1D3BB

Crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3)
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 81
sequence length 81
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 1998-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1d3bB00
3L2ZA 4XTWA 2RA2A 4XU3A 3BFMA 4J5YA 3V7RA 4HT9A 4EMKB 2DJZA 4MMLA 4PJOD 4C8QD 2VC8A 3AHUA 4XTUA 1BIAA 4C92C 2EJ9A 4HT8A 4M78B 1I5LA 5GAOr 2ZGWA 2YHTA 4NL2A 1Y96A 3EFRA 1WPYA 4OP0A 3SWNC 2VXEA 5LJ3g 3FB9A 4M78E 3JCMh 5GAN3 4X9DA 3JB9G 2EWNA 3RKXA 4DQ2A 4RCBA 4M77G 2DTOA 2FB7A 2DTHA 3SWNA 5GAOq 4F7UB 5GAN4 1KQ1A 1X01A 5LJ5h 5GAN2 1U1TA 2JN0A 3FJPA 3BDUA 4F7UE 5GAMf 4NOYA 4JUVA 2YLCA 5GAN6 4XTZA 5LJ5d 3M4GA 4C92D 1BIBA 4M7AB 3RERA 4M75F 4EMKC 3JB9I 4EMGA 5GANd 4M78F 4PJOG 4C8QG 3JCMe 4J6YA 4M75C 4QVDA 4M7AE 4M78C 1H641 4N0AC 4M7DB 2DKGA 2DTIA 3GIBA 5GAN7 4M75B 4EMKA 2E64A 5LJ5e 4M7DE 4V2SA 5LJ3f 4PJOC 3JCMW 4M75A 4J6XA 3JCMV 4M75E 2HNIA 3PGGA 4M78A 4N0AA 3SB2A 3V8JA 4F7UF 5GANe 3BW1A 5CAIA 3JCMc 1M5Q1 4EMHA 4J6WA 4RCCA 3JB9J 5LJ5j 4XU0A 2DZ9A 2E10A 1MGQA 3RESA 5GAN5 5GANj 1I81A 3HFOA 2VXFA 5GMKe 3JB9F 3QSUA 4M7AF 4C92G 4HA8A 4F7UA 4M78D 5GANh 4M7AC 3V8LA 4M7DF 5DY9A 1LNXA 1TH7A 1HK9A 2QTXA 4JRIA 3V7CA 5GMKj 1WNLA 3EFSA 4M7DC 5GAMh 1M8VA 4M77B 5GAOm 3JCMg 4M7AA 5GMKh 2Y90A 1WQWA 3RKYA 1N9RA 4JRKA 4M77E 2RD1A 2E1HA 5GAMd 2EAYA 4M7DA 2RM4A 3L1AA 1D3BB 5LJ5g 4XTVA 3JCMJ 2E65A 3RIRA 2I2LA 3V8KA 3HFNA 5GMKm 3RKWA 3BY7A 1LOJA 4A54A 4C8QB 4M7AD 1B34B 5LJ3h 4PJOB 2DZCA 1WQ7A 1I4K1 1I8FA 5GAMe 4M78G 3RUXA 4C8QE 4PJOE 4M7DD 1JBMA 5GAOp 3JCMQ 5GMKi 3JCMP 4XTYA 2DXUA 5LJ3d 4M75D 4M77F 2EJFA 2K57A 4M77C 4XQ3A 5GAMj 3HSBA 3FIFA 4C92F 3INZA 3QO3A 5GAN8 4NL3A 4F7UG 4XU2A 3JCMf 1Y96B 3VU3C 4WF2A 5LJ3e 4X9CA 5GAOl 4M77A 4PNOA 1N9SA 2RB6A 4MMKA 4PJOF 4C92B 2CGHA 4C8QF 5I21A 5LJ5f 2DVEA 4M7AG 3SWNB 1YCYA 4C8QC 4C92A 3QUIA 5GAOn 4C92E 1HXDA 5GANf 3JB9H 5LJ3j 2DEQA 3JCMb 1D3BA 5GANg 1LJOA 4JLIA 3JCMd 3JB9D 3QHSA 4M7DG 1U1SA 1JRIA 1KQ2A 4A53A 2FYKA 2DXTA 5GMKl 4M77D 3JCMX 4M75G 4XTXA 3V7SA 4C8QA 4PJOA 1B34A 5GAMg 2E41A 2EJGA 4XU1A 4Y91A 2YLBA 4QVCA
chains in the Genus database with same CATH superfamily
1BCOA 1M30A 1AD5A 2XG8D 4Y28E 4AFUC 2AZSA 4C5EA 3G6EA 4EMKB 4KGXB 2QEXA 2P4TA 2FVUA 1Y96A 1UFFA 2HQHA 3REBB 2VXEA 1KHCA 1X75C 3U23A 3J80E 1QVPA 1Z9QA 4DOVA 2YUNA 4DEYA 4IUVA 3UPUA 1KQ1A 5GAN2 3QKJA 3VUBA 2EQJA 1UHFA 1KQSA 3DB3A 1PC0A 4A4KA 1PRLC 2OTJT 4QQDA 2ABLA 3OA6A 3CD6T 5M9OA 4L59A 4EMKA 2KRMA 2KT1A 3SD4A 2RF0A 4L6V5 4C5IA 1VQ6T 5GANe 4AG1C 1MMDA 1Y07A 3C94A 2A7YA 1KG1A 1S72T 2CKKA 1VYTA 1K9MR 1AZEA 2RI3A 5GMKe 4PJNA 2KQWA 5DM7R 4C92G 4HA8A 1AT1B 2XD0A 3GP8A 4M7DF 1WZOA 2F1LA 2RHUA 2VGMA 2X3WD 1PD0A 4X34A 2KMTA 4CC7A 2M9UA 1QWFA 5CKBA 3HRTA 4MDXA 1VQPA 3TSZA 3CC7T 5LJ5g 4FW2A 4N4HA 3M0PA 1EIFA 1V1CA 3CCVT 1OPLA 2K5LA 1FWZA 2WACA 3E2UA 2DX1A 2CYZB 4Z88A 1Y0MA 5GAN8 3HL8A 2DILA 4JJBA 3VU3C 3ZBDA 2I0NA 2CP6A 5LJ3e 2GBQA 4DBQA 1PNJA 2M0YA 5FU7C 2LP5A 1UHCA 2A28A 2JMCA 2D6FA 3JCMb 4JLIA 3JB9D 4GBQA 1KQ2A 5GMKl 2JT4A 4QQGA 1BI1A 1FYNA 3G6ET 2QEXT 1ZSZB 4XU3A 4QT7A 4VUBA 2QXFA 1K8AR 2DYIA 1BIAA 3H8ZA 5CKFA 1G3YA 2K3BA 4M78E 3JCMh 4N4IA 5KE2A 2MMPA 2AT1B 1SPKA 1KQSS 3EGUA 3RNJA 2GF7A 3BDUA 1UJ0A 2O31A 4JZ3A 1RABB 5GAN6 3C12A 1GBRA 3CCQQ 2ZPHB 3SDZA 1VQ9Q 4FYXB 1OZ3A 4XK8E 1ZSZA 2RI2A 3PVQA 1AWOA 2DJQA 3VRYA 3CCEA 2HKNA 3V8JA 1OZ2A 3CCUQ 5AT1B 1KD1C 5LJ5j 2LQKA 2QQ9A 2RPNA 1SSFA 1Q7YC 2DL5A 2ZPIB 2DAQA 1MNEA 3CC2Q 3LX7A 1VQ7Q 2E6NA 4LUEA 1VQPT 1B07A 2VB6A 2WSEE 1QMCA 1W1FA 2RD1A 2EQUA 4IKFA 1D3BB 3OS1A 3NMZC 2EKHA 3FRNA 1NBEB 3HFNA 1LOJA 2CP7A 2BTTA 3A1PA 2LZ6B 1TUDA 5GJVB 3EG9B 1V29B 3HSBA 1YITA 2EGEA 3NTHA 3QO3A 1FMWA 3M59A 1F1BB 4WF2A 8AT1B 2PU9B 4WCIA 4RTWA 3TEEA 3JRZA 3OQ5A 4CC2A 2JTEA 3ASKA 3VS6A 4C8QC 3P8DA 4DOWA 1D3BA 3UT1A 4J9BA 1PHTA 2YXYA 1KSWA 4KUIA 2E3IA 1KD1U 4EDUA 1OYXA 1Q7YU 4PLLA 2KNBB 3EG9A 1YCSB 4C8QD 1YI2Q 1I5LA 1V76A 3EAEA 3VS0A 4F17A 2DTOA 3PIPA 1QCOA 3QPHA 2JTMA 4JS4A 3MCAB 5GAMf 4C0ZA 3GNFB 4M7AB 5FU6C 4PJOG 3CCET 4DBRA 1BU1A 3GF5A 4DA4A 1H641 4IIOA 3QZ5B 1XTDA 4J6XA 1U06A 2HL5C 2RHZA 3HTRA 4BI8B 3OYBA 1AWXA 2VWFA 4JDSA 4FIBA 2QQRA 1LVKA 1JJ2P 3UA7A 5DY9A 4M7AA 2QQBA 1T0JA 3F70A 2K5FA 2NUTB 4A4FA 1I4K1 4KT0E 2XDBA 3WXMB 1YITT 1JBMA 5GMKi 1VA7A 4JJDA 2DF6A 1RAGB 2K57A 4E7KA 2VASA 1C0MA 5FWCA 1VIEA 1T0HA 4C8QF 3VS2A 3MP8A 3QYGB 2YUOA 3EH2A 1W2BA 4M7DG 2NUTA 1BBZA 3OS2A 1T3SA 3CCVQ 4FSXA 1KHIA 2X4JA 2CZ0B 1W70A 3NPFA 4MMLA 4XTUA 2QAZA 1X2KA 3SWNC 2BIVA 2VVKA 1A0NB 1RI0A 2FB7A 1VOMA 2G6FX 1MMGA 2DNUA 3OYLA 2CSQA 2DL4A 1QVGA 1QWEA 2QYZA 5LJ5d 4EMGA 3A5ZB 4M75C 4M78C 4RTUA 3CCQA 2DKGA 2FPEA 1VQ9A 2OTLQ 1VQOA 4R55A 3J7AF 4HVWA 1YHQT 3GNGA 3S6WA 3BW1A 2MAMA 3TCJA 2RJCA 1JEGA 1RI9A 5HCKA 3A8HB 2COYA 3CCUA 2JM9A 3RESA 2RJFA 3OYNA 2GTJA 4M78D 1JU5C 4E7ZA 4EIKA 3L2QA 4AG2C 3CC2A 1SG5A 4KGVB 1VQ7A 4LDYA 4M77B 4ANJA 1OX9A 4X1VA 1LCKA 1M8MA 4MZTA 1QCNA 1IREB 1GCQA 3BY7A 3UDCA 3RMSA 2HQXA 2KYMA 1SSHA 1ZUUA 4KBMB 2CP0A 2BE9B 2B86A 1OOTA 1ZQ1A 1XNIA 1Q86C 3CQTA 3VYHB 3VJPA 4JJNK 4X9CA 4M77A 2F2XA 3VV0A 5I21A 2PUKB 4C92A 5GAOn 1I1JA 4OVAA 1LJOA 1NE8A 2K9GA 1U1SA 1WHJA 1E6GA 2O4XB 4BY6C 1OULA 2VKNA 1UG1A 2L8DA 2EGCA 3VYGA 2EQMA 3FLGA 5L8RE 3OMGA 1C1AA 4IUPA 3CXCA 1D0XA 2VC8A 3AHUA 2EJ9A 3KXTA 1BCMA 4OGCA 2Y4XA 4OP0A 2LX7A 5IAYA 4FYYB 1YI2A 3JB9G 1QVGS 3VRZA 2MI6A 1WLPB 3LWIA 4K11A 1ZBXA 4FYVB 3OW2A 3CCST 5LJ5h 1IHVA 3OS0A 1JJ2S 2ZCFB 2CS7A 4J7IA 2YLCA 2FZGB 2O4XA 5KYXB 3CCQT 2SEMA 3WVDB 3P8BB 2CDTA 4LNPA 4M75F 2OAUA 4EMKC 3QXEB 4M78F 1VQOT 2DE0X 4JRPA 2HBWA 4MZPA 1PKSA 4QW2A 3CPWA 1ZUKA 4M7AE 2EIFA 3OBYA 2M16A 3QJYA 2E3HA 2YRDA 4M75B 3UA6A 1P92A 3CCUT 4ZN1A 2EKOA 2LQ8A 3CCLT 1Q86U 2FL7A 3C4SA 1M5Q1 2HMAA 2RQUA 2C0TA 1W4SA 3CC2T 5HKCA 1VQ7T 1N8RC 2PNIA 5KE3A 1WFWA 2AZVA 1TH7A 2KI7A 1XJWB 5I2SA 5KYXA 4BE1A 3TU4K 4J9CA 1CSKA 1K73R 1NEGA 3Q1JA 2KEAA 2A36A 2RQTA 1IO6A 3ZEHA 2CZ7B 2K2MA 2M0OA 3A8GB 1I8FA 3S3OA 5GAOp 3RMQA 2J6FA 3G1JA 4ME7A 4D8DA 3PTAA 2DL8A 3FC3A 1IZ6A 5CQYA 4TVRA 4OMLA 2ESWA 1M1KC 1JQQA 1N9SA 1HD3A 3MP1A 2DETA 3QHSA 4HKEA 2M1HA 2DL3A 3QDFA 4Y91A 1I0CA 3LLRA 2HL3A 3LH0A 2FZCB 1PG5B 2LRQA 3OB9A 4PFOA 4J5YA 1N8RU 3HPWA 5LL6S 3EG1A 4JLGA 1YI2T 2LX9A 2E6ZA 2HQEA 4JJCA 3CCVA 1NJIC 4PFZA 1Y71A 4B9XA 2FZKB 5LJ3g 2LCCA 2HSPA 2CP2A 2LJ0A 2EYXA 2V1QA 5GAN3 2FPDA 2DERA 4RCBA 1Q81C 2JS2A 2XI9A 3MEWA 1WDXA 3CCMQ 1RAEB 1ZSZC 3DKMA 4CC3A 1R8OB 2F2WA 4JS5A 4IUUA 4C8QG 4QVDA 1PD1A 4AFSC 5IHNA 1NZ9A 2OTLA 1MHNA 2QGFB 1M1KU 1WJSA 2E10A 4B9WA 1MGQA 4HCKA 4RTVA 3G4SQ 3HFOA 5GANj 1RUWA 3I56Q 4CC4B 1NLOC 1KC8C 3LYIA 4PJMA 1D1CA 3T9NA 5GMKj 5A2QE 2MPXC 4PJJA 4M77E 3VS4A 2KVQG 1VYVA 1NJIU 3OMCA 1YHQQ 