2OAUA

Mechanosensitive channel of small conductance (mscs)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
YAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2oauA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oauA03
3HFKA 1VQSA 1P8GA 2PD1A 2RK2A 3BB5A 1TL5A 3TOQA 2P4TA 4HI2A 4OIXA 1Y0HA 2RSQA 2VV5A 3FMBA 2ROPA 5B0FA 2BBEA 2OD6A 1W2IA 2XMUA 2HLUA 1GXTA 1OSDA 4Q2LA 5B0EA 1SQEA 5T7LB 3IWLA 4FNHA 3CJKA 5B0DA 4OJHA 1R6YA 1TR0A 2RH2A 4NPOA 5A6PA 5A6WA 1U7LA 2QLXA 1VIFA 1YJRA 1CC7A 2PGCA 4FNIA 2GFFA 2AW0A 2JDJA 3FRYA 1OQ3A 1V3ZA 3LGNA 5F0UA 2GGPA 1QUPA 2KT3A 2AJ1A 3SFMA 2HFNA 2RILA 2XMWA 2XMVA 1YJVA 2QYCA 2ASYA 3HHLD 4ZA1A 1APSA 1FVSA 1URRA 4F67A 2IYIA 4U9RA 5B09A 2FTRA 1KVJA 4HH1A 4OJGA 2GA7A 1MWYA 1AW0A 1Q8BA 1JK9B 1Q8LA 1S6OA 3HHLB 4HI1A 2AP6A 2LQBA 3UDCA 1AFJA 2KYZA 1X8DA 3GZ7A 2GCFA 3KNGA 3WDOA 3IWXA 3MCSA 2K2PA 4ZOSA 5IXUA 2RU9A 1K0VA 1YJUA 3LGMA 3TRGA 1FVQA 3HX9A 1KVIA 2GQVA 1RJJA 4A47A 1MWZA 4Y2IA 3LO3A 3HDSA 1IUJA 2IFXA 5T7LA 2G9OA 3MZIA 2AJ0A 2OP5A 2OKQA 4Q2MA 4HH0A 3FGVA 3DXSX 2L3MA 2XMMA 4A48A 2GO8A 5KAKA 1N5QA 4OJ1A 3HHLC 2IYGA 4HL9A 2BJEA 1TZ0A 5K9FA 1VIEA 2K1RB 2W4CA 1CC8A 2FHMA 2HFOA 1Y3KA 4OJ3A 2RK1A 1SB6A 1VQYA 2QLWA 2FB0A 2ROEA 2CRLA 1JWWA 4QOTA 1S6UA 1Y3JA 3F44A 2OAUA 1X7VA 3T9NA 3TNVA 2BYCA 2Q3PA 2VH7A 4Y2MA 1P6TA 4Y2KA 4YEAA 2OFHX 3KKFA 2LXFA 2K7JA 2N4DA 2XMJA 5B0BA 1OPZA 5B0CA 1YJTA 1WD6A 1OQ6A 2KKHA 3HHLA 2BUNA 2LDIA 5F0WA 2W4PA 2BJDA 1N5VA 1ULRA 2GV1A 3BDEA 1N5TA 3BN7A 2HLTA 2ROGA 3CJKB 2HIQA 1FESA 1FE4A 3KG1A 3E8OA 4EFAC 5B08A 2FIUA 4NL5A 3KG0A 1X0PA 1YG0A 2XMTA 2ZDPA 3K7RA 4DL0C 1LQ9A 3DCAA 2K7KA 2OMOA 1Y9OA 2OFGX 3BM7A 3I9ZA 1Q4RA 3QGPA 2ACYA 2GGPB 2EW9A 2XMKA 4DN9A 1TL4A 2KT2A 1CPZA 5B0GA 3HF5A 1N5SA 2N7YA 2W4DA 3BGUA 2N4CA 4YDXA 2ZDOA 3VTIA 2RMLA 3BR8A 2K1RA 1TUVA 3BF4A 1AFIA 4DPOA 2LQ9A 2QIFA 1SI9A 1Q53A 5B0AA 2OD4A 1FE0A 1FEEA 2HQIA 3QMQA 4A46A 1YRXA 1KQKA 4A4JA 1XBWA 1GXUA 1FD8A
chains in the Genus database with same CATH superfamily
4M75B 8AT1B 3G87A 1OX8A 4LMZA 2VV5A 4C8NA 3H98A 1S72S 5IAYA 1RT1B 2J05A 1QCOA 3G86A 2MPXC 3SIPB 2EW3A 4FN5A 4ZLLA 1UZHA 4RTWA 1YZ7A 2V94A 2ZBRA 2OPSB 1VISA 3IS9B 3TVKA 4QQBA 1WNEA 3E2EA 2E7XA 5IC4B 3DI6B 1NK7A 2RU9A 4C0GA 3BFMA 4OGEA 3MAAB 3P5TL 3F70A 4WFXA 2DHAA 2R2RA 5KFKA 1UMJA 1VRTA 5DM6Q 4FVMA 1UE9A 2GO8A 2W0ZA 1K4US 1AXQA 1UKUA 3CC7T 3DLEA 1X4FA 2LZ6B 2NUZA 2OTJA 2FUG9 1RQ0A 4XTXA 4Z7YA 3AXMA 5KFEA 1YJ7A 3QYGB 4I1TA 2DNRA 2V9KA 4L5GA 4W90B 2BZYA 2DXBA 1C1BA 1D0ZA 3FCHA 3TSWA 2AYEA 3A8OB 1BKBA 1ZX6A 2NXUA 4ZVFA 3N4WA 4DV6J 5J26A 2CVIA 2PUOB 3OR1A 2B43A 2MMYA 4WU2A 1VK8A 3FZBA 4CNYA 1KQKA 2E6NA 3CCEQ 4BACA 3JV3A 2FPFA 1K8AC 5L8RE 2KYMA 1KVKA 3D0GE 4UOFA 2RRAA 5GAOn 2YKQA 2XMUA 1NU4A 2HVDA 4DU8A 4LFCJ 5D6YA 4C98A 4FS2A 2A6MA 1Q7YR 4K0KJ 3BGRB 1TQLA 3MAQA 3D3CJ 1GCQC 2LX9A 1ZZFA 1WXTA 5HN0A 5HK3A 4EYIB 3DRPB 1VIOA 4JI5J 3N6MA 3IAM9 1Q8LA 1KHIA 2FEIA 2FJAB 5KFPA 3GIIA 1N5QA 2UVWA 3N6NA 1N48A 1Y4ZB 2QEXA 4OB3B 1ABOA 3Q86A 5KFXA 3HVWA 3CCUT 1H7XA 4IFYA 4AFQC 3L4BC 2LNHB 3JAME 5L1KA 4DR5J 5IT9Y 2EWNA 1NG2A 2AJ4A 1LXJA 2G2ZA 4BCAA 3OVBA 2QA2A 3G82A 3BJYA 2GNKA 4CC3A 4JB8B 4DUTA 3T5HA 4F4XA 5HP1B 3J80Y 5F8LA 3VV2B 2OTJQ 2R42A 2W7AA 4OZ2A 3JCMb 1FDAA 2LVMA 1I51B 3CBOA 3QAEA 1DTTB 2V69A 1AD5A 4JV1A 5DG9A 4QU7A 2ZD1A 5J2QA 1BIAA 5CQYA 5KT3A 3GBQA 5GAMd 4DV2J 3C14B 4CO4A 4RTYA 4MZPA 4E7KA 4J9PA 3IGVA 2LP5A 4CLPA 3VCDA 4U7UD 1REGX 2E9ZA 2A18A 1UDLA 4ZA1A 1URRA 2PIIA 2DM1A 1C1CA 4OMFG 1TKZB 4PWUA 2PN6A 1LFWA 1X4CA 4HT9A 1UP1A 2HGNA 1WI8A 3GPAA 1Z4UA 4M7DC 4DCOB 1HBOA 3LP2B 4CT9A 1Q7LB 2WBMA 3HHLC 2MLYA 1SH2A 3L7OA 1PAEX 2K1RB 4LRCA 4V19X 2J76E 4M7AA 2MCNA 3EDRB 2D9OA 2O66A 3L3CA 5I22A 1XNQF 4IURA 2X1GA 4DOZA 1MSWD 4MTPA 4NL2A 5DDQC 3K5MA 2DITA 2YVSA 2XY6A 2W2NP 3ETMA 1L3SA 1DJ7B 3JSRA 3G6XA 2ZH7A 5HMYA 2IA0A 3VR1A 1WGSA 1X5PA 4ZK7M 2CZ6B 3MPDA 1TKTB 3NFCA 1D1UA 2WK4A 2CZ7B 2LQ9A 4K8RA 2C3PA 4BC7A 1WQ7A 4USIA 4UTGA 5LSLA 4ECRA 2DO3A 2J6UA 4TXSA 3W62A 2CZ4A 3OYMA 3LAMA 4ZLPA 1NK4A 4RU9A 2DNGA 2VZ9A 1W26A 3UNYA 4C0OC 3L2UA 1HHQA 4TNOA 4M77B 5FRNA 2HHPA 4OYXA 1SPKA 1RAOA 4U95A 1OX9A 3OUYA 1WLPB 1XMQJ 2CQIA 1NK8A 3ISND 3K5PA 2IDEA 4NCBA 2IIHA 3V5RA 1YWXA 5KT6A 5H9EJ 5G0RA 2F2WA 2NLUA 2UUCF 1H2UX 1ZM3A 4GVBA 3OY9A 1WKJA 3OYYA 1N5ZA 2R5AA 1MMLA 3Q22A 4IO9Q 3DKMA 1TL3B 3AQPA 5L38A 3ZL7C 3P5BP 1PAUB 1WOOA 3K8VA 4WP9A 4X4OA 3CW2C 1FJCA 1M0SA 2DR7A 2DNYA 3UWNA 4BI3A 2E1RA 5IC6B 4O3RA 1PBUA 1O8BA 2NZ4A 4DUYF 1FKOB 4OYPA 4ZIVA 1RTDB 2KT2A 3HVAA 5HQLA 3WIUA 3PT9A 2HZAA 4PJNA 2GJFA 1S1NA 3K59A 4FPIA 2HIYA 1VBXA 4Z7CA 4ZLJA 2D8JA 3TCJA 3LPYA 3V7RA 3B6BA 5HBMB 1S1TA 2P0QA 3S3NA 5LL6d 1T7PA 1WQWA 1KLNA 4N4GA 3BSCA 2F9DA 5CYMB 2E64A 4J9EA 2M8HA 2DGSA 2ZOFA 3RB0A 3PW7A 2MQNA 4OHWA 2GA7A 5J2NB 2Q43A 1YJWA 4UUWA 3E9FA 4K11A 1KQGB 1F3VA 4JJDA 1SH3A 3JYTB 3N6LA 2CP0A 3J81Y 5IHIA 2EK6A 2QX0A 3IXQA 3MMCA 1M30A 1KRPA 2VKZG 4ZPCA 4WYLA 1UG1A 4LREA 2BANB 2XG8D 1KTQA 2LA4A 1DTQB 2A7YA 3PJWA 1H641 2XHCA 1KQFB 3QO9A 2DEUA 2XBPA 2UU9J 1KKHA 4GBQA 4IQMA 2E9RX 