4DEYA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
319
structure length
281
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1C
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 94
structure length 281
sequence length 319
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4deyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4deyA02
1EFHA 4IKEA 1H8HD 4KLZA 4HZUB 2C9CA 1N6OA 1X6BA 3SFVA 4C3ZA 4ZDJA 2V1UA 4IDQA 2EVWX 3R7WA 4CT4B 3IIKA 1XPUA 4PO9A 4I1UA 3NEJA 4CC7A 2PT7A 3OEHA 3M4YA 1P2VA 1Z6AA 1JR3D 4CC2A 1W2GA 1P9RA 1BMFA 3M0RA 4OI0A 2IK8A 2GA8A 1HT2E 3I4LA 1TG0A 2VEDA 2DY1A 3U3JA 1JPNA 4D82A 4TLCA 1V43A 3U5ZB 1ZUNB 2FNAA 2GF9A 3AVPA 3QKRB 5IHPA 1WXTA 5C2JB 1KI4A 1XMJA 1ZCAA 1DOAA 4JLOA 3BFVA 2DPXA 2ZS8A 1KJWA 4YXWA 4G5OA 1T3LA 4Q4JA 2OSBA 1NN1A 2F3RA 1UG1A 2OLKA 3OEHD 4M1OA 4S2EA 3HWSA 2YUPA 2HF9A 2GJAA 1T8UA 2IHYA 1DG3A 3UXMA 3GLFA 4HUTA 1BMFD 5J4HA 2R6GA 2G88A 4ZPXA 2KT1A 1AZTA 1OYYA 2DL3A 2GK7A 4CW7A 1NM7A 5F9HA 4C7OA 4OMMA 3HU2A 2PJRA 5JFGA 1D6JA 1R0XA 1AIPA 1SXJE 2C0TA 4CEJB 3FDIA 1B3QA 1X86B 4IOKA 1PZNA 1DG1G 1UADA 4V02A 1QRAA 2KXDA 4GBMA 1R5NA 3GEEA 1FP7A 5G53C 1T0HB 3C7KA 1M7BA 1BOFA 3AVVA 1W4RA 5DE3A 4DHEA 2GVZC 4R2IA 1IJEA 4YXWD 5I11A 3TR5A 1CR1A 1M8PA 4TLAA 4TLEA 1OH6A 3PUWA 4NCIA 3RVBA 3L0PA 2NO6A 4AFZC 4PXAA 2VHUA 4LOAA 1VPLA 4QBHA 4ZIRB 4U5XA 2FG0A 2WMNB 5FUVA 2FDCA 1N5KA 2ZRCA 4GRAA 1KDOA 1MH1A 1S9DA 3PV0A 4HB4A 4OYHA 1GFCA 3HYTA 4A2QA 1E6CA 2A5FA 2JTEA 4IJMA 3FMIA 2J46A 4UQOA 1G8PA 1Q21A 2KR3A 4L16A 3TQFA 4ARZB 5L3SB 1SHFA 2BV3A 5CDFE 1U99A 3SFZA 3REBB 521PA 1Q12A 3PUXA 5J4YA 2JW4A 2ZE8A 4K11A 1F5NA 1KNQA 2EWWA 2QAGA 1E2HA 3LBHA 4E09A 3U61B 1YRAA 3ZYCA 4JZ4A 1J7KA 2A3RA 1ZUUA 1X27A 4A4DA 2BJWA 4DCVA 2RMKA 1E9AA 2D62A 2VP0A 4B3BA 4KO8A 3IO5A 4UXIA 4PPNA 3KKPA 5TV2A 1NSFA 1GBQA 1XD2B 2ZRDA 2PZ1A 3B1WA 2L0AA 4Q9KA 3C4JA 4F93B 5JJLA 1WFWA 4RFSB 5FUXA 3X2SA 2GESA 4Q19A 1FP6A 2IYZA 2PJZA 2JLUA 2GEUA 3CRW1 4PPGA 1IN7A 3X1DA 3KQUA 2WOOA 1HYQA 3LO5A 4RTUA 1WA7A 1U0HC 4TMVA 3RS7A 3SI7A 1XEXB 3PIRA 4I81A 2ZVPX 1FNMA 4Q1CA 5DIFA 5FOWA 4AWXA 5KDOA 2M51A 3K0EA 4TYQA 1A2BA 1WBDA 2VP4A 1E9FA 1NKSA 2A7QA 4A8JC 4D4MA 5JS8A 5DI9A 1OJLA 4XOIA 2OFOA 1AA9A 1E9CA 1NP6A 3FB4A 3G0HA 3BD9A 2R6DA 1QF9A 4XVQA 1LB1B 4MRPA 4BFSA 5GJWC 3H0HA 3WHLA 3K0FA 3MJHA 2W00A 2VPPA 5GJBA 1Q20A 1S4QA 2QSZA 4B3DA 1OIVA 1GKIA 3ADKA 2C04A 1JBKA 3OHMA 4FN5A 1EFRA 1ZBJA 3VS6A 4JSYA 4MDFA 4AYXA 1EWQA 1E9EA 4O0MA 4EAQA 2AFHE 4KCGA 4BFXA 3NKVA 2HCBA 1P6XA 2DX1A 2DYKA 2W0SA 4LBZA 1Z3IX 1FFHA 4TQAA 3T06B 4EIWA 1U0JA 1TUIA 1JJ7A 1AVZC 1QWEA 1ONBA 4LBWA 3QQ5A 2GCOA 2WVJA 4LZZA 1RJ9A 3BERA 3Q8XB 4KU4A 4C2TA 2VRWA 2QGZA 2HUPA 2WJIA 1L4UA 2X1VA 4WXRA 3AH8A 1KOFA 1OT3A 1P73A 2JM9A 1TEXA 2FFAA 1NVVQ 2Q9BA 4IVPA 4EFNA 5JS7A 1NN5A 2W83A 1PRMC 2ZQ5A 3AGQA 1UGVA 2NWMA 1ZD9A 2YC4C 2P2LA 2VBCA 5CB6A 3RANA 3W5JA 5EUMA 1A1VA 2IYVA 5D3MA 1EFRD 3CB4A 4JLMA 4PQFA 1P2UA 4FMBB 3WNBA 3IEVA 1UE9A 2EYQA 3VR5A 1JQJC 2JLWA 1ZNWA 2RNAA 2NIPA 4FIDA 2F2WA 4V03A 3B2EA 5FTNA 1NNEA 3M6AA 1N6NA 4QL3A 1V5WA 2YUQA 2GGRA 3CUEF 3HDTA 4ZDWA 4H9GA 2RPNA 2F6RA 3MWLA 2HT1A 3AVUA 1XP8A 3UWOA 1XNJA 2YT6A 1GKYA 2W2TA 1ZAKA 2JM8A 2G83A 2QMHA 4QJ4A 5KPDA 3K09C 4IVQA 3LY5A 1KI1A 5FPYA 1E9DA 2FRWA 4GDFA 2JXBA 2ODBA 1KJYA 5DGXA 3PFIA 3TBKA 2QBYB 3U7EB 1QHIA 5FTJA 1IY2A 2OE2A 2PH1A 2PMDA 3PUVA 1M34E 1OFIA 2QQ0A 1DPFA 4PAMA 4NCHA 4TYPA 1NLPC 1G6OA 1K1ZA 5FOTA 4EQ6A 1Z9QA 2RGNC 1ODFA 3SYKA 2EQBA 1E94E 2ZTSA 4CEIA 4XWKA 4AI6A 5TB5A 2H7VA 2ONJA 2ZSFA 3Q72A 3CX6A 4BPBA 1OE0A 2JS0A 1U8ZA 1KI3A 3UK6A 2J0QA 1CF4A 2FOLA 3U7HB 1NEBA 1TTTA 1M6NA 2QMUA 4UNSA 1W5SA 2RGAA 5HCIA 3BJIC 5G3YA 3CRMA 3C16C 1QZXA 4DLRA 4XSHA 1YP5A 1W6XA 1G4AE 3FKSA 1IOZA 2ZVQX 3GPLA 2VQSA 5FPHA 2JCSA 4HUQB 1NYGA 1KI8A 5EXPA 4JYBA 4HB2A 5DYGA 3QVVA 4ITRC 1ZLMA 2C98A 2XTNA 3L8ZA 3GQBA 3QKTA 3NH9A 1UKEA 4XWOA 3NMZC 4B48A 2J9RA 4A0FA 2K2MA 1RRPA 1IXRC 4CVNA 2YYZA 4TLBA 5FUWA 2VHQA 1ZBDA 1MO3A 2C5LA 1GIAA 2PCLA 5G3ZA 4BZQA 1SVSA 2BCGY 4Z88A 3M0QA 1U8AA 2B92A 3B7GA 3O47A 4DDWA 2ZI7A 2NPFA 5CLLA 2G6BA 2BC9A 4LJ4A 4V0ME 1RUWA 1T6NA 3RWMB 1M8MA 2O9VA 4ZCMA 5JHGB 2ZJBA 5ELXA 3DOFA 5LB2A 4D0GA 1KO1A 1GCPA 3QEOA 4BFUA 3KQKA 3QKRA 3FOZA 4EIKA 4QBFA 3E2IA 3FKSD 3D8BA 4ZDIA 1P60A 2BBWA 3DMDA 2WWGA 2DLPA 1QHSA 4XTCS 3QSYA 4K46A 3NC1C 3FHOA 3P4XA 1FTSA 1AS2A 1P9NA 2FGJA 3CWQA 2IYSA 2QSYA 5DHAA 2C99A 2ZSAA 3NBYC 4F7WA 5FBVB 1XFAA 4PHTA 2FEMA 2C0OA 1VECA 5JI2E 3VS5A 1WDTA 1E1QA 1GILA 4Q7LA 4L9WA 3F0TA 5L8VA 4JJDA 1AKEA 5KU1A 2DBMA 3HU1A 4NYMR 2RGBA 4MYCA 2I1VB 4M1SA 1G291 2WBLC 2ERXA 4ESVA 3W9YA 4DCUA 2WJYA 2Z0MA 4GP6A 5FL7A 3B1YA 2GBLA 4IOLA 4Q01A 5K8LA 1QCFA 4CEJA 4QHYA 4YDHB 2O88A 2B6HA 1JQQA 1KSJA 2AK2A 3P32A 4FD2A 2C9OA 2WWWA 4LE9A 3E1SA 5TDHA 1AD5A 2F9MA 1D2NA 1RLQC 2DL5A 2NO7A 1SULA 4P32A 4A8JB 1XPOA 2JA1A 1OV3A 2QG6A 1II9A 5B57C 2JJ8A 2I0NA 1OB5A 1E1QD 2NO1A 1UJ2A 4F91B 1P75A 1TU4A 3GEHA 5AUNB 2ZRHA 5GJWB 3I9QA 1Z0AA 3H84A 4ESHA 2L2PA 3NTUA 4LJAA 4NE2A 3RS2A 3VX3A 2GJSA 2GJ9A 2D7CA 4DBLC 1NI3A 1GG2A 2JT4A 5LBIA 2RGCA 