3H0HA

Human fyn sh3 domain r96i mutant, crystal form i
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
GGTGVTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
total genus 10
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0hA00
2HSPA 1NYFA 4J9BA 3O5ZA 2GBQA 1WFWA 1WX6A 2GGRA 2V1QA 2KNBB 4Z8AA 2CH4W 1AD5A 4HCKA 1HD3A 2K2MA 1X2KA 1ZUYA 5EC7A 5GJWB 2D0NA 2SEMA 4J9EA 4A63B 2DL8A 2EBPA 4LNPA 2K3BA 1K76A 1ARKA 1X6GA 2CUDA 2J05A 2LZ6B 2A36A 2EKHA 2F2VA 4JJDA 1GRIA 1WXTA 2A37A 3ULRB 2DL5A 2DRMA 1UHCA 1LCKA 2D1XA 2FPDA 3EG3A 1M3CA 1OOTA 3M0RA 4JZ3A 1GCPA 2EPDA 2DILA 3VS2A 4D8KA 2JXBA 2LJ1A 3M0PA 1RI9A 2H8HA 2AZSA 3UF4A 3SHWA 3PVLA 2KXCA 3IQLA 2FRWA 4HVWA 1IO6A 2JMCA 2W10A 2JS2A 1Z9ZA 2CREA 3PE0A 2ENMA 1W1FA 2VKNA 4AG2C 2J6OA 1AWOA 2E5KA 2ED0A 2YDLA 3CQTA 1AWXA 2KR3A 4J9GA 1G83A 3M0SA 1J3TA 2LX7A 1N5ZA 2DRKA 1E6HA 2KROA 2DE0X 1QWEA 1NLOC 4OMQA 5IHNA 4K11A 2BZXA 4E6RA 3NMZC 4DEYA 2DBKA 1OEBA 1GL5A 2CT3A 4RUGA 2K6DA 1AWJA 1NM7A 2EGEA 1M30A 4ESRA 3I5SA 1CSKA 1UJYA 2EVRA 5I22A 2DLPA 3A98A 3TVTA 1NEBA 1GCQC 1HJDA 4HVUA 3M0QA 2JM9A 2LJ0A 2G6FX 3RBBB 1JU5C 2RQUA 2DBMA 2FPEA 4AFZC 3REBB 4Z89A 2IIMA 4RTUA 1YWOA 2KRMA 2ED1A 2VWFA 1WXBA 2RQVA 3NHNA 3H0IA 1NEGA 4GBQA 2OJ2A 1K9AA 1MV0B 3ZL7C 2BZYA 1PRLC 2L2PA 4D8DA 2KBTA 1XOVA 4ZNXA 2L0AA 2YUQA 5FW9A 2PZ1A 1UHFA 1PKSA 3M0TA 4J9FA 2EQIA 2CH4A 1G2BA 4J9IA 3I35A 2AZVA 2L3PA 4HVVA 2J6FA 1H3HA 4RTWA 1QKWA 1YNZA 3I9QA 2YT6A 1UECA 4JJBA 3U23A 1H92A 4RTVA 2ROTA 2EYYA 2KRNA 2KT8A 2KYMA 2LCSA 5FWBA 2GNCA 1BU1A 2K7AA 5L23A 1B07A 4AFSC 1ZX6A 2AKKA 2FPFA 2LQWA 4J9CA 4RTXA 3VS4A 1EFNA 1VA7A 2X3WD 1T0JA 2OI3A 2FEIA 1OPLA 1CKAA 2YSQA 4LE9A 2LJ3A 2SRCA 3TSWA 3I5RA 4OMMA 3H0FA 2QDLA 2XMFA 4AFUC 1A0NB 1WIEA 2JTEA 2L3QA 1FYNA 2YUOA 3SEMA 1X69A 3UATA 1WA7A 2MOXA 3FJ5A 2DL3A 2YUPA 2RPNA 3VS0A 2DX1A 1I0CA 1NLPC 1M8MA 1U3OA 1W6XA 1Y57A 4GLMA 4OMOA 2DM1A 1T3SA 2MIOA 1UG1A 2ESWA 1JXMA 3M0UA 1SEMA 3H41A 2RQRA 2C0TA 2JS0A 1FMKA 4J9DA 2DL7A 1QCFA 1BBZA 4AFQC 2J06A 2KT1A 2O31A 5ECAA 2KEAA 2D8JA 4X1VA 2JT4A 2HCKA 1SRLA 2NUZA 2RQWA 1Y0MA 2GTOA 3EHQA 1T0HA 1SPKA 1X43A 4DEXA 2OAWA 5IHKA 1YP5A 2O2OA 1UGVA 2I0NA 2F2XA 1UE9A 2GQIA 1U06A 5GJVB 2PNIA 4AG1C 1K0SA 1BK2A 3UA7A 1ZUKA 5IHIA 2DNUA 3VS5A 2K9GA 1KFZA 2ECZA 3VS3A 1M3BA 2DVJA 4M4ZA 1AZEA 2FG0A 1QLYA 2W0ZA 2CSIA 2F2WA 1YCSB 1I07A 3C0CA 1KJWA 1K4US 2ROLA 2GTJA 1JO8A 1HSQA 2HDAA 1YN8A 2EYXA 2JMAA 2YUNA 2O9SA 4JJCA 1S1NA 3EG1A 3H0HA 2AK5A 4QT7A 2J7IA 4J9HA 1GCQA 3UA6A 2BZ8A 1U5SA 4LUEA 4Z88A 2KYBA 1ZBJA 1SHGA 1RUWA 2O88A 1Z9QA 3LH5A 4CC2A 5IXBA 5IXFA 3VS6A 5HCKA 3VRYA 1UFFA 3QWYA 2ABLA 5IH2A 2LNHB 4CC4B 2EGCA 2LQNA 1YWPA 1JQQA 1ZUUA 1I1JA 3NPFA 2V1RA 1GFDA 2LMJA 5FWCA 2RNAA 4JPBW 4F17A 2K79A 2EYZA 2CSQA 1SRMA 2O9VA 2EW3A 4Y92A 2CDTA 2KGTA 1OV3A 2MCNA 1SSHA 4KRTA 2KRSA 1PWTA 1GBQA 1AOJA 3THKA 4OMLA 1E6GA 1PKTA 2DMOA 2C0OA 2VVKA 3PVQA 2HEQA 2DL4A 1MUZA 1PRMC 2CUBA 1TUCA 2NWMA 2RMOA 1WLPB 4LN2A 1B3QA 1SHFA 2M51A 2B86A 2JW4A 3R6NA 1UUEA 1AWWA 4CC3A 2DJQA 4R0KA 5I11A 2J6KA 1RLQC 4RTZA 3RNJA 2LP5A 4HXJA 1VYVA 1WDXA 1VYUA 2D8HA 2HBWA 2FO0A 2A28A 1H8KA 3EGUA 4F14A 4CC7A 2RF0A 3NGPA 2JM8A 3GBQA 4ORZA 3EG0A 1W70A 4F16A 4OMPA 1ZSGA 1UTIA 1TG0A 2M0YA 2RQTA 1X6BA 2DYBA 1ABQA 1QKXA 1V1CA 1NG2A 2DA9A 1CKBA 1JXOA 2RN8A 1WYXA 2EGAA 2P4RA 2A08A 1T3LA 1ABOA 3EHRA 4RTYA 2KE9A 1E7OA 1PNJA 1VYTA 1NYGA 1WXUA 1JEGA 1AZGB 3EG2A 2KXDA 4LUDA 4IIOA 1UDLA 3KFVA 3QWXX 3VS7A 3VS1A 1X27A 3VRZA 1RLPC 2X3XD 4FSSA 1KIKA 2PTKA 1KSWA 1BB9A 4RTTA 1PHTA 3JV3A 1K1ZA 1GFCA 1OPKA 2FRYA 1AEYA 1WI7A 2BTTA 4OMNA 3REAB 2DF6A 4EIKA 1K0XA 1M3AA 1ZLMA 1TUDA 1X2QA 1GBRA 3TSZA 1MV3A 4IIMA 1AVZC 2CT4A 2L3SA 2EYWA 1M27C 1UJ0A 2C0IA 4JZ4A 1QWFA 2AKLA 4WCIA
chains in the Genus database with same CATH superfamily
4F7UG 3JB9I 2DJZA 3SB2A 2GBQA 4M78A 3UWNA 1VQOA 1R77A 2V1QA 3RMSA 2KNBB 3MP8A 1QP2A 1HD3A 3H9NA 3CC2A 5EC7A 2GF7A 1QVGA 3RMQA 3OYCA 4M75F 2X35A 1SF9A 3MP1A 4LNPA 3VYHB 2K3BA 5D6XA 2J05A 2A36A 2EKHA 2F2VA 3QZ5B 1YI2T 4XAXB 1M4ZA 5KCOA 4RKUE 2DL5A 5KE2A 1NJIC 3TREA 1W2BP 1Q81R 2D1XA 4NOYA 2FPDA 1YJWQ 4DOWA 1GCPA 4FT4A 4D8KA 1YHQQ 4OB0B 4J7IA 2LJ1A 3OYLA 2AZSA 3SHWA 3C12A 2FRWA 4HVWA 2JMCA 2EJGA 3PFSA 5CQXA 1Z9ZA 2J6OA 2E5KA 3CQTA 4A54A 8AT1B 2KR3A 4M77A 1MNEA 1PCXA 2ZPFB 2DXUA 1G83A 3CC4Q 3M0SA 4O5VA 1J3TA 4NS5A 4EMKB 2DRKA 1VQLT 1R0BG 1JBMA 1NLOC 4OMQA 4K11A 2BZXA 2F5TX 2L89A 1NZ9A 4E6RA 3JAME 1OEBA 3QSUA 1K73U 1U1TA 3LX7A 2PVGB 2QQAA 3QDFA 3OYGA 1N8RC 1KD1R 1KQSA 3CCET 5CAIA 2QTXA 2P0QA 5I22A 2EIFA 2IG0A 3A98A 3TVTA 4M77C 1N9RA 5KYNA 1IZ6A 4EMGA 2JM9A 2G6FX 2RQUA 2DBMA 1QCNA 4AFZC 2K5IA 4Z89A 3GIBA 2KRMA 4JRKA 1K73R 1ZSZB 2DIGA 3OYDA 2MWPA 3SWNC 3H0IA 1NEGA 2OJ2A 4AMCA 2L2PA 4D8DA 1XOVA 1M1GA 3MHXA 1LOJA 4F7UB 3G6EA 3M0TA 2CH4A 3UPUA 1RI0A 5GAOp 2J6FA 1AHJB 3I9QA 3MKDA 4QQDA 2R58A 2EYYA 2H3EB 1WJSA 1Q95G 2FPFA 3VS4A 2E41A 1EFNA 1VA7A 2X3WD 3HKSA 4KH1B 1VQNQ 2GFUA 3S6WA 1OPLA 1TWBA 3EGDA 1CKAA 4LE9A 1D0XA 2JOYA 3CC2Q 1EIFA 3CCVT 1WIEA 1KG1A 1Q81U 3CD6A 4C5GA 2L3QA 4PJOB 2YUOA 3SEMA 3S3MA 1Q7YU 3E2UA 4PJOA 2XG8D 4M75G 1PD1A 2MOXA 3CCEA 1QP3A 2YUPA 2RPNA 4PJOC 2DXTA 2CZ7B 1W6XA 5KH6A 4B6MA 2DEQA 4QQ6A 4ELZC 2LT4A 3CCRQ 3OYYA 2ESWA 2HZYA 3CXCP 4C0DC 1JXMA 4F7UE 1PSEA 2FB7A 4C92A 2C0TA 3VKIA 4J9DA 4M78B 2X4JA 3CCMQ 3DLMA 5CKHA 3JB9J 5FLXE 2O31A 2KEAA 3E9FA 1I5OB 4C0DB 2HCKA 1SRLA 2ATCB 4C8QF 4MZMA 3LW5E 3HRUA 3CCUQ 1X43A 2OAWA 3L2QA 5A0GA 2O01E 2DEUA 3CCSQ 1G3SA 2QA4T 1VQ8A 1G3WA 2JN0A 5GAN8 5LJ5g 2PNIA 3QZ9B 2XDDA 4DOVA 1RABB 1BI1A 5FU7C 4BDZA 1B34B 3PMIA 1WHMA 2DVJA 2QG9B 4M4ZA 4C8QA 2FG0A 2W0ZA 4M77F 1VQ9T 1YCSB 3G4SQ 3C0CA 4M7DE 1JO8A 1RACB 3GPLA 1ZHIA 2R5AA 1QMCA 3JCMg 4JJCA 3NTHA 3JCMd 2ZPIB 4J8OA 2QEXQ 2A7YA 2J7IA 5KCHA 2JJ9A 3EGXB 2DXBA 1SHGA 3CEYA 1RUWA 1R0CB 5IXBA 2E1HA 4Y28E 3OW2P 3A1PA 1IHVA 2ABLA 1IXDA 1KK7A 1WGSA 5CKBA 1IHWA 1XTDA 4BB7A 3MEAA 2LDMA 1GFDA 2BKDN 4JPBW 2K79A 4KULA 5I2MA 1K8AC 2QGGA 3CCMA 3OYFA 4DBFA 1KC8C 1H641 4M75A 4Y92A 2KGTA 2MCNA 2RHIA 1Q86U 1V29B 2Y4XA 1WHJA 5LJ5h 3CPWS 1PWTA 1GBQA 3QG1A 2NUPB 1ACMB 2E6ZA 5CKEA 4XU0A 3QO3A 1PKTA 1VQ7T 