2KVQG

Solution structure of nuse:nusg-ctd complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
RPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NusE
publication title A NusE:NusG complex links transcription and translation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kvqG00
1N8RU 4RG2A 3CMAA 1VQLA 1YJ9A 2QEXT 2KVQG 3CCJT 1KQSA 1M90U 1IZ6A 2E6ZA 1Q86C 3DB3A 3CCVA 3CD6A 1VQ5T 1KD1C 2EIFA 1KQSS 1VQ4T 1Q7YU 2OTJA 3G71A 1YITA 3G6ET 3PIPA 5A2QE 1QVFA 3CCRT 3OW2A 3CCMA 2MI6A 3P8BB 2JOYA 4QQDA 1VQKA 3LH0A 1S72A 3G4ST 1Q81C 2MWPA 1VQOA 1YJWA 3CC2A 1VQ9A 1KC8C 3CCEA 1SSFA 1X6OA 1K9MC 3DB4A 2LVMA 1YBYA 3CC7A 1XTDA 1YHQA 3CMET 3CC4A 2DO3A 5IAYA 3I56A 4CRIA 4ZN1A 3I55A 3CCQT 1YI2T 2OTLA 1UEBA 2JVVA 1YIJT 3CCLT 1YJNT 4X34A 1VQMT 1M1KC 3CCUT 1KHIA 5LL6S 5J3BA 2MWOA 1Q82C 2IG0A 1NJIC 2QEXA 1W2BS 3DLLA 1K73U 3CCJA 3CCST 1M1GA 5DLQE 1Q81U 1VQ8T 1VQNT 1JJ2A 2QA4T 1K9MU 1VQ7T 1K8AC 3CXCA 1VQ5A 3TREA 1K73C 4ZN3A 1VQ4A 1N8RC 5DM7R 4TVRA 3CPWS 1JJ2S 3OYYA 3G6EA 2JUFA 3CXCS 2LQ8A 3CCRA 1VQPT 1QVGA 1Q86U 1VQ6T 4YTLA 1M90C 1KD1U 3KBGA 1XNIA 5HY6A 5IT9E 1QVGS 3G4SA 3ER0A 5J26A 3A5ZB 3HKSA 1W2BA 1VQLT 3CMAT 2KDSA 1YJ9T 3J80E 3CMEA 3PIOA 2JNGA 3CCVT 3CD6T 3CCQA 1YI2A 3CPWA 2LCLA 2G3RA 1KC8U 3LGFA 1YIJA 3CCLA 1YJNA 2OTJT 3G71T 1VQMA 2XHCA 1NPPA 1YITT 3J7AF 3CCMT 3CCUA 1VQKT 3CCSA 1S72T 1VQ8A 1NPRA 3LGLA 1VQNA 2QA4A 3J81E 1VQOT 1YJWT 3CC2T 1VQ9T 1VQ7A 1M1KU 3CCET 1RL2A 2CKKA 3CC7T 1EIFA 1YHQT 1NZ9A 1Q7YC 1Q82U 1NJIU 3CC4T 1VQPA 2L3RA 3I56T 3I55T 3CPFA 1BKBA 1QVFS 1VQ6A 3OW2S 2OTLT 3JAME 2E70A 1K8AU 5FLXE
chains in the Genus database with same CATH superfamily
1NM7A 1LPLA 3JCMJ 2XG8D 4L6V5 2X4XA 4Z88A 5CKEA 3CCJT 1Q86C 2XMFA 1KK7A 4P5NA 4LD9K 1K8AR 5GAOl 5GAOq 4DEYA 2L3SA 2CZ7B 2OAUA 4JPBW 5A0GA 2DJZA 4ESRA 2ZPBB 4PFOA 3LLRA 5GANe 2RI2A 1SRMA 1M5Q1 1SSFA 1Y0MA 1A0NB 2RF0A 3CMET 4E7JA 4KGVB 3NGPA 1YN8A 4IURA 1PKTA 1PRLC 2CGHA 3CCQQ 2JTEA 1BI0A 2CSQA 1RI0A 2QQ9A 2LJ0A 4C0DC 4EMGA 4DOWA 2QEXA 1KFZA 2C0TA 4XQ3A 1NG2A 1VQ5A 1U1TA 2E3IA 5FU6B 1QVGA 1UB4A 1WJRA 1R0BG 4M7AG 1OPLA 1G8XA 4OGEA 2M9UA 3A5ZB 3QDRB 3SWNB 3V7RA 4DEXA 4KRTA 3CMAQ 4DOVA 4ZTFA 1OQKA 1QLYA 3PIOA 1B34B 3H8ZA 1B7TA 3CPWA 4PFZA 2OTJT 3G71T 1WJQA 2EWNA 2L8DA 4FW2A 1KD1R 4M7AA 5A0DA 5GAMh 3VV0A 5GAN6 4M77D 5LJ3d 1FXXA 4J7IA 2CKKA 2QDLA 3S3OA 1AT1B 2LNVA 2DVEA 3VJPA 2RQVA 2GBQA 2KEAA 3X20B 2FPFA 5IHKA 2P0KA 3BDLA 4BE2A 2RD1A 2NUZA 3OMGA 2V8IA 1UGQB 2BKDN 1VQ4T 5GANh 3EGDB 2YUOA 1RLQC 2YXYA 1WJSA 3OYAA 3OS1A 2QQSA 2JS2A 4KGXB 4FYWB 1M2OA 1OULA 2W10A 2E12A 5LJ3j 1UUEA 3REAB 1ZBXA 2RI3A 3JCMX 2DIQA 3CC7A 2DRKA 5GAOm 2LQKA 1WGSA 3I56A 1KHCA 1YJNT 4E6RA 2X3XD 1X43A 2DEUA 4F7UE 4C0FA 4C8QD 4E7IA 2EAYA 2B86A 3TREA 4CI0C 1VQ7Q 3JCMW 3OYYA 4NS5A 2K79A 2LQ8A 3GPLA 2Y4XA 5KH6A 3KBGA 2DBKA 3GP8A 1JB0E 3G4SA 2A3LA 4J6YA 4F7UF 2K4YA 4GLMA 1VYUA 4OMOA 2DIGA 2SRCA 4J6WA 4DBHA 1YJ9Q 3JSCA 1X6GA 2LCLA 1VYTA 4AFUC 3CCVQ 1AWOA 3MEWA 1SPKA 3CCMT 2F69A 1KJWA 1I5LA 4M78C 4FCYA 5GANg 3D7SB 4R0KA 2JT4A 3EAEA 1WHKA 3CCET 3MKDA 1MV3A 4KUIA 1EIFA 2HDAA 1W2BP 1IO6A 3HPWA 2OTLQ 1Y96B 4RG2A 2ROLA 3OYDA 3QO3A 2EBPA 2WSFE 1BK2A 1AD5A 3SWNA 2D1XA 1IZ6A 2E6ZA 3DB3A 2XDDA 5LJ3h 1RAHB 2LNHB 1B34A 1YFNA 3ASKA 1KSWA 4A4KA 4A4EA 5GANf 3P8BB 5GAN5 1ZUUA 2QQAA 1M90R 1MMNA 2R5MA 4JDSA 3DB4A 1XTDA 3A1PA 2L0AA 4VUBA 2RI5A 4HT9A 3JCMe 3LX7A 4ELZC 1JO8A 2A28A 3CCLQ 1BCOA 1VQMQ 5J3BA 2PTKA 2DAQA 2RB6A 4M7DB 5IN1A 3M55A 4PLIA 2GGRA 4JRQA 2DL4A 2LJ3A 2CS7A 4LXCA 4L59A 2KNBB 2RM4A 2CT4A 2K7AA 1VQPT 3EGDA 3OYEA 1Q7YR 2EFIA 1X75C 5AYFA 2FG0A 2R58A 3SFMA 1QCOA 5CK9A 2NUTB 1WHHA 1GCPA 3HKSA 4F17A 2KDSA 1PSFA 2EGCA 4OP0A 1WHMA 2DVJA 3CCQA 1MV0B 2DL8A 2RJCA 3U23A 3L2WA 1Z9QA 1YITT 2RQTA 2CP2A 1C6VX 2C0IA 1ABOA 1NLOC 1TWBA 3A8GB 4DA4A 1TTHB 2X4WA 2HBWA 1H641 1YJWQ 3CC2Q 4EIKA 3VKIA 2EQJA 3ULRB 1QKWA 3WVDB 1YHQQ 3CPFA 4C92E 4M78F 3L2QA 2DXUA 1UECA 3FJPA 2HEQA 1N8RU 4B9WA 2RJFA 3BW1A 3EHRA 2ESWA 3CMAA 1LCKA 5GJWB 2NWMA 2RJEA 1Q82R 2HKNA 3I9QA 1TU0B 3DKMA 2EIFA 3NHNA 4ORZA 3G6ET 4C92F 4QT7A 2K3YA 1WZOA 2DL3A 3A8OB 1Q81C 2AKKA 1QWFA 3QBYA 4BB7A 5KYXB 1TH7A 1CSKA 1JXMA 4ZN1A 1JXOA 2VVKA 1FMVA 5FRMA 1SG5A 3JCMb 1OV3A 3OMCA 4DQ2A 1Y96A 3FB9A 3OYJA 4JJBA 2DXCA 2EQIA 5GAN2 1VQ8T 5GAN7 2QGFB 2ENMA 1K73C 1CKBA 2GFUA 3EH2A 3CPWS 2DTHA 3CXCS 3GNGA 5FWCA 1G5VA 3BY7A 4EMKC 1W2BA 2A37A 3C95A 4M7DG 1E6GA 1T0JA 1M27C 2A7YA 4M78D 1YCSB 5FU7B 3CD6T 4GLKA 4J9IA 1RAFB 1WXTA 1KC8U 1I4K1 4PFPA 5GMKe 2ZPHB 2HL5C 3UT1A 4J5YA 4XTZA 4M7DA 2RQUA 3AT1B 1VQKQ 1PCXA 1VQ7A 4C5EA 3A8LB 1UGPB 4GY5A 3TQ7P 1NJIU 4DBRA 2L3RA 3JCMg 4LDXA 3I55T 1QMCA 4IKFA 1C0MA 5C6SA 3HRTA 4ELYC 2NYSA 4BDYA 5D6YA 3L2ZA 2J6OA 1PWTA 1UTIA 2V8JA 3UWNA 3F70A 3RERA 1RAEB 2NUTA 1AWWA 1YJ9A 2XK0A 1SRLA 2IIMA 1D1AA 1FX7A 3CCVA 4PJMA 1KQSS 2NLUA 4BD3A 1Q7YU 2MYSA 3QJ6A 2OI3A 2LX9A 3CCRT 2HKQB 2RHUA 2VC8A 1H3ZA 3A98A 2F1LA 3V7CA 3E9FA 4BY6C 1W4SA 3JCMf 4D8DA 1YBYA 3VRZA 1M3CA 2DZCA 1QCFA 2GFAA 4J9CA 2JXBA 3QG1A 4J83A 2OTLA 1G3SA 1K76A 3OS0A 2CP6A 3FJ5A 4LD6A 3X24B 2D6FA 1I8FA 3OW2P 4Y28E 1UDLA 3GIBA 4AFZC 3CCSQ 2O9SA 1BI3A 1GBQA 1T3LA 1JJ2S 2J6FA 3JB9J 2KRNA 3REBB 4BI8B 1G3YA 2E5QA 4BUGA 4F04B 4HCZA 4LDWA 2DMOA 4KT0E 1ABQA 5GMKh 4OMNA 2OAWA 2YRCA 5KYXA 4WF2A 1I07A 1K4US 1Q86R 3CCLA 5HCKA 1VQMA 5GAMd 1NPPA 4AMCA 2DRMA 2F2XA 1M9SA 2MOXA 3BDUA 1S72T 1UE9A 5GMKm 3GNFB 3LWIA 4F16A 1YWPA 4KULA 3SHWA 4M77B 4M75G 4RCBA 2Y90A 4J9GA 3PT9A 5LJ5e 2P0PA 1RI9A 4M7AE 5GAN4 4XU1A 1MMDA 3R6OA 1AZGB 1LNXA 2PU9B 4BI3A 2ED0A 1KG1A 4OB3B 4PJOG 3VYGA 5GANd 1M8VA 1K0SA 5A2QE 4OB2B 4PJLA 1LOJA 5GAMj 1XQHA 2JOYA 5GAOr 1GFCA 4M7AF 1JQQA 2ZPEB 1YJWA 3CC2A 4FT2A 4RTVA 2H3JA 4AG2C 5D6XA 3QJYA 1K9MC 3X25B 2XD0A 1YHQA 2WSEE 4IUVA 4CRIA 2ZCFB 3VS3A 1YI2T 4JRPA 2EVRA 1ZSZC 1N9SA 3V8JA 3V7SA 1B07A 4D8KA 3CCUT 2XIDA 2QTVA 3FIFA 3RKYA 1M1GA 1SEMA 2ZZDA 4JS5A 2GF7A 2BIVA 1VQNQ 1WLPB 2D0NA 1PD0A 1PKSA 2K5FA 5GANj 5I2SA 1WYXA 2FHDA 1WQ7A 1D0ZA 4WCIA 4C8QB 2V26A 1GCQC 2F2WA 1I81A 1TSFA 2LQNA 4EMHA 2DNUA 4RTWA 1WPYA 3EFOB 3QHSA 3M4YA 1OX8A 3EH1A 1ACMB 2JM9A 4IUQA 4MZPA 1HXDA 2GCXA 2DBMA 3RR6A 5EC7A 5ECAA 1NLPC 2JMAA 4Z8AA 1F1BB 4E7HA 4ATOA 5KYUB 2EKHA 4OMLA 1M1KU 1KQ1A 3VUBA 1VQOQ 3VS1A 4N4IA 2A08A 1G2BA 3CC4Q 3WVEB 3M0QA 3OSSC 1P92A 2ECZA 2DETA 2O9VA 2QDYB 1RAAB 3NTIA 3H0FA 2QEXT 2DD4A 3THKA 1HD3A 2QGGA 2EYWA 2LT4A 1VQ5T 1GXIE 3EGXB 3OW2A 4AG1C 4DBQA 4M77G 1M30A 2CSIA 1RUWA 2KRMA 1VQKA 4J8OA 5CVIA 2K5IA 1KIKA 1X6OA 5IHNA 3E1SA 2BUDA 2RHYA 1AOJA 2LZ6B 4C5HA 2DO3A 5IAYA 3H0HA 