2HL3A

Crystal structure of the a49m mutant cap-gly domain of human dynactin-1 (p150-glued) in complex with human eb1 c-terminal hexapeptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Dynactin-1
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hl3A00
2E4HA 2CP6A 2Z0WA 2CP3A 1TXQA 2CP0A 1LPLA 1WHJA 2COWA 4B6MA 1WHGA 1WHHA 3E2UA 2CP5A 2E3HA 3TQ7P 2HQHA 2CP7A 2CP2A 2MPXC 1WHMA 2E3IA 2M02A 2HKQB 2HL3A 2HKNA 2COYA 1IXDA 1WHKA 2COZA 3RDVA 1WHLA 2QK0A 2HL5C 1TOVA
chains in the Genus database with same CATH superfamily
2KDSA 2FZCB 4M77G 3CCLQ 1S72A 4AFSC 3EGUA 2XKOC 4Z02A 2ZCFB 2JTFA 1N9SA 3NTIA 1BBZA 4M7DE 3QWXX 1PD1A 1CKBA 4PJMA 4ZN3A 4B6MA 2M16A 4LE9A 3FC3A 2E1HA 3GLXA 1Y07A 2KROA 4M77A 1W6XA 3V8KA 2DEQA 4M75C 4C8QB 5ECAA 1K76A 2FPEA 1AOJA 2A7YA 2IG0A 1QVGS 4QKUA 5A2QE 1N5ZA 3SFMA 1VQMT 2FHDA 1LPLA 1IHWA 3QUIA 1VQLQ 1LNXA 1M2VA 2DFUA 5IH2A 4C8QA 2LT1A 1QVFS 1PKSA 3OYKA 3VRYA 1GL5A 4ZGEB 3PVQA 3V8JA 1IXDA 3PIPA 1RACB 4JJBA 4AMCA 1K73C 2AIRB 2I0NA 4M7AB 4FW1A 1M2VB 2EYQA 1VQ6T 2EPDA 1WJRA 1IO6A 2ROTA 3UPUA 4M7DD 3CMAT 2RJEA 4IKFA 1VQMQ 3CPWS 4M7AC 1S1NA 3E1SA 4PFOA 2JMCA 4TVRA 2NYSA 3HKSA 1UUEA 3CMAQ 3UF4A 3TCJA 5KYUA 2CGHA 2LMJA 2EIFA 3M0UA 2VUBA 4FYXB 3TVTA 3CD6T 2QI2A 4XQ3A 3OYJA 2CUDA 1Q82R 1E7OA 1V1CA 4ELZC 2RQRA 3MP6A 3JCMf 4J9EA 4RTVA 1BB9A 4OMOA 2JVVA 1SEMA 4E7ZA 1HD3A 3QHSA 3OBYA 1NBEB 3VYHB 4D6WA 2XDPA 1WZOA 1TSFA 5FROA 4KGZB 3H9NA 5FWCA 4AG1C 4A4EA 2CH4A 2VB6A 4IUUA 1ZX6A 4OMFB 1U3OA 3OS5A 2K2VA 3UA6A 2ZPGB 3QJ6A 1Q81R 5GAOl 2D1XA 1I5OB 2LJ3A 1YN8A 3WVEB 1AWOA 4JZ3A 3KFVA 1Q86U 3SWNB 2G6FX 3GIBA 1K0SA 4C92C 1WGSA 3OMCA 1YHQT 5FRNA 2RHUA 2YRCA 2GNCA 4JUVA 1RAHB 3BDLA 4LDVA 4M78A 1ZSGA 3ZFJA 1MNDA 3QDFA 3CC4A 2IVWA 2RI2A 4N4HA 3QZ5B 4M78D 2EGEA 2YWWA 1HK9A 1VUBA 1PKTA 4AFZC 2JTMA 3CXCP 2CP3A 2Y4YA 4HA8A 3H0HA 3G6EQ 4IUPA 3CCJT 3M55A 2X35A 1OPKA 3ZEHA 1WLPB 4M78F 3IQLA 5KE3A 1D1AA 4M7AE 2DZCA 2DIQA 2F5TX 1AEYA 1JXOA 2D0QB 3THKA 4C8QD 3NTKA 3RMSA 1KQSP 1WX6A 5LJ3d 2P0QA 1ZBJA 2DAQA 1WHJA 1M30A 1WQ7A 1M4ZA 2HAXA 5KH6A 5GAN3 4HT8A 5HK3A 2DERA 2ATCB 3VV0A 3QO3A 1VQKT 3EG9B 2KE9A 3VS2A 2L8DA 2R5AA 3KUFA 5GAOm 2CP6A 2ZPBB 4LDYA 2RHIA 2BZ8A 5CKDA 3BFMA 1RI0A 2XU8A 4E7IA 2EJGA 3L2QA 4E7HA 1D1CA 3AT1B 1GXIE 2EBPA 1N27A 1NYFA 2JMAA 2JS0A 3L2ZA 2K7AA 3NTHA 2D8HA 2OTJQ 4FSXA 2HNIA 3MKDA 3EG3A 5L8RE 3OW2P 3ER0A 4DA4A 2MPXC 5GANg 4D8DA 1I07A 2FRYA 2CT3A 1YI2Q 2HL3A 3MCAB 1SKUB 1PC0A 3H8ZA 2J6OA 8ATCB 2VXEA 2WSFE 4ME7A 2CP0A 3P8DA 2LX7A 1J3TA 1KC8R 1VQNQ 3RIRA 1QVGP 2PZ1A 3M5AA 3A5ZB 2X3XD 2GFAA 2AKLA 1VQ5Q 1M1KC 2AZVA 1K4US 3GOXA 2LJ0A 4C92A 3REBB 4QW2A 2JOYA 4JS4A 4OMMA 1DJ7B 1HYOA 1MHNA 3CCJQ 2LTOA 4Q5WA 1S72T 3M0PA 3G6ET 2CH4W 4QQDA 3CCUA 2V8KA 1KQ2A 4CC7A 3JCMh 2M0YA 3TREA 3FIFA 2J6KA 1GCPA 5FW9A 1RLQC 1IRXA 3V7CA 3CCVA 1WYXA 3QKJA 4RTUA 4EIKA 2X51A 4L5GA 4KUDK 3PNWC 1BI2A 1FX7A 2A36A 5GMKj 2JTEA 5I2MA 5DY9A 3ULRB 2M9UA 5LJ5j 3QG1A 4P5NA 4M78E 2B86A 4FYYB 2DYBA 5D6XA 3EFRA 1KJWA 3I55A 1UHCA 2QA4T 1JU5C 2YUNA 2XIDA 4C8QF 5IHKA 3MP1A 2K3XA 1EX4A 2X4XA 2F69A 2MMPA 4A53A 1U8RA 5KYYB 1ZSZB 1YHQQ 1QCNA 4EMGA 1BK2A 4PJOD 1SPKA 3X24B 4F7UA 1K9AA 1NJIU 1XNIA 1YITQ 3V7RA 1QVFP 4M7AA 5GMKl 3QWYA 1BIBA 3CCMT 1UECA 4M75F 3CCST 2HQEA 4CI0C 1NEBA 1WXBA 1YCYA 5LJ5e 1T0HA 1VYVA 4BDYA 1SHGA 4L59A 1M1GA 2RJDA 3UDCA 3CCRT 4XU3A 4A4GA 3LYIA 4CC4B 1TS9A 2EKHA 2KR3A 1F1BB 3VS6A 4DBRA 2ZAEA 4JRIA 2RM4A 4OGEA 3X26B 4BI8B 1M3BA 4RTTA 2E6NA 1WHLA 1VQ9Q 1NEGA 2QTXA 1RUWA 2QTVA 2PNIA 2ZZDA 1OZ2A 3R6OA 4PJOG 4OB0B 5FU7B 1YJWQ 3ZL7C 4FL6A 4XTVA 4RMOA 5IXFA 2O9VA 3A1PA 2QEXT 2MYSA 1ZLMA 5CVIA 1VQ8Q 1GFCA 2RK2A 4GY5A 1I5LA 1I81A 3M56A 2QEXQ 1U1SA 1NLOC 3QBYA 4Y28E 4EDUA 3FDRA 2DL7A 2RJFA 1YJWT 4BI3A 5IT9E 2KXDA 4A4HA 5HK0A 2PU9B 4KGXB 2QQSA 2LQWA 4M78B 3RESA 2ZPIB 1M1KR 1B7TA 2YHTA 1K73U 4M7DF 1NJIC 1NYGA 3EFOB 2NUPB 2CUBA 2KYBA 1IGUA 1W4SA 2KRNA 2YRDA 3HPWA 3G71A 4LN2A 3CCRQ 2V1RA 3EFSA 2XICA 4MZTA 2X4JA 1LVKA 3EFOA 3VYGA 1WFWA 3G1JA 2C06A 4PLLA 2RD1A 2P84A 1Q82C 1VQ7T 3HFNA 1VQ5A 4EMKC 4B9WA 2DD4A 2DJZA 2X9HA 2CP7A 3SD4A 