2CUBA

Solution structure of the sh3 domain of the human cytoplasmic protein nck1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
88
structure length
88
Chain Sequence
GSSGSSGDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK1
publication title Solution structure of the SH3 domain of the human cytoplasmic protein Nck1
rcsb
source organism Homo sapiens
total genus 8
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2cubA00
2BZYA 3QWXX 3UF4A 1NYFA 2QDLA 1GL5A 1FYNA 1UUEA 3VS4A 4OMQA 2X3XD 2M0YA 2FPEA 2AKLA 3I9QA 1H92A 2LMJA 2YT6A 3ULRB 2KR3A 1JO8A 1WA7A 2ED0A 1Z9ZA 5I11A 1YWPA 2DJQA 4HVUA 2JTEA 2YDLA 1JXOA 4RTVA 1RLQC 4RTUA 1ARKA 1JU5C 4LNPA 1U5SA 2D8JA 5L23A 1GRIA 2BTTA 3UA7A 1W70A 4K11A 1QCFA 2DYBA 4M4ZA 2AK5A 3REAB 3JV3A 1ZX6A 3GBQA 1ABOA 3KFVA 2K7AA 4D8KA 2L3PA 3VS3A 1UFFA 1HSQA 2F2VA 1ZLMA 2F2XA 1SHGA 4LE9A 1RLPC 3EG1A 1X69A 2JT4A 3I5SA 2GBQA 2RQRA 3R6NA 3CQTA 3H41A 3TSWA 2L3QA 3EG0A 2D0NA 1SRMA 1BU1A 1HJDA 1UGVA 2X3WD 4JPBW 3H0IA 1PKSA 1VYVA 4F17A 3EGUA 2KT8A 4RUGA 2K3BA 2EKHA 4RTXA 2AZVA 2YUNA 2K2MA 5IHKA 2LQWA 4CC7A 2YUPA 4FSSA 2EGCA 3C0CA 4RTWA 2L2PA 2C0TA 2MOXA 3H0HA 2K6DA 2SEMA 1UDLA 3TSZA 3NMZC 4KRTA 2CH4A 2SRCA 4ZNXA 1WLPB 2CSQA 3NPFA 3PVQA 1AOJA 2FRWA 2KYBA 3RBBB 2DA9A 2GNCA 4Z8AA 3FJ5A 4IIMA 2KBTA 1WI7A 4RTYA 2DNUA 4CC3A 3ZL7C 4J9BA 5GJVB 2DX1A 3NHNA 1SSHA 2C0IA 2ECZA 3A98A 4OMPA 1J3TA 4RTZA 2HCKA 2BZ8A 2EGEA 2VKNA 2HBWA 2CT4A 1NEGA 1NG2A 2DBMA 1M30A 1K0XA 1S1NA 1ZBJA 2EVRA 2H8HA 1KSWA 3VS0A 1NLOC 5IHNA 2ROTA 2AKKA 2ENMA 1W1FA 4HXJA 4JZ4A 1M27C 2GTOA 2EPDA 1RI9A 1I07A 3VRYA 4J9EA 2C0OA 4ESRA 5IXFA 1LCKA 2VVKA 2RQVA 2KRSA 5FW9A 1NM7A 1H8KA 1YWOA 4LN2A 4F16A 2YUQA 1FMKA 1YP5A 1KFZA 1AD5A 3RNJA 2P4RA 4R0KA 2RQWA 2W0ZA 3PVLA 2A36A 4WCIA 1U06A 2KRNA 2JMAA 2KRMA 1BBZA 2LJ0A 4GLMA 2DF6A 1T0HA 2EYWA 1JQQA 1GCQA 2KNBB 1GBQA 2YSQA 4OMLA 3REBB 1X6GA 2JXBA 1GCQC 1PRMC 1SEMA 1A0NB 1UG1A 2DMOA 4OMNA 1K0SA 1BB9A 3VS6A 3M0QA 4DEXA 2EW3A 2DVJA 3PE0A 1PRLC 1WIEA 2DRMA 1M3CA 1TG0A 1E6HA 2JS2A 2O88A 5I22A 2JM9A 2RNAA 2KGTA 1UHCA 2KEAA 1GFCA 1EFNA 2CSIA 2PNIA 2CUBA 1KIKA 1N5ZA 1Y0MA 3UATA 2LX7A 4IIOA 4E6RA 1K1ZA 2LQNA 4D8DA 1JEGA 1SHFA 2NUZA 4JZ3A 2MCNA 1NEBA 3M0PA 1K4US 1T3SA 2JM8A 2F2WA 1ZSGA 3EHQA 1JXMA 1GBRA 2VWFA 1QWFA 1M3AA 1PNJA 2CREA 4OMOA 3U23A 4DEYA 1Z9QA 2JW4A 1MUZA 1M3BA 2FO0A 2RPNA 2V1RA 4J9FA 1HD3A 1QWEA 2FRYA 2KE9A 5ECAA 1UECA 1IO6A 3TVTA 2HEQA 2JS0A 1AZGB 1WFWA 2LNHB 3VS7A 2DL5A 4A63B 1AWWA 4HVVA 2FPDA 1OEBA 2LJ3A 2PZ1A 3EHRA 1UHFA 2RMOA 5GJWB 4LUDA 1G2BA 2DBKA 2MIOA 4QT7A 1WYXA 2EYZA 2OAWA 3I35A 2RN8A 3M0RA 3VS5A 2DE0X 1AWOA 3EG3A 2O9VA 2K79A 5FWBA 1TUDA 2YUOA 2DL4A 2LZ6B 1I0CA 2DILA 3LH5A 3QWYA 1X27A 1E6GA 2A08A 1GCPA 2J06A 2J6KA 1B3QA 3M0UA 1ABQA 1OV3A 2FEIA 1G83A 1K9AA 1YCSB 4CC4B 1V1CA 2G6FX 2ESWA 5IHIA 2EGAA 1W6XA 2KT1A 1QKXA 2OI3A 2KXDA 3SHWA 1OPLA 2LJ1A 3O5ZA 2DL3A 2J7IA 1AZEA 4CC2A 2LP5A 2KYMA 4AFZC 1AWJA 1WXBA 2EYXA 5HCKA 1B07A 1AWXA 1UJYA 2W10A 5IXBA 3M0TA 2RQUA 2ED1A 2AZSA 4AFUC 1PHTA 5EC7A 2DLPA 2A37A 4Y92A 2V1QA 4HCKA 1RUWA 2J05A 2PTKA 4JJDA 1CKBA 4EIKA 1I1JA 1OOTA 3THKA 1ZUUA 2GQIA 2EYYA 2K9GA 3UA6A 4LUEA 1UJ0A 2FPFA 4J9CA 1XOVA 1VA7A 2KROA 1H3HA 4GBQA 3SEMA 2EQIA 1ZUKA 1X2QA 2J6FA 4J9DA 4J9IA 2DRKA 1CKAA 1T3LA 1VYTA 5FWCA 1E7OA 1SRLA 2KXCA 2O31A 1YNZA 1BK2A 4HVWA 1K76A 1QKWA 2CDTA 1PKTA 2O2OA 2FG0A 5IH2A 2O9SA 1X43A 1WDXA 1PWTA 1WXUA 1X2KA 2DM1A 2LCSA 1AEYA 3EG2A 2DL7A 4JJBA 4AFSC 2CT3A 3VS2A 1NLPC 1X6BA 2DL8A 1OPKA 1YN8A 2RQTA 1AVZC 4OMMA 2EBPA 1MV0B 3NGPA 2IIMA 2J6OA 2NWMA 3M0SA 2ROLA 4AFQC 2L3SA 1WXTA 2HSPA 4ORZA 1SPKA 2D1XA 3VS1A 2BZXA 2A28A 2E5KA 2M51A 4Z89A 4J9GA 2I0NA 2JMCA 1T0JA 1TUCA 4JJCA 4F14A 4AG2C 2ABLA 1CSKA 1U3OA 2RF0A 1VYUA 2XMFA 4RTTA 2GGRA 2OJ2A 3I5RA 1ZUYA 1WX6A 2B86A 1Y57A 3H0FA 1UE9A 4J9HA 2L0AA 3VRZA 2D8HA 2HDAA 2GTJA 4X1VA 1NYGA 1MV3A 3IQLA 1QLYA 1UTIA 2CH4W 2CUDA 4Z88A 1M8MA 1KJWA 1GFDA 4AG1C
chains in the Genus database with same CATH superfamily
5KYYB 4ZN3A 2D0QB 4LDVA 5KYXB 1NYFA 4HCZA 1FYNA 4XU2A 4RCCA 2PUKB 5CKEA 1R8OB 3CMAQ 2FPEA 2AKLA 2YRVA 1MMGA 3M5AA 4WTOB 1WA7A 1NJIU 1VQ8Q 1VQ6T 1YWPA 2DJQA 4HVUA 2JTEA 4RTVA 3A5ZB 2HMAA 4AMCA 1JU5C 2DTIA 2PVDB 5L23A 3E19A 2XDBA 1W70A 1NPPA 4BE2A 4TVRA 3M55A 3MEAA 3DB4A 4M78B 2DYBA 2JTFA 3BFMA 2AK5A 3JV3A 5GAOl 3KFVA 4A54A 2Z0WA 2M16A 2F2VA 3QUIA 3LGLA 2F2XA 4LE9A 4OB0B 2JT4A 2RQRA 3OA6A 3DLMA 2L3QA 1SRMA 1M2OA 1HJDA 4EMKB 1UGVA 3H9NA 4JPBW 2HSEB 5CKFA 4XTXA 4F17A 2MK5A 2KT8A 2K3BA 3KXTA 4RTXA 2AZVA 2YUNA 1C6VX 3JB9J 4CRIA 4EDUA 2LQWA 1MHNA 3EFOB 4MZPA 4PLLA 2C0TA 3MEWA 1MMNA 2SEMA 1QMCA 2SRCA 3MO8A 2CSQA 1TSFA 1AOJA 2MWOA 4PLIA 2ZCFB 3P8BB 2EYQA 1XNIA 2F5TX 5A0LA 3CPWA 2ATCB 3HHTB 3M4GA 3CCVQ 3CC2T 4PFPA 4CC3A 2JOYA 3JCMb 5GJVB 3JB9F 4BI3A 4QVCA 1J3TA 3AT1B 2DETA 3GNFB 2CT4A 1NEGA 3OYLA 1G3YA 5GAMj 1K0XA 2GF7A 2EVRA 3RKYA 1W2BP 1GXIE 3HL8A 1QQJA 3VS0A 2DO3A 2ROTA 3JCMg 2ENMA 5CR2A 2NUTB 3CCMT 2PVOB 1LCKA 2VVKA 1I4K1 3G71A 1Q81U 1WJQA 2PUOB 5GMKh 1FMKA 1YP5A 3QJYA 2DJZA 1AD5A 3G71Q 2CP5A 4KBMB 1RAGB 1U06A 2JMAA 2KRMA 2VYTA 1RI0A 3MHXA 3QSUA 3REBB 3ZBDA 1M4ZA 3JRZA 1X6GA 3OYNA 5KCHA 1SEMA 4XTWA 5FU7B 5FROA 3OYIA 5FU6C 4OMNA 1BB9A 5CVIA 3VS6A 4JDSA 4Q5WA 3OYFA 2CZ7B 3M56A 3PE0A 1PRLC 1WGSA 1WIEA 1QVGA 1VQNQ 1VQMA 2OTLA 2JM9A 2EAYA 2KGTA 4DOWA 1GFCA 1EFNA 1SSFA 3CCET 2MYSA 4AT1B 1QVGS 3UATA 2QA4T 4E6RA 2OTLQ 7AT1B 1K1ZA 1Q82R 1M9SA 4N0AC 3NFCA 1N8RC 2X4WA 4C8QC 3KUFA 3L2VA 3CD6A 1N27A 1T3SA 4B6MA 2F2WA 1MGQA 1O75A 4DBQA 5CKHA 1QWFA 1M3AA 2CREA 4OMOA 3CD6Q 1M3BA 3OB9A 2DXUA 2V1RA 1S72Q 2JNGA 1VOMA 1HD3A 1OX8A 4BY6B 1KC8C 5HK3A 2M0OA 2ZPFB 5ECAA 2E1HA 2HEQA 2JS0A 3VS7A 2DL5A 4CI0C 4LDYA 3CCLA 4DBRA 2LJ3A 2PZ1A 1YHQT 1ACMB 1IHVA 1UHFA 2MIOA 3WVDB 9ATCB 5LJ5e 4M7DA 3I35A 2WSFE 2L3RA 1D1AA 2EFIA 5FLXE 1D1CA 4HT9A 2M1HA 3J7AF 5GMKl 3N5BB 1K9MU 1I0CA 5A0GA 2M9UA 4DBFA 5GAMf 2E64A 2DIQA 1WHJA 5GANe 3META 1KQSA 4X9CA 1GCPA 2LCCA 2H3JA 1G83A 3FLGA 2IG0A 4CC4B 2G6FX 1KQSS 2K5LA 1Q7YR 1SF9A 4GY5A 2LQKA 2COYA 1OPLA 4FYXB 4CC2A 2NLUA 2X51A 2QDYB 3JAME 2EYXA 1RAEB 3M58A 3DKMA 1RACB 3OYAA 2ED1A 2LNVA 1PHTA 2HKNA 