5D6WA 1H3ZA 4ZTJA 2QA4A 1VQ8T 3MPUB 2CUBA 2M1HA 2F5KA 4PK4A 1B3QA 2E12A 1VQKA 2QQRA 1WHHA 4PJOF 1VQNA 4R0KA 1O75A 5CIUA 1RLQC 2CP5A 3SWNA 1QCOA 3RNJA 3WVEB 4HXJA 4N0AC 3FJPA 1WDXA 2K3YA 1MMNA 2HBWA 1UGRB 2YRCA 1H8KA 1IB8A 3V7SA 1BYMA 4NL2A 2DAQA 2JM8A 4ORZA 3EG0A 2ZPGB 4OMPA 1ZSGA 4MMLA 1UGPB 2EAYA 3URGA 1QKXA 3BDLA 3C4SA 1ZSZC 2LNVA 1ABOA 3EHRA 2KE9A 4R55A 1WJRA 4JRQA 1VYTA 3OBYA 1JEGA 4BE2A 2JZ2A 1UDLA 1OX8A 2VV5A 4HCCA 4ATOA 2PTKA 1KSWA 3QDRB 3SDZA 4RTTA 4IUTA 3JV3A 4PJLA 1VQPQ 1YBYA 5I2SA 3AHUA 2QQBA 1S72A 2BTTA 1VQLQ 2DF6A 4QW2A 1N27A 2X4YA 3I56A 4C92G 3UDCA 2NUPA 1RAFB 3UT1A 2NLUA 1X2QA 2L3SA 2EYWA 5HK0A 3A8HB 1M27C 3G6EQ 1KD1C 5M9OA 1QWFA 3QJYA 1M2OA 2HSPA 4A4GA 3O5ZA 1Q86C 3M58A 5GANj 2K5LA 3BW1A 3WXMB 3DB3A 1QVFA 2GGRA 3FIFA 4Z8AA 5KYXB 4PKCC 1AD5A 4ZGJB 2AHJB 1AT1B 2K2MA 1MGQA 3QYHB 5J39A 2DFUA 3CCLA 1VIEA 2QXFA 2KK4A 2FZCB 4J9EA 2DL8A 3PTAA 5D7UA 3EFOB 1K76A 1RAIB 2PUKB 3PNWC 1ARKA 2LZ6B 2QI2A 3MEVA 4M78C 4JJDA 2MPXC 4OMFB 2WACA 2CP7A 3LH0A 2DRMA 1UHCA 3OW2A 3EG3A 3M56A 5I21A 4P5NA 1WNLA 4JZ3A 4N4GA 1U8RA 2EPDA 5IAYA 4E47A 1K9MU 3CCUA 4M77D 5KYWA 3V7RA 1M1KR 1TSFA 3JB9F 1RI9A 1B34A 3PVLA 4WF2A 2JTMA 1SKUB 1F1BB 1IO6A 4ZGEB 2FVUA 3PE0A 1XNIA 2QA4Q 4PJJA 2IPOB 3JRZA 1R8OB 1LPLA 1AWXA 2L3RA 5DY9A 3PT9A 2D6FA 4MMKA 1YI2A 1M90C 3KBGA 2DD5A 1N5ZA 4JJNK 2XI9A 5GAN4 4LD9K 3MEWA 2DE0X 1MHNA 2E3HA 1IGUA 4C8QE 5HY6A 3NMZC 4DEYA 5GMKm 3V8LA 2K6DA 4J83A 3JCMc 4ESRA 5KYYB 2ZZDA 2EVRA 4JLIA 1YIJA 2LX9A 4F7UF 1GCQC 1HJDA 1RADB 3M0QA 1NJIU 1JU5C 4XU2A 4XU3A 1I4K1 4M75D 4B9XA 5FU6B 4RTUA 5C0MA 2XD0A 3D7SB 5DLOA 1KQ2A 1WXBA 1YIJQ 3M54A 1KC8U 1K9AA 4LXCA 4PJOD 3ZL7C 1KQSS 2BZYA 1FXXA 1YJ9A 4LDYA 3BY7A 1VQ9A 1SSFA 3DKMA 5A2QE 2EQIA 4J6WA 3G71A 2AZVA 3ASKA 2NYSA 3MO8A 1H3HA 4RTWA 2YT6A 3CBPA 2VB6A 1UECA 3M55A 4JJBA 4RTVA 2P4TA 3L1AA 2KYMA 3HFNA 1Q7YR 2C06A 1BU1A 3CMAT 2QYZA 5L23A 1ZSZA 4C0FA 3CD6T 5GAOn 1NE8A 2HKQB 1IGQA 4M7AB 2FEIA 5GANg 3CCQA 4CI0C 2R5MA 2LJ3A 4M7AG 3TSWA 1BI3A 1YJNA 2QDLA 2XMFA 4QKUA 4MDWA 2RJDA 2JTEA 2QASA 1FYNA 1X69A 3HL8A 3EG9B 3OSVA 1YITT 5GMKj 4C92E 3JCMJ 3UATA 3OYBA 3G6ET 3FB9A 3HFOA 1FWZA 4M78D 1RL2A 2E6NA 1N8RR 4MZTA 3EFSA 3NFCA 1M8MA 4FYXB 3M4YA 3EH1A 1Y57A 2V26A 2MIOA 3CC7A 1JJ2A 1MMAA 4PLLA 1OZ3A 3F70A 3OQ5A 3M0UA 1SEMA 1VQ7A 3L42A 3OYJA 1VQ6Q 1YJWT 2XKOC 1QCFA 2PUOB 4QQGA 2COWA 3CCVQ 2J06A 2KT1A 4XU1A 2COYA 5ECAA 4A4KA 2MF2A 4OB3B 2D8JA 1D1CA 4X1VA 3RKYA 3EAEA 1KQ1A 3QBYA 2XU8A 3MCAB 1KC8R 2EWNA 1Y0MA 3R6OA 2GTOA 3JCMb 1JJ2P 3OYHA 2RD1A 1YP5A 5DLQE 1UGVA 4M78G 2M0OA 2G3RA 3CC4T 4M7AF 2GQIA 1IREB 1K0SA 1GXIE 5AT1B 5IHIA 3VS5A 4DBQA 2K9GA 4HT8A 1RAGB 2CS7A 1Q82C 3CCJQ 1AZEA 2CSIA 2D0QB 1Q81C 1KJWA 1K4US 2GTJA 1C6VX 1OU9A 2OAUA 2HDAA 3RESA 4JDSA 2E3IA 1S1NA 3EG1A 3LWIA 4BACA 4QT7A 4LDVA 2HD0A 4J9HA 2IVWA 2BZ8A 1U5SA 2KYBA 4FIBA 1VQ9Q 2O88A 3BE3A 1VQ4T 2RK1A 2ZPHB 5HCKA 3VRYA 4E7SA 2EYQA 4CC4B 2CKKA 2EGCA 2LQNA 2VGMA 3X24B 2VYTA 2QEXT 2LMJA 2RNAA 4B9WA 1YJWA 4F17A 3I55T 2CSQA 5J3BA 5LJ5f 5A0LA 2CDTA 2MAMA 1QVFS 4RG2A 3CCJA 1OU8A 4XTWA 4PJMA 1AOJA 2BIVA 3CBMA 3THKA 2EFIA 4IUUA 2DMOA 1VQ5A 2HQEA 1MUZA 1OULA 2NWMA 2QAZA 4E7ZA 2EQUA 3RKWA 3HP9A 2KMTA 1YI2Q 1X01A 2VGNA 1AWWA 2DJQA 2V8KA 3H6ZA 4C92C 2LT1A 1VQ5Q 3LGLA 4RTZA 3BFMA 2GQVA 4A4HA 1WJQA 1UGQB 2K3XA 3OYEA 1N6AA 2A28A 2LC4A 1Q86R 2YLBA 5KYUA 3CCRT 2EJ9A 1W70A 4F16A 3FC3A 1M9SA 1HXDA 1TG0A 2M0YA 3QIIA 3C94A 4LD6A 4JLGA 3TCJA 2RQTA 1ABQA 3LYIA 1UB4A 3PMTA 3MEUA 4JRIA 1JXOA 3NTKA 4M7DF 4M77E 5LJ3j 1E7OA 1PNJA 4E7HA 4ZTFA 1VQNT 3QXEB 2KI7A 2KVQG 1AZGB 1PG5B 4KH0B 3CCQQ 3I55A 3JCMP 3VS7A 3EFRA 3VS1A 1RLPC 1XJWB 2X3XD 4IURA 3QYGB 4OP0A 5LJ3g 3T9NA 3CCJT 4BUGA 1BB9A 4LDXA 1PHTA 5LJ3h 2FRYA 2HKNA 2MK5A 8ATCB 3GF5A 4KUIA 3OYNA 2B8AA 4M7AC 1ZLMA 1PM3A 5GAMe 1GBRA 3TSZA 4DBRA 5GAOl 2LCLA 3M4GA 5CO7A 4JZ4A 4FYVB 4VUBA 4BD3A 2RJEA 5CKFA 4PNOA 1NYFA 4J9BA 4FU6A 2RHZA 1WX6A 1Y71A 2DKGA 1C1AA 2CH4W 4AT1B 4HCKA 3GNGA 2X4XA 5GAN2 1X6OA 1ZUYA 2RHUA 2L5QA 2D0NA 2SEMA 2AT1B 4D6WA 2FYKA 1FX7A 1X6GA 2QTVA 4M7DA 3G71T 3PIPA 1GRIA 1WXTA 2A37A 3EG9A 1Y07A 5IT9E 1LCKA 1VQ6T 2DIQA 1Q82R 1M3CA 1OOTA 4X9CA 3M0RA 4XTXA 1N9SA 3G4SA 4C92F 1VQKQ 2O4XB 5GANh 4XTUA 5J26A 2JXBA 5GANf 3M5AA 2H8HA 4EDUA 4TVRA 1PD0A 2VASA 2W10A 2JS2A 4M78E 2DO3A 5GAOq 2CREA 1W1FA 2VKNA 1M90U 1Y96B 1AWOA 2ED0A 2DTHA 4M75C 3I56Q 1FMVA 2CYZB 1BIAA 3JCMf 4FYYB 1RAAB 2F69A 2RJCA 1E6HA 2AIRB 2KROA 3OS0A 5GMKl 1YIJT 1QWEA 4RG8A 5IHNA 3CC7T 3LWHA 1G8XA 2EKOA 2CT3A 4RUGA 2MYSA 1MMGA 1NM7A 1YITQ 1YFNA 2EGEA 4YTLA 2RI3A 3CPFA 1RAHB 2YXYA 4JS4A 5LJ5d 1CSKA 1G3TA 1UJYA 2DLPA 2X51A 3CCSA 4J6XA 1ZQ1A 3VV0A 2LJ0A 1BKBA 5C6SA 4N4HA 1LVKA 3RBBB 2QEXA 2RHXA 3SFMA 2V8IA 2IIMA 1YWOA 3CC4A 3HSBA 2ED1A 3FDRA 2VWFA 2RQVA 5GAMh 4GBQA 4OVAA 2OTLT 3JCMV 1PRLC 4E7JA 4ZNXA 2L0AA 2M02A 2LTOA 2PZ1A 4J9FA 4J9IA 2RI2A 3I35A 2E64A 2K2VA 2HNIA 2L3PA 3CPWA 3META 2YRVA 3C95A 1QKWA 4OF1A 1H92A 2OTJA 4M77G 4PJNA 3OBWA 2KRNA 2KT8A 2PQWA 2RK2A 5FWBA 2RM4A 3QPHA 4C92B 1B07A 3Q1JA 4AFSC 1ZX6A 2DD4A 5FRNA 4RMOA 1T0JA 1Y7XA 2RHYA 4GY5A 1PSFA 1TU0B 4J7FA 2O4XA 2HL5C 4PL6A 1BI0A 2YSQA 4X9DA 2SRCA 4QVCA 1M1KC 3I5RA 4OMMA 3H0FA 1A0NB 2HQHA 3L2RA 4R56A 1WA7A 3JCMh 4M78F 3RKXA 3I56T 2X9HA 2RB6A 3RIRA 3FEOA 2DX1A 1NLPC 5KYYA 1U3OA 2QQSA 3M53A 4FL6A 4GLMA 2EJFA 4M7AA 2DM1A 4EMKA 5GAMg 4FW1A 2P0PA 4BI3A 1HK9A 2HMAA 4HT9A 2JS0A 1FMKA 3ZBDA 3OY9A 2XIDA 3KXTA 3TQ7P 2JUFA 1P92A 1WHGA 4Q5WA 4E2FB 4XTZA 3EHQA 3M57A 3LGFA 1ZA2B 1T0HA 1SPKA 4ZGDB 4E7KA 5IHKA 2O2OA 9ATCB 1DJ7B 4DBHA 3GOXA 2F2XA 5GJVB 3G71Q 4AG1C 1D0YA 5GAOr 3CC2T 1ZUKA 2DNUA 2XHCA 1VQMA 1QVFP 1WQWA 3CCRA 1KFZA 1TXQA 1M3BA 4BY6B 2E70A 5LL6S 4N4IA 2BUDA 5FRMA 4ANJA 1I07A 1D0ZA 3AT1B 4M7DB 3OS5A 1WHLA 3J7AF 1HSQA 4PFPA 1YN8A 3P8DA 3WVDB 2JMAA 2YUNA 3H0HA 2AK5A 3L2WA 3J80E 1UGSB 4M7DC 3CD6Q 3CMET 3UA6A 4OGEA 4LUEA 4C0ZA 4Z88A 2ZAEA 2QK0A 2BE7D 1MMDA 1VQPT 1NPPA 2X4WA 4C5EA 1Z9QA 5D6YA 1QVGS 1UFFA 4M77B 1IRXA 5IH2A 3A8OB 3CPWP 2NUTA 1YWPA 3S3NA 1JQQA 1I1JA 4LDWA 3OA6A 2LVMA 5EG2A 4BI4A 3X25B 1NBEB 1VOMA 4MZPA 3J81E 2QQ9A 2ZGWA 2EW3A 3OYAA 3OS1A 1SSHA 2KRSA 