2OAUA

Mechanosensitive channel of small conductance (mscs)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
b'YAVNIVAALAIIIVGLIIARMISNAVNRLMISRKIDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSREPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel
publication title Structures of the Prokaryotic Mechanosensitive Channels MscL and MscS
pubmed rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF05552 TM_helix Conserved TM helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2oauA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oauA03
2BYCA 5B0EA 5B0CA 2W4CA 2HLTA 1P6TA 1FE0A 1Y3KA 2XMUA 2GQVA 3HHLD 1N5VA 3KG0A 3QGPA 4NL5A 5K9FA 3FGVA 4HI2A 5A6WA 2VV5A 1TL5A 3MCSA 1FEEA 2K1RA 3FRYA 4ZOSA 5B0GA 2GCFA 4EFAC 3HFKA 1Q8LA 2QIFA 1SQEA 2HLUA 4NPOA 1Y9OA 4OIXA 1URRA 5B08A 1AFIA 1IUJA 3BM7A 2FIUA 4ZA1A 4HL9A 2FB0A 1KQKA 2HFOA 2LQ9A 3KNGA 3DCAA 2OP5A 4Q2MA 4F67A 2RK2A 5B0BA 1OSDA 4YEAA 2KT2A 1SI9A 1FE4A 2BUNA 2XMVA 4Y2KA 2XMWA 2OD4A 4FNIA 1TL4A 1K0VA 3BB5A 2KKHA 2GA7A 5B09A 1CC8A 1YJUA 2G9OA 5F0WA 3LGMA 1FVSA 1OQ3A 1YRXA 2ZDPA 3LGNA 3T9NA 2ROGA 2GFFA 2PGCA 3HF5A 4DL0C 2QLWA 3BF4A 1VQSA 5T7LB 1Q8BA 1N5TA 2ZDOA 1N5QA 2LQBA 1W2IA 1FVQA 2HQIA 2QLXA 2QYCA 5A6PA 1LQ9A 3BDEA 2XMMA 3HDSA 3KKFA 2GGPA 1XBWA 3HHLB 1KVIA 2ROPA 2AW0A 2XMJA 2XMKA 1GXTA 4OJ1A 3LO3A 3DXSX 5IXUA 4U9RA 1AFJA 1RJJA 2ROEA 4DN9A 2W4DA 4OJ3A 2K2PA 5F0UA 2HFNA 2FTRA 1CC7A 3HX9A 3CJKB 3K7RA 1MWZA 4QOTA 2RK1A 2RU9A 4A4JA 4A46A 3HHLC 1VQYA 2PD1A 2N4CA 2BJEA 2CRLA 5B0AA 3TNVA 2N4DA 2AJ1A 2RSQA 3VTIA 1X8DA 4HH0A 4OJGA 4YDXA 1MWYA 1S6UA 1R6YA 2L3MA 3MZIA 2IYGA 3HHLA 1S6OA 4OJHA 2OFGX 1KVJA 1YG0A 1Y3JA 3TRGA 1JK9B 3TOQA 2K1RB 4FNHA 1QUPA 3KG1A 4Y2IA 3CJKA 2HIQA 2RILA 3I9ZA 5B0DA 4A48A 2N7YA 4Y2MA 1TR0A 2IYIA 1V3ZA 1X0PA 2EW9A 1Q4RA 1YJRA 1FESA 2OD6A 1CPZA 2VH7A 1APSA 2ACYA 4A47A 2GV1A 1WD6A 2RMLA 4DPOA 2IFXA 2OKQA 3SFMA 3E8OA 5T7LA 1VIFA 4HI1A 2K7JA 2AP6A 2OFHX 2KT3A 3BR8A 2BJDA 2OMOA 2XMTA 5KAKA 2P4TA 2BBEA 2RH2A 2OAUA 3WDOA 3QMQA 4Q2LA 1SB6A 2FHMA 4HH1A 2W4PA 5B0FA 1ULRA 2AJ0A 2Q3PA 2LDIA 2GO8A 3BN7A 2ASYA 2GGPB 1P8GA 3IWXA 1JWWA 3UDCA 1N5SA 2KYZA 2LXFA 3F44A 1VIEA 1U7LA 1FD8A 3FMBA 1AW0A 1TZ0A 1GXUA 1OPZA 1Y0HA 1Q53A 2JDJA 1X7VA 1YJTA 1OQ6A 1YJVA 3BGUA 1TUVA 3IWLA 3GZ7A 2K7KA
chains in the Genus database with same CATH superfamily
4C92D 3OYMA 2KY9A 2EVRA 4OMMA 3FGVA 3OMGA 2OPPB 3C15A 4DF4A 1EKRA 2LQKA 2JEGA 2R7SA 1HXDA 1KQKA 3G6VA 2ZPBB 3OTDA 4USWA 4LFBF 1SH3A 3CCJT 4DR3J 2GVZB 3Q86A 4ETZA 2F4FA 3NBPB 3R8YA 1YRXA 3OYFA 5GAOp 4C0BA 2ZVSA 3HO1A 4RG8A 2ATCB 4Q43A 1W2IA 2HFSA 1M1FA 4RUAA 2AGQA 4Y34A 3I4PA 1EZZB 4X84A 1D1CA 4K59A 2CG4A 3OYYA 4X9CA 4ER8A 2FTRA 1FRIA 1HQUB 1NYGA 5LMUJ 1EQ0A 4B3SF 3ZZPA 4BDZA 4BC7A 1H8KA 2F8EX 3IWNC 1RTIB 1QE1B 2DGQA 2JN0A 5HN0A 3M57A 1KLNA 2DIQA 2K1RB 4G65A 3NOCA 1X4DA 4OL8A 2LMJA 3HK2A 3DRPB 2D8JA 3RERA 2A28A 2LLZA 1U0HA 3LPEA 2IBKA 1TTHB 3OW2P 2ASJA 3WZ0A 5KAKA 1X4CA 2GHWA 4M77E 3JSMA 2HNIA 2XICA 4QYZK 1HD3A 1YK9A 1VQLA 2APOA 4F2SA 3ET6B 2BYCA 2H5IB 3LWMA 2GTOA 3CGIA 3D1OA 1BCMA 3DGVA 4AUKA 4CLUA 4M7AC 1KSPA 1EX8A 2CZ7B 2CH4A 5J1EA 3K17A 2A37A 4NXMJ 2L3QA 2KFNA 2X51A 2F63A 2BZ8A 3NY0A 3MGJA 1S4FA 4DN0A 2CYZB 4M7AG 1UUEA 1IKXB 1HBOB 5GAN7 3VYGA 1AWXA 3KLIB 2CDRB 3TJ8A 2KDOA 1EARA 2JNJA 3O8WA 1U1LA 3N6NA 3OYLA 2XQCA 1HMVB 3ZNJ1 3I5SA 1FFGB 3RR8A 3VYHB 4CLKA 4MZMA 5KYWB 1F2HA 3V7RA 2KFYA 2B0GA 1NO8A 2LA4A 4BC9A 3O5ZA 4JI0J 2HZCA 3EPIA 1LW0A 3QZ5B 1UGQB 4XDCA 5CCMA 1U2CA 3PM9A 4Y2MA 5HK4A 5DO2A 4H4OA 2XD0A 4NXNF 1G3YA 1N27A 4RBTA 1S1XB 3JAMU 2B4PA 3B8HA 2CZVC 1ROFA 3OXLA 4B3MJ 1GBQA 4XU1A 2M0YA 3QMQA 1PD1A 1AOJA 1M1GA 1VHIA 1D1AA 4D6WA 5K5MA 4P6QA 2KYZA 1VIEA 1U7LA 4DFJA 3CXCR 2HPUA 4LUBA 1VYTA 3EE3A 3KUHA 2ZJRQ 1NJYA 4M7AB 5A8KA 1Q81C 1HBNB 1S7IA 3RBZA 5CQXA 1GCPA 3KUFA 4OHZA 1ZOTA 3D54A 2R7QA 3QJLA 3WIVA 2FVSA 1HBMA 4OX8A 4BCAA 5IN1A 2FHJD 2R4FA 3RDVA 1K0XA 4J9BA 3J7AF 5T7LB 3INZA 1AZEA 1W6XA 2M9UA 3JCMQ 3QSUA 2DXFA 1F6TA 4HXJA 1XNRJ 1A0NB 1HQEB 1KR4A 3PJWA 5FDLB 4LFCF 3G4SQ 1NJXA 2XI9A 1RISA 3EH2A 3MZIA 2AHOB 3SBMA 2MYSA 2EK6A 2JXBA 1DARA 1PAUB 1Y96B 5D3GA 4JI6J 2QQ9A 4BDYA 3J7YU 3P45B 3VGVA 3MEEA 3OFHA 1X4FA 1Q82R 3CD5A 1U25A 3G6EQ 1UPPA 3M2UB 2OPSA 5F8LA 1WKKA 4I2PB 3ZZ0A 2NYSA 2QLFB 4J9LA 3NPFA 2EGAA 3G2XA 2EQMA 4AMCA 2CP0A 1J5OA 3CT9A 1UGSB 3BBBA 3W5YA 2N82B 1OU9A 4P52A 4MFBA 1SEMA 5F8MA 3HSBA 2BKPA 2DR9A 5LM7E 3A8EA 1FXLA 2L8DA 4J7IA 4PJOG 1IQZA 1AZSB 4DV4F 2NUPA 3U7JA 3ZZRA 1NZ9A 4J9FA 5A0YB 4QPTA 4KO0B 2FPHX 3LUYA 2RJFA 2OI2A 4DV5J 2BUDA 1ZPWX 2QEXQ 1CC8A 1U48A 2CKWA 3S7RA 4JI5J 5HLFA 2IPOB 4AG2C 3SZ2A 1HWUA 2P0QA 2RB7A 5RUBA 1VQOQ 3CC4A 4QCLA 3NMRA 1DTQA 4HVUA 3TA0A 1EP4A 1VLYA 1ZS6A 1Z2ZA 3P5TL 3GIMA 4XTXA 2MY8A 2BKOA 1TKTB 4ZVOB 3KHHA 3HSJA 4MDXA 4J5OA 1X4EA 3ZZYA 4A4GA 4EMKB 5HJYA 3H0FA 2DJQA 4P73A 3GFXA 2GHVC 1JLGA 1OY8A 3CCVQ 3IR7B 2NPFA 1M30A 1YWPA 3H0IA 3CCES 5KFBA 1JXMA 2R42A 2CP2A 2XLJA 3ENVA 1IKWB 2AP6A 2FHJA 4F14A 4DZDA 1KHIA 4IO9Q 4HT5A 2Q3PA 3T9ZA 1P8GA 2Q6BA 3FJ2A 1NJIR 4JZ4A 2VB6A 4NI2A 3KJVA 2B9XA 5IFMA 1R7IA 