2HL3A

Crystal structure of the a49m mutant cap-gly domain of human dynactin-1 (p150-glued) in complex with human eb1 c-terminal hexapeptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hl3A00
3E2UA 2CP7A 1WHJA 2CP2A 2E3IA 2COYA 1TXQA 1WHHA 2HKNA 2M02A 3RDVA 2MPXC 1TOVA 3TQ7P 2CP0A 2COWA 2Z0WA 2COZA 2CP3A 1IXDA 2CP6A 2HKQB 1WHGA 2CP5A 2HL3A 2HL5C 1LPLA 4B6MA 2E4HA 1WHKA 1WHLA 2HQHA 2QK0A 2E3HA 1WHMA
chains in the Genus database with same CATH superfamily
4BE1A 1G3WA 1UGSB 3CPWP 2ROTA 1TXQA 1N9RA 3GF5A 2DYIA 2JM8A 5KYWB 3CCQT 3INZA 1VQ5T 3OYHA 4M78G 2DVEA 1Y0MA 4WCIA 3LX7A 3PTAA 4D8DA 1YNZA 1RI0A 1WJSA 2RO0A 4LDVA 1LVKA 2KRSA 2FHDA 3REAB 1QVFS 1V1CA 2CKKA 4HCZA 4F14A 5GMKh 3PVLA 3OBYA 2QXFA 1ACMB 1M1GA 2GNCA 3EGUA 1NE8A 2VC8A 3MP6A 4A53A 1H3ZA 2FPEA 2LJ1A 2LT1A 3FJPA 4M7AG 4DQ2A 4M78A 3BFMA 2M51A 1WQWA 5LJ5j 3SB2A 2O4XB 2RHYA 1GCQC 1PHTA 3UF4A 2QQAA 2I2LA 1ZX6A 3J7AF 4M7DC 1FWZA 3JCMQ 1QP2A 4HT9A 4XTZA 4M77B 1FYNA 4E7LA 1VQMT 2E6ZA 4DEYA 2JM9A 3V7CA 3X25B 3VRZA 1I07A 3CC2A 1VIFA 4BY6B 1M90U 4IUQA 4XU0A 4M7DG 1YCYA 2V8JA 1FMWA 3CBOA 4J5YA 2XMFA 3GIBA 1W2BA 2EVRA 4E7ZA 2JTEA 5I22A 4MZMA 1N8RC 2L3QA 2D0QB 2E70A 1Z9ZA 2NUPB 1K9MC 2EYXA 2JW4A 1M9SA 1GCQA 2CH4A 3MEVA 3MEWA 4OB3B 4C5IA 1MHNA 2K7AA 4Y28E 4M7DA 3EGXB 4C92E 3OS1A 2ZCFB 1AHJB 2ZPIB 4JJCA 1E7OA 1WPYA 3C0CA 2Y4XA 3MCAB 2KNBB 3EG1A 4C5HA 1BI0A 1VQKQ 3NMZC 4C92F 2EQIA 2DBKA 5FRMA 2J7IA 4AMCA 1W2BS 3G6EA 3VYHB 1YJ9A 1VQ6A 2DTIA 3OYAA 2KQWA 3OW2A 1Q7YC 3VRYA 4NL3A 3OYJA 2DEQA 4N4GA 1X75C 1N5ZA 2V8IA 1WHKA 2RB6A 4C5GA 5IXFA 4F7UE 3JCMf 5LJ5d 2HQXA 3CBPA 2D9TA 2ATCB 2YRDA 1IO6A 2K6DA 2PVDB 4RKUE 2CP5A 3R6NA 4A4FA 4OB2B 4F7UF 5GANg 2YXYA 1QVFP 1WJRA 3T9NA 2DYBA 5D6XA 2WSEE 1MV3A 3JCMb 4PLIA 7AT1B 1UB4A 2O01E 3OYYA 3QSUA 1NYGA 1VYUA 4DOVA 2XIDA 2FZKB 1SG5A 1NG2A 1O9SA 1UHFA 2NUTA 4A4KA 2ZZDA 1N8RU 2GCXA 3RBBB 2LJ0A 3BY7A 1G3SA 1K9MU 1YJNA 3GBQA 3TCJA 2EGCA 2KYMA 5FROA 2RQTA 4E47A 1VQ4A 3VV0A 1B7TA 3M0TA 3DLMA 4QQDA 1WHMA 2Y4YA 1VQKT 3BW1A 3BDLA 1YJNQ 8ATCB 2VV5A 4BI4A 2QDYB 2E1HA 1WXUA 3PNWC 1Q81R 4A54A 4EMKC 1TWBA 1VQ4Q 4WF2A 1IREB 3NTIA 1BI3A 2PVGB 3JCMP 5LL6S 4C0ZA 4II1A 1Q7YU 3QG1A 1I5LA 5KE3A 2LTOA 1YWPA 1UJ0A 2L3SA 1BBZA 1FMVA 5CKFA 1GFCA 2JS2A 2XDPA 5FRNA 2ED0A 4DOWA 3CMEQ 1ARKA 4B9WA 1T3SA 3L2RA 3OQ5A 2VVKA 1M3BA 5GMKl 1G83A 4C92C 1V76A 4D6WA 3L2WA 1M1KU 5LJ3g 5CKEA 2LRQA 1UDLA 1D0ZA 2IPOB 1LCKA 4XU2A 3MP1A 1RADB 2OTJA 5FU6B 3CC7A 2A37A 1B34A 3CCRA 1K73U 1ABOA 4N4HA 4LXCA 3O5ZA 1TUDA 4EMKA 2PUKB 2HDAA 1W2BP 3WVDB 3OYKA 2COWA 2QQ9A 3A98A 3PIOA 5GMKj 2OTJQ 3GNFB 2HEQA 3CC7Q 3FDRA 5FW9A 2BZ8A 4C8QD 2DPPB 1VQ8A 3JAME 3CCMA 2K3BA 1QWFA 3CCRQ 2HBWA 1MUZA 1I1JA 2I0NA 5KYUA 1ZUKA 5IHKA 3LLRA 3FIFA 5GAOm 2CDTA 3GNGA 4LD9K 2ABLA 4QT7A 2X4YA 3I56A 4C92A 1UFFA 1K0SA 4FIBA 2H3EB 4RCCA 1B07A 1VQ8Q 3CCVQ 3HHTB 2NLUA 3CCMQ 1VOMA 3P8HA 4ELZC 2CP6A 3EH2A 4HCKA 2EIFA 1NEGA 1H8KA 2DD4A 3GP8A 1YJNT 1HYOA 3CCUA 2E3HA 5CKDA 2FEIA 2LQ8A 4A4GA 4F04B 4BACA 4JLGA 4KGZB 1VQ4T 1U5SA 4DBRA 3I56Q 2OAUA 1M2VB 2VGNA 2KEAA 2FRWA 4QKUA 3OW2P 2QEXA 2EYWA 4ME7A 2QTVA 2BE7D 1LJOA 2KSSA 2X3WD 4B6MA 4VUBA 3EGDA 3AT1B 1IHVA 2LCCA 4FYYB 2MWOA 3CMET 4OMMA 1VA7A 2YUQA 2BZYA 3RESA 3I35A 3CPFA 4Q5WA 2LCSA 5C6SA 2QEXQ 2ED1A 1VQOQ 2J6OA 1Q82U 4CRIA 2KY9A 1SKUB 4ZTFA 2M0OA 4N0AC 4RTXA 2QGFB 1M30A 1QW1A 2DA9A 3GOXA 4M75C 3JCMW 1KJWA 2RMOA 3EG9B 3META 4M78E 2CUBA 3CQTA 1SSFA 1YIJA 4DBQA 1G2BA 1X2QA 2ZGWA 2M02A 2OTJT 2EFIA 3ULRB 3CC7T 4OB1B 1Y96B 2AK5A 5D6YA 2JTMA 1JO8A 4J7IA 2XDDA 4DA4A 3CCRT 2DZ9A 1ZA2B 1PRMC 4E7IA 4M78F 4J9HA 5HK0A 2FPDA 3VS4A 1YIJQ 1YITA 3BDUA 1MMNA 1OZ3A 2FVUA 4L59A 3SFMA 1KK7A 2DRKA 2EWNA 4M7AE 1FMKA 2X4WA 4PJLA 2DERA 4C8QB 5GAN8 1K8AC 1QQJA 2L89A 5CVIA 1Q86C 2PNIA 3MJXA 3RNJA 3KBGA 4BE0A 1VQ8T 1KQ2A 3CCMT 3S3OA 1MNEA 5FWCA 1YFNA 1D3BB 4N0AA 2NUTB 4J9BA 4M75A 1YITQ 1XNIA 3JCMg 1TG0A 1X27A 2DK3A 4M7AF 1S72Q 3I56T 5GAN7 1X6OA 2AZVA 4JPBW 1ABQA 1RUWA 3HRUA 1NJIU 3OYDA 4OMOA 4E7SA 5GANf 2A7YA 2CH4W 3QYHB 3VUBA 4CI0C 3CCUT 5GAOr 4M7DE 3FLGA 3FRNA 3CCQQ 1ZBJA 