1WGSA

Solution structure of the tudor domain from mouse hypothetical protein homologous to histone acetyltransferase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
133
structure length
133
Chain Sequence
b'GSSGSSGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYST histone acetyltransferase 1
publication title Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 5
structure length 133
sequence length 133
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wgsA00
3FDRA 2LRQA 3L42A 3OA6A 1N27A 2MWOA 1OZ3A 2EQJA 5KH6A 2EKOA 4C5HA 3OYGA 4BDYA 3OYNA 3CEYA 2L3RA 3H6ZA 4E7HA 1XNIA 4IUQA 4X34A 4E7KA 2RI3A 3ASKA 4BE1A 3MEVA 1OYXA 3MEWA 3L2UA 1OZ2A 3LX7A 2BUDA 3UWNA 4QVZA 3OS2A 5KE2A 2M0OA 3P8HA 4A4GA 4B9XA 2R57A 4C5EA 2GFAA 2R5MA 2VYTA 3FLGA 3FC3A 4B9WA 2XK0A 4FU6A 2LTOA 4E7LA 5KE3A 2X4XA 3E9GA 4ZTFA 3OS1A 4ZTJA 3OYHA 3PFSA 1WGSA 4QW2A 1WJRA 3L2WA 1WJQA 2EFIA 2X4YA 2K3XA 2RJEA 4IUPA 3L2QA 4QQGA 2HQXA 4IKFA 2MWPA 5D6YA 3C4SA 2IG0A 2WACA 3OYBA 4A4EA 2JZ2A 4PL6A 4C5IA 4EDUA 2QQSA 3LH0A 3OB9A 5FROA 2D9TA 1RI0A 2R5AA 3M9QA 5IAYA 4PLLA 5FRMA 4HCZA 3OMGA 3ZEHA 4IURA 4QQ6A 4IUVA 2LCCA 4L59A 3QIIA 4GY5A 4BE0A 4E7IA 2L89A 2RHXA 3P8DA 1WJSA 3LGFA 2L8DA 2RHYA 3SD4A 2BKDN 2QQRA 2EQKA 2JTFA 3KUFA 2CKKA 5KCOA 3L2RA 2F5KA 4II1A 3MO8A 4OVAA 2RO0A 3QKJA 5C6SA 3DLMA 1H3ZA 4FL6A 2X35A 2XDPA 3DB3A 3LGLA 5IN1A 3EAEA 2B8AA 2E6NA 2DIGA 5C0MA 2BIVA 3NTIA 2YRVA 4IUUA 4BACA 5M9OA 2EQMA 2M1HA 3MEUA 3DB4A 4BD3A 3OY9A 3OYFA 2GFUA 3BDLA 5J39A 4N4HA 3OMCA 4IUTA 5CIUA 2RHUA 2O4XB 2LDMA 2EQUA 4Q5WA 1G5VA 3LLRA 3O8VA 3OYIA 3PMIA 3OYKA 4BE2A 2G3RA 2M16A 2R58A 4NS5A 2RJCA 4A4FA 4QQDA 4BDZA 3H8ZA 5FRNA 2RI5A 3QJ6A 3OYCA 3MEAA 3GOXA 4N4GA 5J26A 3MP6A 3MP8A 3S3NA 2RJDA 2RHIA 3UT1A 2GF7A 1MHNA 2RJFA 3LYIA 4Z02A 3S3MA 3MP1A 2P0KA 4A4HA 4UC4A 2E5QA 5D6WA 4C5GA 5KCHA 3OYAA 2RHZA 3META 3L2VA 3NTHA 3OYLA 3QBYA 3OYMA 3Q1JA 1SSFA 3PMTA 4RG2A 2DIQA 5D6XA 3OQ5A 2PQWA 1KHCA 2O4XA 3S6WA 2FHDA 3OS0A 3OYEA 3S3OA 4E7JA 3PNWC 2HQEA 3FEOA 3ME9A 3F70A 3OYJA 4LD6A 3OYDA 2DAQA 2RI2A 2X4WA 2K3YA 4CRIA 3NTKA 2LVMA 4N4IA 4PLIA 3E9FA 2NLUA 1OI1A
chains in the Genus database with same CATH superfamily
3I9QA 1NG2A 2KI7A 2KROA 3UA7A 4A4GA 2HD0A 4XU3A 3RNJA 1VIEA 3H41A 1QWFA 2XK0A 4OMMA 4QW2A 4OMFB 2CZ6B 4PJLA 4O5VA 2VXFA 1K1ZA 1VQNQ 3M53A 2EGEA 2LQKA 3H0IA 1MMDA 3OYBA 4A4EA 4EDUA 2EQIA 3CCST 2K9GA 3M9QA 4HCKA 1XQHA 1YJWA 3BW1A 3X25B 1NPPA 1KC8R 1LPLA 2JOYA 2QA4A 2P4RA 3E19A 4OB3B 2L8DA 4F04B 3PVLA 4KT0E 1BKBA 2F5KA 2LX7A 4XU0A 5GAN5 2L2PA 5C0MA 4KRTA 5IH2A 4RUGA 3PMIA 2HSEB 2NWMA 1ACMB 4WTOB 2FZGB 3MEAA 1D1BA 2EGCA 1NEGA 2AT1B 1ZSZB 1YJWQ 1D0ZA 4J9IA 4DBQA 4MZMA 3EGDA 4M78C 1WNLA 1Z9QA 4JS4A 4LE9A 2FHDA 1ZSZC 3CCRT 5FW9A 3F70A 3CCVA 1N6AA 1T0JA 4DBFA 1RLPC 1K73R 1M2OA 1M27C 3QSUA 4XU1A 2EQJA 1B34B 4E7HA 2HDAA 2PZ1A 3V7SA 2RI3A 1BIBA 2NUPA 5GANj 4FW2A 4KUDK 3JCMV 1UJ0A 1QKWA 1B7TA 5KE2A 4HVUA 2V1QA 4E6RA 4C5EA 2R5MA 2DO3A 3M4GA 1U1TA 1NZ9A 1D09B 3VYGA 1JB0E 2KRNA 4O6JA 2DL4A 2K3XA 1U1SA 4QQGA 2WACA 1JXOA 3JCMh 4PL6A 1VQ9A 3HFNA 2A37A 2C0TA 3CCVQ 3JCMg 3H0FA 4JRIA 1WXBA 3UA6A 1PD1A 2MAMA 4JZ4A 2OI3A 4GY5A 4E7IA 3CC4A 1YP5A 2LC4A 1B3QA 3PIOA 1R0CB 2B8AA 1QKXA 2PU9B 4M75B 1GCQC 4M7DF 1Q86C 4C0ZA 2EGAA 2LT1A 5J39A 3JCMf 3PTAA 1ZHIA 2O31A 2RQTA 3RMQA 2FB7A 2QA4T 4F7UF 2DL3A 4M75C 3CC2A 1VYUA 1VQ9Q 3RKXA 2G6FX 1GXIE 1K9MC 1CKBA 2VVKA 1BI3A 2E1HA 2PVOB 1TWBA 4QVDA 2CUDA 5GAOr 4M7DG 2E10A 3CC4Q 2KQWA 5D6XA 1PG5B 2VASA 1VQOA 2O2OA 3TVTA 4F7UG 4PK4A 3WVEB 3VV0A 2X4WA 1V29B 1FMKA 2LVMA 2DYIA 2YRCA 4C92E 1ZSZA 1BB9A 3VS4A 2BE7D 4JS5A 4HCCA 1RUWA 3EFSA 4MMKA 3CC2Q 1ZSGA 1VQPA 1OZ2A 1JJ2P 3T9NA 3CCEQ 4BI8B 2ATCB 3QZ5B 3BFMA 1W70A 1B07A 1TTHB 4MZPA 3PFSA 4MDWA 3L2WA 2EFIA 3NFCA 2AIRB 2RJEA 3GBQA 2DXCA 1VQOQ 3C4SA 1B34A 4PFPA 1KFZA 2VC8A 1RI0A 1I81A 3UDCA 1I5LA 4M77E 3VKIA 2CSQA 1WHMA 3OW2S 4L59A 5GANh 1RAFB 2JS2A 1GCPA 2XKOC 1S72A 4PNOA 4WCIA 1MUZA 1LOJA 2F2WA 2X4JA 2CS7A 5GMKe 5CVIA 1OX9A 1UG1A 3NTIA 5LJ5d 1Q81R 1HXDA 5KYNA 4ZGEB 3VUBA 4C8QD 2M9UA 1QVFP 1VQKA 3CPFA 1OU9A 2Y4XA 3M55A 3O8VA 4V2SA 1YBYA 3NPFA 1GCQA 2C06A 1UB4A 3GOXA 5J3BA 5GANf 2CZ1B 2RHIA 2KBTA 3DLLA 5GAMg 3SDZA 4CC7A 4L5GA 4UC4A 2E5QA 2EBPA 3G4SQ 4M75A 1VQ7A 5I21A 2LNHB 1EZZB 3HFOA 4AT1B 1UUEA 4KGXB 5LJ5e 2ECZA 2PQWA 2YLBA 1YHQQ 3HKSA 1YNZA 3I55Q 4K11A 2XHCA 4JPBW 5A0DA 1AT1B 2A0FB 2DAQA 4JLIA 2M0YA 1YIJT 3I56A 4PLIA 1GBRA 3VS0A 1VQKQ 3L42A 5CKFA 1JEGA 2F69A 1X2QA 3RMSA 3CMAQ 3LX7A 3CXCS 2QYZA 4EIKA 1HK9A 1YN8A 1WGSA 5IXFA 1PRLC 3CBPA 2OAWA 5GAN3 1VQPT 2JM9A 1ZUUA 4RTTA 1SF9A 1ZBXA 2KT1A 4HCZA 3I56Q 2DKGA 2YRDA 1YJNQ 9ATCB 3M57A 1AOJA 2J6KA 2FZCB 4VUBA 1BI0A 1Q86U 3RKWA 2D6FA 2HKQB 4C8QB 4Y92A 5GAOm 1WQ7A 1C0MA 1TS9A 1MMAA 4C8QC 3KFVA 3CCJQ 2WSEE 4LUEA 1K9MU 3M0QA 1GL5A 5HK3A 1S72T 2RPNA 3CCLQ 3H8ZA 2BZYA 4GBQA 3QO3A 1OPLA 2FPFA 2KNBB 2RM4A 2GF7A 1MHNA 3A8HB 1A0NB 3EG3A 3RR6A 2ROTA 1NJIR 2J06A 2DIQA 1FYNA 3OS5A 4R56A 2FO0A 1WPYA 2K5LA 3VS5A 4M7AB 3KXTA 1IB8A 2RI2A 1VQLA 4JRKA 2NLUA 2YSQA 2GBQA 4PJOD 1ZUYA 1F1BB 1VQ7T 3RERA 1IREB 1O9SA 1TUGB 4EMKB 4M7AC 3JAME 1UGSB 5GJWB 5KYXB 1NLOC 4OB0B 1IZ6A 4BI3A 2YUNA 2CSIA 4B9XA 3VUZA 1OULA 2LCSA 3G1JA 4EMKC 5GMKj 1K9AA 1TU0B 4KGZB 4RTXA 3J81E 5AYFA 3THKA 1QCOA 3QDFA 3L2QA 4FIBA 3MKDA 4DBRA 2QTVA 4FCYA 2F1LA 2E3IA 3GIBA 3CCQA 2COZA 1NE8A 1R0BG 1FWZA 2E5KA 2EYZA 4PLLA 3C95A 2CP7A 2DLPA 5GANd 1ABOA 1VQLQ 1KHIA 2ZPGB 2K7AA 1AEYA 2CGHA 1MGQA 5KYWB 2QEXQ 3URGA 2WSFE 2EW3A 2CREA 4ESRA 2XDDA 3M4YA 4MDXA 4LDYA 2A36A 2WSCE 1U8RA 1UTIA 3G7ZA 1VYTA 1YI2A 3CCMT 1VQ5T 2V8IA 4IUUA 3EH2A 4BD3A 1QCFA 4J9BA 2GTOA 2QASA 3FJ5A 4QQDA 4M7DD 5GANe 3OYCA 2YUQA 1NYFA 2OX7A 1KK7A 4Z88A 5J26A 1KQ1A 2RJDA 2DVEA 4C8QA 3I5RA 1XTDA 1CKAA 3OYYA 2DMOA 2K5FA 3L2VA 3JB9H 4CI0C 3JRZA 3S6WA 1OPKA 1OQKA 4PJOB 3CPWA 2FZKB 1RAAB 1RAHB 1LCKA 2W0ZA 1ZA2B 1KSWA 2CT4A 3FDRA 1HSQA 2LRQA 2L3PA 2DEQA 2GQIA 4DEXA 1OOTA 1QVGS 4XTZA 2A28A 4PJOC 4JLGA 1QW1A 4M7DE 2QGFB 1M3BA 3L2ZA 2EYYA 2XDBA 1UHCA 2O9VA 4JRQA 2NYSA 4F7UE 4MMLA 2KAFA 4M7AA 2CDTA 3QWYA 1JRIA 2RQVA 1MV0B 1K76A 2MIOA 2KT8A 5EG2A 4JJBA 2NUZA 5D6YA 2IG0A 5CKEA 3TSZA 5A2QE 3OB9A 4EMKA 2ZPEB 1AWXA 1YITA 2L3SA 2PNIA 1RLQC 1M1GA 4FSSA 5KYXA 5IAYA 1IHVA 1SPKA 2RD1A 2AKLA 2LMJA 3V8LA 1BI1A 1SRMA 1MNEA 1VQ4T 3FRNA 4DOVA 1W4SA 2F2XA 3CCQT 2VWFA 3EAEA 3QWXX 5GMKh 1RAEB 3C94A 4RTWA 1K4US 2M1HA 3TREA 4N4HA 2LDMA 4M78E 1PD0A 2DBKA 5AT1B 1FX7A 1XOVA 2M16A 2RJCA 3GNGA 2EYWA 4XK8E 4F14A 5KYWA 3A1PA 1CSKA 4C0DB 2OAUA 1YITQ 3S3NA 1YI2T 2RJFA 3CC7T 3M5AA 2OTLA 1D1CA 4DQ2A 4P5NA 4HA8A 3R6NA 2ABLA 4C0DC 1TXQA 3X24B 4XU2A 2J6OA 3OBWA 5LJ5h 2E6ZA 2CZ0B 2Z0WA 5LJ5g 