2OAUA

Mechanosensitive channel of small conductance (mscs)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
YAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Small-conductance mechanosensitive channel
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2oauA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oauA03
3HFKA 3CJKA 1MWYA 2AJ0A 2HFNA 3BDEA 2CRLA 1FE4A 2GGPB 2OD6A 3F44A 2VV5A 3TRGA 2K1RB 3KG1A 1GXTA 2LDIA 1FD8A 2RK2A 1CC7A 1CC8A 2FB0A 4OJ3A 5K9FA 2RILA 2AW0A 2OFHX 5B0CA 2ZDOA 2BJEA 5B09A 4HI1A 2OD4A 2GA7A 3DXSX 3HHLC 2XMTA 1X0PA 3HHLD 3FGVA 2LQBA 5F0WA 2JDJA 2HLUA 3HHLB 3QGPA 2PGCA 2P4TA 4F67A 1JWWA 1Q53A 2LQ9A 4U9RA 4A47A 2ZDPA 2KKHA 3T9NA 1FEEA 1RJJA 1N5VA 4A4JA 5B0BA 1FE0A 4Y2MA 2L3MA 1X7VA 2VH7A 3BF4A 5KAKA 2GV1A 2GGPA 4Q2LA 1TUVA 1YRXA 4DPOA 1SQEA 2IFXA 1URRA 1AW0A 1Y0HA 2FTRA 4OIXA 3BR8A 4EFAC 4NPOA 1U7LA 3BGUA 4HH0A 4HI2A 4Y2IA 1S6OA 2N4CA 5B0FA 1SB6A 2AP6A 2W4CA 5T7LB 2QLXA 4DN9A 3E8OA 2RMLA 2HLTA 3KKFA 3TNVA 3K7RA 2FIUA 3MCSA 4ZA1A 2RK1A 1SI9A 2RH2A 1GXUA 2ROPA 1LQ9A 1P8GA 4OJHA 1OQ6A 1APSA 1CPZA 2ASYA 3MZIA 1KVIA 2N4DA 5B0EA 1VQSA 1Y3KA 2K7KA 3GZ7A 3CJKB 3VTIA 1YG0A 2HIQA 1XBWA 2QIFA 1KQKA 2RSQA 1W2IA 4A48A 2OMOA 4FNHA 1OPZA 2ROGA 1IUJA 1VQYA 1FVQA 2K1RA 2QLWA 2XMJA 2HFOA 2LXFA 3IWXA 1Q8BA 2BUNA 2Q3PA 2ROEA 1N5TA 1JK9B 3LGMA 2W4PA 1N5SA 1TL4A 1TZ0A 5IXUA 1OSDA 2GQVA 1OQ3A 4NL5A 5T7LA 1AFIA 2XMKA 3LO3A 2HQIA 4YDXA 2K2PA 2KYZA 2N7YA 3HHLA 1TL5A 2GFFA 2QYCA 3KG0A 2KT2A 3IWLA 1QUPA 1YJTA 2ACYA 1WD6A 4YEAA 4ZOSA 1VIFA 5F0UA 4A46A 3DCAA 4DL0C 1FESA 2XMWA 1Q4RA 2EW9A 2BBEA 1YJUA 5B08A 4OJ1A 4OJGA 2AJ1A 4Q2MA 2K7JA 3KNGA 4HL9A 3LGNA 1AFJA 2KT3A 3BB5A 1R6YA 1Y3JA 3I9ZA 1VIEA 2OKQA 3HF5A 1V3ZA 2OAUA 4FNIA 3WDOA 5A6PA 2XMVA 5B0AA 2IYGA 2BYCA 1KVJA 3BN7A 3HDSA 3BM7A 2XMUA 1Y9OA 2FHMA 3HX9A 2BJDA 1X8DA 4QOTA 5A6WA 2W4DA 2XMMA 3TOQA 1YJRA 1K0VA 5B0GA 2G9OA 1YJVA 1FVSA 1N5QA 1P6TA 3QMQA 1TR0A 2IYIA 2OP5A 3FRYA 2GO8A 3FMBA 3UDCA 3SFMA 1S6UA 1ULRA 2OFGX 4Y2KA 2RU9A 1Q8LA 2GCFA 2PD1A 1MWZA 4HH1A 5B0DA
chains in the Genus database with same CATH superfamily
3RBXA 3LWLA 4EEYA 3CC4S 1TTHB 1XNQF 2RVJA 2IM0A 3TW0A 4J6XA 1YWPA 1H73A 4IUTA 3NHNA 4ECTA 2L9WA 4P74A 1YBYA 2LJ3A 4LRBA 3P5TL 5KG0A 2VOOA 4RWWA 1U26A 3CMET 3OA6A 3TEEA 3CMAA 2ILZA 2NCKL 3DRRB 3CMAT 2NXEA 3PO5A 1OZ2A 5HANA 1C0UB 4EFAC 2EPDA 4ME7A 4KO0A 2LJ1A 2WHOA 5DDRC 4GKJJ 2K3IA 2B8QA 3PX0A 2O4XB 2EQMA 1MU2B 2FJVA 2V8JA 2J0SD 3W63A 4CCHA 3HHNB 3L2UA 4NLSA 4B9SA 3KJVB 1H92A 2DGWA 3CCET 3X3UA 3A1PA 5BJRA 2B9YA 3PKYA 1K9MR 4QWDA 2HHQA 3GPAA 4F0MA 3HFOA 3N5BB 4NA1A 3K58A 3BEGB 4MFBB 2YPYA 3MECA 2ZHBA 1B7FA 3V6JA 4C98A 1M3CA 4U95A 1NHVA 2DETA 3EZOA 3L09A 2HBQB 3C95A 4M77C 2DH9A 2QQSA 4K5SA 4RW9B 2JS0A 2V5HG 3ENWA 4NEZA 2VKNA 3H25A 1S9GB 3OQ5A 3MOZA 4XIUA 2KJVA 3OT9A 2VF3A 2MKCA 1U45A 4RUAA 4EZ9A 2R58A 2DERA 2QA1A 1HHSA 1JXEA 2CJQA 2F4VJ 1JJ4A 2K57A 1NZAA 4NS5A 1FD8A 5DGAA 1KKHA 1EP4A 3BSOA 4C0DB 3G82B 5AXLA 1EIYB 1HNWF 2QA4T 2LMJA 2CQ3A 5M2PA 3Q1JA 5DQHA 3LQVA 1IBKJ 3A12A 1FE0A 5KAKA 2HHPA 3LLRA 1WNLA 4XDDA 4OYBA 2D9TA 2BX6A 3G8TA 1N56A 3MF5A 1T9UA 2FLPA 2OEKA 3OSVA 3VQTA 2RB7A 1CJVA 2EGCA 3M30A 5C42A 3HT3A 3CDBA 3CC4T 2QMWA 3MMCB 5KFAA 2BQRA 2ASDA 1LPLA 2HFOA 3FBBA 1WNEA 4ITSA 3S3NA 4J9UE 5D3GB 4DU7A 3RGIA 4KHPJ 1G5VA 1UPMB 3MD1A 3JB9G 2GVZB 2B4PA 3T3FA 3G6ET 3O44A 3TX0A 1UMJA 4O3NA 4M75G 1R0CB 4LDWA 2FHOB 3BN7A 2V4RA 5HROB 2XMMA 4FS2A 2B4UA 4KR0B 1Z2ZA 4NA3A 3R5AA 3IA0A 1M5VC 4F4WA 3IN5A 3F44A 2LDIA 1N27A 3EH1A 3UA7A 2FJAB 3VWSA 4I7FA 4FYDA 3C94A 1ZQ1A 5CVIA 2PI5A 3U1MA 2PMZD 4I2PA 5CQGA 2Y8YA 1CJTB 2DL5A 4UUWA 1Y0HA 2ZUAA 2GTJA 3IRXB 2YLCA 3K5OA 3A8EA 3C6UA 4C8QE 5A8KA 3CJ4A 1HWJA 1UA0A 2A7YA 1MNEA 4M7DC 4DL6A 3T1HJ 2R5MA 3VCDA 1SHGA 2R8GA 3H2VE 5I4MA 2MMYA 1NE8A 4PJNA 1REGX 1HPZB 4KKOB 4K11A 4NMLA 3QIDA 4NXMF 5CR2A 4I2QA 3VYGA 3TUIC 3J81j 3C8YA 1WKJA 2AYMA 2QK0A 2H65B 1K9MT 1NK5A 1CS4A 1B0PA 1YJWS 4R0JA 4DL5A 2CP2A 3LWMA 4DV3F 3MHYA 2EJFA 4W4MA 5HJYA 3OFEA 3CJSA 2V8HA 2CNKB 1YI2A 3I0RA 2D0QB 1VK8A 4A4KA 2BJ8A 4L6V3 2KYMA 1FFWB 4ED1A 3MEAA 1KBRA 3U1LA 3NNCA 1RT6B 3T5LA 3IXQA 1F3VA 2XYHB 2Z2ZA 3M0UA 1NDKA 4IIMA 1NK8A 2MOXA 4LR8A 2C3MA 2KZMA 4LDXA 5I11A 2GGRA 1NJXA 4PNOA 5HP1A 2O67A 2EYXA 5DY9A 2K06A 3GIRA 1T03B 1GAOA 1CBKA 3QGPA 2JM8A 3CD5A 2L3SA 5KT2A 3QIIA 3MR5A 5KYUB 1ZBXA 1RJJA 2VOPA 2ZH8A 3G71T 3DFEA 3DI6A 3A5ZB 1NEBA 3MPUB 4QQDA 4G1PA 4G3IA 2UVVA 1K8AU 3I56T 3OL9A 4DI6A 1PJ7A 2ZJQQ 1YRTA 3D28A 1NSAA 5EG2A 2DRBA 2WVBA 2IVWA 1Y07A 3GLXA 3EGZA 4F3OA 4RTWA 5GMEA 1KVKA 2RD5C 4EDUA 4EBDA 3P4UB 4J7CA 2CNOB 2ZZTA 2DZCA 5K8PA 2GFFA 2MWOA 4MKYA 2BQUA 2DKGA 2DRDA 2RI2A 3CDEA 2K4YA 1KWMA 5IWAJ 2YNGB 4DR2J 2Y4XA 5L9NA 3PJXA 4OI2A 2NUPA 3M0RA 3E2UA 4BY6B 3CCSS 1IXDA 4B3OA 3IMQJ 5GAMh 4M77E 3HPOA 3RKWA 4IFVA 3NGPA 2M8DB 1YJNQ 3Q8VA 4MZTA 4KV8B 1X4CA 5LJ3f 2BKDN 3S8SA 5F0WA 4IG0B 2M88A 3GLJA 1RT6A 4Y3CA 3D6MB 2RF2A 2X4YA 3KOAA 1VBZA 3SXLA 5HLFB 2QL5B 2HGNA 1VQNA 2CQHA 2PA8D 3OR1B 1EX8A 4ZJLA 2R7RA 4O4GA 1KHCA 2YQ0A 1UFLA 1N33J 4BDYA 2QASA 4Z88A 