4EJSC 1KZGB 2P0EA 2F1IA 1E2LA 1LS1A 3C41J 1G2BA 2B7CA 4UNQA 5DLQC 3KKQA 4M2LA 2J1LA 1SXJC 2ZSBA 1TADA 1BYIA 1Q22A 4TMTA 4TTRA 3EZ9A 5FL7D 4D0LB 3NHAA 3VKWA 3A6PC 4CYMA 1UKZA 2CVHA 2J0VA 5AUOB 2D7DA 2W58A 5L3SA 2HV8A 3FPAA 4V0MA 3QBVA 1UPTA 2D2FA 2H18A 4KAXA 4MITA 2QT0A 3FHCB 1OXXK 1EXMA 4I1OA 1S3SA 3O8RA 1VHLA 3EHQA 2FSIA 1HURA 3KTAA 4RY2A 5C1BA 1E0AA 3KFVA 2IYLD 3JZMA 3TSZA 2F43B 4GL2A 4QXAA 3NDPA 2O8EB 2ZEJA 1E2NA 3W6NA 1X2QA 4PC6A 2OBMA 1OFHA 2BEKA 2QEQA 1CSKA 1ZM4A 3CQTA 3AUXA 3P20A 1WP9A 3W3AA 1HEIA 2ABLA 1AQYA 3QIAA 1UDWA 4RFSA 2ZYTX 4A92A 2DRMA 4A0RA 1U5SA 2V6JA 3PUYA 2AWNA 2N1BA 4L15A 3E5HA 3N70A 5JMTA 2GTJA 1DVRA 2V7QA 5EZ5A 4Q9IA 1XEXA 4LNPA 2D0NA 3HJNA 2R6FA 4CC3A 1G9XA 4WZ6A 3GCGA 1C1YA 1H3HA 1PLKA 4J9GA 4C0LA 1R4AA 2IC5A 2V9PA 5BYJA 3AKEA 3GLIB 2IXEA 2YDLA 1BS1A 3Q9LA 5AJYA 2XZPA 2GBQA 3LDAA 2JASA 3VRZA 3DZDA 3ONWA 2FRYA 3GJXC 4Q1BA 3DMNA 1KO7A 1WDXA 1HJDA 1NG1A 1JAIA 4HB0A 2BBTA 2ZI6A 4LHYA 4M9ZA 2HEQA 1WF3A 2AD5A 5BN5A 3I5YA 1OH7A 1PLJA 3H1TA 1BBZA 4HLUC 4DLVA 5EUQB 2G6FX 2IBMA 2QP4A 3SBEA 4DB4A 3RBBB 4ZCIA 3IIJA 4J9DA 2V7QD 3O5ZA 5EXXA 2IW3A 2KYMA 3RLFA 4RTTA 2F1HA 1S1NA 3A98A 4OMPA 2ZRBA 4LCBA 4Q00A 4TLDA 1KI6B 1AWWA 2DWPA 1AWJA 3TH5A 3TVDA 1MABB 3AUYA 4JBXA 3RRNA 3CPHA 2WWIA 2L3SA 4PTLA 4E22A 4NCNA 1D5CA 3THKA 4RSGA 3EG2A 2XZLA 4QBGB 2A37A 3I5XA 1MO5A 2QDLA 4WCIA 2REBA 2LCSA 3GLFB 2XB4A 1YZLA 1QHHA 3DM9B 4AG2C 3CF0A 2C77A 3TGPA 1FMJA 4OQNA 3ADDA 4NP6A 1LY1A 3I62A 1NMYA 3QF4B 4OL0A 1Z06A 3N2IA 1EGAA 1ZNZA 3L0IB 2EGEA 4R98A 3WBKA 3JVVA 5EE9A 3W5IA 2HSPA 3EIEA 4TQ9A 5P21A 3BAFA 2GJ8A 1VHTA 2LJ1A 2ESWA 1VTKA 2BM0A 3TW4A 1P62B 1XB2A 1KGDA 4JS0A 4O3MA 1G1MA 2EW1A 2O8CB 5ANRB 1CTQA 4F4IA 5IHIA 1DS6A 2BOVA 2DM1A 3JZAA 4FCVA 2FSGA 2F2VA 3EG1A 5BQ5A 2PEZA 1CJVC 3T35A 4C0AC 1QG2A 2W10A 1NMXA 4JLDA 3EPKA 1FQKA 2EFCB 2KE9A 2QBYA 1NLZA 3A1SA 3QE0A 4NL4H 5FWCA 4MGKR 4JMPA 4W9MC 2J0UB 3AVYA 3ZVNA 5CK4A 4P31A 1VYTA 1E2JA 2YUNA 2KBTA 2SRCA 1AK2A 1LV7A 4FCWA 4M53A 4TYNA 1QKWA 1W36C 5H68A 2FN4A 3EIHA 1YN8A 3R6NA 1YVDA 4Z8AA 5CITA 4URZR 3TR0A 4G01B 2JDIA 2YINC 2BIFA 4MUBA 4OK5A 4P4TA 4DLYA 1JI0A 4Q48A 3SN6A 3IIMA 1WXBA 3LXRA 2IF2A 2R6CA 2OCYC 1UDLA 4KLNA 5C18A 4OHYA 2HYIC 4NH0A 4MRVA 4ABYA 4MUAA 2ZRKA 1GRIA 2E1RA 3CZPA 3PITA 5IRCD 3VKHA 4HUQA 1EFUA 2QT1A 4BRUA 2VA8A 2QMEA 2AK3A 2HCKA 3ASYA 4FWTA 4JLBA 3U6KA 5A4JA 3RS4A 2MCNA 1N25A 4UKDA 1E98A 1GL9B 4JT2A 1KDPA 2F2XA 4HVWA 4TSFA 2ED1A 2R8RA 3F3YA 1SKQA 2O0HA 4J0QA 2R6AA 4JVSB 2ZRNA 1HQYE 1N0VC 4V0NA 5KO2A 1I4TD 1PNJA 3GEIA 2ENMA 2EPDA 2XSZA 4V0OA 3WNCA 1YHNA 4DJTA 3I5SA 1KMHB 2BZXA 1KK3A 2FF7A 3LBIA 4EJSB 2C03A 2JDID 2MOXA 4DIDA 5FWBA 1EFCA 4A2WA 4LYFA 2WSSA 5CIQA 5K8IA 1OXVA 1SXJB 3GJ0A 4LJ9A 3TJZA 1KJZA 1Z0IA 3AP1A 1IN5A 3RSOA 4CEHB 3K8YA 1E32A 1QWFA 2GZAA 2YNMA 2ECZA 4KFUA 2ZJ8A 1VCOA 3QKSB 4BLPA 2CHQA 3BC1A 3K0FB 4RKFA 2OBLA 3AKCA 4IOMA 3MFYA 2A30A 3IUYA 5I22A 3SR0A 2DBKA 2JMAA 2VSOA 5FTLA 2HJVA 1SVLA 2XSZD 2K5UA 2H57A 821PA 3SJAA 2JLVA 3EAQA 1ESNA 4NCKA 2J7IA 2ZUDA 2EU8A 2ZI4A 2K6DA 1XTRA 2VLIA 4G1UC 3TQCA 4DDVA 1N3BA 1KO5A 4LPKA 1CBUA 5B64A 1G20E 2WSSD 4CIDA 2KXCA 4Q1DA 3T12A 1YR9A 5KDLA 2ZPTX 4B2LA 5KNBA 2FU5C 2P4RA 1IAQA 5EXSA 2ZJ5A 4A1FA 2ZAMA 5KSYA 1IY0A 3SC3A 1LF5A 5GJVC 1K9AA 4TTQA 3EW9A 1H92A 1J90A 4FMCF 1XXHE 4LHZA 4M1KA 4A8JA 4C0KA 1ZW6A 3CH4B 4B43A 3H0KA 3X1ZA 1FNNA 1DAMA 1GZSA 3UIEA 2RGGA 1WLPB 2BZYA 3FE2A 3THXB 4PAOA 5KOYA 2KNBB 4RZ2A 2PZEA 1PV4A 4A2PA 2MMCA 2WKRA 3MUFA 4TL6A 4UXJA 1SVWA 2QP3A 2Y8EA 2GDJA 4XJXA 1Y63A 3T61A 4B74A 2DF6A 3AF3A 2EYWA 2J05A 1YJ5A 2P3SA 1SHGA 1K6MA 2KB0A 2G0TA 1Z0JA 2PX0A 3Q7QA 4HAYA 4JVNA 2IYYA 2O8FB 3MSXA 2WKPA 4ZDKA 3T34A 2KE5A 2BTTA 1AM4D 2ATVA 2V3CC 3U7FB 1XBTA 3FKQA 3GD7A 1D2MA 3MLEA 4IEEA 4EQ6B 4A0HA 1CP2A 4KV9A 4CEIB 2LQWA 3PG5A 2O8EA 3ZZ0A 3FFBA 3ZZUA 1ZUYA 2NTYC 3KB1A 4DSOA 2CCJA 2OJ2A 1Y57A 4LHVA 3REFA 2VSFA 5EE3A 4L4UA 2DE0X 3RYTC 2XAUA 1IO6A 3OE7A 4KFTA 3ZVLA 1RPZA 1Y3AA 3Q85A 4Q4LA 4XH9B 2IWHA 1AJEA 4OJKA 2DFNA 3DEFA 1WA5A 4NYJR 3ULRB 1BIFA 3SJBA 3KKNA 3T1TA 2LKCA 2DMOA 2H17A 1VCNA 4OI4A 4W7SA 1LFDB 3GLIA 2O8BA 4J9EA 2ONKA 3K09A 4L8GA 4XVUA 5DO9A 1G16A 3L82B 1F3OA 3CR7A 2WWYA 3MCAA 2QL6A 4TZ6A 1Z07A 2P6RA 4AG5A 1E0SA 1DAIA 1XXHA 1FW6A 2ZJZA 4LHXA 3EGUA 5IHKA 4R0KA 2QGNA 2IHBA 2RGNA 3OE7D 3R20A 4ACBA 2QY9A 1OEBA 1HSQA 1QBKC 1W47A 2ZRGA 1JR6A 3MJRA 4GBQA 1US8B 1X3SA 1TUEA 3VR6A 3RC3A 4EPYA 3MD0A 1NLYA 1Q3TA 2AKAB 3I73A 2DL4A 1CS4C 1YZKA 3QY0A 3RS0A 4EUNA 1KI6A 1VCMA 2D3WA 3REGA 4OQFA 1XEWY 3TK1A 1MABA 3TMKA 3T1OA 2ROLA 4KBFA 2EYYA 1GL7A 1X8KA 4LJ6A 1K8RA 2WWXA 3ZVRA 4C4PA 2B86A 3IBYA 4OQMA 2BDTA 4JPBW 3CR8A 2K79A 1U2RA 1S3GA 1E2PA 3GBQA 3QF4A 5UKDA 3B6EA 3DDCA 2EGCA 5FOVA 3PVQA 3EZ2A 1M27C 4MKIA 2VP9A 4BEBA 4BGDA 3CPEA 4ZO4A 4HVVA 2DCUA 1YE8A 4M4ZA 2CK3A 4UJ3A 2O8CA 4DSUA 3H2YA 5TMPA 2ZUBA 2IYWA 3W8RA 1X6GA 2DWQA 4PHHA 4F17A 3DO6A 2YWEA 4DT1A 2X3XD 4RD0A 3QKUA 1ZM3A 1KFZA 4JLPA 2CVFA 3HR7A 5JJKA 1UFQA 4A0GA 2MSCB 2QPOA 2FJUA 3ETLA 3IQWA 4CRWB 2DB3A 2E5KA 1W4BA 2J0UA 4F38A 1E99A 3O8BA 2VTKA 1ESMA 2NZ8A 