2CUBA

Solution structure of the sh3 domain of the human cytoplasmic protein nck1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
88
structure length
88
Chain Sequence
GSSGSSGDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of the human cytoplasmic protein Nck1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK1
total genus 8
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cubA00
4HVVA 3M0QA 4JZ4A 2KT8A 5EC7A 5FWBA 2L0AA 2GNCA 4AFQC 3VRYA 2DNUA 3PVLA 4RTZA 2ECZA 1WLPB 1T3SA 1BBZA 3RBBB 1HD3A 1M8MA 2W10A 5I22A 2CH4A 4GBQA 3I9QA 2YUOA 1ARKA 2E5KA 2RQRA 2K6DA 3TSZA 1LCKA 2EGEA 1JO8A 2QDLA 1J3TA 1QLYA 3R6NA 2EPDA 3UF4A 2D0NA 2LCSA 4ZNXA 2JM8A 4OMLA 4RTXA 2KBTA 1SRMA 2BZYA 4Z8AA 1ZUUA 4F17A 4QT7A 1JXMA 3H0FA 3ZL7C 2VVKA 1SEMA 4HCKA 1CSKA 1JEGA 2MOXA 1WIEA 1GCPA 1Y57A 2RQUA 3I5SA 2LP5A 2L3SA 1KFZA 4JZ3A 3REAB 2EGCA 1PHTA 5IHNA 1GBRA 1CKBA 1FMKA 3EGUA 1GFCA 1WXUA 4IIMA 4OMMA 2J6KA 1U06A 3VS6A 4J9CA 1X43A 1X2QA 1AWWA 2JXBA 2HBWA 1BU1A 3UATA 4JJBA 1M27C 1U3OA 2CSQA 2O31A 4LN2A 4LUDA 2AZVA 2AK5A 1UGVA 4M4ZA 5GJVB 1HSQA 1PKSA 4OMPA 2PZ1A 1QKXA 1WFWA 3U23A 1NG2A 1QKWA 2VKNA 1X6BA 1NEGA 5ECAA 3SHWA 2CREA 4F16A 2K7AA 2CUBA 2L2PA 2KE9A 4CC7A 1QCFA 2EGAA 1YWOA 3RNJA 1PWTA 3VS5A 3H41A 2DJQA 2LX7A 1UDLA 2KXCA 1I1JA 3TVTA 1JQQA 4FSSA 2B86A 1WXTA 4WCIA 1UG1A 2EYXA 2GTJA 5IHKA 5L23A 2KEAA 1N5ZA 2HCKA 2OI3A 1HJDA 1ZUYA 4X1VA 2EBPA 2K2MA 1X2KA 4HVWA 4RTWA 1AWXA 1B3QA 3C0CA 2DVJA 2W0ZA 1RI9A 2LJ1A 1TUDA 1KJWA 1IO6A 3EG0A 4ESRA 3UA6A 2D8HA 1UFFA 1SPKA 2RQVA 1W70A 1YCSB 2XMFA 1T0HA 1UE9A 1ZX6A 1UECA 2EQIA 5FWCA 1BK2A 3EG2A 2SRCA 1Y0MA 2CSIA 4OMQA 2YUQA 3IQLA 1PRMC 1UUEA 3M0PA 4JPBW 3GBQA 1X27A 1ZUKA 4JJCA 3THKA 1A0NB 4KRTA 2KROA 1YNZA 2CH4W 1T0JA 4RTUA 1W1FA 3KFVA 3LH5A 2O9VA 2IIMA 2K3BA 4AFSC 1AWOA 1SHGA 1M3CA 4J9BA 2FEIA 4OMOA 2EYWA 1OOTA 2J06A 2C0OA 2C0IA 1EFNA 2DL7A 1G83A 2G6FX 1YWPA 2RNAA 3H0IA 2DL3A 2VWFA 4ORZA 3UA7A 2F2WA 5GJWB 2FPDA 2PTKA 2ABLA 2LNHB 1AZGB 1RUWA 2D1XA 2CDTA 4Y92A 1ZLMA 2DILA 1GFDA 3CQTA 2C0TA 1WA7A 1UTIA 4F14A 3M0SA 2YDLA 1U5SA 2JMCA 1AWJA 1NYGA 3VS7A 2AZSA 3FJ5A 2PNIA 2A36A 2JS2A 1WDXA 2LZ6B 2ROTA 1AZEA 1MV0B 1XOVA 3EG1A 2L3PA 2ENMA 1OEBA 2KNBB 1M30A 2DL8A 1AOJA 1W6XA 2DBMA 2RPNA 1AD5A 2FRWA 4J9EA 1MUZA 4RUGA 1OPLA 2M51A 2CT4A 2BZXA 2H8HA 4AFZC 2OAWA 3PVQA 5IXBA 1E7OA 1GCQA 2KR3A 4J9FA 2JM9A 1TUCA 5FW9A 4RTVA 3JV3A 1GL5A 1RLQC 2MIOA 1JXOA 1H3HA 2LMJA 2FPEA 1NLOC 2HEQA 1WXBA 4CC2A 2J6FA 2NUZA 2ED1A 2CT3A 1NM7A 1V1CA 2NWMA 2EYZA 1BB9A 1WI7A 1Z9ZA 4K11A 2P4RA 1G2BA 5IXFA 4LE9A 2K79A 3TSWA 2GGRA 4J9HA 2DM1A 2A28A 2X3XD 2BTTA 2V1RA 4E6RA 4AG2C 3I35A 3SEMA 2RMOA 3EG3A 2RQWA 2I0NA 2YUPA 4DEYA 2HSPA 2FPFA 4J9DA 4J9IA 3A98A 2O9SA 5HCKA 4HVUA 2FRYA 2MCNA 4EIKA 1OPKA 3M0TA 3VS1A 2ROLA 2YUNA 3NPFA 1SRLA 1KIKA 1K4US 1GBQA 1SHFA 2RN8A 1YP5A 1CKAA 1SSHA 1K0SA 4DEXA 3ULRB 1NEBA 4R0KA 2JW4A 3PE0A 1E6GA 1VYVA 1K9AA 2KRNA 4LNPA 2DL5A 1NLPC 4GLMA 5IHIA 5I11A 3QWXX 2GTOA 1ZSGA 2DMOA 1S1NA 2F2XA 4D8DA 2FG0A 1H92A 2GBQA 3EHQA 4IIOA 1ABOA 1QWEA 1X6GA 2HDAA 1PRLC 1TG0A 1NYFA 1VA7A 3QWYA 2D8JA 2YT6A 4JJDA 2DRMA 2JS0A 1UJYA 4D8KA 2KT1A 1PNJA 2JTEA 2F2VA 2DE0X 1H8KA 1QWFA 1UHFA 3NMZC 1M3BA 2J7IA 2ED0A 1I0CA 4AFUC 2KRMA 4RTTA 3M0RA 1VYTA 2KRSA 4CC4B 2A37A 1K0XA 2JMAA 4RTYA 1GCQC 2DLPA 1OV3A 2DYBA 2LQNA 2LJ0A 1VYUA 2V1QA 1AVZC 2A08A 1Z9QA 2J05A 4J9GA 3VS2A 2CUDA 2RF0A 1WX6A 2KGTA 1X69A 3EHRA 2J6OA 3O5ZA 1KSWA 4AG1C 3VRZA 2DBKA 2EYYA 2FO0A 1WYXA 2AKKA 2EKHA 2EVRA 2KYBA 1JU5C 2AKLA 2DX1A 2JT4A 2ESWA 1I07A 2RQTA 4OMNA 4A63B 4HXJA 2L3QA 5IH2A 1MV3A 3H0HA 3NHNA 1UHCA 4LUEA 3VS0A 2O88A 4Z88A 4Z89A 2KXDA 3M0UA 2M0YA 2KYMA 1YN8A 1FYNA 1M3AA 2O2OA 2OJ2A 2DRKA 1ABQA 2DL4A 1T3LA 4CC3A 2SEMA 3VS3A 1GRIA 1PKTA 2LJ3A 1K76A 1AEYA 2BZ8A 1E6HA 1UJ0A 1RLPC 2EW3A 2K9GA 1ZBJA 3VS4A 3I5RA 2YSQA 2X3WD 1B07A 2GQIA 3NGPA 2LQWA 2DF6A 3REBB 2DA9A 1K1ZA
chains in the Genus database with same CATH superfamily
3H8ZA 4E2FB 3SDZA 3GIBA 5FWBA 2HD0A 2GNCA 5KYWB 3MEAA 5GMKj 2QEXA 1PSEA 2OAUA 2FB7A 3VRYA 1BI3A 4C5GA 1VQMA 3PVLA 1MNEA 1WLPB 1BBZA 1C6VX 3CCQT 1HD3A 1RABB 4M77D 8AT1B 1NZ9A 5LJ5j 3CCRQ 2QAZA 2I2LA 1JO8A 2QDLA 1J3TA 3VJPA 3BDLA 2VASA 1NJIC 2EKOA 5GAOq 3UF4A 1VQ7Q 4OMLA 2QQ9A 4BI4A 1KQ1A 3QIIA 4PK4A 4JUVA 4JS5A 2BZYA 2NUTB 4JLIA 5A0GA 2RJFA 4F17A 1QVFP 2PUKB 4QT7A 1OU8A 1JXMA 2CP0A 3OYGA 3ZL7C 3CBMA 2VVKA 4LDUA 4HCKA 1YI2Q 1JEGA 2KSSA 1WIEA 4XTUA 2RQUA 1BCMA 5FU6C 3RMQA 4R55A 4IUQA 1IRXA 2EGCA 5IHNA 4DBRA 3GPLA 3FB9A 1GBRA 1TWBA 1FMKA 3EGUA 2VGNA 3VU3C 2XU8A 1KC8U 3J81E 2QXFA 3UATA 3WVEB 4HT9A 1TU0B 1U3OA 3S6WA 2CSQA 2O31A 4LN2A 4LUDA 2AZVA 3OB9A 1EX4A 3FC3A 1ZBXA 4MZTA 2OTJT 2V8JA 5CIUA 1JJ2A 1QKWA 9ATCB 3JB9D 4J83A 2E1HA 1M1KU 1NEGA 1EZZB 4F16A 2L2PA 1QCFA 2EGAA 4FU6A 3JCMh 2JUFA 3T9NA 1KC8R 4XU3A 1WZOA 5I2MA 1N8RU 1K9MC 2HBPA 4WCIA 3CCMT 3CMEQ 4OB2B 2KAFA 1BCOA 1D3BB 3CMAA 3MP8A 1HJDA 1N9SA 4X1VA 2EBPA 1X2KA 4HVWA 3WVDB 3G71T 3V8LA 3JCMW 1Q81C 2XG8D 2X35A 4L5GA 1RI9A 4XU0A 3L2ZA 4BACA 2LJ1A 3OQ5A 3P8DA 2EWNA 1KJWA 4M7AF 1UGRB 3UDCA 2RI3A 1I5OB 2XMFA 1C0MA 1UECA 1VQ8A 3SWNB 2R5MA 3CCUA 5KYUB 2SRCA 5KYYB 2YWWA 2K5IA 4V2SA 2BE7D 3LWHA 4JPBW 3RKWA 5A0DA 1X27A 1ZUKA 3V7CA 3AT1B 4DBFA 2MI6A 2CH4W 2KMTA 4RTUA 2HMAA 3JB9F 4OF1A 2K3BA 1SHGA 2OTJA 1M3CA 1WHJA 4O5VA 2FEIA 4HCZA 2EYWA 4M7DD 1NE8A 2XI9A 3M5AA 2O01E 1EFNA 1LPLA 2DYIA 2M1HA 3I55Q 2HL3A 2OX7A 2VWFA 4KUIA 3F70A 3JB9I 2FPDA 2ABLA 2LNHB 1BYMA 1RUWA 2D1XA 3LH0A 5A0LA 2CDTA 2VC8A 2YLBA 3VYHB 3JB9G 1U5SA 2JMCA 1VQLQ 1AWJA 3QSUA 2PNIA 2A36A 3OYFA 2JJ9A 1MV0B 2DXBA 2CGHA 2ENMA 4PFPA 3OYEA 4EDUA 1Y71A 4OVAA 4VUBA 2DBMA 2RPNA 1Q86U 4GLKA 4RG2A 1PC0A 4N0AC 3INZA 4RUGA 1VQNT 1M90R 2H8HA 5GAN8 3CCJA 1XTDA 3PVQA 1E7OA 1YCYA 5LJ5f 2JNGA 1PM3A 3C12A 4RTVA 3OA6A 1GL5A 1RLQC 1H641 1BI2A 2ZPFB 1H3HA 4F7UA 3CD6Q 2FPEA 1WXBA 4CC2A 1Q82R 2CT3A 1I81A 3QUIA 1Z9ZA 2VV5A 1G2BA 1M2VB 3BY7A 3TSWA 3A8OB 2DM1A 2HKQB 3UWNA 4AT1B 4PJOG 2V1RA 4M78C 3SEMA 3P8HA 2E70A 2RMOA 2RQWA 1XQHA 3EH2A 3OS0A 4DEYA 1K8AU 1KQSS 5DY9A 5D6XA 3JCMX 3MEWA 3JCMg 2LDMA 2HNIA 2ROLA 1MMDA 4HT8A 3CCEQ 3RIRA 1D0XA 2F5KA 2IVWA 1VQPA 