3EGXA 5EC7A 2FHDA 2DLPA 2CYZB 3L1AA 1VQ4A 2V1QA 3OMGA 2KK4A 2J05A 2PTKA 1KHIA 5C6SA 3EG9B 1OOTA 1YI2A 4EMKC 3V7SA 2YRDA 3PMTA 3EFRA 4C8QD 1VQ7A 4KT0E 3URGA 2FVUA 2EYYA 3JCMJ 4PJOD 4OP0A 1YJNA 1K73C 4LUEA 1RAHB 1VQ6Q 3I56A 4DBHA 1VQ7Q 1LVKA 1ZUKA 1X2QA 1M1KR 4J9DA 5CKDA 1CKAA 1O9SA 1T3LA 1VYTA 5FWCA 3I56Q 1TWBA 4KGXB 4Y91A 2KSSA 2RHZA 1N6AA 1LPLA 2KAFA 4JRQA 1Y7XA 4HVWA 3HSBA 2K5IA 4M77E 3EGXB 5GAN2 4LDWA 2DK3A 3HFNA 4A4FA 3LLRA 3HKSA 1X2KA 2RJCA 1PCXA 5KCOA 2DFUA 1Y96A 1NLPC 1M5Q1 1KD1R 3PFSA 4UC4A 1IB8A 2IIMA 3M4YA 1N9SA 2NWMA 3CXCA 4E7IA 2ROLA 3SD4A 2L3SA 3CMEA 1ZA1B 2EKOA 4M78D 2I0NA 3CMEQ 4ELYC 8AT1B 3CPFA 4C92B 1ZSZC 3HFOA 1Q7YU 3EH1A 3GPLA 1U3OA 1UGRB 2RF0A 4KULA 4JS5A 2GGRA 4C5HA 4DA4A 2QTVA 3H0FA 3CC2Q 1B7TA 2L0AA 3G71T 2VUBA 4ELZC 1Y96B 2A0FB 3CBOA 4M75E 5FU7C 1UTIA 2CH4W 5GMKj 2DKGA 1QCNA 2KVQG 5LJ3e 1GFDA 3CCUA 4C92G 4M7AE 4M77F 1QVGP 4BDYA 2DAQA 2DZCA 4KGVB 3X25B 2KY9A 3GLXA 1UUEA 1WZOA 4BI4A 3M54A 2DEUA 3CCMQ 4OMQA 4J6XA 3SB2A 2YT6A 4XTYA 1Z9ZA 2MMPA 5DM7R 1JXOA 4HT8A 3A8LB 5DLOA 4LNPA 1VQMT 2D8JA 2OTLT 1GRIA 2BTTA 2R5AA 3CCJQ 4K11A 1V76A 1BIAA 4M4ZA 3REAB 3S3OA 3GBQA 1ABOA 2L3PA 4E7KA 1FWZA 2QG9B 3JCMf 2DD5A 2X4XA 3CD6T 2CP2A 1RL2A 2BUDA 1FMVA 3CC4A 3I5SA 2GBQA 4LXCA 1UB4A 4KH0B 1IXDA 3CQTA 2K4YA 1K8AU 1Q86U 1MMAA 3CC4Q 4M75F 4PFOA 3C94A 3CCEQ 4RUGA 1IHWA 4M7AF 5GAOm 3RDVA 4F7UG 5J39A 1M1FA 1ZA2B 2CP7A 2YUPA 4FSSA 2EGCA 5CKBA 3OS0A 1KQSP 3QZ9B 3CCLT 5J26A 2L2PA 2VGMA 2YHTA 1PSEA 2K2VA 2K6DA 2WACA 4XU1A 4KRTA 2CH4A 3RKXA 3S3NA 4ZNXA 2OTJA 3CBPA 1WLPB 2HD0A 4Y28E 4ZN1A 2OTJQ 1G3WA 4IIMA 5GAOn 4HCBA 3VUBA 1AT1B 1PM3A 4RTYA 2P0PA 3ZL7C 4EMGA 2DTOA 4J9BA 3ER0A 2DX1A 3NHNA 1SSHA 5CIUA 2C0IA 3A98A 3MP6A 1ZQ1A 5GAOr 2BZ8A 4J7FA 2VKNA 1NG2A 4OB3B 5D6XA 1XJWB 4JRKA 4IUTA 4C8QG 1KSWA 2DXCA 4PJOG 1BYMA 2M02A 3A1PA 5GAN4 2QK0A 2GTOA 3VKIA 3BW1A 3VRYA 2CZ1B 3MKDA 1WJSA 1VQ4T 3RMSA 2DXTA 2B8AA 3DLLA 4OB2B 5I2MA 1KFZA 4Z02A 2XK0A 3OYKA 1FMWA 2FZCB 1VQ7T 1I5OB 2EQUA 2DVEA 2ZPEB 1YJNT 2MAMA 5KH6A 1WQWA 3L2WA 4MMLA 1T0HA 1Q81R 1JQQA 3FEOA 3I56T 5GAOq 2KMTA 1GCQA 5FRMA 1GBQA 2YSQA 2JXBA 4KH1B 2ZPHB 2DMOA 4DEXA 2WSCE 4BI8B 3OS5A 2DVJA 4C0DC 1D3BA 2DRMA 3OS2A 1M3CA 4HKEA 4MMKA 6AT1B 3GIBA 3I55A 3CXCP 1UHCA 2KEAA 3HRSA 4PK4A 2KDSA 3EGDA 1KIKA 1Y0MA 3SDZA 4J7IA 2LX7A 4IIOA 4M78G 2CP0A 2YRCA 2DYIA 3SWNC 2O4XA 1JEGA 2Y4XA 2X4JA 1UGPB 5IT9E 1SHFA 3RR6A 1NEBA 4PNOA 3CCRA 1YCYA 2VB6A 3G4SA 4C92C 1ZSGA 3EHQA 2VWFA 3TREA 1PNJA 2X9HA 5L8RE 3QYHB 1IGQA 4DEYA 3G4SQ 2RJDA 3CMET 2RPNA 3OBWA 1HK9A 2MPXC 3V8JA 3QO3A 3E9GA 2LQ8A 1KQ2A 1D3BB 4J5YA 4HVVA 2MF2A 2ZPIB 5CQXA 4QT7A 1G2BA 2DBKA 3EGDB 3CPWS 3OYGA 2OAWA 3M0RA 2CP6A 2V8KA 2DIGA 3EG3A 5HK0A 2L89A 2O9VA 4FT4A 1I8FA 2O4XB 1Q82C 4E7SA 4X34A 1H641 3LH5A 2DD4A 3CCUT 1E6GA 2RA2A 2QTXA 3LGFA 2J06A 2J6KA 3AHUA 4NOYA 3TQ7P 1P92A 1K9MR 2XDPA 5LL6S 1NPRA 1DJ7B 1QKXA 1U8RA 4J6WA 2KXDA 3SHWA 3HRUA 4C5GA 2J7IA 2E5QA 4O5VA 2LP5A 4M77A 1VQOA 1AWJA 1WXBA 3CCJT 4E47A 5HCKA 1AWXA 1X6OA 5GMKm 5IXBA 2RQUA 2Y90A 4AFUC 4JUVA 4PJLA 4O6JA 3QKJA 2HL5C 4HCKA 1VQLA 4JJDA 2JUFA 5LJ5j 1CKBA 5GAN3 3OSVA 1OYXA 3LWIA 4FM4B 2QXFA 1ZUUA 4BB7A 2K9GA 2FPFA 4C92D 2QAZA 1VA7A 2HL3A 4BDZA 3CC4T 3G7ZA 2EQIA 5GANj 1KG1A 1YITA 2DRKA 1BKBA 3A8HB 2G3RA 4LDUA 3QDFA 2HBPA 3OYMA 4QKUA 4RCBA 1VQMQ 4WF2A 2R5MA 3CCQA 1LJOA 2KXCA 3E2UA 4M77B 4ZGJB 1WHHA 4PJOC 1QKWA 1UGQB 2FG0A 1MNEA 2NUPA 1WDXA 2E70A 4M75A 4C0FA 2OTJT 3V7RA 4DOVA 3BY7A 2RH2A 4M7AA 4AFSC 2CT3A 5D6YA 1YN8A 3P8DA 2RQTA 3C4SA 4BE0A 1XQHA 3C12A 4PJNA 5A2QE 1MV0B 2EIFA 2F5KA 3NGPA 3EH2A 1MNDA 1YJWA 1FX7A 3JB9D 3NTKA 4MDWA 2LDMA 4ORZA 2D1XA 3M53A 4PJJA 1QP2A 1M1KC 3CCLQ 4JRIA 5FRNA 4J9GA 2JMCA 2F69A 1NZ9A 2GFAA 4JJNK 4V2SA 4JJCA 2HZYA 3D7SB 4EPCA 5CCAA 4HCCA 2ZPBB 1BCOA 3CBMA 3OYBA 1WX6A 2NUPB 4X9DA 2B86A 1Y57A 4M75B 5KYUA 1UE9A 4J9HA 1M90C 2D8HA 4M78C 4QQDA 2GTJA 3QIIA 4X1VA 4FYYB 4M7AB 2CGHA 1EZZB 3LYIA 4VUBA 3PMIA 1BI3A 1M8MA 1KJWA 3OY9A 1YIJA 5I21A 3OYDA 1KD1C 1M8VA 3QWXX 2ZGWA 3CCSA 1YIJQ 2QDLA 4E7HA 1GL5A 4M7DB 1BI1A 1V29B 2M0YA 1WHLA 1H92A 4C0ZA 2LMJA 2HNIA 2VGNA 2L5QA 4FCYA 2FB7A 2KR3A 4OMFB 3FDRA 5J3BA 2VXEA 4ATOA 4XU0A 1VQ4Q 3X24B 1B34A 4JS4A 2YDLA 4XQ3A 4A4HA 4JLGA 1YI2Q 1IZ6A 3JB9H 2F1LA 3NTHA 4D6WA 1QCOA 1KC8R 5KYUB 1YJNQ 4A53A 1OQKA 3WVEB 3V7CA 2ZPGB 4M7DG 2XKOC 2D9TA 1ZHIA 3HP9A 3VS3A 1X75C 1VQPA 5AYFA 1HSQA 1QW1A 3CCRT 3CPWP 3BDLA 4ZTJA 3G4ST 1SHGA 1VQPQ 1RLPC 5LJ3j 3EG1A 1TS9A 1QVPA 3UWNA 4L59A 3H41A 3OYJA 2D0NA 1BU1A 2XHCA 1VQ9A 3EFSA 3H0IA 1VYVA 2CZ0B 2ZAEA 2YWWA 2EKHA 2OX7A 3GF5A 4E2FB 3DB3A 3OYEA 3E1SA 2X35A 1K8AR 1BIBA 4CC7A 4B9XA 3C0CA 4RTWA 1Q86R 3RESA 4R55A 1QVFA 3H0HA 1UDLA 3RERA 3NMZC 3PT9A 1RAIB 3JCMX 2GQVA 3NPFA 3PVQA 5DLQE 2FRWA 4IUVA 2KYBA 2V8IA 3CXCS 1NJIC 1QVFS 2BE9B 3RBBB 2QEXA 1WHMA 3GP8A 1WI7A 3OYHA 2DNUA 1VQKA 2QEXQ 3OQ5A 1EIFA 2YXYA 4QVDA 4OMPA 2HCKA 1VQKQ 3HRTA 2HBWA 2PVGB 2E6ZA 1OX9A 2RHUA 2DBMA 1D0YA 1M30A 4ANJA 1K73R 2H8HA 4OGCA 2XDDA 1N8RU 1VQOT 2OAUA 1OZ2A 5IHNA 4QQ6A 2XIDA 3RUXA 5CK9A 4HXJA 4JZ4A 3MPUB 1ZBXA 3OBYA 3JCMe 2C0OA 3CCUQ 3A8MB 2LRQA 2Y4YA 3WXMB 3X20B 3FC3A 1NM7A 1H8KA 2BE7D 1YWOA 2HQHA 3V8LA 4L5GA 1VQLT 2BIVA 4F16A 4OB1B 1KC8U 1XTDA 3JSCA 3OYYA 3RNJA 4R0KA 2QQBA 2RQWA 2W0ZA 2JZ2A 4DQ2A 4JLIA 4GLMA 2VXFA 2DF6A 4GLKA 4QW2A 5GMKi 2K3YA 2P0QA 2E65A 1YITT 2KNBB 1G5VA 4OMLA 4JRPA 1PRMC 3MCAB 5CQYA 1A0NB 5LJ5h 3CCQT 4BUGA 3KBGA 3M0QA 1JBMA 2QGFB 4BY6C 2NYSA 3R6OA 1TG0A 2JS2A 2O88A 5GANh 3JB9G 4XTUA 3QXEB 2CSIA 2PNIA 4OF1A 2CUBA 1N5ZA 4N0AA 3RMQA 3S6WA 3VYHB 4C8QA 5A0DA 1SKUB 1OU9A 4JZ3A 2MCNA 1W4SA 3M0PA 2EJGA 1OU8A 4C0GA 1BCMA 4N4IA 1JXMA 1GBRA 2E41A 5M9OA 1YJWT 1YJ9A 2COWA 2R58A 2XI9A 2JW4A 5FU6B 1Q81C 5AT1B 4FU6A 2FRYA 4PJMA 2VASA 2KE9A 1IREB 1U1SA 4P5NA 3QYGB 1IO6A 2AT1B 2LVMA 5KYYA 1WFWA 1TOVA 4IUPA 4E7LA 1HYOA 1K73U 4A63B 5KYXA 5LJ5g 1AWWA 3TCJA 2FPDA 1OEBA 1RADB 4FT2A 3EHRA 2RMOA 5GJWB 4LUDA 4FL6A 3L2UA 2A3LA 3JCMW 5LJ5d 4MZTA 4M7DC 3LX7A 1TUDA 1TXQA 5GANg 3G6EA 2DILA 1YIJT 4XAXB 3Q1JA 4E7ZA 4M77D 1B3QA 4C92E 3CCST 3G6EQ 3M0UA 1ABQA 5GANd 1K9AA 2RJFA 2DTHA 2EGAA 1W6XA 5IAYA 2OI3A 2LJ1A 3O5ZA 5D7UA 2DL3A 