4LUEA 2V1QA 3SEMA 2YUPA 4KH0B 3WXMB 4M77A 5DY9A 2JVVA 2YDLA 3M58A 4OF1A 1AVZC 3GLXA 1BB9A 2HQHA 4HVWA 1SHFA 2VYTA 4C0DB 1QVFP 4FW1A 1W2BS 3DLLA 3EG9B 2CUBA 3HRUA 2DTIA 4ZGEB 3I35A 2QA4Q 1E6HA 5DM7R 2DXTA 1OX9A 1RACB 2JUFA 2ZPGB 4QKUA 2E4HA 2P4RA 3A8MB 2D9TA 3HTRA 3QPHA 1UJ0A 5IT9E 1VQ6Q 5LJ5g 1ZQ1A 3M53A 3RKXA 1IHWA 1D1CA 2GTJA 2YRDA 2FYKA 3OYHA 1VQLQ 4MZTA 3SB2A 1BI1A 4CC3A 2RNAA 4FT4A 4XTYA 4OGCA 1SKUB 3VS0A 4AFQC 1OU8A 4C8QG 3CCSA 1VOMA 1O9SA 3OBYA 3J81E 4J9BA 1NBEB 4KGZB 5KYNA 1CKAA 3JCMc 3CC7T 3H0IA 3EFRA 4J7FA 4BI4A 2EW3A 1U5SA 3I56T 3G1JA 5LJ5f 5CQYA 2FZCB 1SF9A 3HP9A 4BE1A 1K8AU 2JMCA 5KYYB 4C8QA 3C12A 4FM4B 4CC2A 1WFWA 3JB9H 3N5BB 2X35A 3M4GA 3V8KA 3EFOA 2H8HA 2QI2A 1M1FA 3S3NA 3TSWA 3NTKA 2EJGA 2MI6A 5A0LA 4Z89A 2DKGA 4QQDA 2DJQA 3JCMd 3G4ST 5KYUA 1WHGA 4NOYA 4RG8A 2LVMA 2JTFA 2R57A 4C92C 3HSBA 2YUQA 5CR2A 2VUBA 1QVPA 2RHXA 1NE8A 3EG3A 4JJDA 1AWJA 1YIJQ 1TUDA 2QQBA 4C0GA 3MJXA 1QQJA 4J9HA 4RMOA 1H92A 4HA8A 4MDXA 4QVDA 4E2FB 4FSSA 5FROA 2G6FX 1N8RC 1PSEA 1UFFA 4RTXA 1M2VB 3EGXA 2LDMA 4XU3A 1KD1U 1XNIA 4OVAA 1FWZA 3VUZA 3ER0A 1MUZA 2J06A 1PNJA 3J80E 3JCMV 2HQXA 3ZL7C 2IPOB 4Z02A 2VGNA 1E7OA 2KE9A 2AZSA 3X26B 4M78B 4RTUA 3OYLA 1NPRA 1VQNA 3EG9A 1RABB 2XDPA 1Q81R 1VQ9Q 3C0CA 1AHJB 3KFVA 4B6MA 1T0HA 3TCJA 3SDZA 4C0ZA 4LNPA 3QXEB 3TSZA 4HVUA 3URGA 3QYHB 1M3BA 4M7DE 3CCJQ 4X1VA 4FYXB 4BDZA 1Q95G 2OJ2A 3PIPA 1K73R 1QVFA 2DLPA 4AFSC 1GRIA 2I0NA 3RDVA 3C4SA 1VQOA 1MGQA 1KC8C 3PTAA 1V76A 4Y92A 4JS4A 1D09B 2KXDA 3OS2A 3CC4A 2HNIA 4L5GA 1ARKA 2OX7A 3CMEQ 1JU5C 3CCQT 1UGSB 3CBPA 2AZVA 1OI1A 2JJ9A 5KYYA 2YRVA 2J7IA 2BZYA 2A36A 5FU7C 5IXBA 4JLIA 1NJIC 3GF5A 2HSPA 2YWWA 1G3WA 4J9DA 3JCMh 1U3OA 5GAOp 2LT1A 3NMZC 3MCAB 2FRWA 1K9AA 4QW2A 2L89A 3DLMA 3O5ZA 2CP7A 1QVGS 3S6WA 4KH1B 2VGMA 4MMLA 1UHFA 2E6NA 3CMAT 1NYGA 3OQ5A 2O01E 5CQXA 5CIUA 3OYFA 3LGFA 3PFSA 3OYMA 1HSQA 3KXTA 1ZA2B 2MF2A 3J7AF 2QAZA 4OMPA 2OTJQ 3G71Q 1WNLA 5HK3A 4A4GA 2QA4A 3FRNA 4ANJA 3ME9A 4R56A 2PVOB 1BCMA 1FYNA 3S3MA 1PG5B 1VQ6A 3OW2S 3PE0A 3H9NA 1M2VA 4M75B 1X2QA 1WQWA 2EQKA 2PVGB 2L5QA 1VQLA 5GMKj 4M78G 1M90U 4NL2A 2E5KA 3OB9A 2EGAA 5EG2A 5FWBA 4IIOA 4E7KA 4PJOB 2EQUA 2KY9A 1VQ4Q 3MP8A 3T9NA 4FL6A 4C92D 1X2KA 3LWHA 3MHXA 2M0OA 5GAN3 4M78A 1OYXA 4NL3A 1VIEA 5CKDA 2LCSA 2J6KA 2KSSA 3MP6A 2VWFA 3M56A 4HCCA 4FU6A 4IUPA 2EYYA 4M75E 4M7AC 2O2OA 1PD1A 1YJNQ 3VS4A 2D8HA 2IG0A 1QW1A 4HCKA 5IHIA 1Q81U 5DLQE 1HJDA 2E3HA 5HKCA 1VQ7T 2HAXA 4ZN3A 2DA9A 4JZ3A 2E41A 3L2VA 4N0AA 3HFNA 3C94A 1JRIA 4HCBA 2NUPB 3GBQA 1LJOA 4YTLA 2CZ0B 1M4ZA 3LW5E 1MNEA 5J26A 2MIOA 1MMAA 2HSEB 4EMKB 3JB9F 1YJ9T 4M77C 3PVQA 3CBMA 5KCHA 2VB6A 3I56Q 3CCVT 2PZ1A 3MPUB 1LVKA 4GBQA 1YIJA 3CXCP 3M9QA 2XHCA 2KMTA 4OMQA 1GBRA 3CCMQ 4KBMB 2RO0A 1Y57A 1ZA1B 1RL2A 3E2UA 4JJCA 3JRZA 5LJ5d 4V2SA 5CKBA 1U8RA 3CCEQ 1Q82U 3RIRA 1K9MR 1N27A 2DERA 5AT1B 2OTLT 1Y71A 2KROA 3OS5A 2L2PA 2YT6A 1GFDA 2L3QA 1QCNA 1IXDA 3QZ5B 4HKEA 3EG2A 1M3AA 2X3WD 2MAMA 3RMSA 2KVQG 1I5OB 2COZA 3PMIA 2O4XB 2LC4A 2CH4A 3VS2A 3BE3A 4J9FA 1Y7XA 2AHJB 2CUDA 3RNJA 1OZ3A 4Y91A 2F5TX 7AT1B 4JJNK 2EYZA 2K2MA 3LYIA 1VQ9A 2E65A 1EFNA 2C06A 4BY6B 1D0YA 4ZGDB 5LJ5j 1WHJA 2JN0A 2YUNA 2O88A 1KQSP 2BTTA 1W70A 3CCLT 1VQMT 1UJYA 3CQTA 4M75A 1M1KC 2GQIA 5D6WA 1T3SA 2D8JA 3JB9D 3VRYA 2COYA 2EJ9A 1XOVA 2MCNA 3OYNA 3CCJA 2QK0A 2EYQA 3HFOA 5KE2A 2SEMA 5FU6C 1TG0A 1K0XA 1SSHA 3EGUA 1EZZB 3BFMA 4PJOA 2JM8A 4RTZA 1VQPQ 4CC7A 2X9HA 4M77E 1BIBA 2J05A 4RTYA 5GAMe 1HYOA 3SWNC 2I2LA 2WACA 2P84A 2KGTA 3CMEA 5C0MA 1I1JA 2RJDA 1NEGA 1IB8A 2RK1A 3M57A 1JJ2P 2JW4A 4RUGA 2FRYA 3OBWA 4OMMA 2VKNA 3MP1A 5KCOA 1YITQ 4M77F 2FZKB 4MZMA 4IUUA 2P4TA 2YLBA 1U1SA 2FPDA 4WTOB 8AT1B 2KRSA 1V29B 1YJWT 3CC2T 3RBBB 4A53A 1YHQT 2C0OA 1PM3A 1QVFS 2CH4W 2NUPA 1G3TA 3H41A 1HK9A 3VU3C 4EMKA 1UGRB 3FEOA 1YCYA 4XTWA 5GMKi 4FYVB 2OTJA 3G71A 6AT1B 2K3XA 2DZ9A 5LJ5h 4QVZA 3G6EQ 3HL8A 5IH2A 2DILA 4C8QE 2VV5A 4JLGA 4M7AD 1JEGA 2RPNA 2P0QA 4II1A 3M5AA 3OYIA 4RKUE 3MEVA 4AT1B 3M0TA 3RUXA 4PK4A 3G7ZA 3EG0A 1QP2A 2LX7A 1ZSZB 4ME7A 2KK4A 1KHIA 2PNIA 4FSXA 2MWOA 4C8QF 3I5RA 3OA6A 1OPKA 3PNWC 1K9MU 1K8AC 4FIBA 3CXCA 1VQ8Q 1PC0A 1VQ4A 2O4XA 4K11A 2B8AA 2DTOA 3M59A 2QQRA 1Q86U 1ZSGA 5HY6A 3M54A 4XTXA 1W6XA 1G83A 1EX4A 4LN2A 2DFUA 3M0RA 4QQ6A 1N6AA 1N5ZA 4N4GA 2CDTA 1TS9A 1DJ7B 2FL7A 4OB0B 3QZ9B 1IHVA 2XU8A 2L3PA 1WXUA 3VS7A 2AT1B 3CD6Q 1YJNA 5I22A 4A54A 4F14A 4C5GA 1TXQA 1FMWA 3LH5A 4F7UB 2CREA 4E7SA 1VQKT 1OEBA 2W0ZA 4LDYA 5IXFA 2CZ1B 1ZLMA 1N9RA 1AZEA 1NZ9A 1WX6A 5LJ3e 4J9EA 1TOVA 2PQWA 1BKBA 3EG1A 3JAME 3I55Q 2BZ8A 3TEEA 3VS5A 2BE9B 2EYXA 2YLCA 3TVTA 4XU2A 1RLPC 2HL3A 2E10A 1KQ2A 4O5VA 1KQSA 2IVWA 3ZFJA 3JV3A 4RTTA 2K57A 4Q5WA 1SHGA 4X9DA 1MNDA 2KT1A 1KD1C 2M0YA 3M0PA 1WIEA 1UG1A 1S1NA 2KYBA 5L8RE 1N8RR 3CCMA 4A4HA 3L1AA 3CCRQ 1U06A 2KBTA 4IUTA 5GAMg 2K2VA 4HXJA 2ZGWA 2MWPA 1X6BA 3CCEA 1D3BB 5D7UA 2DD5A 4JUVA 3V8LA 3AHUA 2O31A 4XK8E 4QVCA 2XI9A 1IGUA 2V8KA 2RH2A 5LL6S 1R8OB 4M7DC 1IRXA 3CCST 1JJ2A 1IREB 5J39A 3MO8A 4E47A 5I21A 5GAN8 4C5IA 4TVRA 3RMQA 1ZBJA 2R5AA 2M51A 3NPFA 1QKXA 5GAMf 2HMAA 1X01A 2RA2A 2M1HA 5KYWB 2F2VA 2FEIA 2DF6A 2LRQA 2QYZA 2EJFA 2JNGA 4E7ZA 4ZNXA 2G3RA 4HVVA 2DX1A 2CP3A 1BIAA 2K6DA 1ZSZA 5L23A 2KAFA 4CC4B 2GQVA 2DYBA 4N0AC 1S72Q 3NFCA 2K9GA 2EGEA 4LDUA 1I0CA 1KC8R 2LP5A 1VQPA 4XTUA 2FZGB 1VIFA 2KXCA 2QASA 2PVDB 1OZ2A 2CT3A 3HRSA 2X4JA 1GCQA 3EHQA 4F7UG 1W1FA 2VXEA 3META 3SD4A 2HD0A 1NJIR 2DK3A 2DPPB 4X9CA 2HBPA 2M16A 1YITA 3HHTB 2FPEA 4QQGA 2PUKB 3KUFA 4F7UA 4UC4A 1WDXA 4ZTJA 2DM1A 3PGGA 1M8MA 3CBOA 2HQEA 4XU0A 2RMOA 2LCCA 2BZXA 2DE0X 3QSUA 4C92B 1J3TA 2EPDA 2KT8A 3OSVA 3P8DA 4R55A 2RK2A 2M02A 1UEBA 3OYKA 1Y07A 1YI2Q 3EFSA 1RAIB 2CP5A 2AKLA 3GOXA 3CCUQ 1D1BA 3FDRA 4OB1B 2LQWA 1VQNT 4M78E 3QWXX 1AWXA 3UA6A 1WA7A 2E1HA 9ATCB 1O75A 5LJ3g 4IIMA 1RADB 2Z0WA 3G6EA 4M7DF 3OYBA 2DXBA 4M4ZA 4DBFA 3OYGA 5CO7A 1M90C 3OY9A 5GAOn 1UGVA 2RHZA 4JRKA 1UHCA 3R6NA 3E9GA 2ZPIB 1D3BA 4M75C 2ZPFB 1VYVA 4MMKA 2LJ1A 1TUCA 5FRNA 3INZA 2ABLA 1VQ8A 1JBMA 3QKJA 1V1CA 1Z9ZA 1VQOT 4PJOC 5LJ3f 2Y4YA 4D6WA 2MMPA 3UPUA 5KE3A 1Q7YC 3CC4T 3RESA 1WXBA 4A63B 2CP0A 1D0XA 5FLXE 8ATCB 3P8HA 3PMTA 5KYWA 2EQMA 4BACA 3UATA 5GJVB 3L2RA 2QEXQ 1QWEA 2RN8A 5I11A 3CD6A 4XAXB 1IGQA 3QYGB 3VS6A 1WHLA 1VQ5Q 2XDBA 2E64A 4PJNA 2ATCB 3QUIA 1BU1A 2AIRB 4RCCA 2VASA 1BI2A 3A8HB 3I5SA 2RQRA 4PL6A 4EPCA 4E7LA 2FVUA 3NTHA 3RKWA 4KUDK 4M7DD 3CEYA 3I55A 3JCMQ 4OMFB 4O6JA 2CZ6B 5DLOA 2X51A 4X34A 3IQLA 1C1AA 5CKHA 3UDCA 1Q82C 2YHTA 2K3BA 3QWYA 5GMKl 3Q1JA 1PHTA 2QA4T 4ZGJB 1VUBA 2DEQA 