4A53A 3ER0A 4XQ3A 4A4FA 2RA2A 2Y4YA 4L59A 1VQMT 4M75E 6AT1B 2DZCA 2VVKA 2R57A 2QDYB 3PVQA 4X34A 1YHQT 2HEQA 4C5IA 5CR2A 3JCMe 4XTYA 4PJOE 2RMOA 3KUFA 1WPYA 1SHFA 1WQ7A 5L8RE 2OTLQ 2PVOB 3SD4A 3R6NA 2EQKA 1UUEA 4CC3A 3L2UA 1XQHA 3G1JA 2MI6A 5LJ3f 2LP5A 1VYVA 1VYUA 2D8HA 2FO0A 1PC0A 2RF0A 2DYIA 2ZPBB 3O8VA 3EH2A 3HPWA 1TS9A 1S72Q 1UTIA 2DVEA 5FU6C 3CMAA 1JJ2S 3A8GB 1VQ5T 1X6BA 5KYUB 5GAMd 1NG2A 1CKBA 1WYXA 2RN8A 4BE0A 3A5ZB 4II1A 2OTLA 1LNXA 5KE3A 4RTYA 4WTOB 2JVVA 1YJNQ 1YJNT 2VC8A 1WXUA 3JB9G 1BI2A 3CCLT 1TUGB 2KXDA 4PJOG 1B7TA 4BI8B 2A3LA 4OB2B 1X27A 3BDUA 3OSSC 3V8KA 4F04B 2DERA 4KGZB 4FSSA 2LQKA 3JB9H 2DTOA 4PFOA 2M16A 1K8AU 2KSSA 4NL3A 5GAMf 2VXEA 2PVDB 4PFZA 4C5HA 4HA8A 4M7AE 2MMPA 4E7LA 3VYGA 2WSCE 4PLIA 4E7IA 3HRTA 4DQ2A 1MV3A 4IIMA 3CCUT 1K8AR 5CCAA 3H8ZA 3QJ6A 4Y91A 2AKLA 2FZGB 4BDYA 2JTFA 1VUBA 2JNGA 2KAFA 5GAN7 1WFWA 1VQ8Q 4RCCA 1M2VA 3ZEHA 2DPPB 1OI1A 4EMHA 3DB4A 1D1BA 1TH7A 1HYOA 2XK0A 1X2KA 3FLGA 3VU3C 4OGCA 3ZFJA 1VQ4Q 5GJWB 2ZCFB 4FT2A 2CZ0B 2BE9B 4A63B 2EBPA 3JCMW 1BCOA 3G4ST 5GANd 2CUDA 3E9GA 4JRPA 3CMEQ 4FW2A 3ULRB 1M8VA 3X28B 1VQLA 2PU9B 3V7CA 5GAN6 1M90R 2DILA 3VS2A 1V76A 4GLKA 3CXCA 3M0PA 3UF4A 3TEEA 2KXCA 1NPRA 3IQLA 4M75B 2DETA 5FROA 2E10A 2HQXA 2ENMA 4AG2C 3N5BB 2V8JA 2YDLA 3VUBA 2EQJA 1X75C 2YHTA 3X26B 2OX7A 5HK3A 2I2LA 4J9GA 1FMWA 2LX7A 1WHKA 1WZOA 2F1LA 3OMGA 2CP6A 2Z0WA 1I8FA 3CMAQ 3P8BB 2DBKA 5AYFA 1GL5A 1VQPA 1AWJA 1M1KU 1M30A 2COZA 2RJFA 2RH2A 4C8QC 3I5SA 3JCMX 3CCLQ 1NEBA 5A0DA 3QUIA 2XICA 4HVUA 2CGHA 4C8QB 2FPEA 3REBB 1D3BA 4N0AA 2WSFE 4J6YA 4QVZA 5GANe 4XK8E 3NHNA 2L8DA 4QVDA 1MV0B 4UC4A 2KBTA 2FHDA 2YUQA 5FW9A 3M9QA 3RUXA 1UHFA 1PKSA 2HBPA 1QQJA 2FZKB 4KT0E 1G2BA 3OW2S 5GAN3 3PIOA 2HSEB 3HTRA 4HVVA 4F7UA 5GMKi 3RERA 2A0FB 1VQMQ 2DK3A 1YNZA 3HRSA 2XDPA 3U23A 1KQSP 2KY9A 2ROTA 2LCSA 2GNCA 2K7AA 4FM4B 5CQYA 2AKKA 2LQWA 4J9CA 4RTXA 1G5VA 2GCXA 1I81A 1QW1A 2OI3A 3E1SA 4CRIA 2CZ6B 1KHIA 1C0MA 4IUPA 1K9MR 4HCZA 1N8RU 1KHCA 4BE1A 1U1SA 3NTIA 4AFUC 3OYMA 4M7AD 4HCBA 4ZN1A 2E5QA 5GAOm 1D3BB 1W2BS 1QVPA 5LJ5j 1TTHB 1SG5A 5GMKe 3FJ5A 2DL3A 3G7ZA 3M59A 3VS0A 4C8QD 1D1AA 4KGVB 1I0CA 2CP2A 2RO0A 3EGDB 2EQMA 5LJ3d 1S72T 4OMOA 2K4YA 2XDBA 1T3SA 1G3YA 1UG1A 2OTJT 3L2VA 5KYXA 2MWOA 2KDSA 2P0KA 3H41A 1YJ9Q 2RQRA 5CKDA 2DL7A 1BBZA 3OYKA 1W2BA 4AFQC 4KBMB 3L2ZA 3S3OA 4M7DD 2JT4A 4C8QG 1O9SA 2NUZA 2RQWA 3QKJA 3ME9A 2DTIA 1VQ4A 4L5GA 4DEXA 4JS5A 2I0NA 4BY6C 2GFAA 1UE9A 1U06A 1BIBA 3P8HA 4FSXA 4ZN3A 1BK2A 3UA7A 2YWWA 5DM7R 1YITA 3OB9A 3CC7Q 2ECZA 3VS3A 5KYWB 3X20B 2HL3A 4LDUA 1QLYA 1VQ6A 1NJIR 2F2WA 2HAXA 3CCMT 2ROLA 2H3JA 5HKCA 2WSEE 2KQWA 4O6JA 5LJ3e 1BCMA 2EYXA 2O9SA 2K57A 4EMKC 5IN1A 7AT1B 3MP6A 5CK9A 1GCQA 1W4SA 5GAN5 4ME7A 1ZBXA 1YCYA 1M2VB 3E19A 1ZBJA 4IKFA 1EX4A 1OZ2A 5CVIA 3LH5A 3A8MB 1Q82U 4CC2A 2P84A 5IXFA 3VS6A 3CCVA 3RDVA 3GP8A 3QWYA 2DZ9A 3VUZA 2LNHB 2DXCA 1ZUUA 3NPFA 1Y96A 2V1RA 4V2SA 5FWCA 4EPCA 1JB0E 3GNFB 1VQOQ 2EYZA 4C0GA 4OB1B 1Q7YC 1YHQA 1SRMA 2O9VA 3JSCA 2CP3A 1RAEB 4ELYC 1OV3A 3INZA 3SWNB 4KRTA 4A4EA 2E65A 3DLLA 2CZ1B 4C92D 2K5FA 4DA4A 2YRDA 4OMLA 1E6GA 3CMEA 3CCST 1K9MC 3QHSA 3FRNA 2C0OA 1I5LA 2DL4A 1PRMC 2YLCA 1TUCA 1WLPB 4LN2A 2Y90A 5GMKh 1OX9A 1UEBA 1D09B 2M51A 2B86A 1K73C 3EFOA 2JW4A 5I11A 2J6KA 2LRQA 3OMCA 2ZPEB 3CXCS 3RR6A 2CP0A 3A8LB 3PGGA 1QVGP 1ZA1B 4KUDK 3TU4K 4L6V5 1VQKT 2VXFA 3EGUA 1M5Q1 4F14A 1YJ9T 3VJPA 4CC7A 4XTVA 3MJXA 3NGPA 3GBQA 2D9TA 4IUQA 1VQ7Q 3OS2A 2FL7A 3HHTB 1VQOT 1M1FA 2M9UA 4MDXA 2DYBA 1KD1U 1OYXA 1V1CA 2DA9A 3EGXA 1OQKA 3V8JA 2EGAA 2P4RA 2A08A 1T3LA 3I55Q 4Z02A 1TOVA 3CBOA 1NYGA 5LJ5e 3LLRA 3CCQT 2QGFB 3EG2A 4LUDA 4IIOA 3KFVA 2E4HA 2LCCA 3QWXX 3VRZA 1KIKA 4FCYA 4RCBA 1K1ZA 4HKEA 1GFCA 1OPKA 2VUBA 1AEYA 1WI7A 4OMNA 4KGXB 4JUVA 1VIFA 4FYWB 3REAB 3JCMQ 2OTJQ 4EIKA 1K0XA 1LJOA 1JRIA 1M3AA 3JB9D 1MNDA 3CCEQ 1EZZB 1TUDA 4IUVA 4J5YA 2RI5A 1AVZC 2CT4A 3OYIA 5FU7B 5GAMj 4M7DG 2NUTB 1UJ0A 2C0IA 2LQ8A 4WCIA 3GLXA
chains in the Genus database with same CATH topology
2HSPA 1NYFA 4J9BA 3O5ZA 2GBQA 1WFWA 1WX6A 2GGRA 2V1QA 2KNBB 4Z8AA 2CH4W 1AD5A 4HCKA 1HD3A 2K2MA 1X2KA 1ZUYA 5EC7A 5GJWB 2D0NA 2SEMA 4J9EA 4A63B 2DL8A 2EBPA 4LNPA 2K3BA 1K76A 1ARKA 1X6GA 2CUDA 2J05A 2LZ6B 2A36A 2EKHA 2F2VA 4JJDA 1GRIA 1WXTA 2A37A 3ULRB 2DL5A 2DRMA 1UHCA 1LCKA 2D1XA 2FPDA 3EG3A 1M3CA 1OOTA 3M0RA 4JZ3A 1GCPA 2EPDA 2DILA 3VS2A 4D8KA 2JXBA 2LJ1A 3M0PA 1RI9A 2H8HA 2AZSA 3UF4A 3SHWA 3PVLA 2KXCA 3IQLA 2FRWA 4HVWA 1IO6A 2JMCA 2W10A 2JS2A 1Z9ZA 2CREA 3PE0A 2ENMA 1W1FA 2VKNA 4AG2C 2J6OA 1AWOA 2E5KA 2ED0A 2YDLA 3CQTA 1AWXA 2KR3A 4J9GA 1G83A 3M0SA 1J3TA 2LX7A 1N5ZA 2DRKA 1E6HA 2KROA 2DE0X 1QWEA 1NLOC 4OMQA 5IHNA 4K11A 2BZXA 4E6RA 3NMZC 4DEYA 2DBKA 1OEBA 1GL5A 2CT3A 4RUGA 2K6DA 1AWJA 1NM7A 2EGEA 1M30A 4ESRA 3I5SA 1CSKA 1UJYA 2EVRA 5I22A 2DLPA 3A98A 3TVTA 1NEBA 1GCQC 1HJDA 4HVUA 3M0QA 2JM9A 2LJ0A 2G6FX 3RBBB 1JU5C 2RQUA 2DBMA 2FPEA 4AFZC 3REBB 4Z89A 2IIMA 4RTUA 1YWOA 2KRMA 2ED1A 2VWFA 1WXBA 2RQVA 3NHNA 3H0IA 1NEGA 4GBQA 2OJ2A 1K9AA 1MV0B 3ZL7C 2BZYA 1PRLC 2L2PA 4D8DA 2KBTA 1XOVA 4ZNXA 2L0AA 2YUQA 5FW9A 2PZ1A 1UHFA 1PKSA 3M0TA 4J9FA 2EQIA 2CH4A 1G2BA 4J9IA 3I35A 2AZVA 2L3PA 4HVVA 2J6FA 1H3HA 4RTWA 1QKWA 1YNZA 3I9QA 2YT6A 1UECA 4JJBA 3U23A 1H92A 4RTVA 2ROTA 2EYYA 2KRNA 2KT8A 2KYMA 2LCSA 5FWBA 2GNCA 1BU1A 2K7AA 5L23A 1B07A 4AFSC 1ZX6A 2AKKA 2FPFA 2LQWA 4J9CA 4RTXA 3VS4A 1EFNA 1VA7A 2X3WD 1T0JA 2OI3A 2FEIA 1OPLA 1CKAA 2YSQA 4LE9A 2LJ3A 2SRCA 3TSWA 3I5RA 4OMMA 3H0FA 2QDLA 2XMFA 4AFUC 1A0NB 1WIEA 2JTEA 2L3QA 1FYNA 2YUOA 3SEMA 1X69A 3UATA 1WA7A 2MOXA 3FJ5A 2DL3A 2YUPA 2RPNA 3VS0A 2DX1A 1I0CA 1NLPC 1M8MA 1U3OA 1W6XA 1Y57A 4GLMA 4OMOA 2DM1A 1T3SA 2MIOA 1UG1A 2ESWA 1JXMA 3M0UA 1SEMA 3H41A 2RQRA 2C0TA 2JS0A 1FMKA 4J9DA 2DL7A 1QCFA 1BBZA 4AFQC 2J06A 2KT1A 2O31A 5ECAA 2KEAA 2D8JA 4X1VA 2JT4A 2HCKA 1SRLA 2NUZA 2RQWA 1Y0MA 2GTOA 3EHQA 1T0HA 1SPKA 1X43A 4DEXA 2OAWA 5IHKA 1YP5A 2O2OA 1UGVA 2I0NA 2F2XA 1UE9A 2GQIA 1U06A 5GJVB 2PNIA 4AG1C 1K0SA 1BK2A 3UA7A 1ZUKA 5IHIA 2DNUA 3VS5A 2K9GA 1KFZA 2ECZA 3VS3A 1M3BA 2DVJA 4M4ZA 1AZEA 2FG0A 1QLYA 2W0ZA 2CSIA 2F2WA 1YCSB 1I07A 3C0CA 1KJWA 