2HL3A

Crystal structure of the a49m mutant cap-gly domain of human dynactin-1 (p150-glued) in complex with human eb1 c-terminal hexapeptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hl3A00
1WHHA 1WHJA 1TOVA 2M02A 2CP3A 1TXQA 2HKQB 3RDVA 2CP7A 2E3HA 2COYA 1WHGA 2HL5C 2HKNA 1LPLA 3E2UA 2CP5A 2CP6A 4B6MA 1WHKA 1IXDA 2E3IA 1WHMA 2QK0A 2HL3A 1WHLA 3TQ7P 2MPXC 2COWA 2HQHA 2CP2A 2COZA 2CP0A 2Z0WA 2E4HA
chains in the Genus database with same CATH superfamily
3OYBA 2DMOA 1SHFA 2E3HA 1WX6A 4XTYA 2LX9A 3LH5A 4Y28E 1VQMQ 4PJOE 1R8OB 2X3XD 1H92A 2DX1A 4Z02A 3TQ7P 1YP5A 3TSZA 3SWNB 4C92A 1KQ2A 4ZGJB 1BYMA 4IUTA 4M75A 2AKLA 2BKDN 1YJWT 3CCVQ 4M7AF 2HSEB 5CK9A 2KYBA 3QJ6A 5FW9A 2MMPA 3A8OB 4JUVA 2EGEA 3L2QA 4J6XA 5GANd 4QVDA 3M56A 2E1HA 2XMFA 4M7DF 4L6V5 2OTLQ 1W4SA 3LWHA 2HQEA 5FRMA 4HKEA 4JJCA 2D8JA 4QQ6A 1LNXA 7AT1B 4N0AA 2FZCB 1QVGP 1WYXA 3OYAA 4PJLA 4JRPA 2GCXA 4JJBA 1PG5B 3SB2A 3CCRA 4Y92A 4OMPA 3H0FA 1K9AA 3JV3A 2DTIA 3KBGA 1XNIA 2A08A 2DIQA 1G3TA 4X1VA 4E7LA 2EQKA 3OMGA 4J83A 2JM9A 5FRNA 4C8QD 2F5TX 5GAN8 2J6KA 2HNIA 3OYLA 1WHLA 1TUDA 3META 1CKBA 1D09B 1QW1A 1SHGA 1Y0MA 2W0ZA 1K73U 1U5SA 3O5ZA 1YI2A 1MV0B 4AT1B 3M5AA 5GAMf 1W2BA 4NOYA 3OMCA 4F7UA 3JCMP 4OF1A 4IUUA 5GAOn 2QASA 2YRDA 1YIJA 1IHWA 4C8QB 1R77A 4RCCA 4CC4B 3VS2A 2JTEA 1ABOA 1I8FA 2KY9A 1MHNA 3NFCA 3CPWS 5GAOm 2RI3A 3FDRA 1QCOA 4FT4A 2VVKA 2GQIA 3CC4T 2AZVA 1YWOA 4DQ2A 1KQSP 2VASA 1UJ0A 1DJ7B 4J7IA 4RTZA 1M1FA 3L1AA 2R5MA 4J6WA 2OI3A 3CMAT 3VJPA 1N6AA 1AZGB 1NLOC 4A4FA 1OQKA 3V7SA 2NWMA 1UUEA 2E3IA 1RADB 2BIVA 4M77G 2O88A 5FU6B 3LW5E 2M51A 4MZTA 3CCMT 2X4YA 1K8AU 2DK3A 1QP3A 2DERA 3CMET 1NEGA 2CDTA 1SG5A 6AT1B 4RTYA 2RM4A 1ZX6A 1M2OA 3S3MA 2ABLA 2I0NA 1Q81U 1GBRA 1YJWA 4RTWA 4RG2A 4PJOG 2PVOB 3MP8A 4QQDA 4A4EA 1D0ZA 2RH2A 1YI2Q 1Q81C 2DXUA 1BKBA 1PNJA 4NL2A 3OYFA 1KD1U 3L2VA 4RTXA 4WCIA 4FCYA 3VS7A 4QVZA 2B8AA 2HKQB 9ATCB 1KD1C 4LDXA 3H0IA 1YIJQ 1ZSZC 1WXUA 2GNCA 5L8RE 1IGUA 3V7CA 4C0DC 3OW2S 1M2VB 2LQNA 4A54A 2NUTB 3S3OA 5GANj 2XK0A 2NUPA 2BZ8A 5FWBA 5LJ5j 1FMWA 2XI9A 4CI0C 1GCQC 4LDWA 5EG2A 2V8KA 3NGPA 4F14A 3M9QA 1K0XA 3PIPA 4BB7A 4E2FB 5HKCA 3EGUA 3VS5A 4MDXA 2WSFE 2JS0A 2QQRA 4JS5A 3EG9B 1IO6A 3QO3A 1PHTA 1MMGA 2K3XA 2MPXC 4OB1B 2J6OA 2V8IA 5KYXA 1WPYA 1VYUA 5DLQE 2YRCA 3UATA 4Z89A 5IHIA 3CPWP 5I2MA 1NZ9A 4M78B 1NJIC 1BI1A 1K8AR 1BU1A 2ROTA 1QVGA 1CKAA 1WDXA 2MIOA 4PLLA 2O2OA 3A8GB 1QKWA 2X4WA 4JDSA 2Y90A 3SFMA 1TOVA 3REBB 1JQQA 2ECZA 5A0LA 3TU4K 3I5RA 4M7AC 1D3BB 3P8HA 1Q81R 1Q7YU 1YJWQ 1JU5C 2PNIA 3RNJA 1WHMA 1Q7YC 3MP6A 4M7DC 5LJ3h 3CC4A 2CT4A 1FYNA 1TUCA 3MKDA 4PFZA 1B7TA 1KD1R 2E5QA 4PJOC 2XIDA 2DL7A 4RG8A 3AHUA 4GLMA 4M77D 4C8QE 2BTTA 3QUIA 1KK7A 4CC7A 2VXFA 4LDYA 1UHCA 1AD5A 4Q5WA 3MCAB 3CMAA 2BE9B 3EFOA 2DO3A 2P0KA 4J9DA 1WFWA 2K57A 2DKGA 3PTAA 1EZZB 4AFQC 1GBQA 3CCMA 5IHNA 2AHJB 4EMKC 3CMEA 4PJOD 2X4XA 4M77B 2L2PA 2X51A 1G3YA 4ELZC 1KG1A 3QG1A 3OBWA 2MOXA 2RB6A 1TG0A 2RD1A 3C4SA 4LDVA 3OW2P 3T9NA 4MDWA 4C8QF 2H8HA 3EFSA 3GOXA 1ZSGA 4CC2A 3PVLA 3RKYA 4J7FA 1ZBXA 3CC7T 1UFFA 3J81E 1OOTA 4XTVA 4NS5A 2DD4A 4FL6A 4D8DA 4OMNA 1JO8A 5CQYA 3A5ZB 3NMZC 1UG1A 4DBQA 3CC2T 3A1PA 1E6HA 1AWWA 2J05A 3REAB 1R0CB 1NYGA 2YHTA 3OYKA 1SF9A 1AWJA 1W1FA 1Q7YR 2AKKA 3MPUB 2DRKA 2ATCB 3RDVA 1VQ5T 1TU0B 4IUQA 4ESRA 4MZMA 2K5IA 3QBYA 3CC4Q 1SEMA 3JCMV 3E1SA 2GTJA 2DVJA 1TH7A 1MV3A 4HA8A 4XU3A 2HBPA 4O5VA 2EYYA 3X28B 2Z0WA 1D1BA 3CMAQ 4HT9A 2E6ZA 4ANJA 8ATCB 2HZYA 1P92A 3JAME 2E70A 1B3QA 1WNLA 2COYA 2F2WA 4RKUE 1MUZA 3GPLA 1KIKA 3CCMQ 1YJ9T 1U06A 4QKUA 1K9MU 2KQWA 3NHNA 1BCOA 4LDUA 3JCMe 3CMEQ 2OTJA 2LCSA 1G3SA 4M75E 1D0XA 4Y91A 1K9MC 3UDCA 3MEVA 1AOJA 2HBWA 4EMHA 3OYGA 1PKSA 4AG1C 2DE0X 4OB3B 1BI2A 1N9RA 1AWOA 1B07A 2V8JA 4KUIA 1TUGB 1Q86C 1D0YA 4M78E 4PJJA 1I07A 1WXTA 1WGSA 1BIBA 3CCRT 2F5KA 2YLBA 2YRVA 4BI4A 1RAAB 1IHVA 2DL5A 1TXQA 4FW1A 5KH6A 1WJQA 5KCOA 4E6RA 1TWBA 3UF4A 1VQPT 2DJZA 4JLIA 3CBOA 2K5LA 3CEYA 1M3AA 2DEQA 4XAXB 3TVTA 2HEQA 2VYTA 1X6GA 2XHCA 1MMNA 4R0KA 4HXJA 3CXCA 2DL8A 3L2UA 3CCET 1UGPB 1U1TA 2CP7A 2YUQA 1H641 4L59A 