2DNHA 2HQDA 3ICLA 3EZ5A 3OSSC 4JJCA 3KLVA 2HURA 4RX6A 2V69A 4OYZA 3M6VA 4PWDB 1DHMA 1CSKA 4F4KA 1VQNA 2ROLA 4JB8B 4CO3A 3GJRB 1HNVA 1T3OA 8RUCA 4NWBA 3L2QA 4OJ1A 2E70A 4ANJA 6FDRA 2HSEB 4ZPCA 2EG2A 2GIFA 4E7IA 4OJGA 1B70B 3B54A 2XWXA 4B3TJ 4KGVB 2DXBA 2V50A 3TZYA 4DBRA 3RMQA 3KBGA 1HHQA 3AY0A 4FSSA 1RDRA 4A47A 3DRSB 4WFYA 5C25A 2HEQA 1H7WA 3V7CA 2HQGA 1WIEA 5GAN3 3CXCP 2XI2A 1AWWA 5IC6B 2KK4A 3PFSA 1AD5A 2E5LF 3A8OB 3QPHA 1B7TA 2LJ0A 4RNMA 3PW7A 5FJ4A 1WQWA 1OOTA 3BQ0A 1K0TA 2ZBIA 4LNPA 1OPZA 2YXLA 1T3LA 1WLPB 2V34A 4G1IA 2P9GA 4E7SA 3MMBA 2HIYA 1M3AA 1TK0A 2A7YA 4C8MA 3HM9A 1FJGJ 1N56A 1H2TZ 2DX1A 3CCSS 4P74A 2CJXB 3FIFA 1X5SA 4URQU 5JUMA 5B0GA 3QRRA 4GKKJ 2X1GA 1NLKL 1RKJA 4K0KJ 1URRA 4BE2A 1IUJA 4AXIA 1B0TA 4C9DA 3WXMB 2A36A 1TL1B 3C46A 4KE5A 1NJWA 1RWVB 4OB1B 1IBCB 4USJC 5A2QU 4QYZJ 1FRLA 2UUBF 5FU6C 2OPQA 4JI8J 2FZGB 2DLPA 4ZITA 2UV8G 1TK8A 4RCBA 3Q8UA 3A8IA 2XGQA 1KVIA 4P2SA 4ZVSB 4K2XA 4HDGA 4YHHF 2Y1IA 5GAMg 1PKUA 5KT2A 2ROEA 1YI2Q 2FPFA 2MGZB 3I9V9 5IHNA 1VIOA 1S1VA 1NUEA 2VXFA 2GVDA 1VC0A 3TNVA 3AOBA 4OMQA 2GNCA 1Q86T 1CSJA 5L39A 4M1KA 1VOMA 3CD7A 3W66A 2ZZMA 1VQ9S 3HPOA 1F9EB 4L3NA 3V4MA 5CD4A 2V8HA 3FRNA 2E7VA 1Q5VA 2C3PA 5DQHA 2J0XA 1SQGA 1C4AA 2J9EA 2DTOA 3LPYA 3GIKA 2V8IA 3D7SB 3M8PA 2NXJA 4J9IA 5ETVA 3QGGA 2DM1A 2OAUA 4QWCA 4F7UA 3CTRA 3EJMA 4N41A 1WA7A 4RTZA 2HEKA 3W9IA 4NLTA 3GSDA 1MMAA 4ZVTB 3DKMA 2R7OA 3ZTSA 4CNZA 2J7WA 1FE0A 3JQKA 4JS4A 1SUQB 4KIAA 3R5JB 3M55A 3KLFA 4Q7AA 5KYYB 3AJDA 4KGZB 2CVIA 2LVMA 1EFNA 2H1YA 2YUQA 2AYBA 3J81U 2MK5A 5HQLA 1SC4B 5FU6B 2HG4A 4WE1B 3DLEA 5DLGA 4DOZA 3Q8SB 4IYQA 4CCHA 1Q8BA 4H4KC 2GMHA 4R0JA 1JXVA 1Y10A 4NZ6A 1G83A 1S99A 3OVSA 4O3PA 3NHNA 1JKHA 3FEOA 4Y0FA 3CVKA 1QD1A 3EDQB 2WONB 3OLBA 2D9PA 5CYQA 3CCLT 3DGPB 3H98A 2N4DA 1XNQF 4BE1A 4UZBA 2YUOA 1BIBA 1WQ7A 1IBKJ 1KVJA 3OR2A 1D0EA 3U1NA 5CD4H 2YH0A 2B4OA 3EZUA 4DR4J 4RJVA 1IKYA 2L48A 2ASLA 1VJQA 2O9SA 2DRBA 2F2VA 2P2CB 2AX0A 1X69A 1Q82T 3MEUA 2RKIA 1RYRA 1PSFA 3GLJA 2KI7A 3QPIA 4PAAA 1HYOA 4WPAA 3VAFA 3PYGA 3I4HX 2C2KB 3W2VB 3CMAT 1UKUA 2ESWA 3CPWR 1NLPC 4BWJA 5B0CA 3P4UB 4PR6A 2COYA 2CGHA 2CQPA 4JS5A 4XTWA 3MFIA 1Q0NA 2CP7A 2HLUA 1TH7A 1VQ4Q 3OXFA 2HKEA 2XCPA 1C0UB 2D41A 3T1AA 3PEHA 5GMDA 1OQKA 2AKLA 3KK3B 4RU2A 3L7PA 4IFYB 4ECVA 3DKDA 1ZAVA 3FC9A 2FQQB 3BH6B 5BJRA 5AJ3J 1S9FA 3I0RA 4WF9Q 2IJRA 1SRMA 4C5GA 2Y3YA 4XO0A 1TL7A 3QO9B 1WC0A 3QLHA 1WZOA 4DFMA 3CQTA 3FQLA 2OFGX 4NRUA 1S4EA 2Y4YA 2AJ2A 2HIQA 2DKOB 1S0MA 1WHYA 1WJ9A 4UQTA 4W4MA 2UVWA 4ZIWA 2J0WA 2Z4PA 3HZEA 2E4HA 2CFXA 3C6TA 3L09A 1XQIA 5IXFA 1Q78A 1C1BA 3SCLE 4M5MA 3FBBA 1YQHA 2IMWP 2DGVA 3CJ2A 4J9SA 1S9EA 1JX4A 2GO8A 3E01A 4DOWA 3Q8YA 2UZAA 2JM9A 1VRQC 1JLEB 2BQ3A 5GMKj 1RAFB 4LF8F 4B08A 2VIHA 2OI3A 4ELTA 2CDTA 2RNEA 4ECXA 4B9MA 4GO7X 3W2WA 1NJIT 1U2RA 4GC7A 1PRMC 2LDYA 2ZE2B 1TL3A 5HBMB 4M5HA 1XQHA 2HBYB 3H5YA 2GIQA 1IN0A 4O3RA 3RAXA 4HCCA 3TO8A 4KBIA 3UN5A 4E2FB 1KFSA 2KVIA 3DRRA 2BMBA 3CXCS 4HA8A 1NZ8A 1WPYA 2UU9J 2SEMA 1BI0A 1Q7YR 5AE3A 5GAGI 1P9YA 2ZZTA 5FLXE 1D3WA 3TWZA 3F56A 4ECUA 2DR6A 3PW2A 4CO5A 1C1CB 1XNIA 4YB6A 3UATA 3CMET 3TOQA 1RUWA 2J6SA 2HAXA 3LP2A 1H92A 4DL5A 1X0PA 2IA0A 1KC8U 3ASKA 4CNYA 4DOVA 2BIVA 2WTFA 2FJAB 1OZ2A 4KC5A 2A18A 3C15B 4U6PA 1IQTA 3MD3A 1O6XA 2LDIA 1PSDA 2ASYA 1HJDA 5HY6A 4M63A 1OY9A 1A7GE 3VZIA 2DO4A 2B6AA 3PO4A 1MSWD 2K06A 1YIJA 1S72Q 1JXLA 1KOHA 3M2RB 1B99A 1QAJA 3QFWA 4DSFA 2QQBA 4OMOA 1TELA 1ZLMA 4NS5A 1VQ6Q 1FHTA 1VQ7A 1H72C 2OTLQ 4WCEQ 4J9HA 4RW7A 4J9UE 4YUDA 5EGYA 1G8XA 3CMAS 1UL3A 5D4PA 3G4SS 2ABLA 2PFDA 2LEBA 4JBCA 4OI0A 3SWNA 2V8GA 4EO6A 2RT3A 1FK9A 4X64F 3QGIA 2K3BA 2RIJA 3IR5B 1HI0P 1X75C 4C8KA 4EI2A 2DFUA 2H4YB 5HQ8A 1YRTA 1S1WB 2YHTA 4MZPA 1TSFA 4M77F 4OB3B 2OJ2A 1SPBP 4AG1C 3JSMB 1AYEA 3HFNA 4LF5J 4ID5B 2NXEA 1X6GA 2AZSA 1BMQB 1WHMA 1PBAA 2FB7A 3CPWP 1RABB 3HVRA 3PG9A 3DN9A 2EBPA 3L7UA 4E98A 1KONA 2JRSA 2EFIA 2IIMA 2XSJB 2JM8A 3MP8A 4DPYA 2D69A 2ZBQA 2O01E 3BYRA 4TVAB 3FB9A 2EFQA 2EQIA 2ERRA 4ERDA 3G96A 1TV6A 1R0BG 1KIKA 1YBTA 3GV8B 4LQ3A 4IG0A 4CLWA 3OTCA 1MN9A 2A2DA 3HD1A 4Q5WA 3LAKA 2VG6A 4FYDA 2KTQA 2LX9A 1JB0C 5L46A 2MAMA 4XU0A 2CQDA 2NUTB 3LAMA 1T05B 2V68A 3AODA 2MPXC 4ZTFA 3MPUB 3N4WA 5HAOA 2DYAA 2KT8A 3BDUA 2K3IA 4PABA 2CKKA 2RI2A 4OV6A 3M5AA 2OSQA 5LJ3j 2DNRA 4ED1A 2JEIA 1VS3A 4DI6A 2YXYA 2M7SA 4DPTA 4P7VA 1UEUA 3R5CA 4CM2A 3EGDA 1S7HA 1RHMB 3JSYA 5GAMd 2JTFA 3NGKA 4PZVA 1JLQA 4LVNP 1IR2A 4PYAA 3FEZA 3HKZD 1BLUA 4OZLA 1QCNA 4E7ZA 2ZH4A 4OZ3A 2PZ1A 3SDZA 1RWPB 2I8EA 3CB4A 2MPUA 4YTLA 3EVMA 4QQ6A 3HHDA 4HT7A 2P9CA 3N6MA 2NPIA 4LDVA 1W2BR 2E7XA 2G2YA 3T5HA 3AD8C 3GCWP 3CMES 3RRHA 1OJ4A 4OQJA 2AZ1A 3FFIA 5L38A 2N3OA 5GAEU 1RAEB 3DLGA 1F2GA 4W90B 2MKIA 4CYUB 5HMXA 1VQLQ 3HHLD 4X4OA 3GSIA 1L3SA 5I3UB 4C97A 4QKUA 2BABA 3W63A 2QV6A 4WU3A 3MEWA 4RTTA 4DX5A 2EYYA 1LOJA 2LJ1A 4EMGA 2CZ1B 1EIFA 1D0ZA 2DPIA 2CDQA 2E5HA 3B82A 1EAYC 2IDLA 5HO4A 5KFEA 4N47A 4ATNA 1L5UA 1HK9A 5GMKi 1KQ2A 3RESA 1WHGA 3UI3A 5KE2A 1AXQA 1M2OA 3OA6A 4N77A 2DD5A 4I6WA 5J26A 2E44A 2PD1A 3SEMA 3FZ2A 1UA0A 5DDOC 1U1TA 3CCUT 3VGTA 4NLWA 3QIDA 1XWLA 