2CUBA

Solution structure of the sh3 domain of the human cytoplasmic protein nck1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
publication title Solution structure of the SH3 domain of the human cytoplasmic protein Nck1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cubA00
2C0IA 2KNBB 2AKKA 1K4US 1X69A 2CDTA 4KRTA 1FYNA 1RI9A 1AOJA 3VS7A 3PVLA 1J3TA 2O9SA 2FO0A 3I35A 4JZ3A 2A36A 1HD3A 2KE9A 3UA6A 2KXDA 2VVKA 3R6NA 1ZUUA 1KSWA 2VWFA 3M0RA 2JMAA 4RTYA 2EYYA 2DLPA 1SSHA 2D8HA 2SRCA 1V1CA 2AK5A 2DL8A 2KR3A 1K0SA 4R0KA 1W6XA 2RQVA 4FSSA 2JT4A 1JQQA 1JXMA 4JJCA 4JJBA 1UJYA 2YUPA 5I22A 2FPFA 1JXOA 1UDLA 2O31A 2K6DA 3TSZA 1S1NA 1QWEA 3NPFA 3EGUA 2EYXA 1T3LA 1JO8A 2LJ0A 2RF0A 2YUOA 1I0CA 4OMMA 2DNUA 3EHQA 3VS3A 2A28A 1QKWA 3RBBB 1KFZA 1SRLA 1BU1A 4CC3A 1E6HA 2LP5A 1YCSB 2KT8A 1NG2A 1UG1A 2I0NA 2DJQA 3UATA 5IHKA 2K79A 1LCKA 1U06A 2BZXA 4WCIA 2LCSA 1NLPC 1K76A 1JEGA 3U23A 1A0NB 1M3BA 2C0TA 2KRSA 4HVVA 2EVRA 1OEBA 2LX7A 3M0UA 2C0OA 2OJ2A 1PRMC 2HSPA 2K7AA 1OOTA 3VS4A 3EG1A 3VS5A 3VRYA 3M0PA 2L0AA 2LJ3A 2DL4A 2FRWA 2DVJA 1H3HA 4J9BA 2AKLA 1GCQC 2L3QA 2MCNA 2LQNA 2KXCA 3PE0A 2P4RA 2O88A 1K1ZA 4JPBW 2BTTA 1BK2A 1MV3A 2CH4W 2K3BA 1BBZA 3TVTA 3VRZA 1VYVA 2F2VA 1GL5A 2ROTA 1GRIA 2X3XD 1Z9QA 1VYUA 1M3AA 2JTEA 2K9GA 5FWBA 4F17A 1CSKA 4J9EA 1SHFA 1SRMA 2PTKA 3SHWA 4OMPA 2ENMA 2JM9A 2RN8A 1AWOA 2EBPA 1T0JA 4LNPA 2A37A 2V1RA 1T3SA 2F2XA 1BB9A 1MUZA 1TUCA 2G6FX 1WA7A 2GTJA 2JM8A 2CREA 1GBQA 2GGRA 2ED1A 2DA9A 1PHTA 1OPLA 1X27A 2JW4A 1GBRA 1RUWA 4F14A 1YNZA 2RQWA 4AFSC 2CUDA 1TG0A 3M0QA 1WFWA 2EGAA 1W70A 1Y57A 3SEMA 2EPDA 4J9IA 1WXUA 1VYTA 4QT7A 4OMOA 3H0FA 2OI3A 2D1XA 2HEQA 2KT1A 4LUDA 2GQIA 2JS2A 2YDLA 1NYFA 5IHIA 2DM1A 2DILA 1UTIA 2CSQA 2CT4A 2PZ1A 3I5RA 3VS6A 5EC7A 1AEYA 1SPKA 1I1JA 2EQIA 2KGTA 3ZL7C 2FEIA 1X43A 3C0CA 2DX1A 1GCQA 4D8DA 1CKAA 4RTWA 4M4ZA 2JS0A 3REBB 2EYZA 1AVZC 1K9AA 3QWYA 1WDXA 2M0YA 1ZLMA 2KBTA 2ESWA 2X3WD 4IIOA 2RNAA 2LMJA 3KFVA 2AZSA 4RTTA 1N5ZA 1ZUKA 1M3CA 2KYMA 4J9CA 2KYBA 1ABQA 2W10A 2F2WA 2JMCA 1FMKA 2LJ1A 3EG2A 2J06A 2KRNA 3PVQA 1YWOA 4ZNXA 1E6GA 4RUGA 1UECA 2OAWA 3EG0A 1NLOC 2W0ZA 2M51A 5ECAA 1G2BA 4Z89A 5IH2A 2XMFA 2YSQA 4JZ4A 1E7OA 4J9DA 3EHRA 1ZUYA 2ABLA 3VS0A 1WI7A 1AD5A 1PKSA 1KIKA 1K0XA 1ZSGA 5I11A 1UJ0A 4HXJA 3H0IA 1Z9ZA 2YT6A 4LUEA 1W1FA 3IQLA 1OPKA 1X2KA 1NEBA 3VS1A 2YUQA 4IIMA 4HVWA 5L23A 1B3QA 3TSWA 1Y0MA 2GTOA 2D0NA 1T0HA 1M30A 2DRKA 2LZ6B 2EKHA 2L3SA 1SHGA 2ECZA 1YP5A 1RLPC 2J7IA 5HCKA 4J9GA 5FW9A 2J6KA 1G83A 2HBWA 4RTUA 1WXBA 4CC2A 1PKTA 2LNHB 4HVUA 1HJDA 1QKXA 2FRYA 2L2PA 2CH4A 4AFUC 3CQTA 2CUBA 4J9FA 4CC7A 1KJWA 2L3PA 2JXBA 4DEXA 1H8KA 1NM7A 4HCKA 4ORZA 2AZVA 1GCPA 1YWPA 2NUZA 1WYXA 2CT3A 2EGEA 2DRMA 1U3OA 2J6FA 3H0HA 5IXBA 1UHFA 3M0SA 2KROA 2KEAA 1UFFA 3UA7A 1B07A 2DE0X 3A98A 4Z8AA 4J9HA 4DEYA 4AFZC 4GLMA 3THKA 1M27C 4LE9A 4K11A 5FWCA 2HDAA 3VS2A 2GNCA 2ED0A 1WX6A 3GBQA 2IIMA 1GFDA 2FPEA 4JJDA 4LN2A 1X6BA 3O5ZA 1X6GA 1QWFA 1ARKA 2D8JA 2PNIA 3NGPA 4AFQC 4RTZA 1WXTA 3FJ5A 2E5KA 1GFCA 2DL5A 2RQUA 4F16A 3EG3A 2A08A 1ABOA 2YUNA 2H8HA 2RMOA 2GBQA 3I9QA 1SEMA 1H92A 3JV3A 1UHCA 2DL7A 4GBQA 1VA7A 1IO6A 1AWWA 1EFNA 2FG0A 1I07A 2O9VA 3NHNA 2FPDA 3NMZC 4ESRA 1OV3A 1QCFA 4X1VA 4A63B 1AZGB 1PWTA 4OMQA 3H41A 1ZBJA 1AWXA 2RPNA 4Y92A 5IXFA 1JU5C 2BZYA 3ULRB 2DMOA 1U5SA 4RTVA 3I5SA 1XOVA 2QDLA 1YN8A 1M8MA 1X2QA 2V1QA 2HCKA 2O2OA 2DL3A 2DBKA 3QWXX 2RQTA 2RQRA 1CKBA 2LQWA 2MOXA 2K2MA 2NWMA 1NYGA 4AG1C 5GJWB 4Z88A 3M0TA 3UF4A 2EYWA 4AG2C 4RTXA 1UGVA 2EW3A 4E6RA 1ZX6A 1WLPB 4OMLA 3LH5A 1PNJA 2SEMA 2DBMA 1PRLC 1AWJA 5GJVB 3RNJA 2ROLA 4CC4B 2J05A 1AZEA 1UE9A 1UUEA 2CSIA 3REAB 2J6OA 2B86A 1RLQC 5IHNA 4OMNA 1QLYA 1MV0B 1HSQA 2MIOA 1TUDA 1WIEA 1NEGA 2DF6A 4D8KA 2EGCA 2KRMA 2VKNA 4EIKA 2DYBA 2BZ8A
chains in the Genus database with same CATH superfamily
5D6WA 2C0IA 4ZGJB 1VQNQ 3D7SB 4A4HA 2FO0A 3I55T 1RI0A 2KE9A 1IB8A 2JTFA 4V2SA 4BDZA 4KULA 1Q81R 2ZPIB 4M7AC 7AT1B 3ASKA 2JMAA 2DLPA 2D8HA 1VQ7Q 2AK5A 4M7AD 4ANJA 2IVWA 1JQQA 3NTIA 1KC8U 4BD3A 3DB3A 1TSFA 3MP6A 1Q7YR 2ZPHB 5I22A 2YUPA 1VQLQ 1TUGB 1UDLA 2O31A 3FJPA 5AT1B 3TSZA 1BI3A 1QWEA 3NPFA 2CP7A 2LJ0A 2RF0A 4OMMA 1YI2A 1R8OB 3OW2A 5GANf 3EHQA 1QCNA 1BIAA 4II1A 3GPLA 3VS3A 4J83A 3M9QA 1BU1A 1E6HA 1TS9A 2KT8A 3CD6T 1NG2A 1VIEA 5IHKA 3BDLA 5CKFA 4M78A 2LCSA 2Y90A 3QYGB 1JEGA 5KCHA 1M3BA 2C0TA 2XDBA 1YITA 1IGQA 1YJ9T 2EVRA 4WF2A 4L6V5 5L8RE 2NUPA 2O4XA 2C0OA 4MMKA 3G71T 3FC3A 1YHQT 1RAIB 3GNGA 2HL5C 3M0PA 4GLKA 5LL6S 1PC0A 1ZSZC 2DIGA 1H3HA 4J9BA 4MZPA 4JS5A 1JB0E 1GCQC 2CYZB 2L3QA 4PL6A 2LQNA 3V7RA 5D6YA 1K1ZA 1MV3A 5CKBA 5J26A 4M7DF 3HFNA 2GFUA 4FM4B 2L8DA 5FWBA 4PFPA 3KUFA 1VQPT 3OW2S 3A5ZB 4J9EA 5CIUA 2VUBA 1SHFA 2D6FA 2P0PA 2XK0A 2JOYA 2JVVA 3SHWA 5IT9E 5GANg 1TTHB 1BI0A 4C92G 2A37A 2HQHA 3OA6A 2QEXQ 3HTRA 1B34A 4KT0E 2GTJA 4RCCA 4XTXA 2CREA 1PHTA 3OMCA 3I56Q 4E7JA 5HKCA 4F14A 2RQWA 3GOXA 1BKBA 4M75D 1N8RU 5FROA 3CCVT 1G3SA 1W2BP 2EGAA 5KYNA 2V8KA 3VUBA 3SEMA 3CCUT 1WXUA 1VYTA 2RO0A 4QT7A 1NJIU 4OMOA 4PJOB 1WQ7A 4C8QE 2D1XA 3EFOA 4JRKA 2EQKA 4L59A 2YRVA 2EJGA 3H8ZA 5IHIA 2CSQA 5CK9A 2PZ1A 3I5RA 3CEYA 2KGTA 2RHZA 4OB2B 2FEIA 2X4WA 2LQKA 1UGSB 1CKAA 4PJMA 2HSEB 2E41A 1NZ9A 2EAYA 2HBPA 2JS0A 3REBB 2LC4A 2RK2A 3MP8A 3J81E 2M0YA 2OAUA 5KE3A 3H6ZA 2RNAA 1KD1U 3OYCA 2AZSA 1ZUKA 1M3CA 1MMDA 2QA4A 1D1CA 2JTMA 2KYBA 3V7SA 2F2WA 2LJ1A 2R5AA 3JRZA 1E6GA 4RUGA 1UECA 4Z02A 3EG0A 4QVZA 3N5BB 4M77E 4JZ4A 2KI7A 1ZUYA 4KGXB 3OS1A 2VB6A 1KC8R 2DO3A 4KH0B 2KK4A 3V8LA 4PKCC 2DXCA 1H3ZA 4FYYB 3CMEQ 1QVGA 1X2KA 1NEBA 4IUVA 3VS1A 4IIMA 3MHXA 5KYYA 5GAN2 4FU6A 2D0NA 4XTVA 4A4FA 5CR2A 3CCEQ 2K3YA 2J7IA 4M78B 3X24B 5GMKi 3CCMT 4M7DE 4RTUA 3VJPA 5GMKh 3CCRT 4YTLA 3S6WA 2LNHB 2PUKB 4RKUE 1VQ8T 2L2PA 2NUPB 2O4XB 3RIRA 2CP3A 1H8KA 1M2VB 3JCMc 4ORZA 1VIFA 5FLXE 1WYXA 5LJ5h 2J6FA 3H0HA 5FRMA 5LJ5g 1M1KC 1NPPA 4Z8AA 4PNOA 1TOVA 2PUOB 5EG2A 3JB9H 4M7AG 4LE9A 2QQRA 4B9XA 4EMKA 1FXXA 3JB9F 4PJOC 3VS2A 1QVGS 2HQXA 4MMLA 2YHTA 2YLBA 3M57A 4F7UA 3FIFA 1Q86U 1VQ5T 4LN2A 4QVDA 1X6BA 4PJLA 1QWFA 1X6GA 4PJOD 1WGSA 5GAOn 2L5QA 2DAQA 2DZ9A 4C92F 2CP2A 3PNWC 4FCYA 