1GCQA

Crystal structure of vav and grb2 sh3 domains
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
STYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcqA00
4JPBW 2ENMA 1JXMA 2EGAA 2YDLA 1ZSGA 1VA7A 3I35A 4OMMA 1CSKA 1X2QA 1E7OA 2ROTA 2VKNA 4JZ4A 3REAB 2DL5A 2LX7A 2SEMA 1K9AA 2JMAA 2I0NA 4OMNA 2CSQA 4Y92A 2AZVA 2J6OA 4D8DA 2ED0A 1OV3A 3NMZC 3TVTA 4CC2A 3NGPA 1T3SA 2K79A 2D8HA 3ULRB 2FRYA 4ZNXA 1WIEA 1T3LA 2K3BA 2KT8A 2YUPA 1X27A 2OI3A 1BU1A 1K76A 3VS4A 5IXFA 2GBQA 1AZGB 4ESRA 4HVUA 1NLOC 2HSPA 1PWTA 2DYBA 3QWXX 1PNJA 3VS6A 1RI9A 1GBRA 3M0SA 2KRMA 2O31A 4X1VA 2OAWA 2RN8A 2ABLA 2W0ZA 1YCSB 1QKXA 2EYWA 1UECA 3UA6A 4LE9A 1GCPA 1NEBA 3CQTA 2DLPA 4OMLA 2MIOA 2O9SA 4DEYA 2EQIA 2HEQA 1CKBA 2AZSA 4M4ZA 1GFDA 1AWXA 1H3HA 2AKLA 2KNBB 3RNJA 5I22A 1Y0MA 3VRYA 2JM9A 4D8KA 1ABOA 2KROA 4AFSC 1WI7A 2HCKA 1WLPB 1GFCA 4IIOA 2QDLA 3TSWA 2IIMA 1HSQA 2ECZA 2L3PA 4RTZA 1VYTA 2C0TA 4Z88A 1XOVA 1JO8A 1ZX6A 2LZ6B 2CH4W 1AD5A 2DA9A 2CUDA 3QWYA 4K11A 1S1NA 1ZUUA 2CH4A 1WDXA 2DX1A 1JQQA 2EVRA 1U5SA 3RBBB 2ROLA 3VS7A 1M30A 2GGRA 1TG0A 3EG1A 4RTXA 3UF4A 2KYBA 4JJCA 2A37A 2YUNA 1SEMA 1I0CA 5FW9A 1OPLA 1EFNA 2KXDA 1YP5A 1K0SA 2KGTA 1GL5A 1I07A 1U06A 2JW4A 4DEXA 3FJ5A 3VS5A 2AKKA 2X3XD 3KFVA 4RTYA 1X2KA 2BZYA 3EHQA 4AG2C 2AK5A 3C0CA 1T0JA 2EYZA 1ABQA 3M0TA 1ZUKA 4J9BA 1M3AA 2C0OA 4F17A 1WXTA 1VYVA 1G2BA 3TSZA 2V1QA 1QCFA 4ORZA 2BTTA 1M3CA 2SRCA 2KBTA 2DMOA 5IHNA 2NWMA 3A98A 2JTEA 1V1CA 2YSQA 2F2XA 5IXBA 2ESWA 1UG1A 2DM1A 4AFZC 2DRMA 3LH5A 2LCSA 2GQIA 1IO6A 1AWOA 1RLPC 3H41A 4RTUA 4J9EA 2LMJA 1UJYA 1VYUA 2FO0A 1NYFA 3GBQA 2O9VA 1A0NB 3NPFA 4RTWA 2FPFA 2LJ0A 2FEIA 2CREA 2PNIA 1WYXA 1PRMC 1PKSA 2BZXA 2BZ8A 1CKAA 4AFUC 1WA7A 1AWJA 3SHWA 4E6RA 2YT6A 2DBMA 2A36A 4JJBA 4JZ3A 4QT7A 4AG1C 1NLPC 2RQUA 2MCNA 1X6GA 1SPKA 4R0KA 2LNHB 1FMKA 2K2MA 1QWFA 2H8HA 3PE0A 1GBQA 1YWOA 3EGUA 1BB9A 3O5ZA 2RF0A 1X43A 2YUQA 3I5SA 1RUWA 4HXJA 2J7IA 2J05A 4Z8AA 1MV3A 1T0HA 1RLQC 2J06A 2RQVA 1M8MA 1OPKA 3REBB 1GCQC 1JEGA 2DL3A 2DL4A 1MV0B 1UGVA 2J6FA 4RUGA 1K4US 2F2VA 1UFFA 2EKHA 3JV3A 5HCKA 2V1RA 5GJVB 1YNZA 3SEMA 2K6DA 2K7AA 1ARKA 1W6XA 3M0QA 2DBKA 1AWWA 2EYYA 2MOXA 2KXCA 1W70A 5ECAA 2RMOA 3PVQA 1ZLMA 3UA7A 4CC4B 2CT3A 1FYNA 1E6GA 1TUDA 1X6BA 1SSHA 3I5RA 5IH2A 2HDAA 3ZL7C 1Y57A 4HVWA 4J9GA 2PTKA 3VS0A 1AZEA 2LJ1A 2JT4A 5I11A 5GJWB 4J9HA 2L3QA 1M3BA 3I9QA 1JXOA 1SRLA 1Z9ZA 1AVZC 2D8JA 2M0YA 2CUBA 2KRNA 2EW3A 4OMOA 2M51A 1HJDA 1GCQA 2KRSA 2LQNA 1W1FA 2KYMA 1B07A 2RQWA 3R6NA 5FWCA 2JS2A 4J9DA 1N5ZA 1G83A 2P4RA 3U23A 2X3WD 1PHTA 3H0HA 2DNUA 2RPNA 4OMPA 1BK2A 2JS0A 2LJ3A 4KRTA 3EG3A 1JU5C 5L23A 1K0XA 2FPEA 2K9GA 3THKA 1SRMA 2YUOA 2JMCA 2D0NA 2FRWA 5IHKA 4JJDA 3NHNA 1ZUYA 2FPDA 1MUZA 4A63B 3VRZA 2VVKA 4CC3A 2RNAA 2LQWA 1GRIA 2O2OA 2DF6A 3PVLA 1NG2A 4RTTA 2EBPA 2W10A 1UJ0A 2EGEA 2EGCA 2GNCA 3H0IA 2CSIA 2B86A 1OEBA 2D1XA 1WXUA 4EIKA 1E6HA 2ED1A 1PRLC 1KFZA 3VS1A 2L0AA 1UHCA 1NYGA 3M0PA 2DILA 1HD3A 1BBZA 2KT1A 4LN2A 2G6FX 3H0FA 1LCKA 5EC7A 1ZBJA 2DE0X 2EPDA 2OJ2A 2KE9A 4LNPA 4J9CA 1B3QA 1UTIA 2CDTA 1QKWA 2F2WA 3UATA 3VS2A 2C0IA 1H92A 1J3TA 1U3OA 2DL8A 4GLMA 1UUEA 1M27C 1QLYA 1Z9QA 1YN8A 2JXBA 2J6KA 2O88A 1KJWA 2RQRA 3M0UA 4J9FA 1AOJA 3EG0A 4LUEA 3VS3A 2DL7A 2DVJA 1I1JA 1SHGA 1KIKA 3EG2A 2XMFA 2NUZA 1PKTA 5IHIA 1WX6A 1OOTA 2JM8A 4HCKA 2CT4A 4OMQA 1YWPA 1UDLA 4F14A 2A28A 3M0RA 4LUDA 2GTJA 2DRKA 4WCIA 4GBQA 1WXBA 5FWBA 4J9IA 4RTVA 2L3SA 1WFWA 1KSWA 1X69A 1TUCA 1SHFA 2GTOA 2KR3A 1K1ZA 2HBWA 1NEGA 1AEYA 2EYXA 4Z89A 3EHRA 4HVVA 2KEAA 1UE9A 2VWFA 1H8KA 4CC7A 2RQTA 4AFQC 2LP5A 1UHFA 1NM7A 2E5KA 2A08A 2L2PA 1QWEA 2PZ1A 4IIMA 3IQLA 4FSSA 2FG0A 4F16A 2DJQA
chains in the Genus database with same CATH superfamily
3L2RA 2OTLT 1EIFA 1WQWA 1E7OA 2E64A 5GAMh 2QQSA 3JB9I 1FWZA 2LX7A 3WVEB 2P0QA 4Y92A 3V8JA 1NE8A 3VJPA 2DIQA 3GLXA 4FYXB 2J6OA 4ME7A 1OYXA 4M77A 1RADB 1B7TA 4FYWB 2RI5A 5FU7B 4A4HA 1ZA2B 2KI7A 2LRQA 2K3BA 2CS7A 3QJ6A 1VQLQ 2E3IA 1Q81C 2VC8A 5IXFA 4FIBA 2GBQA 1AZGB 1PD0A 1M2VB 2WSFE 3OQ5A 4HVUA 4RKUE 1PWTA 2DYBA 1U1TA 2VYTA 3RR6A 1VQ4A 1G3YA 1VQ8T 5GAN3 4X1VA 2QXFA 3KUFA 2OAWA 2RN8A 2ABLA 2NUTB 4M7DA 4PJOG 1Q7YR 1QKXA 1LVKA 2CP3A 5KCHA 2DLPA 1I5LA 4L5GA 3LLRA 4DEYA 3CBMA 3ME9A 5LJ3g 4M78F 2X4WA 4M4ZA 1QMCA 3RNJA 2RHYA 4XQ3A 2QASA 2FVUA 2K5LA 2HCKA 2DIGA 3I55A 2JZ2A 1VQNQ 3TSWA 1QCOA 3EG9B 1UGSB 5LJ5j 2ECZA 1TSFA 2L3PA 4RTZA 1BCMA 1VYTA 2C0TA 2DETA 3URGA 1VQNT 1JO8A 3CPFA 2EKOA 3JSCA 4DOWA 4FL6A 3V7SA 2DX1A 2QEXT 1IGUA 2VASA 5CKEA 4F7UF 4JJCA 2YUNA 2E12A 2KAFA 1I0CA 2X4XA 4FU6A 4HA8A 3X28B 4M7AB 4M77B 3HFOA 2ZGWA 4MDXA 1GL5A 3FJ5A 4C8QF 4ZN3A 2O4XA 1Q7YU 1YJWA 3CXCP 4LDYA 4ELZC 1SKUB 2EYZA 1ABQA 2XHCA 2RJFA 4LXCA 3TEEA 2WSCE 1Q95G 4NOYA 2JOYA 5LJ3f 1YJNQ 4F17A 4E7HA 1LPLA 1KQSP 5GAN6 2CZ1B 4GY5A 3UPUA 1M3CA 5LJ3h 2DMOA 4M78D 3EGDA 3A98A 1V1CA 2YSQA 2F2XA 3RIRA 2DRMA 3SDZA 2GQIA 5CQXA 1IO6A 2OX7A 1AWOA 5GMKe 3H41A 3JAME 2HQEA 2LX9A 3E9FA 4EMKA 5CIUA 1NYFA 2WACA 3LGLA 5GMKj 5GANd 2HZYA 1HK9A 4R56A 1IZ6A 3CC7A 4C92E 3JCMd 5FU6B 3G7ZA 4AFUC 1YHQA 5CR2A 2RH2A 3QO3A 1VQOT 2YT6A 3FLGA 2DBMA 2QQAA 2A36A 4AG1C 2QGFB 2MCNA 4C8QD 3RUXA 1IGQA 3CC2Q 3HRUA 2QI2A 1FMKA 2K2MA 1KG1A 1QWFA 3CC2T 3PMIA 1N9RA 3V7CA 2VUBA 1YWOA 2HD0A 4HXJA 2J05A 1MV3A 3S3NA 1RLQC 2J06A 4AMCA 4IUUA 4JS4A 1TTHB 1M1FA 1MV0B 5KYXA 4F04B 2J6FA 5LL6S 2CGHA 1K4US 1VQ5Q 4M78C 2E65A 1VQ5T 3JCMP 1M1KC 4C92C 3OS2A 1ARKA 1W6XA 5D6YA 2D9TA 3N5BB 1BCOA 3EGDB 4X9DA 1TXQA 2HL5C 4M7AF 4DBFA 1YITT 2JTFA 1PD1A 4CC4B 2CT3A 5I2MA 3JCMX 4BDYA 3MO8A 1UGQB 1IRXA 3T9NA 4EMKB 2H3EB 3PIOA 5I21A 3I5RA 5IH2A 4N0AA 2CZ0B 4B9WA 4HVWA 1C6VX 3VS0A 2O01E 3QYGB 1AZEA 2LJ1A 4XTVA 5I11A 2OTLA 3CD6T 3OYFA 1JXOA 4BY6C 3HKSA 1SRLA 2CP6A 3JCMQ 2R5AA 2D8JA 4PNOA 3JB9H 1EX4A 4OMOA 1HJDA 4X9CA 3CCUQ 1IXDA 2CYZB 3CCUT 2QQBA 4LDUA 2XG8D 1SG5A 2EAYA 1MHNA 1UB4A 3CMET 3U23A 1BK2A 3MPUB 1VQLA 5GAN5 1K0XA 4C0FA 3A8MB 2DYIA 2V8IA 3FB9A 5FU7C 3THKA 4M7AD 3JCMJ 1Q86C 4A63B 3CCEQ 1M1GA 2LQWA 3CCET 2EQMA 2O2OA 2DF6A 3M53A 1NG2A 2EBPA 1QVFA 2LCLA 2GNCA 2PVOB 3H0IA 4FCYA 2B86A 1OEBA 3MEWA 1WXUA 4EIKA 1E6HA 4IUQA 4RCBA 