3H0FA 1M27C 5CKBA 1JRIA 3QWYA 2MWPA 5GAN3 5KH6A 2D1XA 1MGQA 3DLLA 1YJWA 3L2ZA 2QEXT 4BI3A 1V29B 2RF0A 2F69A 3UA7A 4GLMA 2BE9B 3V7RA 4M7DF 1AVZC 2YUNA 3OYNA 4AFUC 2DL8A 4FSXA 2YUOA 1YJWQ 2MAMA 3HTRA 4RMOA 1BI2A 1VQNA 1RAFB 3QZ9B 2QK0A 3CCLA 2D8JA 4PL6A 3TREA 4CC7A 1EX4A 2R5AA 1VQNQ 1YIJT 4CC2A 5D6WA 1WQ7A 3JCMV 2XKOC 4LE9A 2JMCA 2CYZB 3M58A 3KXTA 2DNUA 4FT4A 1VQMQ 1M90C 2L0AA 2RA2A 1C0MA 3UDCA 1SRLA 1K8AU 2DFUA 1Q86U 2LJ3A 1YITT 4J6YA 4ORZA 1N9SA 1R8OB 2VB6A 3NHNA 3RIRA 3A8OB 1OI1A 3EAEA 3JCMX 2QASA 2KE9A 4XU3A 2QA4A 3OYCA 2GFUA 1M1FA 2C0OA 4XTUA 5LJ3f 1OPKA 3SDZA 5FWBA 3HRTA 3LW5E 5D7UA 3D7SB 3PVQA 3VS3A 2VKNA 5LJ5e 2EAYA 4JJBA 1PM3A 4BDYA 1PCXA 3EG0A 1D09B 5GAOl 3TEEA 2QA4Q 1IB8A 1LNXA 5M9OA 5GAOp 2MOXA 4FYVB 1B3QA 2ZPEB 3RKWA 4WTOB 2V8KA 2HMAA 3FB9A 1GFDA 3A8MB 5GAOn 4M7AC 1YCSB 2KXDA 5DLOA 3M0UA 4ATOA 5GMKm 2XDBA 2K2VA 3M57A 2DE0X 1YJWT 1AWOA 1QCOA 5IH2A 2K79A 2YDLA 1UECA 3V8JA 5A0LA 1K9AA 5GJVB 3EGDB 4F7UB 2DXUA 2RK1A 1PSEA 1X69A 2VXEA 1KFZA 4F17A 2KAFA 5A2QE 3ZFJA 1KC8R 5GAMg 3QHSA 4UC4A 2EYQA 3M0PA 2K3XA 4X34A 4LDXA 1VQNT 2LNHB 3QO3A 2A3LA 2CP0A 4LD6A 4IUPA 1WFWA 3QUIA 4LDWA 1KD1C 2F1LA 3CXCS 5KYYB 5CKHA 1RLQC 4M7AA 2CP7A 3E9GA 5A0DA 1KQ1A 4QVCA 1PKSA 4MDWA 4QQ6A 3M55A 3QPHA 2X9HA 2ESWA 1JXMA 2LNVA 2O2OA 4A63B 3CEYA 1D1CA 3OYMA 3CC2Q 2LT4A 1VQ9A 3SEMA 2CZ0B 4OVAA 2DILA 4C0DC 1TUCA 1UHCA 1U1TA 2QA4T 2C06A 2QDLA 3CBMA 3L1AA 1UTIA 5HCKA 1OZ2A 3PE0A 4ZN1A 2F2WA 4P5NA 2XU8A 1JEGA 1VQ9Q 1SRMA 2HKQB 3OS2A 1X6GA 2DF6A 2LP5A 2F5TX 1QMCA 4XTVA 1AT1B 1KIKA 4FCYA 2HAXA 5GANh 1WGSA 2JJ9A 2J6KA 3VS2A 2K57A 4PFZA 1RI9A 2P0QA 3CCEA 2P0PA 1M5Q1 1NPPA 2DD5A 2E41A 4OGCA 4EDUA 5I11A 2DXTA 3E1SA 3VKIA 4FL6A 4R56A 1PD0A 2G6FX 5C0MA 3KFVA 2FB7A 1JXOA 2DL3A 2KR3A 3RERA 3SD4A 3VS0A 4M78D 3I55A 1JU5C 3L2UA 2K5FA 3G6EQ 3CCEQ 2D8HA 4ZNXA 2B86A 1YJ9Q 1VQ6Q 3CCSA 1JJ2S 1M1KC 3CC4A 2Z0WA 2CSIA 2M1HA 2M16A 2AKLA 2EQJA 1U3OA 1OU8A 4C0FA 2LX9A 2DL5A 5GAN5 1I5OB 5KE2A 4FSSA 4E7HA 4OF1A 3OYLA 4CC3A 1KD1U 4K11A 1ZSZC 2CREA 3V8LA 4C8QG 3I55Q 1K73C 2GFAA 3CCSQ 3OYEA 4XQ3A 1PG5B 1VQPA 2KROA 2E5QA 2FPFA 2GF7A 2JUFA 1KHCA 3CC2T 4V2SA 5DM7R 1ZA1B 1Y7XA 2HQEA 3I5SA 2EQUA 1VQPQ 2DJQA 2MCNA 3SWNC 5GAN4 1M4ZA 3JCMd 1VIEA 3OYFA 3OYIA 1DJ7B 1VQ9T 1Q81U 2RQRA 2LCLA 2V26A 4QW2A 4JZ4A 1X6BA 4M75E 5LJ3h 4M7DD 4B9XA 4KUDK 1ZSZA 3ZBDA 3PFSA 2KVQG 4Y91A 2PQWA 3P8DA 1H641 1YBYA 4FW1A 3L42A 4RTZA 5DY9A 1H92A 4RG8A 5L23A 1X01A 2OAWA 1N8RR 4M75F 3X28B 1C6VX 2RJCA 2GGRA 5GMKe 3QJYA 2C0IA 1K9MR 3SWNA 3E2UA 2XK0A 4GY5A 3G6ET 3CCET 1YJ9T 1VQ6T 5GAOq 3CD6A 1MMGA 1Q82C 2KI7A 1YI2A 1AWJA 1PRLC 2QQSA 4OMPA 2E5KA 2MIOA 3VS5A 2EW3A 4O6JA 4M78B 3PMTA 3G4SA 3RR6A 4LNPA 4IIOA 2OJ2A 3I55T 1K0XA 1JB0E 4ESRA 1RAIB 3CCST 3ASKA 2RHIA 3OBWA 4KGVB 1YI2Q 4PJOG 2AKKA 2QQRA 3GLXA 1PD1A 5FLXE 4D8KA 3M54A 4JDSA 2MF2A 2VXFA 3G4SQ 2OTLA 3C95A 3M0SA 4AT1B 3EFRA 2YSQA 1VQPT 2K9GA 4HXJA 2KXCA 4M7AB 4KGXB 5KYNA 2RPNA 1IGUA 4LDUA 5GJWB 3G71A 2X35A 2YRCA 3UT1A 1ZUYA 1HJDA 5IXBA 2OTLQ 1RABB 5GAMf 1YHQA 4J9EA 3RKYA 2NYSA 5A0GA 1W4SA 5IT9E 2IG0A 5CIUA 2PTKA 1NJIC 3C94A 2HKNA 1BI1A 4DBFA 4M7DB 2DX1A 5KYWA 2CP3A 1PC0A 1IXDA 3H41A 3A8HB 2DETA 2KGTA 3CCUQ 2DVJA 1G3TA 1ZSGA 2RHXA 1SEMA 4M77C 3E9FA 1WXTA 4A4HA 4Z88A 2KRNA 1K4US 4A4EA 1NM7A 1X2KA 4BY6C 2DTOA 2LC4A 2R58A 4M77G 3LYIA 4E7JA 2CUDA 2LZ6B 5GAMd 2EBPA 4HA8A 1YI2T 1XTDA 4ZN3A 2SRCA 4MMLA 4ELYC 5KYXA 1E6HA 3JB9G 3JCMh 1SHGA 1UEBA 2DKGA 3A8GB 2HSEB 4J8OA 1UGVA 2DL4A 2YUPA 1WIEA 3G4ST 2FZCB 4DBHA 2QI2A 5GANj 1QKXA 4L6V5 4JS5A 1HK9A 1TS9A 1M8VA 1QVPA 4OMLA 4Z89A 4M77A 3V7SA 2X51A 5IN1A 2L3PA 2OTLT 3G7ZA 4J83A 2DXBA 2JN0A 1NZ9A 3S3NA 4HT8A 4BD3A 2RQWA 3RDVA 2XD0A 1UJYA 1XOVA 3A1PA 1FX7A 1BK2A 1U8RA 3EFSA 4IKFA 3JCMc 2MYSA 3HRSA 1OV3A 2WACA 4E7KA 2MI6A 3OMGA 4PNOA 3NTKA 2E4HA 4C92D 3TQ7P 4PJMA 1WA7A 3M56A 3QYGB 1WYXA 2E65A 2DL7A 2NUPA 3MO8A 4BE2A 2QAZA 3VS6A 4PJNA 1I8FA 3LGFA 4R55A 3EGXA 1GRIA 4J9IA 1TH7A 3HL8A 4J6XA 2F2XA 2VGMA 3CMAA 2LQNA 3Q1JA 2LX7A 1AZGB 1AOJA 3J80E 1RL2A 2Y90A 1R0BG 2JTFA 2JOYA 5CO7A 2CT3A 5GAN6 2E3IA 2ZAEA 