1WGSA

Solution structure of the tudor domain from mouse hypothetical protein homologous to histone acetyltransferase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
133
structure length
133
Chain Sequence
GSSGSSGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MYST histone acetyltransferase 1
publication title Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase
rcsb
source organism Mus musculus
total genus 5
structure length 133
sequence length 133
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wgsA00
2GF7A 3EAEA 3PNWC 2RJCA 4IUVA 5FRMA 3UWNA 1OYXA 3C4SA 3E9FA 4B9WA 3NTIA 3P8DA 1OZ3A 4PLLA 3NTHA 4BD3A 4E7KA 3QBYA 2NLUA 4HCZA 3OYHA 3OYMA 4A4HA 2D9TA 2X4WA 3LLRA 5FRNA 3UT1A 2WACA 4BE2A 3S3OA 1KHCA 2QQRA 3QIIA 3FLGA 2HQXA 2O4XA 4A4FA 3Q1JA 2M16A 3L2UA 4C5GA 3MEWA 4Q5WA 5KH6A 4ZTJA 1MHNA 1G5VA 2JTFA 2M0OA 3OYGA 3KUFA 3OY9A 5M9OA 4II1A 3FDRA 3S6WA 2RHYA 4QQDA 3OS2A 5KCOA 2LRQA 3L2WA 1RI0A 3OYDA 2JZ2A 3PMIA 1H3ZA 3SD4A 2CKKA 1XNIA 2EFIA 4E7IA 2R58A 4RG2A 4BE1A 2G3RA 2R5AA 3OYIA 2VYTA 5KCHA 2LCCA 3OYKA 4QQGA 2RI5A 3M9QA 5D6XA 3S3MA 2F5KA 5FROA 3OYBA 2RHZA 3OS0A 4E7LA 4LD6A 4ZTFA 4FL6A 2MWPA 5KE2A 2LTOA 3ME9A 3CEYA 3OMGA 2PQWA 3GOXA 2R5MA 2QQSA 4PL6A 3LH0A 5IN1A 2RI3A 2GFUA 3DB3A 2X4YA 3META 4GY5A 2XK0A 4FU6A 2XDPA 3MEUA 4A4EA 2RI2A 2RHXA 2B8AA 4CRIA 3BDLA 2RJDA 3P8HA 4IKFA 3DLMA 1OI1A 3OYLA 4UC4A 3LGFA 2P0KA 1N27A 4IURA 2M1HA 4E7JA 2LDMA 3PFSA 4N4IA 5C0MA 3LGLA 2DIQA 2X35A 2EQUA 4OVAA 2FHDA 3MO8A 4PLIA 2EQJA 2RHUA 3ZEHA 2RO0A 1SSFA 3OA6A 5D6WA 4Z02A 4B9XA 3LYIA 3E9GA 3NTKA 3QKJA 4EDUA 4IUQA 4BDYA 4C5HA 2L8DA 3L42A 4QQ6A 4N4GA 1OZ2A 2LVMA 2X4XA 1WJSA 5D6YA 4C5IA 3S3NA 5KE3A 3OYJA 2EKOA 4QW2A 3FC3A 4BE0A 3OB9A 4X34A 3FEOA 3H6ZA 2O4XB 3OS1A 3O8VA 4N4HA 3MP1A 2BUDA 3H8ZA 3MP8A 3OYNA 2IG0A 4IUTA 4QVZA 5CIUA 3MP6A 3OYCA 3L2RA 2R57A 3MEAA 4IUUA 4BACA 3PMTA 5J26A 1WGSA 3OYAA 2L89A 2K3YA 3OYFA 3L2VA 2EQMA 2MWOA 1WJQA 1WJRA 2HQEA 3OYEA 3LX7A 3MEVA 5IAYA 2RJEA 2BIVA 3OQ5A 2K3XA 4C5EA 2EQKA 2DIGA 3QJ6A 2RHIA 3L2QA 2E6NA 2GFAA 3OMCA 5C6SA 5J39A 3DB4A 2YRVA 2E5QA 2BKDN 3F70A 2L3RA 2RJFA 4BDZA 4A4GA 4IUPA 3ASKA 4NS5A 4E7HA 2DAQA 4L59A
chains in the Genus database with same CATH superfamily
1N8RC 2DYBA 1BI0A 3CCVA 1ZBJA 1UHCA 4BD3A 2ATCB 2MPXC 1ZA2B 1PKTA 1AZEA 2A7YA 1PD1A 1HJDA 3PTAA 3VS4A 4C92D 1BI1A 3JCMX 2JTFA 2ZPFB 3OY9A 1VQ8Q 1M1KR 4M7AF 1WNLA 2HZYA 3WVEB 1WHHA 1GXIE 1PKSA 3QDFA 4ATOA 1KQ2A 3CBOA 5CK9A 1M8MA 5GAOp 2XDDA 1ZSZB 1B34B 3QG1A 3AHUA 4ZN3A 1AEYA 4E7LA 4J8OA 2RQUA 2DYIA 7AT1B 3LH0A 2GFUA 1PHTA 3EG2A 1W2BP 3OSSC 5GMKm 3CCRT 1X6GA 5CKDA 3OYLA 2K3BA 2EYXA 1BBZA 2LDMA 1TH7A 1U1SA 2MMPA 1KD1R 3KBGA 5D6WA 1YJ9A 3RKYA 3M0PA 1YJNT 2C0OA 2DPPB 1W6XA 2FZKB 3FRNA 5A0GA 2PUOB 5HK3A 1YJWQ 2ECZA 4X34A 1VQ6Q 2C06A 2CH4A 3DKMA 1ZSZA 1YWOA 1RADB 1WIEA 1GCQA 1MV0B 1QWFA 3OYFA 1VQMT 1Y07A 1VQOA 4DQ2A 3JB9I 2WSEE 1RAFB 1X27A 2H3EB 3TU4K 2E6NA 3JCMd 4LUEA 2LX9A 4ZGEB 3CC2Q 2AK5A 3CCEA 3H0FA 1IREB 2K7AA 2LQKA 4M7DB 2DVJA 4L6V5 2VV5A 1M1KU 5LJ3e 3VS1A 4MZPA 4FT4A 1HXDA 4DBRA 3OYHA 2NLUA 4R0KA 5EG2A 1NE8A 1VQPA 3VU3C 1KC8R 1G2BA 2HQXA 4RTTA 4F7UF 4ORZA 2HKNA 3QPHA 2L3QA 1QVFS 3RNJA 2DETA 4M77B 1M30A 3S6WA 4LXCA 3OYDA 2DBKA 1H3ZA 4JJNK 1U5SA 3CBMA 1KD1U 2VYTA 5KCHA 2F5KA 4N0AC 3M0UA 3FB9A 2DVEA 5LL6S 4NL3A 4J9BA 3JRZA 2MCNA 1WX6A 4M7DA 1X43A 2V1QA 1EX4A 5C0MA 4J5YA 5GAMj 3EHRA 2KBTA 2ZPBB 3CC4A 1SG5A 5GAOn 4Y91A 3SEMA 4C5IA 3S3NA 2LQWA 2DJZA 3RIRA 4M77A 2J6KA 2A0FB 1Y0MA 3VKIA 1GBRA 3GIBA 1GCQC 5CIUA 1UGQB 4HA8A 4IUUA 2DFUA 1VIFA 3LX7A 4KUDK 3MHXA 1PM3A 1C0MA 2DD5A 1X01A 3RDVA 4C92E 1FMKA 1KFZA 1AOJA 5IHNA 3HFOA 5DY9A 2CGHA 3RKXA 3PE0A 2JW4A 5FWBA 1M4ZA 3EG3A 4M75F 1NM7A 5L8RE 2RJFA 2P4TA 2F1LA 5CO7A 2EYZA 4A4KA 2OAWA 3V7CA 4JPBW 2F2XA 3X25B 2JTMA 3CC7T 2LC4A 2QQRA 2CP3A 4M7DG 3JCMP 4PJJA 1Q81R 4C8QG 4J9EA 1Q82C 4GLKA 3EFRA 3L1AA 1RAAB 4XU2A 3OBYA 2YUNA 4LN2A 1WHLA 2CKKA 2DRMA 2HDAA 2OTLQ 1JRIA 3OYBA 4JS5A 1VQ8A 1M9SA 1VQNQ 2CUDA 1OULA 1MUZA 1BK2A 2XD0A 4PK4A 2XDBA 3BY7A 3URGA 2XDPA 3I5SA 1TWBA 5A0DA 1VQKA 1OI1A 2CT4A 3J7AF 5GMKj 4E7JA 2QQBA 3PVLA 3EFOB 2ED0A 5GANh 5GAN4 3CCJT 1D0ZA 4M77C 1M27C 2RK2A 4JJBA 4XTYA 5IH2A 1XOVA 2ED1A 1ZA1B 5GAN7 5GAMe 2IIMA 3PMTA 1U06A 3CCQT 1YJWA 3GP8A 3LWIA 4AFSC 4F17A 1PRMC 5GAOr 4M77D 3E1SA 1GFCA 2BE9B 1M1FA 3QXEB 3CCUT 4RCBA 1ACMB 2D6FA 2KDSA 3M4YA 5CKFA 3EG1A 1E6GA 3EFOA 4A4GA 3CCSQ 4LDXA 3QYHB 4O5VA 2H8HA 1GRIA 4E47A 1T3LA 2EYYA 1QVPA 4HT8A 4M78F 2EAYA 2MF2A 2M16A 2F2VA 4M7AC 5KH6A 3NHNA 4PJOF 1RAIB 2EYQA 5GAMg 2PVDB 4K11A 3KFVA 1M3AA 1IHVA 1XNIA 2R58A 3CQTA 2R5AA 3CCRQ 5D6XA 2M02A 2WSCE 1QW1A 2RH2A 4ZTFA 2VUBA 2DXBA 3CEYA 3GOXA 1UGPB 2BTTA 2P84A 5I2MA 3CD6T 2QQAA 1K73C 4M7AD 2DL8A 1VQ5A 2MYSA 1I8FA 3META 1NEGA 2K5IA 4RUGA 5GJWB 1TOVA 2E65A 2FO0A 4R55A 2B8AA 1YJNQ 3I55A 2MI6A 1UJ0A 3M0QA 1KQSS 3HSBA 1JJ2S 2KY9A 1YFNA 2X9HA 3NGPA 1UB4A 3M59A 3LYIA 3WVDB 1IRXA 3TCJA 1V76A 2LJ0A 1YN8A 1K4US 3D7SB 4ELYC 4JRKA 4FCYA 1X2QA 4OP0A 4PFZA 2DZCA 3OB9A 5GAN3 4HCCA 4V2SA 2O88A 3VJPA 3OYCA 5KYWB 3ER0A 3OYAA 2OX7A 1Y7XA 5GANd 4OMLA 2QGFB 3A8GB 2M51A 4OB2B 4RG8A 1VQLT 2CUBA 1OPKA 4MDWA 4OB0B 3CCMT 3CMAT 1QWEA 4OMMA 2HSPA 1KSWA 4AFUC 2V8KA 2DAQA 1QVGS 1K9AA 3RMSA 2LJ1A 1OYXA 1YP5A 3C4SA 4KRTA 3CBPA 3NTHA 1ZQ1A 1S72T 3I35A 1K0XA 4KT0E 2K5FA 3FLGA 2GTOA 2MK5A 1W70A 1ZUYA 5HK0A 1K76A 5KYWA 4PJMA 3EG9B 2DMOA 1K73R 2DO3A 2LMJA 2YUPA 4LUDA 4C92A 3SDZA 1D0XA 5KCOA 3L2WA 3PMIA 1ZSGA 2M9UA 1YI2T 1K0SA 3HTRA 3M58A 1OEBA 1D1AA 1BKBA 2E4HA 1M90R 2ABLA 1CKAA 2FZGB 3HPWA 3M4GA 1VQ9T 5IN1A 2FPFA 2DLPA 1HYOA 2OTLA 1VQNA 1N27A 4N4IA 1TUDA 2VGNA 5AYFA 2X35A 1K8AR 4LNPA 1FWZA 4M77E 4OVAA 1KJWA 2QEXT 3H0IA 4AG1C 3NTKA 1MV3A 2RNAA 4PJNA 2CP2A 2KXCA 3C12A 3EG9A 2HNIA 1G83A 3OYJA 5HKCA 1KHIA 2MIOA 4OMQA 3I9QA 3FC3A 5ECAA 2K5LA 2VC8A 5FU7B 4FW1A 4OB3B 1D1BA 3H6ZA 2O4XB 1QVFA 2E41A 3MP8A 2FRYA 3JB9H 1QCOA 4MZTA 4EIKA 2DA9A 3G6ET 4HVWA 1NJIC 2NUZA 3TSZA 4JLIA 3QJ6A 2L3PA 2KAFA 2X3WD 3X24B 2CZ6B 1M3CA 5CKHA 5J39A 1D3BB 4XK8E 2LZ6B 1E6HA 4DBHA 4C92G 4ANJA 1K9MC 1PSFA 1K73U 3QSUA 2B86A 4CC7A 3V8JA 2CREA 2A36A 3G71T 4ME7A 1OX9A 1R0BG 3NTIA 4HCZA 2X4WA 4WTOB 4M7AE 1M90U 1HSQA 5LJ5e 4M75D 2O4XA 1OU9A 2J05A 1NG2A 1QVFP 2OTJT 4ZGDB 4HKEA 4Y92A 4LE9A 5DM7R 4XQ3A 2AZSA 2DL3A 2JT4A 3G4ST 2K6DA 1U1TA 2AHJB 2RD1A 3EG0A 3INZA 1K8AU 3H0HA 4XU1A 4RTYA 4DBFA 2KGTA 3REBB 2K4YA 2JJ9A 1YCYA 2YRDA 1VQ7Q 4FYYB 3RUXA 4OGCA 2XK0A 1WYXA 3J80E 2V26A 3CCRA 2FVUA 2DL5A 3PVQA 3P8HA 2JS0A 2KSSA 1NBEB 3JCMV 1R0CB 2C0IA 4PLIA 2FHDA 3MO8A 3ZEHA 4FIBA 1PC0A 2E70A 2HD0A 1YJNA 4FSXA 4N4GA 1VQKQ 5LJ5g 1WJSA 2QI2A 5AT1B 4N0AA 5KYXB 4IIMA 3H41A 