4DEYA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
319
structure length
281
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1C
total genus 94
structure length 281
sequence length 319
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4deyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4deyA02
3BXZA 3MWLA 1U81A 1GBRA 3RRYA 5A4JA 1CR2A 4QHYA 2GK6A 4JZ3A 5C4MA 4MKGA 1CRPA 4JVNA 2VEDA 4JT2A 2G1KA 1SHGA 2Q6TA 1E9RA 1AOJA 2O8EA 2F2XA 2H18A 1HUQA 1G64A 2RPNA 1UBGA 4ILEA 4QM6A 1XWIA 3H86A 3LW7A 1M8MA 4OMLA 4UNNA 4PO9A 1CJMA 3UXMA 2OM2A 3SFZA 2GBLC 3THWB 1GILA 1WCV1 3ND9A 1W47A 2E9SA 1OB2A 4C0QC 4A36A 1G9XA 1E99A 1Y63A 2MMCA 1YZLA 3M0TA 4QT7A 2K79A 1ZD1A 4I1OA 4G5OA 4DSUA 4L8GA 4ASUD 3LDAA 3SYLA 5GJCA 1ARKA 3U7HB 3MD0A 4LHXA 1Z29A 5H68A 5KSYA 5D3MA 4DBLC 3EIQA 2WOJA 4DVGA 2R6DA 1WRBA 1AEYA 1LS6A 1N6OA 2BIFA 1Z6GA 1NN5A 4IKEA 5AUPB 1DAMA 2QP3A 3DDCA 4DLYA 1TEVA 2AK2A 4IRUB 2BWJA 2DWOA 1UKZA 2ATXA 3UWOA 4EIKA 2JLVA 2OI3A 4GNKA 1M7GA 2GHIA 3MUFA 1E2MA 1G19A 1H8EA 3MJHA 3ZGXA 1E2QA 4GOKA 2G6FX 4PQYA 5AJWA 4O2LA 1LS1A 4MKFA 3DMDA 2IXEA 4D81A 2GAAA 5JRZA 2JMAA 3QUSA 3R8CA 2ECZA 2GILA 2DJQA 1WLPB 3OEED 4RZ3A 2GCOA 1UKYA 1X6GA 2O5VA 1EX7A 1XEFA 4US1R 3LBNA 3KQUA 3A36A 2ZI5A 3ZQJA 1AWXA 2EFEB 3WRXC 4B48A 2D7DA 3DOEA 3CPHA 1LB1B 4RFSB 3O8CA 4QL3A 3BK7A 2ANBA 4FD2A 4LX0A 2A2ZA 5HPYB 2A5JA 3LXXA 1ZNYA 2FEOA 2I0NA 1QHHA 3CX6A 1GWNA 5TMPA 4IIMA 4TYYA 3RSLA 2I1QA 5FH9A 5CM8B 3TE6A 3C5CA 2O31A 1E0JA 2QP9X 1H8HA 2D4HA 2KE5A 3VX4A 3VX3A 1HYQA 2AZSA 4DLUA 3PVQA 3DKVA 2KR3A 1R8SA 5K8IA 1NVXQ 2ZJ8A 4NCIA 3WP0A 1UUEA 2P0EA 4LC0A 3PUXA 4Q9LA 1G3MA 2FFAA 1NSFA 2W6JA 2WAYA 1FTNA 4DT1A 1CU1A 3B1YA 2QY9A 1A1VA 1TX4B 1XD2A 1E2KA 2PMKA 2BBSA 4NYMQ 4ZCLA 4A6PA 2PH1A 1ZBJA 2GAOA 1VIAA 4IDPA 2PLRA 1Q12A 1SXJB 1X3SA 2DLPA 3HDTA 1MRNA 3BAFA 1KNXA 4V0NA 3GLIA 1NBMA 1Y0MA 4C7OA 2DMOA 3ZYCA 3NGPA 1T4GA 2R9VA 1N5JA 3MJRA 5JSZB 2CUDA 1NMZA 4IFBA 1N5LA 3SBEA 3KQKA 1YVDA 4LGMA 4LUEA 4GZMA 3I72A 4LZZA 4KITB 3OE7A 1KK3A 3U44B 5LD2B 4EJSA 2AZVA 2EYYA 2PZGA 2G1JA 3RS2A 3SN6A 2ZIAA 1IN4A 4AWXA 1ZU5A 5D3MB 5FTLA 2J7PA 2QU8A 2Q9AA 2XJ4A 2FZ4A 3D3QA 1UBCA 1VG0B 4LBYA 2RHMA 5P21A 5JWHA 3BC1A 4PPGA 4BASA 3FPAA 2AFIE 2HXSA 4EFLA 4LC1A 1ZUUA 1R0WA 4HAUA 2R62A 3BERA 5G53C 3ZS9A 2OV2A 3I5XA 2IK8A 3K0AB 1ODFA 1E1RD 2NO7A 1NVVR 3UA7A 1FNMA 3ZVNA 1GCPA 1SRMA 3H84A 2CMKA 4JJBA 1EK0A 2RHDA 4NTZA 4TMKA 1F48A 1G1MA 1VDZA 2AKLA 4Q01A 1E98A 2BMDA 1EFNA 3M4YA 3AH8A 5HE9A 2RQRA 1W4RA 1WE2A 3WP1B 2X2FA 1XZQA 2ZSAA 2YSQA 2CEAA 1AM4D 3I92A 1Q22A 4V03A 4LRWA 4XVQA 2F9MA 4B3DA 2ZR7A 1R0XA 4LHYA 2MCNA 1OSNA 3M6AA 4RVCA 2NZ8A 3RC3A 3TQFA 4CT4B 3THYB 1YRAA 4DUGA 1GRNA 4E5UA 4WXPA 4TL6A 2EBPA 2CUBA 3QY0A 3UWKA 3LLMA 1R6BX 1ZX6A 3U4QA 4CW7A 1CIPA 1SVOA 1OIWA 3A1UA 3CUEF 4BLOA 3VRYA 2JLRA 1JU5C 1E6HA 4J9CA 3VS4A 3B60A 1NIJA 3OF5A 4RZXA 3P1JA 5CLLA 3C8UA 2IEYA 5KYKA 4GRAA 1KI1A 1ZRHA 3CPEA 1HT2E 2ZYUX 4OHWA 3U3MA 1RLPC 3EG3A 1ZSGA 2HLDA 3CWQA 3ADBA 1JB1A 4W7SA 3P26A 4EAQA 3ICEA 1ZINA 4D26A 4MGYR 1T5LA 3FMIA 4U00A 3QEJA 2XGJA 1NKTA 1VG1A 3CF2A 1CR0A 3I3SR 3VAAA 2P6RA 2IEZA 2BKEA 2QEQA 2R6CA 4RFVA 1D9XA 1G5RA 1YCSB 2F43A 2JMCA 3M0EA 4XWAA 1FTSA 2VL7A 4MYTA 4DC9A 3GLFB 3NWJA 1NLYA 4TYWA 2OXCA 4DEXA 1KZGB 2VO1A 3QPUA 3MWYW 2LJ3A 2JM8A 2PX0A 2IF0A 5EQTA 2AHOA 2J1LA 3FVQA 5CDFA 3U3OA 2ATVA 1GRIA 1UF9A 2CSQA 4IDHA 3L0OA 1ZD8A 1D2NA 3UATA 1B3QA 2KGTA 2ZS9A 2BV3A 4C4PA 1XMSA 3C41J 5LDDC 1XTJA 3FTQA 3B1VA 4NHOA 2MIOA 621PA 3EC2A 4JLPA 1E2GA 2YUQA 2VSFA 3GD7A 2FJUA 1RC8A 2GXSA 2ZI3A 3V4RA 1U0LA 1ZC3A 4L15A 2KI5A 2K6DA 2F1IA 4H1VA 1PRMC 4DT1B 3CQTA 3L0IB 1N6NA 1KI7A 1OHHA 4N0EA 2HEQA 2OAQ1 5DISB 2VBCA 1JI0A 1QHIA 1Q1BA 1UTIA 1UG1A 1I4DD 4IDNA 4LI0A 1TAGA 4KU4A 5DLQC 2HCBA 1W0JA 2FWRA 1MABB 1Q21A 3JVUA 4I1VA 4LHWA 2ZJBA 2D8JA 1K1ZA 1XZPA 2AK3A 1S0UA 2A36A 4IEIA 5KPJA 3VS0A 3T15A 2ZM5A 2WJJA 2P6UA 4ZDJA 3DL0A 5L3RA 1E9FA 4X8LA 4NCNA 4YLGA 2CLCX 4CEHB 2C0TA 3RNJA 2H1LA 4MRSA 1F6BA 1PHTA 1KDOA 1BOFA 5FPHA 4DDTA 2ZS8A 3IHLA 5IT5A 1Z6YA 4NONA 3GEEA 3VKGA 2NUZA 2FN4A 1QHSA 4G5GA 3UANA 3A98A 4A8JB 4TN1A 1UADA 2JLUA 2DWPA 1X1SA 5DYGA 1EFRD 2NOAA 2WIBA 4C2TA 5BYJA 2F1HA 1Z0DA 3WYFA 4B3BA 4DDUA 1ZW6A 3NBXX 2A28A 3VS3A 1SGWA 3CRQA 1H3HA 1KO8A 1T0JA 2X19A 2WWWA 4OK6A 3K09C 4BRUA 5E95A 2FNAA 2VWFA 2AX4A 1QHNA 1W5TA 2K5UA 1CJKC 4CC4B 3PQCA 4LJ6A 4XSGA 3KJEA 4U7DA 1ZAKA 4WVFA 4HXJA 2JXBA 1XB2A 3VFDA 4ASUA 4K11A 1KO5A 3OFNA 5JI3E 1AVZC 5M04A 1W70A 4OMNA 2B7BA 3ZJYA 4QJ3A 3AF0A 2IL1A 4O2RA 2IYTA 4ZV4A 5BW8A 2RGDA 2Z5FA 3FYHA 2BVNA 3RWMB 2DF6A 3U6KA 5FUWA 1NP6A 2A5FA 6Q21A 1BMFD 2F6RA 5JEDA 1T3LA 1KI6A 3KQLA 1AGRA 1VIYA 821PA 4PFSA 2L0AA 2OXRA 1Q1ZA 1XDBA 2KEAA 2GQIA 3EG0A 5K8LA 1IO6A 1R5BA 3EPHA 1H8ED 2O8BB 4P4SA 3D8BA 5G3YA 1JJVA 4DXAA 5EP2A 1M27C 5JBQA 2KRMA 2YYZA 3RC8A 4IIOA 1NLZA 3G5UA 1AS2A 3C5HA 1E9AA 5E7JA 2REXB 1Y57A 1VMAA 1CXZA 3IDQA 1KSHA 4LYFA 1XU4A 3KKQA 1SVIA 1I1JA 1PUJA 3B2EA 4M9QA 4JLDA 2BZ8A 2ZYWX 4EQ6B 3X1WA 5EJEA 1GZSA 1K9AA 1HE8B 4PXAA 1YRBA 4JZKA 3SJCA 1MKYA 2KJQA 1YHNA 2VH5R 