2OAUA

Mechanosensitive channel of small conductance (mscs)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
YAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Small-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Escherichia coli
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2oauA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oauA03
1X8DA 4Y2MA 2QIFA 1R6YA 2GA7A 1VQYA 3IWXA 3KG1A 2GCFA 3FMBA 1WD6A 2G9OA 2QLWA 3BF4A 1X7VA 1GXUA 1N5QA 1X0PA 1OPZA 2ROPA 3WDOA 1FVSA 2K1RA 1P6TA 2AW0A 1AW0A 2IYIA 1RJJA 1TUVA 2ACYA 1KQKA 2KT3A 3GZ7A 2KYZA 2N4DA 2OMOA 4HH1A 3KNGA 1S6OA 1OQ6A 3FRYA 4HH0A 2RMLA 1FVQA 2GQVA 4DL0C 2PGCA 3HHLC 4Q2LA 4Y2IA 2ROEA 3TNVA 4F67A 1VQSA 2JDJA 2K1RB 1OQ3A 2LQBA 5T7LA 1W2IA 2ZDPA 1XBWA 1JWWA 5B0GA 1AFIA 2RH2A 2FTRA 4FNHA 5B0CA 2IYGA 2RSQA 2XMMA 3MCSA 5F0WA 4ZA1A 1Q8LA 2W4PA 2W4DA 3T9NA 2CRLA 4Q2MA 3FGVA 2FB0A 1AFJA 4A46A 2N7YA 5T7LB 1TL5A 1FEEA 3UDCA 1ULRA 2OFHX 3HHLA 1LQ9A 3KG0A 4DN9A 2OAUA 3LGMA 2GGPA 3CJKA 1YRXA 1SQEA 1YG0A 2K7KA 1N5TA 2IFXA 1SB6A 2QLXA 2QYCA 2RU9A 3I9ZA 5A6PA 2AP6A 4HL9A 2K7JA 5B08A 5KAKA 3HFKA 3DXSX 3VTIA 2VV5A 1Q53A 2HLTA 3SFMA 2FHMA 3HHLB 3BR8A 3TRGA 5B0FA 2GGPB 2XMJA 3HF5A 4OJGA 1V3ZA 1Y9OA 5B0DA 2RK1A 2P4TA 2OD6A 4A48A 2XMUA 2N4CA 4NPOA 2KT2A 5B0BA 2W4CA 1TL4A 2OFGX 5B0EA 1N5VA 2EW9A 1VIEA 2GV1A 5B09A 1FE4A 4OJHA 2HIQA 4HI1A 3QGPA 4OIXA 2OP5A 4OJ3A 4YDXA 1U7LA 2BJDA 4YEAA 1CC7A 2BYCA 1Y3JA 1Q8BA 2XMTA 2HLUA 2HFNA 1YJVA 1MWZA 2L3MA 4DPOA 3MZIA 1YJTA 1KVJA 1URRA 1K0VA 4Y2KA 1N5SA 1YJUA 1OSDA 2XMWA 1YJRA 2LQ9A 1FE0A 1FESA 3F44A 2FIUA 3CJKB 1APSA 1SI9A 1CC8A 2AJ0A 2GFFA 3BN7A 3LGNA 4A4JA 1MWYA 2OKQA 1P8GA 2LDIA 2ZDOA 4QOTA 1Y3KA 2PD1A 2BBEA 1IUJA 1JK9B 2RILA 3LO3A 4NL5A 5K9FA 2LXFA 1Y0HA 2ASYA 2BUNA 2Q3PA 2K2PA 3IWLA 2OD4A 5F0UA 5IXUA 3BDEA 2XMVA 4ZOSA 1TZ0A 3TOQA 3QMQA 2RK2A 3DCAA 1CPZA 3E8OA 2VH7A 5B0AA 4A47A 2BJEA 4U9RA 3BM7A 1KVIA 2GO8A 2HQIA 2KKHA 2HFOA 1S6UA 3BGUA 3HHLD 4OJ1A 2XMKA 1QUPA 3K7RA 1GXTA 3BB5A 3KKFA 4HI2A 4EFAC 3HDSA 4FNIA 1FD8A 1Q4RA 1TR0A 1VIFA 2AJ1A 2ROGA 5A6WA 3HX9A
chains in the Genus database with same CATH superfamily
4MK7A 3F56A 3DLEA 4B3TF 2FVCA 3L42A 4JUVA 5KYUB 3CJ4A 2RHYA 4NE9C 5CYQB 3IRWP 1DLOB 4DV6J 3IBCB 3H6ZA 2WONB 1K44A 2RKIB 2C0OA 1KD1T 1DFDA 3LOUA 2WZ1A 2GFAA 1NBEB 3K8VA 3VV2B 1MMAA 1HK9A 5CCLA 3CCLA 5AXKA 4XTZA 3S3NA 3MMBA 4Y0FA 3NTIA 4GO7X 5EX0A 2WSFE 2R7OA 3UF4A 4G1QB 1YHQQ 3VTIA 2HBQB 3CJQA 4MIBA 4C98A 1CQMA 5C0MA 2HGLA 4N77A 2P5VA 2EJ9A 1AB8A 2DYBA 1D3BA 3CIZA 1YHQS 3P49B 2ZHOA 3PJXA 2XMTA 2COWA 4F0HA 5GAGI 4PZVA 2GS8A 1AWWA 2K2VA 2DO3A 3H90A 4V1Ak 2EFOA 2K8GA 3LP1B 3HM9A 2WOMA 4PFZA 2EFQA 1RQ0A 2LJ3A 5D15A 3PV8A 4F7UB 1JLGA 1SJ1A 1IGQA 5I42B 2F8EX 2MHEA 4ZVHA 5DGBA 5C24A 3LANA 4LREA 3GSIA 3CDEA 3BGUA 3DRRA 5DLGA 4KRTA 1RT6B 4N56A 1X2KA 4PWUA 3ZZPA 4PKDB 1F5AA 4B9VA 3QWXX 1OI1A 4FVMA 2D74B 3H40A 3CCMQ 2CPYA 4IFVB 4CO4A 1VQOT 2QV6A 4DPWA 1T95A 3KLHB 4MMLA 3TX0A 3PCOB 1VJWA 3CCMS 3KNAA 4A8WA 3M0UA 2V2ZA 5KFNA 4ZHRA 3RNJA 1VQNA 1AWOA 2OPSB 3NMZC 3TAQA 4ER8A 1HFEL 3RBDA 4FT2A 3M0SA 4DV6F 4Y65A 2OLWA 4N0AC 4B9TA 2X1BA 4DUTA 3C6TB 4DR3J 4LF5J 4M77F 1NSKL 3QFHA 2YWWA 2HZAA 1JJ2S 1A7GE 1S9EB 3TEGA 2NZ4A 1VQ4S 2E64A 1KIKA 2BJDA 1Y3JA 4NLWA 2DNGA 2ATLA 1I51B 2DBKA 2R3VA 3KFWX 2MKSA 2E9TA 5HMYA 1N9SA 1X4AA 2HNIA 2XIDA 5F0UA 3QIPA 1VQPT 2GNKA 3MPYA 2HPUA 4CC3A 2BA9A 4QR1A 2OPPA 2FJAB 3Q8SB 1NSAA 2HQIA 1QW1A 2BE2A 3G2XA 4FU6A 4NLRA 3M54A 1KD1U 1T3SA 3SCJE 3NMRA 4MK9A 2V2QA 3R7NB 4KGXB 4DN0A 2G9OA 4MZTA 4ICLB 4EMKA 4DQQA 3RIRA 4J9KA 1XNQF 4ELVA 2XSFA 3D67A 3L09A 4OYWA 2WBMA 2E3IA 4URSA 4UUXA 2FTRA 1BQMB 3ZZOA 4JV0A 3NFCA 1IBLF 2CQ3A 1IM6A 3ZZUA 2R4FA 2CA9A 2E1MC 4RBUA 4MKVA 1PILA 3DLKB 4DQSA 1WC4A 1RWWB 1Y57A 3TUJC 1KFZA 3UD3P 1KKHA 1WF1A 2P9GA 3A8OB 4NCGB 5B0BA 1SVDA 3A8GB 1KWMA 4FN5A 2H9ZA 2CH4A 1BK2A 1H641 1EP4B 3HI9A 3BR9A 3DLLQ 2YUOA 1X6GA 4DR3F 1DTTB 3MEEB 4OYZA 2ZHAA 2EKYA 2KYXA 2XYGB 3NAHA 4JB8B 1I0CA 4QKUA 1QVFR 5G4DA 3KK1B 1X9SA 4YS2A 3RBBB 4IUUA 1UTIA 2BZYA 2M52A 2M88A 3R5DA 1ZETA 2HNYB 4OYBA 2F5TX 3FBEA 2XMKA 3S01A 2MKIA 4OGEA 2IC3B 3E19A 4JI5J 3R1HA 1OV3A 2I1RA 1VK8A 2E1CA 1U09A 3J80E 1BHNA 1P6TA 4JJBA 2IVYA 2EGAA 3UD4P 1SL0A 2VIHA 1RABB 3JSMB 2ZVIA 1RTHB 1TL3B 3VYGA 1D09B 1C0MA 3TZYA 3NL0A 3ENVA 5ETMA 1AFJA 1Q7YR 4M75E 3D1QA 2X1GA 3M32A 4MKAA 2KDSA 3BDUA 1NHVA 4QIVA 1YG0A 3I0SB 1WELA 1XNRJ 1FD2A 4I7FA 3BDPA 4ECVA 3EAEA 4WZMA 3OXLA 1BY9A 5F8MA 3ONQA 1X4BA 3CMAQ 2CQPA 2KR3A 4H4KC 1MN9A 1PSDA 1MLAA 2GZOA 4IIOA 3FEYB 1VQ5Q 4ED6A 1SJ4P 2LA4A 4LBHA 2DNUA 4CRJA 3AQPA 2A36A 1YHQA 1X31C 1VQ5S 2CDTA 2J0SD 4O3QA 4JI4F 4DCPB 1F5BA 5IXUA 3HVRA 4ZOSA 4OMFB 3OD2A 1QAJA 2WACA 4DV2J 4NLTA 3RW6A 3JCMQ 1U1RA 3QSYB 4JBCA 3D4JA 3OBYA 5D4LA 3EYZA 2VOOA 2EYQA 1I1JA 3CCUQ 4Q45A 2G2ZA 5DDOC 1JJ4A 1FVSA 5D0EA 4ZKAA 5FLXE 3NGTA 3LAMA 4RUHA 2HD0A 3CCUS 1HKAA 1C0TA 3IAS9 1OQKA 3M56A 4WP3A 2VU5A 2Y1IA 2LX7A 3D6TB 3CCMA 1MGQA 3E9FA 2QQRA 4AFZC 2DRBA 5L1JA 4XTWA 2NWMA 2D3UA 3DXSX 4O3PA 1PC0A 1NKCA 2GGPB 3IM8A 4PQUA 3J7AF 3FB9A 2FB7A 