2LJ3A

Pfbd: high-throughput strategy of backbone fold determination for small well-folded proteins in less than a day
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PFBD: High-throughput Strategy of Backbone fold Determination for small well-folded proteins in less than a day
rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Spectrin alpha chain, brain
total genus 3
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lj3A00
1U06A 1AZGB 2J06A 2J05A 2L3SA 4AFUC 4AFQC 3QWYA 1K9AA 2CT4A 2NWMA 4AG2C 2AZSA 1H3HA 3I5RA 2JMAA 2EGEA 3VRYA 2HCKA 2RQVA 1AZEA 2CT3A 2RMOA 1W6XA 1BBZA 4JJCA 2FRYA 2ROLA 4RTWA 5GJVB 4LUDA 2JM9A 2LNHB 1AVZC 2ENMA 4LUEA 1GL5A 2CUBA 2L3QA 2AKLA 2XMFA 3SHWA 3TSWA 1SEMA 3H0IA 2JS0A 2RF0A 4RTUA 2EYWA 1NM7A 2DILA 4J9IA 1Y0MA 3M0QA 1GCPA 5IHKA 1CKBA 1NYFA 2O9VA 1U3OA 1NEBA 1KJWA 2LP5A 2M51A 3EG1A 2FEIA 1GBRA 2DRKA 2AZVA 1EFNA 2EQIA 1A0NB 4HVVA 1WXTA 2YDLA 1VYVA 1QKWA 2ED1A 1RLQC 4CC4B 2LCSA 3VS3A 4DEXA 3LH5A 2K79A 3H41A 4LNPA 3VS0A 2HSPA 1ZUUA 2LJ1A 2X3XD 1M30A 1GCQA 1UECA 4RTYA 1G2BA 3M0UA 2KE9A 1UJ0A 2CDTA 2P4RA 1YNZA 1VYUA 2ESWA 1M3AA 1PRLC 2GNCA 3UA7A 2D8JA 2W10A 2BZ8A 2KYMA 3M0SA 1K1ZA 1MV3A 3REAB 1KIKA 1T0HA 1AWJA 3M0PA 4LE9A 2J6OA 2LZ6B 1ZBJA 4JZ4A 2CH4A 2GBQA 3UA6A 1MV0B 2JTEA 3FJ5A 2DJQA 3EHRA 2DMOA 2HBWA 1PKSA 4ZNXA 4Z88A 1QWFA 2KEAA 1AD5A 4HCKA 3UATA 1UE9A 1M27C 1HSQA 1OEBA 5IHIA 1CKAA 2CUDA 2MOXA 1UUEA 1OPKA 1U5SA 2YT6A 4ESRA 2M0YA 4LN2A 5I22A 2L0AA 4J9DA 2K9GA 2KXDA 1PRMC 1UJYA 2GGRA 2F2VA 4OMLA 2C0TA 1E6GA 2YUOA 2K7AA 3VS1A 1T3SA 2DX1A 2D8HA 1JXOA 3EG2A 1RUWA 2DL7A 1WXBA 1BU1A 5IH2A 1WYXA 3EG3A 3JV3A 3O5ZA 5ECAA 1V1CA 1GFCA 1RI9A 2J6KA 1WDXA 4CC3A 2OI3A 4RTTA 1I0CA 2YUQA 1X2KA 1I07A 3KFVA 1T3LA 2BZXA 3EHQA 3NHNA 1QCFA 4AFZC 2C0OA 2LJ0A 2KR3A 1ARKA 2V1RA 5HCKA 2KT8A 1J3TA 2PZ1A 3M0TA 1UHCA 5EC7A 4J9EA 1WXUA 2VWFA 2KBTA 1KFZA 4K11A 1BK2A 2EPDA 2L3PA 1TUDA 1NLPC 4J9BA 4D8DA 1JU5C 4KRTA 2HDAA 2A37A 2DL8A 2RPNA 2KYBA 2EVRA 5IXFA 3RNJA 5IHNA 1FYNA 4F17A 2FPFA 4JJDA 2JS2A 4HVUA 4RUGA 2EGAA 2JT4A 2LQWA 1Z9QA 1M8MA 1PNJA 2DL3A 2DA9A 5IXBA 2EW3A 2MCNA 4RTXA 1YCSB 1OV3A 2J6FA 3NGPA 2DNUA 2AK5A 1GBQA 2PNIA 2VVKA 1SRLA 1OPLA 1MUZA 2YUNA 1VA7A 1X69A 4WCIA 2EYYA 1ZUKA 2DL4A 2E5KA 4M4ZA 3SEMA 1E7OA 3TVTA 2RN8A 3I9QA 2RQUA 2LX7A 1X6BA 2KRSA 2BZYA 1X43A 2O9SA 4ORZA 3EG0A 2KGTA 3ZL7C 3I5SA 2W0ZA 1QWEA 3REBB 1UGVA 2EBPA 3VS2A 4DEYA 2KT1A 1W1FA 1ZUYA 2JMCA 3RBBB 3GBQA 1Z9ZA 4JJBA 1AWOA 2IIMA 4AG1C 1ABOA 1HJDA 1B07A 1CSKA 2VKNA 4OMOA 2KNBB 2KRMA 1YP5A 4E6RA 2RQRA 1K0XA 5GJWB 2CH4W 2C0IA 2SRCA 1VYTA 2D0NA 4R0KA 2DM1A 2ROTA 2EKHA 2O88A 1UHFA 2FPEA 3CQTA 4OMPA 4HVWA 1K76A 2A08A 3ULRB 2K6DA 5FWCA 1YN8A 4JPBW 1TUCA 1WA7A 4RTZA 1GFDA 4OMNA 2FPDA 1W70A 1YWPA 4J9FA 2A36A 3VS6A 1X2QA 2KROA 2KXCA 2DF6A 4J9CA 1ZX6A 1N5ZA 2DE0X 4GLMA 3EGUA 1ZLMA 1ZSGA 2JW4A 2O2OA 1T0JA 1NLOC 1AOJA 2DBKA 2RQTA 2DYBA 5I11A 2X3WD 4JZ3A 5L23A 5FWBA 1SSHA 1NEGA 1K0SA 2QDLA 4EIKA 2B86A 1GCQC 5FW9A 1LCKA 3VS5A 2RQWA 2LMJA 1KSWA 1TG0A 1Y57A 2H8HA 4Z89A 2ECZA 2AKKA 3IQLA 4RTVA 1OOTA 1QLYA 3QWXX 1AWWA 2GTOA 4Z8AA 1WI7A 1WLPB 2I0NA 1SRMA 3U23A 4HXJA 3VS7A 3THKA 1G83A 3H0FA 2NUZA 1PKTA 1M3CA 2GQIA 2JM8A 2MIOA 2YUPA 1SHFA 2D1XA 4IIOA 3A98A 4OMMA 3PVLA 4GBQA 2CSQA 2HEQA 1AEYA 1FMKA 4D8KA 1I1JA 4A63B 1NG2A 2L2PA 4J9HA 4AFSC 2DRMA 2DVJA 2PTKA 1UFFA 4FSSA 3PVQA 1BB9A 1H8KA 3M0RA 1JEGA 3PE0A 3NMZC 2OAWA 1B3QA 4CC7A 4IIMA 2RNAA 4QT7A 1RLPC 2CREA 2V1QA 1K4US 1WIEA 2FRWA 1NYGA 1S1NA 1UG1A 3TSZA 3VRZA 2EYXA 2FG0A 1M3BA 4X1VA 3VS4A 2DL5A 1YWOA 2SEMA 1ABQA 2CSIA 2DLPA 2LQNA 2K3BA 3UF4A 1X27A 1X6GA 1H92A 3NPFA 2K2MA 1XOVA 4F16A 2KRNA 2F2WA 1AWXA 3H0HA 2G6FX 1IO6A 2EYZA 1WFWA 1JXMA 2ABLA 3I35A 4OMQA 1SHGA 1JQQA 2O31A 1WX6A 2JXBA 4F14A 1UDLA 3R6NA 2DBMA 2ED0A 2OJ2A 1E6HA 1JO8A 1QKXA 2EGCA 1PWTA 2BTTA 1SPKA 2YSQA 2FO0A 2J7IA 4Y92A 4J9GA 2LJ3A 2GTJA 1HD3A 2F2XA 1GRIA 4CC2A 1PHTA 1UTIA 2A28A 3C0CA
chains in the Genus database with same CATH superfamily
1AZGB 3JCMc 1QVGA 3JCMP 1UEBA 3EFOB 2PVOB 3S3NA 2CYZB 4KBMB 1K8AU 1KD1U 1K9AA 2CT4A 2NWMA 3HFNA 2VGMA 3URGA 7AT1B 1X01A 3VRYA 1JRIA 1AZEA 1S72T 4ZTFA 2K3XA 2ROLA 4F7UE 2E65A 1WJSA 1NJIR 1D09B 1GL5A 2CS7A 4C92C 2AKLA 4M77F 2E70A 3QHSA 1BIAA 1QVFP 1SEMA 4N0AA 1NJIU 4O5VA 4ANJA 4RTUA 2OTJT 4J6XA 4BE1A 5KCOA 1NM7A 5CAIA 4J9IA 1W4SA 2RHUA 1PSFA 2K5LA 5IHKA 4DA4A 1NYFA 1U3OA 1TWBA 1KJWA 1NEBA 3HRTA 4M75F 2V8JA 1SSFA 4FYWB 2P0KA 4PJOC 5LJ5f 4BUGA 2K2VA 5D6WA 2OTJA 4C92A 3CC2A 4XK8E 3OW2P 4HCCA 1RLQC 4CC4B 3LH5A 2K79A 3BW1A 3G4SA 1M30A 2QYZA 4LD6A 4JRIA 1UJ0A 3EGXA 2ESWA 1VQ8Q 1PRLC 3CCMA 1WNLA 5KYUB 1H3ZA 3QSUA 1KQSP 2A3LA 4M75C 1YJ9Q 2XDPA 1K1ZA 3REAB 1C1AA 4LE9A 2J6OA 2RJCA 4JZ4A 2VB6A 3JCMf 2CH4A 1QCNA 5FU7B 2LVMA 4M7AC 3M58A 4J8OA 2VXEA 3TCJA 3FJ5A 4C92E 2MPXC 2DJQA 3CC4A 4HKEA 4ZNXA 1AD5A 2RM4A 2EQJA 3E1SA 4BB7A 3HPWA 1HSQA 5KYYA 1RAAB 4J5YA 2XICA 1MMNA 3V7RA 1CKAA 3C95A 1IREB 4EMHA 2HQXA 2AT1B 4R56A 1OPKA 1YITQ 4PJJA 5DM7R 4ME7A 4C8QF 2KXDA 2QXFA 1UJYA 2GGRA 3OYMA 4OMLA 2LQKA 2C0TA 5IN1A 3VS1A 4OVAA 1VQLQ 1RUWA 1WXBA 1WYXA 4N4HA 3JV3A 3HHTB 5ECAA 3M59A 1RI9A 3CCST 4B9XA 4PLIA 3CPWS 4CC3A 2O01E 2OI3A 4KUDK 2O4XA 3LWIA 4HT9A 2EFIA 4ZGJB 4M78D 1OI1A 1HYOA 1IB8A 4C8QB 3RMQA 1V76A 3V7SA 5CIUA 2BE7D 3OYDA 2JTMA 4LXCA 2L5QA 2KT8A 3V8JA 1UHCA 3PIOA 2KBTA 1BK2A 2L3PA 1NLPC 4JS4A 3VKIA 4IUQA 4P5NA 1M1GA 2DL8A 2RPNA 2KYBA 5I2SA 1FYNA 3TREA 2XU8A 4RUGA 4C0GA 5J26A 3E9FA 2JT4A 2ZPEB 4E7ZA 4BE2A 1Z9QA 1M8MA 1PNJA 2VC8A 5CR2A 2VASA 2EW3A 2DKGA 3GNFB 4RTXA 4Q5WA 2PNIA 1YIJT 5AYFA 2YUNA 2PQWA 3SEMA 2EYYA 3TVTA 5GMKm 5IT9E 1WHGA 4PJOG 3OYCA 1M90R 1X43A 2O9SA 1PD1A 3CMEA 1YHQQ 3M54A 1M90C 1QWEA 4QQDA 5KYXA 4C8QA 2QI2A 2R58A 2FB7A 3RR6A 5GAMf 1W1FA 2JMCA 3GBQA 1Z9ZA 5A0LA 4JJBA 5CQXA 3VYHB 3PT9A 2JTFA 4AG1C 2RB6A 3GPLA 2ZPHB 4C0ZA 3OBYA 4LDUA 1CSKA 3MP6A 3A8LB 3MP8A 2P0PA 3VUZA 2JJ9A 4HCBA 1VYTA 4OGCA 4PJOA 3AHUA 4JJNK 2QEXA 3A5ZB 5GAN4 3CCJT 2A08A 3CXCA 2XK0A 1KHIA 1VQ5T 3OS1A 4BY6C 1QVFS 4ATOA 2GFAA 4OMNA 1W70A 1YWPA 4AT1B 2P0QA 5HK0A 1W2BS 2JUFA 3VS6A 2KXCA 2KROA 4L5GA 1N5ZA 3LW5E 2RK1A 2JW4A 1T0JA 3JB9I 1OX8A 