5GAMe 2VUBA 2C06A 2WSFE 3TREA 1Q81U 3E9FA 3CEYA 3FIFA 3SHWA 2RI5A 2DIGA 3JCMf 4E7HA 3JAME 1SHGA 3ER0A 5HY6A 4Z89A 6AT1B 3O5ZA 1HXDA 3UATA 1H3HA 5LJ3j 1M90R 2V8JA 2KT8A 4LDVA 3EG3A 4XTXA 1D1AA 3A98A 2WSCE 1O9SA 2YUPA 4QVCA 1M4ZA 2ATCB 3FDRA 1X2QA 3JV3A 1AWWA 4LXCA 1QW1A 1KC8U 2CSIA 2FHDA 2FG0A 1WPYA 3R6OA 2EYQA 2EWNA 3SEMA 3RKXA 4F7UB 2E5QA 5GJWB 2D0QB 2DVJA 1ABOA 4XTZA 2GQIA 5DLOA 3OYJA 3EFOA 1MNDA 2XU8A 2OTLT 1BI3A 2DLPA 2DTIA 3CCRT 2LCLA 2DK3A 4RTYA 4M75E 1YWOA 3MHXA 1WHKA 2DA9A 1M3CA 1KFZA 1UUEA 4XU0A 1VQ8T 5GAN5 4IUQA 1RAIB 5KYNA 4D8KA 1UJYA 2RHYA 3CCSQ 4F7UA 5A0GA 1D1BA 4M7AC 2QDLA 3X28B 3H41A 4JRIA 2XDDA 1TTHB 1WNLA 1SKUB 2QK0A 1VQOQ 3QZ9B 1AWJA 1N9RA 4JRKA 3TQ7P 2EAYA 3IQLA 1MMNA 5J39A 3CCLQ 2LQNA 4RMOA 1MV0B 4M7AD 2DZCA 2P4RA 1I07A 1NPRA 4M78G 2YUQA 1EFNA 3JCMP 3S3MA 4OMNA 5IN1A 4FT2A 5I2MA 2JM8A 3META 1JXMA 1VQ4A 1Q82C 1GRIA 4MMKA 1QCFA 4F16A 3O8VA 3QYHB 1UGVA 4FSSA 2DEUA 1YJ9Q 3MKDA 5FLXE 1BK2A 2K2VA 4B6MA 1WHMA 3L2ZA 3A8OB 3CPFA 1GFCA 3L2WA 3I55Q 5D6XA 1WJQA 3G71Q 4A63B 4RTTA 4BB7A 4HCBA 5GANd 3CCMA 1K9MC 2RNAA 4RTZA 3E9GA 4Q5WA 1ZUYA 2E64A 3JCMW 1XOVA 2VYTA 2JZ2A 4J6WA 1Q82U 2QTVA 3M5AA 4E47A 7AT1B 4L5GA 1I81A 1TXQA 4M7AF 3BDLA 2HEQA 1S1NA 2F69A 3G4SA 3I56A 2JJ9A 2MWOA 2W0ZA 2J06A 4HVUA 2CH4W 4N4GA 3ZFJA 1GCQC 2X9HA 1QKWA 2P0QA 1X6GA 2XK0A 5CIUA 2M51A 2E65A 2L3SA 5I11A 4OMMA 4C5HA 2K7AA 1BI2A 1LPLA 3RDVA 2K79A 5CO7A 1YHQA 2JXBA 3VKIA 2DXUA 5LJ3d 1G83A 5D7UA 3EGDB 1MMAA 1OX8A 1K76A 1VQ4T 4M77C 3QJ6A 1VYUA 1WXTA 2FRWA 1AEYA 2RHXA 3VS5A 1WHGA 1SRLA 1K9MU 3QDRB 3CBPA 1K8AC 3NTIA 4LDWA 2DXCA 4M77D 1WGSA 4BI3A 1ZX6A 3FEOA 3BFMA 3V7RA 3EGDA 1VQ5Q 1OU9A 2YHTA 3RR6A 2K4YA 2NYSA 3L2VA 4OB2B 2O2OA 4DQ2A 2JUFA 2GNCA 1GL5A 2LT4A 2CP5A 3CCMT 1OU8A 1TG0A 4F7UE 1UGRB 4NOYA 3CCJQ 1HYOA 4ORZA 2XKOC 2NWMA 1H3ZA 5CQXA 2E70A 4AT1B 2P84A 4V2SA 3JCMV 2HNIA 3PGGA 2LNHB 2KAFA 4BE2A 4EMHA 3JB9J 3G4ST 1RLQC 2A37A 3I56T 4D6WA 1AVZC 3C0CA 3GPLA 9ATCB 4PFPA 3JSCA 1K8AU 2XHCA 2JS0A 1LNXA 3CCSA 3OYFA 3EFSA 1JJ2A 4OF1A 5GAOm 2IVWA 4ZTFA 5KYYB 4BDZA 5HK3A 3CCRQ 2LDMA 4ZGEB 1RADB 2I2LA 1AZGB 3OBWA 4E7IA 1YJWQ 5LJ3h 3REAB 1D0YA 3CCLA 1UGPB 3E19A 3M55A 1VQ8Q 4M75D 1ARKA 2JTFA 4M77F 2DIQA 1NM7A 4OB1B 1H92A 4XQ3A 2ED1A 4C92F 2GQVA 2PVGB 1ACMB 4XAXB 3PE0A 3CBMA 3OYMA 5C0MA 2RB6A 4C92B 2CGHA 4JZ4A 4PJLA 5LJ5f 5KYYA 2KGTA 3MEVA 3QUIA 3PMIA 2PQWA 5FWBA 3CMAA 2JVVA 4ELZC 4XU1A 2O9VA 2DL7A 1YJ9A 2DBKA 2RHIA 1X27A 2RA2A 4II1A 3M58A 3L2UA 2IIMA 3UWNA 5A0LA 1JO8A 5FRMA 1D09B 2KROA 4DBFA 2DM1A 3I55A 1WHHA 1X01A 3I5SA 5EG2A 3G71A 1U1TA 1M9SA 2VGNA 3M4GA 1QVFP 3A8MB 1BIBA 1Z9ZA 1NEBA 3JCMe 2RQRA 2YT6A 3TVTA 2DBMA 1TWBA 1TOVA 2RMOA 2CZ6B 3HHTB 2OAWA 2LCSA 5IH2A 1WXBA 1IHWA 2QQSA 2V1RA 3PVLA 4N0AA 4ZGJB 1NPPA 2DRKA 1M1GA 1TUGB 2QDYB 2RH2A 1VUBA 1E7OA 2CT4A 1KJWA 3EG2A 1Y7XA 2QTXA 2RQWA 2MOXA 2HZYA 1M8VA 5J26A 5ECAA 2FRYA 4ZTJA 1Q95G 5KCOA 1SF9A 2O01E 5CK9A 1MUZA 3AT1B 5CKHA 2EW3A 5C6SA 1H8KA 3HKSA 4MZMA 2BZ8A 1YBYA 2H3JA 4FU6A 2QGGA 3QBYA 2DMOA 5EC7A 3FJ5A 1OI1A 2BKDN 2FO0A 2YRCA 5GAOl 3CMAT 2XICA 1UDLA 1VQMQ 2RO0A 4AMCA 4M7AG 5GANg 3BE3A 1YJ9T 3H6ZA 1R0CB 2HAXA 1YIJA 1JRIA 2KYBA 2ZPFB 5GAMg 3NFCA 2CUDA 1WYXA 4OMPA 4O5VA 5CKDA 4XTWA 5KCHA 1B3QA 1M2VA 2LTOA 2GFAA 3G7ZA 2A08A 1VQ4Q 2CP3A 2COZA 2MYSA 3OSVA 2ZGWA 1VQ5A 3I55T 1PCXA 2EVRA 2EQIA 1YJNQ 3G71T 2EQKA 3E1SA 4LUDA 5GAN4 1KQSP 3GLXA 1SEMA 4LD9K 2J05A 4ESRA 3FJPA 1VQLQ 5L23A 3CCJA 2RN8A 2KY9A 3M4YA 4J9EA 1PSEA 3CBOA 4BUGA 1IRXA 3M54A 1K0SA 1WA7A 1AOJA 2V26A 2DZ9A 2KRSA 3M57A 5IXBA 2JW4A 1IGQA 4JRQA 1WXUA 3OYYA 1KD1R 4BACA 4KUDK 3NGPA 1Q7YR 2QQAA 2RM4A 4BDYA 3LGLA 2JOYA 3D7SB 1QKXA 2LC4A 3RKWA 4PJOB 2DD5A 3CCRA 3LGFA 1YJWA 3JCMQ 1ZA1B 2H3EB 2MF2A 5GAMj 1IGUA 4F04B 1VQ8A 3CMEQ 2IG0A 1K1ZA 4J9DA 4XU2A 4R56A 2O88A 2QA4Q 3PIOA 1YIJT 2DVEA 4E7SA 2K6DA 4C0DB 4C92E 2PVDB 1OPKA 3JCMd 2HDAA 3H9NA 2W10A 2FYKA 1X6OA 2D9TA 1QVFS 4PJOA 3H0FA 3MO8A 2EJGA 4J83A 2LJ3A 2P0PA 1BB9A 1MV3A 4C0FA 4PKCC 1VQKT 1UEBA 2OX7A 1J3TA 1VQ5T 2EYWA 4OMQA 1G2BA 2HBPA 2JMAA 3UF4A 4CRIA 1X6BA 1FXXA 5J3BA 4NL2A 3EFRA 4J9GA 1JXOA 4M77G 3KUFA 3DB4A 3MP6A 3CCJT 2XIDA 1OQKA 2EYYA 3EFOB 2EGAA 1VQNQ 3I5RA 5IHKA 1DJ7B 2GGRA 4M7DB 1M3AA 2YWWA 2GCXA 2A0FB 2J6KA 1OEBA 4QQ6A 2ROTA 4F7UF 1GXIE 5AYFA 4IURA 3X26B 3PNWC 2BZYA 1EZZB 4RCCA 1QLYA 5DLQE 1K73C 1PRMC 2Y4YA 2IPOB 2RK2A 3V8LA 2CT3A 3LWHA 1M3BA 2EYZA 4HVVA 2KBTA 2HSEB 5FW9A 2DYBA 2Y90A 4NS5A 2D1XA 4GLMA 4M7DA 2EBPA 2RJEA 3L1AA 2V8KA 4IIMA 2F2VA 1YJWT 1E6HA 2E5KA 3MPUB 2L5QA 2L89A 1RLPC 1WQ7A 3OYDA 4KRTA 3RUXA 2DFUA 4QVZA 1TU0B 4PK4A 2JNGA 3URGA 1BYMA 3EGXB 5CCAA 2GFUA 3VS7A 3QWYA 4JPBW 1D0ZA 2K5IA 2D8JA 2D8HA 2EFIA 2M02A 1CKAA 4F14A 4MDWA 1SRMA 3M0QA 3H0IA 1VQMA 1M27C 1G8XA 1JB0E 2MK5A 2Z0WA 3QG1A 4M75G 3V7SA 1UB4A 2GTOA 2RJDA 1K73U 3VUZA 1HJDA 1RAFB 1RAAB 1ZHIA 4HT9A 2A3LA 5IXFA 3EGXA 1ZLMA 4J9FA 2ZPGB 3ZL7C 3CMAQ 2MWPA 2XMFA 1IB8A 1YJNA 1UTIA 3N5BB 3JB9I 1VQLA 2ENMA 1T3LA 2C0OA 4LD6A 3LW5E 2PTKA 2HKQB 4FM4B 5LJ5e 4LN2A 3A8LB 1KK7A 2KXDA 1G5VA 3JCMc 4E7LA 2COWA 4O6JA 4LDXA 1YP5A 3OSSC 3EHRA 3JB9F 4J9HA 2L3QA 3MEUA 2BE7D 1PSFA 5D6WA 2L3RA 4J7FA 1IXDA 2LJ1A 2E1HA 1X69A 1R0BG 5GAMd 4E2FB 1O75A 1BI0A 1C6VX 2C0IA 4R0KA 1M1FA 3RIRA 1FX7A 5FU7B 5KYWB 2LQWA 2J7IA 3VS1A 4PJOE 1UECA 2XDPA 3CC4Q 1I5OB 2CZ1B 2X4WA 1BKBA 2X3XD 2EJFA 5FROA 1M90C 3R6NA 2L2PA 2L0AA 3CMEA 4LE9A 4Y92A 1VQMT 1W2BP 2QA4A 3GOXA 5GANf 4KULA 3I35A 1Q86R 1U5SA 4OB0B 5KYWA 3QWXX 4WTOB 2LVMA 5IT9E 2CH4A 3GBQA 2BZXA 2YDLA 1G3SA 4OMFB 2X4XA 4IUTA 4OGEA 1QP3A 4C92C 1YJNT 4BI4A 1EX4A 1U3OA 1M2OA 3C95A 2DXBA 3TSWA 1YIJQ 1QP2A 2KSSA 1QVGP 2ZPBB 5GAOq 1VQLT 1G3TA 2KK4A 4C92D 3OYAA 1ZBJA 3RERA 2KDSA 4FYWB 1PM3A 1VQKQ 2NUPB 4FT4A 4ZN3A 4N0AC 4J8OA 1VQNA 2OTJQ 4CI0C 2G3RA 4EPCA 1M90U 4M7DE 3CD6Q 5LJ3f 4RKUE 5CVIA 3SB2A 2HD0A 1VQ6Q 3QIIA 1GFDA 2EPDA 4P5NA 3THKA 1S72Q 2F5TX 1SHFA 2J6OA 3QSUA 2DO3A 2B8AA 3KFVA 5GANh 2QASA 1KIKA 2X51A 4DBHA 1ZA2B 2AIRB 5GAMh 1NG2A 2ZZDA 3JCMg 5GMKh 2NUPA 3OYGA 1N8RR 2BUDA 1HSQA 4XTVA 3JCMJ 1YFNA 2O9SA 2E4HA 4C0GA 4YTLA 3CC7Q 5D6YA 5I22A 1RL2A 4ATOA 4C8QB 1B34B 2ZAEA 1W6XA 1AHJB 2X35A 1PWTA 1YNZA 2LNVA 3CMET 1WIEA 4QKUA 3INZA 3OYKA 4NL3A 4F7UG 2QA4T 2R5AA 2OI3A 1K4US 4PNOA 3M0SA 4RG8A 2SRCA 4C5GA 4UC4A 3JB9H 8ATCB 4A4GA 2DXTA 4DEXA 3SFMA 4C8QA 3ME9A 1B34A 1M1KR 2E41A 1WX6A 2OJ2A 3G6EQ 2QEXQ 2QG9B 3CXCP 2CUBA 1WI7A 4KH0B 5FU6B 3EH1A 5KH6A 4HT8A 2R57A 3DLLA 2FEIA 3M9QA 3OY9A 3L2RA 5CKEA 3OW2P 2QI2A 4E6RA 3OYHA 3OYIA 4AFZC 3M0RA 1GCPA 3P8HA 1NJIR 3DLMA 3PFSA 1VQNT 1WHLA 3CPWP 2YSQA 3VS3A 4J6YA 4HCCA 1Q81R 4J9IA 3X25B 4BE0A 1NYGA 4PL6A 1QQJA 2F5KA 2VXFA 2RQVA 1HK9A 3V7CA 3HRUA 4FL6A 1VQPQ 4Z02A 4E7JA 1W2BS 3RKYA 1TUCA 4A4HA 