1BYMA

Solution structures of the c-terminal domain of diphtheria toxin repressor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
97
structure length
97
Chain Sequence
NPIPGLDELGVGNSDAAAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (DIPHTHERIA TOXIN REPRESSOR)
publication title Solution structure and peptide binding studies of the C-terminal src homology 3-like domain of the diphtheria toxin repressor protein.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 8
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1998-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bymA00
2LX9A 1U8RA 3MHXA 1G3WA 3HRSA 1G3TA 3E19A 5CVIA 1QVPA 3GLXA 2QQBA 1G3SA 1P92A 3HRUA 1BI0A 2K5LA 2QQAA 2K5IA 2K4YA 4O6JA 1BI2A 1BI3A 4O5VA 2GCXA 1QW1A 2QQ9A 1G3YA 3HRTA 2K5FA 1BYMA 1FX7A 1BI1A 1FWZA 2H3JA
chains in the Genus database with same CATH superfamily
2ED1A 3QYGB 3QYHB 3GBQA 4KGZB 2L3PA 2MF2A 4DBQA 4J9GA 3V8JA 4R55A 1K8AR 2C0TA 2HNIA 2DILA 2L3RA 3CMET 4M7DC 1VA7A 3Q1JA 1M90R 5GAMe 2EBPA 5GANh 2O4XB 3SWNC 3I55A 2ZPGB 1OQKA 2X9HA 3CQTA 2RK1A 2YLCA 1RAIB 5GANf 1VQ9T 3HRSA 2JT4A 2NUTA 1OYXA 2KK4A 3CCJQ 4ZGEB 3CCST 1FMVA 1YHQT 1OU9A 1QWFA 3L2QA 4F7UB 3OB9A 1IB8A 3OMGA 3JCMh 3EG0A 2KYMA 1QCOA 3AT1B 3OW2S 3E1SA 2RJFA 2YUNA 5IT9E 1WQWA 2FZCB 2ABLA 1K0SA 4CC7A 1ZBXA 3JCMf 5KYYB 2QDYB 4J9EA 4DBRA 1Q86R 1RADB 3ZEHA 4AFQC 2KRSA 4DBHA 1QVFS 1VQ7Q 1M9SA 3JB9I 3EG9A 1VQKA 2KSSA 2G3RA 1Z9ZA 2BZXA 1D0XA 2KYBA 4XTYA 4JPBW 3RUXA 1KQ1A 1BI2A 3EGUA 4KGXB 1HYOA 3UF4A 4XTWA 2IG0A 2NWMA 2QQRA 2H3JA 4PLLA 1BU1A 1G3WA 1QVPA 4MZTA 2FZKB 3FJPA 3CCRA 4EIKA 2E64A 3DB4A 4J8OA 3V8LA 3EHRA 1N6AA 4RKUE 2FEIA 2LC4A 3CCEA 1BCOA 3H0IA 3LLRA 4BE2A 1J3TA 4Y28E 4J6XA 1EIFA 1I81A 4F14A 3JAME 2RHXA 2QTVA 4KT0E 1M2VB 2M1HA 2F5TX 1NZ9A 2HQEA 3LX7A 5CCAA 3JCMV 1WQ7A 1M3BA 2CKKA 5CR2A 2J6FA 2CYZB 2VXEA 1AT1B 1OX8A 4PJNA 3QO3A 2O2OA 2VYTA 4BD3A 2EYWA 2JMCA 3NTKA 2JM8A 3LGFA 2E41A 1UECA 3VJPA 1BI0A 1TG0A 4M78F 3M57A 4J7FA 1G83A 3M4GA 4J6YA 2EGCA 3M56A 5LJ5h 3WXMB 3E9FA 3LH5A 5IXBA 1R8OB 3EFSA 2KRNA 2DA9A 8AT1B 2QXFA 2YLBA 2K5FA 2XDPA 1ZHIA 3MJXA 1KQSP 1VQ5Q 2M16A 4TVRA 3TVTA 3G7ZA 1H3HA 4IIOA 3JCMJ 4OB3B 3LWHA 3CC7T 2VXFA 1XQHA 3G6ET 1VQMQ 1M1GA 1WNLA 2LRQA 2RF0A 1YJWA 1KC8R 1MGQA 2DXCA 3EFRA 5LJ3e 4PKCC 1Y7XA 5KYUB 3CCVQ 4J5YA 2P4TA 2QGFB 3CCQA 2RHYA 2YUPA 2M0YA 1PG5B 3NTIA 1LPLA 5KYNA 1D1BA 1O9SA 3HRUA 2EKHA 3EFOB 4KRTA 4V2SA 5FU7C 1S1NA 3I56Q 3CMAQ 2RQTA 2O01E 2ZPIB 5A0LA 1K0XA 3PE0A 2E5KA 2OTLA 2DXBA 2LT4A 3BE3A 4QW2A 1X6BA 2KXDA 2EKOA 3PMIA 2ZAEA 1FWZA 1G3TA 3SFMA 2MAMA 3ZBDA 4R56A 4E7IA 2GNCA 5KE2A 3GF5A 2DF6A 4LDXA 3JCMb 1RUWA 5EC7A 1YITT 1X43A 3G1JA 4FSSA 4DEXA 1YIJA 2KROA 4RCBA 3I55T 1W2BP 4KGVB 1UHCA 4AT1B 2E70A 2DJZA 1WA7A 5GANd 2FPFA 2O4XA 4OMPA 3CXCA 4EMHA 3PTAA 4A4FA 1ABOA 2E5QA 2K5IA 5DM7R 2ROTA 2PVOB 1UGPB 2DVJA 3MP6A 4LDYA 3JCMd 1SPKA 4M77B 2LT1A 1S72A 1KHIA 1YJ9A 3QJ6A 5CKHA 1RI9A 3G71A 1BK2A 5KYXB 3QBYA 5J3BA 1VQKT 1OOTA 4J7IA 3QHSA 4NOYA 4FW1A 5CO7A 1N27A 2DAQA 1Y07A 5CKBA 2P0KA 2YRCA 1K4US 3D7SB 2DYBA 4FU6A 2DJQA 3IQLA 3CEYA 4C8QG 2CZ6B 2FB7A 1VQPT 4C8QD 1XTDA 1CSKA 5GAN5 2XKOC 3U23A 3CCRT 4NL3A 1M8MA 4RG2A 4CI0C 3EHQA 1HD3A 2FPDA 1D0YA 3ASKA 1YI2T 3CCET 1I07A 1ZSZB 3H0FA 1NM7A 5GAOl 3CCLQ 3RR6A 1QMCA 1QP2A 3CD6A 4D8DA 1P92A 4X9DA 4JRIA 3OYDA 1M3AA 2V26A 4C8QA 1K9MR 5I2SA 4QVZA 3A8GB 4LDWA 4O5VA 4FW2A 4LE9A 3L2ZA 1OI1A 3DB3A 3OYMA 4KUIA 2M9UA 3OS1A 1Q7YR 2LX9A 3EGDA 3VS0A 1MV3A 3E19A 1OX9A 1AEYA 4C0GA 5M9OA 1GXIE 1N8RU 2AK5A 1I1JA 2V8IA 2NLUA 3R6NA 1VQLA 2K2MA 2K2VA 2RQVA 2DL3A 2HBPA 2DBKA 4C8QE 1I5LA 2DK3A 2CH4A 3J81E 2DIQA 2SRCA 3M58A 1K76A 4MMLA 1FX7A 2XHCA 3TSZA 1SG5A 1CKBA 4J9BA 5LJ5d 2NUPA 1JU5C 3FJ5A 7AT1B 3CC4A 3RNJA 1QWEA 2KR3A 4E7HA 1FMKA 2QEXA 2QK0A 5DLOA 3PNWC 4WCIA 3QG1A 1WXTA 1XNIA 2CP0A 2M0OA 1YWPA 4AFUC 1RI0A 2P4RA 4B9XA 1BB9A 1NYFA 2JZ2A 2VASA 3GP8A 1E7OA 4PLIA 1IXDA 2KRMA 1VQ6Q 5GAMj 3CCQT 4KH0B 1QLYA 4C0ZA 4CC4B 2QG9B 1D1AA 1VIEA 3CCMQ 5KYUA 1XOVA 2MIOA 3V8KA 3CPFA 3ER0A 3H0HA 2VVKA 2CT3A 1KG1A 2D9TA 1NYGA 3P8BB 3GOXA 3OSVA 4VUBA 4JDSA 2E3IA 1PM3A 2CP7A 1N9SA 4C92F 1NLOC 3CPWP 3KFVA 2LZ6B 1LOJA 2PU9B 1KHCA 1RACB 1ABQA 3BY7A 3MEWA 1FXXA 2RQUA 4NL2A 1YIJT 4UC4A 2CGHA 2HMAA 1KQSS 2V8KA 2VV5A 3NPFA 2X4XA 2BE9B 1YHQQ 3MP1A 2FVUA 3M0UA 2EGEA 4R0KA 5L8RE 4IUVA 4BACA 3REBB 2Y4YA 2QASA 1VQNA 2LP5A 1U3OA 3CC2A 3VUBA 2OTJQ 1PNJA 1Q95G 5DY9A 1K73U 1BIBA 2L5QA 2RN8A 1X2QA 4KH1B 2LJ0A 5GMKl 5GAN8 1I5OB 4KUDK 1ACMB 1X69A 3OA6A 1GRIA 3CCUA 2FPEA 2OAWA 1D09B 1S72T 4PJLA 3A8MB 1YJ9T 2DLPA 2PZ1A 3KXTA 2YRDA 2FL7A 2DBMA 3JB9D 4M78G 2HD0A 5AYFA 2CP3A 3OS5A 4DA4A 1T3SA 3PT9A 4F04B 3HFOA 5I22A 5LJ5e 1QP3A 3H6ZA 2CP6A 1N8RC 2F1LA 3VYHB 1W2BS 4ATOA 3VKIA 1B7TA 2LX7A 4HCCA 3CXCP 3A1PA 3OYJA 4M78A 1E6HA 1E6GA 4XU3A 3CBOA 3CCJA 1IO6A 2Y4XA 2P0PA 2QQAA 1VQ8Q 5CKEA 1GL5A 3JB9H 2CS7A 3QSUA 3O5ZA 1LVKA 1YN8A 1JRIA 2JOYA 1PD1A 2BE7D 4RTXA 2GFUA 1SRMA 1SSFA 2RHIA 4GY5A 4LDUA 2WSFE 2KBTA 1R0CB 3ZFJA 2DL4A 4LUEA 1VQ7A 1GCQC 3M0QA 3VS5A 4J83A 2OAUA 4GBQA 5LJ3j 1WPYA 3WVDB 1LNXA 2JN0A 4OMFB 1MUZA 4OMQA 4RG8A 2DTOA 4JJNK 2FZGB 2LMJA 4MZMA 1X6OA 3M53A 4OB2B 1Q81R 3MHXA 2DMOA 2V8JA 4L5GA 1RLPC 4HVUA 4M7AF 2F2XA 2CUDA 3MKDA 4D8KA 2C0OA 3CC4T 1UEBA 2QEXT 1MMNA 4LN2A 3VS7A 5IHKA 5C0MA 2DYIA 2A36A 3X25B 5GAMg 1TWBA 1MHNA 3G4ST 2IVWA 3A8HB 4JZ4A 4N0AC 3OYFA 1HJDA 1TXQA 4LD6A 1OU8A 3QWXX 4M75F 1QVGA 1B34A 1AD5A 4M77C 4FM4B 2DXTA 1SEMA 2VUBA 3ME9A 1K73C 1ZUUA 1SHGA 5GAOm 5GAOq 4M7DF 3SEMA 4A63B 2MWOA 3I35A 2KY9A 3E9GA 4E47A 1WX6A 4XTVA 2DEQA 4N4GA 3INZA 2RMOA 2Z0WA 1YITQ 3RKYA 1M1KU 4HA8A 2ATCB 1WHHA 2XIDA 4BDYA 4C8QB 2CP2A 2J05A 5CKFA 5IXFA 3FRNA 4OMOA 2L3QA 1YBYA 2RK2A 3TU4K 1VQ5A 4KBMB 1O75A 1TH7A 2J06A 1U1SA 5FU6B 1Y0MA 2OI3A 3OYBA 1ZSZC 1WIEA 3EGDB 1ARKA 1MMGA 1IZ6A 3M5AA 1VQMA 5HY6A 4E7SA 3CC2T 3HSBA 1RAAB 4J9HA 1G3YA 5HCKA 8ATCB 2DL8A 2JMAA 2XU8A 2GQVA 3CCVA 1VQOQ 2K57A 6AT1B 3OYNA 1PC0A 2DERA 3L2WA 3CBPA 3CCUT 2EYZA 5FW9A 4FYXB 2RNAA 4OMLA 2NUPB 3OYGA 2HSEB 4C5HA 3I56A 3CMAA 1QQJA 2C0IA 3PIPA 3QXEB 1VYTA 1GFCA 2HCKA 1RAHB 2RHUA 4HVVA 1VQPQ 4JRPA 4C0FA 2FYKA 1NG2A 2CP5A 1ZBJA 4QVCA 2CZ1B 5CVIA 2YWWA 3CPWS 2I2LA 1JXMA 2E6ZA 5FROA 5GAOn 