1H8KA 1AEYA 4BE0A 2FB7A 2CYZB 3TU4K 3UA7A 4C92G 4LE9A 3CCRA 1NYFA 3VYHB 1VQ6T 4PKCC 5CKFA 4LDVA 5I2MA 3L2UA 1VQLT 2AK5A 2VXFA 4HT8A 5CAIA 1B3QA 4C92A 2WSCE 1NEBA 1YNZA 1VA7A 1BYMA 3ZBDA 2ED1A 4PJOE 5HK0A 3MEUA 1QVGP 2DYIA 4M75F 1OOTA 1K1ZA 4PLLA 1ZX6A 1BBZA 2GTOA 2JZ2A 1R77A 3CC7Q 2V1RA 2QXFA 1MMGA 3E19A 3JCMP 2E70A 2HZYA 2MPXC 3UF4A 1K73U 3CPWP 4PJOF 1MHNA 3QIIA 5CCAA 1M1KR 2QG9B 3M0UA 4FYYB 2YSQA 1X27A 2EKOA 1X69A 4MDWA 2GNCA 2F5KA 1R0CB 3FLGA 3QDFA 2XKOC 3LH0A 1S72A 2JS0A 1ZUYA 4J6XA 3G4SQ 2FO0A 1FMKA 1ZUKA 3JB9I 5M9OA 2ZAEA 4PNOA 2MK5A 1QP3A 1ZHIA 3X28B 1YIJT 2LTOA 3M0SA 2HCKA 4M7AB 1WI7A 2RHIA 2LMJA 2JTMA 4JRIA 3H6ZA 1YP5A 4LUDA 2ROTA 2COWA 3MEAA 1GL5A 2KYMA 2XICA 4C8QC 4EDUA 4M75D 3ZEHA 3FC3A 2D0QB 2QTXA 1RAGB 1PRMC 1H3HA 2K5LA 4XTVA 1YI2A 4PJOD 2PUOB 5FW9A 1XJWB 2DL7A 1OU9A 3JB9G 4N4HA 3CCUA 2X4YA 1TUGB 4B9XA 2KQWA 3L42A 2KR3A 3O8VA 3LGLA 2RQWA 1YWOA 2DL5A 2KI7A 1VQ9T 2BE7D 3PVLA 4PJJA 2A0FB 2H3EB 3OYCA 4JZ4A 4A4FA
chains in the Genus database with same CATH topology
4BDYA 5D6YA 4C0ZA 2YLCA 3L2ZA 2V8JA 3UWNA 3QXEB 4XU2A 3F70A 2XG8D 3JCMJ 3RERA 4L6V5 2X4XA 3URGA 1YJ9A 2E10A 2XK0A 1KQ2A 3QYHB 4O5VA 5CKEA 3CCJT 1KQSA 2IVWA 3ZFJA 1Q86C 4M7DE 2K57A 1FX7A 4Q5WA 4X9DA 3CCVA 1KD1C 4P5NA 1KQSS 2NLUA 4BD3A 1Q7YU 4LD9K 4BDZA 3QJ6A 2LX9A 5GAOl 5GAOq 3PIPA 5L8RE 3CCRT 1QVFA 2OAUA 2CZ7B 3CCMA 4A4HA 5A0GA 2DJZA 2RHUA 3L1AA 2VC8A 2ZPBB 1H3ZA 3LLRA 4IUTA 3V7CA 2K2VA 3E9FA 5GAMg 5GANe 2ZGWA 2MWPA 3C4SA 1VQOA 1MGQA 2RI2A 1KC8C 3CCEA 1M5Q1 1SSFA 3PTAA 1D3BB 4BY6C 4JS4A 1W4SA 3JCMf 1YBYA 2DD5A 4JUVA 3V8LA 3OS2A 3CMET 2DZCA 3CC4A 3AHUA 2HNIA 2GFAA 4L5GA 4E7JA 3QG1A 4IURA 3CCQT 4J83A 2OTLA 4XK8E 1G3SA 3OS0A 2CGHA 4QVCA 1UGSB 2XI9A 4LD6A 3CBPA 1BI0A 1OI1A 1RI0A 2QQ9A 3X24B 2V8KA 2YRVA 2D6FA 2RH2A 4C0DC 5LL6S 1R8OB 4EMGA 1I8FA 4M7DC 1NJIC 5FU7C 4JLIA 4Y28E 4DOWA 3GF5A 2QEXA 3CCST 1G3WA 3GIBA 1JJ2A 4XQ3A 1IREB 5J39A 3MO8A 1VQ5A 1U1TA 1BI3A 3JCMh 4E47A 5GAOp 5I21A 5FU6B 2LT1A 4C5IA 5GAN8 4TVRA 3RMQA 1JJ2S 3MCAB 2R5AA 3JB9J 4QW2A 4BI8B 1QVGA 1G3YA 1UB4A 2E5QA 2L89A 3DLMA 5GAMf 1WJRA 4BUGA 1X01A 2RA2A 2M1HA 4HCZA 4LDWA 1QVGS 3S6WA 4M7AG 2VGMA 4OGEA 2M9UA 3A5ZB 3QDRB 4MMLA 4KT0E 3SWNB 3V7RA 2E6NA 5GMKh 3CMAT 3OQ5A 2LRQA 2O01E 2EJFA 4DOVA 4ZTFA 4WF2A 5CQXA 2JNGA 3PIOA 1B34B 3H8ZA 5CIUA 3CPWA 2G3RA 3OYFA 3LGFA 3CCLA 3PFSA 3OYMA 3KXTA 2OTJT 3G71T 1VQMA 1WJQA 2EWNA 2L8DA 2MF2A 1NPPA 5GAMd 3J7AF 4M7AA 5A0DA 5GAMh 3VV0A 1WNLA 5GAN6 5HK3A 1BIAA 1M9SA 4M77D 5LJ3d 2KAFA 1FXXA 3BDUA 1S72T 2GQVA 4A4GA 4N0AC 2QA4A 3FRNA 4J7IA 3NFCA 5GMKm 3ME9A 3GNFB 4LDUA 4R56A 3LWIA 2PVOB 2CKKA 1VQPA 4KULA 3S3OA 2LNVA 4M77B 4M75G 2DVEA 3S3MA 4XTUA 3VJPA 1VQ6A 3OW2S 1VIFA 2PVDB 2Y90A 4M75B 4RCBA 3PT9A 1OZ2A 3X20B 3HRSA 1WQWA 2EQKA 5LJ5e 2PVGB 2L5QA 2P0PA 2X4JA 4M7AE 4F7UG 5GAN4 1VQLA 2P0KA 2VXEA 4XU1A 3BDLA 5GMKj 4BE2A 2RD1A 3META 4M78G 3SD4A 4NL2A 3R6OA 1M90U 1LNXA 2HD0A 3OMGA 2V8IA 2PU9B 3OB9A 4BI3A 1KG1A 4OB3B 1UGQB 2DK3A 2DPPB 4X9CA 5EG2A 4PJOG 2BKDN 3VYGA 5GANd 1VQ4T 1M8VA 5GANh 4E7KA 4PJOB 2HBPA 2EQUA 2M16A 2KY9A 1YITA 3MP8A 3T9NA 3HHTB 5A2QE 4QQGA 1WJSA 4FL6A 3OS1A 3OYAA 2QQSA 4OB2B 4C92D 1LOJA 2PUKB 3KUFA 5GAMj 3LWHA 1XQHA 2JOYA 4F7UA 4UC4A 5GAOr 2E12A 3MHXA 4ZTJA 4M7AF 5LJ3j 3PGGA 2ZPEB 2M0OA 5GAN3 3CBOA 2HQEA 4FT2A 4M78A 1OYXA 4XU0A 1YJWA 4NL3A 3CC2A 2H3JA 1K9MC 5D6XA 3QJYA 1ZBXA 2RI3A 3X25B 2DIQA 3JCMX 3CC7A 1YHQA 2WSEE 4IUVA 2LCCA 2XD0A 1VIEA 5CKDA 5GAOm 4C92B 2LQKA 1WGSA 2KSSA 3MP6A 3QSUA 3M56A 4HCCA 3I56A 3OSVA 4CRIA 2ZCFB 4FU6A 3P8DA 4IUPA 3TEEA 4R55A 2RK2A 4JRPA 1YI2T 1KHCA 1UEBA 4M75E 4M7AC 3OYKA 1Y07A 1YJNT 3EFSA 1N9SA 3V8JA 3V7SA 5GANj 3GOXA 3CCUT 2XIDA 3FIFA 2IG0A 4F7UE 1QW1A 3RKYA 4C0FA 4C8QD 3FDRA 1M1GA 4OB1B 5DLQE 1Q81U 1VQNT 2ZZDA 4JS5A 4E7IA 2EAYA 2GF7A 2BIVA 4M78E 5HKCA 1VQ7T 3TREA 4CI0C 2HAXA 4ZN3A 2E1HA 1O75A 3JCMW 3OYYA 2E41A 2K5FA 4NS5A 5LJ3g 3L2VA 4N0AA 3HFNA 2LQ8A 3C94A 1JRIA 3G6EA 4HCBA 4M7DF 5I2SA 2Y4XA 2FHDA 1WQ7A 3OYBA 1LJOA 2DXBA 3GPLA 4YTLA 3OYGA 5CO7A 4C8QB 5KH6A 2CZ0B 3OY9A 1M90C 3KBGA 3GP8A 1I81A 1M4ZA 1JB0E 3G4SA 3LW5E 4EMHA 5GAOn 2A3LA 5J26A 4J6YA 2RHZA 4JRKA 1WPYA 2K4YA 4EMKB 4F7UF 3JB9F 1YJ9T 2DIGA 4M77C 3E9GA 2ZPIB 1D3BA 4J6WA 3CBMA 3QHSA 5KCHA 3M4YA 4M75C 2ZPFB 3JSCA 3CCVT 4MMKA 4IUQA 4MZPA 2LCLA 1HXDA 1YIJA 5FRNA 2GCXA 3M9QA 2XHCA 3INZA 3MEWA 2KMTA 2F69A 3CCMT 1I5LA 4E7HA 4ATOA 4M78C 4KBMB 2RO0A 5GANg 1VQ8A 3EAEA 1JBMA 3QKJA 1VQOT 4PJOC 5LJ3f 2Y4YA 4D6WA 1M1KU 3CCET 1KQ1A 1RL2A 2MMPA 5LJ5d 3JRZA 3VUBA 5KE3A 3UPUA 4KUIA 4V2SA 1EIFA 5CKBA 4N4IA 1U8RA 1Q82U 1Q7YC 3RIRA 3CC4T 3RESA 1N27A 3HPWA 3WVEB 2OTLT 1Y71A 3OSSC 1P92A 3OS5A 5FLXE 3P8HA 1Y96B 3PMTA 4RG2A 2QDYB 3QZ5B 3OYDA 2EQMA 3QO3A 4HKEA 4BACA 2WSFE 3NTIA 3SWNA 2MAMA 2QEXT 3RMSA 2DD4A 2KVQG 3L2RA 1IZ6A 2E6ZA 2LT4A 3DB3A 3PMIA 2XDDA 5LJ3h 3CD6A 2O4XB 4XAXB 1VQ5T 1GXIE 1B34A 3QYGB 2LC4A 2XDBA 2E64A 3ASKA 3QUIA 4A4KA 4A4EA 1Y7XA 2AHJB 4M77G 4RCCA 5GANf 3OW2A 1BI2A 1OZ3A 3P8BB 4Y91A 2F5TX 1VQKA 3A8HB 4J8OA 5CVIA 4PL6A 4JJNK 4EPCA 5GAN5 2QQAA 3LYIA 4E7LA 1VQ9A 2E65A 2K5IA 2R5MA 1X6OA 2FVUA 4JDSA 3DB4A 3NTHA 3RKWA 3E1SA 4BY6B 2C06A 1XTDA 2BUDA 2RHYA 4ZGDB 4KUDK 4C5HA 4M7DD 5LJ5j 2DO3A 3CEYA 4VUBA 5IAYA 2RI5A 2JN0A 4HT9A 3I55A 3WXMB 3JCMe 3LX7A 3JCMQ 4ELZC 4OMFB 4M77A 2CZ6B 2JVVA 4O6JA 5DY9A 5DLOA 3CCLT 4X34A 1VQMT 3M58A 4M75A 4OF1A 3GLXA 1M1KC 5D6WA 3JB9D 5CKHA 3UDCA 5J3BA 4C0DB 2VYTA 2EJ9A 2DAQA 2RB6A 1Q82C 4M7DB 2YHTA 1XOVA 5IN1A 3M55A 4PLIA 3DLLA 3HRUA 3OYNA 3CCJA 1W2BS 4JRQA 2DTIA 4ZGEB 5GMKl 2EYQA 3HFOA 3Q1JA 5KE2A 4ZGJB 2QA4T 2CS7A 1VUBA 2DEQA 4L59A 5FU6C 4BE0A 2RM4A 5DM7R 2FB7A 2DXTA 2CYZB 3TU4K 4C92G 2ZPGB 2JUFA 1VQPT 3BFMA 3CCRA 4PJOA 3VYHB 3A8MB 2D9TA 3OYEA 1VQ6T 2EFIA 4PKCC 3QPHA 1X75C 4M77E 5CKFA 5AYFA 5IT9E 2R58A 4LDVA 3SFMA 5LJ5g 1BIBA 1ZQ1A 5CK9A 3M53A 5GAMe 3SWNC 3RKXA 2I2LA 2WACA 3HKSA 5I2MA 3L2UA 1VQLT 2KDSA 2VXFA 1PSFA 2FYKA 4OP0A 3OYHA 3CMEA 5C0MA 4HT8A 4MZTA 3SB2A 1BI1A 2RJDA 5CAIA 4FT4A 4C92A 3CCQA 2WSCE 2RK1A 3M57A 3L2WA 2RJCA 4XTYA 4OGCA 3OBWA 1BYMA 3ZBDA 1YITT 3MP1A 4PJOE 5KCOA 3MEUA 4M77F 5HK0A 4C8QG 4MZMA 4IUUA 2P4TA 3A8GB 4M75F 2YLBA 1U1SA 3CCSA 4DA4A 2X4WA 4PLLA 1O9SA 3OBYA 3J81E 1H641 1V29B 2JZ2A 1YJWT 3CC2T 4A53A 3JCMc 3VKIA 2EQJA 3CC7T 1YHQT 3EFRA 3WVDB 4J7FA 4BI4A 2QXFA 3I56T 3CPFA 5LJ5f 4C92E 5CQYA 1QVFS 4M78F 3E19A 3JCMP 4BE1A 2E70A 3HP9A 3L2QA 1K8AU 1G3TA 2DXUA 1K73U 3FJPA 4C8QA 1N8RU 4PJOF 3C12A 4B9WA 1HK9A 4FM4B 2RJFA 1MHNA 3BW1A 3VU3C 3QIIA 3CMAA 3JB9H 5CCAA 4EMKA 1UGRB 3N5BB 3FEOA 