1K4US 2ROLA 2GTJA 1JO8A 1HSQA 2HDAA 1YN8A 2EYXA 2JMAA 2YUNA 2O9SA 4JJCA 1S1NA 3EG1A 3H0HA 2AK5A 4QT7A 2J7IA 4J9HA 1GCQA 3UA6A 2BZ8A 1U5SA 4LUEA 4Z88A 2KYBA 1ZBJA 1SHGA 1RUWA 2O88A 1Z9QA 3LH5A 4CC2A 5IXBA 5IXFA 3VS6A 5HCKA 3VRYA 1UFFA 3QWYA 2ABLA 5IH2A 2LNHB 4CC4B 2EGCA 2LQNA 1YWPA 1JQQA 1ZUUA 1I1JA 3NPFA 2V1RA 1GFDA 2LMJA 5FWCA 2RNAA 4JPBW 4F17A 2K79A 2EYZA 2CSQA 1SRMA 2O9VA 2EW3A 4Y92A 2CDTA 2KGTA 1OV3A 2MCNA 1SSHA 4KRTA 2KRSA 1PWTA 1GBQA 1AOJA 3THKA 4OMLA 1E6GA 1PKTA 2DMOA 2C0OA 2VVKA 3PVQA 2HEQA 2DL4A 1MUZA 1PRMC 2CUBA 1TUCA 2NWMA 2RMOA 1WLPB 4LN2A 1B3QA 1SHFA 2M51A 2B86A 2JW4A 3R6NA 1UUEA 1AWWA 4CC3A 2DJQA 4R0KA 5I11A 2J6KA 1RLQC 4RTZA 3RNJA 2LP5A 4HXJA 1VYVA 1WDXA 1VYUA 2D8HA 2HBWA 2FO0A 2A28A 1H8KA 3EGUA 4F14A 4CC7A 2RF0A 3NGPA 2JM8A 3GBQA 4ORZA 3EG0A 1W70A 4F16A 4OMPA 1ZSGA 1UTIA 1TG0A 2M0YA 2RQTA 1X6BA 2DYBA 1ABQA 1QKXA 1V1CA 1NG2A 2DA9A 1CKBA 1JXOA 2RN8A 1WYXA 2EGAA 2P4RA 2A08A 1T3LA 1ABOA 3EHRA 4RTYA 2KE9A 1E7OA 1PNJA 1VYTA 1NYGA 1WXUA 1JEGA 1AZGB 3EG2A 2KXDA 4LUDA 4IIOA 1UDLA 3KFVA 3QWXX 3VS7A 3VS1A 1X27A 3VRZA 1RLPC 2X3XD 4FSSA 1KIKA 2PTKA 1KSWA 1BB9A 4RTTA 1PHTA 3JV3A 1K1ZA 1GFCA 1OPKA 2FRYA 1AEYA 1WI7A 2BTTA 4OMNA 3REAB 2DF6A 4EIKA 1K0XA 1M3AA 1ZLMA 1TUDA 1X2QA 1GBRA 3TSZA 1MV3A 4IIMA 1AVZC 2CT4A 2L3SA 2EYWA 1M27C 1UJ0A 2C0IA 4JZ4A 1QWFA 2AKLA 4WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSP A;  1NYF A;  4J9B A;  3O5Z A;  2GBQ A;  1WFW A;  1WX6 A;  2GGR A;  2V1Q A;  2KNB B;  4Z8A A;  2CH4 W;  1AD5 A;  4HCK A;  1HD3 A;  2K2M A;  1X2K A;  1ZUY A;  5EC7 A;  5GJW B;  2D0N A;  2SEM A;  4J9E A;  4A63 B;  2DL8 A;  2EBP A;  4LNP A;  2K3B A;  1K76 A;  1ARK A;  1X6G A;  2CUD A;  2J05 A;  2LZ6 B;  2A36 A;  2EKH A;  2F2V A;  4JJD A;  1GRI A;  1WXT A;  2A37 A;  3ULR B;  2DL5 A;  2DRM A;  1UHC A;  1LCK A;  2D1X A;  2FPD A;  3EG3 A;  1M3C A;  1OOT A;  3M0R A;  4JZ3 A;  1GCP A;  2EPD A;  2DIL A;  3VS2 A;  4D8K A;  2JXB A;  2LJ1 A;  3M0P A;  1RI9 A;  2H8H A;  2AZS A;  3UF4 A;  3SHW A;  3PVL A;  2KXC A;  3IQL A;  2FRW A;  4HVW A;  1IO6 A;  2JMC A;  2W10 A;  2JS2 A;  1Z9Z A;  2CRE A;  3PE0 A;  2ENM A;  1W1F A;  2VKN A;  4AG2 C;  2J6O A;  1AWO A;  2E5K A;  2ED0 A;  2YDL A;  3CQT A;  1AWX A;  2KR3 A;  4J9G A;  1G83 A;  3M0S A;  1J3T A;  2LX7 A;  1N5Z A;  2DRK A;  1E6H A;  2KRO A;  2DE0 X;  1QWE A;  1NLO C;  4OMQ A;  5IHN A;  4K11 A;  2BZX A;  4E6R A;  3NMZ C;  4DEY A;  2DBK A;  1OEB A;  1GL5 A;  2CT3 A;  4RUG A;  2K6D A;  1AWJ A;  1NM7 A;  2EGE A;  1M30 A;  4ESR A;  3I5S A;  1CSK A;  1UJY A;  2EVR A;  5I22 A;  2DLP A;  3A98 A;  3TVT A;  1NEB A;  1GCQ C;  1HJD A;  4HVU A;  3M0Q A;  2JM9 A;  2LJ0 A;  2G6F X;  3RBB B;  1JU5 C;  2RQU A;  2DBM A;  2FPE A;  4AFZ C;  3REB B;  4Z89 A;  2IIM A;  4RTU A;  1YWO A;  2KRM A;  2ED1 A;  2VWF A;  1WXB A;  2RQV A;  3NHN A;  3H0I A;  1NEG A;  4GBQ A;  2OJ2 A;  1K9A A;  1MV0 B;  3ZL7 C;  2BZY A;  1PRL C;  2L2P A;  4D8D A;  2KBT A;  1XOV A;  4ZNX A;  2L0A A;  2YUQ A;  5FW9 A;  2PZ1 A;  1UHF A;  1PKS A;  3M0T A;  4J9F A;  2EQI A;  2CH4 A;  1G2B A;  4J9I A;  3I35 A;  2AZV A;  2L3P A;  4HVV A;  2J6F A;  1H3H A;  4RTW A;  1QKW A;  1YNZ A;  3I9Q A;  2YT6 A;  1UEC A;  4JJB A;  3U23 A;  1H92 A;  4RTV A;  2ROT A;  2EYY A;  2KRN A;  2KT8 A;  2KYM A;  2LCS A;  5FWB A;  2GNC A;  1BU1 A;  2K7A A;  5L23 A;  1B07 A;  4AFS C;  1ZX6 A;  2AKK A;  2FPF A;  2LQW A;  4J9C A;  4RTX A;  3VS4 A;  1EFN A;  1VA7 A;  2X3W D;  1T0J A;  2OI3 A;  2FEI A;  1OPL A;  1CKA A;  2YSQ A;  4LE9 A;  2LJ3 A;  2SRC A;  3TSW A;  3I5R A;  4OMM A;  3H0F A;  2QDL A;  2XMF A;  4AFU C;  1A0N B;  1WIE A;  2JTE A;  2L3Q A;  1FYN A;  2YUO A;  3SEM A;  1X69 A;  3UAT A;  1WA7 A;  2MOX A;  3FJ5 A;  2DL3 A;  2YUP A;  2RPN A;  3VS0 A;  2DX1 A;  1I0C A;  1NLP C;  1M8M A;  1U3O A;  1W6X A;  1Y57 A;  4GLM A;  4OMO A;  2DM1 A;  1T3S A;  2MIO A;  1UG1 A;  2ESW A;  1JXM A;  3M0U A;  1SEM A;  3H41 A;  2RQR A;  2C0T A;  2JS0 A;  1FMK A;  4J9D A;  2DL7 A;  1QCF A;  1BBZ A;  4AFQ C;  2J06 A;  2KT1 A;  2O31 A;  5ECA A;  2KEA A;  2D8J A;  4X1V A;  2JT4 A;  2HCK A;  1SRL A;  2NUZ A;  2RQW A;  1Y0M A;  2GTO A;  3EHQ A;  1T0H A;  1SPK A;  1X43 A;  4DEX A;  2OAW A;  5IHK A;  1YP5 A;  2O2O A;  1UGV A;  2I0N A;  2F2X A;  1UE9 A;  2GQI A;  1U06 A;  5GJV B;  2PNI A;  4AG1 C;  1K0S A;  1BK2 A;  3UA7 A;  1ZUK A;  5IHI A;  2DNU A;  3VS5 A;  2K9G A;  1KFZ A;  2ECZ A;  3VS3 A;  1M3B A;  2DVJ A;  4M4Z A;  1AZE A;  2FG0 A;  1QLY A;  2W0Z A;  2CSI A;  2F2W A;  1YCS B;  1I07 A;  3C0C A;  1KJW A;  1K4U S;  2ROL A;  2GTJ A;  1JO8 A;  1HSQ A;  2HDA A;  1YN8 A;  2EYX A;  2JMA A;  2YUN A;  2O9S A;  4JJC A;  1S1N A;  3EG1 A;  3H0H A;  2AK5 A;  4QT7 A;  2J7I A;  4J9H A;  1GCQ A;  3UA6 A;  2BZ8 A;  1U5S A;  4LUE A;  4Z88 A;  2KYB A;  1ZBJ A;  1SHG A;  1RUW A;  2O88 A;  1Z9Q A;  3LH5 A;  4CC2 A;  5IXB A;  5IXF A;  3VS6 A;  5HCK A;  3VRY A;  1UFF A;  3QWY A;  2ABL A;  5IH2 A;  2LNH B;  4CC4 B;  2EGC A;  2LQN A;  1YWP A;  1JQQ A;  1ZUU A;  1I1J A;  3NPF A;  2V1R A;  1GFD A;  2LMJ A;  5FWC A;  2RNA A;  4JPB W;  4F17 A;  2K79 A;  2EYZ A;  2CSQ A;  1SRM A;  2O9V A;  2EW3 A;  4Y92 A;  2CDT A;  2KGT A;  1OV3 A;  2MCN A;  1SSH A;  4KRT A;  2KRS A;  1PWT A;  1GBQ A;  1AOJ A;  3THK A;  4OML A;  1E6G A;  1PKT A;  2DMO A;  2C0O A;  2VVK A;  3PVQ A;  2HEQ A;  2DL4 A;  1MUZ A;  1PRM C;  2CUB A;  1TUC A;  2NWM A;  2RMO A;  1WLP B;  4LN2 A;  1B3Q A;  1SHF A;  2M51 A;  2B86 A;  2JW4 A;  3R6N A;  1UUE A;  1AWW A;  4CC3 A;  2DJQ A;  4R0K A;  5I11 A;  2J6K A;  1RLQ C;  4RTZ A;  3RNJ A;  2LP5 A;  4HXJ A;  1VYV A;  1WDX A;  1VYU A;  2D8H A;  2HBW A;  2FO0 A;  2A28 A;  1H8K A;  3EGU A;  4F14 A;  4CC7 A;  2RF0 A;  3NGP A;  2JM8 A;  3GBQ A;  4ORZ A;  3EG0 A;  1W70 A;  4F16 A;  4OMP A;  1ZSG A;  1UTI A;  1TG0 A;  2M0Y A;  2RQT A;  1X6B A;  2DYB A;  1ABQ A;  1QKX A;  1V1C A;  1NG2 A;  2DA9 A;  1CKB A;  1JXO A;  2RN8 A;  1WYX A;  2EGA A;  2P4R A;  2A08 A;  1T3L A;  1ABO A;  3EHR A;  4RTY A;  2KE9 A;  1E7O A;  1PNJ A;  1VYT A;  1NYG A;  1WXU A;  1JEG A;  1AZG B;  3EG2 A;  2KXD A;  4LUD A;  4IIO A;  1UDL A;  3KFV A;  3QWX X;  3VS7 A;  3VS1 A;  1X27 A;  3VRZ A;  1RLP C;  2X3X D;  4FSS A;  1KIK A;  2PTK A;  1KSW A;  1BB9 A;  4RTT A;  1PHT A;  3JV3 A;  1K1Z A;  1GFC A;  1OPK A;  2FRY A;  1AEY A;  1WI7 A;  2BTT A;  4OMN A;  3REA B;  2DF6 A;  4EIK A;  1K0X A;  1M3A A;  1ZLM A;  1TUD A;  1X2Q A;  1GBR A;  3TSZ A;  1MV3 A;  4IIM A;  1AVZ C;  2CT4 A;  2L3S A;  2EYW A;  1M27 C;  1UJ0 A;  2C0I A;  4JZ4 A;  1QWF A;  2AKL A;  4WCI A; 