2DTHA 1KD1C 1YI2Q 3S3NA 2R5AA 3VV0A 9ATCB 1UE9A 1C0MA 2DE0X 2XDDA 5IHIA 2MWPA 1IREB 1WFWA 3HP9A 3OYEA 3VS2A 3CCJT 2O88A 1SSHA 3OBYA 3OYLA 4FL6A 2L8DA 4PK4A 2K79A 4AFSC 1D3BA 2DX1A 2EFIA 2COZA 2OX7A 4LXCA 2MOXA 1HK9A 1PHTA 5LJ3g 2RJCA 4HVWA 2DO3A 1G5VA 1C1AA 4PNOA 3A8LB 2MK5A 5FWBA 1UTIA 2DNUA 2M51A 4XTUA 1VQ7T 1RAGB 2E10A 3M0SA 4C92G 5GAMh 2RO0A 4J9CA 5GMKm 1LJOA 2X4YA 1TTHB 1XJWB 2KT1A 1NBEB 5KCHA 1GBRA 1M1FA 1RAEB 5GAMf 1GFDA 1NEBA 1Q86U 3GPLA 2JJ9A 1G8XA 4JS5A 3M4YA 1U06A 1R0BG 4F17A 1M1KC 3C4SA 1WHGA 5J39A 3CXCS 2D1XA 2COYA 3L1AA 4C92A 3OYKA 4BY6B 1MMAA 5IN1A 3CCLA 4J6WA 4BI3A 2RHZA 1YFNA 4ZN3A 2XICA 2LCCA 3OBWA 3OMCA 1OPKA 3UT1A 4EMKA 3UATA 4WTOB 4KULA 1TSFA 2X3WD 1Z9QA 4YTLA 1UGQB 4EMGA 3L2UA 3JV3A 4M78B 1NJIC 4ZNXA 3JRZA 2KQWA 4DOWA 1PCXA 1Q82C 2KAFA 2LQNA 1TUDA 1UDLA 3X20B 2EGAA 3THKA 1BYMA 3TREA 4QQGA 1U8RA 5D6YA 1YWOA 1JBMA 1VQ5T 1AWJA 2OJ2A 4AMCA 4O6JA 1YJNQ 1WGSA 2XG8D 3A8OB 2LDMA 5KCOA 4JJBA 4ZN1A 1TS9A 4GLMA 1QVGP 4IKFA 3CCVT 1GCPA 2I0NA 4FT4A 2F69A 5C6SA 1VQ6A 2AIRB 1X6GA 1YJ9Q 2GBQA 2CZ7B 2KI7A 3KUFA 2K5LA 3E2UA 3SHWA 4E7ZA 1K8AC 2FG0A 3CCMA 2PVDB 3JCMX 3QJYA 4FCYA 3I56T 3FB9A 2XDBA 3LH0A 1M90C 4ELYC 5GMKe 4EPCA 1NEGA 4JLIA 2P0QA 4HCBA 1BKBA 2QQBA 2QA4Q 1VYUA 4C0DB 5GANe 2AKKA 4M7AG 2QQSA 2CH4W 2ZPFB 1UGRB 3PFSA 3HPWA 2QTXA 2YHTA 1B34B 4PJJA 1YJWT 2BKDN 5LJ3h 4E7JA 3VS6A 1VQ4Q 4JJDA 4X34A 4IUPA 4DEYA 4ESRA 1YHQA 1IHWA 4II1A 4OMNA 1Q86C 1SF9A 5LJ3f 1W70A 4PJOG 2C06A 4CC2A 1UGSB 3TQ7P 3JCMe 2FHDA 3X26B 2OTJA 2QDLA 2RJDA 3H9NA 1NPRA 3JCMc 1Y57A 4M75G 1AWOA 4QVDA 4XU0A 4M7AA 4HT9A 2OTLT 2RI5A 1KQ2A 4OB1B 2JTMA 1OPLA 3CMEQ 1AZGB 5CQXA 1WHJA 2MMPA 4M7DG 1GBQA 2E4HA 2EYXA 2A7YA 3EG3A 4ZTFA 2VB6A 1QW1A 4JRKA 2HZYA 1RABB 4EDUA 4M75A 1VQ9Q 4FYWB 1X01A 4C8QC 3CCSQ 1WJRA 1ZSGA 5GAMd 1WI7A 2JVVA 3QKJA 4B6MA 2VGMA 2RI3A 2L89A 2EVRA 1X2KA 2EWNA 1WJQA 1OZ3A 4F7UF 4P5NA 2LJ3A 4M7DA 3VYGA 4RCCA 4CC3A 5FU6C 2QQ9A 1WHLA 4ZGDB 3G4SQ 3VS4A 4AG2C 3KBGA 2X4WA 3OYIA 2K6DA 4DOVA 2YXYA 3SWNA 3SB2A 2JM9A 1QKWA 1MNDA 3CCLT 3NGPA 4MDWA 1VQ8A 1V29B 4A4EA 1X75C 3RDVA 3G71T 1A0NB 2GQIA 1UFFA 5CK9A 4AG1C 3S3MA 2F5KA 4JUVA 5CIUA 1TUCA 3MEAA 4M78D 3AHUA 1C6VX 4E7KA 4M7DE 3EGXA 2JNGA 2R58A 3QDFA 3UPUA 2V1RA 1JO8A 3M0RA 2DFUA 2DL7A 2PNIA 3QZ9B 2QGGA 2WSCE 2NUZA 3LYIA 2KGTA 1WZOA 4OP0A 1DJ7B 1H8KA 1IGUA 2X51A 2EJFA 4RUGA 2DKGA 2YDLA 2XD0A 3C94A 2D8JA 1ZUYA 3VUZA 2XMFA 2EQMA 2NYSA 4ORZA 4CRIA 1BI1A 1KC8C 2HQHA 4OB0B 4J9IA 1Q7YU 4RMOA 1D3BB 1I4K1 4LUDA 5KH6A 5KYWB 1IHVA 1OZ2A 3CD6T 2DVEA 2ZPBB 1CKAA 1Y96A 1OV3A 4XTXA 4ME7A 1U1TA 3BDUA 2O9VA 3C12A 4OGEA 1MNEA 5GAN6 5GAN3 5I11A 3FDRA 2BIVA 1EX4A 5CQYA 2L2PA 1T3LA 2A37A 3FEOA 1UHFA 4BB7A 1JJ2A 3BFMA 3LW5E 3DLMA 3MP8A 1VQ6T 1D1CA 1IRXA 2HQXA 4RTZA 4Y92A 2KNBB 4M78E 3C0CA 4M4ZA 2K4YA 3O8VA 1KD1U 1VQLT 2KT8A 3CCMT 4A4KA 3JCMP 2DRMA 2DXUA 5IAYA 1JQQA 2RH2A 2LNHB 3RKWA 4RTYA 1IGQA 1TUGB 3T9NA 3VS1A 4JRQA 1ZUKA 4XAXB 4C92B 3FLGA 3CC7Q 3G6EQ 1YITA 1WYXA 1ZA1B 1OULA 1NPPA 3P8HA 2CREA 3QWYA 2EQUA 2G6FX 2K9GA 2Y90A 2PVGB 1AVZC 4JLGA 3VS3A 3P8DA 5L23A 2EIFA 3VU3C 4EMKB 1MV0B 2ROLA 4PJOF 2LQKA 4RTTA 1G3SA 3MCAB 3I5RA 3EG2A 1YCSB 1YNZA 4BY6C 1PKTA 3OW2A 5LJ3d 3QIIA 3I5SA 2LTOA 2OTJT 4N4IA 5IHNA 1QVGS 1QVFA 1VQOA 3PGGA 4WF2A 3S6WA 1UG1A 4IURA 2EQKA 3FIFA 2QI2A 2IPOB 1KFZA 2EPDA 4C5IA 1KSWA 3I55Q 3C95A 4M78C 4LNPA 2O9SA 4A53A 1HSQA 5ECAA 1VQPA 2J6KA 5GJVB 1I8FA 3NHNA 2MI6A 1NLPC 1M2OA 4DQ2A 1YP5A 4XTZA 1AZEA 3M55A 2SEMA 1VQNT 2GF7A 1YI2A 1PWTA 3UA6A 1K9MC 4ZGJB 3SDZA 1UGVA 4LDVA 4J9DA 3TCJA 4L59A 2BUDA 4QQDA 2K3XA 4XK8E 4BI8B 5HK3A 4M77F 1Q7YC 4HT8A 2K3BA 3QPHA 1NJIU 4ELZC 1VQKQ 4B9WA 1Q82U 1VQ8T 2CZ0B 4Z89A 5A2QE 2DD4A 1MMDA 2LNVA 2EJ9A 1M5Q1 2HKNA 5LL6S 2LVMA 4IIMA 1M8VA 4C5GA 4AFZC 1TOVA 3HL8A 3JB9F 2JUFA 2DPPB 3CCRQ 2GGRA 2O31A 1M4ZA 3H41A 2JTEA 2EYYA 1W4SA 1WXUA 3OSSC 4FIBA 3CCEQ 5GMKi 3CPWA 4C0DC 1JB0E 5J26A 5LJ5f 4FT2A 3OYHA 2ZPEB 4HKEA 3OQ5A 4M7AB 4MDXA 1EFNA 1SHFA 3VRZA 2J7IA 1N8RR 4Y91A 5GMKj 2YUOA 1K8AU 1R77A 1QCNA 1UUEA 1SRLA 2CUBA 4OGCA 2COWA 3QDRB 2DZ9A 1M90U 2AZVA 2F2VA 5KYWA 4XU2A 3UDCA 2A28A 4PJOB 1Q81U 5GANj 2JS0A 1T0JA 3HFNA 5A0GA 2LCLA 3OY9A 4M75B 2PTKA 3LWIA 2AT1B 2HSPA 2IIMA 4Z8AA 2HDAA 3PVLA 1M3CA 3V7CA 4C92D 2WACA 2RM4A 3DKMA 3RMSA 4M7DB 3MO8A 1FYNA 1AHJB 4K11A 4RTWA 3SWNB 2HL3A 1AWXA 4ANJA 2XI9A 1N9RA 4E7LA 2E12A 1BBZA 1YJWQ 4X9CA 3RKXA 4F7UG 3MEUA 1AOJA 2RB6A 3F70A 2K3YA 3N5BB 1W6XA 3CCQQ 2W10A 3GLXA 2M02A 2DTIA 2RPNA 2RI2A 3CBMA 3QZ5B 2D8HA 1OEBA 2AHJB 3EGXB 2ZCFB 1WJSA 1X27A 1Y71A 1UJ0A 4PFPA 2EW3A 1YJNA 3FC3A 1JJ2P 2OTLQ 1W1FA 2KVQG 2DZCA 4BUGA 2ZGWA 1VQOT 1TU0B 3M9QA 5EG2A 4F7UA 2R5MA 4F16A 1RAFB 1B07A 2YRVA 3L2VA 2W0ZA 5D7UA 3GNGA 4E2FB 2QYZA 2VKNA 5AT1B 4C92E 2YUQA 1U5SA 4HXJA 4JJCA 3MEVA 5DLQE 2DD5A 2D6FA 4J9FA 1K73R 3NMZC 4QKUA 4FSXA 5KYYA 1Y96B 1YIJQ 4JS4A 3I9QA 4GLKA 3SD4A 5FRNA 1PRMC 3JCMW 2HEQA 5A0DA 3X28B 2CSIA 1WDXA 5IH2A 2QA4A 3PIOA 1EZZB 4PFZA 3J7AF 3TSWA 5HKCA 4F7UE 2MCNA 2L0AA 1LCKA 4JZ3A 2ZZDA 2HAXA 3EG1A 1H3ZA 1VQMT 4BE0A 4MMKA 4IUTA 3OW2P 4N4HA 1H92A 1UJYA 4BE1A 5I2MA 1VQ4A 5LJ5j 3GIBA 2K7AA 4FYYB 2PUOB 2VGNA 3RBBB 2FRWA 2R57A 3OYCA 3PMTA 1S72Q 1FMWA 2A0FB 2JTFA 1I0CA 1M27C 3G71Q 1WXBA 1QVFP 5GAOr 2BTTA 1PSFA 1ZX6A 3UWNA 3LGLA 3WVEB 4A4HA 1UB4A 2VC8A 5CKDA 3CMAT 3L2RA 1F1BB 2VWFA 1M2VA 2D0QB 2BZ8A 1PD0A 4DBFA 1KC8U 1WHMA 2YSQA 2V1QA 2MYSA 3JSCA 3RMQA 3JCMQ 1ZA2B 5D6XA 3OYAA 3ULRB 2RD1A 1Q81C 1N5ZA 3CMEA 4HCZA 2X3XD 3A98A 2AKLA 2FRYA 2NUTB 2LQWA 2JXBA 2A08A 2PQWA 3R6OA 1BI3A 4C92C 4BDZA 4M7AD 3URGA 2WSEE 2YT6A 1RL2A 5CAIA 1VQ9A 2A3LA 2AZSA 4A4GA 3CD6Q 3CCSA 3META 2H3EB 4Z88A 3H8ZA 4C5EA 1KK7A 3M59A 2HL5C 3OS0A 2BZYA 1KD1R 4EMKC 4OMMA 2RJEA 2F2WA 4PJOD 2ECZA 4RTUA 2EJGA 2HBWA 2ZPHB 2PUKB 1D0ZA 3EG9B 5GANg 3RESA 3G4SA 4FYVB 4M75D 4E6RA 5GAOp 3L42A 5FU7B 3JB9J 3REAB 1SKUB 3BDLA 5GJWB 4Z02A 2EQIA 1KIKA 2EQJA 2GFAA 2CDTA 1HXDA 2E65A 1VQLQ 3M0PA 5GAN7 2RQRA 4OVAA 4M7DD 1H641 3PVQA 3JCMg 4PJOA 2JS2A 2P84A 5KE3A 4HCKA 4QQ6A 1BIAA 4LD9K 2CT4A 3EFOA 4PJMA 1WLPB 2EYQA 1K1ZA 3EAEA 3RERA 4ZTJA 3HTRA 4M7AE 3TEEA 3CC4Q 3MPUB 2LQ8A 2X35A 5D6WA 2QEXQ 1YCYA 1GCQA 2B8AA 1KQSA 3V7SA 4RTVA 3DLLA 3HRTA 3A5ZB 4PL6A 3OS2A 5FLXE 1BCMA 4PJOE 3GNFB 1V1CA 2EAYA 1QKXA 1PKSA 4M75E 2X4JA 4XQ3A 3J80E 1M1KR 4M77G 4MZPA 1VOMA 3X24B 4D6WA 3V7RA 2DIGA 4M77D 1YJNT 1VYVA 3HKSA 2GTJA 4PFOA 2KXCA 3S3OA 1WHKA 3RIRA 2DM1A 2DRKA 4IUQA 1V76A 1KJWA 3M54A 3EH2A 4N0AA 4OF1A 5FWCA 2FO0A 1ZQ1A 1PRLC 2E3HA 3JB9G 5FRMA 2QAZA 5I21A 1K9MU 1T0HA 4M77A 4QT7A 4C8QF 2B86A 1K9AA 2E6NA 2L3SA 2KEAA 1QCFA 1ZLMA 1AWWA 5GAN4 4A54A 1JEGA 3QUIA 4IUUA 4Q5WA 5KYXA 4X1VA 1JXOA 2RQWA 1NJIR 2MPXC 2CSQA 2H8HA 4XU1A 1W2BA 3EH1A 3CC7A 1Q82R 2QA4T 3G6EA 1VQNQ 3HHTB 2LJ1A 2RA2A 1NE8A 3CC2Q 3NTHA 4M7AC 2DEUA 5LJ5g 3UA7A 3VRYA 2DL5A 3ZL7C 2J6OA 4NS5A 1PSEA 2ENMA 3OYYA 3NFCA 3CCUQ 4M77E 1VQ4T 2XK0A 1RLQC 1B3QA 2DETA 2E1HA 4PJOC 2GTOA 4BI4A 1JJ2S 3M0TA 1ZSZA 2LCSA 2ED0A 2ESWA 2HKQB 2JW4A 2GCXA 2KE9A 4M75C 1M30A 1G2BA 2KMTA 5GAN2 5HK0A 5GMKh 1VUBA 2KDSA 1VIFA 4L6V5 3BW1A 2D0NA
