3H0HA

Human fyn sh3 domain r96i mutant, crystal form i
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
GGTGVTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
total genus 10
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0hA00
2FO0A 1ZLMA 1PRMC 2GNCA 3M0SA 1YNZA 2CUBA 4Z8AA 4OMQA 2HBWA 3EGUA 2EVRA 1I1JA 2AZSA 2BTTA 2L3QA 4AG2C 1ZX6A 2GTJA 2X3WD 1OV3A 4AFQC 2DX1A 2EW3A 1K0XA 2CSIA 1UG1A 1JXOA 1X43A 1KJWA 2EKHA 2DBKA 1UDLA 1SRMA 2CH4A 1JQQA 3JV3A 3QWXX 4LE9A 1TUDA 1I07A 2CUDA 3EHQA 1JU5C 2RF0A 4J9FA 4RTYA 2M0YA 2FEIA 4ORZA 1QKXA 4LN2A 2GQIA 2VWFA 2K7AA 1VYUA 3QWYA 2F2XA 2JM9A 1UGVA 1MUZA 2E5KA 2DA9A 4J9HA 1WA7A 2DE0X 2AZVA 3NMZC 2FG0A 2DL3A 4LNPA 1E6HA 2DF6A 2L0AA 3EG1A 1GBQA 2XMFA 5ECAA 1W6XA 1YP5A 2DVJA 1GBRA 5IXBA 2FPDA 5IHIA 1VYTA 3KFVA 2KT8A 2FPEA 1PNJA 1BU1A 1PWTA 3RBBB 4OMMA 4ZNXA 4FSSA 4OMNA 2HCKA 2J06A 3H0FA 2DRKA 3VS2A 2RN8A 5GJWB 2K3BA 3NHNA 2M51A 1SSHA 2D8HA 2KRMA 1AOJA 2EYXA 2O88A 1UJ0A 2NUZA 2YUOA 1PHTA 3I5SA 1AZEA 4CC7A 2JW4A 1X2KA 3REBB 2DILA 1UE9A 2AK5A 2DRMA 2DJQA 3EHRA 4JZ3A 1NEGA 1FMKA 2YT6A 4ESRA 1K4US 3M0RA 1M30A 1TG0A 1ZUUA 2C0IA 2OJ2A 1UTIA 1RI9A 1X27A 2P4RA 3IQLA 2LNHB 1BK2A 1WI7A 2J6KA 1GCPA 2HDAA 4DEYA 1AWXA 1NG2A 1TUCA 1G2BA 2CDTA 1XOVA 2O2OA 1NLPC 3CQTA 2EYZA 2KYMA 2LJ3A 2F2VA 4HVUA 1X6BA 4X1VA 4J9EA 3ULRB 2BZXA 1PRLC 3VRZA 1Z9QA 1MV3A 2DL4A 1Z9ZA 4EIKA 2KYBA 1RUWA 2AKKA 2MOXA 2BZYA 5IXFA 3VS1A 4RTTA 4GBQA 4HVWA 1K76A 4RTUA 3NPFA 2RMOA 2KRNA 1M27C 3I9QA 3M0QA 2EPDA 1M3BA 1CSKA 1U06A 2J7IA 1AZGB 1E7OA 2RPNA 3U23A 1AWOA 1NYGA 1MV0B 3UA6A 1M3CA 2J6OA 2LJ0A 5L23A 3TSZA 2YDLA 4OMOA 4CC4B 2CREA 4HVVA 2AKLA 1NEBA 4LUDA 4RTVA 2I0NA 1PKTA 1ZUKA 1SHGA 4J9DA 2DL5A 2O31A 4M4ZA 5FWBA 1UHFA 1YCSB 1WFWA 1WXUA 3TSWA 5IH2A 1WYXA 2QDLA 1QCFA 4Y92A 1BBZA 5FW9A 2KBTA 1S1NA 4IIOA 1H92A 1X2QA 1G83A 1UECA 4R0KA 3M0PA 4CC2A 2FPFA 2KNBB 2CT4A 1T0HA 2ENMA 1WIEA 2J6FA 2ROLA 3VS5A 5I22A 1W1FA 2LQWA 4WCIA 1YWPA 3I35A 1UJYA 4JPBW 3UATA 4D8DA 1GFCA 1X69A 2JM8A 1A0NB 3THKA 4RTZA 1CKBA 2A37A 4J9CA 5I11A 2NWMA 2GGRA 1EFNA 2RQTA 1GCQA 2L3PA 4J9BA 1YWOA 4OMPA 4CC3A 1K9AA 1X6GA 2ED1A 4GLMA 2LP5A 3A98A 2V1QA 3C0CA 2VKNA 1I0CA 1NYFA 1VYVA 3PVLA 3H0HA 2A08A 4J9IA 2EGCA 1LCKA 1SEMA 5GJVB 1ABOA 2K6DA 1HD3A 2MCNA 3R6NA 4RTXA 3M0UA 1WDXA 2EGEA 4AFSC 2EYWA 3GBQA 2F2WA 2L2PA 5IHKA 2JMCA 1WLPB 3ZL7C 2ECZA 2DLPA 1AD5A 1HSQA 2BZ8A 2KE9A 4F17A 1CKAA 1N5ZA 2J05A 1Y0MA 1GFDA 4Z88A 1H3HA 2KR3A 1VA7A 2SEMA 2YUQA 3O5ZA 1GL5A 4D8KA 2C0OA 1AWWA 1RLPC 1YN8A 4HCKA 2A36A 2JXBA 1E6GA 2RQUA 1V1CA 1AEYA 2D0NA 2EYYA 1WXBA 1M8MA 3TVTA 2RQWA 2ESWA 2JS0A 2A28A 2LX7A 2H8HA 2DBMA 1JXMA 3UA7A 2VVKA 2LZ6B 1ARKA 2O9SA 1WX6A 2DM1A 2EGAA 2LMJA 4J9GA 4Z89A 1T3SA 2DL7A 3RNJA 4AFZC 1OOTA 2K2MA 1ZUYA 1K1ZA 2G6FX 4JJBA 1OEBA 2PNIA 1RLQC 1UUEA 1GCQC 4AG1C 3REAB 2IIMA 2ROTA 2W0ZA 2DNUA 2GBQA 1SPKA 4QT7A 2KXDA 3VS7A 3H41A 3PE0A 2DYBA 4LUEA 1AVZC 2KRSA 1NLOC 1PKSA 1B07A 2CT3A 1JO8A 3EG3A 3LH5A 3SEMA 1KIKA 3NGPA 1U5SA 2B86A 4JZ4A 2YUPA 4K11A 2FRWA 1JEGA 1UFFA 2MIOA 4DEXA 1AWJA 2DMOA 4KRTA 4A63B 1FYNA 2JMAA 2L3SA 3UF4A 2CH4W 2ED0A 1J3TA 2K79A 4IIMA 1W70A 2LJ1A 2RQVA 2D1XA 4RUGA 1QLYA 2W10A 2RNAA 3VS6A 1T0JA 3VRYA 2ABLA 2RQRA 1KFZA 2LCSA 2KGTA 2CSQA 4RTWA 1ZSGA 2OAWA 5FWCA 2FRYA 4F16A 3SHWA 4HXJA 2KEAA 5EC7A 1OPLA 2YUNA 3FJ5A 1SHFA 2K9GA 3H0IA 1OPKA 1QKWA 4E6RA 1ZBJA 1NM7A 2KT1A 1M3AA 1BB9A 4JJCA 4JJDA 2HSPA 2YSQA 2KROA 3EG2A 2DL8A 1K0SA 2PZ1A 3VS3A 2EBPA 2V1RA 2LQNA 2X3XD 1GRIA 3EG0A 1ABQA 1H8KA 1SRLA 1B3QA 2O9VA 2EQIA 1UHCA 5HCKA 3M0TA 3PVQA 4AFUC 1KSWA 1IO6A 2HEQA 2D8JA 4OMLA 2JT4A 1T3LA 3VS0A 3I5RA 5IHNA 2KXCA 2SRCA 1QWFA 2C0TA 1QWEA 3VS4A 1WXTA 2JS2A 2JTEA 1U3OA 1Y57A 4F14A 2GTOA 1HJDA 2OI3A 2PTKA
chains in the Genus database with same CATH superfamily
2OTLQ 2LX9A 2FVUA 4M77F 1QW1A 3EGUA 1QVFP 2AZSA 3CXCP 2IPOB 2L3QA 1I8FA 3PGGA 2MF2A 4J6XA 1KQ2A 1OU9A 2X3WD 2RHZA 1D0XA 4M75A 4M77D 3CCMA 1VQOT 2DX1A 1K0XA 1PM3A 3HRTA 4RKUE 3VJPA 4ATOA 1KJWA 4LDXA 4DBHA 2JNGA 1JQQA 5GMKj 4M75F 4XTUA 4ZGDB 1I07A 4IUTA 1K73U 4RTYA 3G6EQ 2XKOC 2M0YA 4ORZA 2O4XB 2DFUA 1OYXA 5KE3A 4M75D 1VYUA 1FMVA 1ZHIA 3HFNA 3HRSA 2L3RA 2E5KA 1NZ9A 1M90U 3CCUT 1WZOA 3OYKA 4C92E 3G1JA 3PT9A 3VYGA 5LJ3e 4OB1B 1YJWA 1WJQA 1YHQA 3DLLA 3HSBA 3EFSA 4MMKA 4C0ZA 1IXDA 3EG1A 3CC2A 4IUQA 1IB8A 4M7AG 4ELYC 4N4IA 2XMFA 3FB9A 1YP5A 2DVJA 5ECAA 2ZPIB 1JJ2P 1LPLA 3LWHA 1VYTA 2Z0WA 2DZCA 2HL3A 5A0LA 2FB7A 3RBBB 1RAIB 3CC7Q 2CZ1B 4ZN1A 2HCKA 2V8JA 4Q5WA 2YWWA 1VQPT 1SSHA 4RCCA 1AOJA 1SG5A 1WHGA 2YRCA 3INZA 5DY9A 1D1BA 2DJQA 1BCMA 1VQMT 3CCJQ 4BUGA 1K4US 3GLXA 2C0IA 3X26B 2QA4T 1Q82C 2OJ2A 3CCQT 3G4SQ 3OW2S 4F7UB 2RM4A 2LNHB 5IT9E 1WI7A 3RKYA 1GCPA 1M1KU 2DERA 1G2BA 5GMKm 1K8AU 4BI4A 1TWBA 2O2OA 2LTOA 2EYZA 5CKBA 1X6BA 3EH1A 4ZTFA 4J9EA 3VRZA 2F1LA 1Z9QA 1Z9ZA 1VQ4T 3AHUA 3GOXA 4M7AF 2MOXA 2OTJQ 3D7SB 3JCMc 1VIFA 3QIIA 4JDSA 2RMOA 1VQ6T 3I9QA 1R8OB 3QG1A 3KBGA 5AT1B 1WHLA 2J7IA 2RPNA 2LQKA 2WSCE 2EJFA 3JCMd 1MMDA 1B7TA 1YJ9Q 1TOVA 4DOWA 3RESA 3TSZA 2DAQA 3CMAQ 3C4SA 1RI0A 4CC4B 2AKLA 1NEBA 2EQMA 4RTVA 1W4SA 2LT4A 1M90C 2VYTA 5CAIA 2BUDA 1YITA 3E2UA 1ZQ1A 2CP5A 3TSWA 1C0MA 5IH2A 1WYXA 2XDPA 1QVGP 4IUPA 2OTLT 1WJSA 5GAMd 3ER0A 3NTKA 4IIOA 2PQWA 3EFOB 3FLGA 2V8KA 5GAN8 2J6FA 2ROLA 4BD3A 3M4YA 1O75A 2QYZA 4L5GA 1D1CA 5CKFA 4WCIA 2XICA 1UJYA 4JPBW 3GNFB 3OBYA 1LVKA 2E3IA 2H3JA 1K9MU 4RTZA 5KYUA 4J9CA 2XU8A 2ZPBB 1YCYA 2PVGB 2E4HA 2RQTA 3G6ET 2CP6A 3OYCA 4M7DB 1K9AA 1OX8A 4FSXA 1SF9A 3M9QA 4ZGEB 3A8HB 2LP5A 3OS2A 2V1QA 2XI9A 3OS5A 3H0HA 1X6OA 1LCKA 2QEXA 5LJ3f 5GJVB 4QQ6A 3RERA 3A8LB 4GLKA 1WDXA 2E65A 5HY6A 4MZPA 2DJZA 3CCRA 1M1FA 5KE2A 2JMCA 3L2ZA 5CCAA 1RAGB 1M1GA 3LYIA 3PMTA 2BZ8A 3E1SA 2YLBA 4AT1B 3BE3A 3OS0A 3JCMX 2M0OA 5GAN4 3OYJA 4M7AE 3JCMg 3CC7T 1Q86R 3HFOA 1XJWB 4X9DA 4HCKA 5GAN7 2JXBA 1E6GA 3QO3A 4IKFA 2X9HA 2D0NA 3OBWA 4OB2B 1M8MA 1YIJQ 4OF1A 5DM7R 2LX7A 4NOYA 4HKEA 5KYWA 2DD5A 2DBMA 4IUUA 3FJPA 2LZ6B 2PU9B 2O9SA 5GAMg 2KDSA 1G3TA 4RMOA 3SD4A 3G4ST 3RNJA 2RJDA 2OX7A 1OOTA 2GFAA 2EIFA 2EQKA 3OYAA 3VUBA 1K1ZA 2G6FX 3EG9A 4PJMA 1OEBA 2PNIA 1NPRA 2V8IA 3OYIA 1UUEA 