3TU4K

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
214
structure length
214
Chain Sequence
AKTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
total genus 44
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3tu4K00
4JJNK 2FVUA 1W4SA 1M4ZA 4DA4A 1ZBXA 4FSXA 4DOWA 3TU4K 2FL7A 4FT4A 4FT2A 3PT9A 3PTAA 1ZHIA 4KUIA 4DOVA 4KUDK 4LD9K 4KULA 4BB7A
chains in the Genus database with same CATH superfamily
3CCVT 3CBPA 1RLPC 2QYZA 3D7SB 4X9CA 5GAMf 5GJVB 4EMGA 2NUTA 4M7DD 3C4SA 2MF2A 1Y07A 1EX4A 3CD6T 1DJ7B 2RQUA 3NTHA 2IG0A 3BY7A 4X1VA 4XU0A 3QXEB 3VS1A 1ZUKA 1M27C 3CCRT 4RKUE 4MZPA 4CI0C 5GAOp 1N27A 3J7AF 2RJFA 1IGQA 2EGEA 1YJ9T 5L23A 2DVJA 3L2UA 2J6OA 4PFPA 3I56T 3LGLA 4FSXA 3OW2S 3G4SQ 1BI0A 4J6XA 5GAOm 1HJDA 3PTAA 2M1HA 2CKKA 3GLXA 2LTOA 1TUGB 2LNHB 4A4HA 1GCQC 1FMKA 1IZ6A 4LNPA 4DOVA 1JU5C 4IUQA 3I56A 3HRTA 3A8LB 3FEOA 4PLIA 4OMFB 3G6ET 4Z88A 2XDBA 1IO6A 4F7UA 1QVGS 2DRMA 3LWIA 8AT1B 4XTYA 2WSFE 2YLCA 3G4ST 1OPKA 2PVGB 1QVGA 2P4RA 1KQSS 4JRIA 2YSQA 3JB9G 3CCMA 3CPFA 1TXQA 2D9TA 2GTJA 3REAB 1YHQT 2GTOA 1RL2A 1RAIB 1I8FA 2E64A 1VQ6A 1K73C 2KYBA 4MMLA 1KFZA 3QDRB 1BU1A 1MMGA 5C0MA 2O01E 3CMET 1WA7A 1ARKA 2XHCA 2DKGA 2KBTA 2DVEA 2EW3A 2KXCA 2W10A 2DJQA 3EHRA 2CSQA 2RQVA 3RKXA 1PCXA 2OTJA 3G7ZA 3JCMc 1ZA1B 4PJOG 3CCUT 2E4HA 1QKWA 4GBQA 1YIJQ 2DD4A 2DO3A 1M8VA 2AZVA 2HQEA 5LJ3j 3M0UA 2OI3A 2DTHA 3HSBA 2CS7A 1IRXA 2C0TA 2F2XA 1NJIR 3SHWA 2YUQA 2LQKA 2RJEA 5FU6B 4OMMA 4DEXA 1J3TA 4M7AD 3M54A 4EDUA 1IREB 1BCOA 2EKHA 1SRMA 1MV0B 1V29B 2G6FX 3QKJA 4J9CA 1RI9A 5GANe 1WJRA 3CC7T 1X6GA 3QZ9B 1TH7A 5GAN4 3JCMJ 1WIEA 5KYYB 2MPXC 1M1KR 1CKBA 2A08A 2CZ7B 4C92C 2JXBA 1YP5A 2YRCA 4M7DC 2RHUA 3REBB 2NUTB 5IXFA 2CT4A 4LDUA 1N6AA 4E7JA 3VUZA 3OSSC 2ROLA 2YXYA 2HL5C 3PT9A 3EHQA 2OAUA 4OVAA 2MYSA 1ZHIA 2QI2A 4RCCA 3JSCA 1C1AA 2F1LA 2X3WD 4J8OA 1U06A 2E41A 1NM7A 1NE8A 3OSVA 1C6VX 3EFOB 3GBQA 1VQNA 1N8RR 3OYLA 3OS0A 4J5YA 1VQMA 3KXTA 3PNWC 2RPNA 3UT1A 2E65A 4FT2A 1VQLT 2QASA 2PVDB 1ABQA 1PSEA 4PFZA 1SSHA 1G3TA 1NZ9A 2LVMA 3X20B 1YIJT 5GAMd 1JXMA 3URGA 3CCJA 4C92G 3EFOA 4FW2A 3OYCA 2RMOA 2DETA 1V1CA 2G3RA 5CCAA 1U3OA 2FL7A 2L8DA 3JB9F 2BUDA 3SD4A 4HCCA 1JRIA 1BK2A 3CCJT 1PSFA 4F7UG 2ECZA 2E3HA 3N5BB 4LN2A 3S3NA 4XU3A 3OYBA 3CCUQ 1RACB 3A98A 6AT1B 4OGEA 2EGCA 3HKSA 1M90R 5J39A 5I22A 1KQ1A 1M3BA 1QVPA 2Y4YA 3TCJA 3QBYA 2PZ1A 1WXBA 2KQWA 4ME7A 3DLMA 1UHFA 2FZKB 3ZL7C 3QG1A 3R6OA 4DBHA 1OPLA 2V1RA 1VQ4A 3DKMA 3EG2A 4AG2C 3OY9A 4F7UE 2ATCB 4C0FA 1M3AA 2K5IA 2RQWA 1BIBA 3OQ5A 3QJ6A 2I0NA 1VQKT 1XQHA 2CSIA 2EJFA 4M75C 2RNAA 1VA7A 4M7AC 2PTKA 2EAYA 1VQOT 2OTLT 4F16A 3MP8A 1KG1A 5GMKl 3HFNA 3X24B 3ZBDA 1X6OA 2CUDA 1VIFA 1KC8U 3P8DA 1N8RU 4PFOA 3LW5E 3J80E 4RTVA 3TSZA 2ZZDA 2LJ3A 1YNZA 1ACMB 2R57A 1A0NB 1WYXA 3C95A 3LLRA 1BKBA 1ZBJA 3JCMh 2JVVA 4LDXA 3MEAA 2OTJQ 1KQSA 4N4HA 5GAOr 2GQIA 1ZSZB 1TG0A 2JM9A 2ZPHB 2VUBA 3X25B 2K5FA 3L2VA 3CCRA 1AHJB 2DL3A 5L8RE 1UG1A 5GMKm 1M2VA 4EMKB 2WSEE 2F2VA 2DERA 2DA9A 2RH2A 3M56A 2X51A 4J6WA 3M0PA 2X4JA 4C92E 2RHYA 2EYWA 5LJ5h 3CCMQ 3CC7A 1SHGA 2YRVA 1MMDA 1R77A 1ZSGA 3H0IA 2V1QA 2LZ6B 1RADB 3QO3A 1QP2A 5GJWB 3UA7A 2QA4T 2DM1A 4Y92A 1YJNA 1Q81C 3NFCA 3QIIA 1PKSA 4C8QB 3OS2A 2K2VA 3H41A 4D6WA 3FJPA 3G4SA 5FU6C 1YN8A 1Q82R 3MJXA 4AMCA 4O6JA 3H6ZA 1AWJA 3KUFA 1BI3A 3HL8A 4F04B 4C92A 3G6EA 1SEMA 2L3QA 5GAMe 5GAN5 2QGGA 3GNFB 4IIOA 4BI4A 2FYKA 1Y57A 2JMCA 5FWCA 3NPFA 3X28B 5EG2A 2M16A 4X34A 4TVRA 1G3SA 1K8AU 4IUVA 3VS6A 3JCMV 3OW2P 3BW1A 5HKCA 4N4GA 5GMKj 2XI9A 4M75G 2XDDA 2VXEA 1RLQC 2RA2A 1R0BG 2P0KA 2QTXA 2CP3A 2QDYB 2CZ1B 2W0ZA 2CP7A 2RHXA 3A8HB 5LJ5e 1WJSA 3O5ZA 3VRZA 2KT8A 1LCKA 7AT1B 5GAOq 2VXFA 4MDWA 4BDYA 2F5KA 1ZSZA 3CQTA 1UTIA 4C0DC 4C8QA 1AZEA 2DE0X 4BE0A 1X01A 4LD9K 4E6RA 5DY9A 1AT1B 5AYFA 3V7RA 5CAIA 2EQIA 2XKOC 4XTXA 5KYYA 4HT9A 5LJ3h 1YITA 1G3WA 3GNGA 3A8GB 4F7UF 4AFSC 3CXCP 5D6YA 3CMAT 3L2QA 3X26B 1D0XA 4M7AA 4HA8A 4C8QC 3CMEQ 2JTEA 3CC4Q 3CCQQ 4M75E 4JRKA 2EQKA 4N0AA 3S3MA 3CCLQ 2QAZA 1M2VB 4EMKA 1QVFP 1UGSB 1KD1C 1GBRA 4QW2A 1KQSP 4DOWA 2A37A 1M30A 2D8JA 5KYXA 5FROA 5IHIA 4ZTFA 1IXDA 1K76A 4PNOA 4MMKA 2A0FB 3PVLA 2CYZB 1NPPA 2HQHA 3VS4A 4AFUC 2MK5A 1VQLA 1XJWB 4PJLA 5CR2A 4F14A 5KYUB 1OU9A 1H3ZA 1W70A 4OMPA 2L3RA 3F70A 2X4YA 1JO8A 1HD3A 5GMKh 5GAN7 4OB1B 1BI1A 2FZGB 4ZN1A 2LNVA 4JZ4A 2HQXA 2DTOA 5GANf 1ZUYA 1F1BB 2OTLA 1VQ9Q 2H8HA 4R55A 2HMAA 2HD0A 4M7DG 4DA4A 4N4IA 4J9EA 4PJOF 3EGXB 1M1KU 4II1A 2NUZA 4J9FA 1Y71A 1VQ8A 4F17A 1Z9ZA 1ZQ1A 3OYHA 2OJ2A 4KUDK 4NOYA 2FRWA 2K3YA 1TUCA 2B86A 4OMLA 2CP2A 4ZN3A 4E47A 1XOVA 3MP1A 1W4SA 3G71T 4C5GA 1Y96A 4FT4A 2LMJA 3EG0A 1K0XA 1UGQB 2A7YA 4M7AG 2E1HA 1QW1A 4RG8A 2R58A 2FO0A 3OYDA 1H92A 4CC4B 1G2BA 5I2SA 4ZTJA 4XTWA 2LQWA 1WHHA 2NLUA 3CC2A 4A4GA 4M4ZA 3CC2Q 3CPWP 1WXUA 4RTUA 5IN1A 3CCQA 3CC4A 4C8QE 5IAYA 1EIFA 1SPKA 1WI7A 3HHTB 1B7TA 4EMHA 5HK0A 3M0SA 3OYMA 2A36A 2RF0A 1KSWA 2K57A 2O88A 2COZA 1YITQ 2JNGA 4QQGA 3I55Q 2J6KA 4KRTA 4IKFA 1M8MA 2RI2A 2F5TX 5FRMA 2DK3A 3QJYA 3UA6A 3E9GA 5DM7R 1VYVA 2XU8A 2C0OA 3RKWA 4JDSA 1UEBA 1GBQA 2KRSA 5I2MA 5IHKA 4RTXA 3PGGA 4DBFA 3A8OB 2LQ8A 3LGFA 4OF1A 4LE9A 2ZCFB 2E6ZA 1X2KA 4C5IA 5LJ5g 2DIQA 2ZGWA 2QTVA 2DAQA 3FDRA 1ZA2B 1QCNA 3HTRA 5GAN8 1WHMA 4R0KA 3MEWA 1ZUUA 4ZGJB 1M3CA 2OX7A 2EFIA 1VQPA 1YCYA 1FXXA 2E5KA 1KIKA 3SWNC 1VQ7T 1UGPB 5GAN2 2DEUA 2IVWA 2CH4A 3RERA 1VQ7A 3JV3A 3VUBA 4KH0B 4BE2A 2DYBA 2LRQA 3FC3A 5FWBA 5GAMg 1NG2A 2EBPA 1WFWA 2DL8A 3V7CA 1Y96B 4Y91A 4AFQC 3RMQA 3OYNA 1VQLQ 4M7DA 3PMIA 2SRCA 3L2RA 3G6EQ 1I4K1 2COWA 5D6WA 5GANj 1YJWQ 4E7SA 2H3EB 2DL4A 2QA4Q 3ZEHA 4MDXA 3CEYA 2LC4A 3JCMd 4XU1A 2I2LA 3QWYA 4HXJA 3UDCA 2EYYA 4E2FB 1LPLA 2MCNA 3CCLA 1BCMA 1UFFA 4F7UB 4JS4A 2ZPIB 4CC7A 2YUOA 1EZZB 2MMPA 2JTFA 2YT6A 1G83A 5FRNA 3CMEA 1UGRB 1SRLA 1D09B 4XU2A 4M78C 1KD1R 1MV3A 1FMWA 1PWTA 2YUPA 3GOXA 2AZSA 3TREA 2DD5A 1QWFA 3CC4T 4FM4B 3VKIA 2KNBB 4Q5WA 4D8KA 1KQ2A 3VRYA 2H3JA 1JBMA 2MOXA 2KRNA 4V2SA 2DTIA 1PG5B 2M9UA 3EG1A 4KH1B 4C0ZA 4O5VA 3RUXA 4MZTA 3MHXA 2VWFA 3M4GA 1K1ZA 1VQ8T 2L0AA 3H0HA 2EYQA 3CCRQ 5IHNA 2QDLA 3KFVA 3M55A 1SF9A 4WTOB 3M57A 1I07A 1ZLMA 3FB9A 5DLOA 2GFUA 5CVIA 2RK1A 2K9GA 3JCMb 2HKNA 4BUGA 