2LJ3A

Pfbd: high-throughput strategy of backbone fold determination for small well-folded proteins in less than a day
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
publication title PFBD: High-throughput Strategy of Backbone fold Determination for small well-folded proteins in less than a day
rcsb
source organism Gallus gallus
total genus 3
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lj3A00
1UG1A 2LX7A 2CSIA 4ZNXA 4WCIA 3VS0A 1QKXA 2GBQA 2ESWA 4JJDA 3SHWA 1AVZC 1YN8A 1UFFA 1PRLC 2DILA 2KRNA 1OPKA 1ZBJA 4AFZC 1ZLMA 3O5ZA 4RTTA 1KIKA 2D8JA 3NHNA 3H41A 1CKBA 3PVLA 4JJBA 2LJ3A 1W70A 3JV3A 1NYGA 2RQTA 3I9QA 4R0KA 2CH4A 1GFCA 2M0YA 4ESRA 1X2KA 1H3HA 2KXDA 2CUDA 1I07A 1UTIA 2VWFA 1W1FA 2DA9A 1VYUA 1UDLA 2VVKA 3M0UA 2EGCA 4RTZA 2D8HA 1OEBA 1WDXA 1Z9QA 1UE9A 3EHQA 2MIOA 3SEMA 4J9EA 1MV3A 3UF4A 3VS2A 2DYBA 1HSQA 4Y92A 2VKNA 1PRMC 2O31A 1RUWA 2CT3A 4CC7A 3IQLA 2X3XD 4A63B 2RPNA 2CUBA 2O2OA 2EGEA 2KROA 2J06A 4CC4B 5IH2A 2D1XA 4EIKA 2A37A 2HEQA 2YSQA 5GJWB 1KSWA 2DRMA 2EBPA 2MCNA 5EC7A 1ZX6A 1QKWA 1T3SA 1ZUYA 2DMOA 1AWJA 1CSKA 2F2VA 2OI3A 4J9IA 3M0TA 2HBWA 1PKTA 1X69A 1RI9A 1B07A 3H0IA 3NGPA 3EGUA 2EW3A 2GGRA 2FRYA 2YUQA 1AWWA 3REAB 1WX6A 4HCKA 4JZ4A 1AEYA 1YCSB 2IIMA 1OV3A 1LCKA 3EG2A 3RBBB 2CREA 4LNPA 4RTUA 2AK5A 3RNJA 3NPFA 2LQWA 1M8MA 2LQNA 2DX1A 4JJCA 2KR3A 3I5RA 1K0XA 1WXUA 1QWEA 5FWBA 4HVWA 2MOXA 1VYVA 2EGAA 2K7AA 4OMOA 1WI7A 4FSSA 3UA7A 5ECAA 1U3OA 1T0JA 1EFNA 2DBMA 1WXBA 5IHNA 5I22A 1NYFA 1GFDA 1JQQA 1ZSGA 2EYWA 1HJDA 2YUNA 2CDTA 1U5SA 1CKAA 1WIEA 2JMAA 4KRTA 2KT1A 1GCPA 4OMMA 3EG3A 3QWXX 2NWMA 4CC3A 1FYNA 1QWFA 3I5SA 4D8DA 1WLPB 2EKHA 1NLPC 1VA7A 2DL5A 3TSWA 2DL8A 5I11A 2JM9A 2ECZA 2A28A 2V1RA 4AFQC 1QCFA 4E6RA 4JPBW 1FMKA 4J9FA 4F14A 1SHGA 4AFSC 3R6NA 1B3QA 1NEGA 1UJ0A 4JZ3A 2J6OA 1AZGB 2YDLA 1UGVA 2OAWA 1ZUKA 2G6FX 2KXCA 4IIOA 1G83A 4CC2A 3M0RA 1I1JA 2HDAA 1GBQA 2D0NA 2HCKA 2ROLA 2W10A 1GCQC 2LMJA 2YT6A 2AKKA 2CT4A 1WA7A 2KNBB 2GQIA 2LJ0A 2GTJA 1GL5A 1GBRA 2DJQA 3TSZA 2L3SA 1JXOA 2A08A 3TVTA 1K76A 3KFVA 3H0FA 4D8KA 1OOTA 1AZEA 1SHFA 4F16A 2ED1A 1SRLA 4ORZA 2BZ8A 1YWOA 1T0HA 4K11A 2EPDA 2DBKA 1X43A 2RF0A 1W6XA 2K2MA 1NM7A 4OMNA 1J3TA 1PWTA 1PNJA 2LZ6B 4J9DA 2FRWA 4Z8AA 1K0SA 2GTOA 3EG0A 1S1NA 1H8KA 1ABOA 1TUCA 2RQWA 3A98A 1AOJA 2DLPA 1K9AA 1X27A 1KFZA 2SEMA 2DE0X 2HSPA 3M0PA 1TUDA 2KRSA 5IHKA 1JU5C 2DVJA 2OJ2A 2CH4W 3M0QA 2KT8A 2J05A 2KRMA 1Y0MA 4OMQA 2KEAA 2M51A 2PNIA 2XMFA 2RNAA 2KBTA 2K6DA 1ABQA 2ENMA 2ROTA 4DEXA 2DF6A 2FG0A 2LP5A 3GBQA 4RTWA 2NUZA 1RLQC 4LUEA 1M30A 1X6BA 2B86A 1BK2A 2DNUA 1N5ZA 2KGTA 2FPDA 1WYXA 2EYYA 1GRIA 5FWCA 3UA6A 3VS4A 4J9HA 1UECA 1K4US 4LN2A 2AKLA 1PHTA 4RTYA 1E6GA 2BZYA 4HVUA 4HVVA 5IXBA 1MUZA 4J9CA 4RUGA 2RQUA 5IHIA 2O9SA 2L3PA 4IIMA 3QWYA 4LUDA 1M3BA 2RQVA 2KE9A 1QLYA 2J6FA 3ULRB 2K79A 4RTXA 1UHCA 2EQIA 1IO6A 3CQTA 1U06A 4HXJA 3VRZA 1ARKA 4QT7A 2FPEA 1MV0B 2W0ZA 4GBQA 3ZL7C 2O88A 2CSQA 2ABLA 2RMOA 2JMCA 2RQRA 3H0HA 3NMZC 3VRYA 2LJ1A 2I0NA 1SEMA 2DRKA 1Z9ZA 2K3BA 2BTTA 5IXFA 2EYXA 1OPLA 2FPFA 2V1QA 2DL7A 1M3AA 1ZUUA 2X3WD 4LE9A 4AG1C 1AWOA 1UUEA 2DL4A 2J6KA 2KYBA 2F2XA 2A36A 3U23A 1H92A 2L2PA 2ED0A 2L0AA 1Y57A 2PZ1A 2C0IA 5HCKA 2JW4A 3REBB 1M27C 1BBZA 1K1ZA 5FW9A 3LH5A 3VS7A 2C0OA 4GLMA 2JS2A 2KYMA 4F17A 2DL3A 1VYTA 2AZSA 3VS3A 1KJWA 1WXTA 3C0CA 3PE0A 4X1VA 2J7IA 1UJYA 2F2WA 2JS0A 3THKA 2LNHB 2YUOA 1BU1A 3FJ5A 1YNZA 1E6HA 3VS1A 2PTKA 1UHFA 2FEIA 3M0SA 4DEYA 1I0CA 1NLOC 2RN8A 1V1CA 4M4ZA 3EHRA 1E7OA 2C0TA 5GJVB 2FO0A 3VS5A 2JXBA 2H8HA 1JXMA 1PKSA 1AWXA 2QDLA 2O9VA 2EYZA 1XOVA 2LCSA 2EVRA 4RTVA 4Z88A 4OMPA 1X6GA 2GNCA 2JM8A 1T3LA 1RLPC 4OMLA 1BB9A 1X2QA 5L23A 2P4RA 1SPKA 1M3CA 1A0NB 1YWPA 4J9BA 3EG1A 1SSHA 2DM1A 2L3QA 2YUPA 1GCQA 3VS6A 1HD3A 2K9GA 2E5KA 1SRMA 2SRCA 2AZVA 1TG0A 1AD5A 4Z89A 4AG2C 3I35A 4AFUC 1WFWA 1YP5A 1G2BA 1JEGA 1NG2A 2JTEA 1NEBA 1JO8A 2JT4A 3PVQA 4J9GA 3UATA 2BZXA
chains in the Genus database with same CATH superfamily
1UG1A 2LX7A 5LJ3e 5KCHA 4ZGDB 2DD5A 3JCMh 3VS0A 2ESWA 1UFFA 3OYIA 2KRNA 4ZN1A 3PMTA 1K8AC 3MEAA 4JS5A 4RTTA 3DB3A 2D8JA 3RKWA 1B34B 3NHNA 3CCST 1I5LA 2JJ9A 3CCVT 4R55A 1ZA2B 3JV3A 4QKUA 1X01A 4EMHA 3HRSA 2KXDA 4J6YA 5LJ3d 1O9SA 3V7CA 3PFSA 3CCMT 4PFPA 2MWPA 3HPWA 3X26B 2X4WA 2VVKA 3GNFB 3EGDA 1YI2A 2M16A 3S6WA 5GANf 3CCQT 1FWZA 4F04B 4A63B 4PLIA 2NYSA 1WHGA 1OULA 2EGEA 1EZZB 4DOWA 2HEQA 3A5ZB 4C92A 5GJWB 2DRMA 3HHTB 1ZX6A 2LTOA 4Y28E 2DMOA 1CSKA 2OI3A 1PC0A 3EGXA 2QTXA 3H8ZA 3M0TA 2K5FA 3QKJA 2EQMA 3MCAB 1X69A 4IUPA 2QXFA 3CPWA 3EGUA 1VQKA 4JRIA 3M57A 3REAB 1TH7A 1WX6A 3H6ZA 4HCKA 1LNXA 1U1TA 1YCSB 1UEBA 2IIMA 2E3IA 1OV3A 3OW2P 5CAIA 2AK5A 3M5AA 4EMKC 4ZGEB 2LQNA 3VU3C 2EQJA 2DX1A 1G3WA 2X4YA 3I55T 1K0XA 1QWEA 5FWBA 4HVWA 2MOXA 2EGAA 1OX9A 4OMOA 1WJRA 4GY5A 1M2VA 4ELZC 5ECAA 5GMKe 3CCJA 1M4ZA 1EFNA 2CP2A 4KUDK 1KHIA 1NYFA 3L2QA 1NZ9A 2EYWA 3CCUT 2GFUA 3OYBA 1U5SA 1CKAA 2DYIA 2XK0A 4OMMA 1GCPA 3EG3A 3QWXX 4XTUA 4M7AD 1MMDA 2EKHA 4C0DC 5LJ5h 3UT1A 5HK3A 2EYQA 4PJOF 3EG9B 2A28A 3V7RA 4E6RA 5KYUA 3FLGA 4F14A 4AFSC 3BW1A 3CC7T 2XI9A 4BI4A 2KVQG 3VJPA 5KE2A 2LC4A 1I1JA 2HDAA 5FU7C 1ZSZA 3CC4T 2HCKA 2E65A 2W10A 5FRNA 2LMJA 5D6YA 2PVDB 5CKHA 4M7DD 3CCLT 2KNBB 2AT1B 2GQIA 4MDWA 4RCBA 2JTFA 2GTJA 2WACA 1JXOA 3TVTA 3JB9F 1LJOA 4N4HA 3H0FA 5GMKm 3CC2T 1SHFA 4F16A 2VUBA 1YHQA 3MO8A 4C0ZA 1SRLA 1HXDA 3LLRA 4BE2A 4C8QF 1QCOA 4M75D 1JJ2P 1I8FA 1PWTA 5CIUA 4C8QB 1QVGS 5GAN3 2IG0A 1U8RA 3O8VA 5GAOp 1TUCA 4C0GA 2K5IA 1K9AA 2JUFA 2MAMA 3X24B 2XDPA 2COWA 2SEMA 2DE0X 2HSPA 1FMVA 2JOYA 4P5NA 4N4IA 2CKKA 2DVJA 4MDXA 4EMGA 4JS4A 3M0QA 1NPRA 2KT8A 1Q82R 4A4HA 2PNIA 3GF5A 3QBYA 2KBTA 2K6DA 5LJ3f 2DF6A 3QJYA 4QVDA 1RLQC 5CO7A 2DPPB 2NUPA 4IUUA 4KGXB 1N5ZA 2CYZB 2EWNA 2MF2A 3CCSA 2QEXA 5GAOm 4OB3B 5FWCA 3VS4A 4J9HA 1RAEB 4QQGA 1YJWT 1VQLA 1D1AA 3CCMA 4RTYA 4N4GA 4Y91A 3V8LA 1QQJA 1KD1R 1OI1A 2DERA 2M9UA 4O5VA 4HVUA 2X4JA 4M78D 2YLBA 2C06A 4LDYA 4PLLA 2RQUA 5IHIA 4LUDA 4IIMA 3S3MA 2OTLT 1V76A 4BE1A 3OB9A 5HY6A 3BDUA 2KE9A 4PJNA 3ULRB 4RTXA 2EQIA 1IO6A 4RMOA 4HXJA 3VRZA 2QI2A 1N8RU 2F5KA 4A4GA 3OA6A 3SDZA 2X4XA 3ZL7C 2CZ0B 2O88A 2ABLA 1UGPB 3EH1A 