5BYRA 3L1AA 1DY3A 2XGPA 3SCIE 5AYFA 5ETLA 3LP1A 3HTRA 3T1HF 1H73A 5KYXB 3TUJC 1G2BA 2DJZA 3AD7C 3SFGA 5ETMA 2FGCA 2J6UA 2DK3A 2OFHX 3GOXA 3OQ2A 4ZHRA 1LNQA 2UVVA 4ED8A 1QKXA 5F8GA 1PYOB 4QIEA 2NUPB 1X31C 2QI2A 4RUGA 2VGNA 1SG5A 2KR3A 3E9GA 4OHWA 4ATOA 5JMNA 1IBMF 4TLQA 4ZVQB 1PG5B 5AXKA 2VJUA 4DUYF 3BR9A 2EFPA 3TAQA 3L4BC 3UE2A 4F67A 5FLXY 3EICA 3OSVA 4YEAA 3IRWP 4FF4A 2M9KA 1YI2S 2EG1A 4MKBA 2VG7A 3VR1A 3VRZA 4EU0A 4OZ0A 4YY3F 3NWRA 1BWEA 4O3OA 3MF5A 1NHUA 1WXUA 1SC3B 4CTAB 1U1KA 5AT1B 2PNIA 3AXKA 2IY5B 4CLZA 3CCJA 1KSWA 2ECZA 1DQAA 3MM7A 2ZBPA 4IUFA 2E10A 4QOTA 3VAGA 1JLGB 3QIIA 2BVZA 3DLKA 1Q7YT 1YJWT 3JRZA 1AEYA 3SQOP 3HHLA 3ER0A 1WF1A 4Y2IA 5GJVB 3JSBA 4NEYA 5DDQC 5J2MA 1UP1A 3EVWA 1CPZA 2YKMB 1ZUYA 1M1KC 1SHGA 5KYNA 3QJYA 4OX7A 1SC1B 3D6MB 4AT1B 1R0AA 2HFZA 2ZH9A 2GAHC 1M2VA 2WSCE 3PE0A 5K8MA 2G13A 2BZXA 1SJ3P 2AIRB 2L2PA 1PC5A 4DSJA 2AU0A 4JI1F 1YJVA 4YR2A 3PIOA 1U26A 1QAXA 3V6JA 2XMUA 5JVGQ 1SBRA 4LXCA 5KFAA 2DEIA 5LJ3e 3GJTB 5BYSA 1M3BA 3MM9B 2K3KA 1BK2A 2LMIA 4ITSA 2Z2YB 3C66A 2B9EA 2A1BA 2C3MA 4AL6A 2XMVA 1NDLA 2BANA 5IT4A 5J3BA 3GONA 3NTIA 3C16A 1GNKA 3BF4A 3ZEHA 1ZSGA 2D1XA 2FZKB 4FKXA 1LQ9A 3QIPA 4LSNA 2MQMA 4ANCA 2Q43A 1WJRA 2K2PA 4L59A 1WOSA 1A6LA 4FF2A 3AHPA 1RYSA 3CC4Q 4Y3CA 3JSCA 3ISND 2ASDA 4DR6J 3CC2T 1PSEA 2KVQE 2V9KA 2X7IA 1QVGR 3CJ8A 1R8CA 1NZAA 3NLCA 1W2BP 3E2EA 1VQ8Q 5LJ5j 3K5PA 2VHGA 1V6HA 1VISA 2D1CA 3MMBB 2XMTA 7FD1A 1NEEA 1S49A 1N32J 2QQSA 4LN2A 3OFGA 3QAEA 4F7UG 3H20A 4WP8A 2VC1A 1FD8A 4DL2A 3LWIA 3BGLA 4YMEA 3QZ8A 2Z2ZA 2DXEA 2VXEA 3AD9C 4WF2A 5LSOA 1EB0A 2YDLA 4J9QA 4Y28E 1JMTA 4DQIA 2V1QA 4FS1A 4X4QA 4A8YA 3CJTA 2OPQB 1SJFA 3RNJA 3MMCB 3OYNA 4ZVRB 4CC4B 3O5TB 1KS2A 2M2BA 2CWKA 4NXMF 2EGEA 4N4HA 2PO4A 1NK4A 1VQNQ 4RPFA 1RE1B 3F70A 1PC0A 4L73A 4KBMB 1S6QA 1UPMB 3OW2A 3R7NB 3GIRA 3C14A 5EC7A 4DEXA 2OELA 2DNYA 4OI2A 3KK1A 2CZ4A 4USKA 1GFDA 1RSCA 2F2WA 1I6JA 2CJAA 1YVFA 2XYGB 4A46A 3U27A 4BUGA 2VQEJ 3MEDB 2LJ3A 4DV3J 4KH0B 2BDPA 1ZM9A 1WHLA 4ID8A 1KQ1A 2X4YA 3HFOA 2MQNA 3JCMJ 1G3SA 1HW8A 4DV0J 2JX2A 4QIFA 1U8SA 1VRUB 2N7YA 3T5KA 4DL6A 1QP3A 3E2UA 3KTQA 3UFCX 3TANA 3T1YJ 1LWEA 2GFUA 2F69A 5L8RC 1X4AA 1LFWA 1YJWS 4B3MF 2X3XD 4RNNA 2FJWA 3M4YA 3H5SA 3GR0A 4X65J 2LNVA 2U2FA 1PD0A 1CJUB 1CJTA 4XK8C 5E33A 3E1SA 2LQNA 2VG5A 1WG5A 2X1BA 2ENMA 4DG1A 4WTYA 1BD6A 4KUDK 5E7OB 1FEEA 3TR5A 1HYSB 1Q81R 2DL7A 5GMKl 2YQ0A 1O8BA 2XNQA 2CUYA 1HD0A 4OZNA 3CF5Q 3MMAB 2E1HA 2KMTA 1JKHB 4NLOA 3OS0A 3NXZA 3LGNA 4PYDA 4LDUA 1BIAA 2ZGWA 4OVAA 1RT2A 2HCKA 4C11A 3BDEA 2KRMA 1RTHA 1TKZA 3BREA 2VPYB 3PW5A 2F5GA 3OR2B 2LVWA 2EFNA 3HX9A 2EVZA 3M2VA 4OZ5A 1XNRF 2HQFA 5FRMA 1IKYB 5KOWA 5IHKA 5KG2A 5M2PA 1MG7A 3HHNB 3KMQA 4MMKA 2VDHA 2K5IA 1MW7A 2RKIB 3SV3A 2H48B 4FNHA 3WIUA 4J9KA 5D0EA 4PXCA 3UCGA 1AUSL 4E6RA 1ABOA 2O31A 2VUBA 3P8BB 3VRYA 3HFZB 4FU6A 2YWHA 3SSSA 4R5PA 2DEJA 2CPJA 3OYIA 1ZTWA 5CYMA 3H4DA 2DNQA 2UUTA 4M75E 1GCQA 1DJ7B 3E9FA 3LGHA 4KHPJ 2Z2MA 5CK9A 4DV7J 5L1IA 3D3BJ 2RQTA 2M3DA 3Q8VA 1RBLA 1M5VC 1PRLC 1TKXA 4X2BA 1Z1ZA 2KFZA 1ZPVA 3KLEB 5KFVA 2DYBA 4ZA1A 1JNZB 4ZKAA 1EIYB 5B0BA 1U24A 2GO9A 1QAYA 2C42A 3R5GA 3VAMA 1R43A 3VQSA 5KFSA 2DCLA 5KT7A 4F7VA 1TL7B 3RYLA 5LJ5e 3QLHB 2AYEA 3BQ1A 2NLUA 4JI5F 4K7QA 3SIPB 5LL6S 1QVGP 5K8PA 4QW9A 2GQCA 2N4CA 2Z30B 2LDMA 1YITT 2G4BA 3KK2A 2L3MA 2V8PA 4KPCA 4OJHA 4J9EA 4M5DA 3M4XA 2BJ7A 1XMOJ 1KKHA 2X3WD 4PL6A 4DUZJ 4ZGEB 3TQEA 4BB7A 1SV5B 1G1XA 2NUUG 3BSAA 5CAAA 5A2QE 3H8ZA 5IHIA 2QJ3A 2UXCF 4R56A 3M9QA 3TX8A 1VQ5Q 2M4MA 5GAN4 3L3CA 3EFOA 2BBEA 5KG1A 1X27A 1ULRA 5HQMA 3TARA 4PG8A 3BN7A 4NEZA 1KHVA 3QZ7A 4MIWA 3A1PA 3JAMY 2BQRA 3H2UB 4A63B 3MCAB 2EYWA 3I96A 3BY7A 1X5PA 4ZOSA 1HA1A 3IBFB 2QTXA 2AJFE 3DRRB 2VD3A 4R0KA 3TU4K 4HVVA 2CADA 2ADBA 1WOPA 3PRVA 1W2BS 4WFBQ 3OTBA 2H3JA 4FT4A 4NE9C 2I0NA 2CJQA 2J9CA 2DTHA 3CNQP 4NRTA 2GGPA 1BC6A 3R5AA 1B34A 2EQJA 4A8MP 4F0KA 1T9UA 2XLIA 5LMNJ 4DR2J 3VS3A 3LP2B 2XDPA 2J9DA 4PFPA 4ILRA 3GG0A 1EX4A 2MLXA 4OX9J 3RTVA 2QDYB 3MWBA 1EKSA 2DNUA 1VC5A 3KYLA 5E3AA 1U2FA 3C4SA 1ZYQA 4PXBA 1QLYA 3G7ZA 3BO2A 3QT6A 3CMQA 1D09B 3J81E 2G2ZA 2P0PA 3K5OA 4M78F 3OS5A 2JMAA 2ZWOA 5E3QA 1ZX6A 2RMLA 3KHLA 3AJ1A 1VQLS 3FCWA 2M8HA 3NS6A 3PR4A 2QMUB 5KT4A 3VAHA 8AT1B 2C2DA 2IAJB 2YNGB 3X28B 2HZAA 1V5IB 1IM4A 3D1QA 1CJKA 1N36J 3VS2A 2DHSA 4FPIA 2MLZA 4M78D 3OL9A 1TXQA 4TY8B 4P75A 1OPIA 4AL5A 3NAHA 4GKKF 1F3FA 2LQ9A 2YX4A 3KNGA 3R3TA 4CC2A 2EWHA 3OJUA 4MZTA 1E6VA 5HROA 5BXIA 3G87A 5B09A 3CXCA 2EPDA 4RTUA 1OQ3A 1U5SA 2WSEC 3UN2A 5JJBA 2GHPA 3O8VA 3K89A 2BACA 4O44A 4RNHA 1X5OA 1M5SA 1YP5A 3TYTA 5MAOA 2FO0A 1VQMQ 5A8WB 2DRAA 2IRUA 3RBDA 3OXGA 3VAKA 1JLBB 2AJ1A 3VTIA 1RU2A 4WWSA 3NGTA 1BCOA 1I0CA 1OPLA 4OLOA 4B9XA 1NBEB 2CNNB 2O4XA 3ZL7C 1QP2A 3CCLA 2P84A 1SC6A 4MIBA 5I4MA 4XPEA 3REBB 1CS4A 4PEOA 4V1Ak 1EJ7L 4C8QD 1U1QA 1YITS 1OULA 3QQCD 4KT0E 4RO0A 4EZ6A 2AKWB 2RDJA 3Q22A 2DRKA 2VBZA 4LF7J 3OJSA 4KRTA 4KV8A 1LWFA 1HNZJ 5HKCA 3PJXA 3D66A 1TWBA 4J6YA 1JQGA 2AMCB 1WNEA 4CLTA 3QGPA 2GQVA 2VG6B 4LF9J 3UPUA 2DR7A 3SB2A 1M90U 4KQZA 2ED1A 3WX4A 5I2MA 4P2XA 3VS1A 3ZBDA 2LQJA 4ZK7M 