1NEGA

Crystal structure analysis of n-and c-terminal labeled sh3-domain of alpha-chicken spectrin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLAAAWSHPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
publication title Rapid purification and crystal structure analysis of a small protein carrying two terminal affinity tags
pubmed doi rcsb
source organism Gallus gallus
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1negA00
1Z9ZA 2EQIA 1UHFA 1FYNA 4IIMA 2KRMA 3ZL7C 2DJQA 2HCKA 5IH2A 3VRYA 1MV0B 1PNJA 1W70A 2OAWA 4OMLA 4J9HA 3EHRA 3TSZA 2CH4A 2KYMA 2V1QA 1V1CA 2ESWA 3JV3A 1B3QA 3I9QA 1NYGA 5IHIA 1T0JA 5IXBA 2VVKA 3PVQA 4E6RA 2MIOA 2KROA 4AFSC 1X2KA 3THKA 4CC2A 2CT3A 2A28A 2K7AA 2DL8A 3M0TA 2FG0A 2DVJA 1GL5A 2CUDA 4J9BA 3QWYA 2DL4A 3EG0A 1I07A 2KBTA 1VYTA 2NUZA 2YUPA 1LCKA 5FWCA 1CKAA 1UTIA 2OJ2A 1NLPC 2J6FA 3I5SA 2JS0A 2X3WD 3REAB 2X3XD 2YUOA 2RQTA 2GTJA 2MCNA 3TSWA 2LX7A 1M27C 2K79A 1T3SA 1QCFA 3I5RA 1CKBA 3CQTA 1AVZC 1KIKA 3O5ZA 2L2PA 2DLPA 5FW9A 2DE0X 1VYVA 4IIOA 1AWJA 2KGTA 4RTZA 5I22A 3FJ5A 1BB9A 1PHTA 2HBWA 2FRWA 2PTKA 1JXOA 1QKWA 5EC7A 2JXBA 5FWBA 1H92A 2DL7A 3LH5A 2RNAA 2EYWA 4OMPA 2OI3A 2GTOA 2RMOA 3M0PA 4F16A 1OPKA 1NYFA 5IXFA 4RTYA 1WIEA 1HD3A 2K9GA 1U3OA 2ED1A 1GCQC 4LUDA 2KXDA 1FMKA 1AZGB 4KRTA 2M0YA 1QKXA 1WFWA 2I0NA 1G2BA 4AFUC 1QWEA 2EGEA 3EGUA 4JJBA 1RLPC 3REBB 1S1NA 2D0NA 3TVTA 1T3LA 4J9GA 1ZUUA 3SEMA 1UFFA 2PZ1A 2FPFA 2EYZA 2HDAA 2DF6A 1TUDA 3SHWA 2GBQA 1OPLA 1HJDA 1AOJA 1WXUA 1X2QA 2F2XA 1E6HA 4GLMA 5L23A 1YNZA 2AZSA 1OEBA 4EIKA 1M8MA 2DRMA 1WDXA 1QLYA 1UECA 3VS1A 4RTUA 1WXBA 1SHFA 4OMNA 2ABLA 1W1FA 1PKSA 4HCKA 2FPDA 4F17A 2BZ8A 4FSSA 2DBKA 1ZLMA 1NEGA 4R0KA 1YP5A 2O88A 3UA7A 1WXTA 2BZYA 1GRIA 2ENMA 3M0QA 2L3QA 3VS6A 3NHNA 3C0CA 2AZVA 1UJYA 2KT1A 3H0HA 3H0FA 2AKLA 2K6DA 1M30A 4HVUA 1X69A 1UDLA 1GFDA 2FEIA 5IHKA 2J6KA 1PWTA 4J9DA 2ED0A 2YUNA 1SHGA 2D1XA 2JW4A 1VYUA 4CC7A 2EKHA 1E6GA 2YT6A 4HVVA 4AFZC 2JTEA 1CSKA 3NGPA 1AZEA 1SRLA 3VS7A 2QDLA 4Z89A 2DA9A 1GCQA 3H41A 1YWOA 3M0UA 2CDTA 1YWPA 1AEYA 2W10A 1UG1A 2D8JA 2KNBB 2RQUA 2EGAA 3KFVA 1U06A 2LQNA 2MOXA 2XMFA 2LZ6B 2C0TA 4J9IA 1ZUKA 2JM8A 1ARKA 2K3BA 2O9VA 2K2MA 1ZSGA 2VWFA 1SRMA 2SRCA 2JMCA 3EG1A 1SPKA 1MUZA 1NLOC 4JJDA 4ORZA 2EBPA 2RQRA 3QWXX 2L3SA 1YCSB 2A37A 3VS2A 1ZX6A 2L3PA 1U5SA 3VS0A 3UF4A 2GQIA 3ULRB 4OMMA 2E5KA 4Z88A 4JZ3A 2J7IA 3NMZC 3RBBB 1WYXA 2KYBA 2C0IA 3EHQA 2LMJA 1X43A 2JS2A 3VRZA 3UA6A 4LN2A 4J9CA 3PVLA 1BK2A 3VS5A 1RLQC 1X6GA 2C0OA 2EPDA 2LCSA 2KEAA 4ZNXA 4Y92A 5GJVB 2L0AA 1K4US 1K76A 2BZXA 1EFNA 1W6XA 1K1ZA 2LQWA 2KE9A 1UHCA 4AFQC 2RN8A 2IIMA 1YN8A 2LJ1A 2YSQA 2EVRA 5ECAA 1JXMA 1J3TA 2F2WA 4HXJA 2JMAA 1GBQA 3I35A 1AWOA 1E7OA 4RTXA 2KRNA 4J9FA 2GNCA 4DEYA 1SSHA 5IHNA 2HEQA 2O2OA 1H8KA 1I1JA 1JEGA 3U23A 1NM7A 1HSQA 3VS4A 4RUGA 1ZUYA 3IQLA 1NG2A 2LP5A 2DBMA 3EG2A 2DYBA 2O31A 2DL3A 5GJWB 1SEMA 1M3AA 1H3HA 2RQWA 1GCPA 1M3BA 1A0NB 1IO6A 4A63B 4D8KA 1NEBA 2KXCA 1UUEA 2VKNA 1X6BA 2J05A 5HCKA 2DILA 2DM1A 2D8HA 2A36A 2W0ZA 1B07A 4RTTA 1GBRA 1K9AA 1WLPB 1I0CA 2YDLA 2CREA 1TG0A 2KRSA 3M0SA 1JQQA 2P4RA 1AWXA 3PE0A 2F2VA 2NWMA 1WI7A 1KFZA 3M0RA 4OMQA 1N5ZA 1PRLC 2J6OA 2AK5A 1OOTA 4WCIA 4M4ZA 1ABOA 2CUBA 1UGVA 2B86A 2LJ0A 1T0HA 1OV3A 4ESRA 1X27A 2CT4A 1K0XA 2RPNA 2DX1A 4LNPA 4CC4B 2RF0A 4D8DA 3A98A 2FRYA 4CC3A 1AWWA 3R6NA 1G83A 2ROTA 2DMOA 4K11A 1RUWA 4AG1C 1TUCA 2LNHB 1JO8A 2AKKA 2H8HA 2DL5A 4JZ4A 2V1RA 1XOVA 3EG3A 4JJCA 2PNIA 2EGCA 3NPFA 2RQVA 1VA7A 2M51A 1BU1A 4AG2C 2ECZA 2CSIA 4J9EA 1QWFA 2SEMA 4RTWA 4X1VA 1AD5A 1PKTA 2FPEA 1GFCA 5I11A 2LJ3A 1MV3A 1KJWA 1PRMC 1RI9A 2CSQA 4DEXA 4Z8AA 4F14A 2BTTA 2J06A 2HSPA 2GGRA 4LUEA 3RNJA 2O9SA 1ABQA 4LE9A 1K0SA 1Z9QA 4RTVA 4JPBW 2CH4W 3UATA 2DNUA 2EYYA 2G6FX 2YUQA 4QT7A 1UE9A 2EYXA 3H0IA 4GBQA 1JU5C 2A08A 1BBZA 2EW3A 3VS3A 1Y57A 1KSWA 2KT8A 2FO0A 1WX6A 2DRKA 2KR3A 3GBQA 1M3CA 1WA7A 1UJ0A 2JT4A 4HVWA 1ZBJA 1Y0MA 4OMOA 2ROLA 2JM9A
chains in the Genus database with same CATH superfamily
2MF2A 3TEEA 4Y28E 1FYNA 3ZL7C 2DJQA 3OS0A 4C0DC 2CP6A 3CCRQ 3EHRA 3OYLA 2F5KA 2CH4A 2FZKB 1B3QA 3M57A 2MWPA 4MMLA 1RAGB 5IXBA 4J83A 3QSUA 3A8GB 4PJNA 1HYOA 2A28A 2FG0A 4OF1A 1AT1B 2KBTA 3OYEA 4VUBA 1UTIA 2CP7A 5GANh 3G6ET 2XI9A 3LYIA 1VQ6T 4E7HA 2RHUA 2YUOA 2GTJA 3TSWA 3CPFA 1M27C 3EGXB 3PFSA 2E64A 2OX7A 1AVZC 2AHJB 2F5TX 2RK1A 2L2PA 5CKEA 1IB8A 5CK9A 4IIOA 4F7UA 2OTJT 4RTZA 4HCBA 1M8VA 3FJ5A 2PQWA 3JCMh 2IPOB 3JB9I 3KXTA 2O01E 1YITA 2E65A 1H92A 2DL7A 3LH5A 3SDZA 2EYWA 1IGUA 1KC8U 3C95A 4OMPA 4DBFA 2CP0A 4F16A 2X9HA 2RI2A 2CZ6B 1U3OA 2ED1A 4BI4A 5LJ5h 4LUDA 1FMKA 5CAIA 3JCMb 1YJ9T 4KRTA 1WFWA 5CKFA 1Q86C 2KK4A 3T9NA 5CKBA 2F69A 5GMKh 1QWEA 4C92F 1MNEA 1Q95G 1S1NA 1YBYA 4M75A 2D0NA 4UC4A 3TVTA 1FMVA 3OW2P 3OYHA 1KQSS 1NJIU 3CD6Q 4HT8A 5HK0A 1UFFA 2ZGWA 1OU9A 1KD1U 3CC4Q 3CPWS 2ZPGB 3JCMc 3CCET 3Q1JA 3ME9A 2HKNA 1HJDA 1WXUA 2F2XA 2WSEE 3RMQA 2QEXA 1QMCA 3CBPA 2DRMA 3QJ6A 3E1SA 1UECA 3VS1A 1G3YA 1W1FA 1PKSA 3CCJA 2D9TA 2BZ8A 2X51A 2DBKA 4F7UB 5GMKl 2XD0A 1NEGA 4IURA 4R0KA 1YP5A 1BYMA 2EYQA 2HZYA 3UA7A 5LJ3g 2ENMA 2L3QA 4M7AC 2C06A 2AZVA 4C92D 3CCSQ 1LVKA 2VGMA 2GCXA 2EQJA 5FRNA 1UDLA 3CCRA 5I2MA 2A0FB 1PM3A 2DYIA 2K3XA 2J6KA 3RKXA 5LJ3e 1PWTA 2L89A 1NZ9A 5GAOr 4CC7A 4XTWA 1VQPQ 4M75B 2JTEA 2QQBA 1MGQA 1G3WA 2I2LA 4FW1A 2QDLA 5A0DA 2DFUA 4FYVB 1TH7A 3CMEQ 4MZTA 2OAUA 4M7DG 5FU6B 1G5VA 4C8QG 3M56A 3QBYA 1OX8A 3QG1A 2Y4XA 4GY5A 1U06A 1M1KR 4ZGEB 1ZSZA 5GAN2 2LZ6B 4ZTFA 1ZUKA 2RK2A 1RACB 2K3BA 2K2MA 5EG2A 3CCUT 4RG2A 3RERA 4O6JA 1MUZA 3MP1A 4BE1A 3UPUA 1Y7XA 4JJDA 1QP3A 2EBPA 3CEYA 2EQUA 3VS2A 1VQ4T 3UF4A 3L2VA 2LCLA 4PJLA 2A7YA 4LDWA 1RABB 4PK4A 4JZ3A 2J7IA 4L5GA 2R5MA 2V26A 3M4YA 4C5HA 1NE8A 2QA4Q 4LN2A 4IUVA 2RB6A 1M5Q1 4RMOA 1K4US 1QCOA 2YRCA 3LWHA 2X4JA 2Y90A 3A8LB 3CD6A 2BZXA 1QCNA 1W6XA 1K1ZA 2LQWA 2KY9A 3CC4A 1UHCA 2RN8A 1YN8A 2LJ1A 3EFSA 5GANj 1YHQQ 4J6XA 2EVRA 4BD3A 4HXJA 2JMAA 1GBQA 4PLLA 4BE2A 4BUGA 1ZSZB 2DXTA 2GNCA 1N8RU 1SSHA 3PMTA 1YFNA 4DOWA 2ZPBB 1H8KA 9ATCB 1YJ9Q 3OS1A 3TCJA 1NM7A 3VS4A 3CBOA 3OQ5A 1VQ5Q 1P92A 3CCMQ 3EG2A 2O31A 4XTVA 1UB4A 2E6NA 5LJ3f 1H3HA 1GCPA 1K73C 2KXCA 3L2UA 