4K2XA 1ZX6A 4XU0A 2YX1A 5DGBA 4ED7A 2VASA 3W9HA 4MT1A 1N6QA 4K50A 5EHHA 1Q7YU 4ED4A 3NEKA 2W2QP 4CT8A 1LKZA 3CD0A 3ZFVA 4TXSA 1OPZA 3JSMA 1IHWA 3E19A 2O5DA 3OW2S 4K8RA 4KSEB 1NHUA 2QO3A 3F0NA 2DTOA 3RG6A 2DNMA 1BQNB 5IT4A 1NLKL 3K0JA 3EFSA 4YY3J 3MR3A 2ZZNA 4BE2A 3PVLA 2RT3A 4QWAA 3M8QA 5CA5A 2HZYA 3GOXA 3DRSA 1Y71A 3BGRB 3NAHA 2UUCF 4DLEA 4DR7J 4PCQA 1Q5YA 1LVKA 5A6WA 3QT6A 4DV0F 2P9GA 4CZCA 1IKYB 2M0YA 3VUZA 5F8MA 2V8IA 1IO6A 2UU9F 2CPYA 2GCFA 4HVWA 4CH1A 1UW9A 2LEAA 2YNGA 2KXDA 2VBZA 1FEHA 2XDDA 2CQ2A 1CJKB 3SCJE 4JI8F 3OVSA 2I8EA 4FIBA 3EPIA 4PQUA 1MN7A 3CCJA 2MTLA 1HR0F 1CEZA 4RW7B 2E5KA 4ZMMA 3KHRA 3MM8A 5ETLA 2R2RA 3KUGA 2RRAA 5K20B 1HQEA 1BCMA 1LWCB 1FJGF 4PG8A 1YJNS 5U47A 1N8RC 2IA6A 1Z4UA 4IG0A 3DOLB 5G0RB 1IBKF 1KQGB 2K7KA 1D3BB 4JI2J 3GR0A 4CC7A 2PO4A 2BQ3A 4JI3F 1WORA 1W70A 3NL0A 3QRRA 2RQVA 1S99A 4USKA 4B9NA 1YNZA 1R77A 2DTIA 1DQ9A 3TZZA 4KE5A 3WZ0A 2G2ZA 2QYGA 4EK2A 3HFZB 4LFCF 3L2ZA 1BWVA 5IZHA 3HRSA 1RHQB 1KC8U 3LP0A 1VLYA 3OYJA 2GBQA 4AYBD 2CT3A 1NJZA 3QJ6A 4BY6C 3UR0A 3L3CA 5GAN7 2R7OA 1WHLA 4C8QB 1BQNA 2L0AA 1NPKA 1H2TZ 4E7KA 3PCOB 4YHHF 2AYEA 2PMWA 2DCLA 3NTKA 2X7IA 3CCMQ 2RQ4A 2CP7A 1YITT 4N7TA 4OX9F 2XLJA 3W2VB 3W5YA 4RUGA 4LF7F 2OTLQ 4LF9J 3CCQA 4YP3A 1QVFR 3MKDA 1CULB 2W1BA 2LQJA 1N88A 4M5GA 1S9GA 2EYQA 3CMEQ 4M63A 2OPPB 2AGPA 1AUSL 2H5IB 3NGTA 2CZ1B 4DL3A 1RTIA 1BB9A 2FRYA 4Z89A 4C0GA 5A0YA 1RQ0A 3PEHA 1ZPWX 4DEYA 2BA9A 1S1UB 1AWXA 1KSWA 5D0GA 2EWHA 3R2CJ 3CCMA 3WC2A 1VFJA 3A8JA 1WEYA 3UF4A 3NBPB 1TL5A 2OSRA 3L2VA 1XMBA 1RSCA 2DD8S 2P4RA 3QZ9B 1UTIA 2SEMA 4C92C 2VONA 4NLRA 3RR7A 1VIEA 2F1LA 2FJEB 2GNKA 2BJ3A 5IT0A 1MROB 3M54A 2XYPB 1IKWB 3G8SA 1GFCA 1T0HA 3C14A 2UV8A 3M8SA 3DDKA 3HKWA 2M2BA 4X4TA 4PXCA 1WPYA 3PIOQ 1PCXA 4FF3A 3U02A 1PYSB 2UUBJ 1VBKA 4F16A 4FT2A 2KHDA 1K73R 5J26A 4X62F 4UUXA 2H54B 1WSVA 5LJ3g 2CADA 3P8DA 1PBAA 1NCLA 1T9TA 1PBUA 3T5HA 1YDLA 4ZITA 5M2RA 4II1A 1VQLA 4LMZA 1Q81U 1M1KU 1BD6A 5CQYA 4ZCLA 1BKBA 1SKUB 1NB2A 2QLXA 1X75C 1R27B 2FIUA 4AT1B 2RAQA 3BV8A 1Q86R 1EX4A 3VS3A 3TZWA 3GJQB 3QZ7A 2IDLA 1TS9A 1M90C 1YJ9T 4HVVA 2H1YA 2YTCA 5CYJA 3IC1A 3OY9A 3MM9B 2MZQA 5FLXE 2MZ1A 1OSDA 5T7LA 3K57A 1T3OA 4ES2A 3JS9A 2QQRA 1I07A 1MV0B 3WC0A 3D7SB 1JJ2P 2MDAA 1B3QA 3URGA 2BBEA 5KFWA 1J5OB 4QW9A 1N5YA 1WHJA 3CCLQ 1WHYA 4F4KA 5E3QA 3D6FB 1OY6A 2V69A 3MMBA 3NCRA 3J81Y 2O01E 2VUBA 4LSLA 1QW1A 3ZZOA 4YB1P 2B6AA 4DSJA 3VALA 4N4IA 4ZS6A 5EUHA 2AD9A 4AE5A 3CIMA 1WTFA 1KQSA 4HHHA 5ETOA 4K5RA 2DY9A 4J91A 1CC7A 4UOCA 3TA2A 2MPXC 3H98A 2PUOB 1DQAA 1RT7A 1NK7A 3ZZZA 1I3OB 5IAYA 1ZZNA 2CPHA 3MWBA 3QWXX 1DTTA 1WGSA 1WOPA 2OPRB 3BR8A 3MJXA 2LTOA 2Q6CA 4ID5B 1IR2A 2Y0BB 3UVJB 4U7UD 3MEDA 1KVIA 2DGSA 3MEKA 4LF5J 1BU1A 3EMTA 1C1AA 3GCWP 5LXRA 1JJCB 3I9QA 1RTHA 1BK2A 3D5MA 4LD6A 1IBLF 5DETA 5KFPA 4PAAA 2F2VA 2KT2A 4UC4A 4YEAA 4IO1A 1HBUB 2XCPA 3KUEA 1EQMA 1NM7A 1WEXA 2JTMA 5L46A 2Q79A 3DI6B 4JRIA 1N5ZA 2XMUA 2F69A 2N3LA 1FVSA 3CCVT 3MP6A 4ELVA 3PRVA 2VKZG 3PNIA 4AQYF 2GZOA 1TV6B 1FTRA 3QYYA 2E10A 5HQLA 2ZOMA 2CG4A 3UNYA 5DZ7A 4J9CA 1QVPA 3MEEA 4I67A 1TAQA 2DT9A 4J5YA 2XMTA 2OUGA 2XS2A 3EGDB 3CC7S 1XWLA 4DR3J 1RWNB 2NS1B 2J7KA 3BBCA 3X1LB 1UDLA 1LFWA 3BZQA 1PD1A 3T9NA 4JI0J 1WHVA 3DDNA 4A8YA 2RPNA 4LSNA 4ZCIA 2GMJA 2FTRA 2K3KA 4ER8A 1B0VA 2FPFA 3PFOA 1F6TA 2HHXA 3TNVA 2YBVA 2LMIA 4NOYA 2FPEA 2ZOGA 1HNVA 2AMCB 1LNXA 3N0VA 4IG3A 4PG5A 1F0XA 1R0AA 2NUTB 1VGYA 2PFFB 4MDWA 4KBIA 4Q43A 1JLCA 3S6WA 3W60A 3CC2Q 2YWGA 2UVWA 4XPEA 3QYGB 3G6EA 3I87A 3I82A 3CBPA 4JI3J 5I2SA 3CPWS 4DR4J 2YLBA 4Q2MA 1WF0A 4OX7A 4D8DA 1VQNQ 3FKBA 1M1FA 2HK2A 4B3MF 4FYXB 2ZM6J 4USUA 3SDEA 3DKDA 2DAQA 3SFMA 1AXQA 2A6MA 4I69A 1UGQB 5LJ3h 3WQPA 3QG1A 1HMVA 2QTWA 3UE2A 2VJVA 4LF4J 2KG1A 1HBNB 2JTEA 3LWIA 4LUEA 4P2SA 2CXEA 2WSCC 3LGFA 1V9OA 1XR6A 3CJ3A 1WI7A 3AQPA 2QLBB 2YY3A 3PRBA 1ZOTA 2HWTA 2YX7A 3BQ1A 3TVYA 2A3JA 1U0SA 3V7RA 3TJ9A 2C3OA 1M3AA 3AXKA 3BS9A 3RKXA 4WFAQ 4OI4A 1FRLA 2CREA 4LF9F 2RS8A 2DEQA 2EYYA 1LV5A 1XQIA 2UXDF 6FDRA 5DRKA 2WSEE 3NS7B 4PEOA 3C66A 2U1AA 3A1YG 4N56A 2ADCA 1S97A 1XR5A 3KMQA 1VDHA 2EWNA 5KYWA 3AY0A 4NRUA 3L2WA 1H8KA 5CAAA 4IQXA 1FMWA 1SJ1A 2SRCA 1U02A 4ZIWA 5BYRA 2Y0SD 4M7AA 1LXNA 3FSYA 2IIHA 4DWIA 4DV2J 3IR6B 3N5FA 4JJNK 4HDGA 5K14B 1X31C 2ALZA 3MGJA 1TMJA 4W98A 1K0VA 1LJOA 1ROFA 3ZTRA 5D15A 1L3UA 3MFHA 1WJSA 2MYFA 4KYZA 2M16A 2X9HA 3L9ZA 3O5TB 2EQUA 3CJKA 4OMFB 1T11A 2LRQA 2CWXA 4MZMA 2ENMA 2QTXA 1U1PA 3I55S 4JJBA 2CA9A 4JI7F 4AFFA 1Q82T 2OTJS 4F4AA 4DV6F 1KD1T 5D0HA 4WCIA 2BE2B 4FCYA 4Q2LA 1E6VB 1AZEA 1N4LA 1SV5B 4KIAA 1XNRJ 1K47A 1YI2T 2KN4A 2NXNA 1HKAA 1PKTA 5DLOA 1U1NA 2ZCFB 4UOFA 1PM3A 4IYQA 5A76A 3ER0A 3H4BA 1JLBA 4I68A 2CDQA 1PYTA 1RAGB 2HURA 1Q8BA 2C2ZB 1UHFA 1H3ZA 1Q82U 3BQ0A 1HD1A 1NM2A 1NSQA 1FXLA 2HNZB 3A3PB 4F02A 4CYUB 1PSDA 4JLIA 3LP1A 3AQOA 3R5JB 3PT9A 3RB3A 1VQ5S 5GAGU 2F1FA 1HI0P 2ZJRQ 2XHWA 3V4MA 3AH6A 3W8PA 5GMKe 2VXFA 2BJ1A 4MH8A 2EQKA 1OWXA 3EVOA 2W2NP 2DH8A 1FE4A 3OLAA 1R3NA 3FCVA 2M9KA 4RW6B 5KT5A 2ZHAA 1RHKB 2VA2A 2JHEA 2LYVA 2X4JA 2IRYA 3HHLD 3GV8B 4CT9A 2OTLS 1WXUA 