2OAUA

Mechanosensitive channel of small conductance (mscs)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
YAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2oauA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oauA03
3LGMA 2HFOA 2GCFA 2XMWA 3BF4A 3BN7A 2RH2A 2GO8A 4NL5A 2HLTA 3K7RA 2N7YA 4DPOA 1JK9B 2W4PA 2IFXA 2RU9A 3VTIA 5B0BA 2ROGA 1QUPA 1RJJA 3IWXA 2BYCA 2K1RB 2N4DA 1AW0A 1YRXA 2HFNA 4YDXA 5A6PA 2XMJA 5K9FA 5KAKA 1OPZA 2XMTA 2XMVA 4Y2MA 3KG1A 2PGCA 2GFFA 2XMKA 2G9OA 3MCSA 4Q2MA 1CC7A 3HHLA 4FNIA 1X0PA 1VQYA 3FRYA 2HLUA 3HHLC 1TZ0A 1AFJA 3GZ7A 2OMOA 3SFMA 1YJUA 1MWYA 1N5TA 2W4CA 2XMUA 1VQSA 3FMBA 1R6YA 2ACYA 1P8GA 2ROEA 2VH7A 2XMMA 3QMQA 2OP5A 4YEAA 2OFGX 4EFAC 2CRLA 5F0WA 3DCAA 1IUJA 2LXFA 5T7LA 2ZDPA 2AJ0A 1KQKA 2OD6A 3CJKB 1P6TA 2AP6A 1Q8LA 3TNVA 1OSDA 4QOTA 1CPZA 2OAUA 5B0CA 2P4TA 2EW9A 2RSQA 2KT2A 4ZA1A 2GGPA 1FE4A 2GA7A 3DXSX 1OQ3A 5B0EA 1FD8A 2ASYA 2Q3PA 2RMLA 4A48A 1KVIA 1YG0A 1K0VA 2QYCA 2JDJA 3BB5A 3BGUA 4HI2A 1FVQA 5B0GA 2AJ1A 2VV5A 3HX9A 2ZDOA 2LQ9A 1TUVA 1SB6A 3BR8A 2HQIA 2KYZA 2OFHX 3HF5A 3HHLB 2KT3A 4A4JA 4HH1A 4DN9A 1YJVA 2K2PA 3T9NA 4A46A 1S6OA 1N5VA 2FIUA 1X7VA 5A6WA 1VIFA 4Y2IA 2BBEA 3F44A 3HDSA 3I9ZA 2BJEA 1TL4A 3TOQA 3BDEA 1TR0A 3BM7A 3TRGA 1W2IA 2QLXA 1LQ9A 3HFKA 3WDOA 4HL9A 5B08A 5IXUA 4DL0C 5B0FA 1VIEA 4Q2LA 1TL5A 1URRA 2K7JA 2PD1A 4HH0A 4OJGA 1FE0A 1JWWA 1MWZA 1GXUA 3KNGA 1Y0HA 2OKQA 2ROPA 2HIQA 1WD6A 4OIXA 1CC8A 4OJHA 3IWLA 2K7KA 3LGNA 1Y3JA 2W4DA 2RK2A 2RK1A 1V3ZA 4A47A 2K1RA 3KKFA 5F0UA 2N4CA 1Q4RA 2FHMA 1OQ6A 2GV1A 2LQBA 2L3MA 2IYGA 2OD4A 2QLWA 4NPOA 1Y3KA 1N5QA 4OJ1A 5B0DA 2KKHA 4FNHA 5B0AA 1Q53A 3QGPA 5T7LB 4Y2KA 3UDCA 4F67A 2FB0A 1Y9OA 1FEEA 1AFIA 2GQVA 1ULRA 3LO3A 3E8OA 4HI1A 3HHLD 1YJTA 2AW0A 1Q8BA 2RILA 3FGVA 3KG0A 1APSA 1FVSA 2FTRA 2IYIA 2GGPB 1S6UA 2LDIA 5B09A 1FESA 1GXTA 1SI9A 1SQEA 2BJDA 1X8DA 1XBWA 3MZIA 3CJKA 4ZOSA 2QIFA 1N5SA 1KVJA 4OJ3A 4U9RA 2BUNA 1U7LA 1YJRA
chains in the Genus database with same CATH superfamily
1JLAA 1F3VA 4MZMA 2I0NA 4ZP7A 1AWXA 1GXIE 2A3JA 5GADI 5KE2A 1S72T 1VQ6S 1JLEA 1LV5A 4ED4A 1UPMB 4GKJJ 1VQNS 2PEHA 2YPYA 1UVKA 2DJZA 3RMQA 4K59A 2BV3A 2HZVA 3T6JA 3GV5B 4ZCIA 1RLQC 2B7CB 4KPCA 1N33F 2OTJS 1H7WA 5C25A 2Q3PA 1HL6A 3EGNA 3ME9A 4P52A 3TU4K 1FDNA 3CJ2A 5AE2A 2DBBA 4M77D 2HYIB 1KVKA 2IM3A 4DU7A 3AA9A 2OEKA 1QM9A 4DR5J 4NEZA 4DZ6A 1AXQA 4LRBA 1XMOJ 2W2NP 3I9ZA 4D8KA 1A6LA 1VYTA 4Y2AA 1XC9A 4Y2CA 3QSIA 1U1QA 2M7SA 2QLFB 3BE3A 3N79A 2J6SA 4HKQA 2GMHA 4DU8A 3CCZA 1WOSA 3MURP 4ED7A 3CMES 3CPWR 2KM8B 3W9JA 3GFYA 5AXNA 2RK1A 2UUWA 2E4HA 5KFPA 4OMOA 2DYIA 2Z4PA 4EBDA 1RTDB 3NTKA 2KKHA 2QMXA 3HLUA 5GAN8 1VQLT 1OYXA 1S9FA 3MD1A 3QT6A 2FJVA 3MWBA 3EMTA 2H3JA 4V2SA 4OLOA 1G2BA 4U8VA 3BSAA 1U7LA 2CP7A 2IM1A 3LGMA 2F8HA 3H0IA 1MGQA 1W2BS 3DB4A 1PJ6A 2MAMA 1VJWA 1YBYA 1SC6A 4YDXA 3UT1A 3FLGA 4FCYA 4JRKA 5LSOA 3H2UB 1C4CA 3ULHA 1IJFB 4M94A 1X0PA 3DRRB 4EMDA 1H98A 1YDLA 2GVZB 2CA9A 1SL2A 1KC8T 2OP5A 4IFVA 2DHHA 3SV3A 4CLPA 5F8NA 1UW9A 1ZPWX 3J7ZT 5LJ3e 5CCLA 5GMKh 4YB5A 1X4AA 4YB1P 1B99A 3OVSA 1WI7A 3HKZD 4M77A 2VBZA 3VGVA 2R8KA 2ZDOA 3KK1B 2LQ9A 2KYZA 5KTQA 3HHLB 2HHTA 4DV5J 1C1BA 2FLNA 1M90C 2R2SA 3A8KA 3PR5B 3CD0A 3BN4A 4KQZA 3ZO7A 4J83A 4NYOA 2CZ4A 2V2QA 2GJFA 2OKQA 4PABA 4LF5J 2GNKA 4TYBA 3AD7C 1JLBA 1H92A 2DEQA 1VQOQ 3BGFA 1O51A 3I32A 3PEHA 4M4ZA 1X2KA 4C7QA 2MWOA 4RU2A 2O2OA 1TXQA 5JXSA 1V29B 4JRIA 3JCMd 1Q86T 2KHCA 4N0AC 4G1IA 3MM7B 4LF4J 1GNKA 2M52A 2JOYA 3W2WB 2XMAA 4ECTA 4FW2A 2CQ4A 5ETRA 1CLFA 1H2VZ 4F0KA 3PW2A 5K8OA 3NGUA 4BI8B 3JCMQ 5LJ3g 3G87A 5IH2A 2RUGA 2PU9B 2POKA 2XB2D 1UA0A 1KQSA 2VQFF 3T1AA 3TNVA 2OAUA 4DXLA 4DF8A 4JI4F 3RERA 3JCMW 1S5ZA 1WDDA 3FSIA 4LRCA 1JJ2R 1LK5A 4B9UA 5I3UA 3CPWS 4PWWA 1UMJA 5A0YB 3B82A 2KVQE 2B4UA 1T05A 1VOMA 4CO0A 3KLIA 1M3BA 4M78E 2KFNA 2DRAA 3RJMB 4DL2A 1KP6A 2QA4S 1ZHIA 2HBPA 5FRMA 2WACA 2V1QA 2QTXA 1S97A 2DNZA 3DDIA 2PIIA 4EMKA 4C0FA 4W90B 2ZBCA 3JCMb 4LD9K 1K0SA 1VQ9Q 3VGTA 5CYJA 3PTWA 3PY8A 4UOFA 4KULA 5GAOm 1NEGA 3RMSA 1W25A 5KFTA 4PJOB 3TAPA 2LA6A 4K4ZA 2Y1LB 2ZPHB 2NLWA 3QHSA 1OY8A 5HVFA 4M7DB 4NLWA 1UWAA 1U8RA 1FRMA 1KR4A 2LYVA 5A2QY 3BQ2A 1HARA 4AG2C 3POTA 1HBNB 1RT7A 1NHVA 4NEYA 4FKYA 2HLTA 3HRSA 3W1YC 3FJPA 4CLZA 2F3JA 4F0MA 4LVNP 3QLHB 1H641 4RW6B 1T0JA 4FVCA 1TZ0A 4F36A 2KFZA 1HJDA 2H4WB 3GFXA 3EGDA 4NOYA 4OYAA 2ZBPA 3DCAA 2AV5A 2F8MA 4I2QA 4YR3A 5GAEI 2OX7A 1KQSP 1KWMA 3Q23A 4MFBA 4IRDA 4LF2A 2E9TA 1HHTP 1NZ8A 2X1FA 3CCSA 4RTXA 3V7RA 1LWFA 5KG4A 4XTYA 3HJVA 4RW4B 4F2SA 3HL8A 1W7WA 1I8FA 4KFBA 1HWJA 5HBMB 2EWHA 3FVYA 4DBRA 1SSHA 1NPRA 3F73A 9ATCB 2XULA 2HAIA 3CVKA 1TH7A 2PD1A 1Q16B 2BOAA 2H4YB 2FL7A 5KYNA 2V4JB 1X9MA 4CM2A 3J7YU 4DQ2A 1T9YA 4NZ0A 4DR3F 2BACA 2QN6B 5DDOC 2J7UA 3WC0A 2X1BA 2WCXA 4CM0A 1VQNT 2V63A 3MPYA 2X9HA 4C0DB 2HBRB 2BE2B 2YH0A 5EWFA 2VOOA 5LJ5Y 2QL7B 3REAB 1V9OA 4WE1B 3RNJA 3N5BB 1JJ2S 2H1YA 4LFBJ 1PSDA 3H59A 4DG1B 3LWMA 2CQDA 2OUGA 3IRWP 2JLEA 1VQ4T 1NYFA 1KKHA 2X7IA 3DGPB 1A7GE 2CNOB 2MLZA 4ZGEB 4QIGA 2YLBA 2VPYB 2XDDA 2PA3A 3MM9A 2OI2A 3DXSX 