4DEYA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
319
structure length
281
Chain Sequence
b'EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1C
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 94
structure length 281
sequence length 319
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4deyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4deyA02
3DMNA 3G0HA 4NL4H 3EARA 2ZYTX 3FYHA 5TDHA 3SEMA 4GOKA 4Q7LA 1W5SA 4FINA 421PA 2GJKA 1NG2A 2KYMA 4CEIB 4Q9JA 2R6GA 4G5QA 4Q4HA 1ZM2A 1KY3A 4ZNXA 3PJRA 5KDLA 2R62A 1W44A 3O5ZA 1SEMA 4WZ6A 4MGYR 1WYXA 2AFIE 2EFCB 4QM7A 3ZD7A 4MQBA 2DWQA 1XJQA 2YKGA 1AN0A 4KU4A 5IRCD 5IDVA 3KJHA 3IEVA 1GOTA 5FL3A 3PEWA 2GZDA 4OI4A 1ZM9A 3QXXA 2DY1A 5FTNA 4AWXA 2HJVA 1AIPA 2X8AA 1RRCA 1P9WA 1KHTA 4DLXA 5KNBA 4DB4A 5FW9A 1QG2A 1P2SA 3FE2A 1Z5ZA 1XMJA 4Q66C 5FI1B 4YMTA 1GCPA 1I0CA 3NH9A 3R8CA 4ZIRB 3WNDA 1OH8A 1UJYA 1L8QA 1NIPA 1M6NA 2P6UA 2WSSA 3QIAA 4JT2A 3LXRA 3W6NA 1U0LA 2BZXA 3PVQA 3BIFA 1TEXA 5JJIA 2IK8A 1T0HB 1U8ZA 1U94A 3B6EA 3QQ5A 4XVRA 2DF6A 1QKXA 1QKWA 2ROLA 5EUQB 4S2EA 4WW0A 2IT1A 4ESRA 3PE0A 1N0WA 3P1JA 4XWOA 2QE7D 4ORZA 3MJRA 5GVRA 4KJZA 1DAHA 3SBEA 1A1VA 1LVGA 3U6BA 2B21A 3QEOA 2ZRFA 2REOA 4KO8A 1EX7A 4HB0A 5I11A 5EC7A 4CC3A 5FR1A 2O2OA 1L7VC 1UJ2A 2IYZA 4JMPA 3V9PA 4KBFA 1CXZA 3DHWC 5KHOC 3VR2A 1YJ5A 1KI7A 4EJSC 4FMDF 4URWR 2IWHA 2DWPA 2C99A 3RC8A 3WYFA 4EFLA 5CB8A 4A8JC 4F93B 1UHFA 1K0SA 2W2VA 4BPBA 3QXHA 4LHWA 4DBLC 4URZR 1RJ9A 1EFHA 2O8DB 2F1HA 4M2LA 4POAA 1M27C 1LFDB 5FL7A 1UBCA 2GETA 1YZLA 4L9SA 3WBJA 1JEGA 2GK7A 3LBNA 5K8IA 1SKYE 2EQBA 2P2LA 2YOGA 1GRQA 1W4AA 1H8HA 3VHXA 4D25A 1P2VA 4J9BA 5BYKA 1RLPC 3OE7A 3MG9A 1E2PA 1U5SA 1ESMA 1T9HA 2DYBA 2FG5A 2JJ2D 2WJHA 2ZI6A 3BFVA 3A1SA 4RFVA 3QPWA 4BFVA 2XB2A 4O2RA 1CRQA 1UECA 1HE1C 4Q7MB 3D31A 2O0JA 1KZ7B 4BLTA 4DB2A 1LF0A 1PKSA 5EP3A 2JLZA 2XZPA 2YC4C 2RMOA 4BEBA 4LDJA 2ZU6A 1NKSA 1H92A 3A37A 4PFSA 1UHCA 1JPJA 2HLDD 2ODBA 4TTQA 2KGTA 3GP8A 1Z2AA 2V7QA 5IK2A 2RPNA 3EZ2A 1IM2A 2O52A 1OOTA 1SVSA 4HLCA 5TMPA 4NMMA 4G5SA 1OFHA 3D8BA 1TEVA 4UXJA 1VECA 3AVVA 2C98A 3KXIA 2CH4A 4DLZA 2J0SA 1OXTA 1TF7A 1PLJA 1UBGA 2G1KA 3EW9A 4J9IA 1NEBA 4ACAA 2V1RA 1Q1ZA 3B1VA 4O0MA 5AUOB 5FBVB 3RWOA 4FIDA 2VQSA 1S0UA 1XJCA 4QM6A 3TUIC 5DI9A 2B8TA 2KBEA 3TR5A 1Q1BA 1FMKA 4V0NA 5KOYA 5HR5A 4R98A 2Z4RA 4DVGA 3H0FA 1XWIA 5CDFE 1BMFA 1SVWA 1UE9A 2DL7A 3KJGA 3CRMA 4R2IA 2O8EA 2F1JA 3QKUA 3H41A 4OQNA 5IH2A 1FPMA 1C4OA 1Z29A 1PJRA 4PZLA 2VYFA 3UG7A 1U99A 2O8CB 2E9SA 1GL5A 2CEAA 3N5CA 2IYYA 621PA 2D8HA 4XTCS 3OF5A 3RS7A 4FWIB 4OHZA 4Q01A 1G3RA 2JXBA 1KO4A 2ZSDA 4IEEA 1UBFA 2VP5A 2ZETA 2R6FA 1CR0A 3EWSA 4IOJA 3L8ZA 2DNUA 1ZVQA 2DR3A 2G0NA 1CJKC 2WIAA 1ELOA 3KB1A 4S35A 4XJXA 4D0LB 2OUKA 1TF5A 2YINC 2C03A 1CP2A 2QZ4A 1GKUB 2C0IA 2FFBA 1X69A 1CJTC 3GJ7A 3K0EA 2ZVQX 3RNJA 2O0KA 4QRHA 4ESVA 3OIVA 3M0EA 4BECA 3ADCA 2DL3A 2X3WD 2NTYC 1S9DA 4D4MA 4DT1A 2BBSA 4OL0A 2PZGA 3EA0A 1X6GA 2FO0A 1Z9ZA 1JECA 4X8MA 4Q4JA 1ZYUA 4J9GA 1GSIA 1HD3A 1RJ9B 2L0XA 1W5TA 5CIWA 1HURA 4M9QA 5J4YA 2V1QA 1E1QD 2BOVA 3KXLA 3MWYW 1MV5A 4UKDA 4AG6A 2ZRCA 3E1SA 1RI9A 2ZE8A 3DM5A 5KSZA 2QQEA 3W8RA 1DELA 1W36D 1HT2E 3H0KA 2VHUA 3IPYA 4OMPA 3HYTA 1P3JA 4ON9A 1G291 2EFEB 4BQSA 3OEED 1G7CA 2OBNA 4A4DA 2IWRA 2RQRA 2LNHB 4LJ7A 4YLGA 4WAUA 3VMFA 2QGZA 1SVIA 3CF0A 1II8B 1WCV1 4NYMR 1DAIA 1W0JA 1CSKA 2DFNA 2OILA 3TW8B 2FFHA 3NC0C 5JI3E 2J0UA 2C5LA 2BVNA 4DC9A 1JQJC 2MSDB 4CDGA 2BM0A 4V03A 2L3SA 2J06A 1AGRA 3LDAA 3VS3A 1AK2A 1O87A 3MWJA 1IN6A 1E96A 3RVBA 1W7AA 1ZW6A 1DAGA 5TVKA 1KI2A 3UMRA 4KITB 1SVMA 5CK5A 1JR3A 1WLPB 3VR6A 3LBHA 2LP5A 2OAWA 4GSYA 4ASUA 4D4JA 3ZD6A 1VCIA 1I07A 1MV0B 3KB2A 4PO1A 4LN2A 4IEIA 1Z22A 2JJ1A 4L16A 2O8EB 4EIKA 3C41J 1NKTA 4IOLA 2B8WA 3OAAD 2J6KA 1QHSA 1Z6TA 4TYPA 3U44A 2VBCA 2WJIA 3P27A 1UUEA 4JYCA 1A7JA 2A37A 1BYIA 2AXNA 4WXRA 5CIQA 1XTSA 3BBPA 2PMKA 4BFUA 1KNQA 1F60A 5LD2C 4JL6A 1G6HA 1KY2A 1ZNYA 2GHIA 4WOPA 3IHLA 1Z07A 1YWPA 2HUPA 2QTFA 2GCOA 2VHJA 2IYRA 1P6XA 2PZ1A 3Q5DA 2ZRGA 1ZIOA 2VIIA 5B2ZA 5JLJA 1NY6A 4U5XA 5DN6D 4V0ME 2D1XA 3EG2A 1ZLMA 4M4ZA 3CRW1 3EZ6A 4JBWA 4RD0A 3SHWA 1K4US 4QC2A 1OB2A 3LVRE 1E2LA 4MRNA 1NN1A 1W70A 1AQYA 1P2TA 4QBIA 3SS8A 1I2DA 1KDRA 4DSUA 4HAUA 5HZKA 1P75A 4O3MA 4C7OA 5JJLA 2EKHA 2NZ8A 3VNVA 2EWWA 1P5ZB 2NPFA 4DT1B 3C5HA 1NN3A 4TT3A 4HDOB 3BORA 3CNOA 4OMLA 1E1RD 2G6BA 3B82A 3CR8A 2ZJYA 3CX7A 2ECKA 4HLUA 2V55B 4Q4JB 4YC7A 2WZQA 3LH5A 4JJCA 2GEDA 1YZGA 3AKDA 2BV3A 2X77A 3MCAA 3IGFA 4B43A 4H1VA 2QPAA 4Z8YA 2R44A 3AV0B 4GPTA 4DXAA 1WDXA 2DWOA 3CKLA 3F0TA 5L23A 2Q6TA 3FWYA 3U3KA 4M1OA 4Z54A 1M7GA 2CREA 5F2EA 4MKHA 4G5RA 4N0EA 4Q5IA 4A0HA 2SHKA 2J9RA 3OZXA 1WMSA 2BJWA 2JM9A 2J5XA 3TAUA 4QGAA 1GM5A 1SQ5A 4BFWA 3HPQA 3K70B 1E9CA 1GBQA 3UANA 3WHKA 5DHAA 1KSJA 2AFHE 3K1JA 5BWMA 4Q1EA 4WZAE 3LFUA 3MSXA 3TQFA 4GRAA 4M22A 5D3QA 2OXRA 3EX7C 1CKBA 4RTTA 2J0UB 3GLHA 5HE8A 1KO5A 4TL8A 2XNDD 4MGIR 1YVDA 2H17A 2W2TA 1E2IA 4CW7A 3KQHA 1NBMA 5GJBA 1WFWA 1AWOA 2QSYA 3Q9LA 3RYTC 4RTYA 1HUQA 3AM1A 1KO1A 1QG4A 3LAWA 1RIFA 2ED1A 5FI0B 2KI5A 3KX2A 