1M1KR 3J7AF 5GANg 2K3BA 5KCOA 1VQ7A 8AT1B 4L6V5 4PJOG 3CXCP 2FPFA 2OTJT 3E1SA 2EFIA 1Y96B 3TEEA 2KYBA 3MEVA 2A36A 5GAN7 1U1SA 3DKMA 2ED0A 3LW5E 2C0IA 1K9MU 4M7AF 1KQSP 1W2BP 4M7AB 3I55A 2RHUA 2JS2A 1KC8R 4BY6B 1VYTA 3PT9A 2AZSA 1KJWA 3C0CA 4X1VA 3MEUA 1YI2T 2R5MA 5C6SA 2FZKB 2JS0A 4GLKA 4OGCA 5I21A 1BU1A 3FJ5A 1OU8A 3X20B 1E6HA 2RHYA 1AHJB 3JB9G 2PTKA 1UHFA 1VQNA 1QCNA 3CCUA 4M4ZA 3E19A 1ACMB 2C0TA 2JXBA 2H8HA 3JCMe 4C8QG 1PKSA 3VUZA 4BUGA 1D3BA 2F69A 2QDLA 2O9VA 2LCSA 2EVRA 4M7DF 1X6GA 2RJDA 2GQVA 2JM8A 2RK2A 1T3LA 3GLXA 1RLPC 4M7DB 2HNIA 1BB9A 5L23A 3JB9I 3LX7A 5CVIA 1VQKT 2YRCA 3PGGA 1I5OB 5KYXB 1GCQA 2E5KA 1TG0A 4Z89A 3M55A 2CZ6B 4KUIA 2KI7A 3CCEA 2VXFA 3JCMd 4DBRA 2JTEA 4BI3A 4IUQA 3CD6T 4M75F 3UATA 5A2QE 4PJOC 4OVAA 1NJIR 2CSIA 4J6WA 1YIJT 4M75B 3G7ZA 2DAQA 4E2FB 2M1HA 2GBQA 4JJDA 2YXYA 3CCJT 1YN8A 1VQ4T 1BCOA 5DM7R 4RG2A 2GF7A 3HRTA 2P0QA 3CC2A 2QGGA 1Q7YU 1KQ2A 1CKBA 2CP3A 1XQHA 3EFRA 1NYGA 2RQTA 3H9NA 5GAMe 3I9QA 2M0YA 1X2KA 1H3HA 1UTIA 4RKUE 1OQKA 1MMNA 1W1FA 4CRIA 5A0GA 3OS5A 1LPLA 1UDLA 2AIRB 3DB4A 3CCSQ 2XDBA 3I56Q 3CCVQ 1WDXA 1Z9QA 1N8RC 4BI8B 3EHQA 1W4SA 2MIOA 5GAN6 4J9EA 1MV3A 1EIFA 1HSQA 5GAMd 5A0LA 4C8QC 3CCMQ 4FW1A 3IQLA 5AYFA 1O75A 3QDFA 2RPNA 2CUBA 3OS0A 3KXTA 3RMQA 2KROA 4PJJA 2D1XA 1G3TA 5GAN2 1MGQA 2LCLA 5EC7A 3RR6A 2O4XB 2E5QA 1T3SA 1ZUYA 1M90U 1AWJA 5HK0A 2WSFE 3CCQQ 1RACB 4M78B 1RI9A 4PFZA 1YHQT 2GGRA 5LJ3g 2YUQA 4IKFA 3OSVA 1AWWA 3JCMQ 5KYYB 2HSEB 1LCKA 1YJWA 5LJ5e 4LDXA 4PJOA 4LNPA 4Q5WA 4QQDA 1RADB 2CS7A 1TXQA 2H3EB 4M7AG 2YHTA 1S72A 1WXUA 1R77A 1VYVA 2P4TA 2K7AA 3CPWP 3GOXA 2Y90A 4FSSA 1U3OA 4PKCC 4XTZA 2DBMA 5IHNA 2ZPFB 4M77D 3HL8A 1HJDA 5LJ5d 2DXUA 2YUNA 2CDTA 4CI0C 1WIEA 3I55Q 1NPPA 1K73U 5GAOn 4FIBA 4FT2A 2NWMA 4PL6A 1QWFA 2DETA 4D8DA 1VQ5T 1VA7A 2P0PA 5GANh 3V8JA 3G4SA 1PM3A 3ER0A 2WSEE 4M7DG 4MMKA 1Y7XA 2DKGA 2V1RA 4AFQC 2MI6A 3ZBDA 2DXTA 2OTJA 4KBMB 4JPBW 2QEXT 1FXXA 4J9FA 3WXMB 1SHGA 4A54A 1UJ0A 5M9OA 3INZA 4F7UF 4JZ3A 1C1AA 1ZUKA 2G6FX 4F7UB 1G83A 1VQLT 2HKNA 3M0RA 1VQPQ 1FX7A 4DBHA 3UDCA 1VIEA 2E12A 1OZ2A 1Q81C 2MPXC 1G3YA 3CCRA 2IVWA 3LGLA 2CT4A 4M75G 2RB6A 4J6XA 2L5QA 3CC7Q 2QK0A 1RI0A 2XU8A 1GL5A 2ZPHB 2BE7D 2DJQA 1GBRA 3KUFA 1SG5A 1Q7YC 2A08A 1LVKA 1K76A 4XQ3A 3HTRA 5CQYA 3FRNA 2K2VA 4LXCA 2NUTB 3CC4Q 5J3BA 3SWNB 4ATOA 3MP1A 1D0ZA 4KH1B 2VV5A 5DY9A 4M7AC 2QYZA 4BY6C 4ORZA 2BZ8A 2HBPA 4C92D 5J26A 5GAOr 3OYGA 2EPDA 3CCLQ 4MZPA 4YTLA 2DZ9A 1MMAA 4II1A 3JCMf 1WHKA 2DK3A 3RDVA 1PNJA 1VQ7T 3BE3A 2E3HA 3META 1S1NA 3CC2Q 1H8KA 2PQWA 4PJOE 1BI2A 1C6VX 5AT1B 1X27A 4KT0E 4L5GA 1KFZA 3M0PA 4ZGJB 3OYMA 1TUDA 2DFUA 5IHKA 1WGSA 1ZQ1A 1P92A 1UGQB 4M7DC 2KEAA 4QVZA 3CD6A 2M51A 1SSFA 2FZGB 3LYIA 1M90C 4JRPA 2RNAA 3L2RA 1X75C 1RAFB 1YIJA 3E2UA 2ENMA 5CCAA 2PUOB 1IHWA 2PVOB 3QG1A 1YITT 1VQ4A 2CP7A 1X6BA 1JRIA 3SB2A 3G6EA 3QHSA 2GFAA 3M54A 4IUTA 4NL2A 4X9DA 1VQNT 3HKSA 3JSCA 3VV0A 3OW2S 4LDUA 3MP6A 1XJWB 4M75C 5GAMf 3V7SA 1RABB 1Y96A 2AKLA 1PHTA 4IURA 1VQ6A 4FL6A 4C8QE 1E6GA 3VYHB 3OYHA 4KGZB 3RIRA 2KAFA 3EH2A 3GIBA 3OYNA 1VUBA 5IXBA 1MUZA 2LQKA 3EFOB 1MHNA 5GAN8 3V8KA 3OYCA 3OMGA 4KH0B 1YJ9A 3UPUA 1YJWQ 1K73C 1M3BA 1QLYA 4PK4A 3CCET 1UHCA 3HFOA 1WPYA 1WHJA 2E4HA 2VASA 1ARKA 2FPEA 2W0ZA 3S3NA 3Q1JA 3H0HA 3NMZC 4ELYC 2LJ1A 5GANj 3RERA 1I4K1 2OTLQ 3BDLA 1M5Q1 5FU6B 2E41A 1OPLA 3M4YA 1M3AA 4AG1C 4LE9A 3CPFA 2KDSA 2QG9B 4EMKA 4M77F 1D0YA 3J80E 4F7UG 4A4FA 4M77B 2L0AA 2PZ1A 2R57A 5LJ5f 3JCMP 5HCKA 1M27C 1XNIA 1BBZA 1K1ZA 2ZGWA 4M78C 1VQ8A 2C0OA 3F70A 4QVCA 2OTJQ 4A4KA 4F17A 3G71A 2DL3A 3MJXA 4A4EA 1F1BB 2HQHA 3ME9A 3LWHA 2LNHB 2YUOA 3TU4K 3JCMV 1JJ2S 1M8VA 1V1CA 4WTOB 5DLQE 2HL5C 4BACA 2YLCA 3VS5A 2V8KA 2QQAA 2Y4XA 2ZPBB 4HKEA 2CP5A 1YI2Q 3MEWA 2RJEA 3G1JA 1VQ5A 4HCBA 5IT9E 4HT8A 1XOVA 3OYDA 1FMWA 1R0CB 2QDYB 4RTVA 4Z88A 3EGDB 2L3RA 4OGEA 4Z02A 4OMLA 5IN1A 1SPKA 3NTHA 4J9BA 1YBYA 4JLIA 1SSHA 1WQ7A 4BDYA 1SRMA 3AT1B 3L1AA 2XKOC 1WFWA 1IZ6A 4C92F 3TQ7P 1RL2A 1NG2A 3A8OB 2JT4A 4C92B 1S72T 2X35A 3OYJA 1N27A 2JNGA 1VQKQ 2K4YA 1D1BA 1Q82U 3EGXB 2RM4A 3CBPA 1IGQA 4ZNXA 4WCIA 3JB9H 1ZHIA 4PJLA 3SHWA 1AVZC 1TSFA 1PRLC 1OPKA 1ZBJA 2QQBA 4AFZC 1ZLMA 2AHJB 3O5ZA 1KIKA 1QVGA 2DJZA 2DVEA 5I2SA 2EQKA 2VGMA 3RUXA 1YIJQ 1GFCA 4ESRA 2MWOA 3CCJQ 3G4ST 2VWFA 1YJNT 1JB0E 4B9WA 1M2VB 2DA9A 1KD1U 2VYTA 3GNGA 4M7DE 3M0UA 2EGCA 4RTZA 2XG8D 4J8OA 4HA8A 4C5HA 3JCMg 1UE9A 4AMCA 3L2WA 2HQXA 1KG1A 4PFOA 2VKNA 3WVDB 4CC7A 5KYWA 2X3XD 5J39A 3CCRT 2ZAEA 2O2OA 2J06A 1BYMA 2OAUA 1WHMA 3PTAA 5IH2A 4EIKA 4M75E 2YSQA 3JCMX 3M9QA 1YITA 1M1KU 5KYUB 1QKWA 2LX9A 2F2VA 4FM4B 3LGFA 2DEQA 1PKTA 3MPUB 3H0IA 1G8XA 2EW3A 1UGRB 1K8AR 5LJ3j 5CKBA 1KQSS 3C94A 4KGVB 1ZSZB 4M77G 1B34A 2FHDA 3X25B 4E7IA 3ZFJA 4E7KA 3QYHB 2KMTA 2LQWA 3JCMc 1M8MA 3OSSC 3PIPA 2HMAA 4JJCA 2KR3A 3I5RA 4F7UA 1VQOT 1YHQQ 1QP3A 3ASKA 2RHXA 3QUIA 1KC8U 5GAMg 3MP8A 1Q81R 3LWIA 1WI7A 2A7YA 1BI0A 1PG5B 1BI3A 3C4SA 2BE9B 1T0JA 2RHZA 2B8AA 2EAYA 5I22A 1GFDA 1JQQA 5D6XA 3M58A 5GAOq 1Q7YR 2JVVA 3QSUA 2JMAA 2ZPGB 4KRTA 1IREB 4ANJA 3GPLA 3CMAT 2X51A 4BDZA 1VQMT 4CC3A 3I5SA 5GAN4 2YRVA 1WLPB 4N0AC 3CEYA 2R5AA 1ZA1B 2DL5A 2X9HA 2DL8A 3G6ET 2JM9A 2KSSA 2EJ9A 4X34A 1LOJA 4JJNK 1SKUB 3A8HB 1FMKA 2E1HA 3FEOA 2QA4T 2DTHA 2DZCA 1AZGB 1VQ5Q 4IIOA 2KXCA 2VC8A 5FU6C 3L2UA 1TWBA 2QQ9A 1VQ6T 1GBQA 4C92G 1OU9A 2LT1A 4XK8E 8ATCB 4O6JA 4OB1B 2CP6A 2E70A 3OS1A 4RCCA 3NTKA 2QEXQ 1WA7A 2LVMA 5L8RE 2ZZDA 1NJIU 1BI1A 3TSZA 7AT1B 1M90R 1YJ9T 5LJ5g 2L3SA 1Q86U 5DLOA 4M77C 1VQLQ 1EX4A 3P8DA 3JCMJ 3HP9A 4D8KA 3FB9A 2RH2A 2P84A 3LH0A 5FLXE 1TU0B 1T0HA 4K11A 2M02A 2RF0A 5GMKj 5KE3A 3CMET 1W6XA 1PD0A 1NM7A 2EIFA 4OMNA 1M1FA 4M78F 1TOVA 5C0MA 1K0SA 2GTOA 1QVFS 2V8IA 3EG0A 5D6WA 2JN0A 5CR2A 1ABOA 2RI2A 1WJSA 2DEUA 2RQWA 2D0QB 4PJOD 1K9MC 3EG9A 3MHXA 2DLPA 2DD4A 4ZTJA 4F7UE 1VQ7Q 3D7SB 2OJ2A 1PSEA 1VQ8T 2J05A 2KRMA 1Y0MA 4OMQA 3G71T 4BB7A 1M1KC 3VYGA 2MYSA 3FC3A 1ABQA 3M56A 4OMFB 3PMIA 2ROTA 2K5LA 2RJCA 1Q95G 2LP5A 2K3XA 3L42A 2B86A 1BK2A 2DNUA 3J81E 2HD0A 1Y71A 4C92C 5FRMA 1H641 1UGSB 3RKXA 3JB9D 3KBGA 3HSBA 1VQ9T 2RK1A 1QMCA 1K4US 2JZ2A 4LN2A 4V2SA 4A53A 1YITQ 4JLGA 3CPWS 2XDDA 5HKCA 1R0BG 