1NEBA 2EGAA 3O8VA 3VUZA 3PT9A 3CMAQ 4ZTJA 3TVTA 5HY6A 2DTHA 2EJ9A 1LOJA 1S1NA 3OB9A 1JBMA 2DRMA 5LJ3j 3EFOA 4M4ZA 1D1BA 3OS0A 2JS0A 2DJZA 3QBYA 1T0HA 2EJGA 2F5KA 3MP8A 4QQGA 5GANd 2QYZA 1G8XA 2HSPA 2P0KA 1YN8A 5I21A 3OSSC 5FU7C 4NL2A 1XQHA 2L5QA 2EPDA 3CCLQ 1W6XA 4EMHA 2PU9B 1B34B 3TSWA 2RH2A 1QP3A 4EMKB 4N4IA 3ER0A 4PJJA 2DO3A 3S6WA 1GXIE 1BB9A 5IHIA 1TOVA 2L3RA 3VU3C 2DEUA 1SPKA 2VWFA 4HVVA 4JRKA 4PFPA 1K1ZA 5KYUB 1WDXA 2DBMA 3DB3A 1J3TA 2XICA 4KBMB 2DZCA 4M75D 1QVGA 3LWIA 4ZGDB 1IZ6A 1N6AA 4C92B 4C8QE 5GAMh 1RAGB 1OOTA 3I9QA 2K2MA 5EG2A 2H8HA 2RK2A 4ZGEB 3UA6A 3A8LB 4KH0B 4AFZC 3OYBA 2IVWA 2X4JA 5FU6C 3WXMB 3CXCA 1K8AR 1MNDA 2RM4A 1Q86R 4IUVA 3OY9A 3R6OA 4C8QF 4AFSC 2R57A 2QQBA 3PMIA 3CMAT 2KK4A 1OPLA 2MPXC 1KC8U 1OYXA 1CKBA 1RLPC 2XHCA 4HCBA 1R0CB 3QDFA 2CGHA 1NLOC 4E6RA 4FU6A 2EGEA 1Y57A 3NFCA 4X9DA 4KULA 3U23A 2EYYA 2HZYA 3EHQA 4TVRA 2XG8D 1QVGS 4RG2A 1KHIA 1ZHIA 5LJ3d 1WHHA 1AD5A 4RTTA 4Z02A 1UGPB 1WNLA 2GBQA 4JLIA 4GLKA 3LGLA 1HSQA 2RN8A 1T3LA 3CCLT 3JCMe 3H8ZA 3DKMA 3ZEHA 1I0CA 5KYXB 2EQKA 2HL3A 2RHUA 2QGGA 1LPLA 4RTUA 3KUFA 3MEAA 2YT6A 2ZPHB 1QWEA 2P84A 3VJPA 3GPLA 2KDSA 2IIMA 3VYGA 4KH1B 1GBRA 1E6GA 2RJDA 4AG1C 2EJFA 1D0XA 1QCNA 2DIQA 2A0FB 5I2SA 2PUOB 5AYFA 2JXBA 1A0NB 2HL5C 3LH0A 1WHJA 2KRMA 2O9VA 2ZPFB 5CCAA 2W0ZA 3JRZA 1Q81C 4EIKA 3HFOA 4PJOE 1JJ2A 4M75B 3JB9H 4LN2A 1WHGA 3AHUA 5LJ5f 3FC3A 1M90R 4XTYA 2V1RA 4JJNK 3QWXX 1BCMA 1P92A 1VUBA 4PJOF 1TU0B 4FYWB 4HVUA 2R5MA 1M2VA 2MMPA 1RACB 2CZ7B 1AWXA 3M0RA 1VQKA 3CCJA 2COZA 1NLPC 2RJEA 3H9NA 3TU4K 3QIIA 1YWOA 2A28A 2AT1B 4MZPA 1PNJA 2HNIA 2KBTA 5CQYA 2O31A 4MMKA 2EYZA 2ZPBB 1RAHB 1Z9QA 3CCJQ 2FYKA 2LQKA 4C8QC 5HK3A 2FZGB 1SSHA 2RI2A 2YRVA 2JT4A 3NTHA 2ECZA 1TSFA 2OI3A 4NOYA 4X9CA 1W70A 2CT4A 1HD3A 2HQHA 3EFOB 3QJ6A 1W1FA 3QXEB 3EG9A 4J7FA 1SHFA 1WLPB 2EQMA 3HPWA 3H0HA 3CC4Q 2X3XD 2WSCE 1VYVA 5CR2A 1RAEB 4M7AD 4J9GA 3A5ZB 1Y96A 2RQUA 1D1AA 5CQXA 1K76A 4YTLA 9ATCB 2YHTA 2CZ6B 5J3BA 2W10A 4M77E 3FEOA 4RTWA 1QVGP 2CS7A 4RTVA 3M59A 2DM1A 2FO0A 4ANJA 3L2QA 2SEMA 4C8QA 2RD1A 3MEUA 3EG2A 3JV3A 4KRTA 3SHWA 5CK9A 1CKAA 4Y92A 2PZ1A 1PWTA 2YLBA 3OW2S 1D3BA 4QVDA 2DMOA 1Y07A 1O75A 2KT8A 1KD1R 4OMNA 4M77F 2MK5A 2O9SA 3CXCP 5GAMe 2OX7A 1GBQA 3JB9F 3M5AA 2J6FA 2VASA 4J6WA 1AEYA 2WSFE 5FU7B 3UATA 2P4RA 3P8BB 2RI5A 2G3RA 3MPUB 2L8DA 2EKOA 4RCBA 2RQVA 3OS5A 2J05A 2DAQA 4R0KA 3BE3A 2P4TA 3V8KA 4E2FB 3G1JA 2EKHA 4JZ3A 1BIAA 2GQIA 4X1VA 3CCJT 2K5IA 3LH5A 1VQ7A 3RUXA 1WJQA 2FL7A 4LUEA 1GL5A 4PJOC 3CMEA 3OSVA 1NPRA 3H6ZA 1I81A 3M4GA 2KMTA 2CZ1B 4J9DA 2AZSA 5HKCA 5GAMj 1BKBA 2QG9B 1N27A 4LUDA 3UWNA 1VQ7Q 3CD6Q 4FT2A 5GMKi 1OU9A 1OQKA 3TSZA 3CC4T 1UGRB 2K4YA 1IGQA 4C5EA 3NPFA 1G3YA 4PLLA 1D0YA 3VS1A 4JS4A 5IAYA 1VQLA 1NYFA 2ROLA 1BIBA 1Q7YR 1BU1A 1EFNA 3OA6A 4XU1A 1QLYA 2GTJA 4F16A 1GCPA 2NUZA 3RKXA 4L5GA 1KQSA 1VQLQ 4C92G 4OP0A 5I2MA 2D0NA 3ME9A 1SF9A 2RHZA 5KCOA 1M1KR 2RNAA 4PJOA 1JJ2P 3WVEB 3MHXA 4J9CA 1PKTA 2VYTA 3JSCA 2E64A 4FW2A 3JB9J 1G5VA 2A08A 3CCVA 2YLCA 1K73R 3HFNA 3G71Q 5L8RE 4BB7A 2LVMA 5IHNA 1T0JA 3J81E 2A36A 1YHQQ 4PK4A 4LDYA 4IIMA 3M0QA 5ECAA 1QKWA 2XI9A 4HVWA 1ZUUA 1MV0B 1RAAB 3LWHA 4F7UG 5LJ5h 5GANe 2PVOB 2KT1A 2LQWA 1ZQ1A 1U06A 2M0YA 1OULA 2VUBA 2HBPA 2JZ2A 3UPUA 2RJFA 4MZTA 4C0GA 1QCFA 1IHWA 1KQSS 2C0TA 2COYA 3CPWA 2QTXA 2KYBA 2K3YA 4RUGA 2L2PA 4IUUA 3M9QA 4J9FA 1VQOA 4PFOA 2ENMA 2FRYA 1VQ7T 3CD6T 3REBB 3RMSA 5GAN2 4C0DB 4XTWA 3F70A 4F7UA 1KSWA 1FXXA 3QKJA 3EG3A 3X20B 1YP5A 2LDMA 2F2VA 4OMQA 1NBEB 1CSKA 2O4XA 4GBQA 4EPCA 1R77A 1VYTA 3X24B 5LJ5g 2AIRB 2BZXA 1I4K1 4Z8AA 2GTOA 5CAIA 1BCOA 4HKEA 2JMAA 3DB4A 2V1QA 1VQLT 3OYGA 4KUIA 1EIFA 1UE9A 2J06A 5KYYA 1Q82R 3I5RA 1MMDA 1U1SA 3CPWS 4BDZA 4BI8B 1UUEA 4M75G 2NWMA 4AFQC 3URGA 1OEBA 3G71T 4PJOD 1M3AA 4JRQA 2BIVA 5AT1B 8AT1B 4HCCA 1WHLA 1OX9A 3QZ5B 3X26B 4OGEA 1Y71A 1YHQT 1S72A 2ZPGB 1X43A 3C12A 3FJ5A 3CCVT 5LJ3e 4XK8E 1TTHB 4XTXA 2X4XA 4XAXB 4DEXA 1BYMA 5DLQE 3N5BB 5J39A 2E10A 2B8AA 4OMFB 1ZSZB 1F1BB 3CCQA 2CSQA 2RI3A 1WXBA 1PSFA 3E19A 1ZLMA 1VQ5A 4BUGA 1WX6A 2CP2A 1ZBXA 3THKA 1AWWA 1KC8C 