4DEYA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
319
structure length
281
Chain Sequence
EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLARSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1C
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 94
structure length 281
sequence length 319
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4deyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4deyA02
1OFUX 4LRWA 3EPLA 4LBWA 4J9EA 4IFBA 5G53C 3K70B 2VVKA 4UXJA 1OXUA 2F43A 3RS3A 5B2ZA 4G5QA 2OAQ1 5HZKA 4CGZA 1E6CA 2Q6TA 4HLDA 4IDNA 2QM7A 1HSQA 2F2XA 1E69A 1LF5A 1HE1C 2MSDB 2PMDA 2ZREA 1JU5C 3B7GA 4M1MA 4ON9A 3GQBA 2QGNA 1G3IA 3C7KA 3CIOA 2YHSA 5LBIA 3LFUA 1XD9A 3MLEA 2BZXA 2IF0A 4RFSA 2DF6A 1XNJA 3PEWA 4C2UA 1MV0B 2J9RA 4U7DA 1AWWA 1KI1A 3MGCA 4PHTA 4RTXA 1EX7A 3A1UA 5BN4A 3GBQA 4M4ZA 1XEXA 2GZHA 5CK5A 5AJWA 3SOPA 2QBYB 4QJ4A 2OUKA 3LDAA 4XWAA 1ZC4A 2QPOA 2PLFA 2W0SA 4L15A 2Z6VA 1CU1A 1E98A 1DBSA 2BBWA 1OPLA 1IN7A 1NN0A 1T8UA 4P3YA 3IPXA 4ZIRB 4DLSA 1N0WA 4ACAA 3LVQE 1XDBA 1TMKA 3GP8A 5L23A 1KSFX 1NF3A 2WOJA 4OQXA 4FD2A 2FEIA 1M1YE 5KNCA 4X8HA 1IXSB 2DBYA 1CR0A 1EFTA 1V5WA 2QAGB 3NIBA 1KK2A 1WX6A 2KI5A 1U98A 3BS4A 4Y0AA 2C78A 1KJWA 2AXNA 2QMEA 2GVDC 4PZLA 4AKHA 1GITA 3VX3A 2DILA 1IHUA 2VO1A 3FYHA 5J4VA 4K81B 5JZVA 2YC4C 2RQVA 1BK2A 2RGCA 3THWA 1FMJA 3KQHA 1CJUC 2GJAA 4R0KA 2A5DA 4RKEA 4TMZA 5E4FA 5FPYA 3RNLA 4TL8A 1JR6A 1E79A 5JHGB 2J5XA 3DMNA 4A2WA 1C4OA 4PR0A 1AGRA 3X1XA 1RKBA 1XD2B 1E2HA 4RD6A 3O8DA 2QRZA 4RTZA 1UECA 3IEVA 1JALA 3I3SR 1B3QA 4C0AC 2OLKA 5J5CA 4AD8A 5KSYA 3RS7A 3KX2A 4A6XA 3WHKA 4P4SB 4HI0E 1X1RA 2GTPA 4GBQA 2O8EA 5L3QA 4LV6A 2ZI7A 4X8LA 4WCIA 2JLQA 1E4VA 2XSZA 2IX3A 1NY6A 3UG7A 2FNAA 3IGFA 3VS4A 3KTAB 2ZXUA 2V4ZA 3PVSA 1E1RD 2W6JD 3LY5A 1KO8A 1BO6A 2C98A 3CPHA 1K5GA 1WA7A 1XCGB 3U44B 