1E32A 1XU4A 2WOOA 2ZJZA 3A36A 3RWMB 1BH2A 2WVJA 3I1FA 1DAMA 3T1QA 1VKJA 4JLKA 3GEEA 4ACBA 2XMFA 5HCNA 1HTWA 4ZDIA 4DIEA 4F17A 4LJ5A 4U00A 3K0FA 3VR5A 5IHPA 3U44B 4HB4A 4R7ZA 1W1FA 3ADDA 3GBQA 4AKGA 3R9IA 2QP3A 3UWKA 5JFGA 1G64A 3ZQ6A 2AKAB 5TY0A 2NGRA 3SQWA 3GJ3A 1E2HA 1G17A 3ASZA 2JLWA 2BJVA 3KKOA 1NIJA 2GCOB 1C9KA 3KL4A 2BBTA 3FHCB 1PWTA 3KQUA 3GQBA 4IKEA 5FPKA 3K0AA 5KYKA 4RTZA 1VA7A 2IIMA 2DRKA 1RRPA 2K7AA 2BMFA 3RC3A 3ZIAD 2YT6A 2E5KA 4D8DA 1IXSB 2IXEA 3KUDA 1GRNA 3G5UA 1DS6A 4MGKR 2OG2A 2Z43A 1U2RA 2RGEA 2JDIA 2LKCA 3VHLB 4C7OB 1S4QA 5JRJA 1XCMA 1KJZA 5BQ5A 2REXB 3I61A 1I2MA 2OV2A 1KZGB 4IFBA 4RY2A 3KKMA 4PPQA 2PEYA 3A1UA 3K09A 1N6PA 3ZQJA 5DIFA 4DCUA 2HEQA 1T5LA 2MSEB 2WJGA 3AEZA 4HAYA 4LK2A 2GJ8A 2LJ3A 1E6GA 1OHHD 1XNJA 3LD9A 3FFAA 4MUBA 4KHZA 2DM1A 3E2IA 1H3HA 2OFOA 2B7BA 2ZRDA 1U9IA 4XSHA 1A5TA 3ZVNA 1X1RA 2W00A 4AKHA 1IOZA 5GADl 1GP2A 4R9UC 2KXCA 4CC7A 3WXMA 4OMMA 1MUZA 1Q0UA 1TQDA 3LO5A 2EGEA 1KFZA 5A4JA 3EGUA 1SXJA 4BRWA 2LCSA 3IQXA 2H8KA 5L3RA 4V02A 2NO0A 3R7WA 4GOXA 4DLSA 3Q5EA 4IVQA 2V1UA 1DVRA 1HV8A 4OK6A 4TYYA 5FPHA 1G7RA 3DKVA 3QXCA 4B3DA 4WXPA 5JRZA 5EE3A 4ZV4A 5JS8A 2WSMA 4WCIA 1ZC4A 2NPIA 1IONA 1RZ3A 2GZAA 3RABA 5G3YA 3TW4A 2XOKA 4DSNA 4B47A 3I73A 5B58C 3GLHB 2KBFA 5DHFA 2YJTD 2LJ1A 2CBZA 1ZBDA 1PRLC 5E4FA 1IY0A 3Q3JB 1AWXA 3WNBA 2RF0A 2JIZA 3GD7A 4M1TA 2H16A 1NP6A 1XRJA 5FPYA 1WE2A 1E6CA 3JV3A 2OFXA 2D7CA 1WQ1R 4RZ2A 3IBYA 1TQ6A 3QI2A 2ZS8A 2AD5A 3BS4A 4LV5B 2ZRKA 3SDZA 4NBSA 1GZSA 1W1WA 3THOA 3BB4A 4P31A 4XD7A 4Q48A 3FKSA 4PTLA 4W5HA 2F2VA 3CRRA 3IHWA 3K0FB 4DHEA 2DBYA 1T3LA 5IHNA 4IJMA 1UJ0A 1B07A 2FEIA 3M0RA 1G20E 1ZP6A 6Q21A 4NH0A 1KSGA 4BE7B 4TTPA 1ZRHA 1KSFX 2ZAOA 1SRLA 2QT1A 4JS0A 1VCOA 1MO3A 2A3RA 3AVOA 4BWYA 3M0QA 3PITA 2DE0X 4FMDB 1CJMA 4UNPA 3TIFA 1ZUIA 2DYKA 1UTIA 2WWYA 3E70C 1FX0A 1N5KA 3P4XA 3QE0A 3QENA 3UMFA 2GXSA 2IF2A 3AVUA 1XD2A 5SZJA 2NUZA 2OHFA 1FNNA 2F9MA 2VSFA 2QAGA 2K9GA 1UDWA 1PUJA 2YSQA 1XF9A 1GCQC 3LLUA 4I1UA 2RB4A 4TSFA 2P3SA 2R9VA 2WSSD 1W4RA 1Z6XA 4B48A 3U61B 2G1JA 4E22A 2YUNA 2GA8A 4MYUA 3AGQA 4NTZA 4FCTA 1IN7A 3X1XA 4W5JA 2ZTSA 2CHVA 3CM0A 4I1VA 2RHDA 3K9GA 4Q1DA 4YXWA 1IJEA 1Z0IA 1K1ZA 2A08A 3TNFA 4UNNA 3DZDA 1GNQA 5LB2A 2CK3D 4NU0A 1ZUHA 4B71A 5JHHB 1TNDA 4B35A 1V1CA 1E0KA 4LNPA 3AKYA 3MWLA 2A30A 1QBKC 3ZH9B 3AQ4A 4B3XA 1Z28A 4Z8XA 5HZHA 3H0IA 5H70A 4L15A 2A28A 1SKYB 1SXJB 1QVAA 2FSHA 3B1WA 2G0TA 3LRPA 3TRFA 4B3GA 3T35A 2DBKA 2ROTA 4WZBE 4B2IA 4LOAA 2FRWA 1COWA 3NG1A 1W36C 3QKRB 2X3XD 1KYIA 2H57A 1FOEB 2FFQA 4W7SA 3SN6A 2RGNC 2CVFA 1AZTA 3QVVA 1TU3A 4ZKDA 2KROA 1E4YA 1UDLA 1E2FA 1R0XA 3V4RA 3L2OB 4RCZA 1J8MF 4LY6A 4HAWA 4DCSA 4RJLA 5ECAA 1TG0A 3IUYA 1Y57A 2C04A 2GEUA 4ZDJA 4RCYA 3U3JA 3SNHA 4OI0A 2F9LA 2OCAA 2Z4SA 3ICEA 3TAHA 3VR1A 5FL7D 2C9CA 3B85A 3MRSA 5DE3A 2CSQA 1GITA 4M21A 1A82A 1W0KA 2LX7A 1H8HD 2I1QA 4URUR 1T8TA 5BW8A 4AD8A 1CIPA 3OE7D 1HSQA 3KKQA 3SI7A 4IDPA 1JR3E 4FI3C 1UKVY 4UJ3A 2CLDX 2R8RA 2YZ2A 4D6PA 4AI6A 3V4FA 2DVJA 1OIVA 1DADA 1K8RA 1UGVA 1TUEA 1YZNA 2ZR9A 4HB2A 2KE5A 3AVYA 1KI9A 1ZD9A 5FOSA 4DZZA 4EDHA 4MKIA 4D26A 1IY1A 1FQKA 2CDNA 1G8GA 1T8UA 3HJNA 1OE0A 2XJ9A 2F3RA 3NMZC 2V7QD 1CBUA 3ZS8A 2KT8A 2FEMA 4BLRA 5IK2D 1P60A 2TMKA 2O31A 2GBLC 1XTJA 3CPJB 3JZMA 2FFAA 1QHHB 4QBFA 4QHTA 2B7CA 4PO8A 5E3HA 4CYMA 2DFTA 2DB3A 4RD6A 2A5GA 3JVVA 2KRSA 5IHKA 2DL4A 3NXSA 4IVRA 4E09A 3THWA 1GKIA 4EJSA 1M34E 4TYWA 2QQ0A 1PHTA 1KMHA 1YQTA 5EZ6B 1IAQA 4A8JA 4WIAA 4HUQA 1ZU4A 1WB9A 1GL7A 2RGXA 1TUDA 1X8KA 3Q8XB 3QG1A 4PHGA 2DHRA 2ZS7A 1FX0B 4WA7A 2JMCA 1OXXK 2J0VA 3DL0A 3R8FA 2O8BA 1XD2B 1F6BA 1XZPA 2QAGB 1NJGA 4II7A 4QJ5A 2CCKA 2R65A 3I8XA 2QGNA 2FPMA 3U3OA 2DLPA 5HPYB 2ZSAA 1BIFA 4RFSA 1OPKA 2GGRA 3GJ0A 1J7KA 1MO6A 1ZIPA 1Z9QA 3QPUA 1N5IA 3GJ8A 2IXFA 3EZ7A 4QHYA 2QL6A 1NL3A 1FNMA 3VR3A 1Q3TA 2YHSA 2J1LA 2YWHA 1CU1A 4H9GA 2DRMA 4ITRC 4K8OA 3VKHA 4X1VA 1X43A 2IYSA 1CKAA 4BFTA 1PVOA 2D8JA 1S3SA 2FDCA 4RKFA 3M0PA 3SYLA 4F91B 5EXTA 3UK6A 3QWXX 3OIYA 4JLPA 2KRNA 4DDTA 4RTXA 4KFTA 3L8YA 3QG5A 5KSYA 3TJZA 1XP8A 2A2ZA 1CKEA 3PG5A 2VH5R 4BEJA 4DSOA 3GLHE 4GNKA 4HXJA 4KYIB 2AKYA 4I1OA 3L43A 3V00A 4DEYA 2ZVPX 3WY9A 4A6PA 1NBME 3O8DA 4MKGA 1CULC 2VHCA 2ECZA 3Q7PA 4US0R 3FMPB 1J2JA 2C8VA 4OHXA 4Q02A 4UXHA 3QJYA 5IF9A 1X3SA 1WDTA 3GLFE 2QRZA 3UWOA 4XVUA 2Z5FA 4GP7A 3WMGA 4AYWA 4J9DA 3PUYA 1TF2A 4PSAA 5SZHB 1FL9A 1DPFA 4PPNA 5CITA 3K70D 2GKSA 3DVLA 4PC7A 1IHUA 2PMDA 4O2LA 3VTKA 5AWFC 2EFGA 2RGBA 1JXOA 4NPHA 2QG6A 1CRPA 3HU1A 2WAYA 2FJUA 1VCMA 5BN4A 1W0JD 1JQQA 1EG7A 1LB1B 1MO5A 2EVRA 4LGMA 1TUCA 2BC9A 3VU9A 3VKWA 5FR2A 3ZS9A 4QNMA 5JJKA 3DOEA 5CM8B 3IIMA 4HYYA 3PUVA 2KXDA 2IUUA 2LZ6B 1Z08A 3LLMA 2JM8A 2CE7A 1AS2A 2IYVA 3UG6A 2PBRA 4M53A 3I9QA 1ZINA 4ZDWA 4EJSB 1I4DD 2P0EA 1HY3A 1KMHB 2P6NA 2XJ4A 8OHMA 3KZ1E 5J4VA 1E9RA 4A8JB 1XPUA 1ZD8A 1OKKA 3DMDA 1CR1A 1M7BA 1WP9A 2L0AA 1YZQA 1E2KA 4TMKA 3A4NA 3I5XA 2NO6A 3X1DA 5K8LA 4ASUD 1LW7A 1X86B 2O8BB 1PUIA 1VMAA 2C78A 1EFRA 3THYA 2JJ1D 2K79A 1ONBA 5BXQC 1U81A 1Q1EA 3BAFA 2ED0A 2OM2A 5SZIA 3AVTA 4BFXA 2NOAA 1U98A 2WOJA 3EHRA 