4DEYA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
319
structure length
281
Chain Sequence
b'EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1C
molecule tags Transport protein
source organism Oryctolagus cuniculus
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
total genus 94
structure length 281
sequence length 319
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4deyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4deyA02
1QHIA 2ZROA 3CIOA 4LBYA 2VHTA 1WBBA 4IDPA 4WZ6A 2PJRA 1F60A 1AKEA 1ZINA 2W58A 3B1YA 2YINC 1LY1A 3BFKA 2ZR9A 3N2IA 3LLUA 4FCVA 4GOKA 4Q4LA 5EXTA 1E94E 4NH0A 2IL1A 3VHXA 1W5SA 4EFMA 1VCNA 4HZUB 4Q1FA 4F14A 3TMKA 4TSFA 2DE0X 1CRQA 3OEED 1ESNA 3V4FA 4C30A 4UXJA 1FMLA 4URVR 2GF9A 2IYUA 4C0QC 5BN3A 1ZUYA 2XB2A 3B8HA 1HH4A 4I1UA 3Q3JB 1SKYE 1MV3A 2ZYWX 4AG1C 4PZLA 1Y3AA 2YWEA 5CLLA 5SZIA 1TEXA 2J6OA 3L0SA 3TKLA 1AGPA 1YWPA 4N3NA 1NY5A 1NLFA 2O8EB 1UBGA 3WNBA 3A98A 1FX0A 5B58C 2W6JA 3EIQA 3AUYA 4NYMQ 4YQFA 4KV9A 2ZSFA 4KYUA 2HDAA 2D2FA 2BZ8A 1C4OA 1G16A 4JBXA 5CM9C 5BYJA 5F9FA 2C0IA 1ZM4A 3AF0A 2YT6A 1DAHA 2J59A 1OF1A 1G8YA 2RMOA 1FNNA 1HT1E 1NVVR 1KNQA 2GESA 3VRYA 3IIMA 3R7WA 1GL7A 3IO5A 1BK2A 3ZDQA 1P61B 2ANCA 1KI7A 3B9PA 4BFTA 2XX3A 2BZYA 2C98A 3VR6A 3FOZA 3PITA 4BLOA 1ZNZA 2PBRA 4MGYR 2ZSAA 4X8LA 4B35A 3ADBA 2DX1A 1KO1A 4FN5A 1W4CA 3TAUA 5L3QA 4QNRA 4ZO4A 3EG1A 1XTKA 4YDSA 2A3RA 1S0UA 4UNPA 4O25A 1S3SA 1T6NA 3EC1A 4LE9A 5TB5A 2ZRKA 1G8HA 1G6HA 2KRMA 3WRYC 1N6RA 2ZYVX 1X3SA 2EYUA 1BO6A 4JJZA 3AH8A 1NG1A 4JL6A 2YC4C 1CXZA 2FSHA 3QI2A 1EWRA 1W70A 2A5FA 1NEBA 3IPYA 2L0AA 4MH0R 1R0XA 2ZJOA 2OM2A 4Z51A 2P2LA 3KX2A 3LAWA 5DYIA 1G3MA 2KJQA 3PIRA 3AVXA 2KXDA 4C2TA 2D7CA 2R62A 4LHVA 2F2WA 1KO7A 2IA5A 3GLIB 2UKDA 1V1CA 1DAFA 5DSZA 1S8FA 1OIVA 2V55B 3PUXA 3KJHA 4A63B 5GVRA 4AI6A 4CVNA 3W5IA 1ZC4A 1YZNA 1J70A 3FFBA 1DAIA 2Z43A 3T1OA 4B32A 1H8HA 3LX5A 3U3JA 3OAAA 2J7PA 3FGNA 4U00A 4MA4A 4N0EA 1GSIA 4TQ9A 1G20E 1W7AA 1T5LA 3EA0A 5C2JB 2IYSA 4BLPA 4B6EA 2O8FB 4JJCA 1X8LA 5JS8A 5CM8B 3AM1A 2H16A 2O0KA 1WXTA 2WJYA 5FI0B 1PRMC 3N2EA 2Q3FA 1BYIA 3GFPA 5J5CA 3T5DA 1M2OB 3A1VA 4WA7A 2VP4A 4NP6A 4OJKA 1LNZA 2IF0A 5L3SA 3VNVA 2O2OA 3W8RA 4KODA 1N25A 4LZZA 1NKTA 2XSZD 5JECA 4I99A 1Z9QA 3CQTA 5KTYA 3VR3A 5JJLA 1VKJA 3B85A 4ZDIA 2HUPA 1ZAKA 4QJ5A 4P0TA 4TSFD 5IK2A 3VRZA 3A4NA 1SVKA 5FUYA 1P2SA 5DIFA 3K9NA 5EJEA 5LD2C 4A2QA 2GXUA 2HXSA 2QAGB 2ZANA 4DIEA 1U5SA 3PCRB 5E3HA 4HSEA 3SJCA 4A15A 5FUWA 1QKXA 1ZU4A 4K8OA 2EW3A 4OHWA 2BBTA 2LWIA 5LDDC 2KEAA 1EXMA 1JJVA 4OBEA 1G17A 1IXZA 2R6CA 3B9QA 5IK2D 5EXXA 1ZJ6A 1J99A 3ZD7A 1HE8B 1KZ7B 1YCSB 4EIKA 2C03A 1WF3A 3B1VA 3SEMA 1TADA 3RC8A 1E1RD 2GJ8A 2ESWA 4L9SA 4FCWA 1MUZA 2F1IA 2F3RA 1NI3A 1AS2A 2V8OA 1YU9A 4RZ3A 3GJ7A 4MRNA 3HP1A 5FBWB 3U7EB 2LX7A 3QF7A 4TLBA 1N0WA 2GTJA 2OILA 1XTIA 3OESA 3SYKA 2ODBA 2GGRA 4J9EA 5IHNA 1MT0A 1KDTA 2YYZA 3C14C 3VS4A 2FZLA 421PA 2QU8A 4R98A 1G7TA 3O5ZA 2ASEA 4ARZA 1EFTA 5AUPB 3R7WB 1M30A 4PSAA 1FQKA 4JZ3A 4HLUC 3FMPB 2WJHA 2B7BA 2G6BA 3IPXA 2VTKA 1E98A 4NYMR 4HVUA 3GLGA 5CJPA 3K0SA 2RF0A 3TSWA 3I5XA 3R9XA 4FXPA 1GP2A 3U3OA 2W2TA 4GOXA 2IHBA 2RQRA 4HUTA 4XTRA 2NOAA 4JLDA 2FPFA 5FOSA 1W6XA 1E1QD 4OI2A 3SEAA 3PVQA 1RVDA 3LBIA 4A82A 2A28A 1NF3A 4EJSB 3K0CA 3WP1B 1K1ZA 2PMDA 3I8SA 4EKDA 2VP9A 1OFIA 2XJ4A 4AYXA 2HF8A 2EYZA 2JJ2D 1KK3A 2R2AA 1GM5A 1OYYA 4MUBA 2GBQA 4C9BA 5LB2A 1OXSC 2O8DB 1E2DA 3X1XA 2ZEJA 3QXXA 1M7HA 2FEMA 3TW8B 2ZRLA 1PRLC 3KL4A 2P4RA 4U7DA 5KPDA 1NLYA 2ZVQX 3VNUA 5DH9A 2GXQA 2QGNA 1B0UA 4RSGA 2FEIA 1DTSA 1E96A 2W2XA 2XTMA 4AY2A 3EHRA 3X1WA 2NIPA 1XJ0A 1BH2A 2QAGC 3B78A 3LQRA 3QKUA 4LJ5A 1CP2A 5HR5A 3THWA 2ZR7A 4LUEA 2L2PA 1E9RA 1CJUC 2FRYA 2XEXA 3Q5DA 4Q00A 5HTKA 1VMAA 3CR8A 2GK7A 2MIOA 2GNCA 4IKEA 4AG2C 1EG7A 3UA6A 1GZSA 1Q1EA 1R10A 1SZPA 5LB4A 3WMFA 1PV4A 4G5RA 5HCIA 1T8TA 2ANBA 4RTZA 3P26A 4EUNA 3KB1A 1AKYA 5GJCA 4MKGA 4DSTA 4DZZA 4JPBW 3PG5A 2VHQA 3BK7A 1Z28A 3UK6A 5CB8A 3KQKA 2DYBA 1E2LA 5J4KA 5B57C 2CT4A 2WWHA 2FPDA 4A0RA 4UNRA 2AZSA 1YZGA 1D9ZA 2OUKA 2PEYA 1MV0B 2WICA 1KSFX 4W5JA 4V0OA 5E95A 5JHHB 2IYLD 3EG5A 3H86A 2VA8A 1LV7A 3W8NA 4RY2A 1O87A 2L3SA 5EUMA 4DWJA 5EZ5A 1CBUA 2KBTA 1UHCA 3E1SA 5JMTA 4JT4A 1Y63A 2PH1A 3R20A 1RRPA 4RZ2A 4HAYA 1BKDR 3W6PA 2HBWA 1R5OA 3U3RA 5GVSA 3DOEA 3BOSA 2WSMA 4NPHA 4WIAA 4GPTA 2K6DA 3OEHD 5HZHA 1T0JA 4JS0A 3NGPA 4TL9A 3BD9A 1HJDA 1UKZA 4KLZA 2LQWA 1SGWA 4L5BA 1MO6A 2FFAA 3AKDA 3GEEA 3M1IA 4M1KA 2N42A 3NBXX 2I3BA 4FINA 4MGKR 3NPFA 2X19A 4TZ6A 1CR4A 5IXBA 1ZD1A 3M4YA 3MUFA 2BEJA 3AGQA 2ABLA 4AFZC 2JIZD 2QUZA 2ZYUX 1GBQA 1X2QA 1WMSA 2P6UA 1ONBA 3H4MA 3L43A 2XTZA 1NG2A 4LJ9A 1OXXK 4LY6A 4DCVA 4Q7MB 5IDVA 5L3RA 2RGAA 1WXBA 4LC1A 2GKSA 4DT1A 2EYXA 3QXHA 1KK2A 2W0SA 3LLMA 2J5XA 1RZ3A 4E22A 2J0UB 4NYJR 1AS0A 5C18A 3KUCA 3LFUA 4ACAA 2D2EA 3MG9A 1PVOA 1P75A 1XXHA 2ZJ5A 4NE2A 2BHRA 5CIWA 3BAFA 2O88A 3UANA 2QEQA 4XSGA 1UGVA 2GF0A 4DRZA 3Q9LA 1W5TA 3ZVNA 1WDXA 1XEXB 4B74A 1G21E 1A1VA 5K8TA 3TBKA 3C0CA 4A2WA 3ZZTA 4LJ7A 5GJBA 3THXB 3OIVA 2JGNA 1NLZA 4KVGA 2WJIA 2OXCA 2V1UA 4QXAA 4A0GA 1SVSA 