4PFOA 5I11A 4OF1A 2DTIA 1O75A 5FWBA 2E10A 5AT1B 3HSBA 3EFOA 1TXQA 2O4XB 3KBGA 2B86A 5FW9A 1VQ9T 2MK5A 1Q81R 2YLBA 2RQWA 3CCRT 1KSWA 1TG0A 4OB3B 4M78A 3M56A 1YITT 3BDLA 4Z8AA 1WLPB 2QA4Q 3U23A 5KYNA 4PJOB 2KAFA 3THKA 4KH1B 4X34A 1I5OB 4DQ2A 1QQJA 2MIOA 1XJWB 2EJGA 3S3MA 3J7AF 1VQ4T 3PVLA 3G71Q 5L8RE 2LT1A 4A63B 3AT1B 4J9HA 2DRMA 1PM3A 3JAME 4IUUA 1UFFA 3SD4A 3INZA 1EIFA 4DBHA 2HKQB 1RI0A 1H8KA 3M0RA 5CK9A 2DJZA 5KYWB 3MHXA 1YJ9T 2QA4T 1N8RR 4F04B 4XTWA 2RNAA 4PJOF 4LDYA 2V1QA 1ZSZB 3I55T 1RL2A 1NYGA 1M4ZA 1S1NA 2ZPFB 1I8FA 3VRZA 4A4HA 1N9SA 2EYXA 3MJXA 1YWOA 1SF9A 2SEMA 1KQSS 5GAOm 1F1BB 1K8AR 5GMKi 1KD1R 2LQNA 3UF4A 3H9NA 3NPFA 3D7SB 3ZFJA 5KYUA 4F16A 2F2WA 3FJPA 2G6FX 2BIVA 4BACA 2RJEA 4PNOA 3CC7T 2XI9A 4OMQA 2DBMA 3LLRA 4FW2A 1JO8A 1PWTA 4AMCA 1NPPA 4KGXB 2J7IA 2LX9A 2R57A 2RI5A 3BDUA 2EAYA 2NUTB 3EGXB 1NE8A 2GTJA 2GQVA 1BI2A 2E64A 3EH1A 2F2XA 4KUIA 3RDVA 3OYGA 2RK2A 2EWNA 1PG5B 1M2VA 3QPHA 2DYIA 2X51A 4C92G 5GMKl 1XTDA 2GFUA 2VXFA 2P4TA 2LRQA 1UGPB 2L3SA 4AFUC 4E7IA 2X4WA 2CP2A 3PNWC 3V7CA 1BKBA 2VUBA 4AG2C 4ZN1A 4C8QC 3WVDB 3CCUQ 2EGEA 3G1JA 1MNDA 2HCKA 5DLQE 3Q1JA 5FROA 2BKDN 1BBZA 4JJCA 1VQ6A 2FRYA 4RTWA 1LNXA 5CKHA 4LUDA 2JM9A 3OSVA 1M2OA 2K4YA 2ENMA 2CUBA 2L3QA 3CCRA 4FYXB 1Q7YR 2XMFA 3SWNC 2DETA 2A7YA 1RAEB 3SHWA 3MEUA 1YJNQ 2YLCA 3CCUA 2DEUA 2ZZDA 2M1HA 5LJ3g 4PL6A 1D3BA 3TU4K 2QA4A 1PD0A 3X24B 1QVGS 2KQWA 2LCLA 2HAXA 5KCHA 2G3RA 2LP5A 2O9VA 4C0DC 4EPCA 2FEIA 2PU9B 2RHYA 2AZVA 4CI0C 2EQIA 4IURA 3WVEB 3JCMg 4HVVA 2EQKA 4PJMA 2LCCA 1VYVA 1VQ4A 1QKWA 2DD5A 3LGFA 3HKSA 1JB0E 2QTVA 2CP7A 4FCYA 2LCSA 4DEXA 2X9HA 2RD1A 3H41A 4LNPA 1YJWA 3VS0A 3QJ6A 2HSPA 3CCUT 2LJ1A 5J39A 3M55A 4M7AG 1N27A 2MAMA 1G2BA 2KE9A 2P4RA 2LQ8A 1BI3A 1GXIE 2W10A 3SWNB 3CC4T 1JJ2P 2KYMA 3RKXA 4C8QE 1K9MU 3PFSA 3LGLA 1T0HA 1WHLA 3M0PA 3CCQQ 2LZ6B 1ZBJA 1R0BG 3UWNA 1IHWA 5FRMA 4IUPA 2XKOC 5M9OA 4PFPA 2D6FA 2DTHA 3EHRA 3FEOA 2PVDB 2HL5C 4C8QD 1QWFA 2KEAA 3SB2A 4M77C 1D0YA 3CD6T 3ME9A 3ASKA 1FWZA 2PUKB 1WPYA 1U5SA 2YT6A 3MO8A 4LN2A 4ESRA 3OS2A 2MWPA 5I22A 1OU9A 2L0AA 1IZ6A 4J9DA 2OX7A 3X26B 2QQAA 1VQ5Q 3L2WA 3ZEHA 2DZCA 2K7AA 5FU6B 4JRQA 3DKMA 3NTIA 3EG2A 1VQ5A 4F7UA 3CCQT 3R6OA 2E1HA 3BFMA 4M75D 1O9SA 2J6KA 1K9MR 2Y4YA 1N8RU 2EJFA 4IUVA 1I07A 2CP3A 3KFVA 4II1A 4X9DA 1S72Q 2VV5A 1M8VA 1M9SA 1VQ8A 3CBMA 2LJ0A 3OYHA 1ARKA 5HCKA 4IUTA 3HFOA 3CMAA 3CCLA 5LJ3f 2CZ0B 5EC7A 1WXUA 1B34B 5GAN6 5CKEA 1ZA2B 4WTOB 3FC3A 3CMET 1RACB 1JU5C 4HT8A 4C5HA 4BI4A 2A37A 2EVRA 5IXFA 2KDSA 4BI3A 2HSEB 3VJPA 3KUFA 2LQWA 1M1KC 1VQ7Q 2DL3A 2DA9A 1IXDA 5I21A 4L6V5 2PUOB 3OB9A 3NGPA 2MF2A 4JLGA 4CRIA 2DFUA 1SRLA 1OPLA 1X69A 2RN8A 2CKKA 4RG8A 3OBWA 4M7DB 2KMTA 4ORZA 3EG0A 2KGTA 5LJ3h 3I5SA 2CZ7B 2LT4A 1TS9A 4M77A 2EBPA 4DEYA 2KT1A 5A2QE 4XU0A 4LDWA 1AWOA 3DB4A 1ABOA 3OS0A 2VKNA 3G7ZA 4XTUA 4TVRA 2KNBB 2KRMA 1YP5A 2RQRA 1K0XA 2CH4W 2RH2A 3JCMe 1AHJB 1LPLA 3M5AA 4M75A 4C92F 2FPEA 1NPRA 1HXDA 3CQTA 4M77E 2EIFA 1VQLT 4FL6A 3QUIA 1TTHB 2HL3A 3I56T 1VQ7T 1R77A 2ATCB 4JPBW 1TUCA 1WA7A 1YFNA 2NYSA 1VQPA 1X2QA 2DO3A 3G4SQ 1ZLMA 5GAMj 2RHXA 4M77D 3EGDB 2QGFB 1NLOC 2QK0A 4A53A 2DYBA 3QBYA 2X3WD 4JZ3A 4EDUA 5L23A 1QMCA 1VQMT 2DERA 4M78C 3NTKA 5FLXE 2QDLA 3GLXA 4YTLA 1LCKA 3VS5A 3NTHA 3I55Q 1EX4A 1Y57A 2H8HA 4Z89A 1YJWQ 2AKKA 2KI7A 3M4GA 4XU2A 1QLYA 2HD0A 1VQ7A 4M7AF 3OYKA 2HKNA 4C92B 1G83A 4PLLA 5A0GA 1PKTA 3EFSA 1M3CA 5GAMe 3CCMQ 2JM8A 2YUPA 4IIOA 1WHKA 3EFRA 3A98A 3CD6A 4OMMA 4GBQA 4F7UG 2CSQA 1KQSA 1AEYA 4D8KA 1UB4A 1I1JA 2L2PA 4LDVA 2P84A 4J83A 3PVQA 2HZYA 3G6EQ 2X35A 5GAOl 3PE0A 3NMZC 1IGUA 2E4HA 4QT7A 3O8VA 1RLPC 2CREA 5CKBA 4OGEA 3MKDA 1K4US 2FRWA 4IKFA 2DXUA 2RA2A 1UG1A 5CKFA 1TOVA 2YHTA 1K73U 5CKDA 1Q86C 3DLMA 1IGQA 4X1VA 3VS4A 1W2BP 3A1PA 1FMVA 1KG1A 1ACMB 4N4GA 5GMKh 1MNEA 3OYEA 2DLPA 2CSIA 2K3BA 3VYGA 1X6GA 1H92A 1K73R 3G6ET 2LC4A 1R8OB 4X9CA 1N9RA 3L42A 2EYZA 1WFWA 4B9WA 2IPOB 2ZPIB 4JS5A 2JXBA 4F14A 1UDLA 2OJ2A 1QKXA 2FO0A 1TH7A 4J6YA 1XQHA 4M7AA 3JCMJ 2OAUA 4J9GA 2LJ3A 4RCCA 1HD3A 4CC2A 1SKUB 2X4XA 3DLLA 4QW2A 3JCMW 2OTLQ 4KGZB 1KQ2A 3OYBA 4ZTJA 2J06A 8AT1B 1VQPQ 4QVZA 2Y4XA 1PC0A 3QWYA 1WJRA 3QZ5B 3N5BB 1H3HA 3I5RA 4Y28E 3GP8A 2XD0A 1OULA 5DY9A 1W6XA 3JCMQ 2HNIA 5GAMh 5GJVB 1WQ7A 2LNHB 5GANe 4MDXA 2HQEA 1MMAA 1B7TA 4M7DA 2NUPB 1M1KU 1Q86R 3TSWA 5HK3A 5GAOq 2CGHA 5KYWA 3OMGA 4UC4A 3JCMd 2RO0A 3FB9A 1VOMA 2XIDA 2DILA 3CC2T 1Y0MA 3FRNA 1KC8C 4M7DG 1KC8R 1GBRA 2DRKA 4ZN3A 4DBRA 1OQKA 3MCAB 2FZGB 3V8LA 3OYNA 4EMGA 4MZMA 3CC4Q 3L1AA 3RKWA 1TSFA 2ED1A 3LWHA 3A8HB 3VS3A 1YJWT 2NLUA 3CPWP 5KYXB 2VYTA 1G3YA 3KXTA 1GCQA 1UECA 5D6YA 3VV0A 3CCQA 4A54A 1YNZA 1VYUA 1VQOA 1M3AA 1OZ3A 3UA7A 3A8MB 2E41A 2BZ8A 5HKCA 3M0SA 3C12A 2DAQA 1G5VA 3GIBA 2FZCB 1MV3A 1VQOQ 1AWJA 4HCZA 2RHIA 2XHCA 4JDSA 4ELYC 2JZ2A 3UA6A 1MV0B 4Y91A 4LDXA 2H3EB 5LJ5e 2DMOA 2HBWA 1U1SA 3GOXA 4MMLA 4C92D 4HCKA 1YJNA 1UE9A 4PFZA 1M27C 3GF5A 1YJNT 3OSSC 1M2VB 2OTLT 3CCEQ 4M7AD 4E7LA 2CUDA 1QCOA 2COZA 2HQHA 5GAOn 3CCLQ 3JSCA 1PRMC 3QYGB 3P8DA 1YJ9A 2CP6A 2DX1A 3CXCS 4M7AE 4D6WA 3EG3A 3O5ZA 3QDFA 3JCMX 3OYFA 1V1CA 4N0AC 1GFCA 1YBYA 4RTTA 2YUQA 4OB1B 4XTYA 3CXCP 1X2KA 1T3LA 2BZXA 3EHQA 1QCFA 3G6EA 4M7DD 4E7HA 1G8XA 1WHHA 2KR3A 2MMPA 2DEQA 5C6SA 2V1RA 3H8ZA 3JCMb 3OYLA 3PGGA 2PZ1A 3M0TA 2VWFA 3L2VA 1KFZA 4M7DF 4K11A 2EPDA 2RJFA 2X4JA 4D8DA 4DBFA 1RAIB 2HDAA 4KGVB 1M5Q1 3RNJA 4GLKA 2EJ9A 2FVUA 4J7IA 2E3IA 2JS2A 4FW1A 4HVUA 2EGAA 3L2ZA 5FU6C 1KK7A 1I4K1 1N8RC 4O6JA 1VQ6T 5CO7A 2EQMA 2IVWA 2DNUA 2AK5A 1IRXA 4FM4B 1VA7A 5LJ3e 1ZUKA 2DL4A 2E5KA 2HMAA 3F70A 1E7OA 4M4ZA 1KHCA 1JBMA 2RQUA 2LX7A 2KRSA 2BZYA 1M1FA 3LX7A 1WHMA 3ZL7C 1PCXA 1Y07A 5LJ5h 4M75G 3RBBB 3P8HA 1K9MC 2IIMA 2JOYA 1K73C 1B07A 4OP0A 3L2RA 1ZSZC 4JLIA 4OMOA 1S72A 1FXXA 4M78G 4E6RA 5GJWB 4PJLA 5KH6A 4RKUE 1UHFA 4C5IA 1RAHB 4M77G 4OMPA 4HVWA 1QP2A 1TUGB 3ULRB 3EH2A 5I2MA 2I2LA 3FLGA 2XDDA 3S3OA 4E47A 1VQ9Q 4BD3A 3GNGA 3JB9F 5GAN8 3DB3A 1FX7A 2A36A 9ATCB 2MYSA 3V8KA 1B34A 1BI0A 3JCMV 3EGUA 1Q82C 5FRNA 4M75E 2RQTA 4WF2A 1Q86U 2QG9B 4XTXA 1VQMA 2EQUA 1BIBA 5CQYA 2GF7A 4XU3A 4C0DB 1C0MA 1NEGA 1K0SA 1Q82R 1NZ9A 3BE3A 3S6WA 4M7DE 1I5LA 1UGSB 2LMJA 2WSCE 