4IUUA 1CKAA 1SSHA 4OB0B 3S3MA 1D1BA 4FYYB 3ULRB 2LC4A 3OYMA 3R6OA 4EMHA 2QTVA 1O9SA 3CXCS 1ZSZB 4R0KA 3PE0A 5HK3A 2COYA 4QVDA 1M8VA 3QWXX 1D1AA 2RHZA 4M7AB 2RJCA 2NUTA 3V7SA 2FG0A 1Q95G 2GBQA 1YIJT 4IIOA 5GMKh 1ABOA 1X6GA 1YITA 2L8DA 1PRLC 3QWYA 5CQYA 5GANj 1HXDA 2RI2A 2CZ7B 4D8KA 3E2UA 1PNJA 3GLXA 1BIBA 3TCJA 3MHXA 4M77C 2E10A 1VQKT 1I4K1 3SWNC 4OGEA 1QWFA 1UHFA 2A7YA 1M3BA 4C92A 4MDWA 3A1PA 1UGQB 3OYHA 3BW1A 3LGLA 4JRIA 1V29B 2E6NA 4PJMA 1P92A 2JMAA 2FZKB 3G4SQ 2DLPA 2V1QA 2KI7A 1QVFS 4KGZB 1Z9QA 3MO8A 1QMCA 3VS2A 4QQDA 4M75C 3PMIA 2D9TA 4B9XA 5GAN2 1XJWB 3EHRA 2QQSA 3RDVA 4LXCA 4E7SA 3VRZA 2DBKA 2PU9B 2FO0A 5KYYA 1WYXA 2YLCA 1YHQA 2EVRA 1X75C 3CC2T 2KYBA 3VYGA 1I07A 3HRSA 1PSFA 4FT4A 2Y90A 2HZYA 4OMNA 3DLMA 2QQBA 1UHCA 1PD1A 3I55T 2RB6A 3EH1A 3CMEA 3DLLA 2E4HA 1UGSB 4NS5A 1VQOA 5DLQE 3VS0A 4C5EA 4ZGEB 4Z89A 5KE3A 2RH2A 1YN8A 1M3AA 2KYMA 4XQ3A 3ME9A 3G7ZA 4C0GA 2DL4A 2IPOB 2LT1A 2RHYA 2Y4XA 2DVEA 1RLPC 5J26A 2JOYA 5GAN4 1TH7A 2RI5A 1ZA1B 2DAQA 3NTHA 1Q82C 1B07A 2LQWA 1VUBA 3REBB 1YIJQ 4J7IA 4M7AD 1FX7A 1VQ5A 4JZ4A 1M5Q1 4M77F 2CP2A 3PIOA 5FU6B 1IXDA 4WF2A 2M9UA 4A4EA 4C5IA 2DNUA 4FYXB 1VQKA 5GAMj 2ECZA 4BI3A 2CP7A 4M78E 1KD1R 2CH4A 4GBQA 3I9QA 1K73C 2YUOA 2P4TA 1PCXA 3TU4K 1KD1C 1YI2A 1I5LA 3R6NA 2EPDA 1FMWA 2D0NA 2EQJA 3V8KA 2JM8A 1TXQA 2HQEA 4RTXA 4XTVA 2KBTA 2QA4T 1D0ZA 1SRMA 2CZ0B 2K2VA 2YRDA 4RCBA 1VQ7A 1R0CB 3L2UA 4AMCA 5J39A 4HA8A 3LGFA 5LJ5h 2QGFB 1B7TA 2FZGB 3A8MB 2MOXA 4E47A 4XU2A 2VXEA 3CCRA 3CCSQ 3G6EA 3OW2S 1KFZA 4M7DG 4JZ3A 1PHTA 2IG0A 4C92F 4A4GA 4IIMA 3CC4A 5LJ3g 4ZGJB 1Y7XA 4OMMA 5LJ3e 5IT9E 2HQHA 2QEXQ 2LCCA 3ZEHA 3OYJA 1BU1A 1K9MR 2BKDN 1IGUA 1QCNA 3FLGA 3OSSC 2HQXA 1M1KR 3OMGA 4FSXA 3HKSA 5GJVB 1PKSA 3U23A 2VKNA 3CBOA 3QG1A 2CREA 5KCOA 4CC7A 3OYYA 4C0FA 1OI1A 3RNJA 4C8QD 3H41A 4BUGA 1ZA2B 2KXCA 1M90C 2MMPA 1NJIU 4FSSA 2B86A 5IHKA 3JB9J 4IUPA 3CXCA 1QP3A 2A0FB 1N5ZA 2HCKA 2KEAA 4PNOA 4M75B 1O75A 3JCMV 4RTWA 4ZN3A 4M78D 1KC8C 2DVJA 2W0ZA 2LQKA 2EYQA 4ZTJA 5LL6S 4FT2A 2H3EB 2QA4A 4P5NA 3JCMP 1IO6A 2QGGA 3L1AA 4GY5A 2FVUA 1YITQ 4J6XA 1SPKA 3VUBA 4C5HA 2QQRA 3DB3A 3CPWA 3URGA 2Y4YA 4M77B 1Y0MA 2CSIA 3GOXA 4PJLA 1F1BB 3IQLA 1PRMC 1IB8A 2EQKA 2CKKA 4TVRA 4JJCA 1G3SA 3QJYA 3DKMA 4PFZA 2KROA 4KH0B 3UT1A 5EG2A 4E7LA 2K4YA 5HK0A 1RAAB 1VQPQ 1M9SA 1IHVA 3LH5A 1V76A 4M7AC 1AWOA 4PJJA 4DOWA 5FRMA 4C92D 4J9BA 4C8QF 4OMOA 2C0OA 2C0IA 2DL7A 1PD0A 1QW1A 1BI1A 1Q7YR 1AHJB 1QVFA 4ORZA 2F2WA 4QVZA 2PTKA 1S72A 4EMKC 2HKNA 1ZLMA 2DILA 3KBGA 1RADB 4JDSA 5CKHA 2DZ9A 1NYGA 3FJ5A 8ATCB 3CCMQ 2ROTA 5GANh 1AZEA 5LJ3j 3EG1A 2R57A 4HKEA 1OEBA 3CD6A 1M30A 3A5ZB 2DL8A 5GMKi 2VGMA 1AD5A 4QKUA 4NOYA 2FRWA 4J9EA 1MUZA 4C92B 2BZXA 1VQ6Q 3M54A 3CBPA 1M2OA 2X9HA 3LWIA 2P0KA 4FM4B 2OAWA 1YJ9Q 5IXBA 1N9RA 2JM9A 4PLIA 3SWNA 2WSEE 3CC4T 2E6ZA 4XTWA 3JV3A 4J5YA 3V7RA 3OS1A 2HEQA 1VQ7T 4XAXB 1KHCA 3QZ5B 2PQWA 2ED1A 4R56A 1TOVA 4MZPA 2NWMA 2DXTA 4K11A 4BE2A 4J9HA 3L2WA 1VQ9Q 1OZ2A 1H3ZA 1D1CA 2X3XD 2DEQA 2BTTA 2ZGWA 2B8AA 1YJ9A 2KDSA 4RMOA 2YUPA 2JZ2A 2E3HA 5LJ5e 2K57A 5GANe 4HVUA 2FRYA 3HPWA 3PT9A 3FIFA 1OPKA 1Q86C 3C94A 2XK0A 3M0TA 3VS1A 1WHMA 2LCLA 3NPFA 1RAEB 4M75F 3KUFA 2RK1A 3EFOB 3RKXA 1Q81U 2XDBA 5IN1A 2MYSA 1NEBA 4B9WA 3HRTA 1QVGP 1VYVA 2O4XA 3OYNA 4LNPA 5KE2A 3OS2A 1NLPC 5IHIA 5CR2A 1S1NA 2MWOA 1BKBA 4QW2A 4JS4A 2E64A 5GAN3 3CEYA 3J7AF 3CCUQ 3HP9A 1VQ8Q 1OZ3A 5CK9A 1WHHA 2L89A 2FZCB 2F5TX 2QYZA 2D8JA 2LTOA 5FU7C 3JCMc 5AT1B 2DRMA 1N8RC 1K9MU 2KT1A 3E9FA 5GAOr 1VQPT 1VQMT 1VQ6T 1H8KA 4N4GA 2WACA 4FYWB 4M7AA 2ED0A 2EIFA 4RTTA 4X34A 3X25B 1NPPA 3M0RA 3H9NA 4C8QB 2L5QA 2RHIA 2A37A 2EAYA 1WHLA 3A8HB 5M9OA 3L2VA 1OYXA 4PFOA 4FL6A 2CUDA 2RF0A 1WQ7A 1WX6A 4AG1C 1KSWA 5GMKl 1OX9A 2QA4Q 3SFMA 2EYYA 4QQ6A 4RG8A 4L6V5 2EKHA 2JTFA 3MPUB 1S72T 1KQSP 1JU5C 2AKLA 5D6YA 4A63B 3CCLQ 1DJ7B 1Y07A 4DBHA 5IH2A 2PUOB 1ZQ1A 4MMKA 3L2RA 2JVVA 3C95A 3CCJT 4FCYA 4BI8B 2O88A 4Z88A 4A4HA 1RI0A 3WXMB 3M0UA 2OJ2A 3M4YA 3GF5A 4ELZC 4CC3A 2CP6A 3CC7T 1AEYA 3OSVA 4A53A 1UJ0A 1X6OA 4C8QG 2KY9A 1U1TA 4HCCA 2E65A 4N4HA 1G3TA 4E7KA 1ZBJA 2QI2A 3DB4A 2OTLA 1FXXA 2DA9A 1K1ZA 4HVVA 3M0QA 4JRKA 5EC7A 3MEVA 2L0AA 4AFQC 2PVGB 2QTXA 3AHUA 3PIPA 4RTZA 1T3SA 3RBBB 4FIBA 1M8MA 4OP0A 4KBMB 1LJOA 2HAXA 1ARKA 2E5KA 1IREB 2K6DA 3TSZA 3CMET 2DTIA 3TREA 1LCKA 2QQAA 4E7JA 1TTHB 2DXUA 4E7ZA 3QZ9B 4XTYA 3M53A 3C4SA 1M1FA 1VQMQ 2LCSA 2XDPA 4ZNXA 2DPPB 4LD9K 2CP3A 3LX7A 2ZZDA 3A8LB 2RM4A 1R8OB 1SF9A 4M7AG 3EGXB 3G1JA 2RD1A 2E41A 3CCVA 4Z8AA 2LVMA 1ZUUA 3JCMQ 1WHGA 1UB4A 3SD4A 1D3BA 2H3JA 3NFCA 4OB1B 2OTLQ 4C8QE 1CSKA 1YJNA 2KQWA 4Q5WA 2HL5C 2L3SA 2VYTA 4CRIA 5GAN6 4OMFB 1NBEB 1M90U 1CKBA 5D7UA 1GFCA 1WXUA 1VQNA 1VQKQ 2RJDA 4E7IA 1MGQA 3VS6A 1W2BA 1X2QA 5GAMg 1AWWA 1SSFA 2JXBA 5GAMe 2YXYA 1VQ5Q 4JJBA 1M27C 1PG5B 1M1GA 3CCLA 4M7DE 4M4ZA 5IAYA 3JCMe 4JJNK 3CCET 4JLGA 4EPCA 4ZN1A 1NG2A 5GAN5 1X6BA 3SHWA 4ANJA 4LDVA 3QXEB 2KE9A 4ZGDB 4PJOA 1PWTA 1Q81R 1HYOA 2DJQA 2QASA 2LX7A 4PJNA 4M78G 4F7UB 3CPWS 4KH1B 1I1JA 1TS9A 1Q7YU 2GTJA 4F04B 1OULA 4DQ2A 1ZUYA 5KYWA 2K2MA 1AWXA 2E3IA 3JAME 2XDDA 2ZCFB 3M4GA 4M7DB 5A2QE 3ER0A 4C8QC 1TUDA 3CCLT 2F1LA 3EG0A 3FDRA 3UA6A 2D8HA 1UFFA 2RQVA 1G3WA 2VXFA 4LDXA 1T0HA 1UE9A 1ZX6A 4DOVA 2EQIA 3PTAA 4FW2A 1BK2A 3EG2A 2LNVA 4OMQA 3JCMf 2YUQA 3M0PA 5FU7B 2VUBA 5HKCA 3GBQA 1FMVA 3THKA 1UGPB 3CPWP 1A0NB 4KRTA 2RHUA 4EMGA 1G3YA 2X4XA 5GMKe 5GANd 3KFVA 2O9VA 2IIMA 1QVGS 2FHDA 3X24B 4AFSC 3LLRA 3TQ7P 3JSCA 2J06A 1K73R 2NLUA 3PNWC 5C0MA 2D6FA 1ZSZC 5HY6A 2G6FX 2WSCE 3H0IA 3QJ6A 5GJWB 1AZGB 1BIAA 1RAGB 4A54A 2C0TA 4F7UE 1WA7A 1UTIA 2YDLA 1YJWQ 5D6WA 5LJ3f 3PMTA 3E19A 5CKDA 3CCUT 2JS2A 1WDXA 2LZ6B 2EQUA 2HSEB 2DXCA 3N5BB 2KNBB 2R5AA 3CCEA 1W6XA 2P84A 3M55A 2CT4A 1MHNA 3MEUA 4J7FA 2KR3A 4NL3A 2P0QA 5FW9A 1YI2T 1WJSA 3ZBDA 2LMJA 3NTKA 3OYDA 1W4SA 3JRZA 3X26B 2NUZA 1NM7A 2XD0A 2DK3A 4EMKA 3EGDA 1RAIB 3X28B 2EYZA 1BB9A 1WI7A 2YRVA 2P4RA 1RAHB 4LE9A 5GAOn 3OYIA 5KCHA 2K79A 3UPUA 2WSFE 4M75E 3X20B 1S72Q 4E6RA 4XTXA 2DFUA 4F7UF 2HSPA 3A98A 2O9SA 1WGSA 1R0BG 3QDFA 5HCKA 3EFSA 2DTHA 3SB2A 4EIKA 4KUDK 4M77G 2ZPGB 3M59A 2YUNA 1QQJA 4RKUE 1SRLA 1QVGA 2GFAA 