1KC8C 1YJNA 1VQNQ 5GAOl 3CCUQ 5LL6S 4C8QA 4J9CA 4FSXA 3AHUA 3QZ9B 2O9SA 2L3PA 3QWYA 3OYYA 2RQVA 2J6FA 4E47A 1MMGA 3CQTA 2QQRA 4QT7A 3L2VA 2FZCB 2COYA 1D3BB 3OQ5A 4DA4A 4HT9A 4GBQA 3I56T 1QVFA 2CSQA 1ZBXA 2L89A 2RQRA 3NFCA 3TREA 1BCMA 3CBMA 3VRYA 2I0NA 2RD1A 1C0MA 1Z9ZA 3CCEQ 3PNWC 2BTTA 3VUBA 4FT4A 2D9TA 3QDRB 5IXFA 4AT1B 5GAN5 5CKEA 2DL7A 1ZUUA 2EJFA 3GP8A 2RJFA 2DL4A 2J6KA 4B9XA 3U23A 2K57A 3OMCA 2L2PA 1Y57A 1IRXA 4OF1A 1PD1A 4FW2A 2DTOA 4C5GA 1NJIC 4OB0B 3DLLA 1KQ1A 2KYMA 4NS5A 5GMKi 1VQOA 2ATCB 1Q86C 2QGFB 3VS3A 1SF9A 1WXTA 5GAMh 3PE0A 5CKDA 1PSFA 1ZSZC 4QQ6A 1UJYA 4FYYB 4D6WA 1WJQA 2DIGA 1YNZA 5IAYA 2QASA 3E9GA 1WZOA 3QIIA 3WVEB 4DEYA 4JUVA 2RN8A 3CMAA 1E7OA 1VQMA 5GJVB 2FO0A 1PCXA 1OZ3A 4MZMA 1QVPA 3E9FA 3T9NA 4B6MA 4XU1A 3M59A 3RMSA 1WQWA 2EYZA 4M78G 4OMPA 1UB4A 2CZ7B 3C95A 2P4RA 1M3CA 1A0NB 1YWPA 2DM1A 2GCXA 2QA4A 3VS6A 4OP0A 1HD3A 2K9GA 2SRCA 3C12A 1AD5A 4AG2C 4LDWA 4AFUC 4M77E 3QZ5B 3A8LB 1YP5A 3EAEA 1G2BA 1JEGA 1IGUA 2MK5A 1NEBA 4RG8A 3PVQA 4J9GA 3JAME 2BZXA 2QTVA 1NE8A 3OYLA 2DXCA 1QKXA 4M7AA 3OYAA 4NL3A 2E10A 4NOYA 2FYKA 2VGNA 3M53A 2DILA 1VQPT 3JB9J 5CK9A 4ZTFA 3H41A 1S72Q 4PJOB 2R58A 4XTXA 3PVLA 4JJBA 2LJ3A 1W70A 1D09B 1KK7A 2CH4A 2LQ8A 4R0KA 3CMEA 1RAGB 2H3JA 4FCYA 4LDVA 4IUVA 2CUDA 1WHLA 1I07A 3N5BB 1D0XA 1KHCA 4XTWA 2CP0A 4DOVA 1IB8A 3OBYA 4EDUA 4J7IA 3URGA 1VYUA 4OB2B 2PUKB 5LJ3h 2D8HA 1QVGP 1OEBA 1G3SA 1YFNA 3SEMA 3UF4A 4M7DA 1M9SA 3VS2A 2DYBA 4VUBA 4Y92A 3G4SQ 1PRMC 2O31A 4KULA 1RUWA 1YJNQ 5KYXA 2CT3A 1QP2A 2G3RA 4C92E 2RI3A 3A1PA 4CC4B 3P8BB 3OW2A 2A37A 2COZA 1KSWA 2EBPA 2MCNA 1RAIB 4J9IA 2VXEA 4M75A 1RAAB 2XIDA 2HBWA 1B07A 3NGPA 3CCRQ 3OYKA 2FRYA 4QW2A 1VQ9A 1MNEA 1G5VA 4JZ4A 1AEYA 4E7JA 4HCCA 1DJ7B 3SD4A 3EG2A 3RBBB 2CREA 4WF2A 1WHHA 1H3ZA 2OX7A 4RTUA 4FYXB 3RNJA 3NPFA 2BIVA 2RA2A 1IXDA 3QYGB 5GAMj 4E7ZA 2EKOA 3UA7A 2IPOB 3UWNA 1WXBA 2E6NA 1N8RR 3QJ6A 1ZSGA 2YWWA 2QAZA 4M7AE 1VQOQ 3ZEHA 2KT1A 5FROA 3I56A 3CCVA 1FYNA 2EQUA 4LD9K 1TTHB 1NLPC 4DBFA 1XTDA 2V8JA 3TSWA 5I11A 2ECZA 1QCFA 2O4XA 3CD6Q 3CMAQ 5A0DA 2DO3A 2WSCE 1VQMQ 4BE0A 3R6NA 1B3QA 1NEGA 4M78A 2J6OA 2YDLA 1V29B 5GMKh 1UGVA 2OAWA 3OBWA 2Z0WA 1K9MR 4ME7A 4CC2A 1NBEB 4E7SA 1VQ4Q 3CCQA 3G6EQ 2D0NA 3SWNC 2ZCFB 3OYFA 2ROLA 2PU9B 1GCQC 5KYYA 1JBMA 3BFMA 2DIQA 9ATCB 2KY9A 2YT6A 2AKKA 4JRQA 1JJ2A 2QA4Q 2LJ0A 4C0FA 1VIFA 5LJ5j 1VQ6Q 2BUDA 4XAXB 1TS9A 3KFVA 2F5TX 1OOTA 4J83A 5CQXA 1AZEA 3TCJA 2ED1A 3QO3A 1YWOA 4C5IA 2DBKA 1X43A 3CXCS 2K2MA 4EPCA 2CZ1B 1Y07A 2LCCA 1YJ9Q 1J3TA 2LZ6B 3FJPA 5CKFA 4E7LA 2CGHA 4J9DA 2FRWA 2P0KA 4Z8AA 2KQWA 2ZPEB 3DLMA 1VOMA 5D7UA 4JDSA 3A98A 1W2BS 1AOJA 3A8GB 1YCYA 2DTIA 2FL7A 3CMEQ 4DBQA 1IHVA 2HKQB 5GANe 1GXIE 1N9SA 2KRSA 1JU5C 2CH4W 2XMFA 1D1CA 3JCMb 4FU6A 3OY9A 4DEXA 5KYNA 2FG0A 4HCZA 1BIAA 3GBQA 4RTWA 2NUZA 4LUEA 1M30A 1VQPA 4EMKB 4X9CA 3NTIA 5GANd 1VQ8Q 2KGTA 2FVUA 2MMPA 4BD3A 3G71Q 2FPDA 1WYXA 2EYYA 2F1LA 2NUTA 6AT1B 3SWNA 1GRIA 3CC7A 1K8AU 3UA6A 1HYOA 1UECA 3FIFA 2EJGA 2HZYA 1RAHB 2BKDN 4XU0A 3CC4A 2A3LA 1I81A 1M1GA 5EG2A 4M78E 1AT1B 2BZYA 2E6ZA 4JRKA 4HVVA 2PVGB 4RUGA 2LNVA 1VQ9Q 2V26A 3CCLA 3QPHA 2HAXA 1Q86R 4MZTA 1OYXA 2LT4A 2ZPIB 3L2ZA 4C0DB 4FYWB 1Q81U 3P8HA 4TVRA 2K3YA 3CXCA 2K79A 4XU3A 1Q82C 3A8MB 1U06A 4ZN3A 4C5EA 2XD0A 1MV0B 2I2LA 2RMOA 2JMCA 1TUGB 2NUPB 1B7TA 2HL3A 1MNDA 1SEMA 2DRKA 2KK4A 2XHCA 1KQSA 1W2BA 2HQEA 4PNOA 5FU7B 2A0FB 2EYXA 2Y4YA 3HRUA 3FDRA 2V1QA 2VB6A 2LDMA 2X3WD 2RI5A 1AWOA 1UUEA 1N9RA 2E64A 2F2XA 3VKIA 2DXBA 1QVFP 4XTYA 1H92A 1KD1C 3CBOA 3QXEB 1HK9A 2JW4A 5GMKl 3REBB 5FW9A 3LH5A 3VS7A 2FB7A 4GLMA 3BY7A 2XICA 2NLUA 4DQ2A 1QW1A 4UC4A 3M4GA 2J7IA 2LRQA 2F2WA 3R6OA 3THKA 3HFNA 4FYVB 2JTMA 5I2MA 2RO0A 3EFOA 4J5YA 1M2OA 3VS1A 4N0AA 3EFSA 4R56A 3OYEA 1K73R 2FEIA 3M0SA 1WNLA 3X28B 1I0CA 1NLOC 4PJMA 3EHRA 3OS2A 2M0OA 1JXMA 4J7FA 1AWXA 2O01E 4XTVA 4XU2A 2QQSA 2GNCA 3PIOA 1OX8A 3JCMW 1BKBA 3MKDA 1X2QA 2D6FA 3RKYA 4L59A 4LD6A 3EG1A 1N6AA 2L3QA 2YUPA 3S3OA 1X6OA 2L8DA 2RHIA 2AZVA 2OTLA 5KYWB 3JRZA 3I35A 4MMLA 3SFMA 1BIBA 2YRDA 4C8QD 5KH6A 1R8OB 1JO8A 4E7HA 3RESA 4M77A
chains in the Genus database with same CATH topology
1UG1A 2LX7A 2CSIA 4ZNXA 4WCIA 3VS0A 1QKXA 2GBQA 2ESWA 4JJDA 3SHWA 1AVZC 1YN8A 1UFFA 1PRLC 2DILA 2KRNA 1OPKA 1ZBJA 4AFZC 1ZLMA 3O5ZA 4RTTA 1KIKA 2D8JA 3NHNA 3H41A 1CKBA 3PVLA 4JJBA 2LJ3A 1W70A 3JV3A 1NYGA 2RQTA 3I9QA 4R0KA 2CH4A 1GFCA 2M0YA 4ESRA 1X2KA 1H3HA 2KXDA 2CUDA 1I07A 1UTIA 2VWFA 1W1FA 2DA9A 1VYUA 1UDLA 2VVKA 3M0UA 2EGCA 4RTZA 2D8HA 1OEBA 1WDXA 1Z9QA 1UE9A 3EHQA 2MIOA 3SEMA 4J9EA 1MV3A 3UF4A 3VS2A 2DYBA 1HSQA 4Y92A 2VKNA 1PRMC 2O31A 1RUWA 2CT3A 4CC7A 3IQLA 2X3XD 4A63B 2RPNA 2CUBA 2O2OA 2EGEA 2KROA 2J06A 4CC4B 5IH2A 2D1XA 4EIKA 2A37A 2HEQA 2YSQA 5GJWB 1KSWA 2DRMA 2EBPA 2MCNA 5EC7A 1ZX6A 1QKWA 1T3SA 1ZUYA 2DMOA 1AWJA 1CSKA 2F2VA 2OI3A 4J9IA 3M0TA 2HBWA 1PKTA 1X69A 1RI9A 1B07A 3H0IA 3NGPA 3EGUA 2EW3A 2GGRA 2FRYA 2YUQA 1AWWA 3REAB 1WX6A 4HCKA 4JZ4A 1AEYA 1YCSB 2IIMA 1OV3A 1LCKA 3EG2A 3RBBB 2CREA 4LNPA 4RTUA 2AK5A 3RNJA 3NPFA 2LQWA 1M8MA 2LQNA 2DX1A 4JJCA 2KR3A 3I5RA 1K0XA 1WXUA 1QWEA 5FWBA 4HVWA 2MOXA 1VYVA 2EGAA 2K7AA 4OMOA 1WI7A 4FSSA 3UA7A 5ECAA 1U3OA 1T0JA 1EFNA 2DBMA 1WXBA 5IHNA 5I22A 1NYFA 1GFDA 1JQQA 1ZSGA 2EYWA 1HJDA 2YUNA 2CDTA 1U5SA 1CKAA 1WIEA 2JMAA 4KRTA 2KT1A 1GCPA 4OMMA 3EG3A 3QWXX 2NWMA 4CC3A 1FYNA 1QWFA 3I5SA 4D8DA 1WLPB 2EKHA 1NLPC 1VA7A 2DL5A 3TSWA 2DL8A 5I11A 2JM9A 2ECZA 2A28A 2V1RA 4AFQC 1QCFA 4E6RA 4JPBW 1FMKA 4J9FA 4F14A 1SHGA 4AFSC 3R6NA 1B3QA 1NEGA 1UJ0A 4JZ3A 2J6OA 1AZGB 2YDLA 1UGVA 2OAWA 1ZUKA 2G6FX 2KXCA 4IIOA 1G83A 4CC2A 3M0RA 1I1JA 2HDAA 1GBQA 2D0NA 2HCKA 2ROLA 2W10A 1GCQC 2LMJA 2YT6A 2AKKA 2CT4A 1WA7A 2KNBB 2GQIA 2LJ0A 2GTJA 1GL5A 1GBRA 2DJQA 3TSZA 2L3SA 1JXOA 2A08A 3TVTA 1K76A 3KFVA 3H0FA 4D8KA 1OOTA 1AZEA 1SHFA 4F16A 2ED1A 1SRLA 4ORZA 2BZ8A 1YWOA 1T0HA 4K11A 2EPDA 2DBKA 1X43A 2RF0A 1W6XA 2K2MA 1NM7A 4OMNA 1J3TA 1PWTA 1PNJA 2LZ6B 4J9DA 2FRWA 4Z8AA 1K0SA 2GTOA 3EG0A 1S1NA 1H8KA 1ABOA 1TUCA 2RQWA 3A98A 1AOJA 2DLPA 1K9AA 1X27A 1KFZA 2SEMA 2DE0X 2HSPA 3M0PA 1TUDA 2KRSA 5IHKA 1JU5C 2DVJA 2OJ2A 2CH4W 3M0QA 2KT8A 2J05A 2KRMA 1Y0MA 