1D3BB

Crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
b'SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 81
sequence length 81
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 1998-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1d3bB00
3JCMV 3PGGA 4M75D 2FYKA 5LJ5j 5LJ3h 4EMKB 4M7AB 4F7UG 5I21A 1Y96B 4PJOE 3SWNA 4NL3A 4X9CA 4EMKC 1MGQA 5GAN7 4M7AC 5LJ5h 2E41A 3QUIA 5GAOm 4C92F 1I4K1 4X9DA 4M7AD 4EMHA 3JB9D 4XTUA 4N0AC 1N9RA 4F7UF 1LJOA 3HSBA 5GMKm 3JB9H 5CAIA 1X01A 4M75A 3RESA 4M7DG 3QO3A 5GAMh 3JCMe 5GAMd 2VXFA 5GAMg 4M75G 4M77G 4Y91A 3V7RA 2DZCA 1KQ1A 4XTVA 2E65A 4M7DB 4JRIA 2RD1A 4XU3A 1Y96A 2I2LA 4M78F 1U1SA 2EJGA 4OP0A 4XTZA 4M77B 4MMKA 2FB7A 3V8KA 3JCMQ 4M7DC 1I8FA 4N0AA 5GMKj 4M7DD 2ZGWA 4M77C 5GMKe 4M77D 2DJZA 5GANf 1M8VA 2E1HA 5LJ3d 1H641 5LJ3g 3VU3C 4C92E 4DQ2A 5GAOr 4M7AF 3BFMA 3JB9F 4C8QA 1I5LA 3JCMJ 4XTXA 3RUXA 5LJ5d 3EFRA 2DXTA 5LJ5g 3M4GA 1M5Q1 1LNXA 4C8QG 4M7DA 3JB9G 2VXEA 2JN0A 2Y90A 4M77A 3JB9J 2DVEA 5GAN8 2DXUA 4C8QB 1HK9A 5GAN2 2YLBA 4PJOA 3BDUA 4XU1A 4M78E 4C8QC 3RIRA 4XU0A 3JCMh 4NOYA 5DY9A 4QVDA 2RB6A 1TH7A 4PJOG 4C8QD 3JCMd 3AHUA 1B34A 3RKXA 4M7DF 3INZA 3BW1A 1N9SA 1WPYA 1BIAA 5GAOp 4EMGA 2RA2A 4M75F 4M77F 1HXDA 4PJOB 4XU2A 4XTYA 5GAMf 1JBMA 3JCMb 4V2SA 4M7AE 4HT9A 2QTXA 4PJOC 3EFSA 5GMKh 3FJPA 3QSUA 1B34B 4PJOD 2E64A 1I81A 5GAN5 3JCMP 5GANj 4F7UE 3V7SA 1WNLA 2DTIA 2HNIA 5GANe 3FIFA 1KQ2A 4XQ3A 4M78D 3RKYA 4WF2A 2YHTA 5GAOl 3SB2A 2DTOA 4RCBA 2DTHA 3V8JA 5LJ3f 4PNOA 5GMKl 2EJFA 3FB9A 4J6YA 4RCCA 4HA8A 3JB9I 4C8QF 4A54A 4M7DE 5LJ5f 5LJ3e 1WQWA 3JCMg 4M75E 4M77E 3RKWA 4C92G 2DZ9A 4J5YA 5LJ5e 3JCMX 5GAOn 1YCYA 4C92B 1U1TA 4J6XA 3JCMc 3HFNA 3V7CA 2RM4A 4PJOF 1D3BB 4F7UB 5GAN3 3JCMW 2CGHA 2EJ9A 4C92C 4XTWA 3HFOA 3JCMf 1WQ7A 4M78A 4C92D 1BIBA 5GAMj 4QVCA 3GIBA 5GAMe 4MMLA 3V8LA 3SWNB 2EAYA 4M78G 5GMKi 2YLCA 5GAN4 2K57A 2EWNA 3SWNC 3BY7A 5GAN6 4NL2A 5GANh 1LOJA 3QHSA 1JRIA 4JLIA 5GANg 3L2ZA 5GANd 3L1AA 2DKGA 4M78B 4C8QE 4EMKA 4J6WA 4M7AA 4JUVA 2E10A 4M78C 4HT8A 4M75B 5GAOq 4A53A 4C92A 5LJ3j 4JRKA 3RERA 4M7AG 2DEQA 2VC8A 1D3BA 4F7UA 4M75C
chains in the Genus database with same CATH superfamily
3G1JA 3A98A 3I55Q 4IIMA 5KYYA 1Q86C 1XQHA 1PSEA 3I9QA 4X9DA 1I0CA 1VQPA 1NLOC 2QA4A 1NJIC 1X43A 1PWTA 5GAMg 2K2VA 4M75G 4JRIA 3OMCA 4IIOA 3FRNA 1Q81U 1WDXA 1VQ5A 1H3HA 5GANf 3MO8A 1UFFA 2GQVA 4FYVB 2DBMA 1I5LA 1SG5A 4F16A 4NS5A 1OI1A 3OSSC 2HL5C 2E6ZA 4OB1B 2IVWA 1TSFA 3OYFA 4FIBA 3CCST 2M1HA 4KGVB 5IHKA 3CCLT 2JW4A 4IURA 2CH4A 3M9QA 1HXDA 2VV5A 4XU2A 2P4TA 3LGFA 2NUPA 3QJ6A 2VVKA 3EH2A 3M56A 3CCEA 4LXCA 4ESRA 3FDRA 1ZBJA 4MDWA 4C0DC 3V7SA 1VQ5Q 2OTLT 2ROLA 3RKYA 5GJVB 3CCUA 2DTOA 4J6YA 3U23A 2RPNA 1EIFA 2XU8A 3M58A 3JRZA 3CC4T 1TUCA 5FWBA 4M77E 2XDDA 1V29B 5FLXE 3KUFA 2LJ1A 2JM8A 3VYGA 2RJEA 1MMGA 3HFOA 4J9GA 2GNCA 4OMFB 2JM9A 2XHCA 4OMQA 3NMZC 5KYYB 3SWNC 2D6FA 3BY7A 5GAN6 3CCEQ 1LOJA 1WHHA 1YHQT 4N4GA 1YJWT 2L5QA 3G4SQ 1OV3A 1UE9A 5GAOq 1QVFP 3CCUQ 5GAOp 2X3XD 3H9NA 3LX7A 3SWNA 4IUPA 4M7AC 1AWXA 2ED0A 3CD6A 4IUQA 1YN8A 2YUNA 3M0TA 4EMHA 1WYXA 2E3IA 3RR6A 4WCIA 1FMKA 4OGCA 1RAEB 3VS7A 1VQ7Q 1GL5A 1JXMA 2CS7A 1RLQC 2FZKB 1PKTA 1I8FA 1T3LA 2RN8A 3A1PA 4C5GA 1VQ4T 2M02A 3VU3C 1KC8C 1YJNA 1NEBA 3X28B 2K3BA 1BKBA 3G6ET 2KSSA 1SRMA 4C0GA 4KUIA 1Q7YU 2Y90A 1M90R 2K6DA 3ZL7C 3VS3A 1W1FA 4PJOA 2FL7A 2LJ0A 2DL7A 1I5OB 2VUBA 3H0IA 1IRXA 4C0DB 4KGZB 3OYGA 2WSFE 2CP7A 2DTIA 2COWA 1ARKA 2L3PA 2XMFA 4FYYB 2RI5A 2GGRA 2CUBA 4RCCA 1WIEA 3VRYA 4QQDA 1QVGS 4A4EA 1UHCA 4IUTA 1KD1R 2EGEA 1DJ7B 3UDCA 3PMTA 2RMOA 1Q82R 4DEXA 1YCSB 5FWCA 2CP6A 2PVOB 4MMLA 3SWNB 2DL3A 9ATCB 2X4WA 4J9BA 3ULRB 2M0OA 2EFIA 2MIOA 3CCSQ 1VOMA 1Q86U 3OBWA 4P5NA 3FJ5A 5FROA 1VIEA 3CCLQ 3CCVT 1CKBA 2L2PA 1VQNA 2GTJA 2LQWA 3M54A 1Y71A 1NJIU 1RACB 1BI1A 2O4XB 2YRCA 2E5QA 1JXOA 4M75D 1YNZA 4M7AB 2QYZA 1UGRB 3PT9A 5GAOm 2OTLQ 2YDLA 1LJOA 3REAB 5FRMA 1IO6A 2DYIA 4B9WA 4M7DG 3HTRA 3C95A 3CC4Q 2E65A 4J7IA 2DA9A 4HCCA 1PG5B 2HAXA 3R6OA 4BI3A 2LQ8A 3N5BB 1GFDA 3L2RA 2I0NA 2DL8A 3CC2T 1YHQQ 1X69A 5ECAA 2PQWA 5D6WA 2JOYA 2MCNA 3JCMh 4OMLA 4JJNK 4C8QD 2LC4A 3META 1TUGB 3L2QA 2EYWA 2L3RA 3ER0A 2QQRA 5GMKh 1WJSA 4E7IA 2JMAA 1IHWA 2EYQA 1OX8A 5FW9A 1SPKA 2XD0A 1TWBA 3SHWA 1FX7A 2ZPBB 5GAOl 2BE7D 4AFZC 2H3EB 5KYNA 4PJLA 3OA6A 1G3YA 3CCJT 1JEGA 3HL8A 2DYBA 5IHNA 1W6XA 3A8OB 2FG0A 2F2XA 2O31A 3G6EQ 2AZVA 5CR2A 2DERA 4C92D 2VGNA 3TSWA 4CC7A 1NLPC 4FW1A 2DL5A 2V8JA 3OYBA 4K11A 2RHZA 2LRQA 4AFSC 2DKGA 4EMKA 1G8XA 4QQ6A 4M78C 3GOXA 1D3BA 1AVZC 1QKWA 4VUBA 1QW1A 1U5SA 3E1SA 1ZSGA 4JRPA 3CCVA 1J3TA 3PNWC 2QG9B 4F7UF 1D09B 4R56A 1VQ9T 4XK8E 1VQLA 3RBBB 4RTYA 1KC8U 3G71T 3AT1B 1VQOT 4Z88A 5C6SA 2K7AA 3OYEA 1ABOA 4CC2A 3EHQA 3LWHA 2EQMA 1M3AA 1QVGP 2XI9A 1RAAB 1AZGB 2YUOA 2CP2A 4XTXA 3P8DA 4ZTFA 2PTKA 1Q81R 3LGLA 2F2VA 3NFCA 5CCAA 3CCVQ 4BE1A 1QVPA 4JJDA 1BI0A 1A0NB 3MEUA 3EFOA 1MMAA 1WXTA 4PJOG 2DXCA 4FCYA 2ZPHB 1BI3A 4UC4A 2HEQA 2KY9A 4XTYA 5GAMf 2HL3A 2QDLA 2ZPIB 3I5RA 1UGQB 2D9TA 3I56A 2YXYA 2MOXA 4KUDK 3X20B 1HSQA 1XJWB 1WX6A 3X26B 5KE2A 3PIOA 5HY6A 3TVTA 4C0ZA 2JXBA 2ZZDA 1WHMA 1KHCA 3H0HA 3S3NA 1RADB 2DZ9A 1M1KC 4OB3B 1KQSA 1OU8A 5GAOn 4E7JA 2HKQB 1D3BB 2DPPB 2EJ9A 4XTWA 1ACMB 1FWZA 1BIBA 3CC2Q 3GNFB 3GF5A 3V8LA 4FSSA 1YP5A 2FPFA 2WACA 4ZGJB 1KD1U 2RQRA 3HP9A 2LCSA 1VQ8T 2YWWA 4M78B 1RL2A 4Y28E 1NPPA 1AHJB 2RH2A 2E12A 3JCMb 2OTJT 2GCXA 4GY5A 5I21A 1G3WA 4FU6A 3OB9A 1U3OA 1Y57A 5IAYA 1EZZB 1MGQA 5LJ5h 1MNDA 4OMNA 1N9RA 4JJBA 1E7OA 4PJJA 4ZGDB 3CCRT 1WZOA 1KHIA 1K4US 1WLPB 2VXFA 1RAGB 2JTMA 5C0MA 4DA4A 1RAIB 1Y96A 3OS0A 3X25B 1VQMT 1QWFA 3OYJA 2G3RA 4L5GA 2NLUA 4ZTJA 2DJZA 1YIJA 1H641 3RNJA 5CIUA 4D6WA 2KROA 1XTDA 1BCOA 2XDPA 1LNXA 3PMIA 4RTVA 3JB9J 1ZSZC 2DVEA 1IGUA 2KDSA 2O01E 2PNIA 5L8RE 4DOWA 1Q7YR 2RA2A 2GQIA 2DXBA 3CBOA 3M57A 4HT9A 1ZSZA 4DBQA 2EKOA 2E64A 4E2FB 1VQ9Q 2A08A 2BKDN 4QKUA 3LWIA 1H8KA 3G71Q 1M3CA 1VQOQ 3V8JA 3A8GB 3FEOA 3JB9I 4C8QF 2KT8A 3E19A 3S3MA 2CSQA 2W10A 3CPWA 3CCQA 1O75A 4QW2A 5IT9E 5CKFA 4ATOA 3NHNA 4J6XA 1W4SA 3O5ZA 1K8AC 2LP5A 4A63B 2BIVA 2RJDA 4QVCA 3TSZA 3PVQA 4D8KA 2PZ1A 2EAYA 1D1AA 1JRIA 2IG0A 1F1BB 1KK7A 2ATCB 4RTXA 1PCXA 3UT1A 2DEQA 2VC8A 3I55A 2EIFA 2C06A 5LJ5j 2A28A 1Y96B 1Q86R 4NL3A 1VYTA 3I35A 2F2WA 1AEYA 2OI3A 5I2MA 4M7AD 4C92F 3I5SA 3JB9D 4XTUA 2A7YA 1NJIR 1H3ZA 2G6FX 1X75C 3RESA 4M77G 3A8LB 2DZCA 4LDWA 5GJWB 4XU3A 5KH6A 1R0BG 4M7DC 5D6XA 4BY6C 2V8IA 3R6NA 1OX9A 1X6BA 5IXBA 1YI2T 2XKOC 1NYGA 5LJ3g 5DLQE 3EGXB 2RNAA 2VASA 3BE3A 2WSEE 1TUDA 3P8HA 5LJ5d 2NUZA 4M7DA 3JV3A 1ZSZB 1VQ8Q 1QCFA 2ZAEA 2C0OA 1HK9A 1TG0A 3ZEHA 1D0ZA 1AOJA 3E2UA 4FT2A 4KT0E 2OTJQ 1OZ2A 4NOYA 2GFAA 4LD6A 3ZBDA 4J9FA 1QLYA 4J9CA 1NEGA 1E6GA 2HZYA 