2CP2A

Solution structure of the 1st cap-gly domain in human clip-115/cyln2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
95
structure length
95
Chain Sequence
GSSGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 1st CAP-Gly domain in human CLIP-115/CYLN2
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CLIP-115
total genus 9
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp2A00
2M02A 2MPXC 2CP2A 2CP5A 2HKQB 2HL3A 2HL5C 2CP0A 1TOVA 2HKNA 1WHKA 2Z0WA 2COWA 2E3IA 2E4HA 1IXDA 3E2UA 2CP7A 1WHLA 2HQHA 3RDVA 4B6MA 2QK0A 2COYA 2CP6A 1TXQA 1WHMA 1WHGA 2CP3A 1WHHA 2E3HA 1WHJA 1LPLA 2COZA 3TQ7P
chains in the Genus database with same CATH superfamily
1MMAA 3BDUA 4C8QG 1UJYA 2JVVA 4KUIA 3CXCP 4XTXA 1PWTA 2EYZA 1UDLA 2JM8A 4KH1B 3E2UA 2M16A 2D8JA 1N6AA 1KC8R 4FT2A 4M77G 2CSQA 1WXBA 2JXBA 5C6SA 4EMGA 2YDLA 1ZUUA 1G3YA 3SB2A 1M3BA 3ME9A 2JW4A 1RAGB 4M7DC 1VOMA 1WHKA 1QLYA 5DY9A 2E6NA 2BE7D 3JCMP 1PD0A 3WVEB 4ESRA 1QCOA 2F5KA 2DX1A 2DEQA 2RB6A 3HRTA 4C8QC 1O75A 2RPNA 1ZQ1A 1QCNA 5GAN2 4X1VA 2EWNA 1VQ7A 3U23A 2A36A 1AEYA 1BCOA 4IKFA 3VS6A 2ZZDA 3EG3A 1YI2T 5FW9A 1EFNA 2L3PA 1WZOA 5GANd 4WCIA 1NM7A 1M3CA 3VS5A 2DVJA 4M7AB 4BB7A 3FRNA 1NYFA 2RA2A 2Y90A 1WQWA 2J6KA 1N27A 3ER0A 1SSFA 1QKXA 4JJCA 2F69A 1YITA 3CCET 5IT9E 1VQKQ 4F7UB 4M7DE 2LMJA 1G3SA 1UB4A 3BE3A 2BKDN 1D0YA 5FWBA 2PZ1A 1SG5A 2K6DA 2K4YA 1IHWA 1WHMA 2JM9A 3P8BB 1KD1U 1WX6A 4C0ZA 1YJWQ 4M7DA 4GBQA 3PMTA 5GMKl 1VQ6Q 3X26B 1VQ6T 3CCJA 5IAYA 1N8RR 2BZ8A 2RHZA 3VS1A 2YRDA 6AT1B 3L42A 2LNVA 2AZSA 1YITT 1IHVA 4J6WA 3CCEQ 2K2MA 4E7JA 2EIFA 4BDYA 4FYVB 5IXBA 1VQ9A 3E9GA 4M78C 1S72A 2CP2A 1W2BS 4RTXA 3MP8A 1K9MR 2DKGA 4ZTFA 3OYFA 2DFUA 1WHLA 2YRCA 3FJ5A 2A0FB 1O9SA 3RDVA 4N4IA 3IQLA 1M3AA 1SPKA 1M8MA 3CC4A 4HT9A 1OPKA 4LDVA 2QTXA 2KAFA 1RABB 3EH2A 1G5VA 2D8HA 1BI0A 2LQWA 3JB9G 1M90R 3OYIA 4MDXA 2EQKA 5GAOl 2YHTA 1VQ9T 2CS7A 4OVAA 3T9NA 4KGXB 5FU7B 4J9FA 1SRLA 4LNPA 5GMKh 4HVUA 2CZ1B 3JCMJ 1D3BB 3L2QA 1RL2A 5I21A 1MNEA 1QVGP 2RI3A 3FB9A 2DETA 2MIOA 4O6JA 4M75E 1S72T 4OMPA 5CAIA 2QTVA 4DBFA 1G2BA 2FPFA 3QIIA 4RCCA 2E65A 4L59A 3JCMb 3SWNA 3CCLA 2GBQA 4TVRA 5CQYA 5HK3A 1AWJA 1M1FA 3OS1A 3CCJT 1U3OA 1D09B 3REAB 2XMFA 1B3QA 1KQSP 4FYXB 1K8AC 1VQ4T 2LCSA 3I55T 2EFIA 2J05A 4VUBA 3OW2S 1T0JA 3HFOA 4M78D 2XG8D 3FJPA 3BW1A 5FU7C 4M75C 1KQSS 2ABLA 2C06A 4RTYA 1T3SA 2PUOB 4XU0A 3V7CA 2CP0A 4OMOA 2VV5A 1RADB 4FT4A 4EIKA 4E7LA 3O5ZA 2FZKB 2FEIA 2BE9B 1VQKT 3BDLA 1YHQQ 1B7TA 1QVFA 3CBMA 3OB9A 3CC2Q 1RAAB 2E3HA 3AT1B 4DBQA 5FWCA 3Q1JA 4Y28E 2VWFA 3PNWC 3QDFA 4WF2A 3M9QA 1QVPA 2XKOC 1KHIA 3CPWS 2LCLA 1RLPC 3V7RA 1TH7A 2C0TA 1YHQA 4FW1A 2CSIA 5D6YA 1GFCA 1VQLT 4J83A 4QQ6A 5D6WA 4XK8E 2X4JA 2CYZB 2L89A 4CC7A 2OX7A 3RMQA 2HBPA 1FWZA 4Q5WA 5HCKA 3EGUA 4IUTA 4PFOA 1D3BA 1C6VX 3GPLA 2NUTB 4GLMA 1JB0E 1QCFA 1JJ2P 4CI0C 3M0UA 1M1GA 2G6FX 1B34B 2YT6A 2K3XA 1N9SA 1RACB 2RJDA 3OYEA 2FZGB 2DD5A 4XTWA 1Q7YC 2A37A 1RUWA 4JLGA 2FL7A 2DJZA 1FXXA 1WJSA 4BD3A 5CK9A 1PG5B 3LGLA 3QXEB 4M78E 1VQLA 2DBKA 3FIFA 1UGSB 1XTDA 3MHXA 1KIKA 2R5MA 4NL3A 2PVOB 1WXUA 3CC2A 3M4GA 1NJIU 2D0QB 2RMOA 4XTYA 5CKBA 2QDYB 2P0KA 5GAN6 2IVWA 4BUGA 2EQMA 4ATOA 1LOJA 4C5IA 3ULRB 1K8AR 2M0YA 3SEMA 2B86A 1YIJA 2LRQA 3NTIA 1OZ2A 2OTJA 2FVUA 3M56A 3X24B 2LX7A 5KH6A 2X3WD 3MEVA 2JT4A 3S3OA 3TU4K 2HCKA 1BYMA 1BI2A 3MCAB 4OMMA 3TVTA 5KYWA 1M1KU 2L8DA 2GTJA 1BCMA 3L2VA 1BKBA 2ZAEA 2V26A 5LJ3h 4C92A 4QVCA 4AFSC 1VYTA 2JMAA 1SHFA 1ABQA 2M0OA 3RMSA 2LQKA 3J80E 2RJCA 2W10A 3S3MA 4CC4B 2CUBA 2MWPA 3EFOA 4F04B 4PNOA 4FYYB 1WLPB 1Z9QA 2COWA 3OA6A 3OS0A 1S72Q 2HNIA 2C0OA 2QYZA 1VQ4Q 1MMGA 2RJFA 2DBMA 1AWWA 1YCSB 3CCEA 3EG1A 4MMKA 2RHYA 3KFVA 4M75D 1U8RA 3VV0A 2KDSA 1A0NB 4A4GA 2QGFB 3JCMW 4BI4A 1K1ZA 3H0FA 4LXCA 4X9CA 4E7SA 1J3TA 3H9NA 5LJ3f 3CCJQ 5GAOm 2GFUA 1NEBA 2YUPA 2M51A 3OYAA 3TQ7P 2D6FA 2V8KA 3CCRT 2K7AA 5GANh 2QEXT 2DXUA 3V8LA 3EG9A 2P4RA 2X35A 3PTAA 3CCQA 4GY5A 5GAOn 2VB6A 4JRQA 1X2QA 2DPPB 1M27C 1ZSZA 2CP6A 3JB9F 3I56Q 1U5SA 1QMCA 4PFZA 3INZA 1Y7XA 2AZVA 4ORZA 3PIPA 3RKXA 2MF2A 1AVZC 4DA4A 3CD6Q 2OTLA 4CC3A 3L2ZA 1H3HA 