5GAN8

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
TLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 9
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan800
2HNIA 4WF2A 1U1TA 4V2SA 4M7DG 4HT8A 3JCMP 2CGHA 4JLIA 2I2LA 3JCMh 4MMLA 1Y96B 2EWNA 4XTUA 3BY7A 3QO3A 4M75G 4A53A 4C8QG 1I5LA 4M7AD 5I21A 5GANd 3V8KA 4C8QE 2E65A 3RKWA 4M78F 4M75E 2ZGWA 2FB7A 1JRIA 2YLCA 4F7UG 5GANe 3V7RA 5GANf 3RERA 3PGGA 4C92F 5GAOr 5GAOl 1N9SA 5GANj 1KQ1A 1X01A 5GMKh 4PJOD 4F7UE 3V8JA 3JCMb 3VU3C 3EFRA 4NOYA 1U1SA 3V8LA 2DXTA 3JB9H 4M7DF 4M77D 1LNXA 3JB9I 1N9RA 4C8QF 4MMKA 1B34A 4XTWA 5GAMh 4M75F 5CAIA 1HXDA 4N0AC 3SWNB 5GMKi 5LJ3g 4QVCA 5GAN3 4PJOA 4QVDA 1D3BB 2YLBA 2VC8A 4C92D 4N0AA 2DJZA 4PNOA 4JRKA 3JCMc 4Y91A 5GMKl 3JCMe 3JCMX 3JCMf 3AHUA 4A54A 4JUVA 4F7UF 1WQ7A 5LJ3h 4J5YA 4M7DD 1YCYA 5LJ5h 1WQWA 2EJGA 2E41A 1I8FA 4HA8A 2DTIA 3SB2A 4M7AC 1BIAA 2DXUA 3FJPA 4M7AA 4C92E 5GAN7 4XU2A 3JB9G 3QHSA 1LJOA 3BFMA 3QSUA 5GAMe 2VXFA 5GAMf 2DZCA 4M78D 1B34B 2DZ9A 4PJOC 3FIFA 3QUIA 3JCMd 2K57A 2E64A 4HT9A 4PJOB 3M4GA 4M77C 3RESA 5GAN6 2RD1A 5GANg 3RKYA 5LJ3f 4M77A 3BDUA 2EJFA 3BW1A 3RUXA 5LJ5e 1M8VA 5LJ5f 3FB9A 4C92C 2DKGA 2FYKA 4XU3A 4PJOG 4C8QD 4J6WA 4C92A 4M75D 5GANh 3JB9F 2E1HA 5GAN4 3HFOA 3V7CA 4XU1A 1JBMA 1TH7A 3RIRA 4M77G 4DQ2A 2EJ9A 4M7DC 4PJOE 2DTOA 4XU0A 5DY9A 5GMKe 3JCMW 3GIBA 4M7AB 4XQ3A 4M7DA 4J6YA 4M77E 5GAMd 3HSBA 3HFNA 3INZA 4JRIA 5GMKj 4C8QA 5GAN8 1LOJA 3JCMg 3JB9J 4EMKC 4F7UB 3JCMV 2DEQA 2E10A 3EFSA 4EMKA 1WPYA 1HK9A 4OP0A 5GAMj 4M7AG 5GAN2 5LJ3d 4PJOF 2YHTA 4F7UA 1Y96A 2QTXA 5LJ5d 3RKXA 4XTVA 4M7DE 4M7AE 4M78C 4XTYA 5LJ3e 2JN0A 4M77B 4M77F 4XTZA 5GAOm 4M78B 2RB6A 4M78A 3L1AA 5GAOp 5LJ3j 5GAOq 4J6XA 1H641 1MGQA 4X9DA 5LJ5j 3L2ZA 5GAN5 4C92B 4EMGA 1I4K1 2EAYA 5GAMg 4NL2A 1BIBA 1I81A 4XTXA 4RCCA 4RCBA 4M78G 3V7SA 5GAOn 4EMHA 4M7DB 4C8QC 4M7AF 4M75C 4X9CA 5GMKm 3SWNC 4C8QB 2VXEA 4M78E 4C92G 2DVEA 2DTHA 2Y90A 4M75B 3JCMQ 4M75A 4NL3A 2RM4A 1KQ2A 3SWNA 3JCMJ 1M5Q1 2RA2A 1WNLA 4EMKB 5LJ5g 1D3BA 3JB9D
chains in the Genus database with same CATH superfamily
4Z8AA 1BI3A 1DJ7B 1IGUA 2I2LA 2MYSA 2A08A 1WI7A 3L2UA 1RAEB 2R58A 1NZ9A 2KGTA 3DB3A 3X24B 3KFVA 3HTRA 4KUIA 2CZ0B 4FW2A 1WFWA 1RUWA 2HBWA 1MUZA 3JB9H 1AVZC 4A4FA 2FHDA 2AT1B 5CAIA 2KR3A 1Q7YC 3L2QA 1VUBA 2R57A 1QVFS 4PNOA 2NUTA 3QWYA 1GL5A 4LUEA 2QASA 3CCUT 4J9GA 2KMTA 2O2OA 1I1JA 5CQYA 2OAUA 1PKSA 3HP9A 3FJPA 1K73R 3P8HA 4KH0B 2KRMA 5GAMf 2RK1A 1ABQA 1X27A 2V8KA 2RI3A 2CP2A 3BE3A 4BY6B 2NUTB 2NUPA 5FRNA 3PNWC 5CIUA 2YT6A 1M8VA 4PJMA 1D0YA 1N5ZA 1B7TA 3CMEA 1YJNT 5GANh 4RG2A 2GFUA 4A4GA 2CYZB 2ZPBB 4M7DC 2DTOA 4XU0A 3UF4A 3GIBA 3MCAB 4DOVA 3INZA 2AZSA 5J26A 1UDLA 2DAQA 3J81E 1QCNA 2EYZA 2G3RA 1RAFB 3OYJA 5CKDA 3A8OB 4JPBW 2NUPB 2JMCA 4M7AE 3CCSA 2RH2A 2VYTA 3H0IA 4AG1C 2O01E 2A28A 2JTFA 1H641 3CEYA 1KHIA 5GAMg 1YHQT 5GJWB 1M2OA 4RCBA 3I55A 4EMHA 4M7AF 2WSCE 2FO0A 4M75C 1VQ8A 1X6OA 1MMDA 3SFMA 2DVEA 1UB4A 5IHKA 1K0SA 4J9HA 3JCMP 2P84A 3QZ9B 4XTUA 1G5VA 4OB2B 1MNEA 3KUFA 1Q82U 2CDTA 4A4EA 3OYKA 1TOVA 1RABB 2O4XA 1YI2T 3GOXA 1X01A 4CC2A 2CT4A 2L0AA 2DILA 3A8HB 4D8DA 3OW2A 2EKHA 3CD6A 2VC8A 2NUZA 5FU7B 1M1KC 4AFQC 3HRUA 4AT1B 1MMAA 2COWA 3HKSA 4M7DD 4WTOB 4HCCA 1I8FA 3LGLA 4C5GA 5KYWA 1YJ9A 4FYVB 2FZCB 2CP5A 2CT3A 5HK0A 1D1BA 2DL7A 2PNIA 5CKEA 4R55A 2OTJQ 5FLXE 2QYZA 3A5ZB 1R77A 1Y71A 4JDSA 4BB7A 5LJ3f 2RJFA 3FB9A 1QVGS 2LNHB 1VQOA 4M75D 2RNAA 1JBMA 5KYWB 3M59A 1IREB 3LH0A 1QVFA 3RR6A 3I9QA 1VQ7A 2LX7A 1LOJA 1W1FA 2KDSA 4EMKC 1QMCA 3NHNA 4JJCA 1RL2A 3EG2A 4M4ZA 2K5LA 4F7UA 1G3WA 2FEIA 1VQNA 5LL6S 4LD9K 4KGVB 4ZTJA 4RMOA 1MGQA 5I11A 4J8OA 2M1HA 4ORZA 5HCKA 2D6FA 3CMAQ 4FW1A 4M75B 3VS4A 2BTTA 3JCMJ 1M9SA 3CC7Q 4ELYC 2EVRA 1Q86R 4OMMA 3QIIA 3UA6A 4F7UB 2QDYB 1BI0A 1KQSA 3CC2T 3M55A 2E3IA 3MEAA 5I21A 2XI9A 1GFDA 3F70A 5A0GA 1C6VX 3MP8A 1SSHA 2EYXA 3JCMb 1NE8A 1WA7A 1OU9A 2PQWA 1IZ6A 1RLPC 3GBQA 4QVDA 3SHWA 2ROTA 4JUVA 3UA7A 3ZL7C 4RTXA 1UGSB 2Y4YA 1VQ6Q 1RI0A 3CXCP 2JZ2A 2ED1A 5FU6C 2JVVA 1BIAA 3OA6A 3CCRT 4C5IA 2V1QA 4LDVA 5IH2A 3JB9G 2KYMA 2CP3A 2VXFA 2EQJA 4PJOC 3NTHA 2K57A 3ZBDA 3LWIA 2COYA 1M1FA 2M16A 3BDUA 2CS7A 2P0QA 2DMOA 1AWXA 1LCKA 2EGEA 1T3LA 5GAMd 2OTLA 2FL7A 3VJPA 3E9FA 1YJWA 4B9WA 5J3BA 2E10A 2GNCA 5GAMj 1AT1B 1WLPB 2DD5A 4AG2C 4B6MA 1W6XA 4II1A 1SHGA 1H8KA 1UUEA 3QDFA 2K3BA 4ZTFA 2HMAA 4RTYA 2XMFA 5IHIA 1I81A 4RG8A 1NPPA 1ZHIA 2ABLA 3G71A 5D6XA 2DTHA 4BI3A 1QVGA 4GY5A 3JCMh 4JJDA 2IPOB 2E6NA 3QJYA 1KSWA 4LDUA 3PMIA 4CC7A 2LJ3A 2ZGWA 5KH6A 2FB7A 2KSSA 3OYMA 3M58A 3CCEA 1U3OA 1N9SA 4PJOD 2J05A 4ZN1A 2DM1A 4KH1B 2D1XA 1NM7A 2MWOA 1AD5A 2C0OA 2IIMA 2F5KA 4X1VA 4XTWA 1GCQC 4FCYA 4QVCA 4PJOA 1MMNA 2DJZA 4OB0B 3J80E 3FJ5A 3CCLA 8ATCB 2RQTA 2CP0A 3SB2A 4J9CA 1KC8U 1X6BA 1QKXA 2DE0X 1VQPQ 4HVVA 2RMOA 2VGMA 1WJRA 1PG5B 3QUIA 1NJIC 4HT9A 4PJOB 1VQ9A 3E19A 2BZXA 5I2SA 4C92C 4QKUA 4XU3A 1H3HA 1XOVA 1F1BB 1MV3A 4F16A 4XQ3A 3PMTA 4FIBA 4IUTA 3M0SA 5DLQE 2B8AA 1YIJQ 4OP0A 5LJ3d 3FC3A 1B3QA 3LLRA 4XTYA 3WVEB 3EGXA 5GAOm 5GAOp 3UPUA 5LJ3j 3M9QA 4J6XA 5GAN5 3L2ZA 4EMGA 2QA4A 1I4K1 2DXBA 2ZZDA 1D0XA 1ZSZC 4C8QC 1UECA 1M90C 1YCSB 1QW1A 4FL6A 1VYVA 1WGSA 3H9NA 4HT8A 2X3XD 2D0QB 3QO3A 3EG0A 2KEAA 3MP1A 1NLOC 3QJ6A 1WHKA 4E47A 2PZ1A 1JJ2S 1G2BA 2RPNA 1D1CA 2DO3A 3OS0A 2M0OA 2KAFA 1T0JA 3CCMA 3V8JA 1M3CA 1U1SA 2LTOA 4KGXB 4E2FB 1VA7A 3EG3A 2XK0A 4MMKA 1RACB 1PWTA 1R0BG 1QQJA 3OYNA 4C92D 2YLBA 3JAME 5GMKl 4OB3B 3L2VA 2MOXA 3CCQQ 3TSWA 2E6ZA 5LJ5h 4GBQA 3THKA 2LQWA 1FMVA 1MMGA 4BI4A 2H8HA 3E9GA 5EG2A 1KC8R 5FWCA 3DLLA 3JV3A 3CCJQ 3WVDB 3G7ZA 1Y07A 1UJ0A 4IUPA 2DZ9A 4JS5A 3EG9A 1OQKA 2XD0A 1KHCA 2QQSA 5GAN6 3RUXA 4KT0E 5L23A 2QI2A 1LVKA 4C8QD 5KCOA 3JB9F 2YUPA 2LCSA 2HSEB 4C5HA 1EIFA 2EJ9A 3UATA 9ATCB 3KXTA 1G3TA 1X2KA 5D6YA 4L6V5 4C8QA 2PUOB 3LH5A 4RTVA 1C1AA 3EG9B 4MZMA 3CC4A 3VS7A 2HSPA 1X6GA 2OAWA 3G6EA 4PFOA 3S6WA 2RO0A 3NTKA 5KE2A 4BDZA 1N8RC 4C8QB 1NJIU 4CC3A 2EKOA 5KYUB 1U1TA 3MO8A 3M4YA 2CGHA 2QXFA 4M75G 3I56A 4BACA 4B9XA 4A4HA 2RN8A 2KRNA 3ME9A 4F7UG 3MP6A 3V7RA 1SPKA 2QTVA 2AIRB 4QW2A 4LXCA 1I5OB 3EFRA 1YBYA 4NOYA 2DXTA 3U23A 3ZFJA 1SRMA 2JT4A 5EC7A 5IXFA 2LP5A 1N9RA 3VYHB 2LJ0A 2MIOA 4N0AA 3JCMc 4Y91A 1NLPC 2AHJB 4RTTA 3VUBA 3OYAA 2DL8A 2RJEA 4J5YA 3RNJA 1TUDA 2DRMA 1WZOA 1JQQA 4M7AC 3LWHA 1WXTA 3CCSQ 1PSFA 1M90U 3RMQA 1PHTA 1VQ5A 2EQKA 5GAMe 1K76A 2XG8D 3I55Q 3EG1A 5D7UA 1VQ8Q 2MCNA 2EJFA 1TUGB 2DKGA 1V29B 4FSXA 3VS3A 1K8AR 4J6WA 2E1HA 2XICA 4E7IA 3UWNA 2V8JA 3HSBA 2DXCA 1P92A 1OX8A 5GAN8 3JB9J 1GBRA 2R5AA 2DNUA 2GCXA 3EAEA 2EQMA 2DFUA 1YWOA 4E7LA 4XTVA 2OTJT 3CD6Q 1VQMA 2F69A 3R6OA 2ATCB 3SDZA 4RCCA 2KVQG 1PRLC 2VUBA 2QAZA 1BYMA 4NL3A 1YJ9Q 2GFAA 2M51A 3T9NA 3NMZC 