2FZKB 1YITA 2ECZA 2F1LA 3IQLA 2MWOA 4GY5A 4PJNA 1LVKA 1OOTA 4RTVA 5GMKj 1W2BA 1WI7A 2I0NA 1SRMA 3OW2S 4HXJA 2RHZA 1M1KR 3CCET 3VS7A 2DIGA 2ZCFB 3H0FA 2NUZA 5GANh 1D3BB 1VIFA 3OY9A 2LTOA 4FYVB 5CVIA 5J3BA 1SHFA 2D1XA 4M78F 2HBPA 4OMFB 2QEXQ 1FMKA 2C06A 1Y71A 4DBQA 3P8BB 2GCXA 2QASA 2CZ6B 5FU7C 1YIJA 2PTKA 3CMAT 3RUXA 4C5EA 4RMOA 2DPPB 2OAWA 2QAZA 3G4ST 1YIJQ 1B3QA 1WZOA 4QVCA 3EAEA 2R5AA 1DJ7B 5KE3A 1IHVA 3EG9A 2FG0A 1M3BA 4EMKC 2EYQA 2QQRA 2F5KA 3NFCA 3HP9A 4DOWA 1MGQA 1D1AA 1X27A 1YCYA 2B8AA 3MPUB 4XTVA 4M7DC 2RJDA 2V8KA 1VQNQ 5A0DA 2K57A 2ABLA 3I35A 4E7SA 3M57A 1KC8U 2O31A 3R6NA 1VQ6Q 2ED0A 1QW1A 1E6HA 2EKOA 4DOVA 2EGCA 4NL3A 3HTRA 3SDZA 4R55A 3LYIA 4PJOE 2BTTA 1MMDA 2M9UA 2NUTA 3CC2Q 2YSQA 1RAGB 2L89A 4C5GA 3X20B 4KH0B 3WXMB 4Y92A 3H6ZA 5KE2A 4ELZC 4QKUA 1YI2A 3FDRA 2K5IA 1PHTA 2BUDA 3C0CA 5GMKe 3CD6Q 2K3YA 1U06A 2WSFE 2J05A 3I55A 3CC7A 5HY6A 4AFQC 3OYYA 2AZSA 4E2FB 3T9NA 2JMAA 5IAYA 2LDMA 3C94A 2RQVA 2CT3A 2RMOA 4A4EA 1H641 1Y96A 4XU1A 2E5QA 1K8AC 1KD1C 1YHQA 2JVVA 4MZPA 1AVZC 3CBPA 4FU6A 4LUEA 2YRCA 1UGQB 5DLOA 3JB9H 1KQ1A 4E7KA 3H0IA 2JS0A 4PK4A 1G3TA 2RF0A 5EG2A 3UDCA 2EYWA 1LOJA 3ZBDA 3M0QA 1GCPA 3CCJQ 5D6XA 1CKBA 2DVEA 1Y96B 3EG1A 2M51A 4RG2A 1EFNA 3A8GB 1D0XA 2WACA 3OYJA 1A0NB 1WXTA 1VQLA 4J7FA 2YDLA 4MMKA 3MEAA 1MMGA 1VQKT 2KY9A 1BCMA 4RCBA 1VQ8T 1WJQA 4Z02A 4A4FA 1ZUUA 2X3XD 4NS5A 1VQNA 4RTYA 2DK3A 4FT2A 2JN0A 3M0UA 2CDTA 4M78E 2GNCA 4M7AB 2D8JA 2BE9B 1VQ9A 1ZBXA 1VQOT 4ZGEB 2DXCA 5GAN3 4FYYB 1KIKA 2PVGB 2YXYA 1RADB 4M75B 3RIRA 2RI2A 2DD4A 2FYKA 4E7JA 2GBQA 1PSEA 1ZSZA 2JTEA 1YI2Q 3RESA 3OYAA 5CCAA 5D7UA 2X4YA 3E19A 3JRZA 3M9QA 1PKSA 2OTJQ 3QYHB 4Z88A 4J6WA 2XG8D 1NJIC 3TEEA 3UATA 4BI8B 3EGDA 1OEBA 2LNVA 3X28B 1V29B 2ZAEA 2L3RA 3MEWA 5IHIA 2M16A 4QQ6A 3UT1A 4F7UF 2MOXA 3JB9D 2DXTA 4ZGDB 1UUEA 3HL8A 5GANj 4B6MA 2DXBA 2M0YA 1NBEB 2XDBA 2H3JA 2K9GA 2QTXA 2F2VA 1X6OA 1BI1A 1YI2T 1E6GA 2YUOA 1T3SA 4KULA 4MDWA 2AHJB 2D8HA 1JXOA 2DL7A 1BU1A 2Y90A 2E6ZA 2QDYB 3CCSA 2COWA 5IH2A 1VQMQ 2YRVA 3M53A 3OA6A 2M02A 3CCVA 1WDXA 3CMEQ 3CCSQ 3OQ5A 4XQ3A 1I0CA 2YRDA 2DIQA 1VUBA 3OS5A 1G3WA 3NHNA 5GANg 4JUVA 2AIRB 4EMKB 3OYIA 3E2UA 3QJYA 4AFZC 2C0OA 1Q82U 2F69A 1LJOA 1JJ2A 2D9TA 3E9GA 3CCVQ 1Q81U 1VQPT 1J3TA 2IG0A 4C0FA 4J9EA 1VQKQ 4MZTA 3MEVA 4VUBA 1TUDA 3I56A 4J9BA 3QIIA 2YWWA 4KRTA 2QQ9A 2E12A 5LL6S 1VIEA 5GAN2 1AT1B 3VU3C 1TU0B 3META 1UGRB 5IHNA 4F17A 1FMWA 2FPFA 1QP3A 4EMKA 4JJDA 5GAMg 3X25B 1EZZB 5IXBA 1VQKA 2CP5A 4A4KA 2MCNA 3CCEA 3A8OB 1YCSB 1BYMA 1OV3A 2J6FA 1RABB 1GBQA 2VVKA 1JJ2S 1MUZA 3PIPA 1U1TA 4WCIA 3JB9J 3I9QA 2E3HA 3CEYA 1R0CB 1X6BA 3L2UA 2RI3A 4PKCC 4M77B 2Z0WA 2W0ZA 1QVFA 3UPUA 2OTLA 3REBB 1UGVA 3VS2A 1Y7XA 2A0FB 1ZUYA 4M78B 3VUBA 2QQBA 4XTZA 8ATCB 3L2QA 1HJDA 2WSEE 5KYYB 4BDYA 2K5FA 1MHNA 5GANd 3M4YA 4LD9K 3SFMA 3CC7Q 1Q7YU 5LJ5g 4V2SA 2C0IA 2SRCA 3PMTA 4R0KA 2D0NA 3QXEB 1HK9A 2DM1A 5C0MA 2ROTA 2EKHA 2O88A 4FT4A 3G71A 1QVGP 1QVPA 2M0OA 4C8QG 1K76A 2K6DA 5FWCA 1D0ZA 1YN8A 4FSXA 4OB0B 1VQ4Q 1WGSA 1OZ2A 4NL2A 3RKYA 2FHDA 3CCMT 4RTZA 1GFDA 5GAN7 2FPDA 1G3SA 4J9FA 3CCLT 4J9CA 2DF6A 1C6VX 1ZX6A 2DE0X 4OB2B 4GLMA 1RAFB 4F7UB 3CCJA 3OMCA 1ZSGA 4A4GA 2KVQG 3CBOA 2O2OA 3TQ7P 1AOJA 2DBKA 1BCOA 2QQSA 2ZGWA 4XAXB 3BY7A 3J80E 4JRPA 3HRUA 1SSHA 3CCVT 5LJ5j 3RMSA 3ER0A 4EIKA 2R5MA 1GCQC 3RERA 3G71T 2KSSA 1OU8A 5LJ3d 1M90U 2MI6A 5GANf 2NUPA 2VGNA 1XNIA 3QWXX 1AWWA 2GTOA 4HA8A 4BDZA 1Q81C 2KK4A 4JRKA 1D1BA 5GAOr 2QGGA 4N4IA 2GQIA 2JNGA 3QDRB 1Q7YC 4BY6B 3CCRQ 3I56Q 3EG9B 2CP0A 2D0QB 2HEQA 1P92A 3QZ9B 1NG2A 2F5TX 1SG5A 4AFSC 1U8RA 2V8IA 2DVJA 4FSSA 6AT1B 1BB9A 1VQNT 1JEGA 3CPWA 2DZ9A 4QQGA 2CZ1B 4CC7A 3CPFA 3C4SA 4IIMA 3OW2A 5GAN5 1WIEA 3J81E 3FIFA 3TSZA 5GAMd 3QO3A 2L8DA 2DL5A 3PTAA 1ABQA 1Q95G 4FIBA 4PJOD 1I81A 2COYA 3MP1A 3JCMh 2K2MA 1D1CA 1WQWA 3SWNA 1XOVA 2KRNA 3H0HA 1AWXA 1IO6A 1JXMA 2DTOA 1X75C 1ZHIA 5LJ3j 1N6AA 1SHGA 2FL7A 3CMAQ 4KT0E 1JQQA 4NOYA 1WX6A 3QKJA 1OYXA 3PMIA 2QEXT 3LH0A 1SPKA 4QVDA 1ZA1B 2V26A 1ZQ1A 3QG1A 3JB9G 1YHQT 2ZPGB 4BE0A 4L59A 1GRIA 2ZPBB 1OX9A 2E6NA 3HRSA 5GAOp 1UTIA 2A28A 5LJ5d 1WHJA
chains in the Genus database with same CATH topology
1U06A 1AZGB 2J06A 2J05A 2L3SA 4AFUC 4AFQC 3QWYA 1K9AA 2CT4A 2NWMA 4AG2C 2AZSA 1H3HA 3I5RA 2JMAA 2EGEA 3VRYA 2HCKA 2RQVA 1AZEA 2CT3A 2RMOA 1W6XA 1BBZA 4JJCA 2FRYA 2ROLA 4RTWA 5GJVB 4LUDA 2JM9A 2LNHB 1AVZC 2ENMA 4LUEA 1GL5A 2CUBA 2L3QA 2AKLA 2XMFA 3SHWA 3TSWA 1SEMA 3H0IA 2JS0A 2RF0A 4RTUA 2EYWA 1NM7A 2DILA 4J9IA 1Y0MA 3M0QA 1GCPA 5IHKA 1CKBA 1NYFA 2O9VA 1U3OA 1NEBA 1KJWA 2LP5A 2M51A 3EG1A 2FEIA 1GBRA 2DRKA 2AZVA 1EFNA 2EQIA 1A0NB 4HVVA 1WXTA 2YDLA 1VYVA 1QKWA 2ED1A 1RLQC 4CC4B 2LCSA 3VS3A 4DEXA 3LH5A 2K79A 3H41A 4LNPA 3VS0A 2HSPA 1ZUUA 2LJ1A 2X3XD 1M30A 1GCQA 1UECA 4RTYA 1G2BA 3M0UA 2KE9A 1UJ0A 2CDTA 2P4RA 1YNZA 1VYUA 2ESWA 1M3AA 1PRLC 2GNCA 3UA7A 2D8JA 2W10A 2BZ8A 2KYMA 3M0SA 1K1ZA 1MV3A 3REAB 1KIKA 1T0HA 1AWJA 3M0PA 4LE9A 2J6OA 2LZ6B 1ZBJA 4JZ4A 2CH4A 2GBQA 3UA6A 1MV0B 2JTEA 3FJ5A 2DJQA 3EHRA 2DMOA 2HBWA 1PKSA 4ZNXA 4Z88A 1QWFA 2KEAA 1AD5A 4HCKA 3UATA 1UE9A 1M27C 1HSQA 1OEBA 5IHIA 1CKAA 2CUDA 2MOXA 1UUEA 1OPKA 1U5SA 2YT6A 4ESRA 2M0YA 4LN2A 5I22A 2L0AA 4J9DA 2K9GA 2KXDA 1PRMC 1UJYA 2GGRA 2F2VA 4OMLA 2C0TA 1E6GA 2YUOA 2K7AA 3VS1A 1T3SA 2DX1A 2D8HA 1JXOA 3EG2A 1RUWA 2DL7A 1WXBA 1BU1A 5IH2A 1WYXA 3EG3A 3JV3A 3O5ZA 5ECAA 1V1CA 1GFCA 1RI9A 2J6KA 1WDXA 4CC3A 2OI3A 4RTTA 1I0CA 2YUQA 1X2KA 1I07A 3KFVA 1T3LA 2BZXA 3EHQA 3NHNA 1QCFA 4AFZC 2C0OA 2LJ0A 2KR3A 1ARKA 2V1RA 5HCKA 2KT8A 1J3TA 2PZ1A 3M0TA 1UHCA 5EC7A 4J9EA 1WXUA 2VWFA 2KBTA 1KFZA 4K11A 1BK2A 2EPDA 2L3PA 1TUDA 1NLPC 4J9BA 4D8DA 1JU5C 4KRTA 2HDAA 2A37A 2DL8A 2RPNA 2KYBA 2EVRA 5IXFA 3RNJA 5IHNA 1FYNA 4F17A 2FPFA 4JJDA 2JS2A 4HVUA 4RUGA 2EGAA 2JT4A 2LQWA 1Z9QA 1M8MA 1PNJA 2DL3A 2DA9A 5IXBA 2EW3A 2MCNA 4RTXA 1YCSB 1OV3A 2J6FA 3NGPA 2DNUA 2AK5A 1GBQA 2PNIA 2VVKA 1SRLA 1OPLA 1MUZA 2YUNA 1VA7A 1X69A 4WCIA 2EYYA 1ZUKA 2DL4A 2E5KA 4M4ZA 3SEMA 1E7OA 3TVTA 2RN8A 3I9QA 2RQUA 2LX7A 1X6BA 2KRSA 2BZYA 1X43A 2O9SA 4ORZA 3EG0A 2KGTA 3ZL7C 3I5SA 2W0ZA 1QWEA 3REBB 1UGVA 2EBPA 3VS2A 4DEYA 2KT1A 1W1FA 1ZUYA 2JMCA 