1OX8A 1OZ2A 4JRPA 1ZA1B 1JJ2A 1K73C 2XG8D 2B8AA 3EG3A 1ABOA 2K5LA 2YUNA 4ZTJA 2GBQA 3I9QA 3JV3A 4DQ2A 1IO6A 1AWWA 2FG0A 2FPDA 1M8VA 4LDXA 4FW1A 1QVFA 2DD4A 1WHJA 3VYGA 1PWTA 3EFOB 3C94A 4OMQA 1ZBJA 1AWXA 5HY6A 5IXFA 2BZYA 3ULRB 5GAOp 4N4GA 4RTVA 4KBMB 2QK0A 4UC4A 3R6OA 3I5SA 2QDLA 2E65A 2EWNA 1X2QA 4HCCA 2V1QA 2QDYB 1WHGA 1BI2A 4X34A 2Z0WA 3WXMB 2BIVA 3UDCA 2RQRA 1R0CB 1Q81U 2LQWA 4OGEA 2NWMA 4N4HA 4Z88A 4ELZC 2DTOA 2QYZA 3NFCA 1PCXA 4XU0A 1JJ2S 1OZ3A 4M78C 2ZPBB 1KD1R 2DBMA 1ACMB 3QSUA 1EX4A 2ROLA 1VQOA 3CMAT 4R55A 2J05A 4EPCA 2J6OA 2X9HA 4M78D 1HK9A 1RLQC 3CC4A 2E3HA 3M5AA 4OMNA 3OYIA 2QA4Q 1IHVA 1WHMA 1OI1A 1QVFS 4JRIA 2VKNA 1TXQA 3VU3C 4EIKA 1VQLT 3CXCP 1YIJA 4ZN3A 3E19A 2FZGB 3OS5A 3QKJA 1X69A 2EFIA 1FYNA 5GMKe 1AOJA 3PVLA 4KGZB 2O9SA 3GNFB 3M59A 1R77A 1K73R 5KYYB 3EFRA 2CKKA 5I2MA 2KSSA 1VQ4A 2JUFA 3PMTA 1D0ZA 5LJ3h 4J8OA 1M90U 5GMKj 4M7DA 1Y07A 9ATCB 2EYYA 3SB2A 5LJ5e 2VXEA 1SG5A 2P0KA 3G6EA 3JSCA 2KR3A 3RKWA 4R0KA 2JT4A 1RAEB 1IGUA 4FT4A 1BIBA 3ZEHA 1JXMA 4JJBA 4XTUA 3M4GA 1JXOA 4DBFA 2K6DA 2ZPGB 5LJ5j 3EGUA 4RMOA 1JO8A 2YUOA 1I0CA 1FMWA 1D09B 2QQAA 4C92E 5GAOq 2A7YA 1U8RA 2A28A 1O9SA 4DOVA 3HSBA 4BE1A 1N9SA 3V8KA 5C0MA 2LTOA 1D1BA 1UG1A 2K79A 4EMKB 3J7AF 1LCKA 1XQHA 1NLPC 3FB9A 3RMSA 1A0NB 4F7UB 2KRSA 2DETA 1OEBA 2LX7A 1LPLA 2OTJA 3C95A 2E3IA 2K7AA 1OOTA 3VS4A 3QBYA 3DB4A 4LDVA 2X35A 3HRUA 2FRWA 2QEXT 2DVJA 4XU2A 2HMAA 2AKLA 2QGGA 3PTAA 2MCNA 1VQ9T 4OB3B 2P4RA 3I56T 5A2QE 5CAIA 3CCSA 4JPBW 2BTTA 2DYIA 1OULA 4C5EA 2CH4W 2QI2A 2L3RA 4C5IA 3RESA 3M53A 1VYVA 2CGHA 2ROTA 2X3XD 1W2BA 1XTDA 3H9NA 3E9FA 1CSKA 4B6MA 1K9MC 2DD5A 4MZMA 1B7TA 4M75B 2JM9A 2LNVA 2QQBA 2RN8A 3EGXA 3UWNA 3JCMe 3KXTA 1BB9A 3OQ5A 3I55A 1WA7A 2JN0A 3LX7A 5DLOA 4C8QF 1X27A 4R56A 1JBMA 2E4HA 2AIRB 5GAN4 4OB0B 5KYXA 4GY5A 1Y57A 2RI5A 4PJOG 3V7CA 1WHKA 4L5GA 2E6NA 2VC8A 5J3BA 5IAYA 4LUDA 3OYJA 5AYFA 3A8LB 2BE7D 2RJFA 2X51A 2X4XA 3ZFJA 1HXDA 1UTIA 3CBMA 2CT4A 3VS6A 2KAFA 4N0AA 1VQOQ 1D1AA 3QJYA 5LJ3e 1I1JA 2EQIA 2HAXA 3ZL7C 3CD6A 3C0CA 3CMET 4D8DA 3CC4Q 3FDRA 1YJNT 4M4ZA 2MK5A 3CCQQ 3BY7A 3QWYA 3BE3A 3QHSA 4M77F 2KBTA 1XNIA 1YIJQ 5LJ3j 1WHLA 2DVEA 2WSFE 4EMKC 2LCCA 1YJ9A 1C0MA 2RB6A 2W10A 3CCET 4M7DB 3G71A 3HPWA 4E7KA 4DA4A 3EG2A 1M90R 2KRNA 3PVQA 1YHQA 2LVMA 2ZGWA 2OAWA 5J39A 1NLOC 4A4GA 2YSQA 4JDSA 2LQ8A 2ABLA 1KHIA 5CO7A 4RG8A 1AD5A 1PKSA 3AT1B 1ZSGA 3G6EQ 1VQ6A 1Z9ZA 2YT6A 4C92A 3IQLA 3JCMb 1OX9A 2COWA 3HFOA 1YJWT 2YUQA 5CKHA 1PSFA 4HVWA 2E10A 1B3QA 5KYWA 1VQPA 3TSWA 4BB7A 2GTOA 3MCAB 1S72Q 3OMGA 3CBOA 2LZ6B 3QG1A 4M78G 5HCKA 8ATCB 5GANh 2DEQA 5FW9A 2HL3A 2J6KA 5A0DA 1WXBA 1G3WA 4M75C 4CC2A 4C8QD 1QW1A 2ZCFB 3EH1A 4O5VA 2I2LA 3CQTA 2CUBA 1G3TA 4DEXA 2VV5A 3RKYA 3CCVA 3TREA 4ZTFA 2EGEA 3L2QA 1UHFA 3CCUA 2OTJQ 4ZN1A 1LJOA 3UA7A 2EIFA 5D7UA 3A98A 4HT9A 4GLMA 3THKA 2P84A 4FYVB 4QKUA 4HT8A 3CCLT 3CCSQ 2DTHA 3CC2Q 1UEBA 3EG9A 4JLGA 1WX6A 1SSFA 1F1BB 1KQSA 1NPRA 2FPEA 2RI3A 3L42A 3EGXB 4AFQC 3CBPA 4ME7A 1WXTA 2A3LA 2HZYA 3JCMQ 2XD0A 1MMAA 4M77D 2E5KA 2ZPFB 2DXBA 2A08A 1I4K1 5HK3A 1BCMA 1M1KU 3LGLA 4OGCA 1M9SA 1VQKT 5FU7B 4GBQA 3TEEA 5KYXB 2M02A 3M4YA 1EFNA 3NHNA 4FT2A 4M7DC 3NMZC 5GAN3 4X1VA 3CCJA 2XHCA 1JRIA 1OYXA 3MEWA 5GAMf 2F1LA 3SWNA 3OSVA 4C5HA 1U5SA 4FSXA 4M7DD 2COYA 3A8MB 1WPYA 1M8MA 2ZPEB 3HP9A 1G8XA 3M55A 1PSEA 4LXCA 2DBKA 1K73U 3QWXX 5GAMd 1KQSS 2YLCA 2RM4A 3BW1A 2COZA 4AG1C 3OW2P 4BACA 5LJ5d 5DY9A 3UF4A 2EYWA 4AG2C 3CCMA 1YI2Q 2EW3A 3CCRA 1ZX6A 2XDDA 5GAN7 3CD6Q 3G4SA 1PNJA 2H3EB 2SEMA 1VQ8A 1VOMA 1PRLC 2EJFA 1AWJA 5GJVB 3OYAA 1K8AC 4NL3A 4VUBA 1AT1B 3FEOA 1NJIC 1AHJB 2QXFA 2PVDB 1UE9A 1PG5B 2LRQA 4IURA 3HKSA 1YITQ 3A8OB 3QIIA 1NEGA 2QQ9A 3G71Q 1WJSA 3WVEB 1YHQQ 2BZ8A 2GF7A 5GANe 2NUTA 2KNBB 1K4US 2CDTA 4KRTA 3VS7A 1J3TA 1WZOA 4DOWA 2A36A 1D0XA 3RMQA 3UA6A 5KYWB 2KXDA 2YXYA 2VVKA 1VQ6Q 3R6NA 5GANj 1ZUUA 3PT9A 1VQ5A 2VWFA 2VASA 4RTYA 2DZCA 1UGRB 1SSHA 2GQVA 2KVQG 3G7ZA 4JJNK 3A8GB 1VQPQ 4NL2A 2DL8A 6AT1B 1K0SA 4BY6B 1W6XA 1QMCA 4FSSA 2JJ9A 1X6OA 3OYLA 3V8JA 1ZBXA 4PLLA 3E2UA 1B34B 4Y28E 2OTLT 1VQMA 2QG9B 5CKDA 5KCOA 3OYHA 3RERA 1RABB 3DLMA 1UJYA 5A0GA 3CC7T 2FPFA 3JCMV 3JCMJ 1S1NA 3X28B 2IPOB 3T9NA 2QASA 5FU6B 1SKUB 3QPHA 3L2WA 2EYXA 3NTKA 3RUXA 3LLRA 1KFZA 5FU7C 1YCSB 4C8QA 3CCVQ 3PFSA 3OBWA 5CCAA 2CZ0B 2I0NA 2DJQA 3UATA 3JCMd 4DBQA 4FW2A 1U06A 2P0QA 2BZXA 4WCIA 3RDVA 2E5QA 1K76A 4F7UG 1ZA2B 3EG9B 3X25B 4HVVA 2DXUA 1MHNA 2AT1B 2V8JA 4MDWA 3CPWA 4E7LA 1U1TA 2DJZA 5DLQE 2WACA 2OJ2A 2HSPA 3CPFA 2RHIA 4N0AC 3EG1A 3VS5A 2E12A 2L0AA 2LJ3A 4FL6A 1EIFA 1VQNT 2R5MA 4QW2A 1R0BG 2YRCA 1UB4A 3OYMA 2M16A 4XTZA 3GF5A 3UPUA 1W4SA 3PE0A 3FLGA 2NLUA 2O88A 2K5IA 2QTXA 1BK2A 3E9GA 3LGFA 4LD9K 1M1KR 1BBZA 3CMAA 1KQ2A 3TVTA 2HD0A 2DK3A 3VRZA 1I5LA 3BFMA 3M58A 2JTEA 4M77A 2BE9B 1VQ7T 2MPXC 4JLIA 2D9TA 5LJ3d 5KH6A 4PFOA 4M75G 2PTKA 4BE0A 4OMPA 3SWNB 2BUDA 2ENMA 1ZHIA 3CCJQ 1T0JA 1PM3A 2F2XA 1IZ6A 3JB9D 2G6FX 4AT1B 4PJNA 3ER0A 1GBQA 2DA9A 1OPLA 1QVGP 1M2OA 1RUWA 1GBRA 1YNZA 3OY9A 3CPWS 1VUBA 3QXEB 3PIPA 4AFSC 4PK4A 3CCQT 3HHTB 1TG0A 1WFWA 4C92D 1W70A 3E1SA 4J9IA 2ATCB 4BDYA 2X4JA 1YBYA 3L1AA 2OI3A 1ZQ1A 2CS7A 3TCJA 4BY6C 2ZZDA 3CCMQ 4E2FB 2LCLA 4M78E 2GQIA 2JS2A 1NYFA 4A53A 4E7HA 3G4SQ 2F69A 3OYBA 4D6WA 1Q82C 4P5NA 1U1SA 2FZCB 5EC7A 1AEYA 4QVCA 1SPKA 5FU6C 4ZGDB 3QUIA 2PVGB 4E7ZA 2NUTB 2DX1A 1P92A 1WJQA 2PU9B 4EMGA 4RTWA 4M7AF 1AVZC 2RJDA 1K9AA 1WDXA 1ZLMA 2X3WD 2ESWA 2K5FA 2LMJA 1S72T 3KFVA 4C5GA 1N5ZA 4KUIA 3P8DA 2VGMA 4XTWA 4M7DG 3P8HA 2ZAEA 4J9CA 3GP8A 1YCYA 2JMCA 1FMKA 4CI0C 2CP6A 2F5TX 4NS5A 2DIQA 4F04B 2XI9A 1G2BA 2QEXA 5IH2A 2XMFA 1Q7YC 3EHRA 4FYXB 1VQ5Q 1I81A 1RAFB 1VQ9A 1WI7A 2QGFB 3DKMA 1KIKA 2DKGA 5I11A 1UJ0A 1RAGB 4HXJA 4LUEA 2LX9A 2RI2A 1JJ2P 1QP2A 2DFUA 5KYUA 3JCMW 1VQMQ 2CP5A 5L23A 4RCBA 4C0ZA 4C8QB 5DM7R 2MI6A 3OYYA 2EKHA 2FYKA 1TU0B 1SHGA 2BKDN 2ECZA 1H641 3S3NA 1QVFP 4BI3A 2HBWA 3CC2T 3SWNC 1BI1A 2YWWA 1QKXA 2FRYA 1Q95G 4A4EA 2CH4A 4JRQA 4TVRA 4AFUC 4WTOB 1RACB 2F5KA 1KJWA 2L3PA 2JXBA 1NM7A 4ZGEB 2DTIA 1BYMA 2AZVA 2MWPA 2Y4YA 2CT3A 2QTVA 3PIOA 2DRMA 1Q82R 1Y7XA 5IXBA 5KE2A 3LH0A 3M56A 4J9HA 3VYHB 4K11A 3KBGA 