3HU2A 2KT1A 4FCVA 3K0CC 4RFSB 1JNYA 1II0A 3CF2A 2J7PA 2QTVB 2AL7A 2NIPA 4NCJA 1VYTA 1OIWA 4Q19A 2HT6A 1DAEA 2ORWA 4U02A 2F1IA 5L8VA 2QNRA 4CEHA 2ZJ5A 3FDIA 2F7SA 3PUXA 1SXJE 3NIBA 4NYIQ 2VHQA 2D62A 2W6JA 1M1YE 1SHKA 1AS0A 3RAPR 4FMBB 3UKDA 4LHVA 1PV4A 3CRVA 5I22A 2RGCA 2Q21A 2CJWA 4BUJA 2BHRA 4CZ2A 1E2QA 1PLKA 5DH9A 1ZU5A 1C1YA 2IUSA 2JAQA 3EPKA 2FX3A 4M9XA 1JJ7A 3L82B 3KJEA 5FBWB 5A0FA 2ENMA 1EX6A 1IXZA 3DPUA 1WBDA 3EPHA 2KSQA 1E2MA 2CL7X 3EZ9A 4HZIA 1V5WA 4B3FX 2LQNA 5FBRB 4TT3D 5FUWA 2C0TA 2GRJA 3TVTA 1X27A 3EWAA 4KLNA 1KSHA 2ZI7A 4Q4HB 2CL6X 4B3BA 2P5TB 4TQAA 1Z6GA 5HCKA 4ZPXA 4HDQB 2ZJAA 3OESA 3SJZA 5F9HA 4IOMA 1E4VA 1EFUA 2CVHA 1V43A 3FMOB 5CLQA 1ETUA 4L4UA 1Z0JA 4V0KA 1E2JA 1E9EA 2XSZA 4F14A 4PHHA 1VHLA 1SPKA 5EE0A 5EQTA 5LPNA 1KI6A 4HDCA 5CYOA 2BZ8A 3AVXA 1A0NB 3DDCA 4NKRA 4MRSA 1VIYA 4Q9LA 1JR6A 4LBVA 2PZEA 1G21E 2ZS9A 3IKJA 4JL8A 3VS4A 2DMOA 2P67A 3T15A 4TL6A 4BGDA 3REBB 2MMGA 3VKGA 2FSIA 2V4ZA 3IEUA 2FZ4A 3WRXC 3HU3A 4MDEA 4DIDA 4F4CA 4BLQA 4ZO4A 3VU9B 5FBQB 1XTRA 4Q7KA 2H5EA 2V1XA 1EWRA 2QTHA 5JS7A 3GEHA 2CLSA 4LPSA 1IN8A 3NH6A 2Q3MA 4PPGA 1NSFA 2GNOA 1G83A 1ZCAA 1M3CA 4KRTA 1IN5A 5E7MA 3X1YA 1ZM3A 2M0YA 1N3BA 2WPDA 2DX1A 4M9SA 1DARA 4TTRA 3T1TA 2GTJA 4FSSA 1RKBA 4IFEA 2JLQA 2QY9A 2ZREA 2D0NA 5EE9A 2OXCA 4RD4A 1TMKA 3THYB 5DNYB 1YR8A 1R5NA 3JVUA 5JBQA 2NO7A 4OKSA 4DDUA 4OK5A 1E0SA 3OHMA 2YNMA 4LYFA 4D8KA 4RSGA 5EP1A 1Q20A 2OT3B 3IIJA 3VRZA 3FTQA 5KO2A 1X1SA 5GJWB 3RANA 1R0WA 3X2SA 5DI3A 1ZJ6A 2RH5A 4P0TA 1VHTA 4C2TA 2HF8A 5AUQA 4CEHB 2EVWX 2ZRLA 4PHTA 2IBMA 4JSYA 2EFDB 1R8SA 4Q00A 4FMCF 3AUYA 5GJVB 1E2GA 1G3MA 4E03A 1OV4A 2A9KA 3EIQA 1XB2A 2JLYA 2DBMA 2EBPA 3GMTA 4D4KA 1Y63A 2CJWB 4G5GA 3TSOA 4PC1A 1OIXA 4I4LA 3KDSE 1UF9A 2VWFA 1E0JA 3FHOA 1Z47A 4HCKA 4JZ3A 1RRFA 2I1VB 1F48A 3VX3A 2QU8A 4EFNA 4EQ6A 3I8SA 1TQ4A 2GJ9A 2EYYA 4M1SA 4PQFA 4Q4LA 2V6IA 1KGDA 3PUWA 1ZBJA 1DE0A 1GNPA 3W5JA 3EG3A 2FH5B 2IYTA 3PV0A 1MT0A 1RVDA 4IOKA 2JTEA 2FRYA 1XOVA 2ANCA 3CH4B 3EIHA 4JYBA 4E07A 5K8UA 1E0AA 3LA6A 1M3AA 4AFZC 4Q1FA 2VVKA 2WWIA 5FPSA 4M8NE 2ODNA 5DYIA 3REGA 2QM8A 5C2JB 5L3SA 4NZYA 3NTUA 4K46A 4EAQA 4C9BA 3F5FA 3B1YA 5TB5A 1NRJB 1SXJD 2L3PA 1OXUA 2NZJA 2OLKA 4KCGA 5FOWA 1XX6A 4B32A 1KK0A 3NHBA 3MUFA 4PXAA 4X8LA 1AKEA 2JA1A 4JT4A 5FTJA 5LD2B 3BB1A 1KI6B 2ZJOA 4LPKA 2WKRA 4Q9KA 3CW2A 3H1TA 2FV8A 1T4GA 4EPWA 3MGCA 3AKCA 1ZUYA 3DM9B 2W0ZA 2G3YA 3M0SA 3CR7A 4JL5A 3LVQE 2K6DA 2ERYA 4NYJR 5FTLA 2XOKD 3VX4A 4R71A 3I5YA 5B57C 3BD9A 1I1JA 3NDBB 4MITA 2AWOA 1BU1A 2G77B 3GFOA 1D5CA 3I4LA 2JIZD 3PCRB 1MR3F 4KI0A 1KDTA 5F98A 1ESNA 1KIKA 3M6AA 3NDPA 1B23P 3CONA 3NWJA 2XXAA 2W10A 4CRWB 1E2DA 2HXYA 3B2EA 3RS4A 2YWEA 5CM9C 1X8JA 1RUWA 3B9QA 1GIAA 2MCNA 1UEIA 1KSWA 3VS5A 4XD7D 5JSZA 1NG9A 1K5DA 2KBTA 2HDAA 2EGCA 3CQTA 3I35A 4RD2A 1CJVC 2LJ0A 4Z89A 2WBLC 1NVUQ 4KVGA 4AC9A 4OHVA 4OQFA 3VS6A 3AF0A 1FMJA 1KTVA 1P4SA 1EFCA 3UMSA 1AZSC 1NMZA 1G19A 4GMDA 4M0LA 3GLGA 5EUMA 3RLFA 2DL5A 2WKPA 5DI3B 3F8TA 3FKQA 2BMEA 5E7IA 5G41A 1EWQA 2IX3A 1FUKA 1XD9A 4GZMA 1G5RA 5KDDA 1OFIA 3TBKA 3DO6A 1NN5A 1JEEA 1GBRA 1MOZA 2AR7A 2FPLA 2R6AA 5DO9A 2GAOA 2I0NA 2QPOA 1EFNA 2WHXA 4LRWA 4PC3A 5EP2A 3A1WA 4LJAA 2BTTA 4XOIA 1HT1E 1JQLB 4EQ6B 4CC2A 4N1AA 2G83A 4C0AC 2VRWA 4KV9A 4TSFD 3ICQB 1SHZA 1X6VA 1FTNA 3QKSA 2AD1A 2NO9A 4N0DA 1UAAA 2SRCA 3C4JA 4WVFA 5FOTA 3VQTA 4BLOA 2I3BA 4DSTA 2EYUA 2F43A 2RQWA 1IJFA 1KO7A 5P21A 3SJCA 1J8YF 1IBRA 4YXWD 2QSZA 1N6IA 2I4IA 1Z0DA 1Q21A 1XBTA 4ZKEA 2VKNA 1FMLA 1YR7A 2HJGA 4JLOA 1JB1A 2WAXA 5TXGA 4JPBW 4YONB 2ORVA 5L3SB 3QF7A 1BO6A 1HYQA 4M1MA 2XEXA 3A98A 1FP7A 2D74A 2QAJA 2O9SA 4J9FA 3ZL7C 2RN8A 3GLFA 1EGAA 2ZR7A 1E2NA 3TK1A 2GNCA 2AX4A 3ZZTA 2EYXA 2JS2A 1RYHA 4XSGA 1GNRA 3T12A 2PL3A 4BRUA 2D7DA 4DCVA 2QRNA 1SULA 4NP6A 4QXAA 2WJVA 3MMPA 2YYZA 3NEJA 1FZQA 3U2QA 3LXXA 4TQ9A 1JI0A 2IS1A 3LQQA 1MABA 1AGPA 2D2FA 3EXAA 3H84A 2K5UA 2GCPA 1GKYA 3SE0A 3RHFA 4BFSA 5JEEA 1SHGA 2W83A 1XEXA 1GCQA 1TX4B 3B5JA 4OQMA 2GTPA 4M1YA 2BKUA 3CBQA 2CSIA 1NJFA 1S2MA 4G0NA 5SZKB 3DKPA 4D2IA 1Z6AA 2XXAB 3KFVA 3UA6A 4B33A 4A82A 3EPLA 4D82A 1ZUUA 3C8UA 2IL1A 3B7GA 3BK7A 3CO5A 4FW9A 2GZHA 2OZEA 4IRUB 2J46A 2ONJA 4NYMQ 4PANA 5JSZB 1E94E 1QHIA 3AKEA 3THXA 1OXVA 3BRWD 1U3OA 2KYBA 3VS2A 1KO8A 2GVZC 3K9LA 3LX8A 5M04A 3J81k 4E6RA 1CR4A 2ZRHA 3EC1A 2HDNB 1CF4A 4CF7A 2CH4W 4JJKA 4TL9A 3GLGB 1X8LA 4B2LA 3DOFA 2F2WA 4Q03A 2D06A 1VTKA 3TKLA 4A63B 2RGNA 4P3YA 1MRSA 5G3ZA 4IIOA 2QN6A 1TADA 1IN4A 4Q1BA 3HR8A 2GQIA 2A5FA 3B1XA 1VG0B 4G01B 3T61A 2YUPA 3I72A 5C1BA 2OI3A 1E7OA 2D4HA 3C16C 3IQWA 4B3CA 4PAQA 4F38A 4O25A 1XXHA 3SOPA 3ADBA 1G6OA 1WF3A 1RW4A 3KFXA 3QBTA 4OBEA 1NLOC 5TARA 1OH7A 4JVNA 2FF7A 2NWMA 3WMFA 1FW6A 5FWCA 1NI3A 4AKIA 4HATA 1XMVA 3QKSB 1KK1A 3BOSA 3C5CA 1KDOA 4HAXA 2HF9A 1TQ2A 4YMSA 2F43B 1U90A 4JIMA 4CT4B 5EE1A 1SHFA 4IDHA 2Z83A 3LWNA 4U7DA 4B44A 4EKDA 1G18A 3NBFA 2PLFA 5DISB 3WBKA 3GLIA 1I4TD 4UJ5A 4KVAA 2ZSFA 1R10A 1Z63A 1AKYA 1G3UA 2OO7A 2WM9B 3QXJA 4JVSB 3RRYA 3VFDA 3KTAA 4X8HA 2CT3A 4HVUA 2GBLA 1KMQA 2EYZA 1M74A 1U8AA 4NONA 4A15A 3GCGA 2ODEA 2CUBA 