5A0YA 3UVJA 1ZH5A 1JJ2S 1KQSR 8ATCB 1PNJA 3KG0A 1UVJA 3B4DA 3PG9A 1SL0A 4X65F 2FVSA 1F9FA 3PX4A 4DCJB 2ZZTA 4HXJA 3I82A 2PQWA 2JM8A 2JL9A 3UD4P 2Q6CA 4WJBA 4EO6A 1BGXT 3VWSA 4M7DF 2Y4XA 3C6TB 3JB9H 1ZM4A 1RYSA 1FD8A 2I6WA 1OPIA 3PY8A 4E98A 3KMSA 1PWTA 3WXMB 1B34A 3P8BB 1SJFA 3UATA 4ED3A 2EQUA 1UA0A 1IR0A 1F5CA 3T5JA 3PDNA 1PIEA 3W9IA 2HKEA 2HBQB 1RTIB 2HFNA 1NDKA 3FQLA 3UA7A 5A8WA 4UY8T 5J1EB 5H9FJ 1HA1A 5DLFA 2FY8A 2F40A 2ZKTA 4D6WA 4M1KA 3GFHA 1RWXB 2CWKA 2HHQA 1KTVA 2RJFA 4RW4A 3EAEA 4HHUA 1GRIA 4CRIA 2VL1A 2F4VJ 1FHTA 3TUPA 5KFFA 2QG9B 3UF4A 2L3MA 3I56A 3NBPA 4MAKA 2PA8D 2LCLA 1YJWQ 1IRXA 2MKIA 3LOUA 2VWFA 2CG8A 2MDAA 5B0BA 1AOJA 3LP1A 2DCLA 1VQ8A 2KKHA 1DLOA 4ZVGA 4ZGEB 3T1HJ 1FE4A 4TY8B 3RBXA 1RI9A 5E3RA 3QWUA 2QLFB 3CIMA 5ETLA 3SDZA 5LJ5g 3PRBA 4LFBF 2R5MA 4KJIA 2XO7A 4E7JA 1AUSL 4PFPA 2DIGA 4DEZA 5IV3A 1K9MR 2OH2A 4Y6IA 4IKAA 3VS6A 4DL6A 3DLKA 2CPXA 2XSJB 3T6BA 2B9EA 4II1A 2R8IA 2AGOA 1VQLS 1HBNA 4WIQA 2YHTA 3QBYA 3CCMQ 4J6XA 3ZNJ1 3R5GA 1KIKA 4WP8A 4DEXA 1IKXA 2CA9A 2IYIA 4F0MA 2Y0BB 3UDCA 4A8FA 3ZTPA 3MECA 3MR2A 4AYBD 1U24A 5I42A 4ZN3A 1REVB 1AZSA 1ZYQA 4JZ3A 2B86A 3G7ZA 2HFVA 2C1EB 4DI6A 3DFEA 3HKSA 4HH0A 1U0SA 3ITHA 4WIIA 4C11A 1KD1R 3QSIA 1VQ6T 3Q8VA 4Y2MA 1BD6A 1PYSB 1RT2A 5KFYA 5ITHA 4C3KA 1VQ9S 1ZAWA 2KBTA 1I3OB 4MZTA 2PTKA 3IRXA 4M7DE 3OL9A 1HNZF 2RQKA 3I56Q 1QP3A 1OULA 2XMTA 1RT3B 3HK2A 3JCMh 4DBRA 3THKA 3QZ9B 1BYMA 3A12A 3DRXA 2DFUA 2QQRA 2BTTA 3R6OA 3DOLA 3LP0A 3EGXA 3H42A 4HT7A 4QW8A 4QVDA 3ASKA 2V5HG 4N47A 4PJOD 1RT4A 4H54A 4CC4B 3W66A 1N6AA 1VQ6S 3BKTA 2IM3A 2JFKA 1UGVA 1WHMA 2KYXA 2XMVA 2FVCA 3VGTA 1UCNA 1MUZA 4R56A 4AXIA 5AE2A 1FDNA 3WDOA 2C2EA 2AV5A 2KSSA 1MROA 2ZWPA 4B9LA 1RTJA 2XB2D 2AJ0A 1I94F 1M4ZA 4LSLB 2D3O1 2EKNA 2X4WA 2Q66A 4AQYJ 1Y3KA 4A8OA 2WVEA 1RE1B 1YJNA 4CLKA 4DV4J 1M5OC 3R7SB 4B3SJ 4Y91A 1TV6B 1OY9A 1IR1A 4N8NA 4O44B 2MSTA 1BI3A 4JRQA 4OVAA 2KRSA 4DN9A 1JJCB 4Q7AA 2O4XA 1X4EA 2EVRA 1Q7YC 4L74A 4IH6A 3T1YJ 2YNHB 1MV3A 3PRVA 2HW3A 3HFKA 3OVSA 1KNZA 1WKLA 4EUVA 1CS4A 4WP3A 1LFPA 1N8RU 2LMJA 3KLVA 4YR2A 3NGSA 2QTXA 1BCOA 1OQKA 4QWDA 2DNQA 3MUTP 1UZDA 2DEJA 1C0UA 4ZVEA 2CJBA 1RXOB 3FK4A 4LXCA 2F4FA 2PGCA 1U1OA 2ZAEA 5GAN5 4CI0C 4RW8A 2BE2B 1JEGA 5FLXU 4F67A 4OJGA 2W7PA 3M0UA 4PG7A 1JK9B 2R7QA 4DFPA 3OXFA 3MM7A 1WC6A 3BO3A 5GADU 3QLHB 4R8UB 2ILZA 2J8AA 3BDUA 1WHLA 3DKDA 3CPWR 4DL2A 2KXCA 1YN8A 1VIXA 1Q82U 2VKRA 5KFCA 1OYDA 1RWWB 2ZEJA 4JUZA 1K1QA 2GQIA 3VV0A 2VG6B 4KGMA 3JRZA 2OGUA 2RAQA 1GT8A 4RL1A 5B7WA 2DRAA 4LDVA 2VG7B 2DHHA 1SJQA 3V81A 3BKFA 4EO8A 3CBMA 2IM0A 4U67Q 3UCUP 2KAFA 1I8FA 3JQMA 4IUVA 1TKXB 4JRIA 2V63A 4DV0J 1IKVB 3D1QA 2F63A 2V8PA 2ZC4A 4EBCA 2K79A 1B64A 4A54A 2RHZA 2V4JA 1Q7YT 2WZ1A 1YJNQ 1RP5A 1FWLA 2M3DA 2ZNZA 2AZ1A 1CBKA 3HCXA 1TKDA 1S1XA 2AJFE 3BF4A 3FJPA 3GMGA 1AFIA 1GFCA 2A0FB 3R6LB 4K50A 1H74A 1SBRA 3WQPA 1JJHA 2HZVA 5KYYA 3FFIA 3MR7A 3H0HA 3JB9F 1HWJA 3LANA 4C8KA 3QDFA 2D0NA 4XTZA 4J8OA 3M8WA 4I6YA 4DX6A 2RIJA 4MYUA 4KE5A 1OU8A 2DF6A 2XI9A 2VKNA 3G4SS 2OTLA 3FEZA 3PTAA 4QWCA 1HHTP 2LQBA 2YRDA 3OFFA 1QTMA 3NBPB 3L09A 3LPEA 2DRBA 2J6KA 3ZTOA 3N28A 4DV1F 2QFJA 4F7UF 5C42A 2XWXA 1V5VA 3MD3A 3OW2R 4A8KA 1UWAA 2ZH1A 4PUOB 4P7VA 3MMJA 4JS4A 3GIMA 4AT1B 3VS2A 3L2VA 2ZBCA 4AFZC 1TUCA 2W24A 1VBZA 1RT5B 4OYAA 2NUUG 4IG3B 3HSDA 5EX0A 1T3OA 2KJWA 1YHQT 1HLWA 2CQDA 1FWPA 4NXMF 1Y5IB 3TAMA 2PUKB 3GF5A 1OMSA 1HNIB 1VOMA 3M32B 4NASA 1IN0A 1TMJA 4ZTJA 1J5EF 1SC6A 3UO0A 4X64F 4NLQA 3AOBA 1FO1A 3L95X 1YRXA 2XDBA 2LVWA 1S97A 2FZGB 1UVKA 1KWMA 4RTZA 3EVWA 2BV3A 1YVFA 2KZZA 1KOHA 4Y65A 1FX7A 3PACA 2W2PP 2ALZA 1M1KU 1ROFA 4FW2A 3V4IA 4JOUA 5HKCA 3JAMY 1H2TZ 4XDDA 1ZSGA 3A1YG 1NM7A 3H0PA 1KK7A 3DGVA 3I4PA 4YHHJ 4TVRA 3PO5A 1DBDA 1HI1A 2JN0A 3URGA 3EG9B 5BYSA 3QJPA 4P5NA 1U25A 1YHQS 2B4PA 1MWZA 3E2UA 3W1YC 3NGDA 1N9SA 2EKOA 5GAMh 5HVFA 1NE8A 3IR6B 1HYOA 1WJQA 2YKNB 2RK1A 2IPOB 3R7BB 2ZKUA 2J0QD 4IDKA 1GFDA 3SCLE 4HR2A 4HT8A 3ZTRA 3OL7A 1EJ7L 2JH3A 4UZCA 1G2BA 3CCLT 3T3FA 3PYFA 4IYQA 2KZMA 2BZXA 2VOPA 1WDXA 5LXRA 2KM8C 1QW1A 1K73U 4OX6A 2N7YA 4M5LA 4NLTA 1B7FA 4C0ZA 3UD5A 3LH0A 1YLXA 3I96A 1OYXA 3NNHA 3BR9A 4QVCA 4A4JA 2XG8A 1DAXA 1PCXA 1VQSA 4JI6F 1XERA 2P4TA 3TA1A 3MKDA 1BIBA 3KLIA 3I35A 1R8BA 3HP6A 2F8MA 1GBRA 4U8YA 3DB4A 1BUXA 1N4LA 3EVMA 2LNVA 1BU1A 2W9BB 3QXEB 3R5BA 2BR0A 2VOOA 4F7UE 3CCLS 4NEZA 4U8VA 1X2QA 2P2CB 4RWWA 3RIRA 2HNZB 4XTYA 2FHOB 1FYNA 3PIOA 1FKPB 3M2RA 1VQMQ 3QIDA 4K4UA 4CH7A 2G2YA 3DHWC 3X3UA 1V76A 1F2HA 4DOWA 3S6WA 1T9WA 2MY8A 2D9PA 5CK9A 2XCPA 2BYCA 2C22A 3R2CJ 1VI7A 4A8SA 5HMWA 3OA6A 2ZBQA 1NJWA 4DR6J 4QW9A 4JI7J 3MEAA 3I6PA 4D8KA 1JLEB 5LJ3j 2X35A 2HWIA 1NHUA 4DMZA 3RERA 3CMEA 4LDWA 2I9SA 3CDWA 2QDLA 3PVLA 3M30B 5GAN2 3CUNA 2FDNA 3DC2A 2FC8A 3AD8C 4RKUC 1S0OA 3BDPA 2O31A 2CKKA 1C0UB 1TU0B 4OMPA 3I9QA 2DNPA 3M0RA 1UJ0A 1AZGB 1DQAA 2FYXA 4B3RF 5M9OA 2DY9A 2VQEF 4OB2B 5DDOC 2JDJA 2BE9B 1OQ3A 3W3SA 1V3ZA 4M7DB 2NZCA 4MIWA 3OL8A 4JI0J 3J81U 3ET6A 3THVA 1JLGB 5F9LA 3HHLB 4ED8A 2IVFB 2K3BA 1X8DA 1T03A 2O2OA 5IHKA 1KVIA 1HQUA 4B9VA 2QA4T 