2KVQG

Solution structure of nuse:nusg-ctd complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
RPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords NusE
publication title A NusE:NusG complex links transcription and translation.
pubmed doi rcsb
source organism Escherichia coli
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kvqG00
4QQDA 1EIFA 3G6ET 1N8RU 1QVFS 3P8BB 2G3RA 1VQ4T 1Q86C 2E70A 1K8AC 2MWOA 1KD1U 1VQOT 2MI6A 3CCQT 1YJWT 3CCSA 3HKSA 3KBGA 5FLXE 3I56T 1YI2A 1YIJT 1QVGA 1KC8U 3CCEA 5DM7R 2QA4T 4ZN1A 1VQNT 5LL6S 2KDSA 3DB4A 1VQMA 3CPWS 2CKKA 3CC7A 4YTLA 3CCVT 3CCMA 2QEXT 1YJNA 1BKBA 3I55T 1YJ9A 3LH0A 1Q7YC 1QVGS 3DLLA 1YITT 3LGFA 3CD6T 1K8AU 1VQ9T 1VQLA 1VQPA 1M1GA 1NPRA 2IG0A 1VQ8A 2DO3A 3ER0A 1KQSS 3CMEA 1JJ2S 3CCJA 2L3RA 4RG2A 3CPWA 3CMAA 1Q81C 1UEBA 1YBYA 2JUFA 1XTDA 5J26A 1Q7YU 1Q82U 3CCST 2JVVA 3OW2S 1YI2T 1X6OA 3CCET 4X34A 3G71A 5HY6A 3G4SA 3A5ZB 2E6ZA 1VQMT 1KQSA 1JJ2A 3CCMT 1YJNT 3CC7T 1RL2A 1Q82C 3CC4A 1VQKA 2JOYA 1YJ9T 3CPFA 3CCRA 3CXCA 1S72A 2OTLA 1Q81U 1VQLT 1VQPT 1K73C 3CCUA 1VQ8T 3CCLA 3PIPA 1VQ6A 3OW2A 1M1KC 3J80E 3CMET 1VQ7A 3CCJT 3J7AF 5IT9E 4CRIA 3CXCS 2OTJA 2EIFA 2JNGA 3CC2A 1YHQA 4ZN3A 3CMAT 1SSFA 4TVRA 1XNIA 2MWPA 3LGLA 1NJIC 2XHCA 3G6EA 1K9MU 1K73U 2LCLA 3G71T 3TREA 1VQ4A 1M90C 1NPPA 3G4ST 1M1KU 1VQOA 2LVMA 3CC4T 3J81E 1W2BS 1VQKT 3OYYA 3CCQA 3CCRT 1YJWA 1K9MC 3PIOA 5IAYA 3I56A 1YIJA 1NZ9A 1S72T 2OTLT 1N8RC 1VQ5A 2QA4A 1VQNA 3CCUT 3CCLT 1VQ5T 1VQ6T 3CCVA 5A2QE 1KD1C 2QEXA 3DB3A 1NJIU 1VQ7T 3I55A 2LQ8A 5DLQE 2OTJT 2KVQG 1M90U 3CC2T 1QVFA 1YITA 3CD6A 1YHQT 1KC8C 1W2BA 1VQ9A 1IZ6A 5J3BA 3JAME 1Q86U 1KHIA
chains in the Genus database with same CATH superfamily
1N9SA 3SWNC 4NOYA 5HKCA 4B6MA 2COWA 2LX7A 1OV3A 1HYOA 2RHXA 3EGXB 4XTZA 3CCSA 2CH4W 4JJDA 3WVEB 5IHNA 1KJWA 4PJOG 3GP8A 1ZUKA 1YI2Q 1PRMC 4RTYA 2CYZB 2K9GA 2KI7A 1D0ZA 3I55Q 5GAOq 3CCMQ 2DVJA 1TG0A 1Y96B 4HVUA 1M8MA 5GAN4 2FYKA 1BYMA 5GAOp 1IHWA 3CMAA 1UEBA 2DD5A 3RBBB 2K6DA 1Q7YU 5FWBA 2JJ9A 1X6OA 4JRQA 3QWXX 3OBYA 1K4US 3G71A 3I35A 4M7AD 4CC4B 5ECAA 4BE2A 2RK2A 4ZGJB 5GMKm 4DEXA 4MDWA 1VQ8T 2CP3A 3PIPA 4QKUA 3OSVA 3UPUA 2QYZA 3P8DA 4CRIA 3CC2A 1OQKA 2F69A 2LCSA 3SWNA 5CVIA 4RCBA 1YWOA 4KGXB 3SD4A 3G6EA 3I9QA 1BK2A 3JSCA 2BKDN 2AZSA 1NM7A 2KXCA 2FZCB 4M78E 1WPYA 3M57A 3HSBA 4JRPA 5CKHA 1QCNA 2GBQA 1TS9A 1UUEA 1ZUUA 1X2QA 3RR6A 4BDYA 1F1BB 3HRUA 2ZGWA 4P5NA 1VQ9Q 1I8FA 3L2WA 4NS5A 1SPKA 2XD0A 4OMOA 1JU5C 1K8AR 1D3BA 1M1FA 3X24B 2EWNA 3I56Q 1LCKA 4GLMA 4OP0A 1PSEA 1A0NB 1VQNQ 2QEXT 2E65A 4C92F 1GFDA 1MGQA 1C0MA 2I2LA 3OMGA 3RKWA 2ED1A 5CQYA 1YITQ 4AFZC 2MIOA 4J9GA 2DZCA 2A7YA 5GAN5 1KQSS 2AK5A 2L3RA 1VQPQ 2V1RA 1KQ1A 3RIRA 2JS0A 2AZVA 1KHCA 3LW5E 3SEMA 1O9SA 1XQHA 1Q82U 4C92B 1YI2T 3JV3A 4BI8B 3OQ5A 4RTTA 3NTKA 3L2UA 3CCMT 3NGPA 2O4XA 4AG2C 9ATCB 5FU7C 1E7OA 3LX7A 3HTRA 2JXBA 2VV5A 4JJBA 3CMET 2HQXA 3J7AF 2M02A 2R5MA 3VRYA 1M5Q1 1YHQA 5GMKi 2DAQA 3GF5A 4C8QE 1ARKA 1K1ZA 5HCKA 2ZAEA 2PVGB 3N5BB 4N0AC 1UJ0A 4ZNXA 4XTWA 1PD1A 3J81E 4Z02A 1OZ3A 4X1VA 2VKNA 3CCRT 3FJ5A 1UJYA 4UC4A 4N4HA 1IO6A 3I55A 3QPHA 4E7ZA 1QVFA 2OTJQ 5J3BA 4M78C 2COZA 5CR2A 4J9EA 3GOXA 3VRZA 1QMCA 1BCMA 2G3RA 1OU8A 1SRMA 2K4YA 2HL3A 3M9QA 5KYYA 1K0SA 1YJWT 2XK0A 2BIVA 2KROA 4IUVA 2P0KA 2RK1A 3DB4A 4J83A 1IGQA 1YJ9A 1Q7YC 3X28B 4LDXA 4C92G 2JZ2A 3RNJA 1VQ9T 4BY6B 3M56A 2J6KA 4JDSA 3QJ6A 5HK0A 4CC2A 3EH2A 1O75A 4F17A 4WCIA 4F7UE 5J26A 4N0AA 2EQUA 2JM8A 2CZ6B 1RAEB 3CCET 4L59A 4AT1B 2KE9A 2ZZDA 1FXXA 4FT2A 1IGUA 2K7AA 3HPWA 2KXDA 1TUDA 4RTZA 4PJOE 4O6JA 1VQPT 2JN0A 3JB9J 3E2UA 3QJYA 1OULA 1NE8A 2B8AA 2DYIA 1AWJA 4M78A 4PNOA 4M78F 4ZGEB 1UFFA 2L3PA 3LLRA 3LGLA 5CCAA 4A54A 2ENMA 1TTHB 2PTKA 3CC4T 4QQ6A 4MZPA 2BE7D 2DERA 3VUZA 1U06A 3I56A 3M58A 2DJQA 1JRIA 1X43A 4X9DA 1VQNA 2ECZA 1HD3A 5GANd 4IUPA 4OB3B 2AT1B 2QA4Q 2Y90A 1J3TA 5I11A 1YITA 2C0OA 1T3LA 3C95A 1H92A 4IUUA 3PNWC 4CC7A 2QQRA 2EYWA 1VQ4Q 3BFMA 1GBQA 2WSEE 2HD0A 4EMHA 3OYAA 2C0TA 3LYIA 4IUTA 3REBB 5CK9A 1M3AA 1GCQC 2J6OA 3RUXA 3MPUB 2XG8D 4LE9A 3EG9A 3INZA 1X2KA 1WLPB 2K3XA 3CD6Q 4LUDA 2O88A 1UGQB 3CXCP 2D8HA 1LJOA 1LVKA 3EGDB 4M78D 2E5KA 2KRSA 4HA8A 1QP2A 1CKBA 2RQTA 1M2VB 4PJLA 4PL6A 4EIKA 2RHIA 3L2RA 3PGGA 1T0JA 3E9FA 1RL2A 1BIBA 2HSEB 4C8QF 1T3SA 2RJDA 4A4HA 1G8XA 2F5KA 5LJ3d 5L8RE 2NUPB 1I5OB 1Q81U 4OMLA 1I5LA 3NMZC 1KFZA 2KRMA 1B3QA 5GAOr 1OI1A 4II1A 2NUTA 2OTJA 4ORZA 1FMWA 1AWXA 4ZN3A 2OI3A 4PJOC 4LN2A 2KT1A 4C8QB 2EQKA 1NJIR 3SB2A 2LTOA 2CP5A 3M59A 2LJ0A 2D6FA 1W2BS 2W0ZA 2YUOA 3JCMP 1Q86R 2P4RA 2BUDA 1OOTA 1VQOQ 1GCQA 3EGUA 2ZPFB 3CPWP 2RA2A 3A8HB 4KH1B 1QVGP 2FB7A 3OA6A 2L5QA 4HVWA 3C4SA 4LXCA 2RHUA 5I2MA 2K5IA 3JCMf 1RAHB 1KC8R 3MP1A 1QKWA 3M55A 3THKA 5GAN2 5GAOl 1G3SA 1U8RA 2NWMA 5KYXA 2CT3A 3META 2E70A 2MWOA 2M51A 3PTAA 1EFNA 4Y28E 2AKKA 4PKCC 2D0NA 3JCMb 2QA4T 4ZN1A 1UE9A 2F5TX 1BI2A 1YJNA 4F7UF 2DIGA 2K2VA 4LDYA 1BKBA 1I0CA 4C0ZA 3M5AA 4XU1A 3FB9A 2DXCA 2YRVA 3QKJA 5DY9A 3KFVA 1NPRA 4FYYB 2MAMA 2A37A 2DRKA 4PJOA 3CPWA 1D09B 3FC3A 2KYMA 4C0DB 3OS5A 2JW4A 1YFNA 4F7UB 2ZPHB 3OW2S 3VV0A 2V1QA 4QVZA 1B7TA 1WHKA 6AT1B 1WJQA 3A5ZB 4MDXA 3OYEA 2K5FA 3H9NA 3EHQA 5GANf 4C8QG 5KCHA 3CCUA 1WHHA 1UDLA 3M4GA 4ATOA 2RHYA 1VQ8Q 4QT7A 4C92E 5KH6A 2RQWA 1OEBA 2RQUA 3UF4A 2PU9B 2QAZA 3VU3C 1GFCA 4JRKA 1WHJA 1PHTA 1VQ4A 3VKIA 3OYYA 2CUBA 1WJSA 3FIFA 1WXBA 1SEMA 3QUIA 2DPPB 2ATCB 2CP6A 2LRQA 2X3XD 1VQ5A 2YXYA 2ED0A 2CS7A 4RTUA 2DM1A 4E7LA 2QTXA 1KG1A 5DLQE 3CD6A 4BDZA 3HFOA 5CIUA 2M1HA 2RJCA 1JEGA 3S3MA 1AVZC 2EPDA 2KAFA 2YUNA 4BUGA 4LNPA 2K5LA 2RB6A 3E19A 4PJOD 1Q86C 1HJDA 1VQOT 1ZLMA 3CCQT 3EGXA 1ABOA 2A3LA 4BACA 4JS4A 4PFZA 3RESA 2DFUA 5LJ3f 5KYNA 3BY7A 3EFSA 3UWNA 3DLLA 4F7UG 1TUGB 1RAAB 2IG0A 1WXTA 3WXMB 4J8OA 3MJXA 1Y96A 2DO3A 2LMJA 1Y07A 3ER0A 2QQAA 1LPLA 1CSKA 5IHKA 2DYBA 3CCJQ 1Q81C 2RNAA 2DXUA 5KYWB 4EPCA 1OZ2A 2LQWA 2AIRB 3AT1B 2M0YA 3S3NA 3NFCA 1ZHIA 3G4SQ 2EQIA 2DL5A 1S72A 5GMKl 1VQ6A 4J6YA 1WHGA 1BCOA 1PC0A 5AYFA 3CMEQ 2JNGA 3OS2A 1VQ7Q 3NTIA 1YNZA 3FJPA 4A4KA 2EKHA 1M2OA 2MYSA 2FHDA 4OMNA 4JZ3A 2LDMA 4J9DA 1K9MU 3M0UA 1K73U 2LCLA 1AZGB 2LJ1A 3VS1A 3NPFA 4C92C 4OVAA 4IIOA 2A08A 4RMOA 4E7IA 4MMLA 3QWYA 4HCZA 3CCRQ 2IPOB 5GAMd 1D1CA 1KSWA 1I4K1 4ZTFA 2F2VA 4DBHA 1OPLA 2L3QA 3VUBA 3ZBDA 3QHSA 2NYSA 5IN1A 1G83A 4HCCA 1QLYA 4E47A 4JZ4A 2ABLA 1BIAA 2F2WA 4NL3A 1H3ZA 2RD1A 1ZQ1A 2EGEA 1YJWQ 5FLXE 2DEUA 4RUGA 1ACMB 3CCVT 2JTMA 1VIEA 3DKMA 8ATCB 2VB6A 4M75E 3CBOA 5LJ5f 4IKFA 1WNLA 1Q7YR 3MP6A 4A53A 1BI1A 4IUQA 4Z88A 4FU6A 1XOVA 3LH5A 2O01E 2W10A 1VQ8A 