1GCQA

Crystal structure of vav and grb2 sh3 domains
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'STYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcqA00
5IHNA 1JQQA 4RTXA 5GJWB 2K6DA 4HCKA 2ED0A 4JZ4A 1OPKA 1HSQA 1SPKA 2LJ0A 1X27A 2AK5A 1Y57A 1VYUA 1ABQA 2W10A 1JEGA 2V1RA 2DL8A 2J6OA 2FRWA 4R0KA 1K1ZA 2KROA 5EC7A 3M0PA 1ZUKA 1W70A 2KT1A 2LQNA 4RTUA 4J9DA 2L3SA 3VS3A 3H41A 1X69A 2KXDA 4HXJA 2EYYA 2EYZA 3PVLA 1H3HA 1V1CA 3VS5A 1PKSA 2ROLA 4LNPA 3H0HA 4EIKA 2XMFA 3M0RA 1AD5A 2CT4A 3PE0A 2YUOA 1NM7A 3FJ5A 1MV0B 2KYMA 1T3LA 2FPFA 1BB9A 1WXUA 2V1QA 4OMOA 2CSQA 1OEBA 1QWFA 1JXOA 2PTKA 1ZX6A 2HEQA 4F14A 4RUGA 2YUPA 4IIMA 3TSWA 2KGTA 2DL4A 4J9HA 2E5KA 1T3SA 2KR3A 2OAWA 2NWMA 3RNJA 1Y0MA 1W1FA 1ZLMA 4D8KA 2IIMA 4OMQA 3EG3A 1WA7A 4LN2A 2OI3A 4X1VA 4HVUA 1VYTA 3VS0A 1WI7A 2A37A 2K2MA 1SHFA 1VA7A 2YSQA 2PZ1A 1M8MA 2MOXA 1RI9A 3EG2A 2DF6A 4OMMA 3EHQA 1RLQC 4Y92A 4A63B 4E6RA 2J6FA 1GFCA 3UA7A 2K79A 2DE0X 2DA9A 5IHKA 1H92A 1KFZA 2DLPA 1W6XA 4AFQC 3H0IA 2A08A 2RN8A 1G83A 1U5SA 2DM1A 4RTWA 2EVRA 4JJBA 2FPEA 1Z9QA 2AKKA 2H8HA 2JS0A 2BTTA 2DNUA 4ORZA 1WLPB 1OV3A 2J06A 1E6GA 2RQVA 1UUEA 2D8JA 3NGPA 1WX6A 1ABOA 1JXMA 3C0CA 1IO6A 2CH4A 3JV3A 3QWYA 1PHTA 3TVTA 2KBTA 3REAB 1NG2A 4DEYA 2GTJA 1JU5C 2DX1A 2JTEA 1TUDA 2CT3A 1S1NA 4JPBW 2O88A 1GBRA 2X3WD 3EHRA 4RTZA 1NEBA 1T0HA 2PNIA 3NPFA 1ZBJA 1HD3A 1CSKA 2EQIA 4DEXA 1H8KA 3VS2A 2C0TA 2EBPA 2D0NA 1AZEA 2F2VA 4JJDA 1GL5A 4ZNXA 1I1JA 1RUWA 1FYNA 1HJDA 1ZSGA 3THKA 1A0NB 1AWWA 2JMCA 1AWOA 1PKTA 5I22A 1AOJA 5I11A 2RF0A 1TG0A 2CDTA 2O9VA 2YUQA 1QWEA 4D8DA 2L2PA 1I0CA 3R6NA 4F17A 5IH2A 3SHWA 3VS7A 5FWBA 5IXFA 1PWTA 4QT7A 1UJYA 4M4ZA 2HBWA 1UFFA 2JT4A 2RQWA 2B86A 4AFZC 4JJCA 3TSZA 1CKAA 2KRMA 5ECAA 2RPNA 4Z89A 3I9QA 2EPDA 3VS4A 2EW3A 1BBZA 3GBQA 1QCFA 3H0FA 1UE9A 1K0SA 1KSWA 2LZ6B 2P4RA 2LQWA 2M51A 4GBQA 1UTIA 1YWPA 1BU1A 1VYVA 2C0OA 3A98A 3LH5A 1PNJA 2CUBA 1M3CA 3SEMA 2AKLA 1ARKA 2O31A 4GLMA 2BZ8A 1T0JA 2FPDA 3QWXX 4OMLA 2J6KA 3U23A 2DL5A 3EGUA 4RTVA 2DJQA 1U3OA 1K4US 1I07A 1WXTA 5IXBA 2KT8A 2ABLA 1UJ0A 1X43A 2AZVA 2CH4W 1MUZA 2A36A 1SEMA 2L3QA 1KJWA 2JW4A 2YDLA 1AZGB 2LJ1A 2MCNA 4LUDA 4AFUC 3ULRB 2EKHA 1GBQA 2JMAA 1X6BA 1AWJA 3UATA 1KIKA 4Z8AA 1GRIA 2LNHB 1E7OA 2AZSA 2D8HA 2EYWA 2DBKA 2KRNA 1GFDA 2GBQA 1X6GA 3IQLA 4J9BA 4Z88A 1NLPC 2EGEA 2ROTA 2HCKA 4AFSC 1K9AA 1M30A 4HVWA 4CC3A 3CQTA 2LCSA 4J9IA 2SRCA 3PVQA 1OPLA 1NYGA 4CC2A 1ZUYA 2VKNA 2M0YA 1SRMA 3RBBB 2RNAA 5FW9A 5HCKA 2X3XD 1QKXA 1UDLA 2DL7A 2JM8A 5GJVB 2KXCA 1CKBA 5IHIA 1ZUUA 3UF4A 2JS2A 1WYXA 4ESRA 2RQTA 1SHGA 2DL3A 3I35A 1E6HA 2ENMA 4FSSA 2KRSA 2A28A 2EGAA 3VRYA 2LMJA 2RQRA 1UHCA 3I5SA 1YNZA 2RMOA 4AG1C 2DRKA 4F16A 1UHFA 1Z9ZA 1GCQA 1K76A 2L0AA 1NYFA 2LP5A 4J9FA 4CC7A 1AEYA 2HSPA 4JZ3A 2CREA 2VWFA 2ED1A 2FG0A 2KYBA 4HVVA 4AG2C 2FRYA 1GCQC 4KRTA 3REBB 2EGCA 2SEMA 1NEGA 2J7IA 1BK2A 2GNCA 2C0IA 2NUZA 2DVJA 1WFWA 3VS6A 1LCKA 2CSIA 1AVZC 2DRMA 3NMZC 3EG1A 1QLYA 4IIOA 1M27C 1AWXA 1SSHA 1WDXA 1PRMC 2K9GA 1NLOC 2KEAA 1M3BA 2L3PA 1YP5A 2MIOA 3UA6A 2DMOA 5FWCA 2KE9A 2RQUA 2D1XA 4OMNA 2BZXA 3ZL7C 3NHNA 2F2XA 1K0XA 2YUNA 5L23A 1MV3A 2J05A 2VVKA 1UGVA 1QKWA 2GGRA 4CC4B 2G6FX 2GQIA 1OOTA 1JO8A 2CUDA 1G2BA 2O9SA 1FMKA 4LUEA 4J9EA 2FO0A 1UG1A 3I5RA 2W0ZA 1SRLA 2O2OA 1YWOA 2JXBA 2DYBA 3M0UA 4OMPA 2K3BA 1B3QA 2QDLA 1UECA 1YN8A 1WXBA 2ECZA 3M0SA 4WCIA 2ESWA 3VS1A 2DILA 2GTOA 2I0NA 3O5ZA 1YCSB 4J9CA 1GCPA 2EYXA 2LJ3A 2HDAA 3KFVA 4RTTA 1X2KA 2BZYA 1M3AA 3VRZA 4K11A 2KNBB 1J3TA 2DBMA 1TUCA 1B07A 2YT6A 4J9GA 1N5ZA 2JM9A 1U06A 3M0QA 3M0TA 4RTYA 2K7AA 1X2QA 2F2WA 1WIEA 2LX7A 2FEIA 3EG0A 1RLPC 1PRLC 2OJ2A 1XOVA 4LE9A 1EFNA
chains in the Genus database with same CATH superfamily
1UGSB 2K5FA 3RMQA 2K6DA 2X4YA 2HQEA 4FCYA 1X27A 3L2WA 3FLGA 4E7LA 3H8ZA 2HAXA 4R0KA 4AMCA 2KROA 3MEWA 5EC7A 3RR6A 1ZUKA 4ZTJA 4M78G 1W70A 4RTUA 2LQNA 4BI4A 5C0MA 1RAFB 4MMLA 3VS3A 2P4TA 1RAEB 4L5GA 2QK0A 2KXDA 2IVWA 4HXJA 2EYZA 1QP2A 1H3HA 1V1CA 3VS5A 5FLXE 2QQ9A 4NS5A 5HY6A 4M75B 1XTDA 1Q86U 2HKNA 3H0HA 4EIKA 2XMFA 3P8BB 5FRNA 4KH0B 4KT0E 2E64A 1VIEA 3FJ5A 3OYDA 3G6EQ 4PJLA 2BKDN 4Y91A 2F5KA 1IGQA 1WXUA 3CCSA 2RD1A 4F7UF 4OMOA 2R5MA 3VYGA 2VGMA 5C6SA 2HEQA 3SB2A 4M75D 3HPWA 1G3TA 3M5AA 5AYFA 3S6WA 2KGTA 2DL4A 3EGDB 3JCMQ 4J9HA 4PJOB 2E5KA 4BDZA 1U1SA 1Y0MA 3CCUQ 2DFUA 1O75A 4D8KA 4J7IA 5KYYA 4LDUA 2CZ1B 3EG3A 2ZZDA 1WA7A 2RK1A 3VS0A 2A37A 2WSCE 3X26B 2CP0A 3V8LA 4FW1A 3CXCP 1YJ9A 5LJ3f 2V26A 3V8KA 1G3YA 4E6RA 4M78A 4IUUA 3UA7A 5IHKA 3MP1A 1KFZA 2E10A 4XQ3A 1Q7YR 3OMGA 3RMSA 2MPXC 2DERA 2EVRA 1VOMA 2FPEA 4FT2A 1OZ2A 1U1TA 2EKOA 1Z9QA 2AKKA 2J06A 3QYGB 4B9XA 5M9OA 3C0CA 5KCHA 2GFAA 1SG5A 2CH4A 3JV3A 3LW5E 3I55T 3OS1A 1PHTA 3FDRA 1IREB 3REAB 1UB4A 4QQ6A 2RO0A 4J6WA 1TS9A 1D1BA 2JTEA 3CC4A 1KQSS 1PG5B 3OSVA 3CCMQ 1K9MR 2JJ9A 3LGFA 4JPBW 3QUIA 3ZEHA 2E3IA 4A4EA 3OY9A 4IUPA 3TCJA 3M57A 2K4YA 1M1KR 1OULA 1JBMA 2L8DA 2XD0A 2QXFA 2F2VA 4C92C 4JJDA 4E7HA 1RUWA 4F7UE 2KK4A 4ZGJB 1ZSGA 3THKA 1PKTA 5GAN6 4O6JA 1KD1U 2FVUA 4O5VA 2CDTA 4OVAA 5GAOl 4L6V5 2LT1A 4OGEA 2DO3A 3JB9F 3VS7A 5FWBA 4M75G 1BI1A 1FWZA 1XQHA 2HSEB 1UFFA 2RQWA 2B86A 3M59A 1BIAA 1KC8U 2EPDA 3HFOA 2QQSA 1YITQ 4C92B 4RG2A 1D0YA 1YBYA 1WNLA 1BU1A 3BDLA 1Q95G 1M3CA 4PJOG 1ARKA 1ZHIA 4DBQA 1YJNQ 4Y28E 2MYSA 1G3SA 2J6KA 3U23A 1P92A 3M53A 2CP3A 3EGUA 4PNOA 3GP8A 2DYIA 3LLRA 1K4US 1QVGP 5IXBA 3CC2A 2ABLA 5CKHA 1BIBA 1YITA 2CH4W 4BY6C 5LJ5f 2A36A 1SEMA 2RHIA 1YHQQ 3G6ET 3CCQQ 2LJ1A 5GANe 4AFUC 2E12A 2EKHA 3UATA 1KIKA 3JAME 2LNHB 1YJNA 1E7OA 2AZSA 2D8HA 2EYWA 5KE3A 2KSSA 1X6GA 3IQLA 3CCJQ 4J9BA 1QW1A 2EGEA 5CQYA 2E1HA 4M75A 3CCUT 4CC3A 2QTXA 2XU8A 2LCSA 3CCEQ 2M0OA 4J9IA 2OTLQ 1XNIA 1VQ8Q 1NYGA 1UGRB 3ZBDA 2M0YA 4M7AB 2RNAA 5FW9A 2RK2A 4EMKC 1YHQA 2X3XD 2COYA 4FYXB 4BY6B 2DL7A 3FIFA 1QCOA 5I2MA 4M77F 3UF4A 4A4KA 1YIJA 3CMEQ 1E6HA 2ENMA 4R55A 4PJOA 1PD1A 1KHCA 1MHNA 2RQRA 3GNGA 1YNZA 3OA6A 1VQ8A 1R0CB 1EIFA 2XG8D 1GCQA 3OMCA 1K76A 2MWOA 2L0AA 3HTRA 2RHYA 5J26A 1OQKA 5LL6S 4EMKB 2ED1A 4BUGA 2QGGA 1Q81R 1KD1C 3PIOA 1BK2A 2C0IA 1QMCA 4HCBA 4M77C 3DLMA 2CSIA 1TTHB 3CCMT 1C0MA 4V2SA 