1D3BB

Crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 81
sequence length 81
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 1998-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1d3bB00
4MMKA 4OP0A 5GAMh 5GMKl 5GAN5 1N9RA 3JB9D 2E10A 3JCMW 3QSUA 1WQWA 4X9CA 3QHSA 4XTXA 2DXUA 1N9SA 1Y96A 3SWNC 2I2LA 1X01A 1M5Q1 4XU0A 3V7RA 5GAOl 1LNXA 3FJPA 3JCMJ 4M7DB 4M77E 2DTOA 5GAMj 1LJOA 2EWNA 4M77C 4M75E 2CGHA 4M77A 5DY9A 4XQ3A 3HFOA 4F7UA 2DVEA 4EMGA 3JCMd 5GANg 1BIAA 1B34A 2DTHA 4N0AC 4A54A 1H641 5GMKe 5GAOm 4PJOA 4NL3A 1JRIA 4M78B 4M78F 4M78G 2DJZA 4C8QF 5GAOq 2RD1A 3RKWA 4C92F 4M7AC 4C8QD 3JB9F 3JB9G 4M7AA 5LJ3d 4C92D 3RKYA 4XTVA 3JCMQ 5GMKh 2FYKA 3HFNA 3QUIA 3RESA 3JCMc 5LJ5d 4A53A 4NL2A 1HXDA 3JCMX 5GANf 2RM4A 3JCMP 3JCMb 4JLIA 3JCMV 2DZCA 5GAOn 4Y91A 1I5LA 1D3BB 3BW1A 1WPYA 4WF2A 3V8JA 4QVCA 4F7UE 4M75D 3AHUA 4M7DE 1U1TA 3JB9J 4HT8A 3V8LA 5GMKj 3EFSA 4J5YA 4M7DC 5GANh 2JN0A 5GAN4 4PJOE 1I8FA 2DKGA 1D3BA 4M7DA 2EJFA 2Y90A 3BY7A 5GAMd 4XU1A 2YHTA 3VU3C 4M7AE 2HNIA 4C8QB 3GIBA 3BFMA 3L1AA 4J6YA 1WNLA 4C8QG 4C92B 3JCMg 4C92G 3SWNB 4PJOC 4M78C 4HA8A 3V7CA 5GANj 4JRKA 4M78A 3JB9H 2YLCA 2DTIA 4JUVA 3RERA 4MMLA 3INZA 5GANe 4M77F 5LJ3g 5CAIA 5GAN3 2RB6A 2FB7A 4M77D 4M75B 4M75F 5GAN6 4M75G 5GAN7 4EMKB 3JCMe 5LJ5g 4PJOD 3JCMf 4V2SA 2E1HA 3RKXA 2EJGA 4PNOA 1KQ2A 4JRIA 3V7SA 4M7DG 4M7AD 4J6XA 1M8VA 2VC8A 2E41A 3RUXA 5LJ3e 2DEQA 2VXEA 5LJ3f 4M7DF 1YCYA 3JCMh 1Y96B 4M78E 4HT9A 4C8QE 4XTUA 3QO3A 4XTYA 4C92E 5GAMg 5LJ5e 3PGGA 5GMKi 4C8QC 5LJ5f 3RIRA 5GANd 2EJ9A 1JBMA 2ZGWA 4C92C 3L2ZA 4C8QA 3BDUA 4C92A 4RCBA 5GAOp 3EFRA 4RCCA 3SWNA 1MGQA 5LJ3h 4M77B 2EAYA 3FB9A 4J6WA 4M77G 2K57A 4XTZA 4EMHA 1KQ1A 3SB2A 4F7UB 4F7UF 1B34B 2E65A 4XU2A 4F7UG 4PJOB 4PJOF 4M7DD 4PJOG 2RA2A 4DQ2A 3FIFA 1TH7A 5LJ5h 1U1SA 2DZ9A 1WQ7A 4XU3A 4X9DA 3V8KA 3M4GA 5GAMe 4QVDA 1I4K1 4M75C 4NOYA 5GAMf 2DXTA 4EMKC 5GMKm 5LJ3j 4M75A 4M7AB 4M7AF 4M7AG 4N0AA 1BIBA 4EMKA 1HK9A 2YLBA 5I21A 1I81A 3JB9I 5GAN8 5GAOr 2E64A 2QTXA 2VXFA 1LOJA 3HSBA 5GAN2 4M78D 5LJ5j 4XTWA
chains in the Genus database with same CATH superfamily
2GNCA 3HRSA 1K76A 2GBQA 1Y96A 3NTHA 5FRMA 4P5NA 1YIJT 2DIQA 2JW4A 1QMCA 1N27A 3CCVQ 4RMOA 2CDTA 3WVDB 1S72T 2RJFA 2OTJA 2DMOA 2LT4A 4CC4B 4PLLA 4M7AA 1YN8A 2D0QB 4ZGJB 3RKYA 2QA4A 2PQWA 1NJIR 3VS4A 5GMKh 4FT4A 1WHMA 3CCEA 5FLXE 3EGUA 1TWBA 2L2PA 2DZCA 3V8JA 4F7UE 3OY9A 1YI2Q 3RNJA 2EW3A 3G6EA 2JN0A 2ATCB 3CCLA 1RADB 3PT9A 2OX7A 3LH0A 1YCSB 4OB2B 2K3YA 1M1FA 1YP5A 2V8JA 1NEGA 1BCOA 1R77A 2P4RA 2EPDA 2K6DA 4FYYB 1NYFA 1M9SA 2DRMA 3CC7A 4C5HA 5LJ3g 1MNDA 3M9QA 3UA6A 4MDXA 3L2UA 3GNFB 3OMGA 2E70A 1HD3A 2X51A 2DNUA 5KCHA 2ZPHB 2X4WA 2SRCA 1K9MC 5GJWB 2XI9A 4J9CA 4FYXB 5A2QE 1YCYA 1G83A 2HMAA 4XTUA 1PRMC 1QW1A 1ZA2B 2V8KA 1JBMA 3VS0A 1QP2A 1O9SA 4M4ZA 3ER0A 3CQTA 4J7IA 1B07A 4EMHA 2QEXA 4XTZA 2FHDA 5EC7A 5GANd 4IUVA 1HSQA 3EH1A 4OB3B 2LMJA 3M4GA 3A98A 1VQ8A 2VV5A 3VJPA 4M7AF 4N0AA 2KEAA 3CXCP 3CBOA 2CZ6B 3MP1A 3OYYA 3CC4Q 2COZA 5GAN5 1YHQT 3KBGA 4KH1B 3R6OA 2I2LA 2J6KA 4ESRA 4BDZA 2EQIA 1UE9A 4AFZC 2LQ8A 4DEXA 2DE0X 2RK2A 3HFOA 3QWXX 3VYHB 4N0AC 1H641 3NHNA 2KRSA 1K73R 4M78G 1M27C 2BTTA 2PUKB 3RKWA 2HKNA 3FRNA 1R8OB 4F17A 2YRCA 1U5SA 1UDLA 5IHNA 2HQHA 2JS2A 4RTWA 1IRXA 4NL2A 1HXDA 1FMKA 2A08A 3JCMV 3CMAQ 3BW1A 2YXYA 1YI2A 3I56T 3LGLA 4E2FB 1I8FA 2XDPA 2OJ2A 2E6ZA 3VU3C 1UEBA 1GXIE 3GPLA 2RQRA 3C0CA 5AYFA 5FWBA 1TSFA 2FO0A 1WXUA 5CAIA 2WSFE 2K7AA 3SHWA 2XDBA 1PHTA 2K9GA 2HD0A 3JCMe 1VIEA 1NJIC 4E7SA 4J9DA 2KRMA 2HBPA 2LNHB 1H8KA 2O9SA 1QLYA 3MPUB 1XQHA 2VC8A 2A3LA 5CCAA 1IHWA 2EYXA 4C0FA 3X25B 4E7HA 3CCUA 3L2ZA 1NLOC 2QI2A 4BACA 1WLPB 1NE8A 3CMEQ 2K2VA 1Q82R 2PVOB 1T0JA 1OEBA 3UF4A 2E12A 4JS5A 5DM7R 1GBRA 1F1BB 1LOJA 5J3BA 1E6GA 2HL5C 3CC4A 3SDZA 4QQGA 5GAMh 3M0UA 2E10A 3MEVA 3V7RA 1OV3A 2YUPA 1WJQA 1LJOA 5IAYA 2YUQA 2DEUA 1KJWA 3A5ZB 1FYNA 1UGQB 1J3TA 3EFOB 5I11A 1JRIA 4M78B 1NLPC 3JB9G 3QWYA 1G3TA 3MEAA 2ROLA 1QVFA 4JRQA 1YJ9A 1WFWA 1NYGA 1VQKT 1BI3A 1GRIA 2HEQA 5HK3A 3TEEA 3QKJA 1U1TA 5CKBA 2Y90A 1QCOA 1K8AU 1VQLQ 2RQUA 5CKFA 3EFOA 3LH5A 3M0PA 5GANj 1VIFA 3OYDA 4M78A 5IHKA 1X43A 1K73C 4J8OA 3OYIA 3VS1A 3CD6A 2LP5A 3META 3CCVT 2KXCA 4XAXB 2ZCFB 1KQ2A 2A28A 1M1KR 1ABQA 4IIMA 1M8VA 2OAUA 4TVRA 5CIUA 1VQ5T 2M51A 1TUDA 4IUTA 2YRVA 3KFVA 1RACB 4DBQA 3MEWA 3JRZA 1MGQA 3JAME 3QDFA 2KK4A 1LPLA 2H3EB 3J80E 3CMEA 3BE3A 5LJ5h 1MUZA 1AWOA 1X6GA 2ED1A 2C0OA 1ACMB 1BBZA 3NFCA 5IT9E 3G7ZA 2A36A 1UUEA 1KHCA 2JTEA 2VVKA 4MMKA 4RTZA 1RL2A 1WQWA 2OAWA 2IPOB 3CCMA 5FU7C 2CP0A 3EG0A 2DLPA 3H0HA 3X24B 2JXBA 2CUDA 1R0CB 4XQ3A 2JS0A 2ZAEA 2GTJA 4M78F 4PJMA 4B9XA 1VQ6T 5FU6B 1AEYA 5AT1B 3I5RA 2RJEA 3LWIA 1JJ2S 3H9NA 4QT7A 4JLIA 4Y91A 2DX1A 1KC8C 1TOVA 3P8HA 2DAQA 3G4SQ 2CH4A 1JXOA 2PNIA 2CH4W 2EVRA 3EAEA 1NZ9A 1VQ7Q 5C0MA 1NPRA 1VQLA 2JZ2A 1UG1A 1BYMA 2A7YA 3JCMg 1KD1C 1OX8A 5KCOA 4JJBA 3OYFA 4ATOA 3JB9H 2DVJA 4EPCA 4ORZA 1EIFA 1WIEA 2LX9A 4M75G 4A4EA 3MEUA 4DOVA 5DLOA 2D6FA 2RJCA 2DL8A 4E7JA 2MYSA 4R55A 3VS3A 4M7AD 5D6XA 5A0GA 4PJNA 4HT9A 1MMAA 4MZPA 1QKWA 3BDUA 5LJ3h 2M0YA 4Z89A 3OYCA 1D0XA 3CMAT 3VV0A 1AZGB 3CC2T 4HVWA 1WQ7A 3QIIA 2BUDA 2JM9A 2K4YA 4NOYA 1MHNA 1WYXA 3QZ9B 1GCQA 3HSBA 1KIKA 2QQAA 3C4SA 3DB3A 3QHSA 2X4JA 2RQVA 2DBKA 4IUPA 4KGXB 3S3OA 1TG0A 1JO8A 3OYMA 1LCKA 4J9IA 3P8BB 3JCMJ 4M7DB 2DTOA 4DA4A 2CSQA 1MV0B 4M77C 1Q7YU 4DBHA 1X27A 2NUZA 4PJOC 3J81E 4LDYA 2O4XB 1GCQC 2HAXA 2RHZA 5GAOq 4A4HA 4F16A 1KHIA 4C0GA 3JB9F 2A0FB 1BI2A 1EZZB 2AKLA 4F04B 2GCXA 5KYYB 2EYYA 2JVVA 1VQMT 5GANf 1U06A 1N8RC 1QVPA 4ME7A 4LDUA 2CZ0B 2FVUA 1MNEA 3CCQQ 4EIKA 4BDYA 4AMCA 1D3BA 4LUDA 4HCCA 4M7DA 1WHGA 5M9OA 1I1JA 1RAIB 1VQ7A 3OYJA 4FM4B 1WHHA 3A1PA 2HNIA 2OTJQ 2D0NA 2VKNA 3EG3A 2L8DA 2O4XA 2CP2A 1ABOA 2CREA 2XDDA 4M77F 2LQKA 2FB7A 4M75B 1WXTA 5KYYA 1C6VX 1VQPQ 5FROA 2BE7D 2FPDA 2E3IA 2HDAA 3RDVA 3CCLQ 5HCKA 1OPKA 1JJ2P 1PKSA 1K8AR 4C8QC 4FIBA 4C92C 1Y0MA 2ZGWA 4ELZC 3CXCS 1I5OB 4FW2A 3CC7Q 4N4HA 3CCST 1W70A 2ESWA 5J26A 3OB9A 4AG1C 3ZEHA 4X9DA 4QVDA 3A8OB 2EGCA 4M75A 3DKMA 3F70A 1YHQA 1HJDA 4E47A 2NUPB 1PRLC 2O31A 2CKKA 4VUBA 3L2VA 2X9HA 1M90U 1G3YA 1LNXA 2QEXQ 2LCLA 5CKDA 2EYZA 2H3JA 2B86A 5A0DA 3TSZA 2DVEA 2LJ1A 2EFIA 3GF5A 4Q5WA 1M3BA 2AZSA 4FSXA 1FMWA 4C8QF 3OW2A 4C92F 4QVZA 3CPWA 3VS5A 1RUWA 1CKAA 1VQ9T 2RI3A 1XNIA 3MHXA 2NUPA 1WJRA 4OMOA 3GLXA 4LD6A 4M7DE 4K11A 1SF9A 2RF0A 2ZPIB 1RAEB 3CCQA 1VOMA 1X6OA 3OYLA 3J7AF 2YHTA 3GIBA 3I55T 3SWNB 2VUBA 2DERA 2YLCA 5IXFA 2R57A 2HL3A 2RJDA 1IXDA 4OF1A 4C5EA 1PSFA 4M75F 3VUBA 2EKHA 2AZVA 1VQPA 1FWZA 2LTOA 1IHVA 3M53A 1G3SA 3GP8A 2PU9B 1M1KU 2CUBA 4BI3A 1B7TA 2YSQA 1Q81U 2VGMA 2VB6A 3NMZC 3PGGA 4JJDA 2EJ9A 2QDYB 2QTVA 3HL8A 3SWNA 