1NEGA

Crystal structure analysis of n-and c-terminal labeled sh3-domain of alpha-chicken spectrin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLAAAWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid purification and crystal structure analysis of a small protein carrying two terminal affinity tags
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1negA00
2MOXA 3RNJA 2EPDA 2C0OA 2RQVA 1E7OA 2FRWA 4RTUA 1W70A 1UGVA 1WXBA 1K76A 2DE0X 1SHFA 2A37A 2O88A 1Z9QA 1SPKA 1UDLA 1UFFA 1WDXA 2J06A 2O2OA 2RN8A 4AFQC 1WXUA 2HDAA 1ARKA 2NWMA 1RI9A 1KIKA 2K6DA 2LX7A 2K3BA 2YSQA 2F2WA 2DA9A 1H3HA 1SRMA 1M30A 1MV3A 1JQQA 2JTEA 1PRLC 2P4RA 2KR3A 1G2BA 2KBTA 2DL4A 1X2KA 5IXFA 1ZUYA 2FPDA 3THKA 2GNCA 2EKHA 2RQWA 1YNZA 2RF0A 4HVWA 2LQWA 2KYMA 1T0JA 3FJ5A 4RTTA 1JEGA 2AZVA 1SSHA 1UECA 1PKSA 4D8KA 4R0KA 1JO8A 1MV0B 2J6FA 1T3LA 2A36A 2F2VA 3M0SA 3KFVA 1PRMC 5IHKA 3QWYA 1H92A 1B07A 1NYGA 2CT3A 2LCSA 4RUGA 1AWJA 2GQIA 2YDLA 1QLYA 1GCQA 2CSIA 1TG0A 2NUZA 2FEIA 2DRMA 4CC7A 1CSKA 1NLOC 2C0TA 3EG3A 2AK5A 2YUNA 2EGEA 3H41A 1AWOA 4RTYA 4DEXA 3O5ZA 2KGTA 3EHQA 1YCSB 1M8MA 2I0NA 4WCIA 2DBKA 5FW9A 1X69A 4E6RA 4F17A 2FO0A 1UTIA 2ROTA 4ZNXA 2B86A 2C0IA 1U5SA 4Z89A 3NMZC 4OMNA 3VS5A 1RUWA 3ULRB 1K0SA 3VS4A 2V1RA 1W1FA 1KFZA 2BZXA 1Y57A 1GFDA 1WLPB 3NPFA 5FWCA 5IHIA 3IQLA 3NHNA 3UF4A 2FRYA 2K79A 1MUZA 1YWOA 2KRSA 2LJ1A 4A63B 1PKTA 2PNIA 1I1JA 2CH4W 1GFCA 2CREA 2DF6A 2LMJA 1JXOA 4JZ4A 2D8JA 2GTJA 2BTTA 2DBMA 2SRCA 2D1XA 3VS2A 3QWXX 2EGCA 1PNJA 1JXMA 2D8HA 1YP5A 1B3QA 1TUCA 1YWPA 2DL5A 4KRTA 1ZUKA 1WYXA 3CQTA 1OEBA 1GRIA 1VYVA 2VKNA 3TVTA 2W0ZA 2ED1A 2W10A 3EGUA 2K9GA 1PWTA 1K9AA 2KT8A 4CC3A 4CC4B 4HCKA 1U06A 2PTKA 2CUDA 1NYFA 2JXBA 1K1ZA 2RNAA 1M3CA 2DNUA 4JJBA 1XOVA 2KRNA 3EG1A 1KJWA 2EW3A 2K2MA 2F2XA 1OPLA 2YUQA 2H8HA 2RQRA 1K4US 2LJ3A 1PHTA 2DRKA 5HCKA 3UA7A 2KXCA 4LE9A 1AVZC 2ECZA 2X3WD 4D8DA 2EYZA 2K7AA 4EIKA 2OJ2A 2DYBA 5ECAA 1HSQA 1JU5C 5EC7A 2J6KA 2L0AA 4HVUA 1WXTA 1M3AA 1QWFA 1V1CA 4F16A 4OMOA 2AZSA 1UJYA 1A0NB 2AKKA 3I9QA 4AG2C 2CH4A 1FYNA 2RMOA 2DVJA 2DILA 4OMQA 4GLMA 3EG0A 1J3TA 2L3SA 2ED0A 4Y92A 2MCNA 3R6NA 2L2PA 2MIOA 1E6GA 4RTWA 2GBQA 4LUEA 4J9DA 1ZUUA 1AZEA 1UJ0A 4J9HA 4LUDA 4DEYA 1FMKA 1GBRA 2EBPA 1QKWA 2ABLA 2QDLA 2L3QA 2JM8A 3JV3A 1RLPC 2JS2A 1U3OA 1KSWA 3RBBB 2CT4A 1SRLA 2KNBB 2DM1A 1M27C 3REBB 2XMFA 5GJVB 1X6GA 3SEMA 1WI7A 1M3BA 2LQNA 4J9EA 1HD3A 2RQTA 1AD5A 1Y0MA 1LCKA 4M4ZA 2J7IA 1AZGB 1OV3A 1NEBA 1WA7A 4Z8AA 1NLPC 3M0PA 1E6HA 2KYBA 3ZL7C 2KE9A 2JMCA 1I07A 3UA6A 2KROA 4AFSC 1YN8A 2KRMA 2YUPA 2L3PA 4F14A 2EYYA 2HBWA 4Z88A 2A28A 1W6XA 2EYXA 4JJDA 5I11A 1Z9ZA 1NEGA 1VA7A 1ZX6A 2V1QA 2DLPA 3H0FA 1OPKA 1ZBJA 2VVKA 1CKBA 1ABQA 2HCKA 3PVQA 1X2QA 4RTXA 4X1VA 4JPBW 3UATA 2OI3A 3I5SA 3REAB 1QKXA 4J9IA 3VS0A 1AOJA 3NGPA 4AFZC 2EGAA 1UG1A 2E5KA 1S1NA 3H0HA 1X27A 1TUDA 3VS3A 1K0XA 4HXJA 2BZ8A 2O9SA 2DL3A 2JS0A 3PVLA 3VRYA 2CUBA 2X3XD 2JW4A 2A08A 4FSSA 2D0NA 2ENMA 2SEMA 5FWBA 1X6BA 5L23A 3TSZA 3M0TA 2ROLA 4ORZA 2RPNA 2J6OA 4JJCA 4J9CA 2DX1A 3VS7A 2KEAA 2DL8A 1AWXA 4CC2A 1GL5A 2YT6A 2O31A 4LN2A 3GBQA 3VS6A 2OAWA 1VYTA 2DMOA 1EFNA 1H8KA 2AKLA 5IH2A 3TSWA 1ZSGA 3M0UA 2G6FX 1UUEA 4LNPA 2VWFA 1SHGA 5IHNA 3VS1A 3C0CA 2FPFA 1WFWA 4IIOA 4OMMA 1WX6A 3LH5A 3I35A 2HEQA 2KT1A 1GCQC 2GGRA 1N5ZA 1NG2A 4IIMA 3U23A 2IIMA 2KXDA 3SHWA 2O9VA 4AFUC 1GBQA 2J05A 5IXBA 4GBQA 2CSQA 3PE0A 4RTVA 2ESWA 1UHFA 4J9GA 1BBZA 3M0QA 3VRZA 2JMAA 4J9FA 1WIEA 1NM7A 4ESRA 2DJQA 2RQUA 2EQIA 1CKAA 1IO6A 2LP5A 1QWEA 4RTZA 5I22A 2YUOA 2CDTA 3H0IA 2LJ0A 3I5RA 2LZ6B 4JZ3A 4J9BA 1BB9A 1HJDA 1AEYA 1UHCA 3A98A 2FPEA 1VYUA 1ZLMA 1BK2A 2FG0A 1QCFA 2JT4A 1T0HA 4HVVA 3M0RA 2DL7A 2BZYA 1AWWA 1T3SA 4OMPA 5GJWB 1OOTA 2JM9A 4K11A 2M0YA 2LNHB 4OMLA 2EVRA 1GCPA 1UE9A 1I0CA 1RLQC 2HSPA 2M51A 1SEMA 2EYWA 2GTOA 4AG1C 3EHRA 1ABOA 2PZ1A 4QT7A 1BU1A 3EG2A 1X43A 1G83A
chains in the Genus database with same CATH superfamily
1BIAA 2QQSA 1BI0A 2A7YA 1VQ7A 1K76A 1WGSA 2HSEB 1SHFA 3KXTA 1M90U 5GANd 4ELZC 1UFFA 1VQOT 4ZTJA 4MZPA 2HQHA 3MP8A 3ZFJA 3PNWC 2KDSA 4HT9A 5FU6B 1KIKA 2RM4A 9ATCB 3EFOB 2K3BA 2VV5A 2OX7A 1SRMA 4NS5A 1MV3A 3OYLA 3JCMe 1EIFA 5FU7C 1WJRA 2DL4A 4XTYA 5CIUA 5IXFA 1YITQ 1ZUYA 4LXCA 5GMKj 3BY7A 3FB9A 3MEWA 3CC2Q 2XK0A 3WXMB 3SB2A 4QQDA 3DB4A 3META 4RTTA 2RI3A 2NUPB 5LJ3f 4M7DB 1D0XA 4R0KA 1VQMT 3SD4A 1M1GA 4KBMB 5FLXE 5IAYA 1PSEA 3JB9H 4J6WA 4DBFA 1W2BA 2MK5A 3OYBA 4AT1B 2DETA 4M75G 1I5LA 2NYSA 1VQ7Q 1GCQA 5GAMg 1YHQT 4JLIA 1TG0A 4DBQA 3JRZA 2NUZA 2DRMA 2E1HA 3DB3A 2OTJT 3HFNA 4A53A 1V29B 2KGTA 1YCSB 2YRVA 3OW2S 4F17A 1UTIA 2ROTA 5J3BA 4RCCA 4Z89A 3CMEQ 2X35A 2RHYA 3RUXA 4C5HA 1RUWA 3ULRB 3OYFA 1K0SA 4A4KA 1IZ6A 1Y57A 4QQGA 1X01A 1WLPB 3TCJA 3IQLA 3JCMW 1Q81U 2JUFA 3I56T 4PJOD 2KRSA 2LJ1A 4FYWB 2CH4W 3X28B 4A63B 2DF6A 2PUOB 2M1HA 4OB3B 1JXOA 4JZ4A 2SRCA 2DEQA 2D1XA 3I56A 1IB8A 3VS2A 3CC7Q 3QWXX 2EGCA 3C95A 1M2OA 1JXMA 4ATOA 1JJ2S 2D8HA 1YP5A 1TUCA 1YWPA 1VOMA 3CPWA 5A0GA 2HD0A 4QQ6A 3MEVA 3L42A 4XQ3A 3TVTA 4HCCA 2PVOB 1K9AA 4CC4B 1NJIU 3X20B 2CUDA 4M7DD 3CBMA 3PMTA 4JJBA 3L2WA 1EZZB 5DLOA 2OTJA 3EG1A 1KD1C 2EWNA 4C92D 4ZGEB 2H8HA 2RJCA 2RQRA 1K4US 1R0BG 1N6AA 1G3YA 2XG8D 4EMGA 2RHXA 2KXCA 4LE9A 4M77C 2ECZA 1UGRB 3P8DA 3QYGB 3CC7A 4LD9K 1QVGP 2K3XA 3QJYA 3G4ST 1I8FA 2CKKA 1N9RA 1WPYA 3TREA 4OVAA 1WXTA 2P0KA 3LYIA 5M9OA 1HYOA 1V1CA 3PIOA 3CD6T 4M75E 4OMOA 2DKGA 2AIRB 4AG2C 2CH4A 2RMOA 2YLCA 2DVJA 4OMQA 4YTLA 4EMKB 4PKCC 3EG0A 4R56A 2ZZDA 2P0PA 3X26B 1RL2A 2ED0A 4EMHA 3VJPA 1VQ8T 4ZN1A 4PL6A 1N9SA 1E6GA 4PJOF 3JB9I 2CS7A 1UJ0A 4DEYA 1ZBXA 2EBPA 4F7UF 1VQNT 2QDLA 2L3QA 1YIJT 1YITT 1RLPC 1BCOA 4C92A 1KSWA 2CT4A 3DLMA 1IHWA 2VB6A 4QKUA 1SF9A 3QZ9B 3A8HB 4M4ZA 1EX4A 3CCJQ 2M02A 3NTKA 2HKQB 1RAAB 2B8AA 4OP0A 1NLPC 5D6YA 3JCMJ 2RK1A 1E6HA 3CEYA 2R57A 4LDWA 1PSFA 2E3IA 3I55Q 4JJDA 2D6FA 4M75A 1VA7A 5D6WA 1KQSP 3ZEHA 2LT4A 2DLPA 1OPKA 2RJDA 3QG1A 2K57A 1VIFA 3E9GA 3PVQA 4WF2A 1YHQA 1AOJA 3G6EA 4GLKA 4DQ2A 4RCBA 1VQLQ 3JB9F 4MDXA 3CCVT 1KC8R 1M1KU 2XHCA 2OTJQ 2BZ8A 2VASA 3PVLA 3VRYA 4Q5WA 2A08A 4ZTFA 1OULA 5FWBA 2SEMA 4PLIA 1W2BP 5C6SA 1PD1A 1KC8C 2COWA 4N4HA 4C92E 4ANJA 