5FWCA 5M9OA 2HDAA 4XK8E 5D6XA 2ED0A 4M77B 3O8VA 1D3BA 1TWBA 3C12A 2IIMA 1GFDA 4M75F 3CMAQ 1W2BS 2GCXA 3O5ZA 2JNGA 3X26B 1ARKA 2H3JA 2PNIA 3CMEA 2K3XA 4CRIA 1YJNA 1LNXA 5I21A 2RH2A 1GFCA 3QZ5B 1LOJA 2RQUA 2HNIA 2RD1A 3P8BB 4LDWA 4Q5WA 4A54A 1SF9A 2E6ZA 2RMOA 3CCEA 1SEMA 2DL7A 2RK1A 5HK0A 1VA7A 1YI2T 3QZ9B 3URGA 1I07A 2O9VA 4M7AE 4J7FA 1OV3A 4A63B 4PJJA 2K2VA 3H41A 1VQ4Q 1JU5C 5GANd 2P4TA 3MEVA 2DMOA 1K9MR 3JCMX 2FL7A 2X4YA 1KG1A 2LT1A 1XOVA 3GLXA 2HCKA 1YITT 1M1FA 1YJWA 2XIDA 3HRSA 2K57A 5C6SA 2RQTA 4J5YA 1CKBA 3X20B 1M2VA 2MOXA 2K2MA 1NYGA 4XU3A 2GFAA 4C8QC 4C0FA 1UGVA 4E6RA 1WLPB 4OVAA 1VQ6T 3LH5A 3EH2A 2LDMA 1TH7A 1WQWA 3MO8A 3OYDA 1N6AA 4LDYA 1KQ1A 3RNJA 4CC4B 3JB9G 3S3MA 1RADB 5GAOl 1UUEA 2CSIA 3REAB 2CZ6B 1KC8C 4F7UE 2QQSA 1QLYA 1MV0B 2MIOA 1TUDA 1WIEA 3SD4A 2CZ1B 1M1GA 2YRDA 4D8KA 3QJ6A 2KRMA 3MEAA 2DYBA 1AZGB 5GAN5 2AKKA 1RI9A 5KYUB 4BE2A 1VQ9Q 2VXFA 3I35A 4BUGA 4JZ3A 1X75C 1HD3A 3CCLA 2HKQB 5GAN6 2DEUA 4FYWB 1KSWA 4M77C 3M0RA 1K8AU 4KUDK 2SRCA 3JAME 2EKOA 3JCMP 1V1CA 3F70A 3META 1V29B 2RQVA 3MPUB 2RHYA 2MMPA 2E64A 1KK7A 4ELYC 4JJCA 5GAOm 4M75E 2HQEA 4J7IA 5IN1A 1T3LA 1VQKA 3OYGA 1YFNA 1M5Q1 4DBRA 2DNUA 3I55Q 1QKWA 3RBBB 4PJOF 1SRLA 4CC3A 2LP5A 1WNLA 4A4KA 1QQJA 1Y71A 3M54A 1N27A 1QCOA 1MGQA 4LD6A 2VYTA 1D3BB 3U23A 2CZ7B 1MNDA 2LT4A 2WSCE 4XU1A 4JUVA 4MZTA 1KHCA 5LJ5f 3G1JA 2QA4T 3NTHA 4J6YA 1XJWB 4O6JA 3M0UA 3Q1JA 1PRMC 1DJ7B 3CXCA 3CCJT 3VRYA 3L2RA 3ME9A 2DL4A 1IHWA 3EGDA 3OYFA 2KXCA 1FX7A 5CKEA 3QDFA 1N9RA 2OX7A 1I8FA 1N8RC 1YJNQ 4RG2A 3LW5E 2K3BA 3S3OA 3BDUA 2L89A 4IKFA 3L2ZA 3A8HB 2F2VA 4M7AA 4OMFB 1GL5A 1GRIA 1Z9QA 4PFZA 4X9DA 1VYUA 1C1AA 1M3AA 2K9GA 3WVDB 4F17A 5CQYA 1YJ9Q 1SRMA 4N4IA 1QP3A 1AWOA 5GAN8 3OYKA 3G4ST 2EBPA 3VUZA 2EJ9A 4LNPA 4MDXA 2V1RA 4C92B 1T3SA 2XICA 1MUZA 1TUCA 2FB7A 2JM8A 4HKEA 4NOYA 2GGRA 1OQKA 2ED1A 4E47A 5GAMh 3VKIA 2JW4A 5GAMg 8AT1B 1OU9A 1YJWQ 2CUDA 4M78F 3QDRB 3M0QA 3CXCS 1GXIE 3INZA 1KD1C 2EPDA 5A0LA 2G3RA 4OF1A 2M0OA 3H0FA 2HEQA 2OTLA 1C6VX 3SFMA 1RAAB 2KT1A 4JS4A 3CC7A 2EYQA 2YDLA 3L2UA 2O01E 2DM1A 3DLLA 2DILA 2FVUA 1RL2A 2AHJB 2IG0A 4OB1B 3OS2A 2V8IA 3EFSA 1QVPA 3JCMf 3PGGA 3OYEA 1ZSZA 1RAHB 3RR6A 1X43A 4C0DB 1GCQA 2EQUA 3A1PA 2XKOC 4QQ6A 1IXDA 5CVIA 1IRXA 1M4ZA 3HRTA 2EYZA 1VQMT 3LYIA 1MMGA 4IIOA 3CCUQ 3MKDA 2WSEE 4XQ3A 4RTTA 4HCZA 1N8RR 2R57A 4ATOA 5CQXA 2KYMA 3OYNA 4IUTA 1ABQA 4PJOE 2J06A 4BI8B 4EMHA 2MYSA 1YWOA 3RKXA 3CCLQ 4ZNXA 5ECAA 1K8AR 2DERA 2W0ZA 2M51A 4Z89A 2M9UA 1VQNA 1NJIR 1KQSP 1E7OA 4J9DA 3LWHA 1D0YA 3VS0A 1Q82U 4LDUA 3J80E 5GAOr 4M75A 2D0QB 3HL8A 1K0XA 1PD0A 1Y96A 3FRNA 3H0IA 1LVKA 1W1FA 1OPKA 3AHUA 1MNEA 5LJ3f 2QAZA 4AMCA 2DPPB 3OSSC 3SDZA 3L2VA 3QO3A 2MF2A 3TQ7P 1O75A 1PD1A 1VQ7A 4C8QG 1Y0MA 3C4SA 1I5OB 1T0HA 1M30A 2DRKA 4IUPA 3LWIA 1VQKQ 3JCMh 2L3SA 1YP5A 1RLPC 1WJRA 2MAMA 1V76A 3PMIA 1NE8A 4J9GA 1VQLA 3JCMg 1G83A 3ZBDA 2C06A 1Q86C 2KY9A 1IREB 1PKTA 3OS0A 4HVUA 1Q7YU 1HJDA 2DXTA 2RHXA 1VQOT 4C92C 4HCBA 3JB9J 4J9FA 2RJCA 4CC7A 4HCKA 3CCQA 1X01A 1GCPA 3CC4T 1HYOA 1YWPA 4J6XA 2NUZA 3EGDB 3MP1A 4XAXB 1EZZB 1U3OA 4BI4A 3M0SA 2KROA 2KEAA 1UFFA 2MWOA 1YIJT 1B07A 2DE0X 1UGQB 4DEYA 4AFZC 1M27C 2PQWA 5GMKl 4HA8A 4M7AB 4M77G 1K9MU 2GNCA 2V26A 3CCRQ 2KQWA 5GAMe 2FZKB 1G3YA 3GBQA 2A0FB 1VQ4T 4B9WA 1VQ8Q 4JJDA 4EDUA 5LJ3g 2CP0A 4KGVB 2D8JA 2R58A 3NGPA 4XTYA 4RTZA 3G6ET 2E70A 3FJ5A 5GAMj 1WHHA 2JZ2A 4E7SA 4C0DC 4IUUA 2DL5A 4F16A 1Q81C 2VGNA 1S72A 4E7IA 2KMTA 1BCOA 2H8HA 3MJXA 2XU8A 4FIBA 1H92A 1UHCA 4QQGA 4ESRA 1QCFA 4Y91A 5I2SA 3OB9A 3MEUA 5GMKm 2RPNA 4Y92A 4DBHA 3JB9I 3GIBA 2RJEA 2PVOB 3VV0A 2XDPA 3I56A 2RHUA 4PLIA 1YN8A 3QYHB 1Q86R 3TU4K 2OTLQ 1G5VA 2O2OA 2DL3A 3CC7Q 2FHDA 1ZSZB 2HKNA 4IUQA 4J6WA 2OTJT 2EQJA 5GJWB 4OP0A 2RA2A 3M0TA 4RTXA 1OU8A 3CC2A 4F7UF 2K4YA 2KDSA 4OMLA 3CCST 2M1HA 4PJOA 2EQMA 2NYSA 1M90C 4X9CA 4QQDA 3OBYA 5FRNA 1AZEA 3UT1A 1MMNA 1NBEB 2B86A 5IHNA 1FMVA 3CPWP 2Y4XA 1HSQA 4KH1B 2DF6A 1FWZA 1UGPB 4C0GA 2EGCA 2E1HA 1Y96B 3EAEA
chains in the Genus database with same CATH topology
2C0IA 2KNBB 2AKKA 1K4US 1X69A 2CDTA 4KRTA 1FYNA 1RI9A 1AOJA 3VS7A 3PVLA 1J3TA 2O9SA 2FO0A 3I35A 4JZ3A 2A36A 1HD3A 2KE9A 3UA6A 2KXDA 2VVKA 3R6NA 1ZUUA 1KSWA 2VWFA 3M0RA 2JMAA 4RTYA 2EYYA 2DLPA 1SSHA 2D8HA 2SRCA 1V1CA 2AK5A 2DL8A 2KR3A 1K0SA 4R0KA 1W6XA 2RQVA 4FSSA 2JT4A 1JQQA 1JXMA 4JJCA 4JJBA 1UJYA 2YUPA 5I22A 2FPFA 1JXOA 1UDLA 2O31A 2K6DA 3TSZA 1S1NA 1QWEA 3NPFA 3EGUA 2EYXA 1T3LA 1JO8A 2LJ0A 2RF0A 2YUOA 1I0CA 4OMMA 2DNUA 3EHQA 3VS3A 2A28A 1QKWA 3RBBB 1KFZA 1SRLA 1BU1A 4CC3A 1E6HA 2LP5A 1YCSB 2KT8A 1NG2A 1UG1A 2I0NA 2DJQA 3UATA 5IHKA 2K79A 1LCKA 1U06A 2BZXA 4WCIA 2LCSA 1NLPC 1K76A 1JEGA 3U23A 1A0NB 1M3BA 2C0TA 2KRSA 4HVVA 2EVRA 1OEBA 2LX7A 3M0UA 2C0OA 2OJ2A 1PRMC 2HSPA 2K7AA 1OOTA 3VS4A 3EG1A 3VS5A 3VRYA 3M0PA 2L0AA 2LJ3A 2DL4A 2FRWA 2DVJA 1H3HA 4J9BA 2AKLA 1GCQC 2L3QA 2MCNA 2LQNA 2KXCA 3PE0A 2P4RA 2O88A 1K1ZA 4JPBW 2BTTA 1BK2A 1MV3A 2CH4W 2K3BA 1BBZA 3TVTA 3VRZA 1VYVA 2F2VA 1GL5A 2ROTA 1GRIA 2X3XD 1Z9QA 1VYUA 1M3AA 2JTEA 2K9GA 5FWBA 4F17A 1CSKA 4J9EA 1SHFA 1SRMA 2PTKA 3SHWA 4OMPA 2ENMA 2JM9A 2RN8A 1AWOA 2EBPA 1T0JA 4LNPA 2A37A 2V1RA 1T3SA 2F2XA 1BB9A 1MUZA 1TUCA 2G6FX 1WA7A 2GTJA 2JM8A 2CREA 1GBQA 2GGRA 2ED1A 2DA9A 1PHTA 1OPLA 1X27A 2JW4A 1GBRA 1RUWA 4F14A 1YNZA 2RQWA 4AFSC 2CUDA 1TG0A 3M0QA 1WFWA 2EGAA 1W70A 1Y57A 3SEMA 2EPDA 4J9IA 1WXUA 1VYTA 4QT7A 4OMOA 3H0FA 2OI3A 2D1XA 2HEQA 2KT1A 4LUDA 2GQIA 2JS2A 2YDLA 1NYFA 5IHIA 2DM1A 2DILA 1UTIA 2CSQA 2CT4A 2PZ1A 3I5RA 3VS6A 5EC7A 1AEYA 1SPKA 1I1JA 2EQIA 2KGTA 3ZL7C 2FEIA 1X43A 3C0CA 2DX1A 1GCQA 4D8DA 1CKAA 4RTWA 4M4ZA 2JS0A 3REBB 2EYZA 1AVZC 1K9AA 3QWYA 1WDXA 2M0YA 1ZLMA 2KBTA 2ESWA 2X3WD 4IIOA 2RNAA 2LMJA 3KFVA 2AZSA 4RTTA 1N5ZA 1ZUKA 1M3CA 2KYMA 4J9CA 2KYBA 1ABQA 2W10A 2F2WA 2JMCA 1FMKA 2LJ1A 3EG2A 2J06A 2KRNA 3PVQA 1YWOA 4ZNXA 1E6GA 4RUGA 1UECA 2OAWA 3EG0A 1NLOC 2W0ZA 2M51A 5ECAA 1G2BA 4Z89A 5IH2A 2XMFA 2YSQA 4JZ4A 1E7OA 4J9DA 3EHRA 1ZUYA 2ABLA 3VS0A 1WI7A 1AD5A 1PKSA 1KIKA 1K0XA 1ZSGA 5I11A 1UJ0A 4HXJA 3H0IA 1Z9ZA 2YT6A 4LUEA 1W1FA 3IQLA 1OPKA 1X2KA 1NEBA 3VS1A 2YUQA 4IIMA 4HVWA 5L23A 