1YP5A 1TUEA 1Q3TA 2HV8A 3KKOA 4Q4AB 5K8IA 4TL7A 3U44B 2J0QA 4GLMA 2XTNA 2REBA 3SJZA 4ZKEA 2WJVA 3OEHA 4L15A 3AVOA 5FR1A 4E09A 3CZQA 2NQ2C 1COWA 1FFHA 2ZJ8A 3DZ8A 1OLOA 1I07A 1VIAA 2CJWB 1FX0B 5JJIA 2SEMA 721PA 4ZDJA 1XEFA 2HYIC 2V7QA 2BKEA 3CLVA 1JNYA 4IEIA 1OW3B 2RHDA 5DYGA 2NO9A 2QG6A 2ZAOA 5KOYA 5DISB 1ZW6A 3Q7QA 4N0DA 1G83A 4ZIRA 1W2GA 1RPZA 3NKVA 2Z6VA 4OI1A 2KRSA 3RNLA 4OHVA 1XEWY 1MO4A 4Y0AA 3ETLA 5I22A 2V7QD 1V5WA 4IOJA 2RPNA 3S1AB 3M0TA 4C0KA 4NCJA 5GJWB 1UG1A 3VU9B 5K8UA 3RS2A 5KNBA 3R6NA 2DBMA 1VG9B 2G88A 2R9VA 2H8KA 3T06B 2CHQA 1Z0JA 4B3BA 2WAYA 3R9IA 1US8B 4KFTA 4FW9A 3QSYA 4JVMA 4OMLA 2FFHA 4AKHA 5JS7A 5KDDA 4OHZA 1NVUQ 5H8WA 4Q03A 2ZIAA 1P5ZB 4QJ4A 1UDLA 2DRKA 2Z5FA 3SJAA 3NIBA 5JEDA 3GJ8A 1YKSA 1DARA 2A7QA 3SDZA 1R0WA 2HJGA 2LCSA 1CJMA 4M9ZA 1KI2A 3K09A 4YDHB 1ZMXA 5KSZA 3VFDA 1JEGA 1M6NA 4BLSA 5EE0A 2WSSA 1AQUA 2JM9A 4B2PA 2FEOA 2CCKA 1SRLA 2YWGA 2EWWA 4M9XA 2ENMA 2O31A 3VR2A 3I5YA 1TUCA 2C96A 2KR3A 1M27C 121PA 4YLGA 4BEBA 3BJIC 3GLIA 4XWAA 5IHIA 5FWCA 3VHLB 2DB3A 3U6BA 3AUXA 1N6IA 4YXWA 4ITRC 1T0JB 3WP0A 4AK9A 5KNCA 3CH4B 2VF8A 3PR1A 4G3XA 3UWKA 5F9HA 2DILA 3U7GA 3NMZC 1QHGA 2F43A 3GQBA 4W7SA 1ZSGA 3EGUA 3NTUA 4MUAA 4GZMA 1W1WA 4DSNA 3CX6A 4F17A 2VHJA 1LW7A 4MKFA 3A4MA 1CIPA 4RUGA 2DL5A 2QL6A 3I4LA 3PVSA 1KJWA 5FOUA 1UHFA 4LYAA 5G53C 4LJ4A 3TQCA 1XJQA 1K4US 3I73A 1WXQA 3I1FA 4CC4B 3QEOA 3KQHA 5EE3A 1CR1A 4LC0A 5FR2A 3MWYW 4DT1B 2ZRAA 5AUNB 4KHZA 3T1VA 1T5IA 1Z2CA 2AN9A 3CNOA 3GD7A 4P32A 4TYYA 1MKYA 3EPLA 3SBEA 5CITA 3AKCA 1IQPA 1E4VA 3HPQA 4NYJQ 1NIJA 1ZC3A 1JPJA 2DL3A 2WPDA 3RSLA 1W49A 3PVLA 1UTIA 1GVNB 4AG6A 2DWPA 1E6CA 1BOFA 4TYWA 3KXIA 2PT7A 2FPMA 3THXA 2YVUA 2BOVA 3IIKA 2CLDX 1XZQA 3OFND 4NMMA 1ZCAA 1HUQA 2AZVA 1R4AA 5HCNA 1E9EA 4M1SA 1SXJC 5GJVB 1IN5A 3IHWA 3TW4A 2G1JA 2C77A 2RH5A 1GWNA 3DL0A 2P6RA 4LJ8A 4LK2A 2QBYA 1D2EA 2CXXA 2EYWA 4LV8B 1MRNA 4A8JB 4GP7A 1C9KA 2P3SA 3RRNA 3SHWA 2GRJA 3PENA 2CVHA 4OYHA 4QFMA 4OMPA 1W0JA 2CLCX 2OBNA 2FX3A 4B71A 4CC7A 4BPBA 3RS4A 4JJBA 2RQVA 1P3JA 2J87A 1JR3E 3G0HA 2ERXA 2PLRA 1EFRD 1UBEA 4H1VA 2IUUA 2IT1A 2ED0A 3GLHB 1UBCA 2EGAA 4BFVA 3UPUA 2AK2A 4II7A 3VU9A 3NEYA 2BV3A 3QXSA 2GEDA 1HTWA 3CONA 3IILA 3QG1A 1CEEA 1Q57A 3NBFA 1YNZA 2GAAA 5CYPA 1FTSA 2XNDD 3B2EA 2OLJA 1KI9A 1M3BA 2W2VA 4RJLA 1W47A 5DE3A 3WYFA 3ONWA 1F2UB 3I62A 1F3OA 4JSYA 4CZ2A 3ZIAD 1TUDA 1FL9A 1G5PA 1GKIA 2AXNA 3UF4A 3GJ3A 1TG0A 5SZJA 4D6PA 4WAUA 3RRYA 2ZSDA 1G3RA 3CF6R 3SQWA 4PPFA 3SU8A 1RI9A 1RYFA 4TMVA 2QAJA 1PUIA 1NVVQ 1GCQA 3GPLA 3B13B 3ND9A 3KXKA 3U4QB 1J7KA 1OPKA 1G1MA 3ZJYA 3EPJA 5JI2E 4PANA 3RAPR 2TMKA 3B82A 3H0IA 1XCGB 4PHHA 4B2LA 3R9WA 4ZNXA 3GCGA 3A1TA 3THWB 1OHHD 1W46A 2QMOA 3FKQA 1EFCA 2C95A 2GZHA 2EGEA 5FPHA 3BRWD 4LHYA 3QWXX 1E1RA 3I5RA 2ECKA 5DHAA 2IS4A 1G4AE 1YRAA 2CL7X 1WDTA 3O8BA 1FMKA 2QT1A 3CRW1 3A1UA 5CK5A 5F3WB 2AWNA 1DPFA 1GIAA 1P72A 4HLUA 3ZH9B 1NJFA 3QVUA 2I1QA 5CJ2A 3PJRA 4RTTA 1KYIA 2JCSA 2O0HA 3BERA 2FMXA 2GCNA 1COWD 1Y0MA 3B7GA 5C4GB 4O3MA 1JBKA 1NM7A 2J6FA 1RLPC 1EX6A 1LFDB 1OFHA 3I35A 1QHHA 1SVWA 2M51A 4JLOA 1NEGA 2V9PA 2ZI9A 4FMBB 4OJQA 4QHYA 5KSPA 2QMHA 4HCKA 1SEMA 3HDTA 5FUVA 2H1LA 4Q7LA 4MYCA 1XU4A 1OH5A 2EFGA 3QKTA 1LF5A 2VEDA 3THYB 1XRJA 2GZAA 1M7GA 1G4UR 4X1VA 4IDHA 1UBFA 2J9RA 3DPUA 3DVLA 2XZOA 3B6EA 2BCJQ 4HB3A 1CKEA 4UXHA 2ZSBA 3RS0A 1U0LA 2VP0A 3BGWA 2AX4A 4A6XA 5C4MA 1HY3A 1U81A 4TYNA 3QPUA 3CBQA 1VIYA 4XVQA 1CSKA 2C0OA 1E0KA 2NZJA 2DY1A 3LBHA 5FPYA 2QM7A 3ZVRA 1FOEB 3OF5A 4IFBA 1FPMA 3VKGA 2JDID 4LBWA 1LVGA 3AKYA 1U94A 1UFQA 3REBB 3RSOA 4D82A 3DEFA 2XXAA 1LCKA 3SQXA 2LKCA 4CDGA 3E70C 3E2IA 1ZD9A 1XTRA 3X1ZA 3NHNA 4EAQA 3K0CC 2F55A 2G77B 4QM6A 3K9GA 1NKSA 2JJ8A 2W00A 1Z63A 3LO5A 3TIFA 4RKEA 1KNXA 2LJ0A 2SHKA 2J0UA 4HAXA 2ZJAA 2R8RA 3L8ZA 4ZKDA 4Z8YA 3RVBA 6Q21A 1AWWA 3FDIA 3UG7A 1P9RA 1KAOA 2G0TA 2LZ6B 2GEVA 4PQRA 1E32A 4CEHA 2RGGA 3B60A 3T1QA 4FIDA 5AJXA 5TVKA 2O8BB 3LRPA 2QDLA 4UNNA 1CKBA 1S1CA 1KKMA 4BEJA 1LS1A 1CJKC 2NPFA 3AVVA 4H9GA 1RC8A 1G3UA 3LA6A 5DO9A 1TF7A 2VSXA 4NYIQ 2A37A 5D3QA 4Z8AA 1L4UA 2IEYA 1X2KA 3EIHA 3TH5A 3U44A 4LDJA 1I2DA 4L4UA 4Q4AA 2DJQA 4ZPXA 4IRUB 2A30A 2VLIA 3C5HA 1TQ2A 1GRIA 4L9WA 4A2PA 3ZZ0A 4C0HA 1WB9A 2KGTA 2C99A 4HDCA 2FG0A 5H70A 3PEVA 3SR0A 4Q18A 4DSUA 3MJHA 2ZU6A 1UJYA 1E9SA 2NPIA 3B5JA 4JKYA 1XMSA 2A5DA 5AJYA 2FPEA 5EC7A 3ZS9A 1Q0UA 1UDWA 3DHWC 1E2NA 3M0UA 1TQ6A 1H92A 2OBMA 2J46A 2QRZA 1JXOA 3D8BA 3Q72A 4G01B 4PAMA 1T8UA 2CE7A 1OIWA 4XVRA 3BIFA 4HLCA 4EQ6A 3RLFA 4PAQA 3PEUA 3WMEA 2OJ2A 1SPKA 5BN4A 2H17A 3NBYC 2O9SA 1DADA 1CU1A 4O2RA 5FFMA 1ZU5A 3ASZA 1OPXA 1E9BA 2LKDA 2WOJA 4R2HA 4TTPA 5AJWA 2BMDA 4RTUA 2Z4RA 3GLFE 2MMCA 3DKPA 1Z6TA 1NYFA 3K8YA 2XAUA 1P4SA 2YJTD 4JSTA 2OI3A 3SBDA 1KSJA 4B3GA 4PC3A 2I0NA 3B1XA 1AVZC 1U98A 2JJ1A 1M3CA 4B2IA 3V00A 1W0JD 4MRVA 1IOZA 4HVWA 1KK1A 4TMXA 1GL6A 4LV6A 4M1MA 1QHSA 5DLQC 2DLPA 1IY0A 1UPTA 1TPZA 1X86B 2CNWA 2FNAA 1KO5A 1Z0DA 4V0KA 4AC9A 1Q44A 1GKUB 3GP8A 1E0SA 1YR7A 4LYJA 2H8HA 5IXFA 2KROA 4QHTA 2MSEB 3LX8A 1WX6A 1U9IA 4PPQA 4XIGS 2ODEA 3GLFA 2ZR0A 4DJTA 4P33A 3P27A 3LH5A 1QHHB 