3JCMg 3D7SB 3E2UA 4IIOA 4J8OA 2XG8D 4JJDA 3QZ5B 2KEAA 2DF6A 1N9SA 2CZ6B 2K79A 2SRCA 4Z88A 3SWNC 1PSFA 3EH1A 4F7UE 3C12A 3CC7A 1W70A 3M58A 2JUFA 3PMTA 3SDZA 1NE8A 4J5YA 2DTOA 2YSQA 5HK0A 2RI2A 1A0NB 2A7YA 2EKHA 2E41A 1K9MR 2JT4A 3JCMc 4B6MA 2I2LA 3ZL7C 3CC2A 2JS2A 1RL2A 2OTJQ 3S6WA 2EGCA 2A0FB 2RJEA 3CCST 1I81A 3OYDA 2VXEA 1UEBA 3P8DA 3E9FA 4D6WA 1QCFA 3SEMA 4EIKA 2KSSA 1M3CA 4FU6A 1I0CA 2YUPA 4K11A 4WF2A 2FPDA 4KGVB 1D1CA 1Q86R 2ED0A 3LLRA 4ME7A 4A4KA 4AG2C 1VQ5A 5CKDA 2FL7A 1NG2A 1QVFA 4LUDA 2DM1A 5GMKj 3OYEA 5AYFA 2HD0A 5CKBA 2P4RA 2LTOA 2RHYA 4OMFB 5KCHA 2K2VA 1JJ2A 4PKCC 4QQGA 1WQ7A 1OZ2A 4R56A 4M77F 1MNEA 2EQUA 3PT9A 3R6NA 3EGXA 5CR2A 1T0JA 2DXCA 4OMLA 1YJ9A 2E64A 4A63B 3EG3A 4OB2B 1KHIA 2IPOB 3LGLA 3CQTA 3ME9A 5LJ5d 2KMTA 4PJOF 2VKNA 4C8QC 2E65A 1VQLT 2EW3A 1Y96B 5LJ3e 3KXTA 3GBQA 1U1SA 3G4ST 1VQ4T 3EG2A 3HKSA 2D0QB 4HVVA 3ULRB 3CC7Q 2KAFA 3NTHA 2LMJA 1HJDA 2E12A 2R5AA 4E7JA 1M27C 2O4XA 4KBMB 3PVQA 4C92G 1IREB 2EVRA 3HSBA 1AVZC 4M75G 1X01A 1ZA1B 4JPBW 2FRWA 5GMKi 5I2SA 1UGSB 1X75C 4JRQA 1WZOA 4PJMA 3CC2Q 4DBFA 1HSQA 1VQPA 1ZSZA 2CGHA 4ZGDB 4MMLA 2RHZA 5DLOA 2XDDA 4OMMA 1ZLMA 3EGDA 3UA7A 1QVPA 1SKUB 2QDYB 1WJRA 4M78G 3HFNA 4M4ZA 1VQ5Q 1GCQA 5CQXA 5FU6C 3CCEA 3UT1A 1NM7A 2DPPB 4LUEA 1V29B 2FO0A 3CCUT 2G6FX 1F1BB 3L2ZA 2ZPFB 3DB4A 5IHKA 5GJVB 3WXMB 2L0AA 3WVDB 2YUNA 5GJWB 2K2MA 1S1NA 1QCNA 2VGMA 1YWPA 3OYYA 3JCMh 5LJ3g 2YXYA 1BK2A 5GANe 4ZTJA 4PFOA 1WHGA 1QWFA 1YJ9Q 1RI0A 5CCAA 4KRTA 2CKKA 2ZPBB 3TCJA 1M1KC 4E7KA 2VGNA 1M90U 2DD5A 3CCSA 4O6JA 4J9EA 3M0PA 3X24B 3X26B 5FU7B 3CCJT 1M90C 2EIFA 2KE9A 3EG0A 3V8JA 4E7HA 4F7UG 4FIBA 4PJNA 3UWNA 2CP3A 3H9NA 3LGFA 1AZEA 2JNGA 3A8HB 4M7AA 1SRLA 5D6XA 5A0DA 4JRIA 3NPFA 5C0MA 1HD3A 1X6OA 2EBPA 4OVAA 5L23A 5GAMd 4M7DA 1XJWB 3CCRQ 4PJOA 3BFMA 2M02A 5KYWB 1R0BG 1VQPQ 1PRMC 3GNGA 3OYNA 2DNUA 2FHDA 3VS4A 1WXBA 2ZPGB 4F04B 2DA9A 2RQRA 1ZHIA 1Y7XA 4DOWA 1ACMB 2LT4A 2C0TA 3JCMW 5GANg 2M9UA 5FWCA 2CP0A 3PIOA 1C0MA 4EMKA 3CCEQ 2V1RA 4AMCA 4E7IA 3FJPA 2FPFA 2QYZA 4M78C 2QQBA 2Y4YA 1ARKA 1WJSA 3G6ET 4C92D 1VQLA 3P8BB 2XD0A 3NTIA 3OQ5A 4M75D 1RAIB 2A28A 3G4SA 1VQ4A 2YT6A 4V2SA 4X34A 1CSKA 3MO8A 4KULA 1VYVA 1PC0A 4XU1A 1M1KR 2QQAA 1LCKA 2JVVA 2JTMA 2C0IA 3JSCA 2FB7A 2QI2A 1M9SA 3M0QA 4M78D 1M90R 3VUZA 1WIEA 3CCSQ 3RKXA 1G5VA 3JB9G 1OYXA 4C92B 2DZ9A 1JJ2S 2RQWA 3X20B 4M75B 3EGXB 2DZCA 1YCYA 2V26A 3M53A 2ED1A 1M1GA 4JJNK 2RJDA 2NLUA 1AT1B 4L5GA 1GFDA 2QGFB 1NJIU 3OYHA 2D0NA 1PWTA 2ZPHB 1WA7A 2AT1B 2K3BA 2L89A 2FYKA 1M5Q1 5AT1B 2PQWA 3CCUA 2MAMA 3L2RA 1AHJB 1Z9QA 3IQLA 4J9FA 4M77C 2OTJT 5CAIA 1H3ZA 3SHWA 3VS0A 4HCBA 3OBYA 4E7SA 3THKA 4FYWB 1B34A 4E7ZA 2P0PA 3RUXA 1OPLA 3FC3A 4NL3A 3ZFJA 3OS1A 1OEBA 3G71T 2QDLA 2GFUA 1YCSB 2DJQA 4KH1B 2XDPA 4VUBA 4N4GA 1PD0A 2LQ8A 1RAGB 3ASKA 1G83A 5D7UA 1M8VA 2EQMA 3QYGB 5A2QE 3M59A 3CCJA 2LZ6B 3M0SA 3JCMf 5KYYA 1VQLQ 2HAXA 3I56A 2WACA 3LH0A 2O9SA 4QT7A 4P5NA 3I9QA 3UPUA 2L3PA 3UA6A 3G4SQ 1VQ4Q 3INZA 1G8XA 4FSXA 2QG9B 1V1CA 4F7UB 3Q1JA 1O75A 2A3LA 5DY9A 1W2BS 2MI6A 2DLPA 1WHHA 3FJ5A 3URGA 2XU8A 3GP8A 4BI3A 1X2KA 2RN8A 5FROA 3RR6A 4LN2A 5KYUA 2LNHB 2H3JA 3EHRA 5GAMj 4HT8A 4BDZA 2RK2A 3PE0A 3S3NA 4II1A 2F69A 1BIAA 3MEWA 2QXFA 2MWPA 1QLYA 2JMCA 1NJIR 1KQSA 1EIFA 2EAYA 2KVQG 3X25B 1T3SA 2FZKB 2D9TA 4N4IA 2DILA 3CBMA 5I22A 1OPKA 3G6EA 3CCUQ 2JTFA 2JJ9A 3MEAA 1UECA 1VA7A 4A4GA 5GANh 1GCPA 4LD9K 5LJ5h 3CD6T 2LRQA 2LJ1A 2QEXA 3SWNA 1G3WA 1WI7A 2EFIA 2D8HA 3RBBB 3JB9D 2YUOA 4HCCA 2X3WD 2EPDA 4GBQA 4OGCA 5ECAA 1AEYA 2KGTA 2ESWA 1UGVA 2JW4A 2KR3A 4ATOA 1V76A 5CKFA 1VQ6A 1ABQA 2P84A 1PSEA 2DRMA 3OYCA 3VRZA 4C5IA 4YTLA 2X35A 4QW2A 2J7IA 2M0OA 2CUBA 3CCJQ 3OS5A 3V8LA 1NYFA 2K9GA 3FRNA 4OMOA 2P0QA 2AK5A 4PFPA 2OAWA 1J3TA 3ER0A 1S72T 3JCMQ 1N8RU 4IUPA 2LJ0A 2MF2A 1SRMA 2F2VA 3CPFA 1EFNA 4BY6B 4C92E 2PUKB 1N8RC 3JB9H 3M57A 4DEYA 5CIUA 1BBZA 2F1LA 4IIMA 2YWWA 1I5OB 2NUPB 4DBHA 3G71A 2ZGWA 2AIRB 2HKNA 2ZZDA 1Q86U 2GF7A 1YITT 4JZ4A 3VS1A 1X27A 4JLGA 3J80E 1MNDA 2HQXA 2EJ9A 5GMKe 4LD6A 2F2XA 3VYGA 3FLGA 1KQ1A 3JCMb 1LJOA 1W2BP 1X69A 4E47A 3G6EQ 4JS4A 