3TU4K

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
AKTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
total genus 44
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3tu4K00
4BB7A 4FT2A 4LD9K 4DA4A 3PTAA 1ZHIA 4KUDK 3PT9A 4DOWA 2FL7A 1W4SA 4FT4A 4KUIA 4KULA 2FVUA 1M4ZA 4DOVA 4FSXA 4JJNK 1ZBXA 3TU4K
chains in the Genus database with same CATH superfamily
1Q81R 3LWIA 1I0CA 2JOYA 2ABLA 1WNLA 4KH1B 3MP6A 3OYMA 1SKUB 3GF5A 2EPDA 3SWNA 3UF4A 2DO3A 3EFOA 1RAHB 3QJ6A 3CCJQ 2XG8D 1BK2A 3L2WA 1VQOA 2G6FX 4N4GA 1JEGA 2QA4T 1Q81U 2A08A 2HNIA 4JRIA 2NUPB 4XQ3A 4FU6A 3ULRB 4EDUA 3E2UA 1K9MC 2IPOB 3EG3A 5IXBA 1E6GA 2RPNA 1RAEB 2K79A 3OYDA 5GAN5 1PWTA 2DL4A 2HCKA 3SB2A 2DXCA 2EFIA 2XMFA 1AHJB 4IUVA 1EFNA 2DAQA 5L8RE 1H92A 2OJ2A 3HRTA 2R57A 4LDYA 3RESA 2JMCA 2RK1A 1K73C 1W70A 1GCPA 1FMVA 1M3CA 4IUPA 5A2QE 2CT3A 2R5MA 3CCRA 1U1TA 4HXJA 1RLPC 3NHNA 4E7IA 4JUVA 1JJ2S 5CAIA 3ASKA 1RAAB 3IQLA 2DL3A 3GNGA 1Y07A 2CP3A 3OYLA 4FSSA 1IHWA 2HQHA 1TXQA 4F7UG 3QYHB 2BZ8A 1YP5A 5IAYA 2ESWA 5GANg 2ZGWA 1NZ9A 2ENMA 4HVVA 2YUQA 4J9CA 2RQVA 4LN2A 2OTJT 4A4KA 3CC4T 2VWFA 3HP9A 4KULA 2DFUA 4D8DA 3CCVT 2X4WA 4J9HA 3EG9B 7AT1B 1VQPA 3G1JA 5C0MA 1X27A 1RACB 3QJYA 4IIOA 3O5ZA 2JW4A 4KT0E 4OMFB 4RG8A 4R56A 4IURA 2V1RA 3QZ5B 1VQKQ 1V1CA 4PLLA 3MHXA 1G3SA 1Q7YR 4NS5A 2X3XD 2E4HA 2V8JA 2DF6A 3JCMX 3EG0A 2QGFB 2WSEE 1PD0A 1X2KA 1PNJA 3X20B 3JCMb 1W2BP 2LNVA 3I5RA 5FU7C 2ATCB 4FYVB 3UA7A 1VQ7T 1M1KR 4RG2A 1Q7YU 3VS6A 1PKSA 1C1AA 5GAOn 3CEYA 2E3IA 1XQHA 1I4K1 4QVCA 1Q86R 4J9DA 1M1KU 1ZLMA 5GAMh 2OTLA 1U3OA 2I2LA 2C0IA 2DTIA 3CPFA 4M75A 1YJ9T 1WZOA 3CCMQ 4KH0B 1K0SA 4LDUA 4XTUA 1LPLA 3A5ZB 2DE0X 1KD1C 1Q86U 1YHQT 4KUIA 2KI7A 2LP5A 3C4SA 2VXEA 2B86A 3DB3A 3CXCP 4AFUC 4V2SA 3TQ7P 3GPLA 2PVGB 3J81E 2C0OA 2HL5C 2PVOB 5EC7A 2EQIA 2YRDA 3A1PA 1YJWT 1VQ4T 3E9FA 3M59A 3V8JA 5LJ5e 3H0IA 2DBKA 2RHIA 5GMKl 2E3HA 1QCOA 2YLBA 1BI3A 1S72T 1TU0B 1YJNQ 1RADB 4OMNA 4C92B 2QG9B 1JJ2A 2AT1B 4PFOA 4PJOA 1I8FA 5KYUB 3REBB 4PJOD 3M0QA 4C5HA 4X34A 3CC7Q 5HK0A 3M4GA 4OMLA 2NUZA 4C92E 4A54A 1QVPA 1WIEA 3CCSA 1AOJA 1SRMA 2CDTA 3JSCA 3TEEA 4RTYA 4A4EA 5GAN6 2QDLA 3OY9A 1IRXA 4J9BA 4II1A 2KR3A 1BKBA 4F7UF 4EMKB 3OS1A 4C5GA 1X75C 3JCMg 1M3BA 2LT1A 1K9MR 2SEMA 1NJIC 1OZ3A 2HQEA 2QI2A 1PD1A 4M77C 3JCMJ 3VS0A 2AHJB 4OMOA 2RI2A 1K9MU 2E10A 4XAXB 2X9HA 4UC4A 4L59A 1VQOQ 1YI2Q 2QGGA 2Z0WA 2OI3A 2FL7A 1ZA1B 1WX6A 1I81A 1ZUUA 1W2BS 2RA2A 2LT4A 3G4SA 1PHTA 3H0FA 3CCEQ 2C0TA 1AZEA 3BDLA 4ELYC 8ATCB 5FU6C 3OQ5A 4OMPA 2ED1A 5GANh 4FT2A 1WXUA 2LZ6B 1T3SA 5I2SA 2DL7A 1AWWA 1KK7A 3KUFA 4HA8A 2AKLA 4ATOA 4M7AB 1EIFA 4M7DC 4ZN1A 1JBMA 2AKKA 3SDZA 4C8QB 5A0GA 3G7ZA 1Q82C 1QCNA 3CCRQ 3E1SA 4BI8B 3VV0A 3QHSA 4M7AE 4R55A 2F2XA 1QVGS 2KY9A 5GJWB 3PVLA 1G3WA 4DA4A 4C8QE 3OYKA 3M0PA 1ZHIA 3MO8A 1FMKA 4E7LA 2KAFA 1U06A 1FYNA 3HFOA 5GAOq 1MHNA 5FW9A 1KC8C 3RMSA 4OP0A 1Y96B 2BTTA 4FL6A 2ECZA 1RI9A 2D8JA 1E7OA 2PUOB 4OB3B 2KBTA 1N27A 3CCJT 1WHKA 2K5IA 3MCAB 1VQPQ 2KEAA 3CQTA 1WFWA 2XKOC 3QPHA 4WTOB 2DJQA 4Y91A 2RI5A 2MIOA 3OSVA 4JLGA 1D09B 2VYTA 1LVKA 4PJLA 3JCMV 3VS5A 1YIJA 4RCBA 1OZ2A 2E1HA 1M8VA 1G8XA 1M2VB 4LDWA 4BUGA 3KFVA 5KYWA 1AWOA 3V7RA 2K2MA 2NUTA 2DILA 4BDZA 3L1AA 2PVDB 5GAMj 3SFMA 3LYIA 2A28A 1WI7A 3CBMA 4QVZA 2K57A 1JXMA 2FRYA 1AEYA 2O9VA 5FRNA 2RK2A 4L5GA 5C6SA 4C5EA 4ANJA 4F14A 1UB4A 1UECA 2GBQA 2RJDA 1PG5B 1BB9A 1TUGB 4E47A 2ZAEA 2CZ0B 3PMTA 2HSEB 1M9SA 2KDSA 2OTLQ 3OYBA 1H3HA 2KVQG 3HL8A 2EYZA 4PJJA 5D6WA 2K2VA 2JUFA 5GAN3 4JLIA 5KE3A 2EJFA 3TREA 3L2RA 2SRCA 4J9FA 1CKAA 1B7TA 2KMTA 4IKFA 1ARKA 1IXDA 1T3LA 2O2OA 1QMCA 2FB7A 4HT8A 4EMGA 1PC0A 4FW1A 5GANf 3ZEHA 1CKBA 4M75G 6AT1B 4HVUA 3G71A 2VVKA 1VQKT 1W6XA 2EJ9A 1M27C 1BCMA 2GCXA 3PVQA 1TG0A 3C95A 2YRCA 5FWCA 1TWBA 3TSZA 2L8DA 4D8KA 2LC4A 3JB9H 2CSQA 2L3SA 3FJPA 1NEBA 2X4YA 4QT7A 1NPPA 1M90C 3UATA 1X69A 2VGMA 3V7CA 1QVGA 2DEUA 1NLPC 1SSFA 4J5YA 4M78B 5GAOl 1GL5A 2X35A 2X4XA 1QP3A 3CBOA 3LGFA 1PM3A 1NM7A 3CCSQ 2DPPB 3FB9A 2KYBA 4M78E 3KXTA 2EQUA 3I55T 3SHWA 3OS0A 2HAXA 2QQBA 1IHVA 2BKDN 2A3LA 1P92A 1SHFA 3CCMT 3C94A 2DYIA 2RQRA 1TTHB 1SEMA 5CKHA 3CC2T 3MEVA 1UGVA 4A4FA 2COZA 2CP0A 2KROA 3ZFJA 1HD3A 1VQ6A 3PT9A 4J7FA 4JPBW 4N0AC 1OX9A 4XTWA 3BFMA 3HRUA 1X01A 3D7SB 2DM1A 5A0DA 4CRIA 5GMKh 2LJ0A 4C92C 1M8MA 1ZX6A 5FROA 3N5BB 2FO0A 4C0FA 5CCAA 3G4SQ 3H8ZA 1X6OA 1YJNT 1W4SA 1KQSS 1OQKA 2H3JA 4C0GA 3OYCA 2HL3A 3I5SA 2PU9B 2JT4A 2J6OA 3JCMQ 1PRMC 3CC7T 2RNAA 1OU8A 3A8HB 2L3QA 3CCLA 1UGSB 2F1LA 2OAWA 4OF1A 3LLRA 2LTOA 2D0QB 2MMPA 2COYA 2OX7A 3C12A 4RUGA 4EMKC 4M77A 2KK4A 4LD6A 5LJ5g 2BIVA 3C0CA 5CK9A 3L2QA 5FLXE 2LQKA 1YN8A 1QVFS 4HVWA 2X4JA 2Y4XA 1YI2A 5GAMd 1W1FA 3EHRA 3RUXA 1GFCA 3CD6Q 1WHLA 1K4US 2ED0A 3GNFB 2RHYA 3NGPA 2HKQB 4ELZC 4LXCA 5CKDA 3CCEA 1C6VX 1D3BB 4ME7A 3JCMW 2CZ7B 1N9RA 1SRLA 3EGDB 3JCMf 4ZN3A 3LGLA 2FPEA 3MEWA 1QKWA 4M75F 3URGA 1VQOT 1M30A 3NTKA 4GLMA 1B3QA 4M7DA 4GLKA 2MWPA 2EW3A 1YIJQ 3DLMA 4PJNA 2FRWA 4M7AC 2D0NA 4J8OA 4BI4A 2E41A 4C0ZA 1K76A 2L2PA 3HTRA 4C8QC 2EWNA 4MZTA 4CC2A 5LJ3f 1YWPA 1YWOA 1YITT 2XIDA 3CCUA 5J3BA 5CIUA 5IHNA 3BY7A 3OS2A 3Q1JA 5J39A 2OTJA 3PFSA 4FCYA 3OYAA 1VQNQ 4JJDA 2QTXA 2F2WA 3AHUA 2GGRA 4K11A 4M7AG 2NUPA 3THKA 3OYNA 4J9EA 2QQAA 1NE8A 4RMOA 4PJOF 2E64A 2RHUA 3CMAT 2KT1A 2JM9A 3OA6A 3MKDA 4RTXA 4OB1B 2JTMA 4QW2A 2M02A 4AMCA 3R6NA 1VQMT 2AZSA 4XU3A 4IUQA 5CKFA 1QCFA 1S1NA 3OBWA 1M90R 5GAN8 1VQ7A 4FSXA 2RF0A 2E6NA 5KYXB 3META 1KQSA 3PIOA 1WA7A 1RUWA 4MMLA 3QYGB 1JB0E 3QSUA 3CCQQ 4JRKA 3G71Q 1HXDA 2HEQA 5HCKA 1HYOA 2LCSA 1M90U 1G83A 3T9NA 2VV5A 2DIQA 1Z9QA 3E19A 4IUTA 1M4ZA 1IGUA 3QXEB 5GMKi 1HSQA 2EYWA 3EFSA 4VUBA 1TUDA 4XU2A 5GAMe 2VB6A 1QWFA 4OGCA 5GANd 1VQLA 5D7UA 1QVFA 1U8RA 4M75D 5AT1B 3ZBDA 3V8LA 4C0DB 4PFPA 3FIFA 1VIFA 3EG9A 2HBWA 4LNPA 2V8KA 2LX7A 3H6ZA 4PFZA 1MMAA 3I56Q 1PKTA 1LCKA 2E12A 2D8HA 4Z88A 3LW5E 3JAME 3P8BB 2Y90A 1M1GA 3VYGA 2KXDA 1FX7A 1ZUKA 2F69A 2OTLT 2K7AA 1VQ5Q 2HSPA 3ME9A 3DLLA 5GMKj 2O88A 2QEXA 1ZSGA 1WXBA 4J6YA 1S72A 1WQWA 4FT4A 3VUBA 2XU8A 2CZ1B 3HKSA 2HMAA 5J26A 1VQ6Q 1OULA 2CUDA 1JRIA 1WHJA 1KFZA 3JCMc 1LNXA 3TCJA 4BI3A 5GAOr 3LH0A 1M5Q1 2XI9A 3F70A 5KYYB 4HKEA 