5GAN8

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
TLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 9
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan800
4M7DF 2DEQA 3JB9G 4C8QD 3AHUA 1U1SA 4F7UG 2E64A 3PGGA 1KQ1A 3QUIA 4M75E 4M77E 4M78A 5LJ3d 3JCMV 4C8QB 3JCMd 3RKXA 3V7CA 1TH7A 3HSBA 4M7AG 4PJOC 3FIFA 3QHSA 3SWNC 5LJ3h 4XU3A 3JCMh 4J6WA 2EAYA 5GAN3 4M7DC 1JRIA 1WPYA 2ZGWA 2VXEA 3V8JA 4C92F 2RB6A 4EMKA 2EWNA 1Y96A 5LJ5h 3L2ZA 1I8FA 5GAMd 3JCMJ 4M75G 4M77G 4N0AC 1I81A 3JCMP 4XU2A 4XTUA 5LJ3e 3JCMe 5GAMe 3QSUA 3RKWA 5GMKh 4MMKA 4PJOD 1M5Q1 4C92C 1WQ7A 5GAN5 1LNXA 5GAOm 4M7DG 5GMKm 1HK9A 4J6YA 4C8QG 5LJ3j 2YLCA 3EFRA 2DZCA 5GANh 5GAMj 5GANe 2EJ9A 5GAMf 4V2SA 3INZA 3HFOA 4F7UF 5GAOn 2RA2A 1WNLA 1HXDA 1YCYA 2E10A 1B34A 2RM4A 1JBMA 4XQ3A 3FB9A 5GAN2 1H641 4C92G 2E1HA 3BDUA 5GMKe 3RERA 4J6XA 5GAOr 2DTHA 5I21A 5GANj 4JLIA 1BIAA 3RUXA 2CGHA 1B34B 5GAN4 1D3BB 2YLBA 5GAOl 3JCMQ 4PJOE 2DTIA 4M78D 4A54A 1LJOA 2DVEA 4NL3A 2Y90A 4M78C 1N9RA 4C92D 3JCMX 5GANd 1KQ2A 1U1TA 4NL2A 4M7AC 3M4GA 5GANg 2HNIA 4HA8A 4C8QF 3BFMA 4PJOG 3RIRA 3JCMW 2DKGA 5GAN8 3GIBA 4PJOA 3SWNA 2I2LA 3JB9H 4OP0A 2DTOA 4DQ2A 4JRKA 4XTYA 4M77D 4M75D 3V7RA 3L1AA 5DY9A 4F7UA 1Y96B 4M75C 4M77C 4RCBA 3JCMg 2E65A 5LJ3g 4M7DD 2DJZA 3BY7A 4M75F 4M77F 3JB9J 4XU0A 4X9CA 5GANf 4QVDA 4M7AD 1WQWA 5LJ5d 2JN0A 3JCMc 3RESA 4F7UE 4F7UB 5GMKj 1MGQA 4M7AF 3FJPA 4X9DA 1LOJA 3JB9D 3EFSA 5GAOp 4M7AA 2E41A 4RCCA 4M78F 2DZ9A 1D3BA 2EJGA 3JCMb 1N9SA 4WF2A 5GAMh 3V7SA 4XTXA 5GAN6 2VC8A 2K57A 3RKYA 4M78B 4NOYA 4EMKC 5GMKl 4PJOF 1M8VA 2DXTA 4M7AB 2EJFA 5LJ5e 3QO3A 4C92A 3BW1A 5LJ3f 3JCMf 4A53A 4HT8A 4M7AE 3V8LA 3V8KA 4EMGA 1BIBA 4J5YA 4N0AA 4PNOA 4M7DB 1I4K1 2DXUA 5LJ5j 4JUVA 4M75B 4M77B 5LJ5f 3VU3C 4MMLA 3JB9I 4C8QC 4M7DA 4C8QE 1X01A 4Y91A 4C92E 4PJOB 2FYKA 3SWNB 2FB7A 4XTVA 5GAN7 2QTXA 4HT9A 4M78G 3JB9F 4EMHA 4C92B 1I5LA 4M77A 4M75A 5GAMg 4M78E 4JRIA 5GMKi 5GAOq 3SB2A 2VXFA 5CAIA 4XTZA 5LJ5g 3HFNA 2YHTA 4XU1A 4M7DE 4C8QA 4EMKB 4XTWA 2RD1A 4QVCA
chains in the Genus database with same CATH superfamily
3CEYA 1U1SA 1FXXA 5LJ3d 3JCMV 4M78A 4DOWA 3CCJT 4PJOC 4ATOA 4KGVB 1BK2A 1PSEA 1ZUKA 3V8JA 3G7ZA 5LJ5h 2CH4A 1RL2A 1AHJB 2QQSA 1X27A 1WHGA 2A36A 3CMEA 2O01E 4QQDA 3CPWS 1CKBA 1UFFA 3EFRA 3J80E 5C0MA 1WJRA 2XD0A 1MUZA 5KE3A 1OULA 1HXDA 1NBEB 1YCYA 4Q5WA 4XQ3A 2KROA 4EIKA 2DL5A 1KQSS 2JT4A 1CKAA 2FG0A 4J7IA 2OAWA 2PVGB 2LVMA 2FL7A 3OSVA 2D8JA 3OYIA 1C0MA 1D0YA 2YWWA 4IURA 3RIRA 3OYDA 4BI4A 3JB9H 4EDUA 3V7RA 2IVWA 1QW1A 1FYNA 4M75F 5A0GA 3PE0A 5KYYB 2J6FA 1VQ6T 3THKA 5GJVB 2CP6A 4BB7A 2LQ8A 1YI2Q 1UDLA 1K73C 2DO3A 2KXCA 5EC7A 4C0FA 2PVDB 4ZTFA 3OYGA 3EGDA 3BE3A 3CCQA 1B7TA 1Q82U 1M3CA 4LD6A 1YWOA 4UC4A 3PIPA 4B6MA 1QVGS 2FHDA 3QXEB 1YI2T 2DD4A 3GNGA 4FL6A 2Y4XA 4HT9A 3M56A 1K8AR 3LW5E 3MP1A 2DXCA 3TQ7P 3M0PA 1VYUA 2DPPB 2VXFA 3UPUA 4XU1A 2ROLA 1BKBA 3SDZA 4XTWA 2HZYA 4DA4A 2PVOB 4DBQA 2RHZA 4F7UG 1BU1A 3ZL7C 3FDRA 3OBWA 5GAN3 4PL6A 5D7UA 1KQSA 1QCNA 1Q82R 1AOJA 3L2ZA 5GAMd 1NJIC 2R57A 3JCMP 3GNFB 2F1LA 2DX1A 2M16A 4MMKA 4OVAA 1IXDA 1BCMA 4VUBA 1WZOA 4EPCA 3OY9A 5GAMj 2L89A 4F7UF 1WNLA 2ZPHB 3CCSA 4C92G 3QBYA 3QPHA 5GAN4 1ZA1B 2EGCA 2EQKA 2Z0WA 3A8OB 5A0LA 2LMJA 1KHCA 2PZ1A 3GIBA 2DIGA 3A1PA 1AWJA 4PJOA 4M77D 4M7DD 4Y28E 3CCEQ 3RNJA 2LX7A 2V26A 3LLRA 2V1QA 2ZZDA 3QKJA 3JCMc 3WXMB 1RAGB 4OB1B 2M51A 1O75A 1GRIA 2QEXT 4BE0A 4X1VA 1Y07A 2CZ1B 1GFCA 2EJFA 3CCLQ 4LE9A 1C1AA 5IT9E 3WVDB 2J7IA 4ESRA 1M27C 4J5YA 3X20B 4ANJA 2C0TA 3NTIA 4C8QE 3TSZA 2GFAA 1JJ2A 4PJJA 5GAOq 2EFIA 3I5RA 3CQTA 2JS0A 1DJ7B 2PNIA 4KH0B 2JUFA 1B07A 3RR6A 2KNBB 2DF6A 3PGGA 3QUIA 4M77E 4BD3A 1U8RA 1VQ4A 2OTJQ 1VQPT 2V8IA 3QHSA 4FSXA 1N8RC 4IUTA 5FU7C 2VXEA 3QZ5B 2DE0X 3QYHB 3UATA 1OOTA 1M90U 3Q1JA 1JEGA 1I81A 4QQ6A 4HKEA 2GTOA 1UE9A 1WQ7A 5J26A 1PWTA 2Y4YA 2HQHA 1D1AA 2EJ9A 1BCOA 2JTMA 1N6AA 1N8RU 2GCXA 2YUOA 4PK4A 4A54A 1WHJA 2RQVA 2Y90A 2AK5A 2X4YA 3EGDB 2E4HA 4PFPA 4ELYC 2K5IA 1IREB 5IHIA 1TOVA 2NLUA 1R77A 4A4FA 4J9CA 2GBQA 1EFNA 3C12A 5LJ3g 4RTUA 4QKUA 1FMVA 1NPRA 1PG5B 4ORZA 1VQNT 1AT1B 1LVKA 1LOJA 2DL4A 4PFZA 4LN2A 2DRMA 2KT8A 3LH5A 2DZ9A 3TU4K 4C5EA 2QDLA 4EMKC 3RKYA 4M78B 3VS5A 4LDXA 1JJ2P 5LJ5e 1KIKA 2EGAA 1X69A 2O31A 3OYJA 3OBYA 3EG3A 1VQNQ 3MP8A 3VU3C 1YP5A 3H41A 2FYKA 4C5IA 2EYXA 3M59A 2JNGA 1RAHB 5EG2A 5GMKi 3SB2A 1YJNA 1G5VA 5CKFA 5CAIA 2QEXA 4ME7A 4E7ZA 2NUTB 4M7DE 3G71T 3A98A 1VIEA 2RD1A 2QGGA 1IGQA 2H3EB 4J9HA 4BY6C 4ZGEB 3I55Q 4F16A 3SWNC 2J6OA 2JJ9A 4D6WA 1JXOA 1Q86C 1TWBA 2H8HA 4R56A 3VS7A 4FYWB 3JCMe 1UGVA 2P0QA 5IHNA 3NTKA 3OA6A 2YLCA 3MHXA 4OMMA 2QQRA 2RA2A 2RJEA 3HTRA 4LXCA 1Y57A 1Q7YR 3L2RA 3CMAQ 2LT4A 4J6XA 1UB4A 1VIFA 5D6XA 2G3RA 3REAB 2V1RA 4NL3A 5I2MA 1M2VA 4CI0C 3S3OA 1R0BG 1K9MR 1WHLA 1KC8C 2OJ2A 1SRMA 2DKGA 3KUFA 5KYYA 2HMAA 3QYGB 2CKKA 5HK0A 4J9GA 3X25B 3G6EA 4PLLA 2LQKA 2RNAA 2DJZA 2CH4W 2F2WA 1NEGA 2CZ6B 2VWFA 4F14A 1VQMA 2ZAEA 1QWEA 3EFSA 5GAOp 3G4ST 1KQSP 2K3YA 3G4SQ 2KYMA 4OMOA 5GAMh 3JRZA 3LYIA 4PKCC 1BYMA 3HPWA 4LDYA 2BZXA 1TG0A 4PJNA 3HKSA 1TUCA 2JS2A 3MEUA 1ZSZB 2GNCA 1YIJA 3QJ6A 3CCQQ 2FB7A 4RTTA 2PUOB 1YI2A 1VQKQ 3I55A 4JJBA 4JRIA 1YITT 2CP0A 3CCVQ 1OZ3A 1X6BA 4BACA 3EAEA 4DEYA 1K73R 2CZ0B 2P4TA 3P8DA 2E70A 5IH2A 1N27A 3FIFA 2C0OA 3KFVA 4M7DC 2D1XA 2K2MA 3MO8A 3S6WA 1T3SA 3H0IA 4C0DB 1Y96A 2AT1B 2AIRB 2LDMA 4J8OA 1E6HA 4FU6A 4OMLA 5GAN5 1WFWA 5KYUA 2XMFA 2DZCA 1YJNT 1T3LA 1M30A 3HFOA 2ED1A 2FPEA 1YCSB 1TS9A 1G3TA 3OS2A 2SRCA 2C06A 1IGUA 1MV0B 2YLBA 4PJOE 2GFUA 1VQOQ 2M9UA 1IB8A 2K2VA 1C6VX 1VQMT 2KQWA 1VQ5A 2J05A 2C0IA 2QGFB 4HA8A 1D1BA 1QP2A 3CBPA 2SEMA 2RI3A 1U5SA 4OP0A 3M58A 1BI0A 3EG1A 4J9DA 3C4SA 2E65A 2XICA 3P8HA 4PJLA 1MHNA 5IXBA 2YRDA 2HQEA 4F7UE 4M7AF 2KSSA 3C0CA 3E19A 4M78F 2NUTA 1VQ8T 1K4US 1KG1A 1IO6A 5IHKA 3OYLA 1M1KU 2V8JA 1O9SA 2EYWA 4FYXB 1QWFA 1X2KA 4N0AA 1TSFA 1VA7A 5LJ5j 4HXJA 3PTAA 2CT4A 1OV3A 2QK0A 3M9QA 5CO7A 2A28A 4J7FA 1X01A 1VQPA 4C92E 3VJPA 2HL3A 4M78G 3PVLA 2FVUA 4M77A 1NEBA 1G83A 4JDSA 2MYSA 4AFUC 1AWXA 1YJWA 1ZLMA 2JM9A 4FM4B 4IUUA 2E64A 1D0XA 2RK2A 3HSBA 2PTKA 2WSCE 1YWPA 7AT1B 3VUBA 2VKNA 4Z8AA 4A4GA 4XAXB 2K3BA 1QQJA 3NFCA 2CT3A 4M77G 4AFZC 2HSEB 4R55A 1VQ7Q 1D09B 2FO0A 3CCRQ 1VQ7T 2LX9A 1V1CA 2JW4A 3CCMT 4E7SA 2LNVA 1H3HA 4BY6B 4AT1B 1OPLA 5KYXB 4IUPA 3OYBA 3VS0A 3FB9A 5A0DA 1WXBA 2DTHA 5IN1A 2JZ2A 2K79A 1Q86R 3CC7Q 2E6NA 2XK0A 1QVFS 2DBKA 3EG9A 1WHHA 1WXUA 4RG2A 1BI2A 1WJSA 4C0ZA 2RH2A 3I55T 5HK3A 1Z9QA 3OS0A 2DBMA 2DTOA 3NTHA 2EKOA 1WA7A 2GTJA 1S72A 3HRSA 2COZA 3CPWP 4RTZA 2A7YA 4Y92A 2EQUA 4B9XA 5FRNA 2EVRA 3R6OA 2ZPEB 3M0RA 2KRSA 5CR2A 4A4EA 1S72Q 3V7SA 4NOYA 2MOXA 3TVTA 4B9WA 2ZPBB 3G1JA 4M7AE 3OMCA 2MCNA 1EIFA 3V8KA 