2DD4A 1G3WA 1N6AA 3L42A 1KC8R 1RACB 2AKKA 2KRNA 5KYUB 4RUGA 2FPFA 3V8KA 4OB3B 4RG2A 3RBBB 4XTYA 2PVOB 3J81E 3CC4A 2KXCA 1Y57A 4Z8AA 2KR3A 4GY5A 2KE9A 1N27A 2MIOA 2YRVA 1U8RA 3SWNB 1RAHB 1YCYA 5HK0A 4PJOC 4FW1A 3NTKA 2DEQA 2DPPB 2R5MA 3MEAA 4A53A 5KYUA 4FCYA 1ABQA 2K3YA 3S3NA 2L3PA 2YLBA 1VQ9T 1M2VB 4ELYC 3HRSA 5FRNA 3X24B 2LT1A 1YN8A 3NHNA 2DJZA 3M56A 4PJOD 4KGZB 4M78B 1K0XA 5GAOr 3OYEA 3X20B 4C0DC 4RTXA 3FB9A 2AHJB 4X9DA 1K9AA 3LH5A 2ZPEB 1B7TA 2DTHA 3SWNA 2R58A 3MJXA 1TSFA 3M0UA 3M53A 2JN0A 3HP9A 4JUVA 4AFQC 3OYCA 3OS5A 2NLUA 4A4EA 2PUOB 4ZNXA 1QVFA 4PLIA 1FMVA 3CCEQ 3GIBA 1VQKA 3PT9A 1ZSGA 1YWPA 2V8IA 1OV3A 4GLKA 4M75A 5GAN7 4M78A 2OTJA 5CAIA 1XQHA 3CD6A 1FMKA 2AKLA 5IHIA 4BD3A 2HCKA 1VQ6A 2D0NA 4KH1B 3I9QA 1S72A 5A0DA 2MCNA 3M0TA 3WVEB 4M7DC 4ZGDB 4M4ZA 1WQWA 2P0KA 1PKTA 2CREA 2E12A 1GBQA 5GMKm 1X43A 4A54A 2ED0A 3H0HA 3CC7A 4HXJA 3CC4T 1VIFA 4C8QE 4M7DD 1TS9A 3CXCS 4BY6B 1NYFA 1YITQ 1N5ZA 3EHQA 2RK1A 2H8HA 1UGSB 1Y96B 2ROLA 1UE9A 3OW2S 4OMOA 4PJOF 5CR2A 1UGQB 2NUZA 2X4YA 3ULRB 1WJRA 2VV5A 2PZ1A 4HCZA 2LMJA 4LDUA 3KBGA 2AK5A 2K3XA 2ECZA 3JCMX 3CPWS 3PMTA 1Q82R 2DRMA 1NLPC 1CKBA 1R77A 3EG0A
chains in the Genus database with same CATH topology
2XG8D 4Y28E 3VYGA 2EQMA 3FLGA 5L8RE 3BFMA 3V7RA 4C5EA 3G6EA 1ZHIA 4EMKB 3OMGA 4HT9A 4IUPA 2QEXA 3CXCA 2A3LA 2VC8A 3AHUA 2EJ9A 2ZPGB 2P4TA 3KXTA 2FVUA 2YHTA 2Y4XA 1Y96A 4OP0A 4OGCA 5IAYA 2K4YA 2VXEA 1KHCA 1X75C 3J80E 1YI2A 3L2VA 2MWPA 3JB9G 1QVGS 4OB2B 2MI6A 1QVPA 4DOVA 4DQ2A 3LWIA 2JUFA 1YJNA 1ZBXA 3OW2A 4IUVA 3CCST 3UPUA 1KQ1A 5LJ5h 3OS0A 1JJ2S 2ZCFB 2LT4A 5GAN2 2CS7A 3CCMT 3QKJA 3VUBA 2EQJA 4F7UE 1UGRB 4NOYA 1KQSA 4J7IA 2YLCA 2O4XA 3DB3A 3CCQT 3WVDB 3N5BB 3P8BB 4M75F 4EMKC 2OAUA 4A4KA 3QXEB 4M78F 3JB9I 1VQOT 4JRPA 1VQLA 4MZPA 4QW2A 4LD6A 2XKOC 3LW5E 3CPWA 4M7AE 2EIFA 3OBYA 2OTJT 4QQDA 3OA6A 2M16A 3CD6T 1H3ZA 5M9OA 3QJYA 2E70A 4FM4B 4L59A 4M75B 5CQXA 3SD4A 1P92A 4EMKA 5LJ5e 4V2SA 3CCUT 4L6V5 4ZN1A 2EKOA 2LQ8A 3A8LB 3JCMV 4C5IA 5GANe 2HNIA 3PGGA 3CCLT 1Q86U 1Y07A 2KAFA 4BE2A 1VQ6T 2FL7A 3C4SA 2A7YA 3C94A 1M5Q1 3JCMc 4EMHA 2CKKA 4E7LA 1S72T 1KG1A 3JB9J 3G4ST 1W4SA 3CC2T 4LDXA 4O6JA 3I56T 3OSSC 5HKCA 4D6WA 3JB9F 2RI3A 5GMKe 1VQ7T 2KQWA 1N8RC 5KE3A 5DM7R 4C92G 4HA8A 2XD0A 3GPLA 3GP8A 3JSCA 1K8AU 4M7DF 2XHCA 1LNXA 1TH7A 3CCSA 2RHUA 2VGMA 3MEUA 4X34A 3OYFA 1PSFA 2KMTA 3EFSA 5I2SA 5D6WA 2L3RA 4OF1A 4BE1A 3TU4K 4J7FA 1JJ2A 5GAOm 2IVWA 4ZTFA 2M9UA 3Q1JA 5CKBA 3HRTA 4MDXA 2E1HA 1VQPA 5GAMd 4BDZA 3CC7T 1O75A 1BI0A 5LJ5g 5HK3A 1M1FA 3RIRA 2CZ7B 3ZEHA 1FX7A 2LDMA 5FU7B 2I2LA 4ZGEB 3OBWA 4E7IA 5LJ3h 4N4HA 2M0OA 3A8GB 1EIFA 1I8FA 4PJOE 3S3OA 3CCLA 2XDPA 5GAOp 1UGPB 3E19A 3CCVT 3RMQA 2K5LA 2WACA 1FWZA 3M55A 4M75D 2JTFA 2CZ1B 2X4WA 4M77F 1BKBA 4ME7A 3PTAA 2DIQA 2EJFA 4OB1B 4XQ3A 5FROA 1M90C 2CYZB 4C92F 3FC3A 1IZ6A 5GAN8 2GQVA 2PVGB 3HL8A 4XAXB 3VU3C 3ZBDA 5CQYA 5LJ3e 4TVRA 3CBMA 3OYMA 3CMEA 1M1KC 1VQMT 5C0MA 3OYKA 1N9SA 2RB6A 4C92B 5FU7C 2CGHA 5LJ5f 2QA4A 3MP1A 3GOXA 3MEVA 3QUIA 3PMIA 5GANf 2D6FA 2PQWA 4KULA 3JCMb 3CMAA 2JVVA 4JLIA 3JB9D 3QHSA 4HKEA 1KQ2A 4OB0B 5GMKl 5IT9E 2LVMA 2M1HA 4QQGA 1BI1A 3G6ET 4ELZC 4XU1A 4Y91A 2QEXT 1YJ9A 3LLRA 3LH0A 1G3SA 2LRQA 2RHIA 3OB9A 4OMFB 2RA2A 4XU3A 4J5YA 4II1A 3HPWA 3M58A 4VUBA 5LL6S 4JLGA 1YI2T 2X4XA 1N8RU 2QXFA 2LX9A 2E6ZA 2HQEA 4IUTA 4OGEA 1QP3A 3UWNA 3L2UA 3CCVA 1BIAA 1NJIC 3H8ZA 4C92C 5A0LA 1Y71A 5CKFA 1G3YA 1YJNT 4B9XA 4BI4A 5LJ3g 2LCCA 5FRMA 4M78E 3C95A 3JCMh 2DXBA 4N4IA 5KE2A 2MMPA 5GAN3 1KQSS 1QP2A 4RCBA 2KSSA 2ZPBB 5GAOq 3I55A 1X01A 1Q81C 1VQLT 5EG2A 3G71A 1U1TA 2XI9A 3MEWA 1G3TA 2GF7A 3BDUA 1M9SA 2VGNA 1GXIE 5GAN6 3C12A 3M4GA 2KK4A 3A8MB 4C92D 1BIBA 3DKMA 1R8OB 3OYAA 4JS5A 3RERA 2ZPHB 4IUUA 3SDZA 4C8QG 2KDSA 3JCMe 4QVDA 4FT4A 1OZ3A 4XK8E 4ZN3A 4N0AC 4J8OA 1VQNA 2RI2A 4CI0C 2G3RA 4EPCA 1M90U 4M7DE 2CZ6B 3HHTB 5LJ3f 3CCEA 4RKUE 5CVIA 2QQSA 3SB2A 3V8JA 1OZ2A 4N0AA 1NZ9A 2OTLA 4ZGJB 1MHNA 2HD0A 3QIIA 1KD1C 4P5NA 5LJ5j 1M1KU 1WJSA 1NPPA 2LQKA 2QQ9A 1SSFA 2F5TX 1M1GA 1Q7YC 2E10A 2QDYB 1MGQA 2RH2A 2ZPIB 2DAQA 3HFOA 4B9WA 5GANj 2DO3A 3QSUA 1VUBA 2B8AA 3LX7A 5GANh 2E6NA 1KC8C 1Y7XA 2QTXA 1VQPT 3LYIA 3T9NA 5GMKj 5GAMh 5J26A 1M8VA 5A2QE 2WSEE 3JCMg 2ZZDA 5GMKh 4M77E 2RD1A 2EQUA 3OYGA 2BUDA 4IKFA 4ZTJA 5KCOA 2O01E 2KVQG 1D3BB 5CK9A 4XTVA 3OS1A 3JCMJ 1NJIU 4C0GA 3FRNA 4YTLA 3OMCA 5D6YA 3HFNA 1RL2A 4ATOA 5CKHA 1LOJA 4C8QB 5C6SA 1B34B 3HKSA 4MZMA 1YBYA 5GAMe 2VUBA 1AHJB 2C06A 2H3JA 4FU6A 2WSFE 3QBYA 2X35A 3TREA 2LNVA 3CMET 1V29B 1Q81U 1OI1A 3HSBA 1YITA 3E9FA 3CEYA 3FIFA 2BKDN 2RI5A 3INZA 3NTHA 3QO3A 4F7UG 4NL3A 3M59A 2DIGA 3JCMf 2QA4T 4E7HA 2R5AA 3JAME 3ER0A 4WF2A 2OTJA 5GAOl 3CMAT 2XICA 4PNOA 2PU9B 3TEEA 3JRZA 3OQ5A 4RG8A 2RO0A 5HY6A 4M7AG 4C5GA 3ASKA 4C8QC 4UC4A 1HXDA 3JB9H 3P8DA 4DOWA 5LJ3j 1D3BA 3UT1A 5GANg 1YJ9T 3H6ZA 4A4GA 2V8JA 2HAXA 4LDVA 1JRIA 1YIJA 2DXTA 3SFMA 4XTXA 2ZPFB 3ME9A 4KUIA 4C8QA 1B34A 5GAMg 2E41A 3NFCA 1KD1U 2WSCE 1O9SA 4EDUA 4QVCA 1M4ZA 1OYXA 1Q7YU 4PLLA 4O5VA 5CKDA 4XTWA 5KCHA 3FDRA 2LTOA 2GFAA 3G7ZA 1QW1A 5FU6B 4C8QD 5KH6A 1KC8U 2FHDA 3OSVA 4HT8A 1I5LA 2R57A 3DLLA 3M9QA 3OY9A 2ZGWA 1VQ5A 3L2RA 3I55T 1WPYA 3R6OA 5CKEA 3G71T 2QI2A 2EYQA 2EWNA 3EAEA 3RKXA 3OYHA 2DTOA 3PIPA 3OYIA 2EQKA 3E1SA 3QPHA 4F7UB 3P8HA 5GAN4 2E5QA 2D0QB 2JTMA 3GLXA 4JS4A 4LD9K 3FJPA 3MCAB 5GAMf 3DLMA 4C0ZA 4XTZA 3PFSA 1VQNT 3GNFB 5DLOA 3OYJA 4M7AB 3CCJA 5FU6C 4PJOG 2KY9A 3M4YA 4J6YA 3CCET 2XU8A 1PSEA 3GF5A 4DA4A 4HCCA 1H641 2OTLT 1BI3A 3CBOA 2DTIA 4BUGA 3M54A 3QZ5B 3CCRT 2LCLA 2DK3A 1XTDA 4J6XA 4M75E 3X25B 3MHXA 4BE0A 2RHZA 4PL6A 4BI8B 3OYBA 4JDSA 4XU0A 1VQ8T 2DZ9A 2F5KA 5GAN5 3M57A 4IUQA 2VXFA 4FIBA 2QQRA 2RHYA 4F7UA 5A0GA 4M7AC 3X28B 4JRQA 3OYYA 5DY9A 1HK9A 4JRIA 2XDDA 3V7CA 3HRUA 4FL6A 1WNLA 4BACA 4Z02A 4KUDK 4M7AA 2QQBA 4E7JA 3QZ9B 2QQAA 1W2BS 3RKYA 4A4HA 1N9RA 4JRKA 2DD4A 3F70A 2EAYA 1G3WA 1N6AA 2RM4A 3L42A 2K5FA 3LGLA 5J39A 4BDYA 2JOYA 3V8KA 4A4FA 4RMOA 4OB3B 2LC4A 3RKWA 4M7AD 4PJOB 4RG2A 2DD5A 2DZCA 3CCRA 1I4K1 4KT0E 2XDBA 1NPRA 4M78G 3WXMB 1YITT 1JBMA 3LGFA 1YJWA 3JCMQ 5GMKi 3S3MA 3JCMP 4XTYA 2PVOB 3J81E 2MF2A 5IN1A 3CC4A 2K57A 5GAMj 1VQ8A 2IG0A 4FT2A 4E7KA 5I2MA 4XU2A 4R56A 4GY5A 3META 1N27A 1VIEA 3PIOA 1VQ4A 1Q82C 4MMKA 4C8QF 1YIJT 2YRVA 1U8RA 2DVEA 3SWNB 1YCYA 5CAIA 3MP8A 3QYGB 4C0DB 4C92E 5HK0A 2PVDB 4PJOC 3O8VA 3NTKA 2DEQA 1W2BA 3QYHB 2DPPB 3JCMd 4M7DG 2R5MA 3MEAA 4A53A 2FYKA 1X6OA 2D9TA 1QVFS 4PJOA 1YHQT 2K3YA 3MO8A 2EJGA 3OS2A 4J83A 3S3NA 2P0PA 5FLXE 4C0FA 4PKCC 2YLBA 1VQKT 1UEBA 1VQ9T 2K2VA 4ELYC 3HRSA 3L2ZA 1KHIA 3A8OB 4FSXA 1VQ5T 5FRNA 2X4JA 3X24B 2HBPA 2LT1A 2CZ0B 2DJZA 3M56A 4MMLA 4PJOD 4CRIA 4XTUA 1FXXA 3CPFA 4M78B 5J3BA 5GAOr 4NL2A 3SWNC 3EFRA 3OYEA 