3RERA 5CVIA 4XTXA 4HCCA 2VUBA 1WDXA 3JCMd 1NPRA 1NLOC 1FMVA 4NL3A 1YP5A 3UA6A 2DMOA 2KE9A 3L2ZA 5EG2A 2BZXA 3NHNA 2F2XA 4C92G 2YUNA 2AIRB 3JCMX 3OYFA 1UGVA 2ZPHB 2YLBA 2G6FX 1OOTA 1Y07A 4JRIA 1FMKA 3J81E 4LUEA 1UGPB 3HRTA 2O2OA 2QGFB 2HL3A 4M77B 2DYBA 4BD3A 1PSFA 4XTUA 2DIQA 1RAGB 1PC0A 3CCRQ 2OTJQ 2YWWA 1UECA 3S3OA 2E5QA 1VQMQ 3O5ZA 3SFMA 1Q86R 5GAN7 4C0FA 1X2KA 4M77D 4JUVA 1YITT 1J3TA 4D6WA 3CMAQ 1TUCA 1B07A 1U06A 2QYZA 3G7ZA 1X2QA 1WIEA 2LX7A 3M54A 2VXFA 1RLPC 1ZQ1A 3CCRA 1C1AA 3HRUA 3G1JA 1YJNT 2DIGA 5IHNA 1JQQA 3TEEA 3OS2A 1OZ3A 1BI2A 3G4SQ 2K5LA 3QSUA 1MMGA 2ED0A 3QZ5B 2NUTB 4JZ4A 2AK5A 4M7AG 3OYMA 1Y57A 3JB9G 1K73U 2QG9B 2V1RA 2DL8A 1BKBA 1K1ZA 4C92A 1OI1A 3CMAA 2VASA 1ZSZC 1YHQT 5LJ3e 3CCQT 3H41A 4KUDK 2E3HA 5CKBA 1UEBA 4NL2A 5GMKh 3PVLA 4A53A 5GANf 1Q7YC 4FYWB 4C5GA 4FM4B 4J7FA 4E7SA 4DA4A 3CCJT 1AD5A 4QVDA 2CT4A 2DTHA 1F1BB 3PE0A 1NM7A 1MV0B 3PTAA 4PLLA 3CCET 2EQUA 2OTLT 2P0PA 1VQ8T 1OEBA 4BDYA 3BY7A 5CQXA 3META 4F14A 3KXTA 3P8DA 3OYGA 3TSWA 2PVDB 3GPLA 3AHUA 1WJRA 2OAWA 2H3JA 4WTOB 3CMET 1W1FA 1ZLMA 1K9MC 2CS7A 2CZ6B 4J8OA 1ZA1B 4LDWA 2K2VA 5I2SA 1M1KC 3CPWP 4FYVB 4LN2A 4MZMA 4JS5A 5AT1B 1SHFA 1IZ6A 4QQDA 4M7AA 1I5OB 2DAQA 4KBMB 4DBFA 3AT1B 3EHQA 2R5AA 3H6ZA 3JB9I 4A63B 2OX7A 5CAIA 1GFCA 1KG1A 2K79A 2DE0X 3I55A 2RI5A 1VQPQ 4RG8A 4MMKA 2DLPA 4EMGA 1TUGB 3CEYA 2A08A 3F70A 3JCMh 4EMHA 4M77G 5GAMd 1OYXA 3X28B 1KD1R 4BE0A 4JJBA 1PD0A 2DNUA 1D0ZA 2L5QA 3CC7Q 3EFOB 2RQVA 2D8JA 4OB2B 3VYHB 1ABOA 2K5IA 4M7DF 5FU6B 3PIPA 5J39A 1KC8R 4EMKA 1ZA2B 1NG2A 4DEYA 5GMKi 3HSBA 1KQSA 1TUDA 1EX4A 1S1NA 2CT3A 1GBRA 2YLCA 3E9GA 1I8FA 3PMIA 4BE1A 1OU9A 5DY9A 3RKYA 2PNIA 4RKUE 3VS2A 5A0DA 2EBPA 3CCRT 2OTJT 3RESA 2XDBA 5DM7R 1K73C 1AZEA 3ER0A 2R57A 3OYHA 3EFRA 1VQMT 4ZNXA 1I1JA 4ATOA 5LJ5e 3OW2S 2YHTA 3EH1A 4WF2A 1KQ1A 5I11A 3JB9J 4QW2A 1M1GA 3JB9H 4IKFA 3CMAT 5CKEA 4XU1A 3X20B 4F17A 5IH2A 2BE7D 1VQ6Q 4M77A 2PVOB 2FL7A 5IXFA 1UJYA 4B6MA 2JT4A 2KRMA 1YFNA 2GQVA 3I9QA 5CCAA 3G4ST 1K0SA 4KH1B 1N8RU 1D09B 3LGLA 5FRMA 2H3EB 2M51A 2DTOA 1JJ2P 1VYVA 1LJOA 2O01E 4XU3A 1YI2Q 3G6EA 1PM3A 1Q82U 2DTIA 4FT4A 1OX8A 5D6YA 3H9NA 3ASKA 3V8JA 2EJFA 2BZ8A 3SDZA 1T0JA 3HFNA 2P0QA 3QKJA 1NE8A 2FPDA 3QWXX 3V7RA 3OS0A 1IGUA 3A8MB 3MPUB 4XU2A 2G3RA 1WHJA 4PFZA 1U3OA 3INZA 1AHJB 1WXTA 2KT8A 1MMAA 3OQ5A 3CCUA 2JNGA 1X43A 4M7DD 2NUTA 2L3QA 3CBPA 2JW4A 4M7DE 4PJOE 2MCNA 4LUDA 6AT1B 3VV0A 1X6BA 1EZZB 3BDUA 1G3WA 2X4XA 2QQBA 4Z8AA 1GRIA 4BB7A 1Q81C 3EGXB 2D6FA 3EG9B 2DBKA 2KRNA 2LT4A 2HCKA 1VQOQ 4F7UB 2K3YA 1OPLA 1VIFA 3OYBA 4BI8B 4CC2A 1VQKQ 2K57A 4C8QE 5HCKA 2NUPB 4N0AA 5KYWB 1NBEB 1UDLA 4JRPA 5GAOn 4PK4A 3CXCS 2LVMA 2XK0A 1CKBA 5GMKl 5GAMh 5GANh 2RQTA 1SHGA 2DL3A 3I35A 3FC3A 4FSSA 4PFPA 2K3XA 1WJSA 4ANJA 3VRYA 1VQPT 2QEXQ 3FB9A 4FSXA 3I5SA 3M56A 2C06A 3NTIA 2RMOA 4AG1C 3P8HA 4Q5WA 3CCMA 1LNXA 2HNIA 1Z9ZA 2LC4A 5CKFA 3NFCA 3OYIA 2LP5A 4J9FA 3JCMJ 1NJIU 4JZ3A 2LCCA 1Q86C 3CC7T 3JRZA 4AG2C 4KRTA 2ZCFB 4XAXB 4XU0A 2LCLA 2V8KA 3OS5A 1TH7A 2RM4A 2NUZA 1GXIE 4JLGA 2DVJA 1WFWA 3I56Q 2NYSA 2COWA 1SKUB 1FXXA 1LCKA 2D0QB 5KE2A 4FU6A 1AVZC 1X01A 4OGCA 3NMZC 4PJMA 3PGGA 1QLYA 4IIOA 1M27C 1SSHA 3JCMV 3MEAA 3NTHA 4N4IA 3OYAA 2MIOA 2DZCA 2D1XA 3EFOA 2ZPBB 3ZL7C 5KYNA 3VJPA 4FYYB 1WHGA 3C95A 4C0ZA 1K73R 1Q82C 2P0KA 2VGNA 4J9EA 4A4FA 2FO0A 3I5RA 2BE9B 2W0ZA 2P84A 1V76A 1SRLA 4FIBA 4CI0C 5GAOr 1VQ4Q 2K3BA 2QDLA 3LX7A 3DLLA 1VQ6T 3M0SA 2RHXA 3A8HB 2X51A 1YCSB 4J9CA 1HXDA 1IRXA 2RH2A 3A8LB 4LD6A 3CD6Q 4C0DC 2PUKB 1QVPA 4K11A 3BW1A 4JJNK 4PJJA 3SD4A 2YT6A 3M4YA 3TU4K 2JM9A 1VQLQ 3M0QA 4RTYA 2FEIA 1YI2T 2ZGWA 2DPPB 1H641 3CCQA 1VQ5Q 3X24B 2FHDA 4ZGEB 1X6OA 3L1AA 3CCVQ 4E7KA 2HQHA 4F7UG 1QVGS 3EGDA 2DKGA 1OPKA 1HSQA 2NLUA 3CCJA 3CD6A 1ABQA 2W10A 1JEGA 4GLKA 1G8XA 2FRWA 3CPFA 3CCEA 3WVDB 2VYTA 1M4ZA 3OYJA 2OTLA 1WHHA 4C0DB 2KT1A 4J9DA 4JS4A 1N27A 2CZ7B 1X69A 3UWNA 1VQ5A 4GY5A 3JCMg 1M90U 3E2UA 2EAYA 5FROA 4M7AE 4KGVB 3CMEA 5D6WA 1K8AU 2YUOA 4DBRA 4ME7A 2V8JA 2YRVA 2ZPEB 1VQOT 3VU3C 1NJIC 3PNWC 1BB9A 2V1QA 1QWFA 1VQKT 1ZX6A 4XTWA 3OB9A 3FJPA 4RUGA 1ZBXA 1W2BA 2F1LA 5GAMj 4C5IA 1VQ7Q 2EJGA 2YUPA 2F69A 4IIMA 2HL5C 2HQXA 4VUBA 2CKKA 4MZTA 4F04B 1KC8C 5CKDA 2RB6A 3CBMA 3KBGA 4ELZC 5LJ3h 2QAZA 2KVQG 2NWMA 3EGXA 2Y4XA 3EG9A 4JLIA 2XICA 5L8RE 4OMQA 2QEXT 3L2RA 2EWNA 2OI3A 4X1VA 2FZKB 4HVUA 1VYTA 4F7UA 3GIBA 1WI7A 2K2MA 4LDXA 5D6XA 1VQ9Q 2PZ1A 2NUPA 2MOXA 5KYWA 2OAUA 4OMMA 2BIVA 1RLQC 1FMWA 4Y92A 1H92A 2DA9A 2HD0A 4LXCA 4AFQC 1VQNQ 3H0IA 2E65A 2RN8A 3L2QA 1G83A 2ATCB 3L2VA 2XHCA 3CCLQ 1TXQA 2DM1A 3I56T 4EDUA 4RTWA 3UDCA 1WQ7A 3JCMb 3RKXA 2H8HA 4ORZA 4AT1B 1OV3A 4DOVA 2JTFA 1UUEA 1WX6A 2OTJA 4ZN3A 1BCMA 2R58A 1WZOA 2QASA 3D7SB 3QWYA 1VQMA 3OSSC 4N4GA 2L89A 2GTJA 3E1SA 4UC4A 1N8RR 1BI0A 1WJQA 2O88A 2X3WD 1WPYA 3CCLA 3MHXA 4RTZA 1Q82R 1PSEA 4NOYA 5DLQE 4J6XA 3NPFA 1ZBJA 1HD3A 2VC8A 2VB6A 1CSKA 2EQIA 1B34B 4DEXA 3J7AF 1H8KA 1VQ4T 2C0TA 1I5LA 5CK9A 3FRNA 2EQJA 1KK7A 5GAN8 3OW2A 5HK3A 1QVFA 1FYNA 2X9HA 1AWWA 1XJWB 4EPCA 1AWOA 3G4SA 2MF2A 3CD6T 1AOJA 4M78D 4QQGA 4QVCA 1M2OA 1MMDA 3QYHB 4M78E 2IG0A 4OMFB 1VQLT 2L2PA 1I0CA 3R6NA 1WQWA 3SHWA 4LDYA 1OU8A 1PWTA 4QT7A 4M4ZA 1VQ5T 4KULA 1W2BS 3M58A 1VUBA 2MWPA 4AFZC 1QCNA 2A0FB 4JJCA 1CKAA 1ZSZB 5ECAA 1M8VA 2RPNA 4YTLA 4Z89A 3VS4A 3SWNC 2WACA 3CCVT 2EW3A 3BFMA 3H0FA 5FU7C 2LZ6B 4X9DA 2LQWA 2QDYB 2RJFA 3URGA 4GBQA 5GAMg 1YWPA 5LJ5h 5GANg 5CIUA 2C0OA 3V7CA 1PNJA 2CUBA 3SEMA 2AKLA 2O31A 1YJWQ 2DVEA 5CO7A 5KCOA 1Y96B 4BACA 2DL5A 2CGHA 4JDSA 5HKCA 2KY9A 4RTVA 1W4SA 4RMOA 2HZYA 5HK0A 1I07A 2KAFA 5CR2A 1UJ0A 1S72Q 1KJWA 1RAIB 4FL6A 3SWNB 3QO3A 5GANd 1TWBA 7AT1B 1U8RA 1AZGB 2RHZA 5FU7B 1GBQA 2JZ2A 1NJIR 3LWIA 3S3NA 5LJ3j 3M4GA 1VQ7T 1I81A 2LQ8A 4E2FB 4QKUA 4PJOF 3ME9A 4AFSC 3C4SA 1M30A 1VQPA 2M02A 2JN0A 2HKQB 4HKEA 3PVQA 1ZUYA 4PJNA 1IXDA 1SRMA 3RBBB 1TSFA 3KUFA 2DK3A 1DJ7B 2LDMA 3CXCA 2JM8A 5GJVB 2O4XB 1VQ9T 1ZUUA 3CC7A 2JS2A 1WYXA 4XTVA 2EYQA 2PQWA 3LWHA 1B7TA 4C8QF 3L42A 3G71T 3JSCA 3EAEA 1WHKA 1M5Q1 5KH6A 2CP7A 1QVFS 1VQNT 3RKWA 3CCSQ 3HKSA 2HMAA 4M7DC 4PJOC 3CCLT 4F16A 1TOVA 2DETA 1NYFA 3TREA 3QJYA 1RAHB 