4E2FB 1BIAA 1WHKA 4HVVA 3V8LA 5CQYA 1JQQA 2KVQG 3G7ZA 3SFMA 2CZ0B 1E7OA 2QASA 1PCXA 3C95A 2Y4XA 2L5QA 2L89A 3BE3A 1VQMA 2L2PA 1XQHA 1PD0A 2K3XA 2KEAA 3RMQA 1YITT 1HK9A 1W4SA 1WLPB 1UJYA 5HY6A 1IGQA 4HVUA 5KYYB 2D0NA 3F70A 4KGZB 1LCKA 2ZGWA 5LJ3f 1V1CA 4F7UE 1B34A 4RTWA 5GMKi 1OZ3A 5HCKA 5FU7C 5KYXA 1N8RR 1KHCA 4JRIA 2COYA 3V7RA 4KUIA 2YRCA 3UATA 3FIFA 1M1GA 1N9SA 1G5VA 2J7IA 2M0OA 3CD6Q 2CSIA 2RHYA 3OW2A 3HKSA 1QQJA 3UA6A 1QCFA 2BZXA 4M78D 4RG2A 2A3LA 1MMAA 2P0PA 2G3RA 5FU6B 1UECA 2D8JA 3S3MA 3EGUA 2EYWA 1JXOA 4PJOD 4XTWA 2CP7A 2PQWA 5KYYA 4AG2C 2CYZB 3X20B 4PL6A 1UDLA 1ZHIA 2OJ2A 3DB3A 4OB1B 4DEXA 3MEUA 3I56T 2RI2A 1OQKA 4RTXA 2KYMA 4XTUA 1SRLA 2M1HA 3A8MB 4ZNXA 2EQJA 1VQ5Q 3JCMe 3FJPA 3SWNC 3CPWS 1NZ9A 2DK3A 4RCCA 3X26B 5GAMh 3I55Q 1UE9A 1FMWA 1D0YA 4CC4B 1IXDA 2YHTA 5FWCA 2BUDA 3PT9A 3G1JA 2J06A 3OW2P 3MP6A 2KR3A 3VRZA 2R57A 1H92A 4MMLA 1VQLQ 3CCMQ 5J26A 5LJ3g 1WGSA 3JV3A 1WJQA 2QQ9A 5J3BA 2HAXA 1Y71A 2MAMA 1N8RU 2KXDA 4C0GA 2KROA 4OGEA 1G3SA 1YHQT 1N9RA 3E2UA 1S72Q 2NUTB 1BCOA 1VOMA 2VVKA 4IUPA 4NS5A 2E3IA 1KQSA 2L0AA 2E3HA 1JJ2A 4C0ZA 4M7AB 2GF7A 3JCMg 3CCLT 3P8DA 4FW2A 2J6OA 3QBYA 4A4HA 3JSCA 4Z88A 3CC7A 5IXBA 3J81E 3JCMJ 1M3BA 1M2OA 5IHKA 1YI2Q 4C5GA 1QKWA 4Q5WA 8ATCB 3MJXA 4J83A 1M8VA 2JVVA 5GAOq 2LQ8A 1A0NB 4II1A 3LWHA 3GBQA 3ZFJA 1Q7YC 1Y96B 2DTIA 3HRUA 3O5ZA 3A8LB 4KH1B 2MWPA 5GAN8 3ME9A 2IPOB 2OI3A 2NUTA 2FZCB 2QEXQ 3EFSA 2DD4A 1SEMA 4BI4A 4M7AA 2I2LA 5GAN2 1RAEB 1KQSP 1JJ2P 2LQNA 1Z9ZA 2HL3A 1QVGA 1VQ7A 1VA7A 3OA6A 2PU9B 2RMOA 2DM1A 3M53A 2KNBB 2DERA 2DL4A 3G6EQ 2F5TX 4M77G 4J6WA 5KE3A 3HFNA 1X2KA 2DKGA 3OSVA 1WZOA 5GAMf 1Y96A 2LX7A 5FU6C 1AHJB 1OPLA 3CCQA 5CR2A 2K3YA 2ZZDA 3L2VA 1WJRA 2FPEA 3RESA 1N6AA 2RJEA 1VQ4T 3VV0A 2EGCA 2H3JA 2EQKA 1SHFA 1U3OA 1TUGB 2JOYA 3G71Q 2GFAA 3JB9F 5C6SA 2DXTA 1Q86C 3A5ZB 2LNVA 4F7UB 1JU5C 1M2VB 5A2QE 3T9NA 3OW2S 3M0SA 1QVGP 4L59A 4E6RA 3EAEA 3UWNA 2OTJQ 1H8KA 4E7KA 3S3OA 4JZ4A 3THKA 3G4SQ 3CXCP 4FYWB 4EPCA 1WQ7A 2W10A 4M7AG 4ZTJA 1AT1B 2AT1B 2RQRA 1G3WA 1UGSB 2CP0A 5GANj 3ZL7C 1PSEA 2JZ2A 1Q82R 3A98A 2O9VA 3VS5A 5DLQE 2LTOA 3CD6A 1K1ZA 2VB6A 5FLXE 4F7UA 2R5MA 1M2VA 2RQVA 1WI7A 9ATCB 1JBMA 1Y57A 3MPUB 4CC3A 4FU6A 1OU8A 1Q95G 2AZVA 2RQWA 1PNJA 1TUCA 3PFSA 2CH4W 3HL8A 3HRTA 2MOXA 1XJWB 2O2OA 4Z02A 1VQ6T 3QKJA 4RTZA 4QQ6A 1TTHB 1QCNA 4QW2A 4OF1A 4E7ZA 2FEIA 3MKDA 2K2MA 4HT9A 1GFDA 2XI9A 3H8ZA 2FRWA 1BI3A 2LT1A 4DOWA 2ZCFB 2LJ3A 1RL2A 3L2RA 4M75B 2A37A 4C0DB 2JN0A 3CC2T 2EQMA 4B6MA 3MEVA 2XG8D 2LCSA 4C0FA 1CKBA 1QP3A 1VQLA 2VKNA 3CCMA 3CMAA 3M57A 1VQMQ 3FJ5A 4HCKA 5GMKe 5I2SA 5LJ5h 1GL5A 3FDRA 1SRMA 1NYGA 1ABQA 3TREA 3ULRB 1RLPC 1Q82U 1HD3A 2RJCA 3MCAB 2ESWA 1S1NA 2D0QB 5GJVB 1S72A 2D9TA 4AFQC 2Y90A 3NPFA 4F7UG 1C1AA 4E7SA 3Q1JA 1UGRB 1NLOC 4M75A 4D8KA 1R77A 3OYGA 1TG0A 2E12A 4RMOA 2SRCA 1YI2A 4O6JA 2K2VA 2X4JA 2LCCA 2RHZA 1TSFA 2LP5A 2HCKA 1VQ9A 3LH5A 1NEBA 2KK4A 3CXCS 2Y4YA 1MMGA 2QG9B 3P8BB 4JJDA 5GANe 2PZ1A 2DX1A 1G8XA 2IVWA 5FW9A 2P0KA 1BB9A 2QEXA 4LDWA 4HXJA 1T0HA 3VS2A 1Z9QA 4B9XA 2XHCA 2QDLA 4BDYA 4C5HA 1OZ2A 3RR6A 4KGVB 2J6FA 1YIJT 2EKOA 2DJQA 2EJGA 1MGQA 4LDYA 2VGMA 3LW5E 3OS1A 2QAZA 3VUZA 1J3TA 2M0YA 5A0LA 2W0ZA 3G6EA 3MEAA 2XICA 2KI7A 4ESRA 1DJ7B 4FM4B 2RN8A 3M0TA 3QUIA 2HBWA 1KQ1A 3I5RA 4M75G 1O9SA 4M78B 3CCLQ 1VIEA 4FYVB 1UFFA 3V8KA 1ARKA 2L3RA 2O01E 2X51A 1CSKA 2QTXA 1AD5A 4PJOB 4E7HA 2FYKA 5CKBA 3G71A 5IT9E 1F1BB 1BU1A 3ZBDA 3E9FA 2F69A 3LLRA 5FRNA 2EJ9A 3CPWA 3UT1A 3OYYA 4CI0C 2PVOB 5LJ5f 4Y28E 1BIBA 5LJ3h 4M75C 5L23A 1WHGA 3L2UA 4PJLA 1M1KC 4C0DC 4M7DF 2OTJA 4Z8AA 1UHFA 5LJ5d 2EQIA 5M9OA 4C8QF 3OS2A 3CC7Q 3G4SA 4XTVA 6AT1B 2QA4T 4PFPA 2V8IA 4QQGA 4M78A 3JCMb 2D8HA 2C0TA 2EWNA 1JEGA 2HL5C 4IIOA 3UDCA 3JCMh 4PJOA 2RA2A 4J9DA 3SWNB 1GBQA 3M56A 2DNUA 3BDLA 1KD1C 3HP9A 3DLMA 1WHMA 2XU8A 3CMET 1EIFA 2YUQA 3TEEA 1SSFA 3CPWP 4EDUA 4XTXA 3JCMc 3L42A 1RI9A 2A28A 1D3BA 4X9CA 2ZPHB 4A54A 2JMCA 1D1CA 3FEOA 3IQLA 3OYNA 3CCJQ 4JRQA 2IG0A 4IUTA 4QVZA 5GAOl 3QHSA 2NYSA 3RERA 2YSQA 3WXMB 1AWWA 2XIDA 2RPNA 4C5EA 1NJIR 1YITA 2DIGA 2V8JA 3SWNA 1T3SA 3CCST 2BZ8A 3OMCA 2VXFA 1SHGA 3CCQQ 3QZ5B 1WHJA 1M5Q1 2DILA 1I81A 4MDXA 3CCUQ 1KIKA 2EKHA 1SKUB 4AT1B 1K9MR 1KC8C 1YBYA 4M78G 4BI8B 3CCVT 3JB9D 4QKUA 4RKUE 2QYZA 1FYNA 1SF9A 2DBMA 2WACA 4BE2A 5I22A 4PJOG 1NLPC 3MEWA 1QMCA 2PUKB 3OS5A 1RAGB 1QP2A 1H3HA 2NWMA 3BDUA 2QDYB 3BFMA 1BI2A 2AIRB 2LRQA 4HCBA 1OOTA 2CDTA 1PG5B 4M78C 2KMTA 4J6XA 1B3QA 2RI5A 4EMKB 3OS0A 4LD6A 3TSWA 4FL6A 5LJ3d 2PTKA 4PJOC 2YLBA 2RI3A 2D1XA 3I56A 1WDXA 1NPRA 2RHXA 1X6OA 1SPKA 2RJDA 5KYUB 3LGFA 4MMKA 2PNIA 5CQXA 3L2ZA 2YUOA 3JCMf 3PIPA 1YJ9T 3NMZC 2DL7A 4IUQA 4F16A 1NJIU 4A63B 1AVZC 2QXFA 3GNFB 2AKLA 4BY6B 3VS6A 2XKOC 4BE0A 1UTIA 3EGDB 2ZPGB 3GPLA 4YTLA 3A8HB 2VWFA 2DF6A 2Z0WA 3VS3A 4EMKA 4C8QB 1N5ZA 1K9MU 4DA4A 4AFZC 5IAYA 1VQOT 4XU0A 2BIVA 2FB7A 4ELZC 5I21A 2P4RA 1YHQA 5KYUA 2CZ7B 2YRVA 4A53A 2BKDN 4JLGA 1WFWA 3CCET 4MZMA 2QK0A 4QVCA 2O31A 3TQ7P 3CCLA 3CMAQ 4BB7A 4PLLA 2KYBA 4GLMA 4M75E 2X3XD 1ABOA 4FT2A 1VUBA 4KBMB 1Q81C 1VQPT 3EGDA 3C94A 3VRYA 1RUWA 3QWYA 1IHWA 2HBPA 4QT7A 2HQHA 1KG1A 4C8QA 1LPLA 1MMDA 1QKXA 2L3SA 3R6NA 4F04B 1MMNA 2O9SA 5DLOA 4WCIA 1YNZA 4X9DA 2KRNA 2EGAA 1BYMA 3OYIA 4RTUA 4OMNA 1LJOA 1IO6A 2RM4A 5CAIA 2YLCA 2QQSA 1WQWA 3SB2A 4OMFB 4JRPA 1ZSZC 4GY5A 1TS9A 3EGXB 1W2BS 1B07A 4IKFA 1UGVA 2FPDA 3E19A 1YIJQ 4FYXB 4LDUA 1VQ9Q 3LGLA 2DEUA 2DIQA 4RTVA 2G6FX 3CC4T 2LVMA 2X4XA 1KC8U 4JUVA 5GAN6 2GNCA 2KE9A 3O8VA 1GCPA 3REAB 4EMKC 5GAOm 2VASA 1VYUA 5GMKh 1VQ4A 1QLYA 1WPYA 3CCJA 3L2QA 3EGXA 4X1VA 3CXCA 4XTZA 1LVKA 3QWXX 1O75A 2EJFA 3GF5A 2JM8A 2K57A 1AWOA 1FX7A 1NYFA 3SHWA 4C92F 8AT1B 3QO3A 2GQVA 1ZX6A 2HMAA 4IUVA 4B9WA 3X28B 4BY6C 2CP5A 4NL2A 5I11A 2GTJA 5GAMd 4J7FA 1EZZB 4M7DC 3CCUA 3OBWA 5CKEA 4PNOA 2HEQA 2CSQA 3HHTB 2QA4Q 4C8QC 3CPFA 1NPPA 3KUFA 3M5AA 4M78E 1VQ7T 3UA7A 1XTDA 2GCXA 2LCLA 3R6OA 4J9CA 3SD4A 2EFIA 2DXCA 3N5BB 4PJOE 2EGEA 2AKKA 4ZN1A 1TU0B 2GQIA 1Q7YR 5IXFA 4M7DD 4AMCA 1VQ8T 5KE2A 2LNHB 3CMEQ 1X69A 3OMGA 1H641 4D6WA 4XU3A 4C8QD 2QGGA 5KYNA 2FG0A 2YXYA 4A4EA 4CRIA 1VQKT 4VUBA 1C6VX 1X6BA 2E1HA 4R56A 2EQUA 1AWJA 2COZA 3KXTA 1T0JA 2RO0A 1VQ6A 1I0CA 3VS0A 2COWA 5D6YA 1G3YA 1EFNA 4D8DA 2F2WA 2DEQA 2VXEA 1Q81U 4J9HA 4J6YA 2EVRA 3MP1A 4DOVA 1R8OB 4JJCA 2GGRA 1LOJA 4BACA 2EIFA 2KRMA 4KULA 3CC2A 4FSSA 1YJWT 4GBQA 2HQEA 2I0NA 2CP6A 1AWXA 4NOYA 1G3TA 4TVRA 3CCVQ 1D09B 4JS4A 2GBQA 1Q86R 1YITQ 2DXUA 1VYTA 4J9GA 2DRKA 3M55A 3EHQA 3QDRB 5D7UA 1Q7YU 1AZGB 1KK7A 3QIIA 1TXQA 3VYHB 2KQWA 2OAUA 1MHNA 1VYVA 4P5NA 3BW1A 2RK1A 3GNGA 4QQDA 2A08A 1M90C 1RI0A 4E7IA 2FL7A 4J9FA 1MNDA 2XMFA 3M9QA 3AT1B 3VUBA 3QZ9B 2DE0X 1UG1A 4DBQA 