1WGSA

Solution structure of the tudor domain from mouse hypothetical protein homologous to histone acetyltransferase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
133
structure length
133
Chain Sequence
GSSGSSGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYST histone acetyltransferase 1
publication title Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 5
structure length 133
sequence length 133
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wgsA00
3QKJA 5J26A 3GOXA 3LH0A 1KHCA 3OYMA 4FU6A 4B9XA 4FL6A 4BDYA 1OZ3A 3SD4A 3BDLA 1OZ2A 2L89A 3L2RA 3L2VA 2GF7A 3LX7A 2EKOA 4NS5A 2RI3A 4EDUA 3OS2A 5KE3A 2LRQA 2YRVA 2R58A 4BDZA 4IKFA 2D9TA 4N4HA 2X4WA 4QQ6A 1OYXA 2GFAA 2RJCA 3OYFA 1SSFA 3OB9A 2RHIA 4IUUA 2O4XA 2LCCA 4IUPA 3EAEA 4C5HA 2FHDA 4PLLA 4OVAA 3DLMA 3PFSA 5D6YA 2MWOA 2RHZA 2DIGA 2GFUA 3NTKA 4C5EA 3O8VA 2R5AA 3OYDA 2DIQA 3OYNA 3FC3A 3OYJA 5C6SA 4Q5WA 3FEOA 3OMGA 3P8HA 3ME9A 2XDPA 3ZEHA 3OYIA 4E7KA 3OYAA 2X35A 4A4HA 4Z02A 5IAYA 3OYCA 3OS1A 4L59A 2NLUA 2LVMA 2MWPA 2RO0A 5KCOA 3L2QA 1MHNA 5FRNA 3MEVA 1WJRA 2DAQA 4X34A 4E7IA 5D6WA 4B9WA 2L3RA 5C0MA 5J39A 1WGSA 3FDRA 3QBYA 2HQXA 2M0OA 3C4SA 4GY5A 4IUVA 4QW2A 5FROA 4BD3A 4ZTJA 1N27A 3QJ6A 2RHYA 5KH6A 4BE1A 2EQKA 2R5MA 3MEUA 3PMIA 4PLIA 3UT1A 3UWNA 4BE0A 3DB4A 3LGFA 2BIVA 3NTHA 3QIIA 2RHXA 2XK0A 3META 3H8ZA 3P8DA 4BACA 4C5GA 2P0KA 3OS0A 2HQEA 2WACA 3H6ZA 3OYKA 2PQWA 2EQUA 4ZTFA 4QVZA 2L8DA 3MEAA 5FRMA 2RJFA 3CEYA 2LDMA 3E9GA 2QQRA 3F70A 3LGLA 3PMTA 2K3YA 4RG2A 3S6WA 3OQ5A 4UC4A 4A4EA 2RJEA 2EQJA 2RJDA 3S3NA 4N4GA 3LYIA 2RI5A 2CKKA 2E6NA 2F5KA 2R57A 2O4XB 2G3RA 4LD6A 1G5VA 5CIUA 3MEWA 2BUDA 3OMCA 4PL6A 5KE2A 4CRIA 2VYTA 2RI2A 3KUFA 3MP1A 3OYHA 3Q1JA 4HCZA 3OY9A 3LLRA 4E7LA 2LTOA 3L2UA 3ASKA 4QQGA 1H3ZA 2RHUA 2X4YA 4E7HA 4IUQA 4C5IA 2M16A 3NTIA 4QQDA 3E9FA 2IG0A 4A4GA 3DB3A 4A4FA 2EQMA 5D6XA 1OI1A 3OA6A 3L42A 3MP6A 3MO8A 4IURA 3OYEA 4N4IA 3MP8A 2JTFA 3S3OA 5M9OA 3OYGA 5IN1A 3OYBA 2JZ2A 2K3XA 3FLGA 2EFIA 4IUTA 3PNWC 2B8AA 2BKDN 2E5QA 2X4XA 4II1A 4E7JA 2QQSA 1WJQA 2M1HA 4BE2A 5KCHA 3OYLA 1WJSA 3L2WA 1RI0A 3M9QA 3S3MA 1XNIA
chains in the Genus database with same CATH superfamily
4FYWB 2CREA 1WXBA 4QKUA 4JLIA 4FL6A 3NHNA 4N0AC 3SD4A 2E70A 3QZ9B 1JJ2P 4XU2A 2EKOA 2K2VA 3VRYA 2YRVA 4N4HA 4C0ZA 3E2UA 2DERA 4C92D 2O4XA 4PJLA 1CKBA 1ZLMA 4FSXA 5HY6A 2O9VA 3RKXA 2EPDA 3NTKA 4KGVB 4R56A 1PSEA 3OMGA 3I56T 4JJNK 3TSZA 2F2VA 2B86A 5IAYA 3ZFJA 1U06A 1OPLA 4KT0E 3CC4A 2RO0A 1MHNA 2CSQA 4M7DF 2KRNA 3QWYA 3JCMX 2KK4A 4RG8A 3CCLA 3QJ6A 2COZA 4A4KA 5GMKj 4HKEA 1TOVA 1KFZA 3TREA 2DPPB 4M77C 4ZTFA 5FWCA 2XKOC 3AHUA 4J9CA 2K3YA 4RG2A 1FWZA 2YLCA 2AHJB 4N4GA 1RUWA 2L3PA 2DXTA 4GBQA 1BYMA 4LD6A 3CC7Q 5KYYB 5CIUA 1YHQT 2BUDA 1Q7YC 1PCXA 4ORZA 1AWXA 3OY9A 1XOVA 4IUQA 1K1ZA 1QW1A 1Q7YR 2QASA 1TXQA 3FB9A 4HT8A 3CPWA 3CCVT 4IURA 3NPFA 2VV5A 3CCJQ 3G71A 4RCBA 1SHGA 2FYKA 2YUQA 1GCQC 2K5FA 4MDXA 2XIDA 8ATCB 2DRMA 3OBWA 3RBBB 6AT1B 3OYMA 3UATA 5I2MA 2L2PA 3LWHA 3I55T 1NLPC 2KSSA 4F7UE 4M7AB 2VGMA 4LN2A 2DVJA 1TS9A 3ULRB 3OB9A 2HL5C 3RR6A 3DLMA 3QHSA 4MZMA 1RAAB 2KMTA 1QKXA 3FRNA 1VQPT 4CI0C 2YWWA 2C06A 3SWNB 3P8HA 4VUBA 4F14A 3G4SA 3OYCA 4F04B 2KT8A 3LWIA 1OV3A 3H0FA 3KXTA 2XICA 4JRPA 5L8RE 5FU7C 5IH2A 1E6GA 4XK8E 1VQ9A 4GY5A 1TU0B 2PTKA 4FT2A 1N27A 1Q86C 1BIAA 4EPCA 1DJ7B 1M3BA 2Y4XA 4C8QC 3CCEA 3EHRA 4PJMA 1QP3A 1ZBJA 4KGZB 1N6AA 4MMLA 3OYKA 2KRSA 2QI2A 1I81A 1QVGS 3OQ5A 2JTMA 2QA4T 3S3NA 2QEXA 4A54A 2RQRA 3TU4K 1C6VX 2F5KA 4J9FA 3CMEQ 2XMFA 4EMKA 3U23A 5GANj 2RI2A 3KUFA 1X01A 4XTXA 1VQ8Q 1BI3A 2CYZB 3QXEB 3EH1A 3HHTB 2KI7A 3EFOB 1K76A 1RAIB 1YWOA 2DZCA 4GLMA 1Q7YU 1VYVA 3L42A 3VUZA 4K11A 2M02A 3VS7A 3OYBA 2EFIA 4IUTA 4M7DC 1ZSGA 1EX4A 2ZCFB 1NG2A 3RESA 2L0AA 2QYZA 2RNAA 4OMMA 5GAOn 2YRDA 1KHCA 1WA7A 4PJOF 2CUDA 4ELYC 3J7AF 4JRKA 2L89A 3L2RA 4OGEA 4J6WA 3I9QA 4DA4A 2E5KA 4J9GA 4CC2A 4QVDA 3V8LA 4E7ZA 3WXMB 3SB2A 3M59A 1D0ZA 3MKDA 1K9AA 3VU3C 1QCNA 2HCKA 2DEQA 1QVGP 1S1NA 2CP6A 3HPWA 1YJNQ 3UA6A 4JPBW 1U1SA 2VXEA 3CPFA 1C0MA 2F5TX 3AT1B 1KSWA 2QK0A 3L2QA 3NFCA 2DAQA 2D0NA 2HSPA 1VQ7Q 5GANd 1J3TA 4FYVB 3PGGA 1PD0A 2HZYA 1VQKQ 4DQ2A 1WPYA 1VIFA 2FL7A 2JVVA 5CQYA 2DXUA 2BIVA 4HVWA 1QVFA 1Q86U 3FJ5A 2CT3A 5GANh 1TWBA 1YN8A 1LCKA 4C0GA 4MDWA 4J6XA 2QQRA 3CC4T 5IXBA 4LDWA 4A4EA 5CKEA 2OTJQ 2CP7A 1B34B 2D1XA 3M5AA 4XTYA 1IGQA 2CSIA 1N8RC 2E10A 5D7UA 1RAHB 1QMCA 4F16A 3CCJA 9ATCB 4FIBA 4R0KA 1N8RR 3GLXA 4JDSA 4DOVA 3CMAQ 2AT1B 3M55A 1W1FA 1SF9A 1X6OA 4LDVA 2RHUA 5A2QE 1Y96B 3E9FA 3DB3A 1YNZA 1P92A 1N9SA 3FLGA 3GIBA 4E7SA 1ZSZA 1ZA1B 4E7JA 2D8HA 2QTXA 2RB6A 4C8QE 2CP2A 3M9QA 1VQLQ 4OMFB 1K8AR 3GOXA 2NUPA 3EGXA 2ZPBB 5A0GA 1SHFA 1PHTA 2JM9A 5GAMd 1BI2A 4LDXA 5AT1B 4J8OA 1OPKA 3CCQQ 3HRTA 3L1AA 2LRQA 5GAMg 1OYXA 3G71T 2JUFA 3ER0A 1N9RA 2IPOB 1GCPA 1ABOA 2J7IA 2GFUA 2EW3A 3C95A 4C5EA 3EGDA 3RERA 2DTHA 3ZEHA 4M4ZA 2VVKA 3MHXA 2X35A 2MPXC 4F7UB 1WFWA 1T0HA 4Y28E 2RQVA 1YI2Q 4M7DE 4HA8A 3VYHB 2NUTA 3QBYA 1D0YA 4M75A 3OSVA 1HJDA 4FCYA 2ROLA 1Q82C 3JB9J 1Z9QA 2KBTA 4ELZC 1UDLA 1M8MA 5FW9A 2ENMA 1G8XA 2HNIA 4XU1A 4C5GA 2JXBA 3CMEA 5KYWA 2RN8A 2DZ9A 3G4ST 3G1JA 2LDMA 1YJWQ 1X43A 1VQ8A 3RMSA 1WHHA 3ZL7C 1T0JA 1VQ9T 1I1JA 3HRSA 1TSFA 1WLPB 3EG9B 2MK5A 3JCMQ 3CCMT 5L23A 2E65A 3VYGA 5KE2A 1N8RU 3V7CA 3BE3A 1UUEA 1YP5A 2K7AA 3L2UA 1QKWA 2M16A 2DLPA 3P8BB 1ZQ1A 1QP2A 4N4IA 4JJBA 1UGVA 4M75G 1YITQ 1M90C 2W0ZA 2E5QA 1HXDA 4XTVA 3OYLA 2GNCA 1RI0A 2LJ1A 1XNIA 3LH0A 2JS2A 4B9XA 4NL2A 4M78A 2LX7A 1YJNA 2C0TA 2RHIA 1WXTA 1UE9A 4C5HA 2FHDA 1TUCA 2LC4A 5D6YA 1KQSS 2RHZA 1VQ7A 2JTEA 2A08A 2DIQA 5GAOl 4KBMB 3A8HB 3T9NA 4M77F 4RTVA 3V7RA 2QTVA 1ZUKA 3CCSA 4X9DA 4RTWA 1WJRA 4CC4B 1BK2A 3X25B 1NBEB 1YIJA 2OTJA 2CDTA 2BZ8A 3LGFA 3CXCS 1U1TA 1Q82U 1R0CB 2BE9B 1WHLA 4M78G 2NYSA 1WQWA 4J9HA 1PM3A 4EMKC 3CMAA 3JB9G 1H3HA 4C92A 2ATCB 1MMGA 3JCMg 2CKKA 1RI9A 1KQ2A 2FVUA 1QWEA 2HKQB 2ZGWA 4M75F 1UEBA 1G3TA 1LNXA 3Q1JA 2LTOA 1VQLA 3HKSA 4A4FA 3E19A 2Y4YA 1YJ9T 1KQSP 2ZPGB 2EWNA 4M78D 2YRCA 5KYYA 3CCQA 1S72Q 4II1A 4BI4A 5HK0A 4PFOA 1NYGA 5KYXA 2J6OA 1M90U 1FYNA 3QKJA 4JUVA 3JB9I 2ESWA 2ABLA 2E4HA 2JT4A 4PJOE 1U8RA 1AT1B 1GFDA 1I07A 4RKUE 1OZ3A 4RTUA 3L2VA 5GAN6 3EFRA 5LJ3g 5GAN2 4JZ3A 1LJOA 4C92G 1X2KA 3BDUA 4EDUA 4FW2A 1QLYA 4C8QB 3QYGB 3CXCP 3CC2Q 1I8FA 2CP5A 4IUUA 1JO8A 4OVAA 1YI2A 1BI1A 3OYDA 4OP0A 1W70A 4M7AA 5I22A 2VKNA 3HTRA 1D1BA 5FRNA 1AZGB 1X69A 4B9WA 1YJWA 2KXDA 1IREB 2E41A 3JB9F 3SWNA 5GMKi 4BI3A 3DB4A 5KYUB 2DL7A 4PFPA 4E2FB 1EIFA 5CAIA 2OJ2A 4J7IA 5LL6S 2EQUA 4FW1A 4J9EA 4HVVA 4M7DB 1UECA 3LGLA 4D6WA 4LDYA 1RAEB 1NPPA 2CH4W 2DKGA 5LJ5e 1H641 3CD6T 4OMLA 2YXYA 3RKWA 2LJ3A 3EG1A 2L5QA 