3HL8A 5GAOq 5HK3A 4C8QA 3LX7A 5KYXB 2JZ2A 4OB0B 2EYZA 2CYZB 1U3OA 2DAQA 2CUDA 4C92F 4GY5A 3CPWA 4M75F 2KNBB 3M0TA 3E9GA 2M16A 1JRIA 5LJ3f 2Y4XA 2X4JA 2K4YA 3RERA 4J9CA 4BUGA 3CCLT 4JZ3A 4AFUC 2PUOB 3BW1A 3A8MB 1BCMA 3TEEA 1QVGS 3G7ZA 2YLCA 2PZ1A 4M78F 2V1QA 1GFCA 3ZEHA 1VQ9T 2FZGB 4DA4A 5CKHA 2LDMA 4RMOA 1QQJA 2JMAA 3PNWC 4KH0B 1VQ8T 4EDUA 4D8KA 1RAEB 1N8RR 2KRNA 3I5SA 3HRTA 4HVUA 5KE3A 2ENMA 3CD6A 3EFOB 2PVGB 2CSIA 1M4ZA 2YDLA 4Z8AA 4FT2A 2EYQA 5I11A 5IT9E 3G71Q 4BE1A 4DOVA 2QGGA 5A0GA 5D6YA 5GAOl 3MEUA 2QAZA 5GANf 1OX8A 3QXEB 3HRUA 2QK0A 5GAN4 1UTIA 4F7UF 3N5BB 4HVWA 3OW2A 2QA4T 4M7AE 1OU8A 3M0UA 4R55A 1FXXA 2GQVA 1GL5A 3QJYA 2GTOA 2HCKA 3BY7A 4AFSC 5GAN7 3MHXA 1AWXA 3A8LB 2E5KA 4M7DE 1M2VA 1VQOT 2VWFA 3I35A 2NUTA 1S72A 2CREA 1QWEA 2JXBA 2CT3A 2NYSA 1KQSS 1BI3A 2DXBA 4DBRA 1JXOA 5GAN6 3SD4A 1UJYA 4C0ZA 2RMOA 5J26A 2IIMA 3J7AF 3MJXA 2DBKA 4TVRA 1SSFA 1ZA2B 3VYHB 1VOMA 3HTRA 2KXDA 2XKOC 2RQVA 4LNPA 4XK8E 3EG9A 3GLXA 2ZPIB 2CP5A 1YITA 1SPKA 3VS6A 3H41A 2DL4A 1E7OA 1SSHA 2KI7A 2MCNA 4B9WA 2KDSA 2JM8A 2L3QA 3C94A 1UE9A 2KBTA 4M78A 4J9IA 5GAN2 1KJWA 3GF5A 3QHSA 2A36A 3I55T 1NLPC 5DM7R 4DEXA 2EQJA 3CD6Q 2K6DA 3ZBDA 5GAN5 3F70A 5FU7C 3L2WA 3G1JA 3M4YA 1XQHA 1PKTA 1D3BA 3H8ZA 4IKFA 2LNVA 3CCLA 4ZN1A 4FW2A 3JB9F 3OYIA 1YN8A 1T0HA 2ZPEB 2O9VA 2OJ2A 4ZNXA 1LPLA 3DLLA 8AT1B 1PCXA 2GGRA 1D1AA 1NPRA 2IG0A 3OY9A 3QKJA 3O8VA 4BDYA 1VQ9A 2M1HA 3OSVA 3RKWA 3FEOA 1IRXA 2FPEA 1VQ8A 1K73C 2DETA 1S72Q 4BE0A 4C5HA 1M1KU 2HL5C 3NTKA 4FYYB 4XTXA 1M3BA 5LJ5e 2R58A 2KROA 5GMKl 4FM4B 5I21A 3BDUA 1YHQT 2DBMA 1PM3A 5D6WA 3H6ZA 2VV5A 2HSPA 4M77A 5CKEA 1HXDA 2LQWA 4C0FA 1G2BA 5GMKh 5IN1A 3VUBA 4EMGA 3I56T 1YITQ 4UC4A 1VQNT 1OU9A 2VB6A 2DTHA 1IZ6A 3JCMX 2IVWA 2HMAA 3KFVA 1JBMA 3GNFB 3HHTB 3M55A 2RO0A 1Y57A 3H0HA 1UB4A 2QA4A 3CXCS 5CVIA 2KK4A 1FX7A 5C6SA 3VS3A 2DFUA 2BZYA 3L42A 5LJ3j 4X9CA 4XTUA 4C92C 4J6YA 2SEMA 1RACB 4M75C 5M9OA 4JRKA 1VQOA 3OS0A 2L8DA 3TSWA 2DEUA 1VQKT 3CCQT 1MMAA 2GFAA 1JXMA 3HP9A 1XTDA 3QZ9B 3WVEB 1TTHB 4MZPA 2E10A 1WLPB 3QIIA 1RAFB 3CCLQ 5HY6A 3GIBA 1IGQA 4M7AG 5LJ5g 1K8AC 2DYIA 2RQUA 1NBEB 1HK9A 3QPHA 2RJCA 3VU3C 3M0RA 2X9HA 2ZAEA 4GLKA 4M7DG 4N0AC 1N5ZA 2LX7A 1GRIA 3PFSA 1WHKA 3OYJA 1OULA 3DB3A 1K73R 1VQ9Q 1Y07A 4HCKA 2K5FA 3QDFA 2QEXT 4BACA 1ZBJA 2D6FA 2BZXA 1VQ8Q 5FLXE 3C0CA 1QVFS 4C5GA 3QDRB 1VQ7T 2CZ7B 2DYBA 1TSFA 1VQ6T 1LVKA 3I55A 2A37A 3FIFA 2K7AA 2MK5A 1XOVA 4BD3A 2W10A 1C6VX 2HL3A 1VIEA 1H8KA 4C0GA 5GAMe 4ZGEB 1HYOA 3RMQA 1M8MA 1EX4A 2KXCA 4KGZB 1KFZA 2EQIA 4F16A 1JB0E 1YJNT 4RTTA 2K3YA 2HDAA 2JN0A 5J3BA 3OYMA 2RHXA 2QA4Q 3M4GA 3QYHB 2C06A 2J6FA 1ZUKA 4XTWA 4J9BA 1YNZA 4RCBA 1VQOQ 3AT1B 2O4XB 2KRMA 1Z9ZA 2GBQA 1O9SA 4KGXB 1W6XA 2CZ1B 2M0YA 1FMVA 5GMKm 1KSWA 1I4K1 1VUBA 2WSCE 3LYIA 3QWXX 4ZN3A 1YHQA 3HRSA 2JOYA 2KT8A 5KE2A 2L3RA 2PVDB 1ZSZB 2RNAA 4C0DB 3CXCP 1FWZA 3EGDB 4RTUA 5IXBA 4F17A 1T3LA 1VQNA 1K0SA 1BB9A 3QWYA 4X9DA 5GAMg 2FRYA 5GAN3 4KUDK 3TREA 2EGAA 4XTZA 2PTKA 1VQMT 2RQTA 2FG0A 1KC8U 1TS9A 1C1AA 2LP5A 1RLQC 1KC8C 4FSSA 1YBYA 3I55Q 4PLIA 2LVMA 1JEGA 3JB9J 3HFOA 1FMKA 1U8RA 4M7AD 1OZ3A 1ZUYA 4OMQA 4A53A 2NUZA 1VQKA 2J06A 3CCQA 1ZUUA 2DL3A 2WSEE 1VYTA 4KT0E 3M54A 4N4HA 2L3SA 2L5QA 5GAOp 2LJ3A 2QQ9A 3CCVT 2CZ0B 4M7DD 4FYVB 1QMCA 2EKOA 1NEBA 2CP2A 1QP2A 3EH2A 4XU0A 3BDLA 1UDLA 3U23A 4B9XA 2KT1A 2VUBA 1QVFP 2OTLT 1K76A 3A98A 3DLMA 4BY6C 2CP6A 2XICA 5LL6S 4XU2A 1X6BA 3JCMd 4M7AB 2D1XA 4PNOA 4RTVA 1RLPC 4OGEA 1IB8A 1JJ2P 1KHCA 1MMDA 2COWA 2HQHA 2COZA 4M7DB 1Q95G 1VQ7A 4PJOB 1Q82U 2CSQA 2MYSA 1YHQQ 3R6OA 3OB9A 4LE9A 2QQSA 1Q82C 2CH4W 2RHUA 1QKXA 4PL6A 4ZTFA 2EWNA 2G3RA 4XQ3A 2EYXA 3OS2A 2BUDA 3EAEA 3I56Q 2LC4A 1Y71A 4RUGA 1Y96A 4C5EA 1VQNQ 1OI1A 1PD1A 3MP1A 2LQKA 1RI9A 3CBPA 1YJNA 1NPPA 4EMKB 1KC8R 1IXDA 3HPWA 4J9HA 2R57A 3RMSA 1UHFA 3BE3A 4CC3A 3OA6A 2KYMA 4IUVA 1K1ZA 1MGQA 2E6NA 2MWOA 2ZCFB 3C95A 1UGQB 2LCLA 2OAUA 2DIGA 2EYWA 1RUWA 2RA2A 1VQKQ 3CCQQ 3OSSC 4IURA 4AFZC 5IH2A 1X2QA 1ZQ1A 1PRLC 5CO7A 3V7RA 2RF0A 1RAHB 1I1JA 3LWIA 2VC8A 1YFNA 4ORZA 1OX9A 3E19A 3JCMJ 1K4US 2RPNA 3RIRA 3VV0A 