1BYMA

Solution structures of the c-terminal domain of diphtheria toxin repressor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
97
structure length
97
Chain Sequence
b'NPIPGLDELGVGNSDAAAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (DIPHTHERIA TOXIN REPRESSOR)
publication title Solution structure and peptide binding studies of the C-terminal src homology 3-like domain of the diphtheria toxin repressor protein.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 8
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1998-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bymA00
3HRUA 2LX9A 1G3WA 2H3JA 2GCXA 1FWZA 4O6JA 2K5IA 2K5FA 5CVIA 1BYMA 2QQ9A 2QQBA 1BI0A 3E19A 1G3YA 4O5VA 3GLXA 1BI1A 1U8RA 1G3SA 3MHXA 3HRSA 1BI3A 1FX7A 1G3TA 1QVPA 1P92A 2K5LA 2K4YA 3HRTA 2QQAA 1QW1A 1BI2A
chains in the Genus database with same CATH superfamily
1X27A 2FPEA 3CCUT 1AOJA 1HK9A 3A1PA 1YNZA 1RAGB 1K9AA 2LP5A 2VKNA 2X4YA 3M0QA 1I4K1 1TWBA 2E1HA 2F5TX 4J5YA 4C0ZA 2DM1A 4F14A 2OTLQ 1AWJA 5LJ3g 5DY9A 3CMAT 2DF6A 1W1FA 3C95A 3JAME 4PJMA 4C8QA 2M9UA 2E12A 1WXBA 4XTXA 2LT4A 2M16A 2CKKA 3FEOA 3JCMe 1KD1C 2CDTA 2P4TA 2K3XA 2HKQB 2JTFA 1K4US 4M78G 3JCMX 3RKYA 3JB9D 2R5AA 4HCZA 3CCRQ 2A08A 2AKKA 2PVOB 3SD4A 2LNHB 4AMCA 1PM3A 2XICA 4DEYA 4E7HA 1VQMA 5L23A 1M9SA 5L8RE 3FDRA 4BD3A 5GAN3 3PMTA 1OEBA 3N5BB 2DETA 4FT4A 2K57A 2KRNA 2M51A 2EW3A 3X25B 2OAUA 1QKWA 4XK8E 1RACB 5DLOA 3FIFA 2QTXA 1WX6A 4XQ3A 1I5LA 1ACMB 2EJGA 4FCYA 1K8AU 4CI0C 4JRKA 2AK5A 4DBQA 1UE9A 4HXJA 1QWFA 1VQKQ 2FHDA 2VGNA 1K8AC 4EMKB 1M8MA 5GJWB 2A36A 2H3JA 2FPFA 3NTHA 4JRQA 4Z8AA 3CMET 3I9QA 4AG1C 3VS2A 5HK3A 3J81E 1BB9A 4F7UG 2ZCFB 2IPOB 1GFDA 4JS4A 4X9DA 3HKSA 1YI2Q 1I07A 2CGHA 5GANe 2NWMA 2X35A 1MGQA 2H3EB 1Y57A 2DE0X 2XKOC 3OW2A 3PGGA 2EQJA 5GAOn 3CC2Q 2EJ9A 2PVDB 1U8RA 4LXCA 5LJ3h 2Y90A 4J9IA 1C1AA 3GP8A 1G83A 1EX4A 1KQ1A 1TSFA 4FYYB 4Z88A 2XDBA 1JEGA 1E7OA 1WFWA 1YP5A 4LE9A 3PE0A 3GPLA 3VYHB 2CP0A 3M0RA 4M7DE 4M78D 1VQNQ 3I56T 2LQWA 1MMAA 3OS2A 4CC3A 2GBQA 3OW2P 1IXDA 2M0OA 1FMKA 1V76A 3I5RA 1N8RU 2DVJA 3NPFA 3VUZA 3RESA 4BE0A 1VQ7T 3A98A 3L42A 1N8RC 3FRNA 1QCOA 1GCQC 2CP5A 3VUBA 1SRMA 3HL8A 2YUPA 4XTWA 1VQKT 4M77F 4EMKA 1M4ZA 3FB9A 3V7RA 1G3SA 2DILA 4N4HA 2JW4A 1WHLA 4WTOB 2DFUA 4NL3A 4DA4A 4M77C 4VUBA 3EG1A 4M75D 4MZMA 1Q86U 2MPXC 5GAOl 4QKUA 2O01E 1OV3A 3OMCA 1Q86C 1OQKA 1MHNA 4IIMA 2KGTA 1LOJA 1VQ6A 1TS9A 3KUFA 1YI2T 4HCKA 3VU3C 1VQMQ 2CS7A 3QPHA 4J9HA 1TH7A 4A54A 2NYSA 2OI3A 2QA4Q 2DLPA 3QZ9B 1IO6A 1K0XA 1AZGB 3S3OA 1MNEA 5D6YA 2JMAA 1M1KU 5LJ5e 3CCVA 4QQ6A 2DA9A 2CT3A 2GCXA 4M78B 4HCBA 1UHFA 1M1KC 1YJNQ 1ABQA 1D1CA 4EDUA 1DJ7B 1KQSA 4RUGA 3M58A 3CXCA 1Q81U 2HNIA 4ZGEB 2E4HA 2DTIA 2AZSA 1VQNT 1HD3A 1ZA1B 2RHUA 2DL8A 5C0MA 2DJZA 2KXDA 3CCST 1SEMA 1CSKA 3OYCA 1WHJA 3RKWA 5GAMj 3ER0A 4QVDA 4FL6A 1Q82C 1VIEA 1BKBA 4Y28E 2XD0A 1NJIU 2JJ9A 1UEBA 1KQSP 1NBEB 2BTTA 4M75B 2M0YA 1NJIC 4LDXA 1WHGA 3CXCP 2EKHA 2DYIA 3EH1A 4M7AB 3MCAB 5KYYB 3O5ZA 1Z9ZA 1NM7A 3OYEA 1RLPC 1QQJA 2F5KA 1Q7YR 2QQBA 1WJSA 3QXEB 1F1BB 1WHKA 2DL3A 4D8KA 2DL7A 2LQ8A 5FWBA 5GMKe 4J9CA 2HBPA 4JZ4A 2J7IA 5GMKi 3OS0A 2F1LA 1VQ5T 3GNGA 2RI3A 1RLQC 2EYQA 2X3WD 3EG9B 4L5GA 4HVUA 2RJDA 2EQIA 1D1AA 2BIVA 5J3BA 4RG8A 2HL5C 1K76A 1C0MA 2QEXQ 2V26A 3JCMg 2LTOA 4PKCC 3WVEB 3OS1A 3UDCA 4PJOC 4C8QG 3QSUA 4RCCA 5CQXA 1AWWA 1NLPC 3GBQA 2J6KA 3PNWC 4FW1A 3FJ5A 4M78A 1FYNA 3NTIA 3OYYA 1VQ4Q 3HTRA 1YJNT 5FU6C 2HZYA 2LZ6B 4JLIA 4ZN3A 3UA6A 3VYGA 3UATA 2RHIA 2QG9B 2EKOA 4D6WA 2HDAA 4PJNA 1PRLC 4II1A 5GANd 1WJQA 2KY9A 3TSWA 1TU0B 1IRXA 2ZPHB 1GXIE 4HCCA 1WXUA 5GMKm 3EFOB 2L89A 2K5LA 2BKDN 4J7IA 1D0ZA 1M3AA 1BIBA 5IHIA 4M77E 2KAFA 1LNXA 5IAYA 2AT1B 3DLMA 1YWOA 1GFCA 4M75A 3R6NA 1KD1R 4XU0A 1TUDA 4HT9A 4Z89A 4M7AA 3V7SA 4B6MA 5KYYA 1V1CA 2V1QA 3LX7A 2CP3A 3VS4A 1PCXA 1FX7A 1KJWA 5CKEA 1PC0A 3BDLA 4C92F 2QQRA 2GFUA 4JJDA 3OYHA 2YSQA 4J83A 1I81A 3EG9A 4NS5A 1RAIB 1N5ZA 2KK4A 1VQLQ 2L3RA 2MWPA 2ROTA 1QKXA 1M2OA 2QEXT 2OX7A 5IN1A 4KGXB 4F16A 1BCOA 3I55Q 4KGVB 2WSFE 4PL6A 3CCJQ 2P0PA 1BCMA 1K8AR 5M9OA 5AYFA 1R0BG 2K5FA 2LJ3A 4C8QD 4EMGA 2R58A 2RB6A 4X34A 4C0DC 2EYXA 4X1VA 1VQ4T 5CQYA 4ZGJB 1UECA 2YWWA 2BZXA 3E9FA 4AFZC 1YITT 2F69A 2VWFA 5GAN5 1HYOA 1RAEB 2DXUA 1VQ8T 2JTEA 3EFOA 3RMQA 2QK0A 3EGXB 1YFNA 1PG5B 4E6RA 4X9CA 3GLXA 3T9NA 1E6HA 4FYXB 3UWNA 3PIPA 4RMOA 1QVGS 1B3QA 4PFOA 1XNIA 1SF9A 2E6NA 4MDXA 3HRUA 1YJ9T 1OOTA 5FWCA 5FRMA 1D09B 2DXBA 3M0PA 5KYUB 3HHTB 3M0TA 3E19A 1M3CA 3PVLA 1G3YA 1LPLA 3RMSA 2K2VA 4OGCA 5FRNA 3I56A 3EG0A 3VS6A 4OGEA 4TVRA 2COZA 4PJOE 3CCMQ 2HEQA 4IKFA 4MZTA 2J06A 1YJWA 5CO7A 1UDLA 2A28A 4XTYA 3CPWA 1VQ7A 5LJ5g 1N8RR 2FZGB 5GANh 2XK0A 3I55T 5I22A 2O2OA 2DRMA 3VRYA 3OS5A 2DX1A 1M8VA 1KHCA 1QWEA 2FPDA 1R8OB 5EG2A 2W10A 4J9FA 2MWOA 3A8LB 2O31A 3G71Q 2LNVA 1Q86R 3CPWP 2LVMA 4J6WA 1KC8U 2RJEA 4M7DF 4PK4A 1RL2A 1KC8C 2LCSA 2P0KA 2D6FA 3EGXA 2A3LA 4J7FA 5I11A 1Y07A 3I35A 1YWPA 3S6WA 5FU7C 3LYIA 3CCQA 3DKMA 3OMGA 3Q1JA 1JJ2S 2KT1A 2OTJQ 1S72Q 4C92E 5KYUA 3OYAA 4A63B 2L8DA 2QQAA 1WPYA 2EIFA 2DXCA 2VXEA 1FWZA 2KNBB 3M4YA 2D0QB 1WHHA 1TXQA 3G4SA 1D1BA 1PSFA 3ULRB 1Q82R 1BI3A 4XU2A 3CCLA 2FRYA 2KYMA 2GTOA 4ELYC 3VS5A 4DBHA 2JMCA 1UUEA 4KUIA 4C0FA 5HKCA 2XDDA 1WYXA 3FC3A 3EGUA 2VV5A 3OYLA 5LJ5h 4OF1A 2MOXA 5LJ3j 2D9TA 2BE7D 3BW1A 3M54A 5A0DA 1VQPQ 1R0CB 4M77G 4OB2B 1QVPA 2B86A 4JJNK 2XMFA 5DM7R 3OYIA 1XTDA 1VQ5A 3G6EA 3G71T 5GAMf 2DBKA 1OPKA 1SSHA 2RQVA 3OY9A 1N6AA 3M59A 2RJFA 4O5VA 2CZ6B 2OJ2A 3C94A 4HA8A 2RM4A 2DZ9A 2VVKA 1PD1A 2CUDA 4M75G 3OB9A 3X26B 2DBMA 1Y0MA 2D8HA 4M7AG 2Y4YA 2DL4A 2K5IA 1AWXA 1YIJT 3CCEA 1W2BS 1WIEA 2XDPA 3QZ5B 1T3SA 3ASKA 2LDMA 4OMOA 2HCKA 2GNCA 4J9GA 4ATOA 4XTVA 3C4SA 2OTLT 5GMKh 3JCMP 2KRSA 3EAEA 4ZTJA 3ZEHA 2L0AA 3PMIA 1Y7XA 2BE9B 3OYMA 3TVTA 2R57A 1AVZC 1D0YA 1KG1A 2B8AA 2GQVA 2A37A 5EC7A 3EG2A 5GAN7 2X4JA 1A0NB 2VGMA 2ABLA 3JCMc 4KUDK 4N4IA 3L2UA 2ZPEB 3X28B 4MMLA 1VQOA 4NL2A 3E9GA 1NLOC 4JJCA 3JCMV 2CSIA 4A4KA 3CCRT 1WI7A 4MDWA 2FZCB 4YTLA 1X69A 3F70A 1MMGA 4LDWA 2M1HA 4A4GA 4BI3A 2GFAA 4KH1B 4KGZB 2J05A 4M77D 2O88A 3CC7Q 2XI9A 1ZLMA 3BE3A 3CD6Q 2NUZA 2V8KA 5IT9E 1VIFA 1AWOA 3DB4A 5D6XA 4EPCA 2YRDA 4JUVA 1X01A 2CUBA 2DNUA 2DXTA 4N0AA 3NGPA 1LJOA 