1YITA 1ACMB 1ZUYA 2DL5A 5IHIA 2KYBA 3JCMc 1VQ5Q 3MEWA 4WCIA 3G6EQ 3V8KA 1ZSZC 1LOJA 1YCSB 1VQOQ 3MP1A 3OYHA 4M7AG 4ME7A 1IZ6A 3SEMA 1YCYA 2RD1A 2MF2A 5FWBA 1RADB 3INZA 3I35A 3M0RA 4OB0B 3RKYA 1BI0A 2EGEA 1VQ4Q 2ZPEB 1IHWA 2OTLQ 2RK1A 3PNWC 2K57A 4C92F 2ZZDA 2H8HA 3M0SA 1ZHIA 2FPEA 4JZ4A 4AFSC 3EFOA 2CZ7B 4FU6A 3BDLA 2PVOB 3LX7A 2MMPA 1SKUB 1VQ6T 4M7AD 2O9SA 1SSFA 2EIFA 1M2VB 3EFSA 1KC8C 1X2QA 1UGPB 2R5AA 2DXCA 2JJ9A 4M75C 3CCRT 1V1CA 4J9DA 2AZVA 3H0IA 1KC8R 4A4HA 8AT1B 2G6FX 3UPUA 1Y07A 1D3BA 2FZKB 3M4YA 1OX8A 1NEGA 4Z89A 2DM1A 5J39A 4IUVA 1BU1A 4HCBA 1JU5C 2EBPA 5LJ5f 3VJPA 1VQ7T 4ZN1A 1XJWB 4FSSA 4LDUA 3URGA 5GMKh 1OQKA 2LX9A 3CCST 2V8KA 1EZZB 5DLQE 3RDVA 4OMPA 3M56A 1TH7A 4C0DC 2VUBA 1G3WA 3EH2A 2O4XB 1SEMA 1YIJT 2OTJT 2COYA 1S72A 2YDLA 2JMAA 2VYTA 2CP3A 2A7YA 1Q86R 1OX9A 3J80E 1W4SA 1IB8A 1VQNT 3QPHA 5CKHA 3L2ZA 1OI1A 1B34A 3CMAT 1G83A 3S3OA 1W6XA 2A37A 2OAUA 3CBPA 4M78C 2I0NA 1WQ7A 1KJWA 1FX7A 3SDZA 2LMJA 2DETA 4KRTA 2IVWA 3HP9A 4RCCA 3CC2A 4JS4A 1Y96A 3H41A 1NJIC 2QXFA 5DY9A 2F2WA 4NS5A 2JW4A 4AFZC 2K4YA 1V76A 2FB7A 2BZXA 4XAXB 4Z88A 2ZPHB 4PJOB 1LPLA 4JLGA 4BY6C 5C6SA 4KUDK 2GQIA 3PVQA 4M77E 1KC8U 3GF5A 1X6GA 2YT6A 1JJ2A 4OMOA 5KCOA 1WHKA 2W10A 3VS0A 3QG1A 4WF2A 1IO6A 3SFMA 4C92C 1M3CA 2EVRA 1YI2T 4FM4B 3OW2S 1YFNA 2KR3A 2LNHB 5GAN7 2PUOB 2K2MA 1VQ5A 1QQJA 3M0UA 3G6EA 1BIBA 3E9GA 4C0FA 1VQOA 2KNBB 2XDDA 4UC4A 1NPRA 2ED0A 1G3SA 2RJDA 3HFNA 4HVUA 1YJWT 1AEYA 2E6NA 1K4US 3EGUA 1VQ4A 5CKBA 2OTLA 3I55Q 4M75E 2K5IA 4PL6A 1VQMQ 5GANg 2J05A 4AG1C 4HXJA 4QQGA 5CR2A 2X4YA 3CC7A 1I5LA 1RAFB 1V29B 1H92A 2O88A 1VQPQ 3TCJA 1QWFA 2EYWA 2E6ZA 1ZUUA 1TUDA 2BKDN 2HL3A 3M58A 1WJQA 4AFUC 2LP5A 3JB9H 1TTHB 3CCLT 1YITT 2LCSA 3A8OB 2JOYA 4J9BA 1W2BS 2AIRB 2OI3A 1KG1A 1OZ2A 2MYSA 1PSFA 1PG5B 2DF6A 3WVEB 1NJIU 2FRWA 2R58A 2E1HA 3OW2P 4M7AC 5EC7A 2QGGA 2IIMA 1NYFA 2DTIA 4XTUA 4PJNA 2EAYA 2RQTA 3OYNA 2QA4Q 4EMKB 2A36A 3VS2A 5I11A 4Z02A 2LQKA 2DL4A 3SWNC 4JJCA 3FIFA 3MEVA 4L5GA 3ZBDA 1ZBXA 3JSCA 4AFQC 2D8JA 1GBQA 3R6OA 2X4JA 2YUOA 1K0SA 3JV3A 4LUEA 3VS6A 1KK7A 3A8MB 5IT9E 3H8ZA 2X3WD 1PRLC 2FEIA 1OEBA 2PVGB 4E6RA 3QJYA 5CQXA 1SG5A 1UHFA 1K73C 1PNJA 2RJEA 2KE9A 2YUNA 1W2BP 2PVDB 1VYTA 5EG2A 2DBMA 2KXCA 1G5VA 3WVDB 4OB2B 1SPKA 1Q82R 5FU6B 1H3ZA 2SRCA 3VV0A 1RAGB 2M9UA 3NTIA 1O9SA 4QQDA 2IG0A 2P0PA 2EQMA 3MP6A 2HBWA 1ABQA 5GMKm 4PK4A 2JZ2A 3C12A 3LH5A 3FJPA 3M0PA 5HCKA 1R0BG 1PKSA 2XD0A 3CPWS 1GXIE 2WSEE 4C92E 2A28A 4FYYB 1HK9A 5J26A 3VS1A 3CCET 2V1RA 1S72T 2EGCA 3V7SA 1QCFA 3OSSC 4Y91A 2GTOA 2GF7A 1SRLA 1KD1C 2QQ9A 3QDRB 5GAN4 1VYUA 2KRMA 2KY9A 2RQWA 4PNOA 2MCNA 2LCCA 4RTXA 2JN0A 2QEXT 2EYZA 3QO3A 1LVKA 2DIGA 4MMKA 1M90R 5GJWB 1UGQB 5LJ5j 3CC2T 1MV0B 4E7KA 4D8KA 1AWWA 4L59A 3CCUQ 1WYXA 5I21A 2O01E 4NOYA 4X34A 4DBFA 5D6WA 3UF4A 1AHJB 4V2SA 1R8OB 3HL8A 2LCLA 2BTTA 5KH6A 3G7ZA 1E6HA 1R77A 1OOTA 3OS5A 2H3EB 4OB3B 4BE0A 3QIIA 4M77B 5GAMe 1QVGA 4ATOA 1VQKA 2HQEA 1UTIA 2K9GA 4J5YA 2L8DA 2EGAA 2RJFA 1VQMA 3F70A 3PMTA 1Y7XA 3CPWP 1IHVA 2DE0X 2C0OA 3NGPA 1Q81C 3BFMA 1GL5A 1D1CA 4AT1B 2V8JA 4KH1B 1K73U 1VQPA 2R57A 3V8JA 2KVQG 1Q81R 4DEYA 2DEUA 1VA7A 3OBYA 2LJ0A 3EGDB 3ASKA 4PKCC 4GLKA 1T3LA 1MGQA 4YTLA 1VOMA 3G6ET 2LT4A 2RQUA 3PT9A 1WNLA 1VQOT 5M9OA 2K6DA 1FMVA 2K3XA 3CQTA 3KFVA 2XU8A 5A0LA 1ARKA 5LJ5d 2B8AA 3MJXA 4RTZA 4M75B 4HT9A 1GRIA 3JCMb 2EJFA 3S3MA 1VQ4T 1C1AA 2OTLT 2QDYB 5LJ5h 1FMWA 2X51A 4FYXB 2P4RA 5KYWB 3CC7T 2QA4A 4ESRA 3THKA 2RI3A 4PJJA 3TSWA 3JCMJ 2A0FB 1NZ9A 3M0QA 2GFAA 1D1AA 4C8QD 2V1QA 1KD1U 4AMCA 1F1BB 2M51A 3VRZA 2CUBA 1BBZA 3CCJT 1M1KC 1X27A 2LZ6B 2DYBA 5IXFA 5FU7B 3EG0A 2MWPA 4RMOA 5GAN8 1KIKA 4C0DB 3CCMQ 2L3QA 1M5Q1 2DJQA 2RH2A 5CK9A 3N5BB 2MOXA 3UWNA 2J06A 2KAFA 1Y0MA 4ZN3A 4BACA 3H9NA 1UJ0A 1IGUA 1QVFS 2WSFE 4M7DD 2AKKA 2EQJA 2E3IA 4M78F 2VXFA 3R6NA 3LYIA 4ZGDB 1RABB 2XHCA 1K9MC 3QZ5B 3QSUA 2CZ0B 1Z9ZA 4BUGA 1AZEA 3EG2A 1Q81U 1HYOA 2JNGA 4XU0A 3CBOA 1K9MR 1XQHA 4FT4A 1PKTA 3M54A 1EFNA 2E3HA 1M4ZA 3OA6A 1BKBA 1E7OA 1RLPC 2LNVA 1SSHA 2JTFA 2HQHA 3UDCA 4CC3A 4P5NA 1M1FA 2O2OA 5IHKA 1ZA2B 2FZGB 4J9IA 5KCHA 4BY6B 2PZ1A 1NEBA 1PRMC 1UGRB 3JCMe 2A3LA 2P0QA 2VC8A 2ED1A 2LQ8A 2CGHA 4EMGA 3CMET 1MMAA 2QDLA 2J6FA 2X3XD 2YUPA 5KE3A 4IKFA 4J7FA 4BDZA 2OAWA 3CCUA 4C92B 1VQ8T 2EYYA 2GCXA 1RL2A 2HD0A 4IUPA 3EAEA 4PLLA 3PFSA 1B07A 1BCMA 5DM7R 2BE7D 1OULA 3CBMA 1AOJA 4LXCA 3PIOA 1QVFP 2K79A 1QCOA 1WHJA 1WI7A 2AK5A 2E12A 1M1KU 1B7TA 4R55A 3EHQA 4JRIA 2EJ9A 4PJOA 2RHYA 5LJ3e 2DMOA 2WSCE 2KDSA 4PLIA 3UT1A 2HEQA 5KYXB 1YJ9Q 3META 2GGRA 4JRQA 2FPFA 2P0KA 4KGXB 5FRMA 3M0TA 4ZGJB 1WHGA 3PVLA 1YJNT 2CS7A 2LQWA 2RK2A 4PFZA 2DX1A 1RLQC 2P84A 1D0XA 5CO7A 3A8GB 4CRIA 2QQBA 1K9MU 2OX7A 2JS0A 1VQKT 2NUZA 3JCMf 1WZOA 1VQMT 2DD4A 1AWOA 1QVPA 2KT1A 4M7AF 4PJOG 2RM4A 2H3JA 2RF0A 2DA9A 3GBQA 1AVZC 4X9CA 3IQLA 1M8VA 2KYMA 2QGFB 1YWPA 4LE9A 1XTDA 3E1SA 2AZSA 5CKFA 4BDYA 5GAN5 3OS2A 3JCMW 4J83A 1KQSA 2X9HA 3HFOA 3C94A 2D9TA 2HAXA 4QQ6A 1FMKA 2K5LA 4DOWA 3A5ZB 3I56Q 3CCMA 2ZPIB 2XDBA 1ZX6A 3RUXA 3H0HA 4Y92A 3VUBA 3O8VA 5LJ3f 4PJOD 4EIKA 1MUZA 1Y57A 2LQNA 2PU9B 3ME9A 2XDPA 3BY7A 3CD6Q 2RA2A 3MCAB 7AT1B 3PE0A 4TVRA 1VQLT 2DRKA 5CKDA 3HSBA 2L3RA 5C0MA 1NJIR 3X28B 3C4SA 2M0OA 3TEEA 4BD3A 3CXCA 1X75C 2EJGA 3CCQT 1JEGA 1MNEA 3NTHA 2J6KA 3P8DA 1AD5A 2FO0A 5A0DA 2F1LA 1CKAA 4QVCA 5AYFA 1YHQQ 2C0IA 2EQIA 2VGNA 2G3RA 2RMOA 1D09B 1VQ6Q 1B3QA 3CCVQ 4F7UA 5HK3A 4HCZA 4OB1B 1U5SA 4E7HA 4C5IA 4XTZA 2PUKB 3OYEA 4O6JA 5GMKe 2DNUA 1WDXA 1D3BB 3CCRQ 2GQVA 1NE8A 4JS5A 2NWMA 4BE2A 5GAOq 4XTWA 1CSKA 3SHWA 2AKLA 1A0NB 3EG3A 2HSEB 4Z8AA 1JBMA 1NM7A 4MZTA 2DL3A 5HKCA 1VUBA 4DEXA 3BW1A 1UHCA 1MNDA 2DILA 2FG0A 2EKHA 5GAMj 2MIOA 2RJCA 3EG9A 2HKNA 4LNPA 1VIEA 2I2LA 4N0AA 5KYNA 3RMQA 2SEMA 3CCSQ 1Q95G 4F7UG 3MPUB 3D7SB 3FEOA 4OMNA 5GAOp 3M57A 3OYAA 4ZNXA 1YJ9A 2CT4A 3UA7A 4RTYA 4DBQA 5CCAA 4E7IA 1YIJQ 1WHMA 3FDRA 2HQXA 4QW2A 1YBYA 2KEAA 3CCUT 3VS5A 5GMKl 1VQNQ 2ZPFB 2PNIA 2ZAEA 5I2SA 3M53A 3GNGA 2ROTA 3KBGA 4QVZA 2E64A 1JXOA 3S6WA 4X1VA 3REAB 2DD5A 4J6YA 1Y71A 3DKMA 1K8AC 4OF1A 3J81E 4M78E 4KUIA 4M77A 2F69A 1AWJA 3O5ZA 3LW5E 3OMCA 1I5OB 3PTAA 4E7LA 2EYQA 4MZPA 3TQ7P 1WX6A 2V26A 3A8LB 3REBB 4DBHA 1SRMA 2X4XA 5GAMh 2FRYA 2QQSA 1PWTA 2M1HA 3JRZA 4QT7A 1K73R 3L2WA 2D0QB 3HRUA 4WTOB 1T3SA 2GBQA 2Z0WA 3I56A 2COWA 3I5SA 5FLXE 2JMCA 2V8IA 1KQ1A 4JJDA 1MMDA 1JQQA 4ANJA 1GCQA 4F7UF 3CD6A 4F17A 2F2XA 3X26B 5GANe 1KHIA 3QUIA 3OYFA 2YSQA 4M77G 2BZYA 3PIPA 4XQ3A 1IRXA 2CZ1B 2MWOA 4AG2C 4OGCA 3X20B 3QWXX 2KROA 2JM8A 1JXMA 1M30A 3FC3A 3OYJA 5DLOA 4Q5WA 2P4TA 3VKIA 4PJOC 3JCMP 5ECAA 2NLUA 1GBRA 2LVMA 3M4GA 1HD3A 1N5ZA 1UJYA 1WGSA 4ZTJA 1KD1R 5IHNA 4BE1A 2EQKA 2EYXA 4HCKA 1YHQA 