1U4BA 1SJ1A 1S77D 3S1TA 5H1SV 4CLLA 1IHWA 1L3UA 1VQ7Q 1RCXB 3WC0A 3QRQA 2L89A 1Q81T 2LCWA 1ZSZA 1RWKB 2GA7A 2CPXA 2PGCA 2E6NA 1QTNB 1XTZA 3D6HB 3EGDB 2Y1JA 1NRKA 4X34A 5KFKA 2YUNA 3NTHA 3GU0A 4FDFA 1GXTA 4RUHA 1GFCA 1JLQB 4NZ0A 4V19X 1JJHA 4DQQA 4DQPA 1ZAWA 2CQ1A 1UVNA 1VI7A 2BV3A 3L95X 2E29A 4CP5A 1HD1A 1K8AC 2FRYA 2DISA 2Y1RI 4M78A 4KYZA 3LX7A 1ZAXA 3U23A 4BI3A 4ICLA 2E3HA 4NOYA 3UT1A 4C0OC 5J2NA 2LT4A 5L9XA 4DR4F 1ZBJA 4I6AA 4N4IA 3PYEA 1CULA 4RW6A 2FLPA 4NLDA 4HVZA 3S3MA 3I9QA 2GF7A 2RO0A 2I6WA 2HHTA 1RTJA 1SQFA 2OTJA 2CSIA 2IM0A 4G3IA 1M1KU 3MP1A 3T6BA 3VVUA 3FBCA 1M1HA 2ZHOA 2R3VA 1QVGS 4E0DA 4ZLNA 4CO1A 1VK8A 3OBWA 2KE9A 4X9DA 4RZRA 4IDKA 1YCYA 4A8OA 5LJ5h 3HRSA 4FF3A 2AT1B 3TAMB 3DOMA 3L2ZA 2C2EA 3DMJA 2ZC4A 4Q8FA 4ED2A 4ZP7A 3K5LA 3OFEA 4ILMA 4RL1A 4G1PA 4DEYA 2RJEA 1UWBA 1VQKA 4Y2CA 1RHJB 1H7XA 1IO6A 3PVLA 3CC4S 1JXEA 4C8QA 3LGFA 3VF0B 3DHWC 4GBQA 5LJ3g 3DHXA 1HWJA 3JTPA 2VKRA 5ETSA 3MHYA 2BJ9A 2KZZA 2RE1A 3LO3A 5IXUA 2EFGA 1AFJA 2RJCA 2R8HA 3UVJA 5A2QY 1PJ6A 3LP1B 1U47A 5KFLA 1T95A 3HHLC 2FGOA 2RHIA 1BXNA 4YDXA 1RAIB 2BKNA 4OHYA 3J80E 1G7CB 1TOVA 4EK2A 2OH2A 1U1SA 4LVOP 1Q95G 3BKFA 4USHA 1S6PB 2YNHA 3CJKA 2R8JA 2CQGA 1JU5C 2L9DA 3MTKA 4UOHA 2XWYA 5MLCV 1OZ3A 3VU3C 2F4VJ 4DPXA 1Q7LB 5HANA 1Z9QA 1UVMA 1IKVA 3M6XA 1NHKL 1OX9A 1SVDA 2QL5B 4N8NA 1GMWA 4WIQA 3TEEA 5C24A 2WSCC 3KHGA 3R5DA 4QQGA 3IRXB 1X7VA 4KGXB 1NM7A 1O0PA 3HP9A 1VQNS 2VG7B 4NZ7A 3UCUP 1GK8A 3GPLA 2I0XA 2DHGA 3JB9D 1E6YA 1AFIA 3PIPA 3OL6A 3VGSA 4J9OA 4YDDB 3JTOA 4LFAJ 1U1NA 2C1EB 3MM7B 1G3WA 1M5OC 2QA1A 1K1QA 1HW9A 3DLKB 3VHQA 4MYTA 3Q1JA 5E0OA 5FIIA 4OYMA 3J81Y 3HHLB 2J6FA 2MQQA 4PK4A 4A4JA 4X62J 5J2MB 4IUVA 1X5TA 4DL4A 3D2WA 3T41A 4YR3A 2IM2A 3ISZA 1WG1A 1N4LA 1FERA 3QZ9B 2DZ9A 1PAEX 4PJOE 3I9ZA 5GAN6 1D8YA 1M2VB 2PE8A 3GBQA 2OIHA 3SMZA 1RTDA 2QRRA 3DLBA 3RB6A 5LJ3f 4LBPA 4DCPB 2O2OA 1UWAA 1F5BA 4B9VA 1FDNA 2OMLA 4NYZA 4XDDA 3MECA 3NG8A 1B7YB 2FLLA 5DS7A 1KD1U 1Y7XA 4JUZA 4WFXA 1FD2A 2YPYA 2CZ0B 2PVGB 3A8JA 5AXLA 1FRHA 1BQNB 3URGA 4PRFA 3O6QA 3QAUA 3C16B 3J7YI 1ZM3A 4HCKA 3LQVA 5EWFA 4Y28C 1FKPB 1FKOB 2EKHA 4LSNB 3Q83A 3L7OA 2W8LA 4OYIA 4JDSA 2AZVA 3A8LB 4FCYA 4QPXA 4E7JA 1XERA 1K9MU 3A13A 3K57A 5DLFA 4C0GA 3BW1A 3CUNA 2E41A 1OMSA 1MROA 4J5YA 3EAEA 3HSGA 3CCJQ 3GB0A 1Y07A 3OYEA 2DH8A 2EKYA 1T8EA 3HD2A 3JXOA 2B9WA 4KULA 4KR0B 2OEJA 1JRIA 3G82B 4B9UA 4KJIA 3V7SA 1ABQA 5L1LA 3UW1A 2J05A 4CQ1A 4LF5F 4MYUA 2A3LA 2VQFJ 3SSRA 2XHCA 4IUPA 1EETA 1JJ2R 2YT6A 3V6HA 2F7VA 1T9TA 3DM2A 5DM7R 3FSXA 2DGTA 3OYJA 3ETMA 1N52B 2M8DB 2EJFA 3ISNC 2EQKA 1WELA 3D68A 3MEGB 3PIOQ 2AHJB 1BE4A 3MCSA 3ONQA 4M94A 4TYAA 5IQQA 2LX7A 4YB7A 5EN1A 5D0GA 2W9BB 4Y00A 2L9WA 2IRYA 3C14B 3L2RA 1WC5A 4I68A 3KWMA 4F4YA 2RK2A 4D3GA 2CQCA 3NGUA 3OYGA 4ZN1A 2LA6A 3I5CA 4N5SA 4UF4A 2DD4A 2IM3A 1WKLA 2YNIB 5A76A 3CPWA 3MAAA 2KH9A 2YKPA 3A12A 1PM3A 5KYUA 4C2MA 3AJ2A 4JI7F 4K4UA 2VKZG 2MLYA 5DG7A 2OHDA 1XBWA 3GCXP 4FW2A 4C98A 2WHOA 4RMOA 2QTVA 1ZBTA 2RPNA 2XY7A 3QT8A 4QIGA 1REVB 5C42A 3HZGA 1LWEB 1B0VA 2JL9A 2JNGA 5LJ5g 5THWA 2MQPA 3M0QA 1YIJT 3JB9H 4P5NA 5AXMA 1N9SA 4H54A 3MR7A 4JZ3A 2L3PA 1D0YA 4DWIA 1RTZA 4J9RA 2JJ9A 3CCUA 2RQCA 5KCHA 3FZBA 1NPKA 5J2QA 1GCQC 3S8SA 3FLGA 5FD1A 2DL5A 1WSVA 3R1HA 4M7DA 4DR7F 2B56A 2OEMA 3C3LA 3FRZA 4IR9A 3MI7X 2L3SA 2NQPA 4YB5A 2MWPA 5F8JA 3THTA 2AEMA 5CH7B 2WACA 1URNA 3ILJA 3LLRA 1VR6A 4F0HA 4IRCA 3OL8A 2VC8A 3SFUA 1HWKA 3RKYA 1REGX 2ZUGA 3IG1A 1XC9A 3RAMA 3RJMB 4WP3A 3EDRB 2YKNA 4C48A 2X9HA 5DG8A 2PMZD 4DS4A 5LT5A 6FD1A 2RI3A 3CJRA 4CLSA 5B7WA 1L3TA 3DOKA 1YSJA 3KXTA 2PTKA 1D9DA 3EFSA 2NXUA 2YWWA 2ROPA 1KLMB 1QY7A 3QWPA 5T41A 1N8RU 1M5PC 4QW2A 2OPRA 2V9WA 1PNJA 5DLOA 3J7A1 3IR6B 1S6UA 3N5BB 2O66A 3MR3A 2PI5A 3R2DJ 2L41A 4M75F 5CYMB 1NSKL 3KUGA 3PX4A 3TJAA 5EG2A 1H3HA 2CNLB 1I8FA 5KFZA 4AXJA 4X1VA 1LW2A 1WG4A 4DV2J 1VFJA 3CSKA 1TKXB 4DZ6A 2W4PA 4TU7A 1K9AA 2OJ3A 1VMBA 4I2QA 1M5KC 1WSRA 2HNYA 1RKIA 4E8UA 5LJ5f 1YTYA 1N34F 1TMMA 3H90A 5J2PB 1RCOB 4L5GA 3PGGA 3DI6B 4ZVPB 3R97A 4A4EA 1BI2A 4JV2A 4O4GA 1NCLA 4OZJA 1D3BB 2IJNA 2VPXB 3RR7A 1OSDA 4ZLPA 5KCOA 1YJ7A 1FKAF 2VOOA 3I0SB 4M8LA 4P71A 1UCNA 2RU3A 4N56A 4KKOA 1N5TA 1FCAA 4NA3A 3HJVA 3SYZA 2AW0A 3R6GB 2XMKA 4M5DB 1JJCB 4OB2B 3OTOJ 4Q0BA 1CC7A 3FVYA 3G71T 1BQXA 5LJ3d 3CIZA 3F41A 4ELZC 3BZQA 2D3O1 3FBEA 2E3IA 3CCMT 3UR3C 4XTUA 2D9TA 4O0IA 1LNXA 1JJ2P 3M8SA 1GT8A 1DQ8A 2ZOFA 2EW3A 2XCAA 1APSA 3W7BA 4CDIA 3CC2A 2CA9A 3KUEA 1I5OB 2J6KA 5CR2A 2V4RA 2CJYB 2XZDB 2ZPIB 1YIJS 3H0PA 3QKJA 3GNGA 3V6DA 4FZVA 1TAQA 3C94A 4NXNJ 1U8WA 4DA4A 4RCCA 1S79A 5IV4A 3M05A 1VQ7S 4JI2F 1WTFA 4JV5F 2K5LA 2K7KA 2K2MA 4V2SA 4QR1A 4R8UA 3MMJA 4YS2A 3UA6A 2P6SA 2XO7A 4O5VA 5KFXA 4O3NA 1WJQA 4LD9K 2WZ1A 2NSCA 4RG2A 3PHTA 4LSLB 5I2SA 1B34B 4HACB 5HK3A 1PKTA 3NRBA 1NU4A 3I82A 1S1UA 4XPCA 2EEYA 3GILA 5AXNA 3UNGC 4BY6C 2J7UA 2V8JA 4UZCA 4X4NA 2VBYA 3LH2S 3A3OB 2HSPA 3N0VA 1HNWF 2KDSA 1N0UA 1UMJA 2B7CB 5BR8J 1HPZB 3ZNUA 2F9DA 2DA9A 2CPZA 2BXJA 1T9VA 1DQ9A 3M30A 1KJWA 2ZKTA 5DLQE 1TG0A 1FO1A 4DR6F 4XTTA 1T0JA 1U06A 3MPVA 5IS2A 1OI1A 4LFCJ 5DRKA 4N0AA 1Q4RA 