2H65B 4PKDB 2V8KA 5FWCA 3O5ZA 3M2UA 5B0GA 4XU3A 3CO0P 4E2FB 5EUHA 2QA1A 1TUVA 2KZZA 4XAXB 2MEWA 1VQ5A 4F7UG 2PSZA 1X4GA 5H9EJ 4LREA 1FRJA 5H9FK 1PYTA 1WC1A 4FVMA 2MQ8A 4AXIA 4LDYA 1BY9A 1PM3A 1YJNT 4OHWA 4Q2LA 4U95A 1QE1B 3SQGA 1R0AA 2XNRA 3L1AA 2DXFA 3OYGA 3OTOJ 1KD1T 2IIMA 4UY8T 1M5Q1 1WJ9A 4B3SF 4JJDA 1N48A 3PNIA 1VQPS 5DZ6A 4DQPA 1MWQA 2LJ1A 4P74A 4MKBA 5ETOA 1S6PA 1JEGA 4FF1A 3ZZPA 4EWTA 2W7OA 3RW6A 1I07A 1MHNA 5HVHA 5LSLA 4OMPA 3L9ZA 2MQPA 2HMIB 5FROA 1CKBA 4XQ3A 2YPZA 1HBMB 2JVRA 3PMIA 2F2XA 1U25A 2QEXQ 4ED1A 1SH3A 3PW0A 1S0MA 4FYVB 1D1UA 3H5YA 1EQMA 2WTFA 4AQYJ 3BO4A 2XYHB 2ZE2A 2MHEA 2XO7A 2WSCE 2XYPB 3SSQA 1K0VA 3U1MA 4Y3CA 3S01A 2DJQA 3I5BA 5GAOq 2EGEA 1FRXA 1JO8A 4OZ3A 3F41A 2EPIA 1BB9A 1SF9A 1IWAA 3V6DB 4NLYA 3IO1A 4Y2IA 2C0OA 2A28A 5J39A 2OTLQ 5B08A 1WC4A 4A8YA 4DI6A 5FWBA 5LXYA 4F4KA 1SJ1A 3UA7A 1FFSB 2ATLA 4EUVA 4E7KA 3QZ9B 1CC8A 3D68A 2ZD1A 2HGLA 1RLCL 5KFVA 1HPZA 1OQ6A 1Q82R 4J9IA 3LA0A 3JTOA 3CUNA 4O6JA 4ES2A 1Y5LB 3R5BA 4U9RA 4C8LA 4C92B 5L38A 5AJ3F 4CI0C 1K73U 3DYAA 1QSYA 1YITQ 2F1FA 2HFNA 3IBWA 4MTPA 2AYMA 4A4KA 2IBKA 2W0ZA 2EYYA 3HHTB 1SC3B 4ZP6A 3DU5A 3HHDA 3C15B 1R6YA 1NM7A 4HACA 2KRRA 4B9NA 3RB3A 2KYXA 1OOTA 3RBXA 2DT9A 1UWBA 3MEEB 4JRPA 4PLIA 4M75A 4ZIVA 3D67A 5KFSA 1XWLA 1S7HA 3UCGA 4Y91A 3NLCA 4IG3B 1Q7YT 3MR7A 2KDSA 4XDDA 2L5QA 1NU4A 4G1PA 1FXLA 2EKOA 2PFFB 1JJ4A 5T14A 3RG6A 1ZLMA 2CSQA 4Y00A 3RDVA 1RWMB 4ATOA 1TTHB 5IV4A 2ZH8A 3VRYA 4EBCA 4AYBD 2DM1A 1MNDA 2CJAA 3PVXA 4OJHA 4M95A 5BR8F 3AXMA 5HANA 4UOHA 2E1PA 2R7OA 4A53A 4OJ1A 2GAGC 4PXDA 2EC0A 1PYSB 1IXDA 4ZPBA 2R7UA 1PC0A 3OPKA 5F8JA 2DD5A 3PEJA 2RRAA 2ZOMA 1VI7A 2O67A 4BS2A 4MAKA 4C8QA 3W5XA 3TUZC 4PG7A 1FJ7A 2L08A 4C11B 4NYZA 4J9HA 2NUTB 2YNGA 4K2XA 4EU0A 2CYZB 5KYXB 4CLSA 4WFBQ 2R5MA 1LWEB 4J9FA 2QX0A 3D6FB 3CF5Q 3A8HB 2C06A 3CC7Q 4EFAC 5F0WA 3FC9A 2R9LA 3ZZOA 3EXCX 3ZXWA 2DH7A 1CG2A 2B43A 3TEHB 1S0NA 2L41A 1T3LA 2N3LA 4OI2A 1SH0A 1S6OA 3SDZA 4KKOB 2DO0A 4IQMA 2ZKUA 4DSFA 1S9GB 1I94F 4U7UD 4G1QB 5KT6A 4DPUA 2K3YA 4PXEA 1D9FA 1GCQA 3QJYA 1VIXA 1EQ0A 5CK9A 3VS6A 4CRIA 3I5AA 2LLZA 3SEMA 4EGLA 4PJOG 1ELOA 1NZAA 3I0SB 1TKZA 4OX9J 5FLXU 3UR3C 3HP6A 3VVTA 3K2YA 1XNQJ 3HHLD 1KFZA 4OI1A 4M7DG 3MMBB 1M5SA 3ENWA 5CQGA 1V6HA 4NLSA 1K9MC 1M3CA 5KFXA 3J7AF 2XU8A 4NXNJ 2GIRA 2BYCA 4M78C 3ENQA 1J3TA 1PAEX 1OPZA 1HD1A 4Q45A 3CCSS 3TQ7P 2RT3A 4LUBA 4QWEA 4DSLA 1RTDA 5HY6A 4DFPA 1PKSA 2RH3A 4GMKA 4WF2A 1FXDA 3TUPA 2KXCA 4QVZA 4DV4F 1D8ZA 3CCJT 2FEIA 2OPSB 2BRLA 1UGVA 5G0RA 3Q2TC 1ZA2B 4KJIA 5GAMh 5EX3A 2MZQA 3L2RA 1GT8A 2V50A 3I4HX 4KB7A 1T3SA 5A2QE 3R6NA 2K57A 2GVZA 3QIPA 4F7UE 3OUYB 3UCUP 4OJGA 1TMJA 2KGTA 1BE4A 4M77C 3V6HA 5KFEA 5IS2A 1PC5A 3KFVA 1TVRB 4JPBW 2HHUA 3I56S 3Q8UA 4DOVA 3CCMA 3K5LA 2NYSA 4LN2A 1S72Q 4IOAQ 2KXNB 3KLGB 4FF2A 2UUCF 3GLXA 2OI3A 4IQXA 2LKZA 1NKEA 4LE9A 4Y65A 4ZVQB 3NHNA 4X4RA 3BPSP 3GQCA 4DSKA 3QDFA 1X4CA 2HKNA 1VBYA 4H4OB 4B9TA 2YWKA 5GAOr 3IR6B 4ZJOA 1RTHA 3QNWB 1O6XA 1VC6A 2UUTA 6FD1A 1Y96B 2VQEF 2XHWA 1NSQA 4ZCMA 3EG2A 3P3DA 1C2PA 4HDHA 4OZ1A 2W4CA 3G6YA 1P9YA 4F0HA 1S49A 2MMYA 2G2ZA 3M0QA 4PJOD 1TKDA 1P6TA 2D41A 2YKNB 1NPPA 1RUWA 2MZ1A 3MM7A 4M7DD 1NDCA 5IM0B 2YWEA 4K5SA 1KQGB 3W2WA 4B3MF 1HWUA 2SXLA 1M4ZA 4JYAF 1VK3A 3OXLA 4OB2B 3DLBA 1IREB 1VQLQ 4QW9A 1WHYA 1YGYA 1K9MU 1TL5A 4A4EA 3PDNA 3DKDA 5GAN3 2J0WA 4LDXA 3M7VA 2KFYA 1D0XA 2K7KA 2CP6A 1ZSZC 5L1JA 2RJFA 4C3KA 3JYTB 2GO9A 2FLOA 1TMMA 4M7AF 1B70B 3NWGA 5A0YA 4RUAA 3RBZA 5KFUA 3VJPA 2LDIA 3K5OA 1JLFA 1QVGP 3W60A 3BQ0A 4QYRA 3C16B 2HHHJ 2VIHA 3W3SA 3JCMc 4ED0A 4MJKA 5DRKA 4Y28E 3S8SA 3UATA 1LXNA 2GFFA 1LWXA 1CC7A 2VU5A 1R8AA 3C95A 2DRMA 1T9XA 2A2CA 3CDWA 1FJGJ 2APOA 3T9ZA 3SDEB 2K3KA 3GNGA 4X65F 1IUJA 3H0PA 4J7IA 2C42A 4P75A 3HHNB 3NPFA 5KFAA 1DLOA 1KG1A 1QQJA 2AWZA 2M70A 2YNFA 3M8SA 3EFRA 3TREA 2JMCA 2AD9A 1IBKJ 4DR2F 1NSAA 2XLKA 5GAHI 1JBMA 4N47A 2ED0A 2FPHX 2LVWA 2GJ2A 2DNHA 1MMNA 3QLHA 4RW6A 5KT4A 2CQGA 2W24A 4I69A 3MPWA 4ZVHA 2HEQA 4N4HA 2V8GA 2ZZMA 3H6ZA 2E6ZA 2HZCA 1Y0HA 5C0MA 4WCIA 2FC8A 1HHQA 3OV7A 1I4K1 4OYIA 2CREA 5L9XA 1CJKB 3KTQA 2GMLA 2O66A 3P5TL 3M8YA 1HNWJ 2Y1RI 4RW4A 1RBAA 3VYGA 3AT1B 2HKEA 2XG8D 5HBMA 3Q86A 4N56A 5GAMf 1KK7A 4C92G 4DL3A 1IKYA 1UZDA 1IR2A 4DL5A 1RLPC 3K8WA 1TKTA 2J0XA 2GJIA 3U02A 1JLCB 2NSCA 1VBZA 4O3PA 1NJXA 1R6VA 2F5GA 1RT5A 4ED3A 1WPYA 1HBOB 3RUBL 1VQYA 2V4JA 2WHOA 4J9UE 3A1PA 1H7XA 4LR8A 1UGPB 2CPEA 3IGNA 2AKWB 2FB7A 2JVVA 1J5EF 2CGHA 1VBXA 4B3TF 3JCMe 1SJFA 1Q82T 1RAGB 4NL2A 1U1OA 3CMAT 2KROA 4L72B 1FVQA 4ZVEA 2DR9A 4PQAA 4WE1A 3UR0A 3DKMA 2DHSA 1HYSB 1U02A 3PJ9A 3N5BA 4EK2A 1RWWB 2GZOA 3HVRA 4KHPF 4IURA 1GMUA 1WTFA 3N01A 5L39A 4X64J 2BX6A 4JV5J 3DGPA 1U1RA 2ZH7A 4ETZA 4F4WA 5B7WA 4ICLB 1N88A 3LPEA 4DV1J 1S7IA 1X60A 3H5XA 1XNRJ 5FIIA 2KZMA 1V3RA 4C5HA 2EYWA 4JI3J 3HFVA 3PIOQ 1FJCA 1U2RA 4KIAA 2UXCJ 3CEYA 3G86A 2B5JB 1QVFS 3HZGA 4GRSA 1Q8BA 4MK8A 2V8DA 3M56A 4EMHA 2ZOFA 1TELA 4EYIB 4X62J 5DG7A 4EBEA 4PJOE 3DU6A 1LW0B 3G4SS 4PFPA 1VQKA 3JAMU 4M5GA 4M7DE 1QE1A 1KFDA 4CT9A 2GQ2A 2J7KA 4ELZC 2K9GA 4J7CA 