2CP2A

Solution structure of the 1st cap-gly domain in human clip-115/cyln2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
95
structure length
95
Chain Sequence
GSSGSSGAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLIP-115
publication title Solution structure of the 1st CAP-Gly domain in human CLIP-115/CYLN2
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp2A00
2Z0WA 2E3HA 2COZA 3TQ7P 1WHGA 2HQHA 1TXQA 2MPXC 3E2UA 1WHLA 2M02A 2HKQB 2CP6A 1WHMA 1TOVA 2HL5C 2CP7A 2CP2A 2COWA 2CP5A 2E4HA 2E3IA 1WHJA 1IXDA 2HKNA 2CP3A 3RDVA 1WHHA 2HL3A 2QK0A 1LPLA 4B6MA 2CP0A 1WHKA 2COYA
chains in the Genus database with same CATH superfamily
4A4HA 2QG9B 3I35A 3A8OB 2LNHB 4XTWA 2LJ3A 4M7AG 3OW2S 1NJIC 4JRKA 3L1AA 4M7AE 3CCUT 2K57A 2O4XB 3EGDB 2RQWA 2K79A 2QASA 4PFZA 4KH1B 3RDVA 3MEWA 1X6BA 2QGGA 2PU9B 2X35A 4JUVA 2DBMA 1X27A 2DERA 4C92A 1IZ6A 2ENMA 2QTVA 1SG5A 2COZA 1VQ9T 2L2PA 2V26A 4PNOA 2DRMA 1BK2A 1YN8A 2DL7A 2BZYA 2CP6A 3OQ5A 4PK4A 3EG3A 4HVUA 3M0RA 1M8MA 2FG0A 4AG2C 4M7DD 3MP1A 5KYNA 1YP5A 2A08A 2QAZA 2O01E 2GCXA 1LJOA 1NEGA 2D6FA 3NMZC 4C92G 2E70A 5CKDA 3G71T 2V8JA 4C92E 4KGVB 5CQYA 3A8MB 2VKNA 5AYFA 2OAWA 2YUPA 2RHZA 5FRMA 1RADB 2CP2A 2C0IA 3OYAA 1UB4A 4XTVA 2JTEA 2DX1A 4TVRA 3CBMA 1Q81R 3IQLA 3AT1B 2K5IA 1OZ3A 1GBRA 4JRQA 4JDSA 5KYXB 2D1XA 3RERA 4E7JA 2RM4A 2J05A 4X34A 3CMAQ 3EG9B 3EG1A 2CT3A 4C0ZA 3GF5A 3M0PA 4M78D 4PLIA 5IXFA 2J6FA 3MKDA 2MWPA 3OYFA 4BD3A 2DTIA 1I07A 3OS2A 4CC2A 4M7DA 2O2OA 1QCNA 2E6ZA 5IXBA 2EYZA 4M75F 5KYYB 1YCSB 2D8JA 4FYXB 2M9UA 2PTKA 4JZ3A 2DEUA 4QQGA 3JRZA 3TSWA 1VQ4T 3X24B 4PJMA 1BI2A 3H0FA 4NL2A 4N4IA 1PCXA 1MV3A 3CCUA 1WXUA 1MNDA 4N0AA 5FU7C 2PQWA 4M7DG 1OU9A 3REBB 1ZSZA 2FPFA 2MPXC 4M7DE 1QWEA 2RQTA 1OULA 4DQ2A 1V76A 4QW2A 3OYDA 2DA9A 3NTHA 3ZEHA 2V8KA 2RN8A 2CP3A 1VQ9A 1OYXA 1WXTA 4MDXA 2RK1A 1B07A 4DBQA 3GOXA 2E5QA 4M78A 1D1CA 2LCCA 1M1FA 2ECZA 1QKWA 3S3OA 5GMKi 3JB9I 2E3HA 4OB3B 1N9SA 4XU2A 5LJ3f 5CAIA 4C5GA 1NE8A 3FLGA 3BFMA 2E65A 4ZNXA 2EQUA 2KAFA 4NL3A 4M75D 2EGCA 1VIFA 1N6AA 2CYZB 1PHTA 1VQOA 2HMAA 4RG2A 2K6DA 3VS5A 4DOWA 2SEMA 2RQUA 4FT2A 5C0MA 4FU6A 3CPWP 3CCLQ 4LUEA 2HCKA 4LUDA 3CXCP 3RESA 4HCBA 1K76A 2P0QA 1PG5B 4J7FA 3UA6A 1U1SA 1AVZC 2DD5A 2JXBA 5CKBA 2CDTA 5GMKj 5LJ3d 1VYTA 3EGXA 4X9DA 1HJDA 5M9OA 2V8IA 1YJ9Q 5GAOp 3OYJA 1PRMC 2NUTB 4PJLA 4PJOF 4OMPA 4II1A 1VYUA 2AK5A 1AD5A 5LJ5h 1VIEA 1MNEA 1GBQA 1BIBA 1PNJA 1E7OA 2J7IA 5GANh 2HEQA 2DIQA 3FIFA 4M75A 4CC7A 3J81E 2KDSA 2RD1A 4YTLA 1K73R 3ME9A 1OZ2A 1VQ4A 3S6WA 4M7AB 1IHWA 1PC0A 2EWNA 3CCRT 1OV3A 3M53A 2JM9A 2LMJA 2LRQA 1PD0A 3PMTA 1RAEB 4EPCA 1IXDA 2LJ1A 1R0CB 3F70A 3VS7A 3OBWA 2QA4T 1VA7A 3EFOA 1Q7YC 2X4WA 3QZ5B 3KBGA 2VC8A 5GAMj 4RCCA 1I4K1 2O31A 3QDRB 4M75G 3GP8A 4K11A 2E64A 2BE7D 4M75E 1ZBXA 3I5RA 1PD1A 2D0NA 4PL6A 2QK0A 1AOJA 3X25B 2JS2A 3QO3A 1KHIA 2KXCA 4QKUA 4O6JA 2VV5A 4C92B 1Q81U 1Z9QA 3E9FA 4C5HA 3VJPA 4EMGA 2KT1A 3A8LB 3QJ6A 2QA4Q 2DFUA 2YDLA 1ZUKA 2DTHA 2L5QA 2F5KA 2DXUA 2DNUA 1BI1A 1IHVA 3RKWA 1VQ8Q 3PFSA 5HK3A 2CSQA 3NHNA 2EQKA 1JRIA 4HVVA 3V8KA 2MF2A 4B6MA 4F14A 2JUFA 5HCKA 4PLLA 4J7IA 5KCHA 3CCJT 3CPWS 4XTZA 1WI7A 1BI0A 3PNWC 2RNAA 4JJDA 3CXCS 3R6NA 5GAN7 1AEYA 3A98A 2K5FA 3CD6Q 9ATCB 1YJNT 3QYGB 2EAYA 1YJWQ 5FWBA 3G6ET 1ZUUA 2EJGA 1YCYA 2P0KA 4HCCA 4DA4A 2EGAA 1B34A 3OYNA 5L23A 1HK9A 1K9MR 5D6XA 2JT4A 3CEYA 1OPLA 1OX8A 1XNIA 4A4GA 4AG1C 1YHQQ 1VQMT 1R77A 2KY9A 2BZXA 3TSZA 4Z02A 3JCMX 3QBYA 3PVQA 3CCRA 4JRPA 4CC3A 1YIJA 1QQJA 4R0KA 1I8FA 1QMCA 2O9SA 3LYIA 4M7DB 4RTXA 1TWBA 2DVEA 3E9GA 3EHQA 4PJOG 4RTVA 1NLPC 4PJOE 1KJWA 2MCNA 1W2BA 3VV0A 2IVWA 2W0ZA 4HKEA 1M90C 2OAUA 2CP7A 3TVTA 2PUKB 4JPBW 4LDXA 5GANf 1ZUYA 3OA6A 2WACA 1VOMA 3RKXA 4RTUA 4L59A 3M57A 1EIFA 3C95A 5CKHA 1ZSZB 3WVDB 1A0NB 4E7LA 2E6NA 4OMNA 1WFWA 4HXJA 2KR3A 5ECAA 3DLLA 4J9IA 1HXDA 2DPPB 1JO8A 4IUUA 5GMKl 2K7AA 1YWPA 3CC7Q 2F2VA 4X1VA 3I55A 5LJ5g 3HFNA 3CMEA 2EYXA 2DZCA 1M1KC 4BB7A 2HZYA 5GANg 5FWCA 4DBFA 3UATA 2CP5A 3CCJA 2L89A 1C0MA 5D6YA 3O5ZA 3PTAA 1JJ2P 2QQBA 1VQ5A 4B9XA 4OMLA 2B8AA 2L3RA 1K73C 3LH5A 2WSFE 1YJNA 2A28A 2KGTA 