4ZGEB 1AZEA 1YI2T 2K57A 2KYMA 1B07A 1UJYA 2W10A 4C5IA 2HKQB 2P0KA 3M0TA 3CMAA 2CKKA 1OI1A 3OMCA 2A37A 1VQ8A 1YBYA 3MEVA 2MWPA 4MZMA 1RUWA 4EMKA 3J81E 2YLBA 3BDUA 1UGSB 4IUUA 3C95A 2AHJB 2MI6A 3THKA 1VQPT 4F04B 5KE3A 3EFOA 2QI2A 1UJ0A 2YLCA 3CEYA 4J9CA 3TEEA 1WJRA 2KROA 1OULA 4GBQA 1H3ZA 4OVAA 5EG2A 3VJPA 1QVFP 4J9IA 1C0MA 2LCLA 1PG5B 1VQ9T 3MP1A 3I55Q 1SRLA 2AIRB 1K9MC 2EQMA 4M75D 2LT1A 2O31A 2CZ6B 3MJXA 3E9FA 4XTVA 4PFZA 2E4HA 4M7AD 1BK2A 4C92F 1K76A 4XTZA 5LJ3h 3VV0A 4F7UE 1BI0A 1PKTA 2O2OA 3PGGA 3PTAA 5IH2A 3CCRQ 1SG5A 2K3XA 2A7YA 2VV5A 3JCMh 1JRIA 1WXUA 2KI7A 3EAEA 3JCMQ 3OS1A 2LCSA 1AEYA 3EG2A 1VIEA 4JJBA 3MEUA 4M7DD 3UT1A 2GFUA 1BI2A 2QEXT 2DL8A 3J80E 4YTLA 2EBPA 2QYZA 4B9WA 2NUTA 1VQKT 4BD3A 3F70A 4R56A 3M0SA 1QP3A 1WXTA 4EMHA 2COZA 2HSPA 2BZXA 2E5KA 2M51A 4Z89A 5GAN7 1ZSZA 2VC8A 3CCVA 1T0JA 3H8ZA 3M57A 1EX4A 1D09B 2RI2A 2RK1A 4C8QE 4PJOE 2DZ9A 4XU3A 3A8OB 2D6FA 2XMFA 4RTTA 1PSFA 2DERA 5KYNA 1NE8A 2I2LA 4FW2A 2HDAA 1RAFB 5LJ3g 1NYGA 3IQLA 2E6NA 1QLYA 2CUDA 2JN0A 4Z88A 5DY9A 1TH7A 4F7UF 2BZYA 5LJ3d 3UF4A 2DEQA 3TU4K 1VQOQ 3L2QA 4BACA 3JCMc 2H3EB 2KQWA 3JCMd 3VS4A 3FB9A 2X3XD 3I9QA 1ZSZB 1TTHB 5HY6A 3ULRB 1JO8A 2ED0A 4KUIA 5I11A 2QQSA 1VQLQ 1RLQC 4RTUA 1ARKA 2LC4A 1U5SA 1IRXA 3MP8A 3UA7A 3S3MA 1QCFA 2RO0A 3OW2A 1ZX6A 2K7AA 4D8KA 4M78E 2E3HA 3UDCA 1YITQ 3INZA 1VQNA 4RG2A 1UFFA 1X01A 4C8QF 8ATCB 1Q7YC 4PJOF 1ZLMA 3OW2S 3CCQQ 3G1JA 3QHSA 1X69A 2XG8D 1YJ9T 3R6NA 4J6YA 3TSWA 4QVZA 5GAMe 3EG0A 2DPPB 5KYWA 3P8HA 3QG1A 2DXBA 4PKCC 2X3WD 1PKSA 2RHXA 3EGUA 4L6V5 3BE3A 3QDRB 2K2MA 5IHKA 3H6ZA 3LW5E 4M77G 1S72A 3VYGA 4IKFA 3PIPA 2MOXA 4FYVB 3TSZA 5KE2A 1D0XA 1R0BG 1YJWQ 3QJ6A 2LTOA 2DA9A 2GNCA 4Z8AA 5IN1A 3G6ET 3FJ5A 2KBTA 3QPHA 3QZ5B 1VQ5A 4C5EA 2EQKA 2FZKB 1AHJB 5D6WA 1VQ5Q 3A8GB 3L2ZA 2ECZA 4RTZA 5KYWB 3OYCA 2EGEA 2L8DA 4M78F 1I81A 3EG9A 2EJ9A 1S1NA 1ZBJA 2WSEE 5CO7A 4KGZB 2XICA 1Y07A 3O8VA 1NLOC 2FYKA 3HPWA 3CC7A 2AKKA 1W1FA 2JVVA 1M2VA 2QQAA 3LH0A 3CMAT 1M27C 2RM4A 2EPDA 1RI9A 1I07A 1K8AC 2LX9A 4J9EA 1VQ8T 3CC7Q 1Q86C 4ESRA 5IXFA 1JJ2A 2P84A 2RQVA 2KRSA 5FW9A 3CCSQ 4M75G 3SFMA 4LN2A 1N8RR 4FIBA 2YUQA 3JCMV 2P4RA 3M9QA 4M7AG 2E10A 3PVLA 2A36A 1JJ2S 4WCIA 2KRNA 1RAAB 5LJ5f 2GCXA 1BBZA 1G3SA 2LJ0A 1JB0E 2EYWA 3RIRA 3JCMP 3I55T 3QBYA 2IPOB 1GCQC 5GANf 1UG1A 1K0SA 1VQ6A 2EW3A 1Q82U 3L2RA 1KHCA 2O01E 1M2VB 2V8JA 3ZEHA 1E6HA 1WQ7A 4FSXA 5I22A 1HXDA 2RNAA 5I2SA 3FJPA 5GAN6 2RHYA 3SWNA 3X28B 4A4EA 1C1AA 3JB9I 2LQNA 4D8DA 4C92A 3PNWC 2NUZA 1B34B 2RB6A 1VQ9Q 1K4US 2JM8A 1M90R 4NS5A 3ZFJA 3U23A 4RG8A 1Z9QA 2RHIA 1MUZA 2X4YA 4XK8E 2FO0A 1RABB 1UEBA 4J9FA 2RK2A 4C0DB 1QWEA 3CCVT 3RKWA 2P4TA 1UECA 3PIOA 3TVTA 1TUGB 3L42A 4LD6A 1AZGB 4IURA 2LNHB 3T9NA 4NL2A 1PC0A 5GAN5 1WHGA 1WYXA 2EYZA 3SWNB 2RN8A 3VS5A 4LDXA 2HQEA 2DE0X 1AWOA 4RMOA 2IVWA 2K79A 5FWBA 3M59A 2CS7A 3FRNA 4HA8A 3OSSC 2YUOA 2DL4A 2LZ6B 1LNXA 3QWYA 1X27A 1R0CB 3CC2A 2A08A 3UPUA 2K5FA 4ZGDB 1OV3A 2FEIA 1KQ1A 3ME9A 1YCSB 1Y71A 1V1CA 2ESWA 5GAMh 5IHIA 2EQJA 3OW2P 2KT1A 4QQGA 3GNGA 2XD0A 2JTMA 4F7UA 2RI5A 2BKDN 2QASA 4AFZC 4E7JA 3NTIA 1D1BA 1FXXA 4N4HA 4M77C 3CCMA 2AZSA 5HKCA 3X26B 1M1GA 3ASKA 4NL3A 4Y92A 1U1TA 3FIFA 1VUBA 1M1KU 2V26A 2R57A 1W2BA 4EIKA 1I1JA 4ME7A 1VQNT 4M7DE 3CCJA 2GQIA 1IGUA 3UA6A 3V8KA 5GAOp 1KK7A 1WNLA 1XOVA 1W2BS 1H3HA 1YFNA 3SEMA 1I5LA 2J6FA 1NJIR 4A4KA 2RJEA 2QQ9A 5LJ3f 3VU3C 2EJFA 1M90U 1E7OA 1TU0B 4PJOA 4KUDK 1YNZA 4OGEA 4F7UB 1PD0A 4LD9K 1Q95G 2XU8A 4A4GA 1F1BB 1VIFA 5GAMg 1G8XA 2CDTA 4PL6A 2RD1A 1S72T 4MDXA 1KD1U 3LWHA 2O9SA 1X43A 4J8OA 2ZZDA 2PU9B 3CCEA 2LT4A 1PWTA 1PD1A 2QA4A 1LOJA 2E3IA 5GMKe 2DM1A 5GAMd 1WHKA 2DL7A 4M75C 1YJ9Q 1MMDA 4II1A 3VS2A 1X6BA 2QA4Q 1OPKA 4FW1A 2E12A 4M7AC 1AVZC 1WPYA 1VQ5T 4OMMA 1G3TA 2FL7A 2HQXA 2J6OA 2CP3A 4N4GA 4AFQC 2EWNA 1SPKA 3VS1A 5CAIA 1JJ2P 2A28A 4BE1A 4M7DF 3VUZA 4C8QB 5C0MA 3GOXA 4PJOB 1TUCA 2PQWA 2HAXA 5GAN8 1R77A 4F14A 4AG2C 2ABLA 3CC7T 1CSKA 4IUQA 1VYUA 1OZ3A 2OJ2A 3I5RA 1N9RA 1YHQA 1ZUYA 4M78A 2C06A 3VRZA 3HTRA 2JJ9A 2FZGB 1YHQQ 1MV3A 2QQRA 2RI3A 4ZTFA 1NBEB 1D0ZA 4RKUE 2QGGA 4FYWB 4J83A 4AG1C
chains in the Genus database with same CATH topology
2BZYA 3QWXX 3UF4A 1NYFA 2QDLA 1GL5A 1FYNA 1UUEA 3VS4A 4OMQA 2X3XD 2M0YA 2FPEA 2AKLA 3I9QA 1H92A 2LMJA 2YT6A 3ULRB 2KR3A 1JO8A 1WA7A 2ED0A 1Z9ZA 5I11A 1YWPA 2DJQA 4HVUA 2JTEA 2YDLA 1JXOA 4RTVA 1RLQC 4RTUA 1ARKA 1JU5C 4LNPA 1U5SA 2D8JA 5L23A 1GRIA 2BTTA 3UA7A 1W70A 4K11A 1QCFA 2DYBA 4M4ZA 2AK5A 3REAB 3JV3A 1ZX6A 3GBQA 1ABOA 3KFVA 2K7AA 4D8KA 2L3PA 3VS3A 1UFFA 1HSQA 2F2VA 1ZLMA 2F2XA 1SHGA 4LE9A 1RLPC 3EG1A 1X69A 2JT4A 3I5SA 2GBQA 2RQRA 3R6NA 3CQTA 3H41A 3TSWA 2L3QA 3EG0A 2D0NA 1SRMA 1BU1A 1HJDA 1UGVA 2X3WD 4JPBW 3H0IA 1PKSA 1VYVA 4F17A 3EGUA 2KT8A 4RUGA 2K3BA 2EKHA 4RTXA 2AZVA 2YUNA 2K2MA 5IHKA 2LQWA 4CC7A 2YUPA 4FSSA 2EGCA 3C0CA 4RTWA 2L2PA 2C0TA 2MOXA 3H0HA 2K6DA 2SEMA 1UDLA 3TSZA 3NMZC 4KRTA 2CH4A 2SRCA 4ZNXA 1WLPB 2CSQA 3NPFA 3PVQA 1AOJA 2FRWA 2KYBA 3RBBB 2DA9A 2GNCA 4Z8AA 3FJ5A 4IIMA 2KBTA 1WI7A 4RTYA 2DNUA 4CC3A 3ZL7C 4J9BA 5GJVB 2DX1A 3NHNA 1SSHA 2C0IA 2ECZA 3A98A 4OMPA 1J3TA 4RTZA 2HCKA 2BZ8A 2EGEA 2VKNA 2HBWA 2CT4A 1NEGA 1NG2A 2DBMA 1M30A 1K0XA 1S1NA 1ZBJA 2EVRA 2H8HA 1KSWA 3VS0A 1NLOC 5IHNA 2ROTA 2AKKA 2ENMA 1W1FA 4HXJA 4JZ4A 1M27C 2GTOA 2EPDA 1RI9A 1I07A 3VRYA 4J9EA 2C0OA 4ESRA 5IXFA 1LCKA 2VVKA 2RQVA 2KRSA 5FW9A 1NM7A 1H8KA 1YWOA 4LN2A 4F16A 2YUQA 1FMKA 1YP5A 1KFZA 1AD5A 3RNJA 2P4RA 4R0KA 2RQWA 2W0ZA 3PVLA 2A36A 4WCIA 1U06A 2KRNA 2JMAA 2KRMA 1BBZA 2LJ0A 4GLMA 2DF6A 1T0HA 2EYWA 1JQQA 1GCQA 2KNBB 1GBQA 2YSQA 4OMLA 3REBB 1X6GA 2JXBA 1GCQC 1PRMC 1SEMA 1A0NB 1UG1A 2DMOA 4OMNA 1K0SA 1BB9A 3VS6A 3M0QA 4DEXA 2EW3A 2DVJA 3PE0A 1PRLC 1WIEA 2DRMA 1M3CA 1TG0A 1E6HA 2JS2A 2O88A 5I22A 2JM9A 2RNAA 2KGTA 1UHCA 2KEAA 1GFCA 1EFNA 2CSIA 2PNIA 2CUBA 1KIKA 1N5ZA 1Y0MA 3UATA 2LX7A 4IIOA 4E6RA 1K1ZA 2LQNA 4D8DA 1JEGA 1SHFA 2NUZA 4JZ3A 2MCNA 1NEBA 3M0PA 1K4US 1T3SA 2JM8A 2F2WA 1ZSGA 3EHQA 1JXMA 1GBRA 2VWFA 1QWFA 1M3AA 1PNJA 2CREA 4OMOA 3U23A 4DEYA 1Z9QA 2JW4A 1MUZA 1M3BA 2FO0A 2RPNA 2V1RA 4J9FA 1HD3A 1QWEA 2FRYA 2KE9A 5ECAA 1UECA 1IO6A 3TVTA 2HEQA 2JS0A 1AZGB 