1NEGA

Crystal structure analysis of n-and c-terminal labeled sh3-domain of alpha-chicken spectrin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLAAAWSHPQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Rapid purification and crystal structure analysis of a small protein carrying two terminal affinity tags
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1negA00
2RQWA 4IIMA 2GTOA 2GQIA 2W0ZA 3FJ5A 4OMPA 1FMKA 3VS2A 1UHCA 1CKBA 3IQLA 2ECZA 3QWXX 1UJYA 1X27A 2VWFA 2CUBA 2D0NA 2A37A 1AWJA 2DYBA 1GBQA 1YWPA 2K2MA 2YSQA 2RPNA 1VA7A 1X6BA 3H0HA 2O9SA 2GTJA 5IHKA 1BB9A 2DL5A 3NMZC 2AK5A 1KJWA 2L3PA 4Y92A 2L0AA 3M0PA 4F14A 1PKSA 2FPEA 1UE9A 2AKKA 4RTVA 2DMOA 1QCFA 1E6HA 4JJCA 4JPBW 2DL3A 4ESRA 1RLPC 2V1RA 2EBPA 2YT6A 2F2WA 4Z8AA 4Z89A 1NEBA 3EG3A 3REBB 1WXBA 1AD5A 3RNJA 3U23A 1JO8A 4RTXA 4FSSA 1AVZC 1M27C 3VS4A 1I1JA 2F2VA 2JM9A 1Z9QA 2KEAA 2D8HA 3H41A 2DRMA 1YCSB 4HXJA 2GBQA 3VS5A 3PE0A 1JXOA 1M3BA 3UATA 2FG0A 2AZVA 2GNCA 1YNZA 3TVTA 2LJ3A 1OV3A 4AG1C 1NYFA 4JJBA 2SEMA 1ZLMA 2XMFA 2O31A 2DE0X 4RTTA 1B07A 2HSPA 2DA9A 1HSQA 2FPDA 3LH5A 2B86A 1UECA 2DRKA 3NPFA 4JZ3A 2JT4A 2J06A 1X2KA 2CUDA 3I9QA 1CKAA 2DJQA 3NHNA 4OMQA 1GBRA 2BZYA 4JZ4A 1XOVA 4OMOA 2KE9A 1Z9ZA 2FRWA 2O88A 3EHQA 2CT3A 2MCNA 3EG0A 2EKHA 4AG2C 4DEXA 4LN2A 2DL7A 2ENMA 1E7OA 1PRLC 1BBZA 1NLPC 2RQUA 2K9GA 1AEYA 1W6XA 1U5SA 2D1XA 4RTYA 2J05A 3REAB 1JU5C 2CH4A 3RBBB 2LQNA 1PNJA 4IIOA 3M0UA 3VS7A 2KBTA 4DEYA 2L3SA 4LE9A 1K1ZA 2PTKA 1LCKA 1AWWA 1K76A 4ORZA 1WYXA 3CQTA 2KXDA 4CC7A 4CC3A 4J9IA 1GRIA 2EYWA 1M30A 1OEBA 1ARKA 4A63B 2HCKA 4J9FA 1G2BA 2I0NA 3I5RA 2EGAA 2O2OA 2MOXA 3VS3A 2HEQA 3M0RA 5I22A 1X69A 2K7AA 1U06A 2RF0A 2LJ1A 4CC2A 1YP5A 2IIMA 2KR3A 3TSWA 1WI7A 3VS6A 2KYBA 2C0IA 2EVRA 1ABQA 1T3SA 1PKTA 1U3OA 2J7IA 2JS0A 2A08A 3SHWA 2FRYA 1JQQA 2DX1A 2EPDA 2CH4W 1M3CA 2ESWA 2KT8A 1WXTA 2X3XD 1I07A 2M51A 2EYYA 3KFVA 1Y57A 2LZ6B 4HCKA 1OOTA 4ZNXA 2OAWA 2VKNA 1KSWA 4F16A 1MV3A 5I11A 2YDLA 1AWXA 4JJDA 5FWBA 3EG2A 3UA7A 1GL5A 1AZGB 2OI3A 3M0TA 1ABOA 1BK2A 3UF4A 3H0FA 2A36A 1WDXA 1TUCA 1YN8A 1SRMA 2M0YA 1I0CA 1ZBJA 3A98A 4OMLA 1VYVA 1B3QA 4J9BA 2YUPA 2W10A 1G83A 1AOJA 2DBMA 2LP5A 1N5ZA 2YUOA 1H92A 1X43A 2QDLA 4HVWA 1WXUA 2KRSA 1ZUYA 2DM1A 2CREA 1K0SA 2D8JA 2EYXA 2ABLA 1UG1A 1MUZA 3M0QA 1T3LA 1ZSGA 1EFNA 2CSQA 2O9VA 3EHRA 1SHFA 2PZ1A 2CSIA 2KYMA 1KIKA 1Y0MA 1RUWA 4J9GA 2HDAA 2L2PA 2L3QA 1V1CA 2NWMA 4RTUA 1UFFA 2X3WD 5HCKA 2K79A 2DL4A 4LUDA 3H0IA 1TG0A 2C0OA 2OJ2A 2C0TA 1VYTA 5FWCA 4F17A 1JXMA 4LNPA 2ED1A 2JW4A 2J6KA 1WLPB 2P4RA 4HVUA 3R6NA 2J6OA 3VS1A 2RQTA 2RMOA 2ROTA 2V1QA 3THKA 2LMJA 2BZXA 1IO6A 5IXBA 1TUDA 4WCIA 3I5SA 2LCSA 1W1FA 1GCQA 2G6FX 4LUEA 3I35A 1X2QA 4OMNA 1KFZA 2RQVA 2NUZA 2AKLA 2EQIA 1GFDA 4AFSC 4J9DA 1E6GA 2DBKA 4AFUC 2FO0A 1OPLA 1VYUA 4Z88A 5ECAA 2JS2A 4KRTA 4RUGA 4R0KA 2CT4A 2E5KA 1RLQC 4RTWA 3ZL7C 3EGUA 4RTZA 1OPKA 4E6RA 3PVQA 3TSZA 1MV0B 1PWTA 2JMAA 1PRMC 3UA6A 1QWFA 2DLPA 5FW9A 2JTEA 2ROLA 3VRZA 1H3HA 2KNBB 4D8DA 1SHGA 2LJ0A 3EG1A 1NG2A 2F2XA 1ZUKA 2BTTA 1QLYA 1UDLA 5L23A 1NM7A 2H8HA 1K9AA 2DVJA 4AFZC 1J3TA 5IXFA 3GBQA 1JEGA 1A0NB 2VVKA 3VRYA 2LNHB 2BZ8A 1X6GA 1RI9A 4X1VA 2KRNA 2JM8A 1AZEA 3SEMA 1K4US 1UJ0A 2DF6A 2SRCA 1YWOA 2GGRA 1T0HA 1NLOC 1PHTA 1FYNA 2K3BA 2CDTA 1SEMA 2HBWA 2YUQA 5IHIA 4GLMA 5GJVB 2RNAA 1WX6A 2KROA 2A28A 4GBQA 2ED0A 5GJWB 1ZX6A 1NEGA 2KT1A 2KGTA 1QKXA 1UHFA 4EIKA 3VS0A 1WIEA 4M4ZA 2KRMA 1S1NA 2KXCA 3O5ZA 2RN8A 1ZUUA 2PNIA 1M8MA 2JMCA 1SPKA 1QKWA 1NYGA 1UTIA 4QT7A 4J9HA 4HVVA 2RQRA 3PVLA 4J9EA 4AFQC 1SRLA 2J6FA 1SSHA 1M3AA 2JXBA 1GCQC 2MIOA 5EC7A 1WA7A 1UGVA 1H8KA 4J9CA 5IHNA 3M0SA 1WFWA 1BU1A 1HD3A 1QWEA 1GCPA 2EGCA 2DNUA 1UUEA 1CSKA 4D8KA 3NGPA 4OMMA 2LQWA 3ULRB 5IH2A 1HJDA 2LX7A 2FPFA 2EW3A 3C0CA 2YUNA 4K11A 2DILA 4CC4B 3JV3A 2EGEA 1AWOA 3QWYA 1W70A 2K6DA 1GFCA 2FEIA 2AZSA 2DL8A 1K0XA 2EYZA 1T0JA
chains in the Genus database with same CATH superfamily
4ZTFA 2GQIA 2PVGB 2W0ZA 2V26A 4C8QA 5KCHA 3QWXX 1B34B 2VWFA 2D0NA 2HL3A 1TWBA 4M7DD 2DYBA 3HSBA 5GMKi 1WHMA 1M90C 1GBQA 4PFOA 2QQAA 4P5NA 2BE9B 1IHVA 4WF2A 2RO0A 3QPHA 1LVKA 2AK5A 2E70A 2L3PA 4Y92A 5GAN7 3A8MB 1PKSA 1UE9A 2HKNA 1N8RR 1E6HA 4JJCA 4RCBA 3I56T 1RLPC 2LT4A 1RAGB 4JRPA 2EBPA 1O75A 4NS5A 3MJXA 3L42A 1G3WA 2R5MA 3OW2P 1NEBA 3REBB 1M90U 4OGEA 3RMQA 5GAN4 2QEXA 2VYTA 3M55A 5CO7A 2EQUA 3MP1A 3OS2A 1JO8A 1M27C 2DZ9A 2GFAA 3CMAT 1K9MC 2D8HA 1LPLA 3GNGA 1RL2A 2K3YA 4N0AA 3RESA 4EMGA 4LDUA 2BKDN 1YNZA 5GMKj 1EX4A 3TVTA 1MNDA 4IUTA 2K5IA 1OI1A 4JJBA 2CZ6B 2KSSA 4RTTA 4M77C 1KQ1A 3G71Q 3RKWA 1C1AA 4MMLA 1W2BP 4OMQA 4NL2A 1D3BA 5GAMh 2BZYA 2M1HA 3HRUA 1K9MU 2FL7A 2E4HA 4C8QC 4J83A 1QP2A 2E41A 1VQKA 4LN2A 2JZ2A 5FRNA 3CCQA 2LQ8A 1UGQB 4X9DA 4LDYA 4HA8A 2KY9A 1AEYA 3T9NA 4OP0A 1MMGA 4E7ZA 2J05A 1KD1R 4M77B 1PD1A 4BE0A 1YIJT 3RBBB 2QTVA 1IGQA 5LJ3j 2QGGA 2RI2A 3M0UA 4IKFA 2AHJB 5FU6C 4DEYA 2L3SA 2JTMA 3OBYA 1K1ZA 2PTKA 4CC3A 4C8QB 2E1HA 1M30A 1VQ9A 4JLGA 5CKDA 2HCKA 1IREB 2L3RA 2H3EB 3PMIA 1RACB 1W2BA 2O2OA 5I22A 4CC2A 4IUUA 2IIMA 4KH0B 2ZPHB 1S72T 4LXCA 1WI7A 2HQEA 3E1SA 3WXMB 2EVRA 3OBWA 1PKTA 2DK3A 4J8OA 3O8VA 3SHWA 3OW2S 2DX1A 2YRDA 1YHQT 2C06A 4N0AC 1YJNT 1I07A 4DBRA 3CCUT 1KC8R 3GP8A 1VQ5A 1OOTA 1BIAA 3QO3A 3JCMf 1V29B 2VKNA 5CQXA 4A54A 3A8HB 4F16A 3V8JA 5I11A 1VQ4A 4JJDA 3FEOA 3GIBA 2OI3A 3M0TA 1ABOA 1BK2A 3A8LB 3QG1A 3ER0A 2VXEA 2OAUA 1TUCA 4FW1A 2M0YA 3MP6A 1ZBJA 3RKYA 1VYVA 4J9BA 3DKMA 1AOJA 2DBMA 4M77E 4XTVA 1VQ8A 2YUOA 1BI0A 2B8AA 1X6OA 1W2BS 3V8KA 2DM1A 1NJIR 3G6ET 2CREA 1UG1A 1MUZA 4LD6A 3X28B 2QEXQ 4J6XA 4C8QE 2QG9B 2PZ1A 4FYXB 1Y0MA 4CRIA 1JB0E 2NWMA 2EYQA 3FDRA 1TG0A 1D3BB 3BDUA 1VYTA 2EIFA 1JXMA 1D09B 2LDMA 2P4RA 1HYOA 1M1KC 5LJ5g 3R6NA 2J6OA 2HSEB 4PJJA 1VQOA 3QJYA 2RMOA 2D6FA 3CCJT 3OSSC 1G5VA 4HT8A 3CMET 1TUDA 2ATCB 4WCIA 3I5SA 4FIBA 2LRQA 4M77D 5GAOm 2DFUA 1N8RC 1KFZA 2AKLA 3L2WA 2VGNA 4JRQA 2WACA 3GOXA 1OPLA 2YWWA 4RMOA 2EJGA 2VASA 5GANg 1VQKQ 4E47A 4A4HA 1M8VA 1LOJA 4XTUA 3JAME 3CPFA 3CCQQ 4RTWA 5KE2A 4ZGDB 4E2FB 4Y28E 1MV0B 4FYWB 3EH2A 4IUQA 1PRMC 1QWFA 4BB7A 2ROLA 3QZ9B 1C6VX 2XI9A 2JJ9A 4YTLA 2XD0A 3OB9A 1NG2A 2EQMA 4M7DF 