3PMIA 3OS0A 4D8DA 4GLMA 1KK7A 2E65A 2P0KA 3G4ST 1UFFA 1ZSZC 2YT6A 4EMKC 3M57A 5I21A 1TXQA 2ENMA 5GAN8 1N6AA 4M78D 1X2KA 3S3MA 2LJ3A 4LUEA 1XTDA 1AZEA 1FX7A 3CCUQ 4LDVA 1GCPA 2DA9A 3CBPA 3SWNC 1YWPA 3OSSC 4F14A 2EGAA 1PCXA 2DK3A 1VQ4T 3CCRQ 4Y92A 1RAHB 3PIPA 2WSEE 3JSCA 4R0KA 4RKUE 1K0XA 1T3SA 2KAFA 2GFUA 2AKKA 3UDCA 3TCJA 2J6FA 2RD1A 3E9GA 2KMTA 4OMNA 2KROA 1PNJA 5EG2A 1Q86C 1AT1B 1AD5A 2RHYA 4IURA 2FYKA 1OI1A 4QKUA 1RAGB 3JCMP 2KR3A 4HT8A 5C6SA 1VYTA 3QDRB 1PM3A 4NS5A 4EDUA 1Q7YR 4IKFA 2E6NA 2O2OA 5FW9A 2OTLT 2DETA 4M7AE 2FPFA 2P0PA 3M59A 5A0LA 2K5FA 1V29B 1TUCA 3CCJT 1PWTA 3G71T 4JRKA 5CQYA 4AT1B 3H6ZA 4JUVA 4MDWA 4ZN3A 1YJ9Q 3EG1A 2HCKA 1VQOT 4V2SA 4BI4A 2E1HA 2EJGA 3VYGA 1QWEA 2V1RA 2E41A 3RUXA 4RTVA 1IO6A 3H41A 2Z0WA 3JCMh 2R58A 2EYWA 3CPFA 1MMGA 2EYQA 4RTTA 5GMKi 2PUOB 2YRDA 4MZMA 1YJWT 3FDRA 2XG8D 3CD6Q 3MKDA 4OMLA 1VQNQ 2F2VA 1TH7A 1U1SA 4J7FA 1U3OA 1YBYA 3HHTB 3C95A 2DL4A 1D1BA 3CEYA 2YLBA 3QBYA 1SRMA 5I2SA 3M0TA 3JB9D 2M16A 2QA4T 3X26B 5HY6A 3CCET 2F1LA 3UT1A 4RG2A 1CKBA 3H0FA 3CCRA 5KYNA 4OVAA 3ULRB 1NG2A 3Q1JA 3I35A 2KQWA 1YWOA 2DL5A 2R5MA 4QQ6A 3G6ET 1BIAA 2RO0A 4KULA 4C5IA 2RI2A 4RTUA 4O6JA 3G1JA 1W2BS 2OI3A 1Y57A 1YJNA 3RESA 3CCMQ 1PKTA 1NM7A 1K9AA 2G6FX 1M90R 1ZBJA 2DXBA 4GBQA 2RHIA 5GMKj 1JJ2A 4YTLA 1PD0A 5GAMd 4A63B 3QJYA 3OBWA 3HKSA 4J6YA 1UGPB 1O75A 2MI6A 2ZPGB 1PSEA 2LCCA 4A4KA 2QASA 2WACA 2RB6A 2PZ1A 3H0IA 2DF6A 3REBB 4A4FA 3D7SB 3QG1A 1OU9A 2C06A 3GOXA 1W6XA 1VQ8T 1M4ZA 1QCNA 4PNOA 3ZFJA 3M54A 3RMSA 2QAZA 4BUGA 2DYIA 2M9UA 1NEBA 2K79A 5FU7B 2F5KA 4JZ3A 1ZUUA 2O9VA 4JJNK 4LNPA 1Q95G 2EAYA 1OZ3A 4M77G 1E7OA 5GMKl 4Z8AA 4XU2A 1VQNA 4M7DD 4PJOG 4DQ2A 1YITA 1SEMA 3A8GB 1IZ6A 2DXTA 1RAFB 1BIBA 2E64A 4OMMA 2COWA 4LN2A 4OP0A 2I0NA 1Q81R 1K0SA 4E7KA 2GQIA 4HCBA 2ZPBB 2FG0A 3FJPA 1OYXA 1BK2A 5IXBA 1VYVA 2IG0A 2LT1A 4B9WA 2CGHA 1YI2T 3ME9A 2D8HA 5GANg 3JV3A 2LZ6B 2EQUA 1B3QA 2HQXA 2KYBA 2COYA 1ARKA 1V1CA 5CKEA 1VQMA 2XK0A 4HKEA 5LJ5d 1YIJQ 4WCIA 1TU0B 1T0HA 4M75D 1UJYA 3V8LA 2KY9A 2MMPA 2DKGA 1S72Q 3M4YA 3QYGB 1AWJA 2C0TA 2MAMA 4C8QG 3N5BB 1WNLA 1Q82C 3OYGA 4C92G 4HA8A 1UJ0A 2AK5A 5FRNA 3MO8A 2YWWA 4E7ZA 4DBRA 1NBEB 5GAN3 1X69A 1RI9A 2JNGA 5FWCA 2SEMA 2L3PA 3OS1A 2FPEA 2ABLA 2XKOC 4FU6A 2DO3A 2MIOA 4BI8B 4CC3A 1W2BP 4C0DC 1JXMA 4C5GA 2CS7A 4M78E 4LE9A 3SEMA 3HPWA 3QO3A 3CC4T 3UWNA 2YUNA 2QG9B 4DEYA 3CCSA 4PJLA 5CQXA 3A8MB 3TU4K 4M77B 4R56A 4F7UG 3SB2A 1BU1A 4PJOB 2RA2A 3CXCA 1RLPC 1QVFS 2QTXA 4HVUA 1OX9A 2HSPA 2RMOA 4ANJA 3THKA 4BY6C 3JCMW 4JZ4A 4XTXA 1H3HA 2M1HA 3PNWC 4ELYC 2X4YA 1YJ9T 2RPNA 4XU0A 5GAMj 4HVVA 4ZTFA 4M77A 3PVLA 2RQTA 4PJOA 1ZQ1A 2C0IA 1M1GA 1QWFA 1VQ9A 1YHQQ 1SPKA 4J9HA 5LJ3d 2K2MA 8AT1B 4UC4A 2PVGB 3HFNA 3OQ5A 3CBMA 1LVKA 1M1KC 1YIJA 2DYBA 3R6NA 1D3BB 1PC0A 4AFSC 1Q81C 1QKXA 3JB9J 2VWFA 2JM8A 2X4XA 1W4SA 4PFOA 2M0OA 4HCZA 1S72A 5L23A 1WX6A 2YUOA 4IUUA 4PJJA 3I55A 4C8QB 4C92B 1AWXA 2EBPA 4GY5A 3INZA 1E6HA 1D0YA 1T3LA 1VUBA 3I56Q 5IN1A 2JOYA 3CMET 5CK9A 1OQKA 4FW1A 4JRIA 1A0NB 2J06A 5J39A 2IVWA 4OMFB 1MMNA 4PLIA 5ECAA 4WTOB 1MMDA 3P8DA 1OULA 4RG8A 4C8QA 2KBTA 4C92A 3EFRA 3CCMT 2P0QA 4F7UB 1AHJB 1KQ1A 1B34B 2CSIA 3EH2A 4PJOF 4CRIA 3FIFA 4II1A 2MCNA 2J05A 1HK9A 1KFZA 2K5LA 5LJ5j 3REAB 2KT1A 2G3RA 3C12A 2JMAA 1W1FA 3M56A 1FMVA 1WXBA 2NUTB 2FRYA 2XIDA 4M77E 5L8RE 3T9NA 2Y4YA 4JPBW 4AFQC 2JMCA 4F7UA 3NTKA 3OYAA 4N4IA 1B34A 3L2WA 2MWPA 3RBBB 1C0MA 2DJZA 4ZTJA 1TUGB 3QJ6A 1ZUKA 1VQLT 2AIRB 2ZZDA 4FL6A 4FT2A 2VASA 4KUIA 1QVFP 4FSSA 1AOJA 3NPFA 2D9TA 1KSWA 1TTHB 2NUTA 2EJFA 2LNVA 2X3WD 2MK5A 3CCJA 5CO7A 3ASKA 3L1AA 3ZL7C 1M8MA 3X20B 1VQKQ 1X75C 2IIMA 1RABB 3M58A 1KD1U 1ZSZB 1KQSS 3I56A 4EMKB 2E5QA 3VRZA 2X3XD 1I07A 2K3BA 2KSSA 3EHRA 4KRTA 2RHXA 1QVGS 4B6MA 2KNBB 3MP6A 1UGRB 4J6XA 1AWWA 2JTFA 2P4TA 3O5ZA 1JB0E 4C8QE 4KT0E 4C92E 3DB4A 2BE9B 3OYEA 1YJWA 4RTYA 2GQVA 5GAOp 3OS2A 2E3HA 2F2WA 2V1QA 4J6WA 4F7UF 1JQQA 3C94A 1OPLA 2GFAA 1V76A 2L5QA 3GNGA 5GAMf 2DL7A 3MJXA 1PG5B 5LJ3j 1FXXA 1XOVA 1ZSZA 4MZTA 2XD0A 4EMKA 4Z88A 1I81A 2KXDA 2KT8A 2J6OA 1VQ5Q 3LW5E 4KGVB 5IHIA 3EGXB 3L2QA 5KYXB 2EQMA 2CT3A 2QQSA 3IQLA 1N9SA 2XICA 3OSVA 3LX7A 5GAOl 3LYIA 2NWMA 4FCYA 2LVMA 4M75E 4NL3A 3FJ5A 2EIFA 3BDLA 4EMGA 3L42A 5GMKe 4QW2A 1Z9QA 1G2BA 1VQ7T 4M7AC 2ZPEB 1IREB 4X34A 4XTVA 1BKBA 4E7LA 3SFMA 5CR2A 2DXCA 1SKUB 3H8ZA 2L3QA 3EGXA 5KYXA 4C0ZA 2O88A 1YNZA 1K8AC 2RQWA 4QVCA 3AHUA 1W2BA 3VUZA 3EFSA 5GANh 2LQWA 1IGUA 1OOTA 4Z02A 2CZ1B 4PL6A 1N8RU 1ZHIA 1VQ6Q 3M0RA 3SD4A 1D09B 4KBMB 2EGEA 1WHKA 4DBFA 1RAAB 1H92A 1SG5A 1VQKA 4HXJA 2ROTA 1GBQA 3OYBA 4MMLA 4J9GA 5GANe 1YJNQ 2E5KA 3TQ7P 4AG2C 4L6V5 5GAN7 5GAN6 4JJCA 1JU5C 2H8HA 1P92A 2YDLA 3V7SA 2RI5A 2K3XA 1WI7A 3S6WA 2VXEA 1M30A 4CC2A 5LJ5f 1SHFA 2KGTA 3TREA 3FB9A 2W10A 4BE2A 3VRYA 3CCVA 3QPHA 3OW2S 3A8HB 4XU3A 1N5ZA 3CPWS 5GMKm 2DFUA 4JLGA 3HTRA 2J7IA 2DL3A 3M0SA 3EG9B 1VQ5A 3OYHA 1X2QA 3MCAB 4FYVB 1M3CA 2HZYA 4QQDA 1KQSP 1QVGP 1M5Q1 2V8IA 2FRWA 3PMTA 3E9FA 3CC2Q 1WGSA 2LQNA 1YITQ 1VA7A 3ZBDA 4DOWA 5DY9A 3JCMd 3CCQT 9ATCB 1PD1A 2GTOA 2FZCB 3M0QA 1UECA 2Y4XA 1YFNA 2OTJT 5CVIA 1M2VB 3EG9A 3LWHA 2LDMA 3QUIA 5I2MA 3I9QA 2KYMA 4J9BA 4A53A 3JCMX 4JRPA 1BI1A 2MF2A 2R5AA 1I5LA 1GFCA 1WZOA 3LLRA 1X6BA 1VQPT 2W0ZA 5GAN4 1SSFA 4OGEA 3CCLT 3EG2A 1VQ6A 2WSCE 5D6WA 3L2RA 3PE0A 3V7CA 5KYWB 2ECZA 1VQMQ 3RERA 4OMPA 1M2VA 1EFNA 2DM1A 2JJ9A 2RH2A 2XHCA 4E6RA 4M77D 3CC7T 1Z9ZA 4PJOD 4GLKA 3OYKA 3E2UA 1UGVA 1SRLA 5LJ3f 4OB1B 2QYZA 2CP3A 1U8RA 3VS6A 1KC8R 3RIRA 2KDSA 3LGFA 2LCSA 1OZ2A 5KYWA 2KI7A 2KE9A 2QEXT 3V8KA 1KD1R 1ZSGA 5GAMe 1ZX6A 2RHUA 3E19A 5KH6A 2FZGB 5GAOr 1EX4A 4XTWA 1S1NA 4N4GA 1QCFA 5KE3A 4X9CA 2PVDB 1WHLA 2NLUA 1Q7YC 1K9MU 3UA7A 3CCSQ 1X01A 4D8KA 3CMAA 3WVEB 1RLQC 3CC2A 2LRQA 4LD9K 2LX7A 5GJVB 4L59A 2L89A 4LDXA 5HKCA 4A54A 2RNAA 4JS4A 4BE0A 4C8QD 1I0CA 4C92D 1AVZC 3JCMQ 3OW2P 4PK4A 3CPWP 2K5IA 4CI0C 1Q86U 2E4HA 4RUGA 2BZXA 1UHCA 1WPYA 4WF2A 4KGZB 1UB4A 2CT4A 4J5YA 4C0DB 1BI0A 3BY7A 2RK1A 1JEGA 4JDSA 4XU1A 3EHQA 4J83A 4BB7A 2EQJA 3FLGA 1VQ9Q 4M78C 1RI0A 1GL5A 4J9FA 2O01E 4PKCC 2L3RA 2DD4A 3M55A 2HBWA 4KH0B 1ZUYA 4PFZA 2HQEA 3HRTA 2AHJB 2QQRA 4OGCA 3PIOA 1M3AA 3OS5A 3I55Q 1ZA1B 4IIOA 4BY6B 3VKIA 1N8RR 3I5SA 5LJ5e 2DBMA 2QDLA 3PTAA 4RCCA 3CCUT 4M7DG 2K57A 2BZYA 1SSHA 1UTIA 3CCRT 1G3WA 1I4K1 3NTIA 3HRUA 4AFUC 3JB9I 2VXFA 1M90C 5GAN2 5KYUB 1NJIU 3E1SA 2FEIA 2B8AA 2JUFA 1ZBXA 5LL6S 3QSUA 1NPPA 2DXUA 1YJNT 2VYTA 2X35A 2KRNA 2EWNA 2M02A 2QQBA 1K4US 2KVQG 3QYHB 3UPUA 5HK0A 1QQJA 2RN8A 3X28B 1SHGA 5KYUA 3VS7A 3TSWA 1VQ4Q 3JCMb 6AT1B 1Y07A 2MWOA 3DLMA 3UATA 3OBYA 2NYSA 3QZ5B 5CKHA 4XK8E 3BFMA 1WDXA 1VYUA 3VS2A 2CP7A 8ATCB 2DIGA 1TS9A 5FU6C 2DTIA 2BKDN 4LXCA 2ZPFB 3MP8A 2DJQA 4D6WA 3HP9A 