2FZKB 2F2VA 1YITA 2GQIA 3CXCS 1W70A 2KRSA 3OMCA 1K9MR 1Q81C 4M7AD 3SEMA 2FRWA 1VQ4A 2CREA 1XJWB 5CR2A 4WCIA 1PCXA 2CSQA 1VQOQ 1S72A 2HBPA 3PVLA 3CMAT 3RBBB 1OULA 1WJQA 1IO6A 4PLIA 4Z88A 1VQ7Q 1RI9A 2M0YA 1KD1C 3CC7T 2JS2A 2DIGA 2RJCA 1HYOA 2DTIA 2QQAA 2DA9A 2VGNA 3CPWS 1VQNQ 3OYCA 1OI1A 2KT1A 1K0XA 1GRIA 1EFNA 2E64A 3VYGA 1IB8A 1HSQA 2LCLA 3MJXA 3CCVA 4BUGA 4DBQA 4PJOG 2M02A 5KYYA 1JO8A 3SD4A 2C0TA 1VQ6T 3MKDA 2QEXA 2WSEE 1K1ZA 2HCKA 4M7DA 2HQEA 3OB9A 2YRDA 4IIOA 2OX7A 4RKUE 2DK3A 1VYUA 2AK5A 1WPYA 2HKNA 5GAN2 4MDWA 3H8ZA 1OOTA 4E6RA 4M7DE 1W2BS 2Y4XA 4J83A 4R0KA 2GBQA 3A98A 2K5FA 3M54A 5DLOA 3QXEB 1CKAA 3OW2P 5KYYB 1U06A 1VQLA 2L5QA 4M7DB 2JS0A 2PVDB 1ZUKA 1E6GA 1PM3A 2KT8A 2K9GA 5FRMA 4M75A 1Q7YU 1ZUYA 4C0DC 4HXJA 2L3SA 2A3LA 2XDDA 4WF2A 2LZ6B 4XAXB 2CP6A 2GGRA 4AFSC 1D1AA 2FVUA 3G4SQ 1BB9A 3VS2A 5GANd 2KBTA 3V8KA 1TXQA 4M75E 4O5VA 3S3NA 5GAOr 3TQ7P 5GANj 4F7UE 3VS1A 2RI2A 1NPRA 4JS4A 1T0HA 1OZ2A 1KIKA 4M75F 1HXDA 3BDLA 5LJ3g 2JOYA 2LX9A 2LCCA 5KCHA 1ZBJA 2OTLQ 2HZYA 4HKEA 3JCMf 4RTUA 1YJWQ 3NTIA 1WHJA 1GBQA 2DEUA 4F7UF 1QVFP 1E7OA 1Q82R 3HRSA 1PNJA 4CC4B 3VS0A 1I07A 2ZPGB 2KYBA 3M0UA 3IQLA 3FEOA 1AEYA 1LJOA 3CCUA 1UE9A 2V1RA 3MPUB 2QQBA 4K11A 1Z9ZA 1Q81U 3G71Q 2GTJA 1YNZA 1V1CA 4DEXA 5CK9A 4ZGEB 3GP8A 3RIRA 2JW4A 2A7YA 2KQWA 1PD0A 5GMKe 2HL5C 3C94A 1KQSP 2OTJA 2HL3A 1G8XA 3EGUA 3JCMg 3RDVA 1VQPT 3CCEQ 1UG1A 4JZ3A 1NEGA 1BCOA 4PFZA 1YJNA 3H6ZA 4EMKA 1X2QA 2PUKB 2DL3A 1KD1U 1U5SA 2X9HA 4FU6A 2KXDA 4M78C 2FG0A 4XTZA 3G1JA 2YSQA 2JNGA 5GAOq 2AKKA 4E7JA 2O88A 1YP5A 1Z9QA 2EAYA 3TEEA 4FYXB 3C95A 4N4GA 2K2MA 3CCLQ 4QQDA 2FPFA 1M4ZA 2COZA 5D6WA 1J3TA 4PK4A 1WNLA 2DYBA 4EMKB 1X75C 2HNIA 1YHQA 1M1KU 3OS2A 2BE9B 5ECAA 3MEWA 4C8QG 4A53A 1YIJT 1I5LA 4J7IA 2IG0A 2JMAA 1VQKQ 1VQ9Q 2AKLA 1OPKA 4EDUA 1AWWA 1NYGA 4IKFA 1KQ1A 4DBHA 1ZBXA 4YTLA 1LNXA 1W2BA 1B34A 3H0HA 2DPPB 1YFNA 1WIEA 4ZGDB 5A0DA 1YI2A 4Z02A 1SEMA 2FPDA 3M57A 4C0GA 2VWFA 1UHCA 1X43A 5GJVB 2A37A 1PSEA 3CQTA 4OMLA 4DA4A 2QA4Q 2D0NA 1NEBA 1B34B 4M78D 4BE1A 4M77C 2MPXC 2K79A 3DLMA 3PVQA 1OU8A 3CCQT 5LJ5f 3MEUA 5CKBA 2ZPIB 1KK7A 4IUQA 2RJDA 4VUBA 4XU1A 1QVGP 4PJOE 5FU6B 1K73C 4D8KA 1XNIA 1WJSA 1ZQ1A 2JJ9A 3CCJT 3CCMQ 4PJOF 2DX1A 4M78B 2RB6A 2QGFB 3EHRA 4LDXA 1AHJB 3SWNC 2DERA 1M5Q1 2X51A 5LJ5g 1D3BA 3OY9A 2NYSA 2YUOA 5M9OA 2EYYA 2FZGB 4MMLA 2GF7A 4HVWA 5FWBA 3BY7A 1M1KR 4LE9A 4FT2A 3QDRB 1UTIA 3M0PA 2WSFE 5A0LA 3PTAA 5CQXA 2JTMA 5GMKh 1WX6A 3CC2A 3V8LA 4M77D 4BD3A 4OMOA 5GAN3 1M8MA 4AFZC 1D3BB 1GCQA 2E12A 2KE9A 3JCMX 2ZCFB 1BU1A 4IURA 2O9SA 1G3YA 2YRCA 4E7SA 4HA8A 3JRZA 1YN8A 3HHTB 2RHXA 3QPHA 4LN2A 4Z89A 3CC4Q 3OS5A 4HCKA 1SKUB 1RAGB 3G6EQ 4PLLA 1V76A 4OF1A 5CCAA 3JCMd 4HCBA 5KYXA 2EYWA 3CCRA 2J7IA 2L2PA 2PVOB 5CO7A 2LQ8A 4CRIA 3Q1JA 4N4HA 2G6FX 8AT1B 3VS5A 7AT1B 4C92A 2EQIA 2X4WA 4AFUC 3I56Q 5DY9A 2MF2A 1UGQB 2L3QA 2SEMA 3I5SA 4JRIA 1FWZA 3OS1A 3CCST 4FYWB 2AZVA 1JEGA 2KK4A 2F1LA 4DBFA 1H3ZA 3NFCA 2XDPA 4ANJA 5KYXB 3I55T 2DETA 3A8MB 3CPFA 2JN0A 1VQ8T 1MV0B 4DEYA 6AT1B 4Y92A 4KBMB 4C92B 2X4XA 1ZUUA 5HY6A 1MNDA 2X35A 2HQXA 1ZSZA 1AWOA 3GF5A 5GMKm 2VXEA 2E5QA 3I35A 1YWPA 2RM4A 2JTEA 1NBEB 3M56A 5KYUA 4V2SA 4XK8E 4M7DG 4DBRA 4OGEA 1VQ5Q 1CKBA 1U8RA 2K5IA 1R0CB 2I0NA 2QQRA 4C8QE 3GNFB 2J06A 5KYNA 2OI3A 1FYNA 5GANf 3CD6T 2CKKA 3ULRB 2OJ2A 2PVGB 2K4YA 4ZN3A 1PC0A 1SSFA 4PJLA 3NGPA 1O75A 2DL4A 1ZSZB 1QWEA 3HL8A 4C8QF 4J9BA 2BZYA 1WYXA 1Q86C 1YJ9T 2CH4W 2QQ9A 2A0FB 3FRNA 4QVZA 5AYFA 4J9FA 3CBMA 2GTOA 2PU9B 1JXMA 2QG9B 4AMCA 3X20B 2R5MA 3PE0A 4PJJA 1VQMQ 2H3EB 2J6OA 3M5AA 4Y28E 1RLQC 1QCFA 3CMEQ 1TWBA 2HD0A 2EIFA 2DZCA 2LQNA 3HRTA 1VQOT 5DM7R 5I22A 4E7HA 2LNVA 5GANg 1PRMC 2ENMA 3BW1A 1OZ3A 1VQ7T 2HDAA 1YITQ 2BE7D 4N4IA 2K6DA 3M0QA 3VV0A 4DQ2A 2BKDN 5CKFA 3JCMW 5C0MA 4L5GA 5KE3A 3S3MA 1VQNT 1VQ4Q 4JZ4A 1S72Q 3L42A 1JJ2A 1RAAB 1I0CA 2EPDA 2KNBB 3RKXA 5LJ5d 4ZGJB 1JXOA 1Y57A 2EQUA 1FMWA 3GLXA 5LJ5j 4ATOA 4ME7A 1D0ZA 1XTDA 2F5TX 1BI2A 5L8RE 2O31A 2H3JA 3WXMB 1XQHA 2MWPA 2YRVA 3TSZA 2D8JA 4PKCC 2CH4A 5FU7C 4J9EA 3FLGA 3GPLA 3REBB 3LX7A 2WACA 5I2MA 5IN1A 3E1SA 3M0RA 2P4RA 2K2VA 2E65A 4OMPA 2LQKA 4A63B 3P8DA 3CCVQ 1WHHA 1JJ2P 2YDLA 2ZPEB 2CP7A 2HQHA 1HD3A 2SRCA 1KJWA 1SG5A 1NYFA 2QGGA 1NJIR 2QEXQ 3OYIA 2JXBA 1PD1A 4GLMA 4HVUA 2MI6A 3AHUA 4A54A 3OYEA 5C6SA 1YCYA 3ZEHA 1GCPA 3G4ST 1KQSS 2XHCA 4M7AA 2C0IA 2CUDA 1HJDA 1X69A 4XU2A 3TREA 1WHGA 4ZNXA 1VQLQ 3UT1A 4E7KA 4RTWA 3O5ZA 2DBMA 2LJ1A 3A8LB 3ASKA 3DB4A 1AOJA 3M4GA 2OTLT 5HKCA 2DJQA 3H41A 1YJWT 3PIPA 2GQVA 2DRKA 4E7ZA 1ARKA 4UC4A 4M7AB 3EFOA 1N8RU 1M90R 2E4HA 2DEQA 3OYFA 1Q86U 1RAHB 4J7FA 5LJ3e 1FX7A 4FM4B 3G71T 2DIQA 2VKNA 4Q5WA 4M78G 3MEVA 2CUBA 3EFOB 1QP3A 3DKMA 2VB6A 4X9CA 3QYGB 2LC4A 4IUVA 3HPWA 4O6JA 1BI1A 1G3SA 3TVTA 4EIKA 3CCET 3URGA 3CCUQ 3RKWA 3OBYA 4FSSA 4JJNK 2O4XB 4OGCA 3C4SA 1R8OB 4M7DF 2LMJA 1SF9A 5GAMh 3CCLT 2CZ7B 2B86A 3JCMe 3TCJA 4JRQA 1IRXA 2LT4A 4LDWA 3REAB 4QQGA 4R56A 1YJNQ 4FYYB 1T3SA 2L8DA 1N27A 1B07A 1TG0A 2D8HA 3OYDA 2RQVA 1AWJA 1VQKT 1VQ9T 2KXCA 2YWWA 4BE0A 3QHSA 2F2XA 2DVJA 3MHXA 5AT1B 1IGQA 3FIFA 2MK5A 2RF0A 3AT1B 4ESRA 2L89A 2LDMA 2RD1A 3LW5E 1QCOA 2EGAA 2HAXA 1YHQQ 2VVKA 4RTZA 1UHFA 1TH7A 4M77G 3PIOA 4MZPA 3X28B 2E3HA 1KC8C 4JLGA 2BZ8A 1N8RR 2FPEA 2J6KA 3OYHA 3CXCA 3PFSA 1PKTA 2QA4T 1QLYA 3M0TA 1Y96A 2RI5A 3C12A 2KY9A 1OPLA 1YI2Q 3OSSC 4EPCA 1TU0B 3QBYA 1BIBA 4XTXA 4RUGA 2HKQB 3LGFA 2NWMA 4C92G 3M53A 4OMFB 2EBPA 1JU5C 4JLIA 3VUZA 2QK0A 3UDCA 1Y96B 2EWNA 3CCMT 1UGPB 3CPWA 1AZGB 1IXDA 5A2QE 2YLCA 3QG1A 2LT1A 1Q95G 3RMSA 1WDXA 2DLPA 3QKJA 1ZLMA 4BDYA 1KG1A 1ZA2B 2CZ1B 2D9TA 3G4SA 3JB9I 3VKIA 1SHFA 4D6WA 5GMKi 1QP2A 2ECZA 1Q7YR 2C06A 4C0DB 1JB0E 1WQ7A 5LJ3h 1UEBA 1Y7XA 4C0FA 4KULA 3CMAA 3R6NA 2RQUA 2ROLA 1KFZA 1S1NA 1VOMA 2RHUA 3EGDA 3CC7A 1OEBA 1RAIB 4C0ZA 3CPWP 3VRYA 3L2WA 1D09B 3PT9A 3OSVA 3EH2A 1QVPA 3EH1A 2RHYA 4QT7A 3A8GB 1M3BA 3O8VA 3RESA 4IUUA 2VV5A 1SRLA 4BI8B 1UFFA 2K3YA 3D7SB 5LJ5e 1TS9A 1RADB 1ZX6A 2JUFA 5GAN4 3HFOA 3V7CA 1GFCA 1E6HA 3EGDB 4F04B 2DD4A 2RK2A 2O9VA 2DF6A 3HFNA 3E2UA 2CSIA 3X26B 3CC4T 2P4TA 3CC2Q 1VQ6A 5J39A 2QTXA 3G6ET 3NPFA 1Q81R 3C0CA 1CSKA 2HEQA 1ACMB 1QKWA 4M78A 2MAMA 3L1AA 2JM9A 1K8AC 1W2BP 3S3OA 4A4KA 2DL5A 3I56T 2LRQA 4GLKA 4M78E 2RHZA 4LNPA 1BK2A 2RA2A 1LPLA 2DBKA 2ESWA 2JM8A 3FDRA 1KD1R 4IIMA 2YUNA 3GNGA 4M78F 4DOWA 4HCZA 2YUQA 4X34A 5CVIA 3CCRQ 3PGGA 1WXUA 2EFIA 5GAOl 1UGRB 1WHLA 3VS6A 5IXBA 4BE2A 3LYIA 1IHWA 1MHNA 1A0NB 1AZEA 3VRZA 2K7AA 1VQKA 1NG2A 4JRKA 4JRPA 3TU4K 3EHQA 1K9MC 4P5NA 2FRYA 1VQ5T 2K3XA 2EJGA 4KGZB 1M27C 2DXUA 1H92A 3ER0A 4C5EA 3L2RA 4L59A 3BFMA 1TUCA 1VYTA 4F14A 1M2VA 3OQ5A 3OMGA 2KI7A 1VIFA 2RQRA 4CI0C 4MDXA 4MZTA 3RKYA 4M77A 4F17A 2XIDA 1UJYA 2A36A 