1D9XA 2ZS8A 1Q22A 4LV5B 1UJ0A 1K5DA 4CGZA 5D3MA 3ASYA 4DLTA 2M0YA 2BTTA 3IHLA 2VF7A 4RCYA 5A4JA 4DLWA 4B43A 2RGEA 1W36B 3EWSA 4G5GA 1HEIA 4PHFA 1VHTA 1ZCBA 4M4ZA 1E79D 3E5HA 3QXCA 3M0SA 2VHUA 4HZUA 1JQQA 1OB5A 1UUEA 2A78A 2FE4A 3NEJA 3RS5A 4KSCA 3QKSA 4UNQA 4EFNA 5AUQA 1SHKA 4FMCF 1AIPA 5FTNA 2NG1A 1JR3A 1GRNA 3MWJA 4GOJA 3SYNA 3FHOA 4LCBA 1HT2E 3K70B 2OCPA 1S3GA 1II0A 2OXRA 1BYUA 5E7JA 3WYGA 1QF9A 1SHZA 1KDRA 1V43A 3BB1A 5JSZA 4OHXA 4B48A 4IHQA 3CWQA 2X77A 1BU1A 2KSQA 3UG6A 2O8EA 2DWOA 1AS3A 1W36D 1O3YA 4QGFA 2P0EA 1OFTA 2YOGA 3CF2A 3K0FB 5CK4A 4CEJA 2VIIA 2W6ID 2REXB 4OL0A 1IAQA 2AKKA 5AJVB 2RAPA 4AFSC 5AUOB 1K9AA 2ZS7A 1QBKC 2GQIA 2JA1A 3CB4A 3BBPA 4HLDA 4F7WA 3TUJC 1KSWA 4UXIA 5CDFE 4UJ3A 1XF9A 2ZJ2A 2WKQA 4JLVA 2JT4A 4HAWA 4P3YA 1OEBA 3U3MA 2WWYA 4ACBA 2MOXA 3QNUA 2ZI4A 5BWMA 1NRJB 1SKQA 1IN4A 2WZQA 1XMVA 1F5NA 3I5SA 4MYHA 5L3QB 2J41A 5FBRB 4I81A 1NSFA 2C78A 1OH7A 2ZAMA 3T61A 1RRGA 2PJZA 2F1HA 3SS8A 2J7PD 2J05A 4Z89A 2ERYA 3FJ5A 1E2GA 4ABYA 5KSOA 1IHUA 1Q1ZA 1ZIOA 4YMVA 1JEEA 4KJZA 4RCZA 4Q1AA 2G1KA 3L0OA 1H8KA 2ZM5A 1U8AA 2HJVA 4PSKA 4C7OB 1U8ZA 2FPKA 2OSBA 2XOKD 3BH7A 3DMNA 3T12A 2GHIA 2KYBA 1P2UA 4KITB 2F6RA 1GNQA 5TXGA 3EC2A 2A5JA 4A8JA 1T0HB 3O8CA 2NO1A 2REOA 1TUIA 1H8EA 3RYTC 4TMKA 3UMSA 1XXHE 2A2ZA 4RTVA 3EWAA 2FN4A 1IN7A 1HA3A 4MYTA 1P7CA 4BLTA 1KJZA 5JBQA 1I1JA 1ODFA 2YUQA 4OMQA 4EQ6B 2DR3A 2IYTA 4DUGA 2F3TA 5FBLB 4MDEA 2CL0X 2CH4W 5JRZA 2C0TA 1OHHA 2GXSA 3RBBB 1XEWX 2WSSD 3NHAA 2ZS9A 4WXPA 3W5JA 3HU2A 1I4DD 1J8YF 1X8KA 4AYWA 2PX3A 4KSBA 5L23A 1UADA 2ZI3A 4V0NA 1UKEA 2R6GA 3TAHA 1PLLA 1P2VA 1H65A 1Z0AA 3SE0A 3A4LA 2GTOA 4OMMA 1PZNA 2DCUA 2NO6A 2OLKA 2X2EA 4Q1DA 1I4TD 1U9IC 4NDZA 4AIIA 2UZ3A 2CHGA 3BH0A 4R2IA 1E3MA 3TVTA 1UE9A 1KI8A 2PZGA 4Q1EA 4MDFA 3AV0B 2PLFA 3NDBB 3AVUA 3AF3A 5J4HA 2K7AA 4J0QA 2YUPA 4LJYA 4B3XA 2ROTA 4GT1A 5P21A 3LQQA 2DHRA 2DWQA 1R5NA 2LP5A 3GJ6A 5TMPA 4S2EA 1NN1A 3M0EA 3K9HA 3HYRA 1U0HC 1RLQC 1G18A 1I2MA 4TZ0A 1M3AA 1G8FA 1A2KC 1YE8A 4F93B 4TT3A 3FHCB 1QHNA 2ZRNA 4O0MA 1W0KA 1G3IA 2ZRFA 3K70C 1U0JA 3D7MA 3QF4A 3QY0A 1YR9A 2BKUA 3GFOA 3CPJB 3TE6A 1W48A 2XGJA 4C2UA 2WBLC 2ZVPX 4OQMA 3QKSB 2DL4A 4NTZA 4QKQA 3A8TA 3F3YA 4BFXA 1U3OA 1EGAA 2KBEA 4PPGA 2CK3D 2V1XA 1M34E 5C46F 4BZQA 1OB2A 2WWWA 2DM1A 1MR3F 2RQTA 5DI3B 1D2MA 1RJ9B 1GL5A 3VS7A 4GSYA 5L8VA 4HXJA 1KO4A 1E2FA 2IYQA 4G5QA 3ND8A 1VECA 4J9BA 2RGCA 4Z88A 5IHPA 3A37A 4F4JA 3SJBA 1E2JA 2VPPA 1KK0A 1MABB 2CK3A 2R44A 2GK6A 2C8VA 4EPVA 5FBVB 1OKKA 2WTUA 4AFQC 1KMHB 2ZSEA 4GBQA 1DO0A 3IQXA 4V0MA 4UKDA 4IVRA 1RRCA 2OCYC 4D26A 2OE2A 1A2BA 2G3YA 1B23P 2FO0A 4DCSA 3TRFA 2J0VA 3ZS8A 2YWFA 1II9A 1G5RA 4GZLA 1W44A 2HLDA 2AFHE 1E2QA 5J47A 1XPOA 2KBFA 2DRMA 1E79A 3IKJA 1E9FA 4R7ZA 1FQJA 4B33A 2A08A 2JXBA 2ROLA 1YJ5A 4A92A 5JCZA 1YQTA 4RD3A 2IXFA 3SZRA 4BQSA 1AZTA 1Q3HA 2EKHA 1JECA 1A7JA 1HQCA 1Q21A 1R0YA 4JVLA 1X6VA 1DELA 2BDTA 2N46A 3GLGB 3QJYA 5FL7D 1A82A 4J9CA 1WA7A 1NVXQ 1Z08A 1ZM9A 2I4IA 2CSIA 2VP5A 4GMXA 5BQ5A 5UKDA 5TARA 2P6NA 4OK6A 3EZFA 2JIZA 1JU5C 3CWZA 1D2NA 2MMGA 4TQUS 4HATA 4W9MC 2BJVA 2CCGA 3X2SA 5J4VA 4OI0A 1SVLA 2A5GA 4BASA 2C04A 4DEYA 3BS4A 4QG7A 3MCAA 2VVKA 2ZRPA 4WZBE 2BCGY 4OK3A 2ZJZA 3G82C 2K2MA 1MOZA 2ZI5A 3DOFA 3HU3A 5KPJA 4GFDA 3IEVA 3I32A 4J9IA 2E87A 5BN5A 1Z06A 2X3XD 4HUQB 3C8UA 3FVQA 3HR7A 2ORVA 2ZQ5A 2ZITA 1AA9A 2YOHA 3JVVA 4KBGA 3TK1A 3GLIE 2ZRMA 3VR5A 2EVWX 2O8CA 2OFXA 4C4PA 2X2FA 2JTEA 1N6OA 3TQFA 2Y8EA 4X8OA 1QHXA 1AWOA 1GITA 3WRXC 4I4LA 2FJUA 3QXJA 1U06A 5FBQB 2B92A 3AGPA 2GTPA 4KCGA 4GP6A 1FMJA 3MWKA 2EQIA 4MITA 1Z0FA 2IHYA 4BZPA 4A36A 3FMFA 5LPNA 4RTYA 3K0EA 3MSXA 1GNPA 3EAQA 4QRHA 2GXAA 1GOTA 5DHFA 1KI6A 1E9DA 3GEIA 4WXRA 4Z1MA 1KIMA 4LUDA 1KFZA 2C9YA 4KLNA 1GRRA 1IN6A 3TNFA 4PPNA 5FOTA 4IEEA 1GFCA 3W6OA 4JLPA 3UMFA 5E7MA 1YVDA 2OBLA 2IC5A 4E6RA 4QC2A 2KE5A 3QPWA 1KDPA 1PLJA 1OXUA 4IXMA 1ANKA 3TSZA 4RZXA 1W1FA 4XOIA 4LJ6A 1UEJA 4LUCA 1E2MA 4M1YA 3U61B 2CEAA 5H68A 3L0IB 3HU1A 2EWVA 5CIQA 4TN1A 1XPUA 1HURA 1WQ1R 1YZLA 3DM5A 1JPNA 1R8QA 2J1LA 2P67A 4KU4A 3I61A 1K0SA 4D0GA 5TDHA 2DVJA 4B73A 3KZ1E 4PR0A 4P4SB 1KJYA 4TL6A 3SNHA 1SULA 4ASUD 4MKIA 3A36A 3ADKA 1W36C 3QF4B 2ZE8A 2RMKA 3MMPA 2IWRA 3T1TA 2VKNA 3Q7PA 3OHMA 1BBZA 2VYFA 3QIAA 2OO7A 4RTWA 4M8NE 1IM2A 1BIFA 1XD2A 2EVRA 2GDJA 1L8QA 1SQ5A 2O8FA 4RD4A 2HSPA 3LXRA 3CW2A 2YV5A 3BWDD 4QBGB 5EXSA 4FMDF 2CDNA 1N6KA 2J3EA 5SZKB 1E9CA 1TU3A 2BMJA 5G40A 3UIEA 3AVPA 3QE0A 4DIDA 4M0LA 5FW9A 3KTAB 1SXJD 1XPRA 3VAAA 5JHGB 4PO9A 4JVSB 1QG4A 1F2TB 5I11A 4KFUA 4EFLA 3H0HA 2VH5R 3VKWA 4DXAA 1JO8A 3QQ5A 5KDOA 1AZEA 2MSCB 1FUKA 4CW7A 4URYR 3EX7C 1NMXA 2GBLA 1ZLMA 1TNDA 4HB0A 1XMIA 4TLEA 5E4FA 5EP3A 3HYTA 1W0KD 5EZ6B 1ZYUA 3WNCA 4US2R 4NKRA 1T3SA 2JLZA 3IUYA 1ZUHA 3OAAD 1IN8A 2KXCA 2YNMA 1XBTA 2EU8A 4Q4HA 1PNJA 2K79A 3M0QA 2JLQA 4ZI2A 3CRVA 4XJXA 3DM9B 4I1VA 1E0JA 1HSQA 2QROA 1T3LA 1GKYA 3OIWA 3AF4A 4JMPA 5LD2B 4YMWA 1MO3A 3RC3A 1ZM3A 3LW8A 2KYMA 5EE9A 4Q48A 2NWMA 5KSYA 1Z47A 1X43A 4LOAA 3U23A 4NZYA 3X1DA 1M1YE 1JQLB 3NG1A 3O47A 4Q02A 2B7CA 4DDVA 3PFIA 4IVPA 1I4LD 1J2JA 4WOPA 2UVQA 