5GAN8

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
TLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 9
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan800
3QSUA 4M75B 3BFMA 4MMKA 5LJ3e 4WF2A 3JCMQ 4F7UB 3FIFA 4MMLA 2DEQA 4A54A 5GAN6 4QVDA 3HFOA 5LJ5d 4JUVA 3JB9J 1WPYA 4C92B 3V8LA 4PJOE 4NL2A 4M75F 1WQWA 2ZGWA 4M7AG 4F7UF 1WQ7A 5GAMd 1KQ1A 2DZ9A 1YCYA 4M78B 3V7SA 1N9RA 4J6YA 2CGHA 3BW1A 3SWNA 1LJOA 2YHTA 2DTOA 3EFRA 2E65A 3M4GA 3RESA 5GAN8 4M7AF 4EMKC 4M75C 1M5Q1 3L1AA 1I8FA 3RKWA 4QVCA 5LJ3g 1X01A 4M78F 2VC8A 2DTHA 4EMKA 4M75A 5GAN3 4NL3A 2EJGA 4HT9A 3AHUA 4F7UA 5GAOp 4JLIA 1B34B 1BIAA 3BY7A 3JCMJ 5GAMf 4J5YA 4M7DG 2YLCA 4M75G 4F7UG 1WNLA 4A53A 4XU2A 2QTXA 5GAMg 5GAOq 3JCMP 4M7AC 3JCMV 4M78C 5LJ3j 2JN0A 2DXTA 1LNXA 2DTIA 2E10A 4C8QB 1U1SA 2DVEA 5LJ5h 4M7AA 4C92G 4M7AE 4M78A 5GAN5 2E41A 4M7AD 4XU1A 3V7RA 4M7DF 5GMKl 4EMGA 4M78D 4PJOB 4V2SA 1D3BB 2EAYA 4XTVA 3RUXA 4M78G 5GAMe 5GMKh 3V8KA 5GAMj 3SWNC 3HSBA 1BIBA 3RIRA 4XQ3A 4C92F 4J6XA 5GANd 3JB9F 2RD1A 4M7DC 1M8VA 4M77B 5I21A 2RB6A 4XTWA 4M7DA 4EMHA 1I81A 4M75E 2Y90A 3QHSA 2VXEA 2VXFA 4F7UE 3JCMd 5GMKe 4M7DD 4M75D 3V8JA 4C92C 2RA2A 4M77F 5DY9A 4NOYA 3GIBA 4C92A 4C8QG 4C92E 5GAOn 3JB9H 4JRIA 4Y91A 5GAOm 3JCMW 1D3BA 5GANh 1H641 4C92D 5GAN2 5GANf 5GAN7 1MGQA 5CAIA 5LJ5f 3JB9D 4M78E 3JCMb 5GANg 3JB9G 3RKYA 1N9SA 5LJ5g 2E64A 1KQ2A 3JCMh 3V7CA 4C8QF 3QO3A 3JCMf 2DKGA 5GAOl 1JBMA 4XTUA 1HXDA 3JCMc 3QUIA 4N0AC 3JCMg 5GMKi 2DJZA 3L2ZA 4M77G 4PJOF 4JRKA 3BDUA 1B34A 4N0AA 5GANe 4XTXA 5LJ5e 5LJ5j 4C8QC 5GAOr 4M7DE 1TH7A 4RCCA 4EMKB 3FB9A 1I5LA 3EFSA 5LJ3d 4C8QA 2FB7A 4C8QE 4DQ2A 3JCMe 5GMKj 4HT8A 2I2LA 4PJOC 2E1HA 4J6WA 2EJFA 4C8QD 5GAN4 2DZCA 4XU0A 1Y96B 2YLBA 4RCBA 4OP0A 4PJOA 4X9DA 4PJOD 4M7AB 3INZA 4PJOG 4X9CA 2DXUA 2EJ9A 3PGGA 4HA8A 4M77C 2K57A 3JB9I 3VU3C 5LJ3h 3RKXA 1JRIA 5LJ3f 4M77A 4M77E 4XU3A 3HFNA 4PNOA 4XTZA 1LOJA 3SB2A 1HK9A 4M77D 1I4K1 3JCMX 4XTYA 3FJPA 1U1TA 2FYKA 2RM4A 3SWNB 2HNIA 5GANj 5GAMh 2EWNA 1Y96A 5GMKm 3RERA 4M7DB
chains in the Genus database with same CATH superfamily
4KGXB 4WF2A 1IGUA 1Q95G 5GAN6 1N8RR 1C6VX 3CCUA 4R56A 2VVKA 1WQWA 3LW5E 3OYGA 3LH0A 1KK7A 4IUPA 4AG1C 2MAMA 4EMKC 2RQRA 3L1AA 1I8FA 1KC8C 1R0BG 4FYXB 3I35A 4YTLA 1D0XA 4ZGJB 4FCYA 4M7DG 2YLCA 1YCSB 2RQTA 1Q82C 2VUBA 3OS1A 2RHZA 4RTZA 1VQ4T 4M7DF 1MNDA 1YJNQ 2QA4A 2L3PA 2A3LA 3CPWA 4XAXB 1Q81C 2FRYA 5GANd 1M8VA 1OZ3A 2DM1A 2RJDA 4IUQA 1PSEA 2GQVA 2RJEA 1I81A 4F7UE 1VQ6T 1WHKA 1M1KU 1VQ5Q 3EAEA 2CUBA 5J3BA 3TCJA 3M53A 1YP5A 3I9QA 5GANg 2E64A 2D1XA 3QDRB 2ZPEB 5A0LA 1C0MA 3JV3A 1TS9A 2NUZA 5LJ5e 3QJYA 1PKSA 4PFPA 2HQXA 2LT1A 2L0AA 3MP1A 1K8AC 2DZCA 2LZ6B 3CCRQ 3NGPA 1U06A 4F04B 2YUQA 2OTJQ 3UDCA 4D6WA 2L5QA 3PVQA 4J9EA 4LDXA 2X4JA 1OI1A 4M77C 3JB9I 2F2VA 5KYXA 3SB2A 2K2MA 4FYWB 4J9CA 2RHYA 3OSVA 2CP0A 5GMKm 1U5SA 1ABOA 4J7FA 4A54A 2EYWA 2KK4A 3R6NA 3M54A 3I55Q 2B86A 4F7UF 2IPOB 1RLPC 3SFMA 3QIIA 2E70A 3A98A 2GCXA 2KGTA 1M5Q1 4OMNA 1ZX6A 4BY6B 5C0MA 4J5YA 2HQHA 3E1SA 3ULRB 4A53A 3CCLQ 1BCOA 2XIDA 1M1FA 2LQNA 2FVUA 1V29B 3RUXA 3CC4A 1M1KR 2VASA 3V8KA 3EFOB 4AT1B 3OYFA 1QLYA 1KHCA 4M7DC 1QVGS 2EQKA 2M0OA 2DL5A 2BZXA 3OA6A 2WSEE 2RI2A 3GIBA 3M0PA 4DEYA 4C92E 2BUDA 3JCMW 3UWNA 2WSCE 2AZSA 3KXTA 3L2WA 2EGEA 1YBYA 1M90U 1WYXA 1OYXA 1YI2T 4LUDA 4FM4B 1JBMA 3GPLA 4JJDA 2MWOA 3QUIA 2V8JA 1QVGP 3EG2A 2CP7A 2EYYA 1VQ7T 4XTXA 2DA9A 2M02A 3P8BB 3VS2A 1SSHA 3FB9A 2I2LA 3EGDB 5A0GA 1YITQ 4OMQA 4JZ3A 2QQRA 3UPUA 1G5VA 2VB6A 2CZ1B 3G71T 3JCMX 1TTHB 3H0IA 2CZ7B 2RM4A 3CC2Q 1OPKA 5KYWA 2DD4A 5KYUB 2O2OA 3M9QA 4PJNA 3VKIA 1KC8U 2KRNA 1K9MU 4M78B 1QCFA 5FRMA 3SWNA 1Q82U 3R6OA 2A36A 5DLQE 1X01A 2D0NA 4ME7A 2MOXA 4NL3A 2CSIA 3WXMB 3CCST 4HT9A 5D7UA 4BE1A 2P4TA 1NZ9A 2QDLA 1VQ5A 3CD6Q 4XU2A 3NTIA 2O31A 4RMOA 2G3RA 2JT4A 3GF5A 3SWNC 5KYYB 2ABLA 1M90R 3CC7Q 3OYHA 3OS2A 4RTUA 4FT2A 3VS7A 1OPLA 2OTJA 3CCRA 1KD1U 5DY9A 3EG0A 1NYFA 1ZHIA 2O4XB 2KE9A 2L2PA 1QWFA 3M0UA 4BE2A 3QWYA 3HRSA 1OV3A 1JEGA 2C0IA 1T0HA 5L8RE 1K8AU 2OI3A 1XNIA 5FWCA 1MMAA 2EQMA 2EKHA 4LUEA 2FG0A 1VQMT 1KIKA 1XQHA 4AMCA 2DYBA 2JXBA 2NLUA 4JS4A 2OAWA 1N27A 3ZEHA 4BD3A 2XMFA 1WI7A 1Y96B 1D1AA 3I55A 1OU8A 3NMZC 2J7IA 2O9SA 1SEMA 3REBB 3DLMA 1VQ9Q 1UGRB 2MMPA 1KC8R 3ZFJA 4KGVB 1OULA 3M0TA 2OTLT 2PZ1A 3LX7A 1K9MR 2YUNA 1OX8A 3KBGA 4DA4A 1Q82R 3CCLA 3JCMQ 4MMKA 5HKCA 3ER0A 3CQTA 4QVDA 5CKDA 2XDPA 2QTVA 4JUVA 4DBFA 3OYCA 1ZUYA 1NLOC 1H92A 2DZ9A 3NPFA 2KXCA 3CCEQ 1YIJT 2ED1A 5KE3A 2DTHA 2EJGA 1AZEA 3C0CA 1PCXA 3OB9A 1WNLA 1TSFA 3TSZA 2DTIA 4M7AA 3C4SA 1KD1R 1GBQA 2VWFA 3PIOA 1D3BB 4M78G 2KAFA 3G7ZA 3QPHA 1GCQC 2JVVA 2RJFA 3VRZA 1IRXA 2D8JA 1VQLT 4HKEA 3X28B 1K8AR 3M0RA 4M75E 3OSSC 2LQKA 3QHSA 2DL8A 1IXDA 4K11A 2RHIA 1KJWA 1FX7A 3EH1A 3RMQA 1HSQA 3CCUQ 3JCMf 3EGXB 3UF4A 2RQUA 3CCQT 4BY6C 3MEUA 3QG1A 4N4IA 2RHXA 5J39A 1W6XA 3PE0A 3L2RA 4JJBA 4C8QA 4HT8A 3M57A 4XU0A 1UHFA 2PVDB 1VQOT 1WXBA 1ZSGA 3INZA 4LD6A 5IHNA 4PJOG 4X9CA 3JRZA 4IIMA 3I5RA 4LE9A 2QDYB 2YSQA 1MNEA 2OJ2A 2QXFA 3OW2A 1M1KC 4JS5A 3CD6A 1UECA 3RERA 1RABB 2JNGA 1G3YA 2ZPGB 4MMLA 1VIFA 5KYNA 4M75F 2JMCA 4D8DA 1PRLC 1MV3A 6AT1B 1RAEB 2CGHA 1KQSS 2YHTA 1FMVA 2LJ1A 1K4US 5KYUA 4OB2B 3RKWA 3FEOA 4BI8B 1K0SA 2K3BA 2QGGA 1QCNA 4E7JA 2ROTA 1ZSZB 4ZTJA 3F70A 3SHWA 3THKA 3LWIA 1HD3A 2CREA 3JAME 2HL5C 4M78A 3CPFA 1QP2A 2BE7D 4RTXA 1KQSP 3CMEQ 3X25B 4OMOA 3HSBA 2CSQA 1VQMA 1IO6A 4EPCA 1Y07A 4XQ3A 5J26A 4CRIA 2H8HA 3DB3A 2ZAEA 3KUFA 2KRSA 2KVQG 1QKXA 1X69A 1ZBJA 2H3EB 3PTAA 1D1CA 2AKKA 1X75C 4NOYA 3FJ5A 1DJ7B 2FPEA 1ACMB 1ZUUA 1SRLA 4RUGA 5IHKA 5M9OA 3CXCA 1VQ9A 2EQUA 2MPXC 2RHUA 1WIEA 2HDAA 2OTLA 3A5ZB 2K3YA 3VS3A 1WJRA 4DBRA 2HZYA 2NUTA 2X51A 5ECAA 4R55A 2E6NA 3BDUA 4DBQA 2R58A 2JTEA 3X24B 1NJIU 1TH7A 2RI5A 1RAFB 1UUEA 3JCMe 5A2QE 1Z9QA 2E1HA 1NYGA 4PJOA 2NUPB 1OEBA 1M2VA 3CCEA 2EJ9A 4HVVA 4PLLA 4XTZA 3CC4Q 2K5LA 4Z8AA 4XTYA 3H0HA 3UT1A 2HBWA 3CCMT 1Y96A 2KQWA 5C6SA 2PUKB 4F7UB 1NG2A 4RG2A 3OYEA 3M0SA 2HAXA 2RNAA 1WQ7A 4E47A 4L6V5 2XDDA 1TUDA 3M4GA 4LDVA 3CBPA 2RK2A 4JRPA 3OS5A 4M75C 5LJ5d 1E6HA 2VC8A 4EMKA 3HP9A 1VUBA 1R8OB 1MMNA 1EX4A 1U1SA 1KSWA 3H8ZA 5HK0A 1WLPB 1SRMA 3FRNA 1B3QA 2EAYA 5D6WA 5CKBA 3OYNA 2KYBA 4P5NA 4ELZC 1M3BA 2DJQA 4DOVA 4FT4A 4ANJA 2LP5A 1VQPT 1H3ZA 5I2SA 2QQSA 3V8JA 4AFQC 5KE2A 2DO3A 1K9MC 1UGVA 1NJIR 1D3BA 1V76A 3G1JA 1VQ4Q 5GANf 1TUCA 2DXBA 2BZYA 1JU5C 3JCMh 1SG5A 2LX9A 1TU0B 4HCKA 3A8GB 4A63B 4F14A 1S72T 4J9FA 4WCIA 4LNPA 2FEIA 3META 1VQ6Q 4BDYA 3TU4K 1W4SA 1GL5A 4RTYA 1AWOA 2YLBA 2W0ZA 2CT3A 3I56T 1AEYA 2EW3A 2VV5A 3MP8A 2GNCA 4M77A 4XU3A 1KD1C 2DX1A 1HK9A 4IIOA 4A4EA 1PKTA 2RK1A 4GBQA 2HD0A 2M1HA 3HFOA 1UE9A 3CMEA 2CP2A 4C92B 5DM7R 2JW4A 2PNIA 2K4YA 