5CO7A 1OI1A 1WHGA 4HCZA 3NFCA 1K73U 4MMKA 4C92F 4MZTA 2GF7A 2DK3A 1WPYA 3VUBA 2KNBB 2OI3A 4C0GA 4J9EA 1VQNQ 1VQKT 3EGXB 1KQ2A 4M77D 4PFOA 4M7AC 3VS0A 1VQMA 2DE0X 2Z0WA 3CBOA 1M3CA 1RAGB 4J9BA 1Y0MA 4F16A 1VQLQ 1G5VA 2VGMA 2CH4A 4IIOA 4UC4A 2DTOA 4ATOA 2FPDA 2PUOB 5DM7R 1M8VA 2KEAA 1BI3A 4LE9A 4A63B 1ZQ1A 1K4US 3THKA 2XKOC 4FSXA 4QQ6A 1MGQA 4M75B 4RTWA 1FWZA 2FRYA 3GPLA 2A37A 2AKLA 1X43A 2YWWA 3WXMB 2KRMA 3MPUB 3OMGA 2PVOB 3M54A 2EJFA 1GRIA 4OVAA 4RG8A 1GFCA 2XDPA 3C94A 5LJ5e 3CC4A 2DVJA 1BCMA 4JJCA 2EQMA 3EFOB 2GGRA 2RJEA 2IIMA 2HQEA 5GANe 3OYMA 2YRDA 5FRNA 2KRSA 5EC7A 2K2MA 3V8LA 4M77A 8ATCB 4LDVA 5IT9E 3QIIA 3RIRA 1CKAA 5GAN4 4IUTA 2M02A 3QUIA 1JJ2A 2P4RA 1OQKA 4BE0A 2NWMA 1KC8R 1R8OB 1KQSP 1KQ1A 1NG2A 4RTZA 1VQ6A 1X2KA 4O5VA 4OB0B 5GAN6 1PSFA 1RUWA 4RKUE 4D8KA 2FB7A 1K9MU 4OMMA 3EFRA 1AWOA 5LJ3h 3PVLA 3JCMP 5GAOq 3OBYA 3FEOA 2YSQA 4J9CA 1NBEB 2ATCB 4DEXA 1IGUA 3URGA 2MYSA 3I56Q 1JJ2S 3NTIA 1TUCA 4Y92A 1BCOA 4F17A 4E7HA 2Y4YA 3JCMQ 3PMIA 4XTUA 2A0FB 3DB4A 2AT1B 1VUBA 2NUPA 5GAN3 1VQKA 1Y96A 3JCMh 1BU1A 4LDYA 4M78F 3E19A 1AWXA 3M0SA 1LVKA 2EFIA 3CCVA 2OTJA 1WHHA 1W6XA 5FLXE 1ABQA 5IHKA 2QQAA 1M9SA 3CMAT 3LW5E 2QEXT 1UGPB 1TUDA 1B34B 3JV3A 4PJOB 4A53A 2DXTA 2YRVA 2BTTA 3BDUA 4LNPA 1S1NA 2RHYA 3J80E 2DAQA 2QI2A 4NS5A 1JQQA 3CQTA 4MMLA 2L3QA 3H9NA 3SWNA 3HRUA 2JTFA 2I2LA 5KCOA 3CCST 2FZCB 3RMSA 2P84A 2ZPEB 1UUEA 5GAOl 2QQRA 2EBPA 1KQSA 1WJQA 2QEXQ 2HSEB 2FHDA 1GFDA 1M1GA 4DEYA 1LPLA 2LCLA 2Y4XA 1T0HA 5FROA 1N27A 2K9GA 4RUGA 3LGLA 3EH2A 3E1SA 1RL2A 1IO6A 2DL5A 5GMKm 4N4HA 3CCSQ 1XTDA 1T3SA 2D9TA 4QQDA 3HRSA 1KQSS 3VS4A 1VQOQ 2ABLA 2LZ6B 2RHUA 1M5Q1 5IHNA 2YLBA 3M55A 1YNZA 2F2WA 4WF2A 5CQXA 2CGHA 4J83A 5J3BA 3MEAA 2L8DA 4JS4A 1S72Q 2K2VA 2DXCA 3HFOA 1NZ9A 3G4SQ 3CCLT 2RQVA 3NPFA 2DL8A 1WQWA 4QVCA 4IUQA 2QDYB 1TSFA 3V7SA 1WGSA 1SRLA 4AFSC 1U06A 4NOYA 2BE9B 1UECA 2IPOB 1ZHIA 1I5OB 5A0GA 1SHGA 3OYIA 1K8AC 3I9QA 3CMAA 1Q86R 1ZBJA 4J8OA 1O75A 1Y7XA 1K8AU 1YJ9T 1YITQ 2RI3A 4M75C 3G71A 4OMFB 1AZGB 1UGRB 1BIAA 1RI0A 2QDLA 1X2QA 3VRZA 3UF4A 1FMKA 2EIFA 4OMQA 2VYTA 3T9NA 2DETA 3JCMf 1RABB 4M78G 2MWOA 2X4YA 3HTRA 2WSEE 4M78E 1JBMA 1WJRA 1OOTA 2JM8A 1KC8C 3TU4K 2W10A 2M0YA 2B86A 3UA7A 3ZFJA 1KC8U 2LT1A 3H8ZA 5LJ3g 3H0HA 5A2QE 2M1HA 3OS5A 3META 2RJDA 4FM4B 1X6OA 1YI2Q 2LJ0A 2H8HA 2LQ8A 4AFQC 1VQPQ 2EJ9A 2CH4W 1JXMA 5GAOn 1DJ7B 2KRNA 1D3BA 3JCMd 1Q82R 4FCYA 2CSIA 5J26A 3L2WA 3JCMg 2HBWA 1NPPA 4DBHA 2ZCFB 1XJWB 3MJXA 2RJCA 1UGSB 3L2RA 1N5ZA 2EYWA 4XU0A 5GAMf 4XQ3A 2RQRA 5CK9A 1WHMA 5D7UA 4C8QF 5CVIA 3ER0A 4Z8AA 2KI7A 3ASKA 2DJQA 2RO0A 2BUDA 4J9HA 3SB2A 2PNIA 1VQ8T 1AHJB 3CCLA 4JZ4A 5I11A 1WYXA 3M0TA 1WZOA 2HKQB 1UFFA 3MP6A 2HQXA 1XQHA 4DOVA 2DZ9A 2AHJB 3BDLA 2HKNA 2V1QA 4KUDK 1MHNA 3CPWA 1SHFA 1MMGA 1Q81C 1XOVA 2E12A 5GAMd 4PJOC 3CXCA 3HKSA 2RB6A 1CSKA 1VQ7Q 3CD6T 2DD4A 3GIBA 1AWWA 1YJWT 1Z9ZA 2NUPB 1Y96B 2AKKA 4D8DA 1X01A 2HNIA 5LJ3e 2I0NA 1RLQC 4BE2A 4OMOA 3JB9F 1J3TA 1RLPC 4C8QD 1YIJQ 1BYMA 1T0JA 4PFPA 1YHQT 2L0AA 4HCKA 2FYKA 1BBZA 1EZZB 1FMVA 1QLYA 1X69A 2HBPA 3X20B 2F5TX 4ZN3A 2ROTA 3JCMe 3CCMT 1QKXA 3NGPA 2O4XA 2R57A 3RBBB 1QVFP 4J9FA 3QHSA 3HL8A 1WLPB 1ZLMA 2PZ1A 4X9CA 3RUXA 5GAOm 2DRKA 3SWNB 2X4XA 4MZMA 4E7SA 2NUZA 3OSVA 2QQSA 3QDFA 3WVEB 2DMOA 3CCET 2OTLQ 1GCQC 2LDMA 4ELZC 3A5ZB 3HSBA 2BIVA 2AZSA 2ZZDA 3TCJA 1RI9A 4BI8B 3R6OA 4A4KA 3VRYA 1QVGP 4XAXB 1YFNA 5C6SA 3VYGA 2SRCA 1ACMB 3SEMA 3CCMQ 3I55Q 3JB9D 4L6V5 4C8QA 2YLCA 2QA4A 1Q86C 1NJIR 4JRIA 3INZA 4Z89A 3ZL7C 1N8RR 2HL5C 3CC7T 1VQ8A 5GJVB 1Q86U 1KSWA 3CCEQ 2EQIA 1VQ5Q 2COYA 4CI0C 1UE9A 3SFMA 2JMCA 4OB2B 5KYXA 2GFUA 4C0DB 3DB3A 1AWJA 3DLMA 1JU5C 3CC2T 4C8QG 2HDAA 3QZ9B 3CD6A 4C8QE 4ELYC 2E3IA 5HY6A 4M77F 1YJWA 2XK0A 1G3SA 1KK7A 4LXCA 1R0BG 1WX6A 5HK0A 5LJ5j 2CZ6B 2YUNA 4M78B 1VQNT 5GANj 3MEVA 3OYCA 4FT4A 3RKYA 3E2UA 4F7UA 1Q95G 4PKCC 4ZN1A 1YHQA 2ED1A 2FL7A 1E6HA 4EMKA 1M30A 4N4GA 1VQLT 2QTXA 2HL3A 3ULRB 2FRWA 2ZPBB 1TU0B 1V29B 2CREA 2EYQA 3CC2Q 2EYYA 4HVWA 4KGXB 4QT7A 4AT1B 3EH1A 1PM3A 3G6EA 4KBMB 4ZGJB 2JVVA 4CC4B 2ED0A 4F7UG 2COWA 1QVFS 2E4HA 3JB9G 5CKFA 3CC4Q 4F7UE 