3RBBB 3GBQA 1Z9ZA 4JJBA 1AWOA 2IIMA 4AG1C 1ABOA 1HJDA 1B07A 1CSKA 2VKNA 4OMOA 2KNBB 2KRMA 1YP5A 4E6RA 2RQRA 1K0XA 5GJWB 2CH4W 2C0IA 2SRCA 1VYTA 2D0NA 4R0KA 2DM1A 2ROTA 2EKHA 2O88A 1UHFA 2FPEA 3CQTA 4OMPA 4HVWA 1K76A 2A08A 3ULRB 2K6DA 5FWCA 1YN8A 4JPBW 1TUCA 1WA7A 4RTZA 1GFDA 4OMNA 2FPDA 1W70A 1YWPA 4J9FA 2A36A 3VS6A 1X2QA 2KROA 2KXCA 2DF6A 4J9CA 1ZX6A 1N5ZA 2DE0X 4GLMA 3EGUA 1ZLMA 1ZSGA 2JW4A 2O2OA 1T0JA 1NLOC 1AOJA 2DBKA 2RQTA 2DYBA 5I11A 2X3WD 4JZ3A 5L23A 5FWBA 1SSHA 1NEGA 1K0SA 2QDLA 4EIKA 2B86A 1GCQC 5FW9A 1LCKA 3VS5A 2RQWA 2LMJA 1KSWA 1TG0A 1Y57A 2H8HA 4Z89A 2ECZA 2AKKA 3IQLA 4RTVA 1OOTA 1QLYA 3QWXX 1AWWA 2GTOA 4Z8AA 1WI7A 1WLPB 2I0NA 1SRMA 3U23A 4HXJA 3VS7A 3THKA 1G83A 3H0FA 2NUZA 1PKTA 1M3CA 2GQIA 2JM8A 2MIOA 2YUPA 1SHFA 2D1XA 4IIOA 3A98A 4OMMA 3PVLA 4GBQA 2CSQA 2HEQA 1AEYA 1FMKA 4D8KA 1I1JA 4A63B 1NG2A 2L2PA 4J9HA 4AFSC 2DRMA 2DVJA 2PTKA 1UFFA 4FSSA 3PVQA 1BB9A 1H8KA 3M0RA 1JEGA 3PE0A 3NMZC 2OAWA 1B3QA 4CC7A 4IIMA 2RNAA 4QT7A 1RLPC 2CREA 2V1QA 1K4US 1WIEA 2FRWA 1NYGA 1S1NA 1UG1A 3TSZA 3VRZA 2EYXA 2FG0A 1M3BA 4X1VA 3VS4A 2DL5A 1YWOA 2SEMA 1ABQA 2CSIA 2DLPA 2LQNA 2K3BA 3UF4A 1X27A 1X6GA 1H92A 3NPFA 2K2MA 1XOVA 4F16A 2KRNA 2F2WA 1AWXA 3H0HA 2G6FX 1IO6A 2EYZA 1WFWA 1JXMA 2ABLA 3I35A 4OMQA 1SHGA 1JQQA 2O31A 1WX6A 2JXBA 4F14A 1UDLA 3R6NA 2DBMA 2ED0A 2OJ2A 1E6HA 1JO8A 1QKXA 2EGCA 1PWTA 2BTTA 1SPKA 2YSQA 2FO0A 2J7IA 4Y92A 4J9GA 2LJ3A 2GTJA 1HD3A 2F2XA 1GRIA 4CC2A 1PHTA 1UTIA 2A28A 3C0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U06 A;  1AZG B;  2J06 A;  2J05 A;  2L3S A;  4AFU C;  4AFQ C;  3QWY A;  1K9A A;  2CT4 A;  2NWM A;  4AG2 C;  2AZS A;  1H3H A;  3I5R A;  2JMA A;  2EGE A;  3VRY A;  2HCK A;  2RQV A;  1AZE A;  2CT3 A;  2RMO A;  1W6X A;  1BBZ A;  4JJC A;  2FRY A;  2ROL A;  4RTW A;  5GJV B;  4LUD A;  2JM9 A;  2LNH B;  1AVZ C;  2ENM A;  4LUE A;  1GL5 A;  2CUB A;  2L3Q A;  2AKL A;  2XMF A;  3SHW A;  3TSW A;  1SEM A;  3H0I A;  2JS0 A;  2RF0 A;  4RTU A;  2EYW A;  1NM7 A;  2DIL A;  4J9I A;  1Y0M A;  3M0Q A;  1GCP A;  5IHK A;  1CKB A;  1NYF A;  2O9V A;  1U3O A;  1NEB A;  1KJW A;  2LP5 A;  2M51 A;  3EG1 A;  2FEI A;  1GBR A;  2DRK A;  2AZV A;  1EFN A;  2EQI A;  1A0N B;  4HVV A;  1WXT A;  2YDL A;  1VYV A;  1QKW A;  2ED1 A;  1RLQ C;  4CC4 B;  2LCS A;  3VS3 A;  4DEX A;  3LH5 A;  2K79 A;  3H41 A;  4LNP A;  3VS0 A;  2HSP A;  1ZUU A;  2LJ1 A;  2X3X D;  1M30 A;  1GCQ A;  1UEC A;  4RTY A;  1G2B A;  3M0U A;  2KE9 A;  1UJ0 A;  2CDT A;  2P4R A;  1YNZ A;  1VYU A;  2ESW A;  1M3A A;  1PRL C;  2GNC A;  3UA7 A;  2D8J A;  2W10 A;  2BZ8 A;  2KYM A;  3M0S A;  1K1Z A;  1MV3 A;  3REA B;  1KIK A;  1T0H A;  1AWJ A;  3M0P A;  4LE9 A;  2J6O A;  2LZ6 B;  1ZBJ A;  4JZ4 A;  2CH4 A;  2GBQ A;  3UA6 A;  1MV0 B;  2JTE A;  3FJ5 A;  2DJQ A;  3EHR A;  2DMO A;  2HBW A;  1PKS A;  4ZNX A;  4Z88 A;  1QWF A;  2KEA A;  1AD5 A;  4HCK A;  3UAT A;  1UE9 A;  1M27 C;  1HSQ A;  1OEB A;  5IHI A;  1CKA A;  2CUD A;  2MOX A;  1UUE A;  1OPK A;  1U5S A;  2YT6 A;  4ESR A;  2M0Y A;  4LN2 A;  5I22 A;  2L0A A;  4J9D A;  2K9G A;  2KXD A;  1PRM C;  1UJY A;  2GGR A;  2F2V A;  4OML A;  2C0T A;  1E6G A;  2YUO A;  2K7A A;  3VS1 A;  1T3S A;  2DX1 A;  2D8H A;  1JXO A;  3EG2 A;  1RUW A;  2DL7 A;  1WXB A;  1BU1 A;  5IH2 A;  1WYX A;  3EG3 A;  3JV3 A;  3O5Z A;  5ECA A;  1V1C A;  1GFC A;  1RI9 A;  2J6K A;  1WDX A;  4CC3 A;  2OI3 A;  4RTT A;  1I0C A;  2YUQ A;  1X2K A;  1I07 A;  3KFV A;  1T3L A;  2BZX A;  3EHQ A;  3NHN A;  1QCF A;  4AFZ C;  2C0O A;  2LJ0 A;  2KR3 A;  1ARK A;  2V1R A;  5HCK A;  2KT8 A;  1J3T A;  2PZ1 A;  3M0T A;  1UHC A;  5EC7 A;  4J9E A;  1WXU A;  2VWF A;  2KBT A;  1KFZ A;  4K11 A;  1BK2 A;  2EPD A;  2L3P A;  1TUD A;  1NLP C;  4J9B A;  4D8D A;  1JU5 C;  4KRT A;  2HDA A;  2A37 A;  2DL8 A;  2RPN A;  2KYB A;  2EVR A;  5IXF A;  3RNJ A;  5IHN A;  1FYN A;  4F17 A;  2FPF A;  4JJD A;  2JS2 A;  4HVU A;  4RUG A;  2EGA A;  2JT4 A;  2LQW A;  1Z9Q A;  1M8M A;  1PNJ A;  2DL3 A;  2DA9 A;  5IXB A;  2EW3 A;  2MCN A;  4RTX A;  1YCS B;  1OV3 A;  2J6F A;  3NGP A;  2DNU A;  2AK5 A;  1GBQ A;  2PNI A;  2VVK A;  1SRL A;  1OPL A;  1MUZ A;  2YUN A;  1VA7 A;  1X69 A;  4WCI A;  2EYY A;  1ZUK A;  2DL4 A;  2E5K A;  4M4Z A;  3SEM A;  1E7O A;  3TVT A;  2RN8 A;  3I9Q A;  2RQU A;  2LX7 A;  1X6B A;  2KRS A;  2BZY A;  1X43 A;  2O9S A;  4ORZ A;  3EG0 A;  2KGT A;  3ZL7 C;  3I5S A;  2W0Z A;  1QWE A;  3REB B;  1UGV A;  2EBP A;  3VS2 A;  4DEY A;  2KT1 A;  1W1F A;  1ZUY A;  2JMC A;  3RBB B;  3GBQ A;  1Z9Z A;  4JJB A;  1AWO A;  2IIM A;  4AG1 C;  1ABO A;  1HJD A;  1B07 A;  1CSK A;  2VKN A;  4OMO A;  2KNB B;  2KRM A;  1YP5 A;  4E6R A;  2RQR A;  1K0X A;  5GJW B;  2CH4 W;  2C0I A;  2SRC A;  1VYT A;  2D0N A;  4R0K A;  2DM1 A;  2ROT A;  2EKH A;  2O88 A;  1UHF A;  2FPE A;  3CQT A;  4OMP A;  4HVW A;  1K76 A;  2A08 A;  3ULR B;  2K6D A;  5FWC A;  1YN8 A;  4JPB W;  1TUC A;  1WA7 A;  4RTZ A;  1GFD A;  4OMN A;  2FPD A;  1W70 A;  1YWP A;  4J9F A;  2A36 A;  3VS6 A;  1X2Q A;  2KRO A;  2KXC A;  2DF6 A;  4J9C A;  1ZX6 A;  1N5Z A;  2DE0 X;  4GLM A;  3EGU A;  1ZLM A;  1ZSG A;  2JW4 A;  2O2O A;  1T0J A;  1NLO C;  1AOJ A;  2DBK A;  2RQT A;  2DYB A;  5I11 A;  2X3W D;  4JZ3 A;  5L23 A;  5FWB A;  1SSH A;  1NEG A;  1K0S A;  2QDL A;  4EIK A;  2B86 A;  1GCQ C;  5FW9 A;  1LCK A;  3VS5 A;  2RQW A;  2LMJ A;  1KSW A;  1TG0 A;  1Y57 A;  2H8H A;  4Z89 A;  2ECZ A;  2AKK A;  3IQL A;  4RTV A;  1OOT A;  1QLY A;  3QWX X;  1AWW A;  2GTO A;  4Z8A A;  1WI7 A;  1WLP B;  2I0N A;  1SRM A;  3U23 A;  4HXJ A;  3VS7 A;  3THK A;  1G83 A;  3H0F A;  2NUZ A;  1PKT A;  1M3C A;  2GQI A;  2JM8 A;  2MIO A;  2YUP A;  1SHF A;  2D1X A;  4IIO A;  3A98 A;  4OMM A;  3PVL A;  4GBQ A;  2CSQ A;  2HEQ A;  1AEY A;  1FMK A;  4D8K A;  1I1J A;  4A63 B;  1NG2 A;  2L2P A;  4J9H A;  4AFS C;  2DRM A;  2DVJ A;  2PTK A;  1UFF A;  4FSS A;  3PVQ A;  1BB9 A;  1H8K A;  3M0R A;  1JEG A;  3PE0 A;  3NMZ C;  2OAW A;  1B3Q A;  4CC7 A;  4IIM A;  2RNA A;  4QT7 A;  1RLP C;  2CRE A;  2V1Q A;  1K4U S;  1WIE A;  2FRW A;  1NYG A;  1S1N A;  1UG1 A;  3TSZ A;  3VRZ A;  2EYX A;  2FG0 A;  1M3B A;  4X1V A;  3VS4 A;  2DL5 A;  1YWO A;  2SEM A;  1ABQ A;  2CSI A;  2DLP A;  2LQN A;  2K3B A;  3UF4 A;  1X27 A;  1X6G A;  1H92 A;  3NPF A;  2K2M A;  1XOV A;  4F16 A;  2KRN A;  2F2W A;  1AWX A;  3H0H A;  2G6F X;  1IO6 A;  2EYZ A;  1WFW A;  1JXM A;  2ABL A;  3I35 A;  4OMQ A;  1SHG A;  1JQQ A;  2O31 A;  1WX6 A;  2JXB A;  4F14 A;  1UDL A;  3R6N A;  2DBM A;  2ED0 A;  2OJ2 A;  1E6H A;  1JO8 A;  1QKX A;  2EGC A;  1PWT A;  2BTT A;  1SPK A;  2YSQ A;  2FO0 A;  2J7I A;  4Y92 A;  4J9G A;  2LJ3 A;  2GTJ A;  1HD3 A;  2F2X A;  1GRI A;  4CC2 A;  1PHT A;  1UTI A;  2A28 A;  3C0C A; 
