1GCQA

Crystal structure of vav and grb2 sh3 domains
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
STYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/signaling protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Novel recognition mode between Vav and Grb2 SH3 domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gcqA00
1VYUA 1GBRA 4AFZC 3REBB 4JJBA 1WA7A 4OMMA 1X6GA 1E7OA 1Z9ZA 3VS6A 2CT3A 1NYGA 2DL7A 1LCKA 2F2XA 1T3LA 2A37A 3VRZA 3PE0A 3ULRB 1RLQC 3EG2A 1HSQA 2K2MA 2BTTA 3H0FA 2JMAA 5HCKA 2EYYA 3UATA 4RTXA 2H8HA 1JXMA 1OPKA 2HDAA 2KT1A 2LQNA 1SRMA 2DLPA 2EQIA 3VS0A 4AFQC 1VA7A 4RTWA 2YUOA 2HBWA 2A36A 1W70A 2EGAA 2KNBB 1AWJA 1GBQA 4OMOA 4J9EA 2RF0A 3QWXX 2CUDA 2ED1A 2GQIA 1UHCA 1WFWA 2LQWA 1AOJA 4RUGA 5I11A 3H0IA 1W6XA 2EGEA 2YUPA 2FRYA 2FO0A 2JTEA 2YDLA 2DBKA 4HVUA 2JM9A 2BZYA 1AZEA 1OEBA 3VS7A 1JU5C 1CKAA 2LZ6B 2VKNA 1GFDA 1MV0B 1SHFA 1T3SA 1Y0MA 1ZSGA 5IHKA 4JJCA 3TSWA 2EKHA 2AZSA 2KXDA 4M4ZA 2JS2A 4ORZA 1WXUA 1ABQA 1X43A 1GCQA 4JZ4A 1ZUKA 2MIOA 4LNPA 4RTVA 2XMFA 2C0TA 3VS3A 2DVJA 1K76A 2EYXA 3IQLA 4AFSC 2DRMA 4Y92A 3SEMA 1TG0A 2DRKA 3ZL7C 1K0XA 1A0NB 2GBQA 1YWPA 1GRIA 3UA6A 1ZBJA 5FWCA 3I9QA 1M27C 4Z89A 2J6OA 1WLPB 4JPBW 2M51A 2C0IA 4LN2A 1M30A 1VYTA 4Z8AA 3EHRA 2DBMA 2J6FA 1SHGA 2CDTA 1AWWA 1K4US 2FRWA 1TUDA 2AK5A 2YUNA 3M0QA 2KROA 1T0HA 2HSPA 2K7AA 4JJDA 2DF6A 1T0JA 1OV3A 2KYMA 4J9IA 4E6RA 2FPFA 3EGUA 2L2PA 1YWOA 3NGPA 1CKBA 3RBBB 2CH4W 2RPNA 2SRCA 1ARKA 2J6KA 3PVQA 2CH4A 2L3PA 2RMOA 5FW9A 2FEIA 1OPLA 1NLPC 1M3CA 1ZUUA 2O31A 1WI7A 2M0YA 2V1QA 1K1ZA 4OMNA 3VS1A 1PWTA 5FWBA 1V1CA 3NPFA 2KEAA 4F17A 2D0NA 1G83A 2E5KA 5ECAA 2FPEA 1RLPC 1WXTA 1X2KA 3NHNA 3H0HA 4QT7A 2K6DA 1WYXA 4EIKA 1NG2A 2DYBA 2YSQA 1YCSB 2NWMA 2RN8A 1QWEA 2F2WA 2LP5A 2DL5A 2EW3A 2EBPA 2LJ1A 2ROLA 2O2OA 4HVVA 2G6FX 4D8DA 1UE9A 3EG1A 1PHTA 1AD5A 1JEGA 2IIMA 4IIOA 4X1VA 2MOXA 1X69A 1FYNA 2RQTA 2FPDA 1NEBA 1H8KA 2ESWA 3JV3A 2EPDA 2ED0A 2JMCA 5IXBA 4RTUA 3CQTA 2X3WD 5IH2A 4CC4B 1U06A 2GTJA 2SEMA 2JM8A 4OMQA 1CSKA 1EFNA 1B07A 2DJQA 4K11A 1JQQA 4J9GA 1KIKA 2LNHB 2W10A 4F14A 3M0SA 1ZLMA 2KRMA 5L23A 1M8MA 2KGTA 2KR3A 1MUZA 1WXBA 1AEYA 1AZGB 1OOTA 1YP5A 2ABLA 1AVZC 2HEQA 2I0NA 3PVLA 1N5ZA 1GCPA 2HCKA 3EG0A 1E6GA 3M0TA 1X27A 1PRMC 1VYVA 1JXOA 1I1JA 1AWXA 5IHNA 1SPKA 2OAWA 2ROTA 4Z88A 1SRLA 1NEGA 3REAB 1UDLA 1Y57A 1KJWA 1GFCA 2O9SA 1UECA 2O88A 4DEYA 4RTYA 3R6NA 2PNIA 1M3AA 1AWOA 1WX6A 2D1XA 4J9BA 3SHWA 2LX7A 2DMOA 2CT4A 1BU1A 1ZUYA 3U23A 1HD3A 2V1RA 4RTZA 1Z9QA 4ESRA 2F2VA 4OMLA 1GCQC 2ENMA 1HJDA 4HXJA 1KSWA 3KFVA 3C0CA 2DL8A 2KRNA 2DA9A 1IO6A 1ABOA 4J9DA 1G2BA 2JT4A 2DE0X 5I22A 2EGCA 4J9CA 2OI3A 3M0PA 4GBQA 2DNUA 2B86A 1PKTA 2DX1A 4LUDA 1M3BA 1U3OA 2CREA 1UGVA 3THKA 2GNCA 4F16A 2PZ1A 4HVWA 2KXCA 5IXFA 4R0KA 2FG0A 4J9HA 1J3TA 1UJ0A 2AKKA 4GLMA 2VVKA 3I5SA 1X2QA 4AG1C 2MCNA 1RUWA 2JS0A 2A28A 3VRYA 1ZX6A 1I0CA 1BK2A 3EG3A 2C0OA 5EC7A 3TSZA 4RTTA 3I35A 3A98A 3QWYA 2LJ0A 1W1FA 1SSHA 2OJ2A 4D8KA 5GJVB 2K3BA 2PTKA 1UJYA 4WCIA 3VS5A 2J05A 2RQWA 2CUBA 3H41A 2D8JA 2VWFA 1RI9A 2KE9A 3M0UA 4LUEA 1MV3A 2RQUA 2KT8A 4JZ3A 1WIEA 2P4RA 1XOVA 2KBTA 1E6HA 1WDXA 3VS4A 1UG1A 3EHQA 1H92A 2RNAA 2KRSA 2LCSA 4OMPA 1KFZA 1QLYA 1FMKA 3UF4A 1UTIA 3UA7A 3I5RA 3RNJA 2AZVA 2LJ3A 3LH5A 2W0ZA 1NYFA 2RQVA 2NUZA 1BBZA 2GTOA 4AFUC 2ECZA 4A63B 4J9FA 2A08A 2L3QA 4FSSA 2DM1A 4HCKA 2D8HA 1NLOC 2EVRA 2L0AA 1PNJA 2L3SA 4AG2C 2EYWA 1QKXA 3GBQA 2J7IA 2LMJA 4ZNXA 1X6BA 1UUEA 2DILA 1QKWA 3FJ5A 1QWFA 1GL5A 1YNZA 4IIMA 2BZXA 2YT6A 2QDLA 2RQRA 2DL3A 3VS2A 1S1NA 2CSIA 2K79A 1K9AA 1UHFA 3M0RA 2BZ8A 1SEMA 2KYBA 3NMZC 1NM7A 1TUCA 2X3XD 3TVTA 2K9GA 1PRLC 2DL4A 4CC3A 1I07A 2O9VA 1B3QA 1U5SA 2YUQA 1H3HA 2AKLA 4CC2A 1UFFA 1PKSA 4LE9A 5IHIA 2J06A 3O5ZA 1JO8A 1QCFA 4KRTA 4DEXA 2GGRA 2CSQA 1K0SA 1BB9A 4CC7A 5GJWB 2JW4A 1YN8A 2EYZA 2JXBA
chains in the Genus database with same CATH superfamily
1VYUA 3INZA 5GAN6 2QG9B 3JB9I 4MZTA 2P84A 2CT3A 1QP2A 1LCKA 3S3MA 2K57A 1T3LA 3VRZA 1M2VB 3EG2A 4BB7A 2JMAA 2EYYA 2H8HA 1JXMA 1W4SA 2WSCE 2KT1A 4E47A 2LQNA 2VXFA 2DD5A 1JJ2A 1VA7A 4EDUA 5GAOn 2XICA 5IN1A 2A36A 4DBQA 2HQXA 3M57A 1RAIB 3MO8A 2H3JA 1VQLT 2CUDA 3OYMA 2ED1A 1UHCA 2DAQA 3JSCA 2BIVA 2QQRA 1YJWT 2EGEA 3DLMA 2YUPA 1S72A 2FRYA 3G71A 2DXBA 2FO0A 4HVUA 1Q7YC 3JCMX 3CPFA 3CCJT 1B34A 2QGGA 1YITA 3RKXA 2LZ6B 3CCMQ 4QKUA 3HRTA 4M7AE 2EKHA 1YIJT 4ORZA 2E10A 2QTXA 1ABQA 1YHQQ 1VIEA 2MIOA 4LNPA 4RTVA 5GANh 4C92E 1SF9A 4A53A 2OX7A 3OYLA 1K76A 4AFSC 2COYA 2L89A 4CRIA 4Y92A 1TG0A 1TH7A 1EX4A 4N0AC 1NBEB 2RJEA 2M1HA 3JCMV 4PJOA 3FEOA 1VQOQ 4M7DD 2XDDA 4LN2A 1M30A 1GXIE 2PU9B 1XTDA 4Z8AA 4C8QD 3EHRA 4JS4A 2WACA 2QA4T 1AT1B 2FVUA 3META 2Y4XA 3A1PA 2KROA 2QAZA 3TCJA 2HSPA 1M5Q1 1G3WA 4JJDA 4BDYA 3JCMQ 2CP5A 1WHKA 3VUZA 1OI1A 1O9SA 2CZ0B 2QTVA 1Q82U 4P5NA 1W2BS 4E7JA 4E6RA 3ZEHA 5I21A 2L2PA 1CKBA 1I5LA 3M4YA 2EWNA 2CP0A 3QKJA 4A4EA 2L3PA 3VUBA 3URGA 2MWOA 2K4YA 2K2VA 2OTLT 3G6ET 2LT1A 3PMIA 5LL6S 3X28B 2DEUA 3MP1A 3CCMA 2RK2A 4JS5A 1MNEA 4JUVA 1ZUUA 2P0KA 1WI7A 3OW2P 1K9MC 5GAN4 1K1ZA 3QZ9B 3TU4K 1YHQA 3VS1A 1V1CA 2ZCFB 4IURA 4QVCA 1ZHIA 3NPFA 2RI2A 5ECAA 5L8RE 1WXTA 2GF7A 4HKEA 1D3BA 1Y71A 3SFMA 2YSQA 3Q1JA 3RESA 1YCSB 4IUVA 5CIUA 3PIOA 4IKFA 1OZ3A 1NPRA 2RN8A 2KI7A 1QWEA 1Q86R 2PUOB 2YXYA 4F7UE 1V76A 3MEVA 2LJ1A 3QXEB 2EJ9A 5HK0A 4HVVA 1LNXA 4C5EA 4DA4A 1WGSA 1QVGA 3HFOA 5CKEA 1I81A 4M7DA 2COWA 4IIOA 2NUPB 4RCBA 3CC2A 1X69A 1G5VA 4NL3A 2E3HA 4C8QA 3CCLQ 3I56T 3G4SQ 3RDVA 4EMKC 1OQKA 3JCMW 1H8KA 2YLBA 2NUTA 2ED0A 1YI2T 3EFSA 5IH2A 2LCLA 2SEMA 1B07A 1M8VA 4XTZA 2K5FA 2W10A 1NJIC 2DETA 2BE9B 4TVRA 3E9GA 2KRMA 5L23A 1M8MA 2KGTA 3LWIA 5KYWB 1YJ9T 1ZSZB 1Q95G 5KYYB 3I55T 4A4GA 4AT1B 2I0NA 1N5ZA 4LDWA 2AHJB 3NTKA 1PD0A 2HCKA 1E6GA 4N4GA 5LJ5f 5A0LA 2XI9A 3CCET 4R56A 4EMGA 2D0QB 2EJFA 2XDPA 1Y57A 1KJWA 4KH1B 4BE2A 2F5KA 4A4KA 3CCSQ 3L2RA 2E41A 4KGXB 2QEXQ 1IXDA 4ZTJA 1WX6A 4LD9K 2LX7A 1BU1A 5CO7A 1W2BP 4M77C 2XK0A 4ESRA 2HQEA 3ASKA 5LJ5e 2L8DA 4HXJA 1MMAA 4FIBA 1IB8A 3C0CA 2V8JA 3PMTA 1ABOA 4J9DA 2DERA 2JT4A 3OS1A 1D0ZA 4ZGEB 3LH0A 1PKTA 2RK1A 1ZA1B 2BUDA 4PL6A 1U3OA 1UGVA 4D6WA 1RAFB 3JCMh 