1NEGA

Crystal structure analysis of n-and c-terminal labeled sh3-domain of alpha-chicken spectrin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLAAAWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rapid purification and crystal structure analysis of a small protein carrying two terminal affinity tags
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1negA00
1PWTA 5GJVB 4X1VA 5IHNA 2DVJA 4D8KA 2KT1A 3GBQA 3VRYA 1NG2A 2OJ2A 4LE9A 1VYVA 1GFCA 2OAWA 1W6XA 4AFQC 1PKTA 4FSSA 1YWOA 2DL3A 1Z9ZA 5EC7A 4RTVA 1ZBJA 2DJQA 2D0NA 2BTTA 1X2KA 2EVRA 1NYFA 1I1JA 5IHIA 4LNPA 1PKSA 1Z9QA 2EW3A 3EHQA 4OMNA 1IO6A 4J9IA 3LH5A 1JU5C 1Y57A 2SEMA 3VS4A 1K0SA 2BZYA 2O9SA 4CC3A 4RUGA 2MIOA 4A63B 5IXBA 3FJ5A 2GNCA 2K6DA 1QWFA 1BB9A 1WA7A 1W1FA 1PRLC 4F17A 5IHKA 1UG1A 2DBMA 3THKA 1Y0MA 3H41A 4HVWA 1WIEA 3M0RA 1GL5A 1GCPA 2FPEA 2FEIA 3UF4A 2LJ3A 2LP5A 2KXCA 1E6HA 2GTOA 2DF6A 2YUPA 2KRSA 2JTEA 2JS0A 2A08A 2RQRA 3VS5A 2EBPA 2XMFA 2JXBA 2CUBA 3EG0A 3EG1A 1HJDA 4RTYA 2AKLA 3M0PA 2HCKA 1A0NB 4OMMA 4HXJA 1E6GA 1M3CA 1V1CA 2FRWA 2ROLA 3UATA 1ZUKA 3O5ZA 4HVUA 1AWXA 1U3OA 1UE9A 2L0AA 2GTJA 2NWMA 2GBQA 2JMAA 2J05A 4AFZC 2ED1A 2RMOA 3M0QA 2DNUA 2KYBA 3M0UA 4GBQA 2AZSA 2ABLA 2L3QA 3C0CA 2L3PA 1OPKA 4J9HA 2ENMA 2RN8A 1K0XA 1AWWA 4QT7A 3KFVA 1RLPC 1QLYA 2A37A 1K1ZA 3NHNA 2V1QA 1UJ0A 1G2BA 2DL7A 2HDAA 4OMLA 4RTUA 4AG2C 2FRYA 2KR3A 3RNJA 2FG0A 1M3AA 2M0YA 5HCKA 1K76A 4WCIA 1ABQA 2O31A 4RTWA 4LUDA 1SPKA 4HVVA 1VYTA 1AZGB 2LJ1A 2O2OA 1UDLA 2K2MA 1AWJA 2JT4A 4CC4B 3PE0A 2J06A 2EGAA 1B07A 1SHGA 3VRZA 1EFNA 1TG0A 1GBQA 2DL8A 2J7IA 2C0TA 2C0OA 2G6FX 2JS2A 1PHTA 2J6KA 2CH4W 4LN2A 2LQNA 1TUDA 1ZSGA 2CH4A 1H92A 4JZ3A 4DEYA 2DMOA 1T0JA 1XOVA 4J9EA 1KJWA 3TSZA 2FPDA 2JM8A 1WX6A 2K9GA 2F2WA 1M27C 1QWEA 3M0SA 1UHCA 2D1XA 1E7OA 2ESWA 2A28A 2CSIA 2LJ0A 2LZ6B 1UUEA 3ZL7C 1WXUA 1AZEA 1UFFA 4CC2A 2MOXA 1UECA 4E6RA 2M51A 1MUZA 1NEGA 3I5RA 1YCSB 3TSWA 4F16A 1OOTA 2D8JA 2PNIA 2MCNA 2FO0A 3NGPA 1NEBA 3VS1A 2RQWA 3SEMA 4RTZA 1YP5A 3H0IA 1MV0B 3VS7A 1KSWA 2A36A 2EQIA 1X27A 2CT4A 2PTKA 4RTTA 2YUNA 2CUDA 4AG1C 1M8MA 3NMZC 1GCQA 1CSKA 2DM1A 2JW4A 1U06A 1GBRA 4OMQA 1BK2A 4ZNXA 2D8HA 2KROA 3VS3A 1KIKA 1ZLMA 1JEGA 2C0IA 1GFDA 4OMOA 2BZ8A 2VVKA 2F2XA 1GCQC 1T3LA 4JJCA 2DYBA 2O88A 1X43A 2KNBB 4DEXA 1YN8A 2DE0X 2KRNA 2K79A 2KBTA 2KT8A 1RUWA 2EGCA 3VS0A 3H0FA 1WDXA 2J6FA 2YUOA 3ULRB 2PZ1A 1I0CA 2DILA 1T3SA 2KE9A 2HBWA 4ORZA 4EIKA 1QKWA 3QWYA 1J3TA 1S1NA 3UA7A 4HCKA 2CT3A 1AOJA 1LCKA 5L23A 5IXFA 1X69A 4K11A 1KFZA 2EYXA 3H0HA 2LCSA 2DBKA 1U5SA 2SRCA 1VA7A 1GRIA 2YSQA 1X6GA 1UJYA 1WXBA 2LMJA 1WFWA 3A98A 3M0TA 1FMKA 4LUEA 4AFUC 2ED0A 2GQIA 1HSQA 1H8KA 1ZUYA 2AZVA 2DRKA 2RPNA 2X3WD 3REBB 1SHFA 2OI3A 1RI9A 5FW9A 4KRTA 2QDLA 1TUCA 1MV3A 1NLPC 1UGVA 2JMCA 2KYMA 4AFSC 2H8HA 2I0NA 2CSQA 3VS6A 2RNAA 1JXOA 4J9DA 2CDTA 4IIMA 5I22A 2K7AA 2EKHA 1RLQC 1BBZA 2FPFA 2O9VA 3VS2A 1K9AA 1PRMC 1WYXA 1N5ZA 1X6BA 3I5SA 1AVZC 1T0HA 1WI7A 2EGEA 4Y92A 4GLMA 2YT6A 3CQTA 1SSHA 1CKBA 2W10A 2F2VA 2RQUA 4J9BA 1CKAA 4M4ZA 1PNJA 1AEYA 1M3BA 2L2PA 1NLOC 1YWPA 2HEQA 5FWCA 1G83A 3R6NA 3IQLA 2K3BA 5IH2A 5GJWB 1K4US 4IIOA 2DL5A 1M30A 2X3XD 2EYZA 3PVLA 2ECZA 1JXMA 2EYWA 1OV3A 3SHWA 2RQTA 3EG3A 1JQQA 1QKXA 1NM7A 1HD3A 2P4RA 3TVTA 4Z88A 4J9FA 2LX7A 1JO8A 1SRMA 2KRMA 1QCFA 4JPBW 1VYUA 1ABOA 1UHFA 2KXDA 2RQVA 2B86A 2GGRA 2AK5A 2HSPA 1AWOA 1BU1A 2L3SA 3U23A 2DA9A 4D8DA 5FWBA 4ESRA 2E5KA 3I35A 3REAB 2RF0A 2KGTA 2DX1A 1NYGA 3JV3A 1B3QA 1WLPB 1AD5A 2KEAA 2DL4A 2LQWA 4JJBA 2J6OA 2DLPA 1H3HA 3EG2A 3NPFA 2BZXA 4R0KA 1ZX6A 5I11A 2ROTA 4J9CA 4J9GA 1FYNA 1UTIA 2DRMA 1ZUUA 2NUZA 1WXTA 1ARKA 2YUQA 2VWFA 3RBBB 5ECAA 4OMPA 2IIMA 2CREA 3I9QA 2JM9A 2EYYA 4RTXA 1OPLA 1X2QA 2AKKA 2W0ZA 3UA6A 2EPDA 3EHRA 2YDLA 1OEBA 4CC7A 2VKNA 4Z89A 2LNHB 3PVQA 2V1RA 3EGUA 1YNZA 3QWXX 4Z8AA 4JZ4A 4F14A 4JJDA 1W70A 1SRLA 1SEMA 1I07A
chains in the Genus database with same CATH superfamily
4E7LA 1Q81R 4IUQA 2MPXC 5KCOA 4D8KA 2XDPA 3A1PA 3VRYA 1VIEA 1VOMA 2VV5A 3NTKA 2COZA 4J7FA 4AFQC 4FSSA 4PJOD 4M77G 3META 4R55A 1X2KA 4LNPA 1D0XA 4MZPA 2EW3A 3EHQA 1IO6A 5AT1B 2EYQA 2OTLQ 1O75A 2DTIA 2KY9A 3UT1A 4FYYB 1VQOA 4CC3A 1KK7A 5IXBA 1Q86U 3CCQQ 1RABB 4FL6A 1PRLC 5IHKA 4OB2B 1UG1A 3L2RA 3CBMA 2OX7A 3THKA 3JCMP 2ZGWA 4QQ6A 3JB9D 2RM4A 3M4YA 4WTOB 3LW5E 4ZTFA 5LJ3e 4IUPA 1AT1B 2LP5A 1LOJA 2KXCA 4PFOA 4OB1B 3CD6T 4JUVA 1KG1A 4J8OA 2RQRA 2A08A 2EBPA 3FDRA 3EG0A 2CUBA 3I55T 3EG1A 1HJDA 4RTYA 1NJIR 3UPUA 2A7YA 2DZ9A 1VQNT 4HXJA 4V2SA 3O5ZA 4C0DC 1TS9A 1AWXA 1U3OA 1UE9A 3T9NA 1B7TA 2J05A 4C92E 1YI2A 3M0QA 2KYBA 2AZSA 4ELZC 4IUVA 3SFMA 2AIRB 3C95A 5HKCA 1NJIU 2L3PA 3JCMh 2GF7A 3LYIA 1IRXA 1AWWA 3TCJA 3QJ6A 4QT7A 3KFVA 4C0ZA 3X24B 2X9HA 1C0MA 4M75B 2OTJA 2OTLT 3QKJA 2H3JA 1KQSA 3OS2A 4BE2A 2FRYA 2LQKA 4M77E 1KC8R 1IGQA 4E7KA 1S72T 1Y96A 3CCVA 4LUDA 1SPKA 4C0DB 3RDVA 1BYMA 1NPPA 4VUBA 3CC7Q 4RMOA 4O6JA 2ZAEA 2J06A 3DLLA 3HRUA 4GLKA 1SHGA 1EFNA 1TG0A 2DL8A 1D3BA 2C0TA 2ZPEB 1UEBA 3UWNA 2HQXA 5LJ3j 1ZSGA 1YCYA 3LWHA 4DEYA 4J9EA 1FMVA 5LJ5j 2K9GA 1IZ6A 2E5QA 4PL6A 3VYHB 3BDLA 5GAOp 1SG5A 1E7OA 2CZ6B 2ZPGB 4C8QE 4J6WA 4YTLA 3JCMb 5KH6A 3MKDA 1KQ2A 9ATCB 4QVDA 1KD1C 4BE0A 2DVEA 1NEGA 4C0FA 4C5GA 1YCSB 3QDRB 4ZGJB 5GMKi 4WF2A 2NLUA 2XDBA 3RKYA 4FT4A 3SEMA 5GAOn 3H0IA 4OGEA 3VS7A 2DD4A 4DQ2A 2K5FA 1VQMQ 4OF1A 1M8MA 2PVDB 1GCQA 1XNIA 2PUOB 2FB7A 2KK4A 4XTWA 1OU9A 4C8QD 4PKCC 1KIKA 1ZLMA 1JEGA 4B9WA 2C0IA 4JRIA 3PGGA 2O4XA 2VVKA 3QG1A 3X25B 3VJPA 1GCQC 5D7UA 2FZKB 2E6ZA 3V7RA 2KNBB 4DEXA 2K79A 2KT8A 5C0MA 2EGCA 4A4GA 3HRTA 4X9DA 1WDXA 2FVUA 4M7AC 1HK9A 2RA2A 4B6MA 5KE3A 3BDUA 4XQ3A 2HBWA 1S1NA 1UGSB 3UA7A 5KCHA 3OYEA 3FC3A 3LLRA 3FIFA 3OW2P 4JS5A 4L59A 3SD4A 3H0HA 4Z02A 3RIRA 4NL3A 2LCSA 4FM4B 3EGXA 1K9MU 2LVMA 1VA7A 1YIJT 2BUDA 5D6WA 4M75G 3MPUB 1WJSA 4XTXA 2G3RA 1OI1A 2YRDA 3CMEQ 1FMKA 2LCLA 1YIJA 1TSFA 2DO3A 5J26A 1HSQA 2AZVA 4BI4A 1KQSS 3MO8A 3AHUA 1SHFA 5GAN8 1BI0A 1Q7YU 2OI3A 1RI9A 3QDFA 3EGXB 3QIIA 5HK0A 4BE1A 3OYJA 3L1AA 5FW9A 1OX8A 4KRTA 2BIVA 4M78C 1QVGP 1MV3A 3OBYA 2H8HA 1SSFA 2RNAA 4J9DA 3HFOA 4QQDA 2OTJT 2CDTA 5D6YA 1QCNA 3J80E 2EKHA 3G4SA 4N4IA 