2CZ6B 2VUBA 5LJ5h 3GLXA 3GOXA 2DD5A 1D1BA 1K0XA 4OVAA 3UA6A 3GIBA 1VYTA 2DLPA 3S3MA 3BDUA 1AT1B 2HDAA 1JXOA 2PTKA 2IG0A 4BE0A 4M78C 3M0SA 3FC3A 1O75A 3EGXB 3RKWA 1IZ6A 3QWXX 3VS4A 3SD4A 2QXFA 2KRNA 4ZGDB 4QQ6A 1BI0A 2RO0A 3CCLQ 4BY6B 4OB0B 2LJ1A 1Y71A 2JJ9A 4PKCC 2DERA 1SPKA 1Q95G 2CKKA 2JVVA 2JXBA 3A8LB 3CCST 1VYUA 1D0XA 2O01E 1UE9A 2K5LA 2RMOA 3M54A 4X1VA 4N0AA 2FG0A 3MJXA 1KIKA 4MDXA 4EIKA 1K73R 2YUNA 4DOWA 3FEOA 1IB8A 5D6XA 5LJ3g 4C92A 5KH6A 5KYUA 2Y4YA 4M77G 3QKJA 2ZPEB 3BE3A 2QYZA 2C06A 1K73U 3TU4K 1WJQA 4DBRA 1UTIA 2RQUA 2QTVA 1VOMA 1MGQA 2QAZA 2L5QA 4JRPA 4DBQA 2P84A 4N4HA 3RKYA 1MNEA 2XICA 2X51A 2F5KA 4B6MA 1B07A 4F7UB 4EMKA 1HK9A 1LJOA 1WXTA 2DKGA 3OB9A 3TSWA 2J06A 3JCMd 2GQVA 4BE1A 1HJDA 4P5NA 2FHDA 5CQYA 2BZYA 5GAN2 4F7UE 2DX1A 3HHTB 3CCUQ 3CD6A 4J9IA 3CXCS 1XJWB 4E7ZA 4M7DG 2OTJQ 4FIBA 3L2ZA 3CC4Q 1MMDA 1PCXA 3PE0A 3CMEA 1OYXA 2LRQA 2J05A 4JJNK 3CCVQ 2B8AA 1U1SA 2RD1A 1SF9A 4KGVB 2P4TA 4O6JA 3JV3A 4JZ4A 4JZ3A 1UHFA 3OYJA 3QZ9B 3VKIA 1UGRB 2LMJA 4R0KA 1VA7A 1WPYA 5LJ5f 4HCBA 4LDXA 1RAGB 5I11A 2RH2A 5GAOp 1PSEA 3J7AF 1N9SA 4M7AA 5GAN7 5A0LA 2DXUA 2KYMA 1R0CB 2CP7A 1NLOC 4C8QA 1VQ7Q 3EFRA 3OYGA 2FEIA 2KQWA 4PLIA 1OPLA 1KD1R 2DTHA 1B34B 1VQNA 3LWHA 1CSKA 2VGNA 3OSSC 3JB9I 2CH4A 4FYWB 1JO8A 2XK0A 1KD1U 2IVWA 2DA9A 5DLOA 1QW1A 1VQLQ 1Y96A 3GBQA 3RIRA 2RQTA 2JTFA 3S3NA 4MZPA 4AFQC 1YHQQ 2L89A 1PSFA 2J6KA 4Z02A 3S6WA 2LQ8A 1WGSA 2KGTA 1YBYA 1W2BA 2XHCA 1VQ9A 2K9GA 2CSIA 3QIIA 2PUKB 2R58A 1VQ4Q 4YTLA 1M2VA 3CPWP 2P0QA 4FM4B 1IGQA 4XU0A 2YT6A 3X25B 9ATCB 3UT1A 3CCQA 2EIFA 2K5FA 3O8VA 2M0OA 2QEXQ 2DIGA 2MCNA 1S72Q 2GTOA 2VXFA 3PMIA 4M77F 1BI2A 2JM8A 4XTZA 3FJ5A 2CT4A 3JCMh 3OMGA 2ROLA 1UHCA 3PNWC 3V8KA 1B34A 5IXFA 3OYIA 1T0HA 1XOVA 3LX7A 2M1HA 4KBMB 4E7KA 1K8AC 4WCIA 1ABQA 2PZ1A 1SHGA 1WYXA 1BU1A 1NJIR 3CXCA 3G71T 1Q7YC 3I56A 2CYZB 5CVIA 1UEBA 3VYHB 1VQ8A 4C0DC 2MYSA 5LJ3h 2PNIA 1SSHA 2RJEA 1NJIU 2DZ9A 1YNZA 1H641 4OMQA 1VQ5A 2EKHA 2RB6A 1Y7XA 4M7DF 1X6BA 4Y92A 1R77A 1SG5A 2RHZA 3JB9J 1AVZC 4AG1C 2D9TA 5HY6A 2ZPHB 4FYXB 1G2BA 1UGPB 8AT1B 4E7SA 2WACA 2LCLA 3M0TA 3L2VA 5GANj 2JZ2A 3QO3A 1MMNA 1YFNA 5CQXA 3SWNB 5GMKe 2YHTA 2F5TX 3MEUA 3EFOB 3V7SA 1KSWA 2YWWA 2EGEA 2E65A 1KG1A 1IREB 1QQJA 4PL6A 1Q82R 5KCHA 2CREA 1I1JA 3M0RA 2J6FA 3OYEA 3G6EA 4J9GA 4M78A 4AFSC 1D1AA 1VQ6T 2DXBA 3SEMA 2CS7A 2MF2A 1IO6A 1A0NB 4JRQA 1Q82U 2K6DA 1BI1A 4C92G 1AWXA 1KC8R 3U23A 4OMMA 4DEYA 1ZA2B 2JN0A 3RBBB 4X9CA 1BIAA 3VS7A 4M77D 3DKMA 5I2MA 4E2FB 2QA4A 1NPRA 4BY6C 3VJPA 4BD3A 3RNJA 1YCYA 5FWBA 2V1QA 1QWEA 5IN1A 2J7IA 2YXYA 3JCMP 1JQQA 1KC8U 3I9QA 1KJWA 3L42A 1MMGA 2CP2A 3CCLT 1ZSZB 5FRMA 4HCKA 2DRKA 4ZGJB 4CC7A 3CPWS 3CMEQ 4DQ2A 2L0AA 3ER0A 1MV3A 2HD0A 4LE9A 2IIMA 1R0BG 2KE9A 1TUCA 2YSQA 3MPUB 1UGQB 2AIRB 4HCCA 1Y0MA 3EH2A 3VS2A 1H8KA 2FZGB 1YI2T 4J83A 4RCCA 2EQMA 2K3BA 1OOTA 4M7DD 2DXTA 3RKXA 1WLPB 1K1ZA 1YITA 3CCET 1KHIA 2ZZDA 1TS9A 2JS2A 5IT9E 2QQ9A 1ZBXA 4GBQA 4ZTFA 1G5VA 4MDWA 2MPXC 2K3XA 3PTAA 3CC4A 4A4GA 3S3OA 5LJ5d 2XDBA 2MWOA 1RABB 3CCVA 2CGHA 3QBYA 4ZTJA 3NTIA 3CCRT 2EBPA 5GAN4 1ACMB 3MP8A 3CMAA 2GQIA 1ZSZA 2VC8A 1D0ZA 4E7HA 1UDLA 3NPFA 2H8HA 4C8QG 5ECAA 4ZGEB 1TSFA 1N8RC 3M0UA 4DEXA 1WHGA 1D3BA 3CCUT 1VQMA 2E70A 1M2OA 2JMAA 4X9DA 2EKOA 3EGDA 3P8DA 3QWYA 3MP1A 1VIEA 1OX8A 2DVJA 2KXCA 3NFCA 4M75B 3QUIA 2BE9B 2P4RA 4XTXA 1OEBA 2LX9A 2QQSA 1H3ZA 4IIMA 1VQ9Q 2MAMA 2RM4A 4RTWA 1EZZB 1K8AR 4M75E 1VQPT 4BDYA 1NYGA 2GTJA 4XU1A 4CC4B 5CO7A 1UJ0A 3RMQA 3EH1A 3GP8A 2GFUA 4E6RA 2CH4W 1R8OB 4M4ZA 4CC3A 3AT1B 3X28B 5DLQE 1K8AU 5LJ3j 1TOVA 3OW2P 1YJ9A 4QQDA 2VASA 1WJSA 1ZBJA 4JJBA 2EVRA 1M3AA 4F17A 3UPUA 4EMHA 2EQJA 4C92F 1YHQA 4F16A 2GNCA 4PJOB 1OU9A 1FWZA 3HPWA 2XDDA 4Y28E 2DEQA 2EJGA 1MV0B 4B9XA 4OB2B 1GCQC 2BZXA 3I55Q 3CPWA 1VQ8Q 3A8MB 3CBPA 4PJOE 5CKEA 2RQWA 3QDFA 1YJWA 1VQ4A 2XDPA 1J3TA 2CP6A 1G3YA 2M9UA 1QVGP 1VQLT 3M56A 3WXMB 3CC2Q 3VRZA 5KYXA 1AD5A 2KRSA 2EGAA 1GBQA 1ZUYA 4NL2A 4DBHA 1I5LA 4KRTA 2AK5A 2G3RA 2P0PA 3VS1A 2DTOA 1GXIE 3NMZC 2K4YA 3PIPA 5L23A 2A7YA 1UFFA 4ZNXA 2M16A 1RI0A 5GMKm 1M1FA 2LQNA 2JNGA 2QEXT 2BE7D 2D6FA 1X2QA 4RTZA 2YRVA 1MNDA 2FZKB 4AFZC 2ZPFB 2K3YA 2DYBA 1O9SA 4B9WA 3G6EQ 4JJCA 2M0YA 2DJZA 4LUEA 2L3PA 1I5OB 3RR6A 2HZYA 1Z9ZA 3PGGA 1GRIA 2O4XB 4HCZA 2R5AA 1N6AA 3KBGA 2O9SA 3M5AA 2MI6A 4TVRA 2F2VA 2KNBB 5I22A 3EHQA 2ZCFB 4IUUA 2ROTA 4QKUA 4DOVA 5DM7R 1DJ7B 4MMKA 4M7AF 3H0HA 2LCCA 2H3EB 3QG1A 2KRMA 4M78G 3JB9G 4C8QF 2QA4Q 3JRZA 1PRLC 2DL5A 1LOJA 4KUDK 5IHIA 3H9NA 1NYFA 1X43A 2E5KA 1OV3A 4C92D 5IH2A 5KE2A 1MUZA 3OYHA 1GBRA 4AG2C 1XTDA 3SWNC 5KYYA 4XK8E 2COWA 3INZA 2X3WD 5GANe 4BB7A 3WVEB 1GFDA 5KCOA 3X26B 4QQGA 1RAIB 3J80E 2GFAA 1KHCA 2NYSA 2EGCA 3OW2S 3EGXA 2MOXA 2WSFE 1D1CA 4PNOA 3OBYA 3X24B 2O4XA 2ZPIB 2NWMA 2OAUA 2FPFA 3G4ST 1YITQ 3EG2A 2DL8A 4LD9K 2FYKA 2KSSA 4D6WA 5CKBA 1OPKA 1Y57A 1N8RR 5GAMf 5KYWB 1XNIA 2NUTB 2W10A 2CP5A 4XTVA 2MK5A 2FVUA 2DNUA 1V76A 3FRNA 2FPDA 2RJCA 4JDSA 1N8RU 2W0ZA 3CCJA 4WF2A 1NBEB 3A8OB 4ORZA 2RHXA 2EYXA 2DMOA 3CMAQ 2L3RA 1ZSZC 2D1XA 5LJ3d 1BIBA 4CI0C 5DY9A 3VRYA 2DD4A 3RDVA 1VQMQ 3CD6T 5AYFA 4BACA 4MZMA 3ZL7C 1Q81C 5HKCA 1G3TA 2E5QA 3R6OA 3OMCA 4J6WA 4DBFA 4QVDA 2GF7A 3DB4A 5IHKA 3EG1A 3CMET 1E6HA 1F1BB 4M7AD 4J7IA 2LDMA 3TVTA 4F7UA 4C8QD 3H41A 2QDYB 1ABOA 4XTYA 2FZCB 3I35A 5FU7B 1YIJT 3REAB 3LH5A 2JS0A 2NLUA 5KYNA 1YJ9Q 4KGZB 3P8HA 2E6ZA 1V29B 1AZGB 3EGUA 4LUDA 4NOYA 1KQSP 2YUPA 4PJMA 4RTVA 4BE2A 4KGXB 1D0YA 2HKNA 1VQNT 2V8IA 3VU3C 2RN8A 3OS5A 4M78F 3JB9F 3M57A 1FMWA 1QKXA 4FW2A 2QASA 4OGEA 5GJVB 3M58A 1YJWQ 4M75C 2HQXA 1VQKA 1U5SA 2YUOA 2DRMA 1QLYA 4PK4A 5LJ5j 1QVFP 1ZQ1A 3HSBA 3QDRB 3BW1A 1WQ7A 2CUBA 3OW2A 2AZVA 1I07A 2DBMA 2P0KA 3M4YA 3JCMe 4EPCA 4A4HA 1VYVA 1JU5C 1C0MA 3MEAA 1VQ9T 4JS4A 2RJFA 1OI1A 2DVEA 1K9AA 1WDXA 4C5IA 1TH7A 4GY5A 2LJ3A 1AWJA 2DK3A 3CCQT 2VKNA 2DZCA 2LVMA 3VUZA 4JS5A 3E9GA 3I55A 1GCQA 5D6YA 1WJRA 3VS3A 5LJ3e 1NG2A 4PJOC 1N5ZA 1FXXA 1RLQC 4FYYB 3M9QA 3CCMA 5I21A 1JJ2P 4RTUA 3UWNA 5GAOm 2DETA 4RKUE 1M1KC 1EX4A 3OYFA 2EQKA 3HFNA 3EAEA 1X6GA 5EG2A 3CC2A 1UUEA 4F04B 2PQWA 3A8GB 3FLGA 3M55A 3FDRA 2JTEA 1WHMA 4N4IA 1YCSB 2YLCA 4LDVA 4NL3A 3I56T 1BCOA 5M9OA 1Q86C 4PJOG 1VQ8T 2V26A 4Z8AA 3NTHA 4M77B 2XD0A 4L6V5 3WVDB 1VQ5T 2QQRA 1UG1A 1KQ1A 4A53A 5CR2A 5GAMg 1VUBA 4M77E 1YJNA 4Z89A 1QP2A 2RI3A 4ESRA 1RAFB 2QK0A 2EAYA 4A63B 4O5VA 2A37A 1NEGA 1WHHA 3CC7A 2A0FB 4M78D 4AT1B 3JB9D 3HRSA 2M51A 3OYYA 1T0JA 4RTTA 2HBPA 5HK3A 2WSCE 1BBZA 5FU6B 4E7JA 2LNHB 1UJYA 2ZPBB 1KQ2A 2LQWA 5LL6S 1BYMA 3UDCA 2EYYA 2KT8A 3L2UA 3RERA 4M7DB 3M53A 2I0NA 2YDLA 2EYQA 4J6XA 2BUDA 3G6ET 3A98A 2O31A 2ZPGB 1RL2A 4HT9A 2A36A 4M7DE 4Q5WA