2RI5A 4OYIA 4K0KJ 3E2UA 1N5VA 1RYRA 4DCJB 4PYDA 1NJIC 2FG0A 1T03A 1UGQB 2FRWA 1XNRF 2CZ1B 4WCIA 5F8IA 2PUOB 1JJ2A 2ZC4A 2E1HA 4FBTA 1VQ4A 2LXIA 5IN1A 4OZNA 1FFWB 2RS8A 3BPDA 5FJ4A 2VVKA 3CCJT 4CH7A 5HBMB 4LVNP 3VQSA 3OJSA 5K9FA 1H3HA 3D0IE 3BDEA 1U49A 3G4SQ 1NDCA 2F2VA 2LZ6B 2O01E 2RPNA 3NXZA 2BEFA 3MTJA 4ZVGA 2KFYA 3A8MB 3OR1A 3L3CA 1K73T 1FMWA 3KJVA 4QWDA 3G4SS 1QSSA 4WFZA 2V8PA 2K5IA 3QZ9B 1W25A 2JLGA 5C6SA 2B6AB 2LCCA 1GMVA 4DL0C 4HCKA 5DO2A 3FKBA 2KRNA 3T5KA 2BZ2A 4CH1A 4CLUA 4FYDA 4EO6A 5KFXA 4LJMA 1N5YB 4ANCA 1C1AA 2DVJA 3SEOA 1TKTB 2MJNA 4L74A 4BLGA 4BE0A 2ZE2B 2AEMA 3PE0A 1RTIA 3K5LA 4ECRA 5KYWB 5DG7A 3WIUA 3HRUA 5AJ3F 4IUTA 4OHZA 1SC6A 1I3OB 1T9VA 4NLGA 4X4SA 1KLMB 4K0KF 3SEMA 2FEIA 1XJWB 1VQ9T 2ZDOA 2C2RA 3X26B 5KCHA 2QYGA 2RILA 4ID8A 1YNZA 3IG1A 1UPMB 3TQ7P 4X4PA 1M9SA 4PFPA 5KFTA 2NXUA 2E4HA 3MEKA 3JCMf 2LCLA 4C92D 3R6NA 1HR0J 1BYMA 1MROA 4OQJA 4CNYA 1K9MT 3SD4A 2IPOB 1Q86R 3OJUA 1TFYA 2ZM6J 1I07A 2M02A 3BS9A 2QDYB 3JCMb 4Y28E 4KH1B 1G3TA 2MDAA 4Q5VA 1RT7B 5GAOl 2JM9A 3PVQA 1CKAA 2XDPA 1JKHA 1S7HA 1G3WA 2DGVA 3BSCA 1LWCA 5E2QA 3V6DA 1RYSA 1RLDA 1KQ2A 3SWNC 1BE4A 3CGIA 1Q5VA 4K2XA 3FGVA 2LYVA 1NPRA 4M5DA 2BOAA 5KG6A 1D0ZA 5H9EJ 4ZTFA 1WC6A 4M5KA 2GQ2A 3MPUB 2AMCB 2G0CA 2IVMA 2J9EA 4OIXA 2DGTA 4B9XA 1RWOB 2VUGA 5I22A 2C28A 3WX4A 2DR6A 2DYAA 4NMLA 1K73U 1S0MA 3TANA 1VBXA 3OBIA 2J7UA 1VQ5A 4RKUE 3M8QB 3O5TB 2YKNB 5E33A 3GG0A 3OL9A 2U1AA 4YMEA 7FD1A 5EC7A 3VAFA 3A3NB 1TSFA 4BC7A 3OW2R 5IXBA 2GHPA 2WCXA 4O6JA 2FLPA 3OR2A 2O66A 2MOXA 2W9BB 3CCES 1OZ3A 2MI6A 1VQ7Q 2K3XA 1S1VB 1U26A 2VPYB 2DNQA 3HD1A 1HR0F 3IBFB 3GYGA 3KHHA 2QRRA 2ZM6F 3Q86A 2NUUG 2D7SA 2AJQA 4EEYA 2M9KA 1UFFA 1FRKA 3CEYA 3ZTSA 4F2SA 3HHNB 1VQ7S 3SI8A 4RO0A 2BOPA 4LSLB 4ZVTB 3CCUA 2L9WA 2I9SA 2OHDA 4DN9A 5AE3A 4DU8A 4J9HA 1AUSL 1SJQA 1WHMA 2RDIA 2DIQA 3DMJB 2EWNA 3M4XA 3JCMV 5GAN7 5A0YA 4A48A 2VPWB 3GLJA 3W8GA 5C2CA 4J9PA 3M30B 5KT2A 2I38A 1UEUA 1PD1A 2M51A 3BYRA 4OMPA 1BQXA 1BIAA 4EGLA 1RT2B 1D0YA 3KBGA 1S1UB 4PJOB 3O1LA 3NGDA 2W7OA 2HZCA 3POTA 4RBVA 1OY8A 3SSSA 1Y0HA 2K2PA 1VK3A 2ZPGB 1WI8A 1Q82T 4ESRA 2LC4A 3J7A1 2R8HA 4M7AE 4I1TA 2F7VA 1ABOA 3CD6T 3CPWR 3BKUA 3GFYA 2CSIA 2RQCA 2I6WA 3H0IA 4M94A 2RD5C 2CDRB 3PYFA 4B3OA 4MJKA 2R7RA 3MF5A 3G4SA 5FIIA 3RR6A 2GFUA 2XCPA 1TS9A 2XLJA 2MKHA 3UA7A 1T94A 2MQMA 1F3FA 1RTJA 4PG8A 3IS9B 3QT8A 4I56A 4JYAJ 2RE1A 4JS4A 1ZSGA 3OSSC 1K4US 4C92F 3EICA 4MMOA 1Q81T 3ELHA 3I9ZA 3R2DJ 2V26A 4ECUA 1R8CA 3ADAC 4C0DB 3CCZA 5FU7C 1QLNA 2XSJB 7AT1B 3IRXB 4BI4A 2R5MA 2BW7A 2HQ3A 2RDJA 1M1KT 2HRTA 4K5RA 2CJQA 3GV7B 1ZSZC 1LFWA 2DNRA 3M55A 1VQLQ 4C0FA 2QI2A 1RAFB 4N8NA 5DG8A 4Q8EA 2R8JA 3C6UA 1HW8A 3QO9A 1HSQA 2VD3A 3MR5A 3CCLT 1VQLS 2E12A 2RS2A 3W61A 1TAQA 1WWHA 4IFYB 5GANg 5GJVB 3CCWA 2DFUA 1M30A 2IAJA 3GJTB 5A2QE 4C92C 4F7UF 1XR7A 4R0KA 3C15B 1HBUA 4BB7A 1JLAB 4E47A 2VGNA 4A4GA 2Z4PA 1BWVA 3GYNA 1LOJA 5GAN4 2PEBA 2QL5B 2HMAA 3KMSA 2VPXB 1N32F 5GAN2 1TU0B 1RT5A 4HCBA 1WHWA 5LXYA 2GO9A 2ZH5A 2E1AA 4GMKA 2IMOA 4BCAA 5IFMA 4KAIA 3M57A 1I8FA 2VQEF 1C1BA 1HD0A 4HL9A 2KMTA 4C8OA 2HBZB 4RW9A 2DZCA 1H2UX 4OJGA 4JYAF 2HS3A 4I6YA 3CUNA 4DR1J 3I56Q 3LGHA 1K1SA 4LF9J 1M1HA 1UL3A 3GB0A 1BKBA 1RT4B 1WHLA 5FDLA 3UPFA 2CREA 1YIJT 1IM4A 2MKJA 4YTLA 3I56S 2ZOFA 3CJ5A 4CYUB 4C5IA 1UGVA 4F3OA 3LLRA 2P8IA 4MDXA 4I2QB 3DRSB 3FJ5A 1KFSA 1HYOA 2VYTA 2QA4G 4PQAA 3H5YA 1GCPA 3BBBA 1HNZF 2FVRA 4QWEA 4C97A 2FLOA 4F0KA 2Z2MA 1CJUB 1YJNS 2HL5C 2RK2A 2E5QA 2F65A 2HBYB 5LL6S 1YK9A 1TUWA 1TV6B 2LEBA 5F8JA 2A37A 4RUCA 3GTYX 4L75A 4M77E 2OSQA 5GMKa 1VRUB 2BE7D 5L8RE 2VJUA 2C2KB 2ZVSA 1HNWJ 3CPFA 2DEUA 2HQGA 3A8IA 2NPIA 2JEGA 4WFXA 4P10A 3R27A 1Q81R 4A8XA 2R58A 3NY0A 4M78A 1Q81U 1WC3A 2N3OA 2QA4Q 3CCEA 1UVIA 4JJCA 4EYHB 4LBIA 3WIVA 2WVBA 1RAJA 4CO3A 1M1KR 4FVCA 3KHRA 4J9EA 3NHNA 4TU8A 1SH3A 1M1KU 4EZ6A 2PVGB 1VQ7A 2HK3A 1V6HA 5DDRC 4DF8A 2J06A 3D9BA 3VS1A 5GAOn 3DLEB 2FHMA 4BI3A 5HJYA 6FD1A 3DRPA 3BEGB 4ZN1A 1RADB 4ZJLA 3RTVA 4X64J 1TELA 2OSRA 3PX4A 1W26A 1AA1B 2LDYA 2M0OA 3IQLA 1QAYA 1V5IB 4AYBD 1YJVA 1N6AA 2YSQA 2Y4YA 1GH8A 1U06A 3QJYA 2CJKA 3MMBB 3M2RA 2QMXA 2M16A 4ZPCA 4DR1F 3NOCA 3FJPA 3N79A 1AZSA 3LP0A 2JUFA 3EG2A 2POKA 1JJCB 2WK4A 2JT4A 2GMJA 3NGUA 2FPDA 3N9UC 3W9HA 4KFBB 1DRZA 4XAKA 4UOGA 2XG8D 1O5JA 3EVWA 4NXNF 3JAME 2KI2A 1QWEA 4DEZA 3J81j 5KFZA 1H8KA 1Q16B 3HDSA 2QK0A 2GJIA 2HCKA 4X1VA 4QU6A 3GPAA 2BZ8A 2A3JA 1K0SA 2EK1A 4OX6A 2WOMB 1TQLA 2EKOA 4KT0E 1PBUA 4BUGA 1JEGA 2MJUA 4BACA 4CZCA 3TZZA 5J1EB 4K4YA 5J39A 1FT8A 3J81E 3RYLA 4HT7A 5LXRA 2YKPA 5C24B 4CLTA 3DRRB 4YR0A 3SHWA 3VVTA 3CT9A 1S6PA 4EBEA 2OI3A 2FL7A 4ZVQB 5BYRA 3VCDA 2O5DA 5GMKl 2LTOA 1FRJA 1Q8KA 3SQGA 2COYA 1F6TA 4RW4A 4EWTA 4JI8J 3FVYA 4F36A 1TTHB 3M5AA 3BKFA 4YDXA 3X25B 1ZA1B 1C4AA 4LRBA 4M5HA 4ZHRB 5GADU 4ZDNA 4B9NA 3PACA 4LD9K 4BDZA 2DGUA 2GFFA 4X64F 1P8GA 2ILYA 4DV4J 4FYWB 3A98A 4ZPAA 4YHHJ 3LQVA 2NUHA 2G0JA 4PNOA 3PRVA 3DI6B 2DR7A 1U02A 1VQLA 5CKEA 1PCXA 2Z0GA 4RWXA 1WX6A 3P5TL 5D8HB 2D9OA 4FS1A 1VC6A 2X4JA 1BC6A 3EX7B 1PKSA 2HK2A 2Z2LA 5KOWA 3JCMc 3GIBA 2RQWA 4RW8B 