4QVZA 4AG2C 3C4SA 3IQLA 3M53A 2FG0A 2HD0A 4FM4B 1JQQA 2BUDA 1Q95G 2AHJB 1VQ5Q 3RMQA 2DXCA 1MMAA 1M8MA 1NJIR 1EZZB 3SWNB 1VQOT 3EH1A 3H0IA 2DIGA 2GQVA 4OB0B 1WI7A 2E12A 3MKDA 5KCHA 3M4YA 6AT1B 4JRIA 2BTTA 4IURA 4EMGA 2M9UA 2H3JA 2JNGA 1C1AA 4KT0E 3JB9I 4JUVA 3S3MA 1AZEA 1OX8A 3OMCA 1KQSP 2K5LA 4RTYA 2D6FA 3JCMJ 1VQMA 4NS5A 4M77D 1H3HA 1UG1A 5EC7A 2YWWA 2LMJA 1M2OA 4ZGJB 4O5VA 3JB9D 1UGQB 2O88A 1IRXA 4IUTA 3VS7A 3L2VA 3HSBA 3HKSA 2HCKA 1KG1A 1TUGB 2E6NA 3NGPA 4JJDA 4PKCC 1QVFA 2JVVA 4PJOB 1WZOA 2BKDN 4CC4B 1HXDA 3ZL7C 4MDXA 4JRPA 1S72T 3EHRA 1XJWB 5J26A 1M3CA 3PGGA 3QDRB 3PIPA 3HP9A 4FYXB 4M78C 2DLPA
chains in the Genus database with same CATH topology
3E2UA 2CP7A 1WHJA 2CP2A 2E3IA 2COYA 1TXQA 1WHHA 2HKNA 2M02A 3RDVA 2MPXC 1TOVA 3TQ7P 2CP0A 2COWA 2Z0WA 2COZA 2CP3A 1IXDA 2CP6A 2HKQB 1WHGA 2CP5A 2HL3A 2HL5C 1LPLA 4B6MA 2E4HA 1WHKA 1WHLA 2HQHA 2QK0A 2E3HA 1WHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2U A;  2CP7 A;  1WHJ A;  2CP2 A;  2E3I A;  2COY A;  1TXQ A;  1WHH A;  2HKN A;  2M02 A;  3RDV A;  2MPX C;  1TOV A;  3TQ7 P;  2CP0 A;  2COW A;  2Z0W A;  2COZ A;  2CP3 A;  1IXD A;  2CP6 A;  2HKQ B;  1WHG A;  2CP5 A;  2HL3 A;  2HL5 C;  1LPL A;  4B6M A;  2E4H A;  1WHK A;  1WHL A;  2HQH A;  2QK0 A;  2E3H A;  1WHM A; 
#chains in the Genus database with same CATH topology
 4BE1 A;  1G3W A;  1UGS B;  3CPW P;  2ROT A;  1TXQ A;  1N9R A;  3GF5 A;  2DYI A;  2JM8 A;  5KYW B;  3CCQ T;  3INZ A;  1VQ5 T;  3OYH A;  4M78 G;  2DVE A;  1Y0M A;  4WCI A;  3LX7 A;  3PTA A;  4D8D A;  1YNZ A;  1RI0 A;  1WJS A;  2RO0 A;  4LDV A;  1LVK A;  2KRS A;  2FHD A;  3REA B;  1QVF S;  1V1C A;  2CKK A;  4HCZ A;  4F14 A;  5GMK h;  3PVL A;  3OBY A;  2QXF A;  1ACM B;  1M1G A;  2GNC A;  3EGU A;  1NE8 A;  2VC8 A;  3MP6 A;  4A53 A;  1H3Z A;  2FPE A;  2LJ1 A;  2LT1 A;  3FJP A;  4M7A G;  4DQ2 A;  4M78 A;  3BFM A;  2M51 A;  1WQW A;  5LJ5 j;  3SB2 A;  2O4X B;  2RHY A;  1GCQ C;  1PHT A;  3UF4 A;  2QQA A;  2I2L A;  1ZX6 A;  3J7A F;  4M7D C;  1FWZ A;  3JCM Q;  1QP2 A;  4HT9 A;  4XTZ A;  4M77 B;  1FYN A;  4E7L A;  1VQM T;  2E6Z A;  4DEY A;  2JM9 A;  3V7C A;  3X25 B;  3VRZ A;  1I07 A;  3CC2 A;  1VIF A;  4BY6 B;  1M90 U;  4IUQ A;  4XU0 A;  4M7D G;  1YCY A;  2V8J A;  1FMW A;  3CBO A;  4J5Y A;  2XMF A;  3GIB A;  1W2B A;  2EVR A;  4E7Z A;  2JTE A;  5I22 A;  4MZM A;  1N8R C;  2L3Q A;  2D0Q B;  2E70 A;  1Z9Z A;  2NUP B;  1K9M C;  2EYX A;  2JW4 A;  1M9S A;  1GCQ A;  2CH4 A;  3MEV A;  3MEW A;  4OB3 B;  4C5I A;  1MHN A;  2K7A A;  4Y28 E;  4M7D A;  3EGX B;  4C92 E;  3OS1 A;  2ZCF B;  1AHJ B;  2ZPI B;  4JJC A;  1E7O A;  1WPY A;  3C0C A;  2Y4X A;  3MCA B;  2KNB B;  3EG1 A;  4C5H A;  1BI0 A;  1VQK Q;  3NMZ C;  4C92 F;  2EQI A;  2DBK A;  5FRM A;  2J7I A;  4AMC A;  1W2B S;  3G6E A;  3VYH B;  1YJ9 A;  1VQ6 A;  2DTI A;  3OYA A;  2KQW A;  3OW2 A;  1Q7Y C;  3VRY A;  4NL3 A;  3OYJ A;  2DEQ A;  4N4G A;  1X75 C;  1N5Z A;  2V8I A;  1WHK A;  2RB6 A;  4C5G A;  5IXF A;  4F7U E;  3JCM f;  5LJ5 d;  2HQX A;  3CBP A;  2D9T A;  2ATC B;  2YRD A;  1IO6 A;  2K6D A;  2PVD B;  4RKU E;  2CP5 A;  3R6N A;  4A4F A;  4OB2 B;  4F7U F;  5GAN g;  2YXY A;  1QVF P;  1WJR A;  3T9N A;  2DYB A;  5D6X A;  2WSE E;  1MV3 A;  3JCM b;  4PLI A;  7AT1 B;  1UB4 A;  2O01 E;  3OYY A;  3QSU A;  1NYG A;  1VYU A;  4DOV A;  2XID A;  2FZK B;  1SG5 A;  1NG2 A;  1O9S A;  1UHF A;  2NUT A;  4A4K A;  2ZZD A;  1N8R U;  2GCX A;  3RBB B;  2LJ0 A;  3BY7 A;  1G3S A;  1K9M U;  1YJN A;  3GBQ A;  3TCJ A;  2EGC A;  2KYM A;  5FRO A;  2RQT A;  4E47 A;  1VQ4 A;  3VV0 A;  1B7T A;  3M0T A;  3DLM A;  4QQD A;  1WHM A;  2Y4Y A;  1VQK T;  3BW1 A;  3BDL A;  1YJN Q;  8ATC B;  2VV5 A;  4BI4 A;  2QDY B;  2E1H A;  1WXU A;  3PNW C;  1Q81 R;  4A54 A;  4EMK C;  1TWB A;  1VQ4 Q;  4WF2 A;  1IRE B;  3NTI A;  1BI3 A;  2PVG B;  3JCM P;  5LL6 S;  4C0Z A;  4II1 A;  1Q7Y U;  3QG1 A;  1I5L A;  5KE3 A;  2LTO A;  1YWP A;  1UJ0 A;  2L3S A;  1BBZ A;  1FMV A;  5CKF A;  1GFC A;  2JS2 A;  2XDP A;  5FRN A;  2ED0 A;  4DOW A;  3CME Q;  1ARK A;  