3H0HA

Human fyn sh3 domain r96i mutant, crystal form i
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
b'GGTGVTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 10
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0hA00
2I0NA 4D8DA 4OMMA 4IIMA 3IQLA 4M4ZA 2EGAA 2BZXA 2GBQA 3VS5A 4HXJA 4Y92A 2DL4A 3M0PA 1UFFA 2EYWA 1KIKA 2DILA 2HDAA 1YNZA 2CUBA 3QWYA 1PRLC 4KRTA 1YCSB 2PZ1A 2YSQA 1PNJA 2K7AA 4JJCA 2CH4W 1YWPA 1AWOA 4AFQC 2LP5A 2EW3A 1QKWA 2B86A 2KR3A 2K6DA 5I11A 1W6XA 2RNAA 1JQQA 2MCNA 4JZ4A 1M3BA 2V1QA 1KJWA 1UJ0A 4J9IA 4RTVA 1AWJA 3REAB 3UATA 2DBKA 2H8HA 1K0SA 4RTZA 1NG2A 1Y0MA 1SRMA 1T0HA 1NLOC 2DJQA 2KEAA 2ROLA 1W70A 2AKLA 2VWFA 1T3SA 1YWOA 2KRSA 2DVJA 1SRLA 2BZ8A 1UGVA 2AKKA 1K0XA 1SSHA 4HVVA 2D1XA 3M0UA 1ZSGA 1AVZC 4J9FA 2FPDA 2RQRA 2OJ2A 1TG0A 1BBZA 3U23A 1E6GA 2DF6A 2RF0A 5I22A 2VVKA 2GTJA 2JT4A 1JXMA 2DA9A 4K11A 2J06A 3JV3A 4ZNXA 4OMOA 2RMOA 2DL7A 2RQTA 1BK2A 1WA7A 1VYUA 1X69A 5FWCA 1UHFA 4OMQA 2O88A 3TSZA 2DYBA 1AD5A 2L2PA 2DBMA 2JS2A 1GCQC 3PVQA 2HSPA 2L0AA 1ARKA 1HD3A 1WIEA 2RPNA 4Z89A 1WYXA 5FWBA 2KXCA 3SHWA 1GCPA 2EYYA 2ENMA 1UDLA 1PRMC 2F2VA 3O5ZA 1M30A 2C0TA 2F2XA 2P4RA 1QKXA 1AOJA 1M3CA 2D0NA 2DM1A 1H8KA 3CQTA 1QCFA 1UTIA 4AG1C 2A36A 1GFCA 1BU1A 1ABQA 2JXBA 1WLPB 2LQWA 2K9GA 2KNBB 1OOTA 2RN8A 1EFNA 4D8KA 3REBB 2CT4A 5IXFA 3M0SA 4OMNA 1ZX6A 2ECZA 1NLPC 2ED0A 1Y57A 2GQIA 3TSWA 1JEGA 4IIOA 2VKNA 2A28A 4JJDA 1WFWA 4HVUA 4AFZC 1MV3A 2MIOA 1KSWA 4J9GA 2OI3A 1X43A 4R0KA 2QDLA 4LN2A 1UG1A 1GFDA 1WXBA 1FYNA 2J6OA 1ZUYA 1J3TA 1G2BA 4HCKA 1PKSA 1JXOA 4QT7A 3SEMA 1HSQA 4AG2C 1RI9A 2AZSA 5HCKA 4F16A 1QLYA 2ED1A 2JW4A 4AFSC 1WXUA 2CUDA 3KFVA 3ZL7C 1K76A 4RUGA 1SEMA 5GJVB 4RTYA 3ULRB 2FO0A 2O31A 2LJ1A 4Z8AA 2FPEA 3UA6A 1X6GA 3VRYA 4HVWA 2LNHB 1UHCA 3M0TA 3NGPA 2SEMA 2CREA 2O2OA 1NM7A 3EG0A 4F17A 3VS2A 1AWXA 4OMLA 2EKHA 1PHTA 3H41A 2L3QA 1RUWA 2YUPA 1XOVA 5IH2A 2EPDA 1CKBA 2DE0X 2GGRA 4WCIA 1TUCA 2EYZA 4J9BA 1GL5A 2LZ6B 2HBWA 1RLPC 1SPKA 1OEBA 1ZLMA 3FJ5A 1AZEA 1U06A 2KROA 1PKTA 2LJ0A 1YP5A 2ROTA 4GLMA 1MV0B 1UJYA 3I5SA 1AWWA 1SHGA 1UUEA 1M3AA 1U5SA 3M0RA 1UE9A 2KRNA 2KYBA 3EGUA 3H0HA 4J9DA 1GBRA 5IHKA 3VS7A 4DEYA 2NUZA 1ZUKA 3QWXX 4RTUA 2GNCA 2JTEA 2X3XD 5EC7A 4CC7A 3RBBB 3NMZC 4LUDA 1NYFA 3NPFA 3VRZA 1X27A 2KGTA 3A98A 4JJBA 2DRMA 2FPFA 1T0JA 2KE9A 1B3QA 2LMJA 3H0FA 4DEXA 1Z9ZA 1OPLA 2M0YA 5IHIA 2KRMA 2E5KA 1QWFA 3H0IA 4LUEA 4RTTA 2IIMA 1N5ZA 2O9VA 2YDLA 1E7OA 2PNIA 2LQNA 2C0IA 2DRKA 4CC4B 1IO6A 2LJ3A 3TVTA 2GTOA 2OAWA 3EHQA 2KT1A 2CSIA 2M51A 2YUNA 2J6FA 1JO8A 3GBQA 3M0QA 4J9CA 1OPKA 2FRWA 1FMKA 1HJDA 1B07A 2YUQA 3VS1A 2EGCA 2K3BA 1GBQA 2JMAA 1GCQA 2NWMA 1KFZA 1E6HA 4J9HA 1I0CA 1JU5C 1I1JA 1A0NB 5GJWB 2FEIA 3EHRA 2DL5A 2EVRA 2JM8A 5ECAA 2CT3A 2EYXA 5L23A 3VS3A 2JM9A 2X3WD 1MUZA 2XMFA 4LE9A 1QWEA 2KBTA 3THKA 2K79A 2AK5A 3EG1A 4ESRA 4J9EA 2AZVA 1NYGA 2D8HA 5IHNA 2C0OA 2KYMA 3LH5A 3UF4A 2HEQA 2MOXA 4FSSA 2FG0A 2EGEA 3EG2A 2A08A 1RLQC 3I35A 3C0CA 1Z9QA 3VS6A 2K2MA 1ZUUA 2DX1A 4CC2A 1LCKA 4F14A 1M27C 2DMOA 1PWTA 1H92A 1GRIA 2L3SA 1T3LA 2L3PA 2RQVA 3RNJA 1UECA 1H3HA 3EG3A 3UA7A 2G6FX 2W0ZA 2EBPA 1VYTA 1YN8A 4X1VA 4E6RA 2YT6A 2J6KA 1X2KA 2A37A 4ORZA 2KXDA 1X2QA 1BB9A 2RQWA 1SHFA 4JZ3A 3I9QA 2KT8A 1CSKA 2DL8A 1NEBA 1OV3A 5IXBA 3VS4A 1VYVA 3PE0A 2JS0A 1K4US 1WDXA 1CKAA 4GBQA 3I5RA 4Z88A 1TUDA 1M8MA 1K1ZA 1ZBJA 2SRCA 1WXTA 4EIKA 3NHNA 2O9SA 1X6BA 2CH4A 1AEYA 1VA7A 4A63B 1W1FA 2FRYA 1AZGB 4RTWA 1WI7A 2YUOA 2V1RA 2W10A 2LCSA 1G83A 2EQIA 1S1NA 2LX7A 4LNPA 3R6NA 3VS0A 2DLPA 2J7IA 1V1CA 2D8JA 2CSQA 1U3OA 4AFUC 2F2WA 1WX6A 2BZYA 2ABLA 4OMPA 2RQUA 3PVLA 1K9AA 2JMCA 2HCKA 2BTTA 2DNUA 2ESWA 1I07A 5FW9A 2J05A 1NEGA 4JPBW 2CDTA 2PTKA 1ABOA 2DL3A 4RTXA 4CC3A
chains in the Genus database with same CATH superfamily
5KH6A 2QDYB 1D1BA 2QI2A 4M4ZA 3OS0A 2EGAA 2I2LA 1AHJB 1WHGA 3M57A 2E1HA 1QVGS 3J80E 1VQ4T 2DEUA 2DL4A 2JOYA 1S72T 1KIKA 1M2VB 2DILA 1K8AR 2CP7A 3CCEQ 3CMAQ 2O01E 3BY7A 1MMDA 2PZ1A 1DJ7B 3S6WA 2K7AA 4C92G 4BD3A 1VQ6T 2OTLA 3EH1A 2B86A 3GP8A 2XU8A 2X35A 4C8QC 3CC4Q 4ZTJA 2V1QA 4C8QB 3JCMV 1UJ0A 4J9IA 1K0SA 1NG2A 2QA4Q 4MMLA 3OY9A 1SRMA 2DIGA 2HD0A 2E5QA 1T0HA 2DJQA 3CCJA 2KEAA 4IUPA 1T3SA 1XJWB 1U1TA 2CP2A 1UGVA 4RMOA 2RI3A 4O5VA 4HVVA 3I55A 4PLIA 2OJ2A 4II1A 1BBZA 2ATCB 1Q82R 4FW2A 3L2QA 2QASA 3FEOA 2Y4XA 2RF0A 3TCJA 5KYXA 3HPWA 1VQPQ 2VVKA 3JCMh 2OTJT 3SB2A 1JJ2S 2J06A 2VXEA 2D9TA 2P0QA 1OU8A 3OYNA 3GLXA 1YBYA 2FB7A 1UHFA 3G71T 3MP8A 3RKYA 2QQ9A 5GAOn 3V8LA 3JB9H 2L2PA 3G1JA 1BI0A 2EQKA 2MWOA 2ZPEB 2X4WA 3X28B 1HD3A 4Z89A 2LCLA 1VQ7A 4IUUA 2DTOA 2RA2A 4R56A 4C8QD 3EG9B 2EYYA 3O5ZA 1SG5A 3JCMe 1RI0A 4M77G 3MCAB 4QKUA 2E41A 1RAFB 1WJSA 1AOJA 2DM1A 4M78A 1QCFA 2A36A 2CP5A 1YHQA 1XQHA 1BU1A 2AT1B 2YXYA 4LD9K 1IREB 1WLPB 2LQWA 4M7DF 2K9GA 1YI2T 2KNBB 3RDVA 2XK0A 4M77E 1RABB 1OOTA 3QYHB 2HL3A 1EFNA 4IUQA 4D8KA 1M8VA 5DM7R 1N9SA 3REBB 3M0SA 4M7AF 3QJYA 4OMNA 1ZX6A 3A8HB 3QYGB 8ATCB 1Y57A 2A28A 1W2BA 2P0PA 3BFMA 2GF7A 2HKQB 1RAHB 1IRXA 4A4EA 2EYQA 4LN2A 2P0KA 3GIBA 2A0FB 5FRMA 1G2BA 1JXOA 3SEMA 4C0DC 4E7IA 5GAN4 1HSQA 5GAOm 4C0DB 1RI9A 1D1CA 5GAMh 5I21A 2HQHA 2VYTA 1K76A 2DTIA 4RUGA 3CCRA 4PJNA 4M77B 1BIBA 4Z8AA 4PJOG 5KYXB 2KK4A 3EFOA 3M0TA 3QBYA 2OTLQ 2F69A 4QQDA 2RJDA 2DYIA 2EKHA 2OX7A 4PJOE 2RI5A 2YUPA 4B9XA 5GAMe 3CCLT 1YIJT 2EPDA 4QVZA 4WCIA 1TUCA 5GAMj 5GAOq 1GL5A 2HZYA 1VQNT 3G4ST 1RLPC 1SPKA 1OEBA 1AZEA 5KYNA 1V29B 5LJ5d 3VKIA 4MZTA 5HY6A 1PKTA 3CCJQ 1YP5A 4GLMA 5GAMg 3CCUT 3I5SA 4J5YA 2ZPBB 4OMFB 1U5SA 1VQ5T 1RACB 3OYEA 3PNWC 4ME7A 1GBRA 3WVEB 3RERA 3HTRA 3E2UA 2E6NA 4EMGA 2BIVA 3OYCA 3A8MB 1YJ9A 4CC7A 3L2WA 4PJOC 1X27A 3GNGA 4PJOB 3PIPA 4XTWA 1PM3A 4ATOA 1B3QA 2QK0A 3S3MA 1PSEA 5IHIA 2E5KA 1QWFA 1N8RU 3RKWA 1QCOA 2LQNA 1VQ9T 3CMAT 4DA4A 1N8RC 2DRKA 1IO6A 4MDXA 3TVTA 2DKGA 2OAWA 2KT1A 1MGQA 2M51A 1IGUA 1VQ7Q 4J9CA 2XICA 2G3RA 4ZGEB 3OS5A 2KQWA 4N4HA 3CC7Q 1B07A 3M54A 1VQ8T 1OYXA 2K3BA 4N0AA 1GBQA 2NUPB 4EDUA 1TSFA 1WQWA 2NWMA 1E6HA 2CKKA 1YHQQ 1ZQ1A 1K73U 3QO3A 1XTDA 1R77A 2QA4T 2K4YA 3ZFJA 2ZPIB 3CCVA 1C0MA 2CT3A 2E3HA 5L23A 4XK8E 3VS3A 1Q86U 3THKA 4LDXA 1R0BG 4ZGJB 