4OMQA 2KEAA 2M51A 2PNIA 2XMFA 2RNAA 2KBTA 2K6DA 1ABQA 2ENMA 2ROTA 4DEXA 2DF6A 2FG0A 2LP5A 3GBQA 4RTWA 2NUZA 1RLQC 4LUEA 1M30A 1X6BA 2B86A 1BK2A 2DNUA 1N5ZA 2KGTA 2FPDA 1WYXA 2EYYA 1GRIA 5FWCA 3UA6A 3VS4A 4J9HA 1UECA 1K4US 4LN2A 2AKLA 1PHTA 4RTYA 1E6GA 2BZYA 4HVUA 4HVVA 5IXBA 1MUZA 4J9CA 4RUGA 2RQUA 5IHIA 2O9SA 2L3PA 4IIMA 3QWYA 4LUDA 1M3BA 2RQVA 2KE9A 1QLYA 2J6FA 3ULRB 2K79A 4RTXA 1UHCA 2EQIA 1IO6A 3CQTA 1U06A 4HXJA 3VRZA 1ARKA 4QT7A 2FPEA 1MV0B 2W0ZA 4GBQA 3ZL7C 2O88A 2CSQA 2ABLA 2RMOA 2JMCA 2RQRA 3H0HA 3NMZC 3VRYA 2LJ1A 2I0NA 1SEMA 2DRKA 1Z9ZA 2K3BA 2BTTA 5IXFA 2EYXA 1OPLA 2FPFA 2V1QA 2DL7A 1M3AA 1ZUUA 2X3WD 4LE9A 4AG1C 1AWOA 1UUEA 2DL4A 2J6KA 2KYBA 2F2XA 2A36A 3U23A 1H92A 2L2PA 2ED0A 2L0AA 1Y57A 2PZ1A 2C0IA 5HCKA 2JW4A 3REBB 1M27C 1BBZA 1K1ZA 5FW9A 3LH5A 3VS7A 2C0OA 4GLMA 2JS2A 2KYMA 4F17A 2DL3A 1VYTA 2AZSA 3VS3A 1KJWA 1WXTA 3C0CA 3PE0A 4X1VA 2J7IA 1UJYA 2F2WA 2JS0A 3THKA 2LNHB 2YUOA 1BU1A 3FJ5A 1YNZA 1E6HA 3VS1A 2PTKA 1UHFA 2FEIA 3M0SA 4DEYA 1I0CA 1NLOC 2RN8A 1V1CA 4M4ZA 3EHRA 1E7OA 2C0TA 5GJVB 2FO0A 3VS5A 2JXBA 2H8HA 1JXMA 1PKSA 1AWXA 2QDLA 2O9VA 2EYZA 1XOVA 2LCSA 2EVRA 4RTVA 4Z88A 4OMPA 1X6GA 2GNCA 2JM8A 1T3LA 1RLPC 4OMLA 1BB9A 1X2QA 5L23A 2P4RA 1SPKA 1M3CA 1A0NB 1YWPA 4J9BA 3EG1A 1SSHA 2DM1A 2L3QA 2YUPA 1GCQA 3VS6A 1HD3A 2K9GA 2E5KA 1SRMA 2SRCA 2AZVA 1TG0A 1AD5A 4Z89A 4AG2C 3I35A 4AFUC 1WFWA 1YP5A 1G2BA 1JEGA 1NG2A 2JTEA 1NEBA 1JO8A 2JT4A 3PVQA 4J9GA 3UATA 2BZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG1 A;  2LX7 A;  2CSI A;  4ZNX A;  4WCI A;  3VS0 A;  1QKX A;  2GBQ A;  2ESW A;  4JJD A;  3SHW A;  1AVZ C;  1YN8 A;  1UFF A;  1PRL C;  2DIL A;  2KRN A;  1OPK A;  1ZBJ A;  4AFZ C;  1ZLM A;  3O5Z A;  4RTT A;  1KIK A;  2D8J A;  3NHN A;  3H41 A;  1CKB A;  3PVL A;  4JJB A;  2LJ3 A;  1W70 A;  3JV3 A;  1NYG A;  2RQT A;  3I9Q A;  4R0K A;  2CH4 A;  1GFC A;  2M0Y A;  4ESR A;  1X2K A;  1H3H A;  2KXD A;  2CUD A;  1I07 A;  1UTI A;  2VWF A;  1W1F A;  2DA9 A;  1VYU A;  1UDL A;  2VVK A;  3M0U A;  2EGC A;  4RTZ A;  2D8H A;  1OEB A;  1WDX A;  1Z9Q A;  1UE9 A;  3EHQ A;  2MIO A;  3SEM A;  4J9E A;  1MV3 A;  3UF4 A;  3VS2 A;  2DYB A;  1HSQ A;  4Y92 A;  2VKN A;  1PRM C;  2O31 A;  1RUW A;  2CT3 A;  4CC7 A;  3IQL A;  2X3X D;  4A63 B;  2RPN A;  2CUB A;  2O2O A;  2EGE A;  2KRO A;  2J06 A;  4CC4 B;  5IH2 A;  2D1X A;  4EIK A;  2A37 A;  2HEQ A;  2YSQ A;  5GJW B;  1KSW A;  2DRM A;  2EBP A;  2MCN A;  5EC7 A;  1ZX6 A;  1QKW A;  1T3S A;  1ZUY A;  2DMO A;  1AWJ A;  1CSK A;  2F2V A;  2OI3 A;  4J9I A;  3M0T A;  2HBW A;  1PKT A;  1X69 A;  1RI9 A;  1B07 A;  3H0I A;  3NGP A;  3EGU A;  2EW3 A;  2GGR A;  2FRY A;  2YUQ A;  1AWW A;  3REA B;  1WX6 A;  4HCK A;  4JZ4 A;  1AEY A;  1YCS B;  2IIM A;  1OV3 A;  1LCK A;  3EG2 A;  3RBB B;  2CRE A;  4LNP A;  4RTU A;  2AK5 A;  3RNJ A;  3NPF A;  2LQW A;  1M8M A;  2LQN A;  2DX1 A;  4JJC A;  2KR3 A;  3I5R A;  1K0X A;  1WXU A;  1QWE A;  5FWB A;  4HVW A;  2MOX A;  1VYV A;  2EGA A;  2K7A A;  4OMO A;  1WI7 A;  4FSS A;  3UA7 A;  5ECA A;  1U3O A;  1T0J A;  1EFN A;  2DBM A;  1WXB A;  5IHN A;  5I22 A;  1NYF A;  1GFD A;  1JQQ A;  1ZSG A;  2EYW A;  1HJD A;  2YUN A;  2CDT A;  1U5S A;  1CKA A;  1WIE A;  2JMA A;  4KRT A;  2KT1 A;  1GCP A;  4OMM A;  3EG3 A;  3QWX X;  2NWM A;  4CC3 A;  1FYN A;  1QWF A;  3I5S A;  4D8D A;  1WLP B;  2EKH A;  1NLP C;  1VA7 A;  2DL5 A;  3TSW A;  2DL8 A;  5I11 A;  2JM9 A;  2ECZ A;  2A28 A;  2V1R A;  4AFQ C;  1QCF A;  4E6R A;  4JPB W;  1FMK A;  4J9F A;  4F14 A;  1SHG A;  4AFS C;  3R6N A;  1B3Q A;  1NEG A;  1UJ0 A;  4JZ3 A;  2J6O A;  1AZG B;  2YDL A;  1UGV A;  2OAW A;  1ZUK A;  2G6F X;  2KXC A;  4IIO A;  1G83 A;  4CC2 A;  3M0R A;  1I1J A;  2HDA A;  1GBQ A;  2D0N A;  2HCK A;  2ROL A;  2W10 A;  1GCQ C;  2LMJ A;  2YT6 A;  2AKK A;  2CT4 A;  1WA7 A;  2KNB B;  2GQI A;  2LJ0 A;  2GTJ A;  1GL5 A;  1GBR A;  2DJQ A;  3TSZ A;  2L3S A;  1JXO A;  2A08 A;  3TVT A;  1K76 A;  3KFV A;  3H0F A;  4D8K A;  1OOT A;  1AZE A;  1SHF A;  4F16 A;  2ED1 A;  1SRL A;  4ORZ A;  2BZ8 A;  1YWO A;  1T0H A;  4K11 A;  2EPD A;  2DBK A;  1X43 A;  2RF0 A;  1W6X A;  2K2M A;  1NM7 A;  4OMN A;  1J3T A;  1PWT A;  1PNJ A;  2LZ6 B;  4J9D A;  2FRW A;  4Z8A A;  1K0S A;  2GTO A;  3EG0 A;  1S1N A;  1H8K A;  1ABO A;  1TUC A;  2RQW A;  3A98 A;  1AOJ A;  2DLP A;  1K9A A;  1X27 A;  1KFZ A;  2SEM A;  2DE0 X;  2HSP A;  3M0P A;  1TUD A;  2KRS A;  5IHK A;  1JU5 C;  2DVJ A;  2OJ2 A;  2CH4 W;  3M0Q A;  2KT8 A;  2J05 A;  2KRM A;  1Y0M A;  4OMQ A;  2KEA A;  2M51 A;  2PNI A;  2XMF A;  2RNA A;  2KBT A;  2K6D A;  1ABQ A;  2ENM A;  2ROT A;  4DEX A;  2DF6 A;  2FG0 A;  2LP5 A;  3GBQ A;  4RTW A;  2NUZ A;  1RLQ C;  4LUE A;  1M30 A;  1X6B A;  2B86 A;  1BK2 A;  2DNU A;  1N5Z A;  2KGT A;  2FPD A;  1WYX A;  2EYY A;  1GRI A;  5FWC A;  3UA6 A;  3VS4 A;  4J9H A;  1UEC A;  1K4U S;  4LN2 A;  2AKL A;  1PHT A;  4RTY A;  1E6G A;  2BZY A;  4HVU A;  4HVV A;  5IXB A;  1MUZ A;  4J9C A;  4RUG A;  2RQU A;  5IHI A;  2O9S A;  2L3P A;  4IIM A;  3QWY A;  4LUD A;  1M3B A;  2RQV A;  2KE9 A;  1QLY A;  2J6F A;  3ULR B;  2K79 A;  4RTX A;  1UHC A;  2EQI A;  1IO6 A;  3CQT A;  1U06 A;  4HXJ A;  3VRZ A;  1ARK A;  4QT7 A;  2FPE A;  1MV0 B;  2W0Z A;  4GBQ A;  3ZL7 C;  2O88 A;  2CSQ A;  2ABL A;  2RMO A;  2JMC A;  2RQR A;  3H0H A;  3NMZ C;  3VRY A;  2LJ1 A;  2I0N A;  1SEM A;  2DRK A;  1Z9Z A;  2K3B A;  2BTT A;  5IXF A;  2EYX A;  1OPL A;  2FPF A;  2V1Q A;  2DL7 A;  1M3A A;  1ZUU A;  2X3W D;  4LE9 A;  4AG1 C;  1AWO A;  1UUE A;  2DL4 A;  2J6K A;  2KYB A;  2F2X A;  2A36 A;  3U23 A;  1H92 A;  2L2P A;  2ED0 A;  2L0A A;  1Y57 A;  2PZ1 A;  2C0I A;  5HCK A;  2JW4 A;  3REB B;  1M27 C;  1BBZ A;  1K1Z A;  5FW9 A;  3LH5 A;  3VS7 A;  2C0O A;  4GLM A;  2JS2 A;  2KYM A;  4F17 A;  2DL3 A;  1VYT A;  2AZS A;  3VS3 A;  1KJW A;  1WXT A;  3C0C A;  3PE0 A;  4X1V A;  2J7I A;  1UJY A;  2F2W A;  2JS0 A;  3THK A;  2LNH B;  2YUO A;  1BU1 A;  3FJ5 A;  1YNZ A;  1E6H A;  3VS1 A;  2PTK A;  1UHF A;  2FEI A;  3M0S A;  4DEY A;  1I0C A;  1NLO C;  2RN8 A;  1V1C A;  4M4Z A;  3EHR A;  1E7O A;  2C0T A;  5GJV B;  2FO0 A;  3VS5 A;  2JXB A;  2H8H A;  1JXM A;  1PKS A;  1AWX A;  2QDL A;  2O9V A;  2EYZ A;  1XOV A;  2LCS A;  2EVR A;  4RTV A;  4Z88 A;  4OMP A;  1X6G A;  2GNC A;  2JM8 A;  1T3L A;  1RLP C;  4OML A;  1BB9 A;  1X2Q A;  5L23 A;  2P4R A;  1SPK A;  1M3C A;  1A0N B;  1YWP A;  4J9B A;  3EG1 A;  1SSH A;  2DM1 A;  2L3Q A;  2YUP A;  1GCQ A;  3VS6 A;  1HD3 A;  2K9G A;  2E5K A;  1SRM A;  2SRC A;  2AZV A;  1TG0 A;  1AD5 A;  4Z89 A;  4AG2 C;  3I35 A;  4AFU C;  1WFW A;  1YP5 A;  1G2B A;  1JEG A;  1NG2 A;  2JTE A;  1NEB A;  1JO8 A;  2JT4 A;  3PVQ A;  4J9G A;  3UAT A;  2BZX A; 