3VMFA 4IFEA 2D8HA 2LJ3A 3F8TA 2XB4A 2ONKA 4AKGA 1E2KA 1H8HD 4JKIA 3TLXA 1ZM2A 3EG0A 1QVAA 2K3BA 1LF0A 2NGRA 1YZTA 3ZQ6A 1HD3A 3THKA 4NCKA 2L3QA 2KB0A 4M1WA 4LSGA 4QBIA 4DCNA 3OE7D 5JFGA 3FMIA 1KMQA 1PKSA 1RW4A 2OG2A 2WKRA 2EBPA 2ZJYA 3AVYA 3PXGA 2PZEA 2KI5A 4WCIA 4TT3D 2O8CB 1K0XA 3SYLA 1DAGA 2WM9B 1QVRA 2XSZA 4RZUA 2VHCA 2WHXA 1NN5A 1US8A 4CEIB 2EFEB 2YDLA 3AF2A 4YXWD 3GLGE 1AZSC 2HT1A 2XNSA 1ZBDA 5EUQB 4JYBA 2IX3A 3AVWA 1QKWA 4BE7B 5FTJA 2JM8A 2DFLA 4TYPA 1X1SA 4NYIR 4ZCIA 1NYGA 3FB4A 3TGPA 3QVVA 5DN6D 1KI6B 3ZLJA 4LPKA 4KFRA 1L2TA 5JI3E 2OHFA 3A6PC 5CB6A 3U6KA 4D2IA 3BE4A 2QZ4A 1OJLA 1M74A 4MGZR 4DDUA 1NG9A 2IXEA 4C7OA 1KTVA 3QUSA 4EJSC 2CL6X 1FP7A 5B2ZA 3K09C 5TV2A 1XTJA 1AWXA 1PJRA 4Q9HA 1P60A 4XSHA 2ZUCA 2G9NA 2F9MA 1HQYE 1XCMA 1ZNYA 1KDOA 3IQWA 2FFQA 2RQWA 5G3ZA 1F6BA 2OCAA 2GILA 4LI0A 4DLVA 4DUGD 5IF9A 3X1YA 1KAGA 1P9NA 4US1R 3EZ2A 4M53A 3ZIAA 3IGFA 2J06A 4A4DA 4PX9A 1VYUA 4F91B 2XNDA 2RGNC 1JI0A 5BW8A 4Y92A 5ECAA 2QAGA 3OZXA 4HB2A 4HB4A 5CYOA 3I72A 4OKSA 4A8JC 3WHKA 1SHGA 3CO5A 2YWHA 5HCKA 1YWOA 1YR6A 4D4JA 2YUOA 2D0NA 4RD2A 5J40A 3ADDA 1EX7A 1CULC 2QTVB 2V6IA 1X27A 1SXJB 4TL8A 4D8KA 5JWHA 2IS2A 4K81B 4PHGA 1E1QA 4M1OA 1ELOA 1F2TA 4NCIA 1KSHA 2JLRA 5SZHB 1RFLA 1CF4A 2QM8A 1W4AA 3C7KA 1GDDA 2ZRBA 1Z6GA 3MWLA 3LY5A 1G41A 3A58B 3IBYA 3RANA 4AWXA 1KY3A 4D25A 1NBMD 2RGNA 3NXSA 2ZE6A 3JZMA 2PCLA 1XMJA 2IYWA 1TAGA 3K0AA 2O5VA 2BM0A 4L16A 4B75A 1OPLA 5G3YA 4E07A 4EIWA 4LYFA 3TSOA 2PZFA 4IOMA 2HEQA 3W3ZB 1OXVA 4JLNA 4LBZA 2PCJA 5JLJA 1A0NB 5H1YA 4IOLA 2DL8A 2FRWA 2EW1A 4E03A 5JZVA 2ZUBA 3B1ZA 4HLQB 3SFVA 3ZZUA 4D4MA 4US0R 4JLMA 1Z22A 2A9KA 1AZGB 3AF1A 4C0SA 1AEYA 1AGRA 4QGGA 3REGA 4J9HA 2Q3MA 3NH9A 3QWYA 4EJSA 2HCBA 2GAOA 2RCNA 2VRWA 4NBSA 3WBKA 2QY9A 4PC2A 5FPKA 1UDXA 1X8JA 1YZQA 1B3QA 3GJ4A 3W3AA 2GJKA 2G6FX 3SN6A 5KYKA 1AK2A 2X1VA 4I1SA 2JW4A 1XXHB 2HEIA 3DKVA 221PA 3JV3A 1NMZA 2IUSA 3MAAC 4PQYA 4J9FA 4K11A 2CCJA 2WKPA 4GI7A 2O9VA 2FA9A 2ZTSA 4M9QA 2ZJBA 2I1VB 1LS6A 1WP9A 4OQNA 4URZR 5AR1A 4FMCB 4PHTA 4JYCA 4WBSA 4ZCMA 1VG0B 1E4YA 3RHFA 2EFCB 1ZNXA 2QPAA 4JLKA 1UKVY 3IEUA 1XJCA 3I9QA 2IYRA 3W34A 3C15C 2CUDA 1OYWA 2RGXA 2OAWA 3F5FA 3P4YA 4PC6A 4TMZA 3RWMB 2ZXUA 3H41A 2BC9A 3QEJA 4J9GA 2AKAB 2CSQA 3CRRA 4DCUA 1R6BX 3T5GA 2H7VA 4Q47A 2A5YB 1IBRA 1P62B 2ODNA 3CRMA 2RN8A 1UJ2A 4M22A 4JZ4A 1XX6A 5HKKA 4PTLA 1XNJA 4HEJA 2H18A 3HWSA 5L3VA 5CLQA 3VR4A 3W90A 1E0AA 1VG8A 4BWYA 2OEPA 1FNMA 2OAP1 4ZIRB 3O8RA 2ORIA 5EQTA 5FTKA 2CMKA 3K9LA 2CH4A 1R8SA 1IONA 1LTQA 3C5CA 4Z8XA 4ZV4A 4CF7A 1G2BA 1NNEA 1R7RA 2WWIA 3EARA 1GUAA 3P1JA 3S1AA 2CREA 1XFAA 2WWGA 3NHBA 3OIUA 2FGJA 2GCOA 5E7IA 2D06A 4ERNA 2L3PA 2Q21A 1DO2A 3KFVA 4HDOB 4Q9JA 1DG3A 4BFYA 2R6DA 2YHSA 4TQAA 1XOVA 4BUJA 1Z2AA 2DNUA 1Z83A 1SSHA 1GAJA 2HDNB 1NBME 4RD1A 2QI9C 2VBCA 5IHKA 4PQFA 1OH6A 2JLUA 2EGCA 4LX0A 2Z83A 4DB4A 1QDEA 3TR0A 1UAAA 1PLKA 4K46A 4DKXA 3H0KA 2CVFA 2QQ0A 4CYMA 4MRRA 1EFRA 2D7DA 2JAQA 2QNRA 4TWZA 2BIFA 4L8GA 3V9PA 1P6XA 2K9GA 3QBTA 2B8WA 1QLYA 2QMUA 2RKOA 3KKNA 4Q1CA 4DDTA 5KHOC 1N5IA 1SXJA 1VA7A 4CIDA 3GFTA 1AN0A 2W6JD 4R0KA 1VHLA 2CBZA 3EPHA 1MH1A 4EPWA 5L3SB 1OKKD 5HKKD 1JR6A 1NBMA 1Z8FA 5A0FA 3UXMA 4DCTA 4ZDKA 3THYA 1W2HA 521PA 3TUIC 2CHVA 4KVAA 2E5KA 1CR2A 3FE2A 1QCFA 3HR8A 1S4QA 3VX4A 2AHOA 2RGBA 1TEVA 1M8PA 4NHOA 2BWJA 1BMFD 4P4SA 3LD9A 4Y0VA 4YONB 1ZP6A 4NONA 3K0AB 3LNCA 4DC9A 3RABA 1JAHA 2WV9A 4Z54A 2ORWA 4G5OA 2AR7A 2YKGA 4RFSB 1N0VC 2FF7A 1Z3IX 2PX0A 3K53A 4RD6A 1NY6A 1NJGA 1RIFA 2W83A 1ESMA 4BRUA 2H92A 3QBVA 3GJ5A 1CKAA 4TTQA 1VPLA 1VTKA 1GRQA 4EPYA 1RE0A 4IIMA 3W9YA 2G83A 2JATA 3KTAA 2IYXA 2V3CC 3F0TA 2WMOB 1E6GA 4DDWA 3V4RA 1T3HA 3NC0C 4D8DA 3GLHE 4B3DA 2VP2A 4J9DA 4URUR 4M4SA 3RDPA 4JL5A 4R9UC 5KU1A 3MFYA 3EHQA 4C0LA 1BB9A 4XWKA 2YC2C 1GILA 2YUNA 4DHEA 1BS1A 2KRNA 1JJ7A 2H5EA 4W5WA 2XMFA 1Z29A 1F48A 1Z0KA 3KB2A 3L82B 4XH9B 1YR8A 2FWRA 1ARKA 1Z9ZA 3DZDA 3AEZA 2ZYTX 1IJFA 1OV4A 1T91A 3T35A 2V1RA 3NWJA 2AKLA 3H2YA 1E6HA 1X6GA 4IJMA 2AD1A 1Z6YA 3VS6A 1EWQA 4MRSA 2X8AA 1UECA 2PZ1A 1KI3A 2JEOA 1NSTA 3FKSA 2FDCA 4HVVA 1NVWQ 2BBOA 1K6MA 4TLDA 2ZETA 2GJSA 4HYYA 1ZVQA 1NN3A 2FZ4A 4Q01A 2MSDB 2VSFA 1ZNWA 4LGMA 4RD0A 3QPVA 1C1YA 3THOA 4A0FA 3ULRB 2DA9A 2L0XA 1JXMA 4Q9LA 1FTNA 3L8YA 2ZRDA 1XD9A 5M04A 4FSSA 1E9AA 3M0PA 4Q7JB 4AYTA 4BFWA 3H0FA 5FPSA 5HZKA 1SVIA 5K8LA 2ZI7A 3J81k 3VQTA 1W4RA 4ZI3A 1N5LA 4QGAA 2O0JA 4PXAA 3FHTA 4GMDA 4XTCS 1XD8A 2GCOB 2QT0A 2WWXA 2GEUA 3QKRB 1ZBJA 3CR7A 2QP4A 4CEIA 5EP2A 2QP3A 4B3FX 3U2QA 1SXJE 1N6NA 1R0ZA 3LVRE 3PEYA 1HV8A 1XCPA 1S96A 2ZE5A 3C41J 3BC1A 4JJKA 1XDBA 3WHLA 4UJ5A 1G19A 4GDFA 1SHFA 3U7FB 1IY2A 2GETA 2QORA 1D5CA 2DFTA 2B21A 4P4UA 1PKTA 2W0MA 4KFSA 4AG5A 2ZREA 1KI1A 3C4JA 4PC7A 4QBHA 1G64A 1ZUUA 2GBLC 5HPYB 2HT6A 2ATVA 2W6IA 3PE0A 1DVRA 3GBQA 2WVJA 2D3WA 1OE0A 4Q21A 2WAXA 2SRCA 3ECCA 2WWFA 4HAUA 1K8RA 1TQ4A 3PUVA 1ABQA 2V4ZA 4FMDB 2FV8A 3T15A 1KKLA 2CT3A 1R2QA 4G0NA 5B64A 1BMFA 3GJXC 1MO5A 3K70D 1U99A 3GMTA 3CH5A 3ZQJA 1YHNA 4Q4JA 4YMTA 1G8GA 3ZVLA 1N5KA 3ICEA 1WFWA 1PUJA 1N0UA 1NLOC 1OFUX 2AXPA 1JR3D 4QHSA 1S2MA 