4E47A 1D3BB 3QYHB 4A4GA 2W0ZA 3VS7A 2K4YA 1B07A 3CCMQ 2NUPA 3SFMA 2YUPA 4K11A 2OTJT 4LXCA 2FRWA 1JEGA 2GFUA 2HSEB 3A5ZB 2QQRA 2MIOA 2DMOA 4PL6A 1Y96B 2JMAA 2L3SA 4F7UE 2ED0A 3TU4K 1M9SA 3M59A 1K9MC 2RQVA 1YJ9T 4RUGA 1QLYA 1YBYA 3CMAT 3LWIA 5KYNA 2RQRA 5C0MA 1NJIU 3LW5E 2DXBA 5GMKl 2MPXC 1OPLA 2YUNA 4C8QB 1SHFA 3H0IA 2MYSA 4E6RA 1YI2A 3VU3C 4XAXB 2KT1A 4JJCA 4C92B 3I55A 2E64A 2DL8A 1YJNQ 1S72A 4PJLA 2LQNA 2X3XD 3FEOA 1QP3A 1H8KA 1SRLA 4XU0A 2JJ9A 1N8RU 1KHIA 1IO6A 1GXIE 2VASA 5FU6B 1IHWA 4XU1A 3VS0A 5IHNA 1UEBA 2KXCA 4X34A 1WXTA 2HL5C 2QG9B 1Y57A 2X4JA 2GTOA 3CCUQ 1WPYA 2R5AA 2EJGA 3EH2A 3CD6A 4C92C 2CUBA 5I21A 4L59A 2DYIA 4HCBA 1I1JA 5LJ3d 4Z02A 2BTTA 3HL8A 1RADB 1ZX6A 2DEQA 5KYXA 2K5IA 1OV3A 3DLMA 1D0ZA 3RMQA 2HMAA 2AIRB 2CSIA 3CXCS 5FU6C 1X43A 5M9OA 3OY9A 1KC8R 2VGNA 2K3XA 1FWZA 1TUDA 4M7DE 1ZA2B 3EHQA 3EGDA 1JU5C 4PJOG 2RF0A 3UDCA 2ATCB 3I56A 3OYEA 3EGXB 3G71A 3PTAA 2QDYB 1KQ1A 4EMHA 4JRQA 3QWYA 3M56A 4BDZA 1MUZA 4E7IA 5KYYA 5GAOn 4FYWB 2DA9A 3HKSA 3JB9H 2AZVA 1MMNA 2QTVA 4RCBA 2DL3A 1VUBA 4PLLA 1GBQA 1GBRA 1G5VA 1W6XA 2JN0A 3QKJA 1YITQ 3S3NA 2FPDA 5IHIA 2BIVA 2A7YA 2KT8A 4QQDA 1PNJA 4C5IA 2M1HA 1PSFA 1JJ2S 4OMMA 2QGFB 1VQ4Q 4OMNA 4X9CA 3H0FA 4J5YA 2RK2A 2DTHA 4QVCA 1KQSS 5CKHA 4HCCA 3CCMT 2D8HA 2EYXA 2G3RA 1TH7A 2KMTA 4MDXA 3RIRA 1X2KA 3REBB 2YRVA 2CYZB 2DILA 1D1AA 4DQ2A 5LJ5e 4CI0C 4PNOA 2YT6A 4V2SA 3M0RA 2VC8A 1ZUUA 3CBPA 1UTIA 2MI6A 5LJ3g 3QBYA 1BK2A 5CKDA 3OB9A 1FXXA 4M78G 2CDTA 3SWNA 2QEXQ 1HXDA 4BI3A 2KYMA 2LRQA 2F2VA 3ULRB 2BZXA 3ZEHA 3P8HA 3CCRQ 3CCVA 3CC2T 3CCSQ 3SDZA 3L2RA 1HYOA 2KYBA 2VB6A 3GIBA 5KH6A 1RUWA 2HZYA 5FU7B 1B34B 2BZYA 3VS1A 1EX4A 3KXTA 5GMKe 2EAYA 2MWPA 4GBQA 4Y91A 3V7CA 8AT1B 1YJNT 2A0FB 3HTRA 2PUKB 4BE1A 3MEUA 1M3BA 1DJ7B 1CSKA 2L89A 1AWOA 7AT1B 5L23A 1UGRB 1PG5B 4OMOA 3WXMB 4M7AB 2I0NA 1PKTA 3MJXA 1SHGA 1WHMA 5D6YA 2O31A 4C8QE 4C5EA 1YCSB 2KVQG 1I5LA 4M78A 5FU7C 3RDVA 3JAME 1BBZA 2DXTA 1S1NA 1H92A 3NTIA 1H641 4R0KA 4CC2A 4M78F 1QVGS 2CT4A 4FIBA 3HPWA 1IZ6A 4C0DB 3RKWA 5I22A 3DB3A 1M5Q1 2LQWA 1KQSP 3I35A 2LC4A 3JB9J 2E6NA 4M78D 2RJFA 3UATA 2RH2A 2DK3A 1GFCA 2M9UA 4M7AC 2JM8A 4LDUA 3THKA 2A37A 2NWMA 2GGRA 2CS7A 1EFNA 1GCQA 4JS5A 3FIFA 2LT1A 4OMPA 1BCOA 4Y28E 3A98A 2HBPA 3V7SA 3URGA 4J9IA 2EJ9A 4F04B 4PJOE 5GANh 4DA4A 3R6NA 4C0DC 3M0UA 2EGEA 1VQ5A 5D6XA 3MP1A 5IHKA 2RA2A 1Q81U 4DBQA 2DXCA 5HKCA 4GY5A 1YITT 1QVFA 1HSQA 1N27A 3CMEQ 2KE9A 2XG8D 1W2BS 4O6JA 1GFDA 4XTWA 1H3HA 4M77E 2KR3A 1BYMA 1VA7A 2SEMA 3CBOA 2YUQA 3O5ZA 1VQ9Q 2DZ9A 5CKEA 3ME9A 2JTFA 1S72Q 3M57A 4HA8A 2RQUA 1V1CA 2HNIA 1AEYA 1IRXA 4PK4A 3UPUA 2P0PA 1MNEA 5D6WA 3T9NA 2H8HA 4BY6B 2O4XA 5LJ5f 3UA7A 4M75E 2VVKA 2R57A 2GF7A 1WX6A 3A1PA 3CPWA 3PFSA 2DKGA 2EGAA 4FYVB 1Q82R 2RJEA 5CO7A 3OYGA 1T3SA 2K2MA 2FL7A 5J3BA 4C0FA 2E10A 1AHJB 1KD1R 2QEXT 4EMGA 1M2VB 2KY9A 4KGXB 3REAB 2ROTA 2DNUA 2GBQA 1SPKA 4JS4A 2P84A 3H41A 3PE0A 4KH0B 3CCRT 1VQMA 2KRSA 3CCST 1NLOC 1MMAA 1PKSA 2CT3A 5GANe 1JO8A 2CP7A 1KIKA 1X75C 4BY6C 2HQHA 1UFFA 4VUBA 4PJNA 4EMKB 4A63B 4FCYA 5GANj 1BI0A 3JCMQ 4L6V5 2E3HA 2K79A 3G71Q 1K73R 1WQ7A 2EFIA 2LQ8A 2RD1A 1KK7A 3OYBA 3P8BB 4BE2A 2V26A 1KFZA 2LCSA 4RTWA 1ZSGA 2OAWA 3O8VA 1M90R 1Q86C 2IVWA 3CCEQ 1VQ6A 3FJ5A 4A4KA 2K9GA 3OSVA 1UGSB 1PCXA 4PFOA 1TXQA 1Q81C 1W2BP 5GAOr 3MP6A 1BB9A 4JJDA 1TUGB 2HSPA 4EMKC 2WSFE 2KROA 1N9SA 5CK9A 1K0SA 3QPHA 5GAN2 2VV5A 2PVOB 3EG0A 1B3QA 1VQLA 2EQIA 3M0TA 2KK4A 2D8JA 2GCXA 2QQSA 1VOMA 4NS5A 2CGHA 2OTLA 4M7DC 1V76A 3GPLA 2VXEA 3OQ5A 1RAFB 2CZ6B 5FROA 3JCMh 1U3OA 4FT4A 1VIEA 4DBFA 3EFRA 1HJDA 4FT2A 4QKUA 2FO0A 2QGGA 1ZLMA 2GNCA 2LNVA 1KC8U 2H3EB 1F1BB 4Z8AA 3OYNA 4OGCA 2EKOA 2EVRA 1XNIA 1M1KR 5D7UA 6AT1B 1K8AR 1VQ7Q 5GAMh 3EFOA 3H9NA 1PSEA 3CCVQ 3A8OB 3X25B 3CMET 3QJ6A 2DETA 1UG1A 1JXOA 2C06A 1YI2T 2EKHA 2DBKA 1SRMA 2VXFA 3QWXX 5FLXE 1VQ9T 3CC4A 1IGQA 4LE9A 4E7SA 2CUDA 1LOJA 1BKBA 1S72T 4J9FA 2FEIA 2RO0A 4B6MA 1QKXA 2MMPA 2X4XA 3S3OA 2RJCA 2QTXA 3LLRA 2MWOA 1PD0A 3QUIA 1G3SA 1ZBXA 2E5QA 3FDRA 5LJ5d 4J9HA 2ZPHB 2X51A 1KHCA 2HD0A 1XQHA 3OW2A 2FG0A 3WVDB 4LNPA 2NUTA 1QCOA 3X20B 2L0AA 3CC7A 3FC3A 4N4GA 2Y4YA 1OQKA 2RK1A 4A53A 3CBMA 2XDDA 2FPEA 4JLIA 3CD6T 1YJWQ 1YHQQ 3OYMA 3JCMP 3MO8A 1HK9A 2DD4A 1RABB 2GQVA 1Q95G 4JRPA 3CC2Q 4FSSA 1WJRA 2J06A 2DRKA 2DPPB 2RN8A 3VS2A 2L8DA 3CCJA 5GJWB 2K3BA 5GANf 3OYYA 4HCZA 2KRMA 4EDUA 4XU2A 3HRUA 1UJ0A 2YUOA 3PMIA 1AZEA 1MHNA 1RL2A 1UE9A 2AK5A 2DRMA 3EHRA 3META 4JZ3A 3J81E 3RR6A 4ESRA 3HHTB 4KGVB 3OMCA 1M30A 2DTIA 1EZZB 3L2UA 4RG2A 3TEEA 1K9MR 1VQKA 3G71T 5KCHA 2P4RA 1X27A 3MP8A 4OMFB 4KUDK 5GAMj 2HDAA 1Y71A 2RHUA 1AWXA 2BKDN 1XOVA 1QMCA 1ZSZA 3QJYA 2LJ3A 4HVUA 3RUXA 4C8QC 4R55A 3A8MB 4X1VA 1KC8C 4FW1A 2MAMA 1D09B 4QVDA 1VQ5Q 1ZA1B 1D3BA 2DL4A 3QYGB 2JVVA 4FL6A 3CCET 4KGZB 1QP2A 1Q7YR 4C92G 3QZ9B 4PJOB 2A3LA 5IXFA 1YJ9A 3NPFA 3QDFA 2NLUA 2KRNA 3BDLA 5I2MA 5LJ5g 4QQGA 1Y96A 4ME7A 3UA6A 1M3CA 3SWNB 3OSSC 2K2VA 4M77B 1VQ8A 4PLIA 2XHCA 4HVVA 3CCLA 2D9TA 2HKQB 1ZUKA 1AT1B 1RAAB 3WVEB 4P5NA 2DO3A 3E19A 3VV0A 1WXUA 4R56A 2JTMA 3J80E 2QDLA 1QCFA 4Y92A 3M53A 2ZAEA 4PJOC 4KULA 3JB9G 1MGQA 1X2QA 4JLGA 1G83A 1OZ2A 4M75B 3M0PA 2ZPGB 2FPFA 2P0KA 1M2OA 2QQBA 2ENMA 1WIEA 1JRIA 4C92A 1VQ7T 3VS5A 3CCVT 2K57A 1OU8A 4XK8E 1YWPA 3SWNC 3L2VA 4LDWA 4M77C 1VQNA 4A4EA 4C92F 2XDBA 2YRDA 2CP0A 4J9BA 4TVRA 3V8KA 4XU3A 2R58A 4N0AA 4RG8A 1IHVA 4GLMA 4C92D 3C0CA 1N9RA 4B9WA 1NYFA 1VYVA 1EIFA 4J8OA 2WSEE 3QHSA 1SEMA 4M75C 4DOVA 1ABOA 5IAYA 1HD3A 2CKKA 1H3ZA 2RI5A 3OS1A 4AFSC 2EYWA 1Y07A 2JOYA 3GBQA 5KCOA 2ECZA 2DLPA 2HQEA 2HKNA 3CPFA 2FZCB 1BIAA 1M8VA 5IN1A 1NJIR 4F17A 1N5ZA 5LJ3h 1Y0MA 4IURA 3JCMb 1YJWT 4Z88A 3NTHA 1YHQT 1YIJA 2KQWA 3MPUB 2C0OA 3JB9F 1AWWA 1YN8A 2A36A 2RHYA 4FYXB 5GANd 3JCMJ 1VQLQ 4ELZC 4WTOB 5CQYA 3V7RA 1R0CB 2RQWA 2JS0A 3JB9D 3VYHB 3EGXA 4PFPA 1O9SA 1SSFA 1WNLA 3GNGA 4FW2A 1JXMA 5I2SA 1N8RR 3QXEB 2EQUA 2X4YA 4LDVA 1ARKA 4N4HA 3JSCA 2R5MA 2DM1A 2QQ9A 3AT1B 3V8LA 4J9GA 4Z89A 1QCNA 2OAUA 2QI2A 2YHTA 1ZUYA 4XTYA 1RLQC 3BY7A 1KG1A 9ATCB 1GCQC 4AG1C 2IIMA 3MEAA 4LD9K 4QT7A 1U1SA 3M58A 2AHJB 2DYBA 1VQ5T 1RAEB 4C5HA 2VUBA 1AVZC 3M54A 