1VYUA 3OFNA 1E9SA 1JNYA 2GCPA 2LQNA 4IFBA 2YHSA 4IRUB 3V9PA 4QHSA 2P6UA 1G8YA 2YWGA 3X1XA 1D2EA 5HCKA 4N0DA 2OLJA 4TL9A 1CU1A 3N2EA 2CK3D 3P27A 1KY2A 1ZMXA 2KI5A 2CBZA 2C2HA 1WIEA 3NG1A 1XJ0A 3K0AA 3BE4A 4NYIQ 4XVRA 3KTAB 4M21A 4LWZA 3EWSA 5G41A 5HTKA 3U6BA 1WRBA 5E4FA 1ANKA 3A36A 3K9LA 3IILA 5E7IA 3VR4A 1YR6A 1NG2A 4OK3A 3P4YA 4B3XA 2WAXA 2Q3MA 3PEWA 4TN1A 4HXJA 1KDRA 1RYHA 3OFND 5KNDA 5DSZA 3WNDA 1I0CA 2WIBA 1ABOA 1UJ0A 3VRYA 3A58B 4I1SA 1QHYA 5IXBA 3FFAA 1MRSA 4RJLA 3RABA 4D6PA 5H8WA 2JLRA 4EDHA 3QWXX 1YZUA 5EE0A 4NDZA 4P4SB 1KMHA 2WICA 2WSMA 4ASUA 4TYYA 4EJSA 4ORZA 1YU9A 1R5BA 2IL1A 4Q9HA 3GLHE 1E69A 1W46A 3AKYA 1D8TA 1SXJA 3C15C 3CZQA 2P67A 4B76A 2F55A 3CRRA 4MRRA 3HR8A 1NJFA 1JO8A 1U3OA 4UXHA 1OIXA 4U7DA 4A82A 1CJKC 1HT1E 3KJHA 3QKSA 3U3KA 5SZJA 2LKDA 4D4LA 2LJ0A 1FX0B 3HP1A 1GAJA 5B58C 2AXPA 4R7ZA 1HY3A 3ZJYA 1FYNA 4J9FA 5B30A 3VQTA 1Y0MA 2X3WD 2I3BA 2ZRIA 4H1UA 2R2AA 4LUCA 1Z63A 4LJ7A 4CGZA 4BFVA 4W5JA 1U8YA 1GSIA 1TU3A 2EYZA 4ZCLA 2A28A 3SJCA 4ASUD 3RAPR 4D0NA 1YWPA 1PKTA 5IHNA 4ZV4A 3NDBB 4OI1A 1FMLA 2VIIA 4IDOA 3V4RA 1KAGA 1SXJD 3ZIAA 4JLJA 2KSQA 1EESA 4DZZA 1ZINA 3NC0C 1DAGA 2LJ3A 3CLVA 2GTOA 1NSTA 1NLOC 5CDFA 1W4AA 3KXLA 4KITB 3BB1A 1B23P 2DJQA 4JSTA 1RI9A 4YQFA 1QHHB 3QXJA 2LZ6B 3I8SA 5J5CA 1S96A 1W70A 1DAHA 2DFLA 2AFIE 4BFTA 4OMLA 3BWDD 4URYR 1E6HA 2GXAA 1W44A 1G7RA 1ZUHA 3AVXA 3A1WA 1G18A 3THXA 5AJVB 4HI0E 4Q21A 4YONB 1XF9A 4O2LA 1ELOA 3RHFA 2XNSA 4HLUA 4OMNA 4Q03A 4PAQA 1Q1QA 5KNCA 3TW8B 1TX4B 2DR3A 4E07A 3TUJC 3I61A 1U90A 3ZIAD 3TSWA 1QG4A 1YR7A 1UEJA 5HZHA 4PR0A 2J59A 3H0IA 3KJGA 3PVSA 3FHTA 2O8FA 2GRJA 2UZIR 3CWZA 1G7CA 4U00A 2KRSA 4QHTA 1KNXA 2VHCA 4PO1A 3K9HA 4C0JA 3PQCA 3UMSA 2DBYA 4HAXA 3ZH9B 3Q3JB 2RQVA 4Q5IA 8OHMA 4B2PA 4MKFA 2BBOA 2J87A 5AJWA 2XJ4A 1DAKA 1F2TA 4PHGA 4GP7A 4LJ8A 1N5IA 2CSIA 3UMRA 2F9LA 2FGKA 2X19A 5KSOA 4D26A 1GFIA 3K9NA 5TY0A 4DSNA 3B1ZA 2L3QA 5DNYB 4B6EA 4LDJA 4CC4B 1DO0A 2E87A 2JEOA 1IXZA 1WI7A 3D3QA 5JZVA 2Q9AA 1K4US 1L7VC 1FZQA 3DKVA 2AL7A 1ZU5A 4EFLA 2EFDB 2HF8A 3DOEA 4GNKA 3WP1B 1E0KA 2OV2A 5JRZA 1MKYA 5FL3A 1Q0UA 1N5JA 2DL8A 4X1VA 2OM2A 2ODWA 2WPDA 4LJ5A 1JXMA 1P3JA 2QP9X 4B2IA 2R65A 1OOTA 2TMKA 2WJGA 1S8FA 3CX7A 4FMDF 4JBWA 4TMKA 4RFVA 4B71A 5JRJA 4DDUA 1KO4A 5HE8A 1G3RA 3NHNA 1SHZA 2ZJOA 3I1FA 2ZUCA 4URWR 2QTFA 3UMFA 3ADBA 5FH9A 2JS2A 1GNQA 1US8A 5L3VA 4AK9A 1U98A 2VKNA 2NG1A 4AYTA 1K5DA 3SYLA 1XX6A 2O0JA 3L0SA 3QNUA 4CDGA 3QUSA 2R9VA 3HPQA 1XWIA 3VR2A 2OFXA 3I32A 4RD1A 3QENA 5DI3B 2YC2C 2ZU6A 3MWYW 5HKKA 1DO2A 5JWOA 1Z2CA 4BLQA 3DPUA 4GOXA 1SVMA 2WPDD 1EX6A 4WZBE 3RNJA 2D4HA 1VYVA 4US0R 1I4LD 1NKTA 1TMKA 1MV5A 4FW9A 1ZIOA 4H1VA 1GNPA 3NVAA 4WZAE 1HA3A 3C8UA 1G3MA 4OQLA 4OHZA 4PZLA 1W36D 2WHXA 4GOJA 1E6GA 1N5LA 1A82A 1A4RA 1CJTC 1AWOA 2F3TA 1E96A 1GDDA 1YZQA 4IEIA 4M4SA 1KSFX 4WIAA 4F14A 2FEIA 2XTZA 1Z6TA 3EXAA 2Q0HA 4HLCA 2QA5A 1BU1A 1IM2A 1ZP6A 2A5DA 5HKKD 2BZ8A 3DM5A 2NZJA 3EIQA 3KQHA 4R9UC 1AZEA 4M1TA 1DEKA 4PC1A 3LD9A 2GEVA 4LSGA 3MGCA 3NPFA 2J7KA 721PA 3PE0A 2ZI9A 3QPUA 3LW8A 1J8MF 1GNRA 1AWXA 1LVGA 4CF7A 1MV0B 4OMOA 4LBYA 4QNRA 1TL7C 1MR3F 1UKVY 2OXCA 2V6IA 4B6FA 3MRSA 5K8TA 4XIGS 1YR8A 2GHIA 2ZJAA 4LV5B 1LW7A 3LV8A 3H4MA 3M0EA 5EE1A 2V1QA 2SHKA 4OKSA 3HYRA 1YWOA 1G6HA 3VS1A 1E2GA 5FI1B 1G64A 1GRNA 2OESA 3R8FA 4W5HA 4BLRA 4TL8A 4TMZA 1NVUQ 2REXB 3CW2A 4DRZA 4HAZA 1I1JA 4RCYA 3LX5A 2MSDB 3K53A 1W2HA 5JI3E 2IXGA 2DRKA 1VMAA 2BWJA 1KKLA 2V55B 2GJKA 2RGEA 3TUZC 1XDBA 4RTZA 2EGAA 3FVQA 1R10A 4I1VA 2RQUA 2XB2A 4G5QA 4FI3C 4NCJA 4QGGA 1F48A 2R44A 1KI2A 3L0OA 4P4SA 3SQXA 3AF1A 3SEMA 4X8MA 2MIOA 3CH5A 4DVGA 1OB2A 4RCZA 4Q9JA 4AC9A 2IYXA 3RS5A 1GP2A 4C0BA 2O8BB 2YSQA 4QFMA 4Q18A 4LK2A 1GCQA 3B1VA 1HD3A 1Q57A 2QPAA 4DIEA 4Q9LA 4ZI3A 3QG1A 3SEAA 4DCTA 1XPRA 2WKQA 1XEFA 1FX0A 3CONA 4TTPA 4O2RA 2QROA 1H65A 1X8LA 1XXHB 1WXUA 5G40A 5HE9A 3VS3A 4KYIB 2I4IA 1I07A 2N42A 3D6TB 4PX9A 1KIKA 1HV8A 4FSSA 4LBVA 5AUPB 4MDEA 4BRWA 5BXQC 2GEDA 2ROTA 2GF0A 2IUTA 2WMOB 1XZPA 3GJ5A 3LXXA 3VFDA 4ZKDA 1PUIA 5FBQB 5BW8A 1M7GA 3EPLA 3C14C 5EE5B 1PHTA 5FBRB 1VG8A 1N6IA 3W3ZB 6Q21A 1LF0A 1NYFA 1E2DA 3IEUA 5GVRA 4QGFA 2PL3A 2QU8A 5IDVA 1EX7A 2CL6X 1UAAA 3UA6A 4HYYA 4ACAA 4M0LA 3U44B 2FSHA 3DKPA 3NGPA 1DE0A 4PSKA 3E70C 5D3QA 1VIAA 2XXAA 4ESRA 4DLUA 4AFUC 1M1YE 2VH5R 2WV9A 1T4GA 4JBYA 4QM7A 4J9HA 2QORA 2ZS7A 4RZUA 3A1UA 1Z47A 5FW9A 1JXOA 2D1XA 1D9XA 1JEEA 2ORIA 3CIOA 5CM8B 4OHWA 1G19A 1E9BA 1VG0B 3B82A 1KSGA 5J4LA 4FWIB 2C0IA 3VU9B 3BRWD 2GXUA 121PA 1FL9A 2ZR0A 3B5JA 4POAA 1N2CE 4Q7JB 2ZETA 1XMSA 4BFYA 4MRSA 1ABQA 1SKYE 1I2DA 4JLAA 2FA9A 3FJ5A 2CXXA 2W2VA 4DT1B 1CXZA 2J6FA 2O9SA 2BKEA 4NBSA 2C95A 3OIYA 4TMWA 3AP3A 1NBME 4C0HA 2D8JA 2DVJA 1BB9A 2QRZA 4N1AA 1NN0A 1SHKA 2Z83A 2JLYA 4M9SA 3I5RA 2W6JA 1CKBA 4LC1A 2DFTA 5JCPA 2YWFA 4A63B 1E2MA 4V0KA 3EG3A 4GT1A 4NYMQ 1G17A 3SJZA 3ZDQA 3LRPA 5KTYA 1DADA 2DA9A 1CR2A 4F4JA 1QDEA 3PCRB 2QE7A 1AOJA 4HDQB 2AWOA 2X77A 3K0AB 4BEJA 1XEWX 2YOFA 1LS6A 2GAOA 3T5GA 5FOXA 5EC7A 2RGDA 2RF0A 2O2OA 5CIWA 3GJ8A 4GI7A 2XZOA 1KK1A 2DYBA 1XTKA 4LX0A 3TNFA 5JECA 