1M90R 3BDLA 1JQQA 4JUVA 1A0NB 5D6WA 1VQOA 1PD1A 2L3PA 1ZBXA 2YT6A 4LNPA 4Y91A 2KK4A 3QZ9B 4JRPA 2VGMA 4JPBW 4JS4A 4M78E 3VS1A 9ATCB 1KC8R 2KXDA 4E7KA 5LJ5g 4N4GA 4HVUA 2E12A 1M9SA 2ROTA 3I5SA 1OQKA 1HSQA 1JXMA 1HD3A 1HJDA 4IIMA 2DD5A 1ZX6A 3H0HA 2KRMA 2A37A 2X3XD 1M1KC 4QW2A 4HCCA 1QVGP 3OYHA 1ZSZC 2HAXA 2EWNA 3TREA 3M57A 3SEMA 1TTHB 3JAME 1YHQA 4XU2A 1OYXA 2ZPFB 3QSUA 4GBQA 5GMKh 5FU6B 1NE8A 4C92C 2VV5A 2JOYA 4GLKA 1VQ8A 4C5GA 3OS5A 4GY5A 2DXBA 3MJXA 2RHYA 2KRNA 3MEAA 2HEQA 5KH6A 3RUXA 3QJYA 2OI3A 1PHTA 4M78D 1VQ6A 2QA4T 2VGNA 2FPDA 4KBMB 4HVVA 3CCLA 1G8XA 2R5MA 2D0QB 4PJOG 1Z9ZA 2HBWA 3SWNA 1WDXA 3PFSA 2EBPA 2RHUA 3CD6A 2P4RA 1MMAA 1UTIA 3META 4PFOA 2W10A 1QVGA 2ABLA 2E41A 2DM1A 2RJCA 4FIBA 4XTXA 2K57A 3L2UA 5AT1B 2RO0A 3CBOA 3CMET 2O88A 4ZTJA 3GBQA 1ABOA 4M75B 1X43A 1JU5C 3VS2A 3SWNB 1M1GA 3J7AF 3AT1B 4EMHA 3KXTA 2FRWA 2XDDA 3EGXB 3HFNA 2QTVA 3JCMJ 1QKXA 2OTLA 2L0AA 2QQAA 2LCSA 3DB3A 2DL3A 2QDYB 3JCMd 3OYYA 2RI2A 2GQVA 1D0ZA 4XU3A 2EQIA 2FEIA 1JRIA 2KE9A 1K0XA 3RBBB 4OGEA 4XTUA 2HBPA 2NWMA 1KD1R 2F2XA 4K11A 3UF4A 5GMKm 4QQGA 3CD6Q 1HYOA 3URGA 5GAMf 1RACB 2CSIA 2E10A 3L2QA 2KVQG 2E1HA 2ZPIB 5GANj 3CMEQ 2D0NA 1UG1A 3DB4A 3JCMQ 2LCCA 4QT7A 1ZSGA 1VQ6Q 1JJ2S 1VYVA 2RPNA 1N8RR 5KYXA 2JVVA 2P0PA 4LDVA 1WX6A 2EYQA 1Y96B 4M77C 1VQOT 1GCQC 4FT4A 2EW3A 4RKUE 2WACA 1WHKA 1AZEA 2FZKB 1MMNA 4RTXA 1YJNQ 3T9NA 2PUKB 4PJOF 4OF1A 4C92A 5KCHA 3CCLT 4HT8A 2B86A 1YJ9Q 2CP5A 2DILA 1BIBA 3CXCA 2QQBA 5KCOA 1W2BP 4RMOA 1VQNA 4MMLA 1GXIE 2LJ0A 1BI1A 1V76A 4C0DC 4D8KA 4J9IA 3QDRB 4WCIA 3R6NA 1RAIB 1VOMA 1XOVA 3RKWA 4L6V5 4M7DF 1AWWA 1KQ1A 5LL6S 3OW2A 3H8ZA 1MNDA 3UA7A 3CPFA 2LC4A 1XJWB 1GBQA 2HCKA 4N0AC 3LGLA 4TVRA 2L8DA 4ZN3A 2CP2A 2DVJA 3VUZA 3CCMQ 1PM3A 3H0FA 2VB6A 2LCLA 2HL5C 3FLGA 4J9BA 2G6FX 2D6FA 1B34A 1OX8A 2K5FA 3BDUA 4C0GA 5GAOl 1NG2A 2IIMA 3EGUA 1VQ4T 1N9RA 3S3NA 2MWOA 4NL2A 2L3SA 1ZSZA 5HKCA 5M9OA 3CCJQ 1OU8A 1VQ9T 1RAFB 3OB9A 3VKIA 3L1AA 4M77F 3JB9J 2WSFE 1WHMA 1R8OB 4E6RA 5GANf 2E3IA 4KULA 2QA4Q 1RI0A 1TUDA 4M7AA 4KGXB 2DA9A 1K8AC 3HHTB 1M3BA 4F04B 1VQLA 4BDYA 1M8VA 1AZGB 4M7AB 1GFDA 4Z02A 2GGRA 5LJ3f 4E7HA 4RG8A 3OS1A 3UA6A 1WIEA 2DXUA 2BE7D 2YUQA 4DEXA 2MMPA 3CXCP 3CCRT 4M7DA 2AKLA 2RK1A 3JB9F 1VQPQ 4M4ZA 3LX7A 1UUEA 1Q86U 3D7SB 3VYGA 4FW1A 8AT1B 1GBRA 2NYSA 2YUPA 1SRLA 2DIQA 3G71A 1TU0B 4JS5A 4PLIA 1QP3A 3CCUQ 3EH1A 5CIUA 4M7AG 3OYAA 4J9EA 5DLOA 2DNUA 4O5VA 2RN8A 4EMKA 1VYTA 2CYZB 4FYYB 2JMAA 3TCJA 4JRQA 2RQWA 1VQ5Q 1RI9A 1K76A 3EG0A 2EQMA 4IUQA 4J6YA 4JZ3A 2E5KA 4QVZA 4JLGA 2DL8A 4IUVA 5CQXA 1M4ZA 3CCRA 4JLIA 2CGHA 2KEAA 2YRVA 1K9AA 5FRMA 2QI2A 4OMNA 4OB3B 3PT9A 4MZMA 2J06A 4CC7A 1UJ0A 1YJWT 3I56A 4OMFB 3CCSQ 1VQLQ 4KUDK 1VQLT 4JRKA 4V2SA 4M75D 3MKDA 5L23A 3JCMg 1R0CB 1MV3A 4RTWA 4XU0A 2CS7A 3REBB 3LWIA 3OYKA 2MI6A 5LJ5d 3A5ZB 2YSQA 4BE2A 2H3JA 3ASKA 3QO3A 2DYBA 4KUIA 3JCMf 2L5QA 2EQJA 2A0FB 4LDWA 4ZGDB 5GAN7 2LJ3A 3PMTA 4C92B 1M90C 3EHQA 3DLMA 1QVFA 1MMGA 3ER0A 3N5BB 4FSSA 3SFMA 2PQWA 2RMOA 4M75E 1YHQQ 1SKUB 3RKXA 2KDSA 2ENMA 2KT1A 3CCVT 1JB0E 1I8FA 2QQ9A 2YDLA 5LJ3e 2HKQB 4JJCA 3HRTA 2E6ZA 3CD6T 1D1CA 4C8QG 1YITA 2QEXQ 2MF2A 4E7IA 1AD5A 2V8KA 1BBZA 1GCPA 3M54A 1H641 4MDWA 3RERA 2I0NA 4ZN1A 1YIJT 2EGEA 4N4HA 2BE9B 1RADB 2X9HA 2DYIA 2DTIA 5HY6A 1LJOA 2DVEA 3S3MA 1YN8A 4C92D 4D8DA 3O8VA 3LGFA 2P84A 1FMWA 4FYVB 1VQKA 1XQHA 5GAN8 2I2LA 2KBTA 1VUBA 4F7UA 4CRIA 1NM7A 1M3AA 2X4JA 1X75C 3OYNA 1YIJQ 2RQUA 1XTDA 2LT1A 1NYGA 4PJMA 2MK5A 2EJGA 3JCMb 4HCKA 3G6ET 4NS5A 1M8MA 1SSHA 4A53A 3V8LA 1ZUYA 4PNOA 3L42A 1I4K1 3M4YA 3CCUA 2MWPA 5LJ5f 1IRXA 1OI1A 4X34A 1W1FA 4AMCA 5J39A 1X2QA 3CC7A 1KD1U 2ECZA 5AYFA 2RQTA 1KJWA 2R58A 1NJIU 2HQXA 4JJDA 2YRCA 4XTZA 2EIFA 3OSSC 3X28B 4ZNXA 2VUBA 2LTOA 2DEQA 2JTEA 4C8QD 2O2OA 4DBFA 4AG2C 1I1JA 2CUBA 1BI3A 2K4YA 3JCMh 1ARKA 2EAYA 3UDCA 1I07A 2RB6A 2F5TX 1MNEA 1H92A 2AZSA 3TEEA 1SEMA 2OTLQ 2OTLT 3OMGA 5LJ3j 3VRZA 5GANe 5D6YA 5GAOr 2HSPA 4Z89A 3G71Q 4M78C 2YXYA 1S1NA 1SHFA 1FWZA 2EYZA 3WVEB 1PCXA 4M7AC 3HP9A 1U06A 1VQ9Q 3NGPA 2P0KA 3OYFA 2RQRA 2L3RA 4RCBA 1QMCA 1EZZB 2CREA 2D9TA 2ESWA 4FW2A 4RTYA 5CCAA 4QVDA 1H3ZA 3FRNA 4M7AD 1WQWA 2FZCB 4GLMA 3FJPA 2KGTA 3M0SA 1ZA2B 3GPLA 2CUDA 2OTJA 3CMAT 2DFUA 2R5AA 4DOVA 4EMGA 1OU9A 1RAAB 4FCYA 4C8QC 3ZBDA 4LD9K 4PJOB 2QXFA 3X24B 4XTVA 2RI5A 2J6KA 5IAYA 4C8QA 1YJWQ 5GAN2 5FU6C 5FW9A 5FROA 2QG9B 5LJ3h 1KHIA 2KMTA 3DKMA 2ATCB 3CPWA 1QLYA 5KYWB 1NLPC 2BIVA 2A3LA 3I9QA 4R0KA 2LJ1A 3H6ZA 3CXCS 1VQ9A 1BB9A 2XG8D 3LH0A 1VQ5T 3ME9A 3E2UA 2MIOA 3A8LB 1G3SA 1V29B 1FMKA 2OTJT 3OYMA 1K9MC 2D8HA 1NYFA 1UGPB 2ZPGB 3JSCA 5GMKe 1WYXA 2AHJB 5I21A 4E47A 2GF7A 2VVKA 1M2OA 4OMPA 1D3BB 1JO8A 2HKNA 3CCUT 5FU7B 3PNWC 1OZ2A 4E7LA 1AWOA 3JCMX 1KQ2A 3M4GA 1LPLA 1PRLC 1Q7YC 4OB2B 3BFMA 2EYYA 5KE2A 1SHGA 3X26B 2DK3A 5DY9A 4LUDA 1UHFA 3EH2A 4A4HA 1UGQB 4HCZA 3VS4A 1OPKA 2F69A 3A8MB 4KT0E 3GF5A 2DMOA 3P8BB 3RESA 5GMKj 1YJ9A 1MGQA 4X9DA 3CCQT 4OGCA 1W6XA 1N9SA 1ZHIA 4WF2A 3OW2P 5GMKl 2DL7A 4N4IA 4CC3A 2BKDN 1PKTA 2EKHA 1NZ9A 1XNIA 5FLXE 5I11A 3CCET 2X3WD 2VYTA 3CCVA 3MCAB 3QDFA 4J9FA 2XU8A 3JB9I 1GL5A 1M2VB 1UECA 2JTFA 2L2PA 1WGSA 3UWNA 1WLPB 3CCST 2CP7A 2X4WA 3E9FA 3RMQA 4M75A 3O5ZA 4BI3A 3J81E 1W2BA 1Q81C 4AFQC 5I22A 3FC3A 2NUPB 3F70A 5KYWA 2RJDA 4DBRA 1NJIR 2F2VA 4OB0B 2NUPA 3EGXA 1QCFA 1WPYA 1M1KR 5C6SA 2X35A 3QIIA 2PU9B 4M75G 4YTLA 1E7OA 3C95A 3E1SA 2OX7A 5J3BA 4A4KA 3EHRA 4PJOD 2LNHB 5ECAA 1K8AU 1IHVA 3NMZC 3KBGA 3G6EQ 3INZA 4BE1A 1PNJA 3HRUA 4CC4B 5CVIA 3VS6A 1I5OB 2NUZA 1JBMA 2E3HA 1ABQA 1BIAA 3MP6A 1T0HA 3PMIA 5DLQE 3MPUB 2RHXA 1AEYA 1YNZA 1TXQA 5GANd 5GANg 1RABB 4C8QF 1NLOC 3DLLA 2DERA 2KYBA 4DQ2A 5GAMg 1YITQ 5CKDA 1VQKT 1KC8U 1ACMB 2DETA 2RJFA 3JV3A 4LDUA 2WSEE 4J83A 2JN0A 1M1FA 1PKSA 2XHCA 1SPKA 1D3BA 3MEVA 2A08A 3QG1A 2XIDA 3CMAA 3VS3A 5GAN6 2VC8A 4LUEA 1YFNA 4BUGA 2XDPA 1OEBA 1F1BB 3I56T 3BW1A 3M0UA 2M0OA 3EFOB 1UGSB 2LP5A 4ZGJB 1UEBA 4ELZC 3PIOA 2KI7A 1SG5A 1RLQC 3QWYA 1G3YA 1ZQ1A 2IPOB 4IKFA 1PC0A 1QCOA 1I5LA 2K6DA 2MPXC 1KFZA 1W4SA 1B3QA 4DBHA 1UHCA 4C5HA 1YBYA 2YHTA 3OW2S 4II1A 2LRQA 3CC2A 3L2WA 3JB9G 3ZEHA 4HCBA 4C8QB 2JXBA 2DJQA 1RAEB 1I0CA 1ZUUA 1TUGB 3L2VA 5A2QE 2BZ8A 3NHNA 4FT2A 2K5LA 3M53A 5FWCA 2O9VA 3I56Q 1Q95G 1M5Q1 5L8RE 5GAOm 2ED0A 1PD0A 2QA4A 3OQ5A 2E5QA 3UT1A 1K9MU 5CKEA 1VQ8Q 1E6GA 2RM4A 2XKOC 1YJ9T 2O4XA 3ULRB 4JZ4A 1FX7A 3EG2A 3CCJA 3CBMA 5CQYA 5IXFA 5KYUB 3RDVA 1H8KA 1U1TA 2CSQA 2DLPA 3FEOA 2HNIA 2O4XB 2JM8A 4F17A 1J3TA 2M1HA 1KD1C 1YHQT 1P92A 4WTOB 1K1ZA 3CC4A 2B8AA 2VASA 3OYEA 4L5GA 2HD0A 2KR3A 4Z88A 3H9NA 3CC7T 2COYA 3VRYA 2QYZA 4X9CA 2LQNA 1VQMQ 1RLPC 2GQIA 2F5KA 1SSFA 4F7UB 2AKKA 1RUWA 1WXTA 4OMQA 2CDTA 2K3XA 4P5NA 1QVFP 4MDXA 2YUNA 3C94A 5DM7R 2DXTA 