#chains in the Genus database with same CATH topology
 4F7U G;  3JB9 I;  2DJZ A;  3SB2 A;  2GBQ A;  4M78 A;  3UWN A;  1VQO A;  1R77 A;  2V1Q A;  3RMS A;  2KNB B;  3MP8 A;  1QP2 A;  1HD3 A;  3H9N A;  3CC2 A;  5EC7 A;  2GF7 A;  1QVG A;  3RMQ A;  3OYC A;  4M75 F;  2X35 A;  1SF9 A;  3MP1 A;  4LNP A;  3VYH B;  2K3B A;  5D6X A;  2J05 A;  2A36 A;  2EKH A;  2F2V A;  3QZ5 B;  1YI2 T;  4XAX B;  1M4Z A;  5KCO A;  4RKU E;  2DL5 A;  5KE2 A;  1NJI C;  3TRE A;  1W2B P;  1Q81 R;  2D1X A;  4NOY A;  2FPD A;  1YJW Q;  4DOW A;  1GCP A;  4FT4 A;  4D8K A;  1YHQ Q;  4OB0 B;  4J7I A;  2LJ1 A;  3OYL A;  2AZS A;  3SHW A;  3C12 A;  2FRW A;  4HVW A;  2JMC A;  2EJG A;  3PFS A;  5CQX A;  1Z9Z A;  2J6O A;  2E5K A;  3CQT A;  4A54 A;  8AT1 B;  2KR3 A;  4M77 A;  1MNE A;  1PCX A;  2ZPF B;  2DXU A;  1G83 A;  3CC4 Q;  3M0S A;  4O5V A;  1J3T A;  4NS5 A;  4EMK B;  2DRK A;  1VQL T;  1R0B G;  1JBM A;  1NLO C;  4OMQ A;  4K11 A;  2BZX A;  2F5T X;  2L89 A;  1NZ9 A;  4E6R A;  3JAM E;  1OEB A;  3QSU A;  1K73 U;  1U1T A;  3LX7 A;  2PVG B;  2QQA A;  3QDF A;  3OYG A;  1N8R C;  1KD1 R;  1KQS A;  3CCE T;  5CAI A;  2QTX A;  2P0Q A;  5I22 A;  2EIF A;  2IG0 A;  3A98 A;  3TVT A;  4M77 C;  1N9R A;  5KYN A;  1IZ6 A;  4EMG A;  2JM9 A;  2G6F X;  2RQU A;  2DBM A;  1QCN A;  4AFZ C;  2K5I A;  4Z89 A;  3GIB A;  2KRM A;  4JRK A;  1K73 R;  1ZSZ B;  2DIG A;  3OYD A;  2MWP A;  3SWN C;  3H0I A;  1NEG A;  2OJ2 A;  4AMC A;  2L2P A;  4D8D A;  1XOV A;  1M1G A;  3MHX A;  1LOJ A;  4F7U B;  3G6E A;  3M0T A;  2CH4 A;  3UPU A;  1RI0 A;  5GAO p;  2J6F A;  1AHJ B;  3I9Q A;  3MKD A;  4QQD A;  2R58 A;  2EYY A;  2H3E B;  1WJS A;  1Q95 G;  2FPF A;  3VS4 A;  2E41 A;  1EFN A;  1VA7 A;  2X3W D;  3HKS A;  4KH1 B;  1VQN Q;  2GFU A;  3S6W A;  1OPL A;  1TWB A;  3EGD A;  1CKA A;  4LE9 A;  1D0X A;  2JOY A;  3CC2 Q;  1EIF A;  3CCV T;  1WIE A;  1KG1 A;  1Q81 U;  3CD6 A;  4C5G A;  2L3Q A;  4PJO B;  2YUO A;  3SEM A;  3S3M A;  1Q7Y U;  3E2U A;  4PJO A;  2XG8 D;  4M75 G;  1PD1 A;  2MOX A;  3CCE A;  1QP3 A;  2YUP A;  2RPN A;  4PJO C;  2DXT A;  2CZ7 B;  1W6X A;  5KH6 A;  4B6M A;  2DEQ A;  4QQ6 A;  4ELZ C;  2LT4 A;  3CCR Q;  3OYY A;  2ESW A;  2HZY A;  3CXC P;  4C0D C;  1JXM A;  4F7U E;  1PSE A;  2FB7 A;  4C92 A;  2C0T A;  3VKI A;  4J9D A;  4M78 B;  2X4J A;  3CCM Q;  3DLM A;  5CKH A;  3JB9 J;  5FLX E;  2O31 A;  2KEA A;  3E9F A;  1I5O B;  4C0D B;  2HCK A;  1SRL A;  2ATC B;  4C8Q F;  4MZM A;  3LW5 E;  3HRU A;  3CCU Q;  1X43 A;  2OAW A;  3L2Q A;  5A0G A;  2O01 E;  2DEU A;  3CCS Q;  1G3S A;  2QA4 T;  1VQ8 A;  1G3W A;  2JN0 A;  5GAN 8;  5LJ5 g;  2PNI A;  3QZ9 B;  2XDD A;  4DOV A;  1RAB B;  1BI1 A;  5FU7 C;  4BDZ A;  1B34 B;  3PMI A;  1WHM A;  2DVJ A;  2QG9 B;  4M4Z A;  4C8Q A;  2FG0 A;  2W0Z A;  4M77 F;  1VQ9 T;  1YCS B;  3G4S Q;  3C0C A;  4M7D E;  1JO8 A;  1RAC B;  3GPL A;  1ZHI A;  2R5A A;  1QMC A;  3JCM g;  4JJC A;  3NTH A;  3JCM d;  2ZPI B;  4J8O A;  2QEX Q;  2A7Y A;  2J7I A;  5KCH A;  2JJ9 A;  3EGX B;  2DXB A;  1SHG A;  3CEY A;  1RUW A;  1R0C B;  5IXB A;  2E1H A;  4Y28 E;  3OW2 P;  3A1P A;  1IHV A;  2ABL A;  1IXD A;  1KK7 A;  1WGS A;  5CKB A;  1IHW A;  1XTD A;  4BB7 A;  3MEA A;  2LDM A;  1GFD A;  2BKD N;  4JPB W;  2K79 A;  4KUL A;  5I2M A;  1K8A C;  2QGG A;  3CCM A;  3OYF A;  4DBF A;  1KC8 C;  1H64 1;  4M75 A;  4Y92 A;  2KGT A;  2MCN A;  2RHI A;  1Q86 U;  1V29 B;  2Y4X A;  1WHJ A;  5LJ5 h;  3CPW S;  1PWT A;  1GBQ A;  3QG1 A;  2NUP B;  1ACM B;  2E6Z A;  5CKE A;  4XU0 A;  3QO3 A;  1PKT A;  1VQ7 T;  5D6W A;  1H3Z A;  4ZTJ A;  2QA4 A;  1VQ8 T;  3MPU B;  2CUB A;  2M1H A;  2F5K A;  4PK4 A;  1B3Q A;  2E12 A;  1VQK A;  2QQR A;  1WHH A;  4PJO F;  1VQN A;  4R0K A;  1O75 A;  5CIU A;  1RLQ C;  2CP5 A;  3SWN A;  1QCO A;  3RNJ A;  3WVE B;  4HXJ A;  4N0A C;  3FJP A;  1WDX A;  2K3Y A;  1MMN A;  2HBW A;  1UGR B;  2YRC A;  1H8K A;  1IB8 A;  3V7S A;  1BYM A;  4NL2 A;  2DAQ A;  2JM8 A;  4ORZ A;  3EG0 A;  2ZPG B;  4OMP A;  1ZSG A;  4MML A;  1UGP B;  2EAY A;  3URG A;  1QKX A;  3BDL A;  3C4S A;  1ZSZ C;  2LNV A;  1ABO A;  3EHR A;  2KE9 A;  4R55 A;  1WJR A;  4JRQ A;  1VYT A;  3OBY A;  1JEG A;  4BE2 A;  2JZ2 A;  1UDL A;  1OX8 A;  2VV5 A;  4HCC A;  4ATO A;  2PTK A;  1KSW A;  3QDR B;  3SDZ A;  4RTT A;  4IUT A;  3JV3 A;  4PJL A;  1VQP Q;  1YBY A;  5I2S A;  3AHU A;  2QQB A;  1S72 A;  2BTT A;  1VQL Q;  2DF6 A;  4QW2 A;  1N27 A;  2X4Y A;  3I56 A;  4C92 G;  3UDC A;  2NUP A;  1RAF B;  3UT1 A;  2NLU A;  1X2Q A;  2L3S A;  2EYW A;  5HK0 A;  3A8H B;  1M27 C;  3G6E Q;  1KD1 C;  5M9O A;  1QWF A;  3QJY A;  1M2O A;  2HSP A;  4A4G A;  3O5Z A;  1Q86 C;  3M58 A;  5GAN j;  2K5L A;  3BW1 A;  3WXM B;  3DB3 A;  1QVF A;  2GGR A;  3FIF A;  4Z8A A;  5KYX B;  4PKC C;  1AD5 A;  4ZGJ B;  2AHJ B;  1AT1 B;  2K2M A;  1MGQ A;  3QYH B;  5J39 A;  2DFU A;  3CCL A;  1VIE A;  2QXF A;  2KK4 A;  2FZC B;  4J9E A;  2DL8 A;  3PTA A;  5D7U A;  3EFO B;  1K76 A;  1RAI B;  2PUK B;  3PNW C;  1ARK A;  2LZ6 B;  2QI2 A;  3MEV A;  4M78 C;  4JJD A;  2MPX C;  4OMF B;  2WAC A;  2CP7 A;  3LH0 A;  2DRM A;  1UHC A;  3OW2 A;  3EG3 A;  3M56 A;  5I21 A;  4P5N A;  1WNL A;  4JZ3 A;  4N4G A;  1U8R A;  2EPD A;  5IAY A;  4E47 A;  1K9M U;  3CCU A;  4M77 D;  5KYW A;  3V7R A;  1M1K R;  1TSF A;  3JB9 F;  1RI9 A;  1B34 A;  3PVL A;  4WF2 A;  2JTM A;  1SKU B;  1F1B B;  1IO6 A;  4ZGE B;  2FVU A;  3PE0 A;  1XNI A;  2QA4 Q;  4PJJ A;  2IPO B;  3JRZ A;  1R8O B;  1LPL A;  1AWX A;  2L3R A;  5DY9 A;  3PT9 A;  2D6F A;  4MMK A;  1YI2 A;  1M90 C;  3KBG A;  2DD5 A;  1N5Z A;  4JJN K;  2XI9 A;  5GAN 4;  4LD9 K;  3MEW