1BBZA 5LJ5g 1D09B 4M7DD 5FU6B 1N5ZA 1VUBA 1X6BA 3A8HB 3JCMW 1FMWA 2QK0A 2QA4Q 2EGEA 3CC4T 2RJFA 1C6VX 4N4GA 3J81E 3A8GB 3CCSQ 1CKAA 4PFZA 3QO3A 1PNJA 2L2PA 5LJ5e 1YWPA 5FWCA 1KD1U 1VQLA 1VQKA 3DLMA 3MJXA 1BKBA 3IQLA 2K3BA 5GJWB 1YIJQ 5M9OA 1YJWQ 3QUIA 2X3XD 4C8QF 3JB9H 5CIUA 3GIBA 1I8FA 1OV3A 1ZA1B 1VQPQ 4HT8A 4C92A 3HFNA 3WVDB 3NFCA 1VQ7Q 3OMGA 1NM7A 3TVTA 3RESA 2MF2A 2GQVA 4J9FA 4PJNA 1SRMA 5GMKm 1M8VA 2E70A 3LGLA 4O5VA 8ATCB 1I81A 2RQVA 3S6WA 4E7HA 2K57A 1AWOA 5FWBA 2DERA 4PJMA 3JCMd 2KGTA 1O9SA 1NYGA 3VV0A 1WLPB 2LQWA 2DL4A 4JJBA 2DLPA 1MGQA 1YJ9A 3A8LB 4ME7A 2CP6A 1G8XA 2QAZA 2DYIA 4PJOC 3JCMX 1M9SA 3FRNA 5I11A 1M90R 1VQLT 3D7SB 4J9CA 3KXTA 1IHWA 5GMKj 1OX9A 3GNGA 1Y71A 1ZUUA 1WXTA 5KYWA 1MMAA 4XU3A 3MP8A 4X34A 5ECAA 3M5AA 2IIMA 2GFAA 4LD6A 2QDYB 2VC8A 4RCCA 2JM9A 1RAGB 5GAN5 2AKKA 3UA6A 5KYNA 2JVVA 2EPDA 1D0YA 2YDLA 3OMCA 2DXTA 1Y96B 1JBMA 4MMKA 5DY9A 3QWXX 3QSUA 3CPFA 4JZ4A 4A53A 2QA4T 4QKUA 2CP2A 1MHNA 5GJVB 4X1VA 2XICA 5IHNA 2DVJA 3OW2S 1NG2A 2LC4A 2OJ2A 1GFCA 2OAWA 4N4HA 3QZ5B 5CQXA 2RD1A 1VQ7A 1Z9ZA 5CKDA 2ZPHB 1ZBJA 2DJQA 2K5IA 3FB9A 3RKXA 2D0NA 1YI2Q 3TREA 1Z9QA 1VQMA 3J7AF 3LH5A 1Y57A 3VS4A 3MEAA 1ZHIA 1VQPT 3EG9A 4RUGA 1NPRA 3FJ5A 4JDSA 2K6DA 3OYFA 5AYFA 1WA7A 4KH1B 3I56Q 1TTHB 2WACA 2E1HA 1VQKQ 3BW1A 1PCXA 4DBFA 5IAYA 2WSEE 3M0RA 4A4HA 1VQ9T 2M02A 3A8MB 3QPHA 3UF4A 1M90C 2F69A 2CP3A 2GTOA 4LDXA 2YUPA 4C92F 1K73U 3ZEHA 2JTEA 2JS0A 4HCZA 4C8QG 3MHXA 3S3NA 5IT9E 1E6GA 2E65A 4XU1A 2JTFA 1ZUKA 1PSEA 2GTJA 4FYXB 1BI3A 1WQ7A 2JMAA 3CC2Q 2RHIA 4PJOB 1YHQQ 2QQBA 2BE9B 2F5KA 3H6ZA 3G6EA 1BCOA 2IG0A 3G71Q 2L3QA 3C0CA 5A0LA 1YJ9Q 1D0ZA 4RCBA 3MEVA 1N8RR 3JRZA 4M78B 5A2QE 1VQ6T 1QLYA 3QXEB 4A54A 3CPWP 3SB2A 2OAUA 4FT2A 2KDSA 1UJ0A 1G2BA 2DL7A 3I56A 4R56A 3L2UA 2DKGA 3OQ5A 1R8OB 3G4ST 2MMPA 3CXCS 4M75D 5HCKA 4WCIA 2XD0A 2O31A 2D9TA 1VQOQ 2RJEA 2V8KA 4QVZA 1JJ2S 3LWIA 1WNLA 5DLQE 1UDLA 2BE7D 1AWJA 4NL2A 1U1SA 1S72Q 3OSSC 4UC4A 1B07A 2FZCB 3CCEA 1TXQA 5KYXB 3GF5A 5GAMg 1GBQA 1QP3A 3Q1JA 3M57A 4C8QC 1WHGA 1P92A 4OB0B 5GAOm 3L2WA 4E7SA 1KC8C 1IGUA 3M53A 1T0JA 1XOVA 2QYZA 2FPDA 3CCJA 1M2VB 4QQGA 3QYGB 1M27C 1UHCA 4FCYA 5KYXA 2D1XA 2Z0WA 2LJ0A 5CAIA 3CC2A 5FU7C 1FXXA 2HQEA 1VQ7T 1UFFA 4CC2A 2MOXA 2RHYA 1UECA 4E6RA 2M51A 2RHUA 1MUZA 4LDYA 4M7DB 3TSWA 4F16A 2E64A 1PD0A 3E2UA 1M5Q1 3VU3C 2RQWA 1F1BB 2K2VA 3QYHB 2NUTA 5CO7A 1MV0B 5GMKe 1X27A 2PTKA 3CPWA 4CI0C 2C06A 2NUPA 2YUNA 1K9MR 1W2BP 2LRQA 4OMQA 2D8HA 4HCCA 3VS3A 1K9MC 1VQ4T 2HKQB 1GFDA 2QQSA 2RB6A 2F2XA 2NUPB 1T3LA 3OYNA 5LJ5h 1RUWA 3CC7A 1QVPA 1ZA2B 1I5OB 5GAMd 4EMKB 3M58A 2PZ1A 2OTLA 1T3SA 4FYVB 3JCMf 4A4FA 4EIKA 4ORZA 5CKBA 1J3TA 3VUBA 3URGA 3L2ZA 4HCKA 2CT3A 1VQ8A 4JS4A 3CCUT 3PT9A 1VQ5Q 3A5ZB 5CKFA 1KFZA 3E9FA 2Y4XA 1M1GA 3EFRA 1WHLA 1GRIA 2GCXA 2YSQA 3G7ZA 1WXBA 4M78F 2RI5A 1AHJB 4BY6B 3O8VA 3A98A 1EX4A 1WGSA 4F04B 1YI2T 2ED0A 3VYGA 4EPCA 1X6OA 1M2VA 1VQ9A 1D1AA 2QEXQ 4M75C 2Y4YA 4M7DC 1M2OA 1YHQA 3ZBDA 3HSBA 1TUCA 2EFIA 1UGVA 2CP0A 3RERA 2KYMA 4AFSC 2Y90A 3X28B 3DB4A 4FYWB 5FU7B 4PK4A 2JUFA 1KQ1A 3CCVT 1U8RA 1RLQC 2KAFA 2FPFA 2O9VA 3VS2A 1WYXA 2X4XA 3RMSA 3WXMB 3OY9A 4MDXA 1PSFA 4II1A 1JRIA 1AVZC 4Y92A 4GLMA 4C8QB 2CZ1B 1N6AA 1CKBA 1G3WA 3INZA 2RQUA 5GANg 1YJWT 5CVIA 5KYUB 2MAMA 4J9BA 4FW1A 1M3BA 1NLOC 4PJOA 4A4KA 3CC4Q 4ZGDB 4PFPA 1Y07A 1LVKA 1JXMA 2EYWA 2KVQG 3JCMQ 4HCBA 4Y91A 1ZQ1A 4J6YA 1OULA 4P5NA 1SF9A 1JQQA 4DOVA 3I55A 2NUTB 4CRIA 4OB3B 4M77C 2KRMA 1KD1R 5HK3A 1HYOA 1MMNA 3CXCA 1ABOA 1UHFA 5GAN6 2KXDA 1M90U 4F7UB 2HSPA 3P8DA 4JRKA 1BU1A 1DJ7B 3U23A 4PLLA 4D8DA 1PG5B 2WSFE 1EIFA 4Y28E 1VQMT 4XU0A 4L5GA 2KSSA 2KEAA 3PTAA 2E3IA 2DXUA 3CCVQ 4KUDK 3JB9G 4R0KA 1WJQA 1LPLA 2QI2A 1XTDA 1SKUB 4E7JA 2RK2A 2DTHA 3HP9A 3G71A 3CCQA 4E2FB 3JCMV 2YWWA 5LJ5f 4OMPA 1UGQB 1V29B 2E41A 2CREA 4Q5WA 2KMTA 3DB3A 2HD0A 3I9QA 1OPLA 3M55A 4M7AG 4EMGA 2YHTA 1RADB 1OEBA 2EIFA 2BKDN 3PVQA 4XU2A 3EGUA 4B9XA 5GANh 2P0KA 2V8JA 3CC4A 3CMAQ 1RACB 8AT1B 1JJ2P 4BUGA 2LT1A 1X75C 3E9GA 2XKOC 3GBQA 1OQKA 3DKMA 3M56A 1PKTA 4M78A 3OYAA 3CCEQ 2DL3A 4J5YA 5EC7A 4RTVA 1QVFS 2WSCE 2DZCA 4KT0E 5KYYB 2BTTA 2EVRA 5IHIA 3CC7T 1PKSA 1WHHA 4LDWA 4OMNA 4BDYA 2DETA 3CCMA 1ACMB 1JU5C 1KHCA 2SEMA 3CBOA 4PNOA 3CCLA 3JCMe 3M4GA 2BZYA 2M9UA 4RKUE 2K3XA 3GPLA 2M16A 3OYLA 3NTIA 2XK0A 4AT1B 1QWFA 2VUBA 1BB9A 1IREB 3OYBA 3CCSA 4M7AE 3V8JA 4DA4A 3P8BB 2OTJQ 4PJOF 5GAMf 1Y0MA 2EAYA 4M77A 2K5LA 3H41A 1RAIB 4PLIA 1WIEA 3G1JA 4JLIA 5I21A 5FRNA 1GL5A 4C8QA 1GCPA 3I56T 3CXCP 2LJ3A 2GFUA 4M7AD 2L89A 1N27A 1YJNQ 2KRSA 1VQKT 3VS5A 1S72A 2XMFA 2JXBA 5LJ3h 3WVEB 1JJ2A 2HCKA 4J6XA 4OMMA 2DXBA 1V1CA 1VQ8Q 2ROLA 3UATA 2XHCA 4HVUA 2ZCFB 1ZSZB 3FLGA 3CMAT 2NWMA 2DEUA 4GY5A 3OYYA 2RMOA 5LJ3g 2DNUA 1BI2A 3M0UA 3EFOA 3HPWA 1VQ6Q 2ABLA 1YITQ 2R58A 1WHKA 2CP5A 1OPKA 4E7IA 2QGGA 3CCET 2CZ0B 4J9HA 4KUIA 4C5HA 3CCJQ 1H3ZA 1RLPC 3LX7A 1R77A 1N9RA 2X51A 2V1QA 4OMLA 1IHVA 2JOYA 4RTUA 2A0FB 4M7DF 2PUKB 2FG0A 1M3AA 2M0YA 1ABQA 1ZSZC 1VYTA 1AZGB 2K3YA 5GANd 1QMCA 2YRCA 3RKWA 5CKHA 2O2OA 3G4SQ 2K2MA 2JT4A 2EGAA 3VRZA 3OYCA 5GAN3 3CPWS 2DIQA 2DTOA 4M78G 1PHTA 1C1AA 2J6KA 2RJDA 3CCQT 2YLBA 1B34A 2ZPBB 2LQNA 7AT1B 2PU9B 3OYIA 1H92A 2FYKA 2QEXA 5KYYA 2DJZA 4XAXB 3RUXA 4EMHA 2X4JA 3KUFA 5HY6A 3NTHA 1IXDA 2JM8A 2F2WA 2EJ9A 4HT9A 3M0SA 1QP2A 1MMDA 1WHMA 4OMFB 2ESWA 3X26B 1UUEA 3ZL7C 5C6SA 1D1BA 1RAEB 2EQMA 1TU0B 3QJYA 3L42A 3EFSA 3I55Q 3I5RA 1G5VA 1UB4A 2CS7A 1QVGS 1OOTA 2D8JA 2M1HA 2MCNA 2FO0A 3NGPA 1NEBA 3VS1A 1Q82R 1XQHA 4IKFA 5J3BA 1PC0A 1YP5A 3EGDB 1KSWA 2EQIA 3GNFB 2CT4A 4C92B 4PJOE 4RTTA 2F1LA 2CUDA 5GAOq 2DM1A 2JW4A 2LNVA 1U06A 4BY6C 1GBRA 1BK2A 2KROA 3GLXA 3MCAB 1RI0A 2X35A 2XI9A 4JJCA 1M1FA 2DYBA 2QG9B 3V8LA 1X43A 4FU6A 1YN8A 2DE0X 2KRNA 2KBTA 2E6NA 3VS0A 2HL3A 4M77F 4DOWA 2NYSA 3GOXA 3ULRB 2YUOA 1TWBA 1ZBXA 2I2LA 1U1TA 2V8IA 1G3TA 5DLOA 1N9SA 2VB6A 5FRMA 2RHZA 1BCMA 1AOJA 2YLCA 5I2SA 4TVRA 3ER0A 1LNXA 4K11A 1RAHB 4D6WA 3CD6A 3LH0A 3TU4K 4E47A 2MI6A 3HHTB 1X6GA 1YHQT 1UJYA 4M7DE 2HNIA 3CBPA 3H8ZA 4FW2A 3AT1B 2KQWA 5D6XA 4HA8A 2LMJA 1WFWA 3M0TA 4AFUC 3C4SA 1KQSP 3JCMg 4ANJA 2GQIA 2K4YA 4C92C 5KYWB 2DRKA 2P0PA 2RPNA 3JSCA 