2VH7A 2JFKA 4OYAA 1MNDA 2HHQA 2HNDA 1SHFA 4N76A 4F3QA 1K8AU 2EQUA 1RAHB 3QDRB 2X35A 2OAWA 3DB3A 3WQPA 2H5JB 4KT0C 2QA4A 4OGEA 2YQ1A 1T3NA 1Q82C 3RUBL 1N32F 3IWXA 1H38A 4I69A 1FX4A 2UUCF 4TQSA 5E5NA 4ZJQA 4LUEA 3Q23A 1MGQA 2OEKA 5HROB 3PTWA 3X24B 3N5FA 5I3QA 3K59A 1OSCA 4KUIA 3DDKA 2XZWA 2COWA 4TLRA 1W2BA 2ATLA 1BWVA 4BY6B 2XC9A 1YJNT 2I2LA 1W26A 3I6PA 2DVEA 3PZPA 1S9GB 2I2YA 4GY5A 1RT1B 1UGRB 2E5JA 3ZZTA 5EHHA 3DXSX 3U1LA 1MU2A 2J06A 3PMTA 1XTDA 1P1LA 2O4XB 4AFFA 3BGRB 4OMPA 3KHRA 1CS4B 1XN9A 3BSNA 1X8DA 2KG0A 3NGSA 4DV3F 3OHBA 1TAUA 1VQPT 4FYXB 2CZ9A 2G1DA 4QWEA 1Q16B 5G4DA 2XG8D 2RQRA 2D0QB 2M51A 1FMVA 2EI5A 3HVAA 4LF6J 1NAQA 1FESA 2HFUA 2DBMA 3FNNA 4ALZA 4ZCLA 5IXBA 2UVRA 1JBMA 3T1YF 2KROA 4K2JA 2P4TA 5IM0B 4Q2LA 2QL9B 3EGUA 3GF5A 3KXDA 1LPLA 2JVVA 2RN8A 5ETRA 1QM9A 3W8GA 4X65F 4L75A 2YX1A 1GBRA 3R9LA 3GWCA 5HVHA 7FDRA 3NNHA 4WYLA 5E3RA 4OHXA 1X6OA 2O5DA 3VS6A 3P8DA 2NREA 3CIMA 1RWOB 2MQOA 1N9RA 3BM7A 1LCKA 1Q86R 1HARA 3MPWA 1JLCA 5DQGA 4EGLA 3PXGa 1KC8C 3PFOA 2D3ZA 4C92A 2KEAA 3M8QB 5DJBA 4G1QB 1B07A 3P6YC 4C8QG 1TFWA 2GZOA 3QHSA 2VU5A 2JS0A 2DO0A 3FMWA 2OPPA 4M7AF 3TI0A 1KQSA 3VCDA 1FDBA 4Z7CA 1IREB 2DY9A 2RILA 4FW1A 4NLPA 4XAKA 3GP9A 1YITA 3D6TB 5EWEA 2QQAA 2RS2A 1D8ZA 3CCLQ 5H9EK 5LJ5d 2JEFA 4A8XA 2EPIA 2HBPA 2KSSA 3CDAA 2EBGA 4O6JA 3D5MA 5IWAJ 3OT9A 1SJ4P 4KB7A 1JB0E 4PJMA 1HQUA 2MMYA 2E1MC 4M7AD 4AFSC 2AK5A 3PNWC 4DV7F 1HKAA 1WHVA 5SZTA 3PVXA 4B3OA 4OYWA 4NL5A 4FS2A 3T5JA 1RTIA 4LR7A 2E1RA 2DITA 5A6WA 3ITHA 3S6EA 3QRPA 2K1RA 1Y11A 2VUGA 3R6NA 2HK3A 3TZXA 2ZUAA 2RS8A 1NE8A 1WC1A 3CMAQ 3EGXA 4QBUA 3HP6A 4KH1B 3DRPA 2ALYB 3CCJS 3HHTB 1JJ2S 5KFUA 2DO3A 2P9EA 4ELUA 1RI0A 3PEJA 4C7QA 2LQWA 3W61A 4JYAJ 2FL7A 3MOZA 4BLGA 2RAQA 4NLGA 1VUBA 3GMGA 4G6VB 2PMWA 5E3CA 4DV1F 4Q8EA 5D78A 1VYUA 1JLFB 1IRXA 4K50A 2HGMA 3B78A 1KFDA 3CJKB 3ET6A 4EMKC 4ZCIA 4EZ9A 2XS2A 1X9SA 4KFBB 2C2ZB 3NL0A 2K4YA 2GAGC 1BI3A 2OGUA 2HMAA 1XMOF 4IRDA 2FPDA 1TP7A 2QYZA 4MKYA 4PJOC 4DUZF 4TY9A 1T11A 4DBFA 1HBOA 2CWXA 2LC4A 3H5XA 2DL3A 4EYHB 3B6BA 3KLIA 3NMAA 1RB0A 2KT3A 3SI8A 1VQPS 4RUCA 2WCXA 1UZDA 4MJKA 1QVGA 1HMVA 4PG5A 3HVTB 3G6EA 1JLAA 1E6YB 4OV1A 3NGRA 4NCGB 1LK5A 2C0IA 2LXUA 5C2GA 2RQUA 3OFFA 3RB0A 4QR0A 4Y92A 4BS2A 3RG6A 2ZH5A 1FJ7A 1VRTA 3PKMA 4PXEA 2SXLA 5GMKm 1RQ0A 2COZA 2DXUA 2CG8A 4J9NA 3LW5E 4HL9A 4FBUA 4FIBA 2XDDA 4FP9A 2W10A 1S1XA 2KT2A 2CQ4A 2ZITA 3T9NA 2HMIB 4O4RA 2FVUA 3ENQA 3EG2A 3CCRT 2P5VA 2DR5A 3VAJA 2XMMA 4CLFA 1I1GA 5AE2A 2ZPEB 5GAEI 2MOXA 4PJOF 1LFPA 3HCXA 2QEXA 1IBLJ 4M7AA 5LMNF 4CC7A 4F02A 2U1AA 4WJBA 2A08A 3I56T 1VLOA 3QWUA 3OB9A 2C2RA 3CC7T 4PJOB 4GC6A 2FPEA 2IVFB 1LXNA 2G2OA 3MM5B 1VQOA 3ADAC 2ZBCA 3BN4A 3S01A 3JB9G 3GNFB 2MZQA 1XNQJ 2RHXA 1MV3A 3SFMA 3E8OA 5T7LA 2K7AA 3LH5A 4QU7A 1RWMB 3CMEQ 2MIOA 4OYOA 5KOXA 3OYBA 1N5SA 1NEBA 3MM6B 3ZFJA 3PV8A 3BGUA 1VGYA 3KJNB 3OS1A 4OB0B 4XTZA 2I38A 5CKHA 1OEBA 2I5JA 4ZVFA 1SSFA 3H7HB 2IJFA 1Y96A 4JRKA 4K5SA 2GMJA 3P8HA 3OW2S 3ME9A 1XR5A 1NSAA 1FFSB 3M2UA 2X3GA 3MM8B 3OBYA 4OF1A 1MROB 1Z2LA 2AF6A 4I2PA 3PIPQ 3IQLA 4CRJA 2C2OB 3Q2SC 2HS3A 4YP3A 1RAGB 2VFVA 1QWFA 3RU0A 4F4ZA 4P2MA 4IO1A 2R2UA 2KBTA 2HS0A 3ZTRA 3SD4A 1J2VA 2BE7D 1LV5A 1UW4A 1OYXA 1K73R 4OZ1A 4CLYA 1WEXA 1UB4A 3RGIA 2XYPB 1KP6A 4IUTA 4DSKA 1RBAA 4KO0A 1YJ9T 4QWAA 2ZHAA 2QL7B 1F9FA 3W5ZA 3MEAA 5FROA 1SKWA 3AFGA 5M2UA 2YLBA 4J91A 4M7DC 4QU6A 1QCFA 1GTHA 4HKQA 4RUBA 2BX6A 2MSSA 2BJDA 3VV0A 2DGSA 2DPJA 2BM0A 3UD4P 4XU3A 2ALZA 4M7DG 4M5LA 3UQSA 1DTTB 4J9GA 1HNZF 4C6AA 1TKTA 1WI8A 4C8NA 1D9AA 4FL6A 3DYAB 1ZBXA 3OV7A 1YCSB 4EFAC 4LF9F 3EX7B 1S48A 5CKFA 1FNOA 1TKDA 1ZETA 3BPSP 2BE2B 1OYDA 2LQ5A 3DCAA 2ZH1A 3FDRA 3IS9B 3ULRB 4HCBA 3BBCA 2IDEA 1QAIA 3R7SB 1IKWA 4Z89A 3UWTA 3CCQT 3SDEA 3DLLA 5C42B 2QO3A 3THVA 2GX8A 2V4JA 2RDDA 1BU1A 5L23A 3CCZA 4F7UE 3N79A 3VQTA 3FJPA 3LF0A 1UTIA 2DGOA 4ZJOA 1ZA2B 2HYIB 2IM1A 4OI4A 4HHJA 4M5JA 2XO6A 5J2QB 4WZQA 2PUKB 3TVYA 1Q7YC 4PWDA 3AA8A 5B0DA 5FW9A 2JC1A 4M7DB 2B5JB 1YBUA 4QIVA 2DRDA 4ZMMA 2HGNA 4C5EA 2M0GB 1X9MA 2EKOA 2J6OA 5KFJA 1CJVB 3WVDB 5A0DA 1WDTA 2DTIA 3ZTPA 1U1RA 4PQUA 1HNIB 5FWBA 1VIXA 4TKTA 4PPZA 1MN7A 3CC7S 1ZUKA 1Q86U 4HH1A 1T03B 3AOCA 2B51A 1WWHA 4ORZA 2YY3A 1OU8A 4LRDA 2EJGA 4NLXA 1GXUA 2HHUA 4DDFA 2HHSA 2CYYA 3RBBB 1KTQA 2W4CA 1ZM2A 4ED7A 2Z2LA 2YKOA 5H9EJ 4GVLA 1WEZA 1RA7A 4DL3A 3DOKB 3RAQA 5G0RA 1IZ6A 1FRMA 2ACMA 1R8OB 2FB0A 2IVWA 2FVQA 2COLA 3DRSA 3JCMV 4ILLA 1AWJA 1S57A 4J9PA 4IH7A 1S1NA 1YHQT 3EGWB 1XMQF 2HNZB 2OPRB 2GQQA 2MHEA 4A8KA 4MMOA 2AEFA 2FVPA 3L2VA 2R7TA 5L8RE 1YX2A 2DL8A 3H0HA 6AT1B 1YNZA 2GCXA 1J5EF 2MSTA 3OSPA 3JTNA 4HHUA 2CPHA 1HHSA 1NH7A 3A8MB 2IVYA 2ZHBA 2CQHA 1PYSB 1LW2B 1TL1A 4XK8E 1TR0A 1Y57A 1FRXA 7AT1B 4Z8AA 1NKEA 1M9SA 2V8DA 5LXYA 3CCUQ 3QT7A 4HI1A 2IBOA 3QFHA 3GTYX 1IJEB 2F4VF 3I5RA 4ZJLA 1GFWB 2FHMA 2HQXA 2DILA 1QVFA 2F8HA 4CT9A 5SUHA 3FJ5A 2LXFA 4NLQA 1AVZC 4X4UA 1GMUA 5KG3A 2DXDA 4A8QA 5KE3A 1MMGA 1KN6A 2GJ2A 2H8HA 3LYIA 2RHUA 4IKAA 2CNKB 4MDWA 2MQLA 4FM4B 2ZFHA 4BD3A 1RT4A 1Q82U 1AB8A 1SPKA 2R9LA 2B43A 1HNXF 2MQ8A 5EX0A 4P72A 2GJIA 5F3ZA 5HVGA 1W25A 1Q5YA 