2RJEA 2X35A 1YCYA 2EKOA 3M4GA 3V8KA 4XTWA 5GMKi 4MDWA 2QI2A 1M1FA 3DKMA 2EIFA 2F5KA 3S3NA 2OTJA 3G71A 2K3XA 3G6ET 3FLGA 2DZ9A 3NTKA 4C92F 5LJ5h 2EJGA 2MI6A 5A0LA 4QVZA 2XKOC 2K3YA 2DKGA 4QQDA 3HL8A 3LH0A 3JCMd 1S72A 3G4ST 3A8OB 4C8QE 2VV5A 4JLGA 1Q81C 4M7AD 4J6XA 2P0QA 4NOYA 4II1A 3M5AA 4RG8A 2LVMA 2JTFA 3QBYA 5M9OA 4BB7A 3JB9I 2R57A 3OYIA 1TH7A 4C92C 4RKUE 4PNOA 3HSBA 1QP3A 3MEVA 2VUBA 5CR2A 1QVPA 4ZN1A 1ZHIA 3RUXA 2RHXA 1NE8A 3X28B 1YIJT 5FRMA 2LTOA 3G7ZA 4M7AB 1QP2A 3JCMb 2RHIA 3OMCA 4ME7A 2QQBA 1Y96A 4DQ2A 2KK4A 1KHIA 4C0GA 3FB9A 4FSXA 2JTMA 3OYJA 2DXCA 2MWOA 5GAN2 4RMOA 4C8QF 4JRIA 3OA6A 4HA8A 3H6ZA 1VQ8T 4MDXA 4QVDA 5GAN7 3PNWC 1K9MU 1K8AC 4FIBA 3MEAA 5FROA 3CXCA 1K73C 1VQ4A 2GFUA 1PSEA 2O4XA 1N8RC 3CPWS 2XICA 2B8AA 2DTHA 2DTOA 3CXCS 3M59A 2QQRA 3GNGA 1Q86U 4C8QC 4EDUA 2LDMA 4M75D 4XU3A 3ZEHA 1KD1U 1XNIA 3M54A 5HY6A 4OVAA 1FWZA 3FC3A 2D0QB 3ER0A 3VUZA 1G5VA 2QTXA 4XTXA 3BY7A 4EMKC 1W2BA 3C95A 4M7DG 4QQ6A 3JCMV 3J80E 1N6AA 4N4GA 2HQXA 2A7YA 2K5LA 4M78D 4XTVA 2FL7A 1DJ7B 3QZ9B 4GLKA 4OB0B 5FU7B 2XU8A 1YI2A 3CD6T 1KC8U 1I4K1 2PUOB 1YJNA 5GMKe 4PJOD 2ZPHB 4A54A 4C5GA 3JB9G 4N4HA 4Z02A 4F7UB 2VGNA 3UT1A 3CCUA 2X4YA 4J5YA 1VQKT 3X26B 4XTZA 2KQWA 3L42A 4B9XA 4M78B 3OYLA 3O8VA 1NPRA 3LGLA 1VQNA 4M7DA 4LDYA 1VQ9T 1VQ7A 4C5EA 2CZ1B 3A8LB 1N9RA 2XDPA 1UGPB 4GY5A 1NZ9A 1NJIU 1AHJB 5LJ3e 2L3RA 3JCMg 4LDXA 3I55T 2PQWA 3OYCA 1BKBA 4IKFA 4A4FA 3HRTA 5C6SA 3JAME 3TCJA 4ELYC 3SDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R U;  4RG2 A;  3CMA A;  1VQL A;  1YJ9 A;  2QEX T;  2KVQ G;  3CCJ T;  1KQS A;  1M90 U;  1IZ6 A;  2E6Z A;  1Q86 C;  3DB3 A;  3CCV A;  3CD6 A;  1VQ5 T;  1KD1 C;  2EIF A;  1KQS S;  1VQ4 T;  1Q7Y U;  2OTJ A;  3G71 A;  1YIT A;  3G6E T;  3PIP A;  5A2Q E;  1QVF A;  3CCR T;  3OW2 A;  3CCM A;  2MI6 A;  3P8B B;  2JOY A;  4QQD A;  1VQK A;  3LH0 A;  1S72 A;  3G4S T;  1Q81 C;  2MWP A;  1VQO A;  1YJW A;  3CC2 A;  1VQ9 A;  1KC8 C;  3CCE A;  1SSF A;  1X6O A;  1K9M C;  3DB4 A;  2LVM A;  1YBY A;  3CC7 A;  1XTD A;  1YHQ A;  3CME T;  3CC4 A;  2DO3 A;  5IAY A;  3I56 A;  4CRI A;  4ZN1 A;  3I55 A;  3CCQ T;  1YI2 T;  2OTL A;  1UEB A;  2JVV A;  1YIJ T;  3CCL T;  1YJN T;  4X34 A;  1VQM T;  1M1K C;  3CCU T;  1KHI A;  5LL6 S;  5J3B A;  2MWO A;  1Q82 C;  2IG0 A;  1NJI C;  2QEX A;  1W2B S;  3DLL A;  1K73 U;  3CCJ A;  3CCS T;  1M1G A;  5DLQ E;  1Q81 U;  1VQ8 T;  1VQN T;  1JJ2 A;  2QA4 T;  1K9M U;  1VQ7 T;  1K8A C;  3CXC A;  1VQ5 A;  3TRE A;  1K73 C;  4ZN3 A;  1VQ4 A;  1N8R C;  5DM7 R;  4TVR A;  3CPW S;  1JJ2 S;  3OYY A;  3G6E A;  2JUF A;  3CXC S;  2LQ8 A;  3CCR A;  1VQP T;  1QVG A;  1Q86 U;  1VQ6 T;  4YTL A;  1M90 C;  1KD1 U;  3KBG A;  1XNI A;  5HY6 A;  5IT9 E;  1QVG S;  3G4S A;  3ER0 A;  5J26 A;  3A5Z B;  3HKS A;  1W2B A;  1VQL T;  3CMA T;  2KDS A;  1YJ9 T;  3J80 E;  3CME A;  3PIO A;  2JNG A;  3CCV T;  3CD6 T;  3CCQ A;  1YI2 A;  3CPW A;  2LCL A;  2G3R A;  1KC8 U;  3LGF A;  1YIJ A;  3CCL A;  1YJN A;  2OTJ T;  3G71 T;  1VQM A;  2XHC A;  1NPP A;  1YIT T;  3J7A F;  3CCM T;  3CCU A;  1VQK T;  3CCS A;  1S72 T;  1VQ8 A;  1NPR A;  3LGL A;  1VQN A;  2QA4 A;  3J81 E;  1VQO T;  1YJW T;  3CC2 T;  1VQ9 T;  1VQ7 A;  1M1K U;  3CCE T;  1RL2 A;  2CKK A;  3CC7 T;  1EIF A;  1YHQ T;  1NZ9 A;  1Q7Y C;  1Q82 U;  1NJI U;  3CC4 T;  1VQP A;  2L3R A;  3I56 T;  3I55 T;  3CPF A;  1BKB A;  1QVF S;  1VQ6 A;  3OW2 S;  2OTL T;  3JAM E;  2E70 A;  1K8A U;  5FLX E; 
#chains in the Genus database with same CATH topology
 1NM7 A;  1LPL A;  3JCM J;  2XG8 D;  4L6V 5;  2X4X A;  4Z88 A;  5CKE A;  3CCJ T;  1Q86 C;  2XMF A;  1KK7 A;  4P5N A;  4LD9 K;  1K8A R;  5GAO l;  5GAO q;  4DEY A;  2L3S A;  2CZ7 B;  2OAU A;  4JPB W;  5A0G A;  2DJZ A;  4ESR A;  2ZPB B;  4PFO A;  3LLR A;  5GAN e;  2RI2 A;  1SRM A;  1M5Q 1;  1SSF A;  1Y0M A;  1A0N B;  2RF0 A;  3CME T;  4E7J A;  4KGV B;  3NGP A;  1YN8 A;  4IUR A;  1PKT A;  1PRL C;  2CGH A;  3CCQ Q;  2JTE A;  1BI0 A;  2CSQ A;  1RI0 A;  2QQ9 A;  2LJ0 A;  4C0D C;  4EMG A;  4DOW A;  2QEX A;  1KFZ A;  2C0T A;  4XQ3 A;  1NG2 A;  1VQ5 A;  1U1T A;  2E3I A;  5FU6 B;  1QVG A;  1UB4 A;  1WJR A;  1R0B G;  4M7A G;  1OPL A;  1G8X A;  4OGE A;  2M9U A;  3A5Z B;  3QDR B;  3SWN B;  3V7R A;  4DEX A;  4KRT A;  3CMA Q;  4DOV A;  4ZTF A;  1OQK A;  1QLY A;  3PIO A;  1B34 B;  3H8Z A;  1B7T A;  3CPW A;  4PFZ A;  2OTJ T;  3G71 T;  1WJQ A;  2EWN A;  2L8D A;  4FW2 A;  1KD1 R;  4M7A A;  5A0D A;  5GAM h;  3VV0 A;  5GAN 6;  4M77 D;  5LJ3 d;  1FXX A;  4J7I A;  2CKK A;  2QDL A;  3S3O A;  1AT1 B;  2LNV A;  2DVE A;  3VJP A;  2RQV A;  2GBQ A;  2KEA A;  3X20 B;  2FPF A;  5IHK A;  2P0K A;  3BDL A;  4BE2 A;  2RD1 A;  2NUZ A;  3OMG A;  2V8I A;  1UGQ B;  2BKD N;  1VQ4 T;  5GAN h;  3EGD B;  2YUO A;  1RLQ C;  2YXY A;  1WJS A;  3OYA A;  3OS1 A;  2QQS A;  2JS2 A;  4KGX B;  4FYW B;  1M2O A;  1OUL A;  2W10 A;  2E12 A;  5LJ3 j;  1UUE A;  3REA B;  1ZBX A;  2RI3 A;  3JCM X;  2DIQ A;  3CC7 A;  2DRK A;  5GAO m;  2LQK A;  1WGS A;  3I56 A;  1KHC A;  1YJN T;  4E6R A;  2X3X D;  1X43 A;  2DEU A;  4F7U E;  4C0F A;  4C8Q D;  4E7I A;  2EAY A;  2B86 A;  3TRE A;  4CI0 C;  1VQ7 Q;  3JCM W;  3OYY A;  4NS5 A;  2K79 A;  2LQ8 A;  3GPL A;  2Y4X A;  5KH6 A;  3KBG A;  2DBK A;  3GP8 A;  1JB0 E;  3G4S A;  2A3L A;  4J6Y A;  4F7U F;  2K4Y A;  4GLM A;  1VYU A;  4OMO A;  2DIG A;  2SRC A;  4J6W A;  4DBH A;  1YJ9 Q;  3JSC A;  1X6G A;  2LCL A;  1VYT A;  4AFU C;  3CCV Q;  1AWO A;  3MEW A;  1SPK A;  3CCM T;  2F69 A;  1KJW A;  1I5L A;  4M78 C;  4FCY A;  5GAN g;  3D7S B;  4R0K A;  2JT4 A;  3EAE A;  1WHK A;  3CCE T;  3MKD A;  1MV3 A;  4KUI A;  1EIF A;  2HDA A;  1W2B P;  1IO6 A;  3HPW A;  2OTL Q;  1Y96 B;  4RG2 A;  2ROL A;  3OYD A;  3QO3 A;  2EBP A;  2WSF E;  1BK2 A;  1AD5 A;  3SWN A;  2D1X A;  1IZ6 A;  2E6Z A;  3DB3 A;  2XDD A;  5LJ3 h;  1RAH B;  2LNH B;  1B34 A;  1YFN A;  3ASK A;  1KSW A;  4A4K A;  4A4E A;  5GAN f;  3P8B B;  5GAN 5;  1ZUU A;  2QQA A;  1M90 R;  1MMN A;  2R5M A;  4JDS A;  3DB4 A;  1XTD A;  3A1P A;  2L0A A;  4VUB A;  2RI5 A;  4HT9 A;  3JCM e;  3LX7 A;  4ELZ C;  1JO8 A;  2A28 A;  3CCL Q;  1BCO A;  1VQM Q;  5J3B A;  2PTK A;  2DAQ A;  2RB6 A;  4M7D B;  5IN1 A;  3M55 A;  4PLI A;  2GGR A;  4JRQ A;  2DL4 A;  2LJ3 A;  2CS7 A;  4LXC A;  4L59 A;  2KNB B;  2RM4 A;  2CT4 A;  2K7A A;  1VQP T;  3EGD A;  3OYE A;  1Q7Y R;  2EFI A;  1X75 C;  5AYF A;  2FG0 A;  2R58 A;  3SFM A;  1QCO A;  5CK9 A;  2NUT B;  1WHH A;  1GCP A;  3HKS A;  4F17 A;  2KDS A;  1PSF A;  2EGC A;  