3HHLB 4DFJA 2P4TA 3NMAA 4X4PA 3E2EA 3OTCA 3JTOA 1NK0A 3FUYA 3GG0A 2AEFA 1FX4A 1T0JA 3CC7T 3A4TA 2KQWA 3CD7A 2NR0A 1PG5B 2JUFA 5CABA 5KFEA 1Y3KA 1S9FA 1LWFB 3OJUA 3FJPA 2M3DA 2RNEA 3EG1A 2CQPA 1CG2A 2DB1A 5KFXA 2CFXA 3W65A 2ESWA 1GK8A 3K5MA 2QSWA 1B7YB 5SUHA 1S72Q 4B6MA 4QR2A 5IQQA 4O4RA 3MHXA 2FHDA 1O8BA 1JNRB 2AJ1A 2PUKB 1G8XA 2J8AA 2KT3A 2KVQE 2NYIA 2BZ2A 3V7CA 1W2BA 1K73C 2ZZMA 2MGZB 2BYCA 1BLUA 4PL6A 2F65A 1X8DA 1P6TA 2OP5A 3MD3A 3SCLE 1VYTA 4LRDA 3NRBA 4YFUA 4E47A 2I0XA 5ITHA 4A8QA 3W2WB 4GLMA 2E64A 1G2EA 1NB7A 4FSXA 4XK8E 3EPGA 2OTJQ 2DNPA 4M78G 4ETZA 2RDJA 1KTQA 3LW5E 2F8MA 3W64A 4XTYA 2V2VA 4L5GA 1UGPB 2E7WA 5M2UA 5KG2A 2CPXA 1MWQA 2XZDB 2MQMA 3TQEA 2RHXA 2YNFA 3MI7X 3JQMA 3DKMA 5GMKh 3J7A1 1N8RT 2VG5B 1RBOB 4P2FA 1SQGA 3H9NA 3NGDA 4AFUC 3JQKA 2ZPEB 2DGQA 5ETTA 5DM6Q 2H3JA 5IHKA 2JLEA 4LSLB 2ZBIA 3A98A 1YHQA 1RYRA 1WDXA 4OB3B 1NPPA 5LMUF 2WVDA 4HVUA 1UVNA 2ROGA 2JLGA 3EICA 1Z2LA 2CSQA 5HP1B 1N5TA 1LK7A 1TL4A 5GAHI 2NZCA 2HS0A 2PE8A 1SPKA 2HW3A 4JV0A 1VQ8Q 1M90U 1IQZA 4DLGA 2FY8A 1ZM4A 3OTOF 2LQ8A 1Y3JA 2DYBA 3KLFB 2AZ3A 3VHQA 3HK2A 2D0NA 2Y4YA 3CMEA 3N6NA 3UN2A 4IKFA 4J9FA 2G9OA 2XLIA 1JJ2S 1N5QA 2RN8A 2AZVA 1PIEA 4HR2A 3ZZUA 4J9OA 1A9NB 3AJ2A 2J6SA 1MMDA 4J7IA 2RRBA 2YRCA 4HTIA 3DGPB 5IQ6A 2FZGB 1UEUA 4Q0BB 1WC4A 1FDAA 3LTOA 3CCRS 2E9RX 2DXUA 3OTDA 4LF8F 1VC0A 2HKQB 3ET6A 5EN1A 3TWZA 5F3TA 2P2CB 3E8OA 4AL6A 2HLTA 1FHTA 3QGHA 2OJ3A 2XGPA 4JI4F 1TKTB 4DPWA 2CP5A 3OYCA 2AZSA 4CLZA 4LXCA 3ENQA 3DLMA 1P1TA 3CCUS 4UY8T 2X3DA 3N01A 4DQPA 4QT7A 3QSIA 3V8KA 5DG9A 1W4SA 1SJ4P 4KPYA 2LQ5A 4LFAJ 3WXMB 1TVRA 3VKIA 3GP8A 3MMAB 1I51B 3M6WA 2YQ1A 2QA4Q 2DD5A 4IUUA 1MU2A 4A46A 3QGIA 3JSCA 5GAMf 3KJVA 1S10A 3PW0A 5GAMd 4NRTA 5D6GA 4DOVA 3AD9C 1VC6A 3JB9F 1LK5A 3ZTSA 3MCNA 5EC7A 3MECB 2D7SA 1PCAA 2F63A 5GANe 4J9HA 4MK8A 1Q8LA 4OYXA 5B0DA 4F4ZA 4K4ZA 3J80Y 8ATCB 4M7AE 3MR7A 1JJ2R 5C2CA 1ABOA 1VYAA 4LBHA 2V1RA 2MWPA 1M8VA 5BR8J 2FL7A 1VQPA 1H38A 4DQIA 1I0CA 5HVFA 5I21A 1Q53A 4A47A 1X60A 2B5JA 4BI4A 1YJWA 1SSHA 1T9VA 4NCBA 1XIQA 2GTOA 2KAFA 4WXOA 2V50A 4E6RA 4JI7J 5FU6B 2CJXB 5K8OA 2VJUA 5DG8A 4P7TA 1VQOA 2C1EB 2DLPA 2HCKA 2P8IA 1RAEB 3OXGA 1G4CA 4D8KA 3M9OB 3HFVA 2RO0A 2V4QA 3CCVS 3GIIA 1VQ8S 1GCPA 3BKFA 2JTFA 2B8PA 2IPOB 1CSJA 2A1BA 2YVSA 4J9VA 2E6NA 1RWWB 4H4KA 3OS0A 3CC2T 2LP4A 3MM8B 5C7PA 2FLLA 3UDLA 2QX0A 1N8RU 3R5DA 2CPZA 1D0EA 1RHUB 4XU3A 5KT7A 3CQTA 1NJYA 4Z7YA 2C06A 4B3RF 2B86A 4BCAA 3BSNA 3OHAA 1OX9A 2GJFA 2PQWA 2Z2LA 1R43A 4FBTA 4X65J 1PSEA 1FO1A 1VQLT 1GT8A 2VQEJ 2FO0A 4WWSA 1F5AA 2VD3A 3HTRA 3E01A 2MKYA 5GAMe 3FZBA 1QWFA 2RI3A 2LQ9A 1JX4A 4M78C 1RT1B 1YBAA 2GV1A 3CF5Q 5K14A 2XKOC 4C8ZA 3FFIB 4PWWA 5GAN6 1S6QB 1GQEA 4E7ZA 5LJ5Y 4LREA 1Q0NA 3MUVP 4RG2A 4B17A 5AXKA 2DO0A 1LXJA 1GBRA 2HL3A 3A8GB 4FPRA 3N6MA 4EBCA 4L3NA 1S0NA 2MEWA 3G6YA 2DEJA 3KLVA 3B6BA 5L9XA 4ZP8A 4EI2A 1ZAXA 1K1SA 2HVEA 5A8RB 2DBKA 4HCZA 1DTQB 1U48A 3TSWA 4NXNJ 3ITHB 2CPJA 2HKEA 2ZH7A 3NLCA 3CPWP 4RKUC 1QSLA 2GO8A 1S6UA 5KFDA 4M77A 3WX8A 3K17A 1TFWA 5ETQA 3H5SA 1WHGA 4ZP9A 1U1OA 4XTTA 3KG1A 4ZGDB 2HEKA 4OHVA 2RK2A 4DFKA 3FQLA 3CDAA 2G2OA 1QWEA 2EFIA 1VQKT 1DAXA 4CLSA 4C8MA 1ELOA 4FSSA 3W61A 3QT5A 3P49B 3CJQA 2V4JA 4C8LA 1TXQA 1MUZA 1XQHA 3C16A 4QYZJ 4QPXA 2HNZA 3H8YA 2D8JA 2LZ6B 4CYUA 4IOBA 4QKUA 1RWPB 4TVAB 4IR1A 2YWEA 1YIJQ 1JIHA 2DXDA 5H9EK 1S72S 3K7RA 2EFVA 3H5UA 2XS5A 2OPSA 4ZVQB 2WZ1A 2PN6A 2I9SA 2E6ZA 1UVKA 1C1BA 3JRZA 4PKDB 1UFKA 5DM7R 1S48A 1F9FA 4OMFG 5D0RA 4RCCA 4ZVPB 1VQ8T 2E5HA 4RWXA 3MP1A 2QDLA 2V8KA 2K6DA 1VQ5A 5C25A 5LMUJ 2RB6A 1JKHA 2EFPA 2CPEA 4JJCA 1WD6A 2DHSA 2XMWA 1JU5C 2ZVSA 3IRWP 3JTNA 1SEMA 1JO8A 3OXFA 3TVTA 2JLFA 2W25A 3M59A 4QVZA 4HT9A 2XMVA 4M7DG 3G8QA 1IBCB 1WUUA 2B0GA 5F41A 2MF2A 4I4BA 3LA0A 4N0AA 5EWEA 3KJFB 1SJFA 2FJDB 1MWYA 2MQOA 1JBMA 4M7AC 4XTVA 3DM2B 4OJ3A 1Y10A 4JDSA 5JMNA 1B4SA 4BB7A 3CJ2A 3DC2A 3BN4A 2KM8B 1B99A 2LKZA 4F67A 3MTKA 4ZN3A 3RMQA 3B54A 1RKIA 1OZ3A 3NGKA 2AHJB 4A4JA 3BGFA 2EK1A 6AT1B 3OPKA 3GYXB 1X4HA 2GFAA 3MMBB 4YOEA 2LCWA 3M0QA 3Q8PB 2YT6A 2UXBF 3SB2A 3KKFA 3MEWA 3V8LA 1U25A 4ZPVR 3QRQA 3U23A 2K3BA 2C2NA 3VS5A 1U5SA 1QUVA 3M9MB 1YWOA 2WSFE 2YWWA 1U0HB 3C16B 2JMCA 2K1RA 2GFUA 1UB4A 2ZHOA 3OYMA 3FCWA 1Q78A 5DDQC 5CCAA 1RBLA 1UFFA 4K59A 1G3OA 2BRLA 1XOVA 2RUSA 5D4NA 5D78A 2MQPA 2J6UA 2V2QA 2E5QA 1W2BS 4TU7A 4JI4J 2HZAA 1VQ4Q 2DNZA 4EIKA 3BYPA 2BOPA 4EZ6A 1JJHA 2HRTA 5FIIA 1R8AA 1B7TA 5E0OA 5SZTA 4GO7X 3CMAQ 3RIRA 2KL8A 4QIGA 2JZ5A 4N4HA 4C4WA 3M6UA 4ID5A 4B9VA 3DU6A 1NZ8A 1ZYQA 2LCCA 2F4FA 5C25B 4M75E 1YHQQ 3R2DJ 2PD1A 4WFZA 1X5PA 3X24B 2W9BA 5THWA 2QYZA 3CCVA 3OR1A 4CRIA 2PZ1A 4E7LA 4LQ3A 4KB7A 4P72A 3BGRA 2FY1A 2X3WD 4AG2C 3R8YA 2F40A 3D6HB 3H90A 2Z0WA 4Q5VA 1GTHA 2DK3A 3RAQA 1U1QA 2RHUA 2G3RA 3CCSQ 3TVZA 1EHWA 4QW8A 2AT1B 5DO2A 4ZLNA 3MCOA 1OV3A 2J9EA 2J6TA 2HQ3A 3HSDA 2U2FA 3KLFA 3R27A 3VS1A 4NCAA 2FPDA 1B34B 1U7LA 1DQ8A 4C3MA 1WYXA 4TU9A 2QA4S 1XJWB 1W2BR 3DHWC 2ADBA 3G86A 5DDOC 1TU0B 4RNFA 1HXDA 4OI3A 2PI4A 4QU7A 3MM7A 3ZBDA 2LXUA 4LF6J 3GG1A 5KFVA 3DGPA 2DZ9A 1QVGR 4RZRA 2OI3A 