2V1RA 4ORZA 2DEUA 2GTJA 3MHXA 1H3HA 3P8DA 2YRVA 3WXMB 4J9BA 5GMKl 3OBYA 3CCLQ 2L3QA 2C0OA 4BE1A 1YN8A 2GF7A 3INZA 1YITA 4M7AD 3EH2A 2VASA 3G1JA 4FU6A 4LDYA 3H9NA 4XTZA 1VQ8A 3A8OB 1Q95G 1VUBA 2RK2A 2MCNA 1VYVA 3QKJA 4FM4B 5GANf 3QJ6A 4FSSA 2K6DA 1X6OA 1BK2A 3CC2T 2QGFB 2RI5A 2DJQA 3L2RA 3CC4A 2EYZA 3MEVA 2FEIA 4RTZA 1UG1A 1YJ9A 2DIGA 1PNJA 4OP0A 1I1JA 2CH4A 2SEMA 2RD1A 2YT6A 1M90R 4ANJA 4M77B 3SB2A 2CSQA 3GNFB 4AFSC 1SKUB 2IIMA 1QVFA 4D8DA 5J39A 1Q81C 4OMFB 5AT1B 4ESRA 2LX9A 4C92G 2I2LA 2JTMA 5CAIA 3D7SB 3CC7T 1VA7A 2ZAEA 1SRLA 2HKNA 4DBRA 2EYWA 3JCMd 1HSQA 1UGQB 2EPDA 2KBTA 3M9QA 2LJ1A 3NTKA 1YHQA 4FIBA 1MNDA 2C0TA 2CZ7B 2QI2A 1VQ9A 2QDLA 2WSEE 3L2VA 1S1NA 1QVFP 5KE2A 3S3MA 3EFRA 1M2VB 4GBQA 1SPKA 2HBWA 3H8ZA 1X6BA 2ZZDA 4JRIA 3X20B 5KCOA 3A8GB 2EQMA 4MZPA 3TSZA 4AFQC 5C6SA 4OMLA 1X2QA 2MMPA 1N9RA 2PVGB 1U1SA 1NEBA 4PJOF 3REBB 2RQTA 4OMPA 1R77A 1VQMT 2QA4T 2J6FA 1WHMA 1EFNA 5GAN4 1GCQA 5A0GA 3H41A 2KI7A 1QLYA 1YBYA 5CKBA 4IURA 4M77A 2L5QA 3OQ5A 2XIDA 3CCUA 5FLXE 1PSEA 2K7AA 2KMTA 1UHCA 2X51A 4OB1B 2MF2A 2MAMA 2VYTA 1H8KA 1OU9A 3CMAA 1XJWB 2JS2A 2KEAA 4FYVB 1UFFA 3RNJA 2HQHA 1I8FA 4GLKA 1QMCA 2KXCA 5CCAA 4C92D 3THKA 4PJOB 3QJYA 1UB4A 2J6OA 2LX7A 1VQ6Q 2RQUA 3S3NA 8AT1B 1WLPB 2LQKA 2LC4A 3SWNC 1QP2A 1IZ6A 4KT0E 1M2VA 5GAOm 2QYZA 1QW1A 2FRWA 2JS0A 3CC4Q 3CCVQ 2K3YA 2PTKA 5KCHA 3VRZA 3JB9J 3OW2S 3M0UA 3HP9A 1QCNA 3RKXA 2EGEA 3VS0A 3HFNA 2C0IA 3MP8A 3ME9A 3H0FA 4AFUC 5DLQE 3HRTA 4M7DG 1ZSZC 2DO3A 3O8VA 3UPUA 3E2UA 2E3IA 1FXXA 2X9HA 7AT1B 3ZFJA 1K73U 5LJ3f 2G3RA 1Z9QA 5GANj 1JQQA 1JXOA 3JCMh 1BI0A 3EHQA 5LL6S 2K3BA 1K73C 3IQLA 4FT2A 3CMEA 4CC4B 1YIJA 2DVEA 3QUIA 1EZZB 4F7UE 3EHRA 2CREA 3SDZA 1B07A 4QT7A 2KRMA 4PFZA 2LJ0A 2OTLA 1WGSA 4C92B 3QIIA 2HD0A 2WSCE 4BY6C 3JCMW 1XQHA 2VB6A 1JBMA 4EIKA 1KIKA 3R6OA 3TCJA 1U1TA 2FL7A 3EFSA 2RHYA 1U06A 5LJ5d 3OYBA 4PJOA 1OZ2A 3QYGB 3EGDB 4L6V5 2QASA 4BDZA 4C8QF 3QDRB 2EGAA 1GCPA 1X2KA 1WZOA 4Z02A 2RA2A 2E41A 4C8QC 3CCRA 4JPBW 2FYKA 2HSPA 2JT4A 1RAAB 4LN2A 2NLUA 2CYZB 4HVVA 4QQDA 3BFMA 1HJDA 3TQ7P 3SEMA 2JXBA 2YHTA 2DD5A 1QP3A 1BI2A 3QWYA 1UGPB 2RHZA 1MUZA 3A8MB 4RG2A 1VQLT 1G2BA 3RR6A 3WVDB 2ESWA 4C5EA 2ED0A 4V2SA 2K2MA 4B9WA 1OYXA 4Q5WA 3LWHA 1NPRA 1ZX6A 2MK5A 4J9EA 4ZTFA 2RQRA 3CCJT 1VQKA 4BI8B 3CXCS 4M7DD 3VKIA 1V29B 1KSWA 5I21A 4XU3A 2DD4A 1GL5A 2L2PA 3SFMA 2NUPB 1RI0A 2O9VA 1YCSB 2LT1A 3AHUA 4IIOA 5LJ5j 2JVVA 2MI6A 3QHSA 2YDLA 1VYTA 4C92A 1IGUA 1Q7YU 2EWNA 1YI2A 2EBPA 1B7TA 2JUFA 3V8KA 1RI9A 4KH0B 3C12A 4PLLA 2IVWA 5GAMe 1Q7YC 1BBZA 3KXTA 2C06A 1SG5A 1JU5C 2DTHA 2ECZA 3CC2A 4ZN1A 3EGDA 3CBOA 4OMNA 3QG1A 1JRIA 2NUTB 3LLRA 8ATCB 1BI1A 1SHFA 4RTTA 1M1KR 1WJRA 1WXTA 2FB7A 4BDYA 2E5KA 5GJVB 1YCYA 1OZ3A 5IHKA 2KDSA 1ZQ1A 3DLLA 2FZKB 4Y92A 1VQNA 1H92A 2COWA 1Q81R 2HQXA 3CCSA 3GF5A 1ZUUA 3CCMT 4LUDA 3DB3A 1ZBXA 2XU8A 2DIQA 3ZBDA 1G8XA 5KH6A 9ATCB 2E6ZA 2QAZA 4M7DB 4J8OA 4IUTA 3JSCA 5CKDA 5GMKj 4LDUA 1X75C 2CH4W 3CPFA 2E64A 4J6XA 1EIFA 1NZ9A 2RK1A 5FU7B 4C5IA 1AHJB 4XAXB 2DL5A 1NJIR 1PRMC 1TG0A 1M5Q1 5IXBA 2AHJB 3M57A 2NUPA 2YLBA 3MJXA 1KD1U 2JOYA 2GQIA 2HQEA 1PWTA 4N0AC 4EMKC 1K0SA 1PKTA 2EAYA 2EYYA 1PKSA 2AIRB 1RAHB 1NE8A 4E7SA 2DMOA 1AZEA 1BYMA 5CIUA 2O9SA 4R55A 3OYDA 2HSEB 3C0CA 2YUQA 3I56Q 1GRIA 2QA4A 4C8QE 2PZ1A 1U3OA 4HT8A 5CK9A 3M0SA 1TUGB 2NUTA 2QTVA 3UF4A 3JB9F 1YJWQ 2VUBA 5HY6A 2OTJT 1VQ7Q 3VV0A 4R56A 3FJPA 1S72T 1YJNA 3CBMA 4AT1B 3PVQA 1W6XA 1RABB 2KVQG 4A4HA 4RTUA 3OYNA 1P92A 2FO0A 4LUEA 4OMQA 2X4WA 4E47A 4E7LA 2P84A 2PQWA 4E2FB 4M7DA 2CT4A 1MMDA 1VOMA 2BZ8A 2YLCA 3QYHB 1H3ZA 3RERA 5GAOr 1IHWA 2DEQA 4DOVA 5GAOq 4RTVA 2F2VA 4ZGDB 5IH2A 2K9GA 3PIOA 2FG0A 1TTHB 3PT9A 3JCMf 3H0IA 2AZVA 1G3WA 2MYSA 1RAFB 3JCMb 3CCQQ 4PJJA 2EGCA 1VQPT 1SHGA 2I0NA 1UGSB 2IG0A 3AT1B 4A4FA 4K11A 1IB8A 3UA7A 2QQSA 3JB9I 2YXYA 1LVKA 3PTAA 1ABOA 1GBRA 1I5OB 1U5SA 2QEXA 1OX9A 1BIAA 2G6FX 2EQKA 1NYGA 3JB9H 1NPPA 3HFOA 3MEAA 1JO8A 2RO0A 3CCSQ 4PJOG 3G4SQ 2LMJA 2PUOB 2A0FB 3LWIA 3JRZA 1MV0B 1YJWT 1K73R 1ZBJA 2RMOA 2AKLA 5KYXB 2Z0WA 1HXDA 1VQ4A 3M56A 4M78F 5I2MA 5IXFA 2E3HA 3TEEA 4UC4A 4M78C 3CPWS 3MEUA 3KBGA 2H8HA 3QBYA 1QVGA 4E7ZA 2HMAA 5GAMd 2JNGA 4CRIA 4RCBA 4MMKA 2WACA 1KHIA 3FLGA 1GBQA 5FW9A 1SSFA 3RDVA 3LH0A 1VQ5Q 3G6EQ 4IUQA 1LCKA 1M3BA 2ZPFB 3NFCA 4XU1A 2EJFA 3M53A 1K9MU 3L2QA 5KYNA 4RTXA 1H641 1VYUA 4C5HA 3G7ZA 4M75F 2O4XB 5CKHA 1K9MC 1X6GA 3JCMQ 2EQUA 4KRTA 1QVGP 4OVAA 3KFVA 4M7AF 5I2SA 2EVRA 2ZPBB 2E5QA 4M75C 4QW2A 4XTUA 4BB7A 3CCQT 1D0XA 3MKDA 2ED1A 3M4GA 2P0QA 4M7AC 2E70A 5GAMg 3JCMJ 4F7UF 1T0HA 2L3SA 1VQLA 3CCEQ 2LCCA 1C6VX 4NOYA 3CD6T 1WQ7A 4J6YA 5GAN6 5A0LA 1KQ2A 2X4XA 1JXMA 4PLIA 2GGRA 4GLMA 3MEWA 4PNOA 3UT1A 1M30A 3I55A 3CCJA 2XG8D 1NEGA 1Q82U 2RPNA 2D8JA 4A53A 3G4ST 3VJPA 3V8LA 4LNPA 4PJOD 5KYXA 4FSXA 4LD9K 2XHCA 2JZ2A 1ZHIA 3A8HB 3BDUA 3CCLT 4C5GA 4M4ZA 4IUUA 2MIOA 2ZPIB 2DKGA 3I5SA 3L1AA 1VQOQ 1M1GA 2A7YA 4IUVA 3LGLA 4F17A 4AG2C 1I0CA 1KC8R 3V8JA 4JLGA 3VS7A 2CP6A 1JJ2A 4F7UB 1B34B 3J80E 4HKEA 2V8IA 3OBWA 1PD0A 2RNAA 3G6ET 2YRCA 3A5ZB 2DTOA 3LW5E 4E7JA 1FMWA 1QCFA 2O4XA 5LJ5f 3MO8A 5LJ3e 4B9XA 2CZ1B 4JZ3A 2RF0A 2RN8A 1FMVA 5GAN2 1PHTA 3RBBB 2PU9B 1JJ2P 3CCMA 3H0HA 4DOWA 2QXFA 3HSBA 2LQNA 1IGQA 4CC2A 2CP7A 3CCET 1E6GA 1YITQ 2LCLA 3VS1A 2RI2A 4QQGA 3P8HA 5GAMh 2KYBA 2JM8A 1JB0E 1VQ8Q 4M78E 2QGGA 1OU8A 4LD6A 3E1SA 2VC8A 2P4RA 2W0ZA 2ZGWA 1N27A 2DZCA 1W4SA 3L2ZA 5FU6B 2BZYA 2HL3A 2ZPGB 3LGFA 4JRPA 2M02A 4JJBA 3PFSA 5CVIA 3G71A 4HVWA 1YJ9Q 5GAOp 1T0JA 2VXFA 2DRKA 2KE9A 4E7KA 1UGVA 1CKAA 1UJYA 2X3XD 5IHNA 5A2QE 1VQOT 3M5AA 2JN0A 3RIRA 4BI4A 3NMZC 4BE2A 1OI1A 3TREA 4F7UA 1X43A 1B34A 4F04B 5GANg 2D0NA 3CEYA 3OYFA 3M55A 2BUDA 4C92C 4M75E 4O6JA 1BU1A 4N4GA 4Y91A 5CR2A 1W2BA 2QQ9A 2OTJA 2RJCA 4M7AE 3H6ZA 4RTYA 1D3BB 1S72A 1AEYA 1OPLA 4J9DA 3SWNB 4LDVA 2PUKB 2LRQA 2KQWA 4EMHA 2K4YA 3OYKA 4OB3B 1AD5A 5KE3A 1YHQQ 4ELZC 1UTIA 1RADB 4ZNXA 3RUXA 3OYJA 1UGRB 1VQ9Q 4A4EA 4P5NA 2CZ0B 3OSVA 3U23A 4WCIA 2L3PA 1J3TA 4FW2A 1CKBA 1W2BP 1OULA 1O9SA 3SHWA 2ROLA 3QDFA 1G3TA 4QVCA 1ZSZB 2JM9A 2Y4XA 3REAB 1ZSGA 5KYWB 2DPPB 1Y96B 2E65A 4DEXA 2RH2A 3QO3A 1VQ6T 1M27C 3P8BB 1AT1B 3MP1A 4OMMA 4FYWB 1WDXA 5HK0A 2COYA 3J7AF 4C0DB 1T3LA 4JDSA 3QWXX 1K1ZA 4RKUE 1VQPA 6AT1B 2KSSA 4GY5A 3L2WA 4OB0B 3CC4T 1Y71A 3CCVT 4IUPA 1M90U 2DK3A 5D7UA 3MP6A 4BY6B 1M90C 3BY7A 5D6WA 2DAQA 2ENMA 3OYGA 3CCUQ 2KR3A 2HAXA 5HCKA 3NHNA 3GIBA 1ZA2B 2KROA 1NYFA 1OX8A 3HRSA 1KQSS 5J26A 2YUNA 3CMAQ 4JS5A 2DYBA 2SRCA 2R5MA 1D3BA 1QVFS 3OSSC 3X24B 3SWNA 4PFPA 2D1XA 4C8QB 1MMNA 4PJLA 3OA6A 1ARKA 3CBPA 3TU4K 1WA7A 3JB9G 1M1FA 2FVUA 4C0GA 2F2XA 1KK7A 1YHQT 1XOVA 4BACA 1VQ9T 1ZUYA 4R0KA 2OAWA 4QVZA 4KBMB 1IREB 4L59A 1W70A 2E10A 1WNLA 2V8JA 2PNIA 3ZL7C 1ZSZA 1UJ0A 4RTWA 1KFZA 4KULA 2CP2A 3JV3A 4E7IA 2DERA 4ME7A 1N9SA 5KYWA 3EG3A 1TUCA 1Y96A 4DBFA 2F2WA 2EFIA 5LJ3d 5CKFA 4M7DC 2ATCB 4DQ2A 1K9MR 2KT8A 1O75A 3LH5A 1RUWA 3GOXA 4CC7A 1WQWA 1TOVA 3URGA 1NG2A 1MV3A 3HPWA 1G5VA 2QDYB 5GAN8 3META 4WF2A 3V7CA 2RQWA 5FROA 3VS3A 2K79A 1ZUKA 5ECAA 3CMEQ 1YIJQ 4BUGA 2YUOA 3CC7A 2RHXA 3CD6A 3MPUB 1IHVA 3CQTA
