2OAUA

Mechanosensitive channel of small conductance (mscs)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
YAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Small-conductance mechanosensitive channel
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2oauA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oauA03
1Q8BA 2FTRA 2K7KA 2XMTA 2GA7A 2LXFA 5F0WA 2RILA 1FE4A 2JDJA 4HL9A 1R6YA 1YG0A 3WDOA 3KKFA 3F44A 2RK1A 5B0CA 1LQ9A 1Y0HA 2BYCA 2BUNA 3BM7A 1KVJA 1ULRA 4HH1A 2AJ0A 2RMLA 5A6WA 2XMJA 2OAUA 1GXUA 2QLWA 2VH7A 3IWXA 1N5SA 2IYGA 2GO8A 2L3MA 2RSQA 4HH0A 1TR0A 2HQIA 5B0EA 4Y2MA 4DN9A 3BDEA 2QIFA 1CPZA 2K7JA 4Q2LA 2KT2A 2BJEA 3TOQA 2VV5A 3MCSA 1P6TA 1Y3JA 4DPOA 2OMOA 4A48A 2N4CA 1P8GA 2OFHX 2GQVA 2Q3PA 2AP6A 1TUVA 2FB0A 3FMBA 1MWZA 1Y3KA 2K1RB 1FESA 1IUJA 2XMKA 2LDIA 2AW0A 1JWWA 1KVIA 4A4JA 2ACYA 2ASYA 1OQ6A 3HHLC 2N7YA 2FIUA 2G9OA 2OFGX 2QLXA 4YDXA 3DCAA 3VTIA 2ROEA 1SB6A 1Q4RA 2N4DA 2XMVA 1VQSA 1YJUA 1N5VA 1FEEA 2CRLA 5B0GA 4FNHA 5T7LA 2OD6A 1VQYA 1SQEA 2OD4A 5B0DA 1OPZA 1Q8LA 2W4PA 1KQKA 5B08A 1AFJA 3TNVA 3UDCA 4A46A 2W4CA 2HIQA 5F0UA 2IYIA 3GZ7A 1AW0A 3LGMA 1FVSA 2RK2A 2ZDOA 2RH2A 2XMUA 4OJ1A 1U7LA 5K9FA 1WD6A 1AFIA 2KT3A 2EW9A 2IFXA 3I9ZA 1S6UA 2BBEA 1TZ0A 3BF4A 3E8OA 2KYZA 4HI2A 4U9RA 1K0VA 4QOTA 1V3ZA 3QMQA 1X8DA 3FGVA 2HLUA 2PGCA 3IWLA 1FE0A 2RU9A 1N5TA 4Y2KA 1Q53A 2HFOA 3LGNA 4OJ3A 5B0BA 1OQ3A 1YJVA 1RJJA 1GXTA 3MZIA 3CJKB 1APSA 2BJDA 1XBWA 1TL5A 1JK9B 1FD8A 1OSDA 4NPOA 3KNGA 2GGPA 2AJ1A 5T7LB 1Y9OA 2LQ9A 3FRYA 5KAKA 5B09A 2P4TA 3HHLA 2GV1A 3QGPA 2PD1A 1S6OA 4Q2MA 2OKQA 4A47A 3BGUA 2QYCA 1CC8A 2K2PA 2LQBA 2GFFA 4ZA1A 5B0AA 3HX9A 1VIEA 3T9NA 1YJRA 4OIXA 2HLTA 1MWYA 2OP5A 3HHLD 4ZOSA 4FNIA 1W2IA 3KG0A 1SI9A 3DXSX 2FHMA 2GCFA 2XMWA 3BN7A 4DL0C 4HI1A 1N5QA 1QUPA 3LO3A 3HDSA 3KG1A 3HF5A 3HFKA 1X0PA 3HHLB 5A6PA 4NL5A 1YJTA 2ROPA 2KKHA 1CC7A 3SFMA 4OJHA 3TRGA 3CJKA 3BB5A 1TL4A 1FVQA 2XMMA 4OJGA 2ROGA 4EFAC 2K1RA 2GGPB 3BR8A 3K7RA 1YRXA 2HFNA 2W4DA 1URRA 4Y2IA 1VIFA 4YEAA 5IXUA 5B0FA 2ZDPA 1X7VA 4F67A
chains in the Genus database with same CATH superfamily
1HNZF 3M4GA 2G0IA 1U1TA 3HVTA 2P0QA 4PWDA 1KVJA 2DR7A 3L95X 1Y5LB 2DXCA 2OAUA 3D3BJ 3TYTA 3J7ZT 1P92A 4WK3A 4I67A 1OYXA 4HT5A 1ZSZC 3FSXA 1KQFB 5G0RA 2K3KA 4PG8A 2K1RB 3M5AA 1X5PA 1AWOA 4HCBA 3QXEB 4ZN3A 1HQ2A 2RJEA 4J9FA 2YWHA 2EQKA 2HHUA 2J8AA 2LX7A 1BK2A 2B4UA 1VK8A 3MEDB 3KJVB 2V2ZA 5ETLA 3OYCA 2Z2YB 3UN2A 5CKEA 2RDDA 2F3JA 1VQPS 1V3ZA 4LF9F 3Q8PB 3AAWB 3THPA 3R5GA 1OQ3A 4DWIA 1KNZA 1X75C 4HVUA 5GMKa 5IT4A 1GT8A 3OYBA 2AHOB 1LXNA 3BDUA 2OKQA 4Z7YA 2DH9A 1NSPA 2JZ2A 2R7UA 2K2MA 2LU1A 3CCVA 2CPYA 4ZVPB 2VJVA 3MP1A 4QU7A 4B3MF 4RWWA 1GCPA 1RGVA 4HCZA 2MKYA 3SEOA 1YN8A 2MPXC 4LSNB 2XGPA 2DPJA 2B9YA 4CM0A 5F9NA 2CNNB 4B3SF 4IG0A 1QD1A 3Q83A 1N6QA 3TQ1A 3OYNA 2HW3A 1HW9A 1KC8C 1WHGA 2XI2A 3EVWA 3VV0A 4L5GA 3MM5A 2KAFA 1BQXA 2KU7A 2HNYA 2FYKA 4PXCA 4OVAA 4CLUA 2YRCA 3I0SB 2YPYA 1OX8A 4K4UA 5CKFA 1W1FA 4A8SA 1IJEB 1JQQA 2FG0A 2BJ7A 2J6SA 1GFWB 2M8HA 1QDUB 4Q0BA 1SVDA 2CT3A 4C92E 4J9QA 2MQMA 2KDOA 4OZ1A 2EJFA 1UGSB 1RHRB 2VC1A 3K5LA 3NWGA 3IGVA 1U06A 2FPDA 2LEBA 2UVUA 3NBPB 5THWA 1M90T 4C5GA 3V6DB 2LP5A 2CPXA 2H54B 4U7UK 1GL5A 1HLWA 1Q7YC 3RJMB 2CPDA 1TL5A 3QZ9B 4RTYA 4DFJA 5CR2A 1J5OA 4F3OA 1IO6A 2P6SA 4C9DA 4KBIA 2GNCA 2DNYA 1X4DA 3W61A 1G4CA 2WK4A 2YY3A 5A0YA 1DLOB 5DLQE 2DA9A 4RW6A 4BDYA 4NZ7A 4RWXA 1QP3A 4YEAA 4J8OA 3WX4A 2J9CA 5K8MA 1WQ7A 1RT4B 1SV5B 4RCCA 3SDEB 1WKLA 2HFUA 2OIHA 1WG1A 1UZDA 1AWXA 5FRNA 4EBDA 5HATA 2C2MB 1YVFA 4EIKA 1K8AC 1YIJA 5C24A 4DEXA 1QKXA 4HXJA 3REAB 3TX8A 1SH2A 3OFHA 1XIQA 1LVKA 3LH0A 3OR1A 4JRQA 2EYXA 2AKWB 4PG5A 3HRUA 2W4PA 1RP5A 5B08A 4RTTA 2JX2A 2CQPA 3B4MA 2MY7A 1NNDA 3GJSB 1T03B 4RLEA 4ECQA 2D3OR 2K5IA 3HFZB 4DG1A 5KFDA 2HDAA 3BY7A 3TEEA 3MMAB 1E6GA 4CRIA 1SL0A 4M1KA 1FDDA 4N56A 3I31A 3U27A 4MZTA 3W63A 1FEHA 3C6TB 3OL8A 1H7XA 5EC7A 3U1NA 4DUZJ 4B9SA 3N9UC 3KLHB 1RI0A 2DGXA 1QWFA 3SMZA 4X2BA 4Z89A 3BN7A 2J0XA 2EFPA 4Y91A 1IKWB 1IRXA 1WC1A 2HVEA 1U1KA 1WKJA 4ZN1A 3CCQQ 2KB2A 3OSPA 1QCFA 3URGA 2JNGA 1GMWD 1HWJA 5HBMB 1LPLA 3DGPA 1BC6A 5B0CA 3QSIA 1YSJA 3R7NB 1X9WA 4H4KA 2X1FA 2QEXS 1Y0MA 3G71T 1FYNA 3OVSA 1S99A 4CLSA 2DVJA 2RKIB 3A3NB 3MEVA 4MFBB 2CIMA 1D0YA 4F7UG 2B9XA 3VZHA 3CCVT 3GP9A 2VOPA 4M95A 4BDPA 1VQ8T 4EMDA 1VQ4T 1M1GA 1FKPB 4K4ZA 2KL8A 4XK8C 3ETOA 3FCHA 1ZTWA 2MWPA 4E8UA 4B3SJ 1WDXA 1UFKA 3VVUA 2EKHA 5J2QA 3Q0AA 2KFZA 3PCOB 3I82A 2B7CB 2DY9A 2MYFA 2BUDA 5J1PA 4JI3F 2VGMA 1M0SA 3EHRA 3OA6A 3RB6A 4F7UA 1YJNT 1UL3A 4ZPWR 2DL4A 3PYDA 2JC0A 2RHYA 2F5TX 2BQRA 1KEKA 3G4SQ 2ZPIB 2FHMA 1JXLA 4HI1A 4CO1A 2ROPA 3IM9A 5F41A 1RA6A 4LF9J 2AX0A 3TO8A 5AE3A 3NOCA 2C2ZB 1X7VA 2FVCA 3I56Q 2O31A 5E5NA 4HCCA 1HWIA 2NXNA 3OYGA 2HAIA 4C2MA 1UVMA 3W8GA 3TREA 2H51B 4YR3A 4E7LA 1TKZA 4K4WA 3DM2A 4URSA 4CDIA 2AHJB 5HMWA 4A8WA 1VQ9A 4B9UA 4KYZA 4CCHA 3KK3A 2W2QP 2ZGWA 1K1QA 2G9OA 4OI6A 3RKXA 3E3XA 4RW4A 1P27B 4JI1F 2ZD1B 5KH6A 1Z9QA 4FNHA 3M4YA 5IH2A 3VQTA 2ILYA 3VS7A 1D9DA 2DNHA 2B9EA 2HIQA 2MB0B 2VA2A 1BQNA 2ZC4A 1HNZJ 