1AVZC 1UFFA 3ME9A 4Y28E 1YJ9A 4CRIA 2COYA 4NL2A 1KD1C 3OA6A 2EKOA 2AZVA 4ATOA 1BU1A 2JMCA 5HKCA 3LW5E 3X26B 1UEBA 1WLPB 1FMVA 1V76A 2GFAA 2KE9A 5LJ5f 2OTLQ 4PJOA 5I22A 2DTOA 5DY9A 1WXUA 2CP3A 4X9DA 1WJRA 1U5SA 1AZEA 5IHIA 4AG1C 1EFNA 3HSBA 2CZ7B 1QMCA 4JJNK 1X2KA 1Y96B 2K4YA 1Q95G 2HL5C 1VQNT 2DM1A 1YJ9Q 5A0GA 4FW1A 2DRKA 2HSPA 2X3XD 3ZEHA 2GTJA 1EIFA 3REBB 1W2BA 2QDLA 2DERA 3HP9A 2M02A 1I07A 2LNVA 3SD4A 4FT2A 2W10A 4OVAA 1N5ZA 2X35A 5KYUB 4C0GA 1UGRB 2RH2A 1W1FA 1R77A 2X51A 3M54A 1K8AC 5CQYA 4NL3A 3OSVA 2EQMA 4HKEA 5GAN7 3GNFB 2RHUA 2H3EB 2O4XB 2YXYA 3G71Q 2EQUA 3FJPA 1VQMQ 1AWOA 3L1AA 1YCYA 2RNAA 1X6GA 3QUIA 6AT1B 1TUDA 4N0AC 4LUDA 1WHGA 2VV5A 2CP5A 4BY6B 2XICA 5GAOl 2JM8A 2COWA 4Z89A 3WVDB 1YJWT 2YUOA 1S1NA 2GQVA 4BY6C 3PNWC 4C92D 4EMHA 4XAXB 4LD6A 1PNJA 2P0QA 2QQBA 3VRZA 1KQSP 3CCEA 2CH4A 1N27A 2J05A 2MWOA 3ULRB 3FB9A 1ZLMA 2CP6A 3MEVA 3TU4K 2JT4A 4J9CA 3VYHB 3UWNA 3P8HA 2K2VA 3MPUB 5LL6S 3EG2A 4ZTJA 2K6DA 4M77D 3V7CA 5LJ3d 4B6MA 1NBEB 1OU8A 2HBWA 1H3HA 5FROA 1M9SA 4ORZA 2BTTA 4J9GA 5FRMA 4M78F 3CBMA 3WXMB 3CCVT 1MV3A 2JUFA 3INZA 2JMAA 2DILA 3P8DA 1RAIB 3LGFA 2QDYB 2QQRA 3CCUA 1T0HA 2L5QA 4II1A 5ECAA 3DB3A 4KH0B 1Y96A 1JJ2S 3OYFA 2E4HA 2DYBA 5LJ3e 1Q86R 2ROLA 2E12A 4F16A 1TUCA 3OYKA 4M78G 3G4SA 4ZGJB 2YLCA 4GLMA 1WHHA 5GANg 3JCMJ 3QHSA 1YHQA 3LYIA 1XJWB 3MP1A 3I55A 5KYUA 2MYSA 1QP3A 3SB2A 3LH5A 5GAN8 4C92B 1VQ9T 1K9MR 2RHZA 3NMZC 1D0XA 3MCAB 1QLYA 3PMTA 4N0AA 2HQHA 2O4XA 2DTHA 3RESA 3CCUQ 1SHGA 1RAGB 2PVDB 4E7JA 1KD1U 1Q7YC 3CD6Q 1TSFA 3CC4T 4C92C 3OYJA 3JCMQ 2BE9B 3CMAA 4EPCA 2LJ3A 3OS1A 3E9FA 2J7IA 1IGQA 2Y90A 1QQJA 2Y4YA 2RK1A 1OZ3A 1QVFS 3CEYA 3FIFA 3QJYA 1X01A 1BCMA 2DL7A 2DTIA 3ASKA 1M8MA 1WHKA 3V7RA 2EJ9A 5D7UA 4M77B 3CC2T 3FLGA 2LTOA 4QVCA 2OJ2A 3OYHA 2CUBA 2DBMA 3CCET 4RCCA 4M75F 3QG1A 4IUPA 1YJNA 1Q82C 4F17A 2XD0A 4J7IA 5CO7A 4M77C 1UJYA 4C0FA 1WXTA 2HCKA 3PE0A 2LQNA 2KRMA 1VQOT 1G3YA 4NOYA 3J7AF 2EPDA 3OMGA 1VQ8Q 2K2MA 4BE0A 4FYYB 1I4K1 1K8AU 5FU7B 1E7OA 2BKDN 4DEYA 2EQKA 2JTFA 2RQUA 2JTMA 3CCJA 2JW4A 4FL6A 5IN1A 4M75G 3CCLA 4GLKA 2QXFA 1E6HA 2QAZA 4XQ3A 1M3CA 3CPWP 5FU7C 5FU6B 2KR3A 2D0NA 5CK9A 1BYMA 3QJ6A 3VRYA 4PJNA 4L6V5 1N9RA 1JQQA 3X28B 1IGUA 3CMEA 5FU6C 1M1KC 4JUVA 2E70A 2DZ9A 4AMCA 1I0CA 1K0SA 1YWPA 4J9EA 3V8KA 4RG2A 4X9CA 3J80E 4J8OA 3OQ5A 2AK5A 2YT6A 3G4ST 1WIEA 2HQEA 3EHQA 1PKTA 2YDLA 1YHQT 3M58A 3I55T 2KDSA 1O75A 3A8MB 2V26A 1AHJB 4HT9A 3OYNA 4C92A 3H6ZA 1Q82R 1IXDA 1VQKT 2RB6A 5CKBA 5GAOn 2AZSA 2KXCA 4XTUA 2K5IA 1TG0A 3GF5A 1WQWA 3VS7A 3CMEQ 3QPHA 2K57A 3CMAT 2X4XA 1GFDA 3G6EQ 4M4ZA 2ZPBB 3PT9A 1RI9A 4RMOA 5LJ3j 3I35A 2DX1A 3SWNA 4JJDA 1D3BB 2P0PA 2QEXA 5L8RE 3EG0A 4OB2B 3OW2A 4BI4A 3M0PA 2DZCA 5DM7R 2B86A 1G3TA 4LXCA 4JRPA 2EJGA 1VQ6A 4IURA 3M0RA 3VS6A 4IUVA 4M77A 2X9HA 4KBMB 1WJSA 4PFOA 1UGQB 3I56T 1YJNT 3BDUA 5C6SA 1PM3A 3M0UA 1ZUKA 4KUIA 1HJDA 2DIGA 3JB9F 3JV3A 1I5OB 2I0NA 2YRVA 5M9OA 5FRNA 2GFUA 5FWCA 4OMPA 2O01E 1M90C 1DJ7B 4HVVA 2G3RA 4QT7A 4OP0A 3OBYA 4J83A 4OGCA 4N4GA 3CCJT 5HK0A 4AG2C 4E47A 3UT1A 3KBGA 3CCLT 4Z02A 3S3MA 2FPDA 4RKUE 4A4HA 1KG1A 4AFSC 1VQ6Q 3JB9G 2QTXA 1Q7YU 3OYMA 5I11A 2OTJQ 4LNPA 3CCSA 3OYEA 3EGUA 1PC0A 1H641 1QWEA 2DD4A 4OMOA 1ZQ1A 5IT9E 4XTVA 5D6WA 1Z9ZA 2ZAEA 2FRYA 5CKHA 2D8JA 3CXCA 4BDYA 2CH4W 2MI6A 1C1AA 3HTRA 3EFOB 1PCXA 4IUQA 2CP2A 1G2BA 1W2BP 1Y07A 2L3QA 3MEWA 4RTYA 3JB9I 1U06A 2AKKA 2KYMA 4J5YA 4QVZA 3OS2A 2LQWA 2D1XA 1M4ZA 2QQ9A 1Q82U 1WFWA 2KYBA 1NEBA 2GNCA 4C8QF 3VS2A 1LJOA 3X20B 1X6BA 2BZ8A 4E7SA 1H8KA 3CCSQ 1RL2A 2HQXA 3M0SA 1UGPB 5CKDA 3TEEA 3LH0A 4BB7A 5KYYB 1KC8C 2R5AA 4PFZA 3QZ9B 1OX8A 1EX4A 4J9HA 3UF4A 2LCCA 2V8KA 3CCRA 3QIIA 1KIKA 1WHJA 2RHXA 1JO8A 1M1FA 4LD9K 4C8QG 1VQLT 3KUFA 2DL5A 2DXUA 3L2RA 1YWOA 3DLMA 4AFUC 4J6XA 4M78D 2QEXT 7AT1B 4QKUA 2DEUA 1RADB 3GLXA 2LX9A 1N9SA 3PGGA 3PIPA 1PSEA 1D3BA 2HMAA 2SRCA 3JCMW 5LJ3h 2BZXA 2PUKB 5LJ3g 4M7AF 4CC3A 2LJ0A 1G83A 3AT1B 2NUTB 1M1KU 4A4FA 1WHLA 4LDWA 1JXMA 3ER0A 2P84A 5CQXA 2FL7A 1JBMA 1SEMA 3E1SA 1T3LA 1G8XA 4RCBA 4RTZA 2LCLA 2DFUA 3CCRQ 4FM4B 4M7DB 2EYQA 5DLOA 3V8JA 5GMKm 3S3OA 5LJ3f 3HRTA 2CYZB 1WA7A 2QG9B 4DBHA 4M7AG 1K73C 1AWWA 2K3BA 1H92A 4F7UB 2XMFA 3CBOA 2V1RA 4M7DC 2MK5A 2ZGWA 2JN0A 2MMPA 1OI1A 1UDLA 4OMNA 5KH6A 4C5HA 3EH1A 2GGRA 2CT3A 1RABB 4OF1A 3SEMA 4BUGA 3M56A 4PJMA 2KMTA 3A8OB 3ZBDA 4J6YA 2R57A 2DPPB 4J9FA 4ZTFA 4RTUA 1TOVA 3JCMP 2RA2A 4JZ3A 2HZYA 3UPUA 2JNGA 4CC4B 4DA4A 3EFOA 5GAN6 4X1VA 2P4TA 4M75D 1HD3A 2D0QB 4QQ6A 4M78B 5CCAA 2E65A 4FYVB 2EKHA 3QXEB 1D0YA 3G71A 2ZPHB 3MO8A 3VJPA 1M90U 1VQMA 4AFQC 3HRUA 3M59A 1E6GA 4J7FA 2QA4Q 4D8DA 5KYYA 3HRSA 3OMCA 2DF6A 1PSFA 4PJOF 4JDSA 5IHKA 1GFCA 4R0KA 2LJ1A 2DD5A 1W6XA 1M3AA 4M75E 2RF0A 4ZN3A 3OYAA 1YITT 3QBYA 3REAB 3RIRA 1SG5A 3A98A 5HCKA 4PJOG 1MMGA 1FXXA 2NUTA 1QVGA 2XU8A 3ZFJA 3RUXA 1YFNA 1AD5A 3ZL7C 1NLPC 2QK0A 2KSSA 1KD1R 4E7KA 2DVJA 4BE1A 1OYXA 1BI2A 5FLXE 4M7DA 3EGXB 2BUDA 2DXBA 1K0XA 2VB6A 3MHXA 1WI7A 5GAMj 4HCBA 1WDXA 2VYTA 3LWHA 4FYWB 1X69A 4F7UA 1ZA1B 1N8RC 5IXBA 1KC8U 2OTLT 1D1AA 4IKFA 2GCXA 1UGVA 4E7ZA 4ELZC 2QQSA 3QYHB 1M8VA 3BY7A 1ARKA 2FPEA 1BK2A 5L23A 2D8HA 2LQ8A 1KJWA 2KY9A 2YHTA 3HPWA 1KQSS 1YJ9T 4Z8AA 4HT8A 2EVRA 4Y91A 5KCOA 3GP8A 2LP5A 3QKJA 1BBZA 1YIJA 1X75C 4OB1B 1Q81C 3DKMA 2EJFA 4XTYA 3I5SA 3SFMA 1OV3A 1K8AR 2HL3A 1QCNA 2DK3A 3P8BB 2H8HA 2C0OA 2IVWA 3JB9D 3M0TA 4M78A 1J3TA 1VIFA 2J6FA 3G71T 2FYKA 2A7YA 1PHTA 1VQMT 3A8LB 3MP6A 2IIMA 3MP8A 2DA9A 3CD6A 2P0KA 4OMLA 1M2VB 1K73U 2JS0A 2L0AA 4PJJA 1GRIA 5FWBA 3RBBB 3OS0A 3A5ZB 2RQWA 1YIJQ 1UE9A 5GAN4 1WZOA 2KRSA 3TSWA 2EIFA 3VU3C 4N4IA 3IQLA 3OW2P 1MNDA 3EG9B 1PRMC 2ZCFB 1N8RR 1UECA 2PUOB 2LZ6B 3MJXA 2FG0A 2FVUA 3L2UA 3JCMb 1C6VX 3CQTA 4WF2A 1R8OB 2MOXA 2DL8A 1BCOA 2X4YA 1VQPQ 3RDVA 1VYVA 2K79A 2VGNA 1VQ8A 2MWPA 3SWNB 3C0CA 2JZ2A 1GBQA 3UATA 3EGXA 2KGTA 2HBPA 1LVKA 2F5TX 3QDRB 3SWNC 3R6OA 2PVGB 3U23A 4RTVA 4IIMA 5GAMh 1G3WA 2O88A 2IPOB 2QQAA 4YTLA 2RO0A 1X27A 4R55A 1Y57A 2BIVA 1IRXA 2YUPA 3MEUA 1U3OA 1S72Q 4IUTA 4RG8A 2E41A 2FEIA 5CAIA 1QVPA 1V1CA 2VUBA 3LWIA 1I8FA 1ABQA 3CXCP 4C8QE 2A3LA 2VKNA 2ZPIB 1RACB 3JCMX 4ELYC 3EFRA 5GAMf 1NJIC 4M7AD 2EAYA 2ENMA 2RN8A 3JSCA 4AFZC 2KK4A 4DOWA 3Q1JA 1P92A 2DJQA 1IHWA 5I2SA 2DE0X 1NPRA 3OYDA 3CCUT 1VQ7Q 4J6WA 4FSXA 1IO6A 4KULA 4D8KA 4LDUA 1Q7YR 3JCMd 3CD6T 1VA7A 3CPWS 2PTKA 2H3JA 2XG8D 3OYGA 4IIOA 1NYGA 4XTXA 3CCMA 1KQSA 1VQ5A 1M2VA 4TVRA 4X34A 3G6EA 2JVVA 5GMKl 2RK2A 1N8RU 2V8JA 4M7AE 3FC3A 4A4KA 2DXTA 4B9WA 3VS1A 3E9GA 1SHFA 2E64A 2RQRA 2DRMA 2RMOA 2YWWA 3E2UA 3EG9A 3EHRA 3NGPA 3JCMe 1LNXA 2MF2A 1JU5C 4C5IA 1FMWA 4HXJA 2QGGA 3NHNA 2E3HA 1SKUB 2F2VA 5GJVB 5GAOp 1Y7XA 2HKNA 1T3SA 3VS3A 1HYOA 