2CREA 4J0QA 4EPWA 2ERXA 4WA7A 4GZLA 3TW4A 1GG2A 2GJ9A 2RGBA 4U5XA 4HI0E 3QWYA 4Y0AA 2N1BA 3AGQA 2H5EA 3K53A 1Z0IA 2JLWA 2A30A 2WPDA 3BS4A 4M9ZA 1T3SA 1KK0A 1VG8A 1Q3TA 3QKSA 1ZUIA 2ZRLA 2BCJQ 5GJBA 2FFQA 5LB2A 3EW9A 1NVUQ 4BFTA 3MAAC 1U06A 5L3VA 2GZAA 1OH7A 1MR3F 2CK3A 2HV8A 2BKUA 5FTMA 3TJZA 5CIQA 2K2MA 4US0R 5HCKA 3JZAA 2DL4A 1WYXA 2FSIA 1W6XA 1YU9A 2GXUA 3ZZ0A 2WOOA 3W6NA 2CCJA 4TTRA 5H70A 5CB8A 4FI3C 1G8PA 4BFVA 3TAUA 4DCUA 3K70B 4NZYA 2JGNA 4JZ4A 3REAB 2FPLA 4AKGA 1E0SA 3B6EA 4DDVA 2ZE8A 4QGGA 4QOSA 4JLVA 1YZGA 1AKYA 2RGNA 4LHZA 4ARZB 3OIUA 3FFBA 3NMZC 3I5YA 1CJTC 2AFHE 3OEEA 1J70A 2ZRBA 2Q9BA 4W5HA 4CGZA 1K0XA 3K0EA 4GBMA 2XNDA 4I81A 5CB6A 4QNRA 4KSBA 2QPOA 2OFXA 5F9FA 4R71A 3PIRA 2LCSA 1P73A 2Z6VA 4V02A 2VVKA 2EW1A 2GRJA 4XOIA 4AFSC 4TMWA 4C7OB 3CM0A 1UGVA 4G0NA 1VCMA 5FOSA 2IIMA 4GOJA 3TRFA 1N3BA 3AV0B 3U44A 1G3IA 4EJSB 1ZNWA 4BE7B 3PITA 2VSXA 4KSCA 5CLQA 5A5GA 5TDHA 3KJGA 2CH4W 4M1OA 2IHYA 4UNPA 3RLFA 3VR4A 3VS6A 4DIDA 3R8FA 5KO2A 3WHLA 1QLYA 5FI1B 3QKUA 4QBHA 3EXAA 3NTUA 4JVSB 2J6FA 1XXHE 3JZMA 4D82A 2RQUA 4RKEA 1CEEA 5AUQA 2DL7A 1UECA 2ABLA 3ASZA 2RGGA 4MGZR 3A1SA 3I1FA 1E9SA 3GJ5A 4K8OA 2WIAA 1RZ3A 2D74A 1UHFA 4KVGA 3KFVA 1TMKA 3DEFA 2ZRAA 1DOAA 3AVWA 2A3RA 3I61A 2GA8A 1ELOA 5IXBA 4N0DA 4DZZA 2CT3A 1JJ7A 1G83A 1ZM3A 2V1XA 4KI0A 3B5JA 4IOKA 4LBWA 3ND8A 2JJ2D 4LJ5A 4TL7A 2CHQA 1I4TD 2OG2A 1NN0A 4D0LB 3OHMA 4YDSA 1ONBA 2LZ6B 2W6ID 3FGNA 4HYYA 4M1WA 4NCJA 1XOVA 2IX3A 2WWGA 4D4KA 2QQEA 3H4MA 2OZEA 2ZR0A 5IHNA 3ZIAD 4IXMA 2O0HA 1ZM4A 1VKJA 3DOFA 4ITRC 3DHWC 2YUOA 1VCNA 2ZQ5A 4NYIQ 2ASEA 2HYDA 2QPAA 3REFA 3NEYA 4M53A 1E1RA 3LBHA 3KKMA 3CRW1 1BYUA 1TTTA 1XPRA 4OYHA 1XTRA 4BLRA 3K8YA 5FUXA 2V1QA 1NEBA 4LBVA 2DRKA 2EU8A 4GP6A 3BH7A 4QG7A 2NO6A 4JJKA 3SQXA 4ZI2A 1ESNA 5KSPA 4D8DA 4X8MA 1SRLA 5K8TA 4EQ6A 3MRSA 3TSOA 4HEJA 1SULA 2GCPA 2OE2A 2GBQA 3WBJA 4LJ9A 2EGCA 4V0MA 4LE9A 2FEIA 3NBZC 3W90A 4A15A 4UJ5A 2VHCA 5TY0A 3R7WB 2JLZA 1FMLA 1GITA 1W44A 1MUZA 1YWOA 2IYUA 4ABYA 4FMCB 4MUAA 3B1XA 4A2QA 4FMDB 3LWNA 1M3BA 2EGAA 1TU3A 2WKRA 1UAAA 4BEJA 5DO9A 3S1AA 3ONWA 2WWXA 2FU5C 1YR8A 4DLXA 2GNCA 2W0ZA 1WB9A 2GJ8A 2WAXA 2CNWA 3NG1A 4MRPA 1NI3A 4OHZA 4F4CA 1JECA 2IYXA 2DBMA 1RUWA 3HU2A 1OXUA 1GCQA 5KHOC 3DM5A 2G3YA 3FKQA 1KDRA 4TWZA 1E1QD 2GEDA 2FF7A 1QG2A 1G2BA 1UHCA 3PVSA 4PZZA 2PEZA 5FWCA 3SC3A 4RTXA 5L3QA 1SHFA 2IYVA 4NP6A 3QVVA 2MOXA 4ZNXA 4PHHA 3Q5DA 2CSIA 1B07A 2C2HA 4RD2A 3OZXA 2QDLA 4QJ4A 2G0TA 3A4LA 3N2EA 2JW4A 1JPJA 2CJWB 2JASA 2PL3A 4KVAA 2RB4A 1E2LA 1GKYA 4Q5IA 3NDBB 4OHYA 3TMKA 4DLTA 1DO2A 2F1JA 2NTYC 3T1QA 1R4AA 1ZMXA 1E9EA 2OAWA 2DR3A 3AP3A 2KE9A 1AQYA 1QHYA 1X1RA 4F16A 2SEMA 1Z9ZA 3LX5A 3AP2A 1COWA 3T06B 4B3XA 3AVVA 4G5RA 4CEHA 4BZPA 2CLDX 1N6PA 2XZOA 2O8DA 1F2UB 3PEVA 3LD9A 3AVOA 4A9AA 3O8DA 1BO6A 4OQLA 5F3WB 5CM9C 1KMHA 1MV3A 3QXSA 1DG1G 3NBFA 4DB2A 3VU9A 2F7SA 1NLOC 1A0NB 1N2CE 1XD8A 2C9OA 3B9PA 1IN5A 1Q20A 1FX0A 3AF3A 2YT6A 1OYWA 2QAGA 2O0KA 3HPQA 2R44A 5HCIA 2L0XA 3QKSB 3P27A 2DPXA 3EA0A 2LWIA 3EA5A 1D5CA 3BE4A 5KPDA 2P6NA 4BGDA 1XTKA 2A9KA 2CHVA 2W2TA 5B64A 1WFWA 4OL0A 2YV5A 2R6FA 3IEUA 3TAHA 4WOPA 4XVUA 3MMPA 1YR7A 3QI2A 4Q7MB 1HURA 5EUMA 4Z1MD 2W10A 1SXJD 2PZEA 4FIDA 2EFGA 4KODA 2ZE7A 3M0UA 5DN6A 3CLVA 1U2RA 2AXPA 3W3AA 3GJ3A 4D4MA 5BQ5A 3D31A 5JECA 2C95A 3LAWA 4GP7A 3VQTA 5IXFA 2I3BA 1P5ZB 1KY3A 4MGIR 5GADl 3K0SA 1P61B 2IYWA 3SOPA 4GDFA 1R0YA 3AUYA 4OHVA 2CDNA 4ZIRA 1UDWA 2DBKA 1W0KA 3NHAA 2QROA 1XJCA 2FSHA 4MA4A 5IHPA 2ZSEA 2D2FA 2DFTA 2FFBA 4TYPA 3THWA 1DPFA 3PCRB 2E87A 3LW8A 1EG7A 3RAPR 2WPDD 1ZUKA 5GJVC 4B44A 2VHJA 2IXFA 2ZRPA 3IO5A 3OFND 4NCKA 4AD8A 2X3XD 3W8NA 1OPXA 1W5SA 1Q1QA 1FQJA 1YR9A 3KKPA 4RD3A 3CX7A 4Q4HA 5FL3A 5JJLA 4V0KA 3ASYA 3KL4A 2WWFA 4LDJA 4Q4AA 4UXIA 4B34A 4DCTA 1TADA 1LF0A 4Q21A 1L4UA 2CBZA 5H8WA 3UK6A 2ZUCA 5JSZA 1TPZA 4O25A 2ODBA 4P32A 3T61A 3L0PA 4RD1A 1W36C 3CR8A 2ZSFA 2IYQA 1UE9A 4A92A 3NVAA 4P4TA 4LK2A 2UZIR 4NYJQ 2IUTA 1ZNZA 4QGAA 4URVR 2GZHA 2HF9A 1CF4A 2AD1A 1AZGB 2VSOA 2XXAB 2GF0A 2ZUBA 2GZDA 4HB4A 4LPSA 4TYQA 4ZCIA 3UA6A 5AJVB 2YVUA 4L4UA 4Q1BA 5DE3A 2L3SA 2EYQA 4BQSA 2OLKA 2JTEA 4PX9A 2MSCB 2RCNA 3EHRA 5L3SA 1M3CA 1K6MA 4KYIB 3L82B 4Q66C 1SXJE 3CF6R 4DRZA 1UDLA 4UKDA 5IRCD 1Z0FA 2OCPA 1OYYA 3GJXC 4OK3A 3VKWA 4M1TA 2J7PD 3C7KA 1M34E 3L8ZA 3E1SA 5C18A 1GFCA 5A0FA 1TEXA 2GK7A 3L2OB 2QN6A 2RNAA 1LFDB 4WXRA 4HDQB 2YKGA 2LNHB 3SZRA 1XMVA 4WIAA 3SBDA 1F5NA 4B71A 2N46A 1X69A 4JL6A 4Q1AA 3GCGA 3P32A 3FWYA 3FKSD 5F2EA 2NO1A 4YMSA 3I9QA 3WXMA 1GSIA 4ZIRB 3TH5A 2QMHA 2IBMA 3AQ4A 4US2R 5G3ZA 4DLRA 3B8HA 2HYIC 3H0IA 3IBYA 3NIBA 3VTKA 2CHGA 4ZCMA 2XNDD 2EVWX 4MRVA 4KBFA 1FYNA 3AP1A 1VHLA 4Q4JB 5LPNA 3QF4A 1KAOA 2W6IA 4QKQA 5KUTA 4J9FA 4KYUA 1OXXK 3QBVA 2Z0MA 4KBGA 1KAGA 3H0HA 2G83A 1ZM2A 1NMYA 1P6XA 4JJZA 4OJKA 4C2UA 1CBUA 1JBKA 4OKSA 2D3WA 2J9RA 2OT3B 2FFHA 3QWXX 3KDSE 1HD3A 1Q3HA 3H0KA 3NDPA 2J3EA 2D0NA 2WJIA 2GGRA 2MMGA 1IY0A 2PCLA 3I4LA 4Z88A 5CYPA 1G7RA 4ZKDA 4OI4A 3LY5A 3QVUA 3WNBA 4DLZA 2OO7A 3W6OA 4R0KA 4TSFD 1T8UA 4A2WA 4QM7A 1WXBA 4WW0A 1E79A 1JQLB 2JJ1D 