1WHJA 1OU9A 4PJOF 2PZ1A 4HVWA 4R0KA 1J3TA 1UJ0A 1K73U 3CC4T 3I5SA 5KH6A 4AG1C 2JUFA 2MCNA 4M78F 1FWZA 5LJ3f 2F5TX 4ELZC 2RHUA 2JJ9A 2DIGA 3M4GA 4N0AA 3OBYA 1BCMA 3PIPA 3I35A 2OTLA 3KXTA 4FW1A 2OJ2A 4D8KA 2PTKA 2CZ1B 1D0XA 4PLLA 3MP6A 2DPPB 3SWNB 2KE9A 2DTOA 4LUEA 1MV3A 2RQUA 3L2ZA 2KT8A 4BACA 4JJNK 1ZSZC 3CCSA 5LJ3e 2QEXA 3CPWA 4C92B 4M78B 1MMNA 5I2MA 4OMPA 2LTOA 2VB6A 1UTIA 3X20B 2RI3A 1G3YA 5LJ5d 1TU0B 3CMAQ 2RQVA 3CCVT 1VQ5Q 2FL7A 1M9SA 4FSSA 2D8HA 5CCAA 2EVRA 3OS2A 1TSFA 3FIFA 2JTMA 2L0AA 3VU3C 1QVFS 4B9XA 2EYWA 2WSEE 4PFZA 3OYBA 2LMJA 2RHYA 1X6BA 3EG9B 4DQ2A 3P8HA 2EFIA 1QKWA 1Q82R 4PKCC 2GQVA 3V8JA 2ATCB 4KH0B 3MJXA 3CEYA 5GAN2 1WHLA 4NOYA 2DL3A 3OYKA 2EQMA 5FLXE 1SEMA 4J83A 4PNOA 4PK4A 1TUCA 3TVTA 3LX7A 2RD1A 3DKMA 1U5SA 2YUQA 3UPUA 1H3HA 1YBYA 2V8KA 4LXCA 5LJ5g 2EQKA 1JO8A 1QCFA 4DEXA 3OYGA 2CSQA 3CCEA 3PFSA 1M90U 1BB9A 5AT1B 2JW4A 3HL8A 1WPYA 4EMKA 2EYZA 1ZSGA 2JXBA 2L3RA 1WJSA 4AFZC 3G71T 3REBB 1GBRA 4OMMA 5LJ3d 5GAN8 1YITT 1WNLA 1VQNQ 3BE3A 1OZ2A 2DO3A 3DB3A 2V8IA 1VQ5A 2DLPA 2EQIA 3CBPA 4M7AC 4AFQC 4RTWA 4F7UB 3OSSC 3FLGA 3RKYA 2HBWA 4DOWA 1W70A 1VQ8Q 1AWJA 4EPCA 4OMOA 4C92C 2RF0A 4C92G 4M78G 2I2LA 3RKWA 3H0IA 3GPLA 4E7KA 3LLRA 4LDYA 4MZMA 2JTEA 2YDLA 2JN0A 2DXUA 2HSEB 4C0GA 2BZYA 3CC7A 1G8XA 3CXCP 4QVDA 3VS7A 1CKAA 1XQHA 1GFDA 1LJOA 1MV0B 1Q81R 3KBGA 1TUGB 3J7AF 5LJ3g 5IHKA 3A5ZB 2DYIA 2ZPGB 5DM7R 3L1AA 4M77A 3RUXA 4M4ZA 1WXUA 1X43A 4VUBA 1ZUKA 1UGQB 3CMEA 2DVJA 2EYXA 2P0QA 2RJDA 3SEMA 4XAXB 3A8GB 4LDVA 3SB2A 4BY6B 3C4SA 2DRKA 3ZL7C 2VYTA 1Q86C 3QUIA 1YWPA 1GRIA 5FWCA 1YJNQ 3I9QA 5KYNA 2ZGWA 1VQNA 4JPBW 2M51A 2O4XB 4GLKA 3CCMT 1VYTA 2NUPA 1SKUB 4RKUE 2DJZA 2DBMA 1VOMA 1IZ6A 1SHGA 1W2BA 2CDTA 3MP8A 1YHQT 2AK5A 2CP3A 2YUNA 5FU6B 1TXQA 4DBRA 1TWBA 3NFCA 2DF6A 3QG1A 1T0JA 3E2UA 4XU1A 4OB1B 4PLIA 2MYSA 4FYVB 1RAAB 4GY5A 1M1KU 2FPFA 1NZ9A 3EFRA 3EGUA 3P8DA 1OX9A 3J81E 2J6KA 1ZSZA 5KYYA 1K73R 3ZFJA 3WXMB 1NLPC 4F7UG 3OW2S 3CC2T 3ME9A 1M3CA 1SSFA 3OBWA 3OA6A 3M5AA 1WJQA 2V1QA 4M7AD 3M9QA 2CGHA 2NYSA 3M56A 1M1FA 5J39A 2FPEA 1RLPC 4C92D 3H0HA 4FYWB 2K6DA 1NG2A 3QDFA 2EJGA 1YJNA 1N8RR 1KC8R 2LP5A 5DLOA 4J6WA 4ZTFA 2O2OA 2V26A 4MMKA 3EH2A 4DOVA 5LJ5j 3C12A 4JDSA 4X1VA 2MOXA 2QASA 4E7HA 3DB4A 3C95A 2E70A 4O5VA 4BY6C 3CCQQ 2JOYA 2RQTA 2LX9A 4EMHA 4OMFB 2JNGA 1I8FA 1NEBA 3S6WA 2CS7A 1WQWA 4FL6A 2EPDA 4M78E 4RTUA 4M75A 4FM4B 4ANJA 1MNDA 2HZYA 1VQ6Q 2JM8A 4ME7A 4OMQA 1EFNA 1V29B 4K11A 5GAOp 1JQQA 4HCBA 1KIKA 2LNHB 3M0SA 5FU7C 1D0YA 1QMCA 1WXBA 2K5LA 3FB9A 4E7ZA 1AZGB 1C6VX 2KK4A 1YP5A 1AVZC 3OSVA 3HHTB 1GCPA 3NTIA 3CCLT 1QCOA 3M0TA 1X27A 1PRMC 1JXOA 3OYCA 1RL2A 1AWXA 3M55A 5IHNA 2XDBA 2DTHA 2XIDA 2ROTA 4BE1A 1KD1U 4Z88A 1VQKQ 1LVKA 3REAB 4ZN3A 4FT4A 5GMKj 3EFOB 4M7AA 1RAHB 3MEUA 2R5MA 1M90R 3CCUQ 2O9SA 1UECA 4DEYA 1G3SA 3R6NA 1AWOA 3GNGA 3HRSA 5D7UA 4DBHA 3CBOA 5LJ3j 3ZBDA 1HD3A 4RTZA 1VQ9Q 2LC4A 4II1A 1GCQC 4X9CA 2GFUA 4M77F 4E7SA 3CCQA 1IO6A 1G2BA 2DE0X 2OI3A 3M0PA 5CQYA 3PNWC 2DNUA 1AHJB 2MWPA 2DEQA 1Q82C 1M3BA 4OVAA 3CCST 3THKA 2OTJQ 2DVEA 2GNCA 1VQ7Q 1FMWA 2ZZDA 2QEXT 1UGPB 1VQ6A 5IAYA 2FG0A 4J9HA 2ZPIB 3CCJQ 1KHIA 2AKKA 4GLMA 4QQ6A 1U8RA 1X2QA 5HKCA 2K3XA 2A28A 1VQOA 2QDYB 4J7IA 5A0GA 1IGUA 2M9UA 5EC7A 2C0OA 1MMGA 2E64A 2QGFB 3TSZA 4BUGA 2A3LA 3UWNA 3A98A 1SSHA 5GJVB 2KY9A 2K3BA 4KUIA 1VQPQ 3V8KA 2CUBA 3H41A 2D8JA 4XTVA 3M53A 3JB9F 5CK9A 4JZ3A 1WIEA 3CCUA 1MHNA 3A8MB 4JLIA 1XOVA 1K8AR 1E6HA 1WDXA 4LD6A 1QQJA 4BD3A 1M4ZA 1H92A 2RNAA 1VQ4Q 2BKDN 4RMOA 1QVFA 3LGFA 1FMKA 3UF4A 3UA7A 3QSUA 3RNJA 3SD4A 2QA4Q 1Q81U 4F7UA 4J9FA 2A08A 2QXFA 5HK3A 3PT9A 1VQMQ 2EIFA 3OYNA 4HT8A 4J8OA 1PD1A 2KSSA 5GAN3 3GBQA 4KGZB 4ZNXA 1MGQA 2OTJA 1UUEA 3UT1A 2FZKB 1VQ7A 3D7SB 1GL5A 1YNZA 1BKBA 5GAN5 2QQ9A 3L42A 7AT1B 1M1KR 2P0PA 3QO3A 3VS2A 2CSIA 3M0RA 3VKIA 1KQSP 2FZGB 4B6MA 1VQ5T 3RMSA 2RO0A 4ZN1A 3JCMd 1I07A 1N9RA 2YLCA 1B3QA 4WTOB 4CC2A 1PKSA 2IVWA 4PJLA 2K5IA 4C5GA 1WHMA 5IHIA 3CCLA 5KCOA 3G4SA 3RIRA 4M75F 2GGRA 4OB3B 5GAMf 4C5HA 5C0MA 2PQWA 4GBQA 3X25B 4NL2A 3ER0A 2QQSA 1E7OA 4FYXB 1Q7YR 2DTIA 2EAYA 3CC7T 1B34B 1NYGA 3OYHA 2DL7A 1VQ4A 2YRCA 1U1TA 3PE0A 4MZPA 2EYQA 1RLQC 1HSQA 3WVEB 2K2MA 3H0FA 1UGSB 3MCAB 3OYIA 4RTXA 3FJPA 5KE3A 1OPKA 2HDAA 4OB0B 3GNFB 2NLUA 2XHCA 3CD6Q 3QIIA 2F69A 4FSXA 4BI4A 2X4XA 1BI2A 4KT0E 1VQMA 4M7AF 4J7FA 3CMET 4MDXA 2KNBB 5GAMe 1WZOA 2RHIA 4J9EA 3QYHB 1VIFA 3JRZA 1MMDA 1IREB 4JLGA 1PCXA 5GMKe 1WFWA 4JRQA 2LQWA 4RUGA 5I11A 1W6XA 2QQBA 1SG5A 3CXCS 3RMQA 1K73C 1R77A 4PJOB 1EIFA 1BCOA 1VQNT 1JJ2P 2E5QA 1YJ9Q 1N8RU 1AZEA 1KC8U 1OEBA 5DY9A 1NPPA 3DLLA 1M2VA 4KBMB 1EZZB 1UEBA 1T3SA 4E7IA 2AZSA 4FYYB 8AT1B 1GCQA 2QI2A 4JZ4A 3GIBA 3JAME 4L59A 4XK8E 1VUBA 2C0TA 1KD1R 1KQ1A 3IQLA 4KGVB 2GBQA 1ZBJA 3P8BB 4HCZA 2XU8A 1N6AA 4AMCA 3BDUA 4Z02A 4Z89A 2J6OA 2A0FB 2ZPFB 3AT1B 3M54A 2C0IA 2HAXA 3JB9H 2RI5A 2MK5A 4QQGA 4N4IA 4LDXA 8ATCB 4M7DF 3OYJA 4CI0C 1AWWA 4A4FA 2FRWA 5J26A 1TUDA 4C8QF 4XTUA 1RAGB 1K9MR 1ZBXA 3R6OA 5LJ5h 1YCYA 3EGDB 4YTLA 2KMTA 5GAMd 2K7AA 3LGLA 5D6YA 1OV3A 1D3BB 2LQKA 2RA2A 4OGEA 3OW2A 2C06A 3OYEA 1O75A 1YJNT 4J6YA 4BI3A 2R5AA 1YWOA 2RH2A 3QYGB 2RPNA 1ARKA 2M02A 2RMOA 5FW9A 2FEIA 1OPLA 1LOJA 2BE7D 4PFOA 4M7DB 2HL3A 2PVGB 4JRPA 1I4K1 4ELYC 1D1AA 2O31A 2A7YA 3CMAA 5CKBA 2RHZA 2M0YA 1HK9A 3SWNC 5FWBA 2MMPA 2NUTB 1M90C 1G83A 2L5QA 3A8HB 4PJOG 4M78C 3H8ZA 5GMKh 2DYBA 2M0OA 5CKFA 5GAMg 2NWMA 3QPHA 4J5YA 2F2WA 3LYIA 2DL5A 2EW3A 1NJIR 2IG0A 3PGGA 1IRXA 3QBYA 3QZ5B 5LJ3h 3CCRQ 1U1SA 4D8DA 1PHTA 1AD5A 1JEGA 2IIMA 2X9HA 1C0MA 1FYNA 3HPWA 5GANf 3S3OA 3MEAA 2P4TA 1QVPA 2FPDA 3A8OB 5CKHA 2ESWA 2HKQB 4A4HA 5GMKl 2JMCA 4PJMA 3CQTA 2X3WD 1NE8A 1QVGP 3M59A 2GTJA 3PTAA 4XU2A 4UC4A 3HFNA 2DJQA 1K8AU 2EKOA 4HA8A 2R57A 4F14A 1ZLMA 2KR3A 1MUZA 2QYZA 3L2UA 4HCCA 2H3EB 1OOTA 4R55A 4KULA 5GANe 4IUPA 4QW2A 1ZQ1A 4QVZA 3QJYA 3JCMP 1JB0E 3CCQT 5GAOr 1VYVA 1SPKA 4Y91A 1BIBA 1OU8A 1KQ2A 2JTFA 4OGCA 3NTHA 1OYXA 1UDLA 2PVDB 1S72Q 4V2SA 1VQ8A 2PVOB 5D6WA 1YFNA 1VQ6T 2CYZB 3EAEA 2HBPA 4X9DA 2E6NA 2PNIA 1KG1A 4NS5A 1KK7A 2D1XA 4J9BA 4M7DG 2KDSA 4E2FB 3J80E 2DMOA 2CT4A 1ZUYA 3U23A 4BI8B 5KYWA 3CCRA 1VQOT 1HJDA 2ZPHB 