2PUOB 2DIQA 4MZMA 5HCKA 2D8HA 2V8IA 4B9XA 3CCQT 4EMHA 4M7AE 5LJ5j 4RTTA 4Q5WA 3OBYA 3BY7A 2YDLA 4FYWB 5GMKj 3RKWA 1U1TA 2X35A 3MEVA 1WJQA 1Q82U 3M9QA 1VQPA 4M77G 1KFZA 5DLQE 2QXFA 4OMQA 3L2ZA 1D3BA 2FZCB 2E4HA 4J7IA 1PG5B 5L8RE 1OYXA 3CMEA 1LNXA 2CUBA 1UGVA 2JNGA 4JDSA 4HKEA 3P8BB 4ESRA 4J8OA 3FLGA 2DX1A 3X28B 4LNPA 4D8DA 1VUBA 2QEXT 2FRYA 4OB3B 4CC3A 2ROTA 4J5YA 3JCMV 4C0FA 1TUCA 2E41A 2H8HA 1W2BA 3AT1B 3CCJT 1WQ7A 2L3RA 1B34A 3RIRA 2RI3A 2DKGA 3NPFA 2F1LA 1U1SA 2PUKB 3DB4A 3QDRB 4GLKA 1Q86R 2LT4A 1MMNA 1QWFA 4X1VA 4F7UF 1AD5A 2FPEA 2EKOA 1VQLQ 1VQ6A 3CCRT 2R58A 4E47A 1OX9A 5CKDA 1Y07A 2HSPA 2GGRA 3SWNA 4OB2B 3RNJA 2QA4A 1ABQA 3OYGA 2XU8A 2QQ9A 4C0GA 2XKOC 4RTVA 3PTAA 4JPBW 2ZCFB 1D3BB 5AYFA 3CCUQ 2EYXA 2LNVA 3CCLT 3OYMA 4XTXA 3EGDA 2OTJA 2EW3A 2GFAA 3F70A 5J26A 3VS3A 1VQ4Q 2X4YA 1YHQA 1WX6A 5CVIA 4EPCA 3OSSC 2JT4A 1EIFA 1PD0A 1XTDA 1ZBJA 3PGGA 4NOYA 4OVAA 2XK0A 3C12A 2ROLA 3CCVT 4M78C 1TUGB 4C92G 4PJOC 1Q81U 2HL3A 4FT2A 4BI8B 1YJ9A 3HPWA 5IH2A 3VRYA 2QYZA 1B34B 1PNJA 1W70A 2K3YA 2OAWA 1VQ5A 4OMLA 3CCMA 1O75A 2R5AA 2AIRB 2V1QA 3JV3A 2ESWA 2VXEA 2QQAA 3RDVA 3MEWA 1RAEB 1OZ2A 1QVFS 1T0JA 4A4FA 2WSCE 3PVQA 1M1GA 2KROA 3LWIA 1X2KA 3THKA 4CC2A 4QQDA 2CT3A 3P8DA 3M0TA 3QJYA 2CGHA 2COYA 2DVJA 1MNDA 3SWNB 5J39A 3M58A 5GAN3 4EMKA 4XTYA 1I07A 5A0LA 1VYTA 2YUPA 1LCKA 2JJ9A 3QZ5B 5I2SA 2OJ2A 3EGDB 3I5SA 2E12A 4QVCA 2ZPHB 3REAB 3I55Q 4PJMA 5GAMf 3CD6T 2LX7A 3I5RA 3CQTA 3CC4T 1M1KC 1D1CA 1VYVA 5I22A 1OULA 2RHIA 3CCQQ 1ZHIA 3OYCA 2PTKA 5EC7A 2JXBA 1MMAA 2MWOA 2CZ7B 5HK3A 2HQHA 3L42A 5CKHA 4CI0C 1VQMQ 1U8RA 1YCYA 2GTOA 3NFCA 1OPKA 1I8FA 4KH1B 2KXDA 2M0YA 5CR2A 3CCST 2RD1A 4C5EA 3OSVA 1VQLA 3UDCA 1D0ZA 1T3LA 3HTRA 1QP2A 4EMKB 3GPLA 2M9UA 1O9SA 2VGNA 4C5IA 3J81E 1YI2T 4LD9K 2D6FA 1SSFA 2FPFA 3QZ9B 2JTMA 2HDAA 1ACMB 3SHWA 2GBQA 3CCUA 1JJ2S 2KAFA 1E6HA 4GLMA 5L23A 2AZSA 1KC8C 1WDXA 1D1BA 1VQ4A 1SHFA 2ABLA 1PSEA 3CMET 2RA2A 5KCOA 4F17A 2YRDA 1QVFA 4FL6A 2HNIA 5GAOl 2WACA 4DBRA 1WXTA 3CMAQ 4FYYB 3NHNA 1K73R 3OB9A 3JB9F 2M16A 2DXUA 1K9MR 3GNGA 3H0FA 3L2WA 1M90U 2ZZDA 2FVUA 1KD1C 1GFDA 3OYYA 2FEIA 2QTVA 1I4K1 1M1FA 2RJEA 4M78E 4PJOE 4EDUA 4XU2A 3CCLQ 4J9DA 2ED0A 3JRZA 2EQKA 1JB0E 2D1XA 1C0MA 2YT6A 4PFPA 4C0DB 4AFZC 5FU7C 5KCHA 1Y71A 3NGPA 5KYWA 3X25B 3EFRA 5GANd 4L59A 4Z89A 3CCVQ 1I81A 1FMWA 2LVMA 1R8OB 2QA4T 3J80E 1YWOA 3M0UA 4RCCA 3JB9D 1AEYA 5FROA 2D8JA 3I55A 4DA4A 1F1BB 1WNLA 2LQNA 2QASA 1LPLA 3BE3A 2MOXA 8AT1B 1QVGP 1VQ9Q 3VU3C 4AT1B 3JCMd 1NPRA 2C0TA 2X4XA 4J9IA 3V7RA 1Q7YR 4ZN3A 1YHQT 2DZ9A 2JMCA 4A54A 3EG1A 4KULA 3OYKA 4XU1A 3CCQA 4N0AC 3ER0A 2LRQA 3QWXX 4FM4B 3FDRA 4AMCA 2L3PA 4KGVB 2GQIA 2H3JA 2HQEA 1MHNA 5LJ5d 4OMMA 2E5KA 4Z88A 1VQMA 3S3NA 1WHKA 1WYXA 4JRQA 3LGFA 1D0XA 3JCMQ 2KQWA 3EHQA 1VQ5T 3CCMT 3OYIA 1JJ2A 3S6WA 2JUFA 1UGRB 3EG9A 2DZCA 4M7AA 2PVGB 1BK2A 5KYWB 2KEAA 1QQJA 5D7UA 2LQ8A 6AT1B 3G71T 2RHYA 1C6VX 1NPPA 1RAIB 3DB3A 3CXCP 4LDVA 2IIMA 4KGXB 2YSQA 3FIFA 5ECAA 5GAMh 1WPYA 1J3TA 4A4GA 3GIBA 4F7UG 4QQGA 3I35A 2M02A 2RHXA 1FX7A 2ATCB 1W4SA 4DEYA 2O2OA 1SKUB 1VIEA 3C4SA 1I1JA 3U23A 2CZ1B 3S3MA 2OTLQ 4RUGA 3CMAA 3I56Q 4IKFA 2LP5A 2DBMA 4WTOB 1OQKA 2QTXA 2COZA 4XTUA 1M3AA 2RQWA 1M3BA 4FU6A 1A0NB 1IO6A 4M75C 4D8KA 1YI2Q 1IRXA 2VC8A 2VKNA 4QVDA 2KI7A 2COWA 2DM1A 3X24B 4M75G 2A36A 3GP8A 3VKIA 3CCLA 3EG9B 2EJGA 5D6WA 4M7AB 3WVEB 2HBPA 4IUUA 1RADB 2PVOB 4M7DC 2KRSA 3VJPA 3H9NA 3M0SA 1N8RC 2P4RA 4NL2A 4DOVA 3RMSA 4C8QC 1WI7A 2K5FA 3M0RA 1VQLT 1PRLC 2J6OA 2AK5A 3CCVA 3VUBA 2B86A 2JN0A 5GAN7 4KH0B 4ZN1A 2LJ0A 1OI1A 1X27A 2KSSA 2LDMA 3JSCA 2JTFA 3QXEB 2RF0A 4CC4B 5GAN8 3CC7Q 2G3RA 4MZPA 1VQ9A 2LC4A 1M2OA 2MK5A 1RUWA 2E3IA 3EH1A 1KQSA 3M4GA 3A1PA 2DL5A 2V1RA 2PNIA 1VA7A 4E7KA 5CO7A 2BKDN 4C5GA 3CPWA 4AG2C 3A8OB 2NYSA 1MMGA 3OS5A 2SEMA 1N9RA 1M4ZA 1PKTA 1HK9A 4DBHA 4E7SA 1YJNQ 1EX4A 1OZ3A 5GAOq 1PRMC 4Z8AA 2J06A 3OBWA 4LUEA 2CKKA 3PIPA 2KMTA 1K0SA 5GANg 5GAN5 1Z9QA 2HSEB 1KC8R 3H6ZA 2YUQA 1UE9A 1BBZA 4HCCA 3OA6A 1RAAB 2L5QA 1V76A 5GANe 2KR3A 3GBQA 1M3CA 1VQOQ 3J7AF 3JCMg 5GAN6 1WHLA 4A53A 3TREA 2JM9A 1NJIR 4ELYC 1K8AU 3KUFA 2EQIA 1X75C 1UHFA 4P5NA 3I55T 3OS2A 2KDSA 2EJFA 1KD1R 3CCSA 2OTLA 5CCAA 3I56A 4V2SA 1K9MC 2YLCA 5LJ5g 3JCMe 1NBEB 1V1CA 1X6OA 3G71Q 3QDFA 3I9QA 1YI2A 5IHIA 2YHTA 2VVKA 4KUDK 4M77C 4AFSC 1VIFA 1G3TA 2NLUA 1VQMT 4QW2A 5LJ5e 2VB6A 3MP8A 4J9BA 5FLXE 2DL4A 5KYUA 3EG0A 4X34A 2NUZA 5GMKe 1CKAA 3JB9G 1R0BG 2J6FA 4N4HA 2X3WD 2DXBA 4TVRA 2X3XD 4KUIA 2RQTA 2QI2A 4BB7A 3JAME 4M7DE 1EZZB 2K79A 3GOXA 1V29B 1QCFA 4C8QE 3NTIA 5GAMj 5GAOm 3O5ZA 2DLPA 5FW9A 2DE0X 1KG1A 1TTHB 2DD5A 3CC7A 2BIVA 1Q7YC 4BDYA 1PHTA 2HBWA 3R6OA 2FRWA 2DIGA 4MDXA 1JXOA 4YTLA 1QKWA 4ZGDB 5FWBA 2RNAA 5C6SA 4II1A 2OI3A 2VYTA 4FT4A 2JZ2A 3RUXA 1NYFA 4RTYA 1WIEA 2IG0A 3CMAT 2DXCA 1TSFA 1GCQC 2AT1B 4HT9A 4M78A 4PJOA 3JCMP 1YJNA 2EGEA 2VUBA 3EGUA 3MEUA 4JJBA 1RLPC 1XQHA 3O8VA 1WJRA 3M59A 2DEQA 4JS5A 1RI0A 3SEMA 4L6V5 5KYUB 4DQ2A 2PZ1A 4E2FB 1VQ8Q 2EYZA 1TUDA 3HP9A 4D6WA 2M0OA 4JRIA 5J3BA 1OPLA 4PL6A 1AOJA 1X2QA 4M7AF 2GFUA 4FW2A 1WHMA 3FJPA 3GNFB 1M8MA 7AT1B 4ME7A 4C92C 4HCKA 2FPDA 4FSSA 3OW2S 1ZLMA 1KHIA 3X26B 1GRIA 3M0QA 3WVDB 2H3EB 4E7IA 3EH2A 1KHCA 2KT1A 3A5ZB 2QAZA 1KQ2A 1VQ9T 3CC2Q 3SB2A 3CXCS 3G71A 2GF7A 5AT1B 4M78B 1PC0A 4PJOB 3AHUA 4PKCC 1N8RR 2YUNA 5LJ5f 4M7AD 1AHJB 2YXYA 2JW4A 1E6GA 2XDDA 1CSKA 4BE0A 2HKQB 3VS7A 2CYZB 3ZFJA 2FB7A 4XK8E 2DA9A 1XJWB 1WHJA 2QQRA 4M77E 3PT9A 2NUPA 3BDUA 1IREB 2CDTA 5GMKm 1Y96A 3OYFA 2W10A 1M90C 2RM4A 3NTKA 2KNBB 3MO8A 4FSXA 2D0QB 1MMDA 2XMFA 4M7DD 4A4HA 1W2BP 1Q82R 1ARKA 4C8QD 3MEAA 1TS9A 5HY6A 5GAN4 4J6YA 4JRPA 2QK0A 1NLOC 2RJCA 4ORZA 2QDYB 5LJ3h 2L3SA 1YCSB 2A37A 3QYHB 4Y91A 2QGFB 3SFMA 1VQKQ 3OYDA 3PMIA 1KQ1A 4OMFB 3NMZC 1IZ6A 4OB0B 3RBBB 1G8XA 1PSFA 2CP2A 2OTLT 2KYBA 2EAYA 2LMJA 3HHTB 3I56T 2ZPEB 4OP0A 4MMKA 4FIBA 1X43A 2JS2A 4JUVA 4J9CA 3PVLA 3VS5A 2C0OA 2EPDA 3V7SA 5IN1A 4PLIA 4ZNXA 5GJVB 2L0AA 3LGLA 4BY6C 2VASA 1K76A 4X9DA 5M9OA 1EFNA 3OW2A 3HRSA 2KE9A 3MPUB 2NUPB 3M53A 1R77A 4AFQC 1UGQB 1UGPB 1Y96B 1JXMA 2F2WA 2VXFA 3OMGA 3VUZA 2XG8D 1N6AA 4KT0E 2E10A 3NTHA 2K2VA 4J9FA 4JS4A 1S72T 4B6MA 5IHNA 