5KCHA 3A8MB 2LNHB 4WCIA 1K9MC 4PJOF 2KXCA 1ACMB 1EIFA 4VUBA 4DOWA 4J7FA 4UC4A 4OMPA 3RR6A 4PJOB 4X34A 5GAOp 2RHZA 2KSSA 3LWIA 3MHXA 4Z89A 2HD0A 1JJ2S 1VQ4T 1WDXA 2YLCA 3QYHB 1RADB 1KD1C 2QGFB 5FU6B 1VQPT 3HL8A 2RI3A 5GJVB 1M90C 4KH0B 1YJ9T 2RO0A 2RQVA 1X6OA 1H92A 5CAIA 1OPLA 3UATA 2CZ7B 3A98A 2KGTA 2Z0WA 2DF6A 3VUBA 3SWNC 5GMKe 1FMWA 4RCBA 1D09B 2RI5A 1EZZB 4A4FA 4C5GA 1TU0B 1ZUUA 4M75G 3CC7T 4OMNA 3OYYA 2ZGWA 2DXUA 1VQOA 2XD0A 1QP3A 2GFUA 4PKCC 5KYUB 2JUFA 4N0AC 4J9BA 1W2BP 1OV3A 2L3QA 2MIOA 4ZTFA 3CCET 3L2WA 3M53A 2DTOA 2O4XA 3EG1A 5LJ5f 1W2BS 2H3JA 2IPOB 5HCKA 1VQOT 1KSWA 3OYDA 4JRQA 2MCNA 1V29B 3VS0A 1VIEA 1BI1A 2YLBA 3QYGB 2O4XB 3G4ST 2XHCA 4IIOA 1B07A 5CKFA 1Q7YU 1MGQA 2GF7A 5IHIA 1CKAA 3EHRA 4CC3A 2LJ1A 2O2OA 4M75E 4LD6A 2DETA 1KQSS 3CPWA 5GAN5 1NZ9A 3RERA 3LH5A 4GLKA 2JM9A 1ABQA 4KBMB 3OW2A 5M9OA 1Q7YC 4O5VA 2DRMA 1CSKA 2SRCA 3T9NA 4E7SA 4F7UF 1VQ8T 3OSSC 7AT1B 4AFUC 2QYZA 1YJNA 2OTLT 4XTUA 4A4KA 2QQ9A 2DLPA 1PCXA 2DZ9A 2JW4A 3MO8A 4IURA 3TEEA 4Y92A 2EW3A 3MEUA 1VQ5T 1VQ7A 3CPFA 2JT4A 3M0RA 4C92D 3REAB 4N4GA 1OYXA 3TSWA 1PRMC 2JM8A 1QLYA 2O31A 2FZGB 3G7ZA 4BE1A 5KYYA 4J7IA 4KULA 2K6DA 1PWTA 2CP5A 1NPPA 1OI1A 3M59A 4HVVA 1PD0A 2KNBB 3I55T 1AWJA 2BIVA 2X4WA 4R55A 1N6AA 3G71Q 5FWBA 3EAEA 2YXYA 1RAFB 2EQUA 2DL3A 1G3TA 3TSZA 4KT0E 1R77A 3GNFB 3UT1A 1ARKA 4XU0A 1Q81C 4BE2A 2R5MA 3EGDB 5LL6S 4C8QC 3EG9A 4C0DC 4RG8A 1FYNA 1VQLA 4PJOC 1YITT 3J7AF 1KD1R 2FG0A 2ESWA 1Y7XA 4V2SA 1EFNA 3CC2A 4RTWA 2EYZA 2LQNA 1TUCA 1E6GA 2LQ8A 3I55Q 2XMFA 1IHVA 1RAAB 2QASA 2XK0A 2YUOA 4EMKB 4PJNA 3MEAA 4FCYA 4HCCA 3CXCA 2E64A 3JB9G 4YTLA 2A3LA 2MWOA 2Y90A 4HKEA 3VUZA 1VQPQ 2PTKA 3DKMA 3M54A 4OVAA 5EG2A 1PHTA 8AT1B 1VQ4Q 2LDMA 4C0GA 2RK1A 4FIBA 1RLPC 4BI4A 4N4IA 1WI7A 1H8KA 2B8AA 2DD5A 2V26A 3DB3A 2C0TA 4EPCA 5GAN7 2F5KA 5LJ3g 5J3BA 2G3RA 3CC7A 5CKBA 1QCFA 2LVMA 1D1BA 1WHKA 3C4SA 1QMCA 2CT4A 1GCQC 2V8IA 3OMGA 1PNJA 2KI7A 4ESRA 4M75D 4BB7A 4CC2A 1VQ6Q 1MMNA 1MMGA 3FB9A 1I8FA 2LRQA 4M75A 3VS5A 1MV0B 2EYYA 1KC8U 1WJQA 1PM3A 4R0KA 4XTZA 4FW2A 3P8HA 3S3MA 2NLUA 2OJ2A 2OX7A 3OB9A 4JRKA 4J83A 4C0DB 3JCMP 3FEOA 3MP8A 2C0OA 1QKWA 5LJ3j 1YIJQ 2EFIA 1AHJB 5KE2A 3MEWA 1K73R 3CPWP 2BUDA 1U5SA 1WA7A 1MV3A 2RF0A 1XQHA 4BE0A 4EMHA 5I22A 1N8RR 4M7DC 4JLIA 1H3ZA 3J81E 4J9CA 3PGGA 1KK7A 2RMOA 3JCMJ 2PVDB 3OBWA 4M78G 4N0AA 2OTLQ 4M7AG 5FLXE 3F70A 2DJQA 2L3SA 2OAWA 3MJXA 1OQKA 3C12A 3E2UA 1QKXA 1M3AA 2RQWA 3VS4A 1SF9A 4PL6A 1OU8A 1KC8C 4JJNK 2DNUA 5GANh 3FLGA 1UGVA 1IB8A 2RHYA 1UGQB 2HEQA 1UGSB 2NWMA 1QP2A 4XU2A 1YP5A 1BI3A 1Y96A 1TUDA 4IUQA 4PJJA 4C92G 5A0DA 1B34A 1M1FA 1KHIA 2L0AA 4Y91A 3PTAA 1GFDA 1XOVA 1QW1A 5I11A 1H3HA 1B3QA 3QXEB 1AT1B 2QEXA 2PQWA 4HXJA 4Z88A 2DL5A 3JCMV 1YCSB 2M0OA 1AD5A 3OQ5A 4LUEA 2LNVA 1Q86R 2GQVA 3CXCS 2FPFA 2E6ZA 1PSFA 3RDVA 1WXUA 1X69A 2L2PA 3GBQA 3PIOA 2XDDA 4F14A 1BCOA 5GAN8 5GANf 2DVJA 1SHFA 3OY9A 2BZYA 2O01E 2QQAA 1G8XA 2KRSA 3X20B 3UWNA 3FRNA 1M1KU 2OTJA 3LH0A 2K2MA 3JCMb 4JZ4A 3PE0A 5KCOA 1UEBA 1SSHA 1O75A 4HT9A 1M8MA 3OYLA 5KYWB 2K9GA 2YUQA 5D7UA 2K4YA 3GNGA 2KY9A 2E12A 2ZPHB 4C0FA 2R58A 1D3BB 2HMAA 4KGVB 3JCMX 3I5RA 1UFFA 3EG0A 4XK8E 3OSVA 5J26A 1V76A 3CCSA 2QQBA 3RMQA 2RQUA 9ATCB 4ELYC 3O5ZA 4GLMA 4II1A 4PK4A 1D3BA 2NUPA 3L42A 3OW2S 2DA9A 5FU7C 5FU6C 1G3YA 2L5QA 4D8KA 3I56A 1ZUKA 5CO7A 3D7SB 3JB9I 2OI3A 4JPBW 4ORZA 3OYEA 1W70A 3E9GA 2R57A 1ZHIA 1VQKA 3HSBA 2X3WD 2D8JA 4XU1A 4M77C 1MUZA 2HKNA 1QWEA 1GBRA 1WXTA 4C5HA 5LJ3f 1VQMA 3JV3A 3CCVQ 1VQ9T 1IREB 1M27C 2A0FB 2MF2A 2ZPFB 1K8AR 2QDLA 5IHNA 3TQ7P 3PMTA 2KT1A 1JB0E 3EGDA 4Z8AA 3CCUT 3OS1A 1VA7A 2E65A 2K57A 4PNOA 3G6EA 3M0SA 3OA6A 1KQ1A 4OGCA 3WXMB 1VQNA 1OX8A 3CMEQ 3EH1A 1HJDA 1BCMA 1Y0MA 2BZXA 1UGPB 3O8VA 1I0CA 2HBPA 2EQIA 1PSEA 4DBQA 1I4K1 4FYWB 5I2SA 3LWHA 5GAOr 2E3IA 2LX9A 2FEIA 2VXFA 2HQXA 4EMKA 2GGRA 4ZTJA 4F17A 1G3WA 1RL2A 5HY6A 2LCLA 3PFSA 2E41A 2J05A 1BKBA 3HRUA 2RA2A 1VQ9A 3HP9A 5GAOq 1KD1U 2DXCA 1K1ZA 2E5QA 1LOJA 5EC7A 1M2OA 3JAME 4RTYA 4OMQA 4OF1A 3INZA 5C6SA 1ZA1B 5GAMh 3JCMW 1AWWA 3I56T 5DM7R 1D0ZA 5I21A 2DILA 2FVUA 2HZYA 3JSCA 3JCMg 