1KSWA 3KFVA 3V7CA 2DFUA 2DL8A 3MPUB 3QDRB 5FROA 4RG8A 3GP8A 5CQXA 1D1BA 2YHTA 3CBMA 5I22A 4XTWA 3OYFA 2B86A 1DJ7B 1HYOA 1BI3A 3CCUT 3HSBA 1ZA2B 4PJOD 2CREA 1M1KC 3BW1A 2CKKA 2LVMA 4M78D 4F16A 1H3ZA 1H641 2XD0A 1Q7YU 1VQ9T 2QQAA 2O01E 3HKSA 5GANd 3MEWA 1ZX6A 4M75E 2K3YA 3TREA 1BI1A 1WQ7A 2LJ0A 2VGMA 2HKNA 5KYXB 5GMKi 4C0ZA 4WCIA 3VS5A 2J05A 4QQDA 3TEEA 3E1SA 2VWFA 9ATCB 1RI9A 5FRNA 3G7ZA 2OTJT 4PJOE 1VQ7T 4PJNA 2M16A 3T9NA 1X6OA 1UGRB 2KBTA 2XG8D 5KYUB 5EG2A 1UG1A 2AT1B 3EHQA 3OMGA 1KHCA 1KFZA 1QLYA 3I5RA 2LDMA 2LJ3A 3LH5A 2D6FA 3RERA 1PSFA 1BBZA 2NUZA 2GTOA 2E6ZA 5FU6C 4A63B 2PUKB 4O6JA 2L3QA 1VQPT 1RABB 2FYKA 3VJPA 3G4ST 3CPWP 2L3SA 1XNIA 1WHHA 5GAMj 5GANg 4EMKB 3MKDA 4DBFA 3SWNA 3JB9J 1QWFA 2CP7A 4IIMA 2BZXA 3SDZA 1QW1A 1F1BB 1KQSS 1VQ4T 3OB9A 2K79A 4C92A 4M78A 2BZ8A 1RACB 4C5IA 3CC2Q 2RJFA 3L2VA 5KCHA 2E12A 2K9GA 2OAUA 1PRLC 4N4HA 2DL4A 4CC3A 1XJWB 4XTYA 4KUDK 2AKLA 1VQMT 1KD1C 2B8AA 1K9MU 3FDRA 1R8OB 1LPLA 2J06A 4ATOA 3EGXB 1VQLQ 3JCMf 3AHUA 5GJWB 2Y4YA 3OY9A 3EG9A 5GAOl 5GMKm 4JJBA 4C0DB 1WA7A 1X6GA 1YJWQ 1IHVA 1TOVA 3GOXA 1Z9ZA 4M7DE 3VS6A 4PJJA 1FXXA 3FRNA 2F2XA 1ACMB 4C8QE 2E1HA 2A37A 5J3BA 3ULRB 2WSFE 2BTTA 5HCKA 3UATA 1Y96B 4M77B 1SRMA 3KUFA 1R0CB 3EGDA 2ZPBB 2MAMA 3VS0A 3CXCA 2YUOA 1YIJQ 3JCMe 2EGAA 1FMVA 1GBQA 3QWXX 2GQIA 2FZCB 3X26B 1VQKA 2HMAA 1AOJA 2AIRB 1JJ2S 2DBKA 2JM9A 1HXDA 2JZ2A 2YRDA 4E7LA 3BDLA 1NJIU 5CR2A 3UDCA 2CP2A 1JU5C 2DK3A 2VKNA 1SHFA 1OX8A 4IUTA 3V7SA 1Y0MA 3CD6T 4C0FA 4JJCA 1VQ9A 3TSWA 3E19A 3X24B 3QJ6A 4FU6A 2FB7A 2KXDA 2JS2A 4RG2A 3A8LB 3BY7A 4MMLA 4Y28E 2XMFA 1BIAA 2QK0A 3EH1A 3G1JA 3MHXA 3VS3A 3V7RA 3LW5E 2COZA 2DRMA 4OP0A 1VQLA 2LCCA 4L5GA 1K0XA 1A0NB 1WJRA 3UA6A 2YRVA 1YJWA 2Z0WA 4WF2A 2E65A 2VC8A 1M27C 3VYGA 1WLPB 4JRKA 3CCJA 4IUQA 4OB2B 4XU0A 2OTLQ 3G6EQ 1Q81C 3OS5A 2GFAA 4A54A 2R58A 2J6FA 5A2QE 3CMAT 1K4US 4OF1A 2CZ7B 4MDWA 1YIJA 3M0QA 4C0DC 1T0HA 5KE2A 1VQPA 3OYDA 2KYMA 5CVIA 4J9IA 1D09B 1IHWA 3NGPA 3RBBB 2CH4W 2SRCA 1QCNA 3OS0A 3PVQA 2CH4A 1FX7A 4M77G 2D9TA 3TQ7P 1M2OA 2O4XA 5HY6A 1RAEB 4F04B 6AT1B 3GF5A 5GANj 4ZGDB 4XU3A 3N5BB 2QA4A 4OMNA 3I56Q 2X4JA 1PWTA 1PM3A 2LT4A 4F17A 2DZ9A 2KEAA 2X4WA 2D0NA 2E5KA 3BFMA 1BI0A 2VV5A 4M75B 1X2KA 3NHNA 2DZCA 3O8VA 2KVQG 4QT7A 1YI2Q 1WYXA 1X01A 2HQHA 4EIKA 3JCMJ 4C92F 3JCMg 2ZPEB 4BE0A 1WHGA 2XKOC 2RJCA 2X35A 2EBPA 2ROLA 2G6FX 2YWWA 1BYMA 1UE9A 3EG1A 3G6EA 4JRIA 1JBMA 3I55Q 2DD4A 2MPXC 4L6V5 3JB9G 2DXCA 3C94A 3CCEQ 2CP6A 1TTHB 4M7AB 2KAFA 1VQ8T 1QVGS 3JV3A 3VV0A 2LRQA 2E4HA 1R0BG 4CC4B 1U06A 1CSKA 2EQJA 4J9GA 1N8RC 1KC8C 5GAOm 2MI6A 4FW2A 4RCCA 3CCRT 3OYAA 1AEYA 2ABLA 5DLQE 2HEQA 3PVLA 5C6SA 3EG0A 5KYXA 1I1JA 2E3IA 2LQ8A 3I56A 3CD6A 2OAWA 3F70A 1SRLA 1NEGA 3HTRA 3RR6A 5KYUA 1GFCA 3L2WA 4IUUA 2O88A 3HRUA 1YI2A 3H6ZA 2FHDA 4RTYA 3CC7Q 2JVVA 1M3AA 1X75C 1D1CA 3SHWA 2MF2A 1I5OB 2Y90A 1QP3A 3CC4Q 4M77D 2V1RA 5IT9E 1Z9QA 2F2VA 4OMLA 2VXEA 4PFPA 2ENMA 1YJ9A 3I55A 5CKDA 4B9WA 4M75C 4F7UF 2KRNA 2DA9A 2DIQA 3CMEQ 4M75G 4C8QB 2EGCA 1RI0A 1Y07A 1P92A 2VUBA 4J9CA 2X4YA 1S72T 2DX1A 4LUDA 4Q5WA 2DXTA 4ZGJB 3EFOA 5M9OA 2KQWA 4PJOC 3WVDB 3L2QA 5GAMh 2GCXA 1C1AA 2ZAEA 2KXCA 5IXFA 5CAIA 2HD0A 2VVKA 1RUWA 4M77E 3JCMc 2JS0A 3E9FA 3VRYA 3FC3A 3M58A 1I0CA 3EG3A 1BK2A 2HL5C 3CCVQ 4RTTA 4M7AG 4LDUA 3QWYA 1W1FA 3VYHB 3JB9D 1UJYA 4J6XA 2RQWA 3EGXA 3OQ5A 2VASA 4XTXA 3M0UA 4BDZA 2P4RA 2X51A 4XQ3A 5AYFA 1Q86U 3VS4A 2DKGA 2KRSA 2LCSA 3OYYA 1IGQA 3CC4A 3QHSA 2AZVA 2W0ZA 2LNVA 1NYFA 1Y96A 4AFUC 2ECZA 2F1LA 3CPWS 2IPOB 2RHXA 4HCKA 2DM1A 3V8LA 1TS9A 1KQSA 1NLOC 5GAN7 1Y7XA 2HNIA 2G3RA 1PNJA 4AG2C 1QKXA 4X34A 4FT2A 5I2SA 2J7IA 2EQUA 1QVFP 1PC0A 3JCMb 1OULA 3FJ5A 2DILA 3HP9A 2YT6A 3G71Q 1K8AC 1RADB 2QDLA 2RQRA 4M7DC 1S1NA 1K9AA 1UHFA 2KYBA 1YITQ 4C8QC 3NMZC 1NM7A 3GLXA 2X3XD 1N9SA 2CZ6B 2RM4A 2RB6A 4C8QG 5FU7B 1PG5B 4HT9A 1B7TA 1JRIA 3CCVA 2O9VA 5A0DA 5GAOq 1UFFA 4M75D 4FCYA 4LE9A 2VGNA 4KRTA 3O5ZA 1N27A 5D6XA 3LWHA 3OMCA 1K0SA 1UB4A 1VQKT 3H9NA 4CC7A 5FRMA 1G3TA 1M1GA 1YN8A 5IXBA 3S3NA 1PSEA
chains in the Genus database with same CATH topology
1VYUA 1GBRA 4AFZC 3REBB 4JJBA 1WA7A 4OMMA 1X6GA 1E7OA 1Z9ZA 3VS6A 2CT3A 1NYGA 2DL7A 1LCKA 2F2XA 1T3LA 2A37A 3VRZA 3PE0A 3ULRB 1RLQC 3EG2A 1HSQA 2K2MA 2BTTA 3H0FA 2JMAA 5HCKA 2EYYA 3UATA 4RTXA 2H8HA 1JXMA 1OPKA 2HDAA 2KT1A 2LQNA 1SRMA 2DLPA 2EQIA 3VS0A 4AFQC 1VA7A 4RTWA 2YUOA 2HBWA 2A36A 1W70A 2EGAA 2KNBB 1AWJA 1GBQA 4OMOA 4J9EA 2RF0A 3QWXX 2CUDA 2ED1A 2GQIA 1UHCA 1WFWA 2LQWA 1AOJA 4RUGA 5I11A 3H0IA 1W6XA 2EGEA 2YUPA 2FRYA 2FO0A 2JTEA 2YDLA 2DBKA 4HVUA 2JM9A 2BZYA 1AZEA 1OEBA 3VS7A 1JU5C 1CKAA 2LZ6B 2VKNA 1GFDA 1MV0B 1SHFA 1T3SA 1Y0MA 1ZSGA 5IHKA 4JJCA 3TSWA 2EKHA 2AZSA 2KXDA 4M4ZA 2JS2A 4ORZA 1WXUA 1ABQA 1X43A 1GCQA 4JZ4A 1ZUKA 2MIOA 4LNPA 4RTVA 2XMFA 2C0TA 3VS3A 2DVJA 1K76A 2EYXA 3IQLA 4AFSC 2DRMA 4Y92A 3SEMA 1TG0A 2DRKA 3ZL7C 1K0XA 1A0NB 2GBQA 1YWPA 1GRIA 3UA6A 1ZBJA 5FWCA 3I9QA 1M27C 4Z89A 2J6OA 1WLPB 4JPBW 2M51A 2C0IA 4LN2A 1M30A 1VYTA 4Z8AA 3EHRA 2DBMA 2J6FA 1SHGA 2CDTA 1AWWA 1K4US 2FRWA 1TUDA 2AK5A 2YUNA 3M0QA 2KROA 1T0HA 2HSPA 2K7AA 4JJDA 2DF6A 1T0JA 1OV3A 2KYMA 4J9IA 4E6RA 2FPFA 3EGUA 2L2PA 1YWOA 3NGPA 1CKBA 3RBBB 2CH4W 2RPNA 2SRCA 1ARKA 2J6KA 3PVQA 2CH4A 2L3PA 2RMOA 5FW9A 2FEIA 1OPLA 1NLPC 1M3CA 1ZUUA 2O31A 1WI7A 2M0YA 2V1QA 1K1ZA 4OMNA 3VS1A 1PWTA 5FWBA 1V1CA 3NPFA 2KEAA 4F17A 2D0NA 1G83A 2E5KA 5ECAA 2FPEA 1RLPC 1WXTA 1X2KA 3NHNA 3H0HA 4QT7A 2K6DA 1WYXA 4EIKA 1NG2A 2DYBA 2YSQA 1YCSB 2NWMA 2RN8A 1QWEA 2F2WA 2LP5A 2DL5A 2EW3A 2EBPA 2LJ1A 2ROLA 2O2OA 4HVVA 2G6FX 4D8DA 1UE9A 3EG1A 1PHTA 1AD5A 1JEGA 2IIMA 4IIOA 4X1VA 2MOXA 1X69A 1FYNA 2RQTA 2FPDA 1NEBA 1H8KA 2ESWA 3JV3A 2EPDA 2ED0A 2JMCA 5IXBA 4RTUA 3CQTA 2X3WD 5IH2A 4CC4B 1U06A 2GTJA 2SEMA 2JM8A 4OMQA 1CSKA 1EFNA 1B07A 2DJQA 4K11A 1JQQA 4J9GA 1KIKA 2LNHB 2W10A 4F14A 3M0SA 1ZLMA 2KRMA 5L23A 1M8MA 2KGTA 2KR3A 1MUZA 1WXBA 1AEYA 1AZGB 1OOTA 1YP5A 2ABLA 1AVZC 2HEQA 2I0NA 3PVLA 1N5ZA 1GCPA 2HCKA 3EG0A 1E6GA 3M0TA 1X27A 1PRMC 1VYVA 1JXOA 1I1JA 1AWXA 5IHNA 1SPKA 2OAWA 2ROTA 4Z88A 1SRLA 1NEGA 3REAB 1UDLA 1Y57A 1KJWA 1GFCA 2O9SA 1UECA 2O88A 4DEYA 4RTYA 3R6NA 