chains in the Genus database with same CATH topology
4M7DD 3UPUA 3LWIA 4EMHA 2JOYA 1MGQA 1WNLA 2EQJA 4C92F 2KMTA 1YHQA 4IKFA 4PJOB 2L5QA 3MP6A 3OYMA 4JRPA 1FWZA 3GF5A 3SWNA 3HPWA 2DO3A 2FB7A 2XDDA 4HT8A 4Y28E 2DEQA 2EJGA 3QJ6A 4N4HA 2XG8D 4B9XA 4OB2B 4EMGA 3RKYA 5GANf 3ZEHA 3L2WA 4M75G 1VQOA 2XICA 4N4GA 2F5KA 2QA4T 3G71A 1Q81U 4F7UB 3CPWA 2HNIA 1VQKT 2EJ9A 3A8MB 4JRIA 4EMKA 3CBPA 4PJOE 2GCXA 4XQ3A 4FU6A 5CKEA 1HK9A 1LJOA 4EDUA 1YJWA 2DKGA 3OB9A 1VQ4A 3C95A 2XDPA 1K9MC 3JCMd 2GQVA 2L8DA 4BE1A 4P5NA 2LC4A 3JB9H 2FHDA 5CQYA 1G3YA 3FJPA 2M9UA 2X4YA 3OYDA 5GAN2 5GAN5 3M56A 1VQLT 4F7UE 1NPPA 3WXMB 3SB2A 2DXCA 1M90C 3HHTB 2EFIA 2VGMA 3CD6A 3V7CA 3CXCS 1AHJB 4IUVA 2DAQA 5L8RE 1QVGA 4M7DG 3HRTA 2R57A 4FIBA 3L2ZA 1SSFA 4LDYA 3RESA 3CMEA 4NL2A 4J5YA 1OYXA 2RK1A 2LRQA 4M78B 5GAOl 2X35A 2X4XA 4JJNK 1QP3A 1K73C 1I5LA 3CBOA 2B8AA 2G3RA 2P0PA 3LGFA 2DTOA 1GXIE 1U1SA 4IUPA 5A2QE 2K4YA 2RD1A 3PIPA 2P4TA 2R5MA 4O6JA 3CCJT 2DPPB 3FB9A 2A7YA 3CCRA 1U1TA 4M78E 2M16A 1RI0A 2EQUA 1M1FA 5GMKm 3OYJA 3I55T 4JUVA 3KXTA 5CAIA 3ASKA 4E7IA 1JJ2S 2JNGA 3QZ9B 2QEXT 3VKIA 3OS0A 2HAXA 2QQBA 1UGRB 2D6FA 3GNGA 2BKDN 1Y07A 2A3LA 2YRVA 1P92A 3CCMT 1WPYA 2ZPFB 5LJ5f 4HCBA 4LDXA 3C94A 2K3YA 3OYLA 2RH2A 1O9SA 4B9WA 4F7UG 5GAOp 3QYHB 1PSEA 3J7AF 1N9SA 4M7AA 5CKHA 3CC2T 3MEVA 2DJZA 5GAN7 5A0LA 5IAYA 3PGGA 2DXUA 4A4FA 5GANg 2O4XB 2ZGWA 4HCZA 2R5AA 3ZFJA 1NZ9A 1VQ6A 4C8QA 1N6AA 3KBGA 3EFRA 3M5AA 3OYGA 2MI6A 4A4KA 2OTJT 3PT9A 4J7FA 4TVRA 2KQWA 3CC4T 4PLIA 4N0AC 3HP9A 4KULA 2ZCFB 4IUUA 4XTWA 3BFMA 4DOVA 3CCVT 2X4WA 5DM7R 1DJ7B 3HRUA 1VQPA 5C0MA 2DTHA 1X01A 1B34B 4MMKA 1VQNA 4M7AF 3QJYA 2LCCA 5A0DA 3QG1A 4CRIA 3LWHA 5GMKh 4KT0E 4OMFB 4C92C 4RG8A 4M78G 3JB9G 2VGNA 4R56A 4C8QF 4IURA 3OSSC 3JB9I 3QZ5B 5FROA 3N5BB 4C0FA 5CCAA 3JRZA 4PLLA 3MHXA 1G3SA 1LOJA 4KUDK 3H8ZA 4NS5A 2XK0A 1X6OA 1YJNT 1W4SA 1KD1U 1KQSS 2IVWA 2V8JA 2H3JA 5DLOA 1QW1A 4C0GA 3OYCA 1Y96A 3JCMX 3RIRA 4C92D 3S3NA 2JTFA 2PU9B 2WSEE 4MZPA 5KE2A 3JCMQ 3OYHA 3CC7T 2L89A 3X20B 3A8HB 3JCMb 1PSFA 2LNVA 1XTDA 3SWNC 4XK8E 5FU7C 3CCLA 3INZA 1UGSB 4OF1A 4Z02A 3S6WA 2LQ8A 1VQ7T 1WGSA 5GANe 3LLRA 1YBYA 4RG2A 4BB7A 1Q7YU 1W2BA 2LTOA 2XHCA 3WVEB 2D0QB 2MMPA 3C12A 4EMKC 5KCOA 4M77A 5GAOn 3CEYA 1VQ9A 2KK4A 3X26B 4QQGA 3J80E 3QIIA 1XQHA 2GFAA 4LD6A 1KHCA 2PUKB 2R58A 5LJ5g 4YTLA 2BIVA 1I4K1 5CK9A 3L2QA 4QVCA 3OW2S 2P0QA 4FM4B 5FLXE 2LQKA 1QVFS 2WSFE 2X4JA 4PNOA 4XU0A 3X25B 3OBYA 3X24B 3UT1A 3CCQA 2EIFA 2K5FA 2Y4XA 3O8VA 1YI2A 1M1KU 2O4XA 2M0OA 2ZPIB 5GAMd 2DIGA 5GAMh 3RUXA 2OTLA 2OAUA 2VXFA 3PMIA 4M77F 1BI2A 3G4ST 2I2LA 2DTIA 3CPFA 4M75A 1YJ9T 4XTZA 4LD9K 2FYKA 2KSSA 2RHYA 3GNFB 4LDUA 4XTUA 3JCMh 3OMGA 5CKBA 4D6WA 3A5ZB 4ELZC 3PNWC 5CKDA 5GAMf 3V8KA 1B34A 3OYIA 3CCEA 1KD1C 1XNIA 1Q86U 1D3BB 1XOVA 4ME7A 1YHQT 4KUIA 3LX7A 3C4SA 3JCMW 2CZ7B 2VXEA 2M1HA 1N9RA 4XTVA 3DB3A 2FVUA 4KBMB 3JCMf 4ZN3A 4E7KA 1K8AC 3LGLA 3MEWA 3FRNA 4V2SA 3GPLA 4M75F 3URGA 1VQOT 2PVGB 3J81E 2RJCA 3NTKA 4JDSA 3CXCA 1N8RU 2PVOB 3G71T 3CCJA 1Q7YC 4WF2A 4M7DA 4GLKA 2MWPA 3A8OB 3I56A 2RHXA 1YJWT 2CYZB 3E9FA 5CVIA 1VQ4T 2L3RA 1UEBA 3M59A 3V8JA 3VYHB 3DLMA 1VQ8A 5LJ5e 5LJ3d 4C0DC 5LJ3h 1BIBA 4CI0C 2RHIA 5DY9A 4M7AC 4J8OA 2RJEA 5GMKl 1NJIU 2DD4A 2DZ9A 4BI4A 2E41A 4C0ZA 2YLBA 1H641 1BI3A 1S72T 1VQ5A 3CD6T 5AYFA 4C8QC 4BACA 2RB6A 4MZMA 1Q81C 1Y7XA 2EWNA 4MZTA 5HKCA 5LJ3f 1G3TA 2E5QA 1YITT 4M7DF 3R6OA 3OMCA 2XIDA 4J6WA 3CCUA 4C92B 5J3BA 5CIUA 4QVDA 3BY7A 2GF7A 3DB4A 3Q1JA 3OS2A 2RHZA 1I8FA 1JJ2A 4PJOA 5J39A 3CMET 3JB9J 4PJOD 2OTJA 4C5HA 3PFSA 4X34A 2D9TA 5HY6A 2ZPHB 4M7AD 5HK0A 3M4GA 3OYAA 4J7IA 2LDMA 1UGPB 2QTXA 3AHUA 2WACA 4F7UA 4C92E 4C8QD 2LCLA 4A54A 1QVPA 5GANj 3L2VA 4M7AG 3OYNA 2JZ2A 2QDYB 3QO3A 3CCSA 2QQAA 1NE8A 4RMOA 4PJOF 4XTYA 2E64A 2RHUA 3JSCA 3TEEA 4A4EA 5CQXA 3SWNB 5GMKe 2YHTA 5FU7B 2F5TX 5GAN6 3MEUA 3V7SA 3OY9A 3CMAT 1YIJT 3OA6A 2E65A 4II1A 1KG1A 1IREB 4PL6A 4OB1B 1BKBA 2JTMA 4F7UF 4QW2A 5KCHA 4EMKB 3OS1A 4C5GA 1X75C 3JCMg 2LT1A 2NLUA 3OYEA 3G6EA 1VQMT 4XU3A 4M78A 4IUQA 5CKFA 3S3OA 1NJIC 3P8HA 1OZ3A 1VQ6T 2DXBA 2E6ZA 2HQEA 1V29B 2CS7A 3OBWA 4NOYA 2QI2A 4M77C 2MF2A 5GAN8 3JCMJ 2AHJB 1VQ7A 4FSXA 4BE2A 4JRQA 1Q82U 2E6NA 3META 1KQSA 2RI2A 3PIOA 1K9MU 1VQNT 1BI1A 2V8IA 2E10A 4C92G 4XAXB 3VU3C 4UC4A 4L59A 3OS5A 4M78F 3QYGB 1JB0E 3M57A 4MMLA 3JB9F 3QSUA 4JRKA 2JN0A 1HXDA 1M90U 4X9CA 1BIAA 2FL7A 3DKMA 4M77D 4OGEA 5I2MA 3T9NA 2VV5A 2QA4A 1NPRA 2DIQA 3M58A 1I81A 4M75C 2HQXA 4BY6C 3E19A 4IUTA 1VQKA 3VJPA 4BD3A 1W2BS 1M4ZA 3QXEB 5GMKi 1YCYA 2RA2A 5LJ5j 2LT4A 3G4SA 4VUBA 3EFSA 4XU2A 5IN1A 5GAMe 1ZQ1A 3JCMP 1KC8U 3HSBA 3QDRB 3BDLA 4ELYC 3BW1A 3OQ5A 4OGCA 1WQ7A 5FU6C 3L42A 5GANd 3OW2A 1VQLA 5GANh 3M4YA 2P0KA 3JCMe 1QVFA 3CCLT 4FT2A 4EPCA 1U8RA 5I2SA 4M75D 3ZBDA 3CC4A 3V8LA 4A4HA 5FRMA 3KUFA 4C0DB 3FIFA 1VIFA 4ZGJB 4HA8A 3CPWS 4DQ2A 3ER0A 4ATOA 4M7AB 1EIFA 3MEAA 4M7DC 2V8KA 4ZN1A 1VQ9T 2HD0A 1JBMA 4JS4A 3H6ZA 2RJFA 1OI1A 2DVEA 2E12A 3SDZA 4C8QB 5A0GA 3G7ZA 4C5IA 1Q82C 3LW5E 1TH7A 4GY5A 3JAME 3E1SA 4BI8B 3P8BB 3VV0A 1UGQB 2DK3A 4HCCA 3QHSA 4M7AE 4R55A 3CCQT 2Y90A 1M1GA 1YI2T 4J83A 4RCCA 3VYGA 1FX7A 1QVGS 2KY9A 2DZCA 2EQMA 2LVMA 3VUZA 1G3WA 2F69A 3E9GA 4JS5A 3I55A 4DA4A 2DXTA 5D6YA 3RKXA 3ME9A 4C8QE 2OTLT 3OYKA 3DLLA 1WJRA 5LJ3e 5GMKj 1ZHIA 3MO8A 2QEXA 4J6YA 4PJOC 1S72A 1FXXA 1WQWA 4FT4A 3VUBA 3M9QA 1YITA 3CCET 3CCMA 2XU8A 2CZ1B 5I21A 4E7LA 2KAFA 1KHIA 3HKSA 2ZZDA 3UWNA 5GAOm 3HFOA 4RKUE 5GAOq 1M1KC 3OYFA 1MHNA 2EQKA 3HFNA 1KC8C 5IT9E 3EAEA 5J26A 5EG2A 3CC2A 3RMSA 2QQ9A 1JRIA 1ZBXA 4OP0A 4ZTFA 1Y96B 1LNXA 4FL6A 3TCJA 3JCMc 4BI3A 3LH0A 1M5Q1 5GAOr 1G5VA 4MDWA 2PQWA 2K3XA 2PUOB 4OB3B 3A8GB 1N27A 2XI9A 3F70A 3FDRA 3FLGA 3M55A 