4BE1A 2DPPB 2EKOA 4X1VA 3CD6T 1G8XA 1VQNT 1MV3A 1YITT 4ZNXA 4ZGEB 1D1CA 3A8LB 2OTLQ 4LDWA 4BD3A 1KQSA 4J9EA 3QXEB 5LJ3e 3CCJQ 5D6YA 3G71Q 2V26A 2F5TX 1QVGA 5GAMg 1C1AA 1M2OA 3TVTA 2QGFB 2QGGA 2L3SA 2AT1B 5D7UA 1Y7XA 3PVQA 1WJSA 4E7IA 1VQOQ 3OYNA 3OA6A 3FEOA 1K73U 1BCMA 4A4GA 2HSEB 3EGDB 4M7AG 2XU8A 1OU8A 4ZGDB 2MPXC 2PTKA 2CP5A 1WA7A 1N9RA 1BB9A 4Y28E 2CP6A 1YJWQ 4KUDK 4CC7A 1CSKA 3AT1B 2CYZB 1D1AA 1WHJA 4OB0B 1IGQA 7AT1B 3G4SA 2D8JA 2LJ0A 1Y71A 2MOXA 5GAOm 2DTHA 3DLLA 1UHFA 2JTMA 2DRKA 1DJ7B 1IB8A 5KE2A 3WXMB 2D1XA 3RR6A 1D0ZA 3EGDA 2QA4Q 1XJWB 3CCEQ 2VGNA 4HCKA 3JCMc 2RM4A 4O5VA 1VQ4A 5GAOn 1K9MR 2A37A 3G6EQ 4M7DC 4PJOE 4PFPA 5I22A 2JT4A 2P84A 5IH2A 2F2XA 1HYOA 3S3NA 3KXTA 2F69A 2CZ7B 4L5GA 2DILA 4IUQA 2L0AA 3PFSA 4FYWB 1Q82U 1GFDA 1KG1A 1K1ZA 2HKQB 2GGRA 3RMQA 1UGSB 5LJ5g 1G5VA 3JCMf 1Q86R 3NGPA 3KUFA 3URGA 2FZKB 3RKXA 2BIVA 2OTLA 1H3ZA 3FC3A 2DEQA 1QP3A 1Y96B 1ZLMA 3G71A 1KC8U 4ZN1A 3U23A 3M5AA 4XTYA 4RTXA 4RCBA 3OMCA 2GF7A 4M7DF 4OMQA 2DD5A 2ED0A 2BZ8A 3O8VA 2XMFA 1VQOA 2DZ9A 1VQ8Q 4M75C 5DLQE 4M7AB 2EQKA 2QQ9A 1R0BG 2FL7A 2QXFA 2QK0A 3GBQA 2LC4A
chains in the Genus database with same CATH topology
2QQAA 4OP0A 3C4SA 3MCAB 3DB3A 4QQDA 3QHSA 3HRSA 4E7KA 2X4JA 4IUPA 3S3OA 1Y96A 3NTHA 4HCBA 5FRMA 2ZPBB 1M5Q1 2V8IA 4P5NA 3P8BB 3OYMA 2DIQA 3FJPA 1OYXA 3PMTA 3JCMJ 3E9FA 2DTOA 1WGSA 4DA4A 4M7DB 1N27A 4M77C 2IG0A 2LT1A 3ZBDA 4B9WA 1Q7YU 2CGHA 1YI2T 4DOWA 5DY9A 3ME9A 4PJOC 5GANg 3J81E 3JCMd 4RMOA 4LDYA 3CCQT 2O4XB 3WVDB 1S72T 4NL3A 2EQUA 2RHZA 2HAXA 2HQXA 2RJFA 2OTJA 5GAOq 4A4HA 2LT4A 2Y4XA 4PLLA 1KHIA 5CVIA 4C0GA 2D0QB 4ZGJB 3JB9F 4M7AA 1BI2A 2OTJT 3RKYA 2QA4A 5CKEA 2PQWA 1VQMA 3LWHA 2LDMA 2GCXA 2XK0A 5GMKh 4FT4A 2JVVA 4HKEA 3QUIA 5I2MA 5LJ5d 5FLXE 4A53A 5GANf 3JCMX 3CCEA 4JRPA 1VQMT 1BI1A 2MF2A 2DZCA 1N8RC 2R5AA 1QVPA 1I5LA 4ME7A 4LDUA 3V8JA 4F7UE 2CZ0B 4M75D 3OY9A 2FVUA 3LLRA 3V8LA 3G6EA 2KY9A 2MMPA 2JN0A 5GAN4 4BDYA 1VQPT 2DKGA 1D3BA 1SSFA 3CCLA 3PT9A 4HCCA 3M4YA 4M7DA 4OGEA 5M9OA 3LH0A 3CCLT 1VQ7A 1VQ6A 4OB2B 3OYJA 3QYGB 4FM4B 2K3YA 2HNIA 2MAMA 2WSCE 4C8QG 3N5BB 1WNLA 1Q82C 5D6WA 4C92G 1M1FA 2L8DA 2V8JA 3OYGA 3L2RA 2O4XA 4HA8A 3V7CA 1M9SA 3RERA 5FRNA 3MO8A 2XDDA 4M77F 3CC7A 4C5HA 5LJ3g 2LQKA 2RH2A 2XHCA 5GAN3 2FB7A 4M77D 2JNGA 3CC7T 4M75B 3M9QA 4MDXA 4PJOD 3L2UA 4GLKA 3GNFB 3OMGA 3OYKA 3OS1A 2E70A 5FROA 2XKOC 5KCHA 4FU6A 2DO3A 2ZPHB 2X4WA 1K9MC 4BI8B 4C0DC 4C5GA 2CS7A 2XI9A 5LJ3f 5A2QE 1YCYA 4OB1B 4M78E 1U8RA 3HPWA 4XTUA 3QO3A 3CC4T 4C8QC 1QW1A 2KDSA 4FIBA 3LGFA 2V8KA 1JBMA 2ZGWA 3RIRA 3UWNA 4C92C 4ELZC 3CXCS 3CCSA 1OZ2A 1QP2A 5CQXA 3A8MB 1O9SA 3ER0A 4J7IA 3TU4K 4M77B 4N4HA 4EMHA 4R56A 4XTZA 2FHDA 4F7UG 3SB2A 5GANd 2QEXA 3CCST 4IUVA 5J26A 4PJOB 2RA2A 3OB9A 4OB3B 2QEXT 3ZEHA 3CXCA 3V8KA 4X9DA 3M4GA 5GAMe 4QVDA 1VQ8A 3A8OB 2VV5A 3VJPA 2RHUA 3E19A 4M75A 5KH6A 4N0AA 1QVFS 4M7AF 3DKMA 5GAOr 3CBOA 2QTXA 3F70A 2CZ6B 3MP1A 3OYYA 1YHQA 4E47A 4XTWA 5GAN5 1YHQT 4N4GA 4BY6C 5KE3A 3JCMW 4X9CA 2PVDB 4XTXA 2NLUA 1Q7YC 2CKKA 3KBGA 2M1HA 3PNWC 4VUBA 3L2VA 1K9MU 3R6OA 2X4YA 4ELYC 1G3YA 1X01A 2I2LA 1YJ9T 1M90U 3CMAA 4XU0A 3WVEB 1LNXA 5GAMj 3CC2A 2LCLA 2LRQA 5CKDA 4LD9K 4BDZA 2H3JA 5A0DA 4ZTFA 2LQ8A 4L59A 4M77A 2RK2A 3HFOA 2DVEA 2L89A 5HKCA 4LDXA 2EFIA 3GF5A 4Q5WA 4N0AC 3VYHB 1H641 4A54A 4JS4A 1ZQ1A 4PJOA 1M1GA 4FSXA 4M78G 4C8QF 3OW2A 4BE0A 2PUKB 3RKWA 4C92F 4QVZA 3FRNA 1VQ9A 1R8OB 4C8QD 3CPWA 5LJ3d 4C92D 3JCMQ 1VQ9T 2RI3A 1XNIA 2PVGB 4UC4A 3HFNA 3OQ5A 3CBMA 3MHXA 1M1KC 1YIJA 2K5IA 1HXDA 1WJRA 4NL2A 3GLXA 4LD6A 4CI0C 3JCMV 1Q86U 1D3BB 3BW1A 1WPYA 4WF2A 4M7DE 1Q81C 1YI2A 3I56T 3JB9J 1UB4A 2ZPIB 4J5YA 3LGLA 2X4XA 4C0DB 1I8FA 1W4SA 2XDPA 1BI0A 3CCQA 2M0OA 4HCZA 1S72A 2E6ZA 1X6OA 2RK1A 3BY7A 4JDSA 3OYLA 4XU1A 3J7AF 2YHTA 4J83A 3VU3C 3I55A 1UEBA 4IUUA 4BB7A 1GXIE 2EQJA 4C8QB 3GPLA 3GIBA 3FLGA 4C92B 3I55T 3SWNB 4M78C 1RI0A 2VUBA 2O01E 5AYFA 2YLCA 4PKCC 4GY5A 3INZA 2R57A 2L3RA 2RJDA 2DD4A 3M55A 5CAIA 2WSFE 4OF1A 4C5EA 1PSFA 2XDBA 1VUBA 4M75F 3VUBA 5IN1A 2HD0A 2JOYA 1VIEA 3JCMe 2HQEA 3HRTA 1FWZA 3CMET 2AHJB 2LTOA 2QQRA 3M53A 4OGCA 3PIOA 1G3SA 3GP8A 2HBPA 2PU9B 5CK9A 1M1KU 4JRIA 3OS5A 5J39A 2IVWA 1XQHA 4BI3A 2VC8A 2A3LA 4OMFB 4BY6B 5CCAA 3VKIA 1Q81U 4PLIA 2VGMA 4C0FA 3X25B 5LJ5e 3PGGA 3P8DA 4E7HA 3CCUA 4RG8A 2EJ9A 2QDYB 3L2ZA 4C8QA 2QI2A 4C92A 3PTAA 4BACA 3EFRA 4RCCA 3HL8A 3SWNA 1NE8A 3CCMT 3PMIA 3CCUT 2P0QA 4F7UB 2K57A 1AHJB 3OS0A 1KQ1A 4M7DG 1B34B 2E65A 4PJOF 2K2VA 4CRIA 3FIFA 4II1A 2PVOB 3CCRT 2P0KA 1G3WA 3G4ST 1I4K1 2E12A 4EMKC 3NTIA 4JS5A 3HRUA 3M57A 5DM7R 1HK9A 5I21A 3JB9I 2K5LA 5GAN8 2VXFA 1M90C 1LOJA 1N6AA 5J3BA 4M78D 5GAN2 5LJ5j 3S3MA 1NJIU 3CC4A 3E1SA 4QQGA 3SDZA 5GAMh 2B8AA 2JUFA 1ZBXA 5LL6S 2E10A 3QSUA 1XTDA 1NPPA 1FX7A 2G3RA 3C12A 2DXUA 4LDVA 3CBPA 3SWNC 3OSSC 3MEVA 3M56A 1YJNT 3V7RA 2VYTA 2DK3A 2XIDA 4M77E 1WJQA 2X35A 1LJOA 5IAYA 5L8RE 1VQ4T 3T9NA 2Y4YA 2EWNA 3A5ZB 3PIPA 2WSEE 4F7UA 1UGQB 3JSCA 3NTKA 4RKUE 3OYAA 2QQBA 1B34A 4N4IA 2KVQG 3L2WA 2MWPA 2KAFA 2GFUA 3QYHB 1JRIA 4M78B 3UDCA 3TCJA 2DJZA 3UPUA 3QJ6A 4ZTJA 2RD1A 3E9GA 5HK0A 2KMTA 1VQLT 3JB9G 1Q86C 5EG2A 1G3TA 3X28B 2RHYA 3MEAA 4IURA 1QVFA 2ZZDA 2FYKA 4JRQA 1YJ9A 4FL6A 4FT2A 1OI1A 1VQKT 1BI3A 3JCMP 3JCMb 4KUIA 5HK3A 1YIJT 3TEEA 1Y07A 2MWOA 3QKJA 1U1TA 2D9TA 3DLMA 5CKBA 5C6SA 4HT8A 3QDRB 4NS5A 4EDUA 2EJFA 2Y90A 3OBYA 4IKFA 2E6NA 2LNVA 3QZ5B 5CKHA 1K8AU 2OTLT 4M7AE 3CCJA 2P0PA 3M59A 4XK8E 5CKFA 3ASKA 2K5FA 3BFMA 1V29B 3L1AA 5CO7A 5A0LA 3CCJT 3G71T 5GANj 1VIFA 3OYDA 2DIGA 4JRKA 4M78A 5CQYA 3H6ZA 3X20B 5FU6C 2DTIA 4JUVA 1X75C 4MDWA 1K73C 2BKDN 4J8OA 4ZN3A 2ZPFB 3MP8A 3OYIA 4D6WA 3CD6A 3M58A 3HP9A 1KD1U 4BE1A 2DPPB 2EKOA 1KQSS 3I56A 3CD6T 4EMKB 2E5QA 3META 3CCVT 1VQNT 1VQOT 1YITT 4XAXB 4V2SA 2KSSA 2E1HA 2ZCFB 4BI4A 2RHXA 4ZGEB 1QVGS 3A8LB 2EJGA 3MP6A 1KQ2A 4LDWA 3VYGA 1UGRB 4BD3A 4J6XA 1KQSA 1M8VA 2E41A 3RUXA 3QXEB 5LJ3e 2OAUA 5D6YA 2JTFA 2P4TA 4TVRA 3JCMh 1JB0E 5CIUA 1VQ5T 2F5TX 4KT0E 4C8QE 1NJIC 1QVGA 2R58A 4C92E 5GAMg 4IUTA 3CPFA 2EYQA 5GMKi 2YRVA 3DB4A 3OYEA 1YJWA 2PUOB 3MEWA 2GQVA 4MZMA 5GAOp 1YJWT 3JRZA 1MGQA 2XG8D 3FDRA 3JAME 1Y7XA 2KK4A 3OS2A 4J6WA 4F7UF 3J80E 3CMEA 1WJSA 3C94A 5LJ5h 4E7IA 1TH7A 1U1SA 4J7FA 3OYNA 2GFAA 1YBYA 3OA6A 3HHTB 3FEOA 2L5QA 3GNGA 3C95A 5GAMf 1K73U 4A4GA 5LJ3j 1FXXA 3NFCA 1XOVA 3G7ZA 4MZTA 5IT9E 4EMKA 2XD0A 4M7AG 2XU8A 2YLBA 3CEYA 1I81A 3QBYA 1KHCA 4ZGDB 3LW5E 4MMKA 5I2SA 3L2QA 1N9RA 3JB9D 4Y28E 2EQMA 1RL2A 1WQWA 2M16A 2QA4T 2QQSA 3X26B 3CCMA 4KUDK 1N9SA 5FU7C 2XICA 3OSVA 5HY6A 2CYZB 3LX7A 3CCET 5GAOl 3UT1A 3LYIA 4RG2A 3X24B 4OB0B 3CCRA 4OVAA 3G4SA 2LVMA 3Q1JA 4M75E 2KQWA 2R5MA 2EIFA 3BDLA 4QQ6A 4XQ3A 1Y71A 4EMGA 1BIAA 3L42A 2DTHA 5GAOm 3G6ET 