3AHUA 3RKXA 2CGHA 2F5KA 3A8OB 3CC7T 3JCMg 1VYTA 1RADB 5IT9E 2HL5C 5AT1B 3CCET 2AKLA 3CCRQ 4TVRA 2P84A 3M0UA 3EAEA 1LPLA 1FWZA 2RB6A 3PIPA 1NZ9A 2HQEA 2DIGA 5GMKe 2FPFA 2QG9B 2DYIA 3OSVA 1OQKA 2KT1A 4M75C 5I21A 4JRKA 3U23A 2IIMA 2QK0A 1SSFA 2O9VA 1OI1A 1JJ2A 1B7TA 2ZPHB 1VQ7T 3ME9A 1JJ2P 4M7AF 4CRIA 5FU7B 1BBZA 2JMAA 1WIEA 3M4GA 3HPWA 3MHXA 2L3RA 4J7IA 5GMKh 2X4WA 1QWEA 2YUOA 3V7RA 5DY9A 2DO3A 4F7UG 5J39A 4J9BA 5I2SA 3M54A 1VQ6T 1RAIB 3CD6Q 3A98A 4PJLA 1ZLMA 4XU2A 4BE0A 2LRQA 1T0HA 3CPWP 3M0RA 5GAN4 3MEUA 1YFNA 1FMVA 4Z02A 3SDZA 5KE2A 2JM9A 3T9NA 2LNHB 3OYYA 2LC4A 2EVRA 4MMKA 2HSPA 2M51A 3CCMQ 3KUFA 2GTOA 4E7JA 2FYKA 3EHRA 4QT7A 5KE3A 2RI2A 1TS9A 4BD3A 2C0OA 2RQVA 4FT4A 1VQKT 5KYUA 4RTUA 3S3NA 1K73U 2F5TX 1UGVA 3CCMA 4RG2A 4M7AE 2DE0X 1OX8A 3SWNB 1D3BB 1Q7YU 1RAEB 4KT0E 3LW5E 2O88A 4PK4A 4IUTA 1UDLA 1WJSA 1G5VA 2HBPA 4JS5A 1RACB 5GAMe 2RN8A 3JCMf 1VQ5T 2PVDB 4A4EA 2P4TA 2QEXT 1QVGA 4N4IA 1QQJA 5FROA 5CKEA 1YJNQ 1YITA 1XQHA 2DA9A 3LX7A 2IG0A 2KSSA 2JTEA 4FU6A 2LT1A 4PJMA 2KR3A 1FXXA 4Y91A 3H8ZA 2EKHA 3NTHA 4X34A 2RQWA 1YNZA 2KYMA 4C92F 3CCSQ 2AZVA 4JDSA 1UECA 3OYAA 1PKSA 4D8KA 3CCJT 2K3YA 3FRNA 2DXCA 1HXDA 3OYMA 4M78E 2E3HA 4FYVB 3M0SA 1WHHA 1LJOA 1PC0A 1PRMC 3QWYA 1H92A 2CT3A 1G3WA 2LCSA 4E7ZA 4OB1B 3CCQA 1LOJA 1NE8A 4BI8B 2YDLA 1QLYA 4J8OA 4GY5A 1R8OB 3INZA 1VQPA 3M5AA 5L8RE 2A3LA 4CC7A 1KQSS 1NPRA 3QIIA 3H41A 5LJ3j 2QDYB 2QTXA 3EHQA 1WHKA 4JRIA 5FW9A 4BB7A 1X69A 4RMOA 3X25B 2FVUA 3E2UA 2DTHA 2B86A 2DD4A 1N8RR 3VS5A 2E12A 1YJ9Q 2YWWA 2LQKA 4QW2A 1KFZA 1GFDA 3G1JA 3QPHA 3NPFA 4OB0B 5FWCA 5IHIA 5HY6A 3NHNA 3C94A 3UF4A 1YWOA 3CCLT 1PKTA 2LVMA 2YHTA 2PUKB 1RI0A 4UC4A 4C5IA 2Y90A 2BTTA 3BFMA 4VUBA 1K8AC 1Y96B 2YRCA 1M2VB 3N5BB 5KH6A 4J6YA 2A0FB 2E4HA 1C0MA 3I55T 2DL5A 3CCRT 4KRTA 1WYXA 2MWOA 1VYVA 2VKNA 2V8IA 4F7UE 4LDUA 2W0ZA 4PJOG 2W10A 3EGUA 2K9GA 5LJ3d 2KT8A 4CC3A 3DKMA 1U06A 2PTKA 1WQWA 1K1ZA 1VUBA 1TOVA 3M58A 2ZPEB 2KRNA 3G71T 2Z0WA 2NUTA 5CKDA 2K2MA 2KVQG 3VU3C 2YUQA 4HCZA 1PHTA 3CXCA 2DRKA 4M7AA 5I2MA 2EQMA 2EYQA 1AVZC 3JCMV 4OB2B 2BE7D 4PFZA 4PJOA 5CVIA 3OYJA 1VQPT 1HSQA 5EC7A 1K73R 3VKIA 2MF2A 3OYDA 1D0YA 2RHZA 1QWFA 1K9MR 4F16A 5CO7A 2RO0A 4DOVA 4DOWA 1TXQA 1VQMA 2QQBA 3I9QA 2EQJA 3PGGA 2L3SA 3E9FA 3QDRB 2YRDA 1XTDA 3HHTB 4XTUA 1MNDA 2L2PA 1BI3A 4OMFB 1KK7A 2GBQA 2QA4Q 4EDUA 3CCMT 1V76A 1GXIE 4J9HA 2EJGA 1YJNT 4XTVA 2ABLA 1N27A 2KK4A 4HT8A 4C0FA 2JM8A 2VC8A 3JV3A 3G6ET 3EGDB 5LJ5f 4BI3A 4PJOC 1MMNA 4PLLA 1X6GA 3CCRA 2FZKB 4NL2A 3PFSA 2HQXA 3OYHA 2EQUA 3RKWA 5C0MA 5CCAA 3RERA 1VQ8Q 4C92C 4FYYB 3RIRA 3M0PA 2CP7A 5KYXB 2FB7A 3OYGA 2HL3A 2KE9A 3CCEA 4AFSC 2JN0A 2YUPA 4IUVA 3ZBDA 4F14A 3CC4T 3TQ7P 4Z88A 2A28A 1W6XA 3BW1A 3GNFB 2VXFA 1SKUB 5GMKl 2ZPGB 3V8LA 5KYWA 4C0GA 3OQ5A 2H3JA 1VIEA 2V1QA 2DPPB 3H0FA 1VQLA 1ZBJA 2GCXA 4M78D 1ABQA 1VQKA 4E2FB 4RTXA 4X1VA 3REAB 1YJ9A 3C12A 3RESA 2HNIA 3NGPA 1M2VA 2V8JA 2EGAA 3CCUQ 4HA8A 3JB9D 2AHJB 2E5KA 3C4SA 1R77A 3H0HA 1KHCA 3OS5A 4DBRA 4HXJA 1M1KR 1ZHIA 2DL3A 2PVGB 2CUBA 2X3XD 1QCOA 3EG9B 1PCXA 1Q86R 2KQWA 2LQ8A 1VQ9A 4A4FA 3AT1B 2D0QB 3QHSA 3TSZA 2DAQA 4C8QD 2ROLA 4ORZA 3A8GB 3R6OA 2J6OA 4J9CA 2RA2A 3VS7A 2DL8A 1ZA1B 2ZCFB 1GL5A 3SWNC 4IUUA 3CCQQ 3VS6A 1XNIA 3CCLA 5GAN2 5IH2A 4F7UB 1U1SA 3TSWA 1M9SA 4M77E 4LDXA 2G6FX 2QEXQ 1UUEA 4LNPA 2E10A 3GPLA 3OB9A 2JZ2A 2E41A 3S3MA 1Q82R 1SHGA 3V7CA 4A4GA 4OMMA 1WX6A 4RG8A 2ZPIB 4JS4A 2DD5A 2HEQA 2GGRA 4C8QG 4X9CA 1N5ZA 1NG2A 2GFUA 1WHGA 5GAMj 4AFUC 2J05A 4M7DC 1OYXA 2ZAEA 1LVKA 2CSQA 3PE0A 5GAN6 2MAMA 1SG5A 3HSBA 1IHVA 3M0QA 2DTIA 2NUTB 2DJQA 2RQUA 2EQIA 1KD1U 1YJNA 5CKBA 5GAOl 4EMKA 5I22A 4NOYA 2K2VA 1RAGB 3FDRA 2CDTA 1ACMB 2KI7A 1UGSB 2M9UA 4JZ3A 2F1LA 1M1FA 2QAZA 1HJDA 1R0CB 3JCMX 2FG0A 4MZTA 3QXEB 5GMKm 4HVVA 4N0AA 2EIFA 3OYIA 5GAN5 1RABB 5HKCA 1AWWA 2EFIA 1YJWA 4OMPA 5GJWB 2M0OA 4OMLA 4KGZB 4FCYA 3P8HA 1OZ2A 2E64A 1UE9A 1I0CA 3WVEB 4B9WA 1YI2Q 2O01E 3A5ZB 2PZ1A 3EG2A 1G3SA 3UDCA 4C5GA 5A2QE 3NFCA 2MOXA 4FW1A 1E7OA 2FRWA 2JTFA 1BIBA 5HK3A 1W70A 1UGQB 1WXBA 4M75D 4IUPA 2E70A 2A37A 2FZCB 2ZPBB 3VUBA 4BE1A 1G8XA 2O2OA 4AFQC 3EH2A 4M7DE 3CPFA 3I56Q 2NWMA 1RI9A 2QA4T 3EGXB 5AYFA 5GANg 2K6DA 2LX7A 2YSQA 1M30A 1JQQA 2HZYA 3JSCA 3H9NA 1PRLC 3JAME 2KBTA 1TWBA 2K5FA 2FPDA 1PG5B 3THKA 3L2RA 2E65A 2GNCA 2MWPA 2MPXC 5GAOq 3BDLA 4XTXA 2RF0A 3SFMA 3A1PA 1T0JA 3FJ5A 3OYNA 1SSHA 4M77G 2Y4XA 3CMEA 1VQ5Q 1JO8A 4N0AC 1S72Q 1T3LA 2A36A 3HTRA 4BACA 1KC8U 1YIJA 4M7AB 5IHKA 3MP1A 4WTOB 1NYGA 4E7SA 1VQNA 3GP8A 3JCMb 2CZ7B 4RUGA 1U1TA 1AWJA 2GQIA 2CZ6B 4E7LA 3S6WA 3MPUB 2DZ9A 3QBYA 3O8VA 2C0TA 3EG3A 2AK5A 1Q82U 1AWOA 2FHDA 5CKFA 4RTYA 1U8RA 2GF7A 2GFAA 1M8MA 3RKYA 3G4SQ 2I0NA 4R55A 2QI2A 4WCIA 1YJWQ 5KYXA 4J7FA 2FO0A 2R5MA 1U5SA 1Q86C 3RR6A 3VYHB 4M7AD 4OMNA 1M1KC 3VS4A 3HP9A 1YHQQ 1W1FA 4ZN3A 1Q86U 3CC2A 2KY9A 3G71A 2JNGA 4XTZA 1MUZA 3BE3A 1AT1B 1I1JA 2CREA 3HRTA 1GFCA 2PNIA 1NBEB 3GF5A 2L5QA 3J7AF 2GTJA 2CZ1B 5KYYB 1BKBA 3HL8A 2D9TA 2ZGWA 2DBMA 4V2SA 4JRQA 1D1CA 3CMAQ 3CC4Q 2FL7A 1RAHB 3CMET 3CC2T 1B3QA 3CCVA 3M55A 3Q1JA 1GRIA 1P92A 3HKSA 3DLLA 4M77B 1DJ7B 4L6V5 2WSCE 2ED1A 4AMCA 2QEXA 4QVCA 2QXFA 4HCKA 1I4K1 4C92B 4LD6A 4M77A 2JXBA 4PJOB 2RNAA 1TH7A 2XU8A 2QGGA 3J80E 1X75C 2QTVA 1XOVA 2XDDA 4E47A 2E5QA 3M57A 8ATCB 2F2XA 2BIVA 2LJ3A 2DJZA 5HCKA 2DVEA 4LDVA 1F1BB 3OS1A 3CMAA 2X3WD 2K7AA 4EIKA 1YBYA 2OJ2A 1WHLA 3MO8A 1VQ4T 2DZCA 5ECAA 1JU5C 3OYCA 5GAMd 2J6KA 4MMLA 2L0AA 2RD1A 1IGQA 1M3AA 4PFOA 4C5EA 2R5AA 2XIDA 4XAXB 2AZSA 1UJYA 1A0NB 2AKKA 1IXDA 1FYNA 4GLMA 3MCAB 1J3TA 2DXTA 3G71Q 3H6ZA 1Q7YC 2VXEA 3GIBA 4Y92A 3R6NA 3LWIA 2H3EB 5LJ5h 4MZMA 4J9DA 3UT1A 2G3RA 1Y96A 4LUDA 1QKWA 3GOXA 5GAN7 2MYSA 5KYYA 4ME7A 4O5VA 5GANj 1K9MU 2VUBA 1QVFA 2JS2A 3MEAA 2QYZA 1SRLA 1WNLA 3CCEQ 2KNBB 4C0DC 5GJVB 3SEMA 1WI7A 1KQ1A 4J9EA 5J26A 3V8JA 1OU8A 4A4HA 1LCKA 2LDMA 1Q81R 3CBPA 4IKFA 3GNGA 2J7IA 1OV3A 6AT1B 1WA7A 1I81A 1BI1A 4Z8AA 2EQKA 1OX9A 3G7ZA 2COYA 4E7KA 1WQ7A 2JMCA 7AT1B 1YIJQ 2KROA 3G6EQ 1YN8A 4FT2A 5CAIA 4RKUE 1VQ5A 2EYYA 2HBWA 3GLXA 2LCCA 3JB9G 2FZGB 2C06A 5GMKi 4J6XA 4DA4A 1QCNA 2HCKA 3OW2A 1TSFA 1X2QA 4JPBW 4KGXB 5GAOp 2OI3A 3OW2P 1O9SA 