2BR0A 5J2PB 2DR9A 1NPPA 2AW0A 3P96A 1JLCA 2HW3A 2PA8D 1YHQT 1Q7YC 2LFVA 2E5KA 5DZ6A 1VQSA 1OQ3A 2W8KA 2AX1A 1A0OB 3GMGA 1BI3A 1EB0A 4D8KA 4O3NA 2M2BA 2GTOA 5IT4A 5AE1A 4K8RA 4ZLLA 4CT9A 4NLYA 2CP5A 4DV7F 2BE2B 4RJVA 4KBIA 4O0NA 4LR8A 3MP8A 2K7JA 4I4BA 1WHXA 4MFBA 1U0SA 2K4YA 4ZPDA 1QUVA 5D77A 3TYTA 2EYYA 3UWTA 3GG1A 1RAIB 4V19J 5J1PA 4NRTA 3QJLA 4C8QG 3S8SA 2OTJQ 3W5ZA 4HXJA 1CBKA 1R8PA 2KXNB 1R89A 3BZQA 2GMHA 1R31A 3PIPA 5SZTA 3AXMA 2DBBA 2OTJS 2BZXA 3I56A 3MPVA 4ZLNA 3CCMT 2HMIA 4UTGA 1YDLA 2D3ZA 4XAXB 1IKWA 2NUZA 5DDQC 3T1AA 3MXHP 4IG0A 5GANj 4RCCA 1F0XA 2HQDA 3A8EA 1YJNA 1M2VB 2F4FA 3QJ6A 2DHXA 3Q8RB 4HT8A 4YHHF 3JYTA 1O75A 3BGOP 1RKJA 4LF2A 1FA0A 5HKCA 1NZAA 2V67A 2WBRA 4R5PA 2IM1A 2MWOA 3SSRA 1VQ4T 2YUQA 4GBQA 1XK8A 2MMYA 2XWYA 2IDEA 3HJFA 1SHGA 5KFHA 2ZITA 3V5RA 2F5GA 2VBWA 1LWFA 3G6EQ 2VG6A 3H42A 1RHUB 2MCNA 1X5OA 4UT4A 4BD3A 3IGVA 3WHIA 3OYJA 1E7OA 1DAXA 4B02A 3ETMA 4F2RA 4LSNA 3H4BA 4OZ1A 2KYBA 4E98A 3G6YA 1N33F 3KLIA 1NHKL 1TVRB 3L95X 3W60A 4WP8A 2GHVC 4NXMJ 4C8YA 1FX7A 2VDHA 4CLLA 2DF6A 5D7UA 3M32B 2QL7B 2NREA 3SV4A 2RMOA 3H0HA 2CDQA 3P8BB 4DL7A 1XN9A 1SV5B 2Q3PA 2NLUA 5ETQA 3Q89A 3L9ZA 3B8HA 3O2IA 1TKXA 3LP2B 3NGSA 2C0IA 1KS2A 1Y07A 3VF0B 2DEJA 3MJXA 5MLCV 1RAOA 4NWBA 4C5HA 1WI6A 3JCMJ 2LKZA 4OI1A 1MUZA 4CQ1A 3EG9A 4TU7A 1FNXH 4XPEA 1FTRA 3CDUA 3VAKA 2B9WA 2B5JB 2LMIA 2V9KA 3GCXP 1HI1A 5KFRA 1PAUB 3N6LA 2G0IA 2RB6A 1MHNA 4M7DD 2XY6A 4WE1A 3DOKA 2DXBA 2QAZA 1QDUB 3M6UA 1LW0A 4Y3CA 4YR3A 3HKWA 4CLSA 2QYCA 1SB6A 2QLXA 3VZIA 2COLA 5HVHA 3UPUA 3CCSQ 4BC9A 2VA3A 4C7QA 3DHWC 2UUBJ 2DTJA 4HEA9 3TUZC 1WDXA 2AV5A 1VIEA 5FRNA 4KBMB 2A10A 1C0TB 1UW4A 2EQKA 3CCSS 5SUHA 1WJRA 4Q0BA 5J3BA 2QMUB 4DPOA 3V8JA 1VC0A 5CKDA 2UZAA 4RG2A 4BDPA 2YKMA 3LW5E 3DLBA 4K4VA 2O31A 2C1EB 2XZTB 4IUFA 3MP6A 3JQJA 2AT1B 2DILA 2X4XA 5F8HA 3MR2A 3KWMA 2PUKB 5KT4A 3KK3A 1Q86C 2XS5A 4NXMF 3OHAA 1JJ2R 2OTLQ 5JMNA 5DRKA 4PR6A 1ZM3A 1B34A 3OYCA 3EFRA 2HURA 2MQOA 3BB5A 2GHWA 1VLYA 2OTLS 4U8VA 3FMBA 1S10A 3MAAB 1VRTA 2FC9A 4LRFA 1NMEB 4PWDA 4C0GA 3DFEA 2FJWA 2DGQA 2HFZA 2M9UA 2YNIB 1TG0A 2H8HA 4QYRA 4A54A 2AKLA 3PR4A 2BDPA 2J8SA 1VQ5T 1FKOA 2CRLA 4DOVA 2DNLA 1LQ9A 1REGX 3DDNA 2E10A 2X9HA 4ZP8A 4FYYB 2AJ4A 3VGTA 3LF0A 2F8MA 5ITHA 2PDAA 2YX4A 3LALA 1FCAA 6FDRA 3M0PA 1FXRA 3ZTQA 4ZPVR 2N82B 5CYJA 3GLXA 2GQIA 5B7WA 1WKKA 2JSXA 2CYYA 5IHIA 2DGXA 3NCQA 2FZKB 2NUTB 2Q6CA 1S72A 1I5OB 3MKDA 1FYNA 4IOBA 3L4BC 2F4VJ 3TR5A 2UUBF 1JMTA 1U1TA 2X3GA 3CCUT 3W9JA 1RTIB 3QRRA 1UFKA 2OTJA 4IDKA 3C4SA 4ECSA 1H73A 3V7CA 1F3VA 5FWCA 4FL6A 1IBMF 2YUNA 5LM7E 4XO0A 1QM9A 4L5GA 3W64A 1MN7A 4M5JA 1U8RA 2OI2A 1ZAVA 4DR7J 4JS5A 1MMLA 1GTEA 3I5CA 2J0WA 4C8QB 1WA7A 4Y2IA 4B08A 2EPIA 3KLEA 4ED1A 2IHR1 3EPIA 4XU2A 3ASKA 2LT1A 2W4PA 5IAYA 4BWMA 1MROB 2KJVA 4N76A 1YJ9A 1YRXA 4PKCC 1ZPWX 4YOEA 3NNHA 4J90A 1QVGS 4RCBA 1GBRA 3A8KA 2PNIA 3P8HA 2Y90A 1PNJA 3PO5A 3R8YA 1JKHB 3L2WA 3NS5A 2CSQA 3G4ST 1LWCB 4L6V3 3M59A 2KGTA 4M7DF 5LJ5d 3UDVA 4OI6A 3I5SA 3MM7A 3IM9A 2V94A 3CCQQ 5LJ5Y 1A0NB 4DUZJ 4G6VB 5IM0A 1HYSA 4OHXA 2KM8B 3DB4A 4C92E 3RZAA 3FQKA 1L3TA 2P6TA 4M5DB 2LJ0A 2JVOA 2ZH3A 3CCQS 1RLCL 3M0QA 2Y1JA 1HL6A 1ITPA 5IWAJ 2IJNA 2GO8A 3I31A 4LUDA 2OIHA 4QQ6A 2CQ0A 5C42A 4OZ3A 5HP1A 4FF3A 4J9VA 5FD1A 4OHWA 3HT0A 1S4EA 4OYMA 4RW7B 3H2VE 4DEYA 4ATNA 4C0DC 4UZCA 2ZH8A 2WW8A 4L72B 1KBRA 1VC5A 2LQBA 2KH9A 2EVRA 3K0JA 5A0GA 2KBTA 5F0WA 4DR7F 4I64A 3CMQA 2H5IB 1T02A 2EFGA 3CXCS 3S3MA 2EYWA 2CQIA 1UZHA 2W9CB 1TL7B 2R9LA 1U0HB 2XO6A 1RTDA 4D6WA 4F7UE 2LLZA 3V81B 5FU6B 2RF0A 3OR2B 2DHGA 2W24A 4WKRA 1GX6A 3KLGA 5JVHQ 4WP9A 3RB3A 2P0PA 4RNFA 2D6FA 1RISA 4JI2J 1WOOA 4HHHA 4BY6B 2ZBIA 2A08A 1TKZA 3F73A 1UB4A 3S7RA 1KNZA 1TL1B 1Q1KA 2XTJP 3OSVA 3C0CA 4L76A 3CCSA 4GVBA 1VIXA 4F4KA 1KRPA 3UD5A 1WXTA 2MSSA 2PD1A 3E51A 2PN6A 2J6UA 3V4IA 1EARA 2JM8A 4JLGA 4BWJA 5A0YB 5KFJA 3CEDA 2XMVA 1S5ZA 1SHFA 3QBYA 4DUZF 3VAIA 5CH7B 3ZZYA 3W1YC 2FPHX 4OJ1A 4WXWA 3Q22A 4E0DA 1URNA 5FW9A 2VKRA 3JSCA 2BE9B 1X69A 5IOLA 1YJ7A 3LWMA 4LF6J 1LVKA 2PIIA 3D66A 2X35A 2D9PA 3TSWA 1T9TA 5IWAF 2HHHF 3POTB 3T1HF 1S1WB 5LJ3h 4O3OA 5LJ3d 3JTPA 2VUBA 3HVAA 2MIOA 3R97A 3CC2Q 2D1CA 5LJ3Y 5EWFA 3KLVA 2WVEA 3T9NA 4ECYA 4PLLA 1I5LA 1ICEB 3G82A 2KVIA 1XTDA 2NYSA 4URQU 4FIBA 1JRIA 3HVTB 2OMLA 4N8OA 2W9AA 3MD1A 3HZGA 3L1AA 2Y8YA 3CC2S 1PYOB 4RU9A 2CP7A 2QXFA 2AJ2A 1SC3B 1HNXJ 2JFKA 4P71A 4ETZA 4TVRA 3TJ8A 2CP3A 2J6FA 4J9FA 5B0EA 1RTJB 3C14A 3OVBA 2JMAA 2CUDA 4LDYA 1L3UA 1HHSA 3QATA 4C48A 1W70A 5GAN6 2WVCA 1S1TB 1RBAA 2QO3A 2MZSA 4C5GA 2DVIA 4QYZK 2ZPHB 4A4JA 3NNAA 4C8ZA 4FKYA 2DXFA 4J9NA 1IUJA 3K57A 1S1NA 3EG0A 3C19A 4FPRA 3X20B 1RAHB 1K8AR 1IXDA 3BDLA 4ELUA 1VQ7T 4CO1A 1K8AU 3B6BA 2VFRA 1SG5A 1FRIA 2BKNA 4WWSA 2R7SA 2OPRA 1KQSA 1KSWA 2L8DA 5B09A 1CS4A 2L2PA 1RWNB 4JRPA 4HCZA 2GTJA 3UNYA 4J9BA 3C6UB 2CADA 3QO9B 5I3UA 2KYZA 2BX6A 5GMKm 2Z2ZA 3KDOA 2KFZA 1R8OB 2B3TB 2GX8A 2XI3A 1YWOA 3PYEA 1XBWA 2VKZG 4LF6F 3BGRB 2IAJB 3QXEB 3E01A 1SIZA 3V6JA 1UW9A 1Y5IB 4C2MA 2DGSA 1HBUB 5KFYA 4DWIA 2B9XA 5H1SV 3AJDA 3DDKA 4M5LA 4B3RJ 4RW6A 5KFKA 2ZJPQ 