2HMAA 2XK0A 3CC4Q 2FPDA 4M77D 1G2BA 1M1GA 4B6MA 2HBPA 1VQ6A 3MEAA 1MV3A 3CCVA 1RACB 4KULA 2GTJA 1M9SA 4OMQA 3CCLQ 4C8QA 1PD1A 2CZ6B 3OYYA 2DXBA 1JB0E 2DFUA 1ZSZB 3CCRA 4LUDA 1TG0A 1K8AU 1M2OA 3RIRA 3QYHB 1TUGB 3LLRA 3TVTA 2NUPB 4LD9K 3EGXB 1WXUA 2HDAA 3I55A 2DK3A 2DVEA 5D6XA 3MO8A 4CC7A 4DBRA 2L3SA 2O31A 4M7AE 3NMZC 4BB7A 2ECZA 5GANf 5GJVB 5KYUA 4XU3A 4M75D 3JAME 3GPLA 4A53A 2VB6A 5J3BA 2XG8D 1OU8A 1GFCA 2MI6A 5GAN3 3VS3A 1I4K1 4M7DA 2QAZA 2CH4A 5LJ3j 3G71Q 4IIMA 2K3BA 3RNJA 1JRIA 4C8QG 4EMHA 1VQ5T 1BB9A 2MAMA 1I0CA 4ZGEB 2X4WA 1U3OA 1UFFA 2NUTB 3QDFA 4D8DA 1X6BA 3X24B 3JCMV 5LJ5g 3JCMd 3OYIA 1VQNA 2QQAA 5CVIA 2DYIA 3OS1A 2CP0A 3GNFB 1WIEA 4RUGA 2QG9B 4IIOA 1UG1A 4RTTA 1IXDA 1PC0A 1JJ2S 4KH0B 1NLOC 3JCMh 5FROA 3GP8A 3OW2A 3C0CA 4BI8B 2R5MA 3G4SQ 1OU9A 3MEUA 3PMIA 2XI9A 2YLBA 2RHXA 1G3YA 2DL8A 4M7DG 2DO3A 3DLLA 3OS0A 2WACA 3H6ZA 1VQ9Q 2PQWA 1UB4A 2VWFA 3A98A 3VS4A 3CEYA 1M1KR 5GAMf 1K0XA 1UGSB 4E47A 5GAOr 2YHTA 3A1PA 2VASA 4O5VA 1M3AA 3CCEQ 4L6V5 4NL3A 1MMNA 2RI5A 1M2VA 3I5RA 3JB9D 1O75A 2DBKA 2RPNA 5GAOm 5LJ3d 2M0YA 2FZCB 2KQWA 1FXXA 2KGTA 1BCOA 5FU6C 2Y90A 4A4GA 2QEXQ 2LT1A 5LJ3h 4HCCA 1H8KA 4A63B 4M78B 3MP8A 3OYGA 5IN1A 1M27C 2D6FA 1W2BA 2DTOA 4C8QF 1HSQA 1WJSA 2DJZA
chains in the Genus database with same CATH topology
2JOYA 3LH0A 1W2BS 1XTDA 3E1SA 1KG1A 4JLIA 5CKFA 4B9XA 4FL6A 4BDYA 4N0AC 3SD4A 1OZ2A 2E70A 3QZ9B 4NL2A 4M78A 5GAN5 1PSFA 4XU2A 2EKOA 3WVEB 3OS2A 1YJNA 2K2VA 3JCMW 4J83A 1KQSA 2YRVA 3HFOA 2R58A 1NJIU 3C94A 2E1HA 2D9TA 4N4HA 4C0ZA 4QQ6A 2HAXA 4M7AC 2K5LA 4C92D 2RHIA 4DOWA 2O4XA 3A5ZB 4C5HA 2FHDA 3CCMA 2ZPIB 2XDBA 2LC4A 5D6YA 1KQSS 2RHZA 4FSXA 3RUXA 2DTIA 5HY6A 1VQ7A 4XTUA 3RKXA 3VUBA 2EAYA 3NTKA 3O8VA 5LJ3f 2DIQA 3OYNA 4PJOD 4R56A 1PSEA 5GAOl 4EMKB 4KBMB 2PU9B 3A8HB 3OMGA 3ME9A 2XDPA 3T9NA 3I56T 4JJNK 3BY7A 4M77F 4Z02A 2RA2A 5IAYA 3MCAB 3ZFJA 2LQKA 3V7RA 4TVRA 3SWNC 3CCSA 4KT0E 1VQLT 3CC4A 2RO0A 4X9DA 1MHNA 5CKDA 3FIFA 3MEVA 1WJRA 3HSBA 4M7DF 2L3RA 5C0MA 4L5GA 3X28B 3C4SA 2M0OA 3TEEA 3X25B 1ZBXA 3JSCA 3ZBDA 4BD3A 2KK4A 4RG8A 3JCMX 3CXCA 3CCLA 3QJ6A 3R6OA 2X4JA 1X75C 2EJGA 1YIJA 3CCQT 2OTJA 4A4KA 5GMKj 3NTHA 3LGFA 4HKEA 3CXCS 1U1TA 3A8MB 5IT9E 3H8ZA 3P8DA 1Q82U 3TREA 2DPPB 4M78G 4M77C 4ZTFA 2XKOC 1WQWA 3AHUA 4EMKC 2PVGB 5A0DA 3CMAA 3QJYA 2K3YA 5CQXA 4RG2A 3JB9G 4QVCA 4C92A 1K73C 1FWZA 2RJEA 5AYFA 2YLCA 3JCMg 2AHJB 4N4GA 2DXTA 2CKKA 2PVDB 2VGNA 5EG2A 1KQ2A 1BYMA 2FVUA 4LD6A 2G3RA 2ZGWA 1G5VA 5CIUA 1YHQT 4M75F 3WVDB 2BUDA 4OB2B 1Q7YC 1UEBA 1G3TA 1LNXA 4F7UA 3Q1JA 4HCZA 1XOVA 4OB1B 5FU6B 2LTOA 5HK3A 3OY9A 3HKSA 3VV0A 1VQLA 2M9UA 4E7HA 4IUQA 4C5IA 4XTZA 3NTIA 1O9SA 1QW1A 4QQDA 2P0PA 2PUKB 2IG0A 3FB9A 4A4FA 2EQMA 3CPWA 4HT8A 3CCVT 3MP6A 3OYEA 4IURA 3E19A 2VV5A 2Y4YA 4O6JA 5GMKe 5GMKm 1D3BB 1YJ9T 2ZPGB 2JZ2A 3G71A 2EWNA 3C12A 4M78D 2GQVA 4RCBA 1NE8A 3FJPA 2XD0A 2FYKA 3CPWS 3CCQA 4II1A 4BI4A 5HK0A 4JS5A 2WSEE 1GXIE 4C92E 2K5FA 4BE2A 4MDXA 2XIDA 5GAOq 4XTWA 1M90U 3QKJA 4JUVA 1HK9A 5J26A 3JB9I 3OBWA 3CCET 1JBMA 3V7SA 3OYMA 1S72T 1U8RA 4PJOE 3OSSC 4Y91A 4MZTA 4RKUE 1OZ3A 5HKCA 3L2VA 5GAN6 2GF7A 5I2MA 1VUBA 3EFRA 5LJ3g 5GAN2 3BW1A 4C92G 1LJOA 3LWHA 3I55T 1KD1C 2KSSA 2QQ9A 3BDUA 3QDRB 4M7AB 2VGMA 4EDUA 4F7UE 5GAN4 2KY9A 5GAMj 4C8QB 4PNOA 2RJCA 3QYGB 3OB9A 1I8FA 4IUUA 2LCCA 1VIEA 2I2LA 2JN0A 3DLMA 4N0AA 3QHSA 4OVAA 4MZMA 2QEXT 3QO3A 2DIGA 1BI1A 2KMTA 3RMQA 4MMKA 3FRNA 1VQPT 4F7UG 4CI0C 3OYDA 4OP0A 1UGQB 2C06A 5LJ5j 3FEOA 3SWNB 3P8HA 3CC2T 4VUBA 5GAOp 3M57A 3G4SA 4E7KA 3OYAA 3OYCA 4M7AA 3LWIA 4L59A 1YJ9A 5I21A 3KXTA 2XICA 4JRPA 5L8RE 2O01E 5FRNA 4NOYA 5FU7C 4X34A 4E7IA 5D6WA 4XK8E 5CCAA 4B9WA 1VQ9A 1AHJB 4V2SA 3FDRA 4GY5A 1R8OB 2HQXA 3HL8A 4QW2A 1YJWA 1YBYA 3CCUT 2LCLA 4FT2A 1N27A 1IREB 2E41A 1Q86C 1BIAA 5KH6A 4EPCA 3G7ZA 5GMKl 3JB9F 1DJ7B 2ZPFB 2Y4XA 4C8QC 3CCEA 3OS5A 3SWNA 5GMKi 4BI3A 4OB3B 4BE0A 1QP3A 3DB4A 3QIIA 4M77B 1N6AA 5I2SA 5GAMe 1QVGA 4ATOA 1EIFA 3M53A 1VQKA 2HQEA 3GNGA 4MMLA 5CAIA 4J7IA 5LL6S 3OYKA 2EQUA 4J5YA 2QI2A 3KBGA 4QVZA 2E64A 2L8DA 2RJFA 1I81A 1VQMA 4M7DB 3F70A 3LGLA 1Y7XA 3PMTA 4D6WA 4LDYA 1QVGS 3S6WA 3OQ5A 2JTMA 1NPPA 2DD5A 2QA4T 4J6YA 1Y71A 2DKGA 5LJ5e 3DKMA 1K8AC 4OF1A 3S3NA 3J81E 1H641 4M78E 3CD6T 2QEXA 4A54A 1Q81C 3BFMA 3TU4K 3RKWA 2V8JA 1K73U 4KUIA 2F5KA 2F69A 2L5QA 2R57A 4M77A 1VQPA 1YITA 3JCMc 3V8JA 3LW5E 4EMKA 2KVQG 3MEWA 3OMCA 5GANj 3OBYA 3V8KA 1LOJA 2RI2A 3KUFA 3PTAA 1X01A 3MP1A 3OYHA 4E7LA 4M7AG 4ME7A 4XTXA 1BI3A 2CYZB 1IZ6A 3ASKA 3QXEB 1YCYA 4PKCC 4GLKA 2RD1A 2MF2A 3HHTB 1MGQA 4YTLA 2EYQA 2DZCA 4MZPA 3G6ET 2LT4A 1Q7YU 3L42A 3INZA 4OB0B 3VUZA 3PT9A 3RKYA 3A8LB 1BI0A 1WNLA 1VQOT 5M9OA 3OYBA 2ZPEB 2K3XA 2EFIA 4IUTA 2RK1A 2XU8A 5A0LA 3PNWC 5LJ5d 2B8AA 2ZCFB 4M7DC 2K57A 2X4XA 5GAMh 2QQSA 4C92F 4M75B 4HT9A 2M1HA 3JRZA 3RESA 3L2WA 2ZZDA 3JCMb 2EJFA 5GAOn 3S3MA 2D0QB 1ZHIA 1VQ4T 3HRUA 2OTLT 2QDYB 3I56A 1KHCA 4PJOF 2CZ7B 4FU6A 4ELYC 3J7AF 5FLXE 2V8IA 5LJ5h 3BDLA 4JRKA 2L89A 3L2RA 1KQ1A 4OGEA 2PVOB 3LX7A 4J6WA 3CC7T 2QA4A 2MMPA 4DA4A 4F7UF 2RI3A 1VQ6T 3CD6A 4QVDA 3X26B 3V8LA 5GANe 3JCMJ 4M7AD 3WXMB 1KHIA 1NZ9A 2GFAA 3QUIA 3SB2A 3M59A 1SSFA 3OYFA 4M77G 4C8QD 2EIFA 3PIPA 4XQ3A 1KD1U 2CZ1B 2MWOA 3EFSA 1KC8C 4OGCA 3X20B 3VU3C 1UGPB 3CCJT 1M1KC 2R5AA 2DXCA 4M75C 3FC3A 3CCRT 3OYJA 2DEQA 5DLOA 4Q5WA 2P4TA 3VKIA 3HPWA 4PJOC 3JCMP 4A4HA 5FU7B 1U1SA 2VXEA 2NLUA 3CPFA 2F5TX 3UPUA 2LVMA 1Y07A 1D3BA 2MWPA 3M4GA 4RMOA 3L2QA 3M4YA 5GAN8 3NFCA 2DAQA 4C0DB 1M5Q1 2RH2A 5J39A 5CK9A 1WGSA 5GANd 4IUVA 3N5BB 4HCBA 3PGGA 4ZTJA 4BE1A 2EQKA 5LJ5f 1YHQA 4DQ2A 3VJPA 3UWNA 1WPYA 1VIFA 2FL7A 2JVVA 5CQYA 2DXUA 2BIVA 2KAFA 1VQ7T 2XK0A 4ZN1A 1QVFA 4ZN3A 1Q86U 4BACA 4M77D 4LDUA 3URGA 1M1GA 5GMKh 5GANh 2HBPA 1VQ6A 3MEAA 4C0GA 3CCVA 4KULA 4J6XA 4MDWA 2QQRA 1M9SA 2LX9A 1QVFS 2WSFE 3CCST 3CC4T 2V8KA 4M7DD 4LDWA 4A4EA 4C8QA 2EQJA 5CKEA 5DLQE 2CZ6B 1B34B 3M56A 4M78F 2VXFA 1TH7A 3LYIA 3M5AA 3OYYA 4XTYA 4ZGDB 1N8RC 2E10A 4C0DC 2DXBA 2VUBA 1G3WA 2XHCA 1JB0E 1K9MC 3CCJA 3QZ5B 2O4XB 3CCRA 4FIBA 3QSUA 2CZ0B 4BUGA 1YIJT 1K8AU 2OTJT 3RIRA 3QYHB 1S72A 3GLXA 4JDSA 1Q81U 2JNGA 4DOVA 2VYTA 4XU0A 2A7YA 3CBOA 3LLRA 1XQHA 3M55A 4FT4A 1X6OA 4LDVA 3J80E 2RHUA 3M54A 4LD9K 1W4SA 5A2QE 3I55A 1Y96B 1VQNT 3QPHA 5CKHA 3E9FA 2DK3A 3L2ZA 1M4ZA 2DVEA 3DB3A 3OA6A 1BKBA 1OI1A 5D6XA 1B34A 3MO8A 2LNVA 3CMAT 2JTFA 3S3OA 1P92A 1N9SA 3UDCA 2OAUA 3FLGA 3CBPA 4P5NA 1M1FA 3GIBA 4M7AE 4M78C 1WQ7A 4BB7A 4E7JA 2QTXA 2RB6A 4BY6B 1FX7A 4C8QE 5KCHA 5GANf 3SDZA 4XU3A 4M75D 3JAME 3GPLA 3M9QA 4A53A 2IVWA 4OMFB 3HP9A 5J3BA 2XG8D 3GOXA 4RCCA 1UGRB 3JCMe 2A3LA 3CC2A 2MI6A 5GAN3 2ZPBB 4JS4A 1Y96A 5A0GA 2P0QA 2VC8A 2LQ8A 2CGHA 1I4K1 4EMGA 