1C6VX 1PSEA 1M3AA 1B7TA 1BKBA 4R56A 1NPRA 2YUOA 5CR2A 4OGEA 2NLUA 1QW1A 5FU7B 2K3XA 1B3QA 1U3OA 1WHJA 1FYNA 5IH2A 3A8GB 3A8HB 4R55A 1QVGS 4J5YA 3S3MA 1G3TA 1TTHB 3CCQQ 2DILA 5EG2A 1LNXA 5GJWB 3CC7A 3QJYA 1MV0B 2BKDN 3A1PA 3LH0A 4OGCA 4E6RA 2LC4A 1H3HA 2HQHA 3LGFA 1PKTA 2A3LA 4ME7A 2DYBA 1VYVA 4J6WA 4KUIA 1OX9A 2AZVA 1M2VA 1LCKA 3EG2A 4C92C 3LWIA 3SHWA 3V8JA 3RR6A 4C5IA 4RTTA 3OS1A 3JB9J 2GQVA 2CZ7B 2FEIA 2VGNA 7AT1B 1EX4A 3I56T 4M4ZA 4BI3A 4A4FA 2XHCA 2K3YA 2X3XD 1RAHB 2RF0A 4HT8A 3TREA 2JJ9A 3GLXA 4L5GA 4RTYA 1G8XA 1WA7A 1VQNA 1SSFA 2V1RA 3HPWA 1T3LA 5A0DA 4WTOB 3S3NA 1K9MC 4IKFA 2LCSA 2X3WD 4Z88A 1VQLA 3V7CA 4QVDA 3OB9A 1KD1R 2M0OA 4GLKA 2HAXA 2ZGWA 3M58A 4M77G 1M4ZA 2EVRA 3L2UA 4JLIA 4M77E 3SWNC 3JCMV 2C06A 2DXBA 1UEBA 3ZBDA 4E47A 1IREB 3L42A 3QWXX 2E5KA 2RI2A 3BW1A 1MUZA 3L2VA 1K0SA 3QYHB 4JJBA 1RAAB 1W4SA 4ESRA 5GMKh 5KYUA 3SD4A 1N8RC 2E41A 4MDWA 2VXEA 1K1ZA 4AFUC 3P8HA 1NJIU 2IG0A 3M59A 1N8RU 3M0UA 4E2FB 2YXYA 4M7DC 3RNJA 3EGUA 1MMAA 5DY9A 1W1FA 4BACA 3OYGA 3H6ZA 4VUBA 3FB9A 1O9SA 2XI9A 4FW2A 4OB1B 2RHIA 2MK5A 6AT1B 1FXXA 3FJ5A 2CT4A 1Q7YR 3M56A 2ESWA 4C0DC 5GAN2 1RAIB 4N0AC 3CCUQ 4GLMA 1ZSZC 1JEGA 3AHUA 4AFZC 4C8QB 2FVUA 1VQOT 3QPHA 3D7SB 1QP2A 3LX7A 3VS6A 2RH2A 4IIMA 5KYWA 3V7RA 2HD0A 5GAMh 3FDRA 1VQ9Q 3FC3A 1E6GA 1HD3A 2MOXA 4M78C 2GTOA 3I56A 3EFSA 1S72T 2O9VA 2LQWA 2XICA 3VKIA 3PE0A 1TH7A 4KRTA 5FU6B 3G4ST 2EGEA 4BY6B 2GFAA 1M27C 5GAN5 1HSQA 4EIKA 4KH0B 5GAN8 3G71Q 1JB0E 1D0XA 2YRCA 1FX7A 3OSSC 1JXOA 1Y07A 3C12A 4Y28E 3L2QA 1I5LA 3CPFA 1YITT 2LT4A 4FL6A 3VU3C 1NLOC 1UGQB 2OJ2A 3U23A 4F7UB 2VWFA 2QGFB 3OYEA 1WQ7A 1KIKA 1D1AA 4KULA 3OYHA 4EMKB 1MMNA 3G7ZA 3UWNA 3KFVA 1TUGB 2G3RA 3H41A 2RMOA 1OEBA 2G6FX 4P5NA 3O8VA 3GBQA 3PIOA 1RAFB 3EHRA 2XDBA 1GCPA 1G3YA 1TG0A 2QEXA 3HHTB 2CZ0B 3OS0A 1I1JA 3KUFA 2M51A 1NEBA 2VASA 2KVQG 2DJZA 5CIUA 1YI2T 2NYSA 3M4GA 2CS7A 2JOYA 3GNFB 4KGZB 2P4TA 4CRIA 5KE3A 1CKBA 1VQPT 3QKJA 2J6KA 3G1JA 1VQ4Q 5I21A 4J9DA 2GTJA 3OYLA 4F04B 4FW1A 2JTMA 3C0CA 1NM7A 1KFZA 3BE3A 4ZTJA 2D8HA 1U8RA 1M90R 3CCSA 1WJSA 1ZX6A 2KYMA 4IUVA 3BY7A 2F1LA 5LJ3j 5IN1A 3JCMJ 2AIRB 5KE2A 4DBRA 1KD1C 5CCAA 4JJNK 4BDYA 2DEQA 1S72A 1D0YA 1KD1U 1G3WA 1TOVA 2LQNA 4GBQA 3G4SA 1UHFA 4IUPA 1U1TA 3Q1JA 3UT1A 4E7ZA 3QXEB 4C5EA 1M2VB 1WDXA 4XK8E 1D0ZA 3MCAB 1GL5A 1H641 3M9QA 1K9AA 3J7AF 4RMOA 4JLGA 2EPDA 2ZPHB 1SPKA 1W70A 2QXFA 1M1KR 4M77B 3QG1A 2ROLA 1VQ7T 2JS0A 2KMTA 2L3SA 4LN2A 2K5LA 1OU8A 1YITA 1UHCA 3LLRA 5CKEA 2KXDA 2K4YA 2VVKA 5FW9A 1UTIA 1I81A 4ZGDB 3M0QA 3H0IA 1NYFA 2RK2A 4FSSA 4OF1A 1YIJT 2KK4A 2R5MA 1IB8A 2CKKA 4ANJA 4LD9K 5I2MA 2O88A 3X28B 1Y57A 2J06A 1UDLA 4E7IA 1BB9A 4Y91A 2DL3A 1Q7YU 3UPUA 2LNVA 5GAMg 2OX7A 3HRTA 1SSHA 2MMPA 2R5AA 1YJ9A 2H3JA 5DLQE 1ARKA 2LX7A 4IURA 5KYUB 1YI2A 1WXBA 1VQPA 5L8RE 3JCMc 4PJOD 4HT9A 3DKMA 4F7UF 3REAB 2OTLT 1W2BP 1C1AA 3CCRQ 2HSPA 2QYZA 2EW3A 2J6OA 2DBKA 3PT9A 4C8QC 4ORZA 2KYBA 1K0XA 4GY5A 3OYYA 1MMDA 5DLOA 1H8KA 2DYIA 4FYVB 4XTXA 4BUGA 5GMKe 2CUBA 2D0QB 3OMCA 3I55T 3EGDA 1UJYA 2X9HA 3CMET 3JCMb 3MHXA 1PWTA 4WCIA 5FU6C 1M3BA 4BY6C 2FZGB 3VYHB 5I22A 1YWOA 3TQ7P 2F2XA 1EFNA 1ZA2B 1N9RA 2RJFA 2KBTA 3OYKA 1VQ5T 2MAMA 4Q5WA 2KSSA 4V2SA 2X4JA 2GQIA 3PGGA 3FRNA 2CZ1B 5KYWB 1QP3A 4PJNA 2ZPGB 3JSCA 1WNLA 2CP0A 2FZKB 4AMCA 1X6GA 1NYGA 1VQ7A 4MZPA 4PJOA 3OY9A 4ZGEB 1QCOA 3CMEQ 1LOJA 1SRMA 2JW4A 1IGQA 2F69A 1TXQA 2XG8D 1H92A 1QCFA 4EMKC 4A4EA 3C4SA 3CCJQ 3X26B 4LD6A 2MI6A 5GAMe 2GNCA 4JS5A 2RI5A 2A36A 2RA2A 1I0CA 2LQKA 2E10A 2ZAEA 2JMAA 2JZ2A 2C0TA 1YJNQ 1UJ0A 4KT0E 3G6EQ 4D6WA 3UDCA 3JCMW 5LJ5f 1PKSA 3EG9A 1X75C 4OP0A 4EMHA 2QQ9A 1HYOA 2DF6A 2YT6A 4XU3A 3LWHA 1M90U 2KQWA 2A7YA 1SKUB 2XU8A 4EDUA 1VQMQ 1M2OA 3VUZA 1YBYA 3HP9A 3CC4T 3MEUA 2DM1A 2LVMA 1QVFA 2OTLA 2MIOA 5KYYA 2DLPA 2Y90A 3P8BB 1GXIE 5IHIA 1GCQA 2XMFA 4M7AF 1ABOA 3M4YA 3MO8A 1ZSGA 4ZTFA 1KHCA 1Q82C 2DO3A 1W2BS 2VXFA 2WSCE 3VS2A 2RPNA 2FPEA 5LJ5d 1Q82U 1AZEA 3MP8A 3CCMA 5AT1B 5GANd 4A54A 5GAOr 1VQ6T 3OYBA 3OW2P 1QVGA 3RMQA 3CCQT 2K3BA 2M16A 3P8DA 5I2SA 4BDZA 1M1KU 2H3EB 2P0PA 1U5SA 4J6YA 3SDZA 2C0OA 3TEEA 3CCEA 1TS9A 