1VYUA 1AVZC 2P0QA 1EFNA 1H641 4M7DF 1W2BA 2C0IA 4L59A 3MEVA 3JB9H 1TTHB 4B9WA 2QXFA 2V8IA 2LJ0A 2O4XA 4OMNA 4UC4A 2JS0A 4OMQA 2XDPA 1RAHB 4A53A 4LDVA 3LYIA 2CDTA 1N8RC 2RJDA 2OAWA 2EQMA 2LCCA 3IQLA 1YFNA 1OULA 3CBMA 5GAMh 3A1PA 3E1SA 4JJBA 1N9SA 4C8QD 4M7AE 2CT3A 1IB8A 2KEAA 3OYIA 1U8RA 3QWXX 5KCOA 2LCLA 1YJNQ 4PJOD 1GL5A 3SWNB 1YJWT 1H3HA 3CMAA 2MWOA 1K9MC 2EYXA 1H8KA 4OB2B 5GANd 2HNIA 2DYIA 2WACA 1K8AR 4BE1A 3SEMA 2CH4W 1OX9A 1D3BB 3CC7Q 5LJ3g 4RCBA 1NEBA 2JOYA 5AT1B 2M51A 4HCBA 1UJ0A 3INZA 4QQDA 4M78G 2RN8A 2E5QA 3VS7A 4XTUA 3M0QA 5FW9A 2GCXA 4LDYA 5A0GA 1Q7YU 2CZ0B 4KGXB 3L2WA 3J81E 3P8HA 1N5ZA 1Q86R 2FPFA 1AWOA 4J7FA 2JM8A 2NWMA 2O9VA 3VYHB 2GBQA 1JJ2S 4N0AC 4JUVA 2CGHA 2FHDA 2HEQA 1RAGB 2D1XA 1VQMQ 2M0YA 1ZBXA 4XTVA 2RI5A 2COYA 5A0DA 1WQ7A 3GF5A 4KGVB 4JZ3A 1BB9A 1X2QA 2RB6A 2CREA 1WX6A 2PUKB 3V7SA 1NYGA 1UUEA 3BFMA 5FU7B 4J7IA 3ULRB 1GFDA 3SB2A 1KK7A 2L5QA 4Y28E 1YBYA 1KC8R 2O4XB 1VQ4Q 3RESA 3CPWA 2MI6A 5GANg 2LCSA 2QEXT 1MNEA 2EJGA 4QQ6A 2EQJA 5CKHA 5D6XA 4M77C 2KT1A 4RTZA 4IIMA 2DBMA 1KHCA 2J7IA 2VV5A 1JJ2P 1D1BA 2RD1A 5HK3A 3CPWS 2KY9A 3PIOA 3ASKA 2QQBA 5CIUA 4AT1B 5LJ3d 2J6FA 2L3PA 2MAMA 2JUFA 4MZMA 2RHZA 2EGAA 2GFAA 2QK0A 4LXCA 1MUZA 2IIMA 2OTJT 5CKEA 1ZSZC 4M75A 1Y0MA 3CCJQ 2AKKA 4GY5A 2QGFB 1JEGA 1UGVA 3VS3A 1X27A 3FIFA 4FU6A 4ESRA 1NJIC 2E70A 1K9MU 2BE7D 2ZPGB 3I35A 4LUDA 4PJMA 2K5LA 3M4YA 5CQYA 1S72A 3OYEA 2LX7A 4FCYA 2YLBA 1YJNT 3QYHB 2HL3A 2EKOA 3EFRA 3EFSA 2K2MA 2M02A 4PLLA 4KBMB 1JJ2A 1VQOQ 4J9BA 1VQPT 2XIDA 3CCLT 3MCAB 1TUDA 1GRIA 2FZCB 2HSPA 3QDFA 2YWWA 3CBOA 3RIRA 1SHFA 5GMKe 4RMOA 4PJNA 3WXMB 3CMAQ 2RQRA 2DIGA 1NBEB 3EG3A 5KE3A 2YRDA 3I56Q 2AKLA 2EVRA 4P5NA 3TQ7P 1WDXA 3RKYA 2HDAA 4A54A 2ED0A 3OS5A 4OGCA 2PQWA 4HVVA 1UDLA 3JCMX 3HP9A 3RR6A 4Z89A 2FEIA 2HBPA 2KDSA 2DL7A 2F69A 1IHVA 2LQNA 1FWZA 2R5MA 3A5ZB 4M78F 4M75F 1R0CB 3OB9A 2EJ9A 4IUPA 1PHTA 4E7IA 2FPEA 3OYFA 4M77E 4B6MA 1KHIA 1HSQA 2X3XD 1RUWA 2NUPA 1CKAA 1UHCA 1AWXA 2K3BA 3JCMg 2HZYA 1K0SA 3I55T 1K73R 3RDVA 5A0LA 3SDZA 2ESWA 1YIJA 2KVQG 2JZ2A 3QUIA 3OBYA 3META 3CD6A 4DBQA 2DNUA 3TSWA 3MKDA 2ABLA 2KAFA 5HCKA 1VIEA 1WHLA 5GAN6 4GLMA 3PMTA 1X75C 4LD6A 2J05A 4EIKA 1D0ZA 1NPRA 4M77F 1Q7YC 1VQ6Q 4HCKA 2X4XA 1M90C 1VQNT 1MGQA 4HVWA 1I5OB 1NEGA 2X35A 1ABOA 5IXBA 2F2WA 1OU8A 3JRZA 1WLPB 1VQOA 1D1AA 4PJOA 2DZCA 2FG0A 9ATCB 1OV3A 2ZPBB 3OW2A 1BIAA 3UATA 2LDMA 2BZYA 4NL2A 3I5SA 4FYXB 4M77G 4Z8AA 1T3SA 3OYGA 1S72Q 4BDZA 3NHNA 1VQMT 2FB7A 2PNIA 2QQRA 1KC8C 4JJCA 3OA6A 4FSSA 3TVTA 2KGTA 3PE0A 2EQUA 3JAME 2XICA 1M9SA 2VYTA 5LJ3f 2IPOB 2DXBA 3EG9A 3QPHA 3L1AA 1TOVA 1SG5A 5EC7A 1AZGB 1FMVA 3RMSA 2RQTA 4PKCC 1SSFA 5KYUA 1PNJA 1Q82U 3G71Q 1B34B 3LWHA 4E7HA 2DRKA 1M1KC 4QT7A 4RTTA 3ME9A 2C06A 2BTTA 2K7AA 1D3BA 1M5Q1 4XQ3A 1VQ7Q 3EH1A 3TEEA 4QKUA 5C6SA 2BZ8A 1W1FA 2DBKA 5I21A 1B07A 1LVKA 3EH2A 1O9SA 4ELZC 3NTIA 4PL6A 3OBWA 5GAOn 4BY6B 3C12A 3P8BB 4C92F 2K6DA 1QMCA 4EPCA 5KYNA 3GP8A 2GGRA 4RUGA 1WNLA 2LT1A 4J9DA 4KT0E 4ATOA 3LH0A 2DLPA 4M75B 4PK4A 2DXCA 5D7UA 1VQ5T 1BI2A 1M2OA 2JN0A 4C5EA 2GQVA 3BDLA 3CCSQ 1G3YA 4FYYB 5CK9A 1GCQA 1B34A 4J6YA 1LOJA 3L2ZA 3LX7A 1IHWA 4DEYA 3I55A 5GAN3 1PKTA 2RI3A 3OYYA 3QZ5B 4QVDA 1GCPA 1AEYA 2CZ6B 3VJPA 1OQKA 3EAEA 1PRLC 3WVEB 3S3OA 4RTWA 3QHSA 2PU9B 3VS0A 2BZXA 1JXOA 3M53A 4GLKA 3LH5A 2E12A 4HVUA 3PIPA 3AHUA 3OMGA 5CKDA 4JS5A 3UPUA 2LT4A 1TS9A 3M59A 1YHQA 3FRNA 2VC8A 2O2OA 4J9IA 4J9HA 4QVZA 2HAXA 4IUUA 1P92A 2V26A 3EGUA 3MP6A 2MWPA 3JB9D 1UECA 2P0PA 4J83A 4JJDA 5M9OA 5GANh 2ENMA 2EWNA 4M77D 1ZX6A 2KXDA 4RG2A 5I11A 1YWOA 3OMCA 4KGZB 1QVFS 1VQ9T 1I1JA 3H9NA 2JS2A 4IURA 4C5HA 1YI2T 1HXDA 5CO7A 1SKUB 1PRMC 1M90U 4OMOA 4DQ2A 4ZGDB 1VQ8Q 2PUOB 3JCMe 1YITT 2BKDN 1CSKA 3E9FA 3I9QA 4PJOC 2VVKA 3AT1B 1OOTA 2YUNA 5LJ5f 5KCHA 4DBRA 1S1NA 2JT4A 3OS1A 3E2UA 3V8KA 4M75D 4HT8A 1Q86C 4L5GA 2VGNA 3GPLA 2CP5A 3CCEQ 2OTLQ 4E7LA 3ER0A 3QYGB 3BDUA 4R56A 4ANJA 4KULA 2AK5A 1M1FA 2BE9B 3OYAA 4CC3A 4ELYC 3FJ5A 2DXUA 1UB4A 4BI3A 2K79A 2FVUA 4M7DB 2E10A 1M4ZA 3DB4A 4XTZA 1D0YA 3GIBA 1MHNA 1I81A 1OX8A 4C92D 4QVCA 1MNDA 1K73U 3CC2T 1UJYA 1E6GA 3SWNA 1PM3A 2V8KA 1I0CA 2DXTA 2QQSA 4LDWA 3JCMQ 3JCMP 2K4YA 1IGUA 1NLOC 2DPPB 2RO0A 4M7AF 1MMAA 1T3LA 3TU4K 4WF2A 1W2BP 2CP0A 3S6WA 2XMFA 2E6NA 4M78E 3CXCS 5GAOl 2QEXA 1VQ5Q 4Z02A 5HY6A 3UF4A 1W2BS 3CCMT 1FX7A 3NGPA 1C0MA 5KH6A 5KYWA 1KD1U 3OYKA 1YI2A 3HFOA 1NLPC 1RI0A 3BE3A 2AHJB 1JB0E 4RTYA 1M1GA 2RK2A 1YI2Q 1HYOA 1Y7XA 1T0JA 1Q82C 2D0NA 1WJQA 1W6XA 3CCVA 3U23A 1VQ5A 2KE9A 5IT9E 2VB6A 3EGXA 2QQAA 1Z9QA 2WSCE 4A4FA 1K8AC 2LJ1A 3M58A 3Q1JA 3KBGA 3I5RA 4BI8B 1K9MR 1WHGA 2NYSA 3NMZC 4WCIA 1E6HA 2O9SA 1OYXA 1OZ3A 4JLIA 2DILA 2RHIA 2L89A 4AFZC 4NL3A 2QA4A 5CKBA 2LX9A 2SEMA 1YJ9A 1YJWA 2L3SA 1S72T 4A4KA 5KE2A 4XK8E 4ZNXA 1U5SA 2AT1B 1D1CA 2RJCA 4PJOB 2KROA 1X43A 4XAXB 3VU3C 1X6BA 4C92B 5CKFA 4JRQA 1QP3A 5FLXE 1VQKA 2KK4A 1YCSB 4JRPA 2NUPB 2Y4XA 2VKNA 2DFUA 2FPDA 1BYMA 2E3IA 1WHJA 1QCFA 1XTDA 1VQKQ 1B3QA 2O31A 5GMKi 3T9NA 2J06A 3JB9J 4AG1C 3RNJA 3NTKA 4JLGA 4VUBA 5FU7C 1G5VA 4M78A 2JTMA 1OEBA 1VQPQ 1RABB 2RM4A 3A8MB 4PJJA 1YJ9Q 3CCST 1TWBA 1QVFA 2VASA 3DB3A 2DL5A 2HSEB 3M5AA 3MEUA 1OZ2A 2B8AA 4M7AB 1NYFA 1QKXA 1JQQA 1PD1A 4BY6C 4B9XA 3M0RA 3M0TA 1GFCA 3CCVQ 3VS2A 1U1TA 1QLYA 3C94A 4EMKC 1WGSA 2XG8D 2V8JA 1BBZA 1Q81U 3RBBB 3MO8A 4ORZA 2DX1A 1KJWA 2X4WA 2DMOA 4E7KA 1AD5A 1XNIA 1VYTA 2QEXQ 3V8LA 1VOMA 1UE9A 2ED1A 3VYGA 3JCMW 1VQ4T 2ZPEB 5LJ5d 1K4US 1TSFA 1Q7YR 1GXIE 2KSSA 2JW4A 1WQWA 2CUBA 5KYXB 2XD0A 4FYVB 1PD0A 3JCMf 2ZAEA 1YWPA 5LJ3e 2EIFA 3UWNA 3JB9I 5J26A 4OP0A 3EGDA 3CXCA 2BIVA 4M78D 2JJ9A 4FL6A 3C0CA 4CC2A 1NJIU 4HKEA 2AIRB 2HCKA 3R6NA 1WHKA 5DLQE 2DF6A 3ZFJA 2QG9B 3EG9B 1E7OA 2Y90A 1G8XA 3CCSA 1QQJA 4C8QF 1WPYA 1QWEA 2YDLA 3CCEA 4CRIA 3MPUB 1I5LA 2K3XA 2KYMA 4D8DA 2M0OA 3WVDB 1VQ6T 8ATCB 2P84A 4FIBA 4X9DA 4HCZA 3G1JA 3HPWA 3PFSA 3E19A 1WXTA 3CCET 1MMNA 1LJOA 4KUIA 2MIOA 1U1SA 1X69A 1VQ9A 1R8OB 3V8JA 4C8QG 3DLLA 2P4TA 4YTLA 1K9AA 4OB0B 2VGMA 2LP5A 3H8ZA 3FLGA 4IUTA 1V76A 4L6V5 2JMAA 5J3BA 4M77B 2PVOB 3CCUA 3THKA 1QCOA 3HRSA 3G71A 2D0QB 2ZPFB 1HK9A 2KRMA 1OI1A 2DJZA 4BD3A 2A28A 2ROTA 4PJOE 3O8VA 1RAFB 3L42A 2YHTA 2D8HA 3PVQA 4A4EA 4C0DB 1O75A 1VUBA 2FRYA 4C0GA 2EYZA 2GNCA 1YHQQ 4BB7A 5IH2A 3VS5A 4J9GA 1Q81R 5KYWB 4E7ZA 3H0FA 4JPBW 1FYNA 2GF7A 3CCQT 4JJNK 3SFMA 3EGDB 4M78B 4K11A 5A2QE 1VQNQ 4FYWB 2EPDA 5ECAA 5LJ5j 3HRUA 5LL6S 2KI7A 2X9HA 4ZGEB 1RAEB 1Q95G 3QSUA 4M7DE 2KR3A 2R5AA 2HKQB 1PC0A 2QQ9A 1TU0B 2XK0A 1RAAB 1N9RA 4LUEA 2Z0WA 4FW1A 3VV0A 2CP6A 1LNXA 4M77A 1T0HA 2A3LA 2DZ9A 4OB3B 2DEQA 2L2PA 1WZOA 1QVGP 2HBWA 4BACA 1Q86U 4NS5A 3CD6Q 1AOJA 5GAMj 1AWWA 4A63B 2KMTA 2D6FA 5CQXA 3OYJA 3M9QA