3DLMA 5FROA 5A2QE 1Q86C 4HT9A 4PFOA 2KDSA 1KQSP 4M75F 2P84A 2M16A 2KYMA 3LH5A 3OW2P 2MOXA 3EG2A 1Q81U 1B34A 3ASKA 1Q7YR 3QUIA 1Z9QA 3NFCA 3VS6A 1M90R 1ZUUA 4CC2A 1Q81C 4QVDA 3OQ5A 1OX9A 2R5AA 4KBMB 3FLGA 1YJWA 2E64A 2RHUA 2JJ9A 5FLXE 3CCRQ 2L3PA 1UECA 1H3HA 5GAMf 1RL2A 2RH2A 3EG3A 3UA7A 4FYXB 2G6FX 2W0ZA 2EBPA 1YN8A 2LC4A 3RUXA 4A53A 5GAOp 2J6KA 3VYHB 4ORZA 2QG9B 3OSSC 5CKDA 2KT8A 1TUGB 1B7TA 2DETA 1IZ6A 1VYVA 5LJ5e 1WDXA 3I5RA 5LJ5j 4A4GA 2DXCA 1K1ZA 4HKEA 3OYDA 1WXTA 3NHNA 2FRYA 2W10A 3S3OA 4HCCA 1OZ2A 1KHIA 1S1NA 4LNPA 1AT1B 1JBMA 2EJGA 3BE3A 4D6WA 1K9MC 2K3YA 2D8JA 2K5LA 3KXTA 4E7KA 3GF5A 5LJ3d 3JB9I 3OYGA 2BE7D 3CCEA 2QTVA 2RHYA 3M55A 3PVLA 2JMCA 3HFOA 2ESWA 2YWWA 2RK2A 4JPBW 2CDTA 4BE0A 4BB7A 1D0XA 4F7UG 3OW2A 2XHCA 2BZXA 3CC4A 1QVFS 2EYWA 5HK0A 1B34B 4PJLA 2DTHA 1I8FA 1ZHIA 2OTLT 3LLRA 4KRTA 4BACA 1BCMA 2DERA 4F7UE 5GAN6 2CH4W 4FSXA 1AWOA 2LP5A 2A3LA 2K6DA 2HQXA 5CVIA 2RHXA 2NUTA 2EFIA 2PVOB 2RNAA 2XDDA 4KGXB 1KJWA 4IUVA 3JCMQ 4RTVA 4JRIA 3CCJT 2H8HA 1VQPA 4C0ZA 1FX7A 2O4XA 2X4YA 1NLOC 2CZ1B 3I55T 3JSCA 1W70A 2AKLA 2VWFA 2DD4A 3VYGA 2DVJA 1EZZB 1VQLA 3CD6A 1SRLA 1K0XA 3M0UA 1KQSS 4F7UB 2K5IA 3U23A 2HSEB 2ZAEA 3HFNA 4FT4A 5KYWA 2ZPFB 5GMKi 3QHSA 5I22A 5KYUA 4C8QF 4EPCA 1D0YA 2RJCA 3FJPA 4KH1B 3JV3A 4ZNXA 4OMOA 2RMOA 2DL7A 3M9QA 3PGGA 3PFSA 1X69A 4FIBA 2QTXA 1M1KC 4E7ZA 1AD5A 1EX4A 2DZ9A 1VQ7T 2JS2A 4XTVA 1TTHB 3JB9J 3T9NA 1GCQC 3UWNA 4PK4A 5GAN5 3OS1A 1Y7XA 1ARKA 2Z0WA 3X26B 4C8QG 4FYWB 4QQGA 4J7IA 5CKBA 1PRMC 2PVGB 1YHQT 4ELZC 3CCSA 2C0TA 1PD0A 1KC8U 2F2XA 2P4RA 3RR6A 1M3CA 3WXMB 2BUDA 2VXFA 3RMSA 1KC8C 1GFCA 3LYIA 4HA8A 1TH7A 1ABQA 1BYMA 1O9SA 4UC4A 1PCXA 2Y4YA 4JRQA 5CAIA 5LJ3e 3JCMX 1XNIA 1LOJA 4NOYA 2RHZA 4X9DA 5LJ3j 2V26A 2CT4A 2NUTB 4F04B 2ECZA 4AT1B 5DY9A 2XI9A 2R5MA 4JS5A 4JJDA 4RTXA 4KH0B 3D7SB 3TQ7P 1LJOA 4B9WA 1UG1A 1WXBA 5GANd 2J6OA 5CR2A 1BI2A 4HCKA 1PG5B 4J6XA 4QT7A 4PFZA 4XTZA 3CCRT 4AG2C 2R57A 1UGRB 3QZ5B 4IUTA 2DVEA 2ED1A 2JW4A 5GJVB 3ULRB 2O31A 1W2BP 3UA6A 5KYWB 1X6GA 4RCBA 4HVWA 5GMKl 5KYUB 1Y96B 3QIIA 5D6XA 4JLIA 3M5AA 1NM7A 3VS2A 2V8KA 3CC2Q 3A1PA 4OVAA 1PHTA 3LW5E 2JN0A 4E7HA 4LDYA 5DLQE 3CBOA 3C95A 3BDLA 1CKBA 5CQXA 2K2VA 2LZ6B 2HBWA 4VUBA 1ZLMA 5GMKh 1N8RR 3CXCP 1MMNA 4M77F 2KROA 2DZCA 1M3AA 5GAN2 2YLBA 1VQLQ 3CD6Q 1D0ZA 1UE9A 3CCQA 2KRNA 3I56A 3NTHA 4J9DA 3CPWA 4ZTFA 2JTMA 3MO8A 1R0CB 1YJ9T 3QZ9B 3QWXX 2DXTA 2IG0A 4LDWA 2JTEA 2X3XD 3NMZC 1NYFA 1Y07A 1NJIC 3VRZA 5GMKe 3CC7A 1K73R 2KGTA 2FYKA 1I5LA 2FPFA 2KE9A 5GMKj 3P8BB 4YTLA 2RJFA 3SFMA 4RTTA 1N5ZA 2YDLA 1Q86R 1E7OA 3JCMg 3V7CA 4LDUA 4ZGDB 4QQ6A 4PJMA 2HKNA 4M7DA 3M0QA 1UEBA 2CGHA 3FRNA 2EGCA 3CCSQ 4M7AA 2EQMA 1Q81R 2D6FA 1SF9A 2MK5A 4PJOF 4XQ3A 3OBWA 3CCVT 1A0NB 2WSCE 2FEIA 2EVRA 4M78G 4X34A 1U8RA 3RMQA 4KT0E 3OBYA 5ECAA 4LD6A 4JUVA 1KG1A 1YFNA 2KBTA 1M1FA 3DB4A 1TOVA 3L2VA 1LVKA 2L8DA 1G3YA 2K79A 3MHXA 3GPLA 2AK5A 3EG1A 5GANe 4M78E 3L2ZA 2AZVA 3CXCA 2HBPA 5GANj 5GMKm 4BUGA 3UF4A 4FSSA 2A08A 1O75A 2H3EB 3JCMP 1YJWT 1OULA 4FL6A 4O6JA 2QQRA 4M7DE 2DMOA 1PWTA 3FC3A 2B8AA 2E65A 4E47A 3MEWA 2HQEA 3JCMJ 4P5NA 2MPXC 1K9MR 1T3LA 2MWPA 1HK9A 2V8IA 2K5FA 4LDVA 4KGZB 2CS7A 1W2BS 1WQ7A 1VQOA 1K8AC 4X1VA 1MMGA 4M78C 4Z02A 2A7YA 3LH0A 4M78B 4DOVA 1SHFA 3I9QA 3JCMc 3V7RA 1NEBA 5IXBA 4BI3A 2ZCFB 3GNFB 4OP0A 2BKDN 2JS0A 3JB9D 1K4US 4E7SA 1WJQA 4JRPA 1TUDA 4C5HA 1ZBJA 4M7DC 2SRCA 2KMTA 3OYKA 1D3BA 4EIKA 2IVWA 3OYJA 4M7DB 1D1AA 3E9FA 2CH4A 1VA7A 4A63B 2M1HA 4RTWA 3LGFA 1WPYA 3PMTA 1G83A 3JCMf 2EQIA 3CCQQ 3I56Q 3R6NA 3VS0A 4KULA 2KVQG 4BE1A 3CCET 5J39A 1V1CA 1RAAB 2CP0A 3H9NA 1WX6A 3E19A 3OYAA 1OX8A 2L5QA 3A8OB 4C5EA 5CCAA 2RHIA 5A0LA 1NEGA 2DXUA 3M59A 5KCOA 3LWIA 3L2UA 1P92A 2QEXA 3CC4T 4OMMA 4IIMA 3QKJA 3IQLA 5C0MA 3OB9A 3QDFA 3H6ZA 3EFOB 3HL8A 3VS5A 2JUFA 4M78D 1H641 2MI6A 1UFFA 1ZSZA 4XU2A 1YNZA 3MP6A 3QWYA 1YCSB 1FMVA 4JJCA 4AFQC 2WSFE 2JTFA 2EW3A 4WF2A 1V76A 2C06A 1MNEA 4M7DD 2KR3A 3C94A 1VQMA 4J7FA 1KQ2A 3EGDA 3QDRB 1VQPT 2MCNA 1M3BA 4M75A 4M7AD 2HMAA 3KUFA 1AWJA 2EKOA 4EMKA 3SD4A 3URGA 5J26A 5LJ5h 1VQ4Q 1VQLT 1Y0MA 3CD6T 6AT1B 3MEAA 2ROLA 4RG8A 3UDCA 2KRSA 2LRQA 2QYZA 1KD1C 2AKKA 3CMEA 1SSHA 1G3WA 2D1XA 4Q5WA 4TVRA 1D3BB 1AVZC 4J9FA 5FU6C 3J7AF 2FPDA 5FU6B 1TG0A 5CKHA 1X01A 2YRDA 1E6GA 2DF6A 4R55A 1KC8R 3M58A 2RI2A 4Y28E 2LVMA 2QQBA 2GTJA 2JT4A 2RJEA 1JXMA 2DA9A 4BDYA 5KCHA 2E6ZA 1IB8A 1WA7A 4A54A 5FWCA 3QJ6A 4OMQA 2O88A 1VQOQ 5LJ5g 2DYBA 4N0AC 3RESA 1K9MU 1JB0E 2LQKA 3EGXA 3PVQA 2HSPA 2QGFB 1MHNA 3QSUA 2RPNA 2FZKB 3CCST 4F7UF 2EAYA 5FWBA 3SHWA 5CIUA 4E2FB 1GCPA 2PUOB 2PVDB 2ENMA 1UDLA 2VC8A 2F2VA 3ME9A 1M30A 3EFRA 3EAEA 1N27A 3F70A 1QKXA 3KBGA 2D0NA 1ZSZC 3CQTA 2M02A 4ZN3A 2OTJQ 1UTIA 1ZSZB 4AG1C 1FMWA 3EH2A 1MMAA 1I5OB 2VGMA 1QVGP 4ELYC 2NYSA 1QMCA 2KSSA 3QPHA 2RD1A 5DLOA 5IXFA 2E4HA 1N9RA 1NLPC 2VB6A 2ED0A 1YJNA 2EQJA 2GQIA 2KAFA 3TSWA 4IIOA 2VKNA 4GLKA 1WFWA 4E7JA 3N5BB 4HVUA 4AFZC 1IHWA 1KSWA 4J9GA 2L89A 4RKUE 3L42A 1X43A 1Y71A 4R0KA 1NBEB 1ZA1B 2QDLA 1U1SA 1M1GA 1FYNA 2QEXQ 1ZUYA 3CC2A 1J3TA 1KHCA 1F1BB 3M4YA 5HCKA 4F16A 1SSFA 4AFSC 1WXUA 4ZN1A 1M5Q1 2YHTA 3KFVA 3ZL7C 2FO0A 3X25B 2LJ1A 1QCNA 2FPEA 3VRYA 3TREA 2LNHB 1UHCA 4MMKA 2OAUA 2CREA 4QVCA 3J81E 4DBFA 4L59A 1M2VA 1AWXA 4OMLA 4N4IA 2BE9B 1VQMQ 3CBPA 1JJ2P 2AIRB 1RAEB 5I2MA 3OW2S 3V8KA 1XOVA 3JAME 5IH2A 3G6EA 3EGXB 4J9BA 4XTYA 1WHMA 2DPPB 3CCQT 4M75D 3I56T 2LJ0A 2ROTA 2FHDA 1MV0B 3SDZA 1SHGA 1UUEA 1M1KU 5LJ5f 4RG2A 4L6V5 3CMEQ 1FWZA 1QVGA 3H0HA 2FVUA 3OYYA 4DEYA 1TS9A 5LJ3h 1ZUKA 3CC7T 4RTUA 4BDZA 2GNCA 5EC7A 4HCBA 1IHVA 3RBBB 4LUDA 3CCLQ 4E7LA 1NPRA 3O8VA 4JJBA 2DRMA 3INZA 1T0JA 5C6SA 3H0FA 2LMJA 3R6OA 4DEXA 1PC0A 2M0YA 5L8RE 4DBHA 1H3ZA 2KRMA 1RADB 4LUEA 1BIAA 3H0IA 3QG1A 1WHLA 2DFUA 3CPWP 3CCUQ 4OB1B 5KE3A 5CK9A 1R8OB 2C0IA 3META 4FCYA 2RB6A 2LJ3A 5IAYA 5D6WA 1PD1A 4C92A 2CSIA 2J6FA 2JNGA 4WTOB 3LWHA 9ATCB 1OPKA 1FMKA 1HJDA 2RO0A 3V8JA 4X9CA 4XU3A 3PT9A 5EG2A 5LJ3g 1LNXA 1QVPA 1KFZA 2CZ6B 2DJZA 2O4XB 2HL5C 1I1JA 3EG9A 3CCMA 3VUZA 3EHRA 2DL5A 1OU9A 1JRIA 4BY6C 2KY9A 4BY6B 2EWNA 4FW1A 2EYXA 2JM9A 2X3WD 1MUZA 1TXQA 1JJ2A 1VQ9Q 1VOMA 1QWEA 