#chains in the Genus database with same CATH topology
 1UG1 A;  2LX7 A;  5LJ3 e;  5KCH A;  4ZGD B;  2DD5 A;  3JCM h;  3VS0 A;  2ESW A;  1UFF A;  3OYI A;  2KRN A;  4ZN1 A;  3PMT A;  1K8A C;  3MEA A;  4JS5 A;  4RTT A;  3DB3 A;  2D8J A;  3RKW A;  1B34 B;  3NHN A;  3CCS T;  1I5L A;  2JJ9 A;  3CCV T;  4R55 A;  1ZA2 B;  3JV3 A;  4QKU A;  1X01 A;  4EMH A;  3HRS A;  2KXD A;  4J6Y A;  5LJ3 d;  1O9S A;  3V7C A;  3PFS A;  3CCM T;  4PFP A;  2MWP A;  3HPW A;  3X26 B;  2X4W A;  2VVK A;  3GNF B;  3EGD A;  1YI2 A;  2M16 A;  3S6W A;  5GAN f;  3CCQ T;  1FWZ A;  4F04 B;  4A63 B;  4PLI A;  2NYS A;  1WHG A;  1OUL A;  2EGE A;  1EZZ B;  4DOW A;  2HEQ A;  3A5Z B;  4C92 A;  5GJW B;  2DRM A;  3HHT B;  1ZX6 A;  2LTO A;  4Y28 E;  2DMO A;  1CSK A;  2OI3 A;  1PC0 A;  3EGX A;  2QTX A;  3H8Z A;  3M0T A;  2K5F A;  3QKJ A;  2EQM A;  3MCA B;  1X69 A;  4IUP A;  2QXF A;  3CPW A;  3EGU A;  1VQK A;  4JRI A;  3M57 A;  3REA B;  1TH7 A;  1WX6 A;  3H6Z A;  4HCK A;  1LNX A;  1U1T A;  1YCS B;  1UEB A;  2IIM A;  2E3I A;  1OV3 A;  3OW2 P;  5CAI A;  2AK5 A;  3M5A A;  4EMK C;  4ZGE B;  2LQN A;  3VU3 C;  2EQJ A;  2DX1 A;  1G3W A;  2X4Y A;  3I55 T;  1K0X A;  1QWE A;  5FWB A;  4HVW A;  2MOX A;  2EGA A;  1OX9 A;  4OMO A;  1WJR A;  4GY5 A;  1M2V A;  4ELZ C;  5ECA A;  5GMK e;  3CCJ A;  1M4Z A;  1EFN A;  2CP2 A;  4KUD K;  1KHI A;  1NYF A;  3L2Q A;  1NZ9 A;  2EYW A;  3CCU T;  2GFU A;  3OYB A;  1U5S A;  1CKA A;  2DYI A;  2XK0 A;  4OMM A;  1GCP A;  3EG3 A;  3QWX X;  4XTU A;  4M7A D;  1MMD A;  2EKH A;  4C0D C;  5LJ5 h;  3UT1 A;  5HK3 A;  2EYQ A;  4PJO F;  3EG9 B;  2A28 A;  3V7R A;  4E6R A;  5KYU A;  3FLG A;  4F14 A;  4AFS C;  3BW1 A;  3CC7 T;  2XI9 A;  4BI4 A;  2KVQ G;  3VJP A;  5KE2 A;  2LC4 A;  1I1J A;  2HDA A;  5FU7 C;  1ZSZ A;  3CC4 T;  2HCK A;  2E65 A;  2W10 A;  5FRN A;  2LMJ A;  5D6Y A;  2PVD B;  5CKH A;  4M7D D;  3CCL T;  2KNB B;  2AT1 B;  2GQI A;  4MDW A;  4RCB A;  2JTF A;  2GTJ A;  2WAC A;  1JXO A;  3TVT A;  3JB9 F;  1LJO A;  4N4H A;  3H0F A;  5GMK m;  3CC2 T;  1SHF A;  4F16 A;  2VUB A;  1YHQ A;  3MO8 A;  4C0Z A;  1SRL A;  1HXD A;  3LLR A;  4BE2 A;  4C8Q F;  1QCO A;  4M75 D;  1JJ2 P;  1I8F A;  1PWT A;  5CIU A;  4C8Q B;  1QVG S;  5GAN 3;  2IG0 A;  1U8R A;  3O8V A;  5GAO p;  1TUC A;  4C0G A;  2K5I A;  1K9A A;  2JUF A;  2MAM A;  3X24 B;  2XDP A;  2COW A;  2SEM A;  2DE0 X;  2HSP A;  1FMV A;  2JOY A;  4P5N A;  4N4I A;  2CKK A;  2DVJ A;  4MDX A;  4EMG A;  4JS4 A;  3M0Q A;  1NPR A;  2KT8 A;  1Q82 R;  4A4H A;  2PNI A;  3GF5 A;  3QBY A;  2KBT A;  2K6D A;  5LJ3 f;  2DF6 A;  3QJY A;  4QVD A;  1RLQ C;  5CO7 A;  2DPP B;  2NUP A;  4IUU A;  4KGX B;  1N5Z A;  2CYZ B;  2EWN A;  2MF2 A;  3CCS A;  2QEX A;  5GAO m;  4OB3 B;  5FWC A;  3VS4 A;  4J9H A;  1RAE B;  4QQG A;  1YJW T;  1VQL A;  1D1A A;  3CCM A;  4RTY A;  4N4G A;  4Y91 A;  3V8L A;  1QQJ A;  1KD1 R;  1OI1 A;  2DER A;  2M9U A;  4O5V A;  4HVU A;  2X4J A;  4M78 D;  2YLB A;  2C06 A;  4LDY A;  4PLL A;  2RQU A;  5IHI A;  4LUD A;  4IIM A;  3S3M A;  2OTL T;  1V76 A;  4BE1 A;  3OB9 A;  5HY6 A;  3BDU A;  2KE9 A;  4PJN A;  3ULR B;  4RTX A;  2EQI A;  1IO6 A;  4RMO A;  4HXJ A;  3VRZ A;  2QI2 A;  1N8R U;  2F5K A;  4A4G A;  3OA6 A;  3SDZ A;  2X4X A;  3ZL7 C;  2CZ0 B;  2O88 A;  2ABL A;  1UGP B;  3EH1 A;  1M1K R;  3J7A F;  5GAN g;  2K3B A;  5KCO A;  1VQ7 A;  8AT1 B;  4L6V 5;  4PJO G;  3CXC P;  2FPF A;  2OTJ T;  3E1S A;  2EFI A;  1Y96 B;  3TEE A;  2KYB A;  3MEV A;  2A36 A;  5GAN 7;  1U1S A;  3DKM A;  2ED0 A;  3LW5 E;  2C0I A;  1K9M U;  4M7A F;  1KQS P;  1W2B P;  4M7A B;  3I55 A;  2RHU A;  2JS2 A;  1KC8 R;  4BY6 B;  1VYT A;  3PT9 A;  2AZS A;  1KJW A;  3C0C A;  4X1V A;  3MEU A;  1YI2 T;  2R5M A;  5C6S A;  2FZK B;  2JS0 A;  4GLK A;  4OGC A;  5I21 A;  1BU1 A;  3FJ5 A;  1OU8 A;  3X20 B;  1E6H A;  2RHY A;  1AHJ B;  3JB9 G;  2PTK A;  1UHF A;  1VQN A;  1QCN A;  3CCU A;  4M4Z A;  3E19 A;  1ACM B;  2C0T A;  2JXB A;  2H8H A;  3JCM e;  4C8Q G;  1PKS A;  3VUZ A;  4BUG A;  1D3B A;  2F69 A;  2QDL A;  2O9V A;  2LCS A;  2EVR A;  4M7D F;  1X6G A;  2RJD A;  2GQV A;  2JM8 A;  2RK2 A;  1T3L A;  3GLX A;  1RLP C;  4M7D B;  2HNI A;  1BB9 A;  5L23 A;  3JB9 I;  3LX7 A;  5CVI A;  1VQK T;  2YRC A;  3PGG A;  1I5O B;  5KYX B;  1GCQ A;  2E5K A;  1TG0 A;  4Z89 A;  3M55 A;  2CZ6 B;  4KUI A;  2KI7 A;  3CCE A;  2VXF A;  3JCM d;  4DBR A;  2JTE A;  4BI3 A;  4IUQ A;  3CD6 T;  4M75 F;  3UAT A;  5A2Q E;  4PJO C;  4OVA A;  1NJI R;  2CSI A;  4J6W A;  1YIJ T;  4M75 B;  3G7Z A;  2DAQ A;  4E2F B;  2M1H A;  2GBQ A;  4JJD A;  2YXY A;  3CCJ T;  1YN8 A;  1VQ4 T;  1BCO A;  5DM7 R;  4RG2 A;  2GF7 A;  3HRT A;  2P0Q A;  3CC2 A;  2QGG A;  1Q7Y U;  1KQ2 A;  1CKB A;  2CP3 A;  1XQH A;  3EFR A;  1NYG A;  2RQT A;  3H9N A;  5GAM e;  3I9Q A;  2M0Y A;  1X2K A;  1H3H A;  1UTI A;  4RKU E;  1OQK A;  1MMN A;  1W1F A;  4CRI A;  5A0G A;  3OS5 A;  1LPL A;  1UDL A;  2AIR B;  3DB4 A;  3CCS Q;  2XDB A;  3I56 Q;  3CCV Q;  1WDX A;  1Z9Q A;  1N8R C;  4BI8 B;  3EHQ A;  1W4S A;  2MIO A;  5GAN 6;  4J9E A;  1MV3 A;  1EIF A;  1HSQ A;  5GAM d;  5A0L A;  4C8Q C;  3CCM Q;  4FW1 A;  3IQL A;  5AYF A;  1O75 A;  3QDF A;  2RPN A;  2CUB A;  3OS0 A;  3KXT A;  3RMQ A;  2KRO A;  4PJJ A;  2D1X A;  1G3T A;  5GAN 2;  1MGQ A;  2LCL A;  5EC7 A;  3RR6 A;  2O4X B;  2E5Q A;  1T3S A;  1ZUY A;  1M90 U;  1AWJ A;  5HK0 A;  2WSF E;  3CCQ Q;  1RAC B;  4M78 B;  1RI9 A;  4PFZ A;  1YHQ T;  2GGR A;  5LJ3 g;  2YUQ A;  4IKF A;  3OSV A;  1AWW A;  3JCM Q;  5KYY B;  2HSE B;  1LCK A;  1YJW