chains in the Genus database with same CATH topology
3CCVT 3CBPA 1WJSA 4X9CA 5GAMf 2JOYA 3OMCA 1QVFS 4EMGA 5GAOq 1VQ9T 4M7DD 4HCBA 3INZA 3C4SA 4QQDA 4M78G 2VXFA 4IURA 2E5QA 2MF2A 4MDWA 1Y07A 3CD6T 4XTUA 4BDYA 1DJ7B 3NTHA 2GCXA 2IG0A 2F5KA 4C5HA 1HXDA 4LDYA 5CO7A 1YI2T 5A0GA 3BY7A 1Q7YU 4XU0A 2CZ0B 3QXEB 4C0DC 3L2WA 1M90U 4C8QA 3J81E 3CCRT 4RKUE 3P8HA 4MZPA 4DQ2A 4ZGDB 4CI0C 4BE0A 4J7FA 1X01A 5GAOp 4LD9K 1N27A 2PUOB 3VYHB 5DY9A 1JJ2S 4N0AC 5AYFA 3V7RA 5CAIA 2XKOC 4JUVA 2CGHA 2FHDA 4XTXA 3J7AF 3JCMe 2RJFA 1YITT 2BKDN 3E9FA 4PJOC 4HT9A 5LJ3h 1YJ9T 1YITA 1G3WA 3GNGA 5LJ5f 5KCHA 1ZBXA 3L2UA 4XTVA 3I56T 3A8GB 3OS1A 2RI5A 3V8KA 3LGLA 4FSXA 3OW2S 4F7UF 4M75D 5A0DA 4HT8A 1Q86C 1BI0A 4L5GA 4J6XA 5GAOm 2VGNA 5D6YA 1WQ7A 3PTAA 2M1HA 3X26B 3L2QA 3GPLA 3CMAT 4M7AA 2CKKA 3GLXA 4HA8A 4C8QC 2LTOA 4E7LA 3ER0A 3QYGB 3GF5A 3BDUA 4A4HA 4DOVA 1IZ6A 4IUQA 4R56A 3I56A 4KULA 3HRTA 4M75E 4JRKA 1M1FA 2EQKA 3A8LB 4N0AA 3FEOA 4PLIA 3OYAA 4ELYC 2RB6A 2DXUA 1UB4A 4OMFB 4BI3A 3S3MA 3G6ET 2PUKB 3V7SA 2FVUA 4EMKA 2XDBA 2E10A 4F7UA 1QVGS 4M7DB 1M4ZA 1UGSB 3DB4A 3BFMA 1KD1C 5FU7B 4QW2A 4J7IA 3LWIA 4XTYA 4XTZA 3SB2A 2WSFE 2L5QA 2YLCA 4Y28E 4DOWA 3G4ST 2PVGB 3GIBA 5FROA 1QVGA 1MHNA 1YBYA 1I81A 2O4XB 4ZTFA 1KQSS 4C92D 4JRIA 3JB9G 3RESA 4PNOA 4QVCA 3CPFA 4MMKA 3CCMA 1K73U 3CC2T 2CYZB 1NPPA 3CPWA 2MI6A 2D9TA 3SWNA 5GANg 2QEXT 2V8KA 1VQLA 2DXTA 2EJGA 2QQSA 4LDWA 4QQ6A 2EQJA 5CR2A 1RL2A 5CKHA 3JCMQ 1YHQT 1I8FA 1H3ZA 2E64A 5D6XA 1VQ6A 3JCMP 2K4YA 4M77C 1K73C 2DPPB 2L3RA 2RO0A 3F70A 4MMLA 2X4YA 3QDRB 4M7AF 5C0MA 2O01E 3TU4K 5GMKh 5GAN7 4OB1B 3CMET 1BI1A 1KHCA 2XHCA 4WF2A 4ZN1A 2VV5A 2DKGA 2DVEA 2LNVA 2RD1A 3S6WA 2HQXA 2DTOA 5HK3A 5GANf 2E6NA 4M78E 3CXCS 5GAOl 3CPWS 3RKXA 2QEXA 2KY9A 3PIOA 2OTJA 2OTLA 3ASKA 3G7ZA 2QQBA 5CIUA 4Z02A 5HY6A 3JCMc 1W2BS 4PJOG 4R55A 1FX7A 5LJ3d 5KH6A 3CCMT 3CCUT 1KD1U 3OYKA 1YI2A 2MAMA 2DD4A 2DO3A 2JUFA 4MZMA 1M8VA 2RHZA 2HD0A 3HFOA 2GFAA 2HQEA 1RI0A 4M7DG 2AHJB 5LJ3j 4DA4A 1JB0E 4N4IA 4PJOF 1M1GA 1M1KU 2RK2A 4II1A 2OTJT 5CKEA 2DTHA 3HSBA 2CS7A 1Y71A 1Y7XA 4M75A 1Q82C 4GY5A 1VQ8A 1WJQA 1ZQ1A 2LQKA 2RJEA 5FU6B 3CCVA 1VQ5A 3FIFA 4FU6A 5IT9E 3M54A 4EDUA 3OYHA 1NJIC 2E70A 1K9MU 4NOYA 4KUDK 2ZPGB 1K8AC 4A4FA 2QQAA 2K3YA 1IREB 2WSCE 2K5LA 3M58A 3M4YA 5CQYA 1V29B 3QKJA 3Q1JA 1S72A 3OYEA 3KBGA 5GANe 1WJRA 4ZN3A 2YLBA 1YJNT 3QYHB 4E47A 4BI8B 3CC7T 1XOVA 3MP1A 1W4SA 2EKOA 3QZ9B 3G71T 1TH7A 4C5GA 5GAN4 3JCMJ 3EFRA 1OYXA 1OZ3A 4JLIA 3EFSA 2RHIA 1Y96A 2L89A 4NL3A 4FT4A 2QA4A 5CKBA 2LX9A 4PLLA 4KBMB 1YJ9A 1UGQB 2A7YA 1YJWA 4M7AG 2CZ7B 4C92C 1S72T 2E1HA 1QW1A 4A4KA 5KE2A 1JJ2A 4RG8A 2R58A 4XK8E 4M7DC 2RHUA 1VQPT 3OYDA 2XIDA 2RJCA 3CCLT 4PJOB 3MCAB 4LDUA 4XAXB 3VU3C 1N6AA 4C92B 5I2SA 4E7JA 5CKFA 4JRQA 3VUZA 3OSSC 1QP3A 5FLXE 4XTWA 4ZTJA 1VQKA 3RIRA 3CBOA 2KK4A 5GMKe 4JRPA 2Y4XA 2NLUA 4RMOA 3WXMB 3CC2A 4A4GA 1BYMA 1XTDA 2DIGA 3PT9A 5IN1A 2OAUA 5KE3A 3CCQA 3CC4A 4OVAA 5GMKi 3T9NA 1ZHIA 2QI2A 4RCCA 3JB9J 4C8QE 5IAYA 3NTKA 3JSCA 1EIFA 4P5NA 4JLGA 4J8OA 3HHTB 4VUBA 4EMHA 2E41A 3RKYA 5HK0A 1NE8A 4A54A 5FU7C 3OSVA 4M78A 3OS5A 1G5VA 2JTMA 4OGCA 3OYMA 2K57A 1VQNA 2RM4A 3A8MB 2PQWA 3OYLA 3OS0A 4J5YA 3CCST 1VQMA 3KXTA 3PNWC 1QVFA 2JNGA 4QQGA 3UT1A 3JCMX 3DB3A 4IKFA 3HP9A 3M5AA 2E65A 2RI2A 4FT2A 3MEUA 2F5TX 1OZ2A 1VQLT 2B8AA 2HBPA 2KDSA 2PVDB 4M7AB 2DK3A 3QJYA 5FRMA 3E9GA 5DM7R 2F69A 2XU8A 3RKWA 4BY6C 4B9XA 4JDSA 1UEBA 1FWZA 1PSEA 3A5ZB 2R5MA 4M78F 4M75F 1G3TA 5I2MA 1NZ9A 3OB9A 2LVMA 2EJ9A 4IUPA 3PGGA 3X20B 1YIJT 5GAMd 3A8OB 2LQ8A 3URGA 3LGFA 4E7IA 1U1TA 4OF1A 3CCJA 2ZCFB 2E6ZA 4C92G 3C94A 4C5IA 4EMKC 5LJ5g 1WGSA 4M7AD 2XG8D 2DIQA 2V8JA 4M77E 3OYFA 3OYCA 2ZGWA 1KHIA 2DAQA 3FDRA 2G3RA 1Q81U 3MO8A 5CCAA 2FL7A 5GAN8 2L8DA 3JB9F 2BUDA 3MEWA 3SD4A 3JCMg 4HCCA 4ZGJB 1JRIA 3I55T 3CCJT 1PSFA 2EFIA 2X4WA 5A0LA 1VQPA 1YCYA 3SDZA 4F7UG 1FXXA 1YIJA 3N5BB 4E7KA 2KVQG 2JZ2A 3QUIA 3OBYA 1XNIA 3META 3S3NA 3CD6A 3SWNC 4XU3A 3OYBA 1VQ7T 1UGPB 3V8LA 5GAN2 4OGEA 2IVWA 2KAFA 3RERA 3HKSA 1VQ7A 1VIEA 3VYGA 3JCMW 1VQ4T 2ZPEB 5GAN6 5LJ5d 3VUBA 4BE2A 5J39A 2LRQA 3PMTA 1X75C 3FC3A 5GAMg 1KQ1A 4LD6A 1GXIE 2KSSA 1WQWA 1NPRA 1QVPA 4M77F 2XD0A 3V7CA 1Q7YC 1Y96B 2Y4YA 4Y91A 2X4XA 1M90C 3TCJA 3QBYA 3JCMf 1VQNT 1MGQA 5LJ3e 3RMQA 3OYNA 4M7DA 3PMIA 2KQWA 2EIFA 4ME7A 2X35A 3DLMA 3UWNA 3L2RA 3QG1A 3JB9I 5J26A 3R6OA 1I4K1 4OP0A 1VQ4A 3DKMA 5D6WA 3JRZA 3OY9A 1VQOA 4PJOA 4F7UE 2DZCA 3CXCA 2BIVA 5GANj 4M78D 2ZPBB 4C0FA 3OW2A 2K5IA 4FL6A 1BIBA 3OQ5A 1BIAA 3CEYA 3ZEHA 3QJ6A 4MDXA 2LC4A 2LDMA 1VQKT 1NJIU 3JCMd 1XQHA 4NL2A 4XU1A 2I2LA 3UDCA 4HKEA 2EJFA 4M75C 4M77G 5DLQE 4M7AC 2EAYA 3ZFJA 1VQOT 3CCLA 2OTLT 3OYGA 4F7UB 4JS4A 4BDZA 3MP8A 1VQMT 2FB7A 2QQRA 2Y90A 2ZPIB 5GMKl 3OA6A 3CCSA 1KC8C 1KG1A 2MMPA 2JTFA 2EQUA 3JAME 2XICA 5FRNA 1M9SA 4C8QF 3CMEA 1UGRB 2VYTA 1WPYA 5LJ3f 4XU2A 4M78C 3CCEA 2DXBA 4CRIA 3HFNA 1I5LA 2K3XA 3X24B 1X6OA 3ZBDA 3QPHA 3GOXA 2M0OA 3L1AA 3WVDB 1VIFA 3TREA 3P8DA 1N8RU 2DD5A 1KC8U 1VQ6T 3CC4T 3LW5E 4FM4B 4FIBA 4X9DA 3VKIA 3J80E 4HCZA 3RMSA 3HPWA 4PKCC 1SSFA 2ZZDA 4Q5WA 3PFSA 1KQ2A 2H3JA 3E19A 3CCET 1Q82U 2R57A 1JBMA 1B34B 3C95A 3LWHA 1LJOA 3LLRA 1BKBA 2DTIA 3JCMh 4V2SA 4KUIA 2JVVA 4E7HA 2M9UA 4C0ZA 4LDXA 3MEAA 4O5VA 1M1KC 1U1SA 3RUXA 4MZTA 1VQ9A 3MHXA 1KQSA 4N4HA 3ME9A 5GAOr 1R8OB 3M4GA 2C06A 3V8JA 4C8QG 1VQ8T 2EYQA 3DLLA 1D3BA 2P4TA 2VUBA 2ZPHB 4YTLA 4OB0B 1M5Q1 2VGMA 3X25B 2K5FA 3L2VA 4XQ3A 3CCRA 1AHJB 3M55A 3H8ZA 3FLGA 4IUTA 5L8RE 4L6V5 5J3BA 3TEEA 5GMKm 4EMKB 2WSEE 3M57A 4M77B 2PVOB 5C6SA 5I21A 2RH2A 3FB9A 3CCUA 3M56A 5DLOA 2GFUA 4J6WA 5CVIA 1O9SA 2RK1A 3NTIA 4ELZC 4PL6A 3HRSA 3JCMb 2X4JA 3OBWA 4BUGA 4C92E 5GAOn 