4HCZA 1YJNQ 4A4HA 3L2RA 3M56A 4ESRA 3HHTB 2E3IA 1NYGA 3OYHA 5GAOl 2C0OA 1ZBXA 1VQ8Q 2HEQA 4RCCA 2FG0A 1VQKA 3I35A 4MZPA 1BCOA 3C0CA 3VUBA 4DBRA 2GCXA 4C92E 1M27C 3DKMA 3QXEB 1H92A 5FU7C 1GRIA 3JB9F 5FU7B 5GAMd 4XAXB 1VQOT 5CQYA 1UGSB 2L3SA 4PNOA 3GOXA 2CZ0B 2RK1A 2RQVA 2LTOA 2E70A 3HRUA 4E6RA 1X2KA 4FT2A 4M77A 1X2QA 1BB9A 4XTXA 3TU4K 4BI4A 1ZA2B 2DL8A 3JB9G 1RAGB 3VS4A 3PMIA 4A4KA 2E12A 1HXDA 1CKAA 1NJIU 3G6EQ 3CEYA 4Z88A 4C92C 1NE8A 3FB9A 4C92B 1M2OA 2X4XA 3OYMA 1AEYA 2X4JA 1W1FA 3Q1JA 1I4K1 2YUOA 3P8HA 4LXCA 3BW1A 5FRNA 2LX7A 2NLUA 4JLGA 2DLPA 3WVDB 8AT1B 2YRVA 1NZ9A 4M78F 4MZMA 2MF2A 2BZYA 3OMCA 1YITA 2ABLA 2RQUA 2QEXT 3MEVA 1K9AA 2DNUA 5LJ3f 4B6MA 2HAXA 5FW9A 3JCMb 5GANh 2DL3A 1JU5C 2I0NA 4D8DA 4C0GA 3UPUA 1YCYA 4DQ2A 4PJJA 2CZ7B 3ZBDA 2GBQA 4HXJA 4Y92A 4PJOA 4BI8B 4PFPA 2HNIA 1KD1R 3CPWS 4L5GA 2EIFA 3NTKA 3M0PA 2LT1A 1KQ1A 2F5KA 4J83A 2V8JA 2HDAA 2CUBA 1VQ4A 1PRLC 4NS5A 2YSQA 2GQVA 1S72A 3MJXA 4KUDK 1PNJA 3C12A 1VQMT 2COWA 1YWPA 4M7DG 2DD5A 2Y90A 4C92D 2PUKB 2MMPA 1QKWA 2L3RA 1G8XA 2WACA 1VQ6A 5I11A 2WSEE 1TU0B 1W6XA 1UGPB 1C1AA 1JQQA 3RKXA 4M7AG 4JZ4A 3CCMQ 1WGSA 5CKEA 5GANg 1OI1A 2NUPA 3REAB 4M77C 3UATA 2DBKA 4RTZA 1I81A 2D0QB 1OQKA 1BI3A 2FL7A 2XDPA 3X24B 1WHJA 3CMET 2CP3A 1M4ZA 4M7AE 1G3TA 1YWOA 1K8AU 3M53A 3X20B 2BZ8A 2DXBA 4ANJA 2DAQA 2COYA 1ZSGA 2CYZB 3H8ZA 1VUBA 4OGCA 2RQRA 4FM4B 1PSFA 1VQKQ 1QW1A 1SKUB 4DBQA 4NL3A 2QQSA 2LT4A 2LDMA 4DOWA 4K11A 4PLLA 3ZEHA 3C4SA 3RIRA 4XU0A 1Q95G 3HRTA 4JDSA 4MDWA 2RQTA 3VV0A 5HK3A 2OTJA 1BK2A 1VYUA 4NL2A 2X51A 3I55Q 2K57A 3TSZA 3CXCS 3UT1A 2DBMA 4QW2A 4M7AC 4M7AB 2L0AA 4A4FA 3G71A 1WIEA 1WYXA 3OYIA 2KXCA 1LPLA 2X9HA 3HP9A 1Q82U 1N6AA 4OB2B 3E1SA 4M77D 1H8KA 1Q82C 2MYSA 4OGEA 1QVFP 1BKBA 4J6YA 2ZZDA 2JXBA 3G7ZA 4OB0B 3MPUB 2RM4A 3MP1A 5HKCA 2LNVA 4EMHA 2RN8A 1YJNT 3FIFA 1WZOA 1YI2A 4PL6A 1JEGA 1YITQ 3MEUA 1MV3A 1TWBA 3DB3A 2MIOA 3OA6A 3CC2T 2LX9A 2OI3A 1GFDA 2AHJB 3A8GB 1K73C 1PKSA 4Y91A 4CI0C 1QP3A 1C6VX 1RAIB 4IKFA 2LQ8A 3LGLA 4CRIA 5GANf 2AZSA 2R58A 2XKOC 1QLYA 5KE2A 2EQUA 3TEEA 1QP2A 2CUDA 3AT1B 3PTAA 2F1LA 1SEMA 2GFUA 3LX7A 4RTYA 1M1KR 4OB3B 3NTIA 1S72Q 1KD1U 4PJOD 5D6YA 4C5IA 1WHKA 3NGPA 2SEMA 5GAN8 2H3JA 2O2OA 3PIOA 3EG0A 1BI1A 4FYYB 4F17A 2JVVA 1IXDA 3P8DA 2GFAA 2XIDA 1VQ6Q 3H41A 3CBMA 3G6ET 1W4SA 2L3QA 2XG8D 3OYFA 1RUWA 7AT1B 4KUIA 2DE0X 2GGRA 2EYZA 2DIQA 1EIFA 4M75G 3FJ5A 1YIJA 3CCLA 1U06A 1VQNA 1UJYA 3G4SA 1AWWA 4PKCC 2M0OA 3V7SA 5IT9E 1KK7A 3M0RA 2VASA 2QXFA 2KYBA 3S3NA 1QVFA 3EGUA 5AYFA 2YRCA 3CCUA 5IHKA 3VS7A 4M75E 1VQ5A 2NUZA 4J6WA 2M9UA 4AMCA 2F5TX 3NPFA 4XTUA 2P4TA 3A98A 1VIEA 4F7UA 2ZPGB 1Z9ZA 4GY5A 1OPLA 3VJPA 2ZPHB 5A0DA 3HKSA 2IIMA 2O9VA 2LCCA 2PNIA 3M4GA 2DO3A 1G5VA 4JS4A 4CC4B 3A5ZB 2GTOA 3E9GA 3G71Q 3EHQA 5KYYA 2YUNA 4JJNK 1JO8A 2PU9B 3GBQA 4FYVB 3CMAA 1VQ9A 1YJ9Q 2FRWA 3EGDB 4M75C 5IN1A 4M75B 2FZCB 2YUQA 3VS1A 5CKFA 4EMKC 2JMAA 1GCQA 3CCMT 3OYLA 2DEQA 3ER0A 4EMKB 1KQSA 3OS2A 3EFSA 4J9HA 1I0CA 3SWNA 1VQ8A 1NPPA 1WNLA 4JRKA 3CPFA 1VIFA 5GJWB 3VU3C 1HYOA 4KGVB 2JM8A 1ACMB 5M9OA 5J3BA 4LE9A 2XMFA 3A8LB 2QA4A 4HT8A 1YI2Q 3JRZA 4OF1A 1UB4A 4BE2A 4V2SA 3DLLA 4FU6A 1UGQB 4J9EA 2EJFA 1VQKT 2D8HA 5IHNA 3OMGA 4IURA 2EGEA 2QQAA 1RLQC 2QAZA 1NJIR 2VUBA 3CCVQ 1WJRA 2K2MA 2DX1A 2KI7A 4J8OA 1LCKA 4F14A 1OZ3A 1MNDA 3FDRA 5I2SA 2ZGWA 1WHHA 1D09B 2COZA 3RNJA 3OSVA 2MAMA 5AT1B 4XU1A 2XDBA 1VYTA 4C8QA 3AHUA 1IGQA 2YT6A 5GAOr 3BDUA 2A37A 2CP6A 2KXDA 1QQJA 2RQWA 3JCMW 4JZ3A 3HRSA 1CSKA 1OV3A 4C5GA 1Y96A 2PQWA 2JZ2A 4C0FA 5GAN3 3PE0A 1YJWQ 1Q7YU 4GBQA 3OYBA 5A0GA 1M90U 1M8MA 5KYYB 1YIJQ 1Q7YC 2O9SA 3JCMd 1X6BA 1X75C 1M90C 1AZGB 1WI7A 2FZGB 1VQNQ 2V1RA 3G4SQ 2LCSA 5D7UA 2K3XA 3SWNC 2IPOB 2YLCA 5LL6S 3SWNB 2J7IA 1YITT 3L1AA 5CO7A 2CSQA 1VQ5Q 3MKDA 1U3OA 2DK3A 4AFUC 2F2WA 2VV5A 2E10A 1FXXA 1M9SA 1GXIE 4OMPA 5GAN7 1G3SA 2EJ9A 2HCKA 2BTTA 3HSBA 4N4GA 1I07A 2XD0A 2J05A 1X6OA 4C92F 4C8QE 2PTKA 1ABOA 2VGNA 4CC3A 2QGGA
chains in the Genus database with same CATH topology
2I0NA 4D8DA 4OMMA 4IIMA 3IQLA 4M4ZA 2EGAA 2BZXA 2GBQA 3VS5A 4HXJA 4Y92A 2DL4A 3M0PA 1UFFA 2EYWA 1KIKA 2DILA 2HDAA 1YNZA 2CUBA 3QWYA 1PRLC 4KRTA 1YCSB 2PZ1A 2YSQA 1PNJA 2K7AA 4JJCA 2CH4W 1YWPA 1AWOA 4AFQC 2LP5A 2EW3A 1QKWA 2B86A 2KR3A 2K6DA 5I11A 1W6XA 2RNAA 1JQQA 2MCNA 4JZ4A 1M3BA 2V1QA 1KJWA 1UJ0A 4J9IA 4RTVA 1AWJA 3REAB 3UATA 2DBKA 2H8HA 1K0SA 4RTZA 1NG2A 1Y0MA 1SRMA 1T0HA 1NLOC 2DJQA 2KEAA 2ROLA 1W70A 2AKLA 2VWFA 1T3SA 1YWOA 2KRSA 2DVJA 1SRLA 2BZ8A 1UGVA 2AKKA 1K0XA 1SSHA 4HVVA 2D1XA 3M0UA 1ZSGA 1AVZC 4J9FA 2FPDA 2RQRA 2OJ2A 1TG0A 1BBZA 3U23A 1E6GA 2DF6A 2RF0A 5I22A 2VVKA 2GTJA 2JT4A 1JXMA 2DA9A 4K11A 2J06A 3JV3A 4ZNXA 4OMOA 2RMOA 2DL7A 2RQTA 1BK2A 1WA7A 1VYUA 1X69A 5FWCA 1UHFA 4OMQA 2O88A 3TSZA 2DYBA 1AD5A 2L2PA 2DBMA 2JS2A 1GCQC 3PVQA 2HSPA 2L0AA 1ARKA 1HD3A 1WIEA 2RPNA 4Z89A 1WYXA 5FWBA 2KXCA 3SHWA 1GCPA 2EYYA 2ENMA 1UDLA 1PRMC 2F2VA 3O5ZA 1M30A 2C0TA 2F2XA 2P4RA 1QKXA 1AOJA 1M3CA 2D0NA 2DM1A 1H8KA 3CQTA 1QCFA 1UTIA 4AG1C 2A36A 1GFCA 1BU1A 1ABQA 2JXBA 1WLPB 2LQWA 2K9GA 2KNBB 1OOTA 2RN8A 1EFNA 4D8KA 3REBB 2CT4A 5IXFA 3M0SA 4OMNA 1ZX6A 2ECZA 1NLPC 2ED0A 1Y57A 2GQIA 3TSWA 1JEGA 4IIOA 2VKNA 2A28A 4JJDA 1WFWA 4HVUA 4AFZC 1MV3A 2MIOA 1KSWA 4J9GA 2OI3A 1X43A 4R0KA 2QDLA 4LN2A 1UG1A 1GFDA 1WXBA 1FYNA 2J6OA 1ZUYA 1J3TA 1G2BA 4HCKA 1PKSA 1JXOA 4QT7A 3SEMA 1HSQA 4AG2C 1RI9A 2AZSA 5HCKA 4F16A 1QLYA 2ED1A 2JW4A 4AFSC 1WXUA 2CUDA 3KFVA 3ZL7C 1K76A 4RUGA 1SEMA 5GJVB 4RTYA 3ULRB 2FO0A 2O31A 2LJ1A 4Z8AA 2FPEA 3UA6A 1X6GA 3VRYA 4HVWA 2LNHB 1UHCA 3M0TA 3NGPA 2SEMA 2CREA 2O2OA 1NM7A 3EG0A 4F17A 3VS2A 1AWXA 4OMLA 2EKHA 1PHTA 3H41A 2L3QA 1RUWA 2YUPA 1XOVA 5IH2A 2EPDA 1CKBA 2DE0X 2GGRA 4WCIA 1TUCA 2EYZA 4J9BA 1GL5A 2LZ6B 2HBWA 1RLPC 1SPKA 1OEBA 1ZLMA 3FJ5A 1AZEA 1U06A 2KROA 1PKTA 2LJ0A 1YP5A 2ROTA 4GLMA 1MV0B 1UJYA 3I5SA 1AWWA 1SHGA 1UUEA 1M3AA 1U5SA 3M0RA 1UE9A 2KRNA 2KYBA 3EGUA 3H0HA 4J9DA 1GBRA 5IHKA 3VS7A 4DEYA 2NUZA 1ZUKA 3QWXX 4RTUA 2GNCA 2JTEA 2X3XD 5EC7A 4CC7A 3RBBB 3NMZC 4LUDA 1NYFA 3NPFA 3VRZA 1X27A 2KGTA 3A98A 4JJBA 2DRMA 2FPFA 1T0JA 2KE9A 1B3QA 2LMJA 3H0FA 4DEXA 1Z9ZA 1OPLA 