2LJ3A

Pfbd: high-throughput strategy of backbone fold determination for small well-folded proteins in less than a day
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title PFBD: High-throughput Strategy of Backbone fold Determination for small well-folded proteins in less than a day
rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 3
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lj3A00
2DE0X 2X3WD 4OMQA 4AFSC 4HVVA 2C0OA 1X6BA 1AWXA 1GCQA 3TSWA 1WXTA 2YUOA 1TUCA 4Z8AA 2AK5A 2DBKA 2DYBA 2DX1A 1NG2A 1TUDA 2LJ0A 3PVLA 2MCNA 4LN2A 2K7AA 4CC2A 4LUDA 2LZ6B 2BZYA 1X2QA 1GCPA 1Y0MA 2DVJA 2FRYA 2CH4W 1H3HA 3VS7A 3JV3A 5FWCA 1VYUA 4CC7A 2ROLA 2CT3A 3UF4A 1QCFA 3ULRB 1BK2A 2E5KA 4J9EA 1MUZA 1YWOA 1OPLA 1OEBA 1B07A 1BB9A 2BTTA 2IIMA 4J9CA 4JPBW 1BU1A 4CC4B 4AG2C 1UHFA 4HVWA 1M3AA 4ESRA 3IQLA 1FMKA 3EG3A 3VS5A 1WI7A 3VS6A 2KT8A 2DF6A 4OMNA 3VS4A 5EC7A 5GJWB 1SHGA 3TSZA 5ECAA 2KE9A 2PTKA 3EG0A 2NUZA 4X1VA 2JM8A 3NPFA 1A0NB 3UA7A 1KIKA 4K11A 2J05A 4RTYA 3U23A 2K2MA 1PRMC 2F2VA 2ROTA 1CSKA 2YT6A 2RPNA 3NMZC 1W6XA 2LJ3A 3H0IA 2ENMA 1UG1A 1E6HA 2MIOA 2KBTA 2SEMA 2OJ2A 2EYXA 3SHWA 1XOVA 1VYVA 1UECA 3I5RA 2KR3A 1IO6A 5IHKA 1OOTA 4R0KA 1EFNA 2D0NA 2LQNA 3M0SA 3M0QA 2AZVA 2RF0A 2RQUA 1ZUUA 2FPEA 2LMJA 1AVZC 4JJCA 3M0RA 1V1CA 2FRWA 2RN8A 2RQTA 2BZXA 2C0IA 2KRSA 1SSHA 2KRNA 3H0HA 2DNUA 2HSPA 1KFZA 2V1RA 1QKXA 2DL5A 1X27A 1S1NA 3I35A 1ARKA 3RNJA 2FO0A 2LJ1A 1QWEA 1T0JA 3R6NA 2A28A 2J7IA 1G83A 2DL3A 4OMOA 2J6OA 2K3BA 2H8HA 1MV0B 4WCIA 4JZ3A 1M3BA 1UJYA 1AD5A 2JW4A 1X69A 4OMMA 5IXBA 3CQTA 1Z9ZA 2FPFA 1WXBA 4J9FA 1K0SA 1UHCA 2JXBA 2VKNA 1K4US 4IIOA 1NEBA 3A98A 3I9QA 2AKKA 1WX6A 2CDTA 2JS2A 1AZEA 2KRMA 3SEMA 4D8DA 4J9GA 1AWWA 2F2WA 3QWXX 2DMOA 2EPDA 4J9HA 2JMCA 2MOXA 2O9VA 4JJDA 4AFQC 2HDAA 1E6GA 1GFCA 2EGEA 1HD3A 5IHNA 2V1QA 1WA7A 1AZGB 4RTTA 2GTOA 2HCKA 1LCKA 2KEAA 5IHIA 1UJ0A 4JZ4A 1FYNA 1JXMA 1CKBA 1K0XA 2HEQA 4RTVA 2K9GA 2YUQA 2F2XA 4OMPA 1GCQC 4KRTA 2CUDA 1KSWA 1Z9QA 2I0NA 4EIKA 2JM9A 2JTEA 2DLPA 3O5ZA 1AWJA 2RNAA 1MV3A 3M0TA 1AWOA 1X43A 1UUEA 1UFFA 1WLPB 2GTJA 1Y57A 2L3QA 2JMAA 2KGTA 4A63B 1AOJA 1I0CA 2DJQA 2B86A 1M3CA 2CUBA 2A08A 2EYYA 3UA6A 1WXUA 1SPKA 4AG1C 2D1XA 1VA7A 1QWFA 2EYWA 4JJBA 3THKA 1WDXA 1JEGA 1SRMA 2AKLA 1ZUYA 2O31A 1PNJA 2L0AA 1NLOC 1RLQC 2GGRA 3H0FA 1ZX6A 2LP5A 2CH4A 1G2BA 2GNCA 2G6FX 2BZ8A 1U06A 1K9AA 2KT1A 2DRMA 3VS1A 2ED0A 2O2OA 1T0HA 1W1FA 1PRLC 1WIEA 3EHQA 2W0ZA 2EVRA 4RTZA 4J9IA 2VWFA 1ABQA 2M51A 2K6DA 4GBQA 1KJWA 2KXDA 3I5SA 2OI3A 2VVKA 4J9DA 1QKWA 1UTIA 4CC3A 1ABOA 2D8HA 4AFZC 5IH2A 4Z88A 1YP5A 1PKSA 5HCKA 2ED1A 3FJ5A 1W70A 1NEGA 4RUGA 4Z89A 2DRKA 2KYBA 4RTUA 4AFUC 5IXFA 3REAB 2OAWA 4IIMA 3NGPA 1K76A 5FW9A 1YWPA 4ZNXA 4DEXA 1UE9A 2J6FA 3ZL7C 1GL5A 1GFDA 1GBRA 1PKTA 1N5ZA 1SRLA 2KNBB 2KXCA 4J9BA 1QLYA 4M4ZA 2XMFA 5L23A 1NYFA 1X2KA 2K79A 1CKAA 3H41A 2QDLA 2DL8A 1UDLA 2YUNA 3VS3A 1GBQA 2LNHB 4HCKA 2GBQA 3TVTA 2SRCA 2LQWA 2EGCA 2L2PA 3RBBB 2KYMA 1B3QA 2FG0A 1WFWA 5GJVB 2PZ1A 4F16A 2P4RA 2W10A 2DA9A 3C0CA 1HSQA 2DILA 1ZBJA 2EKHA 4RTXA 1ZLMA 2EYZA 1J3TA 5I22A 2ABLA 2ESWA 2CREA 2RQRA 3EHRA 1NM7A 3KFVA 2J6KA 4LE9A 5FWBA 2PNIA 3VS2A 3M0UA 3REBB 2LCSA 1PHTA 3LH5A 1NLPC 1RI9A 2A37A 1WYXA 4QT7A 4GLMA 2EGAA 1M8MA 3GBQA 1K1ZA 2JS0A 1T3LA 2M0YA 2YDLA 2L3SA 2LX7A 1U3OA 1OV3A 2O9SA 2FEIA 1M30A 4HXJA 1JXOA 1YCSB 2YSQA 4RTWA 4ORZA 2C0TA 2EW3A 3EGUA 4DEYA 4FSSA 2CSQA 2L3PA 2KROA 3VRYA 1TG0A 1JU5C 1AEYA 1JO8A 1BBZA 5I11A 1H8KA 1T3SA 3PE0A 1VYTA 2DM1A 3QWYA 4D8KA 1GRIA 3NHNA 1I1JA 1ZSGA 1OPKA 1M27C 2J06A 3M0PA 2O88A 2CSIA 4HVUA 2EBPA 2DBMA 1U5SA 2ECZA 2RQVA 2DL7A 2RQWA 3EG2A 1X6GA 2X3XD 2AZSA 2GQIA 2A36A 1HJDA 2YUPA 2RMOA 2D8JA 2EQIA 2HBWA 1RLPC 1UGVA 4F17A 3UATA 4Y92A 2CT4A 3PVQA 1YN8A 1PWTA 1E7OA 2FPDA 1NYGA 1H92A 2DL4A 4LUEA 4F14A 1ZUKA 1RUWA 3EG1A 3VS0A 4LNPA 1YNZA 1I07A 4E6RA 2NWMA 3VRZA 2JT4A 1SHFA 4OMLA 1SEMA 1JQQA
chains in the Genus database with same CATH superfamily
2XG8D 2QGFB 3JB9F 3CCLT 1KC8C 4QKUA 1GCQA 2K3XA 1WXTA 3HL8A 4Z8AA 2DBKA 4BB7A 3QKJA 3KBGA 2COWA 3PVLA 1TUDA 5GAOr 2OTLQ 2M9UA 2F69A 3VV0A 4CC2A 5A2QE 2LZ6B 3CCRT 1VQNQ 3VS7A 3CCSA 2QXFA 1O9SA 4C0DC 1M2VB 8AT1B 3QDRB 2HQXA 1YJNA 4C92F 2ROLA 1QCFA 3JB9J 2QA4T 2ATCB 2L8DA 1WPYA 2XI9A 1B07A 1BB9A 2BTTA 4JPBW 2DO3A 2X4YA 1FX7A 4AG2C 4ZTJA 3RMQA 4HVWA 2OX7A 3OYDA 3EG3A 3VS6A 4EMKA 1WHMA 2OTJA 2JVVA 1ZA2B 2YLCA 2EQKA 4AT1B 4FM4B 5I2MA 2NUTB 4C5EA 1G8XA 3LW5E 3NTHA 4K11A 3OMCA 2YXYA 1PRMC 2KDSA 2ROTA 4BI4A 2QEXA 1CSKA 3NMZC 1WJSA 1UGPB 3DB4A 4A4GA 4C92B 4M75E 2KBTA 1VOMA 4M7AC 3UT1A 1YJWA 4X9DA 2BKDN 3CCUA 3SHWA 2YRDA 1VYVA 4M7DE 1VIFA 2E65A 1UECA 3HRSA 5IHKA 2LC4A 2JNGA 1QP3A 3M0SA 2QDYB 1OX8A 2HL3A 3CMAQ 2FZCB 5GMKe 3HRTA 4XTXA 5M9OA 4E47A 4JJCA 3M0RA 2FRWA 2XDBA 3QJYA 3CPWA 1VQ9T 5GAN6 2KRSA 3OYKA 3CBMA 4B6MA 2VGMA 3CC7T 3L2UA 2H3EB 2JTFA 3OBWA 3I35A 1ARKA 1MMAA 1PCXA 3RNJA 3OW2S 3RDVA 5D6XA 1T0JA 2A28A 1Q81C 4BACA 3G6EQ 1MV0B 1VQLQ 1XQHA 4E7SA 1AD5A 2JW4A 2K5FA 3CMEQ 3WVEB 3TEEA 3QZ5B 1WXBA 1JBMA 2MPXC 3PMTA 3JCMW 2PUKB 2EFIA 5LJ5f 2DD4A 2PU9B 2AKKA 1WX6A 4J5YA 4D8DA 2QK0A 4J9HA 3QBYA 2CP2A 2O9VA 3O8VA 3GLXA 2MI6A 3RKWA 2EGEA 1WHLA 1YITA 2V1QA 4C8QA 3KUFA 3OY9A 2HCKA 4M75C 4XTYA 3CCMT 5FRMA 1FYNA 1SG5A 2K9GA 4FYVB 1OU8A 3EG9B 2HNIA 2DTOA 2M02A 2VASA 5FU6C 4KGXB 4OMPA 4M7DC 2CUDA 2JM9A 3BFMA 2DLPA 1AWJA 2QQBA 1VQPT 3LYIA 3CCET 1X43A 1D3BB 1UFFA 1SKUB 1LVKA 1BI3A 3INZA 2KGTA 2ZPEB 3LX7A 5A0LA 3FC3A 4IUUA 3SWNC 1AOJA 4C0ZA 2X35A 5J26A 1M3CA 3V8KA 4M77A 1NJIC 2JOYA 2PQWA 4AG1C 1VA7A 2IPOB 1QWFA 3FDRA 4C8QD 1RAAB 4JS4A 1QVGP 1Q81R 2R5AA 2OAUA 1ZUYA 4PFPA 5CKBA 4A4EA 3CPFA 4O6JA 1NLOC 1BKBA 1YHQQ 3R6OA 2ZPHB 1VQ6Q 2BZ8A 1K9AA 1VQOT 1T0HA 3EHQA 1IHVA 1VQ5T 4A53A 2K6DA 4GBQA 2LT1A 2JTMA 2VVKA 4M77D 3X25B 5GAOq 4J9DA 4CC3A 1NPRA 5GAMe 1YP5A 3J80E 1Q82U 1PKSA 2YLBA 3JCMe 2HQEA 4RTUA 4DBHA 1RADB 3REAB 3S3OA 1YIJA 4AMCA 1VQ7T 4DEXA 1UE9A 2VV5A 1M1GA 3BW1A 3OYJA 2KNBB 5IN1A 4PNOA 4F7UA 2QQ9A 1KC8U 3G71Q 4PJMA 1FMVA 1I8FA 4EMKB 2EJGA 3QO3A 2YUNA 3CCJT 5FROA 3SB2A 1GBQA 2XU8A 4HCKA 1EX4A 2LQWA 4KULA 5GAOm 3RBBB 2BE7D 2YRVA 3NFCA 1YJNQ 2PZ1A 