1RB0A 2W4CA 3OY9A 1QVGA 1YI2Q 4N0AA 2UUTA 1R0AB 4CWBA 1MNEA 4HVZA 4B3SJ 5AT1B 1RT5B 4NCBA 2MGZA 1YI2S 5D0RA 3RW7A 3ISNC 2E6NA 4Y92A 1C1BB 1JXEA 3MCAB 1SSHA 3PKMA 1EETA 3RRHA 3PMIA 4DR5J 4YQWA 2V68A 2OJ3A 3CVKA 4IUVA 5HANA 4LUEA 2XDDA 2H65B 2HBWA 4QYZJ 1SKUB 1CPZA 4J7CA 4MYTA 3QDRB 3M8PA 2VFTA 4JV5F 2W01A 5E3CA 2KKHA 3CCQA 2O3DA 2GVZA 4AG2C 5GAOq 1W2BS 1BLUA 5KT5A 3EVOA 2JHEA 4ENOA 2ADBA 2GA7A 3OYMA 2AZVA 5M9OA 2VG7B 3HSJA 4KV8A 2FJXA 3DDIA 3DXBA 1T3LA 2LU2A 1LW2B 3V8KA 2PGCA 2J5AA 2JXBA 4TLRA 1C2PA 1JNZB 2RB7A 2DVEA 4P2FA 4WFBQ 2B8AA 1LCKA 2WHOA 1FTCA 4J9RA 4IR9A 1QP2A 4ME7A 4ANDA 2R7UA 4DV0F 4AXJA 3I4HX 1WTFA 4MTPA 1X43A 1YN8A 3WX8A 5ADZA 1VQLT 4J9QA 2K3IA 4Z7CA 4LR7A 3CXCA 5A8KA 4M75G 4M78B 4L3KA 1VBKA 1S9GB 3BSOA 3QRQA 1JLBA 3AB2B 5KG1A 1M5KC 3U1LA 4HYKA 1XR6A 4ANJA 4LBPA 4B3RF 1YJUA 2P2CB 4DG1B 3M8ZA 2JZ2A 5GAN8 1HBOB 4HKEA 2RI2A 2ZD1A 3M8YA 3ULHA 3ZNUA 5ECAA 2MKCA 1Y3KA 3ZZZA 2D9TA 2E1PA 4B3SF 2HVDA 2DNMA 3AD9C 4A4EA 1M90R 2UXDJ 3BM7A 2BKOA 2RVJA 1M90U 3NGKA 4PCQA 2L89A 3PG9A 2DXCA 4DR5F 1U2CA 2A3LA 4ILRA 2QIFA 3CBOA 1QJHA 2CQGA 2LU1A 2YLBA 1LK5A 2MY8A 1PG5B 4QJVA 4LUBA 1NB2A 3A3OB 1HPZB 1SJ3P 1RJJA 3GSDA 4LN2A 4AFQC 1ZOTA 2KO1A 2D41A 2DAQA 2LQKA 4KO0B 3LPEA 4B3MJ 1M5PC 5GAN5 3I56T 2CZVC 3DOMA 2H51B 1UTAA 3CMEQ 2N7YA 2P9CA 4XTXA 1WPYA 5GAHU 4KHMA 2RRBA 2CP2A 1X6BA 4CM2A 2LVWA 3P8DA 5E3QA 1YJNT 1ROFA 2ZBPA 2HNDA 4M5GA 1Z9ZA 2NZCA 2V2VA 3CC2A 2HRUA 1N5ZA 3LWIA 2DETA 4G3IA 1XMOJ 1JLEA 1PC5A 1ACMB 1HW9A 4DQIA 2ZZTA 4H4KA 3BPSP 1K0VA 3ZXWA 3IA0A 4B6MA 4UUWA 1S6PB 2PC6A 1UVJA 2AEFA 4DPUA 1ZBJA 2CVEA 3SQGB 2NYHA 3RBXA 2RJZA 2CPXA 1RAAB 4OF1A 4HT9A 3UR0A 4ZP7A 3GCWP 4DSFA 3PVXA 3RMQA 4NX9A 5CZXA 2QA4T 4UY8T 1P9QC 3OTDA 3VAJA 1KQGB 2YDLA 2DL3A 3W2WA 1TUDA 2RJEA 1WJ9A 1U1KA 2ERRA 2W2NP 4LE9A 1KTVA 2UU9F 1N5QA 1SC4B 2AZ3A 4AMCA 1AW0A 1SPKA 2UXDF 2MEWA 2EW3A 4DS5A 3T1YJ 1MWQA 1FVQA 3SV3A 3MAQA 3L2ZA 3EFOB 5KFDA 1VYVA 1U45A 2J6SA 3H2UB 3PMTA 1NDLA 2V8KA 2CQBA 1FEEA 4P72A 4CH0S 2UVWA 5H9FK 4IOAQ 3CJKA 2ED0A 2RU9A 4ZP9A 4PLIA 2VBXA 3IFEA 3HF5A 4J9LA 4BS2A 2O9VA 3K8WA 4DBHA 2CJBA 3VS0A 2J9CA 3HP6A 2XMAA 1XMBA 3JCMd 4JJDA 4Y2CA 2YX1A 2C3OA 4P52A 1JLQB 3MMAA 4IG3B 2DNKA 5HQMA 2AQ4A 1YJRA 4K4TA 1X5PA 5DETA 2LRQA 3EGUA 2BQRA 3M2UB 3VS7A 1YI2A 2GIFA 1XMOF 1HWJA 1UVKA 2NUPA 2AZ1A 2DNZA 3H5SA 3CJSA 3E8OA 1N54B 1M4ZA 2V8IA 3OT9A 4QW2A 3TSZA 1KG1A 2RJDA 1N56A 1FEHA 3EJMA 3CCJA 2GCFA 2R57A 3EWGA 3SXLA 2XM3A 1G7CB 2B7BB 4C8LA 3V8LA 4DV5J 5GAMd 3OS5A 5KH6A 2JX2A 3CDBA 2X3DA 5DZ7A 4CDIA 2W7AA 2ZDPA 4HVWA 5B0CA 2CZ7B 4IG0B 2DNYA 5L9XA 1WNEA 3ITHA 5E7OB 3PNWC 1H2TZ 2ALYB 1BBZA 1NG2A 2J6TA 2K7KA 5A6PA 1AROP 3QPHA 4N41A 3JYTB 1SUQB 1EFNA 5A8RB 2P4TA 4R5PB 4ED2A 3BGFA 2FQQB 5KFSA 3DOLA 2IMWP 3HL8A 2C3PA 2GVDA 4LF1A 3GP8A 2BACA 5J2MA 4B17A 1Z1ZA 3J80U 1HQEB 4ZNXA 4TN2A 4ITSA 1V3RA 1CC8A 2IVFB 4J9MA 1N36J 5GAEI 4IRCA 3JB9G 2E5HA 1VQ8Q 1BGXT 3GILA 1YSJA 2DR5A 3UN5A 4LSNB 1TWBA 3A3PB 3K59A 3SMZA 4KB7A 4AT1B 2VH7A 3DLJA 3KLIB 1VQ8S 2C3YA 3KXTA 5F9LA 3M8SA 2HBRB 2QLFB 3NS7B 2KK4A 1T9WA 1U8WA 4HI2A 2OGUA 2MQPA 4M75B 1VQ9A 3I82A 1VUBA 4KHPF 4DBRA 1M8MA 3W5XA 2HS4A 3X1LB 2RD1A 2LECA 4JI0J 2C0TA 1FRLA 5HI7A 4ZGEB 4DCOB 2GQVA 4DHVA 3KHLA 1NSPA 1TKXB 2L0AA 2BRKA 2YNHA 2YT6A 4DOWA 1NUEA 4HA8A 3I4PA 2DK3A 2DH9A 2EFPA 3D5MA 3KUHA 1FMKA 2OFHX 3PKYA 2XGPA 2O2OA 2OTJT 2FJBB 2AX0A 4QPTA 2CJXB 1NJYA 2CZ9A 2H5JB 4OZ2A 2IM2A 1R0CB 2DNPA 3PFOA 5F9NA 3MHXA 1M5SA 3QJPA 2RDDA 2UVRA 1OPIA 3D0HE 3H20A 2FVQA 3G71Q 1M2OA 1SIWB 2K06A 1UZDA 2AYEA 3OQ2A 2EIFA 4WE1B 1T8EA 2AJFE 4C0HA 2LQJA 1T0JA 1W1FA 2MPXC 3F41A 3G71S 4OMOA 5FLXU 1QSYA 3MCOA 4FDFA 1XTZA 4F14A 3K5NA 1IJEB 1VBZA 4BHQA 3LYIA 4AQYF 3OMCA 3GIKA 1B64A 1WF0A 2YWGA 3FZ2A 3NWRA 1HWKA 2KHCA 2VC0A 4C8QC 2Z56B 2YKAA 3OUYA 3JV3A 5LJ3e 1UEBA 2JN0A 2QA2A 5KTQA 1ZUYA 3QKJA 2DHAA 3QT7A 3HHTB 2XK0A 1VQ6Q 4L73A 5DJBA 1S0OA 2VA2A 2ZCFB 2ZGWA 4EFAC 5GAOp 4NOHA 3VVUA 1ZBXA 4RX6A 3U27A 4USVA 3G6ET 3MEDA 2VOPA 1FMVA 4M7AG 1BUXA 4M7DE 1VQ6S 8AT1B 5J2QA 2CT3A 3SDEB 4V19X 1B0PA 2EFIA 2E65A 2MZQA 4R8UA 1SCJB 2E66A 5DLFA 1AFIA 4FSSA 1MMGA 3MCNA 1B34B 4JI0F 3H5XA 2ABLA 1QP3A 3HSZA 4WPAA 1REVA 2K3BA 5LJ3g 1PJ6A 2EG2A 2LCWA 1Q53A 2GW8A 2RM4A 5AE2A 4ES2A 1L5UA 1VRTB 3CJ8A 2UXBJ 2KM8C 4NA1A 3OTBA 3QJJA 4OJ3A 4QVZA 4NLPA 4OV6A 1UWBA 2FGOA 1SL1A 2Z0WA 2E29A 5KFEA 2I0NA 1N27A 4DSEA 3SZ2A 1FE0A 4NL3A 5AXMA 1A6LA 4Q8FA 2HDAA 3MFIA 3RRGA 1W6XA 2JFDA 2PO4A 4YR2A 3TUPA 1GMWA 5C25A 1N4LA 4JI6J 1S1XB 3HHEA 2Y1LB 5DS7A 4ALZA 2E5IA 4ORZA 3M9OB 4FNIA 2ZZMA 2P0QA 2L3PA 4F16A 1OU9A 2DTOA 3SCIE 3MUVP 1GXUA 2QGFB 2JVVA 3OW2P 5FU6C 3OS0A 4DX7A 5GAN3 2CJYB 1AHJB 2VONA 1S97A 3CCST 1J2VA 4ZPWR 3BBFA 4WTOB 5KFMA 1HQUB 2C06A 5KG2A 4PABA 4BY6C 4EBCA 2XKOC 3OFFA 4FXVA 1NPKA 4XPCA 2QASA 4WYWA 4TXSA 2RT3A 3TVZA 3HHLB 2HNZA 2KVQE 4PK4A 1WKLA 1SH2A 1UVMA 3TCJA 3J7YI 4DUYJ 3HCXA 2NQPA 4JLIA 3TUIC 4UZBA 3KLEB 1CSKA 1VQOQ 4H4OB 3CC4Q 2VJVA 1QVFS 2OTLT 1OPKA 2WB1D 1CLFA 1FX4A 2XMWA 2DHSA 4DQRA 4EMDA 1ZAWA 3LUYA 1ZSZA 2W25A 3IXQA 3RAMA 2E9RX 1TP7A 2BJ7A 3AA9A 