1IGQA 2HDAA 1Q81U 1GCQA 3V8KA 4R56A 2V8JA 4L6V5 1RI9A 2DVEA 3EFRA 1TUCA 3EGDB 1ZLMA 1JBMA 2J6FA 4XTUA 4OB2B 2J06A 3CCVQ 3CCSA 2CUDA 2IPOB 2FZCB 4BE0A 1PKSA 1BU1A 2AK5A 1QP3A 5D7UA 1HYOA 4RMOA 2VVKA 2RQTA 3H41A 2HQXA 1Q95G 2QGGA 2EQJA 3JCMV 4J9CA 3PVLA 2HBWA 5DLQE 4AT1B 4D8DA 4PJOF 2JJ9A 1X2KA 3TSWA 4Z02A 4E7IA 2DNUA 2RI2A 1JJ2S 1VUBA 5CVIA 2EKHA 1UUEA 5KCOA 4QKUA 1K9MC 3M0QA 3URGA 2DE0X 1H3ZA 8AT1B 2XDBA 1S1NA 5ECAA 1MV3A 1NLPC 4CC2A 1AD5A 1KJWA 3M59A 4JUVA 1BIBA 3CCUQ 1VQOQ 4EMKC 1K4US 2GQIA 3THKA 1W2BA 3L1AA 4LD6A 4FM4B 3SHWA 2ECZA 4AFUC 2LP5A 1JEGA 1KK7A 1WYXA 2XU8A 4Y91A 4LDUA 3CCSQ 4DOWA 3CCVA 1VQ7T 1UG1A 4ZGJB 1D1CA 4FSXA 3CC7Q 1LNXA 1YI2Q 1K73C 4UC4A 1GRIA 1ZSZB 2AKKA 2DTIA 2VC8A 2LT4A 2OTLT 3CD6A 2ED1A 1Q86R 4LDYA 2QA4Q 2LQ8A 1JRIA 4KT0E 5CR2A 3DB4A 5KYXA 1WI7A 5KYUA 5FROA 3G6EA 3QJYA 1VIFA 4N0AA 3LWHA 2CP3A 2KR3A 1OU8A 2E70A 4J6YA 5LJ3d 3H0IA 3GP8A 2GCXA 2P84A 3CCQQ 3EAEA 3JAME 3R6NA 1PCXA 3I55A 2DIGA 3RKYA 2A7YA 1PD1A 2EPDA 3PVQA 3VYGA 1W6XA 5IHIA 2ESWA 2KBTA 1M90C 1K9AA 1MGQA 1X69A 1VA7A 5A0LA 1JU5C 3NMZC 1WDXA 1JO8A 4E7HA 1YWOA 4C8QF 1C0MA 3LH0A 5FRNA 4PJOE 2WSEE 1VQ8A 4LDXA 1M1KR 2LZ6B 5FU6C 3VS7A 5GAMd 1N8RC 1B34A 3CPWP 3G1JA 4F7UA 4JRIA 1VYVA 1ZUKA 1MHNA 3A8MB 1QKWA 3OYMA 1AZGB 3RBBB 4C92D 3A5ZB 4IUQA 4C0DB 2DXBA 3JB9D 1KQ1A 2DZCA 2I0NA 2QQAA 4AG2C 3G6ET 1VQMQ 3HL8A 2EAYA 3JCMh 3V8JA 1W2BP 1GBQA 4LUEA 1LJOA 2VXFA 1D0ZA 3QO3A 4M7AA 2EBPA 3PE0A 1AOJA 2JMCA 4JS4A 4F17A 2ZCFB 2AT1B 2BIVA 1HJDA 5CO7A 1CKAA 4PJOD 3QWYA 2KVQG 2KXCA 2FO0A 5IH2A 2KY9A 1TTHB 4BY6B 2EVRA 2DYBA 3VUZA 1E6GA 4QW2A 1R0BG 2XIDA 1TWBA 4J9GA 4ME7A 1IGUA 2L5QA 1ACMB 2KYBA 1K76A 1K73U 2KRNA 1WIEA 4FCYA 3P8DA 1X27A 2WSFE 1AWXA 2F2WA 3SDZA 2LNHB 2E10A 1ZA2B 2PVGB 5DLOA 4XQ3A 4C92B 4HCKA 3BFMA 1Y96B 1YI2A 1QVGS 4M75F 4QQGA 4C0FA 2RQWA 1QWFA 5GAMj 2D9TA 5CKDA 3UA6A 2DAQA 1OEBA 2JUFA 5EC7A 2J6OA 4PL6A 3LWIA 2HSEB 2LJ3A 5A0DA 4QVDA 3OYJA 3CCUA 3OYDA 2CP5A 1NYGA 2DLPA 1M2OA 5GANf 2KQWA 4M78A 2FHDA 3J81E 4IUVA 4LE9A 2HQHA 3QUIA 2OTLQ 1UE9A 3FC3A 1OULA 3RUXA 2KT8A 2OTJT 2NYSA 3CC7T 1WJRA 1VIEA 5HKCA 1LCKA 1WHJA 3M58A 4EPCA 2HKQB 2OAWA 1UGPB 1V76A 4PJOG 3L2WA 1U06A 4XU1A 4DEYA 1XNIA 3I55Q 5GAOp 4GLKA 5LJ5d 1IXDA 2SRCA 2D1XA 1PKTA 5A2QE 2LC4A 4ELZC 2RNAA 3E19A 4JPBW 3QSUA 3G6EQ 1NJIR 4D8KA 5GAOr 3G71T 4HKEA 5GJWB 2EGAA 2HL3A 4ELYC 4MZPA 2LX9A 1IREB 1SKUB 3JB9J 4FL6A 3UPUA 3TEEA 2A08A 4M4ZA 4J9BA 2KYMA 2CT3A 2QI2A 2ZGWA 1K0XA 1NEGA 3PMIA 4E7KA 2RF0A 3UF4A 2JS0A 3CCVT 1UGRB 2VGMA 2DTOA 1OI1A 4LN2A 4FIBA 2O2OA 1OU9A 5CKEA 5GAN8 3OYCA 5KYXB 5KYUB 4OMLA 2O9VA 4JJDA 1RAEB 4C8QA 5AT1B 5GAMf 2JOYA 1VQOA 3SFMA 2LJ1A 1Q86U 3OY9A 2E6ZA 1TUDA 3M5AA 4J9EA 2YSQA 1VQNT 2CZ0B 4PJMA 1HD3A 3OMGA 4P5NA 1FMVA 2H3EB 2YUQA 4NL2A 1WXTA 2KNBB 3DLMA 4C92F 4DQ2A 3JCMd 1I1JA 4KULA 4OMFB 1I81A 2RI5A 3OYKA 1I5OB 2COYA 1VQ5T 5AYFA 1JJ2A 3M0TA 1NZ9A 2E1HA 1JQQA 4BY6C 4HXJA 2RHUA 4E7ZA 1D0XA 2MPXC 1YNZA 2K5IA 3C0CA 4J9DA 4IIMA 1K0SA 3EG0A 1VQPQ 2X4XA 1XOVA 3OBYA 2MK5A 3PGGA 2M9UA 3C95A 3CMEA 3CCST 4J7FA 1VQ8T 4J9HA 2JTMA 4A4KA 3CC7A 2QAZA 3JCMg 2EGCA 3CMEQ 1VQ7Q 1RAHB 4NOYA 4KUDK 2XHCA 3H8ZA 2P0PA 2NLUA 4C8QE 5IXFA 3QHSA 1X43A 5LJ5h 1UTIA 3H0HA 3MP1A 4M77C 3CCUT 3FLGA 3I56A 1TG0A 5EG2A 1UECA 1P92A 1Q81R 3FEOA 4IUPA 4KGZB 1YN8A 5A0GA 4K11A 3OYHA 3TSZA 2HZYA 2OI3A 2P0QA 3C4SA 3EHRA 3GNGA 2LDMA 1Q81C 4JZ4A 3D7SB 4OGCA 2X9HA 4PKCC 2RHIA 2RN8A 4ZNXA 1PSEA 5KYNA 1B07A 3OYBA 5LJ5g 1AT1B 3GF5A 1K73R 4ZTJA 2RH2A 2DILA 4M77E 2DL5A 2F2VA 2MOXA 4M7AD 3E9FA 3VS0A 1NE8A 1X6BA 3X20B 2X4YA 3L2UA 2NUZA 3RNJA 1WQ7A 1GCPA 1OPLA 1UJ0A 1TSFA 3ASKA 2HSPA 1QW1A 2YLBA 3SWNB 3I35A 3PIOA 3CPFA 5FRMA 2HMAA 2K5FA 3A98A 2K79A 3VKIA 2QXFA 4C8QB 3RESA 1BI1A 3QJ6A 3NPFA 1PRLC 5GANj 3MEUA 2KMTA 3HTRA 7AT1B 5D6XA 1F1BB 1MNDA 1ZSZC 3DB3A 3GLXA 3PFSA 4C5EA 1XQHA 3CXCS 3NGPA 3CCLT 5HY6A 1PM3A 1QQJA 5GMKe 2A28A 5IHKA 1DJ7B 4EDUA 4EMKB 2KXDA 2A3LA 2FRWA 3UWNA 2RK1A 2XDDA 1WA7A 3E1SA 1OOTA 4PJOB 2VKNA 4BI8B 4FW2A 1I5LA 1M90U 4ZGDB 1YJ9Q 3LX7A 3OMCA 4RTWA 1FX7A 2YLCA 1OX8A 3EFOB 3DLLA 1M1KC 4KH0B 1RAFB 3M0SA 3HRUA 