4N4IA 3PTAA 2K5IA 2YLCA 3MCAB 4HKEA 4LDVA 4A4GA 2CZ6B 2VUBA 5LJ5d 4NL3A 5LJ5h 2XKOC 3GLXA 3QPHA 5M9OA 3I56T 3GOXA 1Q86C 4Y91A 2DD5A 2MWOA 2RI5A 3OSVA 2CGHA 4JLGA 4PJOG 2VYTA 3QBYA 3CCVA 1VQ8T 4ZTJA 3NTIA 3JCMV 3CCRT 4OVAA 5GAN4 3GIBA 3MP8A 3CMAA 3NTHA 4M77B 3BDUA 3S3MA 4RCBA 1YIJA 2XD0A 2VC8A 4E7HA 1OZ2A 2E1HA 2IG0A 1M8VA 4C8QG 4L6V5 4BE0A 4M78C 3WVDB 1VQ5T 4LDWA 4BUGA 4ZGEB 3FC3A 1O75A 1N8RC 2QQRA 1KQ1A 4A53A 5CR2A 3V7RA 1D3BA 5GAMg 3RKWA 1VUBA 1IZ6A 3CCUT 1VQMA 2E70A 3SD4A 2QXFA 4X9DA 4M77E 3L1AA 4BDZA 2PVDB 1YJNA 2EKOA 1QP2A 5GAMj 2RI3A 4ZGDB 3P8DA 3SFMA 4QQ6A 3LYIA 3MP1A 1VIEA 2EAYA 3NFCA 1BI0A 4O5VA 2RO0A 4M75B 4BY6B 4OB0B 3CBMA 3QUIA 3CC7A 4QVZA 1Y71A 4M78D 3JB9D 2K57A 4PKCC 4XTXA 3HRSA 2LX9A 5FRNA 2QQSA 3OYYA 1H3ZA 2CKKA 2RK2A 4L5GA 5C6SA 2JVVA 4C5EA 3A8LB 2HBPA 5HK3A 3CCST 2WSCE 2MAMA 2RM4A 2O01E 5FU6B 2K5LA 1UB4A 4M75E 1VQPT 3M54A 4E7JA 4N0AA 2RJDA 4BDYA 4XU1A 4E47A 4MDXA 2ZPBB 5CO7A 3RMQA 1KQ2A 5LL6S 1BYMA 3UDCA 2CZ0B 3PMTA 3L2UA 3GP8A 4DOWA 3RERA 2GFUA 3FEOA 3M53A 4M7DB 2EYQA 4J6XA 5D6XA 1M9SA 2BUDA 1R8OB 2KDSA 4C92A 5LJ3g 3OYBA 5KH6A 2KVQG 3HL8A 5D6WA 2Y4YA 5DLQE 3X28B 3G6ET 1K8AU 5LJ3j 2K2VA 2ZPGB 2JUFA 1RL2A 4HT9A 4M77G 3QKJA 2ZPEB 5GAN3 4JLIA 5KE3A 1YJ9A 4QQDA 2C06A 2XDBA 2EJFA 4M7DE 1K73U 1WJSA 3TREA 3TU4K 4Q5WA 3L2RA 1WJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BB7 A;  4FT2 A;  4LD9 K;  4DA4 A;  3PTA A;  1ZHI A;  4KUD K;  3PT9 A;  4DOW A;  2FL7 A;  1W4S A;  4FT4 A;  4KUI A;  4KUL A;  2FVU A;  1M4Z A;  4DOV A;  4FSX A;  4JJN K;  1ZBX A;  3TU4 K; 
#chains in the Genus database with same CATH topology
 1Q81 R;  3LWI A;  1I0C A;  2JOY A;  2ABL A;  1WNL A;  4KH1 B;  3MP6 A;  3OYM A;  1SKU B;  3GF5 A;  2EPD A;  3SWN A;  3UF4 A;  2DO3 A;  3EFO A;  1RAH B;  3QJ6 A;  3CCJ Q;  2XG8 D;  1BK2 A;  3L2W A;  1VQO A;  2G6F X;  4N4G A;  1JEG A;  2QA4 T;  1Q81 U;  2A08 A;  2HNI A;  4JRI A;  2NUP B;  4XQ3 A;  4FU6 A;  3ULR B;  4EDU A;  3E2U A;  1K9M C;  2IPO B;  3EG3 A;  5IXB A;  1E6G A;  2RPN A;  1RAE B;  2K79 A;  3OYD A;  5GAN 5;  1PWT A;  2DL4 A;  2HCK A;  3SB2 A;  2DXC A;  2EFI A;  2XMF A;  1AHJ B;  4IUV A;  1EFN A;  2DAQ A;  5L8R E;  1H92 A;  2OJ2 A;  3HRT A;  2R57 A;  4LDY A;  3RES A;  2JMC A;  2RK1 A;  1K73 C;  1W70 A;  1GCP A;  1FMV A;  1M3C A;  4IUP A;  5A2Q E;  2CT3 A;  2R5M A;  3CCR A;  1U1T A;  4HXJ A;  1RLP C;  3NHN A;  4E7I A;  4JUV A;  1JJ2 S;  5CAI A;  3ASK A;  1RAA B;  3IQL A;  2DL3 A;  3GNG A;  1Y07 A;  2CP3 A;  3OYL A;  4FSS A;  1IHW A;  2HQH A;  1TXQ A;  4F7U G;  3QYH B;  2BZ8 A;  1YP5 A;  5IAY A;  2ESW A;  5GAN g;  2ZGW A;  1NZ9 A;  2ENM A;  4HVV A;  2YUQ A;  4J9C A;  2RQV A;  4LN2 A;  2OTJ T;  4A4K A;  3CC4 T;  2VWF A;  3HP9 A;  4KUL A;  2DFU A;  4D8D A;  3CCV T;  2X4W A;  4J9H A;  3EG9 B;  7AT1 B;  1VQP A;  3G1J A;  5C0M A;  1X27 A;  1RAC B;  3QJY A;  4IIO A;  3O5Z A;  2JW4 A;  4KT0 E;  4OMF B;  4RG8 A;  4R56 A;  4IUR A;  2V1R A;  3QZ5 B;  1VQK Q;  1V1C A;  4PLL A;  3MHX A;  1G3S A;  1Q7Y R;  4NS5 A;  2X3X D;  2E4H A;  2V8J A;  2DF6 A;  3JCM X;  3EG0 A;  2QGF B;  2WSE E;  1PD0 A;  1X2K A;  1PNJ A;  3X20 B;  3JCM b;  1W2B P;  2LNV A;  3I5R A;  5FU7 C;  2ATC B;  4FYV B;  3UA7 A;  1VQ7 T;  1M1K R;  4RG2 A;  1Q7Y U;  3VS6 A;  1PKS A;  1C1A A;  5GAO n;  3CEY A;  2E3I A;  1XQH A;  1I4K 1;  4QVC A;  1Q86 R;  4J9D A;  1M1K U;  1ZLM A;  5GAM h;  2OTL A;  1U3O A;  2I2L A;  2C0I A;  2DTI A;  3CPF A;  4M75 A;  1YJ9 T;  1WZO A;  3CCM Q;  4KH0 B;  1K0S A;  4LDU A;  4XTU A;  1LPL A;  3A5Z B;  2DE0 X;  1KD1 C;  1Q86 U;  1YHQ T;  4KUI A;  2KI7 A;  2LP5 A;  3C4S A;  2VXE A;  2B86 A;  3DB3 A;  3CXC P;  4AFU C;  4V2S A;  3TQ7 P;  3GPL A;  2PVG B;  3J81 E;  2C0O A;  2HL5 C;  2PVO B;  5EC7 A;  2EQI A;  2YRD A;  3A1P A;  1YJW T;  1VQ4 T;  3E9F A;  3M59 A;  3V8J A;  5LJ5 e;  3H0I A;  2DBK A;  2RHI A;  5GMK l;  2E3H A;  1QCO A;  2YLB A;  1BI3 A;  1S72 T;  1TU0 B;  1YJN Q;  1RAD B;  4OMN A;  4C92 B;  2QG9 B;  1JJ2 A;  2AT1 B;  4PFO A;  4PJO A;  1I8F A;  5KYU B;  3REB B;  4PJO D;  3M0Q A;  4C5H A;  4X34 A;  3CC7 Q;  5HK0 A;  3M4G A;  4OML A;  2NUZ A;  4C92 E;  4A54 A;  1QVP A;  1WIE A;  3CCS A;  1AOJ A;  1SRM A;  2CDT A;  3JSC A;  3TEE A;  4RTY A;  4A4E A;  5GAN 6;  2QDL A;  3OY9 A;  1IRX A;  4J9B A;  4II1 A;  2KR3 A;  1BKB A;  4F7U F;  4EMK B;  3OS1 A;  4C5G A;  1X75 C;  3JCM g;  1M3B A;  2LT1 A;  1K9M R;  2SEM A;  1NJI C;  1OZ3 A;  2HQE A;  2QI2 A;  1PD1 A;  4M77 C;  3JCM J;  3VS0 A;  2AHJ B;  4OMO A;  2RI2 A;  1K9M U;  2E10 A;  4XAX B;  2X9H A;  4UC4 A;  4L59 A;  1VQO Q;  1YI2 Q;  2QGG A;  2Z0W A;  2OI3 A;  2FL7 A;  1ZA1 B;  1WX6 A;  1I81 A;  1ZUU A;  1W2B S;  2RA2 A;  2LT4 A;  3G4S A;  1PHT A;  3H0F A;  3CCE Q;  2C0T A;  1AZE A;  3BDL A;  4ELY C;  8ATC B;  5FU6 C;  3OQ5 A;  4OMP A;  2ED1 A;  5GAN h;  4FT2 A;  1WXU A;  2LZ6 B;  1T3S A;  5I2S A;  2DL7 A;  1AWW A;  1KK7 A;  3KUF A;  4HA8 A;  2AKL A;  4ATO A;  4M7A B;  1EIF A;  4M7D C;  4ZN1 A;  1JBM A;  2AKK A;  3SDZ A;  4C8Q B;  5A0G A;  3G7Z A;  1Q82 C;  1QCN A;  3CCR Q;  3E1S A;  4BI8 B;  3VV0 A;  3QHS A;  4M7A E;  4R55 A;  2F2X A;  1QVG S;  2KY9 A;  5GJW B;  3PVL A;  1G3W A;  4DA4 A;  4C8Q E;  3OYK A;  3M0P A;  1ZHI A;  3MO8 A;  1FMK A;  4E7L A;  2KAF A;  1U06 A;  1FYN A;  3HFO A;  5GAO q;  1MHN A;  5FW9 A;  1KC8 C;  3RMS A;  4OP0 A;  1Y96 B;  2BTT A;  4FL6 A;  2ECZ A;  1RI9 A;  2D8J A;  1E7O A;  2PUO B;  4OB3 B;  2KBT A;  1N27 A;  3CCJ T;  1WHK A;  2K5I A;  3MCA B;  1VQP Q;  2KEA A;  3CQT A;  1WFW A;  2XKO C;  3QPH A;  4WTO B;  2DJQ A;  4Y91 A;  2RI5 A;  2MIO A;  3OSV A;  4JLG A;  1D09 B;  2VYT A;  1LVK A;  4PJL A;  3JCM V;  3VS5 A;  1YIJ A;  4RCB A;  1OZ2 A;  2E1H A;  1M8V A;  1G8X A;  1M2V B;  4LDW A;  4BUG A;  3KFV A;  5KYW A;  1AWO A;  3V7R A;  2K2M A;  2NUT A;  2DIL A;  4BDZ A;  3L1A A;  2PVD B;  5GAM j;  3SFM A;  3LYI A;  2A28 A;  1WI7 A;  3CBM A;  4QVZ A;  2K57 A;  1JXM A;  2FRY A;  1AEY A;  2O9V A;  5FRN A;  2RK2 A;  4L5G A;  5C6S A;  4C5E A;  4ANJ A;  4F14 A;  1UB4 A;  1UEC A;  2GBQ A;  2RJD A;  1PG5 B;  1BB9 A;  1TUG B;  4E47 A;  2ZAE A;  