2ECZA 2VYTA 3GP8A 1NLPC 2CZ6B 1U06A 1JRIA 5CKHA 2EGCA 2J06A 5KYXA 1YWPA 1W2BA 1VOMA 4PJLA 1P92A 1VQ6A 3CD6A 1XJWB 2FO0A 2JS2A 3JB9H 4M7AD 3OYNA 2DIGA 1QCOA 4AT1B 3C94A 4XTYA 2VC8A 1JO8A 5IN1A 5KYXB 3JCMQ 3M9QA 3L2RA 2EQKA 3PT9A 1NPRA 3E9FA 3S3NA 1X75C 2E10A 1UB4A 2RH2A 4PFPA 3SEMA 1NE8A 4OB2B 2FPDA 2OTJT 1WNLA 1RABB 2A08A 3URGA 4WTOB 1BYMA 2X4YA 2VGMA 2RJCA 3ASKA 4RUGA 3CCJA 5GAMg 1M90R 4LUDA 5GMKm 4M7DG 4HVUA 1N8RU 4ZGDB 1SSFA 2O9SA 3NMZC 2HDAA 2DTIA 1Z9QA 1LJOA 4XAXB 4IUVA 3H6ZA 3H0FA 5GANd 3R6NA 4M77F 5CR2A 3RKYA 3LGFA 4MMKA 2CSQA 5LJ3h 1ZSZA 2EKOA 5DLOA 1C6VX 4F7UB 5GAMd 3H41A 3RKXA 1Q95G 1VQNT 3RUXA 1TXQA 1TH7A 2P4RA 3CD6Q 4J9FA 2K5FA 3JRZA 2RNAA 4JDSA 1WHGA 2LQKA 2YDLA 4J9IA 2KAFA 4J6XA 3HFOA 2XDBA 2QAZA 3I5SA 3CCQA 2RPNA 2F1LA 2DMOA 4F16A 2ABLA 2MOXA 4F04B 3FJ5A 2K5IA 4MZPA 2DYIA 1AVZC 2V1QA 2D6FA 3H0IA 2KT8A 4ANJA 4ATOA 2QG9B 1YWOA 2VASA 1JJ2P 2M02A 2ROLA 3HRSA 3RNJA 2XG8D 3CBPA 3E19A 1K9MU 2BTTA 4B9XA 3CC7Q 4PFZA 5IAYA 3G4SQ 1Q7YR 4J6YA 1YJNQ 2VKNA 4C92B 2MK5A 3LGLA 1UTIA 1BU1A 4C8QE 2EGAA 4LNPA 5GAMf 2BKDN 4DBHA 3CMAA 3V7SA 4HVWA 2DM1A 1VQKQ 2L89A 3X28B 2HSPA 4OP0A 2JNGA 4E7KA 3DLLA 2E70A 2ED0A 1N8RC 2CS7A 3BE3A 4NOYA 1K9MR 4KH1B 4F7UE 1OOTA 3A8HB 2WACA 1FXXA 1X01A 1VQOQ 2BE9B 3OYHA 4PLIA 3QSUA 4J9DA 1SRLA 1W1FA 2M1HA 2DEUA 4OMLA 3CCEQ 3CMET 2KK4A 1R0CB 1MMAA 2HCKA 1Q81U 5HKCA 4LDXA 4GBQA 2CREA 3CCUQ 2FB7A 1KG1A 5KYNA 1ZSZC 4O6JA 3G4SA 5CK9A 3SHWA 2AT1B 1IGQA 1HSQA 4JJCA 4ZN1A 2LT4A 3A8LB 2P0PA 2VWFA 1H641 2JN0A 2DK3A 3VJPA 4KUIA 2JZ2A 2QK0A 3CQTA 1ZQ1A 1TUGB 3HHTB 4C5IA 2JJ9A 4QQGA 3VKIA 2WSEE 4MZMA 1QQJA 1JXMA 3CCQQ 2VVKA 2YSQA 3LW5E 1VYUA 1I1JA 1R8OB 5GAOn 1WHHA 1PRLC 2QDYB 3M4YA 2GTJA 1MNEA 5J39A 1VQ7Q 2W10A 1E6HA 3JB9D 3CBMA 4FT2A 4M4ZA 2F2XA 1Q82U 4BUGA 2LZ6B 3MEVA 4R56A 2P4TA 2O88A 1Y96B 1C1AA 3SDZA 5D6WA 1UE9A 1QWFA 3GF5A 1YITA 2E3HA 1VQLT 2OAUA 4X1VA 3I9QA 1LCKA 2M51A 3NFCA 4HCZA 2RB6A 3A8GB 3OYIA 3C0CA 2KEAA 2CYZB 2QXFA 1FMKA 5D6YA 1WPYA 2EWNA 4RG2A 2ED1A 2JXBA 4A63B 1TTHB 4K11A 2J6FA 4NL3A 2W0ZA 1X6BA 1RI9A 2E5KA 5GAMe 4ZNXA 1OX9A 2GBQA 3CCLT 2DVEA 4X9DA 5GAN4 4NS5A 4BY6B 1OEBA 1YJNT 2OTLA 2HQHA 2IIMA 1HXDA 1JBMA 2VV5A 4LDWA 3Q1JA 1WJSA 2NUZA 3SWNA 3GPLA 1AWXA 1ZUYA 4RCCA 2I2LA 3CC4Q 3OYGA 1GRIA 4LDUA 3OYFA 5KYWA 4PJOE 2KYMA 2BE7D 2COYA 3CCMQ 2H3EB 3QPHA 2FYKA 1X2KA 3VU3C 1TOVA 2LC4A 4X9CA 2DTHA 1NM7A 3OYCA 1KQSA 2EQJA 1PG5B 4RKUE 3WVDB 1YIJT 1VQ8A 2KMTA 5GAMj 2SEMA 3VRZA 1K8AC 2HSEB 1TG0A 2KVQG 1OZ3A 5GMKh 3N5BB 3C95A 3BW1A 5L23A 1YJWA 2L3PA 5LJ5h 1XTDA 3OYBA 1KFZA 2EYXA 1RAEB 1M5Q1 2DXBA 1K8AU 3M0QA 4QQ6A 1G5VA 3FJPA 2QGGA 1YFNA 4E2FB 3CCSQ 1YBYA 1U1TA 3I35A 2KQWA 3NGPA 4PJOA 2EYWA 2GQIA 4M77B 2AK5A 2DL4A 5IXBA 4NL2A 2FZKB 3QIIA 1JQQA 4E6RA 1R0BG 5CKEA 2COZA 1FMVA 1YIJA 4M7AF 1QVGA 3CCEA 3CC2T 3RKWA 4JLGA 5CIUA 2QQRA 4MDWA 2CZ0B 1Z9ZA 1YJ9A 4E7JA 1C0MA 3OS2A 2J7IA 3LLRA 3M4GA 1VQPA 3OYMA 1RAIB 5GANj 3EG2A 2D9TA 2K3BA 1WHMA 2FRWA 4F7UG 4ZGJB 1KIKA 2EJFA 1UHFA 4JJDA 3M58A 3P8BB 3S6WA 2YT6A 1UJYA 2DKGA 2DPPB 3CCRA 2F2VA 4XTXA 4J8OA 5GANe 1ABOA 1UG1A 4FM4B 3X25B 3EHQA 2DBKA 1BIAA 3A8OB 2LCCA 2QA4Q 4HCBA 1RAGB 1AZGB 2A37A 2K79A 2EQMA 5CQYA 2PUOB 1YI2T 3OS0A 5C0MA 1G3SA 3RBBB 4FT4A 1N9RA 2A28A 2DL8A 3BDUA 4RTXA 3MPUB 3BY7A 3META 1JJ2A 3CC2Q 3CCLA 4M77D 1WQWA 1IZ6A 5FRMA 1X27A 4FYVB 4J9GA 1YI2A 2CP2A 2EJ9A 3CEYA 1T0JA 2P0KA 4MMLA 3G71T 4MDXA 4QVDA 4C92E 2MAMA 3M57A 2ZPEB 2GCXA 1UJ0A 1VYTA 3I56Q 2MWPA 2KBTA 1A0NB 2AHJB 3VS1A 3ME9A 2V8JA 3KXTA 3EH2A 3M0TA 2DRKA 4BD3A 3TU4K 1YNZA 3LX7A 2DXTA 3PVLA 4A54A 2HKQB 4IIMA 1TWBA 2PVOB 3EGXA 5AYFA 1VIFA 4M75B 4OB3B 4DEXA 1S72Q 1T3SA 4JS5A 1QVFA 3UA7A 1ZA2B 4J6WA 1M3CA 5GAN6 4OB1B 4LD9K 2GTOA 4CRIA 2MI6A 1NJIR 3QJYA 3EGXB 2CKKA 4DEYA 2DX1A 2E4HA 5CCAA 1G2BA 4RTZA 3ZBDA 2CZ1B 4E47A 3S3OA 5AT1B 3CMEA 4QVZA 1O9SA 4J5YA 1SG5A 1BI0A 1NG2A 2Y4XA 4AFQC 3JB9F 4XTWA 2C0IA 3QDRB 1X43A 1WIEA 3VS7A 2DO3A 5GJWB 1QVPA 5A0LA 1UDLA 3OYAA 2EAYA 2YUPA 5A0GA 4DOVA 1Q86C 4BACA 2FL7A 4C0ZA 1X6GA 1M9SA 4C5EA 2LP5A 6AT1B 2WSCE 1D0YA 1D0XA 1SRMA 2COWA 4DQ2A 4IUTA 