5LDDC 3VKGA 1G7TA 1SVOA 4OHXA 1GUAA 2CT3A 2BM1A 3HU3A 3U60B 1SVKA 3TSOA 4GMDA 4KFRA 1RKBA 4BZPA 2WIAA 1NVWQ 1JEGA 3BBPA 1GVNB 3BIFA 2HCJB 3V00A 4DLXA 1K0XA 1AQUA 2W6JD 2GVDC 3SYNA 2EVRA 4KSBA 4JLKA 2Z43A 4QNMA 3BS4A 4HVUA 2C9YA 2QQEA 1L8QA 2VP5A 4JZKA 5CK5A 4EPWA 2ZREA 3FMFA 1Q1BA 4KRTA 2W6IA 2KGTA 4JVMA 4ERNA 1OXUA 2QE7D 4ON9A 1KSWA 1ZX6A 1CJMA 1GOTA 5F9FA 2QMOA 4NU0A 4YC7A 4HAWA 1MUZA 2QNRA 1E2KA 5SZIA 4OJQA 3L8YA 1D9ZA 2ZANA 2ZU0C 3VS7A 2BMFA 2RKOA 3RRYA 2HT6A 2CREA 4I99A 2CNWA 2BMJA 2GNOA 3F8TA 1XRJA 3MAAC 4Z8YA 5FFMA 2E9SA 5DI3A 3K1JA 4JKYA 2KRNA 1KY3A 4D8KA 1CEEA 4JJCA 2GCNA 2XOKA 1PRLC 1KHTA 2RHMA 4DUGA 2PCJA 3VS2A 1T5IA 1RE0A 2H5EA 2VO1A 4TSFD 3ZD7A 2IX3A 1R6BX 2ZRLA 2JLZA 1K0SA 1UEIA 4MRNA 3WHKA 2CE2X 1KDTA 1NBMA 1T91A 4L5BA 1ZM9A 1JECA 4V0LA 3SS8A 1SQ5A 2W6ID 3AM1A 4NONA 4BECA 4IIOA 2IS4A 3AF2A 1T3SA 1TPZA 2AK5A 2V1RA 2Z4RA 3UPUA 4C2UA 3KQNA 1F2UA 3RSLA 4YDSA 1UBCA 5AJXA 2LMJA 5DYIA 4AD8A 4C0SA 3PJRA 1M3AA 2XTMA 1KI7A 4WA7A 1ZD8A 4IVRA 2A5YB 1XMIA 1SPKA 2CNWD 4Q1AA 3UG6A 1T5LA 2DL7A 3IO3A 5L3QA 4JYCA 4E5UA 2FH5B 2XOKD 5FOUA 3A8TA 2G9NA 4DDTA 3LVQE 4DUGD 2CUDA 3K70C 3QXSA 2Q9CA 2P6NA 5HPYB 2FPKA 4C30A 1NBMD 2KBFA 2PZGA 3A1TA 1GL6A 2WWHA 3X1WA 4BUJA 4M1MA 3M0UA 3RWOA 1FMKA 1Z9ZA 4RTVA 3NHBA 2IYTA 5GADl 3MG9A 3VTKA 2OFWA 1N6PA 3WRXC 4X8LA 3THOA 1ZNXA 4NHOA 2YJTD 1I4DD 3J81k 1P72A 2OAQ1 3PXGA 2OZEA 3KJEA 2X8AA 1AEYA 2QUZA 4HDCA 3ASZA 1P9WA 3KZ1E 3GLHB 4FXPA 4XWAA 2BVNA 4QJ5A 4A15A 1DARA 5FPTA 2W0MA 2OEPA 2QTHA 5GJCA 1YNZA 1MT0A 3BH6A 1HH4A 2OXRA 1G83A 2RN8A 4JLVA 5IT5A 3VS4A 1F2TB 3UA7A 1G5RA 2GKSA 1XTSA 3B1XA 1KKMA 1TEVA 3GFTA 5CM9C 4JIMA 2ZE5A 5EXTA 3IDQA 2RQWA 4J9CA 4G0NA 2ED0A 3LH5A 3MWJA 2EYXA 3QOFA 4B3FX 4W5WA 2LCFA 2CUBA 4B3CA 3ND9A 4DEYA 2OCAA 3X1YA 1TQDA 1L4YA 3QJYA 4PSVA 1AZSC 3EX7C 2WAYA 1COWA 2OCBA 3L43A 4PQYA 4D80A 4DC9A 1HQCA 1Z8FA 3BB3A 3TE6A 2O5VA 3WRYC 3SQWA 4TYWA 1YZTA 4PPQA 2K7AA 1DBSA 1W5TA 2VF8A 3HPRA 3H41A 1IJFA 1E2EA 3LQRA 1G3QA 1G8GA 4IW3B 1NLFA 1TF5A 621PA 3RDPA 5E95A 1H8KA 3KJIA 5DN6A 2WM9B 1NRJB 4JT4A 4Z1MA 5BN3A 1OLOA 2EYUA 2PLFA 2FPEA 3UATA 2Z5FA 4A6PA 4AKIA 3WYFA 3IQLA 1J2JA 1T0JB 4QBIA 2X2EA 3ZD6A 1VG1A 4GOKA 3T5DA 1XTJA 1FUKA 3EARA 2H92A 1NVVR 3TLXA 4Z54A 2FSFA 4Y0AA 5CB8A 3T1QA 1XD8A 1R0ZA 1W36B 1RFLA 3BH0A 4WAUA 4U02A 2O8DB 4P0TA 2SEMA 1COWD 3PR1A 2A9KA 2LP5A 3SDZA 1GWNA 5LD2C 3NBZC 4Q4AB 4WVFA 2QAJA 1E2IA 4R71A 2XEXA 4TQUS 3O8CA 1SGWA 3EASA 1JQLB 2UVQA 4MGZR 3W8NA 3ZL7C 4LYHA 1B07A 1II8B 1TQ4A 1QLYA 1TNDA 1ZUIA 2V54A 4Z1MD 2IYUA 5DN6D 3U44A 3A4LA 4JKIA 1Z83A 4FCTA 1YRBA 2RHDA 3FYHA 1UTIA 4HDOB 3EA0A 4LYJA 2IYRA 3OF5A 1S1MA 2HBWA 2AR7A 4D25A 2D74A 2ASEA 2J45A 3NEYA 4B47A 2OBNA 3BK7A 2JJ2A 4ILEA 1L2TA 1OYWA 3U23A 5BWMA 1OFUX 3KB2A 5J40A 2JJ1A 4KODA 3EWAA 3UF4A 2C8VA 3QBTA 3THYA 2DILA 4MKHA 2ZRPA 1UHFA 5C4GB 3VU9A 5AJZA 2A2ZA 1AGRA 4PHFA 3DL0A 2YOGA 2ZI3A 4C9BA 3QXXA 2KWIA 1X8JA 2ORVA 5FTMA 4UNRA 1E2QA 2J6OA 3ECCA 2BMEA 2LNHB 1TQ6A 1Z5ZA 4LN2A 1X2KA 1G41A 1GRQA 2PEYA 1GBRA 1Z22A 4RTYA 2WTUA 3NWJA 1X6VA 4G5RA 3FMOB 4JJZA 4Q7MB 4AIIA 1GKUB 3W34A 2JJ2D 2L3PA 1IY1A 2D2EA 1IQPA 2A08A 1U0LA 4TWZA 1M30A 2G1JA 1N6HA 2IYQA 2JJ1D 2HLDA 4RKEA 2AHOA 4R2HA 2K3BA 4US2R 4X8HA 1SVIA 5KHOC 4M8NE 2YKGA 4D81A 1KO8A 2EW3A 1E7OA 4DEXA 1EK0A 3BOSA 4LGMA 5AR1A 2GNCA 1U81A 5FR2A 1ETUA 3RS3A 1ZU4A 3UKDA 3LWNA 2NGRA 1NG9A 2GQIA 1OIWA 1QVAA 4Q66C 1Z0KA 3TUIC 5J4KA 4JJBA 2MSEB 4QT7A 2X2FA 2M0YA 1OFTA 4N3NA 2AKKA 2PTKA 5GJVB 2BHRA 2CL0X 2Q3HA 3C0CA 2ZIAA 1BKDR 4Z8XA 4JZ3A 5E7MA 3U2QA 3U4QB 3K70B 2RGXA 2IEYA 1UHCA 2W2XA 1X43A 3BH7A 3QF7A 4O25A 4P3YA 4PC3A 4B73A 4BE7B 1E2FA 4BLTA 2KYBA 1WE2A 2OHFA 1MO6A 3Q5DA 2HLDD 1TQ2A 2XX3A 2ZROA 4Q7KA 3Q5EA 3VHXA 4DLTA 5GVSA 3K0CC 5JHHB 1O87A 1BYUA 1E4VA 2QN6A 4GZMA 2A78A 2JGNA 5DH9A 3IHWA 3G5UA 3OEEA 2RCNA 4PPFA 1PLLA 3QEJA 5IF9A 2ZRFA 4DWJA 3ZQJA 1JAHA 2NOAA 5JSZB 2J7PA 2YUOA 4D8DA 5M04A 1N6LA 1BO6A 3P1JA 4Q1FA 1CKAA 3CBQA 4DLWA 1RLPC 5L23A 5FI0B 1AN0A 3TAHA 5TARA 3WXMA 4PO8A 5JBQA 5B2ZA 2KT8A 2L0XA 5AUQA 2VSXA 1NVXQ 1RZ3A 3OIUA 4LV6A 4UNPA 5KYKA 2WWFA 2JAQA 3EZ6A 1WCV1 4Q02A 3VMFA 2P65A 2FPDA 3VS0A 1MO4A 3QXCA 4DLSA 1M2OB 5JWHA 2VL7A 1KAOA 1JALA 1E0JA 1JJVA 3H0FA 3R8CA 2FV8A 3GLGE 3OEED 2KROA 3LLMA 1G3IA 1TAGA 1GM5A 4QGAA 3VR1A 2V4ZA 2VHTA 4M9QA 3I92A 1YQTA 1K76A 2J7PD 2WOJA 3LVRE 1G7SA 4NYJQ 1NMZA 3VHLB 2VYFA 3S1AA 1W1FA 3A37A 4GSYA 4AKHA 2FPMA 2IUUA 1R0YA 2CLCX 4OBEA 3AVWA 3QVUA 1XZQA 5HZKA 1NY5A 3N5CA 1KTVA 3T1VA 4Y92A 2XXAB 3TRFA 1ZC3A 2ZSDA 3U3RA 3VR3A 1U06A 3LLUA 4PQRA 4OK6A 2VP6A 3RRMA 4LPSA 1P7CA 1J8YF 2PLRA 3KXKA 4M22A 3C5HA 3KFXA 1E3MA 1T8TA 5FUYA 3CRQA 4WOPA 4K81B 1Q1EA 4MKGA 3AV0B 2GZDA 1WYXA 3CO5A 2JLSA 3BB4A 3M1IA 4UJ5A 2OO7A 2OG2A 1J3TA 1C4OA 4AFQC 1T3HA 2FZ4A 1U9IC 1OV4A 2B7BA 3KL4A 2DHRA 3WMGA 1KIMA 2EFHB 3THWB 3LAWA 1LNZA 1SSHA 4AURA 4B32A 4EPXA 1UKYA 2QPTA 2EWVA 2IIMA 5ECAA 3MMPA 4Q4HA 3A4MA 3AVQA 4URUR 1E9RA 1FUUA 2ODEA 5IH2A 3GJ7A 3GLHA 3AEZA 1J70A 4BLOA 1IN6A 1AS3A 2HXYA 2QRNA 5LD2B 3LQQA 4A9AA 3KUCA 4JJKA 2QTVB 4J9IA 1N6RA 5FR1A 