1WFWA 2LNHB 3VS7A 2DL5A 4A63B 1AWWA 4HVVA 2FPDA 1OEBA 2LJ3A 2PZ1A 3EHRA 1UHFA 2RMOA 5GJWB 4LUDA 1G2BA 2DBKA 2MIOA 4QT7A 1WYXA 2EYZA 2OAWA 3I35A 2RN8A 3M0RA 3VS5A 2DE0X 1AWOA 3EG3A 2O9VA 2K79A 5FWBA 1TUDA 2YUOA 2DL4A 2LZ6B 1I0CA 2DILA 3LH5A 3QWYA 1X27A 1E6GA 2A08A 1GCPA 2J06A 2J6KA 1B3QA 3M0UA 1ABQA 1OV3A 2FEIA 1G83A 1K9AA 1YCSB 4CC4B 1V1CA 2G6FX 2ESWA 5IHIA 2EGAA 1W6XA 2KT1A 1QKXA 2OI3A 2KXDA 3SHWA 1OPLA 2LJ1A 3O5ZA 2DL3A 2J7IA 1AZEA 4CC2A 2LP5A 2KYMA 4AFZC 1AWJA 1WXBA 2EYXA 5HCKA 1B07A 1AWXA 1UJYA 2W10A 5IXBA 3M0TA 2RQUA 2ED1A 2AZSA 4AFUC 1PHTA 5EC7A 2DLPA 2A37A 4Y92A 2V1QA 4HCKA 1RUWA 2J05A 2PTKA 4JJDA 1CKBA 4EIKA 1I1JA 1OOTA 3THKA 1ZUUA 2GQIA 2EYYA 2K9GA 3UA6A 4LUEA 1UJ0A 2FPFA 4J9CA 1XOVA 1VA7A 2KROA 1H3HA 4GBQA 3SEMA 2EQIA 1ZUKA 1X2QA 2J6FA 4J9DA 4J9IA 2DRKA 1CKAA 1T3LA 1VYTA 5FWCA 1E7OA 1SRLA 2KXCA 2O31A 1YNZA 1BK2A 4HVWA 1K76A 1QKWA 2CDTA 1PKTA 2O2OA 2FG0A 5IH2A 2O9SA 1X43A 1WDXA 1PWTA 1WXUA 1X2KA 2DM1A 2LCSA 1AEYA 3EG2A 2DL7A 4JJBA 4AFSC 2CT3A 3VS2A 1NLPC 1X6BA 2DL8A 1OPKA 1YN8A 2RQTA 1AVZC 4OMMA 2EBPA 1MV0B 3NGPA 2IIMA 2J6OA 2NWMA 3M0SA 2ROLA 4AFQC 2L3SA 1WXTA 2HSPA 4ORZA 1SPKA 2D1XA 3VS1A 2BZXA 2A28A 2E5KA 2M51A 4Z89A 4J9GA 2I0NA 2JMCA 1T0JA 1TUCA 4JJCA 4F14A 4AG2C 2ABLA 1CSKA 1U3OA 2RF0A 1VYUA 2XMFA 4RTTA 2GGRA 2OJ2A 3I5RA 1ZUYA 1WX6A 2B86A 1Y57A 3H0FA 1UE9A 4J9HA 2L0AA 3VRZA 2D8HA 2HDAA 2GTJA 4X1VA 1NYGA 1MV3A 3IQLA 1QLYA 1UTIA 2CH4W 2CUDA 4Z88A 1M8MA 1KJWA 1GFDA 4AG1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZY A;  3QWX X;  3UF4 A;  1NYF A;  2QDL A;  1GL5 A;  1FYN A;  1UUE A;  3VS4 A;  4OMQ A;  2X3X D;  2M0Y A;  2FPE A;  2AKL A;  3I9Q A;  1H92 A;  2LMJ A;  2YT6 A;  3ULR B;  2KR3 A;  1JO8 A;  1WA7 A;  2ED0 A;  1Z9Z A;  5I11 A;  1YWP A;  2DJQ A;  4HVU A;  2JTE A;  2YDL A;  1JXO A;  4RTV A;  1RLQ C;  4RTU A;  1ARK A;  1JU5 C;  4LNP A;  1U5S A;  2D8J A;  5L23 A;  1GRI A;  2BTT A;  3UA7 A;  1W70 A;  4K11 A;  1QCF A;  2DYB A;  4M4Z A;  2AK5 A;  3REA B;  3JV3 A;  1ZX6 A;  3GBQ A;  1ABO A;  3KFV A;  2K7A A;  4D8K A;  2L3P A;  3VS3 A;  1UFF A;  1HSQ A;  2F2V A;  1ZLM A;  2F2X A;  1SHG A;  4LE9 A;  1RLP C;  3EG1 A;  1X69 A;  2JT4 A;  3I5S A;  2GBQ A;  2RQR A;  3R6N A;  3CQT A;  3H41 A;  3TSW A;  2L3Q A;  3EG0 A;  2D0N A;  1SRM A;  1BU1 A;  1HJD A;  1UGV A;  2X3W D;  4JPB W;  3H0I A;  1PKS A;  1VYV A;  4F17 A;  3EGU A;  2KT8 A;  4RUG A;  2K3B A;  2EKH A;  4RTX A;  2AZV A;  2YUN A;  2K2M A;  5IHK A;  2LQW A;  4CC7 A;  2YUP A;  4FSS A;  2EGC A;  3C0C A;  4RTW A;  2L2P A;  2C0T A;  2MOX A;  3H0H A;  2K6D A;  2SEM A;  1UDL A;  3TSZ A;  3NMZ C;  4KRT A;  2CH4 A;  2SRC A;  4ZNX A;  1WLP B;  2CSQ A;  3NPF A;  3PVQ A;  1AOJ A;  2FRW A;  2KYB A;  3RBB B;  2DA9 A;  2GNC A;  4Z8A A;  3FJ5 A;  4IIM A;  2KBT A;  1WI7 A;  4RTY A;  2DNU A;  4CC3 A;  3ZL7 C;  4J9B A;  5GJV B;  2DX1 A;  3NHN A;  1SSH A;  2C0I A;  2ECZ A;  3A98 A;  4OMP A;  1J3T A;  4RTZ A;  2HCK A;  2BZ8 A;  2EGE A;  2VKN A;  2HBW A;  2CT4 A;  1NEG A;  1NG2 A;  2DBM A;  1M30 A;  1K0X A;  1S1N A;  1ZBJ A;  2EVR A;  2H8H A;  1KSW A;  3VS0 A;  1NLO C;  5IHN A;  2ROT A;  2AKK A;  2ENM A;  1W1F A;  4HXJ A;  4JZ4 A;  1M27 C;  2GTO A;  2EPD A;  1RI9 A;  1I07 A;  3VRY A;  4J9E A;  2C0O A;  4ESR A;  5IXF A;  1LCK A;  2VVK A;  2RQV A;  2KRS A;  5FW9 A;  1NM7 A;  1H8K A;  1YWO A;  4LN2 A;  4F16 A;  2YUQ A;  1FMK A;  1YP5 A;  1KFZ A;  1AD5 A;  3RNJ A;  2P4R A;  4R0K A;  2RQW A;  2W0Z A;  3PVL A;  2A36 A;  4WCI A;  1U06 A;  2KRN A;  2JMA A;  2KRM A;  1BBZ A;  2LJ0 A;  4GLM A;  2DF6 A;  1T0H A;  2EYW A;  1JQQ A;  1GCQ A;  2KNB B;  1GBQ A;  2YSQ A;  4OML A;  3REB B;  1X6G A;  2JXB A;  1GCQ C;  1PRM C;  1SEM A;  1A0N B;  1UG1 A;  2DMO A;  4OMN A;  1K0S A;  1BB9 A;  3VS6 A;  3M0Q A;  4DEX A;  2EW3 A;  2DVJ A;  3PE0 A;  1PRL C;  1WIE A;  2DRM A;  1M3C A;  1TG0 A;  1E6H A;  2JS2 A;  2O88 A;  5I22 A;  2JM9 A;  2RNA A;  2KGT A;  1UHC A;  2KEA A;  1GFC A;  1EFN A;  2CSI A;  2PNI A;  2CUB A;  1KIK A;  1N5Z A;  1Y0M A;  3UAT A;  2LX7 A;  4IIO A;  4E6R A;  1K1Z A;  2LQN A;  4D8D A;  1JEG A;  1SHF A;  2NUZ A;  4JZ3 A;  2MCN A;  1NEB A;  3M0P A;  1K4U S;  1T3S A;  2JM8 A;  2F2W A;  1ZSG A;  3EHQ A;  1JXM A;  1GBR A;  2VWF A;  1QWF A;  1M3A A;  1PNJ A;  2CRE A;  4OMO A;  3U23 A;  4DEY A;  1Z9Q A;  2JW4 A;  1MUZ A;  1M3B A;  2FO0 A;  2RPN A;  2V1R A;  4J9F A;  1HD3 A;  1QWE A;  2FRY A;  2KE9 A;  5ECA A;  1UEC A;  1IO6 A;  3TVT A;  2HEQ A;  2JS0 A;  1AZG B;  1WFW A;  2LNH B;  3VS7 A;  2DL5 A;  4A63 B;  1AWW A;  4HVV A;  2FPD A;  1OEB A;  2LJ3 A;  2PZ1 A;  3EHR A;  1UHF A;  2RMO A;  5GJW B;  4LUD A;  1G2B A;  2DBK A;  2MIO A;  4QT7 A;  1WYX A;  2EYZ A;  2OAW A;  3I35 A;  2RN8 A;  3M0R A;  3VS5 A;  2DE0 X;  1AWO A;  3EG3 A;  2O9V A;  2K79 A;  5FWB A;  1TUD A;  2YUO A;  2DL4 A;  2LZ6 B;  1I0C A;  2DIL A;  3LH5 A;  3QWY A;  1X27 A;  1E6G A;  2A08 A;  1GCP A;  2J06 A;  2J6K A;  1B3Q A;  3M0U A;  1ABQ A;  1OV3 A;  2FEI A;  1G83 A;  1K9A A;  1YCS B;  4CC4 B;  1V1C A;  2G6F X;  2ESW A;  5IHI A;  2EGA A;  1W6X A;  2KT1 A;  1QKX A;  2OI3 A;  2KXD A;  3SHW A;  1OPL A;  2LJ1 A;  3O5Z A;  2DL3 A;  2J7I A;  1AZE A;  4CC2 A;  2LP5 A;  2KYM A;  4AFZ C;  1AWJ A;  1WXB A;  2EYX A;  5HCK A;  1B07 A;  1AWX A;  1UJY A;  2W10 A;  5IXB A;  3M0T A;  2RQU A;  2ED1 A;  2AZS A;  4AFU C;  1PHT A;  5EC7 A;  2DLP A;  2A37 A;  4Y92 A;  2V1Q A;  4HCK A;  1RUW A;  2J05 A;  2PTK A;  4JJD A;  1CKB A;  4EIK A;  1I1J A;  1OOT A;  3THK A;  1ZUU A;  2GQI A;  2EYY A;  2K9G A;  3UA6 A;  4LUE A;  1UJ0 A;  2FPF A;  4J9C A;  1XOV A;  1VA7 A;  2KRO A;  1H3H A;  4GBQ A;  3SEM A;  2EQI A;  1ZUK A;  1X2Q A;  2J6F A;  4J9D A;  4J9I A;  2DRK A;  1CKA A;  1T3L A;  1VYT A;  5FWC A;  1E7O A;  1SRL A;  2KXC A;  2O31 A;  1YNZ A;  1BK2 A;  4HVW A;  1K76 A;  1QKW A;  2CDT A;  1PKT A;  2O2O A;  2FG0 A;  5IH2 A;  2O9S A;  1X43 A;  1WDX A;  1PWT A;  1WXU A;  1X2K A;  2DM1 A;  2LCS A;  1AEY A;  3EG2 A;  2DL7 A;  4JJB A;  4AFS C;  2CT3 A;  3VS2 A;  1NLP C;  1X6B A;  2DL8 A;  1OPK A;  1YN8 A;  2RQT A;  1AVZ C;  4OMM A;  2EBP A;  1MV0 B;  3NGP A;  2IIM A;  2J6O A;  2NWM A;  3M0S A;  2ROL A;  4AFQ C;  2L3S A;  1WXT A;  2HSP A;  4ORZ A;  1SPK A;  2D1X A;  3VS1 A;  2BZX A;  2A28 A;  2E5K A;  2M51 A;  4Z89 A;  4J9G A;  2I0N A;  2JMC A;  1T0J A;  1TUC A;  4JJC A;  4F14 A;  4AG2 C;  2ABL A;  1CSK A;  1U3O A;  2RF0 A;  1VYU A;  2XMF A;  4RTT A;  2GGR A;  2OJ2 A;  3I5R A;  1ZUY A;  1WX6 A;  2B86 A;  1Y57 A;  3H0F A;  1UE9 A;  4J9H A;  2L0A A;  3VRZ A;  2D8H A;  2HDA A;  2GTJ A;  4X1V A;  1NYG A;  1MV3 A;  3IQL A;  1QLY A;  1UTI A;  2CH4 W;  2CUD A;  4Z88 A;  1M8M A;  1KJW A;  1GFD A;  4AG1 C; 