2FYKA 1OX9A 1C0MA 2LVMA 2EW3A 2L3RA 4J6YA 4M77E 1ZA1B 1VIEA 5HK3A 3QWXX 1VQMT 2RQWA 1M2VB 1HK9A 3CMET 4M7AG 1WXBA 1GXIE 2EYQA 5CKHA 2YHTA 2CZ6B 3OYGA 3EGXB 4M77B 4M77F 4PL6A 1VQPA 1N6AA 1FXXA 4OMQA 1YITT 4NL2A 3V7SA 3I5RA 4OVAA 1M30A 1IHVA 2QDLA 3N5BB 2X4JA 3SWNA 4LDYA 4PJNA 2XDBA 1VQ4T 1G83A 3P8BB 4C92E 3JB9D 4LUDA 5IAYA 3OYLA 1ABOA 1S72T 1Y0MA 3H0FA 4OB1B 3A1PA 1BCMA 1JRIA 5GANe 4TVRA 3RERA 4C92F 4PFPA 1YIJA 3VU3C 4NS5A 2RHIA 2ZPFB 1UGVA 5IHNA 2EGCA 2BIVA 4JJBA 2X4YA 4N0AC 2P0KA 2BUDA 3SWNB 2Z0WA 2L3PA 1OYXA 1TTHB 2M9UA 2W10A 3QZ5B 1K8AU 1WQWA 4KRTA 2E41A 5FROA 2X3WD 1K73U 3QSUA 3CCVT 3KBGA 4J9DA 3OYYA 3QYHB 1WHMA 4BY6C 4ELZC 2P0PA 3OYBA 3X25B 1ZSGA 1EX4A 2E70A 2QEXT 1K4US 2VASA 2E5KA 3JSCA 2YXYA 1Q82C 4KUDK 1W4SA 2ZAEA 1EZZB 3CBPA 4LD6A 2J6FA 1O9SA 5FW9A 5GMKj 4OMNA 1K9AA 3CCQA 1M1GA 2V8IA 3J7AF 4QQ6A 3JCMV 4FT4A 2NLUA 3EFSA 1QWFA 1VQLT 1K9MU 1BBZA 2PTKA 2V26A 2ZPHB 3OW2S 2ED0A 1BKBA 4X9DA 3CCJA 1TSFA 2XKOC 5IT9E 1FMKA 2KROA 2MMPA 2W0ZA 3META 3OBWA 5GAOn 2IVWA 1M3AA 1OV3A 4J9IA 3CBOA 2XU8A 3JCMQ 2Y90A 2DYIA 2F2WA 1KQ2A 5GAN7
chains in the Genus database with same CATH topology
2HNIA 1BI1A 1G3SA 1YHQA 3CCET 1M1KU 1BI3A 3OS2A 1DJ7B 4HT8A 2I2LA 3URGA 4C8QG 3MEWA 1YIJT 3QO3A 2D0QB 4A53A 4J7IA 1I5LA 3L2UA 3QJ6A 3MP1A 2R58A 2IG0A 3RKWA 1NZ9A 3DB3A 3OBYA 4E47A 3X24B 1JJ2S 4JJNK 2O4XB 4KUIA 4OGCA 4EDUA 3C4SA 2DO3A 3OS0A 2M0OA 2CZ0B 2KAFA 1KQ1A 4IKFA 1R8OB 3V8JA 1ZBXA 3CCMA 4YTLA 1U1SA 2LTOA 3JB9H 4M7DF 2XK0A 4A4FA 2FHDA 1LNXA 1W2BA 5GAMh 4MMKA 1B34A 3CCLT 2CZ7B 2DPPB 5CAIA 1Q7YC 3L2QA 3OYNA 4ZGDB 1VUBA 2R57A 2YLBA 4C92D 5A0DA 3JAME 4PNOA 4OB3B 5GMKl 4Z02A 3JCMe 3L2VA 3TCJA 4JRQA 1YI2A 4LDWA 2LT4A 2E6ZA 4QQGA 4R56A 3M57A 4C0GA 5LJ5h 2L8DA 3CCUT 1N27A 4BI4A 2KMTA 1PSEA 3OYDA 5CQYA 2OAUA 3E9GA 5EG2A 3HP9A 3FJPA 4DA4A 1VQKT 1VQ9T 3DLLA 4BE0A 3WVDB 3G7ZA 3QHSA 1Y07A 3MHXA 3P8HA 5GAMf 2RK1A 4M78D 1B34B 4IUPA 2DZ9A 4BE1A 4JS5A 3FIFA 2V8KA 2RI3A 2XD0A 1KHCA 2QQSA 4BY6B 2L89A 4M77C 5GAN6 2LDMA 2RD1A 5FRNA 4FL6A 3LW5E 3PNWC 5CIUA 1M8VA 3DLMA 3RUXA 4KT0E 3CCQT 2QI2A 3MEUA 5CKBA 5LJ5f 2HAXA 2ZPIB 4C8QD 3CMEA 1YJNT 5GANh 5KCOA 4IUQA 2RJDA 4VUBA 3JB9F 4XU1A 1TH7A 4RG2A 4C5HA 1EIFA 2GFUA 2EJ9A 2CYZB 2ZPBB 4M77G 4MZPA 4A4GA 3PIOA 2DTOA 4XU0A 5FU6B 3X28B 1K73C 1KC8C 4JLGA 3MCAB 3GIBA 3KXTA 4DOVA 1G3TA 3INZA 1XNIA 5D6YA 4L6V5 4C8QA 5J26A 2PUOB 1WJSA 2DAQA 1ZQ1A 3OYHA 3PFSA 3J81E 3CXCA 3CCJT 2G3RA 2QA4T 3OYJA 4MZMA 4PJOF 5CKDA 3A8OB 1Y96A 2RI5A 4M7AE 3C12A 3CCSA 2RH2A 2VYTA 4M78B 2RB6A 3CC4A 2KY9A 2O01E 2JTFA 1H641 3OSSC 3CEYA 4EPCA 3QBYA 1KHIA 5GAMg 1YHQT 1BIBA 4LDXA 4XTXA 3G6EA 4RCBA 1AHJB 3S6WA 3I55A 4EMHA 2RO0A 3LGFA 3NTKA 4M7AF 2WSCE 1VQ8A 4M75C 1X6OA 5KE2A 4BDZA 3SWNC 4C8QB 4C92G 1N8RC 3SFMA 2DVEA 1NJIU 1UB4A 3M53A 1M5Q1 4OMFB 1D3BA 2EKOA 5LJ5g 3OY9A 1U1TA 3MO8A 3M4YA 3JCMP 2CGHA 2QXFA 5M9OA 4JLIA 3VUZA 3UDCA 4MMLA 1Y96B 2EWNA 2GF7A 3BY7A 3QZ9B 4M75G 1UGPB 4OB2B 4XTUA 3KUFA 4FT2A 3QDRB 3I56A 3CCMT 3CPWA 4BACA 1Q82U 4A4EA 3OYKA 2WSFE 4B9XA 4A4HA 5A0LA 5A2QE 3ME9A 3PTAA 2YLCA 3QG1A 2LT1A 3MP6A 5CQXA 3V7RA 4F7UG 2O4XA 3RMSA 1YI2T 3QKJA 2JTMA 3GOXA 1X01A 4QW2A 5GMKh 4BDYA 3CC2A 3EFRA 1YBYA 4NOYA 3V8LA 1KG1A 2DXTA 2CZ1B 2D9TA 4M77D 3ZFJA 4BD3A 3JB9I 3VKIA 3G4SA 1N9RA 4M7DC 3A8HB 4D6WA 5GAN3 5GMKi 3OW2A 1QP2A 3VYHB 3CD6A 1D3BB 2VC8A 4N0AA 3JCMc 2E12A 4Y91A 2C06A 4C0DB 1JB0E 3JCMX 2ZCFB 2AHJB 5FU7B 1M1KC 4IURA 3HRUA 1WQ7A 3VUBA 5LJ3h 1UEBA 1Y7XA 3HKSA 2RJEA 4J5YA 3OYAA 4M7DD 1G3YA 4C0FA 4KULA 3CMAA 4HCCA 1I8FA 4HA8A 3LGLA 3JRZA 4C5GA 3HHTB 4M7AC 3LWHA 1YJ9A 2RHXA 2RHUA 1PSFA 3QPHA 1M90U 3CC7A 3RMQA 4C0ZA 1VQ5A 3OS5A 2EQKA 5GAMe 3L2WA 3PT9A 3OSVA 5HK0A 1QVPA 2XG8D 4PLLA 5CCAA 2RHYA 4OF1A 3JCMd 3A8GB 4HCBA 3O8VA 5CKEA 4R55A 5FLXE 3A5ZB 3RESA 1Y71A 4IUUA 4JDSA 2VV5A 4BB7A 3CCRA 4BI8B 5LJ3f 2RJFA 2PVOB 2EJFA 2K3YA 2LQ8A 5CO7A 4CRIA 5LJ5e 3Q1JA 3FB9A 1QVGS 4N4HA 2DKGA 1V29B 4FSXA 1VQOA 4J6WA 4C92A 4M75D 2JUFA 2E1HA 2XICA 5GAN4 3HFOA 3V7CA 3UWNA 1JBMA 4E7IA 2X4WA 3M59A 2V8JA 1IREB 3LH0A 2DD4A 5DY9A 1QVFA 2MF2A 2RK2A 1UGQB 3HSBA 3HFNA 1FWZA 2DXCA 4JRIA 1P92A 5GAN8 3OS1A 1LOJA 2KDSA 3CCST 3X26B 4EMKC 3JB9J 1VQ7A 3CC4T 2P4TA 1RL2A 2R5AA 2GCXA 3EAEA 2EQMA 2KK4A 1H3ZA 1VQ6A 3NFCA 2XDPA 2K5LA 4F7UA 5J39A 2QTXA 3G6ET 4E7LA 1G3WA 3I55T 4XTVA 3A8MB 3CPFA 1VQNA 5LL6S 2JN0A 4LD9K 1VQ8T 2OTJT 4ZTJA 4RMOA 4M78A 2MAMA 3L1AA 1VQMA 2F69A 1MGQA 1K8AC 3S3OA 3R6OA 4J8OA 4KBMB 4C92B 2M1HA 2X4XA 3SDZA 4A4KA 4RCCA 2KVQG 2D6FA 4PJOE 5HY6A 2VUBA 2X35A 2HQXA 3I56T 2LRQA 3GF5A 4GLKA 5GMKm 2VXEA 4M78E 1BYMA 2RHZA 4M75B 2E5QA 4NL3A 2GFAA 2RM4A 2RA2A 3T9NA 3JCMJ 1M9SA 3M56A 1YITA 4ELYC 4V2SA 4XK8E 4M7DG 3QIIA 4OGEA 3FDRA 1U8RA 2K5IA 2QDYB 1BI0A 4F7UB 3CXCS 1KQSA 3OMCA 3CC2T 3M55A 1Q81C 4M7AD 3MEAA 5I21A 2QQRA 2XI9A 3GNGA 4C8QE 4M78F 3GNFB 3F70A 4HCZA 4X34A 4DOWA 5A0GA 1VQ4A 5CVIA 5GANf 3PGGA 3CD6T 2CKKA 2EFIA 3MP8A 5CR2A 5GAOl 2PVGB 2K4YA 1UGRB 4ZN3A 3JCMb 1SSFA 1NE8A 2PQWA 1IZ6A 4BE2A 1O75A 3LYIA 1S72A 1MHNA 2HBPA 3HL8A 4C8QF 3CMAT 1WJQA 4QVDA 4PLIA 1VQKA 4JRKA 1Q86C 1YJ9T 4JRPA 3TU4K 2QQ9A 4JUVA 1KD1C 1K9MC 3CC7T 4P5NA 3FRNA 4QVZA 1VQ5T 1UGSB 2DIGA 2Y4YA 2K3XA 5AYFA 2EJGA 1RI0A 2RJCA 3CBMA 2DTIA 2JZ2A 2QQAA 5FU6C 2PU9B 2VGNA 2JVVA 1BIAA 3X20B 3CPWS 2DXUA 2XDBA 2R5MA 3ER0A 4C5EA 3OA6A 3L2RA 3OYCA 3CCRT 3M5AA 4C5IA 4Y28E 4L59A 4LDVA 3JB9G 3BFMA 1OI1A 2HD0A 2VXFA 2EIFA 2DZCA 2OTLA 2EQJA 3HRTA 1VQOT 4PJOC 3NTHA 2K57A 2E64A 3OQ5A 3VYGA 3OMGA 3ZBDA 5DM7R 1VIFA 3LWIA 4E7HA 5FRMA 2LNVA 4CI0C 5GANg 4MZTA 3RKYA 4MDXA 1M1FA 2LCLA 2M16A 3BDUA 2XIDA 3BW1A 4M77A 2CS7A 1OZ3A 2P0QA 3CCVA 1VQ7T 4BUGA 2FYKA 4PJOG 4N4IA 3SD4A 3VV0A 4DQ2A 1VQ6T 2LVMA 2BKDN 5CKFA 2QEXA 3JCMW 2WSEE 2L3RA 4M7DA 2HQEA 4J6YA 3OB9A 4L5GA 4M77E 5C0MA 1VIEA 5KE3A 5GAMd 4RKUE 3S3MA 5HK3A 2DK3A 2FL7A 3VJPA 3E9FA 1YJWA 1VQMT 4B9WA 5J3BA 2E10A 1WPYA 1HK9A 5GAMj 3CMET 1QVFS 1VQNT 4M7AG 5GAN2 2DD5A 2EYQA 5CKHA 1GXIE 2YHTA 3L42A 4MDWA 1JJ2A 3H8ZA 4II1A 3RKXA 2CZ6B 5LJ5d 4M7DE 3OYGA 4ZGJB 1W2BS 2Y4XA 4J83A 4M77B 2EQUA 4M77F 4ZTFA 4PL6A 1VQPA 2K5FA 3GLXA 1N6AA 3M54A 5DLOA 3QXEB 1FXXA 5LJ5j 4ATOA 4ME7A 1VQLA 1YITT 4NL2A 1I81A 4RG8A 1NPPA 3V7SA 2L5QA 4M7DB 1XTDA 1ZHIA 2F5TX 2PVDB 1BI2A 4OVAA 3N5BB 3G71A 5L8RE 5D6XA 2DTHA 2H3JA 4M75A 3WXMB 1XQHA 1Q7YU 2X4JA 3SWNA 2MWPA 2YRVA 4BI3A 4LDYA 4C0DC 1QVGA 1VQ4T 2A3LA 4PKCC 3P8BB 5FU7C 4GY5A 4C92E 2XDDA 4WF2A 3JB9D 4XAXB 3FLGA 3GPLA 3LX7A 3JCMh 5IAYA 2WACA 3OYLA 5I2MA 2FVUA 5IN1A 2E6NA 3QJYA 3E1SA 4LDUA 1S72T 3PMIA 5GANd 3V8KA 2K2VA 2E65A 4OB1B 4M75E 4O5VA 2LQKA 2ZGWA 5KH6A 3OYMA 2FB7A 2KSSA 3S3NA 1JRIA 3M58A 5GANe 4TVRA 3CCEA 3RERA 4C92F 5GAOr 3P8DA 1N9SA 5GANj 4PJOD 1YIJA 