2RHYA 3G71A 2P0QA 2D0QB 4BY6B 3C12A 5LJ5h 2ZPFB 3P8BB 1HK9A 4C92F 1H641 3CC7A 4M7DF 4EPCA 1OI1A 1W2BA 2DJZA 2YRVA 3GP8A 4L59A 3MEVA 3JB9H 1WNLA 2LT1A 4B9WA 2QXFA 2V8IA 2O4XA 4BD3A 4KT0E 4ATOA 3LH0A 4PJOE 4M75B 4UC4A 3O8VA 2DXCA 3L42A 3QO3A 1VQ5T 1BI2A 2YHTA 1QP2A 2JN0A 4A53A 2XDPA 4A4EA 4C0DB 4LDVA 4C5EA 2GQVA 3LYIA 1O75A 3BDLA 1N8RC 1VUBA 2RJDA 2EQMA 1G3YA 4C0GA 2QA4T 5CK9A 1B34A 2LCCA 4J6YA 1YJNA 1LOJA 1Q81C 4BB7A 3NFCA 3QIIA 3L2ZA 3LX7A 4C8QB 3OS2A 2K2VA 2GF7A 3CBMA 5GAMh 3CCQT 3SFMA 3I55A 4JJNK 4D6WA 5GAN3 3E1SA 3FJPA 2RI3A 3OYYA 4M78B 3QZ5B 4QVDA 3G4SA 5FU6C 1N9SA 4C8QD 4M7AE 5A2QE 2CZ6B 4O6JA 3VJPA 3H6ZA 3EAEA 3WVEB 3S3OA 5LJ5j 3HRUA 3KUFA 5LL6S 1BI3A 3HL8A 3OYIA 4ZGEB 1U8RA 4M7DE 3QHSA 2PU9B 3QSUA 4C92A 3G6EA 2R5AA 3M53A 5GAMe 4GLKA 5GAN5 2E12A 3GNFB 3PIPA 3AHUA 4BI4A 3OMGA 5KCOA 5CKDA 2FYKA 4JS5A 2QQ9A 2LCLA 2XK0A 3UPUA 2LT4A 1N9RA 3M59A 3X28B 5EG2A 1YHQA 4PJOD 3FRNA 2VC8A 2M16A 3SWNB 3VV0A 1YJWT 3CMAA 4X34A 2MWOA 1LNXA 4TVRA 4M77A 1G3SA 1K8AU 4IUVA 3JCMV 1K9MC 2A3LA 2DZ9A 3BW1A 4OB3B 4N4GA 4QVZA 4IUUA 2XI9A 4OB2B 5HKCA 5GMKj 5GANd 2HAXA 1P92A 4M75G 2DEQA 2HNIA 2XDDA 2VXEA 2RA2A 3MP6A 2MWPA 2WACA 4BE1A 2P0KA 4BACA 3JB9D 2P0PA 4J83A 2QTXA 4NS5A 1Q86U 2QDYB 5GAMj 2CZ1B 5M9OA 1D3BB 5GANh 2EWNA 2KMTA 4M77D 2RHXA 3A8HB 2D6FA 5CQXA 5LJ3g 4RCBA 4RG2A 5LJ5e 3M9QA 3OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN K;  2FVU A;  1W4S A;  1M4Z A;  4DA4 A;  1ZBX A;  4FSX A;  4DOW A;  3TU4 K;  2FL7 A;  4FT4 A;  4FT2 A;  3PT9 A;  3PTA A;  1ZHI A;  4KUI A;  4DOV A;  4KUD K;  4LD9 K;  4KUL A;  4BB7 A; 
#chains in the Genus database with same CATH topology
 3CCV T;  3CBP A;  1RLP C;  2QYZ A;  3D7S B;  4X9C A;  5GAM f;  5GJV B;  4EMG A;  2NUT A;  4M7D D;  3C4S A;  2MF2 A;  1Y07 A;  1EX4 A;  3CD6 T;  1DJ7 B;  2RQU A;  3NTH A;  2IG0 A;  3BY7 A;  4X1V A;  4XU0 A;  3QXE B;  3VS1 A;  1ZUK A;  1M27 C;  3CCR T;  4RKU E;  4MZP A;  4CI0 C;  5GAO p;  1N27 A;  3J7A F;  2RJF A;  1IGQ A;  2EGE A;  1YJ9 T;  5L23 A;  2DVJ A;  3L2U A;  2J6O A;  4PFP A;  3I56 T;  3LGL A;  4FSX A;  3OW2 S;  3G4S Q;  1BI0 A;  4J6X A;  5GAO m;  1HJD A;  3PTA A;  2M1H A;  2CKK A;  3GLX A;  2LTO A;  1TUG B;  2LNH B;  4A4H A;  1GCQ C;  1FMK A;  1IZ6 A;  4LNP A;  4DOV A;  1JU5 C;  4IUQ A;  3I56 A;  3HRT A;  3A8L B;  3FEO A;  4PLI A;  4OMF B;  3G6E T;  4Z88 A;  2XDB A;  1IO6 A;  4F7U A;  1QVG S;  2DRM A;  3LWI A;  8AT1 B;  4XTY A;  2WSF E;  2YLC A;  3G4S T;  1OPK A;  2PVG B;  1QVG A;  2P4R A;  1KQS S;  4JRI A;  2YSQ A;  3JB9 G;  3CCM A;  3CPF A;  1TXQ A;  2D9T A;  2GTJ A;  3REA B;  1YHQ T;  2GTO A;  1RL2 A;  1RAI B;  1I8F A;  2E64 A;  1VQ6 A;  1K73 C;  2KYB A;  4MML A;  1KFZ A;  3QDR B;  1BU1 A;  1MMG A;  5C0M A;  2O01 E;  3CME T;  1WA7 A;  1ARK A;  2XHC A;  2DKG A;  2KBT A;  2DVE A;  2EW3 A;  2KXC A;  2W10 A;  2DJQ A;  3EHR A;  2CSQ A;  2RQV A;  3RKX A;  1PCX A;  2OTJ A;  3G7Z A;  3JCM c;  1ZA1 B;  4PJO G;  3CCU T;  2E4H A;  1QKW A;  4GBQ A;  1YIJ Q;  2DD4 A;  2DO3 A;  1M8V A;  2AZV A;  2HQE A;  5LJ3 j;  3M0U A;  2OI3 A;  2DTH A;  3HSB A;  2CS7 A;  1IRX A;  2C0T A;  2F2X A;  1NJI R;  3SHW A;  2YUQ A;  2LQK A;  2RJE A;  5FU6 B;  4OMM A;  4DEX A;  1J3T A;  4M7A D;  3M54 A;  4EDU A;  1IRE B;  1BCO A;  2EKH A;  1SRM A;  1MV0 B;  1V29 B;  2G6F X;  3QKJ A;  4J9C A;  1RI9 A;  5GAN e;  1WJR A;  3CC7 T;  1X6G A;  3QZ9 B;  1TH7 A;  5GAN 4;  3JCM J;  1WIE A;  5KYY B;  2MPX C;  1M1K R;  1CKB A;  2A08 A;  2CZ7 B;  4C92 C;  2JXB A;  1YP5 A;  2YRC A;  4M7D C;  2RHU A;  3REB B;  2NUT B;  5IXF A;  2CT4 A;  4LDU A;  1N6A A;  4E7J A;  3VUZ A;  3OSS C;  2ROL A;  2YXY A;  2HL5 C;  3PT9 A;  3EHQ A;  2OAU A;  4OVA A;  2MYS A;  1ZHI A;  2QI2 A;  4RCC A;  3JSC A;  1C1A A;  2F1L A;  2X3W D;  4J8O A;  1U06 A;  2E41 A;  1NM7 A;  1NE8 A;  3OSV A;  1C6V X;  3EFO B;  3GBQ A;  1VQN A;  1N8R R;  3OYL A;  3OS0 A;  4J5Y A;  1VQM A;  3KXT A;  3PNW C;  2RPN A;  3UT1 A;  2E65 A;  4FT2 A;  1VQL T;  2QAS A;  2PVD B;  1ABQ A;  1PSE A;  4PFZ A;  1SSH A;  1G3T A;  1NZ9 A;  2LVM A;  3X20 B;  1YIJ T;  5GAM d;  1JXM A;  3URG A;  3CCJ A;  4C92 G;  3EFO A;  4FW2 A;  3OYC A;  2RMO A;  2DET A;  1V1C A;  2G3R A;  5CCA A;  1U3O A;  2FL7 A;  2L8D A;  3JB9 F;  2BUD A;  3SD4 A;  4HCC A;  1JRI A;  1BK2 A;  3CCJ T;  1PSF A;  4F7U G;  2ECZ A;  2E3H A;  3N5B B;  4LN2 A;  3S3N A;  4XU3 A;  3OYB A;  3CCU Q;  1RAC B;  3A98 A;  6AT1 B;  4OGE A;  2EGC A;  3HKS A;  1M90 R;  5J39 A;  5I22 A;  1KQ1 A;  1M3B A;  1QVP A;  2Y4Y A;  3TCJ A;  3QBY A;  2PZ1 A;  1WXB A;  2KQW A;  4ME7 A;  3DLM A;  1UHF A;  2FZK B;  3ZL7 C;  3QG1 A;  3R6O A;  4DBH A;  1OPL A;  2V1R A;  1VQ4 A;  3DKM A;  3EG2 A;  4AG2 C;  3OY9 A;  4F7U E;  2ATC B;  4C0F A;  1M3A A;  2K5I A;  2RQW A;  1BIB A;  3OQ5 A;  3QJ6 A;  2I0N A;  1VQK T;  1XQH A;  2CSI A;  2EJF A;  4M75 C;  2RNA A;  1VA7 A;  4M7A C;  2PTK A;  2EAY A;  1VQO T;  2OTL T;  4F16 A;  3MP8 A;  1KG1 A;  5GMK l;  3HFN A;  3X24 B;  3ZBD A;  1X6O A;  2CUD A;  1VIF A;  1KC8 U;  3P8D A;  1N8R U;  4PFO A;  3LW5 E;  3J80 E;  4RTV A;  3TSZ A;  2ZZD A;  2LJ3 A;  1YNZ A;  1ACM B;  2R57 A;  1A0N B;  1WYX A;  3C95 A;  3LLR A;  1BKB A;  1ZBJ A;  3JCM h;  2JVV A;  4LDX A;  3MEA A;  2OTJ Q;  1KQS A;  4N4H A;  5GAO r;  2GQI A;  1ZSZ B;  1TG0 A;  2JM9 A;  2ZPH B;  2VUB A;  3X25 B;  2K5F A;  3L2V A;  3CCR A;  1AHJ B;  2DL3 A;  5L8R E;  1UG1 A;  5GMK m;  1M2V A;  4EMK B;  2WSE E;  2F2V A;  2DER A;  2DA9 A;  2RH2 A;  3M56 A;  2X51 A;  4J6W A;  3M0P A;  2X4J A;  4C92 E;  2RHY A;  2EYW A;  5LJ5 h;  3CCM Q;  3CC7 A;  1SHG A;  2YRV A;  1MMD A;  1R77 A;  1ZSG A;  3H0I A;  2V1Q A;  2LZ6 B;  1RAD B;  3QO3 A;  1QP2 A;  5GJW B;  3UA7 A;  2QA4 T;  2DM1 A;  4Y92 A;  1YJN A;  1Q81 C;  3NFC A;  3QII A;  1PKS A;  4C8Q B;  3OS2 A;  2K2V A;  3H41 A;  4D6W A;  3FJP A;  3G4S A;  5FU6 C;  1YN8 A;  1Q82 R;  3MJX A;  4AMC A;  4O6J A;  3H6Z A;  1AWJ A;  3KUF A;  1BI3 A;  3HL8 A;  4F04 B;  4C92 A;  3G6E A;  1SEM A;  2L3Q A;  5GAM e;  5GAN 5;  2QGG A;  3GNF B;  4IIO A;  4BI4 A;  2FYK A;  1Y57 A;  2JMC A;  5FWC A;  3NPF A;  3X28 B;  5EG2 A;  2M16 A;  