1AVZC 1T0JA 1Q82C 2CZ7B 1X6GA 1ZBJA 2QASA 1MMDA 1GCQA 2MAMA 3PVQA 3I35A 1Q81R 4M7DB 3SD4A 3GLXA 4AG1C 4M77B 3A8GB 1U3OA 2RHIA 1K73U 1UGRB 4HVWA 5CK9A 4A63B 1PRMC 2BTTA 3MEWA 1VQ4Q 2COWA 3EFOA 4KH1B 5I2SA 1NPPA 2XDBA 4QVCA 4RUGA 2K7AA 3AHUA 2DEUA 3V7CA 3FJ5A 1TH7A 6AT1B 1WI7A 2O9SA 4J6WA 2ZGWA 1W2BS 4C92F 2KAFA 2QAZA 5CKHA 1Q81U 2W0ZA 4BDZA 2XI9A 1Y7XA 5GAMe 1X6OA 3M0QA 3CCEA 4M7DG 1WJQA 1LNXA 1HK9A 1S72T 2K9GA 4IIOA 1OX9A 2BZYA 5GANh 3RMSA 5HCKA 2JMCA 8ATCB 5GAOn 2CP3A 1KSWA 2X4XA 4RTVA 2HDAA 1PSFA 3VYHB 2L3QA 1B34B 2DRKA 5FWBA 3CC4Q 1KK7A 3CC2T 4KRTA 3GOXA 2FZGB 3CCMA 1G3WA 1VQ7A 4AFSC 5CKBA 2AZVA 2FPFA 2OAUA 3JCMW 3E9GA 2LQWA 3M55A 1QKWA 1UJYA 3GP8A 4XTYA 3LWHA 3U23A 1N5ZA 4M75C 4MZTA 4XK8E 3BY7A 1G2BA 3A8HB 3G4SA 4CC2A 2KY9A 5GJWB 2BUDA 4BI8B 2IG0A 3OYCA 3CC2Q 4L59A 1Y71A 3JB9D 1Q7YU 4E2FB 1LCKA 4RCCA 1SF9A 1IHWA 3M0TA 3HL8A 2X51A 4JJNK 3EG9B 3TSWA 2DAQA 2M02A 3QWXX 3IQLA 1K0SA 1W70A 1CSKA 3M5AA 2M0YA 1Y0MA 4KGZB 2ZCFB 4E7JA 4MZPA 2RF0A 2QTXA 1EX4A 4O6JA 3VV0A 5KYNA 3NPFA 3ZFJA 1IZ6A 3CC4T 1QVPA 2FRYA 4EMKB 2EPDA 2LZ6B 3SHWA
chains in the Genus database with same CATH topology
4M7DF 2P4TA 3CEYA 1U1SA 1FXXA 2E70A 3P8DA 1KQ1A 1N27A 5LJ3d 4M78A 5LL6S 3JCMV 4DOWA 5FROA 3CCJT 3H8ZA 3OW2A 4PJOC 4ATOA 3FIFA 5LJ3h 1KHIA 2KMTA 4M7DC 3DKMA 3MO8A 1PSEA 3CPFA 2LC4A 3S6WA 3CPWA 3V8JA 3G7ZA 4C0DB 2BIVA 2A3LA 1Y96A 5LJ5h 1RL2A 1AHJB 3H6ZA 2LDMA 3LGLA 4N0AC 4J8OA 4TVRA 3CXCS 2QQSA 1VQ9A 2L8DA 4FU6A 4ZN3A 2XG8D 3VUZA 5GAN5 3CMEA 2O01E 3LH0A 4QQDA 3CPWS 1VQ5T 2LCLA 3ME9A 3FLGA 2DZCA 3EFRA 1YJNT 3J80E 5C0MA 1WJRA 2XD0A 3HFOA 3A8LB 2D6FA 1G3SA 1V29B 5KE3A 1HXDA 1YCYA 1B34A 2OTJT 3OYMA 1K9MC 4Q5WA 4XQ3A 1UGPB 2ZPGB 1G3TA 3JSCA 3OS2A 2K5FA 5GMKe 3BDUA 2AHJB 5I21A 4E47A 4C0GA 1KQSS 2C06A 2GF7A 1D3BB 2YLBA 5GAOl 4PJOE 2GFUA 1VQ4T 4J7IA 2PVGB 3CCUT 2M9UA 5FU7B 2LVMA 1OZ2A 2K2VA 1N9RA 3PNWC 4E7LA 2FL7A 2KQWA 2MWOA 3OSVA 3JCMX 3S3NA 4NL2A 1VQ5A 1KQ2A 3M4GA 3OYIA 4HA8A 1Q7YC 5HKCA 4OB2B 3BFMA 5M9OA 5KE2A 4IURA 1QP2A 3CBPA 3RIRA 3X26B 3OYDA 1VQ9T 3OB9A 2RI3A 2DK3A 3VKIA 4BI4A 3JB9H 4OP0A 4EDUA 3M58A 3V7RA 1BI0A 3L1AA 5DY9A 3C4SA 2E65A 1QW1A 2IVWA 2XICA 4M75F 4M77F 5A0GA 3JB9J 3P8HA 4A4HA 1VQ6T 1UGQB 2WSFE 4HCZA 1MHNA 1R8OB 5GANf 2F69A 3A8MB 4KT0E 3GF5A 4KULA 2HQEA 3P8BB 3RESA 1RI0A 4F7UE 4BB7A 5GMKj 1MGQA 2LQ8A 2KSSA 4X9DA 1YJ9A 1K73C 4M7AA 4M7AF 2DO3A 3E19A 4OGCA 3CCQT 1K8AC 4M78F 4C0FA 1N9SA 1ZHIA 3HHTB 4WF2A 2PVDB 5GMKl 1VQ8T 4ZTFA 4BDYA 3OYGA 1VQLA 4N4IA 1KG1A 3OYLA 1M1KU 2V8JA 1O9SA 2BKDN 1M8VA 4M7AB 1NZ9A 1XNIA 4Z02A 3CCQA 1Q82U 5LJ3f 4LD6A 5FLXE 4E7HA 4UC4A 4RG8A 4N0AA 3OS1A 3PIPA 3CCET 2DXUA 5LJ5j 1QVGS 2VYTA 3CCVA 3MCAB 2FHDA 2XU8A 3M9QA 3QXEB 3JB9I 3PTAA 5CO7A 1YI2T 2DD4A 2JTFA 2MMPA 1WGSA 3CCRT 4M7DA 3GNGA 1X01A 4FL6A 4J7FA 2Y4XA 4C92E 3UWNA 1VQPA 3VJPA 4HT9A 3CCST 2RK1A 3M56A 3LW5E 4M78G 3JB9F 2FVUA 2X4WA 3E9FA 3RMQA 4M77A 3MP1A 4M75A 4BI3A 2DXCA 3J81E 1W2BA 1Q81C 2DPPB 3LX7A 2VXFA 4JDSA 3UPUA 1Q86U 3FC3A 3VYGA 3F70A 4XU1A 1BKBA 3SDZA 4XTWA 2RJDA 1YJWA 4DA4A 2DIQA 3G71A 4FM4B 2PVOB 4IUUA 4JS5A 4PLIA 1QP3A 2RHZA 4F7UG 2E64A 4OB0B 2RK2A 5CIUA 3HSBA 3FDRA 3OBWA 2WSCE 3OYAA 5DLOA 4M7AG 5GAN3 4PL6A 1KQSA 1WPYA 4O5VA 5C6SA 2X35A 3VUBA 3QIIA 4A4GA 4EMKA 2PU9B 3L2ZA 4XAXB 2CYZB 5GAMd 3NFCA 4M75G 2R57A 4M77G 4YTLA 3TCJA 4JRQA 3JCMP 3GNFB 1NJIC 3C95A 3E1SA 4R55A 5J3BA 4A4KA 2M16A 4MMKA 4OVAA 4PJOD 1VQ7T 2LX9A 3CCMT 2EQMA 4VUBA 4IUQA 4J6YA 2LNVA 4EPCA 3OY9A 1K8AU 4BY6B 5GAMj 4QVZA 3KBGA 4BE1A 3INZA 2L89A 3HRUA 4F7UF 5CVIA 1WNLA 2ZPHB 4IUPA 3CCSA 3OYBA 1JBMA 4JLGA 3FB9A 5A0DA 4IUVA 4C92G 5CQXA 1M4ZA 3CCRA 2DTHA 5IN1A 3QBYA 3QPHA 4JLIA 1BIAA 5GAN4 2CGHA 2JZ2A 2YRVA 3MP6A 5FRMA 2E6NA 2XK0A 1QVFS 2EQKA 2QI2A 3PMIA 5DLQE 3A8OB 5A0LA 2RHXA 4OB3B 3PT9A 4RG2A 5GANd 4MZMA 1BI2A 1KHCA 1WJSA 5GANg 4C0ZA 4C8QF 1YJWT 2RH2A 3I56A 3I55T 4OMFB 3DLLA 3GIBA 5HK3A 3OS0A 2DIGA 4KUDK 4PJOA 2DTOA 4DQ2A 4JRKA 1VQLT 3NTHA 4M77D 2EKOA 4M75D 5GAMg 4V2SA 3JCMg 5CKDA 4M7DD 1S72A 3HRSA 4Y28E 1VQKT 1KC8U 2A7YA 4XU0A 2EQUA 4B9XA 2RJFA 2CS7A 5FRNA 4LDUA 3R6OA 2ZPEB 3LWIA 3OYKA 2MI6A 2WSEE 3LLRA 2JN0A 2ZZDA 3A5ZB 3QKJA 4J83A 3JCMc 3WXMB 4BE2A 1M1FA 4OB1B 5CR2A 4A4EA 2H3JA 1O75A 2XHCA 1D3BA 3MEVA 3QG1A 2QEXT 2XIDA 3CMAA 4BE0A 3V7SA 5GAN6 2VC8A 4NOYA 4BUGA 1Y07A 2XDPA 2CZ1B 3ASKA 4B9WA 2EJFA 2ZPBB 3QO3A 3I56T 4KUIA 3BW1A 3JCMf 5IT9E 4M7AE 3WVDB 3OMCA 5LJ5d 1EIFA 2L5QA 3V8KA 4J5YA 2M0OA 3X20B 1UGSB 3BDLA 4JUVA 4ZGJB 2EQJA 5D6WA 1UEBA 4ELZC 3PIOA 1VQOA 3NTIA 1ZBXA 4LDWA 4C8QE 4Y91A 2KK4A 3QZ9B 4ZGDB 1G3YA 5GAN7 1ZQ1A 2GFAA 4JRPA 2VGMA 3PMTA 4IKFA 4JS4A 4C92B 1I5LA 1JJ2A 4M78E 1M90C 5GAOq 1W4SA 2EFIA 4E7KA 3DLMA 5LJ5g 1DJ7B 4N4GA 1QVFA 4C5HA 1YBYA 2YHTA 3OW2S 2E12A 1M9SA 4II1A 2LRQA 2JUFA 3CC2A 3ER0A 3L2WA 3JB9G 3N5BB 3SFMA 2PQWA 3ZEHA 4HCBA 3PGGA 3QUIA 4M75E 4M77E 2DD5A 4BD3A 4C8QB 1U8RA 3RKXA 1VQ4A 1VQPT 2V8IA 3QHSA 2KDSA 4FSXA 1M1KC 3L2VA 1N8RC 4QW2A 4IUTA 5FU7C 4HCCA 5A2QE 2VXEA 3QZ5B 3OYHA 3CCVT 1VQMT 1JB0E 2HAXA 2EWNA 4FT2A 3M57A 3QYHB 2K5LA 3TREA 1I8FA 1M90U 3M53A 3Q1JA 2QQ9A 3JAME 1I81A 1YHQA 4XU2A 1OYXA 5LJ3e 2ZPFB 4QQ6A 3QSUA 4HKEA 5GMKh 3HRTA 5FU6B 1M5Q1 1NE8A 1WQ7A 5L8RE 4C92C 5J26A 5GAOm 2Y4YA 2VV5A 2E6ZA 2JOYA 2QA4A 4GLKA 3CD6T 4C8QG 3OQ5A 4C5GA 1YITA 1VQ8A 2MF2A 3OS5A 2EJ9A 2DXBA 4GY5A 2V8KA 2E5QA 4E7IA 3UT1A 1K9MU 5CKEA 2JTMA 2RHYA 3MEAA 2RM4A 1N6AA 2XKOC 1YJ9T 1N8RU 3M54A 2O4XA 5KH6A 1H641 4MDWA 3RERA 4ZN1A 2GCXA 1YIJT 1FX7A 3RUXA 4N4HA 3QJYA 2DTIA 4M78D 4A54A 5HY6A 1LJOA 1VQ6A 2DVEA 3CCJA 3CBMA 5CQYA 2Y90A 3S3MA 2X4YA 4C92D 2VGNA 4KBMB 3O8VA 2QA4T 4ELYC 1U1TA 3FEOA 2K5IA 3LGFA 2HNIA 2O4XB 3CCLA 1IREB 2NLUA 2M1HA 2R5MA 2D0QB 1KD1C 4PJOG 4A4FA 1VQKA 1XQHA 5GAN8 1P92A 1YHQT 3SWNA 2I2LA 1VUBA 3CC4A 4F7UA 2B8AA 4CRIA 3PFSA 3OYEA 4L5GA 2HD0A 2X4JA 1X75C 3C12A 2RHUA 5LJ3g 3CD6A 3OYNA 3CC7T 1XTDA 4X9CA 1NPRA 2LT1A 3META 2F5KA 1SSFA 4F7UB 1QVGA 1VQNT 1LOJA 2E41A 2DZ9A 2RJCA 2EJGA 2K3XA 4P5NA 4C5EA 4FIBA 3JCMb 3TU4K 4XTXA 3G6ET 4MDXA 2K57A 3RKYA 4M78B 4EMKC 3L2UA 4NS5A 3C94A 5DM7R 2RO0A 4LDXA 2DXTA 3CBOA 5LJ5e 3CMET 1Q82C 2CZ7B 4A53A 4ZTJA 3V8LA 2MAMA 3OYJA 3OBYA 4PNOA 4M7DB 3L42A 3SD4A 1I4K1 3GLXA 3M4YA 3MP8A 2MWPA 4M75B 4M77B 5LJ5f 3CCUA 3VU3C 4X34A 1OI1A 3A8GB 2RHIA 5J39A 3CC7A 1K73U 1UGRB 1KD1U 5AYFA 2FYKA 3SWNB 5CK9A 4C5IA 1M1GA 3J7AF 2R58A 4EMHA 3M59A 2JNGA 3MEWA 1NJIU 5EG2A 5GMKi 3KXTA 3SB2A 1YJNA 1G5VA 2HQXA 5I2SA 5CKFA 5CAIA 1NPPA 4XTZA 2EIFA 2XDDA 3OSSC 2QEXA 3X28B 4ME7A 3HFNA 4M7DE 3G71T 2XDBA 2VUBA 1VIEA 2RD1A 3JCMJ 2OTLA 2LTOA 4QVCA 2DEQA 2QQAA 3DB3A 4C8QD 3AHUA 2QDYB 3JCMd 3OYYA 4BY6C 4ZGEB 2RI2A 3V7CA 1BI3A 1TH7A 2GQVA 2K4YA 3JCMh 3SWNC 4XU3A 