A;  5LJ5 e;  4LDX A;  4PJO A;  4LNP A;  4Q5W A;  4QQD A;  1RAD B;  2CS7 A;  1TXQ A;  2H3E B;  4M7A G;  2YHT A;  1S72 A;  1WXU A;  1R77 A;  1VYV A;  2P4T A;  2K7A A;  3CPW P;  3GOX A;  2Y90 A;  4FSS A;  1U3O A;  4PKC C;  4XTZ A;  2DBM A;  5IHN A;  2ZPF B;  4M77 D;  3HL8 A;  1HJD A;  5LJ5 d;  2DXU A;  2YUN A;  2CDT A;  4CI0 C;  1WIE A;  3I55 Q;  1NPP A;  1K73 U;  5GAO n;  4FIB A;  4FT2 A;  2NWM A;  4PL6 A;  1QWF A;  2DET A;  4D8D A;  1VQ5 T;  1VA7 A;  2P0P A;  5GAN h;  3V8J A;  3G4S A;  1PM3 A;  3ER0 A;  2WSE E;  4M7D G;  4MMK A;  1Y7X A;  2DKG A;  2V1R A;  4AFQ C;  2MI6 A;  3ZBD A;  2DXT A;  2OTJ A;  4KBM B;  4JPB W;  2QEX T;  1FXX A;  4J9F A;  3WXM B;  1SHG A;  4A54 A;  1UJ0 A;  5M9O A;  3INZ A;  4F7U F;  4JZ3 A;  1C1A A;  1ZUK A;  2G6F X;  4F7U B;  1G83 A;  1VQL T;  2HKN A;  3M0R A;  1VQP Q;  1FX7 A;  4DBH A;  3UDC A;  1VIE A;  2E12 A;  1OZ2 A;  1Q81 C;  2MPX C;  1G3Y A;  3CCR A;  2IVW A;  3LGL A;  2CT4 A;  4M75 G;  2RB6 A;  4J6X A;  2L5Q A;  3CC7 Q;  2QK0 A;  1RI0 A;  2XU8 A;  1GL5 A;  2ZPH B;  2BE7 D;  2DJQ A;  1GBR A;  3KUF A;  1SG5 A;  1Q7Y C;  2A08 A;  1LVK A;  1K76 A;  4XQ3 A;  3HTR A;  5CQY A;  3FRN A;  2K2V A;  4LXC A;  2NUT B;  3CC4 Q;  5J3B A;  3SWN B;  4ATO A;  3MP1 A;  1D0Z A;  4KH1 B;  2VV5 A;  5DY9 A;  4M7A C;  2QYZ A;  4BY6 C;  4ORZ A;  2BZ8 A;  2HBP A;  4C92 D;  5J26 A;  5GAO r;  3OYG A;  2EPD A;  3CCL Q;  4MZP A;  4YTL A;  2DZ9 A;  1MMA A;  4II1 A;  3JCM f;  1WHK A;  2DK3 A;  3RDV A;  1PNJ A;  1VQ7 T;  3BE3 A;  2E3H A;  3MET A;  1S1N A;  3CC2 Q;  1H8K A;  2PQW A;  4PJO E;  1BI2 A;  1C6V X;  5AT1 B;  1X27 A;  4KT0 E;  4L5G A;  1KFZ A;  3M0P A;  4ZGJ B;  3OYM A;  1TUD A;  2DFU A;  5IHK A;  1WGS A;  1ZQ1 A;  1P92 A;  1UGQ B;  4M7D C;  2KEA A;  4QVZ A;  3CD6 A;  2M51 A;  1SSF A;  2FZG B;  3LYI A;  1M90 C;  4JRP A;  2RNA A;  3L2R A;  1X75 C;  1RAF B;  1YIJ A;  3E2U A;  2ENM A;  5CCA A;  2PUO B;  1IHW A;  2PVO B;  3QG1 A;  1YIT T;  1VQ4 A;  2CP7 A;  1X6B A;  1JRI A;  3SB2 A;  3G6E A;  3QHS A;  2GFA A;  3M54 A;  4IUT A;  4NL2 A;  4X9D A;  1VQN T;  3HKS A;  3JSC A;  3VV0 A;  3OW2 S;  4LDU A;  3MP6 A;  1XJW B;  4M75 C;  5GAM f;  3V7S A;  1RAB B;  1Y96 A;  2AKL A;  1PHT A;  4IUR A;  1VQ6 A;  4FL6 A;  4C8Q E;  1E6G A;  3VYH B;  3OYH A;  4KGZ B;  3RIR A;  2KAF A;  3EH2 A;  3GIB A;  3OYN A;  1VUB A;  5IXB A;  1MUZ A;  2LQK A;  3EFO B;  1MHN A;  5GAN 8;  3V8K A;  3OYC A;  3OMG A;  4KH0 B;  1YJ9 A;  3UPU A;  1YJW Q;  1K73 C;  1M3B A;  1QLY A;  4PK4 A;  3CCE T;  1UHC A;  3HFO A;  1WPY A;  1WHJ A;  2E4H A;  2VAS A;  1ARK A;  2FPE A;  2W0Z A;  3S3N A;  3Q1J A;  3H0H A;  3NMZ C;  4ELY C;  2LJ1 A;  5GAN j;  3RER A;  1I4K 1;  2OTL Q;  3BDL A;  1M5Q 1;  5FU6 B;  2E41 A;  1OPL A;  3M4Y A;  1M3A A;  4AG1 C;  4LE9 A;  3CPF A;  2KDS A;  2QG9 B;  4EMK A;  4M77 F;  1D0Y A;  3J80 E;  4F7U G;  4A4F A;  4M77 B;  2L0A A;  2PZ1 A;  2R57 A;  5LJ5 f;  3JCM P;  5HCK A;  1M27 C;  1XNI A;  1BBZ A;  1K1Z A;  2ZGW A;  4M78 C;  1VQ8 A;  2C0O A;  3F70 A;  4QVC A;  2OTJ Q;  4A4K A;  4F17 A;  3G71 A;  2DL3 A;  3MJX A;  4A4E A;  1F1B B;  2HQH A;  3ME9 A;  3LWH A;  2LNH B;  2YUO A;  3TU4 K;  3JCM V;  1JJ2 S;  1M8V A;  1V1C A;  4WTO B;  5DLQ E;  2HL5 C;  4BAC A;  2YLC A;  3VS5 A;  2V8K A;  2QQA A;  2Y4X A;  2ZPB B;  4HKE A;  2CP5 A;  1YI2 Q;  3MEW A;  2RJE A;  3G1J A;  1VQ5 A;  4HCB A;  5IT9 E;  4HT8 A;  1XOV A;  3OYD A;  1FMW A;  1R0C B;  2QDY B;  4RTV A;  4Z88 A;  3EGD B;  2L3R A;  4OGE A;  4Z02 A;  4OML A;  5IN1 A;  1SPK A;  3NTH A;  4J9B A;  1YBY A;  4JLI A;  1SSH A;  1WQ7 A;  4BDY A;  1SRM A;  3AT1 B;  3L1A A;  2XKO C;  1WFW A;  1IZ6 A;  4C92 F;  3TQ7 P;  1RL2 A;  1NG2 A;  3A8O B;  2JT4 A;  4C92 B;  1S72 T;  2X35 A;  3OYJ A;  1N27 A;  2JNG A;  1VQK Q;  2K4Y A;  1D1B A;  1Q82 U;  3EGX B;  2RM4 A;  3CBP A;  1IGQ A;  4ZNX A;  4WCI A;  3JB9 H;  1ZHI A;  4PJL A;  3SHW A;  1AVZ C;  1TSF A;  1PRL C;  1OPK A;  1ZBJ A;  2QQB A;  4AFZ C;  1ZLM A;  2AHJ B;  3O5Z A;  1KIK A;  1QVG A;  2DJZ A;  2DVE A;  5I2S A;  2EQK A;  2VGM A;  3RUX A;  1YIJ Q;  1GFC A;  4ESR A;  2MWO A;  3CCJ Q;  3G4S T;  2VWF A;  1YJN T;  1JB0 E;  4B9W A;  1M2V B;  2DA9 A;  1KD1 U;  2VYT A;  3GNG A;  4M7D E;  3M0U A;  2EGC A;  4RTZ A;  2XG8 D;  4J8O A;  4HA8 A;  4C5H A;  3JCM g;  1UE9 A;  4AMC A;  3L2W A;  2HQX A;  1KG1 A;  4PFO A;  2VKN A;  3WVD B;  4CC7 A;  5KYW A;  2X3X D;  5J39 A;  3CCR T;  2ZAE A;  2O2O A;  2J06 A;  1BYM A;  2OAU A;  1WHM A;  3PTA A;  5IH2 A;  4EIK A;  4M75 E;  2YSQ A;  3JCM X;  3M9Q A;  1YIT A;  1M1K U;  5KYU B;  1QKW A;  2LX9 A;  2F2V A;  4FM4 B;  3LGF A;  2DEQ A;  1PKT A;  3MPU B;  3H0I A;  1G8X A;  2EW3 A;  1UGR B;  1K8A R;  5LJ3 j;  5CKB A;  1KQS S;  3C94 A;  4KGV B;  1ZSZ B;  4M77 G;  1B34 A;  2FHD A;  3X25 B;  4E7I A;  3ZFJ A;  4E7K A;  3QYH B;  2KMT A;  2LQW A;  3JCM c;  1M8M A;  3OSS C;  3PIP A;  2HMA A;  4JJC A;  2KR3 A;  3I5R A;  4F7U A;  1VQO T;  1YHQ Q;  1QP3 A;  3ASK A;  2RHX A;  3QUI A;  1KC8 U;  5GAM g;  3MP8 A;  1Q81 R;  3LWI A;  1WI7 A;  2A7Y A;  1BI0 A;  1PG5 B;  1BI3 A;  3C4S A;  2BE9 B;  1T0J A;  2RHZ A;  2B8A A;  2EAY A;  5I22 A;  1GFD A;  1JQQ A;  5D6X A;  3M58 A;  5GAO q;  1Q7Y R;  2JVV A;  3QSU A;  2JMA A;  2ZPG B;  4KRT A;  1IRE B;  4ANJ A;  3GPL A;  3CMA T;  2X51 A;  4BDZ A;  1VQM T;  4CC3 A;  3I5S A;  5GAN 4;  2YRV A;  1WLP B;  4N0A C;  3CEY A;  2R5A A;  1ZA1 B;  2DL5 A;  2X9H A;  2DL8 A;  3G6E T;  2JM9 A;  2KSS A;  2EJ9 A;  4X34 A;  1LOJ A;  4JJN K;  1SKU B;  3A8H B;  1FMK A;  2E1H A;  3FEO A;  2QA4 T;  2DTH A;  2DZC A;  1AZG B;  1VQ5 Q;  4IIO A;  2KXC A;  2VC8 A;  5FU6 C;  3L2U A;  1TWB A;  2QQ9 A;  1VQ6 T;  1GBQ A;  4C92 G;  1OU9 A;  2LT1 A;  4XK8 E;  8ATC B;  4O6J A;  4OB1 B;  2CP6 A;  2E70 A;  3OS1 A;  4RCC A;  3NTK A;  2QEX Q;  1WA7 A;  2LVM A;  5L8R E;  2ZZD A;  1NJI U;  1BI1 A;  3TSZ A;  7AT1 B;  1M90 R;  1YJ9 T;  5LJ5 g;  2L3S A;  1Q86 U;  5DLO A;  4M77 C;  1VQL Q;  1EX4 A;  3P8D A;  3JCM J;  3HP9 A;  4D8K A;  3FB9 A;  2RH2 A;  2P84 A;  3LH0 A;  5FLX E;  1TU0 B;  1T0H A;  4K11 A;  2M02 A;  2RF0 A;  