2CP2A

Solution structure of the 1st cap-gly domain in human clip-115/cyln2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
95
structure length
95
Chain Sequence
GSSGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CLIP-115
publication title Solution structure of the 1st CAP-Gly domain in human CLIP-115/CYLN2
rcsb
source organism Homo sapiens
total genus 9
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp2A00
3RDVA 2CP5A 1WHMA 2CP6A 2COZA 2MPXC 2HQHA 2CP7A 2COYA 3E2UA 1WHJA 2M02A 1IXDA 1LPLA 1TOVA 1TXQA 2HL3A 2E3IA 2Z0WA 1WHLA 2HKNA 2CP3A 2QK0A 1WHGA 2CP0A 1WHKA 1WHHA 2HL5C 4B6MA 3TQ7P 2HKQB 2CP2A 2E3HA 2COWA 2E4HA
chains in the Genus database with same CATH superfamily
5CKEA 2CZ1B 1SSFA 2NUZA 4XAXB 3N5BB 2COZA 1NE8A 4DBHA 3E1SA 4HCKA 3MEUA 2VKNA 5GMKl 4FYYB 4HKEA 3HL8A 4EMKC 2LDMA 1ZA2B 1VQKQ 1NM7A 1WXUA 4PNOA 3CMAA 1VQ8T 1TS9A 3RDVA 3QZ9B 4MDXA 3FJPA 1HYOA 4L5GA 1AWJA 4OMOA 3X25B 3CCEA 1M2VB 1WI7A 1U3OA 1BYMA 2QK0A 1SEMA 4B6MA 1N5ZA 3VS3A 3PGGA 1N6AA 4A4HA 2CS7A 3OSSC 4J9DA 2E4HA 2RJFA 3ASKA 3CQTA 1RI9A 5CAIA 3QXEB 4E7SA 1GFCA 2CP7A 1JB0E 3EGXB 2R5AA 4M7AF 1C6VX 4PJOA 3PE0A 3EG2A 3EG0A 1X6OA 2ED0A 4KGXB 2E3HA 3G1JA 4XU2A 5GAN4 1IRXA 3L42A 2QGFB 2Y90A 3TSZA 1VQ8Q 2MYSA 5FROA 4IUVA 2PNIA 3JV3A 2E3IA 3BDUA 1OPLA 2DYIA 4PFZA 2VC8A 4R55A 1Y07A 3OYYA 3OYLA 2WSCE 2BIVA 2E65A 4XQ3A 1AWOA 1S72T 1WJRA 2BZXA 1UE9A 2COWA 3MHXA 3CMEA 3EFOA 4LDUA 4M7AC 2W0ZA 2E5KA 2R57A 4BY6C 1LVKA 2HQHA 2P4RA 3MCAB 1UGSB 1OULA 3GNGA 2DO3A 2FPDA 1UTIA 1WXTA 1JXMA 4C8QA 1QWEA 3VS1A 2VB6A 2VWFA 3FEOA 1N8RU 3OYDA 4E2FB 2P4TA 4IKFA 2P84A 1K1ZA 3V8LA 3EH2A 3CPWS 4MDWA 3NMZC 3CCLT 2LQWA 4E7ZA 1M8VA 2DA9A 5I2MA 4M77E 1YN8A 2JM9A 1RI0A 3TQ7P 3I56T 2QGGA 1VQLT 2JMCA 3OYAA 2RQRA 4PK4A 3H6ZA 2OTJA 3FLGA 1OU9A 4JRQA 1C1AA 3CPFA 4DOVA 1KIKA 1S72Q 1YJNT 3HFOA 1B34A 1I1JA 3CCRA 1Q82R 1LPLA 2FZGB 5GAMj 2X35A 2YHTA 4C8QE 1KC8U 1VQ9A 3J80E 2H3EB 1BB9A 1AHJB 1YIJA 4MMKA 2F2XA 4RTVA 1PKSA 4TVRA 1ZUKA 2GNCA 4X9DA 5KE2A 4ZN1A 3OYGA 1KSWA 1VQ6T 3OMGA 4C5EA 3X26B 3NFCA 3REAB 2CGHA 5I21A 5IHKA 1NPPA 1C0MA 1AZGB 3JCMf 2E6NA 1T0HA 2HKQB 2I0NA 1LCKA 3CD6T 2L8DA 2CT4A 1W2BA 1I5LA 2DKGA 1W4SA 3G71A 3I56Q 1VQLQ 1K8AU 3M54A 8AT1B 2BE7D 3M0RA 5KYYA 2QYZA 2YUOA 2KR3A 4PL6A 1T3LA 4GLMA 2RQTA 3M58A 1V76A 1YJNQ 2EFIA 2MMPA 3NTHA 3I35A 1NJIC 2CREA 4LDYA 4DEYA 1YWOA 2DXCA 3VS0A 2LCSA 3FC3A 1VQ5T 5GJVB 1VQKA 4YTLA 5CO7A 2A36A 3CXCA 1UGRB 4FYWB 1FXXA 2FRYA 2EYYA 3M56A 4FW2A 4OB2B 2DIGA 3M57A 4RKUE 1VQ6Q 1PG5B 2QDLA 5LJ3g 3JCMV 1IREB 1RAHB 3J7AF 4LDXA 5EG2A 1WPYA 2AIRB 2HSPA 5CKHA 2EQJA 5IXBA 2BZ8A 2EYQA 3CD6Q 4BI3A 1EIFA 3JCMP 1I8FA 3OY9A 5GAN5 3JSCA 4AFQC 2E1HA 3QYGB 1B3QA 4M7AE 4IUQA 1K4US 1O75A 3SHWA 3PIOA 5GAOm 2ABLA 5J3BA 2EKOA 4RCBA 3NPFA 2AKLA 4FCYA 2RM4A 3L2ZA 3RR6A 1Q86R 3H8ZA 2KRMA 4BD3A 3UA6A 2QQ9A 1VQ5Q 1KD1C 2XU8A 3WVDB 2ECZA 2LJ1A 2PUOB 1W2BS 5CVIA 5GAOp 1OYXA 2F2VA 2PUKB 3FJ5A 1BK2A 2AZVA 4F14A 2YLCA 2ZPHB 4ZGDB 5CK9A 1JJ2A 2E12A 1M2VA 1NLPC 3EHQA 3LH0A 1K9MU 2ZCFB 5GMKm 2RHIA 2R5MA 5GAN2 4OMPA 3UPUA 2YRDA 5GJWB 1SRLA 1AD5A 3QUIA 2X3XD 4CI0C 1PCXA 5LJ3d 4OGEA 1TTHB 4M78D 1MMAA 3CCVA 3MKDA 3CXCS 1Y96B 1VQ7Q 5LJ5g 4RTUA 4JRKA 1UECA 5D6WA 1MGQA 2DBMA 2WACA 2DETA 1YCYA 1BBZA 3NTKA 1Q7YC 1OX8A 2MOXA 2YUQA 2JNGA 1N9RA 4F16A 1H3HA 5D6XA 1VQNA 1OI1A 2G6FX 2JZ2A 2O9SA 3CCQT 3CCMT 1NZ9A 4IUPA 3OYHA 1FX7A 1D0ZA 3S3NA 2L3PA 4N0AA 1S72A 4L59A 1RLQC 2XHCA 2QDYB 3MEWA 5AYFA 5KYUB 3KUFA 5J39A 2V8JA 1VIFA 2XKOC 2MF2A 4DOWA 2JN0A 1MHNA 3O8VA 4N4IA 3S3OA 2RD1A 2MAMA 1JJ2S 4F7UB 1KHCA 2XDBA 4AT1B 5LJ5d 2DZCA 4XTXA 5A0LA 1YJ9T 4B9WA 4OVAA 1WIEA 2MI6A 5FWCA 3CCLA 2HZYA 3A1PA 3MEVA 5CKDA 2LCLA 1K8AC 2DMOA 2VV5A 1BCOA 3I56A 3V7CA 3H41A 3GF5A 2JTFA 4F04B 3CCMQ 4A63B 3IQLA 3LWHA 3REBB 3I5RA 4PLLA 2DE0X 3VS2A 1YJNA 4QVCA 1ZUYA 3CBPA 2EGEA 4J7IA 1SKUB 2QXFA 2GGRA 1M1FA 3CEYA 1PNJA 1AT1B 5L8RE 4C92B 3JCMd 3MEAA 1XTDA 4XU3A 3JCMX 1NEBA 2DD4A 3EFRA 2DEQA 4JUVA 3GPLA 1M9SA 3VU3C 1FMWA 2O88A 3OYJA 2RJDA 3JB9G 1UJ0A 4M75B 1HK9A 2XMFA 3UA7A 3J81E 2RHYA 1I0CA 4PJNA 2RK2A 4ATOA 2B8AA 1ZSGA 