4OP0 A;  1WHM A;  2DVJ A;  3CCQ A;  1MV0 B;  2DL8 A;  2RJC A;  3U23 A;  3L2W A;  1Z9Q A;  1YIT T;  2RQT A;  2CP2 A;  1C6V X;  2C0I A;  1ABO A;  1NLO C;  1TWB A;  3A8G B;  4DA4 A;  1TTH B;  2X4W A;  2HBW A;  1H64 1;  1YJW Q;  3CC2 Q;  4EIK A;  3VKI A;  2EQJ A;  3ULR B;  1QKW A;  3WVD B;  1YHQ Q;  3CPF A;  4C92 E;  4M78 F;  3L2Q A;  2DXU A;  1UEC A;  3FJP A;  2HEQ A;  1N8R U;  4B9W A;  2RJF A;  3BW1 A;  3EHR A;  2ESW A;  3CMA A;  1LCK A;  5GJW B;  2NWM A;  2RJE A;  1Q82 R;  2HKN A;  3I9Q A;  1TU0 B;  3DKM A;  2EIF A;  3NHN A;  4ORZ A;  3G6E T;  4C92 F;  4QT7 A;  2K3Y A;  1WZO A;  2DL3 A;  3A8O B;  1Q81 C;  2AKK A;  1QWF A;  3QBY A;  4BB7 A;  5KYX B;  1TH7 A;  1CSK A;  1JXM A;  4ZN1 A;  1JXO A;  2VVK A;  1FMV A;  5FRM A;  1SG5 A;  3JCM b;  1OV3 A;  3OMC A;  4DQ2 A;  1Y96 A;  3FB9 A;  3OYJ A;  4JJB A;  2DXC A;  2EQI A;  5GAN 2;  1VQ8 T;  5GAN 7;  2QGF B;  2ENM A;  1K73 C;  1CKB A;  2GFU A;  3EH2 A;  3CPW S;  2DTH A;  3CXC S;  3GNG A;  5FWC A;  1G5V A;  3BY7 A;  4EMK C;  1W2B A;  2A37 A;  3C95 A;  4M7D G;  1E6G A;  1T0J A;  1M27 C;  2A7Y A;  4M78 D;  1YCS B;  5FU7 B;  3CD6 T;  4GLK A;  4J9I A;  1RAF B;  1WXT A;  1KC8 U;  1I4K 1;  4PFP A;  5GMK e;  2ZPH B;  2HL5 C;  3UT1 A;  4J5Y A;  4XTZ A;  4M7D A;  2RQU A;  3AT1 B;  1VQK Q;  1PCX A;  1VQ7 A;  4C5E A;  3A8L B;  1UGP B;  4GY5 A;  3TQ7 P;  1NJI U;  4DBR A;  2L3R A;  3JCM g;  4LDX A;  3I55 T;  1QMC A;  4IKF A;  1C0M A;  5C6S A;  3HRT A;  4ELY C;  2NYS A;  4BDY A;  5D6Y A;  3L2Z A;  2J6O A;  1PWT A;  1UTI A;  2V8J A;  3UWN A;  3F70 A;  3RER A;  1RAE B;  2NUT A;  1AWW A;  1YJ9 A;  2XK0 A;  1SRL A;  2IIM A;  1D1A A;  1FX7 A;  3CCV A;  4PJM A;  1KQS S;  2NLU A;  4BD3 A;  1Q7Y U;  2MYS A;  3QJ6 A;  2OI3 A;  2LX9 A;  3CCR T;  2HKQ B;  2RHU A;  2VC8 A;  1H3Z A;  3A98 A;  2F1L A;  3V7C A;  3E9F A;  4BY6 C;  1W4S A;  3JCM f;  4D8D A;  1YBY A;  3VRZ A;  1M3C A;  2DZC A;  1QCF A;  2GFA A;  4J9C A;  2JXB A;  3QG1 A;  4J83 A;  2OTL A;  1G3S A;  1K76 A;  3OS0 A;  2CP6 A;  3FJ5 A;  4LD6 A;  3X24 B;  2D6F A;  1I8F A;  3OW2 P;  4Y28 E;  1UDL A;  3GIB A;  4AFZ C;  3CCS Q;  2O9S A;  1BI3 A;  1GBQ A;  1T3L A;  1JJ2 S;  2J6F A;  3JB9 J;  2KRN A;  3REB B;  4BI8 B;  1G3Y A;  2E5Q A;  4BUG A;  4F04 B;  4HCZ A;  4LDW A;  2DMO A;  4KT0 E;  1ABQ A;  5GMK h;  4OMN A;  2OAW A;  2YRC A;  5KYX A;  4WF2 A;  1I07 A;  1K4U S;  1Q86 R;  3CCL A;  5HCK A;  1VQM A;  5GAM d;  1NPP A;  4AMC A;  2DRM A;  2F2X A;  1M9S A;  2MOX A;  3BDU A;  1S72 T;  1UE9 A;  5GMK m;  3GNF B;  3LWI A;  4F16 A;  1YWP A;  4KUL A;  3SHW A;  4M77 B;  4M75 G;  4RCB A;  2Y90 A;  4J9G A;  3PT9 A;  5LJ5 e;  2P0P A;  1RI9 A;  4M7A E;  5GAN 4;  4XU1 A;  1MMD A;  3R6O A;  1AZG B;  1LNX A;  2PU9 B;  4BI3 A;  2ED0 A;  1KG1 A;  4OB3 B;  4PJO G;  3VYG A;  5GAN d;  1M8V A;  1K0S A;  5A2Q E;  4OB2 B;  4PJL A;  1LOJ A;  5GAM j;  1XQH A;  2JOY A;  5GAO r;  1GFC A;  4M7A F;  1JQQ A;  2ZPE B;  1YJW A;  3CC2 A;  4FT2 A;  4RTV A;  2H3J A;  4AG2 C;  5D6X A;  3QJY A;  1K9M C;  3X25 B;  2XD0 A;  1YHQ A;  2WSE E;  4IUV A;  4CRI A;  2ZCF B;  3VS3 A;  1YI2 T;  4JRP A;  2EVR A;  1ZSZ C;  1N9S A;  3V8J A;  3V7S A;  1B07 A;  4D8K A;  3CCU T;  2XID A;  2QTV A;  3FIF A;  3RKY A;  1M1G A;  1SEM A;  2ZZD A;  4JS5 A;  2GF7 A;  2BIV A;  1VQN Q;  1WLP B;  2D0N A;  1PD0 A;  1PKS A;  2K5F A;  5GAN j;  5I2S A;  1WYX A;  2FHD A;  1WQ7 A;  1D0Z A;  4WCI A;  4C8Q B;  2V26 A;  1GCQ C;  2F2W A;  1I81 A;  1TSF A;  2LQN A;  4EMH A;  2DNU A;  4RTW A;  1WPY A;  3EFO B;  3QHS A;  3M4Y A;  1OX8 A;  3EH1 A;  1ACM B;  2JM9 A;  4IUQ A;  4MZP A;  1HXD A;  2GCX A;  2DBM A;  3RR6 A;  5EC7 A;  5ECA A;  1NLP C;  2JMA A;  4Z8A A;  1F1B B;  4E7H A;  4ATO A;  5KYU B;  2EKH A;  4OML A;  1M1K U;  1KQ1 A;  3VUB A;  1VQO Q;  3VS1 A;  4N4I A;  2A08 A;  1G2B A;  3CC4 Q;  3WVE B;  3M0Q A;  3OSS C;  1P92 A;  2ECZ A;  2DET A;  2O9V A;  2QDY B;  1RAA B;  3NTI A;  3H0F A;  2QEX T;  2DD4 A;  3THK A;  1HD3 A;  2QGG A;  2EYW A;  2LT4 A;  1VQ5 T;  1GXI E;  3EGX B;  3OW2 A;  4AG1 C;  4DBQ A;  4M77 G;  1M30 A;  2CSI A;  1RUW A;  2KRM A;  1VQK A;  4J8O A;  5CVI A;  2K5I A;  1KIK A;  1X6O A;  5IHN A;  3E1S A;  2BUD A;  2RHY A;  1AOJ A;  2LZ6 B;  4C5H A;  2DO3 A;  5IAY A;  3H0H A;  4LUE A;  2V1Q A;  3SEM A;  2YUP A;  4KH0 B;  3WXM B;  4M77 A;  5DY9 A;  2JVV A;  2YDL A;  3M58 A;  4OF1 A;  1AVZ C;  3GLX A;  1BB9 A;  2HQH A;  4HVW A;  1SHF A;  2VYT A;  4C0D B;  1QVF P;  4FW1 A;  1W2B S;  3DLL A;  3EG9 B;  2CUB A;  3HRU A;  2DTI A;  4ZGE B;  3I35 A;  2QA4 Q;  1E6H A;  5DM7 R;  2DXT A;  1OX9 A;  1RAC B;  2JUF A;  2ZPG B;  4QKU A;  2E4H A;  2P4R A;  3A8M B;  2D9T A;  3HTR A;  3QPH A;  1UJ0 A;  5IT9 E;  1VQ6 Q;  5LJ5 g;  1ZQ1 A;  3M53 A;  3RKX A;  1IHW A;  1D1C A;  2GTJ A;  2YRD A;  2FYK A;  3OYH A;  1VQL Q;  4MZT A;  3SB2 A;  1BI1 A;  4CC3 A;  2RNA A;  4FT4 A;  4XTY A;  4OGC A;  1SKU B;  3VS0 A;  4AFQ C;  1OU8 A;  4C8Q G;  3CCS A;  1VOM A;  1O9S A;  3OBY A;  3J81 E;  4J9B A;  1NBE B;  4KGZ B;  5KYN A;  1CKA A;  3JCM c;  3CC7 T;  3H0I A;  3EFR A;  4J7F A;  4BI4 A;  2EW3 A;  1U5S A;  3I56 T;  3G1J A;  5LJ5 f;  5CQY A;  2FZC B;  1SF9 A;  3HP9 A;  4BE1 A;  1K8A U;  2JMC A;  5KYY B;  4C8Q A;  3C12 A;  4FM4 B;  4CC2 A;  1WFW A;  3JB9 H;  3N5B B;  2X35 A;  3M4G A;  3V8K A;  3EFO A;  2H8H A;  2QI2 A;  1M1F A;  3S3N A;  3TSW A;  3NTK A;  2EJG A;  2MI6 A;  5A0L A;  4Z89 A;  2DKG A;  4QQD A;  2DJQ A;  3JCM d;  3G4S T;  5KYU A;  1WHG A;  4NOY A;  4RG8 A;  2LVM A;  2JTF A;  2R57 A;  4C92 C;  3HSB A;  2YUQ A;  5CR2 A;  2VUB A;  1QVP A;  2RHX A;  1NE8 A;  3EG3 A;  4JJD A;  1AWJ A;  1YIJ Q;  1TUD A;  2QQB A;  4C0G A;  3MJX A;  1QQJ A;  4J9H A;  4RMO A;  1H92 A;  4HA8 A;  4MDX A;  4QVD A;  4E2F B;  4FSS A;  5FRO A;  2G6F X;  1N8R C;  1PSE A;  1UFF A;  4RTX A;  1M2V B;  3EGX A;  2LDM A;  4XU3 A;  1KD1 U;  1XNI A;  4OVA A;  1FWZ A;  3VUZ A;  3ER0 A;  1MUZ A;  2J06 A;  1PNJ A;  3J80 E;  3JCM V;  2HQX A;  3ZL7 C;  2IPO B;  4Z02 A;  2VGN A;  1E7O A;  2KE9 A;  2AZS A;  3X26 B;  4M78 B;  4RTU A;  3OYL A;  1NPR A;  1VQN A;  3EG9 A;  1RAB B;  2XDP A;  1Q81 R;  1VQ9 Q;  3C0C A;  1AHJ B;  3KFV A;  4B6M A;  1T0H A;  3TCJ A;  3SDZ A;  4C0Z A;  4LNP A;  3QXE B;  3TSZ A;  4HVU A;  3URG A;  3QYH B;  1M3B A;  4M7D E;  3CCJ Q;  4X1V A;  4FYX B;  4BDZ A;  1Q95 G;  2OJ2 A;  3PIP A;  1K73 R;  1QVF A;  2DLP A;  4AFS C;  1GRI A;  2I0N A;  3RDV A;  3C4S A;  1VQO A;  1MGQ A;  1KC8 C;  3PTA A;  1V76 A;  