3H0HA

Human fyn sh3 domain r96i mutant, crystal form i
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
b'GGTGVTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
molecule tags Transferase
source organism Homo sapiens
publication title SH3 domain specificity
rcsb
total genus 10
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0hA00
4R0KA 4AFSC 1EFNA 1GCQA 2RQWA 1PHTA 4J9EA 2K3BA 2LJ3A 2KXDA 5I11A 2VVKA 1ZLMA 2GGRA 1K1ZA 2RQUA 3NMZC 1KSWA 1JXMA 1WXUA 3VS0A 1YWPA 3EG0A 2EYYA 3EHQA 4FSSA 1JO8A 1V1CA 1HSQA 3O5ZA 4RTVA 1AZGB 1G83A 2B86A 3TSZA 3NPFA 3ULRB 2FPDA 4IIOA 1VA7A 1AZEA 2HCKA 1ZUUA 2KEAA 1JU5C 4Z88A 2CH4W 2DBKA 2JS2A 5ECAA 1K0SA 1MUZA 2YDLA 4HCKA 2X3WD 3RNJA 4D8DA 1NLOC 2O88A 1NYFA 1B3QA 1PRMC 2MIOA 2RQTA 1YN8A 3I5RA 3ZL7C 5HCKA 1RUWA 1QKWA 4LN2A 3UA6A 1W1FA 4K11A 2AZVA 1A0NB 1WX6A 4J9BA 2SEMA 2O9SA 1FYNA 1JEGA 2DYBA 2YUQA 2J6OA 1MV3A 5I22A 4RTTA 3REBB 2BZYA 1GL5A 2PZ1A 1GBQA 2KNBB 1J3TA 2KR3A 1W70A 1ZUYA 5GJVB 1U3OA 2YUNA 3EGUA 3VS2A 4J9DA 2LMJA 2EKHA 1CKBA 1NEGA 2DBMA 1AVZC 2BZXA 1NEBA 2J6FA 3A98A 2CSQA 2KRNA 4CC7A 5FW9A 1PKSA 2P4RA 1RLPC 2YT6A 2K79A 2LX7A 2V1RA 4J9HA 1AEYA 1M8MA 4E6RA 3H0HA 1OPKA 2JW4A 4OMPA 4F17A 4Z89A 1B07A 1UG1A 2JT4A 3R6NA 2YUOA 4CC3A 1X27A 2L2PA 3H0IA 2FPFA 2D8HA 2NWMA 1K0XA 4ESRA 1I0CA 4OMMA 4LUEA 1KFZA 1UECA 2LQNA 2KT1A 3VS1A 2I0NA 2O2OA 2JXBA 3FJ5A 2JM8A 2EVRA 2ED0A 2KBTA 1KJWA 1CSKA 3QWXX 4X1VA 2DL8A 1RI9A 2LNHB 1AWXA 2F2XA 1BK2A 1X6BA 3TVTA 1UUEA 2JTEA 2CT4A 1XOVA 2O9VA 2AKKA 2W0ZA 1T0HA 2RQRA 4RTYA 2CT3A 2G6FX 2EGAA 2JMAA 3C0CA 1E7OA 4M4ZA 3THKA 2PNIA 3LH5A 4JJCA 2K7AA 2HEQA 3EG3A 1NYGA 1E6GA 2A28A 3TSWA 1AWOA 2KYMA 2X3XD 2KROA 5IH2A 5L23A 1AWWA 3IQLA 1K9AA 2C0OA 4OMNA 1T3LA 2XMFA 5IHIA 1GCPA 3GBQA 2DM1A 1H92A 2J06A 2AK5A 1QWFA 2FG0A 2VKNA 2YSQA 4RTWA 1I07A 1JXOA 2D8JA 1GRIA 3VS3A 4KRTA 1LCKA 1E6HA 1SRMA 1Z9ZA 3UF4A 3JV3A 2EGCA 1OEBA 3SEMA 1RLQC 2FO0A 1WYXA 3M0QA 5EC7A 1H8KA 2ED1A 5GJWB 4HVWA 2BZ8A 1M3CA 1QCFA 1WXBA 2RN8A 1OV3A 2EGEA 2KXCA 1GFCA 1WDXA 3M0UA 1JQQA 2RMOA 2E5KA 1W6XA 1M30A 2CREA 2CSIA 2EW3A 1U06A 2JM9A 2LP5A 1ABQA 1WIEA 2KRMA 1M27C 1OPLA 2M0YA 2L3QA 1UGVA 1WA7A 2CUBA 4J9FA 1GCQC 2SRCA 3I35A 4QT7A 3PVQA 3CQTA 4CC2A 2OAWA 2K2MA 4J9GA 2DILA 5IXBA 1YP5A 2LZ6B 1GBRA 2DMOA 2GTJA 2CUDA 4IIMA 2L0AA 3M0TA 1TUDA 4LUDA 1NLPC 2MCNA 2KGTA 2H8HA 1BU1A 3VS5A 1S1NA 1UJYA 1SSHA 2GNCA 4OMLA 3H41A 2AZSA 1TUCA 5FWCA 3NHNA 2FRWA 2O31A 4CC4B 3REAB 1WXTA 1QLYA 1X2QA 2QDLA 4GLMA 5IXFA 2EYZA 2YUPA 1SEMA 1UHCA 1U5SA 2DL3A 2ENMA 2LJ0A 2KE9A 3UATA 1YWOA 1Z9QA 4AFQC 4JZ3A 1QKXA 1AD5A 2LJ1A 2CDTA 2GBQA 2DNUA 4AFZC 2A37A 4HVVA 1M3AA 1YNZA 2ECZA 1ZUKA 3PE0A 2W10A 3I9QA 1PRLC 1WFWA 1T0JA 3U23A 2CH4A 1BB9A 1GFDA 2EYWA 1UTIA 2JMCA 2D0NA 1N5ZA 4HVUA 4Z8AA 4GBQA 4HXJA 2DJQA 1HJDA 3UA7A 2IIMA 2ROLA 2J05A 5IHNA 4JZ4A 2AKLA 1X2KA 4RUGA 2DF6A 4RTUA 1UJ0A 1ARKA 4DEXA 2OJ2A 3I5SA 2VWFA 3M0PA 2K9GA 3VRZA 4LE9A 1PNJA 3EHRA 3VS7A 2GTOA 1AOJA 1M3BA 4J9CA 2DVJA 5IHKA 1WI7A 2DL4A 1T3SA 1VYTA 2JS0A 4JJDA 1KIKA 4F16A 2J7IA 2ESWA 2FRYA 2J6KA 4ZNXA 4J9IA 3SHWA 2RNAA 2HSPA 2KT8A 1BBZA 5FWBA 2M51A 2C0IA 1YCSB 1QWEA 1VYUA 2C0TA 2V1QA 4DEYA 1G2BA 4WCIA 1K4US 2RQVA 4Y92A 2KYBA 2RPNA 1FMKA 2BTTA 1NM7A 1Y57A 4A63B 2DL5A 2A36A 4OMOA 1UFFA 1IO6A 2KRSA 1X6GA 2EPDA 2L3SA 3M0RA 2DX1A 2DRKA 3VS4A 1MV0B 3QWYA 2DE0X 2NUZA 2FPEA 2DA9A 2DRMA 4D8KA 2HBWA 3PVLA 4AFUC 4LNPA 4RTXA 3EG1A 2F2VA 2PTKA 2ABLA 1X43A 2L3PA 2DL7A 3NGPA 1AWJA 1UHFA 2DLPA 1UDLA 2EQIA 4EIKA 2FEIA 3H0FA 1OOTA 2D1XA 2A08A 1PKTA 1ZSGA 4OMQA 1K76A 1Y0MA 3M0SA 1ABOA 1TG0A 1UE9A 1CKAA 2K6DA 2ROTA 1H3HA 1HD3A 2EYXA 4JJBA 3KFVA 1ZX6A 3VRYA 1VYVA 4AG2C 2LQWA 2F2WA 1SPKA 3EG2A 1SRLA 4AG1C 1WLPB 1PWTA 2OI3A 1ZBJA 1I1JA 2HDAA 4F14A 1SHGA 4JPBW 1X69A 2EBPA 4ORZA 1SHFA 2LCSA 4RTZA 3VS6A 1NG2A 3RBBB 2MOXA 2GQIA 2RF0A
chains in the Genus database with same CATH superfamily
4Q5WA 3RMQA 4AFSC 3QHSA 4J9EA 5CKDA 4BDYA 3OYDA 3MCAB 4PJOF 4NL3A 2VVKA 1Q81C 2XICA 2EYYA 4M78A 1GXIE 2D6FA 4KT0E 4RTVA 5GAMd 1WJRA 1VQOQ 3JCMc 3OBYA 3ULRB 4M7AD 3SD4A 2CP0A 4IIOA 4C8QB 1WQWA 1VQ6T 4RCCA 2KEAA 3HFNA 1JU5C 2DBKA 2QAZA 4CI0C 4LDWA 1MUZA 3BE3A 4HCKA 1M1KU 3CD6Q 3CMAQ 3L2ZA 4PJOC 1I8FA 5HKCA 3JCMg 1PRMC 2MIOA 2EJ9A 2LT4A 2EWNA 1YN8A 6AT1B 3ZL7C 5HCKA 1RUWA 4LN2A 5LJ3g 1Y7XA 1G3SA 1W1FA 4C5IA 3CCMA 1A0NB 1AT1B 1WX6A 2HZYA 2O4XB 4C92C 4HT8A 1JB0E 3CBPA 1Q95G 2P4TA 4QVCA 1JEGA 2DYBA 2YUQA 1V29B 1FXXA 1MV3A 2LQKA 5I22A 2F5TX 3REBB 2PZ1A 1GBQA 2YLBA 4LDYA 3KBGA 2KR3A 1W70A 1KG1A 3VS2A 3M59A 1CKBA 2X35A 1DJ7B 3JB9F 1PD1A 4BI3A 4LDUA 1PKSA 1UGSB 2K79A 4E6RA 1ZA1B 3QBYA 2JW4A 2HAXA 4Z89A 1LNXA 3VUBA 2L2PA 3H0IA 1N8RR 2NWMA 3HTRA 3JCMV 3UT1A 5GAN2 4M78B 4ESRA 4OMMA 4LUEA 5GAOr 2LQNA 3CBOA 4J6WA 2JXBA 3FJ5A 4DBQA 2JM8A 2EVRA 3OS2A 4C0FA 4O6JA 1IGUA 3QWXX 4X1VA 4RMOA 1VQLT 1BK2A 1X6BA 3MO8A 1XOVA 2O9VA 4PLIA 3CC4T 2E3IA 2RQRA 5GAOm 1YJWQ 4JJCA 2K7AA 1Y96B 2QTVA 2RHYA 1E6GA 3I56Q 3G6EA 1QVFP 4KGZB 1K9AA 4OMNA 1VQNT 2Z0WA 1GCPA 3CD6A 2DM1A 3E1SA 2OTLA 2QG9B 3QYGB 3SWNC 3FEOA 3NFCA 2VKNA 4RTWA 1JXOA 1LCKA 4A4EA 1E6HA 1SRMA 1Z9ZA 2FYKA 4EDUA 2FO0A 1VQ7T 3CCMQ 2ED1A 2RD1A 2RJFA 5GJWB 5GAOq 4HVWA 5A0DA 1OZ3A 3I56A 4EMGA 2JOYA 2KSSA 3HL8A 4BACA 2EGEA 4QW2A 3BY7A 2E41A 3JCMP 2QI2A 2CZ7B 2WSCE 4C92F 4OB0B 4PFOA 1BIBA 1JQQA 1K73C 1UGPB 1BKBA 3EFRA 4XU1A 1ABQA 3WXMB 5FRNA 1M27C 1I4K1 1OPLA 3M5AA 4C0DC 3AHUA 3CEYA 2GFAA 3OA6A 3L2UA 4J9FA 3P8DA 2SRCA 1RAEB 3PVQA 4J5YA 2HQXA 4J9GA 2K2MA 3QDRB 2DILA 2E65A 4PJOA 3OYAA 1GBRA 4M77D 2CUDA 3M0TA 2KDSA 3RDVA 2YLCA 1PG5B 3VS5A 2GQVA 3WVEB 2DPPB 2MWOA 3LLRA 3H41A 3EGXA 1D3BA 4KGXB 2FRWA 4J6XA 4CC4B 1M9SA 2RA2A 4BUGA 2KVQG 3KXTA 2QDLA 5IXFA 1BCMA 4NS5A 1UHCA 3X25B 1KD1U 2OAUA 4LD9K 1WZOA 1Z9QA 2XG8D 1QKXA 3UDCA 2GBQA 2A37A 3S6WA 1M3AA 3OYJA 3ER0A 1M90C 2CZ1B 4DBHA 1WFWA 2RM4A 2R58A 2ZCFB 1NJIU 1VQ6Q 1VQLQ 2D0NA 1QVFS 1K8AU 5GAMe 2IIMA 3CC7A 5LJ5e 4A54A 5IHNA 2DZ9A 4JZ4A 2AKLA 3OBWA 1RAGB 1UJ0A 2OJ2A 1VQPQ 1PD0A 3P8HA 5KYXB 1KHIA 4II1A 3OYKA 1D0YA 3CCEQ 2JVVA 1C0MA 1YJNA 2HL3A 4C5HA 2KMTA 4C5GA 1T3SA 1IXDA 4C92D 1LVKA 1WPYA 1XTDA 1VQ5A 4F7UB 