1ZUKA 3META 3JCMW 4A4EA 1NM7A 3M4YA 1N8RU 5J26A 3M5AA 5GANd 4ATOA 2XHCA 3CCEA 1A0NB 2BZ8A 3AT1B 4XTYA 3Q1JA 2DERA 2A7YA 1K73R 1K4US 1UJ0A 3QYHB 5GAMf 1PHTA 2M0OA 3EGDA 4MZMA 2K3BA 1TUGB 2DTHA 5IHIA 4A4GA 1YI2A 1QVPA 3CC2Q 1X01A 3HRTA 1NEGA 3A1PA 4FW2A 2HQXA 4M78G 3M56A 4EIKA 5GAN8 3VS0A 3LWIA 1WIEA 2YLCA 1KD1C 1M1GA 2RJDA 1VQ5Q 1ZUUA 1VQ7T 2JMCA 4E7SA 1QKWA 4FL6A 4QT7A 2VUBA 3TCJA 4E7LA 4J9HA 4J5YA 3PMTA 4HVVA 3CCVT 4X34A 2CYZB 2FYKA 5D7UA 1LNXA 1WZOA 4OGCA 1SSHA 3VV0A 2JXBA 3OYNA 1PM3A 2DZCA 2ZZDA 3M0SA 1Q86R 2VV5A 4KUIA 3CPWP 1QWEA 1GCPA 4C0DC 2EGCA 2DVEA 1UGRB 1VQ8Q 2LQWA 5CK9A 4XU2A 3RMSA 1KD1U 2LX7A 4JJNK 3C0CA 3LX7A 2YUNA 1HK9A 4DA4A 1BI3A 3JV3A 3G71T 1K8AR 2Z0WA 1W70A 5HKCA 3DLLA 4J6YA 2EYZA 4M78A 1T0JA 2IVWA 2RQWA 4IIMA 4EMKC 3X26B 4OMPA 5FLXE 1OU8A 2CZ7B 3IQLA 4C0DB 2ECZA 2RH2A 1UJYA 1AHJB 2EFIA 4LDVA 2A37A 3GLXA 3RUXA 1VQOQ 4QQGA 1I4K1 1VQMT 3L2QA 1BCOA 3BDLA 1BKBA 2MMPA 4C92G 1Q82C 1OULA 2LQKA 5IHKA 7AT1B 1WPYA 2DL5A 4RG2A 3NMZC 2NUTA 1KC8U 1NJIC 1G3YA 1KJWA 4EMKB 5KYWA 2L0AA 2DXCA 2L5QA 2FPEA 1TH7A 2AKKA 4BDYA 2DMOA 4ESRA 4LDXA 1MHNA 1XNIA 2YT6A 2LX9A 2F2WA 2KDSA 5I2SA 5GMKm 1AD5A 3EGDB 3HP9A 3U23A 1UB4A 1I8FA 4PLLA 4FSSA 1AVZC 3WVEB 1RAIB 2JM9A 6AT1B 1Z9QA 2KEAA 3C94A 3TU4K 3H41A 2GBQA 3EAEA 3PE0A 3VS5A 4C8QG 1JXOA 2P84A 2P0KA 2FVUA 3OYEA 1NJIU 1OX9A 4QQDA 3CCEQ 1MGQA 2LJ3A 1OV3A 4QKUA 4AG1C 1NYFA 5C6SA 2MYSA 1ZLMA 5L8RE 3LWHA 3CPWS 5KYXA 3OYJA 1HSQA 4XK8E 3LH5A 4X9CA 3UT1A 4C92A 2XDBA 5LJ5e 1YI2Q 4JZ3A 3TREA 1M2OA 3JCMg 2V8KA 3KUFA 2DJQA 3NHNA 3OYIA 1Y96A 3FRNA 2AIRB 4M78C 4JZ4A 2JN0A 1WHJA 1Q95G 4OMOA 2KE9A 5FRMA 1YFNA 4PL6A 3L2VA 2FRWA 3EHQA 1VQNA 2EKHA 3P8BB 2ENMA 1E7OA 4DOWA 3E2UA 2DD4A 5GANe 1W6XA 3JCMd 1TU0B 4FYYB 3SB2A 3PIPA 5GAN6 2RHIA 3VKIA 4BI8B 4C5GA 2VB6A 3CCRA 4QVDA 5EG2A 4JS5A 3M59A 4V2SA 2KBTA 1SSFA 4XTWA 5HK3A 3V8LA 1K76A 4M78B 4ORZA 1K73C 2NUPB 3CQTA 1FMVA 2KXDA 3CBPA 3J80E 2BIVA 2EYWA 3TEEA 1OEBA 3OYHA 4M77F 1ARKA 2COWA 2VXFA 4FM4B 1N9SA 2LCCA 4J9FA 2CZ0B 4J7FA 2JTFA 3QYGB 2I0NA 4JLIA 3DB4A 3MEAA 5CKBA 2MOXA 5CVIA 3SDZA 3ZFJA 2QQ9A 2HEQA 3M0RA 1X69A 2K7AA 3QZ5B 2I2LA 2RF0A 4AMCA 2LJ1A 1YP5A 4ZTJA 4IURA 3BW1A 1FMWA 3CEYA 3TSWA 3PFSA 3A5ZB 4C8QF 1H3ZA 2J7IA 2A08A 3LW5E 2XKOC 5AYFA 2PVOB 2EPDA 2CH4W 1VQKT 2ESWA 3UPUA 1K73U 2DO3A 2EYYA 2FHDA 4JRIA 3CCQT 5KYWB 3L1AA 4JRKA 4BY6C 3RDVA 4RKUE 4F7UA 1KSWA 2KMTA 1C0MA 4OB2B 2QGFB 5KYYB 1FX7A 4BI3A 2DXBA 4C92C 3UA7A 4L5GA 4OB3B 3UF4A 2QXFA 4Z02A 4BE1A 2DJZA 3A98A 3QXEB 4OMLA 2NLUA 1VQ9T 1WHLA 4QVCA 2YUPA 2W10A 5DLOA 5I2MA 1I5OB 5HY6A 1N5ZA 2QDLA 1K8AC 1ZUYA 4BY6B 4DOVA 4NL3A 1BYMA 4PLIA 2D8JA 2ABLA 1YITA 1Q81R 3KBGA 4EMHA 4N4IA 1T3LA 5KYXB 1M5Q1 3LGFA 4M78E 4OB0B 2RK2A 2O9VA 3EHRA 1SHFA 1DJ7B 1JJ2P 4C92B 1M4ZA 5GAMg 1RUWA 1KHIA 3QSUA 1V1CA 1UFFA 2X3WD 2K79A 1Y96B 2DL4A 3KXTA 4XU0A 2OJ2A 1VQ5T 4F17A 5CAIA 2MI6A 4HVUA 1K8AU 2D9TA 3MPUB 4ME7A 4PK4A 1QVGP 2RQTA 1VQ4T 1TS9A 2ROTA 3BY7A 3I56A 1IO6A 4ZGJB 5IXBA 1W1FA 2G6FX 2E6NA 2F5TX 2RB6A 3CCMA 1VIEA 1GFDA 2DBKA 2FO0A 1VYUA 1VQNQ 2K57A 1WJQA 2JS2A 3DB3A 3EFOA 4M78D 4RUGA 2D0QB 4KGVB 5GMKh 1JJ2A 2OTLA 5GAOq 4PJOA 2OX7A 4RTZA 3MEWA 5D6WA 4OMFB 1PWTA 3CC2A 3UA6A 3JCMQ 1SKUB 4M7AA 4D8DA 1XQHA 4IUPA 2BE7D 5FU6B 3CCRQ 1QLYA 5L23A 5I21A 5C0MA 1QVGA 3BFMA 1J3TA 3EGXA 5IXFA 1FXXA 2O01E 3OYDA 4C5IA 3INZA 3M58A 1SG5A 4C92E 5LJ5j 1VQOT 2SRCA 1N6AA 4FSXA 1NLOC 2EJ9A 4HT9A 2F69A 2RA2A 3F70A 1SEMA 3HFOA 4O5VA 3QBYA 2QI2A 2KROA 4GBQA 5GJWB 5LJ3h 4PKCC 1UHFA 5KH6A 3JCMe 2Y90A 4C0FA 1JJ2S 1ZA2B 2KVQG 2F5KA 3C4SA 1S1NA 2V8JA 5GANj 2X4YA 1LJOA 2DETA 1SPKA 1NYGA 1UTIA 2ZPIB 4DBQA 3CCST 4J9EA 4AFQC 1SRLA 3FLGA 2RK1A 3DLMA 3CCLA 4KT0E 1QVGS 1QVFP 1WA7A 1WFWA 1BU1A 2GCXA 4Y91A 2DPPB 3CCET 4C92D 4A53A 1S72A 1CSKA 2CP0A 4D8KA 2KK4A 2COZA 4OMMA 4GY5A 3M9QA 5LL6S 1HJDA 2E10A 2EW3A 5DM7R 4PJOC 1YITQ 1YJWA 5DLQE 2LTOA 4EDUA 1TXQA 4M75G 2RM4A 1JBMA 3A8GB 4M7AC 4QW2A 3LH0A 1K0XA 1YWPA 2GTOA 5LJ5d 4O6JA 4C8QD 3ZEHA 3A8OB 1X27A 3CC4T 4XQ3A 3OQ5A 3EFOB 4II1A 1QVFA 2O4XA 2E12A 3NFCA 1I81A 1OQKA 3FB9A 2QQSA 2K2MA 3I56Q 3QDRB 1VA7A 1X6BA 2DXTA 1ZA1B 2DIQA 3PGGA 1WHKA 4PJNA 3J7AF 1YJ9A 3NTKA 4FT4A 3CCMQ 5FU7C 4F14A 1QCFA 4JPBW 2V1RA 1QCOA 2OTLQ 4M75A 4ZN1A 2QASA 3SFMA 4Q5WA 1WXBA 2X9HA 3L2UA 5M9OA 1D0YA 4RTXA 1I1JA 2F2VA 1NPPA 3VJPA 2JVVA 2KAFA 2DRMA 4HXJA 4MDXA 3CMEA 1M90R 3UATA 2FG0A 5GAMe 2AZVA 3MCAB 2GNCA 4PFZA 3I55A 5DY9A 4J7IA 2YRCA 3V7RA 2XMFA 2O31A 2DE0X 1PG5B 4M75F 1B07A 2HSPA 4KGXB 4N4GA 3CXCP 2FPDA 3OS1A 2K5FA 4ZN3A 1NZ9A 2B86A 5CQYA 2EQJA 3NPFA 3CC7A 1IXDA 1X2KA 2CUDA 2CKKA 3I9QA 3H6ZA 2GFUA 4BE2A 1GBRA 1IRXA 1TSFA 1XOVA 4PJOE 3E9GA 1VQPA 3EG0A 5J39A 4DEXA 4NOYA 3HKSA 1H641 1BBZA 1EIFA 2K9GA 2EQKA 1K9MR 3CD6A 2D1XA 4RTYA 3REAB 2QDYB 3CCLQ 2LQNA 1KC8C 1PNJA 2R5AA 3G4SA 1VOMA 1F1BB 1RAHB 1UEBA 4IIOA 3VS7A 1TTHB 4LE9A 1WYXA 1S72Q 3CXCA 1OYXA 5GAOn 3OYLA 1NPRA 4A63B 1B34A 5LJ3f 3I5RA 4M75C 2BUDA 1YJWQ 1QCNA 2O4XB 4BD3A 3BE3A 3VS3A 1M1FA 1U06A 2V8IA 1D1CA 4M78F 4PNOA 5KYUA 4QQ6A 1T3SA 4RCCA 3CCVA 1OX8A 2FRYA 1JQQA 1VQNT 2E5QA 1SF9A 5GAN5 2ZGWA 4LD9K 2FZKB 4XU1A 1WXTA 2X3XD 2HBPA 3KFVA 4EPCA 2XG8D 2LVMA 1Y57A 5FROA 4LDWA 1KQSP 2OAWA 3OYMA 2PVDB 1MV3A 4M75B 2YDLA 2DYIA 5FWBA 2DTIA 1QMCA 1M9SA 1R77A 2X4WA 1GL5A 1YJ9Q 1QP3A 2A36A 3JCMP 2QA4A 3L2RA 1SRMA 1YN8A 3V7CA 1Y07A 3NTIA 1B3QA 3S3OA 1G83A 2K5LA 2Y4XA 3QKJA 1H92A 1IB8A 4HVWA 4QVZA 1WXUA 2KRSA 2HNIA 4C5HA 1K0SA 2EYXA 1VQLA 8AT1B 4XU3A 3VU3C 4A4FA 4ANJA 3M0QA 1ZSGA 4FT2A 9ATCB 3QHSA 3P8HA 2FZGB 2HQHA 4KULA 3VYHB 3H9NA 4J9GA 2YLBA 2L2PA 1KQSA 1VQMA 2RJFA 2VGMA 1BI1A 1MMDA 3CMEQ 3HHTB 4LUDA 5IN1A 3H0IA 2C0TA 3I55Q 5GAOr 4BACA 1ZHIA 2CP6A 2ED1A 2JW4A 2J6KA 2QEXT 1WLPB 3QUIA 4C92F 3VS1A 4F7UG 3OYCA 4R56A 2IPOB 2V1QA 3THKA 2DD5A 2LMJA 2BZXA 5CCAA 3CC7Q 1GCQA 1X2QA 4OMNA 2MF2A 2RQVA 1W4SA 2NUZA 4OB1B 3JCMX 1WQ7A 2EQIA 2DAQA 1ZQ1A 4AFUC 1VQPQ 2M16A 2DXUA 4BI4A 4M75E 4Z88A 4KRTA 3M54A 4HCCA 3PNWC 2CT4A 2X4XA 1FWZA 2E5KA 3QDFA 1RLQC 1R0BG 1YITT 3PTAA 3EGUA 4FYVB 4E6RA 3PVQA 2K3XA 3CD6Q 4PJLA 1ZSZA 2DLPA 3VRZA 3WVDB 1H3HA 1KQSS 3MEUA 2KNBB 3G4SQ 1SHGA 4UC4A 1VQ6A 