chains in the Genus database with same CATH topology
1M8VA 4JDSA 3QYGB 1UGQB 3QYHB 4C5GA 4EMGA 2MF2A 3HL8A 3JB9F 2JUFA 3L2UA 2DPPB 1N9SA 3V8JA 4R55A 4M78B 4C92F 1M4ZA 2HNIA 2L3RA 3CMET 1NJIC 4M7DC 3JRZA 3Q1JA 1LOJA 2KQWA 1W4SA 4DOWA 2PU9B 1Q82C 1KHCA 5GAMe 2KAFA 5GANh 2O4XB 3X20B 3OSSC 4FIBA 3BY7A 3SWNC 3I55A 3MEWA 2ZPGB 5GMKi 3CPWA 1FXXA 4C0DC 4NL2A 1YIJT 1JB0E 4UC4A 1BYMA 2CGHA 3TREA 5J26A 5LJ5f 1KQSS 2RK1A 2YLCA 4FT2A 2V8KA 2VV5A 4QQGA 1U8RA 2X4XA 5D6YA 5GANf 3OYHA 2ZPEB 4HKEA 1VQ9T 3HRSA 3OQ5A 3MP1A 2FVUA 4M7AB 4MDXA 1OYXA 2KK4A 1JBMA 5L8RE 4ZGEB 3CCST 1VQ5T 4IUVA 4BACA 1YHQT 4Y91A 2Y4YA 3L2QA 5GMKj 1VQNA 1K8AU 4F7UB 3OB9A 3OMGA 3VUBA 3CC2A 3JCMh 4O6JA 4OGCA 1WGSA 5DY9A 3QDRB 2DZ9A 2XG8D 1K73U 1BIBA 3A8OB 1M90U 2L5QA 2LDMA 5KCOA 3OW2S 3E1SA 4ZN1A 2RJFA 5GMKl 5GAN8 5IT9E 1WQWA 4KUDK 4XU2A 3UDCA 4IKFA 4PJOB 1ZBXA 3OA6A 3JCMf 3CCVT 2QDYB 4FT4A 2F69A 5C6SA 3CCUA 5GANj 1Q81U 1VQ6A 3HFNA 5A0GA 2LCLA 3ZEHA 3OY9A 1QVFS 2CZ7B 4M75B 3KUFA 2K5LA 1M9SA 1S72T 3JB9I 1VQKA 3A8MB 1YJ9T 2KSSA 2G3RA 3KXTA 1K8AC 3LWIA 2FL7A 3CCMA 2PVDB 3JCMX 3QJYA 4XTYA 3RUXA 1KQ1A 1BI2A 3I56T 3FB9A 3JB9D 2XDBA 3LH0A 4M78G 1M90C 4ELYC 2HD0A 5AYFA 5GMKe 4XTWA 3V7CA 4C92D 2WACA 4EPCA 2RM4A 3DKMA 4JLIA 3RMSA 2IG0A 4M7DB 3MO8A 2P0QA 4HCBA 1BKBA 2QQRA 3OS5A 2H3JA 4PLLA 4DA4A 3PT9A 1G3WA 1AHJB 1QVPA 2QQBA 4MZTA 3FJPA 3HFOA 3CCRA 3SWNB 2E64A 3DB4A 4J8OA 5LJ5e 1QP3A 3V8LA 1N6AA 1N9RA 2XI9A 3H6ZA 4C0DB 1N8RC 4RKUE 5GANe 4E7LA 4M7AG 2QQSA 2E12A 2LC4A 3VYHB 1W2BS 4ATOA 3CCEA 2ZPFB 1UGRB 4X9CA 3VKIA 3PFSA 3RKXA 3HPWA 2QTXA 2YHTA 3LLRA 1B34B 4F7UG 4BE2A 4HCCA 3MEUA 4Y28E 2BKDN 4J6XA 5LJ3h 4E7JA 1EIFA 1YJWT 2RB6A 3CCLA 3OYJA 1I81A 4M78A 3F70A 2K3YA 3N5BB 4X34A 4XU3A 4IUPA 3JAME 2RHXA 1YHQA 4KT0E 2M1HA 3GLXA 3CBOA 2F5TX 2DTIA 3CCJA 1NZ9A 2HQEA 2RI2A 3CBMA 3QZ5B 4II1A 3LX7A 2Y4XA 2P0PA 1Q86C 2AHJB 2QQAA 5LJ3f 4PJOG 2C06A 2ZCFB 5CCAA 1UGSB 1WJSA 3JCMe 2FHDA 3JCMV 3X26B 1WQ7A 1Y71A 2OTJA 5CKEA 3JB9H 1YJNA 2CKKA 2CS7A 5CR2A 2RJDA 3FC3A 3QSUA 1NPRA 3JCMc 4M75G 4QVDA 2KVQG 2CYZB 4XU0A 4M7AA 2VXEA 1JRIA 4HT9A 2OTLT 2JOYA 2DZCA 4BUGA 2ZGWA 2GFUA 2RI5A 1SSFA 2RHIA 4GY5A 1VQOT 3QO3A 3M9QA 2VYTA 4OB1B 4LDUA 1KQ2A 2JTMA 5EG2A 4F7UA 4BD3A 2WSFE 2R5MA 3ZFJA 2YRVA 3L2VA 3NTKA 3LGFA 2E41A 3VJPA 5CQXA 3GNGA 1VQ7A 1BI0A 2MMPA 4M7DG 4J83A 4C92E 2A7YA 2OAUA 5LJ3j 3M57A 4J7FA 3MEVA 1WPYA 4M78F 3M4GA 5DLQE 2DD5A 4J6YA 3WVDB 4ZTFA 2D6FA 1LNXA 2JN0A 3M56A 5LJ5h 4OMFB 3WXMB 3E9FA 4RG8A 1R8OB 4FSXA 3EFSA 2DTOA 1QW1A 4JRKA 1Y96B 4JJNK 3BW1A 4JS4A 2QXFA 2YLBA 4GLKA 3SD4A 2K5FA 4MZMA 4EDUA 1X6OA 4M75A 2XDPA 5FRNA 3M53A 4OB2B 3JCMW 3MHXA 1ZHIA 2V8JA 5A0DA 1X01A 4L5GA 2M16A 4C8QC 1WJRA 3X28B 4TVRA 5GAMd 2JVVA 4M7AF 3QKJA 3G7ZA 2QA4A 2VGMA 2RI3A 2L89A 3PIOA 3J7AF 3JCMJ 4OB3B 3LWHA 3CC4T 5HKCA 2EWNA 3CC7T 1WJQA 2VXFA 1XQHA 4F7UE 1OZ3A 1UEBA 4P5NA 4F7UF 3G6ET 2QEXT 2ZZDA 1M1GA 1WNLA 4M7DA 3VYGA 4RCCA 2HAXA 2LRQA 5C0MA 5FU6C 1H3ZA 2QQ9A 4YTLA 1YJWA 1VQMT 1MGQA 2DXCA 3EFRA 4ZGDB 4BE0A 3KBGA 3X25B 5LJ3e 2X4WA 4PKCC 5GAMg 1Y7XA 3OYIA 4MMKA 4IUTA 1MHNA 4DOVA 3G4ST 3SWNA 4N4HA 2IVWA 3SB2A 3A8HB 4J5YA 1VQ4A 2P4TA 5I2MA 4BE1A 5LJ5j 3GIBA 3CCQA 2PUOB 2RHYA 2VGNA 4N0AC 3OYFA 3CCLT 3OYCA 2R57A 3NTIA 3PMTA 1O9SA 2JTFA 3HRUA 4MDWA 4LD6A 4M75F 4V2SA 1QVGA 1VQ8A 1V29B 4A4EA 1B34A 1X75C 5GAOr 1PSFA 4FM4B 4M77C 5FU7C 3G71T 3UWNA 2DXTA 2O01E 2ZPIB 3LGLA 5A0LA 3WVEB 5CK9A 2VUBA 4A4HA 1UB4A 3ME9A 2F5KA 2VC8A 2DXBA 2LT4A 4JUVA 5CKDA 4QW2A 5CIUA 3L2RA 1K73C 3CMAT 2D0QB 1KC8U 3MEAA 4M78D 5GAOm 3AHUA 2EKOA 3PMIA 4M7DE 4E7KA 1FWZA 3JSCA 5GAOq 4M7DF 3RMQA 2JNGA 2MWOA 2R58A 3JCMQ 5D6XA 2KY9A 3OYAA 3UPUA 1G3TA 3E9GA 3SFMA 2RD1A 4E47A 2MAMA 1Q81C 3ZBDA 4XTVA 3CMEA 2DEQA 3QZ9B 4R56A 4E7IA 4N4GA 3INZA 5KE2A 4HCZA 3GF5A 2WSCE 3LYIA 4LDXA 4OP0A 3RKYA 3JCMb 1M1KU 4HA8A 2PQWA 1DJ7B 1YITT 3R6OA 1BI3A 2EJFA 2XIDA 4BDYA 4C8QB 4C92C 4BDZA 4M7AD 2DKGA 3URGA 1YIJA 2WSEE 5CKFA 2XD0A 3C94A 4RCBA 3I55T 1RL2A 3FRNA 3VUZA 1KC8C 2EQMA 5CAIA 4CRIA 1BI1A 1VQ9A 2A3LA 4OB0B 1YBYA 2E70A 2DJZA 1Q7YU 4RMOA 2RK2A 1D3BB 1I4K1 4A4GA 3TU4K 5GANd 1VQ5A 3CCSA 4KBMB 3META 5KH6A 1O75A 1TH7A 1U1SA 3H8ZA 4C5EA 5FU6B 3CD6T 1OZ2A 3M59A 2O4XA 2DVEA 2ZPBB 4EMHA 3OS0A 3OYBA 4A4FA 3PTAA 1Y96A 3CXCA 4XTXA 2E5QA 4ME7A 4EMKC 1U1TA 3BDUA 2K5IA 1IZ6A 2RJEA 5DM7R 3M5AA 1VQMA 4PJOD 2EJGA 2ZPHB 3C12A 5HY6A 2PVOB 4OGEA 2PUKB 3CC2T 3HSBA 5GAN6 5GAN3 3FDRA 5GANg 3RESA 2BIVA 3G4SA 1G3YA 1UGPB 5CQYA 4M75D 2XU8A 2GQVA 3CCVA 3MP6A 2K57A 3OYNA 3FEOA 5GAOp 4LDYA 3L42A 4BB7A 4M77B 5FU7B 3JCMd 3JB9J 3BDLA 1JJ2A 4Z02A 3L2WA 3BFMA 3CBPA 3LW5E 3DLMA 3MP8A 3CCUT 2LT1A 2EQJA 1KHIA 2GFAA 1S72A 1VQ6T 1YJ9A 2HQXA 3QJ6A 5CKHA 3G71A 1HXDA 2E65A 4M78E 5GAN7 3OYGA 3QBYA 2K4YA 4OVAA 5J3BA 4C5HA 1VQKT 3O8VA 1H641 3I56A 4M7DD 3CMAA 4J7IA 1KD1U 1VQLT 3QHSA 3CCMT 4A4KA 3PIPA 3JCMP 4NOYA 3JCMg 4PJOA 2DXUA 3QXEB 5IAYA 5CO7A 2RH2A 1N27A 2DAQA 1Y07A 5KE3A 3RKWA 5CKBA 2P0KA 4QQ6A 1BIAA 2RHUA 4FU6A 4JRPA 4C0FA 3T9NA 4LD9K 3CEYA 2FYKA 4C8QG 2EYQA 2CZ6B 2FB7A 3EAEA 2CZ1B 5CVIA 4QVCA 1VQPT 4ZTJA 3RERA 4C8QD 3CPWS 4JRQA 4M7AE 3TEEA 4XAXB 4C92B 1XTDA 2LQ8A 2X35A 3FLGA 5GAN5 2I2LA 2XKOC 5D6WA 5FROA 2E6ZA 3CCRT 1YCYA 1YITA 4NL3A 5GAOn 4RG2A 2B8AA 2DTHA 3V7SA 3P8HA 1NPPA 4CI0C 1KQSA 1KD1C 2EQUA 3S3NA 2Y90A 3ASKA 3DLLA 3HRTA 2PVGB 1YI2T 3A5ZB 4PL6A 4JLGA 3OS2A 3CCET 3P8DA 2R5AA 3VV0A 5GAOl 5FLXE 2EIFA 3VU3C 4EMKB 