#chains in the Genus database with same CATH topology
 5KYY B;  4ZN3 A;  2D0Q B;  4LDV A;  5KYX B;  1NYF A;  4HCZ A;  1FYN A;  4XU2 A;  4RCC A;  2PUK B;  5CKE A;  1R8O B;  3CMA Q;  2FPE A;  2AKL A;  2YRV A;  1MMG A;  3M5A A;  4WTO B;  1WA7 A;  1NJI U;  1VQ8 Q;  1VQ6 T;  1YWP A;  2DJQ A;  4HVU A;  2JTE A;  4RTV A;  3A5Z B;  2HMA A;  4AMC A;  1JU5 C;  2DTI A;  2PVD B;  5L23 A;  3E19 A;  2XDB A;  1W70 A;  1NPP A;  4BE2 A;  4TVR A;  3M55 A;  3MEA A;  3DB4 A;  4M78 B;  2DYB A;  2JTF A;  3BFM A;  2AK5 A;  3JV3 A;  5GAO l;  3KFV A;  4A54 A;  2Z0W A;  2M16 A;  2F2V A;  3QUI A;  3LGL A;  2F2X A;  4LE9 A;  4OB0 B;  2JT4 A;  2RQR A;  3OA6 A;  3DLM A;  2L3Q A;  1SRM A;  1M2O A;  1HJD A;  4EMK B;  1UGV A;  3H9N A;  4JPB W;  2HSE B;  5CKF A;  4XTX A;  4F17 A;  2MK5 A;  2KT8 A;  2K3B A;  3KXT A;  4RTX A;  2AZV A;  2YUN A;  1C6V X;  3JB9 J;  4CRI A;  4EDU A;  2LQW A;  1MHN A;  3EFO B;  4MZP A;  4PLL A;  2C0T A;  3MEW A;  1MMN A;  2SEM A;  1QMC A;  2SRC A;  3MO8 A;  2CSQ A;  1TSF A;  1AOJ A;  2MWO A;  4PLI A;  2ZCF B;  3P8B B;  2EYQ A;  1XNI A;  2F5T X;  5A0L A;  3CPW A;  2ATC B;  3HHT B;  3M4G A;  3CCV Q;  3CC2 T;  4PFP A;  4CC3 A;  2JOY A;  3JCM b;  5GJV B;  3JB9 F;  4BI3 A;  4QVC A;  1J3T A;  3AT1 B;  2DET A;  3GNF B;  2CT4 A;  1NEG A;  3OYL A;  1G3Y A;  5GAM j;  1K0X A;  2GF7 A;  2EVR A;  3RKY A;  1W2B P;  1GXI E;  3HL8 A;  1QQJ A;  3VS0 A;  2DO3 A;  2ROT A;  3JCM g;  2ENM A;  5CR2 A;  2NUT B;  3CCM T;  2PVO B;  1LCK A;  2VVK A;  1I4K 1;  3G71 A;  1Q81 U;  1WJQ A;  2PUO B;  5GMK h;  1FMK A;  1YP5 A;  3QJY A;  2DJZ A;  1AD5 A;  3G71 Q;  2CP5 A;  4KBM B;  1RAG B;  1U06 A;  2JMA A;  2KRM A;  2VYT A;  1RI0 A;  3MHX A;  3QSU A;  3REB B;  3ZBD A;  1M4Z A;  3JRZ A;  1X6G A;  3OYN A;  5KCH A;  1SEM A;  4XTW A;  5FU7 B;  5FRO A;  3OYI A;  5FU6 C;  4OMN A;  1BB9 A;  5CVI A;  3VS6 A;  4JDS A;  4Q5W A;  3OYF A;  2CZ7 B;  3M56 A;  3PE0 A;  1PRL C;  1WGS A;  1WIE A;  1QVG A;  1VQN Q;  1VQM A;  2OTL A;  2JM9 A;  2EAY A;  2KGT A;  4DOW A;  1GFC A;  1EFN A;  1SSF A;  3CCE T;  2MYS A;  4AT1 B;  1QVG S;  3UAT A;  2QA4 T;  4E6R A;  2OTL Q;  7AT1 B;  1K1Z A;  1Q82 R;  1M9S A;  4N0A C;  3NFC A;  1N8R C;  2X4W A;  4C8Q C;  3KUF A;  3L2V A;  3CD6 A;  1N27 A;  1T3S A;  4B6M A;  2F2W A;  1MGQ A;  1O75 A;  4DBQ A;  5CKH A;  1QWF A;  1M3A A;  2CRE A;  4OMO A;  3CD6 Q;  1M3B A;  3OB9 A;  2DXU A;  2V1R A;  1S72 Q;  2JNG A;  1VOM A;  1HD3 A;  1OX8 A;  4BY6 B;  1KC8 C;  5HK3 A;  2M0O A;  2ZPF B;  5ECA A;  2E1H A;  2HEQ A;  2JS0 A;  3VS7 A;  2DL5 A;  4CI0 C;  4LDY A;  3CCL A;  4DBR A;  2LJ3 A;  2PZ1 A;  1YHQ T;  1ACM B;  1IHV A;  1UHF A;  2MIO A;  3WVD B;  9ATC B;  5LJ5 e;  4M7D A;  3I35 A;  2WSF E;  2L3R A;  1D1A A;  2EFI A;  5FLX E;  1D1C A;  4HT9 A;  2M1H A;  3J7A F;  5GMK l;  3N5B B;  1K9M U;  1I0C A;  5A0G A;  2M9U A;  4DBF A;  5GAM f;  2E64 A;  2DIQ A;  1WHJ A;  5GAN e;  3MET A;  1KQS A;  4X9C A;  1GCP A;  2LCC A;  2H3J A;  1G83 A;  3FLG A;  2IG0 A;  4CC4 B;  2G6F X;  1KQS S;  2K5L A;  1Q7Y R;  1SF9 A;  4GY5 A;  2LQK A;  2COY A;  1OPL A;  4FYX B;  4CC2 A;  2NLU A;  2X51 A;  2QDY B;  3JAM E;  2EYX A;  1RAE B;  3M58 A;  3DKM A;  1RAC B;  3OYA A;  2ED1 A;  2LNV A;  1PHT A;  2HKN A;  3EGX A;  5EC7 A;  2FHD A;  2DLP A;  2CYZ B;  3L1A A;  1VQ4 A;  2V1Q A;  3OMG A;  2KK4 A;  2J05 A;  2PTK A;  1KHI A;  5C6S A;  3EG9 B;  1OOT A;  1YI2 A;  4EMK C;  3V7S A;  2YRD A;  3PMT A;  3EFR A;  4C8Q D;  1VQ7 A;  4KT0 E;  3URG A;  2FVU A;  2EYY A;  3JCM J;  4PJO D;  4OP0 A;  1YJN A;  1K73 C;  4LUE A;  1RAH B;  1VQ6 Q;  3I56 A;  4DBH A;  1VQ7 Q;  1LVK A;  1ZUK A;  1X2Q A;  1M1K R;  4J9D A;  5CKD A;  1CKA A;  1O9S A;  1T3L A;  1VYT A;  5FWC A;  3I56 Q;  1TWB A;  4KGX B;  4Y91 A;  2KSS A;  2RHZ A;  1N6A A;  1LPL A;  2KAF A;  4JRQ A;  1Y7X A;  4HVW A;  3HSB A;  2K5I A;  4M77 E;  3EGX B;  5GAN 2;  4LDW A;  2DK3 A;  3HFN A;  4A4F A;  3LLR A;  3HKS A;  1X2K A;  2RJC A;  1PCX A;  5KCO A;  2DFU A;  1Y96 A;  1NLP C;  1M5Q 1;  1KD1 R;  3PFS A;  4UC4 A;  1IB8 A;  2IIM A;  3M4Y A;  1N9S A;  2NWM A;  3CXC A;  4E7I A;  2ROL A;  3SD4 A;  2L3S A;  3CME A;  1ZA1 B;  2EKO A;  4M78 D;  2I0N A;  3CME Q;  4ELY C;  8AT1 B;  3CPF A;  4C92 B;  1ZSZ C;  3HFO A;  1Q7Y U;  3EH1 A;  3GPL A;  1U3O A;  1UGR B;  2RF0 A;  4KUL A;  4JS5 A;  2GGR A;  4C5H A;  4DA4 A;  2QTV A;  3H0F A;  3CC2 Q;  1B7T A;  2L0A A;  3G71 T;  2VUB A;  4ELZ C;  1Y96 B;  2A0F B;  3CBO A;  4M75 E;  5FU7 C;  1UTI A;  2CH4 W;  5GMK j;  2DKG A;  1QCN A;  2KVQ G;  5LJ3 e;  1GFD A;  3CCU A;  4C92 G;  4M7A E;  4M77 F;  1QVG P;  4BDY A;  2DAQ A;  2DZC A;  4KGV B;  3X25 B;  2KY9 A;  3GLX A;  1UUE A;  1WZO A;  4BI4 A;  3M54 A;  2DEU A;  3CCM Q;  4OMQ A;  4J6X A;  3SB2 A;  2YT6 A;  4XTY A;  1Z9Z A;  2MMP A;  5DM7 R;  1JXO A;  4HT8 A;  3A8L B;  5DLO A;  4LNP A;  1VQM T;  2D8J A;  2OTL T;  1GRI A;  2BTT A;  2R5A A;  3CCJ Q;  4K11 A;  1V76 A;  1BIA A;  4M4Z A;  3REA B;  3S3O A;  3GBQ A;  1ABO A;  2L3P A;  4E7K A;  1FWZ A;  2QG9 B;  3JCM f;  2DD5 A;  2X4X A;  3CD6 T;  2CP2 A;  1RL2 A;  2BUD A;  1FMV A;  3CC4 A;  3I5S A;  2GBQ A;  4LXC A;  1UB4 A;  4KH0 B;  1IXD A;  3CQT A;  2K4Y A;  1K8A U;  1Q86 U;  1MMA A;  3CC4 Q;  4M75 F;  4PFO A;  3C94 A;  3CCE Q;  4RUG A;  1IHW A;  4M7A F;  5GAO m;  3RDV A;  4F7U G;  5J39 A;  1M1F A;  1ZA2 B;  2CP7 A;  2YUP A;  4FSS A;  2EGC A;  5CKB A;  3OS0 A;  1KQS P;  3QZ9 B;  3CCL T;  5J26 A;  2L2P A;  2VGM A;  2YHT A;  1PSE A;  2K2V A;  2K6D