1X43A 1NIPA 2EFDB 2G77B 4JL5A 2QG6A 3RVBA 2WWYA 4D6PA 3T34A 3U3RA 2FX3A 3CX8A 3B1WA 4CEIA 2HT1A 2CE2X 2G88A 2ORIA 4WZBE 1OIXA 2KRNA 1RI9A 3UMFA 4PO1A 2OBNA 2KB0A 1A2KC 1TF2A 1DE0A 2QM7A 3CRRA 1EFCA 4GFDA 2DFNA 1IJFA 1HQCA 3LVRE 2LJ0A 3IHWA 1GP2A 4PAMA 1IOZA 4BWYA 1OH5A 1HY3A 1KOFA 3GBQA 2JJ2A 4HZIA 3VNVA 5FBWB 1KI3A 3QXJA 2PX3A 3EG5A 1DAIA 1KKMA 1ZUNB 1VECA 2IYYA 2ODNA 4LYAA 5JHGB 4PAQA 1P9WA 3SI7A 5EXXA 1P2SA 3MFYA 2J5XA 4LJ4A 3GMTA 4K46A 3H41A 2QI9C 1SPKA 1MO5A 4JLAA 4KLZA 1SHZA 2WICA 1W49A 2CH4A 2NG1A 1E1QA 4JLKA 3U6BA 2QAGB 4E6RA 4LHVA 3R9WA 1J7KA 4R7ZA 1BYIA 2ZI7A 1BBZA 4JLNA 2GJKA 3K0AA 3TIFA 3ZS8A 1HA3A 1D9ZA 1FP7A 2Z83A 3RNLA 4RCYA 4JBYA 5SZIA 4UQOA 3B78A 1AZEA 4F93B 2RGNC 2HJVA 5EZ5A 3U5ZB 2L3PA 1XD9A 3FDIA 1XPUA 4KXFB 3MCAA 1KZ7B 4NYIR 4ERNA 2IS6A 2JLXA 2WJHA 1LVGA 5SZJA 2V1UA 2EQIA 2QZ4A 1DAHA 3AB3A 5JCZA 4NE2A 1OKKD 3AKCA 4C0SA 3PXGA 1DELA 3FFAA 4XVRA 3ZVLA 4W5WA 5GJVB 1COWD 2OJ2A 1J99A 2D62A 1W2HA 4AFZC 3AKDA 3IIJA 3REGA 3B82A 4N3NA 5JJKA 4B33A 1EFRA 2ZU6A 3B7GA 1KJWA 1E6CA 4Q9IA 2KT1A 1NG1A 4DLSA 3CZQA 5AJYA 2H8HA 1M3AA 4QRHA 3VKHA 4J9GA 2W0SA 1U3OA 2CE7A 5EE9A 4C0KA 2ZJ5A 4G5QA 3DKPA 1VYVA 5DNYB 3QSYA 2WKPA 3HYTA 1P72A 2LMJA 1KTVA 4PSAA 1NN1A 3K0CC 3OAAD 4QBIA 1Z47A 1WXQA 5KNDA 3WNCA 5ELXA 2F55A 4P4SB 1OXSC 3KTAB 3SHWA 2WVJA 4P4UA 2GF9A 1P9RA 2LX7A 2B21A 4CEJB 2RQTA 1TUIA 3WYGA 1CP2A 4LYHA 1LTQA 1G16A 3B9QA 3GLFA 3QG5A 3R9IA 2VKNA 2DRMA 1YWPA 2ZRHA 4LN2A 4MRNA 4P33A 1X6BA 2C0OA 1QVRA 1YZNA 2NO0A 2FSFA 4JYBA 4Y92A 2OLJA 1F2TA 1G41A 2YWFA 2QQ0A 4B35A 1RW4A 4OQXA 1NL3A 3EHQA 1IONA 4KFUA 3O5ZA 1CSKA 2FRWA 4F92B 1QG4A 1XEXA 1QKXA 2HDNB 1NG9A 2FDCA 4L16A 3GEIA 4F7WA 5E7MA 3GQBA 3UG6A 1SVLA 4HZUB 1FL9A 1RRPA 2ZRJA 3EWAA 2GXAA 4UNSA 4BZQA 2PMDA 4PC3A 2W00A 3H2YA 2BZXA 3Q3JB 2BTTA 1N5KA 1X8KA 2W6JD 3SR0A 5BN5A 1ZNXA 3N70A 4ESRA 4IXNA 4R2IA 5TV2A 2K7AA 5KNCA 4MDFA 5J47A 1DBSA 3GJ6A 2YUPA 1G8FA 1VCIA 2FG5A 1NBMD 2JLQA 3QNUA 1XXHA 5JS7A 4EPXA 2VTKA 4TZ6A 2TMKA 3K09A 3Q7QA 2LKCA 4X1VA 1FPMA 2NO9A 2IT1A 4CEIB 2OCYC 3NC1C 4OMMA 2ZAMA 4NPHA 2NIPA 5IF9A 4PO8A 2GEUA 2W83A 4M9XA 3TSWA 1AWJA 4BRWA 4II7A 5LBIA 2V6IA 4OHXA 3ICQB 2AXNA 2IHBA 3QE0A 2DVJA 2I4IA 4NL4H 4P0TA 5C1BA 4A0HA 3GLFE 3RS7A 1I0CA 1S9HA 2GKSA 1Q0UA 1S96A 3EIHA 3K9HA 5DN6D 3FOZA 2EWWA 3H1TA 1X27A 2ZXUA 5EXPA 3ZQ6A 3KJHA 2QSYA 1Q44A 3GLHE 3JV3A 2EYUA 2P65A 4PR0A 4QHSA 2PJRA 2GJSA 1EWQA 4JJCA 2RQVA 1DS6A 1R5OA 1XMJA 2QE7D 1D2EA 1T8TA 4M1SA 5JI2E 2A08A 1KO1A 1P7CA 5AUOB 2GESA 1D2MA 2EGEA 1DAEA 2EQBA 2H92A 3NPFA 2IS2A 1CJVC 3GJ8A 3CH4B 2VHTA 2LP5A 2W58A 3KXLA 2LQWA 1G8GA 4MYCA 4PANA 4URYR 1OJLA 4Q47A 1DTSA 2BJVA 1OV4A 3CNOA 2XTMA 1WXUA 4CEJA 1U0HC 3ZL7C 4FCTA 1UFQA 2B8TA 2HSPA 4AIIA 5C2JB 3AKEA 4AG5A 2IUUA 3EX7C 4W9MC 3FHTA 2BM0A 5DHAA 1WF3A 3HU1A 5KDDA 1XF9A 4NBSA 1JR3E 2KYMA 1E2PA 1G3RA 1Z2AA 2WJVA 4ZDIA 1N6LA 2A5DA 3AUXA 2W0MA 1XX6A 3FHOA 3LQRA 2P3SA 1RFLA 2YC2C 1N0UA 1FUUA 2OBMA 2QM8A 4PHGA 4EFMA 1ZM7A 4FW9A 1VA7A 4Q1EA 1N0WA 2X3WD 5J4YA 1S4QA 2BEKA 4B6FA 1NKSA 2D8HA 4YC7A 2J6KA 2PEYA 1B0UA 3SEAA 5DHFA 3W34A 4K81B 3M0SA 4W5JA 3AEZA 2Z43A 2DILA 1BKDR 4HDCA 3QEOA 4LCBA 4B2IA 2HF8A 2DL3A 2JJ8A 2VP9A 3QIAA 1TL7C 3HU3A 1T5IA 5E3HA 1CR1A 3U23A 4KCGA 2H57A 3N5CA 5CJ2A 4EKDA 1Z63A 2GCNA 1E2IA 1QWEA 4KJZA 1E96A 5EXSA 1KK1A 1MO4A 3UMRA 3EWSA 2OHFA 3F3YA 3Q7PA 1IN8A 3U3JA 2ED1A 3EAQA 4PQRA 3M0PA 5B58C 2ZSBA 4HATA 4BFYA 2WMNB 1KSJA 1SQ5A 2BM1A 2RMKA 3AVQA 3IKJA 1GM5A 1CLUA 1O3YA 2WBLC 2XB4A 2DYBA 4L5BA 2RGCA 3DM9B 4P31A 2XZLA 4BLPA 3AVTA 2WSSD 1Z08A 1OH6A 1DEKA 3CH5A 3PG5A 3A58B 1MO6A 1YZKA 3PEUA 2VP0A 4Z8YA 5F98A 4RTWA 4GLMA 3DZDA 4HB3A 1W36B 3SEMA 3QKRB 2IYRA 4EIWA 4MITA 4A6XA 3IILA 1LF5A 4JBXA 3B13B 1JR3A 2OBLA 3W8RA 4OI0A 1GOTA 221PA 3A1TA 2VHQA 1F2TB 1ZUYA 4J9DA 2XSZD 3UKDA 4DCNA 2H17A 1OHHD 1M1YE 4KFTA 3SS8A 2FE4A 2ZI9A 2H7VA 5FR2A 4M2LA 5KDLA 1T6NA 4KRTA 1E4YA 1CR4A 1PUIA 3ETLA 4V0LA 2ONJA 3X1YA 3D6TB 2J59A 4RUGA 2A5YB 3KXKA 4QC2A 4Q02A 3Q5EA 1JEEA 1IY1A 3CKLA 3DVLA 3ZVRA 5CDFE 1SSHA 1HEIA 4NYJR 2GNOA 4CYMA 4AK9A 2GXQA 3LQQA 1WA7A 1Z0KA 4ZDWA 4OMOA 2B8WA 2WV9A 1GRQA 2FPDA 1KI8A 3UIEA 1WIEA 2FO0A 2FV8A 1II8B 1ZIOA 4HB2A 1E9DA 2CNWD 4A0RA 5K8UA 4YMUA 5DI9A 2NGRA 2JIZA 4FCVA 1P3JA 3ZH9B 1G7CA 2FH5B 4EPVA 3KTAA 4TSFA 4C9BA 4BEBA 1RPZA 2PZ1A 2YZ2A 1QWFA 3D7MA 2BBTA 3THYA 2A78A 4DCVA 1BU1A 3E5HA 4BLSA 5B57C 5EUQB 4EPTA 3GPLA 1GKUB 2QORA 1K5GA 2P5SA 3K0CA 4ON9A 4ACBA 3AKYA 3EASA 4RD4A 3O8RA 3KQHA 1G21E 1U9IC 4MUBA 4EFNA 1X2QA 3AVYA 2CT4A 3GEHA 3AF4A 2ZYVX 4C0JA 4L9SA 2HUPA 4HAXA 4TL9A 5D3QA 4C30A 3TGPA 1W1WA 4TMZA 1SVKA 4DDWA 2EYWA 1H92A 1NYGA 4Z8AA 1G20E 1QZXA 4FWIB 2VP6A 4LUDA 2R6AA 2C8VA 1ABQA 5GJWC 1E3MA 2J87A 4DSNA 4LV6A 1O87A 1G4UR 2WWIA 5AWFC 4XWKA 2N42A 2GDJA 1GFDA 1M2OB 4RZUA 1GL7A 1I2DA 4KLNA 4XTCS 3VR3A 2DX1A 1CS4C 3OIYA 2J0QA 2J7KA 5JWOA 3T1OA 5DI3A 1KO4A 1AK2A 1KJZA 5AK0A 1FP6A 1BIFA 2X2EA 3VHXA 1NMXA 4D2IA 1W4CA 1Q57A 1OE0A 4URZR 2VIIA 1R8QA 3BFKA 2IS4A 1ANKA 3GLIE 4F14A 5TXGA 1ZLMA 1LCKA 1K0SA 2CCGA 3ZVMA 3T5DA 1GNPA 1TQ6A 4LSGA 1ZU4A 