4M7DB 2DE0X 1JEGA 3CCMA 1GBQA 4AG2C 3HRTA 2EVRA 1X2QA 4JRPA 1VQ4A 2H8HA 2RHXA 4QT7A 4M77E 4E7LA 1MMDA 4C8QG 3AHUA 2PVGB 1ZBXA 4WF2A 1OU9A 3JCMc 4M7DA 1T3LA 3V8LA 1B34B 2L3RA 3NHNA 2K3YA 2KRMA 3JCMd 2QA4A 4FU6A 2ENMA 3L2UA 4J9HA 5LJ5g 1GCQA 1OULA 3DB4A 2HL5C 2NUTA 4DBFA 2K5LA 1KHCA 3U23A 3CBOA 2XI9A 4FSSA 3J80E 5DLQE 3CCQT 2AZSA 2CDTA 3NPFA 4BY6C 5GMKi 1G83A 3JB9J 3CCVT 4C92F 1UGRB 4LXCA 2YRVA 1YJ9Q 3SB2A 2NUTB 2RN8A 3L2VA 5CQXA 1Y71A 4KRTA 5GAN2 1Y57A 4L6V5 1FWZA 3VS3A 5LJ3e 5LJ5d 1AZEA 4QVCA 2CSIA 3KBGA 4HCKA 3CC4T 2LCSA 3JCMe 2HBWA 2PUKB 3QZ9B 1M90U 2AKKA 4M78C 4BDZA 1YHQA 2RQTA 3L1AA 3PMIA 2D0NA 3HTRA 1K0XA 2F2WA 2VGNA 2DBMA 3DLMA 1M8VA
chains in the Genus database with same CATH topology
2E4HA 2CP6A 2Z0WA 2CP3A 1TXQA 2CP0A 1LPLA 1WHJA 2COWA 4B6MA 1WHGA 1WHHA 3E2UA 2CP5A 2E3HA 3TQ7P 2HQHA 2CP7A 2CP2A 2MPXC 1WHMA 2E3IA 2M02A 2HKQB 2HL3A 2HKNA 2COYA 1IXDA 1WHKA 2COZA 3RDVA 1WHLA 2QK0A 2HL5C 1TOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4H A;  2CP6 A;  2Z0W A;  2CP3 A;  1TXQ A;  2CP0 A;  1LPL A;  1WHJ A;  2COW A;  4B6M A;  1WHG A;  1WHH A;  3E2U A;  2CP5 A;  2E3H A;  3TQ7 P;  2HQH A;  2CP7 A;  2CP2 A;  2MPX C;  1WHM A;  2E3I A;  2M02 A;  2HKQ B;  2HL3 A;  2HKN A;  2COY A;  1IXD A;  1WHK A;  2COZ A;  3RDV A;  1WHL A;  2QK0 A;  2HL5 C;  1TOV A; 
#chains in the Genus database with same CATH topology
 2KDS A;  2FZC B;  4M77 G;  3CCL Q;  1S72 A;  4AFS C;  3EGU A;  2XKO C;  4Z02 A;  2ZCF B;  2JTF A;  1N9S A;  3NTI A;  1BBZ A;  4M7D E;  3QWX X;  1PD1 A;  1CKB A;  4PJM A;  4ZN3 A;  4B6M A;  2M16 A;  4LE9 A;  3FC3 A;  2E1H A;  3GLX A;  1Y07 A;  2KRO A;  4M77 A;  1W6X A;  3V8K A;  2DEQ A;  4M75 C;  4C8Q B;  5ECA A;  1K76 A;  2FPE A;  1AOJ A;  2A7Y A;  2IG0 A;  1QVG S;  4QKU A;  5A2Q E;  1N5Z A;  3SFM A;  1VQM T;  2FHD A;  1LPL A;  1IHW A;  3QUI A;  1VQL Q;  1LNX A;  1M2V A;  2DFU A;  5IH2 A;  4C8Q A;  2LT1 A;  1QVF S;  1PKS A;  3OYK A;  3VRY A;  1GL5 A;  4ZGE B;  3PVQ A;  3V8J A;  1IXD A;  3PIP A;  1RAC B;  4JJB A;  4AMC A;  1K73 C;  2AIR B;  2I0N A;  4M7A B;  4FW1 A;  1M2V B;  2EYQ A;  1VQ6 T;  2EPD A;  1WJR A;  1IO6 A;  2ROT A;  3UPU A;  4M7D D;  3CMA T;  2RJE A;  4IKF A;  1VQM Q;  3CPW S;  4M7A C;  1S1N A;  3E1S A;  4PFO A;  2JMC A;  4TVR A;  2NYS A;  3HKS A;  1UUE A;  3CMA Q;  3UF4 A;  3TCJ A;  5KYU A;  2CGH A;  2LMJ A;  2EIF A;  3M0U A;  2VUB A;  4FYX B;  3TVT A;  3CD6 T;  2QI2 A;  4XQ3 A;  3OYJ A;  2CUD A;  1Q82 R;  1E7O A;  1V1C A;  4ELZ C;  2RQR A;  3MP6 A;  3JCM f;  4J9E A;  4RTV A;  1BB9 A;  4OMO A;  2JVV A;  1SEM A;  4E7Z A;  1HD3 A;  3QHS A;  3OBY A;  1NBE B;  3VYH B;  4D6W A;  2XDP A;  1WZO A;  1TSF A;  5FRO A;  4KGZ B;  3H9N A;  5FWC A;  4AG1 C;  4A4E A;  2CH4 A;  2VB6 A;  4IUU A;  1ZX6 A;  4OMF B;  1U3O A;  3OS5 A;  2K2V A;  3UA6 A;  2ZPG B;  3QJ6 A;  1Q81 R;  5GAO l;  2D1X A;  1I5O B;  2LJ3 A;  1YN8 A;  3WVE B;  1AWO A;  4JZ3 A;  3KFV A;  1Q86 U;  3SWN B;  2G6F X;  3GIB A;  1K0S A;  4C92 C;  1WGS A;  3OMC A;  1YHQ T;  5FRN A;  2RHU A;  2YRC A;  2GNC A;  4JUV A;  1RAH B;  3BDL A;  4LDV A;  4M78 A;  1ZSG A;  3ZFJ A;  1MND A;  3QDF A;  3CC4 A;  2IVW A;  2RI2 A;  4N4H A;  3QZ5 B;  4M78 D;  2EGE A;  2YWW A;  1HK9 A;  1VUB A;  1PKT A;  4AFZ C;  2JTM A;  3CXC P;  2CP3 A;  2Y4Y A;  4HA8 A;  3H0H A;  3G6E Q;  4IUP A;  3CCJ T;  3M55 A;  2X35 A;  1OPK A;  3ZEH A;  1WLP B;  4M78 F;  3IQL A;  5KE3 A;  1D1A A;  4M7A E;  2DZC A;  2DIQ A;  2F5T X;  1AEY A;  1JXO A;  2D0Q B;  3THK A;  4C8Q D;  3NTK A;  3RMS A;  1KQS P;  1WX6 A;  5LJ3 d;  2P0Q A;  1ZBJ A;  2DAQ A;  1WHJ A;  1M30 A;  1WQ7 A;  1M4Z A;  2HAX A;  5KH6 A;  5GAN 3;  4HT8 A;  5HK3 A;  2DER A;  2ATC B;  3VV0 A;  3QO3 A;  1VQK T;  3EG9 B;  2KE9 A;  3VS2 A;  2L8D A;  2R5A A;  3KUF A;  5GAO m;  2CP6 A;  2ZPB B;  4LDY A;  2RHI A;  2BZ8 A;  5CKD A;  3BFM A;  1RI0 A;  2XU8 A;  4E7I A;  2EJG A;  3L2Q A;  4E7H A;  1D1C A;  3AT1 B;  1GXI E;  2EBP A;  1N27 A;  1NYF A;  2JMA A;  2JS0 A;  3L2Z A;  2K7A A;  3NTH A;  2D8H A;  2OTJ Q;  4FSX A;  2HNI