3X20B 4C0DC 3FB9A 2AHJB 3L2WA 2BIVA 4X9DA 5D6XA 1WJQA 1RI0A 2ZPEB 4M77G 2FB7A 2DTHA 3SWNA 3KUFA 2R58A 3DB4A 3MP6A 3OYLA 3CCJT 4BB7A 3M53A 2JN0A 1QVGA 3HP9A 4JUVA 2XIDA 5LJ5d 3OYCA 3OS5A 4HCBA 2NLUA 4A4EA 4EMGA 2PUOB 5GANd 3CCMA 3A5ZB 1QVFA 1DJ7B 1K9MC 4M75C 3E9GA 4M78C 4PLIA 4Q5WA 4M7DB 3CCQA 2DKGA 3GIBA 1VQKA 2GCXA 1VQ9A 2E64A 3PT9A 1VQOA 4R55A 2V8IA 3J7AF 4GLKA 4M75A 4QQ6A 3JCMW 5GAN7 4M78A 3GNGA 4F7UF 1XOVA 5AYFA 4IURA 3S6WA 3BW1A 2MAMA 1XQHA 3X26B 3TCJA 2RJCA 3PNWC 2VYTA 2JZ2A 4J6WA 4RCCA 5DLQE 3M5AA 1Q82U 1K73C 3A8HB 2Y4YA 3CCUA 4BD3A 4E47A 1VQ6A 3RESA 2RJFA 4L5GA 1I81A 3OYNA 3CD6A 4M7AF 2RK2A 3BDLA 1S72A 4M78D 3V8LA 3LWHA 2F69A 3G4SA 5A0DA 3L2QA 3CC2A 3WVEB 3I56A 1VQ7A 2MWOA 4M7DC 4LDYA 4ZGDB 4M77B 3ZFJA 4N4GA 2Y90A 1WQWA 4NS5A 2P0QA 2P0KA 4M7DA 2XK0A 2RJEA 5CIUA 3L1AA 2V8KA 4MZTA 1IREB 2E65A 2E12A 1YJWT 4C5HA 1BI2A 5GMKm 3BY7A 4A54A 3UDCA 2L5QA 3RMSA 2HQXA 2L89A 1WQ7A 3CC7A 3OYDA 3CC4T 1VIFA 3RUXA 4C8QE 5CO7A 4M7DD 1YHQA 4QVZA 4KBMB 3VKIA 3CXCS 2DXUA 5LJ3d 4BY6B 2JNGA 3URGA 1ZQ1A 1VQ4T 4M77C 1BYMA 3QJ6A 1XNIA 2RK1A 5CCAA 1Q86C 2GFUA 1UGSB 1Y96B 3VYHB 1G5VA 3VJPA 4JJNK 4X9CA 3OW2S 4M77A 2K5IA 2RHXA 4PJOF 3VV0A 5I21A 1UGQB 5CR2A 2X4YA 1K9MU 2PUKB 3QDRB 2EFIA 1WJRA 2VV5A 3CBPA 4C92A 5GAOn 4MDWA 4OVAA 1LJOA 1NE8A 1VQMA 4HCZA 3KBGA 1JB0E 1U1SA 2K3XA 4LDUA 3JCMX 1K8AC 2O4XB 3NTIA 2DXCA 3QG1A 4LDWA 4M77D 4M75G 3V7SA 1UB4A 4BY6C 3CPWS 1WGSA 3PMTA 4BI3A 1K73U 2RJDA 3FEOA 3VUZA 2L8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2Z A;  4XTW A;  2RA2 A;  4XU3 A;  3BFM A;  4J5Y A;  3V7R A;  4HT9 A;  4EMK B;  2DJZ A;  4MML A;  4PJO D;  4C8Q D;  2VC8 A;  3AHU A;  4XTU A;  1BIA A;  4C92 C;  2EJ9 A;  4HT8 A;  4M78 B;  1I5L A;  5GAO r;  2ZGW A;  2YHT A;  4NL2 A;  1Y96 A;  3EFR A;  1WPY A;  4OP0 A;  3SWN C;  2VXE A;  5LJ3 g;  3FB9 A;  4M78 E;  3JCM h;  5GAN 3;  4X9D A;  3JB9 G;  2EWN A;  3RKX A;  4DQ2 A;  4RCB A;  4M77 G;  2DTO A;  2FB7 A;  2DTH A;  3SWN A;  5GAO q;  4F7U B;  5GAN 4;  1KQ1 A;  1X01 A;  5LJ5 h;  5GAN 2;  1U1T A;  2JN0 A;  3FJP A;  3BDU A;  4F7U E;  5GAM f;  4NOY A;  4JUV A;  2YLC A;  5GAN 6;  4XTZ A;  5LJ5 d;  3M4G A;  4C92 D;  1BIB A;  4M7A B;  3RER A;  4M75 F;  4EMK C;  3JB9 I;  4EMG A;  5GAN d;  4M78 F;  4PJO G;  4C8Q G;  3JCM e;  4J6Y A;  4M75 C;  4QVD A;  4M7A E;  4M78 C;  1H64 1;  4N0A C;  4M7D B;  2DKG A;  2DTI A;  3GIB A;  5GAN 7;  4M75 B;  4EMK A;  2E64 A;  5LJ5 e;  4M7D E;  4V2S A;  5LJ3 f;  4PJO C;  3JCM W;  4M75 A;  4J6X A;  3JCM V;  4M75 E;  2HNI A;  3PGG A;  4M78 A;  4N0A A;  3SB2 A;  3V8J A;  4F7U F;  5GAN e;  3BW1 A;  5CAI A;  3JCM c;  1M5Q 1;  4EMH A;  4J6W A;  4RCC A;  3JB9 J;  5LJ5 j;  4XU0 A;  2DZ9 A;  2E10 A;  1MGQ A;  3RES A;  5GAN 5;  5GAN j;  1I81 A;  3HFO A;  2VXF A;  5GMK e;  3JB9 F;  3QSU A;  4M7A F;  4C92 G;  4HA8 A;  4F7U A;  4M78 D;  5GAN h;  4M7A C;  3V8L A;  4M7D F;  5DY9 A;  1LNX A;  1TH7 A;  1HK9 A;  2QTX A;  4JRI A;  3V7C A;  5GMK j;  1WNL A;  3EFS A;  4M7D C;  5GAM h;  1M8V A;  4M77 B;  5GAO m;  3JCM g;  4M7A A;  5GMK h;  2Y90 A;  1WQW A;  3RKY A;  1N9R A;  4JRK A;  4M77 E;  2RD1 A;  2E1H A;  5GAM d;  2EAY A;  4M7D A;  2RM4 A;  3L1A A;  1D3B B;  5LJ5 g;  4XTV A;  3JCM J;  2E65 A;  3RIR A;  2I2L A;  3V8K A;  3HFN A;  5GMK m;  3RKW A;  3BY7 A;  1LOJ A;  4A54 A;  4C8Q B;  4M7A D;  1B34 B;  5LJ3 h;  4PJO B;  2DZC A;  1WQ7 A;  1I4K 1;  1I8F A;  5GAM e;  4M78 G;  3RUX A;  4C8Q E;  4PJO E;  4M7D D;  1JBM A;  5GAO p;  3JCM Q;  5GMK i;  3JCM P;  4XTY A;  2DXU A;  5LJ3 d;  4M75 D;  4M77 F;  2EJF A;  2K57 A;  4M77 C;  4XQ3 A;  5GAM j;  3HSB A;  3FIF A;  4C92 F;  3INZ A;  3QO3 A;  5GAN 8;  4NL3 A;  4F7U G;  4XU2 A;  3JCM f;  1Y96 B;  3VU3 C;  4WF2 A;  5LJ3 e;  4X9C A;  5GAO l;  4M77 A;  4PNO A;  1N9S A;  2RB6 A;  4MMK A;  4PJO F;  4C92 B;  2CGH A;  4C8Q F;  5I21 A;  5LJ5 f;  2DVE A;  4M7A G;  3SWN B;  1YCY A;  4C8Q C;  4C92 A;  3QUI A;  5GAO n;  4C92 E;  1HXD A;  5GAN f;  3JB9 H;  5LJ3 j;  2DEQ A;  3JCM b;  1D3B A;  5GAN g;  1LJO A;  4JLI A;  3JCM d;  3JB9 D;  3QHS A;  4M7D G;  1U1S A;  1JRI A;  1KQ2 A;  4A53 A;  2FYK A;  2DXT A;  5GMK l;  4M77 D;  3JCM X;  4M75 G;  4XTX A;  3V7S A;  4C8Q A;  4PJO A;  1B34 A;  5GAM g;  2E41 A;  2EJG A;  4XU1 A;  4Y91 A;  2YLB A;  4QVC A; 
#chains in the Genus database with same CATH topology
 1BCO A;  1M30 A;  1AD5 A;  2XG8 D;  4Y28 E;  4AFU C;  2AZS A;  4C5E A;  3G6E A;  4EMK B;  4KGX B;  2QEX A;  2P4T A;  2FVU A;  1Y96 A;  1UFF A;  2HQH A;  3REB B;  2VXE A;  1KHC A;  1X75 C;  3U23 A;  3J80 E;  1QVP A;  1Z9Q A;  4DOV A;  2YUN A;  4DEY A;  4IUV A;  3UPU A;  1KQ1 A;  5GAN 2;  3QKJ A;  3VUB A;  2EQJ A;  1UHF A;  1KQS A;  3DB3 A;  1PC0 A;  4A4K A;  1PRL C;  2OTJ T;  4QQD A;  2ABL A;  3OA6 A;  3CD6 T;  5M9O A;  4L59 A;  4EMK A;  2KRM A;  2KT1 A;  3SD4 A;  2RF0 A;  4L6V 5;  4C5I A;  1VQ6 T;  5GAN e;  4AG1 C;  1MMD A;  1Y07 A;  3C94 A;  2A7Y A;  1KG1 A;  1S72 T;  2CKK A;  1VYT A;  1K9M R;  1AZE A;  2RI3 A;  5GMK e;  4PJN A;  2KQW A;  5DM7 R;  4C92 G;  4HA8 A;  1AT1 B;  2XD0 A;  3GP8 A;  4M7D F;  1WZO A;  2F1L A;  2RHU A;  2VGM A;  2X3W D;  1PD0 A;  4X34 A;  2KMT A;  4CC7 A;  2M9U A;  1QWF A;  5CKB A;  3HRT A;  4MDX A;  1VQP A;  3TSZ A;  3CC7 T;  5LJ5 g;  4FW2 A;  4N4H A;  3M0P A;  1EIF A;  1V1C A;  3CCV T;  1OPL A;  2K5L A;  1FWZ A;  2WAC A;  3E2U A;  2DX1 A;  2CYZ B;  4Z88 A;  1Y0M A;  5GAN 8;  3HL8 A;  2DIL A;  4JJB A;  3VU3 C;  3ZBD A;  2I0N A;  2CP6 A;  5LJ3 e;  2GBQ A;  4DBQ A;  1PNJ A;  2M0Y A;  5FU7 C;  2LP5 A;  1UHC A;  2A28 A;  2JMC A;  2D6F A;  3JCM b;  4JLI A;  3JB9 D;  4GBQ A;  1KQ2 A;  5GMK l;  2JT4 A;  4QQG A;  1BI1 A;  1FYN A;  3G6E T;  2QEX T;  1ZSZ B;  4XU3 A;  4QT7 A;  4VUB A;  2QXF A;  1K8A R;  2DYI A;  1BIA A;  3H8Z A;  5CKF A;  1G3Y A;  2K3B A;  4M78 E;  3JCM h;  4N4I A;  5KE2 A;  2MMP A;  2AT1 B;  1SPK A;  1KQS S;  3EGU A;  3RNJ A;  2GF7 A;  3BDU A;  1UJ0 A;  2O31 A;  4JZ3 A;  1RAB B;  5GAN 6;  3C12 A;  1GBR A;  3CCQ Q;  2ZPH B;  3SDZ A;  1VQ9 Q;  4FYX B;  1OZ3 A;  4XK8 E;  1ZSZ A;  2RI2 A;  3PVQ A;  1AWO A;  2DJQ A;  3VRY A;  3CCE A;  2HKN A;  3V8J A;  1OZ2 A;  3CCU Q;  5AT1 B;  1KD1 C;  5LJ5 j;  2LQK A;  2QQ9 A;  2RPN A;  1SSF A;  1Q7Y C;  2DL5 A;  2ZPI B;  2DAQ A;  1MNE A;  3CC2 Q;  3LX7 A;  1VQ7 Q;  2E6N A;  4LUE A;  1VQP T;  1B07 A;  2VB6 A;  2WSE E;  1QMC A;  1W1F A;  2RD1 A;  2EQU A;  4IKF A;  1D3B B;  3OS1 A;  3NMZ C;  2EKH A;  3FRN A;  1NBE B;  3HFN A;  1LOJ A;  2CP7 A;  2BTT A;  3A1P A;  2LZ6 B;  1TUD A;  5GJV B;  3EG9 B;  1V29 B;  3HSB A;  1YIT A;  2EGE A;  3NTH A;  3QO3 A;  1FMW A;  3M59 A;  1F1B B;  4WF2 A;  8AT1 B;  2PU9 