chains in the Genus database with same CATH topology
2F69A 3CCUT 2QEXA 4PJOF 1HK9A 1BIAA 5GAN5 2EQKA 2DXUA 2X4YA 1VQ8T 3JB9H 1NPPA 1I4K1 2E1HA 4J5YA 2F5TX 3HFOA 4C0ZA 3MEAA 1VQMT 2RO0A 3RMQA 5LJ3g 4PJOG 2QA4T 5DY9A 4X9CA 3GLXA 3T9NA 3CMAT 3UWNA 2PUOB 5GAN4 3PIPA 4RMOA 3LWIA 1QVGS 3C95A 3JRZA 1XNIA 5A0GA 3JAME 4C8QA 2M9UA 2E12A 1YJWT 4XTXA 2LT4A 1HXDA 2M16A 2CKKA 3FEOA 1VQ4A 3JCMe 3M56A 2E6NA 4M78F 1YBYA 5CKBA 5I2MA 4MDXA 3HRUA 1YJ9T 1KD1C 2P4TA 4IURA 2K3XA 5FRMA 4M77A 2DXBA 2JTFA 2L5QA 3OQ5A 3TEEA 3HHTB 4UC4A 4M78G 3JCMX 2XIDA 4M78C 3RKYA 3CPWS 3JB9D 2R5AA 3E19A 3MEUA 3CCUA 4HCZA 3KBGA 1G3YA 1PSEA 5FLXE 3QBYA 2PVOB 3SD4A 3RMSA 2K2VA 1QVGA 2KMTA 2XICA 4OGCA 5FRNA 3I56A 5GAMd 4E7HA 2JNGA 4OB1B 4OGEA 4TVRA 4RCBA 4MMKA 4CRIA 1VQMA 2WACA 4PJOE 1M9SA 1KHIA 2MF2A 3FDRA 3FLGA 5L8RE 4BD3A 2MAMA 2VYTA 3CMAA 4IKFA 1SSFA 4MZTA 3LH0A 5GAN3 1YJWA 3PMTA 3N5BB 4IUQA 1I8FA 4GLKA 5CO7A 4FT4A 2K57A 4XTYA 5CCAA 3CPWA 3X25B 2OAUA 2ZPFB 3NFCA 4XU1A 4C92D 5LJ5g 1VQ7A 4PJOB 5GANh 2EJFA 3QJYA 3CC4A 3M53A 1UB4A 4XK8E 1K9MU 5DLOA 3L2QA 1H641 3FIFA 2QTXA 2XK0A 4XQ3A 1I5LA 2EJGA 3S3NA 4C5HA 3G7ZA 4M75F 3I55T 2LQKA 2O4XB 1K8AU 5CKHA 4CI0C 1K9MC 2LC4A 4JRKA 3JCMQ 2EQUA 3SWNC 4OVAA 1QP2A 1IZ6A 2FHDA 4KT0E 4M7AF 3OS5A 2VGNA 5I2SA 2ZPBB 2E5QA 4M75C 4EMKB 5GAOm 1K8AC 4QW2A 4XTUA 4BB7A 1M8VA 1QW1A 3CCQT 1KHCA 3M4GA 2P0QA 1R8OB 4M7AC 2E70A 2H3JA 5GAMg 5EG2A 3NTHA 2K3YA 3JCMJ 4JRQA 4F7UF 2MWOA 3CMET 5KCHA 3A8LB 3JB9J 2LNVA 3OW2S 1VQLA 5HK3A 3J81E 2LVMA 4J6WA 1KC8U 3HP9A 2LCCA 2RJEA 4NOYA 4F7UG 3CD6T 1WQ7A 4J6YA 3RKXA 5GAN6 2ZCFB 5A0LA 1KQ2A 4M7DF 3HFNA 4JS4A 2X4XA 4PLIA 1RL2A 1KC8C 3MP8A 3ME9A 3MEWA 4PNOA 2P0KA 3UT1A 4X9DA 3HKSA 5DLQE 2CGHA 3HRTA 3I55A 5GANe 2D6FA 4M7DG 3O8VA 2DO3A 2X35A 3CCJA 2XG8D 1MGQA 3UPUA 2A3LA 1FXXA 1Q82U 4J7FA 1Y07A 4A53A 3ZFJA 3G4ST 2XKOC 1K73U 3VJPA 3S6WA 5LJ3f 2G3RA 5FU7C 3V8LA 3LYIA 3PGGA 3OW2A 3CCQA 3DKMA 5GANj 2EQJA 4PJOD 3OMGA 3JCMh 1BI0A 5GAOn 5LL6S 3Q1JA 4FSXA 4LD9K 2XHCA 2JZ2A 1K73C 1ZHIA 2EJ9A 3A8HB 3BDUA 4FT2A 3CCLT 2PVDB 1U8RA 5LJ3h 2Y90A 4C92E 3CMEA 1YIJA 2DVEA 4C5GA 3GP8A 3QUIA 4IUUA 1KQ1A 3OYAA 4F7UE 2ZPIB 2DKGA 2L8DA 2QQAA 1U1SA 3L1AA 2XDBA 1M1GA 1WPYA 3SDZA 2A7YA 3GPLA 4IUVA 3LGLA 2EIFA 3V8JA 2DXCA 3VYHB 4JLGA 1WGSA 4C92B 3QIIA 2OTLA 2HD0A 2WSCE 4BY6C 2VXEA 1FWZA 3JCMW 4M78D 4M7DE 1XQHA 1JJ2A 3I56T 3M4YA 2D0QB 1JBMA 3R6OA 4F7UB 3OS2A 1B34B 3J80E 3G4SA 4HKEA 3TCJA 1U1TA 2V8IA 2FL7A 1PSFA 2M0OA 3OBWA 3EFSA 3G6ET 2RHYA 1N8RU 5LJ5d 1BI3A 4XU2A 3OYBA 4PJOA 3CCLA 3A5ZB 1OZ2A 3QYGB 3RESA 3VUZA 4BE0A 1VQ7T 3L42A 4L6V5 4ELYC 2DTOA 4BDZA 3FRNA 4C8QF 1N8RC 3QDRB 3LW5E 4E7JA 4KUIA 4C0FA 5HKCA 2XDDA 2O4XA 5LJ5f 3FC3A 4Z02A 3MO8A 5LJ3e 3VUBA 3HL8A 4B9XA 2RA2A 2E41A 4XTWA 2CZ1B 2VV5A 4C8QC 3CCRA 3OYLA 2FYKA 4M77F 4EMKA 1M4ZA 3FB9A 5LJ5h 4OF1A 5GAN2 1VQKT 3V7RA 1G3SA 5LJ3j 4N4HA 2PU9B 2D9TA 2CYZB 2NLUA 4QQDA 4NL3A 3BFMA 3BW1A 3M54A 5A0DA 3CCMA 4DOWA 4M77G 2QXFA 4DA4A 4OB2B 4M77C 3HSBA 2YHTA 2DD5A 4VUBA 1QVPA 4JJNK 4M75D 5DM7R 3OYIA 1XTDA 4MZMA 1Q86U 5GAOl 1QP3A 1BI2A 1VQ5A 3G6EA 3G71T 1UGPB 2RHZA 3A8MB 5GAMf 4RG2A 2O01E 3CCET 3OMCA 1Q86C 1VQLT 2LCLA 2RI2A 4QQGA 3OY9A 1MHNA 3WVDB 4C5EA 1N6AA 3M59A 3P8HA 5GAMh 4V2SA 1LOJA 1JB0E 1VQ6A 3KUFA 4B9WA 2RJFA 4O5VA 1OYXA 4Q5WA 1YI2T 3LWHA 2CZ6B 1NPRA 3VU3C 3C94A 2CS7A 3QPHA 4M78E 1TH7A 4A54A 4ZTFA 3CCJT 1VQKA 4BI8B 4LD6A 3E1SA 3CXCS 4HA8A 3QZ9B 2RM4A 2VC8A 2DZ9A 4M7DD 3VKIA 4M75G 3L2ZA 1V29B 2DZCA 1N27A 1W4SA 2ZGWA 5D6YA 5FU6B 3S3OA 2ZPGB 5I21A 1M1KU 4XU3A 3OB9A 3LGFA 3X26B 5LJ5e 3CCVA 2DD4A 4JRPA 4QQ6A 4M7AG 2GCXA 2Y4YA 3SFMA 4M78B 4HCBA 1RI0A 2K5IA 1M1KC 3PFSA 2LT1A 5CVIA 3G71A 1YIJT 5GAOp 3AHUA 5LJ5j 2JVVA 3CCEA 4EDUA 1W2BS 1DJ7B 1KQSA 2VXFA 2MI6A 2XDPA 3QHSA 3QZ5B 5A2QE 4E7KA 1VQOT 3M58A 3CXCA 3M5AA 4C92A 3ASKA 1Q81U 2JN0A 2HNIA 3RIRA 4ZGEB 1Q7YU 2LDMA 2EWNA 4BI4A 1YI2A 2DTIA 4ATOA 2JUFA 3V8KA 1VQNT 4XTVA 3C4SA 3C12A 1OI1A 3TREA 4F7UA 2RHUA 1B34A 4PLLA 2IVWA 5GAMe 5C0MA 3EAEA 2DJZA 3CCST 3JCMP 5GANg 1Q7YC 3KXTA 2C06A 3CEYA 4ZTJA 3ZEHA 3OYFA 3M55A 3OYCA 2BUDA 3PMIA 1Y7XA 4C92C 4M75E 3OYMA 2R57A 2DTHA 4O6JA 1KG1A 4N4GA 4Y91A 3RKWA 5CR2A 5GAMj 4ZN1A 2QQ9A 3ER0A 4QVDA 1W2BA 3CC2A 2B8AA 2GQVA 4FL6A 1Q82C 2OTJA 1VIEA 1BKBA 2RJCA 1JRIA 3CBOA 3LLRA 3QG1A 4M7AE 1BI1A 2X4JA 3H6ZA 1D3BB 2VGMA 4Y28E 5GAN7 1S72A 2XD0A 1NJIU 3SWNB 4LDVA 3JCMc 4KUDK 2PUKB 1WJRA 4N4IA 2LRQA 3L2UA 1UEBA 2KQWA 2FB7A 2ZPEB 4M75B 4EMHA 4BDYA 3X28B 1NJIC 4LDXA 2K4YA 4MMLA 3OYKA 1VQOA 1YCYA 4NL2A 3E9GA 4OB3B 1OZ3A 5KE3A 4ELZC 2KDSA 4M7AB 3JCMV 1ZQ1A 4A4KA 3CCRT 3MCAB 3RUXA 3OYJA 1UGRB 3DLLA 4MDWA 4A4EA 4P5NA 2CZ0B 1VQNA 3OSVA 3OYEA 4BE2A 4YTLA 2F5KA 2HQXA 3CCSA 2QQBA 3GF5A 1WJSA 3F70A 3CCMT 3QXEB 4LDWA 3DB3A 2M1HA 4A4GA 2LQ8A 1ZBXA 5GMKe 4BI3A 2HBPA 2XU8A 2GFAA 1O9SA 4M77D 5GMKi 2DIQA 3GNGA 3ZBDA 3OS0A 1VQ5T 2RI3A 5KH6A 2EYQA 2E6ZA 1G3TA 4QVCA 4M7DB 4J8OA 2XI9A 4IUTA 4L5GA 2RJDA 3JSCA 2V8KA 5CKDA 4LDUA 2Y4XA 2BIVA 5GMKj 5IT9E 1X75C 5J3BA 4RG8A 1VIFA 3CPFA 2DPPB 2E64A 4J6XA 1Y96B 2E65A 3JCMg 2RK1A 1EIFA 1NZ9A 2LTOA 2RH2A 3QO3A 4PKCC 5FU7B 1AHJB 4XAXB 4C5IA 1VQ6T 3P8BB 3MP1A 2OTLT 3DB4A 5D6XA 3WVEB 4EPCA 3OS1A 4JUVA 3UDCA 5HK0A 4C8QG 4PJOC 5GMKh 1X01A 4N0AA 2DXTA 3QSUA 4RCCA 1LJOA 5CQXA 3J7AF 4C0DB 1M5Q1 4JDSA 3MHXA 3P8DA 3PNWC 4RKUE 2YRVA 1VQPA 3WXMB 2AHJB 3M57A 2YLBA 4M78A 2KSSA 1KD1U 4GY5A 3L2WA 5GMKl 3OBYA 3NTIA 2JOYA 