5GAN8

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
b'TLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 9
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan800
3EFRA 4PJOG 2CGHA 3JB9D 2DXTA 4M75E 4XTYA 2YLBA 2DXUA 4J6WA 5GAMj 1WQ7A 1WQWA 1I4K1 1B34A 4X9DA 5GAMe 3HSBA 3RESA 3QSUA 3JCMQ 3BW1A 1B34B 4M75C 1U1SA 3INZA 4XTWA 3V8JA 4XU0A 4M7DF 3BFMA 4JUVA 4C8QF 5GAN5 2DZCA 1KQ1A 1I8FA 1N9SA 1I81A 4M78E 3JCMb 2Y90A 4C92E 4F7UB 4JRIA 5GAMh 4M77F 3HFNA 2E65A 4M75G 3RUXA 5LJ3g 2JN0A 3JCMc 4C92C 5GAOp 5GANd 4M7DD 3V7CA 3L1AA 4C8QD 5GANg 2HNIA 2FB7A 2DKGA 5GAOq 4XQ3A 5GAN4 5GMKe 1JRIA 4M77D 3FB9A 3SWNA 4NL2A 2DZ9A 4J5YA 4M78G 4NOYA 1BIBA 4C92G 4EMGA 4PNOA 3SWNB 2QTXA 5I21A 5LJ5j 5GAN7 5GAOr 4XTXA 3QUIA 2DTOA 4F7UF 2YHTA 4QVCA 5LJ5e 2EJGA 1I5LA 5GAOm 4N0AC 4M7AE 4EMKC 3JCMe 4Y91A 5GAOl 4M77B 3JB9G 5GMKm 4EMHA 4XU1A 4HT9A 4PJOA 4M78A 4M7AC 4XTZA 5GMKl 5GAMg 4PJOB 4M7AD 5GAN6 4M78B 4M7DE 3FJPA 5LJ3d 4X9CA 4C8QE 5LJ5h 2DTIA 5DY9A 2FYKA 3JCMh 1M5Q1 4JRKA 3RKXA 4M7DC 1M8VA 1U1TA 1LJOA 2RA2A 3L2ZA 1H641 3M4GA 4M77E 5LJ3f 3V7RA 4C8QC 1HK9A 5GAN8 3GIBA 4M7AF 3EFSA 4MMLA 5GMKj 1YCYA 2E41A 3FIFA 4M77C 4M75A 4N0AA 5GANf 3AHUA 2RB6A 4M75B 3RIRA 3QO3A 4JLIA 4M7DG 4XTVA 4A54A 4C8QG 2EAYA 2VXFA 4PJOD 2VC8A 4M77G 2RM4A 4RCCA 1JBMA 4F7UE 5GAMd 3JCMX 5GMKh 2E1HA 4C92A 4M7DA 5LJ5g 1LOJA 3VU3C 1WPYA 2I2LA 4J6YA 4C8QA 4C92B 4DQ2A 5GAMf 5GANh 2EWNA 3JCMg 4M7DB 3RKWA 3V8LA 3BDUA 2DEQA 2E64A 1TH7A 3JB9H 3JCMV 4M75F 4A53A 3PGGA 4V2SA 4QVDA 4EMKA 2E10A 4XTUA 5CAIA 4XU3A 4WF2A 4NL3A 4M7AG 3JB9I 4EMKB 2DTHA 1BIAA 1LNXA 3V8KA 4XU2A 4F7UG 1KQ2A 3RERA 1D3BA 1WNLA 3RKYA 3JCMJ 1D3BB 3QHSA 2RD1A 2ZGWA 4PJOF 3SWNC 4M75D 4M78F 2EJFA 5LJ3j 4C92F 4MMKA 4M7AA 1HXDA 5GAN2 4OP0A 5LJ3e 4M7AB 4PJOE 4F7UA 3BY7A 4J6XA 5GANj 5GAN3 1X01A 1Y96A 2K57A 5GANe 3JB9F 1Y96B 2VXEA 5LJ5d 4RCBA 4PJOC 4HA8A 4HT8A 4M78C 3JCMd 3JCMW 1MGQA 3HFOA 4M78D 3JCMP 5GMKi 3JB9J 4C92D 2DVEA 2EJ9A 5LJ3h 4C8QB 5LJ5f 3SB2A 3JCMf 4M77A 3V7SA 1N9RA 5GAOn 2YLCA 2DJZA
chains in the Genus database with same CATH superfamily
2DVJA 4LE9A 3LW5E 4PJLA 1WI7A 2LJ1A 1B34A 2RJDA 1VQ6T 3CXCA 4JZ4A 2EGEA 2ZPHB 1YNZA 3G71Q 2HDAA 1U8RA 4XAXB 4AG2C 1SKUB 4NS5A 2HQHA 1Q82U 2KRNA 2D9TA 2CH4A 3REBB 1ARKA 3HKSA 5GANg 4PLIA 4RTTA 4MZMA 3P8BB 2VV5A 1T3SA 2O4XB 2ZAEA 4J5YA 1WDXA 1HYOA 1RI9A 4FYWB 2LDMA 4Y91A 5GAOl 3G6EA 1R0CB 2G3RA 2B8AA 2YDLA 3DB4A 3VS4A 1YI2T 3T9NA 1D09B 2F1LA 3JCMh 3CCEA 5KYXA 1ZHIA 1PNJA 1SEMA 3HTRA 2M02A 5IHKA 5KYUB 1YITT 2E41A 1K9MC 2KT8A 5FWCA 2RQTA 3ULRB 2ENMA 5FRMA 5IN1A 2VXFA 3EFOB 1SSHA 1N5ZA 1K9AA 4KRTA 4E7IA 2X4XA 3RBBB 1WPYA 2SEMA 2PVGB 1M1GA 4MZPA 2WSCE 3X24B 2L8DA 3M0RA 1B7TA 5J3BA 4E7ZA 4Y92A 1M9SA 4F7UG 2HBPA 1X43A 4E7SA 1AHJB 3EGDB 2LQWA 3DLMA 3HPWA 4JRQA 4J6XA 2X4YA 3THKA 2VXEA 2LNVA 2CP3A 5FRNA 3CCRQ 3HFOA 3FDRA 1IHWA 2DVEA 2EJ9A 3RR6A 3OYGA 3V7SA 2LCSA 1Q82C 2DM1A 4M75E 1WQWA 1N8RC 5GAMe 3HSBA 5KH6A 4E7JA 3A8OB 1KC8R 3VS6A 2CYZB 3CCMT 2GF7A 4IUPA 1R77A 3HFNA 2DRKA 1WJQA 1SHFA 3U23A 2KYBA 1VUBA 1GFDA 3EAEA 2FB7A 3KUFA 1JRIA 1YJWQ 2EYWA 1OOTA 5GAN7 2HCKA 4IUQA 3MEVA 2M1HA 2NLUA 2V1QA 1VQMA 1NLOC 3CBPA 3PNWC 2HAXA 2P84A 4XK8E 1XNIA 4GLMA 3H41A 5CKBA 3J80E 2NUTB 1RAGB 4OMFB 1VQNT 3EGXA 4MMLA 2PU9B 2FEIA 1BCOA 5GANf 1OYXA 3E1SA 1VQ7T 4ZGEB 2A28A 4OB3B 3A8HB 4RCCA 3CC2T 1ZUUA 5L23A 3PVQA 3IQLA 3FJ5A 4OMNA 2OTJT 1Y07A 3ZL7C 1K73R 1JQQA 3NTIA 1NEGA 4IKFA 2F5TX 4QQ6A 1AZEA 4WF2A 4EMKB 1MHNA 1D0ZA 4E7KA 5J26A 3MKDA 3CBOA 4FYYB 4FCYA 3G6EQ 2LCCA 3JSCA 1KIKA 3H8ZA 2KROA 4J9HA 2FRWA 5GANj 2DYIA 1JJ2S 1VQLT 4AG1C 2A0FB 3CCEQ 2KGTA 1M1KC 3UA6A 1UJYA 5CO7A 3M4YA 3MJXA 1SG5A 4ZN3A 2H3JA 2F5KA 1B07A 1BI3A 3CPWP 2L3SA 4JUVA 1UGSB 2YRVA 2DZCA 1GCQA 3EHRA 1RAEB 3M55A 4LD6A 2VGMA 5GAMh 2GGRA 2XIDA 2DD4A 2NUZA 5I2SA 3JRZA 4JLGA 2RMOA 4IUUA 2MYSA 4GLKA 3VS2A 1BIBA 1M30A 4BI3A 1QWEA 4ZNXA 1MMAA 1I0CA 2QK0A 1I1JA 4B9XA 3QDFA 3OYHA 5GMKl 4M7AD 3A98A 4WCIA 4LNPA 1RADB 4BE2A 3LWIA 2DTIA 4ZTFA 4JRKA 4M7DC 3C0CA 3OS1A 3E2UA 1W1FA 4C0DC 1GBRA 3GF5A 4HCKA 4M75A 1VQPT 1YJ9A 3DB3A 3TCJA 1K76A 1NPPA 4OGCA 3CC4T 3EG9B 4PFPA 5I11A 3ER0A 2KRMA 1LOJA 2QA4T 3VS0A 2CUBA 3VS5A 1S72T 3TU4K 1TH7A 2L0AA 4XTUA 4PK4A 3WXMB 1WXTA 1ZUKA 4C5EA 3G71T 3CCJQ 3SWNC 1TS9A 1VQMQ 5FU6C 4LDWA 4PJOE 1V29B 3EG1A 2VASA 2DPPB 2CZ7B 2J6OA 1EFNA 3JCMW 4M78D 3L42A 1YJNA 4MZTA 1VIEA 2W0ZA 4BDYA 4OGEA 2V1RA 4DOWA 4FW1A 4RMOA 3QSUA 3JCMQ 2X4WA 1G3TA 3MEAA 1VYUA 1VQ4A 2QASA 1K0XA 4M75G 2EQJA 1YHQA 1ZSZA 5LJ3g 1X6OA 4C92C 4E47A 4HCZA 4RTZA 2CKKA 4M7DD 1NE8A 1NPRA 3I56A 3UF4A 5GMKe 4M7AF 2HKQB 1K1ZA 1YBYA 4PFOA 1RI0A 4A4EA 5IT9E 4ESRA 3GLXA 3OYBA 4J9GA 5IH2A 1JU5C 2K5FA 2EFIA 1EZZB 3CBMA 2BUDA 4M77E 2NWMA 2RA2A 1NJIR 4C8QC 1ZA2B 1F1BB 2JT4A 3EG3A 5L8RE 2BE7D 3A1PA 4E6RA 4HCBA 2EKHA 2VGNA 3G4SQ 2RJEA 2QGFB 3CCRT 1YIJT 2HL3A 3SDZA 3JCMX 4JJNK 2HD0A 3MEUA 3CPWA 2KDSA 2I2LA 3META 2YUOA 1LCKA 2WACA 3JV3A 4V2SA 2WSFE 4L59A 3CXCP 2JTMA 3RKYA 2R58A 3JCMJ 2RD1A 4M78F 3MEWA 2CSIA 2V8KA 5KCOA 1OX8A 5FLXE 1Y96A 2RQWA 2E3HA 3ZBDA 3E19A 4C92D 2NUPA 2L3RA 1TSFA 2YLCA 1LPLA 1YJ9Q 3FLGA 2EYYA 1X2QA 1WQ7A 2LCLA 5DM7R 1I4K1 4C0ZA 3C4SA 4ME7A 4XTWA 1Q86R 4M7DF 2Z0WA 1NEBA 2V8IA 3QPHA 2YXYA 3OMCA 2VKNA 3OYDA 3SHWA 2ED0A 4QVZA 1KD1U 1SRLA 2K9GA 1S1NA 4C8QD 2BZ8A 1UUEA 5CQXA 4AT1B 4HXJA 2HZYA 4DEYA 3FB9A 2QTXA 4QKUA 2QQBA 1I5LA 4FSXA 4E2FB 4IIOA 2RO0A 4PJOA 1WX6A 2AHJB 4C5GA 4KH1B 4Q5WA 1UGVA 3X25B 1M8VA 3LGFA 7AT1B 5LJ3f 4DEXA 1HK9A 2BZYA 2PZ1A 3PT9A 2YRDA 3G6ET 2PVOB 3REAB 4KGVB 2EAYA 6AT1B 3OYIA 2E5QA 1D1CA 1VQ9A 2KMTA 1UDLA 2RM4A 3PE0A 1BU1A 1QVGA 4KULA 2D0QB 4Z02A 1YHQQ 2EWNA 1FXXA 3GP8A 5KYYA 4PJJA 3OSSC 3JB9H 4XU3A 3TSZA 3NGPA 3I56Q 2LT4A 1U3OA 1RAHB 3QWYA 3NFCA 4LD9K 1SHGA 5LJ3j 4C92F 5CCAA 5GAN2 2DX1A 1FMVA 5CK9A 1X01A 5GAN3 5GANe 5LJ5d 3EHQA 3D7SB 5CQYA 1KK7A 4EPCA 4J9IA 1QVFP 1YCSB 4C0DB 4M77A 1K9MU 1H92A 5C0MA 4PJOG 4RG2A 1QW1A 1RLQC 1YJWA 1C0MA 3RESA 4AFSC 1VIFA 2FRYA 5EG2A 3TSWA 2MIOA 4C8QF 1UJ0A 2X3XD 1N9SA 3H0HA 3OBWA 2YWWA 1WFWA 4OVAA 1Y7XA 4WTOB 1M90R 3MP6A 3UDCA 5DLOA 2LQNA 4BD3A 3M56A 4E7HA 2DBKA 4YTLA 2A3LA 1PC0A 3SWNB 5FU6B 2XI9A 4N4HA 1OQKA 4HT9A 4DBFA 3HP9A 2J6FA 1D0XA 1OU9A 2ZPEB 5KYWA 2EGCA 1M3AA 2GCXA 3CMEA 3GIBA 1N8RU 1IREB 2LRQA 1AVZC 3H0IA 5GMKj 4N0AA 1VQMT 3HHTB 3M0PA 3VS3A 3X20B 4PKCC 2VYTA 4M77G 1HJDA 5CKEA 4O5VA 4TVRA 1QQJA 4CI0C 1D0YA 3EGUA 4C92B 1G8XA 2A36A 2BE9B 2VB6A 2DEQA 2A08A 1QCFA 2RNAA 2BTTA 5CAIA 4BI8B 3L2RA 1ZLMA 2IIMA 2JJ9A 2BZXA 2EKOA 3BE3A 1KQ2A 2MMPA 3SFMA 2RQUA 2XHCA 4R55A 2HQXA 1HXDA 2QQRA 3MP1A 4A4KA 2L3QA 2E12A 3TEEA 3BY7A 3QBYA 1G5VA 4JJCA 4J7IA 3JCMd 4GY5A 2LZ6B 4C8QB 2KK4A 3SB2A 2QQAA 2HL5C 1VQKQ 