4Y92 A;  4JS4 A;  1D09 B;  2KXD A;  3OS2 A;  3CC4 A;  2HNI A;  4L5G A;  1ARK A;  2OX7 A;  3CME Q;  1JU5 C;  3CCQ T;  1UGS B;  3CBP A;  2AZV A;  1OI1 A;  2JJ9 A;  5KYY A;  2YRV A;  2J7I A;  2BZY A;  2A36 A;  5FU7 C;  5IXB A;  4JLI A;  1NJI C;  3GF5 A;  2HSP A;  2YWW A;  1G3W A;  4J9D A;  3JCM h;  1U3O A;  5GAO p;  2LT1 A;  3NMZ C;  3MCA B;  2FRW A;  1K9A A;  4QW2 A;  2L89 A;  3DLM A;  3O5Z A;  2CP7 A;  1QVG S;  3S6W A;  4KH1 B;  2VGM A;  4MML A;  1UHF A;  2E6N A;  3CMA T;  1NYG A;  3OQ5 A;  2O01 E;  5CQX A;  5CIU A;  3OYF A;  3LGF A;  3PFS A;  3OYM A;  1HSQ A;  3KXT A;  1ZA2 B;  2MF2 A;  3J7A F;  2QAZ A;  4OMP A;  2OTJ Q;  3G71 Q;  1WNL A;  5HK3 A;  4A4G A;  2QA4 A;  3FRN A;  4ANJ A;  3ME9 A;  4R56 A;  2PVO B;  1BCM A;  1FYN A;  3S3M A;  1PG5 B;  1VQ6 A;  3OW2 S;  3PE0 A;  3H9N A;  1M2V A;  4M75 B;  1X2Q A;  1WQW A;  2EQK A;  2PVG B;  2L5Q A;  1VQL A;  5GMK j;  4M78 G;  1M90 U;  4NL2 A;  2E5K A;  3OB9 A;  2EGA A;  5EG2 A;  5FWB A;  4IIO A;  4E7K A;  4PJO B;  2EQU A;  2KY9 A;  1VQ4 Q;  3MP8 A;  3T9N A;  4FL6 A;  4C92 D;  1X2K A;  3LWH A;  3MHX A;  2M0O A;  5GAN 3;  4M78 A;  1OYX A;  4NL3 A;  1VIE A;  5CKD A;  2LCS A;  2J6K A;  2KSS A;  3MP6 A;  2VWF A;  3M56 A;  4HCC A;  4FU6 A;  4IUP A;  2EYY A;  4M75 E;  4M7A C;  2O2O A;  1PD1 A;  1YJN Q;  3VS4 A;  2D8H A;  2IG0 A;  1QW1 A;  4HCK A;  5IHI A;  1Q81 U;  5DLQ E;  1HJD A;  2E3H A;  5HKC A;  1VQ7 T;  2HAX A;  4ZN3 A;  2DA9 A;  4JZ3 A;  2E41 A;  3L2V A;  4N0A A;  3HFN A;  3C94 A;  1JRI A;  4HCB A;  2NUP B;  3GBQ A;  1LJO A;  4YTL A;  2CZ0 B;  1M4Z A;  3LW5 E;  1MNE A;  5J26 A;  2MIO A;  1MMA A;  2HSE B;  4EMK B;  3JB9 F;  1YJ9 T;  4M77 C;  3PVQ A;  3CBM A;  5KCH A;  2VB6 A;  3I56 Q;  3CCV T;  2PZ1 A;  3MPU B;  1LVK A;  4GBQ A;  1YIJ A;  3CXC P;  3M9Q A;  2XHC A;  2KMT A;  4OMQ A;  1GBR A;  3CCM Q;  4KBM B;  2RO0 A;  1Y57 A;  1ZA1 B;  1RL2 A;  3E2U A;  4JJC A;  3JRZ A;  5LJ5 d;  4V2S A;  5CKB A;  1U8R A;  3CCE Q;  1Q82 U;  3RIR A;  1K9M R;  1N27 A;  2DER A;  5AT1 B;  2OTL T;  1Y71 A;  2KRO A;  3OS5 A;  2L2P A;  2YT6 A;  1GFD A;  2L3Q A;  1QCN A;  1IXD A;  3QZ5 B;  4HKE A;  3EG2 A;  1M3A A;  2X3W D;  2MAM A;  3RMS A;  2KVQ G;  1I5O B;  2COZ A;  3PMI A;  2O4X B;  2LC4 A;  2CH4 A;  3VS2 A;  3BE3 A;  4J9F A;  1Y7X A;  2AHJ B;  2CUD A;  3RNJ A;  1OZ3 A;  4Y91 A;  2F5T X;  7AT1 B;  4JJN K;  2EYZ A;  2K2M A;  3LYI A;  1VQ9 A;  2E65 A;  1EFN A;  2C06 A;  4BY6 B;  1D0Y A;  4ZGD B;  5LJ5 j;  1WHJ A;  2JN0 A;  2YUN A;  2O88 A;  1KQS P;  2BTT A;  1W70 A;  3CCL T;  1VQM T;  1UJY A;  3CQT A;  4M75 A;  1M1K C;  2GQI A;  5D6W A;  1T3S A;  2D8J A;  3JB9 D;  3VRY A;  2COY A;  2EJ9 A;  1XOV A;  2MCN A;  3OYN A;  3CCJ A;  2QK0 A;  2EYQ A;  3HFO A;  5KE2 A;  2SEM A;  5FU6 C;  1TG0 A;  1K0X A;  1SSH A;  3EGU A;  1EZZ B;  3BFM A;  4PJO A;  2JM8 A;  4RTZ A;  1VQP Q;  4CC7 A;  2X9H A;  4M77 E;  1BIB A;  2J05 A;  4RTY A;  5GAM e;  1HYO A;  3SWN C;  2I2L A;  2WAC A;  2P84 A;  2KGT A;  3CME A;  5C0M A;  1I1J A;  2RJD A;  1NEG A;  1IB8 A;  2RK1 A;  3M57 A;  1JJ2 P;  2JW4 A;  4RUG A;  2FRY A;  3OBW A;  4OMM A;  2VKN A;  3MP1 A;  5KCO A;  1YIT Q;  4M77 F;  2FZK B;  4MZM A;  4IUU A;  2P4T A;  2YLB A;  1U1S A;  2FPD A;  4WTO B;  8AT1 B;  2KRS A;  1V29 B;  1YJW T;  3CC2 T;  3RBB B;  4A53 A;  1YHQ T;  2C0O A;  1PM3 A;  1QVF S;  2CH4 W;  2NUP A;  1G3T A;  3H41 A;  1HK9 A;  3VU3 C;  4EMK A;  1UGR B;  3FEO A;  1YCY A;  4XTW A;  5GMK i;  4FYV B;  2OTJ A;  3G71 A;  6AT1 B;  2K3X A;  2DZ9 A;  5LJ5 h;  4QVZ A;  3G6E Q;  3HL8 A;  5IH2 A;  2DIL A;  4C8Q E;  2VV5 A;  4JLG A;  4M7A D;  1JEG A;  2RPN A;  2P0Q A;  4II1 A;  3M5A A;  3OYI A;  4RKU E;  3MEV A;  4AT1 B;  3M0T A;  3RUX A;  4PK4 A;  3G7Z A;  3EG0 A;  1QP2 A;  2LX7 A;  1ZSZ B;  4ME7 A;  2KK4 A;  1KHI A;  2PNI A;  4FSX A;  2MWO A;  4C8Q F;  3I5R A;  3OA6 A;  1OPK A;  3PNW C;  1K9M U;  1K8A C;  4FIB A;  3CXC A;  1VQ8 Q;  1PC0 A;  1VQ4 A;  2O4X A;  4K11 A;  2B8A A;  2DTO A;  3M59 A;  2QQR A;  1Q86 U;  1ZSG A;  5HY6 A;  3M54 A;  4XTX A;  1W6X A;  1G83 A;  1EX4 A;  4LN2 A;  2DFU A;  3M0R A;  4QQ6 A;  1N6A A;  1N5Z A;  4N4G A;  2CDT A;  1TS9 A;  1DJ7 B;  2FL7 A;  4OB0 B;  3QZ9 B;  1IHV A;  2XU8 A;  2L3P A;  1WXU A;  3VS7 A;  2AT1 B;  3CD6 Q;  1YJN A;  5I22 A;  4A54 A;  4F14 A;  4C5G A;  1TXQ A;  1FMW A;  3LH5 A;  4F7U B;  2CRE A;  4E7S A;  1VQK T;  1OEB A;  2W0Z A;  4LDY A;  5IXF A;  2CZ1 B;  1ZLM A;  1N9R A;  1AZE A;  1NZ9 A;  1WX6 A;  5LJ3 e;  4J9E A;  1TOV A;  2PQW A;  1BKB A;  3EG1 A;  3JAM E;  3I55 Q;  2BZ8 A;  3TEE A;  3VS5 A;  2BE9 B;  2EYX A;  2YLC A;  3TVT A;  4XU2 A;  1RLP C;  2HL3 A;  2E10 A;  1KQ2 A;  4O5V A;  1KQS A;  2IVW A;  3ZFJ A;  3JV3 A;  4RTT A;  2K57 A;  4Q5W A;  1SHG A;  4X9D A;  1MND A;  2KT1 A;  1KD1 C;  2M0Y A;  3M0P A;  1WIE A;  1UG1 A;  1S1N A;  2KYB A;  5L8R E;  1N8R R;  3CCM A;  4A4H A;  3L1A A;  3CCR Q;  1U06 A;  2KBT A;  4IUT A;  5GAM g;  2K2V A;  4HXJ A;  2ZGW A;  2MWP A;  1X6B A;  3CCE A;  1D3B B;  5D7U A;  2DD5 A;  4JUV A;  3V8L A;  3AHU A;  2O31 A;  4XK8 E;  4QVC A;  2XI9 A;  1IGU A;  2V8K A;  2RH2 A;  5LL6 S;  1R8O B;  4M7D C;  1IRX A;  3CCS T;  1JJ2 A;  1IRE B;  5J39 A;  3MO8 A;  4E47 A;  5I21 A;  5GAN 8;  4C5I A;  4TVR A;  3RMQ A;  1ZBJ A;  2R5A A;  2M51 A;  3NPF A;  1QKX A;  5GAM f;  2HMA A;  1X01 A;  2RA2 A;  2M1H A;  5KYW B;  2F2V A;  2FEI A;  2DF6 A;  2LRQ A;  2QYZ A;  2EJF A;  2JNG A;  4E7Z A;  4ZNX A;  2G3R A;  4HVV A;  2DX1 A;  2CP3 A;  1BIA A;  2K6D A;  1ZSZ A;  5L23 A;  2KAF A;  4CC4 B;  2GQV A;  2DYB A;  4N0A C;  1S72 Q;  3NFC A;  2K9G A;  2EGE A;  4LDU A;  1I0C A;  1KC8 R;  2LP5 A;  1VQP A;  4XTU A;  2FZG B;  1VIF A;  2KXC A;  2QAS A;  2PVD B;  1OZ2 A;  2CT3 A;  3HRS A;  2X4J A;  1GCQ A;  3EHQ A;  4F7U G;  1W1F A;  2VXE A;  3MET A;  3SD4 A;  2HD0 A;  1NJI R;  2DK3 A;  2DPP B;  4X9C A;  2HBP A;  2M16 A;  1YIT A;  3HHT B;  2FPE A;  4QQG A;  2PUK B;  3KUF A;  4F7U A;  4UC4 A;  1WDX A;  4ZTJ A;  2DM1 A;  3PGG A;  1M8M A;  3CBO A;  2HQE A;  4XU0 A;  2RMO A;  2LCC A;  2BZX A;  2DE0 X;  3QSU A;  4C92 B;  1J3T A;  2EPD A;  2KT8 A;  3OSV A;  3P8D A;  4R55 A;  2RK2 A;  2M02 A;  1UEB A;  3OYK A;  1Y07 A;  1YI2 Q;  3EFS A;  1RAI B;  2CP5 A;  2AKL A;  3GOX A;  3CCU Q;  1D1B A;  3FDR A;  4OB1 B;  2LQW A;  1VQN T;  4M78 E;  3QWX X;  1AWX A;  3UA6 A;  1WA7 A;  2E1H A;  9ATC B;  1O75 A;  5LJ3 g;  4IIM A;  1RAD B;  2Z0W A;  3G6E A;  4M7D F;  3OYB A;  2DXB A;  4M4Z A;  4DBF A;  