1Y71A 4OB0B 3CC4T 3CCVT 2HQEA 4N0AC 3OYYA 4IUPA 1M90U 1YJNT 5FU6C 4EMKC 2DK3A 4BE1A 4JLIA 4ZN3A 2GF7A 3VYGA 3MP6A 3INZA 4BY6B 1YITA 4M7AD 2EAYA 2RHIA 4FU6A 3BY7A 5D6WA 1M90C 2EKOA 4LDYA 4D6WA 1NE8A 2DAQA 3L2RA 1BYMA 5CIUA 3OYGA 4R55A 3OYDA 4XTZA 1VQ8A 3A8OB 2HAXA 3GIBA 4II1A 5GANd 1WJQA 2KY9A 1VUBA 2ZPHB 3HRSA 2QA4A 4C8QE 1KQSS 2RK2A 1GXIE 4HCCA 3QKJA 5GMKm 5J26A 4HT8A 2L89A 2K5LA 2BKDN 4FM4B 4J7IA 5CK9A 4JS5A 5GANf 2R5MA 3QJ6A 1D3BA 1QVFS 1BIBA 1X6OA 3CC2T 3JB9F 2RI5A 3OSSC 4M77E 2KAFA 3X24B 2VUBA 1LNXA 5HY6A 3SWNA 3MEVA 5IAYA 3DLMA 2OTJT 4C8QB 3VV0A 3OA6A 4R56A 3FJPA 1S72T 4M75A 1YJ9A 2DIGA 1YJNA 3CBPA 3TU4K 3CBMA 3JB9G 4OP0A 1M1FA 2FVUA 4XU0A 4C0GA 4HT9A 2RD1A 4M7AA 3V7SA 1YHQT 2KVQG 4M77B 3SB2A 3GNFB 1XOVA 4BACA 3LX7A 1VQ9T 4A4HA 1FX7A 5CKEA 3OYNA 1P92A 3BDLA 1QVFA 2X4WA 2QQRA 2GFUA 4C92F 4QVZA 4E47A 3OYHA 4J83A 5J39A 4KBMB 1Q81C 4OMFB 1IREB 4L59A 2LX9A 1I81A 4E7LA 2E10A 2PQWA 4C92G 2I2LA 1WNLA 2JTMA 2V8JA 5CAIA 4M7DA 4NS5A 2YLCA 3CC7T 2KK4A 3QYHB 4KULA 4E7IA 2L3RA 2MWPA 1H3ZA 4ME7A 1N9SA 5GAOr 3RERA 2DEQA 4DOVA 5GAOq 1Y96A 3JCMd 4ZGDB 1UGQB 1JJ2S 3PIOA 2QEXT 2EFIA 5LJ3d 3M9QA 5IN1A 5CKFA 4M7DC 4DQ2A 3NTKA 1YHQA 2WSFE 1O75A 3PT9A 3JCMf 4PL6A 2P0PA 4FIBA 3GOXA 1VQ9A 2CZ7B 2QI2A 1WQWA 2WSEE 3L2VA 3URGA 1G3WA 3HPWA 1G5VA 5M9OA 2QDYB 5KE2A 3S3MA 5AYFA 5GAN8 3EFRA 2K5FA 4C8QD 4EMGA 3JCMb 3H8ZA 3META 1VQPT 2ZZDA 4WF2A 3V7CA 2R58A 1UGSB 2RB6A 2IG0A 4X34A 5FROA 4C0DC 4JRIA 3X20B 5KCOA 1VQ4T 5CQYA 4A4FA 3A8GB 4ZGJB 2EQMA 2QQSA 4MZPA 4BUGA 3JB9I 3CC7A 2RHXA 3E9FA 3CD6A 3PTAA 5C6SA 1YITT 2MMPA 1N9RA 2PVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRU A;  2LX9 A;  1G3W A;  2H3J A;  2GCX A;  1FWZ A;  4O6J A;  2K5I A;  2K5F A;  5CVI A;  1BYM A;  2QQ9 A;  2QQB A;  1BI0 A;  3E19 A;  1G3Y A;  4O5V A;  3GLX A;  1BI1 A;  1U8R A;  1G3S A;  3MHX A;  3HRS A;  1BI3 A;  1FX7 A;  1G3T A;  1QVP A;  1P92 A;  2K5L A;  2K4Y A;  3HRT A;  2QQA A;  1QW1 A;  1BI2 A; 
#chains in the Genus database with same CATH topology
 1X27 A;  2FPE A;  3CCU T;  1AOJ A;  1HK9 A;  3A1P A;  1YNZ A;  1RAG B;  1K9A A;  2LP5 A;  2VKN A;  2X4Y A;  3M0Q A;  1I4K 1;  1TWB A;  2E1H A;  2F5T X;  4J5Y A;  4C0Z A;  2DM1 A;  4F14 A;  2OTL Q;  1AWJ A;  5LJ3 g;  5DY9 A;  3CMA T;  2DF6 A;  1W1F A;  3C95 A;  3JAM E;  4PJM A;  4C8Q A;  2M9U A;  2E12 A;  1WXB A;  4XTX A;  2LT4 A;  2M16 A;  2CKK A;  3FEO A;  3JCM e;  1KD1 C;  2CDT A;  2P4T A;  2K3X A;  2HKQ B;  2JTF A;  1K4U S;  4M78 G;  3JCM X;  3RKY A;  3JB9 D;  2R5A A;  4HCZ A;  3CCR Q;  2A08 A;  2AKK A;  2PVO B;  3SD4 A;  2LNH B;  4AMC A;  1PM3 A;  2XIC A;  4DEY A;  4E7H A;  1VQM A;  5L23 A;  1M9S A;  5L8R E;  3FDR A;  4BD3 A;  5GAN 3;  3PMT A;  1OEB A;  3N5B B;  2DET A;  4FT4 A;  2K57 A;  2KRN A;  2M51 A;  2EW3 A;  3X25 B;  2OAU A;  1QKW A;  4XK8 E;  1RAC B;  5DLO A;  3FIF A;  2QTX A;  1WX6 A;  4XQ3 A;  1I5L A;  1ACM B;  2EJG A;  4FCY A;  1K8A U;  4CI0 C;  4JRK A;  2AK5 A;  4DBQ A;  1UE9 A;  4HXJ A;  1QWF A;  1VQK Q;  2FHD A;  2VGN A;  1K8A C;  4EMK B;  1M8M A;  5GJW B;  2A36 A;  2H3J A;  2FPF A;  3NTH A;  4JRQ A;  4Z8A A;  3CME T;  3I9Q A;  4AG1 C;  3VS2 A;  5HK3 A;  3J81 E;  1BB9 A;  4F7U G;  2ZCF B;  2IPO B;  1GFD A;  4JS4 A;  4X9D A;  3HKS A;  1YI2 Q;  1I07 A;  2CGH A;  5GAN e;  2NWM A;  2X35 A;  1MGQ A;  2H3E B;  1Y57 A;  2DE0 X;  2XKO C;  3OW2 A;  3PGG A;  2EQJ A;  5GAO n;  3CC2 Q;  2EJ9 A;  2PVD B;  1U8R A;  4LXC A;  5LJ3 h;  2Y90 A;  4J9I A;  1C1A A;  3GP8 A;  1G83 A;  1EX4 A;  1KQ1 A;  1TSF A;  4FYY B;  4Z88 A;  2XDB A;  1JEG A;  1E7O A;  1WFW A;  1YP5 A;  4LE9 A;  3PE0 A;  3GPL A;  3VYH B;  2CP0 A;  3M0R A;  4M7D E;  4M78 D;  1VQN Q;  3I56 T;  2LQW A;  1MMA A;  3OS2 A;  4CC3 A;  2GBQ A;  3OW2 P;  1IXD A;  2M0O A;  1FMK A;  1V76 A;  3I5R A;  1N8R U;  2DVJ A;  3NPF A;  3VUZ A;  3RES A;  4BE0 A;  1VQ7 T;  3A98 A;  3L42 A;  1N8R C;  3FRN A;  1QCO A;  1GCQ C;  2CP5 A;  3VUB A;  1SRM A;  3HL8 A;  2YUP A;  4XTW A;  1VQK T;  4M77 F;  4EMK A;  1M4Z A;  3FB9 A;  3V7R A;  1G3S A;  2DIL A;  4N4H A;  2JW4 A;  1WHL A;  4WTO B;  2DFU A;  4NL3 A;  4DA4 A;  4M77 C;  4VUB A;  3EG1 A;  4M75 D;  4MZM A;  1Q86 U;  2MPX C;  5GAO l;  4QKU A;  2O01 E;  1OV3 A;  3OMC A;  1Q86 C;  1OQK A;  1MHN A;  4IIM A;  2KGT A;  1LOJ A;  1VQ6 A;  1TS9 A;  3KUF A;  1YI2 T;  4HCK A;  3VU3 C;  1VQM Q;  2CS7 A;  3QPH A;  4J9H A;  1TH7 A;  4A54 A;  2NYS A;  2OI3 A;  2QA4 Q;  2DLP A;  3QZ9 B;  1IO6 A;  1K0X A;  1AZG B;  3S3O A;  1MNE A;  5D6Y A;  2JMA A;  1M1K U;  5LJ5 e;  3CCV A;  4QQ6 A;  2DA9 A;  2CT3 A;  2GCX A;  4M78 B;  4HCB A;  1UHF A;  1M1K C;  1YJN Q;  1ABQ A;  1D1C A;  4EDU A;  1DJ7 B;  1KQS A;  4RUG A;  3M58 A;  3CXC A;  1Q81 U;  2HNI A;  4ZGE B;  2E4H A;  2DTI A;  2AZS A;  1VQN T;  1HD3 A;  1ZA1 B;  2RHU A;  2DL8 A;  5C0M A;  2DJZ A;  2KXD A;  3CCS T;  1SEM A;  1CSK A;  3OYC A;  1WHJ A;  3RKW A;  5GAM j;  3ER0 A;  4QVD A;  4FL6 A;  1Q82 C;  1VIE A;  1BKB A;  4Y28 E;  2XD0 A;  1NJI U;  2JJ9 A;  1UEB A;  1KQS P;  1NBE B;  2BTT A;  4M75 B;  2M0Y A;  1NJI C;  4LDX A;  1WHG A;  3CXC P;  2EKH A;  2DYI A;  3EH1 A;  4M7A B;  3MCA B;  5KYY B;  3O5Z A;  1Z9Z A;  1NM7 A;  3OYE A;  1RLP C;  1QQJ A;  2F5K A;  1Q7Y R;  2QQB A;  1WJS A;  3QXE B;  1F1B B;  1WHK A;  2DL3 A;  4D8K A;  2DL7 A;  2LQ8 A;  5FWB A;  5GMK e;  4J9C A;  2HBP A;  4JZ4 A;  2J7I A;  5GMK i;  3OS0 A;  2F1L A;  1VQ5 T;  3GNG A;  2RI3 A;  1RLQ C;  2EYQ A;  2X3W D;  3EG9 B;  4L5G A;  4HVU A;  2RJD A;  2EQI A;  1D1A A;  2BIV A;  5J3B A;  4RG8 A;  2HL5 C;  1K76 A;  1C0M A;  2QEX Q;  2V26 A;  3JCM g;  2LTO A;  4PKC C;  3WVE B;  3OS1 A;  3UDC A;  4PJO C;  4C8Q G;  3QSU A;  4RCC A;  5CQX A;  1AWW A;  1NLP C;  3GBQ A;  2J6K A;  3PNW C;  4FW1 A;  3FJ5 A;  4M78 A;  1FYN A;  3NTI A;  3OYY A;  1VQ4 Q;  3HTR A;  1YJN T;  5FU6 C;  2HZY A;  2LZ6 B;  4JLI A;  4ZN3 A;  3UA6 A;  3VYG A;  3UAT A;  2RHI A;  2QG9 B;  2EKO A;  4D6W A;  2HDA A;  4PJN A;  1PRL C;  4II1 A;  5GAN d;  1WJQ A;  2KY9 A;  3TSW A;  1TU0 B;  1IRX A;  2ZPH B;  1GXI E;  4HCC A;  1WXU A;  5GMK m;  3EFO B;  2L89 A;  2K5L A;  2BKD N;  4J7I A;  1D0Z A;  1M3A A;  1BIB A;  5IHI A;  4M77 E;  2KAF A;  1LNX A;  5IAY