4DEYA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
319
structure length
281
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1C
total genus 94
structure length 281
sequence length 319
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4deyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4deyA02
3X1WA 4GMDA 3VAAA 1ELOA 1V5WA 2ZM5A 3QWYA 1RE0A 2QT1A 3EASA 4IW3B 3SNHA 4E03A 3R8FA 2O88A 2G3YA 4RD0A 4DT1A 4ZDJA 3DMDA 4HLDA 3S1AA 4DDUA 3K70D 1HSQA 3BGWA 4QJ4A 3VNUA 3BH6A 1M34E 2A78A 4QC2A 1Z29A 4A6XA 3KB1A 4JLNA 1RVDA 1FP7A 1H8EA 4DCUA 2B7BA 3CRRA 5ECAA 4I81A 5FWCA 1E0KA 1COWD 3QF4A 2OE2A 3K09C 4PPFA 1OH7A 1FNNA 5SZHB 4PPQA 1K1ZA 1T3HA 4OJKA 3SFVA 5KDOA 3AGQA 3SBDA 3QENA 2RGNC 4M4ZA 2EWVA 2JLSA 2IYUA 3B8HA 4KI0A 2DLPA 3PVLA 5G53C 1Q44A 2DNUA 5FUXA 4J9EA 2VHTA 4KSCA 4Q1AA 3MRSA 3TSWA 4FMCF 2KNBB 3A4MA 3U5ZB 2N46A 2ZRJA 1ZUYA 4JZ3A 4H9GA 1KDPA 2VEDA 1RPZA 2GJ8A 1Z6TA 4LJ9A 4O0MA 1C1YA 2OFOA 4FI3C 1XCPA 4KFTA 4B6FA 1O3YA 2HT6A 3CRMA 3JV3A 1WA7A 1ZRHA 5EE0A 3PG5A 4TTPA 1IY2A 3I5YA 3T15A 1Q0UA 3QPVA 3TK1A 1PLJA 2PZGA 1VYUA 1BBZA 3IHLA 5DYGA 4LJAA 4QXAA 2FGJA 4DLWA 1MR3F 1P9WA 4Z1MD 1BH2A 1N5KA 3L82B 2W0ZA 1G9XA 4DSUA 5HR5A 3OEEA 4RZUA 2HCKA 1ZBJA 4OK5A 1U0LA 1IN8A 5BWMA 4RKFA 3RLFA 4O2RA 1IJFA 4PC3A 4DEYA 4UNPA 2UZ3A 1UKYA 1FNMA 4A1FA 1P2UA 3D31A 2GKSA 4Q9LA 3RWMB 4DSNA 5K8UA 4HVUA 1II8B 2WOJA 5J4VA 3FHTA 2JDIA 4RFSB 5K8IA 3B82A 4JT2A 2F2WA 4LJ8A 5FBQB 4PC1A 1XTRA 3LW8A 1B0UA 3AV0B 3NDPA 4PHFA 2KR3A 1C9KA 2LWIA 2LQNA 2QMOA 1M8MA 1TQDA 1XD2B 1ZNZA 4ZO4A 4J9HA 3KDSE 5JEDA 5I11A 2B92A 1R5OA 1VG8A 4DSOA 1CJUC 2V6IA 4PZZA 5JI2E 3Q5EA 1G7RA 2ZETA 2QNRA 4ZIRA 4LV8B 1SSHA 3OZXA 5AUPB 2AZVA 2K79A 1X1RA 4URWR 4JLPA 2CT3A 4AFUC 2CVFA 1N6NA 2XZPA 1JEGA 3ICEA 2QORA 2KB0A 5F2EA 3BFVA 4LJ4A 4W9MC 4CEIB 4TL6A 4TL7A 5DIFA 3REFA 2GJSA 2JT4A 4GI7A 4R7ZA 4IDPA 3SR0A 2W6JD 3DOFA 3MWYW 3SOPA 3SJCA 5B57C 1PUIA 3QE0A 1C4OA 2OBNA 2VL7A 2MSEB 4PPGA 2JLUA 1CJTC 1FW6A 4CEJB 2X77A 3I72A 5EC7A 4BWYA 1K5GA 1A2KC 1AK2A 4PAQA 3CPJB 1T0JA 4Q5IA 1B23P 3R20A 1E1RA 1GRIA 2GESA 1LCKA 2Q9CA 3NXSA 3SYKA 3WRXC 2KBTA 4M2LA 1EK0A 1CRQA 2BC9A 2VRWA 5EXXA 1B3QA 3CB4A 5CJ2A 4Y92A 1OXVA 4F16A 2FN4A 3CX8A 2EQIA 2H18A 2EFCB 4B74A 1T3SA 3K0SA 3C5HA 4LJ5A 4QFMA 1G20E 5F3WB 4CEJA 1VCIA 3FFBA 4B3BA 5EP3A 2AR7A 4PQRA 2EW3A 2V1QA 3MFYA 2V1UA 3CF0A 4OQMA 1NSTA 3FYHA 4MA4A 2GCPA 1WLPB 3SC3A 3MGCA 3P26A 1VDZA 3UF4A 1ZYUA 3U3RA 2PX3A 3QSYA 1Z6YA 4G5QA 2J6OA 4NDZA 1U94A 5G40A 3HU2A 1WBDA 1MO5A 3PUZA 1AZTA 2B8TA 2HSPA 4ITRC 1I0CA 1ZNWA 4P32A 2HT1A 1GKYA 2JM9A 2QAJA 2AN9A 3LNCA 2QSYA 5GADl 1M8PA 3Q72A 3BD9A 4GOKA 2OEPA 3RVBA 3EXAA 2GQIA 1GCQC 2VKNA 2QE7D 1S96A 2CK3A 3BFXA 3OE7D 3UXMA 1UTIA 1RLQC 1WP9A 3O8BA 5KDLA 3GLFA 4Q21A 4R0KA 3M0EA 4L15A 3BS4A 3O8CA 1KNXA 3DKVA 1NN3A 2AKYA 2AZSA 2QL6A 3EZ9A 3HJNA 4F4JA 4XVUA 4OI2A 4BZQA 3SQXA 3EA5A 3MCAA 4E09A 2AFHE 2X2FA 2XB4A 4G5RA 2VSOA 4Q9JA 1X6GA 2G0TA 2GF9A 1NVXQ 3B1WA 5JWHA 1COWA 2V55B 2HEQA 4US2R 2BCGY 2W83A 4TMVA 3RRZA 1VHLA 4CZ2A 1EFHA 1KK1A 1IXSB 4TYQA 4LYAA 1SKYB 2MSDB 1T6NA 1GNPA 1CBUA 3ZZ0A 3NBZC 3N5CA 4LHXA 1HV8A 1Z6GA 2ZRDA 3FJ5A 3NBYC 1Q1BA 2QAGB 1KAGA 4CEIA 1D6JA 2CJWB 4OMLA 4D4KA 5J4LA 3IGFA 1RJ9B 1OV3A 4B3GA 2ZJYA 1XEWY 2FWRA 4TT3D 3FMFA 3GFPA 1E2FA 2YVUA 5JHGB 1W36D 1MO4A 4AFSC 4M1SA 2PEZA 2IYLD 1AS3A 3DVLA 5HCIA 5JLJA 1T3LA 4AFQC 2HV8A 2J0UA 2ZREA 1QVRA 5IF9A 3QKTA 5HKKD 4HAVA 3TKLA 3VRZA 2GEDA 5HTKA 2KI5A 4QHTA 1GBRA 1FMJA 4QJ5A 5JJLA 2F3RA 5IK2D 1TF5A 2AD5A 2XTNA 2V1XA 3JVVA 3QVUA 4FIDA 2F3TA 1AVZC 3EW9A 1DAEA 1TX4B 1US8B 2QP4A 2OZEA 3UMSA 2D2FA 2E1RA 1JR3A 4KHZA 4M53A 3BAFA 1Z83A 2A3RA 4E6RA 3TQCA 2CXXA 4HAWA 4P4TA 4TTRA 2OT3B 3QOFA 4ZKDA 4J9FA 3A1VA 4R2IA 1DAGA 1ESMA 2WM9B 1E1QA 2RQWA 2J05A 2C77A 3LXXA 4L9SA 2PEYA 2O9VA 4K8OA 1AKYA 2PMKA 3LRPA 5EE9A 2GXAA 4Q47A 2RQVA 2MCNA 3KTAB 1MKYA 1Y63A 2F43B 3K0FA 1XJCA 2J9RA 3B7GA 4Q1CA 2O5VA 5CK4A 2ZJOA 2HLDA 1UM8A 1G83A 1TG0A 1W1WA 2P6UA 1ABQA 1XOVA 1ABOA 1P9RA 2ZANA 4RD2A 3U7EB 4ZNXA 2BTTA 3I73A 2GK6A 2GJAA 2E9SA 4RZ3A 2IK8A 2WBLC 2ZRGA 4ESRA 1G18A 2A2ZA 4QGAA 1W5SA 1G19A 3F0TA 2D74A 2QI9C 1XU4A 2HXSA 1DO2A 1VG1A 1WXUA 5FR1A 4QHSA 5D3MB 3KUCA 3SU8A 1AM4D 1OT3A 2QTHA 1NLOC 2FPEA 1FOEB 4OHVA 3W6PA 3WP0A 2WOOA 4TZ0A 1G7TA 4HAZA 4W5HA 1Z06A 2HYDA 2IHYA 2K6DA 3KQKA 1VMAA 1ZBDA 5JRZA 3MLEA 1SQ5A 2ANCA 1G6HA 2LCFA 5DO9A 3PIRA 4HUQB 3VR2A 2RMKA 3LD9A 4DJTA 1OV4A 2JJ8A 2KYBA 2JJ2A 4HZUA 4JBXA 1I1JA 3I4LA 4EJSA 5M04A 1X69A 2DA9A 2QMEA 1JAHA 1CR1A 1KKMA 1R0YA 3NWJA 2DL5A 1I4TD 1QHHB 4F92B 2YT6A 4MKHA 1LTQA 2BDTA 2AK3A 1OH5A 1MUZA 2CSIA 3F3YA 3DZ8A 3LVRE 2M51A 3KXLA 2ED1A 3WBKA 2WWYA 1XPRA 4V03A 2QRZA 3VS5A 4TN1A 3AF3A 1DEKA 1FUKA 2GBLC 2OG2A 5BXQC 2REXB 2BEJA 3CPEA 3E70C 3TRFA 4AIIA 1GFDA 1N6HA 1XXHA 4TYYA 4JPBW 2J6KA 1XMVA 2ZI9A 3EIHA 2BBOA 2FFAA 2ORWA 4KO8A 4QGHA 4URYR 3M0PA 4KXFB 5AJWA 4EJSB 2ZVQX 2J3EA 1CJVC 3WMFA 5TVKA 3QY0A 1P6XA 3OIYA 3C4JA 1Z0FA 1J8YF 1L4UA 4B48A 2R44A 1AA9A 2XSZA 3FGNA 3U7HB 1N6PA 1M3CA 3GFOA 3K9GA 4UXIA 2KRMA 2O0HA 2ZYTX 1W4BA 1E2IA 