3DLLA 2RO0A 5GMKe 4QW2A 4M78F 4B9XA 2JTMA 1DJ7B 1VQ7T 2ZPEB 5KE2A 5FU6B 1VQ6T 4M7AC 4KULA 3WXMB 2RI2A 4C5IA 1IREB 4X34A 4XTVA 1BKBA 4E7LA 3SFMA 5CR2A 4O6JA 2RJEA 2DXCA 3LWIA 1W2BS 1YJNA 1JJ2S 2VGNA 3RESA 3H8ZA 3JCMc 2RM4A 4JLIA 4O5VA 4C0ZA 1VQ4A 5GAOn 4Y91A 1K8AC 4QVCA 1KC8C 3AHUA 1W2BA 3VUZA 3P8HA 2DXBA 2DAQA 2RHIA 5GMKj 1JJ2A 3EFSA 4M7DC 4M7DD 4YTLA 5GANh 4PJOE 4Z02A 3EAEA 5GAMd 1NZ9A 2CZ1B 4PL6A 1N8RU 1ZHIA 5C0MA 1NPRA 3QJYA 3S3NA 2JZ2A 1VQLA 3OBWA 4KBMB 3SD4A 3KXTA 3HKSA 1BYMA 2F69A 4J6YA 2CZ7B 2A7YA 3JCMg 1KD1C 5KCOA 1UGPB 1O75A 2MI6A 3OYFA 4ATOA 2ZPGB 1PSEA 2LCCA 4L5GA 3JB9H 1VQKA 4EPCA 4IUQA 3OYBA 4MMLA 4A4KA 5GANe 3PFSA 2WACA 1Q82U 1EIFA 4L6V5 2RB6A 1KG1A 4A4FA 2LX9A 4M75G 4A4EA 3QG1A 5GAN6 3MEUA 4DOVA 3RMQA 5GAN7 5DLOA 1UGSB 5LJ5g 1G5VA 3JCMf 3GOXA 2RJCA 2C06A 2D6FA 4E7JA 1P92A 3URGA 3KUFA 3RKXA 1M4ZA 2BIVA 4PNOA 3ZFJA 3V7SA 3M54A 4R55A 1VQ8T 3RMSA 2RI5A 2OTLA 4M7AD 5D6XA 1H3ZA 2K3XA 3S6WA 3FC3A 4BUGA 2DEQA 2VXEA 2M9UA 5A0GA 1VQNA 1QP3A 1Y96B 3G71A 1KC8U 4HT9A 4ZN1A 5FU7B 3M5AA 4XTYA 2F5KA 5LJ5f 4MZPA 4JJNK 3BDUA 4RCBA 3OMCA 2GF7A 5LJ3h 3TREA 2EAYA 3FB9A 1OZ3A 4M77G 5GMKl 2DD5A 3OYCA 4M7DF 3CMAT 4BE2A 4XU2A 3O8VA 3QPHA 3VV0A 3CCVA 4PJOG 4DQ2A 3OW2S 3A8HB 1VQOA 1VQPA 2DZ9A 4XU3A 1WQ7A 1YITA 3CC2T 3CPWS 3QIIA 3A8GB 1IZ6A 2BUDA 2K4YA 4M75C 2DXTA 4NOYA 5DLQE 5GMKm 4JLGA 4M7AB 2EQKA 1MHNA 1BIBA 2QQ9A 3QZ9B 2FL7A 2QXFA 2E64A 3HSBA 1VQ5A 3OYHA 2LC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMK A;  4OP0 A;  5GAM h;  5GMK l;  5GAN 5;  1N9R A;  3JB9 D;  2E10 A;  3JCM W;  3QSU A;  1WQW A;  4X9C A;  3QHS A;  4XTX A;  2DXU A;  1N9S A;  1Y96 A;  3SWN C;  2I2L A;  1X01 A;  1M5Q 1;  4XU0 A;  3V7R A;  5GAO l;  1LNX A;  3FJP A;  3JCM J;  4M7D B;  4M77 E;  2DTO A;  5GAM j;  1LJO A;  2EWN A;  4M77 C;  4M75 E;  2CGH A;  4M77 A;  5DY9 A;  4XQ3 A;  3HFO A;  4F7U A;  2DVE A;  4EMG A;  3JCM d;  5GAN g;  1BIA A;  1B34 A;  2DTH A;  4N0A C;  4A54 A;  1H64 1;  5GMK e;  5GAO m;  4PJO A;  4NL3 A;  1JRI A;  4M78 B;  4M78 F;  4M78 G;  2DJZ A;  4C8Q F;  5GAO q;  2RD1 A;  3RKW A;  4C92 F;  4M7A C;  4C8Q D;  3JB9 F;  3JB9 G;  4M7A A;  5LJ3 d;  4C92 D;  3RKY A;  4XTV A;  3JCM Q;  5GMK h;  2FYK A;  3HFN A;  3QUI A;  3RES A;  3JCM c;  5LJ5 d;  4A53 A;  4NL2 A;  1HXD A;  3JCM X;  5GAN f;  2RM4 A;  3JCM P;  3JCM b;  4JLI A;  3JCM V;  2DZC A;  5GAO n;  4Y91 A;  1I5L A;  1D3B B;  3BW1 A;  1WPY A;  4WF2 A;  3V8J A;  4QVC A;  4F7U E;  4M75 D;  3AHU A;  4M7D E;  1U1T A;  3JB9 J;  4HT8 A;  3V8L A;  5GMK j;  3EFS A;  4J5Y A;  4M7D C;  5GAN h;  2JN0 A;  5GAN 4;  4PJO E;  1I8F A;  2DKG A;  1D3B A;  4M7D A;  2EJF A;  2Y90 A;  3BY7 A;  5GAM d;  4XU1 A;  2YHT A;  3VU3 C;  4M7A E;  2HNI A;  4C8Q B;  3GIB A;  3BFM A;  3L1A A;  4J6Y A;  1WNL A;  4C8Q G;  4C92 B;  3JCM g;  4C92 G;  3SWN B;  4PJO C;  4M78 C;  4HA8 A;  3V7C A;  5GAN j;  4JRK A;  4M78 A;  3JB9 H;  2YLC A;  2DTI A;  4JUV A;  3RER A;  4MML A;  3INZ A;  5GAN e;  4M77 F;  5LJ3 g;  5CAI A;  5GAN 3;  2RB6 A;  2FB7 A;  4M77 D;  4M75 B;  4M75 F;  5GAN 6;  4M75 G;  5GAN 7;  4EMK B;  3JCM e;  5LJ5 g;  4PJO D;  3JCM f;  4V2S A;  2E1H A;  3RKX A;  2EJG A;  4PNO A;  1KQ2 A;  4JRI A;  3V7S A;  4M7D G;  4M7A D;  4J6X A;  1M8V A;  2VC8 A;  2E41 A;  3RUX A;  5LJ3 e;  2DEQ A;  2VXE A;  5LJ3 f;  4M7D F;  1YCY A;  3JCM h;  1Y96 B;  4M78 E;  4HT9 A;  4C8Q E;  4XTU A;  3QO3 A;  4XTY A;  4C92 E;  5GAM g;  5LJ5 e;  3PGG A;  5GMK i;  4C8Q C;  5LJ5 f;  3RIR A;  5GAN d;  2EJ9 A;  1JBM A;  2ZGW A;  4C92 C;  3L2Z A;  4C8Q A;  3BDU A;  4C92 A;  4RCB A;  5GAO p;  3EFR A;  4RCC A;  3SWN A;  1MGQ A;  5LJ3 h;  4M77 B;  2EAY A;  3FB9 A;  4J6W A;  4M77 G;  2K57 A;  4XTZ A;  4EMH A;  1KQ1 A;  3SB2 A;  4F7U B;  4F7U F;  1B34 B;  2E65 A;  4XU2 A;  4F7U G;  4PJO B;  4PJO F;  4M7D D;  4PJO G;  2RA2 A;  4DQ2 A;  3FIF A;  1TH7 A;  5LJ5 h;  1U1S A;  2DZ9 A;  1WQ7 A;  4XU3 A;  4X9D A;  3V8K A;  3M4G A;  5GAM e;  4QVD A;  1I4K 1;  4M75 C;  4NOY A;  5GAM f;  2DXT A;  4EMK C;  5GMK m;  5LJ3 j;  4M75 A;  4M7A B;  4M7A F;  4M7A G;  4N0A A;  1BIB A;  4EMK A;  1HK9 A;  2YLB A;  5I21 A;  1I81 A;  3JB9 I;  5GAN 8;  5GAO r;  2E64 A;  2QTX A;  2VXF A;  1LOJ A;  3HSB A;  5GAN 2;  4M78 D;  5LJ5 j;  4XTW A; 
#chains in the Genus database with same CATH topology
 2GNC A;  3HRS A;  1K76 A;  2GBQ A;  1Y96 A;  3NTH A;  5FRM A;  4P5N A;  1YIJ T;  2DIQ A;  2JW4 A;  1QMC A;  1N27 A;  3CCV Q;  4RMO A;  2CDT A;  3WVD B;  1S72 T;  2RJF A;  2OTJ A;  2DMO A;  2LT4 A;  4CC4 B;  4PLL A;  4M7A A;  1YN8 A;  2D0Q B;  4ZGJ B;  3RKY A;  2QA4 A;  2PQW A;  1NJI R;  3VS4 A;  5GMK h;  4FT4 A;  1WHM A;  3CCE A;  5FLX E;  3EGU A;  1TWB A;  2L2P A;  2DZC A;  3V8J A;  4F7U E;  3OY9 A;  1YI2 Q;  3RNJ A;  2EW3 A;  3G6E A;  2JN0 A;  2ATC B;  3CCL A;  1RAD B;  3PT9 A;  2OX7 A;  3LH0 A;  1YCS B;  4OB2 B;  2K3Y A;  1M1F A;  1YP5 A;  2V8J A;  1NEG A;  1BCO A;  1R77 A;  2P4R A;  2EPD A;  2K6D A;  4FYY B;  1NYF A;  1M9S A;  2DRM A;  3CC7 A;  4C5H A;  5LJ3 g;  1MND A;  3M9Q A;  3UA6 A;  4MDX A;  3L2U A;  3GNF B;  3OMG A;  2E70 A;  1HD3 A;  2X51 A;  2DNU A;  5KCH A;  2ZPH B;  2X4W A;  2SRC A;  1K9M C;  5GJW B;  2XI9 A;  4J9C A;  4FYX B;  5A2Q E;  1YCY A;  1G83 A;  2HMA A;  4XTU A;  1PRM C;  1QW1 A;  1ZA2 B;  2V8K A;  1JBM A;  3VS0 A;  1QP2 A;  1O9S A;  4M4Z A;  3ER0 A;  3CQT A;  4J7I A;  1B07 A;  4EMH A;  2QEX A;  4XTZ A;  2FHD A;  5EC7 A;  5GAN d;  4IUV A;  1HSQ A;  3EH1 A;  4OB3 B;  2LMJ A;  3M4G A;  3A98 A;  1VQ8 A;  2VV5 A;  3VJP A;  4M7A F;  4N0A A;  2KEA A;  3CXC P;  3CBO A;  2CZ6 B;  3MP1 A;  3OYY A;  3CC4 Q;  2COZ A;  5GAN 5;  1YHQ T;  3KBG A;  4KH1 B;  3R6O A;  2I2L A;  2J6K A;  4ESR A;  4BDZ A;  2EQI A;  1UE9 A;  4AFZ C;  2LQ8 A;  4DEX A;  2DE0 X;  2RK2 A;  3HFO A;  3QWX X;  3VYH B;  4N0A C;  1H64 1;  3NHN A;  2KRS A;  1K73 R;  4M78 G;  1M27 C;  2BTT A;  2PUK B;  3RKW A;  2HKN A;  3FRN A;  1R8O B;  4F17 A;  2YRC A;  1U5S A;  1UDL A;  5IHN A;  2HQH A;  2JS2 A;  4RTW A;  1IRX A;  4NL2 A;  1HXD A;  1FMK A;  2A08 A;  3JCM V;  3CMA Q;  3BW1 A;  2YXY A;  1YI2 A;  3I56 T;  3LGL A;  4E2F B;  1I8F A;  2XDP A;  2OJ2 A;  2E6Z A;  3VU3 C;  1UEB A;  1GXI E;  3GPL A;  2RQR A;  3C0C A;  5AYF A;  5FWB A;  1TSF A;  2FO0 A;  1WXU A;  5CAI A;  2WSF E;  2K7A A;  3SHW A;  2XDB A;  1PHT A;  2K9G A;  2HD0 A;  3JCM e;  1VIE A;  1NJI C;  4E7S A;  4J9D A;  2KRM A;  2HBP A;  2LNH B;  1H8K A;  2O9S A;  1QLY A;  3MPU B;  1XQH A;  2VC8 A;  2A3L A;  5CCA A;  1IHW A;  2EYX A;  4C0F A;  3X25 B;  4E7H A;  3CCU A;  3L2Z A;  1NLO C;  2QI2 A;  4BAC A;  1WLP B;  1NE8 A;  3CME Q;  2K2V A;  1Q82 R;  2PVO B;  1T0J