3A8MB 3FB9A 3TQ7P 1JEGA 3MCAB 1NJIC 1HSQA 4RKUE 4R56A 4C92E 1ZUYA 2O4XA 3IQLA 4M77F 3G4SQ 2IVWA 2XDBA 3ASKA 1ZA2B 3CC7T 2DL3A 4XQ3A 4A63B 4O5VA 3CC2A 4A4EA 4XTZA 1X6BA 3FEOA 2M1HA 2HL5C 4BACA 1QW1A 2W0ZA 4LDYA 1GBRA 2Z0WA 4N0AA 2P0PA 1K9AA 1WLPB 1M1KU 1Q81R 3E19A 5GAOp 2CREA 1TG0A 2QG9B 3DLMA 3G7ZA 1JQQA 1AWXA 3PE0A 2HAXA 4OGEA 1YJNT 5I21A 3L1AA 1N5ZA 2MYSA 4M4ZA 1ABOA 1VQ7Q 3RKYA 1VOMA 4M77D 1D1AA 4ZTJA 1T0HA 1TXQA 5FU7B 2CT4A 3OMCA 1K0XA 2RPNA 2K4YA 3FRNA 1YIJQ 1AWWA 1G83A 3BDLA 2DMOA 2CS7A 4K11A 4N4IA 5KYYA 2LNHB 1H641 2AKKA 2CP3A 4XAXB 2O4XB 4JZ4A 1XOVA 4JJCA 4RG8A 1YJWQ 1VQOT 2RQVA 2CSIA 1VQKA 3FC3A 1LOJA 3H8ZA 2L8DA 2YRVA 2Y4YA 2EWNA 3L2RA 2LJ3A 1VQNQ 2CSQA 4LXCA 4F14A 3D7SB 5C0MA 3LLRA 3SD4A 2O9SA 2P4TA 4PFZA 2DJZA 2K5LA 4LE9A 4XU3A 1TU0B 3HFOA 3JCMJ 1WQWA 1I5LA 3ZEHA 2CH4W 4M78F 2EYYA 3UATA 4PJOF 2G6FX 2DTOA 1N27A 3N5BB 5DLOA 2A08A 5GAMd 1BI0A 1BI2A 1PCXA 4IUTA 3V8LA 1KSWA 3LW5E 2RJDA 2FO0A 3HKSA 3OYAA 1QVFP 4M7DA 4QVZA 4BDZA 1WA7A 1UJ0A 1BKBA 3JB9J 4C8QA 1DJ7B 4OMOA 3MKDA 1Z9ZA 2MAMA 4IIMA 5KYYB 2KRMA 2HCKA 2P84A 1BCMA 1MV0B 3OYJA 3ZBDA 3EFOA 4J9HA 3TSZA 3G4SA 2JOYA 1ZBXA 4R55A 5LJ3j 2LQKA 3A8HB 2KYMA 4BI3A 1LJOA 2LTOA 1JRIA 4M7AG 1NYGA 4M78D 4PJOD 4E6RA 2MIOA 3HFNA 1OU8A 1ZQ1A 5GMKi 5FU6C 4E7JA 4IUQA 3QHSA 2K7AA 2DL8A 2X4WA 3G1JA 1GL5A 2K57A 2CUDA 4EMGA 3OY9A 4DBQA 3QWYA 1B7TA 1S72Q 1H3ZA 1K8AC 3C94A 2K5IA 4ELZC 1M90R 3KBGA 3EAEA 5FWCA 4FYXB 1NLPC 4J7FA 2JS0A 2MCNA 5HKCA 1Q86U 1VQ7A 1D0YA 1T3SA 4M7DB 2MI6A 1CKBA 1VQ8T 1KIKA 3LH0A 4C8QB 2LX9A 5D6XA 2LT1A 1AWJA 2KGTA 1YIJA 3UWNA 1BB9A 1Q82C 2HMAA 4Z02A 1UGSB 5GAOn 1SG5A 1D09B 3VV0A 4JLIA 3EFOB 1IGQA 1YJWA 2E5QA 2EQMA 2RMOA 3M0PA 1JJ2P 5IXFA 2K9GA 1HD3A 2DK3A 1AZGB 1QKXA 2I0NA 2EIFA 1G2BA 4ANJA 4A4KA 3QO3A 4AFUC 4J6WA 8ATCB 3G6EQ 1KK7A 3TU4K 2FHDA 3CC2T 1VQ6Q 3REBB 1VQNA 1BCOA 1XNIA 2BE9B 4J9GA 1W2BS 1ZUUA 2RHZA 1ZSZC 4XU0A 2DF6A 2FL7A 3QIIA 2DTHA 5CIUA 4M77A 2FZGB 2OTJQ 1YNZA 4EIKA 1OEBA 4PJJA 2DERA 1WHGA 3E9FA 1QLYA 4RTUA 4F04B 1WXBA 4OMNA 5A0GA 2XIDA 1C1AA 4F7UE 4LD6A 3QUIA 2O88A 2BZYA 4OB1B 1TWBA 4FCYA 3URGA 3VS6A 3C0CA 3HRUA 1UJYA 2EJ9A 2ZPFB 3H0HA 2AKLA 2DAQA 2K6DA 1M30A 2MPXC 5KH6A 2DTIA 1WJSA 4HVUA 3PNWC 1X69A 1IHVA 1RAHB 5KE3A 5IHKA 3MHXA 4CRIA 3DLLA 2RO0A 1YITT 1SHGA 3MP6A 1VYUA 2P0QA 2EKHA 2RI5A 4M75E 4HCZA 1VQKT 3CCEQ 4HVVA 4C0ZA 4HA8A 2RJFA 2ZPIB 2DPPB 1Q81C 5KYXA 1SRLA 1AZEA 4B9WA 2PVDB 3GF5A 2LCCA 1S72A 1GCQA 1I5OB 3CBMA 5IT9E 3E2UA 3H41A 2V8KA 5GAMg 3P8HA 4M77B 1YWPA 1WHHA 3MJXA 1UG1A 4KGZB 4LDXA 2RQUA 3OYBA 2EGAA 1HXDA 3KFVA 4OGCA 3V8KA 3QKJA 3X20B 1KQSP 3JCMW 3V8JA 2JM8A 4ZGJB 2O9VA 5GAMe 1RAFB 1ZSGA 1N9SA 2QQSA 1SF9A 1SRMA 2VWFA 2SRCA 1TOVA 1R0CB 1SPKA 3HRTA 3CPWP 5KE2A 2DD4A 4NL3A 2RQRA 2GQVA 4C92A 1ZX6A 1U5SA 3V7CA 3VS0A 1IXDA 3ULRB 5LL6S 1ZA1B 2DO3A 2C0IA 1M2VA 3VYGA 3G4ST 5KYNA 1QVGS 4N4GA 3VRZA 2E6ZA 3UA6A 1G3SA 2CP5A 2CZ0B 3G6EA 1RLQC 1X6GA 2LCSA 5KYXB 3OYNA 4Y92A 2XICA 1FXXA 2NUTA 1K73U 5GANf 1K9MU 4NS5A 2MMPA 2DVEA 3INZA 2V8JA 1BIBA 4PNOA 4E7LA 2B8AA 1AWOA 1E7OA 1VQOA 4RTXA 2KRNA 4M75F 3HL8A 2YWWA 2P0KA 2HEQA 4E7ZA 1BI3A 2A3LA 1VQ7T 3BW1A 3JCMf 1X01A 5FRMA 4MDWA 1NG2A 2WSFE 3SWNC 4C92B 2DYBA 4M7DF 4X9CA 1YIJT 5GJWB 1SEMA 4M78G 2E1HA 4RCBA 4PJOG 4C8QF 1GXIE 1NEBA 1QVPA 2HD0A 1UUEA 3WXMB 2J05A 2DILA 1M2VB 5D6YA 1B07A 1YJWT 3S3OA 2YLBA 1K8AR 3DKMA 3LX7A 2HQXA 1I0CA 2FYKA 3CCEA 1Q7YU 2XHCA 3GLXA 5IAYA 4M75D 2F2VA 2NWMA 4WF2A 1WGSA 2XDPA 2ZAEA 2BE7D 2NUTB 1VQNT 1OOTA 4WCIA 4PFOA 2DEUA 1JBMA 2EFIA 1OV3A 2JVVA 1IHWA 2QGGA 2KVQG 3A98A 1BI1A 5DY9A 3R6NA 4ATOA 1UEBA 1M9SA 5LJ3d 4AG1C 1YITQ 1QVGA 3BFMA 4JRKA 1JO8A 3RESA 3RR6A 3EG3A 2EGCA 2M51A 1BU1A 5CQYA 1BIAA 4EMKC 2ECZA 4J9EA 4LDUA 3QPHA 4RTWA 1WZOA 5A2QE 5CQXA 1GFCA 3META 3JB9H 3JCMX 5I11A 1MV3A 1KJWA 1RI9A 4IUPA 4DEXA 2E3HA 3M54A 2E70A 2BTTA 3QYGB 3UT1A 3VYHB 3M55A 1VQ8A 1PD1A 4QKUA 2R57A 2PU9B 2DNUA 4QT7A 4KBMB 3H0IA 4GBQA 2QEXQ 2VV5A 1JU5C 5DM7R 4JLGA 3E9GA 4JJNK 2DETA 1Y57A 2BUDA 3M5AA 2KT8A 3PIOA 1VQPT 2DRKA 4QQ6A 3CXCA 3CCJQ 3EGXA 3HSBA 3L2QA 4HVWA 4BY6B 1FWZA 1Y0MA 2RH2A 1RL2A
chains in the Genus database with same CATH topology
1Z9ZA 2EQIA 1UHFA 1FYNA 4IIMA 2KRMA 3ZL7C 2DJQA 2HCKA 5IH2A 3VRYA 1MV0B 1PNJA 1W70A 2OAWA 4OMLA 4J9HA 3EHRA 3TSZA 2CH4A 2KYMA 2V1QA 1V1CA 2ESWA 3JV3A 1B3QA 3I9QA 1NYGA 5IHIA 1T0JA 5IXBA 2VVKA 3PVQA 4E6RA 2MIOA 2KROA 4AFSC 1X2KA 3THKA 4CC2A 2CT3A 2A28A 2K7AA 2DL8A 3M0TA 2FG0A 2DVJA 1GL5A 2CUDA 4J9BA 3QWYA 2DL4A 3EG0A 1I07A 2KBTA 1VYTA 2NUZA 2YUPA 1LCKA 5FWCA 1CKAA 1UTIA 2OJ2A 1NLPC 2J6FA 3I5SA 2JS0A 2X3WD 3REAB 2X3XD 2YUOA 2RQTA 2GTJA 2MCNA 3TSWA 2LX7A 1M27C 2K79A 1T3SA 1QCFA 3I5RA 1CKBA 3CQTA 1AVZC 1KIKA 3O5ZA 2L2PA 2DLPA 5FW9A 2DE0X 1VYVA 4IIOA 1AWJA 2KGTA 4RTZA 5I22A 3FJ5A 1BB9A 1PHTA 2HBWA 2FRWA 2PTKA 1JXOA 1QKWA 5EC7A 2JXBA 5FWBA 1H92A 2DL7A 3LH5A 2RNAA 2EYWA 4OMPA 2OI3A 2GTOA 2RMOA 3M0PA 4F16A 1OPKA 1NYFA 5IXFA 4RTYA 1WIEA 1HD3A 2K9GA 1U3OA 2ED1A 1GCQC 4LUDA 2KXDA 1FMKA 1AZGB 4KRTA 2M0YA 1QKXA 1WFWA 2I0NA 1G2BA 4AFUC 1QWEA 2EGEA 3EGUA 4JJBA 1RLPC 3REBB 1S1NA 2D0NA 3TVTA 1T3LA 4J9GA 1ZUUA 3SEMA 1UFFA 2PZ1A 2FPFA 2EYZA 2HDAA 2DF6A 1TUDA 3SHWA 2GBQA 1OPLA 1HJDA 1AOJA 1WXUA 1X2QA 2F2XA 1E6HA 4GLMA 5L23A 1YNZA 2AZSA 1OEBA 4EIKA 1M8MA 2DRMA 1WDXA 1QLYA 1UECA 3VS1A 4RTUA 1WXBA 1SHFA 4OMNA 2ABLA 1W1FA 1PKSA 4HCKA 2FPDA 4F17A 2BZ8A 4FSSA 2DBKA 1ZLMA 1NEGA 4R0KA 1YP5A 2O88A 3UA7A 1WXTA 2BZYA 1GRIA 2ENMA 3M0QA 2L3QA 3VS6A 3NHNA 3C0CA 2AZVA 1UJYA 2KT1A 3H0HA 3H0FA 2AKLA 2K6DA 1M30A 4HVUA 1X69A 1UDLA 1GFDA 2FEIA 5IHKA 2J6KA 1PWTA 4J9DA 2ED0A 2YUNA 1SHGA 2D1XA 2JW4A 1VYUA 4CC7A 2EKHA 1E6GA 2YT6A 4HVVA 4AFZC 2JTEA 1CSKA 3NGPA 1AZEA 1SRLA 3VS7A 2QDLA 4Z89A 2DA9A 1GCQA 3H41A 1YWOA 3M0UA 2CDTA 1YWPA 1AEYA 2W10A 1UG1A 2D8JA 2KNBB 2RQUA 2EGAA 3KFVA 1U06A 2LQNA 2MOXA 2XMFA 2LZ6B 2C0TA 4J9IA 1ZUKA 2JM8A 1ARKA 2K3BA 2O9VA 2K2MA 1ZSGA 2VWFA 1SRMA 2SRCA 2JMCA 3EG1A 1SPKA 1MUZA 1NLOC 4JJDA 4ORZA 2EBPA 2RQRA 3QWXX 2L3SA 1YCSB 2A37A 3VS2A 1ZX6A 2L3PA 1U5SA 3VS0A 3UF4A 2GQIA 3ULRB 4OMMA 2E5KA 4Z88A 4JZ3A 2J7IA 3NMZC 3RBBB 1WYXA 2KYBA 2C0IA 3EHQA 2LMJA 1X43A 2JS2A 