4GT1A 2XEXA 2IL1A 3CRQA 4CW7A 3VRYA 1QHIA 4FCWA 5CM9C 4HLCA 4DDWA 1TTTA 1PLKA 5GJBA 4NMMA 2ZUDA 2IT1A 3SJAA 3GLGE 5CB8A 1SHKA 1OIVA 3PITA 2AXNA 4LBVA 3CW2A 3RSLA 3OE7A 4CT4B 3GMTA 3VS0A 3GEEA 2QRNA 4I1VA 4KV9A 2Q3FA 3VX4A 2ZSEA 4KSBA 1JXMA 4G3XA 1OKKD 3KJGA 3GLFB 4C3ZA 4RD3A 4JLBA 4V0KA 1UDXA 2PBRA 2QENA 4YDSA 4BLQA 2O52A 1HQCA 4LUCA 2QPTA 1ZM9A 2D8JA 2GJ9A 5FOUA 3UATA 1DO0A 1OIWA 3QKSA 4YMUA 3VNVA 1CKBA 2XXAB 1TF7A 1TPZA 4CEHB 2IYYA 2PX0A 5FUVA 3GPLA 1TAGA 3CZPA 1KMQA 4NYIR 1E2DA 1CULC 1NVVQ 3EG0A 2OLKA 3M6AA 4QRHA 4FWTA 1ZIOA 3TW8B 5JS7A 4ZDKA 5F9FA 4J9BA 5TB5A 1H8ED 2FGKA 3THXA 3GEIA 4KITB 4OI0A 4DVGA 3AVOA 3BB1A 4CRWB 4P0TA 4AC9A 2XSZD 3IBGA 3CPHA 4DLUA 4QT7A 2ZU0C 3ECCA 3T5GA 1CR4A 2GCNA 4EPWA 4NU0A 2IUUA 1UGVA 2IIMA 1K9AA 1YZLA 1JXOA 4TQ9A 3P4YA 1ZUHA 4EUNA 2CH4A 2G0NA 1W48A 4M1WA 1QDEA 1NI3A 1TNDA 3W8RA 3AVXA 1E2NA 1H65A 5BYJA 5IT5A 3E5HA 1E3MA 1GUAA 1XMSA 4HCKA 1AWXA 1KI4A 1RKBA 1J99A 2GZHA 3D7MA 3LX5A 4XVQA 1NG2A 4A0FA 2X3XD 1Z6AA 4EFLA 1FUUA 1NN0A 4AWXA 2FEMA 4EQ6A 2F6RA 4NYMR 1OIXA 1AIPA 1HT1E 1G4UR 1Z0JA 2EFDB 1VYVA 2W6ID 4TSFD 4V0LA 4V0ME 1BOFA 4L4UA 3FMOB 5FTNA 1R6BX 1VTKA 2YINC 1M6NA 5BYKA 4AI6A 4OK6A 1S0UA 3KQNA 4IHQA 4DRZA 2IA5A 1U9IC 1Z07A 2IYQA 3IILA 1YU9A 3OIWA 4LI0A 4RTZA 4IDOA 2RMOA 3WMEA 2CNWD 3ADDA 2QSZA 1GFCA 1YZUA 1SZPA 2X3WD 3NEYA 3K0FB 1M27C 1PRMC 1CR0A 3TBKA 3RDPA 1OFIA 2JLVA 1DPFA 1GSIA 1SXJE 2ASEA 3NTUA 4I4LA 1LS6A 4LHWA 4A4DA 5IH2A 3QUSA 5KNCA 3JZAA 1N0UA 3ZVLA 3PJRA 5J4YA 1G5RA 1KSJA 4ASUA 3KQHA 2JMCA 4J9GA 4N0DA 4LJYA 1VHTA 1TU4A 1A82A 3LY5A 5E95A 2O0KA 3QXSA 2RN8A 1E1RD 1IHUA 2QROA 4IKEA 1AS2A 2JXBA 4UKDA 4MGZR 1XBTA 1S3GA 2B86A 5J5CA 3RS7A 2BWJA 1CU1A 1RRFA 3RANA 3Q3JB 4L16A 3HPRA 3EC2A 2EWWA 1Z9QA 1Q3TA 5LD2B 3UWKA 2Q3HA 2R6FA 2B8WA 1OB2A 1EFNA 3CIOA 1UEIA 4QJ3A 4BFTA 1U0JA 3L8YA 3RNJA 2YV5A 3DEFA 2ENMA 1KTVA 1UJ2A 3DKPA 1IJEA 5FOWA 2YDLA 4C0JA 1K4US 3VKGA 3ZD7A 2CL6X 4BQSA 3FE2A 3K70C 4A2WA 1G3RA 3V4RA 5KSPA 1XTKA 2FX3A 1L2TA 1TQ6A 4TQAA 2VO1A 5E3HA 2ZRBA 4OI4A 1S1NA 3EG2A 4A2QA 1QZXA 4TMXA 4TZ6A 3VS7A 2JJ2D 1JU5C 2CUDA 2GAOA 3B1ZA 3TQFA 4Q9IA 3H0IA 4DLSA 4XWAA 3RABA 3ZIAA 4LUDA 4AKGA 1ZX6A 1G5PA 1OHHD 2PTKA 1SXJC 4HDOB 4JVSB 3H1TA 5K8LA 1BK2A 2GK7A 1FFHA 3GJ6A 4QBFA 2VHUA 5JZVA 2CUBA 2QMUA 3SEAA 3I62A 2HUPA 1ZIPA 2YNMA 2KBFA 4FXPA 3F8TA 1KY2A 2KRSA 3NH6A 4F4CA 2J7PA 5L3SA 1XJQA 1YQTA 1Y57A 2H1LA 3BWDD 3NIBA 1YZGA 4C0HA 1EWQA 1BIFA 1E79A 3PV0A 1AOJA 4RFSA 1KGDA 4YC7A 2RQRA 5JJIA 1A2BA 1ZCAA 4V0NA 4QM6A 2FSHA 2NPIA 3WNBA 1KO5A 1GZSA 1XPUA 3KTAA 3Q8XB 3LH5A 2OXCA 3T1TA 3A4NA 3X1XA 2YZ2A 3KZ1E 5LBIA 1BKDR 1K5DA 1FP6A 4AFZC 1DBSA 1YKSA 2AXPA 4KLNA 4FMCB 4XSGA 4B2LA 4F7WA 1OB5A 1E9DA 2ERYA 2EKHA 3H2YA 4IXMA 4CC4B 1X86B 3IEUA 3EIQA 1Q12A 2H17A 4FMBB 4LBYA 1G17A 5HZHA 4LV5B 4HLUA 3P32A 4BUJA 1SVMA 3CQTA 2MIOA 3I3SR 3ZD6A 3FOZA 4UXJA 4ZI3A 4MKFA 4A0GA 1II0A 4JMPA 4JLMA 5BW8A 2ECZA 1G3QA 2H92A 1NBME 5KOYA 4B35A 3LA6A 4DLRA 2YUNA 2KYMA 2V4ZA 3R6NA 1TUDA 1OXSC 2FE4A 2BKEA 1PZNA 3T5DA 1ANKA 1DTSA 4N1AA 2JJ1D 4TMZA 2OAWA 4DDVA 5B58C 5FH9A 3L0OA 2DF6A 2ANBA 4Q19A 1TMKA 2IS6A 1OH6A 4ACBA 2G6FX 3R7WB 2LX7A 2ONKA 2VLIA 3MWJA 4BFXA 3PCRB 2XOKD 4XTRA 4HB3A 4IDHA 1PLLA 1OXXK 2G9NA 5JWOA 1E2HA 2VSXA 4G5OA 1QHHA 4Q7JB 1M2OB 4Z8YA 2FPDA 3LQQA 3EG1A 2AKAB 1U3OA 2G6BA 1DG3A 4LV6A 5B2ZA 5TXGA 1DAFA 2GJKA 4WCIA 5HCNA 2HJGA 1NEGA 1RZ3A 4OK3A 2J06A 2VF7A 2JA1A 2DFKB 4UXHA 2YKGA 1GILA 1NIJA 4AD8A 4EQ6B 1KY3A 2ZSFA 4TLCA 5FTKA 4DC9A 5L8VA 2QQEA 1Q1EA 2F2VA 1SULA 1W70A 4Q1EA 4QOSA 4RCYA 4PO1A 2AX4A 4DEXA 1SKQA 2OV2A 3A1SA 4JIMA 3T61A 4YONB 4B3XA 5KO2A 3CF2A 3R7WA 2GXQA 2P6RA 2GBQA 3ULRB 3H0KA 1J7KA 1HEIA 4Q4JB 4XH9B 1W36B 3M0QA 2A36A 1FMLA 5DNYB 4L9WA 3K0EA 3U4QA 1MRNA 3KJEA 3RBBB 3CWZA 1OPKA 4HDQB 3OFND 4JKYA 4W5WA 1PV4A 3AP2A 2HYIC 4D8KA 1OEBA 4MRVA 2VSFA 1Z0DA 2BJWA 3DDCA 3UG7A 3W8NA 4ASUD 4D4JA 3N70A 4XIGS 4J9CA 3GJ4A 2G88A 4KVGA 4LX0A 1UKZA 4KVAA 4DKXA 3C0CA 2V7QA 1WB9A 4D26A 2O8BB 1M7HA 3CKLA 3SBEA 4L8GA 3GLGB 4JVMA 1UECA 1N5ZA 4BRUA 5KU1A 1EESA 1UFFA 2O8EA 1KI3A 2WJIA 1N3BA 4KU4A 4MRRA 1MABA 5I22A 1HA3A 4NKRA 3M1IA 4CDGA 4HXJA 3NGPA 2C2HA 4JJKA 3G0HA 4BE7B 1YR8A 2KJQA 2L2PA 2RGGA 2VP5A 3EIEA 5C1BA 4AK9A 2L3SA 1ZC3A 4R2HA 4BLOA 5KNDA 5FW9A 2GBLA 3R9WA 2ZQ5A 2FG0A 3RRMA 2O8BA 3EZ7A 1D2MA 4MH0R 1X2QA 3A4LA 4Q18A 3C41J 4LYJA 3W6OA 3H0HA 1HJDA 1Q22A 2HLDD 3FTQA 4HB2A 1ZU4A 2QT0A 1XDBA 1E1QD 4JL6A 4BFWA 4XWKA 1ZCBA 3AF1A 4Q7MB 3O47A 2XAUA 3THWA 2B21A 3W34A 5J40A 3B60A 1VIAA 2XNDD 2YWFA 1P73A 2AD1A 2DFTA 2Q9AA 1YCSB 2EGEA 3ETLA 3RS5A 3B13B 5C46F 1UKVY 3NDBB 4DXAA 3RSOA 1UBEA 2A5JA 1JR3E 3C7KA 5IK2A 1UHCA 2VWFA 5AJXA 4PSAA 2FMXA 4GP7A 3CLVA 4ON9A 2WHXA 1DAIA 4S35A 5KDDA 4RZXA 1GL5A 2QPOA 1G8GA 2PNIA 3T35A 4KRTA 2BMFA 3C15C 3THWB 4K11A 2DPXA 2HF8A 2DJQA 1W49A 3FFAA 5G3YA 3TGPA 1KSHA 1TF2A 4NCHA 5FUYA 5FI1B 1E96A 4RY2A 2F1RA 4AG1C 1RYFA 3B85A 2QBYA 4B3DA 2C99A 1EXMA 3WNDA 1OJLA 2W58A 2DL4A 1DE0A 2O8DB 2QZ4A 4GBMA 1YR7A 2GHIA 5JCZA 3K09A 1NIPA 3QXXA 3ZYCA 1XEXA 2C8VA 2ATXA 4RD6A 2Y8EA 2R6GA 1VG9B 