5GAMd 1NJIC 4M7DA 2QXFA 5LJ3j 5DY9A 1BI2A 3CMET 4LDXA 4J8OA 4NS5A 1JRIA 4C8QG 4EMHA 1VQ5T 2K4YA 2MAMA 3HRTA 3L1AA 5KE3A 2LRQA 4J7FA 4BDZA 2FB7A 4IKFA 3CCUA 4C92B 4XAXB 2X4WA 4ZGEB 1OYXA 2ZPHB 5GAMg 3G71T 2GCXA 2JUFA 1VQ8T 1RL2A 1N9RA 3ER0A 2HD0A 4IUPA 3EAEA 4PLLA 3PFSA 5DM7R 4PJOB 3CBMA 2GFUA 3C95A 4C5EA 3PIOA 4JLGA 3X24B 4BY6C 5C6SA 3JCMV 5LJ5g 3JCMd 4KUDK 2DTHA 3ZEHA 3OYIA 1VQNA 3RERA 2QQAA 5CVIA 3MHXA 2X35A 4M77E 1KC8U 3GF5A 3OS1A 4F7UB 1JJ2A 4Y28E 2E12A 1M1KU 3GNFB 5KCOA 4R55A 4M7DE 4HA8A 3VYHB 1JJ2S 3QBYA 4M75A 4JRIA 3JCMh 3OSVA 5FROA 3GP8A 3OW2A 2EJ9A 3QG1A 4BI8B 1Q82C 4PJOA 2RHYA 4WF2A 5LJ3e 2WSCE 3JB9J 3SFMA 2R5MA 4C92C 3MEUA 2KDSA 3PMIA 4PLIA 1YI2T 4FM4B 2XI9A 3UT1A 3OW2S 2YLBA 4ELZC 2RHXA 1G3YA 3META 2HNIA 4XU1A 5GAN7 4JRQA 2PUOB 2DO3A 4C5GA 2P0KA 3DLLA 3OS0A 3CMEA 2WACA 4M7DG 3H6ZA 2DZ9A 2PQWA 1UB4A 3G4ST 1VQ5A 3G6EA 1BIBA 5FRMA 3CEYA 2LDMA 3E9GA 4C0FA 5GAMf 4ZGJB 1VQOA 2XDDA 1UGSB 4UC4A 1VQ8A 1NPRA 3RMSA 4E47A 5GAOr 2YHTA 1G3SA 2RJDA 3HFNA 4O5VA 1YJNT 1VQ9T 2CS7A 4L6V5 4NL3A 2RI5A 2RK2A 3HRSA 1YJWT 3JB9D 1O75A 5GAOm 2E6NA 1YI2A 5LJ3d 1VQ4A 5CKBA 2OTLA 3JCMQ 4M75E 3CCMT 2E65A 5CO7A 1H3ZA 2K5IA 4PL6A 3VYGA 5KE2A 1N8RU 3A8GB 3V7CA 2QQBA 4CRIA 5GANg 2KQWA 1K9MU 3L2UA 4QQGA 5CR2A 1VQKT 2X4YA 3CC7A 1I5LA 1FXXA 3JCMf 1V29B 2M16A 3P8BB 2Y90A 5FU6C 4A4GA 1ZQ1A 2LT1A 5LJ3h 4HCCA 1QP2A 1VQMT 4N4IA 4M78B 3MP8A 2DD4A 3OYGA 4M75G 5IN1A 1QVPA 3TCJA 1M90C 4M7AF 4PJOG 2D6FA 2E6ZA 2RM4A 2BKDN 2E5QA 3M58A 2H3JA 1W2BA 2DTOA 1WJQA 4C8QF 1HXDA 4XTVA 1WJSA 3OYLA 4X9CA 3JB9H 2DJZA 3CCLT 1RI0A 1YITT 1M8VA 1XNIA 3A8OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKJ A;  5J26 A;  3GOX A;  3LH0 A;  1KHC A;  3OYM A;  4FU6 A;  4B9X A;  4FL6 A;  4BDY A;  1OZ3 A;  3SD4 A;  3BDL A;  1OZ2 A;  2L89 A;  3L2R A;  3L2V A;  2GF7 A;  3LX7 A;  2EKO A;  4NS5 A;  2RI3 A;  4EDU A;  3OS2 A;  5KE3 A;  2LRQ A;  2YRV A;  2R58 A;  4BDZ A;  4IKF A;  2D9T A;  4N4H A;  2X4W A;  4QQ6 A;  1OYX A;  2GFA A;  2RJC A;  3OYF A;  1SSF A;  3OB9 A;  2RHI A;  4IUU A;  2O4X A;  2LCC A;  4IUP A;  3EAE A;  4C5H A;  2FHD A;  4PLL A;  4OVA A;  3DLM A;  3PFS A;  5D6Y A;  2MWO A;  2RHZ A;  2DIG A;  2GFU A;  3NTK A;  4C5E A;  3O8V A;  2R5A A;  3OYD A;  2DIQ A;  3OYN A;  3FC3 A;  3OYJ A;  5C6S A;  4Q5W A;  3FEO A;  3OMG A;  3P8H A;  3ME9 A;  2XDP A;  3ZEH A;  3OYI A;  4E7K A;  3OYA A;  2X35 A;  4A4H A;  4Z02 A;  5IAY A;  3OYC A;  3OS1 A;  4L59 A;  2NLU A;  2LVM A;  2MWP A;  2RO0 A;  5KCO A;  3L2Q A;  1MHN A;  5FRN A;  3MEV A;  1WJR A;  2DAQ A;  4X34 A;  4E7I A;  5D6W A;  4B9W A;  2L3R A;  5C0M A;  5J39 A;  1WGS A;  3FDR A;  3QBY A;  2HQX A;  2M0O A;  3C4S A;  4GY5 A;  4IUV A;  4QW2 A;  5FRO A;  4BD3 A;  4ZTJ A;  1N27 A;  3QJ6 A;  2RHY A;  5KH6 A;  4BE1 A;  2EQK A;  2R5M A;  3MEU A;  3PMI A;  4PLI A;  3UT1 A;  3UWN A;  4BE0 A;  3DB4 A;  3LGF A;  2BIV A;  3NTH A;  3QII A;  2RHX A;  2XK0 A;  3MET A;  3H8Z A;  3P8D A;  4BAC A;  4C5G A;  2P0K A;  3OS0 A;  2HQE A;  2WAC A;  3H6Z A;  3OYK A;  2PQW A;  2EQU A;  4ZTF A;  4QVZ A;  2L8D A;  3MEA A;  5FRM A;  2RJF A;  3CEY A;  2LDM A;  3E9G A;  2QQR A;  3F70 A;  3LGL A;  3PMT A;  2K3Y A;  4RG2 A;  3S6W A;  3OQ5 A;  4UC4 A;  4A4E A;  2RJE A;  2EQJ A;  2RJD A;  3S3N A;  4N4G A;  3LYI A;  2RI5 A;  2CKK A;  2E6N A;  2F5K A;  2R57 A;  2O4X B;  2G3R A;  4LD6 A;  1G5V A;  5CIU A;  3MEW A;  2BUD A;  3OMC A;  4PL6 A;  5KE2 A;  4CRI A;  2VYT A;  2RI2 A;  3KUF A;  3MP1 A;  3OYH A;  3Q1J A;  4HCZ A;  3OY9 A;  3LLR A;  4E7L A;  2LTO A;  3L2U A;  3ASK A;  4QQG A;  1H3Z A;  2RHU A;  2X4Y A;  4E7H A;  4IUQ A;  4C5I A;  2M16 A;  3NTI A;  4QQD A;  3E9F A;  2IG0 A;  4A4G A;  3DB3 A;  4A4F A;  2EQM A;  5D6X A;  1OI1 A;  3OA6 A;  3L42 A;  3MP6 A;  3MO8 A;  4IUR A;  3OYE A;  4N4I A;  3MP8 A;  2JTF A;  3S3O A;  5M9O A;  3OYG A;  5IN1 A;  3OYB A;  2JZ2 A;  2K3X A;  3FLG A;  2EFI A;  4IUT A;  3PNW C;  2B8A A;  2BKD N;  2E5Q A;  2X4X A;  4II1 A;  4E7J A;  2QQS A;  1WJQ A;  2M1H A;  4BE2 A;  5KCH A;  3OYL A;  1WJS A;  3L2W A;  1RI0 A;  3M9Q A;  3S3M A;  1XNI A; 
#chains in the Genus database with same CATH topology
 4FYW B;  2CRE A;  1WXB A;  4QKU A;  4JLI A;  4FL6 A;  3NHN A;  4N0A C;  3SD4 A;  2E70 A;  3QZ9 B;  1JJ2 P;  4XU2 A;  2EKO A;  2K2V A;  3VRY A;  2YRV A;  4N4H A;  4C0Z A;  3E2U A;  2DER A;  4C92 D;  2O4X A;  4PJL A;  1CKB A;  1ZLM A;  4FSX A;  5HY6 A;  2O9V A;  3RKX A;  2EPD A;  3NTK A;  4KGV B;  4R56 A;  1PSE A;  3OMG A;  3I56 T;  4JJN K;  3TSZ A;  2F2V A;  2B86 A;  5IAY A;  3ZFJ A;  1U06 A;  1OPL A;  4KT0 E;  3CC4 A;  2RO0 A;  1MHN A;  2CSQ A;  4M7D F;  2KRN A;  3QWY A;  3JCM X;  2KK4 A;  4RG8 A;  3CCL A;  3QJ6 A;  2COZ A;  4A4K A;  5GMK j;  4HKE A;  1TOV A;  1KFZ A;  3TRE A;  2DPP B;  4M77 C;  4ZTF A;  5FWC A;  2XKO C;  3AHU A;  4J9C A;  2K3Y A;  4RG2 A;  1FWZ A;  2YLC A;  2AHJ B;  4N4G A;  1RUW A;  2L3P A;  2DXT A;  4GBQ A;  1BYM A;  4LD6 A;  3CC7 Q;  5KYY B;  5CIU A;  1YHQ T;  2BUD A;  1Q7Y C;  1PCX A;  4ORZ A;  1AWX A;  3OY9 A;  1XOV A;  4IUQ A;  1K1Z A;  1QW1 A;  1Q7Y R;  2QAS A;  1TXQ A;  3FB9 A;  4HT8 A;  3CPW A;  3CCV T;  4IUR A;  3NPF A;  2VV5 A;  3CCJ Q;  3G71 A;  4RCB A;  1SHG A;  2FYK A;  2YUQ A;  1GCQ C;  2K5F A;  4MDX A;  2XID A;  8ATC B;  2DRM A;  3OBW A;  3RBB B;  6AT1 B;  3OYM A;  3UAT A;  5I2M A;  2L2P A;  3LWH A;  3I55 T;  1NLP C;  2KSS A;  4F7U E;  4M7A B;  2VGM A;  4LN2 A;  2DVJ A;  1TS9 A;  3ULR B;  3OB9 A;  2HL5 C;  3RR6 A;  3DLM A;  3QHS A;  4MZM A;  1RAA B;  2KMT A;  1QKX A;  3FRN A;  1VQP T;  4CI0 C;  2YWW A;  2C06 A;  3SWN B;  3P8H A;  4VUB A;  4F14 A;  3G4S A;  3OYC A;  4F04 B;  2KT8 A;  3LWI A;  1OV3 A;  3H0F A;  3KXT A;  2XIC A;  4JRP A;  5L8R E;  5FU7 C;  5IH2 A;  1E6G A;  4XK8 E;  1VQ9 A;  4GY5 A;  1TU0 B;  2PTK A;  4FT2 A;  1N27 A;  1Q86 C;  1BIA A;  4EPC A;  1DJ7 B;  1M3B A;  2Y4X A;  4C8Q C;  3CCE A;  3EHR A;  4PJM A;  1QP3 A;  1ZBJ A;  4KGZ B;  1N6A A;  4MML A;  3OYK A;  2KRS A;  2QI2 A;  1I81 A;  1QVG S;  3OQ5 A;  2JTM A;  2QA4 T;  3S3N A;  2QEX A;  4A54 A;  2RQR A;  3TU4 K;  1C6V X;  2F5K A;  4J9F A;  3CME Q;  2XMF A;  4EMK A;  3U23 A;  5GAN j;  2RI2 A;  3KUF A;  1X01 A;  4XTX A;  1VQ8 Q;  1BI3 A;  2CYZ B;  3QXE B;  3EH1 A;  3HHT B;  2KI7 A;  3EFO B;  1K76 A;  1RAI B;  1YWO A;  2DZC A;  4GLM A;  1Q7Y U;  1VYV A;  3L42 A;  3VUZ A;  4K11 A;  2M02 A;  3VS7 A;  3OYB A;  2EFI A;  4IUT A;  4M7D C;  1ZSG A;  1EX4 A;  2ZCF B;  1NG2 A;  3RES A;  2L0A A;  2QYZ A;  2RNA A;  4OMM A;  5GAO n;  2YRD A;  1KHC A;  1WA7 A;  4PJO F;  2CUD A;  4ELY C;  3J7A F;  4JRK A;  2L89 A;  3L2R A;  4OGE