1RLQC 1LPLA 2Y4YA 3BW1A 3QXEB 2DETA 1RI0A 2RO0A 2CP6A 4NS5A 2LNVA 2CT4A 1YJWT 2F2WA 2JMAA 4F7UG 3NTHA 2E3HA 4XU1A 2M51A 3G4ST 3RIRA 3GOXA 2LCCA 3NHNA 4ZN3A 3CCJT 5I21A 1CKAA 4M7DA 2X4WA 3G6ET 3U23A 2JZ2A 1G2BA 1PD0A 2EIFA 4BDZA 3VS0A 1JO8A 3NTKA 2EBPA 3JB9H 3QDFA 4C92D 1WHGA 2VGMA 4PK4A 1X6BA 3MEWA 2EYZA 4N4GA 4B9XA 2J06A 1MMDA 1BU1A 5GANe 1B34A 1ZSZC 1PWTA 4AG2C 2RH2A 5CVIA 1UJYA 3I5SA 3OYMA 2DILA 5LJ3d 3PNWC 3C95A 2EJFA 2HCKA 4OB1B 1YI2Q 2KSSA 2DMOA 3PGGA 2O88A 3H0FA 3HFNA 3QWXX 3QZ5B 1VQ7Q 1OQKA 2ENMA 5GANj 4X1VA 4E7SA 2SEMA 4QQDA 4GY5A 2NUPA 5GJWB 1LVKA 3OY9A 3V8LA 5GAMd 4HVWA 2D6FA 4IURA 3G71Q 3H6ZA 1ARKA 1RUWA 7AT1B 2K3XA 4AFSC 2YT6A 4DOWA 1M4ZA 1QVPA 4FYYB 4F7UA 4D8KA 3CMAT 3VYHB 1NBEB 4C5HA 1UG1A 5IXBA 5GAMg 3UATA 1VQ4A 1TOVA 1ZUKA 4FSSA 2E10A 4M7AE 4C92G 5GAN5 2HBPA 3V7RA 2JTMA 2BIVA 2YRCA 4C92F 5FW9A 4J8OA 4KH1B 3CCSQ 2LRQA 2IVWA 1AZGB 1VQ6A 5FROA 4O5VA 4QVZA 4E6RA 2DRKA 5GMKe 4E7IA 2EQJA 3CCVT 1LCKA 3BE3A 5GANh 4R0KA 3EG3A 2D0QB 2IG0A 5D6XA 3FC3A 2DL7A 1QP3A 1M3CA 4KGZB 1D1BA 4A4FA 1RACB 2VKNA 1VQ8T 3M5AA 4C0DB 1IREB 4IUTA 1M3AA 1VQKT 3T9NA 3S6WA 4J9IA 4DQ2A 4C8QE 5GMKj 5GAN4 1AD5A 3VRYA 1VQNT 1M2OA 1UB4A 5IXFA 2DPPB 2KRMA 1YJWA 3ME9A 5CIUA 5HK3A 4FU6A 2HSPA 1I4K1 3OYIA 4FW2A 3FJPA 1VQMQ 2F69A 1WHLA 1YHQT 2RN8A 2HKNA 4M75B 4J83A 1WA7A 2L89A 3FIFA 1FMKA 3G4SA 2LJ3A 2E4HA 1H8KA 1UGPB 2GF7A 4NL2A 2P0KA 4M4ZA 3CCJA 2ROLA 1NJIC 2DRMA 1PD1A 2OTLQ 3CBOA 4CC4B 2DLPA 3LH5A 1VA7A 4OMFB 2MYSA 1OOTA 2L3RA 3L42A 2D9TA 3TREA 3AT1B 1PG5B 5CQYA 1BIAA 3Q1JA 1WJSA 4BE0A 1EZZB 1TXQA 2HQEA 3OW2S 3EG9B 4XTVA 5GMKh 4LDUA 5GAMj 1U8RA 1YIJQ 4ELYC 2G6FX 1GCQA 1YWOA 2RF0A 2VXFA 4J9DA 2RPNA 1WZOA 4M75D 2JS0A 4C92C 3OW2P 1WDXA 3OBYA 1YI2A 1MGQA 2QEXT 5CAIA 3DLLA 5CK9A 2KY9A 1YJ9T 4CC2A 2CS7A 1KQ2A 2K5IA 1VQ7A 1VQLQ 2L8DA 4MZTA 3UA7A 1AOJA 3PVLA 5IH2A 5AT1B 2CUDA 5GAOr 2K9GA 1ABQA 4LN2A 4J9GA 2QI2A 1ZA2B 4QKUA 3VUBA 2E5QA 1E6GA 1G8XA 2LDMA 3S3OA 4OF1A 1SHGA 3EFOA 3QBYA 2XDBA 2FPDA 3LGLA 3G71A 4Y92A 3CCQQ 1OZ2A 1QWEA 3CMAA 2J6KA 2K7AA 2ZPIB 1ZQ1A 2E12A 4GLMA 3CXCS 1TUGB 2HNIA 2EFIA 5GAMh 2EWNA 2F2XA 3M58A 2DF6A 9ATCB 1H3HA 4FW1A 3MKDA 4Y28E 2FO0A 1VQOQ 3EHQA 2BKDN 1YCYA 1UFFA 3CXCP 3PIPA 4J6YA 2X4YA 3CCSA 2YXYA 1Y7XA 2F5KA 2CP5A 3HRTA 2MF2A 3MPUB 4M75G 3EGDA 3J7AF 2Y4XA 2DNUA 2PTKA 2RJCA 1QQJA 3JCMP 2F5TX 1P92A 5FLXE 2AT1B 3GBQA 1UJ0A 4EMGA 1PRMC 2MWPA 1VQ8A 4Z88A 1QMCA 1VQKA 4JRQA 1BIBA 2B8AA 3L2QA 4J6XA 2QA4T 3OQ5A 1NEBA 4JZ4A 5KYXB 4C0GA 1JXOA 4BB7A 1JQQA 2CP3A 2R5MA 4TVRA 1UGQB 3DKMA 5GAOn 3EGUA 3PFSA 4N4HA 3M59A 3JB9D 1OU9A 1JJ2A 3IQLA 2YRVA 3X20B 1M8MA 1RAHB 3QO3A 4AFZC 3LGFA 1W2BA 1RI9A 1AHJB 2FHDA 4N0AC 2CH4W 1YFNA 3L2ZA 3CBMA 2LCLA 4PFOA 2EPDA 4QW2A 4RCCA 3A8LB 2LJ0A 1PNJA 5CCAA 4J6WA 4RTTA 1D09B 1I07A 1PHTA 5L23A 2P84A 2ZZDA 1X2KA 1EFNA 5KYYA 1M1GA 1X43A 1NPRA 2K57A 3S3NA 4IUVA 2JOYA 4M77E 3X26B 1YWPA 1LOJA 1M30A 3P8HA 2DL4A 3HL8A 2RQVA 2O4XA 2P0QA 1GBRA 2XD0A 3CPWS 2QQAA 3JB9J 1WPYA 3OYBA 4C5GA 1NM7A 1YIJA 3N5BB 4ATOA 4C0DC 4UC4A 3J80E 2KR3A 1I0CA 3RESA 4QT7A 2J6FA 1GFCA 3CPWP 3CCMQ 4M75A 3AHUA 1BI0A 1YJ9A 2E5KA 5CO7A 1WHMA 5GMKl 3A1PA 1RL2A 1W70A 1VQLA 1BB9A 4JLGA 1KG1A 3JB9F 2RD1A 4JJNK 2QASA 2GGRA 1M9SA 2BE9B 4E7KA 3P8DA 1RADB 3EG9A 4M77F 1W1FA 2MIOA 1EIFA 4E7ZA 5D6YA 3CCQA 2LQWA 1N9SA 5LJ5g 1GXIE 1M27C 2RI3A 4PKCC 1MUZA 2JUFA 3VS1A 1VQPQ 4JRKA 1BK2A 5EG2A 4Q5WA 2YUOA 1A0NB 2DE0X 3MCAB 1VQOA 2OX7A 1HYOA 4LDYA 2CZ0B 1WXTA 4OP0A 3H9NA 2RQWA 3FLGA 3NFCA 2X3XD 1O9SA 2A37A 2L3QA 2DIQA 2DK3A 2KEAA 3A8MB 2YDLA 1S72Q 2FZGB 2F1LA 2KT1A 2D8HA 1GRIA 2R5AA 2KROA 1WJQA 2FYKA 2XICA 4J9HA 4VUBA 3E2UA 4ESRA 1Q86C 2HMAA 5KCHA 4CC7A 1FWZA 4LD9K 3I56Q 1O75A 1X6OA 1X2QA 3EGXA 1UGSB 2X35A 3MEVA 3VV0A 1YJNT 4A4GA 2DEUA 3EFRA 4CI0C 2A08A 2COYA 4X34A 4DEXA 3BY7A 2JJ9A 3M0QA 4FSXA 1R77A 4HCCA 2DXTA 1QVFA 2X9HA 2QG9B 2LCSA 1VQ5T 5CKFA 4MDWA 2HEQA 3OYAA 2DERA 1WFWA 4KRTA 2NYSA 8ATCB 1BI2A 2DAQA 1I1JA 1YJWQ 2AK5A 3C12A 2AIRB 2EYQA 1RAAB 2RA2A 1FYNA 3D7SB 1SKUB 4OMPA 2ECZA 4JRIA 5GAOm 5LL6S 1MHNA 2OTJT 5GAN2 3CCRT 4DBHA 4B6MA 3A8OB 3RKYA 3G4SQ 2ESWA 2HSEB 3SD4A 2DKGA 4KBMB 4XTUA 1HXDA 5GJVB 2LT4A 5IN1A 3CCJQ 5GMKi 1ZLMA 3G6EQ 3RNJA 5LJ5j 2QAZA 1ZSZA 2KT8A 1UHCA 3QYHB 4RTVA 2XK0A 2DFUA 1Y57A 4RCBA 2EGAA 4X9DA 4PJLA 3VS6A 4ORZA 2LTOA 4M7AB 3I55T 2NWMA 4RTWA 1IHVA 4HCZA 5LJ3f 2DD5A 2DIGA 5A0DA 3CCMA 1UTIA 2CDTA 5FU6C 1T0JA 2PVOB 2M9UA 3BDLA 4F17A 3QSUA 1X6GA 1U3OA 3CCLT 2XKOC 1Q7YC 1G83A 4EIKA 4PJJA 2COZA 5FU7B 2XU8A 2FRWA 3MJXA 4JDSA 2EGCA 4ZTFA 5GAN8 1PSFA 4QVCA 5LJ3g 1K73C 2LNHB 5GAMf 1AT1B 2PVGB 3VUZA 3JCMV 4C8QB 4O6JA 5LJ5h 3RR6A 2C0OA 4Z89A 1S1NA 2E41A 4M7AD 2ED0A 1BYMA 4V2SA 1IHWA 2I0NA 1VQPA 1HJDA 4OB0B 2X4XA 4HVUA 4EMHA 3CMAQ 2KMTA 2KNBB 2Y90A 2SRCA 1ZBXA 2BTTA 4PFZA 2C06A 2MI6A 4OGEA 1YITT 3H41A 4EDUA 1S72A 3V7CA 4BI4A 1ZA1B 2V26A 4BI3A 2AZVA 3HTRA 4PLIA 4ZNXA 3OYYA 3PMTA 3ASKA 3CC2T 4L5GA 3CCVQ 1RAIB 1I5LA 3I56A 3OBWA 4OVAA 4C8QD 3GNFB 4LXCA 1YJNA 1SHFA 1Q86U 1FXXA 3GNGA 2CH4A 4C5IA 3SEMA 1T3LA 2WSFE 2AHJB 5CKHA 1G3WA 1VQ8Q 4PNOA 1WHHA 1G3SA 1VQKQ 2K5FA 4E7LA 1Q81U 4PJMA 5LJ3e 4L59A 2M16A 2H3JA 1VQNQ 3CD6T 5CKEA 3A8HB 1N5ZA 3MO8A 1MV0B 2COWA 5I2MA 2FPFA 4RG8A 3VJPA 4M7AG 1SF9A 5AYFA 2QQ9A 5IAYA 2K79A 1KQ1A 1QVGA 4KT0E 1SSFA 8AT1B 1N9RA 2PQWA 2KI7A 1IB8A 4A4KA 4M7AF 4C0ZA 3M56A 1RAGB 2NUTB 1YHQQ 3CC7T 2CZ6B 3OYJA 2KDSA 2PU9B 2DXCA 2QGFB 4A4HA 4KUIA 2QTXA 2V1RA 3OMGA 4AFUC 2JN0A 5LJ3j 4E7HA 1NPPA 2A0FB 1D0ZA 4PJOB 4M78D 4OMMA 5GAMe 4ZN1A 1N8RC 1YN8A 1M2VB 1TG0A 2JM9A 1BCMA 1NLPC 1BI3A 2Z0WA 3G6EA 1WGSA 3QKJA 4FL6A 1G3TA 4J7IA 5I22A 1Y71A 2VXEA 3TVTA 5I11A 2FL7A 3GP8A 2XG8D 3EH2A 3WVDB 4C92A 4C8QG 5IHIA 2MCNA 4J9BA 3RMSA 2YUPA 1D0YA 2R57A 4M78E 5CR2A 3J81E 1K9AA 4C8QF 4C0FA 1VQ9T 1VYTA 1QCOA 2V8KA 3PMIA 3MEAA 1VYUA 1Q86R 2DVJA 2DJZA 4GLKA 4FYVB 2EKOA 4F16A 3MP6A 3OYLA 4BACA 4EMKB 3EFSA 2FB7A 2QEXQ 1Q81R 3C94A 2CKKA 1KHIA 1YJ9Q 4PJOD 3VS5A 3S3MA 4XK8E 2DXUA 4OGCA 1J3TA 4HA8A 1VYVA 1WHJA 5LJ3h 3RKXA 3OYDA 2C0TA 1MMGA 3CCET 1Q7YU 2K6DA 2ZPFB 1JJ2S 1B07A 2HL3A 1B7TA 3QZ9B 5IT9E 2ATCB 1W2BS 1CKBA 3BFMA 2PUOB 3TEEA 2VGNA 2XI9A 1GCPA 1Z9ZA 1K73U 2KXDA 3E9FA 4PJOE 3E9GA 2ZGWA 2ZPHB 3VYGA 3V7SA 1JXMA 3L2VA 3O8VA 5HY6A 1JJ2P 1LJOA 1T3SA 3QYGB 1E7OA 1VIEA 1UEBA 2EVRA 4M78F 1W2BP 5KH6A 2LVMA 4JLIA 3JCMJ 2FZKB 3CEYA 4II1A 1SPKA 4JPBW 1YITA 4M7AC 1BI1A 5GAOq 3KFVA 3DB4A 4QQGA 2AKLA 2DVEA 4WTOB 1QW1A 3RBBB 2E3IA 2JM8A 3CCUT 1UDLA 3VS4A 3CC2A 4C5EA 1CSKA 4JJCA 4M77B 1FMWA 3CCVA 4KUDK 3OYKA 3JCMd 3HRUA 1XTDA 2GFAA 5FU7C 3HHTB 5GAN7 2LQ8A 2M0YA 1NEGA 2A28A 1WXUA 3WVEB 4RKUE 1XOVA 2VYTA 4IKFA 2GBQA 2QYZA 1NE8A 2QA4Q 2W10A 3JCMg 2IIMA 4PJOF 4Z02A 4N0AA 5KCOA 