3P8HA 3OYLA 2LT1A 1AZEA 3ZFJA 4IUUA 4FU6A 1Q82U 1YJNQ 4A4FA 1WHHA 4E6RA 1Q7YU 2NUPA 1BK2A 4C92C 1YJ9T 3MO8A 1JXOA 2KROA 3OW2A 4C5HA 3ZEHA 3A8HB 2R57A 2Z0WA 1FMKA 2MAMA 2V1RA 2Y4YA 2E41A 1TUGB 3LLRA 1VQPT 5FLXE 2DIQA 3X25B 2DL4A 4C92G 1X75C 1I07A 5M9OA 1YJNT 2ATCB 5I2SA 4JZ3A 2DZ9A 3MP6A 1Y0MA 4PJOC 2GQVA 4E2FB 1VQ8Q 2GF7A 4F16A 5I22A 3JCMf 1EZZB 2OTJQ 2VASA 4PJOA 3VRZA 1BI3A 1ZSGA 3CCQT 4RTUA 9ATCB 4F7UF 4BDZA 2KEAA 4M77F 2GTOA 4N4GA 1SSHA 2WSCE 1Q82C 2RHXA 4R55A 5GANg 3EG2A 1VQOT 3GIBA 3KBGA 4PJJA 2K2VA 3EG9B 3RR6A 3HP9A 3LW5E 3I9QA 4J7IA 2Y4XA 5LL6S 1VQLQ 1VYUA 3H6ZA 2E12A 5KYWB 2QEXA 4M7AE 3ZL7C 3VYHB 1FMWA 3M53A 1KC8U 3CBPA 1OX9A 4JS5A 4DBRA 3C94A 2JTEA 3M0PA 1SEMA 2ROLA 2VUBA 1QP2A 1UFFA 2FPEA 1TS9A 4X34A 2RJEA 3QDRB 1M30A 2QQ9A 4JRKA 3M55A 4M78G 3OQ5A 2L3SA 2O88A 4IURA 4AG1C 3QKJA 3TCJA 2DM1A 4J8OA 3EGXA 4XAXB 4F14A 2KT1A 3JSCA 3MPUB 2KE9A 3M0RA 3QZ9B 1N8RU 2DL7A 4Y92A 2DRMA 2CDTA 2GFAA 3CBOA 3JCMQ 1SRMA 2JZ2A 3I5RA 5KYYA 5GMKm 3G4SQ 2JS2A 2ZPFB 5KE3A 4RCBA 1X6GA 5J3BA 1YBYA 2FRYA 4E47A 2O4XA 2DERA 1YITQ 4PJNA 3L2RA 3TREA 3QBYA 4QQDA 1X6OA 2AHJB 3REBB 5GANe 1G83A 3JCMe 3MEAA 4M75A 1WFWA 1T0HA 2V1QA 2R5AA 1VQ5Q 4HCCA 1GL5A 2ZPHB 3VRYA 2FG0A 2FYKA 5LJ3e 4X9DA 1IO6A 1ZBXA 2ZPIB 3G4ST 2ZPBB 2CGHA 3OSVA 4M7AC 3JRZA 3VUBA 1SF9A 1GBRA 2X3XD 2MCNA 4PLIA 1Y96A 3HFNA 3CMAT 2M02A 4OB0B 1RAIB 2DMOA 2KRSA 2GGRA 1K8AU 3OS2A 4M77D 2B8AA 3UT1A 2QA4T 5GAMg 1QWEA 2CZ6B 2QQBA 1BB9A 2HL5C 3S3NA 3WVDB 3PT9A 5CKHA 4M7AG 1KFZA 1KG1A 4RKUE 5GAMh 4BE2A 4A4HA 1M8VA 2D0NA 2VXEA 4AMCA 4HT8A 2CREA 2EJGA 1TXQA 1QVFS 2L3QA 1CSKA 2J7IA 1UEBA 1E7OA 4OMQA 3CPWA 1G3TA 4PFPA 1VQKA 3N5BB 2EQIA 4OGEA 3A8LB 4HVVA 4Z88A 3CEYA 2DL3A 4DOVA 3JB9I 5HK0A 4OMNA 2CH4W 1Q86C 3QZ5B 1HSQA 4N0AC 3UDCA 3I5SA 3MEWA 3OYYA 5LJ3g 1GXIE 2RQRA 3CC4Q 4Z8AA 1YHQT 3SD4A 1YWPA 2BZYA 1YJWT 2YWWA 4OF1A 1TOVA 4JRPA 1Y57A 2JTFA 3G71Q 1Z9ZA 2DA9A 4B6MA 2QASA 1UGVA 5FU6B 2EYYA 1IB8A 1XJWB 3CC4T 4C0GA 3CXCA 2RD1A 3CCLQ 3LGFA 1Y71A 2COZA 1RLQC 2EW3A 1M5Q1 2K3BA 1OZ3A 2KRMA 2VYTA 1W1FA 2K3YA 2AIRB 3WXMB 1SHGA 3JB9H 4OB3B 2CT4A 2EQUA 1LVKA 2V8IA 3RIRA 4PLLA 2QQSA 4M78F 3X28B 1YJWA 2GNCA 3CQTA 1M2VA 3GBQA 1KSWA 1PNJA 4XU3A 2DTHA 1KC8C 3CCMQ 2IG0A 4J6XA 3CMAA 3BY7A 8ATCB 3S6WA 3A8OB 4OB1B 1VQMA 2E64A 1YIJQ 4M7DF 3NTKA 5IN1A 4A63B 2EKOA 2HQEA 1NLOC 5J26A 2ROTA 2NUTA 2RK2A 5CCAA 1W70A 4KRTA 5I2MA 2G3RA 2E5QA 1U1TA 5GAMe 3KUFA 1ZX6A 4FYWB 2PVDB 1QVGA 2PNIA 4QT7A 2JN0A 2RM4A 2P4TA 3META 5GMKj 1JXMA 1G8XA 2AKLA 4ZGEB 2L0AA 2O31A 1Y07A 4RTTA 1ZHIA 4JJNK 4CRIA 1EIFA 2QK0A 1I0CA 2KSSA 1GCQC 5CQXA 1VQ9Q 1KQSA 3HHTB 4A54A 4R0KA 2LTOA 2YRVA 4C5GA 1MMNA 2ZPEB 1YP5A 4MZTA 4M78B 2NUPB 4PK4A 2F5TX 2PTKA 4O5VA 4XU2A 1NJIC 2OAUA 1KD1R 4M7DG 5CKFA 2X51A 4NS5A 2SEMA 3QPHA 4JJBA 1D1AA 1RI0A 3CMAQ 2KGTA 4JDSA 2EYXA 1I4K1 3UA7A 2EYWA 4A4EA 1E6HA 4FSSA 2QA4A 4YTLA 1ZBJA 2L2PA 4M75B 1MV0B 5GAN4 1ARKA 1ZUYA 3GNFB 4QVZA 2QDLA 1QVFP 5LJ5j 4IIOA 1NBEB 2OJ2A 2WACA 1OYXA 4RG2A 1K9MU 3VS2A 2M1HA 4MMLA 5LJ5e 4M77B 1R8OB 4C92E 3CMET 1YJNA 3VS4A 1H8KA 2KI7A 1V29B 2CZ7B 4KBMB 2KK4A 3ZBDA 2BZXA 2CP7A 5GAN3 2HD0A 1PC0A 1U1SA 2RQVA 1I8FA 2C0IA 2W0ZA 5C0MA 1VQ5A 3CCMA 4II1A 2PQWA 1YJ9A 2QG9B 5GAOq 1Q82R 2X4WA 1KD1C 1M2VB 4DBHA 3I56T 2DXTA 5KYYB 1N5ZA 3OYNA 2H8HA 3NHNA 3RERA 2RQUA 1VQNQ 4PJLA 4M7DD 1R0CB 1KQ2A 4AFZC 4EMHA 3EH1A 4V2SA 2MWOA 1R77A 2PU9B 4M7AF 1YIJT 1M9SA 4DEXA 1UGQB 3UATA 3CD6T 3OSSC 2K57A 2DF6A 2BTTA 2DL8A 2YUOA 2EGEA 2DYIA 3QYGB 3HKSA 4J9IA 2MI6A 1M4ZA 3EHQA 3M57A 3A1PA 1KHCA 4LDWA 2LCCA 3M54A 1UHFA 4OP0A 2XI9A 2BUDA 4F7UE 2L3RA 5CIUA 4AFQC 2K9GA 2VGNA 3CCMT 1BBZA 3VU3C 4A53A 2CH4A 4J5YA 5GJVB 4WTOB 2DD4A 2I2LA 3J7AF 5LJ5f 2DO3A 2HEQA 1IZ6A 2XICA 4B9XA 3HSBA 4HCBA 1IRXA 2EJ9A 4ANJA 1YCYA 5LJ3j 1N9RA 4BACA 3NFCA 3GOXA 4ZN1A 5KCHA 1WJQA 1TU0B 4RTZA 1AWOA 3RKWA 1WNLA 3HPWA 4RG8A 1VQNA 3V7SA 3G4SA 1H641 5L8RE 3QYHB 4MZMA 3CCRA 1VQ4A 4HA8A 5L23A 2E3IA 1D1BA 2ED0A 2NWMA 3FDRA 3M4YA 4C8QD 2FB7A 2XK0A 4HVWA 5IHNA 3OW2P 2ZPGB 2K5LA 4B9WA 3LYIA 5GAN5 3MKDA 1LPLA 2XD0A 2RO0A 3OYGA 1C1AA 1NPRA 3DKMA 3EGDA 4M75G 