4J6WA 2EAYA 3UDCA 4D6WA 1JRIA 2ZGWA 1W2BS 1Q86C 4C92F 2KAFA 2RB6A 2F5TX 4R56A 5CKHA 4OGEA 3TEEA 1Q81U 4BDZA 4XTUA 2HBPA 2XI9A 3JCMe 1Y7XA 5GAMe 2P0QA 1X6OA 2OTLT 3CCEA 4M7DG 1WJQA 1LNXA 3OMGA 3NTKA 1HK9A 5GMKm 1S72T 4QQGA 3OA6A 5LJ3j 2YLCA 3MHXA 5GANh 3RMSA 3URGA 5GANe 5GAMf 2QQRA 5GAOn 2RA2A 2RJEA 2E10A 3L2QA 2KVQG 3L2RA 2X4XA 5GAN2 2E1HA 5D6YA 2ZPIB 1PSFA 2LT4A 4J6XA 3VYHB 1UB4A 5GAOr 5GANj 1VIFA 5D6XA 1B34B 2G3RA 3DB4A 3JCMQ 2LCCA 4NL3A 3CC2T 4M78C 5I2MA 3GOXA 3CCMA 1JJ2S 1FWZA 1G3WA 3WVEB 4CI0C 3S3OA 3HP9A 1VQ7A 4M7AC 5CKBA 1KC8C 2OAUA 3JCMW 2DKGA 3KUFA 2P0KA 3E9GA 2JVVA 3M55A 3QYGB 3OYFA 2CKKA 3GP8A 5HK0A 2P0PA 3X25B 4XTYA 4LDVA 3LWHA 3G6EA 2EYQA 4PLLA 1Y96B 2L3RA 2LQKA 4M75C 4M77C 4MZTA 4RCBA 4XK8E 2DJZA 3BY7A 3A8HB 1VQOT 3G4SA 2CZ6B 2D9TA 4FT4A 2KY9A 5CCAA 2BUDA 4BI8B 2IG0A 4QVDA 1H3ZA 3FRNA 1VQMA 4M7AD 1WQWA 4RKUE 3OYCA 2WACA 4L59A 3FJPA 1Y71A 3JB9D 3EFSA 5GAOp 1Q7YU 3G4ST 4RCCA 2K3YA 3GPLA 3T9NA 5GAMh 3JRZA 2PUKB 3LYIA 4PKCC 2OTJA 1BYMA 3CMAT 4PJOF 3HPWA 3HL8A 4LDYA 4JJNK 4L6V5 2DAQA 4OF1A 4C92A 5KCHA 3CCLT 2R5AA 4HT8A 4DOVA 4EMGA 1BIBA 3CXCA 2QQBA 3HKSA 3M5AA 5KCOA 4RMOA 1VQNA 2ZCFB 3MEUA 4E7JA 4MMLA 4C8QC 1GXIE 3ZBDA 4MZPA 1YIJA 4LD9K 3QJ6A 4PJOB 1BI1A 2FB7A 2QXFA 3X24B 4XTVA 2QTXA 2PUOB 1YI2A 2RI5A 4C0DC 4O6JA 3VV0A 3I55A 4JRIA 3QDRB 1YITT 5IAYA 3ZFJA 1OZ3A 1IZ6A 3CC4T 1XOVA 4BACA 1QVPA 3EAEA 4C8QA 4EMKB 3RKWA 5FU6C 2CZ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D F;  2DEQ A;  3JB9 G;  4C8Q D;  3AHU A;  1U1S A;  4F7U G;  2E64 A;  3PGG A;  1KQ1 A;  3QUI A;  4M75 E;  4M77 E;  4M78 A;  5LJ3 d;  3JCM V;  4C8Q B;  3JCM d;  3RKX A;  3V7C A;  1TH7 A;  3HSB A;  4M7A G;  4PJO C;  3FIF A;  3QHS A;  3SWN C;  5LJ3 h;  4XU3 A;  3JCM h;  4J6W A;  2EAY A;  5GAN 3;  4M7D C;  1JRI A;  1WPY A;  2ZGW A;  2VXE A;  3V8J A;  4C92 F;  2RB6 A;  4EMK A;  2EWN A;  1Y96 A;  5LJ5 h;  3L2Z A;  1I8F A;  5GAM d;  3JCM J;  4M75 G;  4M77 G;  4N0A C;  1I81 A;  3JCM P;  4XU2 A;  4XTU A;  5LJ3 e;  3JCM e;  5GAM e;  3QSU A;  3RKW A;  5GMK h;  4MMK A;  4PJO D;  1M5Q 1;  4C92 C;  1WQ7 A;  5GAN 5;  1LNX A;  5GAO m;  4M7D G;  5GMK m;  1HK9 A;  4J6Y A;  4C8Q G;  5LJ3 j;  2YLC A;  3EFR A;  2DZC A;  5GAN h;  5GAM j;  5GAN e;  2EJ9 A;  5GAM f;  4V2S A;  3INZ A;  3HFO A;  4F7U F;  5GAO n;  2RA2 A;  1WNL A;  1HXD A;  1YCY A;  2E10 A;  1B34 A;  2RM4 A;  1JBM A;  4XQ3 A;  3FB9 A;  5GAN 2;  1H64 1;  4C92 G;  2E1H A;  3BDU A;  5GMK e;  3RER A;  4J6X A;  5GAO r;  2DTH A;  5I21 A;  5GAN j;  4JLI A;  1BIA A;  3RUX A;  2CGH A;  1B34 B;  5GAN 4;  1D3B B;  2YLB A;  5GAO l;  3JCM Q;  4PJO E;  2DTI A;  4M78 D;  4A54 A;  1LJO A;  2DVE A;  4NL3 A;  2Y90 A;  4M78 C;  1N9R A;  4C92 D;  3JCM X;  5GAN d;  1KQ2 A;  1U1T A;  4NL2 A;  4M7A C;  3M4G A;  5GAN g;  2HNI A;  4HA8 A;  4C8Q F;  3BFM A;  4PJO G;  3RIR A;  3JCM W;  2DKG A;  5GAN 8;  3GIB A;  4PJO A;  3SWN A;  2I2L A;  3JB9 H;  4OP0 A;  2DTO A;  4DQ2 A;  4JRK A;  4XTY A;  4M77 D;  4M75 D;  3V7R A;  3L1A A;  5DY9 A;  4F7U A;  1Y96 B;  4M75 C;  4M77 C;  4RCB A;  3JCM g;  2E65 A;  5LJ3 g;  4M7D D;  2DJZ A;  3BY7 A;  4M75 F;  4M77 F;  3JB9 J;  4XU0 A;  4X9C A;  5GAN f;  4QVD A;  4M7A D;  1WQW A;  5LJ5 d;  2JN0 A;  3JCM c;  3RES A;  4F7U E;  4F7U B;  5GMK j;  1MGQ A;  4M7A F;  3FJP A;  4X9D A;  1LOJ A;  3JB9 D;  3EFS A;  5GAO p;  4M7A A;  2E41 A;  4RCC A;  4M78 F;  2DZ9 A;  1D3B A;  2EJG A;  3JCM b;  1N9S A;  4WF2 A;  5GAM h;  3V7S A;  4XTX A;  5GAN 6;  2VC8 A;  2K57 A;  3RKY A;  4M78 B;  4NOY A;  4EMK C;  5GMK l;  4PJO F;  1M8V A;  2DXT A;  4M7A B;  2EJF A;  5LJ5 e;  3QO3 A;  4C92 A;  3BW1 A;  5LJ3 f;  3JCM f;  4A53 A;  4HT8 A;  4M7A E;  3V8L A;  3V8K A;  4EMG A;  1BIB A;  4J5Y A;  4N0A A;  4PNO A;  4M7D B;  1I4K 1;  2DXU A;  5LJ5 j;  4JUV A;  4M75 B;  4M77 B;  5LJ5 f;  3VU3 C;  4MML A;  3JB9 I;  4C8Q C;  4M7D A;  4C8Q E;  1X01 A;  4Y91 A;  4C92 E;  4PJO B;  2FYK A;  3SWN B;  2FB7 A;  4XTV A;  5GAN 7;  2QTX A;  4HT9 A;  4M78 G;  3JB9 F;  4EMH A;  4C92 B;  1I5L A;  4M77 A;  4M75 A;  5GAM g;  4M78 E;  4JRI A;  5GMK i;  5GAO q;  3SB2 A;  2VXF A;  5CAI A;  4XTZ A;  5LJ5 g;  3HFN A;  2YHT A;  4XU1 A;  4M7D E;  4C8Q A;  4EMK B;  4XTW A;  2RD1 A;  4QVC A; 
#chains in the Genus database with same CATH topology
 3CEY A;  1U1S A;  1FXX A;  5LJ3 d;  3JCM V;  4M78 A;  4DOW A;  3CCJ T;  4PJO C;  4ATO A;  4KGV B;  1BK2 A;  1PSE A;  1ZUK A;  3V8J A;  3G7Z A;  5LJ5 h;  2CH4 A;  1RL2 A;  1AHJ B;  2QQS A;  1X27 A;  1WHG A;  2A36 A;  3CME A;  2O01 E;  4QQD A;  3CPW S;  1CKB A;  1UFF A;  3EFR A;  3J80 E;  5C0M A;  1WJR A;  2XD0 A;  1MUZ A;  5KE3 A;  1OUL A;  1HXD A;  1NBE B;  1YCY A;  4Q5W A;  4XQ3 A;  2KRO A;  4EIK A;  2DL5 A;  1KQS S;  2JT4 A;  1CKA A;  2FG0 A;  4J7I A;  2OAW A;  2PVG B;  2LVM A;  2FL7 A;  3OSV A;  2D8J A;  3OYI A;  1C0M A;  1D0Y A;  2YWW A;  4IUR A;  3RIR A;  3OYD A;  4BI4 A;  3JB9 H;  4EDU A;  3V7R A;  2IVW A;  1QW1 A;  1FYN A;  4M75 F;  5A0G A;  3PE0 A;  5KYY B;  2J6F A;  1VQ6 T;  3THK A;  5GJV B;  2CP6 A;  4BB7 A;  2LQ8 A;  1YI2 Q;  1UDL A;  1K73 C;  2DO3 A;  2KXC A;  5EC7 A;  4C0F A;  2PVD B;  4ZTF A;  3OYG A;  3EGD A;  3BE3 A;  3CCQ A;  1B7T A;  1Q82 U;  1M3C A;  4LD6 A;  1YWO A;  4UC4 A;  3PIP A;  4B6M A;  1QVG S;  2FHD A;  3QXE B;  1YI2 T;  2DD4 A;  3GNG A;  4FL6 A;  2Y4X A;  4HT9 A;  3M56 A;  1K8A R;  3LW5 E;  3MP1 A;  2DXC A;  3TQ7 P;  3M0P A;  1VYU A;  2DPP B;  2VXF A;  3UPU A;  4XU1 A;  2ROL A;  1BKB A;  3SDZ A;  4XTW A;  2HZY A;  4DA4 A;  2PVO B;  4DBQ A;  2RHZ A;  4F7U G;  1BU1 A;  3ZL7 C;  3FDR A;  3OBW A;  5GAN 3;  4PL6 A;  5D7U A;  1KQS A;  1QCN A;  1Q82 R;  1AOJ A;  3L2Z A;  5GAM d;  1NJI C;  2R57 A;  3JCM P;  3GNF B;  2F1L A;  2DX1 A;  2M16 A;  4MMK A;  4OVA A;  1IXD A;  1BCM A;  4VUB A;  1WZO A;  4EPC A;  3OY9 A;  5GAM j;  2L89 A;  4F7U F;  1WNL A;  2ZPH B;  3CCS A;  4C92 G;  3QBY A;  3QPH A;  5GAN 4;  1ZA1 B;  2EGC A;  2EQK A;  2Z0W A;  3A8O B;  5A0L A;  2LMJ A;  1KHC A;  2PZ1 A;  3GIB A;  2DIG A;  3A1P A;  1AWJ A;  4PJO A;  4M77 D;  4M7D D;  4Y28 E;  3CCE Q;  3RNJ A;  2LX7 A;  2V26 A;  3LLR A;  2V1Q A;  2ZZD A;  3QKJ A;  3JCM c;  3WXM B;  1RAG B;  4OB1 B;  2M51 A;  1O75 A;  1GRI A;  2QEX T;  4BE0 A;  4X1V A;  1Y07 A;  2CZ1 B;  1GFC A;  2EJF A;  3CCL Q;  4LE9 A;  1C1A A;  5IT9 E;  3WVD B;  2J7I A;  4ESR A;  1M27 C;  4J5Y A;  3X20 B;  4ANJ A;  2C0T A;  3NTI A;  4C8Q E;  3TSZ A;  2GFA A;  1JJ2 A;  4PJJ A;  5GAO q;  2EFI A;  3I5R A;  3CQT A;  2JS0 A;  1DJ7 B;  2PNI A;  4KH0 B;  2JUF A;  1B07 A;  3RR6 A;  2KNB B;  2DF6 A;  3PGG A;  3QUI A;  4M77 E;  4BD3 A;  1U8R A;  1VQ4 A;  2OTJ Q;  