A;  2AT1 B;  3DLM A;  1YWO A;  1GFC A;  4M75 A;  3R6N A;  1KD1 R;  4XU0 A;  1TUD A;  4HT9 A;  4Z89 A;  4M7A A;  3V7S A;  4B6M A;  5KYY A;  1V1C A;  2V1Q A;  3LX7 A;  2CP3 A;  3VS4 A;  1PCX A;  1FX7 A;  1KJW A;  5CKE A;  1PC0 A;  3BDL A;  4C92 F;  2QQR A;  2GFU A;  4JJD A;  3OYH A;  2YSQ A;  4J83 A;  1I81 A;  3EG9 A;  4NS5 A;  1RAI B;  1N5Z A;  2KK4 A;  1VQL Q;  2L3R A;  2MWP A;  2ROT A;  1QKX A;  1M2O A;  2QEX T;  2OX7 A;  5IN1 A;  4KGX B;  4F16 A;  1BCO A;  3I55 Q;  4KGV B;  2WSF E;  4PL6 A;  3CCJ Q;  2P0P A;  1BCM A;  1K8A R;  5M9O A;  5AYF A;  1R0B G;  2K5F A;  2LJ3 A;  4C8Q D;  4EMG A;  2R58 A;  2RB6 A;  4X34 A;  4C0D C;  2EYX A;  4X1V A;  1VQ4 T;  5CQY A;  4ZGJ B;  1UEC A;  2YWW A;  2BZX A;  3E9F A;  4AFZ C;  1YIT T;  2F69 A;  2VWF A;  5GAN 5;  1HYO A;  1RAE B;  2DXU A;  1VQ8 T;  2JTE A;  3EFO A;  3RMQ A;  2QK0 A;  3EGX B;  1YFN A;  1PG5 B;  4E6R A;  4X9C A;  3GLX A;  3T9N A;  1E6H A;  4FYX B;  3UWN A;  3PIP A;  4RMO A;  1QVG S;  1B3Q A;  4PFO A;  1XNI A;  1SF9 A;  2E6N A;  4MDX A;  3HRU A;  1YJ9 T;  1OOT A;  5FWC A;  5FRM A;  1D09 B;  2DXB A;  3M0P A;  5KYU B;  3HHT B;  3M0T A;  3E19 A;  1M3C A;  3PVL A;  1G3Y A;  1LPL A;  3RMS A;  2K2V A;  4OGC A;  5FRN A;  3I56 A;  3EG0 A;  3VS6 A;  4OGE A;  4TVR A;  2COZ A;  4PJO E;  3CCM Q;  2HEQ A;  4IKF A;  4MZT A;  2J06 A;  1YJW A;  5CO7 A;  1UDL A;  2A28 A;  4XTY A;  3CPW A;  1VQ7 A;  5LJ5 g;  1N8R R;  2FZG B;  5GAN h;  2XK0 A;  3I55 T;  5I22 A;  2O2O A;  2DRM A;  3VRY A;  3OS5 A;  2DX1 A;  1M8V A;  1KHC A;  1QWE A;  2FPD A;  1R8O B;  5EG2 A;  2W10 A;  4J9F A;  2MWO A;  3A8L B;  2O31 A;  3G71 Q;  2LNV A;  1Q86 R;  3CPW P;  2LVM A;  4J6W A;  1KC8 U;  2RJE A;  4M7D F;  4PK4 A;  1RL2 A;  1KC8 C;  2LCS A;  2P0K A;  2D6F A;  3EGX A;  2A3L A;  4J7F A;  5I11 A;  1Y07 A;  3I35 A;  1YWP A;  3S6W A;  5FU7 C;  3LYI A;  3CCQ A;  3DKM A;  3OMG A;  3Q1J A;  1JJ2 S;  2KT1 A;  2OTJ Q;  1S72 Q;  4C92 E;  5KYU A;  3OYA A;  4A63 B;  2L8D A;  2QQA A;  1WPY A;  2EIF A;  2DXC A;  2VXE A;  1FWZ A;  2KNB B;  3M4Y A;  2D0Q B;  1WHH A;  1TXQ A;  3G4S A;  1D1B A;  1PSF A;  3ULR B;  1Q82 R;  1BI3 A;  4XU2 A;  3CCL A;  2FRY A;  2KYM A;  2GTO A;  4ELY C;  3VS5 A;  4DBH A;  2JMC A;  1UUE A;  4KUI A;  4C0F A;  5HKC A;  2XDD A;  1WYX A;  3FC3 A;  3EGU A;  2VV5 A;  3OYL A;  5LJ5 h;  4OF1 A;  2MOX A;  5LJ3 j;  2D9T A;  2BE7 D;  3BW1 A;  3M54 A;  5A0D A;  1VQP Q;  1R0C B;  4M77 G;  4OB2 B;  1QVP A;  2B86 A;  4JJN K;  2XMF A;  5DM7 R;  3OYI A;  1XTD A;  1VQ5 A;  3G6E A;  3G71 T;  5GAM f;  2DBK A;  1OPK A;  1SSH A;  2RQV A;  3OY9 A;  1N6A A;  3M59 A;  2RJF A;  4O5V A;  2CZ6 B;  2OJ2 A;  3C94 A;  4HA8 A;  2RM4 A;  2DZ9 A;  2VVK A;  1PD1 A;  2CUD A;  4M75 G;  3OB9 A;  3X26 B;  2DBM A;  1Y0M A;  2D8H A;  4M7A G;  2Y4Y A;  2DL4 A;  2K5I A;  1AWX A;  1YIJ T;  3CCE A;  1W2B S;  1WIE A;  2XDP A;  3QZ5 B;  1T3S A;  3ASK A;  2LDM A;  4OMO A;  2HCK A;  2GNC A;  4J9G A;  4ATO A;  4XTV A;  3C4S A;  2OTL T;  5GMK h;  3JCM P;  2KRS A;  3EAE A;  4ZTJ A;  3ZEH A;  2L0A A;  3PMI A;  1Y7X A;  2BE9 B;  3OYM A;  3TVT A;  2R57 A;  1AVZ C;  1D0Y A;  1KG1 A;  2B8A A;  2GQV A;  2A37 A;  5EC7 A;  3EG2 A;  5GAN 7;  2X4J A;  1A0N B;  2VGM A;  2ABL A;  3JCM c;  4KUD K;  4N4I A;  3L2U A;  2ZPE B;  3X28 B;  4MML A;  1VQO A;  4NL2 A;  3E9G A;  1NLO C;  4JJC A;  3JCM V;  2CSI A;  4A4K A;  3CCR T;  1WI7 A;  4MDW A;  2FZC B;  4YTL A;  1X69 A;  3F70 A;  1MMG A;  4LDW A;  2M1H A;  4A4G A;  4BI3 A;  2GFA A;  4KH1 B;  4KGZ B;  2J05 A;  4M77 D;  2O88 A;  3CC7 Q;  2XI9 A;  1ZLM A;  3BE3 A;  3CD6 Q;  2NUZ A;  2V8K A;  5IT9 E;  1VIF A;  1AWO A;  3DB4 A;  5D6X A;  4EPC A;  2YRD A;  4JUV A;  1X01 A;  2CUB A;  2DNU A;  2DXT A;  4N0A A;  3NGP A;  1LJO A;  2V1R A;  4ORZ A;  2DEU A;  2GTJ A;  3MHX A;  1H3H A;  3P8D A;  2YRV A;  3WXM B;  4J9B A;  5GMK l;  3OBY A;  3CCL Q;  2L3Q A;  2C0O A;  4BE1 A;  1YN8 A;  2GF7 A;  3INZ A;  1YIT A;  4M7A D;  3EH2 A;  2VAS A;  3G1J A;  4FU6 A;  4LDY A;  3H9N A;  4XTZ A;  1VQ8 A;  3A8O B;  1Q95 G;  1VUB A;  2RK2 A;  2MCN A;  1VYV A;  3QKJ A;  4FM4 B;  5GAN f;  3QJ6 A;  4FSS A;  2K6D A;  1X6O A;  1BK2 A;  3CC2 T;  2QGF B;  2RI5 A;  2DJQ A;  3L2R A;  3CC4 A;  2EYZ A;  3MEV A;  2FEI A;  4RTZ A;  1UG1 A;  1YJ9 A;  2DIG A;  1PNJ A;  4OP0 A;  1I1J A;  2CH4 A;  2SEM A;  2RD1 A;  2YT6 A;  1M90 R;  4ANJ A;  4M77 B;  3SB2 A;  2CSQ A;  3GNF B;  4AFS C;  1SKU B;  2IIM A;  1QVF A;  4D8D A;  5J39 A;  1Q81 C;  4OMF B;  5AT1 B;  4ESR A;  2LX9 A;  4C92 G;  2I2L A;  2JTM A;  5CAI A;  3D7S B;  3CC7 T;  1VA7 A;  2ZAE A;  1SRL A;  2HKN A;  4DBR A;  2EYW A;  3JCM d;  1HSQ A;  1UGQ B;  2EPD A;  2KBT A;  3M9Q A;  2LJ1 A;  3NTK A;  1YHQ A;  4FIB A;  1MND A;  2C0T A;  2CZ7 B;  2QI2 A;  1VQ9 A;  2QDL A;  2WSE E;  3L2V A;  1S1N A;  1QVF P;  5KE2 A;  3S3M A;  3EFR A;  1M2V B;  4GBQ A;  1SPK A;  2HBW A;  3H8Z A;  1X6B A;  2ZZD A;  4JRI A;  3X20 B;  5KCO A;  3A8G B;  2EQM A;  4MZP A;  3TSZ A;  4AFQ C;  5C6S A;  4OML A;  1X2Q A;  2MMP A;  1N9R A;  2PVG B;  1U1S A;  1NEB A;  4PJO F;  3REB B;  2RQT A;  4OMP A;  1R77 A;  1VQM T;  2QA4 T;  2J6F A;  1WHM A;  1EFN A;  5GAN 4;  1GCQ A;  5A0G A;  3H41 A;  2KI7 A;  1QLY A;  1YBY A;  5CKB A;  4IUR A;  4M77 A;  2L5Q A;  3OQ5 A;  2XID A;  3CCU A;  5FLX E;  1PSE A;  2K7A A;  2KMT A;  1UHC A;  2X51 A;  4OB1 B;  2MF2 A;  2MAM A;  2VYT A;  1H8K A;  1OU9 A;  3CMA A;  1XJW B;  2JS2 A;  2KEA A;  4FYV B;  1UFF A;  3RNJ A;  2HQH A;  1I8F A;  4GLK A;  1QMC A;  2KXC A;  5CCA A;  4C92 D;  3THK A;  4PJO B;  3QJY A;  1UB4 A;  2J6O A;  2LX7 A;  1VQ6 Q;  2RQU A;  3S3N A;  8AT1 B;  1WLP B;  2LQK A;  2LC4 A;  3SWN C;  1QP2 A;  1IZ6 A;  4KT0 E;  1M2V A;  5GAO m;  2QYZ A;  1QW1 A;  2FRW A;  2JS0 A;  3CC4 Q;  3CCV Q;  2K3Y A;  2PTK A;  5KCH A;  3VRZ A;  3JB9 J;  3OW2 S;  3M0U A;  3HP9 A;  1QCN A;  3RKX A;  2EGE A;  3VS0 A;  3HFN A;  2C0I A;  3MP8 A;  3ME9 A;  3H0F A;  4AFU C;  5DLQ E;  3HRT A;  4M7D G;  1ZSZ C;  2DO3 A;  3O8V A;  3UPU A;  3E2U A;  2E3I A;  1FXX A;  2X9H A;  7AT1 B;  3ZFJ A;  1K73 U;  5LJ3 f;  2G3R A;  1Z9Q A;  5GAN j;  1JQQ A;  1JXO A;  3JCM h;  1BI0 A;  3EHQ A;  5LL6 S;  2K3B A;  1K73 