8ATCB 5GAMj 2F2XA 5KYUB 2BTTA 2IG0A 2PUOB 1M1KR 2NUTB 3OMGA 3SD4A 1VIFA 2H8HA 3LLRA 4GLKA 2OTJA 3JCMb 4AFZC 3JB9H 2HKQB 1JEGA 2LNHB 2CP7A 1X6GA 4X1VA 2KRNA 4E7JA 2JM8A 1AZEA 3SEMA 1Q86C 2RI5A 2HMAA 3OYAA 1YWOA 2GGRA 2H3JA 4MZTA 1FYNA 2CDTA 1BCMA 2HBWA 2RHZA 2DEQA 5D6XA 3UWNA 2L89A 4M75D 2A28A 3CCMT 2ED0A 1OZ3A 1ZX6A 2KT1A 3CCVQ 3P8DA 4BDZA 1QKXA 2JOYA 1VQ7A 3X20B 2JUFA 3CBMA 2KRMA 2KXCA 1KK7A 4ELYC 2OTLT 4F7UF 1V76A 1M8MA 2XDPA 4DQ2A 4PJOG 2A3LA 3UDCA 3CC2T 1Q86U 3PVLA 2X51A 2FB7A 3QIIA 2J6FA 4MZPA 4M7AG 1M3AA 1PC0A 1GCQC 4D6WA 2MIOA 2QA4Q 2QQBA 3MP8A 5EC7A 1NE8A 1RAEB 2YHTA 2QK0A 1UUEA 1PSFA 3NGPA 4ELZC 2P4TA 5AT1B 4KH1B 3JRZA 3OS5A 3ULRB 3OW2A 2FPFA 5GAMd 4L6V5 1VQLQ 3OYYA 4K11A 4CC4B 2GQVA 2EGEA 1AWOA 2K6DA 1ZSZC 2FEIA 3ZBDA 2AZSA 1YBYA 2DL8A 4OF1A 3S6WA 4CI0C 2CP2A 1VQ8T 4FU6A 3N5BB 1VQMQ 5CKFA 3H8ZA 2KI7A 4E7KA 3CMAA 2FZCB 3FJ5A 1TOVA 1FMKA 3VS2A 1UHCA 1CKBA 4AT1B 4JDSA 2HD0A 2CUBA 5IAYA 1AWJA 4B9XA 3RKXA 2AT1B 3JB9D 1G3SA 2YSQA 1I5LA 2RPNA 3CCLT 1Q7YR 4E7HA 3H0HA 3OYFA 2RHYA 2O9SA 2MWPA 1ZSZB 2GTJA 1D0ZA 5CKHA 1BB9A 3M0PA 3GF5A 2PUKB 4RTVA 4ZGEB 4PJOF 4J6WA 2DL3A 1U1SA 2P0PA 3G7ZA 2CS7A 3ME9A 2GF7A 3E19A 1YJWT 4F7UB 5GAOl 1IZ6A 1D1AA 4Z8AA 4M7AF 4Z89A 3EG3A 1X75C 2VC8A 1AT1B 3RNJA 2K4YA 1Y7XA 2QTXA 1VQ6Q 5LJ3g 1YIJA 3VS4A 4IUVA 2WSEE 2CZ1B 3OYKA 1U1TA 2OTJQ 1YCSB 1M3BA 3M4GA 3SWNA 2YXYA 4M7DG 3FIFA 2SEMA 1RAAB 1Q82R 2DA9A 5LJ3d 1UECA 1YJ9T 2DRKA 2JT4A 2J06A 3MO8A 4KUDK 1WQWA 2RI3A 2CGHA 1CKAA 1EZZB 1XJWB 3J81E 2QQRA 1VQ7Q 1Z9ZA 3VUBA 2O88A 4L59A 2CT3A 2MCNA 1YHQA 4AG2C 2MPXC 5KYNA 4F04B 1YJNA 1M2VA 3FJPA 2DL7A 3CCUA 1YI2T 1PRLC 1G3TA 1NLPC 2RQUA 3M57A 1U5SA 5LJ5h 1IHWA 1IGUA 1JU5C 2CH4A 2DEUA 1WGSA 1MNEA 4DBFA 1N27A 3OA6A 5GAOp 2R57A 3EFSA 3C95A 2HL5C 2NYSA 4F7UE 1LCKA 1AWWA 1G8XA 5CR2A 3EG9A 4M7DA 5A0LA 3I55T 5CKEA 4CC7A 1D0XA 4J9IA 1GRIA 4N4HA 2EJFA 3E9FA 3VUZA 3PIOA 4PJOB 1VUBA 3CBOA 4A4KA 5GANh 1WJRA 1G2BA 2XU8A 2EGAA 3G6EA 3CC7T 1XTDA 1M1KU 4OVAA 4M7AB 2RJEA 3EFRA 2KR3A 2RD1A 3VS6A 2KYBA 3OYBA 4E7IA 2C0IA 2DTOA 1ABQA 1U3OA 3GPLA 1Y71A 3CCSA 2JS0A 1Q81C 3EGXB 3CMAQ 3JSCA 1N9RA 1UGSB 3HPWA 1RI0A 1VQPT 4JS4A 5KCOA 1M3CA 4BUGA 2KT8A 5IT9E 3LYIA 2M51A 3HL8A 4EMKA 4JUVA 3SWNC 4B6MA 4HCKA 2LZ6B 2ZPBB 4ZNXA 4XAXB 3CD6T 1VQ9Q 2LT1A 3S3MA 4B9WA 2EAYA 1AWXA 3G4ST 1KG1A 3EG2A 3CCJA 5D6YA 1AZGB 3C12A 1WNLA 1YCYA 2XICA 4KGZB 3PT9A 3H0FA 4DBHA 1WDXA 4KBMB 4VUBA 4WTOB 5FU7B 2XDDA 1QVFS 1I0CA 4XTZA 1Q81U 2ZAEA 3URGA 1RABB 3JB9G 4HCBA 2LP5A 4XTXA 1X43A 3SWNB 3QJ6A 1PCXA 2X4JA 1BIBA 3FC3A 2QAZA 1MMNA 3CC4A 2PU9B 1EFNA 2CSQA 2RJCA 2XIDA 3OYGA 2E6ZA 2R58A 1YIJQ 1ACMB 2CSIA 2KYMA 4HKEA 1VQ4Q 3JCMc 2X35A 3OSVA 1KIKA 2EKOA 2HDAA 2L3QA 3S3NA 1HXDA 4RTUA 1OU9A 5HCKA 2C0OA 5GMKl 4M7DC 5FWCA 2MAMA 4LNPA 2M02A 1GXIE 4M7AE 2DKGA 1Q7YC 1O9SA 1M2VB 2YRVA 5J3BA 1NBEB 2E64A 2E3IA 5GMKe 1OZ2A 1UGPB 2HAXA 3RERA 2E3HA 2QYZA 3EH1A 5KE3A 2LCSA 2QA4T 4LUEA 3I35A 4C0GA 3M53A 3HTRA 4AFSC 4J9DA 1E6GA 2CP5A 2NUPA 1YHQQ 3EG9B 2A0FB 5ECAA 5A2QE 4M7DB 4C5EA 2HZYA 1YJNQ 3CCUQ 4R0KA 1VQLT 2CP3A 1Q7YU 1WJSA 2E65A 4MMKA 3ZL7C 2P0QA 1OPKA 3TSZA 3VYGA 4PJOD 2LNVA 2JMAA 3JB9J 3OS0A 5FW9A 2JTEA 1PSEA 2L8DA 3EG1A 2LJ0A 3OMCA 3CPWA 2ZCFB 1UDLA 4M7AD 2K2VA 1U8RA 3JB9F 1KQ2A 1WHHA 3HRSA 4HCZA 1K9AA 2DVJA 2EWNA 4RG8A 2ZPGB 3GBQA 5LJ3e 2PQWA 1JRIA 2WSCE 2DIGA 2VVKA 3VRYA 1D1BA 4FCYA 1PD0A 5HK0A 4C0ZA 3X24B 1RI9A 5A0GA 2MK5A 2RHUA 1RADB 2DF6A 3MHXA 1T0HA 3R6OA 1RAFB 3CCRT 3G6EQ 1R8OB 2YUQA 4M77G 5KYYA 4GLMA 3CXCS 2M9UA 5GJVB 1WHGA 2RNAA 3G71A 1WX6A 3TQ7P 4MDWA 3CCSQ 2KGTA 3OY9A 2ZPFB 5LJ5f 2COYA 2RHXA 1B7TA 2ZPEB 1Q82U 4M4ZA 2LCLA 1KHCA 3O5ZA 2RN8A 2PNIA 1ZBXA 3V7SA 3JCMV 2JNGA 2RQRA 3L2ZA 3X25B 3LGLA 2Y4YA 4PFPA 1VQ6T 3CCJQ 2XK0A 5CIUA 4M7DE 2OTJT 1QQJA 2MWOA 5GANf 1UGVA 1H8KA 4J9CA 5IHNA 3JCMh 4TVRA 3HFNA 1HD3A 2DNUA 3RR6A 3D7SB 3MKDA 3GNFB 1MMAA 5IH2A 5GAN3 5A0DA 3MEVA 4R55A 3G1JA 4M77A 3NTHA 2DILA 3AHUA 3CC4Q 2LC4A 2KQWA 3QWYA 2WSFE 1GFCA 3JB9I 2G3RA 1QW1A 2F1LA 4PJMA 3RIRA 5GAN2 3ASKA 1R0CB 1BI2A 3JCMJ 1P92A
chains in the Genus database with same CATH topology
2RQWA 4IIMA 2GTOA 2GQIA 2W0ZA 3FJ5A 4OMPA 1FMKA 3VS2A 1UHCA 1CKBA 3IQLA 2ECZA 3QWXX 1UJYA 1X27A 2VWFA 2CUBA 2D0NA 2A37A 1AWJA 2DYBA 1GBQA 1YWPA 2K2MA 2YSQA 2RPNA 1VA7A 1X6BA 3H0HA 2O9SA 2GTJA 5IHKA 1BB9A 2DL5A 3NMZC 2AK5A 1KJWA 2L3PA 4Y92A 2L0AA 3M0PA 4F14A 1PKSA 2FPEA 1UE9A 2AKKA 4RTVA 2DMOA 1QCFA 1E6HA 4JJCA 4JPBW 2DL3A 4ESRA 1RLPC 2V1RA 2EBPA 2YT6A 2F2WA 4Z8AA 4Z89A 1NEBA 3EG3A 3REBB 1WXBA 1AD5A 3RNJA 3U23A 1JO8A 4RTXA 4FSSA 1AVZC 1M27C 3VS4A 1I1JA 2F2VA 2JM9A 1Z9QA 2KEAA 2D8HA 3H41A 2DRMA 1YCSB 4HXJA 2GBQA 3VS5A 3PE0A 1JXOA 1M3BA 3UATA 2FG0A 2AZVA 2GNCA 1YNZA 3TVTA 2LJ3A 1OV3A 4AG1C 1NYFA 4JJBA 2SEMA 1ZLMA 2XMFA 2O31A 2DE0X 4RTTA 1B07A 2HSPA 2DA9A 1HSQA 2FPDA 3LH5A 2B86A 1UECA 2DRKA 3NPFA 4JZ3A 2JT4A 2J06A 1X2KA 2CUDA 3I9QA 1CKAA 2DJQA 3NHNA 4OMQA 1GBRA 2BZYA 4JZ4A 1XOVA 4OMOA 2KE9A 1Z9ZA 2FRWA 2O88A 3EHQA 2CT3A 2MCNA 3EG0A 2EKHA 4AG2C 4DEXA 4LN2A 2DL7A 2ENMA 1E7OA 1PRLC 1BBZA 1NLPC 2RQUA 2K9GA 1AEYA 1W6XA 1U5SA 2D1XA 4RTYA 2J05A 3REAB 1JU5C 2CH4A 3RBBB 2LQNA 1PNJA 4IIOA 3M0UA 3VS7A 2KBTA 4DEYA 2L3SA 4LE9A 1K1ZA 2PTKA 1LCKA 1AWWA 1K76A 4ORZA 1WYXA 3CQTA 2KXDA 4CC7A 4CC3A 4J9IA 1GRIA 2EYWA 1M30A 1OEBA 1ARKA 4A63B 2HCKA 4J9FA 1G2BA 2I0NA 3I5RA 2EGAA 2O2OA 2MOXA 3VS3A 2HEQA 3M0RA 5I22A 1X69A 2K7AA 1U06A 2RF0A 2LJ1A 4CC2A 1YP5A 2IIMA 2KR3A 3TSWA 1WI7A 3VS6A 2KYBA 2C0IA 2EVRA 1ABQA 1T3SA 1PKTA 1U3OA 2J7IA 2JS0A 2A08A 3SHWA 2FRYA 1JQQA 2DX1A 2EPDA 2CH4W 1M3CA 2ESWA 2KT8A 1WXTA 2X3XD 1I07A 2M51A 2EYYA 3KFVA 1Y57A 2LZ6B 4HCKA 1OOTA 4ZNXA 2OAWA 2VKNA 1KSWA 4F16A 1MV3A 5I11A 2YDLA 1AWXA 4JJDA 5FWBA 3EG2A 3UA7A 1GL5A 1AZGB 2OI3A 3M0TA 1ABOA 1BK2A 3UF4A 3H0FA 2A36A 1WDXA 1TUCA 1YN8A 1SRMA 2M0YA 1I0CA 1ZBJA 3A98A 4OMLA 1VYVA 1B3QA 4J9BA 2YUPA 2W10A 1G83A 1AOJA 2DBMA 2LP5A 1N5ZA 2YUOA 1H92A 1X43A 2QDLA 4HVWA 1WXUA 2KRSA 1ZUYA 2DM1A 2CREA 1K0SA 2D8JA 2EYXA 2ABLA 1UG1A 1MUZA 3M0QA 1T3LA 1ZSGA 1EFNA 2CSQA 2O9VA 3EHRA 1SHFA 2PZ1A 2CSIA 2KYMA 1KIKA 1Y0MA 1RUWA 4J9GA 2HDAA 2L2PA 2L3QA 1V1CA 2NWMA 