2AKLA 4K59A 3SCIE 4LF5F 1YITQ 4R25A 1QMCA 3A98A 2UUBJ 3CE8A 4DX7A 2RF2A 3EFOA 2FHMA 3MCNA 1WUUA 1C0MA 4H4KA 4FF1A 1BQMA 1NYFA 5EN1A 5J2PB 2H5EA 4OYBA 4DV5J 4DBFA 1MMDA 2DYAA 3KUGA 4EFAC 4WXWA 3SDEB 1TG0A 1ZBJA 3BBCA 2PNIA 2YLCA 4M78C 4O6JA 3H41A 1K9MC 1T3NA 1D9FA 3BGUA 1FTCA 2CJ9A 2QAZA 1TAQA 5C7PA 1UGRB 2CG4A 5IQ6A 4ZITA 6AT1B 3NTIA 3MGJA 4CLZA 1XBWA 3Q8YA 1R43A 3OYCA 2R7VA 1M5PC 4AL5A 1KQSS 3M8QB 4H4MB 4LVNP 2D9TA 2ZBPA 1Y0HA 3GPLA 3INZA 3OFGA 3CJKA 1PG5B 3CMEQ 1RLCL 5ETOA 3C66A 3MEVA 1V5IB 2KN4A 2HMAA 2ZHBA 1VIFA 1YJRA 3RKXA 2RILA 4DG1B 2X3WD 1T05A 1S12A 4LJMA 1X5SA 3GIRA 5L39A 4OZ0A 4RPFA 2ZFHA 2V67A 3IBWA 3MTKA 3VALA 3KFVA 3MFIA 3IMQJ 2KH9A 2C3OA 2RPNA 1X4GA 1MLAA 4Y3CA 2COLA 1LW2B 3IG1A 1YNZA 3PIPA 4DR7J 4X9CA 1N33F 2IBOA 5LMUJ 3GYGA 1IVZA 4C8QD 1FRMA 3M58A 1QVGA 1VQYA 1NJYA 3W9JA 4AL7A 4USMA 2HNDB 2ABYA 2VA2A 3HVRA 2E5HA 1RBLA 2VPYB 4UF4A 1K9MT 3VS3A 2FB7A 4B9WA 2FIUA 1MV0B 3QO3A 1FD2A 1NNDA 2MZQA 2HBWA 1M3AA 4ELVA 3EMTA 3LWIA 2DNUA 1UJ4A 4JI8F 1IGUA 3SQGB 3WVEB 1A0OB 3HF5A 3D28A 4JI4F 1JQQA 2AEMA 4O3PA 1N34J 2CNKB 2ZH2A 4RW6A 1G3SA 1VQPA 1UEBA 2BX6A 4JJCA 4KULA 4NCGB 2R7XA 3GU0A 2KE9A 3WC0A 4LRBA 3PYDA 2MLZA 2ROPA 1RISA 5HLFA 4ZJQA 3Q8QB 3ZFVA 3JQKA 4DL4A 4O4GB 1WC4A 1Q81U 1VGYA 2R9LA 4WTYA 3M7VA 5J1PA 3SWNB 3QGHA 2QQSA 1KD1T 3KDOA 2XU8A 2MLXA 5CABA 2YKOA 1QAYA 3TJ8A 1ZTWA 4C92D 2GAHC 3KJVA 2ZPBB 3FBEA 1D9AA 2YKMA 4PG8A 4PNOA 1ZPWX 1YRUA 4FL6A 3NCPA 5LM7E 1QWEA 5GAN7 2RT3A 4BI8B 1HJDA 4KBIA 1UEUA 1NK9A 1RT6A 3P49B 1LJOA 1O5JA 4QR2A 5KT5A 3JCMP 1EQMA 2AHJB 1HL6A 4IDKB 4NYPA 3ENQA 4DOVA 4D3GA 3GV7B 1SPBP 4HT5A 4EIKA 1XQHA 1T9UA 4GO5X 3P8DA 2A36A 1T9TA 4AE5A 2ADCA 4DEYA 2OFHX 5CVIA 4NMLA 2EWHA 2R7TA 1CJTB 3LQVA 4ZP8A 1K0TA 3PIPQ 3ISZA 5F8MA 5I3UA 3EG3A 2IMOA 3PYGA 5LMNF 3OPKA 3NS5A 1X9SA 2VBWA 3O1LA 4QIWD 1RBOB 4IKFA 1F9EB 4MZMA 1B07A 2RQ4A 3HXMA 3NHNA 2R7RA 3CNQP 4MKYA 4PZVA 4NYZA 1IBMF 2AZ3A 3EXYA 4P2FA 2J9DE 3MHYA 1QDUB 4PR6A 2IRUA 3U27A 3Q24A 2RSQA 2V2KA 4Q2LA 1DFDA 1I4K1 3PEJA 3QFHA 1NJIU 3MCOA 4X4RA 4TN2A 1FNMA 2QO3A 1BMQB 1MW7A 4QT7A 1HMVB 3V7CA 4A8QA 4P2MA 1VQPQ 3OFEA 2NUPA 4IFVB 1YQHA 1UW4A 5A76A 4I2QB 1YZ6A 3D3BJ 4M78F 4I7FA 3HJVA 3QNWB 2KXNB 1BCMA 4A8MP 2CXEA 1FMWA 1HR0J 2WACA 2HVZA 3GIBA 2V9WA 4JUVA 1D3BB 1S1WA 1TMMA 2RE1A 3IR5B 4O3SA 1XNRJ 3BS9A 1UVLA 2X51A 4CCHA 1WG1A 3W2VA 2ENMA 1S9GB 4HACB 3TI0A 3KK1A 1TXQA 2FZKB 1UGQB 2RI3A 3AA8A 2COZA 4MK8A 2BOPA 1WFWA 2HBRB 3CJ8A 2UP1A 1T0JA 4LF9J 3BQ1A 3K7RA 1DQ8A 1RWOB 2P0PA 3LH5A 1Q4RA 3SFGA 3CD7A 4GLMA 4M7DG 2VD3A 4L75A 3GONA 3HLUA 1M90U 1BWEA 1NPRA 4EYHB 4XTVA 4JV2A 5LJ5d 4I6AA 3CJQA 4J9CA 4URSA 3NOGA 3AQOA 4DWIA 2CPFA 3A8JA 2EGCA 1UTAA 1RU2A 3DYAB 1OOTA 2E12A 4KT0C 3ZZTA 3K2YA 2XLIA 3OYHA 4QR1A 2UUAJ 2HQHA 3CC7A 2EXUA 3CCMT 1KQ2A 4O3NA 1U8SA 5K14B 1J27A 5MLCV 3FKBA 4GC6A 4G3IA 2HEQA 1GK8A 5KG7A 3T1AA 4RKUE 1H0HB 1TH7A 1S72Q 1JLQA 1RWVB 2M0GB 5DDPC 5ETTA 3CCRS 2H3JA 3ME9A 5KT4A 2GCFA 1M27C 4F4WA 1VQNS 1CJUA 2G1DA 2RQMA 2MQPA 1O0PA 5IXUA 4J6YA 3WX4A 4DV6F 3CCJT 2OEMA 3KUEA 3WHIA 2FO0A 2KY9A 2CJQA 2A2DA 3AB4B 4F2RA 2KJVA 3W5XA 4URGA 4M5GA 5K9FA 2JWNA 4WFZA 4PXEA 2YNGA 3P45B 4LFCF 4PLIA 3L1AA 3C0CA 1Y0MA 4K0KF 4F0HA 1JLCA 4HVZA 1UFWA 3CPWS 2BW7A 4LUDA 3E9GA 1RWNB 2ZM6J 1HD0A 2FQQB 4JI5F 2M0YA 3LW5C 3QIPB 1HQ2A 3CSKA 5DY9A 2E70A 2RMLA 1KFSA 4ETZA 3O8WA 1J5OA 4OX9J 2VHGA 3CCJS 1W6XA 4J9GA 5IT0A 1H7WA 2QYGA 3T19A 2ATLA 2HHTA 2HZYA 2JMAA 5D3GB 3DM2B 4M78E 2MMPA 5ECAA 2O01C 3M2UB 4NPOA 3QKJA 4RR5A 1T05B 4Z8AA 2VC0A 5JMNA 5F8JA 3CCUA 3PR4A 5CD4A 4DR5F 5KG2A 4CM0A 4DF8A 3DU5A 2HRYA 1GTHA 1RTHB 3RW6A 3N01A 1R77A 5CZVA 3IM8A 5CYQB 2DTIA 3BPDA 3GZ7A 2DB1A 2ZE2A 1AVZC 4PJOB 3DLHA 1QLNA 1TL1A 4P74A 4CTAB 3M2VB 2RHYA 5KG4A 4ECZA 5KG3A 1JKHA 2Z0GA 3HFOA 3TNVA 2CQ1A 1WI6A 1T95A 1OV3A 1GCQA 2BJ7A 3OSNA 2UVRA 4DV2F 3AFGA 2VIHA 4RW7A 3Q1JA 2EPDA 2XO6A 1VUBA 1VQ4T 5GAOr 5GMKi 5ADZA 2B4OA 4ZPBA 6FD1A 4C92G 2FRWA 4LSZB 1UPPA 2VU5A 3DOMA 4OI6A 3R5AA 2UXDJ 3OW2S 3FRNA 4F14A 2BKOA 3BR8A 4ZP6A 5FU7C 3HM9A 1H38A 2RRBA 2EIFA 1Y96A 5A0GA 2M9KA 1CPZA 3Q23A 2GQQA 4RUCA 1QVPA 2K8GA 2D41A 4ED4A 2Q6BA 1T11A 1CC7A 3BZQA 2WTFA 2UZAA 3KG4A 1QVFP 2FJBB 5KFJA 3BEGB 1VQ4S 1Q82R 4KH0B 3PCOB 2R8JA 2XMAA 1ZA1B 1BWVA 3ZZZA 2RQRA 3C2PA 3M1VA 2XI3A 3TZWA 2K57A 2LFVA 2OEKA 1NPKA 2A37A 4QWBA 3QAUA 4NLYA 2FVUA 4EPCA 3SEOA 4I69A 3I5RA 4AG2C 1YGYA 3UDVA 2RJEA 3PNWC 1BB9A 2RHQB 2Q3PA 3H5YA 3BH7B 3PJXA 4QR0A 1WYXA 3N0VA 4IRCA 4F36A 1E7OA 1S1UB 3MP8A 1AUDA 1HNWJ 2JRSA 2M16A 3R6NA 4ZVSB 1C4AA 2WONA 3MPYA 4XK8E 2YKPA 3TW0A 2MYSA 1XMQF 2QK0A 3GSIA 2P6TA 2DAQA 4MFBA 5KYWB 2W9CA 4ED1A 4CYUA 5K8PA 4Q0BA 2HYIB 2RKIB 1HWKA 4DPXA 3I5CA 3QT6A 3CO0P 2VPWB 1M2VA 4A4GA 2DHXA 4P71A 3BSOA 1R8OB 2D1XA 2XGQA 1LOUA 1S4FA 3S3MA 2RH2A 1QTNB 3THTA 1VMBA 1FWKA 3GG0A 3HVTA 4FIBA 4RG8A 4LIWA 4JYAJ 1O9SA 2XEXA 1H6KX 3Q8RB 3RBBB 4WF2A 3HSZA 1NKEA 2V8JA 3BE3A 5HMXA 5DS7A 3D6TB 2QMWA 1PC4A 4JJBA 4RNOA 3KTQA 4PXBA 1MN9A 3OS1A 3VUZA 3B54A 4DFJA 2NUTB 5T7LA 3META 4M75F 5GAN8 3KLFB 5EC7A 4O3OA 5FDLA 3R1HA 4PWDB 