2E5KA 3M0RA 3JAME 1VQ5T 1UUEA 1YJ9Q 5GANf 4KH0B 2YT6A 1K8AC 5GMKl 2JMAA 4UC4A 3I55T 4IURA 4L5GA 4JDSA 3RBBB 3EH1A 4C92B 2RHUA 1ZUUA 3I56Q 3E9GA 4JZ3A 2L8DA 2ENMA 2CZ1B 1I5LA 1YIJA 4J7IA 5LJ5j 1SSHA 1PRLC 1VQOQ 4BUGA 4N4HA 2JNGA 2K79A 2ZPEB 2ROTA 3RKWA 3JCMW 1Q86U 1I4K1 1UEBA 4QVDA 1P92A 2EPDA 3A1PA 2MWOA 2ZAEA 4PKCC 3PGGA 3CCEQ 1I07A 4PFOA 2RQTA 4EMGA 1FMVA 1B7TA 1JO8A 4ZGJB 2JTEA 4Z89A 2BE7D 3U23A 2RB6A 2DZ9A 2DTOA 2P0QA 1WA7A 2WSFE 2HKQB 4BDZA 1VQPQ 1LNXA 2PVGB 4LD9K 2E10A 3QJYA 3PIOA 1RACB 2JXBA 3PNWC 5FRMA 1YHQQ 1YCSB 4M7DE 3OYMA 1W1FA 4C8QE 2JM9A 1I5OB 1OX8A 4A4FA 3UPUA 4LDVA 2LT4A 3A8OB 4M4ZA 5GANg 5CVIA 4CC2A 5CCAA 1V29B 1IB8A 1RLQC 2ZPIB 3C0CA 2SEMA 2QA4A 3EH2A 4BE1A 3JB9J 3OYKA 2CT3A 5FROA 2NUPB 1IGUA 4J9IA 1YWPA 2K9GA 1WXUA 2E64A 4EMHA 1BCMA 4OMOA 2X4YA 3DLLA 3CC4Q 2OTLT 1MNEA 1VQNT 3CMEA 5EC7A 2KRSA 3JCMQ 2HSEB 1JXMA 3TVTA 2RF0A 2QTVA 2EBPA 1FXXA 1ZUKA 1ZLMA 3GLXA 3VYGA 2YDLA 2KT8A 1WXTA 5GAN5 2E6ZA 4M77F 2V1RA 2CS7A 3NFCA 4BI3A 3UF4A 3QYGB 3M54A 1I1JA 1RABB 1JB0E 3HRSA 2NUPA 1ZBXA 2DTHA 4F14A 1OV3A 5LJ3j 2EW3A 3OYEA 2BZYA 1IZ6A 1PWTA 4DEYA 1X75C 3OQ5A 4WF2A 4KGXB 3JB9G 4OMPA 4XAXB 3CCSA 2RHIA 2JUFA 1RAHB 2ROLA 2YWWA 3V7SA 2JS2A 3DB4A 2KT1A 2E5QA 3H9NA 4C92C 1W2BA 1VQ4Q 3ASKA 5IHIA 1WXBA 3VS7A 1U8RA
chains in the Genus database with same CATH topology
1N8RC 3RMSA 3EAEA 3CCLA 1BI0A 3UWNA 1OYXA 3C4SA 4BB7A 3CCVA 4PLLA 3CBPA 3NTHA 4BD3A 4E7KA 4M75E 1ZQ1A 1S72T 4FT2A 1VUBA 4KBMB 1Q81C 1VQPT 3S3OA 4KT0E 2K5FA 3FLGA 2A7YA 4EPCA 3C94A 1WQ7A 5HK0A 3PTAA 4M7AG 4C92D 1BI1A 4ZTJA 3JCMX 2HBPA 2JTFA 2ZPFB 2DO3A 1G3WA 4C8QA 1UGSB 3OY9A 1KG1A 4M7AF 1WNLA 4C92A 5GANj 3SDZA 3WVEB 1GXIE 5KCOA 3L2WA 4ATOA 1PSEA 2JZ2A 5DLOA 3PMIA 1KQ2A 2M9UA 4X9DA 1YI2T 3CBOA 5CK9A 5GAOp 2XDDA 1B34B 1BYMA 3M58A 3OYIA 5DLQE 1BKBA 3QG1A 3AHUA 4ZN3A 1LJOA 4E7LA 4J8OA 2LTOA 2RM4A 3CD6A 5FLXE 3HPWA 4F7UA 5CAIA 2R5MA 2YLCA 2QQSA 3M4GA 1VQ9T 1WQWA 3LH0A 5IN1A 2GFUA 1JBMA 4OMFB 3SB2A 4JRPA 4GY5A 4FU6A 2OTLA 1W2BS 3OSSC 5GMKm 3CCRT 4IKFA 5CKDA 3OYLA 1VQNA 3E19A 1N27A 2LDMA 3PFSA 4LDUA 4N4IA 2VGNA 3HL8A 3LGLA 2DIQA 2X35A 1TH7A 3HRTA 5AYFA 1FWZA 4M77E 1U1SA 4OVAA 2QEXT 2MMPA 3KBGA 5D6WA 1YJ9A 4Z02A 3RKYA 1M8VA 1VQ6T 3NTKA 3QKJA 3CC4T 3C12A 4QQ6A 1YJNT 2DPPB 2LVMA 2X4XA 1KC8U 2HNIA 3FRNA 4JUVA 5A0GA 2PUOB 5HKCA 5HK3A 3OYJA 4QW2A 5GAN6 4OF1A 1KHIA 3FC3A 2K5LA 2VC8A 5FU7B 4OB3B 4X34A 3H6ZA 2O4XB 2C06A 3O8VA 2XI9A 2E41A 1QVFA 3MP8A 3H8ZA 3JB9H 3DKMA 1BI3A 2LT1A 4MZTA 4DOWA 4EMKC 2ZCFB 5GAOm 1RL2A 3L2RA 4M75B 3G6ET 4C0DB 1NJIC 2JN0A 3CC2T 3OYFA 2EQMA 1VQMT 3MEVA 1Y07A 2XG8D 1VQOA 5GMKh 4DQ2A 1VQ4A 1WPYA 4JLIA 4C0FA 3JB9I 3CCJA 1QP3A 2WSEE 3QJ6A 3TU4K 2KAFA 3L2QA 2E6NA 3X24B 1VQLA 2CZ6B 3CCMA 3JCMd 2LX9A 5CKHA 4XTZA 4ZGEB 5J39A 3CXCA 3CMAA 1D3BB 3M57A 4XK8E 1O75A 2EJFA 3CCEA 4C92G 1IREB 3GF5A 5GMKe 5I2SA 1K9MC 2LQKA 1PSFA 1K73U 4M7DB 4L6V5 2VV5A 2K57A 5LJ5h 1M1KU 1FX7A 3FDRA 4C92F 5LJ3e 3TREA 3QSUA 3QO3A 2GQVA 4MZPA 4FT4A 3G71T 3V8JA 1Q82U 1HXDA 2RJCA 4IUVA 4ME7A 4B9WA 3MCAB 3X28B 3NTIA 4BY6C 2D0QB 4NL2A 2NLUA 4HCZA 3OYHA 1S72A 5EG2A 2D9TA 2X4WA 4M7AE 5GAMd 1M90U 2Y90A 1NE8A 4F7UG 1VQPA 4J7FA 3VU3C 5LJ5e 4M7DC 4M75D 3CCUA 2HQXA 2O4XA 3OBWA 5CKEA 4PNOA 4F7UF 3Q1JA 1UGRB 3HHTB 3QPHA 4C8QC 2OTJT 4M75A 4ZGDB 1QVFS 4HKEA 3CPFA 1NPPA 3KUFA 3M5AA 4M77B 5DM7R 3OYGA 4M78E 4XQ3A 3S6WA 2E12A 4RMOA 3G4ST 3OYDA 1U1TA 1YI2A 2AHJB 2RD1A 4O6JA 1VQ7T 1H3ZA 1XTDA 2GCXA 2LCLA 3R6OA 3SD4A 4JJNK 2EFIA 3INZA 2DXCA 1K8AU 3N5BB 3CBMA 2K2VA 1KD1U 4PJOE 2VYTA 2X4JA 2LCCA 4XU1A 4ZN1A 5KCHA 2F5KA 4N0AC 2RHZA 4M7DD 2K4YA 1VQ8T 5KE2A 3FB9A 1YCYA 2DVEA 3OMGA 5LL6S 1VQ9A 1H641 4D6WA 4NL3A 3JRZA 2KK4A 3CXCS 2Y4YA 4XU3A 4C8QD 4M7DA 3RUXA 3P8BB 4OGCA 2XK0A 4A4EA 5GANe 3J80E 3CCRA 2FVUA 4CRIA 3P8HA 1VQKT 2IVWA 4VUBA 2E1HA 2P0KA 2KSSA 5C0MA 4J5YA 4R56A 3JCMV 2QEXA 2EQUA 4LDWA 4PLIA 2FHDA 3MO8A 3ZEHA 4FIBA 5GAMj 3KXTA 2RO0A 1VQ6A 4B9XA 2XHCA 2ZPBB 3CC4A 2E70A 5GAOn 2HD0A 4C5HA 4BDYA 1YJNA 4FSXA 5D6YA 4Y91A 1G3YA 1OZ2A 4N4GA 5LJ5g 1WJSA 4C5IA 3S3NA 2QI2A 4N0AA 2DJZA 3RIRA 2EKOA 1YIJT 4M77A 2DEQA 2EJGA 2VXEA 1BIAA 1MGQA 1Q81U 4LDYA 2VGMA 3LW5E 4J6YA 3OS1A 3VUZA 4HT9A 3VKIA 3MP1A 3V8LA 4DOVA 1R8OB 5CQYA 3GIBA 2KVQG 5CIUA 3G7ZA 3SFMA 5A0LA 1UGQB 2CZ0B 4HA8A 1LOJA 3MEAA 4IUUA 3G6EA 4BACA 2XICA 2EIFA 4KULA 3C95A 2Y4XA 3CC2A 2L5QA 2L89A 1YJWT 1VQMA 1DJ7B 2HQEA 4FM4B 1VIFA 1XQHA 3LX7A 4KUDK 3MHXA 2K3XA 2DD5A 4NOYA 1X01A 3RMQA 3QUIA 4C92E 1G3TA 1YITT 1KQ1A 1HK9A 4TVRA 4M75G 1O9SA 1W4SA 4M78B 1VIEA 3HFOA 5HY6A 5DY9A 2CGHA 3RKXA 3V8KA 1M4ZA 4JS4A 4M75F 3F70A 2L3RA 2RJFA 2O01E 5L8RE 2P4TA 2QTXA 4PJOB 4E7HA 2FYKA 5CKBA 2ZGWA 5CO7A 5LJ3f 4A4KA 1B34A 2DXUA 4F7UE 3G71A 3V7CA 5IT9E 3ZBDA 3M55A 5GMKi 3E9FA 1OZ3A 3X25B 2F69A 3QDRB 3LLRA 5FU7C 5FRNA 2EJ9A 2JTMA 3CPWA 3UT1A 3OYYA 4CI0C 2PVOB 5LJ5f 1Q7YU 3CC7T 4Y28E 1KHCA 2LC4A 1BIBA 2QQRA 3QIIA 4M7DG 4JRIA 5LJ3h 3JCMP 3V7RA 4M75C 3L2UA 1M1KC 4KUIA 3VYHB 2KQWA 4C0DC 2OAUA 4M7DF 2OTJA 4C8QG 1MHNA 1M1GA 3FIFA 1Q82C 1N9SA 4P5NA 3BW1A 2M0OA 5LJ5d 1G5VA 4GLKA 3EFRA 5M9OA 3L1AA 2RK1A 3GNGA 4C8QF 3OS2A 2RHYA 4QQDA 3G4SA 4XTVA 3HKSA 4XU2A 3OW2A 1M90C 1RI0A 3OBYA 2CKKA 4M78D 2QA4T 4E7IA 4RG2A 2A3LA 2FL7A 2P0PA 2G3RA 2V8IA 4QQGA 5FU6B 3M9QA 1JRIA 3S3MA 3OYBA 4M78A 3JCMb 4JS5A 1VQ8A 1M9SA 4PJOD 3VUBA 2EWNA 3QZ9B 4XTWA 2PQWA 2CYZB 3X20B 4PL6A 3UDCA 2XD0A 3JCMh 3JAME 1VQ5T 1ZHIA 2RA2A 3DB3A 2XDBA 5GANf 4PJOA 3BY7A 4OB1B 3SWNB 3URGA 2XDPA 3MEUA 3I56T 2RI2A 1K8AC 3M56A 3BDLA 5GMKl 1KD1C 3HP9A 5A0DA 1VQKA 3DLMA 1OI1A 3I55T 4UC4A 2XU8A 3J7AF 4XTUA 5GMKj 4IURA 4L5GA 2M1HA 2QQBA 4E7JA 3A8MB 4JDSA 3CMET 1EIFA 4C92B 2EQJA 2RHUA 3JCMe 3TEEA 1SSFA 5GANh 3FJPA 3E9GA 3SWNC 4EDUA 5GAN4 3CPWS 4XTXA 3CCJT 1NZ9A 2DK3A 2L8DA 4RCCA 3JCMc 3X26B 5GAMh 2CZ1B 3L42A 1QVGS 1I5LA 4M77C 1D3BA 1YIJA 4X9CA 2RK2A 4J7IA 2ZPHB 5LJ5j 4A54A 4XTYA 1XOVA 2YHTA 3FEOA 4BUGA 4N4HA 2JNGA 2BUDA 3PT9A 3OYNA 4JRQA 2IG0A 2ZPEB 4IUTA 3RKWA 4QVZA 5GAMe 3MP6A 5GAN7 3JCMW 1Q86U 1I4K1 2R57A 1UEBA 4MMLA 5GAOl 3PMTA 3QHSA 4QVDA 1P92A 5J26A 5LJ3g 1WGSA 3CCQT 1YJWA 3RERA 3GP8A 2MWOA 1WJQA 3WXMB 3LWIA 4PKCC 3PGGA 2XIDA 2QQ9A 5J3BA 2HAXA 1Y71A 4C5EA 2MAMA 5GAOr 1YITA 4EMGA 2DIGA 4M77D 4C0GA 2V8JA 1N8RU 3E1SA 4OGEA 3SWNA 1M1FA 1G3SA 3QXEB 3CCST 3CCUT 3OMCA 2VXFA 4RCBA 4ZGJB 2D6FA 1YHQT 2RB6A 1N9RA 2DZ9A 3QZ5B 2DTOA 2P0QA 1M5Q1 2KDSA 3M4YA 2WSFE 5CKFA 4BDZA 4A4GA 4IUPA 1I81A 4NS5A 4MDXA 4LDXA 1LNXA 2PVGB 3QYHB 1KQSA 4LD9K 2E10A 3QJYA 4O5VA 3PIOA 1JJ2A 4C0ZA 4M7AB 2GF7A 3PNWC 5FRMA 4M7DE 1KC8C 3JCMg 3CCLT 4E47A 1YBYA 3P8DA 4M78G 4BI8B 3CCVT 3QBYA 3JB9D 4RKUE 4A4HA 3OYMA 3JSCA 4C8QE 1QVPA 4HT8A 3CC7A 4M78F 