4RTUA 1UFFA 2X3WD 5HCKA 2K79A 2DL4A 4LUDA 3H0IA 1TG0A 2C0OA 2OJ2A 2C0TA 1VYTA 5FWCA 4F17A 1JXMA 4LNPA 2ED1A 2JW4A 2J6KA 1WLPB 2P4RA 4HVUA 3R6NA 2J6OA 3VS1A 2RQTA 2RMOA 2ROTA 2V1QA 3THKA 2LMJA 2BZXA 1IO6A 5IXBA 1TUDA 4WCIA 3I5SA 2LCSA 1W1FA 1GCQA 2G6FX 4LUEA 3I35A 1X2QA 4OMNA 1KFZA 2RQVA 2NUZA 2AKLA 2EQIA 1GFDA 4AFSC 4J9DA 1E6GA 2DBKA 4AFUC 2FO0A 1OPLA 1VYUA 4Z88A 5ECAA 2JS2A 4KRTA 4RUGA 4R0KA 2CT4A 2E5KA 1RLQC 4RTWA 3ZL7C 3EGUA 4RTZA 1OPKA 4E6RA 3PVQA 3TSZA 1MV0B 1PWTA 2JMAA 1PRMC 3UA6A 1QWFA 2DLPA 5FW9A 2JTEA 2ROLA 3VRZA 1H3HA 2KNBB 4D8DA 1SHGA 2LJ0A 3EG1A 1NG2A 2F2XA 1ZUKA 2BTTA 1QLYA 1UDLA 5L23A 1NM7A 2H8HA 1K9AA 2DVJA 4AFZC 1J3TA 5IXFA 3GBQA 1JEGA 1A0NB 2VVKA 3VRYA 2LNHB 2BZ8A 1X6GA 1RI9A 4X1VA 2KRNA 2JM8A 1AZEA 3SEMA 1K4US 1UJ0A 2DF6A 2SRCA 1YWOA 2GGRA 1T0HA 1NLOC 1PHTA 1FYNA 2K3BA 2CDTA 1SEMA 2HBWA 2YUQA 5IHIA 4GLMA 5GJVB 2RNAA 1WX6A 2KROA 2A28A 4GBQA 2ED0A 5GJWB 1ZX6A 1NEGA 2KT1A 2KGTA 1QKXA 1UHFA 4EIKA 3VS0A 1WIEA 4M4ZA 2KRMA 1S1NA 2KXCA 3O5ZA 2RN8A 1ZUUA 2PNIA 1M8MA 2JMCA 1SPKA 1QKWA 1NYGA 1UTIA 4QT7A 4J9HA 4HVVA 2RQRA 3PVLA 4J9EA 4AFQC 1SRLA 2J6FA 1SSHA 1M3AA 2JXBA 1GCQC 2MIOA 5EC7A 1WA7A 1UGVA 1H8KA 4J9CA 5IHNA 3M0SA 1WFWA 1BU1A 1HD3A 1QWEA 1GCPA 2EGCA 2DNUA 1UUEA 1CSKA 4D8KA 3NGPA 4OMMA 2LQWA 3ULRB 5IH2A 1HJDA 2LX7A 2FPFA 2EW3A 3C0CA 2YUNA 4K11A 2DILA 4CC4B 3JV3A 2EGEA 1AWOA 3QWYA 1W70A 2K6DA 1GFCA 2FEIA 2AZSA 2DL8A 1K0XA 2EYZA 1T0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQW A;  4IIM A;  2GTO A;  2GQI A;  2W0Z A;  3FJ5 A;  4OMP A;  1FMK A;  3VS2 A;  1UHC A;  1CKB A;  3IQL A;  2ECZ A;  3QWX X;  1UJY A;  1X27 A;  2VWF A;  2CUB A;  2D0N A;  2A37 A;  1AWJ A;  2DYB A;  1GBQ A;  1YWP A;  2K2M A;  2YSQ A;  2RPN A;  1VA7 A;  1X6B A;  3H0H A;  2O9S A;  2GTJ A;  5IHK A;  1BB9 A;  2DL5 A;  3NMZ C;  2AK5 A;  1KJW A;  2L3P A;  4Y92 A;  2L0A A;  3M0P A;  4F14 A;  1PKS A;  2FPE A;  1UE9 A;  2AKK A;  4RTV A;  2DMO A;  1QCF A;  1E6H A;  4JJC A;  4JPB W;  2DL3 A;  4ESR A;  1RLP C;  2V1R A;  2EBP A;  2YT6 A;  2F2W A;  4Z8A A;  4Z89 A;  1NEB A;  3EG3 A;  3REB B;  1WXB A;  1AD5 A;  3RNJ A;  3U23 A;  1JO8 A;  4RTX A;  4FSS A;  1AVZ C;  1M27 C;  3VS4 A;  1I1J A;  2F2V A;  2JM9 A;  1Z9Q A;  2KEA A;  2D8H A;  3H41 A;  2DRM A;  1YCS B;  4HXJ A;  2GBQ A;  3VS5 A;  3PE0 A;  1JXO A;  1M3B A;  3UAT A;  2FG0 A;  2AZV A;  2GNC A;  1YNZ A;  3TVT A;  2LJ3 A;  1OV3 A;  4AG1 C;  1NYF A;  4JJB A;  2SEM A;  1ZLM A;  2XMF A;  2O31 A;  2DE0 X;  4RTT A;  1B07 A;  2HSP A;  2DA9 A;  1HSQ A;  2FPD A;  3LH5 A;  2B86 A;  1UEC A;  2DRK A;  3NPF A;  4JZ3 A;  2JT4 A;  2J06 A;  1X2K A;  2CUD A;  3I9Q A;  1CKA A;  2DJQ A;  3NHN A;  4OMQ A;  1GBR A;  2BZY A;  4JZ4 A;  1XOV A;  4OMO A;  2KE9 A;  1Z9Z A;  2FRW A;  2O88 A;  3EHQ A;  2CT3 A;  2MCN A;  3EG0 A;  2EKH A;  4AG2 C;  4DEX A;  4LN2 A;  2DL7 A;  2ENM A;  1E7O A;  1PRL C;  1BBZ A;  1NLP C;  2RQU A;  2K9G A;  1AEY A;  1W6X A;  1U5S A;  2D1X A;  4RTY A;  2J05 A;  3REA B;  1JU5 C;  2CH4 A;  3RBB B;  2LQN A;  1PNJ A;  4IIO A;  3M0U A;  3VS7 A;  2KBT A;  4DEY A;  2L3S A;  4LE9 A;  1K1Z A;  2PTK A;  1LCK A;  1AWW A;  1K76 A;  4ORZ A;  1WYX A;  3CQT A;  2KXD A;  4CC7 A;  4CC3 A;  4J9I A;  1GRI A;  2EYW A;  1M30 A;  1OEB A;  1ARK A;  4A63 B;  2HCK A;  4J9F A;  1G2B A;  2I0N A;  3I5R A;  2EGA A;  2O2O A;  2MOX A;  3VS3 A;  2HEQ A;  3M0R A;  5I22 A;  1X69 A;  2K7A A;  1U06 A;  2RF0 A;  2LJ1 A;  4CC2 A;  1YP5 A;  2IIM A;  2KR3 A;  3TSW A;  1WI7 A;  3VS6 A;  2KYB A;  2C0I A;  2EVR A;  1ABQ A;  1T3S A;  1PKT A;  1U3O A;  2J7I A;  2JS0 A;  2A08 A;  3SHW A;  2FRY A;  1JQQ A;  2DX1 A;  2EPD A;  2CH4 W;  1M3C A;  2ESW A;  2KT8 A;  1WXT A;  2X3X D;  1I07 A;  2M51 A;  2EYY A;  3KFV A;  1Y57 A;  2LZ6 B;  4HCK A;  1OOT A;  4ZNX A;  2OAW A;  2VKN A;  1KSW A;  4F16 A;  1MV3 A;  5I11 A;  2YDL A;  1AWX A;  4JJD A;  5FWB A;  3EG2 A;  3UA7 A;  1GL5 A;  1AZG B;  2OI3 A;  3M0T A;  1ABO A;  1BK2 A;  3UF4 A;  3H0F A;  2A36 A;  1WDX A;  1TUC A;  1YN8 A;  1SRM A;  2M0Y A;  1I0C A;  1ZBJ A;  3A98 A;  4OML A;  1VYV A;  1B3Q A;  4J9B A;  2YUP A;  2W10 A;  1G83 A;  1AOJ A;  2DBM A;  2LP5 A;  1N5Z A;  2YUO A;  1H92 A;  1X43 A;  2QDL A;  4HVW A;  1WXU A;  2KRS A;  1ZUY A;  2DM1 A;  2CRE A;  1K0S A;  2D8J A;  2EYX A;  2ABL A;  1UG1 A;  1MUZ A;  3M0Q A;  1T3L A;  1ZSG A;  1EFN A;  2CSQ A;  2O9V A;  3EHR A;  1SHF A;  2PZ1 A;  2CSI A;  2KYM A;  1KIK A;  1Y0M A;  1RUW A;  4J9G A;  2HDA A;  2L2P A;  2L3Q A;  1V1C A;  2NWM A;  4RTU A;  1UFF A;  2X3W D;  5HCK A;  2K79 A;  2DL4 A;  4LUD A;  3H0I A;  1TG0 A;  2C0O A;  2OJ2 A;  2C0T A;  1VYT A;  5FWC A;  4F17 A;  1JXM A;  4LNP A;  2ED1 A;  2JW4 A;  2J6K A;  1WLP B;  2P4R A;  4HVU A;  3R6N A;  2J6O A;  3VS1 A;  2RQT A;  2RMO A;  2ROT A;  2V1Q A;  3THK A;  2LMJ A;  2BZX A;  1IO6 A;  5IXB A;  1TUD A;  4WCI A;  3I5S A;  2LCS A;  1W1F A;  1GCQ A;  2G6F X;  4LUE A;  3I35 A;  1X2Q A;  4OMN A;  1KFZ A;  2RQV A;  2NUZ A;  2AKL A;  2EQI A;  1GFD A;  4AFS C;  4J9D A;  1E6G A;  2DBK A;  4AFU C;  2FO0 A;  1OPL A;  1VYU A;  4Z88 A;  5ECA A;  2JS2 A;  4KRT A;  4RUG A;  4R0K A;  2CT4 A;  2E5K A;  1RLQ C;  4RTW A;  3ZL7 C;  3EGU A;  4RTZ A;  1OPK A;  4E6R A;  3PVQ A;  3TSZ A;  1MV0 B;  1PWT A;  2JMA A;  1PRM C;  3UA6 A;  1QWF A;  2DLP A;  5FW9 A;  2JTE A;  2ROL A;  3VRZ A;  1H3H A;  2KNB B;  4D8D A;  1SHG A;  2LJ0 A;  3EG1 A;  1NG2 A;  2F2X A;  1ZUK A;  2BTT A;  1QLY A;  1UDL A;  5L23 A;  1NM7 A;  2H8H A;  1K9A A;  2DVJ A;  4AFZ C;  1J3T A;  5IXF A;  3GBQ A;  1JEG A;  1A0N B;  2VVK A;  3VRY A;  2LNH B;  2BZ8 A;  1X6G A;  1RI9 A;  4X1V A;  2KRN A;  2JM8 A;  1AZE A;  3SEM A;  1K4U S;  1UJ0 A;  2DF6 A;  2SRC A;  1YWO A;  2GGR A;  1T0H A;  1NLO C;  1PHT A;  1FYN A;  2K3B A;  2CDT A;  1SEM A;  2HBW A;  2YUQ A;  5IHI A;  4GLM A;  5GJV B;  2RNA A;  1WX6 A;  2KRO A;  2A28 A;  4GBQ A;  2ED0 A;  5GJW B;  1ZX6 A;  1NEG A;  2KT1 A;  2KGT A;  1QKX A;  1UHF A;  4EIK A;  3VS0 A;  1WIE A;  4M4Z A;  2KRM A;  1S1N A;  2KXC A;  3O5Z A;  2RN8 A;  1ZUU A;  2PNI A;  1M8M A;  2JMC A;  1SPK A;  1QKW A;  1NYG A;  1UTI A;  4QT7 A;  4J9H A;  4HVV A;  2RQR A;  3PVL A;  4J9E A;  4AFQ C;  1SRL A;  2J6F A;  1SSH A;  1M3A A;  2JXB A;  1GCQ C;  2MIO A;  5EC7 A;  1WA7 A;  1UGV A;  1H8K A;  4J9C A;  5IHN A;  3M0S A;  1WFW A;  1BU1 A;  1HD3 A;  1QWE A;  1GCP A;  2EGC A;  2DNU A;  1UUE A;  1CSK A;  4D8K A;  3NGP A;  4OMM A;  2LQW A;  3ULR B;  5IH2 A;  1HJD A;  2LX7 A;  2FPF A;  2EW3 A;  3C0C A;  2YUN A;  4K11 A;  2DIL A;  4CC4 B;  3JV3 A;  2EGE A;  1AWO A;  3QWY A;  1W70 A;  2K6D A;  1GFC A;  2FEI A;  2AZS A;  2DL8 A;  1K0X A;  2EYZ A;  1T0J A; 