4PJOE 1QP2A 3CD6A 4PJOF 2XDDA 3GNFB 2LQKA 2EAYA 1G3SA 1P92A 1IREB 2MWPA 3HP9A 3MCAB 4X9DA 3OYEA 4JRIA 3OYDA 3CCJT 4C8QA 4M75E 4BY6C 3OW2A 3OBYA 2X4JA 4XQ3A 3QIIA 5LJ3d 3J80E 3OYLA 4M77G 4MZPA 4FL6A 3X24B 4D6WA 2L8DA 2LTOA 3V7RA 2DIGA 4M77D 5I2SA 4QVZA 3A8GB 4LDWA 2OTJT 4O5VA 4N4IA 1YJNT 1D3BA 3HKSA 1QVGS 3L2ZA 2EFIA 1QVFA 1OI1A 1VQOA 3S3OA 3DB3A 3OYMA 4KUIA 1HK9A 2M9UA 3OS1A 2LX9A 3RIRA 2RJCA 5LJ3g 3PGGA 4IUQA 2DO3A 4WF2A 1G5VA 3E19A 4PNOA 3S6WA 3A8LB 4C0GA 5M9OA 4IURA 1GXIE 3M54A 2EQKA 4N0AA 3FIFA 4OF1A 2QI2A 1N8RU 2V8IA 2NLUA 4XTUA 1VQ7T 1VQLA 1ZQ1A 2K2VA 2E10A 3JB9G 5FRMA 2HBPA 4C5IA 5I21A 4C92G 5GAMh 1K9MU 4C8QE 4M77A 1I5LA 2RO0A 2DK3A 3C95A 1LJOA 4M78C 2X4YA 4C8QF 5GMKm 2E6NA 2DIQA 3J81E 4A53A 3M58A 4MMLA 1FX7A 2XHCA 1VQPA 5GAN4 4A54A 5KCHA 1I8FA 5LJ5d 3QUIA 4IUUA 1M1FA 4Q5WA 5GAMf 2MI6A 1Q86U 3GPLA 3CC4A 4DQ2A 4XU1A 1W2BA 4XTZA 3CC7A 4JS5A 4E7HA 2QA4T 2QEXA 3G6EA 3HHTB 5DLOA 3M4YA 3PNWC 2RA2A 3QG1A 1NE8A 3M55A 3NTHA 4M7AC 1XNIA 1VQNT 2GF7A 2M0OA 1M1KC 1YI2A 3C4SA 5LJ5g 2OTLA 3CXCS 1RI0A 5J39A 1K9MC 4ZGJB 3SDZA 4B9XA 3L1AA 4C92A 3OYKA 4LDVA 2JZ2A 4BY6B 5IN1A 3TCJA 4J6WA 4NS5A 1PSEA 4L59A 2BUDA 3OYYA 4QQDA 3NFCA 4BI3A 3GP8A 4PLIA 2K3XA 2RHZA 4M77E 4XK8E 4BI8B 2XK0A 4M77F 5HK3A 5GAMj 1VQ4T 3CCQT 1Q7YC 4HT8A 4C0ZA 3QPHA 1NJIU 4ZN3A 2XICA 4ELZC 2E1HA 2LCCA 4PJOC 4B9WA 1Q82U 1VIEA 3OBWA 4BI4A 1JJ2S 2CZ0B 1XOVA 3OMCA 3V8KA 3CPFA 1VQ8T 3UT1A 3ER0A 5A2QE 1KG1A 2GCXA 2DD4A 4EMKA 4M75C 3S3MA 2LNVA 2KMTA 5GAN2 2D9TA 4KULA 5HK0A 2EJ9A 1M5Q1 3P8BB 3GOXA 3OSVA 1VUBA 5GMKh 2KDSA 1VIFA 4L6V5 5LL6S 2LVMA 4VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LX9 A;  1U8R A;  3MHX A;  1G3W A;  3HRS A;  1G3T A;  3E19 A;  5CVI A;  1QVP A;  3GLX A;  2QQB A;  1G3S A;  1P92 A;  3HRU A;  1BI0 A;  2K5L A;  2QQA A;  2K5I A;  2K4Y A;  4O6J A;  1BI2 A;  1BI3 A;  4O5V A;  2GCX A;  1QW1 A;  2QQ9 A;  1G3Y A;  3HRT A;  2K5F A;  1BYM A;  1FX7 A;  1BI1 A;  1FWZ A;  2H3J A; 
#chains in the Genus database with same CATH topology
 2ED1 A;  3QYG B;  3QYH B;  3GBQ A;  4KGZ B;  2L3P A;  2MF2 A;  4DBQ A;  4J9G A;  3V8J A;  4R55 A;  1K8A R;  2C0T A;  2HNI A;  2DIL A;  2L3R A;  3CME T;  4M7D C;  1VA7 A;  3Q1J A;  1M90 R;  5GAM e;  2EBP A;  5GAN h;  2O4X B;  3SWN C;  3I55 A;  2ZPG B;  1OQK A;  2X9H A;  3CQT A;  2RK1 A;  2YLC A;  1RAI B;  5GAN f;  1VQ9 T;  3HRS A;  2JT4 A;  2NUT A;  1OYX A;  2KK4 A;  3CCJ Q;  4ZGE B;  3CCS T;  1FMV A;  1YHQ T;  1OU9 A;  1QWF A;  3L2Q A;  4F7U B;  3OB9 A;  1IB8 A;  3OMG A;  3JCM h;  3EG0 A;  2KYM A;  1QCO A;  3AT1 B;  3OW2 S;  3E1S A;  2RJF A;  2YUN A;  5IT9 E;  1WQW A;  2FZC B;  2ABL A;  1K0S A;  4CC7 A;  1ZBX A;  3JCM f;  5KYY B;  2QDY B;  4J9E A;  4DBR A;  1Q86 R;  1RAD B;  3ZEH A;  4AFQ C;  2KRS A;  4DBH A;  1QVF S;  1VQ7 Q;  1M9S A;  3JB9 I;  3EG9 A;  1VQK A;  2KSS A;  2G3R A;  1Z9Z A;  2BZX A;  1D0X A;  2KYB A;  4XTY A;  4JPB W;  3RUX A;  1KQ1 A;  1BI2 A;  3EGU A;  4KGX B;  1HYO A;  3UF4 A;  4XTW A;  2IG0 A;  2NWM A;  2QQR A;  2H3J A;  4PLL A;  1BU1 A;  1G3W A;  1QVP A;  4MZT A;  2FZK B;  3FJP A;  3CCR A;  4EIK A;  2E64 A;  3DB4 A;  4J8O A;  3V8L A;  3EHR A;  1N6A A;  4RKU E;  2FEI A;  2LC4 A;  3CCE A;  1BCO A;  3H0I A;  3LLR A;  4BE2 A;  1J3T A;  4Y28 E;  4J6X A;  1EIF A;  1I81 A;  4F14 A;  3JAM E;  2RHX A;  2QTV A;  4KT0 E;  1M2V B;  2M1H A;  2F5T X;  1NZ9 A;  2HQE A;  3LX7 A;  5CCA A;  3JCM V;  1WQ7 A;  1M3B A;  2CKK A;  5CR2 A;  2J6F A;  2CYZ B;  2VXE A;  1AT1 B;  1OX8 A;  4PJN A;  3QO3 A;  2O2O A;  2VYT A;  4BD3 A;  2EYW A;  2JMC A;  3NTK A;  2JM8 A;  3LGF A;  2E41 A;  1UEC A;  3VJP A;  1BI0 A;  1TG0 A;  4M78 F;  3M57 A;  4J7F A;  1G83 A;  3M4G A;  4J6Y A;  2EGC A;  3M56 A;  5LJ5 h;  3WXM B;  3E9F A;  3LH5 A;  5IXB A;  1R8O B;  3EFS A;  2KRN A;  2DA9 A;  8AT1 B;  2QXF A;  2YLB A;  2K5F A;  2XDP A;  1ZHI A;  3MJX A;  1KQS P;  1VQ5 Q;  2M16 A;  4TVR A;  3TVT A;  3G7Z A;  1H3H A;  4IIO A;  3JCM J;  4OB3 B;  3LWH A;  3CC7 T;  2VXF A;  1XQH A;  3G6E T;  1VQM Q;  1M1G A;  1WNL A;  2LRQ A;  2RF0 A;  1YJW A;  1KC8 R;  1MGQ A;  2DXC A;  3EFR A;  5LJ3 e;  4PKC C;  1Y7X A;  5KYU B;  3CCV Q;  4J5Y A;  2P4T A;  2QGF B;  3CCQ A;  2RHY A;  2YUP A;  2M0Y A;  1PG5 B;  3NTI A;  1LPL A;  5KYN A;  1D1B A;  1O9S A;  3HRU A;  2EKH A;  3EFO B;  4KRT A;  4V2S A;  5FU7 C;  1S1N A;  3I56 Q;  3CMA Q;  2RQT A;  2O01 E;  2ZPI B;  5A0L A;  1K0X A;  3PE0 A;  2E5K A;  2OTL A;  2DXB A;  2LT4 A;  3BE3 A;  4QW2 A;  1X6B A;  2KXD A;  2EKO A;  3PMI A;  2ZAE A;  1FWZ A;  1G3T A;  3SFM A;  2MAM A;  3ZBD A;  4R56 A;  4E7I A;  2GNC A;  5KE2 A;  3GF5 A;  2DF6 A;  4LDX A;  3JCM b;  1RUW A;  5EC7 A;  1YIT T;  1X43 A;  3G1J A;  4FSS A;  4DEX A;  1YIJ A;  2KRO A;  4RCB A;  3I55 T;  1W2B P;  4KGV B;  1UHC A;  4AT1 B;  2E70 A;  2DJZ A;  1WA7 A;  5GAN d;  2FPF A;  2O4X A;  4OMP A;  3CXC A;  4EMH A;  3PTA A;  4A4F A;  1ABO A;  2E5Q A;  2K5I A;  5DM7 R;  2ROT A;  2PVO B;  1UGP B;  2DVJ A;  3MP6 A;  4LDY A;  3JCM d;  1SPK A;  4M77 B;  2LT1 A;  1S72 A;  1KHI A;  1YJ9 A;  3QJ6 A;  5CKH A;  1RI9 A;  3G71 A;  1BK2 A;  5KYX B;  3QBY A;  5J3B A;  1VQK T;  1OOT A;  4J7I A;  3QHS A;  4NOY A;  4FW1 A;  5CO7 A;  1N27 A;  2DAQ A;  1Y07 A;  5CKB A;  2P0K A;  2YRC A;  1K4U S;  3D7S B;  2DYB A;  4FU6 A;  2DJQ A;  3IQL A;  3CEY A;  4C8Q G;  2CZ6 B;  2FB7 A;  1VQP T;  4C8Q D;  1XTD A;  1CSK A;  5GAN 5;  2XKO C;  3U23 A;  3CCR T;  4NL3 A;  1M8M A;  4RG2 A;  4CI0 C;  3EHQ A;  1HD3 A;  2FPD A;  1D0Y A;  3ASK A;  1YI2 T;  3CCE T;  1I07 A;  1ZSZ B;  3H0F A;  1NM7 A;  5GAO l;  3CCL Q;  3RR6 A;  1QMC A;  1QP2 A;  3CD6 A;  4D8D A;  1P92 A;  4X9D A;  4JRI A;  3OYD A;  1M3A A;  2V26 A;  4C8Q A;  1K9M R;  5I2S A;  4QVZ A;  3A8G B;  4LDW A;  4O5V A;  4FW2 A;  4LE9 A;  3L2Z A;  1OI1 A;  3DB3 A;  3OYM A;  4KUI A;  2M9U A;  3OS1 A;  1Q7Y R;  2LX9 A;  3EGD A;  3VS0 A;  1MV3 A;  3E19 A;  1OX9 A;  1AEY A;  4C0G A;  5M9O A;  1GXI E;  1N8R U;  2AK5 A;  1I1J A;  2V8I A;  2NLU A;  3R6N A;  1VQL A;  2K2M A;  2K2V A;  2RQV A;  2DL3 A;  2HBP A;  2DBK A;  4C8Q E;  1I5L A;  2DK3 A;  2CH4 A;  3J81 E;  2DIQ A;  2SRC A;  3M58 A;  1K76 A;  4MML A;  1FX7 A;  2XHC A;  3TSZ A;  1SG5 