3RESA 5KYNA 2O01E 1N27A 2FEIA 2QTXA 2RK1A 2EJGA 3PMIA 5HCKA 2QTVA 2QEXQ 3FB9A 1VQMA 2C0OA 4CRIA 1VQ7Q 1Q82R 3QSUA 2BE7D 3DKMA 1WHJA 2B86A 1VQ6Q 3KUFA 5GAMh 1B34B 3EHQA 4J9GA 4FYXB 3EFRA 3EG1A 1OV3A 3V8KA 2OX7A 3CCVA 4WTOB 2LT1A 2O31A 1YI2T 4C8QG 1YJNQ 3VKIA 2DVEA 2CS7A 2FVUA 2LCCA 4LXCA 4A4HA 2OTLA 1H3HA 2PU9B 3VRYA 4HCZA 4PK4A 5KYYB 1UGRB 2DXTA 2CH4A 2RJFA 1YIJT 2P4TA 1VIFA 3JRZA 2ROLA 1X43A 1E6GA 5KYWA 5IXFA 5J39A 5EC7A 4OP0A 4ELYC 3PGGA 2XDBA 3JB9I 5GAOr 4EPCA 4QVCA 1GXIE 1I5LA 5LJ3d 4BI8B 4BE2A 1WQWA 4M77E 2H3EB 1BI0A 2RI5A 4MMKA 1RABB 2RHIA 5KYUB 2AZSA 1M30A 5IAYA 5LJ5f 1LOJA 2EJFA 2KRSA 2E4HA
chains in the Genus database with same CATH topology
1WHHA 1WHJA 1TOVA 2M02A 2CP3A 1TXQA 2HKQB 3RDVA 2CP7A 2E3HA 2COYA 1WHGA 2HL5C 2HKNA 1LPLA 3E2UA 2CP5A 2CP6A 4B6MA 1WHKA 1IXDA 2E3IA 1WHMA 2QK0A 2HL3A 1WHLA 3TQ7P 2MPXC 2COWA 2HQHA 2CP2A 2COZA 2CP0A 2Z0WA 2E4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHH A;  1WHJ A;  1TOV A;  2M02 A;  2CP3 A;  1TXQ A;  2HKQ B;  3RDV A;  2CP7 A;  2E3H A;  2COY A;  1WHG A;  2HL5 C;  2HKN A;  1LPL A;  3E2U A;  2CP5 A;  2CP6 A;  4B6M A;  1WHK A;  1IXD A;  2E3I A;  1WHM A;  2QK0 A;  2HL3 A;  1WHL A;  3TQ7 P;  2MPX C;  2COW A;  2HQH A;  2CP2 A;  2COZ A;  2CP0 A;  2Z0W A;  2E4H A; 
#chains in the Genus database with same CATH topology
 3OYB A;  2DMO A;  1SHF A;  2E3H A;  1WX6 A;  4XTY A;  2LX9 A;  3LH5 A;  4Y28 E;  1VQM Q;  4PJO E;  1R8O B;  2X3X D;  1H92 A;  2DX1 A;  4Z02 A;  3TQ7 P;  1YP5 A;  3TSZ A;  3SWN B;  4C92 A;  1KQ2 A;  4ZGJ B;  1BYM A;  4IUT A;  4M75 A;  2AKL A;  2BKD N;  1YJW T;  3CCV Q;  4M7A F;  2HSE B;  5CK9 A;  2KYB A;  3QJ6 A;  5FW9 A;  2MMP A;  3A8O B;  4JUV A;  2EGE A;  3L2Q A;  4J6X A;  5GAN d;  4QVD A;  3M56 A;  2E1H A;  2XMF A;  4M7D F;  4L6V 5;  2OTL Q;  1W4S A;  3LWH A;  2HQE A;  5FRM A;  4HKE A;  4JJC A;  2D8J A;  4QQ6 A;  1LNX A;  7AT1 B;  4N0A A;  2FZC B;  1QVG P;  1WYX A;  3OYA A;  4PJL A;  4JRP A;  2GCX A;  4JJB A;  1PG5 B;  3SB2 A;  3CCR A;  4Y92 A;  4OMP A;  3H0F A;  1K9A A;  3JV3 A;  2DTI A;  3KBG A;  1XNI A;  2A08 A;  2DIQ A;  1G3T A;  4X1V A;  4E7L A;  2EQK A;  3OMG A;  4J83 A;  2JM9 A;  5FRN A;  4C8Q D;  2F5T X;  5GAN 8;  2J6K A;  2HNI A;  3OYL A;  1WHL A;  1TUD A;  3MET A;  1CKB A;  1D09 B;  1QW1 A;  1SHG A;  1Y0M A;  2W0Z A;  1K73 U;  1U5S A;  3O5Z A;  1YI2 A;  1MV0 B;  4AT1 B;  3M5A A;  5GAM f;  1W2B A;  4NOY A;  3OMC A;  4F7U A;  3JCM P;  4OF1 A;  4IUU A;  5GAO n;  2QAS A;  2YRD A;  1YIJ A;  1IHW A;  4C8Q B;  1R77 A;  4RCC A;  4CC4 B;  3VS2 A;  2JTE A;  1ABO A;  1I8F A;  2KY9 A;  1MHN A;  3NFC A;  3CPW S;  5GAO m;  2RI3 A;  3FDR A;  1QCO A;  4FT4 A;  2VVK A;  2GQI A;  3CC4 T;  2AZV A;  1YWO A;  4DQ2 A;  1KQS P;  2VAS A;  1UJ0 A;  1DJ7 B;  4J7I A;  4RTZ A;  1M1F A;  3L1A A;  2R5M A;  4J6W A;  2OI3 A;  3CMA T;  3VJP A;  1N6A A;  1AZG B;  1NLO C;  4A4F A;  1OQK A;  3V7S A;  2NWM A;  1UUE A;  2E3I A;  1RAD B;  2BIV A;  4M77 G;  2O88 A;  5FU6 B;  3LW5 E;  2M51 A;  4MZT A;  3CCM T;  2X4Y A;  1K8A U;  2DK3 A;  1QP3 A;  2DER A;  3CME T;  1NEG A;  2CDT A;  1SG5 A;  6AT1 B;  4RTY A;  2RM4 A;  1ZX6 A;  1M2O A;  3S3M A;  2ABL A;  2I0N A;  1Q81 U;  1GBR A;  1YJW A;  4RTW A;  4RG2 A;  4PJO G;  2PVO B;  3MP8 A;  4QQD A;  4A4E A;  1D0Z A;  2RH2 A;  1YI2 Q;  1Q81 C;  2DXU A;  1BKB A;  1PNJ A;  4NL2 A;  3OYF A;  1KD1 U;  3L2V A;  4RTX A;  4WCI A;  4FCY A;  3VS7 A;  4QVZ A;  2B8A A;  2HKQ B;  9ATC B;  1KD1 C;  4LDX A;  3H0I A;  1YIJ Q;  1ZSZ C;  1WXU A;  2GNC A;  5L8R E;  1IGU A;  3V7C A;  4C0D C;  3OW2 S;  1M2V B;  2LQN A;  4A54 A;  2NUT B;  3S3O A;  5GAN j;  2XK0 A;  2NUP A;  2BZ8 A;  5FWB A;  5LJ5 j;  1FMW A;  2XI9 A;  4CI0 C;  1GCQ C;  4LDW A;  5EG2 A;  2V8K A;  3NGP A;  4F14 A;  3M9Q A;  1K0X A;  3PIP A;  4BB7 A;  4E2F B;  5HKC A;  3EGU A;  3VS5 A;  4MDX A;  2WSF E;  2JS0 A;  2QQR A;  4JS5 A;  3EG9 B;  1IO6 A;  3QO3 A;  1PHT A;  1MMG A;  2K3X A;  2MPX C;  4OB1 B;  2J6O A;  2V8I A;  5KYX A;  1WPY A;  1VYU A;  5DLQ E;  2YRC A;  