A;  2WAC A;  4XU1 A;  4KRT A;  2CH4 A;  3RKX A;  3S3N A;  4ZNX A;  2OTJ A;  3CBP A;  1WLP B;  2HD0 A;  4Y28 E;  4ZN1 A;  2OTJ Q;  1G3W A;  4IIM A;  5GAO n;  4HCB A;  3VUB A;  1AT1 B;  1PM3 A;  4RTY A;  2P0P A;  3ZL7 C;  4EMG A;  2DTO A;  4J9B A;  3ER0 A;  2DX1 A;  3NHN A;  1SSH A;  5CIU A;  2C0I A;  3A98 A;  3MP6 A;  1ZQ1 A;  5GAO r;  2BZ8 A;  4J7F A;  2VKN A;  1NG2 A;  4OB3 B;  5D6X A;  1XJW B;  4JRK A;  4IUT A;  4C8Q G;  1KSW A;  2DXC A;  4PJO G;  1BYM A;  2M02 A;  3A1P A;  5GAN 4;  2QK0 A;  2GTO A;  3VKI A;  3BW1 A;  3VRY A;  2CZ1 B;  3MKD A;  1WJS A;  1VQ4 T;  3RMS A;  2DXT A;  2B8A A;  3DLL A;  4OB2 B;  5I2M A;  1KFZ A;  4Z02 A;  2XK0 A;  3OYK A;  1FMW A;  2FZC B;  1VQ7 T;  1I5O B;  2EQU A;  2DVE A;  2ZPE B;  1YJN T;  2MAM A;  5KH6 A;  1WQW A;  3L2W A;  4MML A;  1T0H A;  1Q81 R;  1JQQ A;  3FEO A;  3I56 T;  5GAO q;  2KMT A;  1GCQ A;  5FRM A;  1GBQ A;  2YSQ A;  2JXB A;  4KH1 B;  2ZPH B;  2DMO A;  4DEX A;  2WSC E;  4BI8 B;  3OS5 A;  2DVJ A;  4C0D C;  1D3B A;  2DRM A;  3OS2 A;  1M3C A;  4HKE A;  4MMK A;  6AT1 B;  3GIB A;  3I55 A;  3CXC P;  1UHC A;  2KEA A;  3HRS A;  4PK4 A;  2KDS A;  3EGD A;  1KIK A;  1Y0M A;  3SDZ A;  4J7I A;  2LX7 A;  4IIO A;  4M78 G;  2CP0 A;  2YRC A;  2DYI A;  3SWN C;  2O4X A;  1JEG A;  2Y4X A;  2X4J A;  1UGP B;  5IT9 E;  1SHF A;  3RR6 A;  1NEB A;  4PNO A;  3CCR A;  1YCY A;  2VB6 A;  3G4S A;  4C92 C;  1ZSG A;  3EHQ A;  2VWF A;  3TRE A;  1PNJ A;  2X9H A;  5L8R E;  3QYH B;  1IGQ A;  4DEY A;  3G4S Q;  2RJD A;  3CME T;  2RPN A;  3OBW A;  1HK9 A;  2MPX C;  3V8J A;  3QO3 A;  3E9G A;  2LQ8 A;  1KQ2 A;  1D3B B;  4J5Y A;  4HVV A;  2MF2 A;  2ZPI B;  5CQX A;  4QT7 A;  1G2B A;  2DBK A;  3EGD B;  3CPW S;  3OYG A;  2OAW A;  3M0R A;  2CP6 A;  2V8K A;  2DIG A;  3EG3 A;  5HK0 A;  2L89 A;  2O9V A;  4FT4 A;  1I8F A;  2O4X B;  1Q82 C;  4E7S A;  4X34 A;  1H64 1;  3LH5 A;  2DD4 A;  3CCU T;  1E6G A;  2RA2 A;  2QTX A;  3LGF A;  2J06 A;  2J6K A;  3AHU A;  4NOY A;  3TQ7 P;  1P92 A;  1K9M R;  2XDP A;  5LL6 S;  1NPR A;  1DJ7 B;  1QKX A;  1U8R A;  4J6W A;  2KXD A;  3SHW A;  3HRU A;  4C5G A;  2J7I A;  2E5Q A;  4O5V A;  2LP5 A;  4M77 A;  1VQO A;  1AWJ A;  1WXB A;  3CCJ T;  4E47 A;  5HCK A;  1AWX A;  1X6O A;  5GMK m;  5IXB A;  2RQU A;  2Y90 A;  4AFU C;  4JUV A;  4PJL A;  4O6J A;  3QKJ A;  2HL5 C;  4HCK A;  1VQL A;  4JJD A;  2JUF A;  5LJ5 j;  1CKB A;  5GAN 3;  3OSV A;  1OYX A;  3LWI A;  4FM4 B;  2QXF A;  1ZUU A;  4BB7 A;  2K9G A;  2FPF A;  4C92 D;  2QAZ A;  1VA7 A;  2HL3 A;  4BDZ A;  3CC4 T;  3G7Z A;  2EQI A;  5GAN j;  1KG1 A;  1YIT A;  2DRK A;  1BKB A;  3A8H B;  2G3R A;  4LDU A;  3QDF A;  2HBP A;  3OYM A;  4QKU A;  4RCB A;  1VQM Q;  4WF2 A;  2R5M A;  3CCQ A;  1LJO A;  2KXC A;  3E2U A;  4M77 B;  4ZGJ B;  1WHH A;  4PJO C;  1QKW A;  1UGQ B;  2FG0 A;  1MNE A;  2NUP A;  1WDX A;  2E70 A;  4M75 A;  4C0F A;  2OTJ T;  3V7R A;  4DOV A;  3BY7 A;  2RH2 A;  4M7A A;  4AFS C;  2CT3 A;  5D6Y A;  1YN8 A;  3P8D A;  2RQT A;  3C4S A;  4BE0 A;  1XQH A;  3C12 A;  4PJN A;  5A2Q E;  1MV0 B;  2EIF A;  2F5K A;  3NGP A;  3EH2 A;  1MND A;  1YJW A;  1FX7 A;  3JB9 D;  3NTK A;  4MDW A;  2LDM A;  4ORZ A;  2D1X A;  3M53 A;  4PJJ A;  1QP2 A;  1M1K C;  3CCL Q;  4JRI A;  5FRN A;  4J9G A;  2JMC A;  2F69 A;  1NZ9 A;  2GFA A;  4JJN K;  4V2S A;  4JJC A;  2HZY A;  3D7S B;  4EPC A;  5CCA A;  4HCC A;  2ZPB B;  1BCO A;  3CBM A;  3OYB A;  1WX6 A;  2NUP B;  4X9D A;  2B86 A;  1Y57 A;  4M75 B;  5KYU A;  1UE9 A;  4J9H A;  1M90 C;  2D8H A;  4M78 C;  4QQD A;  2GTJ A;  3QII A;  4X1V A;  4FYY B;  4M7A B;  2CGH A;  1EZZ B;  3LYI A;  4VUB A;  3PMI A;  1BI3 A;  1M8M A;  1KJW A;  3OY9 A;  1YIJ A;  5I21 A;  3OYD A;  1KD1 C;  1M8V A;  3QWX X;  2ZGW A;  3CCS A;  1YIJ Q;  2QDL A;  4E7H A;  1GL5 A;  4M7D B;  1BI1 A;  1V29 B;  2M0Y A;  1WHL A;  1H92 A;  4C0Z A;  2LMJ A;  2HNI A;  2VGN A;  2L5Q A;  4FCY A;  2FB7 A;  2KR3 A;  4OMF B;  3FDR A;  5J3B A;  2VXE A;  4ATO A;  4XU0 A;  1VQ4 Q;  3X24 B;  1B34 A;  4JS4 A;  2YDL A;  4XQ3 A;  4A4H A;  4JLG A;  1YI2 Q;  1IZ6 A;  3JB9 H;  2F1L A;  3NTH A;  4D6W A;  1QCO A;  1KC8 R;  5KYU B;  1YJN Q;  4A53 A;  1OQK A;  3WVE B;  3V7C A;  2ZPG B;  4M7D G;  2XKO C;  2D9T A;  1ZHI A;  3HP9 A;  3VS3 A;  1X75 C;  1VQP A;  5AYF A;  1HSQ A;  1QW1 A;  3CCR T;  3CPW P;  3BDL A;  4ZTJ A;  3G4S T;  1SHG A;  1VQP Q;  1RLP C;  5LJ3 j;  3EG1 A;  1TS9 A;  1QVP A;  3UWN A;  4L59 A;  3H41 A;  3OYJ A;  2D0N A;  1BU1 A;  2XHC A;  1VQ9 A;  3EFS A;  3H0I A;  1VYV A;  2CZ0 B;  2ZAE A;  2YWW A;  2EKH A;  2OX7 A;  3GF5 A;  4E2F B;  3DB3 A;  3OYE A;  3E1S A;  2X35 A;  1K8A R;  1BIB A;  4CC7 A;  4B9X A;  3C0C A;  4RTW A;  1Q86 R;  3RES A;  4R55 A;  1QVF A;  3H0H A;  1UDL A;  3RER A;  3NMZ C;  3PT9 A;  1RAI B;  3JCM X;  2GQV A;  3NPF A;  3PVQ A;  5DLQ E;  2FRW A;  4IUV A;  2KYB A;  2V8I A;  3CXC S;  1NJI C;  1QVF S;  2BE9 B;  3RBB B;  2QEX A;  1WHM A;  3GP8 A;  1WI7 A;  3OYH A;  2DNU A;  1VQK A;  2QEX Q;  3OQ5 A;  1EIF A;  2YXY A;  4QVD A;  4OMP A;  2HCK A;  1VQK Q;  3HRT A;  2HBW A;  2PVG B;  2E6Z A;  1OX9 A;  2RHU A;  2DBM A;  1D0Y A;  1M30 A;  4ANJ A;  1K73 R;  2H8H A;  4OGC A;  2XDD A;  1N8R U;  1VQO T;  2OAU A;  1OZ2 A;  5IHN A;  4QQ6 A;  2XID A;  3RUX A;  5CK9 A;  4HXJ A;  4JZ4 A;  3MPU B;  1ZBX A;  3OBY A;  3JCM e;  2C0O A;  3CCU Q;  3A8M B;  2LRQ A;  2Y4Y A;  3WXM B;  3X20 B;  3FC3 A;  1NM7 A;  1H8K A;  2BE7 D;  1YWO A;  2HQH A;  3V8L A;  4L5G A;  1VQL T;  2BIV A;  4F16 A;  4OB1 B;  1KC8 U;  1XTD A;  3JSC A;  3OYY A;  3RNJ A;  4R0K A;  2QQB A;  2RQW A;  2W0Z A;  2JZ2 A;  4DQ2 A;  4JLI A;  4GLM A;  2VXF A;  2DF6 A;  4GLK A;  4QW2 A;  5GMK i;  2K3Y A;  2P0Q A;  2E65 A;  1YIT T;  2KNB B;  1G5V A;  4OML A;  4JRP A;  1PRM C;  3MCA B;  5CQY A;  1A0N B;  5LJ5 h;  3CCQ T;  4BUG A;  3KBG A;  3M0Q A;  1JBM A;  2QGF B;  4BY6 C;  2NYS A;  3R6O A;  1TG0 A;  2JS2 A;  2O88 A;  5GAN h;  3JB9 G;  4XTU A;  3QXE B;  2CSI A;  2PNI A;  4OF1 A;  2CUB A;  1N5Z A;  4N0A A;  3RMQ A;  3S6W A;  3VYH B;  4C8Q A;  5A0D A;  1SKU B;  1OU9 A;  4JZ3 A;  2MCN A;  1W4S A;  3M0P A;  2EJG