A;  2DE0 X;  1MHN A;  2E3H A;  1IGU A;  4C8Q E;  5HY6 A;  3NMZ C;  4DEY A;  5GMK m;  3V8L A;  2K6D A;  4J83 A;  3JCM c;  4ESR A;  5KYY B;  2ZZD A;  2EVR A;  4JLI A;  1YIJ A;  2LX9 A;  4F7U F;  1GCQ C;  1HJD A;  1RAD B;  3M0Q A;  1NJI U;  1JU5 C;  4XU2 A;  4XU3 A;  1I4K 1;  4M75 D;  4B9X A;  5FU6 B;  4RTU A;  5C0M A;  2XD0 A;  3D7S B;  5DLO A;  1KQ2 A;  1WXB A;  1YIJ Q;  3M54 A;  1KC8 U;  1K9A A;  4LXC A;  4PJO D;  3ZL7 C;  1KQS S;  2BZY A;  1FXX A;  1YJ9 A;  4LDY A;  3BY7 A;  1VQ9 A;  1SSF A;  3DKM A;  5A2Q E;  2EQI A;  4J6W A;  3G71 A;  2AZV A;  3ASK A;  2NYS A;  3MO8 A;  1H3H A;  4RTW A;  2YT6 A;  3CBP A;  2VB6 A;  1UEC A;  3M55 A;  4JJB A;  4RTV A;  2P4T A;  3L1A A;  2KYM A;  3HFN A;  1Q7Y R;  2C06 A;  1BU1 A;  3CMA T;  2QYZ A;  5L23 A;  1ZSZ A;  4C0F A;  3CD6 T;  5GAO n;  1NE8 A;  2HKQ B;  1IGQ A;  4M7A B;  2FEI A;  5GAN g;  3CCQ A;  4CI0 C;  2R5M A;  2LJ3 A;  4M7A G;  3TSW A;  1BI3 A;  1YJN A;  2QDL A;  2XMF A;  4QKU A;  4MDW A;  2RJD A;  2JTE A;  2QAS A;  1FYN A;  1X69 A;  3HL8 A;  3EG9 B;  3OSV A;  1YIT T;  5GMK j;  4C92 E;  3JCM J;  3UAT A;  3OYB A;  3G6E T;  3FB9 A;  3HFO A;  1FWZ A;  4M78 D;  1RL2 A;  2E6N A;  1N8R R;  4MZT A;  3EFS A;  3NFC A;  1M8M A;  4FYX B;  3M4Y A;  3EH1 A;  1Y57 A;  2V26 A;  2MIO A;  3CC7 A;  1JJ2 A;  1MMA A;  4PLL A;  1OZ3 A;  3F70 A;  3OQ5 A;  3M0U A;  1SEM A;  1VQ7 A;  3L42 A;  3OYJ A;  1VQ6 Q;  1YJW T;  2XKO C;  1QCF A;  2PUO B;  4QQG A;  2COW A;  3CCV Q;  2J06 A;  2KT1 A;  4XU1 A;  2COY A;  5ECA A;  4A4K A;  2MF2 A;  4OB3 B;  2D8J A;  1D1C A;  4X1V A;  3RKY A;  3EAE A;  1KQ1 A;  3QBY A;  2XU8 A;  3MCA B;  1KC8 R;  2EWN A;  1Y0M A;  3R6O A;  2GTO A;  3JCM b;  1JJ2 P;  3OYH A;  2RD1 A;  1YP5 A;  5DLQ E;  1UGV A;  4M78 G;  2M0O A;  2G3R A;  3CC4 T;  4M7A F;  2GQI A;  1IRE B;  1K0S A;  1GXI E;  5AT1 B;  5IHI A;  3VS5 A;  4DBQ A;  2K9G A;  4HT8 A;  1RAG B;  2CS7 A;  1Q82 C;  3CCJ Q;  1AZE A;  2CSI A;  2D0Q B;  1Q81 C;  1KJW A;  1K4U S;  2GTJ A;  1C6V X;  1OU9 A;  2OAU A;  2HDA A;  3RES A;  4JDS A;  2E3I A;  1S1N A;  3EG1 A;  3LWI A;  4BAC A;  4QT7 A;  4LDV A;  2HD0 A;  4J9H A;  2IVW A;  2BZ8 A;  1U5S A;  2KYB A;  4FIB A;  1VQ9 Q;  2O88 A;  3BE3 A;  1VQ4 T;  2RK1 A;  2ZPH B;  5HCK A;  3VRY A;  4E7S A;  2EYQ A;  4CC4 B;  2CKK A;  2EGC A;  2LQN A;  2VGM A;  3X24 B;  2VYT A;  2QEX T;  2LMJ A;  2RNA A;  4B9W A;  1YJW A;  4F17 A;  3I55 T;  2CSQ A;  5J3B A;  5LJ5 f;  5A0L A;  2CDT A;  2MAM A;  1QVF S;  4RG2 A;  3CCJ A;  1OU8 A;  4XTW A;  4PJM A;  1AOJ A;  2BIV A;  3CBM A;  3THK A;  2EFI A;  4IUU A;  2DMO A;  1VQ5 A;  2HQE A;  1MUZ A;  1OUL A;  2NWM A;  2QAZ A;  4E7Z A;  2EQU A;  3RKW A;  3HP9 A;  2KMT A;  1YI2 Q;  1X01 A;  2VGN A;  1AWW A;  2DJQ A;  2V8K A;  3H6Z A;  4C92 C;  2LT1 A;  1VQ5 Q;  3LGL A;  4RTZ A;  3BFM A;  2GQV A;  4A4H A;  1WJQ A;  1UGQ B;  2K3X A;  3OYE A;  1N6A A;  2A28 A;  2LC4 A;  1Q86 R;  2YLB A;  5KYU A;  3CCR T;  2EJ9 A;  1W70 A;  4F16 A;  3FC3 A;  1M9S A;  1HXD A;  1TG0 A;  2M0Y A;  3QII A;  3C94 A;  4LD6 A;  4JLG A;  3TCJ A;  2RQT A;  1ABQ A;  3LYI A;  1UB4 A;  3PMT A;  3MEU A;  4JRI A;  1JXO A;  3NTK A;  4M7D F;  4M77 E;  5LJ3 j;  1E7O A;  1PNJ A;  4E7H A;  4ZTF A;  1VQN T;  3QXE B;  2KI7 A;  2KVQ G;  1AZG B;  1PG5 B;  4KH0 B;  3CCQ Q;  3I55 A;  3JCM P;  3VS7 A;  3EFR A;  3VS1 A;  1RLP C;  1XJW B;  2X3X D;  4IUR A;  3QYG B;  4OP0 A;  5LJ3 g;  3T9N A;  3CCJ T;  4BUG A;  1BB9 A;  4LDX A;  1PHT A;  5LJ3 h;  2FRY A;  2HKN A;  2MK5 A;  8ATC B;  3GF5 A;  4KUI A;  3OYN A;  2B8A A;  4M7A C;  1ZLM A;  1PM3 A;  5GAM e;  1GBR A;  3TSZ A;  4DBR A;  5GAO l;  2LCL A;  3M4G A;  5CO7 A;  4JZ4 A;  4FYV B;  4VUB A;  4BD3 A;  2RJE A;  5CKF A;  4PNO A;  1NYF A;  4J9B A;  4FU6 A;  2RHZ A;  1WX6 A;  1Y71 A;  2DKG A;  1C1A A;  2CH4 W;  4AT1 B;  4HCK A;  3GNG A;  2X4X A;  5GAN 2;  1X6O A;  1ZUY A;  2RHU A;  2L5Q A;  2D0N A;  2SEM A;  2AT1 B;  4D6W A;  2FYK A;  1FX7 A;  1X6G A;  2QTV A;  4M7D A;  3G71 T;  3PIP A;  1GRI A;  1WXT A;  2A37 A;  3EG9 A;  1Y07 A;  5IT9 E;  1LCK A;  1VQ6 T;  2DIQ A;  1Q82 R;  1M3C A;  1OOT A;  4X9C A;  3M0R A;  4XTX A;  1N9S A;  3G4S A;  4C92 F;  1VQK Q;  2O4X B;  5GAN h;  4XTU A;  5J26 A;  2JXB A;  5GAN f;  3M5A A;  2H8H A;  4EDU A;  4TVR A;  1PD0 A;  2VAS A;  2W10 A;  2JS2 A;  4M78 E;  2DO3 A;  5GAO q;  2CRE A;  1W1F A;  2VKN A;  1M90 U;  1Y96 B;  1AWO A;  2ED0 A;  2DTH A;  4M75 C;  3I56 Q;  1FMV A;  2CYZ B;  1BIA A;  3JCM f;  4FYY B;  1RAA B;  2F69 A;  2RJC A;  1E6H A;  2AIR B;  2KRO A;  3OS0 A;  5GMK l;  1YIJ T;  1QWE A;  4RG8 A;  5IHN A;  3CC7 T;  3LWH A;  1G8X A;  2EKO A;  2CT3 A;  4RUG A;  2MYS A;  1MMG A;  1NM7 A;  1YIT Q;  1YFN A;  2EGE A;  4YTL A;  2RI3 A;  3CPF A;  1RAH B;  2YXY A;  4JS4 A;  5LJ5 d;  1CSK A;  1G3T A;  1UJY A;  2DLP A;  2X51 A;  3CCS A;  4J6X A;  1ZQ1 A;  3VV0 A;  2LJ0 A;  1BKB A;  5C6S A;  4N4H A;  1LVK A;  3RBB B;  2QEX A;  2RHX A;  3SFM A;  2V8I A;  2IIM A;  1YWO A;  3CC4 A;  3HSB A;  2ED1 A;  3FDR A;  2VWF A;  2RQV A;  5GAM h;  4GBQ A;  4OVA A;  2OTL T;  3JCM V;  1PRL C;  4E7J A;  4ZNX A;  2L0A A;  2M02 A;  2LTO A;  2PZ1 A;  4J9F A;  4J9I A;  2RI2 A;  3I35 A;  2E64 A;  2K2V A;  2HNI A;  2L3P A;  3CPW A;  3MET A;  2YRV A;  3C95 A;  1QKW A;  4OF1 A;  1H92 A;  2OTJ A;  4M77 G;  4PJN A;  3OBW A;  2KRN A;  2KT8 A;  2PQW A;  2RK2 A;  5FWB A;  2RM4 A;  3QPH A;  4C92 B;  1B07 A;  3Q1J A;  4AFS C;  1ZX6 A;  2DD4 A;  5FRN A;  4RMO A;  1T0J A;  1Y7X A;  2RHY A;  4GY5 A;  1PSF A;  1TU0 B;  4J7F A;  2O4X A;  2HL5 C;  4PL6 A;  1BI0 A;  2YSQ A;  4X9D A;  2SRC A;  4QVC A;  1M1K C;  3I5R A;  4OMM A;  3H0F A;  1A0N B;  2HQH A;  3L2R A;  4R56 A;  1WA7 A;  3JCM h;  4M78 F;  3RKX A;  3I56 T;  2X9H A;  2RB6 A;  3RIR A;  3FEO A;  2DX1 A;  1NLP C;  5KYY A;  1U3O A;  2QQS A;  3M53 A;  4FL6 A;  4GLM A;  2EJF A;  4M7A A;  2DM1 A;  4EMK A;  5GAM g;  4FW1 A;  2P0P A;  4BI3 A;  1HK9 A;  2HMA A;  4HT9 A;  2JS0 A;  1FMK A;  3ZBD A;  3OY9 A;  2XID A;  3KXT A;  3TQ7 P;  2JUF A;  1P92 A;  1WHG A;  4Q5W A;  4E2F B;  4XTZ A;  