2CUBA

Solution structure of the sh3 domain of the human cytoplasmic protein nck1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
88
structure length
88
Chain Sequence
GSSGSSGDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
publication title Solution structure of the SH3 domain of the human cytoplasmic protein Nck1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cubA00
2LQWA 2F2WA 2DL3A 2ECZA 2C0IA 2PTKA 2EYZA 2SRCA 1Y0MA 2FEIA 5IHNA 1OOTA 1OV3A 2FO0A 1KIKA 2EGEA 2KXDA 2PNIA 2I0NA 1PRMC 2RMOA 1BBZA 2B86A 2J6FA 2YUOA 5FWCA 2RQUA 2KE9A 1OPLA 3R6NA 2D8JA 1OEBA 2YDLA 2EW3A 3TVTA 4IIOA 1ABOA 1GFDA 1ZUKA 3SHWA 3TSZA 4ESRA 5IXFA 2GNCA 3ULRB 2FPFA 3IQLA 5ECAA 2A37A 1CKAA 2RQTA 2LMJA 5I11A 1ZBJA 1T3SA 2HBWA 4D8DA 2RQRA 1IO6A 4DEYA 1WDXA 3VS3A 2BZXA 2A28A 2KXCA 1TUCA 3EG3A 1FMKA 2JMAA 2YUQA 3O5ZA 1U3OA 1BB9A 1MV3A 4Y92A 4CC2A 1X69A 2KT1A 2M0YA 1CKBA 4LNPA 1UDLA 2KGTA 4HXJA 1X43A 2KRSA 1M8MA 1QKWA 2EYWA 2GBQA 1NEGA 5IH2A 2DBMA 1GBRA 4J9GA 1FYNA 3PE0A 2VWFA 5I22A 3RNJA 4J9DA 4HCKA 2KEAA 2AK5A 2J6OA 4IIMA 4KRTA 1UFFA 2YSQA 2KRMA 2O31A 2EQIA 2JW4A 2M51A 3EGUA 4AFZC 2DA9A 5EC7A 1BU1A 1S1NA 1ZUUA 2LZ6B 2K2MA 1SRMA 2CT4A 1W1FA 5GJWB 2DILA 2C0OA 1H92A 1XOVA 1K4US 4RTVA 2F2XA 4F17A 1WXTA 1HJDA 4AFUC 2HSPA 4X1VA 1K9AA 1NLPC 2FRWA 2L2PA 5IHIA 2J05A 2GTOA 1G83A 5IHKA 4OMPA 1VA7A 3VS0A 4AG2C 1AWJA 2OI3A 2DYBA 2QDLA 3CQTA 4R0KA 2W0ZA 4RUGA 2EBPA 1UG1A 5L23A 3FJ5A 4F16A 2JS0A 4AFSC 2V1RA 2AKKA 2JT4A 4AFQC 4M4ZA 1QWEA 3I5SA 1NM7A 1UHFA 4OMLA 3H0HA 4DEXA 3A98A 3VS6A 3M0QA 2NUZA 2J6KA 1QWFA 2RQVA 3NGPA 4JPBW 1JO8A 1I07A 1ZSGA 2FRYA 4OMQA 2RNAA 2DL4A 3UF4A 1X6BA 2EVRA 1X2KA 4WCIA 5FW9A 2KYBA 2OAWA 2FPDA 1T0HA 5GJVB 1M3CA 3C0CA 2PZ1A 1WX6A 1RUWA 1T3LA 1GRIA 3VRZA 2LQNA 1VYTA 1AZGB 2JXBA 4OMMA 1WFWA 4RTWA 1U5SA 2CT3A 2YUPA 1UTIA 1RLPC 2DLPA 2FG0A 2CSQA 1TG0A 1Z9QA 1K1ZA 4JJDA 2HDAA 4OMNA 1YP5A 1YWOA 4LN2A 2G6FX 3U23A 2ABLA 1PWTA 1GBQA 1PKTA 4A63B 1BK2A 1SEMA 2OJ2A 3QWXX 2ENMA 2ROTA 1SHFA 2A36A 1AD5A 1E6HA 2VKNA 1UE9A 3THKA 4Z89A 4OMOA 1N5ZA 2DE0X 1SPKA 1GCQA 3VS5A 2MCNA 2DJQA 2K9GA 2SEMA 4JZ3A 1E6GA 2HCKA 1AWWA 2O9VA 4GBQA 2CDTA 2K6DA 4RTTA 4HVUA 3VS7A 2F2VA 1HSQA 2ED1A 3UA6A 1WA7A 1SHGA 1ARKA 4CC7A 2O88A 1PKSA 1KJWA 1MUZA 1PHTA 4RTXA 2LJ0A 4CC4B 1VYUA 1RI9A 1ABQA 2LCSA 2X3XD 1NLOC 2X3WD 1HD3A 4HVVA 2IIMA 1GCPA 4J9CA 4E6RA 4D8KA 1QLYA 1WYXA 2DRKA 3VRYA 1AZEA 2CUDA 2KRNA 4J9EA 2CSIA 1NYGA 1TUDA 2YUNA 1UUEA 4JJCA 3ZL7C 1ZLMA 2DX1A 1H3HA 4F14A 1JXOA 1M3BA 2EKHA 3M0RA 2K3BA 2GQIA 2V1QA 4JZ4A 5HCKA 3M0PA 3H0IA 1W6XA 2CH4A 1AOJA 2LX7A 3LH5A 3NHNA 1UGVA 2MIOA 3JV3A 1WI7A 2K7AA 2DM1A 3REBB 2KNBB 4FSSA 3EHQA 1NYFA 2FPEA 2AKLA 4LE9A 4ZNXA 1H8KA 1AWOA 1I1JA 1YWPA 2LJ3A 3NMZC 1QCFA 4J9HA 1ZUYA 3GBQA 3PVLA 2EYYA 3RBBB 1JEGA 1I0CA 3EHRA 1WXBA 2JM9A 3TSWA 2A08A 3REAB 2K79A 4GLMA 3VS2A 3I5RA 1UJYA 2L3PA 2XMFA 3PVQA 1Y57A 1UHCA 1RLQC 2ED0A 2DL8A 1EFNA 1SSHA 1PNJA 4LUEA 1WXUA 2AZVA 1M3AA 3UA7A 1J3TA 1YCSB 2P4RA 1X2QA 1X6GA 4QT7A 1WLPB 4RTUA 3UATA 2LP5A 3VS4A 3M0SA 1UECA 2YT6A 4J9BA 3I35A 5IXBA 1ZX6A 1OPKA 4RTYA 2BZ8A 2EPDA 2EGAA 1T0JA 2C0TA 2D0NA 3QWYA 1B3QA 2ESWA 3VS1A 2O2OA 1E7OA 2DRMA 2DF6A 2KBTA 4ORZA 1PRLC 1MV0B 2LNHB 3EG1A 1UJ0A 1K0SA 1B07A 2E5KA 2JMCA 2DL5A 2J06A 2KYMA 2BTTA 2KROA 2L0AA 3H0FA 2GTJA 1AEYA 2DMOA 2BZYA 2DNUA 2NWMA 4EIKA 2HEQA 2JTEA 2KR3A 3M0UA 1Z9ZA 4Z88A 2EGCA 4RTZA 2JS2A 1CSKA 2DL7A 2MOXA 1M27C 3EG2A 1K0XA 2H8HA 1G2BA 4Z8AA 2W10A 1KFZA 4J9FA 1GCQC 2CREA 4HVWA 2J7IA 5FWBA 2RN8A 4K11A 2LJ1A 4J9IA 2DBKA 2D1XA 1WIEA 4CC3A 2RQWA 1K76A 1QKXA 1NG2A 2VVKA 2JM8A 4AG1C 3M0TA 3H41A 3KFVA 2RF0A 2CUBA 1JQQA 1JXMA 1V1CA 2CH4W 2DVJA 2AZSA 1YNZA 1AWXA 1GL5A 1AVZC 2GGRA 2L3SA 1U06A 2D8HA 1LCKA 1VYVA 2KT8A 3EG0A 3NPFA 1NEBA 4JJBA 2L3QA 4LUDA 2ROLA 3SEMA 1KSWA 1X27A 1GFCA 1SRLA 2O9SA 2RPNA 3I9QA 1M30A 1A0NB 1W70A 2EYXA 1JU5C 1YN8A
chains in the Genus database with same CATH superfamily
2F2WA 2ECZA 4FYYB 2FEIA 2E65A 2FYKA 4OB2B 2O4XB 5HK3A 2I0NA 1BBZA 4FIBA 3CBMA 2OAUA 4PLIA 1FMWA 2KE9A 3TVTA 4IIOA 4E2FB 4EDUA 3H9NA 3SHWA 3TSZA 1M9SA 3FJPA 4J6YA 5GANe 2FPFA 2LDMA 3IQLA 2XG8D 4PFZA 1ZBJA 4F7UG 1T3SA 4D8DA 1WDXA 2EQJA 2ZGWA 4FU6A 1XJWB 4M7AG 2JMAA 4A4FA 1VQNT 3LLRA 1IHWA 2ZPGB 3MEVA 1Y07A 2VV5A 1BB9A 1MV3A 4CC2A 4ZGEB 2KT1A 3M59A 1ZA2B 3CCLA 4LNPA 4LD9K 4HXJA 1D09B 1ZSZB 4BE1A 4BY6C 2EYWA 5IH2A 1GBRA 1WJSA 1FYNA 2IG0A 5I22A 3RNJA 4PJLA 2RJCA 3CC2A 2AK5A 4OVAA 4C5GA 3WVDB 1ZHIA 1UFFA 1YJWT 2KRMA 2O31A 2ZCFB 3SWNC 2IPOB 2RH2A 5EC7A 1SSFA 3CD6A 2RA2A 1WNLA 4F04B 1ZUUA 2K2MA 2CT4A 2C0OA 1H92A 4F7UE 2KDSA 8AT1B 5KYXB 1K9AA 1NLPC 4M7AE 2J05A 2FZKB 2GTOA 4LXCA 2JJ9A 1F1BB 4YTLA 4E7KA 1YITQ 4OMPA 4FM4B 3ZEHA 5GMKh 3OBYA 1LNXA 3CCVA 2YLBA 3VUZA 3G6ET 1KQ2A 2ZZDA 2OI3A 7AT1B 1IREB 4RUGA 3ZBDA 2W0ZA 4XAXB 5L23A 3M58A 4F16A 2LQ8A 4KGVB 2JT4A 4ATOA 3V8JA 1YHQA 1O9SA 4OMLA 3QJ6A 3H0HA 3EGXA 3A98A 3VS6A 4KH1B 1QWFA 1M1GA 1QMCA 1KHIA 1P92A 4PJOC 1OU9A 3I56Q 1N27A 1VQ5T 3KUFA 2FRYA 4OMQA 1IGUA 2LT1A 3X20B 1C6VX 2AIRB 2DL4A 3E9GA 1M5Q1 1X6BA 3SDZA 4WCIA 3L1AA 1G3TA 4M78C 3FEOA 1RADB 5FU6B 2E6ZA 1Q7YU 3V7RA 4M75B 2E12A 1OULA 1UGPB 2QDYB 2HQEA 1AT1B 1GRIA 3VRZA 2LQNA 4F7UF 1W4SA 1AZGB 2JZ2A 4C8QF 2JXBA 3LGLA 4B6MA 2CT3A 4M7AF 3RKXA 2YUPA 3JCMW 5KCHA 1OX8A 4JJDA 4C0DC 3QG1A 4UC4A 4LN2A 2G6FX 3JCMh 1WQWA 2DTHA 2QQ9A 3MEAA 3DLLA 3NTIA 2ENMA 3SWNA 1AD5A 5LJ3d 3THKA 4L6V5 2CYZB 5A0DA 3VS5A 2MCNA 2DXUA 2X4JA 2HCKA 3CCLQ 2XKOC 1AWWA 2HQHA 2O9VA 4GBQA 3OYAA 1KG1A 3OYMA 4HVUA 2DTOA 3PTAA 2DERA 5KYUB 3CXCS 2RHIA 3M53A 4JUVA 4FT2A 1Q86C 1ZQ1A 1ARKA 5D6YA 4CC7A 3QYHB 3HFNA 1KJWA 5LJ5d 1PHTA 4XK8E 5GAMd 2LJ0A 3CD6Q 4LDUA 1VQ4A 3G6EA 2PVOB 3LGFA 2GF7A 2NYSA 2DXTA 2E1HA 2X3WD 1GCPA 4JLGA 4D8KA 3J80E 1QLYA 1WYXA 2NLUA 2Z0WA 4J9EA 3CCVQ 1LVKA 1ZSZC 3JB9H 5GMKm 1ZLMA 2DX1A 2DYIA 4R56A 2ZAEA 1VQ5A 2K3BA 4IUUA 5CKDA 2V1QA 1YHQQ 3A8LB 2FVUA 2HBPA 1G3SA 1UGVA 2QYZA 3CCEA 1I81A 3RERA 2COWA 1NBEB 1RL2A 3JB9J 1TWBA 3EHQA 2FPEA 4QQGA 3G1JA 2AKLA 4ZNXA 4C5HA 1H8KA 1AWOA 1VQ8A 2LJ3A 1QCFA 4J9HA 1WHKA 2DAQA 3GBQA 1QCNA 2D9TA 4IUTA 3RBBB 3RMQA 5CKBA 4JS4A 4M7DA 1MNDA 2MWPA 