A;  1CKB A;  4J9B A;  5LJ5 d;  2NUP A;  1JU5 C;  3FJ5 A;  7AT1 B;  3CC4 A;  3RNJ A;  1QWE A;  2KR3 A;  4E7H A;  1FMK A;  2QEX A;  2QK0 A;  5DLO A;  3PNW C;  4WCI A;  3QG1 A;  1WXT A;  1XNI A;  2CP0 A;  2M0O A;  1YWP A;  4AFU C;  1RI0 A;  2P4R A;  4B9X A;  1BB9 A;  1NYF A;  2JZ2 A;  2VAS A;  3GP8 A;  1E7O A;  4PLI A;  1IXD A;  2KRM A;  1VQ6 Q;  5GAM j;  3CCQ T;  4KH0 B;  1QLY A;  4C0Z A;  4CC4 B;  2QG9 B;  1D1A A;  1VIE A;  3CCM Q;  5KYU A;  1XOV A;  2MIO A;  3V8K A;  3CPF A;  3ER0 A;  3H0H A;  2VVK A;  2CT3 A;  1KG1 A;  2D9T A;  1NYG A;  3P8B B;  3GOX A;  3OSV A;  4VUB A;  4JDS A;  2E3I A;  1PM3 A;  2CP7 A;  1N9S A;  4C92 F;  1NLO C;  3CPW P;  3KFV A;  2LZ6 B;  1LOJ A;  2PU9 B;  1KHC A;  1RAC B;  1ABQ A;  3BY7 A;  3MEW A;  1FXX A;  2RQU A;  4NL2 A;  1YIJ T;  4UC4 A;  2CGH A;  2HMA A;  1KQS S;  2V8K A;  2VV5 A;  3NPF A;  2X4X A;  2BE9 B;  1YHQ Q;  3MP1 A;  2FVU A;  3M0U A;  2EGE A;  4R0K A;  5L8R E;  4IUV A;  4BAC A;  3REB B;  2Y4Y A;  2QAS A;  1VQN A;  2LP5 A;  1U3O A;  3CC2 A;  3VUB A;  2OTJ Q;  1PNJ A;  1Q95 G;  5DY9 A;  1K73 U;  1BIB A;  2L5Q A;  2RN8 A;  1X2Q A;  4KH1 B;  2LJ0 A;  5GMK l;  5GAN 8;  1I5O B;  4KUD K;  1ACM B;  1X69 A;  3OA6 A;  1GRI A;  3CCU A;  2FPE A;  2OAW A;  1D09 B;  1S72 T;  4PJL A;  3A8M B;  1YJ9 T;  2DLP A;  2PZ1 A;  3KXT A;  2YRD A;  2FL7 A;  2DBM A;  3JB9 D;  4M78 G;  2HD0 A;  5AYF A;  2CP3 A;  3OS5 A;  4DA4 A;  1T3S A;  3PT9 A;  4F04 B;  3HFO A;  5I22 A;  5LJ5 e;  1QP3 A;  3H6Z A;  2CP6 A;  1N8R C;  2F1L A;  3VYH B;  1W2B S;  4ATO A;  3VKI A;  1B7T A;  2LX7 A;  4HCC A;  3CXC P;  3A1P A;  3OYJ A;  4M78 A;  1E6H A;  1E6G A;  4XU3 A;  3CBO A;  3CCJ A;  1IO6 A;  2Y4X A;  2P0P A;  2QQA A;  1VQ8 Q;  5CKE A;  1GL5 A;  3JB9 H;  2CS7 A;  3QSU A;  3O5Z A;  1LVK A;  1YN8 A;  1JRI A;  2JOY A;  1PD1 A;  2BE7 D;  4RTX A;  2GFU A;  1SRM A;  1SSF A;  2RHI A;  4GY5 A;  4LDU A;  2WSF E;  2KBT A;  1R0C B;  3ZFJ A;  2DL4 A;  4LUE A;  1VQ7 A;  1GCQ C;  3M0Q A;  3VS5 A;  4J83 A;  2OAU A;  4GBQ A;  5LJ3 j;  1WPY A;  3WVD B;  1LNX A;  2JN0 A;  4OMF B;  1MUZ A;  4OMQ A;  4RG8 A;  2DTO A;  4JJN K;  2FZG B;  2LMJ A;  4MZM A;  1X6O A;  3M53 A;  4OB2 B;  1Q81 R;  3MHX A;  2DMO A;  2V8J A;  4L5G A;  1RLP C;  4HVU A;  4M7A F;  2F2X A;  2CUD A;  3MKD A;  4D8K A;  2C0O A;  3CC4 T;  1UEB A;  2QEX T;  1MMN A;  4LN2 A;  3VS7 A;  5IHK A;  5C0M A;  2DYI A;  2A36 A;  3X25 B;  5GAM g;  1TWB A;  1MHN A;  3G4S T;  2IVW A;  3A8H B;  4JZ4 A;  4N0A C;  3OYF A;  1HJD A;  1TXQ A;  4LD6 A;  1OU8 A;  3QWX X;  4M75 F;  1QVG A;  1B34 A;  1AD5 A;  4M77 C;  4FM4 B;  2DXT A;  1SEM A;  2VUB A;  3ME9 A;  1K73 C;  1ZUU A;  1SHG A;  5GAO m;  5GAO q;  4M7D F;  3SEM A;  4A63 B;  2MWO A;  3I35 A;  2KY9 A;  3E9G A;  4E47 A;  1WX6 A;  4XTV A;  2DEQ A;  4N4G A;  3INZ A;  2RMO A;  2Z0W A;  1YIT Q;  3RKY A;  1M1K U;  4HA8 A;  2ATC B;  1WHH A;  2XID A;  4BDY A;  4C8Q B;  2CP2 A;  2J05 A;  5CKF A;  5IXF A;  3FRN A;  4OMO A;  2L3Q A;  1YBY A;  2RK2 A;  3TU4 K;  1VQ5 A;  4KBM B;  1O75 A;  1TH7 A;  2J06 A;  1U1S A;  5FU6 B;  1Y0M A;  2OI3 A;  3OYB A;  1ZSZ C;  1WIE A;  3EGD B;  1ARK A;  1MMG A;  1IZ6 A;  3M5A A;  1VQM A;  5HY6 A;  4E7S A;  3CC2 T;  3HSB A;  1RAA B;  4J9H A;  1G3Y A;  5HCK A;  8ATC B;  2DL8 A;  2JMA A;  2XU8 A;  2GQV A;  3CCV A;  1VQO Q;  2K57 A;  6AT1 B;  3OYN A;  1PC0 A;  2DER A;  3L2W A;  3CBP A;  3CCU T;  2EYZ A;  5FW9 A;  4FYX B;  2RNA A;  4OML A;  2NUP B;  3OYG A;  2HSE B;  4C5H A;  3I56 A;  3CMA A;  1QQJ A;  2C0I A;  3PIP A;  3QXE B;  1VYT A;  1GFC A;  2HCK A;  1RAH B;  2RHU A;  4HVV A;  1VQP Q;  4JRP A;  4C0F A;  2FYK A;  1NG2 A;  2CP5 A;  1ZBJ A;  4QVC A;  2CZ1 B;  5CVI A;  2YWW A;  3CPW S;  2I2L A;  1JXM A;  2E6Z A;  5FRO A;  5GAO n;  2DTH A;  1KD1 C;  1YI2 Q;  3S3N A;  2R5A A;  3VV0 A;  9ATC B;  1UE9 A;  1C0M A;  2DE0 X;  2XDD A;  5IHI A;  2MWP A;  1IRE B;  1WFW A;  3HP9 A;  3OYE A;  3VS2 A;  3CCJ T;  2O88 A;  1SSH A;  3OBY A;  3OYL A;  4FL6 A;  2L8D A;  4PK4 A;  2K79 A;  4AFS C;  1D3B A;  2DX1 A;  2EFI A;  2COZ A;  2OX7 A;  4LXC A;  2MOX A;  1HK9 A;  1PHT A;  5LJ3 g;  2RJC A;  4HVW A;  2DO3 A;  1G5V A;  1C1A A;  4PNO A;  3A8L B;  2MK5 A;  5FWB A;  1UTI A;  2DNU A;  2M51 A;  4XTU A;  1VQ7 T;  1RAG B;  2E10 A;  3M0S A;  4C92 G;  5GAM h;  2RO0 A;  4J9C A;  5GMK m;  1LJO A;  2X4Y A;  1TTH B;  1XJW B;  2KT1 A;  1NBE B;  5KCH A;  1GBR A;  1M1F A;  1RAE B;  5GAM f;  1GFD A;  1NEB A;  1Q86 U;  3GPL A;  2JJ9 A;  1G8X A;  4JS5 A;  3M4Y A;  1U06 A;  1R0B G;  4F17 A;  1M1K C;  3C4S A;  1WHG A;  5J39 A;  3CXC S;  2D1X A;  2COY A;  3L1A A;  4C92 A;  3OYK A;  4BY6 B;  1MMA A;  5IN1 A;  3CCL A;  4J6W A;  4BI3 A;  2RHZ A;  1YFN A;  4ZN3 A;  2XIC A;  2LCC A;  3OBW A;  3OMC A;  1OPK A;  3UT1 A;  4EMK A;  3UAT A;  4WTO B;  4KUL A;  1TSF A;  2X3W D;  1Z9Q A;  4YTL A;  1UGQ B;  4EMG A;  3L2U A;  3JV3 A;  4M78 B;  1NJI C;  4ZNX A;  3JRZ A;  2KQW A;  4DOW A;  1PCX A;  1Q82 C;  2KAF A;  2LQN A;  1TUD A;  1UDL A;  3X20 B;  2EGA A;  3THK A;  1BYM A;  3TRE A;  4QQG A;  1U8R A;  5D6Y A;  1YWO A;  1JBM A;  1VQ5 T;  1AWJ A;  2OJ2 A;  4AMC A;  4O6J A;  1YJN Q;  1WGS A;  2XG8 D;  3A8O B;  2LDM A;  5KCO A;  4JJB A;  4ZN1 A;  1TS9 A;  4GLM A;  1QVG P;  4IKF A;  3CCV T;  1GCP A;  2I0N A;  4FT4 A;  2F69 A;  5C6S A;  1VQ6 A;  2AIR B;  1X6G A;  1YJ9 Q;  2GBQ A;  2CZ7 B;  2KI7 A;  3KUF A;  2K5L A;  3E2U A;  3SHW A;  4E7Z A;  1K8A C;  2FG0 A;  3CCM A;  2PVD B;  3JCM X;  3QJY A;  4FCY A;  3I56 T;  3FB9 A;  2XDB A;  3LH0 A;  1M90 C;  4ELY C;  5GMK e;  4EPC A;  1NEG A;  4JLI A;  2P0Q A;  4HCB A;  1BKB A;  2QQB A;  2QA4 Q;  1VYU A;  4C0D B;  5GAN e;  2AKK A;  4M7A G;  2QQS A;  2CH4 W;  2ZPF B;  1UGR B;  3PFS A;  3HPW A;  2QTX A;  2YHT A;  1B34 B;  4PJJ A;  1YJW T;  2BKD N;  5LJ3 h;  4E7J A;  3VS6 A;  1VQ4 Q;  4JJD A;  4X34 A;  4IUP A;  4DEY A;  4ESR A;  1YHQ A;  1IHW A;  4II1 A;  4OMN A;  1Q86 C;  1SF9 A;  5LJ3 f;  1W70 A;  4PJO G;  2C06 A;  4CC2 A;  1UGS B;  3TQ7 P;  3JCM e;  2FHD A;  3X26 B;  2OTJ A;  2QDL A;  2RJD A;  3H9N A;  1NPR A;  3JCM c;  1Y57 A;  4M75 G;  1AWO A;  4QVD A;  4XU0 A;  4M7A A;  4HT9 A;  2OTL T;  2RI5 A;  1KQ2 A;  4OB1 