A;  1OU8 A;  4C0G A;  1BCM A;  4N4I A;  1JXM A;  1GBR A;  2E41 A;  5M9O A;  1YJW T;  1YJ9 A;  2COW A;  2R58 A;  2XI9 A;  2JW4 A;  5FU6 B;  1Q81 C;  5AT1 B;  4FU6 A;  2FRY A;  4PJM A;  2VAS A;  2KE9 A;  1IRE B;  1U1S A;  4P5N A;  3QYG B;  1IO6 A;  2AT1 B;  2LVM A;  5KYY A;  1WFW A;  1TOV A;  4IUP A;  4E7L A;  1HYO A;  1K73 U;  4A63 B;  5KYX A;  5LJ5 g;  1AWW A;  3TCJ A;  2FPD A;  1OEB A;  1RAD B;  4FT2 A;  3EHR A;  2RMO A;  5GJW B;  4LUD A;  4FL6 A;  3L2U A;  2A3L A;  3JCM W;  5LJ5 d;  4MZT A;  4M7D C;  3LX7 A;  1TUD A;  1TXQ A;  5GAN g;  3G6E A;  2DIL A;  1YIJ T;  4XAX B;  3Q1J A;  4E7Z A;  4M77 D;  1B3Q A;  4C92 E;  3CCS T;  3G6E Q;  3M0U A;  1ABQ A;  5GAN d;  1K9A A;  2RJF A;  2DTH A;  2EGA A;  1W6X A;  5IAY A;  2OI3 A;  2LJ1 A;  3O5Z A;  5D7U A;  2DL3 A;  4ZGE B;  1AZE A;  1YI2 T;  2K57 A;  2KYM A;  1B07 A;  1UJY A;  2W10 A;  4C5I A;  2HKQ B;  2P0K A;  3M0T A;  3CMA A;  2CKK A;  1OI1 A;  3OMC A;  2A37 A;  1VQ8 A;  1YBY A;  3MEV A;  2MWP A;  4MZM A;  1RUW A;  4EMK A;  3J81 E;  2YLB A;  3BDU A;  1UGS B;  4IUU A;  3C95 A;  2AHJ B;  2MI6 A;  3THK A;  1VQP T;  4F04 B;  5KE3 A;  3EFO A;  2QI2 A;  1UJ0 A;  2YLC A;  3CEY A;  4J9C A;  3TEE A;  1WJR A;  2KRO A;  1OUL A;  4GBQ A;  1H3Z A;  4OVA A;  5EG2 A;  3VJP A;  1QVF P;  4J9I A;  1C0M A;  2LCL A;  1PG5 B;  1VQ9 T;  3MP1 A;  3I55 Q;  1SRL A;  2AIR B;  1K9M C;  2EQM A;  4M75 D;  2LT1 A;  2O31 A;  2CZ6 B;  3MJX A;  3E9F A;  4XTV A;  4PFZ A;  2E4H A;  4M7A D;  1BK2 A;  4C92 F;  1K76 A;  4XTZ A;  5LJ3 h;  3VV0 A;  4F7U E;  1BI0 A;  1PKT A;  2O2O A;  3PGG A;  3PTA A;  5IH2 A;  3CCR Q;  1SG5 A;  2K3X A;  2A7Y A;  2VV5 A;  3JCM h;  1JRI A;  1WXU A;  2KI7 A;  3EAE A;  3JCM Q;  3OS1 A;  2LCS A;  1AEY A;  3EG2 A;  1VIE A;  4JJB A;  3MEU A;  4M7D D;  3UT1 A;  2GFU A;  1BI2 A;  2QEX T;  2DL8 A;  3J80 E;  4YTL A;  2EBP A;  2QYZ A;  4B9W A;  2NUT A;  1VQK T;  4BD3 A;  3F70 A;  4R56 A;  3M0S A;  1QP3 A;  1WXT A;  4EMH A;  2COZ A;  2HSP A;  2BZX A;  2E5K A;  2M51 A;  4Z89 A;  5GAN 7;  1ZSZ A;  2VC8 A;  3CCV A;  1T0J A;  3H8Z A;  3M57 A;  1EX4 A;  1D09 B;  2RI2 A;  2RK1 A;  4C8Q E;  4PJO E;  2DZ9 A;  4XU3 A;  3A8O B;  2D6F A;  2XMF A;  4RTT A;  1PSF A;  2DER A;  5KYN A;  1NE8 A;  2I2L A;  4FW2 A;  2HDA A;  1RAF B;  5LJ3 g;  1NYG A;  3IQL A;  2E6N A;  1QLY A;  2CUD A;  2JN0 A;  4Z88 A;  5DY9 A;  1TH7 A;  4F7U F;  2BZY A;  5LJ3 d;  3UF4 A;  2DEQ A;  3TU4 K;  1VQO Q;  3L2Q A;  4BAC A;  3JCM c;  2H3E B;  2KQW A;  3JCM d;  3VS4 A;  3FB9 A;  2X3X D;  3I9Q A;  1ZSZ B;  1TTH B;  5HY6 A;  3ULR B;  1JO8 A;  2ED0 A;  4KUI A;  5I11 A;  2QQS A;  1VQL Q;  1RLQ C;  4RTU A;  1ARK A;  2LC4 A;  1U5S A;  1IRX A;  3MP8 A;  3UA7 A;  3S3M A;  1QCF A;  2RO0 A;  3OW2 A;  1ZX6 A;  2K7A A;  4D8K A;  4M78 E;  2E3H A;  3UDC A;  1YIT Q;  3INZ A;  1VQN A;  4RG2 A;  1UFF A;  1X01 A;  4C8Q F;  8ATC B;  1Q7Y C;  4PJO F;  1ZLM A;  3OW2 S;  3CCQ Q;  3G1J A;  3QHS A;  1X69 A;  2XG8 D;  1YJ9 T;  3R6N A;  4J6Y A;  3TSW A;  4QVZ A;  5GAM e;  3EG0 A;  2DPP B;  5KYW A;  3P8H A;  3QG1 A;  2DXB A;  4PKC C;  2X3W D;  1PKS A;  2RHX A;  3EGU A;  4L6V 5;  3BE3 A;  3QDR B;  2K2M A;  5IHK A;  3H6Z A;  3LW5 E;  4M77 G;  1S72 A;  3VYG A;  4IKF A;  3PIP A;  2MOX A;  4FYV B;  3TSZ A;  5KE2 A;  1D0X A;  1R0B G;  1YJW Q;  3QJ6 A;  2LTO A;  2DA9 A;  2GNC A;  4Z8A A;  5IN1 A;  3G6E T;  3FJ5 A;  2KBT A;  3QPH A;  3QZ5 B;  1VQ5 A;  4C5E A;  2EQK A;  2FZK B;  1AHJ B;  5D6W A;  1VQ5 Q;  3A8G B;  3L2Z A;  2ECZ A;  4RTZ A;  5KYW B;  3OYC A;  2EGE A;  2L8D A;  4M78 F;  1I81 A;  3EG9 A;  2EJ9 A;  1S1N A;  1ZBJ A;  2WSE E;  5CO7 A;  4KGZ B;  2XIC A;  1Y07 A;  3O8V A;  1NLO C;  2FYK A;  3HPW A;  3CC7 A;  2AKK A;  1W1F A;  2JVV A;  1M2V A;  2QQA A;  3LH0 A;  3CMA T;  1M27 C;  2RM4 A;  2EPD A;  1RI9 A;  1I07 A;  1K8A C;  2LX9 A;  4J9E A;  1VQ8 T;  3CC7 Q;  1Q86 C;  4ESR A;  5IXF A;  1JJ2 A;  2P84 A;  2RQV A;  2KRS A;  5FW9 A;  3CCS Q;  4M75 G;  3SFM A;  4LN2 A;  1N8R R;  4FIB A;  2YUQ A;  3JCM V;  2P4R A;  3M9Q A;  4M7A G;  2E10 A;  3PVL A;  2A36 A;  1JJ2 S;  4WCI A;  2KRN A;  1RAA B;  5LJ5 f;  2GCX A;  1BBZ A;  1G3S A;  2LJ0 A;  1JB0 E;  2EYW A;  3RIR A;  3JCM P;  3I55 T;  3QBY A;  2IPO B;  1GCQ C;  5GAN f;  1UG1 A;  1K0S A;  1VQ6 A;  2EW3 A;  1Q82 U;  3L2R A;  1KHC A;  2O01 E;  1M2V B;  2V8J A;  3ZEH A;  1E6H A;  1WQ7 A;  4FSX A;  5I22 A;  1HXD A;  2RNA A;  5I2S A;  3FJP A;  5GAN 6;  2RHY A;  3SWN A;  3X28 B;  4A4E A;  1C1A A;  3JB9 I;  2LQN A;  4D8D A;  4C92 A;  3PNW C;  2NUZ A;  1B34 B;  2RB6 A;  1VQ9 Q;  1K4U S;  2JM8 A;  1M90 R;  4NS5 A;  3ZFJ A;  3U23 A;  4RG8 A;  1Z9Q A;  2RHI A;  1MUZ A;  2X4Y A;  4XK8 E;  2FO0 A;  1RAB B;  1UEB A;  4J9F A;  2RK2 A;  4C0D B;  1QWE A;  3CCV T;  3RKW A;  2P4T A;  1UEC A;  3PIO A;  3TVT A;  1TUG B;  3L42 A;  4LD6 A;  1AZG B;  4IUR A;  2LNH B;  3T9N A;  4NL2 A;  1PC0 A;  5GAN 5;  1WHG A;  1WYX A;  2EYZ A;  3SWN B;  2RN8 A;  3VS5 A;  4LDX A;  2HQE A;  2DE0 X;  1AWO A;  4RMO A;  2IVW A;  2K79 A;  5FWB A;  3M59 A;  2CS7 A;  3FRN A;  4HA8 A;  3OSS C;  2YUO A;  2DL4 A;  2LZ6 B;  1LNX A;  3QWY A;  1X27 A;  1R0C B;  3CC2 A;  2A08 A;  3UPU A;  2K5F A;  4ZGD B;  1OV3 A;  2FEI A;  1KQ1 A;  3ME9 A;  1YCS B;  1Y71 A;  1V1C A;  2ESW A;  5GAM h;  5IHI A;  2EQJ A;  3OW2 P;  2KT1 A;  4QQG A;  3GNG A;  2XD0 A;  2JTM A;  4F7U A;  2RI5 A;  2BKD N;  2QAS A;  4AFZ C;  4E7J A;  3NTI A;  1D1B A;  1FXX A;  4N4H A;  4M77 C;  3CCM A;  2AZS A;  5HKC A;  3X26 B;  1M1G A;  3ASK A;  4NL3 A;  4Y92 A;  1U1T A;  3FIF A;  1VUB A;  1M1K U;  2V26 A;  2R57 A;  1W2B A;  4EIK A;  1I1J A;  4ME7 A;  1VQN T;  4M7D E;  3CCJ A;  2GQI A;  1IGU A;  3UA6 A;  3V8K A;  5GAO p;  1KK7 A;  1WNL A;  1XOV A;  1W2B S;  1H3H A;  1YFN A;  3SEM A;  1I5L A;  2J6F A;  1NJI R;  4A4K A;  2RJE A;  2QQ9 A;  5LJ3 f;  3VU3 C;  2EJF A;  1M90 U;  1E7O A;  1TU0 B;  4PJO A;  4KUD K;  1YNZ A;  4OGE A;  4F7U B;  1PD0 A;  4LD9 K;  1Q95 G;  2XU8 A;  4A4G A;  1F1B B;  1VIF A;  5GAM g;  1G8X A;  2CDT A;  4PL6 A;  2RD1 A;  1S72 T;  4MDX A;  1KD1 U;  3LWH A;  2O9S A;  1X43 A;  4J8O A;  2ZZD A;  2PU9 B;  3CCE A;  2LT4 A;  1PWT A;  1PD1 A;  2QA4 A;  1LOJ A;  2E3I A;  5GMK e;  2DM1 A;  5GAM d;  1WHK A;  2DL7 A;  4M75 C;  1YJ9 Q;  1MMD A;  4II1 A;  3VS2 A;  1X6B A;  2QA4 Q;  1OPK A;  4FW1 A;  2E12 A;  4M7A C;  1AVZ C;  1WPY A;  1VQ5 T;  4OMM A;  1G3T A;  2FL7 A;  2HQX A;  2J6O A;  2CP3 A;  4N4G A;  4AFQ C;  2EWN A;  1SPK A;  3VS1 A;  5CAI A;  1JJ2 P;  2A28 A;  4BE1 A;  4M7D F;  3VUZ A;  4C8Q B;  5C0M A;  3GOX A;  4PJO B;  1TUC A;  2PQW A;  2HAX A;  5GAN 8;  1R77 A;  4F14 A;  4AG2 C;  2ABL A;  3CC7 T;  1CSK A;  4IUQ A;  1VYU A;  1OZ3 A;  2OJ2 A;  3I5R A;  1N9R A;  1YHQ A;  1ZUY A;  4M78 A;  2C06 A;  3VRZ A;  3HTR A;  2JJ9 A;  2FZG B;  1YHQ Q;  1MV3 A;  2QQR A;  2RI3 A;  4ZTF A;  1NBE B;  1D0Z A;  4RKU E;  2QGG A;  4FYW B;  4J83 A;  4AG1 C; 