A;  1OEB A;  3UF4 A;  2E12 A;  4JS5 A;  5DM7 R;  1GBR A;  1F1B B;  1LOJ A;  5J3B A;  1E6G A;  2HL5 C;  3CC4 A;  3SDZ A;  4QQG A;  5GAM h;  3M0U A;  2E10 A;  3MEV A;  3V7R A;  1OV3 A;  2YUP A;  1WJQ A;  1LJO A;  5IAY A;  2YUQ A;  2DEU A;  1KJW A;  3A5Z B;  1FYN A;  1UGQ B;  1J3T A;  3EFO B;  5I11 A;  1JRI A;  4M78 B;  1NLP C;  3JB9 G;  3QWY A;  1G3T A;  3MEA A;  2ROL A;  1QVF A;  4JRQ A;  1YJ9 A;  1WFW A;  1NYG A;  1VQK T;  1BI3 A;  1GRI A;  2HEQ A;  5HK3 A;  3TEE A;  3QKJ A;  1U1T A;  5CKB A;  2Y90 A;  1QCO A;  1K8A U;  1VQL Q;  2RQU A;  5CKF A;  3EFO A;  3LH5 A;  3M0P A;  5GAN j;  1VIF A;  3OYD A;  4M78 A;  5IHK A;  1X43 A;  1K73 C;  4J8O A;  3OYI A;  3VS1 A;  3CD6 A;  2LP5 A;  3MET A;  3CCV T;  2KXC A;  4XAX B;  2ZCF B;  1KQ2 A;  2A28 A;  1M1K R;  1ABQ A;  4IIM A;  1M8V A;  2OAU A;  4TVR A;  5CIU A;  1VQ5 T;  2M51 A;  1TUD A;  4IUT A;  2YRV A;  3KFV A;  1RAC B;  4DBQ A;  3MEW A;  3JRZ A;  1MGQ A;  3JAM E;  3QDF A;  2KK4 A;  1LPL A;  2H3E B;  3J80 E;  3CME A;  3BE3 A;  5LJ5 h;  1MUZ A;  1AWO A;  1X6G A;  2ED1 A;  2C0O A;  1ACM B;  1BBZ A;  3NFC A;  5IT9 E;  3G7Z A;  2A36 A;  1UUE A;  1KHC A;  2JTE A;  2VVK A;  4MMK A;  4RTZ A;  1RL2 A;  1WQW A;  2OAW A;  2IPO B;  3CCM A;  5FU7 C;  2CP0 A;  3EG0 A;  2DLP A;  3H0H A;  3X24 B;  2JXB A;  2CUD A;  1R0C B;  4XQ3 A;  2JS0 A;  2ZAE A;  2GTJ A;  4M78 F;  4PJM A;  4B9X A;  1VQ6 T;  5FU6 B;  1AEY A;  5AT1 B;  3I5R A;  2RJE A;  3LWI A;  1JJ2 S;  3H9N A;  4QT7 A;  4JLI A;  4Y91 A;  2DX1 A;  1KC8 C;  1TOV A;  3P8H A;  2DAQ A;  3G4S Q;  2CH4 A;  1JXO A;  2PNI A;  2CH4 W;  2EVR A;  3EAE A;  1NZ9 A;  1VQ7 Q;  5C0M A;  1NPR A;  1VQL A;  2JZ2 A;  1UG1 A;  1BYM A;  2A7Y A;  3JCM g;  1KD1 C;  1OX8 A;  5KCO A;  4JJB A;  3OYF A;  4ATO A;  3JB9 H;  2DVJ A;  4EPC A;  4ORZ A;  1EIF A;  1WIE A;  2LX9 A;  4M75 G;  4A4E A;  3MEU A;  4DOV A;  5DLO A;  2D6F A;  2RJC A;  2DL8 A;  4E7J A;  2MYS A;  4R55 A;  3VS3 A;  4M7A D;  5D6X A;  5A0G A;  4PJN A;  4HT9 A;  1MMA A;  4MZP A;  1QKW A;  3BDU A;  5LJ3 h;  2M0Y A;  4Z89 A;  3OYC A;  1D0X A;  3CMA T;  3VV0 A;  1AZG B;  3CC2 T;  4HVW A;  1WQ7 A;  3QII A;  2BUD A;  2JM9 A;  2K4Y A;  4NOY A;  1MHN A;  1WYX A;  3QZ9 B;  1GCQ A;  3HSB A;  1KIK A;  2QQA A;  3C4S A;  3DB3 A;  3QHS A;  2X4J A;  2RQV A;  2DBK A;  4IUP A;  4KGX B;  3S3O A;  1TG0 A;  1JO8 A;  3OYM A;  1LCK A;  4J9I A;  3P8B B;  3JCM J;  4M7D B;  2DTO A;  4DA4 A;  2CSQ A;  1MV0 B;  4M77 C;  1Q7Y U;  4DBH A;  1X27 A;  2NUZ A;  4PJO C;  3J81 E;  4LDY A;  2O4X B;  1GCQ C;  2HAX A;  2RHZ A;  5GAO q;  4A4H A;  4F16 A;  1KHI A;  4C0G A;  3JB9 F;  2A0F B;  1BI2 A;  1EZZ B;  2AKL A;  4F04 B;  2GCX A;  5KYY B;  2EYY A;  2JVV A;  1VQM T;  5GAN f;  1U06 A;  1N8R C;  1QVP A;  4ME7 A;  4LDU A;  2CZ0 B;  2FVU A;  1MNE A;  3CCQ Q;  4EIK A;  4BDY A;  4AMC A;  1D3B A;  4LUD A;  4HCC A;  4M7D A;  1WHG A;  5M9O A;  1I1J A;  1RAI B;  1VQ7 A;  3OYJ A;  4FM4 B;  1WHH A;  3A1P A;  2HNI A;  2OTJ Q;  2D0N A;  2VKN A;  3EG3 A;  2L8D A;  2O4X A;  2CP2 A;  1ABO A;  2CRE A;  2XDD A;  4M77 F;  2LQK A;  2FB7 A;  4M75 B;  1WXT A;  5KYY A;  1C6V X;  1VQP Q;  5FRO A;  2BE7 D;  2FPD A;  2E3I A;  2HDA A;  3RDV A;  3CCL Q;  5HCK A;  1OPK A;  1JJ2 P;  1PKS A;  1K8A R;  4C8Q C;  4FIB A;  4C92 C;  1Y0M A;  2ZGW A;  4ELZ C;  3CXC S;  1I5O B;  4FW2 A;  3CC7 Q;  4N4H A;  3CCS T;  1W70 A;  2ESW A;  5J26 A;  3OB9 A;  4AG1 C;  3ZEH A;  4X9D A;  4QVD A;  3A8O B;  2EGC A;  4M75 A;  3DKM A;  3F70 A;  1YHQ A;  1HJD A;  4E47 A;  2NUP B;  1PRL C;  2O31 A;  2CKK A;  4VUB A;  3L2V A;  2X9H A;  1M90 U;  1G3Y A;  1LNX A;  2QEX Q;  2LCL A;  5CKD A;  2EYZ A;  2H3J A;  2B86 A;  5A0D A;  3TSZ A;  2DVE A;  2LJ1 A;  2EFI A;  3GF5 A;  4Q5W A;  1M3B A;  2AZS A;  4FSX A;  1FMW A;  4C8Q F;  3OW2 A;  4C92 F;  4QVZ A;  3CPW A;  3VS5 A;  1RUW A;  1CKA A;  1VQ9 T;  2RI3 A;  1XNI A;  3MHX A;  2NUP A;  1WJR A;  4OMO A;  3GLX A;  4LD6 A;  4M7D E;  4K11 A;  1SF9 A;  2RF0 A;  2ZPI B;  1RAE B;  3CCQ A;  1VOM A;  1X6O A;  3OYL A;  3J7A F;  2YHT A;  3GIB A;  3I55 T;  3SWN B;  2VUB A;  2DER A;  2YLC A;  5IXF A;  2R57 A;  2HL3 A;  2RJD A;  1IXD A;  4OF1 A;  4C5E A;  1PSF A;  4M75 F;  3VUB A;  2EKH A;  2AZV A;  1VQP A;  1FWZ A;  2LTO A;  1IHV A;  3M53 A;  1G3S A;  3GP8 A;  2PU9 B;  1M1K U;  2CUB A;  4BI3 A;  1B7T A;  2YSQ A;  1Q81 U;  2VGM A;  2VB6 A;  3NMZ C;  3PGG A;  4JJD A;  2EJ9 A;  2QDY B;  2QTV A;  3HL8 A;  3SWN A;  3PMI A;  3OS0 A;  4D8D A;  4GLM A;  1KK7 A;  2E65 A;  2P0K A;  3G4S T;  1UFF A;  1ZSZ C;  2YT6 A;  4EMK C;  3M57 A;  5I21 A;  1TXQ A;  2ENM A;  5GAN 8;  1N6A A;  4M78 D;  1X2K A;  3S3M A;  2LJ3 A;  4LUE A;  1XTD A;  1AZE A;  1FX7 A;  3CCU Q;  4LDV A;  1GCP A;  2DA9 A;  3CBP A;  3SWN C;  1YWP A;  3OSS C;  4F14 A;  2EGA A;  1PCX A;  2DK3 A;  1VQ4 T;  3CCR Q;  4Y92 A;  1RAH B;  3PIP A;  2WSE E;  3JSC A;  4R0K A;  4RKU E;  1K0X A;  1T3S A;  2KAF A;  2GFU A;  2AKK A;  3UDC A;  3TCJ A;  2J6F A;  2RD1 A;  3E9G A;  2KMT A;  4OMN A;  2KRO A;  1PNJ A;  5EG2 A;  1Q86 C;  1AT1 B;  1AD5 A;  2RHY A;  4IUR A;  2FYK A;  1OI1 A;  4QKU A;  1RAG B;  3JCM P;  2KR3 A;  4HT8 A;  5C6S A;  1VYT A;  3QDR B;  1PM3 A;  4NS5 A;  4EDU A;  1Q7Y R;  4IKF A;  2E6N A;  2O2O A;  5FW9 A;  2OTL T;  2DET A;  4M7A E;  2FPF A;  2P0P A;  3M59 A;  5A0L A;  2K5F A;  1V29 B;  1TUC A;  3CCJ T;  1PWT A;  3G71 T;  4JRK A;  5CQY A;  4AT1 B;  3H6Z A;  4JUV A;  4MDW A;  4ZN3 A;  1YJ9 Q;  3EG1 A;  2HCK A;  1VQO T;  4V2S A;  4BI4 A;  2E1H A;  2EJG A;  3VYG A;  1QWE A;  2V1R A;  2E41 A;  3RUX A;  4RTV A;  1IO6 A;  3H41 A;  2Z0W A;  3JCM h;  2R58 A;  2EYW A;  3CPF A;  1MMG A;  2EYQ A;  4RTT A;  5GMK i;  2PUO B;  2YRD A;  4MZM A;  1YJW T;  3FDR A;  2XG8 D;  3CD6 Q;  3MKD A;  4OML A;  1VQN Q;  2F2V A;  1TH7 A;  1U1S A;  4J7F A;  1U3O A;  1YBY A;  3HHT B;  3C95 A;  2DL4 A;  1D1B A;  3CEY A;  2YLB A;  3QBY A;  1SRM A;  5I2S A;  3M0T A;  3JB9 D;  2M16 A;  2QA4 T;  3X26 B;  5HY6 A;  3CCE T;  2F1L A;  3UT1 A;  4RG2 A;  1CKB A;  3H0F A;  3CCR A;  5KYN A;  4OVA A;  3ULR B;  1NG2 A;  3Q1J A;  3I35 A;  2KQW A;  1YWO A;  2DL5 A;  2R5M A;  4QQ6 A;  3G6E T;  1BIA A;  2RO0 A;  4KUL A;  4C5I A;  2RI2 A;  4RTU A;  4O6J A;  3G1J A;  1W2B S;  2OI3 A;  1Y57 A;  1YJN A;  3RES A;  3CCM Q;  1PKT A;  1NM7 A;  1K9A A;  2G6F X;  1M90 R;  1ZBJ A;  2DXB A;  4GBQ A;  2RHI A;  5GMK j;  1JJ2 A;  4YTL A;  1PD0 A;  5GAM d;  4A63 B;  3QJY A;  3OBW A;  3HKS A;  4J6Y A;  1UGP B;  1O75 A;  2MI6 A;  2ZPG B;  1PSE A;  2LCC A;  4A4K A;  2QAS A;  2WAC A;  2RB6 A;  2PZ1 A;  3H0I A;  2DF6 A;  3REB B;  4A4F A;  3D7S B;  3QG1 A;  1OU9 A;  2C06 A;  