1D3BB

Crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3)
total genus 10
structure length 81
sequence length 81
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 1998-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1d3bB00
1B34A 2DKGA 2EAYA 3JB9D 2QTXA 2EJGA 4JUVA 4PNOA 4M75E 2DZCA 4M78A 5GAOp 4C8QA 2ZGWA 4N0AA 4XU2A 4C8QB 5GAN5 1D3BA 1I81A 4XTWA 2CGHA 4M78B 3JCMc 3AHUA 4M75A 1WQ7A 1I8FA 2RD1A 5LJ3h 5GAN3 1U1TA 3RKYA 5I21A 4WF2A 2EJFA 2YHTA 3L1AA 3RESA 4M78F 2RM4A 4MMLA 2E41A 3VU3C 3JB9I 4M77D 4C92E 1MGQA 5GAMj 2E1HA 2YLCA 1JRIA 2DTHA 1BIAA 1BIBA 3HFNA 3V8JA 4RCCA 4M7DE 4N0AC 1KQ1A 5LJ5j 3QUIA 4M77C 5GAOm 1M5Q1 1X01A 4XU0A 3QHSA 5DY9A 3V7SA 4A53A 3JCMg 1Y96B 5GAN4 1I4K1 3RKXA 4EMHA 4M7DG 3JCMh 4XTUA 4M77A 2VC8A 2YLBA 5GAN8 4M7AE 5GAN7 4PJOB 4M7AD 4JRKA 1Y96A 4OP0A 3V7RA 1YCYA 3JCMP 3M4GA 5LJ5h 4HT8A 1LOJA 4DQ2A 4C92G 5LJ3j 4J6WA 1U1SA 2VXEA 1N9RA 3JCMV 1I5LA 2DTIA 3BDUA 3RERA 4F7UA 4MMKA 5GAMg 3JB9F 4M77F 2RB6A 3FIFA 4XTVA 4XQ3A 3JCMe 4C8QG 3JB9G 1B34B 4PJOD 2RA2A 2E65A 5LJ5e 3JCMb 4HT9A 2FB7A 3FJPA 5GMKm 3GIBA 4M7AF 1TH7A 5LJ3e 3V7CA 2DEQA 4M78C 1N9SA 3INZA 3HFOA 4M77B 4XTYA 3SB2A 4C8QC 3SWNB 5LJ5f 1KQ2A 4NL2A 4Y91A 5GANg 4EMKB 1WQWA 3BY7A 4M78D 5GAOn 5GANj 1H641 4M75B 2DJZA 4C8QD 1LJOA 1WNLA 4J5YA 5GANh 4M78E 5LJ3g 4C92C 4C8QE 4J6YA 3FB9A 4C92D 1HXDA 4M75D 5LJ3d 4F7UF 3JCMW 4M78G 5GMKi 3EFRA 5CAIA 4X9DA 4QVCA 4M75C 5GMKl 4JRIA 3RUXA 4F7UB 5LJ5d 5GANe 3QO3A 3QSUA 5GAN2 3BFMA 2DTOA 2K57A 2Y90A 3L2ZA 1D3BB 3BW1A 3SWNC 4XTZA 5GAOl 5GMKj 4M75G 3PGGA 4RCBA 4JLIA 4M75F 4PJOF 4QVDA 4M7DA 5GAMf 4C92A 4XU3A 4C92F 4EMKA 2DXUA 4XTXA 4EMGA 4HA8A 2DXTA 4M77E 1JBMA 5LJ3f 5GAOq 1HK9A 1WPYA 1M8VA 4PJOG 5GMKh 5GANd 4NL3A 2FYKA 5GAMh 4NOYA 3JCMd 2VXFA 2DZ9A 4X9CA 4A54A 4M7AB 5GAN6 3JB9J 4EMKC 4M7DD 5GANf 1LNXA 4M7AA 3JCMf 4PJOE 4M7DC 5LJ5g 4J6XA 4PJOC 2HNIA 3JCMQ 2EJ9A 3SWNA 5GMKe 3EFSA 3V8LA 4C92B 2E10A 4M7AC 3JCMJ 5GAMe 2DVEA 3RKWA 3RIRA 4F7UE 5GAMd 3HSBA 3V8KA 2I2LA 4M7DF 4M77G 5GAOr 4PJOA 2E64A 4C8QF 4M7DB 2EWNA 3JCMX 4V2SA 3JB9H 2JN0A 4XU1A 4M7AG 4F7UG
chains in the Genus database with same CATH superfamily
1B34A 4E7SA 2BKDN 3JB9D 2VWFA 2L8DA 1VUBA 2ZPGB 2A0FB 3VV0A 4XTWA 5D6WA 2BZ8A 4M75A 3QWYA 1OOTA 1K73R 1IGUA 2XICA 1KSWA 1M27C 1YJNA 4C0DC 2CZ7B 1BIAA 2QYZA 2NLUA 2MYSA 1OPLA 5HK3A 3UWNA 5CKBA 1I4K1 4FIBA 3RKXA 4M7AE 2XHCA 5GAN7 3MP6A 4O6JA 1MMAA 1ZA2B 1GCQC 1JXOA 1K8AR 3HL8A 2DBKA 2B8AA 2RHXA 2R5AA 3MJXA 3QDRB 5GMKm 2IIMA 1QCNA 4C5IA 2D9TA 5LJ5f 2DLPA 3GBQA 4ZTJA 1FX7A 2ZPFB 1PC0A 1VQ7A 1IB8A 5LJ3g 3TU4K 4J6YA 4OB3B 3S3NA 1HXDA 5LJ3d 3NTKA 4X9DA 2DPPB 1SHFA 4JRIA 4F7UB 2A08A 2J06A 2KT1A 2KXDA 3CMAT 4IUTA 1KD1C 4PJOF 2A36A 2L0AA 5KCOA 1E7OA 1UHFA 3CCVA 1W6XA 3DLMA 5FW9A 2HBWA 4NOYA 2CH4A 3OYHA 3UF4A 4OGCA 4KT0E 1NJIR 1YHQA 4CRIA 2DBMA 3VUBA 3TEEA 2OAUA 5GMKe 3ME9A 4BDYA 2CP2A 2JMAA 3H6ZA 3DLLA 2QDYB 1Q86R 2MF2A 3V8KA 4FSSA 2L89A 2LZ6B 1G5VA 4F7UG 1QKXA 3OSSC 3CCLT 5DM7R 2PQWA 2VYTA 2J6FA 4OB0B 3OYMA 5DLOA 1SEMA 4JZ3A 4TVRA 2NUPA 2P4TA 1G3WA 3EH2A 3EG1A 2DO3A 2FVUA 3G7ZA 3OS0A 3RKYA 1M1FA 4A4KA 4A4EA 1G3SA 2DX1A 2E1HA 5IHIA 2DM1A 2X35A 3QUIA 3SDZA 4LUEA 4XU0A 1VQNT 1RLQC 4FT4A 3TREA 5LJ5h 1GRIA 4C92G 1T3SA 2YRVA 3JCMV 2DTIA 1M2VB 1K0SA 4PJOD 2ZZDA 2EGCA 3H41A 2J6KA 3CCUQ 1OX8A 2AK5A 2LDMA 3L2WA 3NTHA 1FMWA 1Y0MA 3FB9A 4IIMA 3JCMW 4D8DA 1VQ5T 3PVQA 1H8KA 2R5MA 1UGPB 3E9FA 3GNGA 1NEGA 2GTJA 3OYKA 3EGDA 3NHNA 2O2OA 4M75G 4C92F 2EQIA 3E1SA 4GLKA 3MHXA 1B07A 1E6GA 3NFCA 2O4XA 4BE0A 2XDPA 2RI3A 2GBQA 4PJOC 3EH1A 3JCMQ 1GFCA 2K3YA 4C0DB 1BCOA 1Y57A 3I5SA 2YSQA 2LX9A 3CMAA 5J39A 2DKGA 2DZCA 4M78A 5GAOp 3FDRA 2Y4YA 1QVGS 2V1RA 1I07A 3TCJA 2VGMA 3VRYA 4E7IA 1U1TA 1VQ4T 1SRLA 4J9GA 3CCJQ 1Q81U 4M4ZA 2RMOA 2FPDA 2X4XA 2DJQA 4FU6A 4BI4A 3PNWC 3JCMg 1YJNQ 4J9IA 3CMAQ 3RDVA 4M77A 1PM3A 3WVDB 3QBYA 2O88A 2FZCB 1QP2A 1W4SA 1VQ6A 2ZAEA 5CIUA 3L42A 1VOMA 4RTXA 2MMPA 5HCKA 3RMSA 2FZGB 4J8OA 3JB9F 1Q82U 4QQ6A 2RA2A 1WXUA 4FSXA 4OMOA 4E6RA 1D09B 4KGXB 2O9VA 3SWNB 3G4SQ 3I55A 5I22A 1FWZA 4M75B 2LCCA 3UA6A 1OULA 5HY6A 3ZEHA 2ROLA 3F70A 1OU9A 2JM8A 1XTDA 1VQPQ 2KNBB 1Z9QA 3EGXA 5GAOl 1ZX6A 3REBB 2LP5A 3BDLA 2H8HA 4XTXA 1Q7YU 4KH0B 2W10A 3VS5A 2MWPA 5GAMh 2RQTA 2X9HA 5A2QE 4EIKA 2E3IA 2D6FA 3H9NA 5FROA 5I2MA 4HCBA 3GF5A 1WJSA 4LDVA 4J7IA 1ZBJA 2YDLA 1IREB 4XU1A 4JZ4A 1VQ4Q 1QVPA 1YNZA 3CCST 2K5LA 3M0TA 4FYYB 3TSWA 2QASA 3MEWA 1PG5B 4CC7A 2EGAA 2JT4A 1SG5A 3GOXA 2YRCA 2X51A 2OX7A 3CXCP 2D8JA 2PNIA 2E5QA 2YHTA 3L1AA 2XDDA 4MZPA 1MNDA 2ESWA 1NYGA 2JJ9A 2EYYA 2AIRB 4J83A 1WJRA 3A98A 1SF9A 2L3SA 3JSCA 4PKCC 1VQKQ 4E7LA 3M53A 2OJ2A 4R0KA 2EYQA 4BUGA 1SRMA 3AT1B 3CMEA 1YI2T 1YJWQ 3QG1A 1U1SA 5CKFA 2QEXQ 1XNIA 3JCMe 3E9GA 1K9MC 1PWTA 1QVFA 3X26B 4ZNXA 2FB7A 3S3MA 1RLPC 1VQ6Q 3H0IA 1UE9A 1RADB 4M78D 2WSFE 5KYUA 1X6BA 4C0GA 4C8QE 3M55A 2ECZA 3OS2A 2DFUA 1M8VA 1GBQA 4QVCA 3QYHB 2KSSA 5GJVB 4E7JA 4F17A 2PTKA 3L2QA 3UT1A 1WDXA 1G8XA 3X28B 3HPWA 3CCJT 4N4GA 3RBBB 1OV3A 3MPUB 1YWOA 5GANd 2FYKA 1GFDA 1V1CA 5GAN6 2NYSA 2D0NA 1S72T 1YJNT 1WHGA 1QLYA 3C0CA 1X43A 4HVWA 3CCRA 3I56T 4R56A 4V2SA 3PIOA 4ZGDB 1AOJA 5AYFA 1MUZA 2LJ0A 2PVOB 2GQVA 1YIJT 3AHUA 1XJWB 1SSFA 2BTTA 2I0NA 1IO6A 4J9CA 2EJFA 1D0YA 1G3TA 4A63B 3CCUA 2ZPHB 3JRZA 4WCIA 3VU3C 3NGPA 4M77D 8ATCB 1NJIU 3CCMA 3ZFJA 1O75A 2L3RA 3TQ7P 4BACA 1VQPT 3JV3A 3R6OA 1M5Q1 4JDSA 2P0KA 3QIIA 1YIJA 1T0HA 4ELZC 1JJ2P 3H0HA 1BYMA 5FRMA 4Z8AA 4II1A 4ZN3A 2DL4A 4DQ2A 2CH4W 1BI1A 2EW3A 1YITT 1I0CA 1YJ9A 2O9SA 3FC3A 4JPBW 2PZ1A 4VUBA 2CT4A 2X4WA 4LDYA 3OW2P 1OQKA 2AZSA 3SB2A 1M3BA 2LC4A 2RJEA 4L6V5 4NL2A 1WYXA 1PSEA 3G6EA 2EQMA 3M0RA 3R6NA 2HDAA 4C8QD 3OY9A 2CZ0B 2X4YA 1Q7YC 3CD6T 2QXFA 1KC8U 2X3XD 1Q82R 1N8RC 4C5HA 3VS4A 4ANJA 2DTOA 4Y92A 2DL7A 2GFAA 3S3OA 4KUDK 4L59A 4CI0C 2XK0A 2KRMA 4PLIA 3GP8A 3THKA 4EMGA 3CXCS 2DXTA 2WACA 1QWFA 1TUGB 1V76A 3JCMd 2DETA 1ZUUA 5LJ5g 3RNJA 2G3RA 2JMCA 4CC3A 3CD6A 1VQOT 1IRXA 2V8JA 4F7UE 4FYXB 1TS9A 2RPNA 1YIJQ 3P8HA 4AFSC 2FHDA 4A4FA 1NE8A 2KT8A 4M75E 4RKUE 3KFVA 1TG0A 4C5EA 1VQPA 2QG9B 4M78B 4DEXA 2JM9A 4OMNA 1ZSGA 2K5FA 3G4SA 1U8RA 1M90U 2E5KA 3M4YA 4R55A 1JRIA 3OMGA 1UDLA 1I1JA 1EFNA 2CYZB 5LJ5j 4M77C 1PSFA 3QJYA 2VVKA 3BE3A 1T0JA 3M4GA 5J26A 1VQKA 3SFMA 1RAEB 1AD5A 4C8QG 3VYHB 1R0BG 3GIBA 3V7CA 1X6OA 2O31A 4EPCA 4ZN1A 1S72Q 2HL5C 3CCJA 1KQ2A 1RI9A 2DL8A 4FL6A 2EKOA 4J5YA 2F5TX 5GJWB 3GPLA 4QQGA 5KE3A 1QCFA 2YUNA 2OTJT 3MKDA 3GNFB 3OA6A 1PRLC 2EQJA 4Y28E 5GANe 1E6HA 5GAN2 2EPDA 1JB0E 3L2ZA 3BW1A 3SWNC 2EKHA 5KYXB 3LYIA 1KG1A 3HKSA 1FMVA 3PGGA 3HRTA 2Y4XA 2E70A 4C92A 3G6ET 4LD9K 4ELYC 1XOVA 2KYMA 4QVZA 3G71T 2EYWA 4NL3A 5C6SA 2DZ9A 4M7AB 4M7DD 1YJ9Q 2HNIA 3A1PA 1KD1U 2XU8A 