B;  4WCI A;  4RTW A;  3TEE A;  3JRZ A;  3OQ5 A;  4CC2 A;  2JTE A;  3ASK A;  3VS6 A;  4C8Q C;  3P8D A;  4DOW A;  1D3B A;  3UT1 A;  4J9B A;  1PHT A;  2YXY A;  1KSW A;  4KUI A;  2E3I A;  1KD1 U;  4EDU A;  1OYX A;  1Q7Y U;  4PLL A;  2KNB B;  3EG9 A;  1YCS B;  4C8Q D;  1YI2 Q;  1I5L A;  1V76 A;  3EAE A;  3VS0 A;  4F17 A;  2DTO A;  3PIP A;  1QCO A;  3QPH A;  2JTM A;  4JS4 A;  3MCA B;  5GAM f;  4C0Z A;  3GNF B;  4M7A B;  5FU6 C;  4PJO G;  3CCE T;  4DBR A;  1BU1 A;  3GF5 A;  4DA4 A;  1H64 1;  4IIO A;  3QZ5 B;  1XTD A;  4J6X A;  1U06 A;  2HL5 C;  2RHZ A;  3HTR A;  4BI8 B;  3OYB A;  1AWX A;  2VWF A;  4JDS A;  4FIB A;  2QQR A;  1LVK A;  1JJ2 P;  3UA7 A;  5DY9 A;  4M7A A;  2QQB A;  1T0J A;  3F70 A;  2K5F A;  2NUT B;  4A4F A;  1I4K 1;  4KT0 E;  2XDB A;  3WXM B;  1YIT T;  1JBM A;  5GMK i;  1VA7 A;  4JJD A;  2DF6 A;  1RAG B;  2K57 A;  4E7K A;  2VAS A;  1C0M A;  5FWC A;  1VIE A;  1T0H A;  4C8Q F;  3VS2 A;  3MP8 A;  3QYG B;  2YUO A;  3EH2 A;  1W2B A;  4M7D G;  2NUT A;  1BBZ A;  3OS2 A;  1T3S A;  3CCV Q;  4FSX A;  1KHI A;  2X4J A;  2CZ0 B;  1W70 A;  3NPF A;  4MML A;  4XTU A;  2QAZ A;  1X2K A;  3SWN C;  2BIV A;  2VVK A;  1A0N B;  1RI0 A;  2FB7 A;  1VOM A;  2G6F X;  1MMG A;  2DNU A;  3OYL A;  2CSQ A;  2DL4 A;  1QVG A;  1QWE A;  2QYZ A;  5LJ5 d;  4EMG A;  3A5Z B;  4M75 C;  4M78 C;  4RTU A;  3CCQ A;  2DKG A;  2FPE A;  1VQ9 A;  2OTL Q;  1VQO A;  4R55 A;  3J7A F;  4HVW A;  1YHQ T;  3GNG A;  3S6W A;  3BW1 A;  2MAM A;  3TCJ A;  2RJC A;  1JEG A;  1RI9 A;  5HCK A;  3A8H B;  2COY A;  3CCU A;  2JM9 A;  3RES A;  2RJF A;  3OYN A;  2GTJ A;  4M78 D;  1JU5 C;  4E7Z A;  4EIK A;  3L2Q A;  4AG2 C;  3CC2 A;  1SG5 A;  4KGV B;  1VQ7 A;  4LDY A;  4M77 B;  4ANJ A;  1OX9 A;  4X1V A;  1LCK A;  1M8M A;  4MZT A;  1QCN A;  1IRE B;  1GCQ A;  3BY7 A;  3UDC A;  3RMS A;  2HQX A;  2KYM A;  1SSH A;  1ZUU A;  4KBM B;  2CP0 A;  2BE9 B;  2B86 A;  1OOT A;  1ZQ1 A;  1XNI A;  1Q86 C;  3CQT A;  3VYH B;  3VJP A;  4JJN K;  4X9C A;  4M77 A;  2F2X A;  3VV0 A;  5I21 A;  2PUK B;  4C92 A;  5GAO n;  1I1J A;  4OVA A;  1LJO A;  1NE8 A;  2K9G A;  1U1S A;  1WHJ A;  1E6G A;  2O4X B;  4BY6 C;  1OUL A;  2VKN A;  1UG1 A;  2L8D A;  2EGC A;  3VYG A;  2EQM A;  3FLG A;  5L8R E;  3OMG A;  1C1A A;  4IUP A;  3CXC A;  1D0X A;  2VC8 A;  3AHU A;  2EJ9 A;  3KXT A;  1BCM A;  4OGC A;  2Y4X A;  4OP0 A;  2LX7 A;  5IAY A;  4FYY B;  1YI2 A;  3JB9 G;  1QVG S;  3VRZ A;  2MI6 A;  1WLP B;  3LWI A;  4K11 A;  1ZBX A;  4FYV B;  3OW2 A;  3CCS T;  5LJ5 h;  1IHV A;  3OS0 A;  1JJ2 S;  2ZCF B;  2CS7 A;  4J7I A;  2YLC A;  2FZG B;  2O4X A;  5KYX B;  3CCQ T;  2SEM A;  3WVD B;  3P8B B;  2CDT A;  4LNP A;  4M75 F;  2OAU A;  4EMK C;  3QXE B;  4M78 F;  1VQO T;  2DE0 X;  4JRP A;  2HBW A;  4MZP A;  1PKS A;  4QW2 A;  3CPW A;  1ZUK A;  4M7A E;  2EIF A;  3OBY A;  2M16 A;  3QJY A;  2E3H A;  2YRD A;  4M75 B;  3UA6 A;  1P92 A;  3CCU T;  4ZN1 A;  2EKO A;  2LQ8 A;  3CCL T;  1Q86 U;  2FL7 A;  3C4S A;  1M5Q 1;  2HMA A;  2RQU A;  2C0T A;  1W4S A;  3CC2 T;  5HKC A;  1VQ7 T;  1N8R C;  2PNI A;  5KE3 A;  1WFW A;  2AZV A;  1TH7 A;  2KI7 A;  1XJW B;  5I2S A;  5KYX A;  4BE1 A;  3TU4 K;  4J9C A;  1CSK A;  1K73 R;  1NEG A;  3Q1J A;  2KEA A;  2A36 A;  2RQT A;  1IO6 A;  3ZEH A;  2CZ7 B;  2K2M A;  2M0O A;  3A8G B;  1I8F A;  3S3O A;  5GAO p;  3RMQ A;  2J6F A;  3G1J A;  4ME7 A;  4D8D A;  3PTA A;  2DL8 A;  3FC3 A;  1IZ6 A;  5CQY A;  4TVR A;  4OML A;  2ESW A;  1M1K C;  1JQQ A;  1N9S A;  1HD3 A;  3MP1 A;  2DET A;  3QHS A;  4HKE A;  2M1H A;  2DL3 A;  3QDF A;  4Y91 A;  1I0C A;  3LLR A;  2HL3 A;  3LH0 A;  2FZC B;  1PG5 B;  2LRQ A;  3OB9 A;  4PFO A;  4J5Y A;  1N8R U;  3HPW A;  5LL6 S;  3EG1 A;  4JLG A;  1YI2 T;  2LX9 A;  2E6Z A;  2HQE A;  4JJC A;  3CCV A;  1NJI C;  4PFZ A;  1Y71 A;  4B9X A;  2FZK B;  5LJ3 g;  2LCC A;  2HSP A;  2CP2 A;  2LJ0 A;  2EYX A;  2V1Q A;  5GAN 3;  2FPD A;  2DER A;  4RCB A;  1Q81 C;  2JS2 A;  2XI9 A;  3MEW A;  1WDX A;  3CCM Q;  1RAE B;  1ZSZ C;  3DKM A;  4CC3 A;  1R8O B;  2F2W A;  4JS5 A;  4IUU A;  4C8Q G;  4QVD A;  1PD1 A;  4AFS C;  5IHN A;  1NZ9 A;  2OTL A;  1MHN A;  2QGF B;  1M1K U;  1WJS A;  2E10 A;  4B9W A;  1MGQ A;  4HCK A;  4RTV A;  3G4S Q;  3HFO A;  5GAN j;  1RUW A;  3I56 Q;  4CC4 B;  1NLO C;  1KC8 C;  3LYI A;  4PJM A;  1D1C A;  3T9N A;  5GMK j;  5A2Q E;  2MPX C;  4PJJ A;  4M77 E;  3VS4 A;  2KVQ G;  1VYV A;  1NJI U;  3OMC A;  1YHQ Q;  5GAM e;  2VUB A;  2C06 A;  2WSF E;  3TRE A;  1Q81 U;  3E9F A;  3CEY A;  3FIF A;  3SHW A;  2RI5 A;  2DIG A;  3JCM f;  4E7H A;  3JAM E;  1SHG A;  3ER0 A;  5HY6 A;  4Z89 A;  6AT1 B;  3O5Z A;  1HXD A;  3UAT A;  1H3H A;  5LJ3 j;  1M90 R;  2V8J A;  2KT8 A;  4LDV A;  3EG3 A;  4XTX A;  1D1A A;  3A98 A;  2WSC E;  1O9S A;  2YUP A;  4QVC A;  1M4Z A;  2ATC B;  3FDR A;  1X2Q A;  3JV3 A;  1AWW A;  4LXC A;  1QW1 A;  1KC8 U;  2CSI A;  2FHD A;  2FG0 A;  1WPY A;  3R6O A;  2EYQ A;  2EWN A;  3SEM A;  3RKX A;  4F7U B;  2E5Q A;  5GJW B;  2D0Q B;  2DVJ A;  1ABO A;  4XTZ A;  2GQI A;  5DLO A;  3OYJ A;  3EFO A;  1MND A;  2XU8 A;  2OTL T;  1BI3 A;  2DLP A;  2DTI A;  3CCR T;  2LCL A;  2DK3 A;  4RTY A;  4M75 E;  1YWO A;  3MHX A;  1WHK A;  2DA9 A;  1M3C A;  1KFZ A;  1UUE A;  4XU0 A;  1VQ8 T;  5GAN 5;  4IUQ A;  1RAI B;  5KYN A;  4D8K A;  1UJY A;  2RHY A;  3CCS Q;  4F7U A;  5A0G A;  1D1B A;  4M7A C;  2QDL A;  3X28 B;  3H41 A;  4JRI A;  2XDD A;  1TTH B;  1WNL A;  1SKU B;  2QK0 A;  1VQO Q;  3QZ9 B;  1AWJ A;  1N9R A;  4JRK A;  3TQ7 P;  2EAY A;  3IQL A;  1MMN A;  5J39 A;  3CCL Q;  2LQN A;  4RMO A;  1MV0 B;  4M7A D;  2DZC A;  2P4R A;  1I07 A;  1NPR A;  4M78 G;  2YUQ A;  1EFN A;  3JCM P;  3S3M A;  4OMN A;  5IN1 A;  4FT2 A;  5I2M A;  2JM8 A;  3MET A;  1JXM A;  1VQ4 A;  1Q82 C;  1GRI A;  4MMK A;  1QCF A;  4F16 A;  3O8V A;  3QYH B;  1UGV A;  4FSS A;  2DEU A;  1YJ9 Q;  3MKD A;  5FLX E;  1BK2 A;  2K2V A;  4B6M A;  1WHM A;  3L2Z A;  3A8O B;  3CPF A;  1GFC A;  3L2W A;  3I55 Q;  5D6X A;  1WJQ A;  3G71 Q;  4A63 B;  4RTT A;  4BB7 A;  4HCB A;  5GAN d;  3CCM A;  1K9M C;  2RNA A;  4RTZ A;  3E9G A;  4Q5W A;  1ZUY A;  2E64 A;  3JCM W;  1XOV A;  2VYT A;  2JZ2 A;  4J6W A;  1Q82 U;  2QTV A;  3M5A A;  4E47 A;  7AT1 B;  4L5G A;  1I81 A;  1TXQ A;  4M7A F;  3BDL A;  2HEQ A;  1S1N A;  2F69 A;  3G4S A;  3I56 A;  2JJ9 A;  2MWO A;  2W0Z A;  2J06 A;  4HVU A;  2CH4 W;  4N4G A;  3ZFJ A;  1GCQ C;  2X9H A;  1QKW A;  2P0Q A;  1X6G A;  2XK0 A;  5CIU A;  2M51 A;  2E65 A;  2L3S A;  5I11 A;  4OMM A;  4C5H A;  2K7A A;  1BI2 A;  1LPL A;  3RDV A;  2K79 A;  5CO7 A;  1YHQ A;  2JXB A;  3VKI A;  2DXU A;  5LJ3 d;  1G83 A;  5D7U A;  3EGD B;  1MMA A;  1OX8 A;  1K76 A;  1VQ4 T;  4M77 