3GOX A;  1W6X A;  1VQ8 T;  1M4Z A;  1QCN A;  4PNO A;  3ZFJ A;  3M54 A;  3RMS A;  2QAZ A;  4BUG A;  2DYI A;  2M9U A;  1NEB A;  2K79 A;  5FU7 B;  2F5K A;  4JZ3 A;  1ZUU A;  2O9V A;  4JJN K;  4LNP A;  1Q95 G;  2EAY A;  1OZ3 A;  4M77 G;  1E7O A;  5GMK l;  4Z8A A;  4XU2 A;  1VQN A;  4M7D D;  4PJO G;  4DQ2 A;  1YIT A;  1SEM A;  3A8G B;  1IZ6 A;  2DXT A;  1RAF B;  1BIB A;  2E64 A;  4OMM A;  2COW A;  4LN2 A;  4OP0 A;  2I0N A;  1Q81 R;  1K0S A;  4E7K A;  2GQI A;  4HCB A;  2ZPB B;  2FG0 A;  3FJP A;  1OYX A;  1BK2 A;  5IXB A;  1VYV A;  2IG0 A;  2LT1 A;  4B9W A;  2CGH A;  1YI2 T;  3ME9 A;  2D8H A;  5GAN g;  3JV3 A;  2LZ6 B;  2EQU A;  1B3Q A;  2HQX A;  2KYB A;  2COY A;  1ARK A;  1V1C A;  5CKE A;  1VQM A;  2XK0 A;  4HKE A;  5LJ5 d;  1YIJ Q;  4WCI A;  1TU0 B;  1T0H A;  4M75 D;  1UJY A;  3V8L A;  2KY9 A;  2MMP A;  2DKG A;  1S72 Q;  3M4Y A;  3QYG B;  1AWJ A;  2C0T A;  2MAM A;  4C8Q G;  3N5B B;  1WNL A;  1Q82 C;  3OYG A;  4C92 G;  4HA8 A;  1UJ0 A;  2AK5 A;  5FRN A;  3MO8 A;  2YWW A;  4E7Z A;  4DBR A;  1NBE B;  5GAN 3;  1X69 A;  1RI9 A;  2JNG A;  5FWC A;  2SEM A;  2L3P A;  3OS1 A;  2FPE A;  2ABL A;  2XKO C;  4FU6 A;  2DO3 A;  2MIO A;  4BI8 B;  4CC3 A;  1W2B P;  4C0D C;  1JXM A;  4C5G A;  2CS7 A;  4M78 E;  4LE9 A;  3SEM A;  3HPW A;  3QO3 A;  3CC4 T;  3UWN A;  2YUN A;  2QG9 B;  4DEY A;  3CCS A;  4PJL A;  5CQX A;  3A8M B;  3TU4 K;  4M77 B;  4R56 A;  4F7U G;  3SB2 A;  1BU1 A;  4PJO B;  2RA2 A;  3CXC A;  1RLP C;  1QVF S;  2QTX A;  4HVU A;  1OX9 A;  2HSP A;  2RMO A;  4ANJ A;  3THK A;  4BY6 C;  3JCM W;  4JZ4 A;  4XTX A;  1H3H A;  2M1H A;  3PNW C;  4ELY C;  2X4Y A;  1YJ9 T;  2RPN A;  4XU0 A;  5GAM j;  4HVV A;  4ZTF A;  4M77 A;  3PVL A;  2RQT A;  4PJO A;  1ZQ1 A;  2C0I A;  1M1G A;  1QWF A;  1VQ9 A;  1YHQ Q;  1SPK A;  4J9H A;  5LJ3 d;  2K2M A;  8AT1 B;  4UC4 A;  2PVG B;  3HFN A;  3OQ5 A;  3CBM A;  1LVK A;  1M1K C;  1YIJ A;  2DYB A;  3R6N A;  1D3B B;  1PC0 A;  4AFS C;  1Q81 C;  1QKX A;  3JB9 J;  2VWF A;  2JM8 A;  2X4X A;  1W4S A;  4PFO A;  2M0O A;  4HCZ A;  1S72 A;  5L23 A;  1WX6 A;  2YUO A;  4IUU A;  4PJJ A;  3I55 A;  4C8Q B;  4C92 B;  1AWX A;  2EBP A;  4GY5 A;  3INZ A;  1E6H A;  1D0Y A;  1T3L A;  1VUB A;  3I56 Q;  5IN1 A;  2JOY A;  3CME T;  5CK9 A;  1OQK A;  4FW1 A;  4JRI A;  1A0N B;  2J06 A;  5J39 A;  2IVW A;  4OMF B;  1MMN A;  4PLI A;  5ECA A;  4WTO B;  1MMD A;  3P8D A;  1OUL A;  4RG8 A;  4C8Q A;  2KBT A;  4C92 A;  3EFR A;  3CCM T;  2P0Q A;  4F7U B;  1AHJ B;  1KQ1 A;  1B34 B;  2CSI A;  3EH2 A;  4PJO F;  4CRI A;  3FIF A;  4II1 A;  2MCN A;  2J05 A;  1HK9 A;  1KFZ A;  2K5L A;  5LJ5 j;  3REA B;  2KT1 A;  2G3R A;  3C12 A;  2JMA A;  1W1F A;  3M56 A;  1FMV A;  1WXB A;  2NUT B;  2FRY A;  2XID A;  4M77 E;  5L8R E;  3T9N A;  2Y4Y A;  4JPB W;  4AFQ C;  2JMC A;  4F7U A;  3NTK A;  3OYA A;  4N4I A;  1B34 A;  3L2W A;  2MWP A;  3RBB B;  1C0M A;  2DJZ A;  4ZTJ A;  1TUG B;  3QJ6 A;  1ZUK A;  1VQL T;  2AIR B;  2ZZD A;  4FL6 A;  4FT2 A;  2VAS A;  4KUI A;  1QVF P;  4FSS A;  1AOJ A;  3NPF A;  2D9T A;  1KSW A;  1TTH B;  2NUT A;  2EJF A;  2LNV A;  2X3W D;  2MK5 A;  3CCJ A;  5CO7 A;  3ASK A;  3L1A A;  3ZL7 C;  1M8M A;  3X20 B;  1VQK Q;  1X75 C;  2IIM A;  1RAB B;  3M58 A;  1KD1 U;  1ZSZ B;  1KQS S;  3I56 A;  4EMK B;  2E5Q A;  3VRZ A;  2X3X D;  1I07 A;  2K3B A;  2KSS A;  3EHR A;  4KRT A;  2RHX A;  1QVG S;  4B6M A;  2KNB B;  3MP6 A;  1UGR B;  4J6X A;  1AWW A;  2JTF A;  2P4T A;  3O5Z A;  1JB0 E;  4C8Q E;  4KT0 E;  4C92 E;  3DB4 A;  2BE9 B;  3OYE A;  1YJW A;  4RTY A;  2GQV A;  5GAO p;  3OS2 A;  2E3H A;  2F2W A;  2V1Q A;  4J6W A;  4F7U F;  1JQQ A;  3C94 A;  1OPL A;  2GFA A;  1V76 A;  2L5Q A;  3GNG A;  5GAM f;  2DL7 A;  3MJX A;  1PG5 B;  5LJ3 j;  1FXX A;  1XOV A;  1ZSZ A;  4MZT A;  2XD0 A;  4EMK A;  4Z88 A;  1I81 A;  2KXD A;  2KT8 A;  2J6O A;  1VQ5 Q;  3LW5 E;  4KGV B;  5IHI A;  3EGX B;  3L2Q A;  5KYX B;  2EQM A;  2CT3 A;  2QQS A;  3IQL A;  1N9S A;  2XIC A;  3OSV A;  3LX7 A;  5GAO l;  3LYI A;  2NWM A;  4FCY A;  2LVM A;  4M75 E;  4NL3 A;  3FJ5 A;  2EIF A;  3BDL A;  4EMG A;  3L42 A;  5GMK e;  4QW2 A;  1Z9Q A;  1G2B A;  1VQ7 T;  4M7A C;  2ZPE B;  1IRE B;  4X34 A;  4XTV A;  1BKB A;  4E7L A;  3SFM A;  5CR2 A;  2DXC A;  1SKU B;  3H8Z A;  2L3Q A;  3EGX A;  5KYX A;  4C0Z A;  2O88 A;  1YNZ A;  1K8A C;  2RQW A;  4QVC A;  3AHU A;  1W2B A;  3VUZ A;  3EFS A;  5GAN h;  2LQW A;  1IGU A;  1OOT A;  4Z02 A;  2CZ1 B;  4PL6 A;  1N8R U;  1ZHI A;  1VQ6 Q;  3M0R A;  3SD4 A;  1D09 B;  4KBM B;  2EGE A;  1WHK A;  4DBF A;  1RAA B;  1H92 A;  1SG5 A;  1VQK A;  4HXJ A;  2ROT A;  1GBQ A;  3OYB A;  4MML A;  4J9G A;  5GAN e;  1YJN Q;  2E5K A;  3TQ7 P;  4AG2 C;  4L6V 5;  5GAN 7;  5GAN 6;  4JJC A;  1JU5 C;  2H8H A;  1P92 A;  2YDL A;  3V7S A;  2RI5 A;  2K3X A;  1WI7 A;  3S6W A;  2VXE A;  1M30 A;  4CC2 A;  5LJ5 f;  1SHF A;  2KGT A;  3TRE A;  3FB9 A;  2W10 A;  4BE2 A;  3VRY A;  3CCV A;  3QPH A;  3OW2 S;  3A8H B;  4XU3 A;  1N5Z A;  3CPW S;  5GMK m;  2DFU A;  4JLG A;  3HTR A;  2J7I A;  2DL3 A;  3M0S A;  3EG9 B;  1VQ5 A;  3OYH A;  1X2Q A;  3MCA B;  4FYV B;  1M3C A;  2HZY A;  4QQD A;  1KQS P;  1QVG P;  1M5Q 1;  2V8I A;  2FRW A;  3PMT A;  3E9F A;  3CC2 Q;  1WGS A;  2LQN A;  1YIT Q;  1VA7 A;  3ZBD A;  4DOW A;  5DY9 A;  3JCM d;  3CCQ T;  9ATC B;  1PD1 A;  2GTO A;  2FZC B;  3M0Q A;  1UEC A;  2Y4X A;  1YFN A;  2OTJ T;  5CVI A;  1M2V B;  3EG9 A;  3LWH A;  2LDM A;  3QUI A;  5I2M A;  3I9Q A;  2KYM A;  4J9B A;  4A53 A;  3JCM X;  4JRP A;  1BI1 A;  2MF2 A;  2R5A A;  1I5L A;  1GFC A;  1WZO A;  3LLR A;  1X6B A;  1VQP T;  2W0Z A;  5GAN 4;  1SSF A;  4OGE A;  3CCL T;  3EG2 A;  1VQ6 A;  2WSC E;  5D6W A;  3L2R A;  3PE0 A;  3V7C A;  5KYW B;  2ECZ A;  1VQM Q;  3RER A;  4OMP A;  1M2V A;  1EFN A;  2DM1 A;  2JJ9 A;  2RH2 A;  2XHC A;  4E6R A;  4M77 D;  3CC7 T;  1Z9Z A;  4PJO D;  4GLK A;  3OYK A;  3E2U A;  1UGV A;  1SRL A;  5LJ3 f;  4OB1 B;  2QYZ A;  2CP3 A;  1U8R A;  3VS6 A;  1KC8 R;  3RIR A;  2KDS A;  3LGF A;  2LCS A;  1OZ2 A;  5KYW A;  2KI7 A;  2KE9 A;  2QEX T;  3V8K A;  1KD1 R;  1ZSG A;  5GAM e;  1ZX6 A;  2RHU A;  3E19 A;  5KH6 A;  2FZG B;  5GAO r;  1EX4 A;  4XTW A;  1S1N A;  4N4G A;  1QCF A;  5KE3 A;  4X9C A;  2PVD B;  1WHL A;  2NLU A;  1Q7Y C;  1K9M U;  3UA7 A;  3CCS Q;  1X01 A;  4D8K A;  3CMA A;  3WVE B;  1RLQ C;  3CC2 A;  2LRQ A;  4LD9 K;  2LX7 A;  5GJV B;  4L59 A;  2L89 A;  4LDX A;  5HKC A;  4A54 A;  2RNA A;  4JS4 A;  4BE0 A;  4C8Q D;  1I0C A;  4C92 D;  1AVZ C;  3JCM Q;  3OW2 P;  4PK4 A;  3CPW P;  2K5I A;  4CI0 C;  1Q86 U;  2E4H A;  4RUG A;  2BZX A;  1UHC A;  1WPY A;  4WF2 A;  4KGZ B;  1UB4 A;  2CT4 A;  4J5Y A;  4C0D B;  