3KXTA 2IIMA 1OQKA 4LD9K 4EMKA 2YXYA 1WPYA 1NPPA 1VQPA 5J39A 3JV3A 3OS5A 1GFDA 1G3WA 3HRSA 5GMKi 2MMPA 1X01A 1YFNA 2LJ0A 2QEXQ 2CKKA 2ENMA 2O9SA 1BIAA 3O8VA 1HK9A 3QWXX 4M7DB 3VJPA 5GAN7 4BI3A 2DJQA 4XTVA 3OBWA 4JLIA 1VQ6A 1MUZA 2R58A 2O01E 1ZA1B 3SWNC 4MDWA 2LVMA 3EGXB 1NG2A 3JCMX 1EX4A 2DXCA 4LUDA 1Q7YR 3VS3A 4RUGA 3CCRQ 4N4HA 1PHTA 1ABOA 2F1LA 3CC2T 4L5GA 2PUKB 3AHUA 4HCZA 2H3JA 2EJFA 2F2XA 3NTHA 1VQMT 1PRMC 4KGVB 4BE1A 1V1CA 1HXDA 1UHCA 3JCMc 5DM7R 1T3LA 1H92A 4D6WA 2E4HA 2FPDA 1OV3A 3MJXA 4F7UG 5KE2A 4RTVA 3G71A 4XTZA 3EFSA 2DK3A 2DEUA 3C12A 2MYSA 3F70A 2LQNA 1PSFA 1CKBA 1WHGA 4M77A 3LH5A 3A8GB 2XDPA 2HAXA 1AHJB 2HKNA 3QG1A 1FYNA 2DRKA 2E5KA 4C0DC 4Z89A 4ZN3A 1W4SA 5I11A 2YUNA 1MMDA 3R6OA 2QQRA 2O4XB 3G7ZA 2EYQA 1WGSA 2JNGA
chains in the Genus database with same CATH topology
2M02A 2MPXC 2CP2A 2CP5A 2HKQB 2HL3A 2HL5C 2CP0A 1TOVA 2HKNA 1WHKA 2Z0WA 2COWA 2E3IA 2E4HA 1IXDA 3E2UA 2CP7A 1WHLA 2HQHA 3RDVA 4B6MA 2QK0A 2COYA 2CP6A 1TXQA 1WHMA 1WHGA 2CP3A 1WHHA 2E3HA 1WHJA 1LPLA 2COZA 3TQ7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M02 A;  2MPX C;  2CP2 A;  2CP5 A;  2HKQ B;  2HL3 A;  2HL5 C;  2CP0 A;  1TOV A;  2HKN A;  1WHK A;  2Z0W A;  2COW A;  2E3I A;  2E4H A;  1IXD A;  3E2U A;  2CP7 A;  1WHL A;  2HQH A;  3RDV A;  4B6M A;  2QK0 A;  2COY A;  2CP6 A;  1TXQ A;  1WHM A;  1WHG A;  2CP3 A;  1WHH A;  2E3H A;  1WHJ A;  1LPL A;  2COZ A;  3TQ7 P; 
#chains in the Genus database with same CATH topology
 1MMA A;  3BDU A;  4C8Q G;  1UJY A;  2JVV A;  4KUI A;  3CXC P;  4XTX A;  1PWT A;  2EYZ A;  1UDL A;  2JM8 A;  4KH1 B;  3E2U A;  2M16 A;  2D8J A;  1N6A A;  1KC8 R;  4FT2 A;  4M77 G;  2CSQ A;  1WXB A;  2JXB A;  5C6S A;  4EMG A;  2YDL A;  1ZUU A;  1G3Y A;  3SB2 A;  1M3B A;  3ME9 A;  2JW4 A;  1RAG B;  4M7D C;  1VOM A;  1WHK A;  1QLY A;  5DY9 A;  2E6N A;  2BE7 D;  3JCM P;  1PD0 A;  3WVE B;  4ESR A;  1QCO A;  2F5K A;  2DX1 A;  2DEQ A;  2RB6 A;  3HRT A;  4C8Q C;  1O75 A;  2RPN A;  1ZQ1 A;  1QCN A;  5GAN 2;  4X1V A;  2EWN A;  1VQ7 A;  3U23 A;  2A36 A;  1AEY A;  1BCO A;  4IKF A;  3VS6 A;  2ZZD A;  3EG3 A;  1YI2 T;  5FW9 A;  1EFN A;  2L3P A;  1WZO A;  5GAN d;  4WCI A;  1NM7 A;  1M3C A;  3VS5 A;  2DVJ A;  4M7A B;  4BB7 A;  3FRN A;  1NYF A;  2RA2 A;  2Y90 A;  1WQW A;  2J6K A;  1N27 A;  3ER0 A;  1SSF A;  1QKX A;  4JJC A;  2F69 A;  1YIT A;  3CCE T;  5IT9 E;  1VQK Q;  4F7U B;  4M7D E;  2LMJ A;  1G3S A;  1UB4 A;  3BE3 A;  2BKD N;  1D0Y A;  5FWB A;  2PZ1 A;  1SG5 A;  2K6D A;  2K4Y A;  1IHW A;  1WHM A;  2JM9 A;  3P8B B;  1KD1 U;  1WX6 A;  4C0Z A;  1YJW Q;  4M7D A;  4GBQ A;  3PMT A;  5GMK l;  1VQ6 Q;  3X26 B;  1VQ6 T;  3CCJ A;  5IAY A;  1N8R R;  2BZ8 A;  2RHZ A;  3VS1 A;  2YRD A;  6AT1 B;  3L42 A;  2LNV A;  2AZS A;  1YIT T;  1IHV A;  4J6W A;  3CCE Q;  2K2M A;  4E7J A;  2EIF A;  4BDY A;  4FYV B;  5IXB A;  1VQ9 A;  3E9G A;  4M78 C;  1S72 A;  2CP2 A;  1W2B S;  4RTX A;  3MP8 A;  1K9M R;  2DKG A;  4ZTF A;  3OYF A;  2DFU A;  1WHL A;  2YRC A;  3FJ5 A;  2A0F B;  1O9S A;  3RDV A;  4N4I A;  3IQL A;  1M3A A;  1SPK A;  1M8M A;  3CC4 A;  4HT9 A;  1OPK A;  4LDV A;  2QTX A;  2KAF A;  1RAB B;  3EH2 A;  1G5V A;  2D8H A;  1BI0 A;  2LQW A;  3JB9 G;  1M90 R;  3OYI A;  4MDX A;  2EQK A;  5GAO l;  2YHT A;  1VQ9 T;  2CS7 A;  4OVA A;  3T9N A;  4KGX B;  5FU7 B;  4J9F A;  1SRL A;  4LNP A;  5GMK h;  4HVU A;  2CZ1 B;  3JCM J;  1D3B B;  3L2Q A;  1RL2 A;  5I21 A;  1MNE A;  1QVG P;  2RI3 A;  3FB9 A;  2DET A;  2MIO A;  4O6J A;  4M75 E;  1S72 T;  4OMP A;  5CAI A;  2QTV A;  4DBF A;  1G2B A;  2FPF A;  3QII A;  4RCC A;  2E65 A;  4L59 A;  3JCM b;  3SWN A;  3CCL A;  2GBQ A;  4TVR A;  5CQY A;  5HK3 A;  1AWJ A;  1M1F A;  3OS1 A;  3CCJ T;  1U3O A;  1D09 B;  3REA B;  2XMF A;  1B3Q A;  1KQS P;  4FYX B;  1K8A C;  1VQ4 T;  2LCS A;  3I55 T;  2EFI A;  2J05 A;  4VUB A;  3OW2 S;  1T0J A;  3HFO A;  4M78 D;  2XG8 D;  3FJP A;  3BW1 A;  5FU7 C;  4M75 C;  1KQS S;  2ABL A;  2C06 A;  4RTY A;  1T3S A;  2PUO B;  4XU0 A;  3V7C A;  2CP0 A;  4OMO A;  2VV5 A;  1RAD B;  4FT4 A;  4EIK A;  4E7L A;  3O5Z