2X51A 1K4US 1GBQA 1SHFA 1YP5A 1YJWT 3MP1A 1K0SA 3S3NA 4DEXA 2KVQG 4C0ZA 3E9GA 1LVKA 4QQGA 2KRNA 1WPYA 1VQLA 4M7DF 2DL5A 1W2BS 5I11A 1YJWA 2GTOA 1ZSGA 4LDYA 5CKEA 2F2XA 5GAMh 4D8DA 2DETA 4X9CA 2BE9B 6AT1B 2M16A 1H92A 3CC2A 3PFSA 2C06A 1TUGB 1QWEA 1TG0A 1NYFA 2YT6A 1VOMA 2OTJQ 2JS0A 1SG5A 1QP2A 3RR6A 5CQXA 2O4XB 4C92G 2F2VA 3OYLA 2DE0X 4A4FA 2DZCA 4FYVB 3NMZC 4BD3A 2J7IA 2KRMA 2PVDB 1MNDA 2CYZB 1C1AA 2KRSA 4OB3B 1N8RR 2DO3A 4KULA 4CC4B 4C0DC 1GCQC 1KG1A 4BB7A 2EJGA 2M02A 1VYUA 1VQOT 1OX8A 2Z0WA 2J05A 3O8VA 4MZMA 2KGTA 3CCRT 2J6OA 4IUVA 1OQKA 3LW5E 1FWZA 3KXTA 1B34A 3BE3A 2A3LA 3OMCA 3OBWA 5GANg 1RACB 2ESWA 4C8QA 2RA2A 1JJ2P 2RQTA 4L59A 4HXJA 3J80E 4MMLA 5LJ3d 2COZA 1GXIE 3CC7Q 3H0HA 3CMAQ 3NHNA 2D0QB 3OW2A 1KQSA 4LUEA 2QG9B 2GCXA 1Q86R 3MJXA 4E7HA 3HTRA 2KXDA 1I8FA 1JBMA 1VQ9T 2LX9A 3CC4Q 2M0YA 2CS7A 5KYXB 1ABQA 3P8BB 3HFNA 2SEMA 1SKUB 5KYXA 2BZ8A 2NYSA 3G6EQ 3CCSA 1D09B 1G8XA 4QVCA 2K9GA 2X3WD 3NGPA 2GQIA 3RERA 3CD6T 2DF6A 4F7UG 3Q1JA 3EAEA 2AIRB 1B34B 3VV0A 2KT8A 1K73U 3JCMd 1KQ2A 4UC4A 1U8RA 2E5QA 3QYHB 1NJIR 4BE0A 2K5LA 1VQ4A 2XICA 5GAMd 4O6JA 3GP8A 2DJZA 2W10A 5I22A 2CZ6B 4PKCC 2RQRA 4XTZA 1G5VA 3I56T 4MDXA 3EFRA 3BDUA 3HHTB 2EGEA 2XHCA 4M77A 1YJNQ 4YTLA 4LDWA 4B6MA 4M7DA 1QLYA 1VQ4Q 2FL7A 2ZPBB 2M0OA 4Z02A 4ELYC 3CCST 3CCVQ 3EG9B 3MKDA 5CO7A 5GAN7 3A8GB 1YIJA 2VB6A 2KK4A 3D7SB 3GNGA 1EIFA 3H0FA 3FEOA 3M58A 1SEMA 4M75A 2L3RA 4M78F 1GCPA 1Y57A 2DTOA 3I5SA 2LP5A 3RKYA 3REAB 1IZ6A 3OYAA 3VUZA 2EFIA 4HCBA 1K8AC 2RK2A 3VKIA 4M77E 2JN0A 3HFOA 2J6KA 2K3YA 1U06A 2JTMA 1VQOQ 4J9CA 5FRNA 1X43A 5CKFA 3JCMb 4FW1A 5C6SA 2HBWA 3CMAT 1Y96A 4PJOB 1ZHIA 3CC7A 1YHQQ 5LJ3h 5DM7R 4M75G 4BDZA 4C92E 2AK5A 4M7AE 1UGVA 2G3RA 3E1SA 2DEUA 1HSQA 4OMPA 2PZ1A 1QKXA 1WFWA 3GNFB 2K3XA 2X4JA 5ECAA 2K7AA 3CCQQ 2CUBA 3OS5A 1YWOA 3VS5A 4ATOA 1JJ2S 1MMAA 3MCAB 3MP6A 2V8IA 2X4WA 4Y28E 3NTIA 1D0YA 2RO0A 1UDLA 4KT0E 3TVTA 1JQQA 3G4SA 4J6YA 1WXTA 3OBYA 1UG1A 1M4ZA 4NL2A 2EYXA 5L23A 2OI3A 2YHTA 1U1SA 4WTOB 3G4ST 3RMSA 1B3QA 3C0CA 1VQ4T 1XNIA 1OU9A 4D6WA 2QK0A 4C0DB 2R58A 1NPRA 3G71A 4PL6A 3L42A 3QO3A 1WHKA 4ESRA 3EGDB 3M9QA 4J6WA 3G6ET 3S3OA 4N0AA 5GAMf 1W70A 1YCSB 3CC2Q 5FWCA 5GMKm 5CKBA 1N27A 2DD5A 4XK8E 2MK5A 3BFMA 5DLOA 1VQ8T 4CI0C 3JCMJ 1UUEA 2ATCB 1YITT 2NUPA 5GAOl 1YNZA 1T0JA 1W1FA 1JRIA 5KYUA 1KD1U 3CXCP 2E12A 2DKGA 4Y91A 5CAIA 2AHJB 1KK7A 1OOTA 2DD4A 1G83A 1YWPA 4PJOD 4A4KA 2RNAA 2DL3A 3V8JA 3UA7A 3OYBA 5KH6A 2ZAEA 3QKJA 4Y92A 1GFDA 3CQTA 4BDYA 1YBYA 4F14A 3M0SA 3VS7A 2AZSA 4M75D 4M78A 3L2QA 1M1KC 3EFOA 1XOVA 1YJ9T 1YHQT 2L3PA 1IHWA 3FRNA 4M78B 4X9DA 3CPFA 1AT1B 1AOJA 1WQWA 2NUPB 3I56A 1OPLA 2M51A 4DBQA 3RUXA 1ACMB 1TSFA 4IKFA 4AFZC 3CCJQ 1YJNT 5AYFA 4XU1A 5GANf 4BY6B 2MAMA 2V8KA 1GCQA 2PVOB 4J9FA 1YFNA 1VQ9A 5LJ5d 1TUCA 5I2SA 2OTLT 2LRQA 3JB9H 2COWA 4PJOF 3HRUA 2MIOA 1JXOA 2RJEA 5J3BA 4BY6C 1NLOC 2J6FA 2DIQA 2QDYB 1V1CA 1LOJA 4C92C 1BI0A 1MMNA 5IXFA 2GGRA 4IURA 2A28A 1ZSZA 3M56A 5CCAA 4AG2C 1LNXA 3I35A 2QEXT 3EG3A 4OGCA 2I0NA 1Q7YC 2RHXA 3QHSA 4J9IA 2FPFA 4J9DA 3OYKA 3I55A 1VQ6A 1Y96B 3I56Q 2MCNA 4JRPA 1M2VA 2ZPHB 4JRQA 3OYCA 3QPHA 1KIKA 4EMKB 5L8RE 1HK9A 4PLLA 2MWPA 2RN8A 3H6ZA 3RESA 3META 4ME7A 4BE1A 2AT1B 2JW4A 5CVIA 3CCMA 1E6GA 1K9AA 7AT1B 1X01A 4RCCA 4GLMA 3LYIA 2DMOA 2ZPEB 1KHIA 1VQLT 4PJOE 1QCOA 2GF7A 3HSBA 2BIVA 3EHQA 1WNLA 2MPXC 2EJFA 3TEEA 2HDAA 1VA7A 1IGQA 1WJRA 4II1A 4JJDA 1UJYA 1Q82U 4ZTFA 2YRCA 2JTEA 1WJQA 1VIFA 2DERA 2DIGA 5LJ5g 3EGXA 1I0CA 1N6AA 4AFUC 4DA4A 1VYTA 4M7DC 1K0XA 4RTYA 2LQ8A 1OV3A 2DYBA 2LQNA 5GAOm 2LJ0A 2CZ1B 2X4YA 1AVZC 2A08A 2MF2A 3ASKA 4J9GA 1X69A 3EG9A 3O5ZA 1R77A 2F69A 1JB0E 5GAOp 3QDRB 3CCVT 2FYKA 5KYNA 3G71Q 2AKKA 4IUTA 3FJPA 2V26A 2ZPIB 2DX1A 5FLXE 3PGGA 2JT4A 2XIDA 2K5FA 2L3QA 1MV3A 4KGXB 1MMGA 2LT4A 1VQ5T 3ZFJA 3M57A 2CP5A 2P0PA 1VIEA 3OY9A 2BUDA 2EJ9A 2GFUA 4LD6A 3OW2P 1VQNQ 3QBYA 1W2BP 1FYNA 2O2OA 1K8AR 2DRKA 1RAFB 1T3LA 1QVPA 3VS3A 4PJOC 1GRIA 1PKTA 2GQVA 2LJ3A 1K76A 3CCQA 1E6HA 2XKOC 2EW3A 1UEBA 4J8OA 4N4IA 4KGVB 5I21A 3VS4A 1RL2A 2EQMA 2YSQA 3HL8A 3I5RA 5FROA 3QYGB
chains in the Genus database with same CATH topology
4HVVA 3M0QA 4JZ4A 2KT8A 5EC7A 5FWBA 2L0AA 2GNCA 4AFQC 3VRYA 2DNUA 3PVLA 4RTZA 2ECZA 1WLPB 1T3SA 1BBZA 3RBBB 1HD3A 1M8MA 2W10A 5I22A 2CH4A 4GBQA 3I9QA 2YUOA 1ARKA 2E5KA 2RQRA 2K6DA 3TSZA 1LCKA 2EGEA 1JO8A 2QDLA 1J3TA 1QLYA 3R6NA 2EPDA 3UF4A 2D0NA 2LCSA 4ZNXA 2JM8A 4OMLA 4RTXA 2KBTA 1SRMA 2BZYA 4Z8AA 1ZUUA 4F17A 4QT7A 1JXMA 3H0FA 3ZL7C 2VVKA 1SEMA 4HCKA 1CSKA 1JEGA 2MOXA 1WIEA 1GCPA 1Y57A 2RQUA 3I5SA 2LP5A 2L3SA 1KFZA 4JZ3A 3REAB 2EGCA 1PHTA 5IHNA 1GBRA 1CKBA 1FMKA 3EGUA 1GFCA 1WXUA 4IIMA 4OMMA 2J6KA 1U06A 3VS6A 4J9CA 1X43A 1X2QA 1AWWA 2JXBA 2HBWA 1BU1A 3UATA 4JJBA 1M27C 1U3OA 2CSQA 2O31A 4LN2A 4LUDA 2AZVA 2AK5A 1UGVA 4M4ZA 5GJVB 1HSQA 1PKSA 4OMPA 2PZ1A 1QKXA 1WFWA 3U23A 1NG2A 1QKWA 2VKNA 1X6BA 1NEGA 5ECAA 3SHWA 2CREA 4F16A 2K7AA 2CUBA 2L2PA 2KE9A 4CC7A 1QCFA 2EGAA 1YWOA 3RNJA 1PWTA 3VS5A 3H41A 2DJQA 2LX7A 1UDLA 2KXCA 1I1JA 3TVTA 1JQQA 4FSSA 2B86A 1WXTA 4WCIA 1UG1A 2EYXA 2GTJA 5IHKA 5L23A 2KEAA 1N5ZA 2HCKA 2OI3A 1HJDA 1ZUYA 4X1VA 2EBPA 2K2MA 1X2KA 4HVWA 4RTWA 1AWXA 1B3QA 3C0CA 2DVJA 2W0ZA 1RI9A 2LJ1A 1TUDA 1KJWA 1IO6A 3EG0A 4ESRA 3UA6A 2D8HA 1UFFA 1SPKA 2RQVA 1W70A 1YCSB 2XMFA 1T0HA 1UE9A 1ZX6A 1UECA 2EQIA 5FWCA 1BK2A 3EG2A 2SRCA 1Y0MA 2CSIA 4OMQA 2YUQA 3IQLA 1PRMC 1UUEA 3M0PA 4JPBW 3GBQA 1X27A 1ZUKA 4JJCA 3THKA 1A0NB 4KRTA 2KROA 1YNZA 2CH4W 1T0JA 4RTUA 1W1FA 3KFVA 3LH5A 2O9VA 2IIMA 2K3BA 4AFSC 1AWOA 1SHGA 1M3CA 4J9BA 2FEIA 4OMOA 2EYWA 1OOTA 2J06A 2C0OA 2C0IA 1EFNA 2DL7A 1G83A 2G6FX 1YWPA 2RNAA 3H0IA 2DL3A 2VWFA 4ORZA 3UA7A 2F2WA 5GJWB 2FPDA 2PTKA 2ABLA 2LNHB 1AZGB 1RUWA 2D1XA 2CDTA 4Y92A 1ZLMA 2DILA 1GFDA 3CQTA 2C0TA 1WA7A 1UTIA 4F14A 3M0SA 2YDLA 1U5SA 2JMCA 1AWJA 1NYGA 3VS7A 2AZSA 3FJ5A 2PNIA 2A36A 2JS2A 1WDXA 2LZ6B 2ROTA 1AZEA 1MV0B 1XOVA 3EG1A 2L3PA 2ENMA 1OEBA 2KNBB 1M30A 2DL8A 1AOJA 1W6XA 2DBMA 2RPNA 1AD5A 2FRWA 4J9EA 1MUZA 4RUGA 1OPLA 2M51A 2CT4A 2BZXA 2H8HA 4AFZC 2OAWA 3PVQA 5IXBA 1E7OA 1GCQA 2KR3A 4J9FA 2JM9A 1TUCA 5FW9A 4RTVA 3JV3A 1GL5A 1RLQC 2MIOA 1JXOA 