2M0YA 5IHIA 2KRMA 2E5KA 1QWFA 3H0IA 4LUEA 4RTTA 2IIMA 1N5ZA 2O9VA 2YDLA 1E7OA 2PNIA 2LQNA 2C0IA 2DRKA 4CC4B 1IO6A 2LJ3A 3TVTA 2GTOA 2OAWA 3EHQA 2KT1A 2CSIA 2M51A 2YUNA 2J6FA 1JO8A 3GBQA 3M0QA 4J9CA 1OPKA 2FRWA 1FMKA 1HJDA 1B07A 2YUQA 3VS1A 2EGCA 2K3BA 1GBQA 2JMAA 1GCQA 2NWMA 1KFZA 1E6HA 4J9HA 1I0CA 1JU5C 1I1JA 1A0NB 5GJWB 2FEIA 3EHRA 2DL5A 2EVRA 2JM8A 5ECAA 2CT3A 2EYXA 5L23A 3VS3A 2JM9A 2X3WD 1MUZA 2XMFA 4LE9A 1QWEA 2KBTA 3THKA 2K79A 2AK5A 3EG1A 4ESRA 4J9EA 2AZVA 1NYGA 2D8HA 5IHNA 2C0OA 2KYMA 3LH5A 3UF4A 2HEQA 2MOXA 4FSSA 2FG0A 2EGEA 3EG2A 2A08A 1RLQC 3I35A 3C0CA 1Z9QA 3VS6A 2K2MA 1ZUUA 2DX1A 4CC2A 1LCKA 4F14A 1M27C 2DMOA 1PWTA 1H92A 1GRIA 2L3SA 1T3LA 2L3PA 2RQVA 3RNJA 1UECA 1H3HA 3EG3A 3UA7A 2G6FX 2W0ZA 2EBPA 1VYTA 1YN8A 4X1VA 4E6RA 2YT6A 2J6KA 1X2KA 2A37A 4ORZA 2KXDA 1X2QA 1BB9A 2RQWA 1SHFA 4JZ3A 3I9QA 2KT8A 1CSKA 2DL8A 1NEBA 1OV3A 5IXBA 3VS4A 1VYVA 3PE0A 2JS0A 1K4US 1WDXA 1CKAA 4GBQA 3I5RA 4Z88A 1TUDA 1M8MA 1K1ZA 1ZBJA 2SRCA 1WXTA 4EIKA 3NHNA 2O9SA 1X6BA 2CH4A 1AEYA 1VA7A 4A63B 1W1FA 2FRYA 1AZGB 4RTWA 1WI7A 2YUOA 2V1RA 2W10A 2LCSA 1G83A 2EQIA 1S1NA 2LX7A 4LNPA 3R6NA 3VS0A 2DLPA 2J7IA 1V1CA 2D8JA 2CSQA 1U3OA 4AFUC 2F2WA 1WX6A 2BZYA 2ABLA 4OMPA 2RQUA 3PVLA 1K9AA 2JMCA 2HCKA 2BTTA 2DNUA 2ESWA 1I07A 5FW9A 2J05A 1NEGA 4JPBW 2CDTA 2PTKA 1ABOA 2DL3A 4RTXA 4CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0N A;  4D8D A;  4OMM A;  4IIM A;  3IQL A;  4M4Z A;  2EGA A;  2BZX A;  2GBQ A;  3VS5 A;  4HXJ A;  4Y92 A;  2DL4 A;  3M0P A;  1UFF A;  2EYW A;  1KIK A;  2DIL A;  2HDA A;  1YNZ A;  2CUB A;  3QWY A;  1PRL C;  4KRT A;  1YCS B;  2PZ1 A;  2YSQ A;  1PNJ A;  2K7A A;  4JJC A;  2CH4 W;  1YWP A;  1AWO A;  4AFQ C;  2LP5 A;  2EW3 A;  1QKW A;  2B86 A;  2KR3 A;  2K6D A;  5I11 A;  1W6X A;  2RNA A;  1JQQ A;  2MCN A;  4JZ4 A;  1M3B A;  2V1Q A;  1KJW A;  1UJ0 A;  4J9I A;  4RTV A;  1AWJ A;  3REA B;  3UAT A;  2DBK A;  2H8H A;  1K0S A;  4RTZ A;  1NG2 A;  1Y0M A;  1SRM A;  1T0H A;  1NLO C;  2DJQ A;  2KEA A;  2ROL A;  1W70 A;  2AKL A;  2VWF A;  1T3S A;  1YWO A;  2KRS A;  2DVJ A;  1SRL A;  2BZ8 A;  1UGV A;  2AKK A;  1K0X A;  1SSH A;  4HVV A;  2D1X A;  3M0U A;  1ZSG A;  1AVZ C;  4J9F A;  2FPD A;  2RQR A;  2OJ2 A;  1TG0 A;  1BBZ A;  3U23 A;  1E6G A;  2DF6 A;  2RF0 A;  5I22 A;  2VVK A;  2GTJ A;  2JT4 A;  1JXM A;  2DA9 A;  4K11 A;  2J06 A;  3JV3 A;  4ZNX A;  4OMO A;  2RMO A;  2DL7 A;  2RQT A;  1BK2 A;  1WA7 A;  1VYU A;  1X69 A;  5FWC A;  1UHF A;  4OMQ A;  2O88 A;  3TSZ A;  2DYB A;  1AD5 A;  2L2P A;  2DBM A;  2JS2 A;  1GCQ C;  3PVQ A;  2HSP A;  2L0A A;  1ARK A;  1HD3 A;  1WIE A;  2RPN A;  4Z89 A;  1WYX A;  5FWB A;  2KXC A;  3SHW A;  1GCP A;  2EYY A;  2ENM A;  1UDL A;  1PRM C;  2F2V A;  3O5Z A;  1M30 A;  2C0T A;  2F2X A;  2P4R A;  1QKX A;  1AOJ A;  1M3C A;  2D0N A;  2DM1 A;  1H8K A;  3CQT A;  1QCF A;  1UTI A;  4AG1 C;  2A36 A;  1GFC A;  1BU1 A;  1ABQ A;  2JXB A;  1WLP B;  2LQW A;  2K9G A;  2KNB B;  1OOT A;  2RN8 A;  1EFN A;  4D8K A;  3REB B;  2CT4 A;  5IXF A;  3M0S A;  4OMN A;  1ZX6 A;  2ECZ A;  1NLP C;  2ED0 A;  1Y57 A;  2GQI A;  3TSW A;  1JEG A;  4IIO A;  2VKN A;  2A28 A;  4JJD A;  1WFW A;  4HVU A;  4AFZ C;  1MV3 A;  2MIO A;  1KSW A;  4J9G A;  2OI3 A;  1X43 A;  4R0K A;  2QDL A;  4LN2 A;  1UG1 A;  1GFD A;  1WXB A;  1FYN A;  2J6O A;  1ZUY A;  1J3T A;  1G2B A;  4HCK A;  1PKS A;  1JXO A;  4QT7 A;  3SEM A;  1HSQ A;  4AG2 C;  1RI9 A;  2AZS A;  5HCK A;  4F16 A;  1QLY A;  2ED1 A;  2JW4 A;  4AFS C;  1WXU A;  2CUD A;  3KFV A;  3ZL7 C;  1K76 A;  4RUG A;  1SEM A;  5GJV B;  4RTY A;  3ULR B;  2FO0 A;  2O31 A;  2LJ1 A;  4Z8A A;  2FPE A;  3UA6 A;  1X6G A;  3VRY A;  4HVW A;  2LNH B;  1UHC A;  3M0T A;  3NGP A;  2SEM A;  2CRE A;  2O2O A;  1NM7 A;  3EG0 A;  4F17 A;  3VS2 A;  1AWX A;  4OML A;  2EKH A;  1PHT A;  3H41 A;  2L3Q A;  1RUW A;  2YUP A;  1XOV A;  5IH2 A;  2EPD A;  1CKB A;  2DE0 X;  2GGR A;  4WCI A;  1TUC A;  2EYZ A;  4J9B A;  1GL5 A;  2LZ6 B;  2HBW A;  1RLP C;  1SPK A;  1OEB A;  1ZLM A;  3FJ5 A;  1AZE A;  1U06 A;  2KRO A;  1PKT A;  2LJ0 A;  1YP5 A;  2ROT A;  4GLM A;  1MV0 B;  1UJY A;  3I5S A;  1AWW A;  1SHG A;  1UUE A;  1M3A A;  1U5S A;  3M0R A;  1UE9 A;  2KRN A;  2KYB A;  3EGU A;  3H0H A;  4J9D A;  1GBR A;  5IHK A;  3VS7 A;  4DEY A;  2NUZ A;  1ZUK A;  3QWX X;  4RTU A;  2GNC A;  2JTE A;  2X3X D;  5EC7 A;  4CC7 A;  3RBB B;  3NMZ C;  4LUD A;  1NYF A;  3NPF A;  3VRZ A;  1X27 A;  2KGT A;  3A98 A;  4JJB A;  2DRM A;  2FPF A;  1T0J A;  2KE9 A;  1B3Q A;  2LMJ A;  3H0F A;  4DEX A;  1Z9Z A;  1OPL A;  2M0Y A;  5IHI A;  2KRM A;  2E5K A;  1QWF A;  3H0I A;  4LUE A;  4RTT A;  2IIM A;  1N5Z A;  2O9V A;  2YDL A;  1E7O A;  2PNI A;  2LQN A;  2C0I A;  2DRK A;  4CC4 B;  1IO6 A;  2LJ3 A;  3TVT A;  2GTO A;  2OAW A;  3EHQ A;  2KT1 A;  2CSI A;  2M51 A;  2YUN A;  2J6F A;  1JO8 A;  3GBQ A;  3M0Q A;  4J9C A;  1OPK A;  2FRW A;  1FMK A;  1HJD A;  1B07 A;  2YUQ A;  3VS1 A;  2EGC A;  2K3B A;  1GBQ A;  2JMA A;  1GCQ A;  2NWM A;  1KFZ A;  1E6H A;  4J9H A;  1I0C A;  1JU5 C;  1I1J A;  1A0N B;  5GJW B;  2FEI A;  3EHR A;  2DL5 A;  2EVR A;  2JM8 A;  5ECA A;  2CT3 A;  2EYX A;  5L23 A;  3VS3 A;  2JM9 A;  2X3W D;  1MUZ A;  2XMF A;  4LE9 A;  1QWE A;  2KBT A;  3THK A;  2K79 A;  2AK5 A;  3EG1 A;  4ESR A;  4J9E A;  2AZV A;  1NYG A;  2D8H A;  5IHN A;  2C0O A;  2KYM A;  3LH5 A;  3UF4 A;  2HEQ A;  2MOX A;  4FSS A;  2FG0 A;  2EGE A;  3EG2 A;  2A08 A;  1RLQ C;  3I35 A;  3C0C A;  1Z9Q A;  3VS6 A;  2K2M A;  1ZUU A;  2DX1 A;  4CC2 A;  1LCK A;  4F14 A;  1M27 C;  2DMO A;  1PWT A;  1H92 A;  1GRI A;  2L3S A;  1T3L A;  2L3P A;  2RQV A;  3RNJ A;  1UEC A;  1H3H A;  3EG3 A;  3UA7 A;  2G6F X;  2W0Z A;  2EBP A;  1VYT A;  1YN8 A;  4X1V A;  4E6R A;  2YT6 A;  2J6K A;  1X2K A;  2A37 A;  4ORZ A;  2KXD A;  1X2Q A;  1BB9 A;  2RQW A;  1SHF A;  4JZ3 A;  3I9Q A;  2KT8 A;  1CSK A;  2DL8 A;  1NEB A;  1OV3 A;  5IXB A;  3VS4 A;  1VYV A;  3PE0 A;  2JS0 A;  1K4U S;  1WDX A;  1CKA A;  4GBQ A;  3I5R A;  4Z88 A;  1TUD A;  1M8M A;  1K1Z A;  1ZBJ A;  2SRC A;  1WXT A;  4EIK A;  3NHN A;  2O9S A;  1X6B A;  2CH4 A;  1AEY A;  1VA7 A;  4A63 B;  1W1F A;  2FRY A;  1AZG B;  4RTW A;  1WI7 A;  2YUO A;  2V1R A;  2W10 A;  2LCS A;  1G83 A;  2EQI A;  1S1N A;  2LX7 A;  4LNP A;  3R6N A;  3VS0 A;  2DLP A;  2J7I A;  1V1C A;  2D8J A;  2CSQ A;  1U3O A;  4AFU C;  2F2W A;  1WX6 A;  2BZY A;  2ABL A;  4OMP A;  2RQU A;  3PVL A;  1K9A A;  2JMC A;  2HCK A;  2BTT A;  2DNU A;  2ESW A;  1I07 A;  5FW9 A;  2J05 A;  1NEG A;  4JPB W;  2CDT A;  2PTK A;  1ABO A;  2DL3 A;  4RTX A;  4CC3 A; 