1RTHB 1YJWS 3D0IE 1C4CA 5HMZA 2JW4A 5CH7B 5KFUA 2ILZA 1VQNT 3RNJA 3PYEA 4QIFA 1NYFA 2B5JA 3IWLA 2EKNA 3NAHA 5L8RC 2CWKA 4E7ZA 5HMXA 3LP0B 5KG7A 4GVLA 3OUYA 2UZAA 2ZE2A 1DLOA 4OLPA 4BY6C 1RWOB 4A4HA 2YNFA 1NK6A 2KXFA 1BU1A 1ZSZA 1BYMA 1SI9A 2DH8A 4LSZB 3BDLA 4DV3J 4DCOB 1ZM9A 1YITT 4TYAA 3JQMA 3G7ZA 4X84A 5IHKA 3AH6A 1JLCA 1QW1A 2CJBA 2RN8A 3A8LB 5C24B 1BQMA 4USHA 1XJWB 3F73A 1BBZA 4C98A 4C8QA 4C0GA 1SRMA 3QZ5B 2MIOA 4MH8A 2VYTA 3HTRA 4DPOA 2C1EB 4I7FA 2BKNA 1FRKA 2WW4A 4YP3A 3FLGA 1KBRA 4CM2A 3MUTP 2OTJA 3PX4A 4DV7J 3CCUQ 2J06A 1WGSA 5HK3A 1P1LA 1RTIB 1VQ5A 1S9EB 4WIIA 2Q6BA 4NOHA 2RB6A 5KFSA 5GANd 1Y4ZB 1XN9A 4ZLPA 3CO9A 1HBOB 1GMUA 3A8MB 1KK7A 4K2JA 2W2PP 1WX6A 1N8RR 3OPKA 3ZBDA 4M5HA 2V8VA 4ELVA 3AXKA 1TTHB 3CD7A 3IM8A 1I94F 2GAHC 4KFBB 4DQSA 1AZGB 5D4PA 2MKKA 1S0NA 4DPTA 2AGOA 2PFFB 3SCKE 2JC1A 4UUXA 3OS2A 4UOGA 4DV6J 5HP1B 3HKWA 1J27A 4DR7F 2GF7A 4GO7X 1N5QA 1QUPA 3QSUA 3T41A 4NXMJ 4NRTA 3FSIA 3CCVQ 3C6UA 1R8OB 3PRBA 3DB3A 4ZCIA 4QBUA 4ICLA 4M78F 1Q86R 2AZ3A 1F3FA 4V1Ak 4DR1F 1MMGA 2K57A 1CS4A 4AE5A 3D1OA 4OYZA 1MMAA 1VQOA 3EICA 1N32F 4ZVSB 1YHQS 1K9MR 4I6WA 4M7DG 1H3ZA 4ZLLA 5IC6B 2VFUA 2C28A 1TSFA 1LW2B 2KG0A 2VPXB 2DPIA 3Q89A 1PAUB 2Q6CA 4IUFA 4FYDA 2PU9B 1HR0J 3PTWA 4BD3A 1T02A 5J2PA 1JLEB 1EX4A 1W26A 3L2QA 2IVYA 3SV3A 2HK2A 4F3QA 3JAME 4WBFA 2KXNB 4AYBD 2B7BB 5ETMA 1ZX6A 3NBPA 5CABA 4USVA 2RB7A 4JDSA 3PJ9A 3QPHA 4N0AA 2GFFA 3ISNC 5C42A 1N33F 3T9NA 1HFEL 1TKTB 1FNOA 2DVIA 3TQEA 2BTTA 1RT7A 4I68A 1NEBA 2HNIA 4GY5A 4WFAQ 4DL2A 3R3TA 5HP1A 3AB2B 4TU8A 1PIEA 3I55S 4J9NA 4OZLA 4X65J 5JVGQ 3DRSA 3C46A 3BO3A 1M5HA 3BDPA 2GBQA 4F4XA 4XTUA 4DN9A 2RQMA 2H1YA 3O6QA 2KT2A 3QT7A 3G82B 3CC4S 2CUYA 1WXBA 3X20B 2JLFA 3IWNC 3DLEA 3PACA 2VFVA 1N8RC 5KFCA 2QJ3A 1N5VA 2FVRA 3M0UA 4DL7A 2B5JB 1CSKA 4JZ3A 3WXMB 3FEXB 4MIAA 4XTVA 2OD4A 3OYJA 1UJ5A 4LIWA 3UDCA 1RYSA 2DGTA 2GQIA 4GC7A 3VS3A 1S10A 3CCTA 2ZHAA 2EWNA 5E3QA 1W2BP 3DOMA 4LR9A 4ES1A 1OI1A 5I42B 1F5CA 4EZ9A 4O0IA 2N82B 5DDRC 1S57A 3M7VA 2HLUA 2HS3A 2ZBQA 2O01C 3CCZA 1RACB 1NG2A 2P9CA 5KG0A 3HFNA 1EETB 2W9CB 3BGOP 4KT0C 3EVOA 1HI1A 2K2PA 1Q82T 1V76A 1UVIA 1S1VA 3PYFA 2QFJA 4J9VA 3RAXA 2DR8A 4E7KA 2RM4A 4FPRA 4DR2J 1OWXA 2EFNA 2LJ0A 5HVHA 2VBYA 3CDBA 4ZJOA 1IKYA 2ROGA 4XTTA 4XO0A 3TVYA 1HMVA 2A28A 3R6GB 3TSZA 3L2ZA 4PJOA 3R6LB 4ZJLA 3MECB 1TVRA 4ID5B 2FLPA 2QMWA 2VICA 3TOQA 4A48A 3I87A 1XNRF 1ARKA 2C06A 4FIBA 2FB0A 5DZ6A 4RG8A 3CPWP 2D8HA 1RT3A 3QHSA 2K9GA 1V3RA 2LVWA 2QV6A 2MPUA 2OTLA 1U2FA 3N5BB 2ZDOA 1B99A 4ELYC 2WACA 2MKHA 3US5A 3BBFA 3MPDA 2XDPA 3FEOA 2FHJA 1V6HA 4C6AA 4XIUA 4ECSA 2AIRB 2ZITA 4CNYA 3ASKA 1K0VA 3K58A 3HP9A 1RSCA 3QJJA 3C3LA 3BYPA 1IHWA 2HKNA 1D3WA 3KNGA 2LCLA 3NXZA 1Y9OA 4M75A 4ILRA 3OYLA 4ZA1A 4LMZA 5LJ3h 2D1CA 2WZ1A 1JJ2R 3KDNA 4I69A 5IWAF 3A8OB 4P2MA 2CXEA 4OQJA 5GAN5 3MR6A 2EGCA 2CPFA 4LDXA 1S9FA 4LUEA 1UMJA 2YKQA 1SKUB 1VYTA 1ZETA 5J1EA 1U1OA 5KFIA 3EGZA 2JEFA 1XQIA 2IM1A 1AA1B 3PJXA 5J2NA 3F44A 4HH1A 3FJPA 3NMRA 3MWBA 2LCSA 2OELA 3PJWA 1FK9A 2G3RA 3Q8SB 1K76A 4DOWA 2ESWA 3Q1JA 2LKZA 1M90R 3SSQA 1LWXA 3BZQA 2ROEA 2BE2A 2CUBA 1M5PC 2M51A 5IXBA 1Q16B 1XR7A 3CVKA 1JMTA 3HSGA 1RXOB 5LL6S 1F2HA 2HGNA 3ZNUA 4J9HA 3L2WA 4O44A 5GADI 5KE2A 1WC5A 3DDIA 1U1SA 3WX8A 4M5KA 2KYZA 1KSWA 4IFVA 3JV3A 4LD6A 4ECVA 3CNQP 1VQ7A 4WCEQ 1H72C 1CKAA 2DEIA 3CJ4A 2EWHA 2WSFC 1AT1B 1FKAF 4FBUA 4DLGA 5FWCA 3MM6A 4PYAA 1L3KA 2VQEJ 3AD9C 1RTJA 3TJ8A 4B3TF 4G1QA 1P9YA 1WHJA 2QMXA 3OLAA 4C92A 3CDEA 4PK4A 1KQSP 2CH4A 1Y57A 3ICLA 1T9TA 2R8IA 1X69A 3CBMA 4LFAJ 2RF0A 1KHVA 1GTHA 3JSBA 3RBDA 1BCMA 2VVKA 1UWAA 4JI3J 1TUCA 2LJ3A 2DGQA 4ILMA 2Y90A 5M2RA 3SD4A 1NHKL 4IO1A 4NXNJ 2ENMA 4G1QB 2KFNA 2GGRA 2A3JA 1WTBA 2W10A 3ZEHA 3CDUA 4ZVEA 2OJ2A 1U1MA 3I56S 2KDSA 3OTDA 1EZZB 2V8PA 3CO0P 3P4UB 2GX8A 3EGVA 4Q5VA 1C1CA 1HNIA 1QVFR 2CP7A 3BN4A 2OTJQ 3IS9A 1QAXA 2BV3A 1TQLA 2PMWA 1RADB 4RTWA 2HBYB 4LRBA 4RW9A 5LJ5d 1TFYA 1RBOB 5KG6A 5KFQA 3M9OB 4PQAA 4GBQA 5F9LA 1N4LA 1X8DA 1N34J 1RT5A 4N4GA 4D3GA 3LTOA 2IRXA 5D77A 2PIIA 5LXYA 2HRYA 4P9SA 3EJMA 1WHKA 5GAOl 3TSWA 4F14A 3JCMJ 3MKDA 4JI5F 3PKMA 3ET6B 5A8WA 1KLMB 3G6VA 3MUVP 1D0XA 1OZ2A 1TKXA 4FNIA 2Y8YA 2NSCA 4OZ5A 2P6TA 3UE2A 5IT9Y 3H98A 5RUBA 4KT0E 1F9HA 1C0TA 3J7AF 3VAGA 2ZJQQ 3OXFA 2BIVA 1X9MA 3L2UA 1MROB 5G0RB 1CJTA 4PPDA 1PJ7A 2GA7A 1ZH5A 2PI5A 3LPEA 2DRKA 2YNIA 2RHIA 2EYZA 3G6YA 2X3WD 4M5GA 3CCJA 3DC2A 2HQIA 1B07A 1KDNA 2ZZTA 1MV0B 5CYMB 2EC0A 2JWNA 3P6YC 1P6TA 3IO1A 4FT2A 3GFYA 2AP6A 2IVWA 3SSSA 2EXUA 3PW0A 4F3MA 1FFGB 4K59A 3L1AA 1RTZA 5FJ4A 1NZAA 1CLFA 3AD8C 1DTQA 4ES3A 3HD2A 4DN0A 1R0BG 1D9AA 3LANA 3GIIA 2F9JA 5KFLA 1FVSA 3VAIA 3PEJA 3MEGA 3UPFA 2BBEA 4YB7A 3WIVA 1C4AA 2RE1A 1KHCA 3B54A 2E9ZA 3DHXA 2RMOA 2ZH7A 1X6GA 3JCMW 3A3OB 1FD8A 2J6KA 4DUYF 3JYTA 1NK9A 2X35A 3AT1B 1VQNA 4EEYA 3HT3A 4PFOA 3CCMT 1QCOA 1CJUA 1YZ7A 2EC2A 2HBPA 1Q86U 2XDDA 1UFFA 4BE0A 1TP7A 5IV4A 2R7RA 2PFDA 3SI8A 1HI0P 4OI0A 2ZKUA 3D6HB 2YKAA 4EMKA 2NQPA 5FDLA 2ED0A 1VQNS 2A6OA 4N5SA 3CJTA 2ZD1A 4M75G 3H8YA 2QZ8A 4LXCA 4M78D 3QIIA 1V1CA 2BYCA 1O9SA 2UUWA 