1O9SA 2KYBA 4HVVA 1GCQC 3REBB 4P5NA 2SEMA 4TVRA 1NEGA 2JOYA 2J7IA 1RAAB 3OYCA 3HL8A 1D0XA 4C8QC 4MDWA 3EG1A 1ACMB 3A5ZB 3QJ6A 3MCAB 1AWXA 4BE2A 1YJ9Q 1PRMC 1M1FA 2DXCA 5GMKj 2KEAA 1M3BA 4M75E 2L3PA 4N4HA 3JCMe 4M7DB 1H3ZA 4DQ2A 2RQUA 1VQ6A 4OMNA 2GF7A 1K0XA 2EIFA 1RI0A 5L23A 2Y4YA 4OB1B 2GGRA 2DXBA 4CC4B 2CUDA 3GLXA 2O9SA 2M9UA 2E41A 1KQSP 1UG1A 4PJOD 1YWOA 3C94A 3HRSA 3M0UA 5GAOp 1LVKA 1YI2A 5KYUB 4C8QB 1D3BB 1M90R 1YN8A 2CP5A 2ECZA 4WCIA 4FW2A 2DILA 4OP0A 2GTOA 5I21A 2I0NA 1B34A 2D9TA 4XK8E 2QTVA 1GCPA 5A0LA 2XDPA 2LJ3A 2HDAA 3CC4Q 2M1HA 1K8AR 2VV5A 1M3AA 2E6NA 3QDFA 5LJ5j 2KNBB 2DBMA 4KUIA 1JJ2S 4E7JA 2E6ZA 4C8QD 4C92F 2F5TX 5A0GA 4J9GA 4B9WA 3QPHA 1N5ZA 1PCXA 2XI9A 3T9NA 3WXMB 5LJ3g 2A7YA 1NZ9A 4LD9K 3EG0A 2RA2A 2Z0WA 2OJ2A 2X4JA 1XOVA 1IHVA 1NPPA 3A8GB 1G5VA 1QP3A 1YJWT 9ATCB 2EQKA 4IUQA 1QVGA 4RTXA 5GJWB 1Y7XA 5KYXB 4HCKA 2QI2A 1ZSZA 2LJ0A 1SPKA 2ZAEA 1VYUA 3VUBA 3VKIA 2J6OA 5GAN4 1VQOA 1R0BG 1S72T 3M0PA 5LJ3d 3M55A 2L3SA 2JVVA 2E4HA 1VQKA 3RIRA 2PU9B 3MJXA 2EYYA 4C5EA 1R77A 2QQRA 2XIDA 3O8VA 3L2UA 1PKSA 8ATCB 3OYEA 1MNDA 1Y96A 2ROLA 4LNPA 8AT1B 3C12A 1M9SA 3M0RA 4IURA 1WGSA 2CYZB 4JRKA 3JCMP 1Y71A 2KYMA 1T3LA 5GMKm 2QEXA 2WSFE 1C6VX 4J6YA 2FPFA 2CSQA 3JCMW 1JXOA 2YXYA 2PTKA 2JTMA 4M7AF 2CP2A 3SWNA 2JUFA 1N6AA 3Q1JA 2XKOC 2LX9A 2ZPFB 1T3SA 2KR3A 1N8RC 3RNJA 3CC2Q 4PLIA 3GF5A 5GAOm 2IIMA 1MMNA 4RCBA 1RABB 1M2VB 4X34A 1N9SA 2DEQA 3CCST 2CZ0B 3I56A 1IB8A 2IPOB 4M7DG 3DB3A 4J83A 1VA7A 2YSQA 3N5BB 1SF9A 1M8MA 2YRCA 1RI9A 4A54A 1WHLA 4LDVA 3EG2A 3JCMc 5IT9E 2DF6A 3NTKA 3OYNA 4C92D 1MNEA 2J6FA 2O4XA 1SSFA 4M7AC 1LPLA 4C92E 4ELYC 4PL6A 3QBYA 1W6XA 3DB4A 2PVGB 1U5SA 5D7UA 1AT1B 4II1A 3VUZA 2DJZA 5GAMe 1OX9A 2DZ9A 3OBYA 1R8OB 4C8QG 2MK5A 1UGQB 2JS0A 2BTTA 1WLPB 1E6GA 2QA4Q 1YIJQ 3NGPA 3X25B 1YJ9T 1VQ4A 2KMTA 1JXMA 2EQMA 1IO6A 2QQAA 3TVTA 2KBTA 3MP6A 5LJ5g 3JCMf 4L59A 3LYIA 1JU5C 2M16A 2DX1A 4XTZA 3EHRA 1NEBA 4KGZB 2X35A 3QHSA 1T0HA 4MZPA 1VQLA 2V8IA 4R56A 1MGQA 2QA4A 2D0NA 4M7DA 1LOJA 1GL5A 4C5HA 5LJ5d 4M7AD 2KQWA 3CBOA 3JB9D 1HJDA 1Q7YU 3CCVA 1A0NB 2JMCA 2BUDA 2DD5A 3CC4T 3E19A 5I22A 4MDXA 3GNFB 2RF0A 3OYYA 2LNVA 3EH2A 1TG0A 2O9VA 2HBPA 2YRDA 2YUQA 1QWEA 3M9QA 4D8DA 4E7IA 4JRQA 3PT9A 2HBWA 5GANj 1JB0E 5KYUA 4C8QA 1D3BA 3TSZA 2EFIA 4IUTA 4M78F 5GAN2 1BBZA 3GBQA 1QCFA 1UE9A 1KSWA 2P4RA 2RI3A 5GAN5 1K9MU 2E70A 4E7ZA 1UTIA 2FZGB 2A3LA 2Y90A 4C0GA 2DD4A 3A98A 3LH5A 3MO8A 4CRIA 1M1KU 4GLMA 4IUVA 3OYKA 4PKCC 1HYOA 4OMLA 3MEUA 3WVEB 1VQ7A 4X9CA 2PUOB 3G71Q 2DJQA 4Z02A 2EJ9A 3UPUA 2KI7A 5KYXA 3QZ9B 2AZVA 1MUZA 4M78C 2YDLA 3HP9A 3ULRB 3MKDA 1QQJA 2JMAA 1AWJA 3QXEB 2KDSA 4DBHA 4KGXB 1VQ9A 1V29B 1GFDA 2GBQA 5KYYB 1IHWA 3R6OA 4Z88A 3BE3A 1NLPC 3G71A 2ROTA 1K9AA 3CC2T 4DOWA 3A1PA 4HVWA 3CQTA 3CPWA 4M77E 2SRCA 1VQNA 2VKNA 3GOXA 1X75C 4OF1A 1QKXA 5DLOA 4OB0B 2MMPA 3QG1A 2RI2A 2KXCA 4M78B 3ZFJA 5IHIA 1WHMA 4PFOA 1W2BP 2DXTA 4N0AC 4ESRA 2FYKA 3A8OB 4HT9A 2AHJB 1TU0B 3TQ7P 3QIIA 2KRSA 3UT1A 1YCYA 1FX7A 2A28A 4ZN1A 2EGAA 5IN1A 3HHTB 2LMJA 1UHCA 1N9RA 2RJEA 5J3BA 3EFSA 3V7SA 1D1AA 2DRKA 3QDRB 4J5YA 5IAYA 1UHFA 3PMTA 3S3MA 1M2VA 1M90C 4CC7A 1AEYA 5GAMf 2HSPA 1RADB 5A2QE 4QVZA 2CREA 2VWFA 2QA4T 1YIJT 2FG0A 3OBWA 2FRYA 1K8AC 2EGCA 2MAMA 2GNCA 4HT8A 1KHIA 2L3RA 4HA8A 3DKMA 3VS6A 1HK9A 4HCZA 2DRMA 4BI3A 4ZTFA 2GCXA 2WSEE 2RJCA 2K9GA 4OB3B 4XTYA 2ZPGB 1RL2A 5FWCA 3I55Q 4RCCA 2LTOA 3J80E 2LRQA 3FEOA 1MV3A 2J05A 2VVKA 5GAN3 1QKWA 2DXUA 1BCOA 2CP6A 5GAOq 4A4GA 4M75F 2GQIA 1JO8A 2X4WA 1G2BA 2FZCB 3LH0A 2VXEA 5FU6C 3RUXA 4A4HA 2JXBA 3E9FA 1KQ2A 1D1CA 3RDVA 2RJDA 4OMPA 2B8AA 1B3QA 2DEUA 1WXBA 2GFUA 3VS1A 2ESWA 1JRIA 1YJWA 1RACB 3MEVA 1BI3A 1Q81U 2EYXA 3KFVA 4RTTA 3OW2P 2BZYA 1QVFP 3OYLA 2ZPIB 2AT1B 2FB7A 3VRZA 2LQKA 2MI6A 1JJ2A 3PFSA 1BYMA 5GMKe 2XDDA 3CPWS 1S72A 1I4K1 3M0TA 2K7AA 2RHUA 2F2WA 4M75C 2COZA 1PRLC 2I2LA 3MP8A 4LE9A 4E47A 4ZGDB 1EFNA
chains in the Genus database with same CATH topology
5IHNA 1JQQA 4RTXA 5GJWB 2K6DA 4HCKA 2ED0A 4JZ4A 1OPKA 1HSQA 1SPKA 2LJ0A 1X27A 2AK5A 1Y57A 1VYUA 1ABQA 2W10A 1JEGA 2V1RA 2DL8A 2J6OA 2FRWA 4R0KA 1K1ZA 2KROA 5EC7A 3M0PA 1ZUKA 1W70A 2KT1A 2LQNA 4RTUA 4J9DA 2L3SA 3VS3A 3H41A 1X69A 2KXDA 4HXJA 2EYYA 2EYZA 3PVLA 1H3HA 1V1CA 3VS5A 1PKSA 2ROLA 4LNPA 3H0HA 4EIKA 2XMFA 3M0RA 1AD5A 2CT4A 3PE0A 2YUOA 1NM7A 3FJ5A 1MV0B 2KYMA 1T3LA 2FPFA 1BB9A 1WXUA 2V1QA 4OMOA 2CSQA 1OEBA 1QWFA 1JXOA 2PTKA 1ZX6A 2HEQA 4F14A 4RUGA 2YUPA 4IIMA 3TSWA 2KGTA 2DL4A 4J9HA 2E5KA 1T3SA 2KR3A 2OAWA 2NWMA 3RNJA 1Y0MA 1W1FA 1ZLMA 4D8KA 2IIMA 4OMQA 3EG3A 1WA7A 4LN2A 2OI3A 4X1VA 4HVUA 1VYTA 3VS0A 1WI7A 2A37A 2K2MA 1SHFA 1VA7A 2YSQA 2PZ1A 1M8MA 2MOXA 1RI9A 3EG2A 2DF6A 4OMMA 3EHQA 1RLQC 4Y92A 4A63B 4E6RA 2J6FA 1GFCA 3UA7A 2K79A 2DE0X 2DA9A 5IHKA 1H92A 1KFZA 2DLPA 1W6XA 4AFQC 3H0IA 2A08A 2RN8A 1G83A 1U5SA 2DM1A 4RTWA 2EVRA 4JJBA 2FPEA 1Z9QA 2AKKA 2H8HA 2JS0A 2BTTA 2DNUA 4ORZA 1WLPB 1OV3A 2J06A 1E6GA 2RQVA 1UUEA 2D8JA 3NGPA 1WX6A 1ABOA 1JXMA 3C0CA 1IO6A 2CH4A 3JV3A 3QWYA 1PHTA 3TVTA 2KBTA 3REAB 1NG2A 4DEYA 2GTJA 1JU5C 2DX1A 2JTEA 1TUDA 2CT3A 1S1NA 4JPBW 2O88A 1GBRA 2X3WD 3EHRA 4RTZA 1NEBA 1T0HA 2PNIA 3NPFA 1ZBJA 1HD3A 1CSKA 2EQIA 4DEXA 1H8KA 3VS2A 2C0TA 2EBPA 2D0NA 1AZEA 2F2VA 4JJDA 1GL5A 4ZNXA 1I1JA 1RUWA 1FYNA 1HJDA 1ZSGA 3THKA 1A0NB 1AWWA 2JMCA 1AWOA 1PKTA 5I22A 1AOJA 5I11A 2RF0A 1TG0A 2CDTA 2O9VA 2YUQA 1QWEA 4D8DA 2L2PA 1I0CA 3R6NA 4F17A 5IH2A 3SHWA 3VS7A 5FWBA 5IXFA 1PWTA 4QT7A 1UJYA 4M4ZA 2HBWA 1UFFA 2JT4A 2RQWA 2B86A 4AFZC 4JJCA 3TSZA 1CKAA 2KRMA 5ECAA 2RPNA 4Z89A 3I9QA 2EPDA 3VS4A 2EW3A 1BBZA 3GBQA 1QCFA 3H0FA 1UE9A 1K0SA 1KSWA 2LZ6B 2P4RA 2LQWA 2M51A 4GBQA 1UTIA 1YWPA 1BU1A 1VYVA 2C0OA 3A98A 3LH5A 1PNJA 2CUBA 1M3CA 3SEMA 2AKLA 1ARKA 2O31A 4GLMA 2BZ8A 1T0JA 2FPDA 3QWXX 4OMLA 2J6KA 3U23A 2DL5A 3EGUA 4RTVA 2DJQA 1U3OA 1K4US 1I07A 1WXTA 5IXBA 2KT8A 2ABLA 1UJ0A 1X43A 2AZVA 2CH4W 1MUZA 2A36A 1SEMA 2L3QA 1KJWA 2JW4A 2YDLA 1AZGB 2LJ1A 2MCNA 4LUDA 4AFUC 3ULRB 2EKHA 1GBQA 2JMAA 1X6BA 1AWJA 3UATA 1KIKA 4Z8AA 1GRIA 2LNHB 1E7OA 2AZSA 2D8HA 2EYWA 2DBKA 2KRNA 1GFDA 2GBQA 1X6GA 3IQLA 4J9BA 4Z88A 1NLPC 2EGEA 2ROTA 