1JWWA 3CC4T 3J7A1 2K5IA 2P0KA 3W7BA 4LQ3A 4USUA 1JLAA 2ZH3A 1JJ2A 2DMOA 4FXVA 1S6QB 3QJJA 1QSLA 5HROA 1VQ5S 2HURA 2HCKA 1K44A 4Q8FA 2ATCB 3PGGA 2J5AA 2NLWA 4ZP9A 3CCWA 5LJ3e 1LKZA 4OYZA 3K0JA 5J1NA 4G65A 4O4RA 2H8HA 5L1LA 4DSKA 3M8YA 2EKYA 4C0DC 1XWLA 3JB9G 4OI3A 1SI9A 3KLGA 4G1QB 1X6BA 2F8HA 5AE1A 4U7CA 1M1KR 1YBTA 1P8GA 2OUGA 2CIMA 3C94A 3I5AA 3CMAS 4K4SA 5LJ5e 3MI7X 5FU6B 3I32A 2HDAA 1SQGA 1UAWA 4M77C 3TYTA 2UU9F 5E3PA 5D15A 2AKWB 2DVJA 3CC4S 4ECUA 3H5XA 2XMWA 3CVKA 4MIBA 3P8HA 1HD3A 3AT1B 2ZHOA 3QT7A 3PW0A 2W8KA 2L5QA 3UW1A 2DIUA 5D8HB 1LNXA 4F7UG 4FYVB 1JXEA 1NZ8A 3P6YC 1HNXF 1TAUA 3V8KA 2IIMA 1P1TA 3H8ZA 2NQPA 4OL8A 1PJ7A 1IKYA 2YNIA 4B02A 3NCRA 3FIFA 4P10A 2KM8B 4X2BA 1Q1KA 2F65A 1KSPA 1LCKA 2XMJA 2N4DA 3D1HA 5KE2A 1U1SA 4FYXB 5CCAA 4OMMA 2DIVA 1IB8A 1KONA 5AT1B 1ZSZB 4A8WA 2H5JB 3K5LA 4KY3A 4C92A 5CAIA 3FJ2A 3DLLQ 1H3HA 4ECSA 2RB6A 3E01B 2GGPB 3BGLA 3GCWP 2V68A 5D78A 3DN9A 1IQZA 2ZDOA 4IG0B 3VS5A 2CQHA 1K8AR 2F4VF 1M3CA 2LT4A 8RUCA 3MM8B 4Q44A 3DLBA 4OB1B 3S7RA 2XGPA 3A8GB 2ZOMA 1VK3A 3PMTA 2OELA 2IJNA 2KVQE 5LOQA 2MAMA 4ZVQB 1GBQA 4USVA 3O44A 4F3MA 4IH5A 4PYAA 5L9NA 2QLJB 1NDCA 2DBMA 2FJVA 5FIIA 4K4YA 3UFCX 3OYAA 3T1HF 1IKWB 5A2QY 4YR3A 5K8NA 4HVVA 5J2MA 5KFAA 4X4PA 3ULHA 4ESRA 3EZUA 2O01E 1BBZA 3FSXA 1VQMT 3LTOA 5DG7A 2VGNA 1FX4A 1IWAA 1MMNA 4WKRA 2XIDA 3HKWA 1EETA 4B9MA 4F3OA 1RUSA 3M8PB 2LDYA 2VH7A 2HMIB 3ILLA 3VAMA 1O51A 1RCXB 3QWYA 4ZCKA 3KYLA 1RAJA 2BUNA 1R0AB 4ELTA 3KLEA 2V50A 4AUKA 1Q16B 3GG1A 2YX7A 3NS7B 2BOAA 2K7KA 4MYTA 3HHNB 1QE1B 1KHWA 3O8VA 4WPAA 2YNFA 5JXSA 2GMHA 2B56A 2BRLA 4B9TA 1Q0NA 4ED6A 4E8UA 4KBMB 3M6WA 1U6ZA 3K89A 3ZC4A 1FEEA 2A1BA 1X5TA 3EFRA 4FBUA 3BKUA 4IRDA 1R8AA 3TU4K 5GANe 1VQ6A 3CC2S 1FK9B 1RADB 1A7GE 1WXUA 4JBCA 2KEAA 2R2TA 1ZQ1A 5A6WA 2XZTB 4LR7A 5I2MA 2HHUA 1LW0A 4N76A 3C16B 3MPWA 1GEHA 2LECA 5BYQA 3Q2TC 3MEDB 4C8MA 3W8PA 5AXNA 2XYHB 5IFMA 1S77D 2H5IB 1VQLQ 2W2OP 4BDYA 1NDPA 2AZSA 2HNYA 1PJ6A 2W8LA 1YITT 4E2FB 1BXNA 2EBEA 4E0DA 4WXOA 3OBWA 3MZIA 2VUGA 3TP2A 3J81j 4ATOA 1KFZA 1YWOA 4UC4A 1WHXA 3VU3C 2IBKA 4ED5A 3VGSA 2ROEA 4RTXA 3IAS9 3W2WA 1NDLA 4M78B 4YEAA 2DK2A 2YUOA 4M77F 4OYOA 1NKCA 4RCBA 4LF1A 3W8GA 2LTOA 2HFUA 1OU9A 1PCAA 3WVDB 3A8MB 3M56A 1VBYA 4ALZA 1J2VA 2IDLA 1G3TA 4XTUA 3CCVT 2H51B 2RHXA 2EW9A 4ZIWA 4QW2A 3PRDA 1VQ9Q 2VG5B 4M7AD 4WFAQ 4OZ1A 1DURA 3DNCA 1W4SA 3X26B 1OPKA 1TUVA 4LD6A 3MEGA 3OR2A 3L9ZA 2ZJRQ 3QZ5B 2R8KA 4X34A 3POTA 1S9EB 4AQYF 4FT4A 3DLGA 2L3PA 2MGZB 2DVEA 2WVDA 2WVBA 2YTCA 4DV4F 4X4SA 3CTRA 1NZ9A 4DQRA 1OZ2A 1T02A 3I0RA 2A2CA 3F73A 4YY3J 4C5HA 4IOAQ 2GTOA 4UUXA 2KXDA 1X2KA 4YFUA 1VQ6Q 3KNGA 3UCGA 4ZOSA 3MXHP 2LRQA 3QATA 1M5KC 2JHEA 3CCVS 3HX9A 4PFZA 2FVPA 3AHUA 3HZGA 4F7UA 4PQUB 2G9OA 1EP4A 4NLOA 3SCJE 2CUDA 3VAFA 5HJYA 3T1YF 2BJ8A 3O6QA 3OYLA 4YDDB 1AEYA 1M8VA 4NL3A 3NMZC 2D69A 4EZ9A 4QJVA 1TSFA 3UN3A 2ALYB 5HROB 1VRUA 1FDBA 3RZAA 2CQ3A 3IP0A 3IBFB 3R9LA 2C2KB 2JM9A 1CG2A 1N6QB 2BABA 4KO0A 3QIIA 1VJWA 2WAQD 5GMEA 2HIQA 3BQ0A 4Z89A 1M8MA 4UOHA 2B4VA 4RLEA 1TS9A 3TQEA 3EZOA 2XDPA 2LXUA 5IQQA 5LSOA 3ZZYA 4AG1C 1VC6A 2QEXS 4C8QB 4NOHA 5GMKl 1Q86R 1H3ZA 3PM9A 3OYJA 2YY3A 4Y2AA 2V0NA 5B0AA 4L3KA 2I5JA 4XQ3A 1Q81R 3V6DB 2JNGA 4X9DA 3OTEA 3C6UA 3NGPA 4I2PA 1T8EA 3NMRA 4ATNA 1R6YA 1JBMA 4ZHRA 2HS3A 2H4WB 4MK7A 2DJQA 1I6JA 4BS2A 3U1MA 3RRKA 2FPEA 4BE1A 4OHYA 4DV0F 2F1FA 1QCNA 4V19J 4DLEA 4F04B 5E3AA 5LJ5h 5KG5A 2J6FA 2J9CA 3IWXA 5L23A 2AZVA 3UDEA 4CLYA 4Z88A 3ZNUA 4KIAA 1ZHIA 1ZUKA 4HHHA 4NX9A 1IUJA 5HK4A 3RTVA 2FLOA 2EC2A 2CH4W 3WZ0A 3SSQA 4LF7J 4OI2A 4OYWA 2XM3A 5D77A 2R58A 2MZSA 1ZAXA 5KFLA 2R8GA 1KR4A 5KOXA 1LWFB 1N8RC 3VS7A 3KHGA 4OX7A 2QN6B 2L89A 4ZCLA 1SKRA 4FCYA 4P6QA 2UXCJ 3I4HX 2E7VA 4O23A 3NRBA 1W2BP 2RHUA 4MJKA 2GFUA 4NLRA 4IUQA 1S0MA 2BKPA 3M6UA 2K6DA 4J7FA 1NJIR 2JXBA 4PPDA 2QA4G 1CJKA 1YP5A 3AJ2A 2PD1A 1SJ4P 3PJ9A 3LGLA 4ERDA 1S49A 3NGRA 1Q82C 3UDLA 2VGMA 1KJWA 2EFPA 1ZM2A 2PMWA 5GMKa 3JCMJ 4DR3J 3D67A 3KBGA 1P9QC 1WJ9A 3OQ2A 2CT4A 4WZMA 1K1ZA 1HBMA 4PCQA 5B09A 1QSSA 3MUMP 3UPUA 4BE2A 2XMFA 4Z37A 4X66J 4EMKA 1YHQA 4NXNJ 4DSLA 1XJWB 3OFHA 2J8SA 4A63B 4R5PA 3JSCA 1UWBB 3G4SQ 1UJYA 4DN0A 3ZZOA 3KLHA 2OAUA 2MKCA 3FDSA 3JCMg 3G71T 2EK1A 4DPWA 1M90R 1S99A 1M5VC 5FROA 3DOKB 2GHPA 2CYZB 2HSPA 4CRJA 2FC9A 4RX6A 3FSYA 1P9YA 4FBTA 1IBLJ 5HMZA 1VDHA 1FRLA 1UHFA 3CPFA 2CADA 4YHHF 1HPZA 3PTWA 1W25A 3TUJC 4TLQA 2DR5A 4ID8A 4P75A 2HBZB 3NS6A 5D6WA 1LWCA 3BYRA 1Q82T 2DXFA 2X1BA 3L7UA 1XNIA 1B3TA 1TL5A 1FRXA 3H6ZA 5FWBA 5KTQA 4J9RA 2KO1A 5B0DA 3EPGA 2ROTA 4E6RA 4G1IA 2RQWA 2C2NA 3MM5B 1V29B 5AXLA 2X1AA 1JLFB 1S72T 3G71S 2L2PA 2DXEA 1SJ1A 3CCLA 3RAQA 4NRTA 2ZPGB 1MWQA 1PRLC 2AP6A 2HSEB 1TL7B 3N5BB 2VODA 2CQBA 2BKDN 3TANA 3ZFJA 3LF0A 5KOWA 5DM7R 2JLGA 2XLJA 3DXSX 1XEZA 3V2UC 4OJ1A 5EUHA 2PVDB 2B5JB 3RU0A 4DR4J 1WHKA 5KYUA 5GAOq 4EI2A 4ZCMA 1YHQQ 2D3OR 1VHFA 2WSEC 3PO4A 2B9XA 4XU1A 3VYGA 2VC8A 3AOAA 2DHGA 5EDWA 1ACMB 2ROGA 4C3LA 2NXCA 2FHDA 1NRKA 2LQWA 3PX6A 2X4YA 2VDHA 3BN4A 3VAHA 1PD1A 3OSSC 4JPBW 1M1KC 4LNPA 2NPFA 4JZ4A 3MMAA 3OR2B 