2CZ0B 2OX7A 2J6KA 3A5ZB 2QXFA 2G3RA 4FT2A 2BKDN 3HFOA 3CMET 5GAN3 1Y71A 2HSPA 5M9OA 5I21A 5KYXA 5FWBA 3CC2T 5KYWA 4MDXA 4C0ZA 4QKUA 2NUPB 4OGEA 5CKBA 1VYUA 2V1QA 4XTUA 1M4ZA 2YRDA 5FRMA 1K4US 2RQVA 4Y92A 3G1JA 2JTMA 3CCUQ 2RPNA 2LCCA 4JS5A 4M75F 1M1KR 2OTJA 1G3WA 3M0RA 2DX1A 2PQWA 4M7AE 1RABB 2RO0A 2VXEA 4WTOB 1KK7A 3CCQT 2DRMA 4D8KA 3QYHB 3QXEB 4ANJA 3PVLA 1VQ7A 3RKXA 2F2VA 4OP0A 1WGSA 8ATCB 2DVEA 4D6WA 2FEIA 3H0FA 2QDYB 4YTLA 4RG8A 3PGGA 2D1XA 4E7KA 1ZSGA 1Y0MA 1QW1A 4M78D 1UE9A 2K6DA 4IUQA 2RI5A 4M75C 1U8RA 4J7FA 2EYXA 1K9MC 2JZ2A 3VRYA 1VYVA 3CCRA 2CP2A 4M7AA 2M02A 2YHTA 2MYSA 2OI3A 4FL6A 3CPWA 2HDAA 1QP3A 1SHGA 1VQLA 1VQ4Q 4ORZA 3C12A 5DLOA 3VS6A 2K5FA 3QUIA 1NG2A 3CC7Q 2HMAA 3JCMW 1W2BP 2ED0A 2RF0A 1U1SA 4R0KA 3ZEHA 1EFNA 3BW1A 2RQWA 2RJDA 1MMDA 4N0AC 2XDBA 4JDSA 5GANd 1R8OB 5LJ3d 4E2FB 4L6V5 1K8AC 1K1ZA 1NE8A 3NMZC 2V8IA 1KSWA 3CC2Q 3VS0A 3CCJT 1YWPA 3EHQA 2K3XA 1JO8A 3I55T 2NUTB 2VB6A 2DK3A 1HSQA 3G6EQ 1VQ5Q 2FPDA 1I5OB 2ATCB 1VQ9Q 1WHKA 2O88A 2P84A 4AT1B 1O75A 1G5VA 3GNFB 3RUXA 2YRCA 1VQMA 2DTHA 2PUKB 4BE2A 2AZVA 2RH2A 5C0MA 4C0GA 1BYMA 2KI7A 3EFSA 2O9SA 3NTKA 4BB7A 5GMKh 2COWA 3M4GA 4HCBA 4M77G 1UGQB 2BZYA 3JSCA 2KNBB 1HYOA 1J3TA 1D3BB 1YI2T 4A4HA 5GJVB 1VQ7Q 3EGUA 4J9DA 2LMJA 2EKHA 1NEGA 2DBMA 2E6NA 2BZXA 1JJ2A 2KRNA 4NOYA 4N4HA 3VKIA 2R5MA 5FW9A 3PIOA 2M9UA 3MP8A 2YT6A 2QGGA 2E3HA 3HPWA 4J9HA 4Y28E 7AT1B 1OPKA 2L5QA 2YRVA 3E9FA 4F17A 1B07A 2F1LA 1UG1A 2JT4A 3A8MB 1K73U 1TXQA 4ELYC 2AHJB 2QA4T 4C8QC 4BI8B 3OW2S 1K0XA 1N9SA 1UECA 2VUBA 3VS1A 1NPPA 2I0NA 3M4YA 4M7AF 2KBTA 1M2VB 2MF2A 1D1AA 3G4ST 1CSKA 5LJ5f 1AWXA 1W2BA 1VQ4A 4E7ZA 1S72A 3TVTA 4J6YA 2WSFE 3Q1JA 5CCAA 1T0HA 1BI0A 4C8QD 2G6FX 1WHLA 3C0CA 3OYBA 1YITT 1RADB 2PNIA 3LX7A 5CR2A 1SG5A 3LH5A 1MNDA 1TUGB 5GAMj 5GANg 4RCBA 2A28A 2IPOB 4OF1A 3G4SA 3OYFA 3CCMT 5IH2A 2HKNA 2C0OA 1T3LA 5GAMh 3HRUA 4IUVA 3EGDB 4MMLA 1H92A 2J06A 3RERA 2LTOA 2K5IA 3CXCA 1VQKT 4XU0A 2M0OA 4M78F 4B9XA 5LJ3h 3VS3A 4EMKA 1M1GA 4QVDA 5FU6C 4KUDK 4E47A 2BZ8A 1OV3A 3G6ET 2KXCA 1ZHIA 1M2OA 3TU4K 3M56A 3CCVA 2CS7A 2PUOB 5J26A 4M78C 2CREA 2CSIA 2JM9A 5DM7R 2CZ6B 2A0FB 5C6SA 3E9GA 4PLLA 1VQPT 4QQDA 2L8DA 3HSBA 4DA4A 2CUBA 3I35A 1VQOA 3CCET 4CC2A 5GAN4 3FLGA 2OAWA 4PFPA 4LDXA 2DTOA 1OI1A 4XTVA 2X4JA 1Q82U 2GTJA 2E1HA 2L0AA 2OTJT 4LUDA 1BU1A 1WJQA 1UJYA 2GNCA 1YI2Q 4FYXB 2EKOA 1F1BB 1BI1A 2CP5A 1JRIA 2O31A 4ZTFA 3REAB 3CCEA 1QLYA 1TH7A 1M2VA 1X2QA 2MPXC 1YJNQ 3NTHA 1LPLA 4PJLA 4EPCA 2XK0A 3EAEA 3S3OA 1NPRA 4X9CA 3MP6A 1AHJB 2LJ0A 2IVWA 3UATA 1QQJA 1YIJA 3JCMX 1WHJA 5KYYB 3OYLA 4N4GA 2CDTA 4M75D 3OYHA 1I5LA 3CCRQ 2RI2A 2P0PA 1YNZA 4BI4A 4XQ3A 3PE0A 1YJ9T 1PRLC 5D6WA 1VUBA 3U23A 2FHDA 3G4SQ 2CH4A 3N5BB 1GFDA 1UTIA 3DB4A 1N5ZA 3M55A 4Z8AA 3EGDA 1HJDA 1YHQQ 3PMTA 3P8BB 3A8OB 1YIJQ 3J7AF 5EG2A 2RHZA 4RUGA 4ATOA 5GMKj 1ARKA 3I5SA 2QQBA 2DO3A 2VASA 3JB9D 2K9GA 4MDWA 4LE9A 4KBMB 3VS7A 4LDVA 2VYTA 5IHKA 5J3BA 4FYWB 1S72Q 1YBYA 2JS0A 3RESA 2KQWA 3CCUT 1N9RA 3JB9G 2WACA 2J7IA 4ZNXA 2FRYA 2HQEA 5GAOn 3CMAT 3QG1A 3SHWA 2ZPIB 2RNAA 4MZTA 1WHHA 2KT8A 1R77A 1C6VX 4HT9A 3CCLA 2MI6A 5CKFA 1M90U 5KCOA 3I55Q 4L5GA 1YITA 4F7UG 3CCQQ 2RHUA 5FLXE 2C0TA 3L42A 2XD0A 4OB1B 1YJNT 1QCNA 4B6MA 4WCIA 2EIFA 4M7DC 3LGFA 1OZ2A 2KYBA 2VXFA 5LJ5j 1VQ9T 3SDZA 2E64A 3QZ9B 1ZSZC 4A63B 2DL5A 5GANj 1FMWA 1PSEA 3MEWA 2KRSA 1XQHA 1OULA 4IUTA 4ZGDB 1JBMA 1IB8A 2EQJA 1PCXA 2LNVA 3CCLT 1SKUB 2FB7A 2HBWA 2YWWA 1VOMA 4LNPA 4PFZA 1N27A 2LT1A 3CCQA 2ABLA 3SB2A 2DL7A 4M7AC 3WVDB 2PVDB 1X75C 3CCUA 2XI9A 4A53A 2M1HA 4B9WA 3MKDA 3OYEA 1PKTA 3JCMh 1K76A 2CYZB 1TG0A 5GAMg 1CKAA 2F5KA 2RB6A 5I2MA 2ROTA 4DBFA 1K8AR 1YHQT 3KFVA 2BE7D 2CKKA 2E4HA 2X51A 3FRNA 3LWIA 3OYIA 2F2WA 1SPKA 1MHNA 3LW5E 5CQXA 2XHCA 1WLPB 1D0ZA 1PWTA 2QQ9A 1ZBJA 3L2VA 3CCJQ 1SSFA 3JB9J 3JCMb 4C92G 3C94A 4OB3B 1VQ5T 2QASA 1ZA2B 2FZCB 1ZQ1A 5GAN5 2LC4A 3DLLA 5KH6A 1EX4A 3VYGA 1RAAB 2PVOB 5GANh 1KD1C 1YJWT 2KXDA 2YXYA 1ZLMA 2RI3A 4X34A 3GIBA 3JRZA 3OYNA 4ZGJB 3CCRT 2ZPHB 3OS0A 3EG0A 4PK4A 3FDRA 4JJNK 3C4SA 4VUBA 2LDMA 1RAIB 1V1CA 4JRKA 3CCJA 2HQHA 3TCJA 1AZGB 1MNEA 4OGCA 1N6AA 2B86A 3TSZA 4EMKC 5DLQE 1VA7A 2HCKA 1ZUUA 2CH4W 2JS2A 2YDLA 2H3EB 4XU2A 2X3WD 1PSFA 2NLUA 1NLOC 4N4IA 2HBPA 3GPLA 3OSVA 5IAYA 2BE9B 1NJIR 2VV5A 3I5RA 3A8HB 1QKWA 4WF2A 4ZN3A 1R0BG 1UEBA 2KY9A 5FU7B 3LH0A 4J9BA 5DY9A 5CIUA 2VC8A 1NBEB 3V7SA 4GLKA 2E70A 2K4YA 3PT9A 5GAN7 3J80E 1Q81R 1WJSA 4RTTA 1GL5A 3HRTA 5IT9E 1ZUYA 3DKMA 5GAN8 1U3OA 3ASKA 1G3YA 3MP1A 1SF9A 5LJ3e 1JJ2S 1NEBA 2J6FA 5GANe 4M7DB 2CSQA 1ZBXA 3M57A 3O8VA 2P4RA 1OYXA 3UWNA 1AEYA 4XAXB 3VUZA 3GNGA 3R6NA 2YUOA 4UC4A 1X27A 2FPFA 2QEXA 1C1AA 2XU8A 1I0CA 3I55A 1KFZA 1YITQ 2KT1A 1H641 3OYCA 2DEQA 4R55A 1YJ9Q 1XJWB 4O5VA 5AT1B 1KJWA 3X20B 5CAIA 2DL8A 1W2BS 1U1TA 2F2XA 4LD6A 1UUEA 3MHXA 2OTJQ 2CT4A 2AKKA 4RKUE 2W0ZA 2CT3A 1K73R 2EGAA 1E7OA 5GMKe 3THKA 5LJ5g 1ZSZB 4XTXA 3EFOA 4J7IA 1KQ2A 1M8VA 5CVIA 2HEQA 3EG3A 1IZ6A 3PTAA 3TSWA 1AWOA 2KYMA 2O4XA 3PIPA 2X3XD 5CKHA 2DEUA 4BY6B 4FIBA 1VQOT 2DYIA 2H3JA 1M1FA 2XMFA 3GBQA 5IHIA 4F7UE 2AIRB 3JB9H 3C95A 5D6XA 2AK5A 2QEXT 2FG0A 2YSQA 1N8RU 3CD6T 1I07A 2D8JA 3FJPA 1Q82R 1GRIA 1RL2A 4ELZC 5FU6B 2GF7A 3JV3A 1OEBA 3SEMA 3JCMf 1WYXA 3M0QA 3D7SB 4PJOE 3VYHB 3JB9I 5GAOl 4E7LA 1WXBA 2RN8A 4HCCA 2ZPGB 1WDXA 1KQSA 1FWZA 4F7UA 1NZ9A 3QDFA 2DKGA 2RMOA 3V8KA 1W6XA 1M30A 2CP6A 2VGMA 3J81E 2E5QA 2EYQA 2XIDA 1U06A 3V7RA 1OU9A 2LP5A 3CC2A 2EJGA 5HK3A 2JJ9A 2M0YA 3CCLQ 1QVPA 5FU7C 2DXCA 2DXTA 3GP8A 1GCQC 3JCMJ 5I2SA 4PL6A 4E7HA 2D9TA 4OB2B 3QO3A 1VQ9A 4JRQA 5KCHA 2LZ6B 4DBRA 2LQ8A 2DMOA 1QP2A 3JCMQ 1K9MU 1TUDA 1NLPC 5D6YA 1D1CA 3UPUA 3OY9A 4KULA 1TUCA 1Q7YR 1HXDA 2EFIA 2HNIA 3H8ZA 4M78G 3CPWS 4M77A 2RHXA 4GLMA 2EYZA 2YUPA 2A7YA 1YJ9A 4C8QG 3PNWC 1U5SA 1TOVA 2QQRA 5LJ3j 2DL3A 2ENMA 3CC4Q 3EH1A 2QQAA 1YWOA 3FC3A 3R6OA 4JZ3A 1AD5A 2LJ1A 1XNIA 1YIJT 3RIRA 2DNUA 4XTZA 4AFZC 4OVAA 3OS5A 1VIFA 3OW2P 4HVVA 4L59A 1KD1R 2EQMA 2XDDA 3LGLA 4LXCA 2ECZA 1ZUKA 2ZPEB 4KGVB 2K57A 3A1PA 1KC8C 3X24B 1IHWA 3OMCA 2F69A 1D1BA 2HSEB 2R57A 1NJIC 4GBQA 1QVFA 1X6OA 4HXJA 1MMAA 2KK4A 1IHVA 4A4KA 1QMCA 2NYSA 3CCSQ 3RR6A 2J05A 