4X34 A;  4TVR A;  1G3S A;  1K8A U;  4IUV A;  3VS6 A;  3JCM V;  3OW2 P;  3BW1 A;  5HKC A;  4N4G A;  5GMK j;  2XI9 A;  4M75 G;  2XDD A;  2VXE A;  1RLQ C;  2RA2 A;  1R0B G;  2P0K A;  2QTX A;  2CP3 A;  2QDY B;  2CZ1 B;  2W0Z A;  2CP7 A;  2RHX A;  3A8H B;  5LJ5 e;  1WJS A;  3O5Z A;  3VRZ A;  2KT8 A;  1LCK A;  7AT1 B;  5GAO q;  2VXF A;  4MDW A;  4BDY A;  2F5K A;  1ZSZ A;  3CQT A;  1UTI A;  4C0D C;  4C8Q A;  1AZE A;  2DE0 X;  4BE0 A;  1X01 A;  4LD9 K;  4E6R A;  5DY9 A;  1AT1 B;  5AYF A;  3V7R A;  5CAI A;  2EQI A;  2XKO C;  4XTX A;  5KYY A;  4HT9 A;  5LJ3 h;  1YIT A;  1G3W A;  3GNG A;  3A8G B;  4F7U F;  4AFS C;  3CXC P;  5D6Y A;  3CMA T;  3L2Q A;  3X26 B;  1D0X A;  4M7A A;  4HA8 A;  4C8Q C;  3CME Q;  2JTE A;  3CC4 Q;  3CCQ Q;  4M75 E;  4JRK A;  2EQK A;  4N0A A;  3S3M A;  3CCL Q;  2QAZ A;  1M2V B;  4EMK A;  1QVF P;  1UGS B;  1KD1 C;  1GBR A;  4QW2 A;  1KQS P;  4DOW A;  2A37 A;  1M30 A;  2D8J A;  5KYX A;  5FRO A;  5IHI A;  4ZTF A;  1IXD A;  1K76 A;  4PNO A;  4MMK A;  2A0F B;  3PVL A;  2CYZ B;  1NPP A;  2HQH A;  3VS4 A;  4AFU C;  2MK5 A;  1VQL A;  1XJW B;  4PJL A;  5CR2 A;  4F14 A;  5KYU B;  1OU9 A;  1H3Z A;  1W70 A;  4OMP A;  2L3R A;  3F70 A;  2X4Y A;  1JO8 A;  1HD3 A;  5GMK h;  5GAN 7;  4OB1 B;  1BI1 A;  2FZG B;  4ZN1 A;  2LNV A;  4JZ4 A;  2HQX A;  2DTO A;  5GAN f;  1ZUY A;  1F1B B;  2OTL A;  1VQ9 Q;  2H8H A;  4R55 A;  2HMA A;  2HD0 A;  4M7D G;  4DA4 A;  4N4I A;  4J9E A;  4PJO F;  3EGX B;  1M1K U;  4II1 A;  2NUZ A;  4J9F A;  1Y71 A;  1VQ8 A;  4F17 A;  1Z9Z A;  1ZQ1 A;  3OYH A;  2OJ2 A;  4KUD K;  4NOY A;  2FRW A;  2K3Y A;  1TUC A;  2B86 A;  4OML A;  2CP2 A;  4ZN3 A;  4E47 A;  1XOV A;  3MP1 A;  1W4S A;  3G71 T;  4C5G A;  1Y96 A;  4FT4 A;  2LMJ A;  3EG0 A;  1K0X A;  1UGQ B;  2A7Y A;  4M7A G;  2E1H A;  1QW1 A;  4RG8 A;  2R58 A;  2FO0 A;  3OYD A;  1H92 A;  4CC4 B;  1G2B A;  5I2S A;  4ZTJ A;  4XTW A;  2LQW A;  1WHH A;  2NLU A;  3CC2 A;  4A4G A;  4M4Z A;  3CC2 Q;  3CPW P;  1WXU A;  4RTU A;  5IN1 A;  3CCQ A;  3CC4 A;  4C8Q E;  5IAY A;  1EIF A;  1SPK A;  1WI7 A;  3HHT B;  1B7T A;  4EMH A;  5HK0 A;  3M0S A;  3OYM A;  2A36 A;  2RF0 A;  1KSW A;  2K57 A;  2O88 A;  2COZ A;  1YIT Q;  2JNG A;  4QQG A;  3I55 Q;  2J6K A;  4KRT A;  4IKF A;  1M8M A;  2RI2 A;  2F5T X;  5FRM A;  2DK3 A;  3QJY A;  3UA6 A;  3E9G A;  5DM7 R;  1VYV A;  2XU8 A;  2C0O A;  3RKW A;  4JDS A;  1UEB A;  1GBQ A;  2KRS A;  5I2M A;  5IHK A;  4RTX A;  3PGG A;  4DBF A;  3A8O B;  2LQ8 A;  3LGF A;  4OF1 A;  4LE9 A;  2ZCF B;  2E6Z A;  1X2K A;  4C5I A;  5LJ5 g;  2DIQ A;  2ZGW A;  2QTV A;  2DAQ A;  3FDR A;  1ZA2 B;  1QCN A;  3HTR A;  5GAN 8;  1WHM A;  4R0K A;  3MEW A;  1ZUU A;  4ZGJ B;  1M3C A;  2OX7 A;  2EFI A;  1VQP A;  1YCY A;  1FXX A;  2E5K A;  1KIK A;  3SWN C;  1VQ7 T;  1UGP B;  5GAN 2;  2DEU A;  2IVW A;  2CH4 A;  3RER A;  1VQ7 A;  3JV3 A;  3VUB A;  4KH0 B;  4BE2 A;  2DYB A;  2LRQ A;  3FC3 A;  5FWB A;  5GAM g;  1NG2 A;  2EBP A;  1WFW A;  2DL8 A;  3V7C A;  1Y96 B;  4Y91 A;  4AFQ C;  3RMQ A;  3OYN A;  1VQL Q;  4M7D A;  3PMI A;  2SRC A;  3L2R A;  3G6E Q;  1I4K 1;  2COW A;  5D6W A;  5GAN j;  1YJW Q;  4E7S A;  2H3E B;  2DL4 A;  2QA4 Q;  3ZEH A;  4MDX A;  3CEY A;  2LC4 A;  3JCM d;  4XU1 A;  2I2L A;  3QWY A;  4HXJ A;  3UDC A;  2EYY A;  4E2F B;  1LPL A;  2MCN A;  3CCL A;  1BCM A;  1UFF A;  4F7U B;  4JS4 A;  2ZPI B;  4CC7 A;  2YUO A;  1EZZ B;  2MMP A;  2JTF A;  2YT6 A;  1G83 A;  5FRN A;  3CME A;  1UGR B;  1SRL A;  1D09 B;  4XU2 A;  4M78 C;  1KD1 R;  1MV3 A;  1FMW A;  1PWT A;  2YUP A;  3GOX A;  2AZS A;  3TRE A;  2DD5 A;  1QWF A;  3CC4 T;  4FM4 B;  3VKI A;  2KNB B;  4Q5W A;  4D8K A;  1KQ2 A;  3VRY A;  2H3J A;  1JBM A;  2MOX A;  2KRN A;  4V2S A;  2DTI A;  1PG5 B;  2M9U A;  3EG1 A;  4KH1 B;  4C0Z A;  4O5V A;  3RUX A;  4MZT A;  3MHX A;  2VWF A;  3M4G A;  1K1Z A;  1VQ8 T;  2L0A A;  3H0H A;  2EYQ A;  3CCR Q;  5IHN A;  2QDL A;  3KFV A;  3M55 A;  1SF9 A;  4WTO B;  3M57 A;  1I07 A;  1ZLM A;  3FB9 A;  5DLO A;  2GFU A;  5CVI A;  2RK1 A;  2K9G A;  3JCM b;  2HKN A;  4BUG A;  1VYU A;  1AVZ C;  2P0Q A;  1EFN A;  1H64 1;  4M7D F;  1W2B A;  2C0I A;  4L59 A;  3MEV A;  3JB9 H;  1TTH B;  4B9W A;  2QXF A;  2V8I A;  2LJ0 A;  2O4X A;  4OMN A;  4UC4 A;  2JS0 A;  4OMQ A;  2XDP A;  1RAH B;  4A53 A;  4LDV A;  3LYI A;  2CDT A;  1N8R C;  2RJD A;  2OAW A;  2EQM A;  2LCC A;  3IQL A;  1YFN A;  1OUL A;  3CBM A;  5GAM h;  3A1P A;  3E1S A;  4JJB A;  1N9S A;  4C8Q D;  4M7A E;  2CT3 A;  1IB8 A;  2KEA A;  3OYI A;  1U8R A;  3QWX X;  5KCO A;  2LCL A;  1YJN Q;  4PJO D;  1GL5 A;  3SWN B;  1YJW T;  1H3H A;  3CMA A;  2MWO A;  1K9M C;  2EYX A;  1H8K A;  4OB2 B;  5GAN d;  2HNI A;  2DYI A;  2WAC A;  1K8A R;  4BE1 A;  3SEM A;  2CH4 W;  1OX9 A;  1D3B B;  3CC7 Q;  5LJ3 g;  4RCB A;  1NEB A;  2JOY A;  5AT1 B;  2M51 A;  4HCB A;  1UJ0 A;  3INZ A;  4QQD A;  4M78 G;  2RN8 A;  2E5Q A;  3VS7 A;  4XTU A;  3M0Q A;  5FW9 A;  2GCX A;  4LDY A;  5A0G A;  1Q7Y U;  2CZ0 B;  4KGX B;  3L2W A;  3J81 E;  3P8H A;  1N5Z A;  1Q86 R;  2FPF A;  1AWO A;  4J7F A;  2JM8 A;  2NWM A;  2O9V A;  3VYH B;  2GBQ A;  1JJ2 S;  4N0A C;  4JUV A;  2CGH A;  2FHD A;  2HEQ A;  1RAG B;  2D1X A;  1VQM Q;  2M0Y A;  1ZBX A;  4XTV A;  2RI5 A;  2COY A;  5A0D A;  1WQ7 A;  3GF5 A;  4KGV B;  4JZ3 A;  1BB9 A;  1X2Q A;  2RB6 A;  2CRE A;  1WX6 A;  2PUK B;  3V7S A;  1NYG A;  1UUE A;  3BFM A;  5FU7 B;  4J7I A;  3ULR B;  1GFD A;  3SB2 A;  1KK7 A;  2L5Q A;  4Y28 E;  1YBY A;  1KC8 R;  2O4X B;  1VQ4 Q;  3RES A;  3CPW A;  2MI6 A;  5GAN g;  2LCS A;  2QEX T;  1MNE A;  2EJG A;  4QQ6 A;  2EQJ A;  5CKH A;  5D6X A;  4M77 C;  2KT1 A;  4RTZ A;  4IIM A;  2DBM A;  1KHC A;  2J7I A;  2VV5 A;  1JJ2 P;  1D1B A;  2RD1 A;  5HK3 A;  3CPW S;  2KY9 A;  3PIO A;  3ASK A;  2QQB A;  5CIU A;  4AT1 B;  5LJ3 d;  2J6F A;  2L3P A;  2MAM A;  2JUF A;  4MZM A;  2RHZ A;  2EGA A;  2GFA A;  2QK0 A;  4LXC A;  1MUZ A;  2IIM A;  2OTJ T;  5CKE A;  1ZSZ C;  4M75 A;  1Y0M A;  3CCJ Q;  2AKK A;  4GY5 A;  2QGF B;  1JEG A;  1UGV A;  3VS3 A;  1X27 A;  3FIF A;  4FU6 A;  4ESR A;  1NJI C;  2E70 A;  1K9M U;  2BE7 D;  2ZPG B;  3I35 A;  4LUD A;  