A;  4J6W A;  3I9Q A;  4DA4 A;  2E5K A;  4J9G A;  4CC2 A;  4QVD A;  3V8L A;  4E7Z A;  3WXM B;  3SB2 A;  3M59 A;  1D0Z A;  3MKD A;  1K9A A;  3VU3 C;  1QCN A;  2HCK A;  2DEQ A;  1QVG P;  1S1N A;  2CP6 A;  3HPW A;  1YJN Q;  3UA6 A;  4JPB W;  1U1S A;  2VXE A;  3CPF A;  1C0M A;  2F5T X;  3AT1 B;  1KSW A;  2QK0 A;  3L2Q A;  3NFC A;  2DAQ A;  2D0N A;  2HSP A;  1VQ7 Q;  5GAN d;  1J3T A;  4FYV B;  3PGG A;  1PD0 A;  2HZY A;  1VQK Q;  4DQ2 A;  1WPY A;  1VIF A;  2FL7 A;  2JVV A;  5CQY A;  2DXU A;  2BIV A;  4HVW A;  1QVF A;  1Q86 U;  3FJ5 A;  2CT3 A;  5GAN h;  1TWB A;  1YN8 A;  1LCK A;  4C0G A;  4MDW A;  4J6X A;  2QQR A;  3CC4 T;  5IXB A;  4LDW A;  4A4E A;  5CKE A;  2OTJ Q;  2CP7 A;  1B34 B;  2D1X A;  3M5A A;  4XTY A;  1IGQ A;  2CSI A;  1N8R C;  2E10 A;  5D7U A;  1RAH B;  1QMC A;  4F16 A;  3CCJ A;  9ATC B;  4FIB A;  4R0K A;  1N8R R;  3GLX A;  4JDS A;  4DOV A;  3CMA Q;  2AT1 B;  3M55 A;  1W1F A;  1SF9 A;  1X6O A;  4LDV A;  2RHU A;  5A2Q E;  1Y96 B;  3E9F A;  3DB3 A;  1YNZ A;  1P92 A;  1N9S A;  3FLG A;  3GIB A;  4E7S A;  1ZSZ A;  1ZA1 B;  4E7J A;  2D8H A;  2QTX A;  2RB6 A;  4C8Q E;  2CP2 A;  3M9Q A;  1VQL Q;  4OMF B;  1K8A R;  3GOX A;  2NUP A;  3EGX A;  2ZPB B;  5A0G A;  1SHF A;  1PHT A;  2JM9 A;  5GAM d;  1BI2 A;  4LDX A;  5AT1 B;  4J8O A;  1OPK A;  3CCQ Q;  3HRT A;  3L1A A;  2LRQ A;  5GAM g;  1OYX A;  3G71 T;  2JUF A;  3ER0 A;  1N9R A;  2IPO B;  1GCP A;  1ABO A;  2J7I A;  2GFU A;  2EW3 A;  3C95 A;  4C5E A;  3EGD A;  3RER A;  2DTH A;  3ZEH A;  4M4Z A;  2VVK A;  3MHX A;  2X35 A;  2MPX C;  4F7U B;  1WFW A;  1T0H A;  4Y28 E;  2RQV A;  1YI2 Q;  4M7D E;  4HA8 A;  3VYH B;  2NUT A;  3QBY A;  1D0Y A;  4M75 A;  3OSV A;  1HJD A;  4FCY A;  2ROL A;  1Q82 C;  3JB9 J;  1Z9Q A;  2KBT A;  4ELZ C;  1UDL A;  1M8M A;  5FW9 A;  2ENM A;  1G8X A;  2HNI A;  4XU1 A;  4C5G A;  2JXB A;  3CME A;  5KYW A;  2RN8 A;  2DZ9 A;  3G4S T;  3G1J A;  2LDM A;  1YJW Q;  1X43 A;  1VQ8 A;  3RMS A;  1WHH A;  3ZL7 C;  1T0J A;  1VQ9 T;  1I1J A;  3HRS A;  1TSF A;  1WLP B;  3EG9 B;  2MK5 A;  3JCM Q;  3CCM T;  5L23 A;  2E65 A;  3VYG A;  5KE2 A;  1N8R U;  3V7C A;  3BE3 A;  1UUE A;  1YP5 A;  2K7A A;  3L2U A;  1QKW A;  2M16 A;  2DLP A;  3P8B B;  1ZQ1 A;  1QP2 A;  4N4I A;  4JJB A;  1UGV A;  4M75 G;  1YIT Q;  1M90 C;  2W0Z A;  2E5Q A;  1HXD A;  4XTV A;  3OYL A;  2GNC A;  1RI0 A;  2LJ1 A;  1XNI A;  3LH0 A;  2JS2 A;  4B9X A;  4NL2 A;  4M78 A;  2LX7 A;  1YJN A;  2C0T A;  2RHI A;  1WXT A;  1UE9 A;  4C5H A;  2FHD A;  1TUC A;  2LC4 A;  5D6Y A;  1KQS S;  2RHZ A;  1VQ7 A;  2JTE A;  2A08 A;  2DIQ A;  5GAO l;  4KBM B;  3A8H B;  3T9N A;  4M77 F;  4RTV A;  3V7R A;  2QTV A;  1ZUK A;  3CCS A;  4X9D A;  4RTW A;  1WJR A;  4CC4 B;  1BK2 A;  3X25 B;  1NBE B;  1YIJ A;  2OTJ A;  2CDT A;  2BZ8 A;  3LGF A;  3CXC S;  1U1T A;  1Q82 U;  1R0C B;  2BE9 B;  1WHL A;  4M78 G;  2NYS A;  1WQW A;  4J9H A;  1PM3 A;  4EMK C;  3CMA A;  3JB9 G;  1H3H A;  4C92 A;  2ATC B;  1MMG A;  3JCM g;  2CKK A;  1RI9 A;  1KQ2 A;  2FVU A;  1QWE A;  2HKQ B;  2ZGW A;  4M75 F;  1UEB A;  1G3T A;  1LNX A;  3Q1J A;  2LTO A;  1VQL A;  3HKS A;  4A4F A;  3E19 A;  2Y4Y A;  1YJ9 T;  1KQS P;  2ZPG B;  2EWN A;  4M78 D;  2YRC A;  5KYY A;  3CCQ A;  1S72 Q;  4II1 A;  4BI4 A;  5HK0 A;  4PFO A;  1NYG A;  5KYX A;  2J6O A;  1M90 U;  1FYN A;  3QKJ A;  4JUV A;  3JB9 I;  2ESW A;  2ABL A;  2E4H A;  2JT4 A;  4PJO E;  1U8R A;  1AT1 B;  1GFD A;  1I07 A;  4RKU E;  1OZ3 A;  4RTU A;  3L2V A;  5GAN 6;  3EFR A;  5LJ3 g;  5GAN 2;  4JZ3 A;  1LJO A;  4C92 G;  1X2K A;  3BDU A;  4EDU A;  4FW2 A;  1QLY A;  4C8Q B;  3QYG B;  3CXC P;  3CC2 Q;  1I8F A;  2CP5 A;  4IUU A;  1JO8 A;  4OVA A;  1YI2 A;  1BI1 A;  3OYD A;  4OP0 A;  1W70 A;  4M7A A;  5I22 A;  2VKN A;  3HTR A;  1D1B A;  5FRN A;  1AZG B;  1X69 A;  4B9W A;  1YJW A;  2KXD A;  1IRE B;  2E41 A;  3JB9 F;  3SWN A;  5GMK i;  4BI3 A;  3DB4 A;  5KYU B;  2DL7 A;  4PFP A;  4E2F B;  1EIF A;  5CAI A;  2OJ2 A;  4J7I A;  5LL6 S;  2EQU A;  4FW1 A;  4J9E A;  4HVV A;  4M7D B;  1UEC A;  3LGL A;  4D6W A;  4LDY A;  1RAE B;  1NPP A;  2CH4 W;  2DKG A;  5LJ5 e;  1H64 1;  3CD6 T;  4OML A;  2YXY A;  3RKW A;  2LJ3 A;  3EG1 A;  2L5Q A;  1YIT A;  1ACM B;  1ZUY A;  2DL5 A;  5IHI A;  2KYB A;  3JCM c;  1VQ5 Q;  3MEW A;  4WCI A;  3G6E Q;  3V8K A;  1ZSZ C;  1LOJ A;  1YCS B;  1VQO Q;  3MP1 A;  3OYH A;  4M7A G;  4ME7 A;  1IZ6 A;  3SEM A;  1YCY A;  2RD1 A;  2MF2 A;  5FWB A;  1RAD B;  3INZ A;  3I35 A;  3M0R A;  4OB0 B;  3RKY A;  1BI0 A;  2EGE A;  1VQ4 Q;  2ZPE B;  1IHW A;  2OTL Q;  2RK1 A;  3PNW C;  2K57 A;  4C92 F;  2ZZD A;  2H8H A;  3M0S A;  1ZHI A;  2FPE A;  4JZ4 A;  4AFS C;  3EFO A;  2CZ7 B;  4FU6 A;  3BDL A;  2PVO B;  3LX7 A;  2MMP A;  1SKU B;  1VQ6 T;  4M7A D;  2O9S A;  1SSF A;  2EIF A;  1M2V B;  3EFS A;  1KC8 C;  1X2Q A;  1UGP B;  2R5A A;  2DXC A;  2JJ9 A;  4M75 C;  3CCR T;  1V1C A;  4J9D A;  2AZV A;  3H0I A;  1KC8 R;  4A4H A;  8AT1 B;  2G6F X;  3UPU A;  1Y07 A;  1D3B A;  2FZK B;  3M4Y A;  1OX8 A;  1NEG A;  4Z89 A;  2DM1 A;  5J39 A;  4IUV A;  1BU1 A;  4HCB A;  1JU5 C;  2EBP A;  5LJ5 f;  3VJP A;  1VQ7 T;  4ZN1 A;  1XJW B;  4FSS A;  4LDU A;  3URG A;  5GMK h;  1OQK A;  2LX9 A;  3CCS T;  2V8K A;  1EZZ B;  5DLQ E;  3RDV A;  4OMP A;  3M56 A;  1TH7 A;  4C0D C;  2VUB A;  1G3W A;  3EH2 A;  2O4X B;  1SEM A;  1YIJ T;  2OTJ T;  2COY A;  1S72 A;  2YDL A;  2JMA A;  2VYT A;  2CP3 A;  2A7Y A;  1Q86 R;  1OX9 A;  3J80 E;  1W4S A;  1IB8 A;  1VQN T;  3QPH A;  5CKH A;  3L2Z A;  1OI1 A;  1B34 A;  3CMA T;  1G83 A;  3S3O A;  1W6X A;  2A37 A;  2OAU A;  3CBP A;  4M78 C;  2I0N A;  1WQ7 A;  1KJW A;  1FX7 A;  3SDZ A;  2LMJ A;  2DET A;  4KRT A;  2IVW A;  3HP9 A;  4RCC A;  3CC2 A;  4JS4 A;  1Y96 A;  3H41 A;  1NJI C;  2QXF A;  5DY9 A;  2F2W A;  4NS5 A;  2JW4 A;  4AFZ C;  2K4Y A;  1V76 A;  2FB7 A;  2BZX A;  4XAX B;  4Z88 A;  2ZPH B;  4PJO B;  1LPL A;  4JLG A;  4BY6 C;  5C6S A;  4KUD K;  2GQI A;  3PVQ A;  4M77 E;  1KC8 U;  3GF5 A;  1X6G A;  2YT6 A;  1JJ2 A;  4OMO A;  5KCO A;  1WHK A;  2W10 A;  3VS0 A;  3QG1 A;  4WF2 A;  1IO6 A;  3SFM A;  4C92 C;  1M3C A;  2EVR A;  1YI2 T;  4FM4 B;  3OW2 S;  1YFN A;  2KR3 A;  2LNH B;  5GAN 7;  2PUO B;  2K2M A;  1VQ5 A;  1QQJ A;  3M0U A;  3G6E A;  1BIB A;  3E9G A;  4C0F A;  1VQO A;  2KNB B;  2XDD A;  4UC4 A;  1NPR A;  2ED0 A;  1G3S A;  2RJD A;  3HFN A;  4HVU A;  1YJW T;  1AEY A;  2E6N A;  1K4U S;  3EGU A;  1VQ4 A;  5CKB A;  2OTL A;  3I55 Q;  4M75 E;  2K5I A;  4PL6 A;  1VQM Q;  5GAN g;  2J05 A;  4AG1 C;  4HXJ A;  4QQG A;  5CR2 A;  2X4Y A;  3CC7 A;  1I5L A;  1RAF B;  1V29 B;  1H92 A;  2O88 A;  1VQP Q;  3TCJ A;  1QWF