2DK3A 5GANh 2CGHA 2XMFA 1CKBA 2KR3A 4MDWA 1NBEB 2LJ0A 2X4JA 5IXFA 1MNDA 2H8HA 1VQ9Q 3QIIA 2XDDA 3CPWS 3TQ7P 2R5MA 1WZOA 4F04B 1GBQA 3OYLA 5HK0A 5GAN4 1PWTA 2EGAA 1V76A 4RTVA 4F7UF 2AKKA 2D0NA 3FC3A 1B3QA 4QVCA 4LUDA 4M7AE 3QJ6A 5M9OA 1ZUYA 1WHHA 1PM3A 1M1KU 1QCOA 1H3ZA 1IZ6A 3LX7A 2XDPA 1KQSP 1RAFB 1TUGB 4O6JA 3M4GA 4JJDA 2EPDA 1WYXA 5J39A 3FEOA 1QVFA 1D1AA 2FG0A 1M2OA 3QWXX 1XJWB 3CMAA 3CCJA 2O88A 2O9VA 4J83A 1RACB 1XOVA 3LGLA 1GCQC 3TVTA 3RKWA 1YJ9T 1Q7YU 1U5SA 1VQ8A 2EVRA 2V8JA 3OYMA 2XKOC 4NL3A 1OULA 1H8KA 2DTHA 1T3LA 3H0FA 1D3BA 2X35A 2CH4W 2ZCFB 2EYQA 2JOYA 2K7AA 3QKJA 2P0QA 2LX7A 3CQTA 2GFAA 1Y71A 2DF6A 3G1JA 1G3YA 4QQGA 9ATCB 1MGQA 2HSPA 1OPKA 4LDXA 3CMEQ 4OB2B 1I5OB 2RK1A 3EFRA 1VQ5Q 1IGQA 4R56A 3OW2S 4X9DA 1EIFA 2DL7A 1B34B 2P4RA 4M75C 2CUDA 3VRZA 1Q81R 3BFMA 3KXTA 1YJNT 2CZ0B 2DERA 1NJIC 1QVPA 4F7UB 1ZBXA 2HMAA 1GCPA 2DILA 4A4HA 3L2QA 4RTYA 5LL6S 3VUBA 2BIVA 2EQMA 3FRNA 4ZGJB 2DKGA 3PTAA 1CSKA 3VS7A 3E9GA 3Q1JA 2L3PA 1VQ4T 2CS7A 4F16A 2KI7A 2OTLA 1YHQT 2J7IA 3G4SA 3OYKA 1TOVA 1XTDA 3C94A 3I56T 4CC4B 2F2VA 5D6WA 5DY9A 2M51A 5FU7C 2XK0A 4K11A 5KYXB 5AT1B 2R5AA 3OQ5A 3FIFA 4FYXB 1M8MA 2RN8A 1Q7YC 2ECZA 5IXBA 1PD1A 2JW4A 3VV0A 2VC8A 5GAMd 2LVMA 1RUWA 2ZZDA 1UGQB 2QDYB 3OSVA 3CCVA 1ZSZC 1Q86C 1KJWA 2ROLA 4PLLA 3A8MB 3S3MA 3CCQQ 4FYVB 5CVIA 4N4IA 4M75D 4M7AA 3M53A 3RMSA 5LJ3e 1MV3A 3CXCS 3S3NA 3CD6A 1K8AU 3QYHB 2DL8A 3WVEB 4BY6C 2RHZA 1N9RA 2DJZA 1UGRB 2DXTA 2YLBA 2DEUA 1KQSA 2JMCA 3J81E 2QYZA 4J9FA 3CMAQ 1WXBA 1Q82R 2C0IA 4CC2A 1N8RR 1KQ1A 2K4YA 1I81A 3G7ZA 2JN0A 4Y28E 3CCSA 5GAOp 1VQ8Q 2XDBA 4J9DA 2CP2A 3L1AA 1NM7A 1OV3A 2K2MA 2C0OA 1KHIA 1D1BA 5GAOr 2K3BA 2DTOA 2COZA 2LP5A 1QVGP 2GQIA 2M0YA 3AT1B 5D7UA 4M78A 1OZ3A 2KT1A 1UECA 3M9QA 3OS5A 3S3OA 1CKAA 2IPOB 4ELYC 3NTKA 1KG1A 1RAIB 5KYNA 2GNCA 2HSEB 2M0OA 3V7RA 8ATCB 3EFSA 2LJ3A 1PSFA 3EGXB 1VYTA 3M0TA 1M3BA 1YITQ 3O5ZA 2FPDA 2XG8D 1JBMA 4M7DA 4B9WA 1JB0E 4PJNA 3VS1A 4DQ2A 2BKDN 1AZGB 4KUIA 3CCLA 3ME9A 5KE2A 1K8AC 3VJPA 4ZN1A 4M75F 4A53A 2KSSA 1M2VB 3KBGA 1PCXA 5ECAA 1VQ9T 2VVKA 2OTLQ 2JVVA 3CCUA 3PIOA 4BI4A 5IHNA 4RCBA 4PJOC 1NG2A 2M9UA 2OX7A 2RHUA 1UG1A 1FMWA 5LJ3h 2PVDB 2CREA 2QQSA 3I5SA 4KUDK 2LT1A 1TUDA 2M16A 2AZVA 3INZA 4AFQC 2GTOA 4BE1A 4XU0A 4J9CA 2IVWA 4C5IA 3ZFJA 2E65A 2EBPA 3CCMQ 1WXUA 2DRMA 1AWXA 1AOJA 1TXQA 3CCVQ 1YJWT 3OS0A 2O4XA 3I5RA 2COYA 2QG9B 3GNFB 3OB9A 4PNOA 4EDUA 1E6HA 1FYNA 5CKFA 5IAYA 1PHTA 1MNEA 4PFZA 3CC7A 3CD6Q 2A37A 1JEGA 3LYIA 1W4SA 2LTOA 3HRSA 1FWZA 1X2KA 1M5Q1 1QP2A 1HSQA 5KYUA 1YCYA 4M77C 5HKCA 4M75B 1Y0MA 1VQOA 2YRCA 3EFOA 1N27A 3GNGA 1VQ7Q 1WGSA 1WIEA 4J7FA 3P8HA 2QDLA 2KY9A 5GMKh 3CMET 1IRXA 2ZPBB 5LJ5g 2MWPA 4PJOD 4C8QA 1OPLA 3CC2Q 3CCSQ 3OMGA 3MP8A 1FX7A 2DNUA 3L2WA 1RL2A 2YUPA 4CC3A 1C6VX 2DMOA 3M54A 2AZSA 2F69A 1LNXA 1VQKA 4RTUA 1YP5A 3ASKA 1K73U 3R6NA 4JRPA 2RK2A 2RI3A 3BDLA 3EGDA 2ZGWA 3OYYA 2JZ2A 4MMKA 5HY6A 4A4FA 1UGPB 1IXDA 3R6OA 4Z88A 3CCET 1PD0A 1BBZA 1IO6A 5FU7B 2HKNA 2JUFA 1A0NB 1M27C 1UHFA 3PMIA 4LN2A 1VQLQ 8AT1B 3EG0A 1GFCA 3SEMA 1Q95G 1KC8C 1NZ9A 2HQEA 3NMZC 5D6YA 4IUTA 2WSEE 4PL6A 2CT3A 2DL3A 1QCNA 1HD3A 2KQWA 3CCLQ 5D6XA 1W70A 1SF9A 2RI5A 1ZSZB 1U06A 5C6SA 2E70A 3M57A 4RUGA 4M77D 2J05A 2YSQA 3UATA 2QGGA 2F2XA 4FT4A 4A63B 3JB9G 3HRUA 2J06A 3CCUQ 5GAN6 1AWWA 4BY6B 2FZKB 2FPFA 2KEAA 2FYKA 2NUTA 1H641 4LXCA 2JMAA 3OYEA 1BYMA 1YWPA 3AHUA 1Y57A 4ANJA 1KQSS 4F14A 4JDSA 4OF1A 4C0FA 1K73C 2QQ9A 2PUOB 3VU3C 5CIUA 3JCMg 1YFNA 1V1CA 2QA4Q 2FL7A 2E10A 4EMKA 3X26B 1S72Q 2COWA 3VYHB 2JTFA 3V8KA 3CCJT 1Q81C 3CMAT 1VQ5A 4Z89A 2X51A 1IGUA 1TTHB 2E3IA 2K3XA 2PNIA 3S6WA 2DETA 3LH0A 2MF2A 1PSEA 3CC7Q 2CSQA 1X69A 4F7UA 1W2BP 1M1FA 1VQ8T 2ZPGB 1Y96B 5KE3A 1UEBA 2GBQA 1RAAB 2LQ8A 5LJ5f 1ZBJA 2NUPB 2QTVA 2DXUA 3ZEHA 2DXBA 2HEQA 1VQOQ 1U1SA 1AD5A 1MMGA 4M4ZA 3V8JA 1BK2A 2MAMA 3OYCA 3DKMA 3RMQA 1WA7A 4OMOA 2DJQA 4M77F 2JXBA 2Y4XA 4OMPA 2QEXA 1R8OB 2RJCA 4OB0B 4HVUA 4C5HA 4AMCA 2DZ9A 4NOYA 3UT1A 1WJSA 5LJ5j 1SRMA 2MI6A 5GAOm 3SD4A 2RI2A 4HKEA 3OYNA 4PJOB 2O31A 5HCKA 5GANd 2EYZA 2OTLT 2O9SA 4II1A 3G4ST 4A4GA 2L2PA 1G3SA 3A8LB 1NJIU 1QWFA 4PJMA 3EG9A 3CCQA 2K5IA 2KXCA 5DLQE 1PRLC 2D1XA 3I55A 2MCNA 1JO8A 3M0SA 2RH2A 1YIJQ 3GPLA 2DXCA 3H9NA 4P5NA 3JCMV 5KYYB 4QVDA 1E6GA 1QKXA 2ATCB 1RABB 2K3YA 2P0KA 4XU2A 2EQIA 2X9HA 4ORZA 3MPUB 4OMMA 2EJFA 1WHGA 3UA7A 5A2QE 3OYAA 4DBQA 3P8DA 4C0GA 1QKWA 1VYVA 2I0NA 2ZPFB 5I2MA 1VQ6A 2CP0A 3CCVT 3OYJA 1BB9A 2MWOA 4E7LA 3JB9J 3DLLA 4RKUE 1LVKA 4UC4A 1BI1A 3JCMf 4QW2A 5GAOn 1X6GA 4M77B 3N5BB 1UTIA 4L5GA 4XTYA 2O01E 5CR2A 4AFZC 3CD6T 4VUBA 4D8DA 2DAQA 4BUGA 1GL5A 3BW1A 3QJYA 2MOXA 2EYXA 2QI2A 4J8OA 2EW3A 3L2UA 4DOVA 1KD1R 4M78E 1Q86U 1WHLA 1YN8A 4JJBA 3PVLA 1K0SA 5A0GA 2D6FA 2CP7A 3V7CA 2J6KA 1UB4A 1OI1A 3JAME 2HNIA 3C95A 1YI2A 1UHCA 4XQ3A 4NL2A 2C06A 1EX4A 5I21A 3LWHA 1MUZA 5A0DA 2EJGA 2K6DA 3OY9A 1YITA 1OZ2A 1TU0B 2V26A 4EMHA 3CCST 4IUVA 1ZX6A 4RG8A 4M7AC 2CT4A 5GAMg 2YUNA 2EQKA 4M7DE 1X6BA 4X9CA 1M2VA 2DL5A 4D6WA 1QVGS 1W2BA 3VKIA 3M58A 3KFVA 4IURA 2GQVA 5KYWB 1J3TA 2ABLA 5GAN8 4OMLA 2FVUA 4KBMB 1UFFA 2IG0A 4JS4A 1NYGA 3WVDB 3QO3A 2O2OA 4LUEA 2K5LA 5EC7A 5FWBA 1Z9ZA 3HRTA 5KCHA 1M3CA 2A7YA 4J6YA 3LH5A 2ZPIB 4FT2A 1PKTA 1MMNA 4Z8AA 2PQWA 2QEXQ 2XU8A 2FZCB 1QLYA 1BI0A 3I35A 1G3WA 4KGZB 1C1AA 2CZ1B 1RLPC 3H6ZA 1XQHA 4X34A 3OA6A 3OS2A 2DA9A 2PTKA 5GJVB 2DIQA 3CCLT 1K9MR 1QP3A 4QT7A 1AWOA 4OB1B 4M78C 1R0BG 1I07A 3CCMA 4ELZC 4FSSA 5A0LA 3M5AA 2YT6A 3UPUA 2E5KA 5FROA 2EIFA 2D8HA 1PKSA 3CCUT 2AKLA 3NTHA 2H3EB 4GBQA 3M59A 4BDZA 2AIRB 2R57A 2ESWA 1I8FA 4L6V5 3I55Q 4C92E 3MO8A 4JRIA 4LDUA 2DL4A 3RUXA 3QYGB 2QXFA 1IHVA 1VA7A 2OI3A 1AEYA 1ZQ1A 2KVQG 1ACMB 1WHMA 2CZ6B 1GRIA 2OAWA 1M90U 4XTXA 3QUIA 1VQNA 1ABOA 1O9SA 1YWOA 4DBRA 5HK3A 5GMKm 3CEYA 2JS2A 1VQ7A 1VQ6Q 3URGA 4JPBW 2AT1B 3PMTA 2LC4A 4C8QE 3UWNA 4DBHA 3PIPA 3CC2A 1NLPC 4AFUC 2OTJA 2DE0X 2JS0A 2RPNA 4MDXA 3RDVA 3CC7T 2RB6A 1T0JA 2K79A 1JXOA 3O8VA 4A54A 2DD5A 1P92A 2B86A 3EH2A 3EH1A 2SRCA 2Y4YA 1PG5B 3I9QA 1OEBA 3OW2P 2G6FX 3E9FA 1W6XA 5FW9A 5GAMf 2KYMA 4CRIA 2E64A 4J9EA 3PGGA 1VQOT 1YI2Q 4M7AG 3JB9I 1VQLA 2JM8A 4J9BA 1WNLA 1G83A 1JJ2P 1D3BB 4BE0A 2RHIA 1JXMA 4OP0A 2CP6A 2X3WD 1GXIE 4QQDA 2RQVA 4HA8A 3CPFA 1VQKT 5GMKi 3QDRB 3VRYA 1TWBA 2F2WA 2JM9A 4FW2A 1Z9QA 2LMJA 3HL8A 5GAMj 2XD0A 4BACA 1WJRA 4OMQA 2KAFA 5CKHA 2W10A 2E4HA 3M0QA 3NHNA 4B6MA 1H3HA 3QG1A 2GFUA 3JCMb 1M90C 4X1VA 4KGXB 1G2BA 4FIBA 2C0TA 3LLRA 2LQKA 5I22A 4R0KA 5GAOq 4JZ3A 1WHKA 4JS5A 3M0UA 2DBMA 5CKDA 2ROTA 3SWNA 4M78G 1K4US 1M1KR 2YHTA 5LJ5e 1QVFS 2KRSA 1VQPA 4XU1A 2FHDA 1NYFA 1QMCA 4XTZA 1N6AA 2RF0A 2KE9A 1BKBA 3CC4A 2FO0A 5LJ3d 4DA4A 1UE9A 2FZGB 5IHIA 1KC8U 3RKXA 3L2ZA 1ABQA 1ZA1B 3L2VA 