4TY8A 4NLXA 4CI0B 3R6LB 2AHOB 2IM2A 1W25A 3OVAA 4LJMA 3FRNA 1BI3A 3CCQQ 5KFLA 1YBUA 1YBTA 1VBXA 3DYAA 1K76A 3D1HA 1RU2A 2HHVA 4M5JA 3TUZC 4CDIA 2ZFHA 2IAJB 3PYFA 3MFIA 3M8RA 1RT2A 2NZ4A 2ZNZA 1TKTA 4KY3A 1OYEA 3HVAA 1PC5A 2C0TA 4JRKA 3B8HA 2CUDA 5DM7Q 2UXCJ 1Z1ZA 3HSZA 2R8KA 2RRNA 2BABA 2YKNA 2AW0A 4M8LA 3CCJT 4JUZA 2EJ9A 3TAMA 1XR7A 3GU0A 1AZSA 4CC2A 2IM1A 1E6YA 4FXVA 2NUHA 4C8QA 3L95X 4PLLA 4GVBA 2J7IA 2O1PA 4WU3A 4OMPA 4KH1B 2JC0A 3OHBA 4TU8A 1RAOA 2YX4A 3SEOA 3VZIA 3NGRA 2DXEA 3T6BA 1UZDA 3DOKA 1KD1R 1UJ5A 2ZVIA 3NGUA 3M2RB 1R89A 3EWGA 1VUBA 2CPDA 1ZH5A 3GFZA 2EFGA 2V1QA 1KEKA 4X4OA 5GVQA 3BFMA 3VS0A 3LP0B 1XK8A 2XU8A 1S1XA 4X4NA 4OMMA 2ZC4A 2FJBB 3SQGB 1OPKA 3BH6B 1N34J 4YTLA 3NAIA 1RZMA 2AIRB 2XNQA 1T94A 4NLVA 4TLRA 1HBOB 4OJ1A 3AB4B 3VUBA 3S7RA 2J6KA 4BD3A 1WEZA 1XTZA 4F26A 1IBMF 4U67Q 2W2MP 1F9EB 1QP2A 4RTXA 3HLUA 2XS7A 3LPEA 5AYFA 1SUQA 1OS5A 2B4VA 1KFZA 2DR6A 3U1NA 3PNWC 4CWBA 2AJQA 1UL3A 1CULA 1S1TB 5I3UA 1Y11A 1T02A 4DV0J 2J9CA 2VIHA 3I5BA 4HLBA 2YXYA 4OHXA 4CC4B 4OHZA 4LDYA 4J9PA 2KG0A 4BUGA 2RS2A 2PVGB 3GR1A 1U1RA 5F9LA 4PJJA 1E7OA 1VK3A 3D6TB 1ZUYA 3IR7B 1RUWA 4Y2IA 2QL7B 2COYA 2W4CA 2M7SA 3ZXWA 4MIAA 5C24B 2JEGA 3PG9A 2CZ9A 2R8JA 4UTGA 3HRUA 2F2WA 4ZVFA 1SL0A 1D8YA 2D1XA 3MZIA 2NYSA 1PC4A 4NLGA 3C19A 4PPZA 3RW7A 5CK9A 3TCJA 1KQKA 4D6WA 1T9XA 1KHVA 4JYAJ 3ILLA 1S1VB 2IVMA 2JX2A 1SBRA 1KC8C 1XTDA 1WHHA 1MROA 2HBZB 3QWPA 1SJQA 2QDYB 5HMXA 1M90R 1S1WA 2DJZA 3NKYA 2EW9A 3A8HB 4BS2A 3IAM9 3THTA 3I55Q 3CULA 1VQ9T 2IC3B 4K4WA 2V6AA 4LDVA 4S0MA 1LNQA 3CC4A 2KDOA 1SH3A 2RDDA 3QDFA 2DJQA 4WK3A 1S6QA 3DLHA 4LQ9A 3IFEA 3L4BC 4QIEA 1Q1KA 2HS3A 2CH4W 3GCXP 5J2PA 1AA1B 1CC8A 1OY8A 4TYAA 5HN0A 2FGOA 1U49A 1KDNA 2ZD1A 5B09A 3LGLA 1IGQA 2GA7A 3HHLC 4CLFA 1K44A 2MXYA 2JDJA 3DMJB 2QZ8A 3J7YI 3CNQP 2JNGA 2JJ9A 5KFBA 3S6EA 3FJ2A 2HQHA 3Q86A 4R0KA 4ECUA 4XTZA 3I32A 2R7SA 2JEIA 2DL4A 2NLWA 2D9OA 3HZGA 3BQ2A 3R97A 3AD8C 4DX5A 5T7LB 3G9CA 1GRIA 1RT7B 3IGNA 2C3UA 1J2VA 3CPFA 1K8AC 4CQ1A 3EG9A 1J5OA 2HIQA 4CLUA 3JAMY 2F8EX 4C0BA 3Q83A 2DK2A 3QJPA 4HHUA 1NDLA 4NE9C 3M9NB 2Z56B 2V8DA 4HT8A 1U2CA 3UVJA 2B3TB 5GAOn 5J2NA 3JCMV 2V4JB 2X4XA 4VUBA 3TARA 2E29A 4ECWA 4C97A 1YLXA 2WVCA 5A2QU 2KYBA 4QJVA 3C15A 2GVDB 4EU0A 3VS6A 1GTEA 4C0FA 1PJ6A 4BACA 1M4ZA 2ZBQA 5GMKm 3IG1B 1Q7YC 2VB6A 1FXXA 4AFZC 3R7NB 2MKSA 3OB9A 5GAEU 2K9GA 1XC9A 1H641 2J9DA 3M6VA 2HG4A 3NOCA 2ZAEA 3OYYA 4FN5A 4C2MA 3KLGA 4FS1A 3O1LA 2PEHA 4ANEA 3QJYA 1E6HA 4A54A 2D3ZA 2D3O1 1RAJA 2R2TA 1F3FA 1S72A 2CJBA 3DN9A 4B9LA 1A0OB 2PFDA 2UUBF 3BE3A 3PACA 3OTEA 4D3GA 3FSIA 3VAJA 2E44A 4Y28C 3I0SB 2FYKA 4RLEA 3TI0A 3RYLA 4X2BA 1DARA 3MPWA 4BHQA 3LAMA 2VGNA 2J06A 5DZ6A 1X4EA 1MMAA 1TKZB 3JCMX 4MK7A 4PJLA 2MLZA 3EM1A 4JP8A 5IT9E 4QW2A 4C5GA 2QT7A 2XMKA 1F60B 4G1QA 2HQFA 5HI7A 3JB9H 3CCQT 5BYQA 2NLUA 2HIYA 2YNFB 3KLHB 1O51A 3GIJA 1R0AB 2MCNA 3RERA 1IR0A 1ZSZC 3I5CA 4N0AC 3VAKA 4HCKA 1UJ0A 2NUUG 1VRUB 3M4GA 2VC0A 2E3IA 3M8WA 2HZCA 2B56A 1M1HA 4AFSC 4L3KA 3FEXB 3GQCA 2EG2A 2EC0A 4B3SJ 1I5LA 4LSNB 2L08A 4ZJQA 2PEBA 3G6XA 1ZBTA 2J76E 2IM3A 1VC5A 5KFHA 3MEUA 1YTYA 3THPA 1HNVB 3JAMU 4ZLPA 2VDHA 4JUVA 2HMIB 1FEEA 2W8KA 1QKWA 5GAOp 2ZOFA 3M1VB 1VQ9A 3PRDA 2JC1A 3UD3P 5C5JA 4RJVA 4OYZA 2FC8A 3HHEA 2KMTA 4IDKB 4ZVGA 2R3VA 1K73U 4IURA 3M2VA 3HSJA 3MM5B 3QXEB 1VQLS 2BV3A 2BUDA 2XIDA 2BE7D 2F9DA 2GHVC 5D0EA 2E3HA 1IR1A 1P27B 1M2VB 2ROEA 3M7VA 4M7DD 2JRSA 1NK4A 1VQ6A 1KHIA 5J1NA 3AOBA 2J8SA 1NPRA 3AODA 1Q81C 1M1KC 2QSFA 3QSYB 4PFPA 1TKZA 3G4SA 4IIOA 4R25A 2UUWA 4WCEQ 5JUMA 3DRRA 2WTFA 3ZTQA 4K0KF 2OAUA 2LU2A 5LJ3Y 5CQXA 1MV3A 3BPSP 1A6LA 2KE9A 3R5BA 2XO6A 2D41A 5C42B 1X43A 3KFVA 4ZOSA 1RISA 2FHKA 4WFXA 4IRCA 3L1AA 2CQCA 2ZPBB 1GX6A 4N8OA 3F41A 4F14A 3OBIA 2KB2A 2XD0A 2J6OA 2CDTA 1D9AA 2JVOA 3VVUA 2LEBA 1YI2S 2KXFA 1G6BA 3OYAA 4C92F 5AT1B 5KFFA 3KNAA 2ZJPQ 1ZZFA 3OV7A 2D6FA 1HSQA 1GL5A 3DGVA 5KYWB 4UQGA 2IJNA 2YWKA 3NGSA 5CYMA 2E9ZA 2JXBA 5B0EA 3D3CJ 4OLPA 2M8HA 5FWCA 4KHPF 3V7SA 2C0IA 1ZSGA 5KE3A 1Q82C 3EZ5A 2LXFA 4F2SA 4Q8FA 1IKXA 3ELHA 4X64F 4PXBA 4IDKA 4P9SA 5EWGA 1Q5VA 3M2VB 5IH2A 1WG4A 4DS4A 1KSPA 4WF9Q 1K8AT 3GE9A 4KGVB 4WBFA 4ZVRB 3GMGA 4WXWA 2VL1A 2HSEB 1KLNA 3D1QA 2XDBA 5A8KB 4ZPTR 2FHJD 1YJ7A 1L3KA 4USHA 5KFTA 4RMOA 1OJ4A 2BEFA 4OB0B 3TREA 3TZXA 2C42A 1QE1A 3IWNC 5HATA 3R1HA 1JLGA 1ZA1B 1YVFA 4M5IA 3BDEA 2HMAA 4QPTA 3V4IA 3A8MB 2EFQA 4KGZB 2DNNA 4BLGA 3BDUA 3G2XA 1WIEA 1Q79A 4ELYC 3C6TB 3V5RA 4Y92A 3OYBA 5HJXA 1F2HA 5CO7A 4OI1A 1KQ2A 1X6BA 2E1RA 2IDEA 4RCBA 2MKHA 1OPIA 4RTYA 2ZEJA 2XBPA 1KFSA 1Q86C 3OR2B 3I4PA 2DO3A 1TK8A 3I5SA 4ESRA 5KYXA 3J7YU 7FDRA 1SL2A 1GXLA 1LQ9A 3EFRA 2V9KA 2CS7A 4CLWA 2BR0A 4JS4A 2E41A 3AA9A 4KTQA 2V9WA 3PKMA 4QYRA 5I3UB 1C0MA 1WHMA 3DDIA 1NUEA 3OFFA 4PWUA 1V3SA 3CD6Q 5CYMB 3WHIA 3CMAS 3CW2C 1HQUB 5KYUA 3RESA 1MN9A 3DLKB 1ZPVA 2XICA 4RNNA 2LECA 1YITQ 3ZEHA 3J7AF 1Q7LB 3Q89A 3J7Z5 2CQIA 4BDPA 4Z8AA 1F1BB 1YK9A 1C0TB 3PTWA 3FDSA 1IKXB 3ETMA 3FMWA 1JMTA 2VBYA 1EKRA 1WX6A 2VYTA 3HI9A 1JXMA 2VU5A 4M94A 2NQPA 1FKOB 2L3PA 2D3OR 1WACA 3JXOA 2LQKA 5H9EJ 