1QKXA 4J9IA 4EPCA 1MMAA 1UG1A 1X27A 1TUDA 2LCLA 1K0XA 4KULA 1PM3A 2O9SA 2QASA 2JS0A 3ASKA 4FSSA 2MMPA 1YI2T 1H3ZA 1X6BA 4FSXA 3JCMd 1TUGB 3M0TA 2X9HA 2RPNA 2X4JA 5FRNA 1N8RU 4CI0C 2DX1A 1AWXA 4Y28E 3CXCS 4FL6A 5LL6S 4E7HA 2X4XA 1VQLT 4LN2A 3GBQA 2OAWA 4ZGJB 3OBYA 2DMOA 2COZA 3CCVQ 1TU0B 5LJ5g 2RK2A 3CC4A 3RDVA 3QYHB 4M78G 2VWFA 5IHNA 3VS1A 4BDZA 2OTLT 1WFWA 1ZQ1A 4XK8E 4N4GA 3LH5A 3I35A 5GAOm 1GCQC 1QP2A 5GAOr 1D1BA 2OAUA 2KXDA 4PJNA 1MMGA 4XU1A 3QKJA 3HRUA 5IXBA 4GBQA 2NLUA 2ESWA 4RTVA 5LJ3g 2EJ9A 4ESRA 4L5GA 1IO6A 5D7UA 1OU9A 4RTZA 4M7DA 1Q81C 1NPPA 1QVFS 4MDWA 4NL3A 3H0IA 2LJ0A 3I5RA 2LZ6B 4M75B 1Q82C 4JUVA 1HK9A 2E6ZA 5GAMf 4PJOE 3VV0A 3PTAA 1UHCA 3L1AA 2FPEA 1VYUA 3L2VA 1ZSZA 3CXCP 4IURA 1QCFA 2CP3A 2EAYA 2BZYA 2RJEA 4M78C 2X4YA 2M0YA 1KG1A 3L2ZA 2CYZB 4C8QA 1GCPA 1OZ3A 1RLQC 3CCLQ 3OSSC 3V8KA 1SEMA 3L2QA 2I2LA 1JRIA 5GANh 1X6OA 4PFPA 1Q7YR 2K5LA 1X43A 1G83A 5CR2A 2LTOA 3RNJA 2EPDA 2V8KA 1D1AA 3OMCA 2R58A 3UWNA 1VQ6Q 1VQ9Q 3M9QA 1Z9QA 1SPKA 5LJ5e 1WDXA 5KYNA 2J06A 4M78B 5GANe 1UGPB 1WXUA 2HDAA 2OTLA 4KUDK 3QUIA 3A8MB 2QA4A 1ARKA 2IVWA 5IN1A 4BY6B 1WJQA 4M78F 1Q95G 2XD0A 2F2WA 1H3HA 2DTOA 3JCMP 2V26A 2P4RA 4M7AG 1G2BA 1QVPA 1MHNA 1X2KA 5GAN8 4C8QC 1WHJA 1VQKQ 5KYWB 2QGFB 3CMAT 1M90C 3M59A 2PU9B 3LWHA 2GQVA 4HVWA 2LQWA 4JJNK 3M56A 3X24B 2RJFA 3RMQA 3V7SA 1JEGA 4KGVB 3OBWA 4HCBA 1ZSZC 3PMIA 4ZGDB 1MV0B 2J6FA 4ELYC 2AT1B 2F2VA 3KFVA 3FLGA 4XU3A 1IRXA 2RHUA 2K4YA 1B07A 2DIQA 1MNEA 2XI9A 2LX9A 1KQSA 1YI2A 3LLRA 3OYEA 4DBHA 4HKEA 4P5NA 1YJ9T 2CSIA 1VQ8A 3HFOA 3FEOA 2FEIA 2JOYA 2X51A 1CSKA 1NLOC 3LGFA 2YUNA 3CCST 2EGEA 3EGDA 4DEXA 3O5ZA 5A0DA 5HK0A 1MGQA 3VYGA 1W2BS 1IREB 2DBKA 1MMDA 3OYKA 2WSFE 4E6RA 4D6WA 1Y7XA 4ZNXA 2C0IA 2BKDN 3OS0A 4JRPA 2HMAA 3NMZC 2V1RA 3UPUA 1K8AR 2BZXA 1VQOQ 4A54A 2BE9B 2DXUA 2FRYA 3CBOA 2K79A 1M8VA 1K73C 2Y4YA 4IUQA 2M16A 5FU6C 2LMJA 1LNXA 1QVGS 3M4YA 2CZ0B 2EKOA 3OS2A 2D8JA 5GANf 3MKDA 1YJWT 3E1SA 3QSUA 5CQXA 1PNJA 4M77F 1BCMA 2DXBA 3WVDB 1N8RC 1ZUKA 2QQAA 3CQTA 1OEBA 4C0ZA 3EFSA 4FM4B 4KH1B 3RMSA 3VUZA 3FC3A 1I5OB 4QVDA 1VQPQ 1PWTA 4BUGA 4M7AC 1NYFA 1M4ZA 3EH1A 2O4XA 4OGCA 3M53A 1PD0A 1M3CA 2DNUA 4X9DA 3QO3A 2ATCB 3L2UA 3CPWS 1D09B 1KJWA 2EW3A 1JB0E 4C8QB 3PT9A 5D6XA 1OPLA 3F70A 2RH2A 1KD1R 3OMGA 2K5IA 1UEBA 3UA7A 2YXYA 3CCUA 4L59A 1C1AA 4D8DA 3CCSA 2EYZA 1QVFP 3MP6A 1ZSZB 2DYBA 1NJIC 1BYMA 2HAXA 1QW1A 4HVUA 2VGNA 3CCUT 4BY6C 5KYUB 1Y07A 2LNVA 1VQ9T 2WSEE 3NTIA 1WZOA 5EG2A 2DILA 1QMCA 2L89A 2MCNA 3A8LB 4OF1A 1UB4A 2MIOA 4RTWA 4LUEA 1ZUUA 5LJ5j 3EFOA 1AZEA 1GBRA 1FMKA 1B34B 1VQ4Q 3BDUA 4C8QF 1H641 1Y71A 2JJ9A 5GAN3 1U3OA 2DFUA 1WHMA 1YCYA 3RBBB 2P0QA 1QP3A 2JVVA 3JCMh 2DM1A 1M27C 3REBB 2XMFA 4J5YA 2IPOB 1M3BA 2LQNA 3FJPA 1HD3A 2RQTA 4C0DB 1AD5A 1Y0MA 4F04B 5DM7R 4F7UA 3TEEA 2DK3A 1AZGB 3QDFA 5CK9A 1K8AU 1NEBA 2KMTA 4M7DG 4FIBA 2RI5A 1RAFB 4II1A 3OY9A 2KYBA 3ZL7C 4JLGA 3CD6A 1AHJB 1I07A 1IGUA 3UA6A 1NJIR 2KRMA 2XICA 2L3PA 2DERA 3OA6A 5DLQE 1G3TA 1C6VX 2EYXA 1KQ2A 5KCHA 2PQWA 4PJJA 5I11A 1Z9ZA 1NEGA 1ZX6A 2QQ9A 4E7IA 3TU4K 8AT1B 1VQMQ 3JB9J 5KCOA 2VVKA 1CKBA 3ER0A 5A0LA 1BI2A 2XDPA 1VQOA 3UATA 3I5SA 3HRSA 4BI4A 3VS0A 2F69A 4AFZC 3CCQT 5LJ3e 4LDYA 1TTHB 5CQYA 4M75F 1S1NA 3QJ6A 3VS3A 4J83A 3JCMc 3SWNA 3P8BB 3FIFA 2JW4A 3EG9A 3D7SB 2D0NA 4BDYA 2ENMA 2XDBA 2XKOC 5L23A 4PNOA 2KAFA 1B34A 4JJCA 3MJXA 2KEAA 3G4SA 4CC2A 2YT6A 2O31A 1JBMA 5CKHA 2CP2A 1EFNA 1H8KA 1VQ4A 2BUDA 1ZSGA 5LJ5d 4QVZA 1ZA2B 2VYTA 1W4SA 4FYXB 2L8DA 1FMWA 2NUPA 5GAOn 2E6NA 1D3BA 1S72T 1D0ZA 2CP0A 3C0CA 4IIOA 1VQNQ 4M7DF 3KBGA 4IIMA 4EMKC 3SHWA 1GBQA 2CP6A 2DEUA 5GAMh 1S72A 4B9XA 3QZ5B 1K9MC 1M5Q1 4XU0A 1UHFA 4J9GA 2CP5A 2WACA 3VRZA 4M77D 4J9FA 4KH0B 4O6JA 1NM7A 4BE2A 3J81E 3S3OA 5FRMA 1CKAA 2LP5A 3JCMQ 2YLBA 4C8QE 2O4XB 1FX7A 4OGEA 2VGMA 3I55A 2OTLQ 4XTWA 1KHIA 2ZPFB 1BB9A 1AEYA 3EFRA 3LH0A 1BK2A 1VQ6A 3E19A 5LJ3h 2JT4A 4KUIA 2DL7A 3URGA 1T3SA 4C92G 1OOTA 4K11A 3CCJA 4B6MA 1O75A 1XJWB 2JTMA 2MI6A 3EGXA 2RHIA 3LGLA 2EJFA 2QQRA 2HKNA 2EYWA 4AG1C 1M90R 1ABOA 1BU1A 4M78A 4FW2A
chains in the Genus database with same CATH topology
2MOXA 3RNJA 2EPDA 2C0OA 2RQVA 1E7OA 2FRWA 4RTUA 1W70A 1UGVA 1WXBA 1K76A 2DE0X 1SHFA 2A37A 2O88A 1Z9QA 1SPKA 1UDLA 1UFFA 1WDXA 2J06A 2O2OA 2RN8A 4AFQC 1WXUA 2HDAA 1ARKA 2NWMA 1RI9A 1KIKA 2K6DA 2LX7A 2K3BA 2YSQA 2F2WA 2DA9A 1H3HA 1SRMA 1M30A 1MV3A 1JQQA 2JTEA 1PRLC 2P4RA 2KR3A 1G2BA 2KBTA 2DL4A 1X2KA 5IXFA 1ZUYA 2FPDA 3THKA 2GNCA 2EKHA 2RQWA 1YNZA 2RF0A 4HVWA 2LQWA 2KYMA 1T0JA 3FJ5A 4RTTA 1JEGA 2AZVA 1SSHA 1UECA 1PKSA 4D8KA 4R0KA 1JO8A 1MV0B 2J6FA 1T3LA 2A36A 2F2VA 3M0SA 3KFVA 1PRMC 5IHKA 3QWYA 1H92A 1B07A 1NYGA 2CT3A 2LCSA 4RUGA 1AWJA 2GQIA 2YDLA 1QLYA 1GCQA 2CSIA 1TG0A 2NUZA 2FEIA 2DRMA 4CC7A 1CSKA 1NLOC 2C0TA 3EG3A 2AK5A 2YUNA 2EGEA 3H41A 1AWOA 4RTYA 4DEXA 3O5ZA 2KGTA 3EHQA 1YCSB 1M8MA 2I0NA 4WCIA 2DBKA 5FW9A 1X69A 4E6RA 4F17A 2FO0A 1UTIA 2ROTA 4ZNXA 2B86A 2C0IA 1U5SA 4Z89A 3NMZC 4OMNA 3VS5A 1RUWA 3ULRB 1K0SA 3VS4A 2V1RA 1W1FA 1KFZA 2BZXA 1Y57A 1GFDA 1WLPB 3NPFA 5FWCA 5IHIA 3IQLA 3NHNA 3UF4A 2FRYA 2K79A 1MUZA 1YWOA 2KRSA 2LJ1A 4A63B 1PKTA 2PNIA 1I1JA 2CH4W 1GFCA 2CREA 2DF6A 2LMJA 1JXOA 4JZ4A 2D8JA 2GTJA 2BTTA 2DBMA 2SRCA 2D1XA 3VS2A 3QWXX 2EGCA 1PNJA 1JXMA 2D8HA 1YP5A 1B3QA 1TUCA 1YWPA 2DL5A 4KRTA 1ZUKA 1WYXA 3CQTA 1OEBA 1GRIA 1VYVA 2VKNA 3TVTA 2W0ZA 2ED1A 2W10A 3EGUA 2K9GA 1PWTA 1K9AA 2KT8A 4CC3A 4CC4B 4HCKA 1U06A 2PTKA 2CUDA 1NYFA 2JXBA 1K1ZA 2RNAA 1M3CA 2DNUA 4JJBA 1XOVA 2KRNA 3EG1A 1KJWA 2EW3A 2K2MA 2F2XA 1OPLA 2YUQA 2H8HA 2RQRA 1K4US 2LJ3A 1PHTA 2DRKA 5HCKA 3UA7A 2KXCA 4LE9A 1AVZC 2ECZA 2X3WD 4D8DA 2EYZA 2K7AA 4EIKA 2OJ2A 2DYBA 5ECAA 1HSQA 1JU5C 5EC7A 2J6KA 2L0AA 4HVUA 1WXTA 1M3AA 1QWFA 1V1CA 4F16A 4OMOA 2AZSA 1UJYA 1A0NB 2AKKA 3I9QA 4AG2C 2CH4A 1FYNA 2RMOA 2DVJA 2DILA 4OMQA 4GLMA 3EG0A 1J3TA 2L3SA 2ED0A 4Y92A 2MCNA 3R6NA 2L2PA 2MIOA 1E6GA 4RTWA 2GBQA 4LUEA 4J9DA 1ZUUA 1AZEA 1UJ0A 4J9HA 4LUDA 4DEYA 1FMKA 1GBRA 2EBPA 1QKWA 2ABLA 2QDLA 2L3QA 2JM8A 3JV3A 1RLPC 2JS2A 1U3OA 1KSWA 3RBBB 2CT4A 1SRLA 2KNBB 2DM1A 1M27C 3REBB 2XMFA 5GJVB 1X6GA 3SEMA 1WI7A 1M3BA 2LQNA 4J9EA 1HD3A 2RQTA 1AD5A 