1F0XA 3G8TA 1RT7B 1V6HA 4Y0FA 1E6VB 4M75D 4RNNA 1KEKA 4B3TJ 4J7IA 2D6FA 5I2SA 2CPDA 2IC3B 4P9SA 3KK2B 4CC7A 1N27A 1VC0A 2APOA 4NI2A 5B0FA 1SQEA 1UEVA 2J9DA 2N7CA 3FCWA 3A8KA 4DR6F 3SFMA 5C2GA 1QCFA 4JI7F 4H4OB 2BEFA 1CJVB 2XKOC 3HFVA 2K4YA 4TQRA 4XU0A 3CJ0A 4HI1A 4WF9Q 1IQTA 2KI2A 2JC0A 3EFSA 1JXOA 4B3OA 1X9MA 3H4DA 1D8ZA 2J06A 3OL6A 2VDIA 1K73C 4LSNB 3H7HB 2VJVA 3CCLQ 3RB4A 4M5NA 2MQQA 1N32J 4K2XA 2AJ2A 1U06A 4AMCA 4R55A 1NKBA 3DRSA 1W2BA 4ES2A 2YRVA 2NS1B 1M1KT 2LEAA 5FU7B 1YKWA 2ZZNA 3CJ4A 2ESWA 4F02A 2CWXA 2HAIA 3FBCA 3S01A 2OX7A 4JI0F 4B9SA 2YDLA 2HVHA 5DQGA 1DQ9A 2GGRA 2F2XA 2C2RA 5GMDA 4FF4A 3KDNA 1EKRA 3QJLA 1XQIA 2QQ9A 4QIGA 4KHMA 3VQSA 3PVXA 1RAEB 4GO7X 4OLPA 2BQRA 4RUAA 3CEDA 1KQSA 1VQ8S 2QA4A 3QRRA 3OTBA 3BB5A 2P4RA 3CCQT 5C25A 1WC1A 3PR5B 3MUVP 2UUBF 2R7WA 2JLEA 4X4VA 7FDRA 1H72C 5IM0B 4DZ6A 5DRKA 2KRMA 2E5QA 4E47A 2F1LA 5IXFA 2OPPA 5CKEA 4KFBA 2FG0A 2B6AA 3K58A 1HWIA 4DV5F 2O1PA 3M4YA 3IGNA 4B9NA 2MHNA 1CEZA 1BQNA 1N5YA 1URNA 4R0JA 1NUEA 2G4BA 4EU0A 4ID5A 1LOJA 3EVOA 1HI8A 4PEOA 1MU2A 1EZZB 4I6WA 2MIOA 4ECWA 3FGVA 3QRPA 3FSIA 2HFOA 4OJ3A 3HP9A 1PGZA 3AH6A 1WHGA 1M1GA 5KCHA 1FWZA 3CCQS 3CJRA 3KKFA 3OS5A 5CAAA 1K8AT 4PJMA 2XWYA 3I0SA 3BDEA 5H1SV 2UUTA 3KG1A 4HCKA 1LNQA 2QZ8A 2KHCA 3BV8A 1UUEA 2QE5A 2AIRB 1YIJT 3HFNA 2I38A 5L46A 1FJGJ 1K47A 3L2WA 2JOQA 3OBIA 2VC1A 2HD0A 2VQFJ 3FEYB 1Q53A 2OO4A 4DR7F 2BQUA 4A4HA 1UGSB 5LMUF 4OZNA 1U2FA 2OD6A 1KC8U 3DU6A 5A2QU 2DYIA 1TR0A 4FDFA 1MNDA 5FLXE 2BIVA 1E6YB 1NZAA 3MM6A 1LPLA 2J0WA 2RS8A 4E7HA 1R89A 1SV5A 2YQ1A 3MEWA 1SUQA 2GZOA 2QA4Q 2KDSA 4BUGA 1DJ0A 4HH1A 1MWYA 1ZPVA 3J7YI 1GFWB 2GC8A 2ILYA 3JSMB 3MP1A 3ADAC 2KT5A 3TRGA 1YIJS 1N34F 3NXZA 2IFXA 2HHHJ 1UVMA 2GS8A 1U4BA 4HTJA 2AHOB 1IBCB 4DCPB 3H0IA 3EXCX 1U0HB 1M5HA 3BW1A 1CULA 2G1HA 4Y00A 1HI0P 2QGFB 2H1YA 1RAAB 3H5SA 1WTBA 3EG1A 4C0DB 5T14A 2MZ1A 1N5TA 1C0TA 2L48A 3JXOA 2IAJB 3KFWX 2U2FA 5K8MA 3CCST 1GTEA 3NL0A 4P2XA 2DLPA 3CXCP 1TL4A 4C4WA 4OI0A 1LWEA 2C2MB 4CO5A 3U7JA 2C42A 2FJWA 4KB7A 3MMBA 3HT0A 3C15B 4K5SA 4ICLB 4IUPA 5I3QA 3CCZA 3C3LA 1U6FA 2BRKA 4KKOA 1U1RA 4P52A 4YB7A 1ZS6A 2XY5A 4M77D 1RYRA 2DERA 3JCMX 2DXCA 3OXLA 2L8DA 1KVJA 4EK2A 3CJ2A 3DMJA 2XULA 2J0SD 2OSRA 2KYZA 1TK8A 1KLMA 4M75G 3CCSS 1DY3A 2GVDA 2QYZA 1VYTA 1RA6A 1T0TV 4M5HA 4UQTA 4J9QA 2C3MA 3G9CA 5GAGI 1NPPA 2ZPEB 4WBFA 1PYTA 2DL8A 5GAHU 3PMIA 3ISNC 3GJRB 4JDSA 1DZ5A 3PW4A 1OI1A 7AT1B 3CQTA 3HRSA 1GX6A 5A8KA 1BE4A 4M5DA 3MURP 1ZOTA 2LLZA 1Q86C 4HKEA 3SFUA 1SRMA 3J7AN 2X4JA 2CP3A 4KV8A 4EBDA 4U96A 1Q81C 5E7OB 1PSFA 4DX8H 3DCAA 1OEBA 3MEEA 4OHXA 2VBZA 3LUYA 1VA7A 4DZDA 3D0HE 2W4DA 2WSEE 2DEQA 1WEXA 3V6HA 1HR0F 1NB2A 4LF4J 5GMKe 5KFHA 3M8RA 1NO8A 5LJ3Y 2LU1A 3MCAB 5AYFA 1TVRA 4O5VA 4KH1B 2OTLT 4L59A 1FJEB 4FSSA 4CP5A 1XNRF 2VF3A 3BGOP 1VRTB 2JOYA 3SWNC 4KQZA 4A8YA 4RO0A 2DTHA 1J3TA 2HK3A 2KT1A 3DLEB 1WIEA 1NSAA 5BR8J 3OHBA 2HFSA 5LJ5Y 2CSQA 3CDUA 4LF9F 3VVUA 1HBUA 2G0CA 1U1PA 4ZDNA 5KYXA 3HTRA 3J7ZT 4EMGA 1C1BB 4K4ZA 4MH8A 1U1TA 4ELYC 3QWXX 3D6FB 5CKBA 1EIFA 2O5DA 4ZPAA 2KXHA 3OR1B 2YLBA 1VIEA 1SB6A 3M8SA 2FB0A 1Q86T 2B9WA 1GNKA 2UUAF 3RKWA 2OTLS 3ZO7A 4LBPA 4Q8EA 3H25A 1Q81T 4LRFA 3CPWA 3M53A 3CCMA 2Q79A 4GKKJ 4HVUA 5CR2A 1NJIC 4L3NA 4NEYA 1PSEA 2KG0A 2BW2A 1YG0A 3P96A 4MT1A 3AD7C 2E65A 4FVCA 4KHPJ 1WOSA 4YP3A 3S8SA 5GMKm 4OHVA 2MK5A 3NG8A 2E44A 4WKYA 3Q8PB 1HYSA 4PABA 3CCJA 2L9WA 2FVQA 5C24A 4ETXA 1MNEA 2LQNA 2MI6A 1HNVA 3AXKA 4Y2CA 1W2IA 3BY7A 1OSDA 2KYBA 2XS5A 4MIAA 5ETSA 2DHSA 5HAOA 1GL5A 3FUYA 1G3OA 1YJ9T 2WOMA 4GKJJ 2Y3YA 1Q5YA 1T94A 2OJ2A 1APSA 4PJJA 5M2RA 4IFYB 3DDNA 4ZJLA 3PX0A 1VQLT 4WK3A 1RWPB 2XY7A 2ZM6F 1HFEL 4XTWA 5LJ3g 1NK5A 5FJ4A 4L73A 1ZM9A 3B78A 3V8LA 2IVWA 2FYKA 3G82B 3KK3A 2D7SA 2B8PA 1M90C 3W64A 1F60B 1LV5A 4OX9F 2I0XA 2P6SA 2SXLA 1VQNQ 4NLVA 2FLLA 4RBUA 2RUGA 5I3PA 1WHWA 4C3MA 2HRUA 1WD6A 2GVZA 5EX3A 1UA1A 2ZD1B 5J2QB 5A8RA 3DGPA 3CXCA 4I56A 3OYGA 2KRBA 2E10A 2MXYA 1YJ9S 1L3UA 4DQSA 5E33A 3TVYA 2BQ3A 1VQ9T 3OW2A 4U6PA 1Y57A 1U1NA 3SYZA 1RHUB 2LC4A 2MZJA 3VS1A 4FZVA 1QLYA 1XOVA 3JB9k 1C1CB 4RW9A 2DJZA 4EDUA 3RESA 2P5VA 1R8CA 2DH7A 2Y8YA 2E3HA 2OPQA 1HBOB 4NA3A 3A3OB 3J81E 5U47A 2DY1A 3IQLA 2OPRA 3CCJQ 1VQ4A 1S57A 4XAKA 5AJ3J 4M7AB 1QUPA 1FXXA 3JB9I 2J7UA 3D7SB 3NOCA 4RUHA 2KR3A 1XC9A 2J9EA 3K5NA 1M5Q1 1NK0A 1HQEA 3DRRA 1M90T 3Q0AA 4JV5J 4M75A 2UXDF 1B0TA 1SHFA 5IZHA 1GMWD 1WZOA 4OP0A 4F26A 2E1HA 4ZVRB 1RT1A 3EX7B 4RUGA 2D0QB 4J9VA 2HQ3A 2Z2MA 4M77G 5D0RA 4JI2J 5IOLA 1X31C 1FTRA 3Q8SB 2BE7D 2OPSA 1MN7A 3IS9A 3GCXP 5DG8A 5KFVA 1YBUA 2W4PA 5H9EK 3DI6A 4QPTA 3GB0A 4B08A 3HFZB 2V34A 3MAAA 4ZGDB 2MKYA 4CH1A 4RNFA 1A9NB 3FC9A 1R0BG 4OMLA 4G1PA 3NGTA 2EI5A 3OUYB 3UA6A 2FLPA 4J90A 3MEKA 2O9SA 3ZTSA 3NGKA 5G0RB 1HK9A 1IWGA 1KD1U 2HQGA 3CDBA 2N3OA 3A4TA 2P9EA 4GVBB 3QHSA 5F8HA 1FJ7A 5KG6A 3VHQA 5BJRA 1U5SA 5KH6A 2LA6A 3VAKA 4DR1J 1EARA 2DRKA 3IC1A 1EHWA 2DNLA 1HNWF 2ZUGA 2LX7A 3JS9A 4PFOA 5DZ6A 4QKUA 1XN9A 3ICLA 4LF6J 2K9GA 2U1AA 2E7WA 4PJOC 2DIQA 2ZJQQ 4GRSA 3ENAA 2QV6A 4OYIA 4F4KA 1U47A 3OJSA 1VQ4Q 1RAHB 