1PKUA 2EKYA 4I6WA 5KFOA 3OJSA 3KFWX 3HJVA 4ES1A 2BJEA 2KFYA 2H8HA 3IS9A 1RT5A 2PSZA 2B51A 3E9GA 4DR6F 5KFJA 3K5NA 2C2RA 4WU2A 2HFSA 4DFPA 4OYAA 4ZHRB 4LE9A 1FWLA 2IJRA 3OYEA 3G4SQ 4M78B 4USMA 3V4IB 4NASA 2VFUA 1DTQA 3OUYB 5GJWB 3OVBA 2XWYA 3CC4Q 3KUFA 5AE2A 4B3OB 2NXCA 5M9OA 4OJHA 5KYYB 1GH8A 2N4DA 1IWGA 2L89A 2W9CB 4J9SA 4FNHA 1HNIB 4OYMA 2VG5A 5J2PB 2A0FB 2M1HA 1FCAA 2ZPIB 3H0FA 4BDZA 3M2UB 3CCJS 2UZAA 1RTJB 4YDXA 4PFOA 2K79A 3I31A 4E7JA 1NJWA 3ETOA 4LF2A 4DL0C 4AL7A 2BKNA 2EBGA 5KCHA 4DBFA 4OZNA 4MTPA 2OELA 1WHXA 3MR2A 5IT9U 4WZMA 3ZNUA 4ATOA 4OI6A 5ETMA 4DPYA 3GFYA 5D4PA 3V6DB 2CP3A 2RJDA 2P5VA 1VQOT 3KK2B 1X0FA 3H0PA 4TYBA 2V34A 3CWJA 4XAXB 2H5EA 1V76A 1N33F 5CIUA 3VV0A 2VG6A 4U8VA 4DR1J 4CO4A 1OU8A 2GIRA 5L1IA 2ZGWA 2KXCA 1XNQJ 4WTOB 1VQNT 4ZN1A 2WB4A 4ILMA 1RT4B 2ZPHB 4MMLA 3BPDA 4IUVA 3LP2B 3VGSA 4M5NA 1WELA 4USIA 2JL9A 4FZVA 3M8PB 1KD1U 1GMVA 1YJ9S 4WIQA 1WA7A 4J9MA 2ROTA 4UOGA 1FK9B 4J9KA 4KV8A 5FD1A 2XY7A 2CJ9A 2MLXA 2QEXT 5F9NA 4PQUB 4DR7F 1YJWQ 1QCFA 5J1PA 1H3DA 3RRGA 5HLFA 1CLFA 5L1KA 1U4BA 4E8UA 4ZPAA 1QVFA 3HDSA 2FHMA 3UCUP 5LSRA 2JVVA 1WC1A 3BSCA 4GLKA 1FDBA 2O9SA 3SSRA 1U6ZA 2GMHA 2YKAA 2AJ4A 4KAIA 3J81E 2CRLA 1TL3B 2K1RB 4RUHA 4NMXA 3AT1B 5L1LA 3ZZ0A 2G0JA 3FDRA 2ZPFB 3JQJA 2CQBA 5FWBA 3JSRA 1QAXA 3R7SB 2HYIB 3FEOA 4ICLB 1C4CA 5B0BA 1HW9A 4OZ3A 3ZZYA 1URNA 1SCJB 4FT4A 1HNWJ 4LR9A 3MMAA 1D1BA 2MLYA 2JOQA 2VODA 4OMLA 1VQ4T 2V2KA 1JLQA 3EE3A 3NOGA 2VG6B 3KJQB 1TQLA 3TEHB 3EVMA 4MMOA 5GADI 4B9XA 3CCVQ 2EK6A 3SCIE 4AMCA 3CC2S 3UI3A 4LFCJ 1JK9B 2G1DA 2FVPA 4CNZA 2VHGA 2QL9B 4HCBA 2RA2A 4K4TA 1MGQA 4KFBB 1T0TV 3T5JA 2HGMA 4FVCA 3UT1A 4PKCC 2CJYB 2HEQA 2CH4A 3QO3A 2A6OA 9ATCB 3LPYA 4E7HA 3F73A 3CMQA 4ED3A 4V19X 1LWCA 3FZ2A 4YN3B 1F9HA 2J5AA 2HHSA 5B0GA 1SQFA 4EUVA 3TP2A 3NWRA 3NMZC 2QGFB 1X2QA 2KROA 3IP0A 2B9XA 4LF7J 5GMDA 3JCMh 3R5GA 1TKXB 2PMHA 3GNFB 4AXIA 1BQXA 2BRKA 4NWBA 4ZP6A 5HKCA 3ZZTA 4LN2A 1MG7A 3CGIA 2XG8D 1L3TA 1FA0A 1FF2A 1TL7B 3KHGA 4TQSA 1FYNA 3MEGA 2IAJA 2DR8A 2ATLA 2XSFA 1FNOA 4MZPA 1OI1A 3IBCB 4FP9A 4ZLJA 2HFZA 5HVGA 2VBWA 2EFOA 2W2OP 4LF8J 3FEYB 2QIFA 1W2BP 1BI1A 4C5EA 4HT7A 3QPHA 4KT0C 2CZ4A 1UVMA 3NCPA 2G2YA 3QIPA 2VDIA 2GW8A 3QZ5B 5KFMA 3WX4A 1E6YB 1RBAA 2R2SA 1PWTA 2ACYA 1JLQB 3UO0A 4EMDA 4B9UA 4OZ2A 2V2ZA 5KG3A 1YWXA 3H41A 2YUPA 4RUBA 3RB0A 3R6OA 4DV3J 1R8OB 3HX9A 2X35A 4JI5J 3M2RA 1HNZF 5KFYA 1Q16B 4HA8A 1G3YA 4ZVEA 1VQPT 4NI2B 2DRAA 3PXGa 1CQMA 2COZA 3S3MA 1Q95G 4WTYA 1S1XB 4FXDA 5T41A 3GNGA 3HT0A 3EDRB 1JLEA 4K2JA 2APOA 4FU6A 5BYSA 2H4WB 2UP1A 4I6YA 4M77B 2Z30B 4RU9A 4F17A 2RHZA 2ZC3A 3EZUA 1YIJS 4GKKJ 4C8QG 1AUDA 2BIVA 3E1SA 4B9MA 2MQNA 5J2MB 4DR6J 3AFGA 3ENAA 4D3HA 1RGVA 4DN9A 2KY9A 1NH7A 2OAWA 5GANf 2BVZA 3P8HA 1RLQC 2RQMA 4B3TF 5KG6A 4F04B 2QTVA 3J80U 2DMOA 4KGXB 1Q7YR 2VFRA 2I6WA 2Q3PA 4M5LA 3TX8A 3ITHA 2W4PA 1TZ0A 3REAB 1DLOB 4PRFA 1T3NA 2DKOB 2V8PA 4J9NA 4Y2AA 4R8UB 3HVRA 2KH9A 5JVHQ 4JB8B 3KBGA 3QLHB 2OKQA 4OFZA 1JLAA 3TR5A 4MIWA 3LF0A 1PYOB 4ATNA 1L3VA 3ISZA 3QIPB 4LIWA 2PIIA 2B43A 4J8OA 1VQOQ 4Y2KA 2YWFA 1HI8A 1HYOA 4DR2F 3RRHA 3L2RA 4X1VA 2MAMA 1FRMA 5ETNA 4WK1A 2DD4A 2AKLA 3M0SA 3CCEA 1X4DA 2GVZA 1UFWA 1DURA 3GIMA 1D1CA 2HPUA 2OFHX 3GFXA 2YQ3A 4ZTJA 1BYMA 3JCMe 2Z2YB 4ILRA 4GMKA 2HLUA 1SF9A 2K2MA 2HAFA 3SWNA 4NYOA 4P71A 3MCAB 3PO4A 1U8WA 2XZTB 4NLUA 3N9UC 1AROP 1BC6A 2F2XA 2DXCA 2IC3A 3OFHA 1AW0A 3H0HA 4HI2A 1Q81T 1M1KT 2FUG9 4C11B 4O0IA 5L23A 1N9RA 3RB4A 2RK1A 2DPIA 1O6XA 2DXFA 3OW2R 4ZPBA 2CIMA 1TV6A 4XQ3A 4OVAA 1FDNA 4FKYA 1KJWA 4PABA 1NNDA 2W7AA 2BUNA 4U7UK 4FYWB 1T3SA 1Q82R 5KG7A 3C6UB 5L39A 2HAXA 3VRYA 3EGDA 1QVGP 2C28A 2DR7A 4RTVA 3IAS9 2ROLA 2RD1A 3I9V9 2Y1LB 1PSFA 1U1LA 2Y90A 1R8BA 2WVEA 4WFNQ 1MHNA 4LBIA 4OYOA 3CD6T 2EI5A 2K7JA 5K5MA 1VQ7A 2CPFA 1VQ9Q 2OPRA 2VKRA 4CTAB 4YMEA 2XMFA 1YJRA 2KXNB 2GHWA 3QMQA 3T1AA 1UG1A 3MEDB 1DY3A 5KYYA 5LMNJ 4WP3A 3TVKA 2DHXA 3EXCX 1TK5A 4DUYJ 2V94A 1HNIA 3MUTP 4JI0F 1M8MA 4AG1C 3HVTA 1H7XA 2AZ1A 1WXTA 2BDPA 3PIPA 3M2UA 3OXLA 3FGVA 4JZ3A 1IM6A 3AJDA 3CDUA 1VQ5Q 5GADU 3TYTA 4PG6A 2HNIA 2NXUA 5J2NB 1SRMA 3D68A 5FW9A 2V8GA 3CDWA 1VQOS 2W9BB 1X5SA 1VISA 2GJ2A 4JI8J 4A4GA 3BR9A 1ZS6A 4OIXA 1HWLA 3HKZD 2FLOA 3VYHB 4X9DA 3JCMQ 2E5LJ 3SV4A 2K5LA 3NTIA 3V6KA 4DCOB 2RQTA 2VPYB 2MKKA 2YKQA 3E3XA 2VUGA 3QAUA 5A2QE 2BANB 1UUEA 4DR4F 1M5KC 2DXTA 1UWAA 3C4SA 3BGLA 3D0HE 3OSPA 2JJ4D 3MEEB 3DLLA 4HKQA 4KJIA 2DE0X 2B9EA 5KFSA 1N36F 4R55A 2DEUA 4B3MJ 3SV3A 2KRMA 1ACMB 4EMKC 4CI0C 2ZM6F 2X1FA 2K3XA 1NSPA 3X28B 5BXIA 3T1YF 2ZH3A 1BMQB 3MM7B 4I56A 4IUQA 4FF4A 3WDOA 4DX6A 1Q86T 4ANJA 4M7DB 5C6SA 2RHQB 3S3OA 4TY9A 4R5PA 1FX2A 2QGGA 2MYSA 4TN2A 2OFGX 4FDFA 2RU3A 5ADZA 2FEIA 4QVDA 3LAKA 4M78D 2FVCA 3KG4A 2IRXA 2YKPA 3DYAB 3GB0A 2CNLB 1QKXA 1EFNA 4KH0B 5AXMA 4BWMA 4YHHJ 4B02A 1ABQA 1I1JA 1FD2A 3W5XA 2QE5A 4M4ZA 2FVQA 2LQNA 2G0CA 2GCXA 2MY8A 4RW8A 1YJ9A 1FJ7A 2RMOA 4RR5A 4LVOP 4ZDNA 2G0IA 2W7PA 1TP7A 3ASKA 4CC3A 5E3CA 2C2DA 3IM9A 4ZP7A 3SDEB 2QG9B 3FB9A 5GANd 2DGVA 1OQ6A 5CXTA 3OYKA 2FHJA 3CJKB 3EGUA 1BE4A 2DHGA 2HVHA 2ZE2B 3ZZPA 1DJ7B 