#chains in the Genus database with same CATH topology
 4ZTF A;  2GQI A;  2PVG B;  2W0Z A;  2V26 A;  4C8Q A;  5KCH A;  3QWX X;  1B34 B;  2VWF A;  2D0N A;  2HL3 A;  1TWB A;  4M7D D;  2DYB A;  3HSB A;  5GMK i;  1WHM A;  1M90 C;  1GBQ A;  4PFO A;  2QQA A;  4P5N A;  2BE9 B;  1IHV A;  4WF2 A;  2RO0 A;  3QPH A;  1LVK A;  2AK5 A;  2E70 A;  2L3P A;  4Y92 A;  5GAN 7;  3A8M B;  1PKS A;  1UE9 A;  2HKN A;  1N8R R;  1E6H A;  4JJC A;  4RCB A;  3I56 T;  1RLP C;  2LT4 A;  1RAG B;  4JRP A;  2EBP A;  1O75 A;  4NS5 A;  3MJX A;  3L42 A;  1G3W A;  2R5M A;  3OW2 P;  1NEB A;  3REB B;  1M90 U;  4OGE A;  3RMQ A;  5GAN 4;  2QEX A;  2VYT A;  3M55 A;  5CO7 A;  2EQU A;  3MP1 A;  3OS2 A;  1JO8 A;  1M27 C;  2DZ9 A;  2GFA A;  3CMA T;  1K9M C;  2D8H A;  1LPL A;  3GNG A;  1RL2 A;  2K3Y A;  4N0A A;  3RES A;  4EMG A;  4LDU A;  2BKD N;  1YNZ A;  5GMK j;  1EX4 A;  3TVT A;  1MND A;  4IUT A;  2K5I A;  1OI1 A;  4JJB A;  2CZ6 B;  2KSS A;  4RTT A;  4M77 C;  1KQ1 A;  3G71 Q;  3RKW A;  1C1A A;  4MML A;  1W2B P;  4OMQ A;  4NL2 A;  1D3B A;  5GAM h;  2BZY A;  2M1H A;  3HRU A;  1K9M U;  2FL7 A;  2E4H A;  4C8Q C;  4J83 A;  1QP2 A;  2E41 A;  1VQK A;  4LN2 A;  2JZ2 A;  5FRN A;  3CCQ A;  2LQ8 A;  1UGQ B;  4X9D A;  4LDY A;  4HA8 A;  2KY9 A;  1AEY A;  3T9N A;  4OP0 A;  1MMG A;  4E7Z A;  2J05 A;  1KD1 R;  4M77 B;  1PD1 A;  4BE0 A;  1YIJ T;  3RBB B;  2QTV A;  1IGQ A;  5LJ3 j;  2QGG A;  2RI2 A;  3M0U A;  4IKF A;  2AHJ B;  5FU6 C;  4DEY A;  2L3S A;  2JTM A;  3OBY A;  1K1Z A;  2PTK A;  4CC3 A;  4C8Q B;  2E1H A;  1M30 A;  1VQ9 A;  4JLG A;  5CKD A;  2HCK A;  1IRE B;  2L3R A;  2H3E B;  3PMI A;  1RAC B;  1W2B A;  2O2O A;  5I22 A;  4CC2 A;  4IUU A;  2IIM A;  4KH0 B;  2ZPH B;  1S72 T;  4LXC A;  1WI7 A;  2HQE A;  3E1S A;  3WXM B;  2EVR A;  3OBW A;  1PKT A;  2DK3 A;  4J8O A;  3O8V A;  3SHW A;  3OW2 S;  2DX1 A;  2YRD A;  1YHQ T;  2C06 A;  4N0A C;  1YJN T;  1I07 A;  4DBR A;  3CCU T;  1KC8 R;  3GP8 A;  1VQ5 A;  1OOT A;  1BIA A;  3QO3 A;  3JCM f;  1V29 B;  2VKN A;  5CQX A;  4A54 A;  3A8H B;  4F16 A;  3V8J A;  5I11 A;  1VQ4 A;  4JJD A;  3FEO A;  3GIB A;  2OI3 A;  3M0T A;  1ABO A;  1BK2 A;  3A8L B;  3QG1 A;  3ER0 A;  2VXE A;  2OAU A;  1TUC A;  4FW1 A;  2M0Y A;  3MP6 A;  1ZBJ A;  3RKY A;  1VYV A;  4J9B A;  3DKM A;  1AOJ A;  2DBM A;  4M77 E;  4XTV A;  1VQ8 A;  2YUO A;  1BI0 A;  2B8A A;  1X6O A;  1W2B S;  3V8K A;  2DM1 A;  1NJI R;  3G6E T;  2CRE A;  1UG1 A;  1MUZ A;  4LD6 A;  3X28 B;  2QEX Q;  4J6X A;  4C8Q E;  2QG9 B;  2PZ1 A;  4FYX B;  1Y0M A;  4CRI A;  1JB0 E;  2NWM A;  2EYQ A;  3FDR A;  1TG0 A;  1D3B B;  3BDU A;  1VYT A;  2EIF A;  1JXM A;  1D09 B;  2LDM A;  2P4R A;  1HYO A;  1M1K C;  5LJ5 g;  3R6N A;  2J6O A;  2HSE B;  4PJJ A;  1VQO A;  3QJY A;  2RMO A;  2D6F A;  3CCJ T;  3OSS C;  1G5V A;  4HT8 A;  3CME T;  1TUD A;  2ATC B;  4WCI A;  3I5S A;  4FIB A;  2LRQ A;  4M77 D;  5GAO m;  2DFU A;  1N8R C;  1KFZ A;  2AKL A;  3L2W A;  2VGN A;  4JRQ A;  2WAC A;  3GOX A;  1OPL A;  2YWW A;  4RMO A;  2EJG A;  2VAS A;  5GAN g;  1VQK Q;  4E47 A;  4A4H A;  1M8V A;  1LOJ A;  4XTU A;  3JAM E;  3CPF A;  3CCQ Q;  4RTW A;  5KE2 A;  4ZGD B;  4E2F B;  4Y28 E;  1MV0 B;  4FYW B;  3EH2 A;  4IUQ A;  1PRM C;  1QWF A;  4BB7 A;  2ROL A;  3QZ9 B;  1C6V X;  2XI9 A;  2JJ9 A;  4YTL A;  2XD0 A;  3OB9 A;  1NG2 A;  2EQM A;  4M7D F;  1ZUK A;  3MET A;  3JCM W;  4A4E A;  1NM7 A;  3M4Y A;  1N8R U;  5J26 A;  3M5A A;  5GAN d;  4ATO A;  2XHC A;  3CCE A;  1A0N B;  2BZ8 A;  3AT1 B;  4XTY A;  3Q1J A;  2DER A;  2A7Y A;  1K73 R;  1K4U S;  1UJ0 A;  3QYH B;  5GAM f;  1PHT A;  2M0O A;  3EGD A;  4MZM A;  2K3B A;  1TUG B;  2DTH A;  5IHI A;  4A4G A;  1YI2 A;  1QVP A;  3CC2 Q;  1X01 A;  3HRT A;  1NEG A;  3A1P A;  4FW2 A;  2HQX A;  4M78 G;  3M56 A;  4EIK A;  5GAN 8;  3VS0 A;  3LWI A;  1WIE A;  2YLC A;  1KD1 C;  1M1G A;  2RJD A;  1VQ5 Q;  1ZUU A;  1VQ7 T;  2JMC A;  4E7S A;  1QKW A;  4FL6 A;  4QT7 A;  2VUB A;  3TCJ A;  4E7L A;  4J9H A;  4J5Y A;  3PMT A;  4HVV A;  3CCV T;  4X34 A;  2CYZ B;  2FYK A;  5D7U A;  1LNX A;  1WZO A;  4OGC A;  1SSH A;  3VV0 A;  2JXB A;  3OYN A;  1PM3 A;  2DZC A;  2ZZD A;  3M0S A;  1Q86 R;  2VV5 A;  4KUI A;  3CPW P;  1QWE A;  1GCP A;  4C0D C;  2EGC A;  2DVE A;  1UGR B;  1VQ8 Q;  2LQW A;  5CK9 A;  4XU2 A;  3RMS A;  1KD1 U;  2LX7 A;  4JJN K;  3C0C A;  3LX7 A;  2YUN A;  1HK9 A;  4DA4 A;  1BI3 A;  3JV3 A;  3G71 T;  1K8A R;  2Z0W A;  1W70 A;  5HKC A;  3DLL A;  4J6Y A;  2EYZ A;  4M78 A;  1T0J A;  2IVW A;  2RQW A;  4IIM A;  4EMK C;  3X26 B;  4OMP A;  5FLX E;  1OU8 A;  2CZ7 B;  3IQL A;  4C0D B;  2ECZ A;  2RH2 A;  1UJY A;  1AHJ B;  2EFI A;  4LDV A;  2A37 A;  3GLX A;  3RUX A;  1VQO Q;  4QQG A;  1I4K 1;  1VQM T;  3L2Q A;  1BCO A;  3BDL A;  1BKB A;  2MMP A;  4C92 G;  1Q82 C;  1OUL A;  2LQK A;  5IHK A;  7AT1 B;  1WPY A;  2DL5 A;  4RG2 A;  3NMZ C;  2NUT A;  1KC8 U;  1NJI C;  1G3Y A;  1KJW A;  4EMK B;  5KYW A;  2L0A A;  2DXC A;  2L5Q A;  2FPE A;  1TH7 A;  2AKK A;  4BDY A;  2DMO A;  4ESR A;  4LDX A;  1MHN A;  1XNI A;  2YT6 A;  2LX9 A;  2F2W A;  2KDS A;  5I2S A;  5GMK m;  1AD5 A;  3EGD B;  3HP9 A;  3U23 A;  1UB4 A;  1I8F A;  4PLL A;  4FSS A;  1AVZ C;  3WVE B;  1RAI B;  2JM9 A;  6AT1 B;  1Z9Q A;  2KEA A;  3C94 A;  3TU4 K;  3H41 A;  2GBQ A;  3EAE A;  3PE0 A;  3VS5 A;  4C8Q G;  1JXO A;  2P84 A;  2P0K A;  2FVU A;  3OYE A;  1NJI U;  1OX9 A;  4QQD A;  3CCE Q;  1MGQ A;  2LJ3 A;  1OV3 A;  4QKU A;  4AG1 C;  1NYF A;  5C6S A;  2MYS A;  1ZLM A;  5L8R E;  3LWH A;  3CPW S;  5KYX A;  3OYJ A;  1HSQ A;  