C;  3IQL A;  4FT2 A;  3CME A;  4CC4 B;  1YIJ A;  2DVE A;  3QUI A;  1EZZ B;  4F7U E;  3EHR A;  2CRE A;  3SDZ A;  1B07 A;  4QT7 A;  2KRM A;  4PFZ A;  2LJ0 A;  2OTL A;  1WGS A;  4C92 B;  3QII A;  2HD0 A;  2WSC E;  4BY6 C;  3JCM W;  1XQH A;  2VB6 A;  1JBM A;  4EIK A;  1KIK A;  3R6O A;  3TCJ A;  1U1T A;  2FL7 A;  3EFS A;  2RHY A;  1U06 A;  5LJ5 d;  3OYB A;  4PJO A;  1OZ2 A;  3QYG B;  3EGD B;  4L6V 5;  2QAS A;  4BDZ A;  4C8Q F;  3QDR B;  2EGA A;  1GCP A;  1X2K A;  1WZO A;  4Z02 A;  2RA2 A;  2E41 A;  4C8Q C;  3CCR A;  4JPB W;  2FYK A;  2HSP A;  2JT4 A;  1RAA B;  4LN2 A;  2NLU A;  2CYZ B;  4HVV A;  4QQD A;  3BFM A;  1HJD A;  3TQ7 P;  3SEM A;  2JXB A;  2YHT A;  2DD5 A;  1QP3 A;  1BI2 A;  3QWY A;  1UGP B;  2RHZ A;  1MUZ A;  3A8M B;  4RG2 A;  1VQL T;  1G2B A;  3RR6 A;  3WVD B;  2ESW A;  4C5E A;  2ED0 A;  4V2S A;  2K2M A;  4B9W A;  1OYX A;  4Q5W A;  3LWH A;  1NPR A;  1ZX6 A;  2MK5 A;  4J9E A;  4ZTF A;  2RQR A;  3CCJ T;  1VQK A;  4BI8 B;  3CXC S;  4M7D D;  3VKI A;  1V29 B;  1KSW A;  5I21 A;  4XU3 A;  2DD4 A;  1GL5 A;  2L2P A;  3SFM A;  2NUP B;  1RI0 A;  2O9V A;  1YCS B;  2LT1 A;  3AHU A;  4IIO A;  5LJ5 j;  2JVV A;  2MI6 A;  3QHS A;  2YDL A;  1VYT A;  4C92 A;  1IGU A;  1Q7Y U;  2EWN A;  1YI2 A;  2EBP A;  1B7T A;  2JUF A;  3V8K A;  1RI9 A;  4KH0 B;  3C12 A;  4PLL A;  2IVW A;  5GAM e;  1Q7Y C;  1BBZ A;  3KXT A;  2C06 A;  1SG5 A;  1JU5 C;  2DTH A;  2ECZ A;  3CC2 A;  4ZN1 A;  3EGD A;  3CBO A;  4OMN A;  3QG1 A;  1JRI A;  2NUT B;  3LLR A;  8ATC B;  1BI1 A;  1SHF A;  4RTT A;  1M1K R;  1WJR A;  1WXT A;  2FB7 A;  4BDY A;  2E5K A;  5GJV B;  1YCY A;  1OZ3 A;  5IHK A;  2KDS A;  1ZQ1 A;  3DLL A;  2FZK B;  4Y92 A;  1VQN A;  1H92 A;  2COW A;  1Q81 R;  2HQX A;  3CCS A;  3GF5 A;  1ZUU A;  3CCM T;  4LUD A;  3DB3 A;  1ZBX A;  2XU8 A;  2DIQ A;  3ZBD A;  1G8X A;  5KH6 A;  9ATC B;  2E6Z A;  2QAZ A;  4M7D B;  4J8O A;  4IUT A;  3JSC A;  5CKD A;  5GMK j;  4LDU A;  1X75 C;  2CH4 W;  3CPF A;  2E64 A;  4J6X A;  1EIF A;  1NZ9 A;  2RK1 A;  5FU7 B;  4C5I A;  1AHJ B;  4XAX B;  2DL5 A;  1NJI R;  1PRM C;  1TG0 A;  1M5Q 1;  5IXB A;  2AHJ B;  3M57 A;  2NUP A;  2YLB A;  3MJX A;  1KD1 U;  2JOY A;  2GQI A;  2HQE A;  1PWT A;  4N0A C;  4EMK C;  1K0S A;  1PKT A;  2EAY A;  2EYY A;  1PKS A;  2AIR B;  1RAH B;  1NE8 A;  4E7S A;  2DMO A;  1AZE A;  1BYM A;  5CIU A;  2O9S A;  4R55 A;  3OYD A;  2HSE B;  3C0C A;  2YUQ A;  3I56 Q;  1GRI A;  2QA4 A;  4C8Q E;  2PZ1 A;  1U3O A;  4HT8 A;  5CK9 A;  3M0S A;  1TUG B;  2NUT A;  2QTV A;  3UF4 A;  3JB9 F;  1YJW Q;  2VUB A;  5HY6 A;  2OTJ T;  1VQ7 Q;  3VV0 A;  4R56 A;  3FJP A;  1S72 T;  1YJN A;  3CBM A;  4AT1 B;  3PVQ A;  1W6X A;  1RAB B;  2KVQ G;  4A4H A;  4RTU A;  3OYN A;  1P92 A;  2FO0 A;  4LUE A;  4OMQ A;  2X4W A;  4E47 A;  4E7L A;  2P84 A;  2PQW A;  4E2F B;  4M7D A;  2CT4 A;  1MMD A;  1VOM A;  2BZ8 A;  2YLC A;  3QYH B;  1H3Z A;  3RER A;  5GAO r;  1IHW A;  2DEQ A;  4DOV A;  5GAO q;  4RTV A;  2F2V A;  4ZGD B;  5IH2 A;  2K9G A;  3PIO A;  2FG0 A;  1TTH B;  3PT9 A;  3JCM f;  3H0I A;  2AZV A;  1G3W A;  2MYS A;  1RAF B;  3JCM b;  3CCQ Q;  4PJJ A;  2EGC A;  1VQP T;  1SHG A;  2I0N A;  1UGS B;  2IG0 A;  3AT1 B;  4A4F A;  4K11 A;  1IB8 A;  3UA7 A;  2QQS A;  3JB9 I;  2YXY A;  1LVK A;  3PTA A;  1ABO A;  1GBR A;  1I5O B;  1U5S A;  2QEX A;  1OX9 A;  1BIA A;  2G6F X;  2EQK A;  1NYG A;  3JB9 H;  1NPP A;  3HFO A;  3MEA A;  1JO8 A;  2RO0 A;  3CCS Q;  4PJO G;  3G4S Q;  2LMJ A;  2PUO B;  2A0F B;  3LWI A;  3JRZ A;  1MV0 B;  1YJW T;  1K73 R;  1ZBJ A;  2RMO A;  2AKL A;  5KYX B;  2Z0W A;  1HXD A;  1VQ4 A;  3M56 A;  4M78 F;  5I2M A;  5IXF A;  2E3H A;  3TEE A;  4UC4 A;  4M78 C;  3CPW S;  3MEU A;  3KBG A;  2H8H A;  3QBY A;  1QVG A;  4E7Z A;  2HMA A;  5GAM d;  2JNG A;  4CRI A;  4RCB A;  4MMK A;  2WAC A;  1KHI A;  3FLG A;  1GBQ A;  5FW9 A;  1SSF A;  3RDV A;  3LH0 A;  1VQ5 Q;  3G6E Q;  4IUQ A;  1LCK A;  1M3B A;  2ZPF B;  3NFC A;  4XU1 A;  2EJF A;  3M53 A;  1K9M U;  3L2Q A;  5KYN A;  4RTX A;  1H64 1;  1VYU A;  4C5H A;  3G7Z A;  4M75 F;  2O4X B;  5CKH A;  1K9M C;  1X6G A;  3JCM Q;  2EQU A;  4KRT A;  1QVG P;  4OVA A;  3KFV A;  4M7A F;  5I2S A;  2EVR A;  2ZPB B;  2E5Q A;  4M75 C;  4QW2 A;  4XTU A;  4BB7 A;  3CCQ T;  1D0X A;  3MKD A;  2ED1 A;  3M4G A;  2P0Q A;  4M7A C;  2E70 A;  5GAM g;  3JCM J;  4F7U F;  1T0H A;  2L3S A;  1VQL A;  3CCE Q;  2LCC A;  1C6V X;  4NOY A;  3CD6 T;  1WQ7 A;  4J6Y A;  5GAN 6;  5A0L A;  1KQ2 A;  2X4X A;  1JXM A;  4PLI A;  2GGR A;  4GLM A;  3MEW A;  4PNO A;  3UT1 A;  1M30 A;  3I55 A;  3CCJ A;  2XG8 D;  1NEG A;  1Q82 U;  2RPN A;  2D8J A;  4A53 A;  3G4S T;  3VJP A;  3V8L A;  4LNP A;  4PJO D;  5KYX A;  4FSX A;  4LD9 K;  2XHC A;  2JZ2 A;  1ZHI A;  3A8H B;  3BDU A;  3CCL T;  4C5G A;  4M4Z A;  4IUU A;  2MIO A;  2ZPI B;  2DKG A;  3I5S A;  3L1A A;  1VQO Q;  1M1G A;  2A7Y A;  4IUV A;  3LGL A;  4F17 A;  4AG2 C;  1I0C A;  1KC8 R;  3V8J A;  4JLG A;  3VS7 A;  2CP6 A;  1JJ2 A;  4F7U B;  1B34 B;  3J80 E;  4HKE A;  2V8I A;  3OBW A;  1PD0 A;  2RNA A;  3G6E T;  2YRC A;  3A5Z B;  2DTO A;  3LW5 E;  4E7J A;  1FMW A;  1QCF A;  2O4X A;  5LJ5 f;  3MO8 A;  5LJ3 e;  4B9X A;  2CZ1 B;  4JZ3 A;  2RF0 A;  2RN8 A;  1FMV A;  5GAN 2;  1PHT A;  3RBB B;  2PU9 B;  1JJ2 P;  3CCM A;  3H0H A;  4DOW A;  2QXF A;  3HSB A;  2LQN A;  1IGQ A;  4CC2 A;  2CP7 A;  3CCE T;  1E6G A;  1YIT Q;  2LCL A;  3VS1 A;  2RI2 A;  4QQG A;  3P8H A;  5GAM h;  2KYB A;  2JM8 A;  1JB0 E;  1VQ8 Q;  4M78 E;  2QGG A;  1OU8 A;  4LD6 A;  3E1S A;  2VC8 A;  2P4R A;  2W0Z A;  2ZGW A;  1N27 A;  2DZC A;  1W4S A;  3L2Z A;  5FU6 B;  2BZY A;  2HL3 A;  2ZPG B;  3LGF A;  4JRP A;  2M02 A;  4JJB A;  3PFS A;  5CVI A;  3G71 A;  4HVW A;  1YJ9 Q;  5GAO p;  1T0J A;  2VXF A;  2DRK A;  2KE9 A;  4E7K A;  1UGV A;  1CKA A;  1UJY A;  2X3X D;  5IHN A;  5A2Q E;  1VQO T;  3M5A A;  2JN0 A;  3RIR A;  4BI4 A;  3NMZ C;  4BE2 A;  1OI1 A;  3TRE A;  4F7U A;  1X43 A;  1B34 A;  4F04 B;  5GAN g;  2D0N A;  3CEY A;  3OYF A;  3M55 A;  2BUD A;  4C92 C;  4M75 E;  4O6J A;  1BU1 A;  4N4G A;  4Y91 A;  5CR2 A;  1W2B A;  2QQ9 A;  2OTJ A;  2RJC A;  4M7A E;  3H6Z A;  4RTY A;  1D3B B;  1S72 A;  1AEY A;  1OPL A;  4J9D A;  3SWN B;  4LDV