2ED1A 1RAIB 4C92G 3S3MA 1M5Q1 2L0AA 1NYGA 3M0PA 3OSVA 2MI6A 3MCAB 1BBZA 4QKUA 4PLIA 4LN2A 1VQNA 5EC7A 2K57A 1ZBJA 2ZPHB 4PJOF 7AT1B 4M75E 4UC4A 3C4SA 1B3QA 2CDTA 2B8AA 1KC8U 4M7DE 3CBPA 3LGFA 2O88A 1KJWA 3M0UA 1AOJA 4OVAA 3EG0A 1K73C 4O5VA 4FT2A 2XI9A 2CT4A 4FM4B 4M77C 2Z0WA 2XD0A 4J6WA 4F14A 3RMQA 5GAN8 1M4ZA 1XQHA 1WXBA 5FWBA 4J9IA 5GMKh 4RG8A 2K3YA 1VIEA 4XU3A 3JCMe 3CC4Q 2AHJB 4J6XA 2EYXA 1JRIA 3EHRA 4HVVA 5GANj 1UE9A 1MMNA 3JCMb 6AT1B 2PVDB 1V76A 4M7DC 4AFQC 1ZQ1A 4C0GA 4C0DB 1UHFA 1YCYA 2MWPA 2E5KA 3OYEA 1YJWT 3QKJA 4DA4A 3KBGA 2FHDA 1FMVA 4IIMA 3VV0A 4PK4A 2FZCB 1ZSGA 1VA7A 1BI0A 3CXCA 1CSKA 3M54A 4PFOA 2ROTA 4YTLA 3RKXA 4E2FB 4V2SA 2K3XA 2DL5A 2MYSA 1VQOA 2SEMA 1K9AA 2JMAA 4BE0A 1KQSA 4D6WA 1OU8A 4VUBA 2COZA 1TU0B 2QTXA 5FU6C 4ZGDB 4LD9K 1O9SA 3G4SQ 3CCQQ 3BDUA 2QQRA 3CCQT 3CC2A 1WIEA 3UT1A 3I56Q 1X27A 3VS4A 3M9QA 3I56T 2ATCB 3V8KA 3SWNA 1Q82R 1NLOC 1K8AR 3CC7T 2HQXA 3QWXX 1PNJA 2WSEE 1IREB 2O31A 1YHQT 3DLMA 5GAOq 1I4K1 3AHUA 3FEOA 3CCJQ 1VQ5A 2EYWA 2K2VA 4LE9A 1GCPA 3CCJT 3CQTA 4BUGA 1YI2Q 1NJIR 2O9SA 1WHHA 2EJFA 3P8DA 2EJGA 2FYKA 2RK1A 1CKBA 4ANJA 4M77G 3META 3EFRA 3LX7A 2AKLA 2KNBB 5I22A 3LWIA 3OSSC 2F69A 1ABOA 3MEUA 3A5ZB 2YXYA 4HT9A 3QG1A 1GFCA 2V8KA 4C92B 2X51A 3E2UA 2QDLA 1ZHIA 3SFMA 1XOVA 2L5QA 2CUDA 4E7IA 4EMKC 3OYIA 4HCBA 1S1NA 2RHIA 2CH4A 2EVRA 3VS7A 3RBBB 1WJSA 3CD6A 3G71Q 4M7DG 1M30A 3L2WA 2GGRA 1TG0A 3OYYA 4RTXA 2KYBA 4Z02A 1SEMA 5CKBA 3A8HB 2R58A 5FW9A 1RAHB 1AT1B 5DLOA 1OPLA 1MMAA 1JJ2P 1K0SA 2KGTA 2DD4A 4GLKA 3CCUA 3EH1A 2X3XD 2M02A 1OZ2A 1WHLA 1MNDA 4AG2C 2AK5A 1I81A 1RABB 3CMEA 1S72Q 1ZUKA 2RM4A 1NJIU 3FDRA 4J9BA 2RHZA 1S72T 2C0OA 2IPOB 2MK5A 1WXTA 3GPLA 5GAMf 4DQ2A 3TSZA 1W2BA 5FRNA 2V1QA 1M90C 1VOMA 2CP2A 3OW2S 1KD1C 2KBTA 2GCXA 3MP6A 4WTOB 5IHNA 1QVGA 3MHXA 3OMGA 3JCMg 5IXBA 2ESWA 2DM1A 2A0FB 3CCEA 3CEYA 2LCSA 5HK3A 3G6EQ 1HXDA 3CCMQ 4J9EA 4RG2A 3CCMT 3OYBA 2FO0A 3PGGA 3OBWA 3PMTA 5C6SA 2V26A 5IAYA 2DAQA 4NL3A 2FEIA 3P8HA 1G8XA 1VQLT 2PNIA 1N27A 5GAN7 1QW1A 5EG2A 4TVRA 1CKAA 3M4GA 4Q5WA 2X35A 1G3TA 1WA7A 3SHWA 4E6RA 3EH2A 3OMCA 3BDLA 4M75A 4JJBA 1Y96B 2ZPFB 1SF9A 4N0AC 4E7SA 4PJLA 4R0KA 2DD5A 4QW2A 2D0QB 3QSUA 5J39A 3OW2P 1VQPQ 2QDYB 1KK7A 1G3WA 3QXEB 2RJEA 1ACMB 4KBMB 3ZFJA 2KDSA 2YUQA 3I5SA 1RUWA 3PTAA 2J7IA 4Z8AA 5J26A 1OZ3A 2Y4XA 4C92F 4ZTJA 2RQVA 3REBB 5LJ5e 5KH6A 3L2UA 2DXUA 5I2SA 3EFOB 2RI2A 3O8VA 3JCMh 5GJVB 1YNZA 2Y4YA 2K6DA 3HP9A 5D7UA 1VQ7Q 2IVWA 1VQ7T 2EYYA 2EIFA 4IURA 4E7ZA 1W70A 4QVZA 1M8VA 2RMOA 1FYNA 2DTIA 3RKYA 1VUBA 2VXFA 3BFMA 4B6MA 5A0DA 1NPRA 2LC4A 3H6ZA 2YRCA 2ZCFB 1N8RU 3QJYA 4J9GA 3OBYA 5C0MA 1LNXA 3X24B 4KGXB 4MMKA 5GJWB 2L3QA 3I9QA 2GFUA 4C0DC 3LYIA 4M75B 5D6WA 1AVZC 1YJNT 5FLXE 2JJ9A 3SD4A 1PCXA 4HCCA 2LQNA 4M7DB 2KYMA 1KQ1A 2RQWA 4C92D 1XTDA 3QDFA 1TUGB 2XU8A 1K9MU 1G83A 2JNGA 3S3OA 1MMDA 3CCQA 2E70A 1Y7XA 2X3WD 4A4KA 5IN1A 2LJ3A 4XTYA 3I56A 4KRTA 3CPWS 2YUOA 2HQHA 2JMCA 2D0NA 2I2LA 4JJDA 1KHIA 3A8GB 2RJCA 1ZUYA 2FPDA 3E1SA 2VVKA 2HL3A 3OYJA 2DPPB 5GAN2 4RMOA 4XU1A 3QBYA 3PVLA 9ATCB 2MAMA 3LW5E 4RTTA 3CCJA 2QA4Q 1TH7A 1UJ0A 2EGEA 2JTMA 4XTXA 4J7IA 1OI1A 4J6YA 1BIBA 3HPWA 2COYA 4QQ6A 4XK8E 1KFZA 1D0XA 3NTHA 5L8RE 4AT1B 2COWA 3M59A 3J80E 4OF1A 2DILA 2O4XB 4XU2A 3HSBA 5HY6A 1OX9A 4C5HA 1Y71A 2G3RA 2G6FX 1IB8A 1WHGA 3DKMA 5M9OA 4J8OA 2DE0X 4Y91A 2ZZDA 5KYWA 1VQ6Q 5CO7A 4KUDK 1QKWA 2F2WA 2VGNA 3G71A 4EMHA 1RAFB 4M77F 1M27C 1KD1U 5KCOA 3DB4A 3JB9G 2BE9B 4ZN1A 4JRIA 4OGCA 3VS3A 1BIAA 2DVJA 4EPCA 2P4TA 1QP2A 3EG2A 2XMFA 5LJ5g 5IHIA 1OOTA 4HCKA 1NBEB 1RAEB 4HKEA 4L6V5 1UDLA 5LJ3d 4N4IA 3CCVQ 2RHUA 1S72A 3LWHA 3CCVT 3L2QA 4RTVA 3TCJA 2L3SA 1Q81U 1TUCA 4OB1B 3SWNC 3MEVA 4M7DF 1RAAB 2DXCA 2HBWA 4KGZB 1NEGA 1D1AA 4MZTA 2XKOC 4Z89A 1WNLA 3QZ5B 2M0OA 3VUZA 2HKQB 3G6EA 3VUBA 2QAZA 1JJ2A 2LT4A 3CCMA 3CMAQ 2MMPA 2PZ1A 2EQKA 4FSSA 2FG0A 3CMAT 2DJQA 2ENMA 2AIRB 1JXMA 2EGAA 3I35A 2YDLA 5CK9A 5GMKl 4OMMA 1X2QA 3JRZA 2VKNA 4OB2B 2YLBA 5KYXB 1WQ7A 1KC8R 1H3ZA 1BI3A 4JZ4A 3REAB 1FMWA 1RI0A 1VQKQ 4M77D 1IHVA 5LJ5f 2I0NA 1VQKT 3OS1A 2CSQA 5KYWB 1OV3A 3NMZC 5LJ5h 3NGPA 1T3SA 3MP8A 4BB7A 4JRKA 2FRYA 1Q82C 1TOVA 1T3LA 2YUPA 1WHJA 3Q1JA 5CCAA 1K8AC 2OI3A 1BU1A 1K76A 1BYMA 1D1BA 4PL6A 4M75D 5CVIA 2HSPA 2NYSA 3A8OB 3DLLA 5DY9A 4M7DD 5A2QE 3UDCA 2JUFA 2XICA 2L3RA 1LOJA 2RA2A 4NL2A 1UECA 3UA6A 2YRDA 1VQ7A 4OMLA 2MIOA 3M55A 5KYYA 5GAOn 2GQVA 5CKHA 1QVPA 2DO3A 2C06A 3WXMB 4HT8A 3HFNA 3L42A 1H3HA 3VRYA 4D8KA 2DTOA 2KROA 1R0CB 4AFSC 2RB6A 1ZSZA 2RO0A 4A4EA 1WLPB 2IIMA 5D6XA 1PSEA 1HSQA 3PNWC 4XTZA 3RKWA 2DA9A 1AD5A 4DOVA 2M9UA 3QWYA 2DXBA 1O75A 2A7YA 2ROLA 3UF4A 2VXEA 1YJNA 3OY9A 2A37A 1YJ9Q 5KYNA 5GANe 1WPYA 4JDSA 3OYGA 3I55Q 1EFNA 3C94A 1KQ2A 1U06A 3VS5A 2FL7A 3CC4T 1W4SA 3KFVA 2MF2A 4M75C 4RTYA 4MZPA 3C0CA 2LVMA 1M2OA 3V8LA 1M3AA 3HHTB 4E47A 1N6AA 3OYMA 1MNEA 3BY7A 4ORZA 2BTTA 2X4JA 2D6FA 2ZPIB 5GAN4 3J7AF 3R6OA 4A54A 3X20B 1UG1A 4BACA 2IG0A 4FW2A 4AFZC 3LH5A 2E6ZA 1WJQA 3OS5A 3MP1A 2LMJA 2HKNA 3OYHA 3H8ZA 1UJYA 1VYUA 3G4ST 1M1KU 3GBQA 4BDZA 2P0PA 1QP3A 1ZSZB 2FPFA 2LJ0A 3S6WA 2CREA 3MEAA 3OYAA 1WYXA 1PKSA 2BZXA 2BZ8A 2XK0A 2YWWA 4KT0E 4XTWA 3HL8A 3E9GA 4A53A 1Q7YC 2KK4A 2FZKB 2DVEA 4PJOE 3CBOA 4QQDA 2LNHB 3RERA 2K5IA 1GBQA 1VQ6A 1YI2T 1BB9A 5AYFA 5LJ3j 3O5ZA 3OA6A 1X43A 3PIPA 5KYUA 5CKDA 3OYDA 2KMTA 2R5MA 4X34A 3TQ7P 1VQMQ 2DL3A 1UGVA 1VQMT 3C12A 4RUGA 4A4GA 5CKFA 4FT4A 5HCKA 2V1RA 4M75G 3CCVA 2L8DA 2DBKA 4XU0A 1AWWA 2HBPA 5IT9E 1UGRB 2E3HA 2MOXA 2KXCA 3J81E 4NS5A 3G71T 4E7LA 5ECAA 1ZLMA 1E6GA 2QQ9A 1TUDA 2HNIA 3JB9F 1X6BA 1Q86U 8AT1B 2HDAA 1QVFS 1Y57A 4OB3B 3F70A 3SWNB 2DJZA 3PT9A 3CMAA 4KULA 1P92A 2DKGA 2PUKB 2M0YA 2EW3A 3L2ZA 1GCQA 5GANg 3GP8A 4EDUA 1W1FA 3CCRQ 1VQKA 4C5IA 8ATCB 3CCRT 1I5OB 1N5ZA 2P4RA 5KE3A 2DERA 4LDVA 4PKCC 1PHTA 2DNUA 1MGQA 3G6ET 2OTLQ 2RPNA 5KYUB 3MKDA 4OMPA 3OB9A 1NPPA 2JS0A 3FIFA 4DBQA 4J83A 1JU5C 5L23A 4XAXB 2FPEA 1SRMA 4OB0B 2XDDA 1QVFP 1RL2A 3QDRB 1WHMA 2FRWA 1X75C 2BE7D 3TU4K 5J3BA 4QVCA 1YIJQ 4ZGEB 4M7AA 4CC3A 1K73U 2RNAA 1YIJT 3P8BB 1UEBA 3JB9D 2HAXA 2W10A 5GAOr 4ATOA 3ER0A 1N8RR 3UWNA 1WGSA 2PU9B 2EFIA 1IHWA 