4OP0A 4Q0BB 3W8PA 2CREA 3HVWA 2ROGA 2GFFA 5K14A 3ENAA 2GJFA 2R7XA 1I4K1 4MKAA 4NMXA 2IIHA 1HWIA 3L2WA 5A6PA 4ZP6A 3ILOA 1VQ4A 2R7UA 4M5NA 4AFQC 2OTJT 2O67A 4AL7A 3KOAA 2ZNYA 2RDIA 1SUQA 1MNEA 4WTOB 4X62F 3VKIA 1TUDA 4RNOA 4UTGA 5KYYA 5HSPA 1Y5IB 4X4TA 4AQYJ 4WBFA 2H3EB 3AH6A 1GAOA 4EO8A 2W2QP 4IIMA 4RW8A 1OX8A 2VVKA 1HL6A 5C5JA 3NOGA 3LH0A 1UE9A 3V6DB 2ACYA 4DU7A 2E1PA 3B4MA 2RHSB 3MOJB 3POTA 1U1OA 1YJWQ 1RT3A 1S0OA 1VQKT 3QYHB 2K2VA 3BV8A 4R8UB 1B64A 1J27A 2ZJPQ 5U47A 4TU9A 4ZPWR 1U6BA 2MJNA 2K79A 2R5AA 2WONA 2ZM6J 3DGPA 1R8PA 4DV6J 2ZPFB 2F9JA 2G6FX 2R8GA 3MEVA 4YN3B 3H2VE 4BHQA 1Y3KA 3R5BA 4D8DA 2DY1A 2KT1A 4LMZA 3US5A 2CP3A 4J6XA 3FRYA 4CM0A 1S1UB 4ECQA 4IKFA 4PCQA 4PQAA 4LDYA 4GMKA 5C7PA 1RHRB 2ZKUA 1SSHA 4I1TA 2FY8A 2I9SA 1HBUA 3JCMX 3IBCB 4RW4B 1EQMA 5GMEA 4F04B 2FD2A 3BO4A 4TQRA 2ZOMA 1UZHA 2B8QA 3SSQA 5CA5A 3W2VA 2AJQA 4U7UK 1NJIU 3V81A 2UXBF 2JZ5A 2YKAA 2QLBB 1AZGB 2HHPA 2XYHB 4LDXA 2VYTA 3CCLS 4B3RF 3JB9k 5GAOr 1KDNA 3M0PA 4EEYA 2HNDB 1N33J 1K73T 3KJFB 2MB0B 4HTIA 3M0TA 1VYVA 4K4ZA 4BDPA 3K5MA 4H4KA 3CDUA 4CO0A 1AWOA 2Z0WA 2LEPA 2HZYA 3NNCA 2Y0BB 4DBHA 3GP8A 4I56A 2O9VA 4IFYA 2VJVA 4ETXA 3CC2Q 4S0MA 1RT5A 5IT0A 3J80U 2VQFF 3T1HJ 4BE0A 2DNGA 3I5BA 2XU8A 3QO9A 3PHEA 4DFPA 3OR1A 4DSLA 1DURA 1WYXA 4WZMA 2FUG9 1NDCA 1RXOB 1N5YA 5D0RA 2ZPGB 4UUWA 5IT9U 1C0TA 1PWTA 2AZ3A 1X60A 4DLEA 4C92C 4CRIA 3P96A 2LXIA 1PBUA 2DVIA 1S72A 1YJUA 4ECZA 3PFEA 3DU6A 4HEA9 2DYIA 3A8HB 1U49A 2MKJA 3H9NA 4DX6A 2V8VA 4C92G 2M16A 2MF2A 5E3PA 1U0HB 4XIUA 2DH9A 2OTLA 3DLHA 1CVJA 4DUTA 1JLEA 3JCMW 2DL4A 3GFHA 1KTVA 4ZVGA 1U1MA 2AEJA 4EBDA 2CRLA 5CZXA 4H4MA 2RMOA 3OLAA 4WFNQ 3PDNA 5HBMA 4JI3J 4VUBA 4F4WA 3D6FB 4IOAQ 4ED6A 4OI6A 5J1EB 1M5Q1 2YQ3A 2OTJS 2BJ3A 4M77D 3AB2B 4LE9A 1PILA 9ATCB 1S1TA 2DNNA 2Q79A 3MTJA 2RUSA 2W7AA 4EWTA 3QJPA 1R8AA 2RM4A 3LGLA 4JPBW 1KFZA 1PCAA 2WSEE 4DX8H 4HH0A 3VJPA 2FVRA 3X26B 1C1CA 1OYEA 1UJ6A 1H3ZA 2HLTA 2E9RX 3TVKA 2NYIA 1N54B 3JSRA 1VQKS 4N8OA 4A4HA 4C92B 4C3KA 3LALA 1LW0B 1YBYA 4F8RA 3CD6T 4UT4A 3ZTQA 1H6KX 4FNIA 2ZH8A 4H4OB 2G9OA 2QGFB 5KFPA 2NCKL 3LTOA 4K4VA 4TXSA 3TREA 4IFVA 1N5QA 1R89A 4LBHA 5GANj 3BQ2A 2QK0A 4HR2A 4L72B 3DDIA 1WF2A 5DDRC 5F0UA 1RAOA 5ETPA 3MHXA 3BGFA 2JS2A 4II1A 5B0AA 3G86A 3R7BB 2FDNA 2NYHA 3M2RA 2WW4A 2JVOA 3KJQB 5HATA 1NYFA 4A4FA 2MTLA 2UUAJ 5A8KB 5D6GA 3GG1A 2WBRA 1FNMA 3G71A 1RADB 2JEJA 3DDNA 4ZTJA 4IURA 2JTMA 1J3TA 5HMZA 3QWXX 3RRKA 4OLPA 3CCMA 1HBMB 5I11A 3PT9A 4QW8A 2LU2A 3QYGB 2KXFA 1IB8A 4IQMA 4B3OB 1GXIE 1WHKA 2MI6A 2P4RA 4FPRA 3KFWX 3ITHB 4DV2F 3D4JA 2HHHJ 1M27C 1T9YA 3MPYA 4ZCKA 3EGXB 3ENWA 4J9MA 1TUVA 4RNFA 2LYVA 5GAOn 3S3OA 2GGRA 5HMWA 3TUZC 2ZAEA 4GKJJ 3PRDA 1S1WA 2J8SA 2GCFA 1CBKA 5KFIA 4OGCA 2J0QD 4YR0A 4ID5A 5D3GB 3G6XA 2WOMA 4RTYA 4PJJA 3MEEB 4XQ3A 2XMWA 2CPEA 3LW5C 2KKHA 3OYCA 1TQLA 4M77A 4KRWA 1WC4A 1PHTA 3QSYB 2OPSB 1I51B 2CPIA 3AOAA 3TVZA 4YFUA 4WFAQ 2W1BA 2QLXA 2LCCA 3J7Z5 2XSJA 5KFDA 3EHQA 4Y91A 4PG7A 2BQUA 4PUOA 2KNBB 1D1UA 3ZZOA 1OIAA 1T3SA 4FXWA 1J5OB 3OTOF 3QO3A 3V4IA 5GAHI 4MFBB 3THPA 2VFTA 5DDPC 1M90C 2HQHA 5L1JA 3TSZA 3MUMP 3K0JA 3PJ9A 2A10A 2X4XA 2HWIA 1UDLA 2LKZA 2MCNA 1SH0A 2W2MP 3CCET 1YITQ 1JLAB 3MURP 2NUTA 2YLCA 5GAOm 1T05A 1IWAA 2KRBA 4XTVA 2EFOA 4QR2A 2FZCB 4C8OA 5HLFB 4DR1J 1VRTB 2KXHA 3CDWA 2BTTA 4AD6A 2X1AA 4UY8T 1LXJA 4YQWA 5ADZA 1DTQB 1KQSR 4W92B 2RI5A 1EP4B 5CKEA 1TU0B 1X2QA 1DZ5A 5KT6A 3LWLA 4ME7A 2ILYA 1D0XA 4D3HA 1E6GA 5IV3A 1JJ2A 4HHHA 5KT5A 2HBRB 1NSQA 5GAMh 4OYXA 4PPDA 4EYIB 2Q1LA 1D9FA 1U3OA 1NB2A 5A8RA 3B4DA 3WVEB 2JZ2A 5ETNA 1VYAA 5HMYA 2J5AA 2KU7A 1ARKA 2DNKA 1UGVA 2O88A 3J81j 3D3CJ 1R8BA 4PNOA 1YJNA 2WVCA 3A5ZB 2DNMA 2E5QA 4CYUA 3CD6S 2IG0A 3KNAA 1YBAA 1V1CA 5ETTA 5BR8F 1SIWB 4NI2B 5I3UA 3KJVB 1MWYA 3RZAA 2UXDJ 3BSCA 1SKRA 3OBIA 1Y3JA 1KHWA 2CQ3A 2YPZA 1EHWA 1CQNA 2AYMA 4DXLA 1GH8A 5L9NA 5FWCA 3GR1A 1RP5A 2HZVA 3TA1A 4TU8A 3N9UC 1VQPA 1QCOA 3UD3P 2Z58B 2I5JB 1Q7YU 2K3XA 2L5QA 2F8MA 5EDWA 1HNVB 4JJBA 3FK4A 1KQGB 2DBKA 2JLGA 4EPCA 1HLWA 3K8VA 2FJEB 2PDAA 5GANe 4PXDA 4AFUC 3NFCA 4DR3F 4LIWA 2X3DA 2FYXA 3CCST 2HL3A 2XBPA 2C2MB 3N6LA 3TAPA 1TUCA 3CPWS 4KSEB 3I32A 5KYXA 1H641 2DNZA 4P9SA 3KFVA 2W2NP 3IP0A 1JEGA 5J39A 3FCHA 2ZDPA 1GQEA 5CCAA 5C25B 5LMUF 2M70A 3TZZA 1FWPA 5M9OA 3FKBA 3OYHA 4IR1A 3OPKA 4PWWA 2ZZDA 1JJ4A 3META 2VASA 1P27B 2H51B 2W9CA 2CUBA 3CDBA 1KQFB 2B4UA 3MR2A 2DVJA 4L6V5 2Y4XA 3CCUS 5LXRA 4J9CA 3UPFA 2RB6A 3PW0A 1VQ9T 3H42A 1FX7A 4IQXA 1NHVA 3G1JA 4DCOB 5KFYA 3KDOA 3LOUA 4P7TA 3OYAA 4LF6F 3M8WA 2BRKA 4GLMA 1HI1A 4LR8A 4CTAA 3TW0A 1QSYA 1O51A 1VK3A 3BR8A 3NWGA 3CBMA 1N6QA 3R27A 1VQ8A 2YRDA 4R55A 1WTBA 3KDNA 4Z37A 2PQWA 2F40A 3THKA 3D9BA 1T0HA 2UXCJ 4NASA 1GRIA 4F50A 4JRQA 1TMJA 3IGVA 3QJJA 1S1VB 5ETOA 4RKUE 2GVDB 4HI2A 3GFZA 3CEDA 5HJXA 2EAYA 5D77A 4IH6A 4KHRA 3SDEB 2YKMA 2DR8A 4A54A 2EK1A 2V4JB 4F7UF 2KRSA 1TL4A 1B0PA 1KC8R 3CULA 2AKKA 3M8PB 4QVDA 3CJQA 4BBYA 1JIHA 1H2VZ 1YDLA 4JI0F 5F8HA 1RWNB 2QA2A 3AHUA 4X66J 2XMJA 2MKSA 4F7UB 3PRBA 2IMOA 2QA4T 1UGPB 1KD1C 1RU1A 1Y0MA 5BYQA 2YUPA 3I55T 3MM9A 3BKTA 4I4BA 3EZOA 4A8FA 4PQUB 9RUBA 