1M1KU 5I11A 1YJ9Q 2VYTA 2A37A 2KNBB 3DB4A 2RJEA 1VQ4T 3RKWA 2LRQA 5IHIA 3CCUT 3CD6A 3C94A 2P0KA 4WTOB 4E6RA 2F1LA 2LVMA 3BE3A 4HXJA 4E7IA 2IG0A 5HK3A 2V1RA 4J9EA 4L6V5 2YWWA 1X75C 3ER0A 2DIQA 2EAYA 1ZBJA 2LCCA 5IHNA 1PD0A 2D8HA 2CH4A 1QKWA 1FMVA 5LJ3h 2B86A 5HY6A 5CIUA 3VS4A 2E10A 1XOVA 8ATCB 1WZOA 2A0FB 2E41A 3L2WA 1VQ5A 4PFPA 2M0YA 4F7UF 1UHFA 2O31A 1X43A 2WSFE 3TU4K 3JB9F 1QP3A 3JCMc 2XICA 2JTMA 5KYXB 1NJIR 5FLXE 2DPPB 3QG1A 2K2VA 1ZHIA 1OOTA 3AT1B 5GAN3 1Z9ZA 1UJYA 4A4FA 1QVPA 2KK4A 1PC0A 1FMKA 4ME7A 1WA7A 2I2LA 4E7LA 2AZSA 2DNUA 2QA4T 1VQ4Q 3CCUQ 1KQSP 2NWMA 1GBRA 3A5ZB 3BY7A 3VYGA 2EQIA 3I55T 2DM1A 2E5QA 2GTJA 1D3BB 3MP8A 3DLLA 4M77D 5GAMg 1TWBA 1NLOC 2LJ0A 3ZFJA 3G4ST 1Q81U 2WSEE 1DJ7B 2RH2A 2YDLA 4C92F 3LYIA 1M90C 1IHVA 2L3QA 1VQPT 4FM4B 3SDZA 2XK0A 3QJ6A 4M75F 3V7SA 1Z9QA 4C8QD 4KH1B 1IB8A 1R0BG 1G3WA 2A08A 3I9QA 2YUNA 5LJ5h 2FYKA 3CPWA 2JXBA 1VQOA 4PKCC 4A53A 3O5ZA 1KD1R 1MV0B 1W1FA 3E9GA 3M5AA 1QVGP 1M3CA 3KFVA 2E64A 3FDRA 2C0IA 4WCIA 3L2UA 1M4ZA 2LQNA 5GMKe 2IVWA 1JU5C 3X28B 4C92C 2QA4Q 5GAN7 1QW1A 2YRCA 2M51A 4RUGA 4DBRA 1MNEA 4DBFA 2XDPA 5FWBA 4IIMA 4LE9A 2DRKA 4J9IA 3I55Q 1IHWA 5GAN6 1M27C 3CCJA 4M75C 1X2QA 1AOJA 2OAWA 2V8KA 2RK1A 3JB9I 1PM3A 2HD0A 1BI3A 3G4SQ 2CUBA 2EYZA 3OSVA 1YI2T 4ESRA 2KAFA 2BUDA 2RJCA 5GAMd 1E6HA 2IPOB 4DBQA 1TG0A 1VQPQ 1IXDA 3JCMh 2HL3A 3A8HB 1M3AA 2JW4A 1H3ZA 3M53A 2K79A 3SB2A 4M77A 4AG1C 2M16A 4IUUA 1Q7YR 2DLPA 3QPHA 4JZ3A 2O4XB 2E70A 3OB9A 2KI7A 3CCQA 3CCMA 2KEAA 1W70A 3SEMA 4AFUC 4BE2A 1WDXA 2PVDB 4N4HA 4BUGA 4EDUA 1TSFA 1W6XA 4A4KA 2R58A 3MP6A 5KYUA 2KQWA 1VUBA 2K4YA 2K5LA 2K7AA 2O9VA 2X4WA 2QAZA 3EGUA 5GANe 4ZN3A 3CC2A 2RN8A 3FRNA 2LQ8A 4C0GA 1YI2Q 4N4GA 4Y91A 4M7DG 4M7AD 2D6FA 3M4GA 2NUTA 2OJ2A 3QWYA 2GQVA 4EMKA 1YJ9A 3NTIA 3NGPA 4OP0A 2J7IA 2DAQA 2KROA 3PFSA 2JM8A 4LD9K 2PQWA 3ULRB 1SPKA 1GRIA 4EMHA 1BKBA 5CKFA 4LXCA 2FZCB 1TH7A 1D0YA 1B7TA 1ZBXA 4X9CA 4II1A 2OTLT 3A98A 1U5SA 3JAME 1PHTA 4PLIA 3HHTB 4F7UE 4BDZA 3OMCA 2F5KA 4ORZA 1IGQA 2EJGA 4Q5WA 3KBGA 1WHLA 3EG9B 4D8DA 5KYWB 3QIIA 1B07A 1XJWB 1QLYA 4M7DF 1VYUA 9ATCB 1UB4A 1G3TA 3M0SA 3TVTA 3JRZA 1M3BA 4JJDA 2NUPA 2ROLA 3M0PA 1K73C 4RTZA 3M0TA 5D7UA 2GCXA 4DEXA 1Q81C 1G3SA 3LLRA 4HVWA 4A4GA 3CCUA 2XI9A 3BW1A 1Y0MA 4M78G 1Q95G 2QASA 3JCMb 3X20B 3HPWA 4FYXB 1EFNA 2QTVA 1ZSZB 4BACA 1R0CB 1Q82U 4XTYA 5DLQE 2AK5A 2LTOA 3A8LB 4A4EA 1CKAA 4M7AA 1MUZA 3E19A 4C92E 2FO0A 3UWNA 3ZEHA 2RHZA 2DFUA 1K9AA 2YT6A 4CC7A 2LNVA 2OTLQ 4JLIA 3RMSA 5LJ3e 1BI2A 1OPKA 4M75E 5DY9A 1G5VA 1I07A 5IH2A 1X2KA 2JJ9A 3QJYA 2DYBA 1WLPB 5KYXA 3OYNA 1Y71A 4GLKA 2DVEA 5GAMh 1K0SA 4FYVB 2BTTA 5GAOr 5C0MA 3OYIA 3UT1A 2L5QA 3E2UA 2KE9A 4IIOA 2MWOA 3CCST 1PWTA 1VQ7T 3VKIA 4JS5A 2EYXA 2K9GA 3SWNB 2QA4A 1NEGA 5I22A 5L23A 1PKTA 1BIBA 2LC4A 1H92A 2ZPFB 2RF0A 2EYWA 4HVVA 2EIFA 2ENMA 4FIBA 2O01E 4FU6A 4CC3A 4HT9A 4ZGJB 4XU1A 4KULA 1PRMC 3G4SA 2DZ9A 2Z0WA 1QWFA 2DL8A 4C0DB 1K76A 4KRTA 2X4XA 4JRIA 3ZBDA 1MNDA 2CZ0B 4XTUA 2L2PA 1VQPA 1VQ8A 4ZGEB 1CSKA 4QQGA 5IAYA 2ESWA 5KCHA 2YRVA 1J3TA 2RHXA 1GBQA 3CMAT 3BFMA 1ABOA 2FZKB 2DL7A 4JJNK 1M90R 2CZ7B 2DTIA 2JTEA 3LWIA 3V8JA 4NS5A 2J6FA 5LJ5e 2AT1B 2P0PA 4QQ6A 2QQBA 4QT7A 1WJQA 1P92A 3CCSQ 4KGZB 1F1BB 2ATCB 4HVUA 1JXOA 4KUIA 4KGVB 2CP5A 1OEBA 1KQSA 4ZNXA 1N8RC 3EGXA 2BE9B 1SG5A 1SSHA 3HRTA 1X01A 4MZPA 2PU9B 2X3WD 4A54A 4PJOB 2XDDA 4RG2A 3L2VA 1Q86U 3RNJA 2V26A 5DLOA 2X4YA 1ACMB 2CT3A 1YI2A 3VS6A 2CKKA 2K2MA 4EIKA 1SHFA 2HNIA 1OV3A 1OX9A 4J9GA 1RLPC 3A8GB 3CMAQ 1ZSZC 2JMAA 2ED1A 3L1AA 2QEXT 4ELZC 1WX6A 1KC8C 4HCBA 3JCMg 2H8HA 4O6JA 1RAAB 5GAOn 1QVGA 1FYNA 3OW2P 1BCMA 3V8KA 2EWNA 2RI5A 3EFOB 4XTWA 3NHNA 1O9SA 4CC2A 2GBQA 3QSUA 4IURA 3VUBA 1ARKA 5GAN8 2ZPGB 2NYSA 3HFNA 3VS7A 4BDYA 2DVJA 2FB7A 1KK7A 1GFDA 1I5OB 4XU0A 3C12A 4PJOG 4F17A 2MIOA 2DF6A 4M7DE 3MJXA 4XK8E 1RACB 3TREA 5KH6A 1UFFA 1OQKA 4FW1A 2YLBA 2K57A 1VA7A 3SWNC 1VQLA 1XNIA 2KYMA 3LX7A 4BE1A 1M2OA 1KQSS 3HRSA 4LDWA 5M9OA 2CZ6B 2HEQA 2QG9B 1QQJA 2KMTA 2K3YA 2MWPA 2QEXQ 1TUCA 2LX9A 4M77G 4PJJA 1LJOA 4C0DC 2GTOA 5D6YA 2LJ3A 5CKBA 2FRWA 3Q1JA 4J6YA 2H3JA 2HKNA 4QVDA 