2KI7A 2X3WD 4NS5A 3REBB 4OGCA 3F70A 3OYDA 2LCCA 1XJWB 3JB9F 2JMCA 4C5EA 3C94A 3P8HA 2I0NA 4OP0A 4IIMA 1W2BS 2ZPFB 1VQ4A 1OZ2A 1I4K1 1VQOT 4ELYC 1Q7YR 1RAAB 1K9AA 4EDUA 1WI7A 4C5IA 2VASA 2YT6A 1SSHA 2B8AA 3JB9I 1VQ8T 1QVFP 1M4ZA 1GXIE 3VKIA 1VQNA 4M4ZA 3SDZA 1AEYA 2HEQA 1FX7A 2RK1A 2PQWA 1G83A 2DAQA 3R6NA 1K73C 5LJ5d 5IH2A 3OYMA 4IIOA 1M1KR 2FHDA 4ATOA 4F7UE 1M30A 2EYZA 3PVLA 3MP6A 4C0GA 4N0AA 4C92G 2EQUA 3CCJT 3SHWA 2RQTA 3EG3A 1Q86C 1QKXA 3EGDA 3CCLT 2QTVA 4Z88A 3SWNA 2VGMA 2E10A 2LX7A 2LT4A 1WZOA 4XK8E 4M7AF 4C92D 2FL7A 2AK5A 1I5LA 2L3SA 1OZ3A 2DA9A 3OYHA 1VQ9Q 4ESRA 2E5KA 2JZ2A 3I35A 2RF0A 1K8AU 2DX1A 2RJCA 3MP1A 3CEYA 3CCMT 2QXFA 2H3EB 2J6OA 2DFUA 4M7AA 1H3HA 2QQAA 2PVOB 3LGFA 4AMCA 1ZX6A 2L8DA 4LD9K 5GANe 2ROTA 4JRPA 5DM7R 1QVFA 2HZYA 4QW2A 2RH2A 3CC2T 2DRMA 2NUZA 1M1KU 4M7AB 1ARKA 2YXYA 4EMKC 1LJOA 3L2QA 1D3BB 2JN0A 3TQ7P 3QHSA 3BE3A 5IN1A 4F7UG 1X2QA 4KGXB 2LX9A 4Z89A 2LNHB 2X4YA 4X9CA 1W4SA 1Q95G 1YNZA 4M7DA 3G6ET 1R0CB 4JJDA 2LTOA 1W70A 4F7UF 2CGHA 3OYGA 1SRLA 2DIGA 1PWTA 1K73R 5KE2A 2E3HA 4M75A 3G71T 2KT1A 4LE9A 2XG8D 1VYVA 5GAN7 1W6XA 1WPYA 1YWOA 4RG8A 1NYFA 1I1JA 3V7SA 4OVAA 2YRVA 3EFOB 1VQ6A 4J9IA 4J7IA 4M78D 1IB8A 1PD1A 1K0SA 2O9SA 4A63B 2MIOA 3PIOA 3EH2A 2GNCA 3H9NA 3QBYA 2PVGB 1W1FA 4F17A 1YFNA 3UDCA 4DBRA 1TH7A 5LJ3f 3OSVA 2DBMA 1QVGA 4HVWA 1WHJA 2M0OA 4IUUA 3OYKA 1JB0E 3FEOA 2FPEA 2FEIA 1QCOA 1EZZB 3EAEA 5CCAA 4M7DG 1E6HA 3CMEA 2DF6A 2P0QA 3PNWC 2AKLA 6AT1B 3CCRT 3M0PA 3A8OB 3C12A 1A0NB 2FRWA 1M3CA 3ASKA 5GAMj 2EWNA 3G6EQ 2ZPIB 1QQJA 1N8RU 2L0AA 4QVCA 2GBQA 1YJNT 1NBEB 3HTRA 4AFZC 2ED1A 1WJRA 4GBQA 5KYUA 5FROA 2MK5A 4DBHA 4M75E 1Q86R 1MNEA 1X01A 3OBWA 2LDMA 1V76A 2ENMA 2RN8A 1K0XA 3PFSA 2COYA 2L5QA 4XTZA 2A37A 3JCMc 1YITT 1K1ZA 3NHNA 2VYTA 2RHXA 4FSXA 3RR6A 2HDAA 2HSEB 4MDWA 4PJLA 4AG2C 1G3YA 1MMGA 2CKKA 2DEQA 2KR3A 1MNDA 5LL6S 3OA6A 3RNJA 2D0QB 1K76A 4RTWA 4HVVA 2LJ1A 1BIAA 4DBQA 2LQ8A 2X4WA 1TOVA 5LJ3d 3CCUQ 1RL2A 4CC4B 1YJWA 3OB9A 5CK9A 3PE0A 3GP8A 2J7IA 4BI3A 4ZTJA 2C0OA 2G6FX 4FIBA 4BACA 2JS2A 2E12A 3PMIA 2HMAA 2CH4W 4LN2A 1TUDA 4M75F 3CCRQ 1KHIA 2CH4A 4JZ3A 1TUGB 2DMOA 4A4EA 1KJWA 3TSZA 4J83A 1WX6A 2HBPA 1QWEA 1PM3A 4RG2A 3FJPA 5A0GA 2A28A 2CSIA 3OW2A 2LZ6B 1AZEA 1BIBA 1WXUA 3CCLQ 3E1SA 4KBMB 1YJ9T 2R5AA 1BI1A 3QZ9B 4F7UA 2JJ9A 3V7CA 4BDZA 4JJNK 2A3LA 2P84A 5GANf 2PNIA 2IVWA 4RTZA 4KULA 4M77B 2EJFA 2DK3A 2A36A 3ME9A 1Q81U 2HQHA 1M1KC 3S3OA 2QEXT 4AG1C 3NMZC 4IURA 1CSKA 3CCUA 4JRQA 1K8AC 4ZNXA 3OS5A 1QW1A 1UGRB 4OMOA 3ZFJA 2CZ7B 2BZ8A 4XTYA 2HKNA 2O88A 1H641 2RI3A 3BY7A 4HKEA 4LDVA 3H0FA 4KGVB 2J6FA 2V26A 2AHJB 1Q7YC 1I0CA 2DILA 2JTMA 5CR2A 2EKOA 3E19A 2P4TA 4MZTA 1VQ5A 2KE9A 1QKWA 3QWYA 3JAME 1R0BG 3CD6Q 2JNGA 1LCKA 2VXEA 5A0DA 3CCRA 5L23A 5IXFA 1X69A 3SWNC 2ZZDA 3EG9B 4ZGEB 2IPOB 1D1CA 2EYXA 3CMET 2DBKA 1HXDA 3JB9J 2SRCA 4NOYA 1U5SA 2DPPB 2QGFB 1NZ9A 4MZMA 1K8AR 4LUEA 3PIPA 2HAXA 3MEWA 1UGPB 2RO0A 1H8KA 1ZUYA 2XIDA 5GAMe 5CKEA 2EQKA 2XU8A 3N5BB 2R57A 2MWPA 4BI8B 2QDLA 2R5MA 1NLPC 1VQ4Q 2QQRA 2CSQA 3VS6A 1JXOA 3PMTA 5GAMh 1YITA 4E7ZA 5I22A 2K7AA 2AT1B 4ZN3A 4BD3A 3HKSA 1NE8A 1N8RC 3KBGA 4XTUA 4ZN1A 4EMKA 5GAN4 1PRMC 4M78E 4LDUA 3CCST 3I5SA 1T0HA 2RI2A 5FU6C 4LXCA 3OS1A 5I2MA 3CQTA 1YJNA 2W10A 2F2VA 3HRSA 3TEEA 4KGZB 2FZGB 1FWZA 1VIFA 5GAOr 5GMKl 2EQJA 1G3SA 5EG2A 5GMKh 3S3MA 2COWA 2DXCA 2MYSA 1K4US 2DL5A 4XTVA 1YBYA 1Y7XA 2QASA 3M59A 2ECZA 1NJIC 3BFMA 2VGNA 3VUZA 3MEUA 5L8RE 2QQ9A 1HD3A 2P4RA 2VXFA 1B34B 1JO8A 3M54A 1KC8U 1QCFA 2DD5A 1VQ5T 3RMQA 4JPBW 1VYUA 3CMAA 2QTXA 4PJOG 2O4XB 2B86A 2GGRA 4M77D 4MMLA 5J39A 4IUTA 2L3RA 4N0AC 3REAB 3JV3A 1B3QA 2EJGA 1AD5A 3EG2A 3NPFA 3SWNB 2D6FA 4PJJA 2QA4A 1OYXA 1Q82C 2BZXA 4BB7A 3JCMJ 5FLXE 4J9GA 3OS0A 1FYNA 5GAOl 1RAFB 3CCMQ 5GANj 5GAN2 3L2VA 1UTIA 3EH1A 1Q81C 2CYZB 3HL8A 2YUQA 2VWFA 1ZSZA 3RBBB 2O01E 1VQLQ 3M9QA 3V8KA 2EYYA 4RTXA 1OU8A 4JLGA 3X20B 4L6V5 2MWOA 2W0ZA 2XDDA 3EHRA 4CC7A 2VKNA 1VQPA 2ATCB 3R6OA 1VQNQ 2V1RA 5CQYA 2E4HA 2HL5C 4Z8AA 2F5TX 4F14A 1WQWA 4KH0B 1Q82U 2CP7A 1SEMA 1W2BA 1I07A
chains in the Genus database with same CATH topology
1PWTA 5GJVB 4X1VA 5IHNA 2DVJA 4D8KA 2KT1A 3GBQA 3VRYA 1NG2A 2OJ2A 4LE9A 1VYVA 1GFCA 2OAWA 1W6XA 4AFQC 1PKTA 4FSSA 1YWOA 2DL3A 1Z9ZA 5EC7A 4RTVA 1ZBJA 2DJQA 2D0NA 2BTTA 1X2KA 2EVRA 1NYFA 1I1JA 5IHIA 4LNPA 1PKSA 1Z9QA 2EW3A 3EHQA 4OMNA 1IO6A 4J9IA 3LH5A 1JU5C 1Y57A 2SEMA 3VS4A 1K0SA 2BZYA 2O9SA 4CC3A 4RUGA 2MIOA 4A63B 5IXBA 3FJ5A 2GNCA 2K6DA 1QWFA 1BB9A 1WA7A 1W1FA 1PRLC 4F17A 5IHKA 1UG1A 2DBMA 3THKA 1Y0MA 3H41A 4HVWA 1WIEA 3M0RA 1GL5A 1GCPA 2FPEA 2FEIA 3UF4A 2LJ3A 2LP5A 2KXCA 1E6HA 2GTOA 2DF6A 2YUPA 2KRSA 2JTEA 2JS0A 2A08A 2RQRA 3VS5A 2EBPA 2XMFA 2JXBA 2CUBA 3EG0A 3EG1A 1HJDA 4RTYA 2AKLA 3M0PA 2HCKA 1A0NB 4OMMA 4HXJA 1E6GA 1M3CA 1V1CA 2FRWA 2ROLA 3UATA 1ZUKA 3O5ZA 4HVUA 1AWXA 1U3OA 1UE9A 2L0AA 2GTJA 2NWMA 2GBQA 2JMAA 2J05A 4AFZC 2ED1A 2RMOA 3M0QA 2DNUA 2KYBA 3M0UA 4GBQA 2AZSA 2ABLA 2L3QA 3C0CA 2L3PA 1OPKA 4J9HA 2ENMA 2RN8A 1K0XA 1AWWA 4QT7A 3KFVA 1RLPC 1QLYA 2A37A 1K1ZA 3NHNA 2V1QA 1UJ0A 1G2BA 2DL7A 2HDAA 4OMLA 4RTUA 4AG2C 2FRYA 2KR3A 3RNJA 2FG0A 1M3AA 2M0YA 5HCKA 1K76A 4WCIA 1ABQA 2O31A 4RTWA 4LUDA 1SPKA 4HVVA 1VYTA 1AZGB 2LJ1A 2O2OA 1UDLA 2K2MA 1AWJA 2JT4A 4CC4B 3PE0A 2J06A 2EGAA 1B07A 1SHGA 3VRZA 1EFNA 1TG0A 1GBQA 2DL8A 2J7IA 2C0TA 2C0OA 2G6FX 2JS2A 1PHTA 2J6KA 2CH4W 4LN2A 2LQNA 1TUDA 1ZSGA 2CH4A 1H92A 4JZ3A 4DEYA 2DMOA 1T0JA 1XOVA 4J9EA 1KJWA 3TSZA 2FPDA 2JM8A 1WX6A 2K9GA 2F2WA 1M27C 1QWEA 3M0SA 1UHCA 2D1XA 1E7OA 2ESWA 2A28A 2CSIA 2LJ0A 2LZ6B 1UUEA 3ZL7C 1WXUA 1AZEA 1UFFA 4CC2A 2MOXA 1UECA 4E6RA 2M51A 1MUZA 1NEGA 3I5RA 1YCSB 3TSWA 4F16A 1OOTA 2D8JA 2PNIA 2MCNA 2FO0A 3NGPA 1NEBA 3VS1A 2RQWA 3SEMA 4RTZA 1YP5A 3H0IA 1MV0B 3VS7A 1KSWA 2A36A 2EQIA 1X27A 2CT4A 2PTKA 4RTTA 2YUNA 2CUDA 4AG1C 1M8MA 3NMZC 1GCQA 1CSKA 2DM1A 2JW4A 1U06A 1GBRA 4OMQA 1BK2A 4ZNXA 2D8HA 2KROA 3VS3A 1KIKA 1ZLMA 1JEGA 2C0IA 1GFDA 4OMOA 2BZ8A 2VVKA 2F2XA 1GCQC 1T3LA 4JJCA 2DYBA 2O88A 1X43A 2KNBB 4DEXA 1YN8A 2DE0X 2KRNA 2K79A 2KBTA 2KT8A 1RUWA 2EGCA 3VS0A 3H0FA 1WDXA 2J6FA 2YUOA 3ULRB 2PZ1A 1I0CA 2DILA 1T3SA 2KE9A 