1E2KA 3OF5A 2OFXA 2MSCB 2CSQA 1SVLA 3U3OA 1GAJA 2W6IA 2OCBA 1GRRA 2Z83A 3TW4A 1GCQA 3EZFA 4BLTA 3M4YA 3RS2A 3B78A 1Z28A 5EUMA 3PQCA 3A6PC 3H4MA 2YWEA 5F9HA 1UBCA 3D6TB 4B71A 2WKPA 2JIZD 3ND8A 1U5SA 2EYUA 3RS0A 3QXJA 5FBRB 5ELXA 1EX7A 1A5TA 1GP2A 2G77B 1UDWA 2ZRNA 4RZ2A 1K0XA 1WYXA 4Q9HA 1X27A 1YR6A 3GJXC 1G3MA 2XOKA 4FCTA 3M0UA 2IYSA 2L0XA 1GG2A 2X2EA 4FSSA 2RKOA 2B7CA 4WZ6A 4ARZB 5SZKB 4PSKA 1I2MA 3ADKA 5FL7A 3K8YA 2GTJA 3K9HA 4A82A 3CBQA 3EZ2A 3C5CA 4OL0A 2ZRKA 2J7IA 4A8JA 1GKUB 3CR7A 2PJRA 3IEVA 1J3TA 1ARKA 1M74A 4GOJA 4JLKA 2H8KA 1ZMXA 2M0YA 1TUEA 4TTQA 1FYNA 1E2MA 4URUR 3BBPA 2F7SA 4QG7A 2LZ6B 1G4AE 2ZRHA 4EPTA 2XZOA 1XEFA 4F91B 2HDNB 1UADA 4AURA 5HCKA 3AVYA 3BERA 4Z8XA 2YWGA 1KJWA 1GITA 4XD7A 3GP8A 2WPDD 1CXZA 3CNOA 2JGNA 2KRNA 2I0NA 3M0TA 1XCMA 2HCBA 1HE1C 4G5SA 2GNCA 3C16C 2WWHA 1AD5A 3VS2A 2WKRA 4WXPA 5CDFA 3AVTA 1F2UB 1P2SA 1ZNXA 1W4AA 4GLMA 3LX8A 3MD0A 4GP6A 4E5UA 5FTMA 3NEJA 2NOAA 1CF4A 1WDXA 3WBJA 5DHFA 1X6VA 1R8QA 3MJHA 2C9YA 2EYYA 2WVJA 2VP6A 2IBMA 5B64A 5EZ5A 2QG6A 3HPQA 1CKEA 1OF1A 2OFWA 2RGEA 1CIPA 3IPXA 1N6KA 2VP2A 4GZMA 4QBHA 5FUWA 1SHZA 2A08A 4OHWA 3QBTA 4DB2A 4URVR 2C9OA 5FTLA 1U99A 1OKKA 1TU3A 3DZDA 3I5RA 1DARA 2ZUCA 2YHSA 4LY6A 2BJVA 1RIFA 2FZ4A 4CC7A 2ZRAA 1WDTA 4JBWA 3T06B 4JZKA 2Z4RA 1JEEA 4JS0A 1JB1A 1RW4A 1X8KA 2ZJAA 4PHTA 3PEWA 4QNRA 1NVUQ 5D3MA 5E4FA 3AKCA 3AKEA 4A63B 1E9SA 1DADA 1JBKA 2ATVA 2CVHA 1OOTA 2FO0A 3L8ZA 3NHAA 5DLQC 1QRAA 2AWNA 3TMKA 3GCGA 4A15A 3WNCA 1KDRA 1OYWA 2BHRA 5AUNB 4PTLA 1OW3B 2O8FA 3VKHA 3X1DA 5LPNA 3AF4A 3LBNA 4LOAA 1E0JA 1E9CA 1N6IA 2XTMA 3QG5A 1TUIA 4PX9A 2P3SA 6Q21A 1MRSA 3BB3A 2ZAOA 1N5IA 4Q1BA 5FPTA 4ESVA 2JM8A 2DYBA 5JRJA 1ZD1A 5KSZA 1FZQA 4JJZA 5FOXA 3LBIA 3TUIC 1Q21A 221PA 3J81k 4V0MA 3R9IA 4WBSA 2RH5A 5FI0B 2R62A 4C2TA 2I3BA 2PLRA 1GWNA 4LPKA 4B2IA 3QKSB 1JECA 1KI2A 1CLUA 4OMMA 2FFHA 4UNRA 5FBLB 1E2GA 2ODEA 3SS8A 2YC4C 4Q7KA 4F14A 2P67A 3DPUA 3P20A 3NKVA 4EIKA 3A8TA 5KPJA 2Z5FA 4Z51A 1L7VC 3AP1A 1M7GA 3KXKA 4DDTA 1YJ5A 2NZ8A 2YSQA 2RAPA 3ZS9A 2EYXA 1HURA 4I99A 4BLPA 3GQBA 1IQPA 2C9CA 4G1UC 2ZI5A 2WJYA 3GLHE 2ODBA 4DCNA 2AL7A 1GIAA 4NYMQ 1LNZA 1ZM2A 2ZIAA 3CX6A 2YUQA 3R8CA 3DM9B 1XNJA 2Q0HA 1YRAA 1PNJA 1JQLB 5IHPA 3ADBA 2GWHA 1SVWA 2ORIA 4JLJA 4KCGA 4LPSA 4B75A 2ECKA 1Q3HA 2ZI4A 5H70A 2GZDA 3VU9A 3BK7A 3GFTA 2CBZA 4HAUA 4AKIA 2FFQA 1PJRA 1DS6A 2V9PA 5DHAA 3ZVMA 2C5LA 2RGBA 3SJZA 1Y0MA 4QKQA 1YVDA 1JEDA 3ZQ6A 1N2CE 3E1SA 1KI1A 3WY9A 1W2GA 3QXHA 4DBLC 3B1YA 1W44A 4Q01A 2GF0A 1BB9A 5IXFA 1AZEA 2D1XA 3SDZA 1P7CA 1GRQA 4UQOA 3BXZA 1U0HC 2GNOA 5IDVA 1RRGA 5DN6A 4YMWA 1NG1A 4TSFA 1QWFA 1DAHA 3ZVRA 2W10A 3IIMA 5BN5A 4HYYA 2IUTA 1K8RA 3VR6A 1CR2A 2P5TB 3THYB 2JLXA 4P3YA 4B47A 1MABB 2UVQA 2NO0A 3CUEF 4JVLA 3VQTA 4KBGA 3LQRA 1ZUNB 2VPPA 1KK2A 2W0SA 4B34A 4DUGD 3U60B 2VP4A 4IDQA 5K8TA 1G5TA 3VS4A 3LXRA 2EFGA 3UMFA 4GDFA 2ZI3A 5JJKA 2WV9A 1KKLA 4NCNA 3VHXA 1W7AA 2RHDA 4MDEA 1YZKA 2IYXA 2PT5A 3QKRA 4XTCS 2CCGA 2O2OA 4C2UA 4WOPA 4Q02A 5DI3A 3ZQJA 4OMQA 2BM1A 3A98A 2BM0A 2JJ1A 1VCOA 2HF9A 1P9NA 1MOZA 3DL0A 3K0AB 3PVQA 2WWGA 2AK2A 3L0IB 3CM0A 5HKKA 2GRJA 3GJ0A 3I5SA 4LSGA 1ZNYA 2BKUA 4IVPA 5FL7D 2A7QA 3I35A 1JJ7A 4C9BA 4YMVA 1XXHE 1Z5ZA 2KBEA 2WKQA 1S9HA 1BO6A 1TADA 3IQLA 1P61B 5CIQA 2N42A 2K2MA 2QY9A 2J41A 3UG6A 2ZE6A 2RB4A 4AYXA 1P72A 4ZDIA 1ZLMA 1M1YE 2A5DA 2FPMA 2LJ0A 2LJ1A 2CLSA 4IFBA 1GL6A 2NGRA 1XXHB 3A58B 2DX1A 5L23A 2J0UB 3WYFA 4EPXA 1QHSA 3IIKA 5P21A 4MDFA 2GTPA 2KE5A 3U2QA 1LW7A 2IF2A 2ZI7A 2CLDX 1CP2A 2QGZA 1FTSA 521PA 5CDFE 1WF3A 1F5NA 3Q7QA 3UPUA 1N25A 3AKDA 1KO7A 3L43A 3W90A 2D3WA 2KGTA 4RTTA 1W6XA 1M3BA 1AEYA 4X8LA 2O8DA 4MYTA 2NMVA 1BMFA 2ZSDA 4NCIA 1Z9ZA 4US1R 2IF0A 1RRCA 2DL3A 1G41A 1IBRA 3I1FA 3U61B 1FMKA 4DCTA 1DVRA 1H8HD 3NG1A 4A6PA 3QF7A 4BLRA 5JCPA 1XF9A 4PZYA 2J7KA 3GJ8A 4X8OA 2GILA 2DB3A 1XCGB 4UNSA 4PFSA 1DELA 2VHCA 4IXNA 3VFDA 3I61A 3PUYA 1RRPA 1R2QA 3UK6A 2P0EA 4BEJA 1WIEA 2H16A 4XWOA 2PZFA 1F48A 2GAAA 1Z6XA 2D2EA 4QHYA 5C4GB 1WQ1R 4UNNA 2REBA 1XD8A 2ZU6A 2JLRA 2XGJA 1F6BA 1X6BA 1VYTA 1TQ4A 2NO7A 3K9LA 2ZR0A 5LB2A 1SXJD 3G82C 2C96A 2EU8A 4RD4A 4A8JC 1WI7A 3MAAC 4P4UA 2CL0X 1NKSA 3U3MA 2GVDC 4RKEA 5EP4A 4QNMA 2AFIE 1H92A 3U7FB 2RQTA 2PL3A 1EFRA 1R0XA 2CEAA 3QXCA 2VA8A 4JLVA 1P3JA 1P75A 2WAYA 4AKEA 4ZI2A 3P1JA 3I5XA 1MV0B 2ZYUX 2ODWA 1XFAA 3TAUA 3QJYA 4WAUA 2SEMA 5GVRA 3X1YA 1W2HA 4QGGA 3RHFA 4HLUC 2R9VA 5BN3A 5GJCA 2ZE7A 5DN6D 4ILEA 4OI1A 2JASA 2XJ9A 4RVCA 2BBWA 2WSSA 3KJIA 1ZM3A 4TMKA 2J7PD 3PR1A 1T8UA 4HUQA 2W6JA 1XWIA 1NM7A 4TL8A 2ZR7A 2OCYC 4ZV4A 1FL9A 1Z08A 3B5JA 4WW0A 2QAGC 1GCPA 2DBYA 2FOLA 2K7AA 2RPNA 3MJRA 4BGDA 2C0TA 2D4HA 1KFZA 1N5JA 3BH7A 4WVFA 1OH8A 4M9XA 3W5JA 4A2PA 2BV3A 3F5FA 3SHFA 1NSFA 3AQ4A 1M7BA 4U02A 4B2PA 3ADCA 1U06A 2MOXA 3WP1B 2JMAA 1EFTA 4YMTA 1G64A 4JJBA 2V54A 2ORVA 1ZJ6A 2CDNA 3ZDQA 3LWNA 4NL4H 1X8LA 4BFVA 3BFKA 4LYFA 2J5XA 2JEOA 3VU9B 4C0QC 3U44A 2BZYA 4B32A 1E9FA 1TUCA 4R98A 1BMFD 1XZQA 4Q4HA 2GTOA 2D62A 3BH0A 4FN5A 4JVNA 4LC1A 1GVNB 4Q48A 1F3OA 4P4SB 2XNDA 4MYUA 5E7MA 3QIAA 2QBYB 2YWHA 5L3QA 2FPFA 