2HL3A

Crystal structure of the a49m mutant cap-gly domain of human dynactin-1 (p150-glued) in complex with human eb1 c-terminal hexapeptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Dynactin-1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hl3A00
3TQ7P 2HQHA 1TOVA 2CP7A 2M02A 1WHGA 1WHKA 2CP5A 1WHMA 2E3HA 2E4HA 2Z0WA 1IXDA 2HL5C 2CP2A 2COWA 2HKQB 2MPXC 2QK0A 2CP0A 2CP6A 2COYA 2CP3A 4B6MA 1TXQA 3RDVA 2COZA 3E2UA 1WHJA 2HL3A 2HKNA 1LPLA 2E3IA 1WHHA 1WHLA
chains in the Genus database with same CATH superfamily
1ZA1B 1UECA 4PJOB 5CKEA 2AT1B 1ZA2B 2LX9A 4N0AA 3P8HA 4JJBA 4OMNA 4XK8E 3OYAA 3VS7A 2OTLT 1M5Q1 2CP2A 3HFOA 1VYTA 3X28B 4B9XA 3OYNA 5I2SA 3CPWS 2ZPHB 4Z88A 2E65A 2ZPGB 1I07A 3OSVA 4XTXA 1YBYA 3CCJQ 3CBPA 2GQVA 2V8IA 2EKHA 4P5NA 4ME7A 1D0YA 1AZGB 2GFUA 4M77D 4A4HA 1VQ8T 3JCMX 3JCMe 1TTHB 3M58A 2KNBB 1YJ9T 2YUQA 1VQKT 4M7DD 1ZSZA 8AT1B 3OYYA 2Y4YA 3QBYA 1UUEA 3V7RA 2K9GA 3JCMP 3M54A 1K73R 1K9MC 1BCOA 1VIEA 2BZYA 2QYZA 1BB9A 2P0KA 3THKA 3JB9G 3PNWC 4OMPA 1M2VB 5FROA 1UFFA 4C8QG 1D09B 4MMKA 4JJDA 2BKDN 2DL3A 4IUVA 3NTHA 4ANJA 3NHNA 1WI7A 1U5SA 3U23A 4DEXA 3CCUA 4LDVA 3J80E 2R5AA 1Q7YR 2A7YA 4PLLA 4A4FA 1WHMA 3RERA 2EJ9A 3CC7Q 1M90R 5A0DA 3BY7A 2C0TA 2EAYA 3C94A 2NUTB 2YHTA 1KQSS 2YT6A 5HCKA 5KCHA 1W2BS 2HCKA 4J6YA 2O31A 3CBMA 2DBMA 4ZGEB 3VS6A 2F2WA 4JS4A 4LDXA 1WHLA 3OBYA 4FYVB 3VRZA 2HQHA 1ZBJA 4J9EA 3CD6T 2M02A 2QA4T 1VQMQ 1VQNT 2EJFA 1WHKA 1WPYA 2RO0A 3I35A 4QQDA 3EGDA 2O9VA 3SWNA 1KQ1A 2RA2A 1H641 4N4HA 2HKQB 3OY9A 2KT1A 5GAMe 1AZEA 4R0KA 1RAAB 1M27C 2JW4A 3I56T 1GCPA 4AMCA 5CKDA 4JRQA 2GFAA 3EFRA 2JNGA 1RABB 3SD4A 2CT3A 2E3HA 4C0FA 2JTFA 1WXBA 1X27A 2QEXQ 1ZSGA 1G8XA 2I2LA 3QG1A 3JCMd 3CPWA 2RQRA 1MMGA 5C0MA 3CCSA 3M4GA 4JUVA 1JXMA 1KD1R 3OS2A 1OZ3A 3PTAA 4JDSA 2X4JA 2K3BA 1KIKA 3S3NA 2YRCA 2JTMA 3QIIA 3SEMA 2AK5A 4EPCA 2KYMA 4E7LA 4EMKB 1NYGA 2X4WA 2W0ZA 3A5ZB 1WA7A 2RM4A 2P84A 2FVUA 5DLQE 3RKXA 2YUOA 1Q95G 2LT4A 1UDLA 4C0DB 4EMKC 4IUTA 3L2WA 1N8RC 1U1TA 1O9SA 1BCMA 4XU0A 2LQWA 3OYIA 1GFDA 3OYCA 2VYTA 1YJWA 1CSKA 1SEMA 5GAN6 2R58A 3L2QA 4K11A 3G7ZA 2LCSA 1H92A 1I4K1 4BI3A 4J9BA 1WXTA 3CCET 1RAHB 2NLUA 1B34A 2XICA 1YWPA 1YNZA 4M77G 1K9MR 4C5IA 2FRYA 2HNIA 5A0LA 5CKHA 3M0TA 1RI0A 4IUPA 3CCJA 5FWCA 2L5QA 4M7DG 1S1NA 5GAMd 1C0MA 1Z9QA 2XMFA 1PRMC 5LJ3j 5GANf 3OYFA 2LX7A 1WJRA 2YSQA 3H0IA 5KYYB 4C5GA 3GPLA 2LQKA 2RHZA 4XU3A 2CT4A 1QW1A 2QK0A 3CMEA 4ZN1A 3CCRQ 3M5AA 2PQWA 2L2PA 2MWPA 1VQ4A 4LDUA 1VQ9Q 2J05A 2A37A 4OB2B 2DPPB 2DL4A 2JS0A 5CKBA 1VQ4T 4QVCA 1Q82C 3RBBB 1PRLC 3CCQQ 3S3MA 2LCCA 3H0HA 1GBRA 3FJ5A 1RL2A 5L8RE 3MCAB 2EQIA 2HKNA 4JLIA 4M75B 3V8LA 1G5VA 5IHIA 2ZPEB 2RPNA 1EZZB 5IT9E 1MMDA 2KBTA 3RR6A 1TS9A 1WHGA 4J9DA 2ZCFB 2VVKA 5KCOA 2DBKA 4NL2A 1HJDA 4M75C 5GAOr 2QQBA 1QVGP 4JZ4A 3DLMA 5J39A 5I11A 1K76A 3EH2A 4J6WA 1PKTA 1X6BA 1VQLT 1VQMA 2F2VA 4RCBA 3TQ7P 4BE2A 2R57A 2DF6A 1WIEA 2DETA 4Y28E 1WLPB 1KJWA 1VYUA 2LQ8A 1NYFA 3EG3A 1GCQC 2VASA 4C92A 4RMOA 1NPPA 1SHFA 2DRKA 4F16A 1AVZC 1QCFA 1VUBA 1YCYA 4KULA 5GAOq 5GAN3 2MOXA 1VYVA 4M77B 3G71A 1Q86U 2JXBA 5CIUA 2QEXA 4N0AC 1AT1B 1F1BB 3CXCA 4M7DB 4M7AA 1N8RR 3MHXA 4M77C 2HEQA 1LJOA 1BK2A 4N4IA 5KH6A 2QXFA 4ATOA 3CCMQ 5GJWB 3M0QA 4XTYA 3V7SA 2KXDA 3LH5A 4RKUE 3QO3A 3KFVA 4QVZA 3UA6A 5LJ5g 1QVFP 5CAIA 3CCLQ 3EGXA 2PVGB 4M4ZA 2DXCA 4ORZA 4XTUA 1SF9A 8ATCB 2JVVA 2RQVA 2CP3A 2GQIA 1K8AU 1HD3A 4O6JA 3DB4A 2G6FX 3V8KA 4FSSA 5CQYA 4C92E 4OB0B 1FMWA 4R55A 3A8MB 3HTRA 4C92F 3A8LB 1JU5C 1T3LA 1UGSB 2RHXA 3OSSC 2O4XA 1YJ9Q 2HL5C 2XIDA 2K5LA 1OX9A 2E6NA 1M9SA 1VQKQ 2COYA 3HL8A 3OYMA 1NG2A 3G6ET 4M7AE 2HL3A 1Y7XA 1VQPT 3TU4K 3BDLA 4M7AF 5CO7A 1IRXA 1SSFA 3G4SA 1BI1A 3OMGA 3RKYA 1G3WA 3HFNA 1PD0A 1QWEA 2MF2A 3QDRB 2A3LA 1X75C 2CH4W 3JCMg 1OU9A 4JRPA 4HCBA 4C8QA 2YRDA 2CP6A 4C0GA 3VKIA 1Q82R 1M8VA 2CUBA 2RK2A 2HMAA 4J9CA 4MDXA 1OYXA 1BI0A 2GF7A 4J9GA 4LDYA 1U8RA 1EFNA 3CBOA 4KH1B 2F5KA 2KEAA 1PCXA 1NBEB 3A8HB 1VQ7T 2XD0A 3CC2A 2DKGA 1W70A 3RNJA 3JCMJ 3QJ6A 1YIJQ 2A08A 1BBZA 1NZ9A 3E1SA 4OMQA 2K7AA 1SRLA 5EC7A 4LD6A 1Y07A 3VS4A 1YITT 3RMSA 