1PD0A 1NJIR 3OYEA 1FXXA 1WHKA 2P4RA 2W10A 1IGQA 1IGUA 4M7AA 1Y96A 9ATCB 2DZ9A 1J3TA 5I22A 2XK0A 4IUVA 2H3JA 3KFVA 1NM7A 3GNGA 2J6KA 4KGVB 4LE9A 2X9HA 3MHXA 2A3LA 3LH5A 3OQ5A 3I55T 2OTJQ 1WYXA 5KH6A 2DPPB 3J81E 3CXCP 3C4SA 2JS0A 4C8QG 2O01E 1JJ2S 2LX7A 1D0XA 1N9SA 5GAN3 5KYXA 1JXOA 5GMKj 1VQMT 3QYGB 3OYYA 5LJ3e 2ZPFB 2QEXQ 5GANh 5GAMg 1OQKA 4RTWA 3FEOA 2CKKA 3JCMg 2C0TA 4ANJA 1TG0A 2ZCFB 4M7AD 3VU3C 1YI2T 1T3SA 1VYTA 3QWYA 3BE3A 1UGSB 1YJWQ 3TREA 1N9RA 4C8QF 3CCUQ 1TWBA 1I1JA 1OPKA 2ZPIB 4Y28E 1M27C 2E12A 2J06A 4KH0B 4BE0A 5GMKh 2L89A 4JJNK 4FYXB 5GAMd 3MP6A 3JCMd 6AT1B 4ATOA 2A7YA 2YUPA 2RMOA 2D8JA 2EQIA 3H6ZA 3UATA 3EGDA 2DVEA 5CQXA 1YN8A 1TSFA 5D6YA 2DL4A 4F14A 3EFRA 1MMDA 4E7HA 5KCHA 2VXFA 3GPLA 4BDYA 4M75A 1JB0E 4BE1A 1QVGA 2AT1B 2NWMA 4OMFB 1D0ZA 1TOVA 4OMLA 1RAGB 1JQQA 2E64A 5CIUA 2DYIA 2DE0X 2X3WD 1D0YA 4AFSC 4HVVA 5GAN8 4PJOE 1M9SA 3GOXA 1AWXA 4M7DA 2YUOA 1TUCA 2FYKA 4X9CA 4C8QB 3CBOA 2AK5A 2DYBA 1BIAA 3VYHB 4EDUA 2RA2A 2FRYA 2D9TA 3SWNA 4HT8A 4V2SA 3JV3A 1G5VA 1BCOA 1LNXA 4PJLA 3OYAA 2MYSA 1X6OA 1VQ9A 1WHGA 2CT3A 1BK2A 4J9EA 2KMTA 1OEBA 3ASKA 2XDDA 4M75D 4F7UG 1YITQ 2RB6A 2IIMA 4J9CA 1R77A 4CC4B 1BYMA 1UHFA 4M77B 4ESRA 5GAN7 4JRIA 3MJXA 4JDSA 4OMNA 5EC7A 2CP6A 2EAYA 2NUZA 1UGQB 5J3BA 4JRKA 1U8RA 4E7JA 4X1VA 2K5LA 1F1BB 4QW2A 4OB3B 4WF2A 3UA7A 4XK8E 1KIKA 3JCMX 1OU9A 4F7UF 4IUTA 2CZ6B 3MEUA 2F2VA 3FRNA 4LDWA 4IKFA 3EGXA 3RKXA 1IZ6A 4M78E 3QHSA 2YT6A 3HTRA 4FYWB 2LJ3A 5GAOp 7AT1B 4C0DB 1UG1A 4XQ3A 1E6HA 2SEMA 3CCMA 4N0AC 4BD3A 4OP0A 3SDZA 4J7IA 4PJOC 3H8ZA 2JUFA 3CXCA 5KE3A 4N4GA 1OOTA 2CP3A 1UEBA 5C6SA 3P8HA 3G4ST 3M0QA 3A1PA 2MMPA 1VQPA 4XU0A 2E4HA 2RQUA 4RG2A 3CCEA 2FPEA 1Q82C 1N27A 1AVZC 1V1CA 2R58A 1VQ8T 4F7UB 3H0HA 2DNUA 2HSPA 3J7AF 2DL5A 1S1NA 4C92G 4QQ6A 3L2WA 5GAOn 3QJ6A 4HCBA 1G83A 2FL7A 2K3BA 2XD0A 2H8HA 4WCIA 4JZ3A 1YIJQ 4M7AB 1Y96B 3G71A 1UJYA 1Y07A 1X69A 5CVIA 5IXBA 3CQTA 3ER0A 3URGA 3X26B 2FPFA 1VQOA 4N4IA 5A0GA 2QQAA 3MEAA 4A4KA 1NEBA 2QQRA 3I9QA 5DLOA 3CC2A 1I5LA 1AWWA 2A0FB 3QWXX 3SFMA 4AFQC 3MCAB 1GFCA 1TTHB 4M78C 5IHNA 5DY9A 5KYXB 1WA7A 3E2UA 5LJ3j 2HZYA 1LCKA 1UJ0A 4GY5A 1IXDA 4JZ4A 3HKSA 4XAXB 4XU2A 2CP7A 1D1AA 2QI2A 1FMWA 3M5AA 3M59A 3OBYA 1VQ7A 2YUQA 4PFZA 4EIKA 3UPUA 2JTEA 2E5QA 2XKOC 3EH1A 3UWNA 5KYUA 3JCMP 3QPHA 1UUEA 2RI5A 3CMAT 3CCJA 1Q82R 2GTJA 1Y57A 5CKEA 2D0QB 3JRZA 4JLGA 4C92E 3MEWA 2K2VA 2B86A 2A08A 3UA6A 2I2LA 1WXUA 3C95A 2JZ2A 2CP0A 3PGGA 3EGDB 1W2BS 2QA4Q 4JJBA 1XTDA 1KC8R 4JS5A 2O31A 1KK7A 2L0AA 2LVMA 4M75B 1RLQC 4B9WA 1G2BA 2GNCA 4ZN1A 2G6FX 3L2RA 3I55A 5AYFA 2KT1A 2DRMA 1W2BP 1Q86C 1VQKA 3VS1A 2ED0A 5FU6B 4M7DB 1Q7YU 1WQWA 3CC4A 2EVRA 2HD0A 5A0DA 2M0OA 1MHNA 2VWFA 1ABQA 2X4JA 4FCYA 4A54A 3I5SA 3X24B 3OMGA 3HHTB 1ZSZC 3SWNB 1YFNA 2D8HA 5CKDA 2LTOA 5IH2A 3CCQT 2C06A 2ED1A 2KY9A 3M57A 4RUGA 2DRKA 2KYBA 1TUGB 4AFUC 1NPPA 2OAWA 3NGPA 1K76A 4BE2A 5FW9A 4ZNXA 4DA4A 2J6FA 3ZL7C 1S72T 1GFDA 2QG9B 3OW2P 1N5ZA 4FT2A 2RK2A 4J9BA 1X01A 4M4ZA 2DTIA 5L23A 1YJ9A 2K79A 1CKAA 3SD4A 3HPWA 2DL8A 2X4WA 3LH0A 3M53A 2LNHB 3VS3A 2GBQA 2SRCA 4IUPA 2EGCA 4NL3A 2L2PA 2KYMA 1B3QA 5I21A 1VQ9Q 3HSBA 3M54A 1HSQA 4EMGA 2DILA 1OZ2A 4N0AA 2RJDA 4RTXA 2EYZA 2VB6A 1Y7XA 3EGXB 2ABLA 3X28B 3OYCA 4MZMA 2RQRA 4PJOA 3CD6A 2VXEA 5CKFA 4C5IA 1ZHIA 5CK9A 2DD5A 4HT9A 5GANg 4IUQA 4E7IA 3M0UA 1BCMA 4NL2A 4PL6A 2LCSA 3REBB 4FYYB 3TU4K 5KE2A 3M56A 1YHQT 2KSSA 1EIFA 4QT7A 2MWOA 4GLMA 1VQ6T 1QVFS 1M8MA 2V8KA 3GBQA 1K1ZA 2EQJA 3LGFA 2EKOA 1T3LA 5J39A 2M0YA 2YDLA 2L3SA 2FEIA 1BI2A 4HXJA 1QCOA 2QAZA 2ZPBB 2QGGA 5GANd 2QTVA 1PG5B 3EGUA 4DEYA 2DIQA 2L3PA 4BDZA 1KQ2A 1AEYA 1JO8A 1KG1A 3PE0A 2DM1A 3BY7A 3CCMQ 4PJOD 5LJ3f 4DBRA 2RK1A 2DBMA 1U5SA 2RQVA 3X20B 4BY6C 2Y4XA 2GCXA 2ZPGB 3M9QA 2X3XD 2GQIA 1RAHB 5D7UA 2ZAEA 1VQPQ 1HJDA 4OGEA 3CCEQ 3PVQA 3FLGA 1ACMB 1PWTA 1E7OA 2FPDA 3CCST 3CEYA 1I4K1 4M78A 4FL6A 1IREB 1AHJB 1D1BA 1W4SA 3VS0A 4RG8A 4JUVA 5FU7C 3GP8A 1IB8A 1I07A 3A8LB 3VRZA 2JT4A 2GFAA 1N8RU 1WJRA 3OYHA 4OMQA 4JLIA 1H641 1WZOA 3PIPA 1W2BA 3TSWA 4F04B 3OS1A 5LJ5e 5D6WA 2MCNA 1VQ4T 4LN2A 3G4SA 3OYIA 1VQOQ 2K7AA 4LUDA 2BZYA 2F5KA 1X2QA 4DOWA 2CH4W 1H3HA 5IAYA 3CC2Q 1VQ8A 5KYUB 2CZ1B 3LGLA 3VYGA 4CC7A 3UF4A 1HXDA 3ULRB 2QEXT 1MUZA 1NBEB 1YWOA 1OPLA 3ZEHA 4E7LA 2PVGB 3PNWC 2DXTA 3BDUA 2RHIA 1G3SA 1BU1A 3P8DA 3CCLA 1UB4A 4KBMB 3OW2A 2HBPA 1M3AA 2DZCA 1WI7A 1YJWT 3E9FA 3VS4A 5GJWB 1VQ7Q 1SHGA 3TSZA 5KYWA 5ECAA 2QQSA 2KE9A 5AT1B 3CCRA 4LDUA 4N4HA 2JM8A 1A0NB 2HQHA 3OYGA 1B7TA 3GF5A 3CCJQ 4RTYA 3U23A 2K2MA 4QVDA 5GMKm 2B8AA 3EAEA 2QA4A 5IT9E 1ZSZA 2DERA 2KAFA 2GQVA 3H0IA 1KQSS 3CCVT 1JJ2P 3MP8A 2MWPA 4UC4A 2MIOA 3A8MB 1WHHA 1Q7YC 1HK9A 2OJ2A 4M77G 5LJ5g 1XOVA 1LOJA 1IO6A 3I56T 4OB1B 2LQNA 3I55Q 3MO8A 2V8IA 1SF9A 1I81A 2LQKA 1VQKQ 2RF0A 3CC4Q 2O4XA 5GAOl 1X75C 2RN8A 2RQTA 3QIIA 1Q86U 5LJ5d 2C0IA 2KRNA 2DFUA 1VQMQ 5DLQE 4FW2A 1KFZA 2V1RA 4M77F 1M90U 1X27A 2WSFE 2XICA 4IURA 1XJWB 2LJ1A 2J7IA 1MNDA 1YI2Q 4C8QE 2DL3A 4OMOA 2J6OA 1PSEA 4ELZC 4P5NA 2RJEA 1Z9ZA 4ZGDB 4PJOB 1P92A 3QSUA 2RH2A 4J9FA 1UHCA 2JXBA 1YJ9Q 2K5IA 2LCLA 3MKDA 3A98A 4FU6A 3RIRA 1FWZA 2WSEE 2JS2A 2JJ9A 4J9GA 2RHUA 3P8BB 3CC7A 2DMOA 3RUXA 2JMCA 1OYXA 4JJDA 2PVDB 2HDAA 1XNIA 4B9XA 2BE9B 5C0MA 1AZGB 2GTOA 4CRIA 1EZZB 2KEAA 1M5Q1 4LD9K 3CCQA 1JXMA 1CKBA 3V7SA 4M7DD 1OX9A 2HEQA 3CD6Q 3EFOA 1Q7YR 3JCMJ 1WHJA 1C0MA 2F2XA 3LWIA 4EPCA 4KRTA 1KSWA 4M7AG 2IVWA 3O5ZA 2E41A 1N6AA 2EJ9A 3S3NA 1MV3A 1M1FA 1WNLA 3DKMA 3CPWS 1K9MU 2L3QA 2JMAA 2YWWA 3GNFB 4DBFA 3NTIA 4A63B 4WTOB 2RJFA 2CUBA 3EH2A 2VUBA 3G1JA 2EYWA 3THKA 4M7AF 1B34A 1WDXA 5GAMj 1K73U 4M78B 1JEGA 2AKLA 2LT4A 2L5QA 1PNJA 4FIBA 3N5BB 4C8QC 3H0FA 1ZX6A 4PJJA 2LP5A 2QTXA 3QG1A 3JCMQ 2OTLT 1TU0B 3FIFA 1VQNT 2K3YA 1PRLC 1WIEA 1H3ZA 1QVPA 2FB7A 4F7UE 5GAMh 1N8RC 3JCMh 1PM3A 2HKNA 1JJ2A 4C5GA 2YHTA 2P0QA 2RHYA 2M51A 2CZ0B 1Y71A 2RHZA 3OS5A 4LDVA 4ZGJB 1M8VA 2HMAA 1UGRB 3E1SA 1ABOA 4AFZC 2X4XA 3QXEB 4Z88A 2M1HA 5HCKA 1NEGA 4Z89A 4EMHA 3L2VA 1RAEB 4IIMA 2RI2A 2DXCA 1YWPA 1GL5A 4M75G 3A8HB 1PKTA 1RABB 2DAQA 2P4TA 1SRLA 2KXCA 2D6FA 1KHIA 1QLYA 3G4SQ 3S3MA 1KQ1A 1VQ5A 4E2FB 2QDLA 3TVTA 4M7DG 4E7KA 3V8LA 1JRIA 