2RQKA 2KZZA 3E9GA 3OS2A 4NOYA 4Z88A 1BQNA 2PEHA 2C2OB 3QYHB 4LXCA 1F9EB 1AD5A 4URGA 2HFOA 2X1AA 3H8YA 1G3OA 5K8PA 4QWBA 4KGVB 1Y11A 2QC3A 3MM7B 2ED1A 1DLOA 1K1ZA 1YZ6A 4M77G 4OMFG 1BI2A 1YWPA 2WW4A 4C92A 2WONA 5A76A 2LQNA 2AKKA 4JI6F 3U02A 1CEZA 3I96A 3MHYA 4QW8A 3GNFB 2QN6B 2YWFA 2A28A 3CPWP 1FXXA 3U1MA 2K7AA 3PW2A 3K89A 4G1QA 2FRYA 1PWTA 5AXNA 2MZTA 4AUKA 5U47A 1JXMA 1ZM9A 5C42B 1OPLA 4GLKA 2IFXA 4OYXA 2NS1B 1OWXA 1BCMA 5KAKA 3FEXB 5ETVA 1NSQA 3Q2TC 4A4HA 4QIFA 5ETRA 4NA3A 2WSCC 2V1QA 2RK1A 1XQHA 3CD7A 3S1TA 4WXOA 2P0KA 2B51A 5CCMA 5D4OA 5C2GA 3NNCA 5KFIA 1PKTA 5DLOA 4LRCA 4FYVB 1XNQJ 4F7UA 1K8AC 4DUYF 5I42A 2RJCA 2ACMA 2FHDA 1QY7A 4B9MA 4K4SA 3LO3A 2D8HA 2GJFA 3KLGB 3BH6B 3G71A 3MEVA 4N7TA 3ILIA 1IBLJ 3EGXB 3DCAA 3UN2A 1YIJA 2DO0A 4H4MA 4ES1A 4X4TA 4ELZC 3OMGA 1M1FA 4R0JA 3CW2C 4FT4A 2W2QP 3FCHA 1RU2A 2AU0A 2ASLA 1TKZB 3W66A 5J26A 1N88A 3BH7B 3EE3A 5KFLA 3REBB 1HNVA 1UHCA 3MEWA 4GVBB 2XY5A 2CAJA 2QLBB 2M70A 2CKKA 1DQ8A 3M8RA 2APOA 1NK9A 4TYBA 1JQGA 2CQ1A 4C3MA 2FJDB 2GGRA 3BY7A 5KT3A 1TK0A 2ASDA 4ZPBA 2DT9A 3M0RA 3CC7Q 4GVLA 3CCQT 3CJ3A 4QVDA 5LL6d 1S9EA 2ADCA 1JX4A 4E7IA 3DN9A 1KOOA 2HQEA 3AB4B 1SL2A 4YN3B 1KC8C 1Q78A 4F4YA 3DGPA 2BTTA 2CXEA 2YWKA 4Y6IA 4M7AB 4RUBA 4E7JA 1Q8BA 5L9NA 4MAKA 1YZ7A 2BUDA 3EDQB 1KD1R 1FDDA 3VS3A 4DL4A 5IT0A 4IURA 1RUSA 3HFNA 3J80Y 2HQFA 2UUAJ 3JB9I 4OB1B 3C14B 2I8EA 3ZTOA 3P45B 3ZFJA 2ROGA 2K3YA 2ZPBB 2XZWA 3AD7C 2M5YA 3CCRQ 4XK8E 1AUDA 4S0MA 3I5AA 1Y5LB 2G1DA 1BQMA 3CCRS 4HTIA 1ZHIA 1HLWA 1KQSR 2IYGA 2G4BA 2SRCA 4M78C 1OOTA 4ZLPA 3DLKA 4JI4J 1FXLA 2YLCA 4OI3A 4PXEA 2C42A 4LR9A 4C0OC 4NCGA 2WVDA 1CS4B 4C9DA 2VF3A 4XIUA 2KRSA 9ATCB 5B08A 3BGLA 1R6VA 4ZP6A 4HVVA 2AHOB 5BJRA 1NJZA 3GJRB 2P84A 1EP4A 5A2QU 2XI2A 3G6VA 1BIBA 5ETLA 2FJEB 1DTTA 3MEEA 4YEAA 1SJRA 4USJC 4I6AA 3E01B 3KK1A 2R8IA 3AHPA 2FVSA 4USHA 2HKEA 1M5VC 2V34A 1S77D 4RNOA 1UJYA 4FF4A 1KEKA 1DTQB 4OFZA 2V8GA 4RTUA 1QVFA 1N34J 3NTHA 2CPDA 3MM8A 3EG3A 2PZ1A 1YCYA 2YTCA 3PJWA 2DA9A 5EUHA 1QAXA 5FLXY 1IVZA 2QSWA 4JPBW 4Z37A 1ZX6A 4WK3A 2X3WD 2CGHA 3QYGB 3LWHA 2W1BA 5K14B 4F4ZA 2IRYA 3CC2T 3O6QA 2NCKL 4D8DA 4AL5A 4AL7A 1QKXA 2QLWA 3ZNJ1 1IKYA 1IKXA 1UHFA 1EETB 2UUAF 3ET6A 4JV1A 1VYUA 2UV8G 4GC6A 2JEIA 3UVJA 4C11B 3EH2A 3QWPA 2WSEE 2HSPA 1ZAXA 2CJ9A 2HQHA 2J7KA 2GVZB 2VICA 4BE2A 2DIUA 2RUGA 3CMAS 2AKWB 1P92A 2KG0A 1LNQA 1V1CA 3OYNA 2KZMA 1DJ7B 3KMQA 2KEAA 4KV8B 2H5EA 5B0FA 1GTHA 4ZVPB 3E1SA 4LFAF 4F25A 2JLEA 4DXLA 4K5SA 3NRBA 3PYDA 4NLOA 5I4MA 2GF7A 3HULA 3HP9A 1PD0A 4I2PA 4M77B 3MZIA 1M5HA 3CXCR 3BO2A 3GONA 3OYDA 3N5BB 2OX7A 4OB3B 4PG4A 4CI0C 2M0YA 2LCSA 2XY7A 1OX8A 2IIHA 2OJ2A 4WFAQ 3VKIA 4HCCA 4X66J 4JDSA 4PJOG 2K5FA 4U9RA 3T19A 4FKXA 2KRRA 1WZOA 3IWNC 1QUPA 3GV8B 1JLBB 3OYKA 3Q8YA 1N34F 5KFBA 2AEJA 3X24B 2XS7A 5A0LA 3BO3A 3WXMB 5AJ3J 1QWFA 2IYIA 2ZUGA 3SFUA 1OJ4A 4U6PA 5L23A 1LV5A 3KLFB 3TNVA 4F67A 4QCLA 3MR3A 1NJIT 1WHJA 4J9GA 2FUG9 1YI2T 4OI2A 4ANEA 1IR0A 1S0VA 5MAOA 5LMUF 1FJ7A 4DL5A 2GGPA 3CCVQ 1H7WA 3NWGA 1FDNA 1N5TA 3PGGA 3MI7X 2GBQA 2DERA 1VHIA 4OI4A 4YB6A 2JLFA 5LT5A 1GMWD 3VUBA 4WYLA 3CCVS 3MCMA 2OFGX 3JAMU 4OHYA 3BJYA 2CYZB 1PYTA 1RT1B 2HRYA 2I5JB 3P5BP 3DC2A 5IV4A 3IMQJ 1KVJA 1NK6A 1SPBP 4EMHA 1RUWA 4OX8A 5E3PA 1LEOA 4M1KA 1WNLA 4QR0A 3JB9k 2ATCB 4RNHA 3J81U 2F2WA 2JL9A 2AYMA 2ZOMA 3GU0A 2Q1LA 5L1IA 5CKBA 4JOUA 3CE8A 4DV3F 1J3TA 1H0HB 1R43A 3FQLA 3TQEA 2XG8A 1GFCA 4CTAA 4UOCA 2HWTA 2PFDA 4QBUA 4X66F 4KPYA 3V7SA 2KT5A 3I55Q 4MIAA 3OYGA 2JTFA 1WUUA 1HNIB 3L7PA 5F3ZA 1GMUA 4OMLA 3K5PA 3OL8A 3I55S 4MKBA 5M2PA 1DY3A 2MKKA 1TKTA 2EXUA 3C2PA 4PJMA 4ECZA 4J5YA 3CCRA 2FB0A 4V2SA 2GQQA 3RUBL 4EIKA 4KGMA 1E6YB 3KUFA 4USKA 2RRAA 2G1HA 2J6KA 1J5OB 2YWHA 2NXEA 1T7PA 1HWUA 5CXTA 2AF6A 5KG3A 1QCOA 3THKA 3CWJA 3R6GB 4ECTA 4AG1C 2FYXA 2O1PA 3R9LA 2VODA 1SKSA 1KLMA 4J8OA 3A13A 3DLGB 2HGMA 3DLLA 2EJGA 2HWIA 2VL1A 4CO2A 2P6SA 2JH3A 1G8XA 2L08A 2JC1A 3ICLA 2ESWA 2ABYA 2OPQA 3T9ZA 2K57A 4M75C 1RI0A 3CJKB 4C8QE 2F9DA 2LDMA 4ED0A 2BBEA 1NXIA 2V69A 3N01A 3Q8QB 3JSBA 1GBQA 2EC2A 3PHTA 3T5JA 3MO8A 3M4GA 3PIOQ 1DQAA 3W9IA 1U47A 1TUGB 3O3LA 1NJIR 2YH0A 2WB4A 1FJGJ 1RT7A 4TU9A 5JJBA 4I69A 1NJIU 4O23A 1S99A 1C0UB 4ILLA 3DM2B 3FCVA 3JB9D 4WU2A 4DI6A 3BF4A 3WDOA 2UP1A 3G1JA 3UCGA 2BANA 2PQWA 1P1TA 3Q0AA 4NCAA 4E7KA 3M1VB 1FWLA 5HCKA 1FK9B 1WKJA 1ZM2A 4RTZA 3TJ9A 1OMSA 4ZCMA 2V2KA 4ERDA 4K4WA 1HMVA 2ZH6A 4DR4J 5T7LB 2ZFHA 1RWPB 1RWMB 3FDSA 2DNHA 1KSPA 5GMKh 3CBMA 1CJTA 1Y10A 2QJ3A 4Z7YA 1K73R 2IG0A 2CNLB 1K47A 3CMAA 2VWFA 1RACB 3BN4A 3JSYA 2QEXQ 4GKJF 2Y4XA 2QL9B 4WKYA 2L9NA 2CQ4A 2HHWA 4OJHA 1RBLA 1VLOA 2DM1A 3NGRA 2BYCA 3PM9A 2RU3A 3ILJA 2DJZA 2L3MA 3PTWA 1G2EA 3IC1A 4X4UA 2QEXS 2BMBA 1UA1A 3M8QA 2ZH2A 3JQKA 3MP1A 1T0HA 3GNGA 4R56A 1JO8A 1R3NA 4K11A 1RU1A 2A1BA 3BV8A 5ETOA 4C8NA 3TVKA 4F3QA 1QMCA 1UGSB 1PGZA 4NZ7A 1UEKA 2RI3A 5HK3A 4U67Q 4ID5A 5DM6Q 2XCAA 1DHMA 1QCNA 1UECA 4NI2A 1S6QA 5KG7A 3VUZA 1F2GA 1UWAA 4M95A 2DJWA 4LQ9A 5J2MB 1S1VA 3HFOA 1L3KA 1YBUA 1IBKJ 5CYMA 3HPOA 1JJ2P 3AOAA 2YNGB 1UVLA 5I2SA 4LSLA 3V6HA 4FP9A 1RHKB 1FJGF 2K1RB 