4XU2A 3D1OA 4N4GA 4NYPA 5GAOl 1N5SA 4DFMA 1N0UA 1U1KA 4X66F 4PJMA 1YHQT 4HKEA 4JI6J 2F5GA 1KQ1A 3GFHA 2D9PA 5GAOm 1O75A 2LFVA 1VQ9S 4ICLA 2KU7A 4H4OA 2AJFE 1RLDA 1R6YA 4Y2CA 3O8WA 1G7CB 4M75C 5HBMA 1ZUKA 4KRTA 4FNIA 2BKOA 2K3YA 2KVIA 5B0AA 3NNAA 1S6PB 1RAAB 1S49A 3UQSA 3HHDA 2GC8A 1R0BG 3H40A 1LOJA 1SXLA 3VR1A 2R7UA 1KK7A 2AV5A 1BI2A 4DV5F 2CJAA 1V6HA 5LJ5g 2VV5A 2JSXA 1FXRA 5KFRA 1B70B 5C0MA 4JI5F 4CLTA 2ZDOA 2KRBA 2HFVA 4RBTA 2KJWA 1VQ4A 5IM0B 4IR9A 2AJ2A 4BI8B 2KM8C 1XNRF 4LNPA 1SUQB 2HHWA 4TQRA 1KN6A 4Q7AA 2GJIA 3CXCP 3MMCA 2HVDA 4A4EA 5GAN4 4P52A 4LUDA 2L3MA 3BF4A 2DTJA 5FLXY 4DSEA 1SRLA 5IC6B 1K1ZA 2HQEA 2DIGA 3SZ2A 3H6ZA 3SQOP 4X62J 3FEZA 3Q2TC 3T19A 4NLQA 1VJWA 3QAEA 1FKPB 2R7QA 4M1KA 4YS2A 1Y00A 3CCES 4EMHA 3BO3A 3HP6A 3P3DA 1HBOA 1YG0A 3US5A 3W9JA 4L6V5 3ZNJ1 2OHDA 2DTHA 2WB1D 4OZLA 4WJBA 1N9SA 1J27A 5GAEI 3VS2A 2L3RA 2FYXA 2Y8WA 4F8RA 3H8ZA 4F3QA 5IXUA 1IM4A 3NY0A 3PM9A 5F8LA 4DV1F 3HHLA 2GQIA 2UUAF 4FYVB 1RDRA 1PRLC 2ACMA 3Q8QB 1NMEB 1LW0A 3QFWA 4C0DC 2L9NA 4LR7A 2XMAA 4UY85 5B08A 4LF6F 1BUXA 1S1TA 3B4MA 2NYHA 4DOWA 1RI9A 2LT1A 5J3BA 2Q6BA 4TLQA 1SIZA 2E12A 2AWZA 2HQGA 4X4VA 5DLQE 4PG7A 1QTNB 5IS2A 5J1EA 1S1WB 3H7HB 1JLBB 3DLJA 4NA2A 4I2PB 1AT1B 2CQ1A 3P45B 1HLWA 4F0HA 2YDLA 1YQHA 1BY9A 2DHAA 4YR2A 3AXMA 1YCYA 5L1JA 4JV2A 3K8VA 4CO1A 3CE8A 4RW4A 4QR1A 1HPZA 2DM1A 1WTBA 2FPHX 5A8WA 2AK5A 1K0XA 4J5OA 3LP1B 4NLPA 2GIFA 1T7PA 2CP0A 2XK0A 1GEHA 5IM0A 1S7IA 1QE1B 1X01A 3UWNA 1U1SA 3QGGA 1K0SA 3EH2A 1UEKA 1C4AA 1FI4A 3R1LA 5KFKA 2CZ0B 5DQGA 5LJ5f 3NXZA 2LA6A 2DEIA 2WK4A 1OQ3A 3BH7B 1F5CA 4RTZA 1SHFA 1U06A 1N32F 1RABB 1FKPA 5HAOA 3CCZA 5CKHA 2HRYA 5D6YA 3FC3A 5D4LA 2XCAA 3DCAA 4ILLA 4DSLA 1M5OC 2OO4A 5A0YB 1S57A 1WDDA 2K5FA 2DNLA 3B4DA 5HY6A 5J2QA 2YRDA 3PR4A 2DVJA 3OR2A 3PX4A 4Y91A 1Q8IA 4HHJA 3AHPA 1B07A 1FFSB 1O0PA 4ZVHA 3CCMT 2R8HA 1X6GA 4ECYA 2QEXS 3UDCA 4ECRA 1V3RA 2H3EB 2XTJP 1MWZA 1I94J 2R7XA 2RQWA 1D3WA 1QCOA 1GMWA 1VQMA 4BBYA 1IKVB 4MKVA 2OD4A 2NSBA 1QSSA 3OYNA 5LMNF 2ZH6A 3C14B 2O31A 5GAGI 4RNOA 3QKJA 3DLKA 1D0ZA 1R7IA 3LOUA 1S12A 1YI2Q 3Q8RB 2CAJA 4J9LA 4ZCKA 2VG7A 1UE9A 1KOOA 2ABYA 2WOMA 1I4K1 2M51A 5KH6A 2WVFA 1CPZA 1FMKA 2KO1A 2NXJA 3KMSA 2YH1A 1TL1B 2MZTA 3Q0AA 4NL3A 1FVQA 3MP8A 4C8QC 2EKHA 2E5LF 3P8BB 1TG0A 1HD0A 4CRJA 3KHHA 2N7YA 5EWFA 4M5KA 2BMBA 3MO8A 2XDPA 4E98A 4K4VA 4RTTA 3LANA 5FU7B 2OTLA 3I96A 2DITA 5IV3A 4CH7A 4KGMA 1LWEA 3V6HA 1RCXB 3THKA 3EX7B 2ABLA 3RNJA 4PXEA 4OI0A 2CUYA 2ERRA 1RWMB 4ZNXA 1K9MC 5CHCB 2XQCA 3G4SS 1UGSB 3GIKA 4C3LA 4C92A 3RBDA 3W5ZA 1EKSA 3GYNA 4FM4B 4LVNP 2K8GA 2DVEA 5E7OB 2KK4A 2RQRA 5GMKl 1TVRB 2ZH2A 3IBFB 1Q7YT 4V2SA 1U8SA 4CLLA 1M5PC 1HQ2A 2B6AB 5FRNA 3ENVA 3UN3A 1N6QB 1RU1A 1VQKA 4NLDA 3JB9D 1XERA 1SIWB 3NWGA 2WRMA 4AXJA 2VICA 3CCRQ 2Z4PA 2Z0GA 5AJ3J 2V8VA 1WC3A 5FU7C 3DLGB 3I56A 5LSOA 3TSZA 4I1TA 5DJBA 1A7GE 2HD0A 2ASYA 3AD7C 3KLHA 4UZBA 2DIVA 2XMJA 1VQ4S 2Y3YA 1GMUA 5LL6d 5E33A 2W9AA 4J6YA 3N28A 4H4MB 4QIVA 4HYKA 1AWOA 2QLFB 1NDPA 2K2PA 4Z02A 1GCQC 1UPPA 2OPQA 1LWXA 4ECQA 2R7WA 4RG8A 5F8NA 4F7UG 2W0ZA 4DF4A 5HO4A 4FL6A 1RKJA 4JZ4A 1HW8A 2Z58B 1WFWA 3NTHA 3K59A 1RT4A 2KXHA 1V3ZA 2C3YA 1QSYA 1YZ7A 4IRKA 3W3SA 1SPBP 3TZYA 4DUTA 2ZKUA 4F36A 4P5NA 1C1CB 4RW7A 2Q43A 1JWWA 4PUOA 3VAFA 4DV2F 1HBUA 3WVDB 3M0TA 4WP8A 2OD6A 4U96A 1AWWA 2RJEA 2BANA 2FRWA 2F9JA 1QM9A 2CYZB 3BREA 3NS6A 5G4DA 3MAAA 1S1NA 1V5IB 1U2FA 2RHSB 2P0QA 1K4US 4OYWA 3UFCX 1SSFA 1ZLMA 4DV5J 1RAHB 2KNBB 1TMMA 2HVIA 1M2OA 5GAOq 3KUHA 1WF1A 4NZ0A 2IRUA 2J0XA 5IXBA 3KLEB 1X9WA 4C8OA 1NK9A 1WC5A 3R3TA 2LU1A 3UD4P 1Q8KA 5DG7A 1KOHA 2CQ0A 1WDTA 3KLIA 2PT0A 1APSA 3D9BA 3CJ5A 1TL3A 5ETKA 2DNOA 4DG1B 1FKAF 4OHYA 5KFIA 3IR5B 2XI2A 4DV7J 1FNMA 4M7DF 4NL5A 3E01B 1SVDA 3CXCR 2CJKA 5KTQA 3GYGA 4HXJA 1EETB 4F25A 1GBQA 4DCJB 1QMCA 3MAQA 4F7VA 1G2BA 3MDFA 5E3RA 3CT9A 4OMOA 3BB5A 4J90A 4F7UA 5CH7B 2CZ7B 4KO0B 3OBWA 3DHXA 2UUAJ 3FFIA 2P0KA 1M1GA 4H4MA 3J7AN 4PJOA 3N6LA 5LM7E 1HWUA 3JSBA 4PWDB 4ED5A 2N3OA 1D09B 2ZE2A 4C5HA 3OBYA 2O2OA 5K9FA 1M5SA 1YZ6A 3UN5A 3BO4A 1JXVA 4OB1B 2LCSA 1I5OB 5D6XA 4B3SF 1RT3B 3FRZA 1N52B 1HIYA 1RL2A 1SJRA 1NLOC 1C1CA 3D0IE 2HHTA 1YITA 3HZEA 3L7PA 1BQMA 4E7IA 5HL7Q 4C3KA 3CMES 2EEYA 2FGCA 5GAMj 1K8AR 5GANj 1QLNA 3Q8SB 2VQFF 3MTJA 1R8PA 3HXMA 4OQJA 3C6TA 1DJ0A 1QVGS 4Y6IA 1RADB 3BKTA 2LVWA 1U2RA 4DCPB 4PPDA 2CDRB 1E6GA 3ULHA 2E7XA 2VPZB 2DNYA 4OZ0A 4QYZK 3WBZA 2YUNA 4GKJF 2AGQA 3PV8A 4DR5F 1I6JA 2UUCJ 1AD5A 4TNOA 4CLPA 3KLIB 4USVA 2VXEA 2DNUA 2M70A 4QIFA 4IKAA 3RAXA 2FZCB 2ZITA 5KFGA 2XY5A 3W9IA 4X4RA 4CH0S 4DEXA 1KIKA 3EYZA 1IHVA 1W6XA 1N54B 2R7TA 2LLZA 4KHRA 3PFEA 3LUYA 1CJVB 3MCMA 2R57A 2HBYB 3MMJA 1YFNA 3OSNA 2KT1A 4DSFA 4M7AD 2UVUA 1UEBA 1VQ7T 4M7AB 4ED2A 4DV4J 2DIQA 3M05A 3DRXA 1X5TA 3ZL7C 3CEDA 3TA0A 3CCQS 3FNNA 4DQRA 3H2UB 1C0TA 1EAYC 3PFSA 1X0PA 1L3SA 3OS5A 1FJGJ 5D3GA 4MFBA 1JKHB 3AA8A 3ONQA 3T41A 1K9AA 4EWTA 2F4VF 3UA6A 4N77A 1H2VZ 4PLIA 4M75B 1WKKA 3VF0B 2D8HA 2EFNA 4JI2F 1UTAA 2NPIA 2VFVA 2KTQA 1EARA 4NLYA 2OTJT 3QT7A 3RTVA 3RRKA 3CCMS 4NI2A 1X4GA 1BIBA 5DS7A 4ZHRA 