#chains in the Genus database with same CATH topology
 1AZG B;  3JCM c;  1QVG A;  3JCM P;  1UEB A;  3EFO B;  2PVO B;  3S3N A;  2CYZ B;  4KBM B;  1K8A U;  1KD1 U;  1K9A A;  2CT4 A;  2NWM A;  3HFN A;  2VGM A;  3URG A;  7AT1 B;  1X01 A;  3VRY A;  1JRI A;  1AZE A;  1S72 T;  4ZTF A;  2K3X A;  2ROL A;  4F7U E;  2E65 A;  1WJS A;  1NJI R;  1D09 B;  1GL5 A;  2CS7 A;  4C92 C;  2AKL A;  4M77 F;  2E70 A;  3QHS A;  1BIA A;  1QVF P;  1SEM A;  4N0A A;  1NJI U;  4O5V A;  4ANJ A;  4RTU A;  2OTJ T;  4J6X A;  4BE1 A;  5KCO A;  1NM7 A;  5CAI A;  4J9I A;  1W4S A;  2RHU A;  1PSF A;  2K5L A;  5IHK A;  4DA4 A;  1NYF A;  1U3O A;  1TWB A;  1KJW A;  1NEB A;  3HRT A;  4M75 F;  2V8J A;  1SSF A;  4FYW B;  2P0K A;  4PJO C;  5LJ5 f;  4BUG A;  2K2V A;  5D6W A;  2OTJ A;  4C92 A;  3CC2 A;  4XK8 E;  3OW2 P;  4HCC A;  1RLQ C;  4CC4 B;  3LH5 A;  2K79 A;  3BW1 A;  3G4S A;  1M30 A;  2QYZ A;  4LD6 A;  4JRI A;  1UJ0 A;  3EGX A;  2ESW A;  1VQ8 Q;  1PRL C;  3CCM A;  1WNL A;  5KYU B;  1H3Z A;  3QSU A;  1KQS P;  2A3L A;  4M75 C;  1YJ9 Q;  2XDP A;  1K1Z A;  3REA B;  1C1A A;  4LE9 A;  2J6O A;  2RJC A;  4JZ4 A;  2VB6 A;  3JCM f;  2CH4 A;  1QCN A;  5FU7 B;  2LVM A;  4M7A C;  3M58 A;  4J8O A;  2VXE A;  3TCJ A;  3FJ5 A;  4C92 E;  2MPX C;  2DJQ A;  3CC4 A;  4HKE A;  4ZNX A;  1AD5 A;  2RM4 A;  2EQJ A;  3E1S A;  4BB7 A;  3HPW A;  1HSQ A;  5KYY A;  1RAA B;  4J5Y A;  2XIC A;  1MMN A;  3V7R A;  1CKA A;  3C95 A;  1IRE B;  4EMH A;  2HQX A;  2AT1 B;  4R56 A;  1OPK A;  1YIT Q;  4PJJ A;  5DM7 R;  4ME7 A;  4C8Q F;  2KXD A;  2QXF A;  1UJY A;  2GGR A;  3OYM A;  4OML A;  2LQK A;  2C0T A;  5IN1 A;  3VS1 A;  4OVA A;  1VQL Q;  1RUW A;  1WXB A;  1WYX A;  4N4H A;  3JV3 A;  3HHT B;  5ECA A;  3M59 A;  1RI9 A;  3CCS T;  4B9X A;  4PLI A;  3CPW S;  4CC3 A;  2O01 E;  2OI3 A;  4KUD K;  2O4X A;  3LWI A;  4HT9 A;  2EFI A;  4ZGJ B;  4M78 D;  1OI1 A;  1HYO A;  1IB8 A;  4C8Q B;  3RMQ A;  1V76 A;  3V7S A;  5CIU A;  2BE7 D;  3OYD A;  2JTM A;  4LXC A;  2L5Q A;  2KT8 A;  3V8J A;  1UHC A;  3PIO A;  2KBT A;  1BK2 A;  2L3P A;  1NLP C;  4JS4 A;  3VKI A;  4IUQ A;  4P5N A;  1M1G A;  2DL8 A;  2RPN A;  2KYB A;  5I2S A;  1FYN A;  3TRE A;  2XU8 A;  4RUG A;  4C0G A;  5J26 A;  3E9F A;  2JT4 A;  2ZPE B;  4E7Z A;  4BE2 A;  1Z9Q A;  1M8M A;  1PNJ A;  2VC8 A;  5CR2 A;  2VAS A;  2EW3 A;  2DKG A;  3GNF B;  4RTX A;  4Q5W A;  2PNI A;  1YIJ T;  5AYF A;  2YUN A;  2PQW A;  3SEM A;  2EYY A;  3TVT A;  5GMK m;  5IT9 E;  1WHG A;  4PJO G;  3OYC A;  1M90 R;  1X43 A;  2O9S A;  1PD1 A;  3CME A;  1YHQ Q;  3M54 A;  1M90 C;  1QWE A;  4QQD A;  5KYX A;  4C8Q A;  2QI2 A;  2R58 A;  2FB7 A;  3RR6 A;  5GAM f;  1W1F A;  2JMC A;  3GBQ A;  1Z9Z A;  5A0L A;  4JJB A;  5CQX A;  3VYH B;  3PT9 A;  2JTF A;  4AG1 C;  2RB6 A;  3GPL A;  2ZPH B;  4C0Z A;  3OBY A;  4LDU A;  1CSK A;  3MP6 A;  3A8L B;  3MP8 A;  2P0P A;  3VUZ A;  2JJ9 A;  4HCB A;  1VYT A;  4OGC A;  4PJO A;  3AHU A;  4JJN K;  2QEX A;  3A5Z B;  5GAN 4;  3CCJ T;  2A08 A;  3CXC A;  2XK0 A;  1KHI A;  1VQ5 T;  3OS1 A;  4BY6 C;  1QVF S;  4ATO A;  2GFA A;  4OMN A;  1W70 A;  1YWP A;  4AT1 B;  2P0Q A;  5HK0 A;  1W2B S;  2JUF A;  3VS6 A;  2KXC A;  2KRO A;  4L5G A;  1N5Z A;  3LW5 E;  2RK1 A;  2JW4 A;  1T0J A;  3JB9 I;  1OX8 A;  4PFO A;  5I11 A;  4OF1 A;  2DTI A;  1O75 A;  5FWB A;  2E10 A;  5AT1 B;  3HSB A;  3EFO A;  1TXQ A;  2O4X B;  3KBG A;  2B86 A;  5FW9 A;  1VQ9 T;  2MK5 A;  1Q81 R;  2YLB A;  2RQW A;  3CCR T;  1KSW A;  1TG0 A;  4OB3 B;  4M78 A;  3M56 A;  1YIT T;  3BDL A;  4Z8A A;  1WLP B;  2QA4 Q;  3U23 A;  5KYN A;  4PJO B;  2KAF A;  3THK A;  4KH1 B;  4X34 A;  1I5O B;  4DQ2 A;  1QQJ A;  2MIO A;  1XJW B;  2EJG A;  3S3M A;  3J7A F;  1VQ4 T;  3PVL A;  3G71 Q;  5L8R E;  2LT1 A;  4A63 B;  3AT1 B;  4J9H A;  2DRM A;  1PM3 A;  3JAM E;  4IUU A;  1UFF A;  3SD4 A;  3INZ A;  1EIF A;  4DBH A;  2HKQ B;  1RI0 A;  1H8K A;  3M0R A;  5CK9 A;  2DJZ A;  5KYW B;  3MHX A;  1YJ9 T;  2QA4 T;  1N8R R;  4F04 B;  4XTW A;  2RNA A;  4PJO F;  4LDY A;  2V1Q A;  1ZSZ B;  3I55 T;  1RL2 A;  1NYG A;  1M4Z A;  1S1N A;  2ZPF B;  1I8F A;  3VRZ A;  4A4H A;  1N9S A;  2EYX A;  3MJX A;  1YWO A;  1SF9 A;  2SEM A;  1KQS S;  5GAO m;  1F1B B;  1K8A R;  5GMK i;  1KD1 R;  2LQN A;  3UF4 A;  3H9N A;  3NPF A;  3D7S B;  3ZFJ A;  5KYU A;  4F16 A;  2F2W A;  3FJP A;  2G6F X;  2BIV A;  4BAC A;  2RJE A;  4PNO A;  3CC7 T;  2XI9 A;  4OMQ A;  2DBM A;  3LLR A;  4FW2 A;  1JO8 A;  1PWT A;  4AMC A;  1NPP A;  4KGX B;  2J7I A;  2LX9 A;  2R57 A;  2RI5 A;  3BDU A;  2EAY A;  2NUT B;  3EGX B;  1NE8 A;  2GTJ A;  2GQV A;  1BI2 A;  2E64 A;  3EH1 A;  2F2X A;  4KUI A;  3RDV A;  3OYG A;  2RK2 A;  2EWN A;  1PG5 B;  1M2V A;  3QPH A;  2DYI A;  2X51 A;  4C92 G;  5GMK l;  1XTD A;  2GFU A;  2VXF A;  2P4T A;  2LRQ A;  1UGP B;  2L3S A;  4AFU C;  4E7I A;  2X4W A;  2CP2 A;  3PNW C;  3V7C A;  1BKB A;  2VUB A;  4AG2 C;  4ZN1 A;  4C8Q C;  3WVD B;  3CCU Q;  2EGE A;  3G1J A;  1MND A;  2HCK A;  5DLQ E;  3Q1J A;  5FRO A;  2BKD N;  1BBZ A;  4JJC A;  1VQ6 A;  2FRY A;  4RTW A;  1LNX A;  5CKH A;  4LUD A;  2JM9 A;  3OSV A;  1M2O A;  2K4Y A;  2ENM A;  2CUB A;  2L3Q A;  3CCR A;  4FYX B;  1Q7Y R;  2XMF A;  3SWN C;  2DET A;  2A7Y A;  1RAE B;  3SHW A;  3MEU A;  1YJN Q;  2YLC A;  3CCU A;  2DEU A;  2ZZD A;  2M1H A;  5LJ3 g;  4PL6 A;  1D3B A;  3TU4 K;  2QA4 A;  1PD0 A;  3X24 B;  1QVG S;  2KQW A;  2LCL A;  2HAX A;  5KCH A;  2G3R A;  2LP5 A;  2O9V A;  4C0D C;  4EPC A;  2FEI A;  2PU9 B;  2RHY A;  2AZV A;  4CI0 C;  2EQI A;  4IUR