4XK8 E;  3LH5 A;  4X9C A;  3UT1 A;  4C92 A;  2XDB A;  5LJ5 e;  1YI2 Q;  4JZ3 A;  3TRE A;  1M2O A;  3JCM g;  2V8K A;  3KUF A;  2DJQ A;  3NHN A;  3OYI A;  1Y96 A;  3FRN A;  2AIR B;  4M78 C;  4JZ4 A;  2JN0 A;  1WHJ A;  1Q95 G;  4OMO A;  2KE9 A;  5FRM A;  1YFN A;  4PL6 A;  3L2V A;  2FRW A;  3EHQ A;  1VQN A;  2EKH A;  3P8B B;  2ENM A;  1E7O A;  4DOW A;  3E2U A;  2DD4 A;  5GAN e;  1W6X A;  3JCM d;  1TU0 B;  4FYY B;  3SB2 A;  3PIP A;  5GAN 6;  2RHI A;  3VKI A;  4BI8 B;  4C5G A;  2VB6 A;  3CCR A;  4QVD A;  5EG2 A;  4JS5 A;  3M59 A;  4V2S A;  2KBT A;  1SSF A;  4XTW A;  5HK3 A;  3V8L A;  1K76 A;  4M78 B;  4ORZ A;  1K73 C;  2NUP B;  3CQT A;  1FMV A;  2KXD A;  3CBP A;  3J80 E;  2BIV A;  2EYW A;  3TEE A;  1OEB A;  3OYH A;  4M77 F;  1ARK A;  2COW A;  2VXF A;  4FM4 B;  1N9S A;  2LCC A;  4J9F A;  2CZ0 B;  4J7F A;  2JTF A;  3QYG B;  2I0N A;  4JLI A;  3DB4 A;  3MEA A;  5CKB A;  2MOX A;  5CVI A;  3SDZ A;  3ZFJ A;  2QQ9 A;  2HEQ A;  3M0R A;  1X69 A;  2K7A A;  3QZ5 B;  2I2L A;  2RF0 A;  4AMC A;  2LJ1 A;  1YP5 A;  4ZTJ A;  4IUR A;  3BW1 A;  1FMW A;  3CEY A;  3TSW A;  3PFS A;  3A5Z B;  4C8Q F;  1H3Z A;  2J7I A;  2A08 A;  3LW5 E;  2XKO C;  5AYF A;  2PVO B;  2EPD A;  2CH4 W;  1VQK T;  2ESW A;  3UPU A;  1K73 U;  2DO3 A;  2EYY A;  2FHD A;  4JRI A;  3CCQ T;  5KYW B;  3L1A A;  4JRK A;  4BY6 C;  3RDV A;  4RKU E;  4F7U A;  1KSW A;  2KMT A;  1C0M A;  4OB2 B;  2QGF B;  5KYY B;  1FX7 A;  4BI3 A;  2DXB A;  4C92 C;  3UA7 A;  4L5G A;  4OB3 B;  3UF4 A;  2QXF A;  4Z02 A;  4BE1 A;  2DJZ A;  3A98 A;  3QXE B;  4OML A;  2NLU A;  1VQ9 T;  1WHL A;  4QVC A;  2YUP A;  2W10 A;  5DLO A;  5I2M A;  1I5O B;  5HY6 A;  1N5Z A;  2QDL A;  1K8A C;  1ZUY A;  4BY6 B;  4DOV A;  4NL3 A;  1BYM A;  4PLI A;  2D8J A;  2ABL A;  1YIT A;  1Q81 R;  3KBG A;  4EMH A;  4N4I A;  1T3L A;  5KYX B;  1M5Q 1;  3LGF A;  4M78 E;  4OB0 B;  2RK2 A;  2O9V A;  3EHR A;  1SHF A;  1DJ7 B;  1JJ2 P;  4C92 B;  1M4Z A;  5GAM g;  1RUW A;  1KHI A;  3QSU A;  1V1C A;  1UFF A;  2X3W D;  2K79 A;  1Y96 B;  2DL4 A;  3KXT A;  4XU0 A;  2OJ2 A;  1VQ5 T;  4F17 A;  5CAI A;  2MI6 A;  4HVU A;  1K8A U;  2D9T A;  3MPU B;  4ME7 A;  4PK4 A;  1QVG P;  2RQT A;  1VQ4 T;  1TS9 A;  2ROT A;  3BY7 A;  3I56 A;  1IO6 A;  4ZGJ B;  5IXB A;  1W1F A;  2G6F X;  2E6N A;  2F5T X;  2RB6 A;  3CCM A;  1VIE A;  1GFD A;  2DBK A;  2FO0 A;  1VYU A;  1VQN Q;  2K57 A;  1WJQ A;  2JS2 A;  3DB3 A;  3EFO A;  4M78 D;  4RUG A;  2D0Q B;  4KGV B;  5GMK h;  1JJ2 A;  2OTL A;  5GAO q;  4PJO A;  2OX7 A;  4RTZ A;  3MEW A;  5D6W A;  4OMF B;  1PWT A;  3CC2 A;  3UA6 A;  3JCM Q;  1SKU B;  4M7A A;  4D8D A;  1XQH A;  4IUP A;  2BE7 D;  5FU6 B;  3CCR Q;  1QLY A;  5L23 A;  5I21 A;  5C0M A;  1QVG A;  3BFM A;  1J3T A;  3EGX A;  5IXF A;  1FXX A;  2O01 E;  3OYD A;  4C5I A;  3INZ A;  3M58 A;  1SG5 A;  4C92 E;  5LJ5 j;  1VQO T;  2SRC A;  1N6A A;  4FSX A;  1NLO C;  2EJ9 A;  4HT9 A;  2F69 A;  2RA2 A;  3F70 A;  1SEM A;  3HFO A;  4O5V A;  3QBY A;  2QI2 A;  2KRO A;  4GBQ A;  5GJW B;  5LJ3 h;  4PKC C;  1UHF A;  5KH6 A;  3JCM e;  2Y90 A;  4C0F A;  1JJ2 S;  1ZA2 B;  2KVQ G;  2F5K A;  3C4S A;  1S1N A;  2V8J A;  5GAN j;  2X4Y A;  1LJO A;  2DET A;  1SPK A;  1NYG A;  1UTI A;  2ZPI B;  4DBQ A;  3CCS T;  4J9E A;  4AFQ C;  1SRL A;  3FLG A;  2RK1 A;  3DLM A;  3CCL A;  4KT0 E;  1QVG S;  1QVF P;  1WA7 A;  1WFW A;  1BU1 A;  2GCX A;  4Y91 A;  2DPP B;  3CCE T;  4C92 D;  4A53 A;  1S72 A;  1CSK A;  2CP0 A;  4D8K A;  2KK4 A;  2COZ A;  4OMM A;  4GY5 A;  3M9Q A;  5LL6 S;  1HJD A;  2E10 A;  2EW3 A;  5DM7 R;  4PJO C;  1YIT Q;  1YJW A;  5DLQ E;  2LTO A;  4EDU A;  1TXQ A;  4M75 G;  2RM4 A;  1JBM A;  3A8G B;  4M7A C;  4QW2 A;  3LH0 A;  1K0X A;  1YWP A;  2GTO A;  5LJ5 d;  4O6J A;  4C8Q D;  3ZEH A;  3A8O B;  1X27 A;  3CC4 T;  4XQ3 A;  3OQ5 A;  3EFO B;  4II1 A;  1QVF A;  2O4X A;  2E12 A;  3NFC A;  1I81 A;  1OQK A;  3FB9 A;  2QQS A;  2K2M A;  3I56 Q;  3QDR B;  1VA7 A;  1X6B A;  2DXT A;  1ZA1 B;  2DIQ A;  3PGG A;  1WHK A;  4PJN A;  3J7A F;  1YJ9 A;  3NTK A;  4FT4 A;  3CCM Q;  5FU7 C;  4F14 A;  1QCF A;  4JPB W;  2V1R A;  1QCO A;  2OTL Q;  4M75 A;  4ZN1 A;  2QAS A;  3SFM A;  4Q5W A;  1WXB A;  2X9H A;  3L2U A;  5M9O A;  1D0Y A;  4RTX A;  1I1J A;  2F2V A;  1NPP A;  3VJP A;  2JVV A;  2KAF A;  2DRM A;  4HXJ A;  4MDX A;  3CME A;  1M90 R;  3UAT A;  2FG0 A;  5GAM e;  2AZV A;  3MCA B;  2GNC A;  4PFZ A;  3I55 A;  5DY9 A;  4J7I A;  2YRC A;  3V7R A;  2XMF A;  2O31 A;  2DE0 X;  1PG5 B;  4M75 F;  1B07 A;  2HSP A;  4KGX B;  4N4G A;  3CXC P;  2FPD A;  3OS1 A;  2K5F A;  4ZN3 A;  1NZ9 A;  2B86 A;  5CQY A;  2EQJ A;  3NPF A;  3CC7 A;  1IXD A;  1X2K A;  2CUD A;  2CKK A;  3I9Q A;  3H6Z A;  2GFU A;  4BE2 A;  1GBR A;  1IRX A;  1TSF A;  1XOV A;  4PJO E;  3E9G A;  1VQP A;  3EG0 A;  5J39 A;  4DEX A;  4NOY A;  3HKS A;  1H64 1;  1BBZ A;  1EIF A;  2K9G A;  2EQK A;  1K9M R;  3CD6 A;  2D1X A;  4RTY A;  3REA B;  2QDY B;  3CCL Q;  2LQN A;  1KC8 C;  1PNJ A;  2R5A A;  3G4S A;  1VOM A;  1F1B B;  1RAH B;  1UEB A;  4IIO A;  3VS7 A;  1TTH B;  4LE9 A;  1WYX A;  1S72 Q;  3CXC A;  1OYX A;  5GAO n;  3OYL A;  1NPR A;  4A63 B;  1B34 A;  5LJ3 f;  3I5R A;  4M75 C;  2BUD A;  1YJW Q;  1QCN A;  2O4X B;  4BD3 A;  3BE3 A;  3VS3 A;  1M1F A;  1U06 A;  2V8I A;  1D1C A;  4M78 F;  4PNO A;  5KYU A;  4QQ6 A;  1T3S A;  4RCC A;  3CCV A;  1OX8 A;  2FRY A;  1JQQ A;  1VQN T;  2E5Q A;  1SF9 A;  5GAN 5;  2ZGW A;  4LD9 K;  2FZK B;  4XU1 A;  1WXT A;  2X3X D;  2HBP A;  3KFV A;  4EPC A;  2XG8 D;  2LVM A;  1Y57 A;  5FRO A;  4LDW A;  1KQS P;  2OAW A;  3OYM A;  2PVD B;  1MV3 A;  4M75 B;  2YDL A;  2DYI A;  5FWB A;  2DTI A;  1QMC A;  1M9S A;  1R77 A;  2X4W A;  1GL5 A;  1YJ9 Q;  1QP3 A;  2A36 A;  3JCM P;  2QA4 A;  3L2R A;  1SRM A;  1YN8 A;  3V7C A;  1Y07 A;  3NTI A;  1B3Q A;  3S3O A;  1G83 A;  2K5L A;  2Y4X A;  3QKJ A;  1H92 A;  1IB8 A;  4HVW A;  4QVZ A;  1WXU A;  2KRS A;  2HNI A;  4C5H A;  1K0S A;  2EYX A;  1VQL A;  8AT1 B;  4XU3 A;  3VU3 C;  4A4F A;  4ANJ A;  3M0Q A;  1ZSG A;  4FT2 A;  9ATC B;  3QHS A;  3P8H A;  2FZG B;  2HQH A;  4KUL A;  3VYH B;  3H9N A;  