3OYG A;  5CO7 A;  1M90 C;  3OY9 A;  5GAO n;  1UGV A;  2RHZ A;  4JRK A;  1UHC A;  3R6N A;  3E9G A;  2ZPI B;  1D3B A;  4M75 C;  2ZPF B;  1VYV A;  4MMK A;  2LJ1 A;  1TUC A;  5FRN A;  3INZ A;  2ABL A;  1VQ8 A;  1JBM A;  3QKJ A;  1V1C A;  1Z9Z A;  1VQO T;  4PJO C;  5LJ3 f;  2Y4Y A;  4D6W A;  2MMP A;  3UPU A;  5KE3 A;  1Q7Y C;  3CC4 T;  3RES A;  1WXB A;  4A63 B;  2CP0 A;  1D0X A;  5FLX E;  8ATC B;  3P8H A;  3PMT A;  5KYW A;  2EQM A;  4BAC A;  3UAT A;  5GJV B;  3L2R A;  2QEX Q;  1QWE A;  2RN8 A;  5I11 A;  3CD6 A;  4XAX B;  1IGQ A;  3QYG B;  3VS6 A;  1WHL A;  1VQ5 Q;  2XDB A;  2E64 A;  4PJN A;  2ATC B;  3QUI A;  1BU1 A;  2AIR B;  4RCC A;  2VAS A;  1BI2 A;  3A8H B;  3I5S A;  2RQR A;  4PL6 A;  4EPC A;  4E7L A;  2FVU A;  3NTH A;  3RKW A;  4KUD K;  4M7D D;  3CEY A;  3I55 A;  3JCM Q;  4OMF B;  4O6J A;  2CZ6 B;  5DLO A;  2X51 A;  4X34 A;  3IQL A;  1C1A A;  5CKH A;  3UDC A;  1Q82 C;  2YHT A;  2K3B A;  3QWY A;  5GMK l;  3Q1J A;  1PHT A;  2QA4 T;  4ZGJ B;  1VUB A;  2DEQ A;  1H8K A;  1AEY A;  4BE0 A;  2FB7 A;  2CYZ B;  3TU4 K;  3UA7 A;  4C92 G;  4LE9 A;  3CCR A;  1NYF A;  3VYH B;  1VQ6 T;  4PKC C;  5CKF A;  4LDV A;  5I2M A;  3L2U A;  1VQL T;  2AK5 A;  2VXF A;  4HT8 A;  5CAI A;  1B3Q A;  4C92 A;  2WSC E;  1NEB A;  1YNZ A;  1VA7 A;  1BYM A;  3ZBD A;  2ED1 A;  4PJO E;  5HK0 A;  3MEU A;  1QVG P;  2DYI A;  4M75 F;  1OOT A;  1K1Z A;  4PLL A;  1ZX6 A;  1BBZ A;  2GTO A;  2JZ2 A;  1R77 A;  3CC7 Q;  2V1R A;  2QXF A;  1MMG A;  3E19 A;  3JCM P;  2E70 A;  2HZY A;  2MPX C;  3UF4 A;  1K73 U;  3CPW P;  4PJO F;  1MHN A;  3QII A;  5CCA A;  1M1K R;  2QG9 B;  3M0U A;  4FYY B;  2YSQ A;  1X27 A;  2EKO A;  1X69 A;  4MDW A;  2GNC A;  2F5K A;  1R0C B;  3FLG A;  3QDF A;  2XKO C;  3LH0 A;  1S72 A;  2JS0 A;  1ZUY A;  4J6X A;  3G4S Q;  2FO0 A;  1FMK A;  1ZUK A;  3JB9 I;  5M9O A;  2ZAE A;  4PNO A;  2MK5 A;  1QP3 A;  1ZHI A;  3X28 B;  1YIJ T;  2LTO A;  3M0S A;  2HCK A;  4M7A B;  1WI7 A;  2RHI A;  2LMJ A;  2JTM A;  4JRI A;  3H6Z A;  1YP5 A;  4LUD A;  2ROT A;  2COW A;  3MEA A;  1GL5 A;  2KYM A;  2XIC A;  4C8Q C;  4EDU A;  4M75 D;  3ZEH A;  3FC3 A;  2D0Q B;  2QTX A;  1RAG B;  1PRM C;  1H3H A;  2K5L A;  4XTV A;  1YI2 A;  4PJO D;  2PUO B;  5FW9 A;  1XJW B;  2DL7 A;  1OU9 A;  3JB9 G;  4N4H A;  3CCU A;  2X4Y A;  1TUG B;  4B9X A;  2KQW A;  3L42 A;  2KR3 A;  3O8V A;  3LGL A;  2RQW A;  1YWO A;  2DL5 A;  2KI7 A;  1VQ9 T;  2BE7 D;  3PVL A;  4PJJ A;  2A0F B;  2H3E B;  3OYC A;  4JZ4 A;  4A4F A; 
#chains in the Genus database with same CATH homology
 4BDY A;  5D6Y A;  4C0Z A;  2YLC A;  3L2Z A;  2V8J A;  3UWN A;  3QXE B;  4XU2 A;  3F70 A;  2XG8 D;  3JCM J;  3RER A;  4L6V 5;  2X4X A;  3URG A;  1YJ9 A;  2E10 A;  2XK0 A;  1KQ2 A;  3QYH B;  4O5V A;  5CKE A;  3CCJ T;  1KQS A;  2IVW A;  3ZFJ A;  1Q86 C;  4M7D E;  2K57 A;  1FX7 A;  4Q5W A;  4X9D A;  3CCV A;  1KD1 C;  4P5N A;  1KQS S;  2NLU A;  4BD3 A;  1Q7Y U;  4LD9 K;  4BDZ A;  3QJ6 A;  2LX9 A;  5GAO l;  5GAO q;  3PIP A;  5L8R E;  3CCR T;  1QVF A;  2OAU A;  2CZ7 B;  3CCM A;  4A4H A;  5A0G A;  2DJZ A;  2RHU A;  3L1A A;  2VC8 A;  2ZPB B;  1H3Z A;  3LLR A;  4IUT A;  3V7C A;  2K2V A;  3E9F A;  5GAM g;  5GAN e;  2ZGW A;  2MWP A;  3C4S A;  1VQO A;  1MGQ A;  2RI2 A;  1KC8 C;  3CCE A;  1M5Q 1;  1SSF A;  3PTA A;  1D3B B;  4BY6 C;  4JS4 A;  1W4S A;  3JCM f;  1YBY A;  2DD5 A;  4JUV A;  3V8L A;  3OS2 A;  3CME T;  2DZC A;  3CC4 A;  3AHU A;  2HNI A;  2GFA A;  4L5G A;  4E7J A;  3QG1 A;  4IUR A;  3CCQ T;  4J83 A;  2OTL A;  4XK8 E;  1G3S A;  3OS0 A;  2CGH A;  4QVC A;  1UGS B;  2XI9 A;  4LD6 A;  3CBP A;  1BI0 A;  1OI1 A;  1RI0 A;  2QQ9 A;  3X24 B;  2V8K A;  2YRV A;  2D6F A;  2RH2 A;  4C0D C;  5LL6 S;  1R8O B;  4EMG A;  1I8F A;  4M7D C;  1NJI C;  5FU7 C;  4JLI A;  4Y28 E;  4DOW A;  3GF5 A;  2QEX A;  3CCS T;  1G3W A;  3GIB A;  1JJ2 A;  4XQ3 A;  1IRE B;  5J39 A;  3MO8 A;  1VQ5 A;  1U1T A;  1BI3 A;  3JCM h;  4E47 A;  5GAO p;  5I21 A;  5FU6 B;  2LT1 A;  4C5I A;  5GAN 8;  4TVR A;  3RMQ A;  1JJ2 S;  3MCA B;  2R5A A;  3JB9 J;  4QW2 A;  4BI8 B;  1QVG A;  1G3Y A;  1UB4 A;  2E5Q A;  2L89 A;  3DLM A;  5GAM f;  1WJR A;  4BUG A;  1X01 A;  2RA2 A;  2M1H A;  4HCZ A;  4LDW A;  1QVG S;  3S6W A;  4M7A G;  2VGM A;  4OGE A;  2M9U A;  3A5Z B;  3QDR B;  4MML A;  4KT0 E;  3SWN B;  3V7R A;  2E6N A;  5GMK h;  3CMA T;  3OQ5 A;  2LRQ A;  2O01 E;  2EJF A;  4DOV A;  4ZTF A;  4WF2 A;  5CQX A;  2JNG A;  3PIO A;  1B34 B;  3H8Z A;  5CIU A;  3CPW A;  2G3R A;  3OYF A;  3LGF A;  3CCL A;  3PFS A;  3OYM A;  3KXT A;  2OTJ T;  3G71 T;  1VQM A;  1WJQ A;  2EWN A;  2L8D A;  2MF2 A;  1NPP A;  5GAM d;  3J7A F;  4M7A A;  5A0D A;  5GAM h;  3VV0 A;  1WNL A;  5GAN 6;  5HK3 A;  1BIA A;  1M9S A;  4M77 D;  5LJ3 d;  2KAF A;  1FXX A;  3BDU A;  1S72 T;  2GQV A;  4A4G A;  4N0A C;  2QA4 A;  3FRN A;  4J7I A;  3NFC A;  5GMK m;  3ME9 A;  3GNF B;  4LDU A;  4R56 A;  3LWI A;  2PVO B;  2CKK A;  1VQP A;  4KUL A;  3S3O A;  2LNV A;  4M77 B;  4M75 G;  2DVE A;  3S3M A;  4XTU A;  3VJP A;  1VQ6 A;  3OW2 S;  1VIF A;  2PVD B;  2Y90 A;  4M75 B;  4RCB A;  3PT9 A;  1OZ2 A;  3X20 B;  3HRS A;  1WQW A;  2EQK A;  5LJ5 e;  2PVG B;  2L5Q A;  2P0P A;  2X4J A;  4M7A E;  4F7U G;  5GAN 4;  1VQL A;  2P0K A;  2VXE A;  4XU1 A;  3BDL A;  5GMK j;  4BE2 A;  2RD1 A;  3MET A;  4M78 G;  3SD4 A;  4NL2 A;  3R6O A;  1M90 U;  1LNX A;  2HD0 A;  3OMG A;  2V8I A;  2PU9 B;  3OB9 A;  4BI3 A;  1KG1 A;  4OB3 B;  1UGQ B;  2DK3 A;  2DPP B;  4X9C A;  5EG2 A;  4PJO G;  2BKD N;  3VYG A;  5GAN d;  1VQ4 T;  1M8V A;  5GAN h;  4E7K A;  4PJO B;  2HBP A;  2EQU A;  2M16 A;  2KY9 A;  1YIT A;  3MP8 A;  3T9N A;  3HHT B;  5A2Q E;  4QQG A;  1WJS A;  4FL6 A;  3OS1 A;  3OYA A;  2QQS A;  4OB2 B;  4C92 D;  1LOJ A;  2PUK B;  3KUF A;  5GAM j;  3LWH A;  1XQH A;  2JOY A;  4F7U A;  4UC4 A;  5GAO r;  2E12 A;  3MHX A;  4ZTJ A;  4M7A F;  5LJ3 j;  3PGG A;  2ZPE B;  2M0O A;  5GAN 3;  3CBO A;  2HQE A;  4FT2 A;  4M78 A;  1OYX A;  4XU0 A;  1YJW A;  4NL3 A;  3CC2 A;  2H3J A;  1K9M C;  5D6X A;  3QJY A;  1ZBX A;  2RI3 A;  3X25 B;  2DIQ A;  3JCM X;  3CC7 A;  1YHQ A;  2WSE E;  4IUV A;  2LCC A;  2XD0 A;  1VIE A;  5CKD A;  5GAO m;  4C92 B;  2LQK A;  1WGS A;  2KSS A;  3MP6 A;  3QSU A;  3M56 A;  4HCC A;  3I56 A;  3OSV A;  4CRI A;  2ZCF B;  4FU6 A;  3P8D A;  4IUP A;  3TEE A;  4R55 A;  2RK2 A;  4JRP A;  1YI2 T;  1KHC A;  1UEB A;  4M75 E;  4M7A C;  3OYK A;  1Y07 A;  1YJN T;  3EFS A;  1N9S A;  3V8J A;  3V7S A;  5GAN j;  3GOX A;  3CCU T;  2XID A;  3FIF