A;  3WVE B;  3JCM g;  4HVV A;  2EQK A;  4PJM A;  2LCC A;  1VYV A;  1VQ4 A;  1QKW A;  2DD5 A;  3LGF A;  3HKS A;  1JB0 E;  2QTV A;  2CP7 A;  4FCY A;  2LCS A;  4DEX A;  2X9H A;  2RD1 A;  3H41 A;  4LNP A;  1YJW A;  3VS0 A;  3QJ6 A;  2HSP A;  3CCU T;  2LJ1 A;  5J39 A;  3M55 A;  4M7A G;  1N27 A;  2MAM A;  1G2B A;  2KE9 A;  2P4R A;  2LQ8 A;  1BI3 A;  1GXI E;  2W10 A;  3SWN B;  3CC4 T;  1JJ2 P;  2KYM A;  3RKX A;  4C8Q E;  1K9M U;  3PFS A;  3LGL A;  1T0H A;  1WHL A;  3M0P A;  3CCQ Q;  2LZ6 B;  1ZBJ A;  1R0B G;  3UWN A;  1IHW A;  5FRM A;  4IUP A;  2XKO C;  5M9O A;  4PFP A;  2D6F A;  2DTH A;  3EHR A;  3FEO A;  2PVD B;  2HL5 C;  4C8Q D;  1QWF A;  2KEA A;  3SB2 A;  4M77 C;  1D0Y A;  3CD6 T;  3ME9 A;  3ASK A;  1FWZ A;  2PUK B;  1WPY A;  1U5S A;  2YT6 A;  3MO8 A;  4LN2 A;  4ESR A;  3OS2 A;  2MWP A;  5I22 A;  1OU9 A;  2L0A A;  1IZ6 A;  4J9D A;  2OX7 A;  3X26 B;  2QQA A;  1VQ5 Q;  3L2W A;  3ZEH A;  2DZC A;  2K7A A;  5FU6 B;  4JRQ A;  3DKM A;  3NTI A;  3EG2 A;  1VQ5 A;  4F7U A;  3CCQ T;  3R6O A;  2E1H A;  3BFM A;  4M75 D;  1O9S A;  2J6K A;  1K9M R;  2Y4Y A;  1N8R U;  2EJF A;  4IUV A;  1I07 A;  2CP3 A;  3KFV A;  4II1 A;  4X9D A;  1S72 Q;  2VV5 A;  1M8V A;  1M9S A;  1VQ8 A;  3CBM A;  2LJ0 A;  3OYH A;  1ARK A;  5HCK A;  4IUT A;  3HFO A;  3CMA A;  3CCL A;  5LJ3 f;  2CZ0 B;  5EC7 A;  1WXU A;  1B34 B;  5GAN 6;  5CKE A;  1ZA2 B;  4WTO B;  3FC3 A;  3CME T;  1RAC B;  1JU5 C;  4HT8 A;  4C5H A;  4BI4 A;  2A37 A;  2EVR A;  5IXF A;  2KDS A;  4BI3 A;  2HSE B;  3VJP A;  3KUF A;  2LQW A;  1M1K C;  1VQ7 Q;  2DL3 A;  2DA9 A;  1IXD A;  5I21 A;  4L6V 5;  2PUO B;  3OB9 A;  3NGP A;  2MF2 A;  4JLG A;  4CRI A;  2DFU A;  1SRL A;  1OPL A;  1X69 A;  2RN8 A;  2CKK A;  4RG8 A;  3OBW A;  4M7D B;  2KMT A;  4ORZ A;  3EG0 A;  2KGT A;  5LJ3 h;  3I5S A;  2CZ7 B;  2LT4 A;  1TS9 A;  4M77 A;  2EBP A;  4DEY A;  2KT1 A;  5A2Q E;  4XU0 A;  4LDW A;  1AWO A;  3DB4 A;  1ABO A;  3OS0 A;  2VKN A;  3G7Z A;  4XTU A;  4TVR A;  2KNB B;  2KRM A;  1YP5 A;  2RQR A;  1K0X A;  2CH4 W;  2RH2 A;  3JCM e;  1AHJ B;  1LPL A;  3M5A A;  4M75 A;  4C92 F;  2FPE A;  1NPR A;  1HXD A;  3CQT A;  4M77 E;  2EIF A;  1VQL T;  4FL6 A;  3QUI A;  1TTH B;  2HL3 A;  3I56 T;  1VQ7 T;  1R77 A;  2ATC B;  4JPB W;  1TUC A;  1WA7 A;  1YFN A;  2NYS A;  1VQP A;  1X2Q A;  2DO3 A;  3G4S Q;  1ZLM A;  5GAM j;  2RHX A;  4M77 D;  3EGD B;  2QGF B;  1NLO C;  2QK0 A;  4A53 A;  2DYB A;  3QBY A;  2X3W D;  4JZ3 A;  4EDU A;  5L23 A;  1QMC A;  1VQM T;  2DER A;  4M78 C;  3NTK A;  5FLX E;  2QDL A;  3GLX A;  4YTL A;  1LCK A;  3VS5 A;  3NTH A;  3I55 Q;  1EX4 A;  1Y57 A;  2H8H A;  4Z89 A;  1YJW Q;  2AKK A;  2KI7 A;  3M4G A;  4XU2 A;  1QLY A;  2HD0 A;  1VQ7 A;  4M7A F;  3OYK A;  2HKN A;  4C92 B;  1G83 A;  4PLL A;  5A0G A;  1PKT A;  3EFS A;  1M3C A;  5GAM e;  3CCM Q;  2JM8 A;  2YUP A;  4IIO A;  1WHK A;  3EFR A;  3A98 A;  3CD6 A;  4OMM A;  4GBQ A;  4F7U G;  2CSQ A;  1KQS A;  1AEY A;  4D8K A;  1UB4 A;  1I1J A;  2L2P A;  4LDV A;  2P84 A;  4J83 A;  3PVQ A;  2HZY A;  3G6E Q;  2X35 A;  5GAO l;  3PE0 A;  3NMZ C;  1IGU A;  2E4H A;  4QT7 A;  3O8V A;  1RLP C;  2CRE A;  5CKB A;  4OGE A;  3MKD A;  1K4U S;  2FRW A;  4IKF A;  2DXU A;  2RA2 A;  1UG1 A;  5CKF A;  1TOV A;  2YHT A;  1K73 U;  5CKD A;  1Q86 C;  3DLM A;  1IGQ A;  4X1V A;  3VS4 A;  1W2B P;  3A1P A;  1FMV A;  1KG1 A;  1ACM B;  4N4G A;  5GMK h;  1MNE A;  3OYE A;  2DLP A;  2CSI A;  2K3B A;  3VYG A;  1X6G A;  1H92 A;  1K73 R;  3G6E T;  2LC4 A;  1R8O B;  4X9C A;  1N9R A;  3L42 A;  2EYZ A;  1WFW A;  4B9W A;  2IPO B;  2ZPI B;  4JS5 A;  2JXB A;  4F14 A;  1UDL A;  2OJ2 A;  1QKX A;  2FO0 A;  1TH7 A;  4J6Y A;  1XQH A;  4M7A A;  3JCM J;  2OAU A;  4J9G A;  2LJ3 A;  4RCC A;  1HD3 A;  4CC2 A;  1SKU B;  2X4X A;  3DLL A;  4QW2 A;  3JCM W;  2OTL Q;  4KGZ B;  1KQ2 A;  3OYB A;  4ZTJ A;  2J06 A;  8AT1 B;  1VQP Q;  4QVZ A;  2Y4X A;  1PC0 A;  3QWY A;  1WJR A;  3QZ5 B;  3N5B B;  1H3H A;  3I5R A;  4Y28 E;  3GP8 A;  2XD0 A;  1OUL A;  5DY9 A;  1W6X A;  3JCM Q;  2HNI A;  5GAM h;  5GJV B;  1WQ7 A;  2LNH B;  5GAN e;  4MDX A;  2HQE A;  1MMA A;  1B7T A;  4M7D A;  2NUP B;  1M1K U;  1Q86 R;  3TSW A;  5HK3 A;  5GAO q;  2CGH A;  5KYW A;  3OMG A;  4UC4 A;  3JCM d;  2RO0 A;  3FB9 A;  1VOM A;  2XID A;  2DIL A;  3CC2 T;  1Y0M A;  3FRN A;  1KC8 C;  4M7D G;  1KC8 R;  1GBR A;  2DRK A;  4ZN3 A;  4DBR A;  1OQK A;  3MCA B;  2FZG B;  3V8L A;  3OYN A;  4EMG A;  4MZM A;  3CC4 Q;  3L1A A;  3RKW A;  1TSF A;  2ED1 A;  3LWH A;  3A8H B;  3VS3 A;  1YJW T;  2NLU A;  3CPW P;  5KYX B;  2VYT A;  1G3Y A;  3KXT A;  1GCQ A;  1UEC A;  5D6Y A;  3VV0 A;  3CCQ A;  4A54 A;  1YNZ A;  1VYU A;  1VQO A;  1M3A A;  1OZ3 A;  3UA7 A;  3A8M B;  2E41 A;  2BZ8 A;  5HKC A;  3M0S A;  3C12 A;  2DAQ A;  1G5V A;  3GIB A;  2FZC B;  1MV3 A;  1VQO Q;  1AWJ A;  4HCZ A;  2RHI A;  2XHC A;  4JDS A;  4ELY C;  2JZ2 A;  3UA6 A;  1MV0 B;  4Y91 A;  4LDX A;  2H3E B;  5LJ5 e;  2DMO A;  2HBW A;  1U1S A;  3GOX A;  4MML A;  4C92 D;  4HCK A;  1YJN A;  1UE9 A;  4PFZ A;  1M27 C;  3GF5 A;  1YJN T;  3OSS C;  1M2V B;  2OTL T;  3CCE Q;  4M7A D;  4E7L A;  2CUD A;  1QCO A;  2COZ A;  2HQH A;  5GAO n;  3CCL Q;  3JSC A;  1PRM C;  3QYG B;  3P8D A;  1YJ9 A;  2CP6 A;  2DX1 A;  3CXC S;  4M7A E;  4D6W A;  3EG3 A;  3O5Z A;  3QDF A;  3JCM X;  3OYF A;  1V1C A;  4N0A C;  1GFC A;  1YBY A;  4RTT A;  2YUQ A;  4OB1 B;  4XTY A;  3CXC P;  1X2K A;  1T3L A;  2BZX A;  3EHQ A;  1QCF A;  3G6E A;  4M7D D;  4E7H A;  1G8X A;  1WHH A;  2KR3 A;  2MMP A;  2DEQ A;  5C6S A;  2V1R A;  3H8Z A;  3JCM b;  3OYL A;  3PGG A;  2PZ1 A;  3M0T A;  2VWF A;  3L2V A;  1KFZ A;  4M7D F;  4K11 A;  2EPD A;  2RJF A;  2X4J A;  4D8D A;  4DBF A;  1RAI B;  2HDA A;  4KGV B;  1M5Q 1;  3RNJ A;  4GLK A;  2EJ9 A;  2FVU A;  4J7I A;  2E3I A;  2JS2 A;  4FW1 A;  4HVU A;  2EGA A;  3L2Z A;  5FU6 C;  1KK7 A;  1I4K 1;  1N8R C;  4O6J A;  1VQ6 T;  5CO7 A;  2EQM A;  2IVW A;  2DNU A;  2AK5 A;  1IRX A;  4FM4 B;  1VA7 A;  5LJ3 e;  1ZUK A;  2DL4 A;  2E5K A;  2HMA A;  3F70 A;  1E7O A;  4M4Z A;  1KHC A;  1JBM A;  2RQU A;  2LX7 A;  2KRS A;  2BZY A;  1M1F