A;  3MKD A;  3EG3 A;  5L8R E;  3OW2 P;  3ER0 A;  4DA4 A;  2MPX C;  5GAN g;  4D8D A;  1I07 A;  2FRY A;  2CT3 A;  1YI2 Q;  2HL3 A;  3MCA B;  1SKU B;  1PC0 A;  3H8Z A;  2J6O A;  8ATC B;  2VXE A;  2WSF E;  4ME7 A;  2CP0 A;  3P8D A;  2LX7 A;  1J3T A;  1KC8 R;  1VQN Q;  3RIR A;  1QVG P;  2PZ1 A;  3M5A A;  3A5Z B;  2X3X D;  2GFA A;  2AKL A;  1VQ5 Q;  1M1K C;  2AZV A;  1K4U S;  3GOX A;  2LJ0 A;  4C92 A;  3REB B;  4QW2 A;  2JOY A;  4JS4 A;  4OMM A;  1DJ7 B;  1HYO A;  1MHN A;  3CCJ Q;  2LTO A;  4Q5W A;  1S72 T;  3M0P A;  3G6E T;  2CH4 W;  4QQD A;  3CCU A;  2V8K A;  1KQ2 A;  4CC7 A;  3JCM h;  2M0Y A;  3TRE A;  3FIF A;  2J6K A;  1GCP A;  5FW9 A;  1RLQ C;  1IRX A;  3V7C A;  3CCV A;  1WYX A;  3QKJ A;  4RTU A;  4EIK A;  2X51 A;  4L5G A;  4KUD K;  3PNW C;  1BI2 A;  1FX7 A;  2A36 A;  5GMK j;  2JTE A;  5I2M A;  5DY9 A;  3ULR B;  2M9U A;  5LJ5 j;  3QG1 A;  4P5N A;  4M78 E;  2B86 A;  4FYY B;  2DYB A;  5D6X A;  3EFR A;  1KJW A;  3I55 A;  1UHC A;  2QA4 T;  1JU5 C;  2YUN A;  2XID A;  4C8Q F;  5IHK A;  3MP1 A;  2K3X A;  1EX4 A;  2X4X A;  2F69 A;  2MMP A;  4A53 A;  1U8R A;  5KYY B;  1ZSZ B;  1YHQ Q;  1QCN A;  4EMG A;  1BK2 A;  4PJO D;  1SPK A;  3X24 B;  4F7U A;  1K9A A;  1NJI U;  1XNI A;  1YIT Q;  3V7R A;  1QVF P;  4M7A A;  5GMK l;  3QWY A;  1BIB A;  3CCM T;  1UEC A;  4M75 F;  3CCS T;  2HQE A;  4CI0 C;  1NEB A;  1WXB A;  1YCY A;  5LJ5 e;  1T0H A;  1VYV A;  4BDY A;  1SHG A;  4L59 A;  1M1G A;  2RJD A;  3UDC A;  3CCR T;  4XU3 A;  4A4G A;  3LYI A;  4CC4 B;  1TS9 A;  2EKH A;  2KR3 A;  1F1B B;  3VS6 A;  4DBR A;  2ZAE A;  4JRI A;  2RM4 A;  4OGE A;  3X26 B;  4BI8 B;  1M3B A;  4RTT A;  2E6N A;  1WHL A;  1VQ9 Q;  1NEG A;  2QTX A;  1RUW A;  2QTV A;  2PNI A;  2ZZD A;  1OZ2 A;  3R6O A;  4PJO G;  4OB0 B;  5FU7 B;  1YJW Q;  3ZL7 C;  4FL6 A;  4XTV A;  4RMO A;  5IXF A;  2O9V A;  3A1P A;  2QEX T;  2MYS A;  1ZLM A;  5CVI A;  1VQ8 Q;  1GFC A;  2RK2 A;  4GY5 A;  1I5L A;  1I81 A;  3M56 A;  2QEX Q;  1U1S A;  1NLO C;  3QBY A;  4Y28 E;  4EDU A;  3FDR A;  2DL7 A;  2RJF A;  1YJW T;  4BI3 A;  5IT9 E;  2KXD A;  4A4H A;  5HK0 A;  2PU9 B;  4KGX B;  2QQS A;  2LQW A;  4M78 B;  3RES A;  2ZPI B;  1M1K R;  1B7T A;  2YHT A;  1K73 U;  4M7D F;  1NJI C;  1NYG A;  3EFO B;  2NUP B;  2CUB A;  2KYB A;  1IGU A;  1W4S A;  2KRN A;  2YRD A;  3HPW A;  3G71 A;  4LN2 A;  3CCR Q;  2V1R A;  3EFS A;  2XIC A;  4MZT A;  2X4J A;  1LVK A;  3EFO A;  3VYG A;  1WFW A;  3G1J A;  2C06 A;  4PLL A;  2RD1 A;  2P84 A;  1Q82 C;  1VQ7 T;  3HFN A;  1VQ5 A;  4EMK C;  4B9W A;  2DD4 A;  2DJZ A;  2X9H A;  2CP7 A;  3SD4 A;  5KCH A;  3A8M B;  2LNH B;  4WCI A;  1K9M C;  4PJO F;  2KXC A;  1ACM B;  1EIF A;  4VUB A;  4DOW A;  4J7F A;  4UC4 A;  4OMP A;  3RR6 A;  4PJO B;  4X34 A;  5GAO p;  2RHZ A;  2KSS A;  3LWI A;  3MHX A;  4Z89 A;  2HD0 A;  1JJ2 S;  1VQ4 T;  1WDX A;  2YLC A;  3QYH B;  1RAD B;  1KD1 C;  2QGF B;  5FU6 B;  1VQP T;  3HL8 A;  2RI3 A;  5GJV B;  1M90 C;  4KH0 B;  1YJ9 T;  2RO0 A;  2RQV A;  1X6O A;  1H92 A;  5CAI A;  1OPL A;  3UAT A;  2CZ7 B;  3A98 A;  2KGT A;  2Z0W A;  2DF6 A;  3VUB A;  3SWN C;  5GMK e;  1FMW A;  4RCB A;  1D09 B;  2RI5 A;  1EZZ B;  4A4F A;  4C5G A;  1TU0 B;  1ZUU A;  4M75 G;  3CC7 T;  4OMN A;  3OYY A;  2ZGW A;  2DXU A;  1VQO A;  2XD0 A;  1QP3 A;  2GFU A;  4PKC C;  5KYU B;  2JUF A;  4N0A C;  4J9B A;  1W2B P;  1OV3 A;  2L3Q A;  2MIO A;  4ZTF A;  3CCE T;  3L2W A;  3M53 A;  2DTO A;  2O4X A;  3EG1 A;  5LJ5 f;  1W2B S;  2H3J A;  2IPO B;  5HCK A;  1VQO T;  1KSW A;  3OYD A;  4JRQ A;  2MCN A;  1V29 B;  3VS0 A;  1VIE A;  1BI1 A;  2YLB A;  3QYG B;  2O4X B;  3G4S T;  2XHC A;  4IIO A;  1B07 A;  5CKF A;  1Q7Y U;  1MGQ A;  2GF7 A;  5IHI A;  1CKA A;  3EHR A;  4CC3 A;  2LJ1 A;  2O2O A;  4M75 E;  4LD6 A;  2DET A;  1KQS S;  3CPW A;  5GAN 5;  1NZ9 A;  3RER A;  3LH5 A;  4GLK A;  2JM9 A;  1ABQ A;  4KBM B;  3OW2 A;  5M9O A;  1Q7Y C;  4O5V A;  2DRM A;  1CSK A;  2SRC A;  3T9N A;  4E7S A;  4F7U F;  1VQ8 T;  3OSS C;  7AT1 B;  4AFU C;  2QYZ A;  1YJN A;  2OTL T;  4XTU A;  4A4K A;  2QQ9 A;  2DLP A;  