4RG8A 3M8WA 1XIQA 3DU6A 4CO0A 2ZPFB 1X27A 2NSCA 2O01C 5HROB 3DMJA 3DKMA 4TY9A 2VB6A 2CQCA 3KUGA 4C8KA 3RU0A 2UUWA 3N6NA 1Y7XA 4ECWA 3M30A 6AT1B 4QIEA 3J7ZT 2JS2A 2DCUB 2HGNA 1T05B 2Y8WA 1K9MR 1B0VA 3BKTA 4DR4F 1OS5A 4EMGA 4J5OA 1K9MU 2A2CA 4O4GB 1XMQF 5D3GB 3O44A 1S1UA 3TVTA 2H48B 2IRUA 1T0TV 3PVLA 2YNHB 1FRXA 1YX2A 1RHRB 3ISZA 4CP5A 2ZEJA 2WAQD 4LT6A 1HHTP 5A2QY 1Q7LB 3MWBA 1Y96B 4RBTA 1UFWA 3SCKE 1WEZA 2WVFA 1ZZNA 4N4GA 1N32J 3X3UA 1N8RC 4FBUA 1YRUA 3OFHA 2CVIA 3Q23A 3FBCA 3DGVA 2VQEJ 4G1IA 3OSNA 2VG5A 3EGNA 3I87A 3LAKA 4LDWA 4PUOB 3R5GA 1FD8A 2BJ1A 3Q8PB 3RR8A 3OYIA 1P9YA 3UE2A 1O8BA 1WJQA 3NGPA 2VASA 3Q83A 2UXCF 2YXLA 3H8ZA 2KFNA 3PY8A 4JUZA 5HK4A 3HHLC 4J37A 4GO5X 4DR2J 3MCSA 1IBKF 1VQNQ 2QA1A 5KG0A 3B82A 2V63A 3GE9A 1HNZJ 2CPZA 4M5MA 2DRMA 3R5CA 2OAUA 3I55A 3IRXA 4M7DA 3KHGA 3MEDB 3JB9F 3FUYA 3US5A 4Y28C 5IQ6A 2LXUA 2FZCB 1VQ8T 1RHMB 3H0FA 4KULA 1KHWA 4C4WA 4R8UB 2HS0A 4UF4A 3VAMA 3TP2A 4MIWA 2ZNYA 4OYPA 5LMNJ 4Y34A 2HKNA 4U96A 3QWYA 4RTVA 2RNEA 1REVB 2CWKA 1NKBA 3URGA 2ASYA 1T9XA 3C15A 2ZHBA 3G6XA 4KQZA 2IJFA 1FJCA 2LJ1A 1X75C 1UWBB 2FDNA 1EHWA 3G8TA 2KN4A 2N3LA 3GIIA 4IUQA 3PDNA 1JLFA 3DYAB 1B3TA 2N4DA 4KGZB 3QAEA 3PNIA 5GAGU 1WHYA 2UVVA 2E1RA 4JI1F 1W2IA 4NLXA 4KKOA 4PWWA 1BD6A 2XC9A 2H3EB 1JBMA 1UKUA 2E44A 2L5QA 3THPA 3G71T 4PPDA 1Q82R 2V9WA 4WIQA 4WIIA 2CIMA 2HQCA 1NYGA 1Q82U 4DR2F 1FF2A 1MW7A 4NXNJ 1JJHA 2CH4W 1WC0A 5F3TA 2XMJA 1Y9OA 4WU3A 4DL6A 1MU2B 2B4UA 5HO4A 5IV3A 3O8WA 5IXFA 2RRNA 5CABA 1WXBA 2LNVA 4I2QA 1IHWA 2E6ZA 3DRSA 3JCMP 5JXSA 5DM7R 3GFHA 2RHXA 3FRNA 2EQJA 1VQ6T 1NRKA 2IIMA 4IYQA 2HAIA 3JAMY 3QHSA 4EUVA 3K58A 3CQTA 1CJUA 3EGVA 2ASJA 3X28B 2QEXA 1TV6A 2W2PP 2HNZB 4OX9J 2V8DA 3O5ZA 1GFDA 2BQ3A 1VRUA 1TZ0A 5LMNF 4CNZA 4NLSA 3H98A 2V0NA 1IXKA 1CKBA 3F70A 1QLYA 4O0IA 1Q79A 2CNOB 4JRKA 3J81Y 1X8DA 3PJ9A 1QE1A 3MD3A 3M05A 3TEEA 3EG1A 3OYBA 2MPUA 3OYHA 3CJTA 2QA4S 3RKYA 4HVUA 3OLBA 4A63B 2LT4A 3QSIA 3QLHA 4HACA 5LJ5f 3MURP 1BQNB 2ZZDA 5KG4A 2XLKA 1M3AA 3I6PA 5I11A 4RTXA 1I94J 1NM2A 4M7AC 4E6RA 2J7WA 1ABQA 4AXIA 4Y2AA 3G7ZA 5LOQA 2VV5A 2DGWA 5HY6A 4C92B 1IJFB 2FGCA 3BQ2A 4I67A 3IGNA 1UFLA 2XI9A 4OV1A 5AYFA 1GXLA 1KD1C 4L59A 5IZHA 1T9YA 2BIVA 1E6GA 2HFNA 1D3WA 1KVKA 1AOJA 5GJWB 1D3BB 2I2YA 2JJ9A 1LPLA 4KFBA 3GR0A 1EKSA 4HHJA 3IR6B 1IGUA 3ETOA 4R25A 5D6WA 1U6FA 2YWEA 4CLYA 4DV7J 4FYXB 2EKNA 2AGPA 3P6YC 2MLXA 1NEBA 2W0ZA 1X2QA 1JLGB 1S49A 2MKYA 2O67A 1H6KX 1WEXA 4UY85 3M2VA 4OX9F 3AOCA 1IN0A 4KRWA 3I9V9 3JRZA 5J1EA 2HYIB 2MY7A 3CBPA 3VRYA 2B4OA 3TEHB 2RMLA 1Y00A 2BJ8A 3EVMA 4DJBA 4JP8A 3VR1A 2JC0A 1IR1A 2D0NA 1Z4UA 2B4PA 3AQOA 4H4MB 3FK4A 2B9YA 4X84A 2VBZA 4X4VA 2A6OA 2FLLA 2CFXA 3GOXA 2Q43A 3KTQA 3CC4T 3W62A 1G1XA 1HNVB 1U1QA 4A4KA 2MWPA 1Z2ZA 1Y7PA 2D8JA 1T11A 1I94F 3PX0A 1OU8A 4ED5A 3BYPA 1UAWA 1HXDA 5E41A 2M1HA 1H3ZA 3WZ0A 4P2XA 1VQ4Q 2MHNA 1IREB 3DI6A 5CO7A 5LJ3f 4ZLJA 4DZ6A 1Q7YT 7FDRA 4TY8A 1I81A 4ZCIA 1B7FA 3W2VA 2AYBA 3PTAA 5CAAA 5GANh 2OEMA 5GANd 3DGPB 3QIPB 3R5AA 5CA5A 4CLZA 2JOYA 2EGCA 4DX5A 4RW8A 3CO0P 2DD5A 5J2PA 2OPPB 4F3MA 1VIFA 2B8PA 1N33J 5D4NA 2RQTA 1PHTA 2KTQA 1SBRA 3O8VA 1OQ6A 3QGGA 3META 3MM9A 1NK4A 4EMKB 1YRTA 3GR1A 3FSYA 3PFSA 4QT7A 2W4DA 3OVAA 1RK8A 4ZTJA 1RKIA 3AT1B 4M77C 1TK8A 4LIRA 2FVUA 3THVA 5L46A 5L8RC 3H41A 2ZH4A 2XU8A 1R8HA 1D0XA 2LEPA 4LRAA 4EYIB 1KK7A 2QMWA 4NPOA 2DEIA 1B07A 3RKWA 1M8VA 3S6WA 2HKQB 3I0RA 5HMZA 1NK5A 4ZGDB 2YHTA 2ECZA 1EQMA 1S12A 2ZAEA 2XYPB 1QD1A 3MMCA 2EBGA 4I0WA 2BQUA 3AAWB 1H7XA 2Z30B 2CPJA 1IHVA 3Q8VA 4DDFA 2B56A 2LDIA 1F2HA 3MR7A 4QW9A 2G2YA 3HXMA 4NRUA 3QT5A 1M2VA 3Q1JA 3CIMA 3BREA 1S6UA 3E2EA 4LF5F 2BJ3A 1U1LA 2LP5A 3RAQA 3M0TA 1ZUKA 3Q2SC 3PW4A 5A6WA 1HQ2A 3OVSA 4LRDA 3PEHA 2DJQA 1YITQ 4C3KA 2NSBA 3V2UC 2RHSB 1D9AA 5GADI 1GNKA 3CC7T 5GMKe 3AODA 4J91A 3MM8B 3EGDA 4PJOD 2HAFA 5A8WA 1UGRB 3G6ES 3BO4A 2QA4A 2IY5B 2E5GA 3M58A 1VYAA 1YITS 3D0GE 2JTMA 2WRMA 2EK6A 3IR7B 3QGHA 1D1CA 1QQJA 4QVCA 1SC1B 1S4FA 1TL5A 3T6BA 3JXOA 1GT8A 5E5NA 1NK0A 1VBYA 1RAEB 1D1BA 3SFMA 2CUYA 1DJ0A 1TVRA 2LQ5A 1IKXB 1IKYB 3KJQB 3TX8A 4FM4B 1IQTA 2HVHA 2HQXA 3D3BJ 3ENQA 2O4XA 3ET6B 4I7FB 4XTTA 4KT0C 1QTNB 4P9SA 3ILOA 1R27B 1FKPA 4DFKA 3UVJB 1TAUA 1YLXA 4USIA 1BI1A 3H5UA 4TQRA 5GAOm 3ZFVA 2R5AA 2IDLA 1Q7YU 2DD8S 1OSCA 2U2FA 2AIRB 2MQ8A 1FWKA 1SV5A 3KXDA 1ZZFA 1U8SA 2F9JA 3P4UB 3LWLA 2F40A 3LP2A 3CCRT 2Y9HA 4PG7A 4HDHA 1U25A 4EZ9A 4DSLA 3M9NB 2V5HG 1Q95G 3CCTA 4JV2A 1WYXA 4F8RA 2DE0X 2JVRA 3MMJA 4I2PB 1DZ5A 1HARA 3AY0A 4IO1A 1WFWA 1CULA 2B5JA 3JCMW 1VJQA 3OA6A 3QZ8A 4K4XA 5EGYA 3RBZA 1WGSA 3UATA 4D3GA 1PCAA 4IH7A 4P7TA 3G87A 2B43A 2BKPA 1QTMA 1XR5A 2SXLA 3HT3A 2J0XA 2E70A 4A8FA 3UDCA 1I1GA 2DB1A 1WJSA 5CK9A 1GQEA 2QFIA 4BBYA 3M4YA 3UW1A 2CJAA 1G6BA 1X4EA 1SQGA 1IBMJ 4JI5F 1Q86T 2ZKUA 5IC6B 3R2CJ 1TL4A 3OL6A 3C8YA 4NLQA 5FRMA 4DR6J 1SEMA 4PQUB 2BVZA 1GX5A 4YB1P 4C5EA 2QLJB 2XHCA 3REAB 2HHXA 3ZZRA 4Y2KA 4DU7A 1T03B 4KIAA 4MMKA 2DISA 4DX8H 2EQIA 5KFUA 2XS2A 4KSEB 4X34A 3HKSA 4WFYA 3HK2A 3QMQA 2FHJD 2YQ0A 4DS4A 3TU4K 1LXNA 3CMAT 4HLBA 3DNCA 3RAXA 4OZLA 5E3RA 3MAAA 1NM7A 