2QA4A 2PUKB 2CP5A 3MHXA 1S72A 4M7DG 1DJ7B 2P0PA 1Q7YR 4F7UE 3G71A 1IB8A 1AT1B 4C92A 2RQRA 4FM4B 4HVVA 2KNBB 4ATOA 2D8JA 3F70A 4CC7A 4D8KA 2L89A 3C12A 1BIAA 3J7AF 2E6NA 3RNJA 3QHSA 2K2VA 1VQNQ 1X75C 2EQUA 2RHXA 2NYSA 4HCCA 2RHYA 1ZSGA 4M7AB 1VOMA 2K57A 3TREA 4N4GA 1M4ZA 4FL6A 3EG2A 2DFUA 3QXEB 4LDYA 4FU6A 3VUZA 4LDVA 1VQ5T 1BI2A 1MMDA 3GOXA 1WLPB 1W2BS 2OTJQ 2JTEA 4IIMA 3JB9D 2QAZA 4J6WA 2FPEA 2P4TA 4HVWA 5GAN5 1WHJA 1MV0B 2Y90A 1YJNQ 4ZGDB 5GJWB 4EIKA 2VWFA 1Q81U 3JCMc 1KSWA 2DIGA 4RTXA 1AWJA 2E6ZA 3VYGA 2LX9A 3OW2A 4EMKC 3GBQA 4EMGA 1X27A 4C92G 2YUQA 2L5QA 3OBYA 3QZ9B 2VUBA 4F17A 4N0AC 3JCMe 1VQ4Q 4ZTJA 3A5ZB 1JJ2A 2QEXT 4M78B 2HBWA 3FJPA 5LJ5h 3CCRA 2OAUA 1YIJA 2MK5A 2XICA 1U1TA 1LJOA 1E7OA 4RTWA 1KFZA 2JNGA 4KT0E 3MCAB 4BB7A 3RIRA 4JLIA 2KBTA 4XTVA 4C8QG 2DLPA 4KH0B 2E1HA 1TG0A 4M7DB 3V8LA 3OYFA 3BDUA 3X28B 1PRMC 1OU8A 1TUCA 2MPXC 1T0HA 2ED1A 3PFSA 3CCQT 3NPFA 3RERA 1K8AR 1KD1C 2DO3A 1OX9A 4PJOF 2OJ2A 3I55T 2CDTA 2KXDA 1VQPQ 2AK5A 5AYFA 1O75A 2RJFA 3JB9F 3CC4Q 4HT8A 1KHCA 2DYBA 3QZ5B 1SSFA 1SPKA 1BCMA 2LNHB 3JCMP 3A8GB 2GTJA 1FMKA
chains in the Genus database with same CATH topology
1UGRB 2DXTA 4L5GA 4XTYA 3LW5E 2YLBA 2O01E 5CR2A 3FLGA 1KQSA 5DM7R 1WQ7A 2LCLA 3J81E 1I4K1 1B34A 4VUBA 4C0ZA 2DAQA 2RJDA 3C4SA 4BUGA 1VQ6T 3BW1A 3CXCA 3QJYA 4ME7A 4XTWA 2QI2A 2ZPHB 4J8OA 4M7DF 3L2UA 4DOVA 2V8IA 3QPHA 1KQ1A 2K4YA 1I81A 4M78E 1U8RA 4XAXB 3OMCA 3G7ZA 4NS5A 1Q86U 3OYDA 1Q82U 2D9TA 2JN0A 4Y28E 3CCSA 5A0GA 5GAOp 2D6FA 4QVZA 2XDBA 3HKSA 3V7CA 1KD1U 1UB4A 1OI1A 3L1AA 4C8QD 2HNIA 3C95A 4PLIA 5CQXA 5GANg 4MZMA 1YI2A 3P8BB 2VV5A 2O4XB 4XQ3A 3FB9A 4NL2A 4J5YA 2C06A 5I21A 3LWHA 1KHIA 2QTXA 5A0DA 5GAOr 2DTOA 2QQBA 1I5LA 2EJGA 3OY9A 4FSXA 1YITA 2LDMA 4Y91A 1OZ2A 5GAOl 3G6EA 2RO0A 4EMHA 3CCST 4PJOA 4IUVA 4M78A 1OZ3A 2G3RA 2AHJB 2B8AA 4RG8A 4C5GA 5GAMg 4M7AC 3DB4A 3M9QA 2EQKA 4M7DE 1YI2T 4Q5WA 3T9NA 3OS5A 4X9CA 3S3OA 4D6WA 1QVGS 4ELYC 3NTKA 3JCMh 3X25B 1W2BA 3VKIA 3CCEA 1ZHIA 3LGFA 1M8VA 3M58A 4IURA 2GQVA 5LJ3f 2M0OA 3V7RA 1HK9A 5GAN8 3EFSA 2FVUA 3PT9A 1PSFA 4KBMB 4JS4A 2E41A 2IG0A 1YITT 1KG1A 3G6ET 3WVDB 1K9MC 3QO3A 2PVOB 2K5LA 2XG8D 5FRMA 5IN1A 2EAYA 2VXFA 3OYIA 2E5QA 1VQ9A 3HRTA 2KMTA 2RM4A 1JBMA 4E7IA 5KCHA 1QVGA 4M7DA 4KULA 4B9WA 2X4XA 2D0QB 1JB0E 4Z02A 1WPYA 2A7YA 4J6YA 4DQ2A 2ZPIB 2BKDN 2EWNA 4FT2A 1FXXA 2PVGB 4KUIA 1M1GA 3ME9A 4MZPA 5KE2A 2PQWA 3GP8A 1K8AC 2WSCE 3OSSC 4M75F 3VJPA 3X24B 2KSSA 2XU8A 4A53A 4ZN1A 3JB9H 3KBGA 4XU3A 2L8DA 1BI0A 2LT4A 5J3BA 1M9SA 4F7UG 1VQ9T 1G3WA 3NFCA 2HBPA 2CZ1B 4LD9K 1AHJB 3H6ZA 1XQHA 4C92F 5CCAA 4X34A 5LJ3j 3OS2A 3OA6A 3DLMA 2JVVA 5GAN2 3HPWA 2DIQA 4JRQA 3CCLT 4J6XA 5CK9A 1X01A 5GAN3 2X4YA 3CCUA 3PIOA 1QP3A 5GANe 4BI4A 5LJ5d 2VXEA 2LNVA 4RCBA 5FRNA 4PJOC 2M9UA 4M78C 4OB1B 2RHUA 5CQYA 3HFOA 4EPCA 3FDRA 3CCMA 2DVEA 2EJ9A 5LJ3h 4ELZC 3OYGA 4C0DB 2PVDB 4M77A 3V7SA 1K9MU 2QQSA 5A0LA 3M5AA 5C0MA 1Q82C 4KUDK 2LT1A 4PJOG 4RG2A 3UPUA 4M75E 1QW1A 5FROA 2EIFA 1WQWA 2M16A 5GAMe 1YJWA 1N8RC 3HSBA 3RESA 5KH6A 3CCUT 4E7JA 3NTHA 1VIFA 3A8OB 3INZA 3M59A 5EG2A 4BDZA 4BE1A 2R57A 4XU0A 2CYZB 4C8QF 2IVWA 4C5IA 3CCMT 1I8FA 1N9SA 2GF7A 4L6V5 3OBWA 4C92E 3ZFJA 4IUPA 3MO8A 4JRIA 4LDUA 3HFNA 2E65A 3RUXA 3QYGB 2QXFA 4OVAA 1WJQA 1Y7XA 1VUBA 1YJWT 3OS0A 3EAEA 2FB7A 3MP6A 3UDCA 5DLOA 2O4XA 1ZQ1A 2KVQG 3KUFA 4BD3A 3M56A 4E7HA 1JRIA 3GNFB 4YTLA 2A3LA 2CZ6B 3OB9A 4PNOA 3SWNB 4EDUA 5GAN7 1M90U 4XTXA 3QUIA 4IUQA 5CKFA 1VQNA 5IAYA 5FU6B 3MEVA 2XI9A 4N4HA 2M1HA 2NLUA 1O9SA 3CC7A 4M77B 5HK3A 5GMKm 3CEYA 3CBPA 3PNWC 1VQMA 4HT9A 1VQ7A 3LYIA 3URGA 2HAXA 3HP9A 3PMTA 1W4SA 2LTOA 3HRSA 1FWZA 2LC4A 4C8QE 3UWNA 4XK8E 3PIPA 1XNIA 3CC2A 5CKBA 2ZPEB 1M5Q1 2GCXA 1QP2A 3CMEA 3J80E 3GIBA 1N8RU 1IREB 4OMFB 2LRQA 2OTJA 1VQNT 4MMLA 2PU9B 5GMKj 4MDXA 1YCYA 4N0AA 4M77C 5GANf 3CC7T 1VQMT 2RB6A 1OYXA 5HKCA 3HHTB 3E1SA 4M75B 1VQOA 1VQ7T 3O8VA 4ZGEB 4OB3B 4A54A 2DD5A 1P92A 1N27A 3GNGA 3X20B 4PKCC 3A8HB 2VYTA 1WGSA 2Y4YA 4M77G 4RCCA 3CC2T 5CKEA 4O5VA 4J7FA 4TVRA 3P8HA 5GMKh 2KY9A 3CMET 2ZPBB 4CI0C 5LJ5g 2MWPA 4PJOD 2OTJT 3E9FA 4C8QA 4C92B 5GAMf 1Y07A 3OMGA 4CRIA 2DEQA 2E64A 3MP8A 3NTIA 1FX7A 3L2WA 4IKFA 3PGGA 2F5TX 1VQOT 1RL2A 4QQ6A 5CAIA 4BI8B 3L2RA 4M7AG 4WF2A 3JB9I 3M54A 4EMKB 1VQLA 1MHNA 2F69A 1LNXA 1VQKA 2EKOA 1KQ2A 4E7KA 2MMPA 1WNLA 3ASKA 5J26A 1K73U 3SFMA 4JRPA 2RK2A 1D3BB 2RI3A 2XHCA 2ZGWA 3BDLA 2RHIA 3CBOA 3OYYA 4R55A 4BE0A 2JZ2A 2HQXA 4MMKA 5HY6A 1HXDA 4A4FA 2LCCA 2QQRA 3JSCA 3MP1A 4OP0A 4A4KA 2E12A 3TEEA 3BY7A 3H8ZA 3QBYA 5GANj 1GXIE 1G5VA 1UGPB 3R6OA 4QQDA 3CCET 4J7IA 1JJ2S 4HA8A 3JCMd 3CPFA 4GY5A 1VQLT 1VQKT 3JCMP 5FU7B 2JUFA 5GMKi 3QDRB 4C8QB 2KK4A 1M1KC 3SB2A 2QQAA 3PMIA 5CO7A 3M4YA 2DK3A 5GANh 4ZN3A 2CGHA 2H3JA 2F5KA 1NZ9A 3HL8A 2HQEA 5GAMj 1KC8C 1BI3A 4BACA 2XD0A 1WJRA 4MDWA 2X4JA 2KAFA 5D6YA 5CKHA 4IUTA 3QG1A 2WSEE 4PL6A 4JUVA 1UGSB 2YRVA 2GFUA 2DZCA 3JCMb 1M90C 3M55A 4LD6A 2VGMA 2KQWA 5GAMh 3QIIA 2XIDA 4FIBA 5D6XA 2XDDA 2DD4A 3CPWS 2RI5A 3LLRA 2LQKA 5C6SA 2R5MA 5I2SA 3JRZA 4JLGA 5GAOq 2E70A 3M57A 3OYLA 5HK0A 5CKDA 4JS5A 4IUUA 5GAN4 4GLKA 4M77D 3SWNA 4M78G 1BIBA 4BI3A 4F7UF 3FC3A 2YHTA 4QVCA 5LJ5e 4M7AE 3QJ6A 1QVFS 5M9OA 1VQPA 4FT4A 3JB9G 3HRUA 4B9XA 4XU1A 2FHDA 3OYHA 4XTZA 1N6AA 5GMKl 4M7AD 5GAN6 1M1KU 1BKBA 1H3ZA 3CC4A 4BY6B 1IZ6A 3LX7A 5LJ3d 3LWIA 4BE2A 4DA4A 2DTIA 2XDPA 4ZTFA 2FYKA 4O6JA 4JRKA 1KC8U 3RKXA 4M7DC 3L2ZA 3M4GA 1H641 3L2VA 2QA4A 3OS1A 2PUKB 4C0DC 3OYEA 1BYMA 3MHXA 3GF5A 3AHUA 1S72A 1VQPT 4M75A 5J39A 3FEOA 1YJ9A 3DB3A 1QVFA 3TCJA 1KQSS 4M7DG 1NPPA 4OGCA 1DJ7B 4JDSA 4OF1A 3CMAA 3CCJA 3CC4T 4J83A 2P0PA 4C0FA 1K73C 4F7UE 3G71A 2QQ9A 4C92A 1XOVA 2PUOB 3ER0A 1LOJA 3LGLA 3VU3C 2QA4T 4FM4B 5CIUA 4ATOA 3JCMg 3RKWA 1S72T 3TU4K 1TH7A 1YJ9T 1Q7YU 1VQ8A 3F70A 2V8JA 2FL7A 2E10A 4XTUA 2XKOC 4EMKA 2L89A 3X26B 4NL3A 3OYMA 3C12A 2DTHA 1BIAA 3VYHB 3WXMB 2JTFA 3V8KA 3CCJT 1Q81C 3CMAT 3J7AF 2E6NA 1D3BA 1VQ5A 1VQ8T 2X35A 4C5EA 3G71T 3QHSA 2K2VA 2K3XA 1X75C 3S6WA 3SWNC 2EQUA 2RHXA 2EYQA 2MF2A 2ZCFB 3LH0A 1PSEA 4HCCA 2JOYA 2RHYA 5FU6C 4M7AB 4LDWA 4PJOE 1V29B 4F7UA 3QKJA 2P0QA 1M1FA 2K57A 3TREA 2GFAA 1M4ZA 2DPPB 1Y71A 4FL6A 2ZPGB 1Y96B 2CZ7B 4N4GA 5KE3A 1UEBA 1G3YA 4QQGA 3QXEB 4LDYA 1MGQA 4FU6A 3JCMW 2LQ8A 3L42A 4M78D 3VUZA 4MZTA 1YJNA 4LDXA 1VIEA 5LJ5f 4LDVA 1VQ5T 1BI2A 4OB2B 4BDYA 4OGEA 3GOXA 1W2BS 4DOWA 3JAME 2RK1A 3EFRA 4RMOA 3JB9D 4J6WA 2DXUA 3ZEHA 4R56A 2DXBA 3OW2S 3QSUA 4X9DA 1EIFA 3JCMQ 1B34B 2P4TA 4M75C 1U1SA 3CD6T 2X4WA 1G3TA 3V8JA 3BFMA 3KXTA 3MEAA 1YJNT 2CZ0B 2MAMA 5GAN5 3OYCA 3DKMA 1NJIC 3RMQA 1VQ4A 2Y90A 1QVPA 4F7UB 1ZBXA 4M77F 4M75G 4ZGDB 2EQJA 1YHQA 2Y4XA 5LJ3g 1X6OA 4A4HA 3JCMc 4C92C 4E47A 4HCZA 1Q81U 2CKKA 3L2QA 5LL6S 3VUBA 