2X19A 3QPWA 4Q1FA 4AY2A 4JSYA 1XRJA 2DRKA 4Z1MA 1ZUKA 5JBQA 2ZRFA 5A0FA 2O8EB 3EWSA 4LJ7A 4D25A 4FMDB 5GJWB 1EGAA 4P31A 1G2BA 2G1JA 4IEIA 1Q1ZA 1E7OA 2P4RA 4NCJA 3T34A 4M9SA 3WYAA 4EPVA 1XX6A 4PC6A 4AKHA 2DFNA 3IKJA 4J0QA 3RC8A 1W4RA 4CGZA 3BB4A 4K46A 2ZROA 3BORA 3FVQA 1UG1A 4V0OA 4MUBA 4LJ6A 4Q7LA 3UWOA 4WIAA 1R8SA 4K81B 1QHYA 4G5GA 3VKWA 4DLXA 5H68A 721PA 3LBHA 1NN1A 4F93B 2REOA 2WJVA 5FOSA 2C0IA 2I4IA 3PUXA 3GLIB 4UNQA 4ZCIA 2ZRMA 1GRNA 1UF9A 3LO5A 5DI3B 1MH1A 1J70A 1LV7A 1RYHA 3AVQA 3K53A 3PFIA 4PO8A 3A1WA 4URZR 3RC3A 4LE9A 2XITA 2ZUBA 1NMZA 1AZGB 1W0KA 1J90A 2QA5A 3B1XA 3WHLA 4BRWA 5GVSA 2MMCA 3NC0C 1G21E 2O8CA 3LAWA 3SN6A 2P2LA 2ZJ5A 2V1RA 1KO1A 1SVOA 2PH1A 2V6JA 4IRUB 4OJQA 4URXR 3THXB 1GFIA 3KJHA 1NY6A 1S1MA 4C0LA 2JLZA 3ZZTA 4E22A 4RTUA 1FTNA 4C7OA 3OFNA 4YMSA 2FNAA 1E4VA 4DUGA 1Z0AA 4LGMA 4BFUA 1NBMA 4X8HA 4HLQB 1QWEA 1IY0A 2GGRA 1DAKA 1NF3A 2CK3D 3LV8A 4JBYA 2KSQA 3T1QA 1UBGA 1W5TA 1YNZA 3CR8A 1U9IA 3OHMA 3QEOA 4QL3A 4PR0A 2DBMA 2GCOB 4IJMA 2J0SA 2YUPA 1GTVA 1UJYA 3AP3A 4Q1DA 4PHGA 1PRLC 3LFUA 4D80A 3H0FA 2DCUA 1F2UA 2IC5A 4Y0VA 2BBSA 4D4LA 4EDHA 2AK5A 1BS1A 2F1HA 2NIPA 3L2OB 4PQFA 2NG1A 1FX0A 4KLZA 3MMPA 2ZRLA 4W5JA 5LB4A 2J0VA 1CRPA 2LNHB 3ZH9B 2UKDA 3U44B 1QKWA 1E6HA 1LFDB 2QE7A 1WMSA 3B9PA 2JCSA 1U90A 4JL8A 3FDIA 1VECA 1KSFX 4DLTA 3HWSA 1T0HA 2ABLA 3ASYA 3VS1A 2R6CA 3CRW1 3OIVA 4TYPA 3EPJA 4C0AC 1D8TA 2JS2A 2ZS8A 4UJ3A 2QN6A 2VP9A 1SHFA 1KI6A 2PCLA 2GDJA 1IN5A 4Z8AA 2Z6VA 4HB0A 4C4PA 4EFMA 4BASA 1NJGA 5FL3A 4LK2A 3ZLJA 3GBQA 1W36C 1NLPC 2A9KA 3K0CA 4EPRA 1OE0A 4GOXA 1JQQA 4M21A 2JLWA 1HTWA 1JI0A 4YQFA 1QG4A 1Z2CA 4YXWD 5JFGA 3AVWA 5TMPA 2IXFA 2QM8A 3X2SA 1GL9B 5FWBA 1OPXA 1KNQA 1T4GA 5EP2A 2FF7A 1AS0A 5AUOB 1EFRD 4WZAE 4YLGA 2DY1A 4LN2A 5AK0A 1J2JA 3JVUA 3R9XA 1NN5A 4BEBA 1NLYA 4IVQA 1KSWA 4PSVA 5CK5A 1NL3A 1WA5A 4ZPXA 4MRPA 5EUQB 4JLDA 1PVOA 2OILA 2QUZA 4G01B 2F1JA 5C2JB 2C95A 2RGNA 4IVRA 1Z0IA 2O0JA 2AHOA 5G3ZA 4TLAA 3KFXA 1MO3A 3OAAD 5A4JA 1H8KA 3ONWA 4M1TA 1PKSA 4RTYA 3QBVA 2NWMA 4TLEA 2V3CC 3K9NA 5EJEA 1EWRA 1XEWX 5CJPA 4HUTA 4E07A 5LD2C 3ZZUA 2Q21A 3K0CC 4MGYR 5C18A 1RI9A 1V1CA 4DLZA 2KXDA 2EGAA 1KK0A 5EE1A 1N6RA 4QGFA 3SQWA 3U3JA 2BBTA 2WJGA 1T91A 3O8DA 3MWKA 1E2LA 1FPMA 5J4KA 2WWFA 2HBWA 3ASZA 3AUXA 4V02A 2HXYA 3PUVA 1XTJA 1KIKA 5KPDA 4GMXA 4IIOA 2Z0MA 4YXWA 2ZRPA 2FFBA 2A28A 4Z89A 3FPAA 4MRNA 1FX0B 2GETA 2AWOA 1XD2A 1F2TA 1UHFA 3HU3A 2ONJA 3I8XA 1WX6A 2WSSD 2RF0A 2Z4SA 1YRBA 1IN7A 1TEXA 2XTZA 4ARZA 5A5GA 2O8FB 2QMHA 4NYJR 2Q6TA 5G41A 4B43A 2A37A 3V00A 1X8JA 2OBMA 5JECA 1P4SA 1E94E 1T0HB 1YWOA 3OIUA 4BPBA 1LY1A 1A7JA 2CHVA 3PXGA 3IO3A 3OEED 2EVWX 4TMWA 2F9MA 3C14C 1BYIA 3I8SA 5TY0A 2X1VA 2YOHA 3PVSA 4C0KA 2HDAA 4YDHB 3JZMA 1B07A 2K9GA 3EHRA 2C03A 2OO7A 4DLYA 4J9IA 1MO6A 3KKMA 5CLLA 3EGUA 2CE2X 3KKQA 3ND9A 1T8TA 1E9EA 2PJZA 1ZVQA 5IHIA 2X8AA 2MMGA 4XOIA 4X1VA 2PT7A 2WICA 1T5IA 4RD1A 1HUQA 2W2VA 1AWOA 3P27A 1IY1A 2N1BA 3QEJA 3A1TA 4KFSA 2WWWA 2DE0X 2QU8A 2FRYA 2D7CA 1E9BA 3LDAA 2OSBA 1D9XA 1VKJA 2IS4A 2EGCA 1D2NA 4D0GA 4TT3A 3HYTA 4BZXA 2IWHA 3AF2A 1ETUA 4MGIR 2QDLA 2WWIA 3SZRA 2SHKA 3BJIC 5FOVA 1UFQA 2J45A 3EAQA 2FRWA 5J4HA 3RNLA 2WMOB 5SZIA 2NUZA 2OUKA 4TYNA 2KWIA 4ORZA 2DILA 1YE8A 1ZSGA 4R71A 1D9ZA 3MWLA 4LDJA 4IOKA 2C78A 1HYQA 3DM5A 1JJVA 3EC1A 2ZE5A 3NHBA 4RTXA 2WJJA 2HEIA 4Q4AB 3W9YA 2OJ2A 4KJZA 1KIMA 3TSZA 1E2JA 1LVGA 4M22A 5H8WA 3EPHA 2GEUA 3FWYA 2ZJ8A 4M1KA 3EARA 1D5CA 1OSNA 2H8HA 3CONA 1SEMA 1Z3IX 4Q4HB 4XD7D 4BFZA 1K0SA 1A4RA 2ZS9A 2Q9BA 5H1YA 2KROA 2EYZA 1PWTA 4JJCA 4IOMA 1F2TB 3AH8A 4NYJQ 1F60A 2VHQA 4POAA 3WXMA 2DMOA 1KI6B 2QP3A 3IQWA 1KO4A 1WXTA 3IUYA 3THYA 3SYLA 1HH4A 2VH5R 3I92A 5FPYA 1G1MA 3SI7A 2NPFA 5HPYB 1UKEA 3A36A 5FPSA 1QBKC 3ZS8A 1SVSA 2BZ8A 3T1VA 1XMJA 4JYCA 1GOTA 3Q9LA 2FZLA 2OI3A 3VS6A 2VHJA 4OBEA 3TUJC 5JHHB 4O2LA 2R2AA 2VBCA 2ZJ2A 5FOTA 2YUOA 2VYFA 2CE7A 4JJDA 1ONBA 3IO5A 2DL7A 2IYZA 1RLPC 2IYWA 4XVRA 1ZC4A 1E69A 1R4AA 2BMEA 4DB4A 5HE9A 2CJWA 2VP0A 4PO9A 2FU5C 4D82A 1JQJC 4HEJA 1U8AA 2GEVA 1IN6A 1XB2A 3O8RA 2FSGA 1H3HA 4LZZA 4LNPA 1E0SA 4M9ZA 2J59A 4MKGA 1O87A 4D8DA 4EAQA 3AM1A 3NC1C 2DBKA 4FD2A 1UJ0A 3KL4A 2IHBA 3TAHA 1PUJA 3TNFA 4HVWA 2ERXA 5SZJA 5EP1A 1A1VA 2QTVB 3PEUA 1E79D 4ABYA 4PXAA 3BRWD 1M3AA 4Q4LA 4A36A 4RJLA 1NG9A 2E5KA 1SVKA 2NO6A 4AYWA 3M0RA 1W46A 5IRCD 2R8RA 2DL8A 1K6MA 1YWPA 2NO1A 2ZSAA 3VR4A 4HZUB 4TL9A 4KYUA 5CB6A 3TSOA 2F9LA 1NJFA 5EXTA 2WIBA 821PA 2PZEA 1W4CA 3UA6A 1IM2A 4NHOA 5CM8B 1KJZA 1KZGB 4PHHA 2YJTD 1X1SA 3QPUA 3V9PA 5DGXA 1WBBA 1OLOA 4Z54A 3KQLA 3CO5A 4HATA 4TMTA 3SYNA 1II9A 4TLDA 3AVVA 1Z0KA 2LKCA 3NH9A 4GL2A 1AN0A 1OPLA 3TVTA 3QI2A 1YN8A 3HR8A 5IHNA 5CYOA 3CH5A 1P60A 2F43A 2ZSBA 5DI9A 2ZYWX 3B1VA 3NPFA 4NP6A 2R6DA 1YHNA 2JIZA 1EX6A 1S4QA 4N3NA 3W3ZB 1R0ZA 1Q57A 4DCVA 2A5YB 3D8BA 1W0JD 1NNEA 1I4LD 4HZIA 2RGCA 4Q66C 1MV5A 4GZLA 1G8HA 3QKRB 1XTQA 2C04A 2FSIA 4MYHA 3TJZA 1T5LA 4DT1B 1ZU5A 3IQXA 1DAMA 1J8MF 1KI7A 1NMXA 1KDOA 4H1VA 4LYHA 4NH0A 2D06A 3TIFA 2PZ1A 4JZ4A 3THKA 3W6NA 2IS2A 1QCFA 4RUGA 2DM1A 1KJYA 4OMNA 3CX7A 3GLHB 