3AHUA 1I1JA 2FRWA 1Q81U 5GAN2 4LN2A 2CP0A 2DNUA 5HY6A 3HHTB 4KH1B 3CCMQ 1X43A 1VQ5Q 1JJ2A 1OEBA 1AWJA 1VQ8T 4C92F 1BIAA 1VOMA 3LGLA 4ME7A 1QP2A 2E6NA 1VUBA 4BACA 3JCMc 3DB4A 2ZPFB 5CIUA 4LDXA 1G5VA 2ESWA 2M51A 4NS5A 2HNIA 4FT4A 8AT1B 3N5BB 2OTJA 3TQ7P 2ED0A 2I2LA 3H9NA 3HL8A 3RKYA 3QYGB 5CR2A 4C92G 2DETA 1ZBJA 3META 1YCSB 4ANJA 3OYLA 1Y71A 1M1KR 1SSFA 2SEMA 1X6OA 4M77F 1KHCA 2C0IA 4EMGA 2MCNA 1SRLA 2HEQA 3FEOA 2EWNA 3C12A 3TCJA 1QVFA 1AZGB 1VQ4A 3BE3A 2JTEA 1NM7A 3O5ZA 1MMNA 1PWTA 2QI2A 3JB9J 4A54A 2L3RA 8ATCB 1XNIA 5IHNA 2LT4A 4MZTA 1Y0MA 4PJOE 4M77G 4CC2A 2M0OA 2VGMA 3EG1A 1TH7A 1WX6A 2ZZDA 4E7LA 4FU6A 5KE3A 3GPLA 3CMET 1WJQA 3A8GB 4PKCC 3CC7A 5LJ5j 3G6ET 5GMKi 4LDVA 2D9TA 5DLQE 1VQ4Q 2VXEA 5I2MA 4KGVB 4A63B 5A0LA 5GAMd 4J9DA 2KXDA 1UHFA 2L89A 3CCQQ 4A53A 2RHYA 2DJZA 1ZX6A 2CKKA 2MPXC 2AHJB 1H3ZA 4JJCA 2XDPA 1W2BS 2X3WD 2O9SA 3SHWA 4XTWA 3EGDB 4E2FB 3OY9A 3BDLA 1G3SA 1QVGP 2ED1A 4ZNXA 4Q5WA 3LLRA 4OMQA 3OYIA 4BE2A 1YI2Q 1M90R 2R58A 1NJIU 4BDZA 3CC7Q 1KQ2A 2JXBA 2RI5A 2XIDA 5GAMe 2A08A 1SSHA 1WYXA 2XI9A 1PKSA 2JJ9A 4ZGDB 5EC7A 4HVWA 4C5GA 2HAXA 5KCHA 4OGEA 3H0HA 3NTHA 2KVQG 4D6WA 2NUPB 1VQNA 1VQ6T 3PVQA 1M5Q1 2OTJT 1M30A 3OSSC 4FYXB 2K3YA 2KEAA 4ZN1A 2EYXA 3NTKA 3D7SB 5GAOq
chains in the Genus database with same CATH topology
2Y90A 2Y4YA 4PJOD 2KSSA 2RK1A 1OZ3A 1VQ7T 1QVFS 3RERA 3CEYA 1IREB 1O9SA 3FIFA 4EMKB 3QJYA 4M7AC 1X01A 3JAME 1UGSB 4E7KA 2DTIA 3ASKA 4JRKA 4BE1A 1OYXA 1BI2A 4OB0B 5FLXE 4M7DA 1IZ6A 4BI3A 2BUDA 3V7RA 2DXBA 2EJ9A 3MHXA 5GAMj 4A4GA 4B9XA 4HCBA 2HD0A 4M77B 4XU3A 3VUZA 3CC2T 1VIEA 2VYTA 3FLGA 3LWHA 2XK0A 2LTOA 4EMKC 4QVCA 3OYHA 4F7UA 4QW2A 5GMKj 4OMFB 3CCET 4RCCA 1N8RC 2CZ6B 4O5VA 2VXFA 3J81E 1KC8U 2OTLT 4M75F 5AYFA 3M53A 3QG1A 4IUPA 3L2QA 1YJNA 1Q82C 4FIBA 4J7IA 4IKFA 2GCXA 2LQKA 5CO7A 2XD0A 4M77C 3OYBA 3GIBA 4A4EA 4C0FA 4ELZC 3CCQA 4EDUA 2QQSA 3QYHB 1NE8A 3CCST 3M9QA 1FWZA 1YJWA 1XQHA 1VQOT 3BW1A 1M8VA 3BY7A 4PLLA 1G3YA 3C95A 4NOYA 3X25B 5GANd 1NPPA 3J7AF 2LQ8A 3OMGA 1KHIA 2KY9A 2YHTA 2ZPGB 2CGHA 3HPWA 4BE0A 1MGQA 2JOYA 2QA4A 1KQSS 1YJ9T 3E19A 1I4K1 4OB3B 3URGA 1K8AU 2WSFE 2L8DA 4HT8A 5FU7B 4KT0E 2BKDN 4Y91A 2EQKA 2JTFA 3M4YA 4LDYA 2WSCE 1BKBA 2JTMA 2F5KA 3GP8A 4MDXA 3QKJA 3CCJA 1U8RA 1YIJA 1X75C 4OB1B 4FL6A 4XU0A 3G7ZA 5IN1A 4M75G 5GAN5 1YI2A 3DKMA 1Q81C 3CCLA 2EJFA 5C0MA 3CCMT 1VQ5T 4GLKA 2V8IA 4IUUA 4XTYA 2QXFA 4BD3A 4XQ3A 3SFMA 5FU7C 2DK3A 5FU6B 3P8BB 3PMIA 2IVWA 3JB9D 4M78A 4QQDA 5CK9A 4M7DD 5GANe 1BYMA 3OYCA 3QJ6A 1VIFA 3G71T 3MEAA 2FYKA 2A7YA 5J26A 4L6V5 1VQMT 3A8LB 1KQ1A 1N9RA 3MP8A 2RJDA 3MP6A 2DVEA 3X28B 5KCOA 3CMEA 4C8QA 5FU6C 1XTDA 1M1KC 4JUVA 2E70A 3CD6A 2P0KA 2DZ9A 4MZMA 3OYYA 2K5FA 4M78C 3L2VA 1WNLA 3JB9H 1K73U 4CI0C 4JS4A 3V8KA 4RG2A 4X9CA 3J80E 3JRZA 4J8OA 3OQ5A 3OS0A 3S6WA 2FHDA 3G4ST 3A5ZB 3CCRT 2HQEA 4PJOB 3CPWA 3F70A 5GAN4 3CCVA 1N6AA 1YHQT 3M58A 2EIFA 3VU3C 4N4IA 3I55T 2KDSA 3FDRA 1O75A 2LRQA 3A8MB 2DEQA 3QSUA 4XU1A 2EQJA 1B34B 2ZCFB 1QVGS 1AHJB 4XTZA 3OYNA 4HT9A 4PJOC 2PUOB 4JLGA 1QW1A 3H6ZA 4C92A 4E7HA 4M7DE 1VQKT 3V7SA 2RB6A 2RI3A 1BIBA 2FVUA 3L2ZA 5CKBA 3L2UA 5GANj 5GAOn 4XTUA 2XDBA 4KUDK 3JCMV 2K5IA 5KE2A 4JRQA 3GF5A 1WQWA 4F7UE 3QPHA 2K57A 4C5EA 2R5MA 2KAFA 2DO3A 4MMLA 3CMAT 3M4GA 1U1TA 3JCMb 1NZ9A 2X4XA 3VYGA 4M7AA 4WF2A 1JB0E 1R8OB 1JRIA 2X4YA 4O6JA 5EG2A 2K3XA 2ZPBB 1U1SA 3PT9A 4RMOA 2VGNA 4QQGA 5LJ3j 1VQ8A 2MWPA 5D6YA 3SWNA 3SWNB 2IG0A 5CKEA 2WACA 1D3BB 2P0PA 2QEXA 2JZ2A 4PL6A 3JCMh 3HFNA 5L8RE 5A2QE 3OB9A 1VQ9A 4OB2B 2ZPEB 4EMKA 3OW2A 1YITA 4BI4A 3JCMg 2DZCA 4JRIA 1M1GA 5DM7R 5IAYA 1G3TA 2RD1A 4JRPA 2EJGA 2HBPA 1VQ6A 2MAMA 3QDRB 2F5TX 4IURA 4IUVA 4M77A 3SWNC 3R6OA 2PVGB 1BI1A 4GY5A 4KBMB 3V8LA 4E7IA 1VQ4T 3CC4A 3FRNA 4DOVA 1WJSA 1UGQB 3I56T 2LC4A 1W4SA 1G3WA 5GAMh 1YJNT 3BDUA 2QQAA 4YTLA 5C6SA 2RO0A 3PIOA 3CCQT 4KUIA 3EAEA 2B8AA 4R55A 2DIGA 3JB9F 5GMKh 2PU9B 3C94A 4M75B 2BIVA 4M7DF 1Q86C 2YRVA 5M9OA 2M1HA 3MEUA 3TREA 4C0ZA 5FRNA 2LT1A 2GFUA 5J39A 4N4HA 4IUTA 3JCMf 2O01E 3PTAA 4RG8A 2E41A 1ZHIA 1DJ7B 1M90C 2LDMA 4M78E 5CAIA 3RMQA 1QVPA 2FB7A 2QA4T 4F7UF 2G3RA 4OP0A 2VUBA 1FX7A 1XOVA 2M16A 3OBYA 2RJCA 1I8FA 3GNGA 4J83A 4M75C 4XK8E 3LWIA 3CC2A 4OGCA 4C8QE 2A3LA 4C0DB 4N4GA 2ZPIB 5HK0A 4E47A 3RKXA 3CCJT 2OAUA 1GXIE 3S3NA 1YI2T 3JCMX 3UT1A 1K9MC 3KBGA 4ELYC 2RJFA 3CCLT 3EFRA 4Z02A 5GAMf 3CC7T 1BI3A 3M5AA 2E1HA 3S3MA 1NJIC 2OTLA 4RKUE 2PVOB 2EAYA 4M7AD 4A4HA 4DQ2A 4P5NA 1KG1A 3JSCA 4HA8A 2KK4A 4QVDA 5GAOr 3JB9G 4DOWA 4M7DG 2QTXA 1Q7YU 3OYMA 3Q1JA 1P92A 2E10A 4C0DC 2KQWA 3X24B 5D6XA 3CCSA 4XU2A 3OBWA 1VQOA 5LJ5h 2E6ZA 3OYEA 5I2SA 2CZ0B 5LJ5g 4F7UG 3ME9A 4Y28E 1NPRA 1H641 3WVEB 3VV0A 2DD4A 3OYDA 2X4WA 4J6WA 1V29B 1ZQ1A 4FSXA 4KULA 4CRIA 3CCUT 1YJ9A 2LVMA 4LDUA 4NL2A 3JCMd 5IT9E 4XTVA 3CD6T 5D6WA 1KD1C 4C92E 3OA6A 3CPWS 2H3JA 5CKHA 3CXCA 2EKOA 2XG8D 3OYGA 2MI6A 4JS5A 4BDYA 4XTXA 4HCCA 3CCMA 1KQSA 1VQ5A 3EFSA 4MMKA 4IUQA 4TVRA 4X34A 4ATOA 3G6EA 1Y07A 3MEWA 5HKCA 2JVVA 3JB9I 1VQPA 1OZ2A 3LW5E 3X26B 5GMKl 4J5YA 1UEBA 2RK2A 4QVZA 3T9NA 4BI8B 3OS2A 1N8RU 2V8JA 4M7AE 3QZ5B 1M4ZA 3BFMA 2QQ9A 1Q82U 2GFAA 5LJ5f 3FC3A 4A4KA 2DXTA 4B9WA 4PJOA 2DTOA 3E9GA 5DY9A 2E64A 4MZPA 4X9DA 4C8QF 3PFSA 4MDWA 1LJOA 3X20B 1WJRA 3L2WA 2EFIA 3NFCA 2RJEA 3HSBA 1RL2A 2CZ7B 2DXCA 1UGPB 2HQXA 4JJNK 5CKDA 3C4SA 3TEEA 1Y96B 1B34A 3JCMe 1LNXA 2MF2A 4C5IA 3LH0A 4BB7A 2VC8A 2K4YA 1VQNT 1RI0A 1I81A 1KC8C 2R5AA 3UDCA 3QZ9B 1I5LA 4M77E 5A0GA 5GAOp 3VKIA 1Y7XA 3ZEHA 3AHUA 1EIFA 2LCCA 2V8KA 5GAN2 3CCRA 3OW2S 4L59A 3QIIA 1W2BA 1Q81U 5GANh 5HY6A 2RHXA 2XKOC 1S72A 3HP9A 1M1FA 3HHTB 4PNOA 2LNVA 4LD9K 4C8QG 1JJ2A 1LOJA 3KUFA 3SD4A 1VQLT 2XDDA 2DXUA 3L2RA 4FT2A 1VQ8T 4OVAA 4C92F 1BIAA 3DLMA 2X4JA 2X35A 4J6XA 2CS7A 3LGLA 4M78D 4ME7A 4C0GA 2QEXT 3GLXA 1QP2A 5GMKe 2RH2A 1UGRB 2E6NA 3M54A 2LX9A 1VUBA 5CVIA 1K8AC 1N9SA 3PGGA 3PIPA 1PSEA 3NTIA 1D3BA 5CQYA 3OSVA 3JCMc 5LJ5d 2EQMA 4NL3A 4BACA 1HXDA 3DB4A 3JCMW 4ZGEB 4HKEA 2ZPFB 3VUBA 2M9UA 3GNFB 5CIUA 5LJ3h 4C8QD 2RHUA 5GAN7 1VQKA 4LDXA 2O4XB 2PUKB 3CPFA 2EQUA 1G5VA 2Y4XA 3FJPA 3M55A 3O8VA 5LJ3g 4M7AF 4V2SA 1YBYA 3L1AA 4NS5A 1M1KU 4A4FA 2HNIA 1YCYA 4FT4A 4LDWA 1UB4A 3ER0A 2C06A 3N5BB 3QUIA 2OTJA 5CQXA 3GOXA 2FL7A 5J3BA 2I2LA 3HL8A 5GANf 1JBMA 4N0AC 3RKYA 2CZ1B 3E1SA 2RHIA 2VV5A 4BY6B 2XICA 3QYGB 5CR2A 4C92G 3DLLA 5GAMg 4RCBA 3SDZA 5GAOl 4L5GA 4UC4A 2E5QA 2LCLA 3META 4M75A 1VQ7A 3OYLA 5I21A 1Y71A 3HFOA 3WVDB 1SSFA 1YJWT 4FM4B 4M7DB 2EYQA 1X6OA 5DLOA 4M77F 5LJ5e 2GQVA 1KHCA 2PQWA 2YLBA 3V8JA 4BY6C 4EMGA 5GMKm 3S3OA 5LJ3f 3HKSA 3HRTA 3PNWC 4C92D 4EMHA 2CYZB 3FEOA 4M7AG 1K73C 2XHCA 2EWNA 3C12A 3TCJA 1QVFA 4XAXB 4F7UB 5A0DA 4LD6A 2DAQA 3CBOA 4JLIA 