4FMCB 2EFGA 2AKLA 1W48A 1AZGB 1G8FA 1XCMA 3SHWA 3IKJA 4I4LA 4E03A 3EC1A 2BBSA 2YV5A 2ZXUA 1JU5C 2ZE7A 3GJ4A 2NUZA 4RD2A 4F16A 2FMXA 2I1QA 4RD3A 4X8OA 1S1CA 4K8OA 5CJ2A 5EP2A 4BASA 4QKQA 4PC7A 4G5SA 5E3HA 2EFEB 1Q3HA 2NQ2C 1PVOA 2D8HA 4QG7A 3WYAA 2IA5A 1FQJA 1W0KA 1ZIPA 2B8TA 3JVUA 1XCGB 3U3MA 1ZRHA 3GLGA 4QGHA 2HXSA 3LX8A 4HATA 5FBLB 5FPKA 2ZS9A 3LBNA 1KMQA 1Z6YA 1R8SA 3O8DA 1I2MA 3ZS9A 1NF3A 3EC2A 5CJPA 3EPJA 2RH5A 4P33A 4AY2A 2O31A 4LYAA 4MYHA 2C96A 5FTKA 2IUSA 3EPHA 1Z6XA 2CH4W 1CULC 1ZD1A 5DHFA 2NMVA 5EQTA 5KSPA 1T0JA 1QHXA 2FPLA 1EWRA 4HAVA 1KK0A 1H8EA 1S2MA 2F1JA 3GMTA 3NBXX 4GZLA 5HCNA 2EBPA 4OMQA 3FMPB 3RRZA 1FTNA 1WX6A 1PWTA 1PUJA 1W0KD 2G1KA 4KYUA 1RIFA 1KYIA 4HZUA 3NH6A 2O8DA 2PMKA 1ZYUA 2J0SA 3AGPA 3OZXA 4DB2A 2HJGA 2DFKB 4MYUA 4Q4AA 5C46F 1EG7A 1WQ1R 2CL7X 1TUDA 1DAEA 2A5GA 2YOHA 5F2EA 1SKYB 3TKLA 4GPTA 4LY6A 1II8A 1OXSC 3V4FA 2GWHA 3IBGA 4OHVA 1PKSA 3TVTA 1XMVA 1OPLA 1P5ZB 2LWIA 3A1VA 3PEVA 2OAWA 1M7HA 1UUEA 1IBRA 5E7JA 4II7A 5F3WB 5CLQA 3EZ7A 1NEGA 4DCSA 3CNNA 4HB3A 3ZVMA 2A36A 2XMFA 4N0EA 4NKRA 2QI9C 1GFDA 3PVLA 1H8ED 1XTIA 1A2KC 3CF2A 3L2OB 3REAB 1JEDA 1F2UB 3IGFA 2H8KA 3PENA 4IOJA 3PEYA 3KKOA 3W6OA 4A36A 2CCGA 1CKEA 2VF7A 2VVKA 3ZLJA 2JIZA 2UKDA 3B78A 4AG1C 4QOSA 4EPVA 4IIMA 1EFNA 2GXSA 5L3QB 4Q1EA 2ZJYA 2PT5A 4YMUA 2J5XA 4NTZA 2BMDA 4IDHA 1YZGA 2ANBA 2FFQA 2ODNA 3SNHA 2NO9A 1E4YA 2FWRA 2CE7A 3NBFA 1UJYA 5LPNA 5F98A 2NPIA 2QAGC 4KJZA 4P4UA 2GK6A 2P5SA 2ANCA 1M3BA 2PNIA 4LUDA 2ZYVX 5L3RA 1W4CA 1T0HA 2BEJA 2V8OA 2G0NA 4TT3A 4YMWA 3LA6A 1ZC4A 2JIZD 4HZIA 3KUDA 3KX2A 5IK2A 3W90A 3QPWA 1CJUC 4G5GA 4LI0A 2XJ9A 1FOEB 4ZIRA 4NPHA 4RTWA 4EFMA 2P5TB 2NO0A 4D4KA 2PBRA 2HYDA 5LB4A 5KSZA 5CYPA 2XITA 5JWRA 1F6BA 1LTQA 4J9BA 5KUTA 1CIPA 4MA4A 1JB1A 1SZPA 3OESA 1NJGA 3EHRA 2N46A 1KK2A 1WBBA 2CDTA 1HUQA 3U4QA 3BXZA 4HLDA 4ARZA 2GTPA 3C5CA 1PJRA 3GFPA 1O3YA 3WYGA 2FFHA 4WW0A 4QJ3A 2W0ZA 4PZYA 3ZQ6A 2F7SA 2Q3FA 3OAAA 4TT3D 1G3UA 2WJJA 4KHZA 5IK2D 2IT1A 5DISB 5BYKA 2ZRAA 2ZAOA 4HLQB 2ZI5A 1AS0A 2CT4A 3R9IA 4LC0A 3FWYA 1OH5A 5JSZA 1XJCA 2ZYWX 4FINA 5H70A 3U3OA 4B44A 3AP2A 2G77B 1ZM7A 1Z29A 2FFBA 2J41A 1RRGA 2CMKA 1YCSB 2BCJQ 1XD2A 3UANA 1UBEA 4LUEA 1OHHA 1AKYA 5CYOA 1P2TA 1A7JA 1UF9A 2AKYA 1CR4A 2J3EA 5KDDA 1J99A 1CRPA 1GRRA 2CJWB 3M0SA 3KQLA 4EKDA 3K70D 3F5FA 3B9PA 3I8XA 3DVLA 1XU4A 5SZKB 1E1RA 4KVAA 3PUZA 2VHJA 3OAAD 3B9QA 1X69A 5A0FA 1R2QA 4MQBA 4DKXA 5TXGA 4PFSA 2RQTA 4S35A 4RZ3A 3R7WB 1Q1ZA 5J47A 2C78A 1JPJA 1Z28A 4Z51A 3GP8A 4DXAA 4AKEA 4JL8A 1ZSGA 1S0UA 4GFDA 2LX7A 4B34A 4DCNA 4Q47A 2UZ3A 2OUKA 3ZS8A 2KBEA 3K0SA 1OKKA 1BK2A 4A6XA 1OHHD 3LNCA 2B21A 1QVRA 2EKHA 221PA 2D06A 1NN3A 2A5JA 2ERYA 2YZ2A 5A5GA 3AVTA 3B13B 3KXIA 1K5GA 3EA5A 1Z2AA 1ZNYA 2XGJA 1XOVA 3DZ8A 1IN8A 3CNLA 1YZNA 4UNNA 3BFXA 2JLXA 1E1RD 3IQXA 4D2IA 1W0JA 1UFFA 2REOA 2CEAA 1NIPA 3AQ4A 2K9GA 2FX3A 2QZ4A 3THYB 1ZVQA 1WMSA 3BGWA 3H86A 1CRQA 2AN9A 1E79A 3CM0A 1NL3A 2CDNA 3FGNA 4Q4JB 1RC8A 5EJEA 4TL7A 3B8HA 1VA7A 3EG5A 3THWA 2FE4A 3W6PA 5JCZA 1Z6GA 3ICEA 2QM7A 3GJ3A 3QPVA 4BFWA 4CEHA 4IXMA 1OKKD 2XNDA 4ZNXA 4TMXA 5JEDA 1BH2A 4C7OB 4Z89A 4CZ2A 2B8WA 1N5ZA 3NIBA 5BN4A 1A0NB 5JEEA 4XSGA 3VNVA 2O52A 5JLJA 2IS6A 2RB4A 1R0WA 3CKLA 1UBGA 5FPSA 3Q7PA 4OI2A 4LRWA 2ZM5A 4RUGA 2OAP1 3CRVA 3KDSE 4QC2A 1RRFA 1W0JD 4RD4A 3UG7A 4IXNA 2AZVA 1WXQA 4PZZA 1G8HA 3OIVA 5TVKA 3RNLA 2HEIA 4QRHA 3A4NA 4HAUA 2J6KA 3R9XA 1E79D 1HTWA 1RW4A 2WZQA 4NMMA 3AVOA 3T15A 3ND8A 2GZHA 2FO0A 4AFSC 1SEMA 2Q21A 2JLQA 3M0TA 1IONA 1G4UR 1VKJA 1VDZA 4BFZA 3M0PA 1OSNA 3WY9A 5KPJA 3RC8A 4PANA 1R8QA 1R7RA 1UM8A 2OI3A 4JL6A 2XNDD 1XJQA 1RVDA 1OXTA 1UDXA 1OPKA 3ZGXA 4LHWA 3WMEA 4KSCA 4YLGA 3SE0A 2F1RA 4C0QC 3GFOA 3G82C 2AD1A 2R62A 2RAPA 1P2SA 3I35A 4JVLA 1ZM2A 4HSEA 1HE1C 2H1LA 1C9KA 5EP3A 1ARKA 4PSAA 2HDNB 3TIFA 2QAGB 1G21E 1GTVA 1IHUA 4IHQA 3R9WA 4XD7A 4EPTA 1ZCBA 2CSQA 4D4JA 4GLMA 3LW7A 4KI0A 1XD9A 4BWYA 1Q44A 2VP2A 3EZFA 4IDPA 5SZHB 1P4SA 1N0UA 3AF4A 4IDNA 421PA 1ZJ6A 2WJHA 2ZJ2A 3WMFA 1MOZA 4KBGA 1HE8B 4MH0R 3JV3A 3BORA 2GILA 1DAFA 2DWOA 2ZR9A 3CPJB 1XCPA 2J06A 2G3YA 2GAAA 2GBLC 2ZITA 4KXFB 5EP4A 3TAUA 1KSHA 3SOPA 1VG9B 3ADCA 5C4MA 4US1R 3SU8A 3EG0A 1YKSA 4BLSA 2CHVA 4E6RA 1DELA 1TF2A 2OCPA 4JLNA 3KKMA 4GMXA 4MGIR 2CLSA 2VWFA 3I3SR 4KFSA 3IHLA 4F92B 4HEJA 1SRMA 3D31A 4PC2A 4XD7D 1IN4A 2EQIA 1KI9A 2FPFA 1A5TA 2CLDX 1W7AA 2Z6VA 4QM6A 2ATXA 4WXPA 3SZRA 3NXSA 4FMDB 3VAAA 2CH4A 2FEOA 1Z0DA 1JR3E 4NZYA 1M3CA 5J4VA 3S1AB 4RD6A 1N6KA 3K0CA 1G5TA 1G5PA 3CX8A 4OQXA 2JMCA 4L9SA 4XTRA 4B35A 2IXFA 2ZRJA 2HDAA 1W49A 3AF0A 4BZXA 1FPMA 2QENA 1TF7A 4YMTA 4MYTA 3AKDA 2IEZA 1TUCA 2ZE6A 4HCKA 5FBWB 2KRMA 2BJVA 2GCOB 3IPYA 3B85A 4TZ0A 1RJ9B 3GLIE 1N0WA 4MGYR 5AWFC 4NYIR 5HR5A 3U7GA 1X1SA 1WB9A 2IS1A 2PX3A 1IXSB 4B33A 1QKXA 1F60A 3SHFA 4ZI2A 4JL5A 1V1CA 2KJQA 2GETA 4RZXA 3QG5A 4B75A 4URXR 1UBFA 2PZFA 1B0UA 4YMVA 1GL5A 4Q4HB 5D3MB 4F4CA 1OPXA 3WBJA 1RRCA 2OILA 3CF6R 3CNOA 1OF1A 2O0KA 1NIJA 3DHWC 4ZKEA 3VX4A 1XTQA 2GXQA 1NY6A 2FZLA 1U94A 1VIYA 2YWHA 3I72A 4EPRA 3ZZTA 2OT3B 4KVGA 2H8HA 1CR0A 2ZSEA 1X1RA 4DSTA 1M74A 2H16A 2JATA 2ZR7A 3P26A 5EZ6B 2QM8A 3IPXA 3QXHA 5JJIA 4AKGA 4YMSA 4IFEA 3VNUA 1GCQC 4URVR 1KZ7B 2AXNA 1RYFA 3D7MA 4B3GA 3QWYA 1T9HA 2BKUA 1EFTA 3FTQA 1MV3A 4RTXA 5IXFA 5K8UA 1R5OA 1SRLA 3GLFE 2KEAA 2Z4SA 5EP1A 2YVUA 4AG6A 2IF0A 1OH8A 1P61B 2Q6TA 1H8HA 4AYWA 3ICQB 4BQSA 1DTSA 2ECKA 1Z08A 2WJVA 4M1WA 5AK0A 4LJYA 3GLGB 1U9IA 3OIWA 2DNUA 3BFKA 3AB3A 1MRNA 2F43A 3LFUA 5FOSA 3UWKA 4WBSA 3QI2A 2MMGA 1CLUA 3PEUA 1UECA 1JR3A 3MWKA 1W1WA 4M9XA 1OW3B 1GITA 3K9GA 3SBDA 4RVCA 1QHGA 2V1XA 4M1YA 3B60A 1AGPA 2CCKA 4CT5A 4Y0VA 2RQRA 2ORWA 2FG5A 2ZYUX 1II0A 2CJWA 3GJ6A 1Z0FA 2CHGA 2AX4A 2RMOA 4G3XA 3WP0A 4LV8B 2AZSA 2ZRMA 2IWRA 1LCKA 1S9HA 1VCIA 4DLZA 2IS2A 1QHNA 5H1YA 1ZUKA