2DBMA 1N6AA 2MK5A 3JSCA 4C8QC 3L2UA 1GFDA 1PC0A 3HKSA 1VQNA 2X3WD 1Q7YR 3RDVA 5FU6B 3O5ZA 1AWJA 1QKWA 2V1QA 2ZPBB 2JS2A 2RMOA 3REAB 2EYXA 4PL6A 3CC7A 5EC7A 1K73R 1WX6A 3LLRA 4IUUA 4HXJA 1YHQA 4M77D 2GTOA 1U1TA 4KH0B 2LC4A 3HPWA 1AVZC 1F1BB 4FIBA 3ZL7C 4M7DB 4LDWA 2QK0A 2DEQA 2K2VA 2LX7A 3PT9A 3LYIA 1JB0E 3TQ7P 3CMET 1IGQA 3M4YA 1K0XA 3QJ6A 1OX9A 2DTOA 2E65A 2CYZB 3E19A 1XJWB 5GAN3 5GAOp 1N8RU 1B34B 2DBKA 2YWWA 2HKQB 2GFUA 4QQ6A 3OMCA 4MZPA 1AWXA 2L3SA 3GLXA 4MZMA 4M78C 1LNXA 5CQXA 4MDXA 2OAUA 2O01E 2J6OA 4BUGA 4CC3A 2QQBA 2E6ZA 1K1ZA 2LMJA 5FRNA 1AWWA 2FZCB 2RB6A 4XTWA 1K76A 1PM3A 1I5OB 2KBTA 4M7DD 1R0CB 3LWHA 3ZBDA 2QEXA 4OMLA 1Y0MA 4Y91A 1X27A 1H641 2WACA 3FDRA 5HCKA 2EQIA 5LJ5f 3JCMb 3JB9G 2GTJA 2DL3A 1IZ6A 5GAOl 4ZGEB 1TWBA 5FWBA 3JCMc 1QVFS 2V8IA 1YNZA 4M77G 3CC4T 2XHCA 3SDZA 2KYMA 3URGA 1M90C 4M7DE 2GQIA 2J05A 2BZ8A 2O9VA 1KFZA 4E2FB 1BKBA 4PJOC 5KYWB 1C1AA 4HCBA 2YRDA 2ZCFB 1KQSA 3TSWA 3OS0A 3EG1A 3M55A 3MHXA 1V1CA 2P0PA 4ZGDB 5DLOA 1QVFP 4B9WA 1VOMA 2A7YA 4KULA 3VU3C 1JRIA 2JTFA 3UA6A 3EHRA 2DYIA 3SWNB 2P4RA 4OB3B 1BBZA
chains in the Genus database with same CATH topology
3QSUA 2JNGA 1G3YA 4M75B 4J83A 4WF2A 2L89A 2ZPGB 3FIFA 4MMLA 1VIFA 5GAN6 3CCLT 2XKOC 3G4SA 3CCUA 1Q7YC 1UGPB 2GF7A 4R56A 4NL2A 2P0KA 1WQWA 4M75F 5FU7B 3LW5E 3OYGA 3LH0A 3CCJA 2XU8A 1NJIC 2CGHA 4JDSA 1KQSS 2YHTA 4IUPA 3CBOA 4ZTFA 2MAMA 5GAN8 4EMKC 1PSFA 4OB2B 3L1AA 1I8FA 4OMFB 3RKWA 4QVCA 2L3RA 3L42A 5LJ3g 1KC8C 2D9TA 3FEOA 1K73C 4BI8B 3TREA 5CQYA 4YTLA 1BIAA 4ZGJB 3Q1JA 1WJSA 5GAMf 4BE0A 4E7JA 4M7DG 2PVGB 2YLCA 3VUZA 4ZTJA 3F70A 3JCMV 3LWIA 4C8QB 2HQEA 2VUBA 4O6JA 1Q82C 3OW2S 3OS1A 5LJ5h 3JAME 4M78A 2E41A 1QP2A 2RHZA 3CPFA 1VQ4T 4M7DF 4M7AD 1BYMA 4V2SA 4XTVA 3X25B 5GMKh 4LDUA 5GAMj 2QA4A 1U8RA 2A3LA 3HSBA 3CPWA 1VQPA 1VQMA 4XAXB 4ELYC 4EPCA 1Y07A 1Q81C 4XQ3A 4OB0B 5J26A 4CRIA 3DB3A 5GANd 3KUFA 1M8VA 2X4XA 1OZ3A 2KVQG 2RJDA 1PSEA 2GQVA 4IUQA 2RJEA 4EMHA 1I81A 2KMTA 2Y90A 3PTAA 4F7UE 2VXFA 4M75D 4C92C 1ZBXA 1X75C 1VQ6T 4NOYA 1DJ7B 2C06A 3OBYA 2MI6A 1YI2A 1M1KU 3EAEA 5M9OA 3CXCA 1MGQA 4OGEA 5J3BA 2EQUA 3M53A 3TCJA 5CAIA 5CK9A 2QEXT 3DLLA 1YITT 2RHUA 5GANg 2KY9A 1YJ9T 2OTLA 3A5ZB 2CS7A 2E64A 4EDUA 1KQ2A 1S72A 3V7CA 2K3YA 2K5IA 4BI4A 1VQ7A 3QDRB 1WJRA 2ZPEB 5A0LA 2L8DA 4BI3A 4MZTA 4PLIA 4R55A 2E6NA 3BDUA 3OYYA 5LJ5e 3QJYA 2R58A 3X24B 3PMTA 3ASKA 5GAOr 2HQXA 2LT1A 4L5GA 1TH7A 2RI5A 1NJIU 3CC2T 1I5LA 2QI2A 3JCMe 5A2QE 3I56A 3OBWA 2E1HA 4OVAA 4C8QD 3MP1A 1K8AC 2DZCA 3GNFB 3VUBA 2E5QA 1YJNA 3UDCA 4PJOA 4D6WA 2LDMA 2L5QA 3S3OA 4OF1A 1Q86U 1FXXA 3GNGA 3QBYA 4LDXA 3LGLA 4C5IA 2X4JA 3G71A 2EJ9A 1OI1A 3CCEA 4M77C 2XDBA 3JB9I 2WSFE 1OZ2A 2AHJB 4PLLA 5CKHA 1G3WA 4PNOA 4XTZA 3CMAA 3SB2A 2ZPIB 3CXCS 1G3SA 1ZQ1A 2E12A 2K5LA 2K5FA 4XTYA 3UT1A 4E7LA 2RHYA 2HNIA 2EFIA 5GAMh 3CCMT 3OSVA 2EWNA 1Y96A 5GMKm 1Q81U 4JRPA 2KQWA 3M58A 5C6SA 4J7FA 2PUKB 4L59A 5LJ3e 2M16A 4F7UB 2H3JA 4RG2A 3CD6T 4Y28E 4A54A 2KK4A 3OYEA 3M54A 5CKEA 3A8HB 3MO8A 5I2MA 3VJPA 4RG8A 2HAXA 4M7AG 5AYFA 4F7UF 1WQ7A 2BKDN 2QQ9A 4E47A 5IAYA 1KQ1A 1QVGA 3SFMA 1YCYA 3QIIA 1SSFA 4KT0E 1N9RA 2PQWA 4J6YA 4L6V5 2XDDA 2X4YA 3PIPA 3CCSA 2E70A 4A4KA 2GCXA 3M4GA 4LDVA 3CBPA 2RK2A 4C0ZA 1Y7XA 1M5Q1 2F5KA 3OS5A 4M75C 5LJ5d 4M7AF 2VC8A 3M56A 3CC7T 4EMKA 3HP9A 1VUBA 3HRTA 4BY6B 5C0MA 2CZ6B 2MF2A 1R8OB 4J5YA 3OYJA 2KDSA 2PU9B 3E1SA 4M75G 2DXCA 3J7AF 2Y4XA 4KUIA 4A4HA 4A53A 2QTXA 2RJCA 3JCMP 3OMGA 5LJ3j 2JN0A 2F5TX 1U1SA 1NPPA 4E7HA 2XIDA 1M1FA 1P92A 3H8ZA 2FVUA 1V29B 5FLXE 5HK0A 4EMGA 4M78D 1VQ8A 4PJOB 2MWPA 3FRNA 5D6WA 2EAYA 3RUXA 3CC4A 5CKBA 5GAMe 4ZN1A 3OYNA 1N8RC 3V8KA 1VQKA 4P5NA 4ELZC 4JRQA 1BIBA 2B8AA 4DOVA 3OYFA 1BI3A 3L2QA 4J6XA 3G6EA 1WGSA 4FT4A 3QKJA 1KHCA 4FL6A 1G3TA 3OQ5A 4J7IA 2QA4T 4M7DC 1VQPT 4C0GA 4BB7A 1QVGS 2EQKA 2M0OA 1H3ZA 1Y71A 2VXEA 5I2SA 2QQSA 3V8JA 3OA6A 2WSEE 2FL7A 3GP8A 5KE2A 2R5MA 2RI2A 2XG8D 2DO3A 4TVRA 1UGQB 3WVDB 1K9MC 4C92A 4C8QG 3DKMA 2BUDA 4C92E 5GAOn 3JCMW 3UWNA 1D3BA 2WSCE 3PFSA 3RMSA 5GANf 3KXTA 3L2WA 3M59A 1YBYA 2DXBA 4N4HA 3JB9D 2R57A 4M78E 1M90U 1JJ2A 5CR2A 2YRVA 1OYXA 1YI2T 3GIBA 3J81E 3X20B 3JCMh 4C8QF 3QO3A 4C0FA 1VQ9T 2LX9A 4FM4B 3LGFA 1JBMA 3GPLA 2V8KA 3PMIA 1W2BA 2MWOA 3MEAA 3QUIA 1AHJB 2FHDA 2V8JA 3A8GB 4N0AC 2DJZA 3L2ZA 4GLKA 2EKOA 1S72T 3CBMA 2LCLA 1VQ7T 4XTXA 3MP6A 3P8BB 4QW2A 3OYLA 4RCCA 3META 3A8LB 4BACA 4EMKB 3FB9A 3EFSA 2FB7A 4BDYA 5CCAA 2I2LA 3TU4K 4J6WA 1W4SA 2YLBA 5A0GA 3C94A 2CKKA 1KHIA 2ZZDA 3I56T 4PJOD 3S3MA 4XK8E 2VV5A 2DXUA 4OGCA 2QQRA 1M1GA 4HA8A 3MP8A 1NPRA 2K57A 3S3NA 4IUVA 2JOYA 5LJ3h 3RKXA 3UPUA 1G5VA 4M77A 4M77E 4XU3A 3X26B 3OYDA 1KD1C 2CZ1B 1LOJA 3G71T 3CCET 1HK9A 1Q7YU 3P8HA 3JCMX 2ZPFB 1JJ2S 2CZ7B 4A4EA 2RM4A 2RK1A 3QZ9B 5IT9E 3HL8A 2DD4A 3M9QA 2HD0A 2O4XA 2P0QA 1W2BS 2XD0A 3CPWS 3BFMA 2PUOB 3TEEA 2M1HA 2VGNA 3HFOA 3VKIA 2QQAA 2XI9A 1KC8U 3CMEA 1K73U 3JB9J 3E9FA 1WPYA 4C92B 3E9GA 4PJOE 5DM7R 2ZGWA 4C5GA 2ZPHB 3OYBA 1YIJA 3N5BB 4ATOA 2K4YA 3VYGA 4C0DC 4UC4A 1K9MU 4M78B 5FRMA 3V7SA 2Y4YA 3L2VA 3O8VA 3BW1A 5HY6A 3SWNA 3QXEB 3J80E 1LJOA 1Q82U 3R6OA 3RESA 5DLQE 1RI0A 3QYGB 2RO0A 1VIEA 1UEBA 2LNVA 1X01A 4M78F 4NS5A 4ME7A 5KH6A 2LVMA 4M75A 3WXMB 4NL3A 3CCST 1YJWT 3AHUA 4HT9A 1BI0A 4JLIA 3JCMJ 4BE1A 3CEYA 2P4TA 4II1A 1NZ9A 1YITA 1VQ5A 4F7UG 4M7AC 4XU2A 1BI1A 5GAOq 1YJ9A 3NTIA 3DB4A 4QQGA 3NTHA 2DVEA 5CO7A 1QW1A 4XU1A 5GMKl 1RL2A 4RMOA 2G3RA 3GF5A 1VQLA 3G4ST 3SWNC 3CCUT 3RIRA 3GOXA 4JLGA 2LCCA 1KG1A 3CC2A 4C5EA 4ZN3A 3JB9F 2RD1A 3OYHA 4M77B 3CCJT 5I21A 4JJNK 3CCVA 3OS2A 4FT2A 4KUDK 4M7DA 2X4WA 1M9SA 3G6ET 3OYKA 3JCMd 3P8DA 2JZ2A 2EIFA 3CCRA 3HRUA 4BDZA 4M77F 4E7KA 1KD1U 5DY9A 2OTJA 1XTDA 3NTKA 2GFAA 1ZHIA 2O4XB 5FU7C 1EIFA 3HHTB 3JB9H 4C92D 5GAN7 2LQ8A 5D6YA 2VGMA 3WVEB 3CCQA 4RKUE 4BE2A 3HRSA 3MEWA 1N9SA 5LJ5g 1GXIE 1XOVA 2RI3A 4PKCC 2VYTA 4IKFA 5L8RE 4N4GA 4B9XA 1K8AU 2JUFA 1NE8A 3JCMg 1XNIA 4PJOF 4JRKA 4Z02A 5GANe 1B34A 2EQMA 4N0AA 5EG2A 5KCOA 4Q5WA 1N6AA 2RH2A 3JSCA 5CVIA 1VQMT 4C8QC 3L2UA 1XQHA 3MCAB 3HKSA 3OYMA 1VQNA 2NLUA 4JS4A 1VQOA 5LJ3d 5FU6B 3PNWC 1N27A 3C95A 4LDYA 3ZEHA 2EJFA 4BD3A 1Y96B 2CZ0B 3I55A 4OP0A 2ZPBB 4OB1B 2KSSA 3FLGA 3NFCA 1O9SA 3DLMA 3PGGA 4PL6A 1UGRB 2MMPA 2DIQA 2DK3A 3CC7A 3ZFJA 3A8MB 3LLRA 4IUUA 3HFNA 3QZ5B 1YHQA 4M77D 2OTLT 2R5AA 3LX7A 1WJQA 1U1TA 2FYKA 2XICA 4VUBA 2LC4A 5GANj 3HPWA 3KBGA 4DA4A 1Q86C 3CCLA 4FIBA 5KCHA 4QQDA 4M7DB 4GY5A 3JCMQ 4MMKA 4LDWA 5HKCA 3ER0A 2DEQA 1FWZA 2K2VA 4QVDA 2XDPA 5CKDA 4LD9K 4JUVA 3OY9A 1O75A 3OYCA 3V8LA 1X6OA 3PT9A 3LYIA 1JB0E 5GAMd 2DZ9A 1UGSB 2X35A 3M4YA 3MEVA 3VV0A 3CMET 1YJNT 4IURA 2D6FA 3QJ6A 4A4GA 3H6ZA 1YIJT 2DTOA 3EFRA 2E65A 2CYZB 2K3XA 3E19A 4CI0C 5KE3A 4DOWA 1M4ZA 1QVPA 