5L3QA 3GLFB 4HUTA 1OV3A 1ZUKA 3RSLA 3TVDA 2R6DA 2IYQA 4EPXA 3UATA 1W4BA 1KAOA 1NM7A 3WHLA 1BYUA 4LX0A 4J9EA 4DKXA 2IA5A 1Z6YA 3UXMA 1KK2A 5BN5A 2EFHB 2BEJA 4BZXA 1E79A 1ABOA 1GL9B 2ZUDA 2X19A 1SZPA 2FGJA 2O8FA 1MABB 5EJEA 2ZE7A 1KJYA 2PJZA 1WBBA 4P4TA 2Z6VA 121PA 2FPKA 3P4YA 1Q1QA 1XEXB 4I81A 3I5RA 3O8CA 2F3TA 1QHXA 2AK5A 4L9WA 1OH6A 1QF9A 3CPEA 1YU9A 3K0AB 1UBEA 2EYQA 3QEJA 1VG9B 1D2EA 1OFUX 1XTQA 3MJHA 4GOJA 4P33A 4QOSA 4AG2C 4YDSA 4JSTA 2D3WA 2FMXA 5JCZA 2V9PA 4LJ8A 4AFSC 2QM7A 3MD0A 3THXB 4XWAA 1FTSA 3HYRA 1W2GA 1Z06A 2IYXA 2JGNA 1UFQA 1OXSC 2ZI5A 2UKDA 3BXZA 1LS6A 4K11A 2VL7A 3NKVA 3ECCA 2IC5A 4KFRA 1IQPA 4C30A 1UKYA 1S8FA 1KI1A 5DGXA 2KNBB 2Q3HA 4Q1AA 1CR2A 5IXFA 3B1ZA 1N6HA 2FGKA 4TLDA 4AYXA 3KXKA 3RRNA 4IW3B 4LC1A 3UA7A 2XITA 3O8BA 5AUPB 1OKKD 5JWOA 1NYGA 2VPPA 4DUGA 2V6JA 1OB5A 1FYNA 2OAP1 4P4SA 1KAGA 3R7WB 1AOJA 1XXHB 4EPYA 2ZUBA 3GPLA 1P9NA 2AWNA 4Z88A 2H1LA 1YRBA 1GFCA 4RZUA 1GFDA 2ZE6A 1EFRD 2OSBA 3TSWA 4G3XA 3ZGXA 1QWFA 2JJ8A 2VP9A 3C7KA 1FFHA 3WP1B 2GF9A 5AR1A 2QP4A 4LZZA 4TYNA 3KQNA 5LBIA 2J7PD 2JLRA 5HTKA 4W5WA 3QOFA 4ESHA 5KPDA 3UF4A 1US8A 4GBMA 2GBQA 2UZ3A 1XEFA 3GLIB 1QHGA 2ZXUA 5H68A 2W6JD 5TV2A 1UEJA 4KBGA 3MWKA 4I99A 4GBQA 3Q72A 4ILEA 3KTAB 1DG3A 4A1FA 3QF4A 4B34A 3PEVA 2WMNB 5IHIA 2IS6A 5BYJA 5L3QB 1Y0MA 1EXMA 5J4LA 1AA9A 2BM1A 4CEIA 3T06B 2OLJA 3BJIC 2VP2A 4PR0A 5FBLB 3OFNA 3AF3A 5EXPA 4URYR 4C2UA 4AK9A 5J47A 1J90A 2B92A 2UVQA 4D81A 1DAFA 1O3YA 2RCNA 2IYUA 3EC2A 3GFPA 2JATA 3SQXA 5LDDC 2CCJA 2ZYWX 3PR1A 4ZDKA 2O8FB 2GXQA 1AWJA 4EPTA 3ZZ0A 3RS2A 1D2MA 2H92A 4Z8AA 4RD1A 3TMKA 5C46F 2VSOA 1GRRA 2GXAA 4PSVA 1P7CA 3W9YA 4UNRA 3K0SA 1JXMA 4RTWA 3HPRA 1WXUA 2ZI3A 3HWSA 1GL6A 3K0CA 4PQYA 4QBHA 4Y0VA 2XSZD 4ZIRA 3HP1A 4LV6A 2JLVA 3NGPA 1HEIA 1P62B 3TUJC 1BMFD 2JCSA 3AP3A 1N0VC 4V0OA 3K53A 1YZUA 2ZU0C 2P4RA 2J05A 1F5NA 3CNNA 4US1R 5HCIA 3RSOA 3PEUA 4JZKA 2RGAA 2OCBA 5JWRA 4YMUA 2OBMA 1UG1A 4FMCB 4RVCA 3NC1C 3TGPA 3GLGE 1G1MA 3KUCA 1RFLA 2CNWA 2REBA 4RTUA 5IXBA 4OMOA 2GK6A 1G9XA 5JHGB 4LHYA 1NVWQ 2CHQA 3H86A 1JU5C 1ZC3A 3VR4A 3QWYA 2DL8A 4X8OA 2ZSEA 4URVR 2YC2C 4LHZA 2X2EA 5FFMA 5GJCA 1QVRA 4MYCA 4MDFA 1MRNA 5JWHA 1AQUA 3TSZA 3WYGA 2WPDD 3U7EB 3SZRA 4JLMA 3G82C 2BBWA 4L8GA 1OYYA 4P4SB 5FTMA 1YCSB 3AP1A 3B9PA 4A0FA 1DTSA 1I4LD 3SHFA 2EW3A 4K81B 2IS4A 4JBXA 4PSKA 1WXBA 1GAJA 1E3MA 4LBZA 1OJLA 1XFAA 2R2AA 4YQFA 4ARZA 3GJ6A 3MFYA 2ZJBA 4QGFA 1G7TA 2QAGC 2EWVA 2C95A 4JVMA 1F3OA 1G4AE 3VNUA 1US8B 3T34A 2O9VA 5UKDA 4LJYA 5DLQC 1ZAKA 1G8PA 2XTZA 4JLDA 4OQXA 3PIRA 3VS7A 1NN0A 3WRYC 4A36A 5JI2E 4B6EA 2XAUA 4BFYA 1G8FA 1ZX6A 3AF4A 2IHYA 1RC8A 3SJBA 2RHMA 2RNAA 4OMNA 3QF4B 1AJEA 1E9BA 2BZYA 3M4YA 1ARKA 1G8HA 4AG5A 2J6FA 4JLNA 2AK2A 2OAQ1 2ZQ5A 1G4UR 2VLIA 1NVVR 2GF0A 3BFXA 1OW3B 2AKKA 3A6PC 2MOXA 2PEZA 4RD3A 5CJPA 3AF2A 2OESA 1KI8A 5CLLA 2ONKA 2C0OA 4JLBA 2W0MA 5EZ5A 5KU1A 4CIDA 4KXFB 4DJTA 2WWFA 4AFUC 4DCTA 1GILA 1JPNA 1Q3HA 4JLAA 1BBZA 1YKSA 1FUUA 2ZRBA 3GEIA 1PLLA 1R0ZA 3THWB 2O88A 1SGWA 1WXTA 1TUIA 4CVNA 4QJ3A 2J7KA 4F4IA 3REAB 2QMHA 1T5IA 4HUQB 2SEMA 4NCIA 3P20A 4I1SA 4Y0AA 3NBXX 5FOUA 2H7VA 3B60A 3BH0A 2AZVA 4C3ZA 2XZOA 1JR3D 2C2HA 1PNJA 4PC6A 4HB3A 4ERNA 1YHNA 5FOXA 3PEYA 1LF5A 1M8MA 5A5GA 2BEKA 1X2QA 5B30A 2JMAA 3HR7A 4MYTA 2OCYC 2AN9A 3U3RA 2YDLA 4HZUA 4HSEA 2CK3A 3W8NA 4F92B 1N5JA 4A0RA 1N5ZA 2J0QA 3R9XA 2NG1A 1N6OA 2J7IA 4LHXA 4QFMA 4F7WA 5KNDA 1HQCA 5H8WA 2YV5A 1T91A 1ZCBA 3H2YA 3QVUA 2J87A 3B13B 1E9DA 2GJAA 5HE9A 2RQTA 2AXPA 1LY1A 3REFA 3PENA 1XXHE 1L4UA 2C9OA 3T1VA 2CHGA 2QENA 1CLUA 2F6RA 1H8EA 1MH1A 2Q0HA 2V3CC 4L5BA 2CDTA 4C0HA 2QI9C 3OIWA 1R2QA 3IPXA 1ZUNB 1NLYA 2QUZA 2N46A 2J41A 4OHWA 4AIIA 5FUXA 3FHTA 2JLXA 3L0OA 1R6BX 3FJ5A 3K8YA 4OI1A 3A1VA 1Z0FA 4ARZB 5FPTA 2RGGA 2OJ2A 1G7SA 4EPVA 3GLIE 1GTVA 1OFTA 1P2UA 4ZI3A 2GVDC 4JJBA 4AYTA 4LYAA 2OEPA 3ASYA 2KB0A 5EE5B 1U0HC 1R5OA 4AG1C 2NO1A 3RNLA 2W0SA 1B3QA 1R4AA 2HXSA 3W3ZB 2EGAA 2WTUA 3UIEA 2ZRMA 4PAOA 3Q85A 2RQVA 2PCLA 1II8A 5CJ2A 4TQUS 4LWZA 1SVOA 4TMXA 1PRMC 3ZYCA 3TUZC 5EP4A 4P32A 2WJYA 2JW4A 2PT7A 1K9AA 2W58A 3U5ZB 2ZI4A 3SYNA 3P26A 4US2R 3M0TA 2EU8A 4PC2A 2A36A 3I62A 2FWRA 2DPXA 4Q1CA 1II9A 5G53C 2WKQA 4Z1MA 4LYHA 2WWXA 2YWFA 2N42A 5FOVA 3QPVA 4KSCA 1N2CE 4B76A 4TZ6A 4QT7A 4IDNA 1NBMD 4MRRA 3BE4A 2QBYA 2VP6A 1ZM7A 3M1IA 4IXMA 5FTKA 2QROA 3OEHA 3FGNA 4F16A 3X1WA 1OYWA 3EIEA 3K9NA 1N6LA 4LBWA 3W3AA 1AD5A 2G6FX 5L3VA 1K5GA 1XCGB 2FSFA 1XD8A 2VF7A 4MKFA 1QRAA 3QXSA 3RS0A 3BC1A 4ABYA 2ZM5A 1YN8A 5D3MA 2A5JA 4A2QA 1OPLA 2ERXA 3D3QA 4EFMA 521PA 5BN3A 3BWDD 2OBLA 5KTYA 1J70A 1KK3A 1NVXQ 3EA5A 3LBIA 2IYWA 2PLRA 3R9WA 5HKKA 4HZUB 3ZVRA 4GL2A 3I92A 4PO9A 4EIWA 4BFZA 1OH5A 1N6NA 1Y3AA 2G88A 4QG7A 1OEBA 2QPTA 1Q12A 2RGDA 3ZJYA 2IS2A 1ODFA 3C15C 1D2NA 1E98A 4DEXA 1YZKA 3B8HA 1JBKA 2W6IA 1OLOA 4TMTA 3FMFA 2XB4A 3LNCA 1Z0KA 1CJUC 3VAAA 1EESA 5IT5A 2ATVA 2CUDA 3MLEA 1ZD1A 3LW8A 3W5IA 2Q9CA 1QDEA 3AB3A 1E2EA 2LWIA 1KKMA 1ZNZA 4PX9A 4LUEA 2JDID 1NVVQ 1VYVA 2ZPTX 2DJQA 3EASA 4PZYA 4TWZA 1G2BA 3EAQA 2GESA 4A2WA 4XWKA 3MAAC 2XTMA 2IEYA 3A1TA 2P5SA 4TLCA 