1VQP T;  2V8I A;  3QHS A;  4FSX A;  1N8R C;  4IUT A;  5FU7 C;  2VXE A;  3QZ5 B;  2DE0 X;  3QYH B;  3UAT A;  1OOT A;  1M90 U;  3Q1J A;  1JEG A;  1I81 A;  4QQ6 A;  4HKE A;  2GTO A;  1UE9 A;  1WQ7 A;  5J26 A;  1PWT A;  2Y4Y A;  2HQH A;  1D1A A;  2EJ9 A;  1BCO A;  2JTM A;  1N6A A;  1N8R U;  2GCX A;  2YUO A;  4PK4 A;  4A54 A;  1WHJ A;  2RQV A;  2Y90 A;  2AK5 A;  2X4Y A;  3EGD B;  2E4H A;  4PFP A;  4ELY C;  2K5I A;  1IRE B;  5IHI A;  1TOV A;  2NLU A;  1R77 A;  4A4F A;  4J9C A;  2GBQ A;  1EFN A;  3C12 A;  5LJ3 g;  4RTU A;  4QKU A;  1FMV A;  1NPR A;  1PG5 B;  4ORZ A;  1VQN T;  1AT1 B;  1LVK A;  1LOJ A;  2DL4 A;  4PFZ A;  4LN2 A;  2DRM A;  2KT8 A;  3LH5 A;  2DZ9 A;  3TU4 K;  4C5E A;  2QDL A;  4EMK C;  3RKY A;  4M78 B;  3VS5 A;  4LDX A;  1JJ2 P;  5LJ5 e;  1KIK A;  2EGA A;  1X69 A;  2O31 A;  3OYJ A;  3OBY A;  3EG3 A;  1VQN Q;  3MP8 A;  3VU3 C;  1YP5 A;  3H41 A;  2FYK A;  4C5I A;  2EYX A;  3M59 A;  2JNG A;  1RAH B;  5EG2 A;  5GMK i;  3SB2 A;  1YJN A;  1G5V A;  5CKF A;  5CAI A;  2QEX A;  4ME7 A;  4E7Z A;  2NUT B;  4M7D E;  3G71 T;  3A98 A;  1VIE A;  2RD1 A;  2QGG A;  1IGQ A;  2H3E B;  4J9H A;  4BY6 C;  4ZGE B;  3I55 Q;  4F16 A;  3SWN C;  2J6O A;  2JJ9 A;  4D6W A;  1JXO A;  1Q86 C;  1TWB A;  2H8H A;  4R56 A;  3VS7 A;  4FYW B;  3JCM e;  1UGV A;  2P0Q A;  5IHN A;  3NTK A;  3OA6 A;  2YLC A;  3MHX A;  4OMM A;  2QQR A;  2RA2 A;  2RJE A;  3HTR A;  4LXC A;  1Y57 A;  1Q7Y R;  3L2R A;  3CMA Q;  2LT4 A;  4J6X A;  1UB4 A;  1VIF A;  5D6X A;  2G3R A;  3REA B;  2V1R A;  4NL3 A;  5I2M A;  1M2V A;  4CI0 C;  3S3O A;  1R0B G;  1K9M R;  1WHL A;  1KC8 C;  2OJ2 A;  1SRM A;  2DKG A;  3KUF A;  5KYY A;  2HMA A;  3QYG B;  2CKK A;  5HK0 A;  4J9G A;  3X25 B;  3G6E A;  4PLL A;  2LQK A;  2RNA A;  2DJZ A;  2CH4 W;  2F2W A;  1NEG A;  2CZ6 B;  2VWF A;  4F14 A;  1VQM A;  2ZAE A;  1QWE A;  3EFS A;  5GAO p;  3G4S T;  1KQS P;  2K3Y A;  3G4S Q;  2KYM A;  4OMO A;  5GAM h;  3JRZ A;  3LYI A;  4PKC C;  1BYM A;  3HPW A;  4LDY A;  2BZX A;  1TG0 A;  4PJN A;  3HKS A;  1TUC A;  2JS2 A;  3MEU A;  1ZSZ B;  2GNC A;  1YIJ A;  3QJ6 A;  3CCQ Q;  2FB7 A;  4RTT A;  2PUO B;  1YI2 A;  1VQK Q;  3I55 A;  4JJB A;  4JRI A;  1YIT T;  2CP0 A;  3CCV Q;  1OZ3 A;  1X6B A;  4BAC A;  3EAE A;  4DEY A;  1K73 R;  2CZ0 B;  2P4T A;  3P8D A;  2E70 A;  5IH2 A;  1N27 A;  3FIF A;  2C0O A;  3KFV A;  4M7D C;  2D1X A;  2K2M A;  3MO8 A;  3S6W A;  1T3S A;  3H0I A;  4C0D B;  1Y96 A;  2AT1 B;  2AIR B;  2LDM A;  4J8O A;  1E6H A;  4FU6 A;  4OML A;  5GAN 5;  1WFW A;  5KYU A;  2XMF A;  2DZC A;  1YJN T;  1T3L A;  1M30 A;  3HFO A;  2ED1 A;  2FPE A;  1YCS B;  1TS9 A;  1G3T A;  3OS2 A;  2SRC A;  2C06 A;  1IGU A;  1MV0 B;  2YLB A;  4PJO E;  2GFU A;  1VQO Q;  2M9U A;  1IB8 A;  2K2V A;  1C6V X;  1VQM T;  2KQW A;  1VQ5 A;  2J05 A;  2C0I A;  2QGF B;  4HA8 A;  1D1B A;  1QP2 A;  3CBP A;  2SEM A;  2RI3 A;  1U5S A;  4OP0 A;  3M58 A;  1BI0 A;  3EG1 A;  4J9D A;  3C4S A;  2E65 A;  2XIC A;  3P8H A;  4PJL A;  1MHN A;  5IXB A;  2YRD A;  2HQE A;  4F7U E;  4M7A F;  2KSS A;  3C0C A;  3E19 A;  4M78 F;  2NUT A;  1VQ8 T;  1K4U S;  1KG1 A;  1IO6 A;  5IHK A;  3OYL A;  1M1K U;  2V8J A;  1O9S A;  2EYW A;  4FYX B;  1QWF A;  1X2K A;  4N0A A;  1TSF A;  1VA7 A;  5LJ5 j;  4HXJ A;  3PTA A;  2CT4 A;  1OV3 A;  2QK0 A;  3M9Q A;  5CO7 A;  2A28 A;  4J7F A;  1X01 A;  1VQP A;  4C92 E;  3VJP A;  2HL3 A;  4M78 G;  3PVL A;  2FVU A;  4M77 A;  1NEB A;  1G83 A;  4JDS A;  2MYS A;  4AFU C;  1AWX A;  1YJW A;  1ZLM A;  2JM9 A;  4FM4 B;  4IUU A;  2E64 A;  1D0X A;  2RK2 A;  3HSB A;  2PTK A;  2WSC E;  1YWP A;  7AT1 B;  3VUB A;  2VKN A;  4Z8A A;  4A4G A;  4XAX B;  2K3B A;  1QQJ A;  3NFC A;  2CT3 A;  4M77 G;  4AFZ C;  2HSE B;  4R55 A;  1VQ7 Q;  1D09 B;  2FO0 A;  3CCR Q;  1VQ7 T;  2LX9 A;  1V1C A;  2JW4 A;  3CCM T;  4E7S A;  2LNV A;  1H3H A;  4BY6 B;  4AT1 B;  1OPL A;  5KYX B;  4IUP A;  3OYB A;  3VS0 A;  3FB9 A;  5A0D A;  1WXB A;  2DTH A;  5IN1 A;  2JZ2 A;  2K79 A;  1Q86 R;  3CC7 Q;  2E6N A;  2XK0 A;  1QVF S;  2DBK A;  3EG9 A;  1WHH A;  1WXU A;  4RG2 A;  1BI2 A;  1WJS A;  4C0Z A;  2RH2 A;  3I55 T;  5HK3 A;  1Z9Q A;  3OS0 A;  2DBM A;  2DTO A;  3NTH A;  2EKO A;  1WA7 A;  2GTJ A;  1S72 A;  3HRS A;  2COZ A;  3CPW P;  4RTZ A;  2A7Y A;  4Y92 A;  2EQU A;  4B9X A;  5FRN A;  2EVR A;  3R6O A;  2ZPE B;  3M0R A;  2KRS A;  5CR2 A;  4A4E A;  1S72 Q;  3V7S A;  4NOY A;  2MOX A;  3TVT A;  4B9W A;  2ZPB B;  3G1J A;  4M7A E;  3OMC A;  2MCN A;  1EIF A;  3V8K A;  1M90 R;  3BDL A;  1JQQ A;  4JUV A;  1A0N B;  5D6W A;  1VQO A;  1PD1 A;  2L3P A;  1ZBX A;  2YT6 A;  4LNP A;  4Y91 A;  2KK4 A;  3QZ9 B;  4JRP A;  2VGM A;  4JPB W;  4JS4 A;  4M78 E;  3VS1 A;  9ATC B;  1KC8 R;  2KXD A;  4E7K A;  5LJ5 g;  4N4G A;  4HVU A;  2E12 A;  1M9S A;  2ROT A;  3I5S A;  1OQK A;  1HSQ A;  1JXM A;  1HD3 A;  1HJD A;  4IIM A;  2DD5 A;  1ZX6 A;  3H0H A;  2KRM A;  2A37 A;  2X3X D;  1M1K C;  4QW2 A;  4HCC A;  1QVG P;  3OYH A;  1ZSZ C;  2HAX A;  2EWN A;  3TRE A;  3M57 A;  3SEM A;  1TTH B;  3JAM E;  1YHQ A;  4XU2 A;  1OYX A;  2ZPF B;  3QSU A;  4GBQ A;  5GMK h;  5FU6 B;  1NE8 A;  4C92 C;  2VV5 A;  2JOY A;  4GLK A;  1VQ8 A;  4C5G A;  3OS5 A;  4GY5 A;  2DXB A;  3MJX A;  2RHY A;  2KRN A;  3MEA A;  2HEQ A;  5KH6 A;  3RUX A;  3QJY A;  2OI3 A;  1PHT A;  4M78 D;  1VQ6 A;  2QA4 T;  2VGN A;  2FPD A;  4KBM B;  4HVV A;  3CCL A;  1G8X A;  2R5M A;  2D0Q B;  4PJO G;  1Z9Z A;  2HBW A;  3SWN A;  1WDX A;  3PFS A;  2EBP A;  2RHU A;  3CD6 A;  2P4R A;  1MMA A;  1UTI A;  3MET A;  4PFO A;  2W10 A;  1QVG A;  2ABL A;  2E41 A;  2DM1 A;  2RJC A;  4FIB A;  4XTX A;  2K57 A;  3L2U A;  5AT1 B;  2RO0 A;  3CBO A;  3CME T;  2O88 A;  4ZTJ A;  3GBQ A;  1ABO A;  4M75 B;  1X43 A;  1JU5 C;  3VS2 A;  3SWN B;  1M1G A;  3J7A F;  3AT1 B;  4EMH A;  3KXT A;  2FRW A;  2XDD A;  3EGX B;  3HFN A;  2QTV A;  3JCM J;  1QKX A;  2OTL A;  2L0A A;  2QQA A;  2LCS A;  3DB3 A;  2DL3 A;  2QDY B;  3JCM d;  3OYY A;  2RI2 A;  2GQV A;  1D0Z A;  4XU3 A;  2EQI A;  2FEI A;  1JRI A;  2KE9 A;  1K0X A;  3RBB B;  4OGE A;  4XTU A;  2HBP A;  2NWM A;  1KD1 R;  2F2X A;  4K11 A;  3UF4 A;  5GMK m;  4QQG A;  3CD6 Q;  1HYO A;  3URG A;  5GAM f;  1RAC B;  2CSI A;  2E10 A;  3L2Q A;  2KVQ G;  2E1H A;  2ZPI B;  5GAN j;  3CME Q;  2D0N A;  1UG1 A;  3DB4 A;  3JCM Q;  2LCC A;  4QT7 A;  1ZSG A;  1VQ6 Q;  1JJ2 S;  1VYV A;  2RPN A;  1N8R R;  5KYX A;  2JVV A;  2P0P A;  4LDV A;  1WX6 A;  2EYQ A;  1Y96 B;  4M77 C;  1VQO T;  1GCQ C;  4FT4 A;  2EW3 A;  4RKU E;  2WAC A;  1WHK A;  1AZE A;  2FZK B;  1MMN A;  4RTX A;  1YJN Q;  3T9N A;  2PUK B;  4PJO F;  4OF1 A;  4C92 A;  5KCH A;  3CCL T;  4HT8 A;  2B86 A;  1YJ9 Q;  