3UAT A;  4Z89 A;  5IHI A;  3CPW P;  5I2M A;  1NZ9 A;  4M78 B;  1NJI C;  1BI1 A;  1K8A R;  1BU1 A;  2ROT A;  1QVG A;  1CKA A;  1WDX A;  2MIO A;  4PLL A;  2O2O A;  3A8G B;  1QKW A;  2X4W A;  4JDS A;  2Y90 A;  3SFM A;  1TOV A;  3REB B;  1JQQ A;  2ECZ A;  5A0L A;  3TU4 K;  3I5R A;  4M7A C;  1D3B B;  3P8H A;  1Q81 R;  1Q7Y U;  1YJW Q;  1JU5 C;  2PNI A;  3RNJ A;  1WHM A;  1Q7Y C;  3MP6 A;  4M7D C;  5LJ3 h;  3CC4 A;  2CT4 A;  1FYN A;  1TUC A;  3MKD A;  4PFZ A;  1B7T A;  1KD1 R;  2E5Q A;  4PJO C;  2XID A;  2DL7 A;  4RG8 A;  3AHU A;  4GLM A;  4M77 D;  4C8Q E;  2BTT A;  3QUI A;  1KK7 A;  4CC7 A;  2VXF A;  4LDY A;  1UHC A;  1AD5 A;  4Q5W A;  3MCA B;  3CMA A;  2BE9 B;  3EFO A;  2DO3 A;  2P0K A;  4J9D A;  1WFW A;  2K57 A;  2DKG A;  3PTA A;  1EZZ B;  4AFQ C;  1GBQ A;  3CCM A;  5IHN A;  2AHJ B;  4EMK C;  3CME A;  4PJO D;  2X4X A;  4M77 B;  2L2P A;  2X51 A;  1G3Y A;  4ELZ C;  1KG1 A;  3QG1 A;  3OBW A;  2MOX A;  2RB6 A;  1TG0 A;  2RD1 A;  3C4S A;  4LDV A;  3OW2 P;  3T9N A;  4MDW A;  4C8Q F;  2H8H A;  3EFS A;  3GOX A;  1ZSG A;  4CC2 A;  3PVL A;  3RKY A;  4J7F A;  1ZBX A;  3CC7 T;  1UFF A;  3J81 E;  1OOT A;  4XTV A;  4NS5 A;  2DD4 A;  4FL6 A;  4D8D A;  4OMN A;  1JO8 A;  5CQY A;  3A5Z B;  3NMZ C;  1UG1 A;  4DBQ A;  3CC2 T;  3A1P A;  1E6H A;  1AWW A;  2J05 A;  3REA B;  1R0C B;  1NYG A;  2YHT A;  3OYK A;  1SF9 A;  1AWJ A;  1W1F A;  1Q7Y R;  2AKK A;  3MPU B;  2DRK A;  2ATC B;  3RDV A;  1VQ5 T;  1TU0 B;  4IUQ A;  4ESR A;  4MZM A;  2K5I A;  3QBY A;  3CC4 Q;  1SEM A;  3JCM V;  3E1S A;  2GTJ A;  2DVJ A;  1TH7 A;  1MV3 A;  4HA8 A;  4XU3 A;  2HBP A;  4O5V A;  2EYY A;  3X28 B;  2Z0W A;  1D1B A;  3CMA Q;  4HT9 A;  2E6Z A;  4ANJ A;  8ATC B;  2HZY A;  1P92 A;  3JAM E;  2E70 A;  1B3Q A;  1WNL A;  2COY A;  2F2W A;  4RKU E;  1MUZ A;  3GPL A;  1KIK A;  3CCM Q;  1YJ9 T;  1U06 A;  4QKU A;  1K9M U;  2KQW A;  3NHN A;  1BCO A;  4LDU A;  3JCM e;  3CME Q;  2OTJ A;  2LCS A;  1G3S A;  4M75 E;  1D0X A;  4Y91 A;  1K9M C;  3UDC A;  3MEV A;  1AOJ A;  2HBW A;  4EMH A;  3OYG A;  1PKS A;  4AG1 C;  2DE0 X;  4OB3 B;  1BI2 A;  1N9R A;  1AWO A;  1B07 A;  2V8J A;  4KUI A;  1TUG B;  1Q86 C;  1D0Y A;  4M78 E;  4PJJ A;  1I07 A;  1WXT A;  1WGS A;  1BIB A;  3CCR T;  2F5K A;  2YLB A;  2YRV A;  4BI4 A;  1RAA B;  1IHV A;  2DL5 A;  1TXQ A;  4FW1 A;  5KH6 A;  1WJQ A;  5KCO A;  4E6R A;  1TWB A;  3UF4 A;  1VQP T;  2DJZ A;  4JLI A;  3CBO A;  2K5L A;  3CEY A;  1M3A A;  2DEQ A;  4XAX B;  3TVT A;  2HEQ A;  2VYT A;  1X6G A;  2XHC A;  1MMN A;  4R0K A;  4HXJ A;  3CXC A;  2DL8 A;  3L2U A;  3CCE T;  1UGP B;  1U1T A;  2CP7 A;  2YUQ A;  1H64 1;  4L59 A;  3JCM g;  3D7S B;  3E2U A;  4IIO A;  4J8O A;  2XG8 D;  4JJD A;  3QZ5 B;  2KEA A;  2DF6 A;  1N9S A;  2CZ6 B;  2K79 A;  2SRC A;  4Z88 A;  3SWN C;  1PSF A;  3EH1 A;  4F7U E;  3C12 A;  3CC7 A;  1W70 A;  3M58 A;  2JUF A;  3PMT A;  3SDZ A;  1NE8 A;  4J5Y A;  2DTO A;  2YSQ A;  5HK0 A;  2RI2 A;  1A0N B;  2A7Y A;  2EKH A;  2E41 A;  1K9M R;  2JT4 A;  3JCM c;  4B6M A;  2I2L A;  3ZL7 C;  3CC2 A;  2JS2 A;  1RL2 A;  2OTJ Q;  3S6W A;  2EGC A;  2A0F B;  2RJE A;  3CCS T;  1I81 A;  3OYD A;  2VXE A;  1UEB A;  3P8D A;  3E9F A;  4D6W A;  1QCF A;  3SEM A;  4EIK A;  2KSS A;  1M3C A;  4FU6 A;  1I0C A;  2YUP A;  4K11 A;  4WF2 A;  2FPD A;  4KGV B;  1D1C A;  1Q86 R;  2ED0 A;  3LLR A;  4ME7 A;  4A4K A;  4AG2 C;  1VQ5 A;  5CKD A;  2FL7 A;  1NG2 A;  1QVF A;  4LUD A;  2DM1 A;  5GMK j;  3OYE A;  5AYF A;  2HD0 A;  5CKB A;  2P4R A;  2LTO A;  2RHY A;  4OMF B;  5KCH A;  2K2V A;  1JJ2 A;  4PKC C;  4QQG A;  1WQ7 A;  1OZ2 A;  4R56 A;  4M77 F;  1MNE A;  2EQU A;  3PT9 A;  3R6N A;  3EGX A;  5CR2 A;  1T0J A;  2DXC A;  4OML A;  1YJ9 A;  2E64 A;  4A63 B;  3EG3 A;  4OB2 B;  1KHI A;  2IPO B;  3LGL A;  3CQT A;  3ME9 A;  5LJ5 d;  2KMT A;  4PJO F;  2VKN A;  4C8Q C;  2E65 A;  1VQL T;  2EW3 A;  1Y96 B;  5LJ3 e;  3KXT A;  3GBQ A;  1U1S A;  3G4S T;  1VQ4 T;  3EG2 A;  3HKS A;  2D0Q B;  4HVV A;  3ULR B;  3CC7 Q;  2KAF A;  3NTH A;  2LMJ A;  1HJD A;  2E12 A;  2R5A A;  4E7J