1M30A 1JJ2S 1WQ7A 3JCMV 3V8JA 1V29B 3WVDB 2CGHA 5GANg 2BE9B 2LX9A 3JCMh 4B9WA 4DA4A 4EMGA 1TSFA 1Z9QA 1IHVA 1K76A 4OGEA 4R56A 2J05A 4C92A 5GAN6 2A36A 1AWOA 3CCEQ 2NUZA 2E6ZA 2XKOC 4C0FA 4E2FB 3TQ7P 2DF6A 3VJPA 4KUIA 4QQGA 2H3JA 2KQWA 3QO3A 1Y7XA 3CCJT 4BY6C 4J9HA 2EIFA 1R0CB 4X9CA 3R6NA 4HCBA 1B34B 4JPBW 2MWPA 2E64A 1QVFP 4N4IA 1TUCA 4FYWB 2YHTA 1IRXA 3G4ST 1AOJA 4LDUA 2XIDA 4FCYA 3ZFJA 4KH0B 1VQKT 2GGRA 3CC4Q 2E3IA 3PT9A 5D6XA 4A4FA 2OTLT 4Q5WA 3A8LB 4BI4A 3CCLT 3TEEA 5A2QE 2QEXA 1VQ7T 4OB0B 1TXQA 4XU3A 5GANh 2EKOA 3A8MB 4KRTA 3HRTA 2DZ9A 3OYJA 2E1HA 4QQDA 2E10A 2FPEA 2RQRA 1N9RA 5LJ3g 2VYTA 5FU6B 2DMOA 1N8RU 2CZ0B 2O9VA 3BW1A 1KD1U 3VS0A 5KYUB 1GBRA 1RAGB 4CC3A 1YI2A 3OYNA 2GQVA 2DE0X 2E41A 3M0SA 4C92D 5CAIA 1VOMA 5LL6S 2BTTA 1ZUYA 3CCMA 1C1AA 1MMGA 1QWFA 2DLPA 4DQ2A 4A63B 2DK3A 4E7HA 1Q82R 3RMQA 5D6YA 3OS0A 1WYXA 3EHRA 3CMEA 2KEAA 1VQLQ 2HDAA 2QI2A 4RG2A 2H3EB 2VUBA 3O5ZA 1LOJA 2KYBA 2LZ6B 4X34A 3I5RA 5DLOA 3OB9A 1VQMT 2RI5A 3CC7T 4M77E 1UGRB 2KY9A 1OU9A 1LNXA 3VS4A 1YN8A 3QG1A 4AFQC 5GAMf 3CCRA 2RN8A 3SFMA 2QASA 4E6RA 1K73C 3JCMd 4DEYA 1WQWA 5LJ3h 4D8KA 1RUWA 5FWCA 2JT4A 3L1AA 2HL5C 4XAXB 3HP9A 1OPKA 3CEYA 1VYTA 2HEQA 3VYGA 3EFRA 2L8DA 1NPPA 5IXFA 2DKGA 1YJWA 5IH2A 1ZBXA 1NZ9A 3UA7A 4B9XA 1RACB 2D8JA 1NLPC 1M3BA 4J9BA 2KMTA 2QGGA 4PLIA 3JB9I 1VQ9A 3JCMX 1PKSA 2A0FB 2RQVA 4C5GA 1GXIE 1RI0A 4LUEA 4RG8A 4M75F 3QSUA 5GMKh 1M27C 3FEOA 4HVVA 3QYHB 4XTXA 1D0XA 2C0IA 3SDZA 4C8QC 1PRLC 2O2OA 4JS5A 2AHJB 3KBGA 1ZSGA 4J9IA 3CCEA 5DM7R 5GAOn 4L6V5 1BB9A 2QDYB 2RO0A 2RMOA 3LH0A 3VS6A 2E3HA 1MV3A 2DL8A 3OYHA 4M75B 4MZMA 1VQPA 2EBPA 1MHNA 1PG5B 3AHUA 4ZGDB 3CBPA 5I22A 4EDUA 2PZ1A 1QQJA 2HCKA 3EGDA 1D1BA 1V76A 1XTDA 3KXTA 1ZA2B 3DLMA 1M2VA 4JUVA 1R0BG 4KT0E 1QP3A 1Q82C 2FPDA 3QDRB 3CC4A 1ZSZB 3JB9F 3CPFA 3FRNA 7AT1B 1VQLT 3EFOB 2NUPA 4BE1A 1VA7A 4Z89A 1KIKA 5LJ5h 2FEIA 1RADB 1QCFA 2D9TA 1C6VX 3ASKA 4M7AE 1WHMA 1RLQC 2V8JA 1NEBA 4C0DC 5GANj 4C8QA 4BI3A 2DIQA 2L89A 3OSSC 1M1KU 4GLKA 4XTUA 1X69A 3M0RA 1AT1B 2LQKA 5C6SA 1N8RC 2E12A 4AG1C 2FRYA 4K11A 2QTVA 1KD1C 1YIJQ 3DB3A 1MUZA 2EYYA 2DVEA 2YWWA 4AMCA 3ME9A 2YUPA 1M90U 2O31A 5CO7A 2LC4A 2X9HA 3JAME 1KQSP 1AZEA 3L42A 4DBQA 4JLIA 2X4XA 3PFSA 2V8KA 1T0HA 2ZPIB 4M75G 3UA6A 2MI6A 1KK7A 2VASA 4OMFB 3JCMJ 2JTEA 1G2BA 3HKSA 3CCQQ 4D8DA 1B07A 3PVLA 1FWZA 2DXTA 3EG2A 2DNUA 1NEGA 3UATA 4RTVA 4J6WA 1RLPC 3R6OA 1EX4A 4QVDA 3RKXA 3MHXA 4EMKB 2OAWA 3OBWA 3VS3A 1X01A 1UHFA 5KE2A 2K3BA 1NYGA 2GCXA 4M77F 3MEAA 5GAMg 3C94A 4XU0A 4KGVB 2KK4A 5A0GA 1XJWB 1YBYA 1Q81R 2JUFA 5LJ3j 4PLLA 3RDVA 2JVVA 2L0AA 2GTOA 2DL3A 4F7UA 2R5AA 4Y91A 4C8QD 5HY6A 4OF1A 2JTFA 1KQSA 2HAXA 1GL5A 2X4JA 2LT4A 3M0QA 8AT1B 3G71Q 1QKXA 4M77B 3JB9G 3GNFB 2OJ2A 2FZGB 4QVCA 5D6WA 4ZTJA 1G3YA 2PUKB 4OGCA 3GBQA 4QW2A 2KSSA 2YLCA 1N27A 3V7SA 1G5VA 2FZKB 2CZ7B 3G6EQ 1QVPA 2SEMA 1OX9A 2XMFA 4HXJA 4FYXB 5LJ5d 5GMKj 2QA4A 1DJ7B 1VQ5T 3OYLA 2FPFA 3JCMe 5GAMh 4XTYA 1M4ZA 3RERA 2MMPA 1AWWA 1KHIA 1JB0E 4M7DF 2QQBA 2ZPGB 2FL7A 2RF0A 3CQTA 2EJ9A 1W6XA 2GQIA 2P84A 2LP5A 2GFAA 2RJEA 2HKQB 3E1SA 3NTHA 1YIJT 4HCKA 3GNGA 2GF7A 3CBMA 2IVWA 1UHCA 4DBFA 4M7DB 1D0YA 3OYDA 3CCVQ 2DL4A 4HT8A 2XDBA 1M9SA 2J7IA 2WSCE 2PUOB 2E4HA 2PVOB 3H0HA 2HQHA 3D7SB 3V8KA 3RKYA 1TH7A 2K79A 2MOXA 3PE0A 4M77G 5CQXA 4WTOB 1H641 1JQQA 1YCSB 3QDFA 3REAB 1QCOA 3CCST 3TU4K 2CUDA 4D6WA 3A98A 2CP0A 1HXDA 4BD3A 4FT4A 5KYWA 5GANe 4FL6A 2JOYA 3H0FA 3MEWA 4M7AF 4WF2A 2VGNA 4NL2A 2EGCA 2HBPA 4Y92A 3TCJA 1RABB 4ME7A 4A4EA 3OY9A 1N5ZA 1M1KC 1BBZA 2DBMA 1W1FA 1WX6A 3HHTB 2LCCA 3CMAT 5CKEA 3JB9H 2EW3A 3PMTA 1YHQQ 2XHCA 4C5IA 4M7AB 2O9SA 5AT1B 2MCNA 3G71T 1M90C 2DXBA 1SRLA 1VQOA 1IB8A 3VS2A 3CCQA 1MNDA 1VQKQ 1FX7A 4FSSA 3TVTA 2VVKA 1Y57A 2OTLQ 3QBYA 4OB1B 3CCLQ 3M54A 2XDDA 3ZL7C 3EAEA 1MMNA 1UGSB 3CC2T 1R77A 4XU2A 2SRCA 5C0MA 4HT9A 3M0TA 5FRNA 3OYMA 3G6ET 2X3WD 4AFUC 4M7DG 3JCMg 3EG3A 2MPXC 2DL7A 1GRIA 3GPLA 1YWPA 3MP8A 2LNVA 5KCOA 2PQWA 2CSQA 5LJ3e 1VYUA 2I0NA 2KDSA 1NBEB 1QW1A 1ZBJA 2XICA 2WSFE 2DETA 1IXDA 1K8AU 1BI3A 1YJ9Q 2Z0WA 3MKDA 3OYGA 2E5QA 5FRMA 3L2VA 4MZTA 4FW1A 3URGA 5FU6C 1PNJA 2ROTA 3TSZA 5CKDA 3BE3A 3IQLA 1W2BP 2QGFB 2L3SA 2WACA 1VQMQ 3RMSA 1WGSA 3CC7Q 4KUDK 1RAIB 4LDVA 1W70A 2ZCFB 2YDLA 4M7AG 1PKTA 1K9MR 1K73R 5GMKe 3EG1A 2V26A 2BZXA 4M4ZA 3CXCS 1JXMA 1FMVA 2DRMA 3SWNB 3OYCA 3O8VA 3HL8A 4GY5A 5EC7A 1SKUB 5GAMj 1B34A 5CKBA 1OYXA 4C0GA 3ZEHA 4C5HA 2YSQA 3G7ZA 2EAYA 5GJVB 1WZOA 3PIOA 1ABQA 1PD0A 2HMAA 4ELZC 3CCVA 2R58A 5GAN7 5I2SA 4OMPA 4V2SA 2LQ8A 3VS5A 1R8OB 5EG2A 1YHQT 1W2BA 1VUBA 2LVMA 2M9UA 2QK0A 2GNCA 4BE0A 1IREB 2YRCA 4XQ3A 2J06A 4CI0C 3OS1A 3GLXA 2XDPA 1D3BB 2QQ9A 3OW2P 4KBMB 4Z8AA 1D1AA 3Q1JA 5KYUA 2FO0A 4J7FA 5FROA 3A8OB 2QXFA 1OX8A 4E7SA 5LJ5e 2OX7A 3CPWS 2DEQA 1SG5A 4F16A 3I55T 2H8HA 1QVGS 4ELYC 4J5YA 2LQNA 3BDUA 4GBQA 2RHZA 1RI9A 3CCJA 1E6GA 4JRIA 4RTXA 3QXEB 2F1LA 4FIBA 4OB2B 4R55A 3MEVA 2X51A 3C12A 2VC8A 2ZPEB 5M9OA 1MV0B 3EH1A 3G4SA 2O4XB 5J39A 1VIFA 1PCXA 2AKLA 2RPNA 1YJ9T 1VQKA 1UG1A 1Y71A 2BZYA 1JBMA 4N4GA 2OTLA 1V1CA 2CP2A 2K2MA 3CCLA 3OW2A 1VQ7A 2FG0A 4M75C 1Z9ZA 2EJGA 4AFSC 1BU1A 3OYFA 1I81A 3L2QA 2JMCA 2DTOA 1KQ2A 3V7CA 2P0QA 4C5EA 4PFOA 2DTIA 1FMKA 1K9MC 2CREA 2IIMA 2P4TA 2MF2A 4ESRA 4A4GA 2CSIA 1ZSZC 1N8RR 4RKUE 2VXEA 4J9CA 5IHIA 1KD1R 4FM4B 2DA9A 2D0QB 3TSWA 1N6AA 4KULA 2X35A 1IZ6A 3FLGA 2X4WA 1TOVA 2KRNA 2D1XA 1VYVA 2CT4A 4E7KA 3BDLA 5KYYB 5I21A 3A8GB 3E9GA 1K8AC 2EVRA 4XTVA 4E7JA 1S1NA 3I56T 1WJRA 2K57A 1VQNT 5FU7B 1VQMA 3CC7A 1QWEA 3EG0A 2EYZA 1G3TA 4F04B 1PWTA 2M0OA 2ESWA 2DILA 1YITT 1YJNQ 3QZ5B 3JCMc 2HZYA 4M75A 5IXBA 3A1PA 5LJ5g 1PM3A 2A28A 3S6WA 1Y0MA 3MEUA 3S3OA 1M8VA 3JCMQ 1UTIA 3H41A 2DJZA 4XK8E 1EZZB 1WDXA 1AD5A 1UECA 1SHGA 4M7DE 1YP5A 2JS2A 5GJWB 5GAMe 3F70A 2X4YA 3V7RA 1UB4A 1UGVA 1ZSZA 4DOWA 2ROLA 2LNHB 3EFOA 4R0KA 4M78B 4EMKC 2YLBA 4JJCA 3CCUQ 5GAN8 1K0XA 1E6HA 1SSFA 4LDWA 1XNIA 4TVRA 1U3OA 4VUBA 4FYVB 2CDTA 3H8ZA 2C06A 1G3WA 3TREA 3C0CA 2HSPA 2FRWA 1MNEA 1HK9A 2HBWA 3X26B 2R57A 2GFUA 1X27A 4M77C 1NJIU 1VQ5Q 1AHJB 5FW9A 4O5VA 1X6BA 3VS7A 2OTJT 2E6NA 1JO8A 1Q86U 4M75D 1JJ2P 3VYHB 1PSFA 1MMAA 3GIBA 3H0IA 1CKAA 3L2ZA 2FVUA 3U23A 1ZA1B 4LD9K 1X6GA 1KC8U 1WA7A 5A0DA 3OYKA 1NYFA 2CKKA 1SSHA 4YTLA 3EG9B 1NG2A 2K3YA 2PVDB 3V8LA 3PVQA 2LJ3A 4PK4A 1VQLA 1M1GA 4J9FA 4OMMA 2Y4XA 4EMKA 2KGTA 4IURA 1WI7A 1GCPA 3UDCA 2XI9A 4DOVA 3KUFA 2VGMA 2DD4A 2RI3A 4FW2A 3MO8A 3OYIA 4PJNA 2QQSA 4JJNK 1WIEA 3CCSQ 4M78G 4DBRA 3JB9D 1BI0A 1JJ2A 1YJNT 2XU8A 2RH2A 1H3HA 3CXCA 2EYXA 4M77A 4M7DC 3M0PA 3UT1A 2NUTB 1JXOA 