2WACA 2EAYA 4BE2A 3J81E 3JCMJ 4PJOG 2MF2A 4A4FA 2M16A 3UPUA 4C5GA 3MEWA 4Q5WA 4M7AC 4J83A 5KH6A 2JVVA 4LDVA 2PUKB 2LT4A 3A8OB 3OS5A 4PJOF 5GAOq 1QP2A 2LQ8A 2EYQA 5GANg 3BDUA 4II1A 5CVIA 2QDYB 5GAMg 2PVDB 3LWHA 3BFMA 5CCAA 1V29B 1BI2A 2LRQA 4HCBA 2ZPIB 3ZFJA 1Q7YC 1XNIA 2QA4A 1Y96B 2R58A 4BE1A 2DTIA 3HRUA 2KMTA 2R5AA 4M78C 3JB9J 3A8LB 4J6XA 5D6XA 2RI5A 3OYKA 2WSCE 4EMKB 5FROA 3OS0A 1QW1A 4LD6A 2RH2A 4ZTFA 4FL6A 2MWPA 5LJ3d 2VUBA 2DXBA 3ME9A 5GAN8 3CEYA 3GOXA 1UGPB 5I2MA 3CD6T 4PJOC 2E64A 2QQAA 4EMHA 1K73C 4M7AD 2YLBA 2RI3A 1VQ5A 1I8FA 2DD4A 3EFSA 2X4YA 3META 2K5IA 3I56A 4BI4A 3DLLA 1NPRA 2E65A 2RHXA 4R55A 2OTLT 2B8AA 4M7AA 1X6OA 2I2LA 2RJDA 3I55A 2MI6A 5GAN2 3LGFA 4MMKA 1KQSS 1VQNT 5CQXA 3L2ZA 3CMEA 1JJ2S 3HSBA 1QVGA 1VQ7A 2KY9A 3JCMf 3JCMQ 3OA6A 2PU9B 3PIPA 1UB4A 3M59A 1YJ9T 3LYIA 3WVDB 3TCJA 1FXXA 3GLXA 3M53A 4IUQA 3VYGA 1NJIU 2F5TX 4M77G 4J6WA 5KE3A 3HFNA 4ELYC 2QXFA 4JRKA 3GNFB 4BY6B 5GAN5 4OP0A 2E6ZA 2XKOC 2DZCA 3OB9A 4M77F 4BE0A 2DKGA 3OSVA 5GAN3 2CS7A 2ZPGB 3NFCA 4HCCA 3GPLA 4BI3A 4YTLA 5GAMf 4V2SA 1Y96A 3A8HB 3QYGB 3M54A 5FU6C 3VJPA 3OYCA 1AHJB 3ER0A 1JB0E 4EMKA 3CCQA 4C8QB 5CR2A 3OYAA 3HRSA 2K3YA 2ZZDA 3L2VA 1K9MU 1ZBXA 1Y7XA 2DTHA 1WJRA 5GANd 5LJ3j 3OYEA 4DA4A 3RESA 1IZ6A 1N6AA 2RJEA 5IAYA 4XU0A 1X75C 2BIVA 3A8GB 3OQ5A 2H3JA 4WF2A 3VV0A 2EQKA 2FB7A 3JB9G 1VQ4T 4XAXB 3CCSA 4OB2B 4RG8A 4ELZC 2JOYA 2JUFA 2RHIA 5I21A 2GFAA 3JB9F 5C6SA 1VQLT 2DXTA 1YHQA 1Q86C 4MDWA 4OB0B 3CCMT 3V7SA 3A5ZB 3CMAT 2CZ7B 3DB4A 2YRVA 4A53A 2E5QA 2LNVA 4F7UB 4C92C 2BKDN 4JLGA 3CCET 1W2BA 4MZMA 3ASKA 1VQOT 4QVCA 5A2QE 3T9NA 2V8KA 3OW2S 2DAQA 4L59A 1U8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF7 A;  3EAE A;  3PNW C;  2RJC A;  4IUV A;  5FRM A;  3UWN A;  1OYX A;  3C4S A;  3E9F A;  4B9W A;  3NTI A;  3P8D A;  1OZ3 A;  4PLL A;  3NTH A;  4BD3 A;  4E7K A;  3QBY A;  2NLU A;  4HCZ A;  3OYH A;  3OYM A;  4A4H A;  2D9T A;  2X4W A;  3LLR A;  5FRN A;  3UT1 A;  2WAC A;  4BE2 A;  3S3O A;  1KHC A;  2QQR A;  3QII A;  3FLG A;  2HQX A;  2O4X A;  4A4F A;  3Q1J A;  2M16 A;  3L2U A;  4C5G A;  3MEW A;  4Q5W A;  5KH6 A;  4ZTJ A;  1MHN A;  1G5V A;  2JTF A;  2M0O A;  3OYG A;  3KUF A;  3OY9 A;  5M9O A;  4II1 A;  3FDR A;  3S6W A;  2RHY A;  4QQD A;  3OS2 A;  5KCO A;  2LRQ A;  3L2W A;  1RI0 A;  3OYD A;  2JZ2 A;  3PMI A;  1H3Z A;  3SD4 A;  2CKK A;  1XNI A;  2EFI A;  4E7I A;  2R58 A;  4RG2 A;  4BE1 A;  2G3R A;  2R5A A;  3OYI A;  2VYT A;  5KCH A;  2LCC A;  3OYK A;  4QQG A;  2RI5 A;  3M9Q A;  5D6X A;  3S3M A;  2F5K A;  5FRO A;  3OYB A;  2RHZ A;  3OS0 A;  4E7L A;  4LD6 A;  4ZTF A;  4FL6 A;  2MWP A;  5KE2 A;  2LTO A;  3ME9 A;  3CEY A;  3OMG A;  2PQW A;  3GOX A;  2R5M A;  2QQS A;  4PL6 A;  3LH0 A;  5IN1 A;  2RI3 A;  2GFU A;  3DB3 A;  2X4Y A;  3MET A;  4GY5 A;  2XK0 A;  4FU6 A;  2XDP A;  3MEU A;  4A4E A;  2RI2 A;  2RHX A;  2B8A A;  4CRI A;  3BDL A;  2RJD A;  3P8H A;  4IKF A;  3DLM A;  1OI1 A;  3OYL A;  4UC4 A;  3LGF A;  2P0K A;  1N27 A;  4IUR A;  2M1H A;  4E7J A;  2LDM A;  3PFS A;  4N4I A;  5C0M A;  3LGL A;  2DIQ A;  2X35 A;  2EQU A;  4OVA A;  2FHD A;  3MO8 A;  4PLI A;  2EQJ A;  2RHU A;  3ZEH A;  2RO0 A;  1SSF A;  3OA6 A;  5D6W A;  4Z02 A;  4B9X A;  3LYI A;  3E9G A;  3NTK A;  3QKJ A;  4EDU A;  4IUQ A;  4BDY A;  4C5H A;  2L8D A;  3L42 A;  4QQ6 A;  4N4G A;  1OZ2 A;  2LVM A;  2X4X A;  1WJS A;  5D6Y A;  4C5I A;  3S3N A;  5KE3 A;  3OYJ A;  2EKO A;  4QW2 A;  3FC3 A;  4BE0 A;  3OB9 A;  4X34 A;  3FEO A;  3H6Z A;  2O4X B;  3OS1 A;  3O8V A;  4N4H A;  3MP1 A;  2BUD A;  3H8Z A;  3MP8 A;  3OYN A;  2IG0 A;  4IUT A;  4QVZ A;  5CIU A;  3MP6 A;  3OYC A;  3L2R A;  2R57 A;  3MEA A;  4IUU A;  4BAC A;  3PMT A;  5J26 A;  1WGS A;  3OYA A;  2L89 A;  2K3Y A;  3OYF A;  3L2V A;  2EQM A;  2MWO A;  1WJQ A;  1WJR A;  2HQE A;  3OYE A;  3LX7 A;  3MEV A;  5IAY A;  2RJE A;  2BIV A;  3OQ5 A;  2K3X A;  4C5E A;  2EQK A;  2DIG A;  3QJ6 A;  2RHI A;  3L2Q A;  2E6N A;  2GFA A;  3OMC A;  5C6S A;  5J39 A;  3DB4 A;  2YRV A;  2E5Q A;  2BKD N;  3F70 A;  2L3R A;  2RJF A;  4BDZ A;  4A4G A;  4IUP A;  3ASK A;  4NS5 A;  4E7H A;  2DAQ A;  4L59 A; 
#chains in the Genus database with same CATH topology
 1N8R C;  2DYB A;  1BI0 A;  3CCV A;  1ZBJ A;  1UHC A;  4BD3 A;  2ATC B;  2MPX C;  1ZA2 B;  1PKT A;  1AZE A;  2A7Y A;  1PD1 A;  1HJD A;  3PTA A;  3VS4 A;  4C92 D;  1BI1 A;  3JCM X;  2JTF A;  2ZPF B;  3OY9 A;  1VQ8 Q;  1M1K R;  4M7A F;  1WNL A;  2HZY A;  3WVE B;  1WHH A;  1GXI E;  1PKS A;  3QDF A;  4ATO A;  1KQ2 A;  3CBO A;  5CK9 A;  1M8M A;  5GAO p;  2XDD A;  1ZSZ B;  1B34 B;  3QG1 A;  3AHU A;  4ZN3 A;  1AEY A;  4E7L A;  4J8O A;  2RQU A;  2DYI A;  7AT1 B;  3LH0 A;  2GFU A;  1PHT A;  3EG2 A;  1W2B P;  3OSS C;  5GMK m;  3CCR T;  1X6G A;  5CKD A;  3OYL A;  2K3B A;  2EYX A;  1BBZ A;  2LDM A;  1TH7 A;  1U1S A;  2MMP A;  1KD1 R;  3KBG A;  5D6W A;  1YJ9 A;  3RKY A;  3M0P A;  1YJN T;  2C0O A;  2DPP B;  1W6X A;  2FZK B;  3FRN A;  5A0G A;  2PUO B;  5HK3 A;  1YJW Q;  2ECZ A;  4X34 A;  1VQ6 Q;  2C06 A;  2CH4 A;  3DKM A;  1ZSZ A;  1YWO A;  1RAD B;  1WIE A;  1GCQ A;  1MV0 B;  1QWF A;  3OYF A;  1VQM T;  1Y07 A;  1VQO A;  4DQ2 A;  3JB9 I;  2WSE E;  1RAF B;  1X27 A;  2H3E B;  3TU4 K;  2E6N A;  3JCM d;  4LUE A;  2LX9 A;  4ZGE B;  3CC2 Q;  2AK5 A;  3CCE A;  3H0F A;  1IRE B;  2K7A A;  2LQK A;  4M7D B;  2DVJ A;  4L6V 5;  2VV5 A;  1M1K U;  5LJ3 e;  3VS1 A;  4MZP A;  4FT4 A;  1HXD A;  4DBR A;  3OYH A;  2NLU A;  4R0K A;  5EG2 A;  1NE8 A;  1VQP A;  3VU3 C;  1KC8 R;  1G2B A;  2HQX A;  4RTT A;  4F7U F;  4ORZ A;  2HKN A;  3QPH A;  2L3Q A;  1QVF S;  3RNJ A;  2DET A;  4M77 B;  1M30 A;  3S6W A;  4LXC A;  3OYD A;  2DBK A;  1H3Z A;  4JJN K;  1U5S A;  3CBM A;  1KD1 U;  2VYT A;  5KCH A;  2F5K A;  4N0A C;  3M0U A;  3FB9 A;  2DVE A;  5LL6 S;  4NL3 A;  4J9B A;  3JRZ A;  2MCN A;  1WX6 A;  4M7D A;  1X43 A;  2V1Q A;  1EX4 A;  5C0M A;  4J5Y A;  5GAM j;  3EHR A;  2KBT A;  2ZPB B;  3CC4 A;  1SG5 A;  5GAO n;  4Y91 A;  3SEM A;  4C5I A;  3S3N A;  2LQW A;  2DJZ A;  3RIR A;  4M77 A;  2J6K A;  2A0F B;  1Y0M A;  3VKI A;  1GBR A;  3GIB A;  1GCQ C;  5CIU A;  1UGQ B;  4HA8 A;  4IUU A;  2DFU A;  1VIF A;  3LX7 A;  4KUD K;  3MHX A;  1PM3 A;  1C0M A;  2DD5 A;  1X01 A;  3RDV A;  4C92 E;  1FMK A;  1KFZ A;  1AOJ A;  5IHN A;  3HFO A;  5DY9 A;  2CGH A;  3RKX A;  3PE0 A;  2JW4 A;  5FWB A;  1M4Z A;  3EG3 A;  4M75 F;  1NM7 A;  5L8R E;  2RJF A;  2P4T A;  2F1L A;  5CO7 A;  2EYZ A;  4A4K A;  2OAW A;  3V7C A;  4JPB W;  2F2X A;  3X25 B;  2JTM A;  3CC7 T;  2LC4 A;  2QQR A;  2CP3 A;  4M7D G;  3JCM P;  4PJJ A;  1Q81 R;  4C8Q G;  4J9E A;  1Q82 C;  4GLK A;  3EFR