2P0QA 1VQ4A 2QQBA 4M7DC 1YIJT 2ZGWA 3I56A 4PLIA 2MMPA 2JN0A 3CCEA 1OI1A 2QI2A 3JB9J 3L42A 1N27A 2MWOA 5CKFA 4A54A 4C5HA 5KH6A 2L3RA 3FB9A 2F69A 1XNIA 3RMSA 2LT4A 4OF1A 3MEVA 4MZTA 3M56A 4BUGA 2KMTA 3TU4K 3A8OB 3LX7A 3VYHB 3UWNA 4M77G 3CXCS 4PJOE 2M0OA 2VGMA 3P8HA 3ZBDA 2K2VA 4J6YA 2R57A 1TH7A 2DPPB 5LL6S 2ZZDA 1HK9A 4FU6A 4E7LA 4ZTFA 5KE3A 4ZTJA 1WGSA 3GPLA 3JCMP 2RA2A 3CMET 1WJQA 3A8GB 4M77D 3UPUA 3CBPA 3V7CA 4PKCC 5LJ3d 3CC7A 5LJ5j 2JNGA 3G6ET 5GMKi 4LDVA 5GAN3 4DA4A 5FROA 1VQPT 2D9TA 1M9SA 5GAN6 5DLQE 2P4TA 1ZBXA 5FRMA 2VXEA 5I2MA 4M75D 4HCZA 4M78F 3CBMA 2DKGA 2D0QB 3WXMB 4QQ6A 5A0LA 3CCVT 4M78B 3M57A 5GAMd 5CCAA 2JUFA 3INZA 2E65A 2L89A 4VUBA 1BI0A 3P8DA 4A53A 3QXEB 3LGFA 1Q86U 2RHYA 2QDYB 2QQRA 3RKWA 2DJZA 3CCUA 2D6FA 2CKKA 2L5QA 2AHJB 4II1A 3G71A 2ZPHB 3MO8A 4C8QB 3VJPA 1H3ZA 1M90U 1VQMA 2XDPA 3DB3A 1W2BS 5GAOm 3HRUA 3M59A 1WQ7A 1Y96A 4XTWA 4J7FA 1JJ2S 3OYFA 3OY9A 5LJ3e 3BDLA 3HRSA 1G3SA 3OMCA 1PSFA 4PJOF 4Q5WA 2E12A 4C8QC 3LLRA 2WSEE 3OYIA 4BE2A 3OYKA 4JDSA 4M78G 5HK3A 1K9MU 1S72T 2R58A 3G4SA 1NJIU 4BDZA 3H8ZA 4ZGJB 1KQ2A 2RI5A 2DD5A 2YLCA 3QO3A 2XIDA 5GAMe 2RM4A 5GANg 3JCMJ 3QHSA 2XI9A 1YHQA 2GF7A 1MHNA 3LYIA 4M75E 4ZGDB 4ZN3A 3MP1A 3I55A 1QP3A 3A8HB 3SB2A 5GAN8 1VQ9T 4C92B 4C5GA 2HAXA 5KCHA 4OGEA 2RHZA 3OYAA 1YITT 3NTHA 3QBYA 2KVQG 3MCAB 3RIRA 4D6WA 3PMTA 1VQNA 4N0AA 2DIQA 2O4XA 2DTHA 3RESA 1VQ6T 2PVDB 4PJOG 4E7JA 3OS5A 4R56A 1KD1U 1M5Q1 2OTJT 1Q7YC 1WPYA 3CC4T 4C92C 1FXXA 2K5LA 3KXTA 4M7AB 1QVGA 2XU8A 3OYJA 3ZFJA 3JCMQ 2RI2A 3OSSC 3RUXA 2K3YA 3CMAA 4EPCA 4ZN1A 3NTKA 1VQLA 3OS1A 5GAOq 3E9FA 2NLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDR A;  2LRQ A;  3L42 A;  3OA6 A;  1N27 A;  2MWO A;  1OZ3 A;  2EQJ A;  5KH6 A;  2EKO A;  4C5H A;  3OYG A;  4BDY A;  3OYN A;  3CEY A;  2L3R A;  3H6Z A;  4E7H A;  1XNI A;  4IUQ A;  4X34 A;  4E7K A;  2RI3 A;  3ASK A;  4BE1 A;  3MEV A;  1OYX A;  3MEW A;  3L2U A;  1OZ2 A;  3LX7 A;  2BUD A;  3UWN A;  4QVZ A;  3OS2 A;  5KE2 A;  2M0O A;  3P8H A;  4A4G A;  4B9X A;  2R57 A;  4C5E A;  2GFA A;  2R5M A;  2VYT A;  3FLG A;  3FC3 A;  4B9W A;  2XK0 A;  4FU6 A;  2LTO A;  4E7L A;  5KE3 A;  2X4X A;  3E9G A;  4ZTF A;  3OS1 A;  4ZTJ A;  3OYH A;  3PFS A;  1WGS A;  4QW2 A;  1WJR A;  3L2W A;  1WJQ A;  2EFI A;  2X4Y A;  2K3X A;  2RJE A;  4IUP A;  3L2Q A;  4QQG A;  2HQX A;  4IKF A;  2MWP A;  5D6Y A;  3C4S A;  2IG0 A;  2WAC A;  3OYB A;  4A4E A;  2JZ2 A;  4PL6 A;  4C5I A;  4EDU A;  2QQS A;  3LH0 A;  3OB9 A;  5FRO A;  2D9T A;  1RI0 A;  2R5A A;  3M9Q A;  5IAY A;  4PLL A;  5FRM A;  4HCZ A;  3OMG A;  3ZEH A;  4IUR A;  4QQ6 A;  4IUV A;  2LCC A;  4L59 A;  3QII A;  4GY5 A;  4BE0 A;  4E7I A;  2L89 A;  2RHX A;  3P8D A;  1WJS A;  3LGF A;  2L8D A;  2RHY A;  3SD4 A;  2BKD N;  2QQR A;  2EQK A;  2JTF A;  3KUF A;  2CKK A;  5KCO A;  3L2R A;  2F5K A;  4II1 A;  3MO8 A;  4OVA A;  2RO0 A;  3QKJ A;  5C6S A;  3DLM A;  1H3Z A;  4FL6 A;  2X35 A;  2XDP A;  3DB3 A;  3LGL A;  5IN1 A;  3EAE A;  2B8A A;  2E6N A;  2DIG A;  5C0M A;  2BIV A;  3NTI A;  2YRV A;  4IUU A;  4BAC A;  5M9O A;  2EQM A;  2M1H A;  3MEU A;  3DB4 A;  4BD3 A;  3OY9 A;  3OYF A;  2GFU A;  3BDL A;  5J39 A;  4N4H A;  3OMC A;  4IUT A;  5CIU A;  2RHU A;  2O4X B;  2LDM A;  2EQU A;  4Q5W A;  1G5V A;  3LLR A;  3O8V A;  3OYI A;  3PMI A;  3OYK A;  4BE2 A;  2G3R A;  2M16 A;  2R58 A;  4NS5 A;  2RJC A;  4A4F A;  4QQD A;  4BDZ A;  3H8Z A;  5FRN A;  2RI5 A;  3QJ6 A;  3OYC A;  3MEA A;  3GOX A;  4N4G A;  5J26 A;  3MP6 A;  3MP8 A;  3S3N A;  2RJD A;  2RHI A;  3UT1 A;  2GF7 A;  1MHN A;  2RJF A;  3LYI A;  4Z02 A;  3S3M A;  3MP1 A;  2P0K A;  4A4H A;  4UC4 A;  2E5Q A;  5D6W A;  4C5G A;  5KCH A;  3OYA A;  2RHZ A;  3MET A;  3L2V A;  3NTH A;  3OYL A;  3QBY A;  3OYM A;  3Q1J A;  1SSF A;  3PMT A;  4RG2 A;  2DIQ A;  5D6X A;  3OQ5 A;  2PQW A;  1KHC A;  2O4X A;  3S6W A;  2FHD A;  3OS0 A;  3OYE A;  3S3O A;  4E7J A;  3PNW C;  2HQE A;  3FEO A;  3ME9 A;  3F70 A;  3OYJ A;  4LD6 A;  3OYD A;  2DAQ A;  2RI2 A;  2X4W A;  2K3Y A;  4CRI A;  3NTK A;  2LVM A;  4N4I A;  4PLI A;  3E9F A;  2NLU A;  1OI1 A; 
#chains in the Genus database with same CATH topology
 3I9Q A;  1NG2 A;  2KI7 A;  2KRO A;  3UA7 A;  4A4G A;  2HD0 A;  4XU3 A;  3RNJ A;  1VIE A;  3H41 A;  1QWF A;  2XK0 A;  4OMM A;  4QW2 A;  4OMF B;  2CZ6 B;  4PJL A;  4O5V A;  2VXF A;  1K1Z A;  1VQN Q;  3M53 A;  2EGE A;  2LQK A;  3H0I A;  1MMD A;  3OYB A;  4A4E A;  4EDU A;  2EQI A;  3CCS T;  2K9G A;  3M9Q A;  4HCK A;  1XQH A;  1YJW A;  3BW1 A;  3X25 B;  1NPP A;  1KC8 R;  1LPL A;  2JOY A;  2QA4 A;  2P4R A;  3E19 A;  4OB3 B;  2L8D A;  4F04 B;  3PVL A;  4KT0 E;  1BKB A;  2F5K A;  2LX7 A;  4XU0 A;  5GAN 5;  2L2P A;  5C0M A;  4KRT A;  5IH2 A;  4RUG A;  3PMI A;  2HSE B;  2NWM A;  1ACM B;  4WTO B;  2FZG B;  3MEA A;  1D1B A;  2EGC A;  1NEG A;  2AT1 B;  1ZSZ B;  1YJW Q;  1D0Z A;  4J9I A;  4DBQ A;  4MZM A;  3EGD A;  4M78 C;  1WNL A;  1Z9Q A;  4JS4 A;  4LE9 A;  2FHD A;  1ZSZ C;  3CCR T;  5FW9 A;  3F70 A;  3CCV A;  1N6A A;  1T0J A;  4DBF A;  1RLP C;  1K73 R;  1M2O A;  1M27 C;  3QSU A;  4XU1 A;  2EQJ A;  1B34 B;  4E7H A;  2HDA A;  2PZ1 A;  3V7S A;  2RI3 A;  1BIB A;  2NUP A;  5GAN j;  4FW2 A;  4KUD K;  3JCM V;  1UJ0 A;  1QKW A;  1B7T A;  5KE2 A;  4HVU A;  2V1Q A;  4E6R A;  4C5E A;  2R5M A;  2DO3 A;  3M4G A;  1U1T A;  1NZ9 A;  1D09 B;  3VYG A;  1JB0 E;  2KRN A;  4O6J A;  2DL4 A;  2K3X A;  1U1S A;  4QQG A;  2WAC A;  1JXO A;  3JCM h;  4PL6 A;  1VQ9 A;  3HFN A;  2A37 A;  2C0T A;  3CCV Q;  3JCM g;  3H0F A;  4JRI A;  1WXB A;  3UA6 A;  1PD1 A;  2MAM A;  4JZ4 A;  2OI3 A;  4GY5 A;  4E7I A;  3CC4 A;  1YP5 A;  2LC4 A;  1B3Q A;  3PIO A;  1R0C B;  2B8A A;  1QKX A;  2PU9 B;  4M75 B;  1GCQ C;  4M7D F;  1Q86 C;  4C0Z A;  2EGA A;  2LT1 A;  5J39 A;  3JCM f;  3PTA A;  1ZHI A;  2O31 A;  2RQT A;  3RMQ A;  2FB7 A;  2QA4 T;  4F7U F;  2DL3 A;  4M75 C;  3CC2 A;  1VYU A;  1VQ9 Q;  3RKX A;  2G6F X;  1GXI E;  1K9M C;  1CKB A;  2VVK A;  1BI3 A;  2E1H A;  2PVO B;  1TWB A;  4QVD A;  2CUD A;  5GAO r;  4M7D G;  2E10 A;  3CC4 Q;  2KQW A;  5D6X A;  1PG5 B;  2VAS A;  1VQO A;  2O2O A;  3TVT A;  4F7U G;  4PK4 A;  3WVE B;  3VV0 A;  2X4W A;  1V29 B;  1FMK A;  2LVM A;  2DYI A;  2YRC A;  4C92 E;  1ZSZ A;  1BB9 A;  3VS4 A;  2BE7 D;  4JS5 A;  4HCC A;  1RUW A;  3EFS A;  4MMK A;  3CC2 Q;  1ZSG A;  1VQP A;  1OZ2 A;  1JJ2 P;  3T9N A;  3CCE Q;  4BI8 B;  2ATC B;  3QZ5 B;  3BFM A;  1W70 A;  1B07 A;  1TTH B;  4MZP A;  3PFS A;  4MDW A;  3L2W A;  2EFI A;  3NFC A;  2AIR B;  2RJE A;  3GBQ A;  2DXC A;  1VQO Q;  3C4S A;  1B34 A;  4PFP A;  1KFZ A;  2VC8 A;  1RI0 A;  1I81 A;  3UDC A;  1I5L