3VRZA 3UA6A 4LN2A 4J9CA 3PVLA 1BK2A 3VS5A 1RLQC 1X6GA 2C0OA 2EPDA 2LCSA 2KEAA 4ZNXA 4Y92A 5GJVB 2L0AA 1K4US 1K76A 2BZXA 1EFNA 1W6XA 1K1ZA 2LQWA 2KE9A 1UHCA 4AFQC 2RN8A 2IIMA 1YN8A 2LJ1A 2YSQA 2EVRA 5ECAA 1JXMA 1J3TA 2F2WA 4HXJA 2JMAA 1GBQA 3I35A 1AWOA 1E7OA 4RTXA 2KRNA 4J9FA 2GNCA 4DEYA 1SSHA 5IHNA 2HEQA 2O2OA 1H8KA 1I1JA 1JEGA 3U23A 1NM7A 1HSQA 3VS4A 4RUGA 1ZUYA 3IQLA 1NG2A 2LP5A 2DBMA 3EG2A 2DYBA 2O31A 2DL3A 5GJWB 1SEMA 1M3AA 1H3HA 2RQWA 1GCPA 1M3BA 1A0NB 1IO6A 4A63B 4D8KA 1NEBA 2KXCA 1UUEA 2VKNA 1X6BA 2J05A 5HCKA 2DILA 2DM1A 2D8HA 2A36A 2W0ZA 1B07A 4RTTA 1GBRA 1K9AA 1WLPB 1I0CA 2YDLA 2CREA 1TG0A 2KRSA 3M0SA 1JQQA 2P4RA 1AWXA 3PE0A 2F2VA 2NWMA 1WI7A 1KFZA 3M0RA 4OMQA 1N5ZA 1PRLC 2J6OA 2AK5A 1OOTA 4WCIA 4M4ZA 1ABOA 2CUBA 1UGVA 2B86A 2LJ0A 1T0HA 1OV3A 4ESRA 1X27A 2CT4A 1K0XA 2RPNA 2DX1A 4LNPA 4CC4B 2RF0A 4D8DA 3A98A 2FRYA 4CC3A 1AWWA 3R6NA 1G83A 2ROTA 2DMOA 4K11A 1RUWA 4AG1C 1TUCA 2LNHB 1JO8A 2AKKA 2H8HA 2DL5A 4JZ4A 2V1RA 1XOVA 3EG3A 4JJCA 2PNIA 2EGCA 3NPFA 2RQVA 1VA7A 2M51A 1BU1A 4AG2C 2ECZA 2CSIA 4J9EA 1QWFA 2SEMA 4RTWA 4X1VA 1AD5A 1PKTA 2FPEA 1GFCA 5I11A 2LJ3A 1MV3A 1KJWA 1PRMC 1RI9A 2CSQA 4DEXA 4Z8AA 4F14A 2BTTA 2J06A 2HSPA 2GGRA 4LUEA 3RNJA 2O9SA 1ABQA 4LE9A 1K0SA 1Z9QA 4RTVA 4JPBW 2CH4W 3UATA 2DNUA 2EYYA 2G6FX 2YUQA 4QT7A 1UE9A 2EYXA 3H0IA 4GBQA 1JU5C 2A08A 1BBZA 2EW3A 3VS3A 1Y57A 1KSWA 2KT8A 2FO0A 1WX6A 2DRKA 2KR3A 3GBQA 1M3CA 1WA7A 1UJ0A 2JT4A 4HVWA 1ZBJA 1Y0MA 4OMOA 2ROLA 2JM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9Z A;  2EQI A;  1UHF A;  1FYN A;  4IIM A;  2KRM A;  3ZL7 C;  2DJQ A;  2HCK A;  5IH2 A;  3VRY A;  1MV0 B;  1PNJ A;  1W70 A;  2OAW A;  4OML A;  4J9H A;  3EHR A;  3TSZ A;  2CH4 A;  2KYM A;  2V1Q A;  1V1C A;  2ESW A;  3JV3 A;  1B3Q A;  3I9Q A;  1NYG A;  5IHI A;  1T0J A;  5IXB A;  2VVK A;  3PVQ A;  4E6R A;  2MIO A;  2KRO A;  4AFS C;  1X2K A;  3THK A;  4CC2 A;  2CT3 A;  2A28 A;  2K7A A;  2DL8 A;  3M0T A;  2FG0 A;  2DVJ A;  1GL5 A;  2CUD A;  4J9B A;  3QWY A;  2DL4 A;  3EG0 A;  1I07 A;  2KBT A;  1VYT A;  2NUZ A;  2YUP A;  1LCK A;  5FWC A;  1CKA A;  1UTI A;  2OJ2 A;  1NLP C;  2J6F A;  3I5S A;  2JS0 A;  2X3W D;  3REA B;  2X3X D;  2YUO A;  2RQT A;  2GTJ A;  2MCN A;  3TSW A;  2LX7 A;  1M27 C;  2K79 A;  1T3S A;  1QCF A;  3I5R A;  1CKB A;  3CQT A;  1AVZ C;  1KIK A;  3O5Z A;  2L2P A;  2DLP A;  5FW9 A;  2DE0 X;  1VYV A;  4IIO A;  1AWJ A;  2KGT A;  4RTZ A;  5I22 A;  3FJ5 A;  1BB9 A;  1PHT A;  2HBW A;  2FRW A;  2PTK A;  1JXO A;  1QKW A;  5EC7 A;  2JXB A;  5FWB A;  1H92 A;  2DL7 A;  3LH5 A;  2RNA A;  2EYW A;  4OMP A;  2OI3 A;  2GTO A;  2RMO A;  3M0P A;  4F16 A;  1OPK A;  1NYF A;  5IXF A;  4RTY A;  1WIE A;  1HD3 A;  2K9G A;  1U3O A;  2ED1 A;  1GCQ C;  4LUD A;  2KXD A;  1FMK A;  1AZG B;  4KRT A;  2M0Y A;  1QKX A;  1WFW A;  2I0N A;  1G2B A;  4AFU C;  1QWE A;  2EGE A;  3EGU A;  4JJB A;  1RLP C;  3REB B;  1S1N A;  2D0N A;  3TVT A;  1T3L A;  4J9G A;  1ZUU A;  3SEM A;  1UFF A;  2PZ1 A;  2FPF A;  2EYZ A;  2HDA A;  2DF6 A;  1TUD A;  3SHW A;  2GBQ A;  1OPL A;  1HJD A;  1AOJ A;  1WXU A;  1X2Q A;  2F2X A;  1E6H A;  4GLM A;  5L23 A;  1YNZ A;  2AZS A;  1OEB A;  4EIK A;  1M8M A;  2DRM A;  1WDX A;  1QLY A;  1UEC A;  3VS1 A;  4RTU A;  1WXB A;  1SHF A;  4OMN A;  2ABL A;  1W1F A;  1PKS A;  4HCK A;  2FPD A;  4F17 A;  2BZ8 A;  4FSS A;  2DBK A;  1ZLM A;  1NEG A;  4R0K A;  1YP5 A;  2O88 A;  3UA7 A;  1WXT A;  2BZY A;  1GRI A;  2ENM A;  3M0Q A;  2L3Q A;  3VS6 A;  3NHN A;  3C0C A;  2AZV A;  1UJY A;  2KT1 A;  3H0H A;  3H0F A;  2AKL A;  2K6D A;  1M30 A;  4HVU A;  1X69 A;  1UDL A;  1GFD A;  2FEI A;  5IHK A;  2J6K A;  1PWT A;  4J9D A;  2ED0 A;  2YUN A;  1SHG A;  2D1X A;  2JW4 A;  1VYU A;  4CC7 A;  2EKH A;  1E6G A;  2YT6 A;  4HVV A;  4AFZ C;  2JTE A;  1CSK A;  3NGP A;  1AZE A;  1SRL A;  3VS7 A;  2QDL A;  4Z89 A;  2DA9 A;  1GCQ A;  3H41 A;  1YWO A;  3M0U A;  2CDT A;  1YWP A;  1AEY A;  2W10 A;  1UG1 A;  2D8J A;  2KNB B;  2RQU A;  2EGA A;  3KFV A;  1U06 A;  2LQN A;  2MOX A;  2XMF A;  2LZ6 B;  2C0T A;  4J9I A;  1ZUK A;  2JM8 A;  1ARK A;  2K3B A;  2O9V A;  2K2M A;  1ZSG A;  2VWF A;  1SRM A;  2SRC A;  2JMC A;  3EG1 A;  1SPK A;  1MUZ A;  1NLO C;  4JJD A;  4ORZ A;  2EBP A;  2RQR A;  3QWX X;  2L3S A;  1YCS B;  2A37 A;  3VS2 A;  1ZX6 A;  2L3P A;  1U5S A;  3VS0 A;  3UF4 A;  2GQI A;  3ULR B;  4OMM A;  2E5K A;  4Z88 A;  4JZ3 A;  2J7I A;  3NMZ C;  3RBB B;  1WYX A;  2KYB A;  2C0I A;  3EHQ A;  2LMJ A;  1X43 A;  2JS2 A;  3VRZ A;  3UA6 A;  4LN2 A;  4J9C A;  3PVL A;  1BK2 A;  3VS5 A;  1RLQ C;  1X6G A;  2C0O A;  2EPD A;  2LCS A;  2KEA A;  4ZNX A;  4Y92 A;  5GJV B;  2L0A A;  1K4U S;  1K76 A;  2BZX A;  1EFN A;  1W6X A;  1K1Z A;  2LQW A;  2KE9 A;  1UHC A;  4AFQ C;  2RN8 A;  2IIM A;  1YN8 A;  2LJ1 A;  2YSQ A;  2EVR A;  5ECA A;  1JXM A;  1J3T A;  2F2W A;  4HXJ A;  2JMA A;  1GBQ A;  3I35 A;  1AWO A;  1E7O A;  4RTX A;  2KRN A;  4J9F A;  2GNC A;  4DEY A;  1SSH A;  5IHN A;  2HEQ A;  2O2O A;  1H8K A;  1I1J A;  1JEG A;  3U23 A;  1NM7 A;  1HSQ A;  3VS4 A;  4RUG A;  1ZUY A;  3IQL A;  1NG2 A;  2LP5 A;  2DBM A;  3EG2 A;  2DYB A;  2O31 A;  2DL3 A;  5GJW B;  1SEM A;  1M3A A;  1H3H A;  2RQW A;  1GCP A;  1M3B A;  1A0N B;  1IO6 A;  4A63 B;  4D8K A;  1NEB A;  2KXC A;  1UUE A;  2VKN A;  1X6B A;  2J05 A;  5HCK A;  2DIL A;  2DM1 A;  2D8H A;  2A36 A;  2W0Z A;  1B07 A;  4RTT A;  1GBR A;  1K9A A;  1WLP B;  1I0C A;  2YDL A;  2CRE A;  1TG0 A;  2KRS A;  3M0S A;  1JQQ A;  2P4R A;  1AWX A;  3PE0 A;  2F2V A;  2NWM A;  1WI7 A;  1KFZ A;  3M0R A;  4OMQ A;  1N5Z A;  1PRL C;  2J6O A;  2AK5 A;  1OOT A;  4WCI A;  4M4Z A;  1ABO A;  2CUB A;  1UGV A;  2B86 A;  2LJ0 A;  1T0H A;  1OV3 A;  4ESR A;  1X27 A;  2CT4 A;  1K0X A;  2RPN A;  2DX1 A;  4LNP A;  4CC4 B;  2RF0 A;  4D8D A;  3A98 A;  2FRY A;  4CC3 A;  1AWW A;  3R6N A;  1G83 A;  2ROT A;  2DMO A;  4K11 A;  1RUW A;  4AG1 C;  1TUC A;  2LNH B;  1JO8 A;  2AKK A;  2H8H A;  2DL5 A;  4JZ4 A;  2V1R A;  1XOV A;  3EG3 A;  4JJC A;  2PNI A;  2EGC A;  3NPF A;  2RQV A;  1VA7 A;  2M51 A;  1BU1 A;  4AG2 C;  2ECZ A;  2CSI A;  4J9E A;  1QWF A;  2SEM A;  4RTW A;  4X1V A;  1AD5 A;  1PKT A;  2FPE A;  1GFC A;  5I11 A;  2LJ3 A;  1MV3 A;  1KJW A;  1PRM C;  1RI9 A;  2CSQ A;  4DEX A;  4Z8A A;  4F14 A;  2BTT A;  2J06 A;  2HSP A;  2GGR A;  4LUE A;  3RNJ A;  2O9S A;  1ABQ A;  4LE9 A;  1K0S A;  1Z9Q A;  4RTV A;  4JPB W;  2CH4 W;  3UAT A;  2DNU A;  2EYY A;  2G6F X;  2YUQ A;  4QT7 A;  1UE9 A;  2EYX A;  3H0I A;  4GBQ A;  1JU5 C;  2A08 A;  1BBZ A;  2EW3 A;  3VS3 A;  1Y57 A;  1KSW A;  2KT8 A;  2FO0 A;  1WX6 A;  2DRK A;  2KR3 A;  3GBQ A;  1M3C A;  1WA7 A;  1UJ0 A;  2JT4 A;  4HVW A;  1ZBJ A;  1Y0M A;  4OMO A;  2ROL A;  2JM9 A; 