2CZ0 B;  3PMT A;  2HSE B;  1M9S A;  2KDS A;  2OTL Q;  3OYB A;  1H3H A;  2KVQ G;  3HL8 A;  2EYZ A;  4PJJ A;  5D6W A;  2K2V A;  2JUF A;  5GAN 3;  4JLI A;  5KE3 A;  2EJF A;  3TRE A;  3L2R A;  2SRC A;  4J9F A;  1CKA A;  1B7T A;  2KMT A;  4IKF A;  1ARK A;  1IXD A;  1T3L A;  2O2O A;  1QMC A;  2FB7 A;  4HT8 A;  4EMG A;  1PC0 A;  4FW1 A;  5GAN f;  3ZEH A;  1CKB A;  4M75 G;  6AT1 B;  4HVU A;  3G71 A;  2VVK A;  1VQK T;  1W6X A;  2EJ9 A;  1M27 C;  1BCM A;  2GCX A;  3PVQ A;  1TG0 A;  3C95 A;  2YRC A;  5FWC A;  1TWB A;  3TSZ A;  2L8D A;  4D8K A;  2LC4 A;  3JB9 H;  2CSQ A;  2L3S A;  3FJP A;  1NEB A;  2X4Y A;  4QT7 A;  1NPP A;  1M90 C;  3UAT A;  1X69 A;  2VGM A;  3V7C A;  1QVG A;  2DEU A;  1NLP C;  1SSF A;  4J5Y A;  4M78 B;  5GAO l;  1GL5 A;  2X35 A;  2X4X A;  1QP3 A;  3CBO A;  3LGF A;  1PM3 A;  1NM7 A;  3CCS Q;  2DPP B;  3FB9 A;  2KYB A;  4M78 E;  3KXT A;  2EQU A;  3I55 T;  3SHW A;  3OS0 A;  2HAX A;  2QQB A;  1IHV A;  2BKD N;  2A3L A;  1P92 A;  1SHF A;  3CCM T;  3C94 A;  2DYI A;  2RQR A;  1TTH B;  1SEM A;  5CKH A;  3CC2 T;  3MEV A;  1UGV A;  4A4F A;  2COZ A;  2CP0 A;  2KRO A;  3ZFJ A;  1HD3 A;  1VQ6 A;  3PT9 A;  4J7F A;  4JPB W;  4N0A C;  1OX9 A;  4XTW A;  3BFM A;  3HRU A;  1X01 A;  3D7S B;  2DM1 A;  5A0D A;  4CRI A;  5GMK h;  2LJ0 A;  4C92 C;  1M8M A;  1ZX6 A;  5FRO A;  3N5B B;  2FO0 A;  4C0F A;  5CCA A;  3G4S Q;  3H8Z A;  1X6O A;  1YJN T;  1W4S A;  1KQS S;  1OQK A;  2H3J A;  4C0G A;  3OYC A;  2HL3 A;  3I5S A;  2PU9 B;  2JT4 A;  2J6O A;  3JCM Q;  1PRM C;  3CC7 T;  2RNA A;  1OU8 A;  3A8H B;  2L3Q A;  3CCL A;  1UGS B;  2F1L A;  2OAW A;  4OF1 A;  3LLR A;  2LTO A;  2D0Q B;  2MMP A;  2COY A;  2OX7 A;  3C12 A;  4RUG A;  4EMK C;  4M77 A;  2KK4 A;  4LD6 A;  5LJ5 g;  2BIV A;  3C0C A;  5CK9 A;  3L2Q A;  5FLX E;  2LQK A;  1YN8 A;  1QVF S;  4HVW A;  2X4J A;  2Y4X A;  1YI2 A;  5GAM d;  1W1F A;  3EHR A;  3RUX A;  1GFC A;  3CD6 Q;  1WHL A;  1K4U S;  2ED0 A;  3GNF B;  2RHY A;  3NGP A;  2HKQ B;  4ELZ C;  4LXC A;  5CKD A;  3CCE A;  1C6V X;  1D3B B;  4ME7 A;  3JCM W;  2CZ7 B;  1N9R A;  1SRL A;  3EGD B;  3JCM f;  4ZN3 A;  3LGL A;  2FPE A;  3MEW A;  1QKW A;  4M75 F;  3URG A;  1VQO T;  1M30 A;  3NTK A;  4GLM A;  1B3Q A;  4M7D A;  4GLK A;  2MWP A;  2EW3 A;  1YIJ Q;  3DLM A;  4PJN A;  2FRW A;  4M7A C;  2D0N A;  4J8O A;  4BI4 A;  2E41 A;  4C0Z A;  1K76 A;  2L2P A;  3HTR A;  4C8Q C;  2EWN A;  4MZT A;  4CC2 A;  5LJ3 f;  1YWP A;  1YWO A;  1YIT T;  2XID A;  3CCU A;  5J3B A;  5CIU A;  5IHN A;  3BY7 A;  3OS2 A;  3Q1J A;  5J39 A;  2OTJ A;  3PFS A;  4FCY A;  3OYA A;  1VQN Q;  4JJD A;  2QTX A;  2F2W A;  3AHU A;  2GGR A;  4K11 A;  4M7A G;  2NUP A;  3THK A;  3OYN A;  4J9E A;  2QQA A;  1NE8 A;  4RMO A;  4PJO F;  2E64 A;  2RHU A;  3CMA T;  2KT1 A;  2JM9 A;  3OA6 A;  3MKD A;  4RTX A;  4OB1 B;  2JTM A;  4QW2 A;  2M02 A;  4AMC A;  3R6N A;  1VQM T;  2AZS A;  4XU3 A;  4IUQ A;  5CKF A;  1QCF A;  1S1N A;  3OBW A;  1M90 R;  5GAN 8;  1VQ7 A;  4FSX A;  2RF0 A;  2E6N A;  5KYX B;  3MET A;  1KQS A;  3PIO A;  1WA7 A;  1RUW A;  4MML A;  3QYG B;  1JB0 E;  3QSU A;  3CCQ Q;  4JRK A;  3G71 Q;  1HXD A;  2HEQ A;  5HCK A;  1HYO A;  2LCS A;  1M90 U;  1G83 A;  3T9N A;  2VV5 A;  2DIQ A;  1Z9Q A;  3E19 A;  4IUT A;  1M4Z A;  1IGU A;  3QXE B;  5GMK i;  1HSQ A;  2EYW A;  3EFS A;  4VUB A;  1TUD A;  4XU2 A;  5GAM e;  2VB6 A;  1QWF A;  4OGC A;  5GAN d;  1VQL A;  5D7U A;  1QVF A;  1U8R A;  4M75 D;  5AT1 B;  3ZBD A;  3V8L A;  4C0D B;  4PFP A;  3FIF A;  1VIF A;  3EG9 A;  2HBW A;  4LNP A;  2V8K A;  2LX7 A;  3H6Z A;  4PFZ A;  1MMA A;  3I56 Q;  1PKT A;  1LCK A;  2E12 A;  2D8H A;  4Z88 A;  3LW5 E;  3JAM E;  3P8B B;  2Y90 A;  1M1G A;  3VYG A;  2KXD A;  1FX7 A;  1ZUK A;  2F69 A;  2OTL T;  2K7A A;  1VQ5 Q;  2HSP A;  3ME9 A;  3DLL A;  5GMK j;  2O88 A;  2QEX A;  1ZSG A;  1WXB A;  4J6Y A;  1S72 A;  1WQW A;  4FT4 A;  3VUB A;  2XU8 A;  2CZ1 B;  3HKS A;  2HMA A;  5J26 A;  1VQ6 Q;  1OUL A;  2CUD A;  1JRI A;  1WHJ A;  1KFZ A;  3JCM c;  1LNX A;  3TCJ A;  4BI3 A;  5GAO r;  3LH0 A;  1M5Q 1;  2XI9 A;  3F70 A;  5KYY B;  4HKE A;  2CZ6 B;  2VUB A;  5LJ5 h;  3GLX A;  3GOX A;  2DD5 A;  1D1B A;  1K0X A;  4OVA A;  3UA6 A;  3GIB A;  1VYT A;  2DLP A;  3S3M A;  3BDU A;  1AT1 B;  2HDA A;  1JXO A;  2PTK A;  2IG0 A;  4BE0 A;  4M78 C;  3M0S A;  3FC3 A;  1O75 A;  3EGX B;  3RKW A;  1IZ6 A;  3QWX X;  3VS4 A;  3SD4 A;  2QXF A;  2KRN A;  4ZGD B;  4QQ6 A;  1BI0 A;  2RO0 A;  3CCL Q;  4BY6 B;  4OB0 B;  2LJ1 A;  1Y71 A;  2JJ9 A;  4PKC C;  2DER A;  1SPK A;  1Q95 G;  2CKK A;  2JVV A;  2JXB A;  3A8L B;  3CCS T;  1VYU A;  1D0X A;  2O01 E;  1UE9 A;  2K5L A;  2RMO A;  3M54 A;  4X1V A;  4N0A A;  2FG0 A;  3MJX A;  1KIK A;  4MDX A;  4EIK A;  1K73 R;  2YUN A;  4DOW A;  3FEO A;  1IB8 A;  5D6X A;  5LJ3 g;  4C92 A;  5KH6 A;  5KYU A;  2Y4Y A;  4M77 G;  3QKJ A;  2ZPE B;  3BE3 A;  2QYZ A;  2C06 A;  1K73 U;  3TU4 K;  1WJQ A;  4DBR A;  1UTI A;  2RQU A;  2QTV A;  1VOM A;  1MGQ A;  2QAZ A;  2L5Q A;  4JRP A;  4DBQ A;  2P84 A;  4N4H A;  3RKY A;  1MNE A;  2XIC A;  2X51 A;  2F5K A;  4B6M A;  1B07 A;  4F7U B;  4EMK A;  1HK9 A;  1LJO A;  1WXT A;  2DKG A;  3OB9 A;  3TSW A;  2J06 A;  3JCM d;  2GQV A;  4BE1 A;  1HJD A;  4P5N A;  2FHD A;  5CQY A;  2BZY A;  5GAN 2;  4F7U E;  2DX1 A;  3HHT B;  3CCU Q;  3CD6 A;  4J9I A;  3CXC S;  1XJW B;  4E7Z A;  4M7D G;  2OTJ Q;  4FIB A;  3L2Z A;  3CC4 Q;  1MMD A;  1PCX A;  3PE0 A;  3CME A;  1OYX A;  2LRQ A;  2J05 A;  4JJN K;  3CCV Q;  2B8A A;  1U1S A;  2RD1 A;  1SF9 A;  4KGV B;  2P4T A;  4O6J A;  3JV3 A;  4JZ4 A;  4JZ3 A;  1UHF A;  3OYJ A;  3QZ9 B;  3VKI A;  1UGR B;  2LMJ A;  4R0K A;  1VA7 A;  1WPY A;  5LJ5 f;  4HCB A;  4LDX A;  1RAG B;  5I11 A;  2RH2 A;  5GAO p;  1PSE A;  3J7A F;  1N9S A;  4M7A A;  5GAN 7;  5A0L A;  2DXU A;  2KYM A;  1R0C B;  2CP7 A;  1NLO C;  4C8Q A;  1VQ7 Q;  3EFR A;  3OYG A;  2FEI A;  2KQW A;  4PLI A;  1OPL A;  1KD1 R;  2DTH A;  1B34 B;  1VQN A;  3LWH A;  1CSK A;  2VGN A;  3OSS C;  3JB9 I;  2CH4 A;  4FYW B;  1JO8 A;  2XK0 A;  1KD1 U;  2IVW A;  2DA9 A;  5DLO A;  1QW1 A;  1VQL Q;  1Y96 A;  3GBQ A;  3RIR A;  2RQT