3EHQ A;  3M57 A;  3LGF A;  1ZA2 B;  1T0H A;  1SPK A;  4ZGD B;  4E7K A;  5IHK A;  2O2O A;  9ATC B;  1DJ7 B;  4DBH A;  3GOX A;  2F2X A;  5GJV B;  3G71 Q;  4AG1 C;  1D0Y A;  5GAO r;  3CC2 T;  1ZUK A;  2DNU A;  2XHC A;  1VQM A;  1QVF P;  1WQW A;  3CCR A;  1KFZ A;  1TXQ A;  1M3B A;  4BY6 B;  2E70 A;  5LL6 S;  4N4I A;  2BUD A;  5FRM A;  4ANJ A;  1I07 A;  1D0Z A;  3AT1 B;  4M7D B;  3OS5 A;  1WHL A;  3J7A F;  1HSQ A;  4PFP A;  1YN8 A;  3P8D A;  3WVD B;  2JMA A;  2YUN A;  3H0H A;  2AK5 A;  3L2W A;  3J80 E;  1UGS B;  4M7D C;  3CD6 Q;  3CME T;  3UA6 A;  4OGE A;  4LUE A;  4C0Z A;  4Z88 A;  2ZAE A;  2QK0 A;  2BE7 D;  1MMD A;  1VQP T;  1NPP A;  2X4W A;  4C5E A;  1Z9Q A;  5D6Y A;  1QVG S;  1UFF A;  4M77 B;  1IRX A;  5IH2 A;  3A8O B;  3CPW P;  2NUT A;  1YWP A;  3S3N A;  1JQQ A;  1I1J A;  4LDW A;  3OA6 A;  2LVM A;  5EG2 A;  4BI4 A;  3X25 B;  1NBE B;  1VOM A;  4MZP A;  3J81 E;  2QQ9 A;  2ZGW A;  2EW3 A;  3OYA A;  3OS1 A;  1SSH A;  2KRS A;  4A53 A;  3ER0 A;  4XQ3 A;  4A4F A;  2RA2 A;  2Y4Y A;  4L59 A;  1VQM T;  4M75 E;  6AT1 B;  2DZC A;  2VVK A;  2R57 A;  2QDY B;  3PVQ A;  4X34 A;  1YHQ T;  2HEQ A;  4C5I A;  5CR2 A;  3JCM e;  4XTY A;  4PJO E;  2RMO A;  3KUF A;  1WPY A;  1SHF A;  1WQ7 A;  5L8R E;  2OTL Q;  2PVO B;  3SD4 A;  3R6N A;  2EQK A;  1UUE A;  4CC3 A;  3L2U A;  1XQH A;  3G1J A;  2MI6 A;  5LJ3 f;  2LP5 A;  1VYV A;  1VYU A;  2D8H A;  2FO0 A;  1PC0 A;  2RF0 A;  2DYI A;  2ZPB B;  3O8V A;  3EH2 A;  3HPW A;  1TS9 A;  1S72 Q;  1UTI A;  2DVE A;  5FU6 C;  3CMA A;  1JJ2 S;  3A8G B;  1VQ5 T;  1X6B A;  5KYU B;  5GAM d;  1NG2 A;  1CKB A;  1WYX A;  2RN8 A;  4BE0 A;  3A5Z B;  4II1 A;  2OTL A;  1LNX A;  5KE3 A;  4RTY A;  4WTO B;  2JVV A;  1YJN Q;  1YJN T;  2VC8 A;  1WXU A;  3JB9 G;  1BI2 A;  3CCL T;  1TUG B;  2KXD A;  4PJO G;  1B7T A;  4BI8 B;  2A3L A;  4OB2 B;  1X27 A;  3BDU A;  3OSS C;  3V8K A;  4F04 B;  2DER A;  4KGZ B;  4FSS A;  2LQK A;  3JB9 H;  2DTO A;  4PFO A;  2M16 A;  1K8A U;  2KSS A;  4NL3 A;  5GAM f;  2VXE A;  2PVD B;  4PFZ A;  4C5H A;  4HA8 A;  4M7A E;  2MMP A;  4E7L A;  3VYG A;  2WSC E;  4PLI A;  4E7I A;  3HRT A;  4DQ2 A;  1MV3 A;  4IIM A;  3CCU T;  1K8A R;  5CCA A;  3H8Z A;  3QJ6 A;  4Y91 A;  2AKL A;  2FZG B;  4BDY A;  2JTF A;  1VUB A;  2JNG A;  2KAF A;  5GAN 7;  1WFW A;  1VQ8 Q;  4RCC A;  1M2V A;  3ZEH A;  2DPP B;  1OI1 A;  4EMH A;  3DB4 A;  1D1B A;  1TH7 A;  1HYO A;  2XK0 A;  1X2K A;  3FLG A;  3VU3 C;  4OGC A;  3ZFJ A;  1VQ4 Q;  5GJW B;  2ZCF B;  4FT2 A;  2CZ0 B;  2BE9 B;  4A63 B;  2EBP A;  3JCM W;  1BCO A;  3G4S T;  5GAN d;  2CUD A;  3E9G A;  4JRP A;  3CME Q;  4FW2 A;  3ULR B;  1M8V A;  3X28 B;  1VQL A;  2PU9 B;  3V7C A;  5GAN 6;  1M90 R;  2DIL A;  3VS2 A;  1V76 A;  4GLK A;  3CXC A;  3M0P A;  3UF4 A;  3TEE A;  2KXC A;  1NPR A;  3IQL A;  4M75 B;  2DET A;  5FRO A;  2E10 A;  2HQX A;  2ENM A;  4AG2 C;  3N5B B;  2V8J A;  2YDL A;  3VUB A;  2EQJ A;  1X75 C;  2YHT A;  3X26 B;  2OX7 A;  5HK3 A;  2I2L A;  4J9G A;  1FMW A;  2LX7 A;  1WHK A;  1WZO A;  2F1L A;  3OMG A;  2CP6 A;  2Z0W A;  1I8F A;  3CMA Q;  3P8B B;  2DBK A;  5AYF A;  1GL5 A;  1VQP A;  1AWJ A;  1M1K U;  1M30 A;  2COZ A;  2RJF A;  2RH2 A;  4C8Q C;  3I5S A;  3JCM X;  3CCL Q;  1NEB A;  5A0D A;  3QUI A;  2XIC A;  4HVU A;  2CGH A;  4C8Q B;  2FPE A;  3REB B;  1D3B A;  4N0A A;  2WSF E;  4J6Y A;  4QVZ A;  5GAN e;  4XK8 E;  3NHN A;  2L8D A;  4QVD A;  1MV0 B;  4UC4 A;  2KBT A;  2FHD A;  2YUQ A;  5FW9 A;  3M9Q A;  3RUX A;  1UHF A;  1PKS A;  2HBP A;  1QQJ A;  2FZK B;  4KT0 E;  1G2B A;  3OW2 S;  5GAN 3;  3PIO A;  2HSE B;  3HTR A;  4HVV A;  4F7U A;  5GMK i;  3RER A;  2A0F B;  1VQM Q;  2DK3 A;  1YNZ A;  3HRS A;  2XDP A;  3U23 A;  1KQS P;  2KY9 A;  2ROT A;  2LCS A;  2GNC A;  2K7A A;  4FM4 B;  5CQY A;  2AKK A;  2LQW A;  4J9C A;  4RTX A;  1G5V A;  2GCX A;  1I81 A;  1QW1 A;  2OI3 A;  3E1S A;  4CRI A;  2CZ6 B;  1KHI A;  1C0M A;  4IUP A;  1K9M R;  4HCZ A;  1N8R U;  1KHC A;  4BE1 A;  1U1S A;  3NTI A;  4AFU C;  3OYM A;  4M7A D;  4HCB A;  4ZN1 A;  2E5Q A;  5GAO m;  1D3B B;  1W2B S;  1QVP A;  5LJ5 j;  1TTH B;  1SG5 A;  5GMK e;  3FJ5 A;  2DL3 A;  3G7Z A;  3M59 A;  3VS0 A;  4C8Q D;  1D1A A;  4KGV B;  1I0C A;  2CP2 A;  2RO0 A;  3EGD B;  2EQM A;  5LJ3 d;  1S72 T;  4OMO A;  2K4Y A;  2XDB A;  1T3S A;  1G3Y A;  1UG1 A;  2OTJ T;  3L2V A;  5KYX A;  2MWO A;  2KDS A;  2P0K A;  3H41 A;  1YJ9 Q;  2RQR A;  5CKD A;  2DL7 A;  1BBZ A;  3OYK A;  1W2B A;  4AFQ C;  4KBM B;  3L2Z A;  3S3O A;  4M7D D;  2JT4 A;  4C8Q G;  1O9S A;  2NUZ A;  2RQW A;  3QKJ A;  3ME9 A;  2DTI A;  1VQ4 A;  4L5G A;  4DEX A;  4JS5 A;  2I0N A;  4BY6 C;  2GFA A;  1UE9 A;  1U06 A;  1BIB A;  3P8H A;  4FSX A;  4ZN3 A;  1BK2 A;  3UA7 A;  2YWW A;  5DM7 R;  1YIT A;  3OB9 A;  3CC7 Q;  2ECZ A;  3VS3 A;  5KYW B;  3X20 B;  2HL3 A;  4LDU A;  1QLY A;  1VQ6 A;  1NJI R;  2F2W A;  2HAX A;  3CCM T;  2ROL A;  2H3J A;  5HKC A;  2WSE E;  2KQW A;  4O6J A;  5LJ3 e;  1BCM A;  2EYX A;  2O9S A;  2K57 A;  4EMK C;  5IN1 A;  7AT1 B;  3MP6 A;  5CK9 A;  1GCQ A;  1W4S A;  5GAN 5;  4ME7 A;  1ZBX A;  1YCY A;  1M2V B;  3E19 A;  1ZBJ A;  4IKF A;  1EX4 A;  1OZ2 A;  5CVI A;  3LH5 A;  3A8M B;  1Q82 U;  4CC2 A;  2P84 A;  5IXF A;  3VS6 A;  3CCV A;  3RDV A;  3GP8 A;  3QWY A;  2DZ9 A;  3VUZ A;  2LNH B;  2DXC A;  1ZUU A;  3NPF A;  1Y96 A;  2V1R A;  4V2S A;  5FWC A;  4EPC A;  1JB0 E;  3GNF B;  1VQO Q;  2EYZ A;  4C0G A;  4OB1 B;  1Q7Y C;  1YHQ A;  1SRM A;  2O9V A;  3JSC A;  2CP3 A;  1RAE B;  4ELY C;  1OV3 A;  3INZ A;  3SWN B;  4KRT A;  4A4E A;  2E65 A;  3DLL A;  2CZ1 B;  4C92 D;  2K5F A;  4DA4 A;  2YRD A;  4OML A;  1E6G A;  3CME A;  3CCS T;  1K9M C;  3QHS A;  3FRN A;  2C0O A;  1I5L A;  2DL4 A;  1PRM C;  2YLC A;  1TUC A;  1WLP B;  4LN2 A;  2Y90 A;  5GMK h;  1OX9 A;  1UEB A;  1D09 B;  2M51 A;  2B86 A;  1K73 C;  3EFO A;  2JW4 A;  5I11 A;  2J6K A;  2LRQ A;  3OMC A;  2ZPE B;  3CXC S;  3RR6 A;  2CP0 A;  3A8L B;  3PGG A;  1QVG P;  1ZA1 B;  4KUD K;  3TU4 K;  4L6V 5;  1VQK T;  2VXF A;  3EGU A;  1M5Q 1;  4F14 A;  1YJ9 T;  3VJP A;  4CC7 A;  4XTV A;  3MJX A;  3NGP A;  3GBQ A;  2D9T A;  4IUQ A;  1VQ7 Q;  3OS2 A;  2FL7 A;  3HHT B;  1VQO T;  1M1F A;  2M9U A;  4MDX A;  2DYB A;  1KD1 U;  1OYX A;  1V1C A;  2DA9 A;  3EGX A;  1OQK A;  3V8J A;  2EGA A;  2P4R A;  2A08 A;  1T3L A;  3I55 Q;  4Z02 A;  1TOV A;  3CBO A;  1NYG A;  5LJ5 e;  3LLR A;  3CCQ T;  2QGF B;  3EG2 A;  4LUD A;  4IIO A;  3KFV A;  2E4H A;  2LCC A;  3QWX X;  3VRZ A;  1KIK A;  4FCY A;  4RCB A;  1K1Z A;  4HKE A;  1GFC A;  1OPK A;  2VUB A;  1AEY A;  1WI7 A;  4OMN A;  4KGX B;  4JUV A;  1VIF A;  4FYW B;  3REA B;  3JCM Q;  2OTJ Q;  4EIK A;  1K0X A;  1LJO A;  1JRI A;  1M3A A;  3JB9 D;  1MND A;  3CCE Q;  1EZZ B;  1TUD A;  4IUV A;  4J5Y A;  2RI5 A;  1AVZ C;  2CT4 A;  3OYI A;  5FU7 B;  5GAM j;  4M7D G;  2NUT B;  1UJ0 A;  2C0I A;  2LQ8 A;  4WCI A;  3GLX A; 