1VQLA 2P0KA 5KE2A 1PM3A 3QIIA 3G71T 3OS0A 1VQPT 1PG5B 2R58A 1PCXA 3PVQA 3PMTA 1BI2A 3PGGA 2QK0A 1X6GA 3LW5E 1VQNQ 1WLPB 2LP5A 1BCOA 3M0SA 1UECA 4AT1B 1PSFA 3BE3A 5IXBA 2AT1B 3BW1A 1NPPA 2EJ9A 3F70A 5CK9A 1XTDA 1B3QA 2V26A 1EX4A 3VS1A 1QQJA 4CRIA 2QTXA 4PJNA 4ORZA 5FU6C 4M75C 1K0SA 1B07A 3OYKA 4CI0C 5GAN5 3PFSA 4A4EA 2KYMA 2BTTA 1N6AA 3QO3A 2BE7D 2DNUA 4EIKA 4M7DD 1JRIA 2L5QA 4C0ZA 3I55T 5GAN3 3OMGA 2PQWA 1G5VA 3EG2A 4LDWA 1V29B 2QQBA 1GCQC 2J7IA 4PJOG 2CGHA 1VQ4Q 2E4HA 3JCMb 5M9OA 3G6EQ 2OTLA 1W2BA 1K73R 2LJ1A 2FZCB 1BCMA 4WF2A 1XQHA 1IZ6A 4PK4A 2DBKA 5GMKl 4OMFB 1HYOA 2B8AA 2RQWA 1QKXA 4M78G 1UGSB 2F5TX 2VVKA 1YIJA 1GXIE 4KBMB 3X26B 3H41A 5KYXA 3KFVA 2YWWA 2QEXT 1JQQA 1JXMA 5I2SA 1YNZA 1AWXA 5C6SA 1H3ZA 2XK0A 4B9WA 1AVZC 1U06A 2D8HA 1VQ5Q 1VYVA 2KT8A 2L3QA 4FYWB 4LUDA 3JCMd 4M77B 2ROLA 4E7IA 3G4ST 1S72T 3CCEQ 1SRLA 2A7YA 3EGDA 1A0NB 4X34A 3L2UA 2EYXA 2H3EB 4J8OA 2XI9A 4RTYA 4PJOE 2DL3A 1D0YA 2D0QB 2EYZA 3R6OA 2CZ1B 1RAHB 2DZ9A 1OV3A 2EQUA 3TU4K 4BI3A 3KBGA 3T9NA 4P5NA 1JBMA 2YUOA 5FWCA 3CC7A 2QQAA 2MPXC 1OPLA 4M78E 3R6NA 5LJ3j 2YRDA 2D8JA 1OEBA 1VQLQ 3SB2A 1GFDA 1ZUKA 1WQ7A 2HQXA 5DLOA 3LYIA 2GNCA 3CCST 2A37A 1CKAA 5LJ5f 3LH0A 5GAMf 3AT1B 5I11A 3JCMV 4F7UA 1IO6A 3OW2A 3EG9B 4NL3A 3L2VA 3VS3A 3GNGA 5CIUA 2BZXA 2A28A 2K3XA 3CPWA 3EG3A 1FMKA 5AT1B 1K8AC 2YUQA 1K9MC 1U3OA 1K9MR 5IT9E 3HL8A 1VQMA 4Y92A 3OW2P 2M0YA 5LJ5j 3CPWP 5GAMj 1UDLA 1X43A 2E41A 2P0QA 3RIRA 1VQKT 1QCOA 2BUDA 1NEGA 4HCBA 4J83A 4RCCA 1LPLA 2PVDB 5DLQE 3HSBA 2P84A 2KEAA 3HRSA 4XQ3A 4BDZA 2J6OA 4IIMA 4OF1A 1WJQA 4FCYA 3J7AF 3MKDA 1YJ9T 2EQIA 2JW4A 2M51A 4AFZC 3VYGA 2DA9A 1S1NA 1RAFB 3OSVA 5J3BA 1W1FA 5HKCA 1YJNA 1M90R 2XU8A 3GLXA 2QI2A 3L2ZA 3M9QA 5LJ3e 1K4US 4RTVA 2F2XA 1WXTA 1D3BB 4AFUC 1HJDA 3OY9A 2HSPA 1VQ7A 2L2PA 4EMKB 1MNEA 4O6JA 5IHKA 1IGQA 5L8RE 4C8QD 1KQSS 1WHHA 5HY6A 4M7AD 2DYBA 3CXCP 4KGZB 1UG1A 3QJYA 4J6WA 3QPHA 3FJ5A 4AFSC 2NUTB 4M4ZA 2VXFA 1MMNA 1NJIR 1YIJQ 3I5SA 5KYYB 5LJ5e 1VOMA 1UHFA 3OYHA 3JSCA 5GAMe 4DEXA 2J6KA 4JPBW 2QGGA 1KQ1A 1QVPA 3V7SA 2RNAA 1WHMA 4WTOB 1OI1A 2EVRA 2QA4T 2G3RA 1IXDA 3G71Q 3QZ9B 4XU2A 5GAOr 3MEUA 4HT9A 2ATCB 2VC8A 1BIAA 2DK3A 3CBPA 1H641 4FW1A 3RKWA 5CO7A 3CC7Q 4M75G 5GMKj 2FG0A 4NS5A 4GY5A 3MP8A 3L2RA 1Z9QA 1K1ZA 4JRPA 2HDAA 4OMNA 4FL6A 1YP5A 1WGSA 2ABLA 1PWTA 5IAYA 1GBQA 1PKTA 1BK2A 2JNGA 4M77C 1SEMA 3P8DA 3JCMQ 5I2MA 4IKFA 2ROTA 3QYGB 1K73U 2KAFA 1E6HA 2VKNA 1UE9A 1N5ZA 2DE0X 5D6WA 1KD1C 1VQMQ 2RD1A 4JZ3A 3JB9D 1E6GA 4XU3A 1W2BS 4HKEA 2LNVA 3X28B 4RTTA 3VS7A 3UWNA 1HSQA 3UA6A 5GAOm 4OGCA 4BE2A 4DOWA 4M75E 2R5MA 1N9SA 2RHYA 2DXCA 4XTYA 3JCMf 1D1BA 2XIDA 4KT0E 3A8GB 4CC4B 1VQOT 3OSSC 1RACB 2XDDA 4OB0B 3CCUT 2QQSA 4L5GA 1B34B 1NLOC 1YJNQ 3S6WA 5GMKe 5CQXA 1I8FA 2IIMA 4A4GA 2X35A 2K2VA 1VQ7Q 4Y28E 4FW2A 2COYA 2DRKA 3VRYA 1AZEA 2KRNA 4RKUE 2CSIA 1IRXA 3V8KA 5CVIA 3ZL7C 3QHSA 1RAGB 4F14A 1FWZA 3HP9A 1HK9A 3EAEA 1RI0A 2GQIA 4V2SA 4ELYC 1QP2A 1Q81C 3G4SQ 1S72Q 4XTWA 3JV3A 2K3YA 2K7AA 1WJRA 2NUPB 3CCMT 2LQKA 2KNBB 4FSSA 2EIFA 1K9MU 1NYFA 3OYLA 4LE9A 1YWPA 3NMZC 4MMKA 2LX9A 1ZUYA 3OW2S 4EMKC 3EFOA 3CPWS 1JEGA 2Y4XA 2JM9A 4J7FA 3FIFA 5CKHA 3CCSQ 1VQNA 2PVGB 4GLMA 1UJYA 1R0CB 1Y57A 3DKMA 3JCMe 3JCMJ 2FHDA 1SSHA 1PNJA 4LUEA 1WXUA 4DBRA 1J3TA 4C8QB 2JTFA 3CCQT 1N8RC 1M90U 2X4YA 1N8RR 2R5AA 4ZGJB 2YHTA 4PFPA 3VS4A 2DTIA 2ZPHB 3I35A 1Y7XA 2E5QA 4LDVA 3E1SA 3V8LA 2X4XA 1YFNA 2DEUA 2C0TA 2D0NA 2H3JA 1KC8C 1KC8R 4PJMA 1YJWA 2QAZA 4C0GA 3OYBA 2PUOB 1M2VB 5CR2A 2ESWA 1G3WA 3OS5A 3CCJT 2O2OA 1MMGA 3G7ZA 2DRMA 2K4YA 4C92B 2DEQA 1YJ9Q 5GAOl 1NJIU 2E10A 5D7UA 2K5LA 1Q86R 1MMDA 4MZTA 1VQOA 4ELZC 2GTJA 1KHCA 1AEYA 3C94A 2YRVA 3CCUA 1JJ2A 4N0AC 2NWMA 2HEQA 3M0UA 1Z9ZA 3VUBA 4Z88A 1MMAA 2EGCA 2LCCA 3DB3A 4HA8A 2JS2A 2MOXA 2H8HA 1G2BA 1D0XA 3E2UA 1TSFA 3C95A 1KFZA 3INZA 3P8BB 4J9FA 5GANg 5FWBA 3JB9I 4PJOA 3H6ZA 3MP1A 3RMSA 3PT9A 2KK4A 3N5BB 4M78A 1D3BA 1QVGA 3RDVA 2CUBA 3TQ7P 1V1CA 3CCMA 2CH4W 2BE9B 1UGRB 4EMKA 2RI5A 3MJXA 1WHLA 3MO8A 1EZZB 4KUIA 1I5LA 1LCKA 2YLCA 3EG0A 2QASA 2OX7A 4JJBA 3HKSA 2K5IA 4A4HA 4XU1A 3QUIA 3SEMA 3OYEA 2KVQG 1GFCA 1N9RA 1RABB 2VGMA 2GQVA 3QDFA 2DZCA 5KYYA 4LDYA 3M57A 4M77G 4KH0B 1NPRA 2PTKA 3S3MA 4JRQA 2V8JA 2FO0A 1KIKA 3DB4A 2EGEA 1PRMC 4BUGA 4A53A 1QVFA 2I2LA 3V7CA 4BI8B 4RG8A 2EW3A 2JTMA 1ABOA 5C0MA 2O4XA 4ESRA 5A2QE 5IXFA 2L3RA 3OQ5A 5ECAA 5DM7R 2KQWA 2RQTA 4XU0A 2LMJA 2HKNA 4A54A 2KMTA 5J39A 5KE3A 4BB7A 3CCJA 2KXCA 2CKKA 3QKJA 4IUPA 5LL6S 3VV0A 3PIPA 1X69A 2BIVA 2E64A 1OYXA 4M77E 4ZTJA 1YJWQ 1VIEA 2HZYA 1QKWA 2GBQA 4EPCA 2QTVA 1UB4A 4J9GA 2VWFA 3CMET 1QW1A 4HCKA 2CP7A 1TH7A 4DBFA 1MHNA 4KRTA 1ZSZA 4XTVA 3HPWA 2LVMA 1VQOQ 1G8XA 4N4HA 3CCUQ 4N4IA 2LZ6B 1SRMA 2EWNA 3FB9A 4IUQA 1D1CA 3KXTA 1JB0E 5CKFA 4C8QC 2CP3A 1XOVA 5IN1A 2DXBA 2X51A 2GFUA 2HD0A 5A0LA 2FRWA 2HL5C 5CAIA 3OYCA 5GAOp 1OZ3A 3J81E 1W2BP 3OS2A 2V8IA 1IB8A 4XTXA 4AG2C 1AWJA 3QDRB 3QSUA 2QDLA 3CQTA 4R0KA 1U8RA 2EBPA 1C0MA 4C92C 2V1RA 3NFCA 2AKKA 4AFQC 1QWEA 1YITT 2DIQA 2RK1A 1WZOA 1NM7A 3CCMQ 3OS1A 4M77F 1N8RU 2RQVA 3NGPA 3SFMA 1I07A 3M54A 1SF9A 4MDWA 3G71A 1VQPA 2XHCA 1ZBXA 1KC8U 2QQRA 3UF4A 1X75C 1R0BG 3P8HA 3S3NA 5FW9A 2KYBA 4X9DA 1ACMB 4X9CA 3I56T 2FPDA 2YRCA 1T0HA 1Y96B 5J26A 5GJVB 4BI4A 2JOYA 1DJ7B 3M56A 1NZ9A 1Q86U 1T3LA 1VYTA 2HKQB 2RO0A 4OMMA 1WPYA 4RTWA 4M75A 4TVRA 2CSQA 1TG0A 2M0OA 5FU7B 3OYIA 4PFOA 2HNIA 2RJFA 1YWOA 1JJ2S 1K8AR 4PJJA 3JCMP 1PD1A 2LTOA 3QWXX 3UDCA 1SHFA 2A36A 1YCYA 3CCJQ 2LCLA 4DQ2A 4OMOA 1OU8A 1GCQA 2VB6A 3A1PA 2DJQA 3I55A 2K9GA 3OYFA 4OB3B 3JCMc 2L89A 1RAAB 2CZ0B 4FYVB 2CDTA 1Q82C 4PJOF 1Q82R 4ME7A 1Q7YC 2K57A 2F2VA 2ED1A 2HAXA 1BIBA 4E7LA 1OQKA 1M2VA 2Y90A 2EAYA 1M1KC 1M1KR 2O88A 1QVGS 1MUZA 4C92A 4M78F 5KYUA 1RI9A 2RB6A 1ABQA 3RKYA 1FMVA 2LCSA 1TU0B 1KK7A 3CC2T 5GAN4 3MEWA 2QEXA 5GAOq 4OP0A 2EJGA 4ANJA 5FROA 4E6RA 2WSEE 3ME9A 3CD6T 4QVDA 2VGNA 1D0ZA 1BKBA 3HHTB 4GLKA 1NYGA 1TUDA 2YUNA 3A8HB 4HCZA 3G4SA 3C4SA 1S72A 2KI7A 1JXOA 2EKHA 1PC0A 4JRKA 3M0RA 1VQ6T 1QVFS 1SKUB 2XD0A 3UPUA 5HCKA 1TOVA 3M0PA 3WXMB 3CCVT 1W6XA 2CH4A 4XTZA 2LX7A 4KUDK 2RHUA 1WI7A 2GCXA 4VUBA 1YBYA 1TTHB 2DM1A 5CKEA 2CP6A 