3N5CA 2WWGA 2KYBA 2KXDA 1XEWX 3TSZA 2AD1A 4F92B 4CVNA 5F9HA 2V1UA 3B9QA 4F14A 1KZGB 3GEHA 2I1QA 2VQSA 4CDGA 1UKEA 4B6EA 3KQUA 2KXCA 3CWZA 4PQRA 4CEIB 1KSHA 2WKPA 1QF9A 3KJHA 2FX3A 1XPOA 3GEIA 2ZS9A 4QGFA 1R4AA 4YMTA 4EPTA 2C5LA 3PR1A 2OE2A 4M1YA 3QXHA 4ZCLA 4MKHA 5DIFA 5IHIA 3B5JA 4NYJQ 3ZH9B 4TMWA 4BGDA 1XF9A 4DRZA 1KJYA 2GF0A 3FHOA 5CB6A 2RGEA 1F60A 2QMOA 4Q9JA 1GWNA 4U5XA 2IXGA 3B1ZA 2FPFA 4BECA 2BCGY 4XTRA 3TAHA 3AVPA 4Q4JA 2CVFA 5EXXA 3ETLA 1AEYA 3RHFA 2YWHA 2PNIA 2O88A 1FMKA 4HZUB 1II8A 1BKDR 1DAHA 3FTQA 4NZYA 2JLZA 1F2TA 2OG2A 2IHBA 4POAA 4YDHB 1R0XA 3U6BA 2C0OA 1P73A 1Z22A 1RYHA 4RD3A 3RS5A 3ASZA 2G9NA 1UDXA 5GVRA 2ESWA 2JAQA 4KAXA 2OBLA 1VHLA 1E6HA 5HPYB 4TSFD 4JJBA 4AIIA 4RKFA 2C77A 1IY2A 2KNBB 1KFZA 4AC9A 1RC8A 1B0UA 2ODWA 5GVSA 4Q9IA 4NBSA 1CULC 4UKDA 2ZRIA 2ZSFA 1R7RA 3ZGXA 2MSEB 4QBIA 2BOVA 2DWQA 2CSQA 5FW9A 1KTVA 3QPWA 1E1QD 2QTVB 4PAOA 2EKHA 4QT7A 1IXRC 3IO3A 3R7WA 4C7OA 2GK6A 1E9SA 2WHXA 1DADA 4OK3A 4PHHA 5SZKB 3OAAD 2JLSA 2BEJA 5LB2A 3D31A 1FMLA 3C5CA 3O47A 4RD0A 4AURA 2O31A 2HEQA 4ZNXA 1G8FA 3QKRB 4N3NA 5CLQA 3QKTA 2CT4A 2IYLD 5CYPA 4GNKA 5FBWB 2NGRA 1JECA 5JWOA 4H1VA 1E9EA 1W5SA 2VL7A 3H0KA 4FMDF 4FINA 4E22A 3U5ZB 2FDCA 3AM1A 3NEJA 3WYAA 4DSNA 5BWMA 3DKVA 3QEJA 4GI7A 2EGAA 5BQ5A 3NH9A 3VQTA 1COWA 5FR2A 1GP2A 4TMVA 3PUVA 2FPMA 3U4QB 3LBIA 2DPXA 2FSIA 2NPFA 2QQEA 1E9CA 2J0UA 3BK7A 2VTKA 5F2EA 4EPXA 4BLOA 4Q4HA 3AVUA 2HSPA 1EXMA 3VS5A 5DYGA 1QG2A 5E95A 4F17A 4ZI2A 2RF0A 1YN8A 1D9ZA 1XTQA 2VP9A 5FOSA 5BYJA 3GLFA 2AKYA 2LZ6B 1P2SA 2VF7A 5DGXA 5K8TA 3A37A 3RANA 3SJCA 4RY2A 2DX1A 3PEUA 1KI6B 1Z63A 2DE0X 1MO5A 1I1JA 3R20A 2K7AA 1G19A 1N0VC 2FPKA 4JSTA 4KJZA 5TXGA 3CPEA 1GFDA 1J70A 4DHEA 1Z83A 3ADDA 1JR3A 2OAWA 2CNWA 5I22A 3HPRA 1XZPA 1EG7A 3CLVA 3KL4A 1Z08A 3P4XA 3TR0A 3H0FA 1KDPA 5DI9A 5TB5A 1ZX6A 1X1SA 4DLWA 1I2MA 