1BI0 A;  3BY7 A;  2RK1 A;  1JEG A;  4JDS A;  4XU1 A;  3EHQ A;  4J83 A;  4BB7 A;  2EQJ A;  3FLG A;  1VQ9 Q;  4M78 C;  1RI0 A;  1GL5 A;  4J9F A;  2O01 E;  4PKC C;  2L3R A;  2DD4 A;  3M55 A;  2HBW A;  4KH0 B;  1ZUY A;  4PFZ A;  2HQE A;  3HRT A;  2AHJ B;  2QQR A;  4OGC A;  3PIO A;  1M3A A;  3OS5 A;  3I55 Q;  1ZA1 B;  4IIO A;  4BY6 B;  3VKI A;  1N8R R;  3I5S A;  5LJ5 e;  2DBM A;  2QDL A;  3PTA A;  4RCC A;  3CCU T;  4M7D G;  2K57 A;  2BZY A;  1SSH A;  1UTI A;  3CCR T;  1G3W A;  1I4K 1;  3NTI A;  3HRU A;  4AFU C;  3JB9 I;  2VXF A;  1M90 C;  5GAN 2;  5KYU B;  1NJI U;  3E1S A;  2FEI A;  2B8A A;  2JUF A;  1ZBX A;  5LL6 S;  3QSU A;  1NPP A;  2DXU A;  1YJN T;  2VYT A;  2X35 A;  2KRN A;  2EWN A;  2M02 A;  2QQB A;  1K4U S;  2KVQ G;  3QYH B;  3UPU A;  5HK0 A;  1QQJ A;  2RN8 A;  3X28 B;  1SHG A;  5KYU A;  3VS7 A;  3TSW A;  1VQ4 Q;  3JCM b;  6AT1 B;  1Y07 A;  2MWO A;  3DLM A;  3UAT A;  3OBY A;  2NYS A;  3QZ5 B;  5CKH A;  4XK8 E;  3BFM A;  1WDX A;  1VYU A;  3VS2 A;  2CP7 A;  8ATC B;  2DIG A;  1TS9 A;  5FU6 C;  2DTI A;  2BKD N;  4LXC A;  2ZPF B;  3MP8 A;  2DJQ A;  4D6W A;  3HP9 A;  4BE1 A;  2DPP B;  2EKO A;  4X1V A;  3CD6 T;  1G8X A;  1VQN T;  1MV3 A;  1YIT T;  4ZNX A;  4ZGE B;  1D1C A;  3A8L B;  2OTL Q;  4LDW A;  4BD3 A;  1KQS A;  4J9E A;  3QXE B;  5LJ3 e;  3CCJ Q;  5D6Y A;  3G71 Q;  2V26 A;  2F5T X;  1QVG A;  5GAM g;  1C1A A;  1M2O A;  3TVT A;  2QGF B;  2QGG A;  2L3S A;  2AT1 B;  5D7U A;  1Y7X A;  3PVQ A;  1WJS A;  4E7I A;  1VQO Q;  3OYN A;  3OA6 A;  3FEO A;  1K73 U;  1BCM A;  4A4G A;  2HSE B;  3EGD B;  4M7A G;  2XU8 A;  1OU8 A;  4ZGD B;  2MPX C;  2PTK A;  2CP5 A;  1WA7 A;  1N9R A;  1BB9 A;  4Y28 E;  2CP6 A;  1YJW Q;  4KUD K;  4CC7 A;  1CSK A;  3AT1 B;  2CYZ B;  1D1A A;  1WHJ A;  4OB0 B;  1IGQ A;  7AT1 B;  3G4S A;  2D8J A;  2LJ0 A;  1Y71 A;  2MOX A;  5GAO m;  2DTH A;  3DLL A;  1UHF A;  2JTM A;  2DRK A;  1DJ7 B;  1IB8 A;  5KE2 A;  3WXM B;  2D1X A;  3RR6 A;  1D0Z A;  3EGD A;  2QA4 Q;  1XJW B;  3CCE Q;  2VGN A;  4HCK A;  3JCM c;  2RM4 A;  4O5V A;  1VQ4 A;  5GAO n;  1K9M R;  2A37 A;  3G6E Q;  4M7D C;  4PJO E;  4PFP A;  5I22 A;  2JT4 A;  2P84 A;  5IH2 A;  2F2X A;  1HYO A;  3S3N A;  3KXT A;  2F69 A;  2CZ7 B;  4L5G A;  2DIL A;  4IUQ A;  2L0A A;  3PFS A;  4FYW B;  1Q82 U;  1GFD A;  1KG1 A;  1K1Z A;  2HKQ B;  2GGR A;  3RMQ A;  1UGS B;  5LJ5 g;  1G5V A;  3JCM f;  1Q86 R;  3NGP A;  3KUF A;  3URG A;  2FZK B;  3RKX A;  2BIV A;  2OTL A;  1H3Z A;  3FC3 A;  2DEQ A;  1QP3 A;  1Y96 B;  1ZLM A;  3G71 A;  1KC8 U;  4ZN1 A;  3U23 A;  3M5A A;  4XTY A;  4RTX A;  4RCB A;  3OMC A;  2GF7 A;  4M7D F;  4OMQ A;  2DD5 A;  2ED0 A;  2BZ8 A;  3O8V A;  2XMF A;  1VQO A;  2DZ9 A;  1VQ8 Q;  4M75 C;  5DLQ E;  4M7A B;  2EQK A;  2QQ9 A;  1R0B G;  2FL7 A;  2QXF A;  2QK0 A;  3GBQ A;  2LC4 A; 
#chains in the Genus database with same CATH homology
 2QQA A;  4OP0 A;  3C4S A;  3MCA B;  3DB3 A;  4QQD A;  3QHS A;  3HRS A;  4E7K A;  2X4J A;  4IUP A;  3S3O A;  1Y96 A;  3NTH A;  4HCB A;  5FRM A;  2ZPB B;  1M5Q 1;  2V8I A;  4P5N A;  3P8B B;  3OYM A;  2DIQ A;  3FJP A;  1OYX A;  3PMT A;  3JCM J;  3E9F A;  2DTO A;  1WGS A;  4DA4 A;  4M7D B;  1N27 A;  4M77 C;  2IG0 A;  2LT1 A;  3ZBD A;  4B9W A;  1Q7Y U;  2CGH A;  1YI2 T;  4DOW A;  5DY9 A;  3ME9 A;  4PJO C;  5GAN g;  3J81 E;  3JCM d;  4RMO A;  4LDY A;  3CCQ T;  2O4X B;  3WVD B;  1S72 T;  4NL3 A;  2EQU A;  2RHZ A;  2HAX A;  2HQX A;  2RJF A;  2OTJ A;  5GAO q;  4A4H A;  2LT4 A;  2Y4X A;  4PLL A;  1KHI A;  5CVI A;  4C0G A;  2D0Q B;  4ZGJ B;  3JB9 F;  4M7A A;  1BI2 A;  2OTJ T;  3RKY A;  2QA4 A;  5CKE A;  2PQW A;  1VQM A;  3LWH A;  2LDM A;  2GCX A;  2XK0 A;  5GMK h;  4FT4 A;  2JVV A;  4HKE A;  3QUI A;  5I2M A;  5LJ5 d;  5FLX E;  4A53 A;  5GAN f;  3JCM X;  3CCE A;  4JRP A;  1VQM T;  1BI1 A;  2MF2 A;  2DZC A;  1N8R C;  2R5A A;  1QVP A;  1I5L A;  4ME7 A;  4LDU A;  3V8J A;  4F7U E;  2CZ0 B;  4M75 D;  3OY9 A;  2FVU A;  3LLR A;  3V8L A;  3G6E A;  2KY9 A;  2MMP A;  2JN0 A;  5GAN 4;  4BDY A;  1VQP T;  2DKG A;  1D3B A;  1SSF A;  3CCL A;  3PT9 A;  4HCC A;  3M4Y A;  4M7D A;  4OGE A;  5M9O A;  3LH0 A;  3CCL T;  1VQ7 A;  1VQ6 A;  4OB2 B;  3OYJ A;  3QYG B;  4FM4 B;  2K3Y A;  2HNI A;  2MAM A;  2WSC E;  4C8Q G;  3N5B B;  1WNL A;  1Q82 C;  5D6W A;  4C92 G;  1M1F A;  2L8D A;  2V8J A;  3OYG A;  3L2R A;  2O4X A;  4HA8 A;  3V7C A;  1M9S A;  3RER A;  5FRN A;  3MO8 A;  2XDD A;  4M77 F;  3CC7 A;  4C5H A;  5LJ3 g;  2LQK A;  2RH2 A;  2XHC A;  5GAN 3;  2FB7 A;  4M77 D;  2JNG A;  3CC7 T;  4M75 B;  3M9Q A;  4MDX A;  4PJO D;  3L2U A;  4GLK A;  3GNF B;  3OMG A;  3OYK A;  3OS1 A;  2E70 A;  5FRO A;  2XKO C;  5KCH A;  4FU6 A;  2DO3 A;  2ZPH B;  2X4W A;  1K9M C;  4BI8 B;  4C0D C;  4C5G A;  2CS7 A;  2XI9 A;  5LJ3 f;  5A2Q E;  1YCY A;  4OB1 B;  4M78 E;  1U8R A;  3HPW A;  4XTU A;  3QO3 A;  3CC4 T;  4C8Q C;  1QW1 A;  2KDS A;  4FIB A;  3LGF A;  2V8K A;  1JBM A;  2ZGW A;  3RIR A;  3UWN A;  4C92 C;  4ELZ C;  3CXC S;  3CCS A;  1OZ2 A;  1QP2 A;  5CQX A;  3A8M B;  1O9S A;  3ER0 A;  4J7I A;  3TU4 K;  4M77 B;  4N4H A;  4EMH A;  4R56 A;  4XTZ A;  2FHD A;  4F7U G;  3SB2 A;  5GAN d;  2QEX A;  3CCS T;  4IUV A;  5J26 A;  4PJO B;  2RA2 A;  3OB9 A;  4OB3 B;  2QEX T;  3ZEH A;  3CXC A;  3V8K A;  4X9D A;  3M4G A;  5GAM e;  4QVD A;  1VQ8 A;  3A8O B;  2VV5 A;  3VJP A;  2RHU A;  3E19 A;  4M75 A;  5KH6 A;  4N0A A;  1QVF S;  4M7A F;  3DKM A;  5GAO r;  3CBO A;  2QTX A;  3F70 A;  2CZ6 B;  3MP1 A;  3OYY A;  1YHQ A;  4E47 A;  4XTW A;  5GAN 5;  1YHQ T;  4N4G A;  4BY6 C;  5KE3 A;  3JCM W;  4X9C A;  2PVD B;  4XTX A;  2NLU A;  1Q7Y C;  2CKK A;  3KBG A;  2M1H A;  3PNW C;  4VUB A;  3L2V A;  1K9M U;  3R6O A;  2X4Y A;  4ELY C;  1G3Y A;  1X01 A;  2I2L A;  1YJ9 T;  1M90 U;  3CMA A;  4XU0 A;  3WVE B;  1LNX A;  5GAM j;  3CC2 A;  2LCL A;  2LRQ A;  5CKD A;  4LD9 K;  4BDZ A;  2H3J A;  5A0D A;  4ZTF A;  2LQ8 A;  4L59 A;  4M77 A;  2RK2 A;  3HFO A;  2DVE A;  2L89 A;  5HKC A;  4LDX A;  2EFI A;  3GF5 A;  4Q5W A;  4N0A C;  3VYH B;  1H64 1;  4A54 A;  4JS4 A;  1ZQ1 A;  4PJO A;  1M1G A;  4FSX A;  4M78 G;  4C8Q F;  3OW2 A;  4BE0 A;  2PUK B;  3RKW A;  4C92 F;  4QVZ A;  3FRN A;  1VQ9 A;  1R8O B;  4C8Q D;  3CPW A;  5LJ3 d;  4C92 D;  3JCM Q;  1VQ9 T;  2RI3 A;  1XNI A;  2PVG B;  4UC4 A;  3HFN A;  3OQ5 A;  3CBM A;  3MHX A;  1M1K C;  1YIJ A;  2K5I A;  1HXD A;  1WJR A;  4NL2 A;  3GLX A;  4LD6 A;  4CI0 C;  3JCM V;  1Q86 U;  1D3B B;  3BW1 A;  1WPY A;  4WF2 A;  4M7D E;  1Q81 C;  1YI2 A;  3I56 T;  3JB9 J;  1UB4 A;  2ZPI B;  4J5Y A;  3LGL A;  2X4X A;  4C0D B;  1I8F A;  1W4S A;  2XDP A;  1BI0 A;  3CCQ A;  2M0O A;  4HCZ A;  1S72 A;  2E6Z A;  