2VUBA 2LP5A 2JN0A 5IAYA 2L3PA 1ZA1B 4M77C 1P92A 1F1BB 2XDDA 2XD0A 3EAEA 3PIPA 2DKGA 3I5SA 3EG0A 4J6XA 2E1HA 5KH6A 4B9WA 1SEMA 2FO0A 2JNGA 1D3BB 4HA8A 1FMWA 4M7AD 1OPKA 4BI4A 1VQ6Q 2DL4A 3QSUA 3CCVT 2OTJT 2EQJA 2RHXA 2YHTA 1PRLC 3FJPA 4FIBA 2VB6A 2X51A 4QVZA 1D1BA 5A0LA 2KE9A 1QVPA 1UGVA 2DIGA 4FYWB 1G2BA 4C0FA 1H3ZA 2R58A 2KROA 1UG1A 2LTOA 3CC2A 4LDWA 4J9GA 1D09B 3QWYA 4FYYB 4LDUA 2NUTA 1VQKQ 2EKOA 2ZPIB 3L2ZA 1K8AR 1RACB 5LL6S 3N5BB 8AT1B 3CCVQ 2OTJQ 4C92D 3VS3A 5HKCA 1AT1B 2LX9A 1SF9A 2PVGB 5J39A 5D6WA 3OW2A 4XU1A 4PJJA 3KXTA 1WIEA 2CUDA 1KG1A 1G83A 2PVDB 4M7AA 2XIDA 3VS1A 1Y71A 2ZPFB 3M5AA 1V1CA 4E7KA 2YUQA 2EKHA 4M7DF 1WHLA 3JB9H 4RCBA 4XTYA 2BZ8A 3CBPA 4BE1A 3GNGA 2GBQA 1IRXA 3NTKA 2KT8A 1QWFA 1WHKA 3CCQA 3JAME
chains in the Genus database with same CATH topology
2Z0WA 2E3HA 2COZA 3TQ7P 1WHGA 2HQHA 1TXQA 2MPXC 3E2UA 1WHLA 2M02A 2HKQB 2CP6A 1WHMA 1TOVA 2HL5C 2CP7A 2CP2A 2COWA 2CP5A 2E4HA 2E3IA 1WHJA 1IXDA 2HKNA 2CP3A 3RDVA 1WHHA 2HL3A 2QK0A 1LPLA 4B6MA 2CP0A 1WHKA 2COYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0W A;  2E3H A;  2COZ A;  3TQ7 P;  1WHG A;  2HQH A;  1TXQ A;  2MPX C;  3E2U A;  1WHL A;  2M02 A;  2HKQ B;  2CP6 A;  1WHM A;  1TOV A;  2HL5 C;  2CP7 A;  2CP2 A;  2COW A;  2CP5 A;  2E4H A;  2E3I A;  1WHJ A;  1IXD A;  2HKN A;  2CP3 A;  3RDV A;  1WHH A;  2HL3 A;  2QK0 A;  1LPL A;  4B6M A;  2CP0 A;  1WHK A;  2COY A; 
#chains in the Genus database with same CATH topology
 4A4H A;  2QG9 B;  3I35 A;  3A8O B;  2LNH B;  4XTW A;  2LJ3 A;  4M7A G;  3OW2 S;  1NJI C;  4JRK A;  3L1A A;  4M7A E;  3CCU T;  2K57 A;  2O4X B;  3EGD B;  2RQW A;  2K79 A;  2QAS A;  4PFZ A;  4KH1 B;  3RDV A;  3MEW A;  1X6B A;  2QGG A;  2PU9 B;  2X35 A;  4JUV A;  2DBM A;  1X27 A;  2DER A;  4C92 A;  1IZ6 A;  2ENM A;  2QTV A;  1SG5 A;  2COZ A;  1VQ9 T;  2L2P A;  2V26 A;  4PNO A;  2DRM A;  1BK2 A;  1YN8 A;  2DL7 A;  2BZY A;  2CP6 A;  3OQ5 A;  4PK4 A;  3EG3 A;  4HVU A;  3M0R A;  1M8M A;  2FG0 A;  4AG2 C;  4M7D D;  3MP1 A;  5KYN A;  1YP5 A;  2A08 A;  2QAZ A;  2O01 E;  2GCX A;  1LJO A;  1NEG A;  2D6F A;  3NMZ C;  4C92 G;  2E70 A;  5CKD A;  3G71 T;  2V8J A;  4C92 E;  4KGV B;  5CQY A;  3A8M B;  2VKN A;  5AYF A;  2OAW A;  2YUP A;  2RHZ A;  5FRM A;  1RAD B;  2CP2 A;  2C0I A;  3OYA A;  1UB4 A;  4XTV A;  2JTE A;  2DX1 A;  4TVR A;  3CBM A;  1Q81 R;  3IQL A;  3AT1 B;  2K5I A;  1OZ3 A;  1GBR A;  4JRQ A;  4JDS A;  5KYX B;  2D1X A;  3RER A;  4E7J A;  2RM4 A;  2J05 A;  4X34 A;  3CMA Q;  3EG9 B;  3EG1 A;  2CT3 A;  4C0Z A;  3GF5 A;  3M0P A;  4M78 D;  4PLI A;  5IXF A;  2J6F A;  3MKD A;  2MWP A;  3OYF A;  4BD3 A;  2DTI A;  1I07 A;  3OS2 A;  4CC2 A;  4M7D A;  2O2O A;  1QCN A;  2E6Z A;  5IXB A;  2EYZ A;  4M75 F;  5KYY B;  1YCS B;  2D8J A;  4FYX B;  2M9U A;  2PTK A;  4JZ3 A;  2DEU A;  4QQG A;  3JRZ A;  3TSW A;  1VQ4 T;  3X24 B;  4PJM A;  1BI2 A;  3H0F A;  4NL2 A;  4N4I A;  1PCX A;  1MV3 A;  3CCU A;  1WXU A;  1MND A;  4N0A A;  5FU7 C;  2PQW A;  4M7D G;  1OU9 A;  3REB B;  1ZSZ A;  2FPF A;  2MPX C;  4M7D E;  1QWE A;  2RQT A;  1OUL A;  4DQ2 A;  1V76 A;  4QW2 A;  3OYD A;  2DA9 A;  3NTH A;  3ZEH A;  2V8K A;  2RN8 A;  2CP3 A;  1VQ9 A;  1OYX A;  1WXT A;  4MDX A;  2RK1 A;  1B07 A;  4DBQ A;  3GOX A;  2E5Q A;  4M78 A;  1D1C A;  2LCC A;  1M1F A;  2ECZ A;  1QKW A;  3S3O A;  5GMK i;  3JB9 I;  2E3H A;  4OB3 B;  1N9S A;  4XU2 A;  5LJ3 f;  5CAI A;  4C5G A;  1NE8 A;  3FLG A;  3BFM A;  2E65 A;  4ZNX A;  2EQU A;  2KAF A;  4NL3 A;  4M75 D;  2EGC A;  1VIF A;  1N6A A;  2CYZ B;  1PHT A;  1VQO A;  2HMA A;  4RG2 A;  2K6D A;  3VS5 A;  4DOW A;  2SEM A;  2RQU A;  4FT2 A;  5C0M A;  4FU6 A;  3CPW P;  3CCL Q;  4LUE A;  2HCK A;  4LUD A;  3CXC P;  3RES A;  4HCB A;  1K76 A;  2P0Q A;  1PG5 B;  4J7F A;  3UA6 A;  1U1S A;  1AVZ C;  2DD5 A;  2JXB A;  5CKB A;  2CDT A;  5GMK j;  5LJ3 d;  1VYT A;  3EGX A;  4X9D A;  1HJD A;  5M9O A;  2V8I A;  1YJ9 Q;  5GAO p;  3OYJ A;  1PRM C;  2NUT B;  4PJL A;  4PJO F;  4OMP A;  4II1 A;  1VYU A;  2AK5 A;  1AD5 A;  5LJ5 h;  1VIE A;  1MNE A;  1GBQ A;  1BIB A;  1PNJ A;  