C;  3QJ6 A;  1VYU A;  1WXT A;  2FRW A;  1AEY A;  2RHX A;  3VS5 A;  1WHG A;  1SRL A;  1K9M U;  3QDR B;  3CBP A;  1K8A C;  3NTI A;  4LDW A;  2DXC A;  4M77 D;  1WGS A;  4BI3 A;  1ZX6 A;  3FEO A;  3BFM A;  3V7R A;  3EGD A;  1VQ5 Q;  1OU9 A;  2YHT A;  3RR6 A;  2K4Y A;  2NYS A;  3L2V A;  4OB2 B;  2O2O A;  4DQ2 A;  2JUF A;  2GNC A;  1GL5 A;  2LT4 A;  2CP5 A;  3CCM T;  1OU8 A;  1TG0 A;  4F7U E;  1UGR B;  4NOY A;  3CCJ Q;  1HYO A;  4ORZ A;  2XKO C;  2NWM A;  1H3Z A;  5CQX A;  2E70 A;  4AT1 B;  2P84 A;  4V2S A;  3JCM V;  2HNI A;  3PGG A;  2LNH B;  2KAF A;  4BE2 A;  4EMH A;  3JB9 J;  3G4S T;  1RLQ C;  2A37 A;  3I56 T;  4D6W A;  1AVZ C;  3C0C A;  3GPL A;  9ATC B;  4PFP A;  3JSC A;  1K8A U;  2XHC A;  2JS0 A;  1LNX A;  3CCS A;  3OYF A;  3EFS A;  1JJ2 A;  4OF1 A;  5GAO m;  2IVW A;  4ZTF A;  5KYY B;  4BDZ A;  5HK3 A;  3CCR Q;  2LDM A;  4ZGE B;  1RAD B;  2I2L A;  1AZG B;  3OBW A;  4E7I A;  1YJW Q;  5LJ3 h;  3REA B;  1D0Y A;  3CCL A;  1UGP B;  3E19 A;  3M55 A;  1VQ8 Q;  4M75 D;  1ARK A;  2JTF A;  4M77 F;  2DIQ A;  1NM7 A;  4OB1 B;  1H92 A;  4XQ3 A;  2ED1 A;  4C92 F;  2GQV A;  2PVG B;  1ACM B;  4XAX B;  3PE0 A;  3CBM A;  3OYM A;  5C0M A;  2RB6 A;  4C92 B;  2CGH A;  4JZ4 A;  4PJL A;  5LJ5 f;  5KYY A;  2KGT A;  3MEV A;  3QUI A;  3PMI A;  2PQW A;  5FWB A;  3CMA A;  2JVV A;  4ELZ C;  4XU1 A;  2O9V A;  2DL7 A;  1YJ9 A;  2DBK A;  2RHI A;  1X27 A;  2RA2 A;  4II1 A;  3M58 A;  3L2U A;  2IIM A;  3UWN A;  5A0L A;  1JO8 A;  5FRM A;  1D09 B;  2KRO A;  4DBF A;  2DM1 A;  3I55 A;  1WHH A;  1X01 A;  3I5S A;  5EG2 A;  3G71 A;  1U1T A;  1M9S A;  2VGN A;  3M4G A;  1QVF P;  3A8M B;  1BIB A;  1Z9Z A;  1NEB A;  3JCM e;  2RQR A;  2YT6 A;  3TVT A;  2DBM A;  1TWB A;  1TOV A;  2RMO A;  2CZ6 B;  3HHT B;  2OAW A;  2LCS A;  5IH2 A;  1WXB A;  1IHW A;  2QQS A;  2V1R A;  3PVL A;  4N0A A;  4ZGJ B;  1NPP A;  2DRK A;  1M1G A;  1TUG B;  2QDY B;  2RH2 A;  1VUB A;  1E7O A;  2CT4 A;  1KJW A;  3EG2 A;  1Y7X A;  2QTX A;  2RQW A;  2MOX A;  2HZY A;  1M8V A;  5J26 A;  5ECA A;  2FRY A;  4ZTJ A;  1Q95 G;  5KCO A;  1SF9 A;  2O01 E;  5CK9 A;  1MUZ A;  3AT1 B;  5CKH A;  2EW3 A;  5C6S A;  1H8K A;  3HKS A;  4MZM A;  2BZ8 A;  1YBY A;  2H3J A;  4FU6 A;  2QGG A;  3QBY A;  2DMO A;  5EC7 A;  3FJ5 A;  1OI1 A;  2BKD N;  2FO0 A;  2YRC A;  5GAO l;  3CMA T;  2XIC A;  1UDL A;  1VQM Q;  2RO0 A;  4AMC A;  4M7A G;  5GAN g;  3BE3 A;  1YJ9 T;  3H6Z A;  1R0C B;  2HAX A;  1YIJ A;  1JRI A;  2KYB A;  2ZPF B;  5GAM g;  3NFC A;  2CUD A;  1WYX A;  4OMP A;  4O5V A;  5CKD A;  4XTW A;  5KCH A;  1B3Q A;  1M2V A;  2LTO A;  2GFA A;  3G7Z A;  2A08 A;  1VQ4 Q;  2CP3 A;  2COZ A;  2MYS A;  3OSV A;  2ZGW A;  1VQ5 A;  3I55 T;  1PCX A;  2EVR A;  2EQI A;  1YJN Q;  3G71 T;  2EQK A;  3E1S A;  4LUD A;  5GAN 4;  1KQS P;  3GLX A;  1SEM A;  4LD9 K;  2J05 A;  4ESR A;  3FJP A;  1VQL Q;  5L23 A;  3CCJ A;  2RN8 A;  2KY9 A;  3M4Y A;  4J9E A;  1PSE A;  3CBO A;  4BUG A;  1IRX A;  3M54 A;  1K0S A;  1WA7 A;  1AOJ A;  2V26 A;  2DZ9 A;  2KRS A;  3M57 A;  5IXB A;  2JW4 A;  1IGQ A;  4JRQ A;  1WXU A;  3OYY A;  1KD1 R;  4BAC A;  4KUD K;  3NGP A;  1Q7Y R;  2QQA A;  2RM4 A;  4BDY A;  3LGL A;  2JOY A;  3D7S B;  1QKX A;  2LC4 A;  3RKW A;  4PJO B;  2DD5 A;  3CCR A;  3LGF A;  1YJW A;  3JCM Q;  1ZA1 B;  2H3E B;  2MF2 A;  5GAM j;  1IGU A;  4F04 B;  1VQ8 A;  3CME Q;  2IG0 A;  1K1Z A;  4J9D A;  4XU2 A;  4R56 A;  2O88 A;  2QA4 Q;  3PIO A;  1YIJ T;  2DVE A;  4E7S A;  2K6D A;  4C0D B;  4C92 E;  2PVD B;  1OPK A;  3JCM d;  2HDA A;  3H9N A;  2W10 A;  2FYK A;  1X6O A;  2D9T A;  1QVF S;  4PJO A;  3H0F A;  3MO8 A;  2EJG A;  4J83 A;  2LJ3 A;  2P0P A;  1BB9 A;  1MV3 A;  4C0F A;  4PKC C;  1VQK T;  1UEB A;  2OX7 A;  1J3T A;  1VQ5 T;  2EYW A;  4OMQ A;  1G2B A;  2HBP A;  2JMA A;  3UF4 A;  4CRI A;  1X6B A;  1FXX A;  5J3B A;  4NL2 A;  3EFR A;  4J9G A;  1JXO A;  4M77 G;  3KUF A;  3DB4 A;  3MP6 A;  3CCJ T;  2XID A;  1OQK A;  2EYY A;  3EFO B;  2EGA A;  1VQN Q;  3I5R A;  5IHK A;  1DJ7 B;  2GGR A;  4M7D B;  1M3A A;  2YWW A;  2GCX A;  2A0F B;  2J6K A;  1OEB A;  4QQ6 A;  2ROT A;  4F7U F;  1GXI E;  5AYF A;  4IUR A;  3X26 B;  3PNW C;  2BZY A;  1EZZ B;  4RCC A;  1QLY A;  5DLQ E;  1K73 C;  1PRM C;  2Y4Y A;  2IPO B;  2RK2 A;  3V8L A;  2CT3 A;  3LWH A;  1M3B A;  2EYZ A;  4HVV A;  2KBT A;  2HSE B;  5FW9 A;  2DYB A;  2Y90 A;  4NS5 A;  2D1X A;  4GLM A;  4M7D A;  2EBP A;  2RJE A;  3L1A A;  2V8K A;  4IIM A;  2F2V A;  1YJW T;  1E6H A;  2E5K A;  3MPU B;  2L5Q A;  2L89 A;  1RLP C;  1WQ7 A;  3OYD A;  4KRT A;  3RUX A;  2DFU A;  4QVZ A;  1TU0 B;  4PK4 A;  2JNG A;  3URG A;  1BYM A;  3EGX B;  5CCA A;  2GFU A;  3VS7 A;  3QWY A;  4JPB W;  1D0Z A;  2K5I A;  2D8J A;  2D8H A;  2EFI A;  2M02 A;  1CKA A;  4F14 A;  4MDW A;  1SRM A;  3M0Q A;  3H0I A;  1VQM A;  1M27 C;  1G8X A;  1JB0 E;  2MK5 A;  2Z0W A;  3QG1 A;  4M75 G;  3V7S A;  1UB4 A;  2GTO A;  2RJD A;  1K73 U;  3VUZ A;  1HJD A;  1RAF B;  1RAA B;  1ZHI A;  4HT9 A;  2A3L A;  5IXF A;  3EGX A;  1ZLM A;  4J9F A;  2ZPG B;  3ZL7 C;  3CMA Q;  2MWP A;  2XMF A;  1IB8 A;  1YJN A;  1UTI A;  3N5B B;  3JB9 I;  1VQL A;  2ENM A;  1T3L A;  2C0O A;  4LD6 A;  3LW5 E;  2PTK A;  2HKQ B;  4FM4 B;  5LJ5 e;  4LN2 A;  3A8L B;  1KK7 A;  2KXD A;  1G5V A;  3JCM c;  4E7L A;  2COW A;  4O6J A;  4LDX A;  1YP5 A;  3OSS C;  3EHR A;  3JB9 F;  4J9H A;  2L3Q A;  3MEU A;  2BE7 D;  1PSF A;  5D6W A;  2L3R A;  4J7F A;  1IXD A;  2LJ1 A;  2E1H A;  1X69 A;  1R0B G;  5GAM d;  4E2F B;  1O75 A;  1BI0 A;  1C6V X;  2C0I A;  4R0K A;  1M1F A;  3RIR A;  1FX7 A;  5FU7 B;  5KYW B;  2LQW A;  2J7I A;  3VS1 A;  4PJO E;  1UEC A;  2XDP A;  3CC4 Q;  1I5O B;  2CZ1 B;  2X4W A;  1BKB A;  2X3X D;  2EJF A;  5FRO A;  1M90 C;  3R6N A;  2L2P A;  2L0A A;  3CME A;  4LE9 A;  4Y92 A;  1VQM T;  1W2B P;  2QA4 A;  3GOX A;  5GAN f;  4KUL A;  3I35 A;  1Q86 R;  1U5S A;  4OB0 B;  5KYW A;  3QWX X;  4WTO B;  2LVM A;  5IT9 E;  2CH4 A;  3GBQ A;  2BZX A;  2YDL A;  1G3S A;  4OMF B;  2X4X A;  4IUT A;  4OGE A;  1QP3 A;  4C92 C;  1YJN T;  4BI4 A;  1EX4 A;  1U3O A;  1M2O A;  3C95 A;  2DXB A;  3TSW A;  1YIJ Q;  1QP2 A;  2KSS A;  1QVG P;  2ZPB B;  5GAO q;  1VQL T;  1G3T A;  2KK4 A;  4C92 D;  3OYA A;  1ZBJ A;  3RER A;  2KDS A;  4FYW B;  1PM3 A;  1VQK Q;  2NUP B;  4FT4 A;  4ZN3 A;  4N0A C;  4J8O A;  1VQN A;  2OTJ Q;  4CI0 C;  2G3R A;  4EPC A;  1M90 U;  4M7D E;  3CD6 Q;  5LJ3 f;  4RKU E;  5CVI A;  3SB2 A;  2HD0 A;  1VQ6 Q;  3QII A;  1GFD A;  2EPD A;  4P5N A;  3THK A;  1S72 Q;  2F5T X;  1SHF A;  2J6O A;  3QSU A;  2DO3 A;  2B8A A;  3KFV A;  5GAN h;  2QAS A;  1KIK A;  2X51 A;  4DBH A;  1ZA2 B;  2AIR B;  5GAM h;  1NG2 A;  2ZZD A;  3JCM g;  5GMK