4QWBA 3TAMA 3JCMg 5H1SV 5GAN7 4ZDNA 1RAEB 2WB4A 3WXMB 4YOEA 2COWA 4WP3A 2RDDA 2KT8A 2ZPIB 2AHOB 3ETMA 4LJMA 3TVZA 3OA6A 3R7BB 4NYPA 2RB7A 1WHVA 1X6OA 5I3PA 1U4BA 4C92D 4CLUA 2ADCA 4RWWA 2ZPGB 2DL7A 2EJ9A 4F16A 1P27B 2XMFA 2O9SA 5A6WA 3AQOA 1S9EB 1LXJA 2GAHC 4X4PA 1HBMA 2IDLA 4ETXA 4P6QA 5B0FA 1S1NA 1VQNQ 1TG0A 3GG1A 5AE1A 4OYWA 4C8MA 1HQUA 4WTOB 2HQCA 2VG5B 2NLUA 3TEEA 3IR5B 2HNZB 1MG7A 1VRTB 3L2WA 3CCRS 3OMGA 1VQ4Q 1M0SA 2P84A 3GIRA 2V9WA 1C0TB 1DTQB 2DNLA 2PN6A 4JI6F 2HSEB 1SQEA 1NK6A 3KBGA 4BWMA 2MJNA 4ITSA 3QRRA 4ZMMA 1FWZA 3NCRA 2N7YA 2K3XA 2LXIA 2PC6A 3CCVT 1VBKA 3HSZA 4NXMF 3QJJA 2K1RB 4DEYA 5IC6B 5KAKA 1EX8A 3OL9A 3OR2A 1M5HA 3FRYA 2FJEB 3CMEQ 2B4VA 3LGLA 2MKCA 5E3QA 1BU1A 5HATA 5KG6A 2XNQA 2B56A 1RAHB 1YJNQ 3IQLA 2DGQA 4B02A 4KY3A 4IO1A 4DUYJ 2HRUA 5B0CA 3KJQB 2KQWA 3OT9A 3M53A 4LFAJ 2W2PP 5MLCV 3T1HJ 2D9TA 1CQMA 2C0TA 4ZKAA 3MR5A 4GLMA 1F9EB 3M2RA 3CCMS 4OZ5A 1K8AU 4K4XA 3N28A 1WEXA 1HI0P 4MKYA 3EG3A 2Q66A 3I5SA 1VC5A 1KN6A 4JI8J 3CCUA 3MEEA 5D77A 5EN1A 2F69A 4QIVA 4K11A 4YHHF 4LBHA 2CJKA 2VG6A 2C0IA 3M9QA 1WEYA 2HHXA 4FDFA 3KMSA 2D3O1 2QDLA 2X3DA 5C6SA 2IYIA 4Z7CA 1H38A 4RL1A 2RIJA 3MP6A 3PT9A 5JVGQ 3OFHA 1X9SA 1D3WA 2PT0A 1X31C 1IB8A 2XY6A 3W9HA 4K4VA 4XTZA 4PQUB 3CTRA 3T19A 2IFXA 5B0BA 1QUPA 3UQSA 1BUXA 1M1FA 2OH2A 4PRFA 2EYZA 5ADZA 1IHWA 2BTTA 4BY6C 2K6DA 1PYOB 1PWTA 4NLXA 1RWVB 3CMQA 1NDLA 4YY3F 1CS4A 4K4YA 1DQ8A 3FEXB 1K9MR 1LOUA 5E3RA 2JSXA 5ETKA 2DNPA 4C11A 4OZNA 2YSQA 1TUDA 2JFDA 3PXGa 4QWDA 1UVNA 2DITA 1FDDA 3CT9A 3R6GB 1LWEA 1DFDA 3I6PA 2WAQD 2DL4A 1LQ9A 4E7LA 4MKAA 4L5GA 1IM6A 1OO0B 4NLRA 2XK0A 1U09A 4DOZA 1TAUA 4K4TA 4HXJA 4ZPCA 2DIQA 3RBDA 2QEXA 4OMMA 4JI5J 1PIEA 1WDXA 3OYCA 4QJVA 3NG8A 2DX1A 1B0TA 1Y3KA 4K7QA 3R5AA 1KLNA 3H8ZA 1GBQA 1WUUA 4C0BA 2LJ3A 2KSSA 5RUBA 1HSQA 4E7IA 4CO5A 1D0EA 4ZP8A 1X5SA 3L42A 1S9GA 2DF6A 1AOJA 4GBQA 1N52B 1ZOTA 3OS2A 3PNWC 2E29A 3TYTA 2OTLA 4USIA 4C92E 1X0FA 1FK9B 2HLUA 3S1TA 3IAS9 1QMCA 4F50A 1L3KA 4X84A 3ET6A 4EZ9A 1TFWA 4FBTA 3I0SA 4JBCA 4ID5B 3F56A 2IPOB 7FD1A 5KFLA 1FX2A 2JN0A 4CYUB 3LW5E 5LJ3j 2KM8C 3RR7A 1O5JA 1HR0F 5JMNA 5CH7B 2YH1A 1B3TA 2ZUGA 3I35A 4A8MP 2OJ2A 3HDSA 1SL0A 1ITPA 4IDKA 3BV8A 5A8WB 3MMAB 3CC4T 1YITA 4RW7B 1GMWD 1T95A 3LGFA 1D3BB 1C1CA 3ZZTA 2YUOA 2J6OA 1M2OA 4KT0E 3W8GA 1LJOA 1NK5A 1QUVA 3M8QB 1XERA 1C4AA 2BKDN 2Y3YA 4J9BA 1XR6A 2MTLA 2RQRA 3VV2B 4LDUA 3CCQT 3NY0A 1W70A 3OHAA 3AB4B 4GC7A 4NCGA 4QW8A 3RAQA 3OS0A 4RNNA 3HHEA 1UHCA 1RI7A 3A98A 4E47A 1X6GA 3EGWB 2FHJD 5KOXA 1NB2A 2LCWA 4GVBB 3J80U 3D0GE 1LCKA 1OI1A 4WYLA 3OUYA 1VQOS 3SQOP 4P71A 2IVWA 1N27A 2V8IA 1FCAA 2KRMA 1UAWA 1NH7A 3RUXA 1TVRA 1AD5A 2V8PA 3HHLC 4L3NA 2CH4W 4WCEQ 1CSJA 1S99A 1M30A 5IT4A 1DTTB 1K73T 5J2MB 3RRGA 1OQ3A 3AAWB 3OYBA 4DUTA 3MEGB 3DM2B 5AXLA 4OI0A 2RA2A 2LXUA 1UKUA 3QBCA 1LFWA 2M4MA 5DZ7A 1E6YA 3J7Z5 2JJ9A 1RI0A 3GV7B 3UVJA 2Z0WA 3NGSA 2MQNA 3OSVA 1YJWT 5KYYB 1XQIA 5ETQA 2E1HA 2R4FA 2DHGA 2DR8A 1LNXA 2H9ZA 2WSEE 4I2PB 3CC7A 4HVZA 2JFKA 2YKNA 3DLHA 4W98A 3ZTOA 1I5LA 2ZJPQ 2QLWA 2QQAA 4N7TA 4DUZF 1F2GA 4BWJA 1Q86C 5C42B 1OY6A 2RD1A 2V2VA 3SFUA 1OIAA 4BACA 2ZH4A 2LNHB 5DLGA 5B09A 2XHCA 3CCJQ 1N54B 2FHJA 2DMOA 2DBMA 2F8EX 3I0RB 5JJBA 3O44A 2Q79A 2QSWA 1VQ9S 1YJRA 3IR7B 4LSLA 4J9DA 1U06A 1B4SA 2YKOA 3VTIA 3GV8B 3UN5A 3P45B 2XCPA 4RCBA 2F9JA 3QGGA 1X4DA 1PCAA 2XGPA 4OMNA 4J9VA 1TL1B 2DKOB 1R27B 4DWIA 2CT3A 2JEJA 1VUBA 2M5YA 4QIFA 3OTCA 3QO3A 5CHCB 1NHUA 2MKSA 4L73A 3MEUA 2JS0A 2VQFJ 1KONA 2RQCA 2RQVA 1VQ7T 1WC0A 3OLBA 3C16A 3UWTA 4JI4J 2HW3A 1X75C 2GIFA 5I42B 5I22A 2HQIA 3KUEA 2Z30B 4ECYA 4HHJA 1NMEB 4A46A 3BW1A 4X66F 3OW2S 1VIFA 4PJOC 3OTEA 2LT1A 4PZVA 4QR0A 4NI2B 4U6PA 4DL4A 1LWCB 1AWOA 3G96A 5HLFA 4M7DC 2RQWA 2QLBB 2HVHA 5J2NB 4V19J 3HULA 2FRYA 1NCLA 3QYHB 2CPJA 1U1MA 4C0OC 2MZSA 1X4EA 2CZ9A 2IA6A 2PI4A 2OJ3A 1FXRA 2JM8A 2QTVA 4PWDB 2H5IB 3O8WA 3VALA 5D3GA 4J6WA 3I9QA 4LIRA 1YBAA 2HNDB 5LJ5e 2GW8A 1AW0A 1TAQA 1Z1ZA 3DDKA 4ZLLA 4E6RA 1S79A 4LSNB 3TP2A 4DQIA 2IG0A 3KLHB 2MQLA 1AZSA 3CXCR 3QIDA 3CCTA 4J5YA 1N6QB 3HFZB 1SVDA 2VDHA 2CP5A 2DXEA 4ANEA 4BDYA 3WX8A 1X4HA 2FDNA 1NE8A 4ZGJB 3M8RA 4FN5A 3PGGA 4H4KC 5BXIA 2NYIA 1G6BA 3DXBA 2XC9A 5DGAA 2RHXA 1AT1B 3EGZA 1U2CA 2BQ3A 4ZCKA 2CZVC 4QZVB 5E2QA 3ISZA 3KWMA 5IHNA 1B0PA 4OX8A 6AT1B 1HBOA 1FKOB 1T3OA 2L48A 2XGQA 2VPZB 1NDKA 4LSZB 4NLQA 3DOKB 3A3PB 3HI9A 4DL0C 2E3HA 1VIEA 3HJFA 4DV7J 2K7JA 1ROFA 1VGYA 1GCPA 4I6YA 3MMCB 5LJ3d 1M1GA 1C0UA 1N36F 1X27A 1U49A 4F04B 3JB9G 2COLA 4XTTA 2VJUA 1RB0A 5E7OB 3TUIC 2QMUB 2XS5A 2RK2A 4O3RA 2IM2A 1HW8A 4FL6A 3KJFB 3NS5A 4L3KA 4CQ1A 1VFJA 2XZTB 1M1HA 4PKCC 2CXEA 1ZUUA 3JSCA 1HYSA 2L2PA 4ZVSB 4HI1A 5I4MA 5LJ5g 1RU2A 1YHQA 1XTDA 2ZZTA 3OYAA 1XR7A 3CJKA 2HBWA 1NK7A 2V34A 3M6WA 5AXKA 2MZRA 4IH6A 3B4MA 4JB8B 4NLTA 3ZTPA 3IM9A 4X1VA 4NMLA 1YQHA 4QVDA 3VAJA 4M63A 2B3TB 1N5YB 3M32B 4EYHB 2QFJA 4X2BA 2W7AA 3BSOA 3S6WA 2MQMA 5H9FJ 3ASKA 2KT5A 3OXFA 2DTOA 3PHEA 1BI2A 4M7AA 1BI3A 4WK1A 4II1A 1N4LA 1HNVA 1LW0A 3RKYA 2XBPA 1X5OA 2WW8A 1TS9A 4DR1F 3BFMA 3LX7A 3PE0A 2HHVA 3PVQA 