A;  3L1A A;  1RAA B;  4XU2 A;  3OBY A;  2YUN A;  4LN2 A;  1WHL A;  2CKK A;  2DRM A;  2HDA A;  2OTL Q;  1JRI A;  3OYB A;  4JS5 A;  1VQ8 A;  1M9S A;  1VQN Q;  2CUD A;  1OUL A;  1MUZ A;  1BK2 A;  2XD0 A;  4PK4 A;  2XDB A;  3BY7 A;  3URG A;  2XDP A;  3I5S A;  1TWB A;  5A0D A;  1VQK A;  1OI1 A;  2CT4 A;  3J7A F;  5GMK j;  4E7J A;  2QQB A;  3PVL A;  3EFO B;  2ED0 A;  5GAN h;  5GAN 4;  3CCJ T;  1D0Z A;  4M77 C;  1M27 C;  2RK2 A;  4JJB A;  4XTY A;  5IH2 A;  1XOV A;  2ED1 A;  1ZA1 B;  5GAN 7;  5GAM e;  2IIM A;  3PMT A;  1U06 A;  3CCQ T;  1YJW A;  3GP8 A;  3LWI A;  4AFS C;  4F17 A;  1PRM C;  5GAO r;  4M77 D;  3E1S A;  1GFC A;  2BE9 B;  1M1F A;  3QXE B;  3CCU T;  4RCB A;  1ACM B;  2D6F A;  2KDS A;  3M4Y A;  5CKF A;  3EG1 A;  1E6G A;  3EFO A;  4A4G A;  3CCS Q;  4LDX A;  3QYH B;  4O5V A;  2H8H A;  1GRI A;  4E47 A;  1T3L A;  2EYY A;  1QVP A;  4HT8 A;  4M78 F;  2EAY A;  2MF2 A;  2M16 A;  2F2V A;  4M7A C;  5KH6 A;  3NHN A;  4PJO F;  1RAI B;  2EYQ A;  5GAM g;  2PVD B;  4K11 A;  3KFV A;  1M3A A;  1IHV A;  1XNI A;  2R58 A;  3CQT A;  2R5A A;  3CCR Q;  5D6X A;  2M02 A;  2WSC E;  1QW1 A;  2RH2 A;  4ZTF A;  2VUB A;  2DXB A;  3CEY A;  3GOX A;  1UGP B;  2BTT A;  2P84 A;  5I2M A;  3CD6 T;  2QQA A;  1K73 C;  4M7A D;  2DL8 A;  1VQ5 A;  2MYS A;  1I8F A;  3MET A;  1NEG A;  2K5I A;  4RUG A;  5GJW B;  1TOV A;  2E65 A;  2FO0 A;  4R55 A;  2B8A A;  1YJN Q;  3I55 A;  2MI6 A;  1UJ0 A;  3M0Q A;  1KQS S;  3HSB A;  1JJ2 S;  2KY9 A;  1YFN A;  2X9H A;  3NGP A;  1UB4 A;  3M59 A;  3LYI A;  3WVD B;  1IRX A;  3TCJ A;  1V76 A;  2LJ0 A;  1YN8 A;  1K4U S;  3D7S B;  4ELY C;  4JRK A;  4FCY A;  1X2Q A;  4OP0 A;  4PFZ A;  2DZC A;  3OB9 A;  5GAN 3;  4HCC A;  4V2S A;  2O88 A;  3VJP A;  3OYC A;  5KYW B;  3ER0 A;  3OYA A;  2OX7 A;  1Y7X A;  5GAN d;  4OML A;  2QGF B;  3A8G B;  2M51 A;  4OB2 B;  4RG8 A;  1VQL T;  2CUB A;  1OPK A;  4MDW A;  4OB0 B;  3CCM T;  3CMA T;  1QWE A;  4OMM A;  2HSP A;  1KSW A;  4AFU C;  2V8K A;  2DAQ A;  1QVG S;  1K9A A;  3RMS A;  2LJ1 A;  1OYX A;  1YP5 A;  3C4S A;  4KRT A;  3CBP A;  3NTH A;  1ZQ1 A;  1S72 T;  3I35 A;  1K0X A;  4KT0 E;  2K5F A;  3FLG A;  2GTO A;  2MK5 A;  1W70 A;  1ZUY A;  5HK0 A;  1K76 A;  5KYW A;  4PJM A;  3EG9 B;  2DMO A;  1K73 R;  2DO3 A;  2LMJ A;  2YUP A;  4LUD A;  4C92 A;  3SDZ A;  1D0X A;  5KCO A;  3L2W A;  3PMI A;  1ZSG A;  2M9U A;  1YI2 T;  1K0S A;  3HTR A;  3M58 A;  1OEB A;  1D1A A;  1BKB A;  2E4H A;  1M90 R;  2ABL A;  1CKA A;  2FZG B;  3HPW A;  3M4G A;  1VQ9 T;  5IN1 A;  2FPF A;  2DLP A;  1HYO A;  2OTL A;  1VQN A;  1N27 A;  4N4I A;  1TUD A;  2VGN A;  5AYF A;  2X35 A;  1K8A R;  4LNP A;  1FWZ A;  4M77 E;  4OVA A;  1KJW A;  2QEX T;  3H0I A;  4AG1 C;  3NTK A;  1MV3 A;  2RNA A;  4PJN A;  2CP2 A;  2KXC A;  3C12 A;  3EG9 A;  2HNI A;  1G83 A;  3OYJ A;  5HKC A;  1KHI A;  2MIO A;  4OMQ A;  3I9Q A;  3FC3 A;  5ECA A;  2K5L A;  2VC8 A;  5FU7 B;  4FW1 A;  4OB3 B;  1D1B A;  3H6Z A;  2O4X B;  1QVF A;  2E41 A;  3MP8 A;  2FRY A;  3JB9 H;  1QCO A;  4MZT A;  4EIK A;  2DA9 A;  3G6E T;  4HVW A;  1NJI C;  2NUZ A;  3TSZ A;  4JLI A;  3QJ6 A;  2L3P A;  2KAF A;  2X3W D;  3X24 B;  2CZ6 B;  1M3C A;  5CKH A;  5J39 A;  1D3B B;  4XK8 E;  2LZ6 B;  1E6H A;  4DBH A;  4C92 G;  4ANJ A;  1K9M C;  1PSF A;  1K73 U;  3QSU A;  2B86 A;  4CC7 A;  3V8J A;  2CRE A;  2A36 A;  3G71 T;  4ME7 A;  1OX9 A;  1R0B G;  3NTI A;  4HCZ A;  2X4W A;  4WTO B;  4M7A E;  1M90 U;  1HSQ A;  5LJ5 e;  4M75 D;  2O4X A;  1OU9 A;  2J05 A;  1NG2 A;  1QVF P;  2OTJ T;  4ZGD B;  4HKE A;  4Y92 A;  4LE9 A;  5DM7 R;  4XQ3 A;  2AZS A;  2DL3 A;  2JT4 A;  3G4S T;  2K6D A;  1U1T A;  2AHJ B;  2RD1 A;  3EG0 A;  3INZ A;  1K8A U;  3H0H A;  4XU1 A;  4RTY A;  4DBF A;  2KGT A;  3REB B;  2K4Y A;  2JJ9 A;  1YCY A;  2YRD A;  1VQ7 Q;  4FYY B;  3RUX A;  4OGC A;  2XK0 A;  1WYX A;  3J80 E;  2V26 A;  3CCR A;  2FVU A;  2DL5 A;  3PVQ A;  3P8H A;  2JS0 A;  2KSS A;  1NBE B;  3JCM V;  1R0C B;  2C0I A;  4PLI A;  2FHD A;  3MO8 A;  3ZEH A;  4FIB A;  1PC0 A;  2E70 A;  2HD0 A;  1YJN A;  4FSX A;  4N4G A;  1VQK Q;  5LJ5 g;  1WJS A;  2QI2 A;  5AT1 B;  4N0A A;  5KYX B;  4IIM A;  3H41 A;  4E2F B;  1BIA A;  1WHK A;  4HVV A;  3V8L A;  5CQY A;  1JQQ A;  2KVQ G;  3G7Z A;  3SFM A;  2CZ0 B;  1E7O A;  2QAS A;  1PCX A;  3C95 A;  2Y4X A;  2L5Q A;  2L89 A;  3BE3 A;  1VQM A;  2L2P A;  1XQH A;  1PD0 A;  2K3X A;  2KEA A;  3RMQ A;  1YIT T;  1HK9 A;  1W4S A;  1WLP B;  1UJY A;  5HY6 A;  1IGQ A;  4HVU A;  5KYY B;  2D0N A;  3F70 A;  4KGZ B;  1LCK A;  2ZGW A;  5LJ3 f;  1V1C A;  4F7U E;  1B34 A;  4RTW A;  5GMK i;  1OZ3 A;  5HCK A;  5FU7 C;  5KYX A;  1N8R R;  1KHC A;  4JRI A;  2COY A;  3V7R A;  4KUI A;  2YRC A;  3UAT A;  3FIF A;  1M1G A;  1N9S A;  1G5V A;  2J7I A;  2M0O A;  3CD6 Q;  2CSI A;  2RHY A;  3OW2 A;  3HKS A;  1QQJ A;  3UA6 A;  1QCF A;  2BZX A;  4M78 D;  4RG2 A;  2A3L A;  1MMA A;  2P0P A;  2G3R A;  5FU6 B;  1UEC A;  2D8J A;  3S3M A;  3EGU A;  2EYW A;  1JXO A;  4PJO D;  4XTW A;  2CP7 A;  2PQW A;  5KYY A;  4AG2 C;  2CYZ B;  3X20 B;  4PL6 A;  1UDL A;  1ZHI A;  2OJ2 A;  3DB3 A;  4OB1 B;  4DEX A;  3MEU A;  3I56 T;  2RI2 A;  1OQK A;  4RTX A;  2KYM A;  4XTU A;  1SRL A;  2M1H A;  3A8M B;  4ZNX A;  2EQJ A;  1VQ5 Q;  3JCM e;  3FJP A;  3SWN C;  3CPW S;  1NZ9 A;  2DK3 A;  4RCC A;  3X26 B;  5GAM h;  3I55 Q;  1UE9 A;  1FMW A;  1D0Y A;  4CC4 B;  1IXD A;  2YHT A;  5FWC A;  2BUD A;  3PT9 A;  3G1J A;  2J06 A;  3OW2 P;  3MP6 A;  2KR3 A;  3VRZ A;  2R57 A;  1H92 A;  4MML A;  1VQL Q;  3CCM Q;  5J26 A;  5LJ3 g;  1WGS A;  3JV3 A;  1WJQ A;  2QQ9 A;  5J3B A;  2HAX A;  1Y71 A;  2MAM A;  1N8R U;  2KXD A;  4C0G A;  2KRO A;  4OGE A;  1G3S A;  1YHQ T;  1N9R A;  3E2U A;  1S72 Q;  2NUT B;  1BCO A;  1VOM A;  2VVK A;  4IUP A;  4NS5 A;  2E3I A;  1KQS A;  2L0A A;  2E3H A;  1JJ2 A;  4C0Z A;  4M7A B;  2GF7 A;  3JCM g;  3CCL T;  3P8D A;  4FW2 A;  2J6O A;  3QBY A;  4A4H A;  3JSC A;  4Z88 A;  3CC7 A;  5IXB A;  3J81 E;  3JCM J;  1M3B A;  1M2O A;  5IHK A;  1YI2 Q;  4C5G A;  1QKW A;  4Q5W A;  8ATC B;  3MJX A;  4J83 A;  1M8V A;  2JVV A;  5GAO q;  2LQ8 A;  1A0N B;  4II1 A;  3LWH A;  3GBQ A;  3ZFJ A;  1Q7Y C;  1Y96 B;  2DTI A;  3HRU A;  3O5Z A;  3A8L B;  4KH1 B;  2MWP A;  5GAN 8;  3ME9 A;  2IPO B;  2OI3 A;  2NUT A;  2FZC B;  2QEX Q;  3EFS A;  2DD4 A;  1SEM A;  4BI4 A;  4M7A A;  2I2L A;  5GAN 2;  1RAE B;  1KQS P;  1JJ2 P;  2LQN A;  1Z9Z A;  2HL3 A;  1QVG A;  1VQ7 A;  1VA7 A;  3OA6 A;  2PU9 B;  2RMO A;  2DM1 A;  3M53 A;  2KNB B;  2DER A;  2DL4 A;  3G6E Q;  2F5T X;  4M77 G;  4J6W A;  5KE3 A;  3HFN A;  1X2K A;  2DKG A;  3OSV A;  1WZO A;  5GAM f;  1Y96 A;  2LX7 A;  