2DIGA 2QEXA 4M7DD 1R8OB 2BIVA 2EQMA 2RJCA 3FRNA 2E6ZA 1NE8A 2DKGA 4OB0B 3VYGA 2LX9A 4ZGJB 3PTAA 3OW2A 1NPRA 3E9GA 3I56A 4C5HA 5GMKe 3Q1JA 4EMKC 4M7AF 2DZ9A 4NOYA 3UT1A 4EMGA 4C92G 3OBYA 2L5QA 3QZ9B 1WJSA 5LJ5j 2VUBA 1VQ4T 2MI6A 1YBYA 5GAOm 4N0AC 2CS7A 3JCMe 2OTLA 1YHQT 3SD4A 2RI2A 3G4SA 4HKEA 4ZTJA 3OYKA 3A5ZB 3OYNA 1JJ2A 4PJOB 2QEXT 1RI0A 1XTDA 4A4EA 4M78B 5IT9E 3GLXA 3OYBA 3FJPA 5LJ5h 3C94A 3I56T 2OAUA 2K5FA 3CCRA 5D6WA 5DY9A 1YIJA 2EFIA 2XICA 5FU7C 2XK0A 1U1TA 2BUDA 1LJOA 2RA2A 4M77E 5GANd 4C8QC 2JNGA 4KT0E 5L8RE 2R5AA 3MCAB 3FIFA 3OQ5A 2OTLT 4BB7A 4II1A 1Q7YC 3G4ST 3RIRA 4JLIA 4A4GA 1G3SA 3A8LB 1NJIU 4XTVA 4C8QG 3CCQA 4HCBA 2VGNA 3VV0A 2RJEA 2K5IA 3CCRT 1YIJT 2VC8A 5DLQE 5GAMd 3SDZA 3JCMX 4JJNK 2HD0A 2LVMA 2E1HA 3MEUA 3I55A 3CPWA 2KDSA 2RH2A 2I2LA 4M7DB 3META 3GPLA 2DXCA 3CCLA 3V8LA 2ZZDA 3OYFA 3BDUA 3X28B 1UGQB 2WACA 4P5NA 3JCMV 2QDYB 4V2SA 3OSVA 4QVDA 2WSFE 3CCVA 1Q86C 4L59A 3PFSA 4PLLA 2K3YA 2P0KA 3A8MB 4XU2A 3CCQT 2JTMA 3RERA 1KD1C 2DO3A 3S3MA 3RKYA 2R58A 3JCMJ 5CVIA 2RD1A 4PJOF 4N4IA 4M75D 4M78F 2EJFA 3MEWA 3I55T 4M7AA 2V8KA 3M53A 3RMSA 5LJ3e 5KCOA 5FLXE 5A2QE 3CXCS 3OYAA 3S3NA 5AYFA 1K8AU 3CD6A 1Y96A 3P8DA 1O75A 2RJFA 4C0GA 1VQ6A 2ZPFB 3QYHB 5I2MA 3JB9F 3CCVT 3OYJA 3WVEB 4HT8A 1KHCA 2MWOA 3E19A 3QZ5B 3ZBDA 4E7LA 3JB9J 1SSFA 4C92D 4BY6C 3DLLA 4RKUE 2L3RA 4UC4A 1BI1A 2RHZA 3JCMf 1N9RA 4QW2A 5GAOn 2YLCA 3A8GB 3CBMA 2DJZA 3N5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFR A;  4PJO G;  2CGH A;  3JB9 D;  2DXT A;  4M75 E;  4XTY A;  2YLB A;  2DXU A;  4J6W A;  5GAM j;  1WQ7 A;  1WQW A;  1I4K 1;  1B34 A;  4X9D A;  5GAM e;  3HSB A;  3RES A;  3QSU A;  3JCM Q;  3BW1 A;  1B34 B;  4M75 C;  1U1S A;  3INZ A;  4XTW A;  3V8J A;  4XU0 A;  4M7D F;  3BFM A;  4JUV A;  4C8Q F;  5GAN 5;  2DZC A;  1KQ1 A;  1I8F A;  1N9S A;  1I81 A;  4M78 E;  3JCM b;  2Y90 A;  4C92 E;  4F7U B;  4JRI A;  5GAM h;  4M77 F;  3HFN A;  2E65 A;  4M75 G;  3RUX A;  5LJ3 g;  2JN0 A;  3JCM c;  4C92 C;  5GAO p;  5GAN d;  4M7D D;  3V7C A;  3L1A A;  4C8Q D;  5GAN g;  2HNI A;  2FB7 A;  2DKG A;  5GAO q;  4XQ3 A;  5GAN 4;  5GMK e;  1JRI A;  4M77 D;  3FB9 A;  3SWN A;  4NL2 A;  2DZ9 A;  4J5Y A;  4M78 G;  4NOY A;  1BIB A;  4C92 G;  4EMG A;  4PNO A;  3SWN B;  2QTX A;  5I21 A;  5LJ5 j;  5GAN 7;  5GAO r;  4XTX A;  3QUI A;  2DTO A;  4F7U F;  2YHT A;  4QVC A;  5LJ5 e;  2EJG A;  1I5L A;  5GAO m;  4N0A C;  4M7A E;  4EMK C;  3JCM e;  4Y91 A;  5GAO l;  4M77 B;  3JB9 G;  5GMK m;  4EMH A;  4XU1 A;  4HT9 A;  4PJO A;  4M78 A;  4M7A C;  4XTZ A;  5GMK l;  5GAM g;  4PJO B;  4M7A D;  5GAN 6;  4M78 B;  4M7D E;  3FJP A;  5LJ3 d;  4X9C A;  4C8Q E;  5LJ5 h;  2DTI A;  5DY9 A;  2FYK A;  3JCM h;  1M5Q 1;  4JRK A;  3RKX A;  4M7D C;  1M8V A;  1U1T A;  1LJO A;  2RA2 A;  3L2Z A;  1H64 1;  3M4G A;  4M77 E;  5LJ3 f;  3V7R A;  4C8Q C;  1HK9 A;  5GAN 8;  3GIB A;  4M7A F;  3EFS A;  4MML A;  5GMK j;  1YCY A;  2E41 A;  3FIF A;  4M77 C;  4M75 A;  4N0A A;  5GAN f;  3AHU A;  2RB6 A;  4M75 B;  3RIR A;  3QO3 A;  4JLI A;  4M7D G;  4XTV A;  4A54 A;  4C8Q G;  2EAY A;  2VXF A;  4PJO D;  2VC8 A;  4M77 G;  2RM4 A;  4RCC A;  1JBM A;  4F7U E;  5GAM d;  3JCM X;  5GMK h;  2E1H A;  4C92 A;  4M7D A;  5LJ5 g;  1LOJ A;  3VU3 C;  1WPY A;  2I2L A;  4J6Y A;  4C8Q A;  4C92 B;  4DQ2 A;  5GAM f;  5GAN h;  2EWN A;  3JCM g;  4M7D B;  3RKW A;  3V8L A;  3BDU A;  2DEQ A;  2E64 A;  1TH7 A;  3JB9 H;  3JCM V;  4M75 F;  4A53 A;  3PGG A;  4V2S A;  4QVD A;  4EMK A;  2E10 A;  4XTU A;  5CAI A;  4XU3 A;  4WF2 A;  4NL3 A;  4M7A G;  3JB9 I;  4EMK B;  2DTH A;  1BIA A;  1LNX A;  3V8K A;  4XU2 A;  4F7U G;  1KQ2 A;  3RER A;  1D3B A;  1WNL A;  3RKY A;  3JCM J;  1D3B B;  3QHS A;  2RD1 A;  2ZGW A;  4PJO F;  3SWN C;  4M75 D;  4M78 F;  2EJF A;  5LJ3 j;  4C92 F;  4MMK A;  4M7A A;  1HXD A;  5GAN 2;  4OP0 A;  5LJ3 e;  4M7A B;  4PJO E;  4F7U A;  3BY7 A;  4J6X A;  5GAN j;  5GAN 3;  1X01 A;  1Y96 A;  2K57 A;  5GAN e;  3JB9 F;  1Y96 B;  2VXE A;  5LJ5 d;  4RCB A;  4PJO C;  4HA8 A;  4HT8 A;  4M78 C;  3JCM d;  3JCM W;  1MGQ A;  3HFO A;  4M78 D;  3JCM P;  5GMK i;  3JB9 J;  4C92 D;  2DVE A;  2EJ9 A;  5LJ3 h;  4C8Q B;  5LJ5 f;  3SB2 A;  3JCM f;  4M77 A;  3V7S A;  1N9R A;  5GAO n;  2YLC A;  2DJZ A; 
#chains in the Genus database with same CATH topology
 2DVJ A;  4LE9 A;  3LW5 E;  4PJL A;  1WI7 A;  2LJ1 A;  1B34 A;  2RJD A;  1VQ6 T;  3CXC A;  4JZ4 A;  2EGE A;  2ZPH B;  1YNZ A;  3G71 Q;  2HDA A;  1U8R A;  4XAX B;  4AG2 C;  1SKU B;  4NS5 A;  2HQH A;  1Q82 U;  2KRN A;  2D9T A;  2CH4 A;  3REB B;  1ARK A;  3HKS A;  5GAN g;  4PLI A;  4RTT A;  4MZM A;  3P8B B;  2VV5 A;  1T3S A;  2O4X B;  2ZAE A;  4J5Y A;  1WDX A;  1HYO A;  1RI9 A;  4FYW B;  2LDM A;  4Y91 A;  5GAO l;  3G6E A;  1R0C B;  2G3R A;  2B8A A;  2YDL A;  3DB4 A;  3VS4 A;  1YI2 T;  3T9N A;  1D09 B;  2F1L A;  3JCM h;  3CCE A;  5KYX A;  1ZHI A;  1PNJ A;  1SEM A;  3HTR A;  2M02 A;  5IHK A;  5KYU B;  1YIT T;  2E41 A;  1K9M C;  2KT8 A;  5FWC A;  2RQT A;  3ULR B;  2ENM A;  5FRM A;  5IN1 A;  2VXF A;  3EFO B;  1SSH A;  1N5Z A;  1K9A A;  4KRT A;  4E7I A;  2X4X A;  3RBB B;  1WPY A;  2SEM A;  2PVG B;  1M1G A;  4MZP A;  2WSC E;  3X24 B;  2L8D A;  3M0R A;  1B7T A;  5J3B A;  4E7Z A;  4Y92 A;  1M9S A;  4F7U G;  2HBP A;  1X43 A;  4E7S A;  1AHJ B;  3EGD B;  2LQW A;  3DLM A;  3HPW A;  4JRQ A;  4J6X A;  2X4Y A;  3THK A;  2VXE A;  2LNV A;  2CP3 A;  5FRN A;  3CCR Q;  3HFO A;  3FDR A;  1IHW A;  2DVE A;  2EJ9 A;  3RR6 A;  3OYG A;  3V7S A;  2LCS A;  1Q82 C;  2DM1 A;  4M75 E;  1WQW A;  1N8R C;  5GAM e;  3HSB A;  5KH6 A;  4E7J A;  3A8O B;  1KC8 R;  3VS6 A;  2CYZ B;  3CCM T;  2GF7 A;  4IUP A;  1R77 A;  3HFN A;  2DRK A;  1WJQ A;  1SHF A;  3U23 A;  2KYB A;  1VUB A;  1GFD A;  3EAE A;  2FB7 A;  3KUF A;  1JRI A;  1YJW Q;  2EYW A;  1OOT A;  5GAN 7;  2HCK A;  4IUQ A;  3MEV A;  2M1H A;  2NLU A;  2V1Q A;  1VQM A;  1NLO C;  3CBP A;  3PNW C;  2HAX A;  2P84 A;  4XK8 E;  1XNI A;  4GLM A;  3H41 A;  5CKB A;  3J80 E;  2NUT B;  1RAG B;  4OMF B;  1VQN T;  3EGX A;  4MML A;  2PU9 B;  2FEI A;  1BCO A;  5GAN f;  1OYX A;  3E1S A;  1VQ7 T;  4ZGE B;  2A28 A;  4OB3 B;  3A8H B;  4RCC A;  3CC2 T;  1ZUU A;  5L23 A;  3PVQ A;  3IQL A;  3FJ5 A;  4OMN A;  2OTJ T;  1Y07 A;  3ZL7 C;  1K73 R;  1JQQ A;  3NTI A;  1NEG A;  4IKF A;  2F5T X;  4QQ6 A;  1AZE A;  4WF2 A;  4EMK B;  1MHN A;  1D0Z A;  4E7K A;  5J26 A;  3MKD A;  3CBO A;  4FYY B;  4FCY A;  3G6E Q;  2LCC A;  3JSC A;  1KIK A;  3H8Z A;  2KRO A;  4J9H A;  2FRW A;  5GAN j;  2DYI A;  1JJ2 S;  1VQL T;  4AG1 C;  2A0F B;  3CCE Q;  2KGT A;  1M1K C;  3UA6 A;  1UJY A;  5CO7 A;  3M4Y A;  3MJX A;  1SG5 A;  4ZN3 A;  2H3J A;  