2HBWA 4ORZA 4EIKA 1QKWA 3QWYA 1J3TA 1S1NA 3UA7A 4HCKA 2CT3A 1AOJA 1LCKA 5L23A 5IXFA 1X69A 4K11A 1KFZA 2EYXA 3H0HA 2LCSA 2DBKA 1U5SA 2SRCA 1VA7A 1GRIA 2YSQA 1X6GA 1UJYA 1WXBA 2LMJA 1WFWA 3A98A 3M0TA 1FMKA 4LUEA 4AFUC 2ED0A 2GQIA 1HSQA 1H8KA 1ZUYA 2AZVA 2DRKA 2RPNA 2X3WD 3REBB 1SHFA 2OI3A 1RI9A 5FW9A 4KRTA 2QDLA 1TUCA 1MV3A 1NLPC 1UGVA 2JMCA 2KYMA 4AFSC 2H8HA 2I0NA 2CSQA 3VS6A 2RNAA 1JXOA 4J9DA 2CDTA 4IIMA 5I22A 2K7AA 2EKHA 1RLQC 1BBZA 2FPFA 2O9VA 3VS2A 1K9AA 1PRMC 1WYXA 1N5ZA 1X6BA 3I5SA 1AVZC 1T0HA 1WI7A 2EGEA 4Y92A 4GLMA 2YT6A 3CQTA 1SSHA 1CKBA 2W10A 2F2VA 2RQUA 4J9BA 1CKAA 4M4ZA 1PNJA 1AEYA 1M3BA 2L2PA 1NLOC 1YWPA 2HEQA 5FWCA 1G83A 3R6NA 3IQLA 2K3BA 5IH2A 5GJWB 1K4US 4IIOA 2DL5A 1M30A 2X3XD 2EYZA 3PVLA 2ECZA 1JXMA 2EYWA 1OV3A 3SHWA 2RQTA 3EG3A 1JQQA 1QKXA 1NM7A 1HD3A 2P4RA 3TVTA 4Z88A 4J9FA 2LX7A 1JO8A 1SRMA 2KRMA 1QCFA 4JPBW 1VYUA 1ABOA 1UHFA 2KXDA 2RQVA 2B86A 2GGRA 2AK5A 2HSPA 1AWOA 1BU1A 2L3SA 3U23A 2DA9A 4D8DA 5FWBA 4ESRA 2E5KA 3I35A 3REAB 2RF0A 2KGTA 2DX1A 1NYGA 3JV3A 1B3QA 1WLPB 1AD5A 2KEAA 2DL4A 2LQWA 4JJBA 2J6OA 2DLPA 1H3HA 3EG2A 3NPFA 2BZXA 4R0KA 1ZX6A 5I11A 2ROTA 4J9CA 4J9GA 1FYNA 1UTIA 2DRMA 1ZUUA 2NUZA 1WXTA 1ARKA 2YUQA 2VWFA 3RBBB 5ECAA 4OMPA 2IIMA 2CREA 3I9QA 2JM9A 2EYYA 4RTXA 1OPLA 1X2QA 2AKKA 2W0ZA 3UA6A 2EPDA 3EHRA 2YDLA 1OEBA 4CC7A 2VKNA 4Z89A 2LNHB 3PVQA 2V1RA 3EGUA 1YNZA 3QWXX 4Z8AA 4JZ4A 4F14A 4JJDA 1W70A 1SRLA 1SEMA 1I07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWT A;  5GJV B;  4X1V A;  5IHN A;  2DVJ A;  4D8K A;  2KT1 A;  3GBQ A;  3VRY A;  1NG2 A;  2OJ2 A;  4LE9 A;  1VYV A;  1GFC A;  2OAW A;  1W6X A;  4AFQ C;  1PKT A;  4FSS A;  1YWO A;  2DL3 A;  1Z9Z A;  5EC7 A;  4RTV A;  1ZBJ A;  2DJQ A;  2D0N A;  2BTT A;  1X2K A;  2EVR A;  1NYF A;  1I1J A;  5IHI A;  4LNP A;  1PKS A;  1Z9Q A;  2EW3 A;  3EHQ A;  4OMN A;  1IO6 A;  4J9I A;  3LH5 A;  1JU5 C;  1Y57 A;  2SEM A;  3VS4 A;  1K0S A;  2BZY A;  2O9S A;  4CC3 A;  4RUG A;  2MIO A;  4A63 B;  5IXB A;  3FJ5 A;  2GNC A;  2K6D A;  1QWF A;  1BB9 A;  1WA7 A;  1W1F A;  1PRL C;  4F17 A;  5IHK A;  1UG1 A;  2DBM A;  3THK A;  1Y0M A;  3H41 A;  4HVW A;  1WIE A;  3M0R A;  1GL5 A;  1GCP A;  2FPE A;  2FEI A;  3UF4 A;  2LJ3 A;  2LP5 A;  2KXC A;  1E6H A;  2GTO A;  2DF6 A;  2YUP A;  2KRS A;  2JTE A;  2JS0 A;  2A08 A;  2RQR A;  3VS5 A;  2EBP A;  2XMF A;  2JXB A;  2CUB A;  3EG0 A;  3EG1 A;  1HJD A;  4RTY A;  2AKL A;  3M0P A;  2HCK A;  1A0N B;  4OMM A;  4HXJ A;  1E6G A;  1M3C A;  1V1C A;  2FRW A;  2ROL A;  3UAT A;  1ZUK A;  3O5Z A;  4HVU A;  1AWX A;  1U3O A;  1UE9 A;  2L0A A;  2GTJ A;  2NWM A;  2GBQ A;  2JMA A;  2J05 A;  4AFZ C;  2ED1 A;  2RMO A;  3M0Q A;  2DNU A;  2KYB A;  3M0U A;  4GBQ A;  2AZS A;  2ABL A;  2L3Q A;  3C0C A;  2L3P A;  1OPK A;  4J9H A;  2ENM A;  2RN8 A;  1K0X A;  1AWW A;  4QT7 A;  3KFV A;  1RLP C;  1QLY A;  2A37 A;  1K1Z A;  3NHN A;  2V1Q A;  1UJ0 A;  1G2B A;  2DL7 A;  2HDA A;  4OML A;  4RTU A;  4AG2 C;  2FRY A;  2KR3 A;  3RNJ A;  2FG0 A;  1M3A A;  2M0Y A;  5HCK A;  1K76 A;  4WCI A;  1ABQ A;  2O31 A;  4RTW A;  4LUD A;  1SPK A;  4HVV A;  1VYT A;  1AZG B;  2LJ1 A;  2O2O A;  1UDL A;  2K2M A;  1AWJ A;  2JT4 A;  4CC4 B;  3PE0 A;  2J06 A;  2EGA A;  1B07 A;  1SHG A;  3VRZ A;  1EFN A;  1TG0 A;  1GBQ A;  2DL8 A;  2J7I A;  2C0T A;  2C0O A;  2G6F X;  2JS2 A;  1PHT A;  2J6K A;  2CH4 W;  4LN2 A;  2LQN A;  1TUD A;  1ZSG A;  2CH4 A;  1H92 A;  4JZ3 A;  4DEY A;  2DMO A;  1T0J A;  1XOV A;  4J9E A;  1KJW A;  3TSZ A;  2FPD A;  2JM8 A;  1WX6 A;  2K9G A;  2F2W A;  1M27 C;  1QWE A;  3M0S A;  1UHC A;  2D1X A;  1E7O A;  2ESW A;  2A28 A;  2CSI A;  2LJ0 A;  2LZ6 B;  1UUE A;  3ZL7 C;  1WXU A;  1AZE A;  1UFF A;  4CC2 A;  2MOX A;  1UEC A;  4E6R A;  2M51 A;  1MUZ A;  1NEG A;  3I5R A;  1YCS B;  3TSW A;  4F16 A;  1OOT A;  2D8J A;  2PNI A;  2MCN A;  2FO0 A;  3NGP A;  1NEB A;  3VS1 A;  2RQW A;  3SEM A;  4RTZ A;  1YP5 A;  3H0I A;  1MV0 B;  3VS7 A;  1KSW A;  2A36 A;  2EQI A;  1X27 A;  2CT4 A;  2PTK A;  4RTT A;  2YUN A;  2CUD A;  4AG1 C;  1M8M A;  3NMZ C;  1GCQ A;  1CSK A;  2DM1 A;  2JW4 A;  1U06 A;  1GBR A;  4OMQ A;  1BK2 A;  4ZNX A;  2D8H A;  2KRO A;  3VS3 A;  1KIK A;  1ZLM A;  1JEG A;  2C0I A;  1GFD A;  4OMO A;  2BZ8 A;  2VVK A;  2F2X A;  1GCQ C;  1T3L A;  4JJC A;  2DYB A;  2O88 A;  1X43 A;  2KNB B;  4DEX A;  1YN8 A;  2DE0 X;  2KRN A;  2K79 A;  2KBT A;  2KT8 A;  1RUW A;  2EGC A;  3VS0 A;  3H0F A;  1WDX A;  2J6F A;  2YUO A;  3ULR B;  2PZ1 A;  1I0C A;  2DIL A;  1T3S A;  2KE9 A;  2HBW A;  4ORZ A;  4EIK A;  1QKW A;  3QWY A;  1J3T A;  1S1N A;  3UA7 A;  4HCK A;  2CT3 A;  1AOJ A;  1LCK A;  5L23 A;  5IXF A;  1X69 A;  4K11 A;  1KFZ A;  2EYX A;  3H0H A;  2LCS A;  2DBK A;  1U5S A;  2SRC A;  1VA7 A;  1GRI A;  2YSQ A;  1X6G A;  1UJY A;  1WXB A;  2LMJ A;  1WFW A;  3A98 A;  3M0T A;  1FMK A;  4LUE A;  4AFU C;  2ED0 A;  2GQI A;  1HSQ A;  1H8K A;  1ZUY A;  2AZV A;  2DRK A;  2RPN A;  2X3W D;  3REB B;  1SHF A;  2OI3 A;  1RI9 A;  5FW9 A;  4KRT A;  2QDL A;  1TUC A;  1MV3 A;  1NLP C;  1UGV A;  2JMC A;  2KYM A;  4AFS C;  2H8H A;  2I0N A;  2CSQ A;  3VS6 A;  2RNA A;  1JXO A;  4J9D A;  2CDT A;  4IIM A;  5I22 A;  2K7A A;  2EKH A;  1RLQ C;  1BBZ A;  2FPF A;  2O9V A;  3VS2 A;  1K9A A;  1PRM C;  1WYX A;  1N5Z A;  1X6B A;  3I5S A;  1AVZ C;  1T0H A;  1WI7 A;  2EGE A;  4Y92 A;  4GLM A;  2YT6 A;  3CQT A;  1SSH A;  1CKB A;  2W10 A;  2F2V A;  2RQU A;  4J9B A;  1CKA A;  4M4Z A;  1PNJ A;  1AEY A;  1M3B A;  2L2P A;  1NLO C;  1YWP A;  2HEQ A;  5FWC A;  1G83 A;  3R6N A;  3IQL A;  2K3B A;  5IH2 A;  5GJW B;  1K4U S;  4IIO A;  2DL5 A;  1M30 A;  2X3X D;  2EYZ A;  3PVL A;  2ECZ A;  1JXM A;  2EYW A;  1OV3 A;  3SHW A;  2RQT A;  3EG3 A;  1JQQ A;  1QKX A;  1NM7 A;  1HD3 A;  2P4R A;  3TVT A;  4Z88 A;  4J9F A;  2LX7 A;  1JO8 A;  1SRM A;  2KRM A;  1QCF A;  4JPB W;  1VYU A;  1ABO A;  1UHF A;  2KXD A;  2RQV A;  2B86 A;  2GGR A;  2AK5 A;  2HSP A;  1AWO A;  1BU1 A;  2L3S A;  3U23 A;  2DA9 A;  4D8D A;  5FWB A;  4ESR A;  2E5K A;  3I35 A;  3REA B;  2RF0 A;  2KGT A;  2DX1 A;  1NYG A;  3JV3 A;  1B3Q A;  1WLP B;  1AD5 A;  2KEA A;  2DL4 A;  2LQW A;  4JJB A;  2J6O A;  2DLP A;  1H3H A;  3EG2 A;  3NPF A;  2BZX A;  4R0K A;  1ZX6 A;  5I11 A;  2ROT A;  4J9C A;  4J9G A;  1FYN A;  1UTI A;  2DRM A;  1ZUU A;  2NUZ A;  1WXT A;  1ARK A;  2YUQ A;  2VWF A;  3RBB B;  5ECA A;  4OMP A;  2IIM A;  2CRE A;  3I9Q A;  2JM9 A;  2EYY A;  4RTX A;  1OPL A;  1X2Q A;  2AKK A;  2W0Z A;  3UA6 A;  2EPD A;  3EHR A;  2YDL A;  1OEB A;  4CC7 A;  2VKN A;  4Z89 A;  2LNH B;  3PVQ A;  2V1R A;  3EGU A;  1YNZ A;  3QWX X;  4Z8A A;  4JZ4 A;  4F14 A;  4JJD A;  1W70 A;  1SRL A;  1SEM A;  1I07 A; 