2AGPA 2XI9A 3C14A 1Y00A 3T9NA 4WIIA 3M0RA 4ALZA 4WK3A 3K5PA 5CQYA 2PFDA 2VBYA 4GO7X 4HL9A 3ER0A 3MJXA 2D1XA 2PZ1A 2IVFB 4X4TA 2OO4A 2DEUA 2BXJA 1FF2A 3META 3NCPA 2F4FA 3EAEA 2H5EA 4Z2XA 3T3FA 2W4DA 2H3EB 3BDLA 2EFGA 2OSRA 1XR5A 4CH1A 2ZEJA 4N5SA 2EQUA 2OTLS 4LXCA 2AJQA 1K9MT 3IFEA 1PSEA 1KQ1A 1YX2A 2FYKA 1IZ6A 3CXCS 2GGRA 4Z7YA 4UY85 4RNMA 1S9EA 3O2IA 3RW7A 2CSIA 1XNIA 2KYBA 3O3LA 3TVTA 4DS5A 2QFIA 2VPXB 4LRDA 3CMAQ 2ROGA 5DM7R 2LQKA 1B34B 1KIKA 3ILIA 2VG5A 2XM3A 3QGHA 3Q83A 2D1CA 2KMTA 4ZPDA 2PVDB 3PTAA 2QQ9A 3RRKA 1MNEA 1YRUA 1VRTA 3IXQA 2CJXB 4PG6A 2JZ2A 2F63A 1RKJA 5HQLA 1YNZA 1JXMA 1AUDA 1HNXF 3PFSA 2V0NA 2DNMA 2XDPA 4O0IA 2RMLA 1K1ZA 2QYCA 4A4HA 5GAMd 4J9LA 5KYUA 3WBZA 3MPDA 4RUGA 3HF5A 4L59A 4A4JA 5LXRA 4FSXA 2C2EA 4ZLPA 2GTJA 1VLYA 3GP9A 5KFWA 3LPYA 1FD2A 3H5SA 2ASLA 4FSSA 1IKXB 4C92C 2HK2A 2KRNA 4ZGDB 2IBOA 1OYDA 4OQJA 1V76A 2N4CA 2DISA 1Q4RA 1SQFA 3QRQA 1C1AA 3M0TA 1M5OC 1C1BB 2DR6A 1RADB 1VMBA 3GTYX 5E5NA 1ZH5A 1IQZA 1Y71A 2CDRB 3MO8A 3P96A 4ELYC 3LW5C 3TWZA 3MCOA 2UVVA 1N8RU 4C8ZA 4X4NA 1KSWA 3GYNA 1F0XA 9RUBA 2L3PA 3MM8B 1WC3A 4J9MA 2XD0A 5AJ3J 1TL7A 2NYHA 2VUBA 1RISA 2DL5A 3SFMA 3DHXA 3JSRA 2RHSB 4KT0C 1FNXH 1UETA 4A4GA 4F17A 3K0JA 2E5HA 1UEVA 2CJ9A 3PIOA 1Q7YC 5KFFA 2DRBA 3G82A 2OLWA 1IR0A 2KEAA 2LEPA 2F5TX 1WKJA 3CC7S 2KVIA 4U96A 2VVKA 1UVJA 5IQ6A 1OX8A 4U67Q 2AHJB 2CQ2A 1K0XA 3D4JA 4AFZC 5IXUA 3O5TB 4RG8A 3LP0A 3K58A 5LOQA 3VQTA 3Q2SC 4FU6A 4KPYA 5I3UB 4KGVB 1N34F 3GJTB 2KJVA 1JX4A 2K8GA 2HVZA 4B08A 1RCOB 2CKWA 4DMZA 2OAWA 3KLIB 3M9OB 4OHZA 4O3NA 5FLXY 2MSTA 4RNOA 1N32F 4O0NA 4JUZA 4WFYA 4P73A 4FXDA 4M5MA 4LF8J 4EMKB 4EO8A 4BE0A 1KHIA 4VUBA 3MPVA 3VKIA 4YR2A 4ZIWA 2SEMA 2CG4A 3AOAA 1VQ6A 5E33A 4MMKA 2QA4G 1VQNA 2Z0GA 3IS9A 5CYMA 1D9DA 4XTWA 1XK8A 2DO3A 1TSFA 3L2QA 1EJ7L 3SMZA 1VHFA 3BQ1A 1SSFA 1FRHA 2WSEC 1RT1B 2LU1A 3D1QA 4P7VA 1Y5NB 3VS1A 4DFKA 4FPRA 3GLJA 3OY9A 3POTB 1RT7B 2R3VA 3OQ2A 4GKJF 5B0EA 3FNNA 2QC3A 1HYOA 1DARA 2YNIB 2YX4A 3BR8A 3DLLQ 3HD1A 1QVGR 3QUIA 1SJ4P 5LL6d 2C2MB 2IJFA 2L9NA 2W9BA 4RNFA 2VFUA 1FK9A 2X4WA 3CSKA 2HSPA 4MFBB 2KNBB 5GMKe 2CJBA 1REVB 1YWOA 1OU9A 3CMEA 2WW4A 1BCMA 4CDIA 5L1IA 4ID5A 1XMOF 2AJ4A 2GFUA 2MKHA 5KFIA 1YJNA 4KHRA 2FJAB 2R2TA 2EBEA 4KFBB 2OD4A 1OMSA 4AL5A 2CJQA 4LF7F 2FD2A 2BDPA 3UDCA 2MWPA 4XTXA 3D9BA 4PJMA 5F8IA 1UGQB 4NLPA 1QCOA 2W2MP 3MMAA 3HT3A 4RW7A 4KUDK 2HDAA 1D0ZA 2QG9B 2Q6CA 4DDFA 4F4YA 2JOQA 1W2BA 1S72S 3BS9A 2RU9A 4ZPTR 3ZTSA 4ANJA 3VRZA 2RQTA 1Q86R 4CC2A 1WF0A 2LT4A 4UQGA 3OYMA 4HDGA 1AWJA 4ECSA 3A4TA 3OYNA 3PKMA 4ER8A 4UTGA 4LUEA 2L3SA 4WIQA 5KCOA 1BHNA 1T0HA 4OGCA 4N76A 1J27A 3LYIA 5DO2A 4XK8E 3HPOA 4DV4J 3CJ8A 2Z2LA 4L75A 5BYRA 1G5VA 3OBYA 2DD4A 5L1KA 1WKKA 2EQKA 4B9XA 5LJ5h 4DN9A 3BYRA 2YX7A 3V8LA 3SSRA 1WNLA 2AKKA 2G6FX 4RMOA 1WC6A 1TR0A 1VQ5T 3VR1A 2B8AA 3HFKA 3SWNB 1UEKA 2LP4A 4Y34A 3E19A 3MUVP 5FRNA 2FVCA 3CD5A 3DLGB 2MYSA 5EHHA 5M2RA 2AT1B 5J2MA 2IC3B 1K8AT 3MEGA 3DM2A 1VQLS 1WHMA 3U23A 5E3CA 2QK0A 3PACA 3EE3A 5F9NA 5J2QA 5EWGA 3OBIA 2UUCJ 2JTFA 2DBKA 1TWBA 1FVSA 4XDCA 3X25B 1T7PA 2YKAA 2ZH5A 4QR1A 1GX6A 1UTIA 3PJWA 2E6NA 4OYZA 3CBMA 3RYLA 2VKNA 1LKZA 2R2RA 2GO8A 1XQHA 2BE7D 2MKJA 3PHTA 4HVUA 4QQ6A 5CKDA 5CIUA 1W2BP 3QRPA 3LAKA 4I2PA 3NEKA 1IQTA 1BWVA 2OPPB 1NPKA 3ZZZA 1JQQA 3NGKA 5ETPA 3LQVA 1MV3A 1VR6A 2LCCA 1WHWA 1R0CB 2M2BA 3CDBA 4KV8A 1S6PB 3D28A 3CC4Q 3N6MA 4NWBA 2DNQA 3H90A 3BDUA 2R8HA 2LECA 5C42A 3RR8A 2DXTA 1BQXA 3N6NA 3KHGA 2AEMA 4WF9Q 1FE4A 2R5AA 1KTQA 5DG9A 2LZ6B 2EVZA 4KSEB 3C46A 2LRQA 3CPWA 5IT0A 2WSFE 3CB4A 4HHUA 4WTYA 1YCSB 1HXDA 4CIOA 5HI7A 3MI7X 3CCQQ 1BXNA 3CDUA 2HG4A 5DQGA 3Q8SB 1JNRB 1HD3A 4M5LA 2C3YA 1BCOA 4JYAJ 4ZP9A 5D15A 4FT2A 1D1BA 2WONB 1U1SA 3NBPB 2JT4A 2BJ1A 3OJUA 2D3OR 4IO9Q 3WHIA 2YKPA 3KLFA 4Y92A 4QPXA 2BKNA 3QT8A 2Z57B 2QAZA 1OY9A 3LGNA 2G4BA 3CQTA 3IC1A 5IZHA 1V3SA 2UVUA 5I42A 2HAFA 4USUA 2BW2A 3NMZC 8RUCA 1ULRA 3GR1A 4KGXB 1Z9QA 3PMTA 4NA1A 2HURA 2L9DA 1YFNA 4OLPA 3US5A 3QZ7A 1PD0A 4ZS6A 4NI2A 2GHWA 3Q8YA 3CD7A 3NNHA 3K7RA 5GAOp 2R42A 3S7RA 3OYFA 1ZBJA 1HPZB 2E12A 3OYYA 2EG1A 3T5LA 5K9FA 4HTIA 3HSGA 1U6FA 5KFMA 3KYLA 5J2NA 3KUFA 5I3QA 2PE8A 3ITHB 4FF4A 2CS7A 3ZFJA 4DV0F 2ZM6F 2EIFA 4IUUA 1YJWQ 3EGUA 4R5PA 1WKLA 3ZFVA 1T0TV 4NLUA 5FD1A 4DA4A 4A63B 4X65J 2RNEA 3AFGA 1RYRA 2HHQA 3DLEA 2J9EA 2E1AA 3DYAB 3CPWP 4CCHA 2I38A 3TR5A 1ZBXA 2GHVC 1O8BA 2HNDA 4DX7A 2CH4A 2KB2A 4LF1A 4DR2J 1X7VA 1VQMT 2EVRA 2BJEA 1I81A 4LSNA 3MOJB 1VYVA 4EPCA 5A8KB 3KLHA 1UWBB 3KXTA 4M75B 3JXOA 1N6QA 1RHRB 1NLPC 1UEUA 5CD4A 2DXUA 3MTKA 2ZH2A 2Y0BB 2LQBA 2V8VA 5IT9U 3QT5A 2VD3A 4CP5A 1QSLA 2LCLA 4C8OA 1J5OB 2VC1A 1FTCA 2HFSA 4IYQA 5LJ5f 2EQJA 1L5UA 3OR1A 3TANA 2CPFA 2BZ2A 3GG0A 2K5FA 3SD4A 3PW5A 1FT8A 1VQ7Q 3JAMY 1D0YA 1JJ2A 1K47A 2VGMA 3PFEA 3TJ8A 3MMCA 2VG7A 1ZPVA 2DL3A 4WJBA 1QWFA 3CC2T 4OHYA 3A1YG 4QWAA 2CPDA 1SUQA 2XMUA 3MAAA 4R8UA 3MMJA 2GMJA 2RO0A 2EXUA 3VGUA 2X4XA 1FFWB 2YWWA 3S3OA 4QQGA 2KY9A 4QOTA 1J5EJ 5LMNF 8ATCB 5F41A 2VJVA 1ZTWA 1IBLF 4B3TJ 4QPTA 2BQUA 1FD8A 1RGVA 2OELA 2RJEA 5E41A 1RYSA 4NLGA 