2P0KA 2LRQA 5KYWB 3OYFA 2RHXA 5CO7A 5KYYA 1VQ8Q 4QVZA 3PTAA 4Y91A 4M75F 4J83A 1ZBJA 2EKHA 4BI8B 4Q5WA 3Q1JA 1ZLMA 2NLUA 4XU1A 2CREA 3CCLQ 1M1KU 3EHRA 1ZSZB 4RCBA 2DEQA 4VUBA 2LDMA 1ZA1B 4HKEA 4M7DF 1RI9A 3QDFA 1I5OB 2A37A 5LJ3h 2CYZB 1VQ4A 3CCRQ 2HAXA 5KCOA 2AIRB 1QW1A 1OV3A 1N8RR 3L42A 2E6ZA 2AHJB 1YCSB 1M4ZA 2YSQA 4HA8A 4D6WA 4J6XA 4GLKA 2E3HA 3ZBDA 1WQ7A 2K4YA 2EW3A 2DKGA 3KXTA 2CSQA 2E1HA 2O4XB 3AT1B 3JCMc 1BBZA 3BDLA 5I11A 3G6ET 1GRIA 1VQLT 2NYSA 3JAME 1MMGA 3NHNA 5GANe 2EQMA 3M0PA 3PT9A 3CMET 4HVUA 2EBPA 5CCAA 4OVAA 3C94A 3QUIA 2LNVA 3RR6A 3DLMA 3E19A 1K8AC 3EG2A 1M90C 2AZSA 2A36A 4ZGEB 1RLPC 3LLRA 5LL6S 4ELYC 1HYOA 2CT4A 1VQMA 2G3RA 5I2SA 2DJZA 3OS0A 4Z02A 4LUEA 2VC8A 1KD1U 1ZUKA 1RUWA 3EG1A 3CCVA 1YI2A 2E70A 1YNZA 4E6RA 4R56A 4RMOA 1R0BG 1SEMA 3VJPA 3S6WA 2C0OA 1G3YA 3HRUA 1X6BA 3VUBA 1BI1A 5GAN5 3PMIA 4PLLA 2CS7A 5GAMf 4NOYA 1QP2A 4J6WA 3JCMf 1GXIE 1U1TA 2DEUA 2DX1A 1NG2A 3I56A 2LJ0A 3EFOB 3T9NA 4J8OA 1GCPA 2WSCE 1Y0MA 2DVJA 4BY6B 2DK3A 8ATCB 4C92C 3OSSC 5FWCA 3WVDB 1VYUA 3G7ZA 2KVQG 3CC7Q 3VUZA 3GIBA 2E5KA 4PK4A 3TCJA 3V8JA 2KI7A 4OGCA 4PKCC 3CCQQ 1WGSA 3LWHA 1RACB 5FU7B 1IHWA 1K9MC 3IQLA 1FMKA 2YRCA 3VS5A 2KT8A 1NZ9A 1RL2A 2DF6A 3L2ZA 1TXQA 1Q86R 1B34B 2Y4YA 4NS5A 1S72Q 2PTKA 3EG0A 2Z0WA 4XTWA 1K8AR 1M90R 4BUGA 2LX9A 3RESA 3NPFA 4JRQA 3M58A 1WJQA 1U1SA 1K73C 2J05A 2VYTA 5FLXE 2IG0A 1QVFP 1QVGS 1AT1B 4FT4A 2RPNA 1W6XA 2FZKB 2ENMA 4XU3A 4YTLA 4KGZB 2JN0A 1OZ3A 2CZ7B 2RJCA 2EYXA 4X34A 1QMCA 1MMNA 1C1AA 2EIFA 2E6NA 3ME9A 3I5RA 2DXBA 2KR3A 5HKCA 1SSFA 1LPLA 2ZZDA 3DLLA 4R0KA 1EFNA 2D0NA 3G71T 3H9NA 2RO0A 5FRNA 2AZVA 1VIEA 3WXMB 3VKIA 1ZUUA 3JB9H 1OI1A 3JB9I 2LMJA 3MP1A 4HCZA 3RERA 1YJNT 2BZXA 3HFOA 1SSHA 1PC0A 3CC2T 2COYA 4A4HA 2XIDA 1QKXA 4L59A 3NTKA 2NUPA 4FW1A 2FO0A 1QWEA 3R6NA 5KYYB 3D7SB 3MEVA 3FB9A 1K9MR 3OYLA 2HL5C 1M3BA 2OTJT 4OMMA 2OTLA 1RI0A 3JCMV 3M55A 3QYHB 4XTUA 2RI3A 3A5ZB 4MDWA 2FHDA 1K0SA 2VKNA 2QYZA 1V76A 4IIOA 3L2QA 1VQNA 1K4US 1VQ5Q 1KHCA 3OB9A 4XTZA 3F70A 2RM4A 4L5GA 1M1KC 1K73R 2CDTA 4M78D 4ZTFA 1AZEA 2ZGWA 2DIGA 2KRMA 2V26A 3SEMA 2F2WA 5CAIA 4HCCA 2EPDA 2F1LA 3CCSQ 2MOXA 4TVRA 1E6GA 2GF7A 1HD3A 3CBPA 4RTTA 2K57A 4RKUE 4MZTA 1RAFB 3OYNA 3JCMb 5IHIA 1TH7A 3A8GB 4XTVA 4QVCA 4C5HA 3CCUT 3CXCS 1K0XA 5HY6A 4RTVA 4PJNA 4R55A 4JRPA 2LCCA 1GCQC 4DBQA 2I0NA 1Z9QA 1ZQ1A 3AHUA 1M2VA 5GANj 2P0PA 2MAMA 2RNAA 3L1AA 2RD1A 4PJOG 3M0TA 1VQ4Q 1AWOA 1VQKT 1WLPB 2E10A 3V7RA 5CR2A 4A4FA 4CI0C 3CC4T 1I0CA 2DJQA 3PIOA 2EYYA 4L6V5 1QQJA 1R0CB 2EYQA 4E7ZA 1ZBXA 1SPKA 4LXCA 2D1XA 4LDXA 2LQ8A 1R8OB 1M2OA 1Q95G 4ME7A 3QZ9B 2L3RA 1SRMA 4PJOF 1C6VX 2NUTA 4C0GA 1KQSP 2MF2A 3A8OB 1PSFA 1VUBA 5GMKi 1NE8A 2GGRA 3OYBA 2GFUA 4EMKC 2CH4A 1KD1C 2P84A 1O75A 1U06A 4O5VA 3HFNA 3CMAA 2KK4A 4DQ2A 2O2OA 3PFSA 1W1FA 4C92A 2W0ZA 1QVFA 2XDPA 2HKQB 1YJ9T 4RTZA 4QQGA 4J9IA 1K8AU 1M1KR 4ZN3A 1TS9A 4KT0E 1KJWA 2KXDA 2OI3A 1YCYA 4PLIA 1QKWA 1UTIA 1YITT 4FSXA 3CCVQ 4MZPA 3JB9D 3OSVA 2EQUA 3FJ5A 3M4YA 1W70A 1G3WA 3MPUB 3OS2A 3G6EA 5GAN2 2PUOB 5IXFA 1MGQA 4M78G 4OB0B 1VQLA 2CGHA 2Y90A 2WACA 3V7CA 3CD6T 1BI0A 2R57A 3CMEA 1GBRA 3C12A 2BIVA 4OF1A 2BUDA 1G3TA 2R5MA 3I56Q 2XMFA 1NYFA 1X2KA 1D09B 3H41A 4DOVA 1Q81U 3META 1PD1A 3M4GA 1UDLA 5CKHA 4C92D 2MK5A 2VGNA 5EG2A 4C0FA 2FG0A 1WFWA 1LJOA 5GMKl 5LJ3g 5CQYA 5GJVB 4M77E 4F16A 4MMKA 4M78F 3JSCA 3OYMA 2COZA 2XHCA 2DA9A 3C0CA 2F5TX 2E3IA 2EJFA 2CP5A 4J6YA 2ESWA 5FWBA 3TQ7P 2PNIA 1S72A 3VS2A 4J7FA 4LDYA 1MNEA 1PHTA 3HP9A 1DJ7B 2DXUA 2DTHA 5HK0A 1NLPC 5LJ3d 1KD1R 2EWNA 3FJPA 4KH1B 2EGAA 4KUIA 1QCNA 3RKYA 2M16A 4PFOA 1U3OA 2O9SA 1M30A 5GAN4 3OA6A 1D1CA 2FVUA 4MMLA 4BI3A 4ORZA 3EG9A 4FSSA 3VRYA 3CPWP 2KROA 3RMSA 1JU5C 4II1A 1BIBA 2QASA 1H8KA 4D8KA 4MDXA 4KUDK 1D3BA 1YIJT 1ZSGA 1YHQA 3E9GA 4RCCA 1NJIU 4OB2B 2O88A 2CSIA 2HSEB 2ECZA 2NUPB 1VQ6A 1YBYA 1OULA 2DL7A 5DM7R 2RQWA 3UDCA 5LJ5j 5HK3A 1X6GA 3EFSA 4LD6A 3JB9G 2HBWA 1UGVA 4F17A 4Y92A 3ZFJA 4QQDA 5GANf 2KQWA 2V8JA 3DB3A 1NYGA 1H92A 5KYNA 2X51A 5L8RE 1V29B 1IRXA 2FZGB 4M77C 4LNPA 2DETA 2PVOB 1RAIB 5LJ5h 4M7AE 1KQSA 1SHFA
chains in the Genus database with same CATH topology
2DE0X 2X3WD 4OMQA 4AFSC 4HVVA 2C0OA 1X6BA 1AWXA 1GCQA 3TSWA 1WXTA 2YUOA 1TUCA 4Z8AA 2AK5A 2DBKA 2DYBA 2DX1A 1NG2A 1TUDA 2LJ0A 3PVLA 2MCNA 4LN2A 2K7AA 4CC2A 4LUDA 2LZ6B 2BZYA 1X2QA 1GCPA 1Y0MA 2DVJA 2FRYA 2CH4W 1H3HA 3VS7A 3JV3A 5FWCA 1VYUA 4CC7A 2ROLA 2CT3A 3UF4A 1QCFA 3ULRB 1BK2A 2E5KA 4J9EA 1MUZA 1YWOA 1OPLA 1OEBA 1B07A 1BB9A 2BTTA 2IIMA 4J9CA 4JPBW 1BU1A 4CC4B 4AG2C 1UHFA 4HVWA 1M3AA 4ESRA 3IQLA 1FMKA 3EG3A 3VS5A 1WI7A 3VS6A 2KT8A 2DF6A 4OMNA 3VS4A 5EC7A 5GJWB 1SHGA 3TSZA 5ECAA 2KE9A 2PTKA 3EG0A 2NUZA 4X1VA 2JM8A 3NPFA 1A0NB 3UA7A 1KIKA 4K11A 2J05A 4RTYA 3U23A 2K2MA 1PRMC 2F2VA 2ROTA 1CSKA 2YT6A 2RPNA 3NMZC 1W6XA 2LJ3A 3H0IA 2ENMA 1UG1A 1E6HA 2MIOA 2KBTA 2SEMA 2OJ2A 2EYXA 3SHWA 1XOVA 1VYVA 1UECA 3I5RA 2KR3A 1IO6A 5IHKA 1OOTA 4R0KA 1EFNA 2D0NA 2LQNA 3M0SA 3M0QA 2AZVA 2RF0A 2RQUA 1ZUUA 2FPEA 2LMJA 1AVZC 4JJCA 3M0RA 1V1CA 2FRWA 2RN8A 2RQTA 2BZXA 2C0IA 2KRSA 1SSHA 2KRNA 3H0HA 2DNUA 2HSPA 1KFZA 2V1RA 1QKXA 2DL5A 1X27A 1S1NA 3I35A 1ARKA 3RNJA 2FO0A 2LJ1A 1QWEA 1T0JA 3R6NA 2A28A 2J7IA 1G83A 2DL3A 4OMOA 2J6OA 2K3BA 2H8HA 1MV0B 4WCIA 4JZ3A 1M3BA 1UJYA 1AD5A 2JW4A 1X69A 4OMMA 5IXBA 3CQTA 1Z9ZA 2FPFA 1WXBA 4J9FA 1K0SA 1UHCA 2JXBA 2VKNA 1K4US 4IIOA 1NEBA 3A98A 3I9QA 2AKKA 1WX6A 2CDTA 2JS2A 1AZEA 2KRMA 3SEMA 4D8DA 4J9GA 1AWWA 2F2WA 3QWXX 2DMOA 2EPDA 4J9HA 2JMCA 2MOXA 2O9VA 4JJDA 4AFQC 2HDAA 1E6GA 1GFCA 2EGEA 1HD3A 5IHNA 2V1QA 1WA7A 1AZGB 4RTTA 2GTOA 2HCKA 1LCKA 2KEAA 5IHIA 1UJ0A 4JZ4A 1FYNA 1JXMA 1CKBA 1K0XA 2HEQA 4RTVA 2K9GA 2YUQA 2F2XA 4OMPA 1GCQC 4KRTA 2CUDA 1KSWA 1Z9QA 2I0NA 4EIKA 2JM9A 2JTEA 2DLPA 3O5ZA 1AWJA 2RNAA 1MV3A 3M0TA 1AWOA 1X43A 1UUEA 1UFFA 1WLPB 2GTJA 1Y57A 2L3QA 2JMAA 2KGTA 4A63B 1AOJA 1I0CA 2DJQA 2B86A 1M3CA 2CUBA 2A08A 2EYYA 3UA6A 1WXUA 1SPKA 4AG1C 2D1XA 1VA7A 1QWFA 2EYWA 4JJBA 3THKA 1WDXA 1JEGA 1SRMA 2AKLA 1ZUYA 2O31A 1PNJA 2L0AA 1NLOC 1RLQC 2GGRA 3H0FA 1ZX6A 2LP5A 2CH4A 1G2BA 2GNCA 2G6FX 2BZ8A 1U06A 1K9AA 2KT1A 2DRMA 3VS1A 2ED0A 2O2OA 1T0HA 1W1FA 1PRLC 