#chains in the Genus database with same CATH topology
 4E7L A;  1Q81 R;  4IUQ A;  2MPX C;  5KCO A;  4D8K A;  2XDP A;  3A1P A;  3VRY A;  1VIE A;  1VOM A;  2VV5 A;  3NTK A;  2COZ A;  4J7F A;  4AFQ C;  4FSS A;  4PJO D;  4M77 G;  3MET A;  4R55 A;  1X2K A;  4LNP A;  1D0X A;  4MZP A;  2EW3 A;  3EHQ A;  1IO6 A;  5AT1 B;  2EYQ A;  2OTL Q;  1O75 A;  2DTI A;  2KY9 A;  3UT1 A;  4FYY B;  1VQO A;  4CC3 A;  1KK7 A;  5IXB A;  1Q86 U;  3CCQ Q;  1RAB B;  4FL6 A;  1PRL C;  5IHK A;  4OB2 B;  1UG1 A;  3L2R A;  3CBM A;  2OX7 A;  3THK A;  3JCM P;  2ZGW A;  4QQ6 A;  3JB9 D;  2RM4 A;  3M4Y A;  4WTO B;  3LW5 E;  4ZTF A;  5LJ3 e;  4IUP A;  1AT1 B;  2LP5 A;  1LOJ A;  2KXC A;  4PFO A;  4OB1 B;  3CD6 T;  4JUV A;  1KG1 A;  4J8O A;  2RQR A;  2A08 A;  2EBP A;  3FDR A;  3EG0 A;  2CUB A;  3I55 T;  3EG1 A;  1HJD A;  4RTY A;  1NJI R;  3UPU A;  2A7Y A;  2DZ9 A;  1VQN T;  4HXJ A;  4V2S A;  3O5Z A;  4C0D C;  1TS9 A;  1AWX A;  1U3O A;  1UE9 A;  3T9N A;  1B7T A;  2J05 A;  4C92 E;  1YI2 A;  3M0Q A;  2KYB A;  2AZS A;  4ELZ C;  4IUV A;  3SFM A;  2AIR B;  3C95 A;  5HKC A;  1NJI U;  2L3P A;  3JCM h;  2GF7 A;  3LYI A;  1IRX A;  1AWW A;  3TCJ A;  3QJ6 A;  4QT7 A;  3KFV A;  4C0Z A;  3X24 B;  2X9H A;  1C0M A;  4M75 B;  2OTJ A;  2OTL T;  3QKJ A;  2H3J A;  1KQS A;  3OS2 A;  4BE2 A;  2FRY A;  2LQK A;  4M77 E;  1KC8 R;  1IGQ A;  4E7K A;  1S72 T;  1Y96 A;  3CCV A;  4LUD A;  1SPK A;  4C0D B;  3RDV A;  1BYM A;  1NPP A;  4VUB A;  3CC7 Q;  4RMO A;  4O6J A;  2ZAE A;  2J06 A;  3DLL A;  3HRU A;  4GLK A;  1SHG A;  1EFN A;  1TG0 A;  2DL8 A;  1D3B A;  2C0T A;  2ZPE B;  1UEB A;  3UWN A;  2HQX A;  5LJ3 j;  1ZSG A;  1YCY A;  3LWH A;  4DEY A;  4J9E A;  1FMV A;  5LJ5 j;  2K9G A;  1IZ6 A;  2E5Q A;  4PL6 A;  3VYH B;  3BDL A;  5GAO p;  1SG5 A;  1E7O A;  2CZ6 B;  2ZPG B;  4C8Q E;  4J6W A;  4YTL A;  3JCM b;  5KH6 A;  3MKD A;  1KQ2 A;  9ATC B;  4QVD A;  1KD1 C;  4BE0 A;  2DVE A;  1NEG A;  4C0F A;  4C5G A;  1YCS B;  3QDR B;  4ZGJ B;  5GMK i;  4WF2 A;  2NLU A;  2XDB A;  3RKY A;  4FT4 A;  3SEM A;  5GAO n;  3H0I A;  4OGE A;  3VS7 A;  2DD4 A;  4DQ2 A;  2K5F A;  1VQM Q;  4OF1 A;  1M8M A;  2PVD B;  1GCQ A;  1XNI A;  2PUO B;  2FB7 A;  2KK4 A;  4XTW A;  1OU9 A;  4C8Q D;  4PKC C;  1KIK A;  1ZLM A;  1JEG A;  4B9W A;  2C0I A;  4JRI A;  3PGG A;  2O4X A;  2VVK A;  3QG1 A;  3X25 B;  3VJP A;  1GCQ C;  5D7U A;  2FZK B;  2E6Z A;  3V7R A;  2KNB B;  4DEX A;  2K79 A;  2KT8 A;  5C0M A;  2EGC A;  4A4G A;  3HRT A;  4X9D A;  1WDX A;  2FVU A;  4M7A C;  1HK9 A;  2RA2 A;  4B6M A;  5KE3 A;  3BDU A;  4XQ3 A;  2HBW A;  1S1N A;  1UGS B;  3UA7 A;  5KCH A;  3OYE A;  3FC3 A;  3LLR A;  3FIF A;  3OW2 P;  4JS5 A;  4L59 A;  3SD4 A;  3H0H A;  4Z02 A;  3RIR A;  4NL3 A;  2LCS A;  4FM4 B;  3EGX A;  1K9M U;  2LVM A;  1VA7 A;  1YIJ T;  2BUD A;  5D6W A;  4M75 G;  3MPU B;  1WJS A;  4XTX A;  2G3R A;  1OI1 A;  2YRD A;  3CME Q;  1FMK A;  2LCL A;  1YIJ A;  1TSF A;  2DO3 A;  5J26 A;  1HSQ A;  2AZV A;  4BI4 A;  1KQS S;  3MO8 A;  3AHU A;  1SHF A;  5GAN 8;  1BI0 A;  1Q7Y U;  2OI3 A;  1RI9 A;  3QDF A;  3EGX B;  3QII A;  5HK0 A;  4BE1 A;  3OYJ A;  3L1A A;  5FW9 A;  1OX8 A;  4KRT A;  2BIV A;  4M78 C;  1QVG P;  1MV3 A;  3OBY A;  2H8H A;  1SSF A;  2RNA A;  4J9D A;  3HFO A;  4QQD A;  2OTJ T;  2CDT A;  5D6Y A;  1QCN A;  3J80 E;  2EKH A;  3G4S A;  4N4I A;  1BBZ A;  5LJ5 g;  1D09 B;  4M7D D;  5FU6 B;  1N5Z A;  1VUB A;  1X6B A;  3A8H B;  3JCM W;  1FMW A;  2QK0 A;  2QA4 Q;  2EGE A;  3CC4 T;  2RJF A;  1C6V X;  4N4G A;  3J81 E;  3A8G B;  3CCS Q;  1CKA A;  4PFZ A;  3QO3 A;  1PNJ A;  2L2P A;  5LJ5 e;  1YWP A;  5FWC A;  1KD1 U;  1VQL A;  1VQK A;  3DLM A;  3MJX A;  1BKB A;  3IQL A;  2K3B A;  5GJW B;  1YIJ Q;  5M9O A;  1YJW Q;  3QUI A;  2X3X D;  4C8Q F;  3JB9 H;  5CIU A;  3GIB A;  1I8F A;  1OV3 A;  1ZA1 B;  1VQP Q;  4HT8 A;  4C92 A;  3HFN A;  3WVD B;  3NFC A;  1VQ7 Q;  3OMG A;  1NM7 A;  3TVT A;  3RES A;  2MF2 A;  2GQV A;  4J9F A;  4PJN A;  1SRM A;  5GMK m;  1M8V A;  2E70 A;  3LGL A;  4O5V A;  8ATC B;  1I81 A;  2RQV A;  3S6W A;  4E7H A;  2K57 A;  1AWO A;  5FWB A;  2DER A;  4PJM A;  3JCM d;  2KGT A;  1O9S A;  1NYG A;  3VV0 A;  1WLP B;  2LQW A;  2DL4 A;  4JJB A;  2DLP A;  1MGQ A;  1YJ9 A;  3A8L B;  4ME7 A;  2CP6 A;  1G8X A;  2QAZ A;  2DYI A;  4PJO C;  3JCM X;  1M9S A;  3FRN A;  5I11 A;  1M90 R;  1VQL T;  3D7S B;  4J9C A;  3KXT A;  1IHW A;  5GMK j;  1OX9 A;  3GNG A;  1Y71 A;  1ZUU A;  1WXT A;  5KYW A;  1MMA A;  4XU3 A;  3MP8 A;  4X34 A;  5ECA A;  3M5A A;  2IIM A;  2GFA A;  4LD6 A;  2QDY B;  2VC8 A;  4RCC A;  2JM9 A;  1RAG B;  5GAN 5;  2AKK A;  3UA6 A;  5KYN A;  2JVV A;  2EPD A;  1D0Y A;  2YDL A;  3OMC A;  2DXT A;  1Y96 B;  1JBM A;  4MMK A;  5DY9 A;  3QWX X;  3QSU A;  3CPF A;  4JZ4 A;  4A53 A;  2QA4 T;  4QKU A;  2CP2 A;  1MHN A;  5GJV B;  4X1V A;  2XIC A;  5IHN A;  2DVJ A;  3OW2 S;  1NG2 A;  2LC4 A;  2OJ2 A;  1GFC A;  2OAW A;  4N4H A;  3QZ5 B;  5CQX A;  2RD1 A;  1VQ7 A;  1Z9Z A;  5CKD A;  2ZPH B;  1ZBJ A;  2DJQ A;  2K5I A;  3FB9 A;  3RKX A;  2D0N A;  1YI2 Q;  3TRE A;  1Z9Q A;  1VQM A;  3J7A F;  3LH5 A;  1Y57 A;  3VS4 A;  3MEA A;  1ZHI A;  1VQP T;  3EG9 A;  4RUG A;  1NPR A;  3FJ5 A;  4JDS A;  2K6D A;  3OYF A;  5AYF A;  1WA7 A;  4KH1 B;  3I56 Q;  1TTH B;  2WAC A;  2E1H A;  1VQK Q;  3BW1 A;  1PCX A;  4DBF A;  5IAY A;  2WSE E;  3M0R A;  4A4H A;  1VQ9 T;  2M02 A;  3A8M B;  3QPH A;  3UF4 A;  1M90 C;  2F69 A;  2CP3 A;  2GTO A;  4LDX A;  2YUP A;  4C92 F;  1K73 U;  3ZEH A;  2JTE A;  2JS0 A;  4HCZ A;  4C8Q G;  3MHX A;  