A;  2PUK B;  2LRQ A;  2KQW A;  4EMH A;  2K4Y A;  3OYK A;  4OB3 B;  1AD5 A;  5KE3 A;  1YHQ Q;  4ELZ C;  1UTI A;  1RAD B;  4ZNX A;  3RUX A;  3OYJ A;  1UGR B;  1VQ9 Q;  4A4E A;  4P5N A;  2CZ0 B;  3OSV A;  3U23 A;  4WCI A;  2L3P A;  1J3T A;  4FW2 A;  1CKB A;  1W2B P;  1OUL A;  1O9S A;  3SHW A;  2ROL A;  3QDF A;  1G3T A;  4QVC A;  1ZSZ B;  2JM9 A;  2Y4X A;  3REA B;  1ZSG A;  5KYW B;  2DPP B;  1Y96 B;  2E65 A;  4DEX A;  2RH2 A;  3QO3 A;  1VQ6 T;  1M27 C;  3P8B B;  1AT1 B;  3MP1 A;  4OMM A;  4FYW B;  1WDX A;  5HK0 A;  2COY A;  3J7A F;  4C0D B;  1T3L A;  4JDS A;  3QWX X;  1K1Z A;  4RKU E;  1VQP A;  6AT1 B;  2KSS A;  4GY5 A;  3L2W A;  4OB0 B;  3CC4 T;  1Y71 A;  3CCV T;  4IUP A;  1M90 U;  2DK3 A;  5D7U A;  3MP6 A;  4BY6 B;  1M90 C;  3BY7 A;  5D6W A;  2DAQ A;  2ENM A;  3OYG A;  3CCU Q;  2KR3 A;  2HAX A;  5HCK A;  3NHN A;  3GIB A;  1ZA2 B;  2KRO A;  1NYF A;  1OX8 A;  3HRS A;  1KQS S;  5J26 A;  2YUN A;  3CMA Q;  4JS5 A;  2DYB A;  2SRC A;  2R5M A;  1D3B A;  1QVF S;  3OSS C;  3X24 B;  3SWN A;  4PFP A;  2D1X A;  4C8Q B;  1MMN A;  4PJL A;  3OA6 A;  1ARK A;  3CBP A;  3TU4 K;  1WA7 A;  3JB9 G;  1M1F A;  2FVU A;  4C0G A;  2F2X A;  1KK7 A;  1YHQ T;  1XOV A;  4BAC A;  1VQ9 T;  1ZUY A;  4R0K A;  2OAW A;  4QVZ A;  4KBM B;  1IRE B;  4L59 A;  1W70 A;  2E10 A;  1WNL A;  2V8J A;  2PNI A;  3ZL7 C;  1ZSZ A;  1UJ0 A;  4RTW A;  1KFZ A;  4KUL A;  2CP2 A;  3JV3 A;  4E7I A;  2DER A;  4ME7 A;  1N9S A;  5KYW A;  3EG3 A;  1TUC A;  1Y96 A;  4DBF A;  2F2W A;  2EFI A;  5LJ3 d;  5CKF A;  4M7D C;  2ATC B;  4DQ2 A;  1K9M R;  2KT8 A;  1O75 A;  3LH5 A;  1RUW A;  3GOX A;  4CC7 A;  1WQW A;  1TOV A;  3URG A;  1NG2 A;  1MV3 A;  3HPW A;  1G5V A;  2QDY B;  5GAN 8;  3MET A;  4WF2 A;  3V7C A;  2RQW A;  5FRO A;  3VS3 A;  2K79 A;  1ZUK A;  5ECA A;  3CME Q;  1YIJ Q;  4BUG A;  2YUO A;  3CC7 A;  2RHX A;  3CD6 A;  3MPU B;  1IHV A;  3CQT A; 
#chains in the Genus database with same CATH homology
 2F69 A;  3CCU T;  2QEX A;  4PJO F;  1HK9 A;  1BIA A;  5GAN 5;  2EQK A;  2DXU A;  2X4Y A;  1VQ8 T;  3JB9 H;  1NPP A;  1I4K 1;  2E1H A;  4J5Y A;  2F5T X;  3HFO A;  4C0Z A;  3MEA A;  1VQM T;  2RO0 A;  3RMQ A;  5LJ3 g;  4PJO G;  2QA4 T;  5DY9 A;  4X9C A;  3GLX A;  3T9N A;  3CMA T;  3UWN A;  2PUO B;  5GAN 4;  3PIP A;  4RMO A;  3LWI A;  1QVG S;  3C95 A;  3JRZ A;  1XNI A;  5A0G A;  3JAM E;  4C8Q A;  2M9U A;  2E12 A;  1YJW T;  4XTX A;  2LT4 A;  1HXD A;  2M16 A;  2CKK A;  3FEO A;  1VQ4 A;  3JCM e;  3M56 A;  2E6N A;  4M78 F;  1YBY A;  5CKB A;  5I2M A;  4MDX A;  3HRU A;  1YJ9 T;  1KD1 C;  2P4T A;  4IUR A;  2K3X A;  5FRM A;  4M77 A;  2DXB A;  2JTF A;  2L5Q A;  3OQ5 A;  3TEE A;  3HHT B;  4UC4 A;  4M78 G;  3JCM X;  2XID A;  4M78 C;  3RKY A;  3CPW S;  3JB9 D;  2R5A A;  3E19 A;  3MEU A;  3CCU A;  4HCZ A;  3KBG A;  1G3Y A;  1PSE A;  5FLX E;  3QBY A;  2PVO B;  3SD4 A;  3RMS A;  2K2V A;  1QVG A;  2KMT A;  2XIC A;  4OGC A;  5FRN A;  3I56 A;  5GAM d;  4E7H A;  2JNG A;  4OB1 B;  4OGE A;  4TVR A;  4RCB A;  4MMK A;  4CRI A;  1VQM A;  2WAC A;  4PJO E;  1M9S A;  1KHI A;  2MF2 A;  3FDR A;  3FLG A;  5L8R E;  4BD3 A;  2MAM A;  2VYT A;  3CMA A;  4IKF A;  1SSF A;  4MZT A;  3LH0 A;  5GAN 3;  1YJW A;  3PMT A;  3N5B B;  4IUQ A;  1I8F A;  4GLK A;  5CO7 A;  4FT4 A;  2K57 A;  4XTY A;  5CCA A;  3CPW A;  3X25 B;  2OAU A;  2ZPF B;  3NFC A;  4XU1 A;  4C92 D;  5LJ5 g;  1VQ7 A;  4PJO B;  5GAN h;  2EJF A;  3QJY A;  3CC4 A;  3M53 A;  1UB4 A;  4XK8 E;  1K9M U;  5DLO A;  3L2Q A;  1H64 1;  3FIF A;  2QTX A;  2XK0 A;  4XQ3 A;  1I5L A;  2EJG A;  3S3N A;  4C5H A;  3G7Z A;  4M75 F;  3I55 T;  2LQK A;  2O4X B;  1K8A U;  5CKH A;  4CI0 C;  1K9M C;  2LC4 A;  4JRK A;  3JCM Q;  2EQU A;  3SWN C;  4OVA A;  1QP2 A;  1IZ6 A;  2FHD A;  4KT0 E;  4M7A F;  3OS5 A;  2VGN A;  5I2S A;  2ZPB B;  2E5Q A;  4M75 C;  4EMK B;  5GAO m;  1K8A C;  4QW2 A;  4XTU A;  4BB7 A;  1M8V A;  1QW1 A;  3CCQ T;  1KHC A;  3M4G A;  2P0Q A;  1R8O B;  4M7A C;  2E70 A;  2H3J A;  5GAM g;  5EG2 A;  3NTH A;  2K3Y A;  3JCM J;  4JRQ A;  4F7U F;  2MWO A;  3CME T;  5KCH A;  3A8L B;  3JB9 J;  2LNV A;  3OW2 S;  1VQL A;  5HK3 A;  3J81 E;  2LVM A;  4J6W A;  1KC8 U;  3HP9 A;  2LCC A;  2RJE A;  4NOY A;  4F7U G;  3CD6 T;  1WQ7 A;  4J6Y A;  3RKX A;  5GAN 6;  2ZCF B;  5A0L A;  1KQ2 A;  4M7D F;  3HFN A;  4JS4 A;  2X4X A;  4PLI A;  1RL2 A;  1KC8 C;  3MP8 A;  3ME9 A;  3MEW A;  4PNO A;  2P0K A;  3UT1 A;  4X9D A;  3HKS A;  5DLQ E;  2CGH A;  3HRT A;  3I55 A;  5GAN e;  2D6F A;  4M7D G;  3O8V A;  2DO3 A;  2X35 A;  3CCJ A;  2XG8 D;  1MGQ A;  3UPU A;  2A3L A;  1FXX A;  1Q82 U;  4J7F A;  1Y07 A;  4A53 A;  3ZFJ A;  3G4S T;  2XKO C;  1K73 U;  3VJP A;  3S6W A;  5LJ3 f;  2G3R A;  5FU7 C;  3V8L A;  3LYI A;  3PGG A;  3OW2 A;  3CCQ A;  3DKM A;  5GAN j;  2EQJ A;  4PJO D;  3OMG A;  3JCM h;  1BI0 A;  5GAO n;  5LL6 S;  3Q1J A;  4FSX A;  4LD9 K;  2XHC A;  2JZ2 A;  1K73 C;  1ZHI A;  2EJ9 A;  3A8H B;  3BDU A;  4FT2 A;  3CCL T;  2PVD B;  1U8R A;  5LJ3 h;  2Y90 A;  4C92 E;  3CME A;  1YIJ A;  2DVE A;  4C5G A;  3GP8 A;  3QUI A;  4IUU A;  1KQ1 A;  3OYA A;  4F7U E;  2ZPI B;  2DKG A;  2L8D A;  2QQA A;  1U1S A;  3L1A A;  2XDB A;  1M1G A;  1WPY A;  3SDZ A;  2A7Y A;  3GPL A;  4IUV A;  3LGL A;  2EIF A;  3V8J A;  2DXC A;  3VYH B;  4JLG A;  1WGS A;  4C92 B;  3QII A;  2OTL A;  2HD0 A;  2WSC E;  4BY6 C;  2VXE A;  1FWZ A;  3JCM W;  4M78 D;  4M7D E;  1XQH A;  1JJ2 A;  3I56 T;  3M4Y A;  2D0Q B;  1JBM A;  3R6O A;  4F7U B;  3OS2 A;  1B34 B;  3J80 E;  3G4S A;  4HKE A;  3TCJ A;  1U1T A;  2V8I A;  2FL7 A;  1PSF A;  2M0O A;  3OBW A;  3EFS A;  3G6E T;  2RHY A;  1N8R U;  5LJ5 d;  1BI3 A;  4XU2 A;  3OYB A;  4PJO A;  3CCL A;  3A5Z B;  1OZ2 A;  3QYG B;  3RES A;  3VUZ A;  4BE0 A;  1VQ7 T;  3L42 A;  4L6V 5;  4ELY C;  2DTO A;  4BDZ A;  3FRN A;  4C8Q F;  1N8R C;  3QDR B;  3LW5 E;  4E7J A;  4KUI A;  4C0F A;  5HKC A;  2XDD A;  2O4X A;  5LJ5 f;  3FC3 A;  4Z02 A;  3MO8 A;  5LJ3 e;  3VUB A;  3HL8 A;  4B9X A;  2RA2 A;  2E41 A;  4XTW A;  2CZ1 B;  2VV5 A;  4C8Q C;  3CCR A;  3OYL A;  2FYK A;  4M77 F;  4EMK A;  1M4Z A;  3FB9 A;  5LJ5 h;  4OF1 A;  5GAN 2;  1VQK T;  3V7R A;  1G3S A;  5LJ3 j;  4N4H A;  2PU9 B;  2D9T A;  2CYZ B;  2NLU