4ZN1A 2ZPEB 4F7UE 3VU3C 4NS5A 2RI2A 2RHIA 2ZPFB 1NPRA 2MWOA 1G5VA 4JS4A 2F5KA 1OZ2A 4XTWA 4M75F 2BIVA 1HXDA 2X4YA 3BDLA 2P0KA 2BUDA 4N0AC 3SWNB 4QVCA 2JOYA 5LJ3g 3OYIA 2LX9A 2LCCA 4PJOA 2DJZA 4OB0B 5KCHA 1OYXA 3J80E 4HKEA 2MI6A 3JCMf 3AHUA 4A54A 3NTIA 4F7UF 2M9UA 3QZ5B 3OYEA 5C6SA 1K8AU 1YCYA 3ZEHA 1WQWA 3HRSA 3CCLA 2E41A 3G4ST 5FROA 1KQSS 3SB2A 2XHCA 1KC8U 1K73U 2ZPGB 4M7AA 4XU2A 3FEOA 3TREA 3QSUA 1LJOA 3CCVT 3CCUA 3UT1A 4E7KA 3KBGA 2VGMA 3OYYA 3QYHB 1WJRA 3QUIA 1NJIC 2QQBA 4BY6C 4ELZC 3A8LB 3ASKA 2P0PA 3DB4A 3OYBA 3X25B 4HT9A 4PJOB 1Q81U 3M4GA 1VQ9A 2E70A 2QEXT 3E19A 2OTLT 5HKCA 3JSCA 5I2SA 4C92C 1YJWT 4XU3A 5CK9A 1Q82C 4ZGEB 4KUDK 1W4SA 3PIPA 3GP8A 2GQVA 3RIRA 1XOVA 2A7YA 3CBPA 2KQWA 5GMKe 4LD6A 4UC4A 4M7AB 4XQ3A 3C94A 1O9SA 1N8RU 3PMTA 4FIBA 4IUTA 2OTJA 5GMKj 3CCQA 3JCMg 1VQPT 1M1GA 2V8IA 3J7AF 4QQ6A 3JCMV 4FT4A 5DLQE 2NLUA 1YJNA 2DEQA 2B8AA 3EFSA 3H6ZA 4EMKA 3OYFA 1Q86U 4OP0A 2PUKB 1VQLT 1KD1U 1K9MU 5LJ3d 3FC3A 4FU6A 4J7FA 3LLRA 4M78C 4XTYA 3WVEB 5LJ3e 2ZPHB 4XTZA 3OW2S 5GAOm 1FX7A 2JNGA 4FM4B 5GAOp 5GAOq 3G71T 5LJ3j 3UPUA 3M9QA 4E7JA 1BKBA 4J6XA 4X9DA 5GAN5 3CCJA 2XKOC 2DIQA 3L2ZA 4EMGA 5IT9E 2QA4A 1I4K1 2EAYA 2DXBA 3TEEA 4Q5WA 2ZZDA 2MMPA 3META 3OBWA 3C95A 4M78G 4N4GA 5GAOn 3MEVA 4C8QC 1QP3A 2IVWA 3DKMA 4QQDA 4X9CA 3CBOA 3QYGB 1M90C 2XU8A 3JCMQ 2LC4A 1M4ZA 2Y90A 4IUVA 3HPWA 5D6WA 1KQ2A 1QW1A 4O6JA 1WNLA 4EMKB 5GAN7 1WGSA 1X75C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  4WF2 A;  1U1T A;  4V2S A;  4M7D G;  4HT8 A;  3JCM P;  2CGH A;  4JLI A;  2I2L A;  3JCM h;  4MML A;  1Y96 B;  2EWN A;  4XTU A;  3BY7 A;  3QO3 A;  4M75 G;  4A53 A;  4C8Q G;  1I5L A;  4M7A D;  5I21 A;  5GAN d;  3V8K A;  4C8Q E;  2E65 A;  3RKW A;  4M78 F;  4M75 E;  2ZGW A;  2FB7 A;  1JRI A;  2YLC A;  4F7U G;  5GAN e;  3V7R A;  5GAN f;  3RER A;  3PGG A;  4C92 F;  5GAO r;  5GAO l;  1N9S A;  5GAN j;  1KQ1 A;  1X01 A;  5GMK h;  4PJO D;  4F7U E;  3V8J A;  3JCM b;  3VU3 C;  3EFR A;  4NOY A;  1U1S A;  3V8L A;  2DXT A;  3JB9 H;  4M7D F;  4M77 D;  1LNX A;  3JB9 I;  1N9R A;  4C8Q F;  4MMK A;  1B34 A;  4XTW A;  5GAM h;  4M75 F;  5CAI A;  1HXD A;  4N0A C;  3SWN B;  5GMK i;  5LJ3 g;  4QVC A;  5GAN 3;  4PJO A;  4QVD A;  1D3B B;  2YLB A;  2VC8 A;  4C92 D;  4N0A A;  2DJZ A;  4PNO A;  4JRK A;  3JCM c;  4Y91 A;  5GMK l;  3JCM e;  3JCM X;  3JCM f;  3AHU A;  4A54 A;  4JUV A;  4F7U F;  1WQ7 A;  5LJ3 h;  4J5Y A;  4M7D D;  1YCY A;  5LJ5 h;  1WQW A;  2EJG A;  2E41 A;  1I8F A;  4HA8 A;  2DTI A;  3SB2 A;  4M7A C;  1BIA A;  2DXU A;  3FJP A;  4M7A A;  4C92 E;  5GAN 7;  4XU2 A;  3JB9 G;  3QHS A;  1LJO A;  3BFM A;  3QSU A;  5GAM e;  2VXF A;  5GAM f;  2DZC A;  4M78 D;  1B34 B;  2DZ9 A;  4PJO C;  3FIF A;  3QUI A;  3JCM d;  2K57 A;  2E64 A;  4HT9 A;  4PJO B;  3M4G A;  4M77 C;  3RES A;  5GAN 6;  2RD1 A;  5GAN g;  3RKY A;  5LJ3 f;  4M77 A;  3BDU A;  2EJF A;  3BW1 A;  3RUX A;  5LJ5 e;  1M8V A;  5LJ5 f;  3FB9 A;  4C92 C;  2DKG A;  2FYK A;  4XU3 A;  4PJO G;  4C8Q D;  4J6W A;  4C92 A;  4M75 D;  5GAN h;  3JB9 F;  2E1H A;  5GAN 4;  3HFO A;  3V7C A;  4XU1 A;  1JBM A;  1TH7 A;  3RIR A;  4M77 G;  4DQ2 A;  2EJ9 A;  4M7D C;  4PJO E;  2DTO A;  4XU0 A;  5DY9 A;  5GMK e;  3JCM W;  3GIB A;  4M7A B;  4XQ3 A;  4M7D A;  4J6Y A;  4M77 E;  5GAM d;  3HSB A;  3HFN A;  3INZ A;  4JRI A;  5GMK j;  4C8Q A;  5GAN 8;  1LOJ A;  3JCM g;  3JB9 J;  4EMK C;  4F7U B;  3JCM V;  2DEQ A;  2E10 A;  3EFS A;  4EMK A;  1WPY A;  1HK9 A;  4OP0 A;  5GAM j;  4M7A G;  5GAN 2;  5LJ3 d;  4PJO F;  2YHT A;  4F7U A;  1Y96 A;  2QTX A;  5LJ5 d;  3RKX A;  4XTV A;  4M7D E;  4M7A E;  4M78 C;  4XTY A;  5LJ3 e;  2JN0 A;  4M77 B;  4M77 F;  4XTZ A;  5GAO m;  4M78 B;  2RB6 A;  4M78 A;  3L1A A;  5GAO p;  5LJ3 j;  5GAO q;  4J6X A;  1H64 1;  1MGQ A;  4X9D A;  5LJ5 j;  3L2Z A;  5GAN 5;  4C92 B;  4EMG A;  1I4K 1;  2EAY A;  5GAM g;  4NL2 A;  1BIB A;  1I81 A;  4XTX A;  4RCC A;  4RCB A;  4M78 G;  3V7S A;  5GAO n;  4EMH A;  4M7D B;  4C8Q C;  4M7A F;  4M75 C;  4X9C A;  5GMK m;  3SWN C;  4C8Q B;  2VXE A;  4M78 E;  4C92 G;  2DVE A;  2DTH A;  2Y90 A;  4M75 B;  3JCM Q;  4M75 A;  4NL3 A;  2RM4 A;  1KQ2 A;  3SWN A;  3JCM J;  1M5Q 1;  2RA2 A;  1WNL A;  4EMK B;  5LJ5 g;  1D3B A;  3JB9 D; 
#chains in the Genus database with same CATH topology
 4Z8A A;  1BI3 A;  1DJ7 B;  1IGU A;  2I2L A;  2MYS A;  2A08 A;  1WI7 A;  3L2U A;  1RAE B;  2R58 A;  1NZ9 A;  2KGT A;  3DB3 A;  3X24 B;  3KFV A;  3HTR A;  4KUI A;  2CZ0 B;  4FW2 A;  1WFW A;  1RUW A;  2HBW A;  1MUZ A;  3JB9 H;  1AVZ C;  4A4F A;  2FHD A;  2AT1 B;  5CAI A;  2KR3 A;  1Q7Y C;  3L2Q A;  1VUB A;  2R57 A;  1QVF S;  4PNO A;  2NUT A;  3QWY A;  1GL5 A;  4LUE A;  2QAS A;  3CCU T;  4J9G A;  2KMT A;  2O2O A;  1I1J A;  5CQY A;  2OAU A;  1PKS A;  3HP9 A;  3FJP A;  1K73 R;  3P8H A;  4KH0 B;  2KRM A;  5GAM f;  2RK1 A;  1ABQ A;  1X27 A;  2V8K A;  2RI3 A;  2CP2 A;  3BE3 A;  4BY6 B;  2NUT B;  2NUP A;  5FRN A;  3PNW C;  5CIU A;  2YT6 A;  1M8V A;  4PJM A;  1D0Y A;  1N5Z A;  1B7T A;  3CME A;  1YJN T;  5GAN h;  4RG2 A;  2GFU A;  4A4G A;  2CYZ B;  2ZPB B;  4M7D C;  2DTO A;  4XU0 A;  3UF4 A;  3GIB A;  3MCA B;  4DOV A;  3INZ A;  2AZS A;  5J26 A;  1UDL A;  2DAQ A;  3J81 E;  1QCN A;  2EYZ A;  2G3R A;  1RAF B;  3OYJ A;  5CKD A;  3A8O B;  4JPB W;  2NUP B;  2JMC A;  4M7A E;  3CCS A;  2RH2 A;  2VYT A;  3H0I A;  4AG1 C;  2O01 E;  2A28 A;  2JTF A;  1H64 1;  3CEY A;  1KHI A;  5GAM g;  1YHQ T;  5GJW B;  1M2O A;  4RCB A;  3I55 A;  4EMH A;  4M7A F;  2WSC E;  2FO0 A;  4M75 C;  1VQ8 A;  1X6O A;  1MMD A;  3SFM A;  2DVE A;  1UB4 A;  5IHK A;  1K0S A;  4J9H A;  3JCM P;  2P84 A;  3QZ9 B;  4XTU A;  1G5V A;  4OB2 B;  1MNE A;  3KUF A;  1Q82 U;  2CDT A;  4A4E A;  3OYK A;  1TOV A;  1RAB B;  2O4X A;  1YI2 T;  3GOX A;  1X01 A;  4CC2 A;  2CT4 A;  2L0A A;  2DIL A;  3A8H B;  4D8D A;  3OW2 A;  2EKH A;  3CD6 A;  2VC8 A;  2NUZ A;  5FU7 B;  1M1K C;  4AFQ C;  3HRU A;  4AT1 B;  1MMA A;  2COW A;  3HKS A;  4M7D D;  4WTO B;  4HCC A;  1I8F A;  3LGL A;  4C5G A;  5KYW A;  1YJ9 A;  4FYV B;  2FZC B;  2CP5 A;  2CT3 A;  5HK0 A;  1D1B A;  2DL7 A;  2PNI A;  5CKE A;  4R55 A;  2OTJ Q;  5FLX E;  2QYZ A;  3A5Z B;  1R77 A;  1Y71 A;  4JDS A;  4BB7 A;  5LJ3 f;  2RJF A;  3FB9 A;  1QVG S;  2LNH B;  1VQO A;  4M75 D;  2RNA A;  1JBM A;  5KYW B;  3M59 A;  1IRE B;  3LH0 A;  1QVF A;  3RR6 A;  3I9Q A;  1VQ7 A;  2LX7 A;  1LOJ A;  1W1F A;  2KDS A;  4EMK C;  1QMC A;  3NHN A;  4JJC A;  1RL2 A;  3EG2 A;  4M4Z A;  2K5L A;  4F7U A;  1G3W A;  2FEI A;  1VQN A;  5LL6 S;  4LD9 K;  4KGV B;  4ZTJ A;  4RMO A;  1MGQ A;  5I11 A;  4J8O A;  2M1H A;  4ORZ A;  5HCK A;  2D6F A;  3CMA Q;  4FW1 A;  