A;  1M27 C;  2O4X A;  4KBM B;  3PVQ A;  4C92 G;  1IRE B;  2EVR A;  3HSB A;  1AVZ C;  4M75 G;  1X01 A;  1ZA1 B;  4JPB W;  2FRW A;  5GMK i;  5I2S A;  1UGS B;  1X75 C;  4JRQ A;  1WZO A;  4PJM A;  3CC2 Q;  4DBF A;  1HSQ A;  1VQP A;  1ZSZ A;  2CGH A;  4ZGD B;  4MML A;  2RHZ A;  5DLO A;  2XDD A;  4OMM A;  1ZLM A;  3EGD A;  3UA7 A;  1QVP A;  1SKU B;  2QDY B;  1WJR A;  4M78 G;  3HFN A;  4M4Z A;  1VQ5 Q;  1GCQ A;  5CQX A;  5FU6 C;  3CCE A;  3UT1 A;  1NM7 A;  2DPP B;  4LUE A;  1V29 B;  2FO0 A;  3CCU T;  2G6F X;  1F1B B;  3L2Z A;  2ZPF B;  3DB4 A;  5IHK A;  5GJV B;  3WXM B;  2L0A A;  3WVD B;  2YUN A;  5GJW B;  2K2M A;  1S1N A;  1QCN A;  2VGM A;  1YWP A;  3OYY A;  3JCM h;  5LJ3 g;  2YXY A;  1BK2 A;  5GAN e;  4ZTJ A;  4PFO A;  1WHG A;  1QWF A;  1YJ9 Q;  1RI0 A;  5CCA A;  4KRT A;  2CKK A;  2ZPB B;  3TCJ A;  1M1K C;  4E7K A;  2VGN A;  1M90 U;  2DD5 A;  3CCS A;  4O6J A;  4J9E A;  3M0P A;  3X24 B;  3X26 B;  5FU7 B;  3CCJ T;  1M90 C;  2EIF A;  2KE9 A;  3EG0 A;  3V8J A;  4E7H A;  4F7U G;  4FIB A;  4PJN A;  3UWN A;  2CP3 A;  3H9N A;  3LGF A;  1AZE A;  2JNG A;  3A8H B;  4M7A A;  1SRL A;  5D6X A;  5A0D A;  4JRI A;  3NPF A;  5C0M A;  1HD3 A;  1X6O A;  2EBP A;  4OVA A;  5L23 A;  5GAM d;  4M7D A;  1XJW B;  3CCR Q;  4PJO A;  3BFM A;  2M02 A;  5KYW B;  1R0B G;  1VQP Q;  1PRM C;  3GNG A;  3OYN A;  2DNU A;  2FHD A;  3VS4 A;  1WXB A;  2ZPG B;  4F04 B;  2DA9 A;  2RQR A;  1ZHI A;  1Y7X A;  4DOW A;  1ACM B;  2LT4 A;  2C0T A;  3JCM W;  5GAN g;  2M9U A;  5FWC A;  2CP0 A;  3PIO A;  1C0M A;  4EMK A;  3CCE Q;  2V1R A;  4AMC A;  4E7I A;  3FJP A;  2FPF A;  2QYZ A;  4M78 C;  2QQB A;  2Y4Y A;  1ARK A;  1WJS A;  3G6E T;  4C92 D;  1VQL A;  3P8B B;  2XD0 A;  3NTI A;  3OQ5 A;  4M75 D;  1RAI B;  2A28 A;  3G4S A;  1VQ4 A;  2YT6 A;  4V2S A;  4X34 A;  1CSK A;  3MO8 A;  4KUL A;  1VYV A;  1PC0 A;  4XU1 A;  1M1K R;  2QQA A;  1LCK A;  2JVV A;  2JTM A;  2C0I A;  3JSC A;  2FB7 A;  2QI2 A;  1M9S A;  3M0Q A;  4M78 D;  1M90 R;  3VUZ A;  1WIE A;  3CCS Q;  3RKX A;  1G5V A;  3JB9 G;  1OYX A;  4C92 B;  2DZ9 A;  1JJ2 S;  2RQW A;  3X20 B;  4M75 B;  3EGX B;  2DZC A;  1YCY A;  2V26 A;  3M53 A;  2ED1 A;  1M1G A;  4JJN K;  2RJD A;  2NLU A;  1AT1 B;  4L5G A;  1GFD A;  2QGF B;  1NJI U;  3OYH A;  2D0N A;  1PWT A;  2ZPH B;  1WA7 A;  2AT1 B;  2K3B A;  2L89 A;  2FYK A;  1M5Q 1;  5AT1 B;  2PQW A;  3CCU A;  2MAM A;  3L2R A;  1AHJ B;  1Z9Q A;  3IQL A;  4J9F A;  4M77 C;  2OTJ T;  5CAI A;  1H3Z A;  3SHW A;  3VS0 A;  4HCB A;  3OBY A;  4E7S A;  3THK A;  4FYW B;  1B34 A;  4E7Z A;  2P0P A;  3RUX A;  1OPL A;  3FC3 A;  4NL3 A;  3ZFJ A;  3OS1 A;  1OEB A;  3G71 T;  2QDL A;  2GFU A;  1YCS B;  2DJQ A;  4KH1 B;  2XDP A;  4VUB A;  4N4G A;  1PD0 A;  2LQ8 A;  1RAG B;  3ASK A;  1G83 A;  5D7U A;  1M8V A;  2EQM A;  3QYG B;  5A2Q E;  3M59 A;  3CCJ A;  2LZ6 B;  3M0S A;  3JCM f;  5KYY A;  1VQL Q;  2HAX A;  3I56 A;  2WAC A;  3LH0 A;  2O9S A;  4QT7 A;  4P5N A;  3I9Q A;  3UPU A;  2L3P A;  3UA6 A;  3G4S Q;  1VQ4 Q;  3INZ A;  1G8X A;  4FSX A;  2QG9 B;  1V1C A;  4F7U B;  3Q1J A;  1O75 A;  2A3L A;  5DY9 A;  1W2B S;  2MI6 A;  2DLP A;  1WHH A;  3FJ5 A;  3URG A;  2XU8 A;  3GP8 A;  4BI3 A;  1X2K A;  2RN8 A;  5FRO A;  3RR6 A;  4LN2 A;  5KYU A;  2LNH B;  2H3J A;  3EHR A;  5GAM j;  4HT8 A;  4BDZ A;  2RK2 A;  3PE0 A;  3S3N A;  4II1 A;  2F69 A;  1BIA A;  3MEW A;  2QXF A;  2MWP A;  1QLY A;  2JMC A;  1NJI R;  1KQS A;  1EIF A;  2EAY A;  2KVQ G;  3X25 B;  1T3S A;  2FZK B;  2D9T A;  4N4I A;  2DIL A;  3CBM A;  5I22 A;  1OPK A;  3G6E A;  3CCU Q;  2JTF A;  2JJ9 A;  3MEA A;  1UEC A;  1VA7 A;  4A4G A;  5GAN h;  1GCP A;  4LD9 K;  5LJ5 h;  3CD6 T;  2LRQ A;  2LJ1 A;  2QEX A;  3SWN A;  1G3W A;  1WI7 A;  2EFI A;  2D8H A;  3RBB B;  3JB9 D;  2YUO A;  4HCC A;  2X3W D;  2EPD A;  4GBQ A;  4OGC A;  5ECA A;  1AEY A;  2KGT A;  2ESW A;  1UGV A;  2JW4 A;  2KR3 A;  4ATO A;  1V76 A;  5CKF A;  1VQ6 A;  1ABQ A;  2P84 A;  1PSE A;  2DRM A;  3OYC A;  3VRZ A;  4C5I A;  4YTL A;  2X35 A;  4QW2 A;  2J7I A;  2M0O A;  2CUB A;  3CCJ Q;  