3TVTA 2K5IA 1Z9ZA 3MP6A 5LJ5h 4BI8B 2KR3A 3S3OA 4RTWA 5FW9A 1Y96A 2AZVA 3FEOA 5GANj 3VYGA 2QTXA 4D6WA 1K73U 3JSCA 3IQLA 4AFSC 4BB7A 3I56Q 3OYLA 1QLYA 4C8QE 3MPUB 1YP5A 3RIRA 2BE7D 4C8QF 2VXEA 4GLKA 2PNIA 5CKFA 2CREA 1I5OB 3RUXA 3M0RA 2CZ0B 2DD4A 1N6AA 2DXUA 1UJYA 2EBPA 1S72T 1YJNT 1C1AA 1YI2A 3LWIA 3I9QA 1N5ZA 4RUGA 1CKBA 4IIOA 5D6WA 5GAMg 1ABQA 1Q7YU 4E6RA 2HQXA 3JB9I 3REAB 4LE9A 2FHDA 2OAUA 4PFPA 1M3AA 1M90U 4M75D 2M16A 2KRNA 5KYWB 2QQSA 1Y71A 2OTJT 4OMMA 2BE9B 3MP8A 3JCMh 4KH0B 1UTIA 2PTKA 4B6MA 1B34B 2IIMA 2EKOA 1GBQA 2VUBA 1KG1A 3CMAT 3VUBA 3EFOA 4MDWA 2V1QA 1QVFS 4BE1A 1WHHA 2DL8A 5FU6B 4A53A 4QW2A 1U06A 2DA9A 3OBWA 2VGMA 1OX8A 1OU8A 2EIFA 3S6WA 1XOVA 2DJQA 3DLLA 1MV0B 2DL5A 2MPXC 3CCMA 1GRIA 2FPEA 5FU6C 1SPKA 5KYXA 1JJ2S 3PVLA 1LCKA 4MZTA 3EGUA 3CCLA 4C5HA 2EQKA 3CCEQ 4J6XA 5DLOA 3BDUA 4LDWA 4QVDA 3SDZA 3OW2A 1KD1U 1UHCA 4GLMA 2EW3A 5HKCA 5HK3A 4LXCA 1VQOA 3JCMb 1G83A 2EYZA 1KHIA 2RD1A 3UATA 4PL6A 2KYBA 1M3CA 4PJLA 2H3EB 3L2RA 3ME9A 4L5GA 4KUDK 4HT8A 3L2UA 1YHQA 4F7UA 4RTXA 2B86A 2HD0A 5KYNA 2AKLA 3EG0A 1H8KA 1RAFB 4FYXB 4PJJA 1VQ6Q 3EG2A 3OS5A 4DBHA 5I2MA 5GJVB 1I8FA 2KRSA 5GAMh 2K3YA 1OQKA 2DVJA 1NJIU 2D8HA 5FLXE 2L3QA 2D1XA 4A63B 3CCUT 1MMAA 5LJ5d 1JQQA 2QDLA 2K5FA 2LDMA 4E2FB 2LVMA 4Z8AA 2OAWA 1KC8C 1N27A 3SHWA 1I5LA 4BY6B 1X01A 1B07A 9ATCB 5LJ5f 2C06A 1K9MU 3WVEB 4B9WA 1YIJA 2L3RA 1RADB 1EIFA 6AT1B 1U3OA 4BY6C 4C92C 4F7UE 4BDYA 4QT7A 1ZX6A 4C0ZA 4FIBA 4F7UF 4HCZA 2DO3A 2FG0A 1TUGB 5GANe 1M1GA 1RACB 2BZ8A 2B8AA 2IPOB 4A54A 4RTYA 4M7AC 1LNXA 1X69A 4HVWA 3A8OB 1D0XA 3EG9A 4X34A 2KVQG 3MEUA 2GCXA 1FMKA 4HCKA 2YXYA 3EGXB 4HVVA 1TH7A 5GAN4 5GAN2 3CCST 4E7HA 1H3HA 2OX7A 3JV3A 4L6V5 2NWMA 1OZ2A 3JCMf 1D0ZA 4Y91A 1OV3A 3AT1B 1I0CA 2BUDA 4M75G 4FCYA 1IO6A 2PUKB 2QDYB 5ECAA 4FW2A 2ATCB 3E2UA 1QQJA 3JRZA 3CC4Q 2KXCA 4DOVA 1EX4A 4M78A 2F1LA 2EQJA 1RAIB 4OB3B 1R77A 4RTZA 2K2VA 1IB8A 1NLPC 4OVAA 1QWFA 4PFZA 2PVDB 4XTVA 3MO8A 4WTOB 3CCVQ 4YTLA 5GMKj 4DEYA 2XDDA 5D6XA 2NYSA 4PLIA 1YJWT 2G3RA 1G3TA 5CQXA 2CSIA 2CKKA 2FZCB 1M30A 1UG1A 2EQMA 1NE8A 4CC3A 4AG1C 3LYIA 1KQSA 1W2BA 3CEYA 3DB3A 2DXBA 3G6EQ 1ZUYA 1MMNA 3CCJT 3JCMV 4J8OA 3MEAA 1N8RU 4RG2A 4FM4B 5KE2A 2V8KA 4M78E 4RTUA 2Z0WA 4M78F 2VWFA 1K9AA 3VUZA 5GAMf 4ZTJA 2JJ9A 4PJOA 3QKJA 5C6SA 1M1KC 3GF5A 3LGFA 2JM8A 2R5MA 1OEBA 3CMET 1Y96B 4LD9K 1LOJA 2ZPBB 2LJ3A 2EFIA 1G3YA 2VB6A 3RESA 1B3QA 2WACA 3PGGA 2HAXA 1KC8R 1VQ7Q 4LN2A 4MZPA 2DM1A 3FB9A 2F5TX 2PVOB 3AHUA 1VQ6A 1OPKA 2MMPA 3I55Q 2D0NA 2K2MA 4BI4A 3JB9H 2PZ1A 4L59A 1D1BA 1QVPA 2W10A 2MK5A 1U1SA 3CPFA 3UPUA 4E7JA 3L42A 4FL6A 2IVWA 3O5ZA 2DRMA 3CC7A 1TOVA 2RHIA 2ZAEA 5GAOn 1G3SA 1DJ7B 2JTEA 1SKUB 5IHKA 4QQ6A 4PK4A 1OPLA 2BZXA 2QTVA 2M0YA 4OMFB 4HKEA 4AFQC 1AHJB 2HBPA 4LNPA 4PJOE 4DQ2A 1Q81C 1VQMT 1PG5B 4PJOF 3EFOB 4LUDA 2VXFA 4J7IA 3GLXA 1YJNQ 4WF2A 2ROLA 2DX1A 2DIQA 2CUDA 2DZ9A 3A98A 1VQ5Q 2HSPA 2EQUA 1JBMA 1OOTA 5FU7B 4DBRA 5M9OA 4CC2A 3X25B 2K3XA 2J06A 3C12A 3M4YA 1PSFA 1UGRB 2NUTA 4C92D 5FU7C 3G71T 1QCOA 2QEXT 1FWZA 5LJ5j 5DM7R 2RK1A 3M9QA 3OYGA 2DIGA 1JEGA 4J9FA 1AWJA 5IXFA 2VGNA 2D9TA 4KT0E 2YRVA 4JPBW 2LNHB 2H8HA 4HVUA 1ZSZB 4M7AD 4XQ3A 4MMLA 4HCCA 4XTWA 1YFNA 1BI2A 2CH4A 3HRTA 1ABOA 1YN8A 4Z02A 2OTLQ 3VU3C 3VS2A 3CC4A 2RB6A 2X3WD 1ZSZC 2KT8A 1MGQA 2JS2A 3M0PA 3LWHA 2ZPIB 2WSFE 2CDTA 5GMKe 3WXMB 3CCVA 3OB9A 2RHYA 1VQ8Q 1MHNA 2J6OA 3PIOA 1UE9A 2EJGA 2M0OA 5KYUA 2VKNA 4AFZC 5GAN8 2DTIA 3JCMW 4O5VA 4DBQA 1LVKA 1PHTA 4XU1A 4EMKA 3SB2A 3CPWP 3L2VA 1T3SA 3MJXA 2QGFB 1M1KR 5IH2A 4FYYB 2ECZA 2AZSA 3X24B 1WQ7A 3ER0A 1J3TA 3G4ST 2J7IA 4X9CA 4KRTA 4X1VA 2FEIA 5LJ3e 4KUIA 2BIVA 3EGDB 3SWNB 3UA7A 1SHGA 3Q1JA 1P92A 3CQTA 2YUNA 2L0AA 3EHRA 2L3PA 1D3BA 2CZ1B 4J9IA 3CCUQ 1K0XA 2CGHA 2X4XA 3CCRA 3SWNC 3M56A 2QI2A 2JZ2A 3CC2T 1UHFA 3CCRT 1NLOC 2LJ0A 1XNIA 4LUEA 4ZTFA 1VQ9A 3QSUA 4OF1A 2RHUA 3OMCA 2DILA 2EPDA 1A0NB 2ZPFB 3GOXA 3ULRB 3CD6Q 2QA4Q 3CCQA 3I55A 4OP0A 1QVGS 1VQNQ 1IXDA 2GTOA 3VS5A 2COWA 2I0NA 3ZBDA 2D6FA 2KI7A 1QP3A 1GXIE 2CP0A 1HSQA 3ASKA 4OB1B 1Q81R 1SSHA 3RDVA 5KYYA 3JB9F 2HDAA 3F70A 5A0GA 4PJNA 