B;  2JTM A;  1OPL A;  3CME Q;  1AZG B;  5CQX A;  1WHJ A;  2MMP A;  4M7D G;  1GBQ A;  2E4H A;  2EYX A;  2A7Y A;  3EG3 A;  4ZTF A;  2VB6 A;  1QW1 A;  4JRK A;  2HZY A;  1RAB B;  4EDU A;  4M75 A;  1VQ9 Q;  4FYW B;  1X01 A;  4C8Q C;  3CCS Q;  1WJR A;  1ZSG A;  5GAM d;  1WI7 A;  2JVV A;  3QKJ A;  4B6M A;  2VGM A;  2RI3 A;  2L89 A;  2EVR A;  1X2K A;  2EWN A;  1WJQ A;  1OZ3 A;  4F7U F;  4P5N A;  2LJ3 A;  4M7D A;  3VYG A;  4RCC A;  4CC3 A;  5FU6 C;  2QQ9 A;  1WHL A;  4ZGD B;  3G4S Q;  3VS4 A;  4AG2 C;  3KBG A;  2X4W A;  3OYI A;  2K6D A;  4DOV A;  2YXY A;  3SWN A;  3SB2 A;  2JM9 A;  1QKW A;  1MND A;  3CCL T;  3NGP A;  4MDW A;  1VQ8 A;  1V29 B;  4A4E A;  1X75 C;  3RDV A;  3G71 T;  1A0N B;  2GQI A;  1UFF A;  5CK9 A;  4AG1 C;  3S3M A;  2F5K A;  4JUV A;  5CIU A;  1TUC A;  3MEA A;  4M78 D;  3AHU A;  1C6V X;  4E7K A;  4M7D E;  3EGX A;  2JNG A;  2R58 A;  3QDF A;  3UPU A;  2V1R A;  1JO8 A;  3M0R A;  2DFU A;  2DL7 A;  2PNI A;  3QZ9 B;  2QGG A;  2WSC E;  2NUZ A;  3LYI A;  2KGT A;  1WZO A;  4OP0 A;  1DJ7 B;  1H8K A;  1IGU A;  2X51 A;  2EJF A;  4RUG A;  2DKG A;  2YDL A;  2XD0 A;  3C94 A;  2D8J A;  1ZUY A;  3VUZ A;  2XMF A;  2EQM A;  2NYS A;  4ORZ A;  4CRI A;  1BI1 A;  1KC8 C;  2HQH A;  4OB0 B;  4J9I A;  1Q7Y U;  4RMO A;  1D3B B;  1I4K 1;  4LUD A;  5KH6 A;  5KYW B;  1IHV A;  1OZ2 A;  3CD6 T;  2DVE A;  2ZPB B;  1CKA A;  1Y96 A;  1OV3 A;  4XTX A;  4ME7 A;  1U1T A;  3BDU A;  2O9V A;  3C12 A;  4OGE A;  1MNE A;  5GAN 6;  5GAN 3;  5I11 A;  3FDR A;  2BIV A;  1EX4 A;  5CQY A;  2L2P A;  1T3L A;  2A37 A;  3FEO A;  1UHF A;  4BB7 A;  1JJ2 A;  3BFM A;  3LW5 E;  3DLM A;  3MP8 A;  1VQ6 T;  1D1C A;  1IRX A;  2HQX A;  4RTZ A;  4Y92 A;  2KNB B;  4M78 E;  3C0C A;  4M4Z A;  2K4Y A;  3O8V A;  1KD1 U;  1VQL T;  2KT8 A;  3CCM T;  4A4K A;  3JCM P;  2DRM A;  2DXU A;  5IAY A;  1JQQ A;  2RH2 A;  2LNH B;  3RKW A;  4RTY A;  1IGQ A;  1TUG B;  3T9N A;  3VS1 A;  4JRQ A;  1ZUK A;  4XAX B;  4C92 B;  3FLG A;  3CC7 Q;  3G6E Q;  1YIT A;  1WYX A;  1ZA1 B;  1OUL A;  1NPP A;  3P8H A;  2CRE A;  3QWY A;  2EQU A;  2G6F X;  2K9G A;  2Y90 A;  2PVG B;  1AVZ C;  4JLG A;  3VS3 A;  3P8D A;  5L23 A;  2EIF A;  3VU3 C;  4EMK B;  1MV0 B;  2ROL A;  4PJO F;  2LQK A;  4RTT A;  1G3S A;  3MCA B;  3I5R A;  3EG2 A;  1YCS B;  1YNZ A;  4BY6 C;  1PKT A;  3OW2 A;  5LJ3 d;  3QII A;  3I5S A;  2LTO A;  2OTJ T;  4N4I A;  5IHN A;  1QVG S;  1QVF A;  1VQO A;  3PGG A;  4WF2 A;  3S6W A;  1UG1 A;  4IUR A;  2EQK A;  3FIF A;  2QI2 A;  2IPO B;  1KFZ A;  2EPD A;  4C5I A;  1KSW A;  3I55 Q;  3C95 A;  4M78 C;  4LNP A;  2O9S A;  4A53 A;  1HSQ A;  5ECA A;  1VQP A;  2J6K A;  5GJV B;  1I8F A;  3NHN A;  2MI6 A;  1NLP C;  1M2O A;  4DQ2 A;  1YP5 A;  4XTZ A;  1AZE A;  3M55 A;  2SEM A;  1VQN T;  2GF7 A;  1YI2 A;  1PWT A;  3UA6 A;  1K9M C;  4ZGJ B;  3SDZ A;  1UGV A;  4LDV A;  4J9D A;  3TCJ A;  4L59 A;  2BUD A;  4QQD A;  2K3X A;  4XK8 E;  4BI8 B;  5HK3 A;  4M77 F;  1Q7Y C;  4HT8 A;  2K3B A;  3QPH A;  1NJI U;  4ELZ C;  1VQK Q;  4B9W A;  1Q82 U;  1VQ8 T;  2CZ0 B;  4Z89 A;  5A2Q E;  2DD4 A;  1MMD A;  2LNV A;  2EJ9 A;  1M5Q 1;  2HKN A;  5LL6 S;  2LVM A;  4IIM A;  1M8V A;  4C5G A;  4AFZ C;  1TOV A;  3HL8 A;  3JB9 F;  2JUF A;  2DPP B;  3CCR Q;  2GGR A;  2O31 A;  1M4Z A;  3H41 A;  2JTE A;  2EYY A;  1W4S A;  1WXU A;  3OSS C;  4FIB A;  3CCE Q;  5GMK i;  3CPW A;  4C0D C;  1JB0 E;  5J26 A;  5LJ5 f;  4FT2 A;  3OYH A;  2ZPE B;  4HKE A;  3OQ5 A;  4M7A B;  4MDX A;  1EFN A;  1SHF A;  3VRZ A;  2J7I A;  1N8R R;  4Y91 A;  5GMK j;  2YUO A;  1K8A U;  1R77 A;  1QCN A;  1UUE A;  1SRL A;  2CUB A;  4OGC A;  2COW A;  3QDR B;  2DZ9 A;  1M90 U;  2AZV A;  2F2V A;  5KYW A;  4XU2 A;  3UDC A;  2A28 A;  4PJO B;  1Q81 U;  5GAN j;  2JS0 A;  1T0J A;  3HFN A;  5A0G A;  2LCL A;  3OY9 A;  4M75 B;  2PTK A;  3LWI A;  2AT1 B;  2HSP A;  2IIM A;  4Z8A A;  2HDA A;  3PVL A;  1M3C A;  3V7C A;  4C92 D;  2WAC A;  2RM4 A;  3DKM A;  3RMS A;  4M7D B;  3MO8 A;  1FYN A;  1AHJ B;  4K11 A;  4RTW A;  3SWN B;  2HL3 A;  1AWX A;  4ANJ A;  2XI9 A;  1N9R A;  4E7L A;  2E12 A;  1BBZ A;  1YJW Q;  4X9C A;  3RKX A;  4F7U G;  3MEU A;  1AOJ A;  2RB6 A;  3F70 A;  2K3Y A;  3N5B B;  1W6X A;  3CCQ Q;  2W10 A;  3GLX A;  2M02 A;  2DTI A;  2RPN A;  2RI2 A;  3CBM A;  3QZ5 B;  2D8H A;  1OEB A;  2AHJ B;  3EGX B;  2ZCF B;  1WJS A;  1X27 A;  1Y71 A;  1UJ0 A;  4PFP A;  2EW3 A;  1YJN A;  3FC3 A;  1JJ2 P;  2OTL Q;  1W1F A;  2KVQ G;  2DZC A;  4BUG A;  2ZGW A;  1VQO T;  1TU0 B;  3M9Q A;  5EG2 A;  4F7U A;  2R5M A;  4F16 A;  1RAF B;  1B07 A;  2YRV A;  3L2V A;  2W0Z A;  5D7U A;  3GNG A;  4E2F B;  2QYZ A;  2VKN A;  5AT1 B;  4C92 E;  2YUQ A;  1U5S A;  4HXJ A;  4JJC A;  3MEV A;  5DLQ E;  2DD5 A;  2D6F A;  4J9F A;  1K73 R;  3NMZ C;  4QKU A;  4FSX A;  5KYY A;  1Y96 B;  1YIJ Q;  4JS4 A;  3I9Q A;  4GLK A;  3SD4 A;  5FRN A;  1PRM C;  3JCM W;  2HEQ A;  5A0D A;  3X28 B;  2CSI A;  1WDX A;  5IH2 A;  2QA4 A;  3PIO A;  1EZZ B;  4PFZ A;  3J7A F;  3TSW A;  5HKC A;  4F7U E;  2MCN A;  2L0A A;  1LCK A;  4JZ3 A;  2ZZD A;  2HAX A;  3EG1 A;  1H3Z A;  1VQM T;  4BE0 A;  4MMK A;  4IUT A;  3OW2 P;  4N4H A;  1H92 A;  1UJY A;  4BE1 A;  5I2M A;  1VQ4 A;  5LJ5 j;  3GIB A;  2K7A A;  4FYY B;  2PUO B;  2VGN A;  3RBB B;  2FRW A;  2R57 A;  3OYC A;  3PMT A;  1S72 Q;  1FMW A;  2A0F B;  2JTF A;  1I0C A;  1M27 C;  3G71 Q;  1WXB A;  1QVF P;  5GAO r;  2BTT A;  1PSF A;  1ZX6 A;  3UWN A;  3LGL A;  3WVE B;  4A4H A;  1UB4 A;  2VC8 A;  5CKD A;  3CMA T;  3L2R A;  1F1B B;  2VWF A;  1M2V A;  2D0Q B;  2BZ8 A;  1PD0 A;  4DBF A;  1KC8 U;  1WHM A;  2YSQ A;  2V1Q A;  2MYS A;  3JSC A;  3RMQ A;  3JCM Q;  1ZA2 B;  5D6X A;  3OYA A;  3ULR B;  2RD1 A;  1Q81 C;  1N5Z A;  3CME A;  4HCZ A;  2X3X D;  3A98 A;  2AKL A;  2FRY A;  2NUT B;  2LQW A;  2JXB A;  2A08 A;  2PQW A;  3R6O A;  1BI3 A;  4C92 C;  4BDZ A;  4M7A D;  3URG A;  2WSE E;  2YT6 A;  1RL2 A;  5CAI A;  1VQ9 A;  2A3L A;  2AZS A;  4A4G A;  3CD6 Q;  3CCS A;  3MET A;  2H3E B;  4Z88 A;  3H8Z A;  4C5E A;  1KK7 A;  3M59 A;  2HL5 C;  3OS0 A;  2BZY A;  1KD1 R;  4EMK C;  4OMM A;  2RJE A;  2F2W A;  4PJO D;  2ECZ A;  4RTU A;  2EJG A;  2HBW A;  2ZPH B;  2PUK B;  1D0Z A;  3EG9 B;  5GAN g;  3RES A;  3G4S