2PNIA 1M3AA 1AWOA 1WX6A 2D1XA 4J9BA 3SHWA 2LX7A 2DMOA 2CT4A 1BU1A 1ZUYA 3U23A 1HD3A 2V1RA 4RTZA 1Z9QA 4ESRA 2F2VA 4OMLA 1GCQC 2ENMA 1HJDA 4HXJA 1KSWA 3KFVA 3C0CA 2DL8A 2KRNA 2DA9A 1IO6A 1ABOA 4J9DA 1G2BA 2JT4A 2DE0X 5I22A 2EGCA 4J9CA 2OI3A 3M0PA 4GBQA 2DNUA 2B86A 1PKTA 2DX1A 4LUDA 1M3BA 1U3OA 2CREA 1UGVA 3THKA 2GNCA 4F16A 2PZ1A 4HVWA 2KXCA 5IXFA 4R0KA 2FG0A 4J9HA 1J3TA 1UJ0A 2AKKA 4GLMA 2VVKA 3I5SA 1X2QA 4AG1C 2MCNA 1RUWA 2JS0A 2A28A 3VRYA 1ZX6A 1I0CA 1BK2A 3EG3A 2C0OA 5EC7A 3TSZA 4RTTA 3I35A 3A98A 3QWYA 2LJ0A 1W1FA 1SSHA 2OJ2A 4D8KA 5GJVB 2K3BA 2PTKA 1UJYA 4WCIA 3VS5A 2J05A 2RQWA 2CUBA 3H41A 2D8JA 2VWFA 1RI9A 2KE9A 3M0UA 4LUEA 1MV3A 2RQUA 2KT8A 4JZ3A 1WIEA 2P4RA 1XOVA 2KBTA 1E6HA 1WDXA 3VS4A 1UG1A 3EHQA 1H92A 2RNAA 2KRSA 2LCSA 4OMPA 1KFZA 1QLYA 1FMKA 3UF4A 1UTIA 3UA7A 3I5RA 3RNJA 2AZVA 2LJ3A 3LH5A 2W0ZA 1NYFA 2RQVA 2NUZA 1BBZA 2GTOA 4AFUC 2ECZA 4A63B 4J9FA 2A08A 2L3QA 4FSSA 2DM1A 4HCKA 2D8HA 1NLOC 2EVRA 2L0AA 1PNJA 2L3SA 4AG2C 2EYWA 1QKXA 3GBQA 2J7IA 2LMJA 4ZNXA 1X6BA 1UUEA 2DILA 1QKWA 3FJ5A 1QWFA 1GL5A 1YNZA 4IIMA 2BZXA 2YT6A 2QDLA 2RQRA 2DL3A 3VS2A 1S1NA 2CSIA 2K79A 1K9AA 1UHFA 3M0RA 2BZ8A 1SEMA 2KYBA 3NMZC 1NM7A 1TUCA 2X3XD 3TVTA 2K9GA 1PRLC 2DL4A 4CC3A 1I07A 2O9VA 1B3QA 1U5SA 2YUQA 1H3HA 2AKLA 4CC2A 1UFFA 1PKSA 4LE9A 5IHIA 2J06A 3O5ZA 1JO8A 1QCFA 4KRTA 4DEXA 2GGRA 2CSQA 1K0SA 1BB9A 4CC7A 5GJWB 2JW4A 1YN8A 2EYZA 2JXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYU A;  1GBR A;  4AFZ C;  3REB B;  4JJB A;  1WA7 A;  4OMM A;  1X6G A;  1E7O A;  1Z9Z A;  3VS6 A;  2CT3 A;  1NYG A;  2DL7 A;  1LCK A;  2F2X A;  1T3L A;  2A37 A;  3VRZ A;  3PE0 A;  3ULR B;  1RLQ C;  3EG2 A;  1HSQ A;  2K2M A;  2BTT A;  3H0F A;  2JMA A;  5HCK A;  2EYY A;  3UAT A;  4RTX A;  2H8H A;  1JXM A;  1OPK A;  2HDA A;  2KT1 A;  2LQN A;  1SRM A;  2DLP A;  2EQI A;  3VS0 A;  4AFQ C;  1VA7 A;  4RTW A;  2YUO A;  2HBW A;  2A36 A;  1W70 A;  2EGA A;  2KNB B;  1AWJ A;  1GBQ A;  4OMO A;  4J9E A;  2RF0 A;  3QWX X;  2CUD A;  2ED1 A;  2GQI A;  1UHC A;  1WFW A;  2LQW A;  1AOJ A;  4RUG A;  5I11 A;  3H0I A;  1W6X A;  2EGE A;  2YUP A;  2FRY A;  2FO0 A;  2JTE A;  2YDL A;  2DBK A;  4HVU A;  2JM9 A;  2BZY A;  1AZE A;  1OEB A;  3VS7 A;  1JU5 C;  1CKA A;  2LZ6 B;  2VKN A;  1GFD A;  1MV0 B;  1SHF A;  1T3S A;  1Y0M A;  1ZSG A;  5IHK A;  4JJC A;  3TSW A;  2EKH A;  2AZS A;  2KXD A;  4M4Z A;  2JS2 A;  4ORZ A;  1WXU A;  1ABQ A;  1X43 A;  1GCQ A;  4JZ4 A;  1ZUK A;  2MIO A;  4LNP A;  4RTV A;  2XMF A;  2C0T A;  3VS3 A;  2DVJ A;  1K76 A;  2EYX A;  3IQL A;  4AFS C;  2DRM A;  4Y92 A;  3SEM A;  1TG0 A;  2DRK A;  3ZL7 C;  1K0X A;  1A0N B;  2GBQ A;  1YWP A;  1GRI A;  3UA6 A;  1ZBJ A;  5FWC A;  3I9Q A;  1M27 C;  4Z89 A;  2J6O A;  1WLP B;  4JPB W;  2M51 A;  2C0I A;  4LN2 A;  1M30 A;  1VYT A;  4Z8A A;  3EHR A;  2DBM A;  2J6F A;  1SHG A;  2CDT A;  1AWW A;  1K4U S;  2FRW A;  1TUD A;  2AK5 A;  2YUN A;  3M0Q A;  2KRO A;  1T0H A;  2HSP A;  2K7A A;  4JJD A;  2DF6 A;  1T0J A;  1OV3 A;  2KYM A;  4J9I A;  4E6R A;  2FPF A;  3EGU A;  2L2P A;  1YWO A;  3NGP A;  1CKB A;  3RBB B;  2CH4 W;  2RPN A;  2SRC A;  1ARK A;  2J6K A;  3PVQ A;  2CH4 A;  2L3P A;  2RMO A;  5FW9 A;  2FEI A;  1OPL A;  1NLP C;  1M3C A;  1ZUU A;  2O31 A;  1WI7 A;  2M0Y A;  2V1Q A;  1K1Z A;  4OMN A;  3VS1 A;  1PWT A;  5FWB A;  1V1C A;  3NPF A;  2KEA A;  4F17 A;  2D0N A;  1G83 A;  2E5K A;  5ECA A;  2FPE A;  1RLP C;  1WXT A;  1X2K A;  3NHN A;  3H0H A;  4QT7 A;  2K6D A;  1WYX A;  4EIK A;  1NG2 A;  2DYB A;  2YSQ A;  1YCS B;  2NWM A;  2RN8 A;  1QWE A;  2F2W A;  2LP5 A;  2DL5 A;  2EW3 A;  2EBP A;  2LJ1 A;  2ROL A;  2O2O A;  4HVV A;  2G6F X;  4D8D A;  1UE9 A;  3EG1 A;  1PHT A;  1AD5 A;  1JEG A;  2IIM A;  4IIO A;  4X1V A;  2MOX A;  1X69 A;  1FYN A;  2RQT A;  2FPD A;  1NEB A;  1H8K A;  2ESW A;  3JV3 A;  2EPD A;  2ED0 A;  2JMC A;  5IXB A;  4RTU A;  3CQT A;  2X3W D;  5IH2 A;  4CC4 B;  1U06 A;  2GTJ A;  2SEM A;  2JM8 A;  4OMQ A;  1CSK A;  1EFN A;  1B07 A;  2DJQ A;  4K11 A;  1JQQ A;  4J9G A;  1KIK A;  2LNH B;  2W10 A;  4F14 A;  3M0S A;  1ZLM A;  2KRM A;  5L23 A;  1M8M A;  2KGT A;  2KR3 A;  1MUZ A;  1WXB A;  1AEY A;  1AZG B;  1OOT A;  1YP5 A;  2ABL A;  1AVZ C;  2HEQ A;  2I0N A;  3PVL A;  1N5Z A;  1GCP A;  2HCK A;  3EG0 A;  1E6G A;  3M0T A;  1X27 A;  1PRM C;  1VYV A;  1JXO A;  1I1J A;  1AWX A;  5IHN A;  1SPK A;  2OAW A;  2ROT A;  4Z88 A;  1SRL A;  1NEG A;  3REA B;  1UDL A;  1Y57 A;  1KJW A;  1GFC A;  2O9S A;  1UEC A;  2O88 A;  4DEY A;  4RTY A;  3R6N A;  2PNI A;  1M3A A;  1AWO A;  1WX6 A;  2D1X A;  4J9B A;  3SHW A;  2LX7 A;  2DMO A;  2CT4 A;  1BU1 A;  1ZUY A;  3U23 A;  1HD3 A;  2V1R A;  4RTZ A;  1Z9Q A;  4ESR A;  2F2V A;  4OML A;  1GCQ C;  2ENM A;  1HJD A;  4HXJ A;  1KSW A;  3KFV A;  3C0C A;  2DL8 A;  2KRN A;  2DA9 A;  1IO6 A;  1ABO A;  4J9D A;  1G2B A;  2JT4 A;  2DE0 X;  5I22 A;  2EGC A;  4J9C A;  2OI3 A;  3M0P A;  4GBQ A;  2DNU A;  2B86 A;  1PKT A;  2DX1 A;  4LUD A;  1M3B A;  1U3O A;  2CRE A;  1UGV A;  3THK A;  2GNC A;  4F16 A;  2PZ1 A;  4HVW A;  2KXC A;  5IXF A;  4R0K A;  2FG0 A;  4J9H A;  1J3T A;  1UJ0 A;  2AKK A;  4GLM A;  2VVK A;  3I5S A;  1X2Q A;  4AG1 C;  2MCN A;  1RUW A;  2JS0 A;  2A28 A;  3VRY A;  1ZX6 A;  1I0C A;  1BK2 A;  3EG3 A;  2C0O A;  5EC7 A;  3TSZ A;  4RTT A;  3I35 A;  3A98 A;  3QWY A;  2LJ0 A;  1W1F A;  1SSH A;  2OJ2 A;  4D8K A;  5GJV B;  2K3B A;  2PTK A;  1UJY A;  4WCI A;  3VS5 A;  2J05 A;  2RQW A;  2CUB A;  3H41 A;  2D8J A;  2VWF A;  1RI9 A;  2KE9 A;  3M0U A;  4LUE A;  1MV3 A;  2RQU A;  2KT8 A;  4JZ3 A;  1WIE A;  2P4R A;  1XOV A;  2KBT A;  1E6H A;  1WDX A;  3VS4 A;  1UG1 A;  3EHQ A;  1H92 A;  2RNA A;  2KRS A;  2LCS A;  4OMP A;  1KFZ A;  1QLY A;  1FMK A;  3UF4 A;  1UTI A;  3UA7 A;  3I5R A;  3RNJ A;  2AZV A;  2LJ3 A;  3LH5 A;  2W0Z A;  1NYF A;  2RQV A;  2NUZ A;  1BBZ A;  2GTO A;  4AFU C;  2ECZ A;  4A63 B;  4J9F A;  2A08 A;  2L3Q A;  4FSS A;  2DM1 A;  4HCK A;  2D8H A;  1NLO C;  2EVR A;  2L0A A;  1PNJ A;  2L3S A;  4AG2 C;  2EYW A;  1QKX A;  3GBQ A;  2J7I A;  2LMJ A;  4ZNX A;  1X6B A;  1UUE A;  2DIL A;  1QKW A;  3FJ5 A;  1QWF A;  1GL5 A;  1YNZ A;  4IIM A;  2BZX A;  2YT6 A;  2QDL A;  2RQR A;  2DL3 A;  3VS2 A;  1S1N A;  2CSI A;  2K79 A;  1K9A A;  1UHF A;  3M0R A;  2BZ8 A;  1SEM A;  2KYB A;  3NMZ C;  1NM7 A;  1TUC A;  2X3X D;  3TVT A;  2K9G A;  1PRL C;  2DL4 A;  4CC3 A;  1I07 A;  2O9V A;  1B3Q A;  1U5S A;  2YUQ A;  1H3H A;  2AKL A;  4CC2 A;  1UFF A;  1PKS A;  4LE9 A;  5IHI A;  2J06 A;  3O5Z A;  1JO8 A;  1QCF A;  4KRT A;  4DEX A;  2GGR A;  2CSQ A;  1K0S A;  1BB9 A;  4CC7 A;  5GJW B;  2JW4 A;  1YN8 A;  2EYZ A;  2JXB A; 