3VS6A 3LW5E 3CCRQ 5GANj 2A0FB 1WNLA 2C0TA 4FW2A 5GANe 2HBWA 1GBQA 1M1KU 2DETA 2O88A 3KFVA 4PNOA 3H6ZA 1K9AA 1KQSS 2O2OA 1VQMQ 4A54A 3ZFJA 4PFZA 4BACA 2H3JA 1Y07A 1KG1A 4E7ZA 2QGFB 3JCMc 2KT1A 1IB8A 1BYMA 1WQ7A 3L2UA 3G4SA 1ZA1B 1SEMA 4O5VA 5GANd 4N4HA 2QTVA 4JUVA 1UECA 2OJ2A 3TCJA 1HJDA 2CZ0B 1T0HA 3CMET 2K3YA 4RCBA 4LUEA 2JS0A 1S72T 2EQKA 4II1A 3M0RA 2XK0A 4KGXB 4EPCA 3OYHA 1K9MC 3QUIA 2MWPA 1VQ7A 2YUPA 2KYMA 4HVVA 4LN2A 3H8ZA 2BZYA 1P92A 1K1ZA 2COZA 2JT4A 1QP2A 4Y91A 3GP8A 3H41A 4M7DB 4BY6B 3MKDA 2HD0A 2RK2A 5AT1B 1YJ9T 2KEAA 3E9FA 2KRMA 2VB6A 1KC8R 5AYFA 2RO0A 4KH0B 3J81E 2RHYA 3JSCA 2EVRA 2D0QB 5CKHA 1ZA2B 1SSFA 3EG2A 2J05A 4JZ4A 4JS4A 3VUBA 4PJOC 3QSUA 3FJPA 2L3QA 2ED1A 2RK1A 2HNIA 1W2BA 1U8RA 2NUPB 1X2KA 3CPWS 3NTHA 2K9GA 1KJWA 2L0AA 1WI7A 1K8AU 1RI9A 2P0PA 2KI7A 4FSXA 4JJCA 5CK9A 1ZUKA 2RQTA 3TQ7P 2Z0WA 1UB4A 1N8RC 1NBEB 3HFNA 3QIIA 3QKJA 5GAN3 5CKDA 3D7SB 2MYSA 3CCSA 4A4FA 2QEXT 4C5IA 3CCLA 2NUTA 1IHVA 4BE0A 2M51A 2QQ9A 2E5KA 1Y0MA 3EG3A 2C0IA 3M0PA 4C8QE 4A53A 4M78D 3VS2A 4RMOA 1WJQA 2OTLA 2LNHB 3MEWA 1SSHA 1LPLA 1TXQA 3CC4A 5GMKm 2DEUA 1S72A 2JMCA 2DAQA 2DIGA 5CVIA 1PSFA 2NYSA 5FRNA 1U1SA 3V8KA 1M4ZA 1KQSP 1M9SA 5J39A 1WA7A 3G7ZA 4FYXB 2BZ8A 1X6GA 4C92E 1YHQA 1VIFA 4M7AF 1YJWA 3JB9F 3DKMA 3JCMJ 3EFRA 4XAXB 4DEYA 3RMQA 2V8KA 3TEEA 2DXUA 4ELZC 2RQUA 3CMEQ 3OYMA 2DIQA 5DY9A 4QVDA 1S72Q 3INZA 1BIAA 4RUGA 4PJOB 3VS0A 2EGAA 2AZSA 4RTUA 2KVQG 2OX7A 3JCMP 1Y7XA 3LH5A 1YWPA 5KYXA 4XQ3A 4WF2A 1D1BA 1R8OB 1YJWQ 1X2QA 5GMKl 1ZLMA 2EJFA 2DL4A 1VQ4A 1WXBA 5A0GA 1YJ9Q 4BD3A 3MEAA 3L2WA 3G6EA 1LCKA 2RI2A 5A2QE 2CT3A 3HRUA 8ATCB 1PRMC 3C94A 2MPXC 2MK5A 1AWWA 1D0XA 1K9MU 2R5MA 3LLRA 1M8MA 2D8HA 2FRYA 2VWFA 1VQ4Q 1G83A 2K3XA 3EH1A 4AT1B 1XNIA 4JLGA 4EMKC 1QP3A 3M0SA 1UG1A 2CREA 4RKUE 4WTOB 1NPRA 1QWEA 3S3OA 4RTTA 3M53A 3ASKA 2ESWA 1H92A 5HCKA 2ABLA 2DBKA 2LQKA 2I2LA 4AFQC 4LNPA 1AT1B 4C0FA 1TTHB 2ZPGB 4M77C 1QVFA 4HVWA 1O9SA 1M1GA 2LCCA 4J7FA 2QEXQ 2KYBA 4PLLA 2EBPA 1EX4A 3OYLA 3CCMT 1K73C 1PD1A 2JN0A 2RJFA 1GFCA 4M77A 4PK4A 4LDYA 5KYXB 1B34A 4DBHA 1W2BS 2D0NA 4ZN3A 2F69A 2DFUA 3O8VA 2HQXA 1KQ2A 2LZ6B 1N8RU 2YHTA 2JTFA 3PTAA 2M0YA 2DVJA 2DX1A 5LJ3f 2EQUA 4OGEA 4OB2B 2FZCB 5L23A 2K2MA 1M27C 5LJ3e 2P84A 2LNVA 2KRSA 1M1KR 4HVUA 1X27A 3CC2A 3HRTA 5D6YA 2RM4A 2RHUA 1S1NA 3JCMf 5GAMj 5GAMe 2KXCA 1UUEA 1JB0E 3QHSA 1YITT 2AHJB 3L2VA 2B8AA 2EYYA 2E10A 5KCHA 1YBYA 3RERA 3FC3A 1K0SA 4EMKB 1B07A 1Q95G 1VQ6T 2EKHA 3VRZA 1R77A 2A3LA 3CCJA 4R0KA 5KYUA 2FEIA 3CQTA 2CP0A 2COYA 2KXDA 5GAMd 3MEVA 1WFWA 3L42A 1G3SA 1GCQA 2RD1A 2ZPEB 3OYKA 4M78F 1NE8A 4M77B 1ZQ1A 4M7DD 1CSKA 5J26A 1OYXA 1NG2A 4JPBW 4C8QA 4Y92A 5IXFA 4ZNXA 2PU9B 1MNEA 3J7AF 1BCMA 1PNJA 2DRMA 2EW3A 1XOVA 3CCJQ 4XU0A 1K76A 1FMVA 2JTEA 4OMOA 4EMGA 1VQ9A 4M75F 2O9SA 1FXXA 3EFOB 3QZ5B 4A4GA 4L59A 4M7AE 3QPHA 3EFSA 3G71A 3OQ5A 3EHRA 3QWYA 4B6MA 1VQOA 1VQKT 2JVVA 1BB9A 3SB2A 1PKSA 3NGPA 5D7UA 3VS1A 1PC0A 4HA8A 1VQPT 2MI6A 1WQWA 1HD3A 2QA4T 4M4ZA 4CC3A 3CC7T 1K8AR 2J6FA 3UPUA 2CGHA 5IH2A 2B86A 3CCMQ 5GANh 3REBB 4R55A 3PE0A 5KYUB 4OP0A 1GCPA 3NTKA 2HSEB 3JCMV 3PGGA 2K5FA 1QMCA 1QKXA 2CZ1B 4AG1C 2K5LA 1YITA 4IUUA 3OYNA 1W2BP 2A37A 1JQQA 3HKSA 3PVLA 3HSBA 1ZX6A 4Z8AA 1RAFB 2ZPFB 3MPUB 4PL6A 1QVFS 1IGQA 2FZGB 2J6KA 2ZCFB 1C1AA 2EJGA 1M1FA 4ANJA 2FB7A 2KBTA 2DNUA 2ZGWA 2F5KA 3CCUT 5CO7A 3DB3A 2DMOA 1WHGA 1VQ8A 3QWXX 2L89A 4ZGEB 4KRTA 1AWOA 2MAMA 2Y4YA 3M55A 3OS2A 2OTJA 1YITQ 1N27A 2P0KA 2KRNA 2O9VA 3DLMA 1UJYA 1AD5A 2FVUA 1JJ2A 4MDXA 1N5ZA 2FO0A 5KYWA 4C5EA 1MUZA 2RF0A 1KSWA 4HKEA 3CCRA 1VQ6Q 4D8DA 4V2SA 1C6VX 1T3SA 1WHKA 4PJOD 2RQWA 4F7UE 1FMWA 1VQMA 1M2OA 8AT1B 3CD6T 5FU7C 3OS5A 1VYVA 2LDMA 3JCMg 3RKWA 4PLIA 2HCKA 5EC7A 4EDUA 1RLPC 1IREB 3V7CA 3THKA 1FYNA 3E9GA 3M0UA 2YSQA 4KH1B 1GXIE 3MHXA 3NTIA 2F5TX 3CC7A 5GMKi 3GNGA 1NYFA 1W70A 2P0QA 4FYWB 3QZ9B 3L1AA 3MCAB 2LJ3A 1YJNT 2GFUA 3P8BB 4HT8A 2K79A 1ZUUA 2QQSA 3Q1JA 3GLXA 3QYHB 1K9MR 5GAN7 3X24B 5CQXA 1VQKQ 4FM4B 1U06A 3VV0A 3KXTA 1SF9A 2L8DA 3PFSA 2AT1B 2PVDB 4JZ3A 1VQPQ 4B9XA 1GBRA 1KQ1A 4OB0B 2QA4Q 3CC7Q 4N4IA 4MMKA 4XTZA 3SDZA 2YRDA 3ME9A 2X3WD 5LL6S 2MWOA 5KYWB 2F1LA 1PD0A 2AKLA 1X6OA 3UA7A 4IKFA 3OYCA 3UATA 4C8QG 1MMDA 3CXCA 3EGUA 2R58A 1SHGA 5FU6B 2JUFA 5GAN2 2HQEA 2FRWA 4XU1A 1UJ0A 4M78E 1UDLA 4PJMA 2CP5A 1TH7A 2HKNA 4M7DF 1N9SA 1RABB 3JAME 2CT4A 3MP8A 1N6AA 4JRQA 3OYIA 2QTXA 1VQNT 2IPOB 4E7KA 1D0YA 1OQKA 1I81A 5GAN5 3NPFA 4F14A 2ENMA 2HDAA 3IQLA 2X51A 4LDXA 1YI2A 4KBMB 4KULA 2LTOA 5FU7B 2EPDA 4HCBA 4M75E 4C92G 1VA7A 3HPWA 1N8RR 5CKBA 3EG0A 2IIMA 1Z9QA 2D1XA 4GLKA 3JCMW 3CEYA 3GIBA 2M9UA 2YLCA 5I2SA 3QDRB 2O4XA 4ZN1A 4QT7A 2PUKB 3MJXA 5IHIA 3RMSA 4J6WA 4M7AA 2XG8D 1B7TA 2HQHA 4QVZA 2SEMA 2K4YA 4BB7A 1G3TA 3CBPA 2EYZA 1YI2Q 3MP6A 2J6OA 4LE9A 1C0MA 4GLMA 2E41A 1UEBA 2KAFA 2AK5A 5HKCA 3OMGA 3C12A 4J9DA 3JB9H 2PVGB 2LVMA 3CD6Q 5HK3A 2J7IA 4YTLA 1TU0B 5DLOA 2BZXA 1B3QA 1NM7A 4A4KA 2XIDA 4EIKA 2WSCE 2QQAA 4M77D 1PHTA 1NZ9A 3KBGA 5IN1A 4DQ2A 3RDVA 3BFMA 1SRLA 5LJ5g 2DXTA 2RHIA 3VS4A 1JJ2S 4J9HA 2FHDA 3CMEA 3EGDA 6AT1B 3H0FA 2HMAA 1OPLA 2KMTA 1YJNQ 5GAN8 1BBZA 1ZUYA 1M90C 3DB4A 3CMAT 3RIRA 3M5AA 4BDYA 3AHUA 2RB6A 4JS5A 3A8MB 1BU1A 3OW2A 4FT4A 3VJPA 2DE0X 2GF7A 4ELYC 3FLGA 2QXFA 2CUDA 2E3HA 1V76A 4E7SA 1YJ9A 2R5AA 1I07A 3VS5A 2DTHA 2PUOB 3HRSA 1IXDA 3FB9A 3S6WA 1WJRA 2BE9B 1V1CA 2E6NA 3OBYA 1VQLT 3SD4A 2CKKA 5HK0A 1KD1C 1K0XA 1JU5C 4PJOF 4FL6A 4BE2A 2J06A 2DJQA 3CPFA 2QAZA 1Q82C 2RHXA 1Z9ZA 4NL2A 3EG1A 5GANg 3L2ZA 2KE9A 1D1CA 2EYXA 2NUTB 4J83A 4JRKA 1TS9A 4F7UA 5CKEA 2LCLA 4AG2C 5A0DA 4LD9K 2D8JA 4L6V5 5LJ3h 1VQNQ 3M4YA 4RTZA 4X9CA 4DOVA 4C5HA 4N0AC 3URGA 1X01A 2X4XA 3SEMA 5GAMh 4AFUC 2X4JA 2QI2A 4LDVA 3EGDB 4AMCA 3WVEB 2BTTA 3EG9A 2P4RA 3I56T 2YUQA 3C4SA 4N0AA 4F04B 2QEXA 3CXCS 4X1VA 4J9IA 2E1HA 5GAOr 2AKKA 4MZPA 3A5ZB 2AIRB 2CP3A 1K73R 2VXEA 2ECZA 1IZ6A 1WHLA 2RJCA 4ORZA 3CPWP 2CH4W 2V26A 1ZHIA 3VUZA 2CZ7B 3QBYA 5CQYA 3RKXA 2KK4A 3PIPA 4HCZA 4Z02A 2E70A 2HSPA 2R57A 3CMAA 2JNGA 4Z89A 1M2VA 4OMMA 1E6HA 3OYDA 2DILA 4DBFA 4M7DE 2LX7A 4PKCC 1MHNA 2OAWA 2DRKA 2DM1A 3WXMB 5A0LA 3JCMX 2X9HA 1AWJA 4F7UB 4OF1A 2MMPA 4M78A 1JO8A 2H8HA 3WVDB 4RG8A 2CSIA 1MMNA 3VYHB 2XICA 1JJ2P 2K57A 4LUDA 3OS1A 4E47A 3CMAQ 1YIJT 1BK2A 1GRIA 3M59A 2X35A 4A4HA 2DD4A 2JJ9A 1RI0A 7AT1B 5LJ3j 3OSVA 4M7AG 4CC4B 3JB9G 4M75C 4BI8B 2CYZB 4F17A 2JS2A 3EG9B 1PRLC 3QYGB 1QQJA 2BUDA 1KIKA 1I4K1 3LYIA 2QDYB 2CZ6B 2QGGA 5CAIA 4M75A 3QO3A 3JCMe 3V7RA 1HYOA 1UTIA 2V1QA 4XTVA 3BDLA 2KQWA 1VQLQ 2FPDA 2KR3A 5GMKj 3SFMA 5GMKe 1YFNA 2L3SA 1M90U 1UGSB 5LJ3d 3M0QA 2DK3A 1GCQC 3RUXA 3CCQT 3M4GA 2VGMA 2RI3A 3OW2S 1Q81C 2SRCA 3TREA 4J9EA 2YLBA 4JDSA 4J8OA 5DM7R 4LDUA 4C8QC 1OU9A 4DBRA 3JCMd 3BW1A 