#chains in the Genus database with same CATH topology
 2MF2 A;  3TEE A;  4Y28 E;  1FYN A;  3ZL7 C;  2DJQ A;  3OS0 A;  4C0D C;  2CP6 A;  3CCR Q;  3EHR A;  3OYL A;  2F5K A;  2CH4 A;  2FZK B;  1B3Q A;  3M57 A;  2MWP A;  4MML A;  1RAG B;  5IXB A;  4J83 A;  3QSU A;  3A8G B;  4PJN A;  1HYO A;  2A28 A;  2FG0 A;  4OF1 A;  1AT1 B;  2KBT A;  3OYE A;  4VUB A;  1UTI A;  2CP7 A;  5GAN h;  3G6E T;  2XI9 A;  3LYI A;  1VQ6 T;  4E7H A;  2RHU A;  2YUO A;  2GTJ A;  3TSW A;  3CPF A;  1M27 C;  3EGX B;  3PFS A;  2E64 A;  2OX7 A;  1AVZ C;  2AHJ B;  2F5T X;  2RK1 A;  2L2P A;  5CKE A;  1IB8 A;  5CK9 A;  4IIO A;  4F7U A;  2OTJ T;  4RTZ A;  4HCB A;  1M8V A;  3FJ5 A;  2PQW A;  3JCM h;  2IPO B;  3JB9 I;  3KXT A;  2O01 E;  1YIT A;  2E65 A;  1H92 A;  2DL7 A;  3LH5 A;  3SDZ A;  2EYW A;  1IGU A;  1KC8 U;  3C95 A;  4OMP A;  4DBF A;  2CP0 A;  4F16 A;  2X9H A;  2RI2 A;  2CZ6 B;  1U3O A;  2ED1 A;  4BI4 A;  5LJ5 h;  4LUD A;  1FMK A;  5CAI A;  3JCM b;  1YJ9 T;  4KRT A;  1WFW A;  5CKF A;  1Q86 C;  2KK4 A;  3T9N A;  5CKB A;  2F69 A;  5GMK h;  1QWE A;  4C92 F;  1MNE A;  1Q95 G;  1S1N A;  1YBY A;  4M75 A;  2D0N A;  4UC4 A;  3TVT A;  1FMV A;  3OW2 P;  3OYH A;  1KQS S;  1NJI U;  3CD6 Q;  4HT8 A;  5HK0 A;  1UFF A;  2ZGW A;  1OU9 A;  1KD1 U;  3CC4 Q;  3CPW S;  2ZPG B;  3JCM c;  3CCE T;  3Q1J A;  3ME9 A;  2HKN A;  1HJD A;  1WXU A;  2F2X A;  2WSE E;  3RMQ A;  2QEX A;  1QMC A;  3CBP A;  2DRM A;  3QJ6 A;  3E1S A;  1UEC A;  3VS1 A;  1G3Y A;  1W1F A;  1PKS A;  3CCJ A;  2D9T A;  2BZ8 A;  2X51 A;  2DBK A;  4F7U B;  5GMK l;  2XD0 A;  1NEG A;  4IUR A;  4R0K A;  1YP5 A;  1BYM A;  2EYQ A;  2HZY A;  3UA7 A;  5LJ3 g;  2ENM A;  2L3Q A;  4M7A C;  2C06 A;  2AZV A;  4C92 D;  3CCS Q;  1LVK A;  2VGM A;  2GCX A;  2EQJ A;  5FRN A;  1UDL A;  3CCR A;  5I2M A;  2A0F B;  1PM3 A;  2DYI A;  2K3X A;  2J6K A;  3RKX A;  5LJ3 e;  1PWT A;  2L89 A;  1NZ9 A;  5GAO r;  4CC7 A;  4XTW A;  1VQP Q;  4M75 B;  2JTE A;  2QQB A;  1MGQ A;  1G3W A;  2I2L A;  4FW1 A;  2QDL A;  5A0D A;  2DFU A;  4FYV B;  1TH7 A;  3CME Q;  4MZT A;  2OAU A;  4M7D G;  5FU6 B;  1G5V A;  4C8Q G;  3M56 A;  3QBY A;  1OX8 A;  3QG1 A;  2Y4X A;  4GY5 A;  1U06 A;  1M1K R;  4ZGE B;  1ZSZ A;  5GAN 2;  2LZ6 B;  4ZTF A;  1ZUK A;  2RK2 A;  1RAC B;  2K3B A;  2K2M A;  5EG2 A;  3CCU T;  4RG2 A;  3RER A;  4O6J A;  1MUZ A;  3MP1 A;  4BE1 A;  3UPU A;  1Y7X A;  4JJD A;  1QP3 A;  2EBP A;  3CEY A;  2EQU A;  3VS2 A;  1VQ4 T;  3UF4 A;  3L2V A;  2LCL A;  4PJL A;  2A7Y A;  4LDW A;  1RAB B;  4PK4 A;  4JZ3 A;  2J7I A;  4L5G A;  2R5M A;  2V26 A;  3M4Y A;  4C5H A;  1NE8 A;  2QA4 Q;  4LN2 A;  4IUV A;  2RB6 A;  1M5Q 1;  4RMO A;  1K4U S;  1QCO A;  2YRC A;  3LWH A;  2X4J A;  2Y90 A;  3A8L B;  3CD6 A;  2BZX A;  1QCN A;  1W6X A;  1K1Z A;  2LQW A;  2KY9 A;  3CC4 A;  1UHC A;  2RN8 A;  1YN8 A;  2LJ1 A;  3EFS A;  5GAN j;  1YHQ Q;  4J6X A;  2EVR A;  4BD3 A;  4HXJ A;  2JMA A;  1GBQ A;  4PLL A;  4BE2 A;  4BUG A;  1ZSZ B;  2DXT A;  2GNC A;  1N8R U;  1SSH A;  3PMT A;  1YFN A;  4DOW A;  2ZPB B;  1H8K A;  9ATC B;  1YJ9 Q;  3OS1 A;  3TCJ A;  1NM7 A;  3VS4 A;  3CBO A;  3OQ5 A;  1VQ5 Q;  1P92 A;  3CCM Q;  3EG2 A;  2O31 A;  4XTV A;  1UB4 A;  2E6N A;  5LJ3 f;  1H3H A;  1GCP A;  1K73 C;  2KXC A;  3L2U A;  2PUO B;  2DIQ A;  4MZM A;  5HCK A;  2D8H A;  2V8I A;  4B9X A;  3CCQ T;  4EMH A;  4M7A E;  5LJ5 j;  4RTT A;  4Q5W A;  3OBY A;  3BY7 A;  2YDL A;  4FYW B;  5GMK j;  3RKW A;  1U1T A;  2X35 A;  3MEV A;  1WJQ A;  1Q82 U;  3M9Q A;  1VQP A;  4M77 G;  1KFZ A;  5DLQ E;  2QXF A;  4OMQ A;  3L2Z A;  1D3B A;  2FZC B;  2E4H A;  4J7I A;  1PG5 B;  5L8R E;  1OYX A;  3CME A;  1LNX A;  2CUB A;  1UGV A;  2JNG A;  4JDS A;  4HKE A;  3P8B B;  4ESR A;  4J8O A;  3FLG A;  2DX1 A;  3X28 B;  4LNP A;  4D8D A;  1VUB A;  2QEX T;  2FRY A;  4OB3 B;  4CC3 A;  2ROT A;  4J5Y A;  3JCM V;  4C0F A;  1TUC A;  2E41 A;  2H8H A;  1W2B A;  3AT1 B;  3CCJ T;  1WQ7 A;  2L3R A;  1B34 A;  3RIR A;  2RI3 A;  2DKG A;  3NPF A;  2F1L A;  1U1S A;  2PUK B;  3DB4 A;  3QDR B;  4GLK A;  1Q86 R;  2LT4 A;  1MMN A;  1QWF A;  4X1V A;  4F7U F;  1AD5 A;  2FPE A;  2EKO A;  1VQL Q;  1VQ6 A;  3CCR T;  2R58 A;  4E47 A;  1OX9 A;  5CKD A;  1Y07 A;  2HSP A;  2GGR A;  3SWN A;  4OB2 B;  3RNJ A;  2QA4 A;  1ABQ A;  3OYG A;  2XU8 A;  2QQ9 A;  4C0G A;  2XKO C;  4RTV A;  3PTA A;  4JPB W;  2ZCF B;  1D3B B;  5AYF A;  3CCU Q;  2EYX A;  2LNV A;  3CCL T;  3OYM A;  4XTX A;  3EGD A;  2OTJ A;  2EW3 A;  2GFA A;  3F70 A;  5J26 A;  3VS3 A;  1VQ4 Q;  2X4Y A;  1YHQ A;  1WX6 A;  5CVI A;  4EPC A;  3OSS C;  2JT4 A;  1EIF A;  1PD0 A;  1XTD A;  1ZBJ A;  3PGG A;  4NOY A;  4OVA A;  2XK0 A;  3C12 A;  2ROL A;  3CCV T;  4M78 C;  1TUG B;  4C92 G;  4PJO C;  1Q81 U;  2HL3 A;  4FT2 A;  4BI8 B;  1YJ9 A;  3HPW A;  5IH2 A;  3VRY A;  2QYZ A;  1B34 B;  1PNJ A;  1W70 A;  2K3Y A;  2OAW A;  1VQ5 A;  4OML A;  3CCM A;  1O75 A;  2R5A A;  2AIR B;  2V1Q A;  3JV3 A;  2ESW A;  2VXE A;  2QQA A;  3RDV A;  3MEW A;  1RAE B;  1OZ2 A;  1QVF S;  1T0J A;  4A4F A;  2WSC E;  3PVQ A;  1M1G A;  2KRO A;  3LWI A;  1X2K A;  3THK A;  4CC2 A;  4QQD A;  2CT3 A;  3P8D A;  3M0T A;  3QJY A;  2CGH A;  2COY A;  2DVJ A;  1MND A;  3SWN B;  5J39 A;  3M58 A;  5GAN 3;  4EMK A;  4XTY A;  1I07 A;  5A0L A;  1VYT A;  2YUP A;  1LCK A;  2JJ9 A;  3QZ5 B;  5I2S A;  2OJ2 A;  3EGD B;  3I5S A;  2E12 A;  4QVC A;  2ZPH B;  3REA B;  3I55 Q;  4PJM A;  5GAM f;  3CD6 T;  2LX7 A;  3I5R A;  3CQT A;  3CC4 T;  1M1K C;  1D1C A;  1VYV A;  5I22 A;  1OUL A;  2RHI A;  