#chains in the Genus database with same CATH topology
 5KH6 A;  2QDY B;  1D1B A;  2QI2 A;  4M4Z A;  3OS0 A;  2EGA A;  2I2L A;  1AHJ B;  1WHG A;  3M57 A;  2E1H A;  1QVG S;  3J80 E;  1VQ4 T;  2DEU A;  2DL4 A;  2JOY A;  1S72 T;  1KIK A;  1M2V B;  2DIL A;  1K8A R;  2CP7 A;  3CCE Q;  3CMA Q;  2O01 E;  3BY7 A;  1MMD A;  2PZ1 A;  1DJ7 B;  3S6W A;  2K7A A;  4C92 G;  4BD3 A;  1VQ6 T;  2OTL A;  3EH1 A;  2B86 A;  3GP8 A;  2XU8 A;  2X35 A;  4C8Q C;  3CC4 Q;  4ZTJ A;  2V1Q A;  4C8Q B;  3JCM V;  1UJ0 A;  4J9I A;  1K0S A;  1NG2 A;  2QA4 Q;  4MML A;  3OY9 A;  1SRM A;  2DIG A;  2HD0 A;  2E5Q A;  1T0H A;  2DJQ A;  3CCJ A;  2KEA A;  4IUP A;  1T3S A;  1XJW B;  1U1T A;  2CP2 A;  1UGV A;  4RMO A;  2RI3 A;  4O5V A;  4HVV A;  3I55 A;  4PLI A;  2OJ2 A;  4II1 A;  1BBZ A;  2ATC B;  1Q82 R;  4FW2 A;  3L2Q A;  2QAS A;  3FEO A;  2Y4X A;  2RF0 A;  3TCJ A;  5KYX A;  3HPW A;  1VQP Q;  2VVK A;  3JCM h;  2OTJ T;  3SB2 A;  1JJ2 S;  2J06 A;  2VXE A;  2D9T A;  2P0Q A;  1OU8 A;  3OYN A;  3GLX A;  1YBY A;  2FB7 A;  1UHF A;  3G71 T;  3MP8 A;  3RKY A;  2QQ9 A;  5GAO n;  3V8L A;  3JB9 H;  2L2P A;  3G1J A;  1BI0 A;  2EQK A;  2MWO A;  2ZPE B;  2X4W A;  3X28 B;  1HD3 A;  4Z89 A;  2LCL A;  1VQ7 A;  4IUU A;  2DTO A;  2RA2 A;  4R56 A;  4C8Q D;  3EG9 B;  2EYY A;  3O5Z A;  1SG5 A;  3JCM e;  1RI0 A;  4M77 G;  3MCA B;  4QKU A;  2E41 A;  1RAF B;  1WJS A;  1AOJ A;  2DM1 A;  4M78 A;  1QCF A;  2A36 A;  2CP5 A;  1YHQ A;  1XQH A;  1BU1 A;  2AT1 B;  2YXY A;  4LD9 K;  1IRE B;  1WLP B;  2LQW A;  4M7D F;  2K9G A;  1YI2 T;  2KNB B;  3RDV A;  2XK0 A;  4M77 E;  1RAB B;  1OOT A;  3QYH B;  2HL3 A;  1EFN A;  4IUQ A;  4D8K A;  1M8V A;  5DM7 R;  1N9S A;  3REB B;  3M0S A;  4M7A F;  3QJY A;  4OMN A;  1ZX6 A;  3A8H B;  3QYG B;  8ATC B;  1Y57 A;  2A28 A;  1W2B A;  2P0P A;  3BFM A;  2GF7 A;  2HKQ B;  1RAH B;  1IRX A;  4A4E A;  2EYQ A;  4LN2 A;  2P0K A;  3GIB A;  2A0F B;  5FRM A;  1G2B A;  1JXO A;  3SEM A;  4C0D C;  4E7I A;  5GAN 4;  1HSQ A;  5GAO m;  4C0D B;  1RI9 A;  1D1C A;  5GAM h;  5I21 A;  2HQH A;  2VYT A;  1K76 A;  2DTI A;  4RUG A;  3CCR A;  4PJN A;  4M77 B;  1BIB A;  4Z8A A;  4PJO G;  5KYX B;  2KK4 A;  3EFO A;  3M0T A;  3QBY A;  2OTL Q;  2F69 A;  4QQD A;  2RJD A;  2DYI A;  2EKH A;  2OX7 A;  4PJO E;  2RI5 A;  2YUP A;  4B9X A;  5GAM e;  3CCL T;  1YIJ T;  2EPD A;  4QVZ A;  4WCI A;  1TUC A;  5GAM j;  5GAO q;  1GL5 A;  2HZY A;  1VQN T;  3G4S T;  1RLP C;  1SPK A;  1OEB A;  1AZE A;  5KYN A;  1V29 B;  5LJ5 d;  3VKI A;  4MZT A;  5HY6 A;  1PKT A;  3CCJ Q;  1YP5 A;  4GLM A;  5GAM g;  3CCU T;  3I5S A;  4J5Y A;  2ZPB B;  4OMF B;  1U5S A;  1VQ5 T;  1RAC B;  3OYE A;  3PNW C;  4ME7 A;  1GBR A;  3WVE B;  3RER A;  3HTR A;  3E2U A;  2E6N A;  4EMG A;  2BIV A;  3OYC A;  3A8M B;  1YJ9 A;  4CC7 A;  3L2W A;  4PJO C;  1X27 A;  3GNG A;  4PJO B;  3PIP A;  4XTW A;  1PM3 A;  4ATO A;  1B3Q A;  2QK0 A;  3S3M A;  1PSE A;  5IHI A;  2E5K A;  1QWF A;  1N8R U;  3RKW A;  1QCO A;  2LQN A;  1VQ9 T;  3CMA T;  4DA4 A;  1N8R C;  2DRK A;  1IO6 A;  4MDX A;  3TVT A;  2DKG A;  2OAW A;  2KT1 A;  1MGQ A;  2M51 A;  1IGU A;  1VQ7 Q;  4J9C A;  2XIC A;  2G3R A;  4ZGE B;  3OS5 A;  2KQW A;  4N4H A;  3CC7 Q;  1B07 A;  3M54 A;  1VQ8 T;  1OYX A;  2K3B A;  4N0A A;  1GBQ A;  2NUP B;  4EDU A;  1TSF A;  1WQW A;  2NWM A;  1E6H A;  2CKK A;  1YHQ Q;  1ZQ1 A;  1K73 U;  3QO3 A;  1XTD A;  1R77 A;  2QA4 T;  2K4Y A;  3ZFJ A;  2ZPI B;  3CCV A;  1C0M A;  2CT3 A;  2E3H A;  5L23 A;  4XK8 E;  3VS3 A;  1Q86 U;  3THK A;  4LDX A;  1R0B G;  4ZGJ B;  3DLM A;  5FRO A;  5A2Q E;  1Q86 C;  4HT9 A;  4PFO A;  2KDS A;  1KQS P;  4M75 F;  2P84 A;  2M16 A;  2KYM A;  3LH5 A;  3OW2 P;  2MOX A;  3EG2 A;  1Q81 U;  1B34 A;  3ASK A;  1Q7Y R;  3QUI A;  1Z9Q A;  3NFC A;  3VS6 A;  1M90 R;  1ZUU A;  4CC2 A;  1Q81 C;  4QVD A;  3OQ5 A;  1OX9 A;  2R5A A;  4KBM B;  3FLG A;  1YJW A;  2E64 A;  2RHU A;  2JJ9 A;  5FLX E;  3CCR Q;  2L3P A;  1UEC A;  1H3H A;  5GAM f;  1RL2 A;  2RH2 A;  3EG3 A;  3UA7 A;  4FYX B;  2G6F X;  2W0Z A;  2EBP A;  1YN8 A;  2LC4 A;  3RUX A;  4A53 A;  5GAO p;  2J6K A;  3VYH B;  4ORZ A;  2QG9 B;  3OSS C;  5CKD A;  2KT8 A;  1TUG B;  1B7T A;  2DET A;  1IZ6 A;  1VYV A;  5LJ5 e;  1WDX A;  3I5R A;  5LJ5 j;  4A4G A;  2DXC A;  1K1Z A;  4HKE A;  3OYD A;  1WXT A;  3NHN A;  2FRY A;  2W10 A;  3S3O A;  4HCC A;  1OZ2 A;  1KHI A;  1S1N A;  4LNP A;  1AT1 B;  1JBM A;  2EJG A;  3BE3 A;  4D6W A;  1K9M C;  2K3Y A;  2D8J A;  2K5L A;  3KXT A;  4E7K A;  3GF5 A;  5LJ3 d;  3JB9 I;  3OYG A;  2BE7 D;  3CCE A;  2QTV A;  2RHY A;  3M55 A;  3PVL A;  2JMC A;  3HFO A;  2ESW A;  2YWW A;  2RK2 A;  4JPB W;  2CDT A;  4BE0 A;  4BB7 A;  1D0X A;  4F7U G;  3OW2 A;  2XHC A;  2BZX A;  3CC4 A;  1QVF S;  2EYW A;  5HK0 A;  1B34 B;  4PJL A;  2DTH A;  1I8F A;  1ZHI A;  2OTL T;  3LLR A;  4KRT A;  4BAC A;  1BCM A;  2DER A;  4F7U E;  5GAN 6;  2CH4 W;  4FSX A;  1AWO A;  2LP5 A;  2A3L A;  2K6D A;  2HQX A;  5CVI A;  2RHX A;  2NUT A;  2EFI A;  2PVO B;  2RNA A;  2XDD A;  4KGX B;  1KJW A;  4IUV A;  3JCM Q;  4RTV A;  4JRI A;  3CCJ T;  2H8H A;  1VQP A;  4C0Z A;  1FX7 A;  2O4X A;  2X4Y A;  1NLO C;  2CZ1 B;  3I55 T;  3JSC A;  1W70 A;  2AKL A;  2VWF A;  2DD4 A;  3VYG A;  2DVJ A;  1EZZ B;  1VQL A;  3CD6 A;  1SRL A;  1K0X A;  3M0U A;  1KQS S;  4F7U B;  2K5I A;  3U23 A;  2HSE B;  2ZAE A;  3HFN A;  4FT4 A;  5KYW A;  2ZPF B;  5GMK i;  3QHS A;  5I22 A;  5KYU A;  4C8Q F;  4EPC A;  1D0Y A;  2RJC A;  3FJP A;  4KH1 B;  3JV3 A;  4ZNX A;  4OMO A;  2RMO A;  2DL7 A;  3M9Q A;  3PGG A;  3PFS A;  1X69 A;  4FIB A;  2QTX A;  1M1K C;  4E7Z A;  