3FKSA 3N2EA 4LUEA 4M1YA 4ZCMA 2I1QA 2IUSA 3HDTA 2ZEJA 4OHXA 5UKDA 4ERNA 3THOA 3Q85A 1YZQA 4EKDA 4WA7A 5BQ5A 5EZ6B 1AGPA 3BC1A 1YZTA 1U8ZA 2VTKA 4HSEA 3WRYC 1Z2AA 1BU1A 3I9QA 5D3QA 3KX2A 3UANA 3C8UA 4D4MA 3LLUA 2EYWA 2CREA 2R6AA 2RGXA 1XTSA 4Q4JA 5KSOA 5DISB 2ROTA 1LS1A 2IYVA 3I32A 1GM5A 1L8QA 1UDLA 4A8JB 4MUAA 2KT1A 3CF6R 1UUEA 2EVRA 3EA0A 3ZVNA 4ZDWA 4KYIB 1TQ2A 2WWXA 4Q4AA 3SFZA 4JL5A 1SHGA 1P5ZB 4LHYA 5F98A 3WYGA 4PAOA 3T12A 3T1OA 3FHCB 3Q5DA 5L3VA 3VTKA 4MQBA 4PANA 1QVAA 2ZR9A 2RHMA 2LKDA 4JT4A 3PEVA 421PA 1R5NA 1M30A 1VCNA 4GNKA 5JS8A 3GLIE 2FPKA 4OQNA 3EX7C 3PUWA 1G8PA 4IIMA 2DHRA 4LWZA 4NPHA 2BCJQ 1X3SA 2OCAA 3SE0A 3GLGA 1U8YA 4KODA 2HJVA 4RTWA 1CJKC 3L0SA 3X1ZA 621PA 4GSYA 3U23A 3CH4B 4F17A 2WPDA 4FWIB 1E6GA 4A0RA 4HB4A 2GXSA 1NY5A 2BZXA 2IXGA 2ZITA 3KKOA 4HAXA 5IHKA 1G291 1G6OA 1XEXB 2I1VB 4B3FX 1E2PA 3HU1A 2P65A 1AWJA 1KMHA 2WJHA 3DO6A 5DSZA 2FSFA 5AR1A 4U7DA 2XZLA 1W0KD 1QHXA 4KFUA 1SGWA 2GXUA 3REBB 4I1OA 4Q00A 2LCSA 4WXRA 5L3RA 1HE8B 2WMNB 5L3QB 3L0PA 5CYPA 4DLVA 5L3SB 4OQFA 4OYHA 5EQTA 2QP9X 3FKQA 3CZQA 1IO6A 4MKIA 4Z88A 1U98A 4GRAA 4C0SA 4OHZA 1KYIA 1VPLA 1N5LA 2CCKA 2ZS7A 3TVDA 3GJ5A 4HAYA 2XXAA 2QPAA 2WAXA 3WMGA 3NHNA 2W00A 1E9RA 4I1UA 1IAQA 4A9AA 1ZD8A 2IEYA 3B9QA 3OEHA 3ICQB 4MRSA 3AGPA 4IFEA 5FR2A 4B6EA 2XMFA 3VS3A 1W47A 1IOZA 1NBMD 3GD7A 1E0AA 3U3KA 2H7VA 2W2TA 3BE4A 4CC2A 3U7GA 2DWQA 5EXPA 1EG7A 5J47A 4Q03A 4C0BA 1P62B 4D6PA 3EHQA 2Q3MA 1W1FA 1UE9A 4FCVA 3RAPR 1G7CA 1AGRA 3KKPA 4D81A 1U2RA 1I07A 1XMIA 1XP8A 1XZPA 3TLXA 2A5GA 4IOLA 3UIEA 2CCJA 4C7OB 121PA 1A0NB 3CNLA 1E2QA 1T0JB 2GZAA 2J1LA 2V8OA 3AUYA 3QKUA 4D0LB 2WSMA 2IYRA 4B76A 4RTVA 4JYBA 4M1MA 2L3PA 2KXCA 1KZ7B 4A0HA 2JLYA 2F55A 4UJ5A 2FH5B 4NONA 3FKSD 4NTZA 1S3SA 1OHHA 2ZVPX 3QWXX 5FPKA 4FMDF 2FPLA 4BZPA 4GPTA 4Q9KA 4DCSA 1LB1B 3UA7A 1ESNA 2DFLA 4D2IA 2CL7X 1P2TA 3H84A 1RFLA 1SXJB 1Z63A 1NP6A 1UAAA 1NEBA 1KAOA 3QQ5A 1G3UA 1GNQA 1KI9A 2H57A 4KAXA 4M1OA 1N6LA 2J87A 2P6NA 2NTYC 8OHMA 2WTUA 5CITA 2F2XA 1E32A 3GJ7A 3DHWC 4OMPA 2GVZC 1S9DA 1S8FA 4CT5A 1JAIA 5JSZB 3NBXX 1KDTA 3P4XA 2NO9A 2XNSA 4XJXA 2IS1A 1JO8A 1QLYA 1UEJA 2FEOA 3E2IA 5E7JA 4AYTA 4G0NA 3WHKA 2ED0A 4PPNA 4RSGA 3A1UA 4HDCA 1R5BA 4DSTA 1WE2A 3EWAA 1QF9A 5IXBA 2LJ3A 5C4MA 2QQ0A 1OXTA 1I4DD 1SPKA 3NVAA 1OFHA 3PEYA 1Z47A 3BIFA 3RRNA 1GKIA 1DG1G 2PLFA 1TEVA 3FHOA 4C30A 4GFDA 2YOGA 5LDDC 1II8A 3PENA 1IXZA 5FBWB 4CF7A 4JLAA 1OXUA 1D2EA 1UPTA 2KE9A 3ZL7C 1OFUX 4X8MA 4ZCLA 2QM7A 3VHLB 2O8CB 2BMJA 2BOVA 1KSGA 1ZINA 2SRCA 2Z43A 4NE2A 4F4IA 4R9UC 1ZD9A 5KNBA 1WCV1 3VR3A 1G7SA 1MT0A 2DYKA 4M9QA 2RGAA 4B3CA 2CMKA 2XX3A 3SJBA 1U81A 1RJ9A 5HZKA 4TYWA 3EG5A 1GDDA 3VR5A 2QAGA 1SRMA 4TWZA 4M0LA 1Q1QA 4QBGB 4NYIQ 2EFHB 3RYTC 4PZLA 3W3AA 2YC2C 1CJMA 2ODNA 3QNUA 1IN4A 3FMPB 1WXBA 3NMZC 3OAAA 1JPNA 2OCPA 2OXRA 1KI8A 1WFWA 2QTFA 2R65A 5TV2A 2DR3A 3B6EA 4LC0A 4IEEA 4O3MA 1E6CA 2K3BA 1Z8FA 1ZUIA 2DWPA 4FINA 1PKTA 2RNAA 3IBYA 1CS4C 1TL7C 2OAQ1 1JR3D 2JAQA 4LRWA 3VR1A 4JKIA 1YZNA 2VQSA 2ZYVX 3EG3A 1EFCA 3B2EA 3IPYA 4KFRA 2BMDA 2VIIA 3GEHA 1HD3A 4CVNA 3RWOA 1Y3AA 3KQUA 1XPOA 2OLJA 2OM2A 1US8A 2RCNA 4XSHA 1VA7A 2AKKA 4B73A 2RQUA 3O5ZA 1XJ0A 1Z22A 3GLFE 3LW7A 3ZGXA 1JPJA 1ODFA 4BFSA 3V4FA 2ZRCA 1MV3A 1AZSC 1G16A 1QKXA 2B6HA 2BIFA 2YYZA 2ESWA 2KEAA 3MSXA 4M4SA 5GJWC 2IX3A 5KYKA 1LF0A 1P2VA 1ZM7A 3VX3A 5DYIA 5AWFC 2AKLA 1SXJA 5AJZA 1NRJB 1QG2A 4PC2A 4AG2C 1NVVR 4RFVA 5KTYA 5E7IA 3LLMA 2ZXUA 3QF4B 5KSYA 4KBFA 4S2EA 5ANRB 4JLOA 4WZBE 1H8HA 2HCJB 2CDTA 1KMHB 4GBQA 1OFTA 1NLZA 2A5FA 2EYQA 2A30A 1UBFA 2PCJA 2OESA 3KFVA 2ZI6A 5JEEA 2CT4A 3SHWA 1S2MA 5B30A 4W7SA 5KUTA 1KOFA 2FG5A 2OHFA 2ZAMA 3Q7PA 3S1AB 2IYTA 2VF8A 4ESHA 2L3QA 4LCBA 5FTJA 1GL7A 3K1JA 5TDHA 2XB2A 2ZRIA 4US0R 5JWRA 1G8FA 2J6FA 2P5SA 1JR6A 4CIDA 4O25A 1VCMA 4MITA 4OHYA 4IDNA 1G3IA 5CLQA 2G83A 3REAB 3REGA 3FB4A 2EW1A 3D3QA 2UZIR 3DMNA 2KT8A 4OQLA 4LBZA 1X2KA 2FJUA 5FBVB 2LP5A 3TE6A 1DOAA 2C0OA 2FV8A 5CIWA 3SEMA 4LBWA 1NLFA 2O9SA 2JS0A 1HY3A 1NKTA 3EZ6A 1GNRA 4IOJA 3AVUA 1AWWA 3EPKA 3TR0A 4EIWA 3A37A 1JALA 3W5IA 1Q20A 4H1UA 1KHTA 4I1SA 1AQUA 1YR9A 2QGNA 4BLSA 3U4QB 5TARA 2JATA 2IEZA 1ZP6A 2GA8A 3CWQA 2J0QA 3H41A 1YP5A 4OQXA 4DWJA 5KHOC 2WIAA 2OAP1 5DH9A 3K70B 2IXEA 1W0JA 4MYCA 4CC3A 2CHGA 1NVWQ 2JLQA 1E9AA 3AF0A 3KUDA 4LHZA 5EXSA 5JI3E 3CRVA 5AJVB 4EFNA 1ZW6A 5JSZA 2D7DA 4HVVA 1L4YA 5GJVB 2C98A 2IW3A 4PQYA 4QM7A 2RGDA 3GLHA 2DRMA 2CH4W 3ZIAD 1XTIA 2LMJA 3M0SA 3IDQA 1EFUA 2ZE8A 3IHWA 2LQWA 1T9HA 1SRLA 2VVKA 1RUWA 4L5BA 1E98A 1AJEA 3AVPA 3AKYA 5DE3A 4NBSA 1CEEA 4PAMA 2F1IA 1RC8A 1HT2E 1ZM4A 2TMKA 4ACAA 3RS3A 1NYFA 2ROLA 3K0AA 4LHVA 2BVNA 2OBLA 1LF5A 5AUQA 3AEZA 3BOSA 2FEIA 4TQUS 3DOEA 4QBIA 4P4SA 4MGKR 2JW4A 5JMTA 1ZAKA 4TLBA 1E2EA 3EPLA 4JSTA 1SVIA 1IXRC 3UKDA 3FMIA 3HR7A 4F38A 1OYYA 1S1CA 5GJVC 2JTEA 1NMYA 2CHQA 3VMFA 1FQKA 2EQBA 4Y0AA 3G5UA 1VIYA 4FW9A 5EE3A 2ZJZA 2YOFA 2D8HA 2O31A 3U6KA 2EBPA 2PMDA 3PE0A 1V43A 3LVQE 1R0WA 2ZJBA 3KKNA 4B33A 4M8NE 2V7QD 1QHGA 4II7A 5BN4A 4AG5A 4DIEA 2CNWA 1GBQA 4B44A 1G8YA 3N2IA 4ZIRB 4A92A 3QG1A 4CEHA 3UMRA 4BECA 1X43A 3TR5A 4AG6A 3NBFA 3CNNA 1CSKA 5EE5B 4DZZA 3HP1A 2EFEB 1XD9A 3OEHD 4D0NA 3GLIA 1JNYA 2DWOA 2G1KA 2NQ2C 2WZQA 2D0NA 2ZTSA 4RCZA 3KB2A 2W2XA 1WXQA 1CKAA 1KO8A 1PHTA 1E4YA 3RRYA 2BEKA 4NZYA 1I2DA 1HQYE 3AB3A 4OMOA 2JDID 1ZUUA 2H5EA 4NCKA 4BFYA 4DHEA 2CLCX 4DIDA 2L0AA 2FA9A 1N0VC 1CTQA 1N6OA 1IONA 2NZJA 4HI0E 1AKEA 3RS4A 4U00A 1QHNA 3GJ3A 2IWRA 2J46A 2W0MA 4P33A 4EPYA 4N0EA 4J9DA 2ZPTX 3H86A 3MG9A 1BYUA 2EPDA 2QEQA 5HE8A 1NYGA 1VG0B 4PC7A 3ZJYA 2FDCA 1WRBA 3OESA 3U6BA 3TH5A 2E87A 5FFMA 2XJ4A 3MUFA 1FQJA 2K5UA 3KXIA 1K76A 3HYRA 3IIJA 4U5XA 1SKYE 4CYMA 5FPHA 3TUZC 1AQYA 2GCOA 5AJYA 2DVJA 1N0WA 4ZKEA 4OKSA 1E99A 3QVVA 1R10A 1KK3A 1R7RA 4EJSC