1H3HA 2LMJA 2FPEA 1NLOC 2HEQA 1WXBA 4CC2A 2J6FA 2NUZA 2ED1A 2CT3A 1NM7A 1V1CA 2NWMA 2EYZA 1BB9A 1WI7A 1Z9ZA 4K11A 2P4RA 1G2BA 5IXFA 4LE9A 2K79A 3TSWA 2GGRA 4J9HA 2DM1A 2A28A 2X3XD 2BTTA 2V1RA 4E6RA 4AG2C 3I35A 3SEMA 2RMOA 3EG3A 2RQWA 2I0NA 2YUPA 4DEYA 2HSPA 2FPFA 4J9DA 4J9IA 3A98A 2O9SA 5HCKA 4HVUA 2FRYA 2MCNA 4EIKA 1OPKA 3M0TA 3VS1A 2ROLA 2YUNA 3NPFA 1SRLA 1KIKA 1K4US 1GBQA 1SHFA 2RN8A 1YP5A 1CKAA 1SSHA 1K0SA 4DEXA 3ULRB 1NEBA 4R0KA 2JW4A 3PE0A 1E6GA 1VYVA 1K9AA 2KRNA 4LNPA 2DL5A 1NLPC 4GLMA 5IHIA 5I11A 3QWXX 2GTOA 1ZSGA 2DMOA 1S1NA 2F2XA 4D8DA 2FG0A 1H92A 2GBQA 3EHQA 4IIOA 1ABOA 1QWEA 1X6GA 2HDAA 1PRLC 1TG0A 1NYFA 1VA7A 3QWYA 2D8JA 2YT6A 4JJDA 2DRMA 2JS0A 1UJYA 4D8KA 2KT1A 1PNJA 2JTEA 2F2VA 2DE0X 1H8KA 1QWFA 1UHFA 3NMZC 1M3BA 2J7IA 2ED0A 1I0CA 4AFUC 2KRMA 4RTTA 3M0RA 1VYTA 2KRSA 4CC4B 2A37A 1K0XA 2JMAA 4RTYA 1GCQC 2DLPA 1OV3A 2DYBA 2LQNA 2LJ0A 1VYUA 2V1QA 1AVZC 2A08A 1Z9QA 2J05A 4J9GA 3VS2A 2CUDA 2RF0A 1WX6A 2KGTA 1X69A 3EHRA 2J6OA 3O5ZA 1KSWA 4AG1C 3VRZA 2DBKA 2EYYA 2FO0A 1WYXA 2AKKA 2EKHA 2EVRA 2KYBA 1JU5C 2AKLA 2DX1A 2JT4A 2ESWA 1I07A 2RQTA 4OMNA 4A63B 4HXJA 2L3QA 5IH2A 1MV3A 3H0HA 3NHNA 1UHCA 4LUEA 3VS0A 2O88A 4Z88A 4Z89A 2KXDA 3M0UA 2M0YA 2KYMA 1YN8A 1FYNA 1M3AA 2O2OA 2OJ2A 2DRKA 1ABQA 2DL4A 1T3LA 4CC3A 2SEMA 3VS3A 1GRIA 1PKTA 2LJ3A 1K76A 1AEYA 2BZ8A 1E6HA 1UJ0A 1RLPC 2EW3A 2K9GA 1ZBJA 3VS4A 3I5RA 2YSQA 2X3WD 1B07A 2GQIA 3NGPA 2LQWA 2DF6A 3REBB 2DA9A 1K1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVV A;  3M0Q A;  4JZ4 A;  2KT8 A;  5EC7 A;  5FWB A;  2L0A A;  2GNC A;  4AFQ C;  3VRY A;  2DNU A;  3PVL A;  4RTZ A;  2ECZ A;  1WLP B;  1T3S A;  1BBZ A;  3RBB B;  1HD3 A;  1M8M A;  2W10 A;  5I22 A;  2CH4 A;  4GBQ A;  3I9Q A;  2YUO A;  1ARK A;  2E5K A;  2RQR A;  2K6D A;  3TSZ A;  1LCK A;  2EGE A;  1JO8 A;  2QDL A;  1J3T A;  1QLY A;  3R6N A;  2EPD A;  3UF4 A;  2D0N A;  2LCS A;  4ZNX A;  2JM8 A;  4OML A;  4RTX A;  2KBT A;  1SRM A;  2BZY A;  4Z8A A;  1ZUU A;  4F17 A;  4QT7 A;  1JXM A;  3H0F A;  3ZL7 C;  2VVK A;  1SEM A;  4HCK A;  1CSK A;  1JEG A;  2MOX A;  1WIE A;  1GCP A;  1Y57 A;  2RQU A;  3I5S A;  2LP5 A;  2L3S A;  1KFZ A;  4JZ3 A;  3REA B;  2EGC A;  1PHT A;  5IHN A;  1GBR A;  1CKB A;  1FMK A;  3EGU A;  1GFC A;  1WXU A;  4IIM A;  4OMM A;  2J6K A;  1U06 A;  3VS6 A;  4J9C A;  1X43 A;  1X2Q A;  1AWW A;  2JXB A;  2HBW A;  1BU1 A;  3UAT A;  4JJB A;  1M27 C;  1U3O A;  2CSQ A;  2O31 A;  4LN2 A;  4LUD A;  2AZV A;  2AK5 A;  1UGV A;  4M4Z A;  5GJV B;  1HSQ A;  1PKS A;  4OMP A;  2PZ1 A;  1QKX A;  1WFW A;  3U23 A;  1NG2 A;  1QKW A;  2VKN A;  1X6B A;  1NEG A;  5ECA A;  3SHW A;  2CRE A;  4F16 A;  2K7A A;  2CUB A;  2L2P A;  2KE9 A;  4CC7 A;  1QCF A;  2EGA A;  1YWO A;  3RNJ A;  1PWT A;  3VS5 A;  3H41 A;  2DJQ A;  2LX7 A;  1UDL A;  2KXC A;  1I1J A;  3TVT A;  1JQQ A;  4FSS A;  2B86 A;  1WXT A;  4WCI A;  1UG1 A;  2EYX A;  2GTJ A;  5IHK A;  5L23 A;  2KEA A;  1N5Z A;  2HCK A;  2OI3 A;  1HJD A;  1ZUY A;  4X1V A;  2EBP A;  2K2M A;  1X2K A;  4HVW A;  4RTW A;  1AWX A;  1B3Q A;  3C0C A;  2DVJ A;  2W0Z A;  1RI9 A;  2LJ1 A;  1TUD A;  1KJW A;  1IO6 A;  3EG0 A;  4ESR A;  3UA6 A;  2D8H A;  1UFF A;  1SPK A;  2RQV A;  1W70 A;  1YCS B;  2XMF A;  1T0H A;  1UE9 A;  1ZX6 A;  1UEC A;  2EQI A;  5FWC A;  1BK2 A;  3EG2 A;  2SRC A;  1Y0M A;  2CSI A;  4OMQ A;  2YUQ A;  3IQL A;  1PRM C;  1UUE A;  3M0P A;  4JPB W;  3GBQ A;  1X27 A;  1ZUK A;  4JJC A;  3THK A;  1A0N B;  4KRT A;  2KRO A;  1YNZ A;  2CH4 W;  1T0J A;  4RTU A;  1W1F A;  3KFV A;  3LH5 A;  2O9V A;  2IIM A;  2K3B A;  4AFS C;  1AWO A;  1SHG A;  1M3C A;  4J9B A;  2FEI A;  4OMO A;  2EYW A;  1OOT A;  2J06 A;  2C0O A;  2C0I A;  1EFN A;  2DL7 A;  1G83 A;  2G6F X;  1YWP A;  2RNA A;  3H0I A;  2DL3 A;  2VWF A;  4ORZ A;  3UA7 A;  2F2W A;  5GJW B;  2FPD A;  2PTK A;  2ABL A;  2LNH B;  1AZG B;  1RUW A;  2D1X A;  2CDT A;  4Y92 A;  1ZLM A;  2DIL A;  1GFD A;  3CQT A;  2C0T A;  1WA7 A;  1UTI A;  4F14 A;  3M0S A;  2YDL A;  1U5S A;  2JMC A;  1AWJ A;  1NYG A;  3VS7 A;  2AZS A;  3FJ5 A;  2PNI A;  2A36 A;  2JS2 A;  1WDX A;  2LZ6 B;  2ROT A;  1AZE A;  1MV0 B;  1XOV A;  3EG1 A;  2L3P A;  2ENM A;  1OEB A;  2KNB B;  1M30 A;  2DL8 A;  1AOJ A;  1W6X A;  2DBM A;  2RPN A;  1AD5 A;  2FRW A;  4J9E A;  1MUZ A;  4RUG A;  1OPL A;  2M51 A;  2CT4 A;  2BZX A;  2H8H A;  4AFZ C;  2OAW A;  3PVQ A;  5IXB A;  1E7O A;  1GCQ A;  2KR3 A;  4J9F A;  2JM9 A;  1TUC A;  5FW9 A;  4RTV A;  3JV3 A;  1GL5 A;  1RLQ C;  2MIO A;  1JXO A;  1H3H A;  2LMJ A;  2FPE A;  1NLO C;  2HEQ A;  1WXB A;  4CC2 A;  2J6F A;  2NUZ A;  2ED1 A;  2CT3 A;  1NM7 A;  1V1C A;  2NWM A;  2EYZ A;  1BB9 A;  1WI7 A;  1Z9Z A;  4K11 A;  2P4R A;  1G2B A;  5IXF A;  4LE9 A;  2K79 A;  3TSW A;  2GGR A;  4J9H A;  2DM1 A;  2A28 A;  2X3X D;  2BTT A;  2V1R A;  4E6R A;  4AG2 C;  3I35 A;  3SEM A;  2RMO A;  3EG3 A;  2RQW A;  2I0N A;  2YUP A;  4DEY A;  2HSP A;  2FPF A;  4J9D A;  4J9I A;  3A98 A;  2O9S A;  5HCK A;  4HVU A;  2FRY A;  2MCN A;  4EIK A;  1OPK A;  3M0T A;  3VS1 A;  2ROL A;  2YUN A;  3NPF A;  1SRL A;  1KIK A;  1K4U S;  1GBQ A;  1SHF A;  2RN8 A;  1YP5 A;  1CKA A;  1SSH A;  1K0S A;  4DEX A;  3ULR B;  1NEB A;  4R0K A;  2JW4 A;  3PE0 A;  1E6G A;  1VYV A;  1K9A A;  2KRN A;  4LNP A;  2DL5 A;  1NLP C;  4GLM A;  5IHI A;  5I11 A;  3QWX X;  2GTO A;  1ZSG A;  2DMO A;  1S1N A;  2F2X A;  4D8D A;  2FG0 A;  1H92 A;  2GBQ A;  3EHQ A;  4IIO A;  1ABO A;  1QWE A;  1X6G A;  2HDA A;  1PRL C;  1TG0 A;  1NYF A;  1VA7 A;  3QWY A;  2D8J A;  2YT6 A;  4JJD A;  2DRM A;  2JS0 A;  1UJY A;  4D8K A;  2KT1 A;  1PNJ A;  2JTE A;  2F2V A;  2DE0 X;  1H8K A;  1QWF A;  1UHF A;  3NMZ C;  1M3B A;  2J7I A;  2ED0 A;  1I0C A;  4AFU C;  2KRM A;  4RTT A;  3M0R A;  1VYT A;  2KRS A;  4CC4 B;  2A37 A;  1K0X A;  2JMA A;  4RTY A;  1GCQ C;  2DLP A;  1OV3 A;  2DYB A;  2LQN A;  2LJ0 A;  1VYU A;  2V1Q A;  1AVZ C;  2A08 A;  1Z9Q A;  2J05 A;  4J9G A;  3VS2 A;  2CUD A;  2RF0 A;  1WX6 A;  2KGT A;  1X69 A;  3EHR A;  2J6O A;  3O5Z A;  1KSW A;  4AG1 C;  3VRZ A;  2DBK A;  2EYY A;  2FO0 A;  1WYX A;  2AKK A;  2EKH A;  2EVR A;  2KYB A;  1JU5 C;  2AKL A;  2DX1 A;  2JT4 A;  2ESW A;  1I07 A;  2RQT A;  4OMN A;  4A63 B;  4HXJ A;  2L3Q A;  5IH2 A;  1MV3 A;  3H0H A;  3NHN A;  1UHC A;  4LUE A;  3VS0 A;  2O88 A;  4Z88 A;  4Z89 A;  2KXD A;  3M0U A;  2M0Y A;  2KYM A;  1YN8 A;  1FYN A;  1M3A A;  2O2O A;  2OJ2 A;  2DRK A;  1ABQ A;  2DL4 A;  1T3L A;  4CC3 A;  2SEM A;  3VS3 A;  1GRI A;  1PKT A;  2LJ3 A;  1K76 A;  1AEY A;  2BZ8 A;  1E6H A;  1UJ0 A;  1RLP C;  2EW3 A;  2K9G A;  1ZBJ A;  3VS4 A;  3I5R A;  2YSQ A;  2X3W D;  1B07 A;  2GQI A;  3NGP A;  2LQW A;  2DF6 A;  3REB B;  2DA9 A;  1K1Z A; 