h;  2NUP A;  3OYG A;  1N8R R;  2BUD A;  1HSQ A;  4XTV A;  3JCM J;  1YFN A;  2O9S A;  2E4H A;  4C0G A;  4YTL A;  3CC7 Q;  5D6Y A;  5I22 A;  1RL2 A;  4ATO A;  4C8Q B;  1B34 B;  2ZAE A;  1W6X A;  1AHJ B;  2X35 A;  1PWT A;  1YNZ A;  2LNV A;  3CME T;  1WIE A;  4QKU A;  3INZ A;  3OYK A;  4NL3 A;  4F7U G;  2QA4 T;  2R5A A;  2OI3 A;  1K4U S;  4PNO A;  3M0S A;  4RG8 A;  2SRC A;  4C5G A;  4UC4 A;  3JB9 H;  8ATC B;  4A4G A;  2DXT A;  4DEX A;  3SFM A;  4C8Q A;  3ME9 A;  1B34 A;  1M1K R;  2E41 A;  1WX6 A;  2OJ2 A;  3G6E Q;  2QEX Q;  2QG9 B;  3CXC P;  2CUB A;  1WI7 A;  4KH0 B;  5FU6 B;  3EH1 A;  5KH6 A;  4HT8 A;  2R57 A;  3DLL A;  2FEI A;  3M9Q A;  3OY9 A;  3L2R A;  5CKE A;  3OW2 P;  2QI2 A;  4E6R A;  3OYH A;  3OYI A;  4AFZ C;  3M0R A;  1GCP A;  3P8H A;  1NJI R;  3DLM A;  3PFS A;  1VQN T;  1WHL A;  3CPW P;  2YSQ A;  3VS3 A;  4J6Y A;  4HCC A;  1Q81 R;  4J9I A;  3X25 B;  4BE0 A;  1NYG A;  4PL6 A;  1QQJ A;  2F5K A;  2VXF A;  2RQV A;  1HK9 A;  3V7C A;  3HRU A;  4FL6 A;  1VQP Q;  4Z02 A;  4E7J A;  1W2B S;  3RKY A;  1TUC A;  4A4H A;  2DD4 A;  1G3W A;  1N6A A;  3L42 A;  1KC8 R;  1RAC B;  2AKK A;  2KRN A;  5KYU B;  4RUG A;  2FPF A;  3V8K A;  4OB3 B;  4RG2 A;  3RBB B;  4XTY A;  2PVO B;  3J81 E;  3CC4 A;  2KXC A;  1Y57 A;  4Z8A A;  2KR3 A;  4GY5 A;  2KE9 A;  1N27 A;  2MIO A;  2YRV A;  1U8R A;  3SWN B;  1RAH B;  1YCY A;  5HK0 A;  4PJO C;  4FW1 A;  3NTK A;  2DEQ A;  2DPP B;  2R5M A;  3MEA A;  4A53 A;  5KYU A;  4FCY A;  1ABQ A;  2K3Y A;  3S3N A;  2L3P A;  2YLB A;  1VQ9 T;  1M2V B;  4ELY C;  3HRS A;  5FRN A;  3X24 B;  2LT1 A;  1YN8 A;  3NHN A;  2DJZ A;  3M56 A;  4PJO D;  4KGZ B;  4M78 B;  1K0X A;  5GAO r;  3OYE A;  3X20 B;  4C0D C;  4RTX A;  3FB9 A;  2AHJ B;  4X9D A;  1K9A A;  3LH5 A;  2ZPE B;  1B7T A;  2DTH A;  3SWN A;  2R58 A;  3MJX A;  1TSF A;  3M0U A;  3M53 A;  2JN0 A;  3HP9 A;  4JUV A;  4AFQ C;  3OYC A;  3OS5 A;  2NLU A;  4A4E A;  2PUO B;  4ZNX A;  1QVF A;  4PLI A;  1FMV A;  3CCE Q;  3GIB A;  1VQK A;  3PT9 A;  1ZSG A;  1YWP A;  2V8I A;  1OV3 A;  4GLK A;  4M75 A;  5GAN 7;  4M78 A;  2OTJ A;  5CAI A;  1XQH A;  3CD6 A;  1FMK A;  2AKL A;  5IHI A;  4BD3 A;  2HCK A;  1VQ6 A;  2D0N A;  4KH1 B;  3I9Q A;  1S72 A;  5A0D A;  2MCN A;  3M0T A;  3WVE B;  4M7D C;  4ZGD B;  4M4Z A;  1WQW A;  2P0K A;  1PKT A;  2CRE A;  2E12 A;  1GBQ A;  5GMK m;  1X43 A;  4A54 A;  2ED0 A;  3H0H A;  3CC7 A;  4HXJ A;  3CC4 T;  1VIF A;  4C8Q E;  4M7D D;  1TS9 A;  3CXC S;  4BY6 B;  1NYF A;  1YIT Q;  1N5Z A;  3EHQ A;  2RK1 A;  2H8H A;  1UGS B;  1Y96 B;  2ROL A;  1UE9 A;  3OW2 S;  4OMO A;  4PJO F;  5CR2 A;  1UGQ B;  2NUZ A;  2X4Y A;  3ULR B;  1WJR A;  2VV5 A;  2PZ1 A;  4HCZ A;  2LMJ A;  4LDU A;  3KBG A;  2AK5 A;  2K3X A;  2ECZ A;  3JCM X;  3CPW S;  3PMT A;  1Q82 R;  2DRM A;  1NLP C;  1CKB A;  1R77 A;  3EG0 A; 
#chains in the Genus database with same CATH homology
 2XG8 D;  4Y28 E;  3VYG A;  2EQM A;  3FLG A;  5L8R E;  3BFM A;  3V7R A;  4C5E A;  3G6E A;  1ZHI A;  4EMK B;  3OMG A;  4HT9 A;  4IUP A;  2QEX A;  3CXC A;  2A3L A;  2VC8 A;  3AHU A;  2EJ9 A;  2ZPG B;  2P4T A;  3KXT A;  2FVU A;  2YHT A;  2Y4X A;  1Y96 A;  4OP0 A;  4OGC A;  5IAY A;  2K4Y A;  2VXE A;  1KHC A;  1X75 C;  3J80 E;  1YI2 A;  3L2V A;  2MWP A;  3JB9 G;  1QVG S;  4OB2 B;  2MI6 A;  1QVP A;  4DOV A;  4DQ2 A;  3LWI A;  2JUF A;  1YJN A;  1ZBX A;  3OW2 A;  4IUV A;  3CCS T;  3UPU A;  1KQ1 A;  5LJ5 h;  3OS0 A;  1JJ2 S;  2ZCF B;  2LT4 A;  5GAN 2;  2CS7 A;  3CCM T;  3QKJ A;  3VUB A;  2EQJ A;  4F7U E;  1UGR B;  4NOY A;  1KQS A;  4J7I A;  2YLC A;  2O4X A;  3DB3 A;  3CCQ T;  3WVD B;  3N5B B;  3P8B B;  4M75 F;  4EMK C;  2OAU A;  4A4K A;  3QXE B;  4M78 F;  3JB9 I;  1VQO T;  4JRP A;  1VQL A;  4MZP A;  4QW2 A;  4LD6 A;  2XKO C;  3LW5 E;  3CPW A;  4M7A E;  2EIF A;  3OBY A;  2OTJ T;  4QQD A;  3OA6 A;  2M16 A;  3CD6 T;  1H3Z A;  5M9O A;  3QJY A;  2E70 A;  4FM4 B;  4L59 A;  4M75 B;  5CQX A;  3SD4 A;  1P92 A;  4EMK A;  5LJ5 e;  4V2S A;  3CCU T;  4L6V 5;  4ZN1 A;  2EKO A;  2LQ8 A;  3A8L B;  3JCM V;  4C5I A;  5GAN e;  2HNI A;  3PGG A;  3CCL T;  1Q86 U;  1Y07 A;  2KAF A;  4BE2 A;  1VQ6 T;  2FL7 A;  3C4S A;  2A7Y A;  3C94 A;  1M5Q 1;  3JCM c;  4EMH A;  2CKK A;  4E7L A;  1S72 T;  1KG1 A;  3JB9 J;  3G4S T;  1W4S A;  3CC2 T;  4LDX A;  4O6J A;  3I56 T;  3OSS C;  5HKC A;  4D6W A;  3JB9 F;  2RI3 A;  5GMK e;  1VQ7 T;  2KQW A;  1N8R C;  5KE3 A;  5DM7 R;  4C92 G;  4HA8 A;  2XD0 A;  3GPL A;  3GP8 A;  3JSC A;  1K8A U;  4M7D F;  2XHC A;  1LNX A;  1TH7 A;  3CCS A;  2RHU A;  2VGM A;  3MEU A;  4X34 A;  3OYF A;  1PSF A;  2KMT A;  3EFS A;  5I2S A;  5D6W A;  2L3R A;  4OF1 A;  4BE1 A;  3TU4 K;  4J7F A;  1JJ2 A;  5GAO m;  2IVW A;  4ZTF A;  2M9U A;  3Q1J A;  5CKB A;  3HRT A;  4MDX A;  2E1H A;  1VQP A;  5GAM d;  4BDZ A;  3CC7 T;  1O75 A;  1BI0 A;  5LJ5 g;  5HK3 A;  1M1F A;  3RIR A;  2CZ7 B;  3ZEH A;  1FX7 A;  2LDM A;  5FU7 B;  2I2L A;  4ZGE B;  3OBW A;  4E7I A;  5LJ3 h;  4N4H A;  2M0O A;  3A8G B;  1EIF A;  1I8F A;  4PJO E;  3S3O A;  3CCL A;  2XDP A;  5GAO p;  1UGP B;  3E19 A;  3CCV T;  3RMQ A;  2K5L A;  2WAC A;  1FWZ A;  3M55 A;  4M75 D;  2JTF A;  2CZ1 B;  2X4W A;  4M77 F;  1BKB A;  4ME7 A;  3PTA A;  2DIQ A;  2EJF A;  4OB1 B;  4XQ3 A;  5FRO A;  1M90 C;  2CYZ B;  4C92 F;  3FC3 A;  1IZ6 A;  5GAN 8;  2GQV A;  2PVG B;  3HL8 A;  4XAX B;  3VU3 C;  3ZBD A;  5CQY A;  5LJ3 e;  4TVR A;  3CBM A;  3OYM A;  3CME A;  1M1K C;  1VQM T;  5C0M A;  3OYK A;  1N9S A;  2RB6 A;  4C92 B;  5FU7 C;  2CGH A;  5LJ5 f;  2QA4 A;  3MP1 A;  3GOX A;  3MEV A;  3QUI A;  3PMI A;  5GAN f;  2D6F A;  2PQW A;  4KUL A;  3JCM b;  3CMA A;  2JVV A;  4JLI A;  3JB9 D;  3QHS A;  4HKE A;  1KQ2 A;  4OB0 B;  5GMK l;  5IT9 E;  2LVM A;  2M1H A;  4QQG A;  1BI1 A;  3G6E T;  4ELZ C;  4XU1 A;  4Y91 A;  2QEX T;  1YJ9 A;  3LLR A;  3LH0 A;  1G3S A;  2LRQ A;  2RHI A;  3OB9 A;  4OMF B;  2RA2 A;  4XU3 A;  4J5Y A;  4II1 A;  3HPW A;  3M58 A;  4VUB A;  5LL6 S;  4JLG A;  1YI2 T;  2X4X A;  1N8R U;  2QXF A;  2LX9 A;  2E6Z A;  2HQE A;  4IUT A;  4OGE A;  1QP3 A;  3UWN A;  3L2U A;  3CCV A;  1BIA A;  1NJI C;  3H8Z A;  4C92 C;  5A0L A;  1Y71 A;  5CKF A;  1G3Y A;  1YJN T;  4B9X A;  4BI4 A;  5LJ3 g;  2LCC A;  5FRM A;  4M78 E;  3C95 A;  3JCM h;  2DXB A;  4N4I A;  5KE2 A;  2MMP A;  5GAN 3;  1KQS S;  1QP2 A;  4RCB A;  2KSS A;  2ZPB B;  5GAO q;  3I55 A;  1X01 A;  1Q81 C;  1VQL T;  5EG2 A;  3G71 A;  1U1T A;  2XI9 A;  3MEW A;  1G3T A;  2GF7 A;  3BDU A;  1M9S A;  2VGN A;  1GXI E;  5GAN 6;  3C12 A;  3M4G A;  2KK4 A;  3A8M B;  4C92 D;  1BIB A;  3DKM A;  1R8O B;  3OYA A;  4JS5 A;  3RER A;  2ZPH B;  4IUU A;  3SDZ A;  4C8Q G;  2KDS A;  3JCM e;  4QVD