4PJM A;  2K5L A;  3M4Y A;  5CQY A;  1S72 A;  3OYE A;  2LX7 A;  4FCY A;  2YLB A;  1YJN T;  3QYH B;  2HL3 A;  2EKO A;  3EFR A;  3EFS A;  2K2M A;  2M02 A;  4PLL A;  4KBM B;  1JJ2 A;  1VQO Q;  4J9B A;  1VQP T;  2XID A;  3CCL T;  3MCA B;  1TUD A;  1GRI A;  2FZC B;  2HSP A;  3QDF A;  2YWW A;  3CBO A;  3RIR A;  1SHF A;  5GMK e;  4RMO A;  4PJN A;  3WXM B;  3CMA Q;  2RQR A;  2DIG A;  1NBE B;  3EG3 A;  5KE3 A;  2YRD A;  3I56 Q;  2AKL A;  2EVR A;  4P5N A;  3TQ7 P;  1WDX A;  3RKY A;  2HDA A;  4A54 A;  2ED0 A;  3OS5 A;  4OGC A;  2PQW A;  4HVV A;  1UDL A;  3JCM X;  3HP9 A;  3RR6 A;  4Z89 A;  2FEI A;  2HBP A;  2KDS A;  2DL7 A;  2F69 A;  1IHV A;  2LQN A;  1FWZ A;  2R5M A;  3A5Z B;  4M78 F;  4M75 F;  1R0C B;  3OB9 A;  2EJ9 A;  4IUP A;  1PHT A;  4E7I A;  2FPE A;  3OYF A;  4M77 E;  4B6M A;  1KHI A;  1HSQ A;  2X3X D;  1RUW A;  2NUP A;  1CKA A;  1UHC A;  1AWX A;  2K3B A;  3JCM g;  2HZY A;  1K0S A;  3I55 T;  1K73 R;  3RDV A;  5A0L A;  3SDZ A;  2ESW A;  1YIJ A;  2KVQ G;  2JZ2 A;  3QUI A;  3OBY A;  3MET A;  3CD6 A;  4DBQ A;  2DNU A;  3TSW A;  3MKD A;  2ABL A;  2KAF A;  5HCK A;  1VIE A;  1WHL A;  5GAN 6;  4GLM A;  3PMT A;  1X75 C;  4LD6 A;  2J05 A;  4EIK A;  1D0Z A;  1NPR A;  4M77 F;  1Q7Y C;  1VQ6 Q;  4HCK A;  2X4X A;  1M90 C;  1VQN T;  1MGQ A;  4HVW A;  1I5O B;  1NEG A;  2X35 A;  1ABO A;  5IXB A;  2F2W A;  1OU8 A;  3JRZ A;  1WLP B;  1VQO A;  1D1A A;  4PJO A;  2DZC A;  2FG0 A;  9ATC B;  1OV3 A;  2ZPB B;  3OW2 A;  1BIA A;  3UAT A;  2LDM A;  2BZY A;  4NL2 A;  3I5S A;  4FYX B;  4M77 G;  4Z8A A;  1T3S A;  3OYG A;  1S72 Q;  4BDZ A;  3NHN A;  1VQM T;  2FB7 A;  2PNI A;  2QQR A;  1KC8 C;  4JJC A;  3OA6 A;  4FSS A;  3TVT A;  2KGT A;  3PE0 A;  2EQU A;  3JAM E;  2XIC A;  1M9S A;  2VYT A;  5LJ3 f;  2IPO B;  2DXB A;  3EG9 A;  3QPH A;  3L1A A;  1TOV A;  1SG5 A;  5EC7 A;  1AZG B;  1FMV A;  3RMS A;  2RQT A;  4PKC C;  1SSF A;  5KYU A;  1PNJ A;  1Q82 U;  3G71 Q;  1B34 B;  3LWH A;  4E7H A;  2DRK A;  1M1K C;  4QT7 A;  4RTT A;  3ME9 A;  2C06 A;  2BTT A;  2K7A A;  1D3B A;  1M5Q 1;  4XQ3 A;  1VQ7 Q;  3EH1 A;  3TEE A;  4QKU A;  5C6S A;  2BZ8 A;  1W1F A;  2DBK A;  5I21 A;  1B07 A;  1LVK A;  3EH2 A;  1O9S A;  4ELZ C;  3NTI A;  4PL6 A;  3OBW A;  5GAO n;  4BY6 B;  3C12 A;  3P8B B;  4C92 F;  2K6D A;  1QMC A;  4EPC A;  5KYN A;  3GP8 A;  2GGR A;  4RUG A;  1WNL A;  2LT1 A;  4J9D A;  4KT0 E;  4ATO A;  3LH0 A;  2DLP A;  4M75 B;  4PK4 A;  2DXC A;  5D7U A;  1VQ5 T;  1BI2 A;  1M2O A;  2JN0 A;  4C5E A;  2GQV A;  3BDL A;  3CCS Q;  1G3Y A;  4FYY B;  5CK9 A;  1GCQ A;  1B34 A;  4J6Y A;  1LOJ A;  3L2Z A;  3LX7 A;  1IHW A;  4DEY A;  3I55 A;  5GAN 3;  1PKT A;  2RI3 A;  3OYY A;  3QZ5 B;  4QVD A;  1GCP A;  1AEY A;  2CZ6 B;  3VJP A;  1OQK A;  3EAE A;  1PRL C;  3WVE B;  3S3O A;  4RTW A;  3QHS A;  2PU9 B;  3VS0 A;  2BZX A;  1JXO A;  3M53 A;  4GLK A;  3LH5 A;  2E12 A;  4HVU A;  3PIP A;  3AHU A;  3OMG A;  5CKD A;  4JS5 A;  3UPU A;  2LT4 A;  1TS9 A;  3M59 A;  1YHQ A;  3FRN A;  2VC8 A;  2O2O A;  4J9I A;  4J9H A;  4QVZ A;  2HAX A;  4IUU A;  1P92 A;  2V26 A;  3EGU A;  3MP6 A;  2MWP A;  3JB9 D;  1UEC A;  2P0P A;  4J83 A;  4JJD A;  5M9O A;  5GAN h;  2ENM A;  2EWN A;  4M77 D;  1ZX6 A;  2KXD A;  4RG2 A;  5I11 A;  1YWO A;  3OMC A;  4KGZ B;  1QVF S;  1VQ9 T;  1I1J A;  3H9N A;  2JS2 A;  4IUR A;  4C5H A;  1YI2 T;  1HXD A;  5CO7 A;  1SKU B;  1PRM C;  1M90 U;  4OMO A;  4DQ2 A;  4ZGD B;  1VQ8 Q;  2PUO B;  3JCM e;  1YIT T;  2BKD N;  1CSK A;  3E9F A;  3I9Q A;  4PJO C;  2VVK A;  3AT1 B;  1OOT A;  2YUN A;  5LJ5 f;  5KCH A;  4DBR A;  1S1N A;  2JT4 A;  3OS1 A;  3E2U A;  3V8K A;  4M75 D;  4HT8 A;  1Q86 C;  4L5G A;  2VGN A;  3GPL A;  2CP5 A;  3CCE Q;  2OTL Q;  4E7L A;  3ER0 A;  3QYG B;  3BDU A;  4R56 A;  4ANJ A;  4KUL A;  2AK5 A;  1M1F A;  2BE9 B;  3OYA A;  4CC3 A;  4ELY C;  3FJ5 A;  2DXU A;  1UB4 A;  4BI3 A;  2K79 A;  2FVU A;  4M7D B;  2E10 A;  1M4Z A;  3DB4 A;  4XTZ A;  1D0Y A;  3GIB A;  1MHN A;  1I81 A;  1OX8 A;  4C92 D;  4QVC A;  1MND A;  1K73 U;  3CC2 T;  1UJY A;  1E6G A;  3SWN A;  1PM3 A;  2V8K A;  1I0C A;  2DXT A;  2QQS A;  4LDW A;  3JCM Q;  3JCM P;  2K4Y A;  1IGU A;  1NLO C;  2DPP B;  2RO0 A;  4M7A F;  1MMA A;  1T3L A;  3TU4 K;  4WF2 A;  1W2B P;  2CP0 A;  3S6W A;  2XMF A;  2E6N A;  4M78 E;  3CXC S;  5GAO l;  2QEX A;  1VQ5 Q;  4Z02 A;  5HY6 A;  3UF4 A;  1W2B S;  3CCM T;  1FX7 A;  3NGP A;  1C0M A;  5KH6 A;  5KYW A;  1KD1 U;  3OYK A;  1YI2 A;  3HFO A;  1NLP C;  1RI0 A;  3BE3 A;  2AHJ B;  1JB0 E;  4RTY A;  1M1G A;  2RK2 A;  1YI2 Q;  1HYO A;  1Y7X A;  1T0J A;  1Q82 C;  2D0N A;  1WJQ A;  1W6X A;  3CCV A;  3U23 A;  1VQ5 A;  2KE9 A;  5IT9 E;  2VB6 A;  3EGX A;  2QQA A;  1Z9Q A;  2WSC E;  4A4F A;  1K8A C;  2LJ1 A;  3M58 A;  3Q1J A;  3KBG A;  3I5R A;  4BI8 B;  1K9M R;  1WHG A;  2NYS A;  3NMZ C;  4WCI A;  1E6H A;  2O9S A;  1OYX A;  1OZ3 A;  4JLI A;  2DIL A;  2RHI A;  2L89 A;  4AFZ C;  4NL3 A;  2QA4 A;  5CKB A;  2LX9 A;  2SEM A;  1YJ9 A;  1YJW A;  2L3S A;  1S72 T;  4A4K A;  5KE2 A;  4XK8 E;  4ZNX A;  1U5S A;  2AT1 B;  1D1C A;  2RJC A;  4PJO B;  2KRO A;  1X43 A;  4XAX B;  3VU3 C;  1X6B A;  4C92 B;  5CKF A;  4JRQ A;  1QP3 A;  5FLX E;  1VQK A;  2KK4 A;  1YCS B;  4JRP A;  2NUP B;  2Y4X A;  2VKN A;  2DFU A;  2FPD A;  1BYM A;  2E3I A;  1WHJ A;  1QCF A;  1XTD A;  1VQK Q;  1B3Q A;  2O31 A;  5GMK i;  3T9N A;  2J06 A;  3JB9 J;  4AG1 C;  3RNJ A;  3NTK A;  4JLG A;  4VUB A;  5FU7 C;  1G5V A;  4M78 A;  2JTM A;  1OEB A;  1VQP Q;  1RAB B;  2RM4 A;  3A8M B;  4PJJ A;  1YJ9 Q;  3CCS T;  1TWB A;  1QVF A;  2VAS A;  3DB3 A;  2DL5 A;  2HSE B;  3M5A A;  3MEU A;  1OZ2 A;  2B8A A;  4M7A B;  1NYF A;  1QKX A;  1JQQ A;  1PD1 A;  4BY6 C;  4B9X A;  3M0R A;  3M0T A;  1GFC A;  3CCV Q;  3VS2 A;  1U1T A;  1QLY A;  3C94 A;  4EMK C;  1WGS A;  2XG8 D;  2V8J A;  1BBZ A;  1Q81 U;  3RBB B;  3MO8 A;  4ORZ A;  2DX1 A;  1KJW A;  2X4W A;  2DMO A;  4E7K A;  1AD5 A;  1XNI A;  1VYT A;  2QEX Q;  3V8L A;  1VOM A;  1UE9 A;  2ED1 A;  3VYG A;  3JCM W;  1VQ4 T;  2ZPE B;  5LJ5 d;  1K4U S;  1TSF A;  1Q7Y R;  1GXI E;  2KSS A;  2JW4 A;  1WQW A;  2CUB A;  5KYX B;  2XD0 A;  