1SQFA 2AJ0A 1SL2A 2DIGA 4H4OB 1FX4A 3W60A 2F40A 5FW9A 2F63A 3TP2A 1WJSA 2OMOA 5IM0A 2DX1A 2M88A 1HL6A 5I2SA 1OEBA 3UWNA 4UUWA 3CJRA 3CJ2A 5T7LA 2XGQA 4RCBA 2VZ9A 3PW4A 4ETZA 2V94A 4HHHA 3KLVA 2COWA 1WF1A 3KJFB 3MECA 1ZPVA 2K7AA 1NM2A 4ZPBA 2O2OA 1PD1A 2WSFE 2FJXA 4FW2A 3NMZC 4F4ZA 2XKOC 4J9SA 2XCPA 3NCQA 2XM3A 3T5KA 4L6V3 1HQEA 4KAIA 3PV8A 2AYEA 3UI3A 1NDKA 3GB0A 1IWAA 4DR2F 1REVB 2W7AA 3TA0A 2CADA 1JLFA 1SJ3P 2FZKB 5D0EA 4PJNA 2VHGA 3QWPA 1N6AA 2OO4A 2O01E 1WC0A 2PA3A 3VAKA 5HK4A 1FTCA 2PSZA 4NOYA 4F7UB 3OSNA 4BWJA 2E5KA 4NYOA 1SJRA 2V8IA 4R56A 2DGSA 2CPEA 4Y6IA 1HHQA 3J7Z5 1PC0A 4RKUE 5EGYA 2HQDA 1LK5A 3VCDA 3CC4Q 3KLEA 2ASLA 2I0XA 1F3VA 1IBKF 2U1AA 3D7SB 3OL6A 4X4TA 4USMA 4DV0J 2B56A 4EMKB 4ANDA 2FPEA 1TXQA 4PABA 1SQGA 1YI2A 3HHLC 4D8KA 4R5PA 4IG3A 2E65A 3M8QB 1SEMA 1KFSA 4RNFA 2H5EA 4FF3A 1X27A 3JTPA 4IUTA 1VQ9Q 2PDAA 2W4CA 1VQ6S 3ITHA 1ACMB 3V2UC 2ZH1A 1U49A 1ZA2B 3K8WA 1RABB 3EFOB 4MMKA 4DSKA 4JRIA 5FIIA 1YI2S 3KLHA 4D8DA 2XY5A 1T9WA 3J81j 2KVQG 3QYHB 2V2VA 2P4TA 3VUBA 1JLGA 4J9EA 4I56A 1GK8A 4LVOP 4QVDA 1LW0A 2RD1A 4M75C 2RQ4A 2QLFB 1JLBB 4JI7J 4QWDA 1RE1B 4YR0A 2RI5A 3S3MA 5HK0A 1UJ0A 2DXUA 4IRDA 1NLOC 2G2YA 5SUHA 1L3VA 3C4SA 4BWMA 1URRA 1NKEA 4BACA 1O51A 5F0WA 2C0OA 1VQKS 4CT9A 4CC2A 5DG8A 2C2EA 2EYWA 1Q7YT 1R0CB 1FTRA 2VUGA 1RI7A 4MK7A 4IR9A 2YUNA 2VUBA 2ZWPA 5GADU 3AB4B 1WZOA 2AW0A 4M5LA 5M9OA 1UCNA 3CJ0A 4YDXA 1PYSB 3DKDA 2CP2A 5KYXB 1YJUA 1JLAB 2DL5A 5B0GA 1RUSA 1WHVA 5C2GA 3DYAB 1UTAA 4C8LA 4C3MA 1KQSS 1N48A 2O4XA 2F1FA 2VBXA 3GWCA 1PC4A 2R7VA 1WHHA 3CW2C 4XAXB 3BBCA 1UW9A 3M0SA 1FDAA 1CJUB 1RTIA 2R7OA 4EZ6A 3H0PA 2CDRB 2XS5A 3EWGA 2CP0A 1ZAXA 3DXBA 4YN3B 5I22A 2X1BA 4LFCF 4MIWA 1ZAWA 3RR6A 2MSTA 2CSIA 1Y96A 1B7FA 2KRMA 5JMNA 4RTZA 1Z9ZA 1YFNA 1WI8A 3NS7B 1CULB 2XNQA 2CSQA 2DTJA 3L42A 1Q86T 1KIKA 4DMZA 4L72B 5F8HA 4K5SA 3OVBA 3H7HB 5CIUA 1E6VA 2GMHA 1X43A 2RILA 1T94A 2DR5A 2QG9B 2GMJA 1AUDA 5A0YB 5LT5A 4OMQA 3KOAA 4ZP9A 4PXDA 5HQMA 1FWLA 1OJ4A 1I5LA 3OTEA 3HL8A 1NBEB 4XTYA 4NX9A 2XD0A 2VPYB 1LOUA 3C2PA 2MZSA 4QPTA 3M2VB 4CC3A 2DGOA 5FROA 4X64J 2VG5A 4R0KA 3QJPA 4C0HA 2EK1A 5HBMA 4H54A 1SJ1A 3OHBA 5HKCA 4DL4A 2Z57B 2IAJA 1YJ9T 4G3IA 4L6V5 4CC4B 5JUMA 2IYIA 3V4IA 1A6LA 1JQGA 1WA7A 5LMUJ 1TMJA 1HSQA 4EBEA 5A2QE 4PL6A 2EEYA 4DV3F 1K8AU 4D3HA 2IVMA 3I32A 4OFZA 4ZVQB 2EJ9A 4PG6A 4JS4A 3MD1A 2KXCA 2G4BA 1DZ5A 3CCUA 1T95A 3QZ7A 5IT9U 3G86A 4OZNA 3MM9B 2DKOB 2PEHA 1T0TV 2P2CB 4E7IA 4UQTA 1FA0A 3R9LA 1QLYA 1GX5A 1M3CA 3MPUB 3T1HF 4NLTA 5BJRA 2PMHA 4AL6A 2DE0X 2E3HA 3ILJA 3GIKA 3JSMA 5L1IA 5D6WA 1L3SA 4KH0B 1YITS 3JCMh 1LQ9A 5A6WA 2YKOA 2HVZA 2F2XA 4KE5A 4HVVA 3ZZRA 1U0HA 1TMMA 1LK7A 3K5MA 1WJQA 3V6JA 4UY8T 4DPXA 1C6VX 4X4UA 1HBOA 4X4SA 1VUBA 3HSJA 3N79A 3JAMY 2NUPA 1NK8A 4YOEA 2LFVA 1F0XA 4B3OA 1WLPB 3MF5A 1U8WA 5H1SV 1FJ7A 2JL9A 4C8QG 2F2VA 2RJDA 1IREB 3LYIA 4J9IA 2WBRA 2DGWA 1VYUA 1C1BA 2OPQB 1M2VA 3BGFA 4ED4A 1OULA 4CH1A 4FF2A 4ED6A 3V6HA 4H4MB 2V8JA 4ZCLA 2I0NA 1M9SA 3RG6A 2OPSA 1VQ4A 3CD5A 1U2CA 1S4EA 3BBBA 1KC8U 2YPZA 3W62A 3VR1A 2KNBB 3SCIE 2QA1A 3QWYA 2ZBRA 3C12A 4J9BA 4DPYA 2YNGA 1TH7A 2R57A 4QT7A 1ZHIA 1O0PA 3CMES 3EXYA 2RQCA 1NB2A 3DLBA 1IR0A 2BZ2A 2A37A 1PGZA 2A18A 2J0SD 3O5ZA 2BM0A 3KHHA 3OBIA 4JBCA 3J7YU 3MCSA 5CVIA 5E41A 1DY3A 3B82A 2A7YA 2M2BA 3GV7B 3IS9B 3D66A 1BIBA 3TRGA 1M4ZA 1OQ6A 2BRKA 1HR0F 1RLDA 4LNPA 1EX8A 1MMNA 3DLJA 2JXBA 4CI0C 1N27A 5J2NB 2A36A 5ETKA 5GAN6 3MMAA 3D0HE 4OYBA 4DR1J 1LW0B 1SC4B 7FDRA 3VHQA 4NLPA 3ENVA 2RQRA 4A4EA 3RYLA 4RUHA 4ZHRA 2YH1A 1FWPA 4CWBA 4NXMF 3TJ9A 3CDWA 2DFUA 2IJRA 5DJBA 4N4IA 3MR5A 2QA4G 2KBTA 3NG8A 3T9ZA 1TK5A 4NL2A 4K8RA 1IKXB 2CVEA 4AXJA 3CTRA 3SSRA 4DV6F 3BO4A 1URNA 3CB4A 5IN1A 3BKFA 2YUOA 5ETRA 4B3RF 2UUBJ 2R9LA 4PJJA 2HFVA 1T9VA 3V8LA 4CTAA 5HQLA 1GRIA 2HHXA 4WPAA 2MZ1A 3AOBA 1IQTA 3QBYA 1G2EA 2D69A 3BKUA 3CULA 4MZMA 1NJYA 3G82A 3H5SA 2VD3A 1Q8BA 3HPOA 2BW2A 5CAIA 3OYAA 3G6ES 1KN6A 2A1BA 3W2WA 1WHXA 4F8RA 1JXMA 5KYYA 9ATCB 2LNVA 5ECAA 3CXCR 4M78C 1CSJA 1JJHA 4ANEA 3ZTRA 2ZZNA 4MKVA 2OPRB 2E3IA 4IH5A 2FVPA 4Y28E 4A4JA 5D4NA 3LWIA 2DXFA 1FFWB 1VQ9S 4OYAA 4N77A 2AX1A 4ED3A 2R42A 2F5KA 2V5HG 3F41A 4OZ3A 1ZYQA 3DLGA 5GAN7 2NSBA 4TKTA 2W9CA 2A2DA 2OPRA 4J9MA 5GAN2 3QIPB 4BI8B 1KD1R 1B34B 5D6XA 2RQKA 2VXFA 1OIAA 3MR3A 2Y1RI 4LT6A 1GXTA 4WF9Q 4RU9A 3KWMA 4DL5A 1J5EJ 2UUCJ 2VASA 2MKJA 3LW5E 4M7DE 2LYVA 1FERA 1WORA 1F6TA 3KMQA 3AQOA 1KFZA 3JXOA 3W7BA 3CMQA 3UNYA 2CREA 1RKJA 2YKNB 2C22A 2LXUA 4M78A 3TUIC 3U7JA 3VGSA 1JJ2A 4DV2J 3NTHA 3M9MB 5GVQA 5M2UA 5HQ8A 1IN0A 2W8LA 4NZ0A 3FBBA 2HNZA 2V34A 5LJ3Y 2QA4A 2BZYA 3GG1A 5J3BA 3MEWA 1TL1A 3OTOF 2HMIB 1D3BB 2IG0A 4F36A 3X24B 5LJ5e 2EVZA 1YBUA 4C0BA 1RT6B 4HT8A 2JM9A 2YHTA 4XU1A 3TVTA 1FF2A 1M1FA 1OPIA 4NYZA 1VQKT 3GF5A 2COYA 5DY9A 1IHVA 3G9CA 1WACA 4J83A 4K4VA 5GMKm 3C66A 4QIVA 2XS7A 1K44A 4PKDB 4GKKJ 1LXJA 2HHTA 3CD6Q 2FJAB 2RQWA 1D09B 4TXSA 4M77F 2Z58B 3HSBA 5DG9A 1GFDA 4LRDA 1TAQA 2E6NA 1V9OA 4C3KA 1HI8A 4HCKA 3S01A 3UD3P 1WSVA 3I9ZA 4H4MA 1TOVA 3ENQA 5DO2A 2DO4A 5KFZA 3QT6A 5HVGA 4WP8A 1VC0A 1MG7A 