3CCQ Q;  1ZHI A;  3OYC A;  2PTK A;  5EC7 A;  2JXB A;  1MMA A;  2MWO A;  2CZ7 B;  5HK3 A;  2HQH A;  3L42 A;  5CKH A;  4CI0 C;  1VQM Q;  1U8R A;  1YCY A;  2GTO A;  3NFC A;  1OPK A;  1I8F A;  4KH1 B;  2KXD A;  2M0Y A;  5CR2 A;  3CCS T;  2RD1 A;  4C5E A;  3OSV A;  1VQL A;  3UDC A;  1D0Z A;  1T3L A;  3HTR A;  1QP2 A;  4EMK B;  3GPL A;  2M9U A;  1O9S A;  2VGN A;  4C5I A;  3J81 E;  1YI2 T;  4LD9 K;  2D6F A;  1SSF A;  2FPF A;  3QZ9 B;  2JTM A;  2HDA A;  1ACM B;  3SHW A;  2GBQ A;  3CCU A;  1JJ2 S;  2KAF A;  1E6H A;  4GLM A;  5L23 A;  2AZS A;  1KC8 C;  1WDX A;  1D1B A;  1VQ4 A;  1SHF A;  2ABL A;  1PSE A;  3CME T;  2RA2 A;  5KCO A;  4F17 A;  2YRD A;  1QVF A;  4FL6 A;  2HNI A;  5GAO l;  2WAC A;  4DBR A;  1WXT A;  3CMA Q;  4FYY B;  3NHN A;  1K73 R;  3OB9 A;  3JB9 F;  2M16 A;  2DXU A;  1K9M R;  3GNG A;  3H0F A;  3L2W A;  1M90 U;  2ZZD A;  2FVU A;  1KD1 C;  1GFD A;  3OYY A;  2FEI A;  2QTV A;  1I4K 1;  1M1F A;  2RJE A;  4M78 E;  4PJO E;  4EDU A;  4XU2 A;  3CCL Q;  4J9D A;  2ED0 A;  3JRZ A;  2EQK A;  1JB0 E;  2D1X A;  1C0M A;  2YT6 A;  4PFP A;  4C0D B;  4AFZ C;  5FU7 C;  5KCH A;  1Y71 A;  3NGP A;  5KYW A;  3X25 B;  3EFR A;  5GAN d;  4L59 A;  4Z89 A;  3CCV Q;  1I81 A;  1FMW A;  2LVM A;  1R8O B;  2QA4 T;  3J80 E;  1YWO A;  3M0U A;  4RCC A;  3JB9 D;  1AEY A;  5FRO A;  2D8J A;  3I55 A;  4DA4 A;  1F1B B;  1WNL A;  2LQN A;  2QAS A;  1LPL A;  3BE3 A;  2MOX A;  8AT1 B;  1QVG P;  1VQ9 Q;  3VU3 C;  4AT1 B;  3JCM d;  1NPR A;  2C0T A;  2X4X A;  4J9I A;  3V7R A;  1Q7Y R;  4ZN3 A;  1YHQ T;  2DZ9 A;  2JMC A;  4A54 A;  3EG1 A;  4KUL A;  3OYK A;  4XU1 A;  3CCQ A;  4N0A C;  3ER0 A;  2LRQ A;  3QWX X;  4FM4 B;  3FDR A;  4AMC A;  2L3P A;  4KGV B;  2GQI A;  2H3J A;  2HQE A;  1MHN A;  5LJ5 d;  4OMM A;  2E5K A;  4Z88 A;  1VQM A;  3S3N A;  1WHK A;  1WYX A;  4JRQ A;  3LGF A;  1D0X A;  3JCM Q;  2KQW A;  3EHQ A;  1VQ5 T;  3CCM T;  3OYI A;  1JJ2 A;  3S6W A;  2JUF A;  1UGR B;  3EG9 A;  2DZC A;  4M7A A;  2PVG B;  1BK2 A;  5KYW B;  2KEA A;  1QQJ A;  5D7U A;  2LQ8 A;  6AT1 B;  3G71 T;  2RHY A;  1C6V X;  1NPP A;  1RAI B;  3DB3 A;  3CXC P;  4LDV A;  2IIM A;  4KGX B;  2YSQ A;  3FIF A;  5ECA A;  5GAM h;  1WPY A;  1J3T A;  4A4G A;  3GIB A;  4F7U G;  4QQG A;  3I35 A;  2M02 A;  2RHX A;  1FX7 A;  2ATC B;  1W4S A;  4DEY A;  2O2O A;  1SKU B;  1VIE A;  3C4S A;  1I1J A;  3U23 A;  2CZ1 B;  3S3M A;  2OTL Q;  4RUG A;  3CMA A;  3I56 Q;  4IKF A;  2LP5 A;  2DBM A;  4WTO B;  1OQK A;  2QTX A;  2COZ A;  4XTU A;  1M3A A;  2RQW A;  1M3B A;  4FU6 A;  1A0N B;  1IO6 A;  4M75 C;  4D8K A;  1YI2 Q;  1IRX A;  2VC8 A;  2VKN A;  4QVD A;  2KI7 A;  2COW A;  2DM1 A;  3X24 B;  4M75 G;  2A36 A;  3GP8 A;  3VKI A;  3CCL A;  3EG9 B;  2EJG A;  5D6W A;  4M7A B;  3WVE B;  2HBP A;  4IUU A;  1RAD B;  2PVO B;  4M7D C;  2KRS A;  3VJP A;  3H9N A;  3M0S A;  1N8R C;  2P4R A;  4NL2 A;  4DOV A;  3RMS A;  4C8Q C;  1WI7 A;  2K5F A;  3M0R A;  1VQL T;  1PRL C;  2J6O A;  2AK5 A;  3CCV A;  3VUB A;  2B86 A;  2JN0 A;  5GAN 7;  4KH0 B;  4ZN1 A;  2LJ0 A;  1OI1 A;  1X27 A;  2KSS A;  2LDM A;  3JSC A;  2JTF A;  3QXE B;  2RF0 A;  4CC4 B;  5GAN 8;  3CC7 Q;  2G3R A;  4MZP A;  1VQ9 A;  2LC4 A;  1M2O A;  2MK5 A;  1RUW A;  2E3I A;  3EH1 A;  1KQS A;  3M4G A;  3A1P A;  2DL5 A;  2V1R A;  2PNI A;  1VA7 A;  4E7K A;  5CO7 A;  2BKD N;  4C5G A;  3CPW A;  4AG2 C;  3A8O B;  2NYS A;  1MMG A;  3OS5 A;  2SEM A;  1N9R A;  1M4Z A;  1PKT A;  1HK9 A;  4DBH A;  4E7S A;  1YJN Q;  1EX4 A;  1OZ3 A;  5GAO q;  1PRM C;  4Z8A A;  2J06 A;  3OBW A;  4LUE A;  2CKK A;  3PIP A;  2KMT A;  1K0S A;  5GAN g;  5GAN 5;  1Z9Q A;  2HSE B;  1KC8 R;  3H6Z A;  2YUQ A;  1UE9 A;  1BBZ A;  4HCC A;  3OA6 A;  1RAA B;  2L5Q A;  1V76 A;  5GAN e;  2KR3 A;  3GBQ A;  1M3C A;  1VQO Q;  3J7A F;  3JCM g;  5GAN 6;  1WHL A;  4A53 A;  3TRE A;  2JM9 A;  1NJI R;  4ELY C;  1K8A U;  3KUF A;  2EQI A;  1X75 C;  1UHF A;  4P5N A;  3I55 T;  3OS2 A;  2KDS A;  2EJF A;  1KD1 R;  3CCS A;  2OTL A;  5CCA A;  3I56 A;  4V2S A;  1K9M C;  2YLC A;  5LJ5 g;  3JCM e;  1NBE B;  1V1C A;  1X6O A;  3G71 Q;  3QDF A;  3I9Q A;  1YI2 A;  5IHI A;  2YHT A;  2VVK A;  4KUD K;  4M77 C;  4AFS C;  1VIF A;  1G3T A;  2NLU A;  1VQM T;  4QW2 A;  5LJ5 e;  2VB6 A;  3MP8 A;  4J9B A;  5FLX E;  2DL4 A;  5KYU A;  3EG0 A;  4X34 A;  2NUZ A;  5GMK e;  1CKA A;  3JB9 G;  1R0B G;  2J6F A;  4N4H A;  2X3W D;  2DXB A;  4TVR A;  2X3X D;  4KUI A;  2RQT A;  2QI2 A;  4BB7 A;  3JAM E;  4M7D E;  1EZZ B;  2K79 A;  3GOX A;  1V29 B;  1QCF A;  4C8Q E;  3NTI A;  5GAM j;  5GAO m;  3O5Z A;  2DLP A;  5FW9 A;  2DE0 X;  1KG1 A;  1TTH B;  2DD5 A;  3CC7 A;  2BIV A;  1Q7Y C;  4BDY A;  1PHT A;  2HBW A;  3R6O A;  2FRW A;  2DIG A;  4MDX A;  1JXO A;  4YTL A;  1QKW A;  4ZGD B;  5FWB A;  2RNA A;  5C6S A;  4II1 A;  2OI3 A;  2VYT A;  4FT4 A;  2JZ2 A;  3RUX A;  1NYF A;  4RTY A;  1WIE A;  2IG0 A;  3CMA T;  2DXC A;  1TSF A;  1GCQ C;  2AT1 B;  4HT9 A;  4M78 A;  4PJO A;  3JCM P;  1YJN A;  2EGE A;  2VUB A;  3EGU A;  3MEU A;  4JJB A;  1RLP C;  1XQH A;  3O8V A;  1WJR A;  3M59 A;  2DEQ A;  4JS5 A;  1RI0 A;  3SEM A;  4L6V 5;  5KYU B;  4DQ2 A;  2PZ1 A;  4E2F B;  1VQ8 Q;  2EYZ A;  1TUD A;  3HP9 A;  4D6W A;  2M0O A;  4JRI A;  5J3B A;  1OPL A;  4PL6 A;  1AOJ A;  1X2Q A;  4M7A F;  2GFU A;  4FW2 A;  1WHM A;  3FJP A;  3GNF B;  1M8M A;  7AT1 B;  4ME7 A;  4C92 C;  4HCK A;  2FPD A;  4FSS A;  3OW2 S;  1ZLM A;  1KHI A;  3X26 B;  1GRI A;  3M0Q A;  3WVD B;  2H3E B;  4E7I A;  3EH2 A;  1KHC A;  2KT1 A;  3A5Z B;  2QAZ A;  1KQ2 A;  1VQ9 T;  3CC2 Q;  3SB2 A;  3CXC S;  3G71 A;  2GF7 A;  5AT1 B;  4M78 B;  1PC0 A;  4PJO B;  3AHU A;  4PKC C;  1N8R R;  2YUN A;  5LJ5 f;  4M7A D;  1AHJ B;  2YXY A;  2JW4 A;  1E6G A;  2XDD A;  1CSK A;  4BE0 A;  2HKQ B;  3VS7 A;  2CYZ B;  3ZFJ A;  2FB7 A;  4XK8 E;  2DA9 A;  1XJW B;  1WHJ A;  2QQR A;  4M77 E;  3PT9 A;  2NUP A;  3BDU A;  1IRE B;  2CDT A;  5GMK m;  1Y96 A;  3OYF A;  2W10 A;  1M90 C;  2RM4 A;  3NTK A;  2KNB B;  3MO8 A;  4FSX A;  2D0Q B;  1MMD A;  2XMF A;  4M7D D;  4A4H A;  1W2B P;  1Q82 R;  1ARK A;  4C8Q D;  3MEA A;  1TS9 A;  5HY6 A;  5GAN 4;  4J6Y