A;  2FZK B;  2FEI A;  2BE9 B;  1VQK T;  3BDL A;  1YHQ Q;  1B7T A;  1QVF A;  3CBM A;  3OB9 A;  3CC2 Q;  1RAA B;  2E3H A;  3AT1 B;  4DBQ A;  5FWC A;  3Q1J A;  4Y28 E;  2VWF A;  3PNW C;  3QDF A;  4WF2 A;  3M9Q A;  1QVP A;  2XKO C;  1KHI A;  3CPW S;  2LCL A;  1RLP C;  3V7R A;  1TH7 A;  2C0T A;  1YHQ A;  4FW1 A;  2CSI A;  5D6Y A;  1GFC A;  1VQL T;  4J83 A;  4QQ6 A;  5D6W A;  4XK8 E;  2X4J A;  2CYZ B;  2L89 A;  4CC7 A;  2OX7 A;  3RMQ A;  2HBP A;  1FWZ A;  4Q5W A;  5HCK A;  3EGU A;  4IUT A;  4PFO A;  1D3B A;  1C6V X;  3GPL A;  2NUT B;  4GLM A;  1JB0 E;  1QCF A;  1JJ2 P;  4CI0 C;  3M0U A;  1M1G A;  2G6F X;  1B34 B;  2YT6 A;  2K3X A;  1N9S A;  1RAC B;  2RJD A;  3OYE A;  2FZG B;  2DD5 A;  4XTW A;  1Q7Y C;  2A37 A;  1RUW A;  4JLG A;  2FL7 A;  2DJZ A;  1FXX A;  1WJS A;  4BD3 A;  5CK9 A;  1PG5 B;  3LGL A;  3QXE B;  4M78 E;  1VQL A;  2DBK A;  3FIF A;  1UGS B;  1XTD A;  3MHX A;  1KIK A;  2R5M A;  4NL3 A;  2PVO B;  1WXU A;  3CC2 A;  3M4G A;  1NJI U;  2D0Q B;  2RMO A;  4XTY A;  5CKB A;  2QDY B;  2P0K A;  5GAN 6;  2IVW A;  4BUG A;  2EQM A;  4ATO A;  1LOJ A;  4C5I A;  3ULR B;  1K8A R;  2M0Y A;  3SEM A;  2B86 A;  1YIJ A;  2LRQ A;  3NTI A;  1OZ2 A;  2OTJ A;  2FVU A;  3M56 A;  3X24 B;  2LX7 A;  5KH6 A;  2X3W D;  3MEV A;  2JT4 A;  3S3O A;  3TU4 K;  2HCK A;  1BYM A;  1BI2 A;  3MCA B;  4OMM A;  3TVT A;  5KYW A;  1M1K U;  2L8D A;  2GTJ A;  1BCM A;  3L2V A;  1BKB A;  2ZAE A;  2V26 A;  5LJ3 h;  4C92 A;  4QVC A;  4AFS C;  1VYT A;  2JMA A;  1SHF A;  1ABQ A;  2M0O A;  3RMS A;  2LQK A;  3J80 E;  2RJC A;  2W10 A;  3S3M A;  4CC4 B;  2CUB A;  2MWP A;  3EFO A;  4F04 B;  4PNO A;  4FYY B;  1WLP B;  1Z9Q A;  2COW A;  3OA6 A;  3OS0 A;  1S72 Q;  2HNI A;  2C0O A;  2QYZ A;  1VQ4 Q;  1MMG A;  2RJF A;  2DBM A;  1AWW A;  1YCS B;  3CCE A;  3EG1 A;  4MMK A;  2RHY A;  3KFV A;  4M75 D;  1U8R A;  3VV0 A;  2KDS A;  1A0N B;  4A4G A;  2QGF B;  3JCM W;  4BI4 A;  1K1Z A;  3H0F A;  4LXC A;  4X9C A;  4E7S A;  1J3T A;  3H9N A;  5LJ3 f;  3CCJ Q;  5GAO m;  2GFU A;  1NEB A;  2YUP A;  2M51 A;  3OYA A;  3TQ7 P;  2D6F A;  2V8K A;  3CCR T;  2K7A A;  5GAN h;  2QEX T;  2DXU A;  3V8L A;  3EG9 A;  2P4R A;  2X35 A;  3PTA A;  3CCQ A;  4GY5 A;  5GAO n;  2VB6 A;  4JRQ A;  1X2Q A;  2DPP B;  1M27 C;  1ZSZ A;  2CP6 A;  3JB9 F;  3I56 Q;  1U5S A;  1QMC A;  4PFZ A;  3INZ A;  1Y7X A;  2AZV A;  4ORZ A;  3PIP A;  3RKX A;  2MF2 A;  1AVZ C;  4DA4 A;  3CD6 Q;  2OTL A;  4CC3 A;  3L2Z A;  1H3H A;  1IGQ A;  2HDA A;  1Q81 U;  1GCQ A;  3V8K A;  4R56 A;  2V8J A;  4L6V 5;  1RI9 A;  2DVE A;  3EFR A;  1TUC A;  3EGD B;  1ZLM A;  1JBM A;  2J6F A;  4XTU A;  4OB2 B;  2J06 A;  3CCV Q;  3CCS A;  2CUD A;  2IPO B;  2FZC B;  4BE0 A;  1PKS A;  1BU1 A;  2AK5 A;  1QP3 A;  5D7U A;  1HYO A;  4RMO A;  2VVK A;  2RQT A;  3H41 A;  2HQX A;  1Q95 G;  2QGG A;  2EQJ A;  3JCM V;  4J9C A;  3PVL A;  2HBW A;  5DLQ E;  4AT1 B;  4D8D A;  4PJO F;  2JJ9 A;  1X2K A;  3TSW A;  4Z02 A;  4E7I A;  2DNU A;  2RI2 A;  1JJ2 S;  1VUB A;  5CVI A;  2EKH A;  1UUE A;  5KCO A;  4QKU A;  1K9M C;  3M0Q A;  3URG A;  2DE0 X;  1H3Z A;  8AT1 B;  2XDB A;  1S1N A;  5ECA A;  1MV3 A;  1NLP C;  4CC2 A;  1AD5 A;  1KJW A;  3M59 A;  4JUV A;  1BIB A;  3CCU Q;  1VQO Q;  4EMK C;  1K4U S;  2GQI A;  3THK A;  1W2B A;  3L1A A;  4LD6 A;  4FM4 B;  3SHW A;  2ECZ A;  4AFU C;  2LP5 A;  1JEG A;  1KK7 A;  1WYX A;  2XU8 A;  4Y91 A;  4LDU A;  3CCS Q;  4DOW A;  3CCV A;  1VQ7 T;  1UG1 A;  4ZGJ B;  1D1C A;  4FSX A;  3CC7 Q;  1LNX A;  1YI2 Q;  1K73 C;  4UC4 A;  1GRI A;  1ZSZ B;  2AKK A;  2DTI A;  2VC8 A;  2LT4 A;  2OTL T;  3CD6 A;  2ED1 A;  1Q86 R;  4LDY A;  2QA4 Q;  2LQ8 A;  1JRI A;  4KT0 E;  5CR2 A;  3DB4 A;  5KYX A;  1WI7 A;  5KYU A;  5FRO A;  3G6E A;  3QJY A;  1VIF A;  4N0A A;  3LWH A;  2CP3 A;  2KR3 A;  1OU8 A;  2E70 A;  4J6Y A;  5LJ3 d;  3H0I A;  3GP8 A;  2GCX A;  2P84 A;  3CCQ Q;  3EAE A;  3JAM E;  3R6N A;  1PCX A;  3I55 A;  2DIG A;  3RKY A;  2A7Y A;  1PD1 A;  2EPD A;  3PVQ A;  3VYG A;  1W6X A;  5IHI A;  2ESW A;  2KBT A;  1M90 C;  1K9A A;  1MGQ A;  1X69 A;  1VA7 A;  5A0L A;  