2F5K A;  1B07 A;  1BI3 A;  3CPW P;  2L3S A;  4JUV A;  1UGS B;  2YRV A;  2DZC A;  1GCQ A;  3EHR A;  1RAE B;  3M55 A;  4LD6 A;  2VGM A;  5GAM h;  2GGR A;  2XID A;  2DD4 A;  2NUZ A;  5I2S A;  3JRZ A;  4JLG A;  2RMO A;  4IUU A;  2MYS A;  4GLK A;  3VS2 A;  1BIB A;  1M30 A;  4BI3 A;  1QWE A;  4ZNX A;  1MMA A;  1I0C A;  2QK0 A;  1I1J A;  4B9X A;  3QDF A;  3OYH A;  5GMK l;  4M7A D;  3A98 A;  4WCI A;  4LNP A;  1RAD B;  4BE2 A;  3LWI A;  2DTI A;  4ZTF A;  4JRK A;  4M7D C;  3C0C A;  3OS1 A;  3E2U A;  1W1F A;  4C0D C;  1GBR A;  3GF5 A;  4HCK A;  4M75 A;  1VQP T;  1YJ9 A;  3DB3 A;  3TCJ A;  1K76 A;  1NPP A;  4OGC A;  3CC4 T;  3EG9 B;  4PFP A;  5I11 A;  3ER0 A;  2KRM A;  1LOJ A;  2QA4 T;  3VS0 A;  2CUB A;  3VS5 A;  1S72 T;  3TU4 K;  1TH7 A;  2L0A A;  4XTU A;  4PK4 A;  3WXM B;  1WXT A;  1ZUK A;  4C5E A;  3G71 T;  3CCJ Q;  3SWN C;  1TS9 A;  1VQM Q;  5FU6 C;  4LDW A;  4PJO E;  1V29 B;  3EG1 A;  2VAS A;  2DPP B;  2CZ7 B;  2J6O A;  1EFN A;  3JCM W;  4M78 D;  3L42 A;  1YJN A;  4MZT A;  1VIE A;  2W0Z A;  4BDY A;  4OGE A;  2V1R A;  4DOW A;  4FW1 A;  4RMO A;  3QSU A;  3JCM Q;  2X4W A;  1G3T A;  3MEA A;  1VYU A;  1VQ4 A;  2QAS A;  1K0X A;  4M75 G;  2EQJ A;  1YHQ A;  1ZSZ A;  5LJ3 g;  1X6O A;  4C92 C;  4E47 A;  4HCZ A;  4RTZ A;  2CKK A;  4M7D D;  1NE8 A;  1NPR A;  3I56 A;  3UF4 A;  5GMK e;  4M7A F;  2HKQ B;  1K1Z A;  1YBY A;  4PFO A;  1RI0 A;  4A4E A;  5IT9 E;  4ESR A;  3GLX A;  3OYB A;  4J9G A;  5IH2 A;  1JU5 C;  2K5F A;  2EFI A;  1EZZ B;  3CBM A;  2BUD A;  4M77 E;  2NWM A;  2RA2 A;  1NJI R;  4C8Q C;  1ZA2 B;  1F1B B;  2JT4 A;  3EG3 A;  5L8R E;  2BE7 D;  3A1P A;  4E6R A;  4HCB A;  2EKH A;  2VGN A;  3G4S Q;  2RJE A;  2QGF B;  3CCR T;  1YIJ T;  2HL3 A;  3SDZ A;  3JCM X;  4JJN K;  2HD0 A;  3MEU A;  3CPW A;  2KDS A;  2I2L A;  3MET A;  2YUO A;  1LCK A;  2WAC A;  3JV3 A;  4V2S A;  2WSF E;  4L59 A;  3CXC P;  2JTM A;  3RKY A;  2R58 A;  3JCM J;  2RD1 A;  4M78 F;  3MEW A;  2CSI A;  2V8K A;  5KCO A;  1OX8 A;  5FLX E;  1Y96 A;  2RQW A;  2E3H A;  3ZBD A;  3E19 A;  4C92 D;  2NUP A;  2L3R A;  1TSF A;  2YLC A;  1LPL A;  1YJ9 Q;  3FLG A;  2EYY A;  1X2Q A;  1WQ7 A;  2LCL A;  5DM7 R;  1I4K 1;  4C0Z A;  3C4S A;  4ME7 A;  4XTW A;  1Q86 R;  4M7D F;  2Z0W A;  1NEB A;  2V8I A;  3QPH A;  2YXY A;  3OMC A;  2VKN A;  3OYD A;  3SHW A;  2ED0 A;  4QVZ A;  1KD1 U;  1SRL A;  2K9G A;  1S1N A;  4C8Q D;  2BZ8 A;  1UUE A;  5CQX A;  4AT1 B;  4HXJ A;  2HZY A;  4DEY A;  3FB9 A;  2QTX A;  4QKU A;  2QQB A;  1I5L A;  4FSX A;  4E2F B;  4IIO A;  2RO0 A;  4PJO A;  1WX6 A;  2AHJ B;  4C5G A;  4KH1 B;  4Q5W A;  1UGV A;  3X25 B;  1M8V A;  3LGF A;  7AT1 B;  5LJ3 f;  4DEX A;  1HK9 A;  2BZY A;  2PZ1 A;  3PT9 A;  2YRD A;  3G6E T;  2PVO B;  3REA B;  4KGV B;  2EAY A;  6AT1 B;  3OYI A;  2E5Q A;  1D1C A;  1VQ9 A;  2KMT A;  1UDL A;  2RM4 A;  3PE0 A;  1BU1 A;  1QVG A;  4KUL A;  2D0Q B;  4Z02 A;  1YHQ Q;  2EWN A;  1FXX A;  3GP8 A;  5KYY A;  4PJJ A;  3OSS C;  3JB9 H;  4XU3 A;  3TSZ A;  3NGP A;  3I56 Q;  2LT4 A;  1U3O A;  1RAH B;  3QWY A;  3NFC A;  4LD9 K;  1SHG A;  5LJ3 j;  4C92 F;  5CCA A;  5GAN 2;  2DX1 A;  1FMV A;  5CK9 A;  1X01 A;  5GAN 3;  5GAN e;  5LJ5 d;  3EHQ A;  3D7S B;  5CQY A;  1KK7 A;  4EPC A;  4J9I A;  1QVF P;  1YCS B;  4C0D B;  4M77 A;  1K9M U;  1H92 A;  5C0M A;  4PJO G;  4RG2 A;  1QW1 A;  1RLQ C;  1YJW A;  1C0M A;  3RES A;  4AFS C;  1VIF A;  2FRY A;  5EG2 A;  3TSW A;  2MIO A;  4C8Q F;  1UJ0 A;  2X3X D;  1N9S A;  3H0H A;  3OBW A;  2YWW A;  1WFW A;  4OVA A;  1Y7X A;  4WTO B;  1M90 R;  3MP6 A;  3UDC A;  5DLO A;  2LQN A;  4BD3 A;  3M56 A;  4E7H A;  2DBK A;  4YTL A;  2A3L A;  1PC0 A;  3SWN B;  5FU6 B;  2XI9 A;  4N4H A;  1OQK A;  4HT9 A;  4DBF A;  3HP9 A;  2J6F A;  1D0X A;  1OU9 A;  2ZPE B;  5KYW A;  2EGC A;  1M3A A;  2GCX A;  3CME A;  3GIB A;  1N8R U;  1IRE B;  2LRQ A;  1AVZ C;  3H0I A;  5GMK j;  4N0A A;  1VQM T;  3HHT B;  3M0P A;  3VS3 A;  3X20 B;  4PKC C;  2VYT A;  4M77 G;  1HJD A;  5CKE A;  4O5V A;  4TVR A;  1QQJ A;  4CI0 C;  1D0Y A;  3EGU A;  4C92 B;  1G8X A;  2A36 A;  2BE9 B;  2VB6 A;  2DEQ A;  2A08 A;  1QCF A;  2RNA A;  2BTT A;  5CAI A;  4BI8 B;  3L2R A;  1ZLM A;  2IIM A;  2JJ9 A;  2BZX A;  2EKO A;  3BE3 A;  1KQ2 A;  2MMP A;  3SFM A;  2RQU A;  2XHC A;  4R55 A;  2HQX A;  1HXD A;  2QQR A;  3MP1 A;  4A4K A;  2L3Q A;  2E12 A;  3TEE A;  3BY7 A;  3QBY A;  1G5V A;  4JJC A;  4J7I A;  3JCM d;  4GY5 A;  2LZ6 B;  4C8Q B;  2KK4 A;  3SB2 A;  2QQA A;  2HL5 C;  1VQK Q;  2DK3 A;  5GAN h;  2CGH A;  2XMF A;  1CKB A;  2KR3 A;  4MDW A;  1NBE B;  2LJ0 A;  2X4J A;  5IXF A;  1MND A;  2H8H A;  1VQ9 Q;  3QII A;  2XDD A;  3CPW S;  3TQ7 P;  2R5M A;  1WZO A;  4F04 B;  1GBQ A;  3OYL A;  5HK0 A;  5GAN 4;  1PWT A;  2EGA A;  1V76 A;  4RTV A;  4F7U F;  2AKK A;  2D0N A;  3FC3 A;  1B3Q A;  4QVC A;  4LUD A;  4M7A E;  3QJ6 A;  5M9O A;  1ZUY A;  1WHH A;  1PM3 A;  1M1K U;  1QCO A;  1H3Z A;  1IZ6 A;  3LX7 A;  2XDP A;  1KQS P;  1RAF B;  1TUG B;  4O6J A;  3M4G A;  4JJD A;  2EPD A;  1WYX A;  5J39 A;  3FEO A;  1QVF A;  1D1A A;  2FG0 A;  1M2O A;  3QWX X;  1XJW B;  3CMA A;  3CCJ A;  2O88 A;  2O9V A;  4J83 A;  1RAC B;  1XOV A;  3LGL A;  1GCQ C;  3TVT A;  3RKW A;  1YJ9 T;  1Q7Y U;  1U5S A;  1VQ8 A;  2EVR A;  2V8J A;  3OYM A;  2XKO C;  4NL3 A;  1OUL A;  1H8K A;  2DTH A;  1T3L A;  3H0F A;  1D3B A;  2X35 A;  2CH4 W;  2ZCF B;  2EYQ A;  2JOY A;  2K7A A;  3QKJ A;  2P0Q A;  2LX7 A;  3CQT A;  2GFA A;  1Y71 A;  2DF6 A;  3G1J A;  1G3Y A;  4QQG A;  9ATC B;  1MGQ A;  2HSP A;  1OPK A;  4LDX A;  3CME Q;  4OB2 B;  1I5O B;  2RK1 A;  3EFR A;  1VQ5 Q;  1IGQ A;  4R56 A;  3OW2 S;  4X9D A;  1EIF A;  2DL7 A;  1B34 B;  2P4R A;  4M75 C;  2CUD A;  3VRZ A;  1Q81 R;  3BFM A;  3KXT A;  1YJN T;  2CZ0 B;  2DER A;  1NJI C;  1QVP A;  4F7U B;  1ZBX A;  2HMA A;  1GCP A;  2DIL A;  4A4H A;  3L2Q A;  4RTY A;  5LL6 S;  3VUB A;  2BIV A;  2EQM A;  3FRN A;  4ZGJ B;  2DKG A;  3PTA A;  1CSK A;  3VS7 A;  3E9G A;  3Q1J A;  2L3P A;  1VQ4 T;  2CS7 A;  4F16 A;  2KI7 A;  2OTL A;  1YHQ T;  2J7I A;  3G4S A;  3OYK A;  1TOV A;  1XTD A;  3C94 A;  3I56 T;  4CC4 B;  2F2V A;  5D6W A;  5DY9 A;  2M51 A;  5FU7 C;  2XK0 A;  4K11 A;  5KYX B;  5AT1 B;  2R5A A;  3OQ5 A;  3FIF A;  4FYX B;  1M8M A;  2RN8 A;  1Q7Y C;  2ECZ A;  5IXB A;  1PD1 A;  2JW4 A;  3VV0 A;  2VC8 A;  5GAM d;  2LVM A;  1RUW A;  2ZZD A;  1UGQ B;  2QDY B;  3OSV A;  3CCV A;  1ZSZ C;  1Q86 C;  1KJW A;  2ROL A;  4PLL A;  3A8M B;  3S3M A;  3CCQ Q;  4FYV B;  5CVI A;  4N4I A;  4M75 D;  4M7A A;  3M53 A;  3RMS A;  5LJ3 e;  1MV3 A;  3CXC S;  3S3N A;  3CD6 A;  1K8A U;  3QYH B;  2DL8 A;  3WVE B;  4BY6 C;  2RHZ A;  1N9R A;  2DJZ A;  