3MRSA 2DBYA 2F9LA 4DLRA 4F4CA 2NUZA 2F2XA 1VYVA 4XWOA 1Z0IA 4RFSA 1P2TA 2ATXA 1XB2A 1YZUA 4G1UC 821PA 5GJWC 4OHYA 3AP1A 3ZGXA 2R65A 4ESHA 4M21A 1NP6A 2EQBA 2BZXA 1G6OA 1S1MA 1X1RA 4FCTA 3PQCA 4GRAA 4URWR 2NO0A 3EXAA 3QG5A 2HCJB 4U02A 5ANRB 2WOOA 3VR1A 4B6FA 4QM7A 2F7SA 2PMKA 4IDNA 4AD8A 2QE7D 2KWIA 2RQUA 4BRWA 2IK8A 4X8MA 5LBIA 2QBYB 4XD7D 4C0BA 2BEKA 2IYZA 3KDSE 2B86A 4QGHA 2FU5C 4PO1A 5EP1A 1XTQA 1S9DA 1UFFA 1J90A 1VG1A 3EASA 4POAA 1CRPA 4UQOA 3VS2A 3VS1A 4B34A 3JZAA 1CJVC 1G291 3GJ0A 4JLAA 2GNOA 2JLWA 2X3WD 1ZUIA 4MGIR 4QBFA 2XJ9A 1XEXA 4O2LA 4OMOA 1UM8A 4HAZA 2GZDA 3NH6A 1DG1G 4DVGA 3TJZA 4AKIA 1VCMA 2ODWA 4E5UA 3VKHA 1S9HA 1E2EA 5KUTA 3RRZA 1KZGB 5J4YA 5EE1A 2XXAB 2GA8A 3IQLA 2F2VA 4D4LA 2Z4SA 1F2UA 3W6NA 3BORA 3PUYA 2BBSA 5ELXA 1Q1QA 3GEHA 1Z6AA 3TR5A 2C2HA 3U60B 2CJWA 3VS5A 4CC3A 5DN6A 2DFNA 4KO8A 5G41A 4DLYA 4V0ME 1H8ED 1SKYB 2JLSA 3BFXA 3U3KA 4Z1MD 2BM1A 621PA 4TYQA 5JEEA 2Q9AA 4FD2A 1Q20A 2AL7A 4PFSA 1L7VC 1E2HA 1PWTA 2J7KA 2K5UA 3EG2A 5DGXA 1IXRC 4JZKA 3I92A 3BH6A 4CEHB 2O8BA 1ETUA 1N6LA 3M6AA 4TMWA 2FSGA 4QNMA 2XOKA 2Q0HA 4QJ3A 3EPKA 1E2PA 3WMGA 3N70A 1DS6A 1U90A 4DLZA 2JJ2A 3SFZA 4TTRA 3QKRA 4JIMA 3Q5EA 4KYIB 4TLCA 2NMVA 2J45A 1OT3A 1ABOA 1TX4B 1N6PA 4JLJA 5FPTA 2KT1A 2FFBA 2IUTA 3RWOA 3M0RA 1WIEA 1DOAA 4KXFB 1GFDA 1XTSA 2ZE7A 1WXUA 3OIYA 1E99A 5AJZA 4YMUA 3MGCA 2HCKA 1VYTA 1OOTA 4JLBA 2JS0A 2KNBB 4U5XA 2LJ1A 2PNIA 1KIKA 2NZ8A 3FFAA 3I3SR 5EXPA 5FWBA 2J6KA 1QG2A 2IW3A 5AK0A 3I8XA 3OFNA 3FKSD 3P32A 3PV0A 5FTMA 5FOVA 5EP4A 5FTLA 2XZLA 4DBLC 2JLVA 3L0PA 3FTQA 1QWEA 4LPSA 2W10A 1TU4A 1YZKA 4IXNA 4A0HA 1EFNA 2P5SA 2IYYA 1WCV1 2DFKB 1KHTA 2IEZA 2LQNA 1GTVA 3CM0A 3VS3A 2UZIR 3DO6A 2DL7A 2RB4A 4IOKA 1JEDA 4MKHA 3MJRA 5DI3A 2VWFA 3LVQE 4D4KA 3FPAA 2ZRGA 2QMEA 2F43B 3LW7A 3KKPA 1FYNA 4N1AA 2DMOA 4H1UA 2QENA 1RYHA 4TMTA 3WXMA 1G3QA 2QE7A 5F98A 5KO2A 1X6BA 2B8TA 1L4YA 5JWRA 2E1RA 4DB2A 2QGZA 1K5GA 4C0JA 2OZEA 4BGDA 2ZRIA 4D0LB 3Q8XB 1U2RA 1ZD8A 2VL7A 5D3MB 3T34A 5FOWA 2OCBA 3NDPA 1DBSA 5BYKA 1II8B 3CKLA 2JS2A 2ECZA 3LV8A 1ZIPA 2XITA 2PL3A 2YOFA 3L2OB 4HDQB 1FZQA 3R8CA 3REAB 3LBNA 1RKBA 1XWIA 1G7CA 4LWZA 2JJ1D 4V03A 2EYYA 4RTXA 4R71A 4G5SA 2N1BA 3UWOA 1GL9B 1NMYA 4ILEA 3EZ6A 1SRMA 2VSOA 4LNPA 1WE2A 2C9CA 4FWIB 3NVAA 1ZX6A 2A36A 4OQFA 5IT5A 3DDCA 1FP6A 4HZIA 4P31A 5FL7A 2CNWD 4LN2A 4OQXA 4XD7A 4JBYA 2ONJA 1EK0A 4IVQA 3U5ZB 1FW6A 2DPXA 2GVZC 4CT5A 4OMNA 4GL2A 1N6HA 1U8YA 3SC3A 4DLUA 3NC1C 3EG3A 4V0LA 1IY1A 1KI4A 1QRAA 4KRTA 3ZD6A 4IIOA 2GWHA 1T4GA 2E9SA 5CDFA 4QL3A 2AKYA 3CUEF 4BFSA 2F1RA 4D80A 3ZVMA 3K0FA 3RRMA 4EPXA 2ZRHA 3A1WA 2EFDB 3KJIA 1AM4D 2QP9X 3CNNA 4ZDWA 4F38A 2AFIE 2ZRCA 2Q3HA 2KT8A 2ZU0C 3AP2A 4LBVA 4M2LA 4BLRA 3WBJA 2CUBA 2R6AA 2H57A 3WYAA 5B30A 1IO6A 4Q1BA 2OFWA 5FH9A 3LDAA 1YRBA 4NCNA 2HYDA 3DMDA 2OAQ1 3P20A 5JJKA 1WI7A 3KUDA 4LRWA 4DLXA 2DF6A 4A6PA 3RNJA 1CTQA 2V1QA 1X69A 4Q5IA 4C0AC 1N2CE 3GLHA 2GJ9A 3FMOB 2V6JA 1QWFA 2CE2X 1I0CA 4DEXA 2WJGA 1QZXA 2EYQA 1CLUA 2P5TB 4OK5A 1TTTA 3EIEA 2QN6A 2OESA 2WIAA 3BB3A 3KXLA 3KJEA 2C9OA 1TQDA 1W4BA 3FWYA 3CX7A 2HF9A 1JAIA 4S35A 3HJNA 4IW3B 4Q7KA 1CS4C 3EA5A 2G0NA 1G7RA 4LHZA 4JBWA 1KOFA 3KQUA 3KQNA 1ZUKA 2FH5B 2IBMA 2CDTA 4B44A 1OIXA 2DBKA 1Z5ZA 4CC2A 3MLEA 4PZZA 4XVUA 2EPDA 1AJEA 1B07A 2IXGA 4Q9IA 1E69A 2QSZA 3N5CA 3Q85A 1R5BA 1N3BA 3IBGA 1T0HA 3P4XA 3CPEA 5DI9A 2O52A 1H3HA 3KFXA 4JT2A 3A1SA 2GJAA 2OV2A 5EE5B 1JB1A 5FOXA 3EZ9A 1M7BA 3OE7A 3AVQA 1DAMA 1G9XA 1CR0A 1WRBA 3EW9A 2QTHA 4EDHA 4FWTA 2Z0MA 4ORZA 3U4QA 1XZPA 4TLAA 1A5TA 2ZUDA 4RKFA 2Q9BA 4Q19A 1LB1B 2Q9CA 3AB3A 4KBFA 3H84A 3BXZA 4ESRA 2JASA 4QOSA 4UNSA 2WJJA 4Q9KA 4D0NA 1WBDA 4BZXA 3CRQA 4AKEA 3U7HB 2ZPTX 5J4LA 1XD2B 3SI7A 4GBMA 2QTFA 4WW0A 4B76A 5F2EA 3CX8A 3BB4A 1KGDA 1Q12A 3BFVA 2D1XA 3TVDA 2NTYC 3AP3A 2FPLA 4B47A 5JSZB 2D74A 3MD0A 2ZRJA 4EPTA 4PC1A 4FI3C 3KKQA 5KNDA 4Q66C 1Z6XA 1EESA 2MCNA 3HPRA 2BJWA 4NU0A 2LMJA 2XZPA 2GVDC 2B6HA 4CEJB 3CZPA 3WY9A 4F92B 3H1TA 4JVNA 3ICQB 1II8A 1AOJA 2ZI6A 2FSIA 4BLQA 4ARZB 2QA5A 1P73A 5JWOA 2WIBA 2JMCA 4WVFA 2BVNA 2JDIA 3O8DA 4URXR 3B1WA 4Q4JB 3REFA 3PUZA 4Q4HB 3WNDA 3CF0A 4HI0E 2C5LA 2PT5A 3KKMA 4PAOA 5IRCD 4YC7A 3KQLA 4MYUA 2QRNA 1NL3A 1ZM7A 5DNYB 2IS1A 1ZRHA 2V54A 1RJ9A 1GFIA 1VDZA 3UATA 1OXTA 3OEEA 1IXSB 1J3TA 1EFHA 2CLSA 2F1JA 4OI4A 4OQLA 1WYXA 5IH2A 3G5UA 4AFUC 3PEWA 4F16A 4HAVA 1GCQC 1QHYA 1J8MF 1KMHA 3IDQA 3QOFA 2EFHB 3RS7A 3CNLA 1UF9A 1OH8A 1WLPB 1XP8A 4IDQA 2D8JA 3LXXA 5JCPA 2O8DA 4PO8A 4ASUA 1MRSA 2J0SA 3ADCA 5HE8A 5FL3A 1G7SA 1NIPA 2QPTA 5FUXA 2QPOA 2KE9A 5AWFC 5A5GA 1MV5A 2OFOA 1PHTA 3AQ4A 1Y57A 3NBZC 1UKYA 2QSYA 2WPDD 4JJDA 4X8HA 1AD5A 4NL4H 1FUUA 8OHMA 4BECA 5JRJA 2NO7A 4B3CA 1T9HA 3EZ7A 4MRPA 1GCPA 3CPHA 2YZ2A 4M1TA 1E2IA 3C16C 3R8FA 1JQJC 4F4IA 2IS6A 2IWHA 2YSQA 2WMNB 3KJGA 1OV3A 1Z07A 4MQBA 3ZL7C 3VS0A 2IYVA 1AQYA 4RVCA 2VQSA 4GNKA 5TY0A 4W5HA 4PZYA 1SVOA 4A9AA 1DAEA 3FYHA 4ON9A 3UKDA 5GADl 1S1NA 5KDLA 1TMKA 4M9SA 1WA5A 4LHWA 1IJEA 1AWJA 1VCOA 1P9WA 4CRWB 3PUWA 2IF2A 3D6TB 3AVTA 1D6JA 4JL8A 3D31A 1GG2A 4LHXA 4EPRA 5BXQC 1DAKA 2RGDA 1KSGA 1VCIA 4IDOA 2R6FA 2ED1A 1HYQA 2GCPA 3D3QA 3RS3A 2AK3A 3K1JA 4I1OA 4CT4B 1NN0A 2FOLA 2VP6A 4HUQA 1N5JA 1G5TA 5HE9A 2BMEA 3ZYCA 3IO3A 1D8TA 1OSNA 3VTKA 2AD5A 2BMFA 3VX3A 1RRFA 2FSFA 4V02A 5GJVC 1ZUNB 3TUZC 1TL7C 2JLYA 1GBRA 1CJTC 2P65A 4BFUA 2FG5A 1NLPC 1N5ZA 1JALA 4DSOA 3SHFA 1HE1C 2OT3B 1E7OA 2AWOA 5C1BA 2LCFA 1SVMA 2BBWA 2HLDD 4AURA 2J7IA 3IIJA 2JMAA 3SOPA 4LYHA 3QENA 1G8PA 4RFVA 1UEIA 2LNHB 1KY2A 3AKEA 1TF2A 1M8MA 4KAXA 3UA7A 2AK5A 4NCHA 2IIMA 4DLSA 2D62A 2DYKA 2RHMA 4A1FA 4P4TA 2VO1A 2Q6TA 4WZAE 1YN8A 2PEZA 2FGKA 5FI1B 1A4RA 1Q1BA 4D81A 1K76A 1TF5A 3LWNA 1DEKA 4ZCLA 2W0ZA 4C3ZA 4BFZA 1EFUA 4LJAA 4QT7A 1MABA 2D4HA 4KI0A 1DE0A 2QQEA 4PSVA 2PTKA 2JLXA 2HXYA 1RUWA 3GLFB 4YMSA 1GNRA 3JVUA 2RNAA 3UMRA 4ESVA 1KO8A