2CP5 A;  2DIL A;  1BIB A;  3CXC A;  2QQB A;  5KCO A;  1W2B P;  4RMO A;  1VQN A;  4MML A;  1GXI E;  2LJ0 A;  1BI1 A;  1V76 A;  4C0D C;  4D8K A;  4J9I A;  3QDR B;  4WCI A;  3R6N A;  1RAI B;  1VOM A;  1XOV A;  3RKW A;  4L6V 5;  4M7D F;  1AWW A;  1KQ1 A;  5LL6 S;  3OW2 A;  3H8Z A;  1MND A;  3UA7 A;  3CPF A;  2LC4 A;  1XJW B;  1GBQ A;  2HCK A;  4N0A C;  3LGL A;  4TVR A;  2L8D A;  4ZN3 A;  2CP2 A;  2DVJ A;  3VUZ A;  3CCM Q;  1PM3 A;  3H0F A;  2VB6 A;  2LCL A;  2HL5 C;  3FLG A;  4J9B A;  2G6F X;  2D6F A;  1B34 A;  1OX8 A;  2K5F A;  3BDU A;  4C0G A;  5GAO l;  1NG2 A;  2IIM A;  3EGU A;  1VQ4 T;  1N9R A;  3S3N A;  2MWO A;  4NL2 A;  2L3S A;  1ZSZ A;  5HKC A;  5M9O A;  3CCJ Q;  1OU8 A;  1VQ9 T;  1RAF B;  3OB9 A;  3VKI A;  3L1A A;  4M77 F;  3JB9 J;  2WSF E;  1WHM A;  1R8O B;  4E6R A;  5GAN f;  2E3I A;  4KUL A;  2QA4 Q;  1RI0 A;  1TUD A;  4M7A A;  4KGX B;  2DA9 A;  1K8A C;  3HHT B;  1M3B A;  4F04 B;  1VQL A;  4BDY A;  1M8V A;  1AZG B;  4M7A B;  1GFD A;  4Z02 A;  2GGR A;  5LJ3 f;  4E7H A;  4RG8 A;  3OS1 A;  3UA6 A;  1WIE A;  2DXU A;  2BE7 D;  2YUQ A;  4DEX A;  2MMP A;  3CXC P;  3CCR T;  4M7D A;  2AKL A;  2RK1 A;  3JB9 F;  1VQP Q;  4M4Z A;  3LX7 A;  1UUE A;  1Q86 U;  3D7S B;  3VYG A;  4FW1 A;  8AT1 B;  1GBR A;  2NYS A;  2YUP A;  1SRL A;  2DIQ A;  3G71 A;  1TU0 B;  4JS5 A;  4PLI A;  1QP3 A;  3CCU Q;  3EH1 A;  5CIU A;  4M7A G;  3OYA A;  4J9E A;  5DLO A;  2DNU A;  4O5V A;  2RN8 A;  4EMK A;  1VYT A;  2CYZ B;  4FYY B;  2JMA A;  3TCJ A;  4JRQ A;  2RQW A;  1VQ5 Q;  1RI9 A;  1K76 A;  3EG0 A;  2EQM A;  4IUQ A;  4J6Y A;  4JZ3 A;  2E5K A;  4QVZ A;  4JLG A;  2DL8 A;  4IUV A;  5CQX A;  1M4Z A;  3CCR A;  4JLI A;  2CGH A;  2KEA A;  2YRV A;  1K9A A;  5FRM A;  2QI2 A;  4OMN A;  4OB3 B;  3PT9 A;  4MZM A;  2J06 A;  4CC7 A;  1UJ0 A;  1YJW T;  3I56 A;  4OMF B;  3CCS Q;  1VQL Q;  4KUD K;  1VQL T;  4JRK A;  4V2S A;  4M75 D;  3MKD A;  5L23 A;  3JCM g;  1R0C B;  1MV3 A;  4RTW A;  4XU0 A;  2CS7 A;  3REB B;  3LWI A;  3OYK A;  2MI6 A;  5LJ5 d;  3A5Z B;  2YSQ A;  4BE2 A;  2H3J A;  3ASK A;  3QO3 A;  2DYB A;  4KUI A;  3JCM f;  2L5Q A;  2EQJ A;  2A0F B;  4LDW A;  4ZGD B;  5GAN 7;  2LJ3 A;  3PMT A;  4C92 B;  1M90 C;  3EHQ A;  3DLM A;  1QVF A;  1MMG A;  3ER0 A;  3N5B B;  4FSS A;  3SFM A;  2PQW A;  2RMO A;  4M75 E;  1YHQ Q;  1SKU B;  3RKX A;  2KDS A;  2ENM A;  2KT1 A;  3CCV T;  1JB0 E;  1I8F A;  2QQ9 A;  2YDL A;  5LJ3 e;  2HKQ B;  4JJC A;  3HRT A;  2E6Z A;  3CD6 T;  1D1C A;  4C8Q G;  1YIT A;  2QEX Q;  2MF2 A;  4E7I A;  1AD5 A;  2V8K A;  1BBZ A;  1GCP A;  3M54 A;  1H64 1;  4MDW A;  3RER A;  2I0N A;  4ZN1 A;  1YIJ T;  2EGE A;  4N4H A;  2BE9 B;  1RAD B;  2X9H A;  2DYI A;  2DTI A;  5HY6 A;  1LJO A;  2DVE A;  3S3M A;  1YN8 A;  4C92 D;  4D8D A;  3O8V A;  3LGF A;  2P84 A;  1FMW A;  4FYV B;  1VQK A;  1XQH A;  5GAN 8;  2I2L A;  2KBT A;  1VUB A;  4F7U A;  4CRI A;  1NM7 A;  1M3A A;  2X4J A;  1X75 C;  3OYN A;  1YIJ Q;  2RQU A;  1XTD A;  2LT1 A;  1NYG A;  4PJM A;  2MK5 A;  2EJG A;  3JCM b;  4HCK A;  3G6E T;  4NS5 A;  1M8M A;  1SSH A;  4A53 A;  3V8L A;  1ZUY A;  4PNO A;  3L42 A;  1I4K 1;  3M4Y A;  3CCU A;  2MWP A;  5LJ5 f;  1IRX A;  1OI1 A;  4X34 A;  1W1F A;  4AMC A;  5J39 A;  1X2Q A;  3CC7 A;  1KD1 U;  2ECZ A;  5AYF A;  2RQT A;  1KJW A;  2R58 A;  1NJI U;  2HQX A;  4JJD A;  2YRC A;  4XTZ A;  2EIF A;  3OSS C;  3X28 B;  4ZNX A;  2VUB A;  2LTO A;  2DEQ A;  2JTE A;  4C8Q D;  2O2O A;  4DBF A;  4AG2 C;  1I1J A;  2CUB A;  1BI3 A;  2K4Y A;  3JCM h;  1ARK A;  2EAY A;  3UDC A;  1I07 A;  2RB6 A;  2F5T X;  1MNE A;  1H92 A;  2AZS A;  3TEE A;  1SEM A;  2OTL Q;  2OTL T;  3OMG A;  5LJ3 j;  3VRZ A;  5GAN e;  5D6Y A;  5GAO r;  2HSP A;  4Z89 A;  3G71 Q;  4M78 C;  2YXY A;  1S1N A;  1SHF A;  1FWZ A;  2EYZ A;  3WVE B;  1PCX A;  4M7A C;  3HP9 A;  1U06 A;  1VQ9 Q;  3NGP A;  2P0K A;  3OYF A;  2RQR A;  2L3R A;  4RCB A;  1QMC A;  1EZZ B;  2CRE A;  2D9T A;  2ESW A;  4FW2 A;  4RTY A;  5CCA A;  4QVD A;  1H3Z A;  3FRN A;  4M7A D;  1WQW A;  2FZC B;  4GLM A;  3FJP A;  2KGT A;  3M0S A;  1ZA2 B;  3GPL A;  2CUD A;  2OTJ A;  3CMA T;  2DFU A;  2R5A A;  4DOV A;  4EMG A;  1OU9 A;  1RAA B;  4FCY A;  4C8Q C;  3ZBD A;  4LD9 K;  4PJO B;  2QXF A;  3X24 B;  4XTV A;  2RI5 A;  2J6K A;  5IAY A;  4C8Q A;  1YJW Q;  5GAN 2;  5FU6 C;  5FW9 A;  5FRO A;  2QG9 B;  5LJ3 h;  1KHI A;  2KMT A;  3DKM A;  2ATC B;  3CPW A;  1QLY A;  5KYW B;  1NLP C;  2BIV A;  2A3L A;  3I9Q A;  4R0K A;  2LJ1 A;  3H6Z A;  3CXC S;  1VQ9 A;  1BB9 A;  2XG8 D;  3LH0 A;  1VQ5 T;  3ME9 A;  3E2U A;  2MIO A;  3A8L B;  1G3S A;  1V29 B;  1FMK A;  2OTJ T;  3OYM A;  1K9M C;  2D8H A;  1NYF A;  1UGP B;  2ZPG B;  3JSC A;  5GMK e;  1WYX A;  2AHJ B;  5I21 A;  4E47 A;  2GF7 A;  2VVK A;  1M2O A;  4OMP A;  1D3B B;  1JO8 A;  2HKN A;  3CCU T;  5FU7 B;  3PNW C;  1OZ2 A;  4E7L A;  1AWO A;  3JCM X;  1KQ2 A;  3M4G A;  1LPL A;  1PRL C;  1Q7Y C;  4OB2 B;  3BFM A;  2EYY A;  5KE2 A;  1SHG A;  3X26 B;  2DK3 A;  5DY9 A;  4LUD A;  1UHF A;  3EH2 A;  4A4H A;  1UGQ B;  4HCZ A;  3VS4 A;  1OPK A;  2F69 A;  3A8M B;  4KT0 E;  3GF5 A;  2DMO A;  3P8B B;  3RES A;  5GMK j;  1YJ9 A;  1MGQ A;  4X9D A;  3CCQ T;  4OGC A;  1W6X A;  1N9S A;  1ZHI A;  4WF2 A;  3OW2 P;  5GMK l;  2DL7 A;  4N4I A;  4CC3 A;  2BKD N;  1PKT A;  2EKH A;  1NZ9 A;  1XNI A;  5FLX E;  5I11 A;  3CCE T;  2X3W D;  2VYT A;  3CCV A;  3MCA B;  3QDF A;  4J9F A;  2XU8 A;  3JB9 I;  1GL5 A;  1M2V B;  1UEC A;  2JTF A;  2L2P A;  1WGS A;  3UWN A;  1WLP B;  3CCS T;  2CP7 A;  2X4W A;  3E9F A;  3RMQ A;  4M75 A;  3O5Z A;  4BI3 A;  3J81 E;  1W2B A;  1Q81 C;  4AFQ C;  5I22 A;  3FC3 A;  2NUP B;  3F70 A;  5KYW A;  2RJD A;  4DBR A;  1NJI R;  2F2V A;  4OB0 B;  2NUP A;  3EGX A;  1QCF A;  1WPY A;  1M1K R;  5C6S A;  2X35 A;  3QII A;  2PU9 B;  4M75 G;  4YTL A;  1E7O A;  3C95 A;  3E1S A;  2OX7 A;  5J3B A;  4A4K A;  3EHR A;  4PJO D;  2LNH B;  5ECA A;  1K8A U;  1IHV A;  3NMZ C;  3KBG A;  3G6E Q;  3INZ A;  4BE1 A;  1PNJ A;  3HRU A;  4CC4 B;  5CVI A;  3VS6 A;  1I5O B;  2NUZ A;  1JBM A;  2E3H A;  1ABQ A;  1BIA A;  3MP6 A;  1T0H A;  3PMI A;  5DLQ E;  3MPU B;  2RHX A;  1AEY A;  1YNZ A;  1TXQ A;  5GAN d;  5GAN g;  1RAB B;  4C8Q F;  1NLO C;  3DLL A;  2DER A;  2KYB A;  4DQ2 A;  5GAM g;  1YIT Q;  5CKD A;  1VQK T;  1KC8 U;  1ACM B;  2DET A;  2RJF A;  3JV3 A;  4LDU A;  2WSE E;  4J83 A;  2JN0 A;  1M1F A;  1PKS A;  2XHC A;  1SPK A;  1D3B A;  3MEV A;  2A08 A;  3QG1 A;  2XID A;  3CMA A;  3VS3 A;  5GAN 6;  2VC8 A;  4LUE A;  1YFN A;  4BUG A;  2XDP A;  1OEB A;  1F1B B;  3I56 T;  3BW1 A;  3M0U A;  2M0O A;  3EFO B;  1UGS B;  2LP5 A;  4ZGJ B;  1UEB A;  4ELZ C;  3PIO A;  2KI7 A;  