2VP4A 1VTKA 2LKCA 2KRNA 3A6PC 1ODFA 3AVOA 4QM6A 3IIJA 1T0JA 4JJKA 1QVRA 2WJHA 5AWFC 1VYVA 4MGZR 3QXJA 1WBBA 4AI6A 1MABB 1NIPA 2HT1A 4FCWA 4I1OA 4F4CA 2G3YA 4PXAA 4H1UA 1JAHA 3KJIA 2FWRA 3QNUA 1FUKA 1JPNA 1BYUA 5J4HA 3CO5A 1ZLMA 2YUPA 1XBTA 2WJJA 4X8OA 2X19A 2RN8A 1YE8A 1EFUA 1NVWQ 3AF3A 3L0IB 3Q8XB 1ZNWA 4HAWA 1WI7A 4Q7LA 2WICA 1E0SA 2EYQA 2DRKA 4MKFA 3CR7A 3OE7A 3U2QA 5IHPA 2G6FX 2LJ0A 3PQCA 2ROTA 4AG2C 1PUIA 3TSWA 4C3ZA 2SRCA 5C4MA 5JCZA 1UDWA 5L8VA 4URVR 2ZSDA 4TLCA 5TARA 3TSOA 2JASA 2DL8A 4JJDA 4ABYA 2GEVA 4Y0VA 1OFIA 2ZJZA 4IW3B 1OHHA 3B60A 1FTNA 1P6XA 2RQTA 3N2IA 3LVRE 3IQLA 2YVUA 1KI7A 2A78A 2B8TA 4IXMA 5HCIA 4QRHA 2Q9BA 1XCMA 3NDPA 3TVDA 5DHFA 2YC2C 3FOZA 4QNRA 1MUZA 2C99A 3K9GA 5LDDC 1KYIA 1X43A 1VCIA 1SHGA 1P2UA 4K11A 1LS6A 4YLGA 1FTSA 3SI7A 1GSIA 2D2FA 4Z8AA 2R8RA 5DSZA 2Q3MA 2DR3A 3CH4B 4D4JA 1G16A 2KGTA 4JLBA 4XVUA 2OJ2A 2DYKA 1D2MA 2GAOA 4B33A 1KMHA 2EVWX 2O0KA 2BTTA 1M6NA 5C1BA 1CR2A 1RIFA 2KBEA 1XP8A 1NG2A 1QHHB 3HU2A 1ZNXA 2NO7A 3K0FB 2DBKA 3UMFA 3K70C 4QBGB 4DUGD 1A82A 2F1JA 2XZPA 2X77A 4Q4AB 4GL2A 4NCIA 2ZJ8A 4ERNA 3AEZA 5JFGA 3OIUA 1KNXA 1RZ3A 4K46A 3QPUA 3IDQA 4DB2A 3PVLA 4XVRA 2GCPA 1DEKA 2KRSA 1VKJA 1TF2A 3DHWC 4BRWA 1PNJA 3NXSA 1UKVY 1PUJA 4UNPA 3GLHE 1NEGA 3EHRA 2A28A 1TQDA 4KVGA 4LPSA 4QGAA 1U9IC 5L3VA 1R10A 2R62A 1G291 2NIPA 3QXXA 1OKKD 2L2PA 1I0CA 1T8TA 1IONA 1GFCA 5J40A 4BZXA 3AV0B 3X1ZA 1G8PA 1QWEA 1R2QA 4QBFA 2E1RA 3S1AB 3LQRA 3N2EA 1Z6XA 2N1BA 3FWYA 4KODA 1NKTA 1EK0A 3M6AA 4XTCS 2RGNC 3SR0A 4TQUS 2EFEB 4RSGA 2JLRA 4ZDJA 1P60A 2D7CA 4TMXA 1ETUA 4NCHA 3GLHB 2ZE8A 5D3MB 2OT3B 5G3YA 4HB2A 2QAGC 4C2TA 1I4TD 1OV3A 1AZTA 2HF8A 1EFHA 4B3XA 4HLUA 2JJ1A 5H1YA 1UFFA 1W4RA 4Q9HA 4JL6A 4P31A 3GJ7A 1OPXA 1HT1E 3LBNA 1PRMC 2A5YB 3JVUA 3DM9B 1AKEA 4A36A 1L7VC 2JGNA 2V8OA 2B7CA 4GP6A 4UNQA 5TY0A 2QY9A 1GRNA 1S3SA 