A;  4FYV B;  4M75 D;  4E6R A;  5GAO p;  3L42 A;  5FU7 B;  3JB9 J;  3REA B;  1SKU B;  3BDL A;  5GJW B;  4Z02 A;  2EQI A;  1KIK A;  2EQJ A;  2GFA A;  2CDT A;  1HXD A;  2E65 A;  1VQL Q;  3M0P A;  5GAN 7;  2RQR A;  4OVA A;  4M7D D;  1H64 1;  3PVQ A;  3JCM g;  4PJO A;  2JS2 A;  2P84 A;  5KE3 A;  4HCK A;  4QQ6 A;  1BIA A;  4LD9 K;  2CT4 A;  3EFO A;  4PJM A;  1WLP B;  2EYQ A;  1K1Z A;  3EAE A;  3RER A;  4ZTJ A;  3HTR A;  4M7A E;  3TEE A;  3CC4 Q;  3MPU B;  2LQ8 A;  2X35 A;  5D6W A;  2QEX Q;  1YCY A;  1GCQ A;  2B8A A;  1KQS A;  3V7S A;  4RTV A;  3DLL A;  3HRT A;  3A5Z B;  4PL6 A;  3OS2 A;  5FLX E;  1BCM A;  4PJO E;  3GNF B;  1V1C A;  2EAY A;  1QKX A;  1PKS A;  4M75 E;  2X4J A;  4XQ3 A;  3J80 E;  1M1K R;  4M77 G;  4MZP A;  1VOM A;  3X24 B;  4D6W A;  3V7R A;  2DIG A;  4M77 D;  1YJN T;  1VYV A;  3HKS A;  2GTJ A;  4PFO A;  2KXC A;  3S3O A;  1WHK A;  3RIR A;  2DM1 A;  2DRK A;  4IUQ A;  1V76 A;  1KJW A;  3M54 A;  3EH2 A;  4N0A A;  4OF1 A;  5FWC A;  2FO0 A;  1ZQ1 A;  1PRL C;  2E3H A;  3JB9 G;  5FRM A;  2QAZ A;  5I21 A;  1K9M U;  1T0H A;  4M77 A;  4QT7 A;  4C8Q F;  2B86 A;  1K9A A;  2E6N A;  2L3S A;  2KEA A;  1QCF A;  1ZLM A;  1AWW A;  5GAN 4;  4A54 A;  1JEG A;  3QUI A;  4IUU A;  4Q5W A;  5KYX A;  4X1V A;  1JXO A;  2RQW A;  1NJI R;  2MPX C;  2CSQ A;  2H8H A;  4XU1 A;  1W2B A;  3EH1 A;  3CC7 A;  1Q82 R;  2QA4 T;  3G6E A;  1VQN Q;  3HHT B;  2LJ1 A;  2RA2 A;  1NE8 A;  3CC2 Q;  3NTH A;  4M7A C;  2DEU A;  5LJ5 g;  3UA7 A;  3VRY A;  2DL5 A;  3ZL7 C;  2J6O A;  4NS5 A;  1PSE A;  2ENM A;  3OYY A;  3NFC A;  3CCU Q;  4M77 E;  1VQ4 T;  2XK0 A;  1RLQ C;  1B3Q A;  2DET A;  2E1H A;  4PJO C;  2GTO A;  4BI4 A;  1JJ2 S;  3M0T A;  1ZSZ A;  2LCS A;  2ED0 A;  2ESW A;  2HKQ B;  2JW4 A;  2GCX A;  2KE9 A;  4M75 C;  1M30 A;  1G2B A;  2KMT A;  5GAN 2;  5HK0 A;  5GMK h;  1VUB A;  2KDS A;  1VIF A;  4L6V 5;  3BW1 A;  2D0N A; 
#chains in the Genus database with same CATH homology
 1M8V A;  4JDS A;  3QYG B;  1UGQ B;  3QYH B;  4C5G A;  4EMG A;  2MF2 A;  3HL8 A;  3JB9 F;  2JUF A;  3L2U A;  2DPP B;  1N9S A;  3V8J A;  4R55 A;  4M78 B;  4C92 F;  1M4Z A;  2HNI A;  2L3R A;  3CME T;  1NJI C;  4M7D C;  3JRZ A;  3Q1J A;  1LOJ A;  2KQW A;  1W4S A;  4DOW A;  2PU9 B;  1Q82 C;  1KHC A;  5GAM e;  2KAF A;  5GAN h;  2O4X B;  3X20 B;  3OSS C;  4FIB A;  3BY7 A;  3SWN C;  3I55 A;  3MEW A;  2ZPG B;  5GMK i;  3CPW A;  1FXX A;  4C0D C;  4NL2 A;  1YIJ T;  1JB0 E;  4UC4 A;  1BYM A;  2CGH A;  3TRE A;  5J26 A;  5LJ5 f;  1KQS S;  2RK1 A;  2YLC A;  4FT2 A;  2V8K A;  2VV5 A;  4QQG A;  1U8R A;  2X4X A;  5D6Y A;  5GAN f;  3OYH A;  2ZPE B;  4HKE A;  1VQ9 T;  3HRS A;  3OQ5 A;  3MP1 A;  2FVU A;  4M7A B;  4MDX A;  1OYX A;  2KK4 A;  1JBM A;  5L8R E;  4ZGE B;  3CCS T;  1VQ5 T;  4IUV A;  4BAC A;  1YHQ T;  4Y91 A;  2Y4Y A;  3L2Q A;  5GMK j;  1VQN A;  1K8A U;  4F7U B;  3OB9 A;  3OMG A;  3VUB A;  3CC2 A;  3JCM h;  4O6J A;  4OGC A;  1WGS A;  5DY9 A;  3QDR B;  2DZ9 A;  2XG8 D;  1K73 U;  1BIB A;  3A8O B;  1M90 U;  2L5Q A;  2LDM A;  5KCO A;  3OW2 S;  3E1S A;  4ZN1 A;  2RJF A;  5GMK l;  5GAN 8;  5IT9 E;  1WQW A;  4KUD K;  4XU2 A;  3UDC A;  4IKF A;  4PJO B;  1ZBX A;  3OA6 A;  3JCM f;  3CCV T;  2QDY B;  4FT4 A;  2F69 A;  5C6S A;  3CCU A;  5GAN j;  1Q81 U;  1VQ6 A;  3HFN A;  5A0G A;  2LCL A;  3ZEH A;  3OY9 A;  1QVF S;  2CZ7 B;  4M75 B;  3KUF A;  2K5L A;  1M9S A;  1S72 T;  3JB9 I;  1VQK A;  3A8M B;  1YJ9 T;  2KSS A;  2G3R A;  3KXT A;  1K8A C;  3LWI A;  2FL7 A;  3CCM A;  2PVD B;  3JCM X;  3QJY A;  4XTY A;  3RUX A;  1KQ1 A;  1BI2 A;  3I56 T;  3FB9 A;  3JB9 D;  2XDB A;  3LH0 A;  4M78 G;  1M90 C;  4ELY C;  2HD0 A;  5AYF A;  5GMK e;  4XTW A;  3V7C A;  4C92 D;  2WAC A;  4EPC A;  2RM4 A;  3DKM A;  4JLI A;  3RMS A;  2IG0 A;  4M7D B;  3MO8 A;  2P0Q A;  4HCB A;  1BKB A;  2QQR A;  3OS5 A;  2H3J A;  4PLL A;  4DA4 A;  3PT9 A;  1G3W A;  1AHJ B;  1QVP A;  2QQB A;  4MZT A;  3FJP A;  3HFO A;  3CCR A;  3SWN B;  2E64 A;  3DB4 A;  4J8O A;  5LJ5 e;  1QP3 A;  3V8L A;  1N6A A;  1N9R A;  2XI9 A;  3H6Z A;  4C0D B;  1N8R C;  4RKU E;  5GAN e;  4E7L A;  4M7A G;  2QQS A;  2E12 A;  2LC4 A;  3VYH B;  1W2B S;  4ATO A;  3CCE A;  2ZPF B;  1UGR B;  4X9C A;  3VKI A;  3PFS A;  3RKX A;  3HPW A;  2QTX A;  2YHT A;  3LLR A;  1B34 B;  4F7U G;  4BE2 A;  4HCC A;  3MEU A;  4Y28 E;  2BKD N;  4J6X A;  5LJ3 h;  4E7J A;  1EIF A;  1YJW T;  2RB6 A;  3CCL A;  3OYJ A;  1I81 A;  4M78 A;  3F70 A;  2K3Y A;  3N5B B;  4X34 A;  4XU3 A;  4IUP A;  3JAM E;  2RHX A;  1YHQ A;  4KT0 E;  2M1H A;  3GLX A;  3CBO A;  2F5T X;  2DTI A;  3CCJ A;  1NZ9 A;  2HQE A;  2RI2 A;  3CBM A;  3QZ5 B;  4II1 A;  3LX7 A;  2Y4X A;  2P0P A;  1Q86 C;  2AHJ B;  2QQA A;  5LJ3 f;  4PJO G;  2C06 A;  2ZCF B;  5CCA A;  1UGS B;  1WJS A;  3JCM e;  2FHD A;  3JCM V;  3X26 B;  1WQ7 A;  1Y71 A;  2OTJ A;  5CKE A;  3JB9 H;  1YJN A;  2CKK A;  2CS7 A;  5CR2 A;  2RJD A;  3FC3 A;  3QSU A;  1NPR A;  3JCM c;  4M75 G;  4QVD A;  2KVQ G;  2CYZ B;  4XU0 A;  4M7A A;  2VXE A;  1JRI A;  4HT9 A;  2OTL T;  2JOY A;  2DZC A;  4BUG A;  2ZGW A;  2GFU A;  2RI5 A;  1SSF A;  2RHI A;  4GY5 A;  1VQO T;  3QO3 A;  3M9Q A;  2VYT A;  4OB1 B;  4LDU A;  1KQ2 A;  2JTM A;  5EG2 A;  4F7U A;  4BD3 A;  2WSF E;  2R5M A;  3ZFJ A;  2YRV A;  3L2V A;  3NTK A;  3LGF A;  2E41 A;  3VJP A;  5CQX A;  3GNG A;  1VQ7 A;  1BI0 A;  2MMP A;  4M7D G;  4J83 A;  4C92 E;  2A7Y A;  2OAU A;  5LJ3 j;  3M57 A;  4J7F A;  3MEV A;  1WPY A;  4M78 F;  3M4G A;  5DLQ E;  2DD5 A;  4J6Y A;  3WVD B;  4ZTF A;  2D6F A;  1LNX A;  2JN0 A;  3M56 A;  5LJ5 h;  4OMF B;  3WXM B;  3E9F A;  4RG8 A;  1R8O B;  4FSX A;  3EFS A;  2DTO A;  1QW1 A;  4JRK A;  1Y96 B;  4JJN K;  3BW1 A;  4JS4 A;  2QXF A;  2YLB A;  4GLK A;  3SD4 A;  2K5F A;  4MZM A;  4EDU A;  1X6O A;  4M75 A;  2XDP A;  5FRN A;  3M53 A;  4OB2 B;  3JCM W;  3MHX A;  1ZHI A;  2V8J A;  5A0D A;  1X01 A;  4L5G A;  2M16 A;  4C8Q C;  1WJR A;  3X28 B;  4TVR A;  5GAM d;  2JVV A;  4M7A F;  3QKJ A;  3G7Z A;  2QA4 A;  2VGM A;  2RI3 A;  2L89 A;  3PIO A;  3J7A F;  3JCM J;  4OB3 B;  3LWH A;  3CC4 T;  5HKC A;  2EWN A;  3CC7 T;  1WJQ A;  2VXF A;  1XQH A;  4F7U E;  1OZ3 A;  1UEB A;  4P5N A;  4F7U F;  3G6E T;  2QEX T;  2ZZD