3KQKA 2HT1A 5DSZA 3U7GA 1IY2A 2HCJB 1SVLA 4KODA 2C9YA 1XEWX 4YMWA 3SEAA 2X2FA 4QJ4A 1EFTA 1KIMA 4HI0E 1N6RA 2ABLA 2LQWA 1W4CA 5GJWC 5KUTA 2CCGA 1GFIA 5C4GB 4GFDA 4FN5A 4P4UA 1UFFA 2ZITA 1N5LA 2XGJA 4OYHA 3BFKA 3ZDQA 2CT4A 4GI7A 2Q3FA 3CZPA 1Z83A 2HYIC 1R7RA 3UPUA 2J45A 5GJVC 4JZ4A 4A2PA 4C0BA 4UNSA 4C0SA 1OSNA 3CZQA 4GP6A 1GG2A 3H4MA 1RPZA 2KR3A 4TZ0A 5ELXA 3QSYA 1EK0A 2ZI9A 3NEYA 4QL3A 1OPXA 4YDHB 3WNCA 4A92A 4JJDA 2QE7A 4UNQA 1K76A 1M8PA 2NQ2C 3KKNA 5J40A 4CEJA 1T0JA 2GAAA 1HH4A 1PZNA 4AKEA 5EXXA 3RRMA 3U23A 2L3QA 2DFLA 4LJ6A 4LCBA 5FWBA 3RS5A 4Y92A 2MSCB 2ZYUX 3EG1A 3D7MA 1BK2A 4TLBA 3CX8A 1XEWY 2QBYB 4OHYA 2VP4A 1SKQA 1XMSA 3CPHA 4TLEA 1ZNXA 4BLPA 3TLXA 1S1MA 4BLSA 3IDQA 1GUAA 2A78A 2A5YB 4ZCLA 5AUNB 4KSBA 1W46A 1AS3A 2MIOA 5KSPA 2FPEA 3K9HA 2XX3A 4OJKA 3PVSA 4LBYA 3W34A 1AEYA 2ASEA 3FKSD 1XTIA 5D3MB 1BB9A 4HEJA 3A8TA 1S9HA 2JLUA 3U4QA 2AKLA 2B86A 2DA9A 3QKTA 1JJVA 4DDVA 1JAHA 4KAXA 1E79D 1DO2A 5JECA 2FA9A 2VTKA 4XIGS 3EHQA 1NNEA 2QMEA 1K6MA 2JJ2A 4XH9B 4DLWA 4TMVA 2ZJ2A 3IBGA 3LY5A 1UDXA 4NCHA 4MYHA 5CB6A 1R5BA 3CB4A 4FD2A 3KJIA 4IXNA 1ZNWA 2EYWA 3S1AA 1HE8B 4MGZR 4B2PA 2HEIA 1OF1A 2PH1A 2HLDA 4HAZA 3SU8A 4PAMA 4QHSA 4B75A 2YUOA 1BS1A 2V8OA 3FMIA 4PZZA 4G1UC 1PKTA 2BKEA 1D9XA 1N25A 3O47A 2AK3A 3E5HA 3TE6A 4DDWA 4AY2A 3IIKA 4IIMA 3EG5A 4TL7A 4GLMA 4RUGA 1YE8A 3IQLA 4UQOA 1YR6A 2KWIA 1YWOA 1G41A 1KI4A 2WV9A 3CUEF 4LE9A 4DLUA 5LB4A 3KQLA 4OK3A 3CRQA 4KLZA 3H0HA 3LV8A 2FG0A 5JEDA 3CWZA 2CMKA 1X6BA 2WWGA 1LV7A 3HDTA 3W90A 3SJAA 3ND8A 4LC0A 1LNZA 2GJSA 1MKYA 3C0CA 3GJXC 2A7QA 4G5OA 2RKOA 4HAVA 4KFSA 5AK0A 1WRBA 4XVQA 3SR0A 2H8HA 4J9HA 1W6XA 2B6HA 4DUGD 2PNIA 1E9FA 1NYFA 1W2HA 4LJ9A 5E95A 3ZVLA 3AVQA 3SFZA 3W6OA 3BGWA 1COWD 4URXR 2BCGY 1M2OB 2AHOA 3NHAA 3WP0A 4A9AA 2F2XA 2PJRA 4C0QC 4J0QA 4WBSA 4EPRA 2QT0A 4W9MC 3N2EA 4OMQA 3EZFA 5ANRB 1TTTA 3NBZC 5F3WB 4FXPA 3K70C 4LUCA 1AVZC 1JAIA 3R20A 5JMTA 2IUTA 2ANBA 4CEJB 3NHNA 1T0JB 2IHBA 2VP0A 3KKPA 2JEOA 1XCPA 3CIOA 3U7HB 2QORA 1Q57A 2HYDA 1Q22A 1S96A 1W0KD 1T3SA 1NF3A 1T6NA 1Z2CA 1GVNB 1A4RA 1VG1A 1YR9A 5B64A 1QWEA 4PPFA 1AM4D 2LCFA 2VEDA 2ZIAA 3A4LA 3WMEA 3IILA 4NCNA 4QGGA 4AURA 1VCNA 3ND9A 1NSTA 3QNUA 4RTVA 4DRZA 3OFND 2KE9A 2MMCA 3AUXA 3WYAA 2ATXA 4IDOA 2HBWA 2IXGA 3U7FB 1G5PA 4NDZA 4CT5A 3U4QB 1H65A 1E1QA 2V54A 2KEAA 2R6CA 1DAKA 3OIUA 4HVVA 5FH9A 1LTQA 4R0KA 2FN4A 2ZRIA 4NHOA 1RLQC 1GRIA 4C0JA 2A5DA 2G9NA 2J6OA 4RKEA 1A2KC 4KYUA 1CTQA 2JASA 2PTKA 1F2UA 1NLZA 4H1UA 821PA 1G5TA 3OEEA 3RRZA 3N70A 5AJYA 4HLQB 4DLRA 4TN1A 5KNCA 4Q47A 3GFTA 3S1AB 2X1VA 2FE4A 3A58B 1KKLA 2GEVA 3CF6R 1SRMA 1XDBA 3QUSA 1FQJA 2JLSA 5FUVA 2KJQA 1B0UA 4TLAA 3GJ5A 3QY0A 3I3SR 2LKDA 1JO8A 2ODWA 3VS1A 5KSOA 3QBVA 1IXRC 1FP6A 5F9FA 1VDZA 2EW1A 1P61B 4MRVA 4NYJQ 1AZGB 2HV8A 2O8CA 3LX5A 4M9ZA 3FPAA 2CNWD 1M3BA 1NMYA 2FOLA 2ZRNA 2XNSA 4JLVA 1T3HA 4JLJA 2ORIA 1G16A 1TL7C 2HCKA 1GDDA 1S3GA 2ZE5A 4TMZA 4TYQA 1HQYE 3L0SA 1S1NA 1XZQA 2J59A 4HLUC 4N3NA 3ADKA 2YVUA 1W49A 3FVQA 3ZLJA 3QKRA 4CGZA 5CYPA 3O8RA 2ESWA 5FUYA 4CC4B 1XMIA 4UXIA 2ZR0A 5AJVB 3U60B 2Y8EA 3OAAA 2C77A 4ZCMA 3L0IB 1D8TA 4LUDA 4YMVA 2CXXA 1CEEA 3U3MA 1KJWA 1UPTA 4M1KA 3VRYA 3AF1A 1F2TA 2WJJA 1Z0AA 3SYKA 2DCUA 1VG8A 2HCBA 2P6RA 1KOFA 1R8QA 1U06A 4D0GA 1W48A 4QNRA 3FFBA 1NG1A 5J4HA 3NBYC 1HA3A 1DEKA 5KDOA 1E9AA 4JKYA 1DOAA 1KNXA 5DN6A 2PT5A 2DILA 4BZPA 1SSHA 4J9CA 2WMOB 2QDLA 1W47A 5KPJA 1WIEA 4LV8B 3AVWA 4JJZA 4A0GA 1UKEA 4RZ3A 1YZTA 1X2KA 2GTOA 4NE2A 2FPFA 2M51A 2E1RA 3BH6A 5CDFA 4IHQA 4BZQA 1U8YA 2L2PA 2EPDA 4E5UA 4Q4AA 1VIAA 1S1CA 1TPZA 3SBDA 1YNZA 1NLFA 1QHHA 2Q9BA 4MA4A 1E1RA 2C96A 1YP5A 2K2MA 2OFWA 2Z0MA 2D2EA 2RMKA 2XZLA 1DBSA 2BMJA 3DZ8A 4FCWA 2WWHA 4Z51A 1HJDA 2ZRPA 4KFUA 5C4MA 2EQIA 1OT3A 2RAPA 2YOFA 1A2BA 4ZCIA 1XJ0A 1U0JA 2O5VA 1G8YA 2QA5A 4IDQA 5H1YA 1W36B 2ZRAA 2WIBA 3PUZA 2FPDA 1P9RA 2N1BA 1L4YA 4PHFA 1XPOA 1F2UB 1RE0A 1MO4A 1L2TA 1Z3IX 2VO1A 4C0LA 4ZI2A 1P73A 2WICA 5E7JA 2QMUA 3FOZA 2UZIR 3LQRA 4HLDA 2YUQA 2W2XA 1M30A 2ZRJA 1KDPA 2BCJQ 4Q9HA 1UADA 3FB4A 3CX6A 1XPRA 221PA 2DFKB 2GDJA 5AJXA 2XNDA 3PXGA 1E6HA 1ABQA 1N6KA 3ONWA 1RYFA 1NEGA 3Q7QA 4RZXA 4MUAA 2ZUCA 2FNAA 3CWQA 3AP2A 3THKA 1LS1A 3SC3A 3K09C 3TQCA 4BASA 4B74A 4QKQA 4JVLA 2BDTA 3VS0A 4Q9IA 3EG0A 1NLPC 3PVLA 2FZLA 3BERA 721PA 5J4KA 4HVWA 3C14C 1JEDA 2ZAMA 1QLYA 2P65A 1JALA 2CL0X 1U9IC 5GVSA 2GILA 4GMXA 1GWNA 1VPLA 1MV3A 3ULRB 2BMDA 2PX0A 4OJQA 2BIFA 3T1OA 4D4LA 1H8ED 3D6TB 2YWGA 1SXJC 4M1WA 5EXSA 3PFIA 3NPFA 3M0UA 1BKDR 1WI7A 2FEOA 3T5DA 1Z8FA 1F2TB 2VF8A 3TR0A 1Q44A 2VHTA 5AJWA 4A6XA 1ZMXA 2QEQA 4AFQC 1TAGA 3F3YA 1NY5A 2PX3A 4NCKA 5JCPA 3I5SA 4NYIR 4FWTA 3BB3A 1QHYA 4LSGA 2HSPA 3A4MA 4LI0A 1D6JA 3JZAA 2FU5C 3P32A 3ZIAA 4QGHA 1AWWA 1BOFA 4Q7JB 3W6PA 2VSXA 3LW7A 1KI3A 1M7HA 3SFVA 3U6KA 3ETLA 2WWWA 4D80A 3GJ4A 4LYJA 2PCJA 4Q21A 3RS3A 4M4SA 1E99A 2ZYVX 1G3QA 2OE2A 4DLYA 1D9ZA 2QMOA 4MRPA 4Q4AB 2CLCX 3PQCA 5JZVA 1T0HA 1J99A 3IO3A 1UKZA 1WA7A 5G40A 4D0NA 2AZSA 5K8TA 1OHHA 5J5CA 3EPJA 1QZXA 2XTNA 4V0LA 4B73A 1LCKA 3CLVA 2JT4A 1DO0A 1SVKA 2JS0A 2CE2X 4JBYA 4OQLA 4XTRA 2GWHA 3BH7A 1VYUA 3I32A 4Z1MD 2FSGA 1WX6A 5DYGA 3T5GA 3B78A 2K3BA 4C0KA 3ZZUA 4Q18A 1E69A 3AVPA 3R6NA 1CS4C 1QCFA 2OCPA 1H8KA 3DEFA 4JKIA 4F4JA 2VA8A 1ZSGA 1G3IA 2ZANA 3L0PA 5C18A 2O0HA 1XTKA 4QBGB 2ZSBA 4V0MA 2GXUA 4OI2A 4MH0R 4TMWA 5CK4A 1N0UA 3RDPA 3OEHD 4DLVA 3NVAA 2YOHA 2ZROA 4C4PA 1YRAA 2KRMA 1J3TA 3IO5A 4R2HA 4LJ4A 4B6FA 2ZEJA 2IEZA 1WXQA 4DCNA 2O8DA 2Q9AA 3AGPA 1RRGA 1DG1G 2F1RA 3TH5A 2IW3A 2E87A 5AJZA 5HKKD 2ZJ8A 4GDFA 2BWJA 4DWJA 2LMJA 2NMVA 3X1ZA 1IO6A 1R0YA 3AH8A 1ANKA 1QHNA 2BBOA 2H18A 3RBBB 4EUNA 2PZFA 1UM8A 2QP9X 3CNLA 4GT1A 3ZVMA 2IF0A 1E9SA 1P72A 1K0XA 1WA5A 2W6ID 4GZLA 4PQRA 1ZM4A 3N2IA 1NMXA 1TU4A 2GCNA 4IVPA 4DLTA 2F55A 2IYLD 2J3EA 3CH5A 2RQUA 1AZEA