#chains in the Genus database with same CATH topology
 1VYU A;  3INZ A;  5GAN 6;  2QG9 B;  3JB9 I;  4MZT A;  2P84 A;  2CT3 A;  1QP2 A;  1LCK A;  3S3M A;  2K57 A;  1T3L A;  3VRZ A;  1M2V B;  3EG2 A;  4BB7 A;  2JMA A;  2EYY A;  2H8H A;  1JXM A;  1W4S A;  2WSC E;  2KT1 A;  4E47 A;  2LQN A;  2VXF A;  2DD5 A;  1JJ2 A;  1VA7 A;  4EDU A;  5GAO n;  2XIC A;  5IN1 A;  2A36 A;  4DBQ A;  2HQX A;  3M57 A;  1RAI B;  3MO8 A;  2H3J A;  1VQL T;  2CUD A;  3OYM A;  2ED1 A;  1UHC A;  2DAQ A;  3JSC A;  2BIV A;  2QQR A;  1YJW T;  2EGE A;  3DLM A;  2YUP A;  1S72 A;  2FRY A;  3G71 A;  2DXB A;  2FO0 A;  4HVU A;  1Q7Y C;  3JCM X;  3CPF A;  3CCJ T;  1B34 A;  2QGG A;  1YIT A;  3RKX A;  2LZ6 B;  3CCM Q;  4QKU A;  3HRT A;  4M7A E;  2EKH A;  1YIJ T;  4ORZ A;  2E10 A;  2QTX A;  1ABQ A;  1YHQ Q;  1VIE A;  2MIO A;  4LNP A;  4RTV A;  5GAN h;  4C92 E;  1SF9 A;  4A53 A;  2OX7 A;  3OYL A;  1K76 A;  4AFS C;  2COY A;  2L89 A;  4CRI A;  4Y92 A;  1TG0 A;  1TH7 A;  1EX4 A;  4N0A C;  1NBE B;  2RJE A;  2M1H A;  3JCM V;  4PJO A;  3FEO A;  1VQO Q;  4M7D D;  2XDD A;  4LN2 A;  1M30 A;  1GXI E;  2PU9 B;  1XTD A;  4Z8A A;  4C8Q D;  3EHR A;  4JS4 A;  2WAC A;  2QA4 T;  1AT1 B;  2FVU A;  3MET A;  2Y4X A;  3A1P A;  2KRO A;  2QAZ A;  3TCJ A;  2HSP A;  1M5Q 1;  1G3W A;  4JJD A;  4BDY A;  3JCM Q;  2CP5 A;  1WHK A;  3VUZ A;  1OI1 A;  1O9S A;  2CZ0 B;  2QTV A;  1Q82 U;  4P5N A;  1W2B S;  4E7J A;  4E6R A;  3ZEH A;  5I21 A;  2L2P A;  1CKB A;  1I5L A;  3M4Y A;  2EWN A;  2CP0 A;  3QKJ A;  4A4E A;  2L3P A;  3VUB A;  3URG A;  2MWO A;  2K4Y A;  2K2V A;  2OTL T;  3G6E T;  2LT1 A;  3PMI A;  5LL6 S;  3X28 B;  2DEU A;  3MP1 A;  3CCM A;  2RK2 A;  4JS5 A;  1MNE A;  4JUV A;  1ZUU A;  2P0K A;  1WI7 A;  3OW2 P;  1K9M C;  5GAN 4;  1K1Z A;  3QZ9 B;  3TU4 K;  1YHQ A;  3VS1 A;  1V1C A;  2ZCF B;  4IUR A;  4QVC A;  1ZHI A;  3NPF A;  2RI2 A;  5ECA A;  5L8R E;  1WXT A;  2GF7 A;  4HKE A;  1D3B A;  1Y71 A;  3SFM A;  2YSQ A;  3Q1J A;  3RES A;  1YCS B;  4IUV A;  5CIU A;  3PIO A;  4IKF A;  1OZ3 A;  1NPR A;  2RN8 A;  2KI7 A;  1QWE A;  1Q86 R;  2PUO B;  2YXY A;  4F7U E;  1V76 A;  3MEV A;  2LJ1 A;  3QXE B;  2EJ9 A;  5HK0 A;  4HVV A;  1LNX A;  4C5E A;  4DA4 A;  1WGS A;  1QVG A;  3HFO A;  5CKE A;  1I81 A;  4M7D A;  2COW A;  4IIO A;  2NUP B;  4RCB A;  3CC2 A;  1X69 A;  1G5V A;  4NL3 A;  2E3H A;  4C8Q A;  3CCL Q;  3I56 T;  3G4S Q;  3RDV A;  4EMK C;  1OQK A;  3JCM W;  1H8K A;  2YLB A;  2NUT A;  2ED0 A;  1YI2 T;  3EFS A;  5IH2 A;  2LCL A;  2SEM A;  1B07 A;  1M8V A;  4XTZ A;  2K5F A;  2W10 A;  1NJI C;  2DET A;  2BE9 B;  4TVR A;  3E9G A;  2KRM A;  5L23 A;  1M8M A;  2KGT A;  3LWI A;  5KYW B;  1YJ9 T;  1ZSZ B;  1Q95 G;  5KYY B;  3I55 T;  4A4G A;  4AT1 B;  2I0N A;  1N5Z A;  4LDW A;  2AHJ B;  3NTK A;  1PD0 A;  2HCK A;  1E6G A;  4N4G A;  5LJ5 f;  5A0L A;  2XI9 A;  3CCE T;  4R56 A;  4EMG A;  2D0Q B;  2EJF A;  2XDP A;  1Y57 A;  1KJW A;  4KH1 B;  4BE2 A;  2F5K A;  4A4K A;  3CCS Q;  3L2R A;  2E41 A;  4KGX B;  2QEX Q;  1IXD A;  4ZTJ A;  1WX6 A;  4LD9 K;  2LX7 A;  1BU1 A;  5CO7 A;  1W2B P;  4M77 C;  2XK0 A;  4ESR A;  2HQE A;  3ASK A;  5LJ5 e;  2L8D A;  4HXJ A;  1MMA A;  4FIB A;  1IB8 A;  3C0C A;  2V8J A;  3PMT A;  1ABO A;  4J9D A;  2DER A;  2JT4 A;  3OS1 A;  1D0Z A;  4ZGE B;  3LH0 A;  1PKT A;  2RK1 A;  1ZA1 B;  2BUD A;  4PL6 A;  1U3O A;  1UGV A;  4D6W A;  1RAF B;  3JCM h;  1WHJ A;  1OU9 A;  4PJO F;  2PZ1 A;  4HVW A;  4R0K A;  1J3T A;  1UJ0 A;  1K73 U;  3CC4 T;  3I5S A;  5KH6 A;  4AG1 C;  2JUF A;  2MCN A;  4M78 F;  1FWZ A;  5LJ3 f;  2F5T X;  4ELZ C;  2RHU A;  2JJ9 A;  2DIG A;  3M4G A;  4N0A A;  3OBY A;  1BCM A;  3PIP A;  3I35 A;  2OTL A;  3KXT A;  4FW1 A;  2OJ2 A;  4D8K A;  2PTK A;  2CZ1 B;  1D0X A;  4PLL A;  3MP6 A;  2DPP B;  3SWN B;  2KE9 A;  2DTO A;  4LUE A;  1MV3 A;  2RQU A;  3L2Z A;  2KT8 A;  4BAC A;  4JJN K;  1ZSZ C;  3CCS A;  5LJ3 e;  2QEX A;  3CPW A;  4C92 B;  4M78 B;  1MMN A;  5I2M A;  4OMP A;  2LTO A;  2VB6 A;  1UTI A;  3X20 B;  2RI3 A;  1G3Y A;  5LJ5 d;  1TU0 B;  3CMA Q;  2RQV A;  3CCV T;  1VQ5 Q;  2FL7 A;  1M9S A;  4FSS A;  2D8H A;  5CCA A;  2EVR A;  3OS2 A;  1TSF A;  3FIF A;  2JTM A;  2L0A A;  3VU3 C;  1QVF S;  4B9X A;  2EYW A;  2WSE E;  4PFZ A;  3OYB A;  2LMJ A;  2RHY A;  1X6B A;  3EG9 B;  4DQ2 A;  3P8H A;  2EFI A;  1QKW A;  1Q82 R;  4PKC C;  2GQV A;  3V8J A;  2ATC B;  4KH0 B;  3MJX A;  3CEY A;  5GAN 2;  1WHL A;  4NOY A;  2DL3 A;  3OYK A;  2EQM A;  5FLX E;  1SEM A;  4J83 A;  4PNO A;  4PK4 A;  1TUC A;  3TVT A;  3LX7 A;  2RD1 A;  3DKM A;  1U5S A;  2YUQ A;  3UPU A;  1H3H A;  1YBY A;  2V8K A;  4LXC A;  5LJ5 g;  2EQK A;  1JO8 A;  1QCF A;  4DEX A;  3OYG A;  2CSQ A;  3CCE A;  3PFS A;  1M90 U;  1BB9 A;  5AT1 B;  2JW4 A;  3HL8 A;  1WPY A;  4EMK A;  2EYZ A;  1ZSG A;  2JXB A;  2L3R A;  1WJS A;  4AFZ C;  3G71 T;  3REB B;  1GBR A;  4OMM A;  5LJ3 d;  5GAN 8;  1YIT T;  1WNL A;  1VQN Q;  3BE3 A;  1OZ2 A;  2DO3 A;  3DB3 A;  2V8I A;  1VQ5 A;  2DLP A;  2EQI A;  3CBP A;  4M7A C;  4AFQ C;  4RTW A;  4F7U B;  3OSS C;  3FLG A;  3RKY A;  2HBW A;  4DOW A;  1W70 A;  1VQ8 Q;  1AWJ A;  4EPC A;  4OMO A;  4C92 C;  2RF0 A;  4C92 G;  4M78 G;  2I2L A;  3RKW A;  3H0I A;  3GPL A;  4E7K A;  3LLR A;  4LDY A;  4MZM A;  2JTE A;  2YDL A;  2JN0 A;  2DXU A;  2HSE B;  4C0G A;  2BZY A;  3CC7 A;  1G8X A;  3CXC P;  4QVD A;  3VS7 A;  1CKA A;  1XQH A;  1GFD A;  1LJO A;  1MV0 B;  1Q81 R;  3KBG A;  1TUG B;  3J7A F;  5LJ3 g;  5IHK A;  3A5Z B;  2DYI A;  2ZPG B;  5DM7 R;  3L1A A;  4M77 A;  3RUX A;  4M4Z A;  1WXU A;  1X43 