1Q95G 2HQEA 2KT8A 1S72Q 1M1KR 4HKEA 1TU0B 1VQ6Q 4PJMA 2EYQA 3CMAQ 2LT1A 3P8HA 2RI2A 4L5GA 1WHLA 2COYA 2PNIA 1WXUA 3MCAB 1M90R 1SHFA 2V8IA 3NHNA 5A0LA 4PJJA 2DTHA 2J6FA 5CKFA 2L2PA 4LD6A 3CCUT 5L23A 4BB7A 1U1SA 1WFWA 2YUQA 4RCCA 2KVQG 2EQMA 1NLOC 2CZ1B 3X25B 3CC2Q 4PFPA 3FDRA 2DBKA 2JMAA 3M53A 5GAOm 2HNIA 2G6FX 2Y4YA 1EIFA 5KYXB 1QVFS 3P8BB 1P92A 2BZ8A 3QYGB 3QZ9B 1VQ4T 3G1JA 1H8KA 4M7AC 2GTJA 5KE3A 4PJOF 2QDLA 1K9AA 4F14A 2RM4A 5GAN3 1QVGA 2EJFA 3M4YA 1UGPB 3HFNA 4M7DA 2OAUA 3LGFA 3CD6T 2VXFA 2ZPBB 2M16A 4M77D 4RTWA 1MMDA 1SF9A 4J6XA 4PJOB 3OYBA 4OMQA 2CP7A 2KBTA 3QIIA 1TWBA 1I07A 2YRDA 2CH4A 1ZX6A 2YT6A 3T9NA 2KR3A 3LWIA 1U1TA 3H6ZA 1W4SA 3J80E 5IT9E 1I1JA 2EGAA 2MK5A 4MMKA 2B86A 2RJFA 4IIMA 3JCMW 1HSQA 5LJ5j 1FYNA 1AEYA 2NLUA 1RAFB 4JLGA 1NJIC 2F2XA 1X75C 2EQJA 4M7AA 3X20B 3PMIA 3JRZA 2EFIA 2QG9B 1YCYA 3ULRB 2DX1A 5IAYA 1YIJA 1S72T 5D7UA 2JM9A 3HRSA 3LWHA 2VWFA 4J7IA 4KGZB 3SHWA 1U5SA 1VQ6T 5HK3A 4M7DD 2KNBB 4ANJA 2P0PA 2QEXQ 1KC8C 1M3CA 3I5SA 3OMCA 2HKNA 4FSXA
chains in the Genus database with same CATH topology
1N9SA 4C5GA 3M55A 5GAN2 1GXIE 1RI0A 3SWNC 5GAOl 1IREB 4BE0A 4RG8A 4XQ3A 4M75F 4NOYA 4CI0C 5HKCA 3QSUA 5GMKh 1G3SA 3FEOA 3GLXA 3OS1A 1U8RA 2E70A 2XDPA 2MWOA 1D3BB 2RHXA 3META 3QYHB 4XTXA 3SDZA 4C8QC 3PTAA 4Y28E 4XTZA 2QQ9A 4KBMB 4JS5A 3CCSA 3WVEB 2AHJB 3KBGA 3Q1JA 4PKCC 4J7FA 3CCEA 5FROA 3JCMb 5DM7R 3A8OB 4PJOG 3GP8A 2QXFA 2QA4T 4ZN1A 5GAOn 5LJ5e 2F5TX 4L6V5 3CPWS 1BI2A 1YJNA 4F7UF 2DIGA 2K2VA 4LDYA 1BKBA 2CYZB 2DEQA 2QDYB 2RO0A 4C0ZA 3LH0A 3I55T 3M5AA 4XU1A 4ELYC 3FB9A 1QVGS 2DXCA 5GAOq 3OYHA 2YRVA 3QKJA 4J5YA 4M75B 4MZMA 5DY9A 1VQPA 1NPRA 1Y96B 1MHNA 3BDUA 5GAN4 2MAMA 2FYKA 3AHUA 2RHZA 1BYMA 4ZGDB 3CCJA 4JRIA 3CBPA 3QXEB 4EDUA 5GAOp 4PJOA 3CPWA 3CMAA 3FC3A 1UEBA 2DD5A 3OS5A 4FIBA 4C0DB 1XTDA 4OB2B 4R55A 3MEVA 3KXTA 1Q7YU 4F7UB 2ZPHB 3OW2S 1X6OA 4JRQA 3VV0A 3DLMA 3C12A 2VC8A 3OBYA 2ZPEB 4JUVA 4QVZA 4KT0E 3G71A 5M9OA 4M7AD 1WJQA 1QP3A 3A5ZB 2O4XB 3G4SA 4MDXA 5J39A 1VIFA 1Q82C 3CC4A 3QDRB 3OYEA 4BE2A 1VQKA 1YJ9T 3JB9F 3CPFA 1Y71A 2RK2A 4ZGJB 2K5FA 1JBMA 4N4GA 3FRNA 5GMKm 5GANf 2OTLA 4C8QG 1VQLT 5KCHA 4MDWA 3CCUA 4BE1A 1VQ8T 3PIPA 3CCLA 3OW2A 3M4GA 3OSVA 2RHYA 3UPUA 4ATOA 1VQ7A 4M75C 3P8DA 2EJGA 4CRIA 5LJ5h 3CC2A 4C92E 3OYFA 1I81A 2F69A 3L2QA 2D9TA 3SWNA 5KH6A 5CVIA 3ASKA 4M7AE 4RCBA 2DTOA 3SD4A 2PU9B 3G6EA 1KQ2A 3V7CA 2V8JA 3VU3C 4C0DC 5GANj 2P0QA 4C8QA 4BI3A 4JRKA 1VQ4A 2DIQA 2L89A 3OSSC 3JSCA 1M1KU 4C5EA 2BKDN 3VKIA 3OYYA 2DTIA 1K9MC 1WJSA 2P4TA 3FIFA 4GLKA 4XTUA 3QUIA 1WPYA 2DPPB 2LRQA 2LQKA 2MF2A 3M57A 4M78E 2E12A 4A4GA 5C6SA 1N8RC 4JRPA 1VQ5A 3HSBA 4RKUE 5CKHA 2CS7A 1KD1C 2VXEA 3DB3A 4E7LA 2QTXA 4FM4B 1KG1A 5DLQE 2DVEA 1M90U 2D0QB 3ME9A 1N6AA 3CD6A 4BDZA 5CO7A 2LC4A 4KULA 2X35A 4BDYA 1IZ6A 3FLGA 3HFOA 5CIUA 2RJCA 2M1HA 3JAME 3S3MA 3L42A 4JLIA 2X4WA 2X4XA 3HRUA 2KAFA 3PFSA 2V8KA 2ZGWA 4P5NA 2ZPIB 1I8FA 4BUGA 4E7KA 2K5LA 2RB6A 3BDLA 3L2WA 3E19A 4NS5A 2XD0A 4PJOD 5I21A 1Q86C 3A8GB 3E9GA 1K8AC 4M75G 1VQOT 4XTVA 2MI6A 1D3BA 3CCQT 4E7JA 4OMFB 3JCMJ 3HKSA 3I56T 1M1FA 2A3LA 4BACA 1WJRA 3X24B 4JS4A 2K57A 2EWNA 3RESA 1VQNT 1FWZA 2DXTA 4OP0A 5FU7B 1VQMA 1PSEA 3CC7A 5LJ3f 2QEXT 2E65A 4J6WA 1G3TA 4C92F 3R6OA 3BY7A 1MGQA 2M0OA 3EFSA 3UWNA 3OMGA 2I2LA 3DLLA 3RKWA 4F7UG 1YITT 3QZ5B 3JCMc 3RKXA 4QVDA 3MHXA 4EMKB 5CQYA 2IG0A 3OBWA 3WXMB 4J8OA 4M75A 2DZCA 1X01A 1Y96A 2A7YA 2DO3A 5KE2A 3ER0A 1Y07A 5LJ5g 4M77F 2GCXA 5GAN5 1KQSS 2L3RA 3S6WA 2QQAA 1KQ1A 3MEAA 3C94A 3MEUA 3RIRA 5GAMg 3S3OA 4XU0A 2KK4A 1KHCA 3LW5E 5A0GA 3JCMQ 1M8VA 1O9SA 1XQHA 1Q81C 1YBYA 2DJZA 4XK8E 2JUFA 5LJ3j 1Q82U 4PLLA 2JVVA 4C92B 1YI2T 4M7DE 4F7UA 2R5AA 4BI8B 2DXUA 4Y91A 4C8QD 3OQ5A 4OF1A 5HY6A 4EPCA 5GAMe 1OZ2A 2JTFA 1KQSA 3NTKA 3F70A 3L2UA 3CCMT 2HAXA 2X4JA 4M7AC 2O4XA 2LT4A 2X4YA 3V7RA 3S3NA 3NFCA 1ZHIA 1UB4A 4M77B 5FU7C 3LX7A 4DOWA 1S72A 3JB9G 3GNFB 5GMKl 1VQ6A 2VV5A 4J6YA 3CMET 2HQXA 4M78B 3J7AF 4EMKC 2YLBA 5AYFA 2R5MA 2JNGA 4QVCA 5GAN8 5D6WA 3OS2A 1M5Q1 4ZTJA 1YHQA 1SSFA 4LDWA 1XNIA 4TVRA 2DAQA 3GF5A 5GMKi 3NTIA 1G3YA 2PUKB 4OGCA 4C8QE 3FJPA 4VUBA 4A4KA 4QW2A 2FHDA 2PVGB 3N5BB 2KSSA 2YLCA 4N0AC 2LDMA 3H8ZA 1K9MU 1N27A 2LCLA 1G3WA 1K73U 2C06A 3TREA 3V7SA 1G5VA 4XTWA 2CZ7B 4C92C 4OVAA 3J81E 4Z02A 1OZ3A 1QVPA 3CCRT 4RMOA 4E7IA 4MMLA 5LJ5d 4HCZA 1HK9A 5GMKj 3X26B 2R57A 5GAMd 2QA4A 1DJ7B 2GFUA 1VQ5T 4M77C 4UC4A 4N4HA 3OYLA 1I4K1 4ZTFA 1NJIU 3JCMe 3QPHA 3I55A 1AHJB 5GAMh 4O5VA 2OTJT 4XTYA 1QVFA 1M4ZA 3RERA 2MMPA 3VUBA 5J3BA 2E6NA 4M78C 3ZBDA 1Q86U 1KHIA 1JB0E 4M75D 3VYHB 1PSFA 3GIBA 4M7DF 3QHSA 2QQBA 2ZPGB 2FL7A 5IN1A 5CR2A 3GOXA 2EJ9A 2G3RA 4HCCA 4E47A 2K4YA 3M9QA 3L2ZA 2FVUA 1BIAA 4NL3A 2GFAA 2RJEA 1YJWT 2XK0A 2RD1A 3E1SA 4LD9K 2BIVA 3NTHA 1H3ZA 1ZQ1A 5FLXE 4IUVA 1YIJT 1KC8U 2P0KA 3GNGA 2RK1A 5A0DA 2GF7A 3OYKA 3DB4A 3CBMA 2IVWA 4J83A 2CKKA 2JTMA 4YTLA 3CCVT 1VIEA 4M7DB 3DKMA 1YJ9A 3OYDA 2K3YA 3CBOA 4M75E 1Q7YC 2PVDB 5LJ5f 4HT8A 3V8LA 4IKFA 1M9SA 1WNLA 2XDBA 3X28B 2WSCE 2PUOB 3MP6A 1BI1A 4IUQA 4A53A 2JZ2A 2PVOB 4FU6A 1XOVA 1M1GA 4BY6B 4C92G 1VQ9T 1VQLA 3M56A 2Y4XA 2O01E 4EMKA 1VQ8A 4IURA 3V8KA 3RKYA 1JJ2S 1TH7A 4JDSA 1WQ7A 3QJ6A 5HK0A 3JCMV 3V8JA 1V29B 3WVDB 1O75A 2CGHA 4M77G 5GANg 5CQXA 2LX9A 3JCMh 2XI9A 3UDCA 4B9WA 4DOVA 4F7UE 1H641 4DA4A 3KUFA 4EMGA 5J26A 2VGMA 2DD4A 2RI3A 2EQUA 3MO8A 4N0AA 3OYIA 3CCST 3TU4K 2QQSA 4D6WA 4JJNK 2CZ6B 4OGEA 4M78G 4L59A 4R56A 3CCET 4C92A 5GAN6 3JB9D 1HXDA 4BD3A 4FT4A 2ZZDA 1BI0A 2E6ZA 2XKOC 1JJ2A 1YJNT 1FXXA 4FT2A 4C0FA 5GANe 4FL6A 2JOYA 2XU8A 3MEWA 3VJPA 2RH2A 4M7AF 4KUIA 4WF2A 2VGNA 4NL2A 3CXCA 3HPWA 2HBPA 3TCJA 4M77A 4O6JA 1VQPT 4M7DC 4PJOE 2JN0A 4QQGA 4ME7A 4A4EA 3OY9A 3JB9J 3UT1A 2H3JA 3QJYA 1M1KC 1NE8A 2KQWA 2HQEA 3QO3A 1Y7XA 3CCJT 2B8AA 4HKEA 4BY6C 2EIFA 4M78A 4PNOA 3HHTB 4X9CA 2LCCA 4M78F 3CMAT 4HCBA 4ZGEB 5CKEA 3JB9H 2EYQA 3PMTA 1B34B 2MWPA 2LT1A 2E64A 3LLRA 3P8HA 3LGLA 5CCAA 2XHCA 4N4IA 4C5IA 2RI2A 4L5GA 4M7AB 4A54A 3G71T 1M90C 2YHTA 2DXBA 3G4ST 3MCAB 4LDUA 2XIDA 2V8IA 3CC4T 3ZFJA 5A0LA 1VQOA 4QQ6A 4MZPA 1VQKT 3CCQA 2DTHA 3VUZA 1FX7A 3PT9A 3I56A 3M58A 5CKFA 5D6XA 4A4FA 2OTLT 4Q5WA 1JRIA 3A8LB 4LD6A 4X9DA 1VQNA 4BI4A 3CCUT 3CCLT 3QBYA 3TEEA 5GANd 5A2QE 4OB1B 4IUPA 2QEXA 4BB7A 4OB3B 1U1SA 1VQ7T 3M54A 2XDDA 2Y90A 4RCCA 4OB0B 3EAEA 1UGSB 2KVQG 2EQMA 3CC2T 4XU3A 2CZ1B 1YITA 4XU2A 2EKOA 3X25B 5GANh 1KC8C 3A8MB 5C0MA 3HRTA 3FDRA 2DZ9A 3M53A 5GAOm 2HNIA 3OYJA 2E1HA 2Y4YA 3C95A 2E10A 4QQDA 5FRNA 4HT9A 3OYMA 1N9RA 5LJ3g 2VYTA 1EIFA 4IUUA 5FU6B 3PNWC 3G6ET 1N8RU 4M7DG 1QVFS 