1B3QA 3TSWA 1Y0MA 2GTOA 2D0NA 1T0HA 1M30A 2DRKA 2LZ6B 2EKHA 2L3SA 1SHGA 2ECZA 1YP5A 1RLPC 2J7IA 5HCKA 4J9GA 5FW9A 2J6KA 1G83A 2HBWA 4RTUA 1WXBA 4CC2A 1PKTA 2LNHB 4HVUA 1HJDA 1QKXA 2FRYA 2L2PA 2CH4A 4AFUC 3CQTA 2CUBA 4J9FA 4CC7A 1KJWA 2L3PA 2JXBA 4DEXA 1H8KA 1NM7A 4HCKA 4ORZA 2AZVA 1GCPA 1YWPA 2NUZA 1WYXA 2CT3A 2EGEA 2DRMA 1U3OA 2J6FA 3H0HA 5IXBA 1UHFA 3M0SA 2KROA 2KEAA 1UFFA 3UA7A 1B07A 2DE0X 3A98A 4Z8AA 4J9HA 4DEYA 4AFZC 4GLMA 3THKA 1M27C 4LE9A 4K11A 5FWCA 2HDAA 3VS2A 2GNCA 2ED0A 1WX6A 3GBQA 2IIMA 1GFDA 2FPEA 4JJDA 4LN2A 1X6BA 3O5ZA 1X6GA 1QWFA 1ARKA 2D8JA 2PNIA 3NGPA 4AFQC 4RTZA 1WXTA 3FJ5A 2E5KA 1GFCA 2DL5A 2RQUA 4F16A 3EG3A 2A08A 1ABOA 2YUNA 2H8HA 2RMOA 2GBQA 3I9QA 1SEMA 1H92A 3JV3A 1UHCA 2DL7A 4GBQA 1VA7A 1IO6A 1AWWA 1EFNA 2FG0A 1I07A 2O9VA 3NHNA 2FPDA 3NMZC 4ESRA 1OV3A 1QCFA 4X1VA 4A63B 1AZGB 1PWTA 4OMQA 3H41A 1ZBJA 1AWXA 2RPNA 4Y92A 5IXFA 1JU5C 2BZYA 3ULRB 2DMOA 1U5SA 4RTVA 3I5SA 1XOVA 2QDLA 1YN8A 1M8MA 1X2QA 2V1QA 2HCKA 2O2OA 2DL3A 2DBKA 3QWXX 2RQTA 2RQRA 1CKBA 2LQWA 2MOXA 2K2MA 2NWMA 1NYGA 4AG1C 5GJWB 4Z88A 3M0TA 3UF4A 2EYWA 4AG2C 4RTXA 1UGVA 2EW3A 4E6RA 1ZX6A 1WLPB 4OMLA 3LH5A 1PNJA 2SEMA 2DBMA 1PRLC 1AWJA 5GJVB 3RNJA 2ROLA 4CC4B 2J05A 1AZEA 1UE9A 1UUEA 2CSIA 3REAB 2J6OA 2B86A 1RLQC 5IHNA 4OMNA 1QLYA 1MV0B 1HSQA 2MIOA 1TUDA 1WIEA 1NEGA 2DF6A 4D8KA 2EGCA 2KRMA 2VKNA 4EIKA 2DYBA 2BZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0I A;  2KNB B;  2AKK A;  1K4U S;  1X69 A;  2CDT A;  4KRT A;  1FYN A;  1RI9 A;  1AOJ A;  3VS7 A;  3PVL A;  1J3T A;  2O9S A;  2FO0 A;  3I35 A;  4JZ3 A;  2A36 A;  1HD3 A;  2KE9 A;  3UA6 A;  2KXD A;  2VVK A;  3R6N A;  1ZUU A;  1KSW A;  2VWF A;  3M0R A;  2JMA A;  4RTY A;  2EYY A;  2DLP A;  1SSH A;  2D8H A;  2SRC A;  1V1C A;  2AK5 A;  2DL8 A;  2KR3 A;  1K0S A;  4R0K A;  1W6X A;  2RQV A;  4FSS A;  2JT4 A;  1JQQ A;  1JXM A;  4JJC A;  4JJB A;  1UJY A;  2YUP A;  5I22 A;  2FPF A;  1JXO A;  1UDL A;  2O31 A;  2K6D A;  3TSZ A;  1S1N A;  1QWE A;  3NPF A;  3EGU A;  2EYX A;  1T3L A;  1JO8 A;  2LJ0 A;  2RF0 A;  2YUO A;  1I0C A;  4OMM A;  2DNU A;  3EHQ A;  3VS3 A;  2A28 A;  1QKW A;  3RBB B;  1KFZ A;  1SRL A;  1BU1 A;  4CC3 A;  1E6H A;  2LP5 A;  1YCS B;  2KT8 A;  1NG2 A;  1UG1 A;  2I0N A;  2DJQ A;  3UAT A;  5IHK A;  2K79 A;  1LCK A;  1U06 A;  2BZX A;  4WCI A;  2LCS A;  1NLP C;  1K76 A;  1JEG A;  3U23 A;  1A0N B;  1M3B A;  2C0T A;  2KRS A;  4HVV A;  2EVR A;  1OEB A;  2LX7 A;  3M0U A;  2C0O A;  2OJ2 A;  1PRM C;  2HSP A;  2K7A A;  1OOT A;  3VS4 A;  3EG1 A;  3VS5 A;  3VRY A;  3M0P A;  2L0A A;  2LJ3 A;  2DL4 A;  2FRW A;  2DVJ A;  1H3H A;  4J9B A;  2AKL A;  1GCQ C;  2L3Q A;  2MCN A;  2LQN A;  2KXC A;  3PE0 A;  2P4R A;  2O88 A;  1K1Z A;  4JPB W;  2BTT A;  1BK2 A;  1MV3 A;  2CH4 W;  2K3B A;  1BBZ A;  3TVT A;  3VRZ A;  1VYV A;  2F2V A;  1GL5 A;  2ROT A;  1GRI A;  2X3X D;  1Z9Q A;  1VYU A;  1M3A A;  2JTE A;  2K9G A;  5FWB A;  4F17 A;  1CSK A;  4J9E A;  1SHF A;  1SRM A;  2PTK A;  3SHW A;  4OMP A;  2ENM A;  2JM9 A;  2RN8 A;  1AWO A;  2EBP A;  1T0J A;  4LNP A;  2A37 A;  2V1R A;  1T3S A;  2F2X A;  1BB9 A;  1MUZ A;  1TUC A;  2G6F X;  1WA7 A;  2GTJ A;  2JM8 A;  2CRE A;  1GBQ A;  2GGR A;  2ED1 A;  2DA9 A;  1PHT A;  1OPL A;  1X27 A;  2JW4 A;  1GBR A;  1RUW A;  4F14 A;  1YNZ A;  2RQW A;  4AFS C;  2CUD A;  1TG0 A;  3M0Q A;  1WFW A;  2EGA A;  1W70 A;  1Y57 A;  3SEM A;  2EPD A;  4J9I A;  1WXU A;  1VYT A;  4QT7 A;  4OMO A;  3H0F A;  2OI3 A;  2D1X A;  2HEQ A;  2KT1 A;  4LUD A;  2GQI A;  2JS2 A;  2YDL A;  1NYF A;  5IHI A;  2DM1 A;  2DIL A;  1UTI A;  2CSQ A;  2CT4 A;  2PZ1 A;  3I5R A;  3VS6 A;  5EC7 A;  1AEY A;  1SPK A;  1I1J A;  2EQI A;  2KGT A;  3ZL7 C;  2FEI A;  1X43 A;  3C0C A;  2DX1 A;  1GCQ A;  4D8D A;  1CKA A;  4RTW A;  4M4Z A;  2JS0 A;  3REB B;  2EYZ A;  1AVZ C;  1K9A A;  3QWY A;  1WDX A;  2M0Y A;  1ZLM A;  2KBT A;  2ESW A;  2X3W D;  4IIO A;  2RNA A;  2LMJ A;  3KFV A;  2AZS A;  4RTT A;  1N5Z A;  1ZUK A;  1M3C A;  2KYM A;  4J9C A;  2KYB A;  1ABQ A;  2W10 A;  2F2W A;  2JMC A;  1FMK A;  2LJ1 A;  3EG2 A;  2J06 A;  2KRN A;  3PVQ A;  1YWO A;  4ZNX A;  1E6G A;  4RUG A;  1UEC A;  2OAW A;  3EG0 A;  1NLO C;  2W0Z A;  2M51 A;  5ECA A;  1G2B A;  4Z89 A;  5IH2 A;  2XMF A;  2YSQ A;  4JZ4 A;  1E7O A;  4J9D A;  3EHR A;  1ZUY A;  2ABL A;  3VS0 A;  1WI7 A;  1AD5 A;  1PKS A;  1KIK A;  1K0X A;  1ZSG A;  5I11 A;  1UJ0 A;  4HXJ A;  3H0I A;  1Z9Z A;  2YT6 A;  4LUE A;  1W1F A;  3IQL A;  1OPK A;  1X2K A;  1NEB A;  3VS1 A;  2YUQ A;  4IIM A;  4HVW A;  5L23 A;  1B3Q A;  3TSW A;  1Y0M A;  2GTO A;  2D0N A;  1T0H A;  1M30 A;  2DRK A;  2LZ6 B;  2EKH A;  2L3S A;  1SHG A;  2ECZ A;  1YP5 A;  1RLP C;  2J7I A;  5HCK A;  4J9G A;  5FW9 A;  2J6K A;  1G83 A;  2HBW A;  4RTU A;  1WXB A;  4CC2 A;  1PKT A;  2LNH B;  4HVU A;  1HJD A;  1QKX A;  2FRY A;  2L2P A;  2CH4 A;  4AFU C;  3CQT A;  2CUB A;  4J9F A;  4CC7 A;  1KJW A;  2L3P A;  2JXB A;  4DEX A;  1H8K A;  1NM7 A;  4HCK A;  4ORZ A;  2AZV A;  1GCP A;  1YWP A;  2NUZ A;  1WYX A;  2CT3 A;  2EGE A;  2DRM A;  1U3O A;  2J6F A;  3H0H A;  5IXB A;  1UHF A;  3M0S A;  2KRO A;  2KEA A;  1UFF A;  3UA7 A;  1B07 A;  2DE0 X;  3A98 A;  4Z8A A;  4J9H A;  4DEY A;  4AFZ C;  4GLM A;  3THK A;  1M27 C;  4LE9 A;  4K11 A;  5FWC A;  2HDA A;  3VS2 A;  2GNC A;  2ED0 A;  1WX6 A;  3GBQ A;  2IIM A;  1GFD A;  2FPE A;  4JJD A;  4LN2 A;  1X6B A;  3O5Z A;  1X6G A;  1QWF A;  1ARK A;  2D8J A;  2PNI A;  3NGP A;  4AFQ C;  4RTZ A;  1WXT A;  3FJ5 A;  2E5K A;  1GFC A;  2DL5 A;  2RQU A;  4F16 A;  3EG3 A;  2A08 A;  1ABO A;  2YUN A;  2H8H A;  2RMO A;  2GBQ A;  3I9Q A;  1SEM A;  1H92 A;  3JV3 A;  1UHC A;  2DL7 A;  4GBQ A;  1VA7 A;  1IO6 A;  1AWW A;  1EFN A;  2FG0 A;  1I07 A;  2O9V A;  3NHN A;  2FPD A;  3NMZ C;  4ESR A;  1OV3 A;  1QCF A;  4X1V A;  4A63 B;  1AZG B;  1PWT A;  4OMQ A;  3H41 A;  1ZBJ A;  1AWX A;  2RPN A;  4Y92 A;  5IXF A;  1JU5 C;  2BZY A;  3ULR B;  2DMO A;  1U5S A;  4RTV A;  3I5S A;  1XOV A;  2QDL A;  1YN8 A;  1M8M A;  1X2Q A;  2V1Q A;  2HCK A;  2O2O A;  2DL3 A;  2DBK A;  3QWX X;  2RQT A;  2RQR A;  1CKB A;  2LQW A;  2MOX A;  2K2M A;  2NWM A;  1NYG A;  4AG1 C;  5GJW B;  4Z88 A;  3M0T A;  3UF4 A;  2EYW A;  4AG2 C;  4RTX A;  1UGV A;  2EW3 A;  4E6R A;  1ZX6 A;  1WLP B;  4OML A;  3LH5 A;  1PNJ A;  2SEM A;  2DBM A;  1PRL C;  1AWJ A;  5GJV B;  3RNJ A;  2ROL A;  4CC4 B;  2J05 A;  1AZE A;  1UE9 A;  1UUE A;  2CSI A;  3REA B;  2J6O A;  2B86 A;  1RLQ C;  5IHN A;  4OMN A;  1QLY A;  1MV0 B;  1HSQ A;  2MIO A;  1TUD A;  1WIE A;  1NEG A;  2DF6 A;  4D8K A;  2EGC A;  2KRM A;  2VKN A;  4EIK A;  2DYB A;  2BZ8 A; 