2KVIA 3OYEA 2V2VA 2MQMA 2DX1A 1N36J 3X1LB 3BGRA 1D0EA 2GMJA 1IZ6A 3RNJA 1UGPB 1WJRA 5GANg 3DRPA 2MKHA 2Z56B 2WW4A 3G6ET 4JYAF 1S1TB 3M54A 4XAXB 3GV5B 3QWPA 3T5LA 3BREA 2YBVA 5DO2A 1Y9OA 3U1NA 2QTVA 1YK9A 1C2PA 1RLPC 2COYA 3A1PA 1WHVA 2M1HA 2YSQA 2ERRA 4KGXB 4Y92A 4YTLA 1WC5A 5E3QA 5HI7A 1XTDA 3OSVA 4PG6A 3GP8A 1N52B 2BBEA 4NLGA 3MMCB 1QVFR 4LIRA 4K4WA 3CC4A 2D1CA 3M0TA 4DQIA 1S5ZA 1QM9A 5GMKh 4QBUA 2LQ5A 5HP1A 3QO9B 3G6ES 3V6JA 2QLBB 2Y90A 5A0YB 1D09B 5HJXA 3UVJB 4CZCA 2HL5C 1DTTA 2ZWOA 2G6FX 3D1OA 1RABB 2FGOA 4OMQA 3CB4A 3G4ST 5RUBA 2FVRA 1OY8A 2OKQA 2EPIA 2V1QA 3C14A 2E5IA 4EEYA 1AWJA 5GAMj 3GWCA 4C0FA 4URQU 1UVIA 3SMZA 1VLOA 2K3KA 1L5UA 5IT4A 4ELZC 5H9FK 1ICEB 3JCMd 3ILJA 1B34B 1TKZA 2LCWA 2HG4A 5THWA 2QI2A 5KG1A 1UW9A 1RA7A 4WZQA 2R7OA 3R27A 1VQKT 4L76A 1HIYA 4R0EA 2UXBJ 1VJQA 3LP2A 2D3ZA 2KNBB 4LBIA 5E2QA 1QVGS 5A8WB 1VQ5Q 2K1RA 4QIEA 4OMFB 2A08A 4I68A 4WFYA 3H8YA 2GF7A 5CKDA 2DGTA 3NEKA 4RW4B 1WEYA 2DR9A 4XU3A 3FDRA 2EYXA 3ZBDA 4DFKA 1VYVA 4FNHA 4YB5A 3TVZA 3OB9A 1G3WA 2M2BA 3OXGA 1VRQC 4F17A 3H90A 4RG2A 4ME7A 2RHIA 2GNCA 3MP6A 2NPIA 1RWMB 3CMAQ 5CZXA 1TKTA 2Y8WA 2LJ0A 5HVGA 3LP1B 4CM2A 4F4YA 5IT9U 1DLOB 1WNLA 1QSYA 3MPVA 3CC4Q 1Q78A 4DL7A 1VQKS 1AT1B 4Y2IA 3J80U 2SRCA 3FJ5A 2CUBA 5CD4H 2VASA 2IYGA 2XC9A 2V26A 4N4HA 4M77A 2O3DA 4YS2A 3ENWA 3RBDA 5GAHI 4RWXA 3HHTB 1MGQA 1RK8A 1JU5C 2AX0A 3RAXA 2QQBA 4YB1P 3VJPA 3Q89A 3DLKB 2W25A 1NJZA 3RDVA 1SKUB 1HBNB 3K57A 2R2UA 2UUWA 3L42A 3MPUB 4FU6A 2E41A 1IBKJ 4ZKAA 2IVMA 4B17A 4PJOF 3D6HB 4BI4A 3H2LA 1IKXB 2HQDA 2PZ1A 1TL3A 3UQSA 1VQMA 1B70B 5ETPA 3MECB 1R7IA 1FFGB 5I42B 4C8YA 3X20B 1AZSB 1P92A 5CQGA 5FU6C 4OIXA 1GXTA 4I67A 4HLBA 4CLLA 1JO8A 5KFDA 3ITHB 1MMGA 4C11B 2QTWA 4ES1A 1FKOA 3GQCA 3OV7A 4ZVTB 4CDIA 2PA3A 1RTDA 1UETA 1RT2B 5DDRC 4PQAA 4DSJA 1VS3A 4LUBA 2XZWA 2IM1A 3IRXB 3A3PB 1ZA2B 3CJ5A 4FPRA 3T5KA 1RU1A 4NZ6A 2HHSA 1QVGP 5HBMA 3QFWA 4DV3J 2AU0A 3HRUA 4ILMA 2Z30B 1EQ0A 2W01A 3DOLB 4J9BA 1KQ1A 3EGXB 3LP0B 2HBPA 2MZRA 5CYMA 5AXMA 2CRLA 4BY6B 1X9WA 2Z57B 1XMOJ 2K7JA 2EQKA 1ZSZC 1RT4B 1OQ6A 2GW8A 4WE1A 5FLXY 5J2NA 4KHRA 2HVEA 1AB8A 4NL5A 4NZ0A 1X0PA 3JYTA 1YX2A 2ZH5A 2JLFA 4JV0A 1UECA 3BSAA 2BANA 2DGVA 2ZPFB 3BBFA 1DTQA 2CGHA 1D1BA 1NCLA 2E3IA 1YITA 5IWAJ 2RU3A 1MROB 4NWBA 4YOEA 2CH4A 1JMTA 2JVRA 1RTJB 2KL8A 2NXJA 1HARA 4TY9A 3CEYA 4GMKA 4O3QA 1RCOB 2KMTA 3N9UC 5HCKA 2WB1D 2VFTA 4N0AA 4OV1A 3VQTA 5L1IA 4CLFA 3AA9A 3SCKE 3MOJB 1G7CB 2D8HA 2JVVA 2F2VA 2YKAA 3CC2Q 2HQXA 1LWXA 2XS7A 2OI3A 1VFJA 3C6TA 2DNKA 3CCVA 2W1BA 2EEYA 1WC3A 2DNOA 3TX0A 2LEPA 1BC6A 4K4XA 4J9SA 3TZYA 2WSFC 3CC7S 2FLNA 1U2CA 4PAAA 1UFFA 4E7LA 1EKSA 1PYOB 2O4XB 5KFBA 4ILLA 4KAIA 3REAB 3GE9A 2QL9B 1RTIA 1V1CA 4PJOE 4Z02A 2CQCA 2LXIA 3VRYA 1CS4B 5J1EA 2NSBA 3VGVA 4NA2A 3RUBL 3H5UA 3DDKA 4QWEA 2ZGWA 2DISA 1SSFA 1PJ5A 4YY3F 1VR6A 3OYDA 5LT5A 3ZZUA 4RW8B 1G8XA 2VXEA 2EYQA 2LQKA 1KC8R 2ABLA 2XSFA 1W1FA 2L41A 5KFZA 4YDXA 2ED0A 1X01A 2QIFA 2ASLA 3MM7B 2ZNYA 4OI1A 1D0XA 1AWXA 5CQXA 2H65B 2AGPA 4PG5A 5HQMA 4DPTA 4TY8A 3IR7B 1WHYA 4HDGA 2X3GA 3W60A 4M7DD 2JZ5A 4TU8A 3HHLD 1Z9ZA 3V81B 2DGOA 3GJQB 4IIOA 2K2VA 6FDRA 4ZPVR 2HFZA 2YWWA 3MWBA 4QVZA 1C4CA 2KXFA 3K5OA 4USHA 2V4JB 3SQOP 1RHQB 3VYHB 3CCUS 2PEBA 2MKKA 2KFNA 1RAIB 2XMMA 2XSJA 1WWHA 5HY6A 1S1XB 1Z9QA 3G6YA 2RM4A 3OYKA 3LYIA 4OB0B 5GAOl 3AD9C 1WSRA 3CCVQ 1RI7A 1T9YA 5LJ3f 5KYYB 3FFIB 3CULA 1JXMA 2WCXA 1PC5A 4K5RA 4KGKA 5IV4A 1I0CA 2FPDA 2FJEB 2MZTA 4CLUA 1REVA 3GYXB 3JCMe 2F5GA 3RR8A 2PVOB 1GMWA 2OJ3A 3H20A 4LR9A 5LJ5f 2MQ8A 1SRLA 3QPHA 3KHLA 3HSGA 1F6TA 3GFXA 4HCCA 4LF7F 1YI2T 3FMBA 2QEXQ 1N88A 4LDYA 3C46A 4EWTA 2M0OA 4DS4A 3RGIA 2C2DA 2CPIA 4C7QA 1RT3A 5C42B 2GIQA 2RUSA 4NYOA 2DRMA 4OV6A 2G2OA 2A3JA 2YWGA 1M2OA 2UXCF 2AYBA 3UWTA 1M5SA 3F41A 1KDNA 4CO1A 4FS1A 1JRIA 5IHNA 4P72A 4B3MJ 5CHCB 1LVKA 2KI7A 1U1QA 1RBAA 3TAMB 2AJQA 4XPEA 4EBEA 1FMKA 1MHNA 2DKGA 3DLMA 2VVKA 2X9HA 3LWHA 3O2IA 1VQ7T 2DCUB 5DLGA 3LA0A 3G96A 2HKQB 3OS0A 2GJIA 2CJAA 1YI2S 3TUIC 2BDPA 2DKOB 2LDIA 4M4ZA 4DR3F 3M0QA 1F2GA 4HDHA 3M9MB 1PD0A 5F8NA 4DUZJ 4NLDA 1SJRA 4C8QC 2ACYA 3EM1A 3V4IB 2J6SA 3SD4A 4LSLA 2NREA 4X66F 1RKIA 4NXNF 1KS2A 1N56A 1O6XA 2KRRA 1UJ6A 2X3XD 2E1AA 3O5TB 2ZCFB 2E66A 2HQIA 3BDLA 2WHOA 1V9OA 3CJSA 1H73A 4OHZA 2KG1A 3JCMW 3MM9A 1R6VA 3VZHA 1GX5A 1VQ7S 1TV6A 3KOAA 3QZ7A 1FMVA 3G71A 1YCSB 4O44A 3RJMB 3LWLA 3EGUA 1RHRB 4XK8C 1Q8IA 4HHJA 1CQNA 1GQEA 1IBLF 3FMWA 2GBQA 4K4TA 2MSSA 2HQCA 3DLJA 4KPCA 3N79A 2YNHA 2ZVSA 4K7QA 4PG4A 1LK7A 5HATA 4ZS6A 2YX4A 2CP2A 1CC8A 4WE1B 5HSPA 2XD0A 1BY9A 1OWXA 2PE8A 3PFEA 4C92C 2A3LA 3HMJG 2BE2A 4L72B 2DD5A 2WVCA 3PXGa 4DQ2A 4J7CA 1R8PA 1NBEB 3UE2A 4JLIA 1W2BR 1G4CA 1IM6A 3KLIB 2IHR1 2EG1A 4DSFA 1S72A 3QLHA 4R8UA 2ZDPA 3V7SA 2K2MA 5D0HA 1M9SA 3BM7A 1RDRA 2JC1A 5D4OA 3UNGC 3GR1A 4Q5WA 4NE9C 2VG6A 5GANf 4OX8A 3OYNA 4Q5VA 4PRFA 2DA9A 5EWGA 2VG7A 3O5ZA 4F16A 3TEGA 3M2RB 1K76A 3JTOA 1B7TA 2VONA 4DR4F 2E4HA 4JJNK 1TKXA 3WBZA 1IKVA 3UN2A 4CO3A 4IUTA 4DPUA 5DGAA 3TZZA 1Q95G 4FNIA 5HL7Q 4ZVOB 2CZ0B 1HNXJ 1NEBA 1ARKA 5CKFA 2CP7A 