4FYV B;  1PD0 A;  3JCM f;  2ZAE A;  1YWP A;  5LJ3 e;  2EIF A;  3UWN A;  3JB9 I;  5J26 A;  4OP0 A;  3EGD A;  3CXC A;  2BIV A;  4M78 D;  2JJ9 A;  4FL6 A;  3C0C A;  4CC2 A;  1NJI U;  4HKE A;  2AIR B;  2HCK A;  3R6N A;  1WHK A;  5DLQ E;  2DF6 A;  3ZFJ A;  2QG9 B;  3EG9 B;  1E7O A;  2Y90 A;  1G8X A;  3CCS A;  1QQJ A;  4C8Q F;  1WPY A;  1QWE A;  2YDL A;  3CCE A;  4CRI A;  3MPU B;  1I5L A;  2K3X A;  2KYM A;  4D8D A;  2M0O A;  3WVD B;  1VQ6 T;  8ATC B;  2P84 A;  4FIB A;  4X9D A;  4HCZ A;  3G1J A;  3HPW A;  3PFS A;  3E19 A;  1WXT A;  3CCE T;  1MMN A;  1LJO A;  4KUI A;  2MIO A;  1U1S A;  1X69 A;  1VQ9 A;  1R8O B;  3V8J A;  4C8Q G;  3DLL A;  2P4T A;  4YTL A;  1K9A A;  4OB0 B;  2VGM A;  2LP5 A;  3H8Z A;  3FLG A;  4IUT A;  1V76 A;  4L6V 5;  2JMA A;  5J3B A;  4M77 B;  2PVO B;  3CCU A;  3THK A;  1QCO A;  3HRS A;  3G71 A;  2D0Q B;  2ZPF B;  1HK9 A;  2KRM A;  1OI1 A;  2DJZ A;  4BD3 A;  2A28 A;  2ROT A;  4PJO E;  3O8V A;  1RAF B;  3L42 A;  2YHT A;  2D8H A;  3PVQ A;  4A4E A;  4C0D B;  1O75 A;  1VUB A;  2FRY A;  4C0G A;  2EYZ A;  2GNC A;  1YHQ Q;  4BB7 A;  5IH2 A;  3VS5 A;  4J9G A;  1Q81 R;  5KYW B;  4E7Z A;  3H0F A;  4JPB W;  1FYN A;  2GF7 A;  3CCQ T;  4JJN K;  3SFM A;  3EGD B;  4M78 B;  4K11 A;  5A2Q E;  1VQN Q;  4FYW B;  2EPD A;  5ECA A;  5LJ5 j;  3HRU A;  5LL6 S;  2KI7 A;  2X9H A;  4ZGE B;  1RAE B;  1Q95 G;  3QSU A;  4M7D E;  2KR3 A;  2R5A A;  2HKQ B;  1PC0 A;  2QQ9 A;  1TU0 B;  2XK0 A;  1RAA B;  1N9R A;  4LUE A;  2Z0W A;  4FW1 A;  3VV0 A;  2CP6 A;  1LNX A;  4M77 A;  1T0H A;  2A3L A;  2DZ9 A;  4OB3 B;  2DEQ A;  2L2P A;  1WZO A;  1QVG P;  2HBW A;  4BAC A;  1Q86 U;  4NS5 A;  3CD6 Q;  1AOJ A;  5GAM j;  1AWW A;  4A63 B;  2KMT A;  2D6F A;  5CQX A;  3OYJ A;  3M9Q A; 
#chains in the Genus database with same CATH homology
 3CCV T;  3CBP A;  1WJS A;  4X9C A;  5GAM f;  2JOY A;  3OMC A;  1QVF S;  4EMG A;  5GAO q;  1VQ9 T;  4M7D D;  4HCB A;  3INZ A;  3C4S A;  4QQD A;  4M78 G;  2VXF A;  4IUR A;  2E5Q A;  2MF2 A;  4MDW A;  1Y07 A;  3CD6 T;  4XTU A;  4BDY A;  1DJ7 B;  3NTH A;  2GCX A;  2IG0 A;  2F5K A;  4C5H A;  1HXD A;  4LDY A;  5CO7 A;  1YI2 T;  5A0G A;  3BY7 A;  1Q7Y U;  4XU0 A;  2CZ0 B;  3QXE B;  4C0D C;  3L2W A;  1M90 U;  4C8Q A;  3J81 E;  3CCR T;  4RKU E;  3P8H A;  4MZP A;  4DQ2 A;  4ZGD B;  4CI0 C;  4BE0 A;  4J7F A;  1X01 A;  5GAO p;  4LD9 K;  1N27 A;  2PUO B;  3VYH B;  5DY9 A;  1JJ2 S;  4N0A C;  5AYF A;  3V7R A;  5CAI A;  2XKO C;  4JUV A;  2CGH A;  2FHD A;  4XTX A;  3J7A F;  3JCM e;  2RJF A;  1YIT T;  2BKD N;  3E9F A;  4PJO C;  4HT9 A;  5LJ3 h;  1YJ9 T;  1YIT A;  1G3W A;  3GNG A;  5LJ5 f;  5KCH A;  1ZBX A;  3L2U A;  4XTV A;  3I56 T;  3A8G B;  3OS1 A;  2RI5 A;  3V8K A;  3LGL A;  4FSX A;  3OW2 S;  4F7U F;  4M75 D;  5A0D A;  4HT8 A;  1Q86 C;  1BI0 A;  4L5G A;  4J6X A;  5GAO m;  2VGN A;  5D6Y A;  1WQ7 A;  3PTA A;  2M1H A;  3X26 B;  3L2Q A;  3GPL A;  3CMA T;  4M7A A;  2CKK A;  3GLX A;  4HA8 A;  4C8Q C;  2LTO A;  4E7L A;  3ER0 A;  3QYG B;  3GF5 A;  3BDU A;  4A4H A;  4DOV A;  1IZ6 A;  4IUQ A;  4R56 A;  3I56 A;  4KUL A;  3HRT A;  4M75 E;  4JRK A;  1M1F A;  2EQK A;  3A8L B;  4N0A A;  3FEO A;  4PLI A;  3OYA A;  4ELY C;  2RB6 A;  2DXU A;  1UB4 A;  4OMF B;  4BI3 A;  3S3M A;  3G6E T;  2PUK B;  3V7S A;  2FVU A;  4EMK A;  2XDB A;  2E10 A;  4F7U A;  1QVG S;  4M7D B;  1M4Z A;  1UGS B;  3DB4 A;  3BFM A;  1KD1 C;  5FU7 B;  4QW2 A;  4J7I A;  3LWI A;  4XTY A;  4XTZ A;  3SB2 A;  2WSF E;  2L5Q A;  2YLC A;  4Y28 E;  4DOW A;  3G4S T;  2PVG B;  3GIB A;  5FRO A;  1QVG A;  1MHN A;  1YBY A;  1I81 A;  2O4X B;  4ZTF A;  1KQS S;  4C92 D;  4JRI A;  3JB9 G;  3RES A;  4PNO A;  4QVC A;  3CPF A;  4MMK A;  3CCM A;  1K73 U;  3CC2 T;  2CYZ B;  1NPP A;  3CPW A;  2MI6 A;  2D9T A;  3SWN A;  5GAN g;  2QEX T;  2V8K A;  1VQL A;  2DXT A;  2EJG A;  2QQS A;  4LDW A;  4QQ6 A;  2EQJ A;  5CR2 A;  1RL2 A;  5CKH A;  3JCM Q;  1YHQ T;  1I8F A;  1H3Z A;  2E64 A;  5D6X A;  1VQ6 A;  3JCM P;  2K4Y A;  4M77 C;  1K73 C;  2DPP B;  2L3R A;  2RO0 A;  3F70 A;  4MML A;  2X4Y A;  3QDR B;  4M7A F;  5C0M A;  2O01 E;  3TU4 K;  5GMK h;  5GAN 7;  4OB1 B;  3CME T;  1BI1 A;  1KHC A;  2XHC A;  4WF2 A;  4ZN1 A;  2VV5 A;  2DKG A;  2DVE A;  2LNV A;  2RD1 A;  3S6W A;  2HQX A;  2DTO A;  5HK3 A;  5GAN f;  2E6N A;  4M78 E;  3CXC S;  5GAO l;  3CPW S;  3RKX A;  2QEX A;  2KY9 A;  3PIO A;  2OTJ A;  2OTL A;  3ASK A;  3G7Z A;  2QQB A;  5CIU A;  4Z02 A;  5HY6 A;  3JCM c;  1W2B S;  4PJO G;  4R55 A;  1FX7 A;  5LJ3 d;  5KH6 A;  3CCM T;  3CCU T;  1KD1 U;  3OYK A;  1YI2 A;  2MAM A;  2DD4 A;  2DO3 A;  2JUF A;  4MZM A;  1M8V A;  2RHZ A;  2HD0 A;  3HFO A;  2GFA A;  2HQE A;  1RI0 A;  4M7D G;  2AHJ B;  5LJ3 j;  4DA4 A;  1JB0 E;  4N4I A;  4PJO F;  1M1G A;  1M1K U;  2RK2 A;  4II1 A;  2OTJ T;  5CKE A;  2DTH A;  3HSB A;  2CS7 A;  1Y71 A;  1Y7X A;  4M75 A;  1Q82 C;  4GY5 A;  1VQ8 A;  1WJQ A;  1ZQ1 A;  2LQK A;  2RJE A;  5FU6 B;  3CCV A;  1VQ5 A;  3FIF A;  4FU6 A;  5IT9 E;  3M54 A;  4EDU A;  3OYH A;  1NJI C;  2E70 A;  1K9M U;  4NOY A;  4KUD K;  2ZPG B;  1K8A C;  4A4F A;  2QQA A;  2K3Y A;  1IRE B;  2WSC E;  2K5L A;  3M58 A;  3M4Y A;  5CQY A;  1V29 B;  3QKJ A;  3Q1J A;  1S72 A;  3OYE A;  3KBG A;  5GAN e;  1WJR A;  4ZN3 A;  2YLB A;  1YJN T;  3QYH B;  4E47 A;  4BI8 B;  3CC7 T;  1XOV A;  3MP1 A;  1W4S A;  2EKO A;  3QZ9 B;  3G71 T;  1TH7 A;  4C5G A;  5GAN 4;  3JCM J;  3EFR A;  1OYX A;  1OZ3 A;  4JLI A;  3EFS A;  2RHI A;  1Y96 A;  2L89 A;  4NL3 A;  4FT4 A;  2QA4 A;  5CKB A;  2LX9 A;  4PLL A;  4KBM B;  1YJ9 A;  1UGQ B;  2A7Y A;  1YJW A;  4M7A G;  2CZ7 B;  4C92 C;  1S72 T;  2E1H A;  1QW1 A;  4A4K A;  5KE2 A;  1JJ2 A;  4RG8 A;  2R58 A;  4XK8 E;  4M7D C;  2RHU A;  1VQP T;  3OYD A;  2XID A;  2RJC A;  3CCL T;  4PJO B;  3MCA B;  4LDU A;  4XAX B;  3VU3 C;  1N6A A;  4C92 B;  5I2S A;  4E7J A;  5CKF A;  4JRQ A;  3VUZ A;  3OSS C;  1QP3 A;  5FLX E;  4XTW A;  4ZTJ A;  1VQK A;  3RIR A;  3CBO A;  2KK4 A;  5GMK e;  4JRP A;  2Y4X A;  2NLU A;  4RMO A;  3WXM B;  3CC2 A;  4A4G A;  1BYM A;  1XTD A;  2DIG A;  3PT9 A;  5IN1 A;  2OAU A;  5KE3 A;  3CCQ A;  3CC4 A;  4OVA A;  5GMK