3OS5 A;  3V8L A;  1NYF A;  2K9G A;  3FRN A;  4OMO A;  2P0Q A;  2AK5 A;  4PFP A;  2OAW A;  1J3T A;  3ER0 A;  1S72 T;  3JCM Q;  1N8R U;  4IUP A;  2LJ0 A;  2MF2 A;  1SRM A;  2F2V A;  3CPF A;  1EFN A;  4BY6 B;  4C92 E;  2PUK B;  1N8R C;  3JB9 H;  3M57 A;  4DEY A;  5CIU A;  1BBZ A;  2F1L A;  4IIM A;  2YWW A;  1I5O B;  2NUP B;  4DBH A;  3G71 A;  2ZGW A;  2AIR B;  2HKN A;  2ZZD A;  1Q86 U;  2GF7 A;  1YIT T;  4JZ4 A;  3VS1 A;  1X27 A;  4JLG A;  3J80 E;  1MND A;  2HQX A;  2EJ9 A;  5GMK e;  4LD6 A;  2F2X A;  3VYG A;  3FLG A;  1KQ1 A;  3JCM b;  1LJO A;  1W2B P;  1X69 A;  4E47 A;  3G6E Q;  4JS4 A;  3HL8 A;  5GAO q;  5HK3 A;  4C8Q A;  3LX7 A;  5KYX B;  2JZ2 A;  4OB0 B;  2EYZ A;  2CYZ B;  1U3O A;  2DAQ A;  2CUD A;  4C92 F;  4GY5 A;  3CPW A;  4M75 F;  2KNB B;  3M0T A;  3E9G A;  2M16 A;  1JRI A;  5LJ3 f;  2Y4X A;  2X4J A;  2K4Y A;  3RER A;  4J9C A;  4BUG A;  3CCL T;  4JZ3 A;  4AFU C;  2PUO B;  3BW1 A;  3A8M B;  1BCM A;  3TEE A;  1QVG S;  3G7Z A;  2YLC A;  2PZ1 A;  4M78 F;  2V1Q A;  1GFC A;  3ZEH A;  1VQ9 T;  2FZG B;  4DA4 A;  5CKH A;  2LDM A;  4RMO A;  1QQJ A;  2JMA A;  3PNW C;  4KH0 B;  1VQ8 T;  4EDU A;  4D8K A;  1RAE B;  1N8R R;  2KRN A;  3I5S A;  3HRT A;  4HVU A;  5KE3 A;  2ENM A;  3CD6 A;  3EFO B;  2PVG B;  2CSI A;  1M4Z A;  2YDL A;  4Z8A A;  4FT2 A;  2EYQ A;  5I11 A;  5IT9 E;  3G71 Q;  4BE1 A;  4DOV A;  2QGG A;  5A0G A;  5D6Y A;  5GAO l;  3MEU A;  2QAZ A;  5GAN f;  1OX8 A;  3QXE B;  3HRU A;  2QK0 A;  5GAN 4;  1UTI A;  4F7U F;  3N5B B;  4HVW A;  3OW2 A;  2QA4 T;  4M7A E;  1OU8 A;  3M0U A;  4R55 A;  1FXX A;  2GQV A;  1GL5 A;  3QJY A;  2GTO A;  2HCK A;  3BY7 A;  4AFS C;  5GAN 7;  3MHX A;  1AWX A;  3A8L B;  2E5K A;  4M7D E;  1M2V A;  1VQO T;  2VWF A;  3I35 A;  2NUT A;  1S72 A;  2CRE A;  1QWE A;  2JXB A;  2CT3 A;  2NYS A;  1KQS S;  1BI3 A;  2DXB A;  4DBR A;  1JXO A;  5GAN 6;  3SD4 A;  1UJY A;  4C0Z A;  2RMO A;  5J26 A;  2IIM A;  3J7A F;  3MJX A;  2DBK A;  4TVR A;  1SSF A;  1ZA2 B;  3VYH B;  1VOM A;  3HTR A;  2KXD A;  2XKO C;  2RQV A;  4LNP A;  4XK8 E;  3EG9 A;  3GLX A;  2ZPI B;  2CP5 A;  1YIT A;  1SPK A;  3VS6 A;  3H41 A;  2DL4 A;  1E7O A;  1SSH A;  2KI7 A;  2MCN A;  4B9W A;  2KDS A;  2JM8 A;  2L3Q A;  3C94 A;  1UE9 A;  2KBT A;  4M78 A;  4J9I A;  5GAN 2;  1KJW A;  3GF5 A;  3QHS A;  2A36 A;  3I55 T;  1NLP C;  5DM7 R;  4DEX A;  2EQJ A;  3CD6 Q;  2K6D A;  3ZBD A;  5GAN 5;  3F70 A;  5FU7 C;  3L2W A;  3G1J A;  3M4Y A;  1XQH A;  1PKT A;  1D3B A;  3H8Z A;  4IKF A;  2LNV A;  3CCL A;  4ZN1 A;  4FW2 A;  3JB9 F;  3OYI A;  1YN8 A;  1T0H A;  2ZPE B;  2O9V A;  2OJ2 A;  4ZNX A;  1LPL A;  3DLL A;  8AT1 B;  1PCX A;  2GGR A;  1D1A A;  1NPR A;  2IG0 A;  3OY9 A;  3QKJ A;  3O8V A;  4BDY A;  1VQ9 A;  2M1H A;  3OSV A;  3RKW A;  3FEO A;  1IRX A;  2FPE A;  1VQ8 A;  1K73 C;  2DET A;  1S72 Q;  4BE0 A;  4C5H A;  1M1K U;  2HL5 C;  3NTK A;  4FYY B;  4XTX A;  1M3B A;  5LJ5 e;  2R58 A;  2KRO A;  5GMK l;  4FM4 B;  5I21 A;  3BDU A;  1YHQ T;  2DBM A;  1PM3 A;  5D6W A;  3H6Z A;  2VV5 A;  2HSP A;  4M77 A;  5CKE A;  1HXD A;  2LQW A;  4C0F A;  1G2B A;  5GMK h;  5IN1 A;  3VUB A;  4EMG A;  3I56 T;  1YIT Q;  4UC4 A;  1VQN T;  1OU9 A;  2VB6 A;  2DTH A;  1IZ6 A;  3JCM X;  2IVW A;  2HMA A;  3KFV A;  1JBM A;  3GNF B;  3HHT B;  3M55 A;  2RO0 A;  1Y57 A;  3H0H A;  1UB4 A;  2QA4 A;  3CXC S;  5CVI A;  2KK4 A;  1FX7 A;  5C6S A;  3VS3 A;  2DFU A;  2BZY A;  3L42 A;  5LJ3 j;  4X9C A;  4XTU A;  4C92 C;  4J6Y A;  2SEM A;  1RAC B;  4M75 C;  5M9O A;  4JRK A;  1VQO A;  3OS0 A;  2L8D A;  3TSW A;  2DEU A;  1VQK T;  3CCQ T;  1MMA A;  2GFA A;  1JXM A;  3HP9 A;  1XTD A;  3QZ9 B;  3WVE B;  1TTH B;  4MZP A;  2E10 A;  1WLP B;  3QII A;  1RAF B;  3CCL Q;  5HY6 A;  3GIB A;  1IGQ A;  4M7A G;  5LJ5 g;  1K8A C;  2DYI A;  2RQU A;  1NBE B;  1HK9 A;  3QPH A;  2RJC A;  3VU3 C;  3M0R A;  2X9H A;  2ZAE A;  4GLK A;  4M7D G;  4N0A C;  1N5Z A;  2LX7 A;  1GRI A;  3PFS A;  1WHK A;  3OYJ A;  1OUL A;  3DB3 A;  1K73 R;  1VQ9 Q;  1Y07 A;  4HCK A;  2K5F A;  3QDF A;  2QEX T;  4BAC A;  