chains in the Genus database with same CATH superfamily
4BU1A 4FFOA 4M49A 2Z9BA 2JFPA 1YVEI 1Y8QB 3NHFA 421PA 4CUZA 4U7FA 5KDLA 5L6MB 1QONA 3S1LA 4YAKA 3QMWA 5CLGA 3R8CA 1CEQA 1JL3A 1OH8A 2DLCX 1GZ7A 4FNMA 1V4NA 2WYHA 5J2UB 1N5OX 4XWOA 2B21A 3K72B 1CUWA 5KQSA 2QS9A 4QELA 1UJ2A 2IYZA 2FSSA 3V9PA 1QNFA 3MQ4A 4HXGA 3RGGA 1EFHA 2QVBA 2F1HA 3CW9A 2O48X 4UTNA 1GRQA 3M6MD 1E2PA 5T3UA 1CRQA 4BHTA 3BL6A 3IKTA 3A37A 4TTQA 3A1FA 1LNQA 3EZ2A 1XLWA 4L3VA 4UREA 1Z74A 1UJ5A 4NMMA 1NX9A 4G5SA 3D8BA 2VYVD 1OXTA 1UBGA 2L42A 2LNVA 1Q7BA 1YJAA 4OYRA 1TGYA 2Z4RA 1MOQA 2V98A 5IH2A 3AJ9A 4L8VA 4ZP1A 4OMFG 1GL5A 2CEAA 2OAUA 4NXNB 3OF5A 3CISA 4DV7B 2GPSA 1B8VA 3BREA 4W9NA 4JP1A 4B84A 3VSDA 1C1DA 1ONPA 4OXXA 2QD3A 1L5RA 3K0KA 3GJ7A 3TNYA 4R8SA 1ZYUA 2FPRA 1Z56C 5DOVA 2CD7A 2H1HA 4HX5A 3TI7A 1TC1A 3NORA 2YV3A 4PJNA 3HA2A 2R5NA 5CFRA 1ODJA 3I1IA 2C4UA 4FGSA 1AN9A 4UHHA 3DDZX 3QX3A 2Y1KA 1AK2A 2PRIA 5JH7F 1SIUA 1M1UA 4D9MA 4KITB 2HLNA 2OCXA 2ZT7A 3OAAD 2X4JA 3F46A 1BN6A 5KB3A 3IODA 2C5SA 3KM0A 3IHLA 4ENTA 4G1VA 2Z2JA 4M4ZA 1C1DB 3D4NA 2ZCUA 2OTJA 3L93A 2AF3C 1AC5A 4NOYA 1XOIA 3CR8A 3VYVA 3PQ5A 4P3KA 3TZHA 2E7ZA 4UTZA 1XEAA 4HN2A 3OYLA 3PNPA 1EVYA 3OCZA 3UMBA 3DV0A 4CKWA 1VOMA 2DKGA 4XZ3A 2X8BA 3G6EA 3G1TA 3T7CA 2JM9A 4OJNA 3TPCA 2CXUA 3IAXA 2ZKIA 4YFVA 3LFUA 5JCOC 5J39A 1SCIA 3R9KA 3RJTA 3RKRA 1N1DA 2ED1A 5FI0B 1E32A 4DYVA 3I1JA 4LDPA 3QW4B 5TGTA 4LJ5A 4F4DA 5IHPA 5E0OA 1VE9A 4AKGA 3GHHA 3KO8A 1VDMA 4GOND 3N53A 2PWYA 3ZIAD 3WICA 1CDZA 1KE2A 4MA0A 1S4QA 5AKXA 1W19A 3MHXA 2O9JA 5G4LA 2DPYA 3IUMA 1VJ5A 2CHFA 5GADl 1GP2A 3AY3A 3K7EA 4CKWB 1RJFA 4D1YA 2P3LA 4TM7A 4YP7A 4O29A 4IVQA 4ZA2A 3ZKWA 2C0PA 5CFNA 2VNKA 2WYIA 3OBYA 1ODSA 5HW0A 4JRPA 4NE9A 2YJTD 2FPWA 2VOEA 1HC7A 2P0YA 2FUG6 1M73E 1IEVA 3RIYA 3QI2A 1AV6A 1GZSA 1Y80A 4IUCS 4NDNE 3S3TA 5G02A 1PDVA 3C3JA 5IHNA 1VMKA 3OPYI 3M0RA 3O4JA 3ZZ1A 2DHCA 1U1CA 3KC2A 2QT1A 1CJMA 4BVLA 2QD2A 3RKSA 3E81A 3FZQA 3UMFA 3ICPA 5KNBD 1Y7XA 3FSJX 2YSQA 1XGKA 1GQFA 3VJRA 1QYRA 1B0AA 1T1RA 3AGQA 1L5HA 2XIDA 4ER5A 5CDGA 1V16A 5LB2A 3ED1A 4B35A 1QIKA 3AKYA 3EB9A 3LRPA 1UDAA 4HWSA 3ZKWB 1TU3A 4HAWA 5SY6A 5AI8A 2OCAA 3B85A 4WPGA 4YTEA 4K05A 3SQOA 2I1QA 5BW8A 3H8SA 5K45A 2YZ2A 5KJCA 3KUKA 1OIVA 1DADA 2QRHA 2Y2UA 2CWWA 5KE3A 1KI9A 4GQBA 5FOSA 4KBMB 4DNFA 2DB3A 5K20A 4DPLA 2OAEA 1USGA 1CFJA 2G67A 2RGXA 2D3TA 2I22A 1KXJA 4JT9A 3QV2A 1Q7YC 1M3SA 4ZO9A 2ZSAA 3PPWA 1L5HB 1OI3A 3LCRA 1M1ZA 4EYEA 1V16B 3G71T 2HWYA 1Q2UA 2VJAA 5PGMA 3UJPA 1YZFA 1ONOA 4LDNA 1PR4A 2HRRA 1OX8A 3O8VA 5EINA 1KD1C 5INTA 3L46A 3HXTA 2BW0A 1L5KA 3C6XA 3WY9A 3E03A 1JI3A 4RPCA 4DJAA 2YWRA 2XODA 3S5UA 1XQWA 2D1SA 3FTNA 1YRWA 3WMGA 2DQZA 5I5GA 5CITA 1Y9DA 1YKGA 3GLQA 4YUAA 3ZTYA 4BNZA 5K3BA 1Z08A 2CE7A 4BI3A 4IDAA 5CXUA 3EGXA 1HY3A 3DMDA 1UMDA 1E2KA 2X4DA 3WIDA 1HDZA 5DBFA 5GAOl 1WZCA 4JUAA 2JJ1D 3ITEA 4BBAA 1U81A 5SZIA 4DBHA 2JZ2A 1NURA 3ENKA 4FCVA 1I9GA 1KH2A 1OIWA 4KR9A 4C5HA 3D0RA 2W6JA 1SURA 4CF3A 2CJWA 4BUJA 3OYKA 4X9CA 1WO8A 3KJEA 1SBQA 3EEYA 1Y1TA 2CL7X 2C2YA 2GRJA 3TVTA 5DM2A 4KLNA 1GGMA 5DCUA 4DLBA 5F9HA 4NZPA 2XLBA 3R6LA 3JB9J 1YK1A 5CCEA 1UWCA 1KVTA 3LOQA 4LYDA 3TZLA 1K8AU 4F14A 3B3QA 4NKRA 2CL5A 1VIYA 3L8MA 3CRZA 1GDTA 4NS4A 4DA8A 1Z34A 5C35A 4B6RA 3GEHA 3OMWA 3EGXB 1CQPA 3FIFA 3M55A 3GRKA 1ZM3A 1UMDB 2M0YA 2WPDA 2GTJA 3CCUA 1WCIA 3WGUA 3O2QB 4YAWA 3D6AA 3LT2A 3CPSA 4PLVA 3TINA 5C0OE 1A96A 3LECA 5KTOA 2CV1A 4EX6A 3LX6A 4GGOA 2WWRA 3SKYA 3GMTA 2CJWB 4FUQA 2GBGA 3MRTA 4L73A 1P0IA 4PS1A 1BOOA 1AT1A 1AXGA 1RBMA 1N2GA 1Z4QA 2V6IA 3PUWA 1Q2XA 5DYYA 3ZGOA 4BVEA 3CH4B 4RVFA 5A62A 4E07A 1WXGA 4R2JA 3ZWXA 2CLMB 2J5QA 2Y1DA 1YJNQ 5C2JB 5LWHA 2MTBA 1EDBA 5BT9A 4BMPB 2YUIA 3FYUC 3GG9A 3KAJA 4DR6B 4RF3A 2C7OA 1ZUYA 1N2JA 3E61A 1QGZA 4W8HA 2YZ7A 2JHAA 3CZ5A 2JIZD 2CLIB 4KI0A 4TZKA 4M0EA 3H9CA 2COZA 5DLDA 2V45A 2C5EA 4CRWB 1R64A 2XOXA 5ICGA 3CC7A 1WCIB 4FB4A 2YL2A 3CQTA 4ZI7F 2ROQA 2WV7A 2J9XB 3DFIA 3FSGA 2DL5A 2WKPA 4D8XA 2I9PA 3GZNA 2R3SA 2XNJA 5AVKA 2AA3A 2AFVA 1JQLB 2HLPA 4QAJA 1NXTA 1AT1B 1V39A 1FTNA 2YQ4A 2AD1A 3QKSA 3I9LA 4EMHA 1UAAA 1IMOA 4D97A 2G07A 3IE2A 1WG8A 2ZZNA 1C7EA 1JDTA 3ZTTA 4N41A 1YR7A 3J7AC 4ND2A 3LPCA 4JPBW 1PO7A 5JSYA 4JJ7A 4G5FA 1CZOA 4QPPA 1VCHA 5HRUA 2FLVA 3GLFA 3IULA 4M78A 4I6EA 2G9QA 5IM4A 2HL3A 4NP6A 1Z2NX 4NY1A 1N8RR 1Z8HA 1C7FA 4G9EA 1FNSA 1SD5A 2FL7A 1ZOPA 