2DTHA 5GAN3 4X34A 2EJGA 4F7UA 5GAOp 1N8RU 1B34B 3BY7A 3CMAT 3VYHB 4FSXA 3OB9A 2GFUA 3OMCA 4MZPA 4QQ6A 4C5HA 1WNLA 3GLXA 4MZMA 5GAMg 1VQ4A 4HCCA 4M78C 2DXTA 1LNXA 2DTIA 2E10A 4M7AA 1QVFA 4M7AE 5CQXA 4C92G 4MDXA 3C4SA 5GAN5 2OAUA 1VQ5T 2HBPA 2O01E 5CKFA 3V7RA 4MDWA 4BUGA 3OYAA 2QQBA 3PIOA 1D3BB 2JTMA 2E6ZA 4M78G 2KAFA 3G7ZA 3QPHA 2JVVA 2BIVA 2RJFA 1BI2A 4C92F 4J8OA 5FRNA 2DAQA 1VQLT 2LRQA 2IVWA 2RB6A 1VQ6A 4HKEA 4XTWA 3X28B 5FROA 3C12A 4M75E 4O5VA 1VQ9A 2EYQA 2LQKA 3OSSC 3QHSA 4QVZA 4M7DD 5GMKe 4E7IA 2EQJA 3LWHA 2RA2A 3ZBDA 3CCVT 2QEXA 2RHIA 4JRIA 4Y91A 5GAOm 5LL6S 1MHNA 1H641 5GANh 5GAN2 3CCRT 1FX7A 2OTJT 2WACA 3FDRA 3RMQA 5LJ5f 3A8OB 2D0QB 2IG0A 5D6XA 3JCMb 3FC3A 3JB9G 3RKYA 1QP3A 3SD4A 5GAOl 1IZ6A 2DKGA 3JCMf 4ZGEB 4KBMB 3CCQT 4XTUA 1HXDA 3JCMc 4BY6C 2LT4A 4A4FA 1QVFS 5IN1A 2V8IA 3MEUA 5GMKi 1VQ8T 3M5AA 4M77G 4C0DB 3QG1A 1IREB 4IUTA 2XHCA 4N4IA 3SDZA 3CC4T 1VQKT 2RHXA 3T9NA 5J39A 5LJ5j 3URGA 3L2RA 1M90C 4M7DE 3S6WA 4C8QA 4DQ2A 3M57A 4C8QE 3QYHB 4HT8A 5GMKj 1BKBA 4PJOC 5GAN4 4HCBA 2XK0A 4XU0A 2ZCFB 4RCBA 1KQSA 2PVDB 1VQNT 4X9DA 3OS0A 1VQOT 1UB4A 3M55A 3MHXA 2DPPB 2LTOA 4M7AB 2P0PA 3INZA 4LD6A 4PJOG 4X9CA 3JRZA 4ZGDB 5DLOA 3I55T 4B9WA 2A7YA 4KULA 4HCZA 3VU3C 1YJWA 1JRIA 3ME9A 5LJ3f 2QDYB 2DD5A 2JTFA 5CIUA 5HK3A 4FU6A 2DIGA 5A0DA 3CCMA 5FU6C 1I4K1 3OYIA 2QXFA 3FJPA 3SWNB 3OW2A 1M1KC 2PVOB 4JS5A 2F69A 1YHQT 3CD6A 4OB3B 2M9UA 3RERA 3BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSU A;  4M75 B;  3BFM A;  4MMK A;  5LJ3 e;  4WF2 A;  3JCM Q;  4F7U B;  3FIF A;  4MML A;  2DEQ A;  4A54 A;  5GAN 6;  4QVD A;  3HFO A;  5LJ5 d;  4JUV A;  3JB9 J;  1WPY A;  4C92 B;  3V8L A;  4PJO E;  4NL2 A;  4M75 F;  1WQW A;  2ZGW A;  4M7A G;  4F7U F;  1WQ7 A;  5GAM d;  1KQ1 A;  2DZ9 A;  1YCY A;  4M78 B;  3V7S A;  1N9R A;  4J6Y A;  2CGH A;  3BW1 A;  3SWN A;  1LJO A;  2YHT A;  2DTO A;  3EFR A;  2E65 A;  3M4G A;  3RES A;  5GAN 8;  4M7A F;  4EMK C;  4M75 C;  1M5Q 1;  3L1A A;  1I8F A;  3RKW A;  4QVC A;  5LJ3 g;  1X01 A;  4M78 F;  2VC8 A;  2DTH A;  4EMK A;  4M75 A;  5GAN 3;  4NL3 A;  2EJG A;  4HT9 A;  3AHU A;  4F7U A;  5GAO p;  4JLI A;  1B34 B;  1BIA A;  3BY7 A;  3JCM J;  5GAM f;  4J5Y A;  4M7D G;  2YLC A;  4M75 G;  4F7U G;  1WNL A;  4A53 A;  4XU2 A;  2QTX A;  5GAM g;  5GAO q;  3JCM P;  4M7A C;  3JCM V;  4M78 C;  5LJ3 j;  2JN0 A;  2DXT A;  1LNX A;  2DTI A;  2E10 A;  4C8Q B;  1U1S A;  2DVE A;  5LJ5 h;  4M7A A;  4C92 G;  4M7A E;  4M78 A;  5GAN 5;  2E41 A;  4M7A D;  4XU1 A;  3V7R A;  4M7D F;  5GMK l;  4EMG A;  4M78 D;  4PJO B;  4V2S A;  1D3B B;  2EAY A;  4XTV A;  3RUX A;  4M78 G;  5GAM e;  5GMK h;  3V8K A;  5GAM j;  3SWN C;  3HSB A;  1BIB A;  3RIR A;  4XQ3 A;  4C92 F;  4J6X A;  5GAN d;  3JB9 F;  2RD1 A;  4M7D C;  1M8V A;  4M77 B;  5I21 A;  2RB6 A;  4XTW A;  4M7D A;  4EMH A;  1I81 A;  4M75 E;  2Y90 A;  3QHS A;  2VXE A;  2VXF A;  4F7U E;  3JCM d;  5GMK e;  4M7D D;  4M75 D;  3V8J A;  4C92 C;  2RA2 A;  4M77 F;  5DY9 A;  4NOY A;  3GIB A;  4C92 A;  4C8Q G;  4C92 E;  5GAO n;  3JB9 H;  4JRI A;  4Y91 A;  5GAO m;  3JCM W;  1D3B A;  5GAN h;  1H64 1;  4C92 D;  5GAN 2;  5GAN f;  5GAN 7;  1MGQ A;  5CAI A;  5LJ5 f;  3JB9 D;  4M78 E;  3JCM b;  5GAN g;  3JB9 G;  3RKY A;  1N9S A;  5LJ5 g;  2E64 A;  1KQ2 A;  3JCM h;  3V7C A;  4C8Q F;  3QO3 A;  3JCM f;  2DKG A;  5GAO l;  1JBM A;  4XTU A;  1HXD A;  3JCM c;  3QUI A;  4N0A C;  3JCM g;  5GMK i;  2DJZ A;  3L2Z A;  4M77 G;  4PJO F;  4JRK A;  3BDU A;  1B34 A;  4N0A A;  5GAN e;  4XTX A;  5LJ5 e;  5LJ5 j;  4C8Q C;  5GAO r;  4M7D E;  1TH7 A;  4RCC A;  4EMK B;  3FB9 A;  1I5L A;  3EFS A;  5LJ3 d;  4C8Q A;  2FB7 A;  4C8Q E;  4DQ2 A;  3JCM e;  5GMK j;  4HT8 A;  2I2L A;  4PJO C;  2E1H A;  4J6W A;  2EJF A;  4C8Q D;  5GAN 4;  2DZC A;  4XU0 A;  1Y96 B;  2YLB A;  4RCB A;  4OP0 A;  4PJO A;  4X9D A;  4PJO D;  4M7A B;  3INZ A;  4PJO G;  4X9C A;  2DXU A;  2EJ9 A;  3PGG A;  4HA8 A;  4M77 C;  2K57 A;  3JB9 I;  3VU3 C;  5LJ3 h;  3RKX A;  1JRI A;  5LJ3 f;  4M77 A;  4M77 E;  4XU3 A;  3HFN A;  4PNO A;  4XTZ A;  1LOJ A;  3SB2 A;  1HK9 A;  4M77 D;  1I4K 1;  3JCM X;  4XTY A;  3FJP A;  1U1T A;  2FYK A;  2RM4 A;  3SWN B;  2HNI A;  5GAN j;  5GAM h;  2EWN A;  1Y96 A;  5GMK m;  3RER A;  4M7D B; 
#chains in the Genus database with same CATH topology
 4KGX B;  4WF2 A;  1IGU A;  1Q95 G;  5GAN 6;  1N8R R;  1C6V X;  3CCU A;  4R56 A;  2VVK A;  1WQW A;  3LW5 E;  3OYG A;  3LH0 A;  1KK7 A;  4IUP A;  4AG1 C;  2MAM A;  4EMK C;  2RQR A;  3L1A A;  1I8F A;  1KC8 C;  1R0B G;  4FYX B;  3I35 A;  4YTL A;  1D0X A;  4ZGJ B;  4FCY A;  4M7D G;  2YLC A;  1YCS B;  2RQT A;  1Q82 C;  2VUB A;  3OS1 A;  2RHZ A;  4RTZ A;  1VQ4 T;  4M7D F;  1MND A;  1YJN Q;  2QA4 A;  2L3P A;  2A3L A;  3CPW A;  4XAX B;  1Q81 C;  2FRY A;  5GAN d;  1M8V A;  1OZ3 A;  2DM1 A;  2RJD A;  4IUQ A;  1PSE A;  2GQV A;  2RJE A;  1I81 A;  4F7U E;  1VQ6 T;  1WHK A;  1M1K U;  1VQ5 Q;  3EAE A;  2CUB A;  5J3B A;  3TCJ A;  3M53 A;  1YP5 A;  3I9Q A;  5GAN g;  2E64 A;  2D1X A;  3QDR B;  2ZPE B;  5A0L A;  1C0M A;  3JV3 A;  1TS9 A;  2NUZ A;  5LJ5 e;  3QJY A;  1PKS A;  4PFP A;  2HQX A;  2LT1 A;  2L0A A;  3MP1 A;  1K8A C;  2DZC A;  2LZ6 B;  3CCR Q;  3NGP A;  1U06 A;  4F04 B;  2YUQ A;  2OTJ Q;  3UDC A;  4D6W A;  2L5Q A;  3PVQ A;  4J9E A;  4LDX A;  2X4J A;  1OI1 A;  4M77 C;  3JB9 I;  2F2V A;  5KYX A;  3SB2 A;  2K2M A;  4FYW B;  4J9C A;  2RHY A;  3OSV A;  2CP0 A;  5GMK m;  1U5S A;  1ABO A;  4J7F A;  4A54 A;  2EYW A;  2KK4 A;  3R6N A;  3M54 A;  3I55 Q;  2B86 A;  4F7U F;  2IPO B;  1RLP C;  3SFM A;  3QII A;  2E70 A;  3A98 A;  2GCX A;  2KGT A;  1M5Q 1;  4OMN A;  1ZX6 A;  4BY6 B;  5C0M A;  4J5Y A;  2HQH A;  3E1S A;  3ULR B;  4A53 A;  3CCL Q;  1BCO A;  2XID A;  1M1F A;  2LQN A;  2FVU A;  1V29 B;  3RUX A;  3CC4 A;  1M1K R;  2VAS A;  3V8K A;  3EFO B;  4AT1 B;  3OYF A;  1QLY A;  1KHC A;  4M7D C;  1QVG S;  2EQK A;  2M0O A;  2DL5 A;  2BZX A;  3OA6 A;  2WSE E;  2RI2 A;  3GIB A;  3M0P A;  4DEY A;  4C92 E;  2BUD A;  3JCM W;  3UWN A;  2WSC E;  2AZS A;  3KXT A;  3L2W A;  2EGE A;  1YBY A;  1M90 U;  1WYX A;  1OYX A;  1YI2 T;  4LUD A;  4FM4 B;  1JBM A;  3GPL A;  4JJD A;  2MWO A;  3QUI A;  2V8J A;  1QVG P;  3EG2 A;  2CP7 A;  2EYY A;  1VQ7 T;  4XTX A;  2DA9 A;  2M02 A;  3P8B B;  3VS2 A;  1SSH A;  3FB9 A;  2I2L A;  3EGD B;  5A0G A;  1YIT Q;  4OMQ A;  4JZ3 A;  2QQR A;  3UPU A;  1G5V A;  2VB6 A;  2CZ1 B;  3G71 T;  3JCM X;  1TTH B;  3H0I A;  2CZ7 B;  2RM4 A;  3CC2 Q;  1OPK A;  5KYW A;  2DD4 A;  5KYU B;  2O2O A;  3M9Q A;  4PJN A;  3VKI A;  1KC8 U;  2KRN A;  1K9M U;  4M78 B;  1QCF A;  5FRM A;  3SWN A;  1Q82 U;  3R6O A;  2A36 A;  5DLQ E;  1X01 A;  