1Y0MA 1LCKA 4M4ZA 2J7IA 1AZGB 1OV3A 1NEBA 1WA7A 4Z8AA 1NLPC 3M0PA 1E6HA 2KYBA 3ZL7C 2KE9A 2JMCA 1I07A 3UA6A 2KROA 4AFSC 1YN8A 2KRMA 2YUPA 2L3PA 4F14A 2EYYA 2HBWA 4Z88A 2A28A 1W6XA 2EYXA 4JJDA 5I11A 1Z9ZA 1NEGA 1VA7A 1ZX6A 2V1QA 2DLPA 3H0FA 1OPKA 1ZBJA 2VVKA 1CKBA 1ABQA 2HCKA 3PVQA 1X2QA 4RTXA 4X1VA 4JPBW 3UATA 2OI3A 3I5SA 3REAB 1QKXA 4J9IA 3VS0A 1AOJA 3NGPA 4AFZC 2EGAA 1UG1A 2E5KA 1S1NA 3H0HA 1X27A 1TUDA 3VS3A 1K0XA 4HXJA 2BZ8A 2O9SA 2DL3A 2JS0A 3PVLA 3VRYA 2CUBA 2X3XD 2JW4A 2A08A 4FSSA 2D0NA 2ENMA 2SEMA 5FWBA 1X6BA 5L23A 3TSZA 3M0TA 2ROLA 4ORZA 2RPNA 2J6OA 4JJCA 4J9CA 2DX1A 3VS7A 2KEAA 2DL8A 1AWXA 4CC2A 1GL5A 2YT6A 2O31A 4LN2A 3GBQA 3VS6A 2OAWA 1VYTA 2DMOA 1EFNA 1H8KA 2AKLA 5IH2A 3TSWA 1ZSGA 3M0UA 2G6FX 1UUEA 4LNPA 2VWFA 1SHGA 5IHNA 3VS1A 3C0CA 2FPFA 1WFWA 4IIOA 4OMMA 1WX6A 3LH5A 3I35A 2HEQA 2KT1A 1GCQC 2GGRA 1N5ZA 1NG2A 4IIMA 3U23A 2IIMA 2KXDA 3SHWA 2O9VA 4AFUC 1GBQA 2J05A 5IXBA 4GBQA 2CSQA 3PE0A 4RTVA 2ESWA 1UHFA 4J9GA 1BBZA 3M0QA 3VRZA 2JMAA 4J9FA 1WIEA 1NM7A 4ESRA 2DJQA 2RQUA 2EQIA 1CKAA 1IO6A 2LP5A 1QWEA 4RTZA 5I22A 2YUOA 2CDTA 3H0IA 2LJ0A 3I5RA 2LZ6B 4JZ3A 4J9BA 1BB9A 1HJDA 1AEYA 1UHCA 3A98A 2FPEA 1VYUA 1ZLMA 1BK2A 2FG0A 1QCFA 2JT4A 1T0HA 4HVVA 3M0RA 2DL7A 2BZYA 1AWWA 1T3SA 4OMPA 5GJWB 1OOTA 2JM9A 4K11A 2M0YA 2LNHB 4OMLA 2EVRA 1GCPA 1UE9A 1I0CA 1RLQC 2HSPA 2M51A 1SEMA 2EYWA 2GTOA 4AG1C 3EHRA 1ABOA 2PZ1A 4QT7A 1BU1A 3EG2A 1X43A 1G83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOX A;  3RNJ A;  2EPD A;  2C0O A;  2RQV A;  1E7O A;  2FRW A;  4RTU A;  1W70 A;  1UGV A;  1WXB A;  1K76 A;  2DE0 X;  1SHF A;  2A37 A;  2O88 A;  1Z9Q A;  1SPK A;  1UDL A;  1UFF A;  1WDX A;  2J06 A;  2O2O A;  2RN8 A;  4AFQ C;  1WXU A;  2HDA A;  1ARK A;  2NWM A;  1RI9 A;  1KIK A;  2K6D A;  2LX7 A;  2K3B A;  2YSQ A;  2F2W A;  2DA9 A;  1H3H A;  1SRM A;  1M30 A;  1MV3 A;  1JQQ A;  2JTE A;  1PRL C;  2P4R A;  2KR3 A;  1G2B A;  2KBT A;  2DL4 A;  1X2K A;  5IXF A;  1ZUY A;  2FPD A;  3THK A;  2GNC A;  2EKH A;  2RQW A;  1YNZ A;  2RF0 A;  4HVW A;  2LQW A;  2KYM A;  1T0J A;  3FJ5 A;  4RTT A;  1JEG A;  2AZV A;  1SSH A;  1UEC A;  1PKS A;  4D8K A;  4R0K A;  1JO8 A;  1MV0 B;  2J6F A;  1T3L A;  2A36 A;  2F2V A;  3M0S A;  3KFV A;  1PRM C;  5IHK A;  3QWY A;  1H92 A;  1B07 A;  1NYG A;  2CT3 A;  2LCS A;  4RUG A;  1AWJ A;  2GQI A;  2YDL A;  1QLY A;  1GCQ A;  2CSI A;  1TG0 A;  2NUZ A;  2FEI A;  2DRM A;  4CC7 A;  1CSK A;  1NLO C;  2C0T A;  3EG3 A;  2AK5 A;  2YUN A;  2EGE A;  3H41 A;  1AWO A;  4RTY A;  4DEX A;  3O5Z A;  2KGT A;  3EHQ A;  1YCS B;  1M8M A;  2I0N A;  4WCI A;  2DBK A;  5FW9 A;  1X69 A;  4E6R A;  4F17 A;  2FO0 A;  1UTI A;  2ROT A;  4ZNX A;  2B86 A;  2C0I A;  1U5S A;  4Z89 A;  3NMZ C;  4OMN A;  3VS5 A;  1RUW A;  3ULR B;  1K0S A;  3VS4 A;  2V1R A;  1W1F A;  1KFZ A;  2BZX A;  1Y57 A;  1GFD A;  1WLP B;  3NPF A;  5FWC A;  5IHI A;  3IQL A;  3NHN A;  3UF4 A;  2FRY A;  2K79 A;  1MUZ A;  1YWO A;  2KRS A;  2LJ1 A;  4A63 B;  1PKT A;  2PNI A;  1I1J A;  2CH4 W;  1GFC A;  2CRE A;  2DF6 A;  2LMJ A;  1JXO A;  4JZ4 A;  2D8J A;  2GTJ A;  2BTT A;  2DBM A;  2SRC A;  2D1X A;  3VS2 A;  3QWX X;  2EGC A;  1PNJ A;  1JXM A;  2D8H A;  1YP5 A;  1B3Q A;  1TUC A;  1YWP A;  2DL5 A;  4KRT A;  1ZUK A;  1WYX A;  3CQT A;  1OEB A;  1GRI A;  1VYV A;  2VKN A;  3TVT A;  2W0Z A;  2ED1 A;  2W10 A;  3EGU A;  2K9G A;  1PWT A;  1K9A A;  2KT8 A;  4CC3 A;  4CC4 B;  4HCK A;  1U06 A;  2PTK A;  2CUD A;  1NYF A;  2JXB A;  1K1Z A;  2RNA A;  1M3C A;  2DNU A;  4JJB A;  1XOV A;  2KRN A;  3EG1 A;  1KJW A;  2EW3 A;  2K2M A;  2F2X A;  1OPL A;  2YUQ A;  2H8H A;  2RQR A;  1K4U S;  2LJ3 A;  1PHT A;  2DRK A;  5HCK A;  3UA7 A;  2KXC A;  4LE9 A;  1AVZ C;  2ECZ A;  2X3W D;  4D8D A;  2EYZ A;  2K7A A;  4EIK A;  2OJ2 A;  2DYB A;  5ECA A;  1HSQ A;  1JU5 C;  5EC7 A;  2J6K A;  2L0A A;  4HVU A;  1WXT A;  1M3A A;  1QWF A;  1V1C A;  4F16 A;  4OMO A;  2AZS A;  1UJY A;  1A0N B;  2AKK A;  3I9Q A;  4AG2 C;  2CH4 A;  1FYN A;  2RMO A;  2DVJ A;  2DIL A;  4OMQ A;  4GLM A;  3EG0 A;  1J3T A;  2L3S A;  2ED0 A;  4Y92 A;  2MCN A;  3R6N A;  2L2P A;  2MIO A;  1E6G A;  4RTW A;  2GBQ A;  4LUE A;  4J9D A;  1ZUU A;  1AZE A;  1UJ0 A;  4J9H A;  4LUD A;  4DEY A;  1FMK A;  1GBR A;  2EBP A;  1QKW A;  2ABL A;  2QDL A;  2L3Q A;  2JM8 A;  3JV3 A;  1RLP C;  2JS2 A;  1U3O A;  1KSW A;  3RBB B;  2CT4 A;  1SRL A;  2KNB B;  2DM1 A;  1M27 C;  3REB B;  2XMF A;  5GJV B;  1X6G A;  3SEM A;  1WI7 A;  1M3B A;  2LQN A;  4J9E A;  1HD3 A;  2RQT A;  1AD5 A;  1Y0M A;  1LCK A;  4M4Z A;  2J7I A;  1AZG B;  1OV3 A;  1NEB A;  1WA7 A;  4Z8A A;  1NLP C;  3M0P A;  1E6H A;  2KYB A;  3ZL7 C;  2KE9 A;  2JMC A;  1I07 A;  3UA6 A;  2KRO A;  4AFS C;  1YN8 A;  2KRM A;  2YUP A;  2L3P A;  4F14 A;  2EYY A;  2HBW A;  4Z88 A;  2A28 A;  1W6X A;  2EYX A;  4JJD A;  5I11 A;  1Z9Z A;  1NEG A;  1VA7 A;  1ZX6 A;  2V1Q A;  2DLP A;  3H0F A;  1OPK A;  1ZBJ A;  2VVK A;  1CKB A;  1ABQ A;  2HCK A;  3PVQ A;  1X2Q A;  4RTX A;  4X1V A;  4JPB W;  3UAT A;  2OI3 A;  3I5S A;  3REA B;  1QKX A;  4J9I A;  3VS0 A;  1AOJ A;  3NGP A;  4AFZ C;  2EGA A;  1UG1 A;  2E5K A;  1S1N A;  3H0H A;  1X27 A;  1TUD A;  3VS3 A;  1K0X A;  4HXJ A;  2BZ8 A;  2O9S A;  2DL3 A;  2JS0 A;  3PVL A;  3VRY A;  2CUB A;  2X3X D;  2JW4 A;  2A08 A;  4FSS A;  2D0N A;  2ENM A;  2SEM A;  5FWB A;  1X6B A;  5L23 A;  3TSZ A;  3M0T A;  2ROL A;  4ORZ A;  2RPN A;  2J6O A;  4JJC A;  4J9C A;  2DX1 A;  3VS7 A;  2KEA A;  2DL8 A;  1AWX A;  4CC2 A;  1GL5 A;  2YT6 A;  2O31 A;  4LN2 A;  3GBQ A;  3VS6 A;  2OAW A;  1VYT A;  2DMO A;  1EFN A;  1H8K A;  2AKL A;  5IH2 A;  3TSW A;  1ZSG A;  3M0U A;  2G6F X;  1UUE A;  4LNP A;  2VWF A;  1SHG A;  5IHN A;  3VS1 A;  3C0C A;  2FPF A;  1WFW A;  4IIO A;  4OMM A;  1WX6 A;  3LH5 A;  3I35 A;  2HEQ A;  2KT1 A;  1GCQ C;  2GGR A;  1N5Z A;  1NG2 A;  4IIM A;  3U23 A;  2IIM A;  2KXD A;  3SHW A;  2O9V A;  4AFU C;  1GBQ A;  2J05 A;  5IXB A;  4GBQ A;  2CSQ A;  3PE0 A;  4RTV A;  2ESW A;  1UHF A;  4J9G A;  1BBZ A;  3M0Q A;  3VRZ A;  2JMA A;  4J9F A;  1WIE A;  1NM7 A;  4ESR A;  2DJQ A;  2RQU A;  2EQI A;  1CKA A;  1IO6 A;  2LP5 A;  1QWE A;  4RTZ A;  5I22 A;  2YUO A;  2CDT A;  3H0I A;  2LJ0 A;  3I5R A;  2LZ6 B;  4JZ3 A;  4J9B A;  1BB9 A;  1HJD A;  1AEY A;  1UHC A;  3A98 A;  2FPE A;  1VYU A;  1ZLM A;  1BK2 A;  2FG0 A;  1QCF A;  2JT4 A;  1T0H A;  4HVV A;  3M0R A;  2DL7 A;  2BZY A;  1AWW A;  1T3S A;  4OMP A;  5GJW B;  1OOT A;  2JM9 A;  4K11 A;  2M0Y A;  2LNH B;  4OML A;  2EVR A;  1GCP A;  1UE9 A;  1I0C A;  1RLQ C;  2HSP A;  2M51 A;  1SEM A;  2EYW A;  2GTO A;  4AG1 C;  3EHR A;  1ABO A;  2PZ1 A;  4QT7 A;  1BU1 A;  3EG2 A;  1X43 A;  1G83 A; 