A;  2JTF A;  3S3N A;  4MZP A;  4AFQ C;  1YHQ Q;  2L89 A;  1PSF A;  2J6K A;  4Z02 A;  3S6W A;  2LQ8 A;  1WGS A;  2KGT A;  1YBY A;  1W2B A;  2XHC A;  1VQ9 A;  2K9G A;  2CSI A;  3QII A;  2PUK B;  2R58 A;  1VQ4 Q;  4YTL A;  1M2V A;  3CPW P;  2P0Q A;  4FM4 B;  1IGQ A;  4XU0 A;  2YT6 A;  3X25 B;  9ATC B;  3UT1 A;  3CCQ A;  2EIF A;  2K5F A;  3O8V A;  2M0O A;  2QEX Q;  2DIG A;  2MCN A;  1S72 Q;  2GTO A;  2VXF A;  3PMI A;  4M77 F;  1BI2 A;  2JM8 A;  4XTZ A;  3FJ5 A;  2CT4 A;  3JCM h;  3OMG A;  2ROL A;  1UHC A;  3PNW C;  3V8K A;  1B34 A;  5IXF A;  3OYI A;  1T0H A;  1XOV A;  3LX7 A;  2M1H A;  4KBM B;  4E7K A;  1K8A C;  4WCI A;  1ABQ A;  2PZ1 A;  1SHG A;  1WYX A;  1BU1 A;  1NJI R;  3CXC A;  3G71 T;  1Q7Y C;  3I56 A;  2CYZ B;  5CVI A;  1UEB A;  3VYH B;  1VQ8 A;  4C0D C;  2MYS A;  5LJ3 h;  2PNI A;  1SSH A;  2RJE A;  1NJI U;  2DZ9 A;  1YNZ A;  1H64 1;  4OMQ A;  1VQ5 A;  2EKH A;  2RB6 A;  1Y7X A;  4M7D F;  1X6B A;  4Y92 A;  1R77 A;  1SG5 A;  2RHZ A;  3JB9 J;  1AVZ C;  4AG1 C;  2D9T A;  5HY6 A;  2ZPH B;  4FYX B;  1G2B A;  1UGP B;  8AT1 B;  4E7S A;  2WAC A;  2LCL A;  3M0T A;  3L2V A;  5GAN j;  2JZ2 A;  3QO3 A;  1MMN A;  1YFN A;  5CQX A;  3SWN B;  5GMK e;  2YHT A;  2F5T X;  3MEU A;  3EFO B;  3V7S A;  1KSW A;  2YWW A;  2EGE A;  2E65 A;  1KG1 A;  1IRE B;  1QQJ A;  4PL6 A;  1Q82 R;  5KCH A;  2CRE A;  1I1J A;  3M0R A;  2J6F A;  3OYE A;  3G6E A;  4J9G A;  4M78 A;  4AFS C;  1D1A A;  1VQ6 T;  2DXB A;  3SEM A;  2CS7 A;  2MF2 A;  1IO6 A;  1A0N B;  4JRQ A;  1Q82 U;  2K6D A;  1BI1 A;  4C92 G;  1AWX A;  1KC8 R;  3U23 A;  4OMM A;  4DEY A;  1ZA2 B;  2JN0 A;  3RBB B;  4X9C A;  1BIA A;  3VS7 A;  4M77 D;  3DKM A;  5I2M A;  4E2F B;  2QA4 A;  1NPR A;  4BY6 C;  3VJP A;  4BD3 A;  3RNJ A;  1YCY A;  5FWB A;  2V1Q A;  1QWE A;  5IN1 A;  2J7I A;  2YXY A;  3JCM P;  1JQQ A;  1KC8 U;  3I9Q A;  1KJW A;  3L42 A;  1MMG A;  2CP2 A;  3CCL T;  1ZSZ B;  5FRM A;  4HCK A;  2DRK A;  4ZGJ B;  4CC7 A;  3CPW S;  3CME Q;  4DQ2 A;  2L0A A;  3ER0 A;  1MV3 A;  2HD0 A;  4LE9 A;  2IIM A;  1R0B G;  2KE9 A;  1TUC A;  2YSQ A;  3MPU B;  1UGQ B;  2AIR B;  4HCC A;  1Y0M A;  3EH2 A;  3VS2 A;  1H8K A;  2FZG B;  1YI2 T;  4J83 A;  4RCC A;  2EQM A;  2K3B A;  1OOT A;  4M7D D;  2DXT A;  3RKX A;  1WLP B;  1K1Z A;  1YIT A;  3CCE T;  1KHI A;  2ZZD A;  1TS9 A;  2JS2 A;  5IT9 E;  2QQ9 A;  1ZBX A;  4GBQ A;  4ZTF A;  1G5V A;  4MDW A;  2MPX C;  2K3X A;  3PTA A;  3CC4 A;  4A4G A;  3S3O A;  5LJ5 d;  2XDB A;  2MWO A;  1RAB B;  3CCV A;  2CGH A;  3QBY A;  4ZTJ A;  3NTI A;  3CCR T;  2EBP A;  5GAN 4;  1ACM B;  3MP8 A;  3CMA A;  2GQI A;  1ZSZ A;  2VC8 A;  1D0Z A;  4E7H A;  1UDL A;  3NPF A;  2H8H A;  4C8Q G;  5ECA A;  4ZGE B;  1TSF A;  1N8R C;  3M0U A;  4DEX A;  1WHG A;  1D3B A;  3CCU T;  1VQM A;  2E70 A;  1M2O A;  2JMA A;  4X9D A;  2EKO A;  3EGD A;  3P8D A;  3QWY A;  3MP1 A;  1VIE A;  1OX8 A;  2DVJ A;  2KXC A;  3NFC A;  4M75 B;  3QUI A;  2BE9 B;  2P4R A;  4XTX A;  1OEB A;  2LX9 A;  2QQS A;  1H3Z A;  4IIM A;  1VQ9 Q;  2MAM A;  2RM4 A;  4RTW A;  1EZZ B;  1K8A R;  4M75 E;  1VQP T;  4BDY A;  1NYG A;  2GTJ A;  4XU1 A;  4CC4 B;  5CO7 A;  1UJ0 A;  3RMQ A;  3EH1 A;  3GP8 A;  2GFU A;  4E6R A;  2CH4 W;  1R8O B;  4M4Z A;  4CC3 A;  3AT1 B;  3X28 B;  5DLQ E;  1K8A U;  5LJ3 j;  1TOV A;  3OW2 P;  1YJ9 A;  4QQD A;  2VAS A;  1WJS A;  1ZBJ A;  4JJB A;  2EVR A;  1M3A A;  4F17 A;  3UPU A;  4EMH A;  2EQJ A;  4C92 F;  1YHQ A;  4F16 A;  2GNC A;  4PJO B;  1OU9 A;  1FWZ A;  3HPW A;  2XDD A;  4Y28 E;  2DEQ A;  2EJG A;  1MV0 B;  4B9X A;  4OB2 B;  1GCQ C;  2BZX A;  3I55 Q;  3CPW A;  1VQ8 Q;  3A8M B;  3CBP A;  4PJO E;  5CKE A;  2RQW A;  3QDF A;  1YJW A;  1VQ4 A;  2XDP A;  1J3T A;  2CP6 A;  1G3Y A;  2M9U A;  1QVG P;  1VQL T;  3M56 A;  3WXM B;  3CC2 Q;  3VRZ A;  5KYX A;  1AD5 A;  2KRS A;  2EGA A;  1GBQ A;  1ZUY A;  4NL2 A;  4DBH A;  1I5L A;  4KRT A;  2AK5 A;  2G3R A;  2P0P A;  3VS1 A;  2DTO A;  1GXI E;  3NMZ C;  2K4Y A;  3PIP A;  5L23 A;  2A7Y A;  1UFF A;  4ZNX A;  2M16 A;  1RI0 A;  5GMK m;  1M1F A;  2LQN A;  2JNG A;  2QEX T;  2BE7 D;  2D6F A;  1X2Q A;  4RTZ A;  2YRV A;  1MND A;  2FZK B;  4AFZ C;  2ZPF B;  2K3Y A;  2DYB A;  1O9S A;  4B9W A;  3G6E Q;  4JJC A;  2M0Y A;  2DJZ A;  4LUE A;  2L3P A;  1I5O B;  3RR6 A;  2HZY A;  1Z9Z A;  3PGG A;  1GRI A;  2O4X B;  4HCZ A;  2R5A A;  1N6A A;  3KBG A;  2O9S A;  3M5A A;  2MI6 A;  4TVR A;  2F2V A;  2KNB B;  5I22 A;  3EHQ A;  2ZCF B;  4IUU A;  2ROT A;  4QKU A;  4DOV A;  5DM7 R;  1DJ7 B;  4MMK A;  4M7A F;  3H0H A;  2LCC A;  2H3E B;  3QG1 A;  2KRM A;  4M78 G;  3JB9 G;  4C8Q F;  2QA4 Q;  3JRZ A;  1PRL C;  2DL5 A;  1LOJ A;  4KUD K;  5IHI A;  3H9N A;  1NYF A;  1X43 A;  2E5K A;  1OV3 A;  4C92 D;  5IH2 A;  5KE2 A;  1MUZ A;  3OYH A;  1GBR A;  4AG2 C;  1XTD A;  3SWN C;  5KYY A;  4XK8 E;  2COW A;  3INZ A;  2X3W D;  5GAN e;  4BB7 A;  3WVE B;  1GFD A;  5KCO A;  3X26 B;  4QQG A;  1RAI B;  3J80 E;  2GFA A;  1KHC A;  2NYS A;  2EGC A;  3OW2 S;  3EGX A;  2MOX A;  2WSF E;  1D1C A;  4PNO A;  3OBY A;  3X24 B;  2O4X A;  2ZPI B;  2NWM A;  2OAU A;  2FPF A;  3G4S T;  1YIT Q;  3EG2 A;  2DL8 A;  4LD9 K;  2FYK A;  2KSS A;  4D6W A;  5CKB A;  1OPK A;  1Y57 A;  1N8R R;  5GAM f;  5KYW B;  1XNI A;  2NUT B;  2W10 A;  2CP5 A;  4XTV A;  2MK5 A;  2FVU A;  2DNU A;  1V76 A;  3FRN A;  2FPD A;  2RJC A;  4JDS A;  1N8R U;  2W0Z A;  3CCJ A;  4WF2 A;  1NBE B;  3A8O B;  4ORZ A;  2RHX A;  2EYX A;  2DMO A;  3CMA Q;  2L3R A;  1ZSZ C;  2D1X A;  5LJ3 d;  1BIB A;  4CI0 C;  5DY9 A;  3VRY A;  2DD4 A;  3RDV A;  1VQM Q;  3CD6 T;  5AYF A;  4BAC A;  4MZM A;  3ZL7 C;  1Q81 C;  5HKC A;  1G3T A;  2E5Q A;  3R6O A;  3OMC A;  4J6W A;  4DBF A;  4QVD A;  2GF7 A;  3DB4 A;  5IHK A;  3EG1 A;  3CME T;  1E6H A;  1F1B B;  4M7A D;  4J7I A;  2LDM A;  3TVT A;  4F7U A;  4C8Q D;  3H41 A;  2QDY B;  1ABO A;  4XTY A;  2FZC B;  3I35 A;  5FU7 B;  1YIJ T;  3REA B;  3LH5 A;  2JS0 A;  2NLU A;  5KYN A;  1YJ9 Q;  4KGZ B;  3P8H A;  2E6Z A;  1V29 B;  1AZG B;  3EGU A;  4LUD A;  4NOY A;  1KQS P;  2YUP A;  4PJM A;  4RTV A;  4BE2 A;  4KGX B;  1D0Y A;  2HKN A;  1VQN T;  2V8I A;  3VU3 C;  