3JCMg 3P8BB 1P92A 2CZ0B 3QYGB 2QQRA 3BW1A 3QZ9B 1VQ4T 1KD1U 3BFMA 3GPLA 5KE3A 2WSEE 3MP8A 2HD0A 4EMHA 2LNVA 4PJOF 5KCOA 3OYAA 2PQWA 1YI2A 2RM4A 5GAN3 1QVGA 2EJFA 5LJ3e 3LYIA 2GQVA 3OYNA 2E41A 4IUTA 4C92D 5CAIA 5CK9A 3M4YA 2KDSA 5LL6S 1QW1A 3CCMA 2XICA 3RUXA 2XG8D 2WSFE 1UGPB 4DQ2A 2DK3A 3HFNA 4M7DA 3INZA 2OAUA 4E7HA 3LGFA 3CD6T 1K8AU 1BI3A 3RMQA 2VXFA 2K3XA 2M16A 2ZPBB 4M77D 5D6YA 3OS0A 3OYGA 2E5QA 5FRMA 3L2VA 1UGQB 4J6XA 3CMEA 1LJOA 4PJOB 2QI2A 4M78D 4RG2A 3OYBA 4LDXA 4MZTA 2VUBA 3URGA 4HA8A 5FU6C 1QP2A 4PL6A 1LOJA 3QIIA 2RHIA 5CKDA 4X34A 5DLOA 3L2RA 3OB9A 1VQMT 2RI5A 3PGGA 3E9FA 3CC7T 1RL2A 1BIBA 2WACA 4M77E 3RMSA 4C8QF 1UGRB 1WGSA 2KY9A 5GAMf 1LNXA 2RJDA 3QG1A 4A4HA 3CCRA 4KUDK 2F5KA 4LDVA 5LJ3d 5L8RE 3SFMA 2ZCFB 3T9NA 1Q81U 1I5LA 1K73C 4M7AG 3JCMd 3LWIA 1U1TA 5GMKe 3H6ZA 1W4SA 1WQWA 5LJ3h 3J80E 5GAOr 5IT9E 1OI1A 4II1A 3CXCS 2OTJA 4MMKA 3L1AA 3SWNB 3OYCA 2RJFA 4ZN3A 3O8VA 3HL8A 4GY5A 3JCMW 4PJOC 4XAXB 5LJ5j 3HP9A 2NLUA 3CEYA 5GAMj 1B34A 4JLGA 5CKBA 4C8QB 1NJIC 1OYXA 2EQKA 4C0GA 3SB2A 1X75C 3VYGA 2EQJA 2LTOA 3EFRA 3ZEHA 2L8DA 4C5HA 3X20B 1NPPA 4M7AA 2DKGA 3PMIA 3M59A 3JRZA 2D6FA 2EFIA 3G7ZA 1W2BS 2EAYA 1YCYA 3JCMP 1YJWA 3PIOA 5IAYA 2BUDA 1ZBXA 1YIJA 1NZ9A 1S72T 2ZPFB 4B9XA 2RA2A 3A8HB 3HRSA 3LWHA 4J7IA 4ELZC 1VQ6T 3CCVA 2FB7A 2R58A 2L5QA 5GAN7 3OA6A 5I2SA 5HK3A 3C4SA 4V2SA 2LQ8A 4M7DD 2KMTA 1R8OB 2RHUA 5EG2A 2K5IA 2P0PA 4PLIA 5I2MA 3JCMf 1VUBA 3JB9I 1YHQT 3JCMX 3OMCA 1W2BA 2LVMA 1VQ9A 4FSXA 3MP1A 2M9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQD A;  1EIF A;  3G6E T;  1N8R U;  1QVF S;  3P8B B;  2G3R A;  1VQ4 T;  1Q86 C;  2E70 A;  1K8A C;  2MWO A;  1KD1 U;  1VQO T;  2MI6 A;  3CCQ T;  1YJW T;  3CCS A;  3HKS A;  3KBG A;  5FLX E;  3I56 T;  1YI2 A;  1YIJ T;  1QVG A;  1KC8 U;  3CCE A;  5DM7 R;  2QA4 T;  4ZN1 A;  1VQN T;  5LL6 S;  2KDS A;  3DB4 A;  1VQM A;  3CPW S;  2CKK A;  3CC7 A;  4YTL A;  3CCV T;  3CCM A;  2QEX T;  1YJN A;  1BKB A;  3I55 T;  1YJ9 A;  3LH0 A;  1Q7Y C;  1QVG S;  3DLL A;  1YIT T;  3LGF A;  3CD6 T;  1K8A U;  1VQ9 T;  1VQL A;  1VQP A;  1M1G A;  1NPR A;  2IG0 A;  1VQ8 A;  2DO3 A;  3ER0 A;  1KQS S;  3CME A;  1JJ2 S;  3CCJ A;  2L3R A;  4RG2 A;  3CPW A;  3CMA A;  1Q81 C;  1UEB A;  1YBY A;  2JUF A;  1XTD A;  5J26 A;  1Q7Y U;  1Q82 U;  3CCS T;  2JVV A;  3OW2 S;  1YI2 T;  1X6O A;  3CCE T;  4X34 A;  3G71 A;  5HY6 A;  3G4S A;  3A5Z B;  2E6Z A;  1VQM T;  1KQS A;  1JJ2 A;  3CCM T;  1YJN T;  3CC7 T;  1RL2 A;  1Q82 C;  3CC4 A;  1VQK A;  2JOY A;  1YJ9 T;  3CPF A;  3CCR A;  3CXC A;  1S72 A;  2OTL A;  1Q81 U;  1VQL T;  1VQP T;  1K73 C;  3CCU A;  1VQ8 T;  3CCL A;  3PIP A;  1VQ6 A;  3OW2 A;  1M1K C;  3J80 E;  3CME T;  1VQ7 A;  3CCJ T;  3J7A F;  5IT9 E;  4CRI A;  3CXC S;  2OTJ A;  2EIF A;  2JNG A;  3CC2 A;  1YHQ A;  4ZN3 A;  3CMA T;  1SSF A;  4TVR A;  1XNI A;  2MWP A;  3LGL A;  1NJI C;  2XHC A;  3G6E A;  1K9M U;  1K73 U;  2LCL A;  3G71 T;  3TRE A;  1VQ4 A;  1M90 C;  1NPP A;  3G4S T;  1M1K U;  1VQO A;  2LVM A;  3CC4 T;  3J81 E;  1W2B S;  1VQK T;  3OYY A;  3CCQ A;  3CCR T;  1YJW A;  1K9M C;  3PIO A;  5IAY A;  3I56 A;  1YIJ A;  1NZ9 A;  1S72 T;  2OTL T;  1N8R C;  1VQ5 A;  2QA4 A;  1VQN A;  3CCU T;  3CCL T;  1VQ5 T;  1VQ6 T;  3CCV A;  5A2Q E;  1KD1 C;  2QEX A;  3DB3 A;  1NJI U;  1VQ7 T;  3I55 A;  2LQ8 A;  5DLQ E;  2OTJ T;  2KVQ G;  1M90 U;  3CC2 T;  1QVF A;  1YIT A;  3CD6 A;  1YHQ T;  1KC8 C;  1W2B A;  1VQ9 A;  1IZ6 A;  5J3B A;  3JAM E;  1Q86 U;  1KHI A; 
#chains in the Genus database with same CATH topology
 1N9S A;  3SWN C;  4NOY A;  5HKC A;  4B6M A;  2COW A;  2LX7 A;  1OV3 A;  1HYO A;  2RHX A;  3EGX B;  4XTZ A;  3CCS A;  2CH4 W;  4JJD A;  3WVE B;  5IHN A;  1KJW A;  4PJO G;  3GP8 A;  1ZUK A;  1YI2 Q;  1PRM C;  4RTY A;  2CYZ B;  2K9G A;  2KI7 A;  1D0Z A;  3I55 Q;  5GAO q;  3CCM Q;  2DVJ A;  1TG0 A;  1Y96 B;  4HVU A;  1M8M A;  5GAN 4;  2FYK A;  1BYM A;  5GAO p;  1IHW A;  3CMA A;  1UEB A;  2DD5 A;  3RBB B;  2K6D A;  1Q7Y U;  5FWB A;  2JJ9 A;  1X6O A;  4JRQ A;  3QWX X;  3OBY A;  1K4U S;  3G71 A;  3I35 A;  4M7A D;  4CC4 B;  5ECA A;  4BE2 A;  2RK2 A;  4ZGJ B;  5GMK m;  4DEX A;  4MDW A;  1VQ8 T;  2CP3 A;  3PIP A;  4QKU A;  3OSV A;  3UPU A;  2QYZ A;  3P8D A;  4CRI A;  3CC2 A;  1OQK A;  2F69 A;  2LCS A;  3SWN A;  5CVI A;  4RCB A;  1YWO A;  4KGX B;  3SD4 A;  3G6E A;  3I9Q A;  1BK2 A;  3JSC A;  2BKD N;  2AZS A;  1NM7 A;  2KXC A;  2FZC B;  4M78 E;  1WPY A;  3M57 A;  3HSB A;  4JRP A;  5CKH A;  1QCN A;  2GBQ A;  1TS9 A;  1UUE A;  1ZUU A;  1X2Q A;  3RR6 A;  4BDY A;  1F1B B;  3HRU A;  2ZGW A;  4P5N A;  1VQ9 Q;  1I8F A;  3L2W A;  4NS5 A;  1SPK A;  2XD0 A;  4OMO A;  1JU5 C;  1K8A R;  1D3B A;  1M1F A;  3X24 B;  2EWN A;  3I56 Q;  1LCK A;  4GLM A;  4OP0 A;  1PSE A;  1A0N B;  1VQN Q;  2QEX T;  2E65 A;  4C92 F;  1GFD A;  1MGQ A;  1C0M A;  2I2L A;  3OMG A;  3RKW A;  2ED1 A;  5CQY A;  1YIT Q;  4AFZ C;  2MIO A;  4J9G A;  2DZC A;  2A7Y A;  5GAN 5;  1KQS S;  2AK5 A;  2L3R A;  1VQP Q;  2V1R A;  1KQ1 A;  3RIR A;  2JS0 A;  2AZV A;  1KHC A;  3LW5 E;  3SEM A;  1O9S A;  1XQH A;  1Q82 U;  4C92 B;  1YI2 T;  3JV3 A;  4BI8 B;  3OQ5 A;  4RTT A;  3NTK A;  3L2U A;  3CCM T;  3NGP A;  2O4X A;  4AG2 C;  9ATC B;  5FU7 C;  1E7O A;  3LX7 A;  3HTR A;  2JXB A;  2VV5 A;  4JJB A;  3CME T;  2HQX A;  3J7A F;  2M02 A;  2R5M A;  3VRY A;  1M5Q 1;  1YHQ A;  5GMK i;  2DAQ A;  3GF5 A;  4C8Q E;  1ARK A;  1K1Z A;  5HCK A;  2ZAE A;  2PVG B;  3N5B B;  4N0A C;  1UJ0 A;  4ZNX A;  4XTW A;  1PD1 A;  3J81 E;  4Z02 A;  1OZ3 A;  4X1V A;  2VKN A;  3CCR T;  3FJ5 A;  1UJY A;  4UC4 A;  4N4H A;  1IO6 A;  3I55 A;  3QPH A;  4E7Z A;  1QVF A;  2OTJ Q;  5J3B A;  4M78 C;  2COZ A;  5CR2 A;  4J9E A;  3GOX A;  3VRZ A;  1QMC A;  1BCM A;  2G3R A;  1OU8 A;  1SRM A;  2K4Y A;  2HL3 A;  3M9Q A;  5KYY A;  1K0S A;  1YJW T;  2XK0 A;  2BIV A;  2KRO A;  4IUV A;  2P0K A;  2RK1 A;  3DB4 A;  4J83 A;  1IGQ A;  1YJ9 A;  1Q7Y C;  3X28 B;  4LDX A;  4C92 G;  2JZ2 A;  3RNJ A;  1VQ9 T;  4BY6 B;  3M56 A;  2J6K A;  4JDS A;  3QJ6 A;  5HK0 A;  4CC2 A;  3EH2 A;  1O75 A;  4F17 A;  4WCI A;  4F7U E;  5J26 A;  4N0A A;  2EQU A;  2JM8 A;  2CZ6 B;  1RAE B;  3CCE T;  4L59 A;  4AT1 B;  2KE9 A;  2ZZD A;  1FXX A;  4FT2 A;  1IGU A;  2K7A A;  3HPW A;  2KXD A;  1TUD A;  4RTZ A;  4PJO E;  4O6J A;  1VQP T;  2JN0 A;  3JB9 J;  3E2U A;  3QJY A;  1OUL A;  1NE8 A;  2B8A A;  2DYI A;  1AWJ A;  4M78 A;  4PNO A;  4M78 F;  4ZGE B;  1UFF A;  2L3P A;  3LLR A;  3LGL A;  5CCA A;  4A54 A;  2ENM A;  1TTH