3S6WA 1RAHB 3EG3A 3LH5A 3SEMA 3NGPA 4JZ4A 3X24B 2D6FA 2QK0A 5GAN5 1AWJA 3CPWP 3CC4Q 4E7KA 2WACA 2LDMA 3UF4A 5GMKi 2CH4W 4OP0A 5LL6S 2M16A 4KT0E 4PKCC 3OYLA 1W70A 3PIPA 3E9FA 2LJ1A 1R77A 2D1XA 2LVMA 1D0YA 2RNAA 2CP3A 5GAOp 3FRNA 2ZZDA 2E12A 5LJ3j 5GAOm 3VRYA 2DTOA 4BDYA 1OULA 2CSQA 3L2WA 1YJNA 1VQOA 5FWCA 1Y7XA 2FRYA 4F16A 4HXJA 2KEAA 5EC7A 5C6SA 1OPKA 2EYQA 1Q86U 4OGEA 1ZBJA 2IG0A 1M3AA 5GANg 4MMLA 2YSQA 2FZGB 2PZ1A 2KSSA 2EBPA 3M5AA 2V1RA 1GRIA 3CXCA 1B34A 1ABQA 1N6AA 2QQAA 1G8XA 1TSFA 2O9VA 2F69A 2D0QB 1UHCA 1YI2Q 3PVQA 1KSWA 2CZ0B 5KYUB 1QVPA 4QW2A 3I55Q 3CCUA 2Y4XA 1NPPA 5FRMA 4J7IA 3LX7A 4QVZA 3X28B 1KD1C 1QWFA 2JS2A 2JTEA 1P92A 2RI2A 4WF2A 4A54A 3TREA 4M7AA 1WHKA 2AT1B 2PUOB 2X4WA 1VQKQ 1PRMC 3M0SA 4PJJA 1YNZA 5J39A 3BW1A 4OMQA 2HBWA 4F7UG 3QDRB 5CQXA 4AG2C 4KUIA 1UGQB 1YFNA 2GTJA 1VQPA 4AFQC 3TCJA 2EW3A 3CD6Q 4KBMB 5EG2A 4M7AD 3VKIA 1JJ2A 3C12A 1I5OB 1UDLA 4XQ3A 2CH4A 3JV3A 1K73C 1OI1A 1KQSA 4M78E 2ZPFB 2QA4A 3CCQA 5A0GA 4EPCA 4LN2A 2QASA 2GQIA 5KYWB 1VQLT 1TTHB 2VWFA 2K7AA 5DLQE 2F2XA 1LNXA 1WHJA 2JM9A 2F5KA 1UGVA 3OYFA 3TQ7P 1G3YA 3H8ZA 4E7LA 1VQ8Q 1WA7A 3I56Q 2DE0X 4IUVA 4C5GA 5A2QE 3NMZC 3CCLQ 1WHHA 2QXFA 1TS9A 4J6WA 1E6HA 3G7ZA 2DF6A 1ACMB 3EG9B 1VQ4A 4XTVA 3C95A 5IXBA 4F7UA 3KFVA 4PFZA 4OB3B 3ZFJA 1BU1A 1JB0E 1BI1A 2JUFA 2M02A 5GAN3 2HAXA 2HQXA 2NUPB 1PWTA 4UC4A 4ZNXA 4E7HA 4F7UF 1I4K1 4LDYA 5HK0A 3NHNA 2M51A 1WQWA 3LGFA 1OX9A 2MK5A 2E6ZA 2O88A 2NUZA 3I5SA 1PHTA 4CC7A 2JW4A 1VQNQ 5CR2A 2O01E 3OW2P 1NEGA 3CC4T 1FMKA 2NUTB 1MNDA 3M4GA 1TG0A 4BI8B 3Q1JA 1Q7YU 1UGPB 1M1KC 2ZPEB 1RI9A 3IQLA 2J6KA 4D6WA 3CCSA 1K8AC 1G3WA 2RHIA 4DEYA 4M7DG 2FHDA 1NG2A 1TUCA 1C6VX 3CQTA 1NLPC 1XTDA 2COWA 2NYSA 5L8RE 3MEVA 1PRLC 1FMWA 3JB9I 1MV3A 1M2VA 4EIKA 8ATCB 3MCAB 4JUVA 3PNWC 2AKKA 1QVGA 1Q81R 2L5QA 3J7AF 3VUZA 4RTTA 4HVWA 1K76A 4RTUA 3G6EA 1M27C 2RHXA 3M0QA 4BE0A 2EPDA 3CCJT 1U06A 3H6ZA 1AZGB 2E1HA 4E7ZA 4EMKA 1E7OA 1U1TA 3U23A 2E70A 1NYGA 1MV0B 2J6OA 2YXYA 3I55T 2LJ0A 1LJOA 1I81A 3SB2A 4E7JA 4BB7A 3DKMA 1ZSZB 2YDLA 2CREA 2K3YA 4LUDA 1QQJA 5GAN6 4J9DA 2DL5A 4M4ZA 1WGSA 5FWBA 1UHFA 2ZGWA 1WFWA 2COYA 3QZ5B 4M7DA 5GAOl 1VQKT 4KH1B 5FW9A 2KBTA 5KYXB 1SKUB 1UECA 4M7DF 2KNBB 3MKDA 2RB6A 1T0HA 4CRIA 1BI3A 3UWNA 3LH0A 1W2BA 3S3MA 2I2LA 2P4TA 1W1FA 3JCMe 3JCMV 3EGDB 4M7DD 3GF5A 3JCMW 4B9XA 4D8DA 3PIOA 1ZSZC 1X69A 1A0NB 3DB4A 1CKBA 5I11A 2BE9B 2L3PA 2RI3A 1YWOA 4MDWA 2KI7A 3G4SA 4CC3A 2FYKA 3F70A 5KYYB 1X6GA 2ED1A 1IREB 3R6OA 2VKNA 1I0CA 4OVAA 3PVLA 5GAMe 2A08A 2K5LA 2EGCA 2YLCA 1Q7YC 3CMEA 1VQ8T 3I56T 2K6DA 2MCNA 3CCLT 4RTXA 4FYYB 1VQ9A 2VGMA 3BFMA 5AYFA 2JZ2A 3A8GB 2F2WA 2L2PA 1WLPB 2E41A 3ZL7C 4MZMA 4ANJA 1AD5A 4JRKA 1VQOQ 4LD6A 4FM4B 5HK3A 2Y90A 1CKAA 2OTJA 2J05A 3N5BB 4C8QG 1GL5A 4C0GA 4D8KA 2CZ7B 2COZA 3UT1A 1TU0B 2CP2A 1RLPC 4OB0B 3RMSA 1PD1A 4XTZA 4J83A 2EYYA 1WXBA 3ZBDA 3TVTA 2DIGA 2ESWA 3CEYA 2A28A 1NBEB 4E2FB 3CMAA 1VQNT 4HT8A 2K5FA 5J26A 4A4HA 4O5VA 3ASKA 3E9GA 3EAEA 1IGUA 3P8DA 2LMJA 3LGLA 4NL2A 3MEWA 1RACB 2DL7A 4AFZC 4II1A 1JBMA 5LJ5h 1OZ3A 4ZN3A 4AMCA 3MHXA 4JJBA 4YTLA 1QVFS 2XD0A 4DBRA 2B8AA 2KXDA 4N0AC 4LUEA 2LCCA 3OYDA 3HP9A 3OYHA 1VQPQ 2KAFA 4C8QA 1U5SA 2B86A 1NE8A 1YIJT 4DEXA 4J7FA 1R0BG 4KRTA 1VQMQ 1FYNA 4JJNK 2QAZA 4C8QF 1MMGA 2QA4Q 1J3TA 3CCQQ 3CPWS 4M77G 5DLOA 1U8RA 4IIMA 1UB4A 4NL3A 1M4ZA 3CCEA 5GMKh 2W10A 3V8JA 3L42A 4C8QD 3VS6A 1T0JA 4A4FA 1NJIC 1PC0A 2DEUA 4M78B 2ABLA 3JRZA 1FX7A 2KGTA 3C94A 2DVEA 2P0QA 2LCLA 3SHWA 4ZGJB 5FRNA 1BIBA 3L2QA 4M75G 1QKWA 3QSUA 1NM7A 2XK0A 1V29B 2DIQA 2X35A 3EG2A 3VS3A 5GAOq 3L1AA 2DXUA 3NFCA 4PJOA 1VQ6Q 1N8RC 2PVDB 4JRIA 4MZTA 4BACA 4XTXA 3JCMf 5HCKA 4AFUC 2BE7D 2HEQA 4OMLA 2EWNA 5A0DA 5CIUA 2FZKB 2XIDA 2JT4A 2F5TX 1T3LA 4PJOF 1Q82U 4ZTJA 2ZCFB 5LJ5j 3I5RA 4M78C 5CVIA 3KUFA 3M55A 3BDUA 4J6YA 3OMGA 2SRCA 3GP8A 1X01A 2C0TA 4FU6A 1QWEA 3VS4A 1BI2A 4M77A 2EQJA 1C1AA 3OA6A 1KD1U 4PJOD 4F14A 2OI3A 2PTKA 4HT9A 3RKXA 5GAMf 1VQ7A
chains in the Genus database with same CATH topology
2FO0A 1ZLMA 1PRMC 2GNCA 3M0SA 1YNZA 2CUBA 4Z8AA 4OMQA 2HBWA 3EGUA 2EVRA 1I1JA 2AZSA 2BTTA 2L3QA 4AG2C 1ZX6A 2GTJA 2X3WD 1OV3A 4AFQC 2DX1A 2EW3A 1K0XA 2CSIA 1UG1A 1JXOA 1X43A 1KJWA 2EKHA 2DBKA 1UDLA 1SRMA 2CH4A 1JQQA 3JV3A 3QWXX 4LE9A 1TUDA 1I07A 2CUDA 3EHQA 1JU5C 2RF0A 4J9FA 4RTYA 2M0YA 2FEIA 4ORZA 1QKXA 4LN2A 2GQIA 2VWFA 2K7AA 1VYUA 3QWYA 2F2XA 2JM9A 1UGVA 1MUZA 2E5KA 2DA9A 4J9HA 1WA7A 2DE0X 2AZVA 3NMZC 2FG0A 2DL3A 4LNPA 1E6HA 2DF6A 2L0AA 3EG1A 1GBQA 2XMFA 5ECAA 1W6XA 1YP5A 2DVJA 1GBRA 5IXBA 2FPDA 5IHIA 1VYTA 3KFVA 2KT8A 2FPEA 1PNJA 1BU1A 1PWTA 3RBBB 4OMMA 4ZNXA 4FSSA 4OMNA 2HCKA 2J06A 3H0FA 2DRKA 3VS2A 2RN8A 5GJWB 2K3BA 3NHNA 2M51A 1SSHA 2D8HA 2KRMA 1AOJA 2EYXA 2O88A 1UJ0A 2NUZA 2YUOA 1PHTA 3I5SA 1AZEA 4CC7A 2JW4A 1X2KA 3REBB 2DILA 1UE9A 2AK5A 2DRMA 2DJQA 3EHRA 4JZ3A 1NEGA 1FMKA 2YT6A 4ESRA 1K4US 3M0RA 1M30A 1TG0A 1ZUUA 2C0IA 2OJ2A 1UTIA 1RI9A 1X27A 2P4RA 3IQLA 2LNHB 1BK2A 1WI7A 2J6KA 1GCPA 2HDAA 4DEYA 1AWXA 1NG2A 1TUCA 1G2BA 2CDTA 1XOVA 2O2OA 1NLPC 3CQTA 2EYZA 2KYMA 2LJ3A 2F2VA 4HVUA 1X6BA 4X1VA 4J9EA 3ULRB 2BZXA 1PRLC 3VRZA 1Z9QA 1MV3A 2DL4A 1Z9ZA 4EIKA 2KYBA 1RUWA 2AKKA 2MOXA 2BZYA 5IXFA 3VS1A 4RTTA 4GBQA 4HVWA 1K76A 4RTUA 3NPFA 2RMOA 2KRNA 1M27C 3I9QA 3M0QA 2EPDA 1M3BA 1CSKA 1U06A 2J7IA 1AZGB 1E7OA 2RPNA 3U23A 1AWOA 1NYGA 1MV0B 3UA6A 1M3CA 2J6OA 2LJ0A 5L23A 3TSZA 2YDLA 4OMOA 4CC4B 2CREA 4HVVA 2AKLA 1NEBA 4LUDA 4RTVA 2I0NA 1PKTA 1ZUKA 1SHGA 4J9DA 2DL5A 2O31A 4M4ZA 5FWBA 1UHFA 1YCSB 1WFWA 1WXUA 3TSWA 5IH2A 1WYXA 2QDLA 1QCFA 4Y92A 1BBZA 5FW9A 2KBTA 1S1NA 4IIOA 1H92A 1X2QA 1G83A 1UECA 4R0KA 3M0PA 4CC2A 2FPFA 2KNBB 2CT4A 1T0HA 2ENMA 1WIEA 2J6FA 2ROLA 3VS5A 5I22A 1W1FA 2LQWA 4WCIA 1YWPA 3I35A 1UJYA 4JPBW 3UATA 4D8DA 1GFCA 1X69A 2JM8A 1A0NB 3THKA 4RTZA 1CKBA 2A37A 4J9CA 5I11A 2NWMA 2GGRA 1EFNA 2RQTA 1GCQA 2L3PA 4J9BA 1YWOA 4OMPA 4CC3A 1K9AA 1X6GA 2ED1A 4GLMA 2LP5A 3A98A 2V1QA 3C0CA 2VKNA 1I0CA 1NYFA 1VYVA 3PVLA 3H0HA 2A08A 4J9IA 2EGCA 1LCKA 1SEMA 5GJVB 1ABOA 2K6DA 1HD3A 2MCNA 3R6NA 4RTXA 3M0UA 1WDXA 2EGEA 4AFSC 2EYWA 3GBQA 2F2WA 2L2PA 5IHKA 2JMCA 1WLPB 3ZL7C 2ECZA 