5FU6 C;  1AHJ B;  1OPL A;  3CCQ A;  5CR2 A;  2K3Y A;  2ZZD A;  3L2V A;  1WJR A;  2FPE A;  3RES A;  1N6A A;  2RJE A;  1VQ4 T;  3VV0 A;  2EGC A;  2H3J A;  2EQK A;  1SHF A;  1U3O A;  1TUG B;  2JOY A;  3G71 Q;  2GFA A;  3JB9 F;  5C6S A;  2DXT A;  1Q86 C;  3A5Z B;  2LNV A;  4F7U B;  1JU5 C;  1M2V B;  5A2Q E;  3T9N A;  3OW2 S;  3M0S A;  1QVG P;  4L59 A;  4E6R A;  3EAE A;  3UWN A;  2OTJ Q;  1H8K A;  4E7K A;  3S3O A;  4JZ4 A;  3THK A;  3G4S Q;  3CXC P;  4FYW B;  4EPC A;  1WQ7 A;  2W10 A;  4M7A G;  4ZTJ A;  1AT1 B;  2AT1 B;  2RQR A;  1G3W A;  1UGS B;  2CP0 A;  5GAN j;  3ZL7 C;  1PSE A;  2JZ2 A;  1Q82 R;  3A98 A;  2O9V A;  3VS5 A;  5DLQ E;  2LTO A;  3CD6 A;  1K1Z A;  2VB6 A;  5FLX E;  4F7U A;  2R5M A;  1M2V A;  2RQV A;  1WI7 A;  9ATC B;  1JBM A;  1Y57 A;  3MPU B;  4CC3 A;  4FU6 A;  1OU8 A;  1Q95 G;  2AZV A;  2RQW A;  1PNJ A;  1TUC A;  3PFS A;  2CH4 W;  3HL8 A;  3HRT A;  2MOX A;  1XJW B;  2O2O A;  4Z02 A;  1VQ6 T;  3QKJ A;  4RTZ A;  4QQ6 A;  1TTH B;  1QCN A;  4QW2 A;  4OF1 A;  4E7Z A;  2FEI A;  3MKD A;  2K2M A;  4HT9 A;  1GFD A;  2XI9 A;  3H8Z A;  2FRW A;  1BI3 A;  2LT1 A;  4DOW A;  2ZCF B;  2LJ3 A;  1RL2 A;  3L2R A;  4M75 B;  2A37 A;  4C0D B;  2JN0 A;  3CC2 T;  2EQM A;  4B6M A;  3MEV A;  2XG8 D;  2LCS A;  4C0F A;  1CKB A;  1QP3 A;  1VQL A;  2VKN A;  3CCM A;  3CMA A;  3M57 A;  1VQM Q;  3FJ5 A;  4HCK A;  5GMK e;  5I2S A;  5LJ5 h;  1GL5 A;  3FDR A;  1SRM A;  1NYG A;  1ABQ A;  3TRE A;  3ULR B;  1RLP C;  1Q82 U;  1HD3 A;  2RJC A;  3MCA B;  2ESW A;  1S1N A;  2D0Q B;  5GJV B;  1S72 A;  2D9T A;  4AFQ C;  2Y90 A;  3NPF A;  4F7U G;  1C1A A;  4E7S A;  3Q1J A;  1UGR B;  1NLO C;  4M75 A;  4D8K A;  1R77 A;  3OYG A;  1TG0 A;  2E12 A;  4RMO A;  2SRC A;  1YI2 A;  4O6J A;  2K2V A;  2X4J A;  2LCC A;  2RHZ A;  1TSF A;  2LP5 A;  2HCK A;  1VQ9 A;  3LH5 A;  1NEB A;  2KK4 A;  3CXC S;  2Y4Y A;  1MMG A;  2QG9 B;  3P8B B;  4JJD A;  5GAN e;  2PZ1 A;  2DX1 A;  1G8X A;  2IVW A;  5FW9 A;  2P0K A;  1BB9 A;  2QEX A;  4LDW A;  4HXJ A;  1T0H A;  3VS2 A;  1Z9Q A;  4B9X A;  2XHC A;  2QDL A;  4BDY A;  4C5H A;  1OZ2 A;  3RR6 A;  4KGV B;  2J6F A;  1YIJ T;  2EKO A;  2DJQ A;  2EJG A;  1MGQ A;  4LDY A;  2VGM A;  3LW5 E;  3OS1 A;  2QAZ A;  3VUZ A;  1J3T A;  2M0Y A;  5A0L A;  2W0Z A;  3G6E A;  3MEA A;  2XIC A;  2KI7 A;  4ESR A;  1DJ7 B;  4FM4 B;  2RN8 A;  3M0T A;  3QUI A;  2HBW A;  1KQ1 A;  3I5R A;  4M75 G;  1O9S A;  4M78 B;  3CCL Q;  1VIE A;  4FYV B;  1UFF A;  3V8K A;  1ARK A;  2L3R A;  2O01 E;  2X51 A;  1CSK A;  2QTX A;  1AD5 A;  4PJO B;  4E7H A;  2FYK A;  5CKB A;  3G71 A;  5IT9 E;  1F1B B;  1BU1 A;  3ZBD A;  3E9F A;  2F69 A;  3LLR A;  5FRN A;  2EJ9 A;  3CPW A;  3UT1 A;  3OYY A;  4CI0 C;  2PVO B;  5LJ5 f;  4Y28 E;  1BIB A;  5LJ3 h;  4M75 C;  5L23 A;  1WHG A;  3L2U A;  4PJL A;  1M1K C;  4C0D C;  4M7D F;  2OTJ A;  4Z8A A;  1UHF A;  5LJ5 d;  2EQI A;  5M9O A;  4C8Q F;  3OS2 A;  3CC7 Q;  3G4S A;  4XTV A;  6AT1 B;  2QA4 T;  4PFP A;  2V8I A;  4QQG A;  4M78 A;  3JCM b;  2D8H A;  2C0T A;  2EWN A;  1JEG A;  2HL5 C;  4IIO A;  3UDC A;  3JCM h;  4PJO A;  2RA2 A;  4J9D A;  3SWN B;  1GBQ A;  3M56 A;  2DNU A;  3BDL A;  1KD1 C;  3HP9 A;  3DLM A;  1WHM A;  2XU8 A;  3CME T;  1EIF A;  2YUQ A;  3TEE A;  1SSF A;  3CPW P;  4EDU A;  4XTX A;  3JCM c;  3L42 A;  1RI9 A;  2A28 A;  1D3B A;  4X9C A;  2ZPH B;  4A54 A;  2JMC A;  1D1C A;  3FEO A;  3IQL A;  3OYN A;  3CCJ Q;  4JRQ A;  2IG0 A;  4IUT A;  4QVZ A;  5GAO l;  3QHS A;  2NYS A;  3RER A;  2YSQ A;  3WXM B;  1AWW A;  2XID A;  2RPN A;  4C5E A;  1NJI R;  1YIT A;  2DIG A;  2V8J A;  3SWN A;  1T3S A;  3CCS T;  2BZ8 A;  3OMC A;  2VXF A;  1SHG A;  3CCQ Q;  3QZ5 B;  1WHJ A;  1M5Q 1;  2DIL A;  1I81 A;  4MDX A;  3CCU Q;  1KIK A;  2EKH A;  1SKU B;  4AT1 B;  1K9M R;  1KC8 C;  1YBY A;  4M78 G;  4BI8 B;  3CCV T;  3JB9 D;  4QKU A;  4RKU E;  2QYZ A;  1FYN A;  1SF9 A;  2DBM A;  2WAC A;  4BE2 A;  5I22 A;  4PJO G;  1NLP C;  3MEW A;  1QMC A;  2PUK B;  3OS5 A;  1RAG B;  1QP2 A;  1H3H A;  2NWM A;  3BDU A;  2QDY B;  3BFM A;  1BI2 A;  2AIR B;  2LRQ A;  4HCB A;  1OOT A;  2CDT A;  1PG5 B;  4M78 C;  2KMT A;  4J6X A;  1B3Q A;  2RI5 A;  4EMK B;  3OS0 A;  4LD6 A;  3TSW A;  4FL6 A;  5LJ3 d;  2PTK A;  4PJO C;  2YLB A;  2RI3 A;  2D1X A;  3I56 A;  1WDX A;  1NPR A;  2RHX A;  1X6O A;  1SPK A;  2RJD A;  5KYU B;  3LGF A;  4MMK A;  2PNI A;  5CQX A;  3L2Z A;  2YUO A;  3JCM f;  3PIP A;  1YJ9 T;  3NMZ C;  2DL7 A;  4IUQ A;  4F16 A;  1NJI U;  4A63 B;  1AVZ C;  2QXF A;  3GNF B;  2AKL A;  4BY6 B;  3VS6 A;  2XKO C;  4BE0 A;  1UTI A;  3EGD B;  2ZPG B;  3GPL A;  4YTL A;  3A8H B;  2VWF A;  2DF6 A;  2Z0W A;  3VS3 A;  4EMK A;  4C8Q B;  1N5Z A;  1K9M U;  4DA4 A;  4AFZ C;  5IAY A;  1VQO T;  4XU0 A;  2BIV A;  2FB7 A;  4ELZ C;  5I21 A;  2P4R A;  1YHQ A;  5KYU A;  2CZ7 B;  2YRV A;  4A53 A;  2BKD N;  4JLG A;  1WFW A;  3CCE T;  4MZM A;  2QK0 A;  4QVC A;  2O31 A;  3TQ7 P;  3CCL A;  3CMA Q;  4BB7 A;  4PLL A;  2KYB A;  4GLM A;  4M75 E;  2X3X D;  1ABO A;  4FT2 A;  1VUB A;  4KBM B;  1Q81 C;  1VQP T;  3EGD A;  3C94 A;  3VRY A;  1RUW A;  3QWY A;  1IHW A;  2HBP A;  4QT7 A;  2HQH A;  1KG1 A;  4C8Q A;  1LPL A;  1MMD A;  1QKX A;  2L3S A;  3R6N A;  4F04 B;  1MMN A;  2O9S A;  5DLO A;  4WCI A;  1YNZ A;  4X9D A;  2KRN A;  2EGA A;  1BYM A;  3OYI A;  4RTU A;  4OMN A;  1LJO A;  1IO6 A;  2RM4 A;  5CAI A;  2YLC A;  2QQS A;  1WQW A;  3SB2 A;  4OMF B;  4JRP A;  1ZSZ C;  4GY5 A;  1TS9 A;  3EGX B;  1W2B S;  1B07 A;  4IKF A;  1UGV A;  2FPD A;  3E19 A;  1YIJ Q;  4FYX B;  4LDU A;  1VQ9 Q;  3LGL A;  2DEU A;  2DIQ A;  4RTV A;  2G6F X;  3CC4 T;  2LVM A;  2X4X A;  1KC8 U;  4JUV A;  5GAN 6;  2GNC A;  2KE9 A;  3O8V A;  1GCP A;  3REA B;  4EMK C;  5GAO m;  2VAS A;  1VYU A;  5GMK h;  1VQ4 A;  1QLY A;  1WPY A;  3CCJ A;  3L2Q A;  3EGX A;  4X1V A;  3CXC A;  4XTZ A;  1LVK A;  3QWX X;  1O75 A;  2EJF A;  3GF5 A;  2JM8 A;  2K57 A;  1AWO A;  1FX7 A;  1NYF A;  3SHW A;  4C92 F;  8AT1 B;  3QO3 A;  2GQV A;  1ZX6 A;  2HMA A;  4IUV A;  4B9W A;  3X28 B;  4BY6 C;  2CP5 A;  4NL2 A;  5I11 A;  2GTJ A;  5GAM d;  4J7F A;  1EZZ B;  4M7D C;  3CCU A;  3OBW A;  5CKE A;  4PNO A;  2HEQ A;  2CSQ A;  3HHT B;  2QA4 Q;  4C8Q C;  3CPF A;  1NPP A;  3KUF A;  3M5A A;  4M78 E;  1VQ7 T;  3UA7 A;  1XTD A;  2GCX A;  2LCL A;  3R6O A;  4J9C A;  3SD4 A;  2EFI A;  2DXC A;  3N5B B;  4PJO E;  2EGE A;  2AKK A;  4ZN1 A;  1TU0 B;  2GQI A;  1Q7Y R;  5IXF A;  4M7D D;  4AMC A;  1VQ8 T;  5KE2 A;  2LNH B;  3CME Q;  1X69 A;  3OMG A;  1H64 1;  4D6W A;  4XU3 A;  4C8Q D;  2QGG A;  5KYN A;  2FG0 A;  2YXY A;  4A4E A;  4CRI A;  1VQK T;  4VUB A;  1C6V X;  1X6B A;  2E1H