4PJLA 3CMEQ 1UGPB 1LOJA 4BE0A 1QVFP 2SEMA 2HAXA 2QQRA 3PVQA 4JDSA 1YIJT 4GBQA 1N9SA 2LP5A 4PJOF 3EGDB 4BI4A 3VJPA 4C8QG 1VQ6A 3CXCP 3EG9A 1JBMA 1UEBA 2XIDA 5IXFA 1QVGS 1V1CA 1TUDA 4EMGA 3RESA 3D7SB 1G2BA 1WGSA 1E7OA 3HP9A 1XQHA 3OBYA 4C5IA 1ZLMA 4BI8B 5HKCA 1WHMA 2DILA 2DX1A 2FG0A 2DL5A 2KT1A 2DXBA 2CUDA 4RTWA 5CQYA 2M02A 4RMOA 1SHGA 1K73R 1ZSZA 1Q81R 5KYYB 4RCCA 4FL6A 2CDTA 5EC7A 3QO3A 1IGUA 1NBEB 1X69A 4NOYA 1HSQA 2RQWA 2K3BA 3H0IA 1AZEA 4Z02A 4Z8AA 1BIAA 2LZ6B 1JRIA 5J26A 4E7HA 2VVKA 3URGA 2YXYA 1YIJQ 1TOVA 1WXBA 2KXCA 4RTXA 4PJMA 1K9MC 1R8OB 3RBBB 5GANf 1Y57A 5LL6S 1KG1A 4JPBW 1S1NA 1BU1A 3CC7T 5FRMA 1QCOA 2EQUA 5GAMe 1GCPA 1U1TA 4J6WA 3CCSA 2ZPBB 1JQQA 3U23A 1YITT 4LD6A 2EGAA 5KCOA 3OS5A 4JZ4A 1U8RA 1VQ7A 4D6WA 3QYHB 1KQ2A 1K0XA 2KSSA 1UDLA 1SRMA 3G71Q 2F69A 4ELYC 2HDAA 3AHUA 2DJQA 2CP2A 1Q86C 4C0ZA 4KUDK 1X27A 1G8XA 2JS0A 2GQIA 4M7AG 1M30A 2KRNA 1I81A 2EBPA 5FW9A 2X9HA 2L0AA 2OAUA 4LDVA 4MMLA 4ZTFA 1BI0A 1NJIU 3OYCA 3INZA 4MZMA 2JVVA 1UHCA 1ZA1B 2DTHA 4RG8A 2EJ9A 1YWPA 1ABQA 3JB9D 5CQXA 3JB9J 3CC7Q 4J7FA 3PVLA 3F70A 1OZ3A 4JRPA 3BDLA 1WQWA 3OYBA 1G83A 5FU7B 2RB6A 1YITQ 2J6OA 4AFSC 1ZX6A 3OQ5A 1X6BA 2EGCA 1Y96A 2DTOA 2C0OA 2D8JA 2KY9A 2PVGB 1RAGB 2RPNA 1PD1A 3CCVT 2KYBA 2ZAEA 1IZ6A 3OS0A 2KVQG 2QI2A 1QCNA 3RMQA 5CR2A 1N8RR 4M7DB 2CP0A 4J6XA 3GP8A 2HL5C 1LNXA 1G3YA 3EFSA 5LJ3f 4HA8A 2VUBA 2RQUA 4C92D 1ZQ1A 4E47A 1YBYA 2V1QA 1VQNT 4XTZA 1KD1U 3THKA 2QTXA 3DKMA 4M75D 2QEXA 4DA4A 1QP2A 3RERA 3OBWA 1GL5A 3WXMB 5GAOq 4RTYA 4JLGA 1KC8R 2FPEA 3QKJA 2DK3A 1I4K1 2EVRA 3LW5E 1QCFA 4PJOE 1PRLC 1PSEA 4PFOA 3PTAA 2KT8A 3CCVQ 4F7UA 2CP3A 1M1KC 3R6OA 3GOXA 1WHHA 2DXTA 4D8KA 3VRZA 3S6WA 1AWWA 2L89A 1H8KA 1MV3A 1D1BA 2A3LA 4C0FA 3CC4T 5ECAA 4O5VA 2F5TX 1Q7YU 4M78B 1VQMT 2GFAA 5GANg 1VQNQ 2OI3A 2X4JA 1PSFA 1K8AR 2KBTA 3E9FA 2CSIA 5LJ5f 2Y4XA 2PVOB 1QMCA 2P0QA 4KBMB 3OW2A 2HQEA 4J9BA 3RKXA 3H0FA 5CCAA 2EJFA 1RL2A 2QQSA 2O2OA 1TU0B 2AHJB 1T3SA 4C92A 2KDSA 4OMLA 2K5FA 2RMOA 4R56A 3VRYA 2ZZDA 3CBMA 3P8HA 2JT4A 3VV0A 3EGDA 4FSSA 4M75A 1T0JA 2K3XA 4QW2A 2YSQA 6AT1B 5A0DA 2DXUA 1ZUUA 4OB3B 2CP6A 4X34A 3VS5A 3P8BB 2DD5A 5GMKi 3PIPA 4JJBA 1RUWA 5FU7C 1VQ4A 3ME9A 2J05A 3G6ET 1WNLA 2DBKA 3CC4Q 1OZ2A 3M0QA 3UATA 2FEIA 1WFWA 1M1GA 3CCLQ 1QKXA 4Y92A 3UF4A 2BKDN 2JOYA 3C0CA 1VQMQ 2LT4A 4KH0B 3M9QA 4NL3A 2MCNA 5HCKA 1D09B 4OB1B 3GBQA 2G3RA 4OMQA 1WHJA 3L2QA 2VXFA 4M7DC 2FVUA 3EG1A 1TXQA 2LNHB 3FIFA 3OS1A 5GANd 3OS2A 2GF7A 5KE3A 1VIEA 1WHKA 2A7YA 3QWXX 5GMKj 3PT9A 1MMDA 3A8MB 2GFUA 4JS4A 1QVFA 3MPUB 4EPCA 1HJDA 3QDRB 2JS2A 2RO0A 4M4ZA 4B9XA 1RAIB 4AFZC 1YFNA 4Z88A 1H641 1KFZA 3P8DA 2M9UA 4MZTA 2LMJA 4QVZA 3VYHB 3LGLA 4N0AC 3CC7A 3CPWP 4M78F 3OW2S 1X6GA 2EKHA 3GIBA 4HT8A 3EAEA 4M7DD 3L2RA 1K9MR 3G6EQ 2AKKA 2RI2A 3OA6A 1YITA 3M59A 1YJWT 4J9HA 3I55A 1YHQT 1D3BA 2CSQA 2CYZB 2F2WA 1E6GA 2V8IA 2LX7A 3MO8A 1TUGB 3X24B 4LNPA 2M0OA 1AEYA 5IT9E 2W10A 1NYGA 1EZZB 5FU6B 4V2SA 4J83A 4LUDA 4C5GA 1WJSA 7AT1B 3CBOA 2MPXC 1D1CA 4ZTJA 4M78C 2RNAA 2BZYA 4FT4A 3UDCA 2KGTA 3HKSA 4J9CA 4P5NA 1M8MA 3CCET 2DJZA 3EHRA 4QKUA 5GANj 4KT0E 1SF9A 5I2SA 2RQVA 1N27A 4E7KA 2HMAA 1VQOT 4CC4B 2OX7A 2PZ1A 3OYKA 2COYA 5GMKh 1QVFS 1CKBA 1YJWQ 1YHQQ 2RA2A 3H9NA 3TEEA 1A0NB 2NLUA 1EX4A 3I5SA 5IN1A 3CCJT 2VASA 1IO6A 1D0XA 4NL2A 3R6NA 3PNWC 2J06A 4M7DA 4DQ2A 3JCMe 3PMTA 2DEUA 1NYFA 2HQXA 2FHDA 2D1XA 2DRMA 3KXTA 2E6ZA 2X51A 4UC4A 1M90U 2O4XA 1AVZC 1VYVA 1YNZA 1RAEB 2HSEB 3CCEQ 2DL3A 4M77B 2Y4YA 2K6DA 2ZPEB 4J8OA 1MMGA 1GCQC 4X1VA 3CMET 2HBWA 2JUFA 5GAMf 1VQOQ 3G7ZA 3M55A 3V7RA 2FPFA 3RKYA 1YCSB 3MP1A 2IIMA 1VYTA 2KXDA 2DERA 3META 1VOMA 2C06A 1RABB 5KYNA 4Z89A 5FRNA 3JCMQ 4C8QB 2VXEA 3RIRA 3SD4A 3RUXA 1NG2A 3SFMA 2CH4W 3PMIA 4AMCA 2DL4A 5GANh 3GNFB 2FL7A 3CCJQ 2EPDA 3HTRA 2RHUA 2M1HA 1YP5A 1RAFB 3QHSA 3CC2T 5A2QE 4FSXA 2XG8D 2J6KA 2XD0A 3OYEA 1UG1A 1M5Q1 2VGMA 2VGNA 3LGFA 3TSWA 3QZ5B 5LJ3j 3GLXA 1M1KR 2NUTB 4EMKB 2D0QB 3CC4A 1W2BP 1Q82C 1NPRA 5HK0A 3C95A 4IUTA 4M78A 2OTJT 1VQMA 3OYMA 3JB9H 1V29B 5DM7R 2RI3A 4CRIA 5FU6C 1HXDA 2MK5A 3QBYA 3OYFA 1B34B 3M4YA 3CCRT 3HRUA 1JEGA 3CCQQ 4OMNA 4BB7A 