3EG3A 4DBRA 2B86A 2LMJA 3TVTA 2EWNA 3JB9H 1M1KU 5D6YA 5FWCA 1VQLT 3X20B 1VQMT 2QTXA 2CDTA 2LQKA 3H8ZA 5IN1A 5FWBA 2DE0X 5IXFA 2FEIA 1BI3A 1IGQA 2V8IA 4JLGA 1QMCA 1ABQA 1I81A 2DYIA 4LNPA 1YWPA 3CC4Q 3OYDA 1WQ7A 4MZTA 3OYIA 3CC4A 2KQWA 4FM4B 3VRZA 5HKCA 3CD6Q 3VUZA 5FRNA 1VQ8Q 4ME7A 3KXTA 1W2BA 1B3QA 1VYUA 4PJJA 1RAGB 4OB1B 5GAN8 4GY5A 4PJOB 1G83A 3CCEA 1BBZA 2MAMA 2KYBA 5LJ3j 1OEBA 2JTEA 4Z89A 1I5LA 1WZOA 4FCYA 2CP7A 3M9QA 5LJ5e 3JCMb 3FJPA 2QQ9A 1WA7A 2H3EB 4C8QC 1VQOQ 1ZSZA 2KXCA 5EC7A 3ULRB 4PJLA 1WQWA 4PFPA 5GAOn 1TXQA 4DBHA 4X1VA 2JOYA 3FRNA 2M9UA 5LJ5d 2RF0A 1OX9A 3BFMA 1KIKA 2JVVA 2M0YA 5CKEA 3VS1A 5I2SA 4E7HA 1Q82C 1N8RR 4ZGEB 4QW2A 5LJ3f 1LVKA 3CPFA 2HQEA 4AG1C 1VQLQ 2FPFA 4RTTA 1VQMQ 3CCMQ 2K4YA 3ER0A 2KRNA 1FMKA 3QJ6A 2E6ZA 2CP3A 3JCMJ 1M1KC 1NM7A 1RUWA 2LNHB 4PJOA 1V29B 2ED0A 3UPUA 2JN0A 2ZPBB 2HKQB 3FEOA 2E12A 2RJDA 4PNOA 4IKFA 1BI0A 2ZGWA 2DRMA 4N0AA 1UJYA 1ACMB 3ASKA 4C0ZA 2LNVA 1QQJA 2L3PA 4LXCA 4WTOB 5IAYA 3EGUA 2DA9A 5CKHA 5D7UA 3CBOA 1VQ9Q 2COWA 3HRSA 2DIQA 4BD3A 5GAMj 3LWHA 2YUOA 2JW4A 4Q5WA 5CQXA 3VS0A 2EQKA 2K2MA 2J7IA 2AHJB 5GAOm 1UUEA 4PJNA 3M0SA 1YFNA 3CCLA 4XTUA 3EG9B 4YTLA 5C0MA 3OBYA 3JCMP 2WSEE 3LH5A 4J6WA 2RHZA 4F7UA 3MEVA 1ABOA 3URGA 3QDFA 3M5AA 4M7AF 1TH7A 2RJFA 3E2UA 3CCVT 2JS2A 9ATCB 1N8RU 3JAME 5KYWA 4E7KA 2GNCA 4C92D 4M78G 2ZCFB 2LX7A 3DKMA 1D1CA 4JS5A 3ZL7C 1PRMC 1MMNA 4KGVB 1VQNQ 2K7AA 3M59A 2OTLA 1Z9ZA 4RCBA 3M0PA 2MPXC 2XMFA 3J80E 1MHNA 2EGEA 2H3JA 5KYNA 1KQSP 1JBMA 5FU6C 3LWIA 2CP6A 2LJ1A 3QZ5B 2G6FX 2DEUA 3CBPA 3HRUA 1VQ4A 3JCMf 4M7DC 2NUZA 3CCUT 2F1LA 1CKAA 3V8LA 1X69A 2DVEA 3HSBA 4M7DF 2GFUA 3P8DA 1NYFA 4IUVA 1VIFA 1VQNA 3PIPA 2K9GA 5CO7A 4ZGJB 2RH2A 2XDBA 2LT4A 5KE2A 4ATOA 2GGRA 5KCHA 1I8FA 2DAQA 3ZBDA 3CCET 5I21A 3CCLQ 3OYBA 3X25B 5KYWB 4ESRA 3OYAA 1W2BP 1WHMA 4LD6A 5KYYA 3KBGA 3PMIA 1KQ1A 1UEBA 1Q7YR 1RAHB 2OAWA 1KC8C 2D8HA 3VS2A 4B9WA 3CCSA 6AT1B 1GXIE 2JUFA 2RQVA 1KJWA 4AFQC 2DL5A 2HSPA 2CKKA 1VQ7Q 1SSHA 1I5OB 2LT1A 1M2OA 1HJDA 4M77B 2HQHA 4EMKB 3OQ5A 3PE0A 2MIOA 1WNLA 2BZXA 3VYGA 4BY6C 3QWXX 2QGGA 2NUTA 3EFRA 5CAIA 2KMTA 1N5ZA 2AKLA 3CQTA 1WFWA 2IG0A 2HEQA 3OYEA 1UGQB 5GAMf 1SKUB 3VS6A 2DXUA 3OW2A 1IZ6A 1VQ9T 1MV0B 2P84A 1X27A 2HZYA 1JQQA 2JTMA 3H0FA 4A54A 1WXTA 1M9SA 4M7AA 1TUDA 4ZTFA 2K79A 3U23A 3UATA 4J9DA 1JJ2A 4C92B 1SPKA 1UFFA 3UA7A 4LDXA 1WX6A 4AG2C 4M7DB 1R77A 4MDWA 1GCPA 1M4ZA 2EJGA 3OYNA 2J05A 1AHJB 2CUDA 2KDSA 2YUQA 3A8MB 1WHJA 2WSCE 3CPWS 1WXBA 2QK0A 4M78F 4MMLA 1VQOA 1LCKA 4XK8E 2RHIA 4E2FB 2PU9B 4JJDA 2QQRA 3LH0A 3M0QA 1VQ7T 1Y96B 4IUQA 4EMHA 1HYOA 2YLBA 1AWWA 3I55T 1QCOA 2VV5A 1YCYA 2M16A 2QTVA 5CR2A 3E19A 4RTYA 3RERA 1A0NB 2CSQA 4XTVA 4J9HA 2QQBA 2P4RA 2EVRA 4HKEA 1NLPC 2AZVA 5M9OA 1K9MU 4JJCA 1W70A 2FO0A 3G1JA 2LCSA 2MCNA 1WHLA 4A4GA 3WVEB 2DJZA 4RTVA 4DBQA 2A3LA 2MK5A 5AT1B 2FL7A 5GMKl 3QZ9B 4PK4A 3RUXA 1UGSB 1NEBA 4OMLA 2K57A 2ATCB 4AFZC 1KC8R 1VQKT 1YITA 1O9SA 4MZMA 2QI2A 2NUPB 1RACB 2C0OA 8AT1B 2AKKA 2K6DA 4QT7A 1EZZB 5LL6S 5IHNA 1YJWT 5GAOq 2BE7D 2R58A 2KAFA 4E47A 4P5NA 2VKNA 4K11A 2KROA 3SHWA 2X4JA 1JXMA 4J6XA 3SD4A 3SWNA 2V8KA 2PUKB 3CXCA 1PKSA 1AWJA 5FLXE 3DB4A 3VJPA 2QA4Q 1CSKA 4C8QF 2DD4A 3NTIA 3MEUA 1NG2A 1Q86C 5IT9E 4PFZA 1BU1A 1MV3A 4XU2A 1D3BA 4Z88A 1PCXA 2DILA 4RTZA 1ZSZB 2E4HA 2SRCA 4RG2A 5LJ3h 3L2RA 1FXXA 2F2XA 3X24B 3HTRA 3CCSQ 1TU0B 3I5RA 1VQLA 3LGLA 4RMOA 1K9AA 4HCKA 1X2QA 3VS3A 3M58A 1LPLA 2RK2A 3OYJA 3OB9A 4RUGA 5GAN4 3PT9A 1IHVA 5KYUB 2RJCA 4JRKA 3V7RA 4HT8A 1ZUYA 1UJ0A 1GBRA 2DXCA 2PVGB 1B7TA 2C06A 3FIFA 4IIOA 2PVDB 2LVMA 4X34A 1EIFA 4GLMA 1VA7A 4OMPA 3LW5E 4M78C 3HFOA 5FU7C 4HCCA 2LTOA 1VQ5Q 2JZ2A 1NJIC 1OZ2A 1YI2Q 1KQSA 1G2BA 1K8AC 5GANj 1RAAB 2BE9B 2QEXT 1HD3A 5GANh 4C92C 2QAZA 2A7YA 1D0XA 3S6WA 1BI2A 1M2VA 1OZ3A 3QSUA 2E3HA 1VQ6T 2V26A 3D7SB 4OMFB 2PUOB 2F5KA 2A37A 4XTZA 5GMKj 3HHTB 4JLIA 4KH1B 1RAFB 4KUIA 1H92A 4HA8A 3EFOB 1D1AA 2QA4T 2OTLQ 1G3YA 5CKDA 2VXFA 2BZYA 3OSVA 3KUFA 2LCLA 5GANf 3NMZC 2LJ3A 2DMOA 5DLQE 1XQHA 2E10A 2IPOB 4OGEA 4M7AC 1WIEA 1SHGA 5A0GA 2QQSA 1TWBA 2QDLA 1JEGA 1UTIA 2ROTA 2XIDA 3C4SA 3PTAA 4LDWA 4C8QA 1M1KR 2COZA 1K73C 1F1BB 5GAN5 3MEAA 1AZGB 1K76A 2A28A 2NWMA 3TSZA 2XD0A 4OF1A 3LX7A 2R57A 2JS0A 2RM4A 1C0MA 1S72A 1M30A 5CVIA 4BY6B 1N6AA 3QXEB 1VIEA 3HFNA 3MP1A 4E7ZA 4OVAA 1ZBXA 4A53A 2COYA 3EHQA 1JJ2S 2ABLA 4M7DG 2CS7A 4M7AD 1GCQA 3G4ST 4FT2A 2P0QA 2XKOC 4OMQA 5GAMg 4IURA 1C6VX 1YHQQ 5CCAA 2IVWA 1U3OA 3EAEA 2O01E 4JJNK 2DNUA 4D8KA 2KEAA 2F2VA 2CUBA 4GBQA 4QQDA 3OBWA 1K9MR 1PD1A 3LLRA 4UC4A 1PNJA 2MOXA 3CC2T 4M75C 3QO3A 2QQAA 3EHRA 2X3WD 1X2KA 4DBFA 2KRSA 1JU5C 4J9FA 1QKWA 3A8OB 2M02A 2EYXA 1WHKA 2LRQA 4J7FA 1HK9A 1BKBA 2JTFA 2DD5A 4PJOE 1W1FA 4IUUA 4C5GA 2KGTA 1YP5A 2OTJA 3OYGA 3RMQA 3SEMA 1VQ5A 2E64A 1QVFP 3J81E 3C12A 1AT1B 4M7AG 1M90C 3M56A 4FYVB 1HSQA 2E6NA 2YWWA 3Q1JA 4CC4B 1YJWA 4BDZA 1N27A 2XG8D 2CGHA 1IHWA 1PKTA 1KQSS 1RL2A 1AWOA 5IHKA 3G6EQ 1M3CA 4HVUA 3RESA 2E41A 1NPPA 4J9EA 4LDUA 2YLCA 2GTOA 2M1HA 4LE9A 1BIBA 1AZEA 2EYZA 3CCQA 3QHSA 2BUDA 3IQLA 4N4IA 3OMCA 3CMEQ 1BB9A 1Q95G 3I35A 2ED1A 2XI9A 3M57A 5L23A 2L3QA 5J3BA 2CP5A 4DA4A 2VXEA 3OW2S 1IXDA 3BDUA 2OTLT 4O5VA 1W2BS 4M77F 1H3HA 4XQ3A 1PD0A 3VKIA 3GLXA 2E65A 3EG2A 3T9NA 5LJ3e 1FYNA 3VS7A 3PVLA 1ARKA 4HCZA 2KBTA 3A8GB 5GANg 3QYGB 3REAB 1UB4A 1NZ9A 4LUDA 2RQRA 1YBYA 3EGXB 4JS4A 1VQ8T 5GMKi 1D0ZA 1VYVA 2J6OA 3WXMB 2DK3A 1Y07A 2DERA 4PL6A 4FW2A 1QVFS 2HKNA 2OTJQ 2ZPIB 5KH6A 4KGZB 4M77E 2P0PA 4OMMA 3I56Q 1J3TA 4BE2A 3O5ZA 2M0OA 2EJ9A 3RR6A 2SEMA 1RABB 1KK7A 2QGFB 5EG2A 4AT1B 1Y71A 2I2LA 3J7AF 1PHTA 2DYBA 4D6WA 3FJ5A 4FYWB 4JUVA 4F14A 2RN8A 2FG0A 1YHQT 1TSFA 1AVZC 2C0TA 3META 4RG8A 5FU7B 4BI3A 1K4US 3JCMc 4JRPA 4A4HA 3HP9A 2HQXA 2GCXA 2DF6A 2K3BA 3CMET 1YI2A 4B6MA 4C92E 2RQWA 1UHCA 1VQMA 1M8MA 3A5ZB 1AWXA 2LQNA 1OU8A 4J9BA 3CC2Q 4M7DE 4OB2B 5DY9A 3DB3A 4HVVA 1Q86U 3P8BB 1ZQ1A 1LOJA 4PJMA 5IXBA 4MMKA 1TTHB 3OYFA 4KRTA 1D1BA 4HT9A 5IH2A 2DEQA 1N9SA 3EG9A 1M1GA 3CPWA 3CC7Q 4RTUA 1ZHIA 1JO8A 3BY7A 2W0ZA 1H641 3CC7A 2YT6A 1AEYA 4F7UF 1KHCA 2VUBA 1NLOC 2GQIA 3I56A 1EX4A 3A8HB 4N4HA 4EDUA 1D3BB 4DOVA 1U5SA 1K0XA 4M75F 4QVDA 2FRYA 3M54A 1K1ZA 2LQWA 2DXBA 2HD0A 1QVGP 4B9XA 5GMKh 2HAXA 3JB9J 2CP0A 1VQ8A 3CC2A 1LNXA 2QEXA 1Y7XA 1K8AU 1OYXA 1X75C 2MWOA 1X6GA 5GAMe 2RQUA 3RIRA 5GAMd 4M77G 3QPHA 3CCQQ 2HCKA 2JNGA 1YITQ 1ZSZC 5D6XA 1MMGA 2EAYA 3CCMT 4F16A 1UGVA 2OI3A 2EBPA 4C8QB 2YUPA 1K73U 2D1XA 2L5QA 1C1AA 4PFOA 2RD1A 3O8VA 4WF2A 1R8OB 2ENMA 2K5IA 3JB9I 4C0FA 1MGQA 2CZ1B 1UECA 5A0DA 1Q81C 3V8JA 4RCCA 3CCRT 2EFIA 3V7SA 5KYYB 3JCMh 5KYXA 2LQ8A 3I9QA 4OP0A 5ECAA 3CC7T 1QP3A 2RHUA 3EFOA 1N9RA 3OS1A 4XAXB 1T3LA 5FU6B 3JB9G 1NPRA 3A8LB 3OS5A 2RI2A 1YCSB 1VQ9A 2HBPA 