#chains in the Genus database with same CATH topology
 1BIA A;  2QQS A;  1BI0 A;  2A7Y A;  1VQ7 A;  1K76 A;  1WGS A;  2HSE B;  1SHF A;  3KXT A;  1M90 U;  5GAN d;  4ELZ C;  1UFF A;  1VQO T;  4ZTJ A;  4MZP A;  2HQH A;  3MP8 A;  3ZFJ A;  3PNW C;  2KDS A;  4HT9 A;  5FU6 B;  1KIK A;  2RM4 A;  9ATC B;  3EFO B;  2K3B A;  2VV5 A;  2OX7 A;  1SRM A;  4NS5 A;  1MV3 A;  3OYL A;  3JCM e;  1EIF A;  5FU7 C;  1WJR A;  2DL4 A;  4XTY A;  5CIU A;  5IXF A;  1YIT Q;  1ZUY A;  4LXC A;  5GMK j;  3BY7 A;  3FB9 A;  3MEW A;  3CC2 Q;  2XK0 A;  3WXM B;  3SB2 A;  4QQD A;  3DB4 A;  3MET A;  4RTT A;  2RI3 A;  2NUP B;  5LJ3 f;  4M7D B;  1D0X A;  4R0K A;  1VQM T;  3SD4 A;  1M1G A;  4KBM B;  5FLX E;  5IAY A;  1PSE A;  3JB9 H;  4J6W A;  4DBF A;  1W2B A;  2MK5 A;  3OYB A;  4AT1 B;  2DET A;  4M75 G;  1I5L A;  2NYS A;  1VQ7 Q;  1GCQ A;  5GAM g;  1YHQ T;  4JLI A;  1TG0 A;  4DBQ A;  3JRZ A;  2NUZ A;  2DRM A;  2E1H A;  3DB3 A;  2OTJ T;  3HFN A;  4A53 A;  1V29 B;  2KGT A;  1YCS B;  2YRV A;  3OW2 S;  4F17 A;  1UTI A;  2ROT A;  5J3B A;  4RCC A;  4Z89 A;  3CME Q;  2X35 A;  2RHY A;  3RUX A;  4C5H A;  1RUW A;  3ULR B;  3OYF A;  1K0S A;  4A4K A;  1IZ6 A;  1Y57 A;  4QQG A;  1X01 A;  1WLP B;  3TCJ A;  3IQL A;  3JCM W;  1Q81 U;  2JUF A;  3I56 T;  4PJO D;  2KRS A;  2LJ1 A;  4FYW B;  2CH4 W;  3X28 B;  4A63 B;  2DF6 A;  2PUO B;  2M1H A;  4OB3 B;  1JXO A;  4JZ4 A;  2SRC A;  2DEQ A;  2D1X A;  3I56 A;  1IB8 A;  3VS2 A;  3CC7 Q;  3QWX X;  2EGC A;  3C95 A;  1M2O A;  1JXM A;  4ATO A;  1JJ2 S;  2D8H A;  1YP5 A;  1TUC A;  1YWP A;  1VOM A;  3CPW A;  5A0G A;  2HD0 A;  4QQ6 A;  3MEV A;  3L42 A;  4XQ3 A;  3TVT A;  4HCC A;  2PVO B;  1K9A A;  4CC4 B;  1NJI U;  3X20 B;  2CUD A;  4M7D D;  3CBM A;  3PMT A;  4JJB A;  3L2W A;  1EZZ B;  5DLO A;  2OTJ A;  3EG1 A;  1KD1 C;  2EWN A;  4C92 D;  4ZGE B;  2H8H A;  2RJC A;  2RQR A;  1K4U S;  1R0B G;  1N6A A;  1G3Y A;  2XG8 D;  4EMG A;  2RHX A;  2KXC A;  4LE9 A;  4M77 C;  2ECZ A;  1UGR B;  3P8D A;  3QYG B;  3CC7 A;  4LD9 K;  1QVG P;  2K3X A;  3QJY A;  3G4S T;  1I8F A;  2CKK A;  1N9R A;  1WPY A;  3TRE A;  4OVA A;  1WXT A;  2P0K A;  3LYI A;  5M9O A;  1HYO A;  1V1C A;  3PIO A;  3CD6 T;  4M75 E;  4OMO A;  2DKG A;  2AIR B;  4AG2 C;  2CH4 A;  2RMO A;  2YLC A;  2DVJ A;  4OMQ A;  4YTL A;  4EMK B;  4PKC C;  3EG0 A;  4R56 A;  2ZZD A;  2P0P A;  3X26 B;  1RL2 A;  2ED0 A;  4EMH A;  3VJP A;  1VQ8 T;  4ZN1 A;  4PL6 A;  1N9S A;  1E6G A;  4PJO F;  3JB9 I;  2CS7 A;  1UJ0 A;  4DEY A;  1ZBX A;  2EBP A;  4F7U F;  1VQN T;  2QDL A;  2L3Q A;  1YIJ T;  1YIT T;  1RLP C;  1BCO A;  4C92 A;  1KSW A;  2CT4 A;  3DLM A;  1IHW A;  2VB6 A;  4QKU A;  1SF9 A;  3QZ9 B;  3A8H B;  4M4Z A;  1EX4 A;  3CCJ Q;  2M02 A;  3NTK A;  2HKQ B;  1RAA B;  2B8A A;  4OP0 A;  1NLP C;  5D6Y A;  3JCM J;  2RK1 A;  1E6H A;  3CEY A;  2R57 A;  4LDW A;  1PSF A;  2E3I A;  3I55 Q;  4JJD A;  2D6F A;  4M75 A;  1VA7 A;  5D6W A;  1KQS P;  3ZEH A;  2LT4 A;  2DLP A;  1OPK A;  2RJD A;  3QG1 A;  2K57 A;  1VIF A;  3E9G A;  3PVQ A;  4WF2 A;  1YHQ A;  1AOJ A;  3G6E A;  4GLK A;  4DQ2 A;  4RCB A;  1VQL Q;  3JB9 F;  4MDX A;  3CCV T;  1KC8 R;  1M1K U;  2XHC A;  2OTJ Q;  2BZ8 A;  2VAS A;  3PVL A;  3VRY A;  4Q5W A;  2A08 A;  4ZTF A;  1OUL A;  5FWB A;  2SEM A;  4PLI A;  1W2B P;  5C6S A;  1PD1 A;  1KC8 C;  2COW A;  4N4H A;  4C92 E;  4ANJ A;  3AHU A;  3RKX A;  2CGH A;  2F5K A;  3A8O B;  3CC7 T;  3JCM g;  1VYT A;  1RAD B;  5IT9 E;  2HL5 C;  5AT1 B;  3CCE T;  2AKL A;  3CCR Q;  4TVR A;  2P84 A;  3M0U A;  3EAE A;  1LPL A;  1FWZ A;  2RB6 A;  3PIP A;  1NZ9 A;  2HQE A;  2DIG A;  5GMK e;  2FPF A;  2QG9 B;  2DYI A;  3OSV A;  1OQK A;  2KT1 A;  4M75 C;  5I21 A;  4JRK A;  3U23 A;  2IIM A;  2QK0 A;  1SSF A;  2O9V A;  1OI1 A;  1JJ2 A;  1B7T A;  2ZPH B;  1VQ7 T;  3ME9 A;  1JJ2 P;  4M7A F;  4CRI A;  5FU7 B;  1BBZ A;  2JMA A;  1WIE A;  3M4G A;  3HPW A;  3MHX A;  2L3R A;  4J7I A;  5GMK h;  2X4W A;  1QWE A;  2YUO A;  3V7R A;  5DY9 A;  2DO3 A;  4F7U G;  5J39 A;  4J9B A;  5I2S A;  3M54 A;  1VQ6 T;  1RAI B;  3CD6 Q;  3A98 A;  4PJL A;  1ZLM A;  4XU2 A;  4BE0 A;  2LRQ A;  1T0H A;  3CPW P;  3M0R A;  5GAN 4;  3MEU A;  1YFN A;  1FMV A;  4Z02 A;  3SDZ A;  5KE2 A;  2JM9 A;  3T9N A;  2LNH B;  3OYY A;  2LC4 A;  2EVR A;  4MMK A;  2HSP A;  2M51 A;  3CCM Q;  3KUF A;  2GTO A;  4E7J A;  2FYK A;  3EHR A;  4QT7 A;  5KE3 A;  2RI2 A;  1TS9 A;  4BD3 A;  2C0O A;  2RQV A;  4FT4 A;  1VQK T;  5KYU A;  4RTU A;  3S3N A;  1K73 U;  2F5T X;  1UGV A;  3CCM A;  4RG2 A;  4M7A E;  2DE0 X;  1OX8 A;  3SWN B;  1D3B B;  1Q7Y U;  1RAE B;  4KT0 E;  3LW5 E;  2O88 A;  4PK4 A;  4IUT A;  1UDL A;  1WJS A;  1G5V A;  2HBP A;  4JS5 A;  1RAC B;  5GAM e;  2RN8 A;  3JCM f;  1VQ5 T;  2PVD B;  4A4E A;  2P4T A;  2QEX T;  1QVG A;  4N4I A;  1QQJ A;  5FRO A;  5CKE A;  1YJN Q;  1YIT A;  1XQH A;  2DA9 A;  3LX7 A;  2IG0 A;  2KSS A;  2JTE A;  4FU6 A;  2LT1 A;  4PJM A;  2KR3 A;  1FXX A;  4Y91 A;  3H8Z A;  2EKH A;  3NTH A;  4X34 A;  2RQW A;  1YNZ A;  2KYM A;  4C92 F;  3CCS Q;  2AZV A;  4JDS A;  1UEC A;  3OYA A;  1PKS A;  4D8K A;  3CCJ T;  2K3Y A;  3FRN A;  2DXC A;  1HXD A;  3OYM A;  4M78 E;  2E3H A;  4FYV B;  3M0S A;  1WHH A;  1LJO A;  1PC0 A;  1PRM C;  3QWY A;  1H92 A;  2CT3 A;  1G3W A;  2LCS A;  4E7Z A;  4OB1 B;  3CCQ A;  1LOJ A;  1NE8 A;  4BI8 B;  2YDL A;  1QLY A;  4J8O A;  4GY5 A;  1R8O B;  3INZ A;  1VQP A;  3M5A A;  5L8R E;  2A3L A;  4CC7 A;  1KQS S;  1NPR A;  3QII A;  3H41 A;  5LJ3 j;  2QDY B;  2QTX A;  3EHQ A;  1WHK A;  4JRI A;  5FW9 A;  4BB7 A;  