1X2KA 2DF6A 4C92A 4RTUA 3OS1A 3MEUA 2RHIA 4JRIA 4F7UF 3S3MA 3M0PA 3VRZA 1VQMT 4E7IA 3EHRA 2GTOA 4J9CA 4PJMA 2KAFA 2DETA 2DVJA 4BDZA 2CP3A 1RAFB 1VYTA 4JJDA 1QVGP 1YHQA 3JAME 1KIKA 8AT1B 4F16A 2ESWA 3BFMA 3G71A 2FZGB 3EGXB 2LVMA 2MK5A 2BUDA 1BBZA 2R5AA 2LX9A 4FCYA 4C92E 1K9MR 4M7AG 3RKWA 2C0IA 1YCSB 3URGA 1QWEA 3TEEA 3QJYA 1G2BA 4FW2A 4N0AA 5FROA 4AMCA 3NTIA 1FMKA 1VQ8Q 5CKEA 3OMGA 3CXCS 1UB4A 1UFFA 1IO6A 3QZ5B 4DOVA 1X6GA 5KYYA 2EPDA 2L3SA 2E10A 3VS4A 1MV0B 1TSFA 3QWYA 2DE0X 2BIVA 4IUPA 2RJEA 2NUZA 3TQ7P 2DA9A 4RG2A 1YJWA 2WSEE 4RTXA 2RK2A 3JCMd 2PTKA 4M78E 1X43A 3NGPA 1AWJA 1UHFA 2DLPA 2Y4XA 1Q86C 3CCVQ 1VQ4T 1KQSS 3E2UA 2XKOC 1Q7YU 4M75G 2EQUA 5AYFA 3M0SA 1ABOA 3OQ5A 1H3HA 3FB9A 2C06A 1HD3A 4AG2C 2LQWA 1G3TA 3QPHA 4GY5A 1SRLA 2FL7A 5J39A 1WNLA 1I1JA 5GAMf 4F14A 4JPBW 1RAHB 1X69A 4MZPA 4M77F 2EBPA 1Q82C 1M1KC 4RTZA 4PJOG 3QJ6A 4M7DD 4FT4A 3EG9B 4FYYB 2GQIA 1PC0A 1YI2A 2HKQB 1GCQA 1PHTA 2K3BA 4EMKB 2LJ3A 3CMEA 5I11A 2GGRA 3PMIA 2RQUA 1JXMA 1OU8A 1WXUA 4JRPA 4FSSA 4Y91A 3O5ZA 3L2QA 4XK8E 1G83A 3NPFA 4A4GA 4QQGA 1S72T 1AZEA 3V8LA 4Z88A 5ECAA 3SWNA 1K0SA 3MEAA 9ATCB 3F70A 2P0KA 1TS9A 3RNJA 4D8DA 1NYFA 1B3QA 2MMPA 3LWHA 3CCST 4QQ6A 2RQTA 3ME9A 1VIEA 2GCXA 3ZBDA 4OMFB 3UA6A 4TVRA 3HRSA 4K11A 1BI3A 1TU0B 2E12A 4M7DA 1KHCA 2SEMA 1FYNA 4BE0A 2QQSA 3MEVA 2J6OA 4E7JA 3OYMA 4PJJA 1OX9A 2RJCA 2O01E 2OTLT 5A0LA 4XU3A 1VQ8A 3DB3A 3CCSA 2A3LA 1YFNA 2YUNA 4FYVB 3A8LB 1TTHB 2QA4Q 3OSSC 5GMKi 1AVZC 3A98A 5LL6S 1Q7YC 2K2VA 3MPUB 4CC7A 3CXCP 2COZA 1B7TA 1RLPC 2LX7A 4ZTJA 2V1RA 4R56A 1Q86R 1M8MA 3H0HA 4J8OA 1VQ8T 4PJOB 4OMPA 3GOXA 3OB9A 1I81A 3G71Q 1VQ6A 4PJOD 1D09B 4IURA 4CC3A 2V8JA 5GMKm 3JCMe 2D8HA 5KE2A 4DOWA 2ZAEA 4PNOA 1YCYA 2O2OA 4P5NA 4C8QE 2RK1A 5CQYA 4IUUA 1RI9A 2LNHB 3CBMA 3CPFA 4M77C 4ME7A 2JTEA 1VQNA 1HK9A 1KC8R 1BI2A 1RI0A 3L2RA 4RTYA 2QEXQ 2JMAA 3RKYA 3TREA 4M4ZA 3SFMA 3EH2A 5CO7A 4C5EA 2JUFA 2LCLA 1N8RC 5KYUB 1EZZB 2M16A 2DJZA 2LRQA 1NYGA 1M5Q1 2KROA 2Y4YA 5L23A 4C8QA 2DIQA 1OQKA 1IRXA 3IQLA 1QVGS 1AWWA 3OYGA 1MMGA 2DZCA 1QWFA 2EJFA 3CMAA 4C92B 1QCOA 2X4WA 3EFOB 2AT1B 4KRTA 2DD4A 3UF4A 1JJ2P 2EGCA 4E7SA 1RLQC 4NL2A 4BD3A 3ZFJA 5EC7A 2K3YA 1H8KA 3I56T 3LYIA 1Y07A 2X4YA 3PFSA 4V2SA 4X9DA 4M77B 5A2QE 1M3CA 1QCFA 5HK0A 5CK9A 5GMKl 1GFCA 2HD0A 3L2WA 5KYNA 2XDPA 3M0UA 3RMSA 1VQKQ 4M7DF 1B34A 4HA8A 2E5KA 2JNGA 2EAYA 2DAQA 2EW3A 1WIEA 1MGQA 2KRMA 2DFUA 5GAN6 2L3QA 1BIAA 2E6ZA 1UGVA 1WA7A 4FW1A 4ZGEB 2V8KA 1IGQA 5KYWB 4QT7A 2JN0A 5LJ5h 3CQTA 2GFUA 1OX8A 5IXBA 1YP5A 2FVUA 4A4FA 2DD5A 1QVGA 4XTWA 4JUVA 4C0DB 4IIMA 1WHGA 1H3ZA 3BDUA 2MCNA 2KGTA 2H8HA 2COYA 2OTLQ 1S1NA 2PU9B 1LOJA 1SSHA 4OMLA 2AZSA 5FWCA 3NHNA 2ZPBB 4FU6A 1WXTA 1KQ1A 4HCZA 2PVGB 2B8AA 2V26A 4PKCC 3T9NA 2DIGA 1W4SA 4Z02A 1SEMA 2I2LA 3FIFA 4M75E 5LJ3f 1Q81U 2VGNA 4QVZA 3HP9A 2KE9A 3META 4AFQC 3G7ZA 4C8QF 4M7AB 2QGFB 3HKSA 3CPWP 3A8GB 2QYZA 1X01A 2JTFA 3OW2A 4EMHA 3AT1B 5KE3A 1MMNA 3V7CA 1VQPA 1ZSZA 2W10A 3I9QA 4CRIA 4BE1A 1T0JA 1V76A 4JLIA 1VQMQ 1BB9A 2EYWA 3KUFA 4FM4B 4MZMA 2ZZDA 2JMCA 3VJPA 3EG9A 4M75A 1LJOA 3CC4A 2L89A 3L1AA 4HVUA 2IG0A 3CC7T 2QTXA 3BDLA 2DJQA 2CP7A 3UA7A 1P92A 5A0GA 3QSUA 2ROLA 3S3NA 2L3RA 4DEXA 2MWPA 4M77E 2VWFA 4DQ2A 4XTYA 3M58A 5KYUA 2FZKB 3OYYA 4F04B 1PNJA 4M75B 1UGRB 1WQ7A 1M3BA 1AOJA 1ACMB 4KH0B 1WI7A 2DL4A 1M90R 2ZPFB 2X9HA 1VQNQ 2D0QB 1B34B 4FSXA 1VQKA 4J9IA 3SWNB 5D7UA 1D0XA 2QK0A 3QIIA 4KH1B 2M51A 3M53A 4HKEA 1G8XA 4M7DE 4BY6C 2NUTA 3E19A 3HHTB 4PJNA 2DXBA 1WHMA 4DEYA 2DTIA 4JLGA 1KQSP 4MMKA 3CCVT 2BTTA 1NM7A 1Y57A 3VU3C 3CMEQ 2A36A 1BCOA 3GF5A 3QKJA 4OMOA 5HY6A 2Y90A 2DRKA 5IN1A 2EQKA 3H6ZA 4M7DG 2CGHA 2DERA 2HL5C 2FPEA 5LJ5d 2QA4A 3INZA 4AFUC 2MAMA 3EG1A 4KUIA 1R0CB 3GLXA 2L3PA 3X26B 3M54A 3H9NA 1TWBA 1UDLA 2EQIA 4EIKA 1O9SA 2DXUA 1OOTA 2A08A 4OMQA 3M9QA 5GANf 4ZN1A 1RACB 4J83A 4JJBA 1EIFA 1ZX6A 1FMVA 3X28B 1KC8U 1Y96A 3DLMA 3EG2A 2NUPA 1PM3A 4AG1C 1Q86U 2K5LA 2P0QA 5GAOp 4JS4A 2X4XA 3MJXA 3V8JA 2ZGWA 5L8RE 1IREB 3VV0A 4IKFA 1FX7A 1SHFA 2LCSA 3G71T 3RBBB 2MOXA
chains in the Genus database with same CATH topology
4R0KA 4AFSC 1EFNA 1GCQA 2RQWA 1PHTA 4J9EA 2K3BA 2LJ3A 2KXDA 5I11A 2VVKA 1ZLMA 2GGRA 1K1ZA 2RQUA 3NMZC 1KSWA 1JXMA 1WXUA 3VS0A 1YWPA 3EG0A 2EYYA 3EHQA 4FSSA 1JO8A 1V1CA 1HSQA 3O5ZA 4RTVA 1AZGB 1G83A 2B86A 3TSZA 3NPFA 3ULRB 2FPDA 4IIOA 1VA7A 1AZEA 2HCKA 1ZUUA 2KEAA 1JU5C 4Z88A 2CH4W 2DBKA 2JS2A 5ECAA 1K0SA 1MUZA 2YDLA 4HCKA 2X3WD 3RNJA 4D8DA 1NLOC 2O88A 1NYFA 1B3QA 1PRMC 2MIOA 2RQTA 1YN8A 3I5RA 3ZL7C 5HCKA 1RUWA 1QKWA 4LN2A 3UA6A 1W1FA 4K11A 2AZVA 1A0NB 1WX6A 4J9BA 2SEMA 2O9SA 1FYNA 1JEGA 2DYBA 2YUQA 2J6OA 1MV3A 5I22A 4RTTA 3REBB 2BZYA 1GL5A 2PZ1A 1GBQA 2KNBB 1J3TA 2KR3A 1W70A 1ZUYA 5GJVB 1U3OA 2YUNA 3EGUA 3VS2A 4J9DA 2LMJA 2EKHA 1CKBA 1NEGA 2DBMA 1AVZC 2BZXA 1NEBA 2J6FA 3A98A 2CSQA 2KRNA 4CC7A 5FW9A 1PKSA 2P4RA 1RLPC 2YT6A 2K79A 2LX7A 2V1RA 4J9HA 1AEYA 1M8MA 4E6RA 3H0HA 1OPKA 2JW4A 4OMPA 4F17A 4Z89A 1B07A 1UG1A 2JT4A 3R6NA 2YUOA 4CC3A 1X27A 2L2PA 3H0IA 2FPFA 2D8HA 2NWMA 1K0XA 4ESRA 1I0CA 4OMMA 4LUEA 1KFZA 1UECA 2LQNA 2KT1A 3VS1A 2I0NA 2O2OA 2JXBA 3FJ5A 2JM8A 2EVRA 2ED0A 2KBTA 1KJWA 1CSKA 3QWXX 4X1VA 2DL8A 1RI9A 2LNHB 1AWXA 2F2XA 1BK2A 1X6BA 3TVTA 1UUEA 2JTEA 2CT4A 1XOVA 2O9VA 2AKKA 2W0ZA 1T0HA 2RQRA 4RTYA 2CT3A 2G6FX 2EGAA 2JMAA 3C0CA 1E7OA 4M4ZA 3THKA 2PNIA 3LH5A 4JJCA 2K7AA 2HEQA 3EG3A 1NYGA 1E6GA 2A28A 3TSWA 1AWOA 2KYMA 2X3XD 2KROA 5IH2A 5L23A 1AWWA 3IQLA 1K9AA 2C0OA 4OMNA 1T3LA 2XMFA 5IHIA 1GCPA 3GBQA 2DM1A 1H92A 2J06A 2AK5A 1QWFA 2FG0A 2VKNA 2YSQA 4RTWA 1I07A 1JXOA 2D8JA 1GRIA 3VS3A 4KRTA 1LCKA 1E6HA 1SRMA 1Z9ZA 3UF4A 3JV3A 2EGCA 1OEBA 3SEMA 1RLQC 2FO0A 1WYXA 3M0QA 5EC7A 1H8KA 2ED1A 5GJWB 4HVWA 2BZ8A 1M3CA 1QCFA 1WXBA 2RN8A 1OV3A 2EGEA 2KXCA 1GFCA 1WDXA 3M0UA 1JQQA 2RMOA 2E5KA 1W6XA 1M30A 2CREA 2CSIA 2EW3A 1U06A 2JM9A 2LP5A 1ABQA 1WIEA 2KRMA 1M27C 1OPLA 2M0YA 2L3QA 1UGVA 1WA7A 2CUBA 4J9FA 1GCQC 2SRCA 3I35A 4QT7A 3PVQA 3CQTA 4CC2A 2OAWA 2K2MA 4J9GA 2DILA 5IXBA 1YP5A 2LZ6B 1GBRA 2DMOA 2GTJA 2CUDA 4IIMA 2L0AA 3M0TA 1TUDA 4LUDA 1NLPC 2MCNA 2KGTA 2H8HA 1BU1A 3VS5A 1S1NA 1UJYA 1SSHA 2GNCA 4OMLA 3H41A 