3OYKA 1VQPT 2XDBA 1PRLC 2YLCA 3VU3C 2KY9A 1VQ8Q 2OTJQ 1JB0E 1UHCA 5GANf 1AHJB 1LJOA 2OTJT 1HD3A 3JCMf 5GMKm 5GANh 2KQWA 1D0YA 1D0ZA 3QIIA 4KH1B 1K9MR 2EPDA 3CXCS 2OJ2A 4LNPA 2GF7A 4J9CA 3JCMc 3M58A 2C0IA 1U3OA 1QLYA 1Z9QA 1YJ9A 4EMGA 2JXBA 2J6KA 1KQSS 2RQRA 3V7RA 2DZ9A 1I1JA 3CC4A 4XTUA 1SHGA 2EYQA 1KIKA 2PVGB 1WX6A 1PSFA 4OMQA 4E7KA 2QEXQ 4KGVB 4JUVA 2A28A 2GTJA 5GAMd 4WCIA 4GBQA 2JN0A 3JB9J 3L1AA 1WFWA 3BW1A 1X69A 4DBRA 2L89A 3EFSA 3PFSA 1R77A 5DLQE 2LP5A 4A4FA 1C1AA 1NM7A 2DK3A 2A08A 2XIDA 1QWEA 2DEUA 3G4SA 1OX8A 1KC8C 1FXXA 4FYVB 4JPBW 2E10A 4P5NA 1C0MA 4RCCA 3ASKA 2LCCA 4PJOA 1RAGB 4ELYC 1M90R 3CCSQ 4BI4A 1ZSZC 1KD1R 3CCST 4OMNA 2R57A 4N4HA 2AZVA 4LDWA 4D8DA 2BUDA 2ED0A 4CI0C 4CC2A 3TVTA 3CCLQ 2K79A 1U8RA 2D8HA 3ULRB 3X25B 3CCLT 4ZNXA 5FROA 2KT8A 2QA4T 1YI2A 4M78E 3WVDB 4MMLA 4ESRA 2HMAA 1VQOQ 2X9HA 4FSXA 2CZ6B 1MMGA 2DTHA 1Q81R 3VS6A 1RI9A 3BE3A 1GBRA 2P0KA 3M0SA 2KRMA 2PUOB 1VQMA 3L2VA 1XJWB 5FRMA 3EGXA 2W0ZA 1YCSB 1D3BA 4J7FA 1NEBA 1VQ9Q 1SSFA 4ZGJB 1W2BS 1VQ9T 2EQIA 2HEQA 3CPWP 1UGPB 2M1HA 4F7UE 5CAIA 2AZSA 1QVGS 1GFDA 1AWXA 1VQ6T 1Y0MA 1YBYA 2JM9A 1M90U 3VKIA 3GNGA 4JLGA 1WI7A 4C8QE 2EQJA 4J5YA 2ZAEA 4IIOA 1U1SA 4BI3A 4Z88A 1OULA 1ZX6A 2LZ6B 4KH0B 2CH4W 4K11A 1ZUUA 1WDXA 1JQQA 1U5SA 1YITQ 4PJOB 2AT1B 4M75F 3EG1A 3JCMW 1RACB 2KXDA 1YP5A 3SB2A 1V29B 1I07A 2JW4A 2LDMA 4DEXA 2E1HA 1W2BP 3QPHA 2AKKA 3CCRA 1X2KA 2BZYA 3EHQA 1H641 1T0JA 3M0TA 3NFCA 1QVGP 3CD6Q 1D1CA 4KUIA 4O6JA 4C8QC 3TREA 5GAOm 1VYVA 1G2BA 2ZPBB 2P84A 3GIBA 1QCFA 1PM3A 2SRCA 3EGXB 1BKBA 2NWMA 3MJXA 5AT1B 2JTEA 1D3BB 2X4YA 3QYHB 2K4YA 1XNIA 2V8JA 4II1A 1BI1A 5A0GA 3AT1B 3CMEQ 1YIJA 1QCNA 4C5EA 2MWOA 1RLPC 2QG9B 4RTUA 4BD3A 2RI3A 4JJNK 2RD1A 4PLLA 2KSSA 4BI8B 3HTRA 2O9VA 3FC3A 1A0NB 2DXTA 3NPFA 4BE1A 1VQPA 4RTWA 2HSEB 2A3LA 1PRMC 1VQ8A 2OTJA 3FRNA 1AWJA 3JCMV 1PC0A 4C5GA 5KE2A 2BIVA 2QK0A 4JZ3A 4CRIA 3EAEA 4QT7A 1NLPC 4JS5A 2RQUA 4HCZA 1X6GA 1NJIC 2CP0A 4FYYB 1SPKA 4PFPA 4FW1A 5GAMe 2H8HA 1B34A 4M78G 3PE0A 2BKDN 2NUPA 4M7AE 4M77E 1GXIE 3EGUA 3FJPA 3RESA 2K5FA 2RF0A 1M9SA 4Y28E 5GAMj 1VQ4Q 1WHKA 1T0HA 1VQ4T 1M8MA 1OPKA 1GCQC 1JEGA 3OW2A 2DL4A 4MZMA 2M16A 1ZBXA 2F2VA 1UFFA 4ZTFA 2EKHA 3JV3A 2CP7A 3SEMA 2QEXA 2K7AA 2EJ9A 3M0QA 3GNFB 3VYHB 4F7UG 4PJMA 1M1KR 2JVVA 1TWBA 2PQWA 3D7SB 4JLIA 2QTVA 3PVQA 3UA7A 4C8QG 4IUVA 5GAOp 4LDXA 1YJ9T 1X01A 3NTIA 4B9XA 4OMFB 3I55T 1SSHA 4M7AC 2VGMA 3ZL7C 4OP0A 2PTKA 5HK0A 3OYCA 3OYLA 2JT4A 4QVDA 4J9HA 1EZZB 2FZGB 2RK2A 1M3BA 2FB7A 2QGGA 3M4YA 1Z9ZA 4DBHA 1Y07A 2RJDA 2CUBA 2KRNA 5LJ5d 2DEQA 2F5TX 2E5QA 2M51A 2E41A 2KRSA 3E19A 3HRSA 3CCSA 1B07A 3R6NA 5FWCA 1B34B 2JS2A 1YJWQ 3G1JA 1G3SA 4J9DA 2NUPB 4M78A 5KYYB 2EQUA 1R0BG 4C92A 3CCLA 2E6NA 3H0HA 4BE2A 4N4GA 2CZ7B 1D09B 1OU9A 2RHXA 4PJOD 2QA4A 3QHSA 5CQYA 3M57A 4C0ZA 3OS0A 3EG3A 1VIFA 2K9GA 3M56A 3QZ9B 1HYOA 2OAUA 5IHKA 3NHNA 1MUZA 3VRZA 1QQJA 1N8RC 1WJRA 4OGEA 1GRIA 1F1BB 3A8LB 4PJJA 4F7UA 2H3JA 1Q86R 2EGCA 2ZPEB 1VQ9A 4IUTA 2Y90A 5LJ3e 2CSIA 2EWNA 2D1XA 3X26B 1I8FA 5A0LA 3LH0A 4E7JA 2LQ8A 4C8QA 2NLUA 3CC7Q 3RMSA 2YHTA 3VS1A 5HKCA 3C95A 3QUIA 1YHQQ 2LT1A 2XDPA 2VB6A 2KT1A 1K9MC 3GOXA 1JJ2S 2E4HA 1DJ7B 3GF5A 3H0FA 1LCKA 5GAOl 3ZEHA 1N9SA 2KE9A 4M7AG 1KHCA 1G5VA 4WF2A 4R55A 1UTIA 4JRPA 3INZA 1YITA 3UATA 2LTOA 3VS2A 5GAMg 3KXTA 1H92A 1FX7A 2F1LA 1J3TA 2GFAA 4JRQA 2DL8A 4GLMA 1UUEA 4L59A 1YN8A 3OYNA 4M78B 3ZBDA 2MPXC 4J9FA 5GMKi 4PJOC 1ZA1B 4LUEA 2DL7A 2CKKA 3CPWA 1M2VA 4PFZA 5DM7R 2DZCA 2NUZA 1PKTA 3A1PA 4LD6A 2JM8A 3M5AA 2F5KA 1YWPA 1K73R 4PJNA 3M0RA 4LUDA 1Y96A 2VV5A 3VYGA 2ZPGB 3RDVA 2DRKA 2LNVA 4IUPA 2NUTA 1PG5B 1Q82U 4MDWA 1R8OB 1WZOA 1BI2A 1K8AU 1KSWA 1SHFA 2GTOA 2KR3A 1K1ZA 2DFUA 3NTKA 1OQKA 2QYZA 2YRVA 1AEYA 4F7UB 2LQKA 2KEAA 2KVQG 3H9NA 2VWFA 1X6OA 1H8KA 4CC7A 1NZ9A 2RQTA 1JBMA 4C8QB 1YFNA 4BY6B 3EFOA 4IKFA 2CP5A 3HRTA 2L2PA 1TS9A 4QQGA 3DB3A 3IQLA 4F16A 3EG9A
chains in the Genus database with same CATH topology
4JPBW 2ENMA 1JXMA 2EGAA 2YDLA 1ZSGA 1VA7A 3I35A 4OMMA 1CSKA 1X2QA 1E7OA 2ROTA 2VKNA 4JZ4A 3REAB 2DL5A 2LX7A 2SEMA 1K9AA 2JMAA 2I0NA 4OMNA 2CSQA 4Y92A 2AZVA 2J6OA 4D8DA 2ED0A 1OV3A 3NMZC 3TVTA 4CC2A 3NGPA 1T3SA 2K79A 2D8HA 3ULRB 2FRYA 4ZNXA 1WIEA 1T3LA 2K3BA 2KT8A 2YUPA 1X27A 2OI3A 1BU1A 1K76A 3VS4A 5IXFA 2GBQA 1AZGB 4ESRA 4HVUA 1NLOC 2HSPA 1PWTA 2DYBA 3QWXX 1PNJA 3VS6A 1RI9A 1GBRA 3M0SA 2KRMA 2O31A 4X1VA 2OAWA 2RN8A 2ABLA 2W0ZA 1YCSB 1QKXA 2EYWA 1UECA 3UA6A 4LE9A 1GCPA 1NEBA 3CQTA 2DLPA 4OMLA 2MIOA 2O9SA 4DEYA 2EQIA 2HEQA 1CKBA 2AZSA 4M4ZA 1GFDA 1AWXA 1H3HA 2AKLA 2KNBB 3RNJA 5I22A 1Y0MA 3VRYA 2JM9A 4D8KA 1ABOA 2KROA 4AFSC 1WI7A 2HCKA 1WLPB 1GFCA 4IIOA 2QDLA 3TSWA 2IIMA 1HSQA 2ECZA 2L3PA 4RTZA 1VYTA 2C0TA 4Z88A 1XOVA 1JO8A 1ZX6A 2LZ6B 2CH4W 1AD5A 2DA9A 2CUDA 3QWYA 4K11A 1S1NA 1ZUUA 2CH4A 1WDXA 2DX1A 1JQQA 2EVRA 1U5SA 3RBBB 2ROLA 3VS7A 1M30A 2GGRA 1TG0A 3EG1A 4RTXA 3UF4A 2KYBA 4JJCA 2A37A 2YUNA 1SEMA 1I0CA 5FW9A 1OPLA 1EFNA 2KXDA 1YP5A 1K0SA 2KGTA 1GL5A 1I07A 1U06A 2JW4A 4DEXA 3FJ5A 3VS5A 2AKKA 2X3XD 3KFVA 4RTYA 1X2KA 2BZYA 3EHQA 4AG2C 2AK5A 3C0CA 1T0JA 2EYZA 1ABQA 3M0TA 1ZUKA 4J9BA 1M3AA 2C0OA 4F17A 1WXTA 1VYVA 1G2BA 3TSZA 2V1QA 1QCFA 4ORZA 2BTTA 1M3CA 2SRCA 2KBTA 2DMOA 5IHNA 2NWMA 3A98A 2JTEA 1V1CA 2YSQA 2F2XA 5IXBA 2ESWA 1UG1A 2DM1A 4AFZC 2DRMA 3LH5A 2LCSA 2GQIA 1IO6A 1AWOA 1RLPC 3H41A 4RTUA 4J9EA 2LMJA 1UJYA 1VYUA 2FO0A 1NYFA 3GBQA 2O9VA 1A0NB 3NPFA 4RTWA 2FPFA 2LJ0A 2FEIA 2CREA 2PNIA 1WYXA 1PRMC 1PKSA 2BZXA 2BZ8A 1CKAA 4AFUC 1WA7A 1AWJA 3SHWA 4E6RA 2YT6A 2DBMA 2A36A 4JJBA 4JZ3A 4QT7A 4AG1C 1NLPC 2RQUA 2MCNA 1X6GA 1SPKA 4R0KA 2LNHB 1FMKA 2K2MA 1QWFA 2H8HA 3PE0A 1GBQA 1YWOA 3EGUA 1BB9A 3O5ZA 2RF0A 1X43A 2YUQA 3I5SA 1RUWA 4HXJA 2J7IA 2J05A 4Z8AA 1MV3A 1T0HA 1RLQC 2J06A 2RQVA 1M8MA 1OPKA 3REBB 1GCQC 1JEGA 2DL3A 2DL4A 1MV0B 1UGVA 2J6FA 4RUGA 1K4US 2F2VA 1UFFA 2EKHA 3JV3A 5HCKA 2V1RA 5GJVB 1YNZA 3SEMA 2K6DA 2K7AA 1ARKA 1W6XA 3M0QA 2DBKA 1AWWA 2EYYA 2MOXA 2KXCA 1W70A 5ECAA 2RMOA 3PVQA 1ZLMA 3UA7A 4CC4B 2CT3A 1FYNA 1E6GA 1TUDA 1X6BA 1SSHA 3I5RA 5IH2A 2HDAA 3ZL7C 1Y57A 4HVWA 4J9GA 2PTKA 3VS0A 1AZEA 2LJ1A 2JT4A 5I11A 