1X6O A;  2RK1 A;  3BY7 A;  4JDS A;  3OYL A;  4XU1 A;  3J7A F;  2YHT A;  4J83 A;  3VU3 C;  3I55 A;  1UEB A;  4IUU A;  4BB7 A;  1GXI E;  2EQJ A;  4C8Q B;  3GPL A;  3GIB A;  3FLG A;  4C92 B;  3I55 T;  3SWN B;  4M78 C;  1RI0 A;  2VUB A;  2O01 E;  5AYF A;  2YLC A;  4PKC C;  4GY5 A;  3INZ A;  2R57 A;  2L3R A;  2RJD A;  2DD4 A;  3M55 A;  5CAI A;  2WSF E;  4OF1 A;  4C5E A;  1PSF A;  2XDB A;  1VUB A;  4M75 F;  3VUB A;  5IN1 A;  2HD0 A;  2JOY A;  1VIE A;  3JCM e;  2HQE A;  3HRT A;  1FWZ A;  3CME T;  2AHJ B;  2LTO A;  2QQR A;  3M53 A;  4OGC A;  3PIO A;  1G3S A;  3GP8 A;  2HBP A;  2PU9 B;  5CK9 A;  1M1K U;  4JRI A;  3OS5 A;  5J39 A;  2IVW A;  1XQH A;  4BI3 A;  2VC8 A;  2A3L A;  4OMF B;  4BY6 B;  5CCA A;  3VKI A;  1Q81 U;  4PLI A;  2VGM A;  4C0F A;  3X25 B;  5LJ5 e;  3PGG A;  3P8D A;  4E7H A;  3CCU A;  4RG8 A;  2EJ9 A;  2QDY B;  3L2Z A;  4C8Q A;  2QI2 A;  4C92 A;  3PTA A;  4BAC A;  3EFR A;  4RCC A;  3HL8 A;  3SWN A;  1NE8 A;  3CCM T;  3PMI A;  3CCU T;  2P0Q A;  4F7U B;  2K57 A;  1AHJ B;  3OS0 A;  1KQ1 A;  4M7D G;  1B34 B;  2E65 A;  4PJO F;  2K2V A;  4CRI A;  3FIF A;  4II1 A;  2PVO B;  3CCR T;  2P0K A;  1G3W A;  3G4S T;  1I4K 1;  2E12 A;  4EMK C;  3NTI A;  4JS5 A;  3HRU A;  3M57 A;  5DM7 R;  1HK9 A;  5I21 A;  3JB9 I;  2K5L A;  5GAN 8;  2VXF A;  1M90 C;  1LOJ A;  1N6A A;  5J3B A;  4M78 D;  5GAN 2;  5LJ5 j;  3S3M A;  1NJI U;  3CC4 A;  3E1S A;  4QQG A;  3SDZ A;  5GAM h;  2B8A A;  2JUF A;  1ZBX A;  5LL6 S;  2E10 A;  3QSU A;  1XTD A;  1NPP A;  1FX7 A;  2G3R A;  3C12 A;  2DXU A;  4LDV A;  3CBP A;  3SWN C;  3OSS C;  3MEV A;  3M56 A;  1YJN T;  3V7R A;  2VYT A;  2DK3 A;  2XID A;  4M77 E;  1WJQ A;  2X35 A;  1LJO A;  5IAY A;  5L8R E;  1VQ4 T;  3T9N A;  2Y4Y A;  2EWN A;  3A5Z B;  3PIP A;  2WSE E;  4F7U A;  1UGQ B;  3JSC A;  3NTK A;  4RKU E;  3OYA A;  2QQB A;  1B34 A;  4N4I A;  2KVQ G;  3L2W A;  2MWP A;  2KAF A;  2GFU A;  3QYH B;  1JRI A;  4M78 B;  3UDC A;  3TCJ A;  2DJZ A;  3UPU A;  3QJ6 A;  4ZTJ A;  2RD1 A;  3E9G A;  5HK0 A;  2KMT A;  1VQL T;  3JB9 G;  1Q86 C;  5EG2 A;  1G3T A;  3X28 B;  2RHY A;  3MEA A;  4IUR A;  1QVF A;  2ZZD A;  2FYK A;  4JRQ A;  1YJ9 A;  4FL6 A;  4FT2 A;  1OI1 A;  1VQK T;  1BI3 A;  3JCM P;  3JCM b;  4KUI A;  5HK3 A;  1YIJ T;  3TEE A;  1Y07 A;  2MWO A;  3QKJ A;  1U1T A;  2D9T A;  3DLM A;  5CKB A;  5C6S A;  4HT8 A;  3QDR B;  4NS5 A;  4EDU A;  2EJF A;  2Y90 A;  3OBY A;  4IKF A;  2E6N A;  2LNV A;  3QZ5 B;  5CKH A;  1K8A U;  2OTL T;  4M7A E;  3CCJ A;  2P0P A;  3M59 A;  4XK8 E;  5CKF A;  3ASK A;  2K5F A;  3BFM A;  1V29 B;  3L1A A;  5CO7 A;  5A0L A;  3CCJ T;  3G71 T;  5GAN j;  1VIF A;  3OYD A;  2DIG A;  4JRK A;  4M78 A;  5CQY A;  3H6Z A;  3X20 B;  5FU6 C;  2DTI A;  4JUV A;  1X75 C;  4MDW A;  1K73 C;  2BKD N;  4J8O A;  4ZN3 A;  2ZPF B;  3MP8 A;  3OYI A;  4D6W A;  3CD6 A;  3M58 A;  3HP9 A;  1KD1 U;  4BE1 A;  2DPP B;  2EKO A;  1KQS S;  3I56 A;  3CD6 T;  4EMK B;  2E5Q A;  3MET A;  3CCV T;  1VQN T;  1VQO T;  1YIT T;  4XAX B;  4V2S A;  2KSS A;  2E1H A;  2ZCF B;  4BI4 A;  2RHX A;  4ZGE B;  1QVG S;  3A8L B;  2EJG A;  3MP6 A;  1KQ2 A;  4LDW A;  3VYG A;  1UGR B;  4BD3 A;  4J6X A;  1KQS A;  1M8V A;  2E41 A;  3RUX A;  3QXE B;  5LJ3 e;  2OAU A;  5D6Y A;  2JTF A;  2P4T A;  4TVR A;  3JCM h;  1JB0 E;  5CIU A;  1VQ5 T;  2F5T X;  4KT0 E;  4C8Q E;  1NJI C;  1QVG A;  2R58 A;  4C92 E;  5GAM g;  4IUT A;  3CPF A;  2EYQ A;  5GMK i;  2YRV A;  3DB4 A;  3OYE A;  1YJW A;  2PUO B;  3MEW A;  2GQV A;  4MZM A;  5GAO p;  1YJW T;  3JRZ A;  1MGQ A;  2XG8 D;  3FDR A;  3JAM E;  1Y7X A;  2KK4 A;  3OS2 A;  4J6W A;  4F7U F;  3J80 E;  3CME A;  1WJS A;  3C94 A;  5LJ5 h;  4E7I A;  1TH7 A;  1U1S A;  4J7F A;  3OYN A;  2GFA A;  1YBY A;  3OA6 A;  3HHT B;  3FEO A;  2L5Q A;  3GNG A;  3C95 A;  5GAM f;  1K73 U;  4A4G A;  5LJ3 j;  1FXX A;  3NFC A;  1XOV A;  3G7Z A;  4MZT A;  5IT9 E;  4EMK A;  2XD0 A;  4M7A G;  2XU8 A;  2YLB A;  3CEY A;  1I81 A;  3QBY A;  1KHC A;  4ZGD B;  3LW5 E;  4MMK A;  5I2S A;  3L2Q A;  1N9R A;  3JB9 D;  4Y28 E;  2EQM A;  1RL2 A;  1WQW A;  2M16 A;  2QA4 T;  2QQS A;  3X26 B;  3CCM A;  4KUD K;  1N9S A;  5FU7 C;  2XIC A;  3OSV A;  5HY6 A;  2CYZ B;  3LX7 A;  3CCE T;  5GAO l;  3UT1 A;  3LYI A;  4RG2 A;  3X24 B;  4OB0 B;  3CCR A;  4OVA A;  3G4S A;  2LVM A;  3Q1J A;  4M75 E;  2KQW A;  2R5M A;  2EIF A;  3BDL A;  4QQ6 A;  4XQ3 A;  1Y71 A;  4EMG A;  1BIA A;  3L42 A;  2DTH A;  5GAO m;  3G6E T;  3DLL A;  2RO0 A;  5GMK e;  4QW2 A;  4M78 F;  4B9X A;  2JTM A;  1DJ7 B;  1VQ7 T;  2ZPE B;  5KE2 A;  5FU6 B;  1VQ6 T;  4M7A C;  4KUL A;  3WXM B;  2RI2 A;  4C5I A;  1IRE B;  4X34 A;  4XTV A;  1BKB A;  4E7L A;  3SFM A;  5CR2 A;  4O6J A;  2RJE A;  2DXC A;  3LWI A;  1W2B S;  1YJN A;  1JJ2 S;  2VGN A;  3RES A;  3H8Z A;  3JCM c;  2RM4 A;  4JLI A;  4O5V A;  4C0Z A;  1VQ4 A;  5GAO n;  4Y91 A;  1K8A C;  4QVC A;  1KC8 C;  3AHU A;  1W2B A;  3VUZ A;  3P8H A;  2DXB A;  2DAQ A;  2RHI A;  5GMK j;  1JJ2 A;  3EFS A;  4M7D C;  4M7D D;  4YTL A;  5GAN h;  4PJO E;  4Z02 A;  3EAE A;  5GAM d;  1NZ9 A;  2CZ1 B;  4PL6 A;  1N8R U;  1ZHI A;  5C0M A;  1NPR A;  3QJY A;  3S3N A;  2JZ2 A;  1VQL A;  3OBW A;  4KBM B;  3SD4 A;  3KXT A;  3HKS A;  1BYM A;  2F69 A;  4J6Y A;  2CZ7 B;  2A7Y A;  3JCM g;  1KD1 C;  5KCO A;  1UGP B;  1O75 A;  2MI6 A;  3OYF A;  4ATO A;  2ZPG B;  1PSE A;  2LCC A;  4L5G A;  3JB9 H;  1VQK A;  4EPC A;  4IUQ A;  3OYB A;  4MML A;  4A4K A;  5GAN e;  3PFS A;  2WAC A;  1Q82 U;  1EIF A;  4L6V 5;  2RB6 A;  1KG1 A;  4A4F A;  2LX9 A;  4M75 G;  4A4E A;  3QG1 A;  5GAN 6;  3MEU A;  4DOV A;  3RMQ A;  5GAN 7;  5DLO A;  1UGS B;  5LJ5 g;  1G5V A;  3JCM f;  3GOX A;  2RJC A;  2C06 A;  2D6F A;  4E7J A;  1P92 A;  3URG A;  3KUF A;  3RKX A;  1M4Z A;  2BIV A;  4PNO A;  3ZFJ A;  3V7S A;  3M54 A;  4R55 A;  1VQ8 T;  3RMS A;  2RI5 A;  2OTL A;  4M7A D;  5D6X A;  1H3Z A;  2K3X A;  3S6W A;  3FC3 A;  4BUG A;  2DEQ A;  2VXE A;  2M9U A;  5A0G A;  1VQN A;  1QP3 A;  1Y96 B;  3G71 A;  1KC8 U;  4HT9 A;  4ZN1 A;  5FU7 B;  3M5A A;  4XTY A;  2F5K A;  5LJ5 f;  4MZP A;  4JJN K;  3BDU A;  4RCB A;  3OMC A;  2GF7 A;  5LJ3 h;  3TRE A;  2EAY A;  3FB9 A;  1OZ3 A;  4M77 G;  5GMK l;  2DD5 A;  3OYC A;  4M7D F;  3CMA T;  4BE2 A;  4XU2 A;  3O8V A;  3QPH A;  3VV0 A;  3CCV A;  4PJO G;  4DQ2 A;  3OW2 S;  3A8H B;  1VQO A;  1VQP A;  2DZ9 A;  4XU3 A;  1WQ7 A;  1YIT A;  3CC2 T;  3CPW S;  3QII A;  3A8G B;  1IZ6 A;  2BUD A;  2K4Y A;  4M75 C;  2DXT A;  4NOY A;  5DLQ E;  5GMK m;  4JLG A;  4M7A B;  2EQK A;  1MHN A;  1BIB A;  2QQ9 A;  3QZ9 B;  2FL7 A;  2QXF A;  2E64 A;  3HSB A;  1VQ5 A;  3OYH A;  2LC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...