1WPYA 1M2VB 4RG2A 4M77F 2EQJA 1JBMA 2GTOA 4HXJA 1VYUA 1T0JA 2KNBB 1B34B 1SHFA 1WHJA 1WXUA 2X4YA 3I55T 4E7LA 2RQVA 3FIFA 4TVRA 3OYAA 3F70A 2M16A 1OPKA 3I56Q 1QCOA 3UA6A 2DO3A 1Q82U 2LQNA 4QQGA 2VYTA 4RTWA 5I22A 3CCMA 2V1RA 2DD5A 1RAHB 1U1TA 2NWMA 4O6JA 3CXCP 1CKAA 4C92C 3HHTB 3QDFA 2YRVA 2FPEA 5GAN4 2EWNA 1TOVA 2DLPA 5I11A 2LMJA 3MP1A 4M75B 4C92A 1UGVA 1QCNA 2EGCA 2QK0A 1G2BA 3EAEA 2DF6A 3UF4A 2FYKA 4F7UG 2QQBA 3T9NA 4PJOE 1PM3A 1EFNA 4CI0C 1M3BA 1VQ5T 2W0ZA 4PFOA 1KFZA 1R0CB 3JCMQ 3EGXA 4E6RA 4GBQA 1OEBA 2MF2A 1BI2A 4CRIA 2LT4A 2EQIA 4MZMA 1M8VA 2LX9A 2HBPA 4X34A 3LH0A 1M5Q1 1YIJQ 4E7HA 2QASA 2OAUA 4BI4A 4PJNA 4C8QB 3BDUA 1VQ6A 3CCET 3G4ST 1RUWA 1OOTA 3OYYA 4OMPA 2LT1A 1K73U 3QG1A 1VUBA 4MZTA 4BDZA 5M9OA 1Q7YC 3GBQA 2XDBA 4IUVA 4PFPA 3CBMA 2JZ2A 1ZBXA 1ABQA 4OVAA 1UHFA 3TU4K 1SKUB 3GPLA 2CDTA 4HCKA 1WGSA 3J80E 2ROTA 5FU6C 1VQ7T 3A8HB 1OULA 5LJ5f 3UWNA 2GBQA 1YWOA 5EG2A 2K5IA 2Y4XA 4BUGA 1AZEA 4J5YA 5LJ5e 1OZ3A 2VKNA 2E4HA 1YCYA 4C92B 1G5VA 3CCQQ 1MV3A 1QVGA 3QJYA 2KGTA 4M78G 4ME7A 3OY9A 3C0CA 1MV0B 5KCOA 4JLIA 1I1JA 4Q5WA 1LVKA 3OW2P 2A36A 5KE3A 3DLLA 2YT6A 3VKIA 1UGPB 1M30A 1VQKA 3QXEB 5J3BA
chains in the Genus database with same CATH topology
4GY5A 5I21A 1G3WA 4FU6A 3OB9A 2K3XA 5IAYA 1XNIA 4JLGA 1MGQA 1QP3A 4EMKC 5LJ5h 1Q86C 2E41A 1XQHA 1PSEA 1UEBA 4X9DA 2KAFA 4RKUE 1VQPA 1N9RA 5HKCA 1NPRA 4ZGDB 3OMGA 3S3OA 3C12A 3JB9H 3CCRT 2QA4A 1NJIC 1KHIA 2LVMA 2PVGB 3M53A 3ASKA 5HK3A 4YTLA 2VXFA 5GAMg 2K2VA 4M75G 2JTMA 2LQKA 5C0MA 4DA4A 4JRIA 3OMCA 5DLOA 1Y96A 2I2LA 3OS0A 3X25B 1VQMT 4C0FA 3OYJA 3FRNA 2ZPGB 1Q81U 2G3RA 2XIDA 4M77C 4A4KA 1VQ5A 4L5GA 2WSCE 1QVFA 2QQAA 4M77D 2NLUA 4ZTJA 1O9SA 2DJZA 1M1GA 2LCCA 3MO8A 4J7FA 1NZ9A 5GANf 1YIJA 1H641 3KBGA 5IN1A 4DQ2A 2GQVA 4M7AG 5CIUA 3BFMA 1I5LA 4D6WA 4PLLA 4NS5A 1XTDA 2DXTA 2RHIA 5LJ5g 1JJ2S 2XDPA 1LNXA 2FHDA 3CMEA 1OI1A 3PMIA 3OYLA 3OSSC 3CCMT 1K73C 2JN0A 2KMTA 2RJFA 4M77A 3JB9J 2DVEA 5GAN8 2E6ZA 4LDYA 4OB1B 2IVWA 1M90C 3DB4A 3CMAT 2KDSA 2O01E 4FIBA 3OYFA 2M1HA 3M5AA 3RIRA 3CCST 3QXEB 4BDYA 3AHUA 2RB6A 4JS5A 1B34A 3A8MB 3CCLT 3OW2A 4IURA 5L8RE 4DOWA 1W2BS 2RA2A 3M9QA 4FT4A 3VJPA 1HXDA 2VV5A 4ZN3A 4XU2A 2DXBA 2P4TA 3LGFA 3QJ6A 3CBOA 3M57A 4HT9A 2F69A 2GF7A 3M56A 4ELYC 2EKOA 3CCEA 2E64A 3FDRA 3FLGA 4C0DC 3O8VA 2HQXA 4MDWA 3V7SA 2BKDN 2QXFA 1KQ2A 3LWIA 2OTLT 3RKYA 1N8RU 2YHTA 2JTFA 1YJ9A 2R5AA 3CCUA 3PTAA 2DTOA 3V8JA 2DTHA 2PUOB 5LJ3f 3A8GB 3HRSA 4J6YA 2EQUA 3FB9A 3FEOA 4OGEA 4OB2B 3JB9I 1EIFA 4C8QF 3E19A 2XU8A 1WJRA 3S6WA 3M58A 2E6NA 3JRZA 5LJ3e 3CC4T 3S3MA 3CPWA 2LNVA 4M77E 3CCQA 1O75A 2XDDA 3OBYA 1VQLT 4QW2A 1V29B 2CKKA 3SD4A 5FLXE 3KUFA 5IT9E 5CKFA 3CC2A 4ATOA 3VYGA 5HK0A 3HRTA 1KD1C 5D6YA 4J6XA 2RJEA 1W4SA 2RM4A 4PJOF 1K8AC 2RHUA 4FL6A 3HFOA 2BIVA 2RJDA 3JCMf 5GAMj 4OMFB 4BE2A 4QVCA 5GAMe 2XHCA 3CPFA 2EAYA 1Q82C 2RHXA 3SWNC 2D6FA 1JB0E 3BY7A 5GAN6 4NL2A 1LOJA 3QHSA 1JRIA 2AHJB 2IG0A 3L2ZA 5GANg 3L2VA 2B8AA 1YHQT 1YITT 4N4GA 1YJWT 2L5QA 2E10A 5KCHA 1YBYA 5GAOq 3UT1A 4J83A 3RERA 4JRKA 2DEQA 2VC8A 3FC3A 4F7UA 3I55A 5GAOp 5CKEA 2EIFA 2LCLA 5A0DA 2C06A 4LD9K 5LJ5j 4L6V5 5LJ3h 4EMKB 3M4YA 3LX7A 1Y96B 3SWNA 4NL3A 4X9CA 4DOVA 4IUPA 1VQ6T 4C5HA 4M7AC 3CD6A 4IUQA 5I2MA 4M7AD 4C92F 2A3LA 4EMHA 3JB9D 4XTUA 2A7YA 4N0AC 3URGA 3CCJA 1H3ZA 1X01A 1X75C 2X4XA 3RESA 5GAMh 4OGCA 2X4JA 2QI2A 5GAMd 4M77G 3A8LB 3MEVA 2DZCA 4LDVA 2CS7A 3L42A 1G3SA 2ZPEB 2RD1A 4LDWA 4XU3A 3OYKA 3WVEB 5KH6A 4M78F 1NE8A 4M77B 3I56T 1ZQ1A 5D6XA 4BY6C 2V8IA 1I8FA 3C4SA 4N0AA 4M7DD 2QEXA 1YI2T 3CXCS 5J26A 1OYXA 4M7DC 2E1HA 2XKOC 4C5GA 5DLQE 3VU3C 5LJ3g 5GAOr 1VQ4T 1KC8C 4MZPA 1YJNA 2WSEE 4C8QA 3A5ZB 3X28B 3P8HA 5LJ5d 2PU9B 1BKBA 3G6ET 2KSSA 4M7DA 4C0GA 4KUIA 2VXEA 3J7AF 1Q7YU 2Y90A 1IZ6A 2RJCA 1HK9A 3ZEHA 4PJOA 4FT2A 1XOVA 2FL7A 4KT0E 1OZ2A 4XU0A 1ZHIA 4NOYA 3VUZA 2CZ7B 3QBYA 2GFAA 5CQYA 4LD6A 3RKXA 3ZBDA 2KK4A 3PIPA 2VUBA 4EMGA 1VQ9A 4M75F 4HCZA 1FXXA 4Z02A 2E70A 3QZ5B 4A4GA 4L59A 4M7AE 2R57A 3QPHA 3CMAA 3EFSA 4C0DB 3G71A 3OQ5A 3OYGA 2JNGA 2WSFE 1VQOA 3LW5E 5GANj 1VQKT 1WNLA 2DTIA 5GANe 1M1KU 2JVVA 3SB2A 2RI5A 4PNOA 3H6ZA 3OYDA 4RCCA 1KQSS 4BE1A 4HA8A 4A54A 2MI6A 1VQPT 4M7DE 1WQWA 4PKCC 3ZFJA 4QQDA 1MHNA 2QA4T 4A4EA 4BACA 1QVGS 2H3JA 1Y07A 4IUTA 3CC7T 3WXMB 5A0LA 1KG1A 3JCMX 1DJ7B 3UDCA 3PMTA 3JCMc 3UPUA 4F7UB 4OF1A 2MMPA 2CGHA 1BYMA 1WQ7A 4M78A 3L2UA 4MMLA 2PVOB 3WVDB 3G4SA 3SWNB 4RG8A 2X4WA 2XICA 3VYHB 2K57A 3OS1A 1YIJT 2M0OA 4E47A 2EFIA 5GANh 4R55A 3M59A 4O5VA 5GANd 4N4HA 1Q86U 2X35A 3OBWA 4P5NA 4A4HA 4JUVA 3CCVT 5FROA 1VIEA 2DD4A 1VQNA 3TCJA 1RI0A 5LJ3j 2CZ0B 3M54A 1Y71A 3OSVA 4OP0A 2K3YA 3CMET 3JB9G 1BI1A 1NJIU 2O4XB 3NTKA 4M75C 2E5QA 4RCBA 2CYZB 4BI8B 3JCMV 3PGGA 2K5FA 4M75D 1S72T 2EQKA 4M7AB 2CZ1B 1YITA 2K5LA 4IUUA 4II1A 3OYNA 1UGRB 3PT9A 4EPCA 2XK0A 3QYGB 3OYHA 1K9MC 2BUDA 3HKSA 3QUIA 5GAOm 2MWPA 1I4K1 1VQ7A 3LYIA 2QDYB 1LJOA 2CZ6B 3HSBA 5FRMA 5CAIA 3H8ZA 4M75A 1P92A 4B9WA 4M7DG 3QO3A 3JCMe 2ZPFB 4PL6A 1QVFS 3C95A 1QP2A 4Y91A 3V7RA 3GP8A 4XTVA 2E65A 4M7DB 2ZCFB 3BDLA 4BY6B 2KQWA 4J7IA 2EJGA 1M1FA 2HD0A 2RK2A 2FB7A 5GMKj 4HCCA 3SFMA 1YJ9T 2ZGWA 2F5KA 3CCUT 5CO7A 3E9FA 5GMKe 3DB3A 1M90U 1UGSB 5AYFA 2HAXA 5LJ3d 2RO0A 3R6OA 2DK3A 4BI3A 1VQ8A 2LQ8A 3J81E 3N5BB 2L89A 3RUXA 4ZGEB 2RHYA 3JSCA 2MAMA 3CCQT 3L2RA 2Y4YA 3M4GA 3M55A 2VGMA 3OS2A 2RI3A 2OTJA 1N27A 3CC2T 3OW2S 2D0QB 1Q81C 5CKHA 3TREA 2PQWA 5D6WA 2P0KA 1SSFA 2YLBA 3DLMA 2JOYA 4JDSA 4J8OA 5DM7R 4LDUA 4C8QC 2FVUA 3JCMh 1JJ2A 4MDXA 4JJNK 4C8QD 3JCMd 4C5EA 2LC4A 3META 3BW1A 1WPYA 4HKEA 3L2QA 3CCRA 4RG2A 4M77F 4JS4A 2EQJA 1JBMA 2L3RA 3JCMb 4V2SA 3ER0A 3VUBA 2QQRA 4PJOC 3QSUA 5GMKh 1WJSA 3FJPA 4E7IA 1B34B 4PJOD 2RK1A 4F7UE 2EYQA 2X4YA 3I55T 2HNIA 4E7LA 3FIFA 4TVRA 1W2BA 2XD0A 1U8RA 3OYAA 1VQMA 1FX7A 3CPWS 3NTHA 2ZPBB 3F70A 5GAOl 2M16A 1K8AU 3CD6T 2P0PA 5FU7C 3OS5A 3OA6A 1G3YA 4FSXA 3CCJT 2DO3A 1Q82U 5CK9A 2LDMA 3HL8A 4QQGA 1UB4A 3JCMg 3RKWA 2VYTA 4PLIA 4EDUA 3CCMA 1N8RC 1IREB 2DD5A 3A8OB 1U1TA 3V7CA 3HFNA 4O6JA 3QIIA 3QKJA 5GAN3 4C92C 5CR2A 3E9GA 5CKDA 3CCSA 1GXIE 3HHTB 4C92D 3MHXA 3NTIA 2VGNA 4A4FA 2QEXT 2F5TX 4C5IA 3CCLA 2YRVA 2V8JA 5GMKi 3OYBA 3CC7A 3GNGA 5GAN4 4BE0A 2EWNA 2P0QA 2RHZA 3QZ9B 2QQ9A 2LRQA 3L1AA 3MCAB 2DKGA 4C8QE 1YJNT 4EMKA 2GFUA 3P8BB 3MP1A 4QQ6A 4M78C 4HT8A 4M75B 4A53A 4C92A 3GOXA 4M78D 1D3BA 2QQSA 3Q1JA 4RMOA 4VUBA 3EAEA 1WJQA 3GLXA 3QYHB 2OTLA 1QW1A 2FYKA 4F7UG 2QQBA 3E1SA 3T9NA 4PJOE 5GAN7 3X24B 5CQXA 4JRPA 3MEWA 4FM4B 3CCVA 3PNWC 3VV0A 3KXTA 4F7UF 3CC4A 4R56A 5GMKm 4CI0C 1VQ9T 2L8DA 3PFSA 1VQ5T 4XK8E 1S72A 1VQLA 2PVDB 2DAQA 1KC8U 2DIGA 5CVIA 3G71T 4B9XA 1PSFA 1VQOT 1KQ1A 4OB0B 5C6SA 5FRNA 1U1SA 3JCMQ 3V8KA 1M4ZA 4MMKA 4N4IA 4XTZA 1M9SA 5J39A 3OYEA 