1ZBJ A;  2D6F A;  2BZX A;  1VQ8 Q;  5FLX E;  3C0C A;  1QVF S;  4C5G A;  3QDR B;  1VQ7 T;  2CZ7 B;  2DYB A;  1TSF A;  1VQ6 T;  1LVK A;  3I55 A;  2A37 A;  3FIF A;  2K7A A;  2MK5 A;  1XOV A;  4BD3 A;  2W10 A;  1C6V X;  2HL3 A;  1VIE A;  1H8K A;  4C0G A;  5GAM e;  4ZGE B;  1HYO A;  3RMQ A;  1M8M A;  1EX4 A;  2KXC A;  4KGZ B;  1KFZ A;  2EQI A;  4F16 A;  1JB0 E;  1YJN T;  4RTT A;  2K3Y A;  2HDA A;  2JN0 A;  5J3B A;  3OYM A;  2RHX A;  2QA4 Q;  3M4G A;  3QYH B;  2C06 A;  2J6F A;  1ZUK A;  4XTW A;  4J9B A;  1YNZ A;  4RCB A;  1VQO Q;  3AT1 B;  2O4X B;  2KRM A;  1Z9Z A;  2GBQ A;  1O9S A;  4KGX B;  1W6X A;  2CZ1 B;  2M0Y A;  1FMV A;  5GMK m;  1KSW A;  1I4K 1;  1VUB A;  2WSC E;  3LYI A;  3QWX X;  4ZN3 A;  1YHQ A;  3HRS A;  2JOY A;  2KT8 A;  5KE2 A;  2L3R A;  2PVD B;  1ZSZ B;  2RNA A;  4C0D B;  3CXC P;  1FWZ A;  3EGD B;  4RTU A;  5IXB A;  4F17 A;  1T3L A;  1VQN A;  1K0S A;  1BB9 A;  3QWY A;  4X9D A;  5GAM g;  2FRY A;  5GAN 3;  4KUD K;  3TRE A;  2EGA A;  4XTZ A;  2PTK A;  1VQM T;  2RQT A;  2FG0 A;  1KC8 U;  1TS9 A;  1C1A A;  2LP5 A;  1RLQ C;  1KC8 C;  4FSS A;  1YBY A;  3I55 Q;  4PLI A;  2LVM A;  1JEG A;  3JB9 J;  3HFO A;  1FMK A;  1U8R A;  4M7A D;  1OZ3 A;  1ZUY A;  4OMQ A;  4A53 A;  2NUZ A;  1VQK A;  2J06 A;  3CCQ A;  1ZUU A;  2DL3 A;  2WSE E;  1VYT A;  4KT0 E;  3M54 A;  4N4H A;  2L3S A;  2L5Q A;  5GAO p;  2LJ3 A;  2QQ9 A;  3CCV T;  2CZ0 B;  4M7D D;  4FYV B;  1QMC A;  2EKO A;  1NEB A;  2CP2 A;  1QP2 A;  3EH2 A;  4XU0 A;  3BDL A;  1UDL A;  3U23 A;  4B9X A;  2KT1 A;  2VUB A;  1QVF P;  2OTL T;  1K76 A;  3A98 A;  3DLM A;  4BY6 C;  2CP6 A;  2XIC A;  5LL6 S;  4XU2 A;  1X6B A;  3JCM d;  4M7A B;  2D1X A;  4PNO A;  4RTV A;  1RLP C;  4OGE A;  1IB8 A;  1JJ2 P;  1KHC A;  1MMD A;  2COW A;  2HQH A;  2COZ A;  4M7D B;  1Q95 G;  1VQ7 A;  4PJO B;  1Q82 U;  2CSQ A;  2MYS A;  1YHQ Q;  3R6O A;  3OB9 A;  4LE9 A;  2QQS A;  1Q82 C;  2CH4 W;  2RHU A;  1QKX A;  4PL6 A;  4ZTF A;  2EWN A;  2G3R A;  4XQ3 A;  2EYX A;  3OS2 A;  2BUD A;  3EAE A;  3I56 Q;  2LC4 A;  1Y71 A;  4RUG A;  1Y96 A;  4C5E A;  1VQN Q;  1OI1 A;  1PD1 A;  3MP1 A;  2LQK A;  1RI9 A;  3CBP A;  1YJN A;  1NPP A;  4EMK B;  1KC8 R;  1IXD A;  3HPW A;  4J9H A;  2R57 A;  3RMS A;  1UHF A;  3BE3 A;  4CC3 A;  3OA6 A;  2KYM A;  4IUV A;  1K1Z A;  1MGQ A;  2E6N A;  2MWO A;  2ZCF B;  3C95 A;  1UGQ B;  2LCL A;  2OAU A;  2DIG A;  2EYW A;  1RUW A;  2RA2 A;  1VQK Q;  3CCQ Q;  3OSS C;  4IUR A;  4AFZ C;  5IH2 A;  1X2Q A;  1ZQ1 A;  1PRL C;  5CO7 A;  3V7R A;  2RF0 A;  1RAH B;  1I1J A;  3LWI A;  2VC8 A;  1YFN A;  4ORZ A;  1OX9 A;  3E19 A;  3JCM J;  1K4U S;  2RPN A;  3RIR A;  3VV0 A;  3RES A;  5KYN A;  2O01 E;  1N27 A;  2FEI A;  2QTX A;  2RK1 A;  2EJG A;  3PMI A;  5HCK A;  2QTV A;  2QEX Q;  3FB9 A;  1VQM A;  2C0O A;  4CRI A;  1VQ7 Q;  1Q82 R;  3QSU A;  2BE7 D;  3DKM A;  1WHJ A;  2B86 A;  1VQ6 Q;  3KUF A;  5GAM h;  1B34 B;  3EHQ A;  4J9G A;  4FYX B;  3EFR A;  3EG1 A;  1OV3 A;  3V8K A;  2OX7 A;  3CCV A;  4WTO B;  2LT1 A;  2O31 A;  1YI2 T;  4C8Q G;  1YJN Q;  3VKI A;  2DVE A;  2CS7 A;  2FVU A;  2LCC A;  4LXC A;  4A4H A;  2OTL A;  1H3H A;  2PU9 B;  3VRY A;  4HCZ A;  4PK4 A;  5KYY B;  1UGR B;  2DXT A;  2CH4 A;  2RJF A;  1YIJ T;  2P4T A;  1VIF A;  3JRZ A;  2ROL A;  1X43 A;  1E6G A;  5KYW A;  5IXF A;  5J39 A;  5EC7 A;  4OP0 A;  4ELY C;  3PGG A;  2XDB A;  3JB9 I;  5GAO r;  4EPC A;  4QVC A;  1GXI E;  1I5L A;  5LJ3 d;  4BI8 B;  4BE2 A;  1WQW A;  4M77 E;  2H3E B;  1BI0 A;  2RI5 A;  4MMK A;  1RAB B;  2RHI A;  5KYU B;  2AZS A;  1M30 A;  5IAY A;  5LJ5 f;  1LOJ A;  2EJF A;  2KRS A;  2E4H A; 
#chains in the Genus database with same CATH homology
 1WHH A;  1WHJ A;  1TOV A;  2M02 A;  2CP3 A;  1TXQ A;  2HKQ B;  3RDV A;  2CP7 A;  2E3H A;  2COY A;  1WHG A;  2HL5 C;  2HKN A;  1LPL A;  3E2U A;  2CP5 A;  2CP6 A;  4B6M A;  1WHK A;  1IXD A;  2E3I A;  1WHM A;  2QK0 A;  2HL3 A;  1WHL A;  3TQ7 P;  2MPX C;  2COW A;  2HQH A;  2CP2 A;  2COZ A;  2CP0 A;  2Z0W A;  2E4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...