1KQSP 2DTHA 1W2BP 5GAMj 2E5QA 1QKWA 2EYYA 2RQTA 4M78B 4BE0A 2LCLA 2A0FB 2K6DA 4FSXA 2MAMA 3C95A 3LGLA 4PFOA 3M0SA 1X6OA 2EVRA 4VUBA 1TXQA 3PT9A 2XG8D 2O88A 1YI2T 3I5SA 5D7UA 3ZL7C 1PNJA 4M78C 3VRYA 4EMGA 3CCSQ 3KXTA 2FZKB 1WDXA 1CKAA 2JOYA 2CYZB 2K4YA 4JS5A 2E70A 5HY6A 1VQ5A 2HBWA 4M75A 3V8JA 4N4GA 4C92G 1VIFA 2DL7A 3A8GB 2IG0A 3MKDA 2X4YA 3GBQA 3V7CA 2LQNA 2ESWA 2XKOC 4PNOA 2VC8A 2EGAA 2KMTA 4E7IA 1GL5A 2E5KA 3VS1A 2DE0X 2ZZDA 1AD5A 3PMIA 1PC0A 3GP8A 3GNFB 2LP5A 3RKWA 1SRMA 4M7AG 2FL7A 2WSCE 2O01E 3HKSA 1M8MA 2YDLA 2WSEE 1TG0A 2M1HA 2BTTA 3BE3A 3CCMT 2LTOA 3QJYA 2E6ZA 4V2SA 4JRIA 2FYKA 1OI1A 1NM7A 2OTLA 4GBQA 2EYQA 3CCLT 2V8JA 1K4US 1V76A 5A2QE 3GIBA 2DVEA 4M77A 3C0CA 4PJOC 3QWXX 4M75E 2ED1A 3O8VA 1NJIC 2EYWA 4M75F 4M7DA 1VQ8A 3E9FA 1N9SA 1RI9A 2RF0A 1VQOT 3HP9A 2KY9A 1QVGA 1YJ9A 3DKMA 3HRUA 1FXXA 2QQ9A 2Y4XA 2OI3A 3VYHB 1V1CA 2K79A 1VQKA 1D1AA 3WVDB 1JRIA 2KGTA 5CK9A 1YHQT 3G1JA 3NTKA 3T9NA 2CZ7B 2FZGB 2X3XD 4E47A 4GY5A 3CXCP 1WNLA 3QHSA 2DJZA 4CRIA 2K57A 4R56A 3CMEQ 3QXEB 2E64A 3NMZC 3URGA 2XHCA 4AT1B 4ZNXA 3FIFA 2KROA 4FW1A 1M4ZA 1VQ4Q 2QQAA 5GANh 2QQRA 4E7KA 3PVQA 3TEEA 4M77E 1BI3A 4C92B 4ZGJB 2FB7A 4M77F 3PMTA 4TVRA 2E12A 1I81A 1MV3A 4M7DE 2CS7A 2EWNA 3FC3A 4IIMA 4M7DF 2RJFA 1YIJT 4D8KA 2A28A 2QGGA 1TSFA 2NUPA 2KAFA 4II1A 3QYHB 1QVFA 4M7AB 5EG2A 1VQLQ 1HXDA 1LPLA 2E3IA 3X26B 3CD6A 1G2BA 2QA4A 1VQNA 2C0IA 5IXBA 2DAQA 2DLPA 2EGEA 5GAOl 2L8DA 4AFUC 3EFSA 3BW1A 2SRCA 1WJSA 1K1ZA 3TSZA 1M2OA 4OMOA 4OGCA 3OYHA 2F2XA 2DTOA 2OJ2A 3UWNA 2O9SA 3I56A 2DEUA 1JJ2A 1XQHA 4ELZC 2KE9A 1KC8U 3R6NA 3JCMQ 3PIPA 1E6HA 1B7TA 1X6GA 2MCNA 4PJMA 5I22A 1QMCA 4A4GA 3G71Q 2L89A 4J5YA 2EGCA 3ZEHA 4E7ZA 4XTZA 2KRMA 1RAGB 3SFMA 3H6ZA 5KE3A 3M59A 1TWBA 1WHJA 3M57A 3UDCA 2O4XB 4C5EA 4CI0C 5KYUB 5LL6S 3RMQA 2ZGWA 2Y90A 2MI6A 3A1PA 2YLCA 4KGZB 1IREB 4NL3A 2LT1A 1UGVA 1WX6A 4M78D 2XDPA 4J7FA 1WXUA 2RI3A 5CCAA 5FRMA 1TUCA 1ZBXA 1Y0MA 4C8QB 1ZQ1A 5AT1B 4XAXB 1X2KA 2LMJA 4X9DA 2YWWA 5I21A 5AYFA 1NJIR 1T0HA 5IN1A 2DXTA 4C0DC 1D3BB 4C8QC 3H9NA 1RAEB 1IGQA 5KYWA 2E1HA 1VQPQ 3CCEA 2SEMA 3EHQA 2ED0A 4RTTA 2D8JA 2DK3A 2F69A 2XK0A 2DYIA 3R6OA 1ZUKA 3FJPA 3QZ5B 1WYXA 1H3ZA 3H0FA 3G4SQ 2KK4A 1M3BA 2PU9B 5GANd 3CXCS 1QCNA 1UGPB 2LZ6B 2V26A 1D1CA 2CSQA 4ESRA 1T0JA 1XTDA 2FPFA 2JUFA 3OYEA 4DBFA 1AWXA 2GNCA 2JMAA 5GAN7 2P4TA 1MNDA 4F7UG 3VV0A 1VA7A 1AWWA 2JMCA 3E9GA 4Z89A 4PJOD 1O75A 3D7SB 3P8DA 3CC2Q 1MUZA 1NPRA 3REBB 2NUZA 2RI5A 4CC4B 1V29B 1VQ6T 3NTIA 1RUWA 2P0PA 3QUIA 3UF4A 5LJ3g 2MYSA 3M55A 1PSEA 4CC7A 4ZGDB 1UB4A 5GMKm 2JM9A 4ZN3A 3N5BB 2CP7A 2XI9A 1YITQ 2XDBA 1FX7A 3ZFJA 2HZYA 3CC7T 4NOYA 2X51A 2RN8A 3VS3A 1ACMB 4FU6A 1X43A 2ROTA 2MWOA 3EH1A 3OW2P 4BUGA 3M53A 4AG2C 1QP2A 1M1KU 1W6XA 1Q86C 1M2VA 7AT1B 5GMKi 5D6YA 4JJNK 2DYBA 4JZ3A 1FMVA 2MIOA 5GAOp 4IKFA 5L23A 2AKKA 4EDUA 4MZMA 3TCJA 2E41A 1S72Q 1Q82U 1VQLA 1OULA 3E19A 3OS0A 4DA4A 3QWYA 1YI2Q 1YWOA 1WFWA 3J7AF 2RQWA 4HA8A 1E7OA 5KYXB 1BU1A 5GMKh 4D8DA 1BIBA 5IAYA 1AOJA 2OTJQ 2O2OA 3TREA 4UC4A 1NEGA 1K8AC 4RG8A 5J3BA 3NGPA 4IUQA 1YCSB 3FDRA 1SG5A 1R0BG 2DEQA 4JLGA 1UJ0A 3CMAQ 3X20B 2DD5A 2M9UA 4HT9A 4QQGA 2HQEA 3KBGA 3MP1A 3EG1A 5DY9A 3OS1A 5FWBA 1Q81U 2H3JA 2XU8A 3P8BB 1N9RA 4OGEA 3QZ9B 4QKUA 4XU2A 3MEWA 3NFCA 1IHVA 1X2QA 4F7UB 4M78G 3CC4T 1WGSA 1IGUA 2GTJA 2PUOB 5LJ3h 1HYOA 2CZ6B 4M7DC 1KFZA 3HRSA 2DMOA 2LC4A 2C0OA 4WCIA 4IURA 1NEBA 3CCVT 2M51A 2ABLA 2V1RA 2KQWA 2L3SA 1W1FA 5GAOm 4RCCA 3INZA 5J26A 2A36A 3FRNA 2QASA 4F14A 2AIRB 1VQOQ 1QKXA 1BIAA 2P4RA 3L1AA 1KQ2A 4PKCC 1JJ2P 1RLQC 1TUDA 3LW5E 2KSSA 4F17A 3UT1A 3OQ5A 4BACA 2E4HA 1Y57A 3H41A 2YLBA 1E6GA 1TU0B 5GAN5 3G6EA 1YHQQ 1VQPA 2RNAA 2FPDA 4BD3A 3M0UA 2COZA 4RTVA 4BDZA 3BFMA 3OYBA 3EAEA 5CR2A 3QDFA 2LNVA 3JB9D 1W4SA 4Y92A 2D0QB 2LRQA 2ENMA 2NUPB 3NPFA 4JRKA 2DERA 4EMHA 4ELYC 1WQWA 4C8QD 1PKSA 2P0QA 1WZOA 3VS0A 1R0CB 1ZUUA 2DFUA 1K73C 1GFCA 4PJOG 3MEVA 4J83A 3TSWA 1VOMA 4E7SA 2KDSA 3OYKA 4NS5A 3HSBA 2QG9B 1UEBA 2RQUA 3C4SA 1K0SA 3EG9B 1VQ7A 3VJPA 1HK9A 2HSEB 5HK0A 1AWOA 1VQ9T 3LLRA 4EIKA 3I5RA 4J9HA 2X35A 3LH0A 3PE0A 3LX7A 4FT2A 