2RN8 A;  3OS5 A;  4M78 F;  3JB9 F;  3M57 A;  1FMW A;  1QKX A;  4FW2 A;  2QAS A;  4OGE A;  5GJV B;  3M58 A;  1YJW Q;  4M75 C;  2HQX A;  1VQK A;  1U5S A;  2YUO A;  2DRM A;  1QLY A;  4PK4 A;  5LJ5 j;  1QVF P;  1ZQ1 A;  3HSB A;  3QDR B;  3BW1 A;  1WQ7 A;  2CUB A;  3OW2 A;  2AZV A;  1I07 A;  2DBM A;  2P0K A;  3M4Y A;  3JCM e;  4EPC A;  4A4H A;  1VYV A;  1JU5 C;  1C0M A;  3MEA A;  1VQ9 T;  4JS4 A;  2RJF A;  1OI1 A;  2DVE A;  1K9A A;  1WDX A;  4C5I A;  1TH7 A;  4GY5 A;  2LJ3 A;  1AWJ A;  2DK3 A;  3CCQ T;  2VKN A;  2DZC A;  2LVM A;  3VUZ A;  4JS5 A;  3E9G A;  3I55 A;  1GCQ A;  5D6Y A;  1WJR A;  3VS3 A;  5LJ3 e;  1NG2 A;  4PJO C;  1N5Z A;  1FXX A;  1RLQ C;  4FYY B;  3M9Q A;  3CCM A;  5I21 A;  1JJ2 P;  4RTU A;  3UWN A;  5GAO m;  2DET A;  4RKU E;  1M1K C;  1EX4 A;  3OYF A;  2EQK A;  3HFN A;  3EAE A;  1X6G A;  5EG2 A;  3CC2 A;  1UUE A;  4F04 B;  2PQW A;  3A8G B;  3FLG A;  3M55 A;  3FDR A;  2JTE A;  1WHM A;  4N4I A;  1YCS B;  2YLC A;  4LDV A;  4NL3 A;  3I56 T;  1BCO A;  5M9O A;  1Q86 C;  4PJO G;  1VQ8 T;  2V26 A;  4Z8A A;  3NTH A;  4M77 B;  2XD0 A;  4L6V 5;  3WVD B;  1VQ5 T;  2QQR A;  1UG1 A;  1KQ1 A;  4A53 A;  5CR2 A;  5GAM g;  1VUB A;  4M77 E;  1YJN A;  4Z89 A;  1QP2 A;  2RI3 A;  4ESR A;  1RAF B;  2QK0 A;  2EAY A;  4A63 B;  4O5V A;  2A37 A;  1NEG A;  1WHH A;  3CC7 A;  2A0F B;  4M78 D;  4AT1 B;  3JB9 D;  3HRS A;  2M51 A;  3OYY A;  1T0J A;  4RTT A;  2HBP A;  5HK3 A;  2WSC E;  1BBZ A;  5FU6 B;  4E7J A;  2LNH B;  1UJY A;  2ZPB B;  1KQ2 A;  2LQW A;  5LL6 S;  1BYM A;  3UDC A;  2EYY A;  2KT8 A;  3L2U A;  3RER A;  4M7D B;  3M53 A;  2I0N A;  2YDL A;  2EYQ A;  4J6X A;  2BUD A;  3G6E T;  3A98 A;  2O31 A;  2ZPG B;  1RL2 A;  4HT9 A;  2A36 A;  4M7D E;  4Q5W A; 
#chains in the Genus database with same CATH homology
 4M7D D;  3UPU A;  3LWI A;  4EMH A;  2JOY A;  1MGQ A;  1WNL A;  2EQJ A;  4C92 F;  2KMT A;  1YHQ A;  4IKF A;  4PJO B;  2L5Q A;  3MP6 A;  3OYM A;  4JRP A;  1FWZ A;  3GF5 A;  3SWN A;  3HPW A;  2DO3 A;  2FB7 A;  2XDD A;  4HT8 A;  4Y28 E;  2DEQ A;  2EJG A;  3QJ6 A;  4N4H A;  2XG8 D;  4B9X A;  4OB2 B;  4EMG A;  3RKY A;  5GAN f;  3ZEH A;  3L2W A;  4M75 G;  1VQO A;  2XIC A;  4N4G A;  2F5K A;  2QA4 T;  3G71 A;  1Q81 U;  4F7U B;  3CPW A;  2HNI A;  1VQK T;  2EJ9 A;  3A8M B;  4JRI A;  4EMK A;  3CBP A;  4PJO E;  2GCX A;  4XQ3 A;  4FU6 A;  5CKE A;  1HK9 A;  1LJO A;  4EDU A;  1YJW A;  2DKG A;  3OB9 A;  1VQ4 A;  3C95 A;  2XDP A;  1K9M C;  3JCM d;  2GQV A;  2L8D A;  4BE1 A;  4P5N A;  2LC4 A;  3JB9 H;  2FHD A;  5CQY A;  1G3Y A;  3FJP A;  2M9U A;  2X4Y A;  3OYD A;  5GAN 2;  5GAN 5;  3M56 A;  1VQL T;  4F7U E;  1NPP A;  3WXM B;  3SB2 A;  2DXC A;  1M90 C;  3HHT B;  2EFI A;  2VGM A;  3CD6 A;  3V7C A;  3CXC S;  1AHJ B;  4IUV A;  2DAQ A;  5L8R E;  1QVG A;  4M7D G;  3HRT A;  2R57 A;  4FIB A;  3L2Z A;  1SSF A;  4LDY A;  3RES A;  3CME A;  4NL2 A;  4J5Y A;  1OYX A;  2RK1 A;  2LRQ A;  4M78 B;  5GAO l;  2X35 A;  2X4X A;  4JJN K;  1QP3 A;  1K73 C;  1I5L A;  3CBO A;  2B8A A;  2G3R A;  2P0P A;  3LGF A;  2DTO A;  1GXI E;  1U1S A;  4IUP A;  5A2Q E;  2K4Y A;  2RD1 A;  3PIP A;  2P4T A;  2R5M A;  4O6J A;  3CCJ T;  2DPP B;  3FB9 A;  2A7Y A;  3CCR A;  1U1T A;  4M78 E;  2M16 A;  1RI0 A;  2EQU A;  1M1F A;  5GMK m;  3OYJ A;  3I55 T;  4JUV A;  3KXT A;  5CAI A;  3ASK A;  4E7I A;  1JJ2 S;  2JNG A;  3QZ9 B;  2QEX T;  3VKI A;  3OS0 A;  2HAX A;  2QQB A;  1UGR B;  2D6F A;  3GNG A;  2BKD N;  1Y07 A;  2A3L A;  2YRV A;  1P92 A;  3CCM T;  1WPY A;  2ZPF B;  5LJ5 f;  4HCB A;  4LDX A;  3C94 A;  2K3Y A;  3OYL A;  2RH2 A;  1O9S A;  4B9W A;  4F7U G;  5GAO p;  3QYH B;  1PSE A;  3J7A F;  1N9S A;  4M7A A;  5CKH A;  3CC2 T;  3MEV A;  2DJZ A;  5GAN 7;  5A0L A;  5IAY A;  3PGG A;  2DXU A;  4A4F A;  5GAN g;  2O4X B;  2ZGW A;  4HCZ A;  2R5A A;  3ZFJ A;  1NZ9 A;  1VQ6 A;  4C8Q A;  1N6A A;  3KBG A;  3EFR A;  3M5A A;  3OYG A;  2MI6 A;  4A4K A;  2OTJ T;  3PT9 A;  4J7F A;  4TVR A;  2KQW A;  3CC4 T;  4PLI A;  4N0A C;  3HP9 A;  4KUL A;  2ZCF B;  4IUU A;  4XTW A;  3BFM A;  4DOV A;  3CCV T;  2X4W A;  5DM7 R;  1DJ7 B;  3HRU A;  1VQP A;  5C0M A;  2DTH A;  1X01 A;  1B34 B;  4MMK A;  1VQN A;  4M7A F;  3QJY A;  2LCC A;  5A0D A;  3QG1 A;  4CRI A;  3LWH A;  5GMK h;  4KT0 E;  4OMF B;  4C92 C;  4RG8 A;  4M78 G;  3JB9 G;  2VGN A;  4R56 A;  4C8Q F;  4IUR A;  3OSS C;  3JB9 I;  3QZ5 B;  5FRO A;  3N5B B;  4C0F A;  5CCA A;  3JRZ A;  4PLL A;  3MHX A;  1G3S A;  1LOJ A;  4KUD K;  3H8Z A;  4NS5 A;  2XK0 A;  1X6O A;  1YJN T;  1W4S A;  1KD1 U;  1KQS S;  2IVW A;  2V8J A;  2H3J A;  5DLO A;  1QW1 A;  4C0G A;  3OYC A;  1Y96 A;  3JCM X;  3RIR A;  4C92 D;  3S3N A;  2JTF A;  2PU9 B;  2WSE E;  4MZP A;  5KE2 A;  3JCM Q;  3OYH A;  3CC7 T;  2L89 A;  3X20 B;  3A8H B;  3JCM b;  1PSF A;  2LNV A;  1XTD A;  3SWN C;  4XK8 E;  5FU7 C;  3CCL A;  3INZ A;  1UGS B;  4OF1 A;  4Z02 A;  3S6W A;  2LQ8 A;  1VQ7 T;  1WGS A;  5GAN e;  3LLR A;  1YBY A;  4RG2 A;  4BB7 A;  1Q7Y U;  1W2B A;  2LTO A;  2XHC A;  3WVE B;  2D0Q B;  2MMP A;  3C12 A;  4EMK C;  5KCO A;  4M77 A;  5GAO n;  3CEY A;  1VQ9 A;  2KK4 A;  3X26 B;  4QQG A;  3J80 E;  3QII A;  1XQH A;  2GFA A;  4LD6 A;  1KHC A;  2PUK B;  2R58 A;  5LJ5 g;  4YTL A;  2BIV A;  1I4K 1;  5CK9 A;  3L2Q A;  4QVC A;  3OW2 S;  2P0Q A;  4FM4 B;  5FLX E;  2LQK A;  1QVF S;  2WSF E;  2X4J A;  4PNO A;  4XU0 A;  3X25 B;  3OBY A;  3X24 B;  3UT1 A;  3CCQ A;  2EIF A;  2K5F A;  2Y4X A;  3O8V A;  1YI2 A;  1M1K U;  2O4X A;  2M0O A;  2ZPI B;  5GAM d;  2DIG A;  5GAM h;  3RUX A;  2OTL A;  2OAU A;  2VXF A;  3PMI A;  4M77 F;  1BI2 A;  3G4S T;  2I2L A;  2DTI A;  3CPF A;  4M75 A;  1YJ9 T;  4XTZ A;  4LD9 K;  2FYK A;  2KSS A;  2RHY A;  3GNF B;  4LDU A;  4XTU A;  3JCM h;  3OMG A;  5CKB A;  4D6W A;  3A5Z B;  4ELZ C;  3PNW C;  5CKD A;  5GAM f;  3V8K A;  1B34 A;  3OYI A;  3CCE A;  1KD1 C;  1XNI A;  1Q86 U;  1D3B B;  1XOV A;  4ME7 A;  1YHQ T;  4KUI A;  3LX7 A;  3C4S A;  3JCM W;  2CZ7 B;  2VXE A;  2M1H A;  1N9R A;  4XTV A;  3DB3 A;  2FVU A;  4KBM B;  3JCM f;  4ZN3 A;  4E7K A;  1K8A C;  3LGL A;  3MEW A;  3FRN A;  4V2S A;  3GPL A;  4M75 F;  3URG A;  