5A0GA 3ZL7C 4VUBA 1VQ9T 2LT1A 2OTLA 1WQ7A 2KRSA 3S3MA 3A8OB 1UUEA 4HCCA 4K11A 1FWZA 1MMNA 1UGVA 3QDFA 2HBPA 2K5IA 1JO8A 2YUPA 4AG2C 5KYWA 3VUZA 3FB9A 4F7UG 1WYXA 4R0KA 3CC2Q 4LUEA 4M78E 1GXIE 1D1AA 1RADB 2L3RA 4ANJA 2NUPB 4RTTA 2ZPIB 2D9TA 4M77F 3G6EA 3G71T 1AWXA 3C4SA 1R77A 2EQKA 2C0TA 1UGQB 1Y7XA 4PJOC 4OB0B 2OTJQ 4OMFB 3HSBA 4OF1A 2EW3A 3CCRQ 3EH1A 5LJ5j 2PTKA 4J9FA 3T9NA 4Y28E 3LH5A 1GCQA 1U06A 1U1SA 3JCMW 4XTVA 3H0HA 1VQ9Q 4C8QF 4M7AB 1KJWA 4BY6B 4GY5A 1BI1A 1VQKT 4J5YA 2QQAA 4C5HA 1OU8A 1WHGA 4LN2A 4E7JA 1KQ1A 4C92G 1KHIA 3EG3A 2L3SA 4M77C 4OMMA 3WVEB 3JCMJ 1JJ2P 2SRCA 4FT2A 5GAOl 4M75G 4PJOD 2A28A 4OGCA 2EQMA 5AT1B 4QQDA 3M0UA 2LQKA 1HD3A 3SWNA 2D0NA 4WF2A 2ROTA 3TCJA 5C6SA 4C8QC 4JJCA 2HCKA 1YJWA 1YHQA 2ZGWA 1K73U 4HCZA 3DLMA 3DB3A
chains in the Genus database with same CATH topology
3RDVA 2CP5A 1WHMA 2CP6A 2COZA 2MPXC 2HQHA 2CP7A 2COYA 3E2UA 1WHJA 2M02A 1IXDA 1LPLA 1TOVA 1TXQA 2HL3A 2E3IA 2Z0WA 1WHLA 2HKNA 2CP3A 2QK0A 1WHGA 2CP0A 1WHKA 1WHHA 2HL5C 4B6MA 3TQ7P 2HKQB 2CP2A 2E3HA 2COWA 2E4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RDV A;  2CP5 A;  1WHM A;  2CP6 A;  2COZ A;  2MPX C;  2HQH A;  2CP7 A;  2COY A;  3E2U A;  1WHJ A;  2M02 A;  1IXD A;  1LPL A;  1TOV A;  1TXQ A;  2HL3 A;  2E3I A;  2Z0W A;  1WHL A;  2HKN A;  2CP3 A;  2QK0 A;  1WHG A;  2CP0 A;  1WHK A;  1WHH A;  2HL5 C;  4B6M A;  3TQ7 P;  2HKQ B;  2CP2 A;  2E3H A;  2COW A;  2E4H A; 
#chains in the Genus database with same CATH topology
 5CKE A;  2CZ1 B;  1SSF A;  2NUZ A;  4XAX B;  3N5B B;  2COZ A;  1NE8 A;  4DBH A;  3E1S A;  4HCK A;  3MEU A;  2VKN A;  5GMK l;  4FYY B;  4HKE A;  3HL8 A;  4EMK C;  2LDM A;  1ZA2 B;  1VQK Q;  1NM7 A;  1WXU A;  4PNO A;  3CMA A;  1VQ8 T;  1TS9 A;  3RDV A;  3QZ9 B;  4MDX A;  3FJP A;  1HYO A;  4L5G A;  1AWJ A;  4OMO A;  3X25 B;  3CCE A;  1M2V B;  1WI7 A;  1U3O A;  1BYM A;  2QK0 A;  1SEM A;  4B6M A;  1N5Z A;  3VS3 A;  3PGG A;  1N6A A;  4A4H A;  2CS7 A;  3OSS C;  4J9D A;  2E4H A;  2RJF A;  3ASK A;  3CQT A;  1RI9 A;  5CAI A;  3QXE B;  4E7S A;  1GFC A;  2CP7 A;  1JB0 E;  3EGX B;  2R5A A;  4M7A F;  1C6V X;  4PJO A;  3PE0 A;  3EG2 A;  3EG0 A;  1X6O A;  2ED0 A;  4KGX B;  2E3H A;  3G1J A;  4XU2 A;  5GAN 4;  1IRX A;  3L42 A;  2QGF B;  2Y90 A;  3TSZ A;  1VQ8 Q;  2MYS A;  5FRO A;  4IUV A;  2PNI A;  3JV3 A;  2E3I A;  3BDU A;  1OPL A;  2DYI A;  4PFZ A;  2VC8 A;  4R55 A;  1Y07 A;  3OYY A;  3OYL A;  2WSC E;  2BIV A;  2E65 A;  4XQ3 A;  1AWO A;  1S72 T;  1WJR A;  2BZX A;  1UE9 A;  2COW A;  3MHX A;  3CME A;  3EFO A;  4LDU A;  4M7A C;  2W0Z A;  2E5K A;  2R57 A;  4BY6 C;  1LVK A;  2HQH A;  2P4R A;  3MCA B;  1UGS B;  1OUL A;  3GNG A;  2DO3 A;  2FPD A;  1UTI A;  1WXT A;  1JXM A;  4C8Q A;  1QWE A;  3VS1 A;  2VB6 A;  2VWF A;  3FEO A;  1N8R U;  3OYD A;  4E2F B;  2P4T A;  4IKF A;  2P84 A;  1K1Z A;  3V8L A;  3EH2 A;  3CPW S;  4MDW A;  3NMZ C;  3CCL T;  2LQW A;  4E7Z A;  1M8V A;  2DA9 A;  5I2M A;  4M77 E;  1YN8 A;  2JM9 A;  1RI0 A;  3TQ7 P;  3I56 T;  2QGG A;  1VQL T;  2JMC A;  3OYA A;  2RQR A;  4PK4 A;  3H6Z A;  2OTJ A;  3FLG A;  1OU9 A;  4JRQ A;  1C1A A;  3CPF A;  4DOV A;  1KIK A;  1S72 Q;  1YJN T;  3HFO A;  1B34 A;  1I1J A;  3CCR A;  1Q82 R;  1LPL A;  2FZG B;  5GAM j;  2X35 A;  2YHT A;  4C8Q E;  1KC8 U;  1VQ9 A;  3J80 E;  2H3E B;  1BB9 A;  1AHJ B;  1YIJ A;  4MMK A;  2F2X A;  4RTV A;  1PKS A;  4TVR A;  1ZUK A;  2GNC A;  4X9D A;  5KE2 A;  4ZN1 A;  3OYG A;  1KSW A;  1VQ6 T;  3OMG A;  4C5E A;  3X26 B;  3NFC A;  3REA B;  2CGH A;  5I21 A;  5IHK A;  1NPP A;  1C0M A;  1AZG B;  3JCM f;  2E6N A;  1T0H A;  2HKQ B;  2I0N A;  1LCK A;  3CD6 T;  2L8D A;  2CT4 A;  1W2B A;  1I5L A;  2DKG A;  1W4S A;  3G71 A;  3I56 Q;  1VQL Q;  1K8A U;  3M54 A;  8AT1 B;  2BE7 D;  3M0R A;  5KYY A;  2QYZ A;  2YUO A;  2KR3 A;  4PL6 A;  1T3L A;  4GLM A;  2RQT A;  3M58 A;  1V76 A;  1YJN Q;  2EFI A;  2MMP A;  3NTH A;  3I35 A;  1NJI C;  2CRE A;  4LDY A;  4DEY A;  1YWO A;  2DXC A;  3VS0 A;  2LCS A;  3FC3 A;  1VQ5 T;  5GJV B;  1VQK A;  4YTL A;  5CO7 A;  2A36 A;  3CXC A;  1UGR B;  