1SG5 A;  1RLQ C;  3QWY A;  1G3Y A;  1ZQ1 A;  2IPO B;  4IKF A;  1PC0 A;  1QCO A;  1I5L A;  2K6D A;  2MPX C;  1KFZ A;  1W4S A;  1B3Q A;  4DBH A;  1UHC A;  4C5H A;  1YBY A;  2YHT A;  3OW2 S;  4II1 A;  2LRQ A;  3CC2 A;  3L2W A;  3JB9 G;  3ZEH A;  4HCB A;  4C8Q B;  2JXB A;  2DJQ A;  1RAE B;  1I0C A;  1ZUU A;  1TUG B;  3L2V A;  5A2Q E;  2BZ8 A;  3NHN A;  4FT2 A;  2K5L A;  3M53 A;  5FWC A;  2O9V A;  3I56 Q;  1Q95 G;  1M5Q 1;  5L8R E;  5GAO m;  2ED0 A;  1PD0 A;  2QA4 A;  3OQ5 A;  2E5Q A;  3UT1 A;  1K9M U;  5CKE A;  1VQ8 Q;  1E6G A;  2RM4 A;  2XKO C;  1YJ9 T;  2O4X A;  3ULR B;  4JZ4 A;  1FX7 A;  3EG2 A;  3CCJ A;  3CBM A;  5CQY A;  5IXF A;  5KYU B;  3RDV A;  1H8K A;  1U1T A;  2CSQ A;  2DLP A;  3FEO A;  2HNI A;  2O4X B;  2JM8 A;  4F17 A;  1J3T A;  2M1H A;  1KD1 C;  1YHQ T;  1P92 A;  4WTO B;  1K1Z A;  3CC4 A;  2B8A A;  2VAS A;  3OYE A;  4L5G A;  2HD0 A;  2KR3 A;  4Z88 A;  3H9N A;  3CC7 T;  2COY A;  3VRY A;  2QYZ A;  4X9C A;  2LQN A;  1VQM Q;  1RLP C;  2GQI A;  2F5K A;  1SSF A;  4F7U B;  2AKK A;  1RUW A;  1WXT A;  4OMQ A;  2CDT A;  2K3X A;  4P5N A;  1QVF P;  4MDX A;  2YUN A;  3C94 A;  5DM7 R;  2DXT A;  1AVZ C;  1T0J A;  1Q82 C;  2CZ7 B;  1X6G A;  1ZBJ A;  2QAS A;  1MMD A;  1GCQ A;  2MAM A;  3PVQ A;  3I35 A;  1Q81 R;  4M7D B;  3SD4 A;  3GLX A;  4AG1 C;  4M77 B;  3A8G B;  1U3O A;  2RHI A;  1K73 U;  1UGR B;  4HVW A;  5CK9 A;  4A63 B;  1PRM C;  2BTT A;  3MEW A;  1VQ4 Q;  2COW A;  3EFO A;  4KH1 B;  5I2S A;  1NPP A;  2XDB A;  4QVC A;  4RUG A;  2K7A A;  3AHU A;  2DEU A;  3V7C A;  3FJ5 A;  1TH7 A;  6AT1 B;  1WI7 A;  2O9S A;  4J6W A;  2ZGW A;  1W2B S;  4C92 F;  2KAF A;  2QAZ A;  5CKH A;  1Q81 U;  2W0Z A;  4BDZ A;  2XI9 A;  1Y7X A;  5GAM e;  1X6O A;  3M0Q A;  3CCE A;  4M7D G;  1WJQ A;  1LNX A;  1HK9 A;  1S72 T;  2K9G A;  4IIO A;  1OX9 A;  2BZY A;  5GAN h;  3RMS A;  5HCK A;  2JMC A;  8ATC B;  5GAO n;  2CP3 A;  1KSW A;  2X4X A;  4RTV A;  2HDA A;  1PSF A;  3VYH B;  2L3Q A;  1B34 B;  2DRK A;  5FWB A;  3CC4 Q;  1KK7 A;  3CC2 T;  4KRT A;  3GOX A;  2FZG B;  3CCM A;  1G3W A;  1VQ7 A;  4AFS C;  5CKB A;  2AZV A;  2FPF A;  2OAU A;  3JCM W;  3E9G A;  2LQW A;  3M55 A;  1QKW A;  1UJY A;  3GP8 A;  4XTY A;  3LWH A;  3U23 A;  1N5Z A;  4M75 C;  4MZT A;  4XK8 E;  3BY7 A;  1G2B A;  3A8H B;  3G4S A;  4CC2 A;  2KY9 A;  5GJW B;  2BUD A;  4BI8 B;  2IG0 A;  3OYC A;  3CC2 Q;  4L59 A;  1Y71 A;  3JB9 D;  1Q7Y U;  4E2F B;  1LCK A;  4RCC A;  1SF9 A;  1IHW A;  3M0T A;  3HL8 A;  2X51 A;  4JJN K;  3EG9 B;  3TSW A;  2DAQ A;  2M02 A;  3QWX X;  3IQL A;  1K0S A;  1W70 A;  1CSK A;  3M5A A;  2M0Y A;  1Y0M A;  4KGZ B;  2ZCF B;  4E7J A;  4MZP A;  2RF0 A;  2QTX A;  1EX4 A;  4O6J A;  3VV0 A;  5KYN A;  3NPF A;  3ZFJ A;  1IZ6 A;  3CC4 T;  1QVP A;  2FRY A;  4EMK B;  2EPD A;  2LZ6 B;  3SHW A; 
#chains in the Genus database with same CATH homology
 4M7D F;  2P4T A;  3CEY A;  1U1S A;  1FXX A;  2E70 A;  3P8D A;  1KQ1 A;  1N27 A;  5LJ3 d;  4M78 A;  5LL6 S;  3JCM V;  4DOW A;  5FRO A;  3CCJ T;  3H8Z A;  3OW2 A;  4PJO C;  4ATO A;  3FIF A;  5LJ3 h;  1KHI A;  2KMT A;  4M7D C;  3DKM A;  3MO8 A;  1PSE A;  3CPF A;  2LC4 A;  3S6W A;  3CPW A;  3V8J A;  3G7Z A;  4C0D B;  2BIV A;  2A3L A;  1Y96 A;  5LJ5 h;  1RL2 A;  1AHJ B;  3H6Z A;  2LDM A;  3LGL A;  4N0A C;  4J8O A;  4TVR A;  3CXC S;  2QQS A;  1VQ9 A;  2L8D A;  4FU6 A;  4ZN3 A;  2XG8 D;  3VUZ A;  5GAN 5;  3CME A;  2O01 E;  3LH0 A;  4QQD A;  3CPW S;  1VQ5 T;  2LCL A;  3ME9 A;  3FLG A;  2DZC A;  3EFR A;  1YJN T;  3J80 E;  5C0M A;  1WJR A;  2XD0 A;  3HFO A;  3A8L B;  2D6F A;  1G3S A;  1V29 B;  5KE3 A;  1HXD A;  1YCY A;  1B34 A;  2OTJ T;  3OYM A;  1K9M C;  4Q5W A;  4XQ3 A;  1UGP B;  2ZPG B;  1G3T A;  3JSC A;  3OS2 A;  2K5F A;  5GMK e;  3BDU A;  2AHJ B;  5I21 A;  4E47 A;  4C0G A;  1KQS S;  2C06 A;  2GF7 A;  1D3B B;  2YLB A;  5GAO l;  4PJO E;  2GFU A;  1VQ4 T;  4J7I A;  2PVG B;  3CCU T;  2M9U A;  5FU7 B;  2LVM A;  1OZ2 A;  2K2V A;  1N9R A;  3PNW C;  4E7L A;  2FL7 A;  2KQW A;  2MWO A;  3OSV A;  3JCM X;  3S3N A;  4NL2 A;  1VQ5 A;  1KQ2 A;  3M4G A;  3OYI A;  4HA8 A;  1Q7Y C;  5HKC A;  4OB2 B;  3BFM A;  5M9O A;  5KE2 A;  4IUR A;  1QP2 A;  3CBP A;  3RIR A;  3X26 B;  3OYD A;  1VQ9 T;  3OB9 A;  2RI3 A;  2DK3 A;  3VKI A;  4BI4 A;  3JB9 H;  4OP0 A;  4EDU A;  3M58 A;  3V7R A;  1BI0 A;  3L1A A;  5DY9 A;  3C4S A;  2E65 A;  1QW1 A;  2IVW A;  2XIC A;  4M75 F;  4M77 F;  5A0G A;  3JB9 J;  3P8H A;  4A4H A;  1VQ6 T;  1UGQ B;  2WSF E;  4HCZ A;  1MHN A;  1R8O B;  5GAN f;  2F69 A;  3A8M B;  4KT0 E;  3GF5 A;  4KUL A;  2HQE A;  3P8B B;  3RES A;  1RI0 A;  4F7U E;  4BB7 A;  5GMK j;  1MGQ A;  2LQ8 A;  2KSS A;  4X9D A;  1YJ9 A;  1K73 C;  4M7A A;  4M7A F;  2DO3 A;  3E19 A;  4OGC A;  3CCQ T;  1K8A C;  4M78 F;  4C0F A;  1N9S A;  1ZHI A;  3HHT B;  4WF2 A;  2PVD B;  5GMK l;  1VQ8 T;  4ZTF A;  4BDY A;  3OYG A;  1VQL A;  4N4I A;  1KG1 A;  3OYL A;  1M1K U;  2V8J A;  1O9S A;  2BKD N;  1M8V A;  4M7A B;  1NZ9 A;  1XNI A;  4Z02 A;  3CCQ A;  1Q82 U;  5LJ3 f;  4LD6 A;  5FLX E;  4E7H A;  4UC4 A;  4RG8 A;  4N0A A;  3OS1 A;  3PIP A;  3CCE T;  2DXU A;  5LJ5 j;  1QVG S;  2VYT A;  3CCV A;  3MCA B;  2FHD A;  2XU8 A;  3M9Q A;  3QXE B;  3JB9 I;  3PTA A;  5CO7 A;  1YI2 T;  2DD4 A;  2JTF A;  2MMP A;  1WGS A;  3CCR T;  4M7D A;  3GNG A;  1X01 A;  4FL6 A;  4J7F A;  2Y4X A;  4C92 E;  3UWN A;  1VQP A;  3VJP A;  4HT9 A;  3CCS T;  2RK1 A;  3M56 A;  3LW5 E;  4M78 G;  3JB9 F;  2FVU A;  2X4W A;  3E9F A;  3RMQ A;  4M77 A;  3MP1 A;  4M75 A;  4BI3 A;  2DXC A;  3J81 E;  1W2B A;  1Q81 C;  2DPP B;  3LX7 A;  2VXF A;  4JDS A;  3UPU A;  1Q86 U;  3FC3 A;  3VYG A;  3F70 A;  4XU1 A;  1BKB A;  3SDZ A;  4XTW A;  2RJD A;  1YJW A;  4DA4 A;  2DIQ A;  3G71 A;  4FM4 B;  2PVO B;  4IUU A;  4JS5 A;  4PLI A;  1QP3 A;  2RHZ A;  4F7U G;  2E64 A;  4OB0 B;  2RK2 A;  5CIU A;  3HSB A;  3FDR A;  3OBW A;  2WSC E;  3OYA A;  5DLO A;  4M7A G;  5GAN 3;  4PL6 A;  1KQS A;  1WPY A;  4O5V A;  5C6S A;  2X35 A;  3VUB A;  3QII A;  4A4G A;  4EMK A;  2PU9 B;  3L2Z A;  4XAX B;  2CYZ B;  5GAM d;  3NFC A;  4M75 G;  2R57 A;  4M77 G;  4YTL A;  3TCJ A;  4JRQ A;  3JCM P;  3GNF B;  1NJI C;  3C95 A;  3E1S A;  4R55 A;  5J3B A;  4A4K A;  2M16 A;  4MMK A;  4OVA A;  4PJO D;  1VQ7 T;  2LX9 A;  3CCM T;  2EQM A;  4VUB A;  4IUQ A;  4J6Y A;  2LNV A;  4EPC A;  3OY9 A;  1K8A U;  4BY6 B;  5GAM j;  4QVZ A;  3KBG A;  4BE1 A;  3INZ A;  2L89 A;  3HRU A;  4F7U F;  5CVI A;  1WNL A;  2ZPH B;  4IUP A;  3CCS A;  3OYB A;  1JBM A;  4JLG A;  3FB9 A;  5A0D A;  4IUV A;  4C92 G;  5CQX A;  1M4Z A;  3CCR A;  2DTH A;  5IN1 A;  3QBY A;  3QPH A;  4JLI A;  1BIA A;  5GAN 4;  2CGH A;  2JZ2 