2AZSA 1TUCA 5FWCA 3NHNA 2FRWA 2O31A 4CC4B 3REAB 1WXTA 1QLYA 1X2QA 2QDLA 4GLMA 5IXFA 2EYZA 2YUPA 1SEMA 1UHCA 1U5SA 2DL3A 2ENMA 2LJ0A 2KE9A 3UATA 1YWOA 1Z9QA 4AFQC 4JZ3A 1QKXA 1AD5A 2LJ1A 2CDTA 2GBQA 2DNUA 4AFZC 2A37A 4HVVA 1M3AA 1YNZA 2ECZA 1ZUKA 3PE0A 2W10A 3I9QA 1PRLC 1WFWA 1T0JA 3U23A 2CH4A 1BB9A 1GFDA 2EYWA 1UTIA 2JMCA 2D0NA 1N5ZA 4HVUA 4Z8AA 4GBQA 4HXJA 2DJQA 1HJDA 3UA7A 2IIMA 2ROLA 2J05A 5IHNA 4JZ4A 2AKLA 1X2KA 4RUGA 2DF6A 4RTUA 1UJ0A 1ARKA 4DEXA 2OJ2A 3I5SA 2VWFA 3M0PA 2K9GA 3VRZA 4LE9A 1PNJA 3EHRA 3VS7A 2GTOA 1AOJA 1M3BA 4J9CA 2DVJA 5IHKA 1WI7A 2DL4A 1T3SA 1VYTA 2JS0A 4JJDA 1KIKA 4F16A 2J7IA 2ESWA 2FRYA 2J6KA 4ZNXA 4J9IA 3SHWA 2RNAA 2HSPA 2KT8A 1BBZA 5FWBA 2M51A 2C0IA 1YCSB 1QWEA 1VYUA 2C0TA 2V1QA 4DEYA 1G2BA 4WCIA 1K4US 2RQVA 4Y92A 2KYBA 2RPNA 1FMKA 2BTTA 1NM7A 1Y57A 4A63B 2DL5A 2A36A 4OMOA 1UFFA 1IO6A 2KRSA 1X6GA 2EPDA 2L3SA 3M0RA 2DX1A 2DRKA 3VS4A 1MV0B 3QWYA 2DE0X 2NUZA 2FPEA 2DA9A 2DRMA 4D8KA 2HBWA 3PVLA 4AFUC 4LNPA 4RTXA 3EG1A 2F2VA 2PTKA 2ABLA 1X43A 2L3PA 2DL7A 3NGPA 1AWJA 1UHFA 2DLPA 1UDLA 2EQIA 4EIKA 2FEIA 3H0FA 1OOTA 2D1XA 2A08A 1PKTA 1ZSGA 4OMQA 1K76A 1Y0MA 3M0SA 1ABOA 1TG0A 1UE9A 1CKAA 2K6DA 2ROTA 1H3HA 1HD3A 2EYXA 4JJBA 3KFVA 1ZX6A 3VRYA 1VYVA 4AG2C 2LQWA 2F2WA 1SPKA 3EG2A 1SRLA 4AG1C 1WLPB 1PWTA 2OI3A 1ZBJA 1I1JA 2HDAA 4F14A 1SHGA 4JPBW 1X69A 2EBPA 4ORZA 1SHFA 2LCSA 4RTZA 3VS6A 1NG2A 3RBBB 2MOXA 2GQIA 2RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0K A;  4AFS C;  1EFN A;  1GCQ A;  2RQW A;  1PHT A;  4J9E A;  2K3B A;  2LJ3 A;  2KXD A;  5I11 A;  2VVK A;  1ZLM A;  2GGR A;  1K1Z A;  2RQU A;  3NMZ C;  1KSW A;  1JXM A;  1WXU A;  3VS0 A;  1YWP A;  3EG0 A;  2EYY A;  3EHQ A;  4FSS A;  1JO8 A;  1V1C A;  1HSQ A;  3O5Z A;  4RTV A;  1AZG B;  1G83 A;  2B86 A;  3TSZ A;  3NPF A;  3ULR B;  2FPD A;  4IIO A;  1VA7 A;  1AZE A;  2HCK A;  1ZUU A;  2KEA A;  1JU5 C;  4Z88 A;  2CH4 W;  2DBK A;  2JS2 A;  5ECA A;  1K0S A;  1MUZ A;  2YDL A;  4HCK A;  2X3W D;  3RNJ A;  4D8D A;  1NLO C;  2O88 A;  1NYF A;  1B3Q A;  1PRM C;  2MIO A;  2RQT A;  1YN8 A;  3I5R A;  3ZL7 C;  5HCK A;  1RUW A;  1QKW A;  4LN2 A;  3UA6 A;  1W1F A;  4K11 A;  2AZV A;  1A0N B;  1WX6 A;  4J9B A;  2SEM A;  2O9S A;  1FYN A;  1JEG A;  2DYB A;  2YUQ A;  2J6O A;  1MV3 A;  5I22 A;  4RTT A;  3REB B;  2BZY A;  1GL5 A;  2PZ1 A;  1GBQ A;  2KNB B;  1J3T A;  2KR3 A;  1W70 A;  1ZUY A;  5GJV B;  1U3O A;  2YUN A;  3EGU A;  3VS2 A;  4J9D A;  2LMJ A;  2EKH A;  1CKB A;  1NEG A;  2DBM A;  1AVZ C;  2BZX A;  1NEB A;  2J6F A;  3A98 A;  2CSQ A;  2KRN A;  4CC7 A;  5FW9 A;  1PKS A;  2P4R A;  1RLP C;  2YT6 A;  2K79 A;  2LX7 A;  2V1R A;  4J9H A;  1AEY A;  1M8M A;  4E6R A;  3H0H A;  1OPK A;  2JW4 A;  4OMP A;  4F17 A;  4Z89 A;  1B07 A;  1UG1 A;  2JT4 A;  3R6N A;  2YUO A;  4CC3 A;  1X27 A;  2L2P A;  3H0I A;  2FPF A;  2D8H A;  2NWM A;  1K0X A;  4ESR A;  1I0C A;  4OMM A;  4LUE A;  1KFZ A;  1UEC A;  2LQN A;  2KT1 A;  3VS1 A;  2I0N A;  2O2O A;  2JXB A;  3FJ5 A;  2JM8 A;  2EVR A;  2ED0 A;  2KBT A;  1KJW A;  1CSK A;  3QWX X;  4X1V A;  2DL8 A;  1RI9 A;  2LNH B;  1AWX A;  2F2X A;  1BK2 A;  1X6B A;  3TVT A;  1UUE A;  2JTE A;  2CT4 A;  1XOV A;  2O9V A;  2AKK A;  2W0Z A;  1T0H A;  2RQR A;  4RTY A;  2CT3 A;  2G6F X;  2EGA A;  2JMA A;  3C0C A;  1E7O A;  4M4Z A;  3THK A;  2PNI A;  3LH5 A;  4JJC A;  2K7A A;  2HEQ A;  3EG3 A;  1NYG A;  1E6G A;  2A28 A;  3TSW A;  1AWO A;  2KYM A;  2X3X D;  2KRO A;  5IH2 A;  5L23 A;  1AWW A;  3IQL A;  1K9A A;  2C0O A;  4OMN A;  1T3L A;  2XMF A;  5IHI A;  1GCP A;  3GBQ A;  2DM1 A;  1H92 A;  2J06 A;  2AK5 A;  1QWF A;  2FG0 A;  2VKN A;  2YSQ A;  4RTW A;  1I07 A;  1JXO A;  2D8J A;  1GRI A;  3VS3 A;  4KRT A;  1LCK A;  1E6H A;  1SRM A;  1Z9Z A;  3UF4 A;  3JV3 A;  2EGC A;  1OEB A;  3SEM A;  1RLQ C;  2FO0 A;  1WYX A;  3M0Q A;  5EC7 A;  1H8K A;  2ED1 A;  5GJW B;  4HVW A;  2BZ8 A;  1M3C A;  1QCF A;  1WXB A;  2RN8 A;  1OV3 A;  2EGE A;  2KXC A;  1GFC A;  1WDX A;  3M0U A;  1JQQ A;  2RMO A;  2E5K A;  1W6X A;  1M30 A;  2CRE A;  2CSI A;  2EW3 A;  1U06 A;  2JM9 A;  2LP5 A;  1ABQ A;  1WIE A;  2KRM A;  1M27 C;  1OPL A;  2M0Y A;  2L3Q A;  1UGV A;  1WA7 A;  2CUB A;  4J9F A;  1GCQ C;  2SRC A;  3I35 A;  4QT7 A;  3PVQ A;  3CQT A;  4CC2 A;  2OAW A;  2K2M A;  4J9G A;  2DIL A;  5IXB A;  1YP5 A;  2LZ6 B;  1GBR A;  2DMO A;  2GTJ A;  2CUD A;  4IIM A;  2L0A A;  3M0T A;  1TUD A;  4LUD A;  1NLP C;  2MCN A;  2KGT A;  2H8H A;  1BU1 A;  3VS5 A;  1S1N A;  1UJY A;  1SSH A;  2GNC A;  4OML A;  3H41 A;  2AZS A;  1TUC A;  5FWC A;  3NHN A;  2FRW A;  2O31 A;  4CC4 B;  3REA B;  1WXT A;  1QLY A;  1X2Q A;  2QDL A;  4GLM A;  5IXF A;  2EYZ A;  2YUP A;  1SEM A;  1UHC A;  1U5S A;  2DL3 A;  2ENM A;  2LJ0 A;  2KE9 A;  3UAT A;  1YWO A;  1Z9Q A;  4AFQ C;  4JZ3 A;  1QKX A;  1AD5 A;  2LJ1 A;  2CDT A;  2GBQ A;  2DNU A;  4AFZ C;  2A37 A;  4HVV A;  1M3A A;  1YNZ A;  2ECZ A;  1ZUK A;  3PE0 A;  2W10 A;  3I9Q A;  1PRL C;  1WFW A;  1T0J A;  3U23 A;  2CH4 A;  1BB9 A;  1GFD A;  2EYW A;  1UTI A;  2JMC A;  2D0N A;  1N5Z A;  4HVU A;  4Z8A A;  4GBQ A;  4HXJ A;  2DJQ A;  1HJD A;  3UA7 A;  2IIM A;  2ROL A;  2J05 A;  5IHN A;  4JZ4 A;  2AKL A;  1X2K A;  4RUG A;  2DF6 A;  4RTU A;  1UJ0 A;  1ARK A;  4DEX A;  2OJ2 A;  3I5S A;  2VWF A;  3M0P A;  2K9G A;  3VRZ A;  4LE9 A;  1PNJ A;  3EHR A;  3VS7 A;  2GTO A;  1AOJ A;  1M3B A;  4J9C A;  2DVJ A;  5IHK A;  1WI7 A;  2DL4 A;  1T3S A;  1VYT A;  2JS0 A;  4JJD A;  1KIK A;  4F16 A;  2J7I A;  2ESW A;  2FRY A;  2J6K A;  4ZNX A;  4J9I A;  3SHW A;  2RNA A;  2HSP A;  2KT8 A;  1BBZ A;  5FWB A;  2M51 A;  2C0I A;  1YCS B;  1QWE A;  1VYU A;  2C0T A;  2V1Q A;  4DEY A;  1G2B A;  4WCI A;  1K4U S;  2RQV A;  4Y92 A;  2KYB A;  2RPN A;  1FMK A;  2BTT A;  1NM7 A;  1Y57 A;  4A63 B;  2DL5 A;  2A36 A;  4OMO A;  1UFF A;  1IO6 A;  2KRS A;  1X6G A;  2EPD A;  2L3S A;  3M0R A;  2DX1 A;  2DRK A;  3VS4 A;  1MV0 B;  3QWY A;  2DE0 X;  2NUZ A;  2FPE A;  2DA9 A;  2DRM A;  4D8K A;  2HBW A;  3PVL A;  4AFU C;  4LNP A;  4RTX A;  3EG1 A;  2F2V A;  2PTK A;  2ABL A;  1X43 A;  2L3P A;  2DL7 A;  3NGP A;  1AWJ A;  1UHF A;  2DLP A;  1UDL A;  2EQI A;  4EIK A;  2FEI A;  3H0F A;  1OOT A;  2D1X A;  2A08 A;  1PKT A;  1ZSG A;  4OMQ A;  1K76 A;  1Y0M A;  3M0S A;  1ABO A;  1TG0 A;  1UE9 A;  1CKA A;  2K6D A;  2ROT A;  1H3H A;  1HD3 A;  2EYX A;  4JJB A;  3KFV A;  1ZX6 A;  3VRY A;  1VYV A;  4AG2 C;  2LQW A;  2F2W A;  1SPK A;  3EG2 A;  1SRL A;  4AG1 C;  1WLP B;  1PWT A;  2OI3 A;  1ZBJ A;  1I1J A;  2HDA A;  4F14 A;  1SHG A;  4JPB W;  1X69 A;  2EBP A;  4ORZ A;  1SHF A;  2LCS A;  4RTZ A;  3VS6 A;  1NG2 A;  3RBB B;  2MOX A;  2GQI A;  2RF0 A; 