A;  4VUB A;  1ZUK A;  1UGQ B;  3CME A;  2DVJ A;  2EYX A;  2P0Q A;  2RJD A;  3SEM A;  4XAX B;  3A8G B;  4LDV A;  3SB2 A;  4BY6 B;  3C4S A;  2DRK A;  3ZL7 C;  2VYT A;  1Q86 C;  3QUI A;  1YWP A;  1GRI A;  5FWC A;  1YJN Q;  3I9Q A;  5KYN A;  2ZGW A;  1VQN A;  4JPB W;  2M51 A;  2O4X B;  4GLK A;  3CCM T;  1VYT A;  2NUP A;  1SKU B;  4RKU E;  2DJZ A;  2DBM A;  1VOM A;  1IZ6 A;  1SHG A;  1W2B A;  2CDT A;  3MP8 A;  1YHQ T;  2AK5 A;  2CP3 A;  2YUN A;  5FU6 B;  1TXQ A;  4DBR A;  1TWB A;  3NFC A;  2DF6 A;  3QG1 A;  1T0J A;  3E2U A;  4XU1 A;  4OB1 B;  4PLI A;  2MYS A;  4FYV B;  1RAA B;  4GY5 A;  1M1K U;  2FPF A;  1NZ9 A;  3EFR A;  3EGU A;  3P8D A;  1OX9 A;  3J81 E;  2J6K A;  1ZSZ A;  5KYY A;  1K73 R;  3ZFJ A;  3WXM B;  1NLP C;  4F7U G;  3OW2 S;  3CC2 T;  3ME9 A;  1M3C A;  1SSF A;  3OBW A;  3OA6 A;  3M5A A;  1WJQ A;  2V1Q A;  4M7A D;  3M9Q A;  2CGH A;  2NYS A;  3M56 A;  1M1F A;  5J39 A;  2FPE A;  1RLP C;  4C92 D;  3H0H A;  4FYW B;  2K6D A;  1NG2 A;  3QDF A;  2EJG A;  1YJN A;  1N8R R;  1KC8 R;  2LP5 A;  5DLO A;  4J6W A;  4ZTF A;  2O2O A;  2V26 A;  4MMK A;  3EH2 A;  4DOV A;  5LJ5 j;  3C12 A;  4JDS A;  4X1V A;  2MOX A;  2QAS A;  4E7H A;  3DB4 A;  3C95 A;  2E70 A;  4O5V A;  4BY6 C;  3CCQ Q;  2JOY A;  2RQT A;  2LX9 A;  4EMH A;  4OMF B;  2JNG A;  1I8F A;  1NEB A;  3S6W A;  2CS7 A;  1WQW A;  4FL6 A;  2EPD A;  4M78 E;  4RTU A;  4M75 A;  4FM4 B;  4ANJ A;  1MND A;  2HZY A;  1VQ6 Q;  2JM8 A;  4ME7 A;  4OMQ A;  1EFN A;  1V29 B;  4K11 A;  5GAO p;  1JQQ A;  4HCB A;  1KIK A;  2LNH B;  3M0S A;  5FU7 C;  1D0Y A;  1QMC A;  1WXB A;  2K5L A;  3FB9 A;  4E7Z A;  1AZG B;  1C6V X;  2KK4 A;  1YP5 A;  1AVZ C;  3OSV A;  3HHT B;  1GCP A;  3NTI A;  3CCL T;  1QCO A;  3M0T A;  1X27 A;  1PRM C;  1JXO A;  3OYC A;  1RL2 A;  1AWX A;  3M55 A;  5IHN A;  2XDB A;  2DTH A;  2XID A;  2ROT A;  4BE1 A;  1KD1 U;  4Z88 A;  1VQK Q;  1LVK A;  3REA B;  4ZN3 A;  4FT4 A;  5GMK j;  3EFO B;  4M7A A;  1RAH B;  3MEU A;  2R5M A;  1M90 R;  3CCU Q;  2O9S A;  1UEC A;  4DEY A;  1G3S A;  3R6N A;  1AWO A;  3GNG A;  3HRS A;  5D7U A;  4DBH A;  3CBO A;  5LJ3 j;  3ZBD A;  1HD3 A;  4RTZ A;  1VQ9 Q;  2LC4 A;  4II1 A;  1GCQ C;  4X9C A;  2GFU A;  4M77 F;  4E7S A;  3CCQ A;  1IO6 A;  1G2B A;  2DE0 X;  2OI3 A;  3M0P A;  5CQY A;  3PNW C;  2DNU A;  1AHJ B;  2MWP A;  2DEQ A;  1Q82 C;  1M3B A;  4OVA A;  3CCS T;  3THK A;  2OTJ Q;  2DVE A;  2GNC A;  1VQ7 Q;  1FMW A;  2ZZD A;  2QEX T;  1UGP B;  1VQ6 A;  5IAY A;  2FG0 A;  4J9H A;  2ZPI B;  3CCJ Q;  1KHI A;  2AKK A;  4GLM A;  4QQ6 A;  1U8R A;  1X2Q A;  5HKC A;  2K3X A;  2A28 A;  1VQO A;  2QDY B;  4J7I A;  5A0G A;  1IGU A;  2M9U A;  5EC7 A;  2C0O A;  1MMG A;  2E64 A;  2QGF B;  3TSZ A;  4BUG A;  2A3L A;  3UWN A;  3A98 A;  1SSH A;  5GJV B;  2KY9 A;  2K3B A;  4KUI A;  1VQP Q;  3V8K A;  2CUB A;  3H41 A;  2D8J A;  4XTV A;  3M53 A;  3JB9 F;  5CK9 A;  4JZ3 A;  1WIE A;  3CCU A;  1MHN A;  3A8M B;  4JLI A;  1XOV A;  1K8A R;  1E6H A;  1WDX A;  4LD6 A;  1QQJ A;  4BD3 A;  1M4Z A;  1H92 A;  2RNA A;  1VQ4 Q;  2BKD N;  4RMO A;  1QVF A;  3LGF A;  1FMK A;  3UF4 A;  3UA7 A;  3QSU A;  3RNJ A;  3SD4 A;  2QA4 Q;  1Q81 U;  4F7U A;  4J9F A;  2A08 A;  2QXF A;  5HK3 A;  3PT9 A;  1VQM Q;  2EIF A;  3OYN A;  4HT8 A;  4J8O A;  1PD1 A;  2KSS A;  5GAN 3;  3GBQ A;  4KGZ B;  4ZNX A;  1MGQ A;  2OTJ A;  1UUE A;  3UT1 A;  2FZK B;  1VQ7 A;  3D7S B;  1GL5 A;  1YNZ A;  1BKB A;  5GAN 5;  2QQ9 A;  3L42 A;  7AT1 B;  1M1K R;  2P0P A;  3QO3 A;  3VS2 A;  2CSI A;  3M0R A;  3VKI A;  1KQS P;  2FZG B;  4B6M A;  1VQ5 T;  3RMS A;  2RO0 A;  4ZN1 A;  3JCM d;  1I07 A;  1N9R A;  2YLC A;  1B3Q A;  4WTO B;  4CC2 A;  1PKS A;  2IVW A;  4PJL A;  2K5I A;  4C5G A;  1WHM A;  5IHI A;  3CCL A;  5KCO A;  3G4S A;  3RIR A;  4M75 F;  2GGR A;  4OB3 B;  5GAM f;  4C5H A;  5C0M A;  2PQW A;  4GBQ A;  3X25 B;  4NL2 A;  3ER0 A;  2QQS A;  1E7O A;  4FYX B;  1Q7Y R;  2DTI A;  2EAY A;  3CC7 T;  1B34 B;  1NYG A;  3OYH A;  2DL7 A;  1VQ4 A;  2YRC A;  1U1T A;  3PE0 A;  4MZP A;  2EYQ A;  1RLQ C;  1HSQ A;  3WVE B;  2K2M A;  3H0F A;  1UGS B;  3MCA B;  3OYI A;  4RTX A;  3FJP A;  5KE3 A;  1OPK A;  2HDA A;  4OB0 B;  3GNF B;  2NLU A;  2XHC A;  3CD6 Q;  3QII A;  2F69 A;  4FSX A;  4BI4 A;  2X4X A;  1BI2 A;  4KT0 E;  1VQM A;  4M7A F;  4J7F A;  3CME T;  4MDX A;  2KNB B;  5GAM e;  1WZO A;  2RHI A;  4J9E A;  3QYH B;  1VIF A;  3JRZ A;  1MMD A;  1IRE B;  4JLG A;  1PCX A;  5GMK e;  1WFW A;  4JRQ A;  2LQW A;  4RUG A;  5I11 A;  1W6X A;  2QQB A;  1SG5 A;  3CXC S;  3RMQ A;  1K73 C;  1R77 A;  4PJO B;  1EIF A;  1BCO A;  1VQN T;  1JJ2 P;  2E5Q A;  1YJ9 Q;  1N8R U;  1AZE A;  1KC8 U;  1OEB A;  5DY9 A;  1NPP A;  3DLL A;  1M2V A;  4KBM B;  1EZZ B;  1UEB A;  1T3S A;  4E7I A;  2AZS A;  4FYY B;  8AT1 B;  1GCQ A;  2QI2 A;  4JZ4 A;  3GIB A;  3JAM E;  4L59 A;  4XK8 E;  1VUB A;  2C0T A;  1KD1 R;  1KQ1 A;  3IQL A;  4KGV B;  2GBQ A;  1ZBJ A;  3P8B B;  4HCZ A;  2XU8 A;  1N6A A;  4AMC A;  3BDU A;  4Z02 A;  4Z89 A;  2J6O A;  2A0F B;  2ZPF B;  3AT1 B;  3M54 A;  2C0I A;  2HAX A;  3JB9 H;  2RI5 A;  2MK5 A;  4QQG A;  4N4I A;  4LDX A;  8ATC B;  4M7D F;  3OYJ A;  4CI0 C;  1AWW A;  4A4F A;  2FRW A;  5J26 A;  1TUD A;  4C8Q F;  4XTU A;  1RAG B;  1K9M R;  1ZBX A;  3R6O A;  5LJ5 h;  1YCY A;  3EGD B;  4YTL A;  2KMT A;  5GAM d;  2K7A A;  3LGL A;  5D6Y A;  1OV3 A;  1D3B B;  2LQK A;  2RA2 A;  4OGE A;  3OW2 A;  2C06 A;  3OYE A;  1O75 A;  1YJN T;  4J6Y A;  4BI3 A;  2R5A A;  1YWO A;  2RH2 A;  3QYG B;  2RPN A;  1ARK A;  2M02 A;  2RMO A;  5FW9 A;  2FEI A;  1OPL A;  1LOJ A;  2BE7 D;  4PFO A;  4M7D B;  2HL3 A;  2PVG B;  4JRP A;  1I4K 1;  4ELY C;  1D1A A;  2O31 A;  2A7Y A;  3CMA A;  5CKB A;  2RHZ A;  2M0Y A;  1HK9 A;  3SWN C;  5FWB A;  2MMP A;  2NUT B;  1M90 C;  1G83 A;  2L5Q A;  3A8H B;  4PJO G;  4M78 C;  3H8Z A;  5GMK h;  2DYB A;  2M0O A;  5CKF A;  5GAM g;  2NWM A;  3QPH A;  4J5Y A;  2F2W A;  3LYI A;  2DL5 A;  2EW3 A;  1NJI R;  2IG0 A;  3PGG A;  1IRX A;  3QBY A;  3QZ5 B;  5LJ3 h;  3CCR Q;  1U1S A;  4D8D A;  1PHT A;  1AD5 A;  1JEG A;  2IIM A;  2X9H A;  1C0M A;  1FYN A;  