A;  4R56 A;  2EQU A;  1AWJ A;  2COZ A;  3KXT A;  1T0J A;  2RO0 A;  1VQ6 A;  1I0C A;  3VS0 A;  2COW A;  5D6Y A;  1G3Y A;  1EFN A;  4D8D A;  2F2W A;  2DEQ A;  2VXE A;  1Q81 U;  4J9H A;  4J6Y A;  2EVR A;  3MP1 A;  4DOV A;  1R8O B;  4JJC A;  2GGR A;  1LOJ A;  4BAC A;  2EIF A;  2KRM A;  4KUL A;  3CC2 A;  4FSS A;  1YJW T;  4GBQ A;  2HQE A;  2I0N A;  2CP6 A;  1AWX A;  4NOY A;  1G3T A;  4TVR A;  3CCV Q;  1D09 B;  4JS4 A;  2GBQ A;  1Q86 R;  1YIT Q;  2DXU A;  1VYT A;  4J9G A;  2DRK A;  3M55 A;  3EHQ A;  3QDR B;  5D7U A;  1Q7Y U;  1AZG B;  1KK7 A;  3QII A;  1TXQ A;  3VYH B;  2KQW A;  2OAU A;  1MHN A;  1VYV A;  4P5N A;  3BW1 A;  2RK1 A;  3GNG A;  4QQD A;  2A08 A;  1M90 C;  1RI0 A;  4E7I A;  2FL7 A;  4J9F A;  1MND A;  2XMF A;  3M9Q A;  3AT1 B;  3VUB A;  3QZ9 B;  2DE0 X;  1UG1 A;  4DBQ A;  2E5K A;  3M0R A;  3JAM E;  1VQ5 T;  1UUE A;  1YJ9 Q;  5GAN f;  4KH0 B;  2YT6 A;  1K8A C;  5GMK l;  2JMA A;  4UC4 A;  3I55 T;  4IUR A;  4L5G A;  4JDS A;  3RBB B;  3EH1 A;  4C92 B;  2RHU A;  1ZUU A;  3I56 Q;  3E9G A;  4JZ3 A;  2L8D A;  2ENM A;  2CZ1 B;  1I5L A;  1YIJ A;  4J7I A;  5LJ5 j;  1SSH A;  1PRL C;  1VQO Q;  4BUG A;  4N4H A;  2JNG A;  2K79 A;  2ZPE B;  2ROT A;  3RKW A;  3JCM W;  1Q86 U;  1I4K 1;  1UEB A;  4QVD A;  1P92 A;  2EPD A;  3A1P A;  2MWO A;  2ZAE A;  4PKC C;  3PGG A;  3CCE Q;  1I07 A;  4PFO A;  2RQT A;  4EMG A;  1FMV A;  1B7T A;  1JO8 A;  4ZGJ B;  2JTE A;  4Z89 A;  2BE7 D;  3U23 A;  2RB6 A;  2DZ9 A;  2DTO A;  2P0Q A;  1WA7 A;  2WSF E;  2HKQ B;  4BDZ A;  1VQP Q;  1LNX A;  2PVG B;  4LD9 K;  2E10 A;  3QJY A;  3PIO A;  1RAC B;  2JXB A;  3PNW C;  5FRM A;  1YHQ Q;  1YCS B;  4M7D E;  3OYM A;  1W1F A;  4C8Q E;  2JM9 A;  1I5O B;  1OX8 A;  4A4F A;  3UPU A;  4LDV A;  2LT4 A;  3A8O B;  4M4Z A;  5GAN g;  5CVI A;  4CC2 A;  5CCA A;  1V29 B;  1IB8 A;  1RLQ C;  2ZPI B;  3C0C A;  2SEM A;  2QA4 A;  3EH2 A;  4BE1 A;  3JB9 J;  3OYK A;  2CT3 A;  5FRO A;  2NUP B;  1IGU A;  4J9I A;  1YWP A;  2K9G A;  1WXU A;  2E64 A;  4EMH A;  1BCM A;  4OMO A;  2X4Y A;  3DLL A;  3CC4 Q;  2OTL T;  1MNE A;  1VQN T;  3CME A;  5EC7 A;  2KRS A;  3JCM Q;  2HSE B;  1JXM A;  3TVT A;  2RF0 A;  2QTV A;  2EBP A;  1FXX A;  1ZUK A;  1ZLM A;  3GLX A;  3VYG A;  2YDL A;  2KT8 A;  1WXT A;  5GAN 5;  2E6Z A;  4M77 F;  2V1R A;  2CS7 A;  3NFC A;  4BI3 A;  3UF4 A;  3QYG B;  3M54 A;  1I1J A;  1RAB B;  1JB0 E;  3HRS A;  2NUP A;  1ZBX A;  2DTH A;  4F14 A;  1OV3 A;  5LJ3 j;  2EW3 A;  3OYE A;  2BZY A;  1IZ6 A;  1PWT A;  4DEY A;  1X75 C;  3OQ5 A;  4WF2 A;  4KGX B;  3JB9 G;  4OMP A;  4XAX B;  3CCS A;  2RHI A;  2JUF A;  1RAH B;  2ROL A;  2YWW A;  3V7S A;  2JS2 A;  3DB4 A;  2KT1 A;  2E5Q A;  3H9N A;  4C92 C;  1W2B A;  1VQ4 Q;  3ASK A;  5IHI A;  1WXB A;  3VS7 A;  1U8R A; 
#chains in the Genus database with same CATH homology
 1N8R C;  3RMS A;  3EAE A;  3CCL A;  1BI0 A;  3UWN A;  1OYX A;  3C4S A;  4BB7 A;  3CCV A;  4PLL A;  3CBP A;  3NTH A;  4BD3 A;  4E7K A;  4M75 E;  1ZQ1 A;  1S72 T;  4FT2 A;  1VUB A;  4KBM B;  1Q81 C;  1VQP T;  3S3O A;  4KT0 E;  2K5F A;  3FLG A;  2A7Y A;  4EPC A;  3C94 A;  1WQ7 A;  5HK0 A;  3PTA A;  4M7A G;  4C92 D;  1BI1 A;  4ZTJ A;  3JCM X;  2HBP A;  2JTF A;  2ZPF B;  2DO3 A;  1G3W A;  4C8Q A;  1UGS B;  3OY9 A;  1KG1 A;  4M7A F;  1WNL A;  4C92 A;  5GAN j;  3SDZ A;  3WVE B;  1GXI E;  5KCO A;  3L2W A;  4ATO A;  1PSE A;  2JZ2 A;  5DLO A;  3PMI A;  1KQ2 A;  2M9U A;  4X9D A;  1YI2 T;  3CBO A;  5CK9 A;  5GAO p;  2XDD A;  1B34 B;  1BYM A;  3M58 A;  3OYI A;  5DLQ E;  1BKB A;  3QG1 A;  3AHU A;  4ZN3 A;  1LJO A;  4E7L A;  4J8O A;  2LTO A;  2RM4 A;  3CD6 A;  5FLX E;  3HPW A;  4F7U A;  5CAI A;  2R5M A;  2YLC A;  2QQS A;  3M4G A;  1VQ9 T;  1WQW A;  3LH0 A;  5IN1 A;  2GFU A;  1JBM A;  4OMF B;  3SB2 A;  4JRP A;  4GY5 A;  4FU6 A;  2OTL A;  1W2B S;  3OSS C;  5GMK m;  3CCR T;  4IKF A;  5CKD A;  3OYL A;  1VQN A;  3E19 A;  1N27 A;  2LDM A;  3PFS A;  4LDU A;  4N4I A;  2VGN A;  3HL8 A;  3LGL A;  2DIQ A;  2X35 A;  1TH7 A;  3HRT A;  5AYF A;  1FWZ A;  4M77 E;  1U1S A;  4OVA A;  2QEX T;  2MMP A;  3KBG A;  5D6W A;  1YJ9 A;  4Z02 A;  3RKY A;  1M8V A;  1VQ6 T;  3NTK A;  3QKJ A;  3CC4 T;  3C12 A;  4QQ6 A;  1YJN T;  2DPP B;  2LVM A;  2X4X A;  1KC8 U;  2HNI A;  3FRN A;  4JUV A;  5A0G A;  2PUO B;  5HKC A;  5HK3 A;  3OYJ A;  4QW2 A;  5GAN 6;  4OF1 A;  1KHI A;  3FC3 A;  2K5L A;  2VC8 A;  5FU7 B;  4OB3 B;  4X34 A;  3H6Z A;  2O4X B;  2C06 A;  3O8V A;  2XI9 A;  2E41 A;  1QVF A;  3MP8 A;  3H8Z A;  3JB9 H;  3DKM A;  1BI3 A;  2LT1 A;  4MZT A;  4DOW A;  4EMK C;  2ZCF B;  5GAO m;  1RL2 A;  3L2R A;  4M75 B;  3G6E T;  4C0D B;  1NJI C;  2JN0 A;  3CC2 T;  3OYF A;  2EQM A;  1VQM T;  3MEV A;  1Y07 A;  2XG8 D;  1VQO A;  5GMK h;  4DQ2 A;  1VQ4 A;  1WPY A;  4JLI A;  4C0F A;  3JB9 I;  3CCJ A;  1QP3 A;  2WSE E;  3QJ6 A;  3TU4 K;  2KAF A;  3L2Q A;  2E6N A;  3X24 B;  1VQL A;  2CZ6 B;  3CCM A;  3JCM d;  2LX9 A;  5CKH A;  4XTZ A;  4ZGE B;  5J39 A;  3CXC A;  3CMA A;  1D3B B;  3M57 A;  4XK8 E;  1O75 A;  2EJF A;  3CCE A;  4C92 G;  1IRE B;  3GF5 A;  5GMK e;  5I2S A;  1K9M C;  2LQK A;  1PSF A;  1K73 U;  4M7D B;  4L6V 5;  2VV5 A;  2K57 A;  5LJ5 h;  1M1K U;  1FX7 A;  3FDR A;  4C92 F;  5LJ3 e;  3TRE A;  3QSU A;  3QO3 A;  2GQV A;  4MZP A;  4FT4 A;  3G71 T;  3V8J A;  1Q82 U;  1HXD A;  2RJC A;  4IUV A;  4ME7 A;  4B9W A;  3MCA B;  3X28 B;  3NTI A;  4BY6 C;  2D0Q B;  4NL2 A;  2NLU A;  4HCZ A;  3OYH A;  1S72 A;  5EG2 A;  2D9T A;  2X4W A;  4M7A E;  5GAM d;  1M90 U;  2Y90 A;  1NE8 A;  4F7U G;  1VQP A;  4J7F A;  3VU3 C;  5LJ5 e;  4M7D C;  4M75 D;  3CCU A;  2HQX A;  2O4X A;  3OBW A;  5CKE A;  4PNO A;  4F7U F;  3Q1J A;  1UGR B;  3HHT B;  3QPH A;  4C8Q C;  2OTJ T;  4M75 A;  4ZGD B;  1QVF S;  4HKE A;  3CPF A;  1NPP A;  3KUF A;  3M5A A;  4M77 B;  5DM7 R;  3OYG A;  4M78 E;  4XQ3 A;  3S6W A;  2E12 A;  4RMO A;  3G4S T;  3OYD A;  1U1T A;  1YI2 A;  2AHJ B;  2RD1 A;  4O6J A;  1VQ7 T;  1H3Z A;  1XTD A;  2GCX A;  2LCL A;  3R6O A;  3SD4 A;  4JJN K;  2EFI A;  3INZ A;  2DXC A;  1K8A U;  3N5B B;  3CBM A;  2K2V A;  1KD1 U;  4PJO E;  2VYT A;  2X4J A;  2LCC A;  4XU1 A;  4ZN1 A;  5KCH A;  2F5K A;  4N0A C;  2RHZ A;  4M7D D;  2K4Y A;  1VQ8 T;  5KE2 A;  3FB9 A;  1YCY A;  2DVE A;  3OMG A;  5LL6 S;  1VQ9 A;  1H64 1;  4D6W A;  4NL3 A;  3JRZ A;  2KK4 A;  3CXC S;  2Y4Y A;  4XU3 A;  4C8Q D;  4M7D A;  3RUX A;  3P8B B;  4OGC A;  2XK0 A;  4A4E A;  5GAN e;  3J80 E;  3CCR A;  2FVU A;  4CRI A;  3P8H A;  1VQK T;  2IVW A;  4VUB A;  2E1H A;  2P0K A;  2KSS A;  5C0M A;  4J5Y A;  4R56 A;  3JCM V;  2QEX A;  2EQU A;  4LDW A;  4PLI A;  2FHD A;  3MO8 A;  3ZEH A;  4FIB A;  