4QVZA 1Q95G 4E7HA 4M7DB 1I1JA 2MAMA 1U1SA 1VQPQ 4JS5A 3BDUA 5EG2A 2M1HA 4FSXA 3CCSA 1FXXA 5GAN8 3BY7A 1M4ZA 1I0CA 3TREA 3FRNA 3CMAT 1WXBA 3TSWA 2DVEA 2RJDA 2MI6A 1EIFA 3REAB 4C5EA 2K79A 3EH1A 3VS2A 3I5RA 1RLQC 2ED0A 2DL8A 4JLIA 3DLMA 1Y71A 2EYQA 1M3AA 2DIGA 4BDYA 3MHXA 3CEYA 3HRTA 1VQKA 3UATA 5GANh 5HK0A 4J9BA 1ZX6A 4PKCC 3GP8A 2BZ8A 2EPDA 2ZPBB 4C8QG 3ZFJA 1KD1R 2EGAA 1X6OA 2MYSA 3Q1JA 1YJ9A 4AMCA 3CMEQ 2DF6A 3RUXA 1PRLC 3I55Q 5FRNA 2LNHB 3EG1A 4DBQA 5DY9A 1UJ0A 3UT1A 3GF5A 2KROA 2RJEA 4BD3A 2DMOA 3CCRT 4C92G 3FC3A 5A0GA 3CC4T 1M27C 1K0XA 5FU7C 1VIFA 4Z8AA 4FYXB 2W10A 2O01E 3JCMX 2CREA 4HVWA 3S3OA 2MWOA 1SG5A 2RN8A 4K11A 2YXYA 3E19A 2X4WA 4C8QE 2QEXQ 3LX7A 1O75A 2OTJT 5GAN2 1VQ6A 2D1XA 1WIEA 3SD4A 3ER0A 4E7JA 1K76A 4NOYA 1VQ4T 1BI1A 2F5KA 3M0TA 3OYGA 2XICA 1Q81R 2L3SA 2QA4A 3A8MB 3NTHA 3EGDB 2XDPA 4C92E 2EKOA 2MK5A 3GOXA 1K8AU 4C5IA 2WACA 3EH2A 3OA6A 5AYFA 3FLGA 1X27A 2O9SA 2M02A 3CMAA 3A5ZB 3OYDA 3QXEB 1W70A 2RI2A 4M75F 4HT8A 3O8VA 1YN8A 3JB9G 2LQWA 2A0FB 4M77A 2C0IA 1YI2T 1OX9A 1OZ2A 2SRCA 3PIOA 1Y0MA 2JVVA 5LJ3g 5IHNA 1OOTA 3CCET 2KXDA 3OMCA 2PNIA 2RMOA 4JRIA 3VKIA 2B86A 2J6FA 1UEBA 1Q82U 4N4GA 2RQUA 2CZ6B 2M9UA 2YDLA 1VQ8T 4MZPA 4F7UB 2P4TA 3ULRB 1M1KU 3JAME 4M7AB 1Y96A 2JUFA 5KYWB 3CPFA 1VQLT 2HBWA 2RQRA 4DEYA 3BDLA 1VQ9T 5LJ5g 1TUCA 1VQKQ 2MMPA 5GAMg 3O5ZA 4M7DC 2HL3A 1CKBA 3EG9A 4C92F 3CCRA 2KGTA 2QXFA 5D6XA 1MGQA 2KRSA 3OB9A 4ZN1A 1M8MA 2DBMA 2KY9A 1V76A 4FT4A 3PE0A 3CC4A 4J9DA 3H8ZA 4QVCA 4M77D 1NE8A 3ASKA 2YSQA 1M1FA 2F1LA 3EGUA 4KGXB 1JJ2P 1LOJA 3MP6A 1BU1A 2DD4A 3TCJA 4QW2A 2X9HA 4LD6A 3CC2Q 5KYNA 4RG2A 3VJPA 5GJWB 4PLLA 2HMAA 2DILA 2LT4A 2OTJA 2CP0A 5I21A 3D7SB 4PNOA 2HSEB 4F17A 3META 4ZN3A 4X1VA 4Y91A 5IHIA 1G83A 1VA7A 1WHGA 3VS0A 2C06A 4BE0A 2DJZA 1VQ6Q 2ZPEB 2KSSA 2JS0A 2EJFA 2DPPB 2WSFE 2OTLT 1QVGP 2A3LA 4E7SA 4J6XA 2DO3A 3M0QA 2NUZA 3JB9F 4NL2A 3L42A 2QA4Q 1R77A 2NUTA 2VYTA 1YI2A 5GANd 1JO8A 3QZ5B 4O5VA 2D6FA 2K5FA 1ZSGA 1YIJT 2CS7A 1KD1U 4QQ6A 4PL6A 3CBOA 2E6NA 3CMAQ 1TUGB 1X2KA 2OAWA 4PJOD 2RHXA 1LJOA 3CCQA 4C0FA 1M3CA 4BACA 3C0CA 2PZ1A 4II1A 1X01A 1WX6A 4A4KA 1QVFP 1RUWA 5GAN7 1BYMA 2RK2A 3EFSA 1WFWA 2E3IA 4Q5WA 1B7TA 2XDBA 1U5SA 4M78D 2M16A 1VQ9A 3M4YA 1UTIA 1RLPC 2DLPA 5FLXE 2VXEA 3EFRA 4N0AA 1KQSA 3U23A 4IUVA 4MMLA 4A63B 2MF2A 3CC7T 4E47A 2OJ2A 2RHZA 3NTKA 3GNFB 1KQSP 1BI3A 4Z89A 4MDXA 5GAN6 1SPKA 4JJNK 2ZPFB 2SEMA 3C12A 4B9XA 2GFAA 3CCRQ 3GIBA 2K6DA 3QBYA 5KH6A 3E9FA 9ATCB 1Q81U 3CC4Q 3URGA 1VQMT 1WA7A 2E3HA 1I5OB 3TEEA 1AHJB 1SHGA 1TXQA 2IVWA 3GPLA 4ZGDB 1PKSA 4QKUA 4RTXA 4DBHA 4M7AC 1VYUA 2DFUA 2WSCE 2X3XD 3JCMg 3M4GA 2OTJQ 1HD3A 4D6WA 3PNWC 4HVVA 4J9CA 1WHJA 2E70A 3EGXB 3OYJA 1K73C 1C1AA 2FZGB 4RMOA 1B34A 2CUDA 4R55A 1G3YA 4Z02A 2AHJB 4XTUA 1YJNT 1UUEA 4JJCA 1H3HA 1M3BA 1VQ7T 2V8KA 2R57A 1FX7A 4JZ4A 2Y4YA 8ATCB 1RAEB 3BFMA 3H0IA 1AOJA 3PMIA 3LH5A 4QQDA 3X25B 3NHNA 4EMGA 2MIOA 3M55A 2QGFB 2RM4A 3REBB 2VUBA 3VYHB 3EFOB 4OB1B 1U1TA 2FB7A 1YI2Q 2LC4A 1UGQB 3PVLA 3RESA 2EYYA 3MCAB 4J7IA 2NUPA 5LJ3f 1QP3A 1IHVA 4BY6B 4LDXA 3M5AA 4M7DG 3A8OB 3EHRA 1VQ8Q 3LWIA 2CZ7B 2A08A 5KCOA 3L2WA 4RCBA 2EQMA 1VUBA 3CCQQ 3OYNA 3HFOA 2PUKB 4ZTFA 2DETA 3SWNB 2P0PA 2L3PA 2XMFA 5CQYA 1XNIA 1UHCA 3RR6A 1TS9A 1EFNA 3MPUB 3OYYA 1R8OB 2AZVA 3UA7A 1VQ9Q 1YCSB 2P4RA 1X2QA 4QT7A 3HRUA 4RTUA 2YT6A 3CMEA 4JDSA 1OPKA 1T0JA 4C8QA 3LWHA 3QWYA 5GMKi 4M7AA 1ZA1B 5KYWA 5GAOn 2BKDN 4IURA 2RI3A 1E7OA 2KBTA 4KULA 1Q7YR 4M7DE 1RAIB 1MV0B 1M8VA 2E5KA 3L2QA 2JMCA 2DL5A 4E7ZA 2J06A 2DD5A 2L0AA 3H0FA 3CCLT 1D1AA 2LRQA 2BZYA 2F69A 2JN0A 2KR3A 2JTEA 1I4K1 2CP5A 4RTZA 1CSKA 2DL7A 4PJOB 2EQKA 4M75D 5GANf 2COZA 4HCCA 2FL7A 2DKGA 1M90C 1HXDA 4DA4A 6AT1B 1YITA 5LJ3h 3FDRA 4M78B 3X24B 4J9IA 5GANj 2CP2A 3CXCA 4J5YA 4CC3A 4EMHA 2OTLQ 3VU3C 3OBWA 1NG2A 4AG1C 2JM8A 2QG9B 2L8DA 4DOVA 2EFIA 2RF0A 2DVJA 2AZSA 1GL5A 2GGRA 1PD0A 2ZPIB 4C0DB 1NJIC 4L59A 1M2OA 3I56A 3NPFA 4OGEA 1NEBA 5LJ5h 2PU9B 2VASA 3HTRA 5CCAA 5GAMh 3AHUA 1YHQT 4M7DF 1KSWA 3WVEB 4MZMA 2RPNA 3I9QA 4C92D 1M30A 1BI0A 5FRMA 1JU5C 1PSEA 3JRZA
chains in the Genus database with same CATH topology
2LQWA 2F2WA 2DL3A 2ECZA 2C0IA 2PTKA 2EYZA 2SRCA 1Y0MA 2FEIA 5IHNA 1OOTA 1OV3A 2FO0A 1KIKA 2EGEA 2KXDA 2PNIA 2I0NA 1PRMC 2RMOA 1BBZA 2B86A 2J6FA 2YUOA 5FWCA 2RQUA 2KE9A 1OPLA 3R6NA 2D8JA 1OEBA 2YDLA 2EW3A 3TVTA 4IIOA 1ABOA 1GFDA 1ZUKA 3SHWA 3TSZA 4ESRA 5IXFA 2GNCA 3ULRB 2FPFA 3IQLA 5ECAA 2A37A 1CKAA 2RQTA 2LMJA 5I11A 1ZBJA 1T3SA 2HBWA 4D8DA 2RQRA 1IO6A 4DEYA 1WDXA 3VS3A 2BZXA 2A28A 2KXCA 1TUCA 3EG3A 1FMKA 2JMAA 2YUQA 3O5ZA 1U3OA 1BB9A 1MV3A 4Y92A 4CC2A 1X69A 2KT1A 2M0YA 1CKBA 4LNPA 1UDLA 2KGTA 4HXJA 1X43A 2KRSA 1M8MA 1QKWA 2EYWA 2GBQA 1NEGA 5IH2A 2DBMA 1GBRA 4J9GA 1FYNA 3PE0A 2VWFA 5I22A 3RNJA 4J9DA 4HCKA 2KEAA 2AK5A 2J6OA 4IIMA 4KRTA 1UFFA 2YSQA 2KRMA 2O31A 2EQIA 2JW4A 2M51A 3EGUA 4AFZC 2DA9A 5EC7A 1BU1A 1S1NA 1ZUUA 2LZ6B 2K2MA 1SRMA 2CT4A 1W1FA 5GJWB 2DILA 2C0OA 1H92A 1XOVA 1K4US 4RTVA 2F2XA 4F17A 1WXTA 1HJDA 4AFUC 2HSPA 4X1VA 1K9AA 1NLPC 2FRWA 2L2PA 5IHIA 2J05A 2GTOA 1G83A 5IHKA 4OMPA 1VA7A 3VS0A 4AG2C 1AWJA 2OI3A 2DYBA 2QDLA 3CQTA 4R0KA 2W0ZA 4RUGA 2EBPA 1UG1A 5L23A 3FJ5A 4F16A 2JS0A 4AFSC 2V1RA 2AKKA 2JT4A 4AFQC 4M4ZA 1QWEA 3I5SA 1NM7A 1UHFA 4OMLA 3H0HA 4DEXA 3A98A 3VS6A 3M0QA 2NUZA 2J6KA 1QWFA 2RQVA 3NGPA 4JPBW 1JO8A 1I07A 1ZSGA 2FRYA 4OMQA 2RNAA 2DL4A 3UF4A 1X6BA 2EVRA 1X2KA 4WCIA 5FW9A 2KYBA 2OAWA 2FPDA 1T0HA 5GJVB 1M3CA 3C0CA 2PZ1A 1WX6A 1RUWA 1T3LA 1GRIA 3VRZA 2LQNA 1VYTA 1AZGB 2JXBA 4OMMA 1WFWA 4RTWA 1U5SA 2CT3A 2YUPA 1UTIA 1RLPC 2DLPA 2FG0A 2CSQA 1TG0A 1Z9QA 1K1ZA 4JJDA 2HDAA 4OMNA 1YP5A 1YWOA 4LN2A 2G6FX 3U23A 2ABLA 1PWTA 1GBQA 1PKTA 4A63B 1BK2A 1SEMA 2OJ2A 3QWXX 2ENMA 2ROTA 1SHFA 2A36A 1AD5A 1E6HA 2VKNA 1UE9A 3THKA 4Z89A 4OMOA 1N5ZA 2DE0X 1SPKA 1GCQA 3VS5A 2MCNA 2DJQA 2K9GA 2SEMA 4JZ3A 1E6GA 2HCKA 1AWWA 2O9VA 4GBQA 2CDTA 2K6DA 4RTTA 4HVUA 3VS7A 2F2VA 1HSQA 2ED1A 3UA6A 1WA7A 1SHGA 1ARKA 4CC7A 2O88A 1PKSA 1KJWA 1MUZA 1PHTA 4RTXA 2LJ0A 4CC4B 1VYUA 1RI9A 1ABQA 2LCSA 2X3XD 1NLOC 2X3WD 1HD3A 4HVVA 2IIMA 1GCPA 4J9CA 4E6RA 4D8KA 1QLYA 1WYXA 2DRKA 3VRYA 1AZEA 2CUDA 2KRNA 