A;  4JRP A;  2QK0 A;  1NLO C;  2RJC A;  4ORZ A;  2QDY B;  5LJ3 h;  2L3S A;  1YCS B;  2A37 A;  3QYH B;  4Y91 A;  2QGF B;  3SFM A;  1VQK Q;  3OYD A;  3PMI A;  1KQ1 A;  4OMF B;  3NMZ C;  1IZ6 A;  4OB0 B;  3RBB B;  1G8X A;  1PSF A;  2CP2 A;  2OTL T;  2KYB A;  2EAY A;  2LMJ A;  3HHT B;  3I56 T;  2ZPE B;  4OP0 A;  4MMK A;  4FIB A;  1X43 A;  2JS2 A;  4JUV A;  4J9C A;  3PVL A;  3VS5 A;  2C0O A;  2EPD A;  3V7S A;  5IN1 A;  4PLI A;  4ZNX A;  5GJV B;  2L0A A;  3LGL A;  4BY6 C;  2VAS A;  1K76 A;  4X9D A;  5M9O A;  1EFN A;  3OW2 A;  3HRS A;  2KE9 A;  3MPU B;  2NUP B;  3M53 A;  1R77 A;  4AFQ C;  1UGQ B;  1UGP B;  1Y96 B;  1JXM A;  2F2W A;  2VXF A;  3OMG A;  3VUZ A;  2XG8 D;  1N6A A;  4KT0 E;  2E10 A;  3NTH A;  2K2V A;  4J9F A;  4JS4 A;  1S72 T;  4B6M A;  5IHN A;  3A8M B;  3FB9 A;  3TQ7 P;  1JEG A;  3MCA B;  1NJI C;  1HSQ A;  4RKU E;  4R56 A;  4C92 E;  1ZUY A;  2O4X A;  3IQL A;  4M77 F;  3G4S Q;  2IVW A;  2XDB A;  3ASK A;  1ZA2 B;  3CC7 T;  2DL3 A;  4XQ3 A;  4A63 B;  4O5V A;  3CC2 A;  4A4E A;  4XTZ A;  1X6B A;  3FEO A;  2M1H A;  2HL5 C;  4BAC A;  1QW1 A;  2W0Z A;  4LDY A;  1GBR A;  2Z0W A;  4N0A A;  2P0P A;  1K9A A;  1WLP B;  1M1K U;  1Q81 R;  3E19 A;  5GAO p;  2CRE A;  1TG0 A;  2QG9 B;  3DLM A;  3G7Z A;  1JQQ A;  1AWX A;  3PE0 A;  2HAX A;  4OGE A;  1YJN T;  5I21 A;  3L1A A;  1N5Z A;  2MYS A;  4M4Z A;  1ABO A;  1VQ7 Q;  3RKY A;  1VOM A;  4M77 D;  1D1A A;  4ZTJ A;  1T0H A;  1TXQ A;  5FU7 B;  2CT4 A;  3OMC A;  1K0X A;  2RPN A;  2K4Y A;  3FRN A;  1YIJ Q;  1AWW A;  1G83 A;  3BDL A;  2DMO A;  2CS7 A;  4K11 A;  4N4I A;  5KYY A;  2LNH B;  1H64 1;  2AKK A;  2CP3 A;  4XAX B;  2O4X B;  4JZ4 A;  1XOV A;  4JJC A;  4RG8 A;  1YJW Q;  1VQO T;  2RQV A;  2CSI A;  1VQK A;  3FC3 A;  1LOJ A;  3H8Z A;  2L8D A;  2YRV A;  2Y4Y A;  2EWN A;  3L2R A;  2LJ3 A;  1VQN Q;  2CSQ A;  4LXC A;  4F14 A;  3D7S B;  5C0M A;  3LLR A;  3SD4 A;  2O9S A;  2P4T A;  4PFZ A;  2DJZ A;  2K5L A;  4LE9 A;  4XU3 A;  1TU0 B;  3HFO A;  3JCM J;  1WQW A;  1I5L A;  3ZEH A;  2CH4 W;  4M78 F;  2EYY A;  3UAT A;  4PJO F;  2G6F X;  2DTO A;  1N27 A;  3N5B B;  5DLO A;  2A08 A;  5GAM d;  1BI0 A;  1BI2 A;  1PCX A;  4IUT A;  3V8L A;  1KSW A;  3LW5 E;  2RJD A;  2FO0 A;  3HKS A;  3OYA A;  1QVF P;  4M7D A;  4QVZ A;  4BDZ A;  1WA7 A;  1UJ0 A;  1BKB A;  3JB9 J;  4C8Q A;  1DJ7 B;  4OMO A;  3MKD A;  1Z9Z A;  2MAM A;  4IIM A;  5KYY B;  2KRM A;  2HCK A;  2P84 A;  1BCM A;  1MV0 B;  3OYJ A;  3ZBD A;  3EFO A;  4J9H A;  3TSZ A;  3G4S A;  2JOY A;  1ZBX A;  4R55 A;  5LJ3 j;  2LQK A;  3A8H B;  2KYM A;  4BI3 A;  1LJO A;  2LTO A;  1JRI A;  4M7A G;  1NYG A;  4M78 D;  4PJO D;  4E6R A;  2MIO A;  3HFN A;  1OU8 A;  1ZQ1 A;  5GMK i;  5FU6 C;  4E7J A;  4IUQ A;  3QHS A;  2K7A A;  2DL8 A;  2X4W A;  3G1J A;  1GL5 A;  2K57 A;  2CUD A;  4EMG A;  3OY9 A;  4DBQ A;  3QWY A;  1B7T A;  1S72 Q;  1H3Z A;  1K8A C;  3C94 A;  2K5I A;  4ELZ C;  1M90 R;  3KBG A;  3EAE A;  5FWC A;  4FYX B;  1NLP C;  4J7F A;  2JS0 A;  2MCN A;  5HKC A;  1Q86 U;  1VQ7 A;  1D0Y A;  1T3S A;  4M7D B;  2MI6 A;  1CKB A;  1VQ8 T;  1KIK A;  3LH0 A;  4C8Q B;  2LX9 A;  5D6X A;  2LT1 A;  1AWJ A;  2KGT A;  1YIJ A;  3UWN A;  1BB9 A;  1Q82 C;  2HMA A;  4Z02 A;  1UGS B;  5GAO n;  1SG5 A;  1D09 B;  3VV0 A;  4JLI A;  3EFO B;  1IGQ A;  1YJW A;  2E5Q A;  2EQM A;  2RMO A;  3M0P A;  1JJ2 P;  5IXF A;  2K9G A;  1HD3 A;  2DK3 A;  1AZG B;  1QKX A;  2I0N A;  2EIF A;  1G2B A;  4ANJ A;  4A4K A;  3QO3 A;  4AFU C;  4J6W A;  8ATC B;  3G6E Q;  1KK7 A;  3TU4 K;  2FHD A;  3CC2 T;  1VQ6 Q;  3REB B;  1VQN A;  1BCO A;  1XNI A;  2BE9 B;  4J9G A;  1W2B S;  1ZUU A;  2RHZ A;  1ZSZ C;  4XU0 A;  2DF6 A;  2FL7 A;  3QII A;  2DTH A;  5CIU A;  4M77 A;  2FZG B;  2OTJ Q;  1YNZ A;  4EIK A;  1OEB A;  4PJJ A;  2DER A;  1WHG A;  3E9F A;  1QLY A;  4RTU A;  4F04 B;  1WXB A;  4OMN A;  5A0G A;  2XID A;  1C1A A;  4F7U E;  4LD6 A;  3QUI A;  2O88 A;  2BZY A;  4OB1 B;  1TWB A;  4FCY A;  3URG A;  3VS6 A;  3C0C A;  3HRU A;  1UJY A;  2EJ9 A;  2ZPF B;  3H0H A;  2AKL A;  2DAQ A;  2K6D A;  1M30 A;  2MPX C;  5KH6 A;  2DTI A;  1WJS A;  4HVU A;  3PNW C;  1X69 A;  1IHV A;  1RAH B;  5KE3 A;  5IHK A;  3MHX A;  4CRI A;  3DLL A;  2RO0 A;  1YIT T;  1SHG A;  3MP6 A;  1VYU A;  2P0Q A;  2EKH A;  2RI5 A;  4M75 E;  4HCZ A;  1VQK T;  3CCE Q;  4HVV A;  4C0Z A;  4HA8 A;  2RJF A;  2ZPI B;  2DPP B;  1Q81 C;  5KYX A;  1SRL A;  1AZE A;  4B9W A;  2PVD B;  3GF5 A;  2LCC A;  1S72 A;  1GCQ A;  1I5O B;  3CBM A;  5IT9 E;  3E2U A;  3H41 A;  2V8K A;  5GAM g;  3P8H A;  4M77 B;  1YWP A;  1WHH A;  3MJX A;  1UG1 A;  4KGZ B;  4LDX A;  2RQU A;  3OYB A;  2EGA A;  1HXD A;  3KFV A;  4OGC A;  3V8K A;  3QKJ A;  3X20 B;  1KQS P;  3JCM W;  3V8J A;  2JM8 A;  4ZGJ B;  2O9V A;  5GAM e;  1RAF B;  1ZSG A;  1N9S A;  2QQS A;  1SF9 A;  1SRM A;  2VWF A;  2SRC A;  1TOV A;  1R0C B;  1SPK A;  3HRT A;  3CPW P;  5KE2 A;  2DD4 A;  4NL3 A;  2RQR A;  2GQV A;  4C92 A;  1ZX6 A;  1U5S A;  3V7C A;  3VS0 A;  1IXD A;  3ULR B;  5LL6 S;  1ZA1 B;  2DO3 A;  2C0I A;  1M2V A;  3VYG A;  3G4S T;  5KYN A;  1QVG S;  4N4G A;  3VRZ A;  2E6Z A;  3UA6 A;  1G3S A;  2CP5 A;  2CZ0 B;  3G6E A;  1RLQ C;  1X6G A;  2LCS A;  5KYX B;  3OYN A;  4Y92 A;  2XIC A;  1FXX A;  2NUT A;  1K73 U;  5GAN f;  1K9M U;  4NS5 A;  2MMP A;  2DVE A;  3INZ A;  2V8J A;  1BIB A;  4PNO A;  4E7L A;  2B8A A;  1AWO A;  1E7O A;  1VQO A;  4RTX A;  2KRN A;  4M75 F;  3HL8 A;  2YWW A;  2P0K A;  2HEQ A;  4E7Z A;  1BI3 A;  2A3L A;  1VQ7 T;  3BW1 A;  3JCM f;  1X01 A;  5FRM A;  4MDW A;  1NG2 A;  2WSF E;  3SWN C;  4C92 B;  2DYB A;  4M7D F;  4X9C A;  1YIJ T;  5GJW B;  1SEM A;  4M78 G;  2E1H A;  4RCB A;  4PJO G;  4C8Q F;  1GXI E;  1NEB A;  1QVP A;  2HD0 A;  1UUE A;  3WXM B;  2J05 A;  2DIL A;  1M2V B;  5D6Y A;  1B07 A;  1YJW T;  3S3O A;  2YLB A;  1K8A R;  3DKM A;  3LX7 A;  2HQX A;  1I0C A;  2FYK A;  3CCE A;  1Q7Y U;  2XHC A;  3GLX A;  5IAY A;  4M75 D;  2F2V A;  2NWM A;  4WF2 A;  1WGS A;  2XDP A;  2ZAE A;  2BE7 D;  2NUT B;  1VQN T;  1OOT A;  4WCI A;  4PFO A;  2DEU A;  1JBM A;  2EFI A;  1OV3 A;  2JVV A;  1IHW A;  2QGG A;  2KVQ G;  3A98 A;  1BI1 A;  5DY9 A;  3R6N A;  4ATO A;  1UEB A;  1M9S A;  5LJ3 d;  4AG1 C;  1YIT Q;  1QVG A;  3BFM A;  4JRK A;  1JO8 A;  3RES A;  3RR6 A;  3EG3 A;  2EGC A;  2M51 A;  1BU1 A;  5CQY A;  1BIA A;  4EMK C;  2ECZ A;  4J9E A;  4LDU A;  3QPH A;  4RTW A;  1WZO A;  5A2Q E;  5CQX A;  1GFC A;  3MET A;  3JB9 H;  3JCM X;  5I11 A;  1MV3 A;  1KJW A;  1RI9 A;  4IUP A;  4DEX A;  2E3H A;  3M54 A;  2E70 A;  2BTT A;  3QYG B;  3UT1 A;  3VYH B;  3M55 A;  1VQ8 A;  1PD1 A;  4QKU A;  2R57 A;  2PU9 B;  2DNU A;  4QT7 A;  4KBM B;  3H0I A;  4GBQ A;  2QEX Q;  2VV5 A;  1JU5 C;  5DM7 R;  4JLG A;  3E9G A;  4JJN K;  2DET A;  1Y57 A;  2BUD A;  3M5A A;  2KT8 A;  3PIO A;  1VQP T;  2DRK A;  4QQ6 A;  3CXC A;  3CCJ Q;  3EGX A;  3HSB A;  3L2Q A;  4HVW A;  4BY6 B;  1FWZ A;  1Y0M A;  2RH2 A;  1RL2 A; 