2VLIA 1NJFA 2FOLA 2XAUA 4YXWA 3B85A 1F60A 5FPKA 3RS4A 4URXR 4AG1C 3CNNA 4DHEA 3BBPA 4TYNA 4F17A 1OKKA 1Z8FA 5JMTA 4DIEA 4NCHA 2QBYB 3OIWA 1SXJA 5CK5A 1OT3A 4IHQA 1JEDA 1XEWY 2WM9B 4DJTA 2ZRGA 1M74A 2ERYA 1II8A 3RRMA 3VS2A 2QL6A 1IN6A 4A63B 4TL8A 1R5NA 1P62B 4GOXA 2ONKA 1FX0B 1XTSA 1RYFA 4MQBA 4JBWA 2EYZA 4Q4HB 3Q72A 3WNDA 2UVQA 1B23P 1HQYE 3LFUA 4XJXA 2ED0A 4LJ7A 5EE0A 3R20A 4NMMA 3REBB 1KMHB 2K3BA 2ODWA 2XX3A 3BB3A 3VHLB 1XRJA 4ACAA 3NH6A 521PA 3VU9B 2WTUA 3NC0C 4DSOA 1ZBDA 2QAGC 3PR1A 5FFMA 1VYUA 4HAWA 1US8B 2VA8A 4IVRA 5L23A 1J3TA 4OBEA 2RH5A 1WX6A 1IJEA 4HB0A 1EWRA 4TLDA 2VPPA 4QBFA 3VR6A 4YMWA 2REBA 4B32A 8OHMA 2KXCA 3GFPA 4IJMA 1RYHA 4GMDA 4HVUA 1AS0A 2QP4A 3VMFA 1KSGA 1M6NA 1MRSA 2F2VA 5JJIA 5KOYA 4HLUC 1XP8A 3CB4A 1V5WA 2JCSA 1OFUX 2VQSA 3IGFA 2CL0X 2C5LA 3LO5A 2ESWA 4OQMA 5L3SB 3U7FB 4MGKR 3X2SA 3DPUA 4F4JA 1Z0AA 2OESA 1L8QA 3KUDA 4J9HA 1PLKA 1PLLA 1S1NA 3TSZA 2ZUDA 4HDOB 4B2LA 4B2PA 5BN3A 3I35A 1NF3A 2C03A 2FEMA 2KROA 4AYWA 1OF1A 2F3TA 3ADDA 4EPRA 1HV8A 2FPFA 2VYFA 4B3GA 3P20A 2EPDA 2E1RA 1TQ2A 1ZCBA 2DFKB 1YZQA 1QBKC 1WDXA 3LVQE 4HVWA 3GP8A 4CC2A 4OI2A 4QGFA 1TU4A 4HSEA 2Q9CA 3PE0A 2V7QA 3BGWA 2O9VA 5J4HA 2QRNA 3CONA 1UM8A 5EXTA 2P5TB 5DH9A 4LJYA 4AG2C 4TT3D 5FUYA 1TF5A 5JS8A 1KNQA 4Q18A 4DWJA 1AWOA 1JO8A 5B2ZA 4M0LA 2RGAA 4UNRA 1H8HD 4WAUA 4OI1A 3ADKA 2D2EA 3AF1A 4QGHA 4HLQB 1XTIA 2WHXA 3SU8A 3IQLA 5I22A 3EZ7A 2Z4RA 1E0KA 2HEIA 3CWZA 1Z6AA 1X8JA 1OPKA 4AC9A 4NKRA 4XIGS 4ZI3A 5J4LA 1JXOA 4AKEA 3PVLA 3BJIC 4FINA 1E2JA 3FKSA 2SHKA 2VP4A 1PKTA 5FOXA 4Q9HA 2EFCB 4BLTA 1C4OA 1AIPA 2BEJA 3VS5A 1ZYUA 2YOFA 1SVSA 1UDXA 1UKVY 1Z3IX 5EE5B 2NQ2C 2KBTA 1CULC 3F8TA 2BJWA 5KNBA 4IVPA 1UJYA 5FL7A 4C3ZA 3KXIA 5CK4A 1GRRA 3OE7D 2GTOA 4KFSA 1OEBA 3RS3A 3PV0A 3SJBA 3UG7A 2XOKA 4JLOA 4PQFA 1XCPA 3EG2A 4G5SA 2C04A 3AM1A 1KJYA 4LJAA 4EPYA 3GLGA 1U8AA 1IN7A 1AGPA 3T5GA 2YWEA 4M4SA 1ZM9A 2YWHA 1P9NA 3ZLJA 2R2AA 1WP9A 1AD5A 1TQDA 3ULRB 1W36D 4O0MA 2ZRNA 4R98A 3WBKA 2EVRA 1KI9A 5EE3A 4Q4AB 2OSBA 3THXB 5FOUA 2AL7A 1EX6A 1U98A 121PA 4AY2A 3SHFA 1I2MA 1SEMA 2ZAOA 4TMVA 1X2KA 2JA1A 1IBRA 2VF8A 4A82A 4U02A 1T0HB 2YHSA 4Q03A 3SQWA 1N6KA 4DSTA 2F3RA 2BHRA 2BMEA 3B1ZA 3SNHA 5FBVB 3KKNA 3ZD7A 1M8PA 2C78A 5JFGA 2QSZA 1DVRA 1KKLA 4TZ0A 2K9GA 2AN9A 2FMXA 3U61B 1W7AA 2QGZA 3TK1A 1QRAA 1FMKA 1Y3AA 4B43A 3EPJA 3G0HA 1T3HA 1OFHA 1WI7A 1JAIA 5LD2C 4MRRA 4B73A 1HH4A 3PJRA 1ZD9A 2WJYA 3EPKA 1KFZA 4OQNA 2Q3MA 4Z8XA 4RZ2A 2MSDB 3A8TA 5FPSA 1VCOA 3FB4A 3V9PA 2QT1A 1W4BA 1OXTA 1JPNA 1AQUA 2RAPA 4V0ME 5FUVA 2FSGA 2ZI6A 4JS0A 2ZANA 1RRGA 3PENA 4WZ6A 1Z07A 2WMOB 2DA9A 3LH5A 1E2DA 3TUIC 3AVXA 4UNQA 3LLUA 3EZ6A 4JYCA 2ROTA 1YQTA 2WZQA 4I1UA 4PC1A 2BMFA 2JAQA 2WSSA 2V54A 2PTKA 2NZJA 4TLBA 4Q7KA 2Q3HA 3X1ZA 3MGCA 2H8KA 3EARA 2YWGA 4ARZA 3U2QA 3IUYA 5JEEA 3HR7A 1XPOA 1JR3D 1E7OA 4IOMA 1QHHB 2BMJA 1NVWQ 3QXHA 1Z28A 1MH1A 1JALA 2G6BA 3NHNA 5FBLB 1RRCA 4UJ3A 2O8EB 2GETA 1KO7A 3ZDQA 4DEYA 1XMIA 2Q0HA 2O8BA 4GI7A 5BWMA 4IVQA 2FG0A 1N6HA 1RLQC 2YUNA 3KUCA 4URWR 3RS0A 2IC5A 2AD5A 1RE0A 3SYKA 3I62A 3V4FA 2NPIA 2QPTA 1P75A 3TKLA 4C0LA 4GL2A 3U60B 1ZUHA 1A7JA 1XD2B 4V0OA 4D0NA 1FQKA 4D8KA 3O47A 4PC6A 1BS1A 2HJGA 2OUKA 2EKHA 1A4RA 4A2PA 1HT1E 2QMOA 3TUJC 2ZR9A 3UMSA 2CXXA 1EFUA 4OJQA 2OFOA 1VG9B 1A2BA 3CIOA 4JSYA 4Q4LA 4I99A 4RTVA 1MT0A 3BB1A 2CDTA 1E69A 4TMXA 2FA9A 2IWHA 4QFMA 2FRYA 2JIZD 3QBTA 2ORVA 4HLDA 3SE0A 2IYSA 3RSOA 3T35A 3ADCA 1ZIPA 1N5IA 2XB2A 4FSSA 1US8A 1ZC4A 2O8CA 1UEIA 4M9SA 4WBSA 4JL8A 4JPBW 3OAAA 1AZSC 2AWNA 5IHKA 4Q7LA 5FTKA 5ECAA 1XEXB 721PA 4XTRA 4LPKA 5LB4A 2DCUA 2FGJA 3GJ0A 2R8RA 1M7HA 1XTQA 2QENA 3TW8B 5FI0B 1WA5A 1W2GA 3KZ1E 4JVLA 3FMOB 1E2EA 1SVWA 4YMVA 4Z54A 1S2MA 1E4VA 4HZUA 1G6OA 2QTVB 2R6GA 4G01B 3P4YA 3THOA 4PC7A 2IWRA 3FJ5A 1MO3A 4CIDA 4D4JA 4DLVA 1SXJC 2XNSA 3GFTA 3QOFA 3W5JA 1LV7A 2IYLD 3KQNA 1GAJA 2GTJA 3HWSA 2ANCA 4LBZA 1JQQA 1E6GA 2A37A 5FW9A 2V8OA 1WBBA 2G0NA 2X77A 3U3KA 3T1VA 3GLHA 4M8NE 2KWIA 3L43A 2GEVA 1G291 1OH8A 4AYXA 2RN8A 1CRQA 2XEXA 4CT5A 1DAFA 3M0QA 2AKYA 2OCAA 5HR5A 3QXXA 2ENMA 2LKDA 4I1SA 3U7EB 5HKKD 3GLIB 3WMGA 3IEVA 3U7GA 3I5SA 2JDIA 3BFVA 1AWWA 4RTUA 2O52A 1UPTA 1N6RA 5EP3A 1RJ9A 1UBFA 4F38A 5C4GB 3C4JA 2R65A 1RVDA 3QPWA 3VS7A 4G1UC 3TR0A 1BMFA 1E94E 1T91A 2J45A 3BOSA 3CZPA 2ZROA 1Q1EA 3PUWA 1N5ZA 2PLFA 2XTZA 5TARA 3QENA 3LA6A 5EC7A 1TUCA 2G9NA 2BOVA 4E07A 1NY6A 5J4VA 3R7WA 4IW3B 4MKHA 2QTHA 3CPJB 4MYUA 3S1AB 1FZQA 2QA5A 3QPVA 4BPBA 1W46A 2WWHA 2DE0X 3MLEA 3W9YA 4RTTA 3TR5A 1QHGA 2HBWA 3P4XA 4IFEA 4OMQA 1Z06A 1Z6TA 2AWOA 3I8SA 2F43B 1II9A 2ZVPX 5GJWB 1HTWA 4HUQA 4AFUC 5JHHB 1QF9A 4FMDF 3BD9A 2KYBA 2J0VA 3C14C 4AYTA 1IHUA 1SZPA 2QE7A 4KO8A 4TLAA 3WY9A 2NMVA 3SJZA 2O8CB 1DADA 5FBRB 1LW7A 4TQUS 2DFLA 4TT3A 2ZJAA 1U8YA 2X1VA 1UBEA 4A0GA 4PHTA 1KDTA 3T1TA 4Q1DA 3VNUA 2M51A 3R6NA 4IOLA 4X8OA 3X1XA 2P67A 1N0VC 2J46A 4UXJA 3GJ4A 4Q1FA 3BRWD 1BH2A 4YONB 1IQPA 2PJZA 1KK2A 3RHFA 2F1RA 2O8FA 3C0CA 4QXAA 4ZPXA 1QHXA 1GL6A 1OIVA 1KIKA 2YOHA 2B86A 2Z4SA 1CJUC 1K4US 2A7QA 1QDEA 1VPLA 2ZREA 1SVMA 4S35A 3K9GA 2JM9A 4M4ZA 