1E7O A;  2J7I A;  5GAN h;  2HEQ A;  2DIQ A;  3FIF A;  4M75 A;  4CC7 A;  3J81 E;  2KDS A;  2RD1 A;  4YTL A;  1K73 R;  3ME9 A;  1OZ2 A;  1VQ4 A;  3S6W A;  4M7A B;  1IHW A;  1PC0 A;  2EWN A;  3CCR T;  1OV3 A;  3M53 A;  2JM9 A;  2LMJ A;  2LRQ A;  1PD0 A;  3PMT A;  1RAE B;  4EPC A;  1IXD A;  2LJ1 A;  1R0C B;  3F70 A;  3VS7 A;  3OBW A;  2QA4 T;  1VA7 A;  3EFO A;  1Q7Y C;  2X4W A;  3QZ5 B;  3KBG A;  2VC8 A;  5GAM j;  4RCC A;  1I4K 1;  2O31 A;  3QDR B;  4M75 G;  3GP8 A;  4K11 A;  2E64 A;  2BE7 D;  4M75 E;  1ZBX A;  3I5R A;  1PD1 A;  2D0N A;  4PL6 A;  2QK0 A;  1AOJ A;  3X25 B;  2JS2 A;  3QO3 A;  1KHI A;  2KXC A;  4QKU A;  4O6J A;  2VV5 A;  4C92 B;  1Q81 U;  1Z9Q A;  3E9F A;  4C5H A;  3VJP A;  4EMG A;  2KT1 A;  3A8L B;  3QJ6 A;  2QA4 Q;  2DFU A;  2YDL A;  1ZUK A;  2DTH A;  2L5Q A;  2F5K A;  2DXU A;  2DNU A;  1BI1 A;  1IHV A;  3RKW A;  1VQ8 Q;  3PFS A;  5HK3 A;  2CSQ A;  3NHN A;  2EQK A;  1JRI A;  4HVV A;  3V8K A;  2MF2 A;  4B6M A;  4F14 A;  2JUF A;  5HCK A;  4PLL A;  4J7I A;  5KCH A;  3CCJ T;  3CPW S;  4XTZ A;  1WI7 A;  1BI0 A;  3PNW C;  2RNA A;  4JJD A;  3CXC S;  3R6N A;  5GAN 7;  1AEY A;  3A98 A;  2K5F A;  3CD6 Q;  9ATC B;  1YJN T;  3QYG B;  2EAY A;  1YJW Q;  5FWB A;  3G6E T;  1ZUU A;  2EJG A;  1YCY A;  2P0K A;  4HCC A;  4DA4 A;  2EGA A;  1B34 A;  3OYN A;  5L23 A;  1HK9 A;  1K9M R;  5D6X A;  2JT4 A;  3CEY A;  1OPL A;  1OX8 A;  1XNI A;  4A4G A;  4AG1 C;  1YHQ Q;  1VQM T;  1R77 A;  2KY9 A;  2BZX A;  3TSZ A;  4Z02 A;  3JCM X;  3QBY A;  3PVQ A;  3CCR A;  4JRP A;  4CC3 A;  1YIJ A;  1QQJ A;  4R0K A;  1I8F A;  1QMC A;  2O9S A;  3LYI A;  4M7D B;  4RTX A;  1TWB A;  2DVE A;  3E9G A;  3EHQ A;  4PJO G;  4RTV A;  1NLP C;  4PJO E;  1KJW A;  2MCN A;  1W2B A;  3VV0 A;  2IVW A;  2W0Z A;  4HKE A;  1M90 C;  2OAU A;  2CP7 A;  3TVT A;  2PUK B;  4JPB W;  4LDX A;  5GAN f;  1ZUY A;  3OA6 A;  2WAC A;  1VOM A;  3RKX A;  4RTU A;  4L59 A;  3M57 A;  1EIF A;  3C95 A;  5CKH A;  1ZSZ B;  3WVD B;  1A0N B;  4E7L A;  2E6N A;  4OMN A;  1WFW A;  4HXJ A;  2KR3 A;  5ECA A;  3DLL A;  4J9I A;  1HXD A;  2DPP B;  1JO8 A;  4IUU A;  5GMK l;  2K7A A;  1YWP A;  3CC7 Q;  2F2V A;  4X1V A;  3I55 A;  5LJ5 g;  3HFN A;  3CME A;  2EYX A;  2DZC A;  1M1K C;  4BB7 A;  2HZY A;  5GAN g;  5FWC A;  4DBF A;  3UAT A;  2CP5 A;  3CCJ A;  2L89 A;  1C0M A;  5D6Y A;  3O5Z A;  3PTA A;  1JJ2 P;  2QQB A;  1VQ5 A;  4B9X A;  4OML A;  2B8A A;  2L3R A;  1K73 C;  3LH5 A;  2WSF E;  1YJN A;  2A28 A;  2KGT A;  5CO7 A;  1OI1 A;  1WHG A;  4HCZ A;  3NFC A;  1K73 U;  4MMK A;  4C92 F;  4MZT A;  2GF7 A;  2DK3 A;  1WPY A;  3VUB A;  2KNB B;  2OI3 A;  4C0G A;  4J9E A;  1VQN Q;  1VQK T;  3EGX B;  1KQ2 A;  4M77 D;  4PFO A;  4M7A C;  3VS0 A;  1VQM A;  2DE0 X;  2Z0W A;  3CBO A;  1M3C A;  1RAG B;  4J9B A;  1Y0M A;  4F16 A;  1VQL Q;  1G5V A;  2VGM A;  2CH4 A;  4IIO A;  4UC4 A;  2DTO A;  4ATO A;  2FPD A;  2PUO B;  5DM7 R;  1M8V A;  2KEA A;  1BI3 A;  4LE9 A;  4A63 B;  1ZQ1 A;  1K4U S;  3THK A;  2XKO C;  4FSX A;  4QQ6 A;  1MGQ A;  4M75 B;  4RTW A;  1FWZ A;  2FRY A;  3GPL A;  2A37 A;  2AKL A;  1X43 A;  2YWW A;  3WXM B;  2KRM A;  3MPU B;  3OMG A;  2PVO B;  3M54 A;  2EJF A;  1GRI A;  4OVA A;  4RG8 A;  1GFC A;  2XDP A;  3C94 A;  5LJ5 e;  3CC4 A;  2DVJ A;  1BCM A;  4JJC A;  2EQM A;  3EFO B;  2GGR A;  2RJE A;  2IIM A;  2HQE A;  5GAN e;  3OYM A;  2YRD A;  5FRN A;  2KRS A;  5EC7 A;  2K2M A;  3V8L A;  4M77 A;  8ATC B;  4LDV A;  5IT9 E;  3QII A;  3RIR A;  1CKA A;  5GAN 4;  4IUT A;  2M02 A;  3QUI A;  1JJ2 A;  2P4R A;  1OQK A;  4BE0 A;  2NWM A;  1KC8 R;  1R8O B;  1KQS P;  1KQ1 A;  1NG2 A;  4RTZ A;  1VQ6 A;  1X2K A;  4O5V A;  4OB0 B;  5GAN 6;  1PSF A;  1RUW A;  4RKU E;  4D8K A;  2FB7 A;  1K9M U;  4OMM A;  3EFR A;  1AWO A;  5LJ3 h;  3PVL A;  3JCM P;  5GAO q;  3OBY A;  3FEO A;  2YSQ A;  4J9C A;  1NBE B;  2ATC B;  4DEX A;  1IGU A;  3URG A;  2MYS A;  3I56 Q;  1JJ2 S;  3NTI A;  1TUC A;  4Y92 A;  1BCO A;  4F17 A;  4E7H A;  2Y4Y A;  3JCM Q;  3PMI A;  4XTU A;  2A0F B;  3DB4 A;  2AT1 B;  1VUB A;  2NUP A;  5GAN 3;  1VQK A;  1Y96 A;  