1PCX A;  2DZ9 A;  2JW4 A;  3MO8 A;  4IUR A;  3TEE A;  4Y92 A;  2EW3 A;  3MEU A;  1VQ5 T;  1VQ7 A;  3CPF A;  2JT4 A;  3M0R A;  4C92 D;  3REA B;  4N4G A;  1OYX A;  3TSW A;  1PRM C;  2JM8 A;  1QLY A;  2O31 A;  2FZG B;  3G7Z A;  4BE1 A;  5KYY A;  4J7I A;  4KUL A;  2K6D A;  1PWT A;  2CP5 A;  1NPP A;  1OI1 A;  3M59 A;  4HVV A;  1PD0 A;  2KNB B;  3I55 T;  1AWJ A;  2BIV A;  2X4W A;  4R55 A;  1N6A A;  3G71 Q;  5FWB A;  3EAE A;  2YXY A;  1RAF B;  2EQU A;  2DL3 A;  1G3T A;  3TSZ A;  4KT0 E;  1R77 A;  3GNF B;  3UT1 A;  1ARK A;  4XU0 A;  1Q81 C;  4BE2 A;  2R5M A;  3EGD B;  5LL6 S;  4C8Q C;  3EG9 A;  4C0D C;  4RG8 A;  1FYN A;  1VQL A;  4PJO C;  1YIT T;  3J7A F;  1KD1 R;  2FG0 A;  2ESW A;  1Y7X A;  4V2S A;  1EFN A;  3CC2 A;  4RTW A;  2EYZ A;  2LQN A;  1TUC A;  1E6G A;  2LQ8 A;  3I55 Q;  2XMF A;  1IHV A;  1RAA B;  2QAS A;  2XK0 A;  2YUO A;  4EMK B;  4PJN A;  3MEA A;  4FCY A;  4HCC A;  3CXC A;  2E64 A;  3JB9 G;  4YTL A;  2A3L A;  2MWO A;  2Y90 A;  4HKE A;  3VUZ A;  1VQP Q;  2PTK A;  3DKM A;  3M54 A;  4OVA A;  5EG2 A;  1PHT A;  8AT1 B;  1VQ4 Q;  2LDM A;  4C0G A;  2RK1 A;  4FIB A;  1RLP C;  4BI4 A;  4N4I A;  1WI7 A;  1H8K A;  2B8A A;  2DD5 A;  2V26 A;  3DB3 A;  2C0T A;  4EPC A;  5GAN 7;  2F5K A;  5LJ3 g;  5J3B A;  2G3R A;  3CC7 A;  5CKB A;  1QCF A;  2LVM A;  1D1B A;  1WHK A;  3C4S A;  1QMC A;  2CT4 A;  1GCQ C;  2V8I A;  3OMG A;  1PNJ A;  2KI7 A;  4ESR A;  4M75 D;  4BB7 A;  4CC2 A;  1VQ6 Q;  1MMN A;  1MMG A;  3FB9 A;  1I8F A;  2LRQ A;  4M75 A;  3VS5 A;  1MV0 B;  2EYY A;  1KC8 U;  1WJQ A;  1PM3 A;  4R0K A;  4XTZ A;  4FW2 A;  3P8H A;  3S3M A;  2NLU A;  2OJ2 A;  2OX7 A;  3OB9 A;  4JRK A;  4J83 A;  4C0D B;  3JCM P;  3FEO A;  3MP8 A;  2C0O A;  1QKW A;  5LJ3 j;  1YIJ Q;  2EFI A;  1AHJ B;  5KE2 A;  3MEW A;  1K73 R;  3CPW P;  2BUD A;  1U5S A;  1WA7 A;  1MV3 A;  2RF0 A;  1XQH A;  4BE0 A;  4EMH A;  5I22 A;  1N8R R;  4M7D C;  4JLI A;  1H3Z A;  3J81 E;  4J9C A;  3PGG A;  1KK7 A;  2RMO A;  3JCM J;  2PVD B;  3OBW A;  4M78 G;  4N0A A;  2OTL Q;  4M7A G;  5FLX E;  3F70 A;  2DJQ A;  2L3S A;  2OAW A;  3MJX A;  1OQK A;  3C12 A;  3E2U A;  1QKX A;  1M3A A;  2RQW A;  3VS4 A;  1SF9 A;  4PL6 A;  1OU8 A;  1KC8 C;  4JJN K;  2DNU A;  5GAN h;  3FLG A;  1UGV A;  1IB8 A;  2RHY A;  1UGQ B;  2HEQ A;  1UGS B;  2NWM A;  1QP2 A;  4XU2 A;  1YP5 A;  1BI3 A;  1Y96 A;  1TUD A;  4IUQ A;  4PJJ A;  4C92 G;  5A0D A;  1B34 A;  1M1F A;  1KHI A;  2L0A A;  4Y91 A;  3PTA A;  1GFD A;  1XOV A;  1QW1 A;  5I11 A;  1H3H A;  1B3Q A;  3QXE B;  1AT1 B;  2QEX A;  2PQW A;  4HXJ A;  4Z88 A;  2DL5 A;  3JCM V;  1YCS B;  2M0O A;  1AD5 A;  3OQ5 A;  4LUE A;  2LNV A;  1Q86 R;  2GQV A;  3CXC S;  2FPF A;  2E6Z A;  1PSF A;  3RDV A;  1WXU A;  1X69 A;  2L2P A;  3GBQ A;  3PIO A;  2XDD A;  4F14 A;  1BCO A;  5GAN 8;  5GAN f;  2DVJ A;  1SHF A;  3OY9 A;  2BZY A;  2O01 E;  2QQA A;  1G8X A;  2KRS A;  3X20 B;  3UWN A;  3FRN A;  1M1K U;  2OTJ A;  3LH0 A;  2K2M A;  3JCM b;  4JZ4 A;  3PE0 A;  5KCO A;  1UEB A;  1SSH A;  1O75 A;  4HT9 A;  1M8M A;  3OYL A;  5KYW B;  2K9G A;  2YUQ A;  5D7U A;  2K4Y A;  3GNG A;  2KY9 A;  2E12 A;  2ZPH B;  4C0F A;  2R58 A;  1D3B B;  2HMA A;  4KGV B;  3JCM X;  3I5R A;  1UFF A;  3EG0 A;  4XK8 E;  3OSV A;  5J26 A;  1V76 A;  3CCS A;  2QQB A;  3RMQ A;  2RQU A;  9ATC B;  4ELY C;  3O5Z A;  4GLM A;  4II1 A;  4PK4 A;  1D3B A;  2NUP A;  3L42 A;  3OW2 S;  2DA9 A;  5FU7 C;  5FU6 C;  1G3Y A;  2L5Q A;  4D8K A;  3I56 A;  1ZUK A;  5CO7 A;  3D7S B;  3JB9 I;  2OI3 A;  4JPB W;  4ORZ A;  3OYE A;  1W70 A;  3E9G A;  2R57 A;  1ZHI A;  1VQK A;  3HSB A;  2X3W D;  2D8J A;  4XU1 A;  4M77 C;  1MUZ A;  2HKN A;  1QWE A;  1GBR A;  1WXT A;  4C5H A;  5LJ3 f;  1VQM A;  3JV3 A;  3CCV Q;  1VQ9 T;  1IRE B;  1M27 C;  2A0F B;  2MF2 A;  2ZPF B;  1K8A R;  2QDL A;  5IHN A;  3TQ7 P;  3PMT A;  2KT1 A;  1JB0 E;  3EGD A;  4Z8A A;  3CCU T;  3OS1 A;  1VA7 A;  2E65 A;  2K57 A;  4PNO A;  3G6E A;  3M0S A;  3OA6 A;  1KQ1 A;  4OGC A;  3WXM B;  1VQN A;  1OX8 A;  3CME Q;  3EH1 A;  1HJD A;  1BCM A;  1Y0M A;  2BZX A;  