2DLPA 1AD5A 1HSQA 2BZ8A 2KE9A 4F17A 1CKAA 1N5ZA 2J05A 1Y0MA 1GFDA 4Z88A 1H3HA 2KR3A 1VA7A 2SEMA 2YUQA 3O5ZA 1GL5A 4D8KA 2C0OA 1AWWA 1RLPC 1YN8A 4HCKA 2A36A 2JXBA 1E6GA 2RQUA 1V1CA 1AEYA 2D0NA 2EYYA 1WXBA 1M8MA 3TVTA 2RQWA 2ESWA 2JS0A 2A28A 2LX7A 2H8HA 2DBMA 1JXMA 3UA7A 2VVKA 2LZ6B 1ARKA 2O9SA 1WX6A 2DM1A 2EGAA 2LMJA 4J9GA 4Z89A 1T3SA 2DL7A 3RNJA 4AFZC 1OOTA 2K2MA 1ZUYA 1K1ZA 2G6FX 4JJBA 1OEBA 2PNIA 1RLQC 1UUEA 1GCQC 4AG1C 3REAB 2IIMA 2ROTA 2W0ZA 2DNUA 2GBQA 1SPKA 4QT7A 2KXDA 3VS7A 3H41A 3PE0A 2DYBA 4LUEA 1AVZC 2KRSA 1NLOC 1PKSA 1B07A 2CT3A 1JO8A 3EG3A 3LH5A 3SEMA 1KIKA 3NGPA 1U5SA 2B86A 4JZ4A 2YUPA 4K11A 2FRWA 1JEGA 1UFFA 2MIOA 4DEXA 1AWJA 2DMOA 4KRTA 4A63B 1FYNA 2JMAA 2L3SA 3UF4A 2CH4W 2ED0A 1J3TA 2K79A 4IIMA 1W70A 2LJ1A 2RQVA 2D1XA 4RUGA 1QLYA 2W10A 2RNAA 3VS6A 1T0JA 3VRYA 2ABLA 2RQRA 1KFZA 2LCSA 2KGTA 2CSQA 4RTWA 1ZSGA 2OAWA 5FWCA 2FRYA 4F16A 3SHWA 4HXJA 2KEAA 5EC7A 1OPLA 2YUNA 3FJ5A 1SHFA 2K9GA 3H0IA 1OPKA 1QKWA 4E6RA 1ZBJA 1NM7A 2KT1A 1M3AA 1BB9A 4JJCA 4JJDA 2HSPA 2YSQA 2KROA 3EG2A 2DL8A 1K0SA 2PZ1A 3VS3A 2EBPA 2V1RA 2LQNA 2X3XD 1GRIA 3EG0A 1ABQA 1H8KA 1SRLA 1B3QA 2O9VA 2EQIA 1UHCA 5HCKA 3M0TA 3PVQA 4AFUC 1KSWA 1IO6A 2HEQA 2D8JA 4OMLA 2JT4A 1T3LA 3VS0A 3I5RA 5IHNA 2KXCA 2SRCA 1QWFA 2C0TA 1QWEA 3VS4A 1WXTA 2JS2A 2JTEA 1U3OA 1Y57A 4F14A 2GTOA 1HJDA 2OI3A 2PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO0 A;  1ZLM A;  1PRM C;  2GNC A;  3M0S A;  1YNZ A;  2CUB A;  4Z8A A;  4OMQ A;  2HBW A;  3EGU A;  2EVR A;  1I1J A;  2AZS A;  2BTT A;  2L3Q A;  4AG2 C;  1ZX6 A;  2GTJ A;  2X3W D;  1OV3 A;  4AFQ C;  2DX1 A;  2EW3 A;  1K0X A;  2CSI A;  1UG1 A;  1JXO A;  1X43 A;  1KJW A;  2EKH A;  2DBK A;  1UDL A;  1SRM A;  2CH4 A;  1JQQ A;  3JV3 A;  3QWX X;  4LE9 A;  1TUD A;  1I07 A;  2CUD A;  3EHQ A;  1JU5 C;  2RF0 A;  4J9F A;  4RTY A;  2M0Y A;  2FEI A;  4ORZ A;  1QKX A;  4LN2 A;  2GQI A;  2VWF A;  2K7A A;  1VYU A;  3QWY A;  2F2X A;  2JM9 A;  1UGV A;  1MUZ A;  2E5K A;  2DA9 A;  4J9H A;  1WA7 A;  2DE0 X;  2AZV A;  3NMZ C;  2FG0 A;  2DL3 A;  4LNP A;  1E6H A;  2DF6 A;  2L0A A;  3EG1 A;  1GBQ A;  2XMF A;  5ECA A;  1W6X A;  1YP5 A;  2DVJ A;  1GBR A;  5IXB A;  2FPD A;  5IHI A;  1VYT A;  3KFV A;  2KT8 A;  2FPE A;  1PNJ A;  1BU1 A;  1PWT A;  3RBB B;  4OMM A;  4ZNX A;  4FSS A;  4OMN A;  2HCK A;  2J06 A;  3H0F A;  2DRK A;  3VS2 A;  2RN8 A;  5GJW B;  2K3B A;  3NHN A;  2M51 A;  1SSH A;  2D8H A;  2KRM A;  1AOJ A;  2EYX A;  2O88 A;  1UJ0 A;  2NUZ A;  2YUO A;  1PHT A;  3I5S A;  1AZE A;  4CC7 A;  2JW4 A;  1X2K A;  3REB B;  2DIL A;  1UE9 A;  2AK5 A;  2DRM A;  2DJQ A;  3EHR A;  4JZ3 A;  1NEG A;  1FMK A;  2YT6 A;  4ESR A;  1K4U S;  3M0R A;  1M30 A;  1TG0 A;  1ZUU A;  2C0I A;  2OJ2 A;  1UTI A;  1RI9 A;  1X27 A;  2P4R A;  3IQL A;  2LNH B;  1BK2 A;  1WI7 A;  2J6K A;  1GCP A;  2HDA A;  4DEY A;  1AWX A;  1NG2 A;  1TUC A;  1G2B A;  2CDT A;  1XOV A;  2O2O A;  1NLP C;  3CQT A;  2EYZ A;  2KYM A;  2LJ3 A;  2F2V A;  4HVU A;  1X6B A;  4X1V A;  4J9E A;  3ULR B;  2BZX A;  1PRL C;  3VRZ A;  1Z9Q A;  1MV3 A;  2DL4 A;  1Z9Z A;  4EIK A;  2KYB A;  1RUW A;  2AKK A;  2MOX A;  2BZY A;  5IXF A;  3VS1 A;  4RTT A;  4GBQ A;  4HVW A;  1K76 A;  4RTU A;  3NPF A;  2RMO A;  2KRN A;  1M27 C;  3I9Q A;  3M0Q A;  2EPD A;  1M3B A;  1CSK A;  1U06 A;  2J7I A;  1AZG B;  1E7O A;  2RPN A;  3U23 A;  1AWO A;  1NYG A;  1MV0 B;  3UA6 A;  1M3C A;  2J6O A;  2LJ0 A;  5L23 A;  3TSZ A;  2YDL A;  4OMO A;  4CC4 B;  2CRE A;  4HVV A;  2AKL A;  1NEB A;  4LUD A;  4RTV A;  2I0N A;  1PKT A;  1ZUK A;  1SHG A;  4J9D A;  2DL5 A;  2O31 A;  4M4Z A;  5FWB A;  1UHF A;  1YCS B;  1WFW A;  1WXU A;  3TSW A;  5IH2 A;  1WYX A;  2QDL A;  1QCF A;  4Y92 A;  1BBZ A;  5FW9 A;  2KBT A;  1S1N A;  4IIO A;  1H92 A;  1X2Q A;  1G83 A;  1UEC A;  4R0K A;  3M0P A;  4CC2 A;  2FPF A;  2KNB B;  2CT4 A;  1T0H A;  2ENM A;  1WIE A;  2J6F A;  2ROL A;  3VS5 A;  5I22 A;  1W1F A;  2LQW A;  4WCI A;  1YWP A;  3I35 A;  1UJY A;  4JPB W;  3UAT A;  4D8D A;  1GFC A;  1X69 A;  2JM8 A;  1A0N B;  3THK A;  4RTZ A;  1CKB A;  2A37 A;  4J9C A;  5I11 A;  2NWM A;  2GGR A;  1EFN A;  2RQT A;  1GCQ A;  2L3P A;  4J9B A;  1YWO A;  4OMP A;  4CC3 A;  1K9A A;  1X6G A;  2ED1 A;  4GLM A;  2LP5 A;  3A98 A;  2V1Q A;  3C0C A;  2VKN A;  1I0C A;  1NYF A;  1VYV A;  3PVL A;  3H0H A;  2A08 A;  4J9I A;  2EGC A;  1LCK A;  1SEM A;  5GJV B;  1ABO A;  2K6D A;  1HD3 A;  2MCN A;  3R6N A;  4RTX A;  3M0U A;  1WDX A;  2EGE A;  4AFS C;  2EYW A;  3GBQ A;  2F2W A;  2L2P A;  5IHK A;  2JMC A;  1WLP B;  3ZL7 C;  2ECZ A;  2DLP A;  1AD5 A;  1HSQ A;  2BZ8 A;  2KE9 A;  4F17 A;  1CKA A;  1N5Z A;  2J05 A;  1Y0M A;  1GFD A;  4Z88 A;  1H3H A;  2KR3 A;  1VA7 A;  2SEM A;  2YUQ A;  3O5Z A;  1GL5 A;  4D8K A;  2C0O A;  1AWW A;  1RLP C;  1YN8 A;  4HCK A;  2A36 A;  2JXB A;  1E6G A;  2RQU A;  1V1C A;  1AEY A;  2D0N A;  2EYY A;  1WXB A;  1M8M A;  3TVT A;  2RQW A;  2ESW A;  2JS0 A;  2A28 A;  2LX7 A;  2H8H A;  2DBM A;  1JXM A;  3UA7 A;  2VVK A;  2LZ6 B;  1ARK A;  2O9S A;  1WX6 A;  2DM1 A;  2EGA A;  2LMJ A;  4J9G A;  4Z89 A;  1T3S A;  2DL7 A;  3RNJ A;  4AFZ C;  1OOT A;  2K2M A;  1ZUY A;  1K1Z A;  2G6F X;  4JJB A;  1OEB A;  2PNI A;  1RLQ C;  1UUE A;  1GCQ C;  4AG1 C;  3REA B;  2IIM A;  2ROT A;  2W0Z A;  2DNU A;  2GBQ A;  1SPK A;  4QT7 A;  2KXD A;  3VS7 A;  3H41 A;  3PE0 A;  2DYB A;  4LUE A;  1AVZ C;  2KRS A;  1NLO C;  1PKS A;  1B07 A;  2CT3 A;  1JO8 A;  3EG3 A;  3LH5 A;  3SEM A;  1KIK A;  3NGP A;  1U5S A;  2B86 A;  4JZ4 A;  2YUP A;  4K11 A;  2FRW A;  1JEG A;  1UFF A;  2MIO A;  4DEX A;  1AWJ A;  2DMO A;  4KRT A;  4A63 B;  1FYN A;  2JMA A;  2L3S A;  3UF4 A;  2CH4 W;  2ED0 A;  1J3T A;  2K79 A;  4IIM A;  1W70 A;  2LJ1 A;  2RQV A;  2D1X A;  4RUG A;  1QLY A;  2W10 A;  2RNA A;  3VS6 A;  1T0J A;  3VRY A;  2ABL A;  2RQR A;  1KFZ A;  2LCS A;  2KGT A;  2CSQ A;  4RTW A;  1ZSG A;  2OAW A;  5FWC A;  2FRY A;  4F16 A;  3SHW A;  4HXJ A;  2KEA A;  5EC7 A;  1OPL A;  2YUN A;  3FJ5 A;  1SHF A;  2K9G A;  3H0I A;  1OPK A;  1QKW A;  4E6R A;  1ZBJ A;  1NM7 A;  2KT1 A;  1M3A A;  1BB9 A;  4JJC A;  4JJD A;  2HSP A;  2YSQ A;  2KRO A;  3EG2 A;  2DL8 A;  1K0S A;  2PZ1 A;  3VS3 A;  2EBP A;  2V1R A;  2LQN A;  2X3X D;  1GRI A;  3EG0 A;  1ABQ A;  1H8K A;  1SRL A;  1B3Q A;  2O9V A;  2EQI A;  1UHC A;  5HCK A;  3M0T A;  3PVQ A;  4AFU C;  1KSW A;  1IO6 A;  2HEQ A;  2D8J A;  4OML A;  2JT4 A;  1T3L A;  3VS0 A;  3I5R A;  5IHN A;  2KXC A;  2SRC A;  1QWF A;  2C0T A;  1QWE A;  3VS4 A;  1WXT A;  2JS2 A;  2JTE A;  1U3O A;  1Y57 A;  4F14 A;  2GTO A;  1HJD A;  2OI3 A;  2PTK A; 