chains in the Genus database with same CATH superfamily
3CIOA 2EZTA 4LBYA 1XK7A 3STUA 4RTKA 4IDPA 4WZ6A 3K72B 1F60A 2MPXC 4U7TB 4PLWA 3GXOA 1ZINA 1A4UA 3NOOA 2YWDA 4FCVA 4PGMA 3P9CA 4Q4LA 4ZALA 1CVLA 3OU7A 3WK9A 3D6NB 4GM4A 4O4JB 5AXBA 2VF5X 4FC6A 4W9NC 1N2EA 2AC7A 1LZKA 3EF1A 5AK6A 1ZS9A 3LTNC 1U7OA 3MGAA 3P9PA 3FOCA 5KYGA 3A05A 1W4LA 4C30A 3QITA 1VMKA 1YBMA 4DMMA 3FR8A 1FMLA 4XAXB 1PYOA 2FWBA 2IYUA 2XYVA 4IVNA 3BE8A 4URVR 5BN3A 4AP9A 4J5YA 3B8HA 3TBFA 2VHXA 1HG0A 2WG0A 4IICA 4ZVPA 2XHCA 1MC1A 2HO5A 4EG3A 1MEJA 1MV3A 4OVAA 2G71A 2ZYWX 1Y3AA 4JLIA 2RHIA 4WKNA 2FL7A 2J6OA 3EXG2 4ZOLA 2OG1A 2BP7B 3E7DA 4L7QA 1NLFA 2XWBF 3HKCB 4ZN3A 1JJBA 3LL4A 3N5KA 1FE8A 2FVXA 3WGIA 4QUKA 4O6JA 1O77A 2W6JA 3AUYA 3EIQA 4YQFA 5JAHA 1G1AA 2JHGA 3U7QB 2XUZA 2D2FA 2BZ8A 1E5QA 1G16A 1CUDA 3JRXA 1YE5A 4JBXA 4HJRA 5BYJA 3UJCA 4B87A 5BVHB 5BOSB 5F9FA 1POWA 5ERGB 2YT6A 3W7VA 2J59A 2Q1YA 3HCRA 3OCWA 1MAAA 3DBLA 2XKAA 4OMCA 4P81A 2A1IA 3VRYA 2PMCA 2C4WA 3SG0A 2UXDB 3ZDQA 3RAFC 1Z4LA 2GUWA 2ZWOA 3UFBA 2ZLBA 3IP6A 2IUEA 3WA6A 4NQRA 5HWSA 2IDKA 2C98A 3HEMA 5EAIA 3VR6A 4C0DB 2EJ9A 1P3Y1 1XLVA 3FOZA 3S8MA 1KVUA 2ZSAA 3V3TA 4X8LA 4PJNA 1V0JA 5C51B 1XQ6A 2DX1A 3GAMA 3H8WA 4FN5A 1W4CA 1I14A 5L3QA 3KD3A 1O97D 1NLMA 5EMJA 4TRMA 1YFJA 3EG1A 1XTKA 3KSDO 3UH0A 2A3RA 1NUTA 1S0UA 5FQNA 4UNPA 5FDFA 1MIOB 3WGLA 2Z1MA 4EL5A 2B1GA 1S3SA 3BXXA 4M7AA 1WHTB 3EC1A 4LE9A 2O6HA 5DYNA 2CJPA 5TB5A 2QQRA 3G1JA 1DGQA 4K1XA 4QXOA 4BIIA 3RADC 5AHKA 1F14A 1KY5A 1GGNA 1CUFA 4FNAA 5DSTA 4XVHA 3QIIA 1JS1X 2YRFA 1LUAA 2QJFA 2EIXA 2A5FA 2FEAA 3IPYA 2FX5A 2L0AA 1U5AA 1DINA 1G9SA 1YJXA 2ZTVA 2ZJOA 4JBNA 1J25A 3TIIA 4Z51A 2P2LA 4HH4A 3LNTA 1EVKA 1M72A 1C8BA 1EHCA 5DYIA 3HJRA 3AVXA 1OY1A 4MS3A 1EZZA 4RG2A 1GSHA 5GMOA 2EJVA 5HIMA 2GZ3A 2QZ9A 4A26A 1ZUNA 2R62A 5KNLA 3PQ8A 1GPDG 4DMRA 1Y1TA 4LHVA 2LIPA 1QIFA 1PT7A 3D02A 2JCYA 1OYXA 1XMXA 4FSDA 4HDRA 2HH9A 5F12A 5HX7A 1TAHA 1V1CA 1DAFA 5DSZA 5FOQA 3RV3A 1YNOA 1OIVA 4C92C 2ACEA 4GZ5A 1YB1A 2GBIA 3PUXA 3KJHA 4A63B 1VHQA 2AR0A 1Q82C 1YHYA 3OLWA 2TS1A 5CAEB 2CVPA 3V8VA 2G76A 4CVNA 4F2GA 5L51A 2EQUA 1YZNA 4K6HA 3FFBA 3JX9A 4Q0MA 2Z43A 3MBOA 4J76A 3LX5A 4JV5B 2GJ4A 1EUCA 4JBGA 4MA4A 2H3EB 1GSIA 2Y1FA 4KVZA 4TQ9A 4C4TA 1LD3A 1RPTA 2C7RA 1QMPA 2H85A 2IYSA 2YWXA 4MWTA 1R15A 2O8FB 5DB4A 5FV4A 4JJCA 1U80A 4H1TA 4MAFA 1T1RA 5CM8B 3ZWKA 2O0KA 4ILKA 2ZUFA 5CDGA 2PXHA 3AR9A 3BZBA 5EJ7A 1Y6GA 3A6LA 3N2EA 1D2AA 3GFPA 5CURA 5J5CA 1HC7A 1HEYA 5CA1A 3CUVA 2FRDC 4BQQA 2YIJA 4AY3A 3I6MA 1T8WA 4L9RA 3SHVA 5L3SA 2A7XA 2J9ZB 3AM4A 1OTYA 4BL5A 4TXMA 2DR2A 1QFYA 3JCZA 1NKTA 4QTYA 5HUJA 1Z9QA 3CQTA 1YQEA 4FX2A 3VR3A 2A67A 5E8RA 3WYNA 4ZDIA 1J1IA 4D9MA 2HUPA 5HXAA 4OYLA 1DKRA 2IHNA 5CXUA 1FW8A 3EDCA 4RABA 3VRZA 4BQOA 5BV0A 1S7GA 5FUYA 3O9MA 5CFQA 5DIFA 3EFOB 2OZLA 5EMLA 2SKEA 1UPFA 2HXSA 2VAWA 3U37A 4A2QA 2ZANA 3I05A 4TTVA 1U5SA 1ENZA 4I8IA 5E3HA 4IM7A 2QEXT 2BGRA 2C0QA 2ZBGA 4LFBB 5FUWA 1QKXA 1PJAA 1LBIA 1U1EA 4OHWA 2BBTA 2JEZA 4RG8A 2KEAA 1JJVA 2BHSA 4CMAA 1UMDA 2JCXA 1P39A 2VWGA 5IK2D 1QU3A 5CFRA 5L6LB 3GJTA 4JGGA 1JRLA 2Q4OA 2NTNA 1FFXB 4E7ZA 1LSUA 3AUFA 3AU8A 3JB9G 4IHJA 4BY9E 1WF3A 3CCCA 3NM5A 2X23A 4TXJA 2X7JA 3RPEA 1ZOLA 2AN5A 5IFKA 3FRHA 3OI7A 2J67A 3AESA 1A5AB 1JNXX 3LXUX 1SFRA 2HAXA 4FYWB 3P4UA 1T9BA 2AZDA 3FCUB 1JLSA 1YU9A 3GJ7A 3CNHA 1CHNA 4YJHB 3U7EB 2JGEA 4ZGDB 1NP7A 3SZOA 2J9YB 4J0FA 4Q6WA 1B41A 4C5AA 5C32A 3RKYA 3DLHA 3EF0A 3FOWA 5JVDA 4KXUA 3J7AC 2ODBA 1KVQA 4G9GA 4J9EA 1G59A 3HCPA 2YYZA 2HCRA 3C14C 3QMPA 3OJEA 3VS4A 2B3TA 5T6BA 1G42A 3T9NA 2QU8A 4U1RA 1G7TA 3O5ZA 2ASEA 4YTLA 1EFTA 4XI9A 1IGUA 4TV9B 3WGHA 4KE6A 3AY3A 3R7WB 5KWIA 4RF4A 4HLUC 3KHKA 3LFHA 1J00A 4M0PA 2E82A 3DFKA 2B7BA 4M9CA 4YX9A 4LJLA 2PKQP 1VIMA 3RBXA 2IGTA 4II1A 4XR4A 5KCHA 2WF6A 1VQMA 5GANf 4PLFA 3BTOA 3PEFA 3TNDA 3GLGA 1GPYA 3P0FA 4E33A 3U4CA 3LCUA 1DZIA 1E3TA 3LPDA 3PDIB 2PAFA 2IHBA 2WMDA 3V32A 1YZ3A 7REQA 3DOOA 4JLDA 2QUHA 4NZ9A 3RJTA 4GVLA 1RXYA 4KMMA 2VC8A 4CMBA 3LF2A 5IWCA 3PVQA 1RVDA 3TQOA 4IHAA 4EJSB 2JL1A 3IEPA 5FHQA 2I0FA 4AYXA 5GAN3 2Q4BA 2R2AA 4U7GA 4MUBA 1JHPA 3KT6A 1RJDA 3OURA 3QRWA 1RBQA 4ND3A 4PYRA 3QXXA 2O8DB 4MUMA 2FEMA 2HPZA 1XNIA 2XVXA 7ADHA 3KL4A 1T24A 4WJKB 5G0WA 4E13A 3EMVA 2C1ZA 3CE6A 2JFZA 4HNAA 4CKXA 4D1YA 5KPDA 4XPIA 4U7DA 2GB4A 2GXQA 2PQWA 2QGNA 2UAGA 3PPVA 3R5HA 