1GVNB 2C96A 1GUAA 2XZPA 2ZE6A 2ZJZA 3Q8XB 5IK2A 2VRWA 5TVKA 3DO6A 2D06A 2O8DB 1YZUA 2ZE5A 2YJTD 3NKVA 4M1KA 5GVRA 2RQWA 1TQ4A 3KB2A 4B76A 3AVUA 5I11A 5B30A 2BDTA 4LWZA 4A8JC 2XOKD 4PPQA 2DL8A 2LJ1A 1R2QA 3WHKA 4KHZA 4AKIA 2KBFA 1TUEA 1Z83A 4FCWA 4KAXA 5HZHA 2GCOB 1ZCAA 2OCBA 1NNEA 3QXCA 1IM2A 1G5PA 3E2IA 3NEJA 2J7IA 4RKFA 3TQCA 4DUGD 5HE8A 2RGEA 4F4IA 1K76A 1NBME 4HAZA 2L3QA 4WZAE 5SZKB 1NYFA 4WCIA 1SKYB 4ZDKA 5AUNB 1HJDA 2HDAA 1NVVQ 2EWVA 2RKOA 5EZ6B 1Z5ZA 4D0GA 4HLUA 5CYOA 3J81k 1XCGB 1EESA 4AURA 1NLPC 1WBDA 2BBWA 1J2JA 1SHKA 3HR8A 2M0YA 3LRPA 4BLQA 3X1DA 4D80A 1P4SA 5J4KA 3GLGB 4PC2A 4FN5A 1I07A 3SJAA 2C0IA 2O88A 1E2FA 2HLDD 3KKOA 2FZLA 4JLBA 1V1CA 2ZRFA 2ZU0C 5FPYA 1G7TA 3W3ZB 3LBIA 3EG1A 2DHRA 1U94A 1YNZA 3I73A 2P2LA 3IPXA 2PNIA 1PVOA 4J9BA 4RTZA 3VS1A 3THXA 5FBQB 2B7CA 1KMQA 2FGKA 1E2NA 1E2HA 3PFIA 1G7SA 2XSZA 2ZJYA 3I8XA 1WXTA 2REOA 3A4MA 1U5SA 5KSZA 4R2HA 2Q3FA 5TB5A 5DSZA 4XD7A 1T0HA 1UKEA 2ZETA 5G41A 3HPRA 3TLXA 1YE8A 4ESHA 3ZD6A 2DNUA 2QUZA 1LY1A 1ZP6A 2WKQA 2ZTSA 3DZ8A 3RS5A 3WRYC 1G3QA 1ZJ6A 3A4NA 4IOJA 4RSGA 3I5RA 1P2VA 2V9PA 4E09A 3A37A 3BIFA 1OFIA 2O0JA 2L2PA 3IIKA 4FMBB 2IUSA 4LJ8A 4TTPA 5CJPA 2PT7A 1E9BA 2OEPA 4GT1A 3VR1A 4RD0A 4DB4A 2W2VA 3EIEA 5KTYA 1U90A 4TLEA 3OIVA 3RYTC 2ZJOA 2F2WA 1GNRA 4BFXA 2DY1A 4HCKA 2ZITA 3PEYA 2VP5A 5ANRB 1L7VC 1KSFX 4Q48A 2KXDA 1L4YA 1ESMA 3K9LA 1PNJA 4A1FA 4A8JA 2YINC 1JQJC 2XJ9A 2XXAA 3G82C 5KSOA 2JT4A 4POAA 1SKQA 1T9HA 4Q19A 4Q4JA 3RANA 3TUZC 3ZZTA 3IQXA 4BZXA 3UF4A 4TMTA 3OEHD 4FMCF 3E70C 4ORZA 2BBOA 4LY6A 4R9UC 2KNBB 1IAQA 1X6VA 1H8KA 2J05A 3JVVA 3MG9A 4PTLA 1AS3A 2I1VB 2KSQA 2QTFA 4XH9B 4A0FA 4OMPA 4B3CA 1K5DA 4HUQB 4M22A 3GLHB 1Z9QA 1JXMA 4H9GA 1I4LD 1OV3A 4I4LA 4B74A 1C9KA 1HSQA 4BFWA 3A6PC 2F9LA 4BFSA 3THKA 3QF7A 2O2OA 3OESA 3CBQA 3QG1A 4JIMA 1JR6A 2JS0A 4CRWB 2OILA 1XFAA 1S1MA 4JKYA 4XWOA 4HAYA 3EZFA 4IDQA 5AJZA 4TTQA 1G3UA 1NRJB 1X86B 5L8VA 2ZS7A 2KT8A 3EPLA 1KI6B 1JAHA 2AR7A 1P2UA 4S2EA 3QJYA 1FFHA 4HAVA 5E4FA 5FTJA 2IYZA 3K70D 2X8AA 2P4RA 5AR1A 5H1YA 3TVTA 1MV0B 5G40A 1AN0A 4CDGA 3QKTA 1OW3B 4CC7A 1XBTA 1W1FA 2DM1A 1A5TA 1YJ5A 4LUCA 1GNQA 4QJ5A 1J8YF 1OFTA 1UJ0A 4QNMA 2C98A 3QKRA 3F0TA 1YZTA 3MWKA 2ZPTX 1U99A 1G6HA 4URUR 5KU1A 1IXZA 2IXGA 1DAGA 1KGDA 2J0UA 2J06A 1JNYA 2AK5A 4GSYA 3IQWA 4OQFA 2QMUA 2EYXA 1Z2CA 3K0FA 1QKWA 1D6JA 2QGNA 1ETUA 3Q9LA 3HP1A 4AKHA 4JJDA 4M21A 4PZLA 4ZO4A 1UJ2A 2IA5A 2CCKA 1OXVA 2ZEJA 2ZYTX 4BFUA 2VF7A 5FTNA 5HKKA 1Z22A 5E7IA 3TBKA 3PEWA 1OB5A 2JDID 3CO5A 2DB3A 3ECCA 4JLJA 3M0RA 2JATA 5EP1A 4LYJA 2HCJB 4Z51A 3QQ5A 5J40A 5DI3B 1AKEA 3H0FA 4KV9A 4Q9JA 1V43A 3SDZA 1R10A 4RTYA 5GVSA 1PJRA 2PZFA 1EGAA 1LNZA 3A1VA 1FMJA 3CR7A 1NN3A 2RF0A 3PUVA 4TQ9A 3RABA 4AFQC 1VTKA 4JT4A 1G8HA 1CKEA 1KHTA 2Q21A 3AGPA 3EGUA 1M7BA 3KFXA 4DCSA 1NLFA 1FOEB 4MH0R 1CKAA 2DL5A 2RGXA 2O8FB 4M1MA 3C16C 1KYIA 3VR5A 4Z1MA 3MSXA 1P60A 5EE1A 2DWQA 2J41A 3BFXA 3QF4B 5JRJA 1RIFA 4DLWA 4RY2A 4J9IA 4M1YA 4Z89A 1Z0JA 1R7RA 4G3XA 4BUJA 2QBYA 1XJ0A 4HLCA 1PKSA 1YKSA 2CK3D 1QCFA 2A5GA 2YOGA 4TQAA 4HVVA 1PZNA 1KSWA 3EZ2A 5FWBA 3BORA 2C77A 4CVNA 3W6PA 4B47A 1H65A 1RKBA 3UPUA 2IF2A 4LV8B 4CC3A 3O8BA 1IY2A 1W0KD 4JVMA 5FR1A 2C9CA 2ZJ2A 3NHBA 4A4DA 4J9EA 1C1YA 3WMEA 1S1CA 3WYAA 1CKBA 2GBLA 5CIWA 4IDOA 4JMPA 4D25A 4N1AA 1IXRC 2FPKA 2QMEA 2FPMA 3BWDD 2V7QD 4Y0VA 1YN8A 1JEGA 3IO3A 1PLJA 3IIMA 5UKDA 2KBEA 1G18A 4YDHB 4C0BA 3KB1A 3A1WA 5SZHB 1G5TA 4YMTA 1F3OA 4NH0A 4NYMR 1EFHA 2BZYA 2B6HA 5HTKA 2GWHA 2E5KA 2FPEA 5JLJA 5FOWA 3ZZUA 1EXMA 3NH9A 4JKIA 1GCQC 1TUDA 1DO0A 1U8ZA 1UFFA 1G4AE 1GKIA 5IH2A 1K8RA 1N25A 1IXSB 3F5FA 4Q1CA 1KIMA 3K0FB 2V55B 2ZI4A 1BK2A 3NXSA 2LQNA 2PCJA 2JLYA 1OPLA 5BXQC 1KI2A 1HE1C 2Y8EA 4EUNA 2AKKA 1UEJA 2D1XA 2JS2A 4MKIA 3V00A 4O3MA 3FE2A 1OOTA 2O9SA 2ZRKA 2ECKA 1NG2A 1MV5A 3VRZA 2WSMA 3CF0A 1AJEA 1ABOA 3LV8A 1M30A 1II0A 5L3QB 2CLSA 4XSHA 4CF7A 1FNNA 1W48A 4DKXA 3AF2A 1U9IA 5FL7D 2V4ZA 4EJSC 1GDDA 2MSEB 1WMSA 4YQFA 3GLGE 2CJWA 3K9NA 2DYKA 3NBYC 1BB9A 3HYRA 3RRZA 3R9XA 3VR2A 1S8FA 3TNFA 4PHFA 1S3GA 1GBQA 1NSTA 3LNCA 5CITA 1S9DA 4LOAA 1PWTA 5DYIA 421PA 3Q85A 1KDPA 1YR6A 4MYHA 1XJQA 1XCMA 4D4LA 2HCKA 1TF7A 2QRZA 2QNRA 5BN4A 1E0AA 2BC9A 4Q00A 3LXRA 2HT6A 3HJNA 2QAJA 1D8TA 4PAOA 4NDZA 2BCGY 4F91B 1FW6A 4BFZA 2NPFA 2ROLA 1U0JA 2C99A 2NWMA 1J90A 2KRSA 5C46F 4FWTA 5DIFA 1DAKA 3BB4A 3CW2A 1RRFA 1F2UA 3ZIAA 2H16A 2QT0A 3GFOA 4B75A 1MOZA 2GJAA 4AG6A 2YC4C 1A82A 2ORWA 4RFSA 2XITA 5IK2D 1VHTA 2OFWA 2UZ3A 1G17A 2CVHA 3GJ7A 4RD6A 4P3YA 1DG3A 1OLOA 2XTNA 3N2IA 1KI4A 2XMFA 1GTVA 4LV5B 5JCPA 4KFRA 1S3SA 2CVFA 2DBYA 3KJIA 4CZ2A 2V1RA 3C15C 3IBGA 3BH0A 2ZRIA 2ZSDA 4GPTA 4UXHA 2JEOA 1W0JD 4XD7D 3W5IA 1GL9B 5JWRA 4NU0A 1EFTA 1XXHB 3CRMA 2YNMA 4Q7JB 4PPNA 3AVPA 5KDOA 1SKYE 1T0JB 1WDTA 3LX8A 2LCFA 5IHIA 2AKAB 2OAP1 3FMFA 3TVDA 5HCNA 1N6IA 1Z6XA 2VHUA 4H1UA 3SYNA 3K70C 3CRVA 3DMNA 3RWOA 4MDEA 1PV4A 3KX2A 4RCZA 3EZ9A 4Q9KA 2SRCA 3L0SA 4X8HA 2EW3A 1TNDA 4JLMA 2C9YA 3K1JA 3U4QB 1NJGA 3IPYA 1X8LA 4PSKA 2J6OA 4BECA 5F9HA 1KY2A 2CL6X 4LNPA 2HXYA 2V6JA 4IEEA 5AJXA 4B6EA 2ZRMA 4B3FX 2ZVQX 4QHTA 3WMFA 4PPFA 1XNJA 2UKDA 1AZTA 4GMXA 4PSVA 1PRLC 5J5CA 2ZRDA 4E22A 1W4AA 1E79D 2JJ1A 2ZRCA 3CNLA 1MABA 1E32A 1QVAA 2IS1A 1AA9A 3M1IA 5EP4A 4EDHA 2EFHB 3I32A 4QBGB 1GL5A 4RJLA 2YDLA 1NY5A 1NEGA 1CTQA 2PT5A 3FHCB 1GFIA 1E9CA 2RMOA 3OEHA 3PUZA 4TLCA 4E03A 3T12A 1VYTA 5BYKA 1RJ9B 5FOTA 2GVDC 3PUYA 5DGXA 5JZVA 2GTPA 2B92A 2CL7X 2JLSA 2J0UB 4ZKEA 4JSTA 3SFVA 2IW3A 1DARA 1XEWX 3EC1A 3L8YA 1TG0A 2VP2A 1L2TA 4PZYA 5FOVA 2PBRA 3RRNA 2J0SA 3BH6A 2D7CA 5FPTA 1G8YA 2ODEA 1YP5A 3RBBB 1FUKA 1WQ1R 4OK5A 4ESVA 1GIAA 2V3CC 4GBQA 4C0HA 4C0AC 3FMPB 4HUTA 1J8MF 2GVZC 5IDVA 4FXPA 5HZKA 1R0ZA 4YXWD 1NM7A 3MWJA 4L9WA 1ZVQA 3RDPA 2W2XA 2WJGA 1P2TA 4AI6A