2ASYA 1S0VA 3KUHA 4ED0A 4CQ1A 3BGFA 4BLGA 5F3TA 3NPFA 2IRYA 3TQ1A 3A3NB 2RS2A 5LJ3d 3ILIA 2MEWA 3G71Q 1NK6A 2CKWA 3CCRT 4O0IA 5MAOA 2RNAA 4B3TF 2NR0A 1VQNT 2IRXA 3TX8A 3CT9A 4DSEA 4KTQA 4J5OA 2R8HA 3HD1A 5GAN6 4TVAB 4IH7A 2E1CA 2P9GA 2K3IA 3RB6A 3F44A 3RUXA 1ZBTA 1D9DA 1FKAF 1E6HA 2ZITA 1R27B 3FB9A 1NSQA 2WSFE 1WF1A 3EUNA 4DBHA 2BZ8A 2YWHA 2VJUA 3IFEA 3KJNB 1KFDA 2OFGX 5C0MA 2NYIA 5L9XA 4B6MA 1VYUA 4J5YA 4RUBA 4DV7J 3EICA 4CC2A 2EGAA 3EG2A 2FD2A 3ET6B 3EH2A 1KSWA 1OIAA 2V8DA 4PXCA 3JCMV 2XHWA 1T03B 4PUOA 2YXLA 1QP2A 4HI2A 2HBYB 1N32F 3L2QA 1HQUB 2RHSB 3X25B 3AAWB 4J9HA 4XIUA 2XI2A 2M7SA 4ZPTR 3AJDA 2J7KA 1QQJA 4JI3J 1RT5A 1OS5A 4IG3A 1IR2A 1NSKL 1SQFA 2RF2B 5IH2A 3EFOB 3QBCA 2B51A 5HQ8A 2OEJA 3GV8B 3EGZA 5KFQA 3JB9D 2NCKL 1BQMB 1HNIA 4O0NA 3M32A 4DQPA 4KUIA 4I4BA 2CZVC 1U45A 5ETVA 3AOCA 2O88A 4X4NA 4C8QF 3M0PA 1RWKB 1QVFS 2K2PA 4ANDA 2WBRA 1NEGA 3M6XA 3B8HA 3OHAA 1SJ3P 2EAYA 2CYYA 1CVJA 5GAMe 2XDDA 1JJ2P 3CCQA 1Q8KA 2KGTA 2H4YB 1RGVA 2ZPHB 4CNZA 1Z2ZA 2PVGB 3CJKB 2MJUA 4A4FA 1VQOT 2J6TA 3EG9A 1IJFB 2G0IA 3MCMA 3M9QA 2B7BB 2VFUA 2MKSA 2HGLA 3D0IE 2HS4A 5E5NA 2A6OA 2YKNA 1OO0B 3A8HB 5CCMA 1TFYA 2OMLA 2CZ1B 2BJ9A 3OTDA 3GNGA 3AJ1A 3TOQA 1GXIE 4ZPDA 3IG1B 2DO0A 1ZUUA 4LFAJ 4C92F 3D54A 2V8HA 3QYHB 1VQ8Q 1WG4A 2GFAA 2HHWA 1SHGA 1KP6A 3SB2A 1TK5A 2YH1A 2RRNA 4ED2A 1VQOS 1AFJA 1U8WA 2HEKA 2RA2A 2Z2LA 3FC3A 5I4MA 1YIJA 3FZ2A 1FJGF 2KROA 3R6GB 2DPJA 4IR1A 2X7IA 2VQFF 3I5SA 1S0NA 5KCOA 3AODA 3IBCB 1WJSA 3R97A 2MWPA 5KT7A 1N8RR 1RL2A 3Q8UA 2QDYB 2N82B 3W65A 4RW6B 2W9BA 3CIZA 2B8QA 4BWMA 1HWUA 4X84A 2DR8A 1H92A 2Y1RI 2IG0A 5GANd 5EGYA 2DRDA 4J83A 5HLFB 4A53A 4CLSA 4DF4A 5DQIA 1NHKL 2MPUA 2IA6A 2HNZA 3JAMU 3CCQQ 1FKPA 5GAN3 4P7TA 3H59A 3X28B 4ECXA 3QDRB 5A0LA 3EHRA 2KTQA 4TYBA 2Z4PA 4OMNA 3MM9B 3KJVB 2YKMB 3CGIA 2FGCA 2HHHF 4BE0A 1TFWA 2YXYA 4NMXA 2AGQA 2JEFA 4RTUA 4FM4B 5DLOA 2HLUA 1RT6B 3OVAA 4RCCA 1L3TA 4C8QE 1JLEA 1X4HA 3JSBA 2B9YA 3A5ZB 2WSCC 1YCYA 2PEHA 3A8EA 4JI1J 2EKHA 3EGVA 1XIQA 2E5LJ 3RAMA 4F4AA 1QKWA 3M30A 3CCSA 3SXLA 4DS5A 5I3UB 1W7WA 3AHPA 3W5ZA 2LU2A 4W92B 5LL6S 3G8SA 3OTOJ 2M70A 4PWWA 4CO0A 9ATCB 4DU7A 1WHJA 2LJ3A 4RU2A 2MHEA 5EHHA 1HXDA 2XZDB 5E0OA 3ER0A 4KPYA 1X7VA 1Y7PA 4M7DA 2BM0A 3HHDA 3A8IA 1YIJQ 5KG0A 1XR7A 4CWBA 1JLGA 2EFGA 3HHLA 1KC8C 2BJ3A 2CDRB 5F0WA 4RBTA 3JSYA 2ZJPQ 1GAOA 2B8AA 1ZTTA 3MFHA 3MD1A 2F7VA 1RSCA 1S7IA 5JVHQ 4Q43A 2LQ8A 1VCTA 2LCCA 1VQ5T 4C92E 4F50A 1S9FA 1XR6A 2NUPB 1RI0A 3RG6A 5T41A 4I7FB 2R4FA 2PSZA 3TAQA 5J2PA 2CPEA 1WG5A 2ECZA 1JLBA 2JX2A 5B0EA 1WHHA 1S1WB 3C12A 4C8OA 2GQ2A 5A6PA 3SDEA 4AXJA 2J6OA 4NS5A 4FXWA 3KXDA 4EMKC 2BUDA 3CMAT 3W2VB 2PI5A 5KT2A 3SV4A 4B9UA 2FTRA 3KK1B 3DLLA 1TUWA 3K8WA 4I0WA 4J9FA 3EYZA 3HJFA 3PW2A 2DVIA 5F3ZA 3NKYA 1ZUYA 1XTZA 3M8QA 4H4MA 3CD6T 2VFSA 3RBZA 4LF4F 1RTZA 2QA1A 3GLJA 1BHNA 2CSIA 3CCSQ 1KC8T 2F3JA 1AROP 2B4UA 4DG1A 1P6TA 4Y2KA 3M57A 4I64A 1ITPA 5I21A 2QSWA 4M5MA 1RAFB 5C6SA 1FEHA 1SG5A 3GNFB 3BO2A 3CXCR 2VBXA 2BA9A 5BR8F 2H9ZA 1FERA 4CO2A 3I5BA 4U7UK 1LW2A 5HK0A 1IO6A 3TJ9A 3PKYA 3I55T 3FBFA 3ZZRA 1JLQB 2HAFA 4MMKA 2YPYA 3UT1A 1GMUA 2ADBA 1T0HA 1SSHA 1CJUB 4UOCA 2HNDA 3CD6S 4USJC 3PNIA 2K06A 1P1LA 2AEJA 4KUDK 2XQCA 1Y5NB 2NYSA 3MTJA 3TQ7P 4OZJA 3VVTA 1SKSA 4GKKF 4IO1A 2QSFA 2CT3A 5DQHA 4RMOA 3M5AA 2YNGB 3SQGA 1JXVA 1CQMA 1JLCB 1PKUA 3PZPA 4DR2J 4KHPF 2ZZMA 1K73R 2F8EX 4TU7A 4NCGA 4X62J 2GQVA 2W10A 3NGUA 2JEIA 1RLQC 2V8GA 3I55S 1B0VA 2P84A 1FXDA 3PE0A 2J0XA 4GC7A 4O4GA 3UPFA 1Y5LB 5GAOm 3SWNA 1J5OB 3PHEA 5CKHA 1JQGA 4X1VA 4FYYB 1X43A 1FRHA 1I5OB 4HCZA 2GO9A 4GKJF 1YJ9A 1G5VA 2DK3A 5AE3A 5KFTA 4PJOG 4JRKA 3QG1A 1D8YA 3UR0A 2EFOA 4J9MA 2R7UA 2OTLQ 4BDPA 1VQLA 4USWA 2ROLA 3KJQB 3M9NB 1FDDA 2AMCB 2ZE2B 2GIFA 1DARA 2PU9B 1CJTA 3ULRB 1TL1B 3J7AF 3MR5A 2MJNA 5DLQE 3IWLA 2QRRA 2HQEA 1JKHB 2G0JA 4PXDA 1PM3A 4C5EA 3DHXA 3S6EA 1BI1A 3U02A 2GFFA 3LGNA 3CCET 2KT3A 1FFWB 1YJVA 4BDZA 3CC2T 5GAEU 5KFOA 3WC2A 4RW7B 1I81A 1NMEB 1CKBA 2ZC3A 4LF8J 4AFUC 2IJFA 1S4EA 2FY1A 1VQ9A 1HHSA 4AFSC 3EHQA 3BYPA 1LK5A 5K5MA 1HD1A 2WB4A 2I0NA 3RYLA 1K8AU 1UFLA 3DOMB 4FKXA 3ELHA 2CAJA 3PFOA 2QASA 2QXFA 1YRTA 3BQ2A 4F7VA 2YWEA 3KHHA 4NLWA 5EWEA 4C97A 1OJ4A 4RBVA 2WW8A 1HMVA 4PPZA 1Y96B 2WRMA 4IFVA 3VRZA 5B0CA 2EQMA 4I2QA 2W9AA 5AJ3F 2EFNA 3FLGA 3AY0A 2V4QA 5M2PA 4QQ6A 2JFDA 3CCES 4N77A 3PKMA 1D3BA 1OPLA 2Z2ZA 2EJFA 2CJXB 4V1Ak 3TA2A 4JV5F 2OLWA 2P9CA 2EG2A 3W63A 1YJ9Q 1WACA 5E3CA 4J37A 1U1MA 3VAIA 3M1VB 2CJYB 4W98A 1S9GA 4HACA 3ZEHA 2XICA 1UFKA 2LKZA 4C2MA 4JI2F 3QT5A 2NWMA 5C2CA 2OTJT 3PYEA 3L7PA 3UCZP 2AD9A 1I1JA 3G6VA 1R31A 4PKCC 1PHTA 4E7SA 5HO4A 4J91A 4RTTA 3V4MA 3OQ5A 1PBAA 5CA5A 2UVVA 4E7IA 3GIKA 2DNNA 1UL3A 5LJ5j 2A10A 1U8RA 4OZ5A 4XU2A 3Q2SC 2KFZA 3CWJA 2ZVIA 2WONB 3M8ZA 3DYAA 2PDAA 3NNAA 1SKWA 4YB6A 4XTTA 2K3XA 2WSCE 2JJ4D 4MFBB 2W9CB 4CYUB 1N0VC 4WYWA 4Q0BB 3R5CA 1NHVA 1X4AA 5K14A 4DL5A 4M78D 3T6JA 4NLPA 4ZTFA 4OGCA 5DZ7A 3T9NA 2DH9A 2BMBA 4F0KA 1JNZB 4FF3A 1M2VB 5KFUA 3T9ZA 3VUBA 4DR1F 2DH8A 3GP9A 2QGGA 2ZUAA 2V8VA 4CLTA 3NNCA 2OTJS 4F3QA 2DPIA 