4J9G A;  2YLB A;  2L2P A;  1KQS A;  1VQM A;  2RJF A;  2VGM A;  1BI1 A;  1MMD A;  3CME Q;  3HHT B;  4LUD A;  5IN1 A;  3H0I A;  2C0T A;  3I55 Q;  5GAO r;  4BAC A;  1ZHI A;  2CP6 A;  2ED1 A;  2JW4 A;  2J6K A;  2QEX T;  1WLP B;  3QUI A;  4C92 F;  3VS1 A;  4F7U G;  3OYC A;  4R56 A;  2IPO B;  2V1Q A;  3THK A;  2DD5 A;  2LMJ A;  2BZX A;  5CCA A;  3CC7 Q;  1GCQ A;  1X2Q A;  4OMN A;  2MF2 A;  2RQV A;  1W4S A;  2NUZ A;  4OB1 B;  3JCM X;  1WQ7 A;  2EQI A;  2DAQ A;  1ZQ1 A;  4AFU C;  1VQP Q;  2M16 A;  2DXU A;  4BI4 A;  4M75 E;  4Z88 A;  4KRT A;  3M54 A;  4HCC A;  3PNW C;  2CT4 A;  2X4X A;  1FWZ A;  2E5K A;  3QDF A;  1RLQ C;  1R0B G;  1YIT T;  3PTA A;  3EGU A;  4FYV B;  4E6R A;  3PVQ A;  2K3X A;  3CD6 Q;  4PJL A;  1ZSZ A;  2DLP A;  3VRZ A;  3WVD B;  1H3H A;  1KQS S;  3MEU A;  2KNB B;  3G4S Q;  1SHG A;  4UC4 A;  1VQ6 A;  8ATC B;  5GAM j;  2F2X A;  5KYU B;  2BTT A;  2IG0 A;  2PUO B;  1M1K R;  2NUT B;  3OMG A;  3SD4 A;  1VIF A;  2H8H A;  3LLR A;  4GLK A;  2OTJ A;  3JCM b;  4AFZ C;  3JB9 H;  2HKQ B;  1JEG A;  2LNH B;  2CP7 A;  1X6G A;  4X1V A;  2KRN A;  4E7J A;  2JM8 A;  1AZE A;  3SEM A;  1Q86 C;  2RI5 A;  2HMA A;  3OYA A;  1YWO A;  2GGR A;  2H3J A;  4MZT A;  1FYN A;  2CDT A;  1BCM A;  2HBW A;  2RHZ A;  2DEQ A;  5D6X A;  3UWN A;  2L89 A;  4M75 D;  2A28 A;  3CCM T;  2ED0 A;  1OZ3 A;  1ZX6 A;  2KT1 A;  3CCV Q;  3P8D A;  4BDZ A;  1QKX A;  2JOY A;  1VQ7 A;  3X20 B;  2JUF A;  3CBM A;  2KRM A;  2KXC A;  1KK7 A;  4ELY C;  2OTL T;  4F7U F;  1V76 A;  1M8M A;  2XDP A;  4DQ2 A;  4PJO G;  2A3L A;  3UDC A;  3CC2 T;  1Q86 U;  3PVL A;  2X51 A;  2FB7 A;  3QII A;  2J6F A;  4MZP A;  4M7A G;  1M3A A;  1PC0 A;  1GCQ C;  4D6W A;  2MIO A;  2QA4 Q;  2QQB A;  3MP8 A;  5EC7 A;  1NE8 A;  1RAE B;  2YHT A;  2QK0 A;  1UUE A;  1PSF A;  3NGP A;  4ELZ C;  2P4T A;  5AT1 B;  4KH1 B;  3JRZ A;  3OS5 A;  3ULR B;  3OW2 A;  2FPF A;  5GAM d;  4L6V 5;  1VQL Q;  3OYY A;  4K11 A;  4CC4 B;  2GQV A;  2EGE A;  1AWO A;  2K6D A;  1ZSZ C;  2FEI A;  3ZBD A;  2AZS A;  1YBY A;  2DL8 A;  4OF1 A;  3S6W A;  4CI0 C;  2CP2 A;  1VQ8 T;  4FU6 A;  3N5B B;  1VQM Q;  5CKF A;  3H8Z A;  2KI7 A;  4E7K A;  3CMA A;  2FZC B;  3FJ5 A;  1TOV A;  1FMK A;  3VS2 A;  1UHC A;  1CKB A;  4AT1 B;  4JDS A;  2HD0 A;  2CUB A;  5IAY A;  1AWJ A;  4B9X A;  3RKX A;  2AT1 B;  3JB9 D;  1G3S A;  2YSQ A;  1I5L A;  2RPN A;  3CCL T;  1Q7Y R;  4E7H A;  3H0H A;  3OYF A;  2RHY A;  2O9S A;  2MWP A;  1ZSZ B;  2GTJ A;  1D0Z A;  5CKH A;  1BB9 A;  3M0P A;  3GF5 A;  2PUK B;  4RTV A;  4ZGE B;  4PJO F;  4J6W A;  2DL3 A;  1U1S A;  2P0P A;  3G7Z A;  2CS7 A;  3ME9 A;  2GF7 A;  3E19 A;  1YJW T;  4F7U B;  5GAO l;  1IZ6 A;  1D1A A;  4Z8A A;  4M7A F;  4Z89 A;  3EG3 A;  1X75 C;  2VC8 A;  1AT1 B;  3RNJ A;  2K4Y A;  1Y7X A;  2QTX A;  1VQ6 Q;  5LJ3 g;  1YIJ A;  3VS4 A;  4IUV A;  2WSE E;  2CZ1 B;  3OYK A;  1U1T A;  2OTJ Q;  1YCS B;  1M3B A;  3M4G A;  3SWN A;  2YXY A;  4M7D G;  3FIF A;  2SEM A;  1RAA B;  1Q82 R;  2DA9 A;  5LJ3 d;  1UEC A;  1YJ9 T;  2DRK A;  2JT4 A;  2J06 A;  3MO8 A;  4KUD K;  1WQW A;  2RI3 A;  2CGH A;  1CKA A;  1EZZ B;  1XJW B;  3J81 E;  2QQR A;  1VQ7 Q;  1Z9Z A;  3VUB A;  2O88 A;  4L59 A;  2CT3 A;  2MCN A;  1YHQ A;  4AG2 C;  2MPX C;  5KYN A;  4F04 B;  1YJN A;  1M2V A;  3FJP A;  2DL7 A;  3CCU A;  1YI2 T;  1PRL C;  1G3T A;  1NLP C;  2RQU A;  3M57 A;  1U5S A;  5LJ5 h;  1IHW A;  1IGU A;  1JU5 C;  2CH4 A;  2DEU A;  1WGS A;  1MNE A;  4DBF A;  1N27 A;  3OA6 A;  5GAO p;  2R57 A;  3EFS A;  3C95 A;  2HL5 C;  2NYS A;  4F7U E;  1LCK A;  1AWW A;  1G8X A;  5CR2 A;  3EG9 A;  4M7D A;  5A0L A;  3I55 T;  5CKE A;  4CC7 A;  1D0X A;  4J9I A;  1GRI A;  4N4H A;  2EJF A;  3E9F A;  3VUZ A;  3PIO A;  4PJO B;  1VUB A;  3CBO A;  4A4K A;  5GAN h;  1WJR A;  1G2B A;  2XU8 A;  2EGA A;  3G6E A;  3CC7 T;  1XTD A;  1M1K U;  4OVA A;  4M7A B;  2RJE A;  3EFR A;  2KR3 A;  2RD1 A;  3VS6 A;  2KYB A;  3OYB A;  4E7I A;  2C0I A;  2DTO A;  1ABQ A;  1U3O A;  3GPL A;  1Y71 A;  3CCS A;  2JS0 A;  1Q81 C;  3EGX B;  3CMA Q;  3JSC A;  1N9R A;  1UGS B;  3HPW A;  1RI0 A;  1VQP T;  4JS4 A;  5KCO A;  1M3C A;  4BUG A;  2KT8 A;  5IT9 E;  3LYI A;  2M51 A;  3HL8 A;  4EMK A;  4JUV A;  3SWN C;  4B6M A;  4HCK A;  2LZ6 B;  2ZPB B;  4ZNX A;  4XAX B;  3CD6 T;  1VQ9 Q;  2LT1 A;  3S3M A;  4B9W A;  2EAY A;  1AWX A;  3G4S T;  1KG1 A;  3EG2 A;  3CCJ A;  5D6Y A;  1AZG B;  3C12 A;  1WNL A;  1YCY A;  2XIC A;  4KGZ B;  3PT9 A;  3H0F A;  4DBH A;  1WDX A;  4KBM B;  4VUB A;  4WTO B;  5FU7 B;  2XDD A;  1QVF S;  1I0C A;  4XTZ A;  1Q81 U;  2ZAE A;  3URG A;  1RAB B;  3JB9 G;  4HCB A;  2LP5 A;  4XTX A;  1X43 A;  3SWN B;  3QJ6 A;  1PCX A;  2X4J A;  1BIB A;  3FC3 A;  2QAZ A;  1MMN A;  3CC4 A;  2PU9 B;  1EFN A;  2CSQ A;  2RJC A;  2XID A;  3OYG A;  2E6Z A;  2R58 A;  1YIJ Q;  1ACM B;  2CSI A;  2KYM A;  4HKE A;  1VQ4 Q;  3JCM c;  2X35 A;  3OSV A;  1KIK A;  2EKO A;  2HDA A;  2L3Q A;  3S3N A;  1HXD A;  4RTU A;  1OU9 A;  5HCK A;  2C0O A;  5GMK l;  4M7D C;  5FWC A;  2MAM A;  4LNP A;  2M02 A;  1GXI E;  4M7A E;  2DKG A;  1Q7Y C;  1O9S A;  1M2V B;  2YRV A;  5J3B A;  1NBE B;  2E64 A;  2E3I A;  5GMK e;  1OZ2 A;  1UGP B;  2HAX A;  3RER A;  2E3H A;  2QYZ A;  3EH1 A;  5KE3 A;  2LCS A;  2QA4 T;  4LUE A;  3I35 A;  4C0G A;  3M53 A;  3HTR A;  4AFS C;  4J9D A;  1E6G A;  2CP5 A;  2NUP A;  1YHQ Q;  3EG9 B;  2A0F B;  5ECA A;  5A2Q E;  4M7D B;  4C5E A;  2HZY A;  1YJN Q;  3CCU Q;  4R0K A;  1VQL T;  2CP3 A;  1Q7Y U;  1WJS A;  2E65 A;  4MMK A;  3ZL7 C;  2P0Q A;  1OPK A;  3TSZ A;  3VYG A;  4PJO D;  2LNV A;  2JMA A;  3JB9 J;  3OS0 A;  5FW9 A;  2JTE A;  1PSE A;  2L8D A;  3EG1 A;  2LJ0 A;  3OMC A;  3CPW A;  2ZCF B;  1UDL A;  4M7A D;  2K2V A;  1U8R A;  3JB9 F;  1KQ2 A;  1WHH A;  3HRS A;  4HCZ A;  1K9A A;  2DVJ A;  2EWN A;  4RG8 A;  2ZPG B;  3GBQ A;  5LJ3 e;  2PQW A;  1JRI A;  2WSC E;  2DIG A;  2VVK A;  3VRY A;  1D1B A;  4FCY A;  1PD0 A;  5HK0 A;  4C0Z A;  3X24 B;  1RI9 A;  5A0G A;  2MK5 A;  2RHU A;  1RAD B;  2DF6 A;  3MHX A;  1T0H A;  3R6O A;  1RAF B;  3CCR T;  3G6E Q;  1R8O B;  2YUQ A;  4M77 G;  5KYY A;  4GLM A;  3CXC S;  2M9U A;  5GJV B;  1WHG A;  2RNA A;  3G71 A;  1WX6 A;  3TQ7 P;  4MDW A;  3CCS Q;  2KGT A;  3OY9 A;  2ZPF B;  5LJ5 f;  2COY A;  2RHX A;  1B7T A;  2ZPE B;  1Q82 U;  4M4Z A;  2LCL A;  1KHC A;  3O5Z A;  2RN8 A;  2PNI A;  1ZBX A;  3V7S A;  3JCM V;  2JNG A;  2RQR A;  3L2Z A;  3X25 B;  3LGL A;  2Y4Y A;  4PFP A;  1VQ6 T;  3CCJ Q;  2XK0 A;  5CIU A;  4M7D E;  2OTJ T;  1QQJ A;  2MWO A;  5GAN f;  1UGV A;  1H8K A;  4J9C A;  5IHN A;  3JCM h;  4TVR A;  3HFN A;  1HD3 A;  2DNU A;  3RR6 A;  3D7S B;  3MKD A;  3GNF B;  1MMA A;  5IH2 A;  5GAN 3;  5A0D A;  3MEV A;  4R55 A;  3G1J A;  4M77 A;  3NTH A;  2DIL A;  3AHU A;  3CC4 Q;  2LC4 A;  2KQW A;  3QWY A;  2WSF E;  1GFC A;  3JB9 I;  2G3R A;  1QW1 A;  2F1L A;  4PJM A;  3RIR A;  5GAN 2;  3ASK A;  1R0C B;  1BI2 A;  3JCM J;  1P92 A; 