4J9EA 2CSIA 1NYGA 1TUDA 2YUNA 1UUEA 4JJCA 3ZL7C 1ZLMA 2DX1A 1H3HA 4F14A 1JXOA 1M3BA 2EKHA 3M0RA 2K3BA 2GQIA 2V1QA 4JZ4A 5HCKA 3M0PA 3H0IA 1W6XA 2CH4A 1AOJA 2LX7A 3LH5A 3NHNA 1UGVA 2MIOA 3JV3A 1WI7A 2K7AA 2DM1A 3REBB 2KNBB 4FSSA 3EHQA 1NYFA 2FPEA 2AKLA 4LE9A 4ZNXA 1H8KA 1AWOA 1I1JA 1YWPA 2LJ3A 3NMZC 1QCFA 4J9HA 1ZUYA 3GBQA 3PVLA 2EYYA 3RBBB 1JEGA 1I0CA 3EHRA 1WXBA 2JM9A 3TSWA 2A08A 3REAB 2K79A 4GLMA 3VS2A 3I5RA 1UJYA 2L3PA 2XMFA 3PVQA 1Y57A 1UHCA 1RLQC 2ED0A 2DL8A 1EFNA 1SSHA 1PNJA 4LUEA 1WXUA 2AZVA 1M3AA 3UA7A 1J3TA 1YCSB 2P4RA 1X2QA 1X6GA 4QT7A 1WLPB 4RTUA 3UATA 2LP5A 3VS4A 3M0SA 1UECA 2YT6A 4J9BA 3I35A 5IXBA 1ZX6A 1OPKA 4RTYA 2BZ8A 2EPDA 2EGAA 1T0JA 2C0TA 2D0NA 3QWYA 1B3QA 2ESWA 3VS1A 2O2OA 1E7OA 2DRMA 2DF6A 2KBTA 4ORZA 1PRLC 1MV0B 2LNHB 3EG1A 1UJ0A 1K0SA 1B07A 2E5KA 2JMCA 2DL5A 2J06A 2KYMA 2BTTA 2KROA 2L0AA 3H0FA 2GTJA 1AEYA 2DMOA 2BZYA 2DNUA 2NWMA 4EIKA 2HEQA 2JTEA 2KR3A 3M0UA 1Z9ZA 4Z88A 2EGCA 4RTZA 2JS2A 1CSKA 2DL7A 2MOXA 1M27C 3EG2A 1K0XA 2H8HA 1G2BA 4Z8AA 2W10A 1KFZA 4J9FA 1GCQC 2CREA 4HVWA 2J7IA 5FWBA 2RN8A 4K11A 2LJ1A 4J9IA 2DBKA 2D1XA 1WIEA 4CC3A 2RQWA 1K76A 1QKXA 1NG2A 2VVKA 2JM8A 4AG1C 3M0TA 3H41A 3KFVA 2RF0A 2CUBA 1JQQA 1JXMA 1V1CA 2CH4W 2DVJA 2AZSA 1YNZA 1AWXA 1GL5A 1AVZC 2GGRA 2L3SA 1U06A 2D8HA 1LCKA 1VYVA 2KT8A 3EG0A 3NPFA 1NEBA 4JJBA 2L3QA 4LUDA 2ROLA 3SEMA 1KSWA 1X27A 1GFCA 1SRLA 2O9SA 2RPNA 3I9QA 1M30A 1A0NB 1W70A 2EYXA 1JU5C 1YN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQW A;  2F2W A;  2DL3 A;  2ECZ A;  2C0I A;  2PTK A;  2EYZ A;  2SRC A;  1Y0M A;  2FEI A;  5IHN A;  1OOT A;  1OV3 A;  2FO0 A;  1KIK A;  2EGE A;  2KXD A;  2PNI A;  2I0N A;  1PRM C;  2RMO A;  1BBZ A;  2B86 A;  2J6F A;  2YUO A;  5FWC A;  2RQU A;  2KE9 A;  1OPL A;  3R6N A;  2D8J A;  1OEB A;  2YDL A;  2EW3 A;  3TVT A;  4IIO A;  1ABO A;  1GFD A;  1ZUK A;  3SHW A;  3TSZ A;  4ESR A;  5IXF A;  2GNC A;  3ULR B;  2FPF A;  3IQL A;  5ECA A;  2A37 A;  1CKA A;  2RQT A;  2LMJ A;  5I11 A;  1ZBJ A;  1T3S A;  2HBW A;  4D8D A;  2RQR A;  1IO6 A;  4DEY A;  1WDX A;  3VS3 A;  2BZX A;  2A28 A;  2KXC A;  1TUC A;  3EG3 A;  1FMK A;  2JMA A;  2YUQ A;  3O5Z A;  1U3O A;  1BB9 A;  1MV3 A;  4Y92 A;  4CC2 A;  1X69 A;  2KT1 A;  2M0Y A;  1CKB A;  4LNP A;  1UDL A;  2KGT A;  4HXJ A;  1X43 A;  2KRS A;  1M8M A;  1QKW A;  2EYW A;  2GBQ A;  1NEG A;  5IH2 A;  2DBM A;  1GBR A;  4J9G A;  1FYN A;  3PE0 A;  2VWF A;  5I22 A;  3RNJ A;  4J9D A;  4HCK A;  2KEA A;  2AK5 A;  2J6O A;  4IIM A;  4KRT A;  1UFF A;  2YSQ A;  2KRM A;  2O31 A;  2EQI A;  2JW4 A;  2M51 A;  3EGU A;  4AFZ C;  2DA9 A;  5EC7 A;  1BU1 A;  1S1N A;  1ZUU A;  2LZ6 B;  2K2M A;  1SRM A;  2CT4 A;  1W1F A;  5GJW B;  2DIL A;  2C0O A;  1H92 A;  1XOV A;  1K4U S;  4RTV A;  2F2X A;  4F17 A;  1WXT A;  1HJD A;  4AFU C;  2HSP A;  4X1V A;  1K9A A;  1NLP C;  2FRW A;  2L2P A;  5IHI A;  2J05 A;  2GTO A;  1G83 A;  5IHK A;  4OMP A;  1VA7 A;  3VS0 A;  4AG2 C;  1AWJ A;  2OI3 A;  2DYB A;  2QDL A;  3CQT A;  4R0K A;  2W0Z A;  4RUG A;  2EBP A;  1UG1 A;  5L23 A;  3FJ5 A;  4F16 A;  2JS0 A;  4AFS C;  2V1R A;  2AKK A;  2JT4 A;  4AFQ C;  4M4Z A;  1QWE A;  3I5S A;  1NM7 A;  1UHF A;  4OML A;  3H0H A;  4DEX A;  3A98 A;  3VS6 A;  3M0Q A;  2NUZ A;  2J6K A;  1QWF A;  2RQV A;  3NGP A;  4JPB W;  1JO8 A;  1I07 A;  1ZSG A;  2FRY A;  4OMQ A;  2RNA A;  2DL4 A;  3UF4 A;  1X6B A;  2EVR A;  1X2K A;  4WCI A;  5FW9 A;  2KYB A;  2OAW A;  2FPD A;  1T0H A;  5GJV B;  1M3C A;  3C0C A;  2PZ1 A;  1WX6 A;  1RUW A;  1T3L A;  1GRI A;  3VRZ A;  2LQN A;  1VYT A;  1AZG B;  2JXB A;  4OMM A;  1WFW A;  4RTW A;  1U5S A;  2CT3 A;  2YUP A;  1UTI A;  1RLP C;  2DLP A;  2FG0 A;  2CSQ A;  1TG0 A;  1Z9Q A;  1K1Z A;  4JJD A;  2HDA A;  4OMN A;  1YP5 A;  1YWO A;  4LN2 A;  2G6F X;  3U23 A;  2ABL A;  1PWT A;  1GBQ A;  1PKT A;  4A63 B;  1BK2 A;  1SEM A;  2OJ2 A;  3QWX X;  2ENM A;  2ROT A;  1SHF A;  2A36 A;  1AD5 A;  1E6H A;  2VKN A;  1UE9 A;  3THK A;  4Z89 A;  4OMO A;  1N5Z A;  2DE0 X;  1SPK A;  1GCQ A;  3VS5 A;  2MCN A;  2DJQ A;  2K9G A;  2SEM A;  4JZ3 A;  1E6G A;  2HCK A;  1AWW A;  2O9V A;  4GBQ A;  2CDT A;  2K6D A;  4RTT A;  4HVU A;  3VS7 A;  2F2V A;  1HSQ A;  2ED1 A;  3UA6 A;  1WA7 A;  1SHG A;  1ARK A;  4CC7 A;  2O88 A;  1PKS A;  1KJW A;  1MUZ A;  1PHT A;  4RTX A;  2LJ0 A;  4CC4 B;  1VYU A;  1RI9 A;  1ABQ A;  2LCS A;  2X3X D;  1NLO C;  2X3W D;  1HD3 A;  4HVV A;  2IIM A;  1GCP A;  4J9C A;  4E6R A;  4D8K A;  1QLY A;  1WYX A;  2DRK A;  3VRY A;  1AZE A;  2CUD A;  2KRN A;  4J9E A;  2CSI A;  1NYG A;  1TUD A;  2YUN A;  1UUE A;  4JJC A;  3ZL7 C;  1ZLM A;  2DX1 A;  1H3H A;  4F14 A;  1JXO A;  1M3B A;  2EKH A;  3M0R A;  2K3B A;  2GQI A;  2V1Q A;  4JZ4 A;  5HCK A;  3M0P A;  3H0I A;  1W6X A;  2CH4 A;  1AOJ A;  2LX7 A;  3LH5 A;  3NHN A;  1UGV A;  2MIO A;  3JV3 A;  1WI7 A;  2K7A A;  2DM1 A;  3REB B;  2KNB B;  4FSS A;  3EHQ A;  1NYF A;  2FPE A;  2AKL A;  4LE9 A;  4ZNX A;  1H8K A;  1AWO A;  1I1J A;  1YWP A;  2LJ3 A;  3NMZ C;  1QCF A;  4J9H A;  1ZUY A;  3GBQ A;  3PVL A;  2EYY A;  3RBB B;  1JEG A;  1I0C A;  3EHR A;  1WXB A;  2JM9 A;  3TSW A;  2A08 A;  3REA B;  2K79 A;  4GLM A;  3VS2 A;  3I5R A;  1UJY A;  2L3P A;  2XMF A;  3PVQ A;  1Y57 A;  1UHC A;  1RLQ C;  2ED0 A;  2DL8 A;  1EFN A;  1SSH A;  1PNJ A;  4LUE A;  1WXU A;  2AZV A;  1M3A A;  3UA7 A;  1J3T A;  1YCS B;  2P4R A;  1X2Q A;  1X6G A;  4QT7 A;  1WLP B;  4RTU A;  3UAT A;  2LP5 A;  3VS4 A;  3M0S A;  1UEC A;  2YT6 A;  4J9B A;  3I35 A;  5IXB A;  1ZX6 A;  1OPK A;  4RTY A;  2BZ8 A;  2EPD A;  2EGA A;  1T0J A;  2C0T A;  2D0N A;  3QWY A;  1B3Q A;  2ESW A;  3VS1 A;  2O2O A;  1E7O A;  2DRM A;  2DF6 A;  2KBT A;  4ORZ A;  1PRL C;  1MV0 B;  2LNH B;  3EG1 A;  1UJ0 A;  1K0S A;  1B07 A;  2E5K A;  2JMC A;  2DL5 A;  2J06 A;  2KYM A;  2BTT A;  2KRO A;  2L0A A;  3H0F A;  2GTJ A;  1AEY A;  2DMO A;  2BZY A;  2DNU A;  2NWM A;  4EIK A;  2HEQ A;  2JTE A;  2KR3 A;  3M0U A;  1Z9Z A;  4Z88 A;  2EGC A;  4RTZ A;  2JS2 A;  1CSK A;  2DL7 A;  2MOX A;  1M27 C;  3EG2 A;  1K0X A;  2H8H A;  1G2B A;  4Z8A A;  2W10 A;  1KFZ A;  4J9F A;  1GCQ C;  2CRE A;  4HVW A;  2J7I A;  5FWB A;  2RN8 A;  4K11 A;  2LJ1 A;  4J9I A;  2DBK A;  2D1X A;  1WIE A;  4CC3 A;  2RQW A;  1K76 A;  1QKX A;  1NG2 A;  2VVK A;  2JM8 A;  4AG1 C;  3M0T A;  3H41 A;  3KFV A;  2RF0 A;  2CUB A;  1JQQ A;  1JXM A;  1V1C A;  2CH4 W;  2DVJ A;  2AZS A;  1YNZ A;  1AWX A;  1GL5 A;  1AVZ C;  2GGR A;  2L3S A;  1U06 A;  2D8H A;  1LCK A;  1VYV A;  2KT8 A;  3EG0 A;  3NPF A;  1NEB A;  4JJB A;  2L3Q A;  4LUD A;  2ROL A;  3SEM A;  1KSW A;  1X27 A;  1GFC A;  1SRL A;  2O9S A;  2RPN A;  3I9Q A;  1M30 A;  1A0N B;  1W70 A;  2EYX A;  1JU5 C;  1YN8 A; 