2D0N A;  4ME7 A;  2MOX A;  4NL3 A;  2CSI A;  3WXM B;  3CCS T;  4HT9 A;  5D7U A;  4BE1 A;  2P4T A;  1NZ9 A;  2QDL A;  1VQ5 A;  3CD6 Q;  4XU2 A;  3NTI A;  2O31 A;  4RMO A;  2G3R A;  2JT4 A;  3GF5 A;  3SWN C;  5KYY B;  2ABL A;  1M90 R;  3CC7 Q;  3OYH A;  3OS2 A;  4RTU A;  4FT2 A;  3VS7 A;  1OPL A;  2OTJ A;  3CCR A;  1KD1 U;  5DY9 A;  3EG0 A;  1NYF A;  1ZHI A;  2O4X B;  2KE9 A;  2L2P A;  1QWF A;  3M0U A;  4BE2 A;  3QWY A;  3HRS A;  1OV3 A;  1JEG A;  2C0I A;  1T0H A;  5L8R E;  1K8A U;  2OI3 A;  1XNI A;  5FWC A;  1MMA A;  2EQM A;  2EKH A;  4LUE A;  2FG0 A;  1VQM T;  1KIK A;  1XQH A;  4AMC A;  2DYB A;  2JXB A;  2NLU A;  4JS4 A;  2OAW A;  1N27 A;  3ZEH A;  4BD3 A;  2XMF A;  1WI7 A;  1Y96 B;  1D1A A;  3I55 A;  1OU8 A;  3NMZ C;  2J7I A;  2O9S A;  1SEM A;  3REB B;  3DLM A;  1VQ9 Q;  1UGR B;  2MMP A;  1KC8 R;  3ZFJ A;  4KGV B;  1OUL A;  3M0T A;  2OTL T;  2PZ1 A;  3LX7 A;  1K9M R;  2YUN A;  1OX8 A;  3KBG A;  4DA4 A;  1Q82 R;  3CCL A;  3JCM Q;  4MMK A;  5HKC A;  3ER0 A;  3CQT A;  4QVD A;  5CKD A;  2XDP A;  2QTV A;  4JUV A;  4DBF A;  3OYC A;  1ZUY A;  1NLO C;  1H92 A;  2DZ9 A;  3NPF A;  2KXC A;  3CCE Q;  1YIJ T;  2ED1 A;  5KE3 A;  2DTH A;  2EJG A;  1AZE A;  3C0C A;  1PCX A;  3OB9 A;  1WNL A;  1TSF A;  3TSZ A;  2DTI A;  4M7A A;  3C4S A;  1KD1 R;  1GBQ A;  2VWF A;  3PIO A;  1D3B B;  4M78 G;  2KAF A;  3G7Z A;  3QPH A;  1GCQ C;  2JVV A;  2RJF A;  3VRZ A;  1IRX A;  2D8J A;  1VQL T;  4HKE A;  3X28 B;  1K8A R;  3M0R A;  4M75 E;  3OSS C;  2LQK A;  3QHS A;  2DL8 A;  1IXD A;  4K11 A;  2RHI A;  1KJW A;  1FX7 A;  3EH1 A;  3RMQ A;  1HSQ A;  3CCU Q;  3JCM f;  3EGX B;  3UF4 A;  2RQU A;  3CCQ T;  4BY6 C;  3MEU A;  3QG1 A;  4N4I A;  2RHX A;  5J39 A;  1W6X A;  3PE0 A;  3L2R A;  4JJB A;  4C8Q A;  4HT8 A;  3M57 A;  4XU0 A;  1UHF A;  2PVD B;  1VQO T;  1WXB A;  1ZSG A;  3INZ A;  4LD6 A;  5IHN A;  4PJO G;  4X9C A;  3JRZ A;  4IIM A;  3I5R A;  4LE9 A;  2QDY B;  2YSQ A;  1MNE A;  2OJ2 A;  2QXF A;  3OW2 A;  1M1K C;  4JS5 A;  3CD6 A;  1UEC A;  3RER A;  1RAB B;  2JNG A;  1G3Y A;  2ZPG B;  4MML A;  1VIF A;  5KYN A;  4M75 F;  2JMC A;  4D8D A;  1PRL C;  1MV3 A;  6AT1 B;  1RAE B;  2CGH A;  1KQS S;  2YHT A;  1FMV A;  2LJ1 A;  1K4U S;  5KYU A;  4OB2 B;  3RKW A;  3FEO A;  4BI8 B;  1K0S A;  2K3B A;  2QGG A;  1QCN A;  4E7J A;  2ROT A;  1ZSZ B;  4ZTJ A;  3F70 A;  3SHW A;  3THK A;  3LWI A;  1HD3 A;  2CRE A;  3JAM E;  2HL5 C;  4M78 A;  3CPF A;  1QP2 A;  2BE7 D;  4RTX A;  1KQS P;  3CME Q;  3X25 B;  4OMO A;  3HSB A;  2CSQ A;  1VQM A;  1IO6 A;  4EPC A;  1Y07 A;  4XQ3 A;  5J26 A;  4CRI A;  2H8H A;  3DB3 A;  2ZAE A;  3KUF A;  2KRS A;  2KVQ G;  1QKX A;  1X69 A;  1ZBJ A;  2H3E B;  3PTA A;  1D1C A;  2AKK A;  1X75 C;  4NOY A;  3FJ5 A;  1DJ7 B;  2FPE A;  1ACM B;  1ZUU A;  1SRL A;  4RUG A;  5IHK A;  5M9O A;  3CXC A;  1VQ9 A;  2EQU A;  2MPX C;  2RHU A;  1WIE A;  2HDA A;  2OTL A;  3A5Z B;  2K3Y A;  3VS3 A;  1WJR A;  4DBR A;  2HZY A;  2NUT A;  2X51 A;  5ECA A;  4R55 A;  2E6N A;  3BDU A;  4DBQ A;  2R58 A;  2JTE A;  3X24 B;  1NJI U;  1TH7 A;  2RI5 A;  1RAF B;  1UUE A;  3JCM e;  5A2Q E;  1Z9Q A;  2E1H A;  1NYG A;  4PJO A;  2NUP B;  1OEB A;  1M2V A;  3CCE A;  2EJ9 A;  4HVV A;  4PLL A;  4XTZ A;  3CC4 Q;  2K5L A;  4Z8A A;  4XTY A;  3H0H A;  3UT1 A;  2HBW A;  3CCM T;  1Y96 A;  2KQW A;  5C6S A;  2PUK B;  4F7U B;  1NG2 A;  4RG2 A;  3OYE A;  3M0S A;  2HAX A;  2RNA A;  1WQ7 A;  4E47 A;  4L6V 5;  2XDD A;  1TUD A;  3M4G A;  4LDV A;  3CBP A;  2RK2 A;  4JRP A;  3OS5 A;  4M75 C;  5LJ5 d;  1E6H A;  2VC8 A;  4EMK A;  3HP9 A;  1VUB A;  1R8O B;  1MMN A;  1EX4 A;  1U1S A;  1KSW A;  3H8Z A;  5HK0 A;  1WLP B;  1SRM A;  3FRN A;  1B3Q A;  2EAY A;  5D6W A;  5CKB A;  3OYN A;  2KYB A;  4P5N A;  4ELZ C;  1M3B A;  2DJQ A;  4DOV A;  4FT4 A;  4ANJ A;  2LP5 A;  1VQP T;  1H3Z A;  5I2S A;  2QQS A;  3V8J A;  4AFQ C;  5KE2 A;  2DO3 A;  1K9M C;  1UGV A;  1NJI R;  1D3B A;  1V76 A;  3G1J A;  1VQ4 Q;  5GAN f;  1TUC A;  2DXB A;  2BZY A;  1JU5 C;  3JCM h;  1SG5 A;  2LX9 A;  1TU0 B;  4HCK A;  3A8G B;  4A63 B;  4F14 A;  1S72 T;  4J9F A;  4WCI A;  4LNP A;  2FEI A;  3MET A;  1VQ6 Q;  4BDY A;  3TU4 K;  1W4S A;  1GL5 A;  4RTY A;  1AWO A;  2YLB A;  2W0Z A;  2CT3 A;  3I56 T;  1AEY A;  2EW3 A;  2VV5 A;  3MP8 A;  2GNC A;  4M77 A;  4XU3 A;  1KD1 C;  2DX1 A;  1HK9 A;  4IIO A;  4A4E A;  1PKT A;  2RK1 A;  4GBQ A;  2HD0 A;  2M1H A;  3HFO A;  1UE9 A;  3CME A;  2CP2 A;  4C92 B;  5DM7 R;  2JW4 A;  2PNI A;  2K4Y A;  1RLQ C;  1LPL A;  2Y4Y A;  3BW1 A;  3QXE B;  2DET A;  1RI0 A;  2RO0 A;  2CP6 A;  4NS5 A;  2LNV A;  2CT4 A;  1YJW T;  2F2W A;  2JMA A;  4F7U G;  3NTH A;  2E3H A;  4XU1 A;  2M51 A;  3G4S T;  3RIR A;  3GOX A;  2LCC A;  3NHN A;  4ZN3 A;  3CCJ T;  5I21 A;  1CKA A;  4M7D A;  2X4W A;  3G6E T;  3U23 A;  2JZ2 A;  1G2B A;  1PD0 A;  2EIF A;  4BDZ A;  3VS0 A;  1JO8 A;  3NTK A;  2EBP A;  3JB9 H;  3QDF A;  4C92 D;  1WHG A;  2VGM A;  4PK4 A;  1X6B A;  3MEW A;  2EYZ A;  4N4G A;  4B9X A;  2J06 A;  1MMD A;  1BU1 A;  5GAN e;  1B34 A;  1ZSZ C;  1PWT A;  4AG2 C;  2RH2 A;  5CVI A;  1UJY A;  3I5S A;  3OYM A;  2DIL A;  5LJ3 d;  3PNW C;  3C95 A;  2EJF A;  2HCK A;  4OB1 B;  1YI2 Q;  2KSS A;  2DMO A;  3PGG A;  2O88 A;  3H0F A;  3HFN A;  3QWX X;  3QZ5 B;  1VQ7 Q;  1OQK A;  2ENM A;  5GAN j;  4X1V A;  4E7S A;  2SEM A;  4QQD A;  4GY5 A;  2NUP A;  5GJW B;  1LVK A;  3OY9 A;  3V8L A;  5GAM d;  4HVW A;  2D6F A;  4IUR A;  3G71 Q;  3H6Z A;  1ARK A;  1RUW A;  7AT1 B;  2K3X A;  4AFS C;  2YT6 A;  4DOW A;  1M4Z A;  1QVP A;  4FYY B;  4F7U A;  4D8K A;  3CMA T;  3VYH B;  1NBE B;  4C5H A;  1UG1 A;  5IXB A;  5GAM g;  3UAT A;  1VQ4 A;  1TOV A;  1ZUK A;  4FSS A;  2E10 A;  4M7A E;  4C92 G;  5GAN 5;  2HBP A;  3V7R A;  2JTM A;  2BIV A;  2YRC A;  4C92 F;  5FW9 A;  4J8O A;  4KH1 B;  3CCS Q;  2LRQ A;  2IVW A;  1AZG B;  1VQ6 A;  5FRO A;  4O5V A;  4QVZ A;  4E6R A;  2DRK A;  5GMK e;  4E7I A;  2EQJ A;  3CCV T;  1LCK A;  3BE3 A;  5GAN h;  4R0K A;  3EG3 A;  2D0Q B;  2IG0 A;  5D6X A;  3FC3 A;  2DL7 A;  1QP3 A;  1M3C A;  4KGZ B;  1D1B A;  4A4F A;  1RAC B;  2VKN A;  1VQ8 T;  3M5A A;  4C0D B;  1IRE B;  4IUT A;  1M3A A;  1VQK T;  3T9N A;  3S6W A;  4J9I A;  4DQ2 A;  4C8Q E;  5GMK j;  5GAN 4;  1AD5 A;  3VRY A;  1VQN T;  1M2O A;  1UB4 A;  5IXF A;  2DPP B;  2KRM A;  1YJW A;  3ME9 A;  5CIU A;  5HK3 A;  4FU6 A;  2HSP A;  1I4K 1;  3OYI A;  4FW2 A;  3FJP A;  1VQM Q;  2F69 A;  1WHL A;  1YHQ T;  2RN8 A;  2HKN A;  4M75 B;  4J83 A;  1WA7 A;  2L89 A;  3FIF A;  1FMK A;  3G4S A;  2LJ3 A;  2E4H A;  1H8K A;  1UGP B;  2GF7 A;  4NL2 A;  2P0K A;  4M4Z A;  3CCJ A;  2ROL A;  1NJI C;  2DRM A;  1PD1 A;  2OTL Q;  