5GMK j;  5KE3 A;  3CME T;  1W6X A;  1PD0 A;  1NM7 A;  2EIF A;  4OMN A;  1M1F A;  4M78 F;  1TOV A;  5C0M A;  1K0S A;  2GTO A;  1QVF S;  2V8I A;  3EG0 A;  5D6W A;  2JN0 A;  5CR2 A;  1ABO A;  2RI2 A;  1WJS A;  2DEU A;  2RQW A;  2D0Q B;  4PJO D;  1K9M C;  3EG9 A;  3MHX A;  2DLP A;  2DD4 A;  4ZTJ A;  4F7U E;  1VQ7 Q;  3D7S B;  2OJ2 A;  1PSE A;  1VQ8 T;  2J05 A;  2KRM A;  1Y0M A;  4OMQ A;  3G71 T;  4BB7 A;  1M1K C;  3VYG A;  2MYS A;  3FC3 A;  1ABQ A;  3M56 A;  4OMF B;  3PMI A;  2ROT A;  2K5L A;  2RJC A;  1Q95 G;  2LP5 A;  2K3X A;  3L42 A;  2B86 A;  1BK2 A;  2DNU A;  3J81 E;  2HD0 A;  1Y71 A;  4C92 C;  5FRM A;  1H64 1;  1UGS B;  3RKX A;  3JB9 D;  3KBG A;  3HSB A;  1VQ9 T;  2RK1 A;  1QMC A;  1K4U S;  2JZ2 A;  4LN2 A;  4V2S A;  4A53 A;  1YIT Q;  4JLG A;  3CPW S;  2XDD A;  5HKC A;  1R0B G;  1KC8 C;  1YJN A;  1VQN Q;  5GAO l;  3CCU Q;  5LL6 S;  4C8Q A;  4J9C A;  4FSX A;  3AHU A;  3QZ9 B;  2O9S A;  2L3P A;  3QWY A;  3OYY A;  2RQV A;  2J6F A;  4E47 A;  1MMG A;  3CQT A;  2QQR A;  4QT7 A;  3L2V A;  2FZC B;  2COY A;  1D3B B;  3OQ5 A;  4DA4 A;  4HT9 A;  4GBQ A;  3I56 T;  1QVF A;  2CSQ A;  1ZBX A;  2L89 A;  2RQR A;  3NFC A;  3TRE A;  1BCM A;  3CBM A;  3VRY A;  2I0N A;  2RD1 A;  1C0M A;  1Z9Z A;  3CCE Q;  3PNW C;  2BTT A;  3VUB A;  4FT4 A;  2D9T A;  3QDR B;  5IXF A;  4AT1 B;  5GAN 5;  5CKE A;  2DL7 A;  1ZUU A;  2EJF A;  3GP8 A;  2RJF A;  2DL4 A;  2J6K A;  4B9X A;  3U23 A;  2K57 A;  3OMC A;  2L2P A;  1Y57 A;  1IRX A;  4OF1 A;  1PD1 A;  4FW2 A;  2DTO A;  4C5G A;  1NJI C;  4OB0 B;  3DLL A;  1KQ1 A;  2KYM A;  4NS5 A;  5GMK i;  1VQO A;  2ATC B;  1Q86 C;  2QGF B;  3VS3 A;  1SF9 A;  1WXT A;  5GAM h;  3PE0 A;  5CKD A;  1PSF A;  1ZSZ C;  4QQ6 A;  1UJY A;  4FYY B;  4D6W A;  1WJQ A;  2DIG A;  1YNZ A;  5IAY A;  2QAS A;  3E9G A;  1WZO A;  3QII A;  3WVE B;  4DEY A;  4JUV A;  2RN8 A;  3CMA A;  1E7O A;  1VQM A;  5GJV B;  2FO0 A;  1PCX A;  1OZ3 A;  4MZM A;  1QVP A;  3E9F A;  3T9N A;  4B6M A;  4XU1 A;  3M59 A;  3RMS A;  1WQW A;  2EYZ A;  4M78 G;  4OMP A;  1UB4 A;  2CZ7 B;  3C95 A;  2P4R A;  1M3C A;  1A0N B;  1YWP A;  2DM1 A;  2GCX A;  2QA4 A;  3VS6 A;  4OP0 A;  1HD3 A;  2K9G A;  2SRC A;  3C12 A;  1AD5 A;  4AG2 C;  4LDW A;  4AFU C;  4M77 E;  3QZ5 B;  3A8L B;  1YP5 A;  3EAE A;  1G2B A;  1JEG A;  1IGU A;  2MK5 A;  1NEB A;  4RG8 A;  3PVQ A;  4J9G A;  3JAM E;  2BZX A;  2QTV A;  1NE8 A;  3OYL A;  2DXC A;  1QKX A;  4M7A A;  3OYA A;  4NL3 A;  2E10 A;  4NOY A;  2FYK A;  2VGN A;  3M53 A;  2DIL A;  1VQP T;  3JB9 J;  5CK9 A;  4ZTF A;  3H41 A;  1S72 Q;  4PJO B;  2R58 A;  4XTX A;  3PVL A;  4JJB A;  2LJ3 A;  1W70 A;  1D09 B;  1KK7 A;  2CH4 A;  2LQ8 A;  4R0K A;  3CME A;  1RAG B;  2H3J A;  4FCY A;  4LDV A;  4IUV A;  2CUD A;  1WHL A;  1I07 A;  3N5B B;  1D0X A;  1KHC A;  4XTW A;  2CP0 A;  4DOV A;  1IB8 A;  3OBY A;  4EDU A;  4J7I A;  3URG A;  1VYU A;  4OB2 B;  2PUK B;  5LJ3 h;  2D8H A;  1QVG P;  1OEB A;  1G3S A;  1YFN A;  3SEM A;  3UF4 A;  4M7D A;  1M9S A;  3VS2 A;  2DYB A;  4VUB A;  4Y92 A;  3G4S Q;  1PRM C;  2O31 A;  4KUL A;  1RUW A;  1YJN Q;  5KYX A;  2CT3 A;  1QP2 A;  2G3R A;  4C92 E;  2RI3 A;  3A1P A;  4CC4 B;  3P8B B;  3OW2 A;  2A37 A;  2COZ A;  1KSW A;  2EBP A;  2MCN A;  1RAI B;  4J9I A;  2VXE A;  4M75 A;  1RAA B;  2XID A;  2HBW A;  1B07 A;  3NGP A;  3CCR Q;  3OYK A;  2FRY A;  4QW2 A;  1VQ9 A;  1MNE A;  1G5V A;  4JZ4 A;  1AEY A;  4E7J A;  4HCC A;  1DJ7 B;  3SD4 A;  3EG2 A;  3RBB B;  2CRE A;  4WF2 A;  1WHH A;  1H3Z A;  2OX7 A;  4RTU A;  4FYX B;  3RNJ A;  3NPF A;  2BIV A;  2RA2 A;  1IXD A;  3QYG B;  5GAM j;  4E7Z A;  2EKO A;  3UA7 A;  2IPO B;  3UWN A;  1WXB A;  2E6N A;  1N8R R;  3QJ6 A;  1ZSG A;  2YWW A;  2QAZ A;  4M7A E;  1VQO Q;  3ZEH A;  2KT1 A;  5FRO A;  3I56 A;  3CCV A;  1FYN A;  2EQU A;  4LD9 K;  1TTH B;  1NLP C;  4DBF A;  1XTD A;  2V8J A;  3TSW A;  5I11 A;  2ECZ A;  1QCF A;  2O4X A;  3CD6 Q;  3CMA Q;  5A0D A;  2DO3 A;  2WSC E;  1VQM Q;  4BE0 A;  3R6N A;  1B3Q A;  1NEG A;  4M78 A;  2J6O A;  2YDL A;  1V29 B;  5GMK h;  1UGV A;  2OAW A;  3OBW A;  2Z0W A;  1K9M R;  4ME7 A;  4CC2 A;  1NBE B;  4E7S A;  1VQ4 Q;  3CCQ A;  3G6E Q;  2D0N A;  3SWN C;  2ZCF B;  3OYF A;  2ROL A;  2PU9 B;  1GCQ C;  5KYY A;  1JBM A;  3BFM A;  2DIQ A;  9ATC B;  2KY9 A;  2YT6 A;  2AKK A;  4JRQ A;  1JJ2 A;  2QA4 Q;  2LJ0 A;  4C0F A;  1VIF A;  5LJ5 j;  1VQ6 Q;  2BUD A;  4XAX B;  1TS9 A;  3KFV A;  2F5T X;  1OOT A;  4J83 A;  5CQX A;  1AZE A;  3TCJ A;  2ED1 A;  3QO3 A;  1YWO A;  4C5I A;  2DBK A;  1X43 A;  3CXC S;  2K2M A;  4EPC A;  2CZ1 B;  1Y07 A;  2LCC A;  1YJ9 Q;  1J3T A;  2LZ6 B;  3FJP A;  5CKF A;  4E7L A;  2CGH A;  4J9D A;  2FRW A;  2P0K A;  4Z8A A;  2KQW A;  2ZPE B;  3DLM A;  1VOM A;  5D7U A;  4JDS A;  3A98 A;  1W2B S;  1AOJ A;  3A8G B;  1YCY A;  2DTI A;  2FL7 A;  3CME Q;  4DBQ A;  1IHV A;  2HKQ B;  5GAN e;  1GXI E;  1N9S A;  2KRS A;  1JU5 C;  2CH4 W;  2XMF A;  1D1C A;  3JCM b;  4FU6 A;  3OY9 A;  4DEX A;  5KYN A;  2FG0 A;  4HCZ A;  1BIA A;  3GBQ A;  4RTW A;  2NUZ A;  4LUE A;  1M30 A;  1VQP A;  4EMK B;  4X9C A;  3NTI A;  5GAN d;  1VQ8 Q;  2KGT A;  2FVU A;  2MMP A;  4BD3 A;  3G71 Q;  2FPD A;  1WYX A;  2EYY A;  2F1L A;  2NUT A;  6AT1 B;  3SWN A;  1GRI A;  3CC7 A;  1K8A U;  3UA6 A;  1HYO A;  1UEC A;  3FIF A;  2EJG A;  2HZY A;  1RAH B;  2BKD N;  4XU0 A;  3CC4 A;  2A3L A;  1I81 A;  1M1G A;  5EG2 A;  4M78 E;  1AT1 B;  2BZY A;  2E6Z A;  4JRK A;  4HVV A;  2PVG B;  4RUG A;  2LNV A;  1VQ9 Q;  2V26 A;  3CCL A;  3QPH A;  2HAX A;  1Q86 R;  4MZT A;  1OYX A;  2LT4 A;  2ZPI B;  3L2Z A;  4C0D B;  4FYW B;  1Q81 U;  3P8H A;  4TVR A;  2K3Y A;  3CXC A;  2K79 A;  4XU3 A;  1Q82 C;  3A8M B;  1U06 A;  4ZN3 A;  4C5E A;  2XD0 A;  1MV0 B;  2I2L A;  2RMO A;  2JMC A;  1TUG B;  2NUP B;  1B7T A;  2HL3 A;  1MND A;  1SEM A;  2DRK A;  2KK4 A;  2XHC A;  1KQS A;  1W2B A;  2HQE A;  4PNO A;  5FU7 B;  2A0F B;  2EYX A;  2Y4Y A;  3HRU A;  3FDR A;  2V1Q A;  2VB6 A;  2LDM A;  2X3W D;  2RI5 A;  1AWO A;  1UUE A;  1N9R A;  2E64 A;  2F2X A;  3VKI A;  2DXB A;  1QVF P;  4XTY A;  1H92 A;  1KD1 C;  3CBO A;  3QXE B;  1HK9 A;  2JW4 A;  5GMK l;  3REB B;  5FW9 A;  3LH5 A;  3VS7 A;  2FB7 A;  4GLM A;  3BY7 A;  2XIC A;  2NLU A;  4DQ2 A;  1QW1 A;  4UC4 A;  3M4G A;  2J7I A;  2LRQ A;  2F2W A;  3R6O A;  3THK A;  3HFN A;  4FYV B;  2JTM A;  5I2M A;  2RO0 A;  3EFO A;  4J5Y A;  1M2O A;  3VS1 A;  4N0A A;  3EFS A;  4R56 A;  3OYE A;  1K73 R;  2FEI A;  3M0S A;  1WNL A;  3X28 B;  1I0C A;  1NLO C;  4PJM A;  3EHR A;  3OS2 A;  2M0O A;  1JXM A;  4J7F A;  1AWX A;  2O01 E;  4XTV A;  4XU2 A;  2QQS A;  2GNC A;  3PIO A;  1OX8 A;  3JCM W;  1BKB A;  3MKD A;  1X2Q A;  2D6F A;  3RKY A;  4L59 A;  4LD6 A;  3EG1 A;  1N6A A;  2L3Q A;  2YUP A;  3S3O A;  1X6O A;  2L8D A;  2RHI A;  2AZV A;  2OTL A;  5KYW B;  3JRZ A;  3I35 A;  4MML A;  3SFM A;  1BIB A;  2YRD A;  4C8Q D;  5KH6 A;  1R8O B;  1JO8 A;  4E7H A;  3RES A;  4M77 A; 