#chains in the Genus database with same CATH topology
 4Q5W A;  3RMQ A;  4AFS C;  3QHS A;  4J9E A;  5CKD A;  4BDY A;  3OYD A;  3MCA B;  4PJO F;  4NL3 A;  2VVK A;  1Q81 C;  2XIC A;  2EYY A;  4M78 A;  1GXI E;  2D6F A;  4KT0 E;  4RTV A;  5GAM d;  1WJR A;  1VQO Q;  3JCM c;  3OBY A;  3ULR B;  4M7A D;  3SD4 A;  2CP0 A;  4IIO A;  4C8Q B;  1WQW A;  1VQ6 T;  4RCC A;  2KEA A;  3HFN A;  1JU5 C;  2DBK A;  2QAZ A;  4CI0 C;  4LDW A;  1MUZ A;  3BE3 A;  4HCK A;  1M1K U;  3CD6 Q;  3CMA Q;  3L2Z A;  4PJO C;  1I8F A;  5HKC A;  3JCM g;  1PRM C;  2MIO A;  2EJ9 A;  2LT4 A;  2EWN A;  1YN8 A;  6AT1 B;  3ZL7 C;  5HCK A;  1RUW A;  4LN2 A;  5LJ3 g;  1Y7X A;  1G3S A;  1W1F A;  4C5I A;  3CCM A;  1A0N B;  1AT1 B;  1WX6 A;  2HZY A;  2O4X B;  4C92 C;  4HT8 A;  1JB0 E;  3CBP A;  1Q95 G;  2P4T A;  4QVC A;  1JEG A;  2DYB A;  2YUQ A;  1V29 B;  1FXX A;  1MV3 A;  2LQK A;  5I22 A;  2F5T X;  3REB B;  2PZ1 A;  1GBQ A;  2YLB A;  4LDY A;  3KBG A;  2KR3 A;  1W70 A;  1KG1 A;  3VS2 A;  3M59 A;  1CKB A;  2X35 A;  1DJ7 B;  3JB9 F;  1PD1 A;  4BI3 A;  4LDU A;  1PKS A;  1UGS B;  2K79 A;  4E6R A;  1ZA1 B;  3QBY A;  2JW4 A;  2HAX A;  4Z89 A;  1LNX A;  3VUB A;  2L2P A;  3H0I A;  1N8R R;  2NWM A;  3HTR A;  3JCM V;  3UT1 A;  5GAN 2;  4M78 B;  4ESR A;  4OMM A;  4LUE A;  5GAO r;  2LQN A;  3CBO A;  4J6W A;  2JXB A;  3FJ5 A;  4DBQ A;  2JM8 A;  2EVR A;  3OS2 A;  4C0F A;  4O6J A;  1IGU A;  3QWX X;  4X1V A;  4RMO A;  1VQL T;  1BK2 A;  1X6B A;  3MO8 A;  1XOV A;  2O9V A;  4PLI A;  3CC4 T;  2E3I A;  2RQR A;  5GAO m;  1YJW Q;  4JJC A;  2K7A A;  1Y96 B;  2QTV A;  2RHY A;  1E6G A;  3I56 Q;  3G6E A;  1QVF P;  4KGZ B;  1K9A A;  4OMN A;  1VQN T;  2Z0W A;  1GCP A;  3CD6 A;  2DM1 A;  3E1S A;  2OTL A;  2QG9 B;  3QYG B;  3SWN C;  3FEO A;  3NFC A;  2VKN A;  4RTW A;  1JXO A;  1LCK A;  4A4E A;  1E6H A;  1SRM A;  1Z9Z A;  2FYK A;  4EDU A;  2FO0 A;  1VQ7 T;  3CCM Q;  2ED1 A;  2RD1 A;  2RJF A;  5GJW B;  5GAO q;  4HVW A;  5A0D A;  1OZ3 A;  3I56 A;  4EMG A;  2JOY A;  2KSS A;  3HL8 A;  4BAC A;  2EGE A;  4QW2 A;  3BY7 A;  2E41 A;  3JCM P;  2QI2 A;  2CZ7 B;  2WSC E;  4C92 F;  4OB0 B;  4PFO A;  1BIB A;  1JQQ A;  1K73 C;  1UGP B;  1BKB A;  3EFR A;  4XU1 A;  1ABQ A;  3WXM B;  5FRN A;  1M27 C;  1I4K 1;  1OPL A;  3M5A A;  4C0D C;  3AHU A;  3CEY A;  2GFA A;  3OA6 A;  3L2U A;  4J9F A;  3P8D A;  2SRC A;  1RAE B;  3PVQ A;  4J5Y A;  2HQX A;  4J9G A;  2K2M A;  3QDR B;  2DIL A;  2E65 A;  4PJO A;  3OYA A;  1GBR A;  4M77 D;  2CUD A;  3M0T A;  2KDS A;  3RDV A;  2YLC A;  1PG5 B;  3VS5 A;  2GQV A;  3WVE B;  2DPP B;  2MWO A;  3LLR A;  3H41 A;  3EGX A;  1D3B A;  4KGX B;  2FRW A;  4J6X A;  4CC4 B;  1M9S A;  2RA2 A;  4BUG A;  2KVQ G;  3KXT A;  2QDL A;  5IXF A;  1BCM A;  4NS5 A;  1UHC A;  3X25 B;  1KD1 U;  2OAU A;  4LD9 K;  1WZO A;  1Z9Q A;  2XG8 D;  1QKX A;  3UDC A;  2GBQ A;  2A37 A;  3S6W A;  1M3A A;  3OYJ A;  3ER0 A;  1M90 C;  2CZ1 B;  4DBH A;  1WFW A;  2RM4 A;  2R58 A;  2ZCF B;  1NJI U;  1VQ6 Q;  1VQL Q;  2D0N A;  1QVF S;  1K8A U;  5GAM e;  2IIM A;  3CC7 A;  5LJ5 e;  4A54 A;  5IHN A;  2DZ9 A;  4JZ4 A;  2AKL A;  3OBW A;  1RAG B;  1UJ0 A;  2OJ2 A;  1VQP Q;  1PD0 A;  3P8H A;  5KYX B;  1KHI A;  4II1 A;  3OYK A;  1D0Y A;  3CCE Q;  2JVV A;  1C0M A;  1YJN A;  2HL3 A;  4C5H A;  2KMT A;  4C5G A;  1T3S A;  1IXD A;  4C92 D;  1LVK A;  1WPY A;  1XTD A;  1VQ5 A;  4F7U B;  2CZ0 B;  2OX7 A;  2J6K A;  3A5Z B;  2QXF A;  2G3R A;  4FT2 A;  2BKD N;  3HFO A;  3CME T;  5GAN 3;  1Y71 A;  2HSP A;  5M9O A;  5I21 A;  5KYX A;  5FWB A;  3CC2 T;  5KYW A;  4MDX A;  4C0Z A;  4QKU A;  2NUP B;  4OGE A;  5CKB A;  1VYU A;  2V1Q A;  4XTU A;  1M4Z A;  2YRD A;  5FRM A;  1K4U S;  2RQV A;  4Y92 A;  3G1J A;  2JTM A;  3CCU Q;  2RPN A;  2LCC A;  4JS5 A;  4M75 F;  1M1K R;  2OTJ A;  1G3W A;  3M0R A;  2DX1 A;  2PQW A;  4M7A E;  1RAB B;  2RO0 A;  2VXE A;  4WTO B;  1KK7 A;  3CCQ T;  2DRM A;  4D8K A;  3QYH B;  3QXE B;  4ANJ A;  3PVL A;  1VQ7 A;  3RKX A;  2F2V A;  4OP0 A;  1WGS A;  8ATC B;  2DVE A;  4D6W A;  2FEI A;  3H0F A;  2QDY B;  4YTL A;  4RG8 A;  3PGG A;  2D1X A;  4E7K A;  1ZSG A;  1Y0M A;  1QW1 A;  4M78 D;  1UE9 A;  2K6D A;  4IUQ A;  2RI5 A;  4M75 C;  1U8R A;  4J7F A;  2EYX A;  1K9M C;  2JZ2 A;  3VRY A;  1VYV A;  3CCR A;  2CP2 A;  4M7A A;  2M02 A;  2YHT A;  2MYS A;  2OI3 A;  4FL6 A;  3CPW A;  2HDA A;  1QP3 A;  1SHG A;  1VQL A;  1VQ4 Q;  4ORZ A;  3C12 A;  5DLO A;  3VS6 A;  2K5F A;  3QUI A;  1NG2 A;  3CC7 Q;  2HMA A;  3JCM W;  1W2B P;  2ED0 A;  2RF0 A;  1U1S A;  4R0K A;  3ZEH A;  1EFN A;  3BW1 A;  2RQW A;  2RJD A;  1MMD A;  4N0A C;  2XDB A;  4JDS A;  5GAN d;  1R8O B;  5LJ3 d;  4E2F B;  4L6V 5;  1K8A C;  1K1Z A;  1NE8 A;  3NMZ C;  2V8I A;  1KSW A;  3CC2 Q;  3VS0 A;  3CCJ T;  1YWP A;  3EHQ A;  2K3X A;  1JO8 A;  3I55 T;  2NUT B;  2VB6 A;  2DK3 A;  1HSQ A;  3G6E Q;  1VQ5 Q;  2FPD A;  1I5O B;  2ATC B;  1VQ9 Q;  1WHK A;  2O88 A;  2P84 A;  4AT1 B;  1O75 A;  1G5V A;  3GNF B;  3RUX A;  2YRC A;  1VQM A;  2DTH A;  2PUK B;  4BE2 A;  2AZV A;  2RH2 A;  5C0M A;  4C0G A;  1BYM A;  2KI7 A;  3EFS A;  2O9S A;  3NTK A;  4BB7 A;  5GMK h;  2COW A;  3M4G A;  4HCB A;  4M77 G;  1UGQ B;  2BZY A;  3JSC A;  2KNB B;  1HYO A;  1J3T A;  1D3B B;  1YI2 T;  4A4H A;  5GJV B;  1VQ7 Q;  3EGU A;  4J9D A;  2LMJ A;  2EKH A;  1NEG A;  2DBM A;  2E6N A;  2BZX A;  1JJ2 A;  2KRN A;  4NOY A;  4N4H A;  3VKI A;  2R5M A;  5FW9 A;  3PIO A;  2M9U A;  3MP8 A;  2YT6 A;  2QGG A;  2E3H A;  3HPW A;  4J9H A;  4Y28 E;  7AT1 B;  1OPK A;  2L5Q A;  2YRV A;  3E9F A;  4F17 A;  