5KT6A 3J7AN 3OR1B 3R3TA 3IWXA 3KJVB 1QCFA 3I9QA 3EFSA 2ROPA 2CP0A 4JRQA 4IOCQ 1M3BA 2YNIA 4W4MA 1U1OA 1B7TA 4HH1A 1DQ9A 1OULA 5I3QA 2CG4A 4M7DG 3OYLA 1RAGB 2HWHA 3UN3A 1RXOB 2CWXA 1BXNA 2MZRA 1K73C 3UT1A 3CB4A 1D8ZA 4MT1A 4DV2F 4QWAA 4UQTA 1H38A 4CTAB 4J7IA 3QIIA 5GMDA 1VGYA 2NUTA 4ZCLA 3OSPA 4PYAA 2LQWA 4RPFA 4RR5A 3AJ1A 4PJOF 5H9EK 3KG4A 2IJRA 3AFGA 4CT8A 5HLFA 5DY9A 1WHVA 1RLQC 3HJVA 4NYZA 2F1LA 1LOUA 1TKDA 2HEQA 2J7IA 4DR6F 4W98A 2KT1A 4ECXA 1MMNA 2DITA 1V76A 2DL5A 2ZBCA 1YKWA 1D8YA 3D6MB 1PSEA 2HVEA 1ZTWA 4F02A 3IG1B 3FEOA 1UE9A 2LP4A 4ZPTR 2AGOA 1PSFA 2L3SA 3PO4A 4C8QA 1OY9A 1O0PA 2ZH9A 2EI5A 1S7IA 1XQIA 2OPQB 3CCVT 4EI2A 1ZS6A 1KQKA 1MMDA 3HTRA 4PJOC 5LSRA 2MSTA 3GJQB 3R7BB 2XBPA 1X9MA 3G6EA 1Q86U 5LSOA 2CS7A 5D6YA 1YITA 1K9MC 3V6DB 5LJ5h 2AWZA 4ECQA 3JQMA 2LEAA 4KUIA 1LWEA 3VYHB 2P9EA 2IM0A 2BW2A 2IVWA 3B4MA 4E8UA 1JXLA 2BANB 2B4VA 3ISND 2R8KA 3OFEA 2AHJB 4P5NA 4CRIA 1PAEX 5KFPA 2X4WA 2VC8A 1SSFA 4KUDK 5HVGA 1RGVA 2JMCA 4IKFA 1PRMC 4HI1A 2KVQG 2RN8A 1WI7A 2RH3A 2IM3A 5K20B 3FDRA 2RAQA 3G9CA 3IP0A 1HMVB 2CT4A 3G96A 2HHHJ 4LVOP 3DLMA 3T1HJ 2R7VA 4DLGA 2EQUA 2QTVA 5GAMf 4M78G 4WCEQ 4PXCA 1CJTB 3FC3A 2PMWA 1EAYC 1T9UA 3IAM9 5D78A 1R8AA 3I55T 1N6QA 3QGIA 2CQHA 5GMEA 1KLNA 5BYSA 4MH8A 1NE8A 2F69A 3QAUA 4JZ4A 3VU3C 5KYNA 4E2FB 4RW7A 1YFNA 4GKKJ 3H9NA 4Y2MA 1UMJA 1UUEA 1SQFA 2A18A 3HHKA 1P27B 3LW5C 5HK0A 2V4JA 3MPWA 2VFSA 1YBYA 4ID5B 1KN6A 1FX2A 2W9CA 3CCEQ 1TL7A 3W7BA 1U0HA 4FNHA 1IWGA 5HQ8A 2PU9B 4NI2B 1S6QB 3FSIA 1PM3A 1JXOA 3M6XA 3V81A 5G0RA 3ZBDA 3GIJA 4NYPA 4LSZB 3QQCD 4OMMA 3OBWA 3N6MA 4CO5A 3PW5A 3RRKA 3L2QA 1AXQA 4HR2A 5CYMB 3ZTRA 1NLOC 1AVZC 3RB6A 1VFJA 2IA6A 2HEKA 2OEJA 3IBWA 2YVSA 1TL1A 2E3HA 2J9DE 3KJFB 5M2UA 2PVOB 5GMKj 1FWPA 3MOJB 4RMOA 4MYUA 3W5YA 2RHIA 3PRDA 3OYAA 4YP3A 1NDKA 2E5JA 4GC7A 3VGSA 1FXDA 1I4K1 1RT3A 1PJ7A 2A2DA 4UQGA 2EKHA 2O88A 1F5CA 2OTLA 4F4AA 5KG5A 1N0UA 4F0MA 4O3SA 3FIFA 2YPZA 2ZBQA 2BM0A 1IZ6A 1KQ1A 3S6EA 4OMQA 2BM1A 4DV1J 1S1WA 3IN5A 3QWUA 1XEZA 1WEYA 1HBNA 4H54A 1FI4A 2EPDA 2AYGA 3OYFA 2MQNA 4B3OB 1TMJA 2V50A 4F7VA 1Y0MA 3R5JB 4GKKF 1OX9A 2HFUA 1Q82C 3MM6A 5CZVA 1C1CA 3HVTA 1Q5YA 2M3DA 3HHDA 2QEXT 2VG5B 3FJ2A 2DL7A 5J2NA 2IBKA 2OELA 2KSSA 5KE2A 1KTQA 2HHVA 1VMBA 1Y4ZB 1IWAA 1OYXA 3HFKA 1VA7A 4JV5J 1KHVA 1GCQC 4RU2A 2JNJA 2RHUA 1S1TA 1LK7A 3C12A 3CTRA 1FE4A 1W7WA 2QE5A 1YJWQ 4PEOA 3EXCX 2F1FA 5GANe 2R8GA 3RJMB 4RTWA 1D9DA 2KRBA 3RERA 5DG9A 2FY1A 1RSCA 1Q81C 1YJWS 3UQSA 4M7DB 3BN7A 4A8KA 2Q79A 2RUSA 4I68A 2EVZA 2J6OA 3RUXA 2LXFA 1FWZA 3U7JA 5KT7A 4OVAA 3TOQA 4DV0J 1TXQA 4A8QA 1M1KC 2XQCA 1IKVA 3VAHA 2D3OR 2ZPEB 4LMZA 3EZOA 1U48A 1RWVB 3RBEA 4VUBA 2MTLA 2OH2A 1HWIA 3LH2S 4IR1A 2XGQA 5EWGA 4KY3A 2ACYA 2KT3A 3R6LB 4LQ3A 3BGRA 2W10A 3HFVA 4PXBA 1BWEA 3GQCA 1U2RA 2H54B 4O44A 3AOBA 4CIOA 3ULRB 2RH2A 2ZBRA 2HBPA 4DV1F 5HJXA 1WTBA 5EDWA 3M7VA 1S59A 2XHWA 1MNDA 5K8MA 5JVGQ 1DBDA 1SXLA 3R6OA 2C2MB 4K59A 1JLFB 1R0AA 1X9WA 5GAOr 2VPZB 3UR3C 3MEUA 4ZN3A 2EW9A 4RW9B 3EZ5A 1D1UA 2HIQA 4DPTA 4X62J 5CAIA 4N47A 4KKOB 1VISA 5I2MA 5FDLB 2VFUA 2KXDA 2CQDA 4OL8A 1R0BG 1NDPA 3PIPQ 2F2XA 2AJ0A 3C16A 2MLZA 2YH1A 4ZVSB 2XWXA 3UA6A 5IQQA 4X4NA 4AD6A 3OYYA 4IRDA 1NU4A 1ZUUA 2KNBB 4PJLA 3IO1A 4IQMA 3JSRA 1UG1A 3BBCA 2VXFA 3A8HB 2DXUA 2VG7A 1Z2LA 3I32A 3OFGA 4CLWA 1YJNQ 2Q6BA 3NOGA 1TR0A 1VQNT 2PI5A 3GYXB 3PR5B 2KJWA 2KRMA 3WQPA 1M0SA 4CLKA 2Q66A 1OYEA 1LW2A 1EJ7L 1BI0A 2EYXA 4IIMA 2D3O1 4FXDA 1JXVA 2XEXA 3SDZA 2V1RA 2P4RA 2CNKB 4P6QA 1HBMA 3SIPB 4YB5A 3DLHA 2L48A 1KOHA 2GNCA 2RSQA 3RMSA 3NCPA 1DURA 1Q8LA 5EN1A 4YDDB 4Z2XA 4A8MP 2KT8A 1M5Q1 3KG0A 3FFIA 2DRAA 3OTCA 2A6MA 1YWXA 2HHSA 3H2LA 1QE1B 4GLMA 4ILMA 1S9GA 3UFCX 1F9FA 1UVNA 1VCTA 3QLHB 4BI8B 5CIUA 2AD9A 4HACB 1FO1A 3DU5A 1UJ4A 4DG1A 1AWXA 4LIWA 2UU9J 3DRPB 5EX3A 1HBOA 3UO0A 3SFGA 4ED7A 3KK2A 4ZIWA 1KP6A 2CPFA 4ZVFA 2G6FX 3LGNA 1A9NB 4NLVA 2D1XA 5BYQA 4X62F 2E5LJ 2E7WA 3U23A 3M2RB 5CHCB 2BUNA 4OLOA 2DTIA 1NYFA 5I3PA 4A53A 1AZSB 3LP0B 2JNGA 5KFFA 4A47A 2QFJA 2BJEA 4IUPA 4C3LA 3EZUA 3B78A 1G83A 1JU5C 5A0DA 3G8QA 4EMKC 4FW2A 1HPZA 2DIGA 2RHZA 3MEGA 3TAMA 4Q44A 4LF9F 4ZGJB 2DL4A 1NK7A 3Q24A 4G65A 4E7ZA 2KXHA 4KO0A 4K4ZA 5KYXA 3VALA 1O9SA 2AZSA 2QSFA 4HH0A 2R2UA 3CMES 1GRIA 5F8NA 1NKEA 4J7FA 4KC5A 1X4HA 2XMMA 5GMKi 1WOSA 3CDAA 4DFPA 1NK8A 3LPYA 4OB2B 1LWXA 4OHVA 4U8YA 2E9ZA 3M2VB 2GIQA 5HAOA 5L38A 3GFZA 1RI9A 3AHUA 1GK8A 4IH5A 2EFNA 2G2OA 2DPIA 1KQSP 4WK1A 1TOVA 1HNWF 1HI8A 3AJ2A 3RDVA 2DKGA 2Y0BB 2DD4A 3HSGA 4R0EA 1CG2A 4RW4B 3TWZA 4YB7A 4PPZA 1ZLMA 4C8QD 3NG8A 1URRA 2COZA 4UOHA 2RQUA 2FLNA 3QT6A 2PFFB 1OZ2A 3DB3A 2KB2A 4QZVB 1NO8A 2VC1A 1I6JA 1YJWA 4PXDA 4B9LA 1B7YB 3FNNA 5D0GA 5M2RA 2M8HA 5KFQA 4C0BA 2K3KA 3R7SB 4L6V5 1VQKQ 1QVGP 3VGUA 2DRKA 1ZM4A 2E5LF 1FHTA 1FFGB 4U7CA 2DH7A 2FC8A 2FYKA 3VRZA 2LQ8A 3L2UA 4TNOA 1VQKS 4JZ3A 3EFOA 2PVDB 2L3RA 4LF8J 3RG6A 1Y71A 2NXNA 1VYTA 2K5LA 3MECA 4TY8B 2RA2A 4NMXA 1KFDA 1FNMA 3W2VB 4ZVRB 1JLCB 2RQ4A 3T5LA 1KONA 3TZXA 3DRYA 3Q8UA 5THWA 4W90B 3JCMh 5IT9U 2KROA 3A8JA 1NEGA 5CKHA 1UJ6A 3GFXA 5C7PA 4KPCA 1PKUA 