4B9W A;  1T3S A;  3L2R A;  3OQ5 A;  2VVK A;  1M3B A;  5GMK l;  1G83 A;  4C92 C;  1V76 A;  4D6W A;  3L2W A;  1M1K U;  5LJ3 g;  5CKE A;  2LRQ A;  1UDL A;  1D0Z A;  2IPO B;  1LCK A;  4XU2 A;  3MP1 A;  1RAD B;  2OTJ A;  5FU6 B;  3CC7 A;  2A37 A;  1B34 A;  3CCR A;  1K73 U;  1ABO A;  4N4H A;  4LXC A;  3O5Z A;  1TUD A;  4EMK A;  2PUK B;  2HDA A;  1W2B P;  3WVD B;  3OYK A;  2COW A;  2QQ9 A;  3A98 A;  3PIO A;  5GMK j;  2OTJ Q;  3GNF B;  2HEQ A;  3CC7 Q;  3FDR A;  5FW9 A;  2BZ8 A;  4C8Q D;  2DPP B;  1VQ8 A;  3JAM E;  3CCM A;  2K3B A;  1QWF A;  3CCR Q;  2HBW A;  1MUZ A;  1I1J A;  2I0N A;  5KYU A;  1ZUK A;  5IHK A;  3LLR A;  3FIF A;  5GAO m;  2CDT A;  3GNG A;  4LD9 K;  2ABL A;  4QT7 A;  2X4Y A;  3I56 A;  4C92 A;  1UFF A;  1K0S A;  4FIB A;  2H3E B;  4RCC A;  1B07 A;  1VQ8 Q;  3CCV Q;  3HHT B;  2NLU A;  3CCM Q;  1VOM A;  3P8H A;  4ELZ C;  2CP6 A;  3EH2 A;  4HCK A;  2EIF A;  1NEG A;  1H8K A;  2DD4 A;  3GP8 A;  1YJN T;  1HYO A;  3CCU A;  2E3H A;  5CKD A;  2FEI A;  2LQ8 A;  4A4G A;  4F04 B;  4BAC A;  4JLG A;  4KGZ B;  1VQ4 T;  1U5S A;  4DBR A;  3I56 Q;  2OAU A;  1M2V B;  2VGN A;  2KEA A;  2FRW A;  4QKU A;  3OW2 P;  2QEX A;  2EYW A;  4ME7 A;  2QTV A;  2BE7 D;  1LJO A;  2KSS A;  2X3W D;  4B6M A;  4VUB A;  3EGD A;  3AT1 B;  1IHV A;  2LCC A;  4FYY B;  2MWO A;  3CME T;  4OMM A;  1VA7 A;  2YUQ A;  2BZY A;  3RES A;  3I35 A;  3CPF A;  4Q5W A;  2LCS A;  5C6S A;  2QEX Q;  2ED1 A;  1VQO Q;  2J6O A;  1Q82 U;  4CRI A;  2KY9 A;  1SKU B;  4ZTF A;  2M0O A;  4N0A C;  4RTX A;  2QGF B;  1M30 A;  1QW1 A;  2DA9 A;  3GOX A;  4M75 C;  3JCM W;  1KJW A;  2RMO A;  3EG9 B;  3MET A;  4M78 E;  2CUB A;  3CQT A;  1SSF A;  1YIJ A;  4DBQ A;  1G2B A;  1X2Q A;  2ZGW A;  2M02 A;  2OTJ T;  2EFI A;  3ULR B;  3CC7 T;  4OB1 B;  1Y96 B;  2AK5 A;  5D6Y A;  2JTM A;  1JO8 A;  4J7I A;  2XDD A;  4DA4 A;  3CCR T;  2DZ9 A;  1ZA2 B;  1PRM C;  4E7I A;  4M78 F;  4J9H A;  5HK0 A;  2FPD A;  3VS4 A;  1YIJ Q;  1YIT A;  3BDU A;  1MMN A;  1OZ3 A;  2FVU A;  4L59 A;  3SFM A;  1KK7 A;  2DRK A;  2EWN A;  4M7A E;  1FMK A;  2X4W A;  4PJL A;  2DER A;  4C8Q B;  5GAN 8;  1K8A C;  1QQJ A;  2L89 A;  5CVI A;  1Q86 C;  2PNI A;  3MJX A;  3RNJ A;  3KBG A;  4BE0 A;  1VQ8 T;  1KQ2 A;  3CCM T;  3S3O A;  1MNE A;  5FWC A;  1YFN A;  1D3B B;  4N0A A;  2NUT B;  4J9B A;  4M75 A;  1YIT Q;  1XNI A;  3JCM g;  1TG0 A;  1X27 A;  2DK3 A;  4M7A F;  1S72 Q;  3I56 T;  5GAN 7;  1X6O A;  2AZV A;  4JPB W;  1ABQ A;  1RUW A;  3HRU A;  1NJI U;  3OYD A;  4OMO A;  4E7S A;  5GAN f;  2A7Y A;  2CH4 W;  3QYH B;  3VUB A;  4CI0 C;  3CCU T;  5GAO r;  4M7D E;  3FLG A;  3FRN A;  3CCQ Q;  1ZBJ A;  3H0F A;  1M27 C;  5CKB A;  1JRI A;  3QWY A;  2MWP A;  5GAN 3;  5KH6 A;  2D1X A;  1MGQ A;  3DLL A;  1YJW A;  3L2Z A;  2QEX T;  4BI3 A;  1V29 B;  2RF0 A;  2F69 A;  3UA7 A;  4GLM A;  2BE9 B;  3V7R A;  4M7D F;  1AVZ C;  2YUN A;  3OYN A;  4AFU C;  2DL8 A;  4FSX A;  2YUO A;  1YJW Q;  2MAM A;  3HTR A;  4RMO A;  1BI2 A;  1VQN A;  1RAF B;  3QZ9 B;  2QK0 A;  3CCL A;  2D8J A;  4PL6 A;  3TRE A;  4CC7 A;  1EX4 A;  2R5A A;  1VQN Q;  1YIJ T;  4CC2 A;  5D6W A;  1WQ7 A;  3JCM V;  2XKO C;  4LE9 A;  2JMC A;  2CYZ B;  3M58 A;  3KXT A;  2DNU A;  4FT4 A;  1VQM Q;  1M90 C;  2L0A A;  2RA2 A;  1C0M A;  3UDC A;  1SRL A;  1K8A U;  2DFU A;  1Q86 U;  2LJ3 A;  1YIT T;  4J6Y A;  4ORZ A;  1N9S A;  1R8O B;  2VB6 A;  3NHN A;  3RIR A;  3A8O B;  1OI1 A;  3EAE A;  3JCM X;  2QAS A;  2KE9 A;  4XU3 A;  2QA4 A;  3OYC A;  2GFU A;  1M1F A;  2C0O A;  4XTU A;  5LJ3 f;  1OPK A;  3SDZ A;  5FWB A;  3HRT A;  3LW5 E;  5D7U A;  3D7S B;  3PVQ A;  3VS3 A;  2VKN A;  5LJ5 e;  2EAY A;  4JJB A;  1PM3 A;  4BDY A;  1PCX A;  3EG0 A;  1D09 B;  5GAO l;  3TEE A;  2QA4 Q;  1IB8 A;  1LNX A;  5M9O A;  5GAO p;  2MOX A;  4FYV B;  1B3Q A;  2ZPE B;  3RKW A;  4WTO B;  2V8K A;  2HMA A;  3FB9 A;  1GFD A;  3A8M B;  5GAO n;  4M7A C;  1YCS B;  2KXD A;  5DLO A;  3M0U A;  4ATO A;  5GMK m;  2XDB A;  2K2V A;  3M57 A;  2DE0 X;  1YJW T;  1AWO A;  1QCO A;  5IH2 A;  2K79 A;  2YDL A;  1UEC A;  3V8J