3HPWA 1Q86R 3JAME 3OW2S 4F04B 3I55T 3CCQT 3GNGA 3J81E 4FT4A 1PWTA 1KHCA 1Q7YC 1R8OB 4A4EA 1ZHIA 5FRNA 1JO8A 1RLPC 1MNEA 1YITA 4KBMB 4JJCA 1M90C 4A4KA 1I1JA 1BKBA 1KSWA 2VV5A 3META 2EYXA 2J6FA 2AHJB 2DNUA 1IZ6A 2X9HA 2DZCA 1KK7A 4FYWB 1PD1A 3L2ZA 1JXOA 1PM3A 4OMLA 2RH2A 2JN0A 1FYNA 3QYGB 4DOWA 1K8AR 2RJEA 1S72A 2LJ1A 1YJNA 5GANg 2CP5A 2RI2A 2YUPA 2FRWA 3QPHA 3OA6A 1AEYA 3PFSA 1UGQB 1M1FA 1VQ5T 5IHNA 1IHWA 4Q5WA 2E10A 4IUUA 3HHTB 2J6KA 5LJ3d 3H8ZA 3JB9J 2JT4A 1JB0E 5CVIA 5LJ5e 3FLGA 3KUFA 4HXJA 1XJWB 2OTJA 4KGVB 2GBQA 2QAZA 1KD1C 2RMOA 2RJCA 4KGXB 5GMKl 3CMAA 1C6VX 1WJQA 1GCQA 5LJ3f 1BYMA 2FO0A 2RJDA 1ZLMA 1YJWQ 2GGRA 3JCMc 3OYJA 1ARKA 3OYDA
chains in the Genus database with same CATH topology
3TQ7P 2HQHA 1TOVA 2CP7A 2M02A 1WHGA 1WHKA 2CP5A 1WHMA 2E3HA 2E4HA 2Z0WA 1IXDA 2HL5C 2CP2A 2COWA 2HKQB 2MPXC 2QK0A 2CP0A 2CP6A 2COYA 2CP3A 4B6MA 1TXQA 3RDVA 2COZA 3E2UA 1WHJA 2HL3A 2HKNA 1LPLA 2E3IA 1WHHA 1WHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TQ7 P;  2HQH A;  1TOV A;  2CP7 A;  2M02 A;  1WHG A;  1WHK A;  2CP5 A;  1WHM A;  2E3H A;  2E4H A;  2Z0W A;  1IXD A;  2HL5 C;  2CP2 A;  2COW A;  2HKQ B;  2MPX C;  2QK0 A;  2CP0 A;  2CP6 A;  2COY A;  2CP3 A;  4B6M A;  1TXQ A;  3RDV A;  2COZ A;  3E2U A;  1WHJ A;  2HL3 A;  2HKN A;  1LPL A;  2E3I A;  1WHH A;  1WHL A; 
#chains in the Genus database with same CATH topology
 1ZA1 B;  1UEC A;  4PJO B;  5CKE A;  2AT1 B;  1ZA2 B;  2LX9 A;  4N0A A;  3P8H A;  4JJB A;  4OMN A;  4XK8 E;  3OYA A;  3VS7 A;  2OTL T;  1M5Q 1;  2CP2 A;  3HFO A;  1VYT A;  3X28 B;  4B9X A;  3OYN A;  5I2S A;  3CPW S;  2ZPH B;  4Z88 A;  2E65 A;  2ZPG B;  1I07 A;  3OSV A;  4XTX A;  1YBY A;  3CCJ Q;  3CBP A;  2GQV A;  2V8I A;  2EKH A;  4P5N A;  4ME7 A;  1D0Y A;  1AZG B;  2GFU A;  4M77 D;  4A4H A;  1VQ8 T;  3JCM X;  3JCM e;  1TTH B;  3M58 A;  2KNB B;  1YJ9 T;  2YUQ A;  1VQK T;  4M7D D;  1ZSZ A;  8AT1 B;  3OYY A;  2Y4Y A;  3QBY A;  1UUE A;  3V7R A;  2K9G A;  3JCM P;  3M54 A;  1K73 R;  1K9M C;  1BCO A;  1VIE A;  2BZY A;  2QYZ A;  1BB9 A;  2P0K A;  3THK A;  3JB9 G;  3PNW C;  4OMP A;  1M2V B;  5FRO A;  1UFF A;  4C8Q G;  1D09 B;  4MMK A;  4JJD A;  2BKD N;  2DL3 A;  4IUV A;  3NTH A;  4ANJ A;  3NHN A;  1WI7 A;  1U5S A;  3U23 A;  4DEX A;  3CCU A;  4LDV A;  3J80 E;  2R5A A;  1Q7Y R;  2A7Y A;  4PLL A;  4A4F A;  1WHM A;  3RER A;  2EJ9 A;  3CC7 Q;  1M90 R;  5A0D A;  3BY7 A;  2C0T A;  2EAY A;  3C94 A;  2NUT B;  2YHT A;  1KQS S;  2YT6 A;  5HCK A;  5KCH A;  1W2B S;  2HCK A;  4J6Y A;  2O31 A;  3CBM A;  2DBM A;  4ZGE B;  3VS6 A;  2F2W A;  4JS4 A;  4LDX A;  1WHL A;  3OBY A;  4FYV B;  3VRZ A;  2HQH A;  1ZBJ A;  4J9E A;  3CD6 T;  2M02 A;  2QA4 T;  1VQM Q;  1VQN T;  2EJF A;  1WHK A;  1WPY A;  2RO0 A;  3I35 A;  4QQD A;  3EGD A;  2O9V A;  3SWN A;  1KQ1 A;  2RA2 A;  1H64 1;  4N4H A;  2HKQ B;  3OY9 A;  2KT1 A;  5GAM e;  1AZE A;  4R0K A;  1RAA B;  1M27 C;  2JW4 A;  3I56 T;  1GCP A;  4AMC A;  5CKD A;  4JRQ A;  2GFA A;  3EFR A;  2JNG A;  1RAB B;  3SD4 A;  2CT3 A;  2E3H A;  4C0F A;  2JTF A;  1WXB A;  1X27 A;  2QEX Q;  1ZSG A;  1G8X A;  2I2L A;  3QG1 A;  3JCM d;  3CPW A;  2RQR A;  1MMG A;  5C0M A;  3CCS A;  3M4G A;  4JUV A;  1JXM A;  1KD1 R;  3OS2 A;  1OZ3 A;  3PTA A;  4JDS A;  2X4J A;  2K3B A;  1KIK A;  3S3N A;  2YRC A;  2JTM A;  3QII A;  3SEM A;  2AK5 A;  4EPC A;  2KYM A;  4E7L A;  4EMK B;  1NYG A;  2X4W A;  2W0Z A;  3A5Z B;  1WA7 A;  2RM4 A;  2P84 A;  2FVU A;  5DLQ E;  3RKX A;  2YUO A;  1Q95 G;  2LT4 A;  1UDL A;  4C0D B;  4EMK C;  4IUT A;  3L2W A;  1N8R C;  1U1T A;  1O9S A;  1BCM A;  4XU0 A;  2LQW A;  3OYI A;  1GFD A;  3OYC A;  2VYT A;  1YJW A;  1CSK A;  1SEM A;  5GAN 6;  2R58 A;  3L2Q A;  4K11 A;  3G7Z A;  2LCS A;  1H92 A;  1I4K 1;  4BI3 A;  4J9B A;  1WXT A;  3CCE T;  1RAH B;  2NLU A;  1B34 A;  2XIC A;  1YWP A;  1YNZ A;  4M77 G;  1K9M R;  4C5I A;  2FRY A;  2HNI A;  5A0L A;  5CKH A;  3M0T A;  1RI0 A;  4IUP A;  3CCJ A;  5FWC A;  2L5Q A;  4M7D G;  1S1N A;  5GAM d;  1C0M A;  1Z9Q A;  2XMF A;  1PRM C;  5LJ3 j;  5GAN f;  3OYF