4A63B 6FD1A 4M7DF 4O3PA 1E6YB 5B09A 1G3YA 1SHFA 4RTXA 4ZP6A 4QIWD 4PLLA 1HIYA 3LP1B 4OZ0A 4C7QA 2JVVA 2GCXA 2BA9A 1QMCA 3DOMB 4H4OA 1NHVA 4ZOSA 2DHGA 2JLGA 5I42A 3RBEA 3A3PB 5A6PA 4KGZB 2CP5A 3CJKA 4DI6A 3G71Q 3HHKA 4RPFA 2FHJD 2F9DA 2K3BA 4QPXA 4C5EA 4F7UE 1NLPC 5CQXA 4CNZA 3PR5B 4RMOA 4EYHB 2MY8A 2E6ZA 4BE1A 2YRDA 1FRJA 1SPBP 2DR6A 1CPZA 3KLFB 1MROA 4F50A 4IUPA 4NYPA 3W2VB 1OY6A 1HJDA 3DRXA 5KFJA 1HQEB 3UR0A 4ZVHA 4M77E 2ASYA 2DHXA 1VQOS 4RUCA 4NCAA 3TA2A 4EDUA 3BR9A 1KG1A 4M7DA 2GIRA 2R7WA 2LXIA 1IZ6A 3BSCA 1VJQA 3CJ3A 3SZ2A 2CA9A 3GV5B 4IIOA 2XY6A 2J5AA 1CKBA 1YI2Q 2ZUGA 2CJYB 1S6PA 3AY0A 2VGNA 4Y2AA 3NL0A 1X6OA 2DKGA 1Q53A 2C3YA 2D9TA 1T9UA 1NJIU 1TUWA 2KGTA 2XO6A 5H9FK 1FD2A 3H4BA 4A47A 1IKVA 2V1RA 5CHCB 3BEGB 2AKLA 1BCOA 4YTLA 5L23A 3A8EA 2DK2A 1X4CA 2L2PA 4HLBA 2HNYB 4QIEA 3AOCA 1RT2A 1UHCA 1WDDA 2JM8A 3HHLB 1NRKA 4MTPA 2FLLA 4AFFA 2H4YB 2LZ6B 1MNDA 2EYQA 4YB5A 1UEVA 2FGCA 4G1IA 1U1PA 2J7IA 2HFSA 2XU8A 1WC6A 2HL5C 1AEYA 4WCIA 5C5JA 2GIQA 4K4YA 2RQVA 2CNKB 2C0IA 3AJDA 2XMJA 4V2SA 4DV5F 3CC7T 2UUAJ 1TR0A 2AZSA 1RAAB 3M8ZA 3LALA 2YWFA 2E5GA 4JLIA 3LUYA 1WOPA 4WU2A 3KK2B 4DZ6A 3CGIA 3TUJC 3DRPA 2QT7A 4ILLA 2YUQA 2EBPA 4J9RA 4JV5F 5KCHA 4AG2C 1F1BB 3IR6B 3KLFA 2ED1A 3JB9I 4FKYA 2EGAA 4M75F 3GPLA 1AB8A 5BXIA 4C8QB 2D74B 3CE8A 3GYGA 3GFXA 3VRYA 2ERRA 2ZC3A 3HSDA 1U24A 3SBMA 4UC4A 1S1UA 1NK0A 2F4VJ 1MUZA 3M32A 1Q8IA 1X60A 1KLMA 1Y7XA 4DX7A 1LCKA 4ALZA 2DH7A 1XTZA 1S1NA 2IM0A 1HBUB 2HYIB 2XZDB 2UV8A 1MHNA 2DYAA 4OI3A 2H3JA 1CJTB 2CQHA 4BB7A 1MWYA 3G87A 3WHIA 3DXSX 1U3OA 5D4OA 2YNIB 3N4WA 4B9XA 5IV3A 8AT1B 4LREA 4IH6A 4PG7A 4DF8A 2W4DA 5CXTA 1VIFA 4Z37A 3RKWA 1ZM4A 2R7TA 1JLAA 4LQ3A 1NCLA 2A10A 3Q8VA 4ZVTB 3NTKA 3SWNB 2KYMA 3HRSA 3BSAA 3HKZD 4WIQA 2K3XA 2KJWA 5EX3A 1EP4B 3GCWP 4DX6A 4HT7A 1Q95G 2M16A 1WC4A 3KUEA 4L74A 2ZAEA 4RZRA 1GMVA 3UR3C 3M57A 5C7PA 4OV6A 2FEIA 4CLTA 2QGFB 3UO0A 2QRRA 2FVUA 2MCNA 1BGXT 1M5KC 4GKJJ 2GNKA 3A98A 1VR6A 2O3DA 2FVSA 5ITHA 4DS4A 4C8MA 4I64A 3NNAA 2UXCJ 5DM7Q 2LQJA 5AE1A 3GCXP 5I3PA 3CIMA 1KQSR 1S1VB 3Q8YA 1APSA 5DS7A 4ENOA 3UVJA 3CBOA 1RUWA 3G6EA 2GV1A 5CCMA 3KYLA 1RAFB 1FX7A 2XLJA 4ECUA 2MKCA 5F8JA 2VONA 4JI0F 1Y00A 1SIWB 3Q2TC 2V8GA 1YX2A 1DAXA 3RERA 2F8MA 3A8KA 1MSWD 2J6FA 4U95A 1KKHA 4ATNA 1LKZA 4M78E 2ZDPA 2BJ1A 3O2IA 1SSFA 1R6YA 2W7PA 4B3TJ 3GU0A 3GYXB 2IAJB 3ZZOA 2LQ8A 4J5OA 2UXBF 2RSQA 4PWUA 2VQEF 2WVEA 3L3CA 4A8QA 4L3KA 3OBWA 3QO9A 2EQMA 3QDRB 4FW1A 1Q81T 2YKMB 1PRMC 4O3SA 1RAIB 2I9SA 1UJYA 1JRIA 1PSEA 2ZH4A 3DGPB 3RW7A 4OHXA 4FM4B 1WHYA 3LP2A 1OZ3A 3QJYA 1VQ8A 4TNOA 3MOZA 5L38A 3FMWA 2ZH8A 1MN7A 2ZPEB 2XMUA 3ISZA 1IXKA 1QAJA 2KT3A 4ED0A 3U02A 3QO9B 5EDWA 1XMQJ 2DNRA 1NB7A 5DLFA 3D9BA 3HO1A 2R7SA 2Y4XA 3TX0A 1T05B 2HFOA 3G71A 3CQTA 4EO6A 2SXLA 3SB2A 1UUEA 3FRYA 3VYGA 3M4XA 2PC6A 4F0KA 3M0PA 2HHHJ 5ETPA 2HEKA 2HG4A 1EHWA 2NPIA 4LF8F 4EUVA 4ZPTR 2KYBA 2V4JB 3TAMB 4K50A 3HZEA 4NLSA 4JP8A 1RDRA 4LRCA 1RCXB 4QIGA 4QYZJ 4A8MP 5F3TA 3ENAA 2XCAA 3OMCA 2UXDJ 2JEGA 4C5HA 1C0UB 4TY8B 2FJWA 4LUDA 4C0FA 4N4HA 3FKBA 4DCJB 5LJ3f 5DQHA 2UUCF 4YQWA 2CDTA 2MJUA 4ZVOB 3DRPB 4G6VB 3M8WA 1GXUA 2QLWA 3QLHB 2Z8QA 5GAGU 1Q7LB 2RRBA 3ILOA 1H2UX 3O8VA 3PZPA 1KFDA 4C97A 1OX9A 1U47A 3BPSP 3QT8A 2XMKA 4YFUA 5CD4A 3CSKA 2XS2A 2OTJS 1U1LA 3OL9A 1VQ6Q 2KM8B 2OPPA 1M2VB 1HHSA 1R0AA 5CZXA 2YXLA 3Q8RB 4IKFA 4F17A 3CXCS 1SH3A 1WELA 4DBHA 5HO4A 2ZPFB 3KG4A 2UV8G 2L3RA 1X4HA 1XEZA 4PUOB 5L9XA 2K4YA 4DU8A 3ZNJ1 4A4FA 5GAHU 4L73A 1FE0A 1NDPA 3PX6A 5DGBA 1K9MU 2D9PA 2X4WA 3OD2A 2NXEA 3ZL7C 3IXQA 1R31A 2OJ3A 4B9TA 1XC9A 3I9QA 2BRLA 3OSSC 2MYSA 4F4KA 3FNNA 4EWTA 3GP8A 2JN0A 4JB8B 3NLCA 2YX4A 3I5SA 1HQUA 2XMWA 2LA6A 2Z56B 4KSEB 9RUBA 3LWHA 1SV5A 1R77A 4ZP8A 2AEMA 4P10A 4DA4A 2BM1A 1U2RA 2KEAA 4RBVA 3CC4A 5I3UB 2IMWP 3DRYA 4K4XA 2QFIA 2LQWA 1PSDA 2YX7A 3I0RB 3PG9A 4A4KA 1N5SA 2FZGB 3DLKB 4DSLA 1Q79A 3A8IA 3DHWC 1RB0A 4I2PA 4USIA 1G1XA 5I4MA 1WHWA 1YBAA 2E5IA 5DZ7A 2DJQA 3M53A 4RW9B 2MDAA 3NS5A 4ECTA 3R1HA 2AGQA 3JB9G 3NP5A 4F25A 1LFPA 4QYRA 3RUXA 1KSPA 1GMWA 4DR6F 4X66F 1GCQC 4HI2A 3REBB 4M7DD 1UGQB 4KBMB 1R3NA 4B3OB 2QQAA 1UHFA 1S49A 4XTWA 3D6FB 4QWEA 4JI7F 1XMOJ 1H6KX 2DNOA 3O3LA 4J6XA 3K8VA 5KFMA 3C16A 4I0WA 3T5HA 1OQKA 2HAXA 1TAUA 2J6TA 4DL6A 4F02A 1T0HA 2CVIA 1VBKA 4CH0S 2DNNA 5L9NA 4HR2A 2YNFB 4DL3A 2QTVA 2RPNA 5B7WA 3UA7A 4B9VA 3Q2SC 1M1KC 3W5ZA 1AHJB 3E9FA 2R5MA 2PVOB 1H3HA 2ZM6F 3HULA 2F5GA 3MEAA 3SFUA 1UW4A 3QO3A 1DTQB 3CPWA 4BE2A 4C11B 4MAKA 1BUXA 1N0VC 2Q3PA 3P8BB 3KJNB 1YITQ 2G0JA 5CD4H 1G2BA 3TZYA 3PVLA 1K47A 1QQJA 3CF5Q 2XMVA 1FJGF 4O5VA 5KYWB 2OTLT 2JH3A 1JJCB 5EN1A 1VA7A 4J9PA 1T05A 1VQ6A 1X4AA 4O4RA 1QE1A 3EE3A 3AQPA 3QGGA 5AYFA 5DG7A 4KHPJ 2W2MP 1YTYA 2O66A 1IBKJ 2KRBA 5IHNA 1RAEB 1N5TA 5J1NA 1JXEA 3OMGA 1XNQF 3EGWB 4MKBA 2E7VA 1E6VB 4E98A 2K5LA 3NTIA 3HJVA 1Q81R 1WI7A 1YRUA 2WBMA 4NS5A 1YJRA 2PE8A 2DD5A 3GV8B 3CCRQ 2J7WA 2DETA 5JXSA 4A8OA 2EI5A 4J9DA 2Q43A 2B8AA 2XBPA 2BQ3A 5CO7A 5FU6B 1JLGB 3QZ8A 4JI8J 4PG4A 3QWXX 3MPVA 3UNGC 4X4PA 3TEGA 3CMET 2CZ0B 4J5YA 4HL9A 4TU7A 2X4YA 3TR5A 2EIFA 