3QDRB 2ZCVA 5B53A 1DTSA 3KUFA 3ONEA 3C4VA 2G08A 4QTTB 1L5VA 1YMUA 5DK4A 4YJ2A 1CP2A 3JQGB 2TYSB 1O9SA 4UU8A 1H6DA 1GSAA 2PXCA 1U04A 4GOND 2FRYA 3H0CA 2IQ5A 4Q00A 1WG8A 4O4IA 1L1FA 3UAYA 2AMYA 4PSCA 4UZFA 1O58A 4F2DA 5GMKh 2GBGA 2NSJA 4BMSA 3EZYA 3OTHA 2GNCA 2FMTA 2BGGA 1EG7A 3UA6A 1HYGA 4R8RA 1NW5A 1RQPA 4QVKA 4TMFA 1MQ8B 1YTLA 3GLKA 1Q86C 2VJNA 2P2ZA 2VPIA 1T8TA 3T3DA 2ANBA 1DRVA 5DHUA 1UBHS 4ZVTA 3CSUA 3P26A 4ZT7A 2B78A 4YRIA 1AKYA 5GJCA 1AKWA 3INTA 5CDSA 5IVIA 4MKGA 2JIDA 2YV3A 1DJNA 3EGEA 5EL0A 2COUA 4FS8A 3UK6A 4DZZA 5CB8A 5I4BA 3E82A 5LD2C 3DWEX 3MMZA 2B20A 3H5TA 4JJIA 4A0RA 1R6VA 2WFZA 2BE9A 1YZGA 5G0VA 1BA3A 4W5JA 4WFQA 5JHHB 5I48A 1ACMA 4WLVA 1INLA 2IYLD 4MVJD 3H86A 4XASA 3RUHA 1ZSZA 3VV0A 4RY2A 3W8NA 2L3SA 5EUMA 2VKQA 2XD0A 2W6MA 4K9NA 4Z02A 3N07A 1N77A 2ZJFA 3W5AA 3NJRA 1UHCA 3ZC3A 1T4CA 2R7KA 3L6UA 4HGYA 1Y63A 3OCYA 3R20A 4JT4A 4RSMA 1JJ2A 2YZNA 1Z26A 4HAYA 5F1KA 1LQ2A 1R5OA 4GPZA 4FDVA 4KPFC 3WLHA 5GVSA 1DIRA 1WIWA 3BOSA 5EPUA 4WIAA 3ZHCA 1QFXA 3QFRA 5IXJA 1L8AA 1UKBA 5DIZA 1C0LA 3HB5X 4YRTA 3RYFA 3CC2T 1UKZA 3A0UA 2Q99A 3HFJA 1SGWA 1IIBA 4QLBA 1F4VA 4D8UA 2R7NA 1K7SN 2G3RA 3GEEA 3G2JA 1UJMA 2O06A 3M1IA 3MQ4A 3CCEQ 2E5QA 4PJOE 4M1KA 4AQDA 3LPNA 4Z4FA 2IE8A 3NPFA 4TZ6A 2VNAA 4BACA 1IMOA 5IXBA 3P9SA 1NQWA 3AGQA 3D7LA 5JS6A 3E3AA 1TC2A 1WMSA 2DTEA 2FZWA 2VJMA 2O3SA 3LWZA 4FILA 4YFVA 5DTEA 4CIWA 1A8IA 4P0QB 3L43A 2XTZA 3CCMA 1NG2A 2Z4TA 5DLYA 4LY6A 5ITWA 3BGVA 4Y1FA 5IDVA 5LM3A 5JPCA 1P2GA 2RGAA 2HI0A 2WD7A 2NNWB 4LCEA 2DGDA 2EYXA 4I4NA 4MEBA 2W0SA 3KB6A 3EG9B 1ILEA 3PPIA 4X94A 4WZAB 5KVQA 1VQ9T 3MG9A 3VC2A 4YJGA 3I56Q 2NQ8A 5ICSA 1NQ5A 2BHRA 2BUCA 3B6KA 1QPBA 1NW9B 2Y9MB 3BAFA 3FWKA 3HJGA 5CIWA 2RONA 3UANA 3MSCA 2XE6A 3U4GA 1UGVA 1Z34A 3DBHB 1OAOC 3KFLA 4B0OA 2IPXA 1V1JA 4YREA 2QA4A 3R23A 2FX2A 2E18A 2G8NA 3D54D 5PNTA 1M1FA 1DC3A 5K8TA 3ZZTA 4AFNA 2Y3IA 3A1EA 5ICMA 5GJBA 2EP8A 3VUBA 1DFGA 3THXB 3L4BA 1XWFA 2WJIA 2OXCA 4C4AA 3ETJA 4ZGBA 3VZBA 1Y1PA 3LC7O 4A0GA 1SVSA 4QX6A 3G71A 1YP5A 1TUEA 1Q3TA 2HV8A 4DM3A 5K8IA 1Y6ZA 3SQLA 2K2VA 4FQ5A 2WMYA 4BE9A 3E27A 2AFIA 1TPYA 3CZQA 4BTVA 1QFZA 3QBEA 1XNGA 5JJIA 4XQ0A 1YS1X 3R6LA 2ZK7A 4BO2A 1I3MA 2QM0A 2YH2A 3KVVA 4AJJA 5DYGA 1CUZA 2QRHA 3ZHRA 5DISB 3WLRA 1KIFA 1GLNA 2OC4A 2H1WA 4N0DA 1W2GA 3CCLQ 3D8TA 4RORA 3BGSA 5F3RA 3KEOA 3TOXA 3WLKX 1IBMB 4EY6A 1UODA 4EG1A 4OHVA 4TXLA 1TCVA 1TKBA 1SG6A 2XKOC 4JIGA 1KPHA 4KQIA 5GANe 3AIOA 3S70A 1FZTA 3M0TA 2VYVA 3HDVA 2DBMA 4OP0A 1HEUA 1UK8A 1VG9B 5AO9A 4B3BA 1KC3A 2WAYA 3R9IA 3FGPA 5JXGA 1ZLXA 4L2IB 4CDRA 3QSYA 3PXBA 2FFHA 4AJ1A 3PUHA 1ID8A 4CKCA 1YRLA 4RKRA 4IIXA 5CK9A 4AKHA 1PWXA 1GTL1 3JD2A 1VJTA 4BB0A 4DCGA 5AOVA 4ZOLF 2ZQZA 3W1WA 4C7KA 4WJLA 1NVUQ 3PDUA 1J07A 3DMFA 3UT0A 2QGGA 3PUJA 1P5ZB 3H8SA 2FW9A 2Z5FA 3OJFA 1Z75A 3GJZA 2OQ2A 2Z08A 1L9KA 3W1EA 1DO8A 2CLKB 3SDZA 1YKSA 2ZYIA 3GJ8A 4EG7A 2V7WA 4UDOA 5JEDA 3UB4A 5BOVA 5J2UA 2FI1A 2LCSA 1CJMA 1DBRA 4B84A 1GT6A 4GYYA 2ZPEB 3VFDA 1JEGA 5EJ4A 2QWXA 1VQLT 1DC4A 3IOCA 2UUAB 3CXCP 3MS4A 4ZQBA 2RH2A 1UCFA 4B2PA 5A1JA 5AI4A 1QR6A 2CCKA 4OQQA 3C97A 3R4CA 4U7WA 2EAUA 2EWWA 1H4VB 1GPNA 2O31A 1KS9A 1MENA 2RH9B 3AUKA 3JXEA 3CSDA 2Z6UA 121PA 4ALJA 4QFCA 4MQEA 2QTAA 4YVFA 5LKAA 4EG6A 1YQGA 4HEA6 4BLUA 3L7AA 3TPCA 3VHLB 4KE7A 1V1RA 3AUXA 1N6IA 3MGKA 4YXWA 2WG1A 3KTDA 4B4VA 3JCMb 3PLAE 2X86A 2P9JA 4AS3A 3IKMB 4G3XA 3UWKA 3P45A 2G70A 5F9HA 1U8UA 3TXYA 3U7GA 4WZBA 2F43A 4W7SA 5IJ0B 4B4UA 2B8NA 2XBLA 4OB3B 1FRZA 1NXVA 1ADFA 3NM4A 3OYIA 4MUIA 4KR3A 3PMTA 3I55T 1CB7A 1RXEA 1H66A 2A86A 4KL8S 3K1AA 4MKFA 4B9EA 2FFRA 2VHYA 3NM6B 1CIPA 3I4LA 2X7XA 2XCRB 1KJWA 5FOUA 1V7ZA 3NAQA 1UHFA 1EWYA 4LYAA 5AI6A 2GLTA 1L4MA 5G53C 2YJZA 2AZMA 4CC4B 2C54A 1L5FA 1CR1A 2KAFA 1DUSA 1FNBA 4DT1B 3LG2A 3PF9A 4NICA 4KRXA 4XDGA 4KHZA 5EFZA 3T1VA 5AUNB 1H05A 4DYHA 3E3NA 3E9NA 3GDOA 4P32A 3HVRA 4TYYA 4JBIA 3SBEA 5CITA 1RQRA 1UGRB 2XDQB 4F1KA 5C1OA 2WG2A 4J6YA 5CDYA 1Q0TA 2B1JA 2X0KA 5BSTA 3SHTA 4QICA 1ZC3A 1JPJA 2DL3A 3C3KA 4OUDA 1T5SA 4HCCA 2J31A 5F51A 3RSLA 1GA1A 4B46A 3EFSA 1IHVA 3EVBA 2DWPA 2LCLA 2IFTA 1FXWF 3RHSA 1ID1A 5FWXA 2PT7A 4MJ3A 1O96B 2FPMA 3OFJA 4LVNA 4WLEA 4ZJPA 5TNXA 5C6SA 3DDZX 4M7DA 3VPAA 3OFND 2ATIA 3WTCA 3EGDA 1DTWA 2RHBA 2AXQA 4X64B 4P1ZA 3PGA1 2O2ZA 2AZVA 3D4OA 1R4AA 5HCNA 4E2YA 2QRLA 1M1GA 1JHOA 4M1SA 1LPAB 4MVJE 1JLHA 1E0DA 3G3EA 5B4TA 3VVLA 4PYJA 2XQFA 1Y5NA 4MRMB 4PE5B 3Q7EA 4ALNA 1P4HA 4ZVVA 1LDYA 1E1MA 3BD7A 1CY6A 4GP7A 4A8JB 1C9KA 3RRNA 3SHWA 2GRJA 3HDHA 5CCEA 1T1GA 4IGKA 1Q50A 4ZVQA 5FOSA 3DW3X 4RZIA 4XX0A 3CXCS 1CUWA 2P2DA 4B71A 4EZIA 4AJLA 1P3JA 3F2IA 1TM2A 1EK2A 2ERXA 1KH3A 4QATA 1UBEA 1HKUA 1NZFA 2AI2A 2I6QA 2LDBA 2ED0A 4LDAA 4XPZA 4D97A 1M0EA 4MJ7A 5F2NA 3ACDA 2NXJA 4KDFA 3HJUA 4N0PA 4I4TB 2W6ZA 4U5QA 1FJGB 2D5CA 2VQ6A 4CLOA 2HIMA 1UIMA 1EZ1A 3GUZA 3HTRA 1NYRA 2OSVA 1QK3A 2VHEA 3NEYA 4MVJG 1PBNA 2BV3A 4RACA 3WGJA 4CV0A 5KVSA 1H2WA 3CONA 3G6EA 2GAAA 3S1LA 3I04M 1LPMA 1E64A 5CYPA 5I7EA 1FTSA 2AYYA 4M77G 3B2EA 3NETA 3PA6A 4FUQA 4I9FA 1W9HA 1G98A 1H3FA 1M3BA 2FLKA 2OLJA 2WUFA 5M2QA 3I62A 1MXHA 