A;  2LX7 A;  1WJR A;  2YSQ A;  3H0I A;  5KYY B;  4C5G A;  3GPL A;  2LQK A;  2RHZ A;  4XU3 A;  2CT4 A;  1QW1 A;  2QK0 A;  3CME A;  4ZN1 A;  3CCR Q;  3M5A A;  2PQW A;  2L2P A;  2MWP A;  1VQ4 A;  4LDU A;  1VQ9 Q;  2J05 A;  2A37 A;  4OB2 B;  2DPP B;  2DL4 A;  2JS0 A;  5CKB A;  1VQ4 T;  4QVC A;  1Q82 C;  3RBB B;  1PRL C;  3CCQ Q;  3S3M A;  2LCC A;  3H0H A;  1GBR A;  3FJ5 A;  1RL2 A;  5L8R E;  3MCA B;  2EQI A;  2HKN A;  4JLI A;  4M75 B;  3V8L A;  1G5V A;  5IHI A;  2ZPE B;  2RPN A;  1EZZ B;  5IT9 E;  1MMD A;  2KBT A;  3RR6 A;  1TS9 A;  1WHG A;  4J9D A;  2ZCF B;  2VVK A;  5KCO A;  2DBK A;  4NL2 A;  1HJD A;  4M75 C;  5GAO r;  2QQB A;  1QVG P;  4JZ4 A;  3DLM A;  5J39 A;  5I11 A;  1K76 A;  3EH2 A;  4J6W A;  1PKT A;  1X6B A;  1VQL T;  1VQM A;  2F2V A;  4RCB A;  3TQ7 P;  4BE2 A;  2R57 A;  2DF6 A;  1WIE A;  2DET A;  4Y28 E;  1WLP B;  1KJW A;  1VYU A;  2LQ8 A;  1NYF A;  3EG3 A;  1GCQ C;  2VAS A;  4C92 A;  4RMO A;  1NPP A;  1SHF A;  2DRK A;  4F16 A;  1AVZ C;  1QCF A;  1VUB A;  1YCY A;  4KUL A;  5GAO q;  5GAN 3;  2MOX A;  1VYV A;  4M77 B;  3G71 A;  1Q86 U;  2JXB A;  5CIU A;  2QEX A;  4N0A C;  1AT1 B;  1F1B B;  3CXC A;  4M7D B;  4M7A A;  1N8R R;  3MHX A;  4M77 C;  2HEQ A;  1LJO A;  1BK2 A;  4N4I A;  5KH6 A;  2QXF A;  4ATO A;  3CCM Q;  5GJW B;  3M0Q A;  4XTY A;  3V7S A;  2KXD A;  3LH5 A;  4RKU E;  3QO3 A;  3KFV A;  4QVZ A;  3UA6 A;  5LJ5 g;  1QVF P;  5CAI A;  3CCL Q;  3EGX A;  2PVG B;  4M4Z A;  2DXC A;  4ORZ A;  4XTU A;  1SF9 A;  8ATC B;  2JVV A;  2RQV A;  2CP3 A;  2GQI A;  1K8A U;  1HD3 A;  4O6J A;  3DB4 A;  2G6F X;  3V8K A;  4FSS A;  5CQY A;  4C92 E;  4OB0 B;  1FMW A;  4R55 A;  3A8M B;  3HTR A;  4C92 F;  3A8L B;  1JU5 C;  1T3L A;  1UGS B;  2RHX A;  3OSS C;  2O4X A;  1YJ9 Q;  2HL5 C;  2XID A;  2K5L A;  1OX9 A;  2E6N A;  1M9S A;  1VQK Q;  2COY A;  3HL8 A;  3OYM A;  1NG2 A;  3G6E T;  4M7A E;  2HL3 A;  1Y7X A;  1VQP T;  3TU4 K;  3BDL A;  4M7A F;  5CO7 A;  1IRX A;  1SSF A;  3G4S A;  1BI1 A;  3OMG A;  3RKY A;  1G3W A;  3HFN A;  1PD0 A;  1QWE A;  2MF2 A;  3QDR B;  2A3L A;  1X75 C;  2CH4 W;  3JCM g;  1OU9 A;  4JRP A;  4HCB A;  4C8Q A;  2YRD A;  2CP6 A;  4C0G A;  3VKI A;  1Q82 R;  1M8V A;  2CUB A;  2RK2 A;  2HMA A;  4J9C A;  4MDX A;  1OYX A;  1BI0 A;  2GF7 A;  4J9G A;  4LDY A;  1U8R A;  1EFN A;  3CBO A;  4KH1 B;  2F5K A;  2KEA A;  1PCX A;  1NBE B;  3A8H B;  1VQ7 T;  2XD0 A;  3CC2 A;  2DKG A;  1W70 A;  3RNJ A;  3JCM J;  3QJ6 A;  1YIJ Q;  2A08 A;  1BBZ A;  1NZ9 A;  3E1S A;  4OMQ A;  2K7A A;  1SRL A;  5EC7 A;  4LD6 A;  1Y07 A;  3VS4 A;  1YIT T;  3RMS A;  3TVT A;  2K5I A;  1Z9Z A;  3MP6 A;  5LJ5 h;  4BI8 B;  2KR3 A;  3S3O A;  4RTW A;  5FW9 A;  1Y96 A;  2AZV A;  3FEO A;  5GAN j;  3VYG A;  2QTX A;  4D6W A;  1K73 U;  3JSC A;  3IQL A;  4AFS C;  4BB7 A;  3I56 Q;  3OYL A;  1QLY A;  4C8Q E;  3MPU B;  1YP5 A;  3RIR A;  2BE7 D;  4C8Q F;  2VXE A;  4GLK A;  2PNI A;  5CKF A;  2CRE A;  1I5O B;  3RUX A;  3M0R A;  2CZ0 B;  2DD4 A;  1N6A A;  2DXU A;  1UJY A;  2EBP A;  1S72 T;  1YJN T;  1C1A A;  1YI2 A;  3LWI A;  3I9Q A;  1N5Z A;  4RUG A;  1CKB A;  4IIO A;  5D6W A;  5GAM g;  1ABQ A;  1Q7Y U;  4E6R A;  2HQX A;  3JB9 I;  3REA B;  4LE9 A;  2FHD A;  2OAU A;  4PFP A;  1M3A A;  1M90 U;  4M75 D;  2M16 A;  2KRN A;  5KYW B;  2QQS A;  1Y71 A;  2OTJ T;  4OMM A;  2BE9 B;  3MP8 A;  3JCM h;  4KH0 B;  1UTI A;  2PTK A;  4B6M A;  1B34 B;  2IIM A;  2EKO A;  1GBQ A;  2VUB A;  1KG1 A;  3CMA T;  3VUB A;  3EFO A;  4MDW A;  2V1Q A;  1QVF S;  4BE1 A;  1WHH A;  2DL8 A;  5FU6 B;  4A53 A;  4QW2 A;  1U06 A;  2DA9 A;  3OBW A;  2VGM A;  1OX8 A;  1OU8 A;  2EIF A;  3S6W A;  1XOV A;  2DJQ A;  3DLL A;  1MV0 B;  2DL5 A;  2MPX C;  3CCM A;  1GRI A;  2FPE A;  5FU6 C;  1SPK A;  5KYX A;  1JJ2 S;  3PVL A;  1LCK A;  4MZT A;  3EGU A;  3CCL A;  4C5H A;  2EQK A;  3CCE Q;  4J6X A;  5DLO A;  3BDU A;  4LDW A;  4QVD A;  3SDZ A;  3OW2 A;  1KD1 U;  1UHC A;  4GLM A;  2EW3 A;  5HKC A;  5HK3 A;  4LXC A;  1VQO A;  3JCM b;  1G83 A;  2EYZ A;  1KHI A;  2RD1 A;  3UAT A;  4PL6 A;  2KYB A;  1M3C A;  