3L2VA 1U06A 3MO8A 3PMTA 2CSIA 2C0IA 1ZUKA 1OPKA 2FZKB 1LJOA 1ZA1B 1QWEA 4M75D 3QKJA 4MDXA 3G71Q 1VYTA 1BK2A 3CCVQ 2CT3A 4RTWA 2D0QB 2NUTB 2VB6A 4PLLA 2Y90A 3EGDB 1YJ9T 2EIFA 2Z0WA 1S1NA 1TUCA 2KE9A 4EMKA 7AT1B 1WPYA 1MNEA 2O4XB 4BI8B 2HL3A 4X9CA 1YN8A 1TOVA 3C94A 4EMKC 1NBEB 1Q81R 1RAIB 1RI0A 3CEYA 1GL5A 2VASA 2MI6A 4DEYA 3EFSA 3MCAB 4F04B 4JJBA 1CKBA 3EG0A 1R0CB 2VGNA 3OYCA 1H3ZA 3CC4T 3JCMX 3G71A 4QKUA 4BB7A 3FLGA 1QVGA 1WJQA 4IUPA 3N5BB 2QA4A 2RO0A 3M0UA 3CCRQ 1WLPB 5GAN3 2RK1A 1KD1R 2K2VA 5L8RE 2BIVA 2DTHA 2KK4A 2JXBA 5I11A 2F2WA 3CBMA 4BE1A 1KFZA 4JRQA 4N0AC 1UG1A 2CZ6B 1X01A 1UGRB 2F69A 3CCEQ 3OYYA 2FPEA 4CC2A 3C95A 2VC8A 3L2UA 4FW1A 2YRDA 2RI5A 1Y96A 2DRKA 2YXYA 2FRWA 2CREA 4ORZA 1WHHA 1MMDA 2RB6A 2KI7A 1P92A 1B34B 4KULA 3INZA 4LN2A 4XTYA 1WGSA 2ZPEB 2KY9A 2DL3A 4Y91A 3CCQT 4Z02A 4M78E 4L5GA 5A0LA 3UDCA 4AMCA 1OI1A 1ZLMA 1KHIA 2HMAA 3PFSA 2L2PA 3CPWP 2HSEB 4M7DA 4KBMB 1BCMA 3I55Q 3OYLA 4XU3A 2RNAA 2AT1B 4DOWA 3MP8A 4PJOG 4HXJA 4AFUC 2GF7A 2EQUA 1QW1A 5CQYA 5HK0A 2DVJA 2KVQG 2RHYA 4NS5A 1M90R 1M3AA 1WI7A 2K3XA 2DIGA 2KR3A 3RKWA 3LGFA 2M51A 5GAOr 2V1QA 1DJ7B 5CK9A 3NPFA
chains in the Genus database with same CATH topology
1M90C 1VQNA 1B34A 4ZGDB 3PIPA 5AYFA 2BKDN 3M56A 3JB9D 5CO7A 2L8DA 4ZGJB 1VUBA 2ZPGB 2E6NA 3Q1JA 2RH2A 2XDBA 2LT4A 5KE2A 3VV0A 4ATOA 1YJWA 4BDZA 1N27A 2XG8D 4XTWA 2CGHA 5D6WA 2PVOB 1KQSS 2GQVA 1YIJT 3AHUA 1RL2A 1SSFA 4M75A 5KCHA 1I8FA 2DAQA 3ZBDA 3JB9F 3CCET 5I21A 2EJFA 3RESA 3OYBA 1G3TA 3CCUA 2ZPHB 2E41A 2XICA 3JRZA 1NPPA 3VU3C 3X25B 4LDUA 4M77D 1YJNA 3OYAA 4C0DC 2YLCA 1NJIU 2CZ7B 3CCMA 2M1HA 4LD6A 1BIAA 1BIBA 2NLUA 1O75A 3ZFJA 2L3RA 3KBGA 3PMIA 4BACA 1VQPT 5HK3A 1KQ1A 1UEBA 3R6OA 3UWNA 1M5Q1 3CCQA 4JDSA 3QHSA 5CKBA 2BUDA 1I4K1 4FIBA 2P0KA 3QIIA 4N4IA 3OMCA 3RKXA 1YIJA 1KC8C 4B9WA 4ELZC 3CCSA 2XHCA 4M7AE 1BYMA 5GAN7 5FRMA 3MP6A 1GXIE 2JUFA 4II1A 2XI9A 3M57A 4O6JA 4ZN3A 4DQ2A 5J3BA 4DA4A 1BI1A 2VXEA 3OW2S 3BDUA 1YITT 2OTLT 4O5VA 1YJ9A 1W2BS 2CKKA 3HL8A 4M77F 3FC3A 4XQ3A 2B8AA 3VKIA 3GLXA 2RHXA 4VUBA 2E65A 2X4WA 2R5AA 3QDRB 4LDYA 3T9NA 5GMKm 5LJ3e 2LT1A 4C5IA 4M77B 3SB2A 2RJEA 2D9TA 2LC4A 4HCZA 4L6V5 5LJ5f 3A8GB 4NL2A 1PSEA 5GANg 3QYGB 4EMKB 3G6EA 2EQMA 4ZTJA 1UB4A 1NZ9A 3OQ5A 4C8QD 1FX7A 1WNLA 2CZ0B 2ZPFB 3OY9A 2X4YA 1Q7YC 1VQ7A 3CD6T 3VYGA 5LJ3g 3TU4K 2QXFA 1KC8U 4J6YA 4OB3B 4BY6C 3S3NA 1YBYA 1HXDA 1N8RC 5LJ3d 4JS4A 4C5HA 1VQ8T 5GMKi 3EFRA 3NTKA 4X9DA 5CAIA 2DPPB 4JRIA 2KMTA 4F7UB 3WXMB 2DTOA 2DK3A 2GFAA 3S3OA 1Y07A 2IG0A 4KUDK 3CMAT 4IUTA 4L59A 3OYEA 1KD1C 1UGQB 4PJOF 4CI0C 2XK0A 4PL6A 5GAMf 4PLIA 2DXUA 1QVFS 3OW2A 3GP8A 1IZ6A 4EMGA 2ZPIB 5KH6A 2DXTA 3CXCS 1VQ9T 4M77E 2P0PA 5KCOA 2WACA 3CCVA 3DLMA 2JTMA 4NOYA 3JCMd 4A54A 3OYHA 4OGCA 4KT0E 1M9SA 1YHQA 4BE2A 4M7AA 4CRIA 3VUBA 5LJ5g 4ZTFA 3TEEA 2M0OA 2G3RA 2OAUA 2EJ9A 5GMKe 1JJ2A 3CD6A 1VQOT 4C92B 3ME9A 4BDYA 3H6ZA 2V8JA 3DLLA 2QDYB 2MF2A 5EG2A 4F7UE 3V8KA 1Y71A 2I2LA 4LDXA 3J7AF 4M7DB 2L89A 1G5VA 4D6WA 4F7UG 4MDWA 3P8HA 3OSSC 3CCLT 2FHDA 1M4ZA 2EJGA 2PQWA 2VYTA 4JUVA 4A4FA 5DM7R 3OYNA 4OB0B 1AHJB 1NE8A 4M75E 4RKUE 3OYMA 4C5EA 5DLOA 1VQPA 1YHQT 2KDSA 4TVRA 3META 4RG8A 5FU7B 4BI3A 4M78B 3JCMc 3A8MB 2P4TA 2WSCE 4JRPA 1G3WA 4A4HA 3HP9A 2DO3A 2FVUA 3G7ZA 3CPWS 3OS0A 2HQXA 3RKYA 1M1FA 2GCXA 2K5FA 4A4KA 4M78F 3G4SA 3CMET 1YI2A 4MMLA 4A4EA 1U8RA 1M90U 1VQOA 4C92E 1G3SA 2E1HA 3M4YA 1VQMA 4R55A 1JRIA 4XK8E 3A5ZB 2RHIA 2X35A 3OMGA 2PU9B 2QQRA 4M7DE 2CYZB 3LH0A 5LJ5j 3QUIA 4M77C 3SDZA 4OB2B 1PSFA 4XU0A 5DY9A 3QJYA 1VQ7T 1Y96B 1VQNT 4IUQA 4EMHA 2YLBA 3I55T 3DB3A 1Q86U 3P8BB 4FT4A 1ZQ1A 1YCYA 2M16A 2VV5A 3M4GA 3TREA 1LOJA 5J26A 5LJ5h 5CR2A 4C92G 3E19A 2YRVA 3RERA 1VQKA 3SFMA 3JCMV 2DTIA 4MMKA 3OYFA 4XTVA 4C8QG 3VYHB 4PJOD 2ZZDA 4HT9A 3GIBA 2QQBA 3V7CA 1X6OA 2DEQA 4EPCA 1N9SA 4HKEA 1M1GA 4ZN1A 5M9OA 1K9MU 3CCJA 3CPWA 1KQ2A 2LDMA 3L2WA 3NTHA 4V2SA 1ZHIA 3BY7A 4A4GA 1H641 4FL6A 3WVEB 2DJZA 2EKOA 3CC7A 4J5YA 2F5TX 3GPLA 4QQGA 5KE3A 2A3LA 3FB9A 2OTJT 4F7UF 3JCMW 2FL7A 5GMKl 3GNFB 3QZ9B 3OA6A 1KHCA 2EQJA 2VUBA 3RUXA 4Y28E 5GANe 1VQ5T 1UGSB 2R5MA 5GAN2 1UGPB 1JB0E 3I56A 2K57A 3A8HB 3E9FA 4N4HA 3L2ZA 1D3BB 1O9SA 3BW1A 2QI2A 3GNGA 4MZMA 3SWNC 3LYIA 4DOVA 3OYKA 1KG1A 4M75G 3HKSA 3PGGA 4M75F 3HRTA 4QVDA 2Y4XA 2E70A 3M54A 4C92A 4C92F 3G6ET 2DXBA 2HD0A 3E1SA 4LD9K 5LL6S 4ELYC 1YJWT 1XOVA 4GLKA 4QVZA 5GAOq 3MHXA 1YITA 4B9XA 3G71T 2R58A 2KAFA 4E47A 5GMKh 4NL3A 4P5NA 2HAXA 3JB9J 5C6SA 2DZ9A 3NFCA 2O4XA 4M7AB 4BE0A 1VQ8A 3CC2A 4M7DD 2XDPA 2X4JA 2RI3A 1LNXA 2QEXA 1Y7XA 4J6XA 4PJOC 1K8AU 1OYXA 2HNIA 1X75C 2MWOA 3SD4A 3SWNA 3JCMQ 1KD1U 2V8KA 2XU8A 2K3YA 2PUKB 4C0DB 5GAMe 3CXCA 5FLXE 3DB4A 3RIRA 3VJPA 5GAMd 4M77G 3QPHA 4C8QF 2EWNA 2LX9A 3JB9H 1M1KU 5D6YA 1VQLT 2JNGA 2DD4A 3X20B 5D6XA 3CMAA 5J39A 1VQMT 2DKGA 2EAYA 3CCMT 2QTXA 2LQKA 3H8ZA 3MEUA 3NTIA 5IN1A 1Q86C 2DZCA 4M78A 5IT9E 5GAOp 1BI3A 2V8IA 3FDRA 4JLGA 4XU2A 4C8QB 2Y4YA 1D3BA 1I81A 1QVGS 1K73U 3TCJA 2L5QA 2VGMA 4E7IA 3OYDA 1WQ7A 2RD1A 4RG2A 5LJ3h 3L2RA 3O8VA 1U1TA 1FXXA 1VQ4T 4WF2A 1R8OB 4MZTA 3X24B 3OYIA 3CC4A 2KQWA 2K5IA 4FM4B 5HKCA 1VQLA 3LGLA 4C0FA 3JB9I 1MGQA 2CZ1B 1Q81U 3VUZA 4RMOA 5A0DA 5FRNA 1Q81C 3V8JA 2X4XA 4ME7A 3KXTA 4RCCA 1VQKT 3CCRT 3M58A 2EFIA 4FU6A 4BI4A 2RK2A 1W2BA 3OYJA 3OB9A 3V7SA 3PNWC 3JCMg 5GAN4 3PT9A 4OB1B 3JCMh 4M77A 5GAN8 4GY5A 2LQ8A 2RJCA 3WVDB 3QBYA 4PJOB 3CCEA 4JRKA 4OP0A 3V7RA 4HT8A 3CC7T 1QP3A 1QP2A 1W4SA 2DXCA 2MAMA 2RHUA 2PVGB 1VQ6A 5CIUA 3L42A 5LJ3j 1N9RA 3OS1A 4XAXB 1I5LA 2MMPA 2C06A 3RMSA 4J8OA 5FU6B 3FIFA 4X34A 2PVDB 2LVMA 5CK9A 1EIFA 3JB9G 1Q82U 1NPRA 3A8LB 3OS5A 4QQ6A 2RA2A 5LJ5e 3M9QA 3JCMb 4FSXA 2RI2A 3FJPA 1VQ9A 3LW5E 2QQ9A 4M78C 2HBPA 3L2VA 3HFOA 3MO8A 5FU7C 3PMTA 4HCCA 4C8QC 2LTOA 3SWNB 2JZ2A 1NJIC 1OZ2A 3I55A 1KQSA 1FWZA 1WQWA 5GAOn 5GANj 1K8AC 2QEXT 4M75B 1LJOA 5GANh 2LCCA 4C92C 5HY6A 2A7YA 3ZEHA 4M75D 3F70A 2JOYA 3S6WA 1BI2A 3QKJA 3FRNA 2M9UA 4MDXA 1XTDA 5LJ5d 1OZ3A 3QSUA 1VQ6T 4OMFB 2D0QB 2PUOB 3BFMA 2JVVA 4PLLA 2Y90A 5GAOl 2F5KA 4XTZA 2EIFA 1YJ9T 5GMKj 3HHTB 3BDLA 4JLIA 5CKEA 5I2SA 4E7HA 1Q82C 4EMKA 4KUIA 4ZGEB 4XTXA 4HA8A 1Q7YU 4QW2A 5LJ3f 2QA4T 1WPYA 3CPFA 2HQEA 1G3YA 5CKDA 2O4XB 4BI8B 2MWPA 5GAMh 2VXFA 4X9CA 3OSVA 3C94A 3KUFA 2LCLA 4EMKC 5GANf 5A2QE 5DLQE 1RI0A 2K4YA 3CEYA 3ER0A 2MI6A 4EDUA 3EFSA 3MCAB 2D6FA 3QJ6A 1XQHA 2E10A 4OGEA 2E6ZA 5FROA 4M7AC 3JCMJ 1M1KC 5I2MA 4HCBA 3GF5A 4PJOA 1V29B 1WJSA 2VGNA 4LDVA 4J7IA 3OYCA 1H3ZA 3CC4T 3JCMX 3UPUA 2JN0A 2ZPBB 1IREB 4XU1A 2QQSA 5A0GA 3G71A 1QVPA 3FEOA 2E12A 2RJDA 2K5LA 4PNOA 4BB7A 3CCST 2XIDA 3C4SA 3FLGA 4LDWA 3MEWA 3PTAA 1BI0A 4IKFA 1QVGA 4C8QA 1WJQA 2ZGWA 4N0AA 1K73C 5GAN5 4IUPA 3N5BB 3MEAA 3GOXA 2QA4A 2RO0A 3ASKA 4C0ZA 2LNVA 