1X69 A;  4RMO A;  3X25 B;  2FVU A;  3E2U A;  2DTH A;  2B86 A;  2DD4 A;  1N8R R;  3VS5 A;  2E12 A;  1YJ9 Q;  2YWW A;  2LQK A;  4QW2 A;  1KFZ A;  1GFD A;  3G1J A;  3QPH A;  3NPF A;  4OB0 B;  5FWC A;  5IHI A;  5HY6 A;  3NHN A;  3C94 A;  3UF4 A;  1YWO A;  3CCL T;  1PKT A;  2LVM A;  2YHT A;  2PUK B;  1RI0 A;  4UC4 A;  4C5I A;  2Y90 A;  2BTT A;  3BFM A;  4VUB A;  1K8A C;  1Y96 B;  2YRC A;  1M2V B;  3N5B B;  5KH6 A;  4J6Y A;  2A0F B;  2E4H A;  1C0M A;  3I55 T;  2DL5 A;  3CCR T;  4KRT A;  1WYX A;  2MWO A;  1VYV A;  2VKN A;  2V8I A;  4F7U E;  4LDU A;  2W0Z A;  4PJO G;  2W10 A;  3EGU A;  2K9G A;  5LJ3 d;  2KT8 A;  4CC3 A;  3DKM A;  1U06 A;  2PTK A;  1WQW A;  1K1Z A;  1VUB A;  1TOV A;  3M58 A;  2ZPE B;  2KRN A;  3G71 T;  2Z0W A;  2NUT A;  5CKD A;  2K2M A;  2KVQ G;  3VU3 C;  2YUQ A;  4HCZ A;  1PHT A;  3CXC A;  2DRK A;  4M7A A;  5I2M A;  2EQM A;  2EYQ A;  1AVZ C;  3JCM V;  4OB2 B;  2BE7 D;  4PFZ A;  4PJO A;  5CVI A;  3OYJ A;  1VQP T;  1HSQ A;  5EC7 A;  1K73 R;  3VKI A;  2MF2 A;  3OYD A;  1D0Y A;  2RHZ A;  1QWF A;  1K9M R;  4F16 A;  5CO7 A;  2RO0 A;  4DOV A;  4DOW A;  1TXQ A;  1VQM A;  2QQB A;  3I9Q A;  2EQJ A;  3PGG A;  2L3S A;  3E9F A;  3QDR B;  2YRD A;  1XTD A;  3HHT B;  4XTU A;  1MND A;  2L2P A;  1BI3 A;  4OMF B;  1KK7 A;  2GBQ A;  2QA4 Q;  4EDU A;  3CCM T;  1V76 A;  1GXI E;  4J9H A;  2EJG A;  1YJN T;  4XTV A;  2ABL A;  1N27 A;  2KK4 A;  4HT8 A;  4C0F A;  2JM8 A;  2VC8 A;  3JV3 A;  3G6E T;  3EGD B;  5LJ5 f;  4BI3 A;  4PJO C;  1MMN A;  4PLL A;  1X6G A;  3CCR A;  2FZK B;  4NL2 A;  3PFS A;  2HQX A;  3OYH A;  2EQU A;  3RKW A;  5C0M A;  5CCA A;  3RER A;  1VQ8 Q;  4C92 C;  4FYY B;  3RIR A;  3M0P A;  2CP7 A;  5KYX B;  2FB7 A;  3OYG A;  2HL3 A;  2KE9 A;  3CCE A;  4AFS C;  2JN0 A;  2YUP A;  4IUV A;  3ZBD A;  4F14 A;  3CC4 T;  3TQ7 P;  4Z88 A;  2A28 A;  1W6X A;  3BW1 A;  3GNF B;  2VXF A;  1SKU B;  5GMK l;  2ZPG B;  3V8L A;  5KYW A;  4C0G A;  3OQ5 A;  2H3J A;  1VIE A;  2V1Q A;  2DPP B;  3H0F A;  1VQL A;  1ZBJ A;  2GCX A;  4M78 D;  1ABQ A;  1VQK A;  4E2F B;  4RTX A;  4X1V A;  3REA B;  1YJ9 A;  3C12 A;  3RES A;  2HNI A;  3NGP A;  1M2V A;  2V8J A;  2EGA A;  3CCU Q;  4HA8 A;  3JB9 D;  2AHJ B;  2E5K A;  3C4S A;  1R77 A;  3H0H A;  1KHC A;  3OS5 A;  4DBR A;  4HXJ A;  1M1K R;  1ZHI A;  2DL3 A;  2PVG B;  2CUB A;  2X3X D;  1QCO A;  3EG9 B;  1PCX A;  1Q86 R;  2KQW A;  2LQ8 A;  1VQ9 A;  4A4F A;  3AT1 B;  2D0Q B;  3QHS A;  3TSZ A;  2DAQ A;  4C8Q D;  2ROL A;  4ORZ A;  3A8G B;  3R6O A;  2J6O A;  4J9C A;  2RA2 A;  3VS7 A;  2DL8 A;  1ZA1 B;  2ZCF B;  1GL5 A;  3SWN C;  4IUU A;  3CCQ Q;  3VS6 A;  1XNI A;  3CCL A;  5GAN 2;  5IH2 A;  4F7U B;  1U1S A;  3TSW A;  1M9S A;  4M77 E;  4LDX A;  2G6F X;  2QEX Q;  1UUE A;  4LNP A;  2E10 A;  3GPL A;  3OB9 A;  2JZ2 A;  2E41 A;  3S3M A;  1Q82 R;  1SHG A;  3V7C A;  4A4G A;  4OMM A;  1WX6 A;  4RG8 A;  2ZPI B;  4JS4 A;  2DD5 A;  2HEQ A;  2GGR A;  4C8Q G;  4X9C A;  1N5Z A;  1NG2 A;  2GFU A;  1WHG A;  5GAM j;  4AFU C;  2J05 A;  4M7D C;  1OYX A;  2ZAE A;  1LVK A;  2CSQ A;  3PE0 A;  5GAN 6;  2MAM A;  1SG5 A;  3HSB A;  1IHV A;  3M0Q A;  2DTI A;  2NUT B;  2DJQ A;  2RQU A;  2EQI A;  1KD1 U;  1YJN A;  5CKB A;  5GAO l;  4EMK A;  5I22 A;  4NOY A;  2K2V A;  1RAG B;  3FDR A;  2CDT A;  1ACM B;  2KI7 A;  1UGS B;  2M9U A;  4JZ3 A;  2F1L A;  1M1F A;  2QAZ A;  1HJD A;  1R0C B;  3JCM X;  2FG0 A;  4MZT A;  3QXE B;  5GMK m;  4HVV A;  4N0A A;  2EIF A;  3OYI A;  5GAN 5;  1RAB B;  5HKC A;  1AWW A;  2EFI A;  1YJW A;  4OMP A;  5GJW B;  2M0O A;  4OML A;  4KGZ B;  4FCY A;  3P8H A;  1OZ2 A;  2E64 A;  1UE9 A;  1I0C A;  3WVE B;  4B9W A;  1YI2 Q;  2O01 E;  3A5Z B;  2PZ1 A;  3EG2 A;  1G3S A;  3UDC A;  4C5G A;  5A2Q E;  3NFC A;  2MOX A;  4FW1 A;  1E7O A;  2FRW A;  2JTF A;  1BIB A;  5HK3 A;  1W70 A;  1UGQ B;  1WXB A;  4M75 D;  4IUP A;  2E70 A;  2A37 A;  2FZC B;  2ZPB B;  3VUB A;  4BE1 A;  1G8X A;  2O2O A;  4AFQ C;  3EH2 A;  4M7D E;  3CPF A;  3I56 Q;  2NWM A;  1RI9 A;  2QA4 T;  3EGX B;  5AYF A;  5GAN g;  2K6D A;  2LX7 A;  2YSQ A;  1M30 A;  1JQQ A;  2HZY A;  3JSC A;  3H9N A;  1PRL C;  3JAM E;  2KBT A;  1TWB A;  2K5F A;  2FPD A;  1PG5 B;  3THK A;  3L2R A;  2E65 A;  2GNC A;  2MWP A;  2MPX C;  5GAO q;  3BDL A;  4XTX A;  2RF0 A;  3SFM A;  3A1P A;  1T0J A;  3FJ5 A;  3OYN A;  1SSH A;  4M77 G;  2Y4X A;  3CME A;  1VQ5 Q;  1JO8 A;  4N0A C;  1S72 Q;  1T3L A;  2A36 A;  3HTR A;  4BAC A;  1KC8 U;  1YIJ A;  4M7A B;  5IHK A;  3MP1 A;  4WTO B;  1NYG A;  4E7S A;  1VQN A;  3GP8 A;  3JCM b;  2CZ7 B;  4RUG A;  1U1T A;  1AWJ A;  2GQI A;  2CZ6 B;  4E7L A;  3S6W A;  3MPU B;  2DZ9 A;  3QBY A;  3O8V A;  2C0T A;  3EG3 A;  2AK5 A;  1Q82 U;  1AWO A;  2FHD A;  5CKF A;  4RTY A;  1U8R A;  2GF7 A;  2GFA A;  1M8M A;  3RKY A;  3G4S Q;  2I0N A;  4R55 A;  2QI2 A;  4WCI A;  1YJW Q;  5KYX A;  4J7F A;  2FO0 A;  2R5M A;  1U5S A;  1Q86 C;  3RR6 A;  3VYH B;  4M7A D;  4OMN A;  1M1K C;  3VS4 A;  3HP9 A;  1YHQ Q;  1W1F A;  4ZN3 A;  1Q86 U;  3CC2 A;  2KY9 A;  3G71 A;  2JNG A;  4XTZ A;  1MUZ A;  3BE3 A;  1AT1 B;  1I1J A;  2CRE A;  3HRT A;  1GFC A;  2PNI A;  1NBE B;  3GF5 A;  2L5Q A;  3J7A F;  2GTJ A;  2CZ1 B;  5KYY B;  1BKB A;  3HL8 A;  2D9T A;  2ZGW A;  2DBM A;  4V2S A;  4JRQ A;  1D1C A;  3CMA Q;  3CC4 Q;  2FL7 A;  1RAH B;  3CME T;  3CC2 T;  1B3Q A;  3CCV A;  3M55 A;  3Q1J A;  1GRI A;  1P92 A;  3HKS A;  3DLL A;  4M77 B;  1DJ7 B;  4L6V 5;  2WSC E;  2ED1 A;  4AMC A;  2QEX A;  4QVC A;  2QXF A;  4HCK A;  1I4K 1;  4C92 B;  4LD6 A;  4M77 A;  2JXB A;  4PJO B;  2RNA A;  1TH7 A;  2XU8 A;  2QGG A;  3J80 E;  1X75 C;  2QTV A;  1XOV A;  2XDD A;  4E47 A;  2E5Q A;  3M57 A;  8ATC B;  2F2X A;  2BIV A;  2LJ3 A;  2DJZ A;  5HCK A;  2DVE A;  4LDV A;  1F1B B;  3OS1 A;  3CMA A;  2X3W D;  2K7A A;  4EIK A;  1YBY A;  2OJ2 A;  1WHL A;  3MO8 A;  1VQ4 T;  2DZC A;  5ECA A;  1JU5 C;  3OYC A;  5GAM d;  2J6K A;  4MML A;  2L0A A;  2RD1 A;  1IGQ A;  1M3A A;  4PFO A;  4C5E A;  2R5A A;  2XID A;  4XAX B;  2AZS A;  1UJY A;  1A0N B;  2AKK A;  1IXD A;  1FYN A;  4GLM A;  3MCA B;  1J3T A;  2DXT A;  3G71 Q;  3H6Z A;  1Q7Y