2HCKA 4AFSC 1K9AA 1M30A 4HVWA 4CC3A 3CQTA 2LCSA 4J9IA 2SRCA 3PVQA 1OPLA 1NYGA 4CC2A 1ZUYA 2VKNA 2M0YA 1SRMA 3RBBB 2RNAA 5FW9A 5HCKA 2X3XD 1QKXA 1UDLA 2DL7A 2JM8A 5GJVB 2KXCA 1CKBA 5IHIA 1ZUUA 3UF4A 2JS2A 1WYXA 4ESRA 2RQTA 1SHGA 2DL3A 3I35A 1E6HA 2ENMA 4FSSA 2KRSA 2A28A 2EGAA 3VRYA 2LMJA 2RQRA 1UHCA 3I5SA 1YNZA 2RMOA 4AG1C 2DRKA 4F16A 1UHFA 1Z9ZA 1GCQA 1K76A 2L0AA 1NYFA 2LP5A 4J9FA 4CC7A 1AEYA 2HSPA 4JZ3A 2CREA 2VWFA 2ED1A 2FG0A 2KYBA 4HVVA 4AG2C 2FRYA 1GCQC 4KRTA 3REBB 2EGCA 2SEMA 1NEGA 2J7IA 1BK2A 2GNCA 2C0IA 2NUZA 2DVJA 1WFWA 3VS6A 1LCKA 2CSIA 1AVZC 2DRMA 3NMZC 3EG1A 1QLYA 4IIOA 1M27C 1AWXA 1SSHA 1WDXA 1PRMC 2K9GA 1NLOC 2KEAA 1M3BA 2L3PA 1YP5A 2MIOA 3UA6A 2DMOA 5FWCA 2KE9A 2RQUA 2D1XA 4OMNA 2BZXA 3ZL7C 3NHNA 2F2XA 1K0XA 2YUNA 5L23A 1MV3A 2J05A 2VVKA 1UGVA 1QKWA 2GGRA 4CC4B 2G6FX 2GQIA 1OOTA 1JO8A 2CUDA 1G2BA 2O9SA 1FMKA 4LUEA 4J9EA 2FO0A 1UG1A 3I5RA 2W0ZA 1SRLA 2O2OA 1YWOA 2JXBA 2DYBA 3M0UA 4OMPA 2K3BA 1B3QA 2QDLA 1UECA 1YN8A 1WXBA 2ECZA 3M0SA 4WCIA 2ESWA 3VS1A 2DILA 2GTOA 2I0NA 3O5ZA 1YCSB 4J9CA 1GCPA 2EYXA 2LJ3A 2HDAA 3KFVA 4RTTA 1X2KA 2BZYA 1M3AA 3VRZA 4K11A 2KNBB 1J3TA 2DBMA 1TUCA 1B07A 2YT6A 4J9GA 1N5ZA 2JM9A 1U06A 3M0QA 3M0TA 4RTYA 2K7AA 1X2QA 2F2WA 1WIEA 2LX7A 2FEIA 3EG0A 1RLPC 1PRLC 2OJ2A 1XOVA 4LE9A 1EFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHN A;  1JQQ A;  4RTX A;  5GJW B;  2K6D A;  4HCK A;  2ED0 A;  4JZ4 A;  1OPK A;  1HSQ A;  1SPK A;  2LJ0 A;  1X27 A;  2AK5 A;  1Y57 A;  1VYU A;  1ABQ A;  2W10 A;  1JEG A;  2V1R A;  2DL8 A;  2J6O A;  2FRW A;  4R0K A;  1K1Z A;  2KRO A;  5EC7 A;  3M0P A;  1ZUK A;  1W70 A;  2KT1 A;  2LQN A;  4RTU A;  4J9D A;  2L3S A;  3VS3 A;  3H41 A;  1X69 A;  2KXD A;  4HXJ A;  2EYY A;  2EYZ A;  3PVL A;  1H3H A;  1V1C A;  3VS5 A;  1PKS A;  2ROL A;  4LNP A;  3H0H A;  4EIK A;  2XMF A;  3M0R A;  1AD5 A;  2CT4 A;  3PE0 A;  2YUO A;  1NM7 A;  3FJ5 A;  1MV0 B;  2KYM A;  1T3L A;  2FPF A;  1BB9 A;  1WXU A;  2V1Q A;  4OMO A;  2CSQ A;  1OEB A;  1QWF A;  1JXO A;  2PTK A;  1ZX6 A;  2HEQ A;  4F14 A;  4RUG A;  2YUP A;  4IIM A;  3TSW A;  2KGT A;  2DL4 A;  4J9H A;  2E5K A;  1T3S A;  2KR3 A;  2OAW A;  2NWM A;  3RNJ A;  1Y0M A;  1W1F A;  1ZLM A;  4D8K A;  2IIM A;  4OMQ A;  3EG3 A;  1WA7 A;  4LN2 A;  2OI3 A;  4X1V A;  4HVU A;  1VYT A;  3VS0 A;  1WI7 A;  2A37 A;  2K2M A;  1SHF A;  1VA7 A;  2YSQ A;  2PZ1 A;  1M8M A;  2MOX A;  1RI9 A;  3EG2 A;  2DF6 A;  4OMM A;  3EHQ A;  1RLQ C;  4Y92 A;  4A63 B;  4E6R A;  2J6F A;  1GFC A;  3UA7 A;  2K79 A;  2DE0 X;  2DA9 A;  5IHK A;  1H92 A;  1KFZ A;  2DLP A;  1W6X A;  4AFQ C;  3H0I A;  2A08 A;  2RN8 A;  1G83 A;  1U5S A;  2DM1 A;  4RTW A;  2EVR A;  4JJB A;  2FPE A;  1Z9Q A;  2AKK A;  2H8H A;  2JS0 A;  2BTT A;  2DNU A;  4ORZ A;  1WLP B;  1OV3 A;  2J06 A;  1E6G A;  2RQV A;  1UUE A;  2D8J A;  3NGP A;  1WX6 A;  1ABO A;  1JXM A;  3C0C A;  1IO6 A;  2CH4 A;  3JV3 A;  3QWY A;  1PHT A;  3TVT A;  2KBT A;  3REA B;  1NG2 A;  4DEY A;  2GTJ A;  1JU5 C;  2DX1 A;  2JTE A;  1TUD A;  2CT3 A;  1S1N A;  4JPB W;  2O88 A;  1GBR A;  2X3W D;  3EHR A;  4RTZ A;  1NEB A;  1T0H A;  2PNI A;  3NPF A;  1ZBJ A;  1HD3 A;  1CSK A;  2EQI A;  4DEX A;  1H8K A;  3VS2 A;  2C0T A;  2EBP A;  2D0N A;  1AZE A;  2F2V A;  4JJD A;  1GL5 A;  4ZNX A;  1I1J A;  1RUW A;  1FYN A;  1HJD A;  1ZSG A;  3THK A;  1A0N B;  1AWW A;  2JMC A;  1AWO A;  1PKT A;  5I22 A;  1AOJ A;  5I11 A;  2RF0 A;  1TG0 A;  2CDT A;  2O9V A;  2YUQ A;  1QWE A;  4D8D A;  2L2P A;  1I0C A;  3R6N A;  4F17 A;  5IH2 A;  3SHW A;  3VS7 A;  5FWB A;  5IXF A;  1PWT A;  4QT7 A;  1UJY A;  4M4Z A;  2HBW A;  1UFF A;  2JT4 A;  2RQW A;  2B86 A;  4AFZ C;  4JJC A;  3TSZ A;  1CKA A;  2KRM A;  5ECA A;  2RPN A;  4Z89 A;  3I9Q A;  2EPD A;  3VS4 A;  2EW3 A;  1BBZ A;  3GBQ A;  1QCF A;  3H0F A;  1UE9 A;  1K0S A;  1KSW A;  2LZ6 B;  2P4R A;  2LQW A;  2M51 A;  4GBQ A;  1UTI A;  1YWP A;  1BU1 A;  1VYV A;  2C0O A;  3A98 A;  3LH5 A;  1PNJ A;  2CUB A;  1M3C A;  3SEM A;  2AKL A;  1ARK A;  2O31 A;  4GLM A;  2BZ8 A;  1T0J A;  2FPD A;  3QWX X;  4OML A;  2J6K A;  3U23 A;  2DL5 A;  3EGU A;  4RTV A;  2DJQ A;  1U3O A;  1K4U S;  1I07 A;  1WXT A;  5IXB A;  2KT8 A;  2ABL A;  1UJ0 A;  1X43 A;  2AZV A;  2CH4 W;  1MUZ A;  2A36 A;  1SEM A;  2L3Q A;  1KJW A;  2JW4 A;  2YDL A;  1AZG B;  2LJ1 A;  2MCN A;  4LUD A;  4AFU C;  3ULR B;  2EKH A;  1GBQ A;  2JMA A;  1X6B A;  1AWJ A;  3UAT A;  1KIK A;  4Z8A A;  1GRI A;  2LNH B;  1E7O A;  2AZS A;  2D8H A;  2EYW A;  2DBK A;  2KRN A;  1GFD A;  2GBQ A;  1X6G A;  3IQL A;  4J9B A;  4Z88 A;  1NLP C;  2EGE A;  2ROT A;  2HCK A;  4AFS C;  1K9A A;  1M30 A;  4HVW A;  4CC3 A;  3CQT A;  2LCS A;  4J9I A;  2SRC A;  3PVQ A;  1OPL A;  1NYG A;  4CC2 A;  1ZUY A;  2VKN A;  2M0Y A;  1SRM A;  3RBB B;  2RNA A;  5FW9 A;  5HCK A;  2X3X D;  1QKX A;  1UDL A;  2DL7 A;  2JM8 A;  5GJV B;  2KXC A;  1CKB A;  5IHI A;  1ZUU A;  3UF4 A;  2JS2 A;  1WYX A;  4ESR A;  2RQT A;  1SHG A;  2DL3 A;  3I35 A;  1E6H A;  2ENM A;  4FSS A;  2KRS A;  2A28 A;  2EGA A;  3VRY A;  2LMJ A;  2RQR A;  1UHC A;  3I5S A;  1YNZ A;  2RMO A;  4AG1 C;  2DRK A;  4F16 A;  1UHF A;  1Z9Z A;  1GCQ A;  1K76 A;  2L0A A;  1NYF A;  2LP5 A;  4J9F A;  4CC7 A;  1AEY A;  2HSP A;  4JZ3 A;  2CRE A;  2VWF A;  2ED1 A;  2FG0 A;  2KYB A;  4HVV A;  4AG2 C;  2FRY A;  1GCQ C;  4KRT A;  3REB B;  2EGC A;  2SEM A;  1NEG A;  2J7I A;  1BK2 A;  2GNC A;  2C0I A;  2NUZ A;  2DVJ A;  1WFW A;  3VS6 A;  1LCK A;  2CSI A;  1AVZ C;  2DRM A;  3NMZ C;  3EG1 A;  1QLY A;  4IIO A;  1M27 C;  1AWX A;  1SSH A;  1WDX A;  1PRM C;  2K9G A;  1NLO C;  2KEA A;  1M3B A;  2L3P A;  1YP5 A;  2MIO A;  3UA6 A;  2DMO A;  5FWC A;  2KE9 A;  2RQU A;  2D1X A;  4OMN A;  2BZX A;  3ZL7 C;  3NHN A;  2F2X A;  1K0X A;  2YUN A;  5L23 A;  1MV3 A;  2J05 A;  2VVK A;  1UGV A;  1QKW A;  2GGR A;  4CC4 B;  2G6F X;  2GQI A;  1OOT A;  1JO8 A;  2CUD A;  1G2B A;  2O9S A;  1FMK A;  4LUE A;  4J9E A;  2FO0 A;  1UG1 A;  3I5R A;  2W0Z A;  1SRL A;  2O2O A;  1YWO A;  2JXB A;  2DYB A;  3M0U A;  4OMP A;  2K3B A;  1B3Q A;  2QDL A;  1UEC A;  1YN8 A;  1WXB A;  2ECZ A;  3M0S A;  4WCI A;  2ESW A;  3VS1 A;  2DIL A;  2GTO A;  2I0N A;  3O5Z A;  1YCS B;  4J9C A;  1GCP A;  2EYX A;  2LJ3 A;  2HDA A;  3KFV A;  4RTT A;  1X2K A;  2BZY A;  1M3A A;  3VRZ A;  4K11 A;  2KNB B;  1J3T A;  2DBM A;  1TUC A;  1B07 A;  2YT6 A;  4J9G A;  1N5Z A;  2JM9 A;  1U06 A;  3M0Q A;  3M0T A;  4RTY A;  2K7A A;  1X2Q A;  2F2W A;  1WIE A;  2LX7 A;  2FEI A;  3EG0 A;  1RLP C;  1PRL C;  2OJ2 A;  1XOV A;  4LE9 A;  1EFN A; 