#chains in the Genus database with same CATH homology
 2RQW A;  4IIM A;  2GTO A;  2GQI A;  2W0Z A;  3FJ5 A;  4OMP A;  1FMK A;  3VS2 A;  1UHC A;  1CKB A;  3IQL A;  2ECZ A;  3QWX X;  1UJY A;  1X27 A;  2VWF A;  2CUB A;  2D0N A;  2A37 A;  1AWJ A;  2DYB A;  1GBQ A;  1YWP A;  2K2M A;  2YSQ A;  2RPN A;  1VA7 A;  1X6B A;  3H0H A;  2O9S A;  2GTJ A;  5IHK A;  1BB9 A;  2DL5 A;  3NMZ C;  2AK5 A;  1KJW A;  2L3P A;  4Y92 A;  2L0A A;  3M0P A;  4F14 A;  1PKS A;  2FPE A;  1UE9 A;  2AKK A;  4RTV A;  2DMO A;  1QCF A;  1E6H A;  4JJC A;  4JPB W;  2DL3 A;  4ESR A;  1RLP C;  2V1R A;  2EBP A;  2YT6 A;  2F2W A;  4Z8A A;  4Z89 A;  1NEB A;  3EG3 A;  3REB B;  1WXB A;  1AD5 A;  3RNJ A;  3U23 A;  1JO8 A;  4RTX A;  4FSS A;  1AVZ C;  1M27 C;  3VS4 A;  1I1J A;  2F2V A;  2JM9 A;  1Z9Q A;  2KEA A;  2D8H A;  3H41 A;  2DRM A;  1YCS B;  4HXJ A;  2GBQ A;  3VS5 A;  3PE0 A;  1JXO A;  1M3B A;  3UAT A;  2FG0 A;  2AZV A;  2GNC A;  1YNZ A;  3TVT A;  2LJ3 A;  1OV3 A;  4AG1 C;  1NYF A;  4JJB A;  2SEM A;  1ZLM A;  2XMF A;  2O31 A;  2DE0 X;  4RTT A;  1B07 A;  2HSP A;  2DA9 A;  1HSQ A;  2FPD A;  3LH5 A;  2B86 A;  1UEC A;  2DRK A;  3NPF A;  4JZ3 A;  2JT4 A;  2J06 A;  1X2K A;  2CUD A;  3I9Q A;  1CKA A;  2DJQ A;  3NHN A;  4OMQ A;  1GBR A;  2BZY A;  4JZ4 A;  1XOV A;  4OMO A;  2KE9 A;  1Z9Z A;  2FRW A;  2O88 A;  3EHQ A;  2CT3 A;  2MCN A;  3EG0 A;  2EKH A;  4AG2 C;  4DEX A;  4LN2 A;  2DL7 A;  2ENM A;  1E7O A;  1PRL C;  1BBZ A;  1NLP C;  2RQU A;  2K9G A;  1AEY A;  1W6X A;  1U5S A;  2D1X A;  4RTY A;  2J05 A;  3REA B;  1JU5 C;  2CH4 A;  3RBB B;  2LQN A;  1PNJ A;  4IIO A;  3M0U A;  3VS7 A;  2KBT A;  4DEY A;  2L3S A;  4LE9 A;  1K1Z A;  2PTK A;  1LCK A;  1AWW A;  1K76 A;  4ORZ A;  1WYX A;  3CQT A;  2KXD A;  4CC7 A;  4CC3 A;  4J9I A;  1GRI A;  2EYW A;  1M30 A;  1OEB A;  1ARK A;  4A63 B;  2HCK A;  4J9F A;  1G2B A;  2I0N A;  3I5R A;  2EGA A;  2O2O A;  2MOX A;  3VS3 A;  2HEQ A;  3M0R A;  5I22 A;  1X69 A;  2K7A A;  1U06 A;  2RF0 A;  2LJ1 A;  4CC2 A;  1YP5 A;  2IIM A;  2KR3 A;  3TSW A;  1WI7 A;  3VS6 A;  2KYB A;  2C0I A;  2EVR A;  1ABQ A;  1T3S A;  1PKT A;  1U3O A;  2J7I A;  2JS0 A;  2A08 A;  3SHW A;  2FRY A;  1JQQ A;  2DX1 A;  2EPD A;  2CH4 W;  1M3C A;  2ESW A;  2KT8 A;  1WXT A;  2X3X D;  1I07 A;  2M51 A;  2EYY A;  3KFV A;  1Y57 A;  2LZ6 B;  4HCK A;  1OOT A;  4ZNX A;  2OAW A;  2VKN A;  1KSW A;  4F16 A;  1MV3 A;  5I11 A;  2YDL A;  1AWX A;  4JJD A;  5FWB A;  3EG2 A;  3UA7 A;  1GL5 A;  1AZG B;  2OI3 A;  3M0T A;  1ABO A;  1BK2 A;  3UF4 A;  3H0F A;  2A36 A;  1WDX A;  1TUC A;  1YN8 A;  1SRM A;  2M0Y A;  1I0C A;  1ZBJ A;  3A98 A;  4OML A;  1VYV A;  1B3Q A;  4J9B A;  2YUP A;  2W10 A;  1G83 A;  1AOJ A;  2DBM A;  2LP5 A;  1N5Z A;  2YUO A;  1H92 A;  1X43 A;  2QDL A;  4HVW A;  1WXU A;  2KRS A;  1ZUY A;  2DM1 A;  2CRE A;  1K0S A;  2D8J A;  2EYX A;  2ABL A;  1UG1 A;  1MUZ A;  3M0Q A;  1T3L A;  1ZSG A;  1EFN A;  2CSQ A;  2O9V A;  3EHR A;  1SHF A;  2PZ1 A;  2CSI A;  2KYM A;  1KIK A;  1Y0M A;  1RUW A;  4J9G A;  2HDA A;  2L2P A;  2L3Q A;  1V1C A;  2NWM A;  4RTU A;  1UFF A;  2X3W D;  5HCK A;  2K79 A;  2DL4 A;  4LUD A;  3H0I A;  1TG0 A;  2C0O A;  2OJ2 A;  2C0T A;  1VYT A;  5FWC A;  4F17 A;  1JXM A;  4LNP A;  2ED1 A;  2JW4 A;  2J6K A;  1WLP B;  2P4R A;  4HVU A;  3R6N A;  2J6O A;  3VS1 A;  2RQT A;  2RMO A;  2ROT A;  2V1Q A;  3THK A;  2LMJ A;  2BZX A;  1IO6 A;  5IXB A;  1TUD A;  4WCI A;  3I5S A;  2LCS A;  1W1F A;  1GCQ A;  2G6F X;  4LUE A;  3I35 A;  1X2Q A;  4OMN A;  1KFZ A;  2RQV A;  2NUZ A;  2AKL A;  2EQI A;  1GFD A;  4AFS C;  4J9D A;  1E6G A;  2DBK A;  4AFU C;  2FO0 A;  1OPL A;  1VYU A;  4Z88 A;  5ECA A;  2JS2 A;  4KRT A;  4RUG A;  4R0K A;  2CT4 A;  2E5K A;  1RLQ C;  4RTW A;  3ZL7 C;  3EGU A;  4RTZ A;  1OPK A;  4E6R A;  3PVQ A;  3TSZ A;  1MV0 B;  1PWT A;  2JMA A;  1PRM C;  3UA6 A;  1QWF A;  2DLP A;  5FW9 A;  2JTE A;  2ROL A;  3VRZ A;  1H3H A;  2KNB B;  4D8D A;  1SHG A;  2LJ0 A;  3EG1 A;  1NG2 A;  2F2X A;  1ZUK A;  2BTT A;  1QLY A;  1UDL A;  5L23 A;  1NM7 A;  2H8H A;  1K9A A;  2DVJ A;  4AFZ C;  1J3T A;  5IXF A;  3GBQ A;  1JEG A;  1A0N B;  2VVK A;  3VRY A;  2LNH B;  2BZ8 A;  1X6G A;  1RI9 A;  4X1V A;  2KRN A;  2JM8 A;  1AZE A;  3SEM A;  1K4U S;  1UJ0 A;  2DF6 A;  2SRC A;  1YWO A;  2GGR A;  1T0H A;  1NLO C;  1PHT A;  1FYN A;  2K3B A;  2CDT A;  1SEM A;  2HBW A;  2YUQ A;  5IHI A;  4GLM A;  5GJV B;  2RNA A;  1WX6 A;  2KRO A;  2A28 A;  4GBQ A;  2ED0 A;  5GJW B;  1ZX6 A;  1NEG A;  2KT1 A;  2KGT A;  1QKX A;  1UHF A;  4EIK A;  3VS0 A;  1WIE A;  4M4Z A;  2KRM A;  1S1N A;  2KXC A;  3O5Z A;  2RN8 A;  1ZUU A;  2PNI A;  1M8M A;  2JMC A;  1SPK A;  1QKW A;  1NYG A;  1UTI A;  4QT7 A;  4J9H A;  4HVV A;  2RQR A;  3PVL A;  4J9E A;  4AFQ C;  1SRL A;  2J6F A;  1SSH A;  1M3A A;  2JXB A;  1GCQ C;  2MIO A;  5EC7 A;  1WA7 A;  1UGV A;  1H8K A;  4J9C A;  5IHN A;  3M0S A;  1WFW A;  1BU1 A;  1HD3 A;  1QWE A;  1GCP A;  2EGC A;  2DNU A;  1UUE A;  1CSK A;  4D8K A;  3NGP A;  4OMM A;  2LQW A;  3ULR B;  5IH2 A;  1HJD A;  2LX7 A;  2FPF A;  2EW3 A;  3C0C A;  2YUN A;  4K11 A;  2DIL A;  4CC4 B;  3JV3 A;  2EGE A;  1AWO A;  3QWY A;  1W70 A;  2K6D A;  1GFC A;  2FEI A;  2AZS A;  2DL8 A;  1K0X A;  2EYZ A;  1T0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...