3JCM h;  1BU1 A;  4LDY A;  4M78 F;  3E19 A;  1AWX A;  3M0S A;  1LVK A;  2EFI A;  3CCV A;  2OTJ A;  1WHH A;  1W6X A;  5FLX E;  1ABQ A;  5IHK A;  2QQA A;  1M9S A;  3CMA T;  3LW5 E;  2QEX T;  1UGP B;  1TUD A;  1B34 B;  3JV3 A;  4PJO B;  4A53 A;  2DXT A;  2YRV A;  2BTT A;  3BDU A;  4LNP A;  1S1N A;  2RHY A;  3J80 E;  2DAQ A;  2QI2 A;  4NS5 A;  1JQQ A;  3CQT A;  4MML A;  2L3Q A;  3H9N A;  3SWN A;  3HRU A;  2JTF A;  2I2L A;  5KCO A;  3CCS T;  2FZC B;  3RMS A;  2P84 A;  2ZPE B;  1UUE A;  5GAO l;  2QQR A;  2EBP A;  1KQS A;  1WJQ A;  2QEX Q;  2HSE B;  2FHD A;  1GFD A;  1M1G A;  4DEY A;  1LPL A;  2LCL A;  2Y4X A;  1T0H A;  5FRO A;  1N27 A;  2K9G A;  4RUG A;  3LGL A;  3EH2 A;  3E1S A;  1RL2 A;  1IO6 A;  2DL5 A;  5GMK m;  4N4H A;  3CCS Q;  1XTD A;  1T3S A;  2D9T A;  4QQD A;  3HRS A;  1KQS S;  3VS4 A;  1VQO Q;  2ABL A;  2LZ6 B;  2RHU A;  1M5Q 1;  5IHN A;  2YLB A;  3M55 A;  1YNZ A;  2F2W A;  4WF2 A;  5CQX A;  2CGH A;  4J83 A;  5J3B A;  3MEA A;  2L8D A;  4JS4 A;  1S72 Q;  2K2V A;  2DXC A;  3HFO A;  1NZ9 A;  3G4S Q;  3CCL T;  2RQV A;  3NPF A;  2DL8 A;  1WQW A;  4QVC A;  4IUQ A;  2QDY B;  1TSF A;  3V7S A;  1WGS A;  1SRL A;  4AFS C;  1U06 A;  4NOY A;  2BE9 B;  1UEC A;  2IPO B;  1ZHI A;  1I5O B;  5A0G A;  1SHG A;  3OYI A;  1K8A C;  3I9Q A;  3CMA A;  1Q86 R;  1ZBJ A;  4J8O A;  1O75 A;  1Y7X A;  1K8A U;  1YJ9 T;  1YIT Q;  2RI3 A;  4M75 C;  3G71 A;  4OMF B;  1AZG B;  1UGR B;  1BIA A;  1RI0 A;  2QDL A;  1X2Q A;  3VRZ A;  3UF4 A;  1FMK A;  2EIF A;  4OMQ A;  2VYT A;  3T9N A;  2DET A;  3JCM f;  1RAB B;  4M78 G;  2MWO A;  2X4Y A;  3HTR A;  2WSE E;  4M78 E;  1JBM A;  1WJR A;  1OOT A;  2JM8 A;  1KC8 C;  3TU4 K;  2W10 A;  2M0Y A;  2B86 A;  3UA7 A;  3ZFJ A;  1KC8 U;  2LT1 A;  3H8Z A;  5LJ3 g;  3H0H A;  5A2Q E;  2M1H A;  3OS5 A;  3MET A;  2RJD A;  4FM4 B;  1X6O A;  1YI2 Q;  2LJ0 A;  2H8H A;  2LQ8 A;  4AFQ C;  1VQP Q;  2EJ9 A;  2CH4 W;  1JXM A;  5GAO n;  1DJ7 B;  2KRN A;  1D3B A;  3JCM d;  1Q82 R;  4FCY A;  2CSI A;  5J26 A;  3L2W A;  3JCM g;  2HBW A;  1NPP A;  4DBH A;  2ZCF B;  1XJW B;  3MJX A;  2RJC A;  1UGS B;  3L2R A;  1N5Z A;  2EYW A;  4XU0 A;  5GAM f;  4XQ3 A;  2RQR A;  5CK9 A;  1WHM A;  5D7U A;  4C8Q F;  5CVI A;  3ER0 A;  4Z8A A;  2KI7 A;  3ASK A;  2DJQ A;  2RO0 A;  2BUD A;  4J9H A;  3SB2 A;  2PNI A;  1VQ8 T;  1AHJ B;  3CCL A;  4JZ4 A;  5I11 A;  1WYX A;  3M0T A;  1WZO A;  2HKQ B;  1UFF A;  3MP6 A;  2HQX A;  1XQH A;  4DOV A;  2DZ9 A;  2AHJ B;  3BDL A;  2HKN A;  2V1Q A;  4KUD K;  1MHN A;  3CPW A;  1SHF A;  1MMG A;  1Q81 C;  1XOV A;  2E12 A;  5GAM d;  4PJO C;  3CXC A;  3HKS A;  2RB6 A;  1CSK A;  1VQ7 Q;  3CD6 T;  2DD4 A;  3GIB A;  1AWW A;  1YJW T;  1Z9Z A;  2NUP B;  1Y96 B;  2AKK A;  4D8D A;  1X01 A;  2HNI A;  5LJ3 e;  2I0N A;  1RLQ C;  4BE2 A;  4OMO A;  3JB9 F;  1J3T A;  1RLP C;  4C8Q D;  1YIJ Q;  1BYM A;  1T0J A;  4PFP A;  1YHQ T;  2L0A A;  4HCK A;  2FYK A;  1BBZ A;  1EZZ B;  1FMV A;  1QLY A;  1X69 A;  2HBP A;  3X20 B;  2F5T X;  4ZN3 A;  2ROT A;  3JCM e;  3CCM T;  1QKX A;  3NGP A;  2O4X A;  2R57 A;  3RBB B;  1QVF P;  4J9F A;  3QHS A;  3HL8 A;  1WLP B;  1ZLM A;  2PZ1 A;  4X9C A;  3RUX A;  5GAO m;  2DRK A;  3SWN B;  2X4X A;  4MZM A;  4E7S A;  2NUZ A;  3OSV A;  2QQS A;  3QDF A;  3WVE B;  2DMO A;  3CCE T;  2OTL Q;  1GCQ C;  2LDM A;  4ELZ C;  3A5Z B;  3HSB A;  2BIV A;  2AZS A;  2ZZD A;  3TCJ A;  1RI9 A;  4BI8 B;  3R6O A;  4A4K A;  3VRY A;  1QVG P;  4XAX B;  1YFN A;  5C6S A;  3VYG A;  2SRC A;  1ACM B;  3SEM A;  3CCM Q;  3I55 Q;  3JB9 D;  4L6V 5;  4C8Q A;  2YLC A;  2QA4 A;  1Q86 C;  1NJI R;  4JRI A;  3INZ A;  4Z89 A;  3ZL7 C;  1N8R R;  2HL5 C;  3CC7 T;  1VQ8 A;  5GJV B;  1Q86 U;  1KSW A;  3CCE Q;  2EQI A;  1VQ5 Q;  2COY A;  4CI0 C;  1UE9 A;  3SFM A;  2JMC A;  4OB2 B;  5KYX A;  2GFU A;  4C0D B;  3DB3 A;  1AWJ A;  3DLM A;  1JU5 C;  3CC2 T;  4C8Q G;  2HDA A;  3QZ9 B;  3CD6 A;  4C8Q E;  4ELY C;  2E3I A;  5HY6 A;  4M77 F;  1YJW A;  2XK0 A;  1G3S A;  1KK7 A;  4LXC A;  1R0B G;  1WX6 A;  5HK0 A;  5LJ5 j;  2CZ6 B;  2YUN A;  4M78 B;  1VQN T;  5GAN j;  