#chains in the Genus database with same CATH topology
 2F2W A;  2ECZ A;  4FYY B;  2FEI A;  2E65 A;  2FYK A;  4OB2 B;  2O4X B;  5HK3 A;  2I0N A;  1BBZ A;  4FIB A;  3CBM A;  2OAU A;  4PLI A;  1FMW A;  2KE9 A;  3TVT A;  4IIO A;  4E2F B;  4EDU A;  3H9N A;  3SHW A;  3TSZ A;  1M9S A;  3FJP A;  4J6Y A;  5GAN e;  2FPF A;  2LDM A;  3IQL A;  2XG8 D;  4PFZ A;  1ZBJ A;  4F7U G;  1T3S A;  4D8D A;  1WDX A;  2EQJ A;  2ZGW A;  4FU6 A;  1XJW B;  4M7A G;  2JMA A;  4A4F A;  1VQN T;  3LLR A;  1IHW A;  2ZPG B;  3MEV A;  1Y07 A;  2VV5 A;  1BB9 A;  1MV3 A;  4CC2 A;  4ZGE B;  2KT1 A;  3M59 A;  1ZA2 B;  3CCL A;  4LNP A;  4LD9 K;  4HXJ A;  1D09 B;  1ZSZ B;  4BE1 A;  4BY6 C;  2EYW A;  5IH2 A;  1GBR A;  1WJS A;  1FYN A;  2IG0 A;  5I22 A;  3RNJ A;  4PJL A;  2RJC A;  3CC2 A;  2AK5 A;  4OVA A;  4C5G A;  3WVD B;  1ZHI A;  1UFF A;  1YJW T;  2KRM A;  2O31 A;  2ZCF B;  3SWN C;  2IPO B;  2RH2 A;  5EC7 A;  1SSF A;  3CD6 A;  2RA2 A;  1WNL A;  4F04 B;  1ZUU A;  2K2M A;  2CT4 A;  2C0O A;  1H92 A;  4F7U E;  2KDS A;  8AT1 B;  5KYX B;  1K9A A;  1NLP C;  4M7A E;  2J05 A;  2FZK B;  2GTO A;  4LXC A;  2JJ9 A;  1F1B B;  4YTL A;  4E7K A;  1YIT Q;  4OMP A;  4FM4 B;  3ZEH A;  5GMK h;  3OBY A;  1LNX A;  3CCV A;  2YLB A;  3VUZ A;  3G6E T;  1KQ2 A;  2ZZD A;  2OI3 A;  7AT1 B;  1IRE B;  4RUG A;  3ZBD A;  2W0Z A;  4XAX B;  5L23 A;  3M58 A;  4F16 A;  2LQ8 A;  4KGV B;  2JT4 A;  4ATO A;  3V8J A;  1YHQ A;  1O9S A;  4OML A;  3QJ6 A;  3H0H A;  3EGX A;  3A98 A;  3VS6 A;  4KH1 B;  1QWF A;  1M1G A;  1QMC A;  1KHI A;  1P92 A;  4PJO C;  1OU9 A;  3I56 Q;  1N27 A;  1VQ5 T;  3KUF A;  2FRY A;  4OMQ A;  1IGU A;  2LT1 A;  3X20 B;  1C6V X;  2AIR B;  2DL4 A;  3E9G A;  1M5Q 1;  1X6B A;  3SDZ A;  4WCI A;  3L1A A;  1G3T A;  4M78 C;  3FEO A;  1RAD B;  5FU6 B;  2E6Z A;  1Q7Y U;  3V7R A;  4M75 B;  2E12 A;  1OUL A;  1UGP B;  2QDY B;  2HQE A;  1AT1 B;  1GRI A;  3VRZ A;  2LQN A;  4F7U F;  1W4S A;  1AZG B;  2JZ2 A;  4C8Q F;  2JXB A;  3LGL A;  4B6M A;  2CT3 A;  4M7A F;  3RKX A;  2YUP A;  3JCM W;  5KCH A;  1OX8 A;  4JJD A;  4C0D C;  3QG1 A;  4UC4 A;  4LN2 A;  2G6F X;  3JCM h;  1WQW A;  2DTH A;  2QQ9 A;  3MEA A;  3DLL A;  3NTI A;  2ENM A;  3SWN A;  1AD5 A;  5LJ3 d;  3THK A;  4L6V 5;  2CYZ B;  5A0D A;  3VS5 A;  2MCN A;  2DXU A;  2X4J A;  2HCK A;  3CCL Q;  2XKO C;  1AWW A;  2HQH A;  2O9V A;  4GBQ A;  3OYA A;  1KG1 A;  3OYM A;  4HVU A;  2DTO A;  3PTA A;  2DER A;  5KYU B;  3CXC S;  2RHI A;  3M53 A;  4JUV A;  4FT2 A;  1Q86 C;  1ZQ1 A;  1ARK A;  5D6Y A;  4CC7 A;  3QYH B;  3HFN A;  1KJW A;  5LJ5 d;  1PHT A;  4XK8 E;  5GAM d;  2LJ0 A;  3CD6 Q;  4LDU A;  1VQ4 A;  3G6E A;  2PVO B;  3LGF A;  2GF7 A;  2NYS A;  2DXT A;  2E1H A;  2X3W D;  1GCP A;  4JLG A;  4D8K A;  3J80 E;  1QLY A;  1WYX A;  2NLU A;  2Z0W A;  4J9E A;  3CCV Q;  1LVK A;  1ZSZ C;  3JB9 H;  5GMK m;  1ZLM A;  2DX1 A;  2DYI A;  4R56 A;  2ZAE A;  1VQ5 A;  2K3B A;  4IUU A;  5CKD A;  2V1Q A;  1YHQ Q;  3A8L B;  2FVU A;  2HBP A;  1G3S A;  1UGV A;  2QYZ A;  3CCE A;  1I81 A;  3RER A;  2COW A;  1NBE B;  1RL2 A;  3JB9 J;  1TWB A;  3EHQ A;  2FPE A;  4QQG A;  3G1J A;  2AKL A;  4ZNX A;  4C5H A;  1H8K A;  1AWO A;  1VQ8 A;  2LJ3 A;  1QCF A;  4J9H A;  1WHK A;  2DAQ A;  3GBQ A;  1QCN A;  2D9T A;  4IUT A;  3RBB B;  3RMQ A;  5CKB A;  4JS4 A;  4M7D A;  1MND A;  2MWP A;  1VQL A;  2P0K A;  5KE2 A;  1PM3 A;  3QII A;  3G71 T;  3OS0 A;  1VQP T;  1PG5 B;  2R58 A;  1PCX A;  3PVQ A;  3PMT A;  1BI2 A;  3PGG A;  2QK0 A;  1X6G A;  3LW5 E;  1VQN Q;  1WLP B;  2LP5 A;  1BCO A;  3M0S A;  1UEC A;  4AT1 B;  1PSF A;  3BE3 A;  5IXB A;  2AT1 B;  3BW1 A;  1NPP A;  2EJ9 A;  3F70 A;  5CK9 A;  1XTD A;  1B3Q A;  2V26 A;  1EX4 A;  3VS1 A;  1QQJ A;  4CRI A;  2QTX A;  4PJN A;  4ORZ A;  5FU6 C;  4M75 C;  1K0S A;  1B07 A;  3OYK A;  4CI0 C;  5GAN 5;  3PFS A;  4A4E A;  2KYM A;  2BTT A;  1N6A A;  3QO3 A;  2BE7 D;  2DNU A;  4EIK A;  4M7D D;  1JRI A;  2L5Q A;  4C0Z A;  3I55 T;  5GAN 3;  3OMG A;  2PQW A;  1G5V A;  3EG2 A;  4LDW A;  1V29 B;  2QQB A;  1GCQ C;  2J7I A;  4PJO G;  2CGH A;  1VQ4 Q;  2E4H A;  3JCM b;  5M9O A;  3G6E Q;  2OTL A;  1W2B A;  1K73 R;  2LJ1 A;  2FZC B;  1BCM A;  4WF2 A;  1XQH A;  1IZ6 A;  4PK4 A;  2DBK A;  5GMK l;  4OMF B;  1HYO A;  2B8A A;  2RQW A;  1QKX A;  4M78 G;  1UGS B;  2F5T X;  2VVK A;  1YIJ A;  1GXI E;  4KBM B;  3X26 B;  3H41 A;  5KYX A;  3KFV A;  2YWW A;  2QEX T;  1JQQ A;  1JXM A;  5I2S A;  1YNZ A;  1AWX A;  5C6S A;  1H3Z A;  2XK0 A;  4B9W A;  1AVZ C;  1U06 A;  2D8H A;  1VQ5 Q;  1VYV A;  2KT8 A;  2L3Q A;  4FYW B;  4LUD A;  3JCM d;  4M77 B;  2ROL A;  4E7I A;  3G4S T;  1S72 T;  3CCE Q;  1SRL A;  2A7Y A;  3EGD A;  1A0N B;  4X34 A;  3L2U A;  2EYX A;  2H3E B;  4J8O A;  2XI9 A;  4RTY A;  4PJO E;  2DL3 A;  1D0Y A;  2D0Q B;  2EYZ A;  3R6O A;  2CZ1 B;  1RAH B;  2DZ9 A;  1OV3 A;  2EQU A;  3TU4 K;  4BI3 A;  3KBG A;  3T9N A;  4P5N A;  1JBM A;  2YUO A;  5FWC A;  3CC7 A;  2QQA A;  2MPX C;  1OPL A;  4M78 E;  3R6N A;  5LJ3 j;  2YRD A;  2D8J A;  1OEB A;  1VQL Q;  3SB2 A;  1GFD A;  1ZUK A;  1WQ7 A;  2HQX A;  5DLO A;  3LYI A;  2GNC A;  3CCS T;  2A37 A;  1CKA A;  5LJ5 f;  3LH0 A;  5GAM f;  3AT1 B;  5I11 A;  3JCM V;  4F7U A;  1IO6 A;  3OW2 A;  3EG9 B;  4NL3 A;  3L2V A;  3VS3 A;  3GNG A;  5CIU A;  2BZX A;  2A28 A;  2K3X A;  3CPW A;  3EG3 A;  1FMK A;  5AT1 B;  1K8A C;  2YUQ A;  1K9M C;  1U3O A;  1K9M R;  5IT9 E;  3HL8 A;  1VQM A;  4Y92 A;  3OW2 P;  2M0Y A;  5LJ5 j;  3CPW P;  5GAM j;  1UDL A;  1X43 A;  2E41 A;  2P0Q A;  3RIR A;  1VQK T;  1QCO