#chains in the Genus database with same CATH homology
 1UG1 A;  2LX7 A;  2CSI A;  4ZNX A;  4WCI A;  3VS0 A;  1QKX A;  2GBQ A;  2ESW A;  4JJD A;  3SHW A;  1AVZ C;  1YN8 A;  1UFF A;  1PRL C;  2DIL A;  2KRN A;  1OPK A;  1ZBJ A;  4AFZ C;  1ZLM A;  3O5Z A;  4RTT A;  1KIK A;  2D8J A;  3NHN A;  3H41 A;  1CKB A;  3PVL A;  4JJB A;  2LJ3 A;  1W70 A;  3JV3 A;  1NYG A;  2RQT A;  3I9Q A;  4R0K A;  2CH4 A;  1GFC A;  2M0Y A;  4ESR A;  1X2K A;  1H3H A;  2KXD A;  2CUD A;  1I07 A;  1UTI A;  2VWF A;  1W1F A;  2DA9 A;  1VYU A;  1UDL A;  2VVK A;  3M0U A;  2EGC A;  4RTZ A;  2D8H A;  1OEB A;  1WDX A;  1Z9Q A;  1UE9 A;  3EHQ A;  2MIO A;  3SEM A;  4J9E A;  1MV3 A;  3UF4 A;  3VS2 A;  2DYB A;  1HSQ A;  4Y92 A;  2VKN A;  1PRM C;  2O31 A;  1RUW A;  2CT3 A;  4CC7 A;  3IQL A;  2X3X D;  4A63 B;  2RPN A;  2CUB A;  2O2O A;  2EGE A;  2KRO A;  2J06 A;  4CC4 B;  5IH2 A;  2D1X A;  4EIK A;  2A37 A;  2HEQ A;  2YSQ A;  5GJW B;  1KSW A;  2DRM A;  2EBP A;  2MCN A;  5EC7 A;  1ZX6 A;  1QKW A;  1T3S A;  1ZUY A;  2DMO A;  1AWJ A;  1CSK A;  2F2V A;  2OI3 A;  4J9I A;  3M0T A;  2HBW A;  1PKT A;  1X69 A;  1RI9 A;  1B07 A;  3H0I A;  3NGP A;  3EGU A;  2EW3 A;  2GGR A;  2FRY A;  2YUQ A;  1AWW A;  3REA B;  1WX6 A;  4HCK A;  4JZ4 A;  1AEY A;  1YCS B;  2IIM A;  1OV3 A;  1LCK A;  3EG2 A;  3RBB B;  2CRE A;  4LNP A;  4RTU A;  2AK5 A;  3RNJ A;  3NPF A;  2LQW A;  1M8M A;  2LQN A;  2DX1 A;  4JJC A;  2KR3 A;  3I5R A;  1K0X A;  1WXU A;  1QWE A;  5FWB A;  4HVW A;  2MOX A;  1VYV A;  2EGA A;  2K7A A;  4OMO A;  1WI7 A;  4FSS A;  3UA7 A;  5ECA A;  1U3O A;  1T0J A;  1EFN A;  2DBM A;  1WXB A;  5IHN A;  5I22 A;  1NYF A;  1GFD A;  1JQQ A;  1ZSG A;  2EYW A;  1HJD A;  2YUN A;  2CDT A;  1U5S A;  1CKA A;  1WIE A;  2JMA A;  4KRT A;  2KT1 A;  1GCP A;  4OMM A;  3EG3 A;  3QWX X;  2NWM A;  4CC3 A;  1FYN A;  1QWF A;  3I5S A;  4D8D A;  1WLP B;  2EKH A;  1NLP C;  1VA7 A;  2DL5 A;  3TSW A;  2DL8 A;  5I11 A;  2JM9 A;  2ECZ A;  2A28 A;  2V1R A;  4AFQ C;  1QCF A;  4E6R A;  4JPB W;  1FMK A;  4J9F A;  4F14 A;  1SHG A;  4AFS C;  3R6N A;  1B3Q A;  1NEG A;  1UJ0 A;  4JZ3 A;  2J6O A;  1AZG B;  2YDL A;  1UGV A;  2OAW A;  1ZUK A;  2G6F X;  2KXC A;  4IIO A;  1G83 A;  4CC2 A;  3M0R A;  1I1J A;  2HDA A;  1GBQ A;  2D0N A;  2HCK A;  2ROL A;  2W10 A;  1GCQ C;  2LMJ A;  2YT6 A;  2AKK A;  2CT4 A;  1WA7 A;  2KNB B;  2GQI A;  2LJ0 A;  2GTJ A;  1GL5 A;  1GBR A;  2DJQ A;  3TSZ A;  2L3S A;  1JXO A;  2A08 A;  3TVT A;  1K76 A;  3KFV A;  3H0F A;  4D8K A;  1OOT A;  1AZE A;  1SHF A;  4F16 A;  2ED1 A;  1SRL A;  4ORZ A;  2BZ8 A;  1YWO A;  1T0H A;  4K11 A;  2EPD A;  2DBK A;  1X43 A;  2RF0 A;  1W6X A;  2K2M A;  1NM7 A;  4OMN A;  1J3T A;  1PWT A;  1PNJ A;  2LZ6 B;  4J9D A;  2FRW A;  4Z8A A;  1K0S A;  2GTO A;  3EG0 A;  1S1N A;  1H8K A;  1ABO A;  1TUC A;  2RQW A;  3A98 A;  1AOJ A;  2DLP A;  1K9A A;  1X27 A;  1KFZ A;  2SEM A;  2DE0 X;  2HSP A;  3M0P A;  1TUD A;  2KRS A;  5IHK A;  1JU5 C;  2DVJ A;  2OJ2 A;  2CH4 W;  3M0Q A;  2KT8 A;  2J05 A;  2KRM A;  1Y0M A;  4OMQ A;  2KEA A;  2M51 A;  2PNI A;  2XMF A;  2RNA A;  2KBT A;  2K6D A;  1ABQ A;  2ENM A;  2ROT A;  4DEX A;  2DF6 A;  2FG0 A;  2LP5 A;  3GBQ A;  4RTW A;  2NUZ A;  1RLQ C;  4LUE A;  1M30 A;  1X6B A;  2B86 A;  1BK2 A;  2DNU A;  1N5Z A;  2KGT A;  2FPD A;  1WYX A;  2EYY A;  1GRI A;  5FWC A;  3UA6 A;  3VS4 A;  4J9H A;  1UEC A;  1K4U S;  4LN2 A;  2AKL A;  1PHT A;  4RTY A;  1E6G A;  2BZY A;  4HVU A;  4HVV A;  5IXB A;  1MUZ A;  4J9C A;  4RUG A;  2RQU A;  5IHI A;  2O9S A;  2L3P A;  4IIM A;  3QWY A;  4LUD A;  1M3B A;  2RQV A;  2KE9 A;  1QLY A;  2J6F A;  3ULR B;  2K79 A;  4RTX A;  1UHC A;  2EQI A;  1IO6 A;  3CQT A;  1U06 A;  4HXJ A;  3VRZ A;  1ARK A;  4QT7 A;  2FPE A;  1MV0 B;  2W0Z A;  4GBQ A;  3ZL7 C;  2O88 A;  2CSQ A;  2ABL A;  2RMO A;  2JMC A;  2RQR A;  3H0H A;  3NMZ C;  3VRY A;  2LJ1 A;  2I0N A;  1SEM A;  2DRK A;  1Z9Z A;  2K3B A;  2BTT A;  5IXF A;  2EYX A;  1OPL A;  2FPF A;  2V1Q A;  2DL7 A;  1M3A A;  1ZUU A;  2X3W D;  4LE9 A;  4AG1 C;  1AWO A;  1UUE A;  2DL4 A;  2J6K A;  2KYB A;  2F2X A;  2A36 A;  3U23 A;  1H92 A;  2L2P A;  2ED0 A;  2L0A A;  1Y57 A;  2PZ1 A;  2C0I A;  5HCK A;  2JW4 A;  3REB B;  1M27 C;  1BBZ A;  1K1Z A;  5FW9 A;  3LH5 A;  3VS7 A;  2C0O A;  4GLM A;  2JS2 A;  2KYM A;  4F17 A;  2DL3 A;  1VYT A;  2AZS A;  3VS3 A;  1KJW A;  1WXT A;  3C0C A;  3PE0 A;  4X1V A;  2J7I A;  1UJY A;  2F2W A;  2JS0 A;  3THK A;  2LNH B;  2YUO A;  1BU1 A;  3FJ5 A;  1YNZ A;  1E6H A;  3VS1 A;  2PTK A;  1UHF A;  2FEI A;  3M0S A;  4DEY A;  1I0C A;  1NLO C;  2RN8 A;  1V1C A;  4M4Z A;  3EHR A;  1E7O A;  2C0T A;  5GJV B;  2FO0 A;  3VS5 A;  2JXB A;  2H8H A;  1JXM A;  1PKS A;  1AWX A;  2QDL A;  2O9V A;  2EYZ A;  1XOV A;  2LCS A;  2EVR A;  4RTV A;  4Z88 A;  4OMP A;  1X6G A;  2GNC A;  2JM8 A;  1T3L A;  1RLP C;  4OML A;  1BB9 A;  1X2Q A;  5L23 A;  2P4R A;  1SPK A;  1M3C A;  1A0N B;  1YWP A;  4J9B A;  3EG1 A;  1SSH A;  2DM1 A;  2L3Q A;  2YUP A;  1GCQ A;  3VS6 A;  1HD3 A;  2K9G A;  2E5K A;  1SRM A;  2SRC A;  2AZV A;  1TG0 A;  1AD5 A;  4Z89 A;  4AG2 C;  3I35 A;  4AFU C;  1WFW A;  1YP5 A;  1G2B A;  1JEG A;  1NG2 A;  2JTE A;  1NEB A;  1JO8 A;  2JT4 A;  3PVQ A;  4J9G A;  3UAT A;  2BZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...