1UGR B;  2DXT A;  2YLB A;  2DEU A;  1KQS A;  2JMC A;  3J81 E;  2QYZ A;  4J9F A;  3CMA Q;  1WXB A;  1Q82 R;  2C0I A;  4CC2 A;  1N8R R;  1KQ1 A;  2K4Y A;  1I81 A;  3G7Z A;  2JN0 A;  4Y28 E;  3CCS A;  5GAO p;  1VQ8 Q;  2XDB A;  4J9D A;  2CP2 A;  3L1A A;  1NM7 A;  1OV3 A;  2K2M A;  2C0O A;  1KHI A;  1D1B A;  5GAO r;  2K3B A;  2DTO A;  2COZ A;  2LP5 A;  1QVG P;  2GQI A;  2M0Y A;  3AT1 B;  5D7U A;  4M78 A;  1OZ3 A;  2KT1 A;  1UEC A;  3M9Q A;  3OS5 A;  3S3O A;  1CKA A;  2IPO B;  4ELY C;  3NTK A;  1KG1 A;  1RAI B;  5KYN A;  2GNC A;  2HSE B;  2M0O A;  3V7R A;  8ATC B;  3EFS A;  2LJ3 A;  1PSF A;  3EGX B;  1VYT A;  3M0T A;  1M3B A;  1YIT Q;  3O5Z A;  2FPD A;  2XG8 D;  1JBM A;  4M7D A;  4B9W A;  1JB0 E;  4PJN A;  3VS1 A;  4DQ2 A;  2BKD N;  1AZG B;  4KUI A;  3CCL A;  3ME9 A;  5KE2 A;  1K8A C;  3VJP A;  4ZN1 A;  4M75 F;  4A53 A;  2KSS A;  1M2V B;  3KBG A;  1PCX A;  5ECA A;  1VQ9 T;  2VVK A;  2OTL Q;  2JVV A;  3CCU A;  3PIO A;  4BI4 A;  5IHN A;  4RCB A;  4PJO C;  1NG2 A;  2M9U A;  2OX7 A;  2RHU A;  1UG1 A;  1FMW A;  5LJ3 h;  2PVD B;  2CRE A;  2QQS A;  3I5S A;  4KUD K;  2LT1 A;  1TUD A;  2M16 A;  2AZV A;  3INZ A;  4AFQ C;  2GTO A;  4BE1 A;  4XU0 A;  4J9C A;  2IVW A;  4C5I A;  3ZFJ A;  2E65 A;  2EBP A;  3CCM Q;  1WXU A;  2DRM A;  1AWX A;  1AOJ A;  1TXQ A;  3CCV Q;  1YJW T;  3OS0 A;  2O4X A;  3I5R A;  2COY A;  2QG9 B;  3GNF B;  3OB9 A;  4PNO A;  4EDU A;  1E6H A;  1FYN A;  5CKF A;  5IAY A;  1PHT A;  1MNE A;  4PFZ A;  3CC7 A;  3CD6 Q;  2A37 A;  1JEG A;  3LYI A;  1W4S A;  2LTO A;  3HRS A;  1FWZ A;  1X2K A;  1M5Q 1;  1QP2 A;  1HSQ A;  5KYU A;  1YCY A;  4M77 C;  5HKC A;  4M75 B;  1Y0M A;  1VQO A;  2YRC A;  3EFO A;  1N27 A;  3GNG A;  1VQ7 Q;  1WGS A;  1WIE A;  4J7F A;  3P8H A;  2QDL A;  2KY9 A;  5GMK h;  3CME T;  1IRX A;  2ZPB B;  5LJ5 g;  2MWP A;  4PJO D;  4C8Q A;  1OPL A;  3CC2 Q;  3CCS Q;  3OMG A;  3MP8 A;  1FX7 A;  2DNU A;  3L2W A;  1RL2 A;  2YUP A;  4CC3 A;  1C6V X;  2DMO A;  3M54 A;  2AZS A;  2F69 A;  1LNX A;  1VQK A;  4RTU A;  1YP5 A;  3ASK A;  1K73 U;  3R6N A;  4JRP A;  2RK2 A;  2RI3 A;  3BDL A;  3EGD A;  2ZGW A;  3OYY A;  2JZ2 A;  4MMK A;  5HY6 A;  4A4F A;  1UGP B;  1IXD A;  3R6O A;  4Z88 A;  3CCE T;  1PD0 A;  1BBZ A;  1IO6 A;  5FU7 B;  2HKN A;  2JUF A;  1A0N B;  1M27 C;  1UHF A;  3PMI A;  4LN2 A;  1VQL Q;  8AT1 B;  3EG0 A;  1GFC A;  3SEM A;  1Q95 G;  1KC8 C;  1NZ9 A;  2HQE A;  3NMZ C;  5D6Y A;  4IUT A;  2WSE E;  4PL6 A;  2CT3 A;  2DL3 A;  1QCN A;  1HD3 A;  2KQW A;  3CCL Q;  5D6X A;  1W70 A;  1SF9 A;  2RI5 A;  1ZSZ B;  1U06 A;  5C6S A;  2E70 A;  3M57 A;  4RUG A;  4M77 D;  2J05 A;  2YSQ A;  3UAT A;  2QGG A;  2F2X A;  4FT4 A;  4A63 B;  3JB9 G;  3HRU A;  2J06 A;  3CCU Q;  5GAN 6;  1AWW A;  4BY6 B;  2FZK B;  2FPF A;  2KEA A;  2FYK A;  2NUT A;  1H64 1;  4LXC A;  2JMA A;  3OYE A;  1BYM A;  1YWP A;  3AHU A;  1Y57 A;  4ANJ A;  1KQS S;  4F14 A;  4JDS A;  4OF1 A;  4C0F A;  1K73 C;  2QQ9 A;  2PUO B;  3VU3 C;  5CIU A;  3JCM g;  1YFN A;  1V1C A;  2QA4 Q;  2FL7 A;  2E10 A;  4EMK A;  3X26 B;  1S72 Q;  2COW A;  3VYH B;  2JTF A;  3V8K A;  3CCJ T;  1Q81 C;  3CMA T;  1VQ5 A;  4Z89 A;  2X51 A;  1IGU A;  1TTH B;  2E3I A;  2K3X A;  2PNI A;  3S6W A;  2DET A;  3LH0 A;  2MF2 A;  1PSE A;  3CC7 Q;  2CSQ A;  1X69 A;  4F7U A;  1W2B P;  1M1F A;  1VQ8 T;  2ZPG B;  1Y96 B;  5KE3 A;  1UEB A;  2GBQ A;  1RAA B;  2LQ8 A;  5LJ5 f;  1ZBJ A;  2NUP B;  2QTV A;  2DXU A;  3ZEH A;  2DXB A;  2HEQ A;  1VQO Q;  1U1S A;  1AD5 A;  1MMG A;  4M4Z A;  3V8J A;  1BK2 A;  2MAM A;  3OYC A;  3DKM A;  3RMQ A;  1WA7 A;  4OMO A;  2DJQ A;  4M77 F;  2JXB A;  2Y4X A;  4OMP A;  2QEX A;  1R8O B;  2RJC A;  4OB0 B;  4HVU A;  4C5H A;  4AMC A;  2DZ9 A;  4NOY A;  3UT1 A;  1WJS A;  5LJ5 j;  1SRM A;  2MI6 A;  5GAO m;  3SD4 A;  2RI2 A;  4HKE A;  3OYN A;  4PJO B;  2O31 A;  5HCK A;  5GAN d;  2EYZ A;  2OTL T;  2O9S A;  4II1 A;  3G4S T;  4A4G A;  2L2P A;  1G3S A;  3A8L B;  1NJI U;  1QWF A;  4PJM A;  3EG9 A;  3CCQ A;  2K5I A;  2KXC A;  5DLQ E;  1PRL C;  2D1X A;  3I55 A;  2MCN A;  1JO8 A;  3M0S A;  2RH2 A;  1YIJ Q;  3GPL A;  2DXC A;  3H9N A;  4P5N A;  3JCM V;  5KYY B;  4QVD A;  1E6G A;  1QKX A;  2ATC B;  1RAB B;  2K3Y A;  2P0K A;  4XU2 A;  2EQI A;  2X9H A;  4ORZ A;  3MPU B;  4OMM A;  2EJF A;  1WHG A;  3UA7 A;  5A2Q E;  3OYA A;  4DBQ A;  3P8D A;  4C0G A;  1QKW A;  1VYV A;  2I0N A;  2ZPF B;  5I2M A;  1VQ6 A;  2CP0 A;  3CCV T;  3OYJ A;  1BB9 A;  2MWO A;  4E7L A;  3JB9 J;  3DLL A;  4RKU E;  1LVK A;  4UC4 A;  1BI1 A;  3JCM f;  4QW2 A;  5GAO n;  1X6G A;  4M77 B;  3N5B B;  1UTI A;  4L5G A;  4XTY A;  2O01 E;  5CR2 A;  4AFZ C;  3CD6 T;  4VUB A;  4D8D A;  2DAQ A;  4BUG A;  1GL5 A;  3BW1 A;  3QJY A;  2MOX A;  2EYX A;  2QI2 A;  4J8O A;  2EW3 A;  3L2U A;  4DOV A;  1KD1 R;  4M78 E;  1Q86 U;  1WHL A;  1YN8 A;  4JJB A;  3PVL A;  1K0S A;  5A0G A;  2D6F A;  2CP7 A;  3V7C A;  2J6K A;  1UB4 A;  1OI1 A;  3JAM E;  2HNI A;  3C95 A;  1YI2 A;  1UHC A;  4XQ3 A;  4NL2 A;  2C06 A;  1EX4 A;  5I21 A;  3LWH A;  1MUZ A;  5A0D A;  2EJG A;  2K6D A;  3OY9 A;  1YIT A;  1OZ2 A;  1TU0 B;  2V26 A;  4EMH A;  3CCS T;  4IUV A;  1ZX6 A;  4RG8 A;  4M7A C;  2CT4 A;  5GAM g;  2YUN A;  2EQK A;  4M7D E;  1X6B A;  4X9C A;  1M2V A;  2DL5 A;  4D6W A;  1QVG S;  1W2B A;  3VKI A;  3M58 A;  3KFV A;  4IUR A;  2GQV A;  5KYW B;  1J3T A;  2ABL A;  5GAN 8;  4OML A;  2FVU A;  4KBM B;  1UFF A;  2IG0 A;  4JS4 A;  1NYG A;  3WVD B;  3QO3 A;  2O2O A;  4LUE A;  2K5L A;  5EC7 A;  5FWB A;  1Z9Z A;  3HRT A;  5KCH A;  1M3C A;  2A7Y A;  4J6Y A;  3LH5 A;  2ZPI B;  4FT2 A;  1PKT A;  1MMN A;  4Z8A A;  2PQW A;  2QEX Q;  2XU8 A;  2FZC B;  1QLY A;  1BI0 A;  3I35 A;  1G3W A;  4KGZ B;  1C1A A;  2CZ1 B;  1RLP C;  3H6Z A;  1XQH A;  4X34 A;  3OA6 A;  3OS2 A;  2DA9 A;  2PTK A;  5GJV B;  2DIQ A;  3CCL T;  1K9M R;  1QP3 A;  4QT7 A;  1AWO A;  4OB1 B;  4M78 C;  1R0B G;  1I07 A;  3CCM A;  4ELZ C;  4FSS A;  5A0L A;  3M5A A;  2YT6 A;  3UPU A;  2E5K A;  5FRO A;  2EIF A;  2D8H A;  1PKS A;  3CCU T;  2AKL A;  3NTH A;  2H3E B;  4GBQ A;  3M59 A;  4BDZ A;  2AIR B;  2R57 A;  2ESW A;  1I8F A;  4L6V 5;  3I55 Q;  4C92 E;  3MO8 A;  4JRI A;  4LDU A;  2DL4 A;  3RUX A;  3QYG B;  2QXF A;  1IHV A;  1VA7 A;  2OI3 A;  1AEY A;  1ZQ1 A;  2KVQ G;  1ACM B;  1WHM A;  2CZ6 B;  1GRI A;  2OAW A;  1M90 U;  4XTX A;  3QUI A;  1VQN A;  1ABO A;  1O9S A;  1YWO A;  4DBR A;  5HK3 A;  5GMK m;  3CEY A;  2JS2 A;  1VQ7 A;  1VQ6 Q;  3URG A;  4JPB W;  2AT1 B;  3PMT A;  2LC4 A;  4C8Q E;  3UWN A;  4DBH A;  3PIP A;  3CC2 A;  1NLP C;  4AFU C;  2OTJ A;  2DE0 X;  2JS0 A;  2RPN A;  4MDX A;  3RDV A;  3CC7 T;  2RB6 A;  1T0J A;  2K79 