chains in the Genus database with same CATH superfamily
5JDCA 3FDJA 2ZM5A 4E7HA 1RE0A 2VDKB 4IW3B 3TIIA 2Z1MA 5FUBA 1RHUA 2EP8A 5GV7A 4BP3A 3C6KA 4HLDA 4DDUA 4IKFA 1KAHA 4QU8A 3VI3B 4AJ9A 4L02A 2R1ZA 3H16A 2X0FA 4KE8A 1Z29A 3CURA 4A6XA 4FKBA 4EHDA 1YE3A 3EFHA 4YJFA 3ZXSA 1Q2UA 1H8EA 3E8XA 3ZNQA 3QJ6A 4GSLA 3RMQA 2B7BA 2C2OA 2WP0A 1XWFA 1MT3A 2ZB8A 4H3SA 4R8MA 5FWCA 4V39A 3CVYA 4LXHA 3OQBA 1BJTA 3SC2A 3MPOA 1FP2A 2I2BA 4N54A 4EB6A 3M70A 1K1ZA 4QG3A 4CT0A 1MMAA 5H9WA 1VHWA 1T3HA 2QV0A 4PYLA 2LPMA 5DNAA 5JVDB 1A4IA 2OHJA 3WKDA 3FTEA 3C12A 1AXEA 2C97A 2Y1WA 3GXOA 3U81A 3V4ZA 5KDOA 1IWPB 1IN1A 2EWVA 1NXOA 4WY8A 4B6RA 2DNUA 2MTBA 3H9JA 5HM8A 1GUYA 4CIWA 2VNHA 1TUGA 1XLTA 2I7CA 4Q1AA 4L8VA 4DR7B 1UK6A 3A4MA 1VLLA 4JZ3A 1ZXLA 3ANTA 4BTEA 4RYLA 1CUYA 1RLMA 2GN4A 2GJ8A 2XODA 3I39X 3EVGA 4GEGA 3A1PA 4A8HA 1Y8RA 1U9ZA 4FI3C 5GM2A 1O3YA 4QWMA 3I28A 4JUFA 3VC7A 3O1LA 1VKNA 2BH2A 4M7DB 2I4TA 2ZCUA 4FSXA 4G2NA 3DC2A 2R58A 3T4UA 1MHTA 5SYAA 1K6JA 1LBQA 3ONEA 2XDDA 5AYVA 3M6FA 1Q0UA 3QPVA 3TK1A 2BF7A 4F04B 2EJFA 2FW7A 4AZ3B 1O03A 1VYUA 4DWOA 4JQZA 1JYEA 4AUMA 1UZUA 1V16B 2IX9A 4LJAA 5B4VA 2V96A 4FK8A 1FX1A 4KR0A 4JEHA 4DREA 5G4KA 3R3HA 3L0CA 2LW7A 4UCQA 4BFVA 4RW0A 4EGQA 2G0AA 5HVNA 4FYWA 1TM7E 1KC8U 1YONA 3TCKA 4RKFA 2CYBA 2MF2A 5KTSA 2VJAA 1Y3CE 3WYBA 1UKYA 5NLLA 3VV0A 4UNIA 1P2UA 4E1BA 3HXQA 2V74B 3C4VA 4OVAA 3KTDA 4Q9LA 4YRTA 4DSNA 3CCVA 3LDFA 1F51E 3AHGA 3NNDA 5DTRA 1WDKA 2I34A 4OQDA 2JDIA 1GPUA 1TU0A 4ZCRA 3B82A 1EE1A 4JR1A 4QUJA 1Y82A 1YDWA 5ELMA 1BOOA 1I32A 1IEQA 4EG3A 5DNCA 2NUBA 4BP9A 1URPA 1U1TA 3AV0B 3FJOA 1UWVA 3E03A 3OICA 4W1SA 3FNBA 1QZ3A 2QMOA 3LKBA 3ZCXA 3MS7A 3EIOA 5AR1A 1TQDA 1XD2B 1YV9A 3IE2A 5I3ZA 3KDSE 4QDOA 4DVJA 5JEDA 3KJFA 2ZW9A 1WCYA 1VG8A 4DSOA 1UINA 1CJUC 2PIDA 1SMKA 3CCVQ 1OLUA 3L1UA 2SECE 4FGWA 3TB4A 4D9MA 4YRDA 1PO7A 3Q5EA 4RZIA 5JSFA 3QFSA 2IP4A 4L74A 1USVA 2CW5A 1SB9A 1V8PA 1VXOA 2QLNA 1NJ1A 2C31A 1UGQB 4ZEXA 4CCYA 2CLHB 1X1RA 4C76A 4REQA 2CT3A 4FE7A 3RQSA 1OX9A 3EUWA 3JZFA 3FC3A 4NZOA 2PGXA 1Z7EA 1YZHA 2X0RA 4RPCA 5F2EA 3BFVA 2A94A 3AUKA 3MIIA 4JOCA 2DXBA 4TL6A 4TL7A 2GJSA 5C5EA 4X00A 4F6RB 2W6JD 4MQMA 1KEVA 2GTIA 3SOPA 1GD1O 4U5QA 1PUIA 3Q1JA 3ZZMA 3PQ7A 4ZT6A 1QPGA 2D1QA 1SU6A 2OBNA 3RAEC 1Z25A 1OBFO 2TRSB 3MWFA 1FW6A 1G20A 2Y4XA 1OQAA 2DKNA 3I55A 3AUJB 4G56A 5LU8A 4BWYA 3DWFA 1AK2A 5CLIA 4Z4HA 1T2CA 2QTLA 3QGMA 1JX6A 2O1SA 3NOOA 4IGKA 4IILA 4PONA 4O4JB 5DMHA 1B23P 2PTHA 2EIHA 3ADPA 2Y67A 2AFVA 1ZJ5A 5I7SA 4GI1A 3CVVA 1S7CA 2AEMA 2VRWA 1Z7GA 5HF6A 5EXXA 3VR2D 5LQJA 4Y92A 4HVCA 1NBEB 1A8HA 4E33A 4X9CA 2EQIA 4AS3A 4YT2A 2KK4A 3DEYX 3X1KA 1WHHA 3MM4A 2YHUA 4KAXA 4ZK6A 3LVBA 1JWLA 5HF9A 4KXNA 1GY8A 2HF2A 1T3SA 1JG2A 4QUBA 2DR0A 2FN8A 3VJMA 1FSSA 4LJ5A 1G20E 3FB1A 4CEJA 1FQWA 2EGGA 1PWHA 5F3WB 1PK8A 5EP3A 1P4JA 1AO0A 1WVMA 1RWXA 2LTAA 3LJKA 1FPQA 1WCIA 4UC4A 4WCVA 3H9BA 4P58A 2MOKA 2O48X 3P26A 4UVHA 5G4KB 4WZBA 3UXEA 3ZHRA 5LWHA 4PZUA 5DK4A 4WOJA 1Z6YA 3JQFA 2EFIA 4G5QA 3SPXA 4JXXA 1MO5A 3B2QA 3M49A 2QQ5A 2I7VA 2CVZA 4HQKA 7REQA 1GAXA 2JM9A 3CVXA 2H4ZA 2AEEA 5C5IA 3BD9A 4GOKA 4YRQA 4YV0A 3Q12A 3FDFA 3QLUC 1M67A 2MHCA 4HR7A 4OY3A 3FCUB 1O0CA 5E8JA 3RFVA 2F8LA 1L8XA 1SUFA 3HC7A 3OCYA 4Y2RA 5HF5A 5C3UA 3ACDA 3WXMB 1WUYA 4JIGA 3HO6A 4RHXA 1Y5RA 3H11B 4BX3A 5GY7A 3GNFB 1ZA1A 3QZ5B 1U80A 2RHRA 4Q7EA 1CX9B 1ZN7A 4PG5A 2A92A 1IEVA 1KNXA 1Z6PA 2BFMA 3OCUA 3SN6A 3ZE2B 2Q3JA 3OBWA 4YJGB 3P5BA 4QGBA 2H7YA 3DGFC 5DGTA 4F4JA 4PNOA 1RADB 1TTPB 3SQXA 1U2TA 3NEPX 4E09A 2JGMA 3BRWA 5C6SA 2EJ9A 1VE7A 2VUHB 4G5RA 4OHPA 3D5EA 3V7FA 1JDSA 2GF9A 1NVXQ 3EVTA 3HLTA 1COWA 4UW9A 5JWHA 3E8MA 3W8DA 4GMFA 2BCGY 4R3WA 4TMVA 3D4PA 4TV8F 2PSHA 3CE6A 1XAJA 1R6TA 2BUAA 1IXSB 1KPIA 1PT6A 3FOBA 3WKCA 5DIZA 2DLCX 3CMAA 1G9TA 3RJMA 2ECQA 3DCIA 4AN4A 1V8OA 1X80B 3AJAA 3FJ5A 3NBYC 3MELA 4BE4A 3ZV4A 2AT1A 4O4JF 3CV3A 2FMUA 2G06A 1CDOA 3IGFA 1RBQA 3LUDA 4B17A 1V1MA 1JDBC 2OZLB 3PKIA 2ZJYA 1WWKA 2OV6A 3H83A 1DLIA 3QQPA 4EHAA 3M58A 1W36D 3FEOA 3T7EA 1RCTE 3G2IA 4QFCA 5TF0A 1DTWA 4V0RA 1GGFA 1HDCA 1XK7A 2ZREA 4QEZA 1QVRA 1AKVA 3KEQA 3QKTA 2BTEA 4Q5WA 2A9PA 2VBGA 1P3Y1 2X86A 2XQIA 4YHBA 5JALA 3EFOA 5HTKA 5KJFA 3WIEA 3TNYA 1YJ8A 4PIVA 2F3RA 2ZTLA 2XICA 4NS5A 1KD1R 2QLJA 4FLMA 5CA1A 2AD5A 3QVWA 4FZ3A 4U7JA 2GPYA 2H7CA 4AECA 2NVBA 4NE7A 1W5AA 1UQTA 5FO0A 3EW9A 1DAEA 4IIFA 3V8RA 2QP4A 2BKAA 3UMSA 