#chains in the Genus database with same CATH homology
 2HSP A;  1NYF A;  4J9B A;  3O5Z A;  2GBQ A;  1WFW A;  1WX6 A;  2GGR A;  2V1Q A;  2KNB B;  4Z8A A;  2CH4 W;  1AD5 A;  4HCK A;  1HD3 A;  2K2M A;  1X2K A;  1ZUY A;  5EC7 A;  5GJW B;  2D0N A;  2SEM A;  4J9E A;  4A63 B;  2DL8 A;  2EBP A;  4LNP A;  2K3B A;  1K76 A;  1ARK A;  1X6G A;  2CUD A;  2J05 A;  2LZ6 B;  2A36 A;  2EKH A;  2F2V A;  4JJD A;  1GRI A;  1WXT A;  2A37 A;  3ULR B;  2DL5 A;  2DRM A;  1UHC A;  1LCK A;  2D1X A;  2FPD A;  3EG3 A;  1M3C A;  1OOT A;  3M0R A;  4JZ3 A;  1GCP A;  2EPD A;  2DIL A;  3VS2 A;  4D8K A;  2JXB A;  2LJ1 A;  3M0P A;  1RI9 A;  2H8H A;  2AZS A;  3UF4 A;  3SHW A;  3PVL A;  2KXC A;  3IQL A;  2FRW A;  4HVW A;  1IO6 A;  2JMC A;  2W10 A;  2JS2 A;  1Z9Z A;  2CRE A;  3PE0 A;  2ENM A;  1W1F A;  2VKN A;  4AG2 C;  2J6O A;  1AWO A;  2E5K A;  2ED0 A;  2YDL A;  3CQT A;  1AWX A;  2KR3 A;  4J9G A;  1G83 A;  3M0S A;  1J3T A;  2LX7 A;  1N5Z A;  2DRK A;  1E6H A;  2KRO A;  2DE0 X;  1QWE A;  1NLO C;  4OMQ A;  5IHN A;  4K11 A;  2BZX A;  4E6R A;  3NMZ C;  4DEY A;  2DBK A;  1OEB A;  1GL5 A;  2CT3 A;  4RUG A;  2K6D A;  1AWJ A;  1NM7 A;  2EGE A;  1M30 A;  4ESR A;  3I5S A;  1CSK A;  1UJY A;  2EVR A;  5I22 A;  2DLP A;  3A98 A;  3TVT A;  1NEB A;  1GCQ C;  1HJD A;  4HVU A;  3M0Q A;  2JM9 A;  2LJ0 A;  2G6F X;  3RBB B;  1JU5 C;  2RQU A;  2DBM A;  2FPE A;  4AFZ C;  3REB B;  4Z89 A;  2IIM A;  4RTU A;  1YWO A;  2KRM A;  2ED1 A;  2VWF A;  1WXB A;  2RQV A;  3NHN A;  3H0I A;  1NEG A;  4GBQ A;  2OJ2 A;  1K9A A;  1MV0 B;  3ZL7 C;  2BZY A;  1PRL C;  2L2P A;  4D8D A;  2KBT A;  1XOV A;  4ZNX A;  2L0A A;  2YUQ A;  5FW9 A;  2PZ1 A;  1UHF A;  1PKS A;  3M0T A;  4J9F A;  2EQI A;  2CH4 A;  1G2B A;  4J9I A;  3I35 A;  2AZV A;  2L3P A;  4HVV A;  2J6F A;  1H3H A;  4RTW A;  1QKW A;  1YNZ A;  3I9Q A;  2YT6 A;  1UEC A;  4JJB A;  3U23 A;  1H92 A;  4RTV A;  2ROT A;  2EYY A;  2KRN A;  2KT8 A;  2KYM A;  2LCS A;  5FWB A;  2GNC A;  1BU1 A;  2K7A A;  5L23 A;  1B07 A;  4AFS C;  1ZX6 A;  2AKK A;  2FPF A;  2LQW A;  4J9C A;  4RTX A;  3VS4 A;  1EFN A;  1VA7 A;  2X3W D;  1T0J A;  2OI3 A;  2FEI A;  1OPL A;  1CKA A;  2YSQ A;  4LE9 A;  2LJ3 A;  2SRC A;  3TSW A;  3I5R A;  4OMM A;  3H0F A;  2QDL A;  2XMF A;  4AFU C;  1A0N B;  1WIE A;  2JTE A;  2L3Q A;  1FYN A;  2YUO A;  3SEM A;  1X69 A;  3UAT A;  1WA7 A;  2MOX A;  3FJ5 A;  2DL3 A;  2YUP A;  2RPN A;  3VS0 A;  2DX1 A;  1I0C A;  1NLP C;  1M8M A;  1U3O A;  1W6X A;  1Y57 A;  4GLM A;  4OMO A;  2DM1 A;  1T3S A;  2MIO A;  1UG1 A;  2ESW A;  1JXM A;  3M0U A;  1SEM A;  3H41 A;  2RQR A;  2C0T A;  2JS0 A;  1FMK A;  4J9D A;  2DL7 A;  1QCF A;  1BBZ A;  4AFQ C;  2J06 A;  2KT1 A;  2O31 A;  5ECA A;  2KEA A;  2D8J A;  4X1V A;  2JT4 A;  2HCK A;  1SRL A;  2NUZ A;  2RQW A;  1Y0M A;  2GTO A;  3EHQ A;  1T0H A;  1SPK A;  1X43 A;  4DEX A;  2OAW A;  5IHK A;  1YP5 A;  2O2O A;  1UGV A;  2I0N A;  2F2X A;  1UE9 A;  2GQI A;  1U06 A;  5GJV B;  2PNI A;  4AG1 C;  1K0S A;  1BK2 A;  3UA7 A;  1ZUK A;  5IHI A;  2DNU A;  3VS5 A;  2K9G A;  1KFZ A;  2ECZ A;  3VS3 A;  1M3B A;  2DVJ A;  4M4Z A;  1AZE A;  2FG0 A;  1QLY A;  2W0Z A;  2CSI A;  2F2W A;  1YCS B;  1I07 A;  3C0C A;  1KJW A;  1K4U S;  2ROL A;  2GTJ A;  1JO8 A;  1HSQ A;  2HDA A;  1YN8 A;  2EYX A;  2JMA A;  2YUN A;  2O9S A;  4JJC A;  1S1N A;  3EG1 A;  3H0H A;  2AK5 A;  4QT7 A;  2J7I A;  4J9H A;  1GCQ A;  3UA6 A;  2BZ8 A;  1U5S A;  4LUE A;  4Z88 A;  2KYB A;  1ZBJ A;  1SHG A;  1RUW A;  2O88 A;  1Z9Q A;  3LH5 A;  4CC2 A;  5IXB A;  5IXF A;  3VS6 A;  5HCK A;  3VRY A;  1UFF A;  3QWY A;  2ABL A;  5IH2 A;  2LNH B;  4CC4 B;  2EGC A;  2LQN A;  1YWP A;  1JQQ A;  1ZUU A;  1I1J A;  3NPF A;  2V1R A;  1GFD A;  2LMJ A;  5FWC A;  2RNA A;  4JPB W;  4F17 A;  2K79 A;  2EYZ A;  2CSQ A;  1SRM A;  2O9V A;  2EW3 A;  4Y92 A;  2CDT A;  2KGT A;  1OV3 A;  2MCN A;  1SSH A;  4KRT A;  2KRS A;  1PWT A;  1GBQ A;  1AOJ A;  3THK A;  4OML A;  1E6G A;  1PKT A;  2DMO A;  2C0O A;  2VVK A;  3PVQ A;  2HEQ A;  2DL4 A;  1MUZ A;  1PRM C;  2CUB A;  1TUC A;  2NWM A;  2RMO A;  1WLP B;  4LN2 A;  1B3Q A;  1SHF A;  2M51 A;  2B86 A;  2JW4 A;  3R6N A;  1UUE A;  1AWW A;  4CC3 A;  2DJQ A;  4R0K A;  5I11 A;  2J6K A;  1RLQ C;  4RTZ A;  3RNJ A;  2LP5 A;  4HXJ A;  1VYV A;  1WDX A;  1VYU A;  2D8H A;  2HBW A;  2FO0 A;  2A28 A;  1H8K A;  3EGU A;  4F14 A;  4CC7 A;  2RF0 A;  3NGP A;  2JM8 A;  3GBQ A;  4ORZ A;  3EG0 A;  1W70 A;  4F16 A;  4OMP A;  1ZSG A;  1UTI A;  1TG0 A;  2M0Y A;  2RQT A;  1X6B A;  2DYB A;  1ABQ A;  1QKX A;  1V1C A;  1NG2 A;  2DA9 A;  1CKB A;  1JXO A;  2RN8 A;  1WYX A;  2EGA A;  2P4R A;  2A08 A;  1T3L A;  1ABO A;  3EHR A;  4RTY A;  2KE9 A;  1E7O A;  1PNJ A;  1VYT A;  1NYG A;  1WXU A;  1JEG A;  1AZG B;  3EG2 A;  2KXD A;  4LUD A;  4IIO A;  1UDL A;  3KFV A;  3QWX X;  3VS7 A;  3VS1 A;  1X27 A;  3VRZ A;  1RLP C;  2X3X D;  4FSS A;  1KIK A;  2PTK A;  1KSW A;  1BB9 A;  4RTT A;  1PHT A;  3JV3 A;  1K1Z A;  1GFC A;  1OPK A;  2FRY A;  1AEY A;  1WI7 A;  2BTT A;  4OMN A;  3REA B;  2DF6 A;  4EIK A;  1K0X A;  1M3A A;  1ZLM A;  1TUD A;  1X2Q A;  1GBR A;  3TSZ A;  1MV3 A;  4IIM A;  1AVZ C;  2CT4 A;  2L3S A;  2EYW A;  1M27 C;  1UJ0 A;  2C0I A;  4JZ4 A;  1QWF A;  2AKL A;  4WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...