3CBO A;  4CC4 B;  2DLP A;  3LH5 A;  1VA7 A;  4OMF B;  2MYS A;  1OOT A;  2L3R A;  3L42 A;  2D9T A;  3TRE A;  3AT1 B;  1PG5 B;  5CQY A;  1BIA A;  3Q1J A;  1WJS A;  4BE0 A;  1EZZ B;  1TXQ A;  2HQE A;  3OW2 S;  3EG9 B;  4XTV A;  5GMK h;  4LDU A;  5GAM j;  1U8R A;  1YIJ Q;  4ELY C;  2G6F X;  1GCQ A;  1YWO A;  2RF0 A;  2VXF A;  4J9D A;  2RPN A;  1WZO A;  4M75 D;  2JS0 A;  4C92 C;  3OW2 P;  1WDX A;  3OBY A;  1YI2 A;  1MGQ A;  2QEX T;  5CAI A;  3DLL A;  5CK9 A;  2KY9 A;  1YJ9 T;  4CC2 A;  2CS7 A;  1KQ2 A;  2K5I A;  1VQ7 A;  1VQL Q;  2L8D A;  4MZT A;  3UA7 A;  1AOJ A;  3PVL A;  5IH2 A;  5AT1 B;  2CUD A;  5GAO r;  2K9G A;  1ABQ A;  4LN2 A;  4J9G A;  2QI2 A;  1ZA2 B;  4QKU A;  3VUB A;  2E5Q A;  1E6G A;  1G8X A;  2LDM A;  3S3O A;  4OF1 A;  1SHG A;  3EFO A;  3QBY A;  2XDB A;  2FPD A;  3LGL A;  3G71 A;  4Y92 A;  3CCQ Q;  1OZ2 A;  1QWE A;  3CMA A;  2J6K A;  2K7A A;  2ZPI B;  1ZQ1 A;  2E12 A;  4GLM A;  3CXC S;  1TUG B;  2HNI A;  2EFI A;  5GAM h;  2EWN A;  2F2X A;  3M58 A;  2DF6 A;  9ATC B;  1H3H A;  4FW1 A;  3MKD A;  4Y28 E;  2FO0 A;  1VQO Q;  3EHQ A;  2BKD N;  1YCY A;  1UFF A;  3CXC P;  3PIP A;  4J6Y A;  2X4Y A;  3CCS A;  2YXY A;  1Y7X A;  2F5K A;  2CP5 A;  3HRT A;  2MF2 A;  3MPU B;  4M75 G;  3EGD A;  3J7A F;  2Y4X A;  2DNU A;  2PTK A;  2RJC A;  1QQJ A;  3JCM P;  2F5T X;  1P92 A;  5FLX E;  2AT1 B;  3GBQ A;  1UJ0 A;  4EMG A;  1PRM C;  2MWP A;  1VQ8 A;  4Z88 A;  1QMC A;  1VQK A;  4JRQ A;  1BIB A;  2B8A A;  3L2Q A;  4J6X A;  2QA4 T;  3OQ5 A;  1NEB A;  4JZ4 A;  5KYX B;  4C0G A;  1JXO A;  4BB7 A;  1JQQ A;  2CP3 A;  2R5M A;  4TVR A;  1UGQ B;  3DKM A;  5GAO n;  3EGU A;  3PFS A;  4N4H A;  3M59 A;  3JB9 D;  1OU9 A;  1JJ2 A;  3IQL A;  2YRV A;  3X20 B;  1M8M A;  1RAH B;  3QO3 A;  4AFZ C;  3LGF A;  1W2B A;  1RI9 A;  1AHJ B;  2FHD A;  4N0A C;  2CH4 W;  1YFN A;  3L2Z A;  3CBM A;  2LCL A;  4PFO A;  2EPD A;  4QW2 A;  4RCC A;  3A8L B;  2LJ0 A;  1PNJ A;  5CCA A;  4J6W A;  4RTT A;  1D09 B;  1I07 A;  1PHT A;  5L23 A;  2P84 A;  2ZZD A;  1X2K A;  1EFN A;  5KYY A;  1M1G A;  1X43 A;  1NPR A;  2K57 A;  3S3N A;  4IUV A;  2JOY A;  4M77 E;  3X26 B;  1YWP A;  1LOJ A;  1M30 A;  3P8H A;  2DL4 A;  3HL8 A;  2RQV A;  2O4X A;  2P0Q A;  1GBR A;  2XD0 A;  3CPW S;  2QQA A;  3JB9 J;  1WPY A;  3OYB A;  4C5G A;  1NM7 A;  1YIJ A;  3N5B B;  4ATO A;  4C0D C;  4UC4 A;  3J80 E;  2KR3 A;  1I0C A;  3RES A;  4QT7 A;  2J6F A;  1GFC A;  3CPW P;  3CCM Q;  4M75 A;  3AHU A;  1BI0 A;  1YJ9 A;  2E5K A;  5CO7 A;  1WHM A;  5GMK l;  3A1P A;  1RL2 A;  1W70 A;  1VQL A;  1BB9 A;  4JLG A;  1KG1 A;  3JB9 F;  2RD1 A;  4JJN K;  2QAS A;  2GGR A;  1M9S A;  2BE9 B;  4E7K A;  3P8D A;  1RAD B;  3EG9 A;  4M77 F;  1W1F A;  2MIO A;  1EIF A;  4E7Z A;  5D6Y A;  3CCQ A;  2LQW A;  1N9S A;  5LJ5 g;  1GXI E;  1M27 C;  2RI3 A;  4PKC C;  1MUZ A;  2JUF A;  3VS1 A;  1VQP Q;  4JRK A;  1BK2 A;  5EG2 A;  4Q5W A;  2YUO A;  1A0N B;  2DE0 X;  3MCA B;  1VQO A;  2OX7 A;  1HYO A;  4LDY A;  2CZ0 B;  1WXT A;  4OP0 A;  3H9N A;  2RQW A;  3FLG A;  3NFC A;  2X3X D;  1O9S A;  2A37 A;  2L3Q A;  2DIQ A;  2DK3 A;  2KEA A;  3A8M B;  2YDL A;  1S72 Q;  2FZG B;  2F1L A;  2KT1 A;  2D8H A;  1GRI A;  2R5A A;  2KRO A;  1WJQ A;  2FYK A;  2XIC A;  4J9H A;  4VUB A;  3E2U A;  4ESR A;  1Q86 C;  2HMA A;  5KCH A;  4CC7 A;  1FWZ A;  4LD9 K;  3I56 Q;  1O75 A;  1X6O A;  1X2Q A;  3EGX A;  1UGS B;  2X35 A;  3MEV A;  3VV0 A;  1YJN T;  4A4G A;  2DEU A;  3EFR A;  4CI0 C;  2A08 A;  2COY A;  4X34 A;  4DEX A;  3BY7 A;  2JJ9 A;  3M0Q A;  4FSX A;  1R77 A;  4HCC A;  2DXT A;  1QVF A;  2X9H A;  2QG9 B;  2LCS A;  1VQ5 T;  5CKF A;  4MDW A;  2HEQ A;  3OYA A;  2DER A;  1WFW A;  4KRT A;  2NYS A;  8ATC B;  1BI2 A;  2DAQ A;  1I1J A;  1YJW Q;  2AK5 A;  3C12 A;  2AIR B;  2EYQ A;  1RAA B;  2RA2 A;  1FYN A;  3D7S B;  1SKU B;  4OMP A;  2ECZ A;  4JRI A;  5GAO m;  5LL6 S;  1MHN A;  2OTJ T;  5GAN 2;  3CCR T;  4DBH A;  4B6M A;  3A8O B;  3RKY A;  3G4S Q;  2ESW A;  2HSE B;  3SD4 A;  2DKG A;  4KBM B;  4XTU A;  1HXD A;  5GJV B;  2LT4 A;  5IN1 A;  3CCJ Q;  5GMK i;  1ZLM A;  3G6E Q;  3RNJ A;  5LJ5 j;  2QAZ A;  1ZSZ A;  2KT8 A;  1UHC A;  3QYH B;  4RTV A;  2XK0 A;  2DFU A;  1Y57 A;  4RCB A;  2EGA A;  4X9D A;  4PJL A;  3VS6 A;  4ORZ A;  2LTO A;  4M7A B;  3I55 T;  2NWM A;  4RTW A;  1IHV A;  4HCZ A;  5LJ3 f;  2DD5 A;  2DIG A;  5A0D A;  3CCM A;  1UTI A;  2CDT A;  5FU6 C;  1T0J A;  2PVO B;  2M9U A;  3BDL A;  4F17 A;  3QSU A;  1X6G A;  1U3O A;  3CCL T;  2XKO C;  1Q7Y C;  1G83 A;  4EIK A;  4PJJ A;  2COZ A;  5FU7 B;  2XU8 A;  2FRW A;  3MJX A;  4JDS A;  2EGC A;  4ZTF A;  5GAN 8;  1PSF A;  4QVC A;  5LJ3 g;  1K73 C;  2LNH B;  5GAM f;  1AT1 B;  2PVG B;  3VUZ A;  3JCM V;  4C8Q B;  4O6J A;  5LJ5 h;  3RR6 A;  2C0O A;  4Z89 A;  1S1N A;  2E41 A;  4M7A D;  2ED0 A;  1BYM A;  4V2S A;  1IHW A;  2I0N A;  1VQP A;  1HJD A;  4OB0 B;  2X4X A;  4HVU A;  4EMH A;  3CMA Q;  2KMT A;  2KNB B;  2Y90 A;  2SRC A;  1ZBX A;  2BTT A;  4PFZ A;  2C06 A;  2MI6 A;  4OGE A;  1YIT T;  3H41 A;  4EDU A;  1S72 A;  3V7C A;  4BI4 A;  1ZA1 B;  2V26 A;  4BI3 A;  2AZV A;  3HTR A;  4PLI A;  4ZNX A;  3OYY A;  3PMT A;  3ASK A;  3CC2 T;  4L5G A;  3CCV Q;  1RAI B;  1I5L A;  3I56 A;  3OBW A;  4OVA A;  4C8Q D;  3GNF B;  4LXC A;  1YJN A;  1SHF A;  1Q86 U;  1FXX A;  3GNG A;  2CH4 A;  4C5I A;  3SEM A;  1T3L A;  2WSF E;  2AHJ B;  5CKH A;  1G3W A;  1VQ8 Q;  4PNO A;  1WHH A;  1G3S A;  1VQK Q;  2K5F A;  4E7L A;  1Q81 U;  4PJM A;  5LJ3 e;  4L59 A;  2M16 A;  2H3J A;  1VQN Q;  3CD6 T;  5CKE A;  3A8H B;  1N5Z A;  3MO8 A;  1MV0 B;  2COW A;  5I2M A;  2FPF A;  4RG8 A;  3VJP A;  4M7A G;  1SF9 A;  5AYF A;  2QQ9 A;  5IAY A;  2K79 A;  1KQ1 A;  1QVG A;  4KT0 E;  1SSF A;  8AT1 B;  1N9R A;  2PQW A;  2KI7 A;  1IB8 A;  4A4K A;  4M7A F;  4C0Z A;  3M56 A;  1RAG B;  2NUT B;  1YHQ Q;  3CC7 T;  2CZ6 B;  3OYJ A;  2KDS A;  2PU9 B;  2DXC A;  2QGF B;  4A4H A;  4KUI A;  2QTX A;  2V1R A;  3OMG A;  4AFU C;  2JN0 A;  5LJ3 j;  4E7H A;  1NPP A;  2A0F B;  1D0Z A;  4PJO B;  4M78 D;  4OMM A;  5GAM e;  4ZN1 A;  1N8R C;  1YN8 A;  1M2V B;  1TG0 A;  2JM9 A;  1BCM A;  1NLP C;  1BI3 A;  2Z0W A;  3G6E A;  1WGS A;  3QKJ A;  4FL6 A;  1G3T A;  4J7I A;  5I22 A;  1Y71 A;  2VXE A;  3TVT A;  5I11 A;  2FL7 A;  3GP8 A;  2XG8 D;  3EH2 A;  3WVD B;  4C92 A;  4C8Q G;  5IHI A;  2MCN A;  4J9B A;  3RMS A;  2YUP A;  1D0Y A;  2R57 A;  4M78 E;  5CR2 A;  3J81 E;  1K9A A;  4C8Q F;  4C0F A;  1VQ9 T;  1VYT A;  1QCO A;  2V8K A;  3PMI A;  3MEA A;  1VYU A;  1Q86 R;  2DVJ A;  2DJZ A;  4GLK A;  4FYV B;  2EKO A;  4F16 A;  3MP6 A;  3OYL A;  4BAC A;  4EMK B;  3EFS A;  2FB7 A;  2QEX Q;  1Q81 R;  3C94 A;  2CKK