A;  4QQD A;  4NL3 A;  3BFM A;  3BW1 A;  3M54 A;  5A0D A;  3CCM A;  4DOW A;  4M77 G;  2QXF A;  4DA4 A;  4OB2 B;  4M77 C;  3HSB A;  2YHT A;  2DD5 A;  4VUB A;  1QVP A;  4JJN K;  4M75 D;  5DM7 R;  3OYI A;  1XTD A;  4MZM A;  1Q86 U;  5GAO l;  1QP3 A;  1BI2 A;  1VQ5 A;  3G6E A;  3G71 T;  1UGP B;  2RHZ A;  3A8M B;  5GAM f;  4RG2 A;  2O01 E;  3CCE T;  3OMC A;  1Q86 C;  1VQL T;  2LCL A;  2RI2 A;  4QQG A;  3OY9 A;  1MHN A;  3WVD B;  4C5E A;  1N6A A;  3M59 A;  3P8H A;  5GAM h;  4V2S A;  1LOJ A;  1JB0 E;  1VQ6 A;  3KUF A;  4B9W A;  2RJF A;  4O5V A;  1OYX A;  4Q5W A;  1YI2 T;  3LWH A;  2CZ6 B;  1NPR A;  3VU3 C;  3C94 A;  2CS7 A;  3QPH A;  4M78 E;  1TH7 A;  4A54 A;  4ZTF A;  3CCJ T;  1VQK A;  4BI8 B;  4LD6 A;  3E1S A;  3CXC S;  4HA8 A;  3QZ9 B;  2RM4 A;  2VC8 A;  2DZ9 A;  4M7D D;  3VKI A;  4M75 G;  3L2Z A;  1V29 B;  2DZC A;  1N27 A;  1W4S A;  2ZGW A;  5D6Y A;  5FU6 B;  3S3O A;  2ZPG B;  5I21 A;  1M1K U;  4XU3 A;  3OB9 A;  3LGF A;  3X26 B;  5LJ5 e;  3CCV A;  2DD4 A;  4JRP A;  4QQ6 A;  4M7A G;  2GCX A;  2Y4Y A;  3SFM A;  4M78 B;  4HCB A;  1RI0 A;  2K5I A;  1M1K C;  3PFS A;  2LT1 A;  5CVI A;  3G71 A;  1YIJ T;  5GAO p;  3AHU A;  5LJ5 j;  2JVV A;  3CCE A;  4EDU A;  1W2B S;  1DJ7 B;  1KQS A;  2VXF A;  2MI6 A;  2XDP A;  3QHS A;  3QZ5 B;  5A2Q E;  4E7K A;  1VQO T;  3M58 A;  3CXC A;  3M5A A;  4C92 A;  3ASK A;  1Q81 U;  2JN0 A;  2HNI A;  3RIR A;  4ZGE B;  1Q7Y U;  2LDM A;  2EWN A;  4BI4 A;  1YI2 A;  2DTI A;  4ATO A;  2JUF A;  3V8K A;  1VQN T;  4XTV A;  3C4S A;  3C12 A;  1OI1 A;  3TRE A;  4F7U A;  2RHU A;  1B34 A;  4PLL A;  2IVW A;  5GAM e;  5C0M A;  3EAE A;  2DJZ A;  3CCS T;  3JCM P;  5GAN g;  1Q7Y C;  3KXT A;  2C06 A;  3CEY A;  4ZTJ A;  3ZEH A;  3OYF A;  3M55 A;  3OYC A;  2BUD A;  3PMI A;  1Y7X A;  4C92 C;  4M75 E;  3OYM A;  2R57 A;  2DTH A;  4O6J A;  1KG1 A;  4N4G A;  4Y91 A;  3RKW A;  5CR2 A;  5GAM j;  4ZN1 A;  2QQ9 A;  3ER0 A;  4QVD A;  1W2B A;  3CC2 A;  2B8A A;  2GQV A;  4FL6 A;  1Q82 C;  2OTJ A;  1VIE A;  1BKB A;  2RJC A;  1JRI A;  3CBO A;  3LLR A;  3QG1 A;  4M7A E;  1BI1 A;  2X4J A;  3H6Z A;  1D3B B;  2VGM A;  4Y28 E;  5GAN 7;  1S72 A;  2XD0 A;  1NJI U;  3SWN B;  4LDV A;  3JCM c;  4KUD K;  2PUK B;  1WJR A;  4N4I A;  2LRQ A;  3L2U A;  1UEB A;  2KQW A;  2FB7 A;  2ZPE B;  4M75 B;  4EMH A;  4BDY A;  3X28 B;  1NJI C;  4LDX A;  2K4Y A;  4MML A;  3OYK A;  1VQO A;  1YCY A;  4NL2 A;  3E9G A;  4OB3 B;  1OZ3 A;  5KE3 A;  4ELZ C;  2KDS A;  4M7A B;  3JCM V;  1ZQ1 A;  4A4K A;  3CCR T;  3MCA B;  3RUX A;  3OYJ A;  1UGR B;  3DLL A;  4MDW A;  4A4E A;  4P5N A;  2CZ0 B;  1VQN A;  3OSV A;  3OYE A;  4BE2 A;  4YTL A;  2F5K A;  2HQX A;  3CCS A;  2QQB A;  3GF5 A;  1WJS A;  3F70 A;  3CCM T;  3QXE B;  4LDW A;  3DB3 A;  2M1H A;  4A4G A;  2LQ8 A;  1ZBX A;  5GMK e;  4BI3 A;  2HBP A;  2XU8 A;  2GFA A;  1O9S A;  4M77 D;  5GMK i;  2DIQ A;  3GNG A;  3ZBD A;  3OS0 A;  1VQ5 T;  2RI3 A;  5KH6 A;  2EYQ A;  2E6Z A;  1G3T A;  4QVC A;  4M7D B;  4J8O A;  2XI9 A;  4IUT A;  4L5G A;  2RJD A;  3JSC A;  2V8K A;  5CKD A;  4LDU A;  2Y4X A;  2BIV A;  5GMK j;  5IT9 E;  1X75 C;  5J3B A;  4RG8 A;  1VIF A;  3CPF A;  2DPP B;  2E64 A;  4J6X A;  1Y96 B;  2E65 A;  3JCM g;  2RK1 A;  1EIF A;  1NZ9 A;  2LTO A;  2RH2 A;  3QO3 A;  4PKC C;  5FU7 B;  1AHJ B;  4XAX B;  4C5I A;  1VQ6 T;  3P8B B;  3MP1 A;  2OTL T;  3DB4 A;  5D6X A;  3WVE B;  4EPC A;  3OS1 A;  4JUV A;  3UDC A;  5HK0 A;  4C8Q G;  4PJO C;  5GMK h;  1X01 A;  4N0A A;  2DXT A;  3QSU A;  4RCC A;  1LJO A;  5CQX A;  3J7A F;  4C0D B;  1M5Q 1;  4JDS A;  3MHX A;  3P8D A;  3PNW C;  4RKU E;  2YRV A;  1VQP A;  3WXM B;  2AHJ B;  3M57 A;  2YLB A;  4M78 A;  2KSS A;  1KD1 U;  4GY5 A;  3L2W A;  5GMK l;  3OBY A;  3NTI A;  2JOY A;  1Y71 A;  4OB0 B;  3CC4 T;  3CCV T;  2HQE A;  4N0A C;  3OYY A;  4IUP A;  1M90 U;  1YJN T;  5FU6 C;  4EMK C;  2DK3 A;  4BE1 A;  4JLI A;  4ZN3 A;  2GF7 A;  3VYG A;  3MP6 A;  3INZ A;  4BY6 B;  1YIT A;  4M7A D;  2EAY A;  2RHI A;  4FU6 A;  3BY7 A;  5D6W A;  1M90 C;  2EKO A;  4LDY A;  4D6W A;  1NE8 A;  2DAQ A;  3L2R A;  1BYM A;  5CIU A;  3OYG A;  4R55 A;  3OYD A;  4XTZ A;  1VQ8 A;  3A8O B;  2HAX A;  3GIB A;  4II1 A;  5GAN d;  1WJQ A;  2KY9 A;  1VUB A;  2ZPH B;  3HRS A;  2QA4 A;  4C8Q E;  1KQS S;  2RK2 A;  1GXI E;  4HCC A;  3QKJ A;  5GMK m;  5J26 A;  4HT8 A;  2L89 A;  2K5L A;  2BKD N;  4FM4 B;  4J7I A;  5CK9 A;  4JS5 A;  5GAN f;  2R5M A;  3QJ6 A;  1D3B A;  1QVF S;  1BIB A;  1X6O A;  3CC2 T;  3JB9 F;  2RI5 A;  3OSS C;  4M77 E;  2KAF A;  3X24 B;  2VUB A;  1LNX A;  5HY6 A;  3SWN A;  3MEV A;  5IAY A;  3DLM A;  2OTJ T;  4C8Q B;  3VV0 A;  3OA6 A;  4R56 A;  3FJP A;  1S72 T;  4M75 A;  1YJ9 A;  2DIG A;  1YJN A;  3CBP A;  3TU4 K;  3CBM A;  3JB9 G;  4OP0 A;  1M1F A;  2FVU A;  4XU0 A;  4C0G A;  4HT9 A;  2RD1 A;  4M7A A;  3V7S A;  1YHQ T;  2KVQ G;  4M77 B;  3SB2 A;  3GNF B;  1XOV A;  4BAC A;  3LX7 A;  1VQ9 T;  4A4H A;  1FX7 A;  5CKE A;  3OYN A;  1P92 A;  3BDL A;  1QVF A;  2X4W A;  2QQR A;  2GFU A;  4C92 F;  4QVZ A;  4E47 A;  3OYH A;  4J83 A;  5J39 A;  4KBM B;  1Q81 C;  4OMF B;  1IRE B;  4L59 A;  2LX9 A;  1I81 A;  4E7L A;  2E10 A;  2PQW A;  4C92 G;  2I2L A;  1WNL A;  2JTM A;  2V8J A;  5CAI A;  4M7D A;  4NS5 A;  2YLC A;  3CC7 T;  2KK4 A;  3QYH B;  4KUL A;  4E7I A;  2L3R A;  2MWP A;  1H3Z A;  4ME7 A;  1N9S A;  5GAO r;  3RER A;  2DEQ A;  4DOV A;  5GAO q;  1Y96 A;  3JCM d;  4ZGD B;  1UGQ B;  1JJ2 S;  3PIO A;  2QEX T;  2EFI A;  5LJ3 d;  3M9Q A;  5IN1 A;  5CKF A;  4M7D C;  4DQ2 A;  3NTK A;  1YHQ A;  2WSF E;  1O75 A;  3PT9 A;  3JCM f;  4PL6 A;  2P0P A;  4FIB A;  3GOX A;  1VQ9 A;  2CZ7 B;  2QI2 A;  1WQW A;  2WSE E;  3L2V A;  3URG A;  1G3W A;  3HPW A;  1G5V A;  5M9O A;  2QDY B;  5KE2 A;  3S3M A;  5AYF A;  5GAN 8;  3EFR A;  2K5F A;  4C8Q D;  4EMG A;  3JCM b;  3H8Z A;  3MET A;  1VQP T;  2ZZD A;  4WF2 A;  3V7C A;  2R58 A;  1UGS B;  2RB6 A;  2IG0 A;  4X34 A;  5FRO A;  4C0D C;  4JRI A;  3X20 B;  5KCO A;  1VQ4 T;  5CQY A;  4A4F A;  3A8G B;  4ZGJ B;  2EQM A;  2QQS A;  4MZP A;  4BUG A;  3JB9 I;  3CC7 A;  2RHX A;  3E9F A;  3CD6 A;  3PTA A;  5C6S A;  1YIT T;  2MMP A;  1N9R A;  2PVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...