5GAN3 5IAYA 2XD0A 2RK1A 4OF1A 3LX7A 5CKHA 2R57A 2E5QA 2YHTA 3L1AA 2XDDA 3CBOA 2K2VA 2RM4A 4MZPA 3HRSA 1S72A 2DIQA 5CVIA 4BD3A 5GAMj 3LWHA 5L8RE 5CQXA 2BIVA 4Q5WA 4BY6B 1N6AA 2DTHA 1VIEA 2KK4A 2EQKA 3QXEB 3HFNA 3MP1A 4J83A 1WJRA 2AHJB 3CBMA 4BE1A 4OVAA 4N0AC 4JRQA 5GAOm 1ZBXA 2CZ6B 1X01A 4A53A 1UGRB 2F69A 3JSCA 4PKCC 4E7LA 3OYYA 1JJ2S 3CCLA 4M7DG 3M53A 4XTUA 3C95A 2VC8A 4YTLA 3L2UA 5C0MA 2CS7A 2EYQA 4BUGA 4M7AD 2RI5A 1Y96A 3OBYA 3JCMP 2WSEE 3G4ST 4FT2A 3CMEA 1YI2T 2P0QA 3QG1A 4J6WA 1U1SA 2XKOC 5CKFA 2RHZA 4F7UA 3MEVA 5GAMg 4IURA 1XNIA 2RB6A 3E9GA 3JCMe 1K9MC 3URGA 1P92A 1B34B 3M5AA 4KULA 1QVFA 3X26B 4M7AF 2FB7A 1TH7A 5CCAA 2IVWA 2RJFA 3INZA 3S3MA 4XTYA 3EAEA 2O01E 4JJNK 3CCVT 1WGSA 2ZPEB 2KY9A 4Y91A 1N8RU 4M78D 2WSFE 4QQDA 3OBWA 3CCQT 3JAME 4Z02A 4M78E 3LLRA 4C0GA 4UC4A 4L5GA 4C8QE 3M55A 5A0LA 4E7KA 3UDCA 4C92D 3OS2A 1OI1A 4M78G 1M8VA 3CC2T 1KHIA 4QVCA 2ZCFB 3QYHB 2KSSA 4M75C 3QO3A 3PFSA 3DKMA 4JS5A 2QQAA 4E7JA 2OTLA 3M59A 4RCBA 4M7DA 4KBMB 3L2QA 3OYLA 4XU3A 3A8OB 3UT1A 3J80E 1MHNA 2H3JA 1JBMA 2LRQA 3X28B 3HPWA 4DOWA 4J7FA 1HK9A 3MP8A 4N4GA 5FU6C 3LWIA 3CCJT 4PJOG 3QZ5B 5GANd 2FYKA 2GF7A 2EQUA 1BKBA 2JTFA 5GAN6 1QW1A 2DD5A 3CBPA 3HRUA 5CQYA 1VQ4A 3JCMf 4PJOE 4M7DC 5HK0A 4IUUA 3CCUT 2RHYA 2KVQG 4NS5A 1S72T 1YJNT 3V8LA 4C5GA 2K3XA 2DIGA 2OTJA 3OYGA 3RMQA 2DVEA 3LGFA 3RKWA 3HSBA 4M7DF 2GFUA 5GAOr 1VQ5A 2E64A 3P8DA 3CCRA 3J81E 3I56T 4R56A 1DJ7B 4IUVA 3C12A 4M7AG 3PIOA 1VIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B34 A;  2DKG A;  2EAY A;  3JB9 D;  2QTX A;  2EJG A;  4JUV A;  4PNO A;  4M75 E;  2DZC A;  4M78 A;  5GAO p;  4C8Q A;  2ZGW A;  4N0A A;  4XU2 A;  4C8Q B;  5GAN 5;  1D3B A;  1I81 A;  4XTW A;  2CGH A;  4M78 B;  3JCM c;  3AHU A;  4M75 A;  1WQ7 A;  1I8F A;  2RD1 A;  5LJ3 h;  5GAN 3;  1U1T A;  3RKY A;  5I21 A;  4WF2 A;  2EJF A;  2YHT A;  3L1A A;  3RES A;  4M78 F;  2RM4 A;  4MML A;  2E41 A;  3VU3 C;  3JB9 I;  4M77 D;  4C92 E;  1MGQ A;  5GAM j;  2E1H A;  2YLC A;  1JRI A;  2DTH A;  1BIA A;  1BIB A;  3HFN A;  3V8J A;  4RCC A;  4M7D E;  4N0A C;  1KQ1 A;  5LJ5 j;  3QUI A;  4M77 C;  5GAO m;  1M5Q 1;  1X01 A;  4XU0 A;  3QHS A;  5DY9 A;  3V7S A;  4A53 A;  3JCM g;  1Y96 B;  5GAN 4;  1I4K 1;  3RKX A;  4EMH A;  4M7D G;  3JCM h;  4XTU A;  4M77 A;  2VC8 A;  2YLB A;  5GAN 8;  4M7A E;  5GAN 7;  4PJO B;  4M7A D;  4JRK A;  1Y96 A;  4OP0 A;  3V7R A;  1YCY A;  3JCM P;  3M4G A;  5LJ5 h;  4HT8 A;  1LOJ A;  4DQ2 A;  4C92 G;  5LJ3 j;  4J6W A;  1U1S A;  2VXE A;  1N9R A;  3JCM V;  1I5L A;  2DTI A;  3BDU A;  3RER A;  4F7U A;  4MMK A;  5GAM g;  3JB9 F;  4M77 F;  2RB6 A;  3FIF A;  4XTV A;  4XQ3 A;  3JCM e;  4C8Q G;  3JB9 G;  1B34 B;  4PJO D;  2RA2 A;  2E65 A;  5LJ5 e;  3JCM b;  4HT9 A;  2FB7 A;  3FJP A;  5GMK m;  3GIB A;  4M7A F;  1TH7 A;  5LJ3 e;  3V7C A;  2DEQ A;  4M78 C;  1N9S A;  3INZ A;  3HFO A;  4M77 B;  4XTY A;  3SB2 A;  4C8Q C;  3SWN B;  5LJ5 f;  1KQ2 A;  4NL2 A;  4Y91 A;  5GAN g;  4EMK B;  1WQW A;  3BY7 A;  4M78 D;  5GAO n;  5GAN j;  1H64 1;  4M75 B;  2DJZ A;  4C8Q D;  1LJO A;  1WNL A;  4J5Y A;  5GAN h;  4M78 E;  5LJ3 g;  4C92 C;  4C8Q E;  4J6Y A;  3FB9 A;  4C92 D;  1HXD A;  4M75 D;  5LJ3 d;  4F7U F;  3JCM W;  4M78 G;  5GMK i;  3EFR A;  5CAI A;  4X9D A;  4QVC A;  4M75 C;  5GMK l;  4JRI A;  3RUX A;  4F7U B;  5LJ5 d;  5GAN e;  3QO3 A;  3QSU A;  5GAN 2;  3BFM A;  2DTO A;  2K57 A;  2Y90 A;  3L2Z A;  1D3B B;  3BW1 A;  3SWN C;  4XTZ A;  5GAO l;  5GMK j;  4M75 G;  3PGG A;  4RCB A;  4JLI A;  4M75 F;  4PJO F;  4QVD A;  4M7D A;  5GAM f;  4C92 A;  4XU3 A;  4C92 F;  4EMK A;  2DXU A;  4XTX A;  4EMG A;  4HA8 A;  2DXT A;  4M77 E;  1JBM A;  5LJ3 f;  5GAO q;  1HK9 A;  1WPY A;  1M8V A;  4PJO G;  5GMK h;  5GAN d;  4NL3 A;  2FYK A;  5GAM h;  4NOY A;  3JCM d;  2VXF A;  2DZ9 A;  4X9C A;  4A54 A;  4M7A B;  5GAN 6;  3JB9 J;  4EMK C;  4M7D D;  5GAN f;  1LNX A;  4M7A A;  3JCM f;  4PJO E;  4M7D C;  5LJ5 g;  4J6X A;  4PJO C;  2HNI A;  3JCM Q;  2EJ9 A;  3SWN A;  5GMK e;  3EFS A;  3V8L A;  4C92 B;  2E10 A;  4M7A C;  3JCM J;  5GAM e;  2DVE A;  3RKW A;  3RIR A;  4F7U E;  5GAM d;  3HSB A;  3V8K A;  2I2L A;  4M7D F;  4M77 G;  5GAO r;  4PJO A;  2E64 A;  4C8Q F;  4M7D B;  2EWN A;  3JCM X;  4V2S A;  3JB9 H;  2JN0 A;  4XU1 A;  4M7A G;  4F7U G; 
#chains in the Genus database with same CATH topology
 1B34 A;  4E7S A;  2BKD N;  3JB9 D;  2VWF A;  2L8D A;  1VUB A;  2ZPG B;  2A0F B;  3VV0 A;  4XTW A;  5D6W A;  2BZ8 A;  4M75 A;  3QWY A;  1OOT A;  1K73 R;  1IGU A;  2XIC A;  1KSW A;  1M27 C;  1YJN A;  4C0D C;  2CZ7 B;  1BIA A;  2QYZ A;  2NLU A;  2MYS A;  1OPL A;  5HK3 A;  3UWN A;  5CKB A;  1I4K 1;  4FIB A;  3RKX A;  4M7A E;  2XHC A;  5GAN 7;  3MP6 A;  4O6J A;  1MMA A;  1ZA2 B;  1GCQ C;  1JXO A;  1K8A R;  3HL8 A;  2DBK A;  2B8A A;  2RHX A;  2R5A A;  3MJX A;  3QDR B;  5GMK m;  2IIM A;  1QCN A;  4C5I A;  2D9T A;  5LJ5 f;  2DLP A;  3GBQ A;  4ZTJ A;  1FX7 A;  2ZPF B;  1PC0 A;  1VQ7 A;  1IB8 A;  5LJ3 g;  3TU4 K;  4J6Y A;  4OB3 B;  3S3N A;  1HXD A;  5LJ3 d;  3NTK A;  4X9D A;  2DPP B;  1SHF A;  4JRI A;  4F7U B;  2A08 A;  2J06 A;  2KT1 A;  2KXD A;  3CMA T;  4IUT A;  1KD1 C;  4PJO F;  2A36 A;  2L0A A;  5KCO A;  1E7O A;  1UHF A;  3CCV A;  1W6X A;  3DLM A;  5FW9 A;  2HBW A;  4NOY A;  2CH4 A;  3OYH A;  3UF4 A;  4OGC A;  4KT0 E;  1NJI R;  1YHQ A;  4CRI A;  2DBM A;  3VUB A;  3TEE A;  2OAU A;  5GMK e;  3ME9 A;  4BDY A;  2CP2 A;  2JMA A;  3H6Z A;  3DLL A;  2QDY B;  1Q86 R;  2MF2 A;  3V8K A;  4FSS A;  2L89 A;  2LZ6 B;  1G5V A;  4F7U G;  1QKX A;  3OSS C;  3CCL T;  5DM7 R;  2PQW A;  2VYT A;  2J6F A;  4OB0 B;  3OYM A;  5DLO A;  1SEM A;  4JZ3 A;  4TVR A;  2NUP A;  2P4T A;  1G3W A;  3EH2 A;  3EG1 A;  2DO3 A;  2FVU A;  3G7Z A;  3OS0 A;  3RKY A;  1M1F A;  4A4K A;  4A4E A;  1G3S A;  2DX1 A;  2E1H A;  5IHI A;  2DM1 A;  2X35 A;  3QUI A;  3SDZ A;  4LUE A;  4XU0 A;  1VQN T;  1RLQ C;  4FT4 A;  3TRE A;  5LJ5 h;  1GRI A;  4C92 G;  1T3S A;  2YRV A;  3JCM V;  2DTI A;  1M2V B;  1K0S A;  4PJO D;  2ZZD A;  2EGC A;  3H41 A;  2J6K A;  3CCU Q;  1OX8 A;  2AK5 A;  2LDM A;  3L2W A;  3NTH A;  1FMW A;  1Y0M A;  3FB9 A;  4IIM A;  3JCM W;  4D8D A;  1VQ5 T;  3PVQ A;  1H8K A;  2R5M A;  1UGP B;  3E9F A;  3GNG A;  1NEG A;  2GTJ A;  3OYK A;  3EGD A;  3NHN A;  2O2O A;  4M75 G;  4C92 F;  2EQI A;  3E1S A;  4GLK A;  3MHX A;  1B07 A;  1E6G A;  3NFC A;  2O4X A;  4BE0 A;  2XDP A;  2RI3 A;  2GBQ A;  4PJO C;  3EH1 A;  3JCM Q;  1GFC A;  2K3Y A;  4C0D B;  1BCO A;  1Y57 A;  3I5S A;  2YSQ A;  2LX9 A;  3CMA A;  5J39 A;  2DKG A;  2DZC A;  4M78 A;  5GAO p;  3FDR A;  2Y4Y A;  1QVG S;  2V1R A;  1I07 A;  3TCJ A;  2VGM A;  3VRY A;  4E7I A;  1U1T