5GJWB 4J9HA 2L3QA 1M3BA 3I9QA 1JXOA 1SRLA 1Z9ZA 1AVZC 2D8JA 2M0YA 2CUBA 2KRNA 2EW3A 4OMOA 2M51A 1HJDA 1GCQA 2KRSA 2LQNA 1W1FA 2KYMA 1B07A 2RQWA 3R6NA 5FWCA 2JS2A 4J9DA 1N5ZA 1G83A 2P4RA 3U23A 2X3WD 1PHTA 3H0HA 2DNUA 2RPNA 4OMPA 1BK2A 2JS0A 2LJ3A 4KRTA 3EG3A 1JU5C 5L23A 1K0XA 2FPEA 2K9GA 3THKA 1SRMA 2YUOA 2JMCA 2D0NA 2FRWA 5IHKA 4JJDA 3NHNA 1ZUYA 2FPDA 1MUZA 4A63B 3VRZA 2VVKA 4CC3A 2RNAA 2LQWA 1GRIA 2O2OA 2DF6A 3PVLA 1NG2A 4RTTA 2EBPA 2W10A 1UJ0A 2EGEA 2EGCA 2GNCA 3H0IA 2CSIA 2B86A 1OEBA 2D1XA 1WXUA 4EIKA 1E6HA 2ED1A 1PRLC 1KFZA 3VS1A 2L0AA 1UHCA 1NYGA 3M0PA 2DILA 1HD3A 1BBZA 2KT1A 4LN2A 2G6FX 3H0FA 1LCKA 5EC7A 1ZBJA 2DE0X 2EPDA 2OJ2A 2KE9A 4LNPA 4J9CA 1B3QA 1UTIA 2CDTA 1QKWA 2F2WA 3UATA 3VS2A 2C0IA 1H92A 1J3TA 1U3OA 2DL8A 4GLMA 1UUEA 1M27C 1QLYA 1Z9QA 1YN8A 2JXBA 2J6KA 2O88A 1KJWA 2RQRA 3M0UA 4J9FA 1AOJA 3EG0A 4LUEA 3VS3A 2DL7A 2DVJA 1I1JA 1SHGA 1KIKA 3EG2A 2XMFA 2NUZA 1PKTA 5IHIA 1WX6A 1OOTA 2JM8A 4HCKA 2CT4A 4OMQA 1YWPA 1UDLA 4F14A 2A28A 3M0RA 4LUDA 2GTJA 2DRKA 4WCIA 4GBQA 1WXBA 5FWBA 4J9IA 4RTVA 2L3SA 1WFWA 1KSWA 1X69A 1TUCA 1SHFA 2GTOA 2KR3A 1K1ZA 2HBWA 1NEGA 1AEYA 2EYXA 4Z89A 3EHRA 4HVVA 2KEAA 1UE9A 2VWFA 1H8KA 4CC7A 2RQTA 4AFQC 2LP5A 1UHFA 1NM7A 2E5KA 2A08A 2L2PA 1QWEA 2PZ1A 4IIMA 3IQLA 4FSSA 2FG0A 4F16A 2DJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPB W;  2ENM A;  1JXM A;  2EGA A;  2YDL A;  1ZSG A;  1VA7 A;  3I35 A;  4OMM A;  1CSK A;  1X2Q A;  1E7O A;  2ROT A;  2VKN A;  4JZ4 A;  3REA B;  2DL5 A;  2LX7 A;  2SEM A;  1K9A A;  2JMA A;  2I0N A;  4OMN A;  2CSQ A;  4Y92 A;  2AZV A;  2J6O A;  4D8D A;  2ED0 A;  1OV3 A;  3NMZ C;  3TVT A;  4CC2 A;  3NGP A;  1T3S A;  2K79 A;  2D8H A;  3ULR B;  2FRY A;  4ZNX A;  1WIE A;  1T3L A;  2K3B A;  2KT8 A;  2YUP A;  1X27 A;  2OI3 A;  1BU1 A;  1K76 A;  3VS4 A;  5IXF A;  2GBQ A;  1AZG B;  4ESR A;  4HVU A;  1NLO C;  2HSP A;  1PWT A;  2DYB A;  3QWX X;  1PNJ A;  3VS6 A;  1RI9 A;  1GBR A;  3M0S A;  2KRM A;  2O31 A;  4X1V A;  2OAW A;  2RN8 A;  2ABL A;  2W0Z A;  1YCS B;  1QKX A;  2EYW A;  1UEC A;  3UA6 A;  4LE9 A;  1GCP A;  1NEB A;  3CQT A;  2DLP A;  4OML A;  2MIO A;  2O9S A;  4DEY A;  2EQI A;  2HEQ A;  1CKB A;  2AZS A;  4M4Z A;  1GFD A;  1AWX A;  1H3H A;  2AKL A;  2KNB B;  3RNJ A;  5I22 A;  1Y0M A;  3VRY A;  2JM9 A;  4D8K A;  1ABO A;  2KRO A;  4AFS C;  1WI7 A;  2HCK A;  1WLP B;  1GFC A;  4IIO A;  2QDL A;  3TSW A;  2IIM A;  1HSQ A;  2ECZ A;  2L3P A;  4RTZ A;  1VYT A;  2C0T A;  4Z88 A;  1XOV A;  1JO8 A;  1ZX6 A;  2LZ6 B;  2CH4 W;  1AD5 A;  2DA9 A;  2CUD A;  3QWY A;  4K11 A;  1S1N A;  1ZUU A;  2CH4 A;  1WDX A;  2DX1 A;  1JQQ A;  2EVR A;  1U5S A;  3RBB B;  2ROL A;  3VS7 A;  1M30 A;  2GGR A;  1TG0 A;  3EG1 A;  4RTX A;  3UF4 A;  2KYB A;  4JJC A;  2A37 A;  2YUN A;  1SEM A;  1I0C A;  5FW9 A;  1OPL A;  1EFN A;  2KXD A;  1YP5 A;  1K0S A;  2KGT A;  1GL5 A;  1I07 A;  1U06 A;  2JW4 A;  4DEX A;  3FJ5 A;  3VS5 A;  2AKK A;  2X3X D;  3KFV A;  4RTY A;  1X2K A;  2BZY A;  3EHQ A;  4AG2 C;  2AK5 A;  3C0C A;  1T0J A;  2EYZ A;  1ABQ A;  3M0T A;  1ZUK A;  4J9B A;  1M3A A;  2C0O A;  4F17 A;  1WXT A;  1VYV A;  1G2B A;  3TSZ A;  2V1Q A;  1QCF A;  4ORZ A;  2BTT A;  1M3C A;  2SRC A;  2KBT A;  2DMO A;  5IHN A;  2NWM A;  3A98 A;  2JTE A;  1V1C A;  2YSQ A;  2F2X A;  5IXB A;  2ESW A;  1UG1 A;  2DM1 A;  4AFZ C;  2DRM A;  3LH5 A;  2LCS A;  2GQI A;  1IO6 A;  1AWO A;  1RLP C;  3H41 A;  4RTU A;  4J9E A;  2LMJ A;  1UJY A;  1VYU A;  2FO0 A;  1NYF A;  3GBQ A;  2O9V A;  1A0N B;  3NPF A;  4RTW A;  2FPF A;  2LJ0 A;  2FEI A;  2CRE A;  2PNI A;  1WYX A;  1PRM C;  1PKS A;  2BZX A;  2BZ8 A;  1CKA A;  4AFU C;  1WA7 A;  1AWJ A;  3SHW A;  4E6R A;  2YT6 A;  2DBM A;  2A36 A;  4JJB A;  4JZ3 A;  4QT7 A;  4AG1 C;  1NLP C;  2RQU A;  2MCN A;  1X6G A;  1SPK A;  4R0K A;  2LNH B;  1FMK A;  2K2M A;  1QWF A;  2H8H A;  3PE0 A;  1GBQ A;  1YWO A;  3EGU A;  1BB9 A;  3O5Z A;  2RF0 A;  1X43 A;  2YUQ A;  3I5S A;  1RUW A;  4HXJ A;  2J7I A;  2J05 A;  4Z8A A;  1MV3 A;  1T0H A;  1RLQ C;  2J06 A;  2RQV A;  1M8M A;  1OPK A;  3REB B;  1GCQ C;  1JEG A;  2DL3 A;  2DL4 A;  1MV0 B;  1UGV A;  2J6F A;  4RUG A;  1K4U S;  2F2V A;  1UFF A;  2EKH A;  3JV3 A;  5HCK A;  2V1R A;  5GJV B;  1YNZ A;  3SEM A;  2K6D A;  2K7A A;  1ARK A;  1W6X A;  3M0Q A;  2DBK A;  1AWW A;  2EYY A;  2MOX A;  2KXC A;  1W70 A;  5ECA A;  2RMO A;  3PVQ A;  1ZLM A;  3UA7 A;  4CC4 B;  2CT3 A;  1FYN A;  1E6G A;  1TUD A;  1X6B A;  1SSH A;  3I5R A;  5IH2 A;  2HDA A;  3ZL7 C;  1Y57 A;  4HVW A;  4J9G A;  2PTK A;  3VS0 A;  1AZE A;  2LJ1 A;  2JT4 A;  5I11 A;  5GJW B;  4J9H A;  2L3Q A;  1M3B A;  3I9Q A;  1JXO A;  1SRL A;  1Z9Z A;  1AVZ C;  2D8J A;  2M0Y A;  2CUB A;  2KRN A;  2EW3 A;  4OMO A;  2M51 A;  1HJD A;  1GCQ A;  2KRS A;  2LQN A;  1W1F A;  2KYM A;  1B07 A;  2RQW A;  3R6N A;  5FWC A;  2JS2 A;  4J9D A;  1N5Z A;  1G83 A;  2P4R A;  3U23 A;  2X3W D;  1PHT A;  3H0H A;  2DNU A;  2RPN A;  4OMP A;  1BK2 A;  2JS0 A;  2LJ3 A;  4KRT A;  3EG3 A;  1JU5 C;  5L23 A;  1K0X A;  2FPE A;  2K9G A;  3THK A;  1SRM A;  2YUO A;  2JMC A;  2D0N A;  2FRW A;  5IHK A;  4JJD A;  3NHN A;  1ZUY A;  2FPD A;  1MUZ A;  4A63 B;  3VRZ A;  2VVK A;  4CC3 A;  2RNA A;  2LQW A;  1GRI A;  2O2O A;  2DF6 A;  3PVL A;  1NG2 A;  4RTT A;  2EBP A;  2W10 A;  1UJ0 A;  2EGE A;  2EGC A;  2GNC A;  3H0I A;  2CSI A;  2B86 A;  1OEB A;  2D1X A;  1WXU A;  4EIK A;  1E6H A;  2ED1 A;  1PRL C;  1KFZ A;  3VS1 A;  2L0A A;  1UHC A;  1NYG A;  3M0P A;  2DIL A;  1HD3 A;  1BBZ A;  2KT1 A;  4LN2 A;  2G6F X;  3H0F A;  1LCK A;  5EC7 A;  1ZBJ A;  2DE0 X;  2EPD A;  2OJ2 A;  2KE9 A;  4LNP A;  4J9C A;  1B3Q A;  1UTI A;  2CDT A;  1QKW A;  2F2W A;  3UAT A;  3VS2 A;  2C0I A;  1H92 A;  1J3T A;  1U3O A;  2DL8 A;  4GLM A;  1UUE A;  1M27 C;  1QLY A;  1Z9Q A;  1YN8 A;  2JXB A;  2J6K A;  2O88 A;  1KJW A;  2RQR A;  3M0U A;  4J9F A;  1AOJ A;  3EG0 A;  4LUE A;  3VS3 A;  2DL7 A;  2DVJ A;  1I1J A;  1SHG A;  1KIK A;  3EG2 A;  2XMF A;  2NUZ A;  1PKT A;  5IHI A;  1WX6 A;  1OOT A;  2JM8 A;  4HCK A;  2CT4 A;  4OMQ A;  1YWP A;  1UDL A;  4F14 A;  2A28 A;  3M0R A;  4LUD A;  2GTJ A;  2DRK A;  4WCI A;  4GBQ A;  1WXB A;  5FWB A;  4J9I A;  4RTV A;  2L3S A;  1WFW A;  1KSW A;  1X69 A;  1TUC A;  1SHF A;  2GTO A;  2KR3 A;  1K1Z A;  2HBW A;  1NEG A;  1AEY A;  2EYX A;  4Z89 A;  3EHR A;  4HVV A;  2KEA A;  1UE9 A;  2VWF A;  1H8K A;  4CC7 A;  2RQT A;  4AFQ C;  2LP5 A;  1UHF A;  1NM7 A;  2E5K A;  2A08 A;  2L2P A;  1QWE A;  2PZ1 A;  4IIM A;  3IQL A;  4FSS A;  2FG0 A;  4F16 A;  2DJQ A; 