3MEV A;  3OYC A;  4FT4 A;  3RKY A;  3E2U A;  4F7U A;  1Q95 G;  4PKC C;  4ZN1 A;  1YHQ A;  2ED1 A;  2FL7 A;  1E6H A;  4EMK A;  1M30 A;  4N4G A;  1VQL T;  2QTX A;  2HL3 A;  3ULR B;  2FRW A;  2ZPB B;  1TU0 B;  1V29 B;  2CRE A;  2EYQ A;  3CC2 Q;  2EYY A;  4HVW A;  4KGX B;  4QT7 A;  4AT1 B;  3EH1 A;  1PM3 A;  3G6E A;  4KBM B;  4ZGJ B;  2JVV A;  4CC4 B;  2ED0 A;  4F7U G;  2COW A;  1QVF S;  2E4H A;  3JB9 G;  5CKF A;  3CC4 Q;  4F7U E;  1C6V X;  1PSE A;  1M3A A;  1B7T A;  1BKB A;  4R56 A;  1NPR A;  2YUO A;  5CR2 A;  4OGE A;  2NLU A;  1QW1 A;  5FU7 B;  2K3X A;  1B3Q A;  1U3O A;  1WHJ A;  1FYN A;  5IH2 A;  3A8G B;  3A8H B;  4R55 A;  1QVG S;  4J5Y A;  3S3M A;  1G3T A;  1TTH B;  3CCQ Q;  2DIL A;  5EG2 A;  1LNX A;  5GJW B;  3CC7 A;  3QJY A;  1MV0 B;  2BKD N;  3A1P A;  3LH0 A;  4OGC A;  4E6R A;  2LC4 A;  1H3H A;  2HQH A;  3LGF A;  1PKT A;  2A3L A;  4ME7 A;  2DYB A;  1VYV A;  4J6W A;  4KUI A;  1OX9 A;  2AZV A;  1M2V A;  1LCK A;  3EG2 A;  4C92 C;  3LWI A;  3SHW A;  3V8J A;  3RR6 A;  4C5I A;  4RTT A;  3OS1 A;  3JB9 J;  2GQV A;  2CZ7 B;  2FEI A;  2VGN A;  7AT1 B;  1EX4 A;  3I56 T;  4M4Z A;  4BI3 A;  4A4F A;  2XHC A;  2K3Y A;  2X3X D;  1RAH B;  2RF0 A;  4HT8 A;  3TRE A;  2JJ9 A;  3GLX A;  4L5G A;  4RTY A;  1G8X A;  1WA7 A;  1VQN A;  1SSF A;  2V1R A;  3HPW A;  1T3L A;  5A0D A;  4WTO B;  3S3N A;  1K9M C;  4IKF A;  2LCS A;  2X3W D;  4Z88 A;  1VQL A;  3V7C A;  4QVD A;  3OB9 A;  1KD1 R;  2M0O A;  4GLK A;  2HAX A;  2ZGW A;  3M58 A;  4M77 G;  1M4Z A;  2EVR A;  3L2U A;  4JLI A;  4M77 E;  3SWN C;  3JCM V;  2C06 A;  2DXB A;  1UEB A;  3ZBD A;  4E47 A;  1IRE B;  3L42 A;  3QWX X;  2E5K A;  2RI2 A;  3BW1 A;  1MUZ A;  3L2V A;  1K0S A;  3QYH B;  4JJB A;  1RAA B;  1W4S A;  4ESR A;  5GMK h;  5KYU A;  3SD4 A;  1N8R C;  2E41 A;  4MDW A;  2VXE A;  1K1Z A;  4AFU C;  3P8H A;  1NJI U;  2IG0 A;  3M59 A;  1N8R U;  3M0U A;  4E2F B;  2YXY A;  4M7D C;  3RNJ A;  3EGU A;  1MMA A;  5DY9 A;  1W1F A;  4BAC A;  3OYG A;  3H6Z A;  4VUB A;  3FB9 A;  1O9S A;  2XI9 A;  4FW2 A;  4OB1 B;  2RHI A;  2MK5 A;  6AT1 B;  1FXX A;  3FJ5 A;  2CT4 A;  1Q7Y R;  3M56 A;  2ESW A;  4C0D C;  5GAN 2;  1RAI B;  4N0A C;  3CCU Q;  4GLM A;  1ZSZ C;  1JEG A;  3AHU A;  4AFZ C;  4C8Q B;  2FVU A;  1VQO T;  3QPH A;  3D7S B;  1QP2 A;  3LX7 A;  3VS6 A;  2RH2 A;  4IIM A;  5KYW A;  3V7R A;  2HD0 A;  5GAM h;  3FDR A;  1VQ9 Q;  3FC3 A;  1E6G A;  1HD3 A;  2MOX A;  4M78 C;  2GTO A;  3I56 A;  3EFS A;  1S72 T;  2O9V A;  2LQW A;  2XIC A;  3VKI A;  3PE0 A;  1TH7 A;  4KRT A;  5FU6 B;  3G4S T;  2EGE A;  4BY6 B;  2GFA A;  1M27 C;  5GAN 5;  1HSQ A;  4EIK A;  4KH0 B;  5GAN 8;  3G71 Q;  1JB0 E;  1D0X A;  2YRC A;  1FX7 A;  3OSS C;  1JXO A;  1Y07 A;  3C12 A;  4Y28 E;  3L2Q A;  1I5L A;  3CPF A;  1YIT T;  2LT4 A;  4FL6 A;  3VU3 C;  1NLO C;  1UGQ B;  2OJ2 A;  3U23 A;  4F7U B;  2VWF A;  2QGF B;  3OYE A;  1WQ7 A;  1KIK A;  1D1A A;  4KUL A;  3OYH A;  4EMK B;  1MMN A;  3G7Z A;  3UWN A;  3KFV A;  1TUG B;  2G3R A;  3H41 A;  2RMO A;  1OEB A;  2G6F X;  4P5N A;  3O8V A;  3GBQ A;  3PIO A;  1RAF B;  3EHR A;  2XDB A;  1GCP A;  1G3Y A;  1TG0 A;  2QEX A;  3HHT B;  2CZ0 B;  3OS0 A;  1I1J A;  3KUF A;  2M51 A;  1NEB A;  2VAS A;  2KVQ G;  2DJZ A;  5CIU A;  1YI2 T;  2NYS A;  3M4G A;  2CS7 A;  2JOY A;  3GNF B;  4KGZ B;  2P4T A;  4CRI A;  5KE3 A;  1CKB A;  1VQP T;  3QKJ A;  2J6K A;  3G1J A;  1VQ4 Q;  5I21 A;  4J9D A;  2GTJ A;  3OYL A;  4F04 B;  4FW1 A;  2JTM A;  3C0C A;  1NM7 A;  1KFZ A;  3BE3 A;  4ZTJ A;  2D8H A;  1U8R A;  1M90 R;  3CCS A;  1WJS A;  1ZX6 A;  2KYM A;  4IUV A;  3BY7 A;  2F1L A;  5LJ3 j;  5IN1 A;  3JCM J;  2AIR B;  5KE2 A;  4DBR A;  1KD1 C;  5CCA A;  4JJN K;  4BDY A;  2DEQ A;  1S72 A;  1D0Y A;  1KD1 U;  1G3W A;  1TOV A;  2LQN A;  4GBQ A;  3G4S A;  1UHF A;  4IUP A;  1U1T A;  3Q1J A;  3UT1 A;  4E7Z A;  3QXE B;  4C5E A;  1M2V B;  1WDX A;  4XK8 E;  1D0Z A;  3MCA B;  1GL5 A;  1H64 1;  3M9Q A;  1K9A A;  3J7A F;  4RMO A;  4JLG A;  2EPD A;  2ZPH B;  1SPK A;  1W70 A;  2QXF A;  1M1K R;  4M77 B;  3QG1 A;  2ROL A;  1VQ7 T;  2JS0 A;  