#chains in the Genus database with same CATH homology
 1Z9Z A;  2EQI A;  1UHF A;  1FYN A;  4IIM A;  2KRM A;  3ZL7 C;  2DJQ A;  2HCK A;  5IH2 A;  3VRY A;  1MV0 B;  1PNJ A;  1W70 A;  2OAW A;  4OML A;  4J9H A;  3EHR A;  3TSZ A;  2CH4 A;  2KYM A;  2V1Q A;  1V1C A;  2ESW A;  3JV3 A;  1B3Q A;  3I9Q A;  1NYG A;  5IHI A;  1T0J A;  5IXB A;  2VVK A;  3PVQ A;  4E6R A;  2MIO A;  2KRO A;  4AFS C;  1X2K A;  3THK A;  4CC2 A;  2CT3 A;  2A28 A;  2K7A A;  2DL8 A;  3M0T A;  2FG0 A;  2DVJ A;  1GL5 A;  2CUD A;  4J9B A;  3QWY A;  2DL4 A;  3EG0 A;  1I07 A;  2KBT A;  1VYT A;  2NUZ A;  2YUP A;  1LCK A;  5FWC A;  1CKA A;  1UTI A;  2OJ2 A;  1NLP C;  2J6F A;  3I5S A;  2JS0 A;  2X3W D;  3REA B;  2X3X D;  2YUO A;  2RQT A;  2GTJ A;  2MCN A;  3TSW A;  2LX7 A;  1M27 C;  2K79 A;  1T3S A;  1QCF A;  3I5R A;  1CKB A;  3CQT A;  1AVZ C;  1KIK A;  3O5Z A;  2L2P A;  2DLP A;  5FW9 A;  2DE0 X;  1VYV A;  4IIO A;  1AWJ A;  2KGT A;  4RTZ A;  5I22 A;  3FJ5 A;  1BB9 A;  1PHT A;  2HBW A;  2FRW A;  2PTK A;  1JXO A;  1QKW A;  5EC7 A;  2JXB A;  5FWB A;  1H92 A;  2DL7 A;  3LH5 A;  2RNA A;  2EYW A;  4OMP A;  2OI3 A;  2GTO A;  2RMO A;  3M0P A;  4F16 A;  1OPK A;  1NYF A;  5IXF A;  4RTY A;  1WIE A;  1HD3 A;  2K9G A;  1U3O A;  2ED1 A;  1GCQ C;  4LUD A;  2KXD A;  1FMK A;  1AZG B;  4KRT A;  2M0Y A;  1QKX A;  1WFW A;  2I0N A;  1G2B A;  4AFU C;  1QWE A;  2EGE A;  3EGU A;  4JJB A;  1RLP C;  3REB B;  1S1N A;  2D0N A;  3TVT A;  1T3L A;  4J9G A;  1ZUU A;  3SEM A;  1UFF A;  2PZ1 A;  2FPF A;  2EYZ A;  2HDA A;  2DF6 A;  1TUD A;  3SHW A;  2GBQ A;  1OPL A;  1HJD A;  1AOJ A;  1WXU A;  1X2Q A;  2F2X A;  1E6H A;  4GLM A;  5L23 A;  1YNZ A;  2AZS A;  1OEB A;  4EIK A;  1M8M A;  2DRM A;  1WDX A;  1QLY A;  1UEC A;  3VS1 A;  4RTU A;  1WXB A;  1SHF A;  4OMN A;  2ABL A;  1W1F A;  1PKS A;  4HCK A;  2FPD A;  4F17 A;  2BZ8 A;  4FSS A;  2DBK A;  1ZLM A;  1NEG A;  4R0K A;  1YP5 A;  2O88 A;  3UA7 A;  1WXT A;  2BZY A;  1GRI A;  2ENM A;  3M0Q A;  2L3Q A;  3VS6 A;  3NHN A;  3C0C A;  2AZV A;  1UJY A;  2KT1 A;  3H0H A;  3H0F A;  2AKL A;  2K6D A;  1M30 A;  4HVU A;  1X69 A;  1UDL A;  1GFD A;  2FEI A;  5IHK A;  2J6K A;  1PWT A;  4J9D A;  2ED0 A;  2YUN A;  1SHG A;  2D1X A;  2JW4 A;  1VYU A;  4CC7 A;  2EKH A;  1E6G A;  2YT6 A;  4HVV A;  4AFZ C;  2JTE A;  1CSK A;  3NGP A;  1AZE A;  1SRL A;  3VS7 A;  2QDL A;  4Z89 A;  2DA9 A;  1GCQ A;  3H41 A;  1YWO A;  3M0U A;  2CDT A;  1YWP A;  1AEY A;  2W10 A;  1UG1 A;  2D8J A;  2KNB B;  2RQU A;  2EGA A;  3KFV A;  1U06 A;  2LQN A;  2MOX A;  2XMF A;  2LZ6 B;  2C0T A;  4J9I A;  1ZUK A;  2JM8 A;  1ARK A;  2K3B A;  2O9V A;  2K2M A;  1ZSG A;  2VWF A;  1SRM A;  2SRC A;  2JMC A;  3EG1 A;  1SPK A;  1MUZ A;  1NLO C;  4JJD A;  4ORZ A;  2EBP A;  2RQR A;  3QWX X;  2L3S A;  1YCS B;  2A37 A;  3VS2 A;  1ZX6 A;  2L3P A;  1U5S A;  3VS0 A;  3UF4 A;  2GQI A;  3ULR B;  4OMM A;  2E5K A;  4Z88 A;  4JZ3 A;  2J7I A;  3NMZ C;  3RBB B;  1WYX A;  2KYB A;  2C0I A;  3EHQ A;  2LMJ A;  1X43 A;  2JS2 A;  3VRZ A;  3UA6 A;  4LN2 A;  4J9C A;  3PVL A;  1BK2 A;  3VS5 A;  1RLQ C;  1X6G A;  2C0O A;  2EPD A;  2LCS A;  2KEA A;  4ZNX A;  4Y92 A;  5GJV B;  2L0A A;  1K4U S;  1K76 A;  2BZX A;  1EFN A;  1W6X A;  1K1Z A;  2LQW A;  2KE9 A;  1UHC A;  4AFQ C;  2RN8 A;  2IIM A;  1YN8 A;  2LJ1 A;  2YSQ A;  2EVR A;  5ECA A;  1JXM A;  1J3T A;  2F2W A;  4HXJ A;  2JMA A;  1GBQ A;  3I35 A;  1AWO A;  1E7O A;  4RTX A;  2KRN A;  4J9F A;  2GNC A;  4DEY A;  1SSH A;  5IHN A;  2HEQ A;  2O2O A;  1H8K A;  1I1J A;  1JEG A;  3U23 A;  1NM7 A;  1HSQ A;  3VS4 A;  4RUG A;  1ZUY A;  3IQL A;  1NG2 A;  2LP5 A;  2DBM A;  3EG2 A;  2DYB A;  2O31 A;  2DL3 A;  5GJW B;  1SEM A;  1M3A A;  1H3H A;  2RQW A;  1GCP A;  1M3B A;  1A0N B;  1IO6 A;  4A63 B;  4D8K A;  1NEB A;  2KXC A;  1UUE A;  2VKN A;  1X6B A;  2J05 A;  5HCK A;  2DIL A;  2DM1 A;  2D8H A;  2A36 A;  2W0Z A;  1B07 A;  4RTT A;  1GBR A;  1K9A A;  1WLP B;  1I0C A;  2YDL A;  2CRE A;  1TG0 A;  2KRS A;  3M0S A;  1JQQ A;  2P4R A;  1AWX A;  3PE0 A;  2F2V A;  2NWM A;  1WI7 A;  1KFZ A;  3M0R A;  4OMQ A;  1N5Z A;  1PRL C;  2J6O A;  2AK5 A;  1OOT A;  4WCI A;  4M4Z A;  1ABO A;  2CUB A;  1UGV A;  2B86 A;  2LJ0 A;  1T0H A;  1OV3 A;  4ESR A;  1X27 A;  2CT4 A;  1K0X A;  2RPN A;  2DX1 A;  4LNP A;  4CC4 B;  2RF0 A;  4D8D A;  3A98 A;  2FRY A;  4CC3 A;  1AWW A;  3R6N A;  1G83 A;  2ROT A;  2DMO A;  4K11 A;  1RUW A;  4AG1 C;  1TUC A;  2LNH B;  1JO8 A;  2AKK A;  2H8H A;  2DL5 A;  4JZ4 A;  2V1R A;  1XOV A;  3EG3 A;  4JJC A;  2PNI A;  2EGC A;  3NPF A;  2RQV A;  1VA7 A;  2M51 A;  1BU1 A;  4AG2 C;  2ECZ A;  2CSI A;  4J9E A;  1QWF A;  2SEM A;  4RTW A;  4X1V A;  1AD5 A;  1PKT A;  2FPE A;  1GFC A;  5I11 A;  2LJ3 A;  1MV3 A;  1KJW A;  1PRM C;  1RI9 A;  2CSQ A;  4DEX A;  4Z8A A;  4F14 A;  2BTT A;  2J06 A;  2HSP A;  2GGR A;  4LUE A;  3RNJ A;  2O9S A;  1ABQ A;  4LE9 A;  1K0S A;  1Z9Q A;  4RTV A;  4JPB W;  2CH4 W;  3UAT A;  2DNU A;  2EYY A;  2G6F X;  2YUQ A;  4QT7 A;  1UE9 A;  2EYX A;  3H0I A;  4GBQ A;  1JU5 C;  2A08 A;  1BBZ A;  2EW3 A;  3VS3 A;  1Y57 A;  1KSW A;  2KT8 A;  2FO0 A;  1WX6 A;  2DRK A;  2KR3 A;  3GBQ A;  1M3C A;  1WA7 A;  1UJ0 A;  2JT4 A;  4HVW A;  1ZBJ A;  1Y0M A;  4OMO A;  2ROL A;  2JM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...