3ZGVA 4YRLA 3CEYA 4NFLA 4AMZA 2XQKA 2NX2A 1C30A 5KSWB 1TQ8A 4D92A 1V47A 2A3RA 5H5JA 5J43A 1GAQA 2HNAA 4NL3A 2O4CA 2OT3B 3PWTA 3KYDB 1YZYA 4MOWA 3A1VA 1GAWA 3FH0A 1EAMA 2IIPA 4FOOA 4RM3A 1YVEI 3JAME 1MAWA 3EG9A 2WM9B 2C77A 2WYWA 4Y6OA 4KOEC 3JQAB 4HF7A 1G55A 1PJBA 4ARCA 4D8UA 1CB0A 1K98A 5ALMA 1E3MA 2QLFA 2VPTA 1CIJA 3TQQA 5KWEA 4ZJYA 3D0OA 1BCMA 4U7PB 2AG6A 3RC2A 3EGVA 4MW2A 3NUZA 2RHUA 2I6UA 2JFOA 4M6WB 4PPYA 3OY2A 4P3NA 1Y63A 2F43B 3D3KA 3O4GA 2FPXA 2CKKA 2J9RA 2X15A 4TMFA 3CCUQ 2ZJOA 1EP2B 2HLDA 1UM8A 3DT8A 5SV2A 1G83A 1ABQA 1XOVA 1P9RA 2EV9A 1PHPA 4O1MA 3GF5A 4GZ3A 3EULA 5DOVA 4C92C 4DA8A 4FYJA 4RZ3A 2IK8A 3C74A 4XZ3A 5JMPA 2WBLC 2ZRGA 4ESRA 3Q2KA 3WHPA 3LQYA 4K9LA 5LJ3e 1HYBA 1P5RA 1W5SA 2WSEE 3ZXXA 5IJ0A 3F0TA 4WZAB 2MWMA 5IYZA 1AKNA 1LRLA 1O95D 2HXSA 2YY7A 3CNQS 1WXUA 3HP9A 1CUVA 1F14A 1G8KA 3KUCA 4MK4A 4QDKA 2EJWA 2EX4A 1SF9A 3V6MA 1AM4D 2FEKA 1N8RR 1VFNA 5ULLA 4RGBA 1X19A 4ND5A 3MJXA 5IYZF 1G7TA 1NZ9A 1RADA 4HAZA 5KYYA 1JSRA 5T6MA 4FX5A 2E1HA 4PRZA 3PC6A 4RPKA 3ZBDA 1OWOA 4Z3DA 3ICOA 2GZ3A 4ARAA 1S8NA 4CKBB 5T67A 2ZIWB 1ZBDA 5JRZA 5HKAA 3WA6A 4R8LA 5ALYA 2JCGA 4YRKA 1C4KA 1NW3A 4EHLA 4DBRA 2COUA 3WLHA 3RSZA 3FN4A 1LPPA 2BMVA 5DNVA 2XMBA 4LQCA 3ZEAA 3OM9A 1K73C 2JJ8A 3EB9A 3JWGA 3SZUA 5JFOA 1LPMA 3TRIA 2ZDQA 5JXIA 4IFIA 1MPXA 1AQJA 5AW1A 3BPSA 1IC6A 2NU9A 1V8FA 1JAHA 1KKMA 1R0YA 3L4SO 3NWJA 4GR4A 4CQNA 3J81k 1B1AA 4F92B 3ZU6A 3FA2A 5B5SA 3HHEA 2Q9UA 3MERA 4A4EA 2IY8A 3IA2A 3K9QO 1WPQA 1XEAA 3B6KA 4J3JA 4M37A 4PG4A 3KXLA 4YRAA 2ED1A 3JQ8A 5EVJA 4DAOA 2WUGA 1BCOA 1XZNA 2VYNA 4RPLA 1VB5A 2WWYA 2BGNA 4QD3A 1DEKA 1FUKA 3MPUA 2GM5A 1GEGA 2WKSA 1P74A 3NWOA 2REXB 1M1ZA 1NBOA 3QE3A 4JJAA 4R31A 1GFDA 4AJEA 4TYYA 1YRQA 3P19A 1XMVA 3EIHA 4MWOA 4B40A 5HIMA 4QA9A 2FFAA 1MG5A 1KQSP 2ORWA 5KKNB 4QDXA 1JEYB 5AJWA 4EJSB 4KXFB 1X74A 2K3YA 1FXSA 2SKCA 4F5EA 4XRGA 2FPRA 2HLHA 3IT0A 3QY0A 1M90U 1P6XA 2NSJA 3Q40A 2RH2A 3AEQA 3FZEA 4RO0A 5FPPA 4EMBA 3KETA 1J09A 1AVTA 1J8YF 5A4AA 2IXAA 3CD6T 1FUIA 5DHUA 2P8SA 4B48A 1AA9A 2E6KA 4RMNA 4ZVNA 2UVPA 3RTBA 1IATA 2HMVA 3SHOA 1UBLS 3B3AA 1H94A 2KRMA 2NSDA 2O0HA 3EZYA 3FLAA 2FP4A 4X20B 1W4BA 5IJ9A 4I6JA 4R7GA 1RABA 1OZ2A 3MTIA 1KVRA 2HQBA 3CRQA 1LWNA 4HQ0A 3O3MB 1QHIA 4FCWA 4LW8A 5HM6A 3ZDAA 4NMMA 4OHMA 1QZUA 5CB8A 1OIVA 3OZWA 1K2WA 2OGWA 4EHKA 4LBVA 4F2PA 4DY6A 2IZOA 5AVXA 3FPEA 3JWIA 2JI7A 3OE7A 1ZOIA 4CT4B 5A5FA 4JCCA 4MVWA 3PUIA 2XKOC 2ZSEA 3DNFA 3HEBA 3D0KA 4O4LF 1SWVA 2CLLB 2QUAA 3GLFB 1RQXA 1JJAA 4RD3A 1U2DC 4UPDA 4F9FA 1DI0A 4YDSA 1HQCA 2J5KA 3F3MA 4LUCA 3ZVKA 2EEZA 5CW1A 4RHUA 4NNJA 5FOUA 2H0QA 4FFOA 3QKSA 4GQIA 3WLOA 4JX8A 1TPZA 1QANA 4G4SO 2IYYA 2GRAA 2Q2WA 5ALRA 4RJJA 4UOEA 2OHXA 3CZPA 2Y4NA 2JAWA 4DR3B 1JEJA 3CMEA 1KMQA 1VE6A 2X13A 3T3MB 3AEKA 3COVA 2O4XB 1CULC 3JCMX 4G1CA 2OLKA 3DD5A 4QRHA 5KVSA 3HWX1 1ZIOA 1D0XA 3EXFA 4OYLA 3JYPA 1H8ED 2FGKA 2PX8A 2VXBA 1G5HA 2YWCA 2ZTVA 2GZ1A 3ELUA 4CIAA 4N3GA 5C7IO 1PGNA 5LKAA 2QYTA 3O92A 4LKRA 4X41A 3WL5A 4DVGA 1U0GA 5ITWA 5IAGA 4ALMA 4URFA 4P0TA 1RAEA 3DB3A 3H3JA 3HCWA 2XD4A 4JI0B 3EIUA 4X66B 2CZ1B 1J0DA 2ZU0C 4E5VA 1MXHA 1Q95A 1CR4A 1QZTA 2EZ9A 1YO6A 2PU7A 5JJ5A 4R5MA 4NU0A 4QDZA 4PJNA 2IIMA 2RHTA 2RSLA 3BUSA 1K9AA 3D9QX 4I55F 3U40A 1JXOA 5GAMg 3P4YA 1QH0A 3VZDA 1XMQB 4EUNA 2VJNA 1J0BA 1NXPA 2YNMD 4UEWA 4C0FA 5WRFA 3GZNB 1YQGA 1B0AA 2WV7A 1QDEA 5HQ3B 5IBQA 3AVXA 5F52A 4K5QA 5IT5A 4NG5A 1SM4A 1VQ6T 3C85A 5JC1A 2W2LD 1GUAA 3HVIA 5C9ZA 5HMMA 1RKBA 4BVFA 1D09B 1J99A 3EQ7A 4R8KA 1KYWA 1U0EA 3ASUA 4MVJH 2R6ZA 2VJOA 4M55A 1FUUA 1NN0A 3IMFA 3W2GA 4AWXA 5CXSA 5AW3A 4C8QB 2AR9A 3GFQA 3VJPA 1OIXA 3SC6A 4E2YA 3IT2A 1QQJA 4M77B 2OBYA 1HT1E 4LHSA 3SZLA 1Z8NA 1LJLA 3LFTA 3HFNA 3HCOA 4V0ME 2EAYA 1BHJA 2W98A 2HWYA 1BOFA 3A06A 1V0JA 1RI3A 3UT1A 2A58A 2XGSA 1F5SA 1R6BX 3FMOB 3NASA 1VTKA 4JT9A 4UZEA 3WLJA 3GRPA 4M75B 4X94A 2HBZA 3KLPX 5CBPB 3VR5D 1BYMA 1N1EA 2ZQYA 3CCRA 1EBFA 1RXYA 2W8BB 3BDUA 3H9CA 3OIWA 4WN9A 4YV1A 1Q7EA 4QX6A 4LDUA 4CKEB 1FFXA 3U9SA 2CNWD 3CC2Q 2QL5A 3IAS6 2VHZA 4XKJA 3SM9A 1YZUA 3FTCA 3BSFA 2EX0A 4R8RA 1SZPA 1EUQA 2ZWMA 3VXKA 4HPWA 3H4IA 3RDPA 3EQ9A 3DT6A 3Q7RA 1DPFA 1GSIA 1MAVA 2P0PA 4K87A 3NTHA 1KBOA 4XR9A 5I45A 1XNQB 3RARA 4TM8A 3G0DA 3CINA 1N0UA 1HDEA 3JZAA 4BEVA 1ZIDA 1IHOA 1ESDA 1KSJA 4RJIA 2JMCA 4J9GA 3HKSA 2VXYA 3FSRA 2P4QA 4NZZA 3D8UA 2VSQA 4HBZA 5E95A 4DM7A 1Y96B 2RN8A 2HWXA 2P41A 4QU9A 4TKVB 4L7QA 4XPIA 2JXBA 1QXSA 2AT1B 3GH1A 1I3LA 2YJGA 4HJXA 3UMJA 3FVWA 2HK6A 4ER3A 5HJ7A 5J5CA 3IAEA 3RS7A 2BWJA 1QYWA 1CU1A 2HLNA 5EJMA 2JF0A 1L7PA 2YNMC 3EC2A 1RJDA 3LCVB 3OKCA 2GCXA 2H1OA 3HA5A 3LKDA 2GT1A 1UEIA 2I8LA 3BGIA 4GU5A 4RSHA 3RVJA 3WL6A 4BV3A 3DKPA 5AI5A 1SXQA 1IJEA 5J58A 1NZFA 4FOPA 1KR5A 4BQSA 1LOJA 3FE2A 4TT8A 4NOMA 5I2SA 5E9AA 2HNKA 1FWZA 1XTKA 2D1FA 2FX3A 4KDRA 5E3HA 4R1NA 3HJHA 4TZ6A 3UBMA 1NQAO 3V4LA 3FYUC 5I9IA 2GAOA 3JVDA 4XUGB 4X97A 4Q9IA 3H0IA 3C94A 3DTVB 3RK4A 3RABA 3MTEA 4CPDA 3BKWA 3BRSA 1HQKA 1TDJA 3STVA 3DKMA 3SX4A 5K8LA 4PR3A 3TW6A 2B25A 3UK0A 3LM8A 3VPBA 2PUDA 3KWLA 4ID9A 2AC4A 3IAXA 2CFSA 2KBFA 