2KMT A;  2L3S A;  4LN2 A;  2K5L A;  1OU8 A;  1YIT A;  1UHC A;  3LLR A;  5CKE A;  2KXD A;  2K4Y A;  2VVK A;  5FW9 A;  1UTI A;  1I81 A;  4ZGD B;  3M0Q A;  3H0I A;  1NYF A;  2RK2 A;  4FSS A;  4OF1 A;  1YIJ T;  2KK4 A;  2R5M A;  1IB8 A;  2CKK A;  4ANJ A;  4LD9 K;  5I2M A;  2O88 A;  3X28 B;  1Y57 A;  2J06 A;  1UDL A;  4E7I A;  1BB9 A;  4Y91 A;  2DL3 A;  1Q7Y U;  3UPU A;  2LNV A;  5GAM g;  2OX7 A;  3HRT A;  1SSH A;  2MMP A;  2R5A A;  1YJ9 A;  2H3J A;  5DLQ E;  1ARK A;  2LX7 A;  4IUR A;  5KYU B;  1YI2 A;  1WXB A;  1VQP A;  5L8R E;  3JCM c;  4PJO D;  4HT9 A;  3DKM A;  4F7U F;  3REA B;  2OTL T;  1W2B P;  1C1A A;  3CCR Q;  2HSP A;  2QYZ A;  2EW3 A;  2J6O A;  2DBK A;  3PT9 A;  4C8Q C;  4ORZ A;  2KYB A;  1K0X A;  4GY5 A;  3OYY A;  1MMD A;  5DLO A;  1H8K A;  2DYI A;  4FYV B;  4XTX A;  4BUG A;  5GMK e;  2CUB A;  2D0Q B;  3OMC A;  3I55 T;  3EGD A;  1UJY A;  2X9H A;  3CME T;  3JCM b;  3MHX A;  1PWT A;  4WCI A;  5FU6 C;  1M3B A;  4BY6 C;  2FZG B;  3VYH B;  5I22 A;  1YWO A;  3TQ7 P;  2F2X A;  1EFN A;  1ZA2 B;  1N9R A;  2RJF A;  2KBT A;  3OYK A;  1VQ5 T;  2MAM A;  4Q5W A;  2KSS A;  4V2S A;  2X4J A;  2GQI A;  3PGG A;  3FRN A;  2CZ1 B;  5KYW B;  1QP3 A;  4PJN A;  2ZPG B;  3JSC A;  1WNL A;  2CP0 A;  2FZK B;  4AMC A;  1X6G A;  1NYG A;  1VQ7 A;  4MZP A;  4PJO A;  3OY9 A;  4ZGE B;  1QCO A;  3CME Q;  1LOJ A;  1SRM A;  2JW4 A;  1IGQ A;  2F69 A;  1TXQ A;  2XG8 D;  1H92 A;  1QCF A;  4EMK C;  4A4E A;  3C4S A;  3CCJ Q;  3X26 B;  4LD6 A;  2MI6 A;  5GAM e;  2GNC A;  4JS5 A;  2RI5 A;  2A36 A;  2RA2 A;  1I0C A;  2LQK A;  2E10 A;  2ZAE A;  2JMA A;  2JZ2 A;  2C0T A;  1YJN Q;  1UJ0 A;  4KT0 E;  3G6E Q;  4D6W A;  3UDC A;  3JCM W;  5LJ5 f;  1PKS A;  3EG9 A;  1X75 C;  4OP0 A;  4EMH A;  2QQ9 A;  1HYO A;  2DF6 A;  2YT6 A;  4XU3 A;  3LWH A;  1M90 U;  2KQW A;  2A7Y A;  1SKU B;  2XU8 A;  4EDU A;  1VQM Q;  1M2O A;  3VUZ A;  1YBY A;  3HP9 A;  3CC4 T;  3MEU A;  2DM1 A;  2LVM A;  1QVF A;  2OTL A;  2MIO A;  5KYY A;  2DLP A;  2Y90 A;  3P8B B;  1GXI E;  5IHI A;  1GCQ A;  2XMF A;  4M7A F;  1ABO A;  3M4Y A;  3MO8 A;  1ZSG A;  4ZTF A;  1KHC A;  1Q82 C;  2DO3 A;  1W2B S;  2VXF A;  2WSC E;  3VS2 A;  2RPN A;  2FPE A;  5LJ5 d;  1Q82 U;  1AZE A;  3MP8 A;  3CCM A;  5AT1 B;  5GAN d;  4A54 A;  5GAO r;  1VQ6 T;  3OYB A;  3OW2 P;  1QVG A;  3RMQ A;  3CCQ T;  2K3B A;  2M16 A;  3P8D A;  5I2S A;  4BDZ A;  1M1K U;  2H3E B;  2P0P A;  1U5S A;  4J6Y A;  3SDZ A;  2C0O A;  3TEE A;  3CCE A;  1TS9 A;  2VUB A;  2LP5 A;  2JN0 A;  5IAY A;  2L3P A;  1ZA1 B;  4M77 C;  1P92 A;  1F1B B;  2XDD A;  2XD0 A;  3EAE A;  3PIP A;  2DKG A;  3I5S A;  3EG0 A;  4J6X A;  2E1H A;  5KH6 A;  4B9W A;  1SEM A;  2FO0 A;  2JNG A;  1D3B B;  4HA8 A;  1FMW A;  4M7A D;  1OPK A;  4BI4 A;  1VQ6 Q;  2DL4 A;  3QSU A;  3CCV T;  2OTJ T;  2EQJ A;  2RHX A;  2YHT A;  1PRL C;  3FJP A;  4FIB A;  2VB6 A;  2X51 A;  4QVZ A;  1D1B A;  5A0L A;  2KE9 A;  1QVP A;  1UGV A;  2DIG A;  4FYW B;  1G2B A;  4C0F A;  1H3Z A;  2R58 A;  2KRO A;  1UG1 A;  2LTO A;  3CC2 A;  4LDW A;  4J9G A;  1D09 B;  3QWY A;  4FYY B;  4LDU A;  2NUT A;  1VQK Q;  2EKO A;  2ZPI B;  3L2Z A;  1K8A R;  1RAC B;  5LL6 S;  3N5B B;  8AT1 B;  3CCV Q;  2OTJ Q;  4C92 D;  3VS3 A;  5HKC A;  1AT1 B;  2LX9 A;  1SF9 A;  2PVG B;  5J39 A;  5D6W A;  3OW2 A;  4XU1 A;  4PJJ A;  3KXT A;  1WIE A;  2CUD A;  1KG1 A;  1G83 A;  2PVD B;  4M7A A;  2XID A;  3VS1 A;  1Y71 A;  2ZPF B;  3M5A A;  1V1C A;  4E7K A;  2YUQ A;  2EKH A;  4M7D F;  1WHL A;  3JB9 H;  4RCB A;  4XTY A;  2BZ8 A;  3CBP A;  4BE1 A;  3GNG A;  2GBQ A;  1IRX A;  3NTK A;  2KT8 A;  1QWF A;  1WHK A;  3CCQ A;  3JAM E; 
#chains in the Genus database with same CATH homology
 2Z0W A;  2E3H A;  2COZ A;  3TQ7 P;  1WHG A;  2HQH A;  1TXQ A;  2MPX C;  3E2U A;  1WHL A;  2M02 A;  2HKQ B;  2CP6 A;  1WHM A;  1TOV A;  2HL5 C;  2CP7 A;  2CP2 A;  2COW A;  2CP5 A;  2E4H A;  2E3I A;  1WHJ A;  1IXD A;  2HKN A;  2CP3 A;  3RDV A;  1WHH A;  2HL3 A;  2QK0 A;  1LPL A;  4B6M A;  2CP0 A;  1WHK A;  2COY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...