#chains in the Genus database with same CATH topology
 2OTL Q;  2LX9 A;  2FVU A;  4M77 F;  1QW1 A;  3EGU A;  1QVF P;  2AZS A;  3CXC P;  2IPO B;  2L3Q A;  1I8F A;  3PGG A;  2MF2 A;  4J6X A;  1KQ2 A;  1OU9 A;  2X3W D;  2RHZ A;  1D0X A;  4M75 A;  4M77 D;  3CCM A;  1VQO T;  2DX1 A;  1K0X A;  1PM3 A;  3HRT A;  4RKU E;  3VJP A;  4ATO A;  1KJW A;  4LDX A;  4DBH A;  2JNG A;  1JQQ A;  5GMK j;  4M75 F;  4XTU A;  4ZGD B;  1I07 A;  4IUT A;  1K73 U;  4RTY A;  3G6E Q;  2XKO C;  2M0Y A;  4ORZ A;  2O4X B;  2DFU A;  1OYX A;  5KE3 A;  4M75 D;  1VYU A;  1FMV A;  1ZHI A;  3HFN A;  3HRS A;  2L3R A;  2E5K A;  1NZ9 A;  1M90 U;  3CCU T;  1WZO A;  3OYK A;  4C92 E;  3G1J A;  3PT9 A;  3VYG A;  5LJ3 e;  4OB1 B;  1YJW A;  1WJQ A;  1YHQ A;  3DLL A;  3HSB A;  3EFS A;  4MMK A;  4C0Z A;  1IXD A;  3EG1 A;  3CC2 A;  4IUQ A;  1IB8 A;  4M7A G;  4ELY C;  4N4I A;  2XMF A;  3FB9 A;  1YP5 A;  2DVJ A;  5ECA A;  2ZPI B;  1JJ2 P;  1LPL A;  3LWH A;  1VYT A;  2Z0W A;  2DZC A;  2HL3 A;  5A0L A;  2FB7 A;  3RBB B;  1RAI B;  3CC7 Q;  2CZ1 B;  4ZN1 A;  2HCK A;  2V8J A;  4Q5W A;  2YWW A;  1VQP T;  1SSH A;  4RCC A;  1AOJ A;  1SG5 A;  1WHG A;  2YRC A;  3INZ A;  5DY9 A;  1D1B A;  2DJQ A;  1BCM A;  1VQM T;  3CCJ Q;  4BUG A;  1K4U S;  3GLX A;  2C0I A;  3X26 B;  2QA4 T;  1Q82 C;  2OJ2 A;  3CCQ T;  3G4S Q;  3OW2 S;  4F7U B;  2RM4 A;  2LNH B;  5IT9 E;  1WI7 A;  3RKY A;  1GCP A;  1M1K U;  2DER A;  1G2B A;  5GMK m;  1K8A U;  4BI4 A;  1TWB A;  2O2O A;  2LTO A;  2EYZ A;  5CKB A;  1X6B A;  3EH1 A;  4ZTF A;  4J9E A;  3VRZ A;  2F1L A;  1Z9Q A;  1Z9Z A;  1VQ4 T;  3AHU A;  3GOX A;  4M7A F;  2MOX A;  2OTJ Q;  3D7S B;  3JCM c;  1VIF A;  3QII A;  4JDS A;  2RMO A;  1VQ6 T;  3I9Q A;  1R8O B;  3QG1 A;  3KBG A;  5AT1 B;  1WHL A;  2J7I A;  2RPN A;  2LQK A;  2WSC E;  2EJF A;  3JCM d;  1MMD A;  1B7T A;  1YJ9 Q;  1TOV A;  4DOW A;  3RES A;  3TSZ A;  2DAQ A;  3CMA Q;  3C4S A;  1RI0 A;  4CC4 B;  2AKL A;  1NEB A;  2EQM A;  4RTV A;  1W4S A;  2LT4 A;  1M90 C;  2VYT A;  5CAI A;  2BUD A;  1YIT A;  3E2U A;  1ZQ1 A;  2CP5 A;  3TSW A;  1C0M A;  5IH2 A;  1WYX A;  2XDP A;  1QVG P;  4IUP A;  2OTL T;  1WJS A;  5GAM d;  3ER0 A;  3NTK A;  4IIO A;  2PQW A;  3EFO B;  3FLG A;  2V8K A;  5GAN 8;  2J6F A;  2ROL A;  4BD3 A;  3M4Y A;  1O75 A;  2QYZ A;  4L5G A;  1D1C A;  5CKF A;  4WCI A;  2XIC A;  1UJY A;  4JPB W;  3GNF B;  3OBY A;  1LVK A;  2E3I A;  2H3J A;  1K9M U;  4RTZ A;  5KYU A;  4J9C A;  2XU8 A;  2ZPB B;  1YCY A;  2PVG B;  2E4H A;  2RQT A;  3G6E T;  2CP6 A;  3OYC A;  4M7D B;  1K9A A;  1OX8 A;  4FSX A;  1SF9 A;  3M9Q A;  4ZGE B;  3A8H B;  2LP5 A;  3OS2 A;  2V1Q A;  2XI9 A;  3OS5 A;  3H0H A;  1X6O A;  1LCK A;  2QEX A;  5LJ3 f;  5GJV B;  4QQ6 A;  3RER A;  3A8L B;  4GLK A;  1WDX A;  2E65 A;  5HY6 A;  4MZP A;  2DJZ A;  3CCR A;  1M1F A;  5KE2 A;  2JMC A;  3L2Z A;  5CCA A;  1RAG B;  1M1G A;  3LYI A;  3PMT A;  2BZ8 A;  3E1S A;  2YLB A;  4AT1 B;  3BE3 A;  3OS0 A;  3JCM X;  2M0O A;  5GAN 4;  3OYJ A;  4M7A E;  3JCM g;  3CC7 T;  1Q86 R;  3HFO A;  1XJW B;  4X9D A;  4HCK A;  5GAN 7;  2JXB A;  1E6G A;  3QO3 A;  4IKF A;  2X9H A;  2D0N A;  3OBW A;  4OB2 B;  1M8M A;  1YIJ Q;  4OF1 A;  5DM7 R;  2LX7 A;  4NOY A;  4HKE A;  5KYW A;  2DD5 A;  2DBM A;  4IUU A;  3FJP A;  2LZ6 B;  2PU9 B;  2O9S A;  5GAM g;  2KDS A;  1G3T A;  4RMO A;  3SD4 A;  3G4S T;  3RNJ A;  2RJD A;  2OX7 A;  1OOT A;  2GFA A;  2EIF A;  2EQK A;  3OYA A;  3VUB A;  1K1Z A;  2G6F X;  3EG9 A;  4PJM A;  1OEB A;  2PNI A;  1NPR A;  2V8I A;  3OYI A;  1UUE A;  4E47 A;  1D3B B;  3QYH B;  4A4G A;  2W0Z A;  3VS7 A;  2K4Y A;  1B07 A;  3CCM Q;  2NUP A;  3SFM A;  2YUP A;  4K11 A;  2OTJ T;  4LXC A;  2FRW A;  1JEG A;  2GFU A;  2HSE B;  3A5Z B;  2QQR A;  2MIO A;  2DMO A;  4PL6 A;  1Y96 B;  2JMA A;  2L3S A;  4F7U E;  2ED0 A;  3TU4 K;  1M9S A;  3M59 A;  1K9M C;  2RQV A;  1YJ9 T;  4RUG A;  1QLY A;  1YBY A;  3CMA T;  3LWI A;  5KYN A;  2RQR A;  5C0M A;  1NJI U;  3LW5 E;  2DXB A;  5GMK l;  2MPX C;  1OPL A;  2YUN A;  4C8Q B;  1SHF A;  3H0I A;  2MYS A;  4E6R A;  1YI2 A;  3VU3 C;  4XAX B;  2KT1 A;  4JJC A;  4C92 B;  3I55 A;  2E64 A;  2DL8 A;  1YJN Q;  1S72 A;  4PJL A;  2LQN A;  2X3X D;  3FEO A;  1QP3 A;  1H8K A;  1SRL A;  4XU0 A;  2JJ9 A;  1N8R U;  1KHI A;  1IO6 A;  1GXI E;  2VAS A;  5FU6 B;  1IHW A;  4XU1 A;  3VS0 A;  5IHN A;  1UEB A;  2KXC A;  4X34 A;  1WXT A;  2HL5 C;  2QG9 B;  1Y57 A;  2X4J A;  2GTO A;  3CCU Q;  1WPY A;  2R5A A;  2EJG A;  3EH2 A;  3CD6 A;  4C92 C;  2CUB A;  5I21 A;  4L59 A;  2DYI A;  4HCB A;  1I1J A;  5LJ3 d;  4Z02 A;  2BTT A;  3HL8 A;  1RAD B;  1ZX6 A;  2DEQ A;  5KYX A;  2K5I A;  1OV3 A;  3DLM A;  1D0Z A;  3RMQ A;  2HMA A;  2AIR B;  2CSI A;  3CXC S;  5FU6 C;  1X43 A;  5M9O A;  3OY9 A;  1KC8 R;  2VGN A;  2K3X A;  1FWZ A;  1TUD A;  4M7D E;  1ZA2 B;  3EHQ A;  3EGD A;  1JU5 C;  4PJO G;  2RF0 A;  3UDC A;  2ATC B;  3I56 A;  3OYE A;  3EGX B;  3G71 A;  3PTA A;  2QDY B;  1KQ1 A;  4EMH A;  4JRQ A;  3QWY A;  3M56 A;  4BDZ A;  1MUZ A;  4E7I A;  5KYY A;  5GAO n;  4FYW B;  2DA9 A;  3HKS A;  3JB9 H;  2AZV A;  1MMN A;  2QTV A;  4RCB A;  2DL3 A;  1VUB A;  4PLL A;  1GBQ A;  1GBR A;  1G5V A;  1W6X A;  2JN0 A;  3QKJ A;  1YIT Q;  3S3N A;  2FPD A;  5IHI A;  2BIV A;  2A7Y A;  2KT8 A;  4QQD A;  1PNJ A;  4C5I A;  2M1H A;  1PSF A;  1JJ2 S;  4OMM A;  2QGF B;  1VQ4 Q;  4OMN A;  4X9C A;  3H0F A;  4J5Y A;  2RK2 A;  2DTH A;  4QVC A;  1KQS S;  5CKH A;  4HCC A;  3CCM T;  2D8H A;  2EYX A;  2G3R A;  1TH7 A;  2KMT A;  4MDX A;  3RIR A;  1X2K A;  3REB B;  2YRV A;  2CYZ B;  2DIL A;  1D1A A;  4DQ2 A;  5LJ5 