A;  4M77 E;  3VKI A;  2CSQ A;  1WHM A;  3OW2 S;  4L59 A;  5GAN h;  1RAF B;  2JS2 A;  1GCP A;  2XKO C;  1S72 A;  4PNO A;  4WCI A;  1MUZ A;  1LOJ A;  2F2W A;  2X4J A;  2CS7 A;  5GMK e;  5CVI A;  1OX9 A;  1UG1 A;  3NTI A;  5LJ5 d;  1Q81 R;  1HXD A;  5KYN A;  4ZGE B;  3VUB A;  4C8Q D;  2M9U A;  1QVF P;  1VQK A;  3CPF A;  1OU9 A;  2Y4X A;  3M55 A;  3O8V A;  4V2S A;  1YBY A;  3NPF A;  1GCQ A;  2C06 A;  1UB4 A;  3GOX A;  5J3B A;  5GAN f;  2CZ1 B;  2RHI A;  2KBT A;  3DLL A;  5GAM g;  3SDZ A;  4CC7 A;  4L5G A;  4UC4 A;  2E5Q A;  2EBP A;  3G4S Q;  4M75 A;  1VQ7 A;  5I21 A;  2LNH B;  1EZZ B;  3HFO A;  4AT1 B;  1UUE A;  4KGX B;  5LJ5 e;  2ECZ A;  2PQW A;  2YLB A;  1YHQ Q;  3HKS A;  1YNZ A;  3I55 Q;  4K11 A;  2XHC A;  4JPB W;  5A0D A;  1AT1 B;  2A0F B;  2DAQ A;  4JLI A;  2M0Y A;  1YIJ T;  3I56 A;  4PLI A;  1GBR A;  3VS0 A;  1VQK Q;  3L42 A;  5CKF A;  1JEG A;  2F69 A;  1X2Q A;  3RMS A;  3CMA Q;  3LX7 A;  3CXC S;  2QYZ A;  4EIK A;  1HK9 A;  1YN8 A;  1WGS A;  5IXF A;  1PRL C;  3CBP A;  2OAW A;  5GAN 3;  1VQP T;  2JM9 A;  1ZUU A;  4RTT A;  1SF9 A;  1ZBX A;  2KT1 A;  4HCZ A;  3I56 Q;  2DKG A;  2YRD A;  1YJN Q;  9ATC B;  3M57 A;  1AOJ A;  2J6K A;  2FZC B;  4VUB A;  1BI0 A;  1Q86 U;  3RKW A;  2D6F A;  2HKQ B;  4C8Q B;  4Y92 A;  5GAO m;  1WQ7 A;  1C0M A;  1TS9 A;  1MMA A;  4C8Q C;  3KFV A;  3CCJ Q;  2WSE E;  4LUE A;  1K9M U;  3M0Q A;  1GL5 A;  5HK3 A;  1S72 T;  2RPN A;  3CCL Q;  3H8Z A;  2BZY A;  4GBQ A;  3QO3 A;  1OPL A;  2FPF A;  2KNB B;  2RM4 A;  2GF7 A;  1MHN A;  3A8H B;  1A0N B;  3EG3 A;  3RR6 A;  2ROT A;  1NJI R;  2J06 A;  2DIQ A;  1FYN A;  3OS5 A;  4R56 A;  2FO0 A;  1WPY A;  2K5L A;  3VS5 A;  4M7A B;  3KXT A;  1IB8 A;  2RI2 A;  1VQL A;  4JRK A;  2NLU A;  2YSQ A;  2GBQ A;  4PJO D;  1ZUY A;  1F1B B;  1VQ7 T;  3RER A;  1IRE B;  1O9S A;  1TUG B;  4EMK B;  4M7A C;  3JAM E;  1UGS B;  5GJW B;  5KYX B;  1NLO C;  4OB0 B;  1IZ6 A;  4BI3 A;  2YUN A;  2CSI A;  4B9X A;  3VUZ A;  1OUL A;  2LCS A;  3G1J A;  4EMK C;  5GMK j;  1K9A A;  1TU0 B;  4KGZ B;  4RTX A;  3J81 E;  5AYF A;  3THK A;  1QCO A;  3QDF A;  3L2Q A;  4FIB A;  3MKD A;  4DBR A;  2QTV A;  4FCY A;  2F1L A;  2E3I A;  3GIB A;  3CCQ A;  2COZ A;  1NE8 A;  1R0B G;  1FWZ A;  2E5K A;  2EYZ A;  4PLL A;  3C95 A;  2CP7 A;  2DLP A;  5GAN d;  1ABO A;  1VQL Q;  1KHI A;  2ZPG B;  2K7A A;  1AEY A;  2CGH A;  1MGQ A;  5KYW B;  2QEX Q;  3URG A;  2WSF E;  2EW3 A;  2CRE A;  4ESR A;  2XDD A;  3M4Y A;  4MDX A;  4LDY A;  2A36 A;  2WSC E;  1U8R A;  1UTI A;  3G7Z A;  1VYT A;  1YI2 A;  3CCM T;  1VQ5 T;  2V8I A;  4IUU A;  3EH2 A;  4BD3 A;  1QCF A;  4J9B A;  2GTO A;  2QAS A;  3FJ5 A;  4QQD A;  4M7D D;  5GAN e;  3OYC A;  2YUQ A;  1NYF A;  2OX7 A;  1KK7 A;  4Z88 A;  5J26 A;  1KQ1 A;  2RJD A;  2DVE A;  4C8Q A;  3I5R A;  1XTD A;  1CKA A;  3OYY A;  2DMO A;  2K5F A;  3L2V A;  3JB9 H;  4CI0 C;  3JRZ A;  3S6W A;  1OPK A;  1OQK A;  4PJO B;  3CPW A;  2FZK B;  1RAA B;  1RAH B;  1LCK A;  2W0Z A;  1ZA2 B;  1KSW A;  2CT4 A;  3FDR A;  1HSQ A;  2LRQ A;  2L3P A;  2DEQ A;  2GQI A;  4DEX A;  1OOT A;  1QVG S;  4XTZ A;  2A28 A;  4PJO C;  4JLG A;  1QW1 A;  4M7D E;  2QGF B;  1M3B A;  3L2Z A;  2EYY A;  2XDB A;  1UHC A;  2O9V A;  4JRQ A;  2NYS A;  4F7U E;  4MML A;  2KAF A;  4M7A A;  2CDT A;  3QWY A;  1JRI A;  2RQV A;  1MV0 B;  1K76 A;  2MIO A;  2KT8 A;  5EG2 A;  4JJB A;  2NUZ A;  5D6Y A;  2IG0 A;  5CKE A;  3TSZ A;  5A2Q E;  3OB9 A;  4EMK A;  2ZPE B;  1AWX A;  1YIT A;  2L3S A;  2PNI A;  1RLQ C;  1M1G A;  4FSS A;  5KYX A;  5IAY A;  1IHV A;  1SPK A;  2RD1 A;  2AKL A;  2LMJ A;  3V8L A;  1BI1 A;  1SRM A;  1MNE A;  1VQ4 T;  3FRN A;  4DOV A;  1W4S A;  2F2X A;  3CCQ T;  2VWF A;  3EAE A;  3QWX X;  5GMK h;  1RAE B;  3C94 A;  4RTW A;  1K4U S;  2M1H A;  3TRE A;  4N4H A;  2LDM A;  4M78 E;  1PD0 A;  2DBK A;  5AT1 B;  1FX7 A;  1XOV A;  2M16 A;  2RJC A;  3GNG A;  2EYW A;  4XK8 E;  4F14 A;  5KYW A;  3A1P A;  1CSK A;  4C0D B;  2OAU A;  1YIT Q;  3S3N A;  1YI2 T;  2RJF A;  3CC7 T;  3M5A A;  2OTL A;  1D1C A;  4DQ2 A;  4P5N A;  4HA8 A;  3R6N A;  2ABL A;  4C0D C;  1TXQ A;  3X24 B;  4XU2 A;  2J6O A;  3OBW A;  5LJ5 h;  2E6Z A;  2CZ0 B;  2Z0W A;  5LJ5 g;  1AVZ C;  1UFF A;  3ME9 A;  4Y28 E;  1YJ9 A;  4CRI A;  2COY A;  4NL2 A;  1KD1 C;  3OA6 A;  2EKO A;  2AZV A;  4ATO A;  1BU1 A;  2JMC A;  5HKC A;  3LW5 E;  3X26 B;  1UEB A;  1WLP B;  1FMV A;  1V76 A;  2GFA A;  2KE9 A;  5LJ5 f;  2OTL Q;  4PJO A;  5I22 A;  2DTO A;  5DY9 A;  1WXU A;  2CP3 A;  4X9D A;  1WJR A;  1U5S A;  1AZE A;  5IHI A;  4AG1 C;  1EFN A;  3HSB A;  2CZ7 B;  1QMC A;  4JJN K;  1X2K A;  1Y96 B;  2K4Y A;  1Q95 G;  2HL5 C;  1VQN T;  2DM1 A;  1YJ9 Q;  5A0G A;  4FW1 A;  2DRK A;  2HSP A;  2X3X D;  3ZEH A;  2GTJ A;  1EIF A;  3REB B;  1W2B A;  2QDL A;  2DER A;  3HP9 A;  2M02 A;  1I07 A;  2LNV A;  3SD4 A;  4FT2 A;  2W10 A;  4OVA A;  1N5Z A;  2X35 A;  5KYU B;  4C0G A;  1UGR B;  2RH2 A;  1W1F A;  1R77 A;  2X51 A;  3M54 A;  1K8A C;  5CQY A;  4NL3 A;  3OSV A;  2EQM A;  4HKE A;  5GAN 7;  3GNF B;  2RHU A;  2H3E B;  2O4X B;  2YXY A;  3G71 Q;  2EQU A;  3FJP A;  1VQM Q;  1AWO A;  3L1A A;  1YCY A;  2RNA A;  1X6G A;  3QUI A;  6AT1 B;  1TUD A;  4N0A C;  4LUD A;  1WHG A;  2VV5 A;  2CP5 A;  4BY6 B;  2XIC A;  5GAO l;  2JM8 A;  2COW A;  4Z89 A;  3WVD B;  1YJW T;  2YUO A;  1S1N A;  2GQV A;  4BY6 C;  3PNW C;  4C92 D;  4EMH A;  4XAX B;  4LD6 A;  1PNJ A;  2P0Q A;  2QQB A;  3VRZ A;  1KQS P;  3CCE A;  2CH4 A;  1N27 A;  2J05 A;  2MWO A;  3ULR B;  3FB9 A;  1ZLM A;  2CP6 A;  3MEV A;  3TU4 K;  2JT4 A;  4J9C A;  3VYH B;  3UWN A;  3P8H A;  2K2V A;  3MPU B;  5LL6 S;  3EG2 A;  4ZTJ A;  2K6D A;  4M77 D;  3V7C A;  5LJ3 d;  4B6M A;  1NBE B;  1OU8 A;  2HBW A;  1H3H A;  5FRO A;  1M9S A;  4ORZ A;  2BTT A;  4J9G A;  5FRM A;  4M78 F;  3CBM A;  3WXM B;  3CCV T;  1MV3 A;  2JUF A;  3INZ A;  2JMA A;  2DIL A;  3P8D A;  1RAI B;  3LGF A;  2QDY B;  2QQR A;  3CCU A;  1T0H A;  2L5Q A;  4II1 A;  5ECA A;  3DB3 A;  4KH0 B;  1Y96 A;  1JJ2 S;  3OYF A;  2E4H A;  2DYB A;  5LJ3 e;  1Q86 R;  2ROL A;  2E12 A;  4F16 A;  1TUC A;  3OYK A;  4M78 G;  3G4S A;  4ZGJ B;  2YLC A;  4GLM A;  1WHH A;  5GAN g;  3JCM J;  3QHS A;  1YHQ A;  3LYI A;  1XJW B;  3MP1 A;  3I55 A;  5KYU A;  2MYS A;  1QP3 A;  3SB2 A;  3LH5 A;  5GAN 8;  4C92 B;  1VQ9 T;  1K9M R;  2RHZ A;  3NMZ C;  1D0X A;  3MCA B;  1QLY A;  3PMT A;  4N0A A;  2HQH A;  2O4X A;  2DTH A;  3RES A;  3CCU Q;  1SHG A;  1RAG B;  2PVD B;  4E7J A;  1KD1 U;  1Q7Y C;  3CD6 Q;  1TSF A;  3CC4 T;  4C92 C;  3OYJ A;  3JCM Q;  2BE9 B;  3CMA A;  4EPC A;  2LJ3 A;  3OS1 A;  3E9F A;  2J7I A;  1IGQ A;  2Y90 A;  