#chains in the Genus database with same CATH topology
 3L2R A;  2OTL T;  1EIF A;  1WQW A;  1E7O A;  2E64 A;  5GAM h;  2QQS A;  3JB9 I;  1FWZ A;  2LX7 A;  3WVE B;  2P0Q A;  4Y92 A;  3V8J A;  1NE8 A;  3VJP A;  2DIQ A;  3GLX A;  4FYX B;  2J6O A;  4ME7 A;  1OYX A;  4M77 A;  1RAD B;  1B7T A;  4FYW B;  2RI5 A;  5FU7 B;  4A4H A;  1ZA2 B;  2KI7 A;  2LRQ A;  2K3B A;  2CS7 A;  3QJ6 A;  1VQL Q;  2E3I A;  1Q81 C;  2VC8 A;  5IXF A;  4FIB A;  2GBQ A;  1AZG B;  1PD0 A;  1M2V B;  2WSF E;  3OQ5 A;  4HVU A;  4RKU E;  1PWT A;  2DYB A;  1U1T A;  2VYT A;  3RR6 A;  1VQ4 A;  1G3Y A;  1VQ8 T;  5GAN 3;  4X1V A;  2QXF A;  3KUF A;  2OAW A;  2RN8 A;  2ABL A;  2NUT B;  4M7D A;  4PJO G;  1Q7Y R;  1QKX A;  1LVK A;  2CP3 A;  5KCH A;  2DLP A;  1I5L A;  4L5G A;  3LLR A;  4DEY A;  3CBM A;  3ME9 A;  5LJ3 g;  4M78 F;  2X4W A;  4M4Z A;  1QMC A;  3RNJ A;  2RHY A;  4XQ3 A;  2QAS A;  2FVU A;  2K5L A;  2HCK A;  2DIG A;  3I55 A;  2JZ2 A;  1VQN Q;  3TSW A;  1QCO A;  3EG9 B;  1UGS B;  5LJ5 j;  2ECZ A;  1TSF A;  2L3P A;  4RTZ A;  1BCM A;  1VYT A;  2C0T A;  2DET A;  3URG A;  1VQN T;  1JO8 A;  3CPF A;  2EKO A;  3JSC A;  4DOW A;  4FL6 A;  3V7S A;  2DX1 A;  2QEX T;  1IGU A;  2VAS A;  5CKE A;  4F7U F;  4JJC A;  2YUN A;  2E12 A;  2KAF A;  1I0C A;  2X4X A;  4FU6 A;  4HA8 A;  3X28 B;  4M7A B;  4M77 B;  3HFO A;  2ZGW A;  4MDX A;  1GL5 A;  3FJ5 A;  4C8Q F;  4ZN3 A;  2O4X A;  1Q7Y U;  1YJW A;  3CXC P;  4LDY A;  4ELZ C;  1SKU B;  2EYZ A;  1ABQ A;  2XHC A;  2RJF A;  4LXC A;  3TEE A;  2WSC E;  1Q95 G;  4NOY A;  2JOY A;  5LJ3 f;  1YJN Q;  4F17 A;  4E7H A;  1LPL A;  1KQS P;  5GAN 6;  2CZ1 B;  4GY5 A;  3UPU A;  1M3C A;  5LJ3 h;  2DMO A;  4M78 D;  3EGD A;  3A98 A;  1V1C A;  2YSQ A;  2F2X A;  3RIR A;  2DRM A;  3SDZ A;  2GQI A;  5CQX A;  1IO6 A;  2OX7 A;  1AWO A;  5GMK e;  3H41 A;  3JAM E;  2HQE A;  2LX9 A;  3E9F A;  4EMK A;  5CIU A;  1NYF A;  2WAC A;  3LGL A;  5GMK j;  5GAN d;  2HZY A;  1HK9 A;  4R56 A;  1IZ6 A;  3CC7 A;  4C92 E;  3JCM d;  5FU6 B;  3G7Z A;  4AFU C;  1YHQ A;  5CR2 A;  2RH2 A;  3QO3 A;  1VQO T;  2YT6 A;  3FLG A;  2DBM A;  2QQA A;  2A36 A;  4AG1 C;  2QGF B;  2MCN A;  4C8Q D;  3RUX A;  1IGQ A;  3CC2 Q;  3HRU A;  2QI2 A;  1FMK A;  2K2M A;  1KG1 A;  1QWF A;  3CC2 T;  3PMI A;  1N9R A;  3V7C A;  2VUB A;  1YWO A;  2HD0 A;  4HXJ A;  2J05 A;  1MV3 A;  3S3N A;  1RLQ C;  2J06 A;  4AMC A;  4IUU A;  4JS4 A;  1TTH B;  1M1F A;  1MV0 B;  5KYX A;  4F04 B;  2J6F A;  5LL6 S;  2CGH A;  1K4U S;  1VQ5 Q;  4M78 C;  2E65 A;  1VQ5 T;  3JCM P;  1M1K C;  4C92 C;  3OS2 A;  1ARK A;  1W6X A;  5D6Y A;  2D9T A;  3N5B B;  1BCO A;  3EGD B;  4X9D A;  1TXQ A;  2HL5 C;  4M7A F;  4DBF A;  1YIT T;  2JTF A;  1PD1 A;  4CC4 B;  2CT3 A;  5I2M A;  3JCM X;  4BDY A;  3MO8 A;  1UGQ B;  1IRX A;  3T9N A;  4EMK B;  2H3E B;  3PIO A;  5I21 A;  3I5R A;  5IH2 A;  4N0A A;  2CZ0 B;  4B9W A;  4HVW A;  1C6V X;  3VS0 A;  2O01 E;  3QYG B;  1AZE A;  2LJ1 A;  4XTV A;  5I11 A;  2OTL A;  3CD6 T;  3OYF A;  1JXO A;  4BY6 C;  3HKS A;  1SRL A;  2CP6 A;  3JCM Q;  2R5A A;  2D8J A;  4PNO A;  3JB9 H;  1EX4 A;  4OMO A;  1HJD A;  4X9C A;  3CCU Q;  1IXD A;  2CYZ B;  3CCU T;  2QQB A;  4LDU A;  2XG8 D;  1SG5 A;  2EAY A;  1MHN A;  1UB4 A;  3CME T;  3U23 A;  1BK2 A;  3MPU B;  1VQL A;  5GAN 5;  1K0X A;  4C0F A;  3A8M B;  2DYI A;  2V8I A;  3FB9 A;  5FU7 C;  3THK A;  4M7A D;  3JCM J;  1Q86 C;  4A63 B;  3CCE Q;  1M1G A;  2LQW A;  3CCE T;  2EQM A;  2O2O A;  2DF6 A;  3M53 A;  1NG2 A;  2EBP A;  1QVF A;  2LCL A;  2GNC A;  2PVO B;  3H0I A;  4FCY A;  2B86 A;  1OEB A;  3MEW A;  1WXU A;  4EIK A;  1E6H A;  4IUQ A;  4RCB A;  2ED1 A;  1RAI B;  4C92 G;  3S3M A;  1M5Q 1;  2L0A A;  1NYG A;  3M0P A;  3OSV A;  2MI6 A;  3MCA B;  1BBZ A;  4QKU A;  4PLI A;  4LN2 A;  1VQN A;  5EC7 A;  2K57 A;  1ZBJ A;  2ZPH B;  4PJO F;  7AT1 B;  4M75 E;  4UC4 A;  3C4S A;  1B3Q A;  2CDT A;  2B8A A;  1KC8 U;  4M7D E;  3CBP A;  3LGF A;  2O88 A;  1KJW A;  3M0U A;  1AOJ A;  4OVA A;  3EG0 A;  1K73 C;  4O5V A;  4FT2 A;  2XI9 A;  2CT4 A;  4FM4 B;  4M77 C;  2Z0W A;  2XD0 A;  4J6W A;  4F14 A;  3RMQ A;  5GAN 8;  1M4Z A;  1XQH A;  1WXB A;  5FWB A;  4J9I A;  5GMK h;  4RG8 A;  2K3Y A;  1VIE A;  4XU3 A;  3JCM e;  3CC4 Q;  2AHJ B;  4J6X A;  2EYX A;  1JRI A;  3EHR A;  4HVV A;  5GAN j;  1UE9 A;  1MMN A;  3JCM b;  6AT1 B;  2PVD B;  1V76 A;  4M7D C;  4AFQ C;  1ZQ1 A;  4C0G A;  4C0D B;  1UHF A;  1YCY A;  2MWP A;  2E5K A;  3OYE A;  1YJW T;  3QKJ A;  4DA4 A;  3KBG A;  2FHD A;  1FMV A;  4IIM A;  3VV0 A;  4PK4 A;  2FZC B;  1ZSG A;  1VA7 A;  1BI0 A;  3CXC A;  1CSK A;  3M54 A;  4PFO A;  2ROT A;  4YTL A;  3RKX A;  4E2F B;  4V2S A;  2K3X A;  2DL5 A;  2MYS A;  1VQO A;  2SEM A;  1K9A A;  2JMA A;  4BE0 A;  1KQS A;  4D6W A;  1OU8 A;  4VUB A;  2COZ A;  1TU0 B;  2QTX A;  5FU6 C;  4ZGD B;  4LD9 K;  1O9S A;  3G4S Q;  3CCQ Q;  3BDU A;  2QQR A;  3CCQ T;  3CC2 A;  1WIE A;  3UT1 A;  3I56 Q;  1X27 A;  3VS4 A;  3M9Q A;  3I56 T;  2ATC B;  3V8K A;  3SWN A;  1Q82 R;  1NLO C;  1K8A R;  3CC7 T;  2HQX A;  3QWX X;  1PNJ A;  2WSE E;  1IRE B;  2O31 A;  1YHQ T;  3DLM A;  5GAO q;  1I4K 1;  3AHU A;  3FEO A;  3CCJ Q;  1VQ5 A;  2EYW A;  2K2V A;  4LE9 A;  1GCP A;  3CCJ T;  3CQT A;  4BUG A;  1YI2 Q;  1NJI R;  2O9S A;  1WHH A;  2EJF A;  3P8D A;  2EJG A;  2FYK A;  2RK1 A;  1CKB A;  4ANJ A;  4M77 G;  3MET A;  3EFR A;  3LX7 A;  2AKL A;  2KNB B;  5I22 A;  3LWI A;  3OSS C;  2F69 A;  1ABO A;  3MEU A;  3A5Z B;  2YXY A;  4HT9 A;  3QG1 A;  1GFC A;  2V8K A;  4C92 B;  2X51 A;  3E2U A;  2QDL A;  1ZHI A;  3SFM A;  1XOV A;  2L5Q A;  2CUD A;  4E7I A;  4EMK C;  3OYI A;  4HCB