B;  2PTK A;  3CC4 T;  4QQ6 A;  4MZP A;  2BE7 D;  2DER A;  3VUZ A;  1U06 A;  3I56 A;  3M58 A;  2DJQ A;  1JRI A;  1X43 A;  4X9D A;  1VQN A;  2ECZ A;  1HD3 A;  5GAN d;  4IUP A;  4OB3 B;  2AT1 B;  2QA4 Q;  2Y90 A;  1J3T A;  5I11 A;  1YIT A;  2C0O A;  1T3L A;  3C95 A;  1H92 A;  4IUU A;  3PNW C;  4CC7 A;  2QQR A;  2EYW A;  1VQ4 Q;  3BFM A;  1GBQ A;  2WSE E;  2HD0 A;  4EMH A;  3OYA A;  2C0T A;  3LYI A;  4IUT A;  3REB B;  5CK9 A;  1M3A A;  1GCQ C;  2J6O A;  3RUX A;  3MPU B;  2XG8 D;  4LE9 A;  3EG9 A;  3INZ A;  1X2K A;  1WLP B;  2K3X A;  3CD6 Q;  4LUD A;  2O88 A;  1UGQ B;  3CXC P;  2D8H A;  1LJO A;  1LVK A;  3EGD B;  4M78 D;  2E5K A;  2KRS A;  4HA8 A;  1QP2 A;  1CKB A;  2RQT A;  1M2V B;  4PJL A;  4PL6 A;  4EIK A;  2RHI A;  3L2R A;  3PGG A;  1T0J A;  3E9F A;  1RL2 A;  1BIB A;  2HSE B;  4C8Q F;  1T3S A;  2RJD A;  4A4H A;  1G8X A;  2F5K A;  5LJ3 d;  5L8R E;  2NUP B;  1I5O B;  1Q81 U;  4OML A;  1I5L A;  3NMZ C;  1KFZ A;  2KRM A;  1B3Q A;  5GAO r;  1OI1 A;  4II1 A;  2NUT A;  2OTJ A;  4ORZ A;  1FMW A;  1AWX A;  4ZN3 A;  2OI3 A;  4PJO C;  4LN2 A;  2KT1 A;  4C8Q B;  2EQK A;  1NJI R;  3SB2 A;  2LTO A;  2CP5 A;  3M59 A;  2LJ0 A;  2D6F A;  1W2B S;  2W0Z A;  2YUO A;  3JCM P;  1Q86 R;  2P4R A;  2BUD A;  1OOT A;  1VQO Q;  1GCQ A;  3EGU A;  2ZPF B;  3CPW P;  2RA2 A;  3A8H B;  4KH1 B;  1QVG P;  2FB7 A;  3OA6 A;  2L5Q A;  4HVW A;  3C4S A;  4LXC A;  2RHU A;  5I2M A;  2K5I A;  3JCM f;  1RAH B;  1KC8 R;  3MP1 A;  1QKW A;  3M55 A;  3THK A;  5GAN 2;  5GAO l;  1G3S A;  1U8R A;  2NWM A;  5KYX A;  2CT3 A;  3MET A;  2E70 A;  2MWO A;  2M51 A;  3PTA A;  1EFN A;  4Y28 E;  2AKK A;  4PKC C;  2D0N A;  3JCM b;  2QA4 T;  4ZN1 A;  1UE9 A;  2F5T X;  1BI2 A;  1YJN A;  4F7U F;  2DIG A;  2K2V A;  4LDY A;  1BKB A;  1I0C A;  4C0Z A;  3M5A A;  4XU1 A;  3FB9 A;  2DXC A;  2YRV A;  3QKJ A;  5DY9 A;  3KFV A;  1NPR A;  4FYY B;  2MAM A;  2A37 A;  2DRK A;  4PJO A;  3CPW A;  1D09 B;  3FC3 A;  2KYM A;  4C0D B;  3OS5 A;  2JW4 A;  1YFN A;  4F7U B;  2ZPH B;  3OW2 S;  3VV0 A;  2V1Q A;  4QVZ A;  1B7T A;  1WHK A;  6AT1 B;  1WJQ A;  3A5Z B;  4MDX A;  3OYE A;  2K5F A;  3H9N A;  3EHQ A;  5GAN f;  4C8Q G;  5KCH A;  3CCU A;  1WHH A;  1UDL A;  3M4G A;  4ATO A;  2RHY A;  1VQ8 Q;  4QT7 A;  4C92 E;  5KH6 A;  2RQW A;  1OEB A;  2RQU A;  3UF4 A;  2PU9 B;  2QAZ A;  3VU3 C;  1GFC A;  4JRK A;  1WHJ A;  1PHT A;  1VQ4 A;  3VKI A;  3OYY A;  2CUB A;  1WJS A;  3FIF A;  1WXB A;  1SEM A;  3QUI A;  2DPP B;  2ATC B;  2CP6 A;  2LRQ A;  2X3X D;  1VQ5 A;  2YXY A;  2ED0 A;  2CS7 A;  4RTU A;  2DM1 A;  4E7L A;  2QTX A;  1KG1 A;  5DLQ E;  3CD6 A;  4BDZ A;  3HFO A;  5CIU A;  2M1H A;  2RJC A;  1JEG A;  3S3M A;  1AVZ C;  2EPD A;  2KAF A;  2YUN A;  4BUG A;  4LNP A;  2K5L A;  2RB6 A;  3E19 A;  4PJO D;  1Q86 C;  1HJD A;  1VQO T;  1ZLM A;  3CCQ T;  3EGX A;  1ABO A;  2A3L A;  4BAC A;  4JS4 A;  4PFZ A;  3RES A;  2DFU A;  5LJ3 f;  5KYN A;  3BY7 A;  3EFS A;  3UWN A;  3DLL A;  4F7U G;  1TUG B;  1RAA B;  2IG0 A;  1WXT A;  3WXM B;  4J8O A;  3MJX A;  1Y96 A;  2DO3 A;  2LMJ A;  1Y07 A;  3ER0 A;  2QQA A;  1LPL A;  1CSK A;  5IHK A;  2DYB A;  3CCJ Q;  1Q81 C;  2RNA A;  2DXU A;  5KYW B;  4EPC A;  1OZ2 A;  2LQW A;  2AIR B;  3AT1 B;  2M0Y A;  3S3N A;  3NFC A;  1ZHI A;  3G4S Q;  2EQI A;  2DL5 A;  1S72 A;  5GMK l;  1VQ6 A;  4J6Y A;  1WHG A;  1BCO A;  1PC0 A;  5AYF A;  3CME Q;  2JNG A;  3OS2 A;  1VQ7 Q;  3NTI A;  1YNZ A;  3FJP A;  4A4K A;  2EKH A;  1M2O A;  2MYS A;  2FHD A;  4OMN A;  4JZ3 A;  2LDM A;  4J9D A;  1K9M U;  3M0U A;  1K73 U;  2LCL A;  1AZG B;  2LJ1 A;  3VS1 A;  3NPF A;  4C92 C;  4OVA A;  4IIO A;  2A08 A;  4RMO A;  4E7I A;  4MML A;  3QWY A;  4HCZ A;  3CCR Q;  2IPO B;  5GAM d;  1D1C A;  1KSW A;  1I4K 1;  4ZTF A;  2F2V A;  4DBH A;  1OPL A;  2L3Q A;  3VUB A;  3ZBD A;  3QHS A;  2NYS A;  5IN1 A;  1G83 A;  4HCC A;  1QLY A;  4E47 A;  4JZ4 A;  2ABL A;  1BIA A;  2F2W A;  4NL3 A;  1H3Z A;  2RD1 A;  1ZQ1 A;  2EGE A;  1YJW Q;  5FLX E;  2DEU A;  4RUG A;  1ACM B;  3CCV T;  2JTM A;  1VIE A;  3DKM A;  8ATC B;  2VB6 A;  4M75 E;  3CBO A;  5LJ5 f;  4IKF A;  1WNL A;  1Q7Y R;  3MP6 A;  4A53 A;  1BI1 A;  4IUQ A;  4Z88 A;  4FU6 A;  1XOV A;  3LH5 A;  2O01 E;  2W10 A;  1VQ8 A;  1M30 A;  1JJ2 S;  1WQ7 A;  3JCM V;  3V8J A;  1V29 B;  3WVD B;  2CGH A;  5GAN g;  2BE9 B;  2LX9 A;  3JCM h;  4B9W A;  4DA4 A;  4EMG A;  1TSF A;  1Z9Q A;  1IHV A;  1K76 A;  4OGE A;  4R56 A;  2J05 A;  4C92 A;  5GAN 6;  2A36 A;  1AWO A;  3CCE Q;  2NUZ A;  2E6Z A;  2XKO C;  4C0F A;  4E2F B;  3TQ7 P;  2DF6 A;  3VJP A;  4KUI A;  4QQG A;  2H3J A;  2KQW A;  3QO3 A;  1Y7X A;  3CCJ T;  4BY6 C;  4J9H A;  2EIF A;  1R0C B;  4X9C A;  3R6N A;  4HCB A;  1B34 B;  4JPB W;  2MWP A;  2E64 A;  1QVF P;  4N4I A;  1TUC A;  4FYW B;  2YHT A;  1IRX A;  3G4S T;  1AOJ A;  4LDU A;  2XID A;  4FCY A;  3ZFJ A;  4KH0 B;  1VQK T;  2GGR A;  3CC4 Q;  2E3I A;  3PT9 A;  5D6X A;  4A4F A;  2OTL T;  4Q5W A;  3A8L B;  4BI4 A;  3CCL T;  3TEE A;  5A2Q E;  2QEX A;  1VQ7 T;  4OB0 B;  1TXQ A;  4XU3 A;  5GAN h;  2EKO A;  3A8M B;  4KRT A;  3HRT A;  2DZ9 A;  3OYJ A;  2E1H A;  4QQD A;  2E10 A;  2FPE A;  2RQR A;  1N9R A;  5LJ3 g;  2VYT A;  5FU6 B;  2DMO A;  1N8R U;  2CZ0 B;  2O9V A;  3BW1 A;  1KD1 U;  3VS0 A;  5KYU B;  1GBR A;  1RAG B;  4CC3 A;  1YI2 A;  3OYN A;  2GQV A;  2DE0 X;  2E41 A;  3M0S A;  4C92 D;  5CAI A;  1VOM A;  5LL6 S;  2BTT A;  1ZUY A;  3CCM A;  1C1A A;  1MMG A;  1QWF A;  2DLP A;  4DQ2 A;  4A63 B;  2DK3 A;  4E7H A;  1Q82 R;  3RMQ A;  5D6Y A;  3OS0 A;  1WYX A;  3EHR A;  3CME A;  2KEA A;  1VQL Q;  2HDA A;  2QI2 A;  4RG2 A;  2H3E B;  2VUB A;  3O5Z A;  1LOJ A;  2KYB A;  2LZ6 B;  4X34 A;  3I5R A;  5DLO A;  3OB9 A;  1VQM T;  2RI5 A;  3CC7 T;  4M77 E;  1UGR B;  2KY9 A;  1OU9 A;  1LNX A;  3VS4 A;  1YN8 A;  3QG1 A;  4AFQ C;  5GAM f;  3CCR A;  2RN8 A;  3SFM A;  2QAS A;  4E6R A;  1K73 C;  3JCM d;  4DEY A;  1WQW A;  5LJ3 h;  4D8K A;  1RUW A;  5FWC A;  2JT4 A;  3L1A A;  2HL5 C;  4XAX B;  3HP9 A;  1OPK A;  3CEY A;  1VYT A;  2HEQ A;  3VYG A;  3EFR A;  2L8D A;  1NPP A;  5IXF A;  2DKG A;  1YJW A;  5IH2 A;  1ZBX A;  1NZ9 A;  3UA7 A;  4B9X A;  1RAC B;  2D8J A;  1NLP C;  1M3B A;  4J9B A;  2KMT A;  2QGG A;  4PLI A;  3JB9 I;  1VQ9 A;  3JCM X;  1PKS A;  2A0F B;  2RQV A;  4C5G A;  1GXI E;  1RI0 A;  4LUE A;  4RG8 A;  4M75 F;  3QSU A;  5GMK h;  1M27 C;  3FEO A;  4HVV A;  3QYH B;  4XTX A;  1D0X A;  2C0I A;  3SDZ A;  4C8Q C;  1PRL C;  2O2O A;  4JS5 A;  2AHJ B;  3KBG A;  1ZSG A;  4J9I A;  3CCE