4M75 B;  3VS4 A;  2BTT A;  3JCM J;  1M9S A;  3CC7 Q;  4ELY C;  2EVR A;  1Q86 R;  4OMM A;  3QII A;  3UA6 A;  4F7U B;  2QDY B;  1BI0 A;  1KQS A;  3CC2 T;  3M55 A;  2E3I A;  3MEA A;  5I21 A;  2XI9 A;  1GFD A;  3F70 A;  5A0G A;  1C6V X;  3MP8 A;  1SSH A;  2EYX A;  3JCM b;  1NE8 A;  1WA7 A;  1OU9 A;  2PQW A;  1IZ6 A;  1RLP C;  3GBQ A;  4QVD A;  3SHW A;  2ROT A;  4JUV A;  3UA7 A;  3ZL7 C;  4RTX A;  1UGS B;  2Y4Y A;  1VQ6 Q;  1RI0 A;  3CXC P;  2JZ2 A;  2ED1 A;  5FU6 C;  2JVV A;  1BIA A;  3OA6 A;  3CCR T;  4C5I A;  2V1Q A;  4LDV A;  5IH2 A;  3JB9 G;  2KYM A;  2CP3 A;  2VXF A;  2EQJ A;  4PJO C;  3NTH A;  2K57 A;  3ZBD A;  3LWI A;  2COY A;  1M1F A;  2M16 A;  3BDU A;  2CS7 A;  2P0Q A;  2DMO A;  1AWX A;  1LCK A;  2EGE A;  1T3L A;  5GAM d;  2OTL A;  2FL7 A;  3VJP A;  3E9F A;  1YJW A;  4B9W A;  5J3B A;  2E10 A;  2GNC A;  5GAM j;  1AT1 B;  1WLP B;  2DD5 A;  4AG2 C;  4B6M A;  1W6X A;  4II1 A;  1SHG A;  1H8K A;  1UUE A;  3QDF A;  2K3B A;  4ZTF A;  2HMA A;  4RTY A;  2XMF A;  5IHI A;  1I81 A;  4RG8 A;  1NPP A;  1ZHI A;  2ABL A;  3G71 A;  5D6X A;  2DTH A;  4BI3 A;  1QVG A;  4GY5 A;  3JCM h;  4JJD A;  2IPO B;  2E6N A;  3QJY A;  1KSW A;  4LDU A;  3PMI A;  4CC7 A;  2LJ3 A;  2ZGW A;  5KH6 A;  2FB7 A;  2KSS A;  3OYM A;  3M58 A;  3CCE A;  1U3O A;  1N9S A;  4PJO D;  2J05 A;  4ZN1 A;  2DM1 A;  4KH1 B;  2D1X A;  1NM7 A;  2MWO A;  1AD5 A;  2C0O A;  2IIM A;  2F5K A;  4X1V A;  4XTW A;  1GCQ C;  4FCY A;  4QVC A;  4PJO A;  1MMN A;  2DJZ A;  4OB0 B;  3J80 E;  3FJ5 A;  3CCL A;  8ATC B;  2RQT A;  2CP0 A;  3SB2 A;  4J9C A;  1KC8 U;  1X6B A;  1QKX A;  2DE0 X;  1VQP Q;  4HVV A;  2RMO A;  2VGM A;  1WJR A;  1PG5 B;  3QUI A;  1NJI C;  4HT9 A;  4PJO B;  1VQ9 A;  3E19 A;  2BZX A;  5I2S A;  4C92 C;  4QKU A;  4XU3 A;  1H3H A;  1XOV A;  1F1B B;  1MV3 A;  4F16 A;  4XQ3 A;  3PMT A;  4FIB A;  4IUT A;  3M0S A;  5DLQ E;  2B8A A;  1YIJ Q;  4OP0 A;  5LJ3 d;  3FC3 A;  1B3Q A;  3LLR A;  4XTY A;  3WVE B;  3EGX A;  5GAO m;  5GAO p;  3UPU A;  5LJ3 j;  3M9Q A;  4J6X A;  5GAN 5;  3L2Z A;  4EMG A;  2QA4 A;  1I4K 1;  2DXB A;  2ZZD A;  1D0X A;  1ZSZ C;  4C8Q C;  1UEC A;  1M90 C;  1YCS B;  1QW1 A;  4FL6 A;  1VYV A;  1WGS A;  3H9N A;  4HT8 A;  2X3X D;  2D0Q B;  3QO3 A;  3EG0 A;  2KEA A;  3MP1 A;  1NLO C;  3QJ6 A;  1WHK A;  4E47 A;  2PZ1 A;  1JJ2 S;  1G2B A;  2RPN A;  1D1C A;  2DO3 A;  3OS0 A;  2M0O A;  2KAF A;  1T0J A;  3CCM A;  3V8J A;  1M3C A;  1U1S A;  2LTO A;  4KGX B;  4E2F B;  1VA7 A;  3EG3 A;  2XK0 A;  4MMK A;  1RAC B;  1PWT A;  1R0B G;  1QQJ A;  3OYN A;  4C92 D;  2YLB A;  3JAM E;  5GMK l;  4OB3 B;  3L2V A;  2MOX A;  3CCQ Q;  3TSW A;  2E6Z A;  5LJ5 h;  4GBQ A;  3THK A;  2LQW A;  1FMV A;  1MMG A;  4BI4 A;  2H8H A;  3E9G A;  5EG2 A;  1KC8 R;  5FWC A;  3DLL A;  3JV3 A;  3CCJ Q;  3WVD B;  3G7Z A;  1Y07 A;  1UJ0 A;  4IUP A;  2DZ9 A;  4JS5 A;  3EG9 A;  1OQK A;  2XD0 A;  1KHC A;  2QQS A;  5GAN 6;  3RUX A;  4KT0 E;  5L23 A;  2QI2 A;  1LVK A;  4C8Q D;  5KCO A;  3JB9 F;  2YUP A;  2LCS A;  2HSE B;  4C5H A;  1EIF A;  2EJ9 A;  3UAT A;  9ATC B;  3KXT A;  1G3T A;  1X2K A;  5D6Y A;  4L6V 5;  4C8Q A;  2PUO B;  3LH5 A;  4RTV A;  1C1A A;  3EG9 B;  4MZM A;  3CC4 A;  3VS7 A;  2HSP A;  1X6G A;  2OAW A;  3G6E A;  4PFO A;  3S6W A;  2RO0 A;  3NTK A;  5KE2 A;  4BDZ A;  1N8R C;  4C8Q B;  1NJI U;  4CC3 A;  2EKO A;  5KYU B;  1U1T A;  3MO8 A;  3M4Y A;  2CGH A;  2QXF A;  4M75 G;  3I56 A;  4BAC A;  4B9X A;  4A4H A;  2RN8 A;  2KRN A;  3ME9 A;  4F7U G;  3MP6 A;  3V7R A;  1SPK A;  2QTV A;  2AIR B;  4QW2 A;  4LXC A;  1I5O B;  3EFR A;  1YBY A;  4NOY A;  2DXT A;  3U23 A;  3ZFJ A;  1SRM A;  2JT4 A;  5EC7 A;  5IXF A;  2LP5 A;  1N9R A;  3VYH B;  2LJ0 A;  2MIO A;  4N0A A;  3JCM c;  4Y91 A;  1NLP C;  2AHJ B;  4RTT A;  3VUB A;  3OYA A;  2DL8 A;  2RJE A;  4J5Y A;  3RNJ A;  1TUD A;  2DRM A;  1WZO A;  1JQQ A;  4M7A C;  3LWH A;  1WXT A;  3CCS Q;  1PSF A;  1M90 U;  3RMQ A;  1PHT A;  1VQ5 A;  2EQK A;  5GAM e;  1K76 A;  2XG8 D;  3I55 Q;  3EG1 A;  5D7U A;  1VQ8 Q;  2MCN A;  2EJF A;  1TUG B;  2DKG A;  1V29 B;  4FSX A;  3VS3 A;  1K8A R;  4J6W A;  2E1H A;  2XIC A;  4E7I A;  3UWN A;  2V8J A;  3HSB A;  2DXC A;  1P92 A;  1OX8 A;  5GAN 8;  3JB9 J;  1GBR A;  2R5A A;  2DNU A;  2GCX A;  3EAE A;  2EQM A;  2DFU A;  1YWO A;  4E7L A;  4XTV A;  2OTJ T;  3CD6 Q;  1VQM A;  2F69 A;  3R6O A;  2ATC B;  3SDZ A;  4RCC A;  2KVQ G;  1PRL C;  2VUB A;  2QAZ A;  1BYM A;  4NL3 A;  1YJ9 Q;  2GFA A;  2M51 A;  3T9N A;  3NMZ C;  2FZK B;  2F2V A;  1YIT A;  2GQI A;  3CXC S;  1W70 A;  2KRS A;  3OMC A;  1K9M R;  1Q81 C;  4M7A D;  3SEM A;  2FRW A;  1VQ4 A;  2CRE A;  1XJW B;  5CR2 A;  4WCI A;  1PCX A;  2CSQ A;  1VQO Q;  1S72 A;  2HBP A;  3PVL A;  3CMA T;  3RBB B;  1OUL A;  1WJQ A;  1IO6 A;  4PLI A;  4Z88 A;  1VQ7 Q;  1RI9 A;  2M0Y A;  1KD1 C;  3CC7 T;  2JS2 A;  2DIG A;  2RJC A;  1HYO A;  2DTI A;  2QQA A;  2DA9 A;  2VGN A;  3CPW S;  1VQN Q;  3OYC A;  1OI1 A;  2KT1 A;  1K0X A;  1GRI A;  1EFN A;  2E64 A;  3VYG A;  1IB8 A;  1HSQ A;  2LCL A;  3MJX A;  3CCV A;  4BUG A;  4DBQ A;  4PJO G;  2M02 A;  5KYY A;  1JO8 A;  3SD4 A;  2C0T A;  1VQ6 T;  3MKD A;  2QEX A;  2WSE E;  1K1Z A;  2HCK A;  4M7D A;  2HQE A;  3OB9 A;  2YRD A;  4IIO A;  2OX7 A;  4RKU E;  2DK3 A;  1VYU A;  2AK5 A;  1WPY A;  2HKN A;  5GAN 2;  4MDW A;  3H8Z A;  1OOT A;  4E6R A;  4M7D E;  1W2B S;  2Y4X A;  4J83 A;  4R0K A;  2GBQ A;  3A98 A;  2K5F A;  3M54 A;  5DLO A;  3QXE B;  1CKA A;  3OW2 P;  5KYY B;  1U06 A;  1VQL A;  2L5Q A;  4M7D B;  2JS0 A;  2PVD B;  1ZUK A;  1E6G A;  1PM3 A;  2KT8 A;  2K9G A;  5FRM A;  4M75 A;  1Q7Y U;  1ZUY A;  4C0D C;  4HXJ A;  2L3S A;  2A3L A;  2XDD A;  4WF2 A;  2LZ6 B;  4XAX B;  2CP6 A;  2GGR A;  4AFS C;  1D1A A;  2FVU A;  3G4S Q;  1BB9 A;  3VS2 A;  5GAN d;  2KBT A;  3V8K A;  1TXQ A;  4M75 E;  4O5V A;  3S3N A;  5GAO r;  3TQ7 P;  5GAN j;  4F7U E;  3VS1 A;  2RI2 A;  1NPR A;  4JS4 A;  1T0H A;  1OZ2 A;  1KIK A;  4M75 F;  1HXD A;  3BDL A;  5LJ3 g;  2JOY A;  2LX9 A;  2LCC A;  5KCH A;  1ZBJ A;  2OTL Q;  2HZY A;  4HKE A;  3JCM f;  4RTU A;  1YJW Q;  3NTI A;  1WHJ A;  1GBQ A;  2DEU A;  4F7U F;  1QVF P;  1E7O A;  1Q82 R;  3HRS A;  1PNJ A;  4CC4 B;  3VS0 A;  1I07 A;  2ZPG B;  2KYB A;  3M0U A;  3IQL A;  3FEO A;  1AEY A;  1LJO A;  3CCU A;  1UE9 A;  2V1R A;  3MPU B;  2QQB A;  4K11 A;  1Z9Z A;  1Q81 U;  3G71 Q;  2GTJ A;  1YNZ A;  1V1C A;  4DEX A;  5CK9 A;  4ZGE B;  3GP8 A;  3RIR A;  2JW4 A;  2A7Y A;  2KQW A;  1PD0 A;  5GMK e;  2HL5 C;  3C94 A;  1KQS P;  2OTJ A;  2HL3 A;  1G8X A;  3EGU A;  3JCM g;  3RDV A;  1VQP T;  3CCE Q;  1UG1 A;  4JZ3 A;  1NEG A;  1BCO A;  4PFZ A;  1YJN A;  3H6Z A;  4EMK A;  