A;  1VQ4 T;  1SRL A;  4J9G A;  3CCJ Q;  1Q81 U;  4M4Z A;  2RMO A;  2FPD A;  2X4X A;  2DJQ A;  4FU6 A;  4BI4 A;  3PNW C;  3JCM g;  1YJN Q;  4J9I A;  3CMA Q;  3RDV A;  4M77 A;  1PM3 A;  3WVD B;  3QBY A;  2O88 A;  2FZC B;  1QP2 A;  1W4S A;  1VQ6 A;  2ZAE A;  5CIU A;  3L42 A;  1VOM A;  4RTX A;  2MMP A;  5HCK A;  3RMS A;  2FZG B;  4J8O A;  3JB9 F;  1Q82 U;  4QQ6 A;  2RA2 A;  1WXU A;  4FSX A;  4OMO A;  4E6R A;  1D09 B;  4KGX B;  2O9V A;  3SWN B;  3G4S Q;  3I55 A;  5I22 A;  1FWZ A;  4M75 B;  2LCC A;  3UA6 A;  1OUL A;  5HY6 A;  3ZEH A;  2ROL A;  3F70 A;  1OU9 A;  2JM8 A;  1XTD A;  1VQP Q;  2KNB B;  1Z9Q A;  3EGX A;  5GAO l;  1ZX6 A;  3REB B;  2LP5 A;  3BDL A;  2H8H A;  4XTX A;  1Q7Y U;  4KH0 B;  2W10 A;  3VS5 A;  2MWP A;  5GAM h;  2RQT A;  2X9H A;  5A2Q E;  4EIK A;  2E3I A;  2D6F A;  3H9N A;  5FRO A;  5I2M A;  4HCB A;  3GF5 A;  1WJS A;  4LDV A;  4J7I A;  1ZBJ A;  2YDL A;  1IRE B;  4XU1 A;  4JZ4 A;  1VQ4 Q;  1QVP A;  1YNZ A;  3CCS T;  2K5L A;  3M0T A;  4FYY B;  3TSW A;  2QAS A;  3MEW A;  1PG5 B;  4CC7 A;  2EGA A;  2JT4 A;  1SG5 A;  3GOX A;  2YRC A;  2X51 A;  2OX7 A;  3CXC P;  2D8J A;  2PNI A;  2E5Q A;  2YHT A;  3L1A A;  2XDD A;  4MZP A;  1MND A;  2ESW A;  1NYG A;  2JJ9 A;  2EYY A;  2AIR B;  4J83 A;  1WJR A;  3A98 A;  1SF9 A;  2L3S A;  3JSC A;  4PKC C;  1VQK Q;  4E7L A;  3M53 A;  2OJ2 A;  4R0K A;  2EYQ A;  4BUG A;  1SRM A;  3AT1 B;  3CME A;  1YI2 T;  1YJW Q;  3QG1 A;  1U1S A;  5CKF A;  2QEX Q;  1XNI A;  3JCM e;  3E9G A;  1K9M C;  1PWT A;  1QVF A;  3X26 B;  4ZNX A;  2FB7 A;  3S3M A;  1RLP C;  1VQ6 Q;  3H0I A;  1UE9 A;  1RAD B;  4M78 D;  2WSF E;  5KYU A;  1X6B A;  4C0G A;  4C8Q E;  3M55 A;  2ECZ A;  3OS2 A;  2DFU A;  1M8V A;  1GBQ A;  4QVC A;  3QYH B;  2KSS A;  5GJV B;  4E7J A;  4F17 A;  2PTK A;  3L2Q A;  3UT1 A;  1WDX A;  1G8X A;  3X28 B;  3HPW A;  3CCJ T;  4N4G A;  3RBB B;  1OV3 A;  3MPU B;  1YWO A;  5GAN d;  2FYK A;  1GFD A;  1V1C A;  5GAN 6;  2NYS A;  2D0N A;  1S72 T;  1YJN T;  1WHG A;  1QLY A;  3C0C A;  1X43 A;  4HVW A;  3CCR A;  3I56 T;  4R56 A;  4V2S A;  3PIO A;  4ZGD B;  1AOJ A;  5AYF A;  1MUZ A;  2LJ0 A;  2PVO B;  2GQV A;  1YIJ T;  3AHU A;  1XJW B;  1SSF A;  2BTT A;  2I0N A;  1IO6 A;  4J9C A;  2EJF A;  1D0Y A;  1G3T A;  4A63 B;  3CCU A;  2ZPH B;  3JRZ A;  4WCI A;  3VU3 C;  3NGP A;  4M77 D;  8ATC B;  1NJI U;  3CCM A;  3ZFJ A;  1O75 A;  2L3R A;  3TQ7 P;  4BAC A;  1VQP T;  3JV3 A;  3R6O A;  1M5Q 1;  4JDS A;  2P0K A;  3QII A;  1YIJ A;  1T0H A;  4ELZ C;  1JJ2 P;  3H0H A;  1BYM A;  5FRM A;  4Z8A A;  4II1 A;  4ZN3 A;  2DL4 A;  4DQ2 A;  2CH4 W;  1BI1 A;  2EW3 A;  1YIT T;  1I0C A;  1YJ9 A;  2O9S A;  3FC3 A;  4JPB W;  2PZ1 A;  4VUB A;  2CT4 A;  2X4W A;  4LDY A;  3OW2 P;  1OQK A;  2AZS A;  3SB2 A;  1M3B A;  2LC4 A;  2RJE A;  4L6V 5;  4NL2 A;  1WYX A;  1PSE A;  3G6E A;  2EQM A;  3M0R A;  3R6N A;  2HDA A;  4C8Q D;  3OY9 A;  2CZ0 B;  2X4Y A;  1Q7Y C;  3CD6 T;  2QXF A;  1KC8 U;  2X3X D;  1Q82 R;  1N8R C;  4C5H A;  3VS4 A;  4ANJ A;  2DTO A;  4Y92 A;  2DL7 A;  2GFA A;  3S3O A;  4KUD K;  4L59 A;  4CI0 C;  2XK0 A;  2KRM A;  4PLI A;  3GP8 A;  3THK A;  4EMG A;  3CXC S;  2DXT A;  2WAC A;  1QWF A;  1TUG B;  1V76 A;  3JCM d;  2DET A;  1ZUU A;  5LJ5 g;  3RNJ A;  2G3R A;  2JMC A;  4CC3 A;  3CD6 A;  1VQO T;  1IRX A;  2V8J A;  4F7U E;  4FYX B;  1TS9 A;  2RPN A;  1YIJ Q;  3P8H A;  4AFS C;  2FHD A;  4A4F A;  1NE8 A;  2KT8 A;  4M75 E;  4RKU E;  3KFV A;  1TG0 A;  4C5E A;  1VQP A;  2QG9 B;  4M78 B;  4DEX A;  2JM9 A;  4OMN A;  1ZSG A;  2K5F A;  3G4S A;  1U8R A;  1M90 U;  2E5K A;  3M4Y A;  4R55 A;  1JRI A;  3OMG A;  1UDL A;  1I1J A;  1EFN A;  2CYZ B;  5LJ5 j;  4M77 C;  1PSF A;  3QJY A;  2VVK A;  3BE3 A;  1T0J A;  3M4G A;  5J26 A;  1VQK A;  3SFM A;  1RAE B;  1AD5 A;  4C8Q G;  3VYH B;  1R0B G;  3GIB A;  3V7C A;  1X6O A;  2O31 A;  4EPC A;  4ZN1 A;  1S72 Q;  2HL5 C;  3CCJ A;  1KQ2 A;  1RI9 A;  2DL8 A;  4FL6 A;  2EKO A;  4J5Y A;  2F5T X;  5GJW B;  3GPL A;  4QQG A;  5KE3 A;  1QCF A;  2YUN A;  2OTJ T;  3MKD A;  3GNF B;  3OA6 A;  1PRL C;  2EQJ A;  4Y28 E;  5GAN e;  1E6H A;  5GAN 2;  2EPD A;  1JB0 E;  3L2Z A;  3BW1 A;  3SWN C;  2EKH A;  5KYX B;  3LYI A;  1KG1 A;  3HKS A;  1FMV A;  3PGG A;  3HRT A;  2Y4X A;  2E70 A;  4C92 A;  3G6E T;  4LD9 K;  4ELY C;  1XOV A;  2KYM A;  4QVZ A;  3G71 T;  2EYW A;  4NL3 A;  5C6S A;  2DZ9 A;  4M7A B;  4M7D D;  1YJ9 Q;  2HNI A;  3A1P A;  1KD1 U;  2XU8 A;  3EG3 A;  4DBR A;  2B86 A;  2LMJ A;  3TVT A;  2EWN A;  3JB9 H;  1M1K U;  5D6Y A;  5FWC A;  1VQL T;  3X20 B;  1VQM T;  2QTX A;  2CDT A;  2LQK A;  3H8Z A;  5IN1 A;  5FWB A;  2DE0 X;  5IXF A;  2FEI A;  1BI3 A;  1IGQ A;  2V8I A;  4JLG A;  1QMC A;  1ABQ A;  1I81 A;  2DYI A;  4LNP A;  1YWP A;  3CC4 Q;  3OYD A;  1WQ7 A;  4MZT A;  3OYI A;  3CC4 A;  2KQW A;  4FM4 B;  3VRZ A;  5HKC A;  3CD6 Q;  3VUZ A;  5FRN A;  1VQ8 Q;  4ME7 A;  3KXT A;  1W2B A;  1B3Q A;  1VYU A;  4PJJ A;  1RAG B;  4OB1 B;  5GAN 8;  4GY5 A;  4PJO B;  1G83 A;  3CCE A;  1BBZ A;  2MAM A;  2KYB A;  5LJ3 j;  1OEB A;  2JTE A;  4Z89 A;  1I5L A;  1WZO A;  4FCY A;  2CP7 A;  3M9Q A;  5LJ5 e;  3JCM b;  3FJP A;  2QQ9 A;  1WA7 A;  2H3E B;  4C8Q C;  1VQO Q;  1ZSZ A;  2KXC A;  5EC7 A;  3ULR B;  4PJL A;  1WQW A;  4PFP A;  5GAO n;  1TXQ A;  4DBH A;  4X1V A;  2JOY A;  3FRN A;  2M9U A;  5LJ5 d;  2RF0 A;  1OX9 A;  3BFM A;  1KIK A;  2JVV A;  2M0Y A;  5CKE A;  3VS1 A;  5I2S A;  4E7H A;  1Q82 C;  1N8R R;  4ZGE B;  4QW2 A;  5LJ3 f;  1LVK A;  3CPF A;  2HQE A;  4AG1 C;  1VQL Q;  2FPF A;  4RTT A;  1VQM Q;  3CCM Q;  2K4Y A;  3ER0 A;  2KRN A;  1FMK A;  3QJ6 A;  2E6Z A;  2CP3 A;  3JCM J;  1M1K C;  1NM7 A;  1RUW A;  2LNH B;  4PJO A;  1V29 B;  2ED0 A;  3UPU A;  2JN0 A;  2ZPB B;  2HKQ B;  3FEO A;  2E12 A;  2RJD A;  4PNO A;  4IKF A;  1BI0 A;  2ZGW A;  2DRM A;  4N0A A;  1UJY A;  1ACM B;  3ASK A;  4C0Z A;  2LNV A;  1QQJ A;  2L3P A;  4LXC A;  4WTO B;  5IAY A;  3EGU A;  2DA9 A;  5CKH A;  5D7U A;  3CBO A;  1VQ9 Q;  2COW A;  3HRS A;  2DIQ A;  4BD3 A;  5GAM j;  3LWH A;  2YUO A;  2JW4 A;  4Q5W A;  5CQX A;  3VS0 A;  2EQK A;  2K2M A;  2J7I A;  2AHJ B;  5GAO m;  1UUE A;  4PJN A;  3M0S A;  1YFN A;  3CCL A;  4XTU A;  3EG9 B;  4YTL A;  5C0M A;  3OBY A;  3JCM P;  2WSE E;  3LH5 A;  4J6W A;  2RHZ A;  4F7U A;  3MEV A;  1ABO A;  3URG A;  3QDF A;  3M5A A;  4M7A F;  1TH7 A;  2RJF A;  3E2U A;  3CCV T;  2JS2 A;  9ATC B;  1N8R U;  3JAM E;  5KYW A;  4E7K A;  2GNC A;  4C92 D;  4M78 G;  2ZCF B;  2LX7 A;  3DKM A;  1D1C A;  4JS5 A;  3ZL7 C;  1PRM C;  1MMN A;  4KGV B;  1VQN Q;  2K7A A;  3M59 A;  2OTL A;  1Z9Z A;  4RCB A;  3M0P A;  2MPX C;  2XMF A;  3J80 E;  1MHN A;  2EGE A;  2H3J A;  5KYN