#chains in the Genus database with same CATH topology
 5D6W A;  2C0I A;  4ZGJ B;  1VQN Q;  3D7S B;  4A4H A;  2FO0 A;  3I55 T;  1RI0 A;  2KE9 A;  1IB8 A;  2JTF A;  4V2S A;  4BDZ A;  4KUL A;  1Q81 R;  2ZPI B;  4M7A C;  7AT1 B;  3ASK A;  2JMA A;  2DLP A;  2D8H A;  1VQ7 Q;  2AK5 A;  4M7A D;  4ANJ A;  2IVW A;  1JQQ A;  3NTI A;  1KC8 U;  4BD3 A;  3DB3 A;  1TSF A;  3MP6 A;  1Q7Y R;  2ZPH B;  5I22 A;  2YUP A;  1VQL Q;  1TUG B;  1UDL A;  2O31 A;  3FJP A;  5AT1 B;  3TSZ A;  1BI3 A;  1QWE A;  3NPF A;  2CP7 A;  2LJ0 A;  2RF0 A;  4OMM A;  1YI2 A;  1R8O B;  3OW2 A;  5GAN f;  3EHQ A;  1QCN A;  1BIA A;  4II1 A;  3GPL A;  3VS3 A;  4J83 A;  3M9Q A;  1BU1 A;  1E6H A;  1TS9 A;  2KT8 A;  3CD6 T;  1NG2 A;  1VIE A;  5IHK A;  3BDL A;  5CKF A;  4M78 A;  2LCS A;  2Y90 A;  3QYG B;  1JEG A;  5KCH A;  1M3B A;  2C0T A;  2XDB A;  1YIT A;  1IGQ A;  1YJ9 T;  2EVR A;  4WF2 A;  4L6V 5;  5L8R E;  2NUP A;  2O4X A;  2C0O A;  4MMK A;  3G71 T;  3FC3 A;  1YHQ T;  1RAI B;  3GNG A;  2HL5 C;  3M0P A;  4GLK A;  5LL6 S;  1PC0 A;  1ZSZ C;  2DIG A;  1H3H A;  4J9B A;  4MZP A;  4JS5 A;  1JB0 E;  1GCQ C;  2CYZ B;  2L3Q A;  4PL6 A;  2LQN A;  3V7R A;  5D6Y A;  1K1Z A;  1MV3 A;  5CKB A;  5J26 A;  4M7D F;  3HFN A;  2GFU A;  4FM4 B;  2L8D A;  5FWB A;  4PFP A;  3KUF A;  1VQP T;  3OW2 S;  3A5Z B;  4J9E A;  5CIU A;  2VUB A;  1SHF A;  2D6F A;  2P0P A;  2XK0 A;  2JOY A;  2JVV A;  3SHW A;  5IT9 E;  5GAN g;  1TTH B;  1BI0 A;  4C92 G;  2A37 A;  2HQH A;  3OA6 A;  2QEX Q;  3HTR A;  1B34 A;  4KT0 E;  2GTJ A;  4RCC A;  4XTX A;  2CRE A;  1PHT A;  3OMC A;  3I56 Q;  4E7J A;  5HKC A;  4F14 A;  2RQW A;  3GOX A;  1BKB A;  4M75 D;  1N8R U;  5FRO A;  3CCV T;  1G3S A;  1W2B P;  2EGA A;  5KYN A;  2V8K A;  3VUB A;  3SEM A;  3CCU T;  1WXU A;  1VYT A;  2RO0 A;  4QT7 A;  1NJI U;  4OMO A;  4PJO B;  1WQ7 A;  4C8Q E;  2D1X A;  3EFO A;  4JRK A;  2EQK A;  4L59 A;  2YRV A;  2EJG A;  3H8Z A;  5IHI A;  2CSQ A;  5CK9 A;  2PZ1 A;  3I5R A;  3CEY A;  2KGT A;  2RHZ A;  4OB2 B;  2FEI A;  2X4W A;  2LQK A;  1UGS B;  1CKA A;  4PJM A;  2HSE B;  2E41 A;  1NZ9 A;  2EAY A;  2HBP A;  2JS0 A;  3REB B;  2LC4 A;  2RK2 A;  3MP8 A;  3J81 E;  2M0Y A;  2OAU A;  5KE3 A;  3H6Z A;  2RNA A;  1KD1 U;  3OYC A;  2AZS A;  1ZUK A;  1M3C A;  1MMD A;  2QA4 A;  1D1C A;  2JTM A;  2KYB A;  3V7S A;  2F2W A;  2LJ1 A;  2R5A A;  3JRZ A;  1E6G A;  4RUG A;  1UEC A;  4Z02 A;  3EG0 A;  4QVZ A;  3N5B B;  4M77 E;  4JZ4 A;  2KI7 A;  1ZUY A;  4KGX B;  3OS1 A;  2VB6 A;  1KC8 R;  2DO3 A;  4KH0 B;  2KK4 A;  3V8L A;  4PKC C;  2DXC A;  1H3Z A;  4FYY B;  3CME Q;  1QVG A;  1X2K A;  1NEB A;  4IUV A;  3VS1 A;  4IIM A;  3MHX A;  5KYY A;  5GAN 2;  4FU6 A;  2D0N A;  4XTV A;  4A4F A;  5CR2 A;  3CCE Q;  2K3Y A;  2J7I A;  4M78 B;  3X24 B;  5GMK i;  3CCM T;  4M7D E;  4RTU A;  3VJP A;  5GMK h;  3CCR T;  4YTL A;  3S6W A;  2LNH B;  2PUK B;  4RKU E;  1VQ8 T;  2L2P A;  2NUP B;  2O4X B;  3RIR A;  2CP3 A;  1H8K A;  1M2V B;  3JCM c;  4ORZ A;  1VIF A;  5FLX E;  1WYX A;  5LJ5 h;  2J6F A;  3H0H A;  5FRM A;  5LJ5 g;  1M1K C;  1NPP A;  4Z8A A;  4PNO A;  1TOV A;  2PUO B;  5EG2 A;  3JB9 H;  4M7A G;  4LE9 A;  2QQR A;  4B9X A;  4EMK A;  1FXX A;  3JB9 F;  4PJO C;  3VS2 A;  1QVG S;  2HQX A;  4MML A;  2YHT A;  2YLB A;  3M57 A;  4F7U A;  3FIF A;  1Q86 U;  1VQ5 T;  4LN2 A;  4QVD A;  1X6B A;  4PJL A;  1QWF A;  1X6G A;  4PJO D;  1WGS A;  5GAO n;  2L5Q A;  2DAQ A;  2DZ9 A;  4C92 F;  2CP2 A;  3PNW C;  4FCY A;  1OX8 A;  1OZ2 A;  4JRP A;  1ZA1 B;  1JJ2 A;  1K73 C;  2XG8 D;  2B8A A;  3EG3 A;  1ABO A;  2K5L A;  2YUN A;  4ZTJ A;  2GBQ A;  3I9Q A;  3JV3 A;  4DQ2 A;  1IO6 A;  1AWW A;  2FG0 A;  2FPD A;  1M8V A;  4LDX A;  4FW1 A;  1QVF A;  2DD4 A;  1WHJ A;  3VYG A;  1PWT A;  3EFO B;  3C94 A;  4OMQ A;  1ZBJ A;  1AWX A;  5HY6 A;  5IXF A;  2BZY A;  3ULR B;  5GAO p;  4N4G A;  4RTV A;  4KBM B;  2QK0 A;  4UC4 A;  3R6O A;  3I5S A;  2QDL A;  2E65 A;  2EWN A;  1X2Q A;  4HCC A;  2V1Q A;  2QDY B;  1WHG A;  1BI2 A;  4X34 A;  2Z0W A;  3WXM B;  2BIV A;  3UDC A;  2RQR A;  1R0C B;  1Q81 U;  2LQW A;  4OGE A;  2NWM A;  4N4H A;  4Z88 A;  4ELZ C;  2DTO A;  2QYZ A;  3NFC A;  1PCX A;  4XU0 A;  1JJ2 S;  1OZ3 A;  4M78 C;  2ZPB B;  1KD1 R;  2DBM A;  1ACM B;  3QSU A;  1EX4 A;  2ROL A;  1VQO A;  3CMA T;  4R55 A;  2J05 A;  4EPC A;  2J6O A;  2X9H A;  4M78 D;  1HK9 A;  1RLQ C;  3CC4 A;  2E3H A;  3M5A A;  4OMN A;  3OYI A;  2QA4 Q;  1IHV A;  1WHM A;  1OI1 A;  1QVF S;  4JRI A;  2VKN A;  1TXQ A;  3VU3 C;  4EIK A;  1VQL T;  3CXC P;  1YIJ A;  4ZN3 A;  3E19 A;  2FZG B;  3OS5 A;  3QKJ A;  1X69 A;  2EFI A;  1FYN A;  5GMK e;  1AOJ A;  3PVL A;  4KGZ B;  2O9S A;  3GNF B;  3M59 A;  1R77 A;  1K73 R;  5KYY B;  3EFR A;  2CKK A;  5I2M A;  2KSS A;  1VQ4 A;  2JUF A;  3PMT A;  1D0Z A;  5LJ3 h;  4J8O A;  1M90 U;  5GMK j;  4M7D A;  1Y07 A;  9ATC B;  2EYY A;  3SB2 A;  5LJ5 e;  2VXE A;  1SG5 A;  2P0K A;  3G6E A;  3JSC A;  2KR3 A;  3RKW A;  4R0K A;  2JT4 A;  1RAE B;  1IGU A;  4FT4 A;  1BIB A;  3ZEH A;  1JXM A;  4JJB A;  4XTU A;  3M4G A;  1JXO A;  4DBF A;  2K6D A;  2ZPG B;  5LJ5 j;  3EGU A;  4RMO A;  1JO8 A;  2YUO A;  1I0C A;  1FMW A;  1D09 B;  2QQA A;  4C92 E;  5GAO q;  2A7Y A;  1U8R A;  2A28 A;  1O9S A;  4DOV A;  3HSB A;  4BE1 A;  1N9S A;  3V8K A;  5C0M A;  2LTO A;  1D1B A;  1UG1 A;  2K79 A;  4EMK B;  3J7A F;  1LCK A;  1XQH A;  1NLP C;  3FB9 A;  3RMS A;  1A0N B;  4F7U B;  2KRS A;  2DET A;  1OEB A;  2LX7 A;  1LPL A;  2OTJ A;  3C95 A;  2E3I A;  2K7A A;  1OOT A;  3VS4 A;  3QBY A;  3DB4 A;  4LDV A;  2X35 A;  3HRU A;  2FRW A;  2QEX