1QQJ A;  2Y4Y A;  2RK1 A;  1OZ3 A;  1QVF S;  3CEY A;  3FIF A;  3QJY A;  1X01 A;  1BCM A;  2DL7 A;  2DTI A;  3ASK A;  1M8M A;  1WHK A;  3V7R A;  2EJ9 A;  5D7U A;  4M77 B;  3CC2 T;  3FLG A;  2LTO A;  4QVC A;  2OJ2 A;  3OYH A;  2CUB A;  2DBM A;  3CCE T;  4RCC A;  4M75 F;  3QG1 A;  4IUP A;  1YJN A;  1Q82 C;  4F17 A;  2XD0 A;  4J7I A;  5CO7 A;  4M77 C;  1UJY A;  4C0F A;  1WXT A;  2HCK A;  3PE0 A;  2LQN A;  2KRM A;  1VQO T;  1G3Y A;  4NOY A;  3J7A F;  2EPD A;  3OMG A;  1VQ8 Q;  2K2M A;  4BE0 A;  4FYY B;  1I4K 1;  1K8A U;  5FU7 B;  1E7O A;  2BKD N;  4DEY A;  2EQK A;  2JTF A;  2RQU A;  2JTM A;  3CCJ A;  2JW4 A;  4FL6 A;  5IN1 A;  4M75 G;  3CCL A;  4GLK A;  2QXF A;  1E6H A;  2QAZ A;  4XQ3 A;  1M3C A;  3CPW P;  5FU7 C;  5FU6 B;  2KR3 A;  2D0N A;  5CK9 A;  1BYM A;  3QJ6 A;  3VRY A;  4PJN A;  4L6V 5;  1N9R A;  1JQQ A;  3X28 B;  1IGU A;  3CME A;  5FU6 C;  1M1K C;  4JUV A;  2E70 A;  2DZ9 A;  4AMC A;  1I0C A;  1K0S A;  1YWP A;  4J9E A;  3V8K A;  4RG2 A;  4X9C A;  3J80 E;  4J8O A;  3OQ5 A;  2AK5 A;  2YT6 A;  3G4S T;  1WIE A;  2HQE A;  3EHQ A;  1PKT A;  2YDL A;  1YHQ T;  3M58 A;  3I55 T;  2KDS A;  1O75 A;  3A8M B;  2V26 A;  1AHJ B;  4HT9 A;  3OYN A;  4C92 A;  3H6Z A;  1Q82 R;  1IXD A;  1VQK T;  2RB6 A;  5CKB A;  5GAO n;  2AZS A;  2KXC A;  4XTU A;  2K5I A;  1TG0 A;  3GF5 A;  1WQW A;  3VS7 A;  3CME Q;  3QPH A;  2K57 A;  3CMA T;  2X4X A;  1GFD A;  3G6E Q;  4M4Z A;  2ZPB B;  3PT9 A;  1RI9 A;  4RMO A;  5LJ3 j;  3I35 A;  2DX1 A;  3SWN A;  4JJD A;  1D3B B;  2P0P A;  2QEX A;  5L8R E;  3EG0 A;  4OB2 B;  3OW2 A;  4BI4 A;  3M0P A;  2DZC A;  5DM7 R;  2B86 A;  1G3T A;  4LXC A;  4JRP A;  2EJG A;  1VQ6 A;  4IUR A;  3M0R A;  3VS6 A;  4IUV A;  4M77 A;  2X9H A;  4KBM B;  1WJS A;  4PFO A;  1UGQ B;  3I56 T;  1YJN T;  3BDU A;  5C6S A;  1PM3 A;  3M0U A;  1ZUK A;  4KUI A;  1HJD A;  2DIG A;  3JB9 F;  3JV3 A;  1I5O B;  2I0N A;  2YRV A;  5M9O A;  5FRN A;  2GFU A;  5FWC A;  4OMP A;  2O01 E;  1M90 C;  1DJ7 B;  4HVV A;  2G3R A;  4QT7 A;  4OP0 A;  3OBY A;  4J83 A;  4OGC A;  4N4G A;  3CCJ T;  5HK0 A;  4AG2 C;  4E47 A;  3UT1 A;  3KBG A;  3CCL T;  4Z02 A;  3S3M A;  2FPD A;  4RKU E;  4A4H A;  1KG1 A;  4AFS C;  1VQ6 Q;  3JB9 G;  2QTX A;  1Q7Y U;  3OYM A;  5I11 A;  2OTJ Q;  4LNP A;  3CCS A;  3OYE A;  3EGU A;  1PC0 A;  1H64 1;  1QWE A;  2DD4 A;  4OMO A;  1ZQ1 A;  5IT9 E;  4XTV A;  5D6W A;  1Z9Z A;  2ZAE A;  2FRY A;  5CKH A;  2D8J A;  3CXC A;  4BDY A;  2CH4 W;  2MI6 A;  1C1A A;  3HTR A;  3EFO B;  1PCX A;  4IUQ A;  2CP2 A;  1G2B A;  1W2B P;  1Y07 A;  2L3Q A;  3MEW A;  4RTY A;  3JB9 I;  1U06 A;  2AKK A;  2KYM A;  4J5Y A;  4QVZ A;  3OS2 A;  2LQW A;  2D1X A;  1M4Z A;  2QQ9 A;  1Q82 U;  1WFW A;  2KYB A;  1NEB A;  2GNC A;  4C8Q F;  3VS2 A;  1LJO A;  3X20 B;  1X6B A;  2BZ8 A;  4E7S A;  1H8K A;  3CCS Q;  1RL2 A;  2HQX A;  3M0S A;  1UGP B;  5CKD A;  3TEE A;  3LH0 A;  4BB7 A;  5KYY B;  1KC8 C;  2R5A A;  4PFZ A;  3QZ9 B;  1OX8 A;  1EX4 A;  4J9H A;  3UF4 A;  2LCC A;  2V8K A;  3CCR A;  3QII A;  1KIK A;  1WHJ A;  2RHX A;  1JO8 A;  1M1F A;  4LD9 K;  4C8Q G;  1VQL T;  3KUF A;  2DL5 A;  2DXU A;  3L2R A;  1YWO A;  3DLM A;  4AFU C;  4J6X A;  4M78 D;  2QEX T;  7AT1 B;  4QKU A;  2DEU A;  1RAD B;  3GLX A;  2LX9 A;  1N9S A;  3PGG A;  3PIP A;  1PSE A;  1D3B A;  2HMA A;  2SRC A;  3JCM W;  5LJ3 h;  2BZX A;  2PUK B;  5LJ3 g;  4M7A F;  4CC3 A;  2LJ0 A;  1G83 A;  3AT1 B;  2NUT B;  1M1K U;  4A4F A;  1WHL A;  4LDW A;  1JXM A;  3ER0 A;  2P84 A;  5CQX A;  2FL7 A;  1JBM A;  1SEM A;  3E1S A;  1T3L A;  1G8X A;  4RCB A;  4RTZ A;  2LCL A;  2DFU A;  3CCR Q;  4FM4 B;  4M7D B;  2EYQ A;  5DLO A;  3V8J A;  5GMK m;  3S3O A;  5LJ3 f;  3HRT A;  2CYZ B;  1WA7 A;  2QG9 B;  4DBH A;  4M7A G;  1K73 C;  1AWW A;  2K3B A;  1H92 A;  4F7U B;  2XMF A;  3CBO A;  2V1R A;  4M7D C;  2MK5 A;  2ZGW A;  2JN0 A;  2MMP A;  1OI1 A;  1UDL A;  4OMN A;  5KH6 A;  4C5H A;  3EH1 A;  2GGR A;  2CT3 A;  1RAB B;  4OF1 A;  3SEM A;  4BUG A;  3M56 A;  4PJM A;  2KMT A;  3A8O B;  3ZBD A;  4J6Y A;  2R57 A;  2DPP B;  4J9F A;  4ZTF A;  4RTU A;  1TOV A;  3JCM P;  2RA2 A;  4JZ3 A;  2HZY A;  3UPU A;  2JNG A;  4CC4 B;  4DA4 A;  3EFO A;  5GAN 6;  4X1V A;  2P4T A;  4M75 D;  1HD3 A;  2D0Q B;  4QQ6 A;  4M78 B;  5CCA A;  2E65 A;  4FYV B;  2EKH A;  3QXE B;  1D0Y A;  3G71 A;  2ZPH B;  3MO8 A;  3VJP A;  1M90 U;  1VQM A;  4AFQ C;  3HRU A;  3M59 A;  1E6G A;  4J7F A;  2QA4 Q;  4D8D A;  5KYY A;  3HRS A;  3OMC A;  2DF6 A;  1PSF A;  4PJO F;  4JDS A;  5IHK A;  1GFC A;  4R0K A;  2LJ1 A;  2DD5 A;  1W6X A;  1M3A A;  4M75 E;  2RF0 A;  4ZN3 A;  3OYA A;  1YIT T;  3QBY A;  3REA B;  3RIR A;  1SG5 A;  3A98 A;  5HCK A;  4PJO G;  1MMG A;  1FXX A;  2NUT A;  1QVG A;  2XU8 A;  3ZFJ A;  3RUX A;  1YFN A;  1AD5 A;  3ZL7 C;  1NLP C;  2QK0 A;  2KSS A;  1KD1 R;  4E7K A;  2DVJ A;  4BE1 A;  1OYX A;  1BI2 A;  5FLX E;  4M7D A;  3EGX B;  2BUD A;  2DXB A;  1K0X A;  2VB6 A;  3MHX A;  1WI7 A;  5GAM j;  4HCB A;  1WDX A;  2VYT A;  3LWH A;  4FYW B;  1X69 A;  4F7U A;  1ZA1 B;  1N8R C;  5IXB A;  1KC8 U;  2OTL T;  1D1A A;  4IKF A;  2GCX A;  1UGV A;  4E7Z A;  4ELZ C;  2QQS A;  3QYH B;  1M8V A;  3BY7 A;  1ARK A;  2FPE A;  1BK2 A;  5L23 A;  2D8H A;  2LQ8 A;  1KJW A;  2KY9 A;  2YHT A;  3HPW A;  1KQS S;  1YJ9 T;  4Z8A A;  4HT8 A;  2EVR A;  4Y91 A;  5KCO A;  3GP8 A;  2LP5 A;  3QKJ A;  1BBZ A;  1YIJ A;  1X75 C;  4OB1 B;  1Q81 C;  3DKM A;  2EJF A;  4XTY A;  3I5S A;  3SFM A;  1OV3 A;  1K8A R;  2HL3 A;  1QCN A;  2DK3 A;  3P8B B;  2H8H A;  2C0O A;  2IVW A;  3JB9 D;  3M0T A;  4M78 A;  1J3T A;  1VIF A;  2J6F A;  3G71 T;  2FYK A;  2A7Y A;  1PHT A;  1VQM T;  3A8L B;  3MP6 A;  2IIM A;  3MP8 A;  2DA9 A;  3CD6 A;  2P0K A;  4OML A;  1M2V B;  1K73 U;  2JS0 A;  2L0A A;  4PJJ A;  1GRI A;  5FWB A;  3RBB B;  3OS0 A;  3A5Z B;  2RQW A;  1YIJ Q;  1UE9 A;  5GAN 4;  1WZO A;  2KRS A;  3TSW A;  2EIF A;  3VU3 C;  4N4I A;  3IQL A;  3OW2 P;  1MND A;  3EG9 B;  1PRM C;  2ZCF B;  1N8R R;  1UEC A;  2PUO B;  2LZ6 B;  3MJX A;  2FG0 A;  2FVU A;  3L2U A;  3JCM b;  1C6V X;  3CQT A;  4WF2 A;  1R8O B;  2MOX A;  2DL8 A;  1BCO A;  2X4Y A;  1VQP Q;  3RDV A;  1VYV A;  2K79 A;  2VGN A;  1VQ8 A;  2MWP A;  3SWN B;  3C0C A;  2JZ2 A;  1GBQ A;  3UAT A;  3EGX A;  2KGT A;  2HBP A;  1LVK A;  2F5T X;  3QDR B;  3SWN C;  3R6O A;  2PVG B;  3U23 A;  4RTV A;  4IIM A;  5GAM h;  1G3W A;  2O88 A;  2IPO B;  2QQA A;  4YTL A;  2RO0 A;  1X27 A;  4R55 A;  1Y57 A;  2BIV A;  1IRX A;  2YUP A;  3MEU A;  1U3O A;  1S72 Q;  4IUT A;  4RG8 A;  2E41 A;  2FEI A;  5CAI A;  1QVP A;  1V1C A;  2VUB A;  3LWI A;  1I8F A;  1ABQ A;  3CXC P;  4C8Q E;  2A3L A;  