A;  1KQS P;  1JBM A;  5FU6 C;  3LWI A;  2CP6 A;  2LJ1 A;  3QZ5 B;  2G6F X;  2DEU A;  3CBP A;  3HRU A;  1VQ4 A;  3JCM f;  4M7D C;  2NUZ A;  3CCU T;  2F1L A;  1CKA A;  3V8L A;  1X69 A;  2DVE A;  3HSB A;  4M7D F;  2GFU A;  3P8D A;  1NYF A;  4IUV A;  1VIF A;  1VQN A;  3PIP A;  2K9G A;  5CO7 A;  4ZGJ B;  2RH2 A;  2XDB A;  2LT4 A;  5KE2 A;  4ATO A;  2GGR A;  5KCH A;  1I8F A;  2DAQ A;  3ZBD A;  3CCE T;  5I21 A;  3CCL Q;  3OYB A;  3X25 B;  5KYW B;  4ESR A;  3OYA A;  1W2B P;  1WHM A;  4LD6 A;  5KYY A;  3KBG A;  3PMI A;  1KQ1 A;  1UEB A;  1Q7Y R;  1RAH B;  2OAW A;  1KC8 C;  2D8H A;  3VS2 A;  4B9W A;  3CCS A;  6AT1 B;  1GXI E;  2JUF A;  2RQV A;  1KJW A;  4AFQ C;  2DL5 A;  2HSP A;  2CKK A;  1VQ7 Q;  1SSH A;  1I5O B;  2LT1 A;  1M2O A;  1HJD A;  4M77 B;  2HQH A;  4EMK B;  3OQ5 A;  3PE0 A;  2MIO A;  1WNL A;  2BZX A;  3VYG A;  4BY6 C;  3QWX X;  2QGG A;  2NUT A;  3EFR A;  5CAI A;  2KMT A;  1N5Z A;  2AKL A;  3CQT A;  1WFW A;  2IG0 A;  2HEQ A;  3OYE A;  1UGQ B;  5GAM f;  1SKU B;  3VS6 A;  2DXU A;  3OW2 A;  1IZ6 A;  1VQ9 T;  1MV0 B;  2P84 A;  1X27 A;  2HZY A;  1JQQ A;  2JTM A;  3H0F A;  4A54 A;  1WXT A;  1M9S A;  4M7A A;  1TUD A;  4ZTF A;  2K79 A;  3U23 A;  3UAT A;  4J9D A;  1JJ2 A;  4C92 B;  1SPK A;  1UFF A;  3UA7 A;  4LDX A;  1WX6 A;  4AG2 C;  4M7D B;  1R77 A;  4MDW A;  1GCP A;  1M4Z A;  2EJG A;  3OYN A;  2J05 A;  1AHJ B;  2CUD A;  2KDS A;  2YUQ A;  3A8M B;  1WHJ A;  2WSC E;  3CPW S;  1WXB A;  2QK0 A;  4M78 F;  4MML A;  1VQO A;  1LCK A;  4XK8 E;  2RHI A;  4E2F B;  2PU9 B;  4JJD A;  2QQR A;  3LH0 A;  3M0Q A;  1VQ7 T;  1Y96 B;  4IUQ A;  4EMH A;  1HYO A;  2YLB A;  1AWW A;  3I55 T;  1QCO A;  2VV5 A;  1YCY A;  2M16 A;  2QTV A;  5CR2 A;  3E19 A;  4RTY A;  3RER A;  1A0N B;  2CSQ A;  4XTV A;  4J9H A;  2QQB A;  2P4R A;  2EVR A;  4HKE A;  1NLP C;  2AZV A;  5M9O A;  1K9M U;  4JJC A;  1W70 A;  2FO0 A;  3G1J A;  2LCS A;  2MCN A;  1WHL A;  4A4G A;  3WVE B;  2DJZ A;  4RTV A;  4DBQ A;  2A3L A;  2MK5 A;  5AT1 B;  2FL7 A;  5GMK l;  3QZ9 B;  4PK4 A;  3RUX A;  1UGS B;  1NEB A;  4OML A;  2K57 A;  2ATC B;  4AFZ C;  1KC8 R;  1VQK T;  1YIT A;  1O9S A;  4MZM A;  2QI2 A;  2NUP B;  1RAC B;  2C0O A;  8AT1 B;  2AKK A;  2K6D A;  4QT7 A;  1EZZ B;  5LL6 S;  5IHN A;  1YJW T;  5GAO q;  2BE7 D;  2R58 A;  2KAF A;  4E47 A;  4P5N A;  2VKN A;  4K11 A;  2KRO A;  3SHW A;  2X4J A;  1JXM A;  4J6X A;  3SD4 A;  3SWN A;  2V8K A;  2PUK B;  3CXC A;  1PKS A;  1AWJ A;  5FLX E;  3DB4 A;  3VJP A;  2QA4 Q;  1CSK A;  4C8Q F;  2DD4 A;  3NTI A;  3MEU A;  1NG2 A;  1Q86 C;  5IT9 E;  4PFZ A;  1BU1 A;  1MV3 A;  4XU2 A;  1D3B A;  4Z88 A;  1PCX A;  2DIL A;  4RTZ A;  1ZSZ B;  2E4H A;  2SRC A;  4RG2 A;  5LJ3 h;  3L2R A;  1FXX A;  2F2X A;  3X24 B;  3HTR A;  3CCS Q;  1TU0 B;  3I5R A;  1VQL A;  3LGL A;  4RMO A;  1K9A A;  4HCK A;  1X2Q A;  3VS3 A;  3M58 A;  1LPL A;  2RK2 A;  3OYJ A;  3OB9 A;  4RUG A;  5GAN 4;  3PT9 A;  1IHV A;  5KYU B;  2RJC A;  4JRK A;  3V7R A;  4HT8 A;  1ZUY A;  1UJ0 A;  1GBR A;  2DXC A;  2PVG B;  1B7T A;  2C06 A;  3FIF A;  4IIO A;  2PVD B;  2LVM A;  4X34 A;  1EIF A;  4GLM A;  1VA7 A;  4OMP A;  3LW5 E;  4M78 C;  3HFO A;  5FU7 C;  4HCC A;  2LTO A;  1VQ5 Q;  2JZ2 A;  1NJI C;  1OZ2 A;  1YI2 Q;  1KQS A;  1G2B A;  1K8A C;  5GAN j;  1RAA B;  2BE9 B;  2QEX T;  1HD3 A;  5GAN h;  4C92 C;  2QAZ A;  2A7Y A;  1D0X A;  3S6W A;  1BI2 A;  1M2V A;  1OZ3 A;  3QSU A;  2E3H A;  1VQ6 T;  2V26 A;  3D7S B;  4OMF B;  2PUO B;  2F5K A;  2A37 A;  4XTZ A;  5GMK j;  3HHT B;  4JLI A;  4KH1 B;  1RAF B;  4KUI A;  1H92 A;  4HA8 A;  3EFO B;  1D1A A;  2QA4 T;  2OTL Q;  1G3Y A;  5CKD A;  2VXF A;  2BZY A;  3OSV A;  3KUF A;  2LCL A;  5GAN f;  3NMZ C;  2LJ3 A;  2DMO A;  5DLQ E;  1XQH A;  2E10 A;  2IPO B;  4OGE A;  4M7A C;  1WIE A;  1SHG A;  5A0G A;  2QQS A;  1TWB A;  2QDL A;  1JEG A;  1UTI A;  2ROT A;  2XID A;  3C4S A;  3PTA A;  4LDW A;  4C8Q A;  1M1K R;  2COZ A;  1K73 C;  1F1B B;  5GAN 5;  3MEA A;  1AZG B;  1K76 A;  2A28 A;  2NWM A;  3TSZ A;  2XD0 A;  4OF1 A;  3LX7 A;  2R57 A;  2JS0 A;  2RM4 A;  1C0M A;  1S72 A;  1M30 A;  5CVI A;  4BY6 B;  1N6A A;  3QXE B;  1VIE A;  3HFN A;  3MP1 A;  4E7Z A;  4OVA A;  1ZBX A;  4A53 A;  2COY A;  3EHQ A;  1JJ2 S;  2ABL A;  4M7D G;  2CS7 A;  4M7A D;  1GCQ A;  3G4S T;  4FT2 A;  2P0Q A;  2XKO C;  4OMQ A;  5GAM g;  4IUR A;  1C6V X;  1YHQ Q;  5CCA A;  2IVW A;  1U3O A;  3EAE A;  2O01 E;  4JJN K;  2DNU A;  4D8K A;  2KEA A;  2F2V A;  2CUB A;  4GBQ A;  4QQD A;  3OBW A;  1K9M R;  1PD1 A;  3LLR A;  4UC4 A;  1PNJ A;  2MOX A;  3CC2 T;  4M75 C;  3QO3 A;  2QQA A;  3EHR A;  2X3W D;  1X2K A;  4DBF A;  2KRS A;  1JU5 C;  4J9F A;  1QKW A;  3A8O B;  2M02 A;  2EYX A;  1WHK A;  2LRQ A;  4J7F A;  1HK9 A;  1BKB A;  2JTF A;  2DD5 A;  4PJO E;  1W1F A;  4IUU A;  4C5G A;  2KGT A;  1YP5 A;  2OTJ A;  3OYG A;  3RMQ A;  3SEM A;  1VQ5 A;  2E64 A;  1QVF P;  3J81 E;  3C12 A;  1AT1 B;  4M7A G;  1M90 C;  3M56 A;  4FYV B;  1HSQ A;  2E6N A;  2YWW A;  3Q1J A;  4CC4 B;  1YJW A;  4BDZ A;  1N27 A;  2XG8 D;  2CGH A;  1IHW A;  1PKT A;  1KQS S;  1RL2 A;  1AWO A;  5IHK A;  3G6E Q;  1M3C A;  4HVU A;  3RES A;  2E41 A;  1NPP A;  4J9E A;  4LDU A;  2YLC A;  2GTO A;  2M1H A;  4LE9 A;  1BIB A;  1AZE A;  2EYZ A;  3CCQ A;  3QHS A;  2BUD A;  3IQL A;  4N4I A;  3OMC A;  3CME Q;  1BB9 A;  1Q95 G;  3I35 A;  2ED1 A;  2XI9 A;  3M57 A;  5L23 A;  2L3Q A;  5J3B A;  2CP5 A;  4DA4 A;  2VXE A;  3OW2 S;  1IXD A;  3BDU A;  2OTL T;  4O5V A;  1W2B S;  4M77 F;  1H3H A;  4XQ3 A;  1PD0 A;  3VKI A;  3GLX A;  2E65 A;  3EG2 A;  3T9N A;  5LJ3 e;  1FYN A;  3VS7 A;  3PVL A;  1ARK A;  4HCZ A;  2KBT A;  3A8G B;  5GAN g;  3QYG B;  3REA B;  1UB4 A;  1NZ9 A;  4LUD A;  2RQR A;  1YBY A;  3EGX B;  4JS4 A;  1VQ8 T;  5GMK i;  1D0Z A;  1VYV A;  2J6O A;  3WXM B;  2DK3 A;  1Y07 A;  2DER A;  4PL6 A;  4FW2 A;  1QVF S;  2HKN A;  2OTJ Q;  2ZPI B;  5KH6 A;  4KGZ B;  4M77 E;  2P0P A;  4OMM A;  3I56 Q;  1J3T A;  4BE2 A;  3O5Z A;  2M0O A;  2EJ9 A;  3RR6 A;  2SEM A;  1RAB B;  1KK7 A;  2QGF B;  5EG2 A;  4AT1 B;  1Y71 A;  2I2L A;  3J7A F;  1PHT A;  2DYB A;  4D6W A;  3FJ5 A;  4FYW B;  4JUV A;  4F14 A;  2RN8 A;  2FG0 A;  1YHQ T;  1TSF A;  1AVZ C;  2C0T A;  3MET A;  4RG8 A;  5FU7 B;  4BI3 A;  1K4U S;  3JCM c;  4JRP A;  4A4H A;  3HP9 A;  2HQX A;  2GCX A;  2DF6 A;  2K3B A;  3CME T;  1YI2 A;  4B6M A;  4C92 E;  2RQW A;  1UHC A;  1VQM A;  1M8M A;  3A5Z B;  1AWX A;  2LQN A;  1OU8 A;  4J9B A;  3CC2 Q;  4M7D E;  4OB2 B;  5DY9 A;  3DB3 A;  4HVV A;  1Q86 U;  3P8B B;  1ZQ1 A;  1LOJ A;  4PJM A;  5IXB A;  4MMK A;  1TTH B;  3OYF A;  4KRT A;  1D1B A;  4HT9 A;  5IH2 A;  2DEQ A;  1N9S A;  3EG9 A;  1M1G A;  