1WIEA 3EHQA 2W0ZA 2EVRA 4RTZA 4J9IA 2VWFA 1ABQA 2M51A 2K6DA 4GBQA 1KJWA 2KXDA 3I5SA 2OI3A 2VVKA 4J9DA 1QKWA 1UTIA 4CC3A 1ABOA 2D8HA 4AFZC 5IH2A 4Z88A 1YP5A 1PKSA 5HCKA 2ED1A 3FJ5A 1W70A 1NEGA 4RUGA 4Z89A 2DRKA 2KYBA 4RTUA 4AFUC 5IXFA 3REAB 2OAWA 4IIMA 3NGPA 1K76A 5FW9A 1YWPA 4ZNXA 4DEXA 1UE9A 2J6FA 3ZL7C 1GL5A 1GFDA 1GBRA 1PKTA 1N5ZA 1SRLA 2KNBB 2KXCA 4J9BA 1QLYA 4M4ZA 2XMFA 5L23A 1NYFA 1X2KA 2K79A 1CKAA 3H41A 2QDLA 2DL8A 1UDLA 2YUNA 3VS3A 1GBQA 2LNHB 4HCKA 2GBQA 3TVTA 2SRCA 2LQWA 2EGCA 2L2PA 3RBBB 2KYMA 1B3QA 2FG0A 1WFWA 5GJVB 2PZ1A 4F16A 2P4RA 2W10A 2DA9A 3C0CA 1HSQA 2DILA 1ZBJA 2EKHA 4RTXA 1ZLMA 2EYZA 1J3TA 5I22A 2ABLA 2ESWA 2CREA 2RQRA 3EHRA 1NM7A 3KFVA 2J6KA 4LE9A 5FWBA 2PNIA 3VS2A 3M0UA 3REBB 2LCSA 1PHTA 3LH5A 1NLPC 1RI9A 2A37A 1WYXA 4QT7A 4GLMA 2EGAA 1M8MA 3GBQA 1K1ZA 2JS0A 1T3LA 2M0YA 2YDLA 2L3SA 2LX7A 1U3OA 1OV3A 2O9SA 2FEIA 1M30A 4HXJA 1JXOA 1YCSB 2YSQA 4RTWA 4ORZA 2C0TA 2EW3A 3EGUA 4DEYA 4FSSA 2CSQA 2L3PA 2KROA 3VRYA 1TG0A 1JU5C 1AEYA 1JO8A 1BBZA 5I11A 1H8KA 1T3SA 3PE0A 1VYTA 2DM1A 3QWYA 4D8KA 1GRIA 3NHNA 1I1JA 1ZSGA 1OPKA 1M27C 2J06A 3M0PA 2O88A 2CSIA 4HVUA 2EBPA 2DBMA 1U5SA 2ECZA 2RQVA 2DL7A 2RQWA 3EG2A 1X6GA 2X3XD 2AZSA 2GQIA 2A36A 1HJDA 2YUPA 2RMOA 2D8JA 2EQIA 2HBWA 1RLPC 1UGVA 4F17A 3UATA 4Y92A 2CT4A 3PVQA 1YN8A 1PWTA 1E7OA 2FPDA 1NYGA 1H92A 2DL4A 4LUEA 4F14A 1ZUKA 1RUWA 3EG1A 3VS0A 4LNPA 1YNZA 1I07A 4E6RA 2NWMA 3VRZA 2JT4A 1SHFA 4OMLA 1SEMA 1JQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE0 X;  2X3W D;  4OMQ A;  4AFS C;  4HVV A;  2C0O A;  1X6B A;  1AWX A;  1GCQ A;  3TSW A;  1WXT A;  2YUO A;  1TUC A;  4Z8A A;  2AK5 A;  2DBK A;  2DYB A;  2DX1 A;  1NG2 A;  1TUD A;  2LJ0 A;  3PVL A;  2MCN A;  4LN2 A;  2K7A A;  4CC2 A;  4LUD A;  2LZ6 B;  2BZY A;  1X2Q A;  1GCP A;  1Y0M A;  2DVJ A;  2FRY A;  2CH4 W;  1H3H A;  3VS7 A;  3JV3 A;  5FWC A;  1VYU A;  4CC7 A;  2ROL A;  2CT3 A;  3UF4 A;  1QCF A;  3ULR B;  1BK2 A;  2E5K A;  4J9E A;  1MUZ A;  1YWO A;  1OPL A;  1OEB A;  1B07 A;  1BB9 A;  2BTT A;  2IIM A;  4J9C A;  4JPB W;  1BU1 A;  4CC4 B;  4AG2 C;  1UHF A;  4HVW A;  1M3A A;  4ESR A;  3IQL A;  1FMK A;  3EG3 A;  3VS5 A;  1WI7 A;  3VS6 A;  2KT8 A;  2DF6 A;  4OMN A;  3VS4 A;  5EC7 A;  5GJW B;  1SHG A;  3TSZ A;  5ECA A;  2KE9 A;  2PTK A;  3EG0 A;  2NUZ A;  4X1V A;  2JM8 A;  3NPF A;  1A0N B;  3UA7 A;  1KIK A;  4K11 A;  2J05 A;  4RTY A;  3U23 A;  2K2M A;  1PRM C;  2F2V A;  2ROT A;  1CSK A;  2YT6 A;  2RPN A;  3NMZ C;  1W6X A;  2LJ3 A;  3H0I A;  2ENM A;  1UG1 A;  1E6H A;  2MIO A;  2KBT A;  2SEM A;  2OJ2 A;  2EYX A;  3SHW A;  1XOV A;  1VYV A;  1UEC A;  3I5R A;  2KR3 A;  1IO6 A;  5IHK A;  1OOT A;  4R0K A;  1EFN A;  2D0N A;  2LQN A;  3M0S A;  3M0Q A;  2AZV A;  2RF0 A;  2RQU A;  1ZUU A;  2FPE A;  2LMJ A;  1AVZ C;  4JJC A;  3M0R A;  1V1C A;  2FRW A;  2RN8 A;  2RQT A;  2BZX A;  2C0I A;  2KRS A;  1SSH A;  2KRN A;  3H0H A;  2DNU A;  2HSP A;  1KFZ A;  2V1R A;  1QKX A;  2DL5 A;  1X27 A;  1S1N A;  3I35 A;  1ARK A;  3RNJ A;  2FO0 A;  2LJ1 A;  1QWE A;  1T0J A;  3R6N A;  2A28 A;  2J7I A;  1G83 A;  2DL3 A;  4OMO A;  2J6O A;  2K3B A;  2H8H A;  1MV0 B;  4WCI A;  4JZ3 A;  1M3B A;  1UJY A;  1AD5 A;  2JW4 A;  1X69 A;  4OMM A;  5IXB A;  3CQT A;  1Z9Z A;  2FPF A;  1WXB A;  4J9F A;  1K0S A;  1UHC A;  2JXB A;  2VKN A;  1K4U S;  4IIO A;  1NEB A;  3A98 A;  3I9Q A;  2AKK A;  1WX6 A;  2CDT A;  2JS2 A;  1AZE A;  2KRM A;  3SEM A;  4D8D A;  4J9G A;  1AWW A;  2F2W A;  3QWX X;  2DMO A;  2EPD A;  4J9H A;  2JMC A;  2MOX A;  2O9V A;  4JJD A;  4AFQ C;  2HDA A;  1E6G A;  1GFC A;  2EGE A;  1HD3 A;  5IHN A;  2V1Q A;  1WA7 A;  1AZG B;  4RTT A;  2GTO A;  2HCK A;  1LCK A;  2KEA A;  5IHI A;  1UJ0 A;  4JZ4 A;  1FYN A;  1JXM A;  1CKB A;  1K0X A;  2HEQ A;  4RTV A;  2K9G A;  2YUQ A;  2F2X A;  4OMP A;  1GCQ C;  4KRT A;  2CUD A;  1KSW A;  1Z9Q A;  2I0N A;  4EIK A;  2JM9 A;  2JTE A;  2DLP A;  3O5Z A;  1AWJ A;  2RNA A;  1MV3 A;  3M0T A;  1AWO A;  1X43 A;  1UUE A;  1UFF A;  1WLP B;  2GTJ A;  1Y57 A;  2L3Q A;  2JMA A;  2KGT A;  4A63 B;  1AOJ A;  1I0C A;  2DJQ A;  2B86 A;  1M3C A;  2CUB A;  2A08 A;  2EYY A;  3UA6 A;  1WXU A;  1SPK A;  4AG1 C;  2D1X A;  1VA7 A;  1QWF A;  2EYW A;  4JJB A;  3THK A;  1WDX A;  1JEG A;  1SRM A;  2AKL A;  1ZUY A;  2O31 A;  1PNJ A;  2L0A A;  1NLO C;  1RLQ C;  2GGR A;  3H0F A;  1ZX6 A;  2LP5 A;  2CH4 A;  1G2B A;  2GNC A;  2G6F X;  2BZ8 A;  1U06 A;  1K9A A;  2KT1 A;  2DRM A;  3VS1 A;  2ED0 A;  2O2O A;  1T0H A;  1W1F A;  1PRL C;  1WIE A;  3EHQ A;  2W0Z A;  2EVR A;  4RTZ A;  4J9I A;  2VWF A;  1ABQ A;  2M51 A;  2K6D A;  4GBQ A;  1KJW A;  2KXD A;  3I5S A;  2OI3 A;  2VVK A;  4J9D A;  1QKW A;  1UTI A;  4CC3 A;  1ABO A;  2D8H A;  4AFZ C;  5IH2 A;  4Z88 A;  1YP5 A;  1PKS A;  5HCK A;  2ED1 A;  3FJ5 A;  1W70 A;  1NEG A;  4RUG A;  4Z89 A;  2DRK A;  2KYB A;  4RTU A;  4AFU C;  5IXF A;  3REA B;  2OAW A;  4IIM A;  3NGP A;  1K76 A;  5FW9 A;  1YWP A;  4ZNX A;  4DEX A;  1UE9 A;  2J6F A;  3ZL7 C;  1GL5 A;  1GFD A;  1GBR A;  1PKT A;  1N5Z A;  1SRL A;  2KNB B;  2KXC A;  4J9B A;  1QLY A;  4M4Z A;  2XMF A;  5L23 A;  1NYF A;  1X2K A;  2K79 A;  1CKA A;  3H41 A;  2QDL A;  2DL8 A;  1UDL A;  2YUN A;  3VS3 A;  1GBQ A;  2LNH B;  4HCK A;  2GBQ A;  3TVT A;  2SRC A;  2LQW A;  2EGC A;  2L2P A;  3RBB B;  2KYM A;  1B3Q A;  2FG0 A;  1WFW A;  5GJV B;  2PZ1 A;  4F16 A;  2P4R A;  2W10 A;  2DA9 A;  3C0C A;  1HSQ A;  2DIL A;  1ZBJ A;  2EKH A;  4RTX A;  1ZLM A;  2EYZ A;  1J3T A;  5I22 A;  2ABL A;  2ESW A;  2CRE A;  2RQR A;  3EHR A;  1NM7 A;  3KFV A;  2J6K A;  4LE9 A;  5FWB A;  2PNI A;  3VS2 A;  3M0U A;  3REB B;  2LCS A;  1PHT A;  3LH5 A;  1NLP C;  1RI9 A;  2A37 A;  1WYX A;  4QT7 A;  4GLM A;  2EGA A;  1M8M A;  3GBQ A;  1K1Z A;  2JS0 A;  1T3L A;  2M0Y A;  2YDL A;  2L3S A;  2LX7 A;  1U3O A;  1OV3 A;  2O9S A;  2FEI A;  1M30 A;  4HXJ A;  1JXO A;  1YCS B;  2YSQ A;  4RTW A;  4ORZ A;  2C0T A;  2EW3 A;  3EGU A;  4DEY A;  4FSS A;  2CSQ A;  2L3P A;  2KRO A;  3VRY A;  1TG0 A;  1JU5 C;  1AEY A;  1JO8 A;  1BBZ A;  5I11 A;  1H8K A;  1T3S A;  3PE0 A;  1VYT A;  2DM1 A;  3QWY A;  4D8K A;  1GRI A;  3NHN A;  1I1J A;  1ZSG A;  1OPK A;  1M27 C;  2J06 A;  3M0P A;  2O88 A;  2CSI A;  4HVU A;  2EBP A;  2DBM A;  1U5S A;  2ECZ A;  2RQV A;  2DL7 A;  2RQW A;  3EG2 A;  1X6G A;  2X3X D;  2AZS A;  2GQI A;  2A36 A;  1HJD A;  2YUP A;  2RMO A;  2D8J A;  2EQI A;  2HBW A;  1RLP C;  1UGV A;  4F17 A;  3UAT A;  4Y92 A;  2CT4 A;  3PVQ A;  1YN8 A;  1PWT A;  1E7O A;  2FPD A;  1NYG A;  1H92 A;  2DL4 A;  4LUE A;  4F14 A;  1ZUK A;  1RUW A;  3EG1 A;  3VS0 A;  4LNP A;  1YNZ A;  1I07 A;  4E6R A;  2NWM A;  3VRZ A;  2JT4 A;  1SHF A;  4OML A;  1SEM A;  1JQQ A; 