3SDZA 3G7ZA 2MF2A 3ME9A 1BI2A 3LWHA 2EQMA 4CRIA 2LT4A 2XI9A 5LL6S 2MWOA 4MZMA 1M8VA 2LX9A 4C92E 2HBPA 1YHQA 1VIFA 4M7AF 1YJWA 3JB9F 1X6OA 3DKMA 4X34A 4XTXA 3JCMJ 4IKFA 3OYCA 3P8DA 3EFRA 3LH0A 4ZTFA 1M5Q1 4C8QG 4E7HA 3CXCA 3LGLA 4XAXB 2R58A 3RMQA 5FU6B 2V8KA 2OAUA 3NFCA 3TEEA 5CCAA 2DXUA 2JUFA 4BI4A 4C8QB 1QVPA 4ELZC 1BI0A 5GAN2 2HQEA 3MEUA 3BDUA 4XU1A 4M78E 3OYMA 3CCET 1VQ6A 2DIQA 5DY9A 4QVDA 1TH7A 4PJOG 3G4ST 2DXCA 3OYYA 4M7DF 3INZA 1N9SA 2LT1A 1BIAA 1K73U 2ZPHB 3QG1A 1VUBA 1BI3A 4MZTA 3JAME 4UC4A 4BDZA 4PJOB 2KY9A 3MP8A 4XTYA 1N6AA 5GAMf 5M9OA 4JRQA 1Q7YC 3OYIA 2QTXA 2ZPIB 2OTJT 1VQNT 4E7KA 2XDBA 2KVQG 1UGQB 1I81A 4IUVA 3CBMA 1Y7XA 5GAN5 3JCMP 2JZ2A 1ZBXA 2D9TA 3I56A 4XQ3A 4OVAA 3TU4K 4WF2A 4LDXA 1YI2A 4KUDK 4KBMB 3X20B 3GPLA 1R8OB 4KULA 2LTOA 5FU7B 1WGSA 3X26B 2EJFA 5KE2A 5GMKl 3J80E 3PIOA 1VQ4A 5HY6A 5FU6C 1VQ7T 4HCBA 3A8HB 5LJ5f 5A0GA 4C0ZA 3UWNA 4BD3A 2ZZDA 5EG2A 3MEAA 2K5IA 4M75E 4C92G 3L2WA 2Y4XA 4BUGA 3HPWA 3G6EA 2RI2A 1KHCA 5CKBA 3S3NA 5A2QE 2DZ9A 3HRUA 1OZ3A 4J5YA 5LJ5e 1M1KC 4OB3B 1KQSA 5GAOn 1YCYA 3C94A 4C92B 4E7JA 1G5VA 4GLKA 1D3BB 2DPPB 3JCMW 2EJ9A 4XTWA 1QVGA 1FWZA 3CEYA 1BIBA 3QJYA 2M9UA 3GIBA 3GNFB 3GF5A 3V8LA 4M78G 4ME7A 3OY9A 2YLCA 5I2SA 3QDRB 2WACA 2O4XA 4ZGJB 4ZN1A 2PUKB 5KCOA 4JLIA 3HP9A 1KD1U 3RMSA 1K9MU 1VQ8T 2R5MA 4Q5WA 4M78B 1RL2A 3LLRA 4J6WA 4Y28E 2XG8D 4M7AA 1NPPA 1AHJB 2RH2A 2K4YA 4QVZA 4BB7A 5KE3A 3DLLA 3VKIA 1G3TA 1UGPB 2E12A 3CBPA 1VQKA 3MP6A 2GCXA 5J3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM V;  3PGG A;  4M75 D;  2FYK A;  5LJ5 j;  5LJ3 h;  4EMK B;  4M7A B;  4F7U G;  5I21 A;  1Y96 B;  4PJO E;  3SWN A;  4NL3 A;  4X9C A;  4EMK C;  1MGQ A;  5GAN 7;  4M7A C;  5LJ5 h;  2E41 A;  3QUI A;  5GAO m;  4C92 F;  1I4K 1;  4X9D A;  4M7A D;  4EMH A;  3JB9 D;  4XTU A;  4N0A C;  1N9R A;  4F7U F;  1LJO A;  3HSB A;  5GMK m;  3JB9 H;  5CAI A;  1X01 A;  4M75 A;  3RES A;  4M7D G;  3QO3 A;  5GAM h;  3JCM e;  5GAM d;  2VXF A;  5GAM g;  4M75 G;  4M77 G;  4Y91 A;  3V7R A;  2DZC A;  1KQ1 A;  4XTV A;  2E65 A;  4M7D B;  4JRI A;  2RD1 A;  4XU3 A;  1Y96 A;  2I2L A;  4M78 F;  1U1S A;  2EJG A;  4OP0 A;  4XTZ A;  4M77 B;  4MMK A;  2FB7 A;  3V8K A;  3JCM Q;  4M7D C;  1I8F A;  4N0A A;  5GMK j;  4M7D D;  2ZGW A;  4M77 C;  5GMK e;  4M77 D;  2DJZ A;  5GAN f;  1M8V A;  2E1H A;  5LJ3 d;  1H64 1;  5LJ3 g;  3VU3 C;  4C92 E;  4DQ2 A;  5GAO r;  4M7A F;  3BFM A;  3JB9 F;  4C8Q A;  1I5L A;  3JCM J;  4XTX A;  3RUX A;  5LJ5 d;  3EFR A;  2DXT A;  5LJ5 g;  3M4G A;  1M5Q 1;  1LNX A;  4C8Q G;  4M7D A;  3JB9 G;  2VXE A;  2JN0 A;  2Y90 A;  4M77 A;  3JB9 J;  2DVE A;  5GAN 8;  2DXU A;  4C8Q B;  1HK9 A;  5GAN 2;  2YLB A;  4PJO A;  3BDU A;  4XU1 A;  4M78 E;  4C8Q C;  3RIR A;  4XU0 A;  3JCM h;  4NOY A;  5DY9 A;  4QVD A;  2RB6 A;  1TH7 A;  4PJO G;  4C8Q D;  3JCM d;  3AHU A;  1B34 A;  3RKX A;  4M7D F;  3INZ A;  3BW1 A;  1N9S A;  1WPY A;  1BIA A;  5GAO p;  4EMG A;  2RA2 A;  4M75 F;  4M77 F;  1HXD A;  4PJO B;  4XU2 A;  4XTY A;  5GAM f;  1JBM A;  3JCM b;  4V2S A;  4M7A E;  4HT9 A;  2QTX A;  4PJO C;  3EFS A;  5GMK h;  3FJP A;  3QSU A;  1B34 B;  4PJO D;  2E64 A;  1I81 A;  5GAN 5;  3JCM P;  5GAN j;  4F7U E;  3V7S A;  1WNL A;  2DTI A;  2HNI A;  5GAN e;  3FIF A;  1KQ2 A;  4XQ3 A;  4M78 D;  3RKY A;  4WF2 A;  2YHT A;  5GAO l;  3SB2 A;  2DTO A;  4RCB A;  2DTH A;  3V8J A;  5LJ3 f;  4PNO A;  5GMK l;  2EJF A;  3FB9 A;  4J6Y A;  4RCC A;  4HA8 A;  3JB9 I;  4C8Q F;  4A54 A;  4M7D E;  5LJ5 f;  5LJ3 e;  1WQW A;  3JCM g;  4M75 E;  4M77 E;  3RKW A;  4C92 G;  2DZ9 A;  4J5Y A;  5LJ5 e;  3JCM X;  5GAO n;  1YCY A;  4C92 B;  1U1T A;  4J6X A;  3JCM c;  3HFN A;  3V7C A;  2RM4 A;  4PJO F;  1D3B B;  4F7U B;  5GAN 3;  3JCM W;  2CGH A;  2EJ9 A;  4C92 C;  4XTW A;  3HFO A;  3JCM f;  1WQ7 A;  4M78 A;  4C92 D;  1BIB A;  5GAM j;  4QVC A;  3GIB A;  5GAM e;  4MML A;  3V8L A;  3SWN B;  2EAY A;  4M78 G;  5GMK i;  2YLC A;  5GAN 4;  2K57 A;  2EWN A;  3SWN C;  3BY7 A;  5GAN 6;  4NL2 A;  5GAN h;  1LOJ A;  3QHS A;  1JRI A;  4JLI A;  5GAN g;  3L2Z A;  5GAN d;  3L1A A;  2DKG A;  4M78 B;  4C8Q E;  4EMK A;  4J6W A;  4M7A A;  4JUV A;  2E10 A;  4M78 C;  4HT8 A;  4M75 B;  5GAO q;  4A53 A;  4C92 A;  5LJ3 j;  4JRK A;  3RER A;  4M7A G;  2DEQ A;  2VC8 A;  1D3B A;  4F7U A;  4M75 C; 
#chains in the Genus database with same CATH topology
 3G1J A;  3A98 A;  3I55 Q;  4IIM A;  5KYY A;  1Q86 C;  1XQH A;  1PSE A;  3I9Q A;  4X9D A;  1I0C A;  1VQP A;  1NLO C;  2QA4 A;  1NJI C;  1X43 A;  1PWT A;  5GAM g;  2K2V A;  4M75 G;  4JRI A;  3OMC A;  4IIO A;  3FRN A;  1Q81 U;  1WDX A;  1VQ5 A;  1H3H A;  5GAN f;  3MO8 A;  1UFF A;  2GQV A;  4FYV B;  2DBM A;  1I5L A;  1SG5 A;  4F16 A;  4NS5 A;  1OI1 A;  3OSS C;  2HL5 C;  2E6Z A;  4OB1 B;  2IVW A;  1TSF A;  3OYF A;  4FIB A;  3CCS T;  2M1H A;  4KGV B;  5IHK A;  3CCL T;  2JW4 A;  4IUR A;  2CH4 A;  3M9Q A;  1HXD A;  2VV5 A;  4XU2 A;  2P4T A;  3LGF A;  2NUP A;  3QJ6 A;  2VVK A;  3EH2 A;  3M56 A;  3CCE A;  4LXC A;  4ESR A;  3FDR A;  1ZBJ A;  4MDW A;  4C0D C;  3V7S A;  1VQ5 Q;  2OTL T;  2ROL A;  3RKY A;  5GJV B;  3CCU A;  2DTO A;  4J6Y A;  3U23 A;  2RPN A;  1EIF A;  2XU8 A;  3M58 A;  3JRZ A;  3CC4 T;  1TUC A;  5FWB A;  4M77 E;  2XDD A;  1V29 B;  5FLX E;  3KUF A;  2LJ1 A;  2JM8 A;  3VYG A;  2RJE A;  1MMG A;  3HFO A;  4J9G A;  2GNC A;  4OMF B;  2JM9 A;  2XHC A;  4OMQ A;  3NMZ C;  5KYY B;  3SWN C;  2D6F A;  3BY7 A;  5GAN 6;  3CCE Q;  1LOJ A;  1WHH A;  1YHQ T;  4N4G A;  1YJW T;  2L5Q A;  3G4S Q;  1OV3 A;  1UE9 A;  5GAO q;  1QVF P;  3CCU Q;  5GAO p;  2X3X D;  3H9N A;  3LX7 A;  3SWN A;  4IUP A;  4M7A C;  1AWX A;  2ED0 A;  3CD6 A;  4IUQ A;  1YN8 A;  2YUN A;  3M0T A;  4EMH A;  1WYX A;  2E3I A;  3RR6 A;  4WCI A;  1FMK A;  4OGC A;  1RAE B;  3VS7 A;  1VQ7 Q;  1GL5 A;  1JXM A;  2CS7 A;  1RLQ C;  2FZK B;  1PKT A;  1I8F A;  1T3L A;  2RN8 A;  3A1P A;  4C5G A;  1VQ4 T;  2M02 A;  3VU3 C;  1KC8 C;  1YJN A;  1NEB A;  3X28 B;  2K3B A;  1BKB A;  3G6E T;  2KSS A;  1SRM A;  4C0G A;  4KUI A;  1Q7Y U;  2Y90 A;  1M90 R;  2K6D A;  3ZL7 C;  3VS3 A;  1W1F A;  4PJO A;  2FL7 A;  2LJ0 A;  2DL7 A;  1I5O B;  2VUB A;  3H0I A;  1IRX A;  4C0D B;  4KGZ B;  3OYG A;  2WSF E;  2CP7 A;  2DTI A;  2COW A;  1ARK A;  2L3P A;  2XMF A;  4FYY B;  2RI5 A;  2GGR A;  2CUB A;  4RCC A;  1WIE A;  3VRY A;  4QQD A;  1QVG S;  4A4E A;  1UHC A;  4IUT A;  1KD1 R;  2EGE A;  1DJ7 B;  3UDC A;  3PMT A;  2RMO A;  1Q82 R;  4DEX A;  1YCS B;  5FWC A;  2CP6 A;  2PVO B;  4MML A;  3SWN B;  2DL3 A;  9ATC B;  2X4W A;  4J9B A;  3ULR B;  2M0O A;  2EFI A;  2MIO A;  3CCS Q;  1VOM A;  1Q86 U;  3OBW A;  4P5N A;  3FJ5 A;  5FRO A;  1VIE A;  3CCL Q;  3CCV