#chains in the Genus database with same CATH topology
 1UGS B;  2K5F A;  3RMQ A;  2K6D A;  2X4Y A;  2HQE A;  4FCY A;  1X27 A;  3L2W A;  3FLG A;  4E7L A;  3H8Z A;  2HAX A;  4R0K A;  4AMC A;  2KRO A;  3MEW A;  5EC7 A;  3RR6 A;  1ZUK A;  4ZTJ A;  4M78 G;  1W70 A;  4RTU A;  2LQN A;  4BI4 A;  5C0M A;  1RAF B;  4MML A;  3VS3 A;  2P4T A;  1RAE B;  4L5G A;  2QK0 A;  2KXD A;  2IVW A;  4HXJ A;  2EYZ A;  1QP2 A;  1H3H A;  1V1C A;  3VS5 A;  5FLX E;  2QQ9 A;  4NS5 A;  5HY6 A;  4M75 B;  1XTD A;  1Q86 U;  2HKN A;  3H0H A;  4EIK A;  2XMF A;  3P8B B;  5FRN A;  4KH0 B;  4KT0 E;  2E64 A;  1VIE A;  3FJ5 A;  3OYD A;  3G6E Q;  4PJL A;  2BKD N;  4Y91 A;  2F5K A;  1IGQ A;  1WXU A;  3CCS A;  2RD1 A;  4F7U F;  4OMO A;  2R5M A;  3VYG A;  2VGM A;  5C6S A;  2HEQ A;  3SB2 A;  4M75 D;  3HPW A;  1G3T A;  3M5A A;  5AYF A;  3S6W A;  2KGT A;  2DL4 A;  3EGD B;  3JCM Q;  4J9H A;  4PJO B;  2E5K A;  4BDZ A;  1U1S A;  1Y0M A;  3CCU Q;  2DFU A;  1O75 A;  4D8K A;  4J7I A;  5KYY A;  4LDU A;  2CZ1 B;  3EG3 A;  2ZZD A;  1WA7 A;  2RK1 A;  3VS0 A;  2A37 A;  2WSC E;  3X26 B;  2CP0 A;  3V8L A;  4FW1 A;  3CXC P;  1YJ9 A;  5LJ3 f;  2V26 A;  3V8K A;  1G3Y A;  4E6R A;  4M78 A;  4IUU A;  3UA7 A;  5IHK A;  3MP1 A;  1KFZ A;  2E10 A;  4XQ3 A;  1Q7Y R;  3OMG A;  3RMS A;  2MPX C;  2DER A;  2EVR A;  1VOM A;  2FPE A;  4FT2 A;  1OZ2 A;  1U1T A;  2EKO A;  1Z9Q A;  2AKK A;  2J06 A;  3QYG B;  4B9X A;  5M9O A;  3C0C A;  5KCH A;  2GFA A;  1SG5 A;  2CH4 A;  3JV3 A;  3LW5 E;  3I55 T;  3OS1 A;  1PHT A;  3FDR A;  1IRE B;  3REA B;  1UB4 A;  4QQ6 A;  2RO0 A;  4J6W A;  1TS9 A;  1D1B A;  2JTE A;  3CC4 A;  1KQS S;  1PG5 B;  3OSV A;  3CCM Q;  1K9M R;  2JJ9 A;  3LGF A;  4JPB W;  3QUI A;  3ZEH A;  2E3I A;  4A4E A;  3OY9 A;  4IUP A;  3TCJ A;  3M57 A;  2K4Y A;  1M1K R;  1OUL A;  1JBM A;  2L8D A;  2XD0 A;  2QXF A;  2F2V A;  4C92 C;  4JJD A;  4E7H A;  1RUW A;  4F7U E;  2KK4 A;  4ZGJ B;  1ZSG A;  3THK A;  1PKT A;  5GAN 6;  4O6J A;  1KD1 U;  2FVU A;  4O5V A;  2CDT A;  4OVA A;  5GAO l;  4L6V 5;  2LT1 A;  4OGE A;  2DO3 A;  3JB9 F;  3VS7 A;  5FWB A;  4M75 G;  1BI1 A;  1FWZ A;  1XQH A;  2HSE B;  1UFF A;  2RQW A;  2B86 A;  3M59 A;  1BIA A;  1KC8 U;  2EPD A;  3HFO A;  2QQS A;  1YIT Q;  4C92 B;  4RG2 A;  1D0Y A;  1YBY A;  1WNL A;  1BU1 A;  3BDL A;  1Q95 G;  1M3C A;  4PJO G;  1ARK A;  1ZHI A;  4DBQ A;  1YJN Q;  4Y28 E;  2MYS A;  1G3S A;  2J6K A;  3U23 A;  1P92 A;  3M53 A;  2CP3 A;  3EGU A;  4PNO A;  3GP8 A;  2DYI A;  3LLR A;  1K4U S;  1QVG P;  5IXB A;  3CC2 A;  2ABL A;  5CKH A;  1BIB A;  1YIT A;  2CH4 W;  4BY6 C;  5LJ5 f;  2A36 A;  1SEM A;  2RHI A;  1YHQ Q;  3G6E T;  3CCQ Q;  2LJ1 A;  5GAN e;  4AFU C;  2E12 A;  2EKH A;  3UAT A;  1KIK A;  3JAM E;  2LNH B;  1YJN A;  1E7O A;  2AZS A;  2D8H A;  2EYW A;  5KE3 A;  2KSS A;  1X6G A;  3IQL A;  3CCJ Q;  4J9B A;  1QW1 A;  2EGE A;  5CQY A;  2E1H A;  4M75 A;  3CCU T;  4CC3 A;  2QTX A;  2XU8 A;  2LCS A;  3CCE Q;  2M0O A;  4J9I A;  2OTL Q;  1XNI A;  1VQ8 Q;  1NYG A;  1UGR B;  3ZBD A;  2M0Y A;  4M7A B;  2RNA A;  5FW9 A;  2RK2 A;  4EMK C;  1YHQ A;  2X3X D;  2COY A;  4FYX B;  4BY6 B;  2DL7 A;  3FIF A;  1QCO A;  5I2M A;  4M77 F;  3UF4 A;  4A4K A;  1YIJ A;  3CME Q;  1E6H A;  2ENM A;  4R55 A;  4PJO A;  1PD1 A;  1KHC A;  1MHN A;  2RQR A;  3GNG A;  1YNZ A;  3OA6 A;  1VQ8 A;  1R0C B;  1EIF A;  2XG8 D;  1GCQ A;  3OMC A;  1K76 A;  2MWO A;  2L0A A;  3HTR A;  2RHY A;  5J26 A;  1OQK A;  5LL6 S;  4EMK B;  2ED1 A;  4BUG A;  2QGG A;  1Q81 R;  1KD1 C;  3PIO A;  1BK2 A;  2C0I A;  1QMC A;  4HCB A;  4M77 C;  3DLM A;  2CSI A;  1TTH B;  3CCM T;  1C0M A;  4V2S A;  3RER A;  5CVI A;  4XTX A;  4HCC A;  2VUB A;  1WDX A;  3JCM d;  1NPR A;  1NLO C;  1FMV A;  4NL3 A;  1YP5 A;  3UA6 A;  2DMO A;  2KE9 A;  3L2Z A;  5EG2 A;  2BZX A;  3NHN A;  2F2X A;  4C92 G;  2YUN A;  2AIR B;  3JCM X;  3OYF A;  1UGV A;  2ZPH B;  2YLB A;  2G6F X;  1OOT A;  1Y07 A;  4JRI A;  1FMK A;  3J81 E;  4LUE A;  1UGP B;  3HRT A;  2O2O A;  2QGF B;  2HL3 A;  4M77 B;  2DYB A;  4BD3 A;  1PSF A;  4XTU A;  2DIQ A;  1RAG B;  1PC0 A;  3CCR Q;  2OTJ Q;  2YWW A;  1UEC A;  3S3O A;  2E5Q A;  1VQM Q;  3O5Z A;  3SFM A;  1Q86 R;  5GAN 7;  4C0F A;  1X2K A;  4M77 D;  4JUV A;  1YIT T;  1J3T A;  4D6W A;  3CMA Q;  1TUC A;  1B07 A;  1U06 A;  2QYZ A;  3G7Z A;  1X2Q A;  1WIE A;  2LX7 A;  3M54 A;  2VXF A;  1RLP C;  1ZQ1 A;  3CCR A;  1C1A A;  3HRU A;  3G1J A;  1YJN T;  2DIG A;  5IHN A;  1JQQ A;  3TEE A;  3OS2 A;  1OZ3 A;  1BI2 A;  3G4S Q;  2K5L A;  3QSU A;  1MMG A;  2ED0 A;  3QZ5 B;  2NUT B;  4JZ4 A;  2AK5 A;  4M7A G;  3OYM A;  1Y57 A;  3JB9 G;  1K73 U;  2QG9 B;  2V1R A;  2DL8 A;  1BKB A;  1K1Z A;  4C92 A;  1OI1 A;  3CMA A;  2VAS A;  1ZSZ C;  1YHQ T;  5LJ3 e;  3CCQ T;  3H41 A;  4KUD K;  2E3H A;  5CKB A;  1UEB A;  4NL2 A;  5GMK h;  3PVL A;  4A53 A;  5GAN f;  1Q7Y C;  4FYW B;  4C5G A;  4FM4 B;  4J7F A;  4E7S A;  4DA4 A;  3CCJ T;  1AD5 A;  4QVD A;  2CT4 A;  2DTH A;  1F1B B;  3PE0 A;  1NM7 A;  1MV0 B;  3PTA A;  4PLL A;  3CCE T;  2EQU A;  2OTL T;  2P0P A;  1VQ8 T;  1OEB A;  4BDY A;  3BY7 A;  5CQX A;  3MET A;  4F14 A;  3KXT A;  3P8D A;  3OYG A;  3TSW A;  2PVD B;  3GPL A;  3AHU A;  1WJR A;  2OAW A;  2H3J A;  4WTO B;  3CME T;  1W1F A;  1ZLM A;  1K9M C;  2CS7 A;  2CZ6 B;  4J8O A;  1ZA1 B;  4LDW A;  2K2V A;  5I2S A;  1M1K C;  3CPW P;  4FYV B;  4LN2 A;  4MZM A;  4JS5 A;  5AT1 B;  1SHF A;  1IZ6 A;  4QQD A;  4M7A A;  1I5O B;  2DAQ A;  4KBM B;  4DBF A;  3AT1 B;  3EHQ A;  2R5A A;  3H6Z A;  3JB9 I;  4A63 B;  2OX7 A;  5CAI A;  1GFC A;  1KG1 A;  2K79 A;  2DE0 X;  3I55 A;  2RI5 A;  1VQP Q;  4RG8 