4PJL A;  2H3E B;  3L2R A;  3ME9 A;  4L5G A;  4KUD K;  4HT8 A;  3L2U A;  1YHQ A;  4F7U A;  4RTX A;  2B86 A;  2HD0 A;  5KYN A;  2AKL A;  3EG0 A;  1H8K A;  1RAF B;  4FYX B;  4PJJ A;  1VQ6 Q;  3EG2 A;  3OS5 A;  4DBH A;  5I2M A;  5GJV B;  1I8F A;  2KRS A;  5GAM h;  2K3Y A;  1OQK A;  2DVJ A;  1NJI U;  2D8H A;  5FLX E;  2L3Q A;  2D1X A;  4A63 B;  3CCU T;  1MMA A;  5LJ5 d;  1JQQ A;  2QDL A;  2K5F A;  2LDM A;  4E2F B;  2LVM A;  4Z8A A;  2OAW A;  1KC8 C;  1N27 A;  3SHW A;  1I5L A;  4BY6 B;  1X01 A;  1B07 A;  9ATC B;  5LJ5 f;  2C06 A;  1K9M U;  3WVE B;  4B9W A;  1YIJ A;  2L3R A;  1RAD B;  1EIF A;  6AT1 B;  1U3O A;  4BY6 C;  4C92 C;  4F7U E;  4BDY A;  4QT7 A;  1ZX6 A;  4C0Z A;  4FIB A;  4F7U F;  4HCZ A;  2DO3 A;  2FG0 A;  1TUG B;  5GAN e;  1M1G A;  1RAC B;  2BZ8 A;  2B8A A;  2IPO B;  4A54 A;  4RTY A;  4M7A C;  1LNX A;  1X69 A;  4HVW A;  3A8O B;  1D0X A;  3EG9 A;  4X34 A;  2KVQ G;  3MEU A;  2GCX A;  1FMK A;  4HCK A;  2YXY A;  3EGX B;  4HVV A;  1TH7 A;  5GAN 4;  5GAN 2;  3CCS T;  4E7H A;  1H3H A;  2OX7 A;  3JV3 A;  4L6V 5;  2NWM A;  1OZ2 A;  3JCM f;  1D0Z A;  4Y91 A;  1OV3 A;  3AT1 B;  1I0C A;  2BUD A;  4M75 G;  4FCY A;  1IO6 A;  2PUK B;  2QDY B;  5ECA A;  4FW2 A;  2ATC B;  3E2U A;  1QQJ A;  3JRZ A;  3CC4 Q;  2KXC A;  4DOV A;  1EX4 A;  4M78 A;  2F1L A;  2EQJ A;  1RAI B;  4OB3 B;  1R77 A;  4RTZ A;  2K2V A;  1IB8 A;  1NLP C;  4OVA A;  1QWF A;  4PFZ A;  2PVD B;  4XTV A;  3MO8 A;  4WTO B;  3CCV Q;  4YTL A;  5GMK j;  4DEY A;  2XDD A;  5D6X A;  2NYS A;  4PLI A;  1YJW T;  2G3R A;  1G3T A;  5CQX A;  2CSI A;  2CKK A;  2FZC B;  1M30 A;  1UG1 A;  2EQM A;  1NE8 A;  4CC3 A;  4AG1 C;  3LYI A;  1KQS A;  1W2B A;  3CEY A;  3DB3 A;  2DXB A;  3G6E Q;  1ZUY A;  1MMN A;  3CCJ T;  3JCM V;  4J8O A;  3MEA A;  1N8R U;  4RG2 A;  4FM4 B;  5KE2 A;  2V8K A;  4M78 E;  4RTU A;  2Z0W A;  4M78 F;  2VWF A;  1K9A A;  3VUZ A;  5GAM f;  4ZTJ A;  2JJ9 A;  4PJO A;  3QKJ A;  5C6S A;  1M1K C;  3GF5 A;  3LGF A;  2JM8 A;  2R5M A;  1OEB A;  3CME T;  1Y96 B;  4LD9 K;  1LOJ A;  2ZPB B;  2LJ3 A;  2EFI A;  1G3Y A;  2VB6 A;  3RES A;  1B3Q A;  2WAC A;  3PGG A;  2HAX A;  1KC8 R;  1VQ7 Q;  4LN2 A;  4MZP A;  2DM1 A;  3FB9 A;  2F5T X;  2PVO B;  3AHU A;  1VQ6 A;  1OPK A;  2MMP A;  3I55 Q;  2D0N A;  2K2M A;  4BI4 A;  3JB9 H;  2PZ1 A;  4L59 A;  1D1B A;  1QVP A;  2W10 A;  2MK5 A;  1U1S A;  3CPF A;  3UPU A;  4E7J A;  3L42 A;  4FL6 A;  2IVW A;  3O5Z A;  2DRM A;  3CC7 A;  1TOV A;  2RHI A;  2ZAE A;  5GAO n;  1G3S A;  1DJ7 B;  2JTE A;  1SKU B;  5IHK A;  4QQ6 A;  4PK4 A;  1OPL A;  2BZX A;  2QTV A;  2M0Y A;  4OMF B;  4HKE A;  4AFQ C;  1AHJ B;  2HBP A;  4LNP A;  4PJO E;  4DQ2 A;  1Q81 C;  1VQM T;  1PG5 B;  4PJO F;  3EFO B;  4LUD A;  2VXF A;  4J7I A;  3GLX A;  1YJN Q;  4WF2 A;  2ROL A;  2DX1 A;  2DIQ A;  2CUD A;  2DZ9 A;  3A98 A;  1VQ5 Q;  2HSP A;  2EQU A;  1JBM A;  1OOT A;  5FU7 B;  4DBR A;  5M9O A;  4CC2 A;  3X25 B;  2K3X A;  2J06 A;  3C12 A;  3M4Y A;  1PSF A;  1UGR B;  2NUT A;  4C92 D;  5FU7 C;  3G71 T;  1QCO A;  2QEX T;  1FWZ A;  5LJ5 j;  5DM7 R;  2RK1 A;  3M9Q A;  3OYG A;  2DIG A;  1JEG A;  4J9F A;  1AWJ A;  5IXF A;  2VGN A;  2D9T A;  4KT0 E;  2YRV A;  4JPB W;  2LNH B;  2H8H A;  4HVU A;  1ZSZ B;  4M7A D;  4XQ3 A;  4MML A;  4HCC A;  4XTW A;  1YFN A;  1BI2 A;  2CH4 A;  3HRT A;  1ABO A;  1YN8 A;  4Z02 A;  2OTL Q;  3VU3 C;  3VS2 A;  3CC4 A;  2RB6 A;  2X3W D;  1ZSZ C;  2KT8 A;  1MGQ A;  2JS2 A;  3M0P A;  3LWH A;  2ZPI B;  2WSF E;  2CDT A;  5GMK e;  3WXM B;  3CCV A;  3OB9 A;  2RHY A;  1VQ8 Q;  1MHN A;  2J6O A;  3PIO A;  1UE9 A;  2EJG A;  2M0O A;  5KYU A;  2VKN A;  4AFZ C;  5GAN 8;  2DTI A;  3JCM W;  4O5V A;  4DBQ A;  1LVK A;  1PHT A;  4XU1 A;  4EMK A;  3SB2 A;  3CPW P;  3L2V A;  1T3S A;  3MJX A;  2QGF B;  1M1K R;  5IH2 A;  4FYY B;  2ECZ A;  2AZS A;  3X24 B;  1WQ7 A;  3ER0 A;  1J3T A;  3G4S T;  2J7I A;  4X9C A;  4KRT A;  4X1V A;  2FEI A;  5LJ3 e;  4KUI A;  2BIV A;  3EGD B;  3SWN B;  3UA7 A;  1SHG A;  3Q1J A;  1P92 A;  3CQT A;  2YUN A;  2L0A A;  3EHR A;  2L3P A;  1D3B A;  