1VQO T;  2PVG B;  3J81 E;  2RJC A;  3NTK A;  4JDS A;  3CXC A;  1N8R U;  2PVO B;  3G71 T;  3CCJ A;  1Q7Y C;  4WF2 A;  4M7D A;  4GLK A;  2MWP A;  3A8O B;  3I56 A;  2RHX A;  1YJW T;  2CYZ B;  3E9F A;  5CVI A;  1VQ4 T;  2L3R A;  1UEB A;  3M59 A;  3V8J A;  3VYH B;  3DLM A;  1VQ8 A;  5LJ5 e;  5LJ3 d;  4C0D C;  5LJ3 h;  1BIB A;  4CI0 C;  2RHI A;  5DY9 A;  4M7A C;  4J8O A;  2RJE A;  5GMK l;  1NJI U;  2DD4 A;  2DZ9 A;  4BI4 A;  2E41 A;  4C0Z A;  2YLB A;  1H64 1;  1BI3 A;  1S72 T;  1VQ5 A;  3CD6 T;  5AYF A;  4C8Q C;  4BAC A;  2RB6 A;  4MZM A;  1Q81 C;  1Y7X A;  2EWN A;  4MZT A;  5HKC A;  5LJ3 f;  1G3T A;  2E5Q A;  1YIT T;  4M7D F;  3R6O A;  3OMC A;  2XID A;  4J6W A;  3CCU A;  4C92 B;  5J3B A;  5CIU A;  4QVD A;  3BY7 A;  2GF7 A;  3DB4 A;  3Q1J A;  3OS2 A;  2RHZ A;  1I8F A;  1JJ2 A;  4PJO A;  5J39 A;  3CME T;  3JB9 J;  4PJO D;  2OTJ A;  4C5H A;  3PFS A;  4X34 A;  2D9T A;  5HY6 A;  2ZPH B;  4M7A D;  5HK0 A;  3M4G A;  3OYA A;  4J7I A;  2LDM A;  1UGP B;  2QTX A;  3AHU A;  2WAC A;  4F7U A;  4C92 E;  4C8Q D;  2LCL A;  4A54 A;  1QVP A;  5GAN j;  3L2V A;  4M7A G;  3OYN A;  2JZ2 A;  2QDY B;  3QO3 A;  3CCS A;  2QQA A;  1NE8 A;  4RMO A;  4PJO F;  4XTY A;  2E64 A;  2RHU A;  3JSC A;  3TEE A;  4A4E A;  5CQX A;  3SWN B;  5GMK e;  2YHT A;  5FU7 B;  2F5T X;  5GAN 6;  3MEU A;  3V7S A;  3OY9 A;  3CMA T;  1YIJ T;  3OA6 A;  2E65 A;  4II1 A;  1KG1 A;  1IRE B;  4PL6 A;  4OB1 B;  1BKB A;  2JTM A;  4F7U F;  4QW2 A;  5KCH A;  4EMK B;  3OS1 A;  4C5G A;  1X75 C;  3JCM g;  2LT1 A;  2NLU A;  3OYE A;  3G6E A;  1VQM T;  4XU3 A;  4M78 A;  4IUQ A;  5CKF A;  3S3O A;  1NJI C;  3P8H A;  1OZ3 A;  1VQ6 T;  2DXB A;  2E6Z A;  2HQE A;  1V29 B;  2CS7 A;  3OBW A;  4NOY A;  2QI2 A;  4M77 C;  2MF2 A;  5GAN 8;  3JCM J;  2AHJ B;  1VQ7 A;  4FSX A;  4BE2 A;  4JRQ A;  1Q82 U;  2E6N A;  3MET A;  1KQS A;  2RI2 A;  3PIO A;  1K9M U;  1VQN T;  1BI1 A;  2V8I A;  2E10 A;  4C92 G;  4XAX B;  3VU3 C;  4UC4 A;  4L59 A;  3OS5 A;  4M78 F;  3QYG B;  1JB0 E;  3M57 A;  4MML A;  3JB9 F;  3QSU A;  4JRK A;  2JN0 A;  1HXD A;  1M90 U;  4X9C A;  1BIA A;  2FL7 A;  3DKM A;  4M77 D;  4OGE A;  5I2M A;  3T9N A;  2VV5 A;  2QA4 A;  1NPR A;  2DIQ A;  3M58 A;  1I81 A;  4M75 C;  2HQX A;  4BY6 C;  3E19 A;  4IUT A;  1VQK A;  3VJP A;  4BD3 A;  1W2B S;  1M4Z A;  3QXE B;  5GMK i;  1YCY A;  2RA2 A;  5LJ5 j;  2LT4 A;  3G4S A;  4VUB A;  3EFS A;  4XU2 A;  5IN1 A;  5GAM e;  1ZQ1 A;  3JCM P;  1KC8 U;  3HSB A;  3QDR B;  3BDL A;  4ELY C;  3BW1 A;  3OQ5 A;  4OGC A;  1WQ7 A;  5FU6 C;  3L42 A;  5GAN d;  3OW2 A;  1VQL A;  5GAN h;  3M4Y A;  2P0K A;  3JCM e;  1QVF A;  3CCL T;  4FT2 A;  4EPC A;  1U8R A;  5I2S A;  4M75 D;  3ZBD A;  3CC4 A;  3V8L A;  4A4H A;  5FRM A;  3KUF A;  4C0D B;  3FIF A;  1VIF A;  4ZGJ B;  4HA8 A;  3CPW S;  4DQ2 A;  3ER0 A;  4ATO A;  4M7A B;  1EIF A;  3MEA A;  4M7D C;  2V8K A;  4ZN1 A;  1VQ9 T;  2HD0 A;  1JBM A;  4JS4 A;  3H6Z A;  2RJF A;  1OI1 A;  2DVE A;  2E12 A;  3SDZ A;  4C8Q B;  5A0G A;  3G7Z A;  4C5I A;  1Q82 C;  3LW5 E;  1TH7 A;  4GY5 A;  3JAM E;  3E1S A;  4BI8 B;  3P8B B;  3VV0 A;  1UGQ B;  2DK3 A;  4HCC A;  3QHS A;  4M7A E;  4R55 A;  3CCQ T;  2Y90 A;  1M1G A;  1YI2 T;  4J83 A;  4RCC A;  3VYG A;  1FX7 A;  1QVG S;  2KY9 A;  2DZC A;  2EQM A;  2LVM A;  3VUZ A;  1G3W A;  2F69 A;  3E9G A;  4JS5 A;  3I55 A;  4DA4 A;  2DXT A;  5D6Y A;  3RKX A;  3ME9 A;  4C8Q E;  2OTL T;  3OYK A;  3DLL A;  1WJR A;  5LJ3 e;  5GMK j;  1ZHI A;  3MO8 A;  2QEX A;  4J6Y A;  4PJO C;  1S72 A;  1FXX A;  1WQW A;  4FT4 A;  3VUB A;  3M9Q A;  1YIT A;  3CCE T;  3CCM A;  2XU8 A;  2CZ1 B;  5I21 A;  4E7L A;  2KAF A;  1KHI A;  3HKS A;  2ZZD A;  3UWN A;  5GAO m;  3HFO A;  4RKU E;  5GAO q;  1M1K C;  3OYF A;  1MHN A;  2EQK A;  3HFN A;  1KC8 C;  5IT9 E;  3EAE A;  5J26 A;  5EG2 A;  3CC2 A;  3RMS A;  2QQ9 A;  1JRI A;  1ZBX A;  4OP0 A;  4ZTF A;  1Y96 B;  1LNX A;  4FL6 A;  3TCJ A;  3JCM c;  4BI3 A;  3LH0 A;  1M5Q 1;  5GAO r;  1G5V A;  4MDW A;  2PQW A;  2K3X A;  2PUO B;  4OB3 B;  3A8G B;  1N27 A;  2XI9 A;  3F70 A;  3FDR A;  3FLG A;  3M55 A;  4N4I A;  3PTA A;  2K5I A;  2YLC A;  3MCA B;  4HKE A;  4LDV A;  4A4G A;  2CZ6 B;  2VUB A;  5LJ5 d;  4NL3 A;  5LJ5 h;  2XKO C;  3GLX A;  3QPH A;  5M9O A;  3I56 T;  3GOX A;  1Q86 C;  4Y91 A;  2DD5 A;  2MWO A;  2RI5 A;  3OSV A;  2CGH A;  4JLG A;  4PJO G;  2VYT A;  3QBY A;  3CCV A;  1VQ8 T;  4ZTJ A;  3NTI A;  3JCM V;  3CCR T;  4OVA A;  5GAN 4;  3GIB A;  3MP8 A;  3CMA A;  3NTH A;  4M77 B;  3BDU A;  3S3M A;  4RCB A;  1YIJ A;  2XD0 A;  2VC8 A;  4E7H A;  1OZ2 A;  2E1H A;  2IG0 A;  1M8V A;  4C8Q G;  4L6V 5;  4BE0 A;  4M78 C;  3WVD B;  1VQ5 T;  4LDW A;  4BUG A;  4ZGE B;  3FC3 A;  1O75 A;  1N8R C;  2QQR A;  1KQ1 A;  4A53 A;  5CR2 A;  3V7R A;  1D3B A;  5GAM g;  3RKW A;  1VUB A;  1IZ6 A;  3CCU T;  1VQM A;  2E70 A;  3SD4 A;  2QXF A;  4X9D A;  4M77 E;  3L1A A;  4BDZ A;  2PVD B;  1YJN A;  2EKO A;  1QP2 A;  5GAM j;  2RI3 A;  4ZGD B;  3P8D A;  3SFM A;  4QQ6 A;  3LYI A;  3MP1 A;  1VIE A;  2EAY A;  3NFC A;  1BI0 A;  4O5V A;  2RO0 A;  4M75 B;  4BY6 B;  4OB0 B;  3CBM A;  3QUI A;  3CC7 A;  4QVZ A;  1Y71 A;  4M78 D;  3JB9 D;  2K57 A;  4PKC C;  4XTX A;  3HRS A;  2LX9 A;  5FRN A;  2QQS A;  3OYY A;  1H3Z A;  2CKK A;  2RK2 A;  4L5G A;  5C6S A;  2JVV A;  4C5E A;  3A8L B;  2HBP A;  5HK3 A;  3CCS T;  2WSC E;  2MAM A;  2RM4 A;  2O01 E;  5FU6 B;  2K5L A;  1UB4 A;  4M75 E;  1VQP T;  3M54 A;  4E7J A;  4N0A A;  2RJD A;  4BDY A;  4XU1 A;  4E47 A;  4MDX A;  2ZPB B;  5CO7 A;  3RMQ A;  1KQ2 A;  5LL6 S;  1BYM A;  3UDC A;  2CZ0 B;  3PMT A;  3L2U A;  3GP8 A;  4DOW A;  3RER A;  2GFU A;  3FEO A;  3M53 A;  4M7D B;  2EYQ A;  4J6X A;  5D6X A;  1M9S A;  2BUD A;  1R8O B;  2KDS A;  4C92 A;  5LJ3 g;  3OYB A;  5KH6 A;  2KVQ G;  3HL8 A;  5D6W A;  2Y4Y A;  5DLQ E;  3X28 B;  3G6E T;  1K8A U;  5LJ3 j;  2K2V A;  2ZPG B;  2JUF A;  1RL2 A;  4HT9 A;  4M77 G;  3QKJ A;  2ZPE B;  5GAN 3;  4JLI A;  5KE3 A;  1YJ9 A;  4QQD A;  2C06 A;  2XDB A;  2EJF A;  4M7D E;  1K73 U;  1WJS A;  3TRE A;  3TU4 K;  4Q5W A;  3L2R A;  1WJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...