e;  4CI0 C;  4PNO A;  2YT6 A;  4V2S A;  3M0R A;  2VC8 A;  1ZUU A;  3CBP A;  1UTI A;  2MI6 A;  5LJ3 g;  3QBY A;  1BK2 A;  5CKD A;  3OB9 A;  1FXX A;  4M78 G;  2CDT A;  3SWN A;  2QEX Q;  1HXD A;  4BI3 A;  2KYM A;  2LRQ A;  2F2V A;  3ULR B;  2BZX A;  3ZEH A;  3P8H A;  3CCR Q;  3CCV A;  3CC2 T;  3CCS Q;  3SDZ A;  3L2R A;  1HYO A;  2KYB A;  2VB6 A;  3GIB A;  5KH6 A;  1RUW A;  2HZY A;  5FU7 B;  1B34 B;  2BZY A;  3VS1 A;  1EX4 A;  3KXT A;  5GMK e;  2EAY A;  2MWP A;  4GBQ A;  4Y91 A;  3V7C A;  8AT1 B;  1YJN T;  2A0F B;  3HTR A;  2PUK B;  4BE1 A;  3MEU A;  1M3B A;  1DJ7 B;  1CSK A;  2L89 A;  1AWO A;  7AT1 B;  5L23 A;  1UGR B;  1PG5 B;  4OMO A;  3WXM B;  4M7A B;  2I0N A;  1PKT A;  3MJX A;  1SHG A;  1WHM A;  5D6Y A;  2O31 A;  4C8Q E;  4C5E A;  1YCS B;  2KVQ G;  1I5L A;  4M78 A;  5FU7 C;  3RDV A;  3JAM E;  1BBZ A;  2DXT A;  1S1N A;  1H92 A;  3NTI A;  1H64 1;  4R0K A;  4CC2 A;  4M78 F;  1QVG S;  2CT4 A;  4FIB A;  3HPW A;  1IZ6 A;  4C0D B;  3RKW A;  5I22 A;  3DB3 A;  1M5Q 1;  2LQW A;  1KQS P;  3I35 A;  2LC4 A;  3JB9 J;  2E6N A;  4M78 D;  2RJF A;  3UAT A;  2RH2 A;  2DK3 A;  1GFC A;  2M9U A;  4M7A C;  2JM8 A;  4LDU A;  3THK A;  2A37 A;  2NWM A;  2GGR A;  2CS7 A;  1EFN A;  1GCQ A;  4JS5 A;  3FIF A;  2LT1 A;  4OMP A;  1BCO A;  4Y28 E;  3A98 A;  2HBP A;  3V7S A;  3URG A;  4J9I A;  2EJ9 A;  4F04 B;  4PJO E;  5GAN h;  4DA4 A;  3R6N A;  4C0D C;  3M0U A;  2EGE A;  1VQ5 A;  5D6X A;  3MP1 A;  5IHK A;  2RA2 A;  1Q81 U;  4DBQ A;  2DXC A;  5HKC A;  4GY5 A;  1YIT T;  1QVF A;  1HSQ A;  1N27 A;  3CME Q;  2KE9 A;  2XG8 D;  1W2B S;  4O6J A;  1GFD A;  4XTW A;  1H3H A;  4M77 E;  2KR3 A;  1BYM A;  1VA7 A;  2SEM A;  3CBO A;  2YUQ A;  3O5Z A;  1VQ9 Q;  2DZ9 A;  5CKE A;  3ME9 A;  2JTF A;  1S72 Q;  3M57 A;  4HA8 A;  2RQU A;  1V1C A;  2HNI A;  1AEY A;  1IRX A;  4PK4 A;  3UPU A;  2P0P A;  1MNE A;  5D6W A;  3T9N A;  2H8H A;  4BY6 B;  2O4X A;  5LJ5 f;  3UA7 A;  4M75 E;  2VVK A;  2R57 A;  2GF7 A;  1WX6 A;  3A1P A;  3CPW A;  3PFS A;  2DKG A;  2EGA A;  4FYV B;  1Q82 R;  2RJE A;  5CO7 A;  3OYG A;  1T3S A;  2K2M A;  2FL7 A;  5J3B A;  4C0F A;  2E10 A;  1AHJ B;  1KD1 R;  2QEX T;  4EMG A;  1M2V B;  2KY9 A;  4KGX B;  3REA B;  2ROT A;  2DNU A;  2GBQ A;  1SPK A;  4JS4 A;  2P84 A;  3H41 A;  3PE0 A;  4KH0 B;  3CCR T;  1VQM A;  2KRS A;  3CCS T;  1NLO C;  1MMA A;  1PKS A;  2CT3 A;  5GAN e;  1JO8 A;  2CP7 A;  1KIK A;  1X75 C;  4BY6 C;  2HQH A;  1UFF A;  4VUB A;  4PJN A;  4EMK B;  4A63 B;  4FCY A;  5GAN j;  1BI0 A;  3JCM Q;  4L6V 5;  2E3H A;  2K79 A;  3G71 Q;  1K73 R;  1WQ7 A;  2EFI A;  2LQ8 A;  2RD1 A;  1KK7 A;  3OYB A;  3P8B B;  4BE2 A;  2V26 A;  1KFZ A;  2LCS A;  4RTW A;  1ZSG A;  2OAW A;  3O8V A;  1M90 R;  1Q86 C;  2IVW A;  3CCE Q;  1VQ6 A;  3FJ5 A;  4A4K A;  2K9G A;  3OSV A;  1UGS B;  1PCX A;  4PFO A;  1TXQ A;  1Q81 C;  1W2B P;  5GAO r;  3MP6 A;  1BB9 A;  4JJD A;  1TUG B;  2HSP A;  4EMK C;  2WSF E;  2KRO A;  1N9S A;  5CK9 A;  1K0S A;  3QPH A;  5GAN 2;  2VV5 A;  2PVO B;  3EG0 A;  1B3Q A;  1VQL A;  2EQI A;  3M0T A;  2KK4 A;  2D8J A;  2GCX A;  2QQS A;  1VOM A;  4NS5 A;  2CGH A;  2OTL A;  4M7D C;  1V76 A;  3GPL A;  2VXE A;  3OQ5 A;  1RAF B;  2CZ6 B;  5FRO A;  3JCM h;  1U3O A;  4FT4 A;  1VIE A;  4DBF A;  3EFR A;  1HJD A;  4FT2 A;  4QKU A;  2FO0 A;  2QGG A;  1ZLM A;  2GNC A;  2LNV A;  1KC8 U;  2H3E B;  1F1B B;  4Z8A A;  3OYN A;  4OGC A;  2EKO A;  2EVR A;  1XNI A;  1M1K R;  5D7U A;  6AT1 B;  1K8A R;  1VQ7 Q;  5GAM h;  3EFO A;  3H9N A;  1PSE A;  3CCV Q;  3A8O B;  3X25 B;  3CME T;  3QJ6 A;  2DET A;  1UG1 A;  1JXO A;  2C06 A;  1YI2 T;  2EKH A;  2DBK A;  1SRM A;  2VXF A;  3QWX X;  5FLX E;  1VQ9 T;  3CC4 A;  1IGQ A;  4LE9 A;  4E7S A;  2CUD A;  1LOJ A;  1BKB A;  1S72 T;  4J9F A;  2FEI A;  2RO0 A;  4B6M A;  1QKX A;  2MMP A;  2X4X A;  3S3O A;  2RJC A;  2QTX A;  3LLR A;  2MWO A;  1PD0 A;  3QUI A;  1G3S A;  1ZBX A;  2E5Q A;  3FDR A;  5LJ5 d;  4J9H A;  2ZPH B;  2X51 A;  1KHC A;  2HD0 A;  1XQH A;  3OW2 A;  2FG0 A;  3WVD B;  4LNP A;  2NUT A;  1QCO A;  3X20 B;  2L0A A;  3CC7 A;  3FC3 A;  4N4G A;  2Y4Y A;  1OQK A;  2RK1 A;  4A53 A;  3CBM A;  2XDD A;  2FPE A;  4JLI A;  3CD6 T;  1YJW Q;  1YHQ Q;  3OYM A;  3JCM P;  3MO8 A;  1HK9 A;  2DD4 A;  1RAB B;  2GQV A;  1Q95 G;  4JRP A;  3CC2 Q;  4FSS A;  1WJR A;  2J06 A;  2DRK A;  2DPP B;  2RN8 A;  3VS2 A;  2L8D A;  3CCJ A;  5GJW B;  2K3B A;  5GAN f;  3OYY A;  4HCZ A;  2KRM A;  4EDU A;  4XU2 A;  3HRU A;  1UJ0 A;  2YUO A;  3PMI A;  1AZE A;  1MHN A;  1RL2 A;  1UE9 A;  2AK5 A;  2DRM A;  3EHR A;  3MET A;  4JZ3 A;  3J81 E;  3RR6 A;  4ESR A;  3HHT B;  4KGV B;  3OMC A;  1M30 A;  2DTI A;  1EZZ B;  3L2U A;  4RG2 A;  3TEE A;  1K9M R;  1VQK A;  3G71 T;  5KCH A;  2P4R A;  1X27 A;  3MP8 A;  4OMF B;  4KUD K;  5GAM j;  2HDA A;  1Y71 A;  2RHU A;  1AWX A;  2BKD N;  1XOV A;  1QMC A;  1ZSZ A;  3QJY A;  2LJ3 A;  4HVU A;  3RUX A;  4C8Q C;  4R55 A;  3A8M B;  4X1V A;  1KC8 C;  4FW1 A;  2MAM A;  1D09 B;  4QVD A;  1VQ5 Q;  1ZA1 B;  1D3B A;  2DL4 A;  3QYG B;  2JVV A;  4FL6 A;  3CCE T;  4KGZ B;  1QP2 A;  1Q7Y R;  4C92 G;  3QZ9 B;  4PJO B;  2A3L A;  5IXF A;  1YJ9 A;  3NPF A;  3QDF A;  2NLU A;  2KRN A;  3BDL A;  5I2M A;  5LJ5 g;  4QQG A;  1Y96 A;  4ME7 A;  3UA6 A;  1M3C A;  3SWN B;  3OSS C;  2K2V A;  4M77 B;  1VQ8 A;  4PLI A;  2XHC A;  4HVV A;  3CCL A;  2D9T A;  2HKQ B;  1ZUK A;  1AT1 B;  1RAA B;  3WVE B;  4P5N A;  2DO3 A;  3E19 A;  3VV0 A;  1WXU A;  4R56 A;  2JTM A;  3J80 E;  2QDL A;  1QCF A;  4Y92 A;  3M53 A;  2ZAE A;  4PJO C;  4KUL A;  3JB9 G;  1MGQ A;  1X2Q A;  4JLG A;  1G83 A;  1OZ2 A;  4M75 B;  3M0P A;  2ZPG B;  2FPF A;  2P0K A;  1M2O A;  2QQB A;  2ENM A;  1WIE A;  1JRI A;  4C92 A;  1VQ7 T;  3VS5 A;  3CCV T;  2K57 A;  1OU8 A;  4XK8 E;  1YWP A;  3SWN C;  3L2V A;  4LDW A;  4M77 C;  1VQN A;  4A4E A;  4C92 F;  2XDB A;  2YRD A;  2CP0 A;  4J9B A;  4TVR A;  3V8K A;  4XU3 A;  2R58 A;  4N0A A;  4RG8 A;  1IHV A;  4GLM A;  4C92 D;  3C0C A;  1N9R A;  4B9W A;  1NYF A;  1VYV A;  1EIF A;  4J8O A;  2WSE E;  3QHS A;  1SEM A;  4M75 C;  4DOV A;  1ABO A;  