1UGP B;  3O8V A;  1I0C A;  2HBP A;  2EQI A;  1PSE A;  4DBQ A;  1I4K 1;  4FYW B;  5I2S A;  3LWH A;  5GAO r;  2E3I A;  2LX9 A;  2FEI A;  2VXF A;  2HQX A;  4EMK A;  2GGR A;  4ZTJ A;  4F17 A;  1G3W A;  1RL2 A;  5HY6 A;  2LCL A;  3PFS A;  2E41 A;  2J05 A;  1BKB A;  3HRU A;  2RA2 A;  1VQ9 A;  3HP9 A;  5GAO q;  1KD1 U;  2DXC A;  1K1Z A;  2E5Q A;  1LOJ A;  5EC7 A;  1M2O A;  3JAM E;  4RTY A;  4OMQ A;  4OF1 A;  3INZ A;  5C6S A;  1ZA1 B;  5GAM h;  3JCM W;  1AWW A;  3I56 T;  5DM7 R;  1D0Z A;  5I21 A;  2DIL A;  2FVU A;  2HZY A;  3JSC A;  3JCM g;  2ECZ A;  2VYT A;  3GP8 A;  1NLP C;  2CZ6 B;  1U06 A;  1JRI A;  5CKH A;  2EGC A;  2J06 A;  5KYX A;  1YWP A;  1W2B A;  1VOM A;  4PJL A;  1P92 A;  1VQ6 A;  3CD6 A;  1XJW B;  2FO0 A;  2JS2 A;  3JB9 H;  4M7A D;  3OYN A;  2DIG A;  1QCO A;  4AT1 B;  3C94 A;  4XTY A;  2VC8 A;  1JO8 A;  5IN1 A;  5KYX B;  3JCM Q;  3M9Q A;  3L2R A;  2EQK A;  3PT9 A;  1NPR A;  3E9F A;  3S3N A;  1X75 C;  2E10 A;  1UB4 A;  2RH2 A;  4PFP A;  3SEM A;  1NE8 A;  4OB2 B;  2FPD A;  2OTJ T;  1WNL A;  1RAB B;  2A08 A;  3URG A;  4WTO B;  1BYM A;  2X4Y A;  2VGM A;  2RJC A;  3ASK A;  4RUG A;  3CCJ A;  5GAM g;  1M90 R;  4LUD A;  5GMK m;  4M7D G;  4HVU A;  1N8R U;  4ZGD B;  1SSF A;  2O9S A;  3NMZ C;  2HDA A;  2DTI A;  1Z9Q A;  1LJO A;  4XAX B;  4IUV A;  3H6Z A;  3H0F A;  5GAN d;  3R6N A;  4M77 F;  5CR2 A;  3RKY A;  3LGF A;  4MMK A;  2CSQ A;  5LJ3 h;  1ZSZ A;  2EKO A;  5DLO A;  1C6V X;  4F7U B;  5GAM d;  3H41 A;  3RKX A;  1Q95 G;  1VQN T;  3RUX A;  1TXQ A;  1TH7 A;  2P4R A;  3CD6 Q;  4J9F A;  2K5F A;  3JRZ A;  2RNA A;  4JDS A;  1WHG A;  2LQK A;  2YDL A;  4J9I A;  2KAF A;  4J6X A;  3HFO A;  2XDB A;  2QAZ A;  3I5S A;  3CCQ A;  2RPN A;  2F1L A;  2DMO A;  4F16 A;  2ABL A;  2MOX A;  4F04 B;  3FJ5 A;  2K5I A;  4MZP A;  2DYI A;  1AVZ C;  2V1Q A;  2D6F A;  3H0I A;  2KT8 A;  4ANJ A;  4ATO A;  2QG9 B;  1YWO A;  2VAS A;  1JJ2 P;  2M02 A;  2ROL A;  3HRS A;  3RNJ A;  2XG8 D;  3CBP A;  3E19 A;  1K9M U;  2BTT A;  4B9X A;  3CC7 Q;  4PFZ A;  5IAY A;  3G4S Q;  1Q7Y R;  4J6Y A;  1YJN Q;  2VKN A;  4C92 B;  2MK5 A;  3LGL A;  1UTI A;  1BU1 A;  4C8Q E;  2EGA A;  4LNP A;  5GAM f;  2BKD N;  4DBH A;  3CMA A;  3V7S A;  4HVW A;  2DM1 A;  1VQK Q;  2L89 A;  3X28 B;  2HSP A;  4OP0 A;  2JNG A;  4E7K A;  3DLL A;  2E70 A;  2ED0 A;  1N8R C;  2CS7 A;  3BE3 A;  4NOY A;  1K9M R;  4KH1 B;  4F7U E;  1OOT A;  3A8H B;  2WAC A;  1FXX A;  1X01 A;  1VQO Q;  2BE9 B;  3OYH A;  4PLI A;  3QSU A;  4J9D A;  1SRL A;  1W1F A;  2M1H A;  2DEU A;  4OML A;  3CCE Q;  3CME T;  2KK4 A;  1R0C B;  1MMA A;  2HCK A;  1Q81 U;  5HKC A;  4LDX A;  4GBQ A;  2CRE A;  3CCU Q;  2FB7 A;  1KG1 A;  5KYN A;  1ZSZ C;  4O6J A;  3G4S A;  5CK9 A;  3SHW A;  2AT1 B;  1IGQ A;  1HSQ A;  4JJC A;  4ZN1 A;  2LT4 A;  3A8L B;  2P0P A;  2VWF A;  1H64 1;  2JN0 A;  2DK3 A;  3VJP A;  4KUI A;  2JZ2 A;  2QK0 A;  3CQT A;  1ZQ1 A;  1TUG B;  3HHT B;  4C5I A;  2JJ9 A;  4QQG A;  3VKI A;  2WSE E;  4MZM A;  1QQJ A;  1JXM A;  3CCQ Q;  2VVK A;  2YSQ A;  3LW5 E;  1VYU A;  1I1J A;  1R8O B;  5GAO n;  1WHH A;  1PRL C;  2QDY B;  3M4Y A;  2GTJ A;  1MNE A;  5J39 A;  1VQ7 Q;  2W10 A;  1E6H A;  3JB9 D;  3CBM A;  4FT2 A;  4M4Z A;  2F2X A;  1Q82 U;  4BUG A;  2LZ6 B;  3MEV A;  4R56 A;  2P4T A;  2O88 A;  1Y96 B;  1C1A A;  3SDZ A;  5D6W A;  1UE9 A;  1QWF A;  3GF5 A;  1YIT A;  2E3H A;  1VQL T;  2OAU A;  4X1V A;  3I9Q A;  1LCK A;  2M51 A;  3NFC A;  4HCZ A;  2RB6 A;  3A8G B;  3OYI A;  3C0C A;  2KEA A;  2CYZ B;  2QXF A;  1FMK A;  5D6Y A;  1WPY A;  2EWN A;  4RG2 A;  2ED1 A;  2JXB A;  4A63 B;  1TTH B;  4K11 A;  2J6F A;  4NL3 A;  2W0Z A;  1X6B A;  1RI9 A;  2E5K A;  5GAM e;  4ZNX A;  1OX9 A;  2GBQ A;  3CCL T;  2DVE A;  4X9D A;  5GAN 4;  4NS5 A;  4BY6 B;  1OEB A;  1YJN T;  2OTL A;  2HQH A;  2IIM A;  1HXD A;  1JBM A;  2VV5 A;  4LDW A;  3Q1J A;  1WJS A;  2NUZ A;  3SWN A;  3GPL A;  1AWX A;  1ZUY A;  4RCC A;  2I2L A;  3CC4 Q;  3OYG A;  1GRI A;  4LDU A;  3OYF A;  5KYW A;  4PJO E;  2KYM A;  2BE7 D;  2COY A;  3CCM Q;  2H3E B;  3QPH A;  2FYK