T;  1CKB A;  2L2P A;  1VQN A;  2GTJ A;  2LQW A;  3M54 A;  1Y71 A;  1NJI U;  1RAC B;  1BI1 A;  2O4X B;  2YRC A;  2E5Q A;  1JXO A;  4M75 D;  1YNZ A;  4M7A B;  2QYZ A;  1UGR B;  3PT9 A;  5GAO m;  2OTL Q;  2YDL A;  1LJO A;  3REA B;  5FRM A;  1IO6 A;  2DYI A;  4B9W A;  4M7D G;  3HTR A;  3C95 A;  3CC4 Q;  2E65 A;  4J7I A;  2DA9 A;  4HCC A;  1PG5 B;  2HAX A;  3R6O A;  4BI3 A;  2LQ8 A;  3N5B B;  1GFD A;  3L2R A;  2I0N A;  2DL8 A;  3CC2 T;  1YHQ Q;  1X69 A;  5ECA A;  2PQW A;  5D6W A;  2JOY A;  2MCN A;  3JCM h;  4OML A;  4JJN K;  4C8Q D;  2LC4 A;  3MET A;  1TUG B;  3L2Q A;  2EYW A;  2L3R A;  3ER0 A;  2QQR A;  5GMK h;  1WJS A;  4E7I A;  2JMA A;  1IHW A;  2EYQ A;  1OX8 A;  5FW9 A;  1SPK A;  2XD0 A;  1TWB A;  3SHW A;  1FX7 A;  2ZPB B;  5GAO l;  2BE7 D;  4AFZ C;  2H3E B;  5KYN A;  4PJL A;  3OA6 A;  1G3Y A;  3CCJ T;  1JEG A;  3HL8 A;  2DYB A;  5IHN A;  1W6X A;  3A8O B;  2FG0 A;  2F2X A;  2O31 A;  3G6E Q;  2AZV A;  5CR2 A;  2DER A;  4C92 D;  2VGN A;  3TSW A;  4CC7 A;  1NLP C;  4FW1 A;  2DL5 A;  2V8J A;  3OYB A;  4K11 A;  2RHZ A;  2LRQ A;  4AFS C;  2DKG A;  4EMK A;  1G8X A;  4QQ6 A;  4M78 C;  3GOX A;  1D3B A;  1AVZ C;  1QKW A;  4VUB A;  1QW1 A;  1U5S A;  3E1S A;  1ZSG A;  4JRP A;  3CCV A;  1J3T A;  3PNW C;  2QG9 B;  4F7U F;  1D09 B;  4R56 A;  1VQ9 T;  4XK8 E;  1VQL A;  3RBB B;  4RTY A;  1KC8 U;  3G71 T;  3AT1 B;  1VQO T;  4Z88 A;  5C6S A;  2K7A A;  3OYE A;  1ABO A;  4CC2 A;  3EHQ A;  3LWH A;  2EQM A;  1M3A A;  1QVG P;  2XI9 A;  1RAA B;  1AZG B;  2YUO A;  2CP2 A;  4XTX A;  3P8D A;  4ZTF A;  2PTK A;  1Q81 R;  3LGL A;  2F2V A;  3NFC A;  5CCA A;  3CCV Q;  4BE1 A;  1QVP A;  4JJD A;  1BI0 A;  1A0N B;  3MEU A;  3EFO A;  1MMA A;  1WXT A;  4PJO G;  2DXC A;  4FCY A;  2ZPH B;  1BI3 A;  4UC4 A;  2HEQ A;  2KY9 A;  4XTY A;  5GAM f;  2HL3 A;  2QDL A;  2ZPI B;  3I5R A;  1UGQ B;  2D9T A;  3I56 A;  2YXY A;  2MOX A;  4KUD K;  3X20 B;  1HSQ A;  1XJW B;  1WX6 A;  3X26 B;  5KE2 A;  3PIO A;  5HY6 A;  3TVT A;  4C0Z A;  2JXB A;  2ZZD A;  1WHM A;  1KHC A;  3H0H A;  3S3N A;  1RAD B;  2DZ9 A;  1M1K C;  4OB3 B;  1KQS A;  1OU8 A;  5GAO n;  4E7J A;  2HKQ B;  1D3B B;  2DPP B;  2EJ9 A;  4XTW A;  1ACM B;  1FWZ A;  1BIB A;  3CC2 Q;  3GNF B;  3GF5 A;  3V8L A;  4FSS A;  1YP5 A;  2FPF A;  2WAC A;  4ZGJ B;  1KD1 U;  2RQR A;  3HP9 A;  2LCS A;  1VQ8 T;  2YWW A;  4M78 B;  1RL2 A;  4Y28 E;  1NPP A;  1AHJ B;  2RH2 A;  2E12 A;  3JCM b;  2OTJ T;  2GCX A;  4GY5 A;  5I21 A;  1G3W A;  4FU6 A;  3OB9 A;  1U3O A;  1Y57 A;  5IAY A;  1EZZ B;  1MGQ A;  5LJ5 h;  1MND A;  4OMN A;  1N9R A;  4JJB A;  1E7O A;  4PJJ A;  4ZGD B;  3CCR T;  1WZO A;  1KHI A;  1K4U S;  1WLP B;  2VXF A;  1RAG B;  2JTM A;  5C0M A;  4DA4 A;  1RAI B;  1Y96 A;  3OS0 A;  3X25 B;  1VQM T;  1QWF A;  3OYJ A;  2G3R A;  4L5G A;  2NLU A;  4ZTJ A;  2DJZ A;  1YIJ A;  1H64 1;  3RNJ A;  5CIU A;  4D6W A;  2KRO A;  1XTD A;  1BCO A;  2XDP A;  1LNX A;  3PMI A;  4RTV A;  3JB9 J;  1ZSZ C;  2DVE A;  1IGU A;  2KDS A;  2O01 E;  2PNI A;  5L8R E;  4DOW A;  1Q7Y R;  2RA2 A;  2GQI A;  2DXB A;  3CBO A;  3M57 A;  4HT9 A;  1ZSZ A;  4DBQ A;  2EKO A;  2E64 A;  4E2F B;  1VQ9 Q;  2A08 A;  2BKD N;  4QKU A;  3LWI A;  1H8K A;  3G71 Q;  1M3C A;  1VQO Q;  3V8J A;  3A8G B;  3FEO A;  3JB9 I;  4C8Q F;  2KT8 A;  3E19 A;  3S3M A;  2CSQ A;  2W10 A;  3CPW A;  3CCQ A;  1O75 A;  4QW2 A;  5IT9 E;  5CKF A;  4ATO A;  3NHN A;  4J6X A;  1W4S A;  3O5Z A;  1K8A C;  2LP5 A;  4A63 B;  2BIV A;  2RJD A;  4QVC A;  3TSZ A;  3PVQ A;  4D8K A;  2PZ1 A;  2EAY A;  1D1A A;  1JRI A;  2IG0 A;  1F1B B;  1KK7 A;  2ATC B;  4RTX A;  1PCX A;  3UT1 A;  2DEQ A;  2VC8 A;  3I55 A;  2EIF A;  2C06 A;  5LJ5 j;  2A28 A;  1Y96 B;  1Q86 R;  4NL3 A;  1VYT A;  3I35 A;  2F2W A;  1AEY A;  2OI3 A;  5I2M A;  4M7A D;  4C92 F;  3I5S A;  3JB9 D;  4XTU A;  2A7Y A;  1NJI R;  1H3Z A;  2G6F X;  1X75 C;  3RES A;  4M77 G;  3A8L B;  2DZC A;  4LDW A;  5GJW B;  4XU3 A;  5KH6 A;  1R0B G;  4M7D C;  5D6X A;  4BY6 C;  2V8I A;  3R6N A;  1OX9 A;  1X6B A;  5IXB A;  1YI2 T;  2XKO C;  1NYG A;  5LJ3 g;  5DLQ E;  3EGX B;  2RNA A;  2VAS A;  3BE3 A;  2WSE E;  1TUD A;  3P8H A;  5LJ5 d;  2NUZ A;  4M7D A;  3JV3 A;  1ZSZ B;  1VQ8 Q;  1QCF A;  2ZAE A;  2C0O A;  1HK9 A;  1TG0 A;  3ZEH A;  1D0Z A;  1AOJ A;  3E2U A;  4FT2 A;  4KT0 E;  2OTJ Q;  1OZ2 A;  4NOY A;  2GFA A;  4LD6 A;  3ZBD A;  4J9F A;  1QLY A;  4J9C A;  1NEG A;  1E6G A;  2HZY A;  3VS6 A;  3LW5 E;  3CCR Q;  5GAN j;  2A0F B;  1WNL A;  2C0T A;  4FW2 A;  5GAN e;  2HBW A;  1GBQ A;  1M1K U;  2DET A;  2O88 A;  3KFV A;  4PNO A;  3H6Z A;  1K9A A;  1KQS S;  2O2O A;  1VQM Q;  4A54 A;  3ZFJ A;  4PFZ A;  4BAC A;  2H3J A;  1Y07 A;  1KG1 A;  4E7Z A;  2QGF B;  3JCM c;  2KT1 A;  1IB8 A;  1BYM A;  1WQ7 A;  3L2U A;  3G4S A;  1ZA1 B;  1SEM A;  4O5V A;  5GAN d;  4N4H A;  2QTV A;  4JUV A;  1UEC A;  2OJ2 A;  3TCJ A;  1HJD A;  2CZ0 B;  1T0H A;  3CME T;  2K3Y A;  4RCB A;  4LUE A;  2JS0 A;  1S72 T;  2EQK A;  4II1 A;  3M0R A;  2XK0 A;  4KGX B;  4EPC A;  3OYH A;  1K9M C;  3QUI A;  2MWP A;  1VQ7 A;  2YUP A;  2KYM A;  4HVV A;  4LN2 A;  3H8Z A;  2BZY A;  1P92 A;  1K1Z A;  2COZ A;  2JT4 A;  1QP2 A;  4Y91 A;  3GP8 A;  3H41 A;  4M7D B;  4BY6 B;  3MKD A;  2HD0 A;  2RK2 A;  5AT1 B;  1YJ9 T;  2KEA A;  3E9F A;  2KRM A;  2VB6 A;  1KC8 R;  5AYF A;  2RO0 A;  4KH0 B;  3J81 E;  2RHY A;  3JSC A;  2EVR A;  2D0Q B;  5CKH A;  1ZA2 B;  1SSF A;  3EG2 A;  2J05 A;  4JZ4 A;  4JS4 A;  3VUB A;  4PJO C;  3QSU A;  3FJP A;  2L3Q A;  2ED1 A;  2RK1 A;  2HNI A;  1W2B A;  1U8R A;  2NUP B;  1X2K A;  3CPW S;  3NTH A;  2K9G A;  1KJW A;  2L0A A;  1WI7 A;  1K8A U;  1RI9 A;  2P0P A;  2KI7 A;  4FSX A;  4JJC A;  5CK9 A;  1ZUK A;  2RQT A;  3TQ7 P;  2Z0W A;  1UB4 A;  1N8R C;  1NBE B;  3HFN A;  3QII A;  3QKJ A;  5GAN 3;  5CKD A;  3D7S B;  2MYS A;  3CCS A;  4A4F A;  2QEX T;  4C5I A;  3CCL A;  2NUT A;  1IHV A;  4BE0 A;  2M51 A;  2QQ9 A;  2E5K A;  1Y0M A;  3EG3 A;  2C0I A;  3M0P A;  4C8Q E;  4A53 A;  4M78 D;  3VS2 A;  4RMO A;  1WJQ A;  2OTL A;  2LNH B;  3MEW A;  1SSH A;  1LPL A;  1TXQ A;  3CC4 A;  5GMK m;  2DEU A;  1S72 A;  2JMC A;  2DAQ A;  2DIG A;  5CVI A;  1PSF A;  2NYS A;  5FRN A;  1U1S A;  3V8K A;  1M4Z A;  1KQS P;  1M9S A;  5J39 A;  1WA7 A;  3G7Z A;  4FYX B;  2BZ8 A;  1X6G A;  4C92 E;  1YHQ A;  1VIF A;  4M7A F;  1YJW A;  3JB9 F;  3DKM A;  3JCM J;  3EFR A;  4XAX B;  4DEY A;  3RMQ A;  2V8K A;  3TEE A;  2DXU A;  4ELZ C;  2RQU A;  3CME Q;  3OYM A;  2DIQ A;  5DY9 A;  4QVD A;  1S72 Q;  3INZ A;  1BIA A;  4RUG A;  4PJO B;  3VS0 A;  2EGA A;  2AZS A;  4RTU A;  2KVQ G;  2OX7 A;  3JCM P;  1Y7X A;  3LH5 A;  1YWP A;  5KYX A;  4XQ3 A;  4WF2 A;  1D1B A;  1R8O