chains in the Genus database with same CATH superfamily
1A95A 1N0IA 3IAS6 1ZN2A 1XPUA 4CC7A 1A9YA 4RADA 4K0KB 4AJJA 1EX1A 3RMQA 4ZZIA 2Q4TA 2FB7A 2DY1A 1GQ2A 3QKRB 2RBGA 2I91A 1DOAA 4BJ6A 3BIWA 1I94B 2LVMA 2J08A 2L69A 2PZKA 3HWSA 4GQAA 4JZYA 2XMGA 1GFWA 2VTEA 3D4NA 1CQIA 1IHXA 4Y1RB 1ISHA 4JC0A 4UVDA 3CCEA 4YUZA 3IUPA 5I9TA 2ECOA 1XC7A 3PNVA 4U5XA 2Z3WA 4JI5B 3JWIA 2P6PA 4HB4A 1B8UA 1RWQA 3GJRA 4DJDC 3G9UA 4IJMA 2J46A 1G8PA 4NL2A 4GIBA 5G0VA 3K9FC 3PUJA 4EY7A 4YLYA 1VQLT 4GLLA 4WLUA 4I3HA 5FX2A 3JAKB 2V3VA 4CG3A 2HJ9A 3HZRA 3L7JA 4D3FA 2RK3A 5CEEA 3CRW1 4XCXA 3ZI0A 1J39A 1D1TA 5DIFA 1L1RA 2O2CA 4KNYA 3PPIA 5GAN3 3G0HA 3BD9A 1CUUA 3ANMA 4FHGA 5DOVA 1XYVA 1OBCA 1EVIA 2PWZA 2YY5A 3SK0A 1CY7A 3CEHA 1AXGA 1ONBA 1YA6A 3Q8XB 5TQ0A 3CEJA 1L4UA 2GT1A 1KOFA 4IVPA 5JS7A 1NVVQ 4TLLB 3DUFB 4M75F 1X7ZA 1O1YA 2Y1XA 1UE9A 3CCUQ 1D6SA 3A7EA 2IIQA 4G1CA 1ZAKA 2JM8A 1DKLA 4M7PA 1QP7A 3UJ7A 1Y4SA 3IB6A 2C5GA 1PR0A 4EW1A 1K8AU 2VDJA 5AI0A 1AKRA 1DPFA 3UZUA 2RGNC 4G65A 3ZQ4A 3VR5D 1CERA 2OHOA 2Z09A 2AN4A 4KRXA 4XSHA 1W6XA 5A3QA 4JYBA 3MOSA 2MSWA 3KJFA 2I7DA 3UJBA 5CMLA 4X0EA 2RHZA 4CDRA 1CD5A 2K2MA 4ER3A 5FUWA 4BZQA 3ZCRA 3RYCB 1EJ2A 2B92A 4C21A 3DOHA 2ISQA 3WWOA 3UWPA 3KQKA 2Z04A 3PL1A 1L4HA 3D8BA 2XICA 3NC1C 4OKNA 4Q82A 4FJ2A 4Q7LA 1T8PA 4CPDA 4MICA 5C81A 2ERXA 3IAHA 2EARA 4PRYA 4L57A 5EKXA 4ZVPA 1Y1LA 3LGFA 1NASA 4YDHB 2C9OA 1MXFA 1D2NA 1RLQC 2WUEA 2W8ZA 3EXHB 4AT1A 5CGQB 4P4LA 5DYNA 3CRZA 4EA8A 1PJSA 4AG3A 3CCLA 2JT4A 3MJSA 2Y0DA 1OYXA 1TADA 5A6SB 4XIIA 2UYQA 4UCFA 3ZGZA 4XGNA 4OOFA 1N7IA 1OJ7A 1EQAA 3H9GA 3HP4A 1YMVA 3W6NA 4R0VA 3CQTA 1E7QA 3AUXA 5LJ3e 3OCWA 5JY1A 4A0RA 1LWOA 3PUYA 5IT9E 2A57A 3CCQQ 3HJNA 3A2KA 1C1YA 1V5GA 4NS1A 1CZKA 2AEFA 2ZULA 3GJXC 2VC8A 3P45A 4HB0A 3UT5B 4M9ZA 4JEHA 1T25A 1BBZA 1TGYA 3H2IA 5KVAA 1A76A 1PZHA 4ZCIA 1NT2A 4FYYA 5BNIA 1U3CA 4R51A 3RHSA 1AWJA 2Q62A 2VGNA 4IJQA 5LJ5j 4JBXA 2PUFA 4JUIA 1W9HA 1JG2A 3EG2A 3QELB 1N8SA 2OHIA 3QF4B 2YH2A 4G9GA 3AJAA 1A9XA 1C7FA 3JVVA 4LE2A 5JJCA 3FZGA 1XR3A 2PXXA 2BM0A 2VUIB 4P5DA 2EW1A 1DX9A 2XCLA 1L5RA 1UT5A 3WWEA 3W4IA 3EPKA 4JEIA 4MGKR 3PC8A 2LV8A 3GU3A 1AK2A 2YVKA 5IJ9A 4IXTA 5LJ3f 2QI2A 5CQXA 4JJIA 2YZGA 3PK0A 1YHQQ 2OKGA 2YINC 1EFDN 3PQ2A 2XAAA 3RRFA 5C18A 3K94A 4BRUA 4PWZA 5BSVA 4C7BA 1YZYA 2XDDA 1GFSA 4TSFA 2O0HA 3KSUA 3WGLA 5CVJA 2BISA 3GJ0A 2RA2A 3DS8A 3LX4A 1JIJA 1IUPA 3MFYA 3BCUA 4WJZA 3CUSA 2X7XA 3M4ZA 1QIEA 1R0CA 1ZL2A 3EXIB 3EAQA 1GADO 1IYZA 4C4OA 2V8BA 4AP6A 3OPNA 2WSSD 3USES 1OAAA 2NYSA 4WSOA 1NXOA 1RQPA 3RFXA 2ZAMA 3ZLUA 4V2UA 4F3TA 1T0IA 1Y3DE 3X1ZA 3EG9B 1VIDA 4YFYA 1HDIA 5KOYA 2JZNA 3JAWB 4KQMA 1W2BS 4OYYA 4A2PA 1LBIA 4HFNA 3MUFA 4TL6A 2VZLA 1I6KA 4R8VA 3MF4A 4RTLA 3Q7QA 4JVNA 2HW8A 3T34A 1TYAE 5COAA 1E1CA 3M57A 3IA7A 2GN8A 3SFTA 3VJRA 3FWKA 3FFBA 5ELLA 4LHVA 1Y57A 1V8BA 1GLNA 5KQPA 1AJEA 1WKVA 3AM3A 4J9EA 2PS1A 5ED0A 1S2DA 1C9JA 1Y9DA 5K0FA 1YI2Q 1XXHA 1RIIA 3TBFA 4O0LA 4D4IA 3OMGA 3PHCA 2XF8A 4CQLA 3G1WA 3G2HA 3REGA 5HKAA 2D3WA 1AKWA 4RM3A 1E3TA 2I66A 1VJ0A 3F5DA 3OHPA 4EG4A 3D2LA 1T9GR 4A5OA 3I04M 1OLXA 1YE8A 4LJSA 3VI4B 3CLHA 3QKIA 4AT1B 1UP6A 3DMHA 5B4UA 4L4ZA 3GCDA 2G28A 1ULBA 4H4EA 1D2EA 1O0CA 1VSUA 2O07A 2DTHA 2FUCA 5JD6A 3OC0A 2I80A 5BRAA 2J8ZA 5K5EA 3WL4A 2WAXA 4GPBA 5G0TA 3HZZA 1H4VB 2DXBA 2PUWA 2YUIA 3C7CB 1Y3IA 4TYYA 3Q0IA 3VKVA 3A6KA 1CIVA 3N0RA 1UGQB 1BE1A 4KH1A 5B58C 3WWYA 5B30A 4C92G 4IUVA 2X1MA 3KJQA 3VDMA 1XMPA 4OB0B 2A28A 4CNBA 2WACA 3HJGA 5K3AA 2CV2A 3TKAA 5CDFA 4X1IA 3H9UA 4ZQCB 4IFIA 3FNRA 5G0SA 3NHUA 3LUJA 1S2IA 5F5LA 3O83A 4E14A 1ISFA 3TW6A 1E8MA 1RJWA 2UZIR 4KACA 3ZDXB 3ID6C 1KNXA 3ZFJA 3TLGA 2DBYA 1K7FB 4OLJA 4DV0B 5JSQA 4DBHA 2BBOA 1RLJA 1F2TA 1FS6A 4Z2YA 1NUSA 2GN2A 5IJZA 5E9AA 3S68A 4LDJA 3VPAA 2WIKA 2COZA 4BNNA 1FZQA 1VRWA 2Q8PA 4GNKA 1P0IA 4UEQA 3ZHTA 3WK8A 4XGRA 4J8OA 5KAPA 4NIMA 2QUKA 1TU0A 4RFVA 1Q81U 1EUYA 2YMQA 4AU1A 1GNQA 3R0QA 2P6OA 2BONA 3C8MA 2B1JA 2B3DA 2Y1WA 2IIPA 5HZGA 1R0CB 3D59A 4M76B 4JNCA 2HA0A 3H1EA 3LHIA 4G1VA 3W2GA 2VPXA 2EJWA 2QRJA 3CCVQ 3LI2A 3HYCA 3VR2D 3AY7A 2VSQA 5HKKD 3T7CA 1AA6A 3DM5A 3IL2A 1F0NA 1NT4A 1DEKA 4FR5A 3SX2A 1ZOSA 1KU6A 4D8WA 1UFOA 3B7PA 1Q84A 1Q6YA 3UPTA 4QNRA 1MR3F 2IBSA 3MELA 2HI0A 2R84A 4KEAA 2Z56A 2AE2A 4NQRA 5AXDA 3PXCX 1KVQA 4M55A 2XMSA 4FYJA 2EHJA 1LJUA 4HAZA 1I1JA 4M54A 4E4TA 1EUCA 1F48A 3JCMc 3A1FA 4P4SA 