#chains in the Genus database with same CATH topology
 3H8Z A;  4E2F B;  3SDZ A;  3GIB A;  5FWB A;  2HD0 A;  2GNC A;  5KYW B;  3MEA A;  5GMK j;  2QEX A;  1PSE A;  2OAU A;  2FB7 A;  3VRY A;  1BI3 A;  4C5G A;  1VQM A;  3PVL A;  1MNE A;  1WLP B;  1BBZ A;  1C6V X;  3CCQ T;  1HD3 A;  1RAB B;  4M77 D;  8AT1 B;  1NZ9 A;  5LJ5 j;  3CCR Q;  2QAZ A;  2I2L A;  1JO8 A;  2QDL A;  1J3T A;  3VJP A;  3BDL A;  2VAS A;  1NJI C;  2EKO A;  5GAO q;  3UF4 A;  1VQ7 Q;  4OML A;  2QQ9 A;  4BI4 A;  1KQ1 A;  3QII A;  4PK4 A;  4JUV A;  4JS5 A;  2BZY A;  2NUT B;  4JLI A;  5A0G A;  2RJF A;  4F17 A;  1QVF P;  2PUK B;  4QT7 A;  1OU8 A;  1JXM A;  2CP0 A;  3OYG A;  3ZL7 C;  3CBM A;  2VVK A;  4LDU A;  4HCK A;  1YI2 Q;  1JEG A;  2KSS A;  1WIE A;  4XTU A;  2RQU A;  1BCM A;  5FU6 C;  3RMQ A;  4R55 A;  4IUQ A;  1IRX A;  2EGC A;  5IHN A;  4DBR A;  3GPL A;  3FB9 A;  1GBR A;  1TWB A;  1FMK A;  3EGU A;  2VGN A;  3VU3 C;  2XU8 A;  1KC8 U;  3J81 E;  2QXF A;  3UAT A;  3WVE B;  4HT9 A;  1TU0 B;  1U3O A;  3S6W A;  2CSQ A;  2O31 A;  4LN2 A;  4LUD A;  2AZV A;  3OB9 A;  1EX4 A;  3FC3 A;  1ZBX A;  4MZT A;  2OTJ T;  2V8J A;  5CIU A;  1JJ2 A;  1QKW A;  9ATC B;  3JB9 D;  4J83 A;  2E1H A;  1M1K U;  1NEG A;  1EZZ B;  4F16 A;  2L2P A;  1QCF A;  2EGA A;  4FU6 A;  3JCM h;  2JUF A;  3T9N A;  1KC8 R;  4XU3 A;  1WZO A;  5I2M A;  1N8R U;  1K9M C;  2HBP A;  4WCI A;  3CCM T;  3CME Q;  4OB2 B;  2KAF A;  1BCO A;  1D3B B;  3CMA A;  3MP8 A;  1HJD A;  1N9S A;  4X1V A;  2EBP A;  1X2K A;  4HVW A;  3WVD B;  3G71 T;  3V8L A;  3JCM W;  1Q81 C;  2XG8 D;  2X35 A;  4L5G A;  1RI9 A;  4XU0 A;  3L2Z A;  4BAC A;  2LJ1 A;  3OQ5 A;  3P8D A;  2EWN A;  1KJW A;  4M7A F;  1UGR B;  3UDC A;  2RI3 A;  1I5O B;  2XMF A;  1C0M A;  1UEC A;  1VQ8 A;  3SWN B;  2R5M A;  3CCU A;  5KYU B;  2SRC A;  5KYY B;  2YWW A;  2K5I A;  4V2S A;  2BE7 D;  3LWH A;  4JPB W;  3RKW A;  5A0D A;  1X27 A;  1ZUK A;  3V7C A;  3AT1 B;  4DBF A;  2MI6 A;  2CH4 W;  2KMT A;  4RTU A;  2HMA A;  3JB9 F;  4OF1 A;  2K3B A;  1SHG A;  2OTJ A;  1M3C A;  1WHJ A;  4O5V A;  2FEI A;  4HCZ A;  2EYW A;  4M7D D;  1NE8 A;  2XI9 A;  3M5A A;  2O01 E;  1EFN A;  1LPL A;  2DYI A;  2M1H A;  3I55 Q;  2HL3 A;  2OX7 A;  2VWF A;  4KUI A;  3F70 A;  3JB9 I;  2FPD A;  2ABL A;  2LNH B;  1BYM A;  1RUW A;  2D1X A;  3LH0 A;  5A0L A;  2CDT A;  2VC8 A;  2YLB A;  3VYH B;  3JB9 G;  1U5S A;  2JMC A;  1VQL Q;  1AWJ A;  3QSU A;  2PNI A;  2A36 A;  3OYF A;  2JJ9 A;  1MV0 B;  2DXB A;  2CGH A;  2ENM A;  4PFP A;  3OYE A;  4EDU A;  1Y71 A;  4OVA A;  4VUB A;  2DBM A;  2RPN A;  1Q86 U;  4GLK A;  4RG2 A;  1PC0 A;  4N0A C;  3INZ A;  4RUG A;  1VQN T;  1M90 R;  2H8H A;  5GAN 8;  3CCJ A;  1XTD A;  3PVQ A;  1E7O A;  1YCY A;  5LJ5 f;  2JNG A;  1PM3 A;  3C12 A;  4RTV A;  3OA6 A;  1GL5 A;  1RLQ C;  1H64 1;  1BI2 A;  2ZPF B;  1H3H A;  4F7U A;  3CD6 Q;  2FPE A;  1WXB A;  4CC2 A;  1Q82 R;  2CT3 A;  1I81 A;  3QUI A;  1Z9Z A;  2VV5 A;  1G2B A;  1M2V B;  3BY7 A;  3TSW A;  3A8O B;  2DM1 A;  2HKQ B;  3UWN A;  4AT1 B;  4PJO G;  2V1R A;  4M78 C;  3SEM A;  3P8H A;  2E70 A;  2RMO A;  2RQW A;  1XQH A;  3EH2 A;  3OS0 A;  4DEY A;  1K8A U;  1KQS S;  5DY9 A;  5D6X A;  3JCM X;  3MEW A;  3JCM g;  2LDM A;  2HNI A;  2ROL A;  1MMD A;  4HT8 A;  3CCE Q;  3RIR A;  1D0X A;  2F5K A;  2IVW A;  1VQP A;  4IUU A;  1CKA A;  1SSH A;  4OB0 B;  3S3M A;  1D1B A;  4FYY B;  3ULR B;  2LC4 A;  3OYM A;  3R6O A;  4EMH A;  2QTV A;  1O9S A;  3CXC S;  1ZSZ B;  4R0K A;  3PE0 A;  5HK3 A;  2COY A;  4QVD A;  1M8V A;  3QWX X;  1D1A A;  2RHZ A;  4M7A B;  2RJC A;  2NUT A;  3V7S A;  2FG0 A;  1Q95 G;  2GBQ A;  1YIJ T;  4IIO A;  5GMK h;  1ABO A;  1X6G A;  1YIT A;  2L8D A;  1PRL C;  3QWY A;  5CQY A;  5GAN j;  1HXD A;  2RI2 A;  2CZ7 B;  4D8K A;  3E2U A;  1PNJ A;  3GLX A;  1BIB A;  3TCJ A;  3MHX A;  4M77 C;  2E10 A;  1VQK T;  1I4K 1;  3SWN C;  4OGE A;  1QWF A;  1UHF A;  2A7Y A;  1M3B A;  4C92 A;  4MDW A;  3A1P A;  1UGQ B;  3OYH A;  3BW1 A;  3LGL A;  4JRI A;  1V29 B;  2E6N A;  4PJM A;  1P92 A;  2JMA A;  2FZK B;  3G4S Q;  2DLP A;  2V1Q A;  2KI7 A;  1QVF S;  4KGZ B;  1Z9Q A;  3MO8 A;  1QMC A;  3VS2 A;  4QQD A;  4M75 C;  3PMI A;  2D9T A;  4B9X A;  5GAN 2;  1XJW B;  3EHR A;  2QQS A;  3RDV A;  4LXC A;  4E7S A;  3VRZ A;  2DBK A;  2PU9 B;  2FO0 A;  5KYY A;  1WYX A;  2YLC A;  1YHQ A;  2EVR A;  1X75 C;  3CC2 T;  2KYB A;  3VYG A;  1I07 A;  3HRS A;  1PSF A;  4FT4 A;  2Y90 A;  2HZY A;  4OMN A;  3DLM A;  2QQB A;  1UHC A;  1PD1 A;  3I55 T;  2RB6 A;  3EH1 A;  3CME A;  3DLL A;  2E4H A;  1UGS B;  4NS5 A;  1VQO A;  5DLQ E;  3VS0 A;  4C5E A;  4ZGE B;  4Z89 A;  5KE3 A;  2RH2 A;  1YN8 A;  1M3A A;  2KYM A;  4XQ3 A;  3ME9 A;  3G7Z A;  4C0G A;  2DL4 A;  2IPO B;  2LT1 A;  2RHY A;  2Y4X A;  2DVE A;  1RLP C;  5J26 A;  2JOY A;  5GAN 4;  1TH7 A;  2RI5 A;  1ZA1 B;  2DAQ A;  3NTH A;  1Q82 C;  1B07 A;  2LQW A;  1VUB A;  3REB B;  1YIJ Q;  4J7I A;  4M7A D;  1FX7 A;  1VQ5 A;  4JZ4 A;  1M5Q 1;  4M77 F;  2CP2 A;  3PIO A;  5FU6 B;  1IXD A;  4WF2 A;  2M9U A;  4A4E A;  4C5I A;  2DNU A;  4FYX B;  1VQK A;  5GAM j;  2ECZ A;  4BI3 A;  2CP7 A;  4M78 E;  1KD1 R;  2CH4 A;  4GBQ A;  3I9Q A;  1K73 C;  2YUO A;  2P4T A;  1PCX A;  3TU4 K;  1KD1 C;  1YI2 A;  1I5L A;  3R6N A;  2EPD A;  1FMW A;  2D0N A;  2EQJ A;  3V8K A;  2JM8 A;  1TXQ A;  2HQE A;  4RTX A;  4XTV A;  2KBT A;  2QA4 T;  1D0Z A;  1SRM A;  2CZ0 B;  2K2V A;  2YRD A;  4RCB A;  1VQ7 A;  1R0C B;  3L2U A;  4AMC A;  5J39 A;  4HA8 A;  3LGF A;  5LJ5 h;  2QGF B;  1B7T A;  2FZG B;  3A8M B;  