A;  4MMK A;  2DLP A;  4EMG A;  1TUG B;  3CEY A;  2A08 A;  3F70 A;  3JCM h;  4EMH A;  4M77 G;  5GAM d;  1OYX A;  3X28 B;  1KD1 R;  4BE0 A;  4JJB A;  1PD0 A;  2DNU A;  1D0Z A;  2L5Q A;  3CC7 Q;  3EFO B;  2RQV A;  2D8J A;  4OB2 B;  3VYH B;  1ABO A;  2K5I A;  4M7D F;  5FU6 B;  3PIP A;  5J39 A;  1KC8 R;  4EMK A;  1ZA2 B;  1NG2 A;  4DEY A;  5GMK i;  3HSB A;  1KQS A;  1TUD A;  1EX4 A;  1S1N A;  2CT3 A;  1GBR A;  2YLC A;  3E9G A;  1I8F A;  3PMI A;  4BE1 A;  1OU9 A;  5DY9 A;  3RKY A;  2PNI A;  4RKU E;  3VS2 A;  5A0D A;  2EBP A;  3CCR T;  2OTJ T;  3RES A;  2XDB A;  5DM7 R;  1K73 C;  1AZE A;  3ER0 A;  2R57 A;  3OYH A;  3EFR A;  1VQM T;  4ZNX A;  1I1J A;  4ATO A;  5LJ5 e;  3OW2 S;  2YHT A;  3EH1 A;  4WF2 A;  1KQ1 A;  5I11 A;  3JB9 J;  4QW2 A;  1M1G A;  3JB9 H;  4IKF A;  3CMA T;  5CKE A;  4XU1 A;  3X20 B;  4F17 A;  5IH2 A;  2BE7 D;  1VQ6 Q;  4M77 A;  2PVO B;  2FL7 A;  5IXF A;  1UJY A;  4B6M A;  2JT4 A;  2KRM A;  1YFN A;  2GQV A;  3I9Q A;  5CCA A;  3G4S T;  1K0S A;  4KH1 B;  1N8R U;  1D09 B;  3LGL A;  5FRM A;  2H3E B;  2M51 A;  2DTO A;  1JJ2 P;  1VYV A;  1LJO A;  2O01 E;  4XU3 A;  1YI2 Q;  3G6E A;  1PM3 A;  1Q82 U;  2DTI A;  4FT4 A;  1OX8 A;  5D6Y A;  3H9N A;  3ASK A;  3V8J A;  2EJF A;  2BZ8 A;  3SDZ A;  1T0J A;  3HFN A;  2P0Q A;  3QKJ A;  1NE8 A;  2FPD A;  3QWX X;  3V7R A;  3OS0 A;  1IGU A;  3A8M B;  3MPU B;  4XU2 A;  2G3R A;  1WHJ A;  4PFZ A;  1U3O A;  3INZ A;  1AHJ B;  1WXT A;  2KT8 A;  1MMA A;  3OQ5 A;  3CCU A;  2JNG A;  1X43 A;  4M7D D;  2NUT A;  2L3Q A;  3CBP A;  2JW4 A;  4M7D E;  4PJO E;  2MCN A;  4LUD A;  6AT1 B;  3VV0 A;  1X6B A;  1EZZ B;  3BDU A;  1G3W A;  2X4X A;  2QQB A;  4Z8A A;  1GRI A;  4BB7 A;  1Q81 C;  3EGX B;  2D6F A;  3EG9 B;  2DBK A;  2KRN A;  2LT4 A;  2HCK A;  1VQO Q;  4F7U B;  2K3Y A;  1OPL A;  1VIF A;  3OYB A;  4BI8 B;  4CC2 A;  1VQK Q;  2K57 A;  4C8Q E;  5HCK A;  2NUP B;  4N0A A;  5KYW B;  1NBE B;  1UDL A;  4JRP A;  5GAO n;  4PK4 A;  3CXC S;  2LVM A;  2XK0 A;  1CKB A;  5GMK l;  5GAM h;  5GAN h;  2RQT A;  1SHG A;  2DL3 A;  3I35 A;  3FC3 A;  4FSS A;  4PFP A;  2K3X A;  1WJS A;  4ANJ A;  3VRY A;  1VQP T;  2QEX Q;  3FB9 A;  4FSX A;  3I5S A;  3M56 A;  2C06 A;  3NTI A;  2RMO A;  4AG1 C;  3P8H A;  4Q5W A;  3CCM A;  1LNX A;  2HNI A;  1Z9Z A;  2LC4 A;  5CKF A;  3NFC A;  3OYI A;  2LP5 A;  4J9F A;  3JCM J;  1NJI U;  4JZ3 A;  2LCC A;  1Q86 C;  3CC7 T;  3JRZ A;  4AG2 C;  4KRT A;  2ZCF B;  4XAX B;  4XU0 A;  2LCL A;  2V8K A;  3OS5 A;  1TH7 A;  2RM4 A;  2NUZ A;  1GXI E;  4JLG A;  2DVJ A;  1WFW A;  3I56 Q;  2NYS A;  2COW A;  1SKU B;  1FXX A;  1LCK A;  2D0Q B;  5KE2 A;  4FU6 A;  1AVZ C;  1X01 A;  4OGC A;  3NMZ C;  4PJM A;  3PGG A;  1QLY A;  4IIO A;  1M27 C;  1SSH A;  3JCM V;  3MEA A;  3NTH A;  4N4I A;  3OYA A;  2MIO A;  2DZC A;  2D1X A;  3EFO A;  2ZPB B;  3ZL7 C;  5KYN A;  3VJP A;  4FYY B;  1WHG A;  3C95 A;  4C0Z A;  1K73 R;  1Q82 C;  2P0K A;  2VGN A;  4J9E A;  4A4F A;  2FO0 A;  3I5R A;  2BE9 B;  2W0Z A;  2P84 A;  1V76 A;  1SRL A;  4FIB A;  4CI0 C;  5GAO r;  1VQ4 Q;  2K3B A;  2QDL A;  3LX7 A;  3DLL A;  1VQ6 T;  3M0S A;  2RHX A;  3A8H B;  2X51 A;  1YCS B;  4J9C A;  1HXD A;  1IRX A;  2RH2 A;  3A8L B;  4LD6 A;  3CD6 Q;  4C0D C;  2PUK B;  1QVP A;  4K11 A;  3BW1 A;  4JJN K;  4PJJ A;  3SD4 A;  2YT6 A;  3M4Y A;  3TU4 K;  2JM9 A;  1VQL Q;  3M0Q A;  4RTY A;  2FEI A;  1YI2 T;  2ZGW A;  2DPP B;  1H64 1;  3CCQ A;  1VQ5 Q;  3X24 B;  2FHD A;  4ZGE B;  1X6O A;  3L1A A;  3CCV Q;  4E7K A;  2HQH A;  4F7U G;  1QVG S;  3EGD A;  2DKG A;  1OPK A;  1HSQ A;  2NLU A;  3CCJ A;  3CD6 A;  1ABQ A;  2W10 A;  1JEG A;  4GLK A;  1G8X A;  2FRW A;  3CPF A;  3CCE A;  3WVD B;  2VYT A;  1M4Z A;  3OYJ A;  2OTL A;  1WHH A;  4C0D B;  2KT1 A;  4J9D A;  4JS4 A;  1N27 A;  2CZ7 B;  1X69 A;  3UWN A;  1VQ5 A;  4GY5 A;  3JCM g;  1M90 U;  3E2U A;  2EAY A;  5FRO A;  4M7A E;  4KGV B;  3CME A;  5D6W A;  1K8A U;  2YUO A;  4DBR A;  4ME7 A;  2V8J A;  2YRV A;  2ZPE B;  1VQO T;  3VU3 C;  1NJI C;  3PNW C;  1BB9 A;  2V1Q A;  1QWF A;  1VQK T;  1ZX6 A;  4XTW A;  3OB9 A;  3FJP A;  4RUG A;  1ZBX A;  1W2B A;  2F1L A;  5GAM j;  4C5I A;  1VQ7 Q;  2EJG A;  2YUP A;  2F69 A;  4IIM A;  2HL5 C;  2HQX A;  4VUB A;  2CKK A;  4MZT A;  4F04 B;  1KC8 C;  5CKD A;  2RB6 A;  3CBM A;  3KBG A;  4ELZ C;  5LJ3 h;  2QAZ A;  2KVQ G;  2NWM A;  3EGX A;  2Y4X A;  3EG9 A;  4JLI A;  2XIC A;  5L8R E;  4OMQ A;  2QEX T;  3L2R A;  2EWN A;  2OI3 A;  4X1V A;  2FZK B;  4HVU A;  1VYT A;  4F7U A;  3GIB A;  1WI7 A;  2K2M A;  4LDX A;  5D6X A;  1VQ9 Q;  2PZ1 A;  2NUP A;  2MOX A;  5KYW A;  2OAU A;  4OMM A;  2BIV A;  1RLQ C;  1FMW A;  4Y92 A;  1H92 A;  2DA9 A;  2HD0 A;  4LXC A;  4AFQ C;  1VQN Q;  3H0I A;  2E65 A;  2RN8 A;  3L2Q A;  1G83 A;  2ATC B;  3L2V A;  2XHC A;  3CCL Q;  1TXQ A;  2DM1 A;  3I56 T;  4EDU A;  4RTW A;  3UDC A;  1WQ7 A;  3JCM b;  3RKX A;  2H8H A;  4ORZ A;  4AT1 B;  1OV3 A;  4DOV A;  2JTF A;  1UUE A;  1WX6 A;  2OTJ A;  4ZN3 A;  1BCM A;  2R58 A;  1WZO A;  2QAS A;  3D7S B;  3QWY A;  1VQM A;  3OSS C;  4N4G A;  2L89 A;  2GTJ A;  3E1S A;  4UC4 A;  1N8R R;  1BI0 A;  1WJQ A;  2O88 A;  2X3W D;  1WPY A;  3CCL A;  3MHX A;  4RTZ A;  1Q82 R;  1PSE A;  4NOY A;  5DLQ E;  4J6X A;  3NPF A;  1ZBJ A;  1HD3 A;  2VC8 A;  2VB6 A;  1CSK A;  2EQI A;  1B34 B;  4DEX A;  3J7A F;  1H8K A;  1VQ4 T;  2C0T A;  1I5L A;  5CK9 A;  3FRN A;  2EQJ A;  1KK7 A;  5GAN 8;  3OW2 A;  5HK3 A;  1QVF A;  1FYN A;  2X9H A;  1AWW A;  1XJW B;  4EPC A;  1AWO A;  3G4S A;  2MF2 A;  3CD6 T;  1AOJ A;  4M78 D;  4QQG A;  4QVC A;  1M2O A;  1MMD A;  3QYH B;  4M78 E;  2IG0 A;  4OMF B;  1VQL T;  2L2P A;  1I0C A;  3R6N A;  1WQW A;  3SHW A;  4LDY A;  1OU8 A;  1PWT A;  4QT7 A;  4M4Z A;  1VQ5 T;  4KUL A;  1W2B S;  3M58 A;  1VUB A;  2MWP A;  4AFZ C;  1QCN A;  2A0F B;  4JJC A;  1CKA A;  1ZSZ B;  5ECA A;  1M8V A;  2RPN A;  4YTL A;  4Z89 A;  3VS4 A;  3SWN C;  2WAC A;  3CCV T;  2EW3 A;  3BFM A;  3H0F A;  5FU7 C;  2LZ6 B;  4X9D A;  2LQW A;  2QDY B;  2RJF A;  3URG A;  4GBQ A;  5GAM g;  1YWP A;  5LJ5 h;  5GAN g;  5CIU A;  2C0O A;  