3A1PA 3TEHB 4X4NA 2L9NA 1VRQC 1E7OA 2JTMA 4ZIWA 1S76D 1XR6A 3MEDA 3D1HA 5FLXU 2IM3A 3JQKA 1VQPQ 3MMCB 2LDIA 1VLYA 1EFNA 2QLXA 4X9DA 4WYLA 2NZ4A 3VTIA 1WXTA 4IURA 4ZVUB 1FEEA 3FFIB 5EUHA 3T1HJ 4BY6B 5HROB 2KT1A 3I5AA 1QAIA 1D8YA 1NU4A 3R27A 3EGXA 4CYUB 1JX4A 4IOAQ 3JTNA 3OYDA 3HHEA 2CQCA 5K20B 3IAM9 2AEFA 3CC7Q 4CLPA 3UD4P 4FZVA 3MMJA 4LVNP 4M7AB 1U26A 3TUZC 2LQ9A 3VS5A 3OYMA 3JB9H 4Q8FA 3VAFA 3GLXA 2R2SA 3CMAA 4OB3B 1PAEX 4JOUA 5D0GA 2YQ1A 3PIOA 1B34A 1VQLA 4LF7J 3EFSA 1NSQA 1M2OA 3QRPA 3HKSA 2JTEA 2CQ4A 3PW2A 1R43A 3M8PB 3EG2A 2RA2A 5D15A 5LXRA 2M02A 2XTJP 4LD9K 2XSFA 1FK9B 4QWBA 3MR7A 1W2BS 4C8QE 4RW4B 1QWEA 1QCNA 3JCMb 3IN5A 3MM7A 3IC1A 4U8VA 1YWOA 1NYGA 3BM7A 4LFBJ 5K8PA 1SJ4P 5GMKh 1VQKA 2FPHX 4QW2A 3V7CA 1WHLA 1FXLA 4NLRA 3H5UA 4OI1A 1QVGS 3T1YJ 1QAYA 3KUGA 3G8SA 3EZ5A 3CCSA 2YQ0A 1N8RU 3ELHA 3D28A 5L8RE 2KQWA 1V3SA 3O8WA 3MP8A 1S1WB 2XYPB 4DPWA 3OY9A 3BGRA 1NJIC 4ZPCA 5GAOq 5JJBA 3VF0B 5LJ5Y 2RKIA 1WKKA 2J0WA 3MMBA 3MD3A 4X4QA 3EH2A 2WB4A 1K73U 4A53A 3LP2B 2GTOA 1LJOA 5HROA 3BH6B 2E5QA 1RWPB 1PM3A 1S1XB 4OZJA 4RW6B 3ZTPA 2LQBA 3Q24A 5A8KA 4OX7A 5F8GA 1TUGB 1G8XA 2LQ5A 2AWZA 4IR1A 3KHGA 3HF5A 2W9BB 1W70A 3N6LA 3H42A 4DQPA 4FF4A 3A8GB 2K7KA 5GAMe 4PQUA 3EH1A 3PVQA 1KQGB 5D4LA 1M5Q1 5D6YA 1NZ9A 4E0DA 3O5TB 1VQMA 4NA1A 2C3PA 4QKUA 2E1HA 1HBMA 2P9EA 4R0JA 4DQ2A 1UKUA 3RW6A 3M32B 1GEHA 4NLOA 1PO6A 1JO8A 1JWWA 1S59A 4NEYA 2HHQA 1U02A 4KGXB 2GHPA 5JVHQ 1Q81U 3F0NA 3EZUA 2FYXA 1YRTA 2M3DA 2QGGA 1KVKA 2Y9HA 1M5SA 1U6ZA 3JAMU 1VQMS 1GBQA 1QM9A 1PWTA 3KUFA 3EHQA 2O67A 5A8RB 4U9RA 4YUDA 2K2VA 3BE3A 1BLUA 3D4JA 1EB0A 3SEMA 1A0OB 2GVZA 3W1YC 3Q8QB 2XHWA 1C0TB 3L9ZA 2F7VA 2IIMA 3EG3A 3M58A 3AFGA 3MFHA 2R8HA 3PMIA 2D9OA 1JKHB 5CCAA 3KLIA 4IKAA 4P2SA 3G4ST 3J7A1 3HDSA 1YHQQ 3N01A 4ANJA 1M1HA 3T3FA 4OMFB 5J39A 5U47A 1HYOA 5IFMA 2I2YA 2EBEA 2NUUG 4O6JA 1CEZA 1S9GB 3VGTA 3WVEB 1LWCB 2UXCF 3I55Q 1EIFA 4M4ZA 1Y0HA 3CD6A 4DV0F 2CNOB 2B8PA 1JLEA 1UETA 3H90A 3J80U 1UPPA 4ZDNA 4IG0B 4F7UF 2YNGB 4N0AC 1K73T 2DITA 2QEXA 3C6UB 2XMAA 3OS5A 2VC0A 4CLZA 2QA4T 1OYDA 1VQMT 2Z4PA 4HTIA 3TI0A 4KUIA 2HQGA 3M8RA 3SFGA 4DHVA 1CS4B 4HA8A 5LSOA 4J9KA 1YK9A 3PXGa 4DX5A 1G3SA 3QAUA 2MQOA 3QG1A 2QL9B 1S48A 1S6UA 2KMTA 3DMJA 1XR5A 1HWKA 2IJFA 3INZA 1RT7B 3MM8B 5GAOn 4NCGA 5KE3A 5CKBA 3QJLA 4NMXA 2QSWA 2HVDA 1S1TB 5KYNA 2EVRA 3NGTA 2ROLA 3JCMc 1FO1A 3HX9A 3MR2A 2RS8A 3CPWS 2MEWA 1BHNA 2MHEA 5KOXA 3HHLD 2ZOFA 1I81A 1OS5A 2FQQB 4KFBA 2X4JA 1F2GA 1SKRA 4LF7F 4FVCA 3GJTB 3MAAB 4OX9F 2VKNA 4LRAA 3VALA 3PW7A 3M56A 1G3TA 2D3O1 1VHFA 3W2VA 2LA4A 2B4PA 4CO2A 1JIHA 2ZPHB 4DR4F 2UUBF 4M78B 2KXHA 1KS2A 2FJVA 2IYGA 2A3LA 3KLGA 3DKMA 3JS9A 4Q2LA 4ZVRB 1KD1C 4LFBF 3A4TA 5GJVB 1QKWA 2R8JA 1X9SA 4ESRA 1LV5A 3A12A 2NLWA 3QQCD 1FMVA 3CCEA 3JSRA 3W2WB 2BQUA 4RTVA 3PM9A 4UOHA 3VUZA 3I56T 2HSPA 3R2DJ 3PHEA 4PNOA 4FT4A 1XNRJ 4WP3A 2OSRA 1TWBA 2HQFA 3T6JA 4M75B 3HRTA 1NAQA 5BR8J 3HXMA 3RUBL 3DYAA 3ZZTA 5C2CA 2GS8A 2JRSA 3G71S 2FLOA 2KK4A 3CJKB 3R6NA 1VYAA 3CUNA 3KXTA 1HYSB 2GQQA 4RW8B 1S12A 2D7SA 3C19A 3NGPA 1YQHA 2DRBA 1FMWA 2MXYA 2YNHA 3H2UB 1FX2A 5D0RA 3OYEA 3Q22A 4NZ6A 3KUHA 4TQRA 5LJ3g 3OFGA 3NNCA 3CMAS 2OPPB 2LDMA 4X65F 2DL7A 4Q0BB 2KH9A 2BE2B 5SZTA 2QAZA 4UY85 1ZBJA 1VRUB 1HD0A 3D3CJ 3RU0A 1FMKA 3N5BA 4HVZA 2YLBA 4MYUA 4JV2A 3QSYB 5AXNA 1FT8A 3PIPQ 2RHZA 2M0YA 1T3LA 2WOMA 4O44B 2Z0WA 4YR2A 3MCMA 5T14A 1PSFA 1VLOA 3WC2A 1JBMA 3ISND 1N36F 2DMOA 1F5BA 1SQEA 4C92F 3GLJA 4OMNA 3TZZA 2MZJA 1N54B 2DAQA 1X5TA 1DQ9A 2RK2A 1YIJT 4MFBA 1KWMA 1N36J 3CCWA 2CZ4A 3E8OA 2R7QA 3L7OA 4ED1A 1S7HA 2ABYA 2ZM6J 2HKQB 3NNHA 1NPRA 3CBPA 2PVDB 3VVTA 2ZOGA 3SQOP 2DYBA 3IR5B 2E1MC 1RT1A 4C92B 3HFVA 3ZZUA 3ILIA 3JCMQ 3QGPA 5GMKj 1H73A 2O9SA 3E19A 4L76A 4DCPB 1PJ6A 5FRMA 1OV3A 3JQJA 4LF1A 3SCLE 3UDVA 1HPZA 2ZNZA 1C0MA 4URGA 2X51A 4MDXA 4ZTJA 5MLCV 4X4VA 4IYQA 5HY6A 3NCRA 4L75A 3G96A 5HSPA 4I2PB 2VODA 1XMOF 3M2RA 4U96A 4YHHF 4DS5A 4C92G 5GAN4 1RHJB 5J26A 3QRRA 1X5OA 3F56A 2XZTB 2DTOA 2MOXA 4P5NA 3M8PA 3FQKA 2V6AA 4AUKA 3BSNA 2R58A 5GAMd 4B02A 2VJUA 2KG1A 1DJ7B 3BH7B 1G5VA 3HVTB 1HKAA 2Z0GA 3MCOA 4RUAA 1TUDA 3EXCX 2MQPA 1YJNS 2RJCA 2WVCA 3M2UB 3RR7A 4PQUB 1NMEB 2A2CA 2QI2A 2E66A 3QGHA 3OYFA 5IM0B 1WOOA 1OSCA 4IUUA 5KFPA 3G6XA 2GQ2A 3Q8UA 3MEEA 3P96A 1Q1KA 2IMOA 2V1QA 3C6TA 5L1LA 2YH0A 4DV1J 2MMYA 3K0JA 2E64A 2HPUA 4X64F 6AT1B 4AG1C 5DDPC 2CZVC 4KRWA 2FD2A 3POTB 4PLIA 4LSLB 2AJ1A 2O9VA 4AT1B 1B70B 1QTMA 4PJLA 2EGEA 2B4VA 4IH7A 2B9WA 2XSJA 1IGUA 3TARA 1VGYA 2ASDA 4C8QF 1R8HA 5E2QA 3PGGA 1S7IA 4RNOA 1YCSB 3H59A 4I6AA 3ZTSA 1YIJS 2K8GA 3ZZYA 2UVRA 2H9ZA 2YQ3A 4XQ3A 4F67A 1Z4UA 5E3CA 5L39A 2ADBA 5CQYA 2RS2A 5KYWA 4ECWA 2HHWA 3GIJA 2XMFA 2XSJB 5KT5A 2B51A 2E5LF 4TYBA 4XU2A 1MW7A 2BZXA 1HWLA 4Q5WA 2EBGA 1A7GE 2CKWA 4O3NA 2Y0SD 3EAEA 2H65B 1RHQB 1K9MC 2P0PA 2VG6A 4K2XA 2JEJA 2HMAA 2I5JA 1EAYC 4P7VA 3OFEA 2HGLA 1TL7B 1DARA 1Y11A 3OYHA 1KOHA 3SDEA 3EDQB 5GAMh 1LWFA 5C42B 1H3DA 4FSXA 4HYKA 4WZMA 1F5AA 5ETQA 3FGVA 3QDFA 2EQIA 4PJOF 3MM9A 2HKEA 4M7AF 2PT0A 2MMPA 2K3IA 4GC6A 2CS7A 1LNXA 1FWKA 3TW0A 