A;  2EYW A;  2E6Z A;  1ZUU A;  1TUD A;  2BKD N;  2HL3 A;  3M58 A;  1WJQ A;  4AFU C;  2LP5 A;  3JB9 H;  1TTH B;  3CCL T;  1YIT T;  2LCS A;  3A8O B;  2JOY A;  4J9B A;  1W2B S;  2AIR B;  2OI3 A;  1KG1 A;  1OZ2 A;  2MYS A;  1PSF A;  1PG5 B;  2DF6 A;  3WVE B;  1NJI U;  2FRW A;  2R58 A;  2E1H A;  3OW2 P;  4M7A C;  5EC7 A;  2QGG A;  2IIM A;  1NYF A;  2DTI A;  4XTU A;  4PJN A;  2EAY A;  2RQT A;  3OYN A;  2QA4 Q;  4EMK B;  2A36 A;  3VS2 A;  5I11 A;  4Z02 A;  2LQK A;  2DL4 A;  3SWN C;  4JJC A;  3FIF A;  3MEV A;  4L5G A;  3ZBD A;  1ZBX A;  3JSC A;  4AFQ C;  2D8J A;  1GBQ A;  3R6O A;  2X4J A;  2YUO A;  1K0S A;  3JV3 A;  4LUE A;  3VS6 A;  1KK7 A;  3A8M B;  5IT9 E;  3H8Z A;  2X3W D;  1PRL C;  2FEI A;  1OEB A;  2PVG B;  4E6R A;  3QJY A;  5CQX A;  1SG5 A;  1UHF A;  1K73 C;  1PNJ A;  2RJE A;  2KE9 A;  2YUN A;  1W2B P;  2PVD B;  1VYT A;  5EG2 A;  2DBM A;  2KXC A;  1G5V A;  3WVD B;  4OB2 B;  1SPK A;  1Q82 R;  5FU6 B;  1H3Z A;  2SRC A;  3VV0 A;  1RAG B;  2M9U A;  3NTI A;  1O9S A;  4QQD A;  2IG0 A;  2P0P A;  2EQM A;  3MP6 A;  2HBW A;  1ABQ A;  5GMK m;  4PK4 A;  2JZ2 A;  3C12 A;  3LH5 A;  3FJP A;  3M0P A;  5HCK A;  1R0B G;  1PKS A;  2XD0 A;  3CPW S;  1GXI E;  2WSE E;  4C92 E;  2A28 A;  4FYY B;  1HK9 A;  5J26 A;  3VS1 A;  3CCE T;  2V1R A;  1S72 T;  2EGC A;  3V7S A;  1QCF A;  3OSS C;  4Y91 A;  2GTO A;  2GF7 A;  1SRL A;  1KD1 C;  2QQ9 A;  3QDR B;  5GAN 4;  1VYU A;  2KRM A;  2KY9 A;  2RQW A;  4PNO A;  2MCN A;  2LCC A;  4RTX A;  2JN0 A;  2QEX T;  2EYZ A;  3QO3 A;  1LVK A;  2DIG A;  4MMK A;  1M90 R;  5GJW B;  1UGQ B;  5LJ5 j;  3CC2 T;  1MV0 B;  4E7K A;  4D8K A;  1AWW A;  4L59 A;  3CCU Q;  1WYX A;  5I21 A;  2O01 E;  4NOY A;  4X34 A;  4DBF A;  5D6W A;  3UF4 A;  1AHJ B;  4V2S A;  1R8O B;  3HL8 A;  2LCL A;  2BTT A;  5KH6 A;  3G7Z A;  1E6H A;  1R77 A;  1OOT A;  3OS5 A;  2H3E B;  4OB3 B;  4BE0 A;  3QII A;  4M77 B;  5GAM e;  1QVG A;  4ATO A;  1VQK A;  2HQE A;  1UTI A;  2K9G A;  4J5Y A;  2L8D A;  2EGA A;  2RJF A;  1VQM A;  3F70 A;  3PMT A;  1Y7X A;  3CPW P;  1IHV A;  2DE0 X;  2C0O A;  3NGP A;  1Q81 C;  3BFM A;  1GL5 A;  1D1C A;  4AT1 B;  2V8J A;  4KH1 B;  1K73 U;  1VQP A;  2R57 A;  3V8J A;  2KVQ G;  1Q81 R;  4DEY A;  2DEU A;  1VA7 A;  3OBY A;  2LJ0 A;  3EGD B;  3ASK A;  4PKC C;  4GLK A;  1T3L A;  1MGQ A;  4YTL A;  1VOM A;  3G6E T;  2LT4 A;  2RQU A;  3PT9 A;  1WNL A;  1VQO T;  5M9O A;  2K6D A;  1FMV A;  2K3X A;  3CQT A;  3KFV A;  2XU8 A;  5A0L A;  1ARK A;  5LJ5 d;  2B8A A;  3MJX A;  4RTZ A;  4M75 B;  4HT9 A;  1GRI A;  3JCM b;  2EJF A;  3S3M A;  1VQ4 T;  1C1A A;  2OTL T;  2QDY B;  5LJ5 h;  1FMW A;  2X51 A;  4FYX B;  2P4R A;  5KYW B;  3CC7 T;  2QA4 A;  4ESR A;  3THK A;  2RI3 A;  4PJJ A;  3TSW A;  3JCM J;  2A0F B;  1NZ9 A;  3M0Q A;  2GFA A;  1D1A A;  4C8Q D;  2V1Q A;  1KD1 U;  4AMC A;  1F1B B;  2M51 A;  3VRZ A;  2CUB A;  1BBZ A;  3CCJ T;  1M1K C;  1X27 A;  2LZ6 B;  2DYB A;  5IXF A;  5FU7 B;  3EG0 A;  2MWP A;  4RMO A;  5GAN 8;  1KIK A;  4C0D B;  3CCM Q;  2L3Q A;  1M5Q 1;  2DJQ A;  2RH2 A;  5CK9 A;  3N5B B;  2MOX A;  3UWN A;  2J06 A;  2KAF A;  1Y0M A;  4ZN3 A;  4BAC A;  3H9N A;  1UJ0 A;  1IGU A;  1QVF S;  2WSF E;  4M7D D;  2AKK A;  2EQJ A;  2E3I A;  4M78 F;  2VXF A;  3R6N A;  3LYI A;  4ZGD B;  1RAB B;  2XHC A;  1K9M C;  3QZ5 B;  3QSU A;  2CZ0 B;  1Z9Z A;  4BUG A;  1AZE A;  3EG2 A;  1Q81 U;  1HYO A;  2JNG A;  4XU0 A;  3CBO A;  1K9M R;  1XQH A;  4FT4 A;  1PKT A;  3M54 A;  1EFN A;  2E3H A;  1M4Z A;  3OA6 A;  1BKB A;  1E7O A;  1RLP C;  2LNV A;  1SSH A;  2JTF A;  2HQH A;  3UDC A;  4CC3 A;  4P5N A;  1M1F A;  2O2O A;  5IHK A;  1ZA2 B;  2FZG B;  4J9I A;  5KCH A;  4BY6 B;  2PZ1 A;  1NEB A;  1PRM C;  1UGR B;  3JCM e;  2A3L A;  2P0Q A;  2VC8 A;  2ED1 A;  2LQ8 A;  2CGH A;  4EMG A;  3CME T;  1MMA A;  2QDL A;  2J6F A;  2X3X D;  2YUP A;  5KE3 A;  4IKF A;  4J7F A;  4BDZ A;  2OAW A;  3CCU A;  4C92 B;  1VQ8 T;  2EYY A;  2GCX A;  1RL2 A;  2HD0 A;  4IUP A;  3EAE A;  4PLL A;  3PFS A;  1B07 A;  1BCM A;  5DM7 R;  2BE7 D;  1OUL A;  3CBM A;  1AOJ A;  4LXC A;  3PIO A;  1QVF P;  2K79 A;  1QCO A;  1WHJ A;  1WI7 A;  2AK5 A;  2E12 A;  1M1K U;  1B7T A;  4R55 A;  3EHQ A;  4JRI A;  2EJ9 A;  4PJO A;  2RHY A;  5LJ3 e;  2DMO A;  2WSC E;  2KDS A;  4PLI A;  3UT1 A;  2HEQ A;  5KYX B;  1YJ9 Q;  3MET A;  2GGR A;  4JRQ A;  2FPF A;  2P0K A;  4KGX B;  5FRM A;  3M0T A;  4ZGJ B;  1WHG A;  3PVL A;  1YJN T;  2CS7 A;  2LQW A;  2RK2 A;  4PFZ A;  2DX1 A;  1RLQ C;  2P84 A;  1D0X A;  5CO7 A;  3A8G B;  4CRI A;  2QQB A;  1K9M U;  2OX7 A;  2JS0 A;  1VQK T;  2NUZ A;  3JCM f;  1WZO A;  1VQM T;  2DD4 A;  1AWO A;  1QVP A;  2KT1 A;  4M7A F;  4PJO G;  2RM4 A;  2H3J A;  2RF0 A;  2DA9 A;  3GBQ A;  1AVZ C;  4X9C A;  3IQL A;  1M8V A;  2KYM A;  2QGF B;  1YWP A;  4LE9 A;  1XTD A;  3E1S A;  2AZS A;  5CKF A;  4BDY A;  5GAN 5;  3OS2 A;  3JCM W;  4J83 A;  1KQS A;  2X9H A;  3HFO A;  3C94 A;  2D9T A;  2HAX A;  4QQ6 A;  1FMK A;  2K5L A;  4DOW A;  3A5Z B;  3I56 Q;  3CCM A;  2ZPI B;  2XDB A;  1ZX6 A;  3RUX A;  3H0H A;  4Y92 A;  3VUB A;  3O8V A;  5LJ3 f;  4PJO D;  4EIK A;  1MUZ A;  1Y57 A;  2LQN A;  2PU9 B;  3ME9 A;  2XDP A;  3BY7 A;  3CD6 Q;  2RA2 A;  3MCA B;  7AT1 B;  3PE0 A;  4TVR A;  1VQL T;  2DRK A;  5CKD A;  3HSB A;  2L3R A;  5C0M A;  1NJI R;  3X28 B;  3C4S A;  2M0O A;  3TEE A;  4BD3 A;  3CXC A;  1X75 C;  2EJG A;  3CCQ T;  1JEG A;  1MNE A;  3NTH A;  2J6K A;  3P8D A;  1AD5 A;  2FO0 A;  5A0D A;  2F1L A;  1CKA A;  4QVC A;  5AYF A;  1YHQ Q;  2C0I A;  2EQI A;  2VGN A;  2G3R A;  2RMO A;  1D09 B;  1VQ6 Q;  1B3Q A;  3CCV Q;  4F7U A;  5HK3 A;  4HCZ A;  4OB1 B;  1U5S A;  4E7H A;  4C5I A;  4XTZ A;  2PUK B;  3OYE A;  4O6J A;  5GMK e;  2DNU A;  1WDX A;  1D3B B;  3CCR Q;  2GQV A;  1NE8 A;  4JS5 A;  2NWM A;  4BE2 A;  5GAO q;  4XTW A;  1CSK A;  3SHW A;  2AKL A;  1A0N B;  3EG3 A;  2HSE B;  4Z8A A;  1JBM A;  1NM7 A;  4MZT A;  2DL3 A;  5HKC A;  1VUB A;  4DEX A;  3BW1 A;  1UHC A;  1MND A;  2DIL A;  2FG0 A;  2EKH A;  5GAM j;  2MIO A;  2RJC A;  3EG9 A;  2HKN A;  4LNP A;  1VIE A;  2I2L A;  4N0A A;  5KYN A;  3RMQ A;  2SEM A;  3CCS Q;  1Q95 G;  4F7U G;  3MPU B;  3D7S B;  3FEO A;  4OMN A;  5GAO p;  3M57 A;  3OYA A;  4ZNX A;  1YJ9 A;  2CT4 A;  3UA7 A;  4RTY A;  4DBQ A;  5CCA A;  4E7I A;  1YIJ Q;  1WHM A;  3FDR A;  2HQX A;  4QW2 A;  1YBY A;  2KEA A;  3CCU T;  3VS5 A;  5GMK l;  1VQN Q;  2ZPF B;  2PNI A;  2ZAE A;  5I2S A;  3M53 A;  3GNG A;  2ROT A;  3KBG A;  4QVZ A;  2E64 A;  1JXO A;  3S6W A;  4X1V A;  3REA B;  2DD5 A;  4J6Y A;  1Y71 A;  3DKM A;  1K8A C;  4OF1 A;  3J81 E;  4M78 E;  4KUI A;  4M77 A;  2F69 A;  1AWJ A;  