3X28B 2AK5A 2EJGA 3MR3A 2XDBA 1EAYC 3NS6A 4OMQA 4KRWA 3P8HA 1FJEB 1RAIB 4NZ7A 2FZCB 1NAQA 1N5YA 3M32A 2HKQB 3NGDA 2MLXA 2MY8A 4YP3A 4KHPJ 2DTHA 3V81A 5D0HA 5D6YA 2EBGA 2ZCFB 1UCNA 4I6WA 2HIQA 4PXBA 1CEZA 4N77A 3GYGA 4OV1A 1V3ZA 1M8VA 2BA9A 4RR5A 1G3TA 1OS5A 2NREA 1VQPA 2X4YA 4USVA 5E0OA 5KOWA 1PNJA 1UA1A 3PX0A 2GBQA 3G2XA 5DLOA 2IVMA 1QSSA 1XMQF 4ECRA 3EH1A 3T5HA 2W8KA 5D4PA 3AJDA 2RH2A 1NJIU 3SYZA 4PEOA 2DIVA 1JJ2P 4NZ6A 2DIUA 2B8QA 2YRCA 1VQ4S 4DQRA 2FUG9 3VVUA 2ZNZA 1TKZB 1WHXA 1RABB 4DL7A 5EWEA 3CD6T 3I55T 4TXSA 3DHWC 3R1LA 3QPHA 1CJVA 2BUDA 3OSNA 1UHFA 5CD4H 2AGQA 4IR1A 2E65A 3VAFA 4ES3A 2CIMA 3AQPA 2JRSA 4E7SA 1RP5A 2CFXA 3MAQA 5FLXE 1FHTA 3ZZRA 4AQYF 2KK4A 5J2PA 4HR2A 1YJNS 2J7WA 1B34A 3TOQA 3OFGA 5J1PA 1Q7YR 2J0QD 1EZZB 2SRCA 4G65A 2ZITA 4X9DA 4ILLA 4C5GA 3GIJA 2J9DE 5ETSA 4ORZA 1YI2T 1WWHA 5G0RB 3C4SA 1ZS6A 3BBBA 4NPOA 1YCYA 1P9QC 2JJ4D 1ZZNA 3QIIA 1QCNA 3IG1A 2FB0A 4NL3A 1UECA 1VK8A 1RTIA 1I6JA 1FWLA 5FU7B 5GAN4 3QIPB 1OU8A 4NCAA 1JXLA 3WVEB 2OEJA 4X34A 5KYWA 3V6JA 4PNOA 2HL5C 2RPNA 4AD6A 4CC3A 2VODA 1IKXA 1VDHA 2X1GA 4XU1A 2X4JA 2K5IA 3T1YJ 4BI4A 3G7ZA 2HFZA 1OJ4A 1GTEA 3KUHA 3D66A 4M5IA 2MGZA 3K17A 1U48A 3TJ9A 1KC8U 2HRYA 2WBRA 3RKWA 1NO8A 2M0YA 3WIVA 1RTHB 4IUFA 3BJYA 1OV3A 2ZNYA 1FFGB 1YLXA 1AVZC 4MH8A 4IH5A 1Q79A 1NBEB 4AFSC 4ZN3A 3CCET 4P9SA 4Z02A 3MM8A 2KT3A 3KJVB 3HFNA 3QWPA 1XJWB 3I87A 1ZQ1A 4M78F 4WPAA 3IA0A 2IY5B 3EVOA 4CI0B 2NCKL 1ZZFA 4OYOA 2DNUA 2W01A 2B9XA 3FMWA 3GMGA 3J81U 4ZNXA 4PFZA 1RL2A 2J5AA 4LDVA 1U6BA 1CJTA 3F0NA 1Q53A 3S3NA 4XK8C 2FVPA 4WKRA 4YHHJ 3BY7A 2XICA 3KHRA 2GC8A 3TW0A 1TU0B 4ZK7M 3PM9A 5IOLA 1N5SA 4DHVA 1JKHB 3PJXA 4ES1A 3HPWA 1Y4ZB 2CPHA 3TSWA 2V2KA 4GY5A 2XCAA 2AX0A 1ZM4A 2XZWA 5FJ4A 1H3DA 3MCNA 5K14A 4ZHRA 3HHKA 1SRLA 2CZ1B 1P8GA 4K4SA 3FEOA 3QQCD 3V7CA 1YBTA 1JLFB 2FJDB 2JUFA 2DXBA 1AEYA 2JM9A 3ZTRA 2UUBF 1XIQA 4FXWA 4PG8A 1OSDA 2MJUA 4IG0A 4J9QA 1IO6A 4YY3J 4I68A 1WDTA 4KE5A 2B51A 3CDAA 4JJCA 1RHKB 1W1FA 3CCWA 2L9WA 1B07A 2EQIA 3TCJA 3ENAA 4F7VA 2NUPA 2UVRA 2YRVA 4L6V5 2AYGA 4P2MA 2EPDA 2D3ZA 1DLOB 5GMKm 4O4GA 1RT1A 1WYXA 2YNFB 4W4MA 4HCCA 4OIXA 1GEHA 4CLFA 4NX9A 1YP5A 5GAMe 4M5HA 4I0WA 3CBOA 1X5PA 4DFMA 3H42A 1FO1A 2A36A 4IUVA 1BGXT 4M77E 4KGKA 2YNIA 4GO5X 2ZBQA 1IGUA 5CQXA 3SBMA 1KHCA 2K79A 2FTRA 4OMFB 1REGX 2DK2A 2WSFC 3J80Y 4IOCQ 1ABQA 2VGNA 4I6AA 1VC0A 1REVA 4BE1A 4F3MA 1U8SA 3FJ5A 1BI0A 2M51A 1SHGA 3JS9A 4V19X 1Q81U 2VC8A 3OYLA 5AT1B 1GK8A 2V6AA 2HNYA 1SJRA 3G1JA 4JI1F 4QT7A 4JI0F 4HT5A 1OPIA 3RAXA 1EX4A 1PKUA 3EG1A 4AFQC 1IKYB 4CRJA 1TKTB 1VISA 4MIBA 3DOLB 1R31A 2V94A 1MROB 3NP5A 4B3OA 1RT5B 3UD4P 4HCKA 2DVIA 2M0OA 3GSIA 3E2EA 2B7BB 1HR0J 2DAQA 1V5VA 2DXDA 2CADA 2R2UA 2GCXA 2X3XD 3DRSB 2ALZA 2GNCA 1FKPA 5IN1A 2A10A 2HQDA 3EPIA 4DCJB 4M75G 2CZ6B 2VA3A 2MPXC 4GC6A 5GAMg 3GOXA 4M78B 2E66A 3KNGA 4TY8B 3I56A 1IKWB 1FNOA 2UV8A 3BR9A 4KH1B 3U1LA 3OVAA 2JX2A 2VBXA 3RBEA 2IYGA 2E7WA 4ZLNA 1UP1A 4FNHA 1M2VB 4RTYA 4MK9A 1WGSA 3T41A 3GILA 3G6ET 2M9KA 4IFYB 1YJ9T 4WZMA 3NS7B 3PFOA 3R9LA 4USHA 1DJ0A 5I2SA 1ZM9A 1FXXA 2HQFA 3N6LA 2XKOC 2RKIA 3SWNA 2IJRA 1T8EA 5KFZA 1SL1A 2WVCA 5KFDA 2A37A 2G0IA 3DLGA 2MHNA 4F14A 1VQKT 4JP8A 1SC4B 2IC3A 2P2CB 4D6WA 1WI6A 3CCJS 1QAYA 3QWUA 3RB0A 1K73C 3GYXB 3EFSA 2YQ3A 2UXBF 4N8OA 3H41A 4LDWA 4LMZA 4C8QG 3EVMA 2KR3A 3BGRB 5U47A 2GTOA 4ZA1A 2D9OA 2PDAA 5HROA 3ENVA 2YKQA 3BGUA 4WFXA 2EC2A 2AF6A 4YN3B 4E7HA 1LW2B 2F2VA 3TAMB 4WFZA 3QFWA 2OPPA 1CVJA 1U0SA 2FYXA 1KHWA 1LK7A 2EFQA 2EFVA 5GAGU 4CH0S 4CWBA 4DCPB 3JAME 2FY1A 2IMWP 4DPWA 3P8BB 4X9CA 3VHQA 3EGXA 2G1DA 3X26B 4HVWA 3TA0A 4DBFA 3C66A 1WF2A 3CJSA 3H7HB 4DUZJ 2FPEA 4TLQA 3BO3A 3G8TA 4MMLA 1X2QA 3DLLA 4P2FA 1HNIB 1XBWA 2GX8A 3MEKA 2WONA 4DR7J 2XMWA 4MDXA 1NJYA 1HQUB 3NBPA 1SCJB 2DEIA 3V4MA 4ZVUB 4CO4A 3VAIA 5L8RE 3PRVA 4M75D 2N4DA 4Q5WA 4U7CA 5LJ5j 3JV3A 2YXLA 2C2NA 1MWYA 4XO0A 5D78A 1RKIA 1MU2A 1VQ5Q 4RPFA 1TK5A 3CULA 3KJNB 1M1KU 4IKAA 1BIBA 2Y4XA 4C3MA 2CNKB 1GAOA 4PCQA 1ZSZB 3OYEA 3BBCA 1FRIA 5HMWA 4FM4B 2BR0A 1QAXA 1FJGF 2CJYB 2HHWA 4XTUA 2MOXA 3OR2B 3MR6A 3IWNC 4OX6A 2O01E 1VQ8T 2R7SA 1BQMA 4X66J 3ITHA 2V4RA 2MCNA 3Q8VA 2I2LA 2AJ2A 1IBKF 4C8QD 3M4YA 5THWA 4JV2A 2FJWA 3D3BJ 1PAUB 2R7XA 2QE5A 2DZCA 5F0UA 5KFGA 5GADU 5E3PA 2DGTA 3CCUT 5DDRC 1BQNB 3M2RB 2PMHA 2UUAF 2RS2A 4FYDA 1G3OA 4P5NA 2O88A 1Y11A 2QIFA 3QGIA 1T02A 1NEBA 5A8KA 1TFYA 2VOPA 4ESRA 2RS8A 2QI2A 4R25A 3QBYA 4RBUA 2HQ3A 3C12A 3I9V9 2W9AA 4Y2MA 2VG6B 2ZH3A 1OZ3A 2DXCA 2QYZA 3UD5A 2J6UA 3KLEA 5HK0A 3GR0A 4ZITA 1RACB 1VRQC 3HSDA 4EDUA 2E9ZA 2LQNA 1RSCA 3LANA 1J5OA 5GJVB 2NXEA 3AHPA 1MMAA 1KVIA 3D3CJ 2IAJB 2X35A 4DJBA 1KBRA 1WG1A 4PFOA 1EP4A 4O3SA 2KTQA 2ZJQQ 3R7SB 2G13A 1G8XA 4NLOA 2XLJA 2W25A 4QBUA 1IXKA 4WFNQ 2V68A 3J81j 1CS4B 3K5NA 2HS3A 3W5ZA 1UVLA 4JJBA 3GP8A 4TLRA 2ROPA 2FVQA 3A5ZB 3M0UA 1GX5A 1N36J 2JTMA 4RBTA 2FGCA 2X51A 4CZCA 4JV5F 1CSKA 2QEXT 1QVFA 1U1PA 3E1SA 2OEMA 1CJUB 6FDRA 4P10A 2KT1A 3CCQA 3HVAA 2HQXA 3G4SA 1XEZA 2NZ4A 3MHXA 2C2RA 2VKZG 3MKDA 3KMQA 2UXCF 3H4DA 3HSJA 5KFRA 5EC7A 4C6AA 3MCSA 