1B07 A;  2F1L A;  1UG1 A;  2JT4 A;  3A8M B;  1K73 U;  1TXQ A;  4ELY C;  2AHJ B;  2QA4 T;  4C8Q C;  4BI8 B;  3OW2 S;  1K0X A;  1N9S A;  1UEC A;  2VUB A;  3VS1 A;  1NPP A;  2I0N A;  3M4Y A;  4M7A F;  2KBT A;  1M2V B;  2MF2 A;  1D1A A;  3G4S T;  1CSK A;  5LJ5 f;  1AWX A;  1W2B A;  1VQ4 A;  4E7Z A;  1S72 A;  3TVT A;  4J6Y A;  2WSF E;  3Q1J A;  5CCA A;  1T0H A;  1BI0 A;  4C8Q D;  2G6F X;  1WHL A;  3C0C A;  3OYB A;  1YIT T;  1RAD B;  2PNI A;  3LX7 A;  5CR2 A;  1SG5 A;  3LH5 A;  1MND A;  1TUG B;  5GAM j;  5GAN g;  4RCB A;  2A28 A;  2IPO B;  4OF1 A;  3G4S A;  3OYF A;  3CCM T;  5IH2 A;  2HKN A;  2C0O A;  1T3L A;  5GAM h;  3HRU A;  4IUV A;  3EGD B;  4MML A;  1H92 A;  2J06 A;  3RER A;  2LTO A;  2K5I A;  3CXC A;  1VQK T;  4XU0 A;  2M0O A;  4M78 F;  4B9X A;  5LJ3 h;  3VS3 A;  4EMK A;  1M1G A;  4QVD A;  5FU6 C;  4KUD K;  4E47 A;  2BZ8 A;  1OV3 A;  3G6E T;  2KXC A;  1ZHI A;  1M2O A;  3TU4 K;  3M56 A;  3CCV A;  2CS7 A;  2PUO B;  5J26 A;  4M78 C;  2CRE A;  2CSI A;  2JM9 A;  5DM7 R;  2CZ6 B;  2A0F B;  5C6S A;  3E9G A;  4PLL A;  1VQP T;  4QQD A;  2L8D A;  3HSB A;  4DA4 A;  2CUB A;  3I35 A;  1VQO A;  3CCE T;  4CC2 A;  5GAN 4;  3FLG A;  2OAW A;  4PFP A;  4LDX A;  2DTO A;  1OI1 A;  4XTV A;  2X4J A;  1Q82 U;  2GTJ A;  2E1H A;  2L0A A;  2OTJ T;  4LUD A;  1BU1 A;  1WJQ A;  1UJY A;  2GNC A;  1YI2 Q;  4FYX B;  2EKO A;  1F1B B;  1BI1 A;  2CP5 A;  1JRI A;  2O31 A;  4ZTF A;  3REA B;  3CCE A;  1QLY A;  1TH7 A;  1M2V A;  1X2Q A;  2MPX C;  1YJN Q;  3NTH A;  1LPL A;  4PJL A;  4EPC A;  2XK0 A;  3EAE A;  3S3O A;  1NPR A;  4X9C A;  3MP6 A;  1AHJ B;  2LJ0 A;  2IVW A;  3UAT A;  1QQJ A;  1YIJ A;  3JCM X;  1WHJ A;  5KYY B;  3OYL A;  4N4G A;  2CDT A;  4M75 D;  3OYH A;  1I5L A;  3CCR Q;  2RI2 A;  2P0P A;  1YNZ A;  4BI4 A;  4XQ3 A;  3PE0 A;  1YJ9 T;  1PRL C;  5D6W A;  1VUB A;  3U23 A;  2FHD A;  3G4S Q;  2CH4 A;  3N5B B;  1GFD A;  1UTI A;  3DB4 A;  1N5Z A;  3M55 A;  4Z8A A;  3EGD A;  1HJD A;  1YHQ Q;  3PMT A;  3P8B B;  3A8O B;  1YIJ Q;  3J7A F;  5EG2 A;  2RHZ A;  4RUG A;  4ATO A;  5GMK j;  1ARK A;  3I5S A;  2QQB A;  2DO3 A;  2VAS A;  3JB9 D;  2K9G A;  4MDW A;  4LE9 A;  4KBM B;  3VS7 A;  4LDV A;  2VYT A;  5IHK A;  5J3B A;  4FYW B;  1S72 Q;  1YBY A;  2JS0 A;  3RES A;  2KQW A;  3CCU T;  1N9R A;  3JB9 G;  2WAC A;  2J7I A;  4ZNX A;  2FRY A;  2HQE A;  5GAO n;  3CMA T;  3QG1 A;  3SHW A;  2ZPI B;  2RNA A;  4MZT A;  1WHH A;  2KT8 A;  1R77 A;  1C6V X;  4HT9 A;  3CCL A;  2MI6 A;  5CKF A;  1M90 U;  5KCO A;  3I55 Q;  4L5G A;  1YIT A;  4F7U G;  3CCQ Q;  2RHU A;  5FLX E;  2C0T A;  3L42 A;  2XD0 A;  4OB1 B;  1YJN T;  1QCN A;  4B6M A;  4WCI A;  2EIF A;  4M7D C;  3LGF A;  1OZ2 A;  2KYB A;  2VXF A;  5LJ5 j;  1VQ9 T;  3SDZ A;  2E64 A;  3QZ9 B;  1ZSZ C;  4A63 B;  2DL5 A;  5GAN j;  1FMW A;  1PSE A;  3MEW A;  2KRS A;  1XQH A;  1OUL A;  4IUT A;  4ZGD B;  1JBM A;  1IB8 A;  2EQJ A;  1PCX A;  2LNV A;  3CCL T;  1SKU B;  2FB7 A;  2HBW A;  2YWW A;  1VOM A;  4LNP A;  4PFZ A;  1N27 A;  2LT1 A;  3CCQ A;  2ABL A;  3SB2 A;  2DL7 A;  4M7A C;  3WVD B;  2PVD B;  1X75 C;  3CCU A;  2XI9 A;  4A53 A;  2M1H A;  4B9W A;  3MKD A;  3OYE A;  1PKT A;  3JCM h;  1K76 A;  2CYZ B;  1TG0 A;  5GAM g;  1CKA A;  2F5K A;  2RB6 A;  5I2M A;  2ROT A;  4DBF A;  1K8A R;  1YHQ T;  3KFV A;  2BE7 D;  2CKK A;  2E4H A;  2X51 A;  3FRN A;  3LWI A;  3OYI A;  2F2W A;  1SPK A;  1MHN A;  3LW5 E;  5CQX A;  2XHC A;  1WLP B;  1D0Z A;  1PWT A;  2QQ9 A;  1ZBJ A;  3L2V A;  3CCJ Q;  1SSF A;  3JB9 J;  3JCM b;  4C92 G;  3C94 A;  4OB3 B;  1VQ5 T;  2QAS A;  1ZA2 B;  2FZC B;  1ZQ1 A;  5GAN 5;  2LC4 A;  3DLL A;  5KH6 A;  1EX4 A;  3VYG A;  1RAA B;  2PVO B;  5GAN h;  1KD1 C;  1YJW T;  2KXD A;  2YXY A;  1ZLM A;  2RI3 A;  4X34 A;  3GIB A;  3JRZ A;  3OYN A;  4ZGJ B;  3CCR T;  2ZPH B;  3OS0 A;  3EG0 A;  4PK4 A;  3FDR A;  4JJN K;  3C4S A;  4VUB A;  2LDM A;  1RAI B;  1V1C A;  4JRK A;  3CCJ A;  2HQH A;  3TCJ A;  1AZG B;  1MNE A;  4OGC A;  1N6A A;  2B86 A;  3TSZ A;  4EMK C;  5DLQ E;  1VA7 A;  2HCK A;  1ZUU A;  2CH4 W;  2JS2 A;  2YDL A;  2H3E B;  4XU2 A;  2X3W D;  1PSF A;  2NLU A;  1NLO C;  4N4I A;  2HBP A;  3GPL A;  3OSV A;  5IAY A;  2BE9 B;  1NJI R;  2VV5 A;  3I5R A;  3A8H B;  1QKW A;  4WF2 A;  4ZN3 A;  1R0B G;  1UEB A;  2KY9 A;  5FU7 B;  3LH0 A;  4J9B A;  5DY9 A;  5CIU A;  2VC8 A;  1NBE B;  3V7S A;  4GLK A;  2E70 A;  2K4Y A;  3PT9 A;  5GAN 7;  3J80 E;  1Q81 R;  1WJS A;  4RTT A;  1GL5 A;  3HRT A;  5IT9 E;  1ZUY A;  3DKM A;  5GAN 8;  1U3O A;  3ASK A;  1G3Y A;  3MP1 A;  1SF9 A;  5LJ3 e;  1JJ2 S;  1NEB A;  2J6F A;  5GAN e;  4M7D B;  2CSQ A;  1ZBX A;  3M57 A;  3O8V A;  2P4R A;  1OYX A;  3UWN A;  1AEY A;  4XAX B;  3VUZ A;  3GNG A;  3R6N A;  2YUO A;  4UC4 A;  1X27 A;  2FPF A;  2QEX A;  1C1A A;  2XU8 A;  1I0C A;  3I55 A;  1KFZ A;  1YIT Q;  2KT1 A;  1H64 1;  3OYC A;  2DEQ A;  4R55 A;  1YJ9 Q;  1XJW B;  4O5V A;  5AT1 B;  1KJW A;  3X20 B;  5CAI A;  2DL8 A;  1W2B S;  1U1T A;  2F2X A;  4LD6 A;  1UUE A;  3MHX A;  2OTJ Q;  2CT4 A;  2AKK A;  4RKU E;  2W0Z A;  2CT3 A;  1K73 R;  2EGA A;  1E7O A;  5GMK e;  3THK A;  5LJ5 g;  1ZSZ B;  4XTX A;  3EFO A;  4J7I A;  1KQ2 A;  1M8V A;  5CVI A;  2HEQ A;  3EG3 A;  1IZ6 A;  3PTA A;  3TSW A;  1AWO A;  2KYM A;  2O4X A;  3PIP A;  2X3X D;  5CKH A;  2DEU A;  4BY6 B;  4FIB A;  1VQO T;  2DYI A;  2H3J A;  1M1F A;  2XMF A;  3GBQ A;  5IHI A;  4F7U E;  2AIR B;  3JB9 H;  3C95 A;  5D6X A;  2AK5 A;  2QEX T;  2FG0 A;  2YSQ A;  1N8R U;  3CD6 T;  1I07 A;  2D8J A;  3FJP A;  1Q82 R;  1GRI A;  1RL2 A;  4ELZ C;  5FU6 B;  2GF7 A;  3JV3 A;  1OEB A;  3SEM A;  3JCM f;  1WYX A;  3M0Q A;  3D7S B;  4PJO E;  3VYH B;  3JB9 I;  5GAO l;  4E7L A;  1WXB A;  2RN8 A;  4HCC A;  2ZPG B;  1WDX A;  1KQS A;  1FWZ A;  4F7U A;  1NZ9 A;  3QDF A;  2DKG A;  2RMO A;  3V8K A;  1W6X A;  1M30 A;  2CP6 A;  2VGM A;  3J81 E;  2E5Q A;  2EYQ A;  2XID A;  1U06 A;  3V7R A;  1OU9 A;  2LP5 A;  3CC2 A;  2EJG A;  5HK3 A;  2JJ9 A;  2M0Y A;  3CCL Q;  1QVP A;  5FU7 C;  2DXC A;  2DXT A;  3GP8 A;  1GCQ C;  3JCM J;  5I2S A;  4PL6 A;  4E7H A;  2D9T A;  4OB2 B;  3QO3 A;  