4Q45A 2AKKA 2IIMA 2MY7A 4K4SA 3Q22A 1EP4B 3AB2B 3SWNC 1R31A 2ASLA 1GXIE 1BGXT 2JFDA 2RHYA 1H6KX 4XK8C 1FKOA 2V26A 4KT0E 3TAQA 5LL6S 5F8JA 5KT6A 3A13A 1CJTA 1VJQA 2L9DA 2DX1A 5A6PA 2KFNA 3KYLA 5I3PA 3IS9B 1M30A 5KFUA 3G96A 3QBCA 3JCMW 3H0IA 1RTJA 1T3LA 2HS4A 2DBMA 3PHEA 4HH1A 3L7OA 4OZ5A 2AEJA 2J0QD 4AL5A 3Q2SC 5LXYA 2CP6A 2IG0A 1QVFS 5IFMA 2LCLA 2DILA 4GRSA 2B4OA 3AOCA 5IOLA 4X34A 1QY7A 4HEA9 3ILOA 4O44A 3EG0A 5IHNA 1UETA 3ISND 4DZ6A 4C48A 4LSZB 2LT4A 3R6GB 1X69A 3PYGA 3DU5A 2VVKA 4Y2MA 4C92E 4PXDA 2MHNA 2R7VA 2KRNA 2GIQA 5CD4H 2AX1A 5T14A 3G7ZA 3NMRA 4XO0A 1CKBA 4CO5A 2A36A 1QCNA 2M0GB 3PYDA 4OX6A 2C2EA 4DSKA 1YP5A 4URQU 3ZFJA 5AJ3F 2PTKA 1JB0E 4DMZA 1SH2A 4O3PA 1Z9ZA 4WKRA 3OFGA 4ETXA 4LT6A 2AEMA 4J9DA 4M5HA 3V6DA 4M7DE 3DXBA 3R6NA 2ZH5A 4DBRA 1RI0A 3EVWA 3PHTA 3IBWA 3RBBB 4OGCA 3FBFA 1Y7PA 3W1YC 5K8MA 1LWFA 1PGZA 2QJ3A 4KUDK 7FD1A 1MMNA 1UJ4A 2W8LA 1XNIA 3VS4A 2D74B 4DQ2A 1U09A 4QVCA 3CC7A 3JB9J 3MM6B 1U0HA 1HWIA 3X20B 2GS8A 2FLNA 3CCLS 1AVZC 2D3UA 4CO3A 4R0EA 2CPIA 4ZVOB 4DX8H 5KG4A 1Z9QA 2K2VA 4CM2A 1CS4B 3CEYA 2BE9B 4ECSA 1RWUA 2C2OB 2E1PA 2FJXA 2LC4A 3I0RB 3R5CA 3GONA 3TO8A 2E1AA 4UW2A 3GJSB 5D7UA 5BR8F 1RHRB 5A2QY 4MYUA 2CQDA 2HWIA 3I5RA 3FC9A 2LNHB 3EXYA 2BM0A 4E7SA 3T9ZA 4DUZF 1ZETA 2C0OA 1S0MA 4QQ6A 2PVOB 2M5YA 3HO1A 1TELA 3M0PA 5RUBA 1IUJA 4OYPA 3VGVA 3HVTB 4C0HA 2CVEA 2BZXA 2DF6A 1WOOA 1SC6A 1Q81R 1M1KR 3EGVA 2KFZA 3D66A 1TUCA 4NLWA 2DGOA 5E3PA 2A10A 5FU6C 4L59A 1VS3A 4P2XA 1M0SA 3UCGA 4ZPWR 1OIAA 2BW2A 3NCQA 3KXDA 4DV7F 3BY7A 3I9ZA 2D1CA 1N0VC 4OZJA 2Q1LA 2MMPA 3HF5A 2B8AA 3VAMA 1YIJA 2UXCF 1RYSA 2P84A 3GWCA 2P9CA 4OZ1A 2QI2A 5HK4A 2QXFA 4WKYA 4X84A 4ZIVA 2KVQG 1ULRA 5IWAF 2HAIA 4E2FB 1RAIB 3AOAA 2WSFC 3LALA 3M53A 1D9DA 1UP1A 3D2WA 4ZVSB 3JSMB 4RPFA 5CKEA 2BOAA 1JJ2A 3SQGA 1W1FA 3PJ9A 5KFZA 1VBYA 3ZO7A 4JRPA 2ZDPA 1WLPB 4C92D 1H7WA 2W10A 5LT5A 2VQEF 3MUMP 4NL2A 1IQTA 1KTVA 3DRSB 4J7FA 1TSFA 3O2IA 1NJIC 2DH7A 2H5JB 1NJIT 1WQ7A 4V19J 3ULRB 4EYIB 2K7AA 1L5UA 1EIFA 1FX7A 2PC6A 4ZGJB 1AEYA 1VR6A 4RBUA 3O5ZA 5FROA 5LJ5d 3HL8A 4ZTFA 1N34F 2VQFJ 1HFEL 2OEMA 2DHHA 3GF5A 3BDLA 2RQCA 2YUQA 3A8IA 3ET6B 3HVWA 2A37A 2OLWA 1IBMJ 1XMOJ 1D8ZA 4P2MA 4LF1A 3W8GA 2WW8A 3M4YA 1AZSB 2G4BA 4GC6A 4LBPA 2X51A 1YJUA 2WSCE 3RBZA 3CCRT 3BBFA 1AFJA 5E5NA 3OQ2A 2J05A 2AF6A 3HM9A 3V81A 2QN6B 1KVJA 4MAKA 1Y9OA 5C24A 4WF2A 4F7UE 4YY3F 3LX7A 3CBMA 2LXIA 5KG1A 1T05B 2C3PA 5G0RA 2KI7A 1QAIA 1FRIA 1JLFA 4ELZC 2XGQA 3JCMd 2J0WA 2KT8A 1RI7A 1DRZA 1RWKB 1UAWA 1HNXJ 3GJTB 3INZA 1PNJA 4HACB 5DLGA 2UU9J 4FBUA 1ZM2A 1HHTP 4OV1A 5EX0A 7AT1B 1H3HA 1RWOB 2FD2A 4Q8EA 5GANh 1SQEA 2O3DA 2DYIA 4F7UB 2EW3A 3JB9I 2K5IA 2AQ4A 4JYAF 2ASJA 3AAWB 4OL8A 4PJOD 4ZPCA 3KWMA 4PJOB 2H51B 1YIJT 3I35A 3QO9B 3W66A 3G71S 2JEFA 3X25B 3GPLA 3C3LA 1VQMQ 4LFBJ 4JI1F 4PJOF 3JTPA 2ZD1B 1WI6A 2KYXA 2HL5C 2IMOA 3KK1B 1RCOB 2L5QA 4P73A 2OMLA 1WI8A 3OYIA 1AHJB 1VIFA 1Q4RA 2XO7A 3TQ1A 2HNDA 2MQQA 1SC4B 3LGNA 1IB8A 4UF4A 2OIHA 2KRSA 4K7QA 3JCMP 4LF4F 3JAME 1VYUA 4ELTA 3EJMA 2CVIA 1JLEB 1DLOA 4ELUA 1RTIB 4ANDA 4B08A 4A53A 1K0TA 2ED1A 2RHIA 3FK4A 1P9YA 1FFGB 2FC9A 4MMKA 1VIXA 5LJ5h 1T05A 5F3ZA 2ILYA 4CIOA 1TKDA 2DGTA 1RTDB 2ZWOA 2H48B 3OYGA 4ED8A 4M77F 4DPOA 2M9UA 2Z8QA 3C15B 3CCWA 2AKWB 1S6OA 1O5JA 3WVEB 3L2QA 1BXNA 4OB2B 2DA9A 3IM8A 1UKUA 4R8UA 4X4QA 2WONA 1VQSA 1G3SA 2YKMA 4O3RA 1RT1A 4FW2A 2UUTA 2GQ2A 2W2PP 5I3QA 4HT5A 2UXBJ 2P6SA 5GAHU 4PJOG 2QA2A 3RMSA 4DU8A 1S77D 1MW7A 5F8HA 4PYDA 5B7WA 5IV4A 1VQPQ 3DMJA 3UW1A 4FVMA 1IJFB 1SKWA 1M90T 3QO9A 1IZ6A 1FESA 2NWMA 1RK8A 2IVYA 4DPUA 4A8OA 3FQKA 2EJGA 2H4YB 2ZUGA 1PRMC 2JEJA 3VVTA 2OPPA 5AE1A 1HYSB 3PW4A 8RUCA 4WZQA 5A0GA 5D6WA 1R8CA 1N48A 3EG9B 3FBEA 1RWVB 2E1CA 2HQCA 2GGPB 1OYXA 2V68A 2YNHB 1IN0A 5LSLA 4O3SA 1BCOA 3VS7A 4JBCA 2M0OA 5HVHA 2Y1RI 2MB0B 2BZ8A 2JNJA 3QT8A 4B9TA 4P6QA 4PK4A 4IQMA 3OD2A 2QFIA 5CZXA 2XLKA 1K9MU 4CP5A 4HH0A 3DB4A 1SB6A 4FW1A 2GVDA 4O5VA 4ZLLA 1EQ0A 3RU0A 4RNHA 1U1TA 4RBVA 4M75D 3NP5A 2DFUA 3DRPA 1ZM9A 4GKKF 2YNIA 1CSKA 2MJNA 3RUXA 1U47A 4JV5F 5KOWA 1LOUA 3JCMc 2VA3A 1TAUA 1TUWA 4DUZJ 1M27C 2FJWA 1HARA 4B3TJ 2MJUA 2QQAA 3MURP 4NX9A 4QCLA 5CYQB 4CNYA 2YKMB 3S1TA 4N5SA 1DTTB 2XNRA 3M1VA 2UVRA 4JRQA 3QZ8A 3PZPA 4A4FA 1T95A 4MKAA 3CJTA 1YCSB 3I55T 2QFJA 1PAUB 2MZRA 3DOMA 1IVZA 3EFOA 2QAZA 1OU9A 3TJ8A 3JCMf 4C6AA 1M2VA 2RILA 1RTHB 2C2KB 3UR3C 2JS2A 1VLOA 4MKBA 3CTRA 4G1QB 4UT4A 1V1CA 3GTYX 4FF1A 1HYSA 3M56A 3ICLA 1D0XA 1Y96B 2ZNYA 2RH3A 4KC5A 5H9FJ 1B3TA 1ARKA 2GGPA 4BC7A 2QMXA 4P10A 1ZUUA 1JQGA 4YUDA 5GAN3 2MZJA 2EQJA 2L48A 3CJRA 4J9GA 4NCGA 2EYWA 2CNNB 3UDVA 1GXUA 2CWKA 4HVZA 4CLKA 1QDUB 5I42A 4TVRA 3JB9k 3E51A 5ECAA 4J9EA 4CO0A 1T9WA 1I81A 1JXOA 3V2UC 1FWZA 1ZHIA 1QVFP 2FVRA 2DISA 2GQVA 2JMAA 3GSIA 4IOCQ 1HL6A 3CBOA 4OX8A 4C8KA 3U7JA 1G3WA 2A08A 2HMIA 3NS5A 2YNIB 4NZ6A 4OYIA 2KR3A 4HL9A 5I2MA 4J9IA 1XMOF 1IREB 4DL2A 3ISNC 1IWAA 4M77G 1JRIA 3VU3C 4M5DB 2QQ9A 3M55A 2IYGA 3SIPB 5ETRA 2LEPA 1VQ5T 1J3TA 3ZTPA 1UECA 3I56Q 2WBRA 1XMQF 4YB6A 5J39A 2B5JB 3JYTB 5CYQA 1D0YA 4RW8B 1JLCB 3BJYA 4L73A 4DHVA 