B;  1YJW Q;  1X2Q A;  5GMK l;  1ZLM A;  2EJF A;  2DL4 A;  1VQ4 A;  1WXB A;  5A0G A;  1YJ9 Q;  4BD3 A;  3MEA A;  3L2W A;  3G6E A;  1LCK A;  2RI2 A;  5A2Q E;  2CT3 A;  3HRU A;  8ATC B;  1PRM C;  3C94 A;  2MPX C;  2MK5 A;  1AWW A;  1D0X A;  1K9M U;  2R5M A;  3LLR A;  1M8M A;  2D8H A;  2FRY A;  2VWF A;  1VQ4 Q;  1G83 A;  2K3X A;  3EH1 A;  4AT1 B;  1XNI A;  4JLG A;  4EMK C;  1QP3 A;  3M0S A;  1UG1 A;  2CRE A;  4RKU E;  4WTO B;  1NPR A;  1QWE A;  3S3O A;  4RTT A;  3M53 A;  3ASK A;  2ESW A;  1H92 A;  5HCK A;  2ABL A;  2DBK A;  2LQK A;  2I2L A;  4AFQ C;  4LNP A;  1AT1 B;  4C0F A;  1TTH B;  2ZPG B;  4M77 C;  1QVF A;  4HVW A;  1O9S A;  1M1G A;  2LCC A;  4J7F A;  2QEX Q;  2KYB A;  4PLL A;  2EBP A;  1EX4 A;  3OYL A;  3CCM T;  1K73 C;  1PD1 A;  2JN0 A;  2RJF A;  1GFC A;  4M77 A;  4PK4 A;  4LDY A;  5KYX B;  1B34 A;  4DBH A;  1W2B S;  2D0N A;  4ZN3 A;  2F69 A;  2DFU A;  3O8V A;  2HQX A;  1KQ2 A;  2LZ6 B;  1N8R U;  2YHT A;  2JTF A;  3PTA A;  2M0Y A;  2DVJ A;  2DX1 A;  5LJ3 f;  2EQU A;  4OGE A;  4OB2 B;  2FZC B;  5L23 A;  2K2M A;  1M27 C;  5LJ3 e;  2P84 A;  2LNV A;  2KRS A;  1M1K R;  4HVU A;  1X27 A;  3CC2 A;  3HRT A;  5D6Y A;  2RM4 A;  2RHU A;  1S1N A;  3JCM f;  5GAM j;  5GAM e;  2KXC A;  1UUE A;  1JB0 E;  3QHS A;  1YIT T;  2AHJ B;  3L2V A;  2B8A A;  2EYY A;  2E10 A;  5KCH A;  1YBY A;  3RER A;  3FC3 A;  1K0S A;  4EMK B;  1B07 A;  1Q95 G;  1VQ6 T;  2EKH A;  3VRZ A;  1R77 A;  2A3L A;  3CCJ A;  4R0K A;  5KYU A;  2FEI A;  3CQT A;  2CP0 A;  2COY A;  2KXD A;  5GAM d;  3MEV A;  1WFW A;  3L42 A;  1G3S A;  1GCQ A;  2RD1 A;  2ZPE B;  3OYK A;  4M78 F;  1NE8 A;  4M77 B;  1ZQ1 A;  4M7D D;  1CSK A;  5J26 A;  1OYX A;  1NG2 A;  4JPB W;  4C8Q A;  4Y92 A;  5IXF A;  4ZNX A;  2PU9 B;  1MNE A;  3J7A F;  1BCM A;  1PNJ A;  2DRM A;  2EW3 A;  1XOV A;  3CCJ Q;  4XU0 A;  1K76 A;  1FMV A;  2JTE A;  4OMO A;  4EMG A;  1VQ9 A;  4M75 F;  2O9S A;  1FXX A;  3EFO B;  3QZ5 B;  4A4G A;  4L59 A;  4M7A E;  3QPH A;  3EFS A;  3G71 A;  3OQ5 A;  3EHR A;  3QWY A;  4B6M A;  1VQO A;  1VQK T;  2JVV A;  1BB9 A;  3SB2 A;  1PKS A;  3NGP A;  5D7U A;  3VS1 A;  1PC0 A;  4HA8 A;  1VQP T;  2MI6 A;  1WQW A;  1HD3 A;  2QA4 T;  4M4Z A;  4CC3 A;  3CC7 T;  1K8A R;  2J6F A;  3UPU A;  2CGH A;  5IH2 A;  2B86 A;  3CCM Q;  5GAN h;  3REB B;  4R55 A;  3PE0 A;  5KYU B;  4OP0 A;  1GCP A;  3NTK A;  2HSE B;  3JCM V;  3PGG A;  2K5F A;  1QMC A;  1QKX A;  2CZ1 B;  4AG1 C;  2K5L A;  1YIT A;  4IUU A;  3OYN A;  1W2B P;  2A37 A;  1JQQ A;  3HKS A;  3PVL A;  3HSB A;  1ZX6 A;  4Z8A A;  1RAF B;  2ZPF B;  3MPU B;  4PL6 A;  1QVF S;  1IGQ A;  2FZG B;  2J6K A;  2ZCF B;  1C1A A;  2EJG A;  1M1F A;  4ANJ A;  2FB7 A;  2KBT A;  2DNU A;  2ZGW A;  2F5K A;  3CCU T;  5CO7 A;  3DB3 A;  2DMO A;  1WHG A;  1VQ8 A;  3QWX X;  2L89 A;  4ZGE B;  4KRT A;  1AWO A;  2MAM A;  2Y4Y A;  3M55 A;  3OS2 A;  2OTJ A;  1YIT Q;  1N27 A;  2P0K A;  2KRN A;  2O9V A;  3DLM A;  1UJY A;  1AD5 A;  2FVU A;  1JJ2 A;  4MDX A;  1N5Z A;  2FO0 A;  5KYW A;  4C5E A;  1MUZ A;  2RF0 A;  1KSW A;  4HKE A;  3CCR A;  1VQ6 Q;  4D8D A;  4V2S A;  1C6V X;  1T3S A;  1WHK A;  4PJO D;  2RQW A;  4F7U E;  1FMW A;  1VQM A;  1M2O A;  8AT1 B;  3CD6 T;  5FU7 C;  3OS5 A;  1VYV A;  2LDM A;  3JCM g;  3RKW A;  4PLI A;  2HCK A;  5EC7 A;  4EDU A;  1RLP C;  1IRE B;  3V7C A;  3THK A;  1FYN A;  3E9G A;  3M0U A;  2YSQ A;  4KH1 B;  1GXI E;  3MHX A;  3NTI A;  2F5T X;  3CC7 A;  5GMK i;  3GNG A;  1NYF A;  1W70 A;  2P0Q A;  4FYW B;  3QZ9 B;  3L1A A;  3MCA B;  2LJ3 A;  1YJN T;  2GFU A;  3P8B B;  4HT8 A;  2K79 A;  1ZUU A;  2QQS A;  3Q1J A;  3GLX A;  3QYH B;  1K9M R;  5GAN 7;  3X24 B;  5CQX A;  1VQK Q;  4FM4 B;  1U06 A;  3VV0 A;  3KXT A;  1SF9 A;  2L8D A;  3PFS A;  2AT1 B;  2PVD B;  4JZ3 A;  1VQP Q;  4B9X A;  1GBR A;  1KQ1 A;  4OB0 B;  2QA4 Q;  3CC7 Q;  4N4I A;  4MMK A;  4XTZ A;  3SDZ A;  2YRD A;  3ME9 A;  2X3W D;  5LL6 S;  2MWO A;  5KYW B;  2F1L A;  1PD0 A;  2AKL A;  1X6O A;  3UA7 A;  4IKF A;  3OYC A;  3UAT A;  4C8Q G;  1MMD A;  3CXC A;  3EGU A;  2R58 A;  1SHG A;  5FU6 B;  2JUF A;  5GAN 2;  2HQE A;  2FRW A;  4XU1 A;  1UJ0 A;  4M78 E;  1UDL A;  4PJM A;  2CP5 A;  1TH7 A;  2HKN A;  4M7D F;  1N9S A;  1RAB B;  3JAM E;  2CT4 A;  3MP8 A;  1N6A A;  4JRQ A;  3OYI A;  2QTX A;  1VQN T;  2IPO B;  4E7K A;  1D0Y A;  1OQK A;  1I81 A;  5GAN 5;  3NPF A;  4F14 A;  2ENM A;  2HDA A;  3IQL A;  2X51 A;  4LDX A;  1YI2 A;  4KBM B;  4KUL A;  2LTO A;  5FU7 B;  2EPD A;  4HCB A;  4M75 E;  4C92 G;  1VA7 A;  3HPW A;  1N8R R;  5CKB A;  3EG0 A;  2IIM A;  1Z9Q A;  2D1X A;  4GLK A;  3JCM W;  3CEY A;  3GIB A;  2M9U A;  2YLC A;  5I2S A;  3QDR B;  2O4X A;  4ZN1 A;  4QT7 A;  2PUK B;  3MJX A;  5IHI A;  3RMS A;  4J6W A;  4M7A A;  2XG8 D;  1B7T A;  2HQH A;  4QVZ A;  2SEM A;  2K4Y A;  4BB7 A;  1G3T A;  3CBP A;  2EYZ A;  1YI2 Q;  3MP6 A;  2J6O A;  4LE9 A;  1C0M A;  4GLM A;  2E41 A;  1UEB A;  2KAF A;  2AK5 A;  5HKC A;  3OMG A;  3C12 A;  4J9D A;  3JB9 H;  2PVG B;  2LVM A;  3CD6 Q;  5HK3 A;  2J7I A;  4YTL A;  1TU0 B;  5DLO A;  2BZX A;  1B3Q A;  1NM7 A;  4A4K A;  2XID A;  4EIK A;  2WSC E;  2QQA A;  4M77 D;  1PHT A;  1NZ9 A;  3KBG A;  5IN1 A;  4DQ2 A;  3RDV A;  3BFM A;  1SRL A;  5LJ5 g;  2DXT A;  2RHI A;  3VS4 A;  1JJ2 S;  4J9H A;  2FHD A;  3CME A;  3EGD A;  6AT1 B;  3H0F A;  2HMA A;  1OPL A;  2KMT A;  1YJN Q;  5GAN 8;  1BBZ A;  1ZUY A;  1M90 C;  3DB4 A;  3CMA T;  3RIR A;  3M5A A;  4BDY A;  3AHU A;  2RB6 A;  4JS5 A;  3A8M B;  1BU1 A;  3OW2 A;  4FT4 A;  3VJP A;  2DE0 X;  2GF7 A;  4ELY C;  3FLG A;  2QXF A;  2CUD A;  2E3H A;  1V76 A;  4E7S A;  1YJ9 A;  2R5A A;  1I07 A;  3VS5 A;  2DTH A;  2PUO B;  3HRS A;  1IXD A;  3FB9 A;  3S6W A;  1WJR A;  2BE9 B;  1V1C A;  2E6N A;  3OBY A;  1VQL T;  3SD4 A;  2CKK A;  5HK0 A;  1KD1 C;  1K0X A;  1JU5 C;  4PJO F;  4FL6 A;  4BE2 A;  2J06 A;  2DJQ A;  3CPF A;  2QAZ A;  1Q82 C;  2RHX A;  1Z9Z A;  4NL2 A;  3EG1 A;  5GAN g;  3L2Z A;  2KE9 A;  1D1C A;  2EYX A;  2NUT B;  4J83 A;  4JRK A;  1TS9 A;  4F7U A;  5CKE A;  2LCL A;  4AG2 C;  5A0D A;  4LD9 K;  2D8J A;  4L6V 5;  5LJ3 h;  1VQN Q;  3M4Y A;  4RTZ A;  4X9C A;  4DOV A;  4C5H A;  4N0A C;  3URG A;  1X01 A;  2X4X A;  3SEM A;  5GAM h;  4AFU C;  2X4J A;  2QI2 A;  4LDV A;  3EGD B;  4AMC A;  3WVE B;  2BTT A;  3EG9 A;  2P4R A;  3I56 T;  2YUQ A;  3C4S A;  4N0A A;  4F04 B;  2QEX A;  3CXC S;  4X1V A;  4J9I A;  2E1H A;  5GAO r;  2AKK A;  4MZP A;  3A5Z B;  2AIR B;  2CP3 A;  1K73 R;  2VXE A;  2ECZ A;  1IZ6 A;  1WHL A;  2RJC A;  4ORZ A;  3CPW P;  2CH4 W;  2V26 A;  1ZHI A;  3VUZ A;  2CZ7 B;  3QBY A;  5CQY A;  3RKX A;  2KK4 A;  3PIP A;  4HCZ A;  4Z02 A;  2E70 A;  2HSP A;  2R57 A;  3CMA