A;  2IG0 A;  4F7U E;  1QW1 A;  3RKY A;  4C0F A;  4C8Q D;  3FDR A;  1M1G A;  4OB1 B;  5DLQ E;  1Q81 U;  1VQN T;  2ZZD A;  4JS5 A;  4E7I A;  2EAY A;  2GF7 A;  2BIV A;  4M78 E;  5HKC A;  1VQ7 T;  3TRE A;  4CI0 C;  2HAX A;  4ZN3 A;  2E1H A;  1O75 A;  3JCM W;  3OYY A;  2E41 A;  2K5F A;  4NS5 A;  5LJ3 g;  3L2V A;  4N0A A;  3HFN A;  2LQ8 A;  3C94 A;  1JRI A;  3G6E A;  4HCB A;  4M7D F;  5I2S A;  2Y4X A;  2FHD A;  1WQ7 A;  3OYB A;  1LJO A;  2DXB A;  3GPL A;  4YTL A;  3OYG A;  5CO7 A;  4C8Q B;  5KH6 A;  2CZ0 B;  3OY9 A;  1M90 C;  3KBG A;  3GP8 A;  1I81 A;  1M4Z A;  1JB0 E;  3G4S A;  3LW5 E;  4EMH A;  5GAO n;  2A3L A;  5J26 A;  4J6Y A;  2RHZ A;  4JRK A;  1WPY A;  2K4Y A;  4EMK B;  4F7U F;  3JB9 F;  1YJ9 T;  2DIG A;  4M77 C;  3E9G A;  2ZPI B;  1D3B A;  4J6W A;  3CBM A;  3QHS A;  5KCH A;  3M4Y A;  4M75 C;  2ZPF B;  3JSC A;  3CCV T;  4MMK A;  4IUQ A;  4MZP A;  2LCL A;  1HXD A;  1YIJ A;  5FRN A;  2GCX A;  3M9Q A;  2XHC A;  3INZ A;  3MEW A;  2KMT A;  2F69 A;  3CCM T;  1I5L A;  4E7H A;  4ATO A;  4M78 C;  4KBM B;  2RO0 A;  5GAN g;  1VQ8 A;  3EAE A;  1JBM A;  3QKJ A;  1VQO T;  4PJO C;  5LJ3 f;  2Y4Y A;  4D6W A;  1M1K U;  3CCE T;  1KQ1 A;  1RL2 A;  2MMP A;  5LJ5 d;  3JRZ A;  3VUB A;  5KE3 A;  3UPU A;  4KUI A;  4V2S A;  1EIF A;  5CKB A;  4N4I A;  1U8R A;  1Q82 U;  1Q7Y C;  3RIR A;  3CC4 T;  3RES A;  1N27 A;  3HPW A;  3WVE B;  2OTL T;  1Y71 A;  3OSS C;  1P92 A;  3OS5 A;  5FLX E;  3P8H A;  1Y96 B;  3PMT A;  4RG2 A;  2QDY B;  3QZ5 B;  3OYD A;  2EQM A;  3QO3 A;  4HKE A;  4BAC A;  2WSF E;  3NTI A;  3SWN A;  2MAM A;  2QEX T;  3RMS A;  2DD4 A;  2KVQ G;  3L2R A;  1IZ6 A;  2E6Z A;  2LT4 A;  3DB3 A;  3PMI A;  2XDD A;  5LJ3 h;  3CD6 A;  2O4X B;  4XAX B;  1VQ5 T;  1GXI E;  1B34 A;  3QYG B;  2LC4 A;  2XDB A;  2E64 A;  3ASK A;  3QUI A;  4A4K A;  4A4E A;  1Y7X A;  2AHJ B;  4M77 G;  4RCC A;  5GAN f;  3OW2 A;  1BI2 A;  1OZ3 A;  3P8B B;  4Y91 A;  2F5T X;  1VQK A;  3A8H B;  4J8O A;  5CVI A;  4PL6 A;  4JJN K;  4EPC A;  5GAN 5;  2QQA A;  3LYI A;  4E7L A;  1VQ9 A;  2E65 A;  2K5I A;  2R5M A;  1X6O A;  2FVU A;  4JDS A;  3DB4 A;  3NTH A;  3RKW A;  3E1S A;  4BY6 B;  2C06 A;  1XTD A;  2BUD A;  2RHY A;  4ZGD B;  4KUD K;  4C5H A;  4M7D D;  5LJ5 j;  2DO3 A;  3CEY A;  4VUB A;  5IAY A;  2RI5 A;  2JN0 A;  4HT9 A;  3I55 A;  3WXM B;  3JCM e;  3LX7 A;  3JCM Q;  4ELZ C;  4OMF B;  4M77 A;  2CZ6 B;  2JVV A;  4O6J A;  5DY9 A;  5DLO A;  3CCL T;  4X34 A;  1VQM T;  3M58 A;  4M75 A;  4OF1 A;  3GLX A;  1M1K C;  5D6W A;  3JB9 D;  5CKH A;  3UDC A;  5J3B A;  4C0D B;  2VYT A;  2EJ9 A;  2DAQ A;  2RB6 A;  1Q82 C;  4M7D B;  2YHT A;  1XOV A;  5IN1 A;  3M55 A;  4PLI A;  3DLL A;  3HRU A;  3OYN A;  3CCJ A;  1W2B S;  4JRQ A;  2DTI A;  4ZGE B;  5GMK l;  2EYQ A;  3HFO A;  3Q1J A;  5KE2 A;  4ZGJ B;  2QA4 T;  2CS7 A;  1VUB A;  2DEQ A;  4L59 A;  5FU6 C;  4BE0 A;  2RM4 A;  5DM7 R;  2FB7 A;  2DXT A;  2CYZ B;  3TU4 K;  4C92 G;  2ZPG B;  2JUF A;  1VQP T;  3BFM A;  3CCR A;  4PJO A;  3VYH B;  3A8M B;  2D9T A;  3OYE A;  1VQ6 T;  2EFI A;  4PKC C;  3QPH A;  1X75 C;  4M77 E;  5CKF A;  5AYF A;  5IT9 E;  2R58 A;  4LDV A;  3SFM A;  5LJ5 g;  1BIB A;  1ZQ1 A;  5CK9 A;  3M53 A;  5GAM e;  3SWN C;  3RKX A;  2I2L A;  2WAC A;  3HKS A;  5I2M A;  3L2U A;  1VQL T;  2KDS A;  2VXF A;  1PSF A;  2FYK A;  4OP0 A;  3OYH A;  3CME A;  5C0M A;  4HT8 A;  4MZT A;  3SB2 A;  1BI1 A;  2RJD A;  5CAI A;  4FT4 A;  4C92 A;  3CCQ A;  2WSC E;  2RK1 A;  3M57 A;  3L2W A;  2RJC A;  4XTY A;  4OGC A;  3OBW A;  1BYM A;  3ZBD A;  1YIT T;  3MP1 A;  4PJO E;  5KCO A;  3MEU A;  4M77 F;  5HK0 A;  4C8Q G;  4MZM A;  4IUU A;  2P4T A;  3A8G B;  4M75 F;  2YLB A;  1U1S A;  3CCS A;  4DA4 A;  2X4W A;  4PLL A;  1O9S A;  3OBY A;  3J81 E;  1H64 1;  1V29 B;  2JZ2 A;  1YJW T;  3CC2 T;  4A53 A;  3JCM c;  3VKI A;  2EQJ A;  3CC7 T;  1YHQ T;  3EFR A;  3WVD B;  4J7F A;  4BI4 A;  2QXF A;  3I56 T;  3CPF A;  5LJ5 f;  4C92 E;  5CQY A;  1QVF S;  4M78 F;  3E19 A;  3JCM P;  4BE1 A;  2E70 A;  3HP9 A;  3L2Q A;  1K8A U;  1G3T A;  2DXU A;  1K73 U;  3FJP A;  4C8Q A;  1N8R U;  4PJO F;  3C12 A;  4B9W A;  1HK9 A;  4FM4 B;  2RJF A;  1MHN A;  3BW1 A;  3VU3 C;  3QII A;  3CMA A;  3JB9 H;  5CCA A;  4EMK A;  1UGR B;  3N5B B;  3FEO A;  2RJE A;  2X35 A;  1YCY A;  2EKO A;  3M4G A;  3V8K A;  4XTW A;  5GMK i;  4MDW A;  2QI2 A;  1M1F A;  3DKM A;  2EIF A;  2F5K A;  3S3N A;  2OTJ A;  3G71 A;  2K3X A;  3G6E T;  3FLG A;  2DZ9 A;  3NTK A;  4C92 F;  5LJ5 h;  2EJG A;  2MI6 A;  5A0L A;  4QVZ A;  2XKO C;  2K3Y A;  2DKG A;  4QQD A;  3HL8 A;  3LH0 A;  3JCM d;  1S72 A;  3G4S T;  3A8O B;  4C8Q E;  2VV5 A;  4JLG A;  1Q81 C;  4M7A D;  4J6X A;  2P0Q A;  4NOY A;  4II1 A;  3M5A A;  4RG8 A;  2LVM A;  2JTF A;  3QBY A;  5M9O A;  4BB7 A;  3JB9 I;  2R57 A;  3OYI A;  1TH7 A;  4C92 C;  4RKU E;  4PNO A;  3HSB A;  1QP3 A;  3MEV A;  2VUB A;  5CR2 A;  1QVP A;  4ZN1 A;  1ZHI A;  3RUX A;  2RHX A;  1NE8 A;  3X28 B;  1YIJ T;  5FRM A;  2LTO A;  3G7Z A;  4M7A B;  1QP2 A;  3JCM b;  2RHI A;  3OMC A;  4ME7 A;  2QQB A;  1Y96 A;  4DQ2 A;  2KK4 A;  1KHI A;  4C0G A;  3FB9 A;  4FSX A;  2JTM A;  3OYJ A;  2DXC A;  2MWO A;  5GAN 2;  4RMO A;  4C8Q F;  4JRI A;  3OA6 A;  4HA8 A;  3H6Z A;  1VQ8 T;  4MDX A;  4QVD A;  5GAN 7;  3PNW C;  1K9M U;  1K8A C;  4FIB A;  3MEA A;  5FRO A;  3CXC A;  1K73 C;  1VQ4 A;  2GFU A;  1PSE A;  2O4X A;  1N8R C;  3CPW S;  2XIC A;  2B8A A;  2DTH A;  2DTO A;  3CXC S;  3M59 A;  2QQR A;  3GNG A;  1Q86 U;  4C8Q C;  4EDU A;  2LDM A;  4M75 D;  4XU3 A;  3ZEH A;  1KD1 U;  1XNI A;  3M54 A;  5HY6 A;  4OVA A;  1FWZ A;  3FC3 A;  2D0Q B;  3ER0 A;  3VUZ A;  1G5V A;  2QTX A;  4XTX A;  3BY7 A;  4EMK C;  1W2B A;  3C95 A;  4M7D G;  4QQ6 A;  3JCM V;  3J80 E;  1N6A A;  4N4G A;  2HQX A;  2A7Y A;  2K5L A;  4M78 D;  4XTV A;  2FL7 A;  1DJ7 B;  3QZ9 B;  4GLK A;  4OB0 B;  5FU7 B;  2XU8 A;  1YI2 A;  3CD6 T;  1KC8 U;  1I4K 1;  2PUO B;  1YJN A;  5GMK e;  4PJO D;  2ZPH B;  4A54 A;  4C5G A;  3JB9 G;  4N4H A;  4Z02 A;  4F7U B;  2VGN A;  3UT1 A;  3CCU A;  2X4Y A;  4J5Y A;  1VQK T;  3X26 B;  4XTZ A;  2KQW A;  3L42 A;  4B9X A;  4M78 B;  3OYL A;  3O8V A;  1NPR A;  3LGL A;  1VQN A;  4M7D A;  4LDY A;  1VQ9 T;  1VQ7 A;  4C5E A;  2CZ1 B;  3A8L B;  1N9R A;  2XDP A;  1UGP B;  4GY5 A;  1NZ9 A;  1NJI U;  1AHJ B;  5LJ3 e;  2L3R A;  3JCM g;  4LDX A;  3I55 T;  2PQW A;  3OYC A;  1BKB A;  4IKF A;  4A4F A;  3HRT A;  5C6S A;  3JAM E;  3TCJ A;  4ELY C;  3SDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...