3S3N A;  5IT9 E;  1E6G A;  2E65 A;  4XU1 A;  2JTF A;  1ZUK A;  1PSE A;  2GTJ A;  4FYX B;  1BI3 A;  1WQ7 A;  2JMA A;  3CC2 Q;  2RHI A;  4PJO B;  1YHQ Q;  2QQB A;  2BE9 B;  2F5K A;  3H6Z A;  3G6E A;  1BCO A;  2IG0 A;  3G71 Q;  2L3Q A;  3C0C A;  5A0L A;  1YJ9 Q;  1D0Z A;  4RCB A;  3MEV A;  1N8R R;  3JRZ A;  4M78 B;  5A2Q E;  1VQ6 T;  1QLY A;  3QXE B;  4A54 A;  3CPW P;  3SB2 A;  2OAU A;  4FT2 A;  2KDS A;  1UJ0 A;  1G2B A;  2DL7 A;  3I56 A;  4R56 A;  3L2U A;  2DKG A;  3OQ5 A;  1R8O B;  3G4S T;  2MMP A;  3CXC S;  4M75 D;  5HCK A;  4WCI A;  2XD0 A;  2O31 A;  2D9T A;  1VQO Q;  2RJE A;  2V8K A;  4QVZ A;  1JJ2 S;  3LWI A;  1WNL A;  5DLQ E;  1UDL A;  2BE7 D;  1AWJ A;  4NL2 A;  1U1S A;  1S72 Q;  3OSS C;  4UC4 A;  1B07 A;  2FZC B;  3CCE A;  1TXQ A;  5KYX B;  3GF5 A;  5GAM g;  1GBQ A;  1QP3 A;  3Q1J A;  3M57 A;  4C8Q C;  1WHG A;  1P92 A;  4OB0 B;  5GAO m;  3L2W A;  4E7S A;  1KC8 C;  1IGU A;  3M53 A;  1T0J A;  1XOV A;  2QYZ A;  2FPD A;  3CCJ A;  1M2V B;  4QQG A;  3QYG B;  1M27 C;  1UHC A;  4FCY A;  5KYX A;  2D1X A;  2Z0W A;  2LJ0 A;  5CAI A;  3CC2 A;  5FU7 C;  1FXX A;  2HQE A;  1VQ7 T;  1UFF A;  4CC2 A;  2MOX A;  2RHY A;  1UEC A;  4E6R A;  2M51 A;  2RHU A;  1MUZ A;  4LDY A;  4M7D B;  3TSW A;  4F16 A;  2E64 A;  1PD0 A;  3E2U A;  1M5Q 1;  3VU3 C;  2RQW A;  1F1B B;  2K2V A;  3QYH B;  2NUT A;  5CO7 A;  1MV0 B;  5GMK e;  1X27 A;  2PTK A;  3CPW A;  4CI0 C;  2C06 A;  2NUP A;  2YUN A;  1K9M R;  1W2B P;  2LRQ A;  4OMQ A;  2D8H A;  4HCC A;  3VS3 A;  1K9M C;  1VQ4 T;  2HKQ B;  1GFD A;  2QQS A;  2RB6 A;  2F2X A;  2NUP B;  1T3L A;  3OYN A;  5LJ5 h;  1RUW A;  3CC7 A;  1QVP A;  1ZA2 B;  1I5O B;  5GAM d;  4EMK B;  3M58 A;  2PZ1 A;  2OTL A;  1T3S A;  4FYV B;  3JCM f;  4A4F A;  4EIK A;  4ORZ A;  5CKB A;  1J3T A;  3VUB A;  3URG A;  3L2Z A;  4HCK A;  2CT3 A;  1VQ8 A;  4JS4 A;  3CCU T;  3PT9 A;  1VQ5 Q;  3A5Z B;  5CKF A;  1KFZ A;  3E9F A;  2Y4X A;  1M1G A;  3EFR A;  1WHL A;  1GRI A;  2GCX A;  2YSQ A;  3G7Z A;  1WXB A;  4M78 F;  2RI5 A;  1AHJ B;  4BY6 B;  3O8V A;  3A98 A;  1EX4 A;  1WGS A;  4F04 B;  1YI2 T;  2ED0 A;  3VYG A;  4EPC A;  1X6O A;  1M2V A;  1VQ9 A;  1D1A A;  2QEX Q;  4M75 C;  2Y4Y A;  4M7D C;  1M2O A;  1YHQ A;  3ZBD A;  3HSB A;  1TUC A;  2EFI A;  1UGV A;  2CP0 A;  3RER A;  2KYM A;  4AFS C;  2Y90 A;  3X28 B;  3DB4 A;  4FYW B;  5FU7 B;  4PK4 A;  2JUF A;  1KQ1 A;  3CCV T;  1U8R A;  1RLQ C;  2KAF A;  2FPF A;  2O9V A;  3VS2 A;  1WYX A;  2X4X A;  3RMS A;  3WXM B;  3OY9 A;  4MDX A;  1PSF A;  4II1 A;  1JRI A;  1AVZ C;  4Y92 A;  4GLM A;  4C8Q B;  2CZ1 B;  1N6A A;  1CKB A;  1G3W A;  3INZ A;  2RQU A;  5GAN g;  1YJW T;  5CVI A;  5KYU B;  2MAM A;  4J9B A;  4FW1 A;  1M3B A;  1NLO C;  4PJO A;  4A4K A;  3CC4 Q;  4ZGD B;  4PFP A;  1Y07 A;  1LVK A;  1JXM A;  2EYW A;  2KVQ G;  3JCM Q;  4HCB A;  4Y91 A;  1ZQ1 A;  4J6Y A;  1OUL A;  4P5N A;  1SF9 A;  1JQQ A;  4DOV A;  3I55 A;  2NUT B;  4CRI A;  4OB3 B;  4M77 C;  2KRM A;  1KD1 R;  5HK3 A;  1HYO A;  1MMN A;  3CXC A;  1ABO A;  1UHF A;  5GAN 6;  2KXD A;  1M90 U;  4F7U B;  2HSP A;  3P8D A;  4JRK A;  1BU1 A;  1DJ7 B;  3U23 A;  4PLL A;  4D8D A;  1PG5 B;  2WSF E;  1EIF A;  4Y28 E;  1VQM T;  4XU0 A;  4L5G A;  2KSS A;  2KEA A;  3PTA A;  2E3I A;  2DXU A;  3CCV Q;  4KUD K;  3JB9 G;  4R0K A;  1WJQ A;  1LPL A;  2QI2 A;  1XTD A;  1SKU B;  4E7J A;  2RK2 A;  2DTH A;  3HP9 A;  3G71 A;  3CCQ A;  4E2F B;  3JCM V;  2YWW A;  5LJ5 f;  4OMP A;  1UGQ B;  1V29 B;  2E41 A;  2CRE A;  4Q5W A;  2KMT A;  3DB3 A;  2HD0 A;  3I9Q A;  1OPL A;  3M55 A;  4M7A G;  4EMG A;  2YHT A;  1RAD B;  1OEB A;  2EIF A;  2BKD N;  3PVQ A;  4XU2 A;  3EGU A;  4B9X A;  5GAN h;  2P0K A;  2V8J A;  3CC4 A;  3CMA Q;  1RAC B;  8AT1 B;  1JJ2 P;  4BUG A;  2LT1 A;  1X75 C;  3E9G A;  2XKO C;  3GBQ A;  1OQK A;  3DKM A;  3M56 A;  1PKT A;  4M78 A;  3OYA A;  3CCE Q;  2DL3 A;  4J5Y A;  5EC7 A;  4RTV A;  1QVF S;  2WSC E;  2DZC A;  4KT0 E;  5KYY B;  2BTT A;  2EVR A;  5IHI A;  3CC7 T;  1PKS A;  1WHH A;  4LDW A;  4OMN A;  4BDY A;  2DET A;  3CCM A;  1ACM B;  1JU5 C;  1KHC A;  2SEM A;  3CBO A;  4PNO A;  3CCL A;  3JCM e;  3M4G A;  2BZY A;  2M9U A;  4RKU E;  2K3X A;  3GPL A;  2M16 A;  3OYL A;  3NTI A;  2XK0 A;  4AT1 B;  1QWF A;  2VUB A;  1BB9 A;  1IRE B;  3OYB A;  3CCS A;  4M7A E;  3V8J A;  4DA4 A;  3P8B B;  2OTJ Q;  4PJO F;  5GAM f;  1Y0M A;  2EAY A;  4M77 A;  2K5L A;  3H41 A;  1RAI B;  4PLI A;  1WIE A;  3G1J A;  4JLI A;  5I21 A;  5FRN A;  1GL5 A;  4C8Q A;  1GCP A;  3I56 T;  3CXC P;  2LJ3 A;  2GFU A;  4M7A D;  2L89 A;  1N27 A;  1YJN Q;  2KRS A;  1VQK T;  3VS5 A;  1S72 A;  2XMF A;  2JXB A;  5LJ3 h;  3WVE B;  1JJ2 A;  2HCK A;  4J6X A;  4OMM A;  2DXB A;  1V1C A;  1VQ8 Q;  2ROL A;  3UAT A;  2XHC A;  4HVU A;  2ZCF B;  1ZSZ B;  3FLG A;  3CMA T;  2NWM A;  2DEU A;  4GY5 A;  3OYY A;  2RMO A;  5LJ3 g;  2DNU A;  1BI2 A;  3M0U A;  3EFO A;  3HPW A;  1VQ6 Q;  2ABL A;  1YIT Q;  2R58 A;  1WHK A;  2CP5 A;  1OPK A;  4E7I A;  2QGG A;  3CCE T;  2CZ0 B;  4J9H A;  4KUI A;  4C5H A;  3CCJ Q;  1H3Z A;  1RLP C;  3LX7 A;  1R77 A;  1N9R A;  2X51 A;  2V1Q A;  4OML A;  1IHV A;  2JOY A;  4RTU A;  2A0F B;  4M7D F;  2PUK B;  2FG0 A;  1M3A A;  2M0Y A;  1ABQ A;  1ZSZ C;  1VYT A;  1AZG B;  2K3Y A;  5GAN d;  1QMC A;  2YRC A;  3RKW A;  5CKH A;  2O2O A;  3G4S Q;  2K2M A;  2JT4 A;  2EGA A;  3VRZ A;  3OYC A;  5GAN 3;  3CPW S;  2DIQ A;  2DTO A;  4M78 G;  1PHT A;  1C1A A;  2J6K A;  2RJD A;  3CCQ T;  2YLB A;  1B34 A;  2ZPB B;  2LQN A;  7AT1 B;  2PU9 B;  3OYI A;  1H92 A;  2FYK A;  2QEX A;  5KYY A;  2DJZ A;  4XAX B;  3RUX A;  4EMH A;  2X4J A;  3KUF A;  5HY6 A;  3NTH A;  1IXD A;  2JM8 A;  2F2W A;  2EJ9 A;  4HT9 A;  3M0S A;  1QP2 A;  1MMD A;  1WHM A;  4OMF B;  2ESW A;  3X26 B;  1UUE A;  3ZL7 C;  5C6S A;  1D1B A;  1RAE B;  2EQM A;  1TU0 B;  3QJY A;  3L42 A;  3EFS A;  3I55 Q;  3I5R A;  1G5V A;  1UB4 A;  2CS7 A;  1QVG S;  1OOT A;  2D8J A;  2M1H A;  2MCN A;  2FO0 A;  3NGP A;  1NEB A;  3VS1 A;  1Q82 R;  1XQH A;  4IKF A;  5J3B A;  1PC0 A;  1YP5 A;  3EGD B;  1KSW A;  2EQI A;  3GNF B;  2CT4 A;  4C92 B;  4PJO E;  4RTT