2RDJA 3UF4A 4O3OA 4PJOG 1M1KU 2KHDA 1VQOT 1L3UA 2GCFA 1X4EA 2QMUB 3LO3A 4ETXA 3PNWC 4FS1A 3W5XA 3AD7C 4N8OA 1U1NA 2HHHF 5CCLA 4DV1F 3BR8A 4JRPA 4FL6A 4O4GA 1JKHA 3CCQT 4TQSA 4MKYA 4R55A 3X28B 3CCQA 2AJ4A 1RCOB 1YG0A 4PJMA 2RK1A 3PX0A 2M4MA 1M90U 2OI3A 1Y5NB 3GYNA 3R2CJ 4WFZA 2DD4A 2DLPA 2LT1A 3FBEA 2K5FA 3H2VE 4E7JA 3LWLA 2MAMA 3DI6B 2ACYA 4MT1A 2DO3A 1FHTA 2BOAA 5DLGA 1Q5YA 2ZUAA 3M8YA 5IT9E 1VQ6T 2UVVA 3NGDA 4A8YA 5CYMA 2J7KA 1RISA 5K9FA 3WVDB 2IBOA 3TQ7P 3AJ1A 2M52A 2IRUA 4OYOA 4ZLJA 1FKOB 3PYGA 2RNEA 4BS2A 3IFEA 2YNHB 3MOJB 3CCLA 3IRXA 2N7CA 2BJDA 1QUVA 2CDQA 4FKXA 3KMSA 1K9AA 4TY8A 3O1LA 4WFNQ 3MURP 3LWMA 1BD6A 1NHUA 2NZCA 3OS1A 1UEKA 4N41A 3BPDA 4ERDA 3GR0A 2WCXA 3PIPA 2BKDN 1YIJQ 2VDHA 2YWKA 1BIAA 3VAMA 1VRTB 4NL5A 2W25A 3LH5A 3IRXB 1WEYA 3OW2P 1WSRA 1VQPA 2FY8A 3HZGA 1KJWA 1CJVA 3FBCA 3E2UA 2RDIA 2KFYA 2DK3A 3TA1A 3LP1A 2W2OP 4HHUA 1T7PA 3IAS9 2K3YA 5BYSA 2C2RA 3I5RA 2UXBJ 2BACA 2HL3A 4OMOA 1WC3A 3CCES 1F60B 4CT8A 4RUBA 2G2ZA 1JXOA 3LA0A 2UU9F 2RHUA 2CNLB 1T0JA 3DRRB 3DCAA 2N4DA 5DETA 4OMMA 4MK9A 3UD5A 2ZH9A 4YY3F 1YKWA 4N7TA 1GXLA 1RBAA 1QSLA 1XMBA 1K0TA 5A8KB 5IQ6A 2GAGC 4XU0A 3JB9k 5DDQC 3QFHA 3KK1B 2UUTA 4VUBA 2FPFA 4Z2XA 2DD8S 2DXTA 4EMGA 3SQGA 2RU9A 1JLBA 1QTNB 4HHJA 2DR9A 3TUPA 1ICEB 4BCAA 4Q7AA 1SUQB 3UA6A 3C94A 3CJ8A 3IRWP 3S3OA 4FSSA 2CQ1A 5HMYA 5LJ5j 5IC4B 1DFDA 2OP5A 5CYQB 1W2IA 3KG0A 4ZPAA 2QN6B 1X2QA 3AHUA 4F2RA 3H40A 2H5JB 3HVAA 4JLGA 2DJWA 1HBMB 3LF0A 1UFWA 3R8YA 1TV6B 3PIOQ 5GAN8 4P2FA 1TL3A 2NYHA 3ZXWA 2KTQA 2ZBCA 4LDVA 1RK8A 1OOTA 3EPIA 2V8DA 1KP6A 1BKBA 2X7IA 2KT8A 2GIFA 2CPJA 4HACB 4JUZA 3D54A 5GAHI 1VQ5S 1U48A 2KROA 1JB0C 4FYVB 3ITHB 3TWZA 4KIAA 2HZAA 4RL1A 2HGMA 1IM4A 4ZPDA 5EX0A 4EMHA 5A76A 5J1EB 2QDLA 4RNMA 5ETOA 2JJ4D 1UVKA 1D8ZA 3PFSA 4P7TA 4EMKC 4KC5A 1RI9A 2HHVA 2EQJA 3R5AA 3CXCA 1T3NA 1IBCB 2NLUA 1UJ4A 4LBPA 1JU5C 2JS2A 2CJXB 3IGNA 2WAQD 4JZ4A 4M7AD 1VC6A 2C2OB 3OJSA 4M94A 3KLIB 2D8JA 3NOGA 3LGHA 1PJ5A 4QOTA 3FEYB 3KJVA 3FZBA 3CT9A 3BFMA 4OB2B 3VKIA 5KFEA 3FJ2A 5GAN3 3GOXA 2PMZD 3CJSA 5M2PA 2XICA 1SH0A 1CC8A 1BI1A 4CO0A 2HVHA 1NKCA 1KQ1A 1NSKL 2M5YA 4DOZA 2R4FA 1MMDA 2DZ9A 2QQBA 2DGVA 1YWXA 2ZH6A 3ZFJA 3KG1A 4NRUA 4F16A 2JFKA 4KPCA 4M5DB 2D0QB 1NJWA 4OL8A 4PCQA 2DZCA 1HPZB 2RHSB 3GIMA 2LJ1A 1U8RA 3H6ZA 3MM6B 4N76A 5CKHA 1V5IB 3HMJG 2IA6A 4PFPA 4DZDA 3F70A 2W9BA 2O88A 4WFYA 5K8OA 3MTKA 3CC2A 1XNQJ 2CZ7B 5E0OA 4KO0A 4KB7A 1VCTA 1YBTA 3BQ2A 1BWEA 3U1MA 2MGZB 3JB9D 3PTAA 1K8AR 4PXBA 2HQEA 2GTJA 2DEQA 1CJKB 1YZ6A 2WONA 3KTQA 2JSXA 4QZVB 5AT1B 3NRBA 4QW8A 1QP2A 1RWWB 4XTXA 5CKDA 1RHUB 2UU9J 2R3VA 3PFOA 2IRYA 2KHCA 1GFCA 5GANg 5KFAA 3TAPA 2L3PA 1HD1A 3UN5A 4AFQC 1HYSA 1WOSA 1QVFP 2RF2A 4C92C 3A8HB 3PKYA 3S6EA 1U1RA 2KXDA 3W9HA 4P72A 1AWJA 1DTTA 1RHKB 1H0HB 4NLDA 2DCLA 2MLXA 2EFVA 1Y07A 2E41A 3QATA 1NEGA 4FXVA 4ZHRB 2ZPGB 4NXNF 1H74A 1GTEA 2GW8A 3Q86A 4LF5F 2P8IA 2RF2B 4X62F 1U25A 5ETSA 1WWHA 3DU5A 3IBCB 5EWFA 1RWMB 2HWTA 1IKXA 4OJHA 4IFYA 2CPHA 1E6HA 2QEXQ 3DLEB 3DM2B 4ID5A 2DILA 4GO5X 2IC3B 3MHXA 3CCLS 3UPUA 5G4DA 1U0HB 1VQ4S 2XMTA 3W8PA 1X0FA 3FQLA 1LOJA 4DSJA 1BWVA 4M5IA 2PNIA 4LUBA 2R2RA 2AT1B 2GO8A 3FCVA 2R2TA 2HHSA 4QR2A 5DLOA 2MSSA 3QGIA 4OYXA 1SG5A 1W4SA 1N9SA 4WE1B 2GMLA 2RT3A 2CJQA 5J2QB 2KI2A 5IOLA 5AJ3F 2L3QA 3PY8A 2KY9A 2ZPBB 3C14B 1TFWA 2D6FA 2HFZA 1VQYA 4BHQA 1TG0A 3A5ZB 3KLGB 2VPZB 1N56A 1KC8R 4KR0B 3AOAA 1KLNA 2R8KA 3I96A 2V4QA 3OL7A 4QR1A 2R8GA 5KT4A 1XWLA 3D6TB 3OTOJ 2IA0A 4C92D 5GAOr 2V0NA 1RZMA 2XC9A 3HP6A 2XB2D 3BQ1A 1VRUA 3NGSA 1I51B 4XU3A 1X0PA 3MM5B 3DLLQ 2PUKB 2K1RA 1CG2A 2GGPB 1WF0A 2UVWA 3S3NA 3LAMA 5IWAJ 4QR0A 1TS9A 3VQSA 2ATLA 1HD3A 1J5EF 2CFXA 4S0MA 4JI2J 3ZZ0A 1WQWA 3EVMA 2Z2MA 4A4GA 3H0FA 1JJ2P 4IRCA 1TK0A 3ZZPA 5B0EA 1LFWA 3Q23A 1IB8A 3UDLA 4CO3A 3GNFB 3BS9A 2VU5A 3OS0A 3FMBA 1SL1A 4TVRA 2DHHA 5EHHA 2DCUB 1SC6A 5FDLB 2B6AB 4PJOC 1X4BA 3R5DA 1YITA 3GIRA 3W65A 1F9FA 4RW7A 3CCJT 1YJWT 4Q43A 5A2QU 4YDDB 1OY9A 2P0KA 1HQUB 4CIOA 5D3GB 2GFUA 3RBBB 5HLFB 4IO9Q 1YCYA 1T9XA 1HK9A 2KYXA 3CWJA 2XZWA 1WYXA 3M59A 2EG1A 3UFCX 4UQGA 1UA1A 2YLCA 3I56A 4MMOA 5LSLA 1M27C 2K06A 4OGCA 5B0AA 1KTQA 3FVYA 2YSQA 1PKSA 1R27B 3M0TA 7FD1A 1T3SA 1Q81C 1HHTP 2XI9A 1UEUA 5A0DA 2KKHA 3D0GE 5L1JA 1FVQA 4EFAC 2JJ9A 3OUYB 1WNEA 4DR3J 5LJ3d 2ZBIA 2FTRA 2W0ZA 3CIZA 3HSZA 2Y0BB 2KZMA 4LIRA 4K4TA 4BI3A 3FIFA 2VH7A 3X1LB 3H2LA 4WKRA 1WEZA 4ME7A 4J9LA 2YWEA 1FESA 1K1ZA 5AE2A 1YJNA 2X4XA 4Y92A 3JCMV 2IDLA 1BI0A 3OLBA 2FDNA 1W2BR 3WBZA 2WSEE 2Y1IA 3OR2A 2JZ5A 5GMKe 1KQSA 1AW0A 3GZ7A 5CYJA 4B3RJ 4C5IA 1AFIA 4Y2CA 1XNIA 5GAGI 5LM7E 2Q79A 4JI8F 2XHCA 5A8WB 4M7DB 4TN2A 2WW8A 3ADAC 1M1KR 3I5CA 3T19A 1JLQB 2LRQA 3M8QA 3X26B 3VGVA 4EPCA 3EG9B 2OSQA 1LWCA 2DF6A 3UCZP 4X4OA 5KCOA 1UJ6A 2IC3A 2W01A 1D3BA 5HLFA 2HQ3A 2HNDA 4FXWA 2E5JA 1WIEA 1FXXA 3RKYA 4IFVB 1MGQA 1D1AA 4K0KF 4ER8A 2FJBB 1VK3A 4URQU 4OB1B 2D1XA 4P73A 2EPDA 3G1JA 3OQ2A 1QVFA 3DU6A 1RAGB 1MNEA 5MAOA 1O75A 2BZ8A 3H8ZA 2ZOMA 3GIBA 2XWYA 2BDPA 3WDOA 3FBFA 4TLQA 2GJ2A 3EPGA 2K79A 4DFKA 1N33J 5E3AA 1LWFB 2K7JA 4GVBB 4FU6A 2Q1LA 