1AD5 A;  1EX4 A;  2DZ9 A;  1VQ7 T;  2JS2 A;  4XTV A;  1TTH B;  3JB9 J;  3T9N A;  1GCQ C;  3UWN A;  4PK4 A;  5GAN 5;  3OS1 A;  1Y7X A;  1ARK A;  2Z0W A;  3X26 B;  4C8Q G;  4FYW B;  4QQG A;  4J7I A;  5CKB A;  1PRM C;  2PVG B;  1YHQ T;  4ELZ C;  3CCS A;  2C0T A;  1PD0 A;  1KC8 U;  2F2X A;  2P4R A;  3RR6 A;  1M3C A;  3WXM B;  2BUD A;  2VXF A;  3RMS A;  1KC8 C;  1GFC A;  3LYI A;  4HA8 A;  1TH7 A;  1ABQ A;  1BYM A;  1O9S A;  4UC4 A;  1PCX A;  2Y4Y A;  4JRQ A;  5CAI A;  5LJ3 e;  3JCM X;  1XNI A;  1LOJ A;  4NOY A;  2RHZ A;  4X9D A;  5LJ3 j;  2V26 A;  2CT4 A;  2NUT B;  4F04 B;  2ECZ A;  4AT1 B;  5DY9 A;  2XI9 A;  2R5M A;  4JS5 A;  4JJD A;  4RTX A;  4KH0 B;  3D7S B;  3TQ7 P;  1LJO A;  4B9W A;  1UG1 A;  1WXB A;  5GAN d;  2J6O A;  5CR2 A;  1BI2 A;  4HCK A;  1PG5 B;  4J6X A;  4QT7 A;  4PFZ A;  4XTZ A;  3CCR T;  4AG2 C;  2R57 A;  1UGR B;  3QZ5 B;  4IUT A;  2DVE A;  2ED1 A;  2JW4 A;  5GJV B;  3ULR B;  2O31 A;  1W2B P;  3UA6 A;  5KYW B;  1X6G A;  4RCB A;  4HVW A;  5GMK l;  5KYU B;  1Y96 B;  3QII A;  5D6X A;  4JLI A;  3M5A A;  1NM7 A;  3VS2 A;  2V8K A;  3CC2 Q;  3A1P A;  4OVA A;  1PHT A;  3LW5 E;  2JN0 A;  4E7H A;  4LDY A;  5DLQ E;  3CBO A;  3C95 A;  3BDL A;  1CKB A;  5CQX A;  2K2V A;  2LZ6 B;  2HBW A;  4VUB A;  1ZLM A;  5GMK h;  1N8R R;  3CXC P;  1MMN A;  4M77 F;  2KRO A;  2DZC A;  1M3A A;  5GAN 2;  2YLB A;  1VQL Q;  3CD6 Q;  1D0Z A;  1UE9 A;  3CCQ A;  2KRN A;  3I56 A;  3NTH A;  4J9D A;  3CPW A;  4ZTF A;  2JTM A;  3MO8 A;  1R0C B;  1YJ9 T;  3QZ9 B;  3QWX X;  2DXT A;  2IG0 A;  4LDW A;  2JTE A;  2X3X D;  3NMZ C;  1NYF A;  1Y07 A;  1NJI C;  3VRZ A;  5GMK e;  3CC7 A;  1K73 R;  2KGT A;  2FYK A;  1I5L A;  2FPF A;  2KE9 A;  5GMK j;  3P8B B;  4YTL A;  2RJF A;  3SFM A;  4RTT A;  1N5Z A;  2YDL A;  1Q86 R;  1E7O A;  3JCM g;  3V7C A;  4LDU A;  4ZGD B;  4QQ6 A;  4PJM A;  2HKN A;  4M7D A;  3M0Q A;  1UEB A;  2CGH A;  3FRN A;  2EGC A;  3CCS Q;  4M7A A;  2EQM A;  1Q81 R;  2D6F A;  1SF9 A;  2MK5 A;  4PJO F;  4XQ3 A;  3OBW A;  3CCV T;  1A0N B;  2WSC E;  2FEI A;  2EVR A;  4M78 G;  4X34 A;  1U8R A;  3RMQ A;  4KT0 E;  3OBY A;  5ECA A;  4LD6 A;  4JUV A;  1KG1 A;  1YFN A;  2KBT A;  1M1F A;  3DB4 A;  1TOV A;  3L2V A;  1LVK A;  2L8D A;  1G3Y A;  2K79 A;  3MHX A;  3GPL A;  2AK5 A;  3EG1 A;  5GAN e;  4M78 E;  3L2Z A;  2AZV A;  3CXC A;  2HBP A;  5GAN j;  5GMK m;  4BUG A;  3UF4 A;  4FSS A;  2A08 A;  1O75 A;  2H3E B;  3JCM P;  1YJW T;  1OUL A;  4FL6 A;  4O6J A;  2QQR A;  4M7D E;  2DMO A;  1PWT A;  3FC3 A;  2B8A A;  2E65 A;  4E47 A;  3MEW A;  2HQE A;  3JCM J;  4P5N A;  2MPX C;  1K9M R;  1T3L A;  2MWP A;  1HK9 A;  2V8I A;  2K5F A;  4LDV A;  4KGZ B;  2CS7 A;  1W2B S;  1WQ7 A;  1VQO A;  1K8A C;  4X1V A;  1MMG A;  4M78 C;  4Z02 A;  2A7Y A;  3LH0 A;  4M78 B;  4DOV A;  1SHF A;  3I9Q A;  3JCM c;  3V7R A;  1NEB A;  5IXB A;  4BI3 A;  2ZCF B;  3GNF B;  4OP0 A;  2BKD N;  2JS0 A;  3JB9 D;  1K4U S;  4E7S A;  1WJQ A;  4JRP A;  1TUD A;  4C5H A;  1ZBJ A;  4M7D C;  2SRC A;  2KMT A;  3OYK A;  1D3B A;  4EIK A;  2IVW A;  3OYJ A;  4M7D B;  1D1A A;  3E9F A;  2CH4 A;  1VA7 A;  4A63 B;  2M1H A;  4RTW A;  3LGF A;  1WPY A;  3PMT A;  1G83 A;  3JCM f;  2EQI A;  3CCQ Q;  3I56 Q;  3R6N A;  3VS0 A;  4KUL A;  2KVQ G;  4BE1 A;  3CCE T;  5J39 A;  1V1C A;  1RAA B;  2CP0 A;  3H9N A;  1WX6 A;  3E19 A;  3OYA A;  1OX8 A;  2L5Q A;  3A8O B;  4C5E A;  5CCA A;  2RHI A;  5A0L A;  1NEG A;  2DXU A;  3M59 A;  5KCO A;  3LWI A;  3L2U A;  1P92 A;  2QEX A;  3CC4 T;  4OMM A;  4IIM A;  3QKJ A;  3IQL A;  5C0M A;  3OB9 A;  3QDF A;  3H6Z A;  3EFO B;  3HL8 A;  3VS5 A;  2JUF A;  4M78 D;  1H64 1;  2MI6 A;  1UFF A;  1ZSZ A;  4XU2 A;  1YNZ A;  3MP6 A;  3QWY A;  1YCS B;  1FMV A;  4JJC A;  4AFQ C;  2WSF E;  2JTF A;  2EW3 A;  4WF2 A;  1V76 A;  2C06 A;  1MNE A;  4M7D D;  2KR3 A;  3C94 A;  1VQM A;  4J7F A;  1KQ2 A;  3EGD A;  3QDR B;  1VQP T;  2MCN A;  1M3B A;  4M75 A;  4M7A D;  2HMA A;  3KUF A;  1AWJ A;  2EKO A;  4EMK A;  3SD4 A;  3URG A;  5J26 A;  5LJ5 h;  1VQ4 Q;  1VQL T;  1Y0M A;  3CD6 T;  6AT1 B;  3MEA A;  2ROL A;  4RG8 A;  3UDC A;  2KRS A;  2LRQ A;  2QYZ A;  1KD1 C;  2AKK A;  3CME A;  1SSH A;  1G3W A;  2D1X A;  4Q5W A;  4TVR A;  1D3B B;  1AVZ C;  4J9F A;  5FU6 C;  3J7A F;  2FPD A;  5FU6 B;  1TG0 A;  5CKH A;  1X01 A;  2YRD A;  1E6G A;  2DF6 A;  4R55 A;  1KC8 R;  3M58 A;  2RI2 A;  4Y28 E;  2LVM A;  2QQB A;  2GTJ A;  2JT4 A;  2RJE A;  1JXM A;  2DA9 A;  4BDY A;  5KCH A;  2E6Z A;  1IB8 A;  1WA7 A;  4A54 A;  5FWC A;  3QJ6 A;  4OMQ A;  2O88 A;  1VQO Q;  5LJ5 g;  2DYB A;  4N0A C;  3RES A;  1K9M U;  1JB0 E;  2LQK A;  3EGX A;  3PVQ A;  2HSP A;  2QGF B;  1MHN A;  3QSU A;  2RPN A;  2FZK B;  3CCS T;  4F7U F;  2EAY A;  5FWB A;  3SHW A;  5CIU A;  4E2F B;  1GCP A;  2PUO B;  2PVD B;  2ENM A;  1UDL A;  2VC8 A;  2F2V A;  3ME9 A;  1M30 A;  3EFR A;  3EAE A;  1N27 A;  3F70 A;  1QKX A;  3KBG A;  2D0N A;  1ZSZ C;  3CQT A;  2M02 A;  4ZN3 A;  2OTJ Q;  1UTI A;  1ZSZ B;  4AG1 C;  1FMW A;  3EH2 A;  1MMA A;  1I5O B;  2VGM A;  1QVG P;  4ELY C;  2NYS A;  1QMC A;  2KSS A;  3QPH A;  2RD1 A;  5DLO A;  5IXF A;  2E4H A;  1N9R A;  1NLP C;  2VB6 A;  2ED0 A;  1YJN A;  2EQJ A;  2GQI A;  2KAF A;  3TSW A;  4IIO A;  2VKN A;  4GLK A;  1WFW A;  4E7J A;  3N5B B;  4HVU A;  4AFZ C;  1IHW A;  1KSW A;  4J9G A;  2L89 A;  4RKU E;  3L42 A;  1X43 A;  1Y71 A;  4R0K A;  1NBE B;  1ZA1 B;  2QDL A;  1U1S A;  1M1G A;  1FYN A;  2QEX Q;  1ZUY A;  3CC2 A;  1J3T A;  1KHC A;  1F1B B;  3M4Y A;  5HCK A;  4F16 A;  1SSF A;  4AFS C;  1WXU A;  4ZN1 A;  1M5Q 1;  2YHT A;  3KFV A;  3ZL7 C;  2FO0 A;  3X25 B;  2LJ1 A;  1QCN A;  2FPE A;  3VRY A;  3TRE A;  2LNH B;  1UHC A;  4MMK A;  2OAU A;  2CRE A;  4QVC A;  3J81 E;  4DBF A;  4L59 A;  1M2V A;  1AWX A;  4OML A;  4N4I A;  2BE9 B;  1VQM Q;  3CBP A;  1JJ2 P;  2AIR B;  1RAE B;  5I2M A;  3OW2 S;  3V8K A;  1XOV A;  3JAM E;  5IH2 A;  3G6E A;  3EGX B;  4J9B A;  4XTY A;  1WHM A;  2DPP B;  3CCQ T;  4M75 D;  3I56 T;  2LJ0 A;  2ROT A;  2FHD A;  1MV0 B;  3SDZ A;  1SHG A;  1UUE A;  1M1K U;  5LJ5 f;  4RG2 A;  4L6V 5;  