T;  2DVJ A;  4XU2 A;  2HMA A;  2AKL A;  2QGG A;  3PTA A;  2MCN A;  1VQ9 T;  4OB3 B;  2P4R A;  3I56 T;  5A2Q E;  5CAI A;  3CCS A;  4JPB W;  2BTT A;  2DYI A;  1OUL A;  4C5E A;  2CH4 W;  2QI2 A;  2L3R A;  4C5I A;  3RES A;  3M53 A;  1VYV A;  2CGH A;  2ROT A;  2X3X D;  1W2B A;  1XTD A;  3H9N A;  3E9F A;  1CSK A;  4B6M A;  1K9M C;  2DD5 A;  4MZM A;  1B7T A;  4M75 B;  2JM9 A;  2LNV A;  2QQB A;  2RN8 A;  3EGX A;  3UWN A;  3JCM e;  3KXT A;  1BB9 A;  3OQ5 A;  3I55 A;  1WA7 A;  2JN0 A;  3LX7 A;  5DLO A;  4C8Q F;  1X27 A;  4R56 A;  1JBM A;  2E4H A;  2AIR B;  5GAN 4;  4OB0 B;  5KYX A;  4GY5 A;  1Y57 A;  2RI5 A;  4PJO G;  3V7C A;  1WHK A;  4L5G A;  2E6N A;  2VC8 A;  5J3B A;  5IAY A;  4LUD A;  3OYJ A;  5AYF A;  3A8L B;  2BE7 D;  2RJF A;  2X51 A;  2X4X A;  3ZFJ A;  1HXD A;  1UTI A;  3CBM A;  2CT4 A;  3VS6 A;  2KAF A;  4N0A A;  1VQO Q;  1D1A A;  3QJY A;  5LJ3 e;  1I1J A;  2EQI A;  2HAX A;  3ZL7 C;  3CD6 A;  3C0C A;  3CME T;  4D8D A;  3CC4 Q;  3FDR A;  1YJN T;  4M4Z A;  2MK5 A;  3CCQ Q;  3BY7 A;  3QWY A;  3BE3 A;  3QHS A;  4M77 F;  2KBT A;  1XNI A;  1YIJ Q;  5LJ3 j;  1WHL A;  2DVE A;  2WSF E;  4EMK C;  2LCC A;  1YJ9 A;  1C0M A;  2RB6 A;  2W10 A;  3CCE T;  4M7D B;  3G71 A;  3HPW A;  4E7K A;  4DA4 A;  3EG2 A;  1M90 R;  2KRN A;  3PVQ A;  1YHQ A;  2LVM A;  2ZGW A;  2OAW A;  5J39 A;  1NLO C;  4A4G A;  2YSQ A;  4JDS A;  2LQ8 A;  2ABL A;  1KHI A;  5CO7 A;  4RG8 A;  1AD5 A;  1PKS A;  3AT1 B;  1ZSG A;  3G6E Q;  1VQ6 A;  1Z9Z A;  2YT6 A;  4C92 A;  3IQL A;  3JCM b;  1OX9 A;  2COW A;  3HFO A;  1YJW T;  2YUQ A;  5CKH A;  1PSF A;  4HVW A;  2E10 A;  1B3Q A;  5KYW A;  1VQP A;  3TSW A;  4BB7 A;  2GTO A;  3MCA B;  1S72 Q;  3OMG A;  3CBO A;  2LZ6 B;  3QG1 A;  4M78 G;  5HCK A;  8ATC B;  5GAN h;  2DEQ A;  5FW9 A;  2HL3 A;  2J6K A;  5A0D A;  1WXB A;  1G3W A;  4M75 C;  4CC2 A;  4C8Q D;  1QW1 A;  2ZCF B;  3EH1 A;  4O5V A;  2I2L A;  3CQT A;  2CUB A;  1G3T A;  4DEX A;  2VV5 A;  3RKY A;  3CCV A;  3TRE A;  4ZTF A;  2EGE A;  3L2Q A;  1UHF A;  3CCU A;  2OTJ Q;  4ZN1 A;  1LJO A;  3UA7 A;  2EIF A;  5D7U A;  3A98 A;  4HT9 A;  4GLM A;  3THK A;  2P84 A;  4FYV B;  4QKU A;  4HT8 A;  3CCL T;  3CCS Q;  2DTH A;  3CC2 Q;  1UEB A;  3EG9 A;  4JLG A;  1WX6 A;  1SSF A;  1F1B B;  1KQS A;  1NPR A;  2FPE A;  2RI3 A;  3L42 A;  3EGX B;  4AFQ C;  3CBP A;  4ME7 A;  1WXT A;  2A3L A;  2HZY A;  3JCM Q;  2XD0 A;  1MMA A;  4M77 D;  2E5K A;  2ZPF B;  2DXB A;  2A08 A;  1I4K 1;  5HK3 A;  1BCM A;  1M1K U;  3LGL A;  4OGC A;  1M9S A;  1VQK T;  5FU7 B;  4GBQ A;  3TEE A;  5KYX B;  2M02 A;  3M4Y A;  1EFN A;  3NHN A;  4FT2 A;  4M7D C;  3NMZ C;  5GAN 3;  4X1V A;  3CCJ A;  2XHC A;  1JRI A;  1OYX A;  3MEW A;  5GAM f;  2F1L A;  3SWN A;  3OSV A;  4C5H A;  1U5S A;  4FSX A;  4M7D D;  2COY A;  3A8M B;  1WPY A;  1M8M A;  2ZPE B;  3HP9 A;  1G8X A;  3M55 A;  1PSE A;  4LXC A;  2DBK A;  1K73 U;  3QWX X;  5GAM d;  1KQS S;  2YLC A;  2RM4 A;  3BW1 A;  2COZ A;  4AG1 C;  3OW2 P;  4BAC A;  5LJ5 d;  5DY9 A;  3UF4 A;  2EYW A;  4AG2 C;  3CCM A;  1YI2 Q;  2EW3 A;  3CCR A;  1ZX6 A;  2XDD A;  5GAN 7;  3CD6 Q;  3G4S A;  1PNJ A;  2H3E B;  2SEM A;  1VQ8 A;  1VOM A;  1PRL C;  2EJF A;  1AWJ A;  5GJV B;  3OYA A;  1K8A C;  4NL3 A;  4VUB A;  1AT1 B;  3FEO A;  1NJI C;  1AHJ B;  2QXF A;  2PVD B;  1UE9 A;  1PG5 B;  2LRQ A;  4IUR A;  3HKS A;  1YIT Q;  3A8O B;  3QII A;  1NEG A;  2QQ9 A;  3G71 Q;  1WJS A;  3WVE B;  1YHQ Q;  2BZ8 A;  2GF7 A;  5GAN e;  2NUT A;  2KNB B;  1K4U S;  2CDT A;  4KRT A;  3VS7 A;  1J3T A;  1WZO A;  4DOW A;  2A36 A;  1D0X A;  3RMQ A;  3UA6 A;  5KYW B;  2KXD A;  2YXY A;  2VVK A;  1VQ6 Q;  3R6N A;  5GAN j;  1ZUU A;  3PT9 A;  1VQ5 A;  2VWF A;  2VAS A;  4RTY A;  2DZC A;  1UGR B;  1SSH A;  2GQV A;  2KVQ G;  3G7Z A;  4JJN K;  3A8G B;  1VQP Q;  4NL2 A;  2DL8 A;  6AT1 B;  1K0S A;  4BY6 B;  1W6X A;  1QMC A;  4FSS A;  2JJ9 A;  1X6O A;  3OYL A;  3V8J A;  1ZBX A;  4PLL A;  3E2U A;  1B34 B;  4Y28 E;  2OTL T;  1VQM A;  2QG9 B;  5CKD A;  5KCO A;  3OYH A;  3RER A;  1RAB B;  3DLM A;  1UJY A;  5A0G A;  3CC7 T;  2FPF A;  3JCM V;  3JCM J;  1S1N A;  3X28 B;  2IPO B;  3T9N A;  2QAS A;  5FU6 B;  1SKU B;  3QPH A;  3L2W A;  2EYX A;  3NTK A;  3RUX A;  3LLR A;  1KFZ A;  5FU7 C;  1YCS B;  4C8Q A;  3CCV Q;  3PFS A;  3OBW A;  5CCA A;  2CZ0 B;  2I0N A;  2DJQ A;  3UAT A;  3JCM d;  4DBQ A;  4FW2 A;  1U06 A;  2P0Q A;  2BZX A;  4WCI A;  3RDV A;  2E5Q A;  1K76 A;  4F7U G;  1ZA2 B;  3EG9 B;  3X25 B;  4HVV A;  2DXU A;  1MHN A;  2AT1 B;  2V8J A;  4MDW A;  3CPW A;  4E7L A;  1U1T A;  2DJZ A;  5DLQ E;  2WAC A;  2OJ2 A;  2HSP A;  3CPF A;  2RHI A;  4N0A C;  3EG1 A;  3VS5 A;  2E12 A;  2L0A A;  2LJ3 A;  4FL6 A;  1EIF A;  1VQN T;  2R5M A;  4QW2 A;  1R0B G;  2YRC A;  1UB4 A;  3OYM A;  2M16 A;  4XTZ A;  3GF5 A;  3UPU A;  1W4S A;  3PE0 A;  3FLG A;  2NLU A;  2O88 A;  2K5I A;  2QTX A;  1BK2 A;  3E9G A;  3LGF A;  4LD9 K;  1M1K R;  1BBZ A;  3CMA A;  1KQ2 A;  3TVT A;  2HD0 A;  2DK3 A;  3VRZ A;  1I5L A;  3BFM A;  3M58 A;  2JTE A;  4M77 A;  2BE9 B;  1VQ7 T;  2MPX C;  4JLI A;  2D9T A;  5LJ3 d;  5KH6 A;  4PFO A;  4M75 G;  2PTK A;  4BE0 A;  4OMP A;  3SWN B;  2BUD A;  2ENM A;  1ZHI A;  3CCJ Q;  1T0J A;  1PM3 A;  2F2X A;  1IZ6 A;  3JB9 D;  2G6F X;  4AT1 B;  4PJN A;  3ER0 A;  1GBQ A;  2DA9 A;  1OPL A;  1QVG P;  1M2O A;  1RUW A;  1GBR A;  1YNZ A;  3OY9 A;  3CPW S;  1VUB A;  3QXE B;  3PIP A;  4AFS C;  4PK4 A;  3CCQ T;  3HHT B;  1TG0 A;  1WFW A;  4C92 D;  1W70 A;  3E1S A;  4J9I A;  2ATC B;  4BDY A;  2X4J A;  1YBY A;  3L1A A;  2OI3 A;  1ZQ1 A;  2CS7 A;  3TCJ A;  4BY6 C;  2ZZD A;  3CCM Q;  4E2F B;  2LCL A;  4M78 E;  2GQI A;  2JS2 A;  1NYF A;  4A53 A;  4E7H A;  3G4S Q;  2F69 A;  3OYB A;  4D6W A;  1Q82 C;  4P5N A;  1U1S A;  2FZC B;  5EC7 A;  1AEY A;  4QVC A;  1SPK A;  5FU6 C;  4ZGD B;  3QUI A;  2PVG B;  4E7Z A;  2NUT B;  2DX1 A;  1P92 A;  1WJQ A;  2PU9 B;  4EMG A;  4RTW A;  4M7A F;  1AVZ C;  2RJD A;  1K9A A;  1WDX A;  1ZLM A;  2X3W D;  2ESW A;  2K5F A;  2LMJ A;  1S72 T;  3KFV A;  4C5G A;  1N5Z A;  4KUI A;  3P8D A;  2VGM A;  4XTW A;  4M7D G;  3P8H