A;  2YRV A;  3MP6 A;  5FRM A;  2E6N A;  2XK0 A;  1QVF S;  2EQK A;  2QI2 A;  3PMI A;  5DLQ E;  3A8O B;  5A0L A;  2RHX A;  4OB3 B;  3PT9 A;  4RG2 A;  5GAN d;  4MZM A;  1BI2 A;  1KHC A;  1WJS A;  5GAN g;  4C0Z A;  4C8Q F;  1YJW T;  2RH2 A;  3I56 A;  3I55 T;  4OMF B;  3DLL A;  3GIB A;  5HK3 A;  3OS0 A;  2DIG A;  4KUD K;  4PJO A;  2DTO A;  4DQ2 A;  4JRK A;  1VQL T;  3NTH A;  4M77 D;  2EKO A;  4M75 D;  5GAM g;  4V2S A;  3JCM g;  5CKD A;  4M7D D;  1S72 A;  3HRS A;  4Y28 E;  1VQK T;  1KC8 U;  2A7Y A;  4XU0 A;  2EQU A;  4B9X A;  2RJF A;  2CS7 A;  5FRN A;  4LDU A;  3R6O A;  2ZPE B;  3LWI A;  3OYK A;  2MI6 A;  2WSE E;  3LLR A;  2JN0 A;  2ZZD A;  3A5Z B;  3QKJ A;  4J83 A;  3JCM c;  3WXM B;  4BE2 A;  1M1F A;  4OB1 B;  5CR2 A;  4A4E A;  2H3J A;  1O75 A;  2XHC A;  1D3B A;  3MEV A;  3QG1 A;  2QEX T;  2XID A;  3CMA A;  4BE0 A;  3V7S A;  5GAN 6;  2VC8 A;  4NOY A;  4BUG A;  1Y07 A;  2XDP A;  2CZ1 B;  3ASK A;  4B9W A;  2EJF A;  2ZPB B;  3QO3 A;  3I56 T;  4KUI A;  3BW1 A;  3JCM f;  5IT9 E;  4M7A E;  3WVD B;  3OMC A;  5LJ5 d;  1EIF A;  2L5Q A;  3V8K A;  4J5Y A;  2M0O A;  3X20 B;  1UGS B;  3BDL A;  4JUV A;  4ZGJ B;  2EQJ A;  5D6W A;  1UEB A;  4ELZ C;  3PIO A;  1VQO A;  3NTI A;  1ZBX A;  4LDW A;  4C8Q E;  4Y91 A;  2KK4 A;  3QZ9 B;  4ZGD B;  1G3Y A;  5GAN 7;  1ZQ1 A;  2GFA A;  4JRP A;  2VGM A;  3PMT A;  4IKF A;  4JS4 A;  4C92 B;  1I5L A;  1JJ2 A;  4M78 E;  1M90 C;  5GAO q;  1W4S A;  2EFI A;  4E7K A;  3DLM A;  5LJ5 g;  1DJ7 B;  4N4G A;  1QVF A;  4C5H A;  1YBY A;  2YHT A;  3OW2 S;  2E12 A;  1M9S A;  4II1 A;  2LRQ A;  2JUF A;  3CC2 A;  3ER0 A;  3L2W A;  3JB9 G;  3N5B B;  3SFM A;  2PQW A;  3ZEH A;  4HCB A;  3PGG A;  3QUI A;  4M75 E;  4M77 E;  2DD5 A;  4BD3 A;  4C8Q B;  1U8R A;  3RKX A;  1VQ4 A;  1VQP T;  2V8I A;  3QHS A;  2KDS A;  4FSX A;  1M1K C;  3L2V A;  1N8R C;  4QW2 A;  4IUT A;  5FU7 C;  4HCC A;  5A2Q E;  2VXE A;  3QZ5 B;  3OYH A;  3CCV T;  1VQM T;  1JB0 E;  2HAX A;  2EWN A;  4FT2 A;  3M57 A;  3QYH B;  2K5L A;  3TRE A;  1I8F A;  1M90 U;  3M53 A;  3Q1J A;  2QQ9 A;  3JAM E;  1I81 A;  1YHQ A;  4XU2 A;  1OYX A;  5LJ3 e;  2ZPF B;  4QQ6 A;  3QSU A;  4HKE A;  5GMK h;  3HRT A;  5FU6 B;  1M5Q 1;  1NE8 A;  1WQ7 A;  5L8R E;  4C92 C;  5J26 A;  5GAO m;  2Y4Y A;  2VV5 A;  2E6Z A;  2JOY A;  2QA4 A;  4GLK A;  3CD6 T;  4C8Q G;  3OQ5 A;  4C5G A;  1YIT A;  1VQ8 A;  2MF2 A;  3OS5 A;  2EJ9 A;  2DXB A;  4GY5 A;  2V8K A;  2E5Q A;  4E7I A;  3UT1 A;  1K9M U;  5CKE A;  2JTM A;  2RHY A;  3MEA A;  2RM4 A;  1N6A A;  2XKO C;  1YJ9 T;  1N8R U;  3M54 A;  2O4X A;  5KH6 A;  1H64 1;  4MDW A;  3RER A;  4ZN1 A;  2GCX A;  1YIJ T;  1FX7 A;  3RUX A;  4N4H A;  3QJY A;  2DTI A;  4M78 D;  4A54 A;  5HY6 A;  1LJO A;  1VQ6 A;  2DVE A;  3CCJ A;  3CBM A;  5CQY A;  2Y90 A;  3S3M A;  2X4Y A;  4C92 D;  2VGN A;  4KBM B;  3O8V A;  2QA4 T;  4ELY C;  1U1T A;  3FEO A;  2K5I A;  3LGF A;  2HNI A;  2O4X B;  3CCL A;  1IRE B;  2NLU A;  2M1H A;  2R5M A;  2D0Q B;  1KD1 C;  4PJO G;  4A4F A;  1VQK A;  1XQH A;  5GAN 8;  1P92 A;  1YHQ T;  3SWN A;  2I2L A;  1VUB A;  3CC4 A;  4F7U A;  2B8A A;  4CRI A;  3PFS A;  3OYE A;  4L5G A;  2HD0 A;  2X4J A;  1X75 C;  3C12 A;  2RHU A;  5LJ3 g;  3CD6 A;  3OYN A;  3CC7 T;  1XTD A;  4X9C A;  1NPR A;  2LT1 A;  3MET A;  2F5K A;  1SSF A;  4F7U B;  1QVG A;  1VQN T;  1LOJ A;  2E41 A;  2DZ9 A;  2RJC A;  2EJG A;  2K3X A;  4P5N A;  4C5E A;  4FIB A;  3JCM b;  3TU4 K;  4XTX A;  3G6E T;  4MDX A;  2K57 A;  3RKY A;  4M78 B;  4EMK C;  3L2U A;  4NS5 A;  3C94 A;  5DM7 R;  2RO0 A;  4LDX A;  2DXT A;  3CBO A;  5LJ5 e;  3CME T;  1Q82 C;  2CZ7 B;  4A53 A;  4ZTJ A;  3V8L A;  2MAM A;  3OYJ A;  3OBY A;  4PNO A;  4M7D B;  3L42 A;  3SD4 A;  1I4K 1;  3GLX A;  3M4Y A;  3MP8 A;  2MWP A;  4M75 B;  4M77 B;  5LJ5 f;  3CCU A;  3VU3 C;  4X34 A;  1OI1 A;  3A8G B;  2RHI A;  5J39 A;  3CC7 A;  1K73 U;  1UGR B;  1KD1 U;  5AYF A;  2FYK A;  3SWN B;  5CK9 A;  4C5I A;  1M1G A;  3J7A F;  2R58 A;  4EMH A;  3M59 A;  2JNG A;  3MEW A;  1NJI U;  5EG2 A;  5GMK i;  3KXT A;  3SB2 A;  1YJN A;  1G5V A;  2HQX A;  5I2S A;  5CKF A;  5CAI A;  1NPP A;  4XTZ A;  2EIF A;  2XDD A;  3OSS C;  2QEX A;  3X28 B;  4ME7 A;  3HFN A;  4M7D E;  3G71 T;  2XDB A;  2VUB A;  1VIE A;  2RD1 A;  3JCM J;  2OTL A;  2LTO A;  4QVC A;  2DEQ A;  2QQA A;  3DB3 A;  4C8Q D;  3AHU A;  2QDY B;  3JCM d;  3OYY A;  4BY6 C;  4ZGE B;  2RI2 A;  3V7C A;  1BI3 A;  1TH7 A;  2GQV A;  2K4Y A;  3JCM h;  3SWN C;  4XU3 A;  4J6W A;  2EAY A;  3UDC A;  4D6W A;  1JRI A;  2ZGW A;  1W2B S;  1Q86 C;  4C92 F;  2KAF A;  2RB6 A;  2F5T X;  4R56 A;  5CKH A;  4OGE A;  3TEE A;  1Q81 U;  4BDZ A;  4XTU A;  2HBP A;  2XI9 A;  3JCM e;  1Y7X A;  5GAM e;  2P0Q A;  1X6O A;  2OTL T;  3CCE A;  4M7D G;  1WJQ A;  1LNX A;  3OMG A;  3NTK A;  1HK9 A;  5GMK m;  1S72 T;  4QQG A;  3OA6 A;  5LJ3 j;  2YLC A;  3MHX A;  5GAN h;  3RMS A;  3URG A;  5GAN e;  5GAM f;  2QQR A;  5GAO n;  2RA2 A;  2RJE A;  2E10 A;  3L2Q A;  2KVQ G;  3L2R A;  2X4X A;  5GAN 2;  2E1H A;  5D6Y A;  2ZPI B;  1PSF A;  2LT4 A;  4J6X A;  3VYH B;  1UB4 A;  5GAO r;  5GAN j;  1VIF A;  5D6X A;  1B34 B;  2G3R A;  3DB4 A;  3JCM Q;  2LCC A;  4NL3 A;  3CC2 T;  4M78 C;  5I2M A;  3GOX A;  3CCM A;  1JJ2 S;  1FWZ A;  1G3W A;  3WVE B;  4CI0 C;  3S3O A;  3HP9 A;  1VQ7 A;  4M7A C;  5CKB A;  1KC8 C;  2OAU A;  3JCM W;  2DKG A;  3KUF A;  2P0K A;  3E9G A;  2JVV A;  3M55 A;  3QYG B;  3OYF A;  2CKK A;  3GP8 A;  5HK0 A;  2P0P A;  3X25 B;  4XTY A;  4LDV A;  3LWH A;  3G6E A;  2EYQ A;  4PLL A;  1Y96 B;  2L3R A;  2LQK A;  4M75 C;  4M77 C;  4MZT A;  4RCB A;  4XK8 E;  2DJZ A;  3BY7 A;  3A8H B;  1VQO T;  3G4S A;  2CZ6 B;  2D9T A;  4FT4 A;  2KY9 A;  5CCA A;  2BUD A;  4BI8 B;  2IG0 A;  4QVD A;  1H3Z A;  3FRN A;  1VQM A;  4M7A D;  1WQW A;  4RKU E;  3OYC A;  2WAC A;  4L59 A;  3FJP A;  1Y71 A;  3JB9 D;  3EFS A;  5GAO p;  1Q7Y U;  3G4S T;  4RCC A;  2K3Y A;  3GPL A;  3T9N A;  5GAM h;  3JRZ A;  2PUK B;  3LYI A;  4PKC C;  2OTJ A;  1BYM A;  3CMA T;  4PJO F;  3HPW A;  3HL8 A;  4LDY A;  4JJN K;  4L6V 5;  2DAQ A;  4OF1 A;  4C92 A;  5KCH A;  3CCL T;  2R5A A;  4HT8 A;  4DOV A;  4EMG A;  1BIB A;  3CXC A;  2QQB A;  3HKS A;  3M5A A;  5KCO A;  4RMO A;  1VQN A;  2ZCF B;  3MEU A;  4E7J A;  4MML A;  4C8Q C;  1GXI E;  3ZBD A;  4MZP A;  1YIJ A;  4LD9 K;  3QJ6 A;  4PJO B;  1BI1 A;  2FB7 A;  2QXF A;  3X24 B;  4XTV A;  2QTX A;  2PUO B;  1YI2 A;  2RI5 A;  4C0D C;  4O6J A;  3VV0 A;  3I55 A;  4JRI A;  3QDR B;  1YIT T;  5IAY A;  3ZFJ A;  1OZ3 A;  1IZ6 A;  3CC4 T;  1XOV A;  4BAC A;  1QVP A;  3EAE A;  4C8Q A;  4EMK B;  3RKW A;  5FU6 C;  2CZ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...