3O5Z A;  3LW5 E;  3OMC A;  1I5O B;  3PTA A;  4E7L A;  2EYQ A;  4MZP A;  3TQ7 P;  1WX6 A;  2V26 A;  3A8L B;  3REB B;  4DBH A;  1SRM A;  2X4X A;  5GAM h;  2FRY A;  2QQS A;  1PWT A;  2M1H A;  3JRZ A;  4QT7 A;  1K73 R;  3L2W A;  2D0Q B;  3HRU A;  4WTO B;  1T3S A;  2GBQ A;  2Z0W A;  3I56 A;  2COW A;  3I5S A;  5FLX E;  2JMC A;  2V8I A;  1KQ1 A;  4JJD A;  1MMD A;  1JQQ A;  4ANJ A;  1GCQ A;  4F7U F;  3CD6 A;  4F17 A;  2F2X A;  3X26 B;  5GAN e;  1KHI A;  3QUI A;  3OYF A;  2YSQ A;  4M77 G;  2BZY A;  3PIP A;  4XQ3 A;  1IRX A;  2CZ1 B;  2MWO A;  4AG2 C;  4OGC A;  3X20 B;  3QWX X;  2KRO A;  2JM8 A;  1JXM A;  1M30 A;  3FC3 A;  3OYJ A;  5DLO A;  4Q5W A;  2P4T A;  3VKI A;  4PJO C;  3JCM P;  5ECA A;  2NLU A;  1GBR A;  2LVM A;  3M4G A;  1HD3 A;  1N5Z A;  1UJY A;  1WGS A;  4ZTJ A;  1KD1 R;  5IHN A;  4BE1 A;  2EQK A;  2EYX A;  4HCK A;  1YHQ A;  2HMA A;  2XK0 A;  3CC4 Q;  2FPD A;  4M77 D;  1G2B A;  1M1G A;  4B6M A;  2HBP A;  1VQ6 A;  3MEA A;  1MV3 A;  3CCV A;  1RAC B;  4KUL A;  2GTJ A;  1M9S A;  4OMQ A;  3CCL Q;  4C8Q A;  1PD1 A;  2CZ6 B;  3OYY A;  2DXB A;  1JB0 E;  2DFU A;  1ZSZ B;  3CCR A;  4LUD A;  1TG0 A;  1K8A U;  1M2O A;  3RIR A;  3QYH B;  1TUG B;  3LLR A;  3TVT A;  2NUP B;  4LD9 K;  3EGX B;  1WXU A;  2HDA A;  3I55 A;  2DK3 A;  2DVE A;  5D6X A;  3MO8 A;  4CC7 A;  4DBR A;  2L3S A;  2O31 A;  4M7A E;  3NMZ C;  4BB7 A;  2ECZ A;  5GAN f;  5GJV B;  5KYU A;  4XU3 A;  4M75 D;  3JAM E;  3GPL A;  4A53 A;  2VB6 A;  5J3B A;  2XG8 D;  1OU8 A;  1GFC A;  2MI6 A;  5GAN 3;  3VS3 A;  1I4K 1;  4M7D A;  2QAZ A;  2CH4 A;  5LJ3 j;  3G71 Q;  4IIM A;  2K3B A;  3RNJ A;  1JRI A;  4C8Q G;  4EMH A;  1VQ5 T;  1BB9 A;  2MAM A;  1I0C A;  4ZGE B;  2X4W A;  1U3O A;  1UFF A;  2NUT B;  3QDF A;  4D8D A;  1X6B A;  3X24 B;  3JCM V;  5LJ5 g;  3JCM d;  3OYI A;  1VQN A;  2QQA A;  5CVI A;  2DYI A;  3OS1 A;  2CP0 A;  3GNF B;  1WIE A;  4RUG A;  2QG9 B;  4IIO A;  1UG1 A;  4RTT A;  1IXD A;  1PC0 A;  1JJ2 S;  4KH0 B;  1NLO C;  3JCM h;  5FRO A;  3GP8 A;  3OW2 A;  3C0C A;  4BI8 B;  2R5M A;  3G4S Q;  1OU9 A;  3MEU A;  3PMI A;  2XI9 A;  2YLB A;  2RHX A;  1G3Y A;  2DL8 A;  4M7D G;  2DO3 A;  3DLL A;  3OS0 A;  2WAC A;  3H6Z A;  1VQ9 Q;  2PQW A;  1UB4 A;  2VWF A;  3A98 A;  3VS4 A;  3CEY A;  1M1K R;  5GAM f;  1K0X A;  1UGS B;  4E47 A;  5GAO r;  2YHT A;  3A1P A;  2VAS A;  4O5V A;  1M3A A;  3CCE Q;  4L6V 5;  4NL3 A;  1MMN A;  2RI5 A;  1M2V A;  3I5R A;  3JB9 D;  1O75 A;  2DBK A;  2RPN A;  5GAO m;  5LJ3 d;  2M0Y A;  2FZC B;  2KQW A;  1FXX A;  2KGT A;  1BCO A;  5FU6 C;  2Y90 A;  4A4G A;  2QEX Q;  2LT1 A;  5LJ3 h;  4HCC A;  1H8K A;  4A63 B;  4M78 B;  3MP8 A;  3OYG A;  5IN1 A;  1M27 C;  2D6F A;  1W2B A;  2DTO A;  4C8Q F;  1HSQ A;  1WJS A;  2DJZ A; 
#chains in the Genus database with same CATH homology
 2JOY A;  3LH0 A;  1W2B S;  1XTD A;  3E1S A;  1KG1 A;  4JLI A;  5CKF A;  4B9X A;  4FL6 A;  4BDY A;  4N0A C;  3SD4 A;  1OZ2 A;  2E70 A;  3QZ9 B;  4NL2 A;  4M78 A;  5GAN 5;  1PSF A;  4XU2 A;  2EKO A;  3WVE B;  3OS2 A;  1YJN A;  2K2V A;  3JCM W;  4J83 A;  1KQS A;  2YRV A;  3HFO A;  2R58 A;  1NJI U;  3C94 A;  2E1H A;  2D9T A;  4N4H A;  4C0Z A;  4QQ6 A;  2HAX A;  4M7A C;  2K5L A;  4C92 D;  2RHI A;  4DOW A;  2O4X A;  3A5Z B;  4C5H A;  2FHD A;  3CCM A;  2ZPI B;  2XDB A;  2LC4 A;  5D6Y A;  1KQS S;  2RHZ A;  4FSX A;  3RUX A;  2DTI A;  5HY6 A;  1VQ7 A;  4XTU A;  3RKX A;  3VUB A;  2EAY A;  3NTK A;  3O8V A;  5LJ3 f;  2DIQ A;  3OYN A;  4PJO D;  4R56 A;  1PSE A;  5GAO l;  4EMK B;  4KBM B;  2PU9 B;  3A8H B;  3OMG A;  3ME9 A;  2XDP A;  3T9N A;  3I56 T;  4JJN K;  3BY7 A;  4M77 F;  4Z02 A;  2RA2 A;  5IAY A;  3MCA B;  3ZFJ A;  2LQK A;  3V7R A;  4TVR A;  3SWN C;  3CCS A;  4KT0 E;  1VQL T;  3CC4 A;  2RO0 A;  4X9D A;  1MHN A;  5CKD A;  3FIF A;  3MEV A;  1WJR A;  3HSB A;  4M7D F;  2L3R A;  5C0M A;  4L5G A;  3X28 B;  3C4S A;  2M0O A;  3TEE A;  3X25 B;  1ZBX A;  3JSC A;  3ZBD A;  4BD3 A;  2KK4 A;  4RG8 A;  3JCM X;  3CXC A;  3CCL A;  3QJ6 A;  3R6O A;  2X4J A;  1X75 C;  2EJG A;  1YIJ A;  3CCQ T;  2OTJ A;  4A4K A;  5GMK j;  3NTH A;  3LGF A;  4HKE A;  3CXC S;  1U1T A;  3A8M B;  5IT9 E;  3H8Z A;  3P8D A;  1Q82 U;  3TRE A;  2DPP B;  4M78 G;  4M77 C;  4ZTF A;  2XKO C;  1WQW A;  3AHU A;  4EMK C;  2PVG B;  5A0D A;  3CMA A;  3QJY A;  2K3Y A;  5CQX A;  4RG2 A;  3JB9 G;  4QVC A;  4C92 A;  1K73 C;  1FWZ A;  2RJE A;  5AYF A;  2YLC A;  3JCM g;  2AHJ B;  4N4G A;  2DXT A;  2CKK A;  2PVD B;  2VGN A;  5EG2 A;  1KQ2 A;  1BYM A;  2FVU A;  4LD6 A;  2G3R A;  2ZGW A;  1G5V A;  5CIU A;  1YHQ T;  4M75 F;  3WVD B;  2BUD A;  4OB2 B;  1Q7Y C;  1UEB A;  1G3T A;  1LNX A;  4F7U A;  3Q1J A;  4HCZ A;  1XOV A;  4OB1 B;  5FU6 B;  2LTO A;  5HK3 A;  3OY9 A;  3HKS A;  3VV0 A;  1VQL A;  2M9U A;  4E7H A;  4IUQ A;  4C5I A;  4XTZ A;  3NTI A;  1O9S A;  1QW1 A;  4QQD A;  2P0P A;  2PUK B;  2IG0 A;  3FB9 A;  4A4F A;  2EQM A;  3CPW A;  4HT8 A;  3CCV T;  3MP6 A;  3OYE A;  4IUR A;  3E19 A;  2VV5 A;  2Y4Y A;  4O6J A;  5GMK e;  5GMK m;  1D3B B;  1YJ9 T;  2ZPG B;  2JZ2 A;  3G71 A;  2EWN A;  3C12 A;  4M78 D;  2GQV A;  4RCB A;  1NE8 A;  3FJP A;  2XD0 A;  2FYK A;  3CPW S;  3CCQ A;  4II1 A;  4BI4 A;  5HK0 A;  4JS5 A;  2WSE E;  1GXI E;  4C92 E;  2K5F A;  4BE2 A;  4MDX A;  2XID A;  5GAO q;  4XTW A;  1M90 U;  3QKJ A;  4JUV A;  1HK9 A;  5J26 A;  3JB9 I;  3OBW A;  3CCE T;  1JBM A;  3V7S A;  3OYM A;  1S72 T;  1U8R A;  4PJO E;  3OSS C;  4Y91 A;  4MZT A;  4RKU E;  1OZ3 A;  5HKC A;  3L2V A;  5GAN 6;  2GF7 A;  5I2M A;  1VUB A;  3EFR A;  5LJ3 g;  5GAN 2;  3BW1 A;  4C92 G;  1LJO A;  3LWH A;  3I55 T;  1KD1 C;  2KSS A;  2QQ9 A;  3BDU A;  3QDR B;  4M7A B;  2VGM A;  4EDU A;  4F7U E;  5GAN 4;  2KY9 A;  5GAM j;  4C8Q B;  4PNO A;  2RJC A;  3QYG B;  3OB9 A;  1I8F A;  4IUU A;  2LCC A;  1VIE A;  2I2L A;  2JN0 A;  3DLM A;  4N0A A;  3QHS A;  4OVA A;  4MZM A;  2QEX T;  3QO3 A;  2DIG A;  1BI1 A;  2KMT A;  3RMQ A;  4MMK A;  3FRN A;  1VQP T;  4F7U G;  4CI0 C;  3OYD A;  4OP0 A;  1UGQ B;  2C06 A;  5LJ5 j;  3FEO A;  3SWN B;  3P8H A;  3CC2 T;  4VUB A;  5GAO p;  3M57 A;  3G4S A;  4E7K A;  3OYA A;  3OYC A;  4M7A A;  3LWI A;  4L59 A;  1YJ9 A;  5I21 A;  3KXT A;  2XIC A;  4JRP A;  5L8R E;  2O01 E;  5FRN A;  4NOY A;  5FU7 C;  4X34 A;  4E7I A;  5D6W A;  4XK8 E;  5CCA A;  4B9W A;  1VQ9 A;  1AHJ B;  4V2S A;  3FDR A;  4GY5 A;  1R8O B;  2HQX A;  3HL8 A;  4QW2 A;  1YJW A;  1YBY A;  3CCU T;  2LCL A;  4FT2 A;  1N27 A;  1IRE B;  2E41 A;  1Q86 C;  1BIA A;  5KH6 A;  4EPC A;  3G7Z A;  5GMK l;  3JB9 F;  1DJ7 B;  2ZPF B;  2Y4X A;  4C8Q C;  3CCE A;  3OS5 A;  3SWN A;  5GMK i;  4BI3 A;  4OB3 B;  