A;  3LX7 A;  1WHM A;  3ZL7 C;  1PCX A;  1Y07 A;  5LJ5 h;  4M75 G;  3RBB B;  3P8H A;  1K9M C;  2IIM A;  2JOY A;  1K73 C;  1B07 A;  4OP0 A;  3L2R A;  1ZSZ C;  4JLI A;  4OMO A;  1S72 A;  1FXX A;  4M78 G;  4E6R A;  5GJW B;  4PJL A;  5KH6 A;  4RKU E;  1UHF A;  4C5I A;  1RAH B;  4M77 G;  4OMP A;  4HVW A;  1QP2 A;  1TUG B;  3ULR B;  3EH2 A;  5I2M A;  2I2L A;  3FLG A;  2XDD A;  3S3O A;  4E47 A;  1VQ9 Q;  4BD3 A;  3GNG A;  3JB9 F;  5GAN 8;  3DB3 A;  1FX7 A;  2A36 A;  9ATC B;  2MYS A;  3V8K A;  1B34 A;  1BI0 A;  3JCM V;  3EGU A;  1Q82 C;  5FRN A;  4M75 E;  2RQT A;  4WF2 A;  1Q86 U;  2QG9 B;  4XTX A;  1VQM A;  2EQU A;  1BIB A;  5CQY A;  2GF7 A;  4XU3 A;  4C0D B;  1C0M A;  1NEG A;  1K0S A;  1Q82 R;  1NZ9 A;  3BE3 A;  3S6W A;  4M7D E;  1I5L A;  1UGS B;  2LMJ A;  2WSC E;  2FZK B;  1YIT A;  2ECZ A;  2F1L A;  3IQL A;  2MWO A;  4GY5 A;  4PJN A;  1LVK A;  1OOT A;  4RTV A;  5GMK j;  1W2B A;  1WI7 A;  2I0N A;  1SRM A;  3OW2 S;  4HXJ A;  2RHZ A;  1M1K R;  3CCE T;  3VS7 A;  2DIG A;  2ZCF B;  3H0F A;  2NUZ A;  5GAN h;  1D3B B;  1VIF A;  3OY9 A;  2LTO A;  4FYV B;  5CVI A;  5J3B A;  1SHF A;  2D1X A;  4M78 F;  2HBP A;  4OMF B;  2QEX Q;  1FMK A;  2C06 A;  1Y71 A;  4DBQ A;  3P8B B;  2GCX A;  2QAS A;  2CZ6 B;  5FU7 C;  1YIJ A;  2PTK A;  3CMA T;  3RUX A;  4C5E A;  4RMO A;  2DPP B;  2OAW A;  2QAZ A;  3G4S T;  1YIJ Q;  1B3Q A;  1WZO A;  4QVC A;  3EAE A;  2R5A A;  1DJ7 B;  5KE3 A;  1IHV A;  3EG9 A;  2FG0 A;  1M3B A;  4EMK C;  2EYQ A;  2QQR A;  2F5K A;  3NFC A;  3HP9 A;  4DOW A;  1MGQ A;  1D1A A;  1X27 A;  1YCY A;  2B8A A;  3MPU B;  4XTV A;  4M7D C;  2RJD A;  2V8K A;  1VQN Q;  5A0D A;  2K57 A;  2ABL A;  3I35 A;  4E7S A;  3M57 A;  1KC8 U;  2O31 A;  3R6N A;  1VQ6 Q;  2ED0 A;  1QW1 A;  1E6H A;  2EKO A;  4DOV A;  2EGC A;  4NL3 A;  3HTR A;  3SDZ A;  4R55 A;  3LYI A;  4PJO E;  2BTT A;  1MMD A;  2M9U A;  2NUT A;  3CC2 Q;  2YSQ A;  1RAG B;  2L89 A;  4C5G A;  3X20 B;  4KH0 B;  3WXM B;  4Y92 A;  3H6Z A;  5KE2 A;  4ELZ C;  4QKU A;  1YI2 A;  3FDR A;  2K5I A;  1PHT A;  2BUD A;  3C0C A;  5GMK e;  3CD6 Q;  2K3Y A;  1U06 A;  2WSF E;  2J05 A;  3I55 A;  3CC7 A;  5HY6 A;  4AFQ C;  3OYY A;  2AZS A;  4E2F B;  3T9N A;  2JMA A;  5IAY A;  2LDM A;  3C94 A;  2RQV A;  2CT3 A;  2RMO A;  4A4E A;  1H64 1;  1Y96 A;  4XU1 A;  2E5Q A;  1K8A C;  1KD1 C;  1YHQ A;  2JVV A;  4MZP A;  1AVZ C;  3CBP A;  4FU6 A;  4LUE A;  2YRC A;  1UGQ B;  5DLO A;  3JB9 H;  1KQ1 A;  4E7K A;  3H0I A;  2JS0 A;  4PK4 A;  1G3T A;  2RF0 A;  5EG2 A;  3UDC A;  2EYW A;  1LOJ A;  3ZBD A;  3M0Q A;  1GCP A;  3CCJ Q;  5D6X A;  1CKB A;  2DVE A;  1Y96 B;  3EG1 A;  2M51 A;  4RG2 A;  1EFN A;  3A8G B;  1D0X A;  2WAC A;  3OYJ A;  1A0N B;  1WXT A;  1VQL A;  4J7F A;  2YDL A;  4MMK A;  3MEA A;  1MMG A;  1VQK T;  2KY9 A;  1BCM A;  4RCB A;  1VQ8 T;  1WJQ A;  4Z02 A;  4A4F A;  1ZUU A;  2X3X D;  4NS5 A;  1VQN A;  4RTY A;  2DK3 A;  4FT2 A;  2JN0 A;  3M0U A;  2CDT A;  4M78 E;  2GNC A;  4M7A B;  2D8J A;  2BE9 B;  1VQ9 A;  1ZBX A;  1VQO T;  4ZGE B;  2DXC A;  5GAN 3;  4FYY B;  1KIK A;  2PVG B;  2YXY A;  1RAD B;  4M75 B;  3RIR A;  2RI2 A;  2DD4 A;  2FYK A;  4E7J A;  2GBQ A;  1PSE A;  1ZSZ A;  2JTE A;  1YI2 Q;  3RES A;  3OYA A;  5CCA A;  5D7U A;  2X4Y A;  3E19 A;  3JRZ A;  3M9Q A;  1PKS A;  2OTJ Q;  3QYH B;  4Z88 A;  4J6W A;  2XG8 D;  1NJI C;  3TEE A;  3UAT A;  4BI8 B;  3EGD A;  1OEB A;  2LNV A;  3X28 B;  1V29 B;  2ZAE A;  2L3R A;  3MEW A;  5IHI A;  2M16 A;  4QQ6 A;  3UT1 A;  4F7U F;  2MOX A;  3JB9 D;  2DXT A;  4ZGD B;  1UUE A;  3HL8 A;  5GAN j;  4B6M A;  2DXB A;  2M0Y A;  1NBE B;  2XDB A;  2H3J A;  2K9G A;  2QTX A;  2F2V A;  1X6O A;  1BI1 A;  1YI2 T;  1E6G A;  2YUO A;  1T3S A;  4KUL A;  4MDW A;  2AHJ B;  2D8H A;  1JXO A;  2DL7 A;  1BU1 A;  2Y90 A;  2E6Z A;  2QDY B;  3CCS A;  2COW A;  5IH2 A;  1VQM Q;  2YRV A;  3M53 A;  3OA6 A;  2M02 A;  3CCV A;  1WDX A;  3CME Q;  3CCS Q;  3OQ5 A;  4XQ3 A;  1I0C A;  2YRD A;  2DIQ A;  1VUB A;  3OS5 A;  1G3W A;  3NHN A;  5GAN g;  4JUV A;  2AIR B;  4EMK B;  3OYI A;  3E2U A;  3QJY A;  4AFZ C;  2C0O A;  1Q82 U;  2F69 A;  1LJO A;  1JJ2 A;  2D9T A;  3E9G A;  3CCV Q;  1Q81 U;  1VQP T;  1J3T A;  2IG0 A;  4C0F A;  4J9E A;  1VQK Q;  4MZT A;  3MEV A;  4VUB A;  1TUD A;  3I56 A;  4J9B A;  3QII A;  2YWW A;  4KRT A;  2QQ9 A;  2E12 A;  5LL6 S;  1VIE A;  5GAN 2;  1AT1 B;  3VU3 C;  1TU0 B;  3MET A;  1UGR B;  5IHN A;  4F17 A;  1FMW A;  2FPF A;  1QP3 A;  4EMK A;  4JJD A;  5GAM g;  3X25 B;  1EZZ B;  5IXB A;  1VQK A;  2CP5 A;  4A4K A;  2MCN A;  3CCE A;  3A8O B;  1YCS B;  1BYM A;  1OV3 A;  2J6F A;  1RAB B;  1GBQ A;  2VVK A;  1JJ2 S;  1MUZ A;  3PIP A;  1U1T A;  4WCI A;  3JB9 J;  3I9Q A;  2E3H A;  3CEY A;  1R0C B;  1X6B A;  3L2U A;  2RI3 A;  4PKC C;  4M77 B;  2Z0W A;  2W0Z A;  1QVF A;  3UPU A;  2OTL A;  3REB B;  1UGV A;  3VS2 A;  1Y7X A;  2A0F B;  1ZUY A;  4M78 B;  3VUB A;  2QQB A;  4XTZ A;  8ATC B;  3L2Q A;  1HJD A;  2WSE E;  5KYY B;  4BDY A;  2K5F A;  1MHN A;  5GAN d;  3M4Y A;  4LD9 K;  3SFM A;  3CC7 Q;  1Q7Y U;  5LJ5 g;  4V2S A;  2C0I A;  2SRC A;  3PMT A;  4R0K A;  2D0N A;  3QXE B;  1HK9 A;  2DM1 A;  5C0M A;  2ROT A;  2EKH A;  2O88 A;  4FT4 A;  3G71 A;  1QVG P;  1QVP A;  2M0O A;  4C8Q G;  1K76 A;  2K6D A;  5FWC A;  1D0Z A;  1YN8 A;  4FSX A;  4OB0 B;  1VQ4 Q;  1WGS A;  1OZ2 A;  4NL2 A;  3RKY A;  2FHD A;  3CCM T;  4RTZ A;  1GFD A;  5GAN 7;  2FPD A;  1G3S A;  4J9F A;  3CCL T;  4J9C A;  2DF6 A;  1C6V X;  1ZX6 A;  2DE0 X;  4OB2 B;  4GLM A;  1RAF B;  4F7U B;  3CCJ A;  3OMC A;  1ZSG A;  4A4G A;  2KVQ G;  3CBO A;  2O2O A;  3TQ7 P;  1AOJ A;  2DBK A;  1BCO A;  2QQS A;  2ZGW A;  4XAX B;  3BY7 A;  3J80 E;  4JRP A;  3HRU A;  1SSH A;  3CCV T;  5LJ5 j;  3RMS A;  3ER0 A;  4EIK A;  2R5M A;  1GCQ C;  3RER A;  3G71 T;  2KSS A;  1OU8 A;  5LJ3 d;  1M90 U;  2MI6 A;  5GAN f;  2NUP A;  2VGN A;  1XNI A;  3QWX X;  1AWW A;  2GTO A;  4HA8 A;  4BDZ A;  1Q81 C;  2KK4 A;  4JRK A;  1D1B A;  5GAO r;  2QGG A;  4N4I A;  2GQI A;  2JNG A;  3QDR B;  1Q7Y C;  4BY6 B;  3CCR Q;  3I56 Q;  3EG9 B;  2CP0 A;  2D0Q B;  2HEQ A;  1P92 A;  3QZ9 B;  1NG2 A;  2F5T X;  1SG5 A;  4AFS C;  1U8R A;  2V8I A;  2DVJ A;  4FSS A;  6AT1 B;  1BB9 A;  1VQN T;  1JEG A;  3CPW A;  2DZ9 A;  4QQG A;  2CZ1 B;  4CC7 A;  3CPF A;  3C4S A;  4IIM A;  3OW2 A;  5GAN 5;  1WIE A;  3J81 E;  3FIF A;  3TSZ A;  5GAM d;  3QO3 A;  2L8D A;  2DL5 A;  3PTA A;  1ABQ A;  1Q95 G;  4FIB A;  4PJO D;  1I81 A;  2COY A;  3MP1 A;  3JCM h;  2K2M A;  1D1C A;  1WQW A;  3SWN A;  1XOV A;  2KRN A;  3H0H A;  1AWX A;  1IO6 A;  1JXM A;  2DTO A;  1X75 C;  1ZHI A;  5LJ3 j;  1N6A A;  1SHG A;  2FL7 A;  3CMA Q;  4KT0 E;  1JQQ A;  4NOY A;  1WX6 A;  3QKJ A;  1OYX A;  3PMI A;  2QEX T;  3LH0 A;  1SPK A;  4QVD A;  1ZA1 B;  2V26 A;  1ZQ1 A;  3QG1 A;  3JB9 G;  1YHQ T;  2ZPG B;  4BE0 A;  4L59 A;  1GRI A;  2ZPB B;  1OX9 A;  2E6N A;  3HRS A;  5GAO p;  1UTI A;  2A28 A;  5LJ5 d;  1WHJ A; 