A;  2JNG A;  4Z89 A;  1M2V A;  4OMM A;  1E6H A;  3OYD A;  2DIL A;  4DBF A;  4M7D E;  2LX7 A;  4PKC C;  1MHN A;  2OAW A;  2DRK A;  2DM1 A;  3WXM B;  5A0L A;  3JCM X;  2X9H A;  1AWJ A;  4F7U B;  4OF1 A;  2MMP A;  4M78 A;  1JO8 A;  2H8H A;  3WVD B;  4RG8 A;  2CSI A;  1MMN A;  3VYH B;  2XIC A;  1JJ2 P;  2K57 A;  4LUD A;  3OS1 A;  4E47 A;  3CMA Q;  1YIJ T;  1BK2 A;  1GRI A;  3M59 A;  2X35 A;  4A4H A;  2DD4 A;  2JJ9 A;  1RI0 A;  7AT1 B;  5LJ3 j;  3OSV A;  4M7A G;  4CC4 B;  3JB9 G;  4M75 C;  4BI8 B;  2CYZ B;  4F17 A;  2JS2 A;  3EG9 B;  1PRL C;  3QYG B;  1QQJ A;  2BUD A;  1KIK A;  1I4K 1;  3LYI A;  2QDY B;  2CZ6 B;  2QGG A;  5CAI A;  4M75 A;  3QO3 A;  3JCM e;  3V7R A;  1HYO A;  1UTI A;  2V1Q A;  4XTV A;  3BDL A;  2KQW A;  1VQL Q;  2FPD A;  2KR3 A;  5GMK j;  3SFM A;  5GMK e;  1YFN A;  2L3S A;  1M90 U;  1UGS B;  5LJ3 d;  3M0Q A;  2DK3 A;  1GCQ C;  3RUX A;  3CCQ T;  3M4G A;  2VGM A;  2RI3 A;  3OW2 S;  1Q81 C;  2SRC A;  3TRE A;  4J9E A;  2YLB A;  4JDS A;  4J8O A;  5DM7 R;  4LDU A;  4C8Q C;  1OU9 A;  4DBR A;  3JCM d;  3BW1 A;  1WPY A;  1M2V B;  4RG2 A;  4M77 F;  2EQJ A;  1JBM A;  2GTO A;  4HXJ A;  1VYU A;  1T0J A;  2KNB B;  1B34 B;  1SHF A;  1WHJ A;  1WXU A;  2X4Y A;  3I55 T;  4E7L A;  2RQV A;  3FIF A;  4TVR A;  3OYA A;  3F70 A;  2M16 A;  1OPK A;  3I56 Q;  1QCO A;  3UA6 A;  2DO3 A;  1Q82 U;  2LQN A;  4QQG A;  2VYT A;  4RTW A;  5I22 A;  3CCM A;  2V1R A;  2DD5 A;  1RAH B;  1U1T A;  2NWM A;  4O6J A;  3CXC P;  1CKA A;  4C92 C;  3HHT B;  3QDF A;  2YRV A;  2FPE A;  5GAN 4;  2EWN A;  1TOV A;  2DLP A;  5I11 A;  2LMJ A;  3MP1 A;  4M75 B;  4C92 A;  1UGV A;  1QCN A;  2EGC A;  2QK0 A;  1G2B A;  3EAE A;  2DF6 A;  3UF4 A;  2FYK A;  4F7U G;  2QQB A;  3T9N A;  4PJO E;  1PM3 A;  1EFN A;  4CI0 C;  1M3B A;  1VQ5 T;  2W0Z A;  4PFO A;  1KFZ A;  1R0C B;  3JCM Q;  3EGX A;  4E6R A;  4GBQ A;  1OEB A;  2MF2 A;  1BI2 A;  4CRI A;  2LT4 A;  2EQI A;  4MZM A;  1M8V A;  2LX9 A;  2HBP A;  4X34 A;  3LH0 A;  1M5Q 1;  1YIJ Q;  4E7H A;  2QAS A;  2OAU A;  4BI4 A;  4PJN A;  4C8Q B;  3BDU A;  1VQ6 A;  3CCE T;  3G4S T;  1RUW A;  1OOT A;  3OYY A;  4OMP A;  2LT1 A;  1K73 U;  3QG1 A;  1VUB A;  4MZT A;  4BDZ A;  5M9O A;  1Q7Y C;  3GBQ A;  2XDB A;  4IUV A;  4PFP A;  3CBM A;  2JZ2 A;  1ZBX A;  1ABQ A;  4OVA A;  1UHF A;  3TU4 K;  1SKU B;  3GPL A;  2CDT A;  4HCK A;  1WGS A;  3J80 E;  2ROT A;  5FU6 C;  1VQ7 T;  3A8H B;  1OUL A;  5LJ5 f;  3UWN A;  2GBQ A;  1YWO A;  5EG2 A;  2K5I A;  2Y4X A;  4BUG A;  1AZE A;  4J5Y A;  5LJ5 e;  1OZ3 A;  2VKN A;  2E4H A;  1YCY A;  4C92 B;  1G5V A;  3CCQ Q;  1MV3 A;  1QVG A;  3QJY A;  2KGT A;  4M78 G;  4ME7 A;  3OY9 A;  3C0C A;  1MV0 B;  5KCO A;  4JLI A;  1I1J A;  4Q5W A;  1LVK A;  3OW2 P;  2A36 A;  5KE3 A;  3DLL A;  2YT6 A;  3VKI A;  1UGP B;  1M30 A;  1VQK A;  3QXE B;  5J3B A; 
#chains in the Genus database with same CATH homology
 4GY5 A;  5I21 A;  1G3W A;  4FU6 A;  3OB9 A;  2K3X A;  5IAY A;  1XNI A;  4JLG A;  1MGQ A;  1QP3 A;  4EMK C;  5LJ5 h;  1Q86 C;  2E41 A;  1XQH A;  1PSE A;  1UEB A;  4X9D A;  2KAF A;  4RKU E;  1VQP A;  1N9R A;  5HKC A;  1NPR A;  4ZGD B;  3OMG A;  3S3O A;  3C12 A;  3JB9 H;  3CCR T;  2QA4 A;  1NJI C;  1KHI A;  2LVM A;  2PVG B;  3M53 A;  3ASK A;  5HK3 A;  4YTL A;  2VXF A;  5GAM g;  2K2V A;  4M75 G;  2JTM A;  2LQK A;  5C0M A;  4DA4 A;  4JRI A;  3OMC A;  5DLO A;  1Y96 A;  2I2L A;  3OS0 A;  3X25 B;  1VQM T;  4C0F A;  3OYJ A;  3FRN A;  2ZPG B;  1Q81 U;  2G3R A;  2XID A;  4M77 C;  4A4K A;  1VQ5 A;  4L5G A;  2WSC E;  1QVF A;  2QQA A;  4M77 D;  2NLU A;  4ZTJ A;  1O9S A;  2DJZ A;  1M1G A;  2LCC A;  3MO8 A;  4J7F A;  1NZ9 A;  5GAN f;  1YIJ A;  1H64 1;  3KBG A;  5IN1 A;  4DQ2 A;  2GQV A;  4M7A G;  5CIU A;  3BFM A;  1I5L A;  4D6W A;  4PLL A;  4NS5 A;  1XTD A;  2DXT A;  2RHI A;  5LJ5 g;  1JJ2 S;  2XDP A;  1LNX A;  2FHD A;  3CME A;  1OI1 A;  3PMI A;  3OYL A;  3OSS C;  3CCM T;  1K73 C;  2JN0 A;  2KMT A;  2RJF A;  4M77 A;  3JB9 J;  2DVE A;  5GAN 8;  2E6Z A;  4LDY A;  4OB1 B;  2IVW A;  1M90 C;  3DB4 A;  3CMA T;  2KDS A;  2O01 E;  4FIB A;  3OYF A;  2M1H A;  3M5A A;  3RIR A;  3CCS T;  3QXE B;  4BDY A;  3AHU A;  2RB6 A;  4JS5 A;  1B34 A;  3A8M B;  3CCL T;  3OW2 A;  4IUR A;  5L8R E;  4DOW A;  1W2B S;  2RA2 A;  3M9Q A;  4FT4 A;  3VJP A;  1HXD A;  2VV5 A;  4ZN3 A;  4XU2 A;  2DXB A;  2P4T A;  3LGF A;  3QJ6 A;  3CBO A;  3M57 A;  4HT9 A;  2F69 A;  2GF7 A;  3M56 A;  4ELY C;  2EKO A;  3CCE A;  2E64 A;  3FDR A;  3FLG A;  4C0D C;  3O8V A;  2HQX A;  4MDW A;  3V7S A;  2BKD N;  2QXF A;  1KQ2 A;  3LWI A;  2OTL T;  3RKY A;  1N8R U;  2YHT A;  2JTF A;  1YJ9 A;  2R5A A;  3CCU A;  3PTA A;  2DTO A;  3V8J A;  2DTH A;  2PUO B;  5LJ3 f;  3A8G B;  3HRS A;  4J6Y A;  2EQU A;  3FB9 A;  3FEO A;  4OGE A;  4OB2 B;  3JB9 I;  1EIF A;  4C8Q F;  3E19 A;  2XU8 A;  1WJR A;  3S6W A;  3M58 A;  2E6N A;  3JRZ A;  5LJ3 e;  3CC4 T;  3S3M A;  3CPW A;  2LNV A;  4M77 E;  3CCQ A;  1O75 A;  2XDD A;  3OBY A;  1VQL T;  4QW2 A;  1V29 B;  2CKK A;  3SD4 A;  5FLX E;  3KUF A;  5IT9 E;  5CKF A;  3CC2 A;  4ATO A;  3VYG A;  5HK0 A;  3HRT A;  1KD1 C;  5D6Y A;  4J6X A;  2RJE A;  1W4S A;  2RM4 A;  4PJO F;  1K8A C;  2RHU A;  4FL6 A;  3HFO A;  2BIV A;  2RJD A;  3JCM f;  5GAM j;  4OMF B;  4BE2 A;  4QVC A;  5GAM e;  2XHC A;  3CPF A;  2EAY A;  1Q82 C;  2RHX A;  3SWN C;  2D6F A;  1JB0 E;  3BY7 A;  5GAN 6;  4NL2 A;  1LOJ A;  3QHS A;  1JRI A;  2AHJ B;  2IG0 A;  3L2Z A;  5GAN g;  3L2V A;  2B8A A;  1YHQ T;  1YIT T;  4N4G A;  1YJW T;  2L5Q A;  2E10 A;  5KCH A;  1YBY A;  5GAO q;  3UT1 A;  4J83 A;  3RER A;  4JRK A;  2DEQ A;  2VC8 A;  3FC3 A;  4F7U A;  3I55 A;  5GAO p;  5CKE A;  2EIF A;  2LCL A;  5A0D A;  2C06 A;  4LD9 K;  5LJ5 j;  4L6V 5;  5LJ3 h;  4EMK B;  3M4Y A;  3LX7 A;  1Y96 B;  3SWN A;  4NL3 A;  4X9C A;  4DOV A;  4IUP A;  1VQ6 T;  4C5H A;  4M7A C;  3CD6 A;  4IUQ A;  5I2M A;  4M7A D;  4C92 F;  2A3L A;  4EMH A;  3JB9 D;  4XTU A;  2A7Y A;  4N0A C;  3URG A;  3CCJ A;  1H3Z A;  1X01 A;  1X75 C;  2X4X A;  3RES A;  5GAM h;  4OGC A;  2X4J A;  2QI2 A;  5GAM d;  4M77 G;  3A8L B;  3MEV A;  2DZC A;  4LDV A;  2CS7 A;  3L42 A;  1G3S A;  2ZPE B;  2RD1 A;  4LDW A;  4XU3 A;  3OYK A;  3WVE B;  5KH6 A;  4M78 F;  1NE8 A;  4M77 B;  3I56 T;  1ZQ1 A;  5D6X A;  4BY6 C;  2V8I A;  1I8F A;  3C4S A;  4N0A A;  4M7D D;  2QEX A;  1YI2 T;  3CXC S;  5J26 A;  1OYX A;  4M7D C;  2E1H A;  2XKO C;  4C5G A;  5DLQ E;  3VU3 C;  5LJ3 g;  5GAO r;  1VQ4 T;  1KC8 C;  4MZP A;  1YJN A;  2WSE E;  4C8Q A;  3A5Z B;  3X28 B;  3P8H A;  5LJ5 d;  2PU9 B;  1BKB A;  3G6E T;  2KSS A;  4M7D A;  4C0G A;  4KUI A;  2VXE A;  3J7A F;  1Q7Y U;  2Y90 A;  1IZ6 A;  2RJC A;  1HK9 