A;  5DM7 R;  5GAO n;  4L6V 5;  1BB9 A;  2QDY B;  2RO0 A;  2RMO A;  3LH0 A;  3VS6 A;  2E3H A;  1MV3 A;  2DL8 A;  3OYH A;  4M75 B;  4MZM A;  1VQP A;  2EBP A;  1MHN A;  1PG5 B;  3AHU A;  4ZGD B;  3CBP A;  5I22 A;  4EDU A;  2PZ1 A;  1QQJ A;  2HCK A;  3EGD A;  1D1B A;  1V76 A;  1XTD A;  3KXT A;  1ZA2 B;  3DLM A;  1M2V A;  4JUV A;  1R0B G;  4KT0 E;  1QP3 A;  1Q82 C;  2FPD A;  3QDR B;  3CC4 A;  1ZSZ B;  3JB9 F;  3CPF A;  3FRN A;  7AT1 B;  1VQL T;  3EFO B;  2NUP A;  4BE1 A;  1VA7 A;  4Z89 A;  1KIK A;  5LJ5 h;  2FEI A;  1RAD B;  1QCF A;  2D9T A;  1C6V X;  3ASK A;  4M7A E;  1WHM A;  1RLQ C;  2V8J A;  1NEB A;  4C0D C;  5GAN j;  4C8Q A;  4BI3 A;  2DIQ A;  2L89 A;  3OSS C;  1M1K U;  4GLK A;  4XTU A;  1X69 A;  3M0R A;  1AT1 B;  2LQK A;  5C6S A;  1N8R C;  2E12 A;  4AG1 C;  2FRY A;  4K11 A;  2QTV A;  1KD1 C;  1YIJ Q;  3DB3 A;  1MUZ A;  2EYY A;  2DVE A;  2YWW A;  4AMC A;  3ME9 A;  2YUP A;  1M90 U;  2O31 A;  5CO7 A;  2LC4 A;  2X9H A;  3JAM E;  1KQS P;  1AZE A;  3L42 A;  4DBQ A;  4JLI A;  2X4X A;  3PFS A;  2V8K A;  1T0H A;  2ZPI B;  4M75 G;  3UA6 A;  2MI6 A;  1KK7 A;  2VAS A;  4OMF B;  3JCM J;  2JTE A;  1G2B A;  3HKS A;  3CCQ Q;  4D8D A;  1B07 A;  3PVL A;  1FWZ A;  2DXT A;  3EG2 A;  2DNU A;  1NEG A;  3UAT A;  4RTV A;  4J6W A;  1RLP C;  3R6O A;  1EX4 A;  4QVD A;  3RKX A;  3MHX A;  4EMK B;  2OAW A;  3OBW A;  3VS3 A;  1X01 A;  1UHF A;  5KE2 A;  2K3B A;  1NYG A;  2GCX A;  4M77 F;  3MEA A;  5GAM g;  3C94 A;  4XU0 A;  4KGV B;  2KK4 A;  5A0G A;  1XJW B;  1YBY A;  1Q81 R;  2JUF A;  5LJ3 j;  4PLL A;  3RDV A;  2JVV A;  2L0A A;  2GTO A;  2DL3 A;  4F7U A;  2R5A A;  4Y91 A;  4C8Q D;  5HY6 A;  4OF1 A;  2JTF A;  1KQS A;  2HAX A;  1GL5 A;  2X4J A;  2LT4 A;  3M0Q A;  8AT1 B;  3G71 Q;  1QKX A;  4M77 B;  3JB9 G;  3GNF B;  2OJ2 A;  2FZG B;  4QVC A;  5D6W A;  4ZTJ A;  1G3Y A;  2PUK B;  4OGC A;  3GBQ A;  4QW2 A;  2KSS A;  2YLC A;  1N27 A;  3V7S A;  1G5V A;  2FZK B;  2CZ7 B;  3G6E Q;  1QVP A;  2SEM A;  1OX9 A;  2XMF A;  4HXJ A;  4FYX B;  5LJ5 d;  5GMK j;  2QA4 A;  1DJ7 B;  1VQ5 T;  3OYL A;  2FPF A;  3JCM e;  5GAM h;  4XTY A;  1M4Z A;  3RER A;  2MMP A;  1AWW A;  1KHI A;  1JB0 E;  4M7D F;  2QQB A;  2ZPG B;  2FL7 A;  2RF0 A;  3CQT A;  2EJ9 A;  1W6X A;  2GQI A;  2P84 A;  2LP5 A;  2GFA A;  2RJE A;  2HKQ B;  3E1S A;  3NTH A;  1YIJ T;  4HCK A;  3GNG A;  2GF7 A;  3CBM A;  2IVW A;  1UHC A;  4DBF A;  4M7D B;  1D0Y A;  3OYD A;  3CCV Q;  2DL4 A;  4HT8 A;  2XDB A;  1M9S A;  2J7I A;  2WSC E;  2PUO B;  2E4H A;  2PVO B;  3H0H A;  2HQH A;  3D7S B;  3V8K A;  3RKY A;  1TH7 A;  2K79 A;  2MOX A;  3PE0 A;  4M77 G;  5CQX A;  4WTO B;  1H64 1;  1JQQ A;  1YCS B;  3QDF A;  3REA B;  1QCO A;  3CCS T;  3TU4 K;  2CUD A;  4D6W A;  3A98 A;  2CP0 A;  1HXD A;  4BD3 A;  4FT4 A;  5KYW A;  5GAN e;  4FL6 A;  2JOY A;  3H0F A;  3MEW A;  4M7A F;  4WF2 A;  2VGN A;  4NL2 A;  2EGC A;  2HBP A;  4Y92 A;  3TCJ A;  1RAB B;  4ME7 A;  4A4E A;  3OY9 A;  1N5Z A;  1M1K C;  1BBZ A;  2DBM A;  1W1F A;  1WX6 A;  3HHT B;  2LCC A;  3CMA T;  5CKE A;  3JB9 H;  2EW3 A;  3PMT A;  1YHQ Q;  2XHC A;  4C5I A;  4M7A B;  2O9S A;  5AT1 B;  2MCN A;  3G71 T;  1M90 C;  2DXB A;  1SRL A;  1VQO A;  1IB8 A;  3VS2 A;  3CCQ A;  1MND A;  1VQK Q;  1FX7 A;  4FSS A;  3TVT A;  2VVK A;  1Y57 A;  2OTL Q;  3QBY A;  4OB1 B;  3CCL Q;  3M54 A;  2XDD A;  3ZL7 C;  3EAE A;  1MMN A;  1UGS B;  3CC2 T;  1R77 A;  4XU2 A;  2SRC A;  5C0M A;  4HT9 A;  3M0T A;  5FRN A;  3OYM A;  3G6E T;  2X3W D;  4AFU C;  4M7D G;  3JCM g;  3EG3 A;  2MPX C;  2DL7 A;  1GRI A;  3GPL A;  1YWP A;  3MP8 A;  2LNV A;  5KCO A;  2PQW A;  2CSQ A;  5LJ3 e;  1VYU A;  2I0N A;  2KDS A;  1NBE B;  1QW1 A;  1ZBJ A;  2XIC A;  2WSF E;  2DET A;  1IXD A;  1K8A U;  1BI3 A;  1YJ9 Q;  2Z0W A;  3MKD A;  3OYG A;  2E5Q A;  5FRM A;  3L2V A;  4MZT A;  4FW1 A;  3URG A;  5FU6 C;  1PNJ A;  2ROT A;  3TSZ A;  5CKD A;  3BE3 A;  3IQL A;  1W2B P;  2QGF B;  2L3S A;  2WAC A;  1VQM Q;  3RMS A;  1WGS A;  3CC7 Q;  4KUD K;  1RAI B;  4LDV A;  1W70 A;  2ZCF B;  2YDL A;  4M7A G;  1PKT A;  1K9M R;  1K73 R;  5GMK e;  3EG1 A;  2V26 A;  2BZX A;  4M4Z A;  3CXC S;  1JXM A;  1FMV A;  2DRM A;  3SWN B;  3OYC A;  3O8V A;  3HL8 A;  4GY5 A;  5EC7 A;  1SKU B;  5GAM j;  1B34 A;  5CKB A;  1OYX A;  4C0G A;  3ZEH A;  4C5H A;  2YSQ A;  3G7Z A;  2EAY A;  5GJV B;  1WZO A;  3PIO A;  1ABQ A;  1PD0 A;  2HMA A;  4ELZ C;  3CCV A;  2R58 A;  5GAN 7;  5I2S A;  4OMP A;  4V2S A;  2LQ8 A;  3VS5 A;  1R8O B;  5EG2 A;  1YHQ T;  1W2B A;  1VUB A;  2LVM A;  2M9U A;  2QK0 A;  2GNC A;  4BE0 A;  1IRE B;  2YRC A;  4XQ3 A;  2J06 A;  4CI0 C;  3OS1 A;  3GLX A;  2XDP A;  1D3B B;  2QQ9 A;  3OW2 P;  4KBM B;  4Z8A A;  1D1A A;  3Q1J A;  5KYU A;  2FO0 A;  4J7F A;  5FRO A;  3A8O B;  2QXF A;  1OX8 A;  4E7S A;  5LJ5 e;  2OX7 A;  3CPW S;  2DEQ A;  1SG5 A;  4F16 A;  3I55 T;  2H8H A;  1QVG S;  4ELY C;  4J5Y A;  2LQN A;  3BDU A;  4GBQ A;  2RHZ A;  1RI9 A;  3CCJ A;  1E6G A;  4JRI A;  4RTX A;  3QXE B;  2F1L A;  4FIB A;  4OB2 B;  4R55 A;  3MEV A;  2X51 A;  3C12 A;  2VC8 A;  2ZPE B;  5M9O A;  1MV0 B;  3EH1 A;  3G4S A;  2O4X B;  5J39 A;  1VIF A;  1PCX A;  2AKL A;  2RPN A;  1YJ9 T;  1VQK A;  1UG1 A;  1Y71 A;  2BZY A;  1JBM A;  4N4G A;  2OTL A;  1V1C A;  2CP2 A;  2K2M A;  3CCL A;  3OW2 A;  1VQ7 A;  2FG0 A;  4M75 C;  1Z9Z A;  2EJG A;  4AFS C;  1BU1 A;  3OYF A;  1I81 A;  3L2Q A;  2JMC A;  2DTO A;  1KQ2 A;  3V7C A;  2P0Q A;  4C5E A;  4PFO A;  2DTI A;  1FMK A;  1K9M C;  2CRE A;  2IIM A;  2P4T A;  2MF2 A;  4ESR A;  4A4G A;  2CSI A;  1ZSZ C;  1N8R R;  4RKU E;  2VXE A;  4J9C A;  5IHI A;  1KD1 R;  4FM4 B;  2DA9 A;  2D0Q B;  3TSW A;  1N6A A;  4KUL A;  2X35 A;  1IZ6 A;  3FLG A;  2X4W A;  1TOV A;  2KRN A;  2D1X A;  1VYV A;  2CT4 A;  4E7K A;  3BDL A;  5KYY B;  5I21 A;  3A8G B;  3E9G A;  1K8A C;  2EVR A;  4XTV A;  4E7J A;  1S1N A;  3I56 T;  1WJR A;  2K57 A;  1VQN T;  5FU7 B;  1VQM A;  3CC7 A;  1QWE A;  3EG0 A;  2EYZ A;  1G3T A;  4F04 B;  1PWT A;  2M0O A;  2ESW A;  2DIL A;  1YIT T;  1YJN Q;  3QZ5 B;  3JCM c;  2HZY A;  4M75 A;  5IXB A;  3A1P A;  5LJ5 g;  1PM3 A;  2A28 A;  3S6W A;  1Y0M A;  3MEU A;  3S3O A;  1M8V A;  3JCM Q;  1UTI A;  3H41 A;  2DJZ A;  4XK8 E;  1EZZ B;  1WDX A;  1AD5 A;  1UEC A;  1SHG A;  4M7D E;  1YP5 A;  2JS2 A;  5GJW B;  5GAM e;  3F70 A;  2X4Y A;  3V7R A;  1UB4 A;  1UGV A;  1ZSZ A;  4DOW A;  2ROL A;  2LNH B;  3EFO A;  4R0K A;  4M78 B;  4EMK C;  2YLB A;  4JJC A;  3CCU Q;  5GAN 8;  1K0X A;  1E6H A;  1SSF A;  4LDW A;  1XNI A;  4TVR