2VKN A;  2ZPI B;  1RAC B;  3JCM X;  4ELY C;  3EFR A;  5GAM f;  1NJI C;  4M7A D;  2EAY A;  2ENM A;  2RN8 A;  3JSC A;  4AFZ C;  2KK4 A;  4DOW A;  3Q1J A;  1P92 A;  2DJQ A;  1IHW A;  5I2S A;  2DE0 X;  1NPR A;  3OYD A;  3CCU T;  1VQ7 Q;  4J6W A;  4FSX A;  1IO6 A;  4KUL A;  4D8K A;  4LDU A;  1Q7Y R;  3JCM d;  3CD6 T;  1VA7 A;  3CPW S;  2PTK A;  2H3J A;  2XG8 D;  3OYG A;  4IIO A;  1NYG A;  4XTX A;  3CCM A;  1KQS A;  1VQ5 A;  1M2V A;  4TVR A;  4X34 A;  3G6E A;  2JVV A;  5GMK l;  2RK2 A;  1N8R U;  2V8J A;  4M7A E;  3FC3 A;  4A4K A;  2DXT A;  4B9W A;  3VS1 A;  3E9G A;  1SHF A;  2E64 A;  2RQR A;  2DRM A;  2RMO A;  2YWW A;  3E2U A;  3EG9 A;  3EHR A;  3NGP A;  3JCM e;  1LNX A;  2MF2 A;  1JU5 C;  4C5I A;  1FMW A;  4HXJ A;  2QGG A;  3NHN A;  2E3H A;  1SKU B;  2F2V A;  5GJV B;  5GAO p;  1Y7X A;  2HKN A;  1T3S A;  3VS3 A;  1HYO A;  3AHU A;  1I1J A;  2FRW A;  1Q81 U;  5GAN 2;  4LN2 A;  2CP0 A;  2DNU A;  5HY6 A;  3HHT B;  4KH1 B;  3CCM Q;  1X43 A;  1VQ5 Q;  1JJ2 A;  1OEB A;  1AWJ A;  1VQ8 T;  4C92 F;  1BIA A;  1VOM A;  3LGL A;  4ME7 A;  1QP2 A;  2E6N A;  1VUB A;  4BAC A;  3JCM c;  3DB4 A;  2ZPF B;  5CIU A;  4LDX A;  1G5V A;  2ESW A;  2M51 A;  4NS5 A;  2HNI A;  4FT4 A;  8AT1 B;  3N5B B;  2OTJ A;  3TQ7 P;  2ED0 A;  2I2L A;  3H9N A;  3HL8 A;  3RKY A;  3QYG B;  5CR2 A;  4C92 G;  2DET A;  1ZBJ A;  3MET A;  1YCS B;  4ANJ A;  3OYL A;  1Y71 A;  1M1K R;  1SSF A;  2SEM A;  1X6O A;  4M77 F;  1KHC A;  2C0I A;  4EMG A;  2MCN A;  1SRL A;  2HEQ A;  3FEO A;  2EWN A;  3C12 A;  3TCJ A;  1QVF A;  1AZG B;  1VQ4 A;  3BE3 A;  2JTE A;  1NM7 A;  3O5Z A;  1MMN A;  1PWT A;  2QI2 A;  3JB9 J;  4A54 A;  2L3R A;  8ATC B;  1XNI A;  5IHN A;  2LT4 A;  4MZT A;  1Y0M A;  4PJO E;  4M77 G;  4CC2 A;  2M0O A;  2VGM A;  3EG1 A;  1TH7 A;  1WX6 A;  2ZZD A;  4E7L A;  4FU6 A;  5KE3 A;  3GPL A;  3CME T;  1WJQ A;  3A8G B;  4PKC C;  3CC7 A;  5LJ5 j;  3G6E T;  5GMK i;  4LDV A;  2D9T A;  5DLQ E;  1VQ4 Q;  2VXE A;  5I2M A;  4KGV B;  4A63 B;  5A0L A;  5GAM d;  4J9D A;  2KXD A;  1UHF A;  2L89 A;  3CCQ Q;  4A53 A;  2RHY A;  2DJZ A;  1ZX6 A;  2CKK A;  2MPX C;  2AHJ B;  1H3Z A;  4JJC A;  2XDP A;  1W2B S;  2X3W D;  2O9S A;  3SHW A;  4XTW A;  3EGD B;  4E2F B;  3OY9 A;  3BDL A;  1G3S A;  1QVG P;  2ED1 A;  4ZNX A;  4Q5W A;  3LLR A;  4OMQ A;  3OYI A;  4BE2 A;  1YI2 Q;  1M90 R;  2R58 A;  1NJI U;  4BDZ A;  3CC7 Q;  1KQ2 A;  2JXB A;  2RI5 A;  2XID A;  5GAM e;  2A08 A;  1SSH A;  1WYX A;  2XI9 A;  1PKS A;  2JJ9 A;  4ZGD B;  5EC7 A;  4HVW A;  4C5G A;  2HAX A;  5KCH A;  4OGE A;  3H0H A;  3NTH A;  2KVQ G;  4D6W A;  2NUP B;  1VQN A;  1VQ6 T;  3PVQ A;  1M5Q 1;  2OTJ T;  1M30 A;  3OSS C;  4FYX B;  2K3Y A;  2KEA A;  4ZN1 A;  2EYX A;  3NTK A;  3D7S B;  5GAO q; 
#chains in the Genus database with same CATH homology
 2Y90 A;  2Y4Y A;  4PJO D;  2KSS A;  2RK1 A;  1OZ3 A;  1VQ7 T;  1QVF S;  3RER A;  3CEY A;  1IRE B;  1O9S A;  3FIF A;  4EMK B;  3QJY A;  4M7A C;  1X01 A;  3JAM E;  1UGS B;  4E7K A;  2DTI A;  3ASK A;  4JRK A;  4BE1 A;  1OYX A;  1BI2 A;  4OB0 B;  5FLX E;  4M7D A;  1IZ6 A;  4BI3 A;  2BUD A;  3V7R A;  2DXB A;  2EJ9 A;  3MHX A;  5GAM j;  4A4G A;  4B9X A;  4HCB A;  2HD0 A;  4M77 B;  4XU3 A;  3VUZ A;  3CC2 T;  1VIE A;  2VYT A;  3FLG A;  3LWH A;  2XK0 A;  2LTO A;  4EMK C;  4QVC A;  3OYH A;  4F7U A;  4QW2 A;  5GMK j;  4OMF B;  3CCE T;  4RCC A;  1N8R C;  2CZ6 B;  4O5V A;  2VXF A;  3J81 E;  1KC8 U;  2OTL T;  4M75 F;  5AYF A;  3M53 A;  3QG1 A;  4IUP A;  3L2Q A;  1YJN A;  1Q82 C;  4FIB A;  4J7I A;  4IKF A;  2GCX A;  2LQK A;  5CO7 A;  2XD0 A;  4M77 C;  3OYB A;  3GIB A;  4A4E A;  4C0F A;  4ELZ C;  3CCQ A;  4EDU A;  2QQS A;  3QYH B;  1NE8 A;  3CCS T;  3M9Q A;  1FWZ A;  1YJW A;  1XQH A;  1VQO T;  3BW1 A;  1M8V A;  3BY7 A;  4PLL A;  1G3Y A;  3C95 A;  4NOY A;  3X25 B;  5GAN d;  1NPP A;  3J7A F;  2LQ8 A;  3OMG A;  1KHI A;  2KY9 A;  2YHT A;  2ZPG B;  2CGH A;  3HPW A;  4BE0 A;  1MGQ A;  2JOY A;  2QA4 A;  1KQS S;  1YJ9 T;  3E19 A;  1I4K 1;  4OB3 B;  3URG A;  1K8A U;  2WSF E;  2L8D A;  4HT8 A;  5FU7 B;  4KT0 E;  2BKD N;  4Y91 A;  2EQK A;  2JTF A;  3M4Y A;  4LDY A;  2WSC E;  1BKB A;  2JTM A;  2F5K A;  3GP8 A;  4MDX A;  3QKJ A;  3CCJ A;  1U8R A;  1YIJ A;  1X75 C;  4OB1 B;  4FL6 A;  4XU0 A;  3G7Z A;  5IN1 A;  4M75 G;  5GAN 5;  1YI2 A;  3DKM A;  1Q81 C;  3CCL A;  2EJF A;  5C0M A;  3CCM T;  1VQ5 T;  4GLK A;  2V8I A;  4IUU A;  4XTY A;  2QXF A;  4BD3 A;  4XQ3 A;  3SFM A;  5FU7 C;  2DK3 A;  5FU6 B;  3P8B B;  3PMI A;  2IVW A;  3JB9 D;  4M78 A;  4QQD A;  5CK9 A;  4M7D D;  5GAN e;  1BYM A;  3OYC A;  3QJ6 A;  1VIF A;  3G71 T;  3MEA A;  2FYK A;  2A7Y A;  5J26 A;  4L6V 5;  1VQM T;  3A8L B;  1KQ1 A;  1N9R A;  3MP8 A;  2RJD A;  3MP6 A;  2DVE A;  3X28 B;  5KCO A;  3CME A;  4C8Q A;  5FU6 C;  1XTD A;  1M1K C;  4JUV A;  2E70 A;  3CD6 A;  2P0K A;  2DZ9 A;  4MZM A;  3OYY A;  2K5F A;  4M78 C;  3L2V A;  1WNL A;  3JB9 H;  1K73 U;  4CI0 C;  4JS4 A;  3V8K A;  4RG2 A;  4X9C A;  3J80 E;  3JRZ A;  4J8O A;  3OQ5 A;  3OS0 A;  3S6W A;  2FHD A;  3G4S T;  3A5Z B;  3CCR T;  2HQE A;  4PJO B;  3CPW A;  3F70 A;  5GAN 4;  3CCV A;  1N6A A;  1YHQ T;  3M58 A;  2EIF A;  3VU3 C;  4N4I A;  3I55 T;  2KDS A;  3FDR A;  1O75 A;  2LRQ A;  3A8M B;  2DEQ A;  3QSU A;  4XU1 A;  2EQJ A;  1B34 B;  2ZCF B;  1QVG S;  1AHJ B;  4XTZ A;  3OYN A;  4HT9 A;  4PJO C;  2PUO B;  4JLG A;  1QW1 A;  3H6Z A;  4C92 A;  4E7H A;  4M7D E;  1VQK T;  3V7S A;  2RB6 A;  2RI3 A;  1BIB A;  2FVU A;  3L2Z A;  5CKB A;  3L2U A;  5GAN j;  5GAO n;  4XTU A;  2XDB A;  4KUD K;  3JCM V;  2K5I A;  5KE2 A;  4JRQ A;  3GF5 A;  1WQW A;  4F7U E;  3QPH A;  2K57 A;  4C5E A;  2R5M A;  2KAF A;  2DO3 A;  4MML A;  3CMA T;  3M4G A;  1U1T A;  3JCM b;  1NZ9 A;  2X4X A;  3VYG A;  4M7A A;  4WF2 A;  1JB0 E;  1R8O B;  1JRI A;  2X4Y A;  4O6J A;  5EG2 A;  2K3X A;  2ZPB B;  1U1S A;  3PT9 A;  4RMO A;  2VGN A;  4QQG A;  5LJ3 j;  1VQ8 A;  2MWP A;  5D6Y A;  3SWN A;  3SWN B;  2IG0 A;  5CKE A;  2WAC A;  1D3B B;  2P0P A;  2QEX A;  2JZ2 A;  4PL6 A;  3JCM h;  3HFN A;  5L8R E;  5A2Q E;  3OB9 A;  1VQ9 A;  4OB2 B;  2ZPE B;  4EMK A;  3OW2 A;  1YIT A;  4BI4 A;  3JCM g;  2DZC A;  4JRI A;  1M1G A;  5DM7 R;  5IAY A;  1G3T A;  2RD1 A;  4JRP A;  2EJG A;  2HBP A;  1VQ6 A;  2MAM A;  3QDR B;  2F5T X;  4IUR A;  4IUV A;  4M77 A;  3SWN C;  3R6O A;  2PVG B;  1BI1 A;  4GY5 A;  4KBM B;  3V8L A;  4E7I A;  1VQ4 T;  3CC4 A;  3FRN A;  4DOV A;  1WJS A;  1UGQ B;  3I56 T;  2LC4 A;  1W4S A;  1G3W A;  5GAM h;  1YJN T;  3BDU A;  2QQA A;  4YTL A;  5C6S A;  2RO0 A;  3PIO A;  3CCQ T;  4KUI A;  3EAE A;  2B8A A;  4R55 A;  2DIG A;  3JB9 