1JU5 C;  3NMZ C;  1WDX A;  1JO8 A;  4E7H A;  1YWO A;  4C8Q F;  1C0M A;  3LH0 A;  5FRN A;  4PJO E;  2WSE E;  1VQ8 A;  4LDX A;  1M1K R;  2LZ6 B;  5FU6 C;  3VS7 A;  5GAM d;  1N8R C;  1B34 A;  3CPW P;  3G1J A;  4F7U A;  4JRI A;  1VYV A;  1ZUK A;  1MHN A;  3A8M B;  1QKW A;  3OYM A;  1AZG B;  3RBB B;  4C92 D;  3A5Z B;  4IUQ A;  4C0D B;  2DXB A;  3JB9 D;  1KQ1 A;  2DZC A;  2I0N A;  2QQA A;  4AG2 C;  3G6E T;  1VQM Q;  3HL8 A;  2EAY A;  3JCM h;  3V8J A;  1W2B P;  1GBQ A;  4LUE A;  1LJO A;  2VXF A;  1D0Z A;  3QO3 A;  4M7A A;  2EBP A;  3PE0 A;  1AOJ A;  2JMC A;  4JS4 A;  4F17 A;  2ZCF B;  2AT1 B;  2BIV A;  1HJD A;  5CO7 A;  1CKA A;  4PJO D;  3QWY A;  2KVQ G;  2KXC A;  2FO0 A;  5IH2 A;  2KY9 A;  1TTH B;  4BY6 B;  2EVR A;  2DYB A;  3VUZ A;  1E6G A;  4QW2 A;  1R0B G;  2XID A;  1TWB A;  4J9G A;  4ME7 A;  1IGU A;  2L5Q A;  1ACM B;  2KYB A;  1K76 A;  1K73 U;  2KRN A;  1WIE A;  4FCY A;  3P8D A;  1X27 A;  2WSF E;  1AWX A;  2F2W A;  3SDZ A;  2LNH B;  2E10 A;  1ZA2 B;  2PVG B;  5DLO A;  4XQ3 A;  4C92 B;  4HCK A;  3BFM A;  1Y96 B;  1YI2 A;  1QVG S;  4M75 F;  4QQG A;  4C0F A;  2RQW A;  1QWF A;  5GAM j;  2D9T A;  5CKD A;  3UA6 A;  2DAQ A;  1OEB A;  2JUF A;  5EC7 A;  2J6O A;  4PL6 A;  3LWI A;  2HSE B;  2LJ3 A;  5A0D A;  4QVD A;  3OYJ A;  3CCU A;  3OYD A;  2CP5 A;  1NYG A;  2DLP A;  1M2O A;  5GAN f;  2KQW A;  4M78 A;  2FHD A;  3J81 E;  4IUV A;  4LE9 A;  2HQH A;  3QUI A;  2OTL Q;  1UE9 A;  3FC3 A;  1OUL A;  3RUX A;  2KT8 A;  2OTJ T;  2NYS A;  3CC7 T;  1WJR A;  1VIE A;  5HKC A;  1LCK A;  1WHJ A;  3M58 A;  4EPC A;  2HKQ B;  2OAW A;  1UGP B;  1V76 A;  4PJO G;  3L2W A;  1U06 A;  4XU1 A;  4DEY A;  1XNI A;  3I55 Q;  5GAO p;  4GLK A;  5LJ5 d;  1IXD A;  2SRC A;  2D1X A;  1PKT A;  5A2Q E;  2LC4 A;  4ELZ C;  2RNA A;  3E19 A;  4JPB W;  3QSU A;  3G6E Q;  1NJI R;  4D8K A;  5GAO r;  3G71 T;  4HKE A;  5GJW B;  2EGA A;  2HL3 A;  4ELY C;  4MZP A;  2LX9 A;  1IRE B;  1SKU B;  3JB9 J;  4FL6 A;  3UPU A;  3TEE A;  2A08 A;  4M4Z A;  4J9B A;  2KYM A;  2CT3 A;  2QI2 A;  2ZGW A;  1K0X A;  1NEG A;  3PMI A;  4E7K A;  2RF0 A;  3UF4 A;  2JS0 A;  3CCV T;  1UGR B;  2VGM A;  2DTO A;  1OI1 A;  4LN2 A;  4FIB A;  2O2O A;  1OU9 A;  5CKE A;  5GAN 8;  3OYC A;  5KYX B;  5KYU B;  4OML A;  2O9V A;  4JJD A;  1RAE B;  4C8Q A;  5AT1 B;  5GAM f;  2JOY A;  1VQO A;  3SFM A;  2LJ1 A;  1Q86 U;  3OY9 A;  2E6Z A;  1TUD A;  3M5A A;  4J9E A;  2YSQ A;  1VQN T;  2CZ0 B;  4PJM A;  1HD3 A;  3OMG A;  4P5N A;  1FMV A;  2H3E B;  2YUQ A;  4NL2 A;  1WXT A;  2KNB B;  3DLM A;  4C92 F;  4DQ2 A;  3JCM d;  1I1J A;  4KUL A;  4OMF B;  1I81 A;  2RI5 A;  3OYK A;  1I5O B;  2COY A;  1VQ5 T;  5AYF A;  1JJ2 A;  3M0T A;  1NZ9 A;  2E1H A;  1JQQ A;  4BY6 C;  4HXJ A;  2RHU A;  4E7Z A;  1D0X A;  2MPX C;  1YNZ A;  2K5I A;  3C0C A;  4J9D A;  4IIM A;  1K0S A;  3EG0 A;  1VQP Q;  2X4X A;  1XOV A;  3OBY A;  2MK5 A;  3PGG A;  2M9U A;  3C95 A;  3CME A;  3CCS T;  4J7F A;  1VQ8 T;  4J9H A;  2JTM A;  4A4K A;  3CC7 A;  2QAZ A;  3JCM g;  2EGC A;  3CME Q;  1VQ7 Q;  1RAH B;  4NOY A;  4KUD K;  2XHC A;  3H8Z A;  2P0P A;  2NLU A;  4C8Q E;  5IXF A;  3QHS A;  1X43 A;  5LJ5 h;  1UTI A;  3H0H A;  3MP1 A;  4M77 C;  3CCU T;  3FLG A;  3I56 A;  1TG0 A;  5EG2 A;  1UEC A;  1P92 A;  1Q81 R;  3FEO A;  4IUP A;  4KGZ B;  1YN8 A;  5A0G A;  4K11 A;  3OYH A;  3TSZ A;  2HZY A;  2OI3 A;  2P0Q A;  3C4S A;  3EHR A;  3GNG A;  2LDM A;  1Q81 C;  4JZ4 A;  3D7S B;  4OGC A;  2X9H A;  4PKC C;  2RHI A;  2RN8 A;  4ZNX A;  1PSE A;  5KYN A;  1B07 A;  3OYB A;  5LJ5 g;  1AT1 B;  3GF5 A;  1K73 R;  4ZTJ A;  2RH2 A;  2DIL A;  4M77 E;  2DL5 A;  2F2V A;  2MOX A;  4M7A D;  3E9F A;  3VS0 A;  1NE8 A;  1X6B A;  3X20 B;  2X4Y A;  3L2U A;  2NUZ A;  3RNJ A;  1WQ7 A;  1GCP A;  1OPL A;  1UJ0 A;  1TSF A;  3ASK A;  2HSP A;  1QW1 A;  2YLB A;  3SWN B;  3I35 A;  3PIO A;  3CPF A;  5FRM A;  2HMA A;  2K5F A;  3A98 A;  2K79 A;  3VKI A;  2QXF A;  4C8Q B;  3RES A;  1BI1 A;  3QJ6 A;  3NPF A;  1PRL C;  5GAN j;  3MEU A;  2KMT A;  3HTR A;  7AT1 B;  5D6X A;  1F1B B;  1MND A;  1ZSZ C;  3DB3 A;  