A;  1U3O A;  4VUB A;  4FYV B;  2CDT A;  3H8Z A;  2C06 A;  1G3W A;  3TRE A;  3C0C A;  2HSP A;  2FRW A;  1MNE A;  1HK9 A;  2HBW A;  3X26 B;  2R57 A;  2GFU A;  1X27 A;  4M77 C;  1NJI U;  1VQ5 Q;  1AHJ B;  5FW9 A;  4O5V A;  1X6B A;  3VS7 A;  2OTJ T;  2E6N A;  1JO8 A;  1Q86 U;  4M75 D;  1JJ2 P;  3VYH B;  1PSF A;  1MMA A;  3GIB A;  3H0I A;  1CKA A;  3L2Z A;  2FVU A;  3U23 A;  1ZA1 B;  4LD9 K;  1X6G A;  1KC8 U;  1WA7 A;  5A0D A;  3OYK A;  1NYF A;  2CKK A;  1SSH A;  4YTL A;  3EG9 B;  1NG2 A;  2K3Y A;  2PVD B;  3V8L A;  3PVQ A;  2LJ3 A;  4PK4 A;  1VQL A;  1M1G A;  4J9F A;  4OMM A;  2Y4X A;  4EMK A;  2KGT A;  4IUR A;  1WI7 A;  1GCP A;  3UDC A;  2XI9 A;  4DOV A;  3KUF A;  2VGM A;  2DD4 A;  2RI3 A;  4FW2 A;  3MO8 A;  3OYI A;  4PJN A;  2QQS A;  4JJN K;  1WIE A;  3CCS Q;  4M78 G;  4DBR A;  3JB9 D;  1BI0 A;  1JJ2 A;  1YJN T;  2XU8 A;  2RH2 A;  1H3H A;  3CXC A;  2EYX A;  4M77 A;  4M7D C;  3M0P A;  3UT1 A;  2NUT B;  1JXO A;  1Q95 G;  2HQE A;  2KT8 A;  1S72 Q;  1M1K R;  4HKE A;  1TU0 B;  1VQ6 Q;  4PJM A;  2EYQ A;  3CMA Q;  2LT1 A;  3P8H A;  2RI2 A;  4L5G A;  1WHL A;  2COY A;  2PNI A;  1WXU A;  3MCA B;  1M90 R;  1SHF A;  2V8I A;  3NHN A;  5A0L A;  4PJJ A;  2DTH A;  2J6F A;  5CKF A;  2L2P A;  4LD6 A;  3CCU T;  5L23 A;  4BB7 A;  1U1S A;  1WFW A;  2YUQ A;  4RCC A;  2KVQ G;  2EQM A;  1NLO C;  2CZ1 B;  3X25 B;  3CC2 Q;  4PFP A;  3FDR A;  2DBK A;  2JMA A;  3M53 A;  5GAO m;  2HNI A;  2G6F X;  2Y4Y A;  1EIF A;  5KYX B;  1QVF S;  3P8B B;  1P92 A;  2BZ8 A;  3QYG B;  3QZ9 B;  1VQ4 T;  3G1J A;  1H8K A;  4M7A C;  2GTJ A;  5KE3 A;  4PJO F;  2QDL A;  1K9A A;  4F14 A;  2RM4 A;  5GAN 3;  1QVG A;  2EJF A;  3M4Y A;  1UGP B;  3HFN A;  4M7D A;  2OAU A;  3LGF A;  3CD6 T;  2VXF A;  2ZPB B;  2M16 A;  4M77 D;  4RTW A;  1MMD A;  1SF9 A;  4J6X A;  4PJO B;  3OYB A;  4OMQ A;  2CP7 A;  2KBT A;  3QII A;  1TWB A;  1I07 A;  2YRD A;  2CH4 A;  1ZX6 A;  2YT6 A;  3T9N A;  2KR3 A;  3LWI A;  1U1T A;  3H6Z A;  1W4S A;  3J80 E;  5IT9 E;  1I1J A;  2EGA A;  2MK5 A;  4MMK A;  2B86 A;  2RJF A;  4IIM A;  3JCM W;  1HSQ A;  5LJ5 j;  1FYN A;  1AEY A;  2NLU A;  1RAF B;  4JLG A;  1NJI C;  2F2X A;  1X75 C;  2EQJ A;  4M7A A;  3X20 B;  3PMI A;  3JRZ A;  2EFI A;  2QG9 B;  1YCY A;  3ULR B;  2DX1 A;  5IAY A;  1YIJ A;  1S72 T;  5D7U A;  2JM9 A;  3HRS A;  3LWH A;  2VWF A;  4J7I A;  4KGZ B;  3SHW A;  1U5S A;  1VQ6 T;  5HK3 A;  4M7D D;  2KNB B;  4ANJ A;  2P0P A;  2QEX Q;  1KC8 C;  1M3C A;  3I5S A;  3OMC A;  2HKN A;  4FSX A; 
#chains in the Genus database with same CATH homology
 1N9S A;  4C5G A;  3M55 A;  5GAN 2;  1GXI E;  1RI0 A;  3SWN C;  5GAO l;  1IRE B;  4BE0 A;  4RG8 A;  4XQ3 A;  4M75 F;  4NOY A;  4CI0 C;  5HKC A;  3QSU A;  5GMK h;  1G3S A;  3FEO A;  3GLX A;  3OS1 A;  1U8R A;  2E70 A;  2XDP A;  2MWO A;  1D3B B;  2RHX A;  3MET A;  3QYH B;  4XTX A;  3SDZ A;  4C8Q C;  3PTA A;  4Y28 E;  4XTZ A;  2QQ9 A;  4KBM B;  4JS5 A;  3CCS A;  3WVE B;  2AHJ B;  3KBG A;  3Q1J A;  4PKC C;  4J7F A;  3CCE A;  5FRO A;  3JCM b;  5DM7 R;  3A8O B;  4PJO G;  3GP8 A;  2QXF A;  2QA4 T;  4ZN1 A;  5GAO n;  5LJ5 e;  2F5T X;  4L6V 5;  3CPW S;  1BI2 A;  1YJN A;  4F7U F;  2DIG A;  2K2V A;  4LDY A;  1BKB A;  2CYZ B;  2DEQ A;  2QDY B;  2RO0 A;  4C0Z A;  3LH0 A;  3I55 T;  3M5A A;  4XU1 A;  4ELY C;  3FB9 A;  1QVG S;  2DXC A;  5GAO q;  3OYH A;  2YRV A;  3QKJ A;  4J5Y A;  4M75 B;  4MZM A;  5DY9 A;  1VQP A;  1NPR A;  1Y96 B;  1MHN A;  3BDU A;  5GAN 4;  2MAM A;  2FYK A;  3AHU A;  2RHZ A;  1BYM A;  4ZGD B;  3CCJ A;  4JRI A;  3CBP A;  3QXE B;  4EDU A;  5GAO p;  4PJO A;  3CPW A;  3CMA A;  3FC3 A;  1UEB A;  2DD5 A;  3OS5 A;  4FIB A;  4C0D B;  1XTD A;  4OB2 B;  4R55 A;  3MEV A;  3KXT A;  1Q7Y U;  4F7U B;  2ZPH B;  3OW2 S;  1X6O A;  4JRQ A;  3VV0 A;  3DLM A;  3C12 A;  2VC8 A;  3OBY A;  2ZPE B;  4JUV A;  4QVZ A;  4KT0 E;  3G71 A;  5M9O A;  4M7A D;  1WJQ A;  1QP3 A;  3A5Z B;  2O4X B;  3G4S A;  4MDX A;  5J39 A;  1VIF A;  1Q82 C;  3CC4 A;  3QDR B;  3OYE A;  4BE2 A;  1VQK A;  1YJ9 T;  3JB9 F;  3CPF A;  1Y71 A;  2RK2 A;  4ZGJ B;  2K5F A;  1JBM A;  4N4G A;  3FRN A;  5GMK m;  5GAN f;  2OTL A;  4C8Q G;  1VQL T;  5KCH A;  4MDW A;  3CCU A;  4BE1 A;  1VQ8 T;  3PIP A;  3CCL A;  3OW2 A;  3M4G A;  3OSV A;  2RHY A;  3UPU A;  4ATO A;  1VQ7 A;  4M75 C;  3P8D A;  2EJG A;  4CRI A;  5LJ5 h;  3CC2 A;  4C92 E;  3OYF A;  1I81 A;  2F69 A;  3L2Q A;  2D9T A;  3SWN A;  5KH6 A;  5CVI A;  3ASK A;  4M7A E;  4RCB A;  2DTO A;  3SD4 A;  2PU9 B;  3G6E A;  1KQ2 A;  3V7C A;  2V8J A;  3VU3 C;  4C0D C;  5GAN j;  2P0Q A;  4C8Q A;  4BI3 A;  4JRK A;  1VQ4 A;  2DIQ A;  2L89 A;  3OSS C;  3JSC A;  1M1K U;  4C5E A;  2BKD N;  3VKI A;  3OYY A;  2DTI A;  1K9M C;  1WJS A;  2P4T A;  3FIF A;  4GLK A;  4XTU A;  3QUI A;  1WPY A;  2DPP B;  2LRQ A;  2LQK A;  2MF2 A;  3M57 A;  4M78 E;  2E12 A;  4A4G A;  5C6S A;  1N8R C;  4JRP A;  1VQ5 A;  3HSB A;  4RKU E;  5CKH A;  2CS7 A;  1KD1 C;  2VXE A;  3DB3 A;  4E7L A;  2QTX A;  4FM4 B;  1KG1 A;  5DLQ E;  2DVE A;  1M90 U;  2D0Q B;  3ME9 A;  1N6A A;  3CD6 A;  4BDZ A;  5CO7 A;  2LC4 A;  4KUL A;  2X35 A;  4BDY A;  1IZ6 A;  3FLG A;  3HFO A;  5CIU A;  2RJC A;  2M1H A;  3JAM E;  3S3M A;  3L42 A;  4JLI A;  2X4W A;  2X4X A;  3HRU A;  2KAF A;  3PFS A;  2V8K A;  2ZGW A;  4P5N A;  2ZPI B;  1I8F A;  4BUG A;  4E7K A;  2K5L A;  2RB6 A;  3BDL A;  3L2W A;  3E19 A;  4NS5 A;  2XD0 A;  4PJO D;  5I21 A;  1Q86 C;  3A8G B;  3E9G A;  1K8A C;  4M75 G;  1VQO T;  4XTV A;  2MI6 A;  1D3B A;  3CCQ T;  4E7J A;  4OMF B;  3JCM J;  3HKS A;  3I56 T;  1M1F A;  2A3L A;  4BAC A;  1WJR A;  3X24 B;  4JS4 A;  2K57 A;  2EWN A;  3RES A;  1VQN T;  1FWZ A;  2DXT A;  4OP0 A;  5FU7 B;  1VQM A;  1PSE A;  3CC7 A;  5LJ3 f;  2QEX T;  2E65 A;  4J6W A;  1G3T A;  4C92 F;  3R6O A;  3BY7 A;  1MGQ A;  2M0O A;  3EFS A;  3UWN A;  3OMG A;  2I2L A;  3DLL A;  3RKW A;  4F7U G;  1YIT T;  3QZ5 B;  3JCM c;  3RKX A;  4QVD A;  3MHX A;  4EMK B;  5CQY A;  2IG0 A;  3OBW A;  3WXM B;  4J8O A;  4M75 A;  2DZC A;  1X01 A;  1Y96 A;  2A7Y A;  2DO3 A;  5KE2 A;  3ER0 A;  1Y07 A;  5LJ5 g;  4M77 F;  2GCX A;  5GAN 5;  1KQS S;  2L3R A;  3S6W A;  2QQA A;  1KQ1 A;  3MEA A;  3C94 A;  3MEU A;  3RIR A;  5GAM g;  3S3O A;  4XU0 A;  2KK4 A;  1KHC A;  3LW5 E;  5A0G A;  3JCM Q;  1M8V A;  1O9S A;  1XQH A;  1Q81 C;  1YBY A;  2DJZ A;  4XK8 E;  2JUF A;  5LJ3 j;  1Q82 U;  4PLL A;  2JVV A;  4C92 B;  1YI2 T;  4M7D E;  4F7U A;  2R5A A;  4BI8 B;  2DXU A;  4Y91 A;  4C8Q D;  3OQ5 A;  4OF1 A;  5HY6 A;  4EPC