2X4GA 3F8TA 4J1QA 4RJ2A 4YECA 3LQ4A 2J7PA 2O0LA 4MMLA 4EJ2A 5L3SA 2GLXA 4J2OA 5ALTA 4DNOA 4U2KA 2PUVA 1EWQA 1E79A 1WF6A 5D5PA 4EY5A 1BTOA 1BEUB 1I7PA 5JJIA 2DQKA 1ZCAA 3MBIA 3MK31 4NENB 3NIWA 1Y4UA 4NZNA 2FSHA 3OW2S 3FF4A 1PYOA 3ZXYA 2Z8YA 4M6WA 3CC4A 2B34A 2F3PA 3NBKA 1VCHA 5DCLA 4C92A 4M77A 3OI7A 3DFUA 3OH8A 2E6UX 3GFSA 3PL1A 4KIGA 2FEAA 4IXTA 4PSDA 4HGOA 1GCGA 5FTWA 3PHCA 1M2JA 1BKDR 1K5DA 4WLOA 3V1NA 3VKUA 4AFZC 1DBSA 3UYLA 4KLNA 4B2LA 1XDWA 4C92F 2ERYA 3ELBA 1ZY2A 4CC4B 3IEUA 4IQ0A 4KH0B 1Q12A 3G13A 4M7WA 4RA6B 3BDIA 3PQEA 2GCGA 1DX6A 5HZHA 1T2VA 2SKDA 3EXHC 3FPFA 3O75A 4HLUA 4YNBA 4DABA 5K0EA 3VKIA 1ADYA 4J0JA 2ASVA 4J4TA 1FYWA 5BW8A 3K71B 2WE8A 3UOWA 5KAMA 5EJ7A 2ECZA 3RYCB 3W5BA 1NBME 2QS9A 1IIRA 2QA4A 1HT0A 5DVZA 1ORWA 3BCHA 2IG0A 1MC1A 2FQYA 5DNUA 2OAUA 4PVDA 4DLRA 3DFZA 4OV6B 2ENUA 1OXSC 1QFMA 3S81A 3GUYA 5LBTA 4JU9A 3T5DA 3PE3A 1FRQA 4ETMA 2JJ1D 2Y6VA 4YDRA 1CUSA 1BW9B 1J1ZA 2ANBA 2G67A 1Q6ZA 1Y96A 1RKXA 3DT9A 5FNVF 3TCXB 4NPCA 2G6FX 4TKVA 1OH6A 3QYHB 1VA5A 1ORIA 2HBRA 4MVJF 3R7WB 1P7VA 3OCVA 2PMEA 1GT6A 2XOKD 3RJTA 4HB3A 1MEJA 1PLLA 5JWOA 4MVCA 3E3NA 4Q7JB 3WK8A 1NUHA 5FFFA 4F7UE 2GMWA 3M59A 4LV6A 3WMXA 5TXGA 1N77A 1T2FA 2GJKA 3LOUA 5HCNA 3I04M 4PFQA 2DK3A 1DQYA 1MIOA 4N3AA 3VR4D 1NEGA 1A5ZA 4EBBA 5BNWA 2DFKB 1WETA 4DW8A 4P98A 1NIJA 4AD8A 4EQ6B 5FTNA 1QONA 5FTKA 3MMNA 2QQEA 1Q1EA 2XCUA 3AL3A 2WNHA 3EJ6A 3R3VA 2B2CA 3RYHB 4YP0A 4QOSA 5B7NA 4PO1A 3U3ZA 3OS5A 1E61A 4JIMA 1AGNA 4KXQA 1FFEA 2OHIA 3E9RA 3CF2A 4MQ6A 5FRNA 1TO6A 3A10A 4YONB 1GQQA 4Q4JB 3KYCB 4HAIA 3AJ8A 5K1ZA 3M0QA 3NRCA 1W36B 3RLIA 1FMLA 5DNYB 5H7XA 3NONA 2ZSKA 2AMLA 2AS0A 4HNAA 4L75A 1X7ZA 3EVBA 4DBZA 3RBBB 4Q0MA 4FNAA 2CUNA 3CWZA 4INPA 1QJCA 2RK6A 4W5WA 4JBIA 4MUHA 4WI1A 1EHYA 1PV4A 2QRQA 5BV0A 1PRYA 2AZDA 1GCOA 2B4AA 4F21A 3FTPA 2HYIC 3L1AA 1SZCA 2ZWIA 3LZDA 4AZ0A 4XWWA 4A2CA 1I6MA 5FWDA 3DDCA 1N5DA 1MXFA 1ZGBA 4HWRA 3UG7A 4BWGA 3N70A 4D4JA 4XIIA 2H8GA 1SCQA 1UXKA 1O5IA 5A5VA 2BHNA 3LK7A 4KVAA 4F4HA 4D26A 2XWPA 5KAPA 2NQTA 1NXWA 2YRXA 1B43A 2R7AA 3CKLA 4XX0A 4C0WA 3K31A 4L8GA 5KU1A 1UECA 4BRUA 1H6AA 1BU5A 1XKXA 4OBBA 2Y6UA 4C92G 1KI3A 2WJIA 4G63A 1HA3A 4NKRA 5E7QA 4E5DA 2OXIA 2XI4A 3PA8A 1SBYA 2DWUA 1UP6A 3JQBC 4O02B 5GV8A 3V2HA 4EY6A 3RUIA 3NGPA 4JJKA 1T1RA 2V3WA 4NDNE 4KE9A 3M53A 5C1BA 2Q3CA 3TZ6A 1JXQA 3K9WA 4UUOA 3S70A 4R2HA 3GMIA 5AOCA 5FW9A 4LDZA 2Y0BA 4G23A 3HO1A 2ZQ5A 3VZQA 5IUJC 3RRMA 5JPDA 4GG1A 1D2MA 1E20A 1L5HB 4PN7A 2I8AA 1GDHA 4LYJA 4YO8A 5F77A 4MMKA 1JFLA 3EWIA 1HJDA 2PL9A 4MVYA 5GAMj 2P62A 4HB2A 1IBKB 1R0BG 4G07A 4XWKA 1SOAA 3ETNA 1ZCBA 3E6AA 4KDEA 4NZPA 1Y6JA 2XAUA 3HL4A 3M4ZA 4B8ZA 3THWA 4CM5A 4XEUA 4DZTA 1FMVA 3V1MA 5H3HA 3A14A 5KHLB 1IGQA 2MT9A 1P73A 4O5OA 1X9HA 3VTFA 9LDTA 2XK0A 4XWTA 2O23A 2Q9AA 3NWBA 2EGEA 2W2MA 2P9JA 1A7KA 3D4LA 1Q2XA 2XHZA 1I2AA 2P3LA 3SLKA 1KYYA 3O9ZA 1A9SA 3OSUA 4ZA2A 1BCRA 1T5DX 2A5JA 4MP8A 1JR3E 1MRZA 4F7UA 3EUFA 4PSAA 3ETGA 2K4YA 2ACWA 2IEDA 3R6DA 1K9VF 3C43A 3CLVA 4GP7A 2WHXA 4I5IA 4QUGA 4S35A 3FETA 4QNNA 4S1NA 2WMDA 5KDDA 4RADA 1HNZB 1CRLA 2XY4A 3T35A 3ECSA 4KRTA 2BMFA 3C15C 2YWWA 3R6OA 3EFSA 3DV2A 2HF8A 2G5PA 4UAJA 4CLDA 1G0OA 2H3JA 4EGCB 2RH8A 4QOEA 2X9GA 2CV2A 3WYDA 1E96A 5GQSA 1UWLA 4A4KA 2IV7A 4KQ9A 2C99A 3GIBA 3AW8A 3H4VA 1DOHA 3OWHA 3WNDA 5AK4A 4GUAA 1LGYA 1NI4A 3VR5H 1TMOA 2GHIA 1T8YA 1J9ZA 4E7JA 5DZSA 2DJZA 4YCJA 2NYAA 2VQEB 5AP9A 2PGAA 2J9YB 4BGIA 1NIPA 3LDGA 5AJUA 3DZFA 2KMLA 4RD6A 2ATXA 3PDCA 2OPHA 1O4WA 4GEKA 3ZTTA 5DRYA 3G8AA 4ZAGA 4AMUA 2CSQA 3ES9A 3LHSA 3ISJA 4X84A 1GCQA 2RC5A 1QLJA 4UM9D 3M4YA 1DRWA 1P44A 4DR6B 5EUMA 1N75A 2QXYA 2M98A 1ZESA 3N8HA 3OM1A 4YH1A 1YJXA 1ZISA 1U1GA 1R9GA 2ZJ7A 1Z15A 1RACA 3L7YA 3WNQA 1YK1A 2X4XA 2EKLA 4DILA 2IV3A 4F5DA 2O14A 1B6GA 5K0BA 3HLKA 4YAEA 5FBRB 4ARUA 1EX7A 2WAMA 5JCXA 3TTYA 2KX7A 5MGNA 4L5IA 2PMFA 2CP6A 2UUOA 3RERA 3C3YA 3DGEC 3E3LA 5EEGA 5EHIA 4DSAA 1NBAA 1T2EA 1RTTA 3PQ5A 1ICEA 1V6SA 4MUNA 3META 4FSSA 4ARZB 1Z4MA 4ELYC 1I2MA 2EFYA 3AOEA 4PSKA 3Q3GE 3DB1A 3LGFA 3K9HA 1QIGA 1YI8A 3CZRA 3WRWA 1O1YA 3CLKA 4A82A 2BN4A 2MINB 4IIVA 3ZWXA 3VR3D 3JD4A 2VASA 1O58A 1EHCA 1UWKA 2NZUG 2QKYA 3NJ8A 4NV3A 1YASA 3T9FA 1B74A 1GKUB 3QPCA 4DLKA 1ARKA 2H8KA 4MQ4A 2DQ4A 3D1VA 5CDSA 1QRDA 1FYNA 1YR2A 5KCZA 2R0QC 1RPAA 3GY0A 2F7SA 4PJOD 4HN2A 4OQZA 3WLNA 1YGPA 4KXVA 3RUXA 2BIVA 3UTDA 3IHKA 4VUBA 3C8DA 2CP5A 3DHEA 4JOQA 3MRXA 5CLGA 3J81A 1YRYE 2HJRA 4PX2A 4EO9A 4XD7A 3GLRA 1CXZA 1MFZA 3DOHA 3I58A 2JGNA 2YL2A 5CNIA 1XCMA 1FMTA 4EB0A 2HCBA 2G7ZA 1JLHA 3C16C 2HK7A 4RTMA 1U6JA 1ZRMA 1D0VA 1F2VA 1N3LA 3P9SA 4KPEC 1NW6A 2WKRA 2YIMA 4S1VA 1T9DA 1ZNXA 1W4AA 4FFDA 4DV5B 3GLKA 3G1UA 4BNYA 4E5UA 4BXOA 2GYUA 1MJFA 3NEJA 3WBJA 4GIBA 4JDSA 5DHFA 3IUBA 2FVUA 1X6VA 3JQPA 3HKBB 3V8BA 2CLFB 2RO0A 3UAXA 1TFRA 3NYQA 5B64A 1MDBA 5EZ5A 2OZVA 2OFWA 4K6KA 2RGEA 4RK0A 3CPFA 4U7HA 2A08A 3QBTA 1U3FA 4L0MA 2AQ8A 4URVR 5KH6A 3PHHA 4QQKA 1WLSA 4AS1A 3DZDA 1DARA 3ZG6A 2YHSA 1IOWA 1V4VA 1VBMA 3KU1A 5B36A 3DOCA 4JP1A 1KERA 1PT5A 4WCDA 2HRRA 3KZOA 1BQ4A 2HL5C 1NVUQ 1VQOQ 2FE1A