3GLX A;  3PFS A;  4C5E A;  1XQH A;  3CXC S;  3NGP A;  3CCL T;  5HY6 A;  1PM3 A;  1QQJ A;  5GMK e;  2A28 A;  5IHK A;  1DJ7 B;  4EDU A;  4EMK B;  2KXD A;  2A3L A;  2FRW A;  3UWN A;  2RK1 A;  2XDD A;  1WA7 A;  3E1S A;  1OOT A;  4PJO B;  2VKN A;  4BI8 B;  4FW2 A;  1I5L A;  1M90 U;  4ZGD B;  1YJ9 Q;  3LX7 A;  3OMC A;  4RTW A;  1FX7 A;  2YLC A;  1OX8 A;  3EFO B;  3DLL A;  1M1K C;  4KH0 B;  1RAF B;  3M0S A;  3HRU A;  3P8H A;  3OYL A;  2LT1 A;  1AZE A;  3ZFJ A;  4IUU A;  4FU6 A;  1Q82 U;  1YJN Q;  4A4F A;  1WHH A;  4E6R A;  1Q7Y U;  2NUP A;  1BK2 A;  4C92 C;  1YJ9 T;  3MO8 A;  1JXO A;  2KRO A;  3OW2 A;  4C5H A;  3ZEH A;  3A8H B;  2R57 A;  2Z0W A;  1FMK A;  2MAM A;  2V1R A;  2Y4Y A;  2E41 A;  1TUG B;  3LLR A;  1VQP T;  5FLX E;  2DIQ A;  3X25 B;  2DL4 A;  4C92 G;  1X75 C;  1I07 A;  5M9O A;  1YJN T;  2ATC B;  5I2S A;  4JZ3 A;  2DZ9 A;  3MP6 A;  1Y0M A;  4PJO C;  2GQV A;  4E2F B;  1VQ8 Q;  2GF7 A;  4F16 A;  5I22 A;  3JCM f;  1EZZ B;  2OTJ Q;  2VAS A;  4PJO A;  3VRZ A;  1BI3 A;  1ZSG A;  3CCQ T;  4RTU A;  9ATC B;  4F7U F;  4BDZ A;  2KEA A;  4M77 F;  2GTO A;  4N4G A;  1SSH A;  2WSC E;  1Q82 C;  2RHX A;  4R55 A;  5GAN g;  3EG2 A;  1VQO T;  3GIB A;  3KBG A;  4PJJ A;  2K2V A;  3EG9 B;  3RR6 A;  3HP9 A;  3LW5 E;  3I9Q A;  4J7I A;  2Y4X A;  5LL6 S;  1VQL Q;  1VYU A;  3H6Z A;  2E12 A;  5KYW B;  2QEX A;  4M7A E;  3ZL7 C;  3VYH B;  1FMW A;  3M53 A;  1KC8 U;  3CBP A;  1OX9 A;  4JS5 A;  4DBR A;  3C94 A;  2JTE A;  3M0P A;  1SEM A;  2ROL A;  2VUB A;  1QP2 A;  1UFF A;  2FPE A;  1TS9 A;  4X34 A;  2RJE A;  3QDR B;  1M30 A;  2QQ9 A;  4JRK A;  3M55 A;  4M78 G;  3OQ5 A;  2L3S A;  2O88 A;  4IUR A;  4AG1 C;  3QKJ A;  3TCJ A;  2DM1 A;  4J8O A;  3EGX A;  4XAX B;  4F14 A;  2KT1 A;  3JSC A;  3MPU B;  2KE9 A;  3M0R A;  3QZ9 B;  1N8R U;  2DL7 A;  4Y92 A;  2DRM A;  2CDT A;  2GFA A;  3CBO A;  3JCM Q;  1SRM A;  2JZ2 A;  3I5R A;  5KYY A;  5GMK m;  3G4S Q;  2JS2 A;  2ZPF B;  5KE3 A;  4RCB A;  1X6G A;  5J3B A;  1YBY A;  2FRY A;  4E47 A;  2O4X A;  2DER A;  1YIT Q;  4PJN A;  3L2R A;  3TRE A;  3QBY A;  4QQD A;  1X6O A;  2AHJ B;  3REB B;  5GAN e;  1G83 A;  3JCM e;  3MEA A;  4M75 A;  1WFW A;  1T0H A;  2V1Q A;  2R5A A;  1VQ5 Q;  4HCC A;  1GL5 A;  2ZPH B;  3VRY A;  2FG0 A;  2FYK A;  5LJ3 e;  4X9D A;  1IO6 A;  1ZBX A;  2ZPI B;  3G4S T;  2ZPB B;  2CGH A;  3OSV A;  4M7A C;  3JRZ A;  3VUB A;  1SF9 A;  1GBR A;  2X3X D;  2MCN A;  4PLI A;  1Y96 A;  3HFN A;  3CMA T;  2M02 A;  4OB0 B;  1RAI B;  2DMO A;  2KRS A;  2GGR A;  1K8A U;  3OS2 A;  4M77 D;  2B8A A;  3UT1 A;  2QA4 T;  5GAM g;  1QWE A;  2CZ6 B;  2QQB A;  1BB9 A;  2HL5 C;  3S3N A;  3WVD B;  3PT9 A;  5CKH A;  4M7A G;  1KFZ A;  1KG1 A;  4RKU E;  5GAM h;  4BE2 A;  4A4H A;  1M8V A;  2D0N A;  2VXE A;  4AMC A;  4HT8 A;  2CRE A;  2EJG A;  1TXQ A;  1QVF S;  2L3Q A;  1CSK A;  2J7I A;  1UEB A;  1E7O A;  4OMQ A;  3CPW A;  1G3T A;  4PFP A;  1VQK A;  3N5B B;  2EQI A;  4OGE A;  3A8L B;  4HVV A;  4Z88 A;  3CEY A;  2DL3 A;  4DOV A;  3JB9 I;  5HK0 A;  4OMN A;  2CH4 W;  1Q86 C;  3QZ5 B;  1HSQ A;  4N0A C;  3UDC A;  3I5S A;  3MEW A;  3OYY A;  5LJ3 g;  1GXI E;  2RQR A;  3CC4 Q;  4Z8A A;  1YHQ T;  3SD4 A;  1YWP A;  2BZY A;  1YJW T;  2YWW A;  4OF1 A;  1TOV A;  4JRP A;  1Y57 A;  2JTF A;  3G71 Q;  1Z9Z A;  2DA9 A;  4B6M A;  2QAS A;  1UGV A;  5FU6 B;  2EYY A;  1IB8 A;  1XJW B;  3CC4 T;  4C0G A;  3CXC A;  2RD1 A;  3CCL Q;  3LGF A;  1Y71 A;  2COZ A;  1RLQ C;  2EW3 A;  1M5Q 1;  2K3B A;  1OZ3 A;  2KRM A;  2VYT A;  1W1F A;  2K3Y A;  2AIR B;  3WXM B;  1SHG A;  3JB9 H;  4OB3 B;  2CT4 A;  2EQU A;  1LVK A;  2V8I A;  3RIR A;  4PLL A;  2QQS A;  4M78 F;  3X28 B;  1YJW A;  2GNC A;  3CQT A;  1M2V A;  3GBQ A;  1KSW A;  1PNJ A;  4XU3 A;  2DTH A;  1KC8 C;  3CCM Q;  2IG0 A;  4J6X A;  3CMA A;  3BY7 A;  8ATC B;  3S6W A;  3A8O B;  4OB1 B;  1VQM A;  2E64 A;  1YIJ Q;  4M7D F;  3NTK A;  5IN1 A;  4A63 B;  2EKO A;  2HQE A;  1NLO C;  5J26 A;  2ROT A;  2NUT A;  2RK2 A;  5CCA A;  1W70 A;  4KRT A;  5I2M A;  2G3R A;  2E5Q A;  1U1T A;  5GAM e;  3KUF A;  1ZX6 A;  4FYW B;  2PVD