3V7C A;  1PNJ A;  2CUB A;  3SEM A;  2AKL A;  2O31 A;  1YJW Q;  2DVE A;  5CO7 A;  5KCO A;  1Y96 B;  4BAC A;  2DL5 A;  2CGH A;  4JDS A;  5HKC A;  2KY9 A;  4RTV A;  1W4S A;  4RMO A;  2HZY A;  5HK0 A;  1I07 A;  2KAF A;  5CR2 A;  1UJ0 A;  1S72 Q;  1KJW A;  1RAI B;  4FL6 A;  3SWN B;  3QO3 A;  5GAN d;  1TWB A;  7AT1 B;  1U8R A;  1AZG B;  2RHZ A;  5FU7 B;  1GBQ A;  2JZ2 A;  1NJI R;  3LWI A;  3S3N A;  5LJ3 j;  3M4G A;  1VQ7 T;  1I81 A;  2LQ8 A;  4E2F B;  4QKU A;  4PJO F;  3ME9 A;  4AFS C;  3C4S A;  1M30 A;  1VQP A;  2M02 A;  2JN0 A;  2HKQ B;  4HKE A;  3PVQ A;  1ZUY A;  4PJN A;  1IXD A;  1SRM A;  3RBB B;  1TSF A;  3KUF A;  2DK3 A;  1DJ7 B;  2LDM A;  3CXC A;  2JM8 A;  5GJV B;  2O4X B;  1VQ9 T;  1ZUU A;  3CC7 A;  2JS2 A;  1WYX A;  4XTV A;  2EYQ A;  2PQW A;  3LWH A;  1B7T A;  4C8Q F;  3L42 A;  3G71 T;  3JSC A;  3EAE A;  1WHK A;  1M5Q 1;  5KH6 A;  2CP7 A;  1QVF S;  1VQN T;  3RKW A;  3CCS Q;  3HKS A;  2HMA A;  4M7D C;  4PJO C;  3CCL T;  4F16 A;  1TOV A;  2DET A;  1NYF A;  3TRE A;  3QJY A;  1RAH B;  1O9S A;  2KYB A;  4HVV A;  1GCQ C;  3REB B;  4P5N A;  2SEM A;  4TVR A;  1NEG A;  2JOY A;  2J7I A;  1RAA B;  3OYC A;  3HL8 A;  1D0X A;  4C8Q C;  4MDW A;  3EG1 A;  1ACM B;  3A5Z B;  3QJ6 A;  3MCA B;  1AWX A;  4BE2 A;  1YJ9 Q;  1PRM C;  1M1F A;  2DXC A;  5GMK j;  2KEA A;  1M3B A;  4M75 E;  2L3P A;  4N4H A;  3JCM e;  4M7D B;  1H3Z A;  4DQ2 A;  2RQU A;  1VQ6 A;  4OMN A;  2GF7 A;  1K0X A;  2EIF A;  1RI0 A;  5L23 A;  2Y4Y A;  4OB1 B;  2GGR A;  2DXB A;  4CC4 B;  2CUD A;  3GLX A;  2O9S A;  2M9U A;  2E41 A;  1KQS P;  1UG1 A;  4PJO D;  1YWO A;  3C94 A;  3HRS A;  3M0U A;  5GAO p;  1LVK A;  1YI2 A;  5KYU B;  4C8Q B;  1D3B B;  1M90 R;  1YN8 A;  2CP5 A;  2ECZ A;  4WCI A;  4FW2 A;  2DIL A;  4OP0 A;  2GTO A;  5I21 A;  2I0N A;  1B34 A;  2D9T A;  4XK8 E;  2QTV A;  1GCP A;  5A0L A;  2XDP A;  2LJ3 A;  2HDA A;  3CC4 Q;  2M1H A;  1K8A R;  2VV5 A;  1M3A A;  2E6N A;  3QDF A;  5LJ5 j;  2KNB B;  2DBM A;  4KUI A;  1JJ2 S;  4E7J A;  2E6Z A;  4C8Q D;  4C92 F;  2F5T X;  5A0G A;  4J9G A;  4B9W A;  3QPH A;  1N5Z A;  1PCX A;  2XI9 A;  3T9N A;  3WXM B;  5LJ3 g;  2A7Y A;  1NZ9 A;  4LD9 K;  3EG0 A;  2RA2 A;  2Z0W A;  2OJ2 A;  2X4J A;  1XOV A;  1IHV A;  1NPP A;  3A8G B;  1G5V A;  1QP3 A;  1YJW T;  9ATC B;  2EQK A;  4IUQ A;  1QVG A;  4RTX A;  5GJW B;  1Y7X A;  5KYX B;  4HCK A;  2QI2 A;  1ZSZ A;  2LJ0 A;  1SPK A;  2ZAE A;  1VYU A;  3VUB A;  3VKI A;  2J6O A;  5GAN 4;  1VQO A;  1R0B G;  1S72 T;  3M0P A;  5LJ3 d;  3M55 A;  2L3S A;  2JVV A;  2E4H A;  1VQK A;  3RIR A;  2PU9 B;  3MJX A;  2EYY A;  4C5E A;  1R77 A;  2QQR A;  2XID A;  3O8V A;  3L2U A;  1PKS A;  8ATC B;  3OYE A;  1MND A;  1Y96 A;  2ROL A;  4LNP A;  8AT1 B;  3C12 A;  1M9S A;  3M0R A;  4IUR A;  1WGS A;  2CYZ B;  4JRK A;  3JCM P;  1Y71 A;  2KYM A;  1T3L A;  5GMK m;  2QEX A;  2WSF E;  1C6V X;  4J6Y A;  2FPF A;  2CSQ A;  3JCM W;  1JXO A;  2YXY A;  2PTK A;  2JTM A;  4M7A F;  2CP2 A;  3SWN A;  2JUF A;  1N6A A;  3Q1J A;  2XKO C;  2LX9 A;  2ZPF B;  1T3S A;  2KR3 A;  1N8R C;  3RNJ A;  3CC2 Q;  4PLI A;  3GF5 A;  5GAO m;  2IIM A;  1MMN A;  4RCB A;  1RAB B;  1M2V B;  4X34 A;  1N9S A;  2DEQ A;  3CCS T;  2CZ0 B;  3I56 A;  1IB8 A;  2IPO B;  4M7D G;  3DB3 A;  4J83 A;  1VA7 A;  2YSQ A;  3N5B B;  1SF9 A;  1M8M A;  2YRC A;  1RI9 A;  4A54 A;  1WHL A;  4LDV A;  3EG2 A;  3JCM c;  5IT9 E;  2DF6 A;  3NTK A;  3OYN A;  4C92 D;  1MNE A;  2J6F A;  2O4X A;  1SSF A;  4M7A C;  1LPL A;  4C92 E;  4ELY C;  4PL6 A;  3QBY A;  1W6X A;  3DB4 A;  2PVG B;  1U5S A;  5D7U A;  1AT1 B;  4II1 A;  3VUZ A;  2DJZ A;  5GAM e;  1OX9 A;  2DZ9 A;  3OBY A;  1R8O B;  4C8Q G;  2MK5 A;  1UGQ B;  2JS0 A;  2BTT A;  1WLP B;  1E6G A;  2QA4 Q;  1YIJ Q;  3NGP A;  3X25 B;  1YJ9 T;  1VQ4 A;  2KMT A;  1JXM A;  2EQM A;  1IO6 A;  2QQA A;  3TVT A;  2KBT A;  3MP6 A;  5LJ5 g;  3JCM f;  4L59 A;  3LYI A;  1JU5 C;  2M16 A;  2DX1 A;  4XTZ A;  3EHR A;  1NEB A;  4KGZ B;  2X35 A;  3QHS A;  1T0H A;  4MZP A;  1VQL A;  2V8I A;  4R56 A;  1MGQ A;  2QA4 A;  2D0N A;  4M7D A;  1LOJ A;  1GL5 A;  4C5H A;  5LJ5 d;  4M7A D;  2KQW A;  3CBO A;  3JB9 D;  1HJD A;  1Q7Y U;  3CCV A;  1A0N B;  2JMC A;  2BUD A;  2DD5 A;  3CC4 T;  3E19 A;  5I22 A;  4MDX A;  3GNF B;  2RF0 A;  3OYY A;  2LNV A;  3EH2 A;  1TG0 A;  2O9V A;  2HBP A;  2YRD A;  2YUQ A;  1QWE A;  3M9Q A;  4D8D A;  4E7I A;  4JRQ A;  3PT9 A;  2HBW A;  5GAN j;  1JB0 E;  5KYU A;  4C8Q A;  1D3B A;  3TSZ A;  2EFI A;  4IUT A;  4M78 F;  5GAN 2;  1BBZ A;  3GBQ A;  1QCF A;  1UE9 A;  1KSW A;  2P4R A;  2RI3 A;  5GAN 5;  1K9M U;  2E70 A;  4E7Z A;  1UTI A;  2FZG B;  2A3L A;  2Y90 A;  4C0G A;  2DD4 A;  3A98 A;  3LH5 A;  3MO8 A;  4CRI A;  1M1K U;  4GLM A;  4IUV A;  3OYK A;  4PKC C;  1HYO A;  4OML A;  3MEU A;  3WVE B;  1VQ7 A;  4X9C A;  2PUO B;  3G71 Q;  2DJQ A;  4Z02 A;  2EJ9 A;  3UPU A;  2KI7 A;  5KYX A;  3QZ9 B;  2AZV A;  1MUZ A;  4M78 C;  2YDL A;  3HP9 A;  3ULR B;  3MKD A;  1QQJ A;  2JMA A;  1AWJ A;  3QXE B;  2KDS A;  4DBH A;  4KGX B;  1VQ9 A;  1V29 B;  1GFD A;  2GBQ A;  5KYY B;  1IHW A;  3R6O A;  4Z88 A;  3BE3 A;  1NLP C;  3G71 A;  2ROT A;  1K9A A;  3CC2 T;  4DOW A;  3A1P A;  4HVW A;  3CQT A;  3CPW A;  4M77 E;  2SRC A;  1VQN A;  2VKN A;  3GOX A;  1X75 C;  4OF1 A;  1QKX A;  5DLO A;  4OB0 B;  2MMP A;  3QG1 A;  2RI2 A;  2KXC A;  4M78 B;  3ZFJ A;  5IHI A;  1WHM A;  4PFO A;  1W2B P;  2DXT A;  4N0A C;  4ESR A;  2FYK A;  3A8O B;  4HT9 A;  2AHJ B;  1TU0 B;  3TQ7 P;  3QII A;  2KRS A;  3UT1 A;  1YCY A;  1FX7 A;  2A28 A;  4ZN1 A;  2EGA A;  5IN1 A;  3HHT B;  2LMJ A;  1UHC A;  1N9R A;  2RJE A;  5J3B A;  3EFS A;  3V7S A;  1D1A A;  2DRK A;  3QDR B;  4J5Y A;  5IAY A;  1UHF A;  3PMT A;  3S3M A;  1M2V A;  1M90 C;  4CC7 A;  1AEY A;  5GAM f;  2HSP A;  1RAD B;  5A2Q E;  4QVZ A;  2CRE A;  2VWF A;  2QA4 T;  1YIJ T;  2FG0 A;  3OBW A;  2FRY A;  1K8A C;  2EGC A;  2MAM A;  2GNC A;  4HT8 A;  1KHI A;  2L3R A;  4HA8 A;  3DKM A;  3VS6 A;  1HK9 A;  4HCZ A;  2DRM A;  4BI3 A;  4ZTF A;  2GCX A;  2WSE E;  2RJC A;  2K9G A;  4OB3 B;  4XTY A;  2ZPG B;  1RL2 A;  5FWC A;  3I55 Q;  4RCC A;  2LTO A;  3J80 E;  2LRQ A;  3FEO A;  1MV3 A;  2J05 A;  2VVK A;  5GAN 3;  1QKW A;  2DXU A;  1BCO A;  2CP6 A;  5GAO q;  4A4G A;  4M75 F;  2GQI A;  1JO8 A;  2X4W A;  1G2B A;  2FZC B;  3LH0 A;  2VXE A;  5FU6 C;  3RUX A;  4A4H A;  2JXB A;  3E9F A;  1KQ2 A;  1D1C A;  3RDV A;  2RJD A;  4OMP A;  2B8A A;  1B3Q A;  2DEU A;  1WXB A;  2GFU A;  3VS1 A;  2ESW A;  1JRI A;  1YJW A;  1RAC B;  3MEV A;  1BI3 A;  1Q81 U;  2EYX A;  3KFV A;  4RTT A;  3OW2 P;  2BZY A;  1QVF P;  3OYL A;  2ZPI B;  2AT1 B;  2FB7 A;  3VRZ A;  2LQK A;  2MI6 A;  1JJ2 A;  3PFS A;  1BYM A;  5GMK e;  2XDD A;  3CPW S;  1S72 A;  1I4K 1;  3M0T A;  2K7A A;  2RHU A;  2F2W A;  4M75 C;  2COZ A;  1PRL C;  2I2L A;  3MP8 A;  4LE9 A;  4E47 A;  4ZGD B;  1EFN A; 