A;  1X2K A;  3VU3 C;  1TOV A;  2LC4 A;  4X9C A;  2DTH A;  1NM7 A;  3OYC A;  1KQS A;  2EQJ A;  1PG5 B;  4RKU E;  3WVD B;  1YIJ T;  1VQ8 A;  2KMT A;  5GAM j;  2SEM A;  3VRZ A;  1K8A C;  2HSE B;  1TG0 A;  2KVQ G;  1OZ3 A;  5GMK h;  3N5B B;  3C95 A;  3BW1 A;  5L23 A;  1YJW A;  2L3P A;  5LJ5 h;  1XTD A;  3OYB A;  1KFZ A;  2EYX A;  1RAE B;  1M5Q 1;  2DXB A;  1K8A U;  3M0Q A;  4QQ6 A;  1G5V A;  3FJP A;  2QGG A;  1YFN A;  4E2F B;  3CCS Q;  1YBY A;  1U1T A;  3I35 A;  2KQW A;  3NGP A;  4PJO A;  2EYW A;  2GQI A;  4M77 B;  2AK5 A;  2DL4 A;  5IXB A;  4NL2 A;  2FZK B;  3QII A;  1JQQ A;  4E6R A;  1R0B G;  5CKE A;  2COZ A;  1FMV A;  1YIJ A;  4M7A F;  1QVG A;  3CCE A;  3CC2 T;  3RKW A;  4JLG A;  5CIU A;  2QQR A;  4MDW A;  2CZ0 B;  1Z9Z A;  1YJ9 A;  4E7J A;  1C0M A;  3OS2 A;  2J7I A;  3LLR A;  3M4G A;  1VQP A;  3OYM A;  1RAI B;  5GAN j;  3EG2 A;  2D9T A;  2K3B A;  1WHM A;  2FRW A;  4F7U G;  4ZGJ B;  1KIK A;  2EJF A;  1UHF A;  4JJD A;  3M58 A;  3P8B B;  3S6W A;  2YT6 A;  1UJY A;  2DKG A;  2DPP B;  3CCR A;  2F2V A;  4XTX A;  4J8O A;  5GAN e;  1ABO A;  1UG1 A;  4FM4 B;  3X25 B;  3EHQ A;  2DBK A;  1BIA A;  3A8O B;  2LCC A;  2QA4 Q;  4HCB A;  1RAG B;  1AZG B;  2A37 A;  2K79 A;  2EQM A;  5CQY A;  2PUO B;  1YI2 T;  3OS0 A;  5C0M A;  1G3S A;  3RBB B;  4FT4 A;  1N9R A;  2A28 A;  2DL8 A;  3BDU A;  4RTX A;  3MPU B;  3BY7 A;  3MET A;  1JJ2 A;  3CC2 Q;  3CCL A;  4M77 D;  1WQW A;  1IZ6 A;  5FRM A;  1X27 A;  4FYV B;  4J9G A;  1YI2 A;  2CP2 A;  2EJ9 A;  3CEY A;  1T0J A;  2P0K A;  4MML A;  3G71 T;  4MDX A;  4QVD A;  4C92 E;  2MAM A;  3M57 A;  2ZPE B;  2GCX A;  1UJ0 A;  1VYT A;  3I56 Q;  2MWP A;  2KBT A;  1A0N B;  2AHJ B;  3VS1 A;  3ME9 A;  2V8J A;  3KXT A;  3EH2 A;  3M0T A;  2DRK A;  4BD3 A;  3TU4 K;  1YNZ A;  3LX7 A;  2DXT A;  3PVL A;  4A54 A;  2HKQ B;  4IIM A;  1TWB A;  2PVO B;  3EGX A;  5AYF A;  1VIF A;  4M75 B;  4OB3 B;  4DEX A;  1S72 Q;  1T3S A;  4JS5 A;  1QVF A;  3UA7 A;  1ZA2 B;  4J6W A;  1M3C A;  5GAN 6;  4OB1 B;  4LD9 K;  2GTO A;  4CRI A;  2MI6 A;  1NJI R;  3QJY A;  3EGX B;  2CKK A;  4DEY A;  2DX1 A;  2E4H A;  5CCA A;  1G2B A;  4RTZ A;  3ZBD A;  2CZ1 B;  4E47 A;  3S3O A;  5AT1 B;  3CME A;  4QVZ A;  1O9S A;  4J5Y A;  1SG5 A;  1BI0 A;  1NG2 A;  2Y4X A;  4AFQ C;  3JB9 F;  4XTW A;  2C0I A;  3QDR B;  1X43 A;  1WIE A;  3VS7 A;  2DO3 A;  5GJW B;  1QVP A;  5A0L A;  1UDL A;  3OYA A;  2EAY A;  2YUP A;  5A0G A;  4DOV A;  1Q86 C;  4BAC A;  2FL7 A;  4C0Z A;  1X6G A;  1M9S A;  4C5E A;  2LP5 A;  6AT1 B;  2WSC E;  1D0Y A;  1D0X A;  1SRM A;  2COW A;  4DQ2 A;  4IUT A;  4M7D B;  2DE0 X;  1JEG A;  3CCM A;  1GBQ A;  4AG2 C;  3HRT A;  2EVR A;  1X2Q A;  4JRP A;  1VQ4 A;  2H8H A;  2RHX A;  4QT7 A;  4M77 E;  4E7L A;  1MMD A;  4C8Q G;  3AHU A;  2PVG B;  1ZBX A;  4WF2 A;  1OU9 A;  3JCM c;  4M7D A;  1T3L A;  3V8L A;  1B34 B;  2L3R A;  3NHN A;  2K3Y A;  2KRM A;  3JCM d;  2QA4 A;  4FU6 A;  2ENM A;  3L2U A;  4J9H A;  5LJ5 g;  1GCQ A;  1OUL A;  3DB4 A;  2HL5 C;  2NUT A;  4DBF A;  2K5L A;  1KHC A;  3U23 A;  3CBO A;  2XI9 A;  4FSS A;  3J80 E;  5DLQ E;  3CCQ T;  2AZS A;  2CDT A;  3NPF A;  4BY6 C;  5GMK i;  1G83 A;  3JB9 J;  3CCV T;  4C92 F;  1UGR B;  4LXC A;  2YRV A;  1YJ9 Q;  3SB2 A;  2NUT B;  2RN8 A;  3L2V A;  5CQX A;  1Y71 A;  4KRT A;  5GAN 2;  1Y57 A;  4L6V 5;  1FWZ A;  3VS3 A;  5LJ3 e;  5LJ5 d;  1AZE A;  4QVC A;  2CSI A;  3KBG A;  4HCK A;  3CC4 T;  2LCS A;  3JCM e;  2HBW A;  2PUK B;  3QZ9 B;  1M90 U;  2AKK A;  4M78 C;  4BDZ A;  1YHQ A;  2RQT A;  3L1A A;  3PMI A;  2D0N A;  3HTR A;  1K0X A;  2F2W A;  2VGN A;  2DBM A;  3DLM A;  1M8V A; 
#chains in the Genus database with same CATH homology
 2E4H A;  2CP6 A;  2Z0W A;  2CP3 A;  1TXQ A;  2CP0 A;  1LPL A;  1WHJ A;  2COW A;  4B6M A;  1WHG A;  1WHH A;  3E2U A;  2CP5 A;  2E3H A;  3TQ7 P;  2HQH A;  2CP7 A;  2CP2 A;  2MPX C;  1WHM A;  2E3I A;  2M02 A;  2HKQ B;  2HL3 A;  2HKN A;  2COY A;  1IXD A;  1WHK A;  2COZ A;  3RDV A;  1WHL A;  2QK0 A;  2HL5 C;  1TOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...