5IAY A;  1HD3 A;  2CKK A;  1H3Z A;  2RI5 A;  3OS1 A;  4AFS C;  2EYW A;  1Y07 A;  2JOY A;  3GBQ A;  5KCO A;  2ECZ A;  2DLP A;  2HQE A;  2HKN A;  3CPF A;  2FZC B;  1BIA A;  1M8V A;  5IN1 A;  1NJI R;  4F17 A;  1N5Z A;  5LJ3 h;  1Y0M A;  4IUR A;  3JCM b;  1YJW T;  4Z88 A;  3NTH A;  1YHQ T;  1YIJ A;  2KQW A;  3MPU B;  2C0O A;  3JB9 F;  1AWW A;  1YN8 A;  2A36 A;  2RHY A;  4FYX B;  5GAN d;  3JCM J;  1VQL Q;  4ELZ C;  4WTO B;  5CQY A;  3V7R A;  1R0C B;  2RQW A;  2JS0 A;  3JB9 D;  3VYH B;  3EGX A;  4PFP A;  1O9S A;  1SSF A;  1WNL A;  3GNG A;  4FW2 A;  1JXM A;  5I2S A;  1N8R R;  3QXE B;  2EQU A;  2X4Y A;  4LDV A;  1ARK A;  4N4H A;  3JSC A;  2R5M A;  2DM1 A;  2QQ9 A;  3AT1 B;  3V8L A;  4J9G A;  4Z89 A;  1QCN A;  2OAU A;  2QI2 A;  2YHT A;  1ZUY A;  4XTY A;  1RLQ C;  3BY7 A;  1KG1 A;  9ATC B;  1GCQ C;  4AG1 C;  2IIM A;  3MEA A;  4LD9 K;  4QT7 A;  1U1S A;  3M58 A;  2AHJ B;  2DYB A;  1VQ5 T;  1RAE B;  4C5H A;  2VUB A;  1AVZ C;  3M54 A;  3S6W A;  1RAH B;  3EG3 A;  3LH5 A;  3SEM A;  3NGP A;  4JZ4 A;  3X24 B;  2D6F A;  2QK0 A;  5GAN 5;  1AWJ A;  3CPW P;  3CC4 Q;  4E7K A;  2WAC A;  2LDM A;  3UF4 A;  5GMK i;  2CH4 W;  4OP0 A;  5LL6 S;  2M16 A;  4KT0 E;  4PKC C;  3OYL A;  1W70 A;  3PIP A;  3E9F A;  2LJ1 A;  1R77 A;  2D1X A;  2LVM A;  1D0Y A;  2RNA A;  2CP3 A;  5GAO p;  3FRN A;  2ZZD A;  2E12 A;  5LJ3 j;  5GAO m;  3VRY A;  2DTO A;  4BDY A;  1OUL A;  2CSQ A;  3L2W A;  1YJN A;  1VQO A;  5FWC A;  1Y7X A;  2FRY A;  4F16 A;  4HXJ A;  2KEA A;  5EC7 A;  5C6S A;  1OPK A;  2EYQ A;  1Q86 U;  4OGE A;  1ZBJ A;  2IG0 A;  1M3A A;  5GAN g;  4MML A;  2YSQ A;  2FZG B;  2PZ1 A;  2KSS A;  2EBP A;  3M5A A;  2V1R A;  1GRI A;  3CXC A;  1B34 A;  1ABQ A;  1N6A A;  2QQA A;  1G8X A;  1TSF A;  2O9V A;  2F69 A;  2D0Q B;  1UHC A;  1YI2 Q;  3PVQ A;  1KSW A;  2CZ0 B;  5KYU B;  1QVP A;  4QW2 A;  3I55 Q;  3CCU A;  2Y4X A;  1NPP A;  5FRM A;  4J7I A;  3LX7 A;  4QVZ A;  3X28 B;  1KD1 C;  1QWF A;  2JS2 A;  2JTE A;  1P92 A;  2RI2 A;  4WF2 A;  4A54 A;  3TRE A;  4M7A A;  1WHK A;  2AT1 B;  2PUO B;  2X4W A;  1VQK Q;  1PRM C;  3M0S A;  4PJJ A;  1YNZ A;  5J39 A;  3BW1 A;  4OMQ A;  2HBW A;  4F7U G;  3QDR B;  5CQX A;  4AG2 C;  4KUI A;  1UGQ B;  1YFN A;  2GTJ A;  1VQP A;  4AFQ C;  3TCJ A;  2EW3 A;  3CD6 Q;  4KBM B;  5EG2 A;  4M7A D;  3VKI A;  1JJ2 A;  3C12 A;  1I5O B;  1UDL A;  4XQ3 A;  2CH4 A;  3JV3 A;  1K73 C;  1OI1 A;  1KQS A;  4M78 E;  2ZPF B;  2QA4 A;  3CCQ A;  5A0G A;  4EPC A;  4LN2 A;  2QAS A;  2GQI A;  5KYW B;  1VQL T;  1TTH B;  2VWF A;  2K7A A;  5DLQ E;  2F2X A;  1LNX A;  1WHJ A;  2JM9 A;  2F5K A;  1UGV A;  3OYF A;  3TQ7 P;  1G3Y A;  3H8Z A;  4E7L A;  1VQ8 Q;  1WA7 A;  3I56 Q;  2DE0 X;  4IUV A;  4C5G A;  5A2Q E;  3NMZ C;  3CCL Q;  1WHH A;  2QXF A;  1TS9 A;  4J6W A;  1E6H A;  3G7Z A;  2DF6 A;  1ACM B;  3EG9 B;  1VQ4 A;  4XTV A;  3C95 A;  5IXB A;  4F7U A;  3KFV A;  4PFZ A;  4OB3 B;  3ZFJ A;  1BU1 A;  1JB0 E;  1BI1 A;  2JUF A;  2M02 A;  5GAN 3;  2HAX A;  2HQX A;  2NUP B;  1PWT A;  4UC4 A;  4ZNX A;  4E7H A;  4F7U F;  1I4K 1;  4LDY A;  5HK0 A;  3NHN A;  2M51 A;  1WQW A;  3LGF A;  1OX9 A;  2MK5 A;  2E6Z A;  2O88 A;  2NUZ A;  3I5S A;  1PHT A;  4CC7 A;  2JW4 A;  1VQN Q;  5CR2 A;  2O01 E;  3OW2 P;  1NEG A;  3CC4 T;  1FMK A;  2NUT B;  1MND A;  3M4G A;  1TG0 A;  4BI8 B;  3Q1J A;  1Q7Y U;  1UGP B;  1M1K C;  2ZPE B;  1RI9 A;  3IQL A;  2J6K A;  4D6W A;  3CCS A;  1K8A C;  1G3W A;  2RHI A;  4DEY A;  4M7D G;  2FHD A;  1NG2 A;  1TUC A;  1C6V X;  3CQT A;  1NLP C;  1XTD A;  2COW A;  2NYS A;  5L8R E;  3MEV A;  1PRL C;  1FMW A;  3JB9 I;  1MV3 A;  1M2V A;  4EIK A;  8ATC B;  3MCA B;  4JUV A;  3PNW C;  2AKK A;  1QVG A;  1Q81 R;  2L5Q A;  3J7A F;  3VUZ A;  4RTT A;  4HVW A;  1K76 A;  4RTU A;  3G6E A;  1M27 C;  2RHX A;  3M0Q A;  4BE0 A;  2EPD A;  3CCJ T;  1U06 A;  3H6Z A;  1AZG B;  2E1H A;  4E7Z A;  4EMK A;  1E7O A;  1U1T A;  3U23 A;  2E70 A;  1NYG A;  1MV0 B;  2J6O A;  2YXY A;  3I55 T;  2LJ0 A;  1LJO A;  1I81 A;  3SB2 A;  4E7J A;  4BB7 A;  3DKM A;  1ZSZ B;  2YDL A;  2CRE A;  2K3Y A;  4LUD A;  1QQJ A;  5GAN 6;  4J9D A;  2DL5 A;  4M4Z A;  1WGS A;  5FWB A;  1UHF A;  2ZGW A;  1WFW A;  2COY A;  3QZ5 B;  4M7D A;  5GAO l;  1VQK T;  4KH1 B;  5FW9 A;  2KBT A;  5KYX B;  1SKU B;  1UEC A;  4M7D F;  2KNB B;  3MKD A;  2RB6 A;  1T0H A;  4CRI A;  1BI3 A;  3UWN A;  3LH0 A;  1W2B A;  3S3M A;  2I2L A;  2P4T A;  1W1F A;  3JCM e;  3JCM V;  3EGD B;  4M7D D;  3GF5 A;  3JCM W;  4B9X A;  4D8D A;  3PIO A;  1ZSZ C;  1X69 A;  1A0N B;  3DB4 A;  1CKB A;  5I11 A;  2BE9 B;  2L3P A;  2RI3 A;  1YWO A;  4MDW A;  2KI7 A;  3G4S A;  4CC3 A;  2FYK A;  3F70 A;  5KYY B;  1X6G A;  2ED1 A;  1IRE B;  3R6O A;  2VKN A;  1I0C A;  4OVA A;  3PVL A;  5GAM e;  2A08 A;  2K5L A;  2EGC A;  2YLC A;  1Q7Y C;  3CME A;  1VQ8 T;  3I56 T;  2K6D A;  2MCN A;  3CCL T;  4RTX A;  4FYY B;  1VQ9 A;  2VGM A;  3BFM A;  5AYF A;  2JZ2 A;  3A8G B;  2F2W A;  2L2P A;  1WLP B;  2E41 A;  3ZL7 C;  4MZM A;  4ANJ A;  1AD5 A;  4JRK A;  1VQO Q;  4LD6 A;  4FM4 B;  5HK3 A;  2Y90 A;  1CKA A;  2OTJ A;  2J05 A;  3N5B B;  4C8Q G;  1GL5 A;  4C0G A;  4D8K A;  2CZ7 B;  2COZ A;  3UT1 A;  1TU0 B;  2CP2 A;  1RLP C;  4OB0 B;  3RMS A;  1PD1 A;  4XTZ A;  4J83 A;  2EYY A;  1WXB A;  3ZBD A;  3TVT A;  2DIG A;  2ESW A;  3CEY A;  2A28 A;  1NBE B;  4E2F B;  3CMA A;  1VQN T;  4HT8 A;  2K5F A;  5J26 A;  4A4H A;  4O5V A;  3ASK A;  3E9G A;  3EAE A;  1IGU A;  3P8D A;  2LMJ A;  3LGL A;  4NL2 A;  3MEW A;  1RAC B;  2DL7 A;  4AFZ C;  4II1 A;  1JBM A;  5LJ5 h;  1OZ3 A;  4ZN3 A;  4AMC A;  3MHX A;  4JJB A;  4YTL A;  1QVF S;  2XD0 A;  4DBR A;  2B8A A;  2KXD A;  4N0A C;  4LUE A;  2LCC A;  3OYD A;  3HP9 A;  3OYH A;  1VQP Q;  2KAF A;  4C8Q A;  1U5S A;  2B86 A;  1NE8 A;  1YIJ T;  4DEX A;  4J7F A;  1R0B G;  4KRT A;  1VQM Q;  1FYN A;  4JJN K;  2QAZ A;  4C8Q F;  1MMG A;  2QA4 Q;  1J3T A;  3CCQ Q;  3CPW S;  4M77 G;  5DLO A;  1U8R A;  4IIM A;  1UB4 A;  4NL3 A;  1M4Z A;  3CCE A;  5GMK h;  2W10 A;  3V8J A;  3L42 A;  4C8Q D;  3VS6 A;  1T0J A;  4A4F A;  1NJI C;  1PC0 A;  2DEU A;  4M78 B;  2ABL A;  3JRZ A;  1FX7 A;  2KGT A;  3C94 A;  2DVE A;  2P0Q A;  2LCL A;  3SHW A;  4ZGJ B;  5FRN A;  1BIB A;  3L2Q A;  4M75 G;  1QKW A;  3QSU A;  1NM7 A;  2XK0 A;  1V29 B;  2DIQ A;  2X35 A;  3EG2 A;  3VS3 A;  5GAO q;  3L1A A;  2DXU A;  3NFC A;  4PJO A;  1VQ6 Q;  1N8R C;  2PVD B;  4JRI A;  4MZT A;  4BAC A;  4XTX A;  3JCM f;  5HCK A;  4AFU C;  2BE7 D;  2HEQ A;  4OML A;  2EWN A;  5A0D A;  5CIU A;  2FZK B;  2XID A;  2JT4 A;  2F5T X;  1T3L A;  4PJO F;  1Q82 U;  4ZTJ A;  2ZCF B;  5LJ5 j;  3I5R A;  4M78 C;  5CVI A;  3KUF A;  3M55 A;  3BDU A;  4J6Y A;  3OMG A;  2SRC A;  3GP8 A;  1X01 A;  2C0T A;  4FU6 A;  1QWE A;  3VS4 A;  1BI2 A;  4M77 A;  2EQJ A;  1C1A A;  3OA6 A;  1KD1 U;  4PJO D;  4F14 A;  2OI3 A;  2PTK A;  4HT9 A;  3RKX A;  5GAM f;  1VQ7 A; 