F;  5GMK h;  2PU9 B;  3C94 A;  4M75 B;  2BIV A;  4M7D F;  1Q86 C;  2YRV A;  5M9O A;  2M1H A;  3MEU A;  3TRE A;  4C0Z A;  5FRN A;  2LT1 A;  2GFU A;  5J39 A;  4N4H A;  4IUT A;  3JCM f;  2O01 E;  3PTA A;  4RG8 A;  2E41 A;  1ZHI A;  1DJ7 B;  1M90 C;  2LDM A;  4M78 E;  5CAI A;  3RMQ A;  1QVP A;  2FB7 A;  2QA4 T;  4F7U F;  2G3R A;  4OP0 A;  2VUB A;  1FX7 A;  1XOV A;  2M16 A;  3OBY A;  2RJC A;  1I8F A;  3GNG A;  4J83 A;  4M75 C;  4XK8 E;  3LWI A;  3CC2 A;  4OGC A;  4C8Q E;  2A3L A;  4C0D B;  4N4G A;  2ZPI B;  5HK0 A;  4E47 A;  3RKX A;  3CCJ T;  2OAU A;  1GXI E;  3S3N A;  1YI2 T;  3JCM X;  3UT1 A;  1K9M C;  3KBG A;  4ELY C;  2RJF A;  3CCL T;  3EFR A;  4Z02 A;  5GAM f;  3CC7 T;  1BI3 A;  3M5A A;  2E1H A;  3S3M A;  1NJI C;  2OTL A;  4RKU E;  2PVO B;  2EAY A;  4M7A D;  4A4H A;  4DQ2 A;  4P5N A;  1KG1 A;  3JSC A;  4HA8 A;  2KK4 A;  4QVD A;  5GAO r;  3JB9 G;  4DOW A;  4M7D G;  2QTX A;  1Q7Y U;  3OYM A;  3Q1J A;  1P92 A;  2E10 A;  4C0D C;  2KQW A;  3X24 B;  5D6X A;  3CCS A;  4XU2 A;  3OBW A;  1VQO A;  5LJ5 h;  2E6Z A;  3OYE A;  5I2S A;  2CZ0 B;  5LJ5 g;  4F7U G;  3ME9 A;  4Y28 E;  1NPR A;  1H64 1;  3WVE B;  3VV0 A;  2DD4 A;  3OYD A;  2X4W A;  4J6W A;  1V29 B;  1ZQ1 A;  4FSX A;  4KUL A;  4CRI A;  3CCU T;  1YJ9 A;  2LVM A;  4LDU A;  4NL2 A;  3JCM d;  5IT9 E;  4XTV A;  3CD6 T;  5D6W A;  1KD1 C;  4C92 E;  3OA6 A;  3CPW S;  2H3J A;  5CKH A;  3CXC A;  2EKO A;  2XG8 D;  3OYG A;  2MI6 A;  4JS5 A;  4BDY A;  4XTX A;  4HCC A;  3CCM A;  1KQS A;  1VQ5 A;  3EFS A;  4MMK A;  4IUQ A;  4TVR A;  4X34 A;  4ATO A;  3G6E A;  1Y07 A;  3MEW A;  5HKC A;  2JVV A;  3JB9 I;  1VQP A;  1OZ2 A;  3LW5 E;  3X26 B;  5GMK l;  4J5Y A;  1UEB A;  2RK2 A;  4QVZ A;  3T9N A;  4BI8 B;  3OS2 A;  1N8R U;  2V8J A;  4M7A E;  3QZ5 B;  1M4Z A;  3BFM A;  2QQ9 A;  1Q82 U;  2GFA A;  5LJ5 f;  3FC3 A;  4A4K A;  2DXT A;  4B9W A;  4PJO A;  2DTO A;  3E9G A;  5DY9 A;  2E64 A;  4MZP A;  4X9D A;  4C8Q F;  3PFS A;  4MDW A;  1LJO A;  3X20 B;  1WJR A;  3L2W A;  2EFI A;  3NFC A;  2RJE A;  3HSB A;  1RL2 A;  2CZ7 B;  2DXC A;  1UGP B;  2HQX A;  4JJN K;  5CKD A;  3C4S A;  3TEE A;  1Y96 B;  1B34 A;  3JCM e;  1LNX A;  2MF2 A;  4C5I A;  3LH0 A;  4BB7 A;  2VC8 A;  2K4Y A;  1VQN T;  1RI0 A;  1I81 A;  1KC8 C;  2R5A A;  3UDC A;  3QZ9 B;  1I5L A;  4M77 E;  5A0G A;  5GAO p;  3VKI A;  1Y7X A;  3ZEH A;  3AHU A;  1EIF A;  2LCC A;  2V8K A;  5GAN 2;  3CCR A;  3OW2 S;  4L59 A;  3QII A;  1W2B A;  1Q81 U;  5GAN h;  5HY6 A;  2RHX A;  2XKO C;  1S72 A;  3HP9 A;  1M1F A;  3HHT B;  4PNO A;  2LNV A;  4LD9 K;  4C8Q G;  1JJ2 A;  1LOJ A;  3KUF A;  3SD4 A;  1VQL T;  2XDD A;  2DXU A;  3L2R A;  4FT2 A;  1VQ8 T;  4OVA A;  4C92 F;  1BIA A;  3DLM A;  2X4J A;  2X35 A;  4J6X A;  2CS7 A;  3LGL A;  4M78 D;  4ME7 A;  4C0G A;  2QEX T;  3GLX A;  1QP2 A;  5GMK e;  2RH2 A;  1UGR B;  2E6N A;  3M54 A;  2LX9 A;  1VUB A;  5CVI A;  1K8A C;  1N9S A;  3PGG A;  3PIP A;  1PSE A;  3NTI A;  1D3B A;  5CQY A;  3OSV A;  3JCM c;  5LJ5 d;  2EQM A;  4NL3 A;  4BAC A;  1HXD A;  3DB4 A;  3JCM W;  4ZGE B;  4HKE A;  2ZPF B;  3VUB A;  2M9U A;  3GNF B;  5CIU A;  5LJ3 h;  4C8Q D;  2RHU A;  5GAN 7;  1VQK A;  4LDX A;  2O4X B;  2PUK B;  3CPF A;  2EQU A;  1G5V A;  2Y4X A;  3FJP A;  3M55 A;  3O8V A;  5LJ3 g;  4M7A F;  4V2S A;  1YBY A;  3L1A A;  4NS5 A;  1M1K U;  4A4F A;  2HNI A;  1YCY A;  4FT4 A;  4LDW A;  1UB4 A;  3ER0 A;  2C06 A;  3N5B B;  3QUI A;  2OTJ A;  5CQX A;  3GOX A;  2FL7 A;  5J3B A;  2I2L A;  3HL8 A;  5GAN f;  1JBM A;  4N0A C;  3RKY A;  2CZ1 B;  3E1S A;  2RHI A;  2VV5 A;  4BY6 B;  2XIC A;  3QYG B;  5CR2 A;  4C92 G;  3DLL A;  5GAM g;  4RCB A;  3SDZ A;  5GAO l;  4L5G A;  4UC4 A;  2E5Q A;  2LCL A;  3MET A;  4M75 A;  1VQ7 A;  3OYL A;  5I21 A;  1Y71 A;  3HFO A;  3WVD B;  1SSF A;  1YJW T;  4FM4 B;  4M7D B;  2EYQ A;  1X6O A;  5DLO A;  4M77 F;  5LJ5 e;  2GQV A;  1KHC A;  2PQW A;  2YLB A;  3V8J A;  4BY6 C;  4EMG A;  5GMK m;  3S3O A;  5LJ3 f;  3HKS A;  3HRT A;  3PNW C;  4C92 D;  4EMH A;  2CYZ B;  3FEO A;  4M7A G;  1K73 C;  2XHC A;  2EWN A;  3C12 A;  3TCJ A;  1QVF A;  4XAX B;  4F7U B;  5A0D A;  4LD6 A;  2DAQ A;  3CBO A;  4JLI A;  2P0Q A;  1VQ4 A;  2QQB A;  4M7D C;  1YIJ T;  2ZGW A;  3I56 A;  4PLI A;  2MMP A;  2JN0 A;  3CCE A;  1OI1 A;  2QI2 A;  3JB9 J;  3L42 A;  1N27 A;  2MWO A;  5CKF A;  4A54 A;  4C5H A;  5KH6 A;  2L3R A;  3FB9 A;  2F69 A;  1XNI A;  3RMS A;  2LT4 A;  4OF1 A;  3MEV A;  4MZT A;  3M56 A;  4BUG A;  2KMT A;  3TU4 K;  3A8O B;  3LX7 A;  3VYH B;  3UWN A;  4M77 G;  3CXC S;  4PJO E;  2M0O A;  2VGM A;  3P8H A;  3ZBD A;  2K2V A;  4J6Y A;  2R57 A;  1TH7 A;  2DPP B;  5LL6 S;  2ZZD A;  1HK9 A;  4FU6 A;  4E7L A;  4ZTF A;  5KE3 A;  4ZTJ A;  1WGS A;  3GPL A;  3JCM P;  2RA2 A;  3CME T;  1WJQ A;  3A8G B;  4M77 D;  3UPU A;  3CBP A;  3V7C A;  4PKC C;  5LJ3 d;  3CC7 A;  5LJ5 j;  2JNG A;  3G6E T;  5GMK i;  4LDV A;  5GAN 3;  4DA4 A;  5FRO A;  1VQP T;  2D9T A;  1M9S A;  5GAN 6;  5DLQ E;  2P4T A;  1ZBX A;  5FRM A;  2VXE A;  5I2M A;  4M75 D;  4HCZ A;  4M78 F;  3CBM A;  2DKG A;  2D0Q B;  3WXM B;  4QQ6 A;  5A0L A;  3CCV T;  4M78 B;  3M57 A;  5GAM d;  5CCA A;  2JUF A;  3INZ A;  2E65 A;  2L89 A;  4VUB A;  1BI0 A;  3P8D A;  4A53 A;  3QXE B;  3LGF A;  1Q86 U;  2RHY A;  2QDY B;  2QQR A;  3RKW A;  2DJZ A;  3CCU A;  2D6F A;  2CKK A;  2L5Q A;  2AHJ B;  4II1 A;  3G71 A;  2ZPH B;  3MO8 A;  4C8Q B;  3VJP A;  1H3Z A;  1M90 U;  1VQM A;  2XDP A;  3DB3 A;  1W2B S;  5GAO m;  3HRU A;  3M59 A;  1WQ7 A;  1Y96 A;  4XTW A;  4J7F A;  1JJ2 S;  3OYF A;  3OY9 A;  5LJ3 e;  3BDL A;  3HRS A;  1G3S A;  3OMC A;  1PSF A;  4PJO F;  4Q5W A;  2E12 A;  4C8Q C;  3LLR A;  2WSE E;  3OYI A;  4BE2 A;  3OYK A;  4JDS A;  4M78 G;  5HK3 A;  1K9M U;  1S72 T;  2R58 A;  3G4S A;  1NJI U;  4BDZ A;  3H8Z A;  4ZGJ B;  1KQ2 A;  2RI5 A;  2DD5 A;  2YLC A;  3QO3 A;  2XID A;  5GAM e;  2RM4 A;  5GAN g;  3JCM J;  3QHS A;  2XI9 A;  1YHQ A;  2GF7 A;  1MHN A;  3LYI A;  4M75 E;  4ZGD B;  4ZN3 A;  3MP1 A;  3I55 A;  1QP3 A;  3A8H B;  3SB2 A;  5GAN 8;  1VQ9 T;  4C92 B;  4C5G A;  2HAX A;  5KCH A;  4OGE A;  2RHZ A;  3OYA A;  1YIT T;  3NTH A;  3QBY A;  2KVQ G;  3MCA B;  3RIR A;  4D6W A;  3PMT A;  1VQN A;  4N0A A;  2DIQ A;  2O4X A;  2DTH A;  3RES A;  1VQ6 T;  2PVD B;  4PJO G;  4E7J A;  3OS5 A;  4R56 A;  1KD1 U;  1M5Q 1;  2OTJ T;  1Q7Y C;  1WPY A;  3CC4 T;  4C92 C;  1FXX A;  2K5L A;  3KXT A;  4M7A B;  1QVG A;  2XU8 A;  3OYJ A;  3ZFJ A;  3JCM Q;  2RI2 A;  3OSS C;  3RUX A;  2K3Y A;  3CMA A;  4EPC A;  4ZN1 A;  3NTK A;  1VQL A;  3OS1 A;  5GAO q;  3E9F A;  2NLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...