3CPW A;  3CC7 Q;  4RTU A;  1ZHI A;  1JO8 A;  3BY7 A;  2W0Z A;  1H64 1;  3CC7 A;  2YT6 A;  1AEY A;  4F7U F;  1KHC A;  2VUB A;  1NLO C;  2GQI A;  3I56 A;  1EX4 A;  3A8H B;  4N4H A;  4EDU A;  1D3B B;  4DOV A;  1U5S A;  1K0X A;  4M75 F;  4QVD A;  2FRY A;  3M54 A;  1K1Z A;  2LQW A;  2DXB A;  2HD0 A;  1QVG P;  4B9X A;  5GMK h;  2HAX A;  3JB9 J;  2CP0 A;  1VQ8 A;  3CC2 A;  1LNX A;  2QEX A;  1Y7X A;  1K8A U;  1OYX A;  1X75 C;  2MWO A;  1X6G A;  5GAM e;  2RQU A;  3RIR A;  5GAM d;  4M77 G;  3QPH A;  3CCQ Q;  2HCK A;  2JNG A;  1YIT Q;  1ZSZ C;  5D6X A;  1MMG A;  2EAY A;  3CCM T;  4F16 A;  1UGV A;  2OI3 A;  2EBP A;  4C8Q B;  2YUP A;  1K73 U;  2D1X A;  2L5Q A;  1C1A A;  4PFO A;  2RD1 A;  3O8V A;  4WF2 A;  1R8O B;  2ENM A;  2K5I A;  3JB9 I;  4C0F A;  1MGQ A;  2CZ1 B;  1UEC A;  5A0D A;  1Q81 C;  3V8J A;  4RCC A;  3CCR T;  2EFI A;  3V7S A;  5KYY B;  3JCM h;  5KYX A;  2LQ8 A;  3I9Q A;  4OP0 A;  5ECA A;  3CC7 T;  1QP3 A;  2RHU A;  3EFO A;  1N9R A;  3OS1 A;  4XAX B;  1T3L A;  5FU6 B;  3JB9 G;  1NPR A;  3A8L B;  3OS5 A;  2RI2 A;  1YCS B;  1VQ9 A;  2HBP A;  3L2V A;  1U06 A;  3MO8 A;  3PMT A;  2CSI A;  2C0I A;  1ZUK A;  1OPK A;  2FZK B;  1LJO A;  1ZA1 B;  1QWE A;  4M75 D;  3QKJ A;  4MDX A;  3G71 Q;  1VYT A;  1BK2 A;  3CCV Q;  2CT3 A;  4RTW A;  2D0Q B;  2NUT B;  2VB6 A;  4PLL A;  2Y90 A;  3EGD B;  1YJ9 T;  2EIF A;  2Z0W A;  1S1N A;  1TUC A;  2KE9 A;  4EMK A;  7AT1 B;  1WPY A;  1MNE A;  2O4X B;  4BI8 B;  2HL3 A;  4X9C A;  1YN8 A;  1TOV A;  3C94 A;  4EMK C;  1NBE B;  1Q81 R;  1RAI B;  1RI0 A;  3CEY A;  1GL5 A;  2VAS A;  2MI6 A;  4DEY A;  3EFS A;  3MCA B;  4F04 B;  4JJB A;  1CKB A;  3EG0 A;  1R0C B;  2VGN A;  3OYC A;  1H3Z A;  3CC4 T;  3JCM X;  3G71 A;  4QKU A;  4BB7 A;  3FLG A;  1QVG A;  1WJQ A;  4IUP A;  3N5B B;  2QA4 A;  2RO0 A;  3M0U A;  3CCR Q;  1WLP B;  5GAN 3;  2RK1 A;  1KD1 R;  2K2V A;  5L8R E;  2BIV A;  2DTH A;  2KK4 A;  2JXB A;  5I11 A;  2F2W A;  3CBM A;  4BE1 A;  1KFZ A;  4JRQ A;  4N0A C;  1UG1 A;  2CZ6 B;  1X01 A;  1UGR B;  2F69 A;  3CCE Q;  3OYY A;  2FPE A;  4CC2 A;  3C95 A;  2VC8 A;  3L2U A;  4FW1 A;  2YRD A;  2RI5 A;  1Y96 A;  2DRK A;  2YXY A;  2FRW A;  2CRE A;  4ORZ A;  1WHH A;  1MMD A;  2RB6 A;  2KI7 A;  1P92 A;  1B34 B;  4KUL A;  3INZ A;  4LN2 A;  4XTY A;  1WGS A;  2ZPE B;  2KY9 A;  2DL3 A;  4Y91 A;  3CCQ T;  4Z02 A;  4M78 E;  4L5G A;  5A0L A;  3UDC A;  4AMC A;  1OI1 A;  1ZLM A;  1KHI A;  2HMA A;  3PFS A;  2L2P A;  3CPW P;  2HSE B;  4M7D A;  4KBM B;  1BCM A;  3I55 Q;  3OYL A;  4XU3 A;  2RNA A;  2AT1 B;  4DOW A;  3MP8 A;  4PJO G;  4HXJ A;  4AFU C;  2GF7 A;  2EQU A;  1QW1 A;  5CQY A;  5HK0 A;  2DVJ A;  2KVQ G;  2RHY A;  4NS5 A;  1M90 R;  1M3A A;  1WI7 A;  2K3X A;  2DIG A;  2KR3 A;  3RKW A;  3LGF A;  2M51 A;  5GAO r;  2V1Q A;  1DJ7 B;  5CK9 A;  3NPF A; 
#chains in the Genus database with same CATH homology
 1M90 C;  1VQN A;  1B34 A;  4ZGD B;  3PIP A;  5AYF A;  2BKD N;  3M56 A;  3JB9 D;  5CO7 A;  2L8D A;  4ZGJ B;  1VUB A;  2ZPG B;  2E6N A;  3Q1J A;  2RH2 A;  2XDB A;  2LT4 A;  5KE2 A;  3VV0 A;  4ATO A;  1YJW A;  4BDZ A;  1N27 A;  2XG8 D;  4XTW A;  2CGH A;  5D6W A;  2PVO B;  1KQS S;  2GQV A;  1YIJ T;  3AHU A;  1RL2 A;  1SSF A;  4M75 A;  5KCH A;  1I8F A;  2DAQ A;  3ZBD A;  3JB9 F;  3CCE T;  5I21 A;  2EJF A;  3RES A;  3OYB A;  1G3T A;  3CCU A;  2ZPH B;  2E41 A;  2XIC A;  3JRZ A;  1NPP A;  3VU3 C;  3X25 B;  4LDU A;  4M77 D;  1YJN A;  3OYA A;  4C0D C;  2YLC A;  1NJI U;  2CZ7 B;  3CCM A;  2M1H A;  4LD6 A;  1BIA A;  1BIB A;  2NLU A;  1O75 A;  3ZFJ A;  2L3R A;  3KBG A;  3PMI A;  4BAC A;  1VQP T;  5HK3 A;  1KQ1 A;  1UEB A;  3R6O A;  3UWN A;  1M5Q 1;  3CCQ A;  4JDS A;  3QHS A;  5CKB A;  2BUD A;  1I4K 1;  4FIB A;  2P0K A;  3QII A;  4N4I A;  3OMC A;  3RKX A;  1YIJ A;  1KC8 C;  4B9W A;  4ELZ C;  3CCS A;  2XHC A;  4M7A E;  1BYM A;  5GAN 7;  5FRM A;  3MP6 A;  1GXI E;  2JUF A;  4II1 A;  2XI9 A;  3M57 A;  4O6J A;  4ZN3 A;  4DQ2 A;  5J3B A;  4DA4 A;  1BI1 A;  2VXE A;  3OW2 S;  3BDU A;  1YIT T;  2OTL T;  4O5V A;  1YJ9 A;  1W2B S;  2CKK A;  3HL8 A;  4M77 F;  3FC3 A;  4XQ3 A;  2B8A A;  3VKI A;  3GLX A;  2RHX A;  4VUB A;  2E65 A;  2X4W A;  2R5A A;  3QDR B;  4LDY A;  3T9N A;  5GMK m;  5LJ3 e;  2LT1 A;  4C5I A;  4M77 B;  3SB2 A;  2RJE A;  2D9T A;  2LC4 A;  4HCZ A;  4L6V 5;  5LJ5 f;  3A8G B;  4NL2 A;  1PSE A;  5GAN g;  3QYG B;  4EMK B;  3G6E A;  2EQM A;  4ZTJ A;  1UB4 A;  1NZ9 A;  3OQ5 A;  4C8Q D;  1FX7 A;  1WNL A;  2CZ0 B;  2ZPF B;  3OY9 A;  2X4Y A;  1Q7Y C;  1VQ7 A;  3CD6 T;  3VYG A;  5LJ3 g;  3TU4 K;  2QXF A;  1KC8 U;  4J6Y A;  4OB3 B;  4BY6 C;  3S3N A;  1YBY A;  1HXD A;  1N8R C;  5LJ3 d;  4JS4 A;  4C5H A;  1VQ8 T;  5GMK i;  3EFR A;  3NTK A;  4X9D A;  5CAI A;  2DPP B;  4JRI A;  2KMT A;  4F7U B;  3WXM B;  2DTO A;  2DK3 A;  2GFA A;  3S3O A;  1Y07 A;  2IG0 A;  4KUD K;  3CMA T;  4IUT A;  4L59 A;  3OYE A;  1KD1 C;  1UGQ B;  4PJO F;  4CI0 C;  2XK0 A;  4PL6 A;  5GAM f;  4PLI A;  2DXU A;  1QVF S;  3OW2 A;  3GP8 A;  1IZ6 A;  4EMG A;  2ZPI B;  5KH6 A;  2DXT A;  3CXC S;  1VQ9 T;  4M77 E;  2P0P A;  5KCO A;  2WAC A;  3CCV A;  3DLM A;  2JTM A;  4NOY A;  3JCM d;  4A54 A;  3OYH A;  4OGC A;  4KT0 E;  1M9S A;  1YHQ A;  4BE2 A;  4M7A A;  4CRI A;  3VUB A;  5LJ5 g;  4ZTF A;  3TEE A;  2M0O A;  2G3R A;  2OAU A;  2EJ9 A;  5GMK e;  1JJ2 A;  3CD6 A;  1VQO T;  4C92 B;  3ME9 A;  4BDY A;  3H6Z A;  2V8J A;  3DLL A;  2QDY B;  2MF2 A;  5EG2 A;  4F7U E;  3V8K A;  1Y71 A;  2I2L A;  4LDX A;  3J7A F;  4M7D B;  2L89 A;  1G5V A;  4D6W A;  4F7U G;  4MDW A;  3P8H A;  3OSS C;  3CCL T;  2FHD A;  1M4Z A;  2EJG A;  2PQW A;  2VYT A;  4JUV A;  4A4F A;  5DM7 R;  3OYN A;  4OB0 B;  1AHJ B;  1NE8 A;  4M75 E;  4RKU E;  3OYM A;  4C5E A;  5DLO A;  1VQP A;  1YHQ T;  2KDS A;  4TVR A;  3MET A;  4RG8 A;  5FU7 B;  4BI3 A;  4M78 B;  3JCM c;  3A8M B;  2P4T A;  2WSC E;  4JRP A;  1G3W A;  4A4H A;  3HP9 A;  2DO3 A;  2FVU A;  3G7Z A;  3CPW S;  3OS0 A;  2HQX A;  3RKY A;  1M1F A;  2GCX A;  2K5F A;  4A4K A;  4M78 F;  3G4S A;  3CME T;  1YI2 A;  4MML A;  4A4E A;  1U8R A;  1M90 U;  1VQO A;  4C92 E;  1G3S A;  2E1H A;  3M4Y A;  1VQM A;  4R55 A;  1JRI A;  4XK8 E;  3A5Z B;  2RHI A;  2X35 A;  3OMG A;  2PU9 B;  2QQR A;  4M7D E;  2CYZ B;  3LH0 A;  5LJ5 j;  3QUI A;  4M77 C;  3SDZ A;  4OB2 B;  1PSF A;  4XU0 A;  5DY9 A;  3QJY A;  1VQ7 T;  1Y96 B;  1VQN T;  4IUQ A;  4EMH A;  2YLB A;  3I55 T;  3DB3 A;  1Q86 U;  3P8B B;  4FT4 A;  1ZQ1 A;  1YCY A;  2M16 A;  2VV5 A;  3M4G A;  3TRE A;  1LOJ A;  5J26 A;  5LJ5 h;  5CR2 A;  4C92 G;  3E19 A;  2YRV A;  3RER A;  1VQK A;  3SFM A;  3JCM V;  2DTI A;  4MMK A;  3OYF A;  4XTV A;  4C8Q G;  3VYH