1H8HD 3OEHA 3A4LA 3MJHA 3QKSB 4RVCA 4AKEA 4DDWA 2QROA 1PLJA 1W47A 4NMMA 3I61A 4PO9A 2HXYA 1SVIA 3BFVA 2LWIA 2ZRNA 1N6LA 3M0EA 1N6HA 5FTLA 1G5RA 2O8FA 3H2YA 3HU3A 4B3BA 1EESA 5KSZA 3Q85A 4DKXA 2ZM5A 2HCJB 1GBQA 1ZIOA 2SHKA 1VHTA 2FPLA 4LC0A 3AB3A 1SEMA 1ZNZA 2CLCX 2P2LA 5KDLA 2DFLA 3AF4A 4O25A 3PIRA 3V4RA 4CEHA 1G83A 5FPTA 2EVRA 4OQNA 3VHLB 4YMVA 2IUUA 2H57A 1E9BA 4S2EA 2XTNA 2ZRPA 4LI0A 2CLSA 2GEUA 1OOTA 2VSFA 1ESMA 3NC0C 5JHHB 1KSGA 3EIEA 4B34A 1Q44A 1H8EA 4F91B 1OH5A 1XJ0A 4GZMA 1N6IA 1G4AE 2BJWA 4BLPA 1F2UB 4YQFA 1IY0A 3LO5A 1S9HA 2GTOA 2GZAA 3DOEA 3THKA 2JJ2A 1AWJA 4CEJA 1PVOA 3VKHA 2DRMA 3ZQ6A 1DG1G 2ZIAA 2RGXA 1NY5A 2PEYA 1E2KA 1NIJA 2MSCB 4ZI3A 2M51A 2KJQA 4AG5A 1JJ7A 4WW0A 3QENA 4LJ9A 4H9GA 4XD7A 1U3OA 3CRQA 3ZVMA 2GKSA 2LP5A 3Q72A 1KI3A 4DLXA 2HDAA 4K8OA 1E0JA 4LHXA 4LCBA 5EUMA 3FFBA 5AUQA 1ABQA 3CQTA 3DOFA 4JBYA 4BFYA 1Z29A 3EG5A 3M1IA 2X8AA 5JRJA 3QSYA 3VS6A 3PJRA 5EE3A 1XTKA 2WIBA 2L3QA 1ZBDA 3BAFA 3GLIE 1Z0AA 5FI1B 1SXJC 1MRNA 4URYR 4A8JB 3AH8A 4C9BA 1AK2A 5FBLB 4V02A 3JV3A 3HPQA 3BE4A 3TUIC 1G3MA 4F4JA 2ZRAA 2ODEA 5KNDA 1X6VA 3SBDA 4B2LA 1YJ5A 2ZJBA 3L8YA 2W6IA 3M0SA 3PVQA 2WIAA 4LHVA 3VR1A 4PC2A 2O52A 4LHWA 4URUR 2HJGA 3QBTA 3ZYCA 5LD2B 3BWDD 2O9VA 2J3EA 2P3SA 5IHNA 1TU4A 1Z28A 2EQBA 2X1VA 3U60B 3ZIAD 1Z3IX 3UANA 3KQLA 3MRSA 5LB4A 4UNNA 4L4UA 3AUXA 2CE7A 3P4YA 1VCOA 2OILA 3E70C 4A6PA 3GLIB 4B2PA 4FI3C 2EGCA 4JVLA 1WFWA 5GJBA 1NLZA 1CXZA 4DC9A 3SJAA 2VP6A 1AZGB 1E2JA 1XRJA 4C0KA 1OIWA 4GMDA 5IDVA 2V1RA 1IN6A 2SEMA 1HH4A 1NLOC 3DMDA 5DN6D 1T5IA 1TADA 2J59A 2ED0A 4OMMA 3SFZA 1J3TA 4Z89A 4QBHA 2BC9A 1KAGA 5FWBA 2BBSA 2CE2X 4JLVA 3REFA 2J6FA 1II9A 1AS0A 1ZBJA 2ZE6A 2YDLA 5ELXA 2A9KA 3C14C 1YRAA 1JEGA 1NNEA 1OH8A 4AKGA 5AUOB 4CF7A 2Z5FA 3JZMA 4KBGA 1GFIA 1NVXQ 2C96A 2ZSEA 2ZUBA 3QVUA 3RAPR 2I1VB 2NO1A 1NVVR 1KI4A 3AP3A 