#chains in the Genus database with same CATH topology
 2XG8 D;  2QGF B;  3JB9 F;  3CCL T;  1KC8 C;  4QKU A;  1GCQ A;  2K3X A;  1WXT A;  3HL8 A;  4Z8A A;  2DBK A;  4BB7 A;  3QKJ A;  3KBG A;  2COW A;  3PVL A;  1TUD A;  5GAO r;  2OTL Q;  2M9U A;  2F69 A;  3VV0 A;  4CC2 A;  5A2Q E;  2LZ6 B;  3CCR T;  1VQN Q;  3VS7 A;  3CCS A;  2QXF A;  1O9S A;  4C0D C;  1M2V B;  8AT1 B;  3QDR B;  2HQX A;  1YJN A;  4C92 F;  2ROL A;  1QCF A;  3JB9 J;  2QA4 T;  2ATC B;  2L8D A;  1WPY A;  2XI9 A;  1B07 A;  1BB9 A;  2BTT A;  4JPB W;  2DO3 A;  2X4Y A;  1FX7 A;  4AG2 C;  4ZTJ A;  3RMQ A;  4HVW A;  2OX7 A;  3OYD A;  3EG3 A;  3VS6 A;  4EMK A;  1WHM A;  2OTJ A;  2JVV A;  1ZA2 B;  2YLC A;  2EQK A;  4AT1 B;  4FM4 B;  5I2M A;  2NUT B;  4C5E A;  1G8X A;  3LW5 E;  3NTH A;  4K11 A;  3OMC A;  2YXY A;  1PRM C;  2KDS A;  2ROT A;  4BI4 A;  2QEX A;  1CSK A;  3NMZ C;  1WJS A;  1UGP B;  3DB4 A;  4A4G A;  4C92 B;  4M75 E;  2KBT A;  1VOM A;  4M7A C;  3UT1 A;  1YJW A;  4X9D A;  2BKD N;  3CCU A;  3SHW A;  2YRD A;  1VYV A;  4M7D E;  1VIF A;  2E65 A;  1UEC A;  3HRS A;  5IHK A;  2LC4 A;  2JNG A;  1QP3 A;  3M0S A;  2QDY B;  1OX8 A;  2HL3 A;  3CMA Q;  2FZC B;  5GMK e;  3HRT A;  4XTX A;  5M9O A;  4E47 A;  4JJC A;  3M0R A;  2FRW A;  2XDB A;  3QJY A;  3CPW A;  1VQ9 T;  5GAN 6;  2KRS A;  3OYK A;  3CBM A;  4B6M A;  2VGM A;  3CC7 T;  3L2U A;  2H3E B;  2JTF A;  3OBW A;  3I35 A;  1ARK A;  1MMA A;  1PCX A;  3RNJ A;  3OW2 S;  3RDV A;  5D6X A;  1T0J A;  2A28 A;  1Q81 C;  4BAC A;  3G6E Q;  1MV0 B;  1VQL Q;  1XQH A;  4E7S A;  1AD5 A;  2JW4 A;  2K5F A;  3CME Q;  3WVE B;  3TEE A;  3QZ5 B;  1WXB A;  1JBM A;  2MPX C;  3PMT A;  3JCM W;  2PUK B;  2EFI A;  5LJ5 f;  2DD4 A;  2PU9 B;  2AKK A;  1WX6 A;  4J5Y A;  4D8D A;  2QK0 A;  4J9H A;  3QBY A;  2CP2 A;  2O9V A;  3O8V A;  3GLX A;  2MI6 A;  3RKW A;  2EGE A;  1WHL A;  1YIT A;  2V1Q A;  4C8Q A;  3KUF A;  3OY9 A;  2HCK A;  4M75 C;  4XTY A;  3CCM T;  5FRM A;  1FYN A;  1SG5 A;  2K9G A;  4FYV B;  1OU8 A;  3EG9 B;  2HNI A;  2DTO A;  2M02 A;  2VAS A;  5FU6 C;  4KGX B;  4OMP A;  4M7D C;  2CUD A;  2JM9 A;  3BFM A;  2DLP A;  1AWJ A;  2QQB A;  1VQP T;  3LYI A;  3CCE T;  1X43 A;  1D3B B;  1UFF A;  1SKU B;  1LVK A;  1BI3 A;  3INZ A;  2KGT A;  2ZPE B;  3LX7 A;  5A0L A;  3FC3 A;  4IUU A;  3SWN C;  1AOJ A;  4C0Z A;  2X35 A;  5J26 A;  1M3C A;  3V8K A;  4M77 A;  1NJI C;  2JOY A;  2PQW A;  4AG1 C;  1VA7 A;  2IPO B;  1QWF A;  3FDR A;  4C8Q D;  1RAA B;  4JS4 A;  1QVG P;  1Q81 R;  2R5A A;  2OAU A;  1ZUY A;  4PFP A;  5CKB A;  4A4E A;  3CPF A;  4O6J A;  1NLO C;  1BKB A;  1YHQ Q;  3R6O A;  2ZPH B;  1VQ6 Q;  2BZ8 A;  1K9A A;  1VQO T;  1T0H A;  3EHQ A;  1IHV A;  1VQ5 T;  4A53 A;  2K6D A;  4GBQ A;  2LT1 A;  2JTM A;  2VVK A;  4M77 D;  3X25 B;  5GAO q;  4J9D A;  4CC3 A;  1NPR A;  5GAM e;  1YP5 A;  3J80 E;  1Q82 U;  1PKS A;  2YLB A;  3JCM e;  2HQE A;  4RTU A;  4DBH A;  1RAD B;  3REA B;  3S3O A;  1YIJ A;  4AMC A;  1VQ7 T;  4DEX A;  1UE9 A;  2VV5 A;  1M1G A;  3BW1 A;  3OYJ A;  2KNB B;  5IN1 A;  4PNO A;  4F7U A;  2QQ9 A;  1KC8 U;  3G71 Q;  4PJM A;  1FMV A;  1I8F A;  4EMK B;  2EJG A;  3QO3 A;  2YUN A;  3CCJ T;  5FRO A;  3SB2 A;  1GBQ A;  2XU8 A;  4HCK A;  1EX4 A;  2LQW A;  4KUL A;  5GAO m;  3RBB B;  2BE7 D;  2YRV A;  3NFC A;  1YJN Q;  2PZ1 A;  1PD0 A;  1NJI R;  3OYE A;  1FXX A;  1WHK A;  2P4R A;  2W10 A;  1IGQ A;  1IGU A;  4M7A A;  1Y96 A;  9ATC B;  2DZ9 A;  1J3T A;  5I22 A;  2XK0 A;  4IUV A;  2H3J A;  3KFV A;  1NM7 A;  3GNG A;  2J6K A;  4KGV B;  4LE9 A;  2X9H A;  3MHX A;  2A3L A;  3LH5 A;  3OQ5 A;  3I55 T;  2OTJ Q;  1WYX A;  5KH6 A;  2DPP B;  3J81 E;  3CXC P;  3C4S A;  2JS0 A;  4C8Q G;  2O01 E;  1JJ2 S;  2LX7 A;  1D0X A;  1N9S A;  5GAN 3;  5KYX A;  1JXO A;  5GMK j;  1VQM T;  3QYG B;  3OYY A;  5LJ3 e;  2ZPF B;  2QEX Q;  5GAN h;  5GAM g;  1OQK A;  4RTW A;  3FEO A;  2CKK A;  3JCM g;  2C0T A;  4ANJ A;  1TG0 A;  2ZCF B;  4M7A D;  3VU3 C;  1YI2 T;  1T3S A;  1VYT A;  3QWY A;  3BE3 A;  1UGS B;  1YJW Q;  3TRE A;  1N9R A;  4C8Q F;  3CCU Q;  1TWB A;  1I1J A;  1OPK A;  2ZPI B;  4Y28 E;  1M27 C;  2E12 A;  2J06 A;  4KH0 B;  4BE0 A;  5GMK h;  2L89 A;  4JJN K;  4FYX B;  5GAM d;  3MP6 A;  3JCM d;  6AT1 B;  4ATO A;  2A7Y A;  2YUP A;  2RMO A;  2D8J A;  2EQI A;  3H6Z A;  3UAT A;  3EGD A;  2DVE A;  5CQX A;  1YN8 A;  1TSF A;  5D6Y A;  2DL4 A;  4F14 A;  3EFR A;  1MMD A;  4E7H A;  5KCH A;  2VXF A;  3GPL A;  4BDY A;  4M75 A;  1JB0 E;  4BE1 A;  1QVG A;  2AT1 B;  2NWM A;  4OMF B;  1D0Z A;  1TOV A;  4OML A;  1RAG B;  1JQQ A;  2E64 A;  5CIU A;  2DYI A;  2DE0 X;  2X3W D;  1D0Y A;  4AFS C;  4HVV A;  5GAN 8;  4PJO E;  1M9S A;  3GOX A;  1AWX A;  4M7D A;  2YUO A;  1TUC A;  2FYK A;  4X9C A;  4C8Q B;  3CBO A;  2AK5 A;  2DYB A;  1BIA A;  3VYH B;  4EDU A;  2RA2 A;  2FRY A;  2D9T A;  3SWN A;  4HT8 A;  4V2S A;  3JV3 A;  1G5V A;  1BCO A;  1LNX A;  4PJL A;  3OYA A;  2MYS A;  1X6O A;  1VQ9 A;  1WHG A;  2CT3 A;  1BK2 A;  4J9E A;  2KMT A;  1OEB A;  3ASK A;  2XDD A;  4M75 D;  4F7U G;  1YIT Q;  2RB6 A;  2IIM A;  4J9C A;  1R77 A;  4CC4 B;  1BYM A;  1UHF A;  4M77 B;  4ESR A;  5GAN 7;  4JRI A;  3MJX A;  4JDS A;  4OMN A;  5EC7 A;  2CP6 A;  2EAY A;  2NUZ A;  1UGQ B;  5J3B A;  4JRK A;  1U8R A;  4E7J A;  4X1V A;  2K5L A;  1F1B B;  4QW2 A;  4OB3 B;  4WF2 A;  3UA7 A;  4XK8 E;  1KIK A;  3JCM X;  1OU9 A;  4F7U F;  4IUT A;  2CZ6 B;  3MEU A;  2F2V A;  3FRN A;  4LDW A;  4IKF A;  3EGX A;  3RKX A;  1IZ6 A;  4M78 E;  3QHS A;  2YT6 A;  3HTR A;  4FYW B;  2LJ3 A;  5GAO