4CLYA 1GH8A 1TUVA 3MCAB 2GVDA 2WRMA 1BQMB 4PPZA 3B78A 3MI7X 2ZFHA 3M0QA 2PEBA 4WXWA 4OGEA 4UOFA 4CLLA 2CRLA 4WFXA 1R89A 2KSSA 1U09A 2CJKA 2DJZA 2W2NP 4ED8A 2XQCA 4QJVA 5KFHA 1UVLA 4F04B 4M7DC 1TK8A 5K8NA 3THKA 3GMGA 4QYZK 4DLEA 2IM2A 1YJVA 2K6DA 1TL1B 2RD5C 2RRNA 2BJ9A 2ZVSA 2DERA 2GO9A 2OEKA 3UATA 3CXCP 3DN9A 2E4HA 2XNRA 2L5QA 1FXRA 1YJ9Q 3N6MA 3S7RA 2VQFJ 2BVZA 3RRHA 4DR3F 3NPFA 1LWEB 4W98A 2XMMA 1MLAA 5EWGA 4LBHA 4KH1B 1KTVA 1I8FA 4Y2IA 3ER0A 2BE7D 5ETNA 1BXNA 4DR6J 2OHDA 3J80E 2GFAA 2XYHB 3LOUA 2CKKA 3CCJQ 2CZ1B 1YP5A 2BUNA 3E01A 3E51A 1YHQT 2RMLA 3IWXA 1NE8A 2AJFE 2PQWA 2KI7A 4NL3A 5FWBA 1EQMA 1VJWA 2KN4A 1AUSL 3VV2B 2RO0A 3VZIA 2DNGA 4C8ZA 4ZPVR 1FKOA 3VU3C 4V19J 6FDRA 2RJFA 5FLXE 4DBQA 4BC7A 3DRSB 1VQSA 1K1SA 2DXBA 4FDFA 3I6PA 4C3LA 1W25A 1KQKA 4OMPA 2BR0A 5KYUA 4U7CA 2HIYA 3WIUA 1GCQA 3H0IA 2NPFA 2CJ9A 2DM1A 5DDOC 3RGIA 2RH2A 2OTLS 1B0VA 4J7IA 4JV5J 4KKOB 4WU3A 3M55A 1G3WA 1SUQA 3BF4A 3FRZA 3MMCA 3K5NA 2WSCE 2XO7A 2XI3A 2V68A 1QVPA 1JXVA 3DLLA 4DSIA 2LNHB 1SCJB 2R2UA 2HQXA 2QYGA 3DLGB 5KFOA 4OMLA 1HMVB 4PAAA 4EBCA 1S6OA 3CCST 1FKPA 3DMJB 2UUAF 3DOKA 2V9KA 4LJMA 3QIPA 1NSAA 2XIDA 2ZEJA 1D1UA 3CCMA 3QAEA 3U23A 4LQ9A 1FRIA 1L5UA 2KR3A 3OTBA 3X3UA 3J7YI 1YJTA 1NK7A 2VFSA 2RRAA 2H48B 2VPWB 1L3TA 3MGJA 4ELUA 4LFCJ 2QTWA 2WOMB 3K7RA 2YKNA 2G13A 4PR6A 5EWEA 2HS4A 2HBQB 1SXLA 4JI6F 2L3SA 1I4K1 3KKFA 1NH7A 4C0ZA 4OYIA 2OH2A 3MAAA 2U2FA 2W7OA 1WUUA 2X9HA 3I35A 1M5OC 1Q8KA 4X4RA 3I4PA 2EQUA 3NGKA 4C8QC 1EARA 1B3QA 2OFHX 1T11A 4F4WA 4F2SA 3EUNA 3L7PA 2VL1A 1N5YA 5J2MA 4QQ6A 1NPPA 4ZLNA 1C1BB 5F8NA 2OPQA 1IXDA 2VF3A 3MPWA 2M9UA 5GMKl 2YX1A 2ATCB 2HBZB 2AJQA 1SSHA 3M2VA 2M9KA 4RU2A 2FO0A 1K4US 2XDBA 5GAEI 3HM9A 4XPEA 1SIZA 3C95A 4EI2A 3CD6S 2J9DE 5CYQA 2UXDF 2JS0A 4V19X 1RWXB 2WSEC 2HNDB 1RT3B 3L2VA 1TV6A 4CLFA 3W9JA 3EGXB 1IBMJ 3P8DA 4YB6A 4M75D 1QJHA 3E1SA 3NAIA 2ZHBA 2PI4A 3QPIA 4M7AE 3NMAA 1S9GA 4HACA 4XAKA 4OHZA 1X5SA 3DLKA 3I0SA 3CDAA 4JYAJ 3QT5A 1WG4A 2R7XA 2DXEA 1HBNA 1REVA 5GANj 4LF6J 1YJNQ 2MKSA 5KFGA 4RR5A 1YDLA 2J9EA 3W5YA 2QL5B 2Y8WA 1F9EB 4AFSC 1RWNB 1Q78A 3PR4A 1VRTA 1X4FA 4LF5J 2C3MA 4QU6A 3OR2B 2RIJA 1RT2B 4B08A 4ZTFA 4HDGA 3KNAA 1P8GA 1UVJA 4DU7A 5AJ3J 1VQ4Q 2J0QD 4L59A 1OMSA 3CMAQ 4PFZA 2Q66A 3C0CA 1M8MA 4RG2A 4CC7A 5H9FJ 3ZZZA 2WSCC 3CCVS 2M7SA 1UPMB 4RNNA 3EG9A 3GJRB 2DVEA 4PKCC 3IBFB 4JV1A 2MZTA 3CC2Q 5T41A 3DRRA 4UZBA 4NA3A 2EKOA 1VBXA 1HNWJ 4IUQA 4GKJF 4EU0A 3NCPA 4FPIA 4ITSA 4J7FA 1PRLC 1TKXB 2UP1A 4NPOA 4B9MA 4ZCMA 5KAKA 1M8VA 1HARA 1U1QA 4Y3CA 1K0SA 2DRDA 2CQGA 4O0NA 1B7TA 2COLA 5A8RA 1FI4A 1SKSA 4HVWA 2ZH3A 5A0LA 4M5JA 1VS3A 1LNQA 2LDYA 4M78G 4C11A 1TL4A 4DFMA 4LDUA 2BXJA 2GVZB 3FUYA 4WZQA 1ZSZB 3MJXA 1PNJA 1ZA1B 2CP6A 4DV2F 2JT4A 1P1TA 3G8TA 1WNLA 4UZCA 2FB7A 5J2PB 1FCAA 2QIFA 2W1BA 4M77B 1T3OA 2MZQA 2V67A 2MKIA 2VV5A 1FFSB 5DM6Q 2JNJA 4HKEA 2DPPB 4BBYA 3H0HA 3CCSS 4ELTA 4XPCA 1XK8A 4KKOA 1DQAA 2OTJT 2QA4S 2IY5B 3I4HX 1SB6A 2RQUA 1ZAVA 5CA5A 5ETTA 2L0AA 2CQ3A 1PC5A 2YTCA 1OPZA 2ZCFB 1DHMA 1N8RT 1YJ9A 2SEMA 1U6FA 3W9IA 1QSYA 3CCJS 4NLYA 4EK2A 3IG1B 4IDKB 3OT9A 1PCAA 4KV8B 1IKWA 1IWGA 3RBZA 3UCGA 4XDCA 3VWSA 3EGNA 4K4SA 2HMIA 3MAQA 3MEUA 5C6SA 2QYCA 3M8SA 1QSSA 1X6BA 1MMLA 1RYRA 4M77D 2PA8D 1VQ7S 5KT6A 2RHQB 5I2MA 2DEUA 2XG8D 1WXUA 1SBRA 1MV3A 1ZTTA 4QWCA 3PEHA 2JMCA 3GFZA 3AA9A 1H98A 3WZ0A 4TU9A 2AEJA 2OLWA 2MZRA 1ZUKA 1WFWA 3G6EQ 4DUYJ 1NK5A 4ZK7M 4LF4J 2LMIA 4Y28C 1UTIA 1N5YB 5D8HB 2RQTA 1Y96B 3ZO7A 3RZAA 3TZWA 1FJEB 2BJEA 4LF4F 2V2KA 2H5IB 1I07A 1YWPA 1DURA 5GANf 1RTHA 2I1RA 4J7CA 2I2LA 1LEOA 1DBDA 2OI2A 4ANCA 1H8KA 1J3TA 4UT4A 2JVRA 2DHSA 2G6FX 1GBRA 1D0EA 1U8SA 4KO0B 4DV5J 3OW2A 4K7QA 4J9GA 3IMQJ 2KJVA 2HHPA 2XULA 5K14A 4ID8A 5LL6d 1NXIA 2DXDA 4IOCQ 1Y7PA 2C2DA 1WJ9A 5LJ5g 3IP0A 3CCLQ 2E5HA 4O23A 3FZ2A 1H7WA 3OV7A 1IKYB 1UGRB 2MWOA 3N28A 2WHOA 3JCMX 4QW9A 4USTA 3HLUA 4TY9A 5CQGA 2FUG9 2MQNA 2ZWOA 1XQHA 5KYUB 1ZS6A 2MHNA 2J76E 3MFIA 2CP3A 3EDRB 1S6QB 3M2RB 5HCKA 1JNRB 3ZTQA 4RKUC 2NUTB 1M5VC 4A8XA 3RBXA 1EQ0A 3JCMP 2DNUA 3PDNA 3UVJB 3E2EA 2EFQA 4LR8A 3LGFA 1NJIT 4E6RA 3CCUT 2MQQA 3D68A 5B0FA 2J6UA 3J81E 2AQ4A 2DBKA 4RW8A 4C0DB 2E44A 4KQZA 5IHIA 5L46A 1VBYA 2NUTA 2JUFA 4HTJA 2CPZA 4PZVA 2LQNA 1MN9A 1Q7YR 3TAMA 3QYGB 2J9DA 3T1AA 2DIVA 4FYYB 3BW1A 1FRXA 2RHXA 2N4CA 1BI3A 4DOVA 3AA8A 2YVSA 1VQ5T 3L7UA 2YKPA 2E70A 2AYGA 1RWUA 4OF1A 3SQGB 4ZMMA 3DFEA 3OXGA 2FZCB 3VS2A 4DUTA 2HBWA 4NLGA 1UB4A 1JLFB 1HNXJ 1NJIR 3NGUA 4J37A 5DM7R 3TVZA 4XDDA 2LQKA 1I0CA 2MLZA 2WVFA 3R1LA 4U7UD 3VGUA 2F8EX 4E2FB 1WD6A 2CG4A 2JOQA 2B86A 3H25A 4KPYA 4CO4A 2O1PA 1T8EA 3FFIA 3LGNA 3WC0A 4RBUA 1Z2ZA 2VOOA 3KJQB 2NREA 4HDHA 1UVNA 5CZVA 3OYKA 2VBWA 3V5RA 1ZUYA 2QQRA 3MEGB 4DFPA 1N34F 1IVZA 1P9QC 1VBZA 3KFWX 1HNWF 1X01A 1OU9A 2AZ1A 3A13A 1AWWA 1I5OB 2BE9B 5GJWB 3NGRA 1EETA 5HAOA 2E29A 3DLHA 2F1LA 3CCRT 3QNWB 3SIPB 1D9FA 4IG3B 2E7WA 4RBTA 2EKYA 3M2UA 2DL8A 2WB1D 5LJ5h 4WP9A 2OTLQ 2PN6A 4LRFA 4II1A 4B17A 2EFGA 4HH0A 2BJ3A 3DOLB 3M1VA 4RO0A 2CYZB 3J7AN 1PHTA 1A9NB 2LX9A 3B4DA 1RWVB 2AYMA 2C42A 4OX8A 5HN0A 2QDYB 