4U1RA 1F1BB 3BXHA 3NBUA 1X9IA 1JFRA 1G20B 1KXZA 4JU8A 2JVJA 1CQWA 4DA7A 5EVJA 4HNVA 3DZGA 4PX3A 3O0TA 3CONA 5T67A 1XXHB 4MVJM 3Q8MA 4YYZA 3U3ZA 1ZVMA 1GHTA 2EGGA 4X44A 3S1LA 1M7GA 3W3ZB 1LF0A 4TWBA 1I36A 1E5XA 3ESCA 1SJ9A 4U63A 2D1YA 1VIAA 4QTTB 1M1KC 2P35A 4J9HA 3L4JA 3C12A 4KIUA 1SHJA 3MPUB 1CUBA 1D9XA 4U6NA 2QM0A 3FIFA 3MUOA 3HC7A 3I01A 4OG2A 3W7AA 4OA5A 1UPAA 1RS0A 2FA9A 1NHGA 3CF4G 3KT8A 4X7BA 4PGAA 1SHKA 1NVTA 2NTNA 4NARA 5DXAA 2JPDA 3I37X 4BCDA 1QDEA 3BEOA 1MVNA 1Q86U 2O3TA 3HLKA 2GKOA 1Y89A 2DYBA 4HVTA 4J0CA 4YUVA 2XB6A 4WFIA 2GK3A 3K32A 4HVUA 3GUZA 3K5IA 2JHFA 4WLVA 2VDWA 5DM60 3T4XA 1E2KA 4DLPA 4GVLA 2Q1WA 3OBIA 3MAAC 3WXMB 5DI3A 1L5NA 4JKYA 3LSTA 4KH1B 2V8JA 3JTEA 1KHTA 3R3UA 1K9MR 1Y5RA 4L02A 1Z7YA 1IN1A 4GOMD 4LE0A 2V3WA 2IS4A 5IG2A 1TPZA 3H83A 3CD6Q 3HVUA 3DL7A 1MX1A 1R16A 3Q1KA 2FH5B 5DCYA 1K5HA 1F51E 2B1RA 2P6NA 2CP5A 2FPKA 5AW9A 2PZGA 2R66A 1NXSA 3WGUA 3CO0S 4DUYB 2YN4A 3Q7RA 2VT6A 3G2NA 2IZOA 2Z6QA 2YJTD 3J81k 3LX7A 1EAYA 3BDVA 1B6TA 4E5NA 1F2TB 2UU9B 3DEYX 3VOAA 2YZMA 2LIPA 5FEMA 4CIBA 4ZT2A 1COWA 4QDXA 1QO7A 1JFFA 3HHPA 4QWWA 1CDDA 3MGGA 4WESB 3H5NA 2GQVA 4MDXA 3GNSA 3KE9A 3IT0A 1N77A 3IRUA 2RGRA 4Y7DA 4RLHA 3H2ZA 2CXRA 3K9WA 4Q4AB 4M7DC 3A14A 3AILA 1YRBA 1UTIA 5L3ZA 2EOAA 2IYRA 3UO8B 1DHRA 1QYIA 4GKJB 2OOKA 3OBYA 5D7UA 4ER5A 3U7JA 2QRKA 3UFXA 1Z82A 1SXQA 2UZAA 3DL0A 2YOGA 2ZI3A 3PLRA 2RCYA 5DHQA 1TQ6A 3A31A 4JR2A 1U3GA 3F6EX 3FMOB 3N3AC 5FLXA 1XDWA 2L3PA 1KGSA 1ZI6A 2G1JA 1JJ2A 2Y0PA 1YIAA 3OQVA 5JNWA 3A6DA 1YL5A 2BHRA 1TC2A 5LQAA 4F2GA 2JA2A 3BE8A 3EZYA 4PBSA 4Q7KA 2O0MA 1QHFA 4BI4A 2C5FA 2A78A 4ZQIA 2BZSA 1FTGA 1LNXA 1TCVA 1VLQA 4U3JA 1DWPA 3GG2A 4FP9A 1UQTA 1AGNA 3BMQB 5ICSA 1NVXQ 2J07A 1I3MA 3QXCA 5JXHA 5EHNA 3UV7A 3EXEA 2FV8A 4UEWA 3OEED 1TAGA 2I9PA 1YQTA 1VZ2A 4BO3A 3E5MA 4Y2PA 4KGVA 2IHJA 3N5CA 3PVZA 2VNAA 2HCTA 4PQRA 4XU3A 2EV9A 5EIHA 2ZZNA 2C4KA 1GQOA 1K3TA 2OO7A 3QV2A 4DUZB 4W1SA 2FZ4A 3KKLA 3HZHA 2DHRA 3HNRA 3I55T 2VCYA 3R6GA 3HO1A 1XT6A 3WGMA 1V1JA 5LZ9A 2TECE 2Q41A 4RQAA 4CQMA 2FJ0A 2PZJA 4J9IA 1XJWA 4TLMB 1QS0A 3CMEQ 1YCHA 1Z45A 4G36A 1XCMA 1EA7A 3R9XB 4X8OA 5A3VA 3IBCA 3KO8A 4YRGA 2JHGA 2NQ2C 3WYAA 1ZRHA 1SQ6A 3D3JA 3GLGA 3P19A 1GPBA 5GAN5 3O8DA 4WINA 3V8JA 2RH5A 4D3DA 3D1LA 5LQCA 1FLAA 2GTHA 5EQTA 3DVQX 4ZOBA 2IEIA 1USKA 2VDWB 4TWIA 1WHMA 2AUMA 1GQRA 3AWIA 2CBGA 3DG9A 4DB2A 1QCNA 1GN9A 3B3GA 1DAEA 3VOTA 4DR6B 4KUHA 3TVTA 3L4BC 3CNNA 3M4JA 1GFDA 2XMCA 4DJJA 1WNTA 1WXEA 3IOYA 3OY7A 1S7CA 2RJFA 1EFNA 4Q1EA 3VBCA 3TNJA 4JQOA 1WHSA 4BMDA 1YNOA 5K99A 1CYEA 2FMTA 3JCMg 2TSYB 3NM4A 4BNDA 1WAMA 2QN3A 2XGMA 3OF3A 1FOEB 2YVQA 1NTRA 2HYDA 2DT8A 1QVPA 2CNDA 3EHRA 1WSBA 2Z9DA 4M77C 4Q3KA 3C5CA 1CZNA 5JYCA 5LZ2A 4BNKA 3ZBQA 2WJJA 2IT1A 1DV2A 2E2WA 4XCQA 1JFFB 3EE6A 2ZYGA 1OH5A 2ZYWX 3REQB 3PDIA 5HUQA 3AP2A 3DV2A 2J41A 3ZV3A 3PI6A 2WZBA 4L5JA 1O94A 5MN5A 2PO5A 1MJHA 2J5KA 3J81E 3H9NA 4OYLA 4OGWA 1Z7GA 2AYZA 1BJTA 5ALWA 1ES9A 2B8JA 1ZD2P 2K87A 4QYTA 1QBGA 2WD7B 2ERYA 1HNWB 1I6LA 5IN1A 3RPEA 2AV6A 2FPIA 3LUHA 2K9GA 2XTJA 1QVWA 2IHKA 5ICFA 1JDNA 4MIOA 3ZW9A 3QPVA 4REQB 4DIMA 1L5GB 4L74A 4PAWA 5HF9A 3KQWA 3SQMA 4B7XA 1CRWG 1MPTA 3Q7PA 4FFLA 3CKKA 5GMKe 3TLKA 1E79D 1EBUA 1JLMA 1WVMA 2GZHA 2IPMA 3RJZA 2W6QA 2BF7A 4DS3A 3PDWA 3IH5A 4RLFA 3JASA 3I35A 1ZM2A 3V8VA 4AUNA 4JI0B 2F4VB 5L7TA 3TIFA 3I56T 2B78A 1ZCBA 3JCMh 4BWYA 3ZHBA 1N2GA 4NBRA 5A04A 421PA 3CG4A 4U3JB 2XBLA 2ZSHA 4KXFB 5C4MA 4US1R 5ENVA 1CUDA 4YTEA 1EDBA 2J4CA 3MT7A 4AY6A 3R3WA 2B9VA 3EUFA 2FEOA 1ZSYA 1A9PA 4KGVB 4B4DA 3JWPA 5JR3A 2ZPEB 2JJYA 3GIBA 4M36A 5KNDH 4EDUA 4HDKB 3HY6A 1MC1A 1GPLA 2M1HA 2REQA 3T4PA 1DC7A 2WE8A 1X1SA 5CVTA 2GMWA 1F60A 2FPSA 2EL7A 3QG5A 3V32A 4EMTA 2B0CA 2HSGA 1VZ3A 2GHQA 5CM2Z 4FHZA 3CPFA 4RZSA 1M74A 3Q7EA 3P26A 2XB8A 1GCQC 3X2EA 3FTQA 2H9YA 5EMLA 3UT6A 2YVUA 4H1WA 2XG8D 4I2VA 3MPOA 1KZ1A 3GLGB 1CLUA 1HYEA 5B53A 2L3RA 1QHGA 2ZB4A 3VPSA 2XBMA 1XKTA 1YB4A 1UPBA 2BF4A 2C00A 5HS4A 1I9CA 3JVIA 1VCIA 4OLHA 2XUOA 1L1FA 1ULUA 1P1CA 2PT7A 3FPEA 3C6XA 4FD3A 4DRXA 3KP1A 3NVKI 1P9RA 5KCOA 1V1RB 3DQPA 1X9HA 4XLTA 3LKVA 1JPNA 4D82A 3U5ZB 2ZB2A 1XAJA 2DPXA 2D5BA 1R8YA 4Q4JA 3VZPA 2OSBA 2XCRB 1W59A 1M34B 2PLWA 3TTTA 1R37A 1NM7A 5DLQE 1U3FA 1SXJE 4B7CA 2ZSKA 4LHSA 2IP2A 1QRAA 2KXDA 2P3QA 3CC7T 2D13A 5DE3A 5JNRA 4TLAA 2C29D 1C3EA 5KCZA 4BNDB 3R4CA 4NCIA 4XTWA 1BIAA 4JBGA 3B12A 1W2BP 2JZ2A 3MS7A 1Q1NA 4QUKA 3UQZA 3H4IA 5CKFA 5C0OE 3F97A 1SHFA 1B41A 521PA 1VE5A 2FMFA 3IAM1 3PNYA 5KS2A 3PXBA 1FP4B 3O8QB 2VK2A 4BPRA 3EIWA 4YRBA 2ZGVA 1FP6A 4ZD6A 5HJ2A 2C2BA 3SI7A 3CPWS 5KDOA 4EW2A 2G17A 1TTQB 1WJQA 4RPHA 1T3TA 1M1UA 4P35A 1OI7A 4BN4A 4XVQA 4L6CA 1RJGA 4L28A 3WHLA 2P2CA 4RL4A 1JBKA 4FN5A 4FFOA 4JSYA 2JJMA 4BFXA 1V5EA 3L6OO 1ZUD1 3R3HA 2BI8A 1D7OA 2FPIB 3FSEA 3C6BA 2H1SA 1Z68A 5DF1A 2NU8A 3LKZA 2C7GA 4OSEA 1NVEA 4PQFA 3KYCA 4FS8A 3TGWA 1K7EB 3U1BA 1V5WA 2YUQA 4CUJA 3MCWA 4ZDWA 1EYZA 1VQ4T 2GZMA 2JXBA 1GPAA 4NCXA 4GD3Q 4PNZA 1ECBA 4C4XA 4J1TA 3H3FA 5U1PA 5CX4A 2BSAA 3M59A 1E94E 1F8XA 1LVHA 4JJNK 3BJIC 5G3YA 1YP5A 5CFPA 3D0RA 2J9RA 