p;  7AT1 B;  4C0D B;  1UG1 A;  4XQ3 A;  1E6H A;  2SEM A;  3CCM A;  4N0A C;  4BD3 A;  4OP0 A;  3SDZ A;  4J7I A;  4PJO C;  3H8Z A;  2JUF A;  3CXC A;  5KE3 A;  4N4G A;  1OOT A;  2CP3 A;  1UEB A;  5C6S A;  3P8H A;  3G4S T;  3M0Q A;  3A1P A;  2MMP A;  1VQP A;  4XU0 A;  2E4H A;  2RQU A;  4RG2 A;  3CCE A;  2FPE A;  1Q82 C;  1N27 A;  1AVZ C;  1V1C A;  2R58 A;  1VQ8 T;  4F7U B;  3H0H A;  2DNU A;  2HSP A;  3J7A F;  2DL5 A;  1S1N A;  4C92 G;  4QQ6 A;  3L2W A;  5GAO n;  3QJ6 A;  4HCB A;  1G83 A;  2FL7 A;  2K3B A;  2XD0 A;  2H8H A;  4WCI A;  4JZ3 A;  1YIJ Q;  4M7A B;  1Y96 B;  3G71 A;  1UJY A;  1Y07 A;  1X69 A;  5CVI A;  5IXB A;  3CQT A;  3ER0 A;  3URG A;  3X26 B;  2FPF A;  1VQO A;  4N4I A;  5A0G A;  2QQA A;  3MEA A;  4A4K A;  1NEB A;  2QQR A;  3I9Q A;  5DLO A;  3CC2 A;  1I5L A;  1AWW A;  2A0F B;  3QWX X;  3SFM A;  4AFQ C;  3MCA B;  1GFC A;  1TTH B;  4M78 C;  5IHN A;  5DY9 A;  5KYX B;  1WA7 A;  3E2U A;  5LJ3 j;  2HZY A;  1LCK A;  1UJ0 A;  4GY5 A;  1IXD A;  4JZ4 A;  3HKS A;  4XAX B;  4XU2 A;  2CP7 A;  1D1A A;  2QI2 A;  1FMW A;  3M5A A;  3M59 A;  3OBY A;  1VQ7 A;  2YUQ A;  4PFZ A;  4EIK A;  3UPU A;  2JTE A;  2E5Q A;  2XKO C;  3EH1 A;  3UWN A;  5KYU A;  3JCM P;  3QPH A;  1UUE A;  2RI5 A;  3CMA T;  3CCJ A;  1Q82 R;  2GTJ A;  1Y57 A;  5CKE A;  2D0Q B;  3JRZ A;  4JLG A;  4C92 E;  3MEW A;  2K2V A;  2B86 A;  2A08 A;  3UA6 A;  2I2L A;  1WXU A;  3C95 A;  2JZ2 A;  2CP0 A;  3PGG A;  3EGD B;  1W2B S;  2QA4 Q;  4JJB A;  1XTD A;  1KC8 R;  4JS5 A;  2O31 A;  1KK7 A;  2L0A A;  2LVM A;  4M75 B;  1RLQ C;  4B9W A;  1G2B A;  2GNC A;  4ZN1 A;  2G6F X;  3L2R A;  3I55 A;  5AYF A;  2KT1 A;  2DRM A;  1W2B P;  1Q86 C;  1VQK A;  3VS1 A;  2ED0 A;  5FU6 B;  4M7D B;  1Q7Y U;  1WQW A;  3CC4 A;  2EVR A;  2HD0 A;  5A0D A;  2M0O A;  1MHN A;  2VWF A;  1ABQ A;  2X4J A;  4FCY A;  4A54 A;  3I5S A;  3X24 B;  3OMG A;  3HHT B;  1ZSZ C;  3SWN B;  1YFN A;  2D8H A;  5CKD A;  2LTO A;  5IH2 A;  3CCQ T;  2C06 A;  2ED1 A;  2KY9 A;  3M57 A;  4RUG A;  2DRK A;  2KYB A;  1TUG B;  4AFU C;  1NPP A;  2OAW A;  3NGP A;  1K76 A;  4BE2 A;  5FW9 A;  4ZNX A;  4DA4 A;  2J6F A;  3ZL7 C;  1S72 T;  1GFD A;  2QG9 B;  3OW2 P;  1N5Z A;  4FT2 A;  2RK2 A;  4J9B A;  1X01 A;  4M4Z A;  2DTI A;  5L23 A;  1YJ9 A;  2K79 A;  1CKA A;  3SD4 A;  3HPW A;  2DL8 A;  2X4W A;  3LH0 A;  3M53 A;  2LNH B;  3VS3 A;  2GBQ A;  2SRC A;  4IUP A;  2EGC A;  4NL3 A;  2L2P A;  2KYM A;  1B3Q A;  5I21 A;  1VQ9 Q;  3HSB A;  3M54 A;  1HSQ A;  4EMG A;  2DIL A;  1OZ2 A;  4N0A A;  2RJD A;  4RTX A;  2EYZ A;  2VB6 A;  1Y7X A;  3EGX B;  2ABL A;  3X28 B;  3OYC A;  4MZM A;  2RQR A;  4PJO A;  3CD6 A;  2VXE A;  5CKF A;  4C5I A;  1ZHI A;  5CK9 A;  2DD5 A;  4HT9 A;  5GAN g;  4IUQ A;  4E7I A;  3M0U A;  1BCM A;  4NL2 A;  4PL6 A;  2LCS A;  3REB B;  4FYY B;  3TU4 K;  5KE2 A;  3M56 A;  1YHQ T;  2KSS A;  1EIF A;  4QT7 A;  2MWO A;  4GLM A;  1VQ6 T;  1QVF S;  1M8M A;  2V8K A;  3GBQ A;  1K1Z A;  2EQJ A;  3LGF A;  2EKO A;  1T3L A;  5J39 A;  2M0Y A;  2YDL A;  2L3S A;  2FEI A;  1BI2 A;  4HXJ A;  1QCO A;  2QAZ A;  2ZPB B;  2QGG A;  5GAN d;  2QTV A;  1PG5 B;  3EGU A;  4DEY A;  2DIQ A;  2L3P A;  4BDZ A;  1KQ2 A;  1AEY A;  1JO8 A;  1KG1 A;  3PE0 A;  2DM1 A;  3BY7 A;  3CCM Q;  4PJO D;  5LJ3 f;  4DBR A;  2RK1 A;  2DBM A;  1U5S A;  2RQV A;  3X20 B;  4BY6 C;  2Y4X A;  2GCX A;  2ZPG B;  3M9Q A;  2X3X D;  2GQI A;  1RAH B;  5D7U A;  2ZAE A;  1VQP Q;  1HJD A;  4OGE A;  3CCE Q;  3PVQ A;  3FLG A;  1ACM B;  1PWT A;  1E7O A;  2FPD A;  3CCS T;  3CEY A;  1I4K 1;  4M78 A;  4FL6 A;  1IRE B;  1AHJ B;  1D1B A;  1W4S A;  3VS0 A;  4RG8 A;  4JUV A;  5FU7 C;  3GP8 A;  1IB8 A;  1I07 A;  3A8L B;  3VRZ A;  2JT4 A;  2GFA A;  1N8R U;  1WJR A;  3OYH A;  4OMQ A;  4JLI A;  1H64 1;  1WZO A;  3PIP A;  1W2B A;  3TSW A;  4F04 B;  3OS1 A;  5LJ5 e;  5D6W A;  2MCN A;  1VQ4 T;  4LN2 A;  3G4S A;  3OYI A;  1VQO Q;  2K7A A;  4LUD A;  2BZY A;  2F5K A;  1X2Q A;  4DOW A;  2CH4 W;  1H3H A;  5IAY A;  3CC2 Q;  1VQ8 A;  5KYU B;  2CZ1 B;  3LGL A;  3VYG A;  4CC7 A;  3UF4 A;  1HXD A;  3ULR B;  2QEX T;  1MUZ A;  1NBE B;  1YWO A;  1OPL A;  3ZEH A;  4E7L A;  2PVG B;  3PNW C;  2DXT A;  3BDU A;  2RHI A;  1G3S A;  1BU1 A;  3P8D A;  3CCL A;  1UB4 A;  4KBM B;  3OW2 A;  2HBP A;  1M3A A;  2DZC A;  1WI7 A;  1YJW T;  3E9F A;  3VS4 A;  5GJW B;  1VQ7 Q;  1SHG A;  3TSZ A;  5KYW A;  5ECA A;  2QQS A;  2KE9 A;  5AT1 B;  3CCR A;  4LDU A;  4N4H A;  2JM8 A;  1A0N B;  2HQH A;  3OYG A;  1B7T A;  3GF5 A;  3CCJ Q;  4RTY A;  3U23 A;  2K2M A;  4QVD A;  5GMK m;  2B8A A;  3EAE A;  2QA4 A;  5IT9 E;  1ZSZ A;  2DER A;  2KAF A;  2GQV A;  3H0I A;  1KQS S;  3CCV T;  1JJ2 P;  3MP8 A;  2MWP A;  4UC4 A;  2MIO A;  3A8M B;  1WHH A;  1Q7Y C;  1HK9 A;  2OJ2 A;  4M77 G;  5LJ5 g;  1XOV A;  1LOJ A;  1IO6 A;  3I56 T;  4OB1 B;  2LQN A;  3I55 Q;  3MO8 A;  2V8I A;  1SF9 A;  1I81 A;  2LQK A;  1VQK Q;  2RF0 A;  3CC4 Q;  2O4X A;  5GAO l;  1X75 C;  2RN8 A;  2RQT A;  3QII A;  1Q86 U;  5LJ5 d;  2C0I A;  2KRN A;  2DFU A;  1VQM Q;  5DLQ E;  4FW2 A;  1KFZ A;  2V1R A;  4M77 F;  1M90 U;  1X27 A;  2WSF E;  2XIC A;  4IUR A;  1XJW B;  2LJ1 A;  2J7I A;  1MND A;  1YI2 Q;  4C8Q E;  2DL3 A;  4OMO A;  2J6O A;  1PSE A;  4ELZ C;  4P5N A;  2RJE A;  1Z9Z A;  4ZGD B;  4PJO B;  1P92 A;  3QSU A;  2RH2 A;  4J9F A;  1UHC A;  2JXB A;  1YJ9 Q;  2K5I A;  2LCL A;  3MKD A;  3A98 A;  4FU6 A;  3RIR A;  1FWZ A;  2WSE E;  2JS2 A;  2JJ9 A;  4J9G A;  2RHU A;  3P8B B;  3CC7 A;  2DMO A;  3RUX A;  2JMC A;  1OYX A;  4JJD A;  2PVD B;  2HDA A;  1XNI A;  4B9X A;  2BE9 B;  5C0M A;  1AZG B;  2GTO A;  4CRI A;  1EZZ B;  2KEA A;  1M5Q 1;  4LD9 K;  3CCQ A;  1JXM A;  1CKB A;  3V7S A;  4M7D D;  1OX9 A;  2HEQ A;  3CD6 Q;  3EFO A;  1Q7Y R;  3JCM J;  1WHJ A;  1C0M A;  2F2X A;  3LWI A;  4EPC A;  4KRT A;  1KSW A;  4M7A G;  2IVW A;  3O5Z A;  2E41 A;  1N6A A;  2EJ9 A;  3S3N A;  1MV3 A;  1M1F A;  1WNL A;  3DKM A;  3CPW S;  1K9M U;  2L3Q A;  2JMA A;  2YWW A;  3GNF B;  4DBF A;  3NTI A;  4A63 B;  4WTO B;  2RJF A;  2CUB A;  3EH2 A;  2VUB A;  3G1J A;  2EYW A;  3THK A;  4M7A F;  1B34 A;  1WDX A;  5GAM