A;  1S1N A;  2RHI A;  2CH4 A;  2EVR A;  3VS7 A;  3RBB B;  1WJS A;  3CD6 A;  3G71 Q;  4M7D G;  1M30 A;  3L2W A;  2GGR A;  1TG0 A;  3OYY A;  4RTX A;  2KYB A;  4Z02 A;  1SEM A;  5CKB A;  3A8H B;  2R58 A;  5FW9 A;  1RAH B;  1AT1 B;  5DLO A;  1OPL A;  1MMA A;  1JJ2 P;  1K0S A;  2KGT A;  2DD4 A;  4GLK A;  3CCU A;  3EH1 A;  2X3X D;  2M02 A;  1OZ2 A;  1WHL A;  1MND A;  4AG2 C;  2AK5 A;  1I81 A;  1RAB B;  3CME A;  1S72 Q;  1ZUK A;  2RM4 A;  1NJI U;  3FDR A;  4J9B A;  2RHZ A;  1S72 T;  2C0O A;  2IPO B;  2MK5 A;  1WXT A;  3GPL A;  5GAM f;  4DQ2 A;  3TSZ A;  1W2B A;  5FRN A;  2V1Q A;  1M90 C;  1VOM A;  2CP2 A;  3OW2 S;  1KD1 C;  2KBT A;  2GCX A;  3MP6 A;  4WTO B;  5IHN A;  1QVG A;  3MHX A;  3OMG A;  3JCM g;  5IXB A;  2ESW A;  2DM1 A;  2A0F B;  3CCE A;  3CEY A;  2LCS A;  5HK3 A;  3G6E Q;  1HXD A;  3CCM Q;  4J9E A;  4RG2 A;  3CCM T;  3OYB A;  2FO0 A;  3PGG A;  3OBW A;  3PMT A;  5C6S A;  2V26 A;  5IAY A;  2DAQ A;  4NL3 A;  2FEI A;  3P8H A;  1G8X A;  1VQL T;  2PNI A;  1N27 A;  5GAN 7;  1QW1 A;  5EG2 A;  4TVR A;  1CKA A;  3M4G A;  4Q5W A;  2X35 A;  1G3T A;  1WA7 A;  3SHW A;  4E6R A;  3EH2 A;  3OMC A;  3BDL A;  4M75 A;  4JJB A;  1Y96 B;  2ZPF B;  1SF9 A;  4N0A C;  4E7S A;  4PJL A;  4R0K A;  2DD5 A;  4QW2 A;  2D0Q B;  3QSU A;  5J39 A;  3OW2 P;  1VQP Q;  2QDY B;  1KK7 A;  1G3W A;  3QXE B;  2RJE A;  1ACM B;  4KBM B;  3ZFJ A;  2KDS A;  2YUQ A;  3I5S A;  1RUW A;  3PTA A;  2J7I A;  4Z8A A;  5J26 A;  1OZ3 A;  2Y4X A;  4C92 F;  4ZTJ A;  2RQV A;  3REB B;  5LJ5 e;  5KH6 A;  3L2U A;  2DXU A;  5I2S A;  3EFO B;  2RI2 A;  3O8V A;  3JCM h;  5GJV B;  1YNZ A;  2Y4Y A;  2K6D A;  3HP9 A;  5D7U A;  1VQ7 Q;  2IVW A;  1VQ7 T;  2EYY A;  2EIF A;  4IUR A;  4E7Z A;  1W70 A;  4QVZ A;  1M8V A;  2RMO A;  1FYN A;  2DTI A;  3RKY A;  1VUB A;  2VXF A;  3BFM A;  4B6M A;  5A0D A;  1NPR A;  2LC4 A;  3H6Z A;  2YRC A;  2ZCF B;  1N8R U;  3QJY A;  4J9G A;  3OBY A;  5C0M A;  1LNX A;  3X24 B;  4KGX B;  4MMK A;  5GJW B;  2L3Q A;  3I9Q A;  2GFU A;  4C0D C;  3LYI A;  4M75 B;  5D6W A;  1AVZ C;  1YJN T;  5FLX E;  2JJ9 A;  3SD4 A;  1PCX A;  4HCC A;  2LQN A;  4M7D B;  2KYM A;  1KQ1 A;  2RQW A;  4C92 D;  1XTD A;  3QDF A;  1TUG B;  2XU8 A;  1K9M U;  1G83 A;  2JNG A;  3S3O A;  1MMD A;  3CCQ A;  2E70 A;  1Y7X A;  2X3W D;  4A4K A;  5IN1 A;  2LJ3 A;  4XTY A;  3I56 A;  4KRT A;  3CPW S;  2YUO A;  2HQH A;  2JMC A;  2D0N A;  2I2L A;  4JJD A;  1KHI A;  3A8G B;  2RJC A;  1ZUY A;  2FPD A;  3E1S A;  2VVK A;  2HL3 A;  3OYJ A;  2DPP B;  5GAN 2;  4RMO A;  4XU1 A;  3QBY A;  3PVL A;  9ATC B;  2MAM A;  3LW5 E;  4RTT A;  3CCJ A;  2QA4 Q;  1TH7 A;  1UJ0 A;  2EGE A;  2JTM A;  4XTX A;  4J7I A;  1OI1 A;  4J6Y A;  1BIB A;  3HPW A;  2COY A;  4QQ6 A;  4XK8 E;  1KFZ A;  1D0X A;  3NTH A;  5L8R E;  4AT1 B;  2COW A;  3M59 A;  3J80 E;  4OF1 A;  2DIL A;  2O4X B;  4XU2 A;  3HSB A;  5HY6 A;  1OX9 A;  4C5H A;  1Y71 A;  2G3R A;  2G6F X;  1IB8 A;  1WHG A;  3DKM A;  5M9O A;  4J8O A;  2DE0 X;  4Y91 A;  2ZZD A;  5KYW A;  1VQ6 Q;  5CO7 A;  4KUD K;  1QKW A;  2F2W A;  2VGN A;  3G71 A;  4EMH A;  1RAF B;  4M77 F;  1M27 C;  1KD1 U;  5KCO A;  3DB4 A;  3JB9 G;  2BE9 B;  4ZN1 A;  4JRI A;  4OGC A;  3VS3 A;  1BIA A;  2DVJ A;  4EPC A;  2P4T A;  1QP2 A;  3EG2 A;  2XMF A;  5LJ5 g;  5IHI A;  1OOT A;  4HCK A;  1NBE B;  1RAE B;  4HKE A;  4L6V 5;  1UDL A;  5LJ3 d;  4N4I A;  3CCV Q;  2RHU A;  1S72 A;  3LWH A;  3CCV T;  3L2Q A;  4RTV A;  3TCJ A;  2L3S A;  1Q81 U;  1TUC A;  4OB1 B;  3SWN C;  3MEV A;  4M7D F;  1RAA B;  2DXC A;  2HBW A;  4KGZ B;  1NEG A;  1D1A A;  4MZT A;  2XKO C;  4Z89 A;  1WNL A;  3QZ5 B;  2M0O A;  3VUZ A;  2HKQ B;  3G6E A;  3VUB A;  2QAZ A;  1JJ2 A;  2LT4 A;  3CCM A;  3CMA Q;  2MMP A;  2PZ1 A;  2EQK A;  4FSS A;  2FG0 A;  3CMA T;  2DJQ A;  2ENM A;  2AIR B;  1JXM A;  2EGA A;  3I35 A;  2YDL A;  5CK9 A;  5GMK l;  4OMM A;  1X2Q A;  3JRZ A;  2VKN A;  4OB2 B;  2YLB A;  5KYX B;  1WQ7 A;  1KC8 R;  1H3Z A;  1BI3 A;  4JZ4 A;  3REA B;  1FMW A;  1RI0 A;  1VQK Q;  4M77 D;  1IHV A;  5LJ5 f;  2I0N A;  1VQK T;  3OS1 A;  2CSQ A;  5KYW B;  1OV3 A;  3NMZ C;  5LJ5 h;  3NGP A;  1T3S A;  3MP8 A;  4BB7 A;  4JRK A;  2FRY A;  1Q82 C;  1TOV A;  1T3L A;  2YUP A;  1WHJ A;  3Q1J A;  5CCA A;  1K8A C;  2OI3 A;  1BU1 A;  1K76 A;  1BYM A;  1D1B A;  4PL6 A;  4M75 D;  5CVI A;  2HSP A;  2NYS A;  3A8O B;  3DLL A;  5DY9 A;  4M7D D;  5A2Q E;  3UDC A;  2JUF A;  2XIC A;  2L3R A;  1LOJ A;  2RA2 A;  4NL2 A;  1UEC A;  3UA6 A;  2YRD A;  1VQ7 A;  4OML A;  2MIO A;  3M55 A;  5KYY A;  5GAO n;  2GQV A;  5CKH A;  1QVP A;  2DO3 A;  2C06 A;  3WXM B;  4HT8 A;  3HFN A;  3L42 A;  1H3H A;  3VRY A;  4D8K A;  2DTO A;  2KRO A;  1R0C B;  4AFS C;  2RB6 A;  1ZSZ A;  2RO0 A;  4A4E A;  1WLP B;  2IIM A;  5D6X A;  1PSE A;  1HSQ A;  3PNW C;  4XTZ A;  3RKW A;  2DA9 A;  1AD5 A;  4DOV A;  2M9U A;  3QWY A;  2DXB A;  1O75 A;  2A7Y A;  2ROL A;  3UF4 A;  2VXE A;  1YJN A;  3OY9 A;  2A37 A;  1YJ9 Q;  5KYN A;  5GAN e;  1WPY A;  4JDS A;  3OYG A;  3I55 Q;  1EFN A;  3C94 A;  1KQ2 A;  1U06 A;  3VS5 A;  2FL7 A;  3CC4 T;  1W4S A;  3KFV A;  2MF2 A;  4M75 C;  4RTY A;  4MZP A;  3C0C A;  2LVM A;  1M2O A;  3V8L A;  1M3A A;  3HHT B;  4E47 A;  1N6A A;  3OYM A;  1MNE A;  3BY7 A;  4ORZ A;  2BTT A;  2X4J A;  2D6F A;  2ZPI B;  5GAN 4;  3J7A F;  3R6O A;  4A54 A;  3X20 B;  1UG1 A;  4BAC A;  2IG0 A;  4FW2 A;  4AFZ C;  3LH5 A;  2E6Z A;  1WJQ A;  3OS5 A;  3MP1 A;  2LMJ A;  2HKN A;  3OYH A;  3H8Z A;  1UJY A;  1VYU A;  3G4S T;  1M1K U;  3GBQ A;  4BDZ A;  2P0P A;  1QP3 A;  1ZSZ B;  2FPF A;  2LJ0 A;  3S6W A;  2CRE A;  3MEA A;  3OYA A;  1WYX A;  1PKS A;  2BZX A;  2BZ8 A;  2XK0 A;  2YWW A;  4KT0 E;  4XTW A;  3HL8 A;  3E9G A;  4A53 A;  1Q7Y C;  2KK4 A;  2FZK B;  2DVE A;  4PJO E;  3CBO A;  4QQD A;  2LNH B;  3RER A;  2K5I A;  1GBQ A;  1VQ6 A;  1YI2 T;  1BB9 A;  5AYF A;  5LJ3 j;  3O5Z A;  3OA6 A;  1X43 A;  3PIP A;  5KYU A;  5CKD A;  3OYD A;  2KMT A;  2R5M A;  4X34 A;  3TQ7 P;  1VQM Q;  2DL3 A;  1UGV A;  1VQM T;  3C12 A;  4RUG A;  4A4G A;  5CKF A;  4FT4 A;  5HCK A;  2V1R A;  4M75 G;  