A;  5A0L A;  1K9A A;  5GJV B;  3EGD B;  4F7U B;  2DXU A;  2RK1 A;  1PSE A;  1X69 A;  2VXE A;  1KFZ A;  4F17 A;  2KAF A;  5A2Q E;  3ZFJ A;  1KC8 R;  5GAM g;  3QHS A;  4UC4 A;  2EYQ A;  3M0P A;  2K3X A;  4X34 A;  4LDX A;  1VQN T;  2LNH B;  3QO3 A;  2A3L A;  2CP0 A;  4LD6 A;  4IUP A;  1WFW A;  3QUI A;  4LDW A;  1KD1 C;  2F1L A;  3CXC S;  5KYY B;  5CKH A;  1RLQ C;  4M7A A;  2CP7 A;  3E9G A;  5A0D A;  1KQ1 A;  4QVC A;  1PKS A;  4MDW A;  4QQ6 A;  3M55 A;  3QPH A;  2X9H A;  2ESW A;  1JXM A;  2LNV A;  2O2O A;  4A63 B;  3CEY A;  1D1C A;  3OYM A;  3CC2 Q;  2LT4 A;  1VQ9 A;  3SEM A;  2CZ0 B;  4OVA A;  2DIL A;  4C0D C;  1TUC A;  1UHC A;  1U1T A;  2QA4 T;  2C06 A;  2QDL A;  3CBM A;  3L1A A;  1UTI A;  5HCK A;  1OZ2 A;  3PE0 A;  4ZN1 A;  2F2W A;  4P5N A;  2XU8 A;  1JEG A;  1VQ9 Q;  1SRM A;  2HKQ B;  3OS2 A;  1X6G A;  2DF6 A;  2LP5 A;  2F5T X;  1QMC A;  4XTV A;  1AT1 B;  1KIK A;  4FCY A;  2HAX A;  5GAN h;  1WGS A;  2JJ9 A;  2J6K A;  3VS2 A;  2K57 A;  4PFZ A;  1RI9 A;  2P0Q A;  3CCE A;  2P0P A;  1M5Q 1;  1NPP A;  2DD5 A;  2E41 A;  4OGC A;  4EDU A;  5I11 A;  2DXT A;  3E1S A;  3VKI A;  4FL6 A;  4R56 A;  1PD0 A;  2G6F X;  5C0M A;  3KFV A;  2FB7 A;  1JXO A;  2DL3 A;  2KR3 A;  3RER A;  3SD4 A;  3VS0 A;  4M78 D;  3I55 A;  1JU5 C;  3L2U A;  2K5F A;  3G6E Q;  3CCE Q;  2D8H A;  4ZNX A;  2B86 A;  1YJ9 Q;  1VQ6 Q;  3CCS A;  1JJ2 S;  1M1K C;  3CC4 A;  2Z0W A;  2CSI A;  2M1H A;  2M16 A;  2AKL A;  2EQJ A;  1U3O A;  1OU8 A;  4C0F A;  2LX9 A;  2DL5 A;  5GAN 5;  1I5O B;  5KE2 A;  4FSS A;  4E7H A;  4OF1 A;  3OYL A;  4CC3 A;  1KD1 U;  4K11 A;  1ZSZ C;  2CRE A;  3V8L A;  4C8Q G;  3I55 Q;  1K73 C;  2GFA A;  3CCS Q;  3OYE A;  4XQ3 A;  1PG5 B;  1VQP A;  2KRO A;  2E5Q A;  2FPF A;  2GF7 A;  2JUF A;  1KHC A;  3CC2 T;  4V2S A;  5DM7 R;  1ZA1 B;  1Y7X A;  2HQE A;  3I5S A;  2EQU A;  1VQP Q;  2DJQ A;  2MCN A;  3SWN C;  5GAN 4;  1M4Z A;  3JCM d;  1VIE A;  3OYF A;  3OYI A;  1DJ7 B;  1VQ9 T;  1Q81 U;  2RQR A;  2LCL A;  2V26 A;  4QW2 A;  4JZ4 A;  1X6B A;  4M75 E;  5LJ3 h;  4M7D D;  4B9X A;  4KUD K;  1ZSZ A;  3ZBD A;  3PFS A;  2KVQ G;  4Y91 A;  2PQW A;  3P8D A;  1H64 1;  1YBY A;  4FW1 A;  3L42 A;  4RTZ A;  5DY9 A;  1H92 A;  4RG8 A;  5L23 A;  1X01 A;  2OAW A;  1N8R R;  4M75 F;  3X28 B;  1C6V X;  2RJC A;  2GGR A;  5GMK e;  3QJY A;  2C0I A;  1K9M R;  3SWN A;  3E2U A;  2XK0 A;  4GY5 A;  3G6E T;  3CCE T;  1YJ9 T;  1VQ6 T;  5GAO q;  3CD6 A;  1MMG A;  1Q82 C;  2KI7 A;  1YI2 A;  1AWJ A;  1PRL C;  2QQS A;  4OMP A;  2E5K A;  2MIO A;  3VS5 A;  2EW3 A;  4O6J A;  4M78 B;  3PMT A;  3G4S A;  3RR6 A;  4LNP A;  4IIO A;  2OJ2 A;  3I55 T;  1K0X A;  1JB0 E;  4ESR A;  1RAI B;  3CCS T;  3ASK A;  2RHI A;  3OBW A;  4KGV B;  1YI2 Q;  4PJO G;  2AKK A;  2QQR A;  3GLX A;  1PD1 A;  5FLX E;  4D8K A;  3M54 A;  4JDS A;  2MF2 A;  2VXF A;  3G4S Q;  2OTL A;  3C95 A;  3M0S A;  4AT1 B;  3EFR A;  2YSQ A;  1VQP T;  2K9G A;  4HXJ A;  2KXC A;  4M7A B;  4KGX B;  5KYN A;  2RPN A;  1IGU A;  4LDU A;  5GJW B;  3G71 A;  2X35 A;  2YRC A;  3UT1 A;  1ZUY A;  1HJD A;  5IXB A;  2OTL Q;  1RAB B;  5GAM f;  1YHQ A;  4J9E A;  3RKY A;  2NYS A;  5A0G A;  1W4S A;  5IT9 E;  2IG0 A;  5CIU A;  2PTK A;  1NJI C;  3C94 A;  2HKN A;  1BI1 A;  4DBF A;  4M7D B;  2DX1 A;  5KYW A;  2CP3 A;  1PC0 A;  1IXD A;  3H41 A;  3A8H B;  2DET A;  2KGT A;  3CCU Q;  2DVJ A;  1G3T A;  1ZSG A;  2RHX A;  1SEM A;  4M77 C;  3E9F A;  1WXT A;  4A4H A;  4Z88 A;  2KRN A;  1K4U S;  4A4E A;  1NM7 A;  1X2K A;  4BY6 C;  2DTO A;  2LC4 A;  2R58 A;  4M77 G;  3LYI A;  4E7J A;  2CUD A;  2LZ6 B;  5GAM d;  2EBP A;  4HA8 A;  1YI2 T;  1XTD A;  4ZN3 A;  2SRC A;  4MML A;  4ELY C;  5KYX A;  1E6H A;  3JB9 G;  3JCM h;  1SHG A;  1UEB A;  2DKG A;  3A8G B;  2HSE B;  4J8O A;  1UGV A;  2DL4 A;  2YUP A;  1WIE A;  3G4S T;  2FZC B;  4DBH A;  2QI2 A;  5GAN j;  1QKX A;  4L6V 5;  4JS5 A;  1HK9 A;  1TS9 A;  1M8V A;  1QVP A;  4OML A;  4Z89 A;  4M77 A;  3V7S A;  2X51 A;  5IN1 A;  2L3P A;  2OTL T;  3G7Z A;  4J83 A;  2DXB A;  2JN0 A;  1NZ9 A;  3S3N A;  4HT8 A;  