A;  1JXO A;  3O8V A;  4A54 A;  2DD5 A;  1P92 A;  2B86 A;  3EH2 A;  3EH1 A;  2SRC A;  2Y4Y A;  1PG5 B;  3I9Q A;  1OEB A;  3OW2 P;  2G6F X;  3E9F A;  1W6X A;  5FW9 A;  5GAM f;  2KYM A;  4CRI A;  2E64 A;  4J9E A;  3PGG A;  1VQO T;  1YI2 Q;  4M7A G;  3JB9 I;  1VQL A;  2JM8 A;  4J9B A;  1WNL A;  1G83 A;  1JJ2 P;  1D3B B;  4BE0 A;  2RHI A;  1JXM A;  4OP0 A;  2CP6 A;  2X3W D;  1GXI E;  4QQD A;  2RQV A;  4HA8 A;  3CPF A;  1VQK T;  5GMK i;  3QDR B;  3VRY A;  1TWB A;  2F2W A;  2JM9 A;  4FW2 A;  1Z9Q A;  2LMJ A;  3HL8 A;  5GAM j;  2XD0 A;  4BAC A;  1WJR A;  4OMQ A;  2KAF A;  5CKH A;  2W10 A;  2E4H A;  3M0Q A;  3NHN A;  4B6M A;  1H3H A;  3QG1 A;  2GFU A;  3JCM b;  1M90 C;  4X1V A;  4KGX B;  1G2B A;  4FIB A;  2C0T A;  3LLR A;  2LQK A;  5I22 A;  4R0K A;  5GAO q;  4JZ3 A;  1WHK A;  4JS5 A;  3M0U A;  2DBM A;  5CKD A;  2ROT A;  3SWN A;  4M78 G;  1K4U S;  1M1K R;  2YHT A;  5LJ5 e;  1QVF S;  2KRS A;  1VQP A;  4XU1 A;  2FHD A;  1NYF A;  1QMC A;  4XTZ A;  1N6A A;  2RF0 A;  2KE9 A;  1BKB A;  3CC4 A;  2FO0 A;  5LJ3 d;  4DA4 A;  1UE9 A;  2FZG B;  5IHI A;  1KC8 U;  3RKX A;  3L2Z A;  1ABQ A;  1ZA1 B;  3L2V A;  2QA4 A;  2PUK B;  2CP5 A;  3MHX A;  1S72 A;  4M7D G;  1DJ7 B;  2P0P A;  1Q7Y R;  4F7U E;  3G71 A;  1IB8 A;  1AT1 B;  4C92 A;  2RQR A;  4FM4 B;  4HVV A;  2KNB B;  4ATO A;  2D8J A;  3F70 A;  4CC7 A;  4D8K A;  2L89 A;  3C12 A;  1BIA A;  3J7A F;  2E6N A;  3RNJ A;  3QHS A;  2K2V A;  1VQN Q;  1X75 C;  2EQU A;  2RHX A;  2NYS A;  4HCC A;  2RHY A;  1ZSG A;  4M7A B;  1VOM A;  2K57 A;  3TRE A;  4N4G A;  1M4Z A;  4FL6 A;  3EG2 A;  2DFU A;  3QXE B;  4LDY A;  4FU6 A;  3VUZ A;  4LDV A;  1VQ5 T;  1BI2 A;  1MMD A;  3GOX A;  1WLP B;  1W2B S;  2OTJ Q;  2JTE A;  4IIM A;  3JB9 D;  2QAZ A;  4J6W A;  2FPE A;  2P4T A;  4HVW A;  5GAN 5;  1WHJ A;  1MV0 B;  2Y90 A;  1YJN Q;  4ZGD B;  5GJW B;  4EIK A;  2VWF A;  1Q81 U;  3JCM c;  1KSW A;  2DIG A;  4RTX A;  1AWJ A;  2E6Z A;  3VYG A;  2LX9 A;  3OW2 A;  4EMK C;  3GBQ A;  4EMG A;  1X27 A;  4C92 G;  2YUQ A;  2L5Q A;  3OBY A;  3QZ9 B;  2VUB A;  4F17 A;  4N0A C;  3JCM e;  1VQ4 Q;  4ZTJ A;  3A5Z B;  1JJ2 A;  2QEX T;  4M78 B;  2HBW A;  3FJP A;  5LJ5 h;  3CCR A;  2OAU A;  1YIJ A;  2MK5 A;  2XIC A;  1U1T A;  1LJO A;  1E7O A;  4RTW A;  1KFZ A;  2JNG A;  4KT0 E;  3MCA B;  4BB7 A;  3RIR A;  4JLI A;  2KBT A;  4XTV A;  4C8Q G;  2DLP A;  4KH0 B;  2E1H A;  1TG0 A;  4M7D B;  3V8L A;  3OYF A;  3BDU A;  3X28 B;  1PRM C;  1OU8 A;  1TUC A;  2MPX C;  1T0H A;  2ED1 A;  3PFS A;  3CCQ T;  3NPF A;  3RER A;  1K8A R;  1KD1 C;  2DO3 A;  1OX9 A;  4PJO F;  2OJ2 A;  3I55 T;  2CDT A;  2KXD A;  1VQP Q;  2AK5 A;  5AYF A;  1O75 A;  2RJF A;  3JB9 F;  3CC4 Q;  4HT8 A;  1KHC A;  2DYB A;  3QZ5 B;  1SSF A;  1SPK A;  1BCM A;  2LNH B;  3JCM P;  3A8G B;  2GTJ A;  1FMK A; 
#chains in the Genus database with same CATH homology
 1UGR B;  2DXT A;  4L5G A;  4XTY A;  3LW5 E;  2YLB A;  2O01 E;  5CR2 A;  3FLG A;  1KQS A;  5DM7 R;  1WQ7 A;  2LCL A;  3J81 E;  1I4K 1;  1B34 A;  4VUB A;  4C0Z A;  2DAQ A;  2RJD A;  3C4S A;  4BUG A;  1VQ6 T;  3BW1 A;  3CXC A;  3QJY A;  4ME7 A;  4XTW A;  2QI2 A;  2ZPH B;  4J8O A;  4M7D F;  3L2U A;  4DOV A;  2V8I A;  3QPH A;  1KQ1 A;  2K4Y A;  1I81 A;  4M78 E;  1U8R A;  4XAX B;  3OMC A;  3G7Z A;  4NS5 A;  1Q86 U;  3OYD A;  1Q82 U;  2D9T A;  2JN0 A;  4Y28 E;  3CCS A;  5A0G A;  5GAO p;  2D6F A;  4QVZ A;  2XDB A;  3HKS A;  3V7C A;  1KD1 U;  1UB4 A;  1OI1 A;  3L1A A;  4C8Q D;  2HNI A;  3C95 A;  4PLI A;  5CQX A;  5GAN g;  4MZM A;  1YI2 A;  3P8B B;  2VV5 A;  2O4X B;  4XQ3 A;  3FB9 A;  4NL2 A;  4J5Y A;  2C06 A;  5I21 A;  3LWH A;  1KHI A;  2QTX A;  5A0D A;  5GAO r;  2DTO A;  2QQB A;  1I5L A;  2EJG A;  3OY9 A;  4FSX A;  1YIT A;  2LDM A;  4Y91 A;  1OZ2 A;  5GAO l;  3G6E A;  2RO0 A;  4EMH A;  3CCS T;  4PJO A;  4IUV A;  4M78 A;  1OZ3 A;  2G3R A;  2AHJ B;  2B8A A;  4RG8 A;  4C5G A;  5GAM g;  4M7A C;  3DB4 A;  3M9Q A;  2EQK A;  4M7D E;  1YI2 T;  4Q5W A;  3T9N A;  3OS5 A;  4X9C A;  3S3O A;  4D6W A;  1QVG S;  4ELY C;  3NTK A;  3JCM h;  3X25 B;  1W2B A;  3VKI A;  3CCE A;  1ZHI A;  3LGF A;  1M8V A;  3M58 A;  4IUR A;  2GQV A;  5LJ3 f;  2M0O A;  3V7R A;  1HK9 A;  5GAN 8;  3EFS A;  2FVU A;  3PT9 A;  1PSF A;  4KBM B;  4JS4 A;  2E41 A;  2IG0 A;  1YIT T;  1KG1 A;  3G6E T;  3WVD B;  1K9M C;  3QO3 A;  2PVO B;  2K5L A;  2XG8 D;  5FRM A;  5IN1 A;  2EAY A;  2VXF A;  3OYI A;  2E5Q A;  1VQ9 A;  3HRT A;  2KMT A;  2RM4 A;  1JBM A;  4E7I A;  5KCH A;  1QVG A;  4M7D A;  4KUL A;  4B9W A;  2X4X A;  2D0Q B;  1JB0 E;  4Z02 A;  1WPY A;  2A7Y A;  4J6Y A;  4DQ2 A;  2ZPI B;  2BKD N;  2EWN A;  4FT2 A;  1FXX A;  2PVG B;  4KUI A;  1M1G A;  3ME9 A;  4MZP A;  5KE2 A;  2PQW A;  3GP8 A;  1K8A C;  2WSC E;  3OSS C;  4M75 F;  3VJP A;  3X24 B;  2KSS A;  2XU8 A;  4A53 A;  4ZN1 A;  3JB9 H;  3KBG A;  4XU3 A;  2L8D A;  1BI0 A;  2LT4 A;  5J3B A;  1M9S A;  4F7U G;  1VQ9 T;  1G3W A;  3NFC A;  2HBP A;  2CZ1 B;  4LD9 K;  1AHJ B;  3H6Z A;  1XQH A;  4C92 F;  5CCA A;  4X34 A;  5LJ3 j;  3OS2 A;  3OA6 A;  3DLM A;  2JVV A;  5GAN 2;  3HPW A;  2DIQ A;  4JRQ A;  3CCL T;  4J6X A;  5CK9 A;  1X01 A;  5GAN 3;  2X4Y A;  3CCU A;  3PIO A;  1QP3 A;  5GAN e;  4BI4 A;  5LJ5 d;  2VXE A;  2LNV A;  4RCB A;  5FRN A;  4PJO C;  2M9U A;  4M78 C;  4OB1 B;  2RHU A;  5CQY A;  3HFO A;  4EPC A;  3FDR A;  3CCM A;  2DVE A;  2EJ9 A;  5LJ3 h;  4ELZ C;  3OYG A;  4C0D B;  2PVD B;  4M77 A;  3V7S A;  1K9M U;  2QQS A;  5A0L A;  3M5A A;  5C0M A;  1Q82 C;  4KUD K;  2LT1 A;  4PJO G;  4RG2 A;  3UPU A;  4M75 E;  1QW1 A;  5FRO A;  2EIF A;  1WQW A;  2M16 A;  5GAM e;  1YJW A;  1N8R C;  3HSB A;  3RES A;  5KH6 A;  3CCU T;  4E7J A;  3NTH A;  1VIF A;  3A8O B;  3INZ A;  3M59 A;  5EG2 A;  4BDZ A;  4BE1 A;  2R57 A;  4XU0 A;  2CYZ B;  4C8Q F;  2IVW A;  4C5I A;  3CCM T;  1I8F A;  1N9S A;  2GF7 A;  4L6V 5;  3OBW A;  4C92 E;  3ZFJ A;  4IUP A;  3MO8 A;  4JRI A;  4LDU A;  3HFN A;  2E65 A;  3RUX A;  3QYG B;  2QXF A;  4OVA A;  1WJQ A;  1Y7X A;  1VUB A;  1YJW T;  3OS0 A;  3EAE A;  2FB7 A;  3MP6 A;  3UDC A;  5DLO A;  2O4X A;  1ZQ1 A;  2KVQ G;  3KUF A;  4BD3 A;  3M56 A;  4E7H A;  1JRI A;  3GNF B;  4YTL A;  2A3L A;  2CZ6 B;  3OB9 A;  4PNO A;  3SWN B;  4EDU A;  5GAN 7;  1M90 U;  4XTX A;  3QUI A;  4IUQ A;  5CKF A;  1VQN A;  5IAY A;  5FU6 B;  3MEV A;  2XI9 A;  4N4H A;  2M1H A;  2NLU A;  1O9S A;  3CC7 A;  4M77 B;  5HK3 A;  5GMK m;  3CEY A;  3CBP A;  3PNW C;  1VQM A;  4HT9 A;  1VQ7 A;  3LYI A;  3URG A;  2HAX A;  3HP9 A;  3PMT A;  1W4S A;  2LTO A;  3HRS A;  1FWZ A;  2LC4 A;  4C8Q E;  3UWN A;  4XK8 E;  3PIP A;  1XNI A;  3CC2 A;  5CKB A;  2ZPE B;  1M5Q 1;  2GCX A;  1QP2 