A;  2BUD A;  1NEG A;  4HCB A;  4J83 A;  4RCC A;  1LPL A;  2PVD B;  5DLQ E;  3HSB A;  2P84 A;  2KEA A;  3HRS A;  4XQ3 A;  4BDZ A;  2J6O A;  4IIM A;  4OF1 A;  1WJQ A;  4FCY A;  3J7A F;  3MKD A;  1YJ9 T;  2EQI A;  2JW4 A;  2M51 A;  4AFZ C;  3VYG A;  2DA9 A;  1S1N A;  1RAF B;  3OSV A;  5J3B A;  1W1F A;  5HKC A;  1YJN A;  1M90 R;  2XU8 A;  3GLX A;  2QI2 A;  3L2Z A;  3M9Q A;  5LJ3 e;  1K4U S;  4RTV A;  2F2X A;  1WXT A;  1D3B B;  4AFU C;  1HJD A;  3OY9 A;  2HSP A;  1VQ7 A;  2L2P A;  4EMK B;  1MNE A;  4O6J A;  5IHK A;  1IGQ A;  5L8R E;  4C8Q D;  1KQS S;  1WHH A;  5HY6 A;  4M7A D;  2DYB A;  3CXC P;  4KGZ B;  1UG1 A;  3QJY A;  4J6W A;  3QPH A;  3FJ5 A;  4AFS C;  2NUT B;  4M4Z A;  2VXF A;  1MMN A;  1NJI R;  1YIJ Q;  3I5S A;  5KYY B;  5LJ5 e;  1VOM A;  1UHF A;  3OYH A;  3JSC A;  5GAM e;  4DEX A;  2J6K A;  4JPB W;  2QGG A;  1KQ1 A;  1QVP A;  3V7S A;  2RNA A;  1WHM A;  4WTO B;  1OI1 A;  2EVR A;  2QA4 T;  2G3R A;  1IXD A;  3G71 Q;  3QZ9 B;  4XU2 A;  5GAO r;  3MEU A;  4HT9 A;  2ATC B;  2VC8 A;  1BIA A;  2DK3 A;  3CBP A;  1H64 1;  4FW1 A;  3RKW A;  5CO7 A;  3CC7 Q;  4M75 G;  5GMK j;  2FG0 A;  4NS5 A;  4GY5 A;  3MP8 A;  3L2R A;  1Z9Q A;  1K1Z A;  4JRP A;  2HDA A;  4OMN A;  4FL6 A;  1YP5 A;  1WGS A;  2ABL A;  1PWT A;  5IAY A;  1GBQ A;  1PKT A;  1BK2 A;  2JNG A;  4M77 C;  1SEM A;  3P8D A;  3JCM Q;  5I2M A;  4IKF A;  2ROT A;  3QYG B;  1K73 U;  2KAF A;  1E6H A;  2VKN A;  1UE9 A;  1N5Z A;  2DE0 X;  5D6W A;  1KD1 C;  1VQM Q;  2RD1 A;  4JZ3 A;  3JB9 D;  1E6G A;  4XU3 A;  1W2B S;  4HKE A;  2LNV A;  3X28 B;  4RTT A;  3VS7 A;  3UWN A;  1HSQ A;  3UA6 A;  5GAO m;  4OGC A;  4BE2 A;  4DOW A;  4M75 E;  2R5M A;  1N9S A;  2RHY A;  2DXC A;  4XTY A;  3JCM f;  1D1B A;  2XID A;  4KT0 E;  3A8G B;  4CC4 B;  1VQO T;  3OSS C;  1RAC B;  2XDD A;  4OB0 B;  3CCU T;  2QQS A;  4L5G A;  1B34 B;  1NLO C;  1YJN Q;  3S6W A;  5GMK e;  5CQX A;  1I8F A;  2IIM A;  4A4G A;  2X35 A;  2K2V A;  1VQ7 Q;  4Y28 E;  4FW2 A;  2COY A;  2DRK A;  3VRY A;  1AZE A;  2KRN A;  4RKU E;  2CSI A;  1IRX A;  3V8K A;  5CVI A;  3ZL7 C;  3QHS A;  1RAG B;  4F14 A;  1FWZ A;  3HP9 A;  1HK9 A;  3EAE A;  1RI0 A;  2GQI A;  4V2S A;  4ELY C;  1QP2 A;  1Q81 C;  3G4S Q;  1S72 Q;  4XTW A;  3JV3 A;  2K3Y A;  2K7A A;  1WJR A;  2NUP B;  3CCM T;  2LQK A;  2KNB B;  4FSS A;  2EIF A;  1K9M U;  1NYF A;  3OYL A;  4LE9 A;  1YWP A;  3NMZ C;  4MMK A;  2LX9 A;  1ZUY A;  3OW2 S;  4EMK C;  3EFO A;  3CPW S;  1JEG A;  2Y4X A;  2JM9 A;  4J7F A;  3FIF A;  5CKH A;  3CCS Q;  1VQN A;  2PVG B;  4GLM A;  1UJY A;  1R0C B;  1Y57 A;  3DKM A;  3JCM e;  3JCM J;  2FHD A;  1SSH A;  1PNJ A;  4LUE A;  1WXU A;  4DBR A;  1J3T A;  4C8Q B;  2JTF A;  3CCQ T;  1N8R C;  1M90 U;  2X4Y A;  1N8R R;  2R5A A;  4ZGJ B;  2YHT A;  4PFP A;  3VS4 A;  2DTI A;  2ZPH B;  3I35 A;  1Y7X A;  2E5Q A;  4LDV A;  3E1S A;  3V8L A;  2X4X A;  1YFN A;  2DEU A;  2C0T A;  2D0N A;  2H3J A;  1KC8 C;  1KC8 R;  4PJM A;  1YJW A;  2QAZ A;  4C0G A;  3OYB A;  2PUO B;  1M2V B;  5CR2 A;  2ESW A;  1G3W A;  3OS5 A;  3CCJ T;  2O2O A;  1MMG A;  3G7Z A;  2DRM A;  2K4Y A;  4C92 B;  2DEQ A;  1YJ9 Q;  5GAO l;  1NJI U;  2E10 A;  5D7U A;  2K5L A;  1Q86 R;  1MMD A;  4MZT A;  1VQO A;  4ELZ C;  2GTJ A;  1KHC A;  1AEY A;  3C94 A;  2YRV A;  3CCU A;  1JJ2 A;  4N0A C;  2NWM A;  2HEQ A;  3M0U A;  1Z9Z A;  3VUB A;  4Z88 A;  1MMA A;  2EGC A;  2LCC A;  3DB3 A;  4HA8 A;  2JS2 A;  2MOX A;  2H8H A;  1G2B A;  1D0X A;  3E2U A;  1TSF A;  3C95 A;  1KFZ A;  3INZ A;  3P8B B;  4J9F A;  5GAN g;  5FWB A;  3JB9 I;  4PJO A;  3H6Z A;  3MP1 A;  3RMS A;  3PT9 A;  2KK4 A;  3N5B B;  4M78 A;  1D3B A;  1QVG A;  3RDV A;  2CUB A;  3TQ7 P;  1V1C A;  3CCM A;  2CH4 W;  2BE9 B;  1UGR B;  4EMK A;  2RI5 A;  3MJX A;  1WHL A;  3MO8 A;  1EZZ B;  4KUI A;  1I5L A;  1LCK A;  2YLC A;  3EG0 A;  2QAS A;  2OX7 A;  4JJB A;  3HKS A;  2K5I A;  4A4H A;  4XU1 A;  3QUI A;  3SEM A;  3OYE A;  2KVQ G;  1GFC A;  1N9R A;  1RAB B;  2VGM A;  2GQV A;  3QDF A;  2DZC A;  5KYY A;  4LDY A;  3M57 A;  4M77 G;  4KH0 B;  1NPR A;  2PTK A;  3S3M A;  4JRQ A;  2V8J A;  2FO0 A;  1KIK A;  3DB4 A;  2EGE A;  1PRM C;  4BUG A;  4A53 A;  1QVF A;  2I2L A;  3V7C A;  4BI8 B;  4RG8 A;  2EW3 A;  2JTM A;  1ABO A;  5C0M A;  2O4X A;  4ESR A;  5A2Q E;  5IXF A;  2L3R A;  3OQ5 A;  5ECA A;  5DM7 R;  2KQW A;  2RQT A;  4XU0 A;  2LMJ A;  2HKN A;  4A54 A;  2KMT A;  5J39 A;  5KE3 A;  4BB7 A;  3CCJ A;  2KXC A;  2CKK A;  3QKJ A;  4IUP A;  5LL6 S;  3VV0 A;  3PIP A;  1X69 A;  2BIV A;  2E64 A;  1OYX A;  4M77 E;  4ZTJ A;  1YJW Q;  1VIE A;  2HZY A;  1QKW A;  2GBQ A;  4EPC A;  2QTV A;  1UB4 A;  4J9G A;  2VWF A;  3CME T;  1QW1 A;  4HCK A;  2CP7 A;  1TH7 A;  4DBF A;  1MHN A;  4KRT A;  1ZSZ A;  4XTV A;  3HPW A;  2LVM A;  1VQO Q;  1G8X A;  4N4H A;  3CCU Q;  4N4I A;  2LZ6 B;  1SRM A;  2EWN A;  3FB9 A;  4IUQ A;  1D1C A;  3KXT A;  1JB0 E;  5CKF A;  4C8Q C;  2CP3 A;  1XOV A;  5IN1 A;  2DXB A;  2X51 A;  2GFU A;  2HD0 A;  5A0L A;  2FRW A;  2HL5 C;  5CAI A;  3OYC A;  5GAO p;  1OZ3 A;  3J81 E;  1W2B P;  3OS2 A;  2V8I A;  1IB8 A;  4XTX A;  4AG2 C;  1AWJ A;  3QDR B;  3QSU A;  2QDL A;  3CQT A;  4R0K A;  1U8R A;  2EBP A;  1C0M A;  4C92 C;  2V1R A;  3NFC A;  2AKK A;  4AFQ C;  1QWE A;  1YIT T;  2DIQ A;  2RK1 A;  1WZO A;  1NM7 A;  3CCM Q;  3OS1 A;  4M77 F;  1N8R U;  2RQV A;  3NGP A;  3SFM A;  1I07 A;  3M54 A;  1SF9 A;  4MDW A;  3G71 A;  1VQP A;  2XHC A;  1ZBX A;  1KC8 U;  2QQR A;  3UF4 A;  1X75 C;  1R0B G;  3P8H A;  3S3N A;  5FW9 A;  2KYB A;  4X9D A;  1ACM B;  4X9C A;  3I56 T;  2FPD A;  2YRC A;  1T0H A;  1Y96 B;  5J26 A;  5GJV B;  4BI4 A;  2JOY A;  1DJ7 B;  3M56 A;  1NZ9 A;  1Q86 U;  1T3L A;  1VYT A;  2HKQ B;  2RO0 A;  4OMM A;  1WPY A;  4RTW A;  4M75 A;  4TVR A;  2CSQ A;  1TG0 A;  2M0O A;  5FU7 B;  3OYI A;  4PFO A;  2HNI A;  2RJF A;  1YWO A;  1JJ2 S;  1K8A R;  4PJJ A;  3JCM P;  1PD1 A;  2LTO A;  3QWX X;  3UDC A;  1SHF A;  2A36 A;  1YCY A;  3CCJ Q;  2LCL A;  4DQ2 A;  4OMO A;  1OU8 A;  1GCQ A;  2VB6 A;  3A1P A;  2DJQ A;  3I55 A;  2K9G A;  3OYF A;  4OB3 B;  3JCM c;  2L89 A;  1RAA B;  2CZ0 B;  