2CZ1 B;  4J9I A;  3CCU Q;  1K0X A;  2CGH A;  2X4X A;  3CCR A;  3SWN C;  3M56 A;  2QI2 A;  2JZ2 A;  3CC2 T;  1UHF A;  3CCR T;  1NLO C;  2LJ0 A;  1XNI A;  4LUE A;  4ZTF A;  1VQ9 A;  3QSU A;  4OF1 A;  2RHU A;  3OMC A;  2DIL A;  2EPD A;  1A0N B;  2ZPF B;  3GOX A;  3ULR B;  3CD6 Q;  2QA4 Q;  3CCQ A;  3I55 A;  4OP0 A;  1QVG S;  1VQN Q;  1IXD A;  2GTO A;  3VS5 A;  2COW A;  2I0N A;  3ZBD A;  2D6F A;  2KI7 A;  1QP3 A;  1GXI E;  2CP0 A;  1HSQ A;  3ASK A;  4OB1 B;  1Q81 R;  1SSH A;  3RDV A;  5KYY A;  3JB9 F;  2HDA A;  3F70 A;  5A0G A;  4PJN A;  1KQS P;  2DTH A;  1W2B P;  5GAM j;  2E5Q A;  1QKW A;  2EYY A;  2RQT A;  4M78 B;  4BE0 A;  2LCL A;  2A0F B;  2K6D A;  4FSX A;  2MAM A;  3C95 A;  3LGL A;  4PFO A;  3M0S A;  1X6O A;  2EVR A;  4VUB A;  1TXQ A;  3PT9 A;  2XG8 D;  2O88 A;  1YI2 T;  3I5S A;  5D7U A;  3ZL7 C;  1PNJ A;  4M78 C;  3VRY A;  4EMG A;  3CCS Q;  3KXT A;  2FZK B;  1WDX A;  1CKA A;  2JOY A;  2CYZ B;  2K4Y A;  4JS5 A;  2E70 A;  5HY6 A;  1VQ5 A;  2HBW A;  4M75 A;  3V8J A;  4N4G A;  4C92 G;  1VIF A;  2DL7 A;  3A8G B;  2IG0 A;  3MKD A;  2X4Y A;  3GBQ A;  3V7C A;  2LQN A;  2ESW A;  2XKO C;  4PNO A;  2VC8 A;  2EGA A;  2KMT A;  4E7I A;  1GL5 A;  2E5K A;  3VS1 A;  2DE0 X;  2ZZD A;  1AD5 A;  3PMI A;  1PC0 A;  3GP8 A;  3GNF B;  2LP5 A;  3RKW A;  1SRM A;  4M7A G;  2FL7 A;  2WSC E;  2O01 E;  3HKS A;  1M8M A;  2YDL A;  2WSE E;  1TG0 A;  2M1H A;  2BTT A;  3BE3 A;  3CCM T;  2LTO A;  3QJY A;  2E6Z A;  4V2S A;  4JRI A;  2FYK A;  1OI1 A;  1NM7 A;  2OTL A;  4GBQ A;  2EYQ A;  3CCL T;  2V8J A;  1K4U S;  1V76 A;  5A2Q E;  3GIB A;  2DVE A;  4M77 A;  3C0C A;  4PJO C;  3QWX X;  4M75 E;  2ED1 A;  3O8V A;  1NJI C;  2EYW A;  4M75 F;  4M7D A;  1VQ8 A;  3E9F A;  1N9S A;  1RI9 A;  2RF0 A;  1VQO T;  3HP9 A;  2KY9 A;  1QVG A;  1YJ9 A;  3DKM A;  3HRU A;  1FXX A;  2QQ9 A;  2Y4X A;  2OI3 A;  3VYH B;  1V1C A;  2K79 A;  1VQK A;  1D1A A;  3WVD B;  1JRI A;  2KGT A;  5CK9 A;  1YHQ T;  3G1J A;  3NTK A;  3T9N A;  2CZ7 B;  2FZG B;  2X3X D;  4E47 A;  4GY5 A;  3CXC P;  1WNL A;  3QHS A;  2DJZ A;  4CRI A;  2K57 A;  4R56 A;  3CME Q;  3QXE B;  2E64 A;  3NMZ C;  3URG A;  2XHC A;  4AT1 B;  4ZNX A;  3FIF A;  2KRO A;  4FW1 A;  1M4Z A;  1VQ4 Q;  2QQA A;  5GAN h;  2QQR A;  4E7K A;  3PVQ A;  3TEE A;  4M77 E;  1BI3 A;  4C92 B;  4ZGJ B;  2FB7 A;  4M77 F;  3PMT A;  4TVR A;  2E12 A;  1I81 A;  1MV3 A;  4M7D E;  2CS7 A;  2EWN A;  3FC3 A;  4IIM A;  4M7D F;  2RJF A;  1YIJ T;  4D8K A;  2A28 A;  2QGG A;  1TSF A;  2NUP A;  2KAF A;  4II1 A;  3QYH B;  1QVF A;  4M7A B;  5EG2 A;  1VQL Q;  1HXD A;  1LPL A;  2E3I A;  3X26 B;  3CD6 A;  1G2B A;  2QA4 A;  1VQN A;  2C0I A;  5IXB A;  2DAQ A;  2DLP A;  2EGE A;  5GAO l;  2L8D A;  4AFU C;  3EFS A;  3BW1 A;  2SRC A;  1WJS A;  1K1Z A;  3TSZ A;  1M2O A;  4OMO A;  4OGC A;  3OYH A;  2F2X A;  2DTO A;  2OJ2 A;  3UWN A;  2O9S A;  3I56 A;  2DEU A;  1JJ2 A;  1XQH A;  4ELZ C;  2KE9 A;  1KC8 U;  3R6N A;  3JCM Q;  3PIP A;  1E6H A;  1B7T A;  1X6G A;  2MCN A;  4PJM A;  5I22 A;  1QMC A;  4A4G A;  3G71 Q;  2L89 A;  4J5Y A;  2EGC A;  3ZEH A;  4E7Z A;  4XTZ A;  2KRM A;  1RAG B;  3SFM A;  3H6Z A;  5KE3 A;  3M59 A;  1TWB A;  1WHJ A;  3M57 A;  3UDC A;  2O4X B;  4C5E A;  4CI0 C;  5KYU B;  5LL6 S;  3RMQ A;  2ZGW A;  2Y90 A;  2MI6 A;  3A1P A;  2YLC A;  4KGZ B;  1IRE B;  4NL3 A;  2LT1 A;  1UGV A;  1WX6 A;  4M78 D;  2XDP A;  4J7F A;  1WXU A;  2RI3 A;  5CCA A;  5FRM A;  1TUC A;  1ZBX A;  1Y0M A;  4C8Q B;  1ZQ1 A;  5AT1 B;  4XAX B;  1X2K A;  2LMJ A;  4X9D A;  2YWW A;  5I21 A;  5AYF A;  1NJI R;  1T0H A;  5IN1 A;  2DXT A;  4C0D C;  1D3B B;  4C8Q C;  3H9N A;  1RAE B;  1IGQ A;  5KYW A;  2E1H A;  1VQP Q;  3CCE A;  2SEM A;  3EHQ A;  2ED0 A;  4RTT A;  2D8J A;  2DK3 A;  2F69 A;  2XK0 A;  2DYI A;  3R6O A;  1ZUK A;  3FJP A;  3QZ5 B;  1WYX A;  1H3Z A;  3H0F A;  3G4S Q;  2KK4 A;  1M3B A;  2PU9 B;  5GAN d;  3CXC S;  1QCN A;  1UGP B;  2LZ6 B;  2V26 A;  1D1C A;  2CSQ A;  4ESR A;  1T0J A;  1XTD A;  2FPF A;  2JUF A;  3OYE A;  4DBF A;  1AWX A;  2GNC A;  2JMA A;  5GAN 7;  2P4T