3QYYA 2YRVA 2FHKA 1RCOB 1E6HA 2RO0A 4J9OA 1EX4A 1X4FA 4MFBB 1WDDA 3EGWB 1JLQA 3CSKA 2ROTA 4IG3A 2E41A 3EXYA 4KHPJ 3UDLA 3MM9B 4F50A 1CC7A 1S72Q 2EGEA 2HLUA 5KYYA 2KXFA 2UVUA 1R7IA 3M2UA 4XTUA 3MTKA 1IRXA 2EEYA 2V8VA 1S72S 2E7XA 4FZVA 4DSIA 3NBPA 5ETNA 5GAHI 1W2BA 5L1LA 4X2BA 5GAMh 3CXCP 5IC4B 2ZH1A 2HMIB 4EBDA 3QUIA 3JTOA 3I0RB 4JI8F 4ED8A 1RDRA 1IKWB 3DHXA 3LTOA 3LX7A 1UGPB 2AJ1A 2H4YB 1HD1A 4DSJA 3MMCB 1R6YA 9RUBA 5LJ5e 1FJEB 4QQGA 2MZ1A 2NR0A 4P74A 1NH7A 3HSDA 5D6GA 5H9FJ 3CD5A 5L1KA 4DV4F 3G8SA 2QQSA 4OP0A 2OUGA 2NYIA 3FEZA 2Y3YA 1SUQA 4AQYJ 3AXKA 2CNNB 3DRXA 4LF8F 4WFNQ 5A8RA 1YJ9Q 1F1BB 4KYZA 1LWFB 3EHRA 3VJPA 4NS5A 1VQMQ 2VG6B 3M6WA 3J7Z5 4EO8A 2OD6A 2DZ9A 1YJ9S 1WG1A 1WSRA 3EGDB 5A8WB 2KY9A 1N52B 1VQMS 5LJ5g 3A5ZB 1U7LA 1HQEA 3SSQA 3C94A 2YNFA 3EPGA 1D9FA 2FZGB 3VS6A 4J9DA 1QKWA 1WC5A 3TW0A 4RUAA 3K5MA 3V4MA 4DSKA 3VQTA 1ZYQA 1TUCA 4UW2A 2O4XB 2L41A 4M75A 4DA4A 1CJKA 2QZ8A 1FKPB 1CJVA 3GWCA 3ZZ0A 1GXTA 4OGCA 5I21A 1QAIA 4PJOE 3T6JA 4C8QF 1K1QA 2G3RA 2RHQB 4LFBJ 1WD6A 2NXCA 2CZ4A 2GQCA 1B4SA 2M7SA 1X0PA 3OQ5A 1T3OA 4KGKA 3M6VA 2YRCA 1LFPA 5FWBA 3EG9B 3P3DA 3SWNA 3PFEA 1KJWA 2GCXA 3CD0A 2R7TA 4NA2A 5RUBA 1ZA2B 2B7CB 1WHHA 1DARA 3CF5Q 3JTNA 4DZDA 3CMEA 2HAXA 4F17A 2QYZA 1C4CA 1NJXA 1CULB 1HJDA 2YKQA 3DOKB 2DTHA 3EUNA 1LW0B 4NZ0A 1WIEA 3A8LB 1GFWB 2N4CA 2F5KA 2B9EA 2X51A 2F8HA 2MQLA 3QGPA 4Y91A 2MB0B 2HHTA 3MEAA 1MV0B 5KFOA 2RJFA 1VR6A 3TREA 3ZC4A 3D68A 4ZIVA 3GPLA 1N5SA 3PZPA 2LQ9A 1FESA 1HD3A 2FIUA 4X9DA 1R8BA 4Q0BB 3ER0A 2QTXA 2E7VA 4DFMA 2W8LA 1YBAA 3BSNA 3NCRA 2GJ2A 1YITT 2YKMB 5HATA 3ZTPA 4J6YA 3OYEA 2ZH7A 3KUEA 2PA3A 1KDNA 3KK3B 2ZKTA 1U6BA 2GMLA 3ME9A 1AZEA 3R5BA 3SDEA 3FBBA 2KQWA 2DBMA 4DLEA 4PAAA 3MM5A 1X60A 3GZ7A 2VQFJ 2F63A 2HL3A 4M5IA 4W92B 1GAOA 1L3SA 1VQKA 3UCZP 2JW4A 4J9IA 2ALZA 2C2NA 4LFBF 4PWDB 1J27A 1IBCB 5HSPA 5HL7Q 3LH5A 1YGYA 2DXDA 3THTA 5KFVA 2X3XD 2R7XA 1FKOB 3RKXA 2HHQA 2FY8A 3FCWA 3FSXA 2G13A 4II1A 5B0DA 2RF2A 2CZ6B 3V7RA 4XDDA 4ZITA 4HKQA 5CQXA 1FRHA 3CO9A 1W2BP 3TA2A 4G1PA 3BQ1A 3KDNA 1MSWD 2IRXA 2V8JA 2R2RA 3GV5B 4DQPA 4MK8A 1X5SA 4F04B 4NASA 1S1XA 3LGFA 4Q43A 3QNWB 5HMXA 1PO6A 4TKTA 3WBZA 2BV3A 2VDIA 2YX7A 4TQSA 3L2VA 3BW1A 2Z58B 1CVJA 4IDKB 3VGVA 4JI7J 1E6VA 2PMZD 5HLFB 3HLUA 4M78D 1RHJB 2M4MA 3ZEHA 1FNOA 1G2BA 5L39A 2YQ1A 1N0VC 4CC7A 1S9FA 1KQSS 1JB0C 1UPPA 4NLDA 4UC4A 1RCXB 3VZHA 1HQUA 1TFWA 4ZVEA 1YQHA 4ZS6A 1KQFB 5IH2A 5D6XA 4PJNA 2XD0A 4QU7A 4YUDA 3HFZB 1M5OC 1ZTTA 4OLPA 2C3MA 3HHLA 1RLPC 3QRPA 2VQFF 2R7WA 1XOVA 2NXJA 4FW1A 2XO7A 2YKOA 2CG8A 3T5HA 4OI0A 4CC2A 2VBYA 1LKZA 5HN0A 4ED4A 1VQOS 1G3SA 3NP5A 3CC4S 3FC9A 4H4OA 2R42A 4MZMA 2YXYA 5EHHA 4YFUA 1ZBTA 3C46A 3NKYA 2CZ0B 5CCAA 2DCLA 2OP5A 2NLWA 3MAHA 4Z02A 3TJAA 4PL6A 1GL5A 3FZBA 2FVPA 1MWZA 4EDUA 4QQDA 4DPXA 2MQQA 1VQMA 4WBFA 1OSDA 1RA7A 2XYHB 1TH7A 2GAHC 5KYUA 3EHQA 5CYQA 1VQ8A 1EIFA 1U2FA 3PRBA 4E7HA 1LWEB 3SQOP 4NLUA 4OX7A 2RKIA 5IM0B 4DBFA 1HYSB 3D2WA 3GIMA 3WVDB 5E3AA 4JRIA 1VIOA 1PRLC 1VRQC 1HA1A 3CJRA 5LSLA 1WXUA 1TMMA 2V8HA 3OTOJ 4FXWA 1VQPQ 5HP1B 2F4VF 1UCNA 1N6QB 2JDJA 4F26A 4JI7F 4J83A 1VQPS 4WTYA 3EGZA 1YP5A 2W2OP 4RZRA 1SRLA 3LP1A 1K8AT 4QR2A 3NLCA 3W63A 5FROA 3PW0A 5J1NA 2AK5A 2RNAA 3NMAA 4XDCA 1UP1A 1G3YA 2D0QB 4N5SA 8ATCB 1OY6A 2H1YA 1RTDB 1B0TA 4M7DC 5F8GA 3JB9H 5IT9Y 2V4JB 4PFOA 3PHEA 2DY9A 3TA0A 5DGAA 5HQLA 3W65A 1NNDA 3MR6A 1RT6A 2IA0A 1ZH5A 5LJ5j 2DXEA 3M9QA 3TQ1A 1YVFA 4P2MA 2YRDA 5G0RB 5KFGA 3QFWA 4AFFA 2JEFA 3F44A 4IFVA 3QIDA 2VZ9A 5DQIA 2PI4A 2FHOB 2ZUAA 4A8OA 2DO4A 1SI9A 5E0OA 2F3JA 1S76D 3EGXA 4O3RA 3OLAA 3KLHA 4NL5A 4B9UA 1W4SA 3HVWA 2J9DA 5IS2A 2OPSA 3PEJA 3V4IB 2KHDA 4C6AA 4A8SA 5BXIA 4N4HA 1VQ6A 1S57A 5CD4A 3KKFA 4J9SA 1G4CA 4LFCJ 3AD8C 5ETSA 4GRSA 2XMFA 2MLYA 1NAQA 3C6TA 1JIHA 1JNRB 2QG9B 2GAGC 4OB0B 3SBMA 1KC8T 2DHHA 3MDFA 1RT3B 1WDTA 1U1SA 5ETTA 5IHNA 1KHIA 1JWWA 1X6OA 4USTA 4PJJA 5CD4H 3CC7S 2HFSA 2HVZA 1RP5A 3OTOF 3FMWA 1X01A 3HO1A 1XC9A 4IQXA 2O9SA 2KL8A 3D6FB 4XU1A 4WF9Q 5EWEA 1AEYA 1PYSB 2CPEA 4M78F 3G82B 1R77A 5IT9E 1HBNB 2DK2A 2V4RA 2HHPA 4C8MA 4M7AA 5DQGA 2PTKA 3SB2A 1NZ9A 3EMTA 3MM6B 4X65J 2R2SA 1C1CB 3N4WA 4ETXA 3H0PA 5T14A 2CPHA 4EPCA 2DPPB 1O6XA 5J2NB 2VKNA 5IHKA 3G86A 3OL7A 1HHQA 3PX6A 4J6WA 5BR8J 4ICLA 4IO9Q 1S48A 3H4DA 4CC4B 5ETPA 2EAYA 4ZK7M 1WC1A 4LDUA 4USUA 2ENMA 3WC0A 2FO0A 3CCET 2MK5A 1IQZA 4LFAJ 1YTYA 2JWNA 4JI2F 1S0NA 3JCMe 4HHUA 1YCSB 2OPRB 2QQAA 1XWLA 1UJ0A 3FBFA 1EX8A 4WJBA 4Q7AA 2KG1A 3D1HA 2ZWOA 3K2YA 3I5BA 1IO6A 2KYMA 4ZVOB 5LJ3j 4RUGA 4LFCF 2JZ5A 5I3UB 1V29B 1C6VX 2H4WB 1NCLA 1IKVB 3IR5B 4F4WA 1H98A 1ULRA 5CVIA 3LGMA 2VHGA 1M3CA 4B9SA 2EQMA 4DBQA 3B4DA 2AP6A 1M90T 1U24A 3W3SA 3HMJG 1RWUA 1S79A 2K6DA 3BR8A 3OTEA 2ZOGA 4M75D 1M90C 3I5RA 4ZJOA 3K5OA 2HNYA 1QVGR 3JCMg 2WSFC 2I0XA 4LF7J 4RW6B 4XTYA 4O44B 5GAMe 1VQOA 2RQRA 1DTQA 3CC4A 1WHGA 2EFVA 2ZJRQ 2EJFA 3ENAA 5KFCA 2OO4A 1OO0B 2IC3A 1WG4A 3L7OA 1YJTA 5KE3A 4CM0A 2HIYA 4DX6A 3MFHA 1ZQ1A 3TAPA 1VS3A 2MGZB 1YBTA 4OZJA 4FCYA 2FD2A 4X65F 2CP6A 3JSMA 1RTHA 4LD6A 1TL3A 5LMUJ 1B70B 2L3QA 5K14A 4L3NA 4DL2A 1KC8R <