2VZ9A 4LREA 4NA2A 3TRGA 3KLFB 2R2SA 4PFOA 3V6KA 4U8VA 3M58A 2RQMA 1O5JA 3E3XA 2DNLA 3Q2TC 2ZD1A 1T94A 1YJRA 2RHQB 1SXLA 2A0FB 3W9JA 3CJSA 1VCTA 3RKWA 3DLEB 2IA6A 1K9MC 1KQSP 1FTCA 3EGVA 4JLIA 4HKEA 2WBMA 3BDLA 5IWAF 2XDBA 2PT0A 2DBBA 3W5XA 5G0RB 2R58A 5HI7A 2XY5A 4KPYA 4UC4A 4PLLA 5CYQB 1C2PA 2C0OA 4Z88A 4F3MA 3L2UA 3RBXA 1RGVA 3A98A 3ZC4A 2FIUA 4C5HA 4O3QA 5I42A 1SI9A 5CXTA 1FI4A 4USTA 1X4BA 3BB5A 5DETA 2JOYA 1IJFB 2HHWA 4CI0C 5CQGA 4USUA 1UEKA 3KKFA 2AGOA 2FC8A 4JYAF 2AQ4A 3DLLQ 2D3OR 4JP8A 4JI6F 1MWQA 2HBZB 5CYJA 2EC2A 1SKSA 1GL5A 3A3NB 1R6VA 3CCRA 2EGCA 2A6MA 1VBXA 5KG7A 3CC2S 3A3PB 4IIOA 1K0SA 1YG0A 2FJXA 3MMCA 3NNAA 4HT9A 4U7UD 2WW8A 2VC0A 1KWMA 2G0CA 3KLHA 3I56A 1Q8IA 1HHTP 2XK0A 3CC7A 4ED3A 4DSIA 2CPFA 2M1HA 5HP1A 1G2EA 3NCPA 2J6TA 3JCMP 3EVOA 5KG4A 3CCWA 1H0HB 1ZH5A 1RT4B 4K4XA 3MEDA 3I0RB 1C1AA 4ANEA 5M2RA 2KGTA 2PIIA 1O9SA 3M0SA 4DV5F 1D1BA 4UOFA 3EGNA 2AD9A 2LFVA 3BS9A 5K14B 4RBVA 1VRUA 2MZRA 1NEGA 1T0TV 3FC3A 2DHAA 2DIUA 1RHUB 2FYKA 2RH3A 4CI0B 1FXDA 1A0OB 5CQYA 2PFFB 1CQMA 3WHIA 1V5VA 3JCMe 1WHJA 3D0HE 2HHXA 2XZTB 3C6TB 2H5EA 4MIAA 2HQIA 4DU8A 1C1BB 1BI1A 1WXTA 4MT1A 5KT3A 1CJUA 1S9EB 4RW8B 3E01B 1MV0B 1LOUA 3RB4A 3BJYA 3AA9A 4LF2A 1IBLF 4HLBA 4FVCA 1HYSA 3POTB 2QDLA 1RT3B 3W2WB 2FC9A 4L3KA 1SL2A 3MMAA 3W9HA 1TL3B 1U6FA 3NS7B 2IYIA 1TUGB 2QA4S 2R7VA 2DXCA 2DEUA 4X4RA 2RF2A 4ZPTR 3BDPA 5GANh 4LSZB 4X4PA 1BB9A 1V3RA 2HK2A 4FKYA 3I55S 2ZH2A 3C2PA 2RHZA 1YJ9A 3JQJA 3W3SA 1BY9A 2JWNA 3HMJG 3RB3A 3UCZP 1SB6A 2JVRA 2Z0GA 2KQWA 3FMBA 3SEOA 3CW2C 2RJDA 1IM6A 3BYPA 2QSWA 1N8RC 4QWDA 3SWNC 1VQ5A 4IRKA 2J9DE 1HBUB 2ZH3A 1H3DA 2XTJP 5GAMf 2QC3A 4B6MA 3FSYA 4N7TA 4U8YA 4JUVA 2B7BB 3HXMA 3TZWA 4DHVA 1R0CB 2W7PA 3FCVA 4QJVA 3DOLA 1YZ7A 2BUNA 2PC6A 3V81B 4ZLJA 3G4ST 4NL3A 2KRNA 1K76A 2QLWA 1VQSA 1NDKA 4CT8A 1QVFR 3LP0A 4MK8A 3HDSA 4B3TF 1SCJB 3R1LA 3EG1A 4Y65A 1I94J 3Q89A 1MWZA 3CCQA 3G6ET 3D28A 3MD1A 2ZH6A 2CQ0A 3M7VA 2PEBA 2E5KA 1Z9ZA 2JMCA 2B6AB 3KLEA 1G3TA 3EMTA 3HI9A 2G3RA 3IN5A 1RT5B 4TYBA 4F16A 4NCBA 2WAQD 1NG2A 3AAWB 2YX7A 1RZMA 3MXHP 4RW7B 1UTAA 2BZ2A 3OR1B 1FJGF 4CH7A 3EXCX 2CT3A 4J9DA 4ENOA 3SWNB 2AJ0A 1N5YB 4K0KF 2HQCA 5F8NA 1FK9B 2E1CA 2DTJA 1IGUA 1C0TB 3JB9J 3J7ZT 4FVMA 3G8SA 2LT1A 2QEXT 2W24A 2V2VA 3TQ1A 3FBFA 1NMEB 3HT3A 2BE9B 2MZSA 4JI8F 3CBOA 2FY1A 3AQOA 3ZXWA 1RWUA 1SV5A 5D6XA 3EG9A 3M9MB 2HFOA 1WKJA 2MYFA 1HSQA 3PNIA 4QIWD 2CH4W 2VL1A 1VQOT 3DRYA 3FSIA 4CH0S 3GIBA 2KB2A 2ZDOA 3MCOA 4RTVA 4H4MB 4ECYA 1QVPA 4DR5J 3QBYA 1KQSS 3OY9A 1Y4ZB 3OTEA 1KC8T 1YHQA 3CCVT 5IZHA 3T6JA 2V67A 2OX7A 2BJEA 3NGDA 4K4TA 1UEBA 2B8PA 1S1TB 4C0HA 3NS5A 4NLYA 1TV6B 4F3OA 4Z2XA 4LF4J 3KG1A 2PA3A 2XULA 4IG0B 1E7OA 1VQMA 1V3ZA 1NK5A 2NWMA 2G0IA 1KK7A 4QQDA 3M1VA 2R57A 4K11A 5GAHU 1YIJQ 4DQ2A 2BEFA 3RUXA 3BE3A 4B9TA 4U96A 2VOPA 2LEAA 1LK7A 2C06A 3G8QA 3OUYA 1UAWA 1KHCA 2ROTA 3OVAA 2E7WA 2Z56B 3S6WA 4ZS6A 4HYKA 2K8GA 1CKAA 4WU2A 3CBPA 1JO8A 3PMIA 4IFVB 3I87A 1X2KA 2BKDN 2KT5A 1RA6A 3D67A 1UVKA 5K8OA 2RF0A 3VALA 4M77C 4M78E 3FQKA 3TJ9A 2RA2A 3RW6A 4ZLLA 2PVOB 2HKNA 4DF8A 4WK1A 4M77G 5C0MA 1Y7PA 2IAJA 2YNGA 1IBKF 4J7FA 1H2UX 1RI9A 1NK9A 1V76A 3ETOA 3IM8A 3FFIB 2DIGA 3HRUA 3MDFA 2J7KA 3DC2A 3DLGB 2XS5A 3NTKA 4I6YA 4NX9A 1OV3A 1Q81U 4BI4A 4TY8A 2V4QA 2HRUA 1F0XA 3HSDA 1S5ZA 2O3DA 2ZOGA 2HFVA 1MMNA 4R25A 5GAN2 4N4GA 4E7LA 3C12A 3LANA 1WD6A 3G6ES 4X4VA 4OMFG 1ZM4A 3Q24A 2PSZA 4WYWA 4C8LA 1UFKA 3VWSA 2V2KA 3M6WA 2V8KA 4C8QE 3PTAA 1BYMA 4OHVA 5A8WA 1RAAB 1NNDA 3R2CJ 3OS2A 2NLWA 2HGLA 1JLBA 1NK7A 3MAQA 2WOMB 3HHEA 5LOQA 1NB7A 1WJSA 2XI3A 2CP6A 2C3YA 5DGAA 3JCMh 4DMZA 2ZNZA 2DAQA 4M77B 3C8YA 3NKYA 4CH1A 3HFKA 3EFRA 2FJVA 1PIEA 5D0HA 3C6UA 1QVFP 3HSZA 2RD1A 3CPFA 2MJUA 1YI2T 2PI4A 4PUOB 5AJ3F 5GANg 3M4GA 1NKCA 2XY6A 2QASA 2QEXS 3EXYA 3NGPA 3V4IB 4DPUA 1U09A 2XMAA 2UUWA 1IWGA 2WSFE 1FVQA 4ZHRB 3G6YA 2FHOB 1W70A 1I07A 3CO0P 2KYMA 2ADCA 4QWBA 2MXYA 3BO3A 4RW9A 2CS7A 2C22A 1VQYA 1VQOS 1P9QC 3BEGB 4OMFB 2VONA 4JI7J 3M32A 5C6SA 5IT9E 2RVJA 2ED0A 1B3TA 4AQYF 5F3TA 4DFKA 3GJSB 3P5BP 1DRZA 4ZNXA 3G71Q 4ES3A 2YWFA 3CCVS 2HQEA 2RQVA 2CJBA 1M5HA 3CCMQ 3UDLA 1JNRB 2OMOA 4PKDB 3H4BA 5GMKe 2KZMA 4RTXA 2IC3A 2E5IA 4J37A 1HR0J 3R6OA 2ZM6F 4GRSA 4UUXA 4NLVA 4DV6F 3KG0A 1RWWB 4MKVA 2QYGA 5A8RB 2ZJQQ 4DR7J 1AROP 1ACMB 2GBQA 1XR7A 2MDAA 5A0LA 2HVEA 2JLEA 2MZ1A 2W2OP 2OLWA 2VBXA 1IXDA 2DF6A 1K44A 1WC3A 2UU9F 3W60A 1X0FA 3SCKE 4ECTA 1T02A 2DCUB 2B8AA 1CG2A 1QKWA 1RBOB 3D1HA 1R0AB 1DLOA 4L6V3 2V2QA 2CZ6B 2DZCA 2DGWA 1RJJA 1NH8A 3TUPA 2WVDA 1FNXH 2CQIA 2QXFA 1FJEB 3D0IE 2NUZA 3TAMA 3M8YA 1N33F 2SRCA 1QUPA 3KLGA 5GANf 2CQBA 1GMVA 4USMA 2NUHA 3MP6A 4ECSA 1A9NB 4GVBA 4HT8A 2W2PP 2BZYA 4DPOA 2ABYA 3VS4A 3REAB 3HULA 2BANB 4B9LA 1U02A 3QIPB 3K2YA 1VQ4T 1IVZA 2E66A 2R2RA 1OS5A 5CHCB 1Y5NB 1G5VA 1Q8KA 1S6PA 3SXLA 5GADI 4JV0A 4RKUC 2XB2D 2O1PA 4JI4J 1FWLA 4OMLA 1Y9OA 2IHR1 4CZCA 2XSFA 2QGGA 1MMDA 1QSSA 3M8RA 1N34J 1F60B 1R31A 2W9CB 5DM7Q 1VC6A 1FVSA 4ECRA 3UDEA 2WK4A 2D0NA 2B3TB 1UECA 3JQMA 3CD6A 2VBWA 4L74A 1RT7A 4Q5VA 4FBTA 2YNFA 3IRXA 4F25A 1QTMA 4DN9A 2HFNA 1YJNQ 3M56A 1WFWA 2E1AA 