4FYW B;  1FXX A;  2FRY A;  2EYY A;  3M56 A;  4FW2 A;  4OB2 B;  2DIG A;  3M57 A;  4RKU E;  1VQ6 Q;  1PG5 B;  2QDL A;  5LJ3 g;  3JCM V;  1IRE B;  1RAH B;  3J7A F;  4LDX A;  5EG2 A;  1WPY A;  2AIR B;  2HSP A;  5CKH A;  2EQJ A;  5IXB A;  2BZ8 A;  2EYQ A;  3CD6 Q;  4BI3 A;  1EIF A;  3JCM P;  1I8F A;  3OY9 A;  5GAN 5;  3JSC A;  4AFQ C;  2E1H A;  3QYG B;  1B3Q A;  4M7A E;  4IUQ A;  1K4U S;  1O75 A;  3SHW A;  3PIO A;  5GAO m;  2ABL A;  5J3B A;  2EKO A;  4RCB A;  3NPF A;  2AKL A;  4FCY A;  2RM4 A;  3L2Z A;  3RR6 A;  1Q86 R;  3H8Z A;  2KRM A;  4BD3 A;  3UA6 A;  2QQ9 A;  1VQ5 Q;  1KD1 C;  2XU8 A;  3WVD B;  2ECZ A;  2LJ1 A;  2PUO B;  1W2B S;  5CVI A;  5GAO p;  1OYX A;  2F2V A;  2PUK B;  3FJ5 A;  1BK2 A;  2AZV A;  4F14 A;  2YLC A;  2ZPH B;  4ZGD B;  5CK9 A;  1JJ2 A;  2E12 A;  1M2V A;  1NLP C;  3EHQ A;  3LH0 A;  1K9M U;  2ZCF B;  5GMK m;  2RHI A;  2R5M A;  5GAN 2;  4OMP A;  3UPU A;  2YRD A;  5GJW B;  1SRL A;  1AD5 A;  3QUI A;  2X3X D;  4CI0 C;  1PCX A;  5LJ3 d;  4OGE A;  1TTH B;  4M78 D;  1MMA A;  3CCV A;  3MKD A;  3CXC S;  1Y96 B;  1VQ7 Q;  5LJ5 g;  4RTU A;  4JRK A;  1UEC A;  5D6W A;  1MGQ A;  2DBM A;  2WAC A;  2DET A;  1YCY A;  1BBZ A;  3NTK A;  1Q7Y C;  1OX8 A;  2MOX A;  2YUQ A;  2JNG A;  1N9R A;  4F16 A;  1H3H A;  5D6X A;  1VQN A;  1OI1 A;  2G6F X;  2JZ2 A;  2O9S A;  3CCQ T;  3CCM T;  1NZ9 A;  4IUP A;  3OYH A;  1FX7 A;  1D0Z A;  3S3N A;  2L3P A;  4N0A A;  1S72 A;  4L59 A;  1RLQ C;  2XHC A;  2QDY B;  3MEW A;  5AYF A;  5KYU B;  3KUF A;  5J39 A;  2V8J A;  1VIF A;  2XKO C;  2MF2 A;  4DOW A;  2JN0 A;  1MHN A;  3O8V A;  4N4I A;  3S3O A;  2RD1 A;  2MAM A;  1JJ2 S;  4F7U B;  1KHC A;  2XDB A;  4AT1 B;  5LJ5 d;  2DZC A;  4XTX A;  5A0L A;  1YJ9 T;  4B9W A;  4OVA A;  1WIE A;  2MI6 A;  5FWC A;  3CCL A;  2HZY A;  3A1P A;  3MEV A;  5CKD A;  2LCL A;  1K8A C;  2DMO A;  2VV5 A;  1BCO A;  3I56 A;  3V7C A;  3H41 A;  3GF5 A;  2JTF A;  4F04 B;  3CCM Q;  4A63 B;  3IQL A;  3LWH A;  3REB B;  3I5R A;  4PLL A;  2DE0 X;  3VS2 A;  1YJN A;  4QVC A;  1ZUY A;  3CBP A;  2EGE A;  4J7I A;  1SKU B;  2QXF A;  2GGR A;  1M1F A;  3CEY A;  1PNJ A;  1AT1 B;  5L8R E;  4C92 B;  3JCM d;  3MEA A;  1XTD A;  4XU3 A;  3JCM X;  1NEB A;  2DD4 A;  3EFR A;  2DEQ A;  4JUV A;  3GPL A;  1M9S A;  3VU3 C;  1FMW A;  2O88 A;  3OYJ A;  2RJD A;  3JB9 G;  1UJ0 A;  4M75 B;  1HK9 A;  2XMF A;  3UA7 A;  3J81 E;  2RHY A;  1I0C A;  4PJN A;  2RK2 A;  4ATO A;  2B8A A;  1ZSG A;  1M1K U;  5I11 A;  1YJ9 Q;  2VYT A;  2A37 A;  2KNB B;  3DB4 A;  2RJE A;  1VQ4 T;  3RKW A;  2LRQ A;  5IHI A;  3CCU T;  3CD6 A;  3C94 A;  2P0K A;  4WTO B;  4E6R A;  2F1L A;  2LVM A;  3BE3 A;  4HXJ A;  4E7I A;  2IG0 A;  5HK3 A;  2V1R A;  4J9E A;  4L6V 5;  2YWW A;  1X75 C;  3ER0 A;  2DIQ A;  2EAY A;  1ZBJ A;  2LCC A;  5IHN A;  1PD0 A;  2D8H A;  2CH4 A;  1QKW A;  1FMV A;  5LJ3 h;  2B86 A;  5HY6 A;  5CIU A;  3VS4 A;  2E10 A;  1XOV A;  8ATC B;  1WZO A;  2A0F B;  2E41 A;  3L2W A;  1VQ5 A;  4PFP A;  2M0Y A;  4F7U F;  1UHF A;  2O31 A;  1X43 A;  2WSF E;  3TU4 K;  3JB9 F;  1QP3 A;  3JCM c;  2XIC A;  2JTM A;  5KYX B;  1NJI R;  5FLX E;  2DPP B;  3QG1 A;  2K2V A;  1ZHI A;  1OOT A;  3AT1 B;  5GAN 3;  1Z9Z A;  1UJY A;  4A4F A;  1QVP A;  2KK4 A;  1PC0 A;  1FMK A;  4ME7 A;  1WA7 A;  2I2L A;  4E7L A;  2AZS A;  2DNU A;  2QA4 T;  1VQ4 Q;  3CCU Q;  1KQS P;  2NWM A;  1GBR A;  3A5Z B;  3BY7 A;  3VYG A;  2EQI A;  3I55 T;  2DM1 A;  2E5Q A;  2GTJ A;  1D3B B;  3MP8 A;  3DLL A;  4M77 D;  5GAM g;  1TWB A;  1NLO C;  2LJ0 A;  3ZFJ A;  3G4S T;  1Q81 U;  2WSE E;  1DJ7 B;  2RH2 A;  2YDL A;  4C92 F;  3LYI A;  1M90 C;  1IHV A;  2L3Q A;  1VQP T;  4FM4 B;  3SDZ A;  2XK0 A;  3QJ6 A;  4M75 F;  3V7S A;  1Z9Q A;  4C8Q D;  4KH1 B;  1IB8 A;  1R0B G;  1G3W A;  2A08 A;  3I9Q A;  2YUN A;  5LJ5 h;  2FYK A;  3CPW A;  2JXB A;  1VQO A;  4PKC C;  4A53 A;  3O5Z A;  1KD1 R;  1MV0 B;  1W1F A;  3E9G A;  3M5A A;  1QVG P;  1M3C A;  3KFV A;  2E64 A;  3FDR A;  2C0I A;  4WCI A;  3L2U A;  1M4Z A;  2LQN A;  5GMK e;  2IVW A;  1JU5 C;  3X28 B;  4C92 C;  2QA4 Q;  5GAN 7;  1QW1 A;  2YRC A;  