i;  3T9N A;  1ZHI A;  2QI2 A;  4RCC A;  3JB9 J;  4C8Q E;  5IAY A;  3NTK A;  3JSC A;  1EIF A;  4P5N A;  4JLG A;  4J8O A;  3HHT B;  4VUB A;  4EMH A;  2E41 A;  3RKY A;  5HK0 A;  1NE8 A;  4A54 A;  5FU7 C;  3OSV A;  4M78 A;  3OS5 A;  1G5V A;  2JTM A;  4OGC A;  3OYM A;  2K57 A;  1VQN A;  2RM4 A;  3A8M B;  2PQW A;  3OYL A;  3OS0 A;  4J5Y A;  3CCS T;  1VQM A;  3KXT A;  3PNW C;  1QVF A;  2JNG A;  4QQG A;  3UT1 A;  3JCM X;  3DB3 A;  4IKF A;  3HP9 A;  3M5A A;  2E65 A;  2RI2 A;  4FT2 A;  3MEU A;  2F5T X;  1OZ2 A;  1VQL T;  2B8A A;  2HBP A;  2KDS A;  2PVD B;  4M7A B;  2DK3 A;  3QJY A;  5FRM A;  3E9G A;  5DM7 R;  2F69 A;  2XU8 A;  3RKW A;  4BY6 C;  4B9X A;  4JDS A;  1UEB A;  1FWZ A;  1PSE A;  3A5Z B;  2R5M A;  4M78 F;  4M75 F;  1G3T A;  5I2M A;  1NZ9 A;  3OB9 A;  2LVM A;  2EJ9 A;  4IUP A;  3PGG A;  3X20 B;  1YIJ T;  5GAM d;  3A8O B;  2LQ8 A;  3URG A;  3LGF A;  4E7I A;  1U1T A;  4OF1 A;  3CCJ A;  2ZCF B;  2E6Z A;  4C92 G;  3C94 A;  4C5I A;  4EMK C;  5LJ5 g;  1WGS A;  4M7A D;  2XG8 D;  2DIQ A;  2V8J A;  4M77 E;  3OYF A;  3OYC A;  2ZGW A;  1KHI A;  2DAQ A;  3FDR A;  2G3R A;  1Q81 U;  3MO8 A;  5CCA A;  2FL7 A;  5GAN 8;  2L8D A;  3JB9 F;  2BUD A;  3MEW A;  3SD4 A;  3JCM g;  4HCC A;  4ZGJ B;  1JRI A;  3I55 T;  3CCJ T;  1PSF A;  2EFI A;  2X4W A;  5A0L A;  1VQP A;  1YCY A;  3SDZ A;  4F7U G;  1FXX A;  1YIJ A;  3N5B B;  4E7K A;  2KVQ G;  2JZ2 A;  3QUI A;  3OBY A;  1XNI A;  3MET A;  3S3N A;  3CD6 A;  3SWN C;  4XU3 A;  3OYB A;  1VQ7 T;  1UGP B;  3V8L A;  5GAN 2;  4OGE A;  2IVW A;  2KAF A;  3RER A;  3HKS A;  1VQ7 A;  1VIE A;  3VYG A;  3JCM W;  1VQ4 T;  2ZPE B;  5GAN 6;  5LJ5 d;  3VUB A;  4BE2 A;  5J39 A;  2LRQ A;  3PMT A;  1X75 C;  3FC3 A;  5GAM g;  1KQ1 A;  4LD6 A;  1GXI E;  2KSS A;  1WQW A;  1NPR A;  1QVP A;  4M77 F;  2XD0 A;  3V7C A;  1Q7Y C;  1Y96 B;  2Y4Y A;  4Y91 A;  2X4X A;  1M90 C;  3TCJ A;  3QBY A;  3JCM f;  1VQN T;  1MGQ A;  5LJ3 e;  3RMQ A;  3OYN A;  4M7D A;  3PMI A;  2KQW A;  2EIF A;  4ME7 A;  2X35 A;  3DLM A;  3UWN A;  3L2R A;  3QG1 A;  3JB9 I;  5J26 A;  3R6O A;  1I4K 1;  4OP0 A;  1VQ4 A;  3DKM A;  5D6W A;  3JRZ A;  3OY9 A;  1VQO A;  4PJO A;  4F7U E;  2DZC A;  3CXC A;  2BIV A;  5GAN j;  4M78 D;  2ZPB B;  4C0F A;  3OW2 A;  2K5I A;  4FL6 A;  1BIB A;  3OQ5 A;  1BIA A;  3CEY A;  3ZEH A;  3QJ6 A;  4MDX A;  2LC4 A;  2LDM A;  1VQK T;  1NJI U;  3JCM d;  1XQH A;  4NL2 A;  4XU1 A;  2I2L A;  3UDC A;  4HKE A;  2EJF A;  4M75 C;  4M77 G;  5DLQ E;  4M7A C;  2EAY A;  3ZFJ A;  1VQO T;  3CCL A;  2OTL T;  3OYG A;  4F7U B;  4JS4 A;  4BDZ A;  3MP8 A;  1VQM T;  2FB7 A;  2QQR A;  2Y90 A;  2ZPI B;  5GMK l;  3OA6 A;  3CCS A;  1KC8 C;  1KG1 A;  2MMP A;  2JTF A;  2EQU A;  3JAM E;  2XIC A;  5FRN A;  1M9S A;  4C8Q F;  3CME A;  1UGR B;  2VYT A;  1WPY A;  5LJ3 f;  4XU2 A;  4M78 C;  3CCE A;  2DXB A;  4CRI A;  3HFN A;  1I5L A;  2K3X A;  3X24 B;  1X6O A;  3ZBD A;  3QPH A;  3GOX A;  2M0O A;  3L1A A;  3WVD B;  1VIF A;  3TRE A;  3P8D A;  1N8R U;  2DD5 A;  1KC8 U;  1VQ6 T;  3CC4 T;  3LW5 E;  4FM4 B;  4FIB A;  4X9D A;  3VKI A;  3J80 E;  4HCZ A;  3RMS A;  3HPW A;  4PKC C;  1SSF A;  2ZZD A;  4Q5W A;  3PFS A;  1KQ2 A;  2H3J A;  3E19 A;  3CCE T;  1Q82 U;  2R57 A;  1JBM A;  1B34 B;  3C95 A;  3LWH A;  1LJO A;  3LLR A;  1BKB A;  2DTI A;  3JCM h;  4V2S A;  4KUI A;  2JVV A;  4E7H A;  2M9U A;  4C0Z A;  4LDX A;  3MEA A;  4O5V A;  1M1K C;  1U1S A;  3RUX A;  4MZT A;  1VQ9 A;  3MHX A;  1KQS A;  4N4H A;  3ME9 A;  5GAO r;  1R8O B;  3M4G A;  2C06 A;  3V8J A;  4C8Q G;  1VQ8 T;  2EYQ A;  3DLL A;  1D3B A;  2P4T A;  2VUB A;  2ZPH B;  4YTL A;  4OB0 B;  1M5Q 1;  2VGM A;  3X25 B;  2K5F A;  3L2V A;  4XQ3 A;  3CCR A;  1AHJ B;  3M55 A;  3H8Z A;  3FLG A;  4IUT A;  5L8R E;  4L6V 5;  5J3B A;  3TEE A;  5GMK m;  4EMK B;  2WSE E;  3M57 A;  4M77 B;  2PVO B;  5C6S A;  5I21 A;  2RH2 A;  3FB9 A;  3CCU A;  3M56 A;  5DLO A;  2GFU A;  4J6W A;  5CVI A;  1O9S A;  2RK1 A;  3NTI A;  4ELZ C;  4PL6 A;  3HRS A;  3JCM b;  2X4J A;  3OBW A;  4BUG A;  4C92 E;  5GAO n;  2RHY A;  3G71 A;  2P0Q A;  2D0Q B;  4BY6 B;  3C12 A;  5LJ5 h;  2ZPF B;  3P8B B;  1HK9 A;  4C92 F;  1H64 1;  3CC7 A;  4M7D F;  4EPC A;  1OI1 A;  1W2B A;  2DJZ A;  2YRV A;  3GP8 A;  4L59 A;  3MEV A;  3JB9 H;  1WNL A;  2LT1 A;  4B9W A;  2QXF A;  2V8I A;  2O4X A;  4BD3 A;  4KT0 E;  4ATO A;  3LH0 A;  4PJO E;  4M75 B;  4UC4 A;  3O8V A;  2DXC A;  3L42 A;  3QO3 A;  1VQ5 T;  1BI2 A;  2YHT A;  1QP2 A;  2JN0 A;  4A53 A;  2XDP A;  4A4E A;  4C0D B;  4LDV A;  4C5E A;  2GQV A;  3LYI A;  1O75 A;  3BDL A;  1N8R C;  1VUB A;  2RJD A;  2EQM A;  1G3Y A;  4C0G A;  2QA4 T;  5CK9 A;  1B34 A;  2LCC A;  4J6Y A;  1YJN A;  1LOJ A;  1Q81 C;  4BB7 A;  3NFC A;  3QII A;  3L2Z A;  3LX7 A;  4C8Q B;  3OS2 A;  2K2V A;  2GF7 A;  3CBM A;  5GAM h;  3CCQ T;  3SFM A;  3I55 A;  4JJN K;  4D6W A;  5GAN 3;  3E1S A;  3FJP A;  2RI3 A;  3OYY A;  4M78 B;  3QZ5 B;  4QVD A;  3G4S A;  5FU6 C;  1N9S A;  4C8Q D;  4M7A E;  5A2Q E;  2CZ6 B;  4O6J A;  3VJP A;  3H6Z A;  3EAE A;  3WVE B;  3S3O A;  5LJ5 j;  3HRU A;  3KUF A;  5LL6 S;  1BI3 A;  3HL8 A;  3OYI A;  4ZGE B;  1U8R A;  4M7D E;  3QHS A;  2PU9 B;  3QSU A;  4C92 A;  3G6E A;  2R5A A;  3M53 A;  5GAM e;  4GLK A;  5GAN 5;  2E12 A;  3GNF B;  3PIP A;  3AHU A;  4BI4 A;  3OMG A;  5KCO A;  5CKD A;  2FYK A;  4JS5 A;  2QQ9 A;  2LCL A;  2XK0 A;  3UPU A;  2LT4 A;  1N9R A;  3M59 A;  3X28 B;  5EG2 A;  1YHQ A;  4PJO D;  3FRN A;  2VC8 A;  2M16 A;  3SWN B;  3VV0 A;  1YJW T;  3CMA A;  4X34 A;  2MWO A;  1LNX A;  4TVR A;  4M77 A;  1G3S A;  1K8A U;  4IUV A;  3JCM V;  1K9M C;  2A3L A;  2DZ9 A;  3BW1 A;  4OB3 B;  4N4G A;  4QVZ A;  4IUU A;  2XI9 A;  4OB2 B;  5HKC A;  5GMK j;  5GAN d;  2HAX A;  1P92 A;  4M75 G;  2DEQ A;  2HNI A;  2XDD A;  2VXE A;  2RA2 A;  3MP6 A;  2MWP A;  2WAC A;  4BE1 A;  2P0K A;  4BAC A;  3JB9 D;  2P0P A;  4J83 A;  2QTX A;  4NS5 A;  1Q86 U;  2QDY B;  5GAM j;  2CZ1 B;  5M9O A;  1D3B B;  5GAN h;  2EWN A;  2KMT A;  4M77 D;  2RHX A;  3A8H B;  2D6F A;  5CQX A;  5LJ3 g;  4RCB A;  4RG2 A;  5LJ5 e;  3M9Q A;  3OYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...