3CCV A;  2L8D A;  2DBK A;  4XU0 A;  1AWW A;  2HBP A;  5IT9 E;  1UGR B;  2E3H A;  2MOX A;  2KXC A;  3J81 E;  4NS5 A;  3G71 T;  4E7L A;  5ECA A;  1ZLM A;  1E6G A;  2QQ9 A;  1TUD A;  2HNI A;  3JB9 F;  1X6B A;  1Q86 U;  8AT1 B;  2HDA A;  1QVF S;  1Y57 A;  4OB3 B;  3F70 A;  3SWN B;  2DJZ A;  3PT9 A;  3CMA A;  4KUL A;  1P92 A;  2DKG A;  2PUK B;  2M0Y A;  2EW3 A;  3L2Z A;  1GCQ A;  5GAN g;  3GP8 A;  4EDU A;  1W1F A;  3CCR Q;  1VQK A;  4C5I A;  8ATC B;  3CCR T;  1I5O B;  1N5Z A;  2P4R A;  5KE3 A;  2DER A;  4LDV A;  4PKC C;  1PHT A;  2DNU A;  1MGQ A;  3G6E T;  2OTL Q;  2RPN A;  5KYU B;  3MKD A;  4OMP A;  3OB9 A;  1NPP A;  2JS0 A;  3FIF A;  4DBQ A;  4J83 A;  1JU5 C;  5L23 A;  4XAX B;  2FPE A;  1SRM A;  4OB0 B;  2XDD A;  1QVF P;  1RL2 A;  3QDR B;  1WHM A;  2FRW A;  1X75 C;  2BE7 D;  3TU4 K;  5J3B A;  4QVC A;  1YIJ Q;  4ZGE B;  4M7A A;  4CC3 A;  1K73 U;  2RNA A;  1YIJ T;  3P8B B;  1UEB A;  3JB9 D;  2HAX A;  2W10 A;  5GAO r;  4ATO A;  3ER0 A;  1N8R R;  3UWN A;  1WGS A;  2PU9 B;  2EFI A;  1IHW A;  3OYK A;  1VQP T;  2XDB A;  1PRL C;  2YLC A;  3VU3 C;  2KY9 A;  1VQ8 Q;  2OTJ Q;  1JB0 E;  1UHC A;  5GAN f;  1AHJ B;  1LJO A;  2OTJ T;  1HD3 A;  3JCM f;  5GMK m;  5GAN h;  2KQW A;  1D0Y A;  1D0Z A;  3QII A;  4KH1 B;  1K9M R;  2EPD A;  3CXC S;  2OJ2 A;  4LNP A;  2GF7 A;  4J9C A;  3JCM c;  3M58 A;  2C0I A;  1U3O A;  1QLY A;  1Z9Q A;  1YJ9 A;  4EMG A;  2JXB A;  2J6K A;  1KQS S;  2RQR A;  3V7R A;  2DZ9 A;  1I1J A;  3CC4 A;  4XTU A;  1SHG A;  2EYQ A;  1KIK A;  2PVG B;  1WX6 A;  1PSF A;  4OMQ A;  4E7K A;  2QEX Q;  4KGV B;  4JUV A;  2A28 A;  2GTJ A;  5GAM d;  4WCI A;  4GBQ A;  2JN0 A;  3JB9 J;  3L1A A;  1WFW A;  3BW1 A;  1X69 A;  4DBR A;  2L89 A;  3EFS A;  3PFS A;  1R77 A;  5DLQ E;  2LP5 A;  4A4F A;  1C1A A;  1NM7 A;  2DK3 A;  2A08 A;  2XID A;  1QWE A;  2DEU A;  3G4S A;  1OX8 A;  1KC8 C;  1FXX A;  4FYV B;  4JPB W;  2E10 A;  4P5N A;  1C0M A;  4RCC A;  3ASK A;  2LCC A;  4PJO A;  1RAG B;  4ELY C;  1M90 R;  3CCS Q;  4BI4 A;  1ZSZ C;  1KD1 R;  3CCS T;  4OMN A;  2R57 A;  4N4H A;  2AZV A;  4LDW A;  4D8D A;  2BUD A;  2ED0 A;  4CI0 C;  4CC2 A;  3TVT A;  3CCL Q;  2K79 A;  1U8R A;  2D8H A;  3ULR B;  3X25 B;  3CCL T;  4ZNX A;  5FRO A;  2KT8 A;  2QA4 T;  1YI2 A;  4M78 E;  3WVD B;  4MML A;  4ESR A;  2HMA A;  1VQO Q;  2X9H A;  4FSX A;  2CZ6 B;  1MMG A;  2DTH A;  1Q81 R;  3VS6 A;  1RI9 A;  3BE3 A;  1GBR A;  2P0K A;  3M0S A;  2KRM A;  2PUO B;  1VQM A;  3L2V A;  1XJW B;  5FRM A;  3EGX A;  2W0Z A;  1YCS B;  1D3B A;  4J7F A;  1NEB A;  1VQ9 Q;  1SSF A;  4ZGJ B;  1W2B S;  1VQ9 T;  2EQI A;  2HEQ A;  3CPW P;  1UGP B;  2M1H A;  4F7U E;  5CAI A;  2AZS A;  1QVG S;  1GFD A;  1AWX A;  1VQ6 T;  1Y0M A;  1YBY A;  2JM9 A;  1M90 U;  3VKI A;  3GNG A;  4JLG A;  1WI7 A;  4C8Q E;  2EQJ A;  4J5Y A;  2ZAE A;  4IIO A;  1U1S A;  4BI3 A;  4Z88 A;  1OUL A;  1ZX6 A;  2LZ6 B;  4KH0 B;  2CH4 W;  4K11 A;  1ZUU A;  1WDX A;  1JQQ A;  1U5S A;  1YIT Q;  4PJO B;  2AT1 B;  4M75 F;  3EG1 A;  3JCM W;  1RAC B;  2KXD A;  1YP5 A;  3SB2 A;  1V29 B;  1I07 A;  2JW4 A;  2LDM A;  4DEX A;  2E1H A;  1W2B P;  3QPH A;  2AKK A;  3CCR A;  1X2K A;  2BZY A;  3EHQ A;  1H64 1;  1T0J A;  3M0T A;  3NFC A;  1QVG P;  3CD6 Q;  1D1C A;  4KUI A;  4O6J A;  4C8Q C;  3TRE A;  5GAO m;  1VYV A;  1G2B A;  2ZPB B;  2P84 A;  3GIB A;  1QCF A;  1PM3 A;  2SRC A;  3EGX B;  1BKB A;  2NWM A;  3MJX A;  5AT1 B;  2JTE A;  1D3B B;  2X4Y A;  3QYH B;  2K4Y A;  1XNI A;  2V8J A;  4II1 A;  1BI1 A;  5A0G A;  3AT1 B;  3CME Q;  1YIJ A;  1QCN A;  4C5E A;  2MWO A;  1RLP C;  2QG9 B;  4RTU A;  4BD3 A;  2RI3 A;  4JJN K;  2RD1 A;  4PLL A;  2KSS A;  4BI8 B;  3HTR A;  2O9V A;  3FC3 A;  1A0N B;  2DXT A;  3NPF A;  4BE1 A;  1VQP A;  4RTW A;  2HSE B;  2A3L A;  1PRM C;  1VQ8 A;  2OTJ A;  3FRN A;  1AWJ A;  3JCM V;  1PC0 A;  4C5G A;  5KE2 A;  2BIV A;  2QK0 A;  4JZ3 A;  4CRI A;  3EAE A;  4QT7 A;  1NLP C;  4JS5 A;  2RQU A;  4HCZ A;  1X6G A;  1NJI C;  2CP0 A;  4FYY B;  1SPK A;  4PFP A;  4FW1 A;  5GAM e;  2H8H A;  1B34 A;  4M78 G;  3PE0 A;  2BKD N;  2NUP A;  4M7A E;  4M77 E;  1GXI E;  3EGU A;  3FJP A;  3RES A;  2K5F A;  2RF0 A;  1M9S A;  4Y28 E;  5GAM j;  1VQ4 Q;  1WHK A;  1T0H A;  1VQ4 T;  1M8M A;  1OPK A;  1GCQ C;  1JEG A;  3OW2 A;  2DL4 A;  4MZM A;  2M16 A;  1ZBX A;  2F2V A;  1UFF A;  4ZTF A;  2EKH A;  3JV3 A;  2CP7 A;  3SEM A;  2QEX A;  2K7A A;  2EJ9 A;  3M0Q A;  3GNF B;  3VYH B;  4F7U G;  4PJM A;  1M1K R;  2JVV A;  1TWB A;  2PQW A;  3D7S B;  4JLI A;  2QTV A;  3PVQ A;  3UA7 A;  4C8Q G;  4IUV A;  5GAO p;  4LDX A;  1YJ9 T;  1X01 A;  3NTI A;  4B9X A;  4OMF B;  3I55 T;  1SSH A;  4M7A C;  2VGM A;  3ZL7 C;  4OP0 A;  2PTK A;  5HK0 A;  3OYC A;  3OYL A;  2JT4 A;  4QVD A;  4J9H A;  1EZZ B;  2FZG B;  2RK2 A;  1M3B A;  2FB7 A;  2QGG A;  3M4Y A;  1Z9Z A;  4DBH A;  1Y07 A;  2RJD A;  2CUB A;  2KRN A;  5LJ5 d;  2DEQ A;  2F5T X;  2E5Q A;  2M51 A;  2E41 A;  2KRS A;  3E19 A;  3HRS A;  3CCS A;  1B07 A;  3R6N A;  5FWC A;  1B34 B;  2JS2 A;  1YJW Q;  3G1J A;  1G3S A;  4J9D A;  2NUP B;  4M78 A;  5KYY B;  2EQU A;  1R0B G;  4C92 A;  3CCL A;  2E6N A;  3H0H A;  4BE2 A;  4N4G A;  2CZ7 B;  1D09 B;  1OU9 A;  2RHX A;  4PJO D;  2QA4 A;  3QHS A;  5CQY A;  3M57 A;  4C0Z A;  3OS0 A;  3EG3 A;  1VIF A;  2K9G A;  3M56 A;  3QZ9 B;  1HYO A;  2OAU A;  5IHK A;  3NHN A;  1MUZ A;  3VRZ A;  1QQJ A;  1N8R C;  1WJR A;  4OGE A;  1GRI A;  1F1B B;  3A8L B;  4PJJ A;  4F7U A;  2H3J A;  1Q86 R;  2EGC A;  2ZPE B;  1VQ9 A;  4IUT A;  2Y90 A;  5LJ3 e;  2CSI A;  2EWN A;  2D1X A;  3X26 B;  1I8F A;  5A0L A;  3LH0 A;  4E7J A;  2LQ8 A;  4C8Q A;  2NLU A;  3CC7 Q;  3RMS A;  2YHT A;  3VS1 A;  5HKC A;  3C95 A;  3QUI A;  1YHQ Q;  2LT1 A;  2XDP A;  2VB6 A;  2KT1 A;  1K9M C;  3GOX A;  1JJ2 S;  2E4H A;  1DJ7 B;  3GF5 A;  3H0F A;  1LCK A;  5GAO l;  3ZEH A;  1N9S A;  2KE9 A;  4M7A G;  1KHC A;  1G5V A;  4WF2 A;  4R55 A;  1UTI A;  4JRP A;  3INZ A;  1YIT A;  3UAT A;  2LTO A;  3VS2 A;  5GAM g;  3KXT A;  1H92 A;  1FX7 A;  2F1L A;  1J3T A;  2GFA A;  4JRQ A;  2DL8 A;  4GLM A;  1UUE A;  4L59 A;  1YN8 A;  3OYN A;  4M78 B;  3ZBD A;  2MPX C;  4J9F A;  5GMK i;  4PJO C;  1ZA1 B;  4LUE A;  2DL7 A;  2CKK A;  3CPW A;  1M2V A;  4PFZ A;  5DM7 R;  2DZC A;  2NUZ A;  1PKT A;  3A1P A;  4LD6 A;  2JM8 A;  3M5A A;  2F5K A;  1YWP A;  1K73 R;  4PJN A;  3M0R A;  4LUD A;  1Y96 A;  2VV5 A;  3VYG A;  2ZPG B;  3RDV A;  2DRK A;  2LNV A;  4IUP A;  2NUT A;  1PG5 B;  1Q82 U;  4MDW A;  1R8O B;  1WZO A;  1BI2 A;  1K8A U;  1KSW A;  1SHF A;  2GTO A;  2KR3 A;  1K1Z A;  2DFU A;  3NTK A;  1OQK A;  2QYZ A;  2YRV A;  1AEY A;  4F7U B;  2LQK A;  2KEA A;  2KVQ G;  3H9N A;  2VWF A;  1X6O A;  1H8K A;  4CC7 A;  1NZ9 A;  2RQT A;  1JBM A;  4C8Q B;  1YFN A;  4BY6 B;  3EFO A;  4IKF A;  2CP5 A;  3HRT A;  2L2P A;  1TS9 A;  4QQG A;  3DB3 A;  3IQL A;  4F16 A;  3EG9 A; 