C;  2VXE A;  3GIB A;  4Y92 A;  3R6N A;  3LWI A;  2H3E B;  5LJ5 h;  4MZM A;  4J9D A;  3UT1 A;  2G3R A;  1Y96 A;  4LUD A;  1QKW A;  3GOX A;  5GAN 7;  2MYS A;  5KYY A;  4ME7 A;  4O5V A;  5GAN j;  1K9M U;  2VUB A;  1QVF A;  2JS2 A;  3MEA A;  2QYZ A;  1SRL A;  1WNL A;  3CCE Q;  2KNB B;  4C0D C;  5GJV B;  3SEM A;  1WI7 A;  1KQ1 A;  4J9E A;  5J26 A;  3V8J A;  1OU8 A;  4A4H A;  1LCK A;  2LDM A;  1Q81 R;  3CBP A;  4IKF A;  3GNG A;  2J7I A;  1OV3 A;  6AT1 B;  1WA7 A;  1I81 A;  1BI1 A;  4Z8A A;  2EQK A;  1OX9 A;  3G7Z A;  2COY A;  4E7K A;  1WQ7 A;  2JMC A;  7AT1 B;  1YIJ Q;  2KRO A;  3G6E Q;  1YN8 A;  4FT2 A;  5CAI A;  4RKU E;  1VQ5 A;  2EYY A;  2HBW A;  3GLX A;  2LCC A;  3JB9 G;  2FZG B;  2C06 A;  5GMK i;  4J6X A;  4DA4 A;  1QCN A;  2HCK A;  3OW2 A;  1TSF A;  1X2Q A;  4JPB W;  4KGX B;  5GAO p;  2OI3 A;  3OW2 P;  1O9S A;  1QKX A;  4J9I A;  4EPC A;  1MMA A;  1UG1 A;  1X27 A;  1TUD A;  2LCL A;  1K0X A;  4KUL A;  1PM3 A;  2O9S A;  2QAS A;  2JS0 A;  3ASK A;  4FSS A;  2MMP A;  1YI2 T;  1H3Z A;  1X6B A;  4FSX A;  3JCM d;  1TUG B;  3M0T A;  2X9H A;  2RPN A;  2X4J A;  5FRN A;  1N8R U;  4CI0 C;  2DX1 A;  1AWX A;  4Y28 E;  3CXC S;  4FL6 A;  5LL6 S;  4E7H A;  2X4X A;  1VQL T;  4LN2 A;  3GBQ A;  2OAW A;  4ZGJ B;  3OBY A;  2DMO A;  2COZ A;  3CCV Q;  1TU0 B;  5LJ5 g;  2RK2 A;  3CC4 A;  3RDV A;  3QYH B;  4M78 G;  2VWF A;  5IHN A;  3VS1 A;  4BDZ A;  2OTL T;  1WFW A;  1ZQ1 A;  4XK8 E;  4N4G A;  3LH5 A;  3I35 A;  5GAO m;  1GCQ C;  1QP2 A;  5GAO r;  1D1B A;  2OAU A;  2KXD A;  4PJN A;  1MMG A;  4XU1 A;  3QKJ A;  3HRU A;  5IXB A;  4GBQ A;  2NLU A;  2ESW A;  4RTV A;  5LJ3 g;  2EJ9 A;  4ESR A;  4L5G A;  1IO6 A;  5D7U A;  1OU9 A;  4RTZ A;  4M7D A;  1Q81 C;  1NPP A;  1QVF S;  4MDW A;  4NL3 A;  3H0I A;  2LJ0 A;  3I5R A;  2LZ6 B;  4M75 B;  1Q82 C;  4JUV A;  1HK9 A;  2E6Z A;  5GAM f;  4PJO E;  3VV0 A;  3PTA A;  1UHC A;  3L1A A;  2FPE A;  1VYU A;  3L2V A;  1ZSZ A;  3CXC P;  4IUR A;  1QCF A;  2CP3 A;  2EAY A;  2BZY A;  2RJE A;  4M78 C;  2X4Y A;  2M0Y A;  1KG1 A;  3L2Z A;  2CYZ B;  4C8Q A;  1GCP A;  1OZ3 A;  1RLQ C;  3CCL Q;  3OSS C;  3V8K A;  1SEM A;  3L2Q A;  2I2L A;  1JRI A;  5GAN h;  1X6O A;  4PFP A;  1Q7Y R;  2K5L A;  1X43 A;  1G83 A;  5CR2 A;  2LTO A;  3RNJ A;  2EPD A;  2V8K A;  1D1A A;  3OMC A;  2R58 A;  3UWN A;  1VQ6 Q;  1VQ9 Q;  3M9Q A;  1Z9Q A;  1SPK A;  5LJ5 e;  1WDX A;  5KYN A;  2J06 A;  4M78 B;  5GAN e;  1UGP B;  1WXU A;  2HDA A;  2OTL A;  4KUD K;  3QUI A;  3A8M B;  2QA4 A;  1ARK A;  2IVW A;  5IN1 A;  4BY6 B;  1WJQ A;  4M78 F;  1Q95 G;  2XD0 A;  2F2W A;  1H3H A;  2DTO A;  3JCM P;  2V26 A;  2P4R A;  4M7A G;  1G2B A;  1QVP A;  1MHN A;  1X2K A;  5GAN 8;  4C8Q C;  1WHJ A;  1VQK Q;  5KYW B;  2QGF B;  3CMA T;  1M90 C;  3M59 A;  2PU9 B;  3LWH A;  2GQV A;  4HVW A;  2LQW A;  4JJN K;  3M56 A;  3X24 B;  2RJF A;  3RMQ A;  3V7S A;  1JEG A;  4KGV B;  3OBW A;  4HCB A;  1ZSZ C;  3PMI A;  4ZGD B;  1MV0 B;  2J6F A;  4ELY C;  2AT1 B;  2F2V A;  3KFV A;  3FLG A;  4XU3 A;  1IRX A;  2RHU A;  2K4Y A;  1B07 A;  2DIQ A;  1MNE A;  2XI9 A;  2LX9 A;  1KQS A;  1YI2 A;  3LLR A;  3OYE A;  4DBH A;  4HKE A;  4P5N A;  1YJ9 T;  2CSI A;  1VQ8 A;  3HFO A;  3FEO A;  2FEI A;  2JOY A;  2X51 A;  1CSK A;  1NLO C;  3LGF A;  2YUN A;  3CCS T;  2EGE A;  3EGD A;  4DEX A;  3O5Z A;  5A0D A;  5HK0 A;  1MGQ A;  3VYG A;  1W2B S;  1IRE B;  2DBK A;  1MMD A;  3OYK A;  2WSF E;  4E6R A;  4D6W A;  1Y7X A;  4ZNX A;  2C0I A;  2BKD N;  3OS0 A;  4JRP A;  2HMA A;  3NMZ C;  2V1R A;  3UPU A;  1K8A R;  2BZX A;  1VQO Q;  4A54 A;  2BE9 B;  2DXU A;  2FRY A;  3CBO A;  2K79 A;  1M8V A;  1K73 C;  2Y4Y A;  4IUQ A;  2M16 A;  5FU6 C;  2LMJ A;  1LNX A;  1QVG S;  3M4Y A;  2CZ0 B;  2EKO A;  3OS2 A;  2D8J A;  5GAN f;  3MKD A;  1YJW T;  3E1S A;  3QSU A;  5CQX A;  1PNJ A;  4M77 F;  1BCM A;  2DXB A;  3WVD B;  1N8R C;  1ZUK A;  2QQA A;  3CQT A;  1OEB A;  4C0Z A;  3EFS A;  4FM4 B;  4KH1 B;  3RMS A;  3VUZ A;  3FC3 A;  1I5O B;  4QVD A;  1VQP Q;  1PWT A;  4BUG A;  4M7A C;  1NYF A;  1M4Z A;  3EH1 A;  2O4X A;  4OGC A;  3M53 A;  1PD0 A;  1M3C A;  2DNU A;  4X9D A;  3QO3 A;  2ATC B;  3L2U A;  3CPW S;  1D09 B;  1KJW A;  2EW3 A;  1JB0 E;  4C8Q B;  3PT9 A;  5D6X A;  1OPL A;  3F70 A;  2RH2 A;  1KD1 R;  3OMG A;  2K5I A;  1UEB A;  3UA7 A;  2YXY A;  3CCU A;  4L59 A;  1C1A A;  4D8D A;  3CCS A;  2EYZ A;  1QVF P;  3MP6 A;  1ZSZ B;  2DYB A;  1NJI C;  1BYM A;  2HAX A;  1QW1 A;  4HVU A;  2VGN A;  3CCU T;  4BY6 C;  5KYU B;  1Y07 A;  2LNV A;  1VQ9 T;  2WSE E;  3NTI A;  1WZO A;  5EG2 A;  2DIL A;  1QMC A;  2L89 A;  2MCN A;  3A8L B;  4OF1 A;  1UB4 A;  2MIO A;  4RTW A;  4LUE A;  1ZUU A;  5LJ5 j;  3EFO A;  1AZE A;  1GBR A;  1FMK A;  1B34 B;  1VQ4 Q;  3BDU A;  4C8Q F;  1H64 1;  1Y71 A;  2JJ9 A;  5GAN 3;  1U3O A;  2DFU A;  1WHM A;  1YCY A;  3RBB B;  2P0Q A;  1QP3 A;  2JVV A;  3JCM h;  2DM1 A;  1M27 C;  3REB B;  2XMF A;  4J5Y A;  2IPO B;  1M3B A;  2LQN A;  3FJP A;  1HD3 A;  2RQT A;  4C0D B;  1AD5 A;  1Y0M A;  4F04 B;  5DM7 R;  4F7U A;  3TEE A;  2DK3 A;  1AZG B;  3QDF A;  5CK9 A;  1K8A U;  1NEB A;  2KMT A;  4M7D G;  4FIB A;  2RI5 A;  1RAF B;  4II1 A;  3OY9 A;  2KYB A;  3ZL7 C;  4JLG A;  3CD6 A;  1AHJ B;  1I07 A;  1IGU A;  3UA6 A;  1NJI R;  2KRM A;  2XIC A;  2L3P A;  2DER A;  3OA6 A;  5DLQ E;  1G3T A;  1C6V X;  2EYX A;  1KQ2 A;  5KCH A;  2PQW A;  4PJJ A;  5I11 A;  1Z9Z A;  1NEG A;  1ZX6 A;  2QQ9 A;  4E7I A;  3TU4 K;  8AT1 B;  1VQM Q;  3JB9 J;  5KCO A;  2VVK A;  1CKB A;  3ER0 A;  5A0L A;  1BI2 A;  2XDP A;  1VQO A;  3UAT A;  3I5S A;  3HRS A;  4BI4 A;  3VS0 A;  2F69 A;  4AFZ C;  3CCQ T;  5LJ3 e;  4LDY A;  1TTH B;  5CQY A;  4M75 F;  1S1N A;  3QJ6 A;  3VS3 A;  4J83 A;  3JCM c;  3SWN A;  3P8B B;  3FIF A;  2JW4 A;  3EG9 A;  3D7S B;  2D0N A;  4BDY A;  2ENM A;  2XDB A;  2XKO C;  5L23 A;  4PNO A;  2KAF A;  1B34 A;  4JJC A;  3MJX A;  2KEA A;  3G4S A;  4CC2 A;  2YT6 A;  2O31 A;  1JBM A;  5CKH A;  2CP2 A;  1EFN A;  1H8K A;  1VQ4 A;  2BUD A;  1ZSG A;  5LJ5 d;  4QVZ A;  1ZA2 B;  2VYT A;  1W4S A;  4FYX B;  2L8D A;  1FMW A;  2NUP A;  5GAO n;  2E6N A;  1D3B A;  1S72 T;  1D0Z A;  2CP0 A;  3C0C A;  4IIO A;  1VQN Q;  4M7D F;  3KBG A;  4IIM A;  4EMK C;  3SHW A;  1GBQ A;  2CP6 A;  2DEU A;  5GAM h;  1S72 A;  4B9X A;  3QZ5 B;  1K9M C;  1M5Q 1;  4XU0 A;  1UHF A;  4J9G A;  2CP5 A;  2WAC A;  3VRZ A;  4M77 D;  4J9F A;  4KH0 B;  4O6J A;  1NM7 A;  4BE2 A;  3J81 E;  3S3O A;  5FRM A;  1CKA A;  2LP5 A;  3JCM Q;  2YLB A;  4C8Q E;  2O4X B;  1FX7 A;  4OGE A;  2VGM A;  3I55 A;  2OTL Q;  4XTW A;  1KHI A;  2ZPF B;  1BB9 A;  1AEY A;  3EFR A;  3LH0 A;  1BK2 A;  1VQ6 A;  3E19 A;  5LJ3 h;  2JT4 A;  4KUI A;  2DL7 A;  3URG A;  1T3S A;  4C92 G;  1OOT A;  4K11 A;  3CCJ A;  4B6M A;  1O75 A;  1XJW B;  2JTM A;  2MI6 A;  3EGX A;  2RHI A;  3LGL A;  2EJF A;  2QQR A;  2HKN A;  2EYW A;  4AG1 C;  1M90 R;  1ABO A;  1BU1 A;  4M78 A;  4FW2 A; 