1VQ9 A;  4JRQ A;  5KCH A;  2LZ6 B;  4DBR A;  2LQ8 A;  2DMO A;  1QP2 A;  3JCM Q;  1K9M U;  1TUD A;  1NLP C;  5D6Y A;  1D1C A;  3UPU A;  3OY9 A;  4KUL A;  1TUC A;  1Q7Y R;  1HXD A;  2EFI A;  2HNI A;  3H8Z A;  4M78 G;  3CPW S;  4M77 A;  2RHX A;  4GLM A;  2EYZ A;  2YUP A;  2A7Y A;  1YJ9 A;  4C8Q G;  3PNW C;  1U5S A;  1TOV A;  2QQR A;  5LJ3 j;  2DL3 A;  2ENM A;  3CC4 Q;  3EH1 A;  2QQA A;  1YWO A;  3FC3 A;  3R6O A;  4JZ3 A;  1AD5 A;  2LJ1 A;  1XNI A;  1YIJ T;  3RIR A;  2DNU A;  4XTZ A;  4AFZ C;  4OVA A;  3OS5 A;  1VIF A;  3OW2 P;  4HVV A;  4L59 A;  1KD1 R;  2EQM A;  2XDD A;  3LGL A;  4LXC A;  2ECZ A;  1ZUK A;  2ZPE B;  4KGV B;  2K57 A;  3A1P A;  1KC8 C;  3X24 B;  1IHW A;  3OMC A;  2F69 A;  1D1B A;  2HSE B;  2R57 A;  1NJI C;  4GBQ A;  1QVF A;  1X6O A;  4HXJ A;  1MMA A;  2KK4 A;  1IHV A;  4A4K A;  1QMC A;  2NYS A;  3CCS Q;  3RR6 A;  2J05 A;  1X2K A;  2DF6 A;  4C92 A;  4RTU A;  3OS1 A;  3MEU A;  2RHI A;  4JRI A;  4F7U F;  3S3M A;  3M0P A;  3VRZ A;  1VQM T;  4E7I A;  3EHR A;  2GTO A;  4J9C A;  4PJM A;  2KAF A;  2DET A;  2DVJ A;  4BDZ A;  2CP3 A;  1RAF B;  1VYT A;  4JJD A;  1QVG P;  1YHQ A;  3JAM E;  1KIK A;  8AT1 B;  4F16 A;  2ESW A;  3BFM A;  3G71 A;  2FZG B;  3EGX B;  2LVM A;  2MK5 A;  2BUD A;  1BBZ A;  2R5A A;  2LX9 A;  4FCY A;  4C92 E;  1K9M R;  4M7A G;  3RKW A;  2C0I A;  1YCS B;  3URG A;  1QWE A;  3TEE A;  3QJY A;  1G2B A;  4FW2 A;  4N0A A;  5FRO A;  4AMC A;  3NTI A;  1FMK A;  1VQ8 Q;  5CKE A;  3OMG A;  3CXC S;  1UB4 A;  1UFF A;  1IO6 A;  3QZ5 B;  4DOV A;  1X6G A;  5KYY A;  2EPD A;  2L3S A;  2E10 A;  3VS4 A;  1MV0 B;  1TSF A;  3QWY A;  2DE0 X;  2BIV A;  4IUP A;  2RJE A;  2NUZ A;  3TQ7 P;  2DA9 A;  4RG2 A;  1YJW A;  2WSE E;  4RTX A;  2RK2 A;  3JCM d;  2PTK A;  4M78 E;  1X43 A;  3NGP A;  1AWJ A;  1UHF A;  2DLP A;  2Y4X A;  1Q86 C;  3CCV Q;  1VQ4 T;  1KQS S;  3E2U A;  2XKO C;  1Q7Y U;  4M75 G;  2EQU A;  5AYF A;  3M0S A;  1ABO A;  3OQ5 A;  1H3H A;  3FB9 A;  2C06 A;  1HD3 A;  4AG2 C;  2LQW A;  1G3T A;  3QPH A;  4GY5 A;  1SRL A;  2FL7 A;  5J39 A;  1WNL A;  1I1J A;  5GAM f;  4F14 A;  4JPB W;  1RAH B;  1X69 A;  4MZP A;  4M77 F;  2EBP A;  1Q82 C;  1M1K C;  4RTZ A;  4PJO G;  3QJ6 A;  4M7D D;  4FT4 A;  3EG9 B;  4FYY B;  2GQI A;  1PC0 A;  1YI2 A;  2HKQ B;  1GCQ A;  1PHT A;  2K3B A;  4EMK B;  2LJ3 A;  3CME A;  5I11 A;  2GGR A;  3PMI A;  2RQU A;  1JXM A;  1OU8 A;  1WXU A;  4JRP A;  4FSS A;  4Y91 A;  3O5Z A;  3L2Q A;  4XK8 E;  1G83 A;  3NPF A;  4A4G A;  4QQG A;  1S72 T;  1AZE A;  3V8L A;  4Z88 A;  5ECA A;  3SWN A;  1K0S A;  3MEA A;  9ATC B;  3F70 A;  2P0K A;  1TS9 A;  3RNJ A;  4D8D A;  1NYF A;  1B3Q A;  2MMP A;  3LWH A;  3CCS T;  4QQ6 A;  2RQT A;  3ME9 A;  1VIE A;  2GCX A;  3ZBD A;  4OMF B;  3UA6 A;  4TVR A;  3HRS A;  4K11 A;  1BI3 A;  1TU0 B;  2E12 A;  4M7D A;  1KHC A;  2SEM A;  1FYN A;  4BE0 A;  2QQS A;  3MEV A;  2J6O A;  4E7J A;  3OYM A;  4PJJ A;  1OX9 A;  2RJC A;  2O01 E;  2OTL T;  5A0L A;  4XU3 A;  1VQ8 A;  3DB3 A;  3CCS A;  2A3L A;  1YFN A;  2YUN A;  4FYV B;  3A8L B;  1TTH B;  2QA4 Q;  3OSS C;  5GMK i;  1AVZ C;  3A98 A;  5LL6 S;  1Q7Y C;  2K2V A;  3MPU B;  4CC7 A;  3CXC P;  2COZ A;  1B7T A;  1RLP C;  2LX7 A;  4ZTJ A;  2V1R A;  4R56 A;  1Q86 R;  1M8M A;  3H0H A;  4J8O A;  1VQ8 T;  4PJO B;  4OMP A;  3GOX A;  3OB9 A;  1I81 A;  3G71 Q;  1VQ6 A;  4PJO D;  1D09 B;  4IUR A;  4CC3 A;  2V8J A;  5GMK m;  3JCM e;  2D8H A;  5KE2 A;  4DOW A;  2ZAE A;  4PNO A;  1YCY A;  2O2O A;  4P5N A;  4C8Q E;  2RK1 A;  5CQY A;  4IUU A;  1RI9 A;  2LNH B;  3CBM A;  3CPF A;  4M77 C;  4ME7 A;  2JTE A;  1VQN A;  1HK9 A;  1KC8 R;  1BI2 A;  1RI0 A;  3L2R A;  4RTY A;  2QEX Q;  2JMA A;  3RKY A;  3TRE A;  4M4Z A;  3SFM A;  3EH2 A;  5CO7 A;  4C5E A;  2JUF A;  2LCL A;  1N8R C;  5KYU B;  1EZZ B;  2M16 A;  2DJZ A;  2LRQ A;  1NYG A;  1M5Q 1;  2KRO A;  2Y4Y A;  5L23 A;  4C8Q A;  2DIQ A;  1OQK A;  1IRX A;  3IQL A;  1QVG S;  1AWW A;  3OYG A;  1MMG A;  2DZC A;  1QWF A;  2EJF A;  3CMA A;  4C92 B;  1QCO A;  2X4W A;  3EFO B;  2AT1 B;  4KRT A;  2DD4 A;  3UF4 A;  1JJ2 P;  2EGC A;  4E7S A;  1RLQ C;  4NL2 A;  4BD3 A;  3ZFJ A;  5EC7 A;  2K3Y A;  1H8K A;  3I56 T;  3LYI A;  1Y07 A;  2X4Y A;  3PFS A;  4V2S A;  4X9D A;  4M77 B;  5A2Q E;  1M3C A;  1QCF A;  5HK0 A;  5CK9 A;  5GMK l;  1GFC A;  2HD0 A;  3L2W A;  5KYN A;  2XDP A;  3M0U A;  3RMS A;  1VQK Q;  4M7D F;  1B34 A;  4HA8 A;  2E5K A;  2JNG A;  2EAY A;  2DAQ A;  2EW3 A;  1WIE A;  1MGQ A;  2KRM A;  2DFU A;  5GAN 6;  2L3Q A;  1BIA A;  2E6Z A;  1UGV A;  1WA7 A;  4FW1 A;  4ZGE B;  2V8K A;  1IGQ A;  5KYW B;  4QT7 A;  2JN0 A;  5LJ5 h;  3CQT A;  2GFU A;  1OX8 A;  5IXB A;  1YP5 A;  2FVU A;  4A4F A;  2DD5 A;  1QVG A;  4XTW A;  4JUV A;  4C0D B;  4IIM A;  1WHG A;  1H3Z A;  3BDU A;  2MCN A;  2KGT A;  2H8H A;  2COY A;  2OTL Q;  1S1N A;  2PU9 B;  1LOJ A;  1SSH A;  4OML A;  2AZS A;  5FWC A;  3NHN A;  2ZPB B;  4FU6 A;  1WXT A;  1KQ1 A;  4HCZ A;  2PVG B;  2B8A A;  2V26 A;  4PKC C;  3T9N A;  2DIG A;  1W4S A;  4Z02 A;  1SEM A;  2I2L A;  3FIF A;  4M75 E;  5LJ3 f;  1Q81 U;  2VGN A;  4QVZ A;  3HP9 A;  2KE9 A;  3MET A;  4AFQ C;  3G7Z A;  4C8Q F;  4M7A B;  2QGF B;  3HKS A;  3CPW P;  3A8G B;  2QYZ A;  1X01 A;  2JTF A;  3OW2 A;  4EMH A;  3AT1 B;  5KE3 A;  1MMN A;  3V7C A;  1VQP A;  1ZSZ A;  2W10 A;  3I9Q A;  4CRI A;  4BE1 A;  1T0J A;  1V76 A;  4JLI A;  1VQM Q;  1BB9 A;  2EYW A;  3KUF A;  4FM4 B;  4MZM A;  2ZZD A;  2JMC A;  3VJP A;  3EG9 A;  4M75 A;  1LJO A;  3CC4 A;  2L89 A;  3L1A A;  4HVU A;  2IG0 A;  3CC7 T;  2QTX A;  3BDL A;  2DJQ A;  2CP7 A;  3UA7 A;  1P92 A;  5A0G A;  3QSU A;  2ROL A;  3S3N A;  2L3R A;  4DEX A;  2MWP A;  4M77 E;  2VWF A;  4DQ2 A;  4XTY A;  3M58 A;  5KYU A;  2FZK B;  3OYY A;  4F04 B;  1PNJ A;  4M75 B;  1UGR B;  1WQ7 A;  1M3B A;  1AOJ A;  1ACM B;  4KH0 B;  1WI7 A;  2DL4 A;  1M90 R;  2ZPF B;  2X9H A;  1VQN Q;  2D0Q B;  1B34 B;  4FSX A;  1VQK A;  4J9I A;  3SWN B;  5D7U A;  1D0X A;  2QK0 A;  3QII A;  4KH1 B;  2M51 A;  3M53 A;  4HKE A;  1G8X A;  4M7D E;  4BY6 C;  2NUT A;  3E19 A;  3HHT B;  4PJN A;  2DXB A;  1WHM A;  4DEY A;  2DTI A;  4JLG A;  1KQS P;  4MMK A;  3CCV T;  2BTT A;  1NM7 A;  1Y57 A;  3VU3 C;  3CME Q;  2A36 A;  1BCO A;  3GF5 A;  3QKJ A;  4OMO A;  5HY6 A;  2Y90 A;  2DRK A;  5IN1 A;  2EQK A;  3H6Z A;  4M7D G;  2CGH A;  2DER A;  2HL5 C;  2FPE A;  5LJ5 d;  2QA4 A;  3INZ A;  4AFU C;  2MAM A;  3EG1 A;  4KUI A;  1R0C B;  3GLX A;  2L3P A;  3X26 B;  3M54 A;  3H9N A;  1TWB A;  1UDL A;  2EQI A;  4EIK A;  1O9S A;  2DXU A;  1OOT A;  2A08 A;  4OMQ A;  3M9Q A;  5GAN f;  4ZN1 A;  1RAC B;  4J83 A;  4JJB A;  1EIF A;  1ZX6 A;  1FMV A;  3X28 B;  1KC8 U;  1Y96 A;  3DLM A;  3EG2 A;  2NUP A;  1PM3 A;  4AG1 C;  1Q86 U;  2K5L A;  2P0Q A;  5GAO p;  4JS4 A;  2X4X A;  3MJX A;  3V8J A;  2ZGW A;  5L8R E;  1IRE B;  3VV0 A;  4IKF A;  1FX7 A;  1SHF A;  2LCS A;  3G71 T;  3RBB B;  2MOX A; 