#chains in the Genus database with same CATH homology
 5IHN A;  1JQQ A;  4RTX A;  5GJW B;  2K6D A;  4HCK A;  2ED0 A;  4JZ4 A;  1OPK A;  1HSQ A;  1SPK A;  2LJ0 A;  1X27 A;  2AK5 A;  1Y57 A;  1VYU A;  1ABQ A;  2W10 A;  1JEG A;  2V1R A;  2DL8 A;  2J6O A;  2FRW A;  4R0K A;  1K1Z A;  2KRO A;  5EC7 A;  3M0P A;  1ZUK A;  1W70 A;  2KT1 A;  2LQN A;  4RTU A;  4J9D A;  2L3S A;  3VS3 A;  3H41 A;  1X69 A;  2KXD A;  4HXJ A;  2EYY A;  2EYZ A;  3PVL A;  1H3H A;  1V1C A;  3VS5 A;  1PKS A;  2ROL A;  4LNP A;  3H0H A;  4EIK A;  2XMF A;  3M0R A;  1AD5 A;  2CT4 A;  3PE0 A;  2YUO A;  1NM7 A;  3FJ5 A;  1MV0 B;  2KYM A;  1T3L A;  2FPF A;  1BB9 A;  1WXU A;  2V1Q A;  4OMO A;  2CSQ A;  1OEB A;  1QWF A;  1JXO A;  2PTK A;  1ZX6 A;  2HEQ A;  4F14 A;  4RUG A;  2YUP A;  4IIM A;  3TSW A;  2KGT A;  2DL4 A;  4J9H A;  2E5K A;  1T3S A;  2KR3 A;  2OAW A;  2NWM A;  3RNJ A;  1Y0M A;  1W1F A;  1ZLM A;  4D8K A;  2IIM A;  4OMQ A;  3EG3 A;  1WA7 A;  4LN2 A;  2OI3 A;  4X1V A;  4HVU A;  1VYT A;  3VS0 A;  1WI7 A;  2A37 A;  2K2M A;  1SHF A;  1VA7 A;  2YSQ A;  2PZ1 A;  1M8M A;  2MOX A;  1RI9 A;  3EG2 A;  2DF6 A;  4OMM A;  3EHQ A;  1RLQ C;  4Y92 A;  4A63 B;  4E6R A;  2J6F A;  1GFC A;  3UA7 A;  2K79 A;  2DE0 X;  2DA9 A;  5IHK A;  1H92 A;  1KFZ A;  2DLP A;  1W6X A;  4AFQ C;  3H0I A;  2A08 A;  2RN8 A;  1G83 A;  1U5S A;  2DM1 A;  4RTW A;  2EVR A;  4JJB A;  2FPE A;  1Z9Q A;  2AKK A;  2H8H A;  2JS0 A;  2BTT A;  2DNU A;  4ORZ A;  1WLP B;  1OV3 A;  2J06 A;  1E6G A;  2RQV A;  1UUE A;  2D8J A;  3NGP A;  1WX6 A;  1ABO A;  1JXM A;  3C0C A;  1IO6 A;  2CH4 A;  3JV3 A;  3QWY A;  1PHT A;  3TVT A;  2KBT A;  3REA B;  1NG2 A;  4DEY A;  2GTJ A;  1JU5 C;  2DX1 A;  2JTE A;  1TUD A;  2CT3 A;  1S1N A;  4JPB W;  2O88 A;  1GBR A;  2X3W D;  3EHR A;  4RTZ A;  1NEB A;  1T0H A;  2PNI A;  3NPF A;  1ZBJ A;  1HD3 A;  1CSK A;  2EQI A;  4DEX A;  1H8K A;  3VS2 A;  2C0T A;  2EBP A;  2D0N A;  1AZE A;  2F2V A;  4JJD A;  1GL5 A;  4ZNX A;  1I1J A;  1RUW A;  1FYN A;  1HJD A;  1ZSG A;  3THK A;  1A0N B;  1AWW A;  2JMC A;  1AWO A;  1PKT A;  5I22 A;  1AOJ A;  5I11 A;  2RF0 A;  1TG0 A;  2CDT A;  2O9V A;  2YUQ A;  1QWE A;  4D8D A;  2L2P A;  1I0C A;  3R6N A;  4F17 A;  5IH2 A;  3SHW A;  3VS7 A;  5FWB A;  5IXF A;  1PWT A;  4QT7 A;  1UJY A;  4M4Z A;  2HBW A;  1UFF A;  2JT4 A;  2RQW A;  2B86 A;  4AFZ C;  4JJC A;  3TSZ A;  1CKA A;  2KRM A;  5ECA A;  2RPN A;  4Z89 A;  3I9Q A;  2EPD A;  3VS4 A;  2EW3 A;  1BBZ A;  3GBQ A;  1QCF A;  3H0F A;  1UE9 A;  1K0S A;  1KSW A;  2LZ6 B;  2P4R A;  2LQW A;  2M51 A;  4GBQ A;  1UTI A;  1YWP A;  1BU1 A;  1VYV A;  2C0O A;  3A98 A;  3LH5 A;  1PNJ A;  2CUB A;  1M3C A;  3SEM A;  2AKL A;  1ARK A;  2O31 A;  4GLM A;  2BZ8 A;  1T0J A;  2FPD A;  3QWX X;  4OML A;  2J6K A;  3U23 A;  2DL5 A;  3EGU A;  4RTV A;  2DJQ A;  1U3O A;  1K4U S;  1I07 A;  1WXT A;  5IXB A;  2KT8 A;  2ABL A;  1UJ0 A;  1X43 A;  2AZV A;  2CH4 W;  1MUZ A;  2A36 A;  1SEM A;  2L3Q A;  1KJW A;  2JW4 A;  2YDL A;  1AZG B;  2LJ1 A;  2MCN A;  4LUD A;  4AFU C;  3ULR B;  2EKH A;  1GBQ A;  2JMA A;  1X6B A;  1AWJ A;  3UAT A;  1KIK A;  4Z8A A;  1GRI A;  2LNH B;  1E7O A;  2AZS A;  2D8H A;  2EYW A;  2DBK A;  2KRN A;  1GFD A;  2GBQ A;  1X6G A;  3IQL A;  4J9B A;  4Z88 A;  1NLP C;  2EGE A;  2ROT A;  2HCK A;  4AFS C;  1K9A A;  1M30 A;  4HVW A;  4CC3 A;  3CQT A;  2LCS A;  4J9I A;  2SRC A;  3PVQ A;  1OPL A;  1NYG A;  4CC2 A;  1ZUY A;  2VKN A;  2M0Y A;  1SRM A;  3RBB B;  2RNA A;  5FW9 A;  5HCK A;  2X3X D;  1QKX A;  1UDL A;  2DL7 A;  2JM8 A;  5GJV B;  2KXC A;  1CKB A;  5IHI A;  1ZUU A;  3UF4 A;  2JS2 A;  1WYX A;  4ESR A;  2RQT A;  1SHG A;  2DL3 A;  3I35 A;  1E6H A;  2ENM A;  4FSS A;  2KRS A;  2A28 A;  2EGA A;  3VRY A;  2LMJ A;  2RQR A;  1UHC A;  3I5S A;  1YNZ A;  2RMO A;  4AG1 C;  2DRK A;  4F16 A;  1UHF A;  1Z9Z A;  1GCQ A;  1K76 A;  2L0A A;  1NYF A;  2LP5 A;  4J9F A;  4CC7 A;  1AEY A;  2HSP A;  4JZ3 A;  2CRE A;  2VWF A;  2ED1 A;  2FG0 A;  2KYB A;  4HVV A;  4AG2 C;  2FRY A;  1GCQ C;  4KRT A;  3REB B;  2EGC A;  2SEM A;  1NEG A;  2J7I A;  1BK2 A;  2GNC A;  2C0I A;  2NUZ A;  2DVJ A;  1WFW A;  3VS6 A;  1LCK A;  2CSI A;  1AVZ C;  2DRM A;  3NMZ C;  3EG1 A;  1QLY A;  4IIO A;  1M27 C;  1AWX A;  1SSH A;  1WDX A;  1PRM C;  2K9G A;  1NLO C;  2KEA A;  1M3B A;  2L3P A;  1YP5 A;  2MIO A;  3UA6 A;  2DMO A;  5FWC A;  2KE9 A;  2RQU A;  2D1X A;  4OMN A;  2BZX A;  3ZL7 C;  3NHN A;  2F2X A;  1K0X A;  2YUN A;  5L23 A;  1MV3 A;  2J05 A;  2VVK A;  1UGV A;  1QKW A;  2GGR A;  4CC4 B;  2G6F X;  2GQI A;  1OOT A;  1JO8 A;  2CUD A;  1G2B A;  2O9S A;  1FMK A;  4LUE A;  4J9E A;  2FO0 A;  1UG1 A;  3I5R A;  2W0Z A;  1SRL A;  2O2O A;  1YWO A;  2JXB A;  2DYB A;  3M0U A;  4OMP A;  2K3B A;  1B3Q A;  2QDL A;  1UEC A;  1YN8 A;  1WXB A;  2ECZ A;  3M0S A;  4WCI A;  2ESW A;  3VS1 A;  2DIL A;  2GTO A;  2I0N A;  3O5Z A;  1YCS B;  4J9C A;  1GCP A;  2EYX A;  2LJ3 A;  2HDA A;  3KFV A;  4RTT A;  1X2K A;  2BZY A;  1M3A A;  3VRZ A;  4K11 A;  2KNB B;  1J3T A;  2DBM A;  1TUC A;  1B07 A;  2YT6 A;  4J9G A;  1N5Z A;  2JM9 A;  1U06 A;  3M0Q A;  3M0T A;  4RTY A;  2K7A A;  1X2Q A;  2F2W A;  1WIE A;  2LX7 A;  2FEI A;  3EG0 A;  1RLP C;  1PRL C;  2OJ2 A;  1XOV A;  4LE9 A;  1EFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...