#chains in the Genus database with same CATH homology
 1U06 A;  1AZG B;  2J06 A;  2J05 A;  2L3S A;  4AFU C;  4AFQ C;  3QWY A;  1K9A A;  2CT4 A;  2NWM A;  4AG2 C;  2AZS A;  1H3H A;  3I5R A;  2JMA A;  2EGE A;  3VRY A;  2HCK A;  2RQV A;  1AZE A;  2CT3 A;  2RMO A;  1W6X A;  1BBZ A;  4JJC A;  2FRY A;  2ROL A;  4RTW A;  5GJV B;  4LUD A;  2JM9 A;  2LNH B;  1AVZ C;  2ENM A;  4LUE A;  1GL5 A;  2CUB A;  2L3Q A;  2AKL A;  2XMF A;  3SHW A;  3TSW A;  1SEM A;  3H0I A;  2JS0 A;  2RF0 A;  4RTU A;  2EYW A;  1NM7 A;  2DIL A;  4J9I A;  1Y0M A;  3M0Q A;  1GCP A;  5IHK A;  1CKB A;  1NYF A;  2O9V A;  1U3O A;  1NEB A;  1KJW A;  2LP5 A;  2M51 A;  3EG1 A;  2FEI A;  1GBR A;  2DRK A;  2AZV A;  1EFN A;  2EQI A;  1A0N B;  4HVV A;  1WXT A;  2YDL A;  1VYV A;  1QKW A;  2ED1 A;  1RLQ C;  4CC4 B;  2LCS A;  3VS3 A;  4DEX A;  3LH5 A;  2K79 A;  3H41 A;  4LNP A;  3VS0 A;  2HSP A;  1ZUU A;  2LJ1 A;  2X3X D;  1M30 A;  1GCQ A;  1UEC A;  4RTY A;  1G2B A;  3M0U A;  2KE9 A;  1UJ0 A;  2CDT A;  2P4R A;  1YNZ A;  1VYU A;  2ESW A;  1M3A A;  1PRL C;  2GNC A;  3UA7 A;  2D8J A;  2W10 A;  2BZ8 A;  2KYM A;  3M0S A;  1K1Z A;  1MV3 A;  3REA B;  1KIK A;  1T0H A;  1AWJ A;  3M0P A;  4LE9 A;  2J6O A;  2LZ6 B;  1ZBJ A;  4JZ4 A;  2CH4 A;  2GBQ A;  3UA6 A;  1MV0 B;  2JTE A;  3FJ5 A;  2DJQ A;  3EHR A;  2DMO A;  2HBW A;  1PKS A;  4ZNX A;  4Z88 A;  1QWF A;  2KEA A;  1AD5 A;  4HCK A;  3UAT A;  1UE9 A;  1M27 C;  1HSQ A;  1OEB A;  5IHI A;  1CKA A;  2CUD A;  2MOX A;  1UUE A;  1OPK A;  1U5S A;  2YT6 A;  4ESR A;  2M0Y A;  4LN2 A;  5I22 A;  2L0A A;  4J9D A;  2K9G A;  2KXD A;  1PRM C;  1UJY A;  2GGR A;  2F2V A;  4OML A;  2C0T A;  1E6G A;  2YUO A;  2K7A A;  3VS1 A;  1T3S A;  2DX1 A;  2D8H A;  1JXO A;  3EG2 A;  1RUW A;  2DL7 A;  1WXB A;  1BU1 A;  5IH2 A;  1WYX A;  3EG3 A;  3JV3 A;  3O5Z A;  5ECA A;  1V1C A;  1GFC A;  1RI9 A;  2J6K A;  1WDX A;  4CC3 A;  2OI3 A;  4RTT A;  1I0C A;  2YUQ A;  1X2K A;  1I07 A;  3KFV A;  1T3L A;  2BZX A;  3EHQ A;  3NHN A;  1QCF A;  4AFZ C;  2C0O A;  2LJ0 A;  2KR3 A;  1ARK A;  2V1R A;  5HCK A;  2KT8 A;  1J3T A;  2PZ1 A;  3M0T A;  1UHC A;  5EC7 A;  4J9E A;  1WXU A;  2VWF A;  2KBT A;  1KFZ A;  4K11 A;  1BK2 A;  2EPD A;  2L3P A;  1TUD A;  1NLP C;  4J9B A;  4D8D A;  1JU5 C;  4KRT A;  2HDA A;  2A37 A;  2DL8 A;  2RPN A;  2KYB A;  2EVR A;  5IXF A;  3RNJ A;  5IHN A;  1FYN A;  4F17 A;  2FPF A;  4JJD A;  2JS2 A;  4HVU A;  4RUG A;  2EGA A;  2JT4 A;  2LQW A;  1Z9Q A;  1M8M A;  1PNJ A;  2DL3 A;  2DA9 A;  5IXB A;  2EW3 A;  2MCN A;  4RTX A;  1YCS B;  1OV3 A;  2J6F A;  3NGP A;  2DNU A;  2AK5 A;  1GBQ A;  2PNI A;  2VVK A;  1SRL A;  1OPL A;  1MUZ A;  2YUN A;  1VA7 A;  1X69 A;  4WCI A;  2EYY A;  1ZUK A;  2DL4 A;  2E5K A;  4M4Z A;  3SEM A;  1E7O A;  3TVT A;  2RN8 A;  3I9Q A;  2RQU A;  2LX7 A;  1X6B A;  2KRS A;  2BZY A;  1X43 A;  2O9S A;  4ORZ A;  3EG0 A;  2KGT A;  3ZL7 C;  3I5S A;  2W0Z A;  1QWE A;  3REB B;  1UGV A;  2EBP A;  3VS2 A;  4DEY A;  2KT1 A;  1W1F A;  1ZUY A;  2JMC A;  3RBB B;  3GBQ A;  1Z9Z A;  4JJB A;  1AWO A;  2IIM A;  4AG1 C;  1ABO A;  1HJD A;  1B07 A;  1CSK A;  2VKN A;  4OMO A;  2KNB B;  2KRM A;  1YP5 A;  4E6R A;  2RQR A;  1K0X A;  5GJW B;  2CH4 W;  2C0I A;  2SRC A;  1VYT A;  2D0N A;  4R0K A;  2DM1 A;  2ROT A;  2EKH A;  2O88 A;  1UHF A;  2FPE A;  3CQT A;  4OMP A;  4HVW A;  1K76 A;  2A08 A;  3ULR B;  2K6D A;  5FWC A;  1YN8 A;  4JPB W;  1TUC A;  1WA7 A;  4RTZ A;  1GFD A;  4OMN A;  2FPD A;  1W70 A;  1YWP A;  4J9F A;  2A36 A;  3VS6 A;  1X2Q A;  2KRO A;  2KXC A;  2DF6 A;  4J9C A;  1ZX6 A;  1N5Z A;  2DE0 X;  4GLM A;  3EGU A;  1ZLM A;  1ZSG A;  2JW4 A;  2O2O A;  1T0J A;  1NLO C;  1AOJ A;  2DBK A;  2RQT A;  2DYB A;  5I11 A;  2X3W D;  4JZ3 A;  5L23 A;  5FWB A;  1SSH A;  1NEG A;  1K0S A;  2QDL A;  4EIK A;  2B86 A;  1GCQ C;  5FW9 A;  1LCK A;  3VS5 A;  2RQW A;  2LMJ A;  1KSW A;  1TG0 A;  1Y57 A;  2H8H A;  4Z89 A;  2ECZ A;  2AKK A;  3IQL A;  4RTV A;  1OOT A;  1QLY A;  3QWX X;  1AWW A;  2GTO A;  4Z8A A;  1WI7 A;  1WLP B;  2I0N A;  1SRM A;  3U23 A;  4HXJ A;  3VS7 A;  3THK A;  1G83 A;  3H0F A;  2NUZ A;  1PKT A;  1M3C A;  2GQI A;  2JM8 A;  2MIO A;  2YUP A;  1SHF A;  2D1X A;  4IIO A;  3A98 A;  4OMM A;  3PVL A;  4GBQ A;  2CSQ A;  2HEQ A;  1AEY A;  1FMK A;  4D8K A;  1I1J A;  4A63 B;  1NG2 A;  2L2P A;  4J9H A;  4AFS C;  2DRM A;  2DVJ A;  2PTK A;  1UFF A;  4FSS A;  3PVQ A;  1BB9 A;  1H8K A;  3M0R A;  1JEG A;  3PE0 A;  3NMZ C;  2OAW A;  1B3Q A;  4CC7 A;  4IIM A;  2RNA A;  4QT7 A;  1RLP C;  2CRE A;  2V1Q A;  1K4U S;  1WIE A;  2FRW A;  1NYG A;  1S1N A;  1UG1 A;  3TSZ A;  3VRZ A;  2EYX A;  2FG0 A;  1M3B A;  4X1V A;  3VS4 A;  2DL5 A;  1YWO A;  2SEM A;  1ABQ A;  2CSI A;  2DLP A;  2LQN A;  2K3B A;  3UF4 A;  1X27 A;  1X6G A;  1H92 A;  3NPF A;  2K2M A;  1XOV A;  4F16 A;  2KRN A;  2F2W A;  1AWX A;  3H0H A;  2G6F X;  1IO6 A;  2EYZ A;  1WFW A;  1JXM A;  2ABL A;  3I35 A;  4OMQ A;  1SHG A;  1JQQ A;  2O31 A;  1WX6 A;  2JXB A;  4F14 A;  1UDL A;  3R6N A;  2DBM A;  2ED0 A;  2OJ2 A;  1E6H A;  1JO8 A;  1QKX A;  2EGC A;  1PWT A;  2BTT A;  1SPK A;  2YSQ A;  2FO0 A;  2J7I A;  4Y92 A;  4J9G A;  2LJ3 A;  2GTJ A;  1HD3 A;  2F2X A;  1GRI A;  4CC2 A;  1PHT A;  1UTI A;  2A28 A;  3C0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...