B;  1QVG A;  2PNI A;  4QT7 A;  2JN0 A;  2RM4 A;  2P4T A;  3MET A;  5GMK j;  1JXM A;  1G8X A;  2AKL A;  4ZGE B;  2L0A A;  2O31 A;  1Y07 A;  4RTT A;  1ZHI A;  4JJN K;  4CRI A;  1EIF A;  2QK0 A;  1I0C A;  2KSS A;  1GCQ C;  5CQX A;  1VQ9 Q;  1KQS A;  3HHT B;  4A54 A;  4R0K A;  2LTO A;  2YRV A;  4C5G A;  1MMN A;  2ZPE B;  1YP5 A;  4MZT A;  4M78 B;  2NUP B;  4PK4 A;  2F5T X;  2PTK A;  4O5V A;  4XU2 A;  1NJI C;  2OAU A;  1KD1 R;  4M7D G;  5CKF A;  2X51 A;  4NS5 A;  2SEM A;  3QPH A;  4JJB A;  1D1A A;  1RI0 A;  3CMA Q;  2KGT A;  4JDS A;  2EYX A;  1I4K 1;  3UA7 A;  2EYW A;  4A4E A;  1E6H A;  4FSS A;  2QA4 A;  4YTL A;  1ZBJ A;  2L2P A;  4M75 B;  1MV0 B;  5GAN 4;  1ARK A;  1ZUY A;  3GNF B;  4QVZ A;  2QDL A;  1QVF P;  5LJ5 j;  4IIO A;  1NBE B;  2OJ2 A;  2WAC A;  1OYX A;  4RG2 A;  1K9M U;  3VS2 A;  2M1H A;  4MML A;  5LJ5 e;  4M77 B;  1R8O B;  4C92 E;  3CME T;  1YJN A;  3VS4 A;  1H8K A;  2KI7 A;  1V29 B;  2CZ7 B;  4KBM B;  2KK4 A;  3ZBD A;  2BZX A;  2CP7 A;  5GAN 3;  2HD0 A;  1PC0 A;  1U1S A;  2RQV A;  1I8F A;  2C0I A;  2W0Z A;  5C0M A;  1VQ5 A;  3CCM A;  4II1 A;  2PQW A;  1YJ9 A;  2QG9 B;  5GAO q;  1Q82 R;  2X4W A;  1KD1 C;  1M2V B;  4DBH A;  3I56 T;  2DXT A;  5KYY B;  1N5Z A;  3OYN A;  2H8H A;  3NHN A;  3RER A;  2RQU A;  1VQN Q;  4PJL A;  4M7D D;  1R0C B;  1KQ2 A;  4AFZ C;  4EMH A;  3EH1 A;  4V2S A;  2MWO A;  1R77 A;  2PU9 B;  4M7A F;  1YIJ T;  1M9S A;  4DEX A;  1UGQ B;  3UAT A;  3CD6 T;  3OSS C;  2K57 A;  2DF6 A;  2BTT A;  2DL8 A;  2YUO A;  2EGE A;  2DYI A;  3QYG B;  3HKS A;  4J9I A;  2MI6 A;  1M4Z A;  3EHQ A;  3M57 A;  3A1P A;  1KHC A;  4LDW A;  2LCC A;  3M54 A;  1UHF A;  4OP0 A;  2XI9 A;  2BUD A;  4F7U E;  2L3R A;  5CIU A;  4AFQ C;  2K9G A;  2VGN A;  3CCM T;  1BBZ A;  3VU3 C;  4A53 A;  2CH4 A;  4J5Y A;  5GJV B;  4WTO B;  2DD4 A;  2I2L A;  3J7A F;  5LJ5 f;  2DO3 A;  2HEQ A;  1IZ6 A;  2XIC A;  4B9X A;  3HSB A;  4HCB A;  1IRX A;  2EJ9 A;  4ANJ A;  1YCY A;  5LJ3 j;  1N9R A;  4BAC A;  3NFC A;  3GOX A;  4ZN1 A;  5KCH A;  1WJQ A;  1TU0 B;  4RTZ A;  1AWO A;  3RKW A;  1WNL A;  3HPW A;  4RG8 A;  1VQN A;  3V7S A;  3G4S A;  1H64 1;  5L8R E;  3QYH B;  4MZM A;  3CCR A;  1VQ4 A;  4HA8 A;  5L23 A;  2E3I A;  1D1B A;  2ED0 A;  2NWM A;  3FDR A;  3M4Y A;  4C8Q D;  2FB7 A;  2XK0 A;  4HVW A;  5IHN A;  3OW2 P;  2ZPG B;  2K5L A;  4B9W A;  3LYI A;  5GAN 5;  3MKD A;  1LPL A;  2XD0 A;  2RO0 A;  3OYG A;  1C1A A;  1NPR A;  3DKM A;  3EGD A;  4M75 G;  3KXT A;  2IIM A;  1OQK A;  4LD9 K;  4EMK A;  2YXY A;  1WPY A;  1NPP A;  1VQP A;  5J39 A;  3JV3 A;  3OS5 A;  1GFD A;  1G3W A;  3HRS A;  5GMK i;  2MMP A;  1X01 A;  1YFN A;  2LJ0 A;  2QEX Q;  2CKK A;  2ENM A;  2O9S A;  1BIA A;  3O8V A;  1HK9 A;  3QWX X;  4M7D B;  3VJP A;  5GAN 7;  4BI3 A;  2DJQ A;  4XTV A;  3OBW A;  4JLI A;  1VQ6 A;  1MUZ A;  2R58 A;  2O01 E;  1ZA1 B;  3SWN C;  4MDW A;  2LVM A;  3EGX B;  1NG2 A;  3JCM X;  1EX4 A;  2DXC A;  4LUD A;  1Q7Y R;  3VS3 A;  4RUG A;  3CCR Q;  4N4H A;  1PHT A;  1ABO A;  2F1L A;  3CC2 T;  4L5G A;  2PUK B;  3AHU A;  4HCZ A;  2H3J A;  2EJF A;  2F2X A;  3NTH A;  1VQM T;  1PRM C;  4KGV B;  4BE1 A;  1V1C A;  1HXD A;  1UHC A;  3JCM c;  5DM7 R;  1T3L A;  1H92 A;  4D6W A;  2E4H A;  2FPD A;  1OV3 A;  3MJX A;  4F7U G;  5KE2 A;  4RTV A;  3G71 A;  4XTZ A;  3EFS A;  2DK3 A;  2DEU A;  3C12 A;  2MYS A;  3F70 A;  2LQN A;  1PSF A;  1CKB A;  1WHG A;  4M77 A;  3LH5 A;  3A8G B;  2XDP A;  2HAX A;  1AHJ B;  2HKN A;  3QG1 A;  1FYN A;  2DRK A;  2E5K A;  4C0D C;  4Z89 A;  4ZN3 A;  1W4S A;  5I11 A;  2YUN A;  1MMD A;  3R6O A;  2QQR A;  2O4X B;  3G7Z A;  2EYQ A;  1WGS A;  2JNG A; 
#chains in the Genus database with same CATH homology
 2M02 A;  2MPX C;  2CP2 A;  2CP5 A;  2HKQ B;  2HL3 A;  2HL5 C;  2CP0 A;  1TOV A;  2HKN A;  1WHK A;  2Z0W A;  2COW A;  2E3I A;  2E4H A;  1IXD A;  3E2U A;  2CP7 A;  1WHL A;  2HQH A;  3RDV A;  4B6M A;  2QK0 A;  2COY A;  2CP6 A;  1TXQ A;  1WHM A;  1WHG A;  2CP3 A;  1WHH A;  2E3H A;  1WHJ A;  1LPL A;  2COZ A;  3TQ7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...