1JNYA 4OK5A 3QXCA 1YP5A 2DL7A 3D3QA 1PKSA 1WE2A 2I0NA 3MWKA 3LAWA 2X3XD 2YYZA 2KT8A 3EGUA 5KDOA 1ZVQA 3PUWA 2JLWA 2BBOA 2EU8A 3TAUA 2GNCA 4EFNA 4DDVA 2H17A 3TMKA 3BH0A 1Q1BA 1HA3A 2V9PA 2OFOA 2GXSA 2QRNA 3BERA 3I8XA 4A0RA 5GJWC 2MMCA 2F3RA 1UGVA 2M0YA 2V6JA 4KFSA 2GBLA 2GJ9A 2RGAA 5TMPA 2VYFA 1Z9ZA 4QL3A 3SEMA 4YMWA 5EP1A 1AA9A 1QBKC 2HUPA 2F9MA 4KVAA 3NHAA 3U3OA 2CL0X 2RQRA 1KI2A 1KO1A 4AFZC 3CBQA 3R8FA 2J41A 2PMKA 4US0R 4W5HA 2UZ3A 1CR1A 3AGQA 3QEOA 4RD4A 1JXOA 2MOXA 3LX5A 1E99A 2F6RA 4GDFA 2XTMA 1SSHA 1LTQA 3SDZA 1E4YA 2RPNA 1U8ZA 3FPAA 5D3QA 3B1VA 4LY6A 3HU1A 4II7A 3ZL7C 3M0PA 1SVLA 1D2NA 1R8SA 4IOKA 4QHYA 2WOOA 4Z8YA 4NL4H 3A1SA 3BC1A 3QIAA 3UKDA 3DZ8A 1MV5A 3U6KA 3BORA 1G3QA 1JEDA 2GWHA 3LD9A 5AK0A 2EFHB 1KOFA 1F48A 4B6FA 3L43A 3PFIA 3WP1B 3QF4A 3UIEA 5AUNB 4JLKA 2OO7A 1KAOA 1GCPA 5CJ2A 2ZYWX 1D2EA 4V03A 1RLQC 2GA8A 1GKUB 2J7KA 3PXGA 4B32A 4B73A 2QZ4A 1Y57A 3MWJA 4JLJA 1F3OA 2IYVA 1G4UR 1MKYA 4DT1A 2J6KA 5FOWA 3ZJYA 1AQUA 2OCBA 1OPKA 1P61B 2IWRA 4YMUA 1R0ZA 2Z0MA 4Z88A 2ZS7A 3OEEA 3IUYA 2IHYA 3QPVA 4IJMA 4NCNA 2PT5A 3TLXA 4L9SA 1RYFA 1ZJ6A 4JKIA 1UHCA 4JJZA 1GNQA 1DE0A 1UKZA 4JLOA 4NTZA 3T15A 1KKMA 1D6JA 3B13B 1RRGA 1NSFA 2QG6A 3NWJA 2EW1A 2UKDA 2ZRHA 1R5NA 4O0MA 1YZKA 3EASA 5FL7D 5A5GA 5JSZB 2GXAA 2O8CA 5F9FA 5CYOA 5DYIA 2WSSD 3RDPA 5F98A 4GFDA 1NMZA 3TGPA 2GQIA 2C03A 2QE7D 3I9QA 1IAQA 1KSWA 1J2JA 1W48A 1SHFA 2IA5A 1UBGA 4BZQA 1OV4A 2IUSA 4BFXA 4DZZA 3A98A 2JEOA 3GLGA 2B6HA 1FP7A 2XOKD 2WM9B 1YZUA 4LE9A 4E07A 2NOAA 2ZAOA 4Q18A 4TMKA 1JXMA 5AR1A 3O5ZA 1SKYB 2IYSA 2QTFA 4U02A 4HEJA 1U94A 3OFND 2ORIA 3BH7A 4ILEA 5CIQA 4NCKA 4ZIRA 1ZUYA 1CR4A 3CF2A 4JLNA 1P9NA 1ZUIA 4V0MA 2ASEA 2OBNA 1RLPC 2WWXA 4MQBA 4ASUD 2WPDA 4NYJR 4D0LB 2CHVA 2WWYA 2XTZA 1G6HA 2KWIA 3W5JA 1LS1A 4RFVA 2WZQA 3NPFA 3MWYW 1FZQA 2OEPA 1G3RA 1F6BA 3C41J 3B78A 