chains in the Genus database with same CATH superfamily
3LLVA 3K1TA 4C8QA 2XTJA 1W29A 1HNWB 4XDYA 3R3JA 2B82A 1NNUA 2FHPA 4M0EA 3QA9A 4JVNA 2Q7XA 1RWXA 1YRQA 1FU7A 5JPIA 1Q74A 3H11A 4OGCA 2J3IA 2WYIA 4Z4QA 2H18A 1MMFB 5K8VA 5CVEA 1FFXB 1U7TA 1WSDA 1BIAA 1NPPA 1LFAA 3L41A 1L4FA 5HIAA 4OMLA 4UNNA 2RIRA 3PHCA 2QJTA 1XCOA 5CLHA 2GBLC 3R6LA 1KEZA 5IU6A 4BNLA 5U1PA 4ZAYA 2WT8A 1QVVA 4LZPA 1AURA 2MMCA 4PICA 4JQSA 5BVHB 2K79A 3K8ZA 1H6AA 4L8GA 3LLRA 3ZKWB 3DDHA 3ZTYA 3LDAA 1QP4A 4YRFA 3P19A 3PUKA 1QV7A 3MD0A 5ADWA 4PLZA 5KSYA 4LIPD 4EMSA 2N47A 4K26A 2HJ9A 3HDVA 4TTJA 5DM0A 4DVGA 5TF4A 2W4IA 2YYYA 3FWKA 1LS6A 1D6NA 1VQPT 1F38A 4G8CA 1W4ZA 1P31A 4C14A 2JFVA 5AUPB 1SXPA 4DM4A 1QCZA 3G59A 3LHFA 4GWKA 4H59A 3ZDDA 1TEVA 3ESCA 5CR2A 4N6GA 1R27A 4QUDA 2ATXA 2W70A 3PDWA 4F06A 2LTOA 2NXNA 1VIEA 1YCHA 1N9GB 2GHIA 3HNRA 2GVNA 5A5FA 1RXVA 1GV0A 2O2XA 3MJHA 3ZGXA 4RQUA 4EL5A 3RERA 4JH0A 1SA0B 4GOKA 1E3JA 1FVFA 1UIRA 2UUPA 5J63A 3TWOA 4O2LA 3MIIA 4CR6A 3CTPA 2IXEA 3QUSA 4QIHA 2GILA 3C6BA 3BHMA 4RJJA 1Q7YR 3K94A 2V7PA 3HV0A 2VDNB 1EX7A 2QVBA 3A31A 4N5IX 4GKKB 2HHAA 1U6JA 4IYRA 3A36A 3ZQJA 2AFIA 3UJHA 2IZ7A 2PUVA 3CVOA 2BELA 4OB7A 1W5FA 1O58A 1Z25A 1JDBB 1U2DC 4BO6A 4KGXA 3PFCA 4X61A 3EAEA 3AJRA 3N0RA 4PGGA 2AF4C 3BK7A 3GHHA 4QL3A 2ZVJA 4LX0A 4DMMA 3VNSA 4DRXB 4MWGA 4EMBA 2I22A 3LXXA 4GVLA 3T95A 1ZNYA 4E7LA 4MHTA 3I5MA 2I0NA 5TMPA 4HKEA 4TYYA 4IIMA 3H0CA 1GJRA 3LOUA 4EZEA 3RTCA 4MS4B 3C5CA 5AK5A 4WZZA 4DREA 2KAFA 5ALSA 2HMUA 4GM0A 4BP1A 2GGSA 5DGDA 1G5VA 3FJYA 4B45A 1NVXQ 2FUCA 2ZJ8A 3NBKA 4E5NA 3I56Q 3JVDA 2P2SA 3DVSX 3VOSA 1E7QA 2P0EA 3LT4A 3JCMg 3HH8A 4FDUA 1JLMA 2FFAA 4J43A 2ZKLA 3TZEA 3SM9A 1FTNA 2OWEA 4OJMX 4R16A 4AQDA 2EJVA 1QANA 2FQ1A 2QY9A 3V1TC 3TF5A 1A1VA 1T5TA 4KAAA 2PMKA 3FYSA 1F7UA 1O8BA 2I87A 4NYMQ 3F73A 2GAOA 4ZN6A 2DYIA 2HQSA 3EGDB 2F3SA 1KNXA 3I52A 3GLIA 4R2JA 1QP2A 3NGPA 1X1AA 4MYRA 3ROEA 3W2FA 4A7PA 1FYEA 4OP3A 3S29A 1PWHA 4NFLA 4OXNA 1YVDA 1PJQA 1DDOA 2JVJA 3I72A 1UJNA 3CF4A 5LD2B 2EYYA 2WZBA 3TLCA 3EG9B 1R66A 4BXOA 2K3XA 3DP7A 4ANJA 3BY7A 3N2KB 4NZPA 2ZR8A 2NUTA 4WX2B 3SF8B 2QU8A 2H2HA 3H13A 1ISHA 3H17A 1KMIY 4Q3DA 4Z5XA 3AFNA 3QMVA 1FP4A 1MRZA 1MENA 2H06A 3L06A 4PPGA 2SNIE 2W2QA 2H51A 3OT4A 3QTLA 3UBMA 4FHDA 1D2CA 2TS1A 1Z13A 3QUBA 2UVPB 5G53C 3OYEA 1EX9A 1H0SA 2XMCA 2QTVA 4H3KB 4ZVQA 4AP6A 3OYIA 2QVLA 3I5XA 1E1RD 2NO7A 3DS8A 4F3CA 2O1XA 3ZVNA 3H84A 2VRNA 3IMEA 4Y0NA 4BKUA 2FMTA 1C0PA 2F8MA 4CKZA 4E6EA 3HZZA 2B4KA 1VDZA 3GRUA 4CLEA 4G0XA 4JT8A 3HJFA 3X26B 4GS5A 4JC4A 5HE9A 2O3TA 1W4RA 4ALIA 1XZQA 1FFBA 3I92A 2ZGVA 4V03A 4BUGA 4RF3A 1FJ2A 3TLZA 4B3DA 3I34X 1OSNA 1CX9B 4L7QA 2NZ8A 3ZHSA 2Z8XA 2CFOA 5T67A 4CU5A 3L7YA 1CERA 3LLMA 2X1MA 4LNUA 4CW7A 1SVOA 4RVUA 1HDOA 5K20A 3CX4A 1WDWB 3HJTA 1HO3A 1JU5C 1UJ4A 3EGVA 3H1FA 3B60A 1MG5A 2UZ1B 4ZZ3A 1ZOIA 4FD3A 1P5HA 1YDFA 2D1YA 2DTDA 3OYMA 4G0ZA 4OHKA 2QDYB 4C89A 4J0GA 1MXFA 1NR7A 2IEYA 4BO0A 3GGGA 4FKBA 3CCVQ 2LR0A 2ZYUX 3U3MA 4B3JA 1RLPC 2VQ6A 1WWKA 1ZSGA 2D0PB 2DHDA 1IGQA 1OYXA 1NI5A 3K2IA 5K3CA 2AN1A 3TOXA 4GOOD 2DULA 3PHIA 3SGLA 1UDRA 2F67A 3NC4A 5H5JA 3TRHA 4HNVA 2BZSA 1SG6A 3NNDA 2JFPA 4AY6A 1Z75A 4MQLA 2DKNA 3WGQA 2P6RA 4M78G 2KY9A 3CLSC 3O93A 4FYIA 2WV7A 5FF9A 5IMBA 3BQNB 3GT3A 4PRKA 4OP0A 2C4HA 4RFVA 1D9XA 3UAWA 1YCSB 1SEVA 2HTEA 4DC9A 1NVFA 2VL7A 4GQIA 1PIWA 1KJ8A 4ID3A 2IYPA 4JXJA 3CCJT 1RYYA 4GKBA 3RVDA 2LJ3A 4ZGWA 1I24A 1NASA 3DMFA 1YL6A 1ZEMA 4L28A 4EYEA 1QTNA 4YNBA 3NIWA 2QYOA 2J1LA 1WOMA 2ATVA 1GRIA 1SAYA 4ARSA 2CSQA 5FRDA 1FFGA 2RCYA 3FAZA 3D5QA 3M83A 4G67A 2PUOB 3NUGA 4X20A 4B2YA 4RHYA 4XM0A 5LDDC 2XQVA 1XTJA 5CQXA 5F12A 1J1UA 5GAMd 2AI1A 3FTQA 4FFWA 5DMHA 4NHOA 4QTUB 5IJ0B 5HZMA 5KJ1A 2MIOA 4XIYA 5I01A 3EC2A 5DBEX 3VSAA 2ZYRA 4DV5B 1BWPA 3D4LA 3VR5H 5JS2A 2OFFA 5J3JA 1FDIA 3OC0A 5ER9A 5TQ2A 4RVHA 5EY5B 1O97C 2ZZKA 4CFSA 4CFZA 1ZC3A 2K6DA 2PYZA 3L8CA 3RUCA 1WQ7A 1ZHHA 5C8DA 5KZMB 3ZBDA 4DT1B 2QDXA 4TKVB 1QMCA 4N0EA 1C1XB 4FZVA 3E58A 4G1BA 5K2OA 2VK8A 3BL8A 2CP7A 1VXOA 1UTIA 4L73A 4LI0A 4PINA 2ASVA 3D2AA 3TCXB 4BKMA 2HCBA 3MJTA 1GUZA 1Q21A 3QFSA 4YCMA 2R1TA 2X0KA 3LUAA 4LHWA 4J76A 4KPGA 4EB3A 5I7EA 5E6RA 3ANSA 4IEIA 3VS0A 3ZCQA 4DIOA 3CCUA 3UOGA 1TA0A 2REQB 1TGVA 1FBTA 4KPUA 4O08A 1RAFB 1F4LA 1BVRA 3ONVA 3WMRA 3UK1A 1KXZA 1E9FA 3O3NB 4X8LA 4L5IA 5FWYA 2CLCX 2ILTA 2H1LA 4MRSA 1PHTA 2QK0A 5FPHA 4BGUA 3D6HA 