3QSUA 3GIJA 1G83A 1Z1ZA 3QJYA 2EGEA 1WDDA 2ZOGA 3HVTB 3MAHA 3QGGA 4LF6F 1S1VA 3LWMA 3E3XA 1T9VA 1X60A 1JB0C 1U48A 3VF0B 2PFFB 1HW8A 3I9V9 3MEUA 4B3SF 2B3TB 3HKZD 3PIOQ 1JLBB 1AHJB 5A2QE 1W2BS 1AWOA 2WVFA 4A46A 2YRCA 3J7YU 4ZJOA 1WX6A 2QEXT 1Y11A 1N36F 2DNZA 2XNQA 2GIRA 5T7LB 3SI8A 1U49A 3PFSA 1FA0A 4M7AC 5FDLB 1S7HA 3G6EA 3QIPA 2MF2A 1G3YA 3C95A 3M05A 3MF5A 4HVWA 5CIUA 1JLAB 4IR9A 1S6PA 2QA4S 4B9XA 4OZLA 1P27B 3RBEA 1DRZA 4RZRA 2MWOA 5F8IA 1YJUA 1N9RA 2E9TA 4OMOA 4ZGJB 5D3GA 2OP5A 3DM2A 4DSIA 3M2UA 4J9OA 4P73A 3S1TA 1RKJA 1F1BB 4QZVB 2QLWA 3KLGB 4HTIA 5LXYA 4FYWB 3V6KA 1KD1C 1K0SA 3RW7A 2AK5A 4DA4A 1RTHA 2RQCA 3VZIA 4DX5A 5CYQA 2GV1A 3NWGA 2I1RA 2OI2A 1L3VA 1NB7A 3E8OA 1X6GA 1FF2A 5B08A 3HO1A 4PJOA 1WC0A 2AKKA 5LJ3h 4CTAA 3M2VA 3VKIA 1PSDA 3QZ8A 1NYGA 2CP5A 3TUZC 3RRGA 3RB3A 2KDOA 3KWMA 5DM7Q 3QMQA 3G4SA 2HWTA 1SC4B 2Y1LB 3HT3A 1TP7A 2QMXA 1LEOA 2V1RA 1FXLA 1X5OA 4CLWA 4R0KA 1PC0A 1IKYB 2YNIB 5GAGU 1XNQJ 4IUFA 1SL1A 2C06A 3HD2A 5HVHA 3U23A 2GCXA 4LT6A 5IN1A 1FVSA 2CNLB 4PLLA 3MOZA 1AW0A 2YQ0A 2HKNA 5GANj 1VQKA 5KFNA 1Q86U 2UXBF 4C92B 1UJ5A 4UT4A 1X4BA 4A8XA 3G6EQ 1LXNA 3OD2A 4M5JA 2E1PA 1U3OA 1QWFA 3H9NA 1MMAA 4OYMA 3OS2A 2EYZA 2ZH8A 3G8QA 1Y10A 4WCEQ 4N8OA 1S6UA 2LJ1A 5D4NA 4N7TA 1RHKB 3PHTA 4HYKA 5GADI 2EQJA 3H2UB 3R3TA 1HWLA 4QIFA 3CD0A 1YDLA 3REBB 2Y9HA 2F9JA 4LBHA 3BH6B 2ZH6A 2OIHA 1SXLA 1KQSP 2JNJA 2UUCJ 2CQGA 2KHDA 1QY7A 5J2MB 4C8LA 1B7YB 1I1GA 4UW2A 5CYJA 2HL3A 3GJTB 2V2QA 3BPSP 3D9BA 5CCLA 3OT9A 1S1UA 2DGWA 1Q5VA 5KFSA 4OJHA 4KRTA 2L08A 1R8HA 1EETB 2J7IA 2DZCA 4ZP7A 3GLXA 2KRNA 3EWGA 2M9UA 4ANJA 5KYWA 2DPPB 2YUPA 4DUYJ 1X75C 1N8RT 2RKIA 1Q8BA 4RNHA 1IBKF 4IRKA 1BK2A 4M5IA 4LDXA 2QL7B 4QIVA 3KLEB 4J9IA 2LDMA 2D74B 3TVTA 3PEHA 3PV8A 4BB7A 3E19A 3ZTQA 1EIYB 4Z2XA 5JUMA 2YNFB 2EVZA 3RKYA 4Q2MA 1UHCA 3QGIA 2VA3A 4N5SA 3SEMA 1ZETA 2AWZA 1RHJB 4M63A 4TKTA 5KFGA 3A8LB 1VQKQ 3GYNA 2LXFA 4BWJA 1K9AA 4M7AF 2I2YA 2CFXA 4HKQA 2W2QP 3UI3A 3OTCA 4RNMA 1YJWT 3VGUA 2QL5B 3M55A 1LQ9A 2OMOA 1LW0B 3ENVA 2NUTA 3WIVA 1KOOA 1WXBA 2YPZA 2VICA 1WDTA 3KLFA 1Y00A 3C19A 1H98A 4QCLA 1GMVA 5K8OA 4PWDA 1RB0A 2IY5B 4QYZJ 4DBQA 4DDFA 1FE0A 4WK1A 4DV3F 4M78G 2E5KA 2EYYA 2HNYB 3SBMA 1F5BA 2HHVA 1TELA 2KT8A 1S6QA 1QAJA 5GANh 4CT8A 3JQJA 4BBYA 5SUHA 3GJSB 3GSDA 3E1SA 1XMOF 3WX8A 2JEGA 1M3BA 2DL5A 5ETRA 3ZZ0A 2BJ1A 1CKAA 4LF2A 3W2WB 4LR8A 5DGBA 3CCTA 3L2RA 4NCAA 4X65J 2HPUA 2RO0A 4G1QA 3B82A 3DXBA 2CZ9A 5E41A 1YJWS 1RWUA 1SCJB 1ABQA 5C5JA 2KQWA 3NAHA 2XNRA 2VPZB 5CH7B 2EBPA 5IWAF 1FRJA 4RTVA 1G6BA 2MB0B 5ETNA 4OI4A 2GX8A 2DEIA 2H54B 1K0XA 3HHEA 2KU7A 3CDEA 2QQAA 3MEGB 4WWSA 5DJBA 2VFRA 2D3UA 4WFNQ 1D1AA 2I2LA 3POTB 2DILA 3I31A 4IOBA 1OZ3A 1S59A 4ZVPB 1S1VB 3DLGB 3BN7A 2YUQA 4WTOB 1NAQA 3IO1A 3ZXWA 2K7AA 3KNAA 1EB0A 3SZ2A 1Z2LA 1JX4A 1UEKA 2JZ2A 2BKNA 3TEHB 2FJXA 1OY6A 3FRZA 3I0RB 5D4PA 3E51A 7FD1A 4DPOA 2ZHAA 1U1LA 1V3RA 2EC0A 3P4UB 4C6AA 3I56T 3DRYA 1U26A 3CCMS 1RACB 5KE3A 5D0GA 1JIHA 2RK2A 4NOYA 1WEZA 3G1JA 2YUNA 4JLGA 4F7UB 1ZSZA 2L3SA 3FEOA 1EP4B 3BBBA 1JB0E 1VQ8T 1XK8A 3MJXA 4OF1A 3FRYA 1S6PB 3HPOA 3E01A 2GGPA 3FQKA 4M75C 4C8QG 2KK4A 2CQ0A 1X4DA 1VRUB 3OLBA 3CDAA 1PKTA 4IG0A 2PMZD 2AEFA 5GAEI 1Y7XA 4KO0B 3LH2S 1QVGR 3D4JA 3JCMc 2RMOA 3MCSA 3MM8A 4LFBJ 4J9LA 4IQXA 5GAOp 4RJVA 3LO3A 3S3OA 4M7AE 3H4BA 4BHQA 3KXTA 2RI2A 2JVOA 3VAGA 3RR7A 4EMHA 2PO4A 2Y0SD 4BY6C 4LE9A 1D0YA 4EMDA 3I56S 2I5JB 1Y07A 5KFWA 1E6GA 4C0HA 1IKWA 4UZBA 4LRAA 3CC7Q 3CJTA 4IOCQ 1YJTA 2BVZA 1D1CA 4N4IA 3C6UB 3NCQA 4I2PB 4C5GA 1FESA 2JTMA 2ZPIB 2GHVC 4MDWA 4ZHRB 4DL0C 2DL4A 2FJDB 1IGQA 4ED7A 5FWCA 1TK0A 4PJLA 2BACA 3TZXA 1DHMA 4JRPA 2EJ9A 2SEMA 2B0GA 3M6VA 1X27A 3NTHA 5F41A 4PK4A 3M8PA 2HMIA 1R0CB 2R57A 2BJDA 1N54B 2AYGA 4YUDA 3CXCS 1IREB 1NLOC 2B7CB 2AQ4A 2DD4A 2CNNB 1R0AA 1K73T 2RDIA 2OSQA 3RRHA 1W70A 1QD1A 1QAXA 1TTHB 2JW4A 2JUFA 3DB3A 1QE1A 1HNZJ 4FT2A 3H40A 2EYWA 4V2SA 4CI0B 3RMQA 1B99A 3RMSA 5D7UA 1YBYA 1Q7YU 3D5MA 2DGQA 3SV3A 1K0VA 1BI0A 2HRTA 1RUWA 3HSJA 3LX7A 3HDSA 2E6ZA 3UN5A 3J7Z5 1FK9A 2UVUA 3TJAA 4LDUA 4ECTA 2DD8S 5K20B 3CPWP 2AT1B 2MQLA 1SEMA 1YI2A 2RH3A 1QKXA 3VAJA 2XK0A 3C16A 2BZ2A 2AF6A 1CJKB 2L3RA 3EGDA 3UD3P 3TO8A 2DTOA 3MEDA 1G2EA 4FSXA 3GOXA 4NLUA 5ETKA 4M8LA 3CCUQ 1GH8A 2LT1A 4PL6A 1WTFA 3QT8A 2K3YA 3CO9A 2VUBA 3QJ6A 2R2SA 3FCVA 1X6OA 3JCMQ 1HBMB 5B0GA 1N5SA 5GVQA 3EG0A 4B3MF 3OMGA 2PC6A 2YH0A 1I94J 4EMKB 4M78A 4ES3A 1VQ7A 4L6V3 1YJNT 5GAMg 2C2OB 4K4VA 4R5PB 3PVQA 3ZZPA 4K2JA 2UV8G 4UQGA 2Y1IA 4LVOP 1NM2A 1U7LA 1WKKA 5D6XA 4UY85 1JXLA 3GFZA 2ZH4A 4QYRA 1FXRA 2LCSA 3KLHB 4KGVB 2HZCA 2FHJD 2VG5A 2L0AA 1B0PA 4DUZF 5IXBA 1EFNA 1YBAA 2YWFA 2Z58B 4FXDA 1A6LA 1S9EA 4J9UE 1HPZB 2ZBIA 2MGZA 4KGZB 1TUGB 1AYEA 3W9HA 1YTYA 1BLUA 4HL9A 1GXLA 1NEEA 1VBKA 4QWAA 2W4CA 4BC9A 4QYZK 1LWCB 1U6BA 5EWFA 3P3DA 2RJCA 2XS2A 2LYVA 3M59A 3SHWA 1YJNS 2C3UA 4L6V5 3EE3A 2HNIA 3OW2P 4C8ZA 2DR6A 3QRQA 2X3DA 3C8YA 3W61A 4YN3B 2DXTA 1NSPA 1YI2Q 4PQUA 2Z2YB 3HHKA 1MG7A 2XMKA 4NLXA 2W7OA 9RUBA 1HW9A 3OSPA 5D4LA 5KFMA 4DPYA 4USTA 2QC3A 3N5FA 1IM4A 2VB6A 5CXTA