B;  4PJO D;  2ZZD A;  4HT9 A;  3GIB A;  2QQB A;  3V7C A;  1X6O A;  2DEQ A;  4EPC A;  1N9S A;  4HKE A;  1M1G A;  4ZN1 A;  5M9O A;  1K9M U;  3CCJ A;  3CPW A;  1KQ2 A;  2LDM A;  3L2W A;  3NTH A;  4V2S A;  1ZHI A;  3BY7 A;  4A4G A;  1H64 1;  4FL6 A;  3WVE B;  2DJZ A;  2EKO A;  3CC7 A;  4J5Y A;  2F5T X;  3GPL A;  4QQG A;  5KE3 A;  2A3L A;  3FB9 A;  2OTJ T;  4F7U F;  3JCM W;  2FL7 A;  5GMK l;  3GNF B;  3QZ9 B;  3OA6 A;  1KHC A;  2EQJ A;  2VUB A;  3RUX A;  4Y28 E;  5GAN e;  1VQ5 T;  1UGS B;  2R5M A;  5GAN 2;  1UGP B;  1JB0 E;  3I56 A;  2K57 A;  3A8H B;  3E9F A;  4N4H A;  3L2Z A;  1D3B B;  1O9S A;  3BW1 A;  2QI2 A;  3GNG A;  4MZM A;  3SWN C;  3LYI A;  4DOV A;  3OYK A;  1KG1 A;  4M75 G;  3HKS A;  3PGG A;  4M75 F;  3HRT A;  4QVD A;  2Y4X A;  2E70 A;  3M54 A;  4C92 A;  4C92 F;  3G6E T;  2DXB A;  2HD0 A;  3E1S A;  4LD9 K;  5LL6 S;  4ELY C;  1YJW T;  1XOV A;  4GLK A;  4QVZ A;  5GAO q;  3MHX A;  1YIT A;  4B9X A;  3G71 T;  2R58 A;  2KAF A;  4E47 A;  5GMK h;  4NL3 A;  4P5N A;  2HAX A;  3JB9 J;  5C6S A;  2DZ9 A;  3NFC A;  2O4X A;  4M7A B;  4BE0 A;  1VQ8 A;  3CC2 A;  4M7D D;  2XDP A;  2X4J A;  2RI3 A;  1LNX A;  2QEX A;  1Y7X A;  4J6X A;  4PJO C;  1K8A U;  1OYX A;  2HNI A;  1X75 C;  2MWO A;  3SD4 A;  3SWN A;  3JCM Q;  1KD1 U;  2V8K A;  2XU8 A;  2K3Y A;  2PUK B;  4C0D B;  5GAM e;  3CXC A;  5FLX E;  3DB4 A;  3RIR A;  3VJP A;  5GAM d;  4M77 G;  3QPH A;  4C8Q F;  2EWN A;  2LX9 A;  3JB9 H;  1M1K U;  5D6Y A;  1VQL T;  2JNG A;  2DD4 A;  3X20 B;  5D6X A;  3CMA A;  5J39 A;  1VQM T;  2DKG A;  2EAY A;  3CCM T;  2QTX A;  2LQK A;  3H8Z A;  3MEU A;  3NTI A;  5IN1 A;  1Q86 C;  2DZC A;  4M78 A;  5IT9 E;  5GAO p;  1BI3 A;  2V8I A;  3FDR A;  4JLG A;  4XU2 A;  4C8Q B;  2Y4Y A;  1D3B A;  1I81 A;  1QVG S;  1K73 U;  3TCJ A;  2L5Q A;  2VGM A;  4E7I A;  3OYD A;  1WQ7 A;  2RD1 A;  4RG2 A;  5LJ3 h;  3L2R A;  3O8V A;  1U1T A;  1FXX A;  1VQ4 T;  4WF2 A;  1R8O B;  4MZT A;  3X24 B;  3OYI A;  3CC4 A;  2KQW A;  2K5I A;  4FM4 B;  5HKC A;  1VQL A;  3LGL A;  4C0F A;  3JB9 I;  1MGQ A;  2CZ1 B;  1Q81 U;  3VUZ A;  4RMO A;  5A0D A;  5FRN A;  1Q81 C;  3V8J A;  2X4X A;  4ME7 A;  3KXT A;  4RCC A;  1VQK T;  3CCR T;  3M58 A;  2EFI A;  4FU6 A;  4BI4 A;  2RK2 A;  1W2B A;  3OYJ A;  3OB9 A;  3V7S A;  3PNW C;  3JCM g;  5GAN 4;  3PT9 A;  4OB1 B;  3JCM h;  4M77 A;  5GAN 8;  4GY5 A;  2LQ8 A;  2RJC A;  3WVD B;  3QBY A;  4PJO B;  3CCE A;  4JRK A;  4OP0 A;  3V7R A;  4HT8 A;  3CC7 T;  1QP3 A;  1QP2 A;  1W4S A;  2DXC A;  2MAM A;  2RHU A;  2PVG B;  1VQ6 A;  5CIU A;  3L42 A;  5LJ3 j;  1N9R A;  3OS1 A;  4XAX B;  1I5L A;  2MMP A;  2C06 A;  3RMS A;  4J8O A;  5FU6 B;  3FIF A;  4X34 A;  2PVD B;  2LVM A;  5CK9 A;  1EIF A;  3JB9 G;  1Q82 U;  1NPR A;  3A8L B;  3OS5 A;  4QQ6 A;  2RA2 A;  5LJ5 e;  3M9Q A;  3JCM b;  4FSX A;  2RI2 A;  3FJP A;  1VQ9 A;  3LW5 E;  2QQ9 A;  4M78 C;  2HBP A;  3L2V A;  3HFO A;  3MO8 A;  5FU7 C;  3PMT A;  4HCC A;  4C8Q C;  2LTO A;  3SWN B;  2JZ2 A;  1NJI C;  1OZ2 A;  3I55 A;  1KQS A;  1FWZ A;  1WQW A;  5GAO n;  5GAN j;  1K8A C;  2QEX T;  4M75 B;  1LJO A;  5GAN h;  2LCC A;  4C92 C;  5HY6 A;  2A7Y A;  3ZEH A;  4M75 D;  3F70 A;  2JOY A;  3S6W A;  1BI2 A;  3QKJ A;  3FRN A;  2M9U A;  4MDX A;  1XTD A;  5LJ5 d;  1OZ3 A;  3QSU A;  1VQ6 T;  4OMF B;  2D0Q B;  2PUO B;  3BFM A;  2JVV A;  4PLL A;  2Y90 A;  5GAO l;  2F5K A;  4XTZ A;  2EIF A;  1YJ9 T;  5GMK j;  3HHT B;  3BDL A;  4JLI A;  5CKE A;  5I2S A;  4E7H A;  1Q82 C;  4EMK A;  4KUI A;  4ZGE B;  4XTX A;  4HA8 A;  1Q7Y U;  4QW2 A;  5LJ3 f;  2QA4 T;  1WPY A;  3CPF A;  2HQE A;  1G3Y A;  5CKD A;  2O4X B;  4BI8 B;  2MWP A;  5GAM h;  2VXF A;  4X9C A;  3OSV A;  3C94 A;  3KUF A;  2LCL A;  4EMK C;  5GAN f;  5A2Q E;  5DLQ E;  1RI0 A;  2K4Y A;  3CEY A;  3ER0 A;  2MI6 A;  4EDU A;  3EFS A;  3MCA B;  2D6F A;  3QJ6 A;  1XQH A;  2E10 A;  4OGE A;  2E6Z A;  5FRO A;  4M7A C;  3JCM J;  1M1K C;  5I2M A;  4HCB A;  3GF5 A;  4PJO A;  1V29 B;  1WJS A;  2VGN A;  4LDV A;  4J7I A;  3OYC A;  1H3Z A;  3CC4 T;  3JCM X;  3UPU A;  2JN0 A;  2ZPB B;  1IRE B;  4XU1 A;  2QQS A;  5A0G A;  3G71 A;  1QVP A;  3FEO A;  2E12 A;  2RJD A;  2K5L A;  4PNO A;  4BB7 A;  3CCS T;  2XID A;  3C4S A;  3FLG A;  4LDW A;  3MEW A;  3PTA A;  1BI0 A;  4IKF A;  1QVG A;  4C8Q A;  1WJQ A;  2ZGW A;  4N0A A;  1K73 C;  5GAN 5;  4IUP A;  3N5B B;  3MEA A;  3GOX A;  2QA4 A;  2RO0 A;  3ASK A;  4C0Z A;  2LNV A;  5GAN 3;  5IAY A;  2XD0 A;  2RK1 A;  4OF1 A;  3LX7 A;  5CKH A;  2R57 A;  2E5Q A;  2YHT A;  3L1A A;  2XDD A;  3CBO A;  2K2V A;  2RM4 A;  4MZP A;  3HRS A;  1S72 A;  2DIQ A;  5CVI A;  4BD3 A;  5GAM j;  3LWH A;  5L8R E;  5CQX A;  2BIV A;  4Q5W A;  4BY6 B;  1N6A A;  2DTH A;  1VIE A;  2KK4 A;  2EQK A;  3QXE B;  3HFN A;  3MP1 A;  4J83 A;  1WJR A;  2AHJ B;  3CBM A;  4BE1 A;  4OVA A;  4N0A C;  4JRQ A;  5GAO m;  1ZBX A;  2CZ6 B;  1X01 A;  4A53 A;  1UGR B;  2F69 A;  3JSC A;  4PKC C;  4E7L A;  3OYY A;  1JJ2 S;  3CCL A;  4M7D G;  3M53 A;  4XTU A;  3C95 A;  2VC8 A;  4YTL A;  3L2U A;  5C0M A;  2CS7 A;  2EYQ A;  4BUG A;  4M7A D;  2RI5 A;  1Y96 A;  3OBY A;  3JCM P;  2WSE E;  3G4S T;  4FT2 A;  3CME A;  1YI2 T;  2P0Q A;  3QG1 A;  4J6W A;  1U1S A;  2XKO C;  5CKF A;  2RHZ A;  4F7U A;  3MEV A;  5GAM g;  4IUR A;  1XNI A;  2RB6 A;  3E9G A;  3JCM e;  1K9M C;  3URG A;  1P92 A;  1B34 B;  3M5A A;  4KUL A;  1QVF A;  3X26 B;  4M7A F;  2FB7 A;  1TH7 A;  5CCA A;  2IVW A;  2RJF A;  3INZ A;  3S3M A;  4XTY A;  3EAE A;  2O01 E;  4JJN K;  3CCV T;  1WGS A;  2ZPE B;  2KY9 A;  4Y91 A;  1N8R U;  4M78 D;  2WSF E;  4QQD A;  3OBW A;  3CCQ T;  3JAM E;  4Z02 A;  4M78 E;  3LLR A;  4C0G A;  4UC4 A;  4L5G A;  4C8Q E;  3M55 A;  5A0L A;  4E7K A;  3UDC A;  4C92 D;  3OS2 A;  1OI1 A;  4M78 G;  1M8V A;  3CC2 T;  1KHI A;  4QVC A;  2ZCF B;  3QYH B;  2KSS A;  4M75 C;  3QO3 A;  3PFS A;  3DKM A;  4JS5 A;  2QQA A;  4E7J A;  2OTL A;  3M59 A;  4RCB A;  4M7D A;  4KBM B;  3L2Q A;  3OYL A;  4XU3 A;  3A8O B;  3UT1 A;  3J80 E;  1MHN A;  2H3J A;  1JBM A;  2LRQ A;  3X28 B;  3HPW A;  4DOW A;  4J7F A;  1HK9 A;  3MP8 A;  4N4G A;  5FU6 C;  3LWI A;  3CCJ T;  4PJO G;  3QZ5 B;  5GAN d;  2FYK A;  2GF7 A;  2EQU A;  1BKB A;  2JTF A;  5GAN 6;  1QW1 A;  2DD5 A;  3CBP A;  3HRU A;  5CQY A;  1VQ4 A;  3JCM f;  4PJO E;  4M7D C;  5HK0 A;  4IUU A;  3CCU T;  2RHY A;  2KVQ G;  4NS5 A;  1S72 T;  1YJN T;  3V8L A;  4C5G A;  2K3X A;  2DIG A;  2OTJ A;  3OYG A;  3RMQ A;  2DVE A;  3LGF A;  3RKW A;  3HSB A;  4M7D F;  2GFU A;  5GAO r;  1VQ5 A;  2E64 A;  3P8D A;  3CCR A;  3J81 E;  3I56 T;  4R56 A;  1DJ7 B;  4IUV A;  3C12 A;  4M7A G;  3PIO A;  1VIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...