5IJWA 3BMOB 1T15A 1Z6YA 1NFFA 2WYWA 5EXEA 3S68A 2DR2A 6LDHA 2FN4A 4RG8A 1J23A 4XTXA 4A8JB 3ENKA 3H9UA 5AW7A 1W2WB 3HYNA 2BFDA 2X7XA 2WIBA 4LY3A 2F1HA 2ZB4A 3DQQA 5H9VA 1XDGA 3H05A 3KVOA 3NBXX 4LVNA 5D6YA 4ELZC 3G6EQ 3CKYA 1U28A 3CRQA 2GDZA 1X7HA 4BWVA 1T0JA 2EF0A 4BRUA 4DIFA 3V8BA 4Q3KA 3QRWA 3N59A 7ADHA 1CJKC 3FAKA 3TSYA 3KJEA 5BSHA 4U7DA 4ASUA 3RS9A 2FPUA 4F9GA 3TO5A 4K11A 2IODA 1GEEA 2B0CA 2R6R1 3HYCA 2CP0A 3PDJA 2PMCA 4OMNA 2PLNA 3ZJYA 2Y1DA 4WACA 3I9V1 1KK7A 2IYTA 2CVZA 1SC6A 5AO9A 2V7WA 1KAMA 2JKZA 3D7NA 3DMTA 2WU0A 1E2UA 2BVNA 3KP1A 3NZEA 4ZEWA 5E6UB 5LP6C 3RWMB 3BWEA 2F6RA 2QRJA 4BQIA 5JEDA 3DLTA 2I2BA 4RGYA 4WOBA 5BQOA 1AGRA 1ZSZB 1EK5A 4RIHA 4PFSA 2X3YA 1RPTA 2CL5A 5G0VA 2GQIA 3EG0A 4MCAA 3HXTA 1R5BA 1X38A 5AKHA 5ELMA 3WB1A 5DNWA 3IHKA 4P4SA 1X0VA 4DXAA 5D87A 2C0CA 2FZCB 4DL9A 2YYZA 1HTBA 2BFNA 3AQIA 1N8RU 1NLZA 2EAUA 2E1PA 1AS2A 3D6FA 3TX2A 3CH6A 1YVPA 3ZV3A 4OQPA 1VMAA 1CXZA 5AW8A 1AT1A 3TNDA 1CQIA 3I2KA 4C06A 1F8GA 4W9RA 5DMXA 3KKQA 4ND3A 3ETEA 1PUJA 2R96A 1UK8A 5GAOr 3I23A 3KOZA 1CV2A 1T9AA 2WSYB 4M9QA 4JU9A 1C1XA 2ZYWX 4MI1A 3UH0A 4AJ1A 4EQ6B 3CCBA 2C8LA 3F9IA 3RB8A 1YRBA 4NV3A 4NBTA 1F9AA 1T1IA 3E05A 1WUJS 3GH3A 1MKYA 3SJCA 2KJQA 2ON6A 2E6NA 3BWCA 3I5UA 3GMDA 4L95C 1UL1X 4AN0A 1ONPA 1Q0QA 2EGHA 2R8ZA 2VN8A 5E6SB 4DG9A 5HVNA 4KNYA 2O5EA 2O9JA 1E59A 1GG2A 3SXPA 3W05A 3ZDFA 2W6CX 2GPBA 2CXHA 2N1BA 2RGWA 2H5EA 3K53A 3M4ZA 4M7AD 3EUEA 4QE3A 2WPDA 3IX7A 4M9ZA 4UUPA 1WZUA 1E66A 1KK0A 1VG8A 3DFZA 3QKSA 2ZRLA 4F7DA 3NM4A 2NV6A 5GJBA 1QIDA 3WWPA 1WVIA 2H4YA 5K1ZA 4DG5A 4M77F 2VTDA 4KBYA 1R8OB 1E7SA 1XELA 1QZ3A 3EEFA 3HQ4O 3VKVA 5L3VA 3SEQA 4PTYA 2FOXA 4E08A 1SQ6A 4OGGA 4M88A 1ZCFA 1BXKA 3LY8A 2Z5GA 5CIQA 1FFAA 4TTSA 4US0R 5TPWA 4EMTA 1E60A 5BPFA 9GPBA 2DL4A 1WYXA 1E5QA 1LPAB 1OR8A 4OY3A 3SFTA 1R4ZA 3ZZ0A 1TCBA 3W6NA 2CCJA 4TTRA 5H70A 2FR1A 3C43A 5ITVA 4FP9A 3TAUA 1O94D 2VQFB 4FM9A 2JGNA 3REAB 2FPLA 1IGUA 3K70B 4AKGA 1E0SA 3B6EA 4DDVA 1VDMA 1PT5A 2NSHA 2ZE8A 4N9WA 2AF3C 2RGNA 2YRCA 4FHFA 4G86A 1THZA 4LHZA 2DTXA 2QR3A 3B53X 3OIUA 3QV1A 3SZLA 2ATCB 3NMZC 1FCJA 2AFHE 4DR7B 3RIHA 2B69A 1Q6ZA 2Q9BA 3CCQT 4I81A 1L3BA 4FYPA 5CB6A 3VUEA 4I5GA 4B75A 2YWDA 5CVUA 4KO3S 3UOWA 2LCSA 1R9NA 4Q6BA 1R6VA 4K8RB 1JU9A 2EW1A 5LJ5d 5GINE 3V4VB 1XL1A 1AUVA 4TMWA 3OCXA 4YP0A 1N5OX 4OP2A 4UARA 2HB6A 3R44A 3CO0S 2IIMA 3DFUA 5ISMA 1GAXA 5ES4B 1EA7A 1Y5NA 4DEVA 1KHCA 5EMNA 3U44A 2VNAA 1LU9A 4EJSB 1ZNWA 2B4TO 1MO2A 4A8HA 4LF6B 3OLWA 4KSCA 4R41A 1H2WA 5TDHA 3KJGA 5A5GA 4CCAA 3AU9A 4P08A 2P91A 4LJLA 3RLFA 2LV8A 4LW8A 3QKUA 3N3BC 1RYEA 4RMNA 5LNK1 1YUBA 4F71A 2J6FA 3JATA 2MK5A 4RQTA 4NOLA 1ZA2B 2RQUA 2DWCA 4YO7A 1CEEA 2K7FA 1ZGJA 2DL7A 2CMDA 3N7TA 2NU8A 3WI7A 4DJJA 1E9SA 4GSLA 1RZ3A 2D7DA 3ICWA 1MX3A 2JCBA 1Y6JA 2PGJA 3H9BA 2E65A 2ONYA 4WT7A 3WQRA 2A0UA 4CBVA 4WI1A 2ZRAA 2QN9A 1SC4A 1XU9A 2BLNA 2X2OA 4X3PA 4AECA 4FPXA 4ZXPA 3I2IA 2RK1A 4WBNA 3O9ZA 4DZZA 1NPRA 2CT3A 1JJ7A 3WAGA 2FPRA 4Y7DA 1U8EA 4KBMB 3B5JA 3DHVA 4LBWA 4C7KA 3O0TA 4TL7A 2CHQA 2ZAYA 3MF4A 2NXCA 4K9OA 3NYRA 4OATA 4DJDC 4CIAA 4D0LB 4DMUB 4OB2B 1ONBA 1EXWA 1VSVA 3EIOA 4M1WA 5DP2A 5EJIA 2XXBA 2OZEA 3IOEA 4DWOA 3IVCA 4CM3A 4IXMA 1CRZA 2QD3A 4M6WB 1AHPA 4Z4IA 1VKJA 2O0MA 3E9MA 3O4JA 3DHWC 1HL7A 4ITRC 2ZQ5A 4JY7A 1PJSA 4FOOA 4HJRA 2QD2A 3T7TA 1P4AA 3R23A 4M7PA 4RIGA 4MP8A 3NEYA 4M53A 3LBHA 5FA5A 4BNMA 3IP1A 4R1LA 2ZTVA 3PC2A 1TJYA 2DXIA 3PHHA 1GCUA 3PXXA 2V1QA 2E48A 5FUXA 7ABPA 1SC1A 4TVSA 4O4HB 3I42A 1NEBA 3QH4A 5CAIA 1PSEA 1FJHA 2EU8A 2PXAA 2VDPB 3DEYX 3EOZA 4LBVA 1LBSA 4RU1A 4GP6A 2BDEA 4CCSA 1NQXA 5GAOl 2XCSB 3O1JC 4QG7A 4LFBB 5EYPB 1H69A 1EZZA 1ESNA 2VCEA 1Z2OX 2X5XA 3C48A 3EDCA 4X8MA 1JPUA 3TQSA 4EQ6A 4I46A 3BKWA 3MRSA 1XVAA 2Q5LA 2OX7A 1SULA 4HEJA 3PX3A 4LC9A 5EAIA 5K99A 4ETIA 4OLAA 2CKKA 1DKOA 3LCJA 4OQDA 5C35A 3CBGA 2J6HA 4QT0A 1A72A 1KZYC 4MVWA 5E6SA 2VHCA 3KNZA 4N76A 2JLZA 3EB9A 4MQUA 2CDRA 2IYUA 5FYDA 5LA6B 4ABYA 3L01A 5EJ7A 1I3MA 1XDUA 1QC5B 4JODA 1ORTA 1DNPA 2BR3A 2CZ1B 5GAOm 1RXSA 1C3OB 2EGAA 3BXEA 3G5LA 2H2AA 3KXPA 1X7DA 3QELA 4DABA 4JLGA 1UAAA 3JZFA 1GAWA 2HH9A 1PNTA 2QU7A 1MOQA 1XE3A 2OORA 3LYLA 2DECA 3U40A 3X2FA 3SSMA 4BN4A 4YVFA 1PR1A 5H4GA 2PPLA 1NI3A 2ID9A 2PLAA 3DKRA 4OHZA 4RADA 4AL4A 1UGQB 1OFUA 1UBTS 3H2ZA 1OBFO 1Q82U 2ALJA 4TS4A 3KJFA 1KYTA 4NR0A 4EJMA 1A9ZA 4LGVA 2V7BA 2YS7A 2Z2KA 1KDRA 3BDVA 4KWHA 1LDNA 3ZY3A 3LTEA 2OTJT 3DDOA 3PA6A 2NU8B 4EF4A 1G2BA 2ZPGB 1TLTA 2PEZA 4PZZA 5FWCA 3SF0A 5K6TA 1LQ2A 4RTXA 3CCMQ 1WPXA 2QLNA 2IYVA 5FORA 4YUXA 1APBA 2QQBA 5CNKA 2MOXA 4ZNXA 2IPLA 2A35A 4Y2YA 2CSIA 5TPWB 4XGNA 2X0EA 2QM0A 4XB2A 1YR1A 3L7JA 1XVIA 3WLJA 3O4GA 4IKPA 4EW6A 3A4VA 2QDLA 3BGVA 1B34A 3KV3O 4YPVA 3A4LA 2PUKB 2PL3A 3U1TA 1M2VA 1MCZA 4NG5A 3QLVC 2VH2A 2XKBA 4OHYA 1FNDA 5AM5A 3C70A 4DLTA 4I8DA 2ZCJA 3WYEA 3IXLA 3LX6A 4RGVA 1R4AA 1GFZA 2OAWA 3DD1A 2P1DA 3C5VA 1GSAA 3AP3A 3EK2A 4C8QD 1X1RA 4KLRA 4UAJA 2WE7A 2XTAA 2NYVA 2H2WA 2QTWB 1WUHS 1Z9ZA 5LDGA 4ZFNA 3OMCA 4GL4A 4WLNA 1RM4A 3VC7A 1FU4A 1COWA 1LDMA 4L9AA 4OB6A 1T9CA 1ZH6A 1ZW1A 4PHCA 2COYA 