A;  1KHI A;  1YJ9 Q;  4PJO D;  3VS5 A;  3S3M A;  4XK8 E;  2DXU A;  4OGC A;  1J3T A;  4HA8 A;  1VYV A;  1WHJ A;  5LJ3 h;  3RKX A;  3OYD A;  2C0T A;  1MMG A;  3CCE T;  1Q7Y U;  2K6D A;  2ZPF B;  1JJ2 S;  1B07 A;  2HL3 A;  1B7T A;  3QZ9 B;  5IT9 E;  2ATC B;  1W2B S;  1CKB A;  3BFM A;  2PUO B;  3TEE A;  2VGN A;  2XI9 A;  1GCP A;  1Z9Z A;  1K73 U;  2KXD A;  3E9F A;  4PJO E;  3E9G A;  2ZGW A;  2ZPH B;  3VYG A;  3V7S A;  1JXM A;  3L2V A;  3O8V A;  5HY6 A;  1JJ2 P;  1LJO A;  1T3S A;  3QYG B;  1E7O A;  1VIE A;  1UEB A;  2EVR A;  4M78 F;  1W2B P;  5KH6 A;  2LVM A;  4JLI A;  3JCM J;  2FZK B;  3CEY A;  4II1 A;  1SPK A;  4JPB W;  1YIT A;  4M7A C;  1BI1 A;  5GAO q;  3KFV A;  3DB4 A;  4QQG A;  2AKL A;  2DVE A;  4WTO B;  1QW1 A;  3RBB B;  2E3I A;  2JM8 A;  3CCU T;  1UDL A;  3VS4 A;  3CC2 A;  4C5E A;  1CSK A;  4JJC A;  4M77 B;  1FMW A;  3CCV A;  4KUD K;  3OYK A;  3JCM d;  3HRU A;  1XTD A;  2GFA A;  5FU7 C;  3HHT B;  5GAN 7;  2LQ8 A;  2M0Y A;  1NEG A;  2A28 A;  1WXU A;  3WVE B;  4RKU E;  1XOV A;  2VYT A;  4IKF A;  2GBQ A;  2QYZ A;  1NE8 A;  2QA4 Q;  2W10 A;  3JCM g;  2IIM A;  4PJO F;  4Z02 A;  4N0A A;  5KCO A;  2DBM A;  1N6A A;  2MK5 A;  3JSC A;  4C8Q C;  3L2U A;  1GFD A;  1PC0 A;  3HKS A;  1VQN A;  2X3W D;  1Q7Y R;  3RDV A;  5FU6 B;  3O5Z A;  1AWJ A;  1QKW A;  2V1Q A;  2ZPB B;  2JS2 A;  2RMO A;  3REA B;  2EYX A;  4PL6 A;  3CC7 A;  5EC7 A;  1K73 R;  1WX6 A;  3LLR A;  4IUU A;  4HXJ A;  1YHQ A;  4M77 D;  2GTO A;  1U1T A;  4KH0 B;  2LC4 A;  3HPW A;  1AVZ C;  1F1B B;  4FIB A;  3ZL7 C;  4M7D B;  4LDW A;  2QK0 A;  2DEQ A;  2K2V A;  2LX7 A;  3PT9 A;  3LYI A;  1JB0 E;  3TQ7 P;  3CME T;  1IGQ A;  3M4Y A;  1K0X A;  3QJ6 A;  1OX9 A;  2DTO A;  2E65 A;  2CYZ B;  3E19 A;  1XJW B;  5GAN 3;  5GAO p;  1N8R U;  1B34 B;  2DBK A;  2YWW A;  2HKQ B;  2GFU A;  4QQ6 A;  3OMC A;  4MZP A;  1AWX A;  2L3S A;  3GLX A;  4MZM A;  4M78 C;  1LNX A;  5CQX A;  4MDX A;  2OAU A;  2O01 E;  2J6O A;  4BUG A;  4CC3 A;  2QQB A;  2E6Z A;  1K1Z A;  2LMJ A;  5FRN A;  1AWW A;  2FZC B;  2RB6 A;  4XTW A;  1K76 A;  1PM3 A;  1I5O B;  2KBT A;  4M7D D;  1R0C B;  3LWH A;  3ZBD A;  2QEX A;  4OML A;  1Y0M A;  4Y91 A;  1X27 A;  1H64 1;  2WAC A;  3FDR A;  5HCK A;  2EQI A;  5LJ5 f;  3JCM b;  3JB9 G;  2GTJ A;  2DL3 A;  1IZ6 A;  5GAO l;  4ZGE B;  1TWB A;  5FWB A;  3JCM c;  1QVF S;  2V8I A;  1YNZ A;  4M77 G;  3CC4 T;  2XHC A;  3SDZ A;  2KYM A;  3URG A;  1M90 C;  4M7D E;  2GQI A;  2J05 A;  2BZ8 A;  2O9V A;  1KFZ A;  4E2F B;  1BKB A;  4PJO C;  5KYW B;  1C1A A;  4HCB A;  2YRD A;  2ZCF B;  1KQS A;  3TSW A;  3OS0 A;  3EG1 A;  3M55 A;  3MHX A;  1V1C A;  2P0P A;  4ZGD B;  5DLO A;  1QVF P;  4B9W A;  1VOM A;  2A7Y A;  4KUL A;  3VU3 C;  1JRI A;  2JTF A;  3UA6 A;  3EHR A;  2DYI A;  3SWN B;  2P4R A;  4OB3 B;  1BBZ A; 
#chains in the Genus database with same CATH homology
 3QSU A;  2JNG A;  1G3Y A;  4M75 B;  4J83 A;  4WF2 A;  2L89 A;  2ZPG B;  3FIF A;  4MML A;  1VIF A;  5GAN 6;  3CCL T;  2XKO C;  3G4S A;  3CCU A;  1Q7Y C;  1UGP B;  2GF7 A;  4R56 A;  4NL2 A;  2P0K A;  1WQW A;  4M75 F;  5FU7 B;  3LW5 E;  3OYG A;  3LH0 A;  3CCJ A;  2XU8 A;  1NJI C;  2CGH A;  4JDS A;  1KQS S;  2YHT A;  4IUP A;  3CBO A;  4ZTF A;  2MAM A;  5GAN 8;  4EMK C;  1PSF A;  4OB2 B;  3L1A A;  1I8F A;  4OMF B;  3RKW A;  4QVC A;  2L3R A;  3L42 A;  5LJ3 g;  1KC8 C;  2D9T A;  3FEO A;  1K73 C;  4BI8 B;  3TRE A;  5CQY A;  4YTL A;  1BIA A;  4ZGJ B;  3Q1J A;  1WJS A;  5GAM f;  4BE0 A;  4E7J A;  4M7D G;  2PVG B;  2YLC A;  3VUZ A;  4ZTJ A;  3F70 A;  3JCM V;  3LWI A;  4C8Q B;  2HQE A;  2VUB A;  4O6J A;  1Q82 C;  3OW2 S;  3OS1 A;  5LJ5 h;  3JAM E;  4M78 A;  2E41 A;  1QP2 A;  2RHZ A;  3CPF A;  1VQ4 T;  4M7D F;  4M7A D;  1BYM A;  4V2S A;  4XTV A;  3X25 B;  5GMK h;  4LDU A;  5GAM j;  2QA4 A;  1U8R A;  2A3L A;  3HSB A;  3CPW A;  1VQP A;  1VQM A;  4XAX B;  4ELY C;  4EPC A;  1Y07 A;  1Q81 C;  4XQ3 A;  4OB0 B;  5J26 A;  4CRI A;  3DB3 A;  5GAN d;  3KUF A;  1M8V A;  2X4X A;  1OZ3 A;  2KVQ G;  2RJD A;  1PSE A;  2GQV A;  4IUQ A;  2RJE A;  4EMH A;  1I81 A;  2KMT A;  2Y90 A;  3PTA A;  4F7U E;  2VXF A;  4M75 D;  4C92 C;  1ZBX A;  1X75 C;  1VQ6 T;  4NOY A;  1DJ7 B;  2C06 A;  3OBY A;  2MI6 A;  1YI2 A;  1M1K U;  3EAE A;  5M9O A;  3CXC A;  1MGQ A;  4OGE A;  5J3B A;  2EQU A;  3M53 A;  3TCJ A;  5CAI A;  5CK9 A;  2QEX T;  3DLL A;  1YIT T;  2RHU A;  5GAN g;  2KY9 A;  1YJ9 T;  2OTL A;  3A5Z B;  2CS7 A;  2E64 A;  4EDU A;  1KQ2 A;  1S72 A;  3V7C A;  2K3Y A;  2K5I A;  4BI4 A;  1VQ7 A;  3QDR B;  1WJR A;  2ZPE B;  5A0L A;  2L8D A;  4BI3 A;  4MZT A;  4PLI A;  4R55 A;  2E6N A;  3BDU A;  3OYY A;  5LJ5 e;  3QJY A;  2R58 A;  3X24 B;  3PMT A;  3ASK A;  5GAO r;  2HQX A;  2LT1 A;  4L5G A;  1TH7 A;  2RI5 A;  1NJI U;  3CC2 T;  1I5L A;  2QI2 A;  3JCM e;  5A2Q E;  3I56 A;  3OBW A;  2E1H A;  4OVA A;  4C8Q D;  3MP1 A;  1K8A C;  2DZC A;  3GNF B;  3VUB A;  2E5Q A;  1YJN A;  3UDC A;  4PJO A;  4D6W A;  2LDM A;  2L5Q A;  3S3O A;  4OF1 A;  1Q86 U;  1FXX A;  3GNG A;  3QBY A;  4LDX A;  3LGL A;  4C5I A;  2X4J A;  3G71 A;  2EJ9 A;  1OI1 A;  3CCE A;  4M77 C;  2XDB A;  3JB9 I;  2WSF E;  1OZ2 A;  2AHJ B;  4PLL A;  5CKH A;  1G3W A;  4PNO A;  4XTZ A;  3CMA A;  3SB2 A;  2ZPI B;  3CXC S;  1G3S A;  1ZQ1 A;  2E12 A;  2K5L A;  2K5F A;  4XTY A;  3UT1 A;  4E7L A;  2RHY A;  2HNI A;  2EFI A;  5GAM h;  3CCM T;  3OSV A;  2EWN A;  1Y96 A;  5GMK m;  1Q81 U;  4JRP A;  2KQW A;  3M58 A;  5C6S A;  4J7F A;  2PUK B;  4L59 A;  5LJ3 e;  2M16 A;  4F7U B;  2H3J A;  4RG2 A;  3CD6 T;  4Y28 E;  4A54 A;  2KK4 A;  3OYE A;  3M54 A;  5CKE A;  3A8H B;  3MO8 A;  5I2M A;  3VJP A;  4RG8 A;  2HAX A;  4M7A G;  5AYF A;  4F7U F;  1WQ7 A;  2BKD N;  2QQ9 A;  4E47 A;  5IAY A;  1KQ1 A;  1QVG A;  3SFM A;  1YCY A;  3QII A;  1SSF A;  4KT0 E;  1N9R A;  2PQW A;  4J6Y A;  4L6V 5;  2XDD A;  2X4Y A;  3PIP A;  3CCS A;  2E70 A;  4A4K A;  2GCX A;  3M4G A;  4LDV A;  3CBP A;  2RK2 A;  4C0Z A;  1Y7X A;  1M5Q 1;  2F5K A;  3OS5 A;  4M75 C;  5LJ5 d;  4M7A F;  2VC8 A;  3M56 A;  3CC7 T;  4EMK A;  3HP9 A;  1VUB A;  3HRT A;  4BY6 B;  5C0M A;  2CZ6 B;  2MF2 A;  1R8O B;  4J5Y A;  3OYJ A;  2KDS A;  2PU9 B;  3E1S A;  4M75 G;  2DXC A;  3J7A F;  2Y4X A;  4KUI A;  4A4H A;  4A53 A;  2QTX A;  2RJC A;  3JCM P;  3OMG A;  5LJ3 j;  2JN0 A;  2F5T X;  1U1S A;  1NPP A;  4E7H A;  2XID A;  1M1F A;  1P92 A;  3H8Z A;  2FVU A;  1V29 B;  5FLX E;  5HK0 A;  4EMG A;  4M78 D;  1VQ8 A;  4PJO B;  2MWP A;  3FRN A;  5D6W A;  2EAY A;  3RUX A;  3CC4 A;  5CKB A;  5GAM e;  4ZN1 A;  3OYN A;  1N8R C;  3V8K A;  1VQK A;  4P5N A;  4ELZ C;  4JRQ A;  1BIB A;  2B8A A;  4DOV A;  3OYF A;  1BI3 A;  3L2Q