4JSYA 4CZ2A 3X43A 4P7JA 1MVNA 5FT9A 1PK8A 1Q1AA 5KWVA 4DV2B 1Q81C 1I7NA 2I6GA 3UF4A 5SZJA 4CG1A 2BR3A 5GMKi 5JVDF 4GSLA 1UPBA 2LT1A 4WAUA 1G3RA 3KOMA 4HUJA 4RVOA 3UH1A 3P8HA 2BDEA 3DFZA 3K0KA 4TMVA 2QAJA 3KT0A 2V9ZA 3U4QB 5IX8A 5GV7A 1JDBB 3LZDA 4H7DA 3FPEA 3GV0A 2DVEA 3HMKA 4UTOA 2XUQA 4Z0PA 3RAPR 5JI2E 3B82A 3H0IA 1U7XA 1XCGB 2FG7C 1ZD3A 2P2CA 3QE9Y 3R9WA 5J23A 3I5UA 2I9PA 2Z9BA 2DKGA 2LQ8A 3A1TA 3BRCA 4FDMA 4PZAA 2IIVA 4A4GA 3FC3A 2C95A 1QU2A 2PDAA 3O4RA 3R0ZA 1ECGA 2WAMA 2QK4A 3BRWD 1NA5A 1RLUA 4LHYA 5FPHA 3G2PA 1GT91 1EBUA 1N9ZA 1C1DA 1G4AE 4XQ9A 4PHCA 4HVCA 1F0KA 2H1RA 2CL7X 2F3SA 3L01A 2QT1A 3CRW1 1DPFA 4KW7A 1GIAA 3GX1A 3RC9A 3HXOA 3GIWA 4MWSA 1KHCA 4DWVA 1ST2A 1UQUA 2O0HA 4IJ6A 2BTQA 3BERA 4NG4A 1LBQA 3M54A 2ZSUA 3B7GA 4O3MA 1EYZA 5C4GB 1P3DA 1RD4A 1JBKA 2BTOA 4FVTA 3IAM6 3RYHB 5C8VA 2A33A 1G20A 1LV8A 1NRXA 4KO1S 4EKIA 1J97A 1TYAE 3RC7A 1TRHA 1THZA 3DLLA 2JNGA 5GOTA 2VXBA 1P18A 2M51A 4LQLA 1H5QA 2J0EA 2V9PA 3AFNA 4FMBB 4QHYA 1K8XB 4G1CA 2WQ6A 2PUCA 2MWOA 1MT3A 2H1LA 2QLMA 1NHWA 3C6BA 2IXAA 3CE9A 3FFWA 4MZXA 1XZKA 3MJVA 1WZOA 5AKIA 3ZG6A 4CM7A 4XB1A 2VEDA 3THYB 3NAMA 3CEAA 4X1VA 4IDHA 3ZLUA 1UBFA 3GVPA 2G0AA 4C08A 3LWHA 1OPRA 2R60A 1W5BA 4XEUA 2XZOA 2QTBA 3PLRA 3L8DA 3QUBA 3RIGA 1M6EX 1N2OA 4HB3A 3ASVA 3RS0A 1BJKA 2ZSBA 3BFJA 1U0LA 2CB0A 2DKOA 4OBWA 2W4IA 5C4MA 5FCDA 4Q16A 1Q81R 3C94A 2ADMA 2FDRA 4FOTA 2LR0A 1ZKMA 4YYEA 3VDMA 1D0VA 1Q1GA 2FB9A 1XWWA 2JARA 3IVGA 4GSKA 4ZT6A 5AT1A 5I8WA 5LYJF 1YO6A 2QM7A 5GANh 3AW9A 2CKKA 4PW0A 4Z4QA 1FOEB 4IFBA 2L5QA 3HL8A 1FPMA 3G79A 3ELUA 1W88B 3RB8A 2JDID 3MTGA 1LVGA 3RSOA 4D82A 2K5LA 2I6UA 4Q5WA 4PK4A 5ITZA 1LCKA 1K8AR 4LVCA 4CDGA 3E2IA 1ZD9A 1GKKA 1YR1A 4R69A 4WCFA 4BO9A 4NYMR 1JIIA 1NJ6A 1Q7BA 2AZTA 2IEAA 1YI2Q 3C70A 2HA7A 2I7XA 3P0EA 4IXWA 3LO5A 2P75A 3MFQA 5J5AA 1ATIA 3OLCX 4H7JA 2SHKA 4IMPA 3AILA 3KLPX 4YAIA 3SFMA 2R8RA 3GQVA 3G2KA 3VV2A 2GEVA 4O4LB 2G0TA 2NADA 2Y1XA 3KUKA 2D5BA 3B60A 3T1QA 5TVKA 5CHYA 5DNAA 3ENNA 3LY8A 4NR0A 3LRPA 2QDLA 9ATCA 4K87A 1C2YA 1FFYA 1LS1A 2M6LA 1CJKC 4OOEA 3G0BA 1G3UA 3UNXA 5DO9A 2IP4A 1L4UA 2IEYA 3MJFA 3RC8A 1W87A 2EWMA 4CFSA 1ACLA 2ROQA 1I2DA 4ZPXA 2DJQA 1XZCA 2OFPA 4M8IA 2VLIA 5C3UA 1TVEA 4NABA 4YUZA 3ZD6A 2J3JA 1G3YA 1WB9A 3TOSA 3E9GA 1Y5LA 4JB8A 4L5AA 5CM9C 2I9KA 1RTTA 2FUG6 2Q29A 2JVKA 1VBFA 3PHHA 1O8BA 3UFXB 3RVNA 5B3AA 1EWTA 1WLYA 3RVMA 1S72Q 2NPIA 1QIJA 2RB5A 3HV2A 1ODCA 1L7MA 2PGIA 2A5DA 3UWSA 3ZS9A 4F9FA 4YLYA 2WIGA 1RJGA 1P1IA 3IH5A 5DW0A 4EB6B 3NWBA 4B4DA 3WLJA 1SKUA 2R84A 4ARSA 4ZV7A 3R3YA 1JXOA 4ITVA 1UBMS 3NYIA 4PAMA 1QGUB 2NXNA 3F1KA 1JF8A 5EZSA 3BIFA 1N5RA 2WE7A 3GF4A 2REQA 4AZVA 1SA0B 4ZZIA 2QRVB 3WMEA 10MHA 1DADA 4RSHA 3DSRA 3H5VA 1EVEA 2YZKA 1ZU5A 2E41A 2FN3A 3ASZA 4MICA 2WOJA 4RVGA 4ENSA 3LK6A 3KLOA 5CVDA 4B8ZA 5LQUA 2VBIA 3K8YA 2OY0A 3U49A 4LXIA 3R7SA 3G5MA 1AQLA 3PA8A 4D81A 3IOEA 1CE8A 1WB5A 4MB6A 1KEZA 2ZIGA 4PC3A 5AVKA 5LIPA 4B3GA 3TZLA 2VCYA 1JVBA 1AVZC 1EUZA 1AUPA 1U98A 5DM1A 5JQGF 3ZY3A 3IE1A 4W4TA 5EESA 3DFUA 5GZ1A 1KK1A 3QVXA 1WUIS 3P8BB 1C7QA 1QHSA 4M37A 5C4IA 1UPTA 2CNWA 4P54A 3CISA 4IUUA 1Z0DA 4V0KA 4GY5A 2QEXA 2OXEA 4QQFA 1EG2A 3BD6A 1YR7A 3TRDA 2XMGA 1DC5A 3N76A 2WTEA 3LX8A 1BDMA 1H0KA 4U2KA 1U9IA 4UBLA 3RHTA 3RM3A 3MXTA 3OYMA 1ZN2A 2XU8A 3OYGA 4H15A 1Z4KA 1Z0UA 1I5LA 1K5DA 4CGZA 4PLYA 1BI1A 1WW3A 2B35A 3VYWA 4LY0A 4X41A 1G21B 4B45A 4B43A 2Q50A 1V9SA 1KAMA 4F7UB 3DXYA 1JLRA 1IUKA 3R3JA 4D9EA 1SC9A 2DIGA 4PHFA 3V80A 3V2IA 4E7KA 4IKFA 1DXHA 3H1GA 3M0SA 1EX9A 3PX3A 3JWEA 1N2IA 2A78A 3CCMT 2L18A 1F1JA 4KSCA 4KQ1A 2IGBA 4UEJA 3EVFA 3M89A 5IMBA 4XM2A 4FYYA 1AIPA 5EERA 4EY5A 1MEOA 4HHEA 3BVPA 1DT5A 1YE3A 3K70B 2KI7A 2NUTA 2OCPA 1YI8A 1BWRA 4MDHA 2OXRA 4I3HA 3E9MA 1MTZA 2AE2A 1YI2A 5E7JA 3WYGA 3G4SA 3OIDA 4E11A 1KDRA 2AUNA 3BB1A 1FX7A 1XVUA 5JQGB 2FHPA 3HFGA 3KOZA 3SYNA 4WNAB 1D3BB 3BMOA 3HKCA 4BNMA 1O3YA 1UC8A 4NMWA 3ZQ4A 1KQ3A 2UZ1A 3U1TA 3I2JA 3EFHA 1USKA 1FXWA 2I3ZA 2FQXA 3RJ9A 2P9HA 3PRHA 4KQFA 3K16A 3DTYA 2W6ID 2QQ9A 3GGJA 3RTBA 3VOTA 2RAPA 3JYNA 4DR4B 2GM3A 3CPSA 1K8AU 2G09A 2FPPA 2QPLA 2ZPGB 1ZRMA 2P9TA 3DBLB 3MJTA 1C0PA 1ZISA 4NOMA 3I09A 4UOQA 2JA1A 2J4CA 3BBPA 3CB4A 1HL3A 1U0RA 1RXVA 1KSWA 3CZCA 4UXIA 1ITZA 1RYZA 1IZ9A 2FPGA 3FMGA 3H13A 2NACA 4EKNB 3JVIA 2EIFA 1EB8A 4FHEA 2WWYA 3CC4T 3PC8C 3TLGB 1SU8A 1ODLA 3QNUA 2ZI4A 2FMHA 4II3A 2DT8A 1Z6ZA 1SKQA 2O7SA 3RJMA 1EK6A 1XMVA 1F5NA 1SN7A 1THMA 2WZQA 4MYHA 4FGKA 4PX3A 1PWHA 3ZDFA 5L3QB 3AEQA 4XTUA 3P2MA 2OCGA 2N0SA 2YHIA 3CLUC 3NFRA 1CFZA 4JLUA 1MX1A 3BJRA 2PJZA 1MIOA 2W2QA 1W0CA 2X9LA 1QW1A 3SS8A 2J05A 4JXJA 6GPBA 5EJ6A 4Z89A 2ERYA 3DQZA 5KSOA 1EE2A 4QYMA 4ZGWA 1L4LA 2X22A 3ZWQA 1FY2A 4B83A 4Q1AA 5EUBA 4EJ2A 5LFAA 5TIIA 1U8AA 3TPZA 2XOKD 3BH7A 5HK8A 1Q7YR 1JU4A 1W30A 4OA5A 4Y2YA 4NCBA 2WKWA 2ECQA 3VU3C 1IHXA 1KJJA 4KACA 2O8BB 2Z2IA 1N57A 1T0HB 2E6ZA 1DC8A 1H8EA 1Q0QA 1T35A 3BXPA 2G72A 2XWJI 3AUAA 4O2BB 4NOYA 5ECYA 4RTVA 1W8DA 3RTEA 3UMSA 1BHJA 3WBBA 4B2YA 3T7KA 1RC0A 1GV1A 3U80A 1KJZA 1I1JA 1ODFA 2YUQA 5ALJA 1YKGA 3AOGA 2NZ2A 3PJGA 4DUGA 2F3TA 3RVDA 1UT5