#chains in the Genus database with same CATH homology
 4JPB W;  2ENM A;  1JXM A;  2EGA A;  2YDL A;  1ZSG A;  1VA7 A;  3I35 A;  4OMM A;  1CSK A;  1X2Q A;  1E7O A;  2ROT A;  2VKN A;  4JZ4 A;  3REA B;  2DL5 A;  2LX7 A;  2SEM A;  1K9A A;  2JMA A;  2I0N A;  4OMN A;  2CSQ A;  4Y92 A;  2AZV A;  2J6O A;  4D8D A;  2ED0 A;  1OV3 A;  3NMZ C;  3TVT A;  4CC2 A;  3NGP A;  1T3S A;  2K79 A;  2D8H A;  3ULR B;  2FRY A;  4ZNX A;  1WIE A;  1T3L A;  2K3B A;  2KT8 A;  2YUP A;  1X27 A;  2OI3 A;  1BU1 A;  1K76 A;  3VS4 A;  5IXF A;  2GBQ A;  1AZG B;  4ESR A;  4HVU A;  1NLO C;  2HSP A;  1PWT A;  2DYB A;  3QWX X;  1PNJ A;  3VS6 A;  1RI9 A;  1GBR A;  3M0S A;  2KRM A;  2O31 A;  4X1V A;  2OAW A;  2RN8 A;  2ABL A;  2W0Z A;  1YCS B;  1QKX A;  2EYW A;  1UEC A;  3UA6 A;  4LE9 A;  1GCP A;  1NEB A;  3CQT A;  2DLP A;  4OML A;  2MIO A;  2O9S A;  4DEY A;  2EQI A;  2HEQ A;  1CKB A;  2AZS A;  4M4Z A;  1GFD A;  1AWX A;  1H3H A;  2AKL A;  2KNB B;  3RNJ A;  5I22 A;  1Y0M A;  3VRY A;  2JM9 A;  4D8K A;  1ABO A;  2KRO A;  4AFS C;  1WI7 A;  2HCK A;  1WLP B;  1GFC A;  4IIO A;  2QDL A;  3TSW A;  2IIM A;  1HSQ A;  2ECZ A;  2L3P A;  4RTZ A;  1VYT A;  2C0T A;  4Z88 A;  1XOV A;  1JO8 A;  1ZX6 A;  2LZ6 B;  2CH4 W;  1AD5 A;  2DA9 A;  2CUD A;  3QWY A;  4K11 A;  1S1N A;  1ZUU A;  2CH4 A;  1WDX A;  2DX1 A;  1JQQ A;  2EVR A;  1U5S A;  3RBB B;  2ROL A;  3VS7 A;  1M30 A;  2GGR A;  1TG0 A;  3EG1 A;  4RTX A;  3UF4 A;  2KYB A;  4JJC A;  2A37 A;  2YUN A;  1SEM A;  1I0C A;  5FW9 A;  1OPL A;  1EFN A;  2KXD A;  1YP5 A;  1K0S A;  2KGT A;  1GL5 A;  1I07 A;  1U06 A;  2JW4 A;  4DEX A;  3FJ5 A;  3VS5 A;  2AKK A;  2X3X D;  3KFV A;  4RTY A;  1X2K A;  2BZY A;  3EHQ A;  4AG2 C;  2AK5 A;  3C0C A;  1T0J A;  2EYZ A;  1ABQ A;  3M0T A;  1ZUK A;  4J9B A;  1M3A A;  2C0O A;  4F17 A;  1WXT A;  1VYV A;  1G2B A;  3TSZ A;  2V1Q A;  1QCF A;  4ORZ A;  2BTT A;  1M3C A;  2SRC A;  2KBT A;  2DMO A;  5IHN A;  2NWM A;  3A98 A;  2JTE A;  1V1C A;  2YSQ A;  2F2X A;  5IXB A;  2ESW A;  1UG1 A;  2DM1 A;  4AFZ C;  2DRM A;  3LH5 A;  2LCS A;  2GQI A;  1IO6 A;  1AWO A;  1RLP C;  3H41 A;  4RTU A;  4J9E A;  2LMJ A;  1UJY A;  1VYU A;  2FO0 A;  1NYF A;  3GBQ A;  2O9V A;  1A0N B;  3NPF A;  4RTW A;  2FPF A;  2LJ0 A;  2FEI A;  2CRE A;  2PNI A;  1WYX A;  1PRM C;  1PKS A;  2BZX A;  2BZ8 A;  1CKA A;  4AFU C;  1WA7 A;  1AWJ A;  3SHW A;  4E6R A;  2YT6 A;  2DBM A;  2A36 A;  4JJB A;  4JZ3 A;  4QT7 A;  4AG1 C;  1NLP C;  2RQU A;  2MCN A;  1X6G A;  1SPK A;  4R0K A;  2LNH B;  1FMK A;  2K2M A;  1QWF A;  2H8H A;  3PE0 A;  1GBQ A;  1YWO A;  3EGU A;  1BB9 A;  3O5Z A;  2RF0 A;  1X43 A;  2YUQ A;  3I5S A;  1RUW A;  4HXJ A;  2J7I A;  2J05 A;  4Z8A A;  1MV3 A;  1T0H A;  1RLQ C;  2J06 A;  2RQV A;  1M8M A;  1OPK A;  3REB B;  1GCQ C;  1JEG A;  2DL3 A;  2DL4 A;  1MV0 B;  1UGV A;  2J6F A;  4RUG A;  1K4U S;  2F2V A;  1UFF A;  2EKH A;  3JV3 A;  5HCK A;  2V1R A;  5GJV B;  1YNZ A;  3SEM A;  2K6D A;  2K7A A;  1ARK A;  1W6X A;  3M0Q A;  2DBK A;  1AWW A;  2EYY A;  2MOX A;  2KXC A;  1W70 A;  5ECA A;  2RMO A;  3PVQ A;  1ZLM A;  3UA7 A;  4CC4 B;  2CT3 A;  1FYN A;  1E6G A;  1TUD A;  1X6B A;  1SSH A;  3I5R A;  5IH2 A;  2HDA A;  3ZL7 C;  1Y57 A;  4HVW A;  4J9G A;  2PTK A;  3VS0 A;  1AZE A;  2LJ1 A;  2JT4 A;  5I11 A;  5GJW B;  4J9H A;  2L3Q A;  1M3B A;  3I9Q A;  1JXO A;  1SRL A;  1Z9Z A;  1AVZ C;  2D8J A;  2M0Y A;  2CUB A;  2KRN A;  2EW3 A;  4OMO A;  2M51 A;  1HJD A;  1GCQ A;  2KRS A;  2LQN A;  1W1F A;  2KYM A;  1B07 A;  2RQW A;  3R6N A;  5FWC A;  2JS2 A;  4J9D A;  1N5Z A;  1G83 A;  2P4R A;  3U23 A;  2X3W D;  1PHT A;  3H0H A;  2DNU A;  2RPN A;  4OMP A;  1BK2 A;  2JS0 A;  2LJ3 A;  4KRT A;  3EG3 A;  1JU5 C;  5L23 A;  1K0X A;  2FPE A;  2K9G A;  3THK A;  1SRM A;  2YUO A;  2JMC A;  2D0N A;  2FRW A;  5IHK A;  4JJD A;  3NHN A;  1ZUY A;  2FPD A;  1MUZ A;  4A63 B;  3VRZ A;  2VVK A;  4CC3 A;  2RNA A;  2LQW A;  1GRI A;  2O2O A;  2DF6 A;  3PVL A;  1NG2 A;  4RTT A;  2EBP A;  2W10 A;  1UJ0 A;  2EGE A;  2EGC A;  2GNC A;  3H0I A;  2CSI A;  2B86 A;  1OEB A;  2D1X A;  1WXU A;  4EIK A;  1E6H A;  2ED1 A;  1PRL C;  1KFZ A;  3VS1 A;  2L0A A;  1UHC A;  1NYG A;  3M0P A;  2DIL A;  1HD3 A;  1BBZ A;  2KT1 A;  4LN2 A;  2G6F X;  3H0F A;  1LCK A;  5EC7 A;  1ZBJ A;  2DE0 X;  2EPD A;  2OJ2 A;  2KE9 A;  4LNP A;  4J9C A;  1B3Q A;  1UTI A;  2CDT A;  1QKW A;  2F2W A;  3UAT A;  3VS2 A;  2C0I A;  1H92 A;  1J3T A;  1U3O A;  2DL8 A;  4GLM A;  1UUE A;  1M27 C;  1QLY A;  1Z9Q A;  1YN8 A;  2JXB A;  2J6K A;  2O88 A;  1KJW A;  2RQR A;  3M0U A;  4J9F A;  1AOJ A;  3EG0 A;  4LUE A;  3VS3 A;  2DL7 A;  2DVJ A;  1I1J A;  1SHG A;  1KIK A;  3EG2 A;  2XMF A;  2NUZ A;  1PKT A;  5IHI A;  1WX6 A;  1OOT A;  2JM8 A;  4HCK A;  2CT4 A;  4OMQ A;  1YWP A;  1UDL A;  4F14 A;  2A28 A;  3M0R A;  4LUD A;  2GTJ A;  2DRK A;  4WCI A;  4GBQ A;  1WXB A;  5FWB A;  4J9I A;  4RTV A;  2L3S A;  1WFW A;  1KSW A;  1X69 A;  1TUC A;  1SHF A;  2GTO A;  2KR3 A;  1K1Z A;  2HBW A;  1NEG A;  1AEY A;  2EYX A;  4Z89 A;  3EHR A;  4HVV A;  2KEA A;  1UE9 A;  2VWF A;  1H8K A;  4CC7 A;  2RQT A;  4AFQ C;  2LP5 A;  1UHF A;  1NM7 A;  2E5K A;  2A08 A;  2L2P A;  1QWE A;  2PZ1 A;  4IIM A;  3IQL A;  4FSS A;  2FG0 A;  4F16 A;  2DJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...