3CME Q;  1FWZ A;  1QVG A;  3H0H A;  2FVU A;  3OYY A;  4DEY A;  1TS9 A;  5LJ3 h;  1ZUK A;  3CC7 T;  4RTU A;  4BDZ A;  2GNC A;  5EC7 A;  4HCB A;  1IHV A;  3RBB B;  4LUD A;  3CCL Q;  4E7L A;  1NPR A;  3O8V A;  4JJB A;  2DRM A;  3INZ A;  1T0J A;  5C6S A;  3H0F A;  2LMJ A;  3R6O A;  4DEX A;  1PC0 A;  2M0Y A;  5L8R E;  4DBH A;  1H3Z A;  2KRM A;  1RAD B;  4LUE A;  1BIA A;  3H0I A;  3QG1 A;  1WHL A;  2DFU A;  3CPW P;  3CCU Q;  4OB1 B;  5KE3 A;  5CK9 A;  1R8O B;  2C0I A;  3MET A;  4FCY A;  2RB6 A;  2LJ3 A;  5IAY A;  5D6W A;  1PD1 A;  4C92 A;  2CSI A;  2J6F A;  2JNG A;  4WTO B;  3LWH A;  9ATC B;  1OPK A;  1FMK A;  1HJD A;  2RO0 A;  3V8J A;  4X9C A;  4XU3 A;  3PT9 A;  5EG2 A;  5LJ3 g;  1LNX A;  1QVP A;  1KFZ A;  2CZ6 B;  2DJZ A;  2O4X B;  2HL5 C;  1I1J A;  3EG9 A;  3CCM A;  3VUZ A;  3EHR A;  2DL5 A;  1OU9 A;  1JRI A;  4BY6 C;  2KY9 A;  4BY6 B;  2EWN A;  4FW1 A;  2EYX A;  2JM9 A;  2X3W D;  1MUZ A;  1TXQ A;  1JJ2 A;  1VQ9 Q;  1VOM A;  1QWE A;  4HCZ A;  1YJN Q;  4A4H A;  3L2R A;  3M56 A;  4ESR A;  3HHT B;  2E3I A;  1NYG A;  3OYH A;  5GAO l;  2C0O A;  1ZBX A;  1VQ8 Q;  2HEQ A;  4RCC A;  2FG0 A;  1VQK A;  3I35 A;  4MZP A;  1BCO A;  3C0C A;  3VUB A;  4DBR A;  2GCX A;  4C92 E;  1M27 C;  3DKM A;  3QXE B;  1H92 A;  5FU7 C;  1GRI A;  3JB9 F;  5FU7 B;  5GAM d;  4XAX B;  1VQO T;  5CQY A;  1UGS B;  2L3S A;  4PNO A;  3GOX A;  2CZ0 B;  2RK1 A;  2RQV A;  2LTO A;  2E70 A;  3HRU A;  4E6R A;  1X2K A;  4FT2 A;  4M77 A;  1X2Q A;  1BB9 A;  4XTX A;  3TU4 K;  4BI4 A;  1ZA2 B;  2DL8 A;  3JB9 G;  1RAG B;  3VS4 A;  3PMI A;  4A4K A;  2E12 A;  1HXD A;  1CKA A;  1NJI U;  3G6E Q;  3CEY A;  4Z88 A;  4C92 C;  1NE8 A;  3FB9 A;  4C92 B;  1M2O A;  2X4X A;  3OYM A;  1AEY A;  2X4J A;  1W1F A;  3Q1J A;  1I4K 1;  2YUO A;  3P8H A;  4LXC A;  3BW1 A;  5FRN A;  2LX7 A;  2NLU A;  4JLG A;  2DLP A;  3WVD B;  8AT1 B;  2YRV A;  1NZ9 A;  4M78 F;  4MZM A;  2MF2 A;  2BZY A;  3OMC A;  1YIT A;  2ABL A;  2RQU A;  2QEX T;  3MEV A;  1K9A A;  2DNU A;  5LJ3 f;  4B6M A;  2HAX A;  5FW9 A;  3JCM b;  5GAN h;  2DL3 A;  1JU5 C;  2I0N A;  4D8D A;  4C0G A;  3UPU A;  1YCY A;  4DQ2 A;  4PJJ A;  2CZ7 B;  3ZBD A;  2GBQ A;  4HXJ A;  4Y92 A;  4PJO A;  4BI8 B;  4PFP A;  2HNI A;  1KD1 R;  3CPW S;  4L5G A;  2EIF A;  3NTK A;  3M0P A;  2LT1 A;  1KQ1 A;  2F5K A;  4J83 A;  2V8J A;  2HDA A;  2CUB A;  1VQ4 A;  1PRL C;  4NS5 A;  2YSQ A;  2GQV A;  1S72 A;  3MJX A;  4KUD K;  1PNJ A;  3C12 A;  1VQM T;  2COW A;  1YWP A;  4M7D G;  2DD5 A;  2Y90 A;  4C92 D;  2PUK B;  2MMP A;  1QKW A;  2L3R A;  1G8X A;  2WAC A;  1VQ6 A;  5I11 A;  2WSE E;  1TU0 B;  1W6X A;  1UGP B;  1C1A A;  1JQQ A;  3RKX A;  4M7A G;  4JZ4 A;  3CCM Q;  1WGS A;  5CKE A;  5GAN g;  1OI1 A;  2NUP A;  3REA B;  4M77 C;  3UAT A;  2DBK A;  4RTZ A;  1I81 A;  2D0Q B;  1OQK A;  1BI3 A;  2FL7 A;  2XDP A;  3X24 B;  1WHJ A;  3CME T;  2CP3 A;  1M4Z A;  4M7A E;  1G3T A;  1YWO A;  1K8A U;  3M53 A;  3X20 B;  2BZ8 A;  2DXB A;  4ANJ A;  2DAQ A;  2COY A;  1ZSG A;  2CYZ B;  3H8Z A;  1VUB A;  4OGC A;  2RQR A;  4FM4 B;  1PSF A;  1VQK Q;  1QW1 A;  1SKU B;  4DBQ A;  4NL3 A;  2QQS A;  2LT4 A;  2LDM A;  4DOW A;  4K11 A;  4PLL A;  3ZEH A;  3C4S A;  3RIR A;  4XU0 A;  1Q95 G;  3HRT A;  4JDS A;  4MDW A;  2RQT A;  3VV0 A;  5HK3 A;  2OTJ A;  1BK2 A;  1VYU A;  4NL2 A;  2X51 A;  3I55 Q;  2K57 A;  3TSZ A;  3CXC S;  3UT1 A;  2DBM A;  4QW2 A;  4M7A C;  4M7A B;  2L0A A;  4A4F A;  3G71 A;  1WIE A;  1WYX A;  3OYI A;  2KXC A;  1LPL A;  2X9H A;  3HP9 A;  1Q82 U;  1N6A A;  4OB2 B;  3E1S A;  4M77 D;  1H8K A;  1Q82 C;  2MYS A;  4OGE A;  1QVF P;  1BKB A;  4J6Y A;  2ZZD A;  2JXB A;  3G7Z A;  4OB0 B;  3MPU B;  2RM4 A;  3MP1 A;  5HKC A;  2LNV A;  4EMH A;  2RN8 A;  1YJN T;  3FIF A;  1WZO A;  1YI2 A;  4PL6 A;  1JEG A;  1YIT Q;  3MEU A;  1MV3 A;  1TWB A;  3DB3 A;  2MIO A;  3OA6 A;  3CC2 T;  2LX9 A;  2OI3 A;  1GFD A;  2AHJ B;  3A8G B;  1K73 C;  1PKS A;  4Y91 A;  4CI0 C;  1QP3 A;  1C6V X;  1RAI B;  4IKF A;  2LQ8 A;  3LGL A;  4CRI A;  5GAN f;  2AZS A;  2R58 A;  2XKO C;  1QLY A;  5KE2 A;  2EQU A;  3TEE A;  1QP2 A;  2CUD A;  3AT1 B;  3PTA A;  2F1L A;  1SEM A;  2GFU A;  3LX7 A;  4RTY A;  1M1K R;  4OB3 B;  3NTI A;  1S72 Q;  1KD1 U;  4PJO D;  5D6Y A;  4C5I A;  1WHK A;  3NGP A;  2SEM A;  5GAN 8;  2H3J A;  2O2O A;  3PIO A;  3EG0 A;  1BI1 A;  4FYY B;  4F17 A;  2JVV A;  1IXD A;  3P8D A;  2GFA A;  2XID A;  1VQ6 Q;  3H41 A;  3CBM A;  3G6E T;  1W4S A;  2L3Q A;  2XG8 D;  3OYF A;  1RUW A;  7AT1 B;  4KUI A;  2DE0 X;  2GGR A;  2EYZ A;  2DIQ A;  1EIF A;  4M75 G;  3FJ5 A;  1YIJ A;  3CCL A;  1U06 A;  1VQN A;  1UJY A;  3G4S A;  1AWW A;  4PKC C;  2M0O A;  3V7S A;  5IT9 E;  1KK7 A;  3M0R A;  2VAS A;  2QXF A;  2KYB A;  3S3N A;  1QVF A;  3EGU A;  5AYF A;  2YRC A;  3CCU A;  5IHK A;  3VS7 A;  4M75 E;  1VQ5 A;  2NUZ A;  4J6W A;  2M9U A;  4AMC A;  2F5T X;  3NPF A;  4XTU A;  2P4T A;  3A98 A;  1VIE A;  4F7U A;  2ZPG B;  1Z9Z A;  4GY5 A;  1OPL A;  3VJP A;  2ZPH B;  5A0D A;  3HKS A;  2IIM A;  2O9V A;  2LCC A;  2PNI A;  3M4G A;  2DO3 A;  1G5V A;  4JS4 A;  4CC4 B;  3A5Z B;  2GTO A;  3E9G A;  3G71 Q;  3EHQ A;  5KYY A;  2YUN A;  4JJN K;  1JO8 A;  2PU9 B;  3GBQ A;  4FYV B;  3CMA A;  1VQ9 A;  1YJ9 Q;  2FRW A;  3EGD B;  4M75 C;  5IN1 A;  4M75 B;  2FZC B;  2YUQ A;  3VS1 A;  5CKF A;  4EMK C;  2JMA A;  1GCQ A;  3CCM T;  3OYL A;  2DEQ A;  3ER0 A;  4EMK B;  1KQS A;  3OS2 A;  3EFS A;  4J9H A;  1I0C A;  3SWN A;  1VQ8 A;  1NPP A;  1WNL A;  4JRK A;  3CPF A;  1VIF A;  5GJW B;  3VU3 C;  1HYO A;  4KGV B;  2JM8 A;  1ACM B;  5M9O A;  5J3B A;  4LE9 A;  2XMF A;  3A8L B;  2QA4 A;  4HT8 A;  1YI2 Q;  3JRZ A;  4OF1 A;  1UB4 A;  4BE2 A;  4V2S A;  3DLL A;  4FU6 A;  1UGQ B;  4J9E A;  2EJF A;  1VQK T;  2D8H A;  5IHN A;  3OMG A;  4IUR A;  2EGE A;  2QQA A;  1RLQ C;  2QAZ A;  1NJI R;  2VUB A;  3CCV Q;  1WJR A;  2K2M A;  2DX1 A;  2KI7 A;  4J8O A;  1LCK A;  4F14 A;  1OZ3 A;  1MND A;  3FDR A;  5I2S A;  2ZGW A;  1WHH A;  1D09 B;  2COZ A;  3RNJ A;  3OSV A;  2MAM A;  5AT1 B;  4XU1 A;  2XDB A;  1VYT A;  4C8Q A;  3AHU A;  1IGQ A;  2YT6 A;  5GAO r;  3BDU A;  2A37 A;  2CP6 A;  2KXD A;  1QQJ A;  2RQW A;  3JCM W;  4JZ3 A;  3HRS A;  1CSK A;  1OV3 A;  4C5G A;  1Y96 A;  2PQW A;  2JZ2 A;  4C0F A;  5GAN 3;  3PE0 A;  1YJW Q;  1Q7Y U;  4GBQ A;  3OYB A;  5A0G A;  1M90 U;  1M8M A;  5KYY B;  1YIJ Q;  1Q7Y C;  2O9S A;  3JCM d;  1X6B A;  1X75 C;  1M90 C;  1AZG B;  1WI7 A;  2FZG B;  1VQN Q;  2V1R A;  3G4S Q;  2LCS A;  5D7U A;  2K3X A;  3SWN C;  2IPO B;  2YLC A;  5LL6 S;  3SWN B;  2J7I A;  1YIT T;  3L1A A;  5CO7 A;  2CSQ A;  1VQ5 Q;  3MKD A;  1U3O A;  2DK3 A;  4AFU C;  2F2W A;  2VV5 A;  2E10 A;  1FXX A;  1M9S A;  1GXI E;  4OMP A;  5GAN 7;  1G3S A;  2EJ9 A;  2HCK A;  2BTT A;  3HSB A;  4N4G A;  1I07 A;  2XD0 A;  2J05 A;  1X6O A;  4C92 F;  4C8Q E;  2PTK A;  1ABO A;  2VGN A;  4CC3 A;  2QGG A; 