#chains in the Genus database with same CATH homology
 4R0K A;  4AFS C;  1EFN A;  1GCQ A;  2RQW A;  1PHT A;  4J9E A;  2K3B A;  2LJ3 A;  2KXD A;  5I11 A;  2VVK A;  1ZLM A;  2GGR A;  1K1Z A;  2RQU A;  3NMZ C;  1KSW A;  1JXM A;  1WXU A;  3VS0 A;  1YWP A;  3EG0 A;  2EYY A;  3EHQ A;  4FSS A;  1JO8 A;  1V1C A;  1HSQ A;  3O5Z A;  4RTV A;  1AZG B;  1G83 A;  2B86 A;  3TSZ A;  3NPF A;  3ULR B;  2FPD A;  4IIO A;  1VA7 A;  1AZE A;  2HCK A;  1ZUU A;  2KEA A;  1JU5 C;  4Z88 A;  2CH4 W;  2DBK A;  2JS2 A;  5ECA A;  1K0S A;  1MUZ A;  2YDL A;  4HCK A;  2X3W D;  3RNJ A;  4D8D A;  1NLO C;  2O88 A;  1NYF A;  1B3Q A;  1PRM C;  2MIO A;  2RQT A;  1YN8 A;  3I5R A;  3ZL7 C;  5HCK A;  1RUW A;  1QKW A;  4LN2 A;  3UA6 A;  1W1F A;  4K11 A;  2AZV A;  1A0N B;  1WX6 A;  4J9B A;  2SEM A;  2O9S A;  1FYN A;  1JEG A;  2DYB A;  2YUQ A;  2J6O A;  1MV3 A;  5I22 A;  4RTT A;  3REB B;  2BZY A;  1GL5 A;  2PZ1 A;  1GBQ A;  2KNB B;  1J3T A;  2KR3 A;  1W70 A;  1ZUY A;  5GJV B;  1U3O A;  2YUN A;  3EGU A;  3VS2 A;  4J9D A;  2LMJ A;  2EKH A;  1CKB A;  1NEG A;  2DBM A;  1AVZ C;  2BZX A;  1NEB A;  2J6F A;  3A98 A;  2CSQ A;  2KRN A;  4CC7 A;  5FW9 A;  1PKS A;  2P4R A;  1RLP C;  2YT6 A;  2K79 A;  2LX7 A;  2V1R A;  4J9H A;  1AEY A;  1M8M A;  4E6R A;  3H0H A;  1OPK A;  2JW4 A;  4OMP A;  4F17 A;  4Z89 A;  1B07 A;  1UG1 A;  2JT4 A;  3R6N A;  2YUO A;  4CC3 A;  1X27 A;  2L2P A;  3H0I A;  2FPF A;  2D8H A;  2NWM A;  1K0X A;  4ESR A;  1I0C A;  4OMM A;  4LUE A;  1KFZ A;  1UEC A;  2LQN A;  2KT1 A;  3VS1 A;  2I0N A;  2O2O A;  2JXB A;  3FJ5 A;  2JM8 A;  2EVR A;  2ED0 A;  2KBT A;  1KJW A;  1CSK A;  3QWX X;  4X1V A;  2DL8 A;  1RI9 A;  2LNH B;  1AWX A;  2F2X A;  1BK2 A;  1X6B A;  3TVT A;  1UUE A;  2JTE A;  2CT4 A;  1XOV A;  2O9V A;  2AKK A;  2W0Z A;  1T0H A;  2RQR A;  4RTY A;  2CT3 A;  2G6F X;  2EGA A;  2JMA A;  3C0C A;  1E7O A;  4M4Z A;  3THK A;  2PNI A;  3LH5 A;  4JJC A;  2K7A A;  2HEQ A;  3EG3 A;  1NYG A;  1E6G A;  2A28 A;  3TSW A;  1AWO A;  2KYM A;  2X3X D;  2KRO A;  5IH2 A;  5L23 A;  1AWW A;  3IQL A;  1K9A A;  2C0O A;  4OMN A;  1T3L A;  2XMF A;  5IHI A;  1GCP A;  3GBQ A;  2DM1 A;  1H92 A;  2J06 A;  2AK5 A;  1QWF A;  2FG0 A;  2VKN A;  2YSQ A;  4RTW A;  1I07 A;  1JXO A;  2D8J A;  1GRI A;  3VS3 A;  4KRT A;  1LCK A;  1E6H A;  1SRM A;  1Z9Z A;  3UF4 A;  3JV3 A;  2EGC A;  1OEB A;  3SEM A;  1RLQ C;  2FO0 A;  1WYX A;  3M0Q A;  5EC7 A;  1H8K A;  2ED1 A;  5GJW B;  4HVW A;  2BZ8 A;  1M3C A;  1QCF A;  1WXB A;  2RN8 A;  1OV3 A;  2EGE A;  2KXC A;  1GFC A;  1WDX A;  3M0U A;  1JQQ A;  2RMO A;  2E5K A;  1W6X A;  1M30 A;  2CRE A;  2CSI A;  2EW3 A;  1U06 A;  2JM9 A;  2LP5 A;  1ABQ A;  1WIE A;  2KRM A;  1M27 C;  1OPL A;  2M0Y A;  2L3Q A;  1UGV A;  1WA7 A;  2CUB A;  4J9F A;  1GCQ C;  2SRC A;  3I35 A;  4QT7 A;  3PVQ A;  3CQT A;  4CC2 A;  2OAW A;  2K2M A;  4J9G A;  2DIL A;  5IXB A;  1YP5 A;  2LZ6 B;  1GBR A;  2DMO A;  2GTJ A;  2CUD A;  4IIM A;  2L0A A;  3M0T A;  1TUD A;  4LUD A;  1NLP C;  2MCN A;  2KGT A;  2H8H A;  1BU1 A;  3VS5 A;  1S1N A;  1UJY A;  1SSH A;  2GNC A;  4OML A;  3H41 A;  2AZS A;  1TUC A;  5FWC A;  3NHN A;  2FRW A;  2O31 A;  4CC4 B;  3REA B;  1WXT A;  1QLY A;  1X2Q A;  2QDL A;  4GLM A;  5IXF A;  2EYZ A;  2YUP A;  1SEM A;  1UHC A;  1U5S A;  2DL3 A;  2ENM A;  2LJ0 A;  2KE9 A;  3UAT A;  1YWO A;  1Z9Q A;  4AFQ C;  4JZ3 A;  1QKX A;  1AD5 A;  2LJ1 A;  2CDT A;  2GBQ A;  2DNU A;  4AFZ C;  2A37 A;  4HVV A;  1M3A A;  1YNZ A;  2ECZ A;  1ZUK A;  3PE0 A;  2W10 A;  3I9Q A;  1PRL C;  1WFW A;  1T0J A;  3U23 A;  2CH4 A;  1BB9 A;  1GFD A;  2EYW A;  1UTI A;  2JMC A;  2D0N A;  1N5Z A;  4HVU A;  4Z8A A;  4GBQ A;  4HXJ A;  2DJQ A;  1HJD A;  3UA7 A;  2IIM A;  2ROL A;  2J05 A;  5IHN A;  4JZ4 A;  2AKL A;  1X2K A;  4RUG A;  2DF6 A;  4RTU A;  1UJ0 A;  1ARK A;  4DEX A;  2OJ2 A;  3I5S A;  2VWF A;  3M0P A;  2K9G A;  3VRZ A;  4LE9 A;  1PNJ A;  3EHR A;  3VS7 A;  2GTO A;  1AOJ A;  1M3B A;  4J9C A;  2DVJ A;  5IHK A;  1WI7 A;  2DL4 A;  1T3S A;  1VYT A;  2JS0 A;  4JJD A;  1KIK A;  4F16 A;  2J7I A;  2ESW A;  2FRY A;  2J6K A;  4ZNX A;  4J9I A;  3SHW A;  2RNA A;  2HSP A;  2KT8 A;  1BBZ A;  5FWB A;  2M51 A;  2C0I A;  1YCS B;  1QWE A;  1VYU A;  2C0T A;  2V1Q A;  4DEY A;  1G2B A;  4WCI A;  1K4U S;  2RQV A;  4Y92 A;  2KYB A;  2RPN A;  1FMK A;  2BTT A;  1NM7 A;  1Y57 A;  4A63 B;  2DL5 A;  2A36 A;  4OMO A;  1UFF A;  1IO6 A;  2KRS A;  1X6G A;  2EPD A;  2L3S A;  3M0R A;  2DX1 A;  2DRK A;  3VS4 A;  1MV0 B;  3QWY A;  2DE0 X;  2NUZ A;  2FPE A;  2DA9 A;  2DRM A;  4D8K A;  2HBW A;  3PVL A;  4AFU C;  4LNP A;  4RTX A;  3EG1 A;  2F2V A;  2PTK A;  2ABL A;  1X43 A;  2L3P A;  2DL7 A;  3NGP A;  1AWJ A;  1UHF A;  2DLP A;  1UDL A;  2EQI A;  4EIK A;  2FEI A;  3H0F A;  1OOT A;  2D1X A;  2A08 A;  1PKT A;  1ZSG A;  4OMQ A;  1K76 A;  1Y0M A;  3M0S A;  1ABO A;  1TG0 A;  1UE9 A;  1CKA A;  2K6D A;  2ROT A;  1H3H A;  1HD3 A;  2EYX A;  4JJB A;  3KFV A;  1ZX6 A;  3VRY A;  1VYV A;  4AG2 C;  2LQW A;  2F2W A;  1SPK A;  3EG2 A;  1SRL A;  4AG1 C;  1WLP B;  1PWT A;  2OI3 A;  1ZBJ A;  1I1J A;  2HDA A;  4F14 A;  1SHG A;  4JPB W;  1X69 A;  2EBP A;  4ORZ A;  1SHF A;  2LCS A;  4RTZ A;  3VS6 A;  1NG2 A;  3RBB B;  2MOX A;  2GQI A;  2RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...