4UTGA 1N5ZA 1AZSB 4B9WA 5E3RA 4OMFG 1TVRB 2OD6A 5B0DA 2ZVIA 2MQLA 1FRHA 4KGMA 2LC4A 4ECXA 2ABLA 3THVA 2RNAA 4ED5A 1B4SA 1RTJB 1XERA 4Z88A 1SKWA 4C4WA 5J2MB 2EW9A 3DB4A 3MHYA 4CH7A 2VG7A 4PEOA 3T1YF 5GAOp 2C3UA 4F0MA 5ADZA 1HNVA 4L3NA 4Y2KA 2JTFA 2DTHA 4RW7B 3G6ET 2ZJPQ 4RJVA 2FJEB 2AD9A 1DJ0A 2AF6A 3CMEQ 4I6YA 3QUIA 3V6DA 5D78A 3HD1A 3UT1A 4AFUC 1YJ9S 2M0GB 5KFYA 4DL0C 2NYSA 2CT4A 1U45A 1WEXA 4FXDA 2BX6A 1I1GA 3V7RA 5I21A 2OGUA 1Q82C 1MU2A 3HCXA 4LR7A 4Z8AA 4DJBA 1ZLMA 4M7AC 4ZNXA 4HEA9 3VYHB 3C15B 1ABOA 2QEXT 1WG5A 1KR4A 3K2YA 1IR1A 4Y0FA 2EW3A 2VIHA 4JV0A 3TVKA 2VG5B 1ULRA 2FLNA 3V6KA 4DR5J 3EG0A 3I5BA 4KHMA 4FF1A 1W2BA 1V5VA 5E33A 4N47A 5EG2A 4KV8A 4A8FA 1M30A 2L9WA 4P6QA 1VQ7Q 1G7CB 1RT5B 3VAJA 5KG4A 2Y3YA 2LP4A 3SWNA 4NA2A 5KG3A 3LGMA 1NEEA 2W8KA 3KK2A 1UZHA 3RAQA 1VOMA 4KGKA 3SCJE 1G83A 4WTYA 1JNZB 2DNLA 4CP5A 1TELA 1ZM3A 2YBVA 1S9EA 2AV5A 4W92B 4OP0A 2Y1JA 2G1HA 1Q7YU 3AHPA 1JEGA 4HKQA 2CJAA 4USJC 4YY3J 2FRYA 2RI3A 1KD1U 5HJXA 3KHLA 2NXJA 1UDLA 2CUDA 2YWWA 1ELOA 2DNPA 3IG1A 3OQ5A 4IDKA 3UN3A 5KFVA 4NE9C 4CZCA 1Y10A 4LF8J 1HBUA 1RAOA 4OHVA 1FRLA 3HI9A 2LCCA 4CQ1A 1VI7A 4FP9A 4NCGB 1SJFA 3BSOA 3C16B 3LQVA 3CCLT 2NXCA 1U4BA 3BYRA 2ZH5A 1FE4A 2G0CA 2BMBA 5GAMj 2OMLA 2ROTA 2BANA 1I3OB 2E12A 3GILA 1FNXH 2EPIA 2F2WA 1SF9A 3OB9A 2NUPB 4O3RA 1Y3JA 2DIUA 2ZKTA 1OPKA 2L89A 1W7WA 2CPIA 4P74A 3CCET 1Z2LA 4ED7A 4H4KC 1HW8A 4C0OC 3R7SB 2B4OA 2BANB 1RLCL 1WI6A 5FU7C 8RUCA 2YRVA 2CZ9A 2DHAA 2VQFF 5LMNJ 3QYYA 4PWWA 2AGPA 3JCMd 4PJOE 2Z2ZA 1ZUUA 3I55A 1X2KA 2H3EB 3VS4A 1H2VZ 2YWGA 4OJ3A 4J9CA 3MZIA 2N3LA 2VWFA 2VFRA 3HVRA 4NI2B 2QQ9A 4M7AG 3EZOA 5KFNA 2FHOB 2HLTA 3MM8A 1K73R 3PNIA 4DPUA 3MP6A 4NLVA 1TKZB 3M30A 3JB9J 1CC7A 4G65A 5KTQA 4QVCA 3DOLA 2EYYA 1BB9A 3ET6A 5KFTA 4K0KJ 4QVZA 1S5ZA 3CC7S 4R8UB 4AD6A 4DQRA 3FK4A 4GLKA 1Y71A 1ZPWX 3DOKB 1S6QA 2QA2A 2OX7A 2VB6A 1I6JA 4IFYB 1FNMA 4DSEA 4WKYA 1BY9A 3K5OA 3FEZA 3M30B 4DQQA 1O5JA 2X1AA 2Z30B 4E47A 1MWZA 1SHGA 2DO0A 2DNMA 2QXFA 5GANh 2QQSA 3MM7B 5LJ5f 1RT1B 3CC2S 3CC2T 3OYYA 4IRKA 1S1XA 3GR1A 2KRSA 3J81Y 2VXEA 3KDOA 4KY3A 1N32J 4LF6F 1IGQA 2FHDA 2DIQA 3CMAT 1S0MA 4A8KA 3QMQA 4C8NA 1NM7A 2GZOA 2J6OA 4J90A 4MKAA 5E3PA 5GAMg 1TL3B 4WXOA 1XTDA 2ZJRQ 4Y65A 2VA3A 1NDCA 1K73C 2JVOA 3M05A 3BGRB 4WWSA 2IDEA 2V4RA 1PCXA 4X66J 5KFXA 4I2QB 4G1PA 1OU8A 1C2PA 2A0FB 2SRCA 4O3QA 4I4BA 1D1CA 2AJ2A 3ONQA 1YGYA 2F69A 2BOPA 2XYGB 2B0GA 4Z7CA 2FL7A 4F4AA 5KT7A 2MLYA 3O44A 1JB0E 1S77D 4QWAA 5LMUF 3H5YA 2PGCA 4DF4A 2EAYA 2MGZA 3ZC4A 2DGUA 2CQ2A 3K17A 2E1PA 1KOOA 3BDEA 5D0HA 1EJ7L 3SHWA 4AMCA 2H4WB 1CJVB 3PRVA 1SC3B 4R8UA 4EO8A 3SYZA 3EFOA 1UECA 3RMSA 1R8PA 1IUJA 5CAAA 2N7YA 2LCWA 3LLRA 3QKJA 2EG2A 4NWBA 1JLQA 3CCMS 1PD0A 1VMBA 2E5LJ 2ZZDA 4UOCA 1U6BA 2C2NA 3KK3B 4OJ1A 1VC5A 4ECRA 1RA7A 5K5MA 4PJOD 3NHNA 4WF2A 3RDVA 2E9RX 4MZPA 4QCLA 1EKRA 1BQNB 2QLJB 3OJUA 1NPKA 5BYRA 3KK1A 4Q2MA 2IBKA 1S6PB 2D41A 3GTYX 1VIEA 3HHTB 2XLIA 4X1VA 4KULA 1S0VA 3BJYA 2B8QA 2BW7A 4EYIB 3M6UA 3KBGA 3SDZA 1WF2A 2HZVA 3JCMg 2V69A 1VISA 2V50A 3V8KA 4D6WA 3NS6A 1YRXA 2DB1A 3JSYA 1ITPA 1KHWA 1CQNA 2L08A 4R25A 1M3AA 5GMDA 3VAHA 1HNIB 4AQYJ 4ATOA 2JMAA 3LGLA 2ECZA 4DBFA 3P49B 2L3MA 2IIHA 2V8KA 1XMQF 3PFEA 4F26A 3RB0A 1B7YB 4MIBA 1ROFA 2E1CA 1Y3KA 4AL5A 4XK8E 2MTLA 5F3ZA 4C8QD 1YJWA 4J6WA 3ZFVA 1BI2A 2EK6A 4ICLB 4B9LA 3LPYA 2CG8A 3MXHP 2X3DA 4KUDK 1UGVA 2DT9A 1R6VA 3ENWA 2VKRA 3B6BA 1S72A 1S72S 4Y00A 2C2KB 1S72T 2KO1A 1RBLA 4YHHJ 3BREA 2KZZA 4MDWA 2CAJA 1VQPT 1Q82R 3MDFA 1IJFB 4ES2A 1DQ8A 2CYYA 4OYWA 3RESA 1KRPA 3H5XA 4LDWA 5IXFA 5L1KA 1NK4A 5HL7Q 4W90B 1QE1B 3EFRA 3HVWA 4ECZA 4AFZC 3N0VA 1WHMA 3CCSQ 2M1HA 3UCUP 2NWMA 2WTFA 1WJRA 3RB4A 4DEZA 1EIYB 2ZBPA 2YDLA 4IUVA 3HPWA 2ASJA 1NDLA 3P5BP 4M8LA 3K59A 4JI1J 2EFIA 4B9NA 2J05A 1VQKQ 3BQ0A 1S1TA 1IQZA 1B0TA 2RVJA 4DEYA 2JEIA 2QX0A 2MI6A 3WQPA 3N5FA 3W64A 4IIMA 1HNXF 2ZH2A 3OTCA 1S0OA 4FVMA 2CGHA 5CK9A 2YUPA 4M5NA 2XLKA 2WVBA 3TANA 3DLMA 1VQ9T 3AJ2A 5FU6C 2G2OA 2OUGA 3KHRA 2CZ6B 4W4MA 4FYXB 2DY1A 3R5CA 1R8BA 5IT0A 5D3GA 2M70A 1G6BA 2MQ8A 5FU7B 2KM8C 5ETVA 3V8JA 2DBBA 3TNVA 4GKKF 1VQ8S 4A54A 4JI0J 5F8IA 1I1JA 1RTDA 3CCUS 4M77C 4FS2A 1AOJA 2Y4YA 1LW2A 4JJDA 2FC9A 3GONA 2V4JA 5KFKA 1V29B 1RAJA 1TL7A 2BEFA 2IJNA 1NJXA 5AXKA 1VHIA 3OVAA 3C14A 4NMLA 1ZM2A 3NWRA 2GGPA 4C0DC 1QVGA 3HHLA 4X34A 2PD1A 5IZHA 1YNZA 3FJ5A 3M54A 3NY0A 3RR8A 2AMCB 1M1KT 4WFBQ 3PRDA 3MAHA 3QLHA 3JSCA 5D6GA 1S97A 2MJNA 2FY1A 2V26A 3MUMP 4DUZF 1PBUA 5AXLA 1KHIA 2WVDA 4DV4J 5IXUA 1YJ7A 2ZHOA 3FRNA 1NZ8A 1YLXA 4P71A 1OPLA 1IM6A 2B6AA 2LXFA 1KD1T 2IVFB 3DDNA 1VQNQ 3VRZA 5C25B 2N3OA 4RTUA 3HHDA 1QVGR 1SPKA 2KRRA 4JUVA 1AZSA 3LAKA 1K9MT 4F4YA 2F4VF 5HI7A 5LJ3e 4JI4F 4WYWA 2BKOA 1H38A 1QY7A 4PUOA 1RL2A 3UDEA 2P4RA 2X3GA 3RB3A 1KVIA 1PYTA 5DQIA 2NR0A 3ILLA 2P5VA 3ULRB 1A0NB 3HJFA 2QE5A 4OYPA 2F65A 3U1LA 4WE1A 4U8YA 2VFTA 2VC8A 1VQLS 1VQLT 5F0UA 2L41A 3D2WA 4ZS6A 4NLWA 3PMTA 5KFFA 3DI6A 3CD6T 4USKA 3W66A 4KGVB 2NUHA 4P75A 1UE9A 1OY8A 1VFJA 3QFWA 4C8YA 1AVZC 1S79A 2OEJA 3KFVA 3TAQA 4JS5A 2B3TB 3CJQA 2PTKA 3TCJA 4DQIA