2M51 A;  4RUG A;  4DBR A;  1MNE A;  4DBF A;  2XDP A;  5FWB A;  4IIM A;  4LE9 A;  2DRK A;  4J9I A;  3I55 Q;  1IHW A;  5GAN 6;  1M27 C;  3CCJ A;  4M75 C;  1X2Q A;  1AOJ A;  2OAW A;  2V8K A;  2RK1 A;  3JB9 I;  1PM3 A;  2HD0 A;  1BI3 A;  3G4S Q;  2CUB A;  2EYZ A;  3OSV A;  1YI2 T;  4ESR A;  2KAF A;  2BUD A;  2RJC A;  5GAM d;  1E6H A;  2IPO B;  4DBQ A;  1TG0 A;  1VQP Q;  1IXD A;  3JCM h;  2HL3 A;  3A8H B;  1M3A A;  2JW4 A;  1H3Z A;  3M53 A;  2K79 A;  3SB2 A;  4M77 A;  4AG1 C;  2M16 A;  4IUU A;  1Q7Y R;  2DLP A;  3QPH A;  4JZ3 A;  2O4X B;  2E70 A;  3OB9 A;  2KI7 A;  3CCQ A;  3CCM A;  2KEA A;  1W70 A;  3SEM A;  4AFU C;  4BE2 A;  1WDX A;  2PVD B;  4N4H A;  4BUG A;  4EDU A;  1TSF A;  1W6X A;  4A4K A;  2R58 A;  3MP6 A;  5KYU A;  2KQW A;  1VUB A;  2K4Y A;  2K5L A;  2K7A A;  2O9V A;  2X4W A;  2QAZ A;  3EGU A;  5GAN e;  4ZN3 A;  3CC2 A;  2RN8 A;  3FRN A;  2LQ8 A;  4C0G A;  1YI2 Q;  4N4G A;  4Y91 A;  4M7D G;  4M7A D;  2D6F A;  3M4G A;  2NUT A;  2OJ2 A;  3QWY A;  2GQV A;  4EMK A;  1YJ9 A;  3NTI A;  3NGP A;  4OP0 A;  2J7I A;  2DAQ A;  2KRO A;  3PFS A;  2JM8 A;  4LD9 K;  2PQW A;  3ULR B;  1SPK A;  1GRI A;  4EMH A;  1BKB A;  5CKF A;  4LXC A;  2FZC B;  1TH7 A;  1D0Y A;  1B7T A;  1ZBX A;  4X9C A;  4II1 A;  2OTL T;  3A98 A;  1U5S A;  3JAM E;  1PHT A;  4PLI A;  3HHT B;  4F7U E;  4BDZ A;  3OMC A;  2F5K A;  4ORZ A;  1IGQ A;  2EJG A;  4Q5W A;  3KBG A;  1WHL A;  3EG9 B;  4D8D A;  5KYW B;  3QII A;  1B07 A;  1XJW B;  1QLY A;  4M7D F;  1VYU A;  9ATC B;  1UB4 A;  1G3T A;  3M0S A;  3TVT A;  3JRZ A;  1M3B A;  4JJD A;  2NUP A;  2ROL A;  3M0P A;  1K73 C;  4RTZ A;  3M0T A;  5D7U A;  2GCX A;  4DEX A;  1Q81 C;  1G3S A;  3LLR A;  4HVW A;  4A4G A;  3CCU A;  2XI9 A;  3BW1 A;  1Y0M A;  4M78 G;  1Q95 G;  2QAS A;  3JCM b;  3X20 B;  3HPW A;  4FYX B;  1EFN A;  2QTV A;  1ZSZ B;  4BAC A;  1R0C B;  1Q82 U;  4XTY A;  5DLQ E;  2AK5 A;  2LTO A;  3A8L B;  4A4E A;  1CKA A;  4M7A A;  1MUZ A;  3E19 A;  4C92 E;  2FO0 A;  3UWN A;  3ZEH A;  2RHZ A;  2DFU A;  1K9A A;  2YT6 A;  4CC7 A;  2LNV A;  2OTL Q;  4JLI A;  3RMS A;  5LJ3 e;  1BI2 A;  1OPK A;  4M75 E;  5DY9 A;  1G5V A;  1I07 A;  5IH2 A;  1X2K A;  2JJ9 A;  3QJY A;  2DYB A;  1WLP B;  5KYX A;  3OYN A;  1Y71 A;  4GLK A;  2DVE A;  5GAM h;  1K0S A;  4FYV B;  2BTT A;  5GAO r;  5C0M A;  3OYI A;  3UT1 A;  2L5Q A;  3E2U A;  2KE9 A;  4IIO A;  2MWO A;  3CCS T;  1PWT A;  1VQ7 T;  3VKI A;  4JS5 A;  2EYX A;  2K9G A;  3SWN B;  2QA4 A;  1NEG A;  5I22 A;  5L23 A;  1PKT A;  1BIB A;  2LC4 A;  1H92 A;  2ZPF B;  2RF0 A;  2EYW A;  4HVV A;  2EIF A;  2ENM A;  4FIB A;  2O01 E;  4FU6 A;  4CC3 A;  4HT9 A;  4ZGJ B;  4XU1 A;  4KUL A;  1PRM C;  3G4S A;  2DZ9 A;  2Z0W A;  1QWF A;  2DL8 A;  4C0D B;  1K76 A;  4KRT A;  2X4X A;  4JRI A;  3ZBD A;  1MND A;  2CZ0 B;  4XTU A;  2L2P A;  1VQP A;  1VQ8 A;  4ZGE B;  1CSK A;  4QQG A;  5IAY A;  2ESW A;  5KCH A;  2YRV A;  1J3T A;  2RHX A;  1GBQ A;  3CMA T;  3BFM A;  1ABO A;  2FZK B;  2DL7 A;  4JJN K;  1M90 R;  2CZ7 B;  2DTI A;  2JTE A;  3LWI A;  3V8J A;  4NS5 A;  2J6F A;  5LJ5 e;  2AT1 B;  2P0P A;  4QQ6 A;  2QQB A;  4QT7 A;  1WJQ A;  1P92 A;  3CCS Q;  4KGZ B;  1F1B B;  2ATC B;  4HVU A;  1JXO A;  4KUI A;  4KGV B;  2CP5 A;  1OEB A;  1KQS A;  4ZNX A;  1N8R C;  3EGX A;  2BE9 B;  1SG5 A;  1SSH A;  3HRT A;  1X01 A;  4MZP A;  2PU9 B;  2X3W D;  4A54 A;  4PJO B;  2XDD A;  4RG2 A;  3L2V A;  1Q86 U;  3RNJ A;  2V26 A;  5DLO A;  2X4Y A;  1ACM B;  2CT3 A;  1YI2 A;  3VS6 A;  2CKK A;  2K2M A;  4EIK A;  1SHF A;  2HNI A;  1OV3 A;  1OX9 A;  4J9G A;  1RLP C;  3A8G B;  3CMA Q;  1ZSZ C;  2JMA A;  2ED1 A;  3L1A A;  2QEX T;  4ELZ C;  1WX6 A;  1KC8 C;  4HCB A;  3JCM g;  2H8H A;  4O6J A;  1RAA B;  5GAO n;  1QVG A;  1FYN A;  3OW2 P;  1BCM A;  3V8K A;  2EWN A;  2RI5 A;  3EFO B;  4XTW A;  3NHN A;  1O9S A;  4CC2 A;  2GBQ A;  3QSU A;  4IUR A;  3VUB A;  1ARK A;  5GAN 8;  2ZPG B;  2NYS A;  3HFN A;  3VS7 A;  4BDY A;  2DVJ A;  2FB7 A;  1KK7 A;  1GFD A;  1I5O B;  4XU0 A;  3C12 A;  4PJO G;  4F17 A;  2MIO A;  2DF6 A;  4M7D E;  3MJX A;  4XK8 E;  1RAC