4BD3 A;  2RQW A;  3RDV A;  2XD0 A;  1UJY A;  1XOV A;  3A1P A;  1FX7 A;  1BK2 A;  1U8R A;  3EFS A;  4IKF A;  3JCM c;  2MYS A;  3HRS A;  1OV3 A;  2WAC A;  4E7K A;  2MI6 A;  3OMG A;  4PNO A;  3NTK A;  2E4H A;  4C92 D;  3TQ7 P;  4PJM A;  1WA7 A;  3M56 A;  3QYG B;  1WYX A;  2E65 A;  2DL7 A;  2NUP A;  3MO8 A;  4BE2 A;  2QAZ A;  3VS6 A;  4PJN A;  1I8F A;  3LGF A;  4R55 A;  3EGX A;  1GRI A;  4J9I A;  1TH7 A;  3HL8 A;  4J6X A;  2F2X A;  2VGM A;  3CMA A;  2LQN A;  3Q1J A;  2LX7 A;  1AZG B;  1AOJ A;  3J80 E;  1RL2 A;  2Y90 A;  1R0B G;  2JTF A;  2JOY A;  5CO7 A;  2CT3 A;  5GAN 6;  2E3I A;  2ZAE A;  1NEB A;  2EGA A;  3O8V A;  3VUZ A;  3PT9 A;  3CMA Q;  4ZTJ A;  3TVT A;  5HY6 A;  2DTH A;  2EJ9 A;  1LOJ A;  1S1N A;  3OB9 A;  1JBM A;  2DRM A;  5LJ3 j;  3EFO A;  4M4Z A;  1D1B A;  3OS0 A;  2JS0 A;  2DJZ A;  3QBY A;  1T0H A;  2EJG A;  2F5K A;  3MP8 A;  4QQG A;  5GAN d;  2QYZ A;  1G8X A;  2HSP A;  2P0K A;  1YN8 A;  5I21 A;  3OSS C;  5FU7 C;  4NL2 A;  1XQH A;  2L5Q A;  2EPD A;  3CCL Q;  1W6X A;  4EMH A;  2PU9 B;  1B34 B;  3TSW A;  2RH2 A;  1QP3 A;  4EMK B;  4N4I A;  3ER0 A;  4PJJ A;  2DO3 A;  3S6W A;  1GXI E;  1BB9 A;  5IHI A;  1TOV A;  2L3R A;  3VU3 C;  2DEU A;  1SPK A;  2VWF A;  4HVV A;  4JRK A;  4PFP A;  1K1Z A;  5KYU B;  1WDX A;  2DBM A;  3DB3 A;  1J3T A;  2XIC A;  4KBM B;  2DZC A;  4M75 D;  1QVG A;  3LWI A;  4ZGD B;  1IZ6 A;  1N6A A;  4C92 B;  4C8Q E;  5GAM h;  1RAG B;  1OOT A;  3I9Q A;  2K2M A;  5EG2 A;  2H8H A;  2RK2 A;  4ZGE B;  3UA6 A;  3A8L B;  4KH0 B;  4AFZ C;  3OYB A;  2IVW A;  2X4J A;  5FU6 C;  3WXM B;  3CXC A;  1K8A R;  1MND A;  2RM4 A;  1Q86 R;  4IUV A;  3OY9 A;  3R6O A;  4C8Q F;  4AFS C;  2R57 A;  2QQB A;  3PMI A;  3CMA T;  2KK4 A;  1OPL A;  2MPX C;  1KC8 U;  1OYX A;  1CKB A;  1RLP C;  2XHC A;  4HCB A;  1R0C B;  3QDF A;  2CGH A;  1NLO C;  4E6R A;  4FU6 A;  2EGE A;  1Y57 A;  3NFC A;  4X9D A;  4KUL A;  3U23 A;  2EYY A;  2HZY A;  3EHQ A;  4TVR A;  2XG8 D;  1QVG S;  4RG2 A;  1KHI A;  1ZHI A;  5LJ3 d;  1WHH A;  1AD5 A;  4RTT A;  4Z02 A;  1UGP B;  1WNL A;  2GBQ A;  4JLI A;  4GLK A;  3LGL A;  1HSQ A;  2RN8 A;  1T3L A;  3CCL T;  3JCM e;  3H8Z A;  3DKM A;  3ZEH A;  1I0C A;  5KYX B;  2EQK A;  2HL3 A;  2RHU A;  2QGG A;  1LPL A;  4RTU A;  3KUF A;  3MEA A;  2YT6 A;  2ZPH B;  1QWE A;  2P84 A;  3VJP A;  3GPL A;  2KDS A;  2IIM A;  3VYG A;  4KH1 B;  1GBR A;  1E6G A;  2RJD A;  4AG1 C;  2EJF A;  1D0X A;  1QCN A;  2DIQ A;  2A0F B;  5I2S A;  2PUO B;  5AYF A;  2JXB A;  1A0N B;  2HL5 C;  3LH0 A;  1WHJ A;  2KRM A;  2O9V A;  2ZPF B;  5CCA A;  2W0Z A;  3JRZ A;  1Q81 C;  4EIK A;  3HFO A;  4PJO E;  1JJ2 A;  4M75 B;  3JB9 H;  4LN2 A;  1WHG A;  3AHU A;  5LJ5 f;  3FC3 A;  1M90 R;  4XTY A;  2V1R A;  4JJN K;  3QWX X;  1BCM A;  1P92 A;  1VUB A;  4PJO F;  1TU0 B;  4FYW B;  4HVU A;  2R5M A;  1M2V A;  2MMP A;  1RAC B;  2CZ7 B;  1AWX A;  3M0R A;  1VQK A;  3CCJ A;  2COZ A;  1NLP C;  2RJE A;  3H9N A;  3TU4 K;  3QII A;  1YWO A;  2A28 A;  2AT1 B;  4MZP A;  1PNJ A;  2HNI A;  2KBT A;  5CQY A;  2O31 A;  4MMK A;  2EYZ A;  2ZPB B;  1RAH B;  1Z9Q A;  3CCJ Q;  2FYK A;  2LQK A;  4C8Q C;  5HK3 A;  2FZG B;  1SSH A;  2RI2 A;  2YRV A;  2JT4 A;  3NTH A;  2ECZ A;  1TSF A;  2OI3 A;  4NOY A;  4X9C A;  1W70 A;  2CT4 A;  1HD3 A;  2HQH A;  3EFO B;  3QJ6 A;  1W1F A;  3QXE B;  3EG9 A;  4J7F A;  1SHF A;  1WLP B;  2EQM A;  3HPW A;  3H0H A;  3CC4 Q;  2X3X D;  2WSC E;  1VYV A;  5CR2 A;  1RAE B;  4M7A D;  4J9G A;  3A5Z B;  1Y96 A;  2RQU A;  1D1A A;  5CQX A;  1K76 A;  4YTL A;  9ATC B;  2YHT A;  2CZ6 B;  5J3B A;  2W10 A;  4M77 E;  3FEO A;  4RTW A;  1QVG P;  2CS7 A;  4RTV A;  3M59 A;  2DM1 A;  2FO0 A;  4ANJ A;  3L2Q A;  2SEM A;  4C8Q A;  2RD1 A;  3MEU A;  3EG2 A;  3JV3 A;  4KRT A;  3SHW A;  5CK9 A;  1CKA A;  4Y92 A;  2PZ1 A;  1PWT A;  2YLB A;  3OW2 S;  1D3B A;  4QVD A;  2DMO A;  1Y07 A;  1O75 A;  2KT8 A;  1KD1 R;  4OMN A;  4M77 F;  2MK5 A;  2O9S A;  3CXC P;  5GAM e;  2OX7 A;  1GBQ A;  3JB9 F;  3M5A A;  2J6F A;  2VAS A;  4J6W A;  1AEY A;  2WSF E;  5FU7 B;  