#chains in the Genus database with same CATH homology
 2I0N A;  4D8D A;  4OMM A;  4IIM A;  3IQL A;  4M4Z A;  2EGA A;  2BZX A;  2GBQ A;  3VS5 A;  4HXJ A;  4Y92 A;  2DL4 A;  3M0P A;  1UFF A;  2EYW A;  1KIK A;  2DIL A;  2HDA A;  1YNZ A;  2CUB A;  3QWY A;  1PRL C;  4KRT A;  1YCS B;  2PZ1 A;  2YSQ A;  1PNJ A;  2K7A A;  4JJC A;  2CH4 W;  1YWP A;  1AWO A;  4AFQ C;  2LP5 A;  2EW3 A;  1QKW A;  2B86 A;  2KR3 A;  2K6D A;  5I11 A;  1W6X A;  2RNA A;  1JQQ A;  2MCN A;  4JZ4 A;  1M3B A;  2V1Q A;  1KJW A;  1UJ0 A;  4J9I A;  4RTV A;  1AWJ A;  3REA B;  3UAT A;  2DBK A;  2H8H A;  1K0S A;  4RTZ A;  1NG2 A;  1Y0M A;  1SRM A;  1T0H A;  1NLO C;  2DJQ A;  2KEA A;  2ROL A;  1W70 A;  2AKL A;  2VWF A;  1T3S A;  1YWO A;  2KRS A;  2DVJ A;  1SRL A;  2BZ8 A;  1UGV A;  2AKK A;  1K0X A;  1SSH A;  4HVV A;  2D1X A;  3M0U A;  1ZSG A;  1AVZ C;  4J9F A;  2FPD A;  2RQR A;  2OJ2 A;  1TG0 A;  1BBZ A;  3U23 A;  1E6G A;  2DF6 A;  2RF0 A;  5I22 A;  2VVK A;  2GTJ A;  2JT4 A;  1JXM A;  2DA9 A;  4K11 A;  2J06 A;  3JV3 A;  4ZNX A;  4OMO A;  2RMO A;  2DL7 A;  2RQT A;  1BK2 A;  1WA7 A;  1VYU A;  1X69 A;  5FWC A;  1UHF A;  4OMQ A;  2O88 A;  3TSZ A;  2DYB A;  1AD5 A;  2L2P A;  2DBM A;  2JS2 A;  1GCQ C;  3PVQ A;  2HSP A;  2L0A A;  1ARK A;  1HD3 A;  1WIE A;  2RPN A;  4Z89 A;  1WYX A;  5FWB A;  2KXC A;  3SHW A;  1GCP A;  2EYY A;  2ENM A;  1UDL A;  1PRM C;  2F2V A;  3O5Z A;  1M30 A;  2C0T A;  2F2X A;  2P4R A;  1QKX A;  1AOJ A;  1M3C A;  2D0N A;  2DM1 A;  1H8K A;  3CQT A;  1QCF A;  1UTI A;  4AG1 C;  2A36 A;  1GFC A;  1BU1 A;  1ABQ A;  2JXB A;  1WLP B;  2LQW A;  2K9G A;  2KNB B;  1OOT A;  2RN8 A;  1EFN A;  4D8K A;  3REB B;  2CT4 A;  5IXF A;  3M0S A;  4OMN A;  1ZX6 A;  2ECZ A;  1NLP C;  2ED0 A;  1Y57 A;  2GQI A;  3TSW A;  1JEG A;  4IIO A;  2VKN A;  2A28 A;  4JJD A;  1WFW A;  4HVU A;  4AFZ C;  1MV3 A;  2MIO A;  1KSW A;  4J9G A;  2OI3 A;  1X43 A;  4R0K A;  2QDL A;  4LN2 A;  1UG1 A;  1GFD A;  1WXB A;  1FYN A;  2J6O A;  1ZUY A;  1J3T A;  1G2B A;  4HCK A;  1PKS A;  1JXO A;  4QT7 A;  3SEM A;  1HSQ A;  4AG2 C;  1RI9 A;  2AZS A;  5HCK A;  4F16 A;  1QLY A;  2ED1 A;  2JW4 A;  4AFS C;  1WXU A;  2CUD A;  3KFV A;  3ZL7 C;  1K76 A;  4RUG A;  1SEM A;  5GJV B;  4RTY A;  3ULR B;  2FO0 A;  2O31 A;  2LJ1 A;  4Z8A A;  2FPE A;  3UA6 A;  1X6G A;  3VRY A;  4HVW A;  2LNH B;  1UHC A;  3M0T A;  3NGP A;  2SEM A;  2CRE A;  2O2O A;  1NM7 A;  3EG0 A;  4F17 A;  3VS2 A;  1AWX A;  4OML A;  2EKH A;  1PHT A;  3H41 A;  2L3Q A;  1RUW A;  2YUP A;  1XOV A;  5IH2 A;  2EPD A;  1CKB A;  2DE0 X;  2GGR A;  4WCI A;  1TUC A;  2EYZ A;  4J9B A;  1GL5 A;  2LZ6 B;  2HBW A;  1RLP C;  1SPK A;  1OEB A;  1ZLM A;  3FJ5 A;  1AZE A;  1U06 A;  2KRO A;  1PKT A;  2LJ0 A;  1YP5 A;  2ROT A;  4GLM A;  1MV0 B;  1UJY A;  3I5S A;  1AWW A;  1SHG A;  1UUE A;  1M3A A;  1U5S A;  3M0R A;  1UE9 A;  2KRN A;  2KYB A;  3EGU A;  3H0H A;  4J9D A;  1GBR A;  5IHK A;  3VS7 A;  4DEY A;  2NUZ A;  1ZUK A;  3QWX X;  4RTU A;  2GNC A;  2JTE A;  2X3X D;  5EC7 A;  4CC7 A;  3RBB B;  3NMZ C;  4LUD A;  1NYF A;  3NPF A;  3VRZ A;  1X27 A;  2KGT A;  3A98 A;  4JJB A;  2DRM A;  2FPF A;  1T0J A;  2KE9 A;  1B3Q A;  2LMJ A;  3H0F A;  4DEX A;  1Z9Z A;  1OPL A;  2M0Y A;  5IHI A;  2KRM A;  2E5K A;  1QWF A;  3H0I A;  4LUE A;  4RTT A;  2IIM A;  1N5Z A;  2O9V A;  2YDL A;  1E7O A;  2PNI A;  2LQN A;  2C0I A;  2DRK A;  4CC4 B;  1IO6 A;  2LJ3 A;  3TVT A;  2GTO A;  2OAW A;  3EHQ A;  2KT1 A;  2CSI A;  2M51 A;  2YUN A;  2J6F A;  1JO8 A;  3GBQ A;  3M0Q A;  4J9C A;  1OPK A;  2FRW A;  1FMK A;  1HJD A;  1B07 A;  2YUQ A;  3VS1 A;  2EGC A;  2K3B A;  1GBQ A;  2JMA A;  1GCQ A;  2NWM A;  1KFZ A;  1E6H A;  4J9H A;  1I0C A;  1JU5 C;  1I1J A;  1A0N B;  5GJW B;  2FEI A;  3EHR A;  2DL5 A;  2EVR A;  2JM8 A;  5ECA A;  2CT3 A;  2EYX A;  5L23 A;  3VS3 A;  2JM9 A;  2X3W D;  1MUZ A;  2XMF A;  4LE9 A;  1QWE A;  2KBT A;  3THK A;  2K79 A;  2AK5 A;  3EG1 A;  4ESR A;  4J9E A;  2AZV A;  1NYG A;  2D8H A;  5IHN A;  2C0O A;  2KYM A;  3LH5 A;  3UF4 A;  2HEQ A;  2MOX A;  4FSS A;  2FG0 A;  2EGE A;  3EG2 A;  2A08 A;  1RLQ C;  3I35 A;  3C0C A;  1Z9Q A;  3VS6 A;  2K2M A;  1ZUU A;  2DX1 A;  4CC2 A;  1LCK A;  4F14 A;  1M27 C;  2DMO A;  1PWT A;  1H92 A;  1GRI A;  2L3S A;  1T3L A;  2L3P A;  2RQV A;  3RNJ A;  1UEC A;  1H3H A;  3EG3 A;  3UA7 A;  2G6F X;  2W0Z A;  2EBP A;  1VYT A;  1YN8 A;  4X1V A;  4E6R A;  2YT6 A;  2J6K A;  1X2K A;  2A37 A;  4ORZ A;  2KXD A;  1X2Q A;  1BB9 A;  2RQW A;  1SHF A;  4JZ3 A;  3I9Q A;  2KT8 A;  1CSK A;  2DL8 A;  1NEB A;  1OV3 A;  5IXB A;  3VS4 A;  1VYV A;  3PE0 A;  2JS0 A;  1K4U S;  1WDX A;  1CKA A;  4GBQ A;  3I5R A;  4Z88 A;  1TUD A;  1M8M A;  1K1Z A;  1ZBJ A;  2SRC A;  1WXT A;  4EIK A;  3NHN A;  2O9S A;  1X6B A;  2CH4 A;  1AEY A;  1VA7 A;  4A63 B;  1W1F A;  2FRY A;  1AZG B;  4RTW A;  1WI7 A;  2YUO A;  2V1R A;  2W10 A;  2LCS A;  1G83 A;  2EQI A;  1S1N A;  2LX7 A;  4LNP A;  3R6N A;  3VS0 A;  2DLP A;  2J7I A;  1V1C A;  2D8J A;  2CSQ A;  1U3O A;  4AFU C;  2F2W A;  1WX6 A;  2BZY A;  2ABL A;  4OMP A;  2RQU A;  3PVL A;  1K9A A;  2JMC A;  2HCK A;  2BTT A;  2DNU A;  2ESW A;  1I07 A;  5FW9 A;  2J05 A;  1NEG A;  4JPB W;  2CDT A;  2PTK A;  1ABO A;  2DL3 A;  4RTX A;  4CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...