j;  1K73 U;  4M78 B;  1JEG A;  2AKL A;  2LT4 A;  2L5Q A;  1PNJ A;  4FIB A;  3N5B B;  4C8Q C;  3H0F A;  1ZX6 A;  4PJJ A;  2LP5 A;  2QTX A;  3QG1 A;  3JCM Q;  2OTL T;  1TU0 B;  3FIF A;  1VQN T;  2K3Y A;  1PRL C;  1WIE A;  1H3Z A;  1QVP A;  2FB7 A;  4F7U E;  5GAM h;  1N8R C;  3JCM h;  1PM3 A;  2HKN A;  1JJ2 A;  4C5G A;  2YHT A;  2P0Q A;  2RHY A;  2M51 A;  2CZ0 B;  1Y71 A;  2RHZ A;  3OS5 A;  4LDV A;  4ZGJ B;  1M8V A;  2HMA A;  1UGR B;  3E1S A;  1ABO A;  4AFZ C;  2X4X A;  3QXE B;  4Z88 A;  2M1H A;  5HCK A;  1NEG A;  4Z89 A;  4EMH A;  3L2V A;  1RAE B;  4IIM A;  2RI2 A;  2DXC A;  1YWP A;  1GL5 A;  4M75 G;  3A8H B;  1PKT A;  1RAB B;  2DAQ A;  2P4T A;  1SRL A;  2KXC A;  2D6F A;  1KHI A;  1QLY A;  3G4S Q;  3S3M A;  1KQ1 A;  1VQ5 A;  4E2F B;  2QDL A;  3TVT A;  4M7D G;  4E7K A;  3V8L A;  1JRI A;  2P0K A;  2LRQ A;  5KYW B;  3OYF A;  2RHX A;  5CO7 A;  5KYY A;  1VQ8 Q;  4QVZ A;  3PTA A;  4Y91 A;  4M75 F;  4J83 A;  1ZBJ A;  2EKH A;  4BI8 B;  4Q5W A;  3Q1J A;  1ZLM A;  2NLU A;  4XU1 A;  2CRE A;  3CCL Q;  1M1K U;  3EHR A;  1ZSZ B;  4RCB A;  2DEQ A;  4VUB A;  2LDM A;  1ZA1 B;  4HKE A;  4M7D F;  1RI9 A;  3QDF A;  1I5O B;  2A37 A;  5LJ3 h;  2CYZ B;  1VQ4 A;  3CCR Q;  2HAX A;  5KCO A;  2AIR B;  1QW1 A;  1OV3 A;  1N8R R;  3L42 A;  2E6Z A;  2AHJ B;  1YCS B;  1M4Z A;  2YSQ A;  4HA8 A;  4D6W A;  4J6X A;  4GLK A;  2E3H A;  3ZBD A;  1WQ7 A;  2K4Y A;  2EW3 A;  2DKG A;  3KXT A;  2CSQ A;  2E1H A;  2O4X B;  3AT1 B;  3JCM c;  1BBZ A;  3BDL A;  5I11 A;  3G6E T;  1GRI A;  1VQL T;  2NYS A;  3JAM E;  1MMG A;  3NHN A;  5GAN e;  2EQM A;  3M0P A;  3PT9 A;  3CME T;  4HVU A;  2EBP A;  5CCA A;  4OVA A;  3C94 A;  3QUI A;  2LNV A;  3RR6 A;  3DLM A;  3E19 A;  1K8A C;  3EG2 A;  1M90 C;  2AZS A;  2A36 A;  4ZGE B;  1RLP C;  3LLR A;  5LL6 S;  4ELY C;  1HYO A;  2CT4 A;  1VQM A;  2G3R A;  5I2S A;  2DJZ A;  3OS0 A;  4Z02 A;  4LUE A;  2VC8 A;  1KD1 U;  1ZUK A;  1RUW A;  3EG1 A;  3CCV A;  1YI2 A;  2E70 A;  1YNZ A;  4E6R A;  4R56 A;  4RMO A;  1R0B G;  1SEM A;  3VJP A;  3S6W A;  2C0O A;  1G3Y A;  3HRU A;  1X6B A;  3VUB A;  1BI1 A;  5GAN 5;  3PMI A;  4PLL A;  2CS7 A;  5GAM f;  4NOY A;  1QP2 A;  4J6W A;  3JCM f;  1GXI E;  1U1T A;  2DEU A;  2DX1 A;  1NG2 A;  3I56 A;  2LJ0 A;  3EFO B;  3T9N A;  4J8O A;  1GCP A;  2WSC E;  1Y0M A;  2DVJ A;  4BY6 B;  2DK3 A;  8ATC B;  4C92 C;  3OSS C;  5FWC A;  3WVD B;  1VYU A;  3G7Z A;  2KVQ G;  3CC7 Q;  3VUZ A;  3GIB A;  2E5K A;  4PK4 A;  3TCJ A;  3V8J A;  2KI7 A;  4OGC A;  4PKC C;  3CCQ Q;  1WGS A;  3LWH A;  1RAC B;  5FU7 B;  1IHW A;  1K9M C;  3IQL A;  1FMK A;  2YRC A;  3VS5 A;  2KT8 A;  1NZ9 A;  1RL2 A;  2DF6 A;  3L2Z A;  1TXQ A;  1Q86 R;  1B34 B;  2Y4Y A;  4NS5 A;  1S72 Q;  2PTK A;  3EG0 A;  2Z0W A;  4XTW A;  1K8A R;  1M90 R;  4BUG A;  2LX9 A;  3RES A;  3NPF A;  4JRQ A;  3M58 A;  1WJQ A;  1U1S A;  1K73 C;  2J05 A;  2VYT A;  5FLX E;  2IG0 A;  1QVF P;  1QVG S;  1AT1 B;  4FT4 A;  2RPN A;  1W6X A;  2FZK B;  2ENM A;  4XU3 A;  4YTL A;  4KGZ B;  2JN0 A;  1OZ3 A;  2CZ7 B;  2RJC A;  2EYX A;  4X34 A;  1QMC A;  1MMN A;  1C1A A;  2EIF A;  2E6N A;  3ME9 A;  3I5R A;  2DXB A;  2KR3 A;  5HKC A;  1SSF A;  1LPL A;  2ZZD A;  3DLL A;  4R0K A;  1EFN A;  2D0N A;  3G71 T;  3H9N A;  2RO0 A;  5FRN A;  2AZV A;  1VIE A;  3WXM B;  3VKI A;  1ZUU A;  3JB9 H;  1OI1 A;  3JB9 I;  2LMJ A;  3MP1 A;  4HCZ A;  3RER A;  1YJN T;  2BZX A;  3HFO A;  1SSH A;  1PC0 A;  3CC2 T;  2COY A;  4A4H A;  2XID A;  1QKX A;  4L59 A;  3NTK A;  2NUP A;  4FW1 A;  2FO0 A;  1QWE A;  3R6N A;  5KYY B;  3D7S B;  3MEV A;  3FB9 A;  1K9M R;  3OYL A;  2HL5 C;  1M3B A;  2OTJ T;  4OMM A;  2OTL A;  1RI0 A;  3JCM V;  3M55 A;  3QYH B;  4XTU A;  2RI3 A;  3A5Z B;  4MDW A;  2FHD A;  1K0S A;  2VKN A;  2QYZ A;  1V76 A;  4IIO A;  3L2Q A;  1VQN A;  1K4U S;  1VQ5 Q;  1KHC A;  3OB9 A;  4XTZ A;  3F70 A;  2RM4 A;  4L5G A;  1M1K C;  1K73 R;  2CDT A;  4M78 D;  4ZTF A;  1AZE A;  2ZGW A;  2DIG A;  2KRM A;  2V26 A;  3SEM A;  2F2W A;  5CAI A;  4HCC A;  2EPD A;  2F1L A;  3CCS Q;  2MOX A;  4TVR A;  1E6G A;  2GF7 A;  1HD3 A;  3CBP A;  4RTT A;  2K57 A;  4RKU E;  4MZT A;  1RAF B;  3OYN A;  3JCM b;  5IHI A;  1TH7 A;  3A8G B;  4XTV A;  4QVC A;  4C5H A;  3CCU T;  3CXC S;  1K0X A;  5HY6 A;  4RTV A;  4PJN A;  4R55 A;  4JRP A;  2LCC A;  1GCQ C;  4DBQ A;  2I0N A;  1Z9Q A;  1ZQ1 A;  3AHU A;  1M2V A;  5GAN j;  2P0P A;  2MAM A;  2RNA A;  3L1A A;  2RD1 A;  4PJO G;  3M0T A;  1VQ4 Q;  1AWO A;  1VQK T;  1WLP B;  2E10 A;  3V7R A;  5CR2 A;  4A4F A;  4CI0 C;  3CC4 T;  1I0C A;  2DJQ A;  3PIO A;  2EYY A;  4L6V 5;  1QQJ A;  1R0C B;  2EYQ A;  4E7Z A;  1ZBX A;  1SPK A;  4LXC A;  2D1X A;  4LDX A;  2LQ8 A;  1R8O B;  1M2O A;  1Q95 G;  4ME7 A;  3QZ9 B;  2L3R A;  1SRM A;  4PJO F;  1C6V X;  2NUT A;  4C0G A;  1KQS P;  2MF2 A;  3A8O B;  1PSF A;  1VUB A;  5GMK i;  1NE8 A;  2GGR A;  3OYB A;  2GFU A;  4EMK C;  2CH4 A;  1KD1 C;  2P84 A;  1O75 A;  1U06 A;  4O5V A;  3HFN A;  3CMA A;  2KK4 A;  4DQ2 A;  2O2O A;  3PFS A;  1W1F A;  4C92 A;  2W0Z A;  1QVF A;  2XDP A;  2HKQ B;  1YJ9 T;  4RTZ A;  4QQG A;  4J9I A;  1K8A U;  1M1K R;  4ZN3 A;  1TS9 A;  4KT0 E;  1KJW A;  2KXD A;  2OI3 A;  1YCY A;  4PLI A;  1QKW A;  1UTI A;  1YIT T;  4FSX A;  3CCV Q;  4MZP A;  3JB9 D;  3OSV A;  2EQU A;  3FJ5 A;  3M4Y A;  1W70 A;  1G3W A;  3MPU B;  3OS2 A;  3G6E A;  5GAN 2;  2PUO B;  5IXF A;  1MGQ A;  4M78 G;  4OB0 B;  1VQL A;  2CGH A;  2Y90 A;  2WAC A;  3V7C A;  3CD6 T;  1BI0 A;  2R57 A;  3CME A;  1GBR A;  3C12 A;  2BIV A;  4OF1 A;  2BUD A;  1G3T A;  2R5M A;  3I56 Q;  2XMF A;  1NYF A;  1X2K A;  1D09 B;  3H41 A;  4DOV A;  1Q81 U;  3MET A;  1PD1 A;  3M4G A;  1UDL A;  5CKH A;  4C92 D;  2MK5 A;  2VGN A;  5EG2 A;  4C0F A;  2FG0 A;  1WFW A;  1LJO A;  5GMK l;  5LJ3 g;  5CQY A;  5GJV B;  4M77 E;  4F16 A;  4MMK A;  4M78 F;  3JSC A;  3OYM A;  2COZ A;  2XHC A;  2DA9 A;  3C0C A;  2F5T X;  2E3I A;  2EJF A;  2CP5 A;  4J6Y A;  2ESW A;  5FWB A;  3TQ7 P;  2PNI A;  1S72 A;  3VS2 A;  4J7F A;  4LDY A;  1MNE A;  1PHT A;  3HP9 A;  1DJ7 B;  2DXU A;  2DTH A;  5HK0 A;  1NLP C;  5LJ3 d;  1KD1 R;  2EWN A;  3FJP A;  4KH1 B;  2EGA A;  4KUI A;  1QCN A;  3RKY A;  2M16 A;  4PFO A;  1U3O A;  2O9S A;  1M30 A;  5GAN 4;  3OA6 A;  1D1C A;  2FVU A;  4MML A;  4BI3 A;  4ORZ A;  3EG9 A;  4FSS A;  3VRY A;  3CPW P;  2KRO A;  3RMS A;  1JU5 C;  4II1 A;  1BIB A;  2QAS A;  1H8K A;  4D8K A;  4MDX A;  4KUD K;  1D3B A;  1YIJ T;  1ZSG A;  1YHQ A;  3E9G A;  4RCC A;  1NJI U;  4OB2 B;  2O88 A;  2CSI A;  2HSE B;  2ECZ A;  2NUP B;  1VQ6 A;  1YBY A;  1OUL A;  2DL7 A;  5DM7 R;  2RQW A;  3UDC A;  5LJ5 j;  5HK3 A;  1X6G A;  3EFS A;  4LD6 A;  3JB9 G;  2HBW A;  1UGV A;  4F17 A;  4Y92 A;  3ZFJ A;  4QQD A;  5GAN f;  2KQW A;  2V8J A;  3DB3 A;  1NYG A;  1H92 A;  5KYN A;  2X51 A;  5L8R E;  1V29 B;  1IRX A;  2FZG B;  4M77 C;  4LNP A;  2DET A;  2PVO B;  1RAI B;  5LJ5 h;  4M7A E;  1KQS A;  1SHF A; 