A;  3CME A;  3J80 E;  3GIB A;  1N8R U;  1IRE B;  4OMF B;  2LRQ A;  2OTJ A;  1VQN T;  4MML A;  2PU9 B;  5GMK j;  4MDX A;  1YCY A;  4N0A A;  4M77 C;  5GAN f;  3CC7 T;  1VQM T;  2RB6 A;  1OYX A;  5HKC A;  3HHT B;  3E1S A;  4M75 B;  1VQO A;  1VQ7 T;  3O8V A;  4ZGE B;  4OB3 B;  4A54 A;  2DD5 A;  1P92 A;  1N27 A;  3GNG A;  3X20 B;  4PKC C;  3A8H B;  2VYT A;  1WGS A;  2Y4Y A;  4M77 G;  4RCC A;  3CC2 T;  5CKE A;  4O5V A;  4J7F A;  4TVR A;  3P8H A;  5GMK h;  2KY9 A;  3CME T;  2ZPB B;  4CI0 C;  5LJ5 g;  2MWP A;  4PJO D;  2OTJ T;  3E9F A;  4C8Q A;  4C92 B;  5GAM f;  1Y07 A;  3OMG A;  4CRI A;  2DEQ A;  2E64 A;  3MP8 A;  3NTI A;  1FX7 A;  3L2W A;  4IKF A;  3PGG A;  2F5T X;  1VQO T;  1RL2 A;  4QQ6 A;  5CAI A;  4BI8 B;  3L2R A;  4M7A G;  4WF2 A;  3JB9 I;  3M54 A;  4EMK B;  1VQL A;  1MHN A;  2F69 A;  1LNX A;  1VQK A;  2EKO A;  1KQ2 A;  4E7K A;  2MMP A;  1WNL A;  3ASK A;  5J26 A;  1K73 U;  3SFM A;  4JRP A;  2RK2 A;  1D3B B;  2RI3 A;  2XHC A;  2ZGW A;  3BDL A;  2RHI A;  3CBO A;  3OYY A;  4R55 A;  4BE0 A;  2JZ2 A;  2HQX A;  4MMK A;  5HY6 A;  1HXD A;  4A4F A;  2LCC A;  2QQR A;  3JSC A;  3MP1 A;  4OP0 A;  4A4K A;  2E12 A;  3TEE A;  3BY7 A;  3H8Z A;  3QBY A;  5GAN j;  1GXI E;  1G5V A;  1UGP B;  3R6O A;  4QQD A;  3CCE T;  4J7I A;  1JJ2 S;  4HA8 A;  3JCM d;  3CPF A;  4GY5 A;  1VQL T;  1VQK T;  3JCM P;  5FU7 B;  2JUF A;  5GMK i;  3QDR B;  4C8Q B;  2KK4 A;  1M1K C;  3SB2 A;  2QQA A;  3PMI A;  5CO7 A;  3M4Y A;  2DK3 A;  5GAN h;  4ZN3 A;  2CGH A;  2H3J A;  2F5K A;  1NZ9 A;  3HL8 A;  2HQE A;  5GAM j;  1KC8 C;  1BI3 A;  4BAC A;  2XD0 A;  1WJR A;  4MDW A;  2X4J A;  2KAF A;  5D6Y A;  5CKH A;  4IUT A;  3QG1 A;  2WSE E;  4PL6 A;  4JUV A;  1UGS B;  2YRV A;  2GFU A;  2DZC A;  3JCM b;  1M90 C;  3M55 A;  4LD6 A;  2VGM A;  2KQW A;  5GAM h;  3QII A;  2XID A;  4FIB A;  5D6X A;  2XDD A;  2DD4 A;  3CPW S;  2RI5 A;  3LLR A;  2LQK A;  5C6S A;  2R5M A;  5I2S A;  3JRZ A;  4JLG A;  5GAO q;  2E70 A;  3M57 A;  3OYL A;  5HK0 A;  5CKD A;  4JS5 A;  4IUU A;  5GAN 4;  4GLK A;  4M77 D;  3SWN A;  4M78 G;  1BIB A;  4BI3 A;  4F7U F;  3FC3 A;  2YHT A;  4QVC A;  5LJ5 e;  4M7A E;  3QJ6 A;  1QVF S;  5M9O A;  1VQP A;  4FT4 A;  3JB9 G;  3HRU A;  4B9X A;  4XU1 A;  2FHD A;  3OYH A;  4XTZ A;  1N6A A;  5GMK l;  4M7A D;  5GAN 6;  1M1K U;  1BKB A;  1H3Z A;  3CC4 A;  4BY6 B;  1IZ6 A;  3LX7 A;  5LJ3 d;  3LWI A;  4BE2 A;  4DA4 A;  2DTI A;  2XDP A;  4ZTF A;  2FYK A;  4O6J A;  4JRK A;  1KC8 U;  3RKX A;  4M7D C;  3L2Z A;  3M4G A;  1H64 1;  3L2V A;  2QA4 A;  3OS1 A;  2PUK B;  4C0D C;  3OYE A;  1BYM A;  3MHX A;  3GF5 A;  3AHU A;  1S72 A;  1VQP T;  4M75 A;  5J39 A;  3FEO A;  1YJ9 A;  3DB3 A;  1QVF A;  3TCJ A;  1KQS S;  4M7D G;  1NPP A;  4OGC A;  1DJ7 B;  4JDS A;  4OF1 A;  3CMA A;  3CCJ A;  3CC4 T;  4J83 A;  2P0P A;  4C0F A;  1K73 C;  4F7U E;  3G71 A;  2QQ9 A;  4C92 A;  1XOV A;  2PUO B;  3ER0 A;  1LOJ A;  3LGL A;  3VU3 C;  2QA4 T;  4FM4 B;  5CIU A;  4ATO A;  3JCM g;  3RKW A;  1S72 T;  3TU4 K;  1TH7 A;  1YJ9 T;  1Q7Y U;  1VQ8 A;  3F70 A;  2V8J A;  2FL7 A;  2E10 A;  4XTU A;  2XKO C;  4EMK A;  2L89 A;  3X26 B;  4NL3 A;  3OYM A;  3C12 A;  2DTH A;  1BIA A;  3VYH B;  3WXM B;  2JTF A;  3V8K A;  3CCJ T;  1Q81 C;  3CMA T;  3J7A F;  2E6N A;  1D3B A;  1VQ5 A;  1VQ8 T;  2X35 A;  4C5E A;  3G71 T;  3QHS A;  2K2V A;  2K3X A;  1X75 C;  3S6W A;  3SWN C;  2EQU A;  2RHX A;  2EYQ A;  2MF2 A;  2ZCF B;  3LH0 A;  1PSE A;  4HCC A;  2JOY A;  2RHY A;  5FU6 C;  4M7A B;  4LDW A;  4PJO E;  1V29 B;  4F7U A;  3QKJ A;  2P0Q A;  1M1F A;  2K57 A;  3TRE A;  2GFA A;  1M4Z A;  2DPP B;  1Y71 A;  4FL6 A;  2ZPG B;  1Y96 B;  2CZ7 B;  4N4G A;  5KE3 A;  1UEB A;  1G3Y A;  4QQG A;  3QXE B;  4LDY A;  1MGQ A;  4FU6 A;  3JCM W;  2LQ8 A;  3L42 A;  4M78 D;  3VUZ A;  4MZT A;  1YJN A;  4LDX A;  1VIE A;  5LJ5 f;  4LDV A;  1VQ5 T;  1BI2 A;  4OB2 B;  4BDY A;  4OGE A;  3GOX A;  1W2B S;  4DOW A;  3JAM E;  2RK1 A;  3EFR A;  4RMO A;  3JB9 D;  4J6W A;  2DXU A;  3ZEH A;  4R56 A;  2DXB A;  3OW2 S;  3QSU A;  4X9D A;  1EIF A;  3JCM Q;  1B34 B;  2P4T A;  4M75 C;  1U1S A;  3CD6 T;  2X4W A;  1G3T A;  3V8J A;  3BFM A;  3KXT A;  3MEA A;  1YJN T;  2CZ0 B;  2MAM A;  5GAN 5;  3OYC A;  3DKM A;  1NJI C;  3RMQ A;  1VQ4 A;  2Y90 A;  1QVP A;  4F7U B;  1ZBX A;  4M77 F;  4M75 G;  4ZGD B;  2EQJ A;  1YHQ A;  2Y4X A;  5LJ3 g;  1X6O A;  4A4H A;  3JCM c;  4C92 C;  4E47 A;  4HCZ A;  1Q81 U;  2CKK A;  3L2Q A;  5LL6 S;  3VUB A;  2DIG A;  2QEX A;  4M7D D;  1R8O B;  2BIV A;  2EQM A;  2RJC A;  3FRN A;  2E6Z A;  1NE8 A;  2DKG A;  4OB0 B;  3VYG A;  2LX9 A;  4ZGJ B;  3PTA A;  3OW2 A;  1NPR A;  3E9G A;  3I56 A;  4C5H A;  5GMK e;  3Q1J A;  4EMK C;  4M7A F;  2DZ9 A;  4NOY A;  3UT1 A;  4EMG A;  4C92 G;  3OBY A;  2L5Q A;  3QZ9 B;  1WJS A;  5LJ5 j;  2VUB A;  1VQ4 T;  2MI6 A;  1YBY A;  5GAO m;  4N0A C;  2CS7 A;  3JCM e;  2OTL A;  1YHQ T;  3SD4 A;  2RI2 A;  3G4S A;  4HKE A;  4ZTJ A;  3OYK A;  3A5Z B;  3OYN A;  1JJ2 A;  4PJO B;  2QEX T;  1RI0 A;  1XTD A;  4A4E A;  4M78 B;  5IT9 E;  3GLX A;  3OYB A;  3FJP A;  5LJ5 h;  3C94 A;  3I56 T;  2OAU A;  2K5F A;  3CCR A;  5D6W A;  5DY9 A;  1YIJ A;  2EFI A;  2XIC A;  5FU7 C;  2XK0 A;  1U1T A;  2BUD A;  1LJO A;  2RA2 A;  4M77 E;  5GAN d;  4C8Q C;  2JNG A;  4KT0 E;  5L8R E;  2R5A A;  3MCA B;  3FIF A;  3OQ5 A;  2OTL T;  4BB7 A;  4II1 A;  1Q7Y C;  3G4S T;  3RIR A;  4JLI A;  4A4G A;  1G3S A;  3A8L B;  1NJI U;  4XTV A;  4C8Q G;  3CCQ A;  4HCB A;  2VGN A;  3VV0 A;  2RJE A;  2K5I A;  3CCR T;  1YIJ T;  2VC8 A;  5DLQ E;  5GAM d;  3SDZ A;  3JCM X;  4JJN K;  2HD0 A;  2LVM A;  2E1H A;  3MEU A;  3I55 A;  3CPW A;  2KDS A;  2RH2 A;  2I2L A;  4M7D B;  3MET A;  3GPL A;  2DXC A;  3CCL A;  3V8L A;  2ZZD A;  3OYF A;  3BDU A;  3X28 B;  1UGQ B;  2WAC A;  4P5N A;  3JCM V;  2QDY B;  4V2S A;  3OSV A;  4QVD A;  2WSF E;  3CCV A;  1Q86 C;  4L59 A;  3PFS A;  4PLL A;  2K3Y A;  2P0K A;  3A8M B;  4XU2 A;  3CCQ T;  2JTM A;  3RER A;  1KD1 C;  2DO3 A;  3S3M A;  3RKY A;  2R58 A;  3JCM J;  5CVI A;  2RD1 A;  4PJO F;  4N4I A;  4M75 D;  4M78 F;  2EJF A;  3MEW A;  3I55 T;  4M7A A;  2V8K A;  3M53 A;  3RMS A;  5LJ3 e;  5KCO A;  5FLX E;  5A2Q E;  3CXC S;  3OYA A;  3S3N A;  5AYF A;  1K8A U;  3CD6 A;  1Y96 A;  3P8D A;  1O75 A;  2RJF A;  4C0G A;  1VQ6 A;  2ZPF B;  3QYH B;  5I2M A;  3JB9 F;  3CCV T;  3OYJ A;  3WVE B;  4HT8 A;  1KHC A;  2MWO A;  3E19 A;  3QZ5 B;  3ZBD A;  4E7L A;  3JB9 J;  1SSF A;  4C92 D;  4BY6 C;  3DLL A;  4RKU E;  2L3R A;  4UC4 A;  1BI1 A;  2RHZ A;  3JCM f;  1N9R A;  4QW2 A;  5GAO n;  2YLC A;  3A8G B;  3CBM A;  2DJZ A;  3N5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...