2HGMA 4X62F 1AFJA 3CWJA 2DGUA 1VQMQ 5CCMA 4AG1C 2QT7A 2JH3A 3CCLS 3JSYA 2X3GA 2Z8QA 2OD6A 1FMWA 2HBYB 5DM7Q 3CMAS 4OGEA 1SH2A 1HD0A 3PKYA 3AA8A 4USKA 2AZVA 3LWIA 2BJ8A 3AHUA 1YVFA 3EX7B 4ECWA 4CLYA 4NRTA 4KH0B 4CH7A 3MFIA 3TI0A 3D54A 1OULA 3MM6B 4DR1J 1PD1A 4BDZA 3CJ4A 3ET6B 2LC4A 1RBLA 3JB9I 3BDEA 3UDEA 4B17A 3G8SA 1DBDA 1H2UX 2RJDA 4F7UF 5DDQC 3LAMA 2V5HG 3EZUA 3RGIA 5IHIA 3M6VA 5IV3A 3Q8RB 4A8SA 1Y3JA 1K4US 1Y7XA 4M75E 2R7QA 3CCRA 4LF6F 5B0AA 2HS0A 3D7SB 3CC2Q 3QGPA 3H25A 5T7LB 2K3BA 4F67A 1YWPA 1QVFP 4PUOA 4IDKB 5D0GA 2PEBA 4PYAA 1YJTA 3AOCA 4OMFG 2V9KA 1C1CB 4MIWA 2BUNA 4TKTA 1S77D 3HT0A 1S1XB 4HYKA 3A8LB 4FXVA 3MGJA 3SCIE 3J7YI 2HWTA 2XEXA 3DFEA 4M8LA 5HK4A 5DLFA 3HMJG 2DO4A 2EFPA 1PCXA 2R57A 2W1BA 1C6VX 4CLWA 4F26A 3QAEA 2DNOA 1FWKA 2OMOA 1FKAF 4KGMA 1SIZA 4NCGB 1WOPA 4FYYB 1S6QB 5KG7A 3KK3B 1X01A 3AODA 2AP6A 1FX7A 1RAJA 4UF4A 5F9LA 4DX6A 3QJPA 1GL5A 1HNXJ 4C8QE 2BE9B 3P4UB 3BB5A 5LJ5d 3HX9A 2HQHA 1LPLA 2O3DA 4AT1B 2CP2A 1S12A 2CWXA 1TKXB 3DMJA 2J0SD 1WC5A 4ED2A 3J80E 3IAM9 3UE2A 3C3LA 2VF3A 3C0CA 3HCXA 1UFKA 4J7FA 1PJ5A 2ZC4A 2MK5A 2JC0A 2O4XB 5A0LA 5ETTA 4K5RA 1SC1B 3R5DA 3M30A 4OI4A 4QW2A 2BJ7A 4ANDA 1KDNA 3HD2A 1E6YB 3L2VA 2VFTA 3TSZA 2CQ3A 1G1XA 1CKAA 2KAFA 1N6AA 3UVJB 3R3TA 2JNGA 4HCBA 3M8WA 3KJVA 1NB7A 3CD6Q 3I55Q 3FGVA 1UW4A 2Z2ZA 3R6OA 3SCKE 2FVSA 1JLGA 3EICA 1MUZA 3N9UC 1UVIA 5GAEU 3CCVS 4OJ3A 3A8EA 1SV5A 3I82A 2ECZA 2HFOA 5EX0A 1Y7PA 1UJ0A 2NR0A 3VCDA 2HQGA 5CAIA 1D9AA 3C6TA 4YS2A 1SKUB 2V4QA 1JB0E 2WOMB 4LRFA 2RJZA 2BANA 5GAGI 5CVIA 4LNPA 2ROEA 4KUIA 4MKVA 4L76A 1SHFA 1BKBA 2KE9A 1U24A 4BLGA 4LSLB 2JS2A 4MDWA 3INZA 4ZPAA 1JKHA 1UZHA 2LNVA 1YI2Q 2NSBA 1EETA 1R8HA 2OGUA 1RZMA 2D3UA 2B4PA 4JS5A 5KFYA 2HBZB 1N5VA 5KFCA 3RB6A 2KHDA 4K0KJ 5FDLA 3K59A 3VZHA 3GCXP 4C0ZA 5D6WA 4HH0A 1F9FA 4EMKC 5GMKj 2HFUA 1SIWB 3UF4A 3W2VB 4O3QA 2FHMA 2L3MA 1NUEA 1D8YA 1H73A 4DLEA 1QW1A 4C8KA 1RLDA 1AA1B 2Q6BA 1Y9OA 4LD6A 4J9CA 2R7TA 3NOGA 1GXTA 5HLFB 1BD6A 3AJ1A 2DYAA 4UC4A 1N32J 2OHDA 1RWKB 5LL6S 2RF0A 2PMWA 2BABA 3SV4A 2AQ4A 3E9FA 3TO8A 2B9WA 3RESA 4M78D 2CP0A 2K2VA 3CCEQ 3QFHA 4J9KA 4JRQA 3EZ5A 1KHVA 3IBFB 1BWEA 4TVAB 2KBTA 1TL3A 3IRXA 3FZ2A 1ZA1B 3M8PA 1NJIT 3FBCA 3O6QA 4RX6A 1T9TA 1KOOA 5K5MA 5D3GB 4Q7AA 3TA2A 2NQPA 1E6GA 5GAOn 1YIJT 5A8RB 2ZHAA 2IJNA 4I4BA 2MXYA 4QYZK 1F5AA 5GMKl 4EEYA 2RHYA 4C5EA 5DY9A 4FS1A 1QLNA 2KI7A 1XMBA 5J26A 3PZPA 1H3ZA 4HH1A 1K76A 2MPUA 2K2PA 1K73R 1FMVA 1AZSB 2LQ5A 5KFOA 1HQEA 2E3IA 2XY5A 2DTIA 3EVWA 1WJQA 5F8LA 3D6MB 5L8RC 4ZPVR 1ABOA 4N4IA 2YDLA 1RWPB 3D6HB 2DGVA 3BKFA 3KHHA 5CAAA 1U47A 1X43A 1U1TA 3WIUA 3HKWA 3KFWX 3KOAA 2JNJA 3DOLA 3NWRA 1Y10A 1BYMA 1SBRA 2C22A 1MROA 4Q5VA 3QWXX 2CQHA 3FJ2A 2OPQB 4PAAA 3HK2A 4LF7J 2GQVA 2CDTA 3CEDA 4ZJQA 4WXOA 4LF9F 3DRSA 2ZPEB 3LP1A 5JVHQ 1DJ7B 3DLMA 2FY8A 1VQOA 1C0UB 4PJOF 1R89A 4DPOA 1YHQT 2J06A 3EJMA 3CCLT 1JK9B 2J6TA 4M78A 3BKUA 3U27A 2O01C 2JEIA 3OBWA 4TY8A 4M7DF 5J1EB 3W61A 2XMTA 5F8HA 1IKWA 4IH7A 2BIVA 1JRIA 4ZN1A 3QMQA 1M2VA 2EJFA 3JCMV 3CJKB 4RBVA 2BW7A 3RU0A 3ZNJ1 3SWNC 7FDRA 2RSQA 4IFYA 1Q82U 3TVKA 4ZVPB 3LP2A 2D74B 3GFZA 2OMLA 3S6EA 3CC4S 3WZ0A 1PRMC 5FU6B 1NXIA 2XS7A 3OFFA 4NE9C 5BYQA 4CC7A 2IM0A 2RDIA 4DSEA 1WJSA 4M7AB 4Q8EA 8AT1B 2DILA 1HNVB 1K8AC 4CTAA 3BGRA 2ZPFB 3DC2A 3FQKA 2HBQB 3CCQS 3G71S 3RTVA 2MB0B 3C14B 1Q7LB 3LLRA 3NOCA 4DV2F 2VXFA 3QPIA 2XWXA 2YQ1A 1LW2A 2C2OB 2WBMA 2BMBA 4H54A 1RCXB 4CT8A 3OYKA 3IMQJ 1VQ9A 3K89A 1YK9A 1SG5A 1Q0NA 4J5OA 4OMLA 2LX7A 3GB0A 2I2YA 1RQ0A 2HVIA 3IWXA 1C0MA 1IBCB 4QR2A 4FT4A 2LDYA 1G83A 2ERRA 4CNZA 4E0DA 3OSSC 2HPUA 2MLYA 2LU2A 4RNHA 3PYFA 3NGPA 1CPZA 4E8UA 1R77A 3N4WA 4V1Ak 1HNIA 3BH6B 5CKFA 3JCMP 2BVZA 2AJ1A 5K20B 3OW2A 1YJWS 1U45A 3BSNA 2H51B 1FI4A 3DRYA 5AE3A 3MM5A 5HMZA 3G6EQ 3TRGA 1YJ9Q 1HIYA 1WOOA 3DLKA 4FYXB 4YTLA 1ZSZA 5KYUB 2Y4YA 3VU3C 5IT9Y 1VQKQ 1IBMF 2QGGA 2KN4A 2EYQA 3KHLA 3RZAA 2UU9F 5A0GA 3I5RA 1FESA 1U3OA 3R5CA 2VKRA 2BJ3A 4LFCF 1DURA 3DDNA 2X1AA 3A8IA 2V26A 2EI5A 1U1LA 2P5VA 2U1AA 2B86A 2G9OA 4B9LA 1QD1A 3EHQA 4TYAA 2E7XA 3JQMA 1KQFB 3FMBA 1QJHA 4J9GA 4J90A 4DV0J 3MEWA 2ZM6J 1BQNA 3HKSA 3V2UC 2P6TA 1M5PC 2VFRA 4GVLA 3UD3P 1VQ7S 2FLPA 3ZEHA 5CA5A 1KTVA 1AHJB 4M75C 3PYEA 2QL5B 1NM2A 4OF1A 3A13A 1Q81T 2VFSA 5K8PA 1M90U 2DRKA 4QIEA 1DAXA 4NCBA 2VV5A 2MZJA 1TL7B 3JQJA 2HRTA 3HXMA 5D6GA 5L23A 1RXOB 4PLLA 3OW2P 3OVBA 1PSFA 5I2MA 1VYUA 5LSRA 2D9PA 4ZJLA 3H20A 3ISND 2A6OA 5DS7A 3Q8QB 3FSXA 1Y07A 2WB1D 1GXUA 2HHSA 3M9NB 3G82B 2DA9A 3G6XA 1I1JA 3T5KA 3DOMB 2COYA 2J6FA 1ZAXA 4UUXA 3MFHA 3GIMA 2BRKA 5IWAF 4ED6A 2EQMA 5SZTA 1DRZA 1S0VA 4ECVA 3BYPA 4ZVGA 2JZ5A 3Q1JA 4IUTA 7AT1B 2IAJA 4NS5A 1QY7A 5KG2A 4BDPA 3PX6A 4HEA9 4DV7F 4X4VA 2YWFA 3GIBA 5HK3A 1HWLA 3QJ6A 2GGPB 2E64A 3AJ2A 3FCVA 2KL8A 1WQ7A 2AZ3A 4C8QC 2YUPA 3LP0B 2DK3A 2QL9B 4X4SA 3QSYB 2FJXA 5IXFA 3QXEB 4K50A 2F4VF 1HLWA 4HT7A 4B9WA 3KK2B 2UZAA 2LQWA 2MMPA 2ZC3A 3C6UA 3R6LB 3D0HE 5HO4A 3K5MA 4BC9A 4C92F 3ETOA 2RE1A 1VQ6T 1WG5A 1HNZF 3ZZ0A 2ACYA 4A54A 1VQ8Q 4JI2F 1KQKA 1OSCA 1CJUA 4Q0BA 3NNCA 3FB9A 4WKYA 5DM6Q 