A;  2F1L A;  2CUD A;  5GAO q;  2DM1 A;  2JW4 A;  2LNV A;  1U06 A;  4BY6 C;  1GBR A;  1BK2 A;  2KRO A;  3GLX A;  3MCA B;  1RI0 A;  2X35 A;  2XI9 A;  4JJC A;  1M1F A;  2DYB A;  2QG9 B;  3V8L A;  1X43 A;  4FU6 A;  1YN8 A;  2DE0 X;  2KRN A;  2KBT A;  2E6N A;  3VS0 A;  2HL3 A;  4M77 F;  4DOW A;  2NYS A;  3GOX A;  3ULR B;  2YUO A;  1TWB A;  1ZBX A;  2I2L A;  1U1T A;  2V8I A;  1G3T A;  5DLO A;  1N9S A;  2VB6 A;  5FRM A;  2RHZ A;  1BCM A;  1AOJ A;  2YLC A;  5I2S A;  4TVR A;  3ER0 A;  1LNX A;  4K11 A;  1RAH B;  4D6W A;  3CD6 A;  3LH0 A;  3TU4 K;  4E47 A;  2MI6 A;  3HHT B;  1X6G A;  1YHQ T;  1UJY A;  4M7D E;  2HNI A;  3CBP A;  3H8Z A;  4FW2 A;  3AT1 B;  2KQW A;  5D6X A;  4HA8 A;  2LMJ A;  1WFW A;  3M0T A;  4AFU C;  3C4S A;  1KQS P;  3JCM g;  4ANJ A;  2GQI A;  2K4Y A;  4C92 C;  5KYW B;  2DRK A;  2P0P A;  2RPN A;  3JSC A;  2KI7 A;  2X3W D;  4NS5 A;  3REB B;  4OGC A;  3F70 A;  3OYD A;  2LCC A;  1XJW B;  3JB9 F;  2JMC A;  4C5E A;  3C94 A;  3P8H A;  2I0N A;  4OP0 A;  4IIM A;  1W2B S;  2ZPF B;  1VQ4 A;  1OZ2 A;  1I4K 1;  1VQO T;  4ELY C;  1Q7Y R;  1RAA B;  1K9A A;  4EDU A;  1WI7 A;  4C5I A;  2VAS A;  2YT6 A;  1SSH A;  2B8A A;  3JB9 I;  1VQ8 T;  1QVF P;  1M4Z A;  1GXI E;  3VKI A;  1VQN A;  4M4Z A;  3SDZ A;  1AEY A;  2HEQ A;  1FX7 A;  2RK1 A;  2PQW A;  1G83 A;  2DAQ A;  3R6N A;  1K73 C;  5LJ5 d;  5IH2 A;  3OYM A;  4IIO A;  1M1K R;  2FHD A;  4ATO A;  4F7U E;  1M30 A;  2EYZ A;  3PVL A;  3MP6 A;  4C0G A;  4N0A A;  4C92 G;  2EQU A;  3CCJ T;  3SHW A;  2RQT A;  3EG3 A;  1Q86 C;  1QKX A;  3EGD A;  3CCL T;  2QTV A;  4Z88 A;  3SWN A;  2VGM A;  2E10 A;  2LX7 A;  2LT4 A;  1WZO A;  4XK8 E;  4M7A F;  4C92 D;  2FL7 A;  2AK5 A;  1I5L A;  2L3S A;  1OZ3 A;  2DA9 A;  3OYH A;  1VQ9 Q;  4ESR A;  2E5K A;  2JZ2 A;  3I35 A;  2RF0 A;  1K8A U;  2DX1 A;  2RJC A;  3MP1 A;  3CEY A;  3CCM T;  2QXF A;  2H3E B;  2J6O A;  2DFU A;  4M7A A;  1H3H A;  2QQA A;  2PVO B;  3LGF A;  4AMC A;  1ZX6 A;  2L8D A;  4LD9 K;  5GAN e;  2ROT A;  4JRP A;  5DM7 R;  1QVF A;  2HZY A;  4QW2 A;  2RH2 A;  3CC2 T;  2DRM A;  2NUZ A;  1M1K U;  4M7A B;  1ARK A;  2YXY A;  4EMK C;  1LJO A;  3L2Q A;  1D3B B;  2JN0 A;  3TQ7 P;  3QHS A;  3BE3 A;  5IN1 A;  4F7U G;  1X2Q A;  4KGX B;  2LX9 A;  4Z89 A;  2LNH B;  2X4Y A;  4X9C A;  1W4S A;  1Q95 G;  1YNZ A;  4M7D A;  3G6E T;  1R0C B;  4JJD A;  2LTO A;  1W70 A;  4F7U F;  2CGH A;  3OYG A;  1SRL A;  2DIG A;  1PWT A;  1K73 R;  5KE2 A;  2E3H A;  4M75 A;  3G71 T;  2KT1 A;  4LE9 A;  2XG8 D;  1VYV A;  5GAN 7;  1W6X A;  1WPY A;  1YWO A;  4RG8 A;  1NYF A;  1I1J A;  3V7S A;  4OVA A;  2YRV A;  3EFO B;  1VQ6 A;  4J9I A;  4J7I A;  4M78 D;  1IB8 A;  1PD1 A;  1K0S A;  2O9S A;  4A63 B;  2MIO A;  3PIO A;  3EH2 A;  2GNC A;  3H9N A;  3QBY A;  2PVG B;  1W1F A;  4F17 A;  1YFN A;  3UDC A;  4DBR A;  1TH7 A;  5LJ3 f;  3OSV A;  2DBM A;  1QVG A;  4HVW A;  1WHJ A;  2M0O A;  4IUU A;  3OYK A;  1JB0 E;  3FEO A;  2FPE A;  2FEI A;  1QCO A;  1EZZ B;  3EAE A;  5CCA A;  4M7D G;  1E6H A;  3CME A;  2DF6 A;  2P0Q A;  3PNW C;  2AKL A;  6AT1 B;  3CCR T;  3M0P A;  3A8O B;  3C12 A;  1A0N B;  2FRW A;  1M3C A;  3ASK A;  5GAM j;  2EWN A;  3G6E Q;  2ZPI B;  1QQJ A;  1N8R U;  2L0A A;  4QVC A;  2GBQ A;  1YJN T;  1NBE B;  3HTR A;  4AFZ C;  2ED1 A;  1WJR A;  4GBQ A;  5KYU A;  5FRO A;  2MK5 A;  4DBH A;  4M75 E;  1Q86 R;  1MNE A;  1X01 A;  3OBW A;  2LDM A;  1V76 A;  2ENM A;  2RN8 A;  1K0X A;  3PFS A;  2COY A;  2L5Q A;  4XTZ A;  2A37 A;  3JCM c;  1YIT T;  1K1Z A;  3NHN A;  2VYT A;  2RHX A;  4FSX A;  3RR6 A;  2HDA A;  2HSE B;  4MDW A;  4PJL A;  4AG2 C;  1G3Y A;  1MMG A;  2CKK A;  2DEQ A;  2KR3 A;  1MND A;  5LL6 S;  3OA6 A;  3RNJ A;  2D0Q B;  1K76 A;  4RTW A;  4HVV A;  2LJ1 A;  1BIA A;  4DBQ A;  2LQ8 A;  2X4W A;  1TOV A;  5LJ3 d;  3CCU Q;  1RL2 A;  4CC4 B;  1YJW A;  3OB9 A;  5CK9 A;  3PE0 A;  3GP8 A;  2J7I A;  4BI3 A;  4ZTJ A;  2C0O A;  2G6F X;  4FIB A;  4BAC A;  2JS2 A;  2E12 A;  3PMI A;  2HMA A;  2CH4 W;  4LN2 A;  1TUD A;  4M75 F;  3CCR Q;  1KHI A;  2CH4 A;  4JZ3 A;  1TUG B;  2DMO A;  4A4E A;  1KJW A;  3TSZ A;  4J83 A;  1WX6 A;  2HBP A;  1QWE A;  1PM3 A;  4RG2 A;  3FJP A;  5A0G A;  2A28 A;  2CSI A;  3OW2 A;  2LZ6 B;  1AZE A;  1BIB A;  1WXU A;  3CCL Q;  3E1S A;  4KBM B;  1YJ9 T;  2R5A A;  1BI1 A;  3QZ9 B;  4F7U A;  2JJ9 A;  3V7C A;  4BDZ A;  4JJN K;  2A3L A;  2P84 A;  5GAN f;  2PNI A;  2IVW A;  4RTZ A;  4KUL A;  4M77 B;  2EJF A;  2DK3 A;  2A36 A;  3ME9 A;  1Q81 U;  2HQH A;  1M1K C;  3S3O A;  2QEX T;  4AG1 C;  3NMZ C;  4IUR A;  1CSK A;  3CCU A;  4JRQ A;  1K8A C;  4ZNX A;  3OS5 A;  1QW1 A;  1UGR B;  4OMO A;  3ZFJ A;  2CZ7 B;  2BZ8 A;  4XTY A;  2HKN A;  2O88 A;  1H64 1;  2RI3 A;  3BY7 A;  4HKE A;  4LDV A;  3H0F A;  4KGV B;  2J6F A;  2V26 A;  2AHJ B;  1Q7Y C;  1I0C A;  2DIL A;  2JTM A;  5CR2 A;  2EKO A;  3E19 A;  2P4T A;  4MZT A;  1VQ5 A;  2KE9 A;  1QKW A;  3QWY A;  3JAM E;  1R0B G;  3CD6 Q;  2JNG A;  1LCK A;  2VXE A;  5A0D A;  3CCR A;  5L23 A;  5IXF A;  1X69 A;  3SWN C;  2ZZD A;  3EG9 B;  4ZGE B;  2IPO B;  1D1C A;  2EYX A;  3CME T;  2DBK A;  1HXD A;  3JB9 J;  2SRC A;  4NOY A;  1U5S A;  2DPP B;  2QGF B;  1NZ9 A;  4MZM A;  1K8A R;  4LUE A;  3PIP A;  2HAX A;  3MEW A;  1UGP B;  2RO0 A;  1H8K A;  1ZUY A;  2XID A;  5GAM e;  5CKE A;  2EQK A;  2XU8 A;  3N5B B;  2R57 A;  2MWP A;  4BI8 B;  2QDL A;  2R5M A;  1NLP C;  1VQ4 Q;  2QQR A;  2CSQ A;  3VS6 A;  1JXO A;  3PMT A;  5GAM h;  1YIT A;  4E7Z A;  5I22 A;  2K7A A;  2AT1 B;  4ZN3 A;  4BD3 A;  3HKS A;  1NE8 A;  1N8R C;  3KBG A;  4XTU A;  4ZN1 A;  4EMK A;  5GAN 4;  1PRM C;  4M78 E;  4LDU A;  3CCS T;  3I5S A;  1T0H A;  2RI2 A;  5FU6 C;  4LXC A;  3OS1 A;  5I2M A;  3CQT A;  1YJN A;  2W10 A;  2F2V A;  3HRS A;  3TEE A;  4KGZ B;  2FZG B;  1FWZ A;  1VIF A;  5GAO r;  5GMK l;  2EQJ A;  1G3S A;  5EG2 A;  5GMK h;  3S3M A;  2COW A;  2DXC A;  2MYS A;  1K4U S;  2DL5 A;  4XTV A;  1YBY A;  1Y7X A;  2QAS A;  3M59 A;  2ECZ A;  1NJI C;  3BFM A;  2VGN A;  3VUZ A;  3MEU A;  5L8R E;  2QQ9 A;  1HD3 A;  2P4R A;  2VXF A;  1B34 B;  1JO8 A;  3M54 A;  1KC8 U;  1QCF A;  2DD5 A;  1VQ5 T;  3RMQ A;  4JPB W;  1VYU A;  3CMA A;  2QTX A;  4PJO G;  2O4X B;  2B86 A;  2GGR A;  4M77 D;  4MML A;  5J39 A;  4IUT A;  2L3R A;  4N0A C;  3REA B;  3JV3 A;  1B3Q A;  2EJG A;  1AD5 A;  3EG2 A;  3NPF A;  3SWN B;  2D6F A;  4PJJ A;  2QA4 A;  1OYX A;  1Q82 C;  2BZX A;  4BB7 A;  3JCM J;  5FLX E;  4J9G A;  3OS0 A;  1FYN A;  5GAO l;  1RAF B;  3CCM Q;  5GAN j;  5GAN 2;  3L2V A;  1UTI A;  3EH1 A;  1Q81 C;  2CYZ B;  3HL8 A;  2YUQ A;  2VWF A;  1ZSZ A;  3RBB B;  2O01 E;  1VQL Q;  3M9Q A;  3V8K A;  2EYY A;  4RTX A;  1OU8 A;  4JLG A;  3X20 B;  4L6V 5;  2MWO A;  2W0Z A;  2XDD A;  3EHR A;  4CC7 A;  2VKN A;  1VQP A;  2ATC B;  3R6O A;  1VQN Q;  2V1R A;  5CQY A;  2E4H A;  2HL5 C;  4Z8A A;  2F5T X;  4F14 A;  1WQW A;  4KH0 B;  1Q82 U;  2CP7 A;  1SEM A;  1W2B A;  1I07 A; 