1X2Q A;  2PUK B;  2DL3 A;  1KD1 U;  1U5S A;  2X9H A;  4FU6 A;  2KXD A;  4M78 C;  2FG0 A;  4XTZ A;  3G1J A;  2YSQ A;  2JNG A;  5GAO q;  2AKK A;  4E7J A;  2O88 A;  1YP5 A;  1Z9Q A;  2EAY A;  3TEE A;  4FYX B;  3C95 A;  4N4G A;  2K2M A;  3CCL Q;  4QQD A;  2FPF A;  1M4Z A;  2COZ A;  5D6W A;  1J3T A;  4PK4 A;  1WNL A;  2DYB A;  4EMK B;  1X75 C;  2HNI A;  1YHQ A;  1M1K U;  3OS2 A;  2BE9 B;  5ECA A;  3MEW A;  4C8Q G;  4A53 A;  1YIJ T;  1I5L A;  4J7I A;  2IG0 A;  2JMA A;  1VQK Q;  1VQ9 Q;  2AKL A;  1OPK A;  4EDU A;  1AWW A;  1NYG A;  4IKF A;  1KQ1 A;  4DBH A;  1ZBX A;  4YTL A;  1LNX A;  1W2B A;  1B34 A;  3H0H A;  2DPP B;  1YFN A;  1WIE A;  4ZGD B;  5A0D A;  1YI2 A;  4Z02 A;  1SEM A;  2FPD A;  3M57 A;  4C0G A;  2VWF A;  1UHC A;  1X43 A;  5GJV B;  2A37 A;  1PSE A;  3CQT A;  4OML A;  4DA4 A;  2QA4 Q;  2D0N A;  1NEB A;  1B34 B;  4M78 D;  4BE1 A;  4M77 C;  2MPX C;  2K79 A;  3DLM A;  3PVQ A;  1OU8 A;  3CCQ T;  5LJ5 f;  3MEU A;  5CKB A;  2ZPI B;  1KK7 A;  4IUQ A;  2RJD A;  4VUB A;  4XU1 A;  1QVG P;  4PJO E;  5FU6 B;  1K73 C;  4D8K A;  1XNI A;  1WJS A;  1ZQ1 A;  2JJ9 A;  3CCJ T;  3CCM Q;  4PJO F;  2DX1 A;  4M78 B;  2RB6 A;  2QGF B;  3EHR A;  4LDX A;  1AHJ B;  3SWN C;  2DER A;  1M5Q 1;  2X51 A;  5LJ5 g;  1D3B A;  3OY9 A;  2NYS A;  2YUO A;  5M9O A;  2EYY A;  2FZG B;  4MML A;  2GF7 A;  4HVW A;  5FWB A;  3BY7 A;  1M1K R;  4LE9 A;  4FT2 A;  3QDR B;  1UTI A;  3M0P A;  2WSF E;  5A0L A;  3PTA A;  5CQX A;  2JTM A;  5GMK h;  1WX6 A;  3CC2 A;  3V8L A;  4M77 D;  4BD3 A;  4OMO A;  5GAN 3;  1M8M A;  4AFZ C;  1D3B B;  1GCQ A;  2E12 A;  2KE9 A;  3JCM X;  2ZCF B;  1BU1 A;  4IUR A;  2O9S A;  1G3Y A;  2YRC A;  4E7S A;  4HA8 A;  3JRZ A;  1YN8 A;  3HHT B;  2RHX A;  3QPH A;  4LN2 A;  4Z89 A;  3CC4 Q;  3OS5 A;  4HCK A;  1SKU B;  1RAG B;  3G6E Q;  4PLL A;  1V76 A;  4OF1 A;  5CCA A;  3JCM d;  4HCB A;  5KYX A;  2EYW A;  3CCR A;  2J7I A;  2L2P A;  2PVO B;  5CO7 A;  2LQ8 A;  4CRI A;  3Q1J A;  4N4H A;  2G6F X;  8AT1 B;  3VS5 A;  7AT1 B;  4C92 A;  2EQI A;  2X4W A;  4AFU C;  3I56 Q;  5DY9 A;  2MF2 A;  1UGQ B;  2L3Q A;  2SEM A;  3I5S A;  4JRI A;  1FWZ A;  3OS1 A;  3CCS T;  4FYW B;  2AZV A;  1JEG A;  2KK4 A;  2F1L A;  4DBF A;  1H3Z A;  3NFC A;  2XDP A;  4ANJ A;  5KYX B;  3I55 T;  2DET A;  3A8M B;  3CPF A;  2JN0 A;  1VQ8 T;  1MV0 B;  4DEY A;  6AT1 B;  4Y92 A;  4KBM B;  4C92 B;  2X4X A;  1ZUU A;  5HY6 A;  1MND A;  2X35 A;  2HQX A;  1ZSZ A;  1AWO A;  3GF5 A;  5GMK m;  2VXE A;  2E5Q A;  3I35 A;  1YWP A;  2RM4 A;  2JTE A;  1NBE B;  3M56 A;  5KYU A;  4V2S A;  4XK8 E;  4M7D G;  4DBR A;  4OGE A;  1VQ5 Q;  1CKB A;  1U8R A;  2K5I A;  1R0C B;  2I0N A;  2QQR A;  4C8Q E;  3GNF B;  2J06 A;  5KYN A;  2OI3 A;  1FYN A;  5GAN f;  3CD6 T;  2CKK A;  3ULR B;  2OJ2 A;  2PVG B;  2K4Y A;  4ZN3 A;  1PC0 A;  1SSF A;  4PJL A;  3NGP A;  1O75 A;  2DL4 A;  1ZSZ B;  1QWE A;  3HL8 A;  4C8Q F;  4J9B A;  2BZY A;  1WYX A;  1Q86 C;  1YJ9 T;  2CH4 W;  2QQ9 A;  2A0F B;  3FRN A;  4QVZ A;  5AYF A;  4J9F A;  3CBM A;  2GTO A;  2PU9 B;  1JXM A;  2QG9 B;  4AMC A;  3X20 B;  2R5M A;  3PE0 A;  4PJJ A;  1VQM Q;  2H3E B;  2J6O A;  3M5A A;  4Y28 E;  1RLQ C;  1QCF A;  3CME Q;  1TWB A;  2HD0 A;  2EIF A;  2DZC A;  2LQN A;  3HRT A;  1VQO T;  5DM7 R;  5I22 A;  4E7H A;  2LNV A;  5GAN g;  1PRM C;  2ENM A;  3BW1 A;  1OZ3 A;  1VQ7 T;  2HDA A;  1YIT Q;  2BE7 D;  4N4I A;  2K6D A;  3M0Q A;  3VV0 A;  4DQ2 A;  2BKD N;  5CKF A;  3JCM W;  5C0M A;  4L5G A;  5KE3 A;  3S3M A;  1VQN T;  1VQ4 Q;  4JZ4 A;  1S72 Q;  3L42 A;  1JJ2 A;  1RAA B;  1I0C A;  2EPD A;  2KNB B;  3RKX A;  5LJ5 d;  4ZGJ B;  1JXO A;  1Y57 A;  2EQU A;  1FMW A;  3GLX A;  5LJ5 j;  4ATO A;  4ME7 A;  1D0Z A;  1XTD A;  2F5T X;  1BI2 A;  5L8R E;  2O31 A;  2H3J A;  3WXM B;  1XQH A;  2MWP A;  2YRV A;  3TSZ A;  2D8J A;  4PKC C;  2CH4 A;  5FU7 C;  4J9E A;  3FLG A;  3GPL A;  3REB B;  3LX7 A;  2WAC A;  5I2M A;  5IN1 A;  3E1S A;  3M0R A;  2P4R A;  2K2V A;  2E65 A;  4OMP A;  2LQK A;  4A63 B;  3P8D A;  3CCV Q;  1WHH A;  1JJ2 P;  2YDL A;  2ZPE B;  2CP7 A;  2HQH A;  1HD3 A;  2SRC A;  1KJW A;  1SG5 A;  1NYF A;  2QGG A;  1NJI R;  2QEX Q;  3OYI A;  2JXB A;  1PD1 A;  4GLM A;  4HVU A;  2MI6 A;  3AHU A;  4A54 A;  3OYE A;  5C6S A;  1YCY A;  3ZEH A;  1GCP A;  3G4S T;  1KQS S;  2XHC A;  4M7A A;  2C0I A;  2CUD A;  1HJD A;  1X69 A;  4XU2 A;  3TRE A;  1WHG A;  4ZNX A;  1VQL Q;  3UT1 A;  4E7K A;  4RTW A;  3O5Z A;  2DBM A;  2LJ1 A;  3A8L B;  3ASK A;  3DB4 A;  1AOJ A;  3M4G A;  2OTL T;  5HKC A;  2DJQ A;  3H41 A;  1YJW T;  3PIP A;  2GQV A;  2DRK A;  4E7Z A;  1ARK A;  4UC4 A;  4M7A B;  3EFO A;  1N8R U;  1M90 R;  2E4H A;  2DEQ A;  3OYF A;  1Q86 U;  1RAH B;  4J7F A;  5LJ3 e;  1FX7 A;  4FM4 B;  3G71 T;  2DIQ A;  2VKN A;  4Q5W A;  4M78 G;  3MEV A;  2CUB A;  3EFO B;  1QP3 A;  3DKM A;  2VB6 A;  4X9C A;  3QYG B;  2LC4 A;  4IUV A;  3HPW A;  4O6J A;  1BI1 A;  1G3S A;  3TVT A;  4EIK A;  3CCE T;  3URG A;  3CCU Q;  3RKW A;  3OBY A;  4FSS A;  4JJN K;  2O4X B;  4OGC A;  3C4S A;  1R8O B;  4M7D F;  2LMJ A;  1SF9 A;  5GAM h;  3CCL T;  2CZ7 B;  2B86 A;  3JCM e;  3TCJ A;  4JRQ A;  1IRX A;  2LT4 A;  4LDW A;  3REA B;  4QQG A;  4R56 A;  1YJN Q;  4FYY B;  1T3S A;  2L8D A;  1N27 A;  1B07 A;  1TG0 A;  2D8H A;  3OYD A;  2RQV A;  1AWJ A;  1VQK T;  1VQ9 T;  2KXC A;  2YWW A;  4BE0 A;  3QHS A;  2F2X A;  2DVJ A;  3MHX A;  5AT1 B;  1IGQ A;  3FIF A;  2MK5 A;  2RF0 A;  3AT1 B;  4ESR A;  2L89 A;  2LDM A;  2RD1 A;  3LW5 E;  1QCO A;  2EGA A;  2HAX A;  1YHQ Q;  2VVK A;  4RTZ A;  1UHF A;  1TH7 A;  4M77 G;  3PIO A;  4MZP A;  3X28 B;  2E3H A;  1KC8 C;  4JLG A;  2BZ8 A;  1N8R R;  2FPE A;  2J6K A;  3OYH A;  3CXC A;  3PFS A;  1PKT A;  2QA4 T;  1QLY A;  3M0T A;  1Y96 A;  2RI5 A;  3C12 A;  2KY9 A;  1OPL A;  1YI2 Q;  3OSS C;  4EPC A;  1TU0 B;  3QBY A;  1BIB A;  4XTX A;  4RUG A;  2HKQ B;  3LGF A;  2NWM A;  4C92 G;  3M53 A;  4OMF B;  2EBP A;  1JU5 C;  4JLI A;  3VUZ A;  2QK0 A;  3UDC A;  1Y96 B;  2EWN A;  3CCM T;  1UGP B;  3CPW A;  1AZG B;  1IXD A;  5A2Q E;  2YLC A;  3QG1 A;  2LT1 A;  1Q95 G;  3RMS A;  1WDX A;  2DLP A;  3QKJ A;  1ZLM A;  4BDY A;  1KG1 A;  1ZA2 B;  2CZ1 B;  2D9T A;  3G4S A;  3JB9 I;  3VKI A;  1SHF A;  4D6W A;  5GMK i;  1QP2 A;  2ECZ A;  1Q7Y R;  2C06 A;  4C0D B;  1JB0 E;  1WQ7 A;  5LJ3 h;  1UEB A;  1Y7X A;  4C0F A;  4KUL A;  3CMA A;  3R6N A;  2RQU A;  2ROL A;  1KFZ A;  1S1N A;  1VOM A;  2RHU A;  3EGD A;  3CC7 A;  1OEB A;  1RAI B;  4C0Z A;  3CPW P;  3VRY A;  3L2W A;  1D09 B;  3PT9 A;  3OSV A;  3EH2 A;  1QVP A;  3EH1 A;  2RHY A;  4QT7 A;  3A8G B;  1M3B A;  3O8V A;  3RES A;  4IUU A;  2VV5 A;  1SRL A;  4BI8 B;  1UFF A;  2K3Y A;  