4BE0 A;  1QP3 A;  3DB4 A;  3QII A;  4M77 B;  1N6A A;  5I2S A;  5GAM e;  1QVG A;  4ATO A;  1EIF A;  3M53 A;  1VQK A;  2HQE A;  3GNG A;  4MML A;  5CAI A;  4J7I A;  5LL6 S;  3OYK A;  2EQU A;  4J5Y A;  2QI2 A;  3KBG A;  4QVZ A;  2E64 A;  2L8D A;  2RJF A;  1I81 A;  1VQM A;  4M7D B;  3F70 A;  3LGL A;  1Y7X A;  3PMT A;  4D6W A;  4LDY A;  1QVG S;  3S6W A;  3OQ5 A;  2JTM A;  1NPP A;  2DD5 A;  2QA4 T;  4J6Y A;  1Y71 A;  2DKG A;  5LJ5 e;  3DKM A;  1K8A C;  4OF1 A;  3S3N A;  3J81 E;  1H64 1;  4M78 E;  3CD6 T;  2QEX A;  4A54 A;  1Q81 C;  3BFM A;  3TU4 K;  3RKW A;  2V8J A;  1K73 U;  4KUI A;  2F5K A;  2F69 A;  2L5Q A;  2R57 A;  4M77 A;  1VQP A;  1YIT A;  3JCM c;  3V8J A;  3LW5 E;  4EMK A;  2KVQ G;  3MEW A;  3OMC A;  5GAN j;  3OBY A;  3V8K A;  1LOJ A;  2RI2 A;  3KUF A;  3PTA A;  1X01 A;  3MP1 A;  3OYH A;  4E7L A;  4M7A G;  4ME7 A;  4XTX A;  1BI3 A;  2CYZ B;  1IZ6 A;  3ASK A;  3QXE B;  1YCY A;  4PKC C;  4GLK A;  2RD1 A;  2MF2 A;  3HHT B;  1MGQ A;  4YTL A;  2EYQ A;  2DZC A;  4MZP A;  3G6E T;  2LT4 A;  1Q7Y U;  3L42 A;  3INZ A;  4OB0 B;  3VUZ A;  3PT9 A;  3RKY A;  3A8L B;  1BI0 A;  1WNL A;  1VQO T;  5M9O A;  3OYB A;  2ZPE B;  2K3X A;  2EFI A;  4IUT A;  2RK1 A;  2XU8 A;  5A0L A;  3PNW C;  5LJ5 d;  2B8A A;  2ZCF B;  4M7D C;  2K57 A;  2X4X A;  5GAM h;  2QQS A;  4C92 F;  4M75 B;  4HT9 A;  2M1H A;  3JRZ A;  3RES A;  3L2W A;  2ZZD A;  3JCM b;  2EJF A;  5GAO n;  3S3M A;  2D0Q B;  1ZHI A;  1VQ4 T;  3HRU A;  2OTL T;  2QDY B;  3I56 A;  1KHC A;  4PJO F;  2CZ7 B;  4FU6 A;  4ELY C;  3J7A F;  5FLX E;  2V8I A;  5LJ5 h;  3BDL A;  4JRK A;  2L89 A;  3L2R A;  1KQ1 A;  4OGE A;  2PVO B;  3LX7 A;  4J6W A;  3CC7 T;  2QA4 A;  2MMP A;  4DA4 A;  4F7U F;  2RI3 A;  1VQ6 T;  3CD6 A;  4QVD A;  3X26 B;  3V8L A;  5GAN e;  3JCM J;  4M7A D;  3WXM B;  1KHI A;  1NZ9 A;  2GFA A;  3QUI A;  3SB2 A;  3M59 A;  1SSF A;  3OYF A;  4M77 G;  4C8Q D;  2EIF A;  3PIP A;  4XQ3 A;  1KD1 U;  2CZ1 B;  2MWO A;  3EFS A;  1KC8 C;  4OGC A;  3X20 B;  3VU3 C;  1UGP B;  3CCJ T;  1M1K C;  2R5A A;  2DXC A;  4M75 C;  3FC3 A;  3CCR T;  3OYJ A;  2DEQ A;  5DLO A;  4Q5W A;  2P4T A;  3VKI A;  3HPW A;  4PJO C;  3JCM P;  4A4H A;  5FU7 B;  1U1S A;  2VXE A;  2NLU A;  3CPF A;  2F5T X;  3UPU A;  2LVM A;  1Y07 A;  1D3B A;  2MWP A;  3M4G A;  4RMO A;  3L2Q A;  3M4Y A;  5GAN 8;  3NFC A;  2DAQ A;  4C0D B;  1M5Q 1;  2RH2 A;  5J39 A;  5CK9 A;  1WGS A;  5GAN d;  4IUV A;  3N5B B;  4HCB A;  3PGG A;  4ZTJ A;  4BE1 A;  2EQK A;  5LJ5 f;  1YHQ A;  4DQ2 A;  3VJP A;  3UWN A;  1WPY A;  1VIF A;  2FL7 A;  2JVV A;  5CQY A;  2DXU A;  2BIV A;  2KAF A;  1VQ7 T;  2XK0 A;  4ZN1 A;  1QVF A;  4ZN3 A;  1Q86 U;  4BAC A;  4M77 D;  4LDU A;  3URG A;  1M1G A;  5GMK h;  5GAN h;  2HBP A;  1VQ6 A;  3MEA A;  4C0G A;  3CCV A;  4KUL A;  4J6X A;  4MDW A;  2QQR A;  1M9S A;  2LX9 A;  1QVF S;  2WSF E;  3CCS T;  3CC4 T;  2V8K A;  4M7D D;  4LDW A;  4A4E A;  4C8Q A;  2EQJ A;  5CKE A;  5DLQ E;  2CZ6 B;  1B34 B;  3M56 A;  4M78 F;  2VXF A;  1TH7 A;  3LYI A;  3M5A A;  3OYY A;  4XTY A;  4ZGD B;  1N8R C;  2E10 A;  4C0D C;  2DXB A;  2VUB A;  1G3W A;  2XHC A;  1JB0 E;  1K9M C;  3CCJ A;  3QZ5 B;  2O4X B;  3CCR A;  4FIB A;  3QSU A;  2CZ0 B;  4BUG A;  1YIJ T;  1K8A U;  2OTJ T;  3RIR A;  3QYH B;  1S72 A;  3GLX A;  4JDS A;  1Q81 U;  2JNG A;  4DOV A;  2VYT A;  4XU0 A;  2A7Y A;  3CBO A;  3LLR A;  1XQH A;  3M55 A;  4FT4 A;  1X6O A;  4LDV A;  3J80 E;  2RHU A;  3M54 A;  4LD9 K;  1W4S A;  5A2Q E;  3I55 A;  1Y96 B;  1VQN T;  3QPH A;  5CKH A;  3E9F A;  2DK3 A;  3L2Z A;  1M4Z A;  2DVE A;  3DB3 A;  3OA6 A;  1BKB A;  1OI1 A;  5D6X A;  1B34 A;  3MO8 A;  2LNV A;  3CMA T;  2JTF A;  3S3O A;  1P92 A;  1N9S A;  3UDC A;  2OAU A;  3FLG A;  3CBP A;  4P5N A;  1M1F A;  3GIB A;  4M7A E;  4M78 C;  1WQ7 A;  4BB7 A;  4E7J A;  2QTX A;  2RB6 A;  4BY6 B;  1FX7 A;  4C8Q E;  5KCH A;  5GAN f;  3SDZ A;  4XU3 A;  4M75 D;  3JAM E;  3GPL A;  3M9Q A;  4A53 A;  2IVW A;  4OMF B;  3HP9 A;  5J3B A;  2XG8 D;  3GOX A;  4RCC A;  1UGR B;  3JCM e;  2A3L A;  3CC2 A;  2MI6 A;  5GAN 3;  2ZPB B;  4JS4 A;  1Y96 A;  5A0G A;  2P0Q A;  2VC8 A;  2LQ8 A;  2CGH A;  1I4K 1;  4EMG A;  5GAM d;  1NJI C;  4M7D A;  2QXF A;  5LJ3 j;  5DY9 A;  1BI2 A;  3CME T;  4LDX A;  4J8O A;  4NS5 A;  1JRI A;  4C8Q G;  4EMH A;  1VQ5 T;  2K4Y A;  2MAM A;  3HRT A;  3L1A A;  5KE3 A;  2LRQ A;  4J7F A;  4BDZ A;  2FB7 A;  4IKF A;  3CCU A;  4C92 B;  4XAX B;  2X4W A;  4ZGE B;  1OYX A;  2ZPH B;  5GAM g;  3G71 T;  2GCX A;  2JUF A;  1VQ8 T;  1RL2 A;  1N9R A;  3ER0 A;  2HD0 A;  4IUP A;  3EAE A;  4PLL A;  3PFS A;  5DM7 R;  4PJO B;  3CBM A;  2GFU A;  3C95 A;  4C5E A;  3PIO A;  4JLG A;  3X24 B;  4BY6 C;  5C6S A;  3JCM V;  5LJ5 g;  3JCM d;  4KUD K;  2DTH A;  3ZEH A;  3OYI A;  1VQN A;  3RER A;  2QQA A;  5CVI A;  3MHX A;  2X35 A;  4M77 E;  1KC8 U;  3GF5 A;  3OS1 A;  4F7U B;  1JJ2 A;  4Y28 E;  2E12 A;  1M1K U;  3GNF B;  5KCO A;  4R55 A;  4M7D E;  4HA8 A;  3VYH B;  1JJ2 S;  3QBY A;  4M75 A;  4JRI A;  3JCM h;  3OSV A;  5FRO A;  3GP8 A;  3OW2 A;  2EJ9 A;  3QG1 A;  4BI8 B;  1Q82 C;  4PJO A;  2RHY A;  4WF2 A;  5LJ3 e;  2WSC E;  3JB9 J;  3SFM A;  2R5M A;  4C92 C;  3MEU A;  2KDS A;  3PMI A;  4PLI A;  1YI2 T;  4FM4 B;  2XI9 A;  3UT1 A;  3OW2 S;  2YLB A;  4ELZ C;  2RHX A;  1G3Y A;  3MET A;  2HNI A;  4XU1 A;  5GAN 7;  4JRQ A;  2PUO B;  2DO3 A;  4C5G A;  2P0K A;  3DLL A;  3OS0 A;  3CME A;  2WAC A;  4M7D G;  3H6Z A;  2DZ9 A;  2PQW A;  1UB4 A;  3G4S T;  1VQ5 A;  3G6E A;  1BIB A;  5FRM A;  3CEY A;  2LDM A;  3E9G A;  4C0F A;  5GAM f;  4ZGJ B;  1VQO A;  2XDD A;  1UGS B;  4UC4 A;  1VQ8 A;  1NPR A;  3RMS A;  4E47 A;  5GAO r;  2YHT A;  1G3S A;  2RJD A;  3HFN A;  4O5V A;  1YJN T;  1VQ9 T;  2CS7 A;  4L6V 5;  4NL3 A;  2RI5 A;  2RK2 A;  3HRS A;  1YJW T;  3JB9 D;  1O75 A;  5GAO m;  2E6N A;  1YI2 A;  5LJ3 d;  1VQ4 A;  5CKB A;  2OTL A;  3JCM Q;  4M75 E;  3CCM T;  2E65 A;  5CO7 A;  1H3Z A;  2K5I A;  4PL6 A;  3VYG A;  5KE2 A;  1N8R U;  3A8G B;  3V7C A;  2QQB A;  4CRI A;  5GAN g;  2KQW A;  1K9M U;  3L2U A;  4QQG A;  5CR2 A;  1VQK T;  2X4Y A;  3CC7 A;  1I5L A;  1FXX A;  3JCM f;  1V29 B;  2M16 A;  3P8B B;  2Y90 A;  5FU6 C;  4A4G A;  1ZQ1 A;  2LT1 A;  5LJ3 h;  4HCC A;  1QP2 A;  1VQM T;  4N4I A;  4M78 B;  3MP8 A;  2DD4 A;  3OYG A;  4M75 G;  5IN1 A;  1QVP A;  3TCJ A;  1M90 C;  4M7A F;  4PJO G;  2D6F A;  2E6Z A;  2RM4 A;  2BKD N;  2E5Q A;  3M58 A;  2H3J A;  1W2B A;  2DTO A;  1WJQ A;  4C8Q F;  1HXD A;  4XTV A;  1WJS A;  3OYL A;  4X9C A;  3JB9 H;  2DJZ A;  3CCL T;  1RI0 A;  1YIT T;  1M8V A;  1XNI A;  3A8O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...