3HPW A;  5GAN f;  3S3O A;  3MEA A;  2P4T A;  1QVP A;  2FPD A;  3A8O B;  5CKH A;  2ESW A;  2HKQ B;  4A4H A;  5GMK l;  2JMC A;  4PJM A;  3CQT A;  2X3W D;  1NE8 A;  1QVG P;  3M59 A;  2GTJ A;  3PTA A;  4XU2 A;  4UC4 A;  3HFN A;  2DJQ A;  1K8A U;  2EKO A;  4HA8 A;  2R57 A;  4F14 A;  1ZLM A;  2KR3 A;  1MUZ A;  2QYZ A;  3L2U A;  4HCC A;  2H3E B;  1OOT A;  4R55 A;  4KUL A;  5GAN e;  4IUP A;  4QW2 A;  1ZQ1 A;  4QVZ A;  3QJY A;  3JCM P;  1JB0 E;  3CCQ T;  5GAO r;  1VYV A;  1SPK A;  4Y91 A;  1BIB A;  1OU8 A;  1KQ2 A;  2JTF A;  4OGC A;  3NTH A;  1OYX A;  1UDL A;  2PVD B;  1S72 Q;  4V2S A;  1VQ8 A;  2PVO B;  5D6W A;  1YFN A;  1VQ6 T;  2CYZ B;  3EAE A;  2HBP A;  4X9D A;  2E6N A;  2PNI A;  1KG1 A;  4NS5 A;  1KK7 A;  2D1X A;  4J9B A;  4M7D G;  2KDS A;  4E2F B;  3J80 E;  2DMO A;  2CT4 A;  1ZUY A;  3U23 A;  4BI8 B;  5KYW A;  3CCR A;  1VQO T;  1HJD A;  2ZPH B;  1KSW A;  3KFV A;  3V7C A;  2DFU A;  2DL8 A;  3MPU B;  3QDR B;  5FRO A;  4RG8 A;  3GP8 A;  5CQX A;  1D1B A;  2YHT A;  3CBM A;  5I22 A;  4XTW A;  3OYF A;  2B86 A;  1DJ7 B;  1HYO A;  1BI3 A;  3CCU T;  3HSB A;  1ZA2 B;  4PJO D;  2CRE A;  1M1K C;  3BW1 A;  2CKK A;  2LVM A;  4M78 D;  4F16 A;  1H3Z A;  1H64 1;  2XD0 A;  1Q7Y U;  1VQ9 T;  2QQA A;  2O01 E;  3HKS A;  5GAN d;  3MEW A;  1ZX6 A;  4M75 E;  2K3Y A;  3TRE A;  1BI1 A;  1WQ7 A;  2LJ0 A;  2VGM A;  2HKN A;  5KYX B;  5GMK i;  4C0Z A;  4WCI A;  3VS5 A;  2J05 A;  4QQD A;  3TEE A;  3E1S A;  2VWF A;  9ATC B;  1RI9 A;  5FRN A;  3G7Z A;  2OTJ T;  4PJO E;  1VQ7 T;  4PJN A;  2M16 A;  3T9N A;  1X6O A;  1UGR B;  2KBT A;  2XG8 D;  5KYU B;  5EG2 A;  1UG1 A;  2AT1 B;  3EHQ A;  3OMG A;  1KHC A;  1KFZ A;  1QLY A;  3I5R A;  2LDM A;  2LJ3 A;  3LH5 A;  2D6F A;  3RER A;  1PSF A;  1BBZ A;  2NUZ A;  2GTO A;  2E6Z A;  5FU6 C;  4A63 B;  2PUK B;  4O6J A;  2L3Q A;  1VQP T;  1RAB B;  2FYK A;  3VJP A;  3G4S T;  3CPW P;  2L3S A;  1XNI A;  1WHH A;  5GAM j;  5GAN g;  4EMK B;  3MKD A;  4DBF A;  3SWN A;  3JB9 J;  1QWF A;  2CP7 A;  4IIM A;  2BZX A;  3SDZ A;  1QW1 A;  1F1B B;  1KQS S;  1VQ4 T;  3OB9 A;  2K79 A;  4C92 A;  4M78 A;  2BZ8 A;  1RAC B;  4C5I A;  3CC2 Q;  2RJF A;  3L2V A;  5KCH A;  2E12 A;  2K9G A;  2OAU A;  1PRL C;  4N4H A;  2DL4 A;  4CC3 A;  1XJW B;  4XTY A;  4KUD K;  2AKL A;  1VQM T;  1KD1 C;  2B8A A;  1K9M U;  3FDR A;  1R8O B;  1LPL A;  2J06 A;  4ATO A;  3EGX B;  1VQL Q;  3JCM f;  3AHU A;  5GJW B;  2Y4Y A;  3OY9 A;  3EG9 A;  5GAO l;  5GMK m;  4JJB A;  4C0D B;  1WA7 A;  1X6G A;  1YJW Q;  1IHV A;  1TOV A;  3GOX A;  1Z9Z A;  4M7D E;  3VS6 A;  4PJJ A;  1FXX A;  3FRN A;  2F2X A;  1ACM B;  4C8Q E;  2E1H A;  2A37 A;  5J3B A;  3ULR B;  2WSF E;  2BTT A;  5HCK A;  3UAT A;  1Y96 B;  4M77 B;  1SRM A;  3KUF A;  1R0C B;  3EGD A;  2ZPB B;  2MAM A;  3VS0 A;  3CXC A;  2YUO A;  1YIJ Q;  3JCM e;  2EGA A;  1FMV A;  1GBQ A;  3QWX X;  2GQI A;  2FZC B;  3X26 B;  1VQK A;  2HMA A;  1AOJ A;  2AIR B;  1JJ2 S;  2DBK A;  2JM9 A;  1HXD A;  2JZ2 A;  2YRD A;  4E7L A;  3BDL A;  1NJI U;  5CR2 A;  3UDC A;  2CP2 A;  1JU5 C;  2DK3 A;  2VKN A;  1SHF A;  1OX8 A;  4IUT A;  3V7S A;  1Y0M A;  3CD6 T;  4C0F A;  4JJC A;  1VQ9 A;  3TSW A;  3E19 A;  3X24 B;  3QJ6 A;  4FU6 A;  2FB7 A;  2KXD A;  2JS2 A;  4RG2 A;  3A8L B;  3BY7 A;  4MML A;  4Y28 E;  2XMF A;  1BIA A;  2QK0 A;  3EH1 A;  3G1J A;  3MHX A;  3VS3 A;  3V7R A;  3LW5 E;  2COZ A;  2DRM A;  4OP0 A;  1VQL A;  2LCC A;  4L5G A;  1K0X A;  1A0N B;  1WJR A;  3UA6 A;  2YRV A;  1YJW A;  2Z0W A;  4WF2 A;  2E65 A;  2VC8 A;  1M27 C;  3VYG A;  1WLP B;  4JRK A;  3CCJ A;  4IUQ A;  4OB2 B;  4XU0 A;  2OTL Q;  3G6E Q;  1Q81 C;  3OS5 A;  2GFA A;  4A54 A;  2R58 A;  2J6F A;  5A2Q E;  3CMA T;  1K4U S;  4OF1 A;  2CZ7 B;  4MDW A;  1YIJ A;  3M0Q A;  4C0D C;  1T0H A;  5KE2 A;  1VQP A;  3OYD A;  2KYM A;  5CVI A;  4J9I A;  1D09 B;  1IHW A;  3NGP A;  3RBB B;  2CH4 W;  2SRC A;  1QCN A;  3OS0 A;  3PVQ A;  2CH4 A;  1FX7 A;  4M77 G;  2D9T A;  3TQ7 P;  1M2O A;  2O4X A;  5HY6 A;  1RAE B;  4F04 B;  6AT1 B;  3GF5 A;  5GAN j;  4ZGD B;  4XU3 A;  3N5B B;  2QA4 A;  4OMN A;  3I56 Q;  2X4J A;  1PWT A;  1PM3 A;  2LT4 A;  4F17 A;  2DZ9 A;  2KEA A;  2X4W A;  2D0N A;  2E5K A;  3BFM A;  1BI0 A;  2VV5 A;  4M75 B;  1X2K A;  3NHN A;  2DZC A;  3O8V A;  2KVQ G;  4QT7 A;  1YI2 Q;  1WYX A;  1X01 A;  2HQH A;  4EIK A;  3JCM J;  4C92 F;  3JCM g;  2ZPE B;  4BE0 A;  1WHG A;  2XKO C;  2RJC A;  2X35 A;  2EBP A;  2ROL A;  2G6F X;  2YWW A;  1BYM A;  1UE9 A;  3EG1 A;  3G6E A;  4JRI A;  1JBM A;  3I55 Q;  2DD4 A;  2MPX C;  4L6V 5;  3JB9 G;  2DXC A;  3C94 A;  3CCE Q;  2CP6 A;  1TTH B;  4M7A B;  2KAF A;  1VQ8 T;  1QVG S;  3JV3 A;  3VV0 A;  2LRQ A;  2E4H A;  1R0B G;  4CC4 B;  1U06 A;  1CSK A;  2EQJ A;  4J9G A;  1N8R C;  1KC8 C;  5GAO m;  2MI6 A;  4FW2 A;  4RCC A;  3CCR T;  3OYA A;  1AEY A;  2ABL A;  5DLQ E;  2HEQ A;  3PVL A;  5C6S A;  3EG0 A;  5KYX A;  1I1J A;  2E3I A;  2LQ8 A;  3I56 A;  3CD6 A;  2OAW A;  3F70 A;  1SRL A;  1NEG A;  3HTR A;  3RR6 A;  5KYU A;  1GFC A;  3L2W A;  4IUU A;  2O88 A;  3HRU A;  1YI2 A;  3H6Z A;  2FHD A;  4RTY A;  3CC7 Q;  2JVV A;  1M3A A;  1X75 C;  1D1C A;  3SHW A;  2MF2 A;  1I5O B;  2Y90 A;  1QP3 A;  3CC4 Q;  4M77 D;  2V1R A;  5IT9 E;  1Z9Q A;  2F2V A;  4OML A;  2VXE A;  4PFP A;  2ENM A;  1YJ9 A;  3I55 A;  5CKD A;  4B9W A;  4M75 C;  4F7U F;  2KRN A;  2DA9 A;  2DIQ A;  3CME Q;  4M75 G;  4C8Q B;  2EGC A;  1RI0 A;  1Y07 A;  1P92 A;  2VUB A;  4J9C A;  2X4Y A;  1S72 T;  2DX1 A;  4LUD A;  4Q5W A;  2DXT A;  4ZGJ B;  3EFO A;  5M9O A;  2KQW A;  4PJO C;  3WVD B;  3L2Q A;  5GAM h;  2GCX A;  1C1A A;  2ZAE A;  2KXC A;  5IXF A;  5CAI A;  2HD0 A;  2VVK A;  1RUW A;  4M77 E;  3JCM c;  2JS0 A;  3E9F A;  3VRY A;  3FC3 A;  3M58 A;  1I0C A;  3EG3 A;  1BK2 A;  2HL5 C;  3CCV Q;  4RTT A;  4M7A G;  4LDU A;  3QWY A;  1W1F A;  3VYH B;  3JB9 D;  1UJY A;  4J6X A;  2RQW A;  3EGX A;  3OQ5 A;  2VAS A;  4XTX A;  3M0U A;  4BDZ A;  2P4R A;  2X51 A;  4XQ3 A;  5AYF A;  1Q86 U;  3VS4 A;  2DKG A;  2KRS A;  2LCS A;  3OYY A;  1IGQ A;  3CC4 A;  3QHS A;  2AZV A;  2W0Z A;  2LNV A;  1NYF A;  1Y96 A;  4AFU C;  2ECZ A;  2F1L A;  3CPW S;  2IPO B;  2RHX A;  4HCK A;  2DM1 A;  3V8L A;  1TS9 A;  1KQS A;  1NLO C;  5GAN 7;  1Y7X A;  2HNI A;  2G3R A;  1PNJ A;  4AG2 C;  1QKX A;  4X34 A;  4FT2 A;  5I2S A;  2J7I A;  2EQU A;  1QVF P;  1PC0 A;  3JCM b;  1OUL A;  3FJ5 A;  2DIL A;  3HP9 A;  2YT6 A;  3G71 Q;  1K8A C;  1RAD B;  2QDL A;  2RQR A;  4M7D C;  1S1N A;  1K9A A;  1UHF A;  2KYB A;  1YIT Q;  4C8Q C;  3NMZ C;  1NM7 A;  3GLX A;  2X3X D;  1N9S A;  2CZ6 B;  2RM4 A;  2RB6 A;  4C8Q G;  5FU7 B;  1PG5 B;  4HT9 A;  1B7T A;  1JRI A;  3CCV A;  2O9V A;  5A0D A;  5GAO q;  1UFF A;  4M75 D;  4FCY A;  4LE9 A;  2VGN A;  4KRT A;  3O5Z A;  1N27 A;  5D6X A;  3LWH A;  3OMC A;  1K0S A;  1UB4 A;  1VQK T;  3H9N A;  4CC7 A;  5FRM A;  1G3T A;  1M1G A;  1YN8 A;  5IXB A;  3S3N A;  1PSE A; 