4FYV B;  2CDT A;  1Q82 C;  4PJO F;  1Q82 R;  4ME7 A;  1Q7Y C;  2K57 A;  2F2V A;  2ED1 A;  2HAX A;  1BIB A;  4E7L A;  1OQK A;  1M2V A;  2Y90 A;  2EAY A;  1M1K C;  1M1K R;  2O88 A;  1QVG S;  1MUZ A;  4C92 A;  4M78 F;  5KYU A;  1RI9 A;  2RB6 A;  1ABQ A;  3RKY A;  1FMV A;  2LCS A;  1TU0 B;  1KK7 A;  3CC2 T;  5GAN 4;  3MEW A;  2QEX A;  5GAO q;  4OP0 A;  2EJG A;  4ANJ A;  5FRO A;  4E6R A;  2WSE E;  3ME9 A;  3CD6 T;  4QVD A;  2VGN A;  1D0Z A;  1BKB A;  3HHT B;  4GLK A;  1NYG A;  1TUD A;  2YUN A;  3A8H B;  4HCZ A;  3G4S A;  3C4S A;  1S72 A;  2KI7 A;  1JXO A;  2EKH A;  1PC0 A;  4JRK A;  3M0R A;  1VQ6 T;  1QVF S;  1SKU B;  2XD0 A;  3UPU A;  5HCK A;  1TOV A;  3M0P A;  3WXM B;  3CCV T;  1W6X A;  2CH4 A;  4XTZ A;  2LX7 A;  4KUD K;  2RHU A;  1WI7 A;  2GCX A;  4VUB A;  1YBY A;  1TTH B;  2DM1 A;  5CKE A;  2CP6 A;  4QVZ A;  1Q95 G;  4E7H A;  4M7D B;  1I1J A;  2MAM A;  1U1S A;  1VQP Q;  4JS5 A;  3BDU A;  5EG2 A;  2M1H A;  4FSX A;  3CCS A;  1FXX A;  5GAN 8;  3BY7 A;  1M4Z A;  1I0C A;  3TRE A;  3FRN A;  3CMA T;  1WXB A;  3TSW A;  2DVE A;  2RJD A;  2MI6 A;  1EIF A;  3REA B;  4C5E A;  2K79 A;  3EH1 A;  3VS2 A;  3I5R A;  1RLQ C;  2ED0 A;  2DL8 A;  4JLI A;  3DLM A;  1Y71 A;  2EYQ A;  1M3A A;  2DIG A;  4BDY A;  3MHX A;  3CEY A;  3HRT A;  1VQK A;  3UAT A;  5GAN h;  5HK0 A;  4J9B A;  1ZX6 A;  4PKC C;  3GP8 A;  2BZ8 A;  2EPD A;  2ZPB B;  4C8Q G;  3ZFJ A;  1KD1 R;  2EGA A;  1X6O A;  2MYS A;  3Q1J A;  1YJ9 A;  4AMC A;  3CME Q;  2DF6 A;  3RUX A;  1PRL C;  3I55 Q;  5FRN A;  2LNH B;  3EG1 A;  4DBQ A;  5DY9 A;  1UJ0 A;  3UT1 A;  3GF5 A;  2KRO A;  2RJE A;  4BD3 A;  2DMO A;  3CCR T;  4C92 G;  3FC3 A;  5A0G A;  3CC4 T;  1M27 C;  1K0X A;  5FU7 C;  1VIF A;  4Z8A A;  4FYX B;  2W10 A;  2O01 E;  3JCM X;  2CRE A;  4HVW A;  3S3O A;  2MWO A;  1SG5 A;  2RN8 A;  4K11 A;  2YXY A;  3E19 A;  2X4W A;  4C8Q E;  2QEX Q;  3LX7 A;  1O75 A;  2OTJ T;  5GAN 2;  1VQ6 A;  2D1X A;  1WIE A;  3SD4 A;  3ER0 A;  4E7J A;  1K76 A;  4NOY A;  1VQ4 T;  1BI1 A;  2F5K A;  3M0T A;  3OYG A;  2XIC A;  1Q81 R;  2L3S A;  2QA4 A;  3A8M B;  3NTH A;  3EGD B;  2XDP A;  4C92 E;  2EKO A;  2MK5 A;  3GOX A;  1K8A U;  4C5I A;  2WAC A;  3EH2 A;  3OA6 A;  5AYF A;  3FLG A;  1X27 A;  2O9S A;  2M02 A;  3CMA A;  3A5Z B;  3OYD A;  3QXE B;  1W70 A;  2RI2 A;  4M75 F;  4HT8 A;  3O8V A;  1YN8 A;  3JB9 G;  2LQW A;  2A0F B;  4M77 A;  2C0I A;  1YI2 T;  1OX9 A;  1OZ2 A;  2SRC A;  3PIO A;  1Y0M A;  2JVV A;  5LJ3 g;  5IHN A;  1OOT A;  3CCE T;  2KXD A;  3OMC A;  2PNI A;  2RMO A;  4JRI A;  3VKI A;  2B86 A;  2J6F A;  1UEB A;  1Q82 U;  4N4G A;  2RQU A;  2CZ6 B;  2M9U A;  2YDL A;  1VQ8 T;  4MZP A;  4F7U B;  2P4T A;  3ULR B;  1M1K U;  3JAM E;  4M7A B;  1Y96 A;  2JUF A;  5KYW B;  3CPF A;  1VQL T;  2HBW A;  2RQR A;  4DEY A;  3BDL A;  1VQ9 T;  5LJ5 g;  1TUC A;  1VQK Q;  2MMP A;  5GAM g;  3O5Z A;  4M7D C;  2HL3 A;  1CKB A;  3EG9 A;  4C92 F;  3CCR A;  2KGT A;  2QXF A;  5D6X A;  1MGQ A;  2KRS A;  3OB9 A;  4ZN1 A;  1M8M A;  2DBM A;  2KY9 A;  1V76 A;  4FT4 A;  3PE0 A;  3CC4 A;  4J9D A;  3H8Z A;  4QVC A;  4M77 D;  1NE8 A;  3ASK A;  2YSQ A;  1M1F A;  2F1L A;  3EGU A;  4KGX B;  1JJ2 P;  1LOJ A;  3MP6 A;  1BU1 A;  2DD4 A;  3TCJ A;  4QW2 A;  2X9H A;  4LD6 A;  3CC2 Q;  5KYN A;  4RG2 A;  3VJP A;  5GJW B;  4PLL A;  2HMA A;  2DIL A;  2LT4 A;  2OTJ A;  2CP0 A;  5I21 A;  3D7S B;  4PNO A;  2HSE B;  4F17 A;  3MET A;  4ZN3 A;  4X1V A;  4Y91 A;  5IHI A;  1G83 A;  1VA7 A;  1WHG A;  3VS0 A;  2C06 A;  4BE0 A;  2DJZ A;  1VQ6 Q;  2ZPE B;  2KSS A;  2JS0 A;  2EJF A;  2DPP B;  2WSF E;  2OTL T;  1QVG P;  2A3L A;  4E7S A;  4J6X A;  2DO3 A;  3M0Q A;  2NUZ A;  3JB9 F;  4NL2 A;  3L42 A;  2QA4 Q;  1R77 A;  2NUT A;  2VYT A;  1YI2 A;  5GAN d;  1JO8 A;  3QZ5 B;  4O5V A;  2D6F A;  2K5F A;  1ZSG A;  1YIJ T;  2CS7 A;  1KD1 U;  4QQ6 A;  4PL6 A;  3CBO A;  2E6N A;  3CMA Q;  1TUG B;  1X2K A;  2OAW A;  4PJO D;  2RHX A;  1LJO A;  3CCQ A;  4C0F A;  1M3C A;  4BAC A;  3C0C A;  2PZ1 A;  4II1 A;  1X01 A;  1WX6 A;  4A4K A;  1QVF P;  1RUW A;  5GAN 7;  1BYM A;  2RK2 A;  3EFS A;  1WFW A;  2E3I A;  4Q5W A;  1B7T A;  2XDB A;  1U5S A;  4M78 D;  2M16 A;  1VQ9 A;  3M4Y A;  1UTI A;  1RLP C;  2DLP A;  5FLX E;  2VXE A;  3EFR A;  4N0A A;  1KQS A;  3U23 A;  4IUV A;  4MML A;  4A63 B;  2MF2 A;  3CC7 T;  4E47 A;  2OJ2 A;  2RHZ A;  3NTK A;  3GNF B;  1KQS P;  1BI3 A;  4Z89 A;  4MDX A;  5GAN 6;  1SPK A;  4JJN K;  2ZPF B;  2SEM A;  3C12 A;  4B9X A;  2GFA A;  3CCR Q;  3GIB A;  2K6D A;  3QBY A;  5KH6 A;  3E9F A;  9ATC B;  1Q81 U;  3CC4 Q;  3URG A;  1VQM T;  1WA7 A;  2E3H A;  1I5O B;  3TEE A;  1AHJ B;  1SHG A;  1TXQ A;  2IVW A;  3GPL A;  4ZGD B;  1PKS A;  4QKU A;  4RTX A;  4DBH A;  4M7A C;  1VYU A;  2DFU A;  2WSC E;  2X3X D;  3JCM g;  3M4G A;  2OTJ Q;  1HD3 A;  4D6W A;  3PNW C;  4HVV A;  4J9C A;  1WHJ A;  2E70 A;  3EGX B;  3OYJ A;  1K73 C;  1C1A A;  2FZG B;  4RMO A;  1B34 A;  2CUD A;  4R55 A;  1G3Y A;  4Z02 A;  2AHJ B;  4XTU A;  1YJN T;  1UUE A;  4JJC A;  1H3H A;  1M3B A;  1VQ7 T;  2V8K A;  2R57 A;  1FX7 A;  4JZ4 A;  2Y4Y A;  8ATC B;  1RAE B;  3BFM A;  3H0I A;  1AOJ A;  3PMI A;  3LH5 A;  4QQD A;  3X25 B;  3NHN A;  4EMG A;  2MIO A;  3M55 A;  2QGF B;  2RM4 A;  3REB B;  2VUB A;  3VYH B;  3EFO B;  4OB1 B;  1U1T A;  2FB7 A;  1YI2 Q;  2LC4 A;  1UGQ B;  3PVL A;  3RES A;  2EYY A;  3MCA B;  4J7I A;  2NUP A;  5LJ3 f;  1QP3 A;  1IHV A;  4BY6 B;  4LDX A;  3M5A A;  4M7D G;  3A8O B;  3EHR A;  1VQ8 Q;  3LWI A;  2CZ7 B;  2A08 A;  5KCO A;  3L2W A;  4RCB A;  2EQM A;  1VUB A;  3CCQ Q;  3OYN A;  3HFO A;  2PUK B;  4ZTF A;  2DET A;  3SWN B;  2P0P A;  2L3P A;  2XMF A;  5CQY A;  1XNI A;  1UHC A;  3RR6 A;  1TS9 A;  1EFN A;  3MPU B;  3OYY A;  1R8O B;  2AZV A;  3UA7 A;  1VQ9 Q;  1YCS B;  2P4R A;  1X2Q A;  4QT7 A;  3HRU A;  4RTU A;  2YT6 A;  3CME A;  4JDS A;  1OPK A;  1T0J A;  4C8Q A;  3LWH A;  3QWY A;  5GMK i;  4M7A A;  1ZA1 B;  5KYW A;  5GAO n;  2BKD N;  4IUR A;  2RI3 A;  1E7O A;  2KBT A;  4KUL A;  1Q7Y R;  4M7D E;  1RAI B;  1MV0 B;  1M8V A;  2E5K A;  3L2Q A;  2JMC A;  2DL5 A;  4E7Z A;  2J06 A;  2DD5 A;  2L0A A;  3H0F A;  3CCL T;  1D1A A;  2LRQ A;  2BZY A;  2F69 A;  2JN0 A;  2KR3 A;  2JTE A;  1I4K 1;  2CP5 A;  4RTZ A;  1CSK A;  2DL7 A;  4PJO B;  2EQK A;  4M75 D;  5GAN f;  2COZ A;  4HCC A;  2FL7 A;  2DKG A;  1M90 C;  1HXD A;  4DA4 A;  6AT1 B;  1YIT A;  5LJ3 h;  3FDR A;  4M78 B;  3X24 B;  4J9I A;  5GAN j;  2CP2 A;  3CXC A;  4J5Y A;  4CC3 A;  4EMH A;  2OTL Q;  3VU3 C;  3OBW A;  1NG2 A;  4AG1 C;  2JM8 A;  2QG9 B;  2L8D A;  4DOV A;  2EFI A;  2RF0 A;  2DVJ A;  2AZS A;  1GL5 A;  2GGR A;  1PD0 A;  2ZPI B;  4C0D B;  1NJI C;  4L59 A;  1M2O A;  3I56 A;  3NPF A;  4OGE A;  1NEB A;  5LJ5 h;  2PU9 B;  2VAS A;  3HTR A;  5CCA A;  5GAM h;  3AHU A;  1YHQ T;  4M7D F;  1KSW A;  3WVE B;  4MZM A;  2RPN A;  3I9Q A;  4C92 D;  1M30 A;  1BI0 A;  5FRM A;  1JU5 C;  1PSE A;  3JRZ A; 