4URSA 1U5SA 3WVDB 5LMNJ 2OTJT 2HVDA 1IBLJ 2CWKA 1HBUB 3IS9B 1IM4A 4ME7A 1O0PA 1NJZA 5CYMB 3CCUQ 3DN9A 4QKUA 3MOZA 5DLQE 2ILYA 1UGRB 1P1LA 5HJYA 2R8JA 4DFJA 3U7JA 4RTZA 1MN9A 3CPFA 3E3XA 1E6VB 1IN0A 2AU0A 1EIFA 3CJTA 3ZNUA 4DN0A 1WJRA 1QLYA 3C8YA 3MEDA 1JB0C 1GCQC 2CQIA 5HMYA 4JI7F 4DQQA 4A47A 4DV6J 3CMET 2E5LJ 1N5QA 1WSRA 1S76D 2JW4A 5C2CA 3QZ5B 1HK9A 5KG0A 1S1VA 2W9BB 4JV0A 2M88A 3E51A 3CXCA 1V5IB 3MM6A 4GLKA 2KXHA 3EUNA 1KLMB 4DF4A 5SUHA 3OL8A 4NA3A 1T9VA 4Q8FA 3WX4A 4KGZB 1XMQJ 2QZ8A 1X69A 1N33J 3REBB 2XMKA 5D4LA 2A6MA 2YTCA 2CZ0B 3OL7A 1S1TB 3ILJA 3W8PA 1RAAB 1NK0A 2P8IA 3M0SA 4RW9A 5C24A 5T7LA 2ZDPA 4KYZA 5GMEA 4JUVA 2OPRB 4AMCA 4A8WA 2YRDA 4OYBA 3QO9A 3THPA 5DG8A 2NS1B 2YLCA 1Y5IB 2XSJB 1UFLA 1VLOA 2QXFA 3I31A 4LVOP 3A8OB 2RQMA 3OS1A 1T3NA 2ATCB 2CPYA 1S1XA 1JLQB 1IHVA 3DNCA 5GMDA 5GMKi 1EKRA 4AUKA 1U2FA 2HZYA 1M1KT 3GPLA 2P4RA 2F40A 5GJWB 3G71T 4WZQA 1KQSR 2RI3A 1UPPA 5FU7C 4RO0A 1E6HA 2YUQA 4DR4F 2R7VA 4RTUA 2DCUB 1FE0A 1S6QA 3KK3A 5M9OA 1ZAVA 3PRBA 1O75A 2A0FB 3J81Y 3GCWP 5GAN6 2EAYA 1Q8KA 2WZ1A 2KXDA 3NFCA 2IHR1 1F1BB 5B0DA 1EB0A 2DGOA 3W5YA 2DPPB 3D2WA 3CXCP 1TKXA 5DQIA 4NLVA 1G3YA 5GAN5 4HTJA 2C2ZB 2Y1IA 5KG1A 4O44A 4ECUA 2V2ZA 3U1NA 2UXDF 3KNAA 2O4XA 4BUGA 3MTJA 4Q2MA 1VYAA 2DKGA 4IR9A 2M02A 2IRYA 3OYHA 4IIOA 5GAHU 5J2QB 3UI3A 1X4BA 1ZUYA 1F3FA 5F3TA 2IRXA 1SRMA 1GBRA 2CKKA 1WHGA 1PC4A 3HSBA 4BCAA 2KDOA 3OQ5A 3EFOB 2MYFA 1U8WA 1RT3A 3DRPB 2O1PA 1UGSB 2C3MA 5L9NA 2WOMA 2XI2A 4KV8B 3BM7A 2QLXA 1XOVA 3HTRA 4M7AG 2A18A 1KEKA 2HNIA 2QA4T 1FERA 1F9HA 3CJ5A 2G2OA 2KI2A 1VQMA 1N5ZA 3S3MA 2A3LA 2PO4A 1ICEB 2LTOA 3FRZA 4OV6A 1RT2B 4PPDA 2E70A 1HW9A 2NUUG 3KXDA 2CP3A 4KAIA 1EHWA 1VRUB 1JNZB 1TP7A 4DCOB 5GAMj 2EFOA 2QRRA 3H4BA 3JCMJ 2EFNA 2Z56B 2CQ0A 1JJCB 2ZWOA 1NKBA 2RHIA 2IIHA 5LJ3h 5I21A 1BLUA 1FDAA 3BGOP 4P2XA 3KLFB 3WQPA 4CO2A 1M8MA 1WHKA 3EDQB 3BO2A 3K57A 1YRXA 2ADBA 5CR2A 3KG1A 3RAMA 4F7UA 2NPIA 3W2VA 1NEEA 4LF8F 4OZLA 1A9NB 1UEBA 2DR7A 2R8GA 3GPAA 2BM0A 1KQSS 2QJ3A 3CC2A 3EPGA 2JXBA 2P0QA 2XLIA 2UUBJ 2N82B 2I8EA 3FCWA 3JSMA 1S1WB 4MMOA 1TQLA 3MPUB 4CO1A 1ZTTA 3QSUA 4RG2A 3QDRB 2AYEA 4OB1B 4Z88A 1RDRA 4R5PB 2ASJA 1GTHA 4F02A 1NLOC 2QV6A 4MYTA 4WP9A 1MWZA 3R2CJ 3DLEB 3OXGA 1GXLA 3L7UA 1WORA 3BBFA 1NSKL 2W2OP 1RT4B 2CQCA 1IWGA 5A8RA 2COZA 1JXOA 3CGIA 2PA8D 1NK8A 2GVDB 2OIHA 4J9EA 4PPZA 1FTRA 3URGA 3P5BP 4C48A 2BJDA 1IKVB 1RU1A 4KBIA 2J76E 3FEZA 1K8AR 1S72A 1YKWA 2PMZD 1UTAA 1XN9A 2WVBA 4JV1A 2ENMA 4M7AD 1RJJA 1M90R 2LEAA 4FF3A 4IUPA 1M9SA 4DX5A 4UT4A 2ZVSA 3D0IE 3M9MB 1SJQA 1OX9A 1KSPA 3BPDA 1R8CA 3OR1B 2OPQA 1TV6B 5A76A 5DETA 2DR5A 1JU5C 4JI1J 4JI0J 4DOWA 2YBVA 2E9RX 3OL6A 3CD6A 3I55A 3HO1A 3P8DA 5IT9E 2VG7B 4C0DC 2B6AB 4OZ2A 3QG1A 1PG5B 1BC6A 1SUQB 3FCHA 3MAAB 5J1EA 4R8UB 3UW1A 2RQ4A 3B4DA 5D4NA 3LUYA 4DR3J 1UVMA 4C3LA 5GANe 4IUQA 4F4AA 1UDLA 4USMA 2I5JB 4OHXA 2CZ7B 1NNDA 4JZ4A 3VS5A 1S4EA 3OD2A 1GFCA 5KT2A 2CVEA 3R5JB 5T41A 1VQLA 2FVRA 1TUCA 1N9SA 2DGWA 3DRRA 2BEFA 2ZHOA 1ZSGA 3LO3A 1YI2A 4B9SA 2Y8WA 1VQPT 4ATNA 2ZOGA 2DGSA 2E10A 4YMEA 2Z58B 4IKFA 3V81B 1PGZA 2KJWA 3IBCB 1RWOB 4TU7A 3F70A 3JQKA 1YIJQ 1MMLA 2RJCA 3M59A 2FG0A 4KTQA 1AYEA 3KK1A 2ACMA 1N8RC 3HHLA 1QVGA 2G0JA 5AYFA 3QATA 3W65A 3CIZA 4TU9A 3PV8A 2VH7A 4YEAA 3B8HA 1T11A 1LFPA 3VAMA 4BC7A 2UXBJ 3I5CA 5KFJA 2ZGWA 4YB6A 1FEHA 4P7TA 1IVZA 2VBWA 4D8DA 5BJRA 3OYJA 3EHRA 3THVA 4JLIA 3MCMA 4G6VB 5G4DA 3GIIA 2VWFA 1Y57A 5LJ3f 4ZVOB 3H98A 5KE3A 5GANg 3VS0A 1YJVA 2HIYA 1VQ5S 4U8YA 2O5DA 1UFFA 1IRXA 2ESWA 3Q8PB 2NWMA 2D8HA 4B3SJ 1CJVB 3CCEA 3ADAC 3MXHP 4GKKF 2DCLA 1YHQQ 3CCLQ 5LMUF 3W7BA 3ZTQA 1UJ5A 1N0UA 4K2JA 3L09A 2KRSA 5J2PB 3AH6A 5LT5A 4Y2KA 3A8GB 3Q0AA 3H0HA 5BYSA 2JEGA 3KUGA 3M5AA 5ETLA 2RF2B 1T03B 3UN3A 3ILLA 4J8OA 2J8SA 3A3NB 4URQU 3H9NA 5M2PA 5CABA 4I64A 2RUSA 3M58A 3J7A1 1GFDA 4DBHA 4OZ0A 3UDLA 2CVIA 1B0VA 5HVGA 2HQEA 3M4GA 3IG1B 2JLFA 4OX7A 1JJHA 2G1HA 1S48A 3BREA 1R8BA 1RTIB 2CQBA 3A3OB 5KYWB 4DV3F 4X4QA 2YQ0A 2CAJA 3EDRB 1F60B 1YG0A 3X20B 4PJLA 1UL3A 1QVFR 3A12A 2MF2A 2K06A 4ZPWR 3G6VA 1QKWA 4PJOA 4O3OA 1BK2A 2MGZB 2AEJA 5ECAA 4UZCA 1S1UB 5KFHA 3B78A 2CUYA 3MEVA 4M7DA 2QQBA 2VB6A 1UJ6A 4RTVA 4RJVA 1HBNA 1QWEA 4JJNK 4OVAA 3IWLA 4ID8A 2EKYA 4M7AE 5GAOl 3VAHA 2HEKA 2L8DA 1WXBA 5ITHA 2AW0A 2E44A 1L3TA 1VHIA 4BE2A 2UUAJ 2FLLA 3P6YC 2KRBA 4YR0A 3DOMA 1CJTB 4DQSA 1T9WA 5E3AA 2ZH9A 4P2SA 4J6YA 3BEGB 4DR6F 2WSCC 3GZ7A 3FC3A 4AFFA 2M0GB 4H4MB 2AMCB 3UCZP 2DRDA 2CPZA 1YSJA 2ZBIA 2CDQA 3B54A 3SFGA 3J81E 5IC4B 1H2TZ 2GGPA 4H4KA 4C4WA 2AZSA 2NXNA 4OYXA 4DLGA 3L7PA 2DLPA 2E5JA 3M8ZA 1VQMS 3CCVQ 4B3RF 4E7JA 1L3UA 4J9NA 3MF5A 3KK2A 2LX9A 1TUGB 5K14B 4ZHRB 5BR8J 3RRHA 1X6BA 1KNZA 3NMAA 3H40A 4IG0B 3R7NB 1T94A 1URRA 2EKHA 2KG1A 2BE2A 2XZDB 4F4XA 3M2VB 1Q95G 4OI6A 2ZFHA 1NLKL 3OTDA 2YNHB 1WXUA 3UDVA 4EMGA 2D0NA 5KT3A 4DG1A 2B9YA 2NUPB 2YWHA 4BD3A 5CCAA 2L0AA 1HKAA 2VASA 1HBUA 4K8RA 4KC5A 2HCKA 3ISNC 2M1HA 3JB9F 2DZ9A 3BKTA 2DVJA 2PTKA 1NH8A 2EGCA 1SI9A 5GMKa 4KO0B 3OS5A 2C3PA 1LVKA 4O4GB 3CE8A 3BN7A 4PL6A 1E6VA 3NTHA 3E2UA 4NRUA 3G6EA 