3UAT A;  2P4R A;  3P8B B;  2RI5 A;  2G3R A;  3MPU B;  2L8D A;  2EKO A;  4RCB A;  2RQV A;  3OS5 A;  2J05 A;  2DAQ A;  4R0K A;  3BE3 A;  2P4T A;  3V8K A;  4E2F B;  3G1J A;  2EKH A;  4JZ3 A;  1BIA A;  2GQI A;  4X1V A;  3CCJ T;  2K5I A;  3LH5 A;  1VQ7 A;  3RUX A;  1WJQ A;  2FL7 A;  4LUE A;  1GL5 A;  4PJO C;  3CME A;  3OSV A;  1NPR A;  3H6Z A;  1I81 A;  3M4G A;  2KMT A;  2CZ1 B;  4J9D A;  2AZS A;  5HKC A;  5GAM j;  1BKB A;  2QG9 B;  1N27 A;  4LUD A;  3UWN A;  1VQ7 Q;  3CD6 Q;  4FT2 A;  5GMK i;  1OU9 A;  1OQK A;  3TSZ A;  3CC4 T;  1UGR B;  2K4Y A;  1IGQ A;  4C5E A;  3NPF A;  1G3Y A;  4PLL A;  1D0Y A;  3VS1 A;  4JS4 A;  5IAY A;  1VQL A;  1NYF A;  2ROL A;  1BIB A;  1Q7Y R;  1BU1 A;  1EFN A;  3OA6 A;  4XU1 A;  1QLY A;  2GTJ A;  4F16 A;  1GCP A;  2NUZ A;  3RKX A;  4L5G A;  1KQS A;  1VQL Q;  4C92 G;  4OP0 A;  5I2M A;  2D0N A;  3ME9 A;  1SF9 A;  2RHZ A;  5KCO A;  1M1K R;  2RNA A;  4PJO A;  1JJ2 P;  3WVE B;  3MHX A;  4J9C A;  1PKT A;  2VYT A;  3JSC A;  2E64 A;  4FW2 A;  3JB9 J;  1G5V A;  2A08 A;  3CCV A;  2YLC A;  1K73 R;  3HFN A;  3G71 Q;  5L8R E;  4BB7 A;  2LVM A;  5IHN A;  1T0J A;  3J81 E;  2A36 A;  1YHQ Q;  4PK4 A;  4LDY A;  4IIM A;  3M0Q A;  5ECA A;  1QKW A;  2XI9 A;  4HVW A;  1ZUU A;  1MV0 B;  1RAA B;  3LWH A;  4F7U G;  5LJ5 h;  5GAN e;  2PVO B;  2KT1 A;  2LQW A;  1ZQ1 A;  1U06 A;  2M0Y A;  1OUL A;  2VUB A;  2HBP A;  2JZ2 A;  3UPU A;  2RJF A;  4MZT A;  4C0G A;  1QCF A;  1IHW A;  1KQS S;  2C0T A;  2COY A;  3CPW A;  2QTX A;  2KYB A;  2K3Y A;  4RUG A;  2L2P A;  4IUU A;  3M9Q A;  4J9F A;  1VQO A;  4PFO A;  2ENM A;  2FRY A;  1VQ7 T;  3CD6 T;  3REB B;  3RMS A;  5GAN 2;  4C0D B;  4XTW A;  3F70 A;  4F7U A;  1KSW A;  1FXX A;  3QKJ A;  3EG3 A;  3X20 B;  1YP5 A;  2LDM A;  2F2V A;  4OMQ A;  1NBE B;  1CSK A;  2O4X A;  4GBQ A;  4EPC A;  1R77 A;  1VYT A;  3X24 B;  5LJ5 g;  2AIR B;  2BZX A;  1I4K 1;  4Z8A A;  2GTO A;  5CAI A;  1BCO A;  4HKE A;  2JMA A;  3DB4 A;  2V1Q A;  1VQL T;  3OYG A;  4KUI A;  1EIF A;  1UE9 A;  2J06 A;  5KYY A;  1Q82 R;  3I5R A;  1MMD A;  1U1S A;  3CPW S;  4BDZ A;  4BI8 B;  1UUE A;  4M75 G;  2NWM A;  4AFQ C;  3URG A;  1OEB A;  3G71 T;  4PJO D;  1M3A A;  4JRQ A;  2BIV A;  5AT1 B;  8AT1 B;  4HCC A;  1WHL A;  1OX9 A;  3QZ5 B;  3X26 B;  4OGE A;  1Y71 A;  1YHQ T;  1S72 A;  2ZPG B;  1X43 A;  3C12 A;  3FJ5 A;  3CCV T;  5LJ3 e;  4XK8 E;  1TTH B;  4XTX A;  2X4X A;  4XAX B;  4DEX A;  1BYM A;  5DLQ E;  3N5B B;  5J39 A;  2E10 A;  2B8A A;  4OMF B;  1ZSZ B;  1F1B B;  3CCQ A;  2CSQ A;  2RI3 A;  1WXB A;  1PSF A;  3E19 A;  1ZLM A;  1VQ5 A;  4BUG A;  1WX6 A;  2CP2 A;  1ZBX A;  3THK A;  1AWW A;  1KC8 C;  4QVZ A;  4AG2 C;  3C4S A;  3IQL A;  3M53 A;  2FG0 A;  2HD0 A;  4FM4 B;  1JQQ A;  2BUD A;  1Q95 G;  2AHJ B;  1VQ5 Q;  3RMQ A;  2DXC A;  1MMA A;  1M8M A;  1NJI R;  1EZZ B;  3SWN B;  1VQO T;  3EH1 A;  3H0I A;  2DIG A;  2GQV A;  4OB0 B;  1WI7 A;  2E12 A;  3MKD A;  5KCH A;  3M4Y A;  6AT1 B;  4JRI A;  2BTT A;  4IUR A;  4EMG A;  2M9U A;  2H3J A;  2JNG A;  1C1A A;  4KT0 E;  3JB9 I;  4JUV A;  3S3M A;  1AZE A;  1OX8 A;  3OMC A;  1KQS P;  2K5L A;  4RTY A;  2D6F A;  3JCM J;  1VQM A;  4NS5 A;  4M77 D;  1H3H A;  1UG1 A;  5EC7 A;  2YWW A;  2LMJ A;  1M2O A;  4ZGJ B;  4O5V A;  3JB9 D;  1UGQ B;  2O88 A;  1IRX A;  4IUT A;  3VS7 A;  3L2V A;  3HSB A;  3HKS A;  2HCK A;  1KG1 A;  1TUG B;  2E6N A;  3NGP A;  4JJD A;  4PKC C;  1QVF A;  2JVV A;  4PJO B;  1WZO A;  2BKD N;  4CC4 B;  1HXD A;  3ZL7 C;  4MDX A;  4JRP A;  1S72 T;  3EHR A;  1XJW B;  5J26 A;  1M3C A;  3PGG A;  3QDR B;  3PIP A;  3HP9 A;  4FYX B;  4M78 C;  2DLP A; 
#chains in the Genus database with same CATH homology
 3E2U A;  2CP7 A;  1WHJ A;  2CP2 A;  2E3I A;  2COY A;  1TXQ A;  1WHH A;  2HKN A;  2M02 A;  3RDV A;  2MPX C;  1TOV A;  3TQ7 P;  2CP0 A;  2COW A;  2Z0W A;  2COZ A;  2CP3 A;  1IXD A;  2CP6 A;  2HKQ B;  1WHG A;  2CP5 A;  2HL3 A;  2HL5 C;  1LPL A;  4B6M A;  2E4H A;  1WHK A;  1WHL A;  2HQH A;  2QK0 A;  2E3H A;  1WHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...