2MOX A;  4E47 A;  4XU2 A;  2VXE A;  3CCR A;  3CCS Q;  3G6E A;  3OW2 S;  1KFZ A;  4M7D G;  4JZ3 A;  1PHT A;  2IG0 A;  4C92 F;  4A4G A;  4IIM A;  3CC4 A;  5LJ3 g;  4ZGJ B;  1Y7X A;  4OMM A;  5LJ3 e;  5IT9 E;  2HQH A;  2QEX Q;  2LCC A;  3ZEH A;  3OYJ A;  1BU1 A;  1K9M R;  2BKD N;  1IGU A;  1QCN A;  3FLG A;  3OSS C;  2HQX A;  1M1K R;  3OMG A;  4FSX A;  3HKS A;  5GJV B;  1PKS A;  3U23 A;  2VKN A;  3CBO A;  3QG1 A;  2CRE A;  5KCO A;  4CC7 A;  3OYY A;  4C0F A;  1OI1 A;  3RNJ A;  4C8Q D;  3H41 A;  4BUG A;  1ZA2 B;  2KXC A;  1M90 C;  2MMP A;  1NJI U;  4FSS A;  2B86 A;  5IHK A;  3JB9 J;  4IUP A;  3CXC A;  1QP3 A;  2A0F B;  1N5Z A;  2HCK A;  2KEA A;  4PNO A;  4M75 B;  1O75 A;  3JCM V;  4RTW A;  4ZN3 A;  4M78 D;  1KC8 C;  2DVJ A;  2W0Z A;  2LQK A;  2EYQ A;  4ZTJ A;  5LL6 S;  4FT2 A;  2H3E B;  2QA4 A;  4P5N A;  3JCM P;  1IO6 A;  2QGG A;  3L1A A;  4GY5 A;  2FVU A;  1YIT Q;  4J6X A;  1SPK A;  3VUB A;  4C5H A;  2QQR A;  3DB3 A;  3CPW A;  3URG A;  2Y4Y A;  4M77 B;  1Y0M A;  2CSI A;  3GOX A;  4PJL A;  1F1B B;  3IQL A;  1PRM C;  1IB8 A;  2EQK A;  2CKK A;  4TVR A;  4JJC A;  1G3S A;  3QJY A;  3DKM A;  4PFZ A;  2KRO A;  4KH0 B;  3UT1 A;  5EG2 A;  4E7L A;  2K4Y A;  5HK0 A;  1RAA B;  1VQP Q;  1M9S A;  1IHV A;  3LH5 A;  1V76 A;  4M7A C;  1AWO A;  4PJJ A;  4DOW A;  5FRM A;  4C92 D;  4J9B A;  4C8Q F;  4OMO A;  2C0O A;  2C0I A;  2DL7 A;  1PD0 A;  1QW1 A;  1BI1 A;  1Q7Y R;  1AHJ B;  1QVF A;  4ORZ A;  2F2W A;  4QVZ A;  2PTK A;  1S72 A;  4EMK C;  2HKN A;  1ZLM A;  2DIL A;  3KBG A;  1RAD B;  4JDS A;  5CKH A;  2DZ9 A;  1NYG A;  3FJ5 A;  8ATC B;  3CCM Q;  2ROT A;  5GAN h;  1AZE A;  5LJ3 j;  3EG1 A;  2R57 A;  4HKE A;  1OEB A;  3CD6 A;  1M30 A;  3A5Z B;  2DL8 A;  5GMK i;  2VGM A;  1AD5 A;  4QKU A;  4NOY A;  2FRW A;  4J9E A;  1MUZ A;  4C92 B;  2BZX A;  1VQ6 Q;  3M54 A;  3CBP A;  1M2O A;  2X9H A;  3LWI A;  2P0K A;  4FM4 B;  2OAW A;  1YJ9 Q;  5IXB A;  1N9R A;  2JM9 A;  4PLI A;  3SWN A;  2WSE E;  3CC4 T;  2E6Z A;  4XTW A;  3JV3 A;  4J5Y A;  3V7R A;  3OS1 A;  2HEQ A;  1VQ7 T;  4XAX B;  1KHC A;  3QZ5 B;  2PQW A;  2ED1 A;  4R56 A;  1TOV A;  4MZP A;  2NWM A;  2DXT A;  4K11 A;  4BE2 A;  4J9H A;  3L2W A;  1VQ9 Q;  1OZ2 A;  1H3Z A;  1D1C A;  2X3X D;  2DEQ A;  2BTT A;  2ZGW A;  2B8A A;  1YJ9 A;  2KDS A;  4RMO A;  2YUP A;  2JZ2 A;  2E3H A;  5LJ5 e;  2K57 A;  5GAN e;  4HVU A;  2FRY A;  3HPW A;  3PT9 A;  3FIF A;  1OPK A;  1Q86 C;  3C94 A;  2XK0 A;  3M0T A;  3VS1 A;  1WHM A;  2LCL A;  3NPF A;  1RAE B;  4M75 F;  3KUF A;  2RK1 A;  3EFO B;  3RKX A;  1Q81 U;  2XDB A;  5IN1 A;  2MYS A;  1NEB A;  4B9W A;  3HRT A;  1QVG P;  1VYV A;  2O4X A;  3OYN A;  4LNP A;  5KE2 A;  3OS2 A;  1NLP C;  5IHI A;  5CR2 A;  1S1N A;  2MWO A;  1BKB A;  4QW2 A;  4JS4 A;  2E64 A;  5GAN 3;  3CEY A;  3J7A F;  3CCU Q;  3HP9 A;  1VQ8 Q;  1OZ3 A;  5CK9 A;  1WHH A;  2L89 A;  2FZC B;  2F5T X;  2QYZ A;  2D8J A;  2LTO A;  5FU7 C;  3JCM c;  5AT1 B;  2DRM A;  1N8R C;  1K9M U;  2KT1 A;  3E9F A;  5GAO r;  1VQP T;  1VQM T;  1VQ6 T;  1H8K A;  4N4G A;  2WAC A;  4FYW B;  4M7A A;  2ED0 A;  2EIF A;  4RTT A;  4X34 A;  3X25 B;  1NPP A;  3M0R A;  3H9N A;  4C8Q B;  2L5Q A;  2RHI A;  2A37 A;  2EAY A;  1WHL A;  3A8H B;  5M9O A;  3L2V A;  1OYX A;  4PFO A;  4FL6 A;  2CUD A;  2RF0 A;  1WQ7 A;  1WX6 A;  4AG1 C;  1KSW A;  5GMK l;  1OX9 A;  2QA4 Q;  3SFM A;  2EYY A;  4QQ6 A;  4RG8 A;  4L6V 5;  2EKH A;  2JTF A;  3MPU B;  1S72 T;  1KQS P;  1JU5 C;  2AKL A;  5D6Y A;  4A63 B;  3CCL Q;  1DJ7 B;  1Y07 A;  4DBH A;  5IH2 A;  2PUO B;  1ZQ1 A;  4MMK A;  3L2R A;  2JVV A;  3C95 A;  3CCJ T;  4FCY A;  4BI8 B;  2O88 A;  4Z88 A;  4A4H A;  1RI0 A;  3WXM B;  3M0U A;  2OJ2 A;  3M4Y A;  3GF5 A;  4ELZ C;  4CC3 A;  2CP6 A;  3CC7 T;  1AEY A;  3OSV A;  4A53 A;  1UJ0 A;  1X6O A;  4C8Q G;  2KY9 A;  1U1T A;  4HCC A;  2E65 A;  4N4H A;  1G3T A;  4E7K A;  1ZBJ A;  2QI2 A;  3DB4 A;  2OTL A;  1FXX A;  2DA9 A;  1K1Z A;  4HVV A;  3M0Q A;  4JRK A;  5EC7 A;  3MEV A;  2L0A A;  4AFQ C;  2PVG B;  2QTX A;  3AHU A;  3PIP A;  4RTZ A;  1T3S A;  3RBB B;  4FIB A;  1M8M A;  4OP0 A;  4KBM B;  1LJO A;  2HAX A;  1ARK A;  2E5K A;  1IRE B;  2K6D A;  3TSZ A;  3CME T;  2DTI A;  3TRE A;  1LCK A;  2QQA A;  4E7J A;  1TTH B;  2DXU A;  4E7Z A;  3QZ9 B;  4XTY A;  3M53 A;  3C4S A;  1M1F A;  1VQM Q;  2LCS A;  2XDP A;  4ZNX A;  2DPP B;  4LD9 K;  2CP3 A;  3LX7 A;  2ZZD A;  3A8L B;  2RM4 A;  1R8O B;  1SF9 A;  4M7A G;  3EGX B;  3G1J A;  2RD1 A;  2E41 A;  3CCV A;  4Z8A A;  2LVM A;  1ZUU A;  3JCM Q;  1WHG A;  1UB4 A;  3SD4 A;  1D3B A;  2H3J A;  3NFC A;  4OB1 B;  2OTL Q;  4C8Q E;  1CSK A;  1YJN A;  2KQW A;  4Q5W A;  2HL5 C;  2L3S A;  2VYT A;  4CRI A;  5GAN 6;  4OMF B;  1NBE B;  1M90 U;  1CKB A;  5D7U A;  1GFC A;  1WXU A;  1VQN A;  1VQK Q;  2RJD A;  4E7I A;  1MGQ A;  3VS6 A;  1W2B A;  1X2Q A;  5GAM g;  1AWW A;  1SSF A;  2JXB A;  5GAM e;  2YXY A;  1VQ5 Q;  4JJB A;  1M27 C;  1PG5 B;  1M1G A;  3CCL A;  4M7D E;  4M4Z A;  5IAY A;  3JCM e;  4JJN K;  3CCE T;  4JLG A;  4EPC A;  4ZN1 A;  1NG2 A;  5GAN 5;  1X6B A;  3SHW A;  4ANJ A;  4LDV A;  3QXE B;  2KE9 A;  4ZGD B;  4PJO A;  1PWT A;  1Q81 R;  1HYO A;  2DJQ A;  2QAS A;  2LX7 A;  4PJN A;  4M78 G;  4F7U B;  3CPW S;  4KH1 B;  1I1J A;  1TS9 A;  1Q7Y U;  2GTJ A;  4F04 B;  1OUL A;  4DQ2 A;  1ZUY A;  5KYW A;  2K2M A;  1AWX A;  2E3I A;  3JAM E;  2XDD A;  2ZCF B;  3M4G A;  4M7D B;  5A2Q E;  3ER0 A;  4C8Q C;  1TUD A;  3CCL T;  2F1L A;  3EG0 A;  3FDR A;  3UA6 A;  2D8H A;  1UFF A;  2RQV A;  1G3W A;  2VXF A;  4LDX A;  1T0H A;  1UE9 A;  1ZX6 A;  4DOV A;  2EQI A;  3PTA A;  4FW2 A;  1BK2 A;  3EG2 A;  2LNV A;  4OMQ A;  3JCM f;  2YUQ A;  3M0P A;  5FU7 B;  2VUB A;  5HKC A;  3GBQ A;  1FMV A;  3THK A;  1UGP B;  3CPW P;  1A0N B;  4KRT A;  2RHU A;  4EMG A;  1G3Y A;  2X4X A;  5GMK e;  5GAN d;  3KFV A;  2O9V A;  2IIM A;  1QVG S;  2FHD A;  3X24 B;  4AFS C;  3LLR A;  3TQ7 P;  3JSC A;  2J06 A;  1K73 R;  2NLU A;  3PNW C;  5C0M A;  2D6F A;  1ZSZ C;  5HY6 A;  2G6F X;  2WSC E;  3H0I A;  3QJ6 A;  5GJW B;  1AZG B;  1BIA A;  1RAG B;  4A54 A;  2C0T A;  4F7U E;  1WA7 