2CVEA 2DPPB 2V5HG 4LF1A 5JXSA 2VPWB 1N48A 1U8RA 1LWCA 3JV3A 1M0SA 1JK9B 1KG1A 2RQKA 1UVJA 5CCLA 4JI3F 1N6QB 2N7CA 1ICEB 1T7PA 5D8HB 3OVBA 2KJVA 1RLDA 2OKQA 2XNRA 1XK8A 2X4JA 2Y0SD 3Q0AA 3UDVA 1VQPQ 2CAJA 2JH3A 1S6QB 3HKWA 1MHNA 3W1YC 4RWXA 4DCJB 4K8RA 3V8JA 3TA2A 1R77A 1OO0B 2RQ4A 2AGPA 1FRKA 2C0TA 3CJ3A 1YZ6A 3UR0A 3KK1B 1ZA1B 5H9FK 3MPDA 2A2CA 2X4WA 2R8IA 2VV5A 2GS8A 5CKBA 1FMWA 1CLFA 4NLSA 1HIYA 2GQIA 4EMDA 4JI2J 1UETA 4JV5J 4QT7A 2L9NA 2FRWA 3BSOA 3MR5A 2LCLA 2LZ6B 4PKCC 3HHKA 2R2TA 1Q79A 1H74A 4DX7A 2L3RA 1RHKB 4RTWA 5D6WA 4M7DE 4OJ3A 1DAXA 1LWXA 1U6ZA 4J8OA 2BW7A 3PX0A 4IG3A 3JAME 1X9WA 1BQNA 2ZD1B 1ZTTA 1XEZA 1CJTB 5CVIA 3WX8A 4B17A 3JCMg 1Y71A 2VG5B 5ITHA 4Z02A 3OSNA 4DG1B 5J1NA 2DMOA 1FKPA 1FKOA 1HNWJ 2UUAF 3BPDA 3GV7B 2V63A 1QW1A 4ECWA 4CWBA 4FT2A 2OD6A 2KXCA 1QVFS 2AWZA 2KO1A 4LDWA 5GAN8 1HWLA 4ZPVR 1S72T 2DIVA 2DJWA 2EIFA 1NPPA 2VFUA 5B0FA 1RT2B 1FRJA 2HQ3A 4M5KA 3CCEA 2CUDA 1VQ6T 1GX5A 4C11B 5KFCA 1RTHB 1TKZB 4HDHA 3UDCA 2OTLT 4XU2A 2HHHF 1G4CA 1SJRA 5CABA 1O75A 3M2VB 5I42B 2F2XA 3J80Y 4FXVA 3ZTOA 2DHXA 2JT4A 3G82A 2K3YA 4GKJF 2V6AA 2VKNA 2YKQA 4LFBJ 1NK0A 2POKA 2UUCJ 1VQ4S 3E19A 5DQIA 4F0MA 1UHFA 4Z7YA 1TVRA 4I7FA 3CO9A 4KAIA 1YN8A 2XMFA 5IT9Y 4R5PB 4F4XA 4FYYB 2E6ZA 5DG9A 2GIRA 3K58A 2ZH7A 4KGKA 1M3CA 1FDDA 3ELHA 1RT6A 1RK8A 4B3SJ 3KLHB 3MEGA 2RRBA 3M6UA 1PGZA 5GVQA 2VGMA 1SRLA 1UVIA 1BHNA 1SF9A 4FXDA 2W9BA 4ED5A 5GMKh 3EHRA 1QQJA 5HP1B 1M90R 2HWHA 2KN4A 3CWJA 2K5FA 3PR5B 1RWXB 2VDIA 4X4SA 4USVA 2YNIA 4M75D 4NL2A 1RUSA 3QT5A 3RBEA 2LP4A 1Q1KA 1FJCA 5C2CA 4DLGA 1L3KA 4ES2A 2LRQA 4DR1F 2KRRA 2FJDB 3JCMf 2ZBRA 1REVA 3W65A 3IGNA 2H54B 2Y8WA 3C95A 3S3NA 3C0CA 3LWHA 3GYNA 3KK2B 2EXUA 3U02A 4NOHA 4TNOA 2QN6B 4E7HA 4OX6A 1QJHA 3CCSA 1TK5A 2HAFA 4FN5A 3PW4A 2QQRA 2OUGA 1LVKA 4EIKA 2EJ9A 4UW2A 4AFZC 1S12A 4YB1P 1Q86C 2QSFA 3EFOB 5GANd 2HVDA 4ZPAA 2W0ZA 2Y90A 4HCZA 2W4DA 3N28A 3SQGA 2RU9A 3IA0A 2BA9A 1M1KR 2VPZB 2RF2B 3CCRQ 1E6HA 4BI8B 1KRPA 1L3VA 2D8HA 5FU7C 2UXDF 2H9ZA 5D4NA 2DRMA 2ZVIA 5E41A 4QQBA 4K4YA 3I56Q 4EBEA 3CC7Q 1QSLA 4RU9A 1VQLT 1VQ9A 3Q8RB 3M9OB 1KLMA 2RH2A 3WDOA 3U1MA 5IQ6A 2GGPB 2YBVA 5GAGU 3EWGA 2RJZA 1ITPA 3DOLB 1IHVA 3VS7A 3N5BA 1S76D 1N5VA 2DGXA 3VS0A 1ZZNA 4BWMA 1FMKA 5EUHA 1S72S 2MZTA 4C0FA 4URGA 5JVHQ 3M54A 1VDHA 4ZPDA 3LP0B 1VQ6S 2YWKA 1FE4A 2OTLS 2D3UA 4A4KA 1PJ7A 3KG4A 2WB4A 5D6YA 2KYBA 4M75A 3X20B 2QE5A 2WVBA 1VHFA 1U1PA 4M5GA 3RKXA 4ZVUB 1WHXA 2FEIA 2HBQB 4NA1A 1ZQ1A 2HVIA 2XEXA 4LQ9A 3A4TA 3DB4A 4NYPA 3V5RA 1UJYA 2GTJA 1YRUA 1JXOA 5KFRA 5J2PA 5FU7B 1CJKB 2FVCA 3DI6A 2JHEA 4DEZA 1VA7A 2C3OA 1FEHA 1GX6A 4DV1J 4OFZA 5D4OA 4LBIA 1D3BA 3VGUA 3QG1A 3ILLA 4C8YA 1UVLA 4J7CA 3I55A 2DB1A 3I0SA 3EG3A 4OZ2A 2IFXA 3MUTP 4ANDA 1E6VB 2JFDA 3K5NA 3IXQA 3QYYA 2NS1B 4ED0A 5KFQA 5E2QA 2DXTA 1B7FA 1YJ9Q 2VWFA 1WORA 1ZSZC 1ZHIA 2QLJB 4O44B 1M8VA 2LP5A 4ZPBA 2BJ1A 2XS7A 3EG9B 1TZ0A 1YKWA 2D9OA 1UA1A 1RLQC 4BACA 1ZUUA 3HL8A 1KVKA 5B0EA 4B9SA 2JSXA 4DV4J 2JUFA 2D7SA 5LJ3h 2EWNA 4LRCA 2J76E 3PKYA 4WP9A 3CEYA 1QDUB 4OYBA 4Y2KA 1IGQA 3PYFA 2YWEA 2LTOA 2D6FA 4AE5A 4M78C 1MMLA 3LGMA 3KMSA 2VQEF 1NKBA 3I5AA 2J8AA 4MK7A 2BW2A 3UO0A 1FA0A 3GQCA 5H9FJ 2BRLA 3X1LB 4M78G 4ZN3A 5T14A 2IVMA 4X66F 4DV0F 1FDAA 3OD2A 4KV8B 1LWFB 2ZC3A 3G71S 1I3OB 5KFHA 3VUBA 3JYTA 1X43A 1KD1R 2EYZA 3CCQQ 2KYXA 3F73A 2YSQA 4PG4A 1YLXA 1UFLA 2Y8YA 3CCMS 3VUZA 3M1VB 5DGBA 3QBCA 4QYRA 2ILZA 4LSLA 2KJWA 4A48A 4HACA 2LCSA 3BFMA 2LU1A 3MKDA 1B3QA 3OUYB 1ZSZB 1GEHA 2HVZA 1K47A 2K9GA 1BBZA 4RR5A 3RMSA 2DHHA 3QSIA 1BGXT 4C92E 2YTCA 1K9MR 1LKZA 1VJWA 4U67Q 1UJ0A 1JWWA 1NJIC 3VV2B 2MY7A 1HPZA 4C8QC 3GLXA 1AHJB 2JDJA 3VVTA 1FT8A 2MEWA 3GZ7A 1YWXA 2X1FA 1WNLA 2F1FA 1C0MA 1MLAA 5F9LA 1S0NA 3AT1B 2CJKA 3QJ6A 1N0VC 5L1KA 1BQMA 5B08A 4KY3A 4M78B 4ICLB 2HL5C 1FX2A 1WEYA 5J2NB 1K0VA 5KH6A 2KAFA 3CC4T 3HF5A 4LJMA 4CO4A 4DL0C 1CULB 4RW6B 2O01C 3MCNA 4F26A 4CLPA 3F0NA 2QYCA 4WKRA 2GVZA 2WSFC 4NLRA 5AE1A 1RTJB 5KFOA 1B4SA 3QATA 3NBPA 4PG6A 1VQ8T 3K7RA 1YHQQ 2AYGA 3WC2A 3TCJA 2FJBB 3FUYA 2NXNA 2XIDA 3ZZZA 2BR0A 4IDKB 4WIIA 3MCMA 1WHHA 3RRGA 3RIRA 4KTQA 4K4SA 3DOMB 3DMJB 4C8QF 4ESRA 2W01A 3UN3A 4EDUA 3JCMd 1K73C 3MUVP 4LRAA 1MUZA 4KHPF 3OYDA 2GV1A 1M90T 1NXIA 1LEOA 3GYGA 2KM8C 1IXKA 4JOUA 1XJWB 5KFGA 1S59A 2E5LJ 1QE1A 1UWBB 2Y9HA 4LT6A 1NDPA 1BKBA 2HHVA 1S9GA 1UW9A 1ELOA 1RT1A 2HBWA 3SCJE 3H6ZA 4C8QB 2VF3A 3HRTA 4F2RA 2XG8A 1WACA 3M8ZA 3UF4A 2YWGA 4WXWA 3BGRA 2YRCA 1OWXA 4P2FA 3C6UB 3UVJB 3IFEA 4R0EA 1CKBA 1T9XA 1P6TA 1VQNT 2DD8S 3I35A 1Q8LA 3E51A 4ELVA 1SQEA 4OIXA 2HS4A 3P49B 1Y5LB 2YNHB 4Q2MA 4ZGJB 4OI1A 2K57A 1WOOA 2PU9B 2DT9A 3UWNA 1YJNS 3V8LA 2UUBJ 2F5TX 4A53A 4RW9B 4CO2A 4DBQA 5IM0A 4CIOA 5CO7A 4MAKA 2QX0A 4YHHJ 3M32B 5GADU 5LSLA 1IKVB 3CMAA 2HWTA 2PA8D 4F36A 4UOGA 3EPGA 1DFDA 3IAS9 3EYZA 2DEQA 3G4SA 5LJ3Y 3JCMc 2PN6A 4Y2AA 2EFVA 1WGSA 5C24B 1IKXA 3Q8PB 1K1ZA 2R7WA 3H40A 2E64A 3HKSA 3H59A 4WK3A 2V26A 4QVCA 2B4VA 2JLFA 5I21A 1U45A 1GMWD 1M1KT 2KM8B 3HFVA 4TN2A 1PJ5A 1SL1A 4ZP8A 2OTJQ 5CKDA 5KYWA 2IC3B 3M8QA 4DL7A 4G1QA 1K1SA 2Y1LB 3TVTA 3OQ5A 3NMZC 2K7JA 2KG1A 1LJOA 1FYNA