A;  1MND A;  4F7U G;  3VV0 A;  1VA7 A;  1AWW A;  2JMC A;  3E9G A;  4Z89 A;  4PJO D;  1O75 A;  3D7S B;  3P8D A;  3CC2 Q;  1MUZ A;  1NPR A;  3REB B;  2NUZ A;  2RI5 A;  4CC4 B;  1V29 B;  1VQ6 T;  3NTI A;  1RUW A;  2P0P A;  3QUI A;  3UF4 A;  5LJ3 g;  2MYS A;  3M55 A;  1PSE A;  4CC7 A;  4ZGD B;  1UB4 A;  5GMK m;  2JM9 A;  4ZN3 A;  3N5B B;  2CP7 A;  2XI9 A;  1YIT Q;  2XDB A;  1FX7 A;  3ZFJ A;  2HZY A;  3CC7 T;  4NOY A;  2X51 A;  2RN8 A;  3VS3 A;  1ACM B;  4FU6 A;  1X43 A;  2ROT A;  2MWO A;  3EH1 A;  3OW2 P;  4BUG A;  3M53 A;  4AG2 C;  1QP2 A;  1M1K U;  1W6X A;  1Q86 C;  1M2V A;  7AT1 B;  5GMK i;  5D6Y A;  4JJN K;  2DYB A;  4JZ3 A;  1FMV A;  2MIO A;  5GAO p;  4IKF A;  5L23 A;  2AKK A;  4EDU A;  4MZM A;  3TCJ A;  2E41 A;  1S72 Q;  1Q82 U;  1VQL A;  1OUL A;  3E19 A;  3OS0 A;  4DA4 A;  3QWY A;  1YI2 Q;  1YWO A;  1WFW A;  3J7A F;  2RQW A;  4HA8 A;  1E7O A;  5KYX B;  1BU1 A;  5GMK h;  4D8D A;  1BIB A;  5IAY A;  1AOJ A;  2OTJ Q;  2O2O A;  3TRE A;  4UC4 A;  1NEG A;  1K8A C;  4RG8 A;  5J3B A;  3NGP A;  4IUQ A;  1YCS B;  3FDR A;  1SG5 A;  1R0B G;  2DEQ A;  4JLG A;  1UJ0 A;  3CMA Q;  3X20 B;  2DD5 A;  2M9U A;  4HT9 A;  4QQG A;  2HQE A;  3KBG A;  3MP1 A;  3EG1 A;  5DY9 A;  3OS1 A;  5FWB A;  1Q81 U;  2H3J A;  2XU8 A;  3P8B B;  1N9R A;  4OGE A;  3QZ9 B;  4QKU A;  4XU2 A;  3MEW A;  3NFC A;  1IHV A;  1X2Q A;  4F7U B;  4M78 G;  3CC4 T;  1WGS A;  1IGU A;  2GTJ A;  2PUO B;  5LJ3 h;  1HYO A;  2CZ6 B;  4M7D C;  1KFZ A;  3HRS A;  2DMO A;  2LC4 A;  2C0O A;  4WCI A;  4IUR A;  1NEB A;  3CCV T;  2M51 A;  2ABL A;  2V1R A;  2KQW A;  2L3S A;  1W1F A;  5GAO m;  4RCC A;  3INZ A;  5J26 A;  2A36 A;  3FRN A;  2QAS A;  4F14 A;  2AIR B;  1VQO Q;  1QKX A;  1BIA A;  2P4R A;  3L1A A;  1KQ2 A;  4PKC C;  1JJ2 P;  1RLQ C;  1TUD A;  3LW5 E;  2KSS A;  4F17 A;  3UT1 A;  3OQ5 A;  4BAC A;  2E4H A;  1Y57 A;  3H41 A;  2YLB A;  1E6G A;  1TU0 B;  5GAN 5;  3G6E A;  1YHQ Q;  1VQP A;  2RNA A;  2FPD A;  4BD3 A;  3M0U A;  2COZ A;  4RTV A;  4BDZ A;  3BFM A;  3OYB A;  3EAE A;  5CR2 A;  3QDF A;  2LNV A;  3JB9 D;  1W4S A;  4Y92 A;  2D0Q B;  2LRQ A;  2ENM A;  2NUP B;  3NPF A;  4JRK A;  2DER A;  4EMH A;  4ELY C;  1WQW A;  4C8Q D;  1PKS A;  2P0Q A;  1WZO A;  3VS0 A;  1R0C B;  1ZUU A;  2DFU A;  1K73 C;  1GFC A;  4PJO G;  3MEV A;  4J83 A;  3TSW A;  1VOM A;  4E7S A;  2KDS A;  3OYK A;  4NS5 A;  3HSB A;  2QG9 B;  1UEB A;  2RQU A;  3C4S A;  1K0S A;  3EG9 B;  1VQ7 A;  3VJP A;  1HK9 A;  2HSE B;  5HK0 A;  1AWO A;  1VQ9 T;  3LLR A;  4EIK A;  3I5R A;  4J9H A;  2X35 A;  3LH0 A;  3PE0 A;  3LX7 A;  4FT2 A;  3HPW A;  1Q86 R;  3JAM E;  3OW2 S;  4F04 B;  3I55 T;  3CCQ T;  3GNG A;  3J81 E;  4FT4 A;  1PWT A;  1KHC A;  1Q7Y C;  1R8O B;  4A4E A;  1ZHI A;  5FRN A;  1JO8 A;  1RLP C;  1MNE A;  1YIT A;  4KBM B;  4JJC A;  1M90 C;  4A4K A;  1I1J A;  1BKB A;  1KSW A;  2VV5 A;  3MET A;  2EYX A;  2J6F A;  2AHJ B;  2DNU A;  1IZ6 A;  2X9H A;  2DZC A;  1KK7 A;  4FYW B;  1PD1 A;  3L2Z A;  1JXO A;  1PM3 A;  4OML A;  2RH2 A;  2JN0 A;  1FYN A;  3QYG B;  4DOW A;  1K8A R;  2RJE A;  1S72 A;  2LJ1 A;  1YJN A;  5GAN g;  2CP5 A;  2RI2 A;  2YUP A;  2FRW A;  3QPH A;  3OA6 A;  1AEY A;  3PFS A;  1UGQ B;  1M1F A;  1VQ5 T;  5IHN A;  1IHW A;  4Q5W A;  2E10 A;  4IUU A;  3HHT B;  2J6K A;  5LJ3 d;  3H8Z A;  3JB9 J;  2JT4 A;  1JB0 E;  5CVI A;  5LJ5 e;  3FLG A;  3KUF A;  4HXJ A;  1XJW B;  2OTJ A;  4KGV B;  2GBQ A;  2QAZ A;  1KD1 C;  2RMO A;  2RJC A;  4KGX B;  5GMK l;  3CMA A;  1C6V X;  1WJQ A;  1GCQ A;  5LJ3 f;  1BYM A;  2FO0 A;  2RJD A;  1ZLM A;  1YJW Q;  2GGR A;  3JCM c;  3OYJ A;  1ARK A;  3OYD A; 
#chains in the Genus database with same CATH homology
 3TQ7 P;  2HQH A;  1TOV A;  2CP7 A;  2M02 A;  1WHG A;  1WHK A;  2CP5 A;  1WHM A;  2E3H A;  2E4H A;  2Z0W A;  1IXD A;  2HL5 C;  2CP2 A;  2COW A;  2HKQ B;  2MPX C;  2QK0 A;  2CP0 A;  2CP6 A;  2COY A;  2CP3 A;  4B6M A;  1TXQ A;  3RDV A;  2COZ A;  3E2U A;  1WHJ A;  2HL3 A;  2HKN A;  1LPL A;  2E3I A;  1WHH A;  1WHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...