A;  1UTI A;  2YDL A;  1YJW Q;  5D6W A;  5LJ3 f;  3PMT A;  3E19 A;  5CKD A;  3CCU T;  2JS2 A;  1WDX A;  2LZ6 B;  2EQU A;  2HSE B;  2DXC A;  3N5B B;  2KNB B;  2R5A A;  3CCE A;  1W6X A;  2P84 A;  3M55 A;  2CT4 A;  1MHN A;  3MEU A;  4J7F A;  2KR3 A;  4NL3 A;  2P0Q A;  5FW9 A;  1YI2 T;  1WJS A;  3ZBD A;  2LMJ A;  3NTK A;  3OYD A;  1W4S A;  3JRZ A;  3X26 B;  2NUZ A;  1NM7 A;  2XD0 A;  2DK3 A;  4EMK A;  3EGD A;  1RAI B;  3X28 B;  2EYZ A;  1BB9 A;  1WI7 A;  2YRV A;  2P4R A;  1RAH B;  4LE9 A;  5GAO n;  3OYI A;  5KCH A;  2K79 A;  3UPU A;  2WSF E;  4M75 E;  3X20 B;  1S72 Q;  4E6R A;  4XTX A;  2DFU A;  4F7U F;  2HSP A;  3A98 A;  2O9S A;  1WGS A;  1R0B G;  3QDF A;  5HCK A;  3EFS A;  2DTH A;  3SB2 A;  4EIK A;  4KUD K;  4M77 G;  2ZPG B;  3M59 A;  2YUN A;  1QQJ A;  4RKU E;  1SRL A;  1QVG A;  2GFA A;  2X51 A;  1K4U S;  1GBQ A;  1SHF A;  1YP5 A;  1YJW T;  3MP1 A;  1K0S A;  3S3N A;  4DEX A;  2KVQ G;  4C0Z A;  3E9G A;  1LVK A;  4QQG A;  2KRN A;  1WPY A;  1VQL A;  4M7D F;  2DL5 A;  1W2B S;  5I11 A;  1YJW A;  2GTO A;  1ZSG A;  4LDY A;  5CKE A;  2F2X A;  5GAM h;  4D8D A;  2DET A;  4X9C A;  2BE9 B;  6AT1 B;  2M16 A;  1H92 A;  3CC2 A;  3PFS A;  2C06 A;  1TUG B;  1QWE A;  1TG0 A;  1NYF A;  2YT6 A;  1VOM A;  2OTJ Q;  2JS0 A;  1SG5 A;  1QP2 A;  3RR6 A;  5CQX A;  2O4X B;  4C92 G;  2F2V A;  3OYL A;  2DE0 X;  4A4F A;  2DZC A;  4FYV B;  3NMZ C;  4BD3 A;  2J7I A;  2KRM A;  2PVD B;  1MND A;  2CYZ B;  1C1A A;  2KRS A;  4OB3 B;  1N8R R;  2DO3 A;  4KUL A;  4CC4 B;  4C0D C;  1GCQ C;  1KG1 A;  4BB7 A;  2EJG A;  2M02 A;  1VYU A;  1VQO T;  1OX8 A;  2Z0W A;  2J05 A;  3O8V A;  4MZM A;  2KGT A;  3CCR T;  2J6O A;  4IUV A;  1OQK A;  3LW5 E;  1FWZ A;  3KXT A;  1B34 A;  3BE3 A;  2A3L A;  3OMC A;  3OBW A;  5GAN g;  1RAC B;  2ESW A;  4C8Q A;  2RA2 A;  1JJ2 P;  2RQT A;  4L59 A;  4HXJ A;  3J80 E;  4MML A;  5LJ3 d;  2COZ A;  1GXI E;  3CC7 Q;  3H0H A;  3CMA Q;  3NHN A;  2D0Q B;  3OW2 A;  1KQS A;  4LUE A;  2QG9 B;  2GCX A;  1Q86 R;  3MJX A;  4E7H A;  3HTR A;  2KXD A;  1I8F A;  1JBM A;  1VQ9 T;  2LX9 A;  3CC4 Q;  2M0Y A;  2CS7 A;  5KYX B;  1ABQ A;  3P8B B;  3HFN A;  2SEM A;  1SKU B;  5KYX A;  2BZ8 A;  2NYS A;  3G6E Q;  3CCS A;  1D09 B;  1G8X A;  4QVC A;  2K9G A;  2X3W D;  3NGP A;  2GQI A;  3RER A;  3CD6 T;  2DF6 A;  4F7U G;  3Q1J A;  3EAE A;  2AIR B;  1B34 B;  3VV0 A;  2KT8 A;  1K73 U;  3JCM d;  1KQ2 A;  4UC4 A;  1U8R A;  2E5Q A;  3QYH B;  1NJI R;  4BE0 A;  2K5L A;  1VQ4 A;  2XIC A;  5GAM d;  4O6J A;  3GP8 A;  2DJZ A;  2W10 A;  5I22 A;  2CZ6 B;  4PKC C;  2RQR A;  4XTZ A;  1G5V A;  3I56 T;  4MDX A;  3EFR A;  3BDU A;  3HHT B;  2EGE A;  2XHC A;  4M77 A;  1YJN Q;  4YTL A;  4LDW A;  4B6M A;  4M7D A;  1QLY A;  1VQ4 Q;  2FL7 A;  2ZPB B;  2M0O A;  4Z02 A;  4ELY C;  3CCS T;  3CCV Q;  3EG9 B;  3MKD A;  5CO7 A;  5GAN 7;  3A8G B;  1YIJ A;  2VB6 A;  2KK4 A;  3D7S B;  3GNG A;  1EIF A;  3H0F A;  3FEO A;  3M58 A;  1SEM A;  4M75 A;  2L3R A;  4M78 F;  1GCP A;  1Y57 A;  2DTO A;  3I5S A;  2LP5 A;  3RKY A;  3REA B;  1IZ6 A;  3OYA A;  3VUZ A;  2EFI A;  4HCB A;  1K8A C;  2RK2 A;  3VKI A;  4M77 E;  2JN0 A;  3HFO A;  2J6K A;  2K3Y A;  1U06 A;  2JTM A;  1VQO Q;  4J9C A;  5FRN A;  1X43 A;  5CKF A;  3JCM b;  4FW1 A;  5C6S A;  2HBW A;  3CMA T;  1Y96 A;  4PJO B;  1ZHI A;  3CC7 A;  1YHQ Q;  5LJ3 h;  5DM7 R;  4M75 G;  4BDZ A;  4C92 E;  2AK5 A;  4M7A E;  1UGV A;  2G3R A;  3E1S A;  2DEU A;  1HSQ A;  4OMP A;  2PZ1 A;  1QKX A;  1WFW A;  3GNF B;  2K3X A;  2X4J A;  5ECA A;  2K7A A;  3CCQ Q;  2CUB A;  3OS5 A;  1YWO A;  3VS5 A;  4ATO A;  1JJ2 S;  1MMA A;  3MCA B;  3MP6 A;  2V8I A;  2X4W A;  4Y28 E;  3NTI A;  1D0Y A;  2RO0 A;  1UDL A;  4KT0 E;  3TVT A;  1JQQ A;  3G4S A;  4J6Y A;  1WXT A;  3OBY A;  1UG1 A;  1M4Z A;  4NL2 A;  2EYX A;  5L23 A;  2OI3 A;  2YHT A;  1U1S A;  4WTO B;  3G4S T;  3RMS A;  1B3Q A;  3C0C A;  1VQ4 T;  1XNI A;  1OU9 A;  4D6W A;  2QK0 A;  4C0D B;  2R58 A;  1NPR A;  3G71 A;  4PL6 A;  3L42 A;  3QO3 A;  1WHK A;  4ESR A;  3EGD B;  3M9Q A;  4J6W A;  3G6E T;  3S3O A;  4N0A A;  5GAM f;  1W70 A;  1YCS B;  3CC2 Q;  5FWC A;  5GMK m;  5CKB A;  1N27 A;  2DD5 A;  4XK8 E;  2MK5 A;  3BFM A;  5DLO A;  1VQ8 T;  4CI0 C;  3JCM J;  1UUE A;  2ATC B;  1YIT T;  2NUP A;  5GAO l;  1YNZ A;  1T0J A;  1W1F A;  1JRI A;  5KYU A;  1KD1 U;  3CXC P;  2E12 A;  2DKG A;  4Y91 A;  5CAI A;  2AHJ B;  1KK7 A;  1OOT A;  2DD4 A;  1G83 A;  1YWP A;  4PJO D;  4A4K A;  2RNA A;  2DL3 A;  3V8J A;  3UA7 A;  3OYB A;  5KH6 A;  2ZAE A;  3QKJ A;  4Y92 A;  1GFD A;  3CQT A;  4BDY A;  1YBY A;  4F14 A;  3M0S A;  3VS7 A;  2AZS A;  4M75 D;  4M78 A;  3L2Q A;  1M1K C;  3EFO A;  1XOV A;  1YJ9 T;  1YHQ T;  2L3P A;  1IHW A;  3FRN A;  4M78 B;  4X9D A;  3CPF A;  1AT1 B;  1AOJ A;  1WQW A;  2NUP B;  3I56 A;  1OPL A;  2M51 A;  4DBQ A;  3RUX A;  1ACM B;  1TSF A;  4IKF A;  4AFZ C;  3CCJ Q;  1YJN T;  5AYF A;  4XU1 A;  5GAN f;  4BY6 B;  2MAM A;  2V8K A;  1GCQ A;  2PVO B;  4J9F A;  1YFN A;  1VQ9 A;  5LJ5 d;  1TUC A;  5I2S A;  2OTL T;  2LRQ A;  3JB9 H;  2COW A;  4PJO F;  3HRU A;  2MIO A;  1JXO A;  2RJE A;  5J3B A;  4BY6 C;  1NLO C;  2J6F A;  2DIQ A;  2QDY B;  1V1C A;  1LOJ A;  4C92 C;  1BI0 A;  1MMN A;  5IXF A;  2GGR A;  4IUR A;  2A28 A;  1ZSZ A;  3M56 A;  5CCA A;  4AG2 C;  1LNX A;  3I35 A;  2QEX T;  3EG3 A;  4OGC A;  2I0N A;  1Q7Y C;  2RHX A;  3QHS A;  4J9I A;  2FPF A;  4J9D A;  3OYK A;  3I55 A;  1VQ6 A;  1Y96 B;  3I56 Q;  2MCN A;  4JRP A;  1M2V A;  2ZPH B;  4JRQ A;  3OYC A;  3QPH A;  1KIK A;  4EMK B;  5L8R E;  1HK9 A;  4PLL A;  2MWP A;  2RN8 A;  3H6Z A;  3RES A;  3MET A;  4ME7 A;  4BE1 A;  2AT1 B;  2JW4 A;  5CVI A;  3CCM A;  1E6G A;  1K9A A;  7AT1 B;  1X01 A;  4RCC A;  4GLM A;  3LYI A;  2DMO A;  2ZPE B;  1KHI A;  1VQL T;  4PJO E;  1QCO A;  2GF7 A;  3HSB A;  2BIV A;  3EHQ A;  1WNL A;  2MPX C;  2EJF A;  3TEE A;  2HDA A;  1VA7 A;  1IGQ A;  1WJR A;  4II1 A;  4JJD A;  1UJY A;  1Q82 U;  4ZTF A;  2YRC A;  2JTE A;  1WJQ A;  1VIF A;  2DER A;  2DIG A;  5LJ5 g;  3EGX A;  1I0C A;  1N6A A;  4AFU C;  4DA4 A;  1VYT A;  4M7D C;  1K0X A;  4RTY A;  2LQ8 A;  1OV3 A;  2DYB A;  2LQN A;  5GAO m;  2LJ0 A;  2CZ1 B;  2X4Y A;  1AVZ C;  2A08 A;  2MF2 A;  3ASK A;  4J9G A;  1X69 A;  3EG9 A;  3O5Z A;  1R77 A;  2F69 A;  1JB0 E;  5GAO p;  3QDR B;  3CCV T;  2FYK A;  5KYN A;  3G71 Q;  2AKK A;  4IUT A;  3FJP A;  2V26 A;  2ZPI B;  2DX1 A;  5FLX E;  3PGG A;  2JT4 A;  2XID A;  2K5F A;  2L3Q A;  1MV3 A;  4KGX B;  1MMG A;  2LT4 A;  1VQ5 T;  3ZFJ A;  3M57 A;  2CP5 A;  2P0P A;  1VIE A;  3OY9 A;  2BUD A;  2EJ9 A;  2GFU A;  4LD6 A;  3OW2 P;  1VQN Q;  3QBY A;  1W2B P;  1FYN A;  2O2O A;  1K8A R;  2DRK A;  1RAF B;  1T3L A;  1QVP A;  3VS3 A;  4PJO C;  1GRI A;  1PKT A;  2GQV A;  2LJ3 A;  1K76 A;  3CCQ A;  1E6H A;  2XKO C;  2EW3 A;  1UEB A;  4J8O A;  4N4I A;  4KGV B;  5I21 A;  3VS4 A;  1RL2 A;  2EQM A;  2YSQ A;  3HL8 A;  3I5R A;  5FRO A;  3QYG B; 