A;  1M1G A;  1WNL A;  4M7D A;  3VYG A;  4RCC A;  2HAX A;  2LRQ A;  5C0M A;  5FU6 C;  1H3Z A;  2QQ9 A;  4YTL A;  1YJW A;  1VQM T;  1MGQ A;  2DXC A;  3EFR A;  4ZGD B;  4BE0 A;  3KBG A;  3X25 B;  5LJ3 e;  2X4W A;  4PKC C;  5GAM g;  1Y7X A;  3OYI A;  4MMK A;  4IUT A;  1MHN A;  4DOV A;  3G4S T;  3SWN A;  4N4H A;  2IVW A;  3SB2 A;  3A8H B;  4J5Y A;  1VQ4 A;  2P4T A;  5I2M A;  4BE1 A;  5LJ5 j;  3GIB A;  3CCQ A;  2PUO B;  2RHY A;  2VGN A;  4N0A C;  3OYF A;  3CCL T;  3OYC A;  2R57 A;  3NTI A;  3PMT A;  1O9S A;  2JTF A;  3HRU A;  4MDW A;  4LD6 A;  4M75 F;  4V2S A;  1QVG A;  1VQ8 A;  1V29 B;  4A4E A;  1B34 A;  1X75 C;  5GAO r;  1PSF A;  4FM4 B;  4M77 C;  5FU7 C;  3G71 T;  3UWN A;  2DXT A;  2O01 E;  2ZPI B;  3LGL A;  5A0L A;  3WVE B;  5CK9 A;  2VUB A;  4A4H A;  1UB4 A;  3ME9 A;  2F5K A;  2VC8 A;  2DXB A;  2LT4 A;  4JUV A;  5CKD A;  4QW2 A;  5CIU A;  3L2R A;  1K73 C;  3CMA T;  2D0Q B;  1KC8 U;  3MEA A;  4M78 D;  5GAO m;  3AHU A;  2EKO A;  3PMI A;  4M7D E;  4E7K A;  1FWZ A;  3JSC A;  5GAO q;  4M7D F;  3RMQ A;  2JNG A;  2MWO A;  2R58 A;  3JCM Q;  5D6X A;  2KY9 A;  3OYA A;  3UPU A;  1G3T A;  3E9G A;  3SFM A;  2RD1 A;  4E47 A;  2MAM A;  1Q81 C;  3ZBD A;  4XTV A;  3CME A;  2DEQ A;  3QZ9 B;  4R56 A;  4E7I A;  4N4G A;  3INZ A;  5KE2 A;  4HCZ A;  3GF5 A;  2WSC E;  3LYI A;  4LDX A;  4OP0 A;  3RKY A;  3JCM b;  1M1K U;  4HA8 A;  2PQW A;  1DJ7 B;  1YIT T;  3R6O A;  1BI3 A;  2EJF A;  2XID A;  4BDY A;  4C8Q B;  4C92 C;  4BDZ A;  4M7A D;  2DKG A;  3URG A;  1YIJ A;  2WSE E;  5CKF A;  2XD0 A;  3C94 A;  4RCB A;  3I55 T;  1RL2 A;  3FRN A;  3VUZ A;  1KC8 C;  2EQM A;  5CAI A;  4CRI A;  1BI1 A;  1VQ9 A;  2A3L A;  4OB0 B;  1YBY A;  2E70 A;  2DJZ A;  1Q7Y U;  4RMO A;  2RK2 A;  1D3B B;  1I4K 1;  4A4G A;  3TU4 K;  5GAN d;  1VQ5 A;  3CCS A;  4KBM B;  3MET A;  5KH6 A;  1O75 A;  1TH7 A;  1U1S A;  3H8Z A;  4C5E A;  5FU6 B;  3CD6 T;  1OZ2 A;  3M59 A;  2O4X A;  2DVE A;  2ZPB B;  4EMH A;  3OS0 A;  3OYB A;  4A4F A;  3PTA A;  1Y96 A;  3CXC A;  4XTX A;  2E5Q A;  4ME7 A;  4EMK C;  1U1T A;  3BDU A;  2K5I A;  1IZ6 A;  2RJE A;  5DM7 R;  3M5A A;  1VQM A;  4PJO D;  2EJG A;  2ZPH B;  3C12 A;  5HY6 A;  2PVO B;  4OGE A;  2PUK B;  3CC2 T;  3HSB A;  5GAN 6;  5GAN 3;  3FDR A;  5GAN g;  3RES A;  2BIV A;  3G4S A;  1G3Y A;  1UGP B;  5CQY A;  4M75 D;  2XU8 A;  2GQV A;  3CCV A;  3MP6 A;  2K57 A;  3OYN A;  3FEO A;  5GAO p;  4LDY A;  3L42 A;  4BB7 A;  4M77 B;  5FU7 B;  3JCM d;  3JB9 J;  3BDL A;  1JJ2 A;  4Z02 A;  3L2W A;  3BFM A;  3CBP A;  3LW5 E;  3DLM A;  3MP8 A;  3CCU T;  2LT1 A;  2EQJ A;  1KHI A;  2GFA A;  1S72 A;  1VQ6 T;  1YJ9 A;  2HQX A;  3QJ6 A;  5CKH A;  3G71 A;  1HXD A;  2E65 A;  4M78 E;  5GAN 7;  3OYG A;  3QBY A;  2K4Y A;  4OVA A;  5J3B A;  4C5H A;  1VQK T;  3O8V A;  1H64 1;  3I56 A;  4M7D D;  3CMA A;  4J7I A;  1KD1 U;  1VQL T;  3QHS A;  3CCM T;  4A4K A;  3PIP A;  3JCM P;  4NOY A;  3JCM g;  4PJO A;  2DXU A;  3QXE B;  5IAY A;  5CO7 A;  2RH2 A;  1N27 A;  2DAQ A;  1Y07 A;  5KE3 A;  3RKW A;  5CKB A;  2P0K A;  4QQ6 A;  1BIA A;  2RHU A;  4FU6 A;  4JRP A;  4C0F A;  3T9N A;  4LD9 K;  3CEY A;  2FYK A;  4C8Q G;  2EYQ A;  2CZ6 B;  2FB7 A;  3EAE A;  2CZ1 B;  5CVI A;  4QVC A;  1VQP T;  4ZTJ A;  3RER A;  4C8Q D;  3CPW S;  4JRQ A;  4M7A E;  3TEE A;  4XAX B;  4C92 B;  1XTD A;  2LQ8 A;  2X35 A;  3FLG A;  5GAN 5;  2I2L A;  2XKO C;  5D6W A;  5FRO A;  2E6Z A;  3CCR T;  1YCY A;  1YIT A;  4NL3 A;  5GAO n;  4RG2 A;  2B8A A;  2DTH A;  3V7S A;  3P8H A;  1NPP A;  4CI0 C;  1KQS A;  1KD1 C;  2EQU A;  3S3N A;  2Y90 A;  3ASK A;  3DLL A;  3HRT A;  2PVG B;  1YI2 T;  3A5Z B;  4PL6 A;  4JLG A;  3OS2 A;  3CCE T;  3P8D A;  2R5A A;  3VV0 A;  5GAO l;  5FLX E;  2EIF A;  3VU3 C;  4EMK B;  4PJO E;  1QP2 A;  3CD6 A;  4PJO F;  2XDD A;  3GNF B;  2LQK A;  2EAY A;  1G3S A;  1P92 A;  1IRE B;  2MWP A;  3HP9 A;  3MCA B;  4X9D A;  3OYE A;  4JRI A;  3OYD A;  3CCJ T;  4C8Q A;  4M75 E;  4BY6 C;  3OW2 A;  3OBY A;  2X4J A;  4XQ3 A;  3QII A;  5LJ3 d;  3J80 E;  3OYL A;  4M77 G;  4MZP A;  4FL6 A;  3X24 B;  4D6W A;  2L8D A;  2LTO A;  3V7R A;  2DIG A;  4M77 D;  5I2S A;  4QVZ A;  3A8G B;  4LDW A;  2OTJ T;  4O5V A;  4N4I A;  1YJN T;  1D3B A;  3HKS A;  1QVG S;  3L2Z A;  2EFI A;  1QVF A;  1OI1 A;  1VQO A;  3S3O A;  3DB3 A;  3OYM A;  4KUI A;  1HK9 A;  2M9U A;  3OS1 A;  2LX9 A;  3RIR A;  2RJC A;  5LJ3 g;  3PGG A;  4IUQ A;  2DO3 A;  4WF2 A;  1G5V A;  3E19 A;  4PNO A;  3S6W A;  3A8L B;  4C0G A;  5M9O A;  4IUR A;  1GXI E;  3M54 A;  2EQK A;  4N0A A;  3FIF A;  4OF1 A;  2QI2 A;  1N8R U;  2V8I A;  2NLU A;  4XTU A;  1VQ7 T;  1VQL A;  1ZQ1 A;  2K2V A;  2E10 A;  3JB9 G;  5FRM A;  2HBP A;  4C5I A;  5I21 A;  4C92 G;  5GAM h;  1K9M U;  4C8Q E;  4M77 A;  1I5L A;  2RO0 A;  2DK3 A;  3C95 A;  1LJO A;  4M78 C;  2X4Y A;  4C8Q F;  5GMK m;  2E6N A;  2DIQ A;  3J81 E;  4A53 A;  3M58 A;  4MML A;  1FX7 A;  2XHC A;  1VQP A;  5GAN 4;  4A54 A;  5KCH A;  1I8F A;  5LJ5 d;  3QUI A;  4IUU A;  1M1F A;  4Q5W A;  5GAM f;  2MI6 A;  1Q86 U;  3GPL A;  3CC4 A;  4DQ2 A;  4XU1 A;  1W2B A;  4XTZ A;  3CC7 A;  4JS5 A;  4E7H A;  2QA4 T;  2QEX A;  3G6E A;  3HHT B;  5DLO A;  3M4Y A;  3PNW C;  2RA2 A;  3QG1 A;  1NE8 A;  3M55 A;  3NTH A;  4M7A C;  1XNI A;  1VQN T;  2GF7 A;  2M0O A;  1M1K C;  1YI2 A;  3C4S A;  5LJ5 g;  2OTL A;  3CXC S;  1RI0 A;  5J39 A;  1K9M C;  4ZGJ B;  3SDZ A;  4B9X A;  3L1A A;  4C92 A;  3OYK A;  4LDV A;  2JZ2 A;  4BY6 B;  5IN1 A;  3TCJ A;  4J6W A;  4NS5 A;  1PSE A;  4L59 A;  2BUD A;  3OYY A;  4QQD A;  3NFC A;  4BI3 A;  3GP8 A;  4PLI A;  2K3X A;  2RHZ A;  4M77 E;  4XK8 E;  4BI8 B;  2XK0 A;  4M77 F;  5HK3 A;  5GAM j;  1VQ4 T;  3CCQ T;  1Q7Y C;  4HT8 A;  4C0Z A;  3QPH A;  1NJI U;  4ZN3 A;  2XIC A;  4ELZ C;  2E1H A;  2LCC A;  4PJO C;  4B9W A;  1Q82 U;  1VIE A;  3OBW A;  4BI4 A;  1JJ2 S;  2CZ0 B;  1XOV A;  3OMC A;  3V8K A;  3CPF A;  1VQ8 T;  3UT1 A;  3ER0 A;  5A2Q E;  1KG1 A;  2GCX A;  2DD4 A;  4EMK A;  4M75 C;  3S3M A;  2LNV A;  2KMT A;  5GAN 2;  2D9T A;  4KUL A;  5HK0 A;  2EJ9 A;  1M5Q 1;  3P8B B;  3GOX A;  3OSV A;  1VUB A;  5GMK h;  2KDS A;  1VIF A;  4L6V 5;  5LL6 S;  2LVM A;  4VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...