B;  3TRE A;  5KH6 A;  1UFF A;  1OQK A;  4FW1 A;  2YLB A;  2K57 A;  1VA7 A;  3SWN C;  1VQL A;  1XNI A;  2KYM A;  3LX7 A;  4BE1 A;  1M2O A;  1KQS S;  3HRS A;  4LDW A;  5M9O A;  2CZ6 B;  2HEQ A;  2QG9 B;  1QQJ A;  2KMT A;  2K3Y A;  2MWP A;  2QEX Q;  1TUC A;  2LX9 A;  4M77 G;  4PJJ A;  1LJO A;  4C0D C;  2GTO A;  5D6Y A;  2LJ3 A;  5CKB A;  2FRW A;  3Q1J A;  4J6Y A;  2H3J A;  2HKN A;  4QVD A;  4PJL A;  3CME Q;  1UGP B;  1LOJ A;  4BE0 A;  1QVF P;  2SEM A;  2HAX A;  2QQR A;  3PVQ A;  4JDS A;  1YIJ T;  4GBQ A;  1N9S A;  2LP5 A;  4PJO F;  3EGD B;  4BI4 A;  3VJP A;  4C8Q G;  1VQ6 A;  3CXC P;  3EG9 A;  1JBM A;  1UEB A;  2XID A;  5IXF A;  1QVG S;  1V1C A;  1TUD A;  4EMG A;  3RES A;  3D7S B;  1G2B A;  1WGS A;  1E7O A;  3HP9 A;  1XQH A;  3OBY A;  4C5I A;  1ZLM A;  4BI8 B;  5HKC A;  1WHM A;  2DIL A;  2DX1 A;  2FG0 A;  2DL5 A;  2KT1 A;  2DXB A;  2CUD A;  4RTW A;  5CQY A;  2M02 A;  4RMO A;  1SHG A;  1K73 R;  1ZSZ A;  1Q81 R;  5KYY B;  4RCC A;  4FL6 A;  2CDT A;  5EC7 A;  3QO3 A;  1IGU A;  1NBE B;  1X69 A;  4NOY A;  1HSQ A;  2RQW A;  2K3B A;  3H0I A;  1AZE A;  4Z02 A;  4Z8A A;  1BIA A;  2LZ6 B;  1JRI A;  5J26 A;  4E7H A;  2VVK A;  3URG A;  2YXY A;  1YIJ Q;  1TOV A;  1WXB A;  2KXC A;  4RTX A;  4PJM A;  1K9M C;  1R8O B;  3RBB B;  5GAN f;  1Y57 A;  5LL6 S;  1KG1 A;  4JPB W;  1S1N A;  1BU1 A;  3CC7 T;  5FRM A;  1QCO A;  2EQU A;  5GAM e;  1GCP A;  1U1T A;  4J6W A;  3CCS A;  2ZPB B;  1JQQ A;  3U23 A;  1YIT T;  4LD6 A;  2EGA A;  5KCO A;  3OS5 A;  4JZ4 A;  1U8R A;  1VQ7 A;  4D6W A;  3QYH B;  1KQ2 A;  1K0X A;  2KSS A;  1UDL A;  1SRM A;  3G71 Q;  2F69 A;  4ELY C;  2HDA A;  3AHU A;  2DJQ A;  2CP2 A;  1Q86 C;  4C0Z A;  4KUD K;  1X27 A;  1G8X A;  2JS0 A;  2GQI A;  4M7A G;  1M30 A;  2KRN A;  1I81 A;  2EBP A;  5FW9 A;  2X9H A;  2L0A A;  2OAU A;  4LDV A;  4MML A;  4ZTF A;  1BI0 A;  1NJI U;  3OYC A;  3INZ A;  4MZM A;  2JVV A;  1UHC A;  1ZA1 B;  2DTH A;  4RG8 A;  2EJ9 A;  1YWP A;  1ABQ A;  3JB9 D;  5CQX A;  3JB9 J;  3CC7 Q;  4J7F A;  3PVL A;  3F70 A;  1OZ3 A;  4JRP A;  3BDL A;  1WQW A;  3OYB A;  1G83 A;  5FU7 B;  2RB6 A;  1YIT Q;  2J6O A;  4AFS C;  1ZX6 A;  3OQ5 A;  1X6B A;  2EGC A;  1Y96 A;  2DTO A;  2C0O A;  2D8J A;  2KY9 A;  2PVG B;  1RAG B;  2RPN A;  1PD1 A;  3CCV T;  2KYB A;  2ZAE A;  1IZ6 A;  3OS0 A;  2KVQ G;  2QI2 A;  1QCN A;  3RMQ A;  5CR2 A;  1N8R R;  4M7D B;  2CP0 A;  4J6X A;  3GP8 A;  2HL5 C;  1LNX A;  1G3Y A;  3EFS A;  5LJ3 f;  4HA8 A;  2VUB A;  2RQU A;  4C92 D;  1ZQ1 A;  4E47 A;  1YBY A;  2V1Q A;  1VQN T;  4XTZ A;  1KD1 U;  3THK A;  2QTX A;  3DKM A;  4M75 D;  2QEX A;  4DA4 A;  1QP2 A;  3RER A;  3OBW A;  1GL5 A;  3WXM B;  5GAO q;  4RTY A;  4JLG A;  1KC8 R;  2FPE A;  3QKJ A;  2DK3 A;  1I4K 1;  2EVR A;  3LW5 E;  1QCF A;  4PJO E;  1PRL C;  1PSE A;  4PFO A;  3PTA A;  2KT8 A;  3CCV Q;  4F7U A;  2CP3 A;  1M1K C;  3R6O A;  3GOX A;  1WHH A;  2DXT A;  4D8K A;  3VRZ A;  3S6W A;  1AWW A;  2L89 A;  1H8K A;  1MV3 A;  1D1B A;  2A3L A;  4C0F A;  3CC4 T;  5ECA A;  4O5V A;  2F5T X;  1Q7Y U;  4M78 B;  1VQM T;  2GFA A;  5GAN g;  1VQN Q;  2OI3 A;  2X4J A;  1PSF A;  1K8A R;  2KBT A;  3E9F A;  2CSI A;  5LJ5 f;  2Y4X A;  2PVO B;  1QMC A;  2P0Q A;  4KBM B;  3OW2 A;  2HQE A;  4J9B A;  3RKX A;  3H0F A;  5CCA A;  2EJF A;  1RL2 A;  2QQS A;  2O2O A;  1TU0 B;  2AHJ B;  1T3S A;  4C92 A;  2KDS A;  4OML A;  2K5F A;  2RMO A;  4R56 A;  3VRY A;  2ZZD A;  3CBM A;  3P8H A;  2JT4 A;  3VV0 A;  3EGD A;  4FSS A;  4M75 A;  1T0J A;  2K3X A;  4QW2 A;  2YSQ A;  6AT1 B;  5A0D A;  2DXU A;  1ZUU A;  4OB3 B;  2CP6 A;  4X34 A;  3VS5 A;  3P8B B;  2DD5 A;  5GMK i;  3PIP A;  4JJB A;  1RUW A;  5FU7 C;  1VQ4 A;  3ME9 A;  2J05 A;  3G6E T;  1WNL A;  2DBK A;  3CC4 Q;  1OZ2 A;  3M0Q A;  3UAT A;  2FEI A;  1WFW A;  1M1G A;  3CCL Q;  1QKX A;  4Y92 A;  3UF4 A;  2BKD N;  2JOY A;  3C0C A;  1VQM Q;  2LT4 A;  4KH0 B;  3M9Q A;  4NL3 A;  2MCN A;  5HCK A;  1D09 B;  4OB1 B;  3GBQ A;  2G3R A;  4OMQ A;  1WHJ A;  3L2Q A;  2VXF A;  4M7D C;  2FVU A;  3EG1 A;  1TXQ A;  2LNH B;  3FIF A;  3OS1 A;  5GAN d;  3OS2 A;  