#chains in the Genus database with same CATH homology
 2MOX A;  3RNJ A;  2EPD A;  2C0O A;  2RQV A;  1E7O A;  2FRW A;  4RTU A;  1W70 A;  1UGV A;  1WXB A;  1K76 A;  2DE0 X;  1SHF A;  2A37 A;  2O88 A;  1Z9Q A;  1SPK A;  1UDL A;  1UFF A;  1WDX A;  2J06 A;  2O2O A;  2RN8 A;  4AFQ C;  1WXU A;  2HDA A;  1ARK A;  2NWM A;  1RI9 A;  1KIK A;  2K6D A;  2LX7 A;  2K3B A;  2YSQ A;  2F2W A;  2DA9 A;  1H3H A;  1SRM A;  1M30 A;  1MV3 A;  1JQQ A;  2JTE A;  1PRL C;  2P4R A;  2KR3 A;  1G2B A;  2KBT A;  2DL4 A;  1X2K A;  5IXF A;  1ZUY A;  2FPD A;  3THK A;  2GNC A;  2EKH A;  2RQW A;  1YNZ A;  2RF0 A;  4HVW A;  2LQW A;  2KYM A;  1T0J A;  3FJ5 A;  4RTT A;  1JEG A;  2AZV A;  1SSH A;  1UEC A;  1PKS A;  4D8K A;  4R0K A;  1JO8 A;  1MV0 B;  2J6F A;  1T3L A;  2A36 A;  2F2V A;  3M0S A;  3KFV A;  1PRM C;  5IHK A;  3QWY A;  1H92 A;  1B07 A;  1NYG A;  2CT3 A;  2LCS A;  4RUG A;  1AWJ A;  2GQI A;  2YDL A;  1QLY A;  1GCQ A;  2CSI A;  1TG0 A;  2NUZ A;  2FEI A;  2DRM A;  4CC7 A;  1CSK A;  1NLO C;  2C0T A;  3EG3 A;  2AK5 A;  2YUN A;  2EGE A;  3H41 A;  1AWO A;  4RTY A;  4DEX A;  3O5Z A;  2KGT A;  3EHQ A;  1YCS B;  1M8M A;  2I0N A;  4WCI A;  2DBK A;  5FW9 A;  1X69 A;  4E6R A;  4F17 A;  2FO0 A;  1UTI A;  2ROT A;  4ZNX A;  2B86 A;  2C0I A;  1U5S A;  4Z89 A;  3NMZ C;  4OMN A;  3VS5 A;  1RUW A;  3ULR B;  1K0S A;  3VS4 A;  2V1R A;  1W1F A;  1KFZ A;  2BZX A;  1Y57 A;  1GFD A;  1WLP B;  3NPF A;  5FWC A;  5IHI A;  3IQL A;  3NHN A;  3UF4 A;  2FRY A;  2K79 A;  1MUZ A;  1YWO A;  2KRS A;  2LJ1 A;  4A63 B;  1PKT A;  2PNI A;  1I1J A;  2CH4 W;  1GFC A;  2CRE A;  2DF6 A;  2LMJ A;  1JXO A;  4JZ4 A;  2D8J A;  2GTJ A;  2BTT A;  2DBM A;  2SRC A;  2D1X A;  3VS2 A;  3QWX X;  2EGC A;  1PNJ A;  1JXM A;  2D8H A;  1YP5 A;  1B3Q A;  1TUC A;  1YWP A;  2DL5 A;  4KRT A;  1ZUK A;  1WYX A;  3CQT A;  1OEB A;  1GRI A;  1VYV A;  2VKN A;  3TVT A;  2W0Z A;  2ED1 A;  2W10 A;  3EGU A;  2K9G A;  1PWT A;  1K9A A;  2KT8 A;  4CC3 A;  4CC4 B;  4HCK A;  1U06 A;  2PTK A;  2CUD A;  1NYF A;  2JXB A;  1K1Z A;  2RNA A;  1M3C A;  2DNU A;  4JJB A;  1XOV A;  2KRN A;  3EG1 A;  1KJW A;  2EW3 A;  2K2M A;  2F2X A;  1OPL A;  2YUQ A;  2H8H A;  2RQR A;  1K4U S;  2LJ3 A;  1PHT A;  2DRK A;  5HCK A;  3UA7 A;  2KXC A;  4LE9 A;  1AVZ C;  2ECZ A;  2X3W D;  4D8D A;  2EYZ A;  2K7A A;  4EIK A;  2OJ2 A;  2DYB A;  5ECA A;  1HSQ A;  1JU5 C;  5EC7 A;  2J6K A;  2L0A A;  4HVU A;  1WXT A;  1M3A A;  1QWF A;  1V1C A;  4F16 A;  4OMO A;  2AZS A;  1UJY A;  1A0N B;  2AKK A;  3I9Q A;  4AG2 C;  2CH4 A;  1FYN A;  2RMO A;  2DVJ A;  2DIL A;  4OMQ A;  4GLM A;  3EG0 A;  1J3T A;  2L3S A;  2ED0 A;  4Y92 A;  2MCN A;  3R6N A;  2L2P A;  2MIO A;  1E6G A;  4RTW A;  2GBQ A;  4LUE A;  4J9D A;  1ZUU A;  1AZE A;  1UJ0 A;  4J9H A;  4LUD A;  4DEY A;  1FMK A;  1GBR A;  2EBP A;  1QKW A;  2ABL A;  2QDL A;  2L3Q A;  2JM8 A;  3JV3 A;  1RLP C;  2JS2 A;  1U3O A;  1KSW A;  3RBB B;  2CT4 A;  1SRL A;  2KNB B;  2DM1 A;  1M27 C;  3REB B;  2XMF A;  5GJV B;  1X6G A;  3SEM A;  1WI7 A;  1M3B A;  2LQN A;  4J9E A;  1HD3 A;  2RQT A;  1AD5 A;  1Y0M A;  1LCK A;  4M4Z A;  2J7I A;  1AZG B;  1OV3 A;  1NEB A;  1WA7 A;  4Z8A A;  1NLP C;  3M0P A;  1E6H A;  2KYB A;  3ZL7 C;  2KE9 A;  2JMC A;  1I07 A;  3UA6 A;  2KRO A;  4AFS C;  1YN8 A;  2KRM A;  2YUP A;  2L3P A;  4F14 A;  2EYY A;  2HBW A;  4Z88 A;  2A28 A;  1W6X A;  2EYX A;  4JJD A;  5I11 A;  1Z9Z A;  1NEG A;  1VA7 A;  1ZX6 A;  2V1Q A;  2DLP A;  3H0F A;  1OPK A;  1ZBJ A;  2VVK A;  1CKB A;  1ABQ A;  2HCK A;  3PVQ A;  1X2Q A;  4RTX A;  4X1V A;  4JPB W;  3UAT A;  2OI3 A;  3I5S A;  3REA B;  1QKX A;  4J9I A;  3VS0 A;  1AOJ A;  3NGP A;  4AFZ C;  2EGA A;  1UG1 A;  2E5K A;  1S1N A;  3H0H A;  1X27 A;  1TUD A;  3VS3 A;  1K0X A;  4HXJ A;  2BZ8 A;  2O9S A;  2DL3 A;  2JS0 A;  3PVL A;  3VRY A;  2CUB A;  2X3X D;  2JW4 A;  2A08 A;  4FSS A;  2D0N A;  2ENM A;  2SEM A;  5FWB A;  1X6B A;  5L23 A;  3TSZ A;  3M0T A;  2ROL A;  4ORZ A;  2RPN A;  2J6O A;  4JJC A;  4J9C A;  2DX1 A;  3VS7 A;  2KEA A;  2DL8 A;  1AWX A;  4CC2 A;  1GL5 A;  2YT6 A;  2O31 A;  4LN2 A;  3GBQ A;  3VS6 A;  2OAW A;  1VYT A;  2DMO A;  1EFN A;  1H8K A;  2AKL A;  5IH2 A;  3TSW A;  1ZSG A;  3M0U A;  2G6F X;  1UUE A;  4LNP A;  2VWF A;  1SHG A;  5IHN A;  3VS1 A;  3C0C A;  2FPF A;  1WFW A;  4IIO A;  4OMM A;  1WX6 A;  3LH5 A;  3I35 A;  2HEQ A;  2KT1 A;  1GCQ C;  2GGR A;  1N5Z A;  1NG2 A;  4IIM A;  3U23 A;  2IIM A;  2KXD A;  3SHW A;  2O9V A;  4AFU C;  1GBQ A;  2J05 A;  5IXB A;  4GBQ A;  2CSQ A;  3PE0 A;  4RTV A;  2ESW A;  1UHF A;  4J9G A;  1BBZ A;  3M0Q A;  3VRZ A;  2JMA A;  4J9F A;  1WIE A;  1NM7 A;  4ESR A;  2DJQ A;  2RQU A;  2EQI A;  1CKA A;  1IO6 A;  2LP5 A;  1QWE A;  4RTZ A;  5I22 A;  2YUO A;  2CDT A;  3H0I A;  2LJ0 A;  3I5R A;  2LZ6 B;  4JZ3 A;  4J9B A;  1BB9 A;  1HJD A;  1AEY A;  1UHC A;  3A98 A;  2FPE A;  1VYU A;  1ZLM A;  1BK2 A;  2FG0 A;  1QCF A;  2JT4 A;  1T0H A;  4HVV A;  3M0R A;  2DL7 A;  2BZY A;  1AWW A;  1T3S A;  4OMP A;  5GJW B;  1OOT A;  2JM9 A;  4K11 A;  2M0Y A;  2LNH B;  4OML A;  2EVR A;  1GCP A;  1UE9 A;  1I0C A;  1RLQ C;  2HSP A;  2M51 A;  1SEM A;  2EYW A;  2GTO A;  4AG1 C;  3EHR A;  1ABO A;  2PZ1 A;  4QT7 A;  1BU1 A;  3EG2 A;  1X43 A;  1G83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...