A;  2ZAE A;  4J9C A;  3GP8 A;  1YCY A;  2JMC A;  1FMK A;  4CI0 C;  2CP6 A;  2F5T X;  4NS5 A;  2DIQ A;  4F04 B;  2XI9 A;  1G2B A;  2QEX A;  5IH2 A;  2XMF A;  1Q7Y C;  3EHR A;  4FYX B;  1VQ5 Q;  1I81 A;  1RAF B;  1VQ9 A;  1WI7 A;  2QGF B;  3DKM A;  1KIK A;  2DKG A;  5I11 A;  1UJ0 A;  1RAG B;  4HXJ A;  4LUE A;  2LX9 A;  2RI2 A;  1JJ2 P;  1QP2 A;  2DFU A;  5KYU A;  3JCM W;  1VQM Q;  2CP5 A;  5L23 A;  4RCB A;  4C0Z A;  4C8Q B;  5DM7 R;  2MI6 A;  3OYY A;  2EKH A;  2FYK A;  1TU0 B;  1SHG A;  2BKD N;  2ECZ A;  1H64 1;  3S3N A;  1QVF P;  4BI3 A;  2HBW A;  3CC2 T;  3SWN C;  1BI1 A;  2YWW A;  1QKX A;  2FRY A;  1Q95 G;  4A4E A;  2CH4 A;  4JRQ A;  4TVR A;  4AFU C;  4WTO B;  1RAC B;  2F5K A;  1KJW A;  2L3P A;  2JXB A;  1NM7 A;  4ZGE B;  2DTI A;  1BYM A;  2AZV A;  2MWP A;  2Y4Y A;  2CT3 A;  2QTV A;  3PIO A;  2DRM A;  1Q82 R;  1Y7X A;  5IXB A;  5KE2 A;  3LH0 A;  3M56 A;  4J9H A;  3VYH B;  4K11 A;  3KBG A;  5FWC A;  5M9O A;  2HDA A;  4XK8 E;  5D6X A;  2ED0 A;  4M77 B;  3O8V A;  1D3B A;  1TWB A;  3C12 A;  2IIM A;  1GFD A;  4M75 F;  3CMA Q;  1W2B S;  2GCX A;  3O5Z A;  2JNG A;  3X26 B;  1ARK A;  2H3J A;  2PNI A;  3CME A;  2K3X A;  4CRI A;  1YJN A;  1LNX A;  5I21 A;  2RH2 A;  1GFC A;  3QZ5 B;  1LOJ A;  2RQU A;  2HNI A;  2RD1 A;  3P8B B;  4LDW A;  4Q5W A;  4A54 A;  1SF9 A;  2E6Z A;  2RMO A;  3CCE A;  1SEM A;  2DL7 A;  2RK1 A;  5HK0 A;  1VA7 A;  1YI2 T;  3QZ9 B;  3URG A;  1I07 A;  2O9V A;  4M7A E;  4J7F A;  1OV3 A;  4A63 B;  4PJJ A;  2K2V A;  3H41 A;  1VQ4 Q;  1JU5 C;  5GAN d;  2P4T A;  3MEV A;  2DMO A;  1K9M R;  3JCM X;  2FL7 A;  2X4Y A;  1KG1 A;  2LT1 A;  1XOV A;  3GLX A;  2HCK A;  1YIT T;  1M1F A;  1YJW A;  2XID A;  3HRS A;  2K57 A;  5C6S A;  2RQT A;  4J5Y A;  1CKB A;  3X20 B;  1M2V A;  2MOX A;  2K2M A;  1NYG A;  4XU3 A;  2GFA A;  4C8Q C;  4C0F A;  1UGV A;  4E6R A;  1WLP B;  4OVA A;  1VQ6 T;  3LH5 A;  3EH2 A;  2LDM A;  1TH7 A;  1WQW A;  3MO8 A;  3OYD A;  1N6A A;  4LDY A;  1KQ1 A;  3RNJ A;  4CC4 B;  3JB9 G;  3S3M A;  1RAD B;  5GAO l;  1UUE A;  2CSI A;  3REA B;  2CZ6 B;  1KC8 C;  4F7U E;  2QQS A;  1QLY A;  1MV0 B;  2MIO A;  1TUD A;  1WIE A;  3SD4 A;  2CZ1 B;  1M1G A;  2YRD A;  4D8K A;  3QJ6 A;  2KRM A;  3MEA A;  2DYB A;  1AZG B;  5GAN 5;  2AKK A;  1RI9 A;  5KYU B;  4BE2 A;  1VQ9 Q;  2VXF A;  3I35 A;  4BUG A;  4JZ3 A;  1X75 C;  1HD3 A;  3CCL A;  2HKQ B;  5GAN 6;  2DEU A;  4FYW B;  1KSW A;  4M77 C;  3M0R A;  1K8A U;  4KUD K;  2SRC A;  3JAM E;  2EKO A;  3JCM P;  1V1C A;  3F70 A;  3MET A;  1V29 B;  2RQV A;  3MPU B;  2RHY A;  2MMP A;  2E64 A;  1KK7 A;  4ELY C;  4JJC A;  5GAO m;  4M75 E;  2HQE A;  4J7I A;  5IN1 A;  1T3L A;  1VQK A;  3OYG A;  1YFN A;  1M5Q 1;  4DBR A;  2DNU A;  3I55 Q;  1QKW A;  3RBB B;  4PJO F;  1SRL A;  4CC3 A;  2LP5 A;  1WNL A;  4A4K A;  1QQJ A;  1Y71 A;  3M54 A;  1N27 A;  1QCO A;  1MGQ A;  4LD6 A;  2VYT A;  1D3B B;  3U23 A;  2CZ7 B;  1MND A;  2LT4 A;  2WSC E;  4XU1 A;  4JUV A;  4MZT A;  1KHC A;  5LJ5 f;  3G1J A;  2QA4 T;  3NTH A;  4J6Y A;  1XJW B;  4O6J A;  3M0U A;  3Q1J A;  1PRM C;  1DJ7 B;  3CXC A;  3CCJ T;  3VRY A;  3L2R A;  3ME9 A;  2DL4 A;  1IHW A;  3EGD A;  3OYF A;  2KXC A;  1FX7 A;  5CKE A;  3QDF A;  1N9R A;  2OX7 A;  1I8F A;  1N8R C;  1YJN Q;  4RG2 A;  3LW5 E;  2K3B A;  3S3O A;  3BDU A;  2L89 A;  4IKF A;  3L2Z A;  3A8H B;  2F2V A;  4M7A A;  4OMF B;  1GL5 A;  1GRI A;  1Z9Q A;  4PFZ A;  4X9D A;  1VYU A;  1C1A A;  1M3A A;  2K9G A;  3WVD B;  4F17 A;  5CQY A;  1YJ9 Q;  1SRM A;  4N4I A;  1QP3 A;  1AWO A;  5GAN 8;  3OYK A;  3G4S T;  2EBP A;  3VUZ A;  2EJ9 A;  4LNP A;  4MDX A;  2V1R A;  4C92 B;  1T3S A;  2XIC A;  1MUZ A;  1TUC A;  2FB7 A;  2JM8 A;  4HKE A;  4NOY A;  2GGR A;  1OQK A;  2ED1 A;  4E47 A;  5GAM h;  3VKI A;  2JW4 A;  5GAM g;  8AT1 B;  1OU9 A;  1YJW Q;  2CUD A;  4M78 F;  3QDR B;  3M0Q A;  3CXC S;  1GXI E;  3INZ A;  1KD1 C;  2EPD A;  5A0L A;  2G3R A;  4OF1 A;  2M0O A;  3H0F A;  2HEQ A;  2OTL A;  1C6V X;  3SFM A;  1RAA B;  2KT1 A;  4JS4 A;  3CC7 A;  2EYQ A;  2YDL A;  3L2U A;  2O01 E;  2DM1 A;  3DLL A;  2DIL A;  2FVU A;  1RL2 A;  2AHJ B;  2IG0 A;  4OB1 B;  3OS2 A;  2V8I A;  3EFS A;  1QVP A;  3JCM f;  3PGG A;  3OYE A;  1ZSZ A;  1RAH B;  3RR6 A;  1X43 A;  4C0D B;  1GCQ A;  2EQU A;  3A1P A;  2XKO C;  4QQ6 A;  1IXD A;  5CVI A;  1IRX A;  1M4Z A;  3HRT A;  2EYZ A;  1VQM T;  3LYI A;  1MMG A;  4IIO A;  3CCU Q;  3MKD A;  2WSE E;  4XQ3 A;  4RTT A;  4HCZ A;  1N8R R;  2R57 A;  4ATO A;  5CQX A;  2KYM A;  3OYN A;  4IUT A;  1ABQ A;  4PJO E;  2J06 A;  4BI8 B;  4EMH A;  2MYS A;  1YWO A;  3RKX A;  3CCL Q;  4ZNX A;  5ECA A;  1K8A R;  2DER A;  2W0Z A;  2M51 A;  4Z89 A;  2M9U A;  1VQN A;  1NJI R;  1KQS P;  1E7O A;  4J9D A;  3LWH A;  1D0Y A;  3VS0 A;  1Q82 U;  4LDU A;  3J80 E;  5GAO r;  4M75 A;  2D0Q B;  3HL8 A;  1K0X A;  1PD0 A;  1Y96 A;  3FRN A;  3H0I A;  1LVK A;  1W1F A;  1OPK A;  3AHU A;  1MNE A;  5LJ3 f;  2QAZ A;  4AMC A;  2DPP B;  3OSS C;  3SDZ A;  3L2V A;  3QO3 A;  2MF2 A;  3TQ7 P;  1O75 A;  1PD1 A;  1VQ7 A;  4C8Q G;  1Y0M A;  3C4S A;  1I5O B;  1T0H A;  1M30 A;  2DRK A;  4IUP A;  3LWI A;  1VQK Q;  3JCM h;  2L3S A;  1YP5 A;  1RLP C;  1WJR A;  2MAM A;  1V76 A;  3PMI A;  1NE8 A;  4J9G A;  1VQL A;  3JCM g;  1G83 A;  3ZBD A;  2C06 A;  1Q86 C;  2KY9 A;  1IRE B;  1PKT A;  3OS0 A;  4HVU A;  1Q7Y U;  1HJD A;  2DXT A;  2RHX A;  1VQO T;  4C92 C;  4HCB A;  3JB9 J;  4J9F A;  2RJC A;  4CC7 A;  4HCK A;  3CCQ A;  1X01 A;  1GCP A;  3CC4 T;  1HYO A;  1YWP A;  4J6X A;  2NUZ A;  3EGD B;  3MP1 A;  4XAX B;  1EZZ B;  1U3O A;  4BI4 A;  3M0S A;  2KRO A;  2KEA A;  1UFF A;  2MWO A;  1YIJ T;  1B07 A;  2DE0 X;  1UGQ B;  4DEY A;  4AFZ C;  1M27 C;  2PQW A;  5GMK l;  4HA8 A;  4M7A B;  4M77 G;  1K9M U;  2GNC A;  2V26 A;  3CCR Q;  2KQW A;  5GAM e;  2FZK B;  1G3Y A;  3GBQ A;  2A0F B;  1VQ4 T;  4B9W A;  1VQ8 Q;  4JJD A;  4EDU A;  5LJ3 g;  2CP0 A;  4KGV B;  2D8J A;  2R58 A;  3NGP A;  4XTY A;  4RTZ A;  3G6E T;  2E70 A;  3FJ5 A;  5GAM j;  1WHH A;  2JZ2 A;  4E7S A;  4C0D C;  4IUU A;  2DL5 A;  4F16 A;  1Q81 C;  2VGN A;  1S72 A;  4E7I A;  2KMT A;  1BCO A;  2H8H A;  3MJX A;  2XU8 A;  4FIB A;  1H92 A;  1UHC A;  4QQG A;  4ESR A;  1QCF A;  4Y91 A;  5I2S A;  3OB9 A;  3MEU A;  5GMK m;  2RPN A;  4Y92 A;  4DBH A;  3JB9 I;  3GIB A;  2RJE A;  2PVO B;  3VV0 A;  2XDP A;  3I56 A;  2RHU A;  4PLI A;  1YN8 A;  3QYH B;  1Q86 R;  3TU4 K;  2OTL Q;  1G5V A;  2O2O A;  2DL3 A;  3CC7 Q;  2FHD A;  1ZSZ B;  2HKN A;  4IUQ A;  4J6W A;  2OTJ T;  2EQJ A;  5GJW B;  4OP0 A;  2RA2 A;  3M0T A;  4RTX A;  1OU8 A;  3CC2 A;  4F7U F;  2K4Y A;  2KDS A;  4OML A;  3CCS T;  2M1H A;  4PJO A;  2EQM A;  2NYS A;  1M90 C;  4X9C A;  4QQD A;  3OBY A;  5FRN A;  1AZE A;  3UT1 A;  1MMN A;  1NBE B;  2B86 A;  5IHN A;  1FMV A;  3CPW P;  2Y4X A;  1HSQ A;  4KH1 B;  2DF6 A;  1FWZ A;  1UGP B;  4C0G A;  2EGC A;  2E1H A;  1Y96 B;  3EAE A; 