4XAKA 1UW4A 5HQMA 4XU1A 1FRJA 3SMZA 5GJVB 4O0NA 1S0OA 4M78F 2KKHA 1PD0A 2VPWB 3FVYA 1ZTWA 1REVA 2X1BA 1S9EA 1OY9A 3Q23A 4F4YA 1HNXF 4DBHA 1URRA 1X4AA 2MSSA 4DZDA 1YJWT 1JEGA 3MOJB 4DR3F 3JSYA 2DIUA 2FVUA 1G83A 4C0ZA 3H4DA 2HRUA 1JB0C 4ZA1A 2SXLA 2ROPA 1UWBA 4IUFA 3PYEA 2R4FA 2ZBPA 2OMOA 3UPFA 3Q8UA 3PMTA 1C0UA 1RLPC 1UGVA 5LJ3j 1YJNT 2YRVA 3VGTA 3FCHA 4UQTA 3PMIA 4OF1A 5MLCV 2CKKA 3EUNA 4HDHA 1X5OA 3B82A 4OP0A 1NO8A 5CCLA 3KLEA 1RAFB 3OYLA 4YR0A 2E9TA 1N36J 1VIOA 1BHNA 3TOQA 4PJOE 1FMVA 4DQSA 4TY8B 1FRKA 2VZ9A 4ZCMA 3QYHB 2HQXA 4GC7A 4N47A 2DRKA 1S5ZA 2A28A 4X9CA 4DG1A 4Y28E 3EG3A 2NUTA 1GXTA 3F56A 3POTA 1WHKA 3DLLQ 1H72C 1XEZA 5E2QA 2HGLA 2C22A 2CUBA 2HDAA 1NKCA 3W7BA 4ZVUB 1VQ6S 4C92G 1TUDA 5LJ3e 1VQMS 2VWFA 1KONA 5MAOA 3A8LB 4M77D 3SI8A 3EHQA 1YRXA 2MHEA 1HI1A 4K4XA 2HNYB 4ECVA 3V81B 3O6QA 2N4CA 4C7QA 2F8HA 3WIVA 2RMLA 5LJ5j 3TAMB 3MCSA 2M02A 4LFAF 1MNDA 1RHJB 4JPBW 2DL8A 1Y5LB 1BIAA 2FB7A 3CC7Q 4RW4B 4TKTA 4WP9A 4V1Ak 1AYEA 4GVBB 4KGKA 1XBWA 1HMVB 5HSPA 2BACA 4OMNA 4ZGEB 2QLWA 1HBNA 2OTJA 1VRTA 1S72T 1RT5B 4Z2XA 4CM0A 2VFTA 3A8KA 2UXDJ 3CCSA 4A8FA 2GQCA 4QQBA 3M57A 2CT4A 1EZZB 2BE2A 5GMKi 2HHHJ 3KK3A 3R9LA 3DLEB 1SV5A 4X66J 3OUYA 1WZOA 2EGAA 3H42A 1LW2A 2BJDA 5A0LA 2RE1A 2E7VA 3RB6A 1TR0A 4BC9A 3M4XA 3D4JA 1KC8T 5JXSA 1R6VA 2O01C 4QWCA 5LJ5e 4DL7A 3VGUA 5A8WB 4ZJOA 3HP9A 5L8RC 3LH5A 2QA4G 3CJ8A 3ZC4A 6FD1A 4HI1A 4F3MA 1TWBA 3X26B 2QRRA 2OPSB 3BGOP 3UWTA 3CCLT 3M30B 3GV5B 1FJEB 5GAN8 1MLAA 2ALYB 4G65A 1PHTA 3F70A 4IFYB 5KOXA 1TK0A 3QHSA 3T5KA 1AZGB 4GO5X 1C1BB 1TUVA 3CPWA 2DXBA 3RJMB 3BW1A 1JNZB 4DV6J 2E4HA 1WKLA 4DA4A 2POKA 2BM1A 3OMCA 1X2KA 3KK2A 1KNZA 4A8WA 1JQQA 1YJNA 1HK9A 3IWXA 4HCCA 5CKFA 2HNYA 3I56S 2DJWA 4DBQA 2DPJA 1ZSZA 2WOMB 1NJIU 2DL3A 5F0UA 1OYDA 1PAEX 4XPCA 4O23A 4M75A 4JV5J 3HD1A 3CCRA 1E6VA 1S1VA 3AHUA 4I2QB 2MKJA 2HK3A 1VRTB 3TU4K 2PDAA 2I1RA 5HK0A 4A8XA 3QBYA 1TOVA 2BKPA 4J9QA 4PG4A 4F4XA 5CAIA 3M6XA 1FK9A 4DR1F 2XULA 1A0NB 3HFNA 2GX8A 2EPIA 5B0CA 1G1XA 4XTUA 4USJC 1D1UA 3QPIA 1UJ6A 1TL1A 2X3GA 1N5VA 3PGGA 1AWJA 4C92B 2R9LA 4K4YA 2DBBA 3EHRA 5GMKa 1NU4A 3P5BP 5KCOA 1XN9A 2ZBRA 2OGUA 4KPCA 1YN8A 4LDUA 2YXLA 1S79A 2JWNA 4DEZA 4FPIA 2B7BB 2RIJA 2ECZA 2JW4A 3G1JA 2BJ9A 4IFYA 1MMLA 2CSIA 4FYYB 1PKSA 2YKOA 4RW6A 5EX3A 1S0VA 1M5HA 3K5LA 2P0PA 3J7ZT 4ECZA 2XI9A 1KRPA 2WACA 2DGUA 3LO3A 4O44B 2J9DE 1S4FA 2DGXA 3IWLA 3CIZA 1YJTA 3OL7A 4QR0A 2VFSA 4EBEA 5LOQA 3SDZA 5CZVA 2Y1JA 1VCTA 4EO6A 1N8RR 1SJ3P 4EMGA 2AYGA 2V67A 1NH8A 1YITS 2Y9HA 2R2UA 1N32J 4PJOC 3LP2A 4MIBA 2EKNA 5E41A 5D8HB 3QWUA 3CCUA 5ETPA 3HKSA 1GNKA 2ZWPA 2R5AA 2BTTA 3DRPB 3I4HX 2AJ0A 1S4EA 4K0KJ 3BSAA 1S7HA 1HR0J 5JJBA 2VPXB 2WAQD 1B34A 4JOUA 4QIWD 1XMQJ 3TQ7P 3DLGA 5L38A 5CCMA 3HSGA 2E5IA 4AD6A 1VQ8A 1M5Q1 4PUOB 3PTAA 1X4FA 3I55A 1CJUA 1K1QA 1DBDA 4QQGA 2MGZA 5B0FA 1OO0B 1O9SA 2AP6A 3MAAB 4A8SA 1Y0MA 2MPUA 3VZHA 3OS1A 1NG2A 1BBZA 1WSRA 4U8YA 5KE2A 1RTZA 2RF2B 1WC0A 3GV7B 4ZKAA 1Y7XA 1RHMB 2G6FX 3MM6A 3CCEQ 3W2WA 1TKXA 2AX0A 2HBPA 2HZVA 3O8VA 1QVGA 4WFBQ 3PVQA 2J7UA 4Z37A 2M4MA 4WE1B 2OJ2A 5AE3A 3HHTB 1QUPA 3CCJQ 3PDNA 1RB0A 4DDFA 1TL7A 2KT5A 2O66A 3MXHP 1NYFA 2W7OA 4X64J 1YSJA 3JV3A 5EGYA 4DS5A 1M3BA 1UVJA 4X4UA 1WG1A 4NCGB 5E3AA 1HD3A 2F5TX 1WHWA 1MSWD 4BWJA 4ANCA 4OX9J 3HFKA 4M75F 1FNXH 2JM9A 3HD2A 3M8QB 2PA3A 2Q66A 5IXFA 1U8RA 2QEXA 3OYHA 4L76A 3OYFA 2HVZA 1SKRA 1IKYA 2QA4A 3WIUA 3UD5A 1QAYA 3Q24A 1FJCA 2AYBA 2EYZA 2CG8A 3JCMg 4RL1A 1PO6A 5D4OA 3BGUA 3VTIA 2F5KA 5HK3A 3EG2A 3KXTA 2OEJA 2QMUB 4X4SA 4HTJA 1QQJA 4JJDA 2DYAA 4USTA 5KG5A 1SI9A 1D1AA 2O88A 1UEVA 1QTMA 1SH0A 3TA1A 5HMYA 2WCXA 4QU6A 1VQPS 3D54A 1QAJA 1FDDA 2YSQA 3H5YA 3DOLA 1RA7A 4PWDA 1HNZJ 3JCMb 2VGMA 2E5JA 2X3XD 1D3BA 2CZVC 1REVB 5H1SV 4IRDA 2YHTA 2H9ZA 2RUGA 1NKEA 3GBQA 2UV8G 5J2MA 2F3JA 3MEGB 2LX9A 1YGYA 1FWKA 3S01A 2GAGC 3FLGA 1GFDA 1RT3A 2KBTA 3OL8A 2HHHF 2HHUA 3PW5A 3TUPA 4Y0FA 4F2RA 4OLOA 4LRFA 4U6PA 2J6FA 2XSJB 2E1HA 2HBWA 4NLOA 4NZ7A 1HQEB 3M58A 3A3OB 2RNAA 2HWHA 2LNVA 2KSSA 3CCST 2RJCA 1RWXB 3CC2A 2DR5A 2DY1A 4P7VA 3QFHA 2PGCA 3THVA 3M32A 4IH7A 4IH5A 3N79A 3QLHA 2ATCB 2VH7A 4B9WA 4YDDB 5AXNA 1X9SA 3SD4A 2IVFB 3G4ST 4BE0A 2JVRA 5HROA 4LRAA 2OI2A 3GJRB 1VQKS 1UA1A 4RKUE 3FJ5A 1P8GA 3HHKA 4LUBA 1AB8A 3W2VA 3P96A 1WJRA 1VOMA 3PIOA 1PC0A 3UDEA 2NUZA 1SL1A 2RSQA 4IUPA 1FTCA 2ZBCA 3BYRA 3LGHA 3MPVA 1HBMB 4NYZA 2GHPA 3A3NB 1HHQA 1LCKA 5C2GA 4I7FB 1YHQS 1ZTTA 5GAMg 3CO0P 3EGWB 1VQNS 2DO4A 4DPTA 2XY6A 3SEMA 1EB0A 3KHLA 4DJBA 3EDQB 1YJ9Q 4QWBA 1OPLA 2EVRA 5IN1A 3IRXA 1C2PA 3ILIA 4L72B 3I6PA 4QOTA 4N76A 1ZAVA 2W01A 2PU9B 2GAHC 2MQ8A 2I5JA 1VYVA 2E1MC 4F0KA 1FRXA 2XWXA 5KFNA 5FDLA 2JOYA 3UATA 1NEEA 4DL4A 1GCQA 2G1HA 1X27A 4C8QF 1T9YA 1H2UX 3VAIA 3QRPA 4DPXA 3NFCA 2XZWA 2KZZA 4B3RJ 1VQ6Q 2I2YA 4L75A 1NHKL 1IKWA 2DCUB 2A2CA 1U3OA 4C8NA 1RUSA 4X65F 4A63B 2HNDB 1JLGB 4C9DA 4C5IA 4XTWA 3KK3B 4LF5F 3CCLA 2RI5A 1JLAB 2ZPGB 4O6JA 3RDVA 4BE1A 1N6AA 3NBPA 1IBLJ 1FRHA 4W90B 3QUIA 1VA7A 2XI3A 3OMGA 1KP6A 3M32B 4URGA 3GZ7A 1TH7A 3CVKA 2NPFA 2LJ0A 4OGEA 3VQSA 1S76D 2RQKA 1OEBA