3D7S B;  5LJ5 e;  1TS9 A;  1RAD B;  1ZX6 A;  2JUF A;  5GAN 4;  3HFO A;  3V7C A;  1GFC A;  1E6H A;  3EGD B;  4F04 B;  2DD4 A;  2RK2 A;  2O9V A;  2DF6 A;  3HFN A;  3E2U A;  2CSI A;  3X26 B;  3CC4 T;  2P4T A;  3CC2 Q;  1VQ6 A;  5J39 A;  2QTX A;  3G6E T;  3NPF A;  1Q81 R;  3C0C A;  1CSK A;  2HEQ A;  1ACM B;  1QKW A;  4M78 A;  2MAM A;  3L1A A;  2JM9 A;  1K8A C;  1W2B P;  3S3O A;  4A4K A;  2DL5 A;  3I56 T;  2LRQ A;  4GLK A;  4M78 E;  2RHZ A;  4LNP A;  1BK2 A;  2RA2 A;  1LPL A;  2DBK A;  2ESW A;  2JM8 A;  3FDR A;  1KD1 R;  4IIM A;  2YUN A;  3GNG A;  4M78 F;  4DOW A;  4HCZ A;  2YUQ A;  4X34 A;  5CVI A;  3CCR Q;  3PGG A;  1WXU A;  2EFI A;  5GAO l;  1UGR B;  1WHL A;  3VS6 A;  5IXB A;  4BE2 A;  3LYI A;  1IHW A;  1MHN A;  1A0N B;  1AZE A;  3VRZ A;  2K7A A;  1VQK A;  1NG2 A;  4JRK A;  4JRP A;  3TU4 K;  3EHQ A;  1K9M C;  4P5N A;  2FRY A;  1VQ5 T;  2K3X A;  2EJG A;  4KGZ B;  1M27 C;  2DXU A;  1H92 A;  3ER0 A;  4C5E A;  3L2R A;  4L59 A;  3BFM A;  1TUC A;  1VYT A;  4F14 A;  1M2V A;  3OQ5 A;  3OMG A;  2KI7 A;  1VIF A;  2RQR A;  4CI0 C;  4MDX A;  4MZT A;  3RKY A;  4M77 A;  4F17 A;  2XID A;  1UJY A;  2A36 A;  2FYK A;  1OX9 A;  1C0M A;  2LVM A;  2EW3 A;  2L3R A;  4J6Y A;  4M77 E;  1ZA1 B;  1VIE A;  5HK3 A;  3QWX X;  1VQM T;  2RQW A;  1M2V B;  1HK9 A;  3CME T;  4M7A G;  1WXB A;  1GXI E;  2EYQ A;  5CKH A;  2YHT A;  2CZ6 B;  3OYG A;  3EGX B;  4M77 B;  4M77 F;  4PL6 A;  1VQP A;  1N6A A;  1FXX A;  4OMQ A;  1YIT T;  4NL2 A;  3V7S A;  3I5R A;  4OVA A;  1M30 A;  1IHV A;  2QDL A;  3N5B B;  2X4J A;  3SWN A;  4LDY A;  4PJN A;  2XDB A;  1VQ4 T;  1G83 A;  3P8B B;  4C92 E;  3JB9 D;  4LUD A;  5IAY A;  3OYL A;  1ABO A;  1S72 T;  1Y0M A;  3H0F A;  4OB1 B;  3A1P A;  1BCM A;  1JRI A;  5GAN e;  4TVR A;  3RER A;  4C92 F;  4PFP A;  1YIJ A;  3VU3 C;  4NS5 A;  2RHI A;  2ZPF B;  1UGV A;  5IHN A;  2EGC A;  2BIV A;  4JJB A;  2X4Y A;  4N0A C;  2P0K A;  2BUD A;  3SWN B;  2Z0W A;  2L3P A;  1OYX A;  1TTH B;  2M9U A;  2W10 A;  3QZ5 B;  1K8A U;  1WQW A;  4KRT A;  2E41 A;  5FRO A;  2X3W D;  1K73 U;  3QSU A;  3CCV T;  3KBG A;  4J9D A;  3OYY A;  3QYH B;  1WHM A;  4BY6 C;  4ELZ C;  2P0P A;  3OYB A;  3X25 B;  1ZSG A;  1EX4 A;  2E70 A;  2QEX T;  1K4U S;  2VAS A;  2E5K A;  3JSC A;  2YXY A;  1Q82 C;  4KUD K;  1W4S A;  2ZAE A;  1EZZ B;  3CBP A;  4LD6 A;  2J6F A;  1O9S A;  5FW9 A;  5GMK j;  4OMN A;  1K9A A;  3CCQ A;  1M1G A;  2V8I A;  3J7A F;  4QQ6 A;  3JCM V;  4FT4 A;  2NLU A;  3EFS A;  1QWF A;  1VQL T;  1K9M U;  1BBZ A;  2PTK A;  2V26 A;  2ZPH B;  3OW2 S;  2ED0 A;  1BKB A;  4X9D A;  3CCJ A;  1TSF A;  2XKO C;  5IT9 E;  1FMK A;  2KRO A;  2MMP A;  2W0Z A;  3MET A;  3OBW A;  5GAO n;  2IVW A;  1M3A A;  1OV3 A;  4J9I A;  3CBO A;  2XU8 A;  3JCM Q;  2Y90 A;  2DYI A;  2F2W A;  1KQ2 A;  5GAN 7; 
#chains in the Genus database with same CATH homology
 2HNI A;  1BI1 A;  1G3S A;  1YHQ A;  3CCE T;  1M1K U;  1BI3 A;  3OS2 A;  1DJ7 B;  4HT8 A;  2I2L A;  3URG A;  4C8Q G;  3MEW A;  1YIJ T;  3QO3 A;  2D0Q B;  4A53 A;  4J7I A;  1I5L A;  3L2U A;  3QJ6 A;  3MP1 A;  2R58 A;  2IG0 A;  3RKW A;  1NZ9 A;  3DB3 A;  3OBY A;  4E47 A;  3X24 B;  1JJ2 S;  4JJN K;  2O4X B;  4KUI A;  4OGC A;  4EDU A;  3C4S A;  2DO3 A;  3OS0 A;  2M0O A;  2CZ0 B;  2KAF A;  1KQ1 A;  4IKF A;  1R8O B;  3V8J A;  1ZBX A;  3CCM A;  4YTL A;  1U1S A;  2LTO A;  3JB9 H;  4M7D F;  2XK0 A;  4A4F A;  2FHD A;  1LNX A;  1W2B A;  5GAM h;  4MMK A;  1B34 A;  3CCL T;  2CZ7 B;  2DPP B;  5CAI A;  1Q7Y C;  3L2Q A;  3OYN A;  4ZGD B;  1VUB A;  2R57 A;  2YLB A;  4C92 D;  5A0D A;  3JAM E;  4PNO A;  4OB3 B;  5GMK l;  4Z02 A;  3JCM e;  3L2V A;  3TCJ A;  4JRQ A;  1YI2 A;  4LDW A;  2LT4 A;  2E6Z A;  4QQG A;  4R56 A;  3M57 A;  4C0G A;  5LJ5 h;  2L8D A;  3CCU T;  1N27 A;  4BI4 A;  2KMT A;  1PSE A;  3OYD A;  5CQY A;  2OAU A;  3E9G A;  5EG2 A;  3HP9 A;  3FJP A;  4DA4 A;  1VQK T;  1VQ9 T;  3DLL A;  4BE0 A;  3WVD B;  3G7Z A;  3QHS A;  1Y07 A;  3MHX A;  3P8H A;  5GAM f;  2RK1 A;  4M78 D;  1B34 B;  4IUP A;  2DZ9 A;  4BE1 A;  4JS5 A;  3FIF A;  2V8K A;  2RI3 A;  2XD0 A;  1KHC A;  2QQS A;  4BY6 B;  2L89 A;  4M77 C;  5GAN 6;  2LDM A;  2RD1 A;  5FRN A;  4FL6 A;  3LW5 E;  3PNW C;  5CIU A;  1M8V A;  3DLM A;  3RUX A;  4KT0 E;  3CCQ T;  2QI2 A;  3MEU A;  5CKB A;  5LJ5 f;  2HAX A;  2ZPI B;  4C8Q D;  3CME A;  1YJN T;  5GAN h;  5KCO A;  4IUQ A;  2RJD A;  4VUB A;  3JB9 F;  4XU1 A;  1TH7 A;  4RG2 A;  4C5H A;  1EIF A;  2GFU A;  2EJ9 A;  2CYZ B;  2ZPB B;  4M77 G;  4MZP A;  4A4G A;  3PIO A;  2DTO A;  4XU0 A;  5FU6 B;  3X28 B;  1K73 C;  1KC8 C;  4JLG A;  3MCA B;  3GIB A;  3KXT A;  4DOV A;  1G3T A;  3INZ A;  1XNI A;  5D6Y A;  4L6V 5;  4C8Q A;  5J26 A;  2PUO B;  1WJS A;  2DAQ A;  1ZQ1 A;  3OYH A;  3PFS A;  3J81 E;  3CXC A;  3CCJ T;  2G3R A;  2QA4 T;  3OYJ A;  4MZM A;  4PJO F;  5CKD A;  3A8O B;  1Y96 A;  2RI5 A;  4M7A E;  3C12 A;  3CCS A;  2RH2 A;  2VYT A;  4M78 B;  2RB6 A;  3CC4 A;  2KY9 A;  2O01 E;  2JTF A;  1H64 1;  3OSS C;  3CEY A;  4EPC A;  3QBY A;  1KHI A;  5GAM g;  1YHQ T;  1BIB A;  4LDX A;  4XTX A;  3G6E A;  4RCB A;  1AHJ B;  3S6W A;  3I55 A;  4EMH A;  2RO0 A;  3LGF A;  3NTK A;  4M7A F;  2WSC E;  1VQ8 A;  4M75 C;  1X6O A;  5KE2 A;  4BDZ A;  3SWN C;  4C8Q B;  4C92 G;  1N8R C;  3SFM A;  2DVE A;  1NJI U;  1UB4 A;  3M53 A;  1M5Q 1;  4OMF B;  1D3B A;  2EKO A;  5LJ5 g;  3OY9 A;  1U1T A;  3MO8 A;  3M4Y A;  3JCM P;  2CGH A;  2QXF A;  5M9O A;  4JLI A;  3VUZ A;  3UDC A;  4MML A;  1Y96 B;  2EWN A;  2GF7 A;  3BY7 A;  3QZ9 B;  4M75 G;  1UGP B;  4OB2 B;  4XTU A;  3KUF A;  4FT2 A;  3QDR B;  3I56 A;  3CCM T;  3CPW A;  4BAC A;  1Q82 U;  4A4E A;  3OYK A;  2WSF E;  4B9X A;  4A4H A;  5A0L A;  5A2Q E;  3ME9 A;  3PTA A;  2YLC A;  3QG1 A;  2LT1 A;  3MP6 A;  5CQX A;  3V7R A;  4F7U G;  2O4X A;  3RMS A;  1YI2 T;  3QKJ A;  2JTM A;  3GOX A;  1X01 A;  4QW2 A;  5GMK h;  4BDY A;  3CC2 A;  3EFR A;  1YBY A;  4NOY A;  3V8L A;  1KG1 A;  2DXT A;  2CZ1 B;  2D9T A;  4M77 D;  3ZFJ A;  4BD3 A;  3JB9 I;  3VKI A;  3G4S A;  1N9R A;  4M7D C;  3A8H B;  4D6W A;  5GAN 3;  5GMK i;  3OW2 A;  1QP2 A;  3VYH B;  3CD6 A;  1D3B B;  2VC8 A;  4N0A A;  3JCM c;  2E12 A;  4Y91 A;  2C06 A;  4C0D B;  1JB0 E;  3JCM X;  2ZCF B;  2AHJ B;  5FU7 B;  1M1K C;  4IUR A;  3HRU A;  1WQ7 A;  3VUB A;  5LJ3 h;  1UEB A;  1Y7X A;  3HKS A;  2RJE A;  4J5Y A;  3OYA A;  4M7D D;  1G3Y A;  4C0F A;  4KUL A;  3CMA A;  4HCC A;  1I8F A;  4HA8 A;  3LGL A;  3JRZ A;  4C5G A;  3HHT B;  4M7A C;  3LWH A;  1YJ9 A;  2RHX A;  2RHU A;  1PSF A;  3QPH A;  1M90 U;  3CC7 A;  3RMQ A;  4C0Z A;  1VQ5 A;  3OS5 A;  2EQK A;  5GAM e;  3L2W A;  3PT9 A;  3OSV A;  5HK0 A;  1QVP A;  