#chains in the Genus database with same CATH homology
 2BZY A;  3QWX X;  3UF4 A;  1NYF A;  2QDL A;  1GL5 A;  1FYN A;  1UUE A;  3VS4 A;  4OMQ A;  2X3X D;  2M0Y A;  2FPE A;  2AKL A;  3I9Q A;  1H92 A;  2LMJ A;  2YT6 A;  3ULR B;  2KR3 A;  1JO8 A;  1WA7 A;  2ED0 A;  1Z9Z A;  5I11 A;  1YWP A;  2DJQ A;  4HVU A;  2JTE A;  2YDL A;  1JXO A;  4RTV A;  1RLQ C;  4RTU A;  1ARK A;  1JU5 C;  4LNP A;  1U5S A;  2D8J A;  5L23 A;  1GRI A;  2BTT A;  3UA7 A;  1W70 A;  4K11 A;  1QCF A;  2DYB A;  4M4Z A;  2AK5 A;  3REA B;  3JV3 A;  1ZX6 A;  3GBQ A;  1ABO A;  3KFV A;  2K7A A;  4D8K A;  2L3P A;  3VS3 A;  1UFF A;  1HSQ A;  2F2V A;  1ZLM A;  2F2X A;  1SHG A;  4LE9 A;  1RLP C;  3EG1 A;  1X69 A;  2JT4 A;  3I5S A;  2GBQ A;  2RQR A;  3R6N A;  3CQT A;  3H41 A;  3TSW A;  2L3Q A;  3EG0 A;  2D0N A;  1SRM A;  1BU1 A;  1HJD A;  1UGV A;  2X3W D;  4JPB W;  3H0I A;  1PKS A;  1VYV A;  4F17 A;  3EGU A;  2KT8 A;  4RUG A;  2K3B A;  2EKH A;  4RTX A;  2AZV A;  2YUN A;  2K2M A;  5IHK A;  2LQW A;  4CC7 A;  2YUP A;  4FSS A;  2EGC A;  3C0C A;  4RTW A;  2L2P A;  2C0T A;  2MOX A;  3H0H A;  2K6D A;  2SEM A;  1UDL A;  3TSZ A;  3NMZ C;  4KRT A;  2CH4 A;  2SRC A;  4ZNX A;  1WLP B;  2CSQ A;  3NPF A;  3PVQ A;  1AOJ A;  2FRW A;  2KYB A;  3RBB B;  2DA9 A;  2GNC A;  4Z8A A;  3FJ5 A;  4IIM A;  2KBT A;  1WI7 A;  4RTY A;  2DNU A;  4CC3 A;  3ZL7 C;  4J9B A;  5GJV B;  2DX1 A;  3NHN A;  1SSH A;  2C0I A;  2ECZ A;  3A98 A;  4OMP A;  1J3T A;  4RTZ A;  2HCK A;  2BZ8 A;  2EGE A;  2VKN A;  2HBW A;  2CT4 A;  1NEG A;  1NG2 A;  2DBM A;  1M30 A;  1K0X A;  1S1N A;  1ZBJ A;  2EVR A;  2H8H A;  1KSW A;  3VS0 A;  1NLO C;  5IHN A;  2ROT A;  2AKK A;  2ENM A;  1W1F A;  4HXJ A;  4JZ4 A;  1M27 C;  2GTO A;  2EPD A;  1RI9 A;  1I07 A;  3VRY A;  4J9E A;  2C0O A;  4ESR A;  5IXF A;  1LCK A;  2VVK A;  2RQV A;  2KRS A;  5FW9 A;  1NM7 A;  1H8K A;  1YWO A;  4LN2 A;  4F16 A;  2YUQ A;  1FMK A;  1YP5 A;  1KFZ A;  1AD5 A;  3RNJ A;  2P4R A;  4R0K A;  2RQW A;  2W0Z A;  3PVL A;  2A36 A;  4WCI A;  1U06 A;  2KRN A;  2JMA A;  2KRM A;  1BBZ A;  2LJ0 A;  4GLM A;  2DF6 A;  1T0H A;  2EYW A;  1JQQ A;  1GCQ A;  2KNB B;  1GBQ A;  2YSQ A;  4OML A;  3REB B;  1X6G A;  2JXB A;  1GCQ C;  1PRM C;  1SEM A;  1A0N B;  1UG1 A;  2DMO A;  4OMN A;  1K0S A;  1BB9 A;  3VS6 A;  3M0Q A;  4DEX A;  2EW3 A;  2DVJ A;  3PE0 A;  1PRL C;  1WIE A;  2DRM A;  1M3C A;  1TG0 A;  1E6H A;  2JS2 A;  2O88 A;  5I22 A;  2JM9 A;  2RNA A;  2KGT A;  1UHC A;  2KEA A;  1GFC A;  1EFN A;  2CSI A;  2PNI A;  2CUB A;  1KIK A;  1N5Z A;  1Y0M A;  3UAT A;  2LX7 A;  4IIO A;  4E6R A;  1K1Z A;  2LQN A;  4D8D A;  1JEG A;  1SHF A;  2NUZ A;  4JZ3 A;  2MCN A;  1NEB A;  3M0P A;  1K4U S;  1T3S A;  2JM8 A;  2F2W A;  1ZSG A;  3EHQ A;  1JXM A;  1GBR A;  2VWF A;  1QWF A;  1M3A A;  1PNJ A;  2CRE A;  4OMO A;  3U23 A;  4DEY A;  1Z9Q A;  2JW4 A;  1MUZ A;  1M3B A;  2FO0 A;  2RPN A;  2V1R A;  4J9F A;  1HD3 A;  1QWE A;  2FRY A;  2KE9 A;  5ECA A;  1UEC A;  1IO6 A;  3TVT A;  2HEQ A;  2JS0 A;  1AZG B;  1WFW A;  2LNH B;  3VS7 A;  2DL5 A;  4A63 B;  1AWW A;  4HVV A;  2FPD A;  1OEB A;  2LJ3 A;  2PZ1 A;  3EHR A;  1UHF A;  2RMO A;  5GJW B;  4LUD A;  1G2B A;  2DBK A;  2MIO A;  4QT7 A;  1WYX A;  2EYZ A;  2OAW A;  3I35 A;  2RN8 A;  3M0R A;  3VS5 A;  2DE0 X;  1AWO A;  3EG3 A;  2O9V A;  2K79 A;  5FWB A;  1TUD A;  2YUO A;  2DL4 A;  2LZ6 B;  1I0C A;  2DIL A;  3LH5 A;  3QWY A;  1X27 A;  1E6G A;  2A08 A;  1GCP A;  2J06 A;  2J6K A;  1B3Q A;  3M0U A;  1ABQ A;  1OV3 A;  2FEI A;  1G83 A;  1K9A A;  1YCS B;  4CC4 B;  1V1C A;  2G6F X;  2ESW A;  5IHI A;  2EGA A;  1W6X A;  2KT1 A;  1QKX A;  2OI3 A;  2KXD A;  3SHW A;  1OPL A;  2LJ1 A;  3O5Z A;  2DL3 A;  2J7I A;  1AZE A;  4CC2 A;  2LP5 A;  2KYM A;  4AFZ C;  1AWJ A;  1WXB A;  2EYX A;  5HCK A;  1B07 A;  1AWX A;  1UJY A;  2W10 A;  5IXB A;  3M0T A;  2RQU A;  2ED1 A;  2AZS A;  4AFU C;  1PHT A;  5EC7 A;  2DLP A;  2A37 A;  4Y92 A;  2V1Q A;  4HCK A;  1RUW A;  2J05 A;  2PTK A;  4JJD A;  1CKB A;  4EIK A;  1I1J A;  1OOT A;  3THK A;  1ZUU A;  2GQI A;  2EYY A;  2K9G A;  3UA6 A;  4LUE A;  1UJ0 A;  2FPF A;  4J9C A;  1XOV A;  1VA7 A;  2KRO A;  1H3H A;  4GBQ A;  3SEM A;  2EQI A;  1ZUK A;  1X2Q A;  2J6F A;  4J9D A;  4J9I A;  2DRK A;  1CKA A;  1T3L A;  1VYT A;  5FWC A;  1E7O A;  1SRL A;  2KXC A;  2O31 A;  1YNZ A;  1BK2 A;  4HVW A;  1K76 A;  1QKW A;  2CDT A;  1PKT A;  2O2O A;  2FG0 A;  5IH2 A;  2O9S A;  1X43 A;  1WDX A;  1PWT A;  1WXU A;  1X2K A;  2DM1 A;  2LCS A;  1AEY A;  3EG2 A;  2DL7 A;  4JJB A;  4AFS C;  2CT3 A;  3VS2 A;  1NLP C;  1X6B A;  2DL8 A;  1OPK A;  1YN8 A;  2RQT A;  1AVZ C;  4OMM A;  2EBP A;  1MV0 B;  3NGP A;  2IIM A;  2J6O A;  2NWM A;  3M0S A;  2ROL A;  4AFQ C;  2L3S A;  1WXT A;  2HSP A;  4ORZ A;  1SPK A;  2D1X A;  3VS1 A;  2BZX A;  2A28 A;  2E5K A;  2M51 A;  4Z89 A;  4J9G A;  2I0N A;  2JMC A;  1T0J A;  1TUC A;  4JJC A;  4F14 A;  4AG2 C;  2ABL A;  1CSK A;  1U3O A;  2RF0 A;  1VYU A;  2XMF A;  4RTT A;  2GGR A;  2OJ2 A;  3I5R A;  1ZUY A;  1WX6 A;  2B86 A;  1Y57 A;  3H0F A;  1UE9 A;  4J9H A;  2L0A A;  3VRZ A;  2D8H A;  2HDA A;  2GTJ A;  4X1V A;  1NYG A;  1MV3 A;  3IQL A;  1QLY A;  1UTI A;  2CH4 W;  2CUD A;  4Z88 A;  1M8M A;  1KJW A;  1GFD A;  4AG1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...