A;  3ZEH A;  4PJO A;  4FT2 A;  1XOV A;  2FL7 A;  4KT0 E;  1OZ2 A;  4XU0 A;  1ZHI A;  4NOY A;  3VUZ A;  2CZ7 B;  3QBY A;  2GFA A;  5CQY A;  4LD6 A;  3RKX A;  3ZBD A;  2KK4 A;  3PIP A;  2VUB A;  4EMG A;  1VQ9 A;  4M75 F;  4HCZ A;  1FXX A;  4Z02 A;  2E70 A;  3QZ5 B;  4A4G A;  4L59 A;  4M7A E;  2R57 A;  3QPH A;  3CMA A;  3EFS A;  4C0D B;  3G71 A;  3OQ5 A;  3OYG A;  2JNG A;  2WSF E;  1VQO A;  3LW5 E;  5GAN j;  1VQK T;  1WNL A;  2DTI A;  5GAN e;  1M1K U;  2JVV A;  3SB2 A;  2RI5 A;  4PNO A;  3H6Z A;  3OYD A;  4RCC A;  1KQS S;  4BE1 A;  4HA8 A;  4A54 A;  2MI6 A;  1VQP T;  4M7D E;  1WQW A;  4PKC C;  3ZFJ A;  4QQD A;  1MHN A;  2QA4 T;  4A4E A;  4BAC A;  1QVG S;  2H3J A;  1Y07 A;  4IUT A;  3CC7 T;  3WXM B;  5A0L A;  1KG1 A;  3JCM X;  1DJ7 B;  3UDC A;  3PMT A;  3JCM c;  3UPU A;  4F7U B;  4OF1 A;  2MMP A;  2CGH A;  1BYM A;  1WQ7 A;  4M78 A;  3L2U A;  4MML A;  2PVO B;  3WVD B;  3G4S A;  3SWN B;  4RG8 A;  2X4W A;  2XIC A;  3VYH B;  2K57 A;  3OS1 A;  1YIJ T;  2M0O A;  4E47 A;  2EFI A;  5GAN h;  4R55 A;  3M59 A;  4O5V A;  5GAN d;  4N4H A;  1Q86 U;  2X35 A;  3OBW A;  4P5N A;  4A4H A;  4JUV A;  3CCV T;  5FRO A;  1VIE A;  2DD4 A;  1VQN A;  3TCJ A;  1RI0 A;  5LJ3 j;  2CZ0 B;  3M54 A;  1Y71 A;  3OSV A;  4OP0 A;  2K3Y A;  3CME T;  3JB9 G;  1BI1 A;  1NJI U;  2O4X B;  3NTK A;  4M75 C;  2E5Q A;  4RCB A;  2CYZ B;  4BI8 B;  3JCM V;  3PGG A;  2K5F A;  4M75 D;  1S72 T;  2EQK A;  4M7A B;  2CZ1 B;  1YIT A;  2K5L A;  4IUU A;  4II1 A;  3OYN A;  1UGR B;  3PT9 A;  4EPC A;  2XK0 A;  3QYG B;  3OYH A;  1K9M C;  2BUD A;  3HKS A;  3QUI A;  5GAO m;  2MWP A;  1I4K 1;  1VQ7 A;  3LYI A;  2QDY B;  1LJO A;  2CZ6 B;  3HSB A;  5FRM A;  5CAI A;  3H8Z A;  4M75 A;  1P92 A;  4B9W A;  4M7D G;  3QO3 A;  3JCM e;  2ZPF B;  4PL6 A;  1QVF S;  3C95 A;  1QP2 A;  4Y91 A;  3V7R A;  3GP8 A;  4XTV A;  2E65 A;  4M7D B;  2ZCF B;  3BDL A;  4BY6 B;  2KQW A;  4J7I A;  2EJG A;  1M1F A;  2HD0 A;  2RK2 A;  2FB7 A;  5GMK j;  4HCC A;  3SFM A;  1YJ9 T;  2ZGW A;  2F5K A;  3CCU T;  5CO7 A;  3E9F A;  5GMK e;  3DB3 A;  1M90 U;  1UGS B;  5AYF A;  2HAX A;  5LJ3 d;  2RO0 A;  3R6O A;  2DK3 A;  4BI3 A;  1VQ8 A;  2LQ8 A;  3J81 E;  3N5B B;  2L89 A;  3RUX A;  4ZGE B;  2RHY A;  3JSC A;  2MAM A;  3CCQ T;  3L2R A;  2Y4Y A;  3M4G A;  3M55 A;  2VGM A;  3OS2 A;  2RI3 A;  2OTJ A;  1N27 A;  3CC2 T;  3OW2 S;  2D0Q B;  1Q81 C;  5CKH A;  3TRE A;  2PQW A;  5D6W A;  2P0K A;  1SSF A;  2YLB A;  3DLM A;  2JOY A;  4JDS A;  4J8O A;  5DM7 R;  4LDU A;  4C8Q C;  2FVU A;  3JCM h;  1JJ2 A;  4MDX A;  4JJN K;  4C8Q D;  3JCM d;  4C5E A;  2LC4 A;  3MET A;  3BW1 A;  1WPY A;  4HKE A;  3L2Q A;  3CCR A;  4RG2 A;  4M77 F;  4JS4 A;  2EQJ A;  1JBM A;  2L3R A;  3JCM b;  4V2S A;  3ER0 A;  3VUB A;  2QQR A;  4PJO C;  3QSU A;  5GMK h;  1WJS A;  3FJP A;  4E7I A;  1B34 B;  4PJO D;  2RK1 A;  4F7U E;  2EYQ A;  2X4Y A;  3I55 T;  2HNI A;  4E7L A;  3FIF A;  4TVR A;  1W2B A;  2XD0 A;  1U8R A;  3OYA A;  1VQM A;  1FX7 A;  3CPW S;  3NTH A;  2ZPB B;  3F70 A;  5GAO l;  2M16 A;  1K8A U;  3CD6 T;  2P0P A;  5FU7 C;  3OS5 A;  3OA6 A;  1G3Y A;  4FSX A;  3CCJ T;  2DO3 A;  1Q82 U;  5CK9 A;  2LDM A;  3HL8 A;  4QQG A;  1UB4 A;  3JCM g;  3RKW A;  2VYT A;  4PLI A;  4EDU A;  3CCM A;  1N8R C;  1IRE B;  2DD5 A;  3A8O B;  1U1T A;  3V7C A;  3HFN A;  4O6J A;  3QII A;  3QKJ A;  5GAN 3;  4C92 C;  5CR2 A;  3E9G A;  5CKD A;  3CCS A;  1GXI E;  3HHT B;  4C92 D;  3MHX A;  3NTI A;  2VGN A;  4A4F A;  2QEX T;  2F5T X;  4C5I A;  3CCL A;  2YRV A;  2V8J A;  5GMK i;  3OYB A;  3CC7 A;  3GNG A;  5GAN 4;  4BE0 A;  2EWN A;  2P0Q A;  2RHZ A;  3QZ9 B;  2QQ9 A;  2LRQ A;  3L1A A;  3MCA B;  2DKG A;  4C8Q E;  1YJN T;  4EMK A;  2GFU A;  3P8B B;  3MP1 A;  4QQ6 A;  4M78 C;  4HT8 A;  4M75 B;  4A53 A;  4C92 A;  3GOX A;  4M78 D;  1D3B A;  2QQS A;  3Q1J A;  4RMO A;  4VUB A;  3EAE A;  1WJQ A;  3GLX A;  3QYH B;  2OTL A;  1QW1 A;  2FYK A;  4F7U G;  2QQB A;  3E1S A;  3T9N A;  4PJO E;  5GAN 7;  3X24 B;  5CQX A;  4JRP A;  3MEW A;  4FM4 B;  3CCV A;  3PNW C;  3VV0 A;  3KXT A;  4F7U F;  3CC4 A;  4R56 A;  5GMK m;  4CI0 C;  1VQ9 T;  2L8D A;  3PFS A;  1VQ5 T;  4XK8 E;  1S72 A;  1VQL A;  2PVD B;  2DAQ A;  1KC8 U;  2DIG A;  5CVI A;  3G71 T;  4B9X A;  1PSF A;  1VQO T;  1KQ1 A;  4OB0 B;  5C6S A;  5FRN A;  1U1S A;  3JCM Q;  3V8K A;  1M4Z A;  4MMK A;  4N4I A;  4XTZ A;  1M9S A;  5J39 A;  3OYE A;  3SDZ A;  3G7Z A;  2MF2 A;  3ME9 A;  1BI2 A;  3LWH A;  2EQM A;  4CRI A;  2LT4 A;  2XI9 A;  5LL6 S;  2MWO A;  4MZM A;  1M8V A;  2LX9 A;  4C92 E;  2HBP A;  1YHQ A;  1VIF A;  4M7A F;  1YJW A;  3JB9 F;  1X6O A;  3DKM A;  4X34 A;  4XTX A;  3JCM J;  4IKF A;  3OYC A;  3P8D A;  3EFR A;  3LH0 A;  4ZTF A;  1M5Q 1;  4C8Q G;  4E7H A;  3CXC A;  3LGL A;  4XAX B;  2R58 A;  3RMQ A;  5FU6 B;  2V8K A;  2OAU A;  3NFC A;  3TEE A;  5CCA A;  2DXU A;  2JUF A;  4BI4 A;  4C8Q B;  1QVP A;  4ELZ C;  1BI0 A;  5GAN 2;  2HQE A;  3MEU A;  3BDU A;  4XU1 A;  4M78 E;  3OYM A;  3CCE T;  1VQ6 A;  2DIQ A;  5DY9 A;  4QVD A;  1TH7 A;  4PJO G;  3G4S T;  2DXC A;  3OYY A;  4M7D F;  3INZ A;  1N9S A;  2LT1 A;  1BIA A;  1K73 U;  2ZPH B;  3QG1 A;  1VUB A;  1BI3 A;  4MZT A;  3JAM E;  4UC4 A;  4BDZ A;  4PJO B;  2KY9 A;  3MP8 A;  4XTY A;  1N6A A;  5GAM f;  5M9O A;  4JRQ A;  1Q7Y C;  3OYI A;  2QTX A;  2ZPI B;  2OTJ T;  1VQN T;  4E7K A;  2XDB A;  2KVQ G;  1UGQ B;  1I81 A;  4IUV A;  3CBM A;  1Y7X A;  5GAN 5;  3JCM P;  2JZ2 A;  1ZBX A;  2D9T A;  3I56 A;  4XQ3 A;  4OVA A;  3TU4 K;  4WF2 A;  4LDX A;  1YI2 A;  4KUD K;  4KBM B;  3X20 B;  3GPL A;  1R8O B;  4KUL A;  2LTO A;  5FU7 B;  1WGS A;  3X26 B;  2EJF A;  5KE2 A;  5GMK l;  3J80 E;  3PIO A;  1VQ4 A;  5HY6 A;  5FU6 C;  1VQ7 T;  4HCB A;  3A8H B;  5LJ5 f;  5A0G A;  4C0Z A;  3UWN A;  4BD3 A;  2ZZD A;  5EG2 A;  3MEA A;  2K5I A;  4M75 E;  4C92 G;  3L2W A;  2Y4X A;  4BUG A;  3HPW A;  3G6E A;  2RI2 A;  1KHC A;  5CKB A;  3S3N A;  5A2Q E;  2DZ9 A;  3HRU A;  1OZ3 A;  4J5Y A;  5LJ5 e;  1M1K C;  4OB3 B;  1KQS A;  5GAO n;  1YCY A;  3C94 A;  4C92 B;  4E7J A;  1G5V A;  4GLK A;  1D3B B;  2DPP B;  3JCM W;  2EJ9 A;  4XTW A;  1QVG A;  1FWZ A;  3CEY A;  1BIB A;  3QJY A;  2M9U A;  3GIB A;  3GNF B;  3GF5 A;  3V8L A;  4M78 G;  4ME7 A;  3OY9 A;  2YLC A;  5I2S A;  3QDR B;  2WAC A;  2O4X A;  4ZGJ B;  4ZN1 A;  2PUK B;  5KCO A;  4JLI A;  3HP9 A;  1KD1 U;  3RMS A;  1K9M U;  1VQ8 T;  2R5M A;  4Q5W A;  4M78 B;  1RL2 A;  3LLR A;  4J6W A;  4Y28 E;  2XG8 D;  4M7A A;  1NPP A;  1AHJ B;  2RH2 A;  2K4Y A;  4QVZ A;  4BB7 A;  5KE3 A;  3DLL A;  3VKI A;  1G3T A;  1UGP B;  2E12 A;  3CBP A;  1VQK A;  3MP6 A;  2GCX A;  5J3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...