1VQ4A 3CC2S 1YJ9A 1A0OB 4USJC 2XG8A 2QYGA 1I3OB 4RKUE 4FPIA 2DH8A 1B7FA 3CCST 3FDRA 5HCKA 5I11A 4ZTJA 2D0QB 1RAFB 3NCQA 4FKXA 3VGSA 1KLMA 3NL0A 2DHXA 1I94J 4TY9A 2QGFB 2BKPA 4DR5F 4PJJA 4N41A 4XPEA 4Y0FA 2HNYB 1WACA 3QYYA 1P92A 2QQRA 4X4UA 4WU3A 5HL7Q 1M5KC 3DI6B 1S1TA 2RDJA 4R56A 1K44A 5CO7A 2LA4A 4CC4B 1WNEA 2LMIA 2OPRA 2MKIA 3L7OA 3VS3A 2MQOA 3H0FA 1S59A 3VUZA 2HMIA 4B3OB 2YKMB 3B6BA 1HQ2A 2GV1A 2FQQB 2XSJA 3I56T 1HI8A 3SCJE 4AL7A 1JLQA 2YWGA 3ZC4A 4J9SA 1D1AA 1VQ6Q 4LF6J 1OQKA 2RQKA 3OTBA 2GQCA 4LRAA 1L3SA 1S6UA 1FKPB 2Y0SD 2F5KA 1K0TA 4HKEA 2CQ1A 2DERA 1WX6A 2AX1A 2CT4A 4FIBA 2Y1JA 1MLAA 2ZWPA 2RN8A 2OTJQ 4CO3A 2EK6A 1KFSA 3M6UA 3E01B 4FZVA 5CXTA 2HGNA 3LWHA 1HHSA 3TX0A 2D69A 3CD6S 3I55S 1B7TA 2WVDA 4DPXA 3V6DA 1WA7A 3SB2A 4O4RA 2DFUA 2OFGX 2Z2MA 3LH5A 4M5DB 2P0PA 2EW9A 3T1YF 5F8MA 2M16A 3VS4A 2RKIB 1GQEA 3M0PA 4BI3A 1ZYQA 2RHUA 1PJ7A 5EDWA 4DV5F 5KFQA 2YXYA 2EGAA 3MCAB 3EYZA 3PX4A 2ZKTA 4OZJA 2DVEA 3I96A 3V8JA 2YUNA 1M90T 4QU6A 4LF5F 4DZDA 1GMVA 1YI2S 4C92A 5HROB 1VQ8A 3M1VB 2G0CA 1VCTA 3KLVA 1U1NA 3KKFA 3IM8A 1R8OB 2VUGA 3EFOA 3DRPA 1Z2ZA 4OHVA 2K2MA 4UQTA 3C15A 2F65A 4LF4F 2YT6A 1U1KA 3EG9B 1PHTA 2RAQA 4FP9A 2DE0X 1QVGS 3NKYA 2VA2A 2VQEJ 1S57A 4OI3A 2G3RA 2CNLB 2ZPBB 4ZOSA 3QT7A 4DX8H 2R7RA 5GANh 3EGXB 4IG3A 4I67A 4A8KA 2PI5A 2P6SA 4FYWB 1F2HA 4L74A 2RD5C 3CNQP 1RT2A 3MD3A 4AL6A 3R2DJ 1VQSA 3G71Q 4B3MJ 4YQWA 3HM9A 1VRUA 5LJ3Y 1Q5VA 4NASA 3PO4A 4UW2A 2RB6A 1KOHA 3SZ2A 5KT5A 4PYDA 4MT1A 5M2UA 3CCES 3EXYA 2J8AA 2VC0A 3ICLA 3LWLA 4IRCA 2FIUA 1X9WA 1RUSA 2RM4A 4PK4A 2V8HA 2DD8S 1ZM2A 3VYHB 3NGTA 3EG0A 1MU2B 3EGVA 2KO1A 5EGYA 4QVCA 1W2IA 4I7FB 2JLGA 1R43A 4CNYA 5GVQA 2RQUA 3GONA 1PBAA 2CUDA 1DHMA 2FC9A 4A8QA 1UJYA 1U6ZA 3CJQA 1HMVB 4A8OA 3PIPQ 2NUTA 3KDOA 3SCLE 3Q22A 1DZ5A 5KYXA 1LOJA 4JOUA 4WP8A 2MKYA 4D3GA 2C2DA 4B9VA 4PXCA 4WBFA 2LQJA 2V67A 2A2DA 1S1WA 2BZYA 3MEAA 1BQMB 3GBQA 4TN2A 3GNFB 2BZXA 3CBPA 2VHGA 1UUEA 5A0DA 5D4OA 1EFNA 2EEYA 2QASA 5GAN2 2DY1A 4OFZA 1QTNB 2XMJA 3ELHA 2V1RA 2KU7A 1H74A 3R27A 4QYZJ 3C94A 5K8MA 1RT4A 1VIOA 1NJIC 3MECB 3PR4A 4B6MA 1N5TA 4KKOA 3OYIA 3GE9A 2FZKB 2OSQA 3TQEA 4G1QA 2J05A 2M9UA 2DJWA 2GVDA 3E9GA 1RBOB 2QA4Q 1IKVA 4OB3B 4ZVFA 4QIWD 2CYYA 1N8RR 4N4GA 4LQ3A 5HMXA 1PBUA 1WI8A 3PVLA 4JS4A 1SPBP 3KLEB 1U0HB 2XQCA 4F3QA 3TZZA 5HN0A 5EG2A 1TL4A 3AD9C 2Q1LA 4I56A 3X1LB 4C5IA 2Y8YA 3V5RA 4E98A 4RW8B 4MYUA 1GRIA 2RI5A 3MMBA 1CQNA 1RI9A 1TV6A 2EWNA 1YBUA 4WWSA 1WLPB 2YX1A 2CG8A 1EP4B 1SKSA 3FBBA 2B6AA 4J6XA 1NDPA 4Y28C 1YZ6A 1G7CB 2PNIA 2RMOA 3KG0A 3N5FA 2B4OA 1YZ7A 5IHKA 1B7YB 3FZBA 5A2QU 3WC2A 4OP0A 2C3UA 2RHZA 3PCOB 4LFBF 4LF9J 5KFBA 2OPSA 3TQ1A 2BOPA 3D1OA 3G4ST 3OW2R 4PJNA 2I5JA 1OPLA 3H5UA 3CDEA 4OB0B 3CCJA 5D8HB 2ASDA 4RU9A 2MY7A 4ANCA 5FU6C 1RHUB 3PW4A 2HWHA 4DS4A 3THTA 4DPYA 2P4TA 1Q8IA 3SHWA 4M7AC 2H54B 2FGOA 4TQRA 1KC8C 3W9IA 2NXJA 2ROTA 3D5MA 2PUKB 1SB6A 3H2VE 4LT6A 3GIKA 1RTJB 3CJ3A 3LTOA 1O9SA 4RUCA 3FK4A 3KLGA 5GANf 1KQ2A 3X3UA 3EZOA 1RT6B 3TVYA 3IGVA 1Z2LA 3OTOF 3T6BA 1YTYA 2H5JB 4H4OA 4R0KA 5H9EK 4ZVRB 2FO0A 1OYEA 2AYBA 4KRTA 3GU0A 1Y96A 1QTMA 3BSCA 2BZ8A 1GMWA 3G6ES 2R8IA 1YJ9S 4DV2J 4PR6A 4RCCA 3CCRT 3NMRA 4ERDA 1RA6A 1NSPA 2QA2A 1JMTA 3JCMh 2E5GA 1S4FA 5D0RA 1QKXA 2ABLA 2XIDA 1W6XA 2FVUA 5IM0A 3V4IB 3L2ZA 1VQKS 1VA7A 4RWXA 2F1LA 1FNMA 2KYMA 1H3HA 4NOHA 1WHHA 4MZTA 1NK4A 1I0CA 3VWSA 4PUOB 2ZJRQ 1NKCA 4ENOA 4A8FA 4DR7F 4WYWA 3D1HA 4C9DA 2UVWA 1T9UA 4CLKA 4F2RA 5L46A 3NNAA 2VDIA 2Q43A 3PG9A 2GS8A 2RF2A 5DQHA 1S10A 3IP0A 2DH9A 2E41A 3W64A 3SXLA 1T03A 3HRTA 3JYTA 2DL8A 2FRWA 1X4FA 1RA7A 3OMCA 2A7YA 2EFIA 4WU2A 3M05A 2J7IA 3CCMT 2HD0A 1K9AA 3EH2A 1VQPQ 3CJ0A 5CZVA 1N56A 2EW3A 4C8YA 3TX8A 5KFKA 3ZBDA 5KCHA 4MIAA 1WIEA 1WD6A 4JI6J 3UA6A 3BGLA 3DGVA 3TZWA 4X4OA 4RKUC 2GQQA 2JWNA 3JB9k 5CYQB 3UPUA 5CZXA 1QVPA 2O31A 1WHJA 2ZH6A 1AB8A 2QLJB 2QDYB 2JMAA 3DMJB 4NXMJ 4LBIA 1IBMJ 1KS2A 3SDEA 2HL3A 3TZYA 1ZX6A 3DB3A 2M8DB 2W9CB 2UU9J 5MAOA 4YFUA 4M5NA 3FFIB 1CULB 1S1UA 4ZLJA 5CKEA 4LFCJ 2UV8G 3SIPB 3DRXA 3MAHA 2W4PA 3M30B 2EK1A 2PVGB 4XAKA 2Y9HA 2HVEA 2JVOA 1R7IA 2QO3A 2DIGA 1YJUA 2BJ9A 3QJLA 1R0BG 2D6FA 1JLGB 3FBEA 1Q81C 4FS2A 2MIOA 1SV5B 4AXJA 4EIKA 4ECXA 4C0GA 3OB9A 3C6TB 4DEZA 2XS2A 1CJKA 2BANB 1VQ8S 1R3NA 2DPIA 1YIJA 4JZ3A 1LNQA 3OLAA 2MQQA 1MMGA 4LBPA 4H4MA 3MUTP 2VXEA 1QDUB 1Q86U 1IJEB 4RZRA 1JLCA 3CCUS 1EETB 4D3HA 1Q5YA 3VF0B 1G3SA 5IWAJ 3L2UA 1PRLC 2RVJA 3QAUA 3HVTB 1W4SA 4M1KA 1RWUA 5FDLB 4M77F 4Z89A 2JL9A 2XYGB 2LCSA 2ZAEA 3NRBA 2QTWA 4TNOA 4BBYA 3THKA 3FEYB 1PKTA 2AKLA 1UB4A 4YDDB 4E7ZA 3M2VA 1RHMB 2F4VJ 2PGCA 2YNHA 4ZTFA 1EARA 2P9CA 1DQAA 3CCLA 3W63A 2XMMA 2XSFA 1WXTA 2A08A 3MP1A 1HNZJ 3CMAA 4NMXA 4JI2J 1D09B 2RRBA 3MUMP 1VJQA 4UOGA 5HP1B 2KT2A 1FA0A 2GA7A 3JCMX 2DNKA 4KO0A 3GJQB 2ASYA 5KH6A 4ICLA 2VZ9A 3ZL7C 3Q24A 3J7AN 3BZQA 1G3WA 2IA0A 4EI2A 3JCMf 4ELTA 4DPTA 4F25A 2EKNA 2FHDA 2D7SA 2R58A 2B0GA 5JUMA 3PO5A 1TL3B 3IRXB 4TVRA 2B5JA 1MSWD 2NXUA 3M8PB 1TK0A 4MK7A 4NLDA 3M57A 2H48B 4J9PA 1JLAB 2GFAA 4JDSA 2B9EA 3OJSA 5AXMA 2C1EB 5KG3A 4F3OA 1Q1KA