4BFSA 2W83A 3JVDA 2BKUA 4QDXA 4A82A 3BK7A 1MB9A 2VUTA 1VE1A 4QVGA 4KQ2A 5AJTA 1JTFA 2OO3A 3HNOA 2XLCA 4JB3A 4MW9A 2J32A 4Q03A 3VPAA 4BNIA 4Q1BA 3GZNB 3WLTA 4G01B 4HEHA 2YUPA 1TTHA 1V8DA 1RW4A 1WL8A 3HFJA 2ISCA 2IGTA 1KMCA 1FW6A 5EHNA 3QKSB 3BOSA 2DT8A 1SCAA 3PQ8A 2XEDA 1YF3A 1R10A 2R6JA 1SUEA 5EHQA 1DUVG 2PKXA 3GLFB 5I3ZA 3GYBA 4M78B 2IYQA 2XE6A 1F17A 2IEDA 3C3DA 4NU5A 2FGJA 2GYWA 4FT4A 2ZE7A 2W2PA 1ZGBA 3EMDA 4EF4A 1N2CA 1OH6A 1QF9A 4V1CA 1A2OA 2Q4BA 3C6YA 3C7TA 4GOJA 4CTMA 4E5SA 2P2YA 3JWJA 3CVXA 2DPHA 2V9PA 2JGNA 4BQFA 3IA2A 4NJEB 4ARIA 4BNLA 1QF6A 1QO0A 2RJOA 4Q1AA 3V8PA 4UHEA 4EGAA 1TTHB 1K8YB 3Q4GA 1N8RC 2AWNA 1HG0A 3ZGXA 2GKOA 2GF9A 5AR1A 4Y6LA 4ICIA 1DHTA 3EVFA 3HN2A 3CA8A 2FPIA 2HPAA 4CHGA 1RVV1 1KJ8A 1ODTC 1NBIA 3LS2A 3URMA 1WWKA 3IR5A 4JFRA 3RC9A 1U0GA 4YIHA 2CCJA 3GGPA 2A0KA 1HXHA 1RJGA 3ZI7A 2HU5A 3WWZA 4MV6A 2QR3A 3HBLA 4V1CB 4ZIRA 1T0IA 2I7CA 3AP3A 4W1SA 2Q3EA 3CCSA 4JZKA 1LPAB 1EIWA 2KMLA 1MOPA 2PBLA 2YN0A 2WIGA 3BAZA 1DINA 1V8BA 3LZCA 4X8OA 3IUEA 1Y9ZA 4WF2A 5J9FA 1YR3A 4LYEA 1RD4A 2WU4A 3HSSA 1G3YA 1JBMA 3Q3IA 3GJ6A 1YULA 4JVMA 4J0JA 1CY0A 1X39A 3JCZA 2PWAA 3Q0TA 1P44A 1ZA1A 2FPIB 2OECA 1QWSA 5DBGA 1A9TA 2WEKA 1SQ6A 1I2ZA 1PR2A 1ZSNA 2ONKA 4ED9A 1VQ7T 2NZ2A 2GVNA 1UJBA 2AEJA 2QYZA 4FM9A 2IHTA 2PO5A 4C5BA 4HB3A 2C2BA 5GAN3 1GQSA 3ZXIA 3PEYA 4MYTA 3ZOKA 4A0RA 4JC5A 1RIIA 1N6OA 3UHAA 1IEWA 1Z7WA 3ETEA 3NUZA 4DREA 3UENA 1J2RA 1PL6A 3JQEA 4MEAA 4EO4A 2AMVA 1DWQA 4KPUA 3A1VA 1GTVA 1OFTA 4MQLA 3WK6A 1K06A 1XAHA 2L2QA 2ODQA 3GRZA 1GPWB 1DX4A 4HNRA 2ZBDA 3JRXA 2ZI4A 4G0MA 1G5VA 2NAFA 1ZG3A 4FDAA 3H2IA 1N2CE 2XUKA 5B4TA 2MF2A 3A14A 5M5BA 4XGNA 1WXHA 1ZOLA 2FSFA 521PA 4TYMA 5HNKA 4I2NA 3OYEA 4GGPA 2DG2A 4YJKA 1QYWA 4NRDA 2O2EA 3M33A 5ALOA 1OEBA 3S5JA 3OFVA 5HK0A 3P4UA 1NPRA 1RMTA 4HCJA 2B8JA 2Q9CA 1KS9A 2G40A 3DEHA 3M6WA 2DJQA 2JIRA 4A2WA 3MAAC 2XTMA 5I7FA 4KPUB 4TLCA 1W4SA 4YMWA 1YB2A 3PKJA 2C9YA 2X2FA 2PV7A 4MDYA 3TOSA 4R1TA 3G79A 4MW6A 1FXUA 4F4FA 1ATZA 1U28A 1QVPA 4FDUA 3TTXA 1ZSVA 4JP3A 4UNSA 1Z4LA 4UEKA 2VPYA 1NPPA 1N7IA 1U4SA 3DFZA 3TTUA 2W2LA 2OORA 4KX5A 2L3QA 1F5SA 2DFLA 2OZVA 4WN3A 2ZW9A 4JR0A 4RMOA 4E0BA 1SXIA 2VP4A 1JPUA 4G2TA 3T3MB 5CXXA 3H8VA 3PFWO 3ABRB 16PKA 4UD6A 1GUAA 3WBBA 4PIPA 1BB9A 4BVAA 2HMTA 4P9NA 3K1AA 2LD4A 1CRZA 3QPCA 1PU2A 4IMPA 2Q2NA 1IE3A 1HYBA 2GEKA 1ZKMA 4YRSA 4MI9A 3FMIA 4Y2XA 4QUEA 4GLMA 4H1HA 3IQLA 3GUHA 1GKLA 3ZK7A 1P8AA 4DIMA 5DBOA 3JYLA 4DMKA 1K3FA 1FYXA 3BGWA 4GMGA 1MVNA 3G8YA 2PJRA 3EVNA 4YO7A 4HR7A 3M6XA 4LQLA 4MW0A 2Q5OA 5B1DA 1JT9A 4MMZB 2XRZA 4C92A 1ZONA 3V6LA 1REQA 2QDXA 4L08A 2QVCA 1VCNA 3FEOA 4C89A 1DEOA 4DTIA 4IRXA 2NUAA 3EAGA 4IDOA 4O4IA 1E1QA 2V54A 4LZJA 4NHOA 1YB7A 3NHKA 3K1AB 1B1CA 2C1XA 2G9NA 2J6OA 2LTOA 3GRUA 3FLEA 3CEHA 3FCCA 4BFLA 1KKLA 3D59A 4LJLA 2LKDA 1R3DA 4MWOA 3RNOA 4EB3A 3OFKA 4BO5A 4ZYXA 4N8SA 5KYGA 5REQB 1P17A 1TL7C 4TYQA 1RXWA 4HF7A 1P19A 3OZRA 3QKRA 3TQIA 5ADWA 2EFJA 2VCEA 1B00A 2C77A 3ZE9A 1F9EA 4YMVA 4A27A 4WN9A 1Z0AA 4YJ3A 4RTRA 3H75A 3EDOA 2HKIA 2W11A 3IVMA 1YS9A 4C92B 4JJZA 1YZTA 1UBUS 1REQB 2Y4OA 4OH1A 2L2PA 2G4VA 3ROEA 5J2TA 3A5ZB 4EW2A 3FVRA 4C7BA 3D43A 4NFYA 2NUAB 2VJQA 4OUKX 1PUXA 4IHJA 4O4IB 2ARKA 3MJVA 5C4MA 4IJ5A 1MNEA 3V7CA 5E4JA 1JDBB 3FOCA 2H3EA 2ECFA 4DANA 1T5OA 1XQ9A 5HRAA 3AI2A 3F4BA 3PSAA 2QNIA 4Q9HA 5D87A 2EXXA 4F97A 3CX6A 1ZH8A 4G4JA 1MHTA 2O6LA 5A7GA 4OLHA 4UVGA 1OLSA 4RZXA 3CWQA 1E63A 4B74A 4QKQA 1RLJA 3TMYA 1GPUA 1LZKA 4RHFA 3VSEA 4PN3A 1E7YA 1RHKA 1ORVA 2FB9A 4M1WA 3NPFA 5BSVA 1DP4A 4WN9B 4YJ3B 2IZ1A 4AFQC 3NBKA 1NY5A 1TZ2A 4ZGEB 1OI4A 5A0TA 4FWTA 2HSPA 3FJPA 2MT9A 4X54A 5EG5A 5G1PA 3A06A 4COKA 3GJ4A 4BY6C 2DU8A 3TIVA 5J2TB 5T41A 2DTIA 3DLIA 3LGLA 1LCKA 3CLVA 1F8GA 1PV4A 4R1UA 3B78A 2K3BA 5AIBA 1KZ4A 4DMMA 3MILA 1CS4C 2H3EB 4W5QA 4BZZA 6GPBA 3F1KA 3DHNA 3K30A 4II1A 4ARSA 3H8WA 4TXLA 3QE4A 1AKTA 1X2EA 3LL7A 1OLSB 3TKAA 4BAZA 5C52B 4AJ1A 2QP9X 2IXBA 2UUCB 4D41A 3I55Q 2XWBF 1GPMA 3STTA 1HEYA 3G0HA 3EARA 3OA0A 3FYHA 5TDHA 3SEMA 2KYMA 3CG4A 2PRZA 4UHKA 5IRCD 4KU4A 1IIBA 2QY6A 4CQMA 1RRCA 5DVZA 1GCPA 2BKXA 3IBSA 2OQIA 3WGOA 3B5EA 2FPUA 3QIAA 2R1TA 4TV8F 1K8AR 1CZHA 4GY5A 2QK4A 1RM4A 3PXUA 1NQVA 2GUGA 4KJZA 3L7BA 5DTJA 4EF6A 1EX7A 4HD8A 2L3RA 1KQFA 5FR1A 2M6RA 3NGLA 4PRLA 1MNDA 3ZDAA 5KHOC 3O0DA 3LHSA 2C99A 4EOGA 3QXHA 3TG8A 2QN1A 2J6BA 4GE3A 1EE9A 4L9SA 2QX7A 4H7FA 3ODGA 5MN6A 1N9SA 1MAHA 2DYBA 2YHAA 3FDXA 2F8MA 4BFVA 4BX2A 1UECA 1F4PA 3GLXA 4FKZA 2JFXA 1NKSA 3DVSX 1PCXA 3TW8A 3RC7A 4Z4EA 2CJXA 1PG0A 1VECA 2C98A 4LF6B 3FCYA 4GZ5A 1Q1ZA 4X44A 2A88A 3GPDG 2ET6A 1XWIA 3H0EA 3OI7A 1SVWA 4P4NA 4CQMB 4K0KB 2F1JA 3GOHA 3FVVA 3UG7A 1QGYA 4X84A 1OREA 1Y9JA 4KEAA 5CEFA 1J23A 3DQPA 3QUTA 3JQ7A 4FLEA 1G3TA 2HA5A 4LZOA 2R6FA 1FA9A 5LBUA 3BD7A 2G0NA 4MO2A 3INGA 2WIAA 4S35A 3ZE8A 3HDGA 1M2WA 1F1BA 1VQNQ 1BS9A 3MN1A 2ZVQX 4QRHA 1EDZA 2A58A 2Y76A 8MHTA 2DL3A 1ISMA 2NXJA 3II6X 3MXOA 4HMPA 2CFCA 3ZWKA 4DOWA 3OZVA 3W8RA 1DELA 2LRQA 3BGSA 2FUNB 3F8WA 3OA2A 3INZA 2TSYB 4MR8A 5KNCD 4TPKA 4U6NA 3TW8B 2CXNA 3ZHXA 3LDAA 3SP1A 1E96A 3RVBA 