3BDIA 5G2OA 2G9VA 5CVCA 2G8LA 3M1LA 1N6PA 4FJ2A 4BZPA 4YRRA 2VPTA 3P94A 4UOQA 3K9WA 1ISRA 1ZRMA 2ZB2A 3AEYA 5GAMe 1DG1G 3NBFA 5DT2A 4UM9D 4BO5A 3A4IA 4GPEA 2YUTA 5EPUA 1KAEA 3Q88A 2FB9A 5JRDS 2RJDA 2DOKA 2QSJA 1EX1A 2EEPA 3NGMA 3KYIB 3EG9A 2HV9A 2JJQA 1J24A 2RK2A 2QRLA 3HXPA 3RODA 3C6ZA 1QGAA 1X92A 5HCIA 3NFRA 2PKCA 1SCDA 3EA0A 2IEDA 4AO7A 1Q0HA 4M75F 3G6KA 4JUCA 2VUSA 1Z4JA 4BGDA 2YRFA 5B2FA 4O2AB 2QL5A 2VZ9A 1UDAA 2YRXA 2VYQA 4NFSA 1ZK3A 2V3VA 2HHJA 1Y8RB 3KAKA 1Z56C 4Q7MB 1HURA 5EUMA 1NVAA 3ZG6A 5E8RA 4WXYB 5GIPE 2W10A 2PZEA 4KODA 1D4OA 5DN6A 5AHWA 5IN4A 3NKFA 4IUVA 3GJ3A 3SWNA 4D4MA 2X6RA 3LAWA 1JXAA 3QLUC 2VTBA 1T6ZA 5IXFA 2JI8A 4FNOA 1U9CA 1ULZA 2IYWA 4PJNA 4FL6A 1RACA 1YK1A 2JPDA 2RI2A 3GZ4A 4WKOA 2BL4A 4WN9A 3SOPA 3TE7A 5K0SA 4GDFA 1ZBXA 1DFIA 1YE3A 4ZIRA 4MS4A 2DBKA 3FI0A 3EPRA 1O5TA 4RV4A 3ZHCA 4MA4A 4XTYA 5FLXE 4WZAB 3TOVA 5IHPA 1JTEA 1RD4A 3DEJA 4KIJA 4FYMA 2Q5EA 5B5SA 3ZXUB 4ZC1A 2I3DA 3THWA 2YJZA 1H3NA 3PFFA 4JC8A 5EKXA 4A4HA 3H2BA 1VQ6A 1LTKA 2WPDD 3HLKA 3OIGA 4WFQA 5GJVC 4B44A 1ZR4A 4C4YA 3ZWNA 1BGXT 2X3XD 2FPPA 3FPBA 3W8NA 4HCBA 1W85B 5B2EA 1W5SA 1Q1QA 2BT4A 4CMJA 4X92A 3JYQA 3FBGA 4Q4HA 5JJLA 3WLSA 4V0KA 4BY6C 1GU1A 1PHRA 4FZRA 4H27A 4LZWA 5IDYA 3VVBA 4ENSA 1EVYA 1TADA 4QUBA 1LF0A 4HNTA 4FILA 1NLMA 3JB9G 4FC6A 1D0XA 5K01A 4J0HA 4B09A 2PKRA 2CBZA 3TU4K 5DBOA 3UK6A 1PZGA 1TPZA 5MGNA 1ORWA 3ZHTA 1JFFB 3TX6A 4L0MA 3GAZA 2PX6A 4R4JA 1NJ2A 3NVAA 4U9IS 4BO7A 1XWWA 3R0VA 4B9AA 1EUCB 1U0OC 2QUAA 2G5PA 2I8AA 3CGWA 3PPVA 1CFZA 4FKZA 5JAQA 4K9QA 4TS1A 1W9HA 1HDCA 1RLMA 1XYYA 4OLFA 2GZDA 3TKYA 3VPDA 5IJ9A 1V3UA 1DEOA 3QJGA 3JWIA 4QASA 3W8EA 4L4UA 4Q1BA 5M5BA 3WLMA 3HCDA 1OPRA 1RM5A 4N8DA 4N0AA 4I1PA 5KOJB 2A1TR 4DHWA 4YRNA 3P2JA 1JDUA 1M3CA 4M7AE 3L82B 2V26A 4Q66C 2QE6A 1SXJE 1SG5A 3FJPA 1V9LA 3IYLW 4ICIA 5AH0A 3WA6A 2I3AA 1AZWA 1U7WA 2NTVA 2RG7A 4D8YA 2OCPA 5JW6A 1JR4A 4UCFA 4WKBA 1C9NA 3FCYA 4FZ5A 4OK3A 2GPAA 3ABQB 3ANLA 2ACKA 2GEFA 1VSBA 2WSLA 3C7KA 4BE2A 1GKLA 1OOEA 1PS8A 3E1SA 1SVUA 1GFCA 3GY0A 3L8ZA 3P9CA 5FHQA 5C18A 4KL8S 3K8QA 1TCCA 3LQFA 5IH7A 3IUEA 2UU9B 1WQWA 4TV9A 4WXRA 5T8KA 1NBEA 4MAMA 4CKEB 1U2SA 4NZOA 1YBHA 2JA2A 3SZRA 2FLVA 4CHTA 1YI8A 1FS5A 3SBDA 3K6JA 5AVXA 2KQWA 1X69A 4G81A 4AKSA 1I5OA 1MVLA 4FFDA 4DLNA 3MK31 1J8QA 4N18A 3QNWA 5I21A 1I5EA 3Q8WA 4BFWA 3FKSD 4UAVA 5F2EA 2LDXA 1DTWA 3SZUA 1V76A 3I9QA 3ESAA 3QBYA 3WXMA 3URGA 2XK0A 5GAN8 2GASA 2G17A 3VO8A 4ZIRB 1K3UB 1THTA 3JQ8B 4Y18A 4BMXA 2V4UA 5BN1A 3C3WA 1SBQA 4OJYA 1LK0A 3OWHA 4PS0A 5FADA 5KINB 3ZDEA 4CQLA 4HVAA 4UBJA 5J2UF 5HQ3B 2HYIC 3H0IA 1X1CA 3IBYA 4C7JA 1RS0A 3VTKA 2CHGA 1PYOA 2XVZA 4WJLA 2YQ4A 4RVSA 1L1QA 2MIIA 3L4BC 3B3FA 1IEVA 3D02A 2H3EB 4INZA 1L5HA 4S1VA 5KSWB 1JJIA 3ON5A 5KUTA 4DOVA 3CN9A 5LJ3h 1MJFA 5JZSA 1KAGA 1ULUA 2PQ2A 4WY5A 5EMJA 2G83A 1EG2A 3JWJA 4C2UA 1GGJA 4OKNA 3VDNB 5AIBA 4M99A 4H1HA 3QYPA 1G55A 3AM5A 3NOVA 5TQ0B 4O2BF 2J3EA 2XCIA 2D0NA 4QLOA 3GDGA 1EHCA 3RVOA 2GGRA 1CUBA 3DLIA 4F5EA 1BXGA 2PCLA 1M1KC 1WEKA 1VQMQ 1G7RA 4CIVA 2QTGA 1OGJA 4OI4A 4DLZA 1KBQA 4ZKDA 5LMCA 8ATCA 1WPYA 2OO7A 5CUQA 2HCRA 1V8OA 3FWPA 4UHKA 3META 4AN4A 1T8UA 4MVJD 3P8BB 1F8UA 4GYKA 4M7DA 3FN4A 1D1CA 2D7JA 4E51A 3B70A 4NL3A 4XUCA 2D5IA 3U3RA 1K06A 2PX2A 3CS3A 3CX8A 3GRRA 3AIOA 4CEIA 2HT1A 3GI1A 5ITSA 3C0KA 2LBPA 1FNBA 1GPYA 2ZYIA 4O2AF 4WZBE 2KRNA 1Y4ZA 3AJEA 3GX1A 2QVGA 5LLDA 4R1PA 4PO1A 4HBGA 2BONA 4G2NA 2J6BA 3OPNA 1TF2A 2QM7A 1MIOA 3CRRA 4NAVA 4X6XA 1PI3A 1EFCA 3CV3A 3D6JA 3WSTA 2C88A 3K2QA 4GF5A 1HQCA 4D44A 3EDOA 3LC0A 5CFPA 2A57A 3SCZA 1QV9A 1IOZA 1T3ZA 2WTNA 3QPBA 2P2DA 1RYMA 5FLEX 1K73U 1KOFA 3IP8A 2JJ2A 4QYSA 3UXEA 1RCUA 5FBWB 1Y1TA 3QXJA 2G72A 3EG5A 3EXFA 3CH7A 1KKMA 1VECA 2IYYA 2JZNA 2ODNA 2PVPA 5ERYA 5CTJA 4PAQA 3N7AA 1RNLA 2I54A 4DRYA 4N4HA 5CX1A 1WSWA 3RKSA 1RWOA 4EWLA 5M7EA 2JCXA 3GMTA 1S2DA 1Z2PX 3IOYA 2R1UA 4Z4FA 4H3SA 4KLZA 1SHZA 1CQIB 4M78D 2WICA 1W49A 2R2GA 2NG1A 3S8EA 1QKIA 2KVQG 4R2XA 4WA8A 4XTUA 3KOXA 4NFYA 5BOSA 3VO9A 1QIJA 1BBZA 1G98A 3ZS8A 5JS7A 3TIFA 5LQKA 1D9ZA 1DMSA 5AHKA 2A0FB 1FP7A 1VOMA 4PLCA 4BAZA 5FWNA 1VLZA 5HHTA 1EJ0A 1QK4A 4IIJB 1Q5PA 2CLHB 5JQGF 1QVFA 4MUMA 5GONB 3G88A 5EQFA 4F4UA 4GVPA 1J7JA 2HJVA 3I04A 4L5JA 3EXEB 1O6FA 3WC4A 4AN1A 4FFNA 4JDSA 3W6ZA 3JCZA 3D59A 3OZVA 4H0FA 4ERNA 1ACJA 1YJNA 5A05A 2WJHA 3TTTA 4A3SA 2EX0A 4IF4A 3V5NA 2EQIA 1YS4A 3OZFA 2XT9A 4K6KA 1KC8R 2Z95A 1KEEB 3RJTA 3EAFA 5H3LA 1J2UA 4WNYA 1PK7A 1RWBA 4RKUE 3C3CA 1S4MA 3FFAA 3VSCA 5GJVB 2VASA 3F90A 3L3BA 4OB0B 1COWD 3OW2S 2XHEA 3DYVA 4I66A 4Y9UA 4K05A 3WKBA 3B82A 2HL6A 2OHOA 4EEZA 1Y8QA 1NW4A 3NRBA 5JY1A 4Q15A 3QFTA 3SS9X 4B33A 1M2JA 1Q19A 2HMAA 1WUTA 4RULA 1QAQA 4N7BA 5CA0F 1M67A 3J7AF 4DLSA 4LZNA 3SHOA 3SM3A 4D1YA 4GIBA 5E6UA 1M3AA 4UUMA 4CODB 2RBKA 1MB9A 4AVYA 2CE7A 2E3HA 2O2HA 3A6FA 1Q86R 3ET5A 4FSDA 4G5QA 1NJSA 2NQTA 4L57A 3TNJA 4OSEA 1VYVA 3KEOA 4PGHA 5AVYA 5LDHA 3QSYA 4XK8E 1A4IA 2WKPA 3WXMB 1KTVA 2C94A 4PSAA 4G4JA 2BEUB 4YI5A 5T6MA 3KLPX 5DK4A 5FHRA 1EM8B 1HSOA 4PLFA 4XU2A 3UJAA 5ELXA 1OXSC 4UVDA 4Y9DA 5LL6P 3UJ8A