3MXTA 2ZPGB 2YYZA 2VHQA 2XCTB 3WLEA 1SVSA 1KHCA 1R27A 4V0ME 3HJHA 3GNGA 1ZUNA 5K3OA 5JLAA 4DREA 4DCPA 2X0DA 1AS2A 1WMAA 2ZWIA 2JRCA 3NBYC 3VAZA 2BFOA 5TGZA 5JJBA 3OZBA 4JJDA 1LZKA 4EABA 1QIIA 4KMRA 1QF6A 1JHXA 5ALVA 4HT8A 5C80A 1NV8A 2CD9A 4CU2A 4KN8A 3MEAA 4BCBA 5K6TA 3A4IA 2I6UA 4ZXFA 3CVJA 4HQFA 4P32A 2I0NA 2RC5A 5K2OA 2PVPA 4I9FA 2A0KA 4YP1A 4HS9A 3RNOA 1JHUA 4AS2A 4R1QA 3UUGA 1YV9A 5A06A 4TTRA 4ZOQI 3GGPA 4FW8A 3QLVA 4PZCA 1ZIYA 5FB3A 1QR6A 4DLLA 4MI3A 5TRTA 5F4BA 2DH5A 1C3LA 1ZM4A 1WP9A 3I30X 3USZA 4CI0C 4NJEA 2JFYA 3JB9G 1XEXA 4KMOA 2D3TA 3MOIA 1H3HA 1ESCA 1R3DA 3NOOA 4AMBA 4F0JA 2YN0A 1AQ6A 5DY9A 2W6PA 4LHYA 3MCAB 4R0NA 4DRXB 2O7RA 3EQ2A 1EB8A 1LRKA 1QG6A 2YYYA 4HLUC 5EFOA 5A9SB 1T2CA 3KHKA 4GW3A 3O5ZA 2OX7A 2IW3A 2KYMA 3H5AA 2D0QB 2LRQA 1NE7A 2MYNA 1VQ8T 2P9EA 2ZB3A 1RJDA 1I30A 4UVEA 2QDLA 2REBA 2YL2A 4HRAA 4YRTA 3ZHCA 4XTVA 3BF7A 2IPOB 3PJGA 4JS0A 3MGBA 4UM9D 4CN9A 3Q3EA 3I1YA 1X42A 5LCXA 1ZGGA 4RV5A 3INGA 4W8GA 1K8ZB 3I52A 3A1SA 1PJAA 3EVBA 5D1HA 5ESDA 4IS3A 3A27A 3I2JA 3RG2A 3O82A 4PNHA 2AEJA 3FPHA 5ALUA 3SN6A 1ATZA 1XRLA 3AESB 2E1RA 5IRCD 4HCCA 2IIVA 2IYEA 4FEYA 1NI4A 1MOPA 2MCNA 2H1WA 1I4TD 4QUAA 3WNCA 3IAAA 2AUNA 3E53A 1I33A 3NEPX 2W2PA 3KZOA 1VYHA 1IN5A 2YNMA 2FMUA 1VKRA 3FLEA 5FFFA 2E0IA 2Q3LA 1OZAA 2Z57A 3WAKA 2EP5A 2AA3A 4RYDA 4DDVA 2VLIA 2YIMA 4Q1DA 2YHIB 1K2VN 3RSCA 3OHSX 3FRJA 1IAQA 2ZJ5A 1LF5A 5GJVC 3KB8A 2R7LA 2IJGX 1U7XA 3QOXA 2EGHA 2O2GA 2PZEA 1L9KA 3TB4A 1PR6A 4H16A 1U0SY 2DFDA 4UUQA 2KB0A 3OZGA 4EVQA 4KPEC 3UJCA 3CC4A 1KKUA 2WKPA 4ZDKA 2HA2A 3U7FB 3DMYA 2VK4A 4B3JA 1T13A 2F8SA 3ZZ0A 5ETJA 3JW8A 4E51A 1CE8A 1H4SA 5HWSA 1EVYA 5LR6A 2V98A 5JUWA 4Q4LA 2DTIA 4XH9B 5FQOA 3NTVA 1QW1A 3SMVA 3AW9A 3IV6A 5A0LA 5CT9A 3DEJA 4KXVA 4DSZA 4F11A 1NR1A 4P3OA 5CBPA 2OQIA 3HZOA 3OLXA 3MJRA 5EKUA 2JFWA 1W9MA 3ZY4A 3TMKA 1TRKA 1MABA 1U1GA 1K8RA 3DZJA 1AO0A 5AHKA 2BEVA 2Y0CA 4C4PA 1BFDA 1ZOIA 1C9DB 4YCCA 4PLIA 1EHYA 4GQBA 1LI5A 3TW0A 2HRDA 1Y4UA 4Q1VA 1DCKA 2IDMA 3WL6A 1THTA 2VZ8A 5LJ5d 3A6HA 4K1LA 2PS0A 4TV8B 3W6UA 1VYUA 1DDOA 3FUWA 1ZY2A 4IFBA 2HPVA 4TL9A 2E4YA 2HA5A 4DOWA 2GD2A 1I5EA 3A36A 4GLBA 1WXIA 2O8NA 3PJEA 3OFND 5KNDA 5KTPA 3WNDA 4NJEB 2RI0A 2AJBA 3UUEA 3ANTA 1YU9A 3F74A 2P9FA 4MVJG 1Z62A 1N8NA 3HR8A 1U3OA 4R1TA 1CJKC 2GPBA 1GKLA 2JH8A 3PUHA 2XYVA 1U0TA 1OCEA 4ASUD 3G23A 3UJHA 1XMXA 3Q3GE 1H23A 1EESA 1ZDMA 4RSRA 4M77D 1JUDA 1QJCA 2OCGA 5ES3A 2DJQA 4X7PA 4IMPA 3BGVA 4NV3A 5FJJA 4WK2B 3P9NA 3VUFA 4MTCA 5KNCA 2QX4A 2I7XA 3B1JA 4MWGA 3ZIAD 4IILA 4YP7A 2GQ0A 4PR0A 4X7RA 1QWSA 1R64A 1FS5A 2HMAA 1Z8HA 1TYCA 5IBCA 3IOBA 3L7BA 2P7HA 2ORED 4WJLA 3BD7A 4YRLA 2RJ3A 4UZEA 1YGPA 2Z30A 2XUQA 3B1ZA 3HUTA 2NXCA 4N7RA 3SXUA 2EFDB 2W6NA 1MKYA 3OZRA 5TQJA 3KEQA 2ZT5A 3JY6A 2K7FA 1P7VA 2YV1A 2CP3A 2AXEA 4P3KA 1S8FA 4YUXA 2Z6UA 3EWIA 5K3BA 2QUBA 4D8VA 4HMQA 4L7VA 2JKYA 4AYTA 1K5DA 5HHTA 3BFPA 4UULA 1M2JA 2WPDD 2MYSA 1KA9H 4LCEA 5IDQA 1JPUA 3ZTTA 3C8UA 4UBLA 1CJTC 1A4RA 1W36D 1E96A 1YZQA 4IEIA 3RS9A 3CLTD 5IXSA 4BO1A 5DLOA 3K2BA 1IM2A 3ZDRA 3PKZA 1BCRB 4M1TA 1NGSA 5MDHA 1OLSA 5CLGA 4PONA 4QRDA 4M0UA 5AIAA 2CMFA 1GZDA 4PGHA 4D43A 1RI2A 2ICAA 2D0PB 1M66A 4RHYA 5KREA 2RM4A 3UFBA 2X8WA 2E5WA 3W8DA 3GAAA 3T3EA 1J06A 4GG1A 4BNFA 3LX5A 1CE8B 4FGWA 4RPLA 2ZWPA 1SU7A 4JUDX 1XDBA 3GWGA 1U7OA 4FI3C 4XIFA 1WPQA 1R0RE 2VUSA 2WG1A 1E5VA 4W5RA 2FFJA 4IJVA 1L0BA 2XKJE 1HD3A 3BK2A 2WKQA 5CBPB 1IOLA 4MW9A 4KYIB 4UDYX 1Q7CA 3GCWA 4ZYTA 2CKMA 1MV8A 1QU3A 3VYGA 3UA6A 1B14A 4Y1GA 1M1YE 2QORA 3LFHA 2XK0A 2FZCA 3HL4A 5LVAA 3UICA 1GG5A 4WKGA 3F1KA 4POAA 1GA1A 5IBPA 3FR7A 1PFKA 2WHRA 1H69A 3OIYA 3GFSA 3MQ4A 1NN0A 2I78A 4X95A 3TINA 4M75B 1PSWA 4LC1A 4GT1A 1G17A 4B09A 2QUJA 4E2WA 1GPDG 5A7FA 2JFQA 1CCWA 2FZVA 1PBNA 1CY8A 2HKQB 1K8YB 3TRIA 2CT3A 3S70A 2GM5A 1HL7A 1CUHA 2Z43A 5DCWA 5J1TB 3M6IA 2W6IA 2O50A 1KSWA 4BMZA 3JYQA 1Q7YU 1E3LA 3C1OA 3OX2A 5BORA 3X24B 1U1DA 13PKA 3KBBA 4L7QA 5DTRA 1KEEA 1NMSA 1OX4A 3AM1A 5CTAA 1M0SA 5LJ3g 4KQEA 4PLLA 1VB5A 5C5DA 1N75A 1UXIA 5AH0A 4IIFA 4MAMA 3KSRA 1NBMD 1M2GA 1GL6A 3M0UA 1N9KA 2QZ9A 1FK8A 5ER9A 2NP7A 5C37A 4Y28E 3KZ1E 4XX1A 2VK1A 4B6MA 4YS6A 4B5KA 2RK2A 2QTHA 2AZTA 9ABPA 3UA7A 1XTSA 3WGYA 4G0NA 1XNGA 2EYXA 1PGJA 1AZSC 5C5EA 4IHJA 1JWLA 2HWWA 4IL5A 3JCMW 2DAPA 3HPRA 621PA 3NB0A 3IAEA 1WG8A 4CHTA 1CVIA 1YKGA 4K03A 3QUIA 2WG2A 3T5DA 2FW9A 4Y0AA 3PA8A 5T7BA 4D4GA 4RJTA 1E2IA 2IU0A 3EASA 4REMA 2V7UA 2UVQA 1ZUIA 1RABB 3VPGA 2C92A 3BXOA 1NW6A 1UWCA 4ZVRA 4JASB 4LW8A 2JJ2A 4R7GA 1G9TA 2JJ1A 5JPCA 5AJZA 4PHFA 4TYMA 4MS3B 4UNRA 2J6OA 3ECCA 2B37A 1PQPA 5DRYA 2XIJA 3N1UA 1TUBB 1S4MA 1U0LA 4XM1A 3L1IA 3I9OA 5M34A 4MV9A 5KHOC 5J59A 1H2RS 1U81A 3LWNA 4LXCA 5LJ3h 1VA4A 4JQYA 4UTZA 1EE2A 1DWOA 3S3MA 1JHYA 3OCVA 4J6FA 1PEKE 3EDMA 1XUOA 1XZJA 4NDNE 4B73A 1FFGA 1WE2A 2GRAA 1N5OX 1VHWA 3K0CC 2QVCA 4GM0A 3KQYA 2FXIA 5IF9A 3H5LA 4GMGA 3NETA 5M04A 1BO6A 5E7QA 3IR6A 5HVNA 2JANA 4X85A 4MJLA 3PFGA 1PTJC 5BQ3A 2VSXA 2XLCA 2JAQA 3BIJA 5F1OA 3IQIX 1K86A 5F5NA 4BNYA 1DDGA 4NOYA 3OSSC 2X15A 4M9QA 3LVRE 1G7SA 3OPYB 3V55A 2FPMA 4OBEA<