#chains in the Genus database with same CATH homology
 4HVV A;  3M0Q A;  4JZ4 A;  2KT8 A;  5EC7 A;  5FWB A;  2L0A A;  2GNC A;  4AFQ C;  3VRY A;  2DNU A;  3PVL A;  4RTZ A;  2ECZ A;  1WLP B;  1T3S A;  1BBZ A;  3RBB B;  1HD3 A;  1M8M A;  2W10 A;  5I22 A;  2CH4 A;  4GBQ A;  3I9Q A;  2YUO A;  1ARK A;  2E5K A;  2RQR A;  2K6D A;  3TSZ A;  1LCK A;  2EGE A;  1JO8 A;  2QDL A;  1J3T A;  1QLY A;  3R6N A;  2EPD A;  3UF4 A;  2D0N A;  2LCS A;  4ZNX A;  2JM8 A;  4OML A;  4RTX A;  2KBT A;  1SRM A;  2BZY A;  4Z8A A;  1ZUU A;  4F17 A;  4QT7 A;  1JXM A;  3H0F A;  3ZL7 C;  2VVK A;  1SEM A;  4HCK A;  1CSK A;  1JEG A;  2MOX A;  1WIE A;  1GCP A;  1Y57 A;  2RQU A;  3I5S A;  2LP5 A;  2L3S A;  1KFZ A;  4JZ3 A;  3REA B;  2EGC A;  1PHT A;  5IHN A;  1GBR A;  1CKB A;  1FMK A;  3EGU A;  1GFC A;  1WXU A;  4IIM A;  4OMM A;  2J6K A;  1U06 A;  3VS6 A;  4J9C A;  1X43 A;  1X2Q A;  1AWW A;  2JXB A;  2HBW A;  1BU1 A;  3UAT A;  4JJB A;  1M27 C;  1U3O A;  2CSQ A;  2O31 A;  4LN2 A;  4LUD A;  2AZV A;  2AK5 A;  1UGV A;  4M4Z A;  5GJV B;  1HSQ A;  1PKS A;  4OMP A;  2PZ1 A;  1QKX A;  1WFW A;  3U23 A;  1NG2 A;  1QKW A;  2VKN A;  1X6B A;  1NEG A;  5ECA A;  3SHW A;  2CRE A;  4F16 A;  2K7A A;  2CUB A;  2L2P A;  2KE9 A;  4CC7 A;  1QCF A;  2EGA A;  1YWO A;  3RNJ A;  1PWT A;  3VS5 A;  3H41 A;  2DJQ A;  2LX7 A;  1UDL A;  2KXC A;  1I1J A;  3TVT A;  1JQQ A;  4FSS A;  2B86 A;  1WXT A;  4WCI A;  1UG1 A;  2EYX A;  2GTJ A;  5IHK A;  5L23 A;  2KEA A;  1N5Z A;  2HCK A;  2OI3 A;  1HJD A;  1ZUY A;  4X1V A;  2EBP A;  2K2M A;  1X2K A;  4HVW A;  4RTW A;  1AWX A;  1B3Q A;  3C0C A;  2DVJ A;  2W0Z A;  1RI9 A;  2LJ1 A;  1TUD A;  1KJW A;  1IO6 A;  3EG0 A;  4ESR A;  3UA6 A;  2D8H A;  1UFF A;  1SPK A;  2RQV A;  1W70 A;  1YCS B;  2XMF A;  1T0H A;  1UE9 A;  1ZX6 A;  1UEC A;  2EQI A;  5FWC A;  1BK2 A;  3EG2 A;  2SRC A;  1Y0M A;  2CSI A;  4OMQ A;  2YUQ A;  3IQL A;  1PRM C;  1UUE A;  3M0P A;  4JPB W;  3GBQ A;  1X27 A;  1ZUK A;  4JJC A;  3THK A;  1A0N B;  4KRT A;  2KRO A;  1YNZ A;  2CH4 W;  1T0J A;  4RTU A;  1W1F A;  3KFV A;  3LH5 A;  2O9V A;  2IIM A;  2K3B A;  4AFS C;  1AWO A;  1SHG A;  1M3C A;  4J9B A;  2FEI A;  4OMO A;  2EYW A;  1OOT A;  2J06 A;  2C0O A;  2C0I A;  1EFN A;  2DL7 A;  1G83 A;  2G6F X;  1YWP A;  2RNA A;  3H0I A;  2DL3 A;  2VWF A;  4ORZ A;  3UA7 A;  2F2W A;  5GJW B;  2FPD A;  2PTK A;  2ABL A;  2LNH B;  1AZG B;  1RUW A;  2D1X A;  2CDT A;  4Y92 A;  1ZLM A;  2DIL A;  1GFD A;  3CQT A;  2C0T A;  1WA7 A;  1UTI A;  4F14 A;  3M0S A;  2YDL A;  1U5S A;  2JMC A;  1AWJ A;  1NYG A;  3VS7 A;  2AZS A;  3FJ5 A;  2PNI A;  2A36 A;  2JS2 A;  1WDX A;  2LZ6 B;  2ROT A;  1AZE A;  1MV0 B;  1XOV A;  3EG1 A;  2L3P A;  2ENM A;  1OEB A;  2KNB B;  1M30 A;  2DL8 A;  1AOJ A;  1W6X A;  2DBM A;  2RPN A;  1AD5 A;  2FRW A;  4J9E A;  1MUZ A;  4RUG A;  1OPL A;  2M51 A;  2CT4 A;  2BZX A;  2H8H A;  4AFZ C;  2OAW A;  3PVQ A;  5IXB A;  1E7O A;  1GCQ A;  2KR3 A;  4J9F A;  2JM9 A;  1TUC A;  5FW9 A;  4RTV A;  3JV3 A;  1GL5 A;  1RLQ C;  2MIO A;  1JXO A;  1H3H A;  2LMJ A;  2FPE A;  1NLO C;  2HEQ A;  1WXB A;  4CC2 A;  2J6F A;  2NUZ A;  2ED1 A;  2CT3 A;  1NM7 A;  1V1C A;  2NWM A;  2EYZ A;  1BB9 A;  1WI7 A;  1Z9Z A;  4K11 A;  2P4R A;  1G2B A;  5IXF A;  4LE9 A;  2K79 A;  3TSW A;  2GGR A;  4J9H A;  2DM1 A;  2A28 A;  2X3X D;  2BTT A;  2V1R A;  4E6R A;  4AG2 C;  3I35 A;  3SEM A;  2RMO A;  3EG3 A;  2RQW A;  2I0N A;  2YUP A;  4DEY A;  2HSP A;  2FPF A;  4J9D A;  4J9I A;  3A98 A;  2O9S A;  5HCK A;  4HVU A;  2FRY A;  2MCN A;  4EIK A;  1OPK A;  3M0T A;  3VS1 A;  2ROL A;  2YUN A;  3NPF A;  1SRL A;  1KIK A;  1K4U S;  1GBQ A;  1SHF A;  2RN8 A;  1YP5 A;  1CKA A;  1SSH A;  1K0S A;  4DEX A;  3ULR B;  1NEB A;  4R0K A;  2JW4 A;  3PE0 A;  1E6G A;  1VYV A;  1K9A A;  2KRN A;  4LNP A;  2DL5 A;  1NLP C;  4GLM A;  5IHI A;  5I11 A;  3QWX X;  2GTO A;  1ZSG A;  2DMO A;  1S1N A;  2F2X A;  4D8D A;  2FG0 A;  1H92 A;  2GBQ A;  3EHQ A;  4IIO A;  1ABO A;  1QWE A;  1X6G A;  2HDA A;  1PRL C;  1TG0 A;  1NYF A;  1VA7 A;  3QWY A;  2D8J A;  2YT6 A;  4JJD A;  2DRM A;  2JS0 A;  1UJY A;  4D8K A;  2KT1 A;  1PNJ A;  2JTE A;  2F2V A;  2DE0 X;  1H8K A;  1QWF A;  1UHF A;  3NMZ C;  1M3B A;  2J7I A;  2ED0 A;  1I0C A;  4AFU C;  2KRM A;  4RTT A;  3M0R A;  1VYT A;  2KRS A;  4CC4 B;  2A37 A;  1K0X A;  2JMA A;  4RTY A;  1GCQ C;  2DLP A;  1OV3 A;  2DYB A;  2LQN A;  2LJ0 A;  1VYU A;  2V1Q A;  1AVZ C;  2A08 A;  1Z9Q A;  2J05 A;  4J9G A;  3VS2 A;  2CUD A;  2RF0 A;  1WX6 A;  2KGT A;  1X69 A;  3EHR A;  2J6O A;  3O5Z A;  1KSW A;  4AG1 C;  3VRZ A;  2DBK A;  2EYY A;  2FO0 A;  1WYX A;  2AKK A;  2EKH A;  2EVR A;  2KYB A;  1JU5 C;  2AKL A;  2DX1 A;  2JT4 A;  2ESW A;  1I07 A;  2RQT A;  4OMN A;  4A63 B;  4HXJ A;  2L3Q A;  5IH2 A;  1MV3 A;  3H0H A;  3NHN A;  1UHC A;  4LUE A;  3VS0 A;  2O88 A;  4Z88 A;  4Z89 A;  2KXD A;  3M0U A;  2M0Y A;  2KYM A;  1YN8 A;  1FYN A;  1M3A A;  2O2O A;  2OJ2 A;  2DRK A;  1ABQ A;  2DL4 A;  1T3L A;  4CC3 A;  2SEM A;  3VS3 A;  1GRI A;  1PKT A;  2LJ3 A;  1K76 A;  1AEY A;  2BZ8 A;  1E6H A;  1UJ0 A;  1RLP C;  2EW3 A;  2K9G A;  1ZBJ A;  3VS4 A;  3I5R A;  2YSQ A;  2X3W D;  1B07 A;  2GQI A;  3NGP A;  2LQW A;  2DF6 A;  3REB B;  2DA9 A;  1K1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...