#chains in the Genus database with same CATH homology
 1PWT A;  5GJV B;  4X1V A;  5IHN A;  2DVJ A;  4D8K A;  2KT1 A;  3GBQ A;  3VRY A;  1NG2 A;  2OJ2 A;  4LE9 A;  1VYV A;  1GFC A;  2OAW A;  1W6X A;  4AFQ C;  1PKT A;  4FSS A;  1YWO A;  2DL3 A;  1Z9Z A;  5EC7 A;  4RTV A;  1ZBJ A;  2DJQ A;  2D0N A;  2BTT A;  1X2K A;  2EVR A;  1NYF A;  1I1J A;  5IHI A;  4LNP A;  1PKS A;  1Z9Q A;  2EW3 A;  3EHQ A;  4OMN A;  1IO6 A;  4J9I A;  3LH5 A;  1JU5 C;  1Y57 A;  2SEM A;  3VS4 A;  1K0S A;  2BZY A;  2O9S A;  4CC3 A;  4RUG A;  2MIO A;  4A63 B;  5IXB A;  3FJ5 A;  2GNC A;  2K6D A;  1QWF A;  1BB9 A;  1WA7 A;  1W1F A;  1PRL C;  4F17 A;  5IHK A;  1UG1 A;  2DBM A;  3THK A;  1Y0M A;  3H41 A;  4HVW A;  1WIE A;  3M0R A;  1GL5 A;  1GCP A;  2FPE A;  2FEI A;  3UF4 A;  2LJ3 A;  2LP5 A;  2KXC A;  1E6H A;  2GTO A;  2DF6 A;  2YUP A;  2KRS A;  2JTE A;  2JS0 A;  2A08 A;  2RQR A;  3VS5 A;  2EBP A;  2XMF A;  2JXB A;  2CUB A;  3EG0 A;  3EG1 A;  1HJD A;  4RTY A;  2AKL A;  3M0P A;  2HCK A;  1A0N B;  4OMM A;  4HXJ A;  1E6G A;  1M3C A;  1V1C A;  2FRW A;  2ROL A;  3UAT A;  1ZUK A;  3O5Z A;  4HVU A;  1AWX A;  1U3O A;  1UE9 A;  2L0A A;  2GTJ A;  2NWM A;  2GBQ A;  2JMA A;  2J05 A;  4AFZ C;  2ED1 A;  2RMO A;  3M0Q A;  2DNU A;  2KYB A;  3M0U A;  4GBQ A;  2AZS A;  2ABL A;  2L3Q A;  3C0C A;  2L3P A;  1OPK A;  4J9H A;  2ENM A;  2RN8 A;  1K0X A;  1AWW A;  4QT7 A;  3KFV A;  1RLP C;  1QLY A;  2A37 A;  1K1Z A;  3NHN A;  2V1Q A;  1UJ0 A;  1G2B A;  2DL7 A;  2HDA A;  4OML A;  4RTU A;  4AG2 C;  2FRY A;  2KR3 A;  3RNJ A;  2FG0 A;  1M3A A;  2M0Y A;  5HCK A;  1K76 A;  4WCI A;  1ABQ A;  2O31 A;  4RTW A;  4LUD A;  1SPK A;  4HVV A;  1VYT A;  1AZG B;  2LJ1 A;  2O2O A;  1UDL A;  2K2M A;  1AWJ A;  2JT4 A;  4CC4 B;  3PE0 A;  2J06 A;  2EGA A;  1B07 A;  1SHG A;  3VRZ A;  1EFN A;  1TG0 A;  1GBQ A;  2DL8 A;  2J7I A;  2C0T A;  2C0O A;  2G6F X;  2JS2 A;  1PHT A;  2J6K A;  2CH4 W;  4LN2 A;  2LQN A;  1TUD A;  1ZSG A;  2CH4 A;  1H92 A;  4JZ3 A;  4DEY A;  2DMO A;  1T0J A;  1XOV A;  4J9E A;  1KJW A;  3TSZ A;  2FPD A;  2JM8 A;  1WX6 A;  2K9G A;  2F2W A;  1M27 C;  1QWE A;  3M0S A;  1UHC A;  2D1X A;  1E7O A;  2ESW A;  2A28 A;  2CSI A;  2LJ0 A;  2LZ6 B;  1UUE A;  3ZL7 C;  1WXU A;  1AZE A;  1UFF A;  4CC2 A;  2MOX A;  1UEC A;  4E6R A;  2M51 A;  1MUZ A;  1NEG A;  3I5R A;  1YCS B;  3TSW A;  4F16 A;  1OOT A;  2D8J A;  2PNI A;  2MCN A;  2FO0 A;  3NGP A;  1NEB A;  3VS1 A;  2RQW A;  3SEM A;  4RTZ A;  1YP5 A;  3H0I A;  1MV0 B;  3VS7 A;  1KSW A;  2A36 A;  2EQI A;  1X27 A;  2CT4 A;  2PTK A;  4RTT A;  2YUN A;  2CUD A;  4AG1 C;  1M8M A;  3NMZ C;  1GCQ A;  1CSK A;  2DM1 A;  2JW4 A;  1U06 A;  1GBR A;  4OMQ A;  1BK2 A;  4ZNX A;  2D8H A;  2KRO A;  3VS3 A;  1KIK A;  1ZLM A;  1JEG A;  2C0I A;  1GFD A;  4OMO A;  2BZ8 A;  2VVK A;  2F2X A;  1GCQ C;  1T3L A;  4JJC A;  2DYB A;  2O88 A;  1X43 A;  2KNB B;  4DEX A;  1YN8 A;  2DE0 X;  2KRN A;  2K79 A;  2KBT A;  2KT8 A;  1RUW A;  2EGC A;  3VS0 A;  3H0F A;  1WDX A;  2J6F A;  2YUO A;  3ULR B;  2PZ1 A;  1I0C A;  2DIL A;  1T3S A;  2KE9 A;  2HBW A;  4ORZ A;  4EIK A;  1QKW A;  3QWY A;  1J3T A;  1S1N A;  3UA7 A;  4HCK A;  2CT3 A;  1AOJ A;  1LCK A;  5L23 A;  5IXF A;  1X69 A;  4K11 A;  1KFZ A;  2EYX A;  3H0H A;  2LCS A;  2DBK A;  1U5S A;  2SRC A;  1VA7 A;  1GRI A;  2YSQ A;  1X6G A;  1UJY A;  1WXB A;  2LMJ A;  1WFW A;  3A98 A;  3M0T A;  1FMK A;  4LUE A;  4AFU C;  2ED0 A;  2GQI A;  1HSQ A;  1H8K A;  1ZUY A;  2AZV A;  2DRK A;  2RPN A;  2X3W D;  3REB B;  1SHF A;  2OI3 A;  1RI9 A;  5FW9 A;  4KRT A;  2QDL A;  1TUC A;  1MV3 A;  1NLP C;  1UGV A;  2JMC A;  2KYM A;  4AFS C;  2H8H A;  2I0N A;  2CSQ A;  3VS6 A;  2RNA A;  1JXO A;  4J9D A;  2CDT A;  4IIM A;  5I22 A;  2K7A A;  2EKH A;  1RLQ C;  1BBZ A;  2FPF A;  2O9V A;  3VS2 A;  1K9A A;  1PRM C;  1WYX A;  1N5Z A;  1X6B A;  3I5S A;  1AVZ C;  1T0H A;  1WI7 A;  2EGE A;  4Y92 A;  4GLM A;  2YT6 A;  3CQT A;  1SSH A;  1CKB A;  2W10 A;  2F2V A;  2RQU A;  4J9B A;  1CKA A;  4M4Z A;  1PNJ A;  1AEY A;  1M3B A;  2L2P A;  1NLO C;  1YWP A;  2HEQ A;  5FWC A;  1G83 A;  3R6N A;  3IQL A;  2K3B A;  5IH2 A;  5GJW B;  1K4U S;  4IIO A;  2DL5 A;  1M30 A;  2X3X D;  2EYZ A;  3PVL A;  2ECZ A;  1JXM A;  2EYW A;  1OV3 A;  3SHW A;  2RQT A;  3EG3 A;  1JQQ A;  1QKX A;  1NM7 A;  1HD3 A;  2P4R A;  3TVT A;  4Z88 A;  4J9F A;  2LX7 A;  1JO8 A;  1SRM A;  2KRM A;  1QCF A;  4JPB W;  1VYU A;  1ABO A;  1UHF A;  2KXD A;  2RQV A;  2B86 A;  2GGR A;  2AK5 A;  2HSP A;  1AWO A;  1BU1 A;  2L3S A;  3U23 A;  2DA9 A;  4D8D A;  5FWB A;  4ESR A;  2E5K A;  3I35 A;  3REA B;  2RF0 A;  2KGT A;  2DX1 A;  1NYG A;  3JV3 A;  1B3Q A;  1WLP B;  1AD5 A;  2KEA A;  2DL4 A;  2LQW A;  4JJB A;  2J6O A;  2DLP A;  1H3H A;  3EG2 A;  3NPF A;  2BZX A;  4R0K A;  1ZX6 A;  5I11 A;  2ROT A;  4J9C A;  4J9G A;  1FYN A;  1UTI A;  2DRM A;  1ZUU A;  2NUZ A;  1WXT A;  1ARK A;  2YUQ A;  2VWF A;  3RBB B;  5ECA A;  4OMP A;  2IIM A;  2CRE A;  3I9Q A;  2JM9 A;  2EYY A;  4RTX A;  1OPL A;  1X2Q A;  2AKK A;  2W0Z A;  3UA6 A;  2EPD A;  3EHR A;  2YDL A;  1OEB A;  4CC7 A;  2VKN A;  4Z89 A;  2LNH B;  3PVQ A;  2V1R A;  3EGU A;  1YNZ A;  3QWX X;  4Z8A A;  4JZ4 A;  4F14 A;  4JJD A;  1W70 A;  1SRL A;  1SEM A;  1I07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...