#chains in the Genus database with same CATH homology
 1VYU A;  1GBR A;  4AFZ C;  3REB B;  4JJB A;  1WA7 A;  4OMM A;  1X6G A;  1E7O A;  1Z9Z A;  3VS6 A;  2CT3 A;  1NYG A;  2DL7 A;  1LCK A;  2F2X A;  1T3L A;  2A37 A;  3VRZ A;  3PE0 A;  3ULR B;  1RLQ C;  3EG2 A;  1HSQ A;  2K2M A;  2BTT A;  3H0F A;  2JMA A;  5HCK A;  2EYY A;  3UAT A;  4RTX A;  2H8H A;  1JXM A;  1OPK A;  2HDA A;  2KT1 A;  2LQN A;  1SRM A;  2DLP A;  2EQI A;  3VS0 A;  4AFQ C;  1VA7 A;  4RTW A;  2YUO A;  2HBW A;  2A36 A;  1W70 A;  2EGA A;  2KNB B;  1AWJ A;  1GBQ A;  4OMO A;  4J9E A;  2RF0 A;  3QWX X;  2CUD A;  2ED1 A;  2GQI A;  1UHC A;  1WFW A;  2LQW A;  1AOJ A;  4RUG A;  5I11 A;  3H0I A;  1W6X A;  2EGE A;  2YUP A;  2FRY A;  2FO0 A;  2JTE A;  2YDL A;  2DBK A;  4HVU A;  2JM9 A;  2BZY A;  1AZE A;  1OEB A;  3VS7 A;  1JU5 C;  1CKA A;  2LZ6 B;  2VKN A;  1GFD A;  1MV0 B;  1SHF A;  1T3S A;  1Y0M A;  1ZSG A;  5IHK A;  4JJC A;  3TSW A;  2EKH A;  2AZS A;  2KXD A;  4M4Z A;  2JS2 A;  4ORZ A;  1WXU A;  1ABQ A;  1X43 A;  1GCQ A;  4JZ4 A;  1ZUK A;  2MIO A;  4LNP A;  4RTV A;  2XMF A;  2C0T A;  3VS3 A;  2DVJ A;  1K76 A;  2EYX A;  3IQL A;  4AFS C;  2DRM A;  4Y92 A;  3SEM A;  1TG0 A;  2DRK A;  3ZL7 C;  1K0X A;  1A0N B;  2GBQ A;  1YWP A;  1GRI A;  3UA6 A;  1ZBJ A;  5FWC A;  3I9Q A;  1M27 C;  4Z89 A;  2J6O A;  1WLP B;  4JPB W;  2M51 A;  2C0I A;  4LN2 A;  1M30 A;  1VYT A;  4Z8A A;  3EHR A;  2DBM A;  2J6F A;  1SHG A;  2CDT A;  1AWW A;  1K4U S;  2FRW A;  1TUD A;  2AK5 A;  2YUN A;  3M0Q A;  2KRO A;  1T0H A;  2HSP A;  2K7A A;  4JJD A;  2DF6 A;  1T0J A;  1OV3 A;  2KYM A;  4J9I A;  4E6R A;  2FPF A;  3EGU A;  2L2P A;  1YWO A;  3NGP A;  1CKB A;  3RBB B;  2CH4 W;  2RPN A;  2SRC A;  1ARK A;  2J6K A;  3PVQ A;  2CH4 A;  2L3P A;  2RMO A;  5FW9 A;  2FEI A;  1OPL A;  1NLP C;  1M3C A;  1ZUU A;  2O31 A;  1WI7 A;  2M0Y A;  2V1Q A;  1K1Z A;  4OMN A;  3VS1 A;  1PWT A;  5FWB A;  1V1C A;  3NPF A;  2KEA A;  4F17 A;  2D0N A;  1G83 A;  2E5K A;  5ECA A;  2FPE A;  1RLP C;  1WXT A;  1X2K A;  3NHN A;  3H0H A;  4QT7 A;  2K6D A;  1WYX A;  4EIK A;  1NG2 A;  2DYB A;  2YSQ A;  1YCS B;  2NWM A;  2RN8 A;  1QWE A;  2F2W A;  2LP5 A;  2DL5 A;  2EW3 A;  2EBP A;  2LJ1 A;  2ROL A;  2O2O A;  4HVV A;  2G6F X;  4D8D A;  1UE9 A;  3EG1 A;  1PHT A;  1AD5 A;  1JEG A;  2IIM A;  4IIO A;  4X1V A;  2MOX A;  1X69 A;  1FYN A;  2RQT A;  2FPD A;  1NEB A;  1H8K A;  2ESW A;  3JV3 A;  2EPD A;  2ED0 A;  2JMC A;  5IXB A;  4RTU A;  3CQT A;  2X3W D;  5IH2 A;  4CC4 B;  1U06 A;  2GTJ A;  2SEM A;  2JM8 A;  4OMQ A;  1CSK A;  1EFN A;  1B07 A;  2DJQ A;  4K11 A;  1JQQ A;  4J9G A;  1KIK A;  2LNH B;  2W10 A;  4F14 A;  3M0S A;  1ZLM A;  2KRM A;  5L23 A;  1M8M A;  2KGT A;  2KR3 A;  1MUZ A;  1WXB A;  1AEY A;  1AZG B;  1OOT A;  1YP5 A;  2ABL A;  1AVZ C;  2HEQ A;  2I0N A;  3PVL A;  1N5Z A;  1GCP A;  2HCK A;  3EG0 A;  1E6G A;  3M0T A;  1X27 A;  1PRM C;  1VYV A;  1JXO A;  1I1J A;  1AWX A;  5IHN A;  1SPK A;  2OAW A;  2ROT A;  4Z88 A;  1SRL A;  1NEG A;  3REA B;  1UDL A;  1Y57 A;  1KJW A;  1GFC A;  2O9S A;  1UEC A;  2O88 A;  4DEY A;  4RTY A;  3R6N A;  2PNI A;  1M3A A;  1AWO A;  1WX6 A;  2D1X A;  4J9B A;  3SHW A;  2LX7 A;  2DMO A;  2CT4 A;  1BU1 A;  1ZUY A;  3U23 A;  1HD3 A;  2V1R A;  4RTZ A;  1Z9Q A;  4ESR A;  2F2V A;  4OML A;  1GCQ C;  2ENM A;  1HJD A;  4HXJ A;  1KSW A;  3KFV A;  3C0C A;  2DL8 A;  2KRN A;  2DA9 A;  1IO6 A;  1ABO A;  4J9D A;  1G2B A;  2JT4 A;  2DE0 X;  5I22 A;  2EGC A;  4J9C A;  2OI3 A;  3M0P A;  4GBQ A;  2DNU A;  2B86 A;  1PKT A;  2DX1 A;  4LUD A;  1M3B A;  1U3O A;  2CRE A;  1UGV A;  3THK A;  2GNC A;  4F16 A;  2PZ1 A;  4HVW A;  2KXC A;  5IXF A;  4R0K A;  2FG0 A;  4J9H A;  1J3T A;  1UJ0 A;  2AKK A;  4GLM A;  2VVK A;  3I5S A;  1X2Q A;  4AG1 C;  2MCN A;  1RUW A;  2JS0 A;  2A28 A;  3VRY A;  1ZX6 A;  1I0C A;  1BK2 A;  3EG3 A;  2C0O A;  5EC7 A;  3TSZ A;  4RTT A;  3I35 A;  3A98 A;  3QWY A;  2LJ0 A;  1W1F A;  1SSH A;  2OJ2 A;  4D8K A;  5GJV B;  2K3B A;  2PTK A;  1UJY A;  4WCI A;  3VS5 A;  2J05 A;  2RQW A;  2CUB A;  3H41 A;  2D8J A;  2VWF A;  1RI9 A;  2KE9 A;  3M0U A;  4LUE A;  1MV3 A;  2RQU A;  2KT8 A;  4JZ3 A;  1WIE A;  2P4R A;  1XOV A;  2KBT A;  1E6H A;  1WDX A;  3VS4 A;  1UG1 A;  3EHQ A;  1H92 A;  2RNA A;  2KRS A;  2LCS A;  4OMP A;  1KFZ A;  1QLY A;  1FMK A;  3UF4 A;  1UTI A;  3UA7 A;  3I5R A;  3RNJ A;  2AZV A;  2LJ3 A;  3LH5 A;  2W0Z A;  1NYF A;  2RQV A;  2NUZ A;  1BBZ A;  2GTO A;  4AFU C;  2ECZ A;  4A63 B;  4J9F A;  2A08 A;  2L3Q A;  4FSS A;  2DM1 A;  4HCK A;  2D8H A;  1NLO C;  2EVR A;  2L0A A;  1PNJ A;  2L3S A;  4AG2 C;  2EYW A;  1QKX A;  3GBQ A;  2J7I A;  2LMJ A;  4ZNX A;  1X6B A;  1UUE A;  2DIL A;  1QKW A;  3FJ5 A;  1QWF A;  1GL5 A;  1YNZ A;  4IIM A;  2BZX A;  2YT6 A;  2QDL A;  2RQR A;  2DL3 A;  3VS2 A;  1S1N A;  2CSI A;  2K79 A;  1K9A A;  1UHF A;  3M0R A;  2BZ8 A;  1SEM A;  2KYB A;  3NMZ C;  1NM7 A;  1TUC A;  2X3X D;  3TVT A;  2K9G A;  1PRL C;  2DL4 A;  4CC3 A;  1I07 A;  2O9V A;  1B3Q A;  1U5S A;  2YUQ A;  1H3H A;  2AKL A;  4CC2 A;  1UFF A;  1PKS A;  4LE9 A;  5IHI A;  2J06 A;  3O5Z A;  1JO8 A;  1QCF A;  4KRT A;  4DEX A;  2GGR A;  2CSQ A;  1K0S A;  1BB9 A;  4CC7 A;  5GJW B;  2JW4 A;  1YN8 A;  2EYZ A;  2JXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...