A;  5GAM e;  1OZ2 A;  2JTF A;  1KQS A;  3NTK A;  3F70 A;  3L2U A;  3CCM T;  2HAX A;  2X4J A;  4M7A C;  2O4X A;  2LT4 A;  2X4Y A;  3V7R A;  3S3N A;  3NFC A;  1ZHI A;  1UB4 A;  4M77 B;  5FU7 C;  3LX7 A;  4DOW A;  1S72 A;  3JB9 G;  3GNF B;  5GMK l;  1VQ6 A;  2VV5 A;  4J6Y A;  3CME T;  2HQX A;  4M78 B;  3J7A F;  4EMK C;  2YLB A;  5AYF A;  2R5M A;  2JNG A;  4QVC A;  5GAN 8;  5D6W A;  3OS2 A;  1M5Q 1;  4ZTJ A;  1YHQ A;  1SSF A;  4LDW A;  1XNI A;  4TVR A;  2DAQ A;  3GF5 A;  5GMK i;  3NTI A;  1G3Y A;  2PUK B;  4OGC A;  4C8Q E;  3FJP A;  4VUB A;  4A4K A;  4QW2 A;  2FHD A;  2PVG B;  3N5B B;  2KSS A;  2YLC A;  4N0A C;  2LDM A;  3H8Z A;  1K9M U;  1N27 A;  2LCL A;  1G3W A;  1K73 U;  2C06 A;  3TRE A;  3V7S A;  1G5V A;  4XTW A;  2CZ7 B;  4C92 C;  4OVA A;  3J81 E;  4Z02 A;  1OZ3 A;  1QVP A;  3CCR T;  4RMO A;  4E7I A;  4MML A;  5LJ5 d;  4HCZ A;  1HK9 A;  5GMK j;  3X26 B;  2R57 A;  5GAM d;  2QA4 A;  1DJ7 B;  2GFU A;  1VQ5 T;  4M77 C;  4UC4 A;  4N4H A;  3OYL A;  1I4K 1;  4ZTF A;  1NJI U;  3JCM e;  3QPH A;  3I55 A;  1AHJ B;  5GAM h;  4O5V A;  2OTJ T;  4XTY A;  1QVF A;  1M4Z A;  3RER A;  2MMP A;  3VUB A;  5J3B A;  2E6N A;  4M78 C;  3ZBD A;  1Q86 U;  1KHI A;  1JB0 E;  4M75 D;  3VYH B;  1PSF A;  3GIB A;  4M7D F;  3QHS A;  2QQB A;  2ZPG B;  2FL7 A;  5IN1 A;  5CR2 A;  3GOX A;  2EJ9 A;  2G3R A;  4HCC A;  4E47 A;  2K4Y A;  3M9Q A;  3L2Z A;  2FVU A;  1BIA A;  4NL3 A;  2GFA A;  2RJE A;  1YJW T;  2XK0 A;  2RD1 A;  3E1S A;  4LD9 K;  2BIV A;  3NTH A;  1H3Z A;  1ZQ1 A;  5FLX E;  4IUV A;  1YIJ T;  1KC8 U;  2P0K A;  3GNG A;  2RK1 A;  5A0D A;  2GF7 A;  3OYK A;  3DB4 A;  3CBM A;  2IVW A;  4J83 A;  2CKK A;  2JTM A;  4YTL A;  3CCV T;  1VIE A;  4M7D B;  3DKM A;  1YJ9 A;  3OYD A;  2K3Y A;  3CBO A;  4M75 E;  1Q7Y C;  2PVD B;  5LJ5 f;  4HT8 A;  3V8L A;  4IKF A;  1M9S A;  1WNL A;  2XDB A;  3X28 B;  2WSC E;  2PUO B;  3MP6 A;  1BI1 A;  4IUQ A;  4A53 A;  2JZ2 A;  2PVO B;  4FU6 A;  1XOV A;  1M1G A;  4BY6 B;  4C92 G;  1VQ9 T;  1VQL A;  3M56 A;  2Y4X A;  2O01 E;  4EMK A;  1VQ8 A;  4IUR A;  3V8K A;  3RKY A;  1JJ2 S;  1TH7 A;  4JDS A;  1WQ7 A;  3QJ6 A;  5HK0 A;  3JCM V;  3V8J A;  1V29 B;  3WVD B;  1O75 A;  2CGH A;  4M77 G;  5GAN g;  5CQX A;  2LX9 A;  3JCM h;  2XI9 A;  3UDC A;  4B9W A;  4DOV A;  4F7U E;  1H64 1;  4DA4 A;  3KUF A;  4EMG A;  5J26 A;  2VGM A;  2DD4 A;  2RI3 A;  2EQU A;  3MO8 A;  4N0A A;  3OYI A;  3CCS T;  3TU4 K;  2QQS A;  4D6W A;  4JJN K;  2CZ6 B;  4OGE A;  4M78 G;  4L59 A;  4R56 A;  3CCE T;  4C92 A;  5GAN 6;  3JB9 D;  1HXD A;  4BD3 A;  4FT4 A;  2ZZD A;  1BI0 A;  2E6Z A;  2XKO C;  1JJ2 A;  1YJN T;  1FXX A;  4FT2 A;  4C0F A;  5GAN e;  4FL6 A;  2JOY A;  2XU8 A;  3MEW A;  3VJP A;  2RH2 A;  4M7A F;  4KUI A;  4WF2 A;  2VGN A;  4NL2 A;  3CXC A;  3HPW A;  2HBP A;  3TCJ A;  4M77 A;  4O6J A;  1VQP T;  4M7D C;  4PJO E;  2JN0 A;  4QQG A;  4ME7 A;  4A4E A;  3OY9 A;  3JB9 J;  3UT1 A;  2H3J A;  3QJY A;  1M1K C;  1NE8 A;  2KQW A;  2HQE A;  3QO3 A;  1Y7X A;  3CCJ T;  2B8A A;  4HKE A;  4BY6 C;  2EIF A;  4M78 A;  4PNO A;  3HHT B;  4X9C A;  2LCC A;  4M78 F;  3CMA T;  4HCB A;  4ZGE B;  5CKE A;  3JB9 H;  2EYQ A;  3PMT A;  1B34 B;  2MWP A;  2LT1 A;  2E64 A;  3LLR A;  3P8H A;  3LGL A;  5CCA A;  2XHC A;  4N4I A;  4C5I A;  2RI2 A;  4L5G A;  4M7A B;  4A54 A;  3G71 T;  1M90 C;  2YHT A;  2DXB A;  3G4S T;  3MCA B;  4LDU A;  2XID A;  2V8I A;  3CC4 T;  3ZFJ A;  5A0L A;  1VQO A;  4QQ6 A;  4MZP A;  1VQK T;  3CCQ A;  2DTH A;  3VUZ A;  1FX7 A;  3PT9 A;  3I56 A;  3M58 A;  5CKF A;  5D6X A;  4A4F A;  2OTL T;  4Q5W A;  1JRI A;  3A8L B;  4LD6 A;  4X9D A;  1VQN A;  4BI4 A;  3CCU T;  3CCL T;  3QBY A;  3TEE A;  5GAN d;  5A2Q E;  4OB1 B;  4IUP A;  2QEX A;  4BB7 A;  4OB3 B;  1U1S A;  1VQ7 T;  3M54 A;  2XDD A;  2Y90 A;  4RCC A;  4OB0 B;  3EAE A;  1UGS B;  2KVQ G;  2EQM A;  3CC2 T;  4XU3 A;  2CZ1 B;  1YIT A;  4XU2 A;  2EKO A;  3X25 B;  5GAN h;  1KC8 C;  3A8M B;  5C0M A;  3HRT A;  3FDR A;  2DZ9 A;  3M53 A;  5GAO m;  2HNI A;  3OYJ A;  2E1H A;  2Y4Y A;  3C95 A;  2E10 A;  4QQD A;  5FRN A;  4HT9 A;  3OYM A;  1N9R A;  5LJ3 g;  2VYT A;  1EIF A;  4IUU A;  5FU6 B;  3PNW C;  3G6E T;  1N8R U;  4M7D G;  1QVF S;  3JCM g;  3P8B B;  1P92 A;  2CZ0 B;  3QYG B;  2QQR A;  3BW1 A;  3QZ9 B;  1VQ4 T;  1KD1 U;  3BFM A;  3GPL A;  5KE3 A;  2WSE E;  3MP8 A;  2HD0 A;  4EMH A;  2LNV A;  4PJO F;  5KCO A;  3OYA A;  2PQW A;  1YI2 A;  2RM4 A;  5GAN 3;  1QVG A;  2EJF A;  5LJ3 e;  3LYI A;  2GQV A;  3OYN A;  2E41 A;  4IUT A;  4C92 D;  5CAI A;  5CK9 A;  3M4Y A;  2KDS A;  5LL6 S;  1QW1 A;  3CCM A;  2XIC A;  3RUX A;  2XG8 D;  2WSF E;  1UGP B;  4DQ2 A;  2DK3 A;  3HFN A;  4M7D A;  3INZ A;  2OAU A;  4E7H A;  3LGF A;  3CD6 T;  1K8A U;  1BI3 A;  3RMQ A;  2VXF A;  2K3X A;  2M16 A;  2ZPB B;  4M77 D;  5D6Y A;  3OS0 A;  3OYG A;  2E5Q A;  5FRM A;  3L2V A;  1UGQ B;  4J6X A;  3CME A;  1LJO A;  4PJO B;  2QI2 A;  4M78 D;  4RG2 A;  3OYB A;  4LDX A;  4MZT A;  2VUB A;  3URG A;  4HA8 A;  5FU6 C;  1QP2 A;  4PL6 A;  1LOJ A;  3QII A;  2RHI A;  5CKD A;  4X34 A;  5DLO A;  3L2R A;  3OB9 A;  1VQM T;  2RI5 A;  3PGG A;  3E9F A;  3CC7 T;  1RL2 A;  1BIB A;  2WAC A;  4M77 E;  3RMS A;  4C8Q F;  1UGR B;  1WGS A;  2KY9 A;  5GAM f;  1LNX A;  2RJD A;  3QG1 A;  4A4H A;  3CCR A;  4KUD K;  2F5K A;  4LDV A;  5LJ3 d;  5L8R E;  3SFM A;  2ZCF B;  3T9N A;  1Q81 U;  1I5L A;  1K73 C;  4M7A G;  3JCM d;  3LWI A;  1U1T A;  5GMK e;  3H6Z A;  1W4S A;  1WQW A;  5LJ3 h;  3J80 E;  5GAO r;  5IT9 E;  1OI1 A;  4II1 A;  3CXC S;  2OTJ A;  4MMK A;  3L1A A;  3SWN B;  3OYC A;  2RJF A;  4ZN3 A;  3O8V A;  3HL8 A;  4GY5 A;  3JCM W;  4PJO C;  4XAX B;  5LJ5 j;  3HP9 A;  2NLU A;  3CEY A;  5GAM j;  1B34 A;  4JLG A;  5CKB A;  4C8Q B;  1NJI C;  1OYX A;  2EQK A;  4C0G A;  3SB2 A;  1X75 C;  3VYG A;  2EQJ A;  2LTO A;  3EFR A;  3ZEH A;  2L8D A;  4C5H A;  3X20 B;  1NPP A;  4M7A A;  2DKG A;  3PMI A;  3M59 A;  3JRZ A;  2D6F A;  2EFI A;  3G7Z A;  1W2B S;  2EAY A;  1YCY A;  3JCM P;  1YJW A;  3PIO A;  5IAY A;  2BUD A;  1ZBX A;  1YIJ A;  1NZ9 A;  1S72 T;  2ZPF B;  4B9X A;  2RA2 A;  3A8H B;  3HRS A;  3LWH A;  4J7I A;  4ELZ C;  1VQ6 T;  3CCV A;  2FB7 A;  2R58 A;  2L5Q A;  5GAN 7;  3OA6 A;  5I2S A;  5HK3 A;  3C4S A;  4V2S A;  2LQ8 A;  4M7D D;  2KMT A;  1R8O B;  2RHU A;  5EG2 A;  2K5I A;  2P0P A;  4PLI A;  5I2M A;  3JCM f;  1VUB A;  3JB9 I;  1YHQ T;  3JCM X;  3OMC A;  1W2B A;  2LVM A;  1VQ9 A;  4FSX A;  3MP1 A;  2M9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...