2GF7 A;  5KE3 A;  1VIE A;  1WHK A;  2A7Y A;  3QWX X;  5GMK j;  3PT9 A;  1MMD A;  3A8M B;  2GFU A;  4JS4 A;  1QVF A;  3MPU B;  4EPC A;  1HJD A;  3QDR B;  2JS2 A;  2RO0 A;  4M4Z A;  4B9X A;  1RAI B;  4AFZ C;  1YFN A;  4Z88 A;  1H64 1;  1KFZ A;  3P8D A;  2M9U A;  4MZT A;  2LMJ A;  4QVZ A;  3VYH B;  3LGL A;  4N0A C;  3CC7 A;  3CPW P;  4M78 F;  3OW2 S;  1X6G A;  2EKH A;  3GIB A;  4HT8 A;  3EAE A;  4M7D D;  3L2R A;  1K9M R;  3G6E Q;  2AKK A;  2RI2 A;  3OA6 A;  1YIT A;  3M59 A;  1YJW T;  4J9H A;  3I55 A;  1YHQ T;  1D3B A;  2CSQ A;  2CYZ B;  2F2W A;  1E6G A;  2V8I A;  2LX7 A;  3MO8 A;  1TUG B;  3X24 B;  4LNP A;  2M0O A;  1AEY A;  5IT9 E;  2W10 A;  1NYG A;  1EZZ B;  5FU6 B;  4V2S A;  4J83 A;  4LUD A;  4C5G A;  1WJS A;  7AT1 B;  3CBO A;  2MPX C;  1D1C A;  4ZTJ A;  4M78 C;  2RNA A;  2BZY A;  4FT4 A;  3UDC A;  2KGT A;  3HKS A;  4J9C A;  4P5N A;  1M8M A;  3CCE T;  2DJZ A;  3EHR A;  4QKU A;  5GAN j;  4KT0 E;  1SF9 A;  5I2S A;  2RQV A;  1N27 A;  4E7K A;  2HMA A;  1VQO T;  4CC4 B;  2OX7 A;  2PZ1 A;  3OYK A;  2COY A;  5GMK h;  1QVF S;  1CKB A;  1YJW Q;  1YHQ Q;  2RA2 A;  3H9N A;  3TEE A;  1A0N B;  2NLU A;  1EX4 A;  3I5S A;  5IN1 A;  3CCJ T;  2VAS A;  1IO6 A;  1D0X A;  4NL2 A;  3R6N A;  3PNW C;  2J06 A;  4M7D A;  4DQ2 A;  3JCM e;  3PMT A;  2DEU A;  1NYF A;  2HQX A;  2FHD A;  2D1X A;  2DRM A;  3KXT A;  2E6Z A;  2X51 A;  4UC4 A;  1M90 U;  2O4X A;  1AVZ C;  1VYV A;  1YNZ A;  1RAE B;  2HSE B;  3CCE Q;  2DL3 A;  4M77 B;  2Y4Y A;  2K6D A;  2ZPE B;  4J8O A;  1MMG A;  1GCQ C;  4X1V A;  3CME T;  2HBW A;  2JUF A;  5GAM f;  1VQO Q;  3G7Z A;  3M55 A;  3V7R A;  2FPF A;  3RKY A;  1YCS B;  3MP1 A;  2IIM A;  1VYT A;  2KXD A;  2DER A;  3MET A;  1VOM A;  2C06 A;  1RAB B;  5KYN A;  4Z89 A;  5FRN A;  3JCM Q;  4C8Q B;  2VXE A;  3RIR A;  3SD4 A;  3RUX A;  1NG2 A;  3SFM A;  2CH4 W;  3PMI A;  4AMC A;  2DL4 A;  5GAN h;  3GNF B;  2FL7 A;  3CCJ Q;  2EPD A;  3HTR A;  2RHU A;  2M1H A;  1YP5 A;  1RAF B;  3QHS A;  3CC2 T;  5A2Q E;  4FSX A;  2XG8 D;  2J6K A;  2XD0 A;  3OYE A;  1UG1 A;  1M5Q 1;  2VGM A;  2VGN A;  3LGF A;  3TSW A;  3QZ5 B;  5LJ3 j;  3GLX A;  1M1K R;  2NUT B;  4EMK B;  2D0Q B;  3CC4 A;  1W2B P;  1Q82 C;  1NPR A;  5HK0 A;  3C95 A;  4IUT A;  4M78 A;  2OTJ T;  1VQM A;  3OYM A;  3JB9 H;  1V29 B;  5DM7 R;  2RI3 A;  4CRI A;  5FU6 C;  1HXD A;  2MK5 A;  3QBY A;  3OYF A;  1B34 B;  3M4Y A;  3CCR T;  3HRU A;  1JEG A;  3CCQ Q;  4OMN A;  4BB7 A;  5A0G A;  3ZL7 C;  4VUB A;  1VQ9 T;  2LT1 A;  2OTL A;  1WQ7 A;  2KRS A;  3S3M A;  3A8O B;  1UUE A;  4HCC A;  4K11 A;  1FWZ A;  1MMN A;  1UGV A;  3QDF A;  2HBP A;  2K5I A;  1JO8 A;  2YUP A;  4AG2 C;  5KYW A;  3VUZ A;  3FB9 A;  4F7U G;  1WYX A;  4R0K A;  3CC2 Q;  4LUE A;  4M78 E;  1GXI E;  1D1A A;  1RAD B;  2L3R A;  4ANJ A;  2NUP B;  4RTT A;  2ZPI B;  2D9T A;  4M77 F;  3G6E A;  3G71 T;  1AWX A;  3C4S A;  1R77 A;  2EQK A;  2C0T A;  1UGQ B;  1Y7X A;  4PJO C;  4OB0 B;  2OTJ Q;  4OMF B;  3HSB A;  4OF1 A;  2EW3 A;  3CCR Q;  3EH1 A;  5LJ5 j;  2PTK A;  4J9F A;  3T9N A;  4Y28 E;  3LH5 A;  1GCQ A;  1U06 A;  1U1S A;  3JCM W;  4XTV A;  3H0H A;  1VQ9 Q;  4C8Q F;  4M7A B;  1KJW A;  4BY6 B;  4GY5 A;  1BI1 A;  1VQK T;  4J5Y A;  2QQA A;  4C5H A;  1OU8 A;  1WHG A;  4LN2 A;  4E7J A;  1KQ1 A;  4C92 G;  1KHI A;  3EG3 A;  2L3S A;  4M77 C;  4OMM A;  3WVE B;  3JCM J;  1JJ2 P;  2SRC A;  4FT2 A;  5GAO l;  4M75 G;  4PJO D;  2A28 A;  4OGC A;  2EQM A;  5AT1 B;  4QQD A;  3M0U A;  2LQK A;  1HD3 A;  3SWN A;  2D0N A;  4WF2 A;  2ROT A;  3TCJ A;  5C6S A;  4C8Q C;  4JJC A;  2HCK A;  1YJW A;  1YHQ A;  2ZGW A;  1K73 U;  4HCZ A;  3DLM A;  3DB3 A; 
#chains in the Genus database with same CATH homology
 3RDV A;  2CP5 A;  1WHM A;  2CP6 A;  2COZ A;  2MPX C;  2HQH A;  2CP7 A;  2COY A;  3E2U A;  1WHJ A;  2M02 A;  1IXD A;  1LPL A;  1TOV A;  1TXQ A;  2HL3 A;  2E3I A;  2Z0W A;  1WHL A;  2HKN A;  2CP3 A;  2QK0 A;  1WHG A;  2CP0 A;  1WHK A;  1WHH A;  2HL5 C;  4B6M A;  3TQ7 P;  2HKQ B;  2CP2 A;  2E3H A;  2COW A;  2E4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...