A;  4FT4 A;  1OZ3 A;  4XK8 E;  4ZN3 A;  4N0A C;  4J8O A;  1VQN A;  2RI2 A;  4CI0 C;  2G3R A;  4EPC A;  1M90 U;  4M7D E;  2CZ6 B;  3HHT B;  5LJ3 f;  3CCE A;  4RKU E;  5CVI A;  2QQS A;  3SB2 A;  3V8J A;  1OZ2 A;  4N0A A;  1NZ9 A;  2OTL A;  4ZGJ B;  1MHN A;  2HD0 A;  3QII A;  1KD1 C;  4P5N A;  5LJ5 j;  1M1K U;  1WJS A;  1NPP A;  2LQK A;  2QQ9 A;  1SSF A;  2F5T X;  1M1G A;  1Q7Y C;  2E10 A;  2QDY B;  1MGQ A;  2RH2 A;  2ZPI B;  2DAQ A;  3HFO A;  4B9W A;  5GAN j;  2DO3 A;  3QSU A;  1VUB A;  2B8A A;  3LX7 A;  5GAN h;  2E6N A;  1KC8 C;  1Y7X A;  2QTX A;  1VQP T;  3LYI A;  3T9N A;  5GMK j;  5GAM h;  5J26 A;  1M8V A;  5A2Q E;  2WSE E;  3JCM g;  2ZZD A;  5GMK h;  4M77 E;  2RD1 A;  2EQU A;  3OYG A;  2BUD A;  4IKF A;  4ZTJ A;  5KCO A;  2O01 E;  2KVQ G;  1D3B B;  5CK9 A;  4XTV A;  3OS1 A;  3JCM J;  1NJI U;  4C0G A;  3FRN A;  4YTL A;  3OMC A;  5D6Y A;  3HFN A;  1RL2 A;  4ATO A;  5CKH A;  1LOJ A;  4C8Q B;  5C6S A;  1B34 B;  3HKS A;  4MZM A;  1YBY A;  5GAM e;  2VUB A;  1AHJ B;  2C06 A;  2H3J A;  4FU6 A;  2WSF E;  3QBY A;  2X35 A;  3TRE A;  2LNV A;  3CME T;  1V29 B;  1Q81 U;  1OI1 A;  3HSB A;  1YIT A;  3E9F A;  3CEY A;  3FIF A;  2BKD N;  2RI5 A;  3INZ A;  3NTH A;  3QO3 A;  4F7U G;  4NL3 A;  3M59 A;  2DIG A;  3JCM f;  2QA4 T;  4E7H A;  2R5A A;  3JAM E;  3ER0 A;  4WF2 A;  2OTJ A;  5GAO l;  3CMA T;  2XIC A;  4PNO A;  2PU9 B;  3TEE A;  3JRZ A;  3OQ5 A;  4RG8 A;  2RO0 A;  5HY6 A;  4M7A G;  4C5G A;  3ASK A;  4C8Q C;  4UC4 A;  1HXD A;  3JB9 H;  3P8D A;  4DOW A;  5LJ3 j;  1D3B A;  3UT1 A;  5GAN g;  1YJ9 T;  3H6Z A;  4A4G A;  2V8J A;  2HAX A;  4LDV A;  1JRI A;  1YIJ A;  2DXT A;  3SFM A;  4XTX A;  2ZPF B;  3ME9 A;  4KUI A;  4C8Q A;  1B34 A;  5GAM g;  2E41 A;  3NFC A;  1KD1 U;  2WSC E;  1O9S A;  4EDU A;  4QVC A;  1M4Z A;  1OYX A;  1Q7Y U;  4PLL A;  4O5V A;  5CKD A;  4XTW A;  5KCH A;  3FDR A;  2LTO A;  2GFA A;  3G7Z A;  1QW1 A;  5FU6 B;  4C8Q D;  5KH6 A;  1KC8 U;  2FHD A;  3OSV A;  4HT8 A;  1I5L A;  2R57 A;  3DLL A;  3M9Q A;  3OY9 A;  2ZGW A;  1VQ5 A;  3L2R A;  3I55 T;  1WPY A;  3R6O A;  5CKE A;  3G71 T;  2QI2 A;  2EYQ A;  2EWN A;  3EAE A;  3RKX A;  3OYH A;  2DTO A;  3PIP A;  3OYI A;  2EQK A;  3E1S A;  3QPH A;  4F7U B;  3P8H A;  5GAN 4;  2E5Q A;  2D0Q B;  2JTM A;  3GLX A;  4JS4 A;  4LD9 K;  3FJP A;  3MCA B;  5GAM f;  3DLM A;  4C0Z A;  4XTZ A;  3PFS A;  1VQN T;  3GNF B;  5DLO A;  3OYJ A;  4M7A B;  3CCJ A;  5FU6 C;  4PJO G;  2KY9 A;  3M4Y A;  4J6Y A;  3CCE T;  2XU8 A;  1PSE A;  3GF5 A;  4DA4 A;  4HCC A;  1H64 1;  2OTL T;  1BI3 A;  3CBO A;  2DTI A;  4BUG A;  3M54 A;  3QZ5 B;  3CCR T;  2LCL A;  2DK3 A;  1XTD A;  4J6X A;  4M75 E;  3X25 B;  3MHX A;  4BE0 A;  2RHZ A;  4PL6 A;  4BI8 B;  3OYB A;  4JDS A;  4XU0 A;  1VQ8 T;  2DZ9 A;  2F5K A;  5GAN 5;  3M57 A;  4IUQ A;  2VXF A;  4FIB A;  2QQR A;  2RHY A;  4F7U A;  5A0G A;  4M7A C;  3X28 B;  4JRQ A;  3OYY A;  5DY9 A;  1HK9 A;  4JRI A;  2XDD A;  3V7C A;  3HRU A;  4FL6 A;  1WNL A;  4BAC A;  4Z02 A;  4KUD K;  4M7A A;  2QQB A;  4E7J A;  3QZ9 B;  2QQA A;  1W2B S;  3RKY A;  4A4H A;  1N9R A;  4JRK A;  2DD4 A;  3F70 A;  2EAY A;  1G3W A;  1N6A A;  2RM4 A;  3L42 A;  2K5F A;  3LGL A;  5J39 A;  4BDY A;  2JOY A;  3V8K A;  4A4F A;  4RMO A;  4OB3 B;  2LC4 A;  3RKW A;  4M7A D;  4PJO B;  4RG2 A;  2DD5 A;  2DZC A;  3CCR A;  1I4K 1;  4KT0 E;  2XDB A;  1NPR A;  4M78 G;  3WXM B;  1YIT T;  1JBM A;  3LGF A;  1YJW A;  3JCM Q;  5GMK i;  3S3M A;  3JCM P;  4XTY A;  2PVO B;  3J81 E;  2MF2 A;  5IN1 A;  3CC4 A;  2K57 A;  5GAM j;  1VQ8 A;  2IG0 A;  4FT2 A;  4E7K A;  5I2M A;  4XU2 A;  4R56 A;  4GY5 A;  3MET A;  1N27 A;  1VIE A;  3PIO A;  1VQ4 A;  1Q82 C;  4MMK A;  4C8Q F;  1YIJ T;  2YRV A;  1U8R A;  2DVE A;  3SWN B;  1YCY A;  5CAI A;  3MP8 A;  3QYG B;  4C0D B;  4C92 E;  5HK0 A;  2PVD B;  4PJO C;  3O8V A;  3NTK A;  2DEQ A;  1W2B A;  3QYH B;  2DPP B;  3JCM d;  4M7D G;  2R5M A;  3MEA A;  4A53 A;  2FYK A;  1X6O A;  2D9T A;  1QVF S;  4PJO A;  1YHQ T;  2K3Y A;  3MO8 A;  2EJG A;  3OS2 A;  4J83 A;  3S3N A;  2P0P A;  5FLX E;  4C0F A;  4PKC C;  2YLB A;  1VQK T;  1UEB A;  1VQ9 T;  2K2V A;  4ELY C;  3HRS A;  3L2Z A;  1KHI A;  3A8O B;  4FSX A;  1VQ5 T;  5FRN A;  2X4J A;  3X24 B;  2HBP A;  2LT1 A;  2CZ0 B;  2DJZ A;  3M56 A;  4MML A;  4PJO D;  4CRI A;  4XTU A;  1FXX A;  3CPF A;  4M78 B;  5J3B A;  5GAO r;  4NL2 A;  3SWN C;  3EFR A;  3OYE A;  3X20 B;  4C0D C;  3FB9 A;  2AHJ B;  3L2W A;  2BIV A;  4X9D A;  5D6X A;  1WJQ A;  1RI0 A;  2ZPE B;  4M77 G;  2FB7 A;  2DTH A;  3SWN A;  3KUF A;  2R58 A;  3DB4 A;  3MP6 A;  3OYL A;  3CCJ T;  4BB7 A;  3M53 A;  2JN0 A;  1QVG A;  3HP9 A;  4JUV A;  2XID A;  5LJ5 d;  3OYC A;  3OS5 A;  4HCB A;  2NLU A;  4A4E A;  4EMG A;  2PUO B;  5GAN d;  3CCM A;  3A5Z B;  1QVF A;  1DJ7 B;  1K9M C;  4M75 C;  3E9G A;  4M78 C;  4PLI A;  4Q5W A;  4M7D B;  3CCQ A;  2DKG A;  3GIB A;  1VQK A;  2GCX A;  1VQ9 A;  2E64 A;  3PT9 A;  1VQO A;  4R55 A;  2V8I A;  3J7A F;  4GLK A;  4M75 A;  4QQ6 A;  3JCM W;  5GAN 7;  4M78 A;  3GNG A;  4F7U F;  1XOV A;  5AYF A;  4IUR A;  3S6W A;  3BW1 A;  2MAM A;  1XQH A;  3X26 B;  3TCJ A;  2RJC A;  3PNW C;  2VYT A;  2JZ2 A;  4J6W A;  4RCC A;  5DLQ E;  3M5A A;  1Q82 U;  1K73 C;  3A8H B;  2Y4Y A;  3CCU A;  4BD3 A;  4E47 A;  1VQ6 A;  3RES A;  2RJF A;  4L5G A;  1I81 A;  3OYN A;  3CD6 A;  4M7A F;  2RK2 A;  3BDL A;  1S72 A;  4M78 D;  3V8L A;  3LWH A;  2F69 A;  3G4S A;  5A0D A;  3L2Q A;  3CC2 A;  3WVE B;  3I56 A;  1VQ7 A;  2MWO A;  4M7D C;  4LDY A;  4ZGD B;  4M77 B;  3ZFJ A;  4N4G A;  2Y90 A;  1WQW A;  4NS5 A;  2P0Q A;  2P0K A;  4M7D A;  2XK0 A;  2RJE A;  5CIU A;  3L1A A;  2V8K A;  4MZT A;  1IRE B;  2E65 A;  2E12 A;  1YJW T;  4C5H A;  1BI2 A;  5GMK m;  3BY7 A;  4A54 A;  3UDC A;  2L5Q A;  3RMS A;  2HQX A;  2L89 A;  1WQ7 A;  3CC7 A;  3OYD A;  3CC4 T;  1VIF A;  3RUX A;  4C8Q E;  5CO7 A;  4M7D D;  1YHQ A;  4QVZ A;  4KBM B;  3VKI A;  3CXC S;  2DXU A;  5LJ3 d;  4BY6 B;  2JNG A;  3URG A;  1ZQ1 A;  1VQ4 T;  4M77 C;  1BYM A;  3QJ6 A;  1XNI A;  2RK1 A;  5CCA A;  1Q86 C;  2GFU A;  1UGS B;  1Y96 B;  3VYH B;  1G5V A;  3VJP A;  4JJN K;  4X9C A;  3OW2 S;  4M77 A;  2K5I A;  2RHX A;  4PJO F;  3VV0 A;  5I21 A;  1UGQ B;  5CR2 A;  2X4Y A;  1K9M U;  2PUK B;  3QDR B;  2EFI A;  1WJR A;  2VV5 A;  3CBP A;  4C92 A;  5GAO n;  4MDW A;  4OVA A;  1LJO A;  1NE8 A;  1VQM A;  4HCZ A;  3KBG A;  1JB0 E;  1U1S A;  2K3X A;  4LDU A;  3JCM X;  1K8A C;  2O4X B;  3NTI A;  2DXC A;  3QG1 A;  4LDW A;  4M77 D;  4M75 G;  3V7S A;  1UB4 A;  4BY6 C;  3CPW S;  1WGS A;  3PMT A;  4BI3 A;  1K73 U;  2RJD A;  3FEO A;  3VUZ A;  2L8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...