#chains in the Genus database with same CATH homology
 2FO0 A;  1ZLM A;  1PRM C;  2GNC A;  3M0S A;  1YNZ A;  2CUB A;  4Z8A A;  4OMQ A;  2HBW A;  3EGU A;  2EVR A;  1I1J A;  2AZS A;  2BTT A;  2L3Q A;  4AG2 C;  1ZX6 A;  2GTJ A;  2X3W D;  1OV3 A;  4AFQ C;  2DX1 A;  2EW3 A;  1K0X A;  2CSI A;  1UG1 A;  1JXO A;  1X43 A;  1KJW A;  2EKH A;  2DBK A;  1UDL A;  1SRM A;  2CH4 A;  1JQQ A;  3JV3 A;  3QWX X;  4LE9 A;  1TUD A;  1I07 A;  2CUD A;  3EHQ A;  1JU5 C;  2RF0 A;  4J9F A;  4RTY A;  2M0Y A;  2FEI A;  4ORZ A;  1QKX A;  4LN2 A;  2GQI A;  2VWF A;  2K7A A;  1VYU A;  3QWY A;  2F2X A;  2JM9 A;  1UGV A;  1MUZ A;  2E5K A;  2DA9 A;  4J9H A;  1WA7 A;  2DE0 X;  2AZV A;  3NMZ C;  2FG0 A;  2DL3 A;  4LNP A;  1E6H A;  2DF6 A;  2L0A A;  3EG1 A;  1GBQ A;  2XMF A;  5ECA A;  1W6X A;  1YP5 A;  2DVJ A;  1GBR A;  5IXB A;  2FPD A;  5IHI A;  1VYT A;  3KFV A;  2KT8 A;  2FPE A;  1PNJ A;  1BU1 A;  1PWT A;  3RBB B;  4OMM A;  4ZNX A;  4FSS A;  4OMN A;  2HCK A;  2J06 A;  3H0F A;  2DRK A;  3VS2 A;  2RN8 A;  5GJW B;  2K3B A;  3NHN A;  2M51 A;  1SSH A;  2D8H A;  2KRM A;  1AOJ A;  2EYX A;  2O88 A;  1UJ0 A;  2NUZ A;  2YUO A;  1PHT A;  3I5S A;  1AZE A;  4CC7 A;  2JW4 A;  1X2K A;  3REB B;  2DIL A;  1UE9 A;  2AK5 A;  2DRM A;  2DJQ A;  3EHR A;  4JZ3 A;  1NEG A;  1FMK A;  2YT6 A;  4ESR A;  1K4U S;  3M0R A;  1M30 A;  1TG0 A;  1ZUU A;  2C0I A;  2OJ2 A;  1UTI A;  1RI9 A;  1X27 A;  2P4R A;  3IQL A;  2LNH B;  1BK2 A;  1WI7 A;  2J6K A;  1GCP A;  2HDA A;  4DEY A;  1AWX A;  1NG2 A;  1TUC A;  1G2B A;  2CDT A;  1XOV A;  2O2O A;  1NLP C;  3CQT A;  2EYZ A;  2KYM A;  2LJ3 A;  2F2V A;  4HVU A;  1X6B A;  4X1V A;  4J9E A;  3ULR B;  2BZX A;  1PRL C;  3VRZ A;  1Z9Q A;  1MV3 A;  2DL4 A;  1Z9Z A;  4EIK A;  2KYB A;  1RUW A;  2AKK A;  2MOX A;  2BZY A;  5IXF A;  3VS1 A;  4RTT A;  4GBQ A;  4HVW A;  1K76 A;  4RTU A;  3NPF A;  2RMO A;  2KRN A;  1M27 C;  3I9Q A;  3M0Q A;  2EPD A;  1M3B A;  1CSK A;  1U06 A;  2J7I A;  1AZG B;  1E7O A;  2RPN A;  3U23 A;  1AWO A;  1NYG A;  1MV0 B;  3UA6 A;  1M3C A;  2J6O A;  2LJ0 A;  5L23 A;  3TSZ A;  2YDL A;  4OMO A;  4CC4 B;  2CRE A;  4HVV A;  2AKL A;  1NEB A;  4LUD A;  4RTV A;  2I0N A;  1PKT A;  1ZUK A;  1SHG A;  4J9D A;  2DL5 A;  2O31 A;  4M4Z A;  5FWB A;  1UHF A;  1YCS B;  1WFW A;  1WXU A;  3TSW A;  5IH2 A;  1WYX A;  2QDL A;  1QCF A;  4Y92 A;  1BBZ A;  5FW9 A;  2KBT A;  1S1N A;  4IIO A;  1H92 A;  1X2Q A;  1G83 A;  1UEC A;  4R0K A;  3M0P A;  4CC2 A;  2FPF A;  2KNB B;  2CT4 A;  1T0H A;  2ENM A;  1WIE A;  2J6F A;  2ROL A;  3VS5 A;  5I22 A;  1W1F A;  2LQW A;  4WCI A;  1YWP A;  3I35 A;  1UJY A;  4JPB W;  3UAT A;  4D8D A;  1GFC A;  1X69 A;  2JM8 A;  1A0N B;  3THK A;  4RTZ A;  1CKB A;  2A37 A;  4J9C A;  5I11 A;  2NWM A;  2GGR A;  1EFN A;  2RQT A;  1GCQ A;  2L3P A;  4J9B A;  1YWO A;  4OMP A;  4CC3 A;  1K9A A;  1X6G A;  2ED1 A;  4GLM A;  2LP5 A;  3A98 A;  2V1Q A;  3C0C A;  2VKN A;  1I0C A;  1NYF A;  1VYV A;  3PVL A;  3H0H A;  2A08 A;  4J9I A;  2EGC A;  1LCK A;  1SEM A;  5GJV B;  1ABO A;  2K6D A;  1HD3 A;  2MCN A;  3R6N A;  4RTX A;  3M0U A;  1WDX A;  2EGE A;  4AFS C;  2EYW A;  3GBQ A;  2F2W A;  2L2P A;  5IHK A;  2JMC A;  1WLP B;  3ZL7 C;  2ECZ A;  2DLP A;  1AD5 A;  1HSQ A;  2BZ8 A;  2KE9 A;  4F17 A;  1CKA A;  1N5Z A;  2J05 A;  1Y0M A;  1GFD A;  4Z88 A;  1H3H A;  2KR3 A;  1VA7 A;  2SEM A;  2YUQ A;  3O5Z A;  1GL5 A;  4D8K A;  2C0O A;  1AWW A;  1RLP C;  1YN8 A;  4HCK A;  2A36 A;  2JXB A;  1E6G A;  2RQU A;  1V1C A;  1AEY A;  2D0N A;  2EYY A;  1WXB A;  1M8M A;  3TVT A;  2RQW A;  2ESW A;  2JS0 A;  2A28 A;  2LX7 A;  2H8H A;  2DBM A;  1JXM A;  3UA7 A;  2VVK A;  2LZ6 B;  1ARK A;  2O9S A;  1WX6 A;  2DM1 A;  2EGA A;  2LMJ A;  4J9G A;  4Z89 A;  1T3S A;  2DL7 A;  3RNJ A;  4AFZ C;  1OOT A;  2K2M A;  1ZUY A;  1K1Z A;  2G6F X;  4JJB A;  1OEB A;  2PNI A;  1RLQ C;  1UUE A;  1GCQ C;  4AG1 C;  3REA B;  2IIM A;  2ROT A;  2W0Z A;  2DNU A;  2GBQ A;  1SPK A;  4QT7 A;  2KXD A;  3VS7 A;  3H41 A;  3PE0 A;  2DYB A;  4LUE A;  1AVZ C;  2KRS A;  1NLO C;  1PKS A;  1B07 A;  2CT3 A;  1JO8 A;  3EG3 A;  3LH5 A;  3SEM A;  1KIK A;  3NGP A;  1U5S A;  2B86 A;  4JZ4 A;  2YUP A;  4K11 A;  2FRW A;  1JEG A;  1UFF A;  2MIO A;  4DEX A;  1AWJ A;  2DMO A;  4KRT A;  4A63 B;  1FYN A;  2JMA A;  2L3S A;  3UF4 A;  2CH4 W;  2ED0 A;  1J3T A;  2K79 A;  4IIM A;  1W70 A;  2LJ1 A;  2RQV A;  2D1X A;  4RUG A;  1QLY A;  2W10 A;  2RNA A;  3VS6 A;  1T0J A;  3VRY A;  2ABL A;  2RQR A;  1KFZ A;  2LCS A;  2KGT A;  2CSQ A;  4RTW A;  1ZSG A;  2OAW A;  5FWC A;  2FRY A;  4F16 A;  3SHW A;  4HXJ A;  2KEA A;  5EC7 A;  1OPL A;  2YUN A;  3FJ5 A;  1SHF A;  2K9G A;  3H0I A;  1OPK A;  1QKW A;  4E6R A;  1ZBJ A;  1NM7 A;  2KT1 A;  1M3A A;  1BB9 A;  4JJC A;  4JJD A;  2HSP A;  2YSQ A;  2KRO A;  3EG2 A;  2DL8 A;  1K0S A;  2PZ1 A;  3VS3 A;  2EBP A;  2V1R A;  2LQN A;  2X3X D;  1GRI A;  3EG0 A;  1ABQ A;  1H8K A;  1SRL A;  1B3Q A;  2O9V A;  2EQI A;  1UHC A;  5HCK A;  3M0T A;  3PVQ A;  4AFU C;  1KSW A;  1IO6 A;  2HEQ A;  2D8J A;  4OML A;  2JT4 A;  1T3L A;  3VS0 A;  3I5R A;  5IHN A;  2KXC A;  2SRC A;  1QWF A;  2C0T A;  1QWE A;  3VS4 A;  1WXT A;  2JS2 A;  2JTE A;  1U3O A;  1Y57 A;  4F14 A;  2GTO A;  1HJD A;  2OI3 A;  2PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...