#chains in the Genus database with same CATH homology
 2C0I A;  2KNB B;  2AKK A;  1K4U S;  1X69 A;  2CDT A;  4KRT A;  1FYN A;  1RI9 A;  1AOJ A;  3VS7 A;  3PVL A;  1J3T A;  2O9S A;  2FO0 A;  3I35 A;  4JZ3 A;  2A36 A;  1HD3 A;  2KE9 A;  3UA6 A;  2KXD A;  2VVK A;  3R6N A;  1ZUU A;  1KSW A;  2VWF A;  3M0R A;  2JMA A;  4RTY A;  2EYY A;  2DLP A;  1SSH A;  2D8H A;  2SRC A;  1V1C A;  2AK5 A;  2DL8 A;  2KR3 A;  1K0S A;  4R0K A;  1W6X A;  2RQV A;  4FSS A;  2JT4 A;  1JQQ A;  1JXM A;  4JJC A;  4JJB A;  1UJY A;  2YUP A;  5I22 A;  2FPF A;  1JXO A;  1UDL A;  2O31 A;  2K6D A;  3TSZ A;  1S1N A;  1QWE A;  3NPF A;  3EGU A;  2EYX A;  1T3L A;  1JO8 A;  2LJ0 A;  2RF0 A;  2YUO A;  1I0C A;  4OMM A;  2DNU A;  3EHQ A;  3VS3 A;  2A28 A;  1QKW A;  3RBB B;  1KFZ A;  1SRL A;  1BU1 A;  4CC3 A;  1E6H A;  2LP5 A;  1YCS B;  2KT8 A;  1NG2 A;  1UG1 A;  2I0N A;  2DJQ A;  3UAT A;  5IHK A;  2K79 A;  1LCK A;  1U06 A;  2BZX A;  4WCI A;  2LCS A;  1NLP C;  1K76 A;  1JEG A;  3U23 A;  1A0N B;  1M3B A;  2C0T A;  2KRS A;  4HVV A;  2EVR A;  1OEB A;  2LX7 A;  3M0U A;  2C0O A;  2OJ2 A;  1PRM C;  2HSP A;  2K7A A;  1OOT A;  3VS4 A;  3EG1 A;  3VS5 A;  3VRY A;  3M0P A;  2L0A A;  2LJ3 A;  2DL4 A;  2FRW A;  2DVJ A;  1H3H A;  4J9B A;  2AKL A;  1GCQ C;  2L3Q A;  2MCN A;  2LQN A;  2KXC A;  3PE0 A;  2P4R A;  2O88 A;  1K1Z A;  4JPB W;  2BTT A;  1BK2 A;  1MV3 A;  2CH4 W;  2K3B A;  1BBZ A;  3TVT A;  3VRZ A;  1VYV A;  2F2V A;  1GL5 A;  2ROT A;  1GRI A;  2X3X D;  1Z9Q A;  1VYU A;  1M3A A;  2JTE A;  2K9G A;  5FWB A;  4F17 A;  1CSK A;  4J9E A;  1SHF A;  1SRM A;  2PTK A;  3SHW A;  4OMP A;  2ENM A;  2JM9 A;  2RN8 A;  1AWO A;  2EBP A;  1T0J A;  4LNP A;  2A37 A;  2V1R A;  1T3S A;  2F2X A;  1BB9 A;  1MUZ A;  1TUC A;  2G6F X;  1WA7 A;  2GTJ A;  2JM8 A;  2CRE A;  1GBQ A;  2GGR A;  2ED1 A;  2DA9 A;  1PHT A;  1OPL A;  1X27 A;  2JW4 A;  1GBR A;  1RUW A;  4F14 A;  1YNZ A;  2RQW A;  4AFS C;  2CUD A;  1TG0 A;  3M0Q A;  1WFW A;  2EGA A;  1W70 A;  1Y57 A;  3SEM A;  2EPD A;  4J9I A;  1WXU A;  1VYT A;  4QT7 A;  4OMO A;  3H0F A;  2OI3 A;  2D1X A;  2HEQ A;  2KT1 A;  4LUD A;  2GQI A;  2JS2 A;  2YDL A;  1NYF A;  5IHI A;  2DM1 A;  2DIL A;  1UTI A;  2CSQ A;  2CT4 A;  2PZ1 A;  3I5R A;  3VS6 A;  5EC7 A;  1AEY A;  1SPK A;  1I1J A;  2EQI A;  2KGT A;  3ZL7 C;  2FEI A;  1X43 A;  3C0C A;  2DX1 A;  1GCQ A;  4D8D A;  1CKA A;  4RTW A;  4M4Z A;  2JS0 A;  3REB B;  2EYZ A;  1AVZ C;  1K9A A;  3QWY A;  1WDX A;  2M0Y A;  1ZLM A;  2KBT A;  2ESW A;  2X3W D;  4IIO A;  2RNA A;  2LMJ A;  3KFV A;  2AZS A;  4RTT A;  1N5Z A;  1ZUK A;  1M3C A;  2KYM A;  4J9C A;  2KYB A;  1ABQ A;  2W10 A;  2F2W A;  2JMC A;  1FMK A;  2LJ1 A;  3EG2 A;  2J06 A;  2KRN A;  3PVQ A;  1YWO A;  4ZNX A;  1E6G A;  4RUG A;  1UEC A;  2OAW A;  3EG0 A;  1NLO C;  2W0Z A;  2M51 A;  5ECA A;  1G2B A;  4Z89 A;  5IH2 A;  2XMF A;  2YSQ A;  4JZ4 A;  1E7O A;  4J9D A;  3EHR A;  1ZUY A;  2ABL A;  3VS0 A;  1WI7 A;  1AD5 A;  1PKS A;  1KIK A;  1K0X A;  1ZSG A;  5I11 A;  1UJ0 A;  4HXJ A;  3H0I A;  1Z9Z A;  2YT6 A;  4LUE A;  1W1F A;  3IQL A;  1OPK A;  1X2K A;  1NEB A;  3VS1 A;  2YUQ A;  4IIM A;  4HVW A;  5L23 A;  1B3Q A;  3TSW A;  1Y0M A;  2GTO A;  2D0N A;  1T0H A;  1M30 A;  2DRK A;  2LZ6 B;  2EKH A;  2L3S A;  1SHG A;  2ECZ A;  1YP5 A;  1RLP C;  2J7I A;  5HCK A;  4J9G A;  5FW9 A;  2J6K A;  1G83 A;  2HBW A;  4RTU A;  1WXB A;  4CC2 A;  1PKT A;  2LNH B;  4HVU A;  1HJD A;  1QKX A;  2FRY A;  2L2P A;  2CH4 A;  4AFU C;  3CQT A;  2CUB A;  4J9F A;  4CC7 A;  1KJW A;  2L3P A;  2JXB A;  4DEX A;  1H8K A;  1NM7 A;  4HCK A;  4ORZ A;  2AZV A;  1GCP A;  1YWP A;  2NUZ A;  1WYX A;  2CT3 A;  2EGE A;  2DRM A;  1U3O A;  2J6F A;  3H0H A;  5IXB A;  1UHF A;  3M0S A;  2KRO A;  2KEA A;  1UFF A;  3UA7 A;  1B07 A;  2DE0 X;  3A98 A;  4Z8A A;  4J9H A;  4DEY A;  4AFZ C;  4GLM A;  3THK A;  1M27 C;  4LE9 A;  4K11 A;  5FWC A;  2HDA A;  3VS2 A;  2GNC A;  2ED0 A;  1WX6 A;  3GBQ A;  2IIM A;  1GFD A;  2FPE A;  4JJD A;  4LN2 A;  1X6B A;  3O5Z A;  1X6G A;  1QWF A;  1ARK A;  2D8J A;  2PNI A;  3NGP A;  4AFQ C;  4RTZ A;  1WXT A;  3FJ5 A;  2E5K A;  1GFC A;  2DL5 A;  2RQU A;  4F16 A;  3EG3 A;  2A08 A;  1ABO A;  2YUN A;  2H8H A;  2RMO A;  2GBQ A;  3I9Q A;  1SEM A;  1H92 A;  3JV3 A;  1UHC A;  2DL7 A;  4GBQ A;  1VA7 A;  1IO6 A;  1AWW A;  1EFN A;  2FG0 A;  1I07 A;  2O9V A;  3NHN A;  2FPD A;  3NMZ C;  4ESR A;  1OV3 A;  1QCF A;  4X1V A;  4A63 B;  1AZG B;  1PWT A;  4OMQ A;  3H41 A;  1ZBJ A;  1AWX A;  2RPN A;  4Y92 A;  5IXF A;  1JU5 C;  2BZY A;  3ULR B;  2DMO A;  1U5S A;  4RTV A;  3I5S A;  1XOV A;  2QDL A;  1YN8 A;  1M8M A;  1X2Q A;  2V1Q A;  2HCK A;  2O2O A;  2DL3 A;  2DBK A;  3QWX X;  2RQT A;  2RQR A;  1CKB A;  2LQW A;  2MOX A;  2K2M A;  2NWM A;  1NYG A;  4AG1 C;  5GJW B;  4Z88 A;  3M0T A;  3UF4 A;  2EYW A;  4AG2 C;  4RTX A;  1UGV A;  2EW3 A;  4E6R A;  1ZX6 A;  1WLP B;  4OML A;  3LH5 A;  1PNJ A;  2SEM A;  2DBM A;  1PRL C;  1AWJ A;  5GJV B;  3RNJ A;  2ROL A;  4CC4 B;  2J05 A;  1AZE A;  1UE9 A;  1UUE A;  2CSI A;  3REA B;  2J6O A;  2B86 A;  1RLQ C;  5IHN A;  4OMN A;  1QLY A;  1MV0 B;  1HSQ A;  2MIO A;  1TUD A;  1WIE A;  1NEG A;  2DF6 A;  4D8K A;  2EGC A;  2KRM A;  2VKN A;  4EIK A;  2DYB A;  2BZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...