A;  4J6X A;  3G6E A;  1WGS A;  4FT4 A;  3QKJ A;  1KHC A;  4FL6 A;  1G3T A;  3OQ5 A;  4J7I A;  2QA4 T;  4M7D C;  1VQP T;  4C0G A;  4BB7 A;  1QVG S;  2EQK A;  2M0O A;  1H3Z A;  1Y71 A;  2VXE A;  5I2S A;  2QQS A;  3V8J A;  3OA6 A;  2WSE E;  2FL7 A;  3GP8 A;  5KE2 A;  2R5M A;  2RI2 A;  2XG8 D;  2DO3 A;  4TVR A;  1UGQ B;  3WVD B;  1K9M C;  4C92 A;  4C8Q G;  3DKM A;  2BUD A;  4C92 E;  5GAO n;  3JCM W;  3UWN A;  1D3B A;  2WSC E;  3PFS A;  3RMS A;  5GAN f;  3KXT A;  3L2W A;  3M59 A;  1YBY A;  2DXB A;  4N4H A;  3JB9 D;  2R57 A;  4M78 E;  1M90 U;  1JJ2 A;  5CR2 A;  2YRV A;  1OYX A;  1YI2 T;  3GIB A;  3J81 E;  3X20 B;  3JCM h;  4C8Q F;  3QO3 A;  4C0F A;  1VQ9 T;  2LX9 A;  4FM4 B;  3LGF A;  1JBM A;  3GPL A;  2V8K A;  3PMI A;  1W2B A;  2MWO A;  3MEA A;  3QUI A;  1AHJ B;  2FHD A;  2V8J A;  3A8G B;  4N0A C;  2DJZ A;  3L2Z A;  4GLK A;  2EKO A;  1S72 T;  3CBM A;  2LCL A;  1VQ7 T;  4XTX A;  3MP6 A;  3P8B B;  4QW2 A;  3OYL A;  4RCC A;  3MET A;  3A8L B;  4BAC A;  4EMK B;  3FB9 A;  3EFS A;  2FB7 A;  4BDY A;  5CCA A;  2I2L A;  3TU4 K;  4J6W A;  1W4S A;  2YLB A;  5A0G A;  3C94 A;  2CKK A;  1KHI A;  2ZZD A;  3I56 T;  4PJO D;  3S3M A;  4XK8 E;  2VV5 A;  2DXU A;  4OGC A;  2QQR A;  1M1G A;  4HA8 A;  3MP8 A;  1NPR A;  2K57 A;  3S3N A;  4IUV A;  2JOY A;  5LJ3 h;  3RKX A;  3UPU A;  1G5V A;  4M77 A;  4M77 E;  4XU3 A;  3X26 B;  3OYD A;  1KD1 C;  2CZ1 B;  1LOJ A;  3G71 T;  3CCE T;  1HK9 A;  1Q7Y U;  3P8H A;  3JCM X;  2ZPF B;  1JJ2 S;  2CZ7 B;  4A4E A;  2RM4 A;  2RK1 A;  3QZ9 B;  5IT9 E;  3HL8 A;  2DD4 A;  3M9Q A;  2HD0 A;  2O4X A;  2P0Q A;  1W2B S;  2XD0 A;  3CPW S;  3BFM A;  2PUO B;  3TEE A;  2M1H A;  2VGN A;  3HFO A;  3VKI A;  2QQA A;  2XI9 A;  1KC8 U;  3CME A;  1K73 U;  3JB9 J;  3E9F A;  1WPY A;  4C92 B;  3E9G A;  4PJO E;  5DM7 R;  2ZGW A;  4C5G A;  2ZPH B;  3OYB A;  1YIJ A;  3N5B B;  4ATO A;  2K4Y A;  3VYG A;  4C0D C;  4UC4 A;  1K9M U;  4M78 B;  5FRM A;  3V7S A;  2Y4Y A;  3L2V A;  3O8V A;  3BW1 A;  5HY6 A;  3SWN A;  3QXE B;  3J80 E;  1LJO A;  1Q82 U;  3R6O A;  3RES A;  5DLQ E;  1RI0 A;  3QYG B;  2RO0 A;  1VIE A;  1UEB A;  2LNV A;  1X01 A;  4M78 F;  4NS5 A;  4ME7 A;  5KH6 A;  2LVM A;  4M75 A;  3WXM B;  4NL3 A;  3CCS T;  1YJW T;  3AHU A;  4HT9 A;  1BI0 A;  4JLI A;  3JCM J;  4BE1 A;  3CEY A;  2P4T A;  4II1 A;  1NZ9 A;  1YIT A;  1VQ5 A;  4F7U G;  4M7A C;  4XU2 A;  1BI1 A;  5GAO q;  1YJ9 A;  3NTI A;  3DB4 A;  4QQG A;  3NTH A;  2DVE A;  5CO7 A;  1QW1 A;  4XU1 A;  5GMK l;  1RL2 A;  4RMO A;  2G3R A;  3GF5 A;  1VQL A;  3G4S T;  3SWN C;  3CCU T;  3RIR A;  3GOX A;  4JLG A;  2LCC A;  1KG1 A;  3CC2 A;  4C5E A;  4ZN3 A;  3JB9 F;  2RD1 A;  3OYH A;  4M77 B;  3CCJ T;  5I21 A;  4JJN K;  3CCV A;  3OS2 A;  4FT2 A;  4KUD K;  4M7D A;  2X4W A;  1M9S A;  3G6E T;  3OYK A;  3JCM d;  3P8D A;  2JZ2 A;  2EIF A;  3CCR A;  3HRU A;  4BDZ A;  4M77 F;  4E7K A;  1KD1 U;  5DY9 A;  2OTJ A;  1XTD A;  3NTK A;  2GFA A;  1ZHI A;  2O4X B;  5FU7 C;  1EIF A;  3HHT B;  3JB9 H;  4C92 D;  5GAN 7;  2LQ8 A;  5D6Y A;  2VGM A;  3WVE B;  3CCQ A;  4RKU E;  4BE2 A;  3HRS A;  3MEW A;  1N9S A;  5LJ5 g;  1GXI E;  1XOV A;  2RI3 A;  4PKC C;  2VYT A;  4IKF A;  5L8R E;  4N4G A;  4B9X A;  1K8A U;  2JUF A;  1NE8 A;  3JCM g;  1XNI A;  4PJO F;  4JRK A;  4Z02 A;  5GAN e;  1B34 A;  2EQM A;  4N0A A;  5EG2 A;  5KCO A;  4Q5W A;  1N6A A;  2RH2 A;  3JSC A;  5CVI A;  1VQM T;  4C8Q C;  3L2U A;  1XQH A;  3MCA B;  3HKS A;  3OYM A;  1VQN A;  2NLU A;  4JS4 A;  1VQO A;  5LJ3 d;  5FU6 B;  3PNW C;  1N27 A;  3C95 A;  4LDY A;  3ZEH A;  2EJF A;  4BD3 A;  1Y96 B;  2CZ0 B;  3I55 A;  4OP0 A;  2ZPB B;  4OB1 B;  2KSS A;  3FLG A;  3NFC A;  1O9S A;  3DLM A;  3PGG A;  4PL6 A;  1UGR B;  2MMP A;  2DIQ A;  2DK3 A;  3CC7 A;  3ZFJ A;  3A8M B;  3LLR A;  4IUU A;  3HFN A;  3QZ5 B;  1YHQ A;  4M77 D;  2OTL T;  2R5A A;  3LX7 A;  1WJQ A;  1U1T A;  2FYK A;  2XIC A;  4VUB A;  2LC4 A;  5GAN j;  3HPW A;  3KBG A;  4DA4 A;  1Q86 C;  3CCL A;  4FIB A;  5KCH A;  4QQD A;  4M7D B;  4GY5 A;  3JCM Q;  4MMK A;  4LDW A;  5HKC A;  3ER0 A;  2DEQ A;  1FWZ A;  2K2V A;  4QVD A;  2XDP A;  5CKD A;  4LD9 K;  4JUV A;  3OY9 A;  1O75 A;  3OYC A;  3V8L A;  1X6O A;  3PT9 A;  3LYI A;  1JB0 E;  5GAM d;  2DZ9 A;  1UGS B;  2X35 A;  3M4Y A;  3MEV A;  3VV0 A;  3CME T;  1YJN T;  4IUR A;  2D6F A;  3QJ6 A;  4A4G A;  3H6Z A;  1YIJ T;  2DTO A;  3EFR A;  2E65 A;  2CYZ B;  2K3X A;  3E19 A;  4CI0 C;  5KE3 A;  4DOW A;  1M4Z A;  1QVP A;  2DTH A;  5GAN 3;  4X34 A;  2EJG A;  4F7U A;  5GAO p;  1N8R U;  1B34 B;  3BY7 A;  3CMA T;  3VYH B;  4FSX A;  3OB9 A;  2GFU A;  3OMC A;  4MZP A;  4QQ6 A;  4C5H A;  1WNL A;  3GLX A;  4MZM A;  5GAM g;  1VQ4 A;  4HCC A;  4M78 C;  2DXT A;  1LNX A;  2DTI A;  2E10 A;  4M7A A;  1QVF A;  4M7A E;  5CQX A;  4C92 G;  4MDX A;  3C4S A;  5GAN 5;  2OAU A;  1VQ5 T;  2HBP A;  2O01 E;  5CKF A;  3V7R A;  4MDW A;  4BUG A;  3OYA A;  2QQB A;  3PIO A;  1D3B B;  2JTM A;  2E6Z A;  4M78 G;  2KAF A;  3G7Z A;  3QPH A;  2JVV A;  2BIV A;  2RJF A;  1BI2 A;  4C92 F;  4J8O A;  5FRN A;  2DAQ A;  1VQL T;  2LRQ A;  2IVW A;  2RB6 A;  1VQ6 A;  4HKE A;  4XTW A;  3X28 B;  5FRO A;  3C12 A;  4M75 E;  4O5V A;  1VQ9 A;  2EYQ A;  2LQK A;  3OSS C;  3QHS A;  4QVZ A;  4M7D D;  5GMK e;  4E7I A;  2EQJ A;  3LWH A;  2RA2 A;  3ZBD A;  3CCV T;  2QEX A;  2RHI A;  4JRI A;  4Y91 A;  5GAO m;  5LL6 S;  1MHN A;  1H64 1;  5GAN h;  5GAN 2;  3CCR T;  1FX7 A;  2OTJ T;  2WAC A;  3FDR A;  3RMQ A;  5LJ5 f;  3A8O B;  2D0Q B;  2IG0 A;  5D6X A;  3JCM b;  3FC3 A;  3JB9 G;  3RKY A;  1QP3 A;  3SD4 A;  5GAO l;  1IZ6 A;  2DKG A;  3JCM f;  4ZGE B;  4KBM B;  3CCQ T;  4XTU A;  1HXD A;  3JCM c;  4BY6 C;  2LT4 A;  4A4F A;  1QVF S;  5IN1 A;  2V8I A;  3MEU A;  5GMK i;  1VQ8 T;  3M5A A;  4M77 G;  4C0D B;  3QG1 A;  1IRE B;  4IUT A;  2XHC A;  4N4I A;  3SDZ A;  3CC4 T;  1VQK T;  2RHX A;  3T9N A;  5J39 A;  5LJ5 j;  3URG A;  3L2R A;  1M90 C;  4M7D E;  3S6W A;  4C8Q A;  4DQ2 A;  3M57 A;  4C8Q E;  3QYH B;  4HT8 A;  5GMK j;  1BKB A;  4PJO C;  5GAN 4;  4HCB A;  2XK0 A;  4XU0 A;  2ZCF B;  4RCB A;  1KQS A;  2PVD B;  1VQN T;  4X9D A;  3OS0 A;  1VQO T;  1UB4 A;  3M55 A;  3MHX A;  2DPP B;  2LTO A;  4M7A B;  2P0P A;  3INZ A;  4LD6 A;  4PJO G;  4X9C A;  3JRZ A;  4ZGD B;  5DLO A;  3I55 T;  4B9W A;  2A7Y A;  4KUL A;  4HCZ A;  3VU3 C;  1YJW A;  1JRI A;  3ME9 A;  5LJ3 f;  2QDY B;  2DD5 A;  2JTF A;  5CIU A;  5HK3 A;  4FU6 A;  2DIG A;  5A0D A;  3CCM A;  5FU6 C;  1I4K 1;  3OYI A;  2QXF A;  3FJP A;  3SWN B;  3OW2 A;  1M1K C;  2PVO B;  4JS5 A;  2F69 A;  1YHQ T;  3CD6 A;  4OB3 B;  2M9U A;  3RER A;  3BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...