#chains in the Genus database with same CATH homology
 2DE0 X;  2X3W D;  4OMQ A;  4AFS C;  4HVV A;  2C0O A;  1X6B A;  1AWX A;  1GCQ A;  3TSW A;  1WXT A;  2YUO A;  1TUC A;  4Z8A A;  2AK5 A;  2DBK A;  2DYB A;  2DX1 A;  1NG2 A;  1TUD A;  2LJ0 A;  3PVL A;  2MCN A;  4LN2 A;  2K7A A;  4CC2 A;  4LUD A;  2LZ6 B;  2BZY A;  1X2Q A;  1GCP A;  1Y0M A;  2DVJ A;  2FRY A;  2CH4 W;  1H3H A;  3VS7 A;  3JV3 A;  5FWC A;  1VYU A;  4CC7 A;  2ROL A;  2CT3 A;  3UF4 A;  1QCF A;  3ULR B;  1BK2 A;  2E5K A;  4J9E A;  1MUZ A;  1YWO A;  1OPL A;  1OEB A;  1B07 A;  1BB9 A;  2BTT A;  2IIM A;  4J9C A;  4JPB W;  1BU1 A;  4CC4 B;  4AG2 C;  1UHF A;  4HVW A;  1M3A A;  4ESR A;  3IQL A;  1FMK A;  3EG3 A;  3VS5 A;  1WI7 A;  3VS6 A;  2KT8 A;  2DF6 A;  4OMN A;  3VS4 A;  5EC7 A;  5GJW B;  1SHG A;  3TSZ A;  5ECA A;  2KE9 A;  2PTK A;  3EG0 A;  2NUZ A;  4X1V A;  2JM8 A;  3NPF A;  1A0N B;  3UA7 A;  1KIK A;  4K11 A;  2J05 A;  4RTY A;  3U23 A;  2K2M A;  1PRM C;  2F2V A;  2ROT A;  1CSK A;  2YT6 A;  2RPN A;  3NMZ C;  1W6X A;  2LJ3 A;  3H0I A;  2ENM A;  1UG1 A;  1E6H A;  2MIO A;  2KBT A;  2SEM A;  2OJ2 A;  2EYX A;  3SHW A;  1XOV A;  1VYV A;  1UEC A;  3I5R A;  2KR3 A;  1IO6 A;  5IHK A;  1OOT A;  4R0K A;  1EFN A;  2D0N A;  2LQN A;  3M0S A;  3M0Q A;  2AZV A;  2RF0 A;  2RQU A;  1ZUU A;  2FPE A;  2LMJ A;  1AVZ C;  4JJC A;  3M0R A;  1V1C A;  2FRW A;  2RN8 A;  2RQT A;  2BZX A;  2C0I A;  2KRS A;  1SSH A;  2KRN A;  3H0H A;  2DNU A;  2HSP A;  1KFZ A;  2V1R A;  1QKX A;  2DL5 A;  1X27 A;  1S1N A;  3I35 A;  1ARK A;  3RNJ A;  2FO0 A;  2LJ1 A;  1QWE A;  1T0J A;  3R6N A;  2A28 A;  2J7I A;  1G83 A;  2DL3 A;  4OMO A;  2J6O A;  2K3B A;  2H8H A;  1MV0 B;  4WCI A;  4JZ3 A;  1M3B A;  1UJY A;  1AD5 A;  2JW4 A;  1X69 A;  4OMM A;  5IXB A;  3CQT A;  1Z9Z A;  2FPF A;  1WXB A;  4J9F A;  1K0S A;  1UHC A;  2JXB A;  2VKN A;  1K4U S;  4IIO A;  1NEB A;  3A98 A;  3I9Q A;  2AKK A;  1WX6 A;  2CDT A;  2JS2 A;  1AZE A;  2KRM A;  3SEM A;  4D8D A;  4J9G A;  1AWW A;  2F2W A;  3QWX X;  2DMO A;  2EPD A;  4J9H A;  2JMC A;  2MOX A;  2O9V A;  4JJD A;  4AFQ C;  2HDA A;  1E6G A;  1GFC A;  2EGE A;  1HD3 A;  5IHN A;  2V1Q A;  1WA7 A;  1AZG B;  4RTT A;  2GTO A;  2HCK A;  1LCK A;  2KEA A;  5IHI A;  1UJ0 A;  4JZ4 A;  1FYN A;  1JXM A;  1CKB A;  1K0X A;  2HEQ A;  4RTV A;  2K9G A;  2YUQ A;  2F2X A;  4OMP A;  1GCQ C;  4KRT A;  2CUD A;  1KSW A;  1Z9Q A;  2I0N A;  4EIK A;  2JM9 A;  2JTE A;  2DLP A;  3O5Z A;  1AWJ A;  2RNA A;  1MV3 A;  3M0T A;  1AWO A;  1X43 A;  1UUE A;  1UFF A;  1WLP B;  2GTJ A;  1Y57 A;  2L3Q A;  2JMA A;  2KGT A;  4A63 B;  1AOJ A;  1I0C A;  2DJQ A;  2B86 A;  1M3C A;  2CUB A;  2A08 A;  2EYY A;  3UA6 A;  1WXU A;  1SPK A;  4AG1 C;  2D1X A;  1VA7 A;  1QWF A;  2EYW A;  4JJB A;  3THK A;  1WDX A;  1JEG A;  1SRM A;  2AKL A;  1ZUY A;  2O31 A;  1PNJ A;  2L0A A;  1NLO C;  1RLQ C;  2GGR A;  3H0F A;  1ZX6 A;  2LP5 A;  2CH4 A;  1G2B A;  2GNC A;  2G6F X;  2BZ8 A;  1U06 A;  1K9A A;  2KT1 A;  2DRM A;  3VS1 A;  2ED0 A;  2O2O A;  1T0H A;  1W1F A;  1PRL C;  1WIE A;  3EHQ A;  2W0Z A;  2EVR A;  4RTZ A;  4J9I A;  2VWF A;  1ABQ A;  2M51 A;  2K6D A;  4GBQ A;  1KJW A;  2KXD A;  3I5S A;  2OI3 A;  2VVK A;  4J9D A;  1QKW A;  1UTI A;  4CC3 A;  1ABO A;  2D8H A;  4AFZ C;  5IH2 A;  4Z88 A;  1YP5 A;  1PKS A;  5HCK A;  2ED1 A;  3FJ5 A;  1W70 A;  1NEG A;  4RUG A;  4Z89 A;  2DRK A;  2KYB A;  4RTU A;  4AFU C;  5IXF A;  3REA B;  2OAW A;  4IIM A;  3NGP A;  1K76 A;  5FW9 A;  1YWP A;  4ZNX A;  4DEX A;  1UE9 A;  2J6F A;  3ZL7 C;  1GL5 A;  1GFD A;  1GBR A;  1PKT A;  1N5Z A;  1SRL A;  2KNB B;  2KXC A;  4J9B A;  1QLY A;  4M4Z A;  2XMF A;  5L23 A;  1NYF A;  1X2K A;  2K79 A;  1CKA A;  3H41 A;  2QDL A;  2DL8 A;  1UDL A;  2YUN A;  3VS3 A;  1GBQ A;  2LNH B;  4HCK A;  2GBQ A;  3TVT A;  2SRC A;  2LQW A;  2EGC A;  2L2P A;  3RBB B;  2KYM A;  1B3Q A;  2FG0 A;  1WFW A;  5GJV B;  2PZ1 A;  4F16 A;  2P4R A;  2W10 A;  2DA9 A;  3C0C A;  1HSQ A;  2DIL A;  1ZBJ A;  2EKH A;  4RTX A;  1ZLM A;  2EYZ A;  1J3T A;  5I22 A;  2ABL A;  2ESW A;  2CRE A;  2RQR A;  3EHR A;  1NM7 A;  3KFV A;  2J6K A;  4LE9 A;  5FWB A;  2PNI A;  3VS2 A;  3M0U A;  3REB B;  2LCS A;  1PHT A;  3LH5 A;  1NLP C;  1RI9 A;  2A37 A;  1WYX A;  4QT7 A;  4GLM A;  2EGA A;  1M8M A;  3GBQ A;  1K1Z A;  2JS0 A;  1T3L A;  2M0Y A;  2YDL A;  2L3S A;  2LX7 A;  1U3O A;  1OV3 A;  2O9S A;  2FEI A;  1M30 A;  4HXJ A;  1JXO A;  1YCS B;  2YSQ A;  4RTW A;  4ORZ A;  2C0T A;  2EW3 A;  3EGU A;  4DEY A;  4FSS A;  2CSQ A;  2L3P A;  2KRO A;  3VRY A;  1TG0 A;  1JU5 C;  1AEY A;  1JO8 A;  1BBZ A;  5I11 A;  1H8K A;  1T3S A;  3PE0 A;  1VYT A;  2DM1 A;  3QWY A;  4D8K A;  1GRI A;  3NHN A;  1I1J A;  1ZSG A;  1OPK A;  1M27 C;  2J06 A;  3M0P A;  2O88 A;  2CSI A;  4HVU A;  2EBP A;  2DBM A;  1U5S A;  2ECZ A;  2RQV A;  2DL7 A;  2RQW A;  3EG2 A;  1X6G A;  2X3X D;  2AZS A;  2GQI A;  2A36 A;  1HJD A;  2YUP A;  2RMO A;  2D8J A;  2EQI A;  2HBW A;  1RLP C;  1UGV A;  4F17 A;  3UAT A;  4Y92 A;  2CT4 A;  3PVQ A;  1YN8 A;  1PWT A;  1E7O A;  2FPD A;  1NYG A;  1H92 A;  2DL4 A;  4LUE A;  4F14 A;  1ZUK A;  1RUW A;  3EG1 A;  3VS0 A;  4LNP A;  1YNZ A;  1I07 A;  4E6R A;  2NWM A;  3VRZ A;  2JT4 A;  1SHF A;  4OML A;  1SEM A;  1JQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...