5GAM j;  3KXT A;  2RO0 A;  1VQ6 A;  4B9X A;  2XHC A;  2ZPB B;  3CC4 A;  2E70 A;  5GAO n;  2HD0 A;  4C5H A;  4BDY A;  1YJN A;  4FSX A;  5D6Y A;  4Y91 A;  1G3Y A;  1OZ2 A;  4N4G A;  5LJ5 g;  1WJS A;  4C5I A;  3S3N A;  2QI2 A;  4N0A A;  2DJZ A;  3RIR A;  2EKO A;  1YIJ T;  4M77 A;  2DEQ A;  2EJG A;  2VXE A;  1BIA A;  1MGQ A;  1Q81 U;  4LDY A;  2VGM A;  3LW5 E;  4J6Y A;  3OS1 A;  3VUZ A;  4HT9 A;  3VKI A;  3MP1 A;  3V8L A;  4DOV A;  1R8O B;  5CQY A;  3GIB A;  2KVQ G;  5CIU A;  3G7Z A;  3SFM A;  5A0L A;  1UGQ B;  2CZ0 B;  4HA8 A;  1LOJ A;  3MEA A;  4IUU A;  3G6E A;  4BAC A;  2XIC A;  2EIF A;  4KUL A;  3C95 A;  2Y4X A;  3CC2 A;  2L5Q A;  2L89 A;  1YJW T;  1VQM A;  1DJ7 B;  2HQE A;  4FM4 B;  1VIF A;  1XQH A;  3LX7 A;  4KUD K;  3MHX A;  2K3X A;  2DD5 A;  4NOY A;  1X01 A;  3RMQ A;  3QUI A;  4C92 E;  1G3T A;  1YIT T;  1KQ1 A;  1HK9 A;  4TVR A;  4M75 G;  1O9S A;  1W4S A;  4M78 B;  1VIE A;  3HFO A;  5HY6 A;  5DY9 A;  2CGH A;  3RKX A;  3V8K A;  1M4Z A;  4JS4 A;  4M75 F;  3F70 A;  2L3R A;  2RJF A;  2O01 E;  5L8R E;  2P4T A;  2QTX A;  4PJO B;  4E7H A;  2FYK A;  5CKB A;  2ZGW A;  5CO7 A;  5LJ3 f;  4A4K A;  1B34 A;  2DXU A;  4F7U E;  3G71 A;  3V7C A;  5IT9 E;  3ZBD A;  3M55 A;  5GMK i;  3E9F A;  1OZ3 A;  3X25 B;  2F69 A;  3QDR B;  3LLR A;  5FU7 C;  5FRN A;  2EJ9 A;  2JTM A;  3CPW A;  3UT1 A;  3OYY A;  4CI0 C;  2PVO B;  5LJ5 f;  1Q7Y U;  3CC7 T;  4Y28 E;  1KHC A;  2LC4 A;  1BIB A;  2QQR A;  3QII A;  4M7D G;  4JRI A;  5LJ3 h;  3JCM P;  3V7R A;  4M75 C;  3L2U A;  1M1K C;  4KUI A;  3VYH B;  2KQW A;  4C0D C;  2OAU A;  4M7D F;  2OTJ A;  4C8Q G;  1MHN A;  1M1G A;  3FIF A;  1Q82 C;  1N9S A;  4P5N A;  3BW1 A;  2M0O A;  5LJ5 d;  1G5V A;  4GLK A;  3EFR A;  5M9O A;  3L1A A;  2RK1 A;  3GNG A;  4C8Q F;  3OS2 A;  2RHY A;  4QQD A;  3G4S A;  4XTV A;  3HKS A;  4XU2 A;  3OW2 A;  1M90 C;  1RI0 A;  3OBY A;  2CKK A;  4M78 D;  2QA4 T;  4E7I A;  4RG2 A;  2A3L A;  2FL7 A;  2P0P A;  2G3R A;  2V8I A;  4QQG A;  5FU6 B;  3M9Q A;  1JRI A;  3S3M A;  3OYB A;  4M78 A;  3JCM b;  4JS5 A;  1VQ8 A;  1M9S A;  4PJO D;  3VUB A;  2EWN A;  3QZ9 B;  4XTW A;  2PQW A;  2CYZ B;  3X20 B;  4PL6 A;  3UDC A;  2XD0 A;  3JCM h;  3JAM E;  1VQ5 T;  1ZHI A;  2RA2 A;  3DB3 A;  2XDB A;  5GAN f;  4PJO A;  3BY7 A;  4OB1 B;  3SWN B;  3URG A;  2XDP A;  3MEU A;  3I56 T;  2RI2 A;  1K8A C;  3M56 A;  3BDL A;  5GMK l;  1KD1 C;  3HP9 A;  5A0D A;  1VQK A;  3DLM A;  1OI1 A;  3I55 T;  4UC4 A;  2XU8 A;  3J7A F;  4XTU A;  5GMK j;  4IUR A;  4L5G A;  2M1H A;  2QQB A;  4E7J A;  3A8M B;  4JDS A;  3CME T;  1EIF A;  4C92 B;  2EQJ A;  2RHU A;  3JCM e;  3TEE A;  1SSF A;  5GAN h;  3FJP A;  3E9G A;  3SWN C;  4EDU A;  5GAN 4;  3CPW S;  4XTX A;  3CCJ T;  1NZ9 A;  2DK3 A;  2L8D A;  4RCC A;  3JCM c;  3X26 B;  5GAM h;  2CZ1 B;  3L42 A;  1QVG S;  1I5L A;  4M77 C;  1D3B A;  1YIJ A;  4X9C A;  2RK2 A;  4J7I A;  2ZPH B;  5LJ5 j;  4A54 A;  4XTY A;  1XOV A;  2YHT A;  3FEO A;  4BUG A;  4N4H A;  2JNG A;  2BUD A;  3PT9 A;  3OYN A;  4JRQ A;  2IG0 A;  2ZPE B;  4IUT A;  3RKW A;  4QVZ A;  5GAM e;  3MP6 A;  5GAN 7;  3JCM W;  1Q86 U;  1I4K 1;  2R57 A;  1UEB A;  4MML A;  5GAO l;  3PMT A;  3QHS A;  4QVD A;  1P92 A;  5J26 A;  5LJ3 g;  1WGS A;  3CCQ T;  1YJW A;  3RER A;  3GP8 A;  2MWO A;  1WJQ A;  3WXM B;  3LWI A;  4PKC C;  3PGG A;  2XID A;  2QQ9 A;  5J3B A;  2HAX A;  1Y71 A;  4C5E A;  2MAM A;  5GAO r;  1YIT A;  4EMG A;  2DIG A;  4M77 D;  4C0G A;  2V8J A;  1N8R U;  3E1S A;  4OGE A;  3SWN A;  1M1F A;  1G3S A;  3QXE B;  3CCS T;  3CCU T;  3OMC A;  2VXF A;  4RCB A;  4ZGJ B;  2D6F A;  1YHQ T;  2RB6 A;  1N9R A;  2DZ9 A;  3QZ5 B;  2DTO A;  2P0Q A;  1M5Q 1;  2KDS A;  3M4Y A;  2WSF E;  5CKF A;  4BDZ A;  4A4G A;  4IUP A;  1I81 A;  4NS5 A;  4MDX A;  4LDX A;  1LNX A;  2PVG B;  3QYH B;  1KQS A;  4LD9 K;  2E10 A;  3QJY A;  4O5V A;  3PIO A;  1JJ2 A;  4C0Z A;  4M7A B;  2GF7 A;  3PNW C;  5FRM A;  4M7D E;  1KC8 C;  3JCM g;  3CCL T;  4E47 A;  1YBY A;  3P8D A;  4M78 G;  4BI8 B;  3CCV T;  3QBY A;  3JB9 D;  4RKU E;  4A4H A;  3OYM A;  3JSC A;  4C8Q E;  1QVP A;  4HT8 A;  3CC7 A;  4M78 F;  2WAC A;  2EAY A;  4BE2 A;  3J81 E;  3JCM J;  4PJO G;  2MF2 A;  4A4F A;  2M16 A;  3UPU A;  4C5G A;  3MEW A;  4Q5W A;  4M7A C;  4J83 A;  5KH6 A;  2JVV A;  4LDV A;  2PUK B;  2LT4 A;  3A8O B;  3OS5 A;  4PJO F;  5GAO q;  1QP2 A;  2LQ8 A;  2EYQ A;  5GAN g;  3BDU A;  4II1 A;  5CVI A;  2QDY B;  5GAM g;  2PVD B;  3LWH A;  3BFM A;  5CCA A;  1V29 B;  1BI2 A;  2LRQ A;  4HCB A;  2ZPI B;  3ZFJ A;  1Q7Y C;  1XNI A;  2QA4 A;  1Y96 B;  2R58 A;  4BE1 A;  2DTI A;  3HRU A;  2KMT A;  2R5A A;  4M78 C;  3JB9 J;  3A8L B;  4J6X A;  5D6X A;  2RI5 A;  3OYK A;  2WSC E;  4EMK B;  5FRO A;  3OS0 A;  1QW1 A;  4LD6 A;  2RH2 A;  4ZTF A;  4FL6 A;  2MWP A;  5LJ3 d;  2VUB A;  2DXB A;  3ME9 A;  5GAN 8;  3CEY A;  3GOX A;  1UGP B;  5I2M A;  3CD6 T;  4PJO C;  2E64 A;  2QQA A;  4EMH A;  1K73 C;  4M7A D;  2YLB A;  2RI3 A;  1VQ5 A;  1I8F A;  2DD4 A;  3EFS A;  2X4Y A;  3MET A;  2K5I A;  3I56 A;  4BI4 A;  3DLL A;  1NPR A;  2E65 A;  2RHX A;  4R55 A;  2OTL T;  2B8A A;  4M7A A;  1X6O A;  2I2L A;  2RJD A;  3I55 A;  2MI6 A;  5GAN 2;  3LGF A;  4MMK A;  1KQS S;  1VQN T;  5CQX A;  3L2Z A;  3CME A;  1JJ2 S;  3HSB A;  1QVG A;  1VQ7 A;  2KY9 A;  3JCM f;  3JCM Q;  3OA6 A;  2PU9 B;  3PIP A;  1UB4 A;  3M59 A;  1YJ9 T;  3LYI A;  3WVD B;  3TCJ A;  1FXX A;  3GLX A;  3M53 A;  4IUQ A;  3VYG A;  1NJI U;  2F5T X;  4M77 G;  4J6W A;  5KE3 A;  3HFN A;  4ELY C;  2QXF A;  4JRK A;  3GNF B;  4BY6 B;  5GAN 5;  4OP0 A;  2E6Z A;  2XKO C;  2DZC A;  3OB9 A;  4M77 F;  4BE0 A;  2DKG A;  3OSV A;  5GAN 3;  2CS7 A;  2ZPG B;  3NFC A;  4HCC A;  3GPL A;  4BI3 A;  4YTL A;  5GAM f;  4V2S A;  1Y96 A;  3A8H B;  3QYG B;  3M54 A;  5FU6 C;  3VJP A;  3OYC A;  1AHJ B;  3ER0 A;  1JB0 E;  4EMK A;  3CCQ A;  4C8Q B;  5CR2 A;  3OYA A;  3HRS A;  2K3Y A;  2ZZD A;  3L2V A;  1K9M U;  1ZBX A;  1Y7X A;  2DTH A;  1WJR A;  5GAN d;  5LJ3 j;  3OYE A;  4DA4 A;  3RES A;  1IZ6 A;  1N6A A;  2RJE A;  5IAY A;  4XU0 A;  1X75 C;  2BIV A;  3A8G B;  3OQ5 A;  2H3J A;  4WF2 A;  3VV0 A;  2EQK A;  2FB7 A;  3JB9 G;  1VQ4 T;  4XAX B;  3CCS A;  4OB2 B;  4RG8 A;  4ELZ C;  2JOY A;  2JUF A;  2RHI A;  5I21 A;  2GFA A;  3JB9 F;  5C6S A;  1VQL T;  2DXT A;  1YHQ A;  1Q86 C;  4MDW A;  4OB0 B;  3CCM T;  3V7S A;  3A5Z B;  3CMA T;  2CZ7 B;  3DB4 A;  2YRV A;  4A53 A;  2E5Q A;  2LNV A;  4F7U B;  4C92 C;  2BKD N;  4JLG A;  3CCE T;  1W2B A;  4MZM A;  3ASK A;  1VQO T;  4QVC A;  5A2Q E;  3T9N A;  2V8K A;  3OW2 S;  2DAQ A;  4L59 A;  1U8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...