1PR9A 1PGJA 2ZUVA 1FP2A 4AJKA 5CK5A 3QOXA 1KS2A 4IRMA 4XU0A 3G89A 2EW2A 4WXRA 4Y67A 3QWBA 2GHIA 3JQ7B 4NECA 1BXZA 2IYRA 5BPFA 4DBLE 1IHOA 1ZLMA 4C1BA 5EGNA 1YUMA 1P75A 1U31A 2O5RA 4UD2A 1RWXA 1BJKA 3C5HA 3KKEA 3ER8A 4RTPA 1BJTA 2G6BA 4TTSA 2AZTA 4BNMA 4UATA 2XUOA 4IGKA 4MCJA 4N0EA 4IZIA 3GVHA 3R7DA 4MR8B 3HY6A 4RH3A 3GLHA 2ZT6A 1EZ4A 2H17A 2NXCA 4AN1A 4BQPA 3C39A 4BVBA 4YLEA 3A9CA 3P8HA 3EAEA 1A71A 3RPEA 5IT9E 2JIBA 5F76A 1XNRB 3ADDA 4MYDA 3HRTA 1FBNA 5BR4A 5DGHA 3PPXA 2WJPA 3PE3A 1ZRSA 3RVKA 1WNFA 4RTZA 3HV0A 3RC3A 5CH5A 2IZ7A 4E4RA 1EK5A 3GRCA 3W4JA 1TECE 2OD2A 3DMHA 1I2MA 5LUAA 4Y2VA 4PPQA 2EQUA 4PX3A 4P82A 1RM3A 1PWEA 4J49A 4M7DA 1JPVA 4AKHA 4MV9A 3BD8A 5IYZA 3A7DA 2O7VA 2UXDB 5K99A 3L7YA 1ORWA 4FGJA 1WUIS 1D0SA 2O3TA 2PX8A 1AZWA 5FPPA 4F3YA 4ZV4A 3GLVA 2YWXA 4JODA 3O8NA 3SDSA 1VPWA 3EC7A 3GLHB 2KBFA 3AL3A 2GD1O 2NO5A 1XA3A 5AW3A 3JV3A 3MWGA 3FTEA 2XGGA 3GT4A 1YBFA 5IC5A 3CF4G 4Q48A 3NHSA 2XWQA 2JGDA 1T3LA 2WB4A 1M6EX 1RWWA 4QU5A 2DE0X 3RUPA 2HHAA 2VUHB 5K3EA 4OGEA 1UFOA 3JCMc 2P9JA 2P3SA 2WSSD 3QYHB 2YUNA 3X1XA 1NBEA 3D9QX 2X9HA 1IJEA 4M7DB 4UNNA 2W4IA 4B71A 2O2SA 1E66A 1SKYB 4G0PA 5IYZB 4LOAA 1ZJYA 2X3XD 1HFWA 3KT0A 3U7RA 4RJLA 3IUYA 4IJ6A 5FRDA 1Z2EA 3NVMB 1LCIA 3MRSA 4MHOA 1W0KA 3GOXA 2IPOA 3CH6A 4URUR 1D3BA 4AI6A 2E5FA 2A9OA 1PT6A 3EVCA 3FAZA 3I2GA 4FOSA 2F4NA 4XE5A 4CG2A 2F3RA 2KT8A 2JGDB 4BP8A 3GF4A 3GV0A 1JBEA 2FFAA 4PJLA 1MENA 3KZMA 1TT7A 3P8ZA 5H81A 2KQUA 3NXSA 3PC2A 2QQ0A 3VTZA 4A8JA 4ZTBA 3KVVA 3L06A 4PHGA 2DHRA 2O8BA 4EJ0A 4LKRA 1QP0A 4O2BF 1GZ3A 2VHEA 3W3AD 2FPMA 3U3OA 5HPYB 1ZXXA 4RFSA 5BRNA 4BFCA 1OGYA 1NBEB 3QPUA 3UKOA 2H5LA 1Q0ZA 2QL6A 3ULKA 3F71A 2YHSA 3DB3A 2DRMA 2CB0A 3VKHA 1LKZA 3E9DA 1S3SA 3O1IC 5EXTA 2EAUA 2GRAA 3GLHE 3TLAA 1VQLQ 3Q7PA 2IPOB 5TF0A 1D1BA 2JAOA 2NUTB 1LI4A 3CLUD 1D3BB 1NTRA 3LKBA 2BMVA 3S2ZA 5CLHA 4QNMA 1IVNA 2L17A 2P7IA 3I9QA 4AJEA 1S2LA 4KRFA 4A8JB 1I7DA 3SS9X 1OBVA 4RE6A 1KDZA 2O8BB 3RSFA 4JNKA 3VPCA 3T7RA 4RFSB 3CCMT 1II0A 4OP0A 3R1IA 4M7DE 3KBBA 1VQ8T 4Q19A 3UMYA 4ZAGA 5L8VA 1JVSA 2F7SA 5EZSA 2WHYA 3PNOA 3EVGA 5JJCA 3R3VA 1SHTX 1R4ZA 4HWGA 1V71A 2WDPA 4DIFA 5FUWA 1LU9A 2GPJA 3CCLQ 3RYHA 4JA0A 1Z6GA 4Z2AA 1OILA 3A1DA 2ZSIA 1PNQA 3RLIA 2YHIA 1Z0JA 5DHSA 1KI6A 3ZQ4A 5FU7C 4MVWA 4BL5A 1G21E 1VQ5T 4YPVA 4MDEA 3O21A 2IZZA 2V4UA 4MI6A 2Q3MA 2HM7A 1F8XA 5D6XA 1A76A 4N0QA 4KVZA 5FPQA 3R24A 4FONA 4OHBA 1UOPA 1BDHA 1R5NA 3LU1A 1NDQA 5LXTF 4YFYA 3F6SA 4K9RA 5DGIA 5GJWB 1B76A 2O2DA 3OCWA 4M60A 5I7HA 4JSYA 2GASA 1HORA 2PE5A 3EIQA 4MWEA 3TSOA 2IHNA 3VGJA 1E3JA 3RYHB 3UPTA 2X9LA 4K46A 2XXBA 4H7PA 3WHIA 1SXJD 2YHIB 4N01A 3ZJTA 4MR7A 5IU6A 1KI6B 4LPKA 1M2JA 2ODAA 2XOKD 3GK3A 2I0FA 1E6KA 3E3OA 1G5FA 1KPHA 2WA1A 1P1CA 1E3DA 1P5JA 3Q6MA 3RK4A 2K3YA 2X0DA 3IRUA 1QFZA 4RELA 2I80A 5CDHA 3QM1A 1QCDA 1ZSZB 2MINA 4UBOA 4GZMA 3KTFA 1KQNA 1WHJA 5NULA 4LRWA 4LJAA 1JB9A 4LD6A 1OLXA 1L7RA 3VNQA 3AI3A 2NLUA 1Y96A 2NQ8A 1VMDA 1VKHA 3CSDA 2NVUA 3I30X 3VBCA 2HL6A 3LVBA 1VLHA 4ENVA 1C1XB 4YONB 1HYQA 3BTUA 4F6RA 4J9FA 1THTA 2YJ6A 1EGAA 5HTOA 2CHEA 3FTDA 4HS4A 4MR7B 2Q07A 1GNRA 3K4QA 5TEVA 3LQFA 2AI3A 1SULA 2EX1A 1S89A 1VBFA 1IJBA 5JPDA 2A14A 1JI0A 4Q3DA 4QIHA 1JEAA 4IIJF 2D8MA 3B5JA 1QKIA 4I0WB 5K3CA 1MX3A 3CMAA 2CEKA 2FWBA 1H2YA 3WL5A 1IB0A 2D0DA 4FW9A 3L0ZA 4IS2A 1B74A 3BRWD 3K9LA 2V7XA 2GARA 3CLHA 1GGKA 5D6WA 5D3KA 3PHGA 2O19A 2MINB 1IN4A 2EP8A 1PR6A 4TOIA 3CMET 5AVUA 3CT6A 3BWVA 3G2JA 2L18A 2I6QA 1OLXB 4IURA 1OH7A 3ZLUA 4AKIA 1BE1A 3E53A 1L5WA 2V26A 4JIMA 4E08A 2IUFA 5EE1A 3MTIA 3OYGA 3VR3D 2NVUB 2W48A 4QVZA 2ZT5A 3ECSA 3V7RA 1I4OA 2RM4A 2YIVX 4F6RB 4ZN6A 4OIMA 1YCDA 4G5YA 2FPSA 4ENSA 3EZNA 5CLFA 4RLHA 2KS6A 1MEOA 1JLRA 1L9KA 2VHXA 4WV3A 3L0DA 2NTJA 4RMNA 3P4YA 2IYEA 4N5NA 3PGVA 3CN9A 3PTZA 5KWJA 2ZGVA 2PV0A 4G23A 4EECA 4P33A 5C8ZA 2QKYA 4KHPB 2IELA 4XWAA 2IYXA 2DWUA 2Y1OA 4C30A 3EEQA 3LT0A 4NU6A 2I7DA 1VJTA 1FYNA 3IA7A 3R7WB 4R16A 1AOJA 4CLXA 1BE6A 3ID6C 2J7PD 1DV1A 4W5WA 3QOFA 1WPYA 1SD2A 3UF4A 3OKAA 4P5NA 2XE4A 3QNWA 2JK1A 1S4MA 1CUHA 3CCRA 1LI5A 2PANA 1Y8QA 4IP0A 5MGNA 1HDOA 3UK1A 1HDCA 5J47A 2UVQA 3PRJA 5EKTA 3SQXA 1M9SA 3FWZA 1D2MA 3L7MA 4FR5A 4B6PA 2Q99A 2QG4A 4UNRA 3QBJA 4Y0VA 3A05A 1XQ1A 1H6CA 1G0NA 2BM9A 3HYLA 1U0SY 1QO7A 3PEUA 2QTBA 4E6EA 1GPAA 5I4IA 2BMWA 2FPOA 3HI4A 3KBOA 4YJFA 4L9AA 2DXTA 1KEUA 1XC7A 4MYCA 4LGYA 3LUCA 4J75A 2ZIWB 4KMMA 3G82C 3MMNA 3AP1A 1NW7A 4PSKA 1GAJA 1KBZA 4XKJA 3MFYA 2B1RA 2P9TA 3IIEA 2QAGC 2E6ZA 1Q77A 3E84A 4MP6A 3VNUA 2XTZA 4RHUA 1S6YA 1EIZA 1MC8A 3JVEA 4HWTA 3OX1A 4MPPA 3WNZA 5C7LO 2R8PA 3A6LA 2ZUSA 2J6FA 3N2LA 2RK3A 4RV5A 3A6EA 4J43A 2YMPA 2AKKA 4C4ZA 3H97A 5BSEA 4CIDA 2X5XA 3DCNA 1Q3HA 2GD0A 3THWB 1TUIA 4OO3A 4QTTB 2J7KA 4U0KA 1YKFA 1F4LA 1MMFB 3HYSA 4WQMA 4OUDA 2RCYA 4ZK2A 1VUBA 5KC8A 2P6PA 1KOJA 2G1PA 3WZMA 4YJFB 5HE9A 2RHCA 3OY2A 2FR8C 4XU2A 4RCBA 2GX6A 4L4YA 1JKFA 1CUZA 1QQAA 4J0KA 1I33A 5FPTA 4EPVA 1A8PA 3ROGA 4HT8A 4E2ZA 1UC4B 3PD0A 3WLKX 4KQ6A 4FI3F 5BSHA 3BJMA 4P32A 1VQ9A 2YS6A 3C12A 1GLNA 5JDIC 4LYHA 2WWXA 4E7PA 4A3SA 3UT1A 1CNMA 4MRRA 3W7VA 1DTW