2XG8 D;  4PLL A;  5CCA A;  2RHY A;  4OF1 A;  3JCM d;  3A8G B;  4HCB A;  3O8V A;  5CKE A;  4R55 A;  5FLX E;  3A5Z B;  3RES A;  1Y71 A;  4IUU A;  4JDS A;  2VV5 A;  4BB7 A;  3CCR A;  4BI8 B;  5LJ3 f;  2RJF A;  2PVO B;  2EJF A;  2K3Y A;  2LQ8 A;  5CO7 A;  4CRI A;  5LJ5 e;  3Q1J A;  3FB9 A;  1QVG S;  4N4H A;  2DKG A;  1V29 B;  4FSX A;  1VQO A;  4J6W A;  4C92 A;  4M75 D;  2JUF A;  2E1H A;  2XIC A;  5GAN 4;  3HFO A;  3V7C A;  3UWN A;  1JBM A;  4E7I A;  2X4W A;  3M59 A;  2V8J A;  1IRE B;  3LH0 A;  2DD4 A;  5DY9 A;  1QVF A;  2MF2 A;  2RK2 A;  1UGQ B;  3HSB A;  3HFN A;  1FWZ A;  2DXC A;  4JRI A;  1P92 A;  5GAN 8;  3OS1 A;  1LOJ A;  2KDS A;  3CCS T;  3X26 B;  4EMK C;  3JB9 J;  1VQ7 A;  3CC4 T;  2P4T A;  1RL2 A;  2R5A A;  2GCX A;  3EAE A;  2EQM A;  2KK4 A;  1H3Z A;  1VQ6 A;  3NFC A;  2XDP A;  2K5L A;  4F7U A;  5J39 A;  2QTX A;  3G6E T;  4E7L A;  1G3W A;  3I55 T;  4XTV A;  3A8M B;  3CPF A;  1VQN A;  5LL6 S;  2JN0 A;  4LD9 K;  1VQ8 T;  2OTJ T;  4ZTJ A;  4RMO A;  4M78 A;  2MAM A;  3L1A A;  1VQM A;  2F69 A;  1MGQ A;  1K8A C;  3S3O A;  3R6O A;  4J8O A;  4KBM B;  4C92 B;  2M1H A;  2X4X A;  3SDZ A;  4A4K A;  4RCC A;  2KVQ G;  2D6F A;  4PJO E;  5HY6 A;  2VUB A;  2X35 A;  2HQX A;  3I56 T;  2LRQ A;  3GF5 A;  4GLK A;  5GMK m;  2VXE A;  4M78 E;  1BYM A;  2RHZ A;  4M75 B;  2E5Q A;  4NL3 A;  2GFA A;  2RM4 A;  2RA2 A;  3T9N A;  3JCM J;  1M9S A;  3M56 A;  1YIT A;  4ELY C;  4V2S A;  4XK8 E;  4M7D G;  3QII A;  4OGE A;  3FDR A;  1U8R A;  2K5I A;  2QDY B;  1BI0 A;  4F7U B;  3CXC S;  1KQS A;  3OMC A;  3CC2 T;  3M55 A;  1Q81 C;  4M7A D;  3MEA A;  5I21 A;  2QQR A;  2XI9 A;  3GNG A;  4C8Q E;  4M78 F;  3GNF B;  3F70 A;  4HCZ A;  4X34 A;  4DOW A;  5A0G A;  1VQ4 A;  5CVI A;  5GAN f;  3PGG A;  3CD6 T;  2CKK A;  2EFI A;  3MP8 A;  5CR2 A;  5GAO l;  2PVG B;  2K4Y A;  1UGR B;  4ZN3 A;  3JCM b;  1SSF A;  1NE8 A;  2PQW A;  1IZ6 A;  4BE2 A;  1O75 A;  3LYI A;  1S72 A;  1MHN A;  2HBP A;  3HL8 A;  4C8Q F;  3CMA T;  1WJQ A;  4QVD A;  4PLI A;  1VQK A;  4JRK A;  1Q86 C;  1YJ9 T;  4JRP A;  3TU4 K;  2QQ9 A;  4JUV A;  1KD1 C;  1K9M C;  3CC7 T;  4P5N A;  3FRN A;  4QVZ A;  1VQ5 T;  1UGS B;  2DIG A;  2Y4Y A;  2K3X A;  5AYF A;  2EJG A;  1RI0 A;  2RJC A;  3CBM A;  2DTI A;  2JZ2 A;  2QQA A;  5FU6 C;  2PU9 B;  2VGN A;  2JVV A;  1BIA A;  3X20 B;  3CPW S;  2DXU A;  2XDB A;  2R5M A;  3ER0 A;  4C5E A;  3OA6 A;  3L2R A;  3OYC A;  3CCR T;  3M5A A;  4C5I A;  4Y28 E;  4L59 A;  4LDV A;  3JB9 G;  3BFM A;  1OI1 A;  2HD0 A;  2VXF A;  2EIF A;  2DZC A;  2OTL A;  2EQJ A;  3HRT A;  1VQO T;  4PJO C;  3NTH A;  2K57 A;  2E64 A;  3OQ5 A;  3VYG A;  3OMG A;  3ZBD A;  5DM7 R;  1VIF A;  3LWI A;  4E7H A;  5FRM A;  2LNV A;  4CI0 C;  5GAN g;  4MZT A;  3RKY A;  4MDX A;  1M1F A;  2LCL A;  2M16 A;  3BDU A;  2XID A;  3BW1 A;  4M77 A;  2CS7 A;  1OZ3 A;  2P0Q A;  3CCV A;  1VQ7 T;  4BUG A;  2FYK A;  4PJO G;  4N4I A;  3SD4 A;  3VV0 A;  4DQ2 A;  1VQ6 T;  2LVM A;  2BKD N;  5CKF A;  2QEX A;  3JCM W;  2WSE E;  2L3R A;  4M7D A;  2HQE A;  4J6Y A;  3OB9 A;  4L5G A;  4M77 E;  5C0M A;  1VIE A;  5KE3 A;  5GAM d;  4RKU E;  3S3M A;  5HK3 A;  2DK3 A;  2FL7 A;  3VJP A;  3E9F A;  1YJW A;  1VQM T;  4B9W A;  5J3B A;  2E10 A;  1WPY A;  1HK9 A;  5GAM j;  3CME T;  1QVF S;  1VQN T;  4M7A G;  5GAN 2;  2DD5 A;  2EYQ A;  5CKH A;  1GXI E;  2YHT A;  3L42 A;  4MDW A;  1JJ2 A;  3H8Z A;  4II1 A;  3RKX A;  2CZ6 B;  5LJ5 d;  4M7D E;  3OYG A;  4ZGJ B;  1W2B S;  2Y4X A;  4J83 A;  4M77 B;  2EQU A;  4M77 F;  4ZTF A;  4PL6 A;  1VQP A;  2K5F A;  3GLX A;  1N6A A;  3M54 A;  5DLO A;  3QXE B;  1FXX A;  5LJ5 j;  4ATO A;  4ME7 A;  1VQL A;  1YIT T;  4NL2 A;  1I81 A;  4RG8 A;  1NPP A;  3V7S A;  2L5Q A;  4M7D B;  1XTD A;  1ZHI A;  2F5T X;  2PVD B;  1BI2 A;  4OVA A;  3N5B B;  3G71 A;  5L8R E;  5D6X A;  2DTH A;  2H3J A;  4M75 A;  3WXM B;  1XQH A;  1Q7Y U;  2X4J A;  3SWN A;  2MWP A;  2YRV A;  4BI3 A;  4LDY A;  4C0D C;  1QVG A;  1VQ4 T;  2A3L A;  4PKC C;  3P8B B;  5FU7 C;  4GY5 A;  4C92 E;  2XDD A;  4WF2 A;  3JB9 D;  4XAX B;  3FLG A;  3GPL A;  3LX7 A;  3JCM h;  5IAY A;  2WAC A;  3OYL A;  5I2M A;  2FVU A;  5IN1 A;  2E6N A;  3QJY A;  3E1S A;  4LDU A;  1S72 T;  3PMI A;  5GAN d;  3V8K A;  2K2V A;  2E65 A;  4OB1 B;  4M75 E;  4O5V A;  2LQK A;  2ZGW A;  5KH6 A;  3OYM A;  2FB7 A;  2KSS A;  3S3N A;  1JRI A;  3M58 A;  5GAN e;  4TVR A;  3CCE A;  3RER A;  4C92 F;  5GAO r;  3P8D A;  1N9S A;  5GAN j;  4PJO D;  1YIJ A;  4ZN1 A;  2ZPE B;  4F7U E;  3VU3 C;  4NS5 A;  2RI2 A;  2RHI A;  2ZPF B;  1NPR A;  2MWO A;  1G5V A;  4JS4 A;  2F5K A;  1OZ2 A;  4XTW A;  4M75 F;  2BIV A;  1HXD A;  2X4Y A;  3BDL A;  2P0K A;  2BUD A;  4N0A C;  3SWN B;  4QVC A;  2JOY A;  5LJ3 g;  3OYI A;  2LX9 A;  2LCC A;  4PJO A;  2DJZ A;  4OB0 B;  5KCH A;  1OYX A;  3J80 E;  4HKE A;  2MI6 A;  3JCM f;  3AHU A;  4A54 A;  3NTI A;  4F7U F;  2M9U A;  3QZ5 B;  3OYE A;  5C6S A;  1K8A U;  1YCY A;  3ZEH A;  1WQW A;  3HRS A;  3CCL A;  2E41 A;  3G4S T;  5FRO A;  1KQS S;  3SB2 A;  2XHC A;  1KC8 U;  1K73 U;  2ZPG B;  4M7A A;  4XU2 A;  3FEO A;  3TRE A;  3QSU A;  1LJO A;  3CCV T;  3CCU A;  3UT1 A;  4E7K A;  3KBG A;  2VGM A;  3OYY A;  3QYH B;  1WJR A;  3QUI A;  1NJI C;  2QQB A;  4BY6 C;  4ELZ C;  3A8L B;  3ASK A;  2P0P A;  3DB4 A;  3OYB A;  3X25 B;  4HT9 A;  4PJO B;  1Q81 U;  3M4G A;  1VQ9 A;  2E70 A;  2QEX T;  3E19 A;  2OTL T;  5HKC A;  3JSC A;  5I2S A;  4C92 C;  1YJW T;  4XU3 A;  5CK9 A;  1Q82 C;  4ZGE B;  4KUD K;  1W4S A;  3PIP A;  3GP8 A;  2GQV A;  3RIR A;  1XOV A;  2A7Y A;  3CBP A;  2KQW A;  5GMK e;  4LD6 A;  4UC4 A;  4M7A B;  4XQ3 A;  3C94 A;  1O9S A;  1N8R U;  3PMT A;  4FIB A;  4IUT A;  2OTJ A;  5GMK j;  3CCQ A;  3JCM g;  1VQP T;  1M1G A;  2V8I A;  3J7A F;  4QQ6 A;  3JCM V;  4FT4 A;  5DLQ E;  2NLU A;  1YJN A;  2DEQ A;  2B8A A;  3EFS A;  3H6Z A;  4EMK A;  3OYF A;  1Q86 U;  4OP0 A;  2PUK B;  1VQL T;  1KD1 U;  1K9M U;  5LJ3 d;  3FC3 A;  4FU6 A;  4J7F A;  3LLR A;  4M78 C;  4XTY A;  3WVE B;  5LJ3 e;  2ZPH B;  4XTZ A;  3OW2 S;  5GAO m;  1FX7 A;  2JNG A;  4FM4 B;  5GAO p;  5GAO q;  3G71 T;  5LJ3 j;  3UPU A;  3M9Q A;  4E7J A;  1BKB A;  4J6X A;  4X9D A;  5GAN 5;  3CCJ A;  2XKO C;  2DIQ A;  3L2Z A;  4EMG A;  5IT9 E;  2QA4 A;  1I4K 1;  2EAY A;  2DXB A;  3TEE A;  4Q5W A;  2ZZD A;  2MMP A;  3MET A;  3OBW A;  3C95 A;  4M78 G;  4N4G A;  5GAO n;  3MEV A;  4C8Q C;  1QP3 A;  2IVW A;  3DKM A;  4QQD A;  4X9C A;  3CBO A;  3QYG B;  1M90 C;  2XU8 A;  3JCM Q;  2LC4 A;  1M4Z A;  2Y90 A;  4IUV A;  3HPW A;  5D6W A;  1KQ2 A;  1QW1 A;  4O6J A;  1WNL A;  4EMK B;  5GAN 7;  1WGS A;  1X75 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...