#chains in the Genus database with same CATH homology
 2LQW A;  2F2W A;  2DL3 A;  2ECZ A;  2C0I A;  2PTK A;  2EYZ A;  2SRC A;  1Y0M A;  2FEI A;  5IHN A;  1OOT A;  1OV3 A;  2FO0 A;  1KIK A;  2EGE A;  2KXD A;  2PNI A;  2I0N A;  1PRM C;  2RMO A;  1BBZ A;  2B86 A;  2J6F A;  2YUO A;  5FWC A;  2RQU A;  2KE9 A;  1OPL A;  3R6N A;  2D8J A;  1OEB A;  2YDL A;  2EW3 A;  3TVT A;  4IIO A;  1ABO A;  1GFD A;  1ZUK A;  3SHW A;  3TSZ A;  4ESR A;  5IXF A;  2GNC A;  3ULR B;  2FPF A;  3IQL A;  5ECA A;  2A37 A;  1CKA A;  2RQT A;  2LMJ A;  5I11 A;  1ZBJ A;  1T3S A;  2HBW A;  4D8D A;  2RQR A;  1IO6 A;  4DEY A;  1WDX A;  3VS3 A;  2BZX A;  2A28 A;  2KXC A;  1TUC A;  3EG3 A;  1FMK A;  2JMA A;  2YUQ A;  3O5Z A;  1U3O A;  1BB9 A;  1MV3 A;  4Y92 A;  4CC2 A;  1X69 A;  2KT1 A;  2M0Y A;  1CKB A;  4LNP A;  1UDL A;  2KGT A;  4HXJ A;  1X43 A;  2KRS A;  1M8M A;  1QKW A;  2EYW A;  2GBQ A;  1NEG A;  5IH2 A;  2DBM A;  1GBR A;  4J9G A;  1FYN A;  3PE0 A;  2VWF A;  5I22 A;  3RNJ A;  4J9D A;  4HCK A;  2KEA A;  2AK5 A;  2J6O A;  4IIM A;  4KRT A;  1UFF A;  2YSQ A;  2KRM A;  2O31 A;  2EQI A;  2JW4 A;  2M51 A;  3EGU A;  4AFZ C;  2DA9 A;  5EC7 A;  1BU1 A;  1S1N A;  1ZUU A;  2LZ6 B;  2K2M A;  1SRM A;  2CT4 A;  1W1F A;  5GJW B;  2DIL A;  2C0O A;  1H92 A;  1XOV A;  1K4U S;  4RTV A;  2F2X A;  4F17 A;  1WXT A;  1HJD A;  4AFU C;  2HSP A;  4X1V A;  1K9A A;  1NLP C;  2FRW A;  2L2P A;  5IHI A;  2J05 A;  2GTO A;  1G83 A;  5IHK A;  4OMP A;  1VA7 A;  3VS0 A;  4AG2 C;  1AWJ A;  2OI3 A;  2DYB A;  2QDL A;  3CQT A;  4R0K A;  2W0Z A;  4RUG A;  2EBP A;  1UG1 A;  5L23 A;  3FJ5 A;  4F16 A;  2JS0 A;  4AFS C;  2V1R A;  2AKK A;  2JT4 A;  4AFQ C;  4M4Z A;  1QWE A;  3I5S A;  1NM7 A;  1UHF A;  4OML A;  3H0H A;  4DEX A;  3A98 A;  3VS6 A;  3M0Q A;  2NUZ A;  2J6K A;  1QWF A;  2RQV A;  3NGP A;  4JPB W;  1JO8 A;  1I07 A;  1ZSG A;  2FRY A;  4OMQ A;  2RNA A;  2DL4 A;  3UF4 A;  1X6B A;  2EVR A;  1X2K A;  4WCI A;  5FW9 A;  2KYB A;  2OAW A;  2FPD A;  1T0H A;  5GJV B;  1M3C A;  3C0C A;  2PZ1 A;  1WX6 A;  1RUW A;  1T3L A;  1GRI A;  3VRZ A;  2LQN A;  1VYT A;  1AZG B;  2JXB A;  4OMM A;  1WFW A;  4RTW A;  1U5S A;  2CT3 A;  2YUP A;  1UTI A;  1RLP C;  2DLP A;  2FG0 A;  2CSQ A;  1TG0 A;  1Z9Q A;  1K1Z A;  4JJD A;  2HDA A;  4OMN A;  1YP5 A;  1YWO A;  4LN2 A;  2G6F X;  3U23 A;  2ABL A;  1PWT A;  1GBQ A;  1PKT A;  4A63 B;  1BK2 A;  1SEM A;  2OJ2 A;  3QWX X;  2ENM A;  2ROT A;  1SHF A;  2A36 A;  1AD5 A;  1E6H A;  2VKN A;  1UE9 A;  3THK A;  4Z89 A;  4OMO A;  1N5Z A;  2DE0 X;  1SPK A;  1GCQ A;  3VS5 A;  2MCN A;  2DJQ A;  2K9G A;  2SEM A;  4JZ3 A;  1E6G A;  2HCK A;  1AWW A;  2O9V A;  4GBQ A;  2CDT A;  2K6D A;  4RTT A;  4HVU A;  3VS7 A;  2F2V A;  1HSQ A;  2ED1 A;  3UA6 A;  1WA7 A;  1SHG A;  1ARK A;  4CC7 A;  2O88 A;  1PKS A;  1KJW A;  1MUZ A;  1PHT A;  4RTX A;  2LJ0 A;  4CC4 B;  1VYU A;  1RI9 A;  1ABQ A;  2LCS A;  2X3X D;  1NLO C;  2X3W D;  1HD3 A;  4HVV A;  2IIM A;  1GCP A;  4J9C A;  4E6R A;  4D8K A;  1QLY A;  1WYX A;  2DRK A;  3VRY A;  1AZE A;  2CUD A;  2KRN A;  4J9E A;  2CSI A;  1NYG A;  1TUD A;  2YUN A;  1UUE A;  4JJC A;  3ZL7 C;  1ZLM A;  2DX1 A;  1H3H A;  4F14 A;  1JXO A;  1M3B A;  2EKH A;  3M0R A;  2K3B A;  2GQI A;  2V1Q A;  4JZ4 A;  5HCK A;  3M0P A;  3H0I A;  1W6X A;  2CH4 A;  1AOJ A;  2LX7 A;  3LH5 A;  3NHN A;  1UGV A;  2MIO A;  3JV3 A;  1WI7 A;  2K7A A;  2DM1 A;  3REB B;  2KNB B;  4FSS A;  3EHQ A;  1NYF A;  2FPE A;  2AKL A;  4LE9 A;  4ZNX A;  1H8K A;  1AWO A;  1I1J A;  1YWP A;  2LJ3 A;  3NMZ C;  1QCF A;  4J9H A;  1ZUY A;  3GBQ A;  3PVL A;  2EYY A;  3RBB B;  1JEG A;  1I0C A;  3EHR A;  1WXB A;  2JM9 A;  3TSW A;  2A08 A;  3REA B;  2K79 A;  4GLM A;  3VS2 A;  3I5R A;  1UJY A;  2L3P A;  2XMF A;  3PVQ A;  1Y57 A;  1UHC A;  1RLQ C;  2ED0 A;  2DL8 A;  1EFN A;  1SSH A;  1PNJ A;  4LUE A;  1WXU A;  2AZV A;  1M3A A;  3UA7 A;  1J3T A;  1YCS B;  2P4R A;  1X2Q A;  1X6G A;  4QT7 A;  1WLP B;  4RTU A;  3UAT A;  2LP5 A;  3VS4 A;  3M0S A;  1UEC A;  2YT6 A;  4J9B A;  3I35 A;  5IXB A;  1ZX6 A;  1OPK A;  4RTY A;  2BZ8 A;  2EPD A;  2EGA A;  1T0J A;  2C0T A;  2D0N A;  3QWY A;  1B3Q A;  2ESW A;  3VS1 A;  2O2O A;  1E7O A;  2DRM A;  2DF6 A;  2KBT A;  4ORZ A;  1PRL C;  1MV0 B;  2LNH B;  3EG1 A;  1UJ0 A;  1K0S A;  1B07 A;  2E5K A;  2JMC A;  2DL5 A;  2J06 A;  2KYM A;  2BTT A;  2KRO A;  2L0A A;  3H0F A;  2GTJ A;  1AEY A;  2DMO A;  2BZY A;  2DNU A;  2NWM A;  4EIK A;  2HEQ A;  2JTE A;  2KR3 A;  3M0U A;  1Z9Z A;  4Z88 A;  2EGC A;  4RTZ A;  2JS2 A;  1CSK A;  2DL7 A;  2MOX A;  1M27 C;  3EG2 A;  1K0X A;  2H8H A;  1G2B A;  4Z8A A;  2W10 A;  1KFZ A;  4J9F A;  1GCQ C;  2CRE A;  4HVW A;  2J7I A;  5FWB A;  2RN8 A;  4K11 A;  2LJ1 A;  4J9I A;  2DBK A;  2D1X A;  1WIE A;  4CC3 A;  2RQW A;  1K76 A;  1QKX A;  1NG2 A;  2VVK A;  2JM8 A;  4AG1 C;  3M0T A;  3H41 A;  3KFV A;  2RF0 A;  2CUB A;  1JQQ A;  1JXM A;  1V1C A;  2CH4 W;  2DVJ A;  2AZS A;  1YNZ A;  1AWX A;  1GL5 A;  1AVZ C;  2GGR A;  2L3S A;  1U06 A;  2D8H A;  1LCK A;  1VYV A;  2KT8 A;  3EG0 A;  3NPF A;  1NEB A;  4JJB A;  2L3Q A;  4LUD A;  2ROL A;  3SEM A;  1KSW A;  1X27 A;  1GFC A;  1SRL A;  2O9S A;  2RPN A;  3I9Q A;  1M30 A;  1A0N B;  1W70 A;  2EYX A;  1JU5 C;  1YN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...