4OMQA 1S1CA 3AGPA 2O8BA 3EWAA 2EGEA 1YWPA 3UF4A 4J9DA 1VECA 1P9WA 2GEDA 5JEDA 4TL7A 1GKYA 3BB4A 1M3BA 3TK1A 1QKWA 2CHQA 4JLMA 3U7EB 3O8BA 2XXAB 1J7KA 4GPTA 4MUAA 4CIDA 1PJRA 1TG0A 3H0IA 1J8YF 1NJFA 1OYYA 2JJ8A 3RSLA 4B3FX 4X8MA 1TQ4A 2VF8A 2P4RA 5EZ5A 1OEBA 2BM0A 1YKSA 2JMCA 4HVVA 4Q1BA 3SYLA 4D2IA 2PL3A 3SFVA 1V1CA 2B21A 4OJKA 5EE9A 3K0EA 1UAAA 1X86B 2QDLA 1FX0B 3GJ8A 1TQ6A 1Y63A 3PG5A 2A5FA 2C9CA 3I8SA 4P4SA 5AJYA 1D8TA 2LJ1A 3GFOA 3GJ0A 5HKKA 4HATA 1M7GA 1XFAA 3K70D 3THXA 3KTAA 1NLPC 5H8WA 3EZ9A 4KYUA 5IXFA 4Q1DA 3ZD6A 3VKWA 5KHOC 2QM8A 2ATXA 1K1ZA 2EFDB 4FWIB 1DS6A 1A0NB 4RZ3A 2L3PA 1GILA 1P5ZB 4Q19A 4ESHA 2P65A 2D06A 2UVQA 5FFMA 2CT3A 3Q3JB 2IYXA 3GFTA 4P0TA 2ZJ5A 3PUYA 5BN5A 3GPLA 2JCSA 1AIPA 1OJLA 5CM8B 3ND8A 3ZVNA 4UXIA 4CEIA 4R7ZA 1XEXB 5E3HA 4D0GA 1Z06A 1JQQA 1D9XA 4NYIQ 5KO2A 2GRJA 3SHFA 1IOZA 4CC4B 3D7MA 3VU9A 2JDIA 2KT1A 4RD2A 5FOXA 2OESA 3DM5A 2REBA 3FHCB 1ZCAA 3OAAA 4W7SA 1TL7C 1G7RA 4AWXA 1Y3AA 5KPDA 5EQTA 1IN5A 3BB1A 3VR4A 4DJTA 1SXJE 1T0HB 4ESVA 4LK2A 5JI2E 2Z4SA 1CF4A 2XNDD 2X2EA 1UBEA 4PPQA 4XVQA 3RWOA 2GJSA 2DHRA 1OF1A 4E09A 2RB4A 1UFQA 2R6CA 3SN6A 5JJIA 4LYFA 3ZZUA 1G5TA 3F3YA 2A3RA 4GZLA 3W34A 4TQAA 1PKTA 3I73A 1DAMA 4OMNA 2CH4W 4OI1A 3LW7A 1XXHA 1YR6A 2A08A 4JZ4A 2HF9A 1GRRA 5HCNA 2OZEA 3WYGA 5K8UA 2IS2A 2CK3D 3AKEA 2IYQA 5SZJA 1XMIA 4IDPA 4BEBA 5JECA 1GZSA 4MITA 1GRIA 1SXJB 2QQ0A 4LN2A 4TLBA 121PA 3ZZTA 1DOAA 4KFUA 3O8CA 2ZU6A 3CB4A 1CIPA 4A8JC 1GL5A 3K1JA 1P9RA 2FU5C 5JS7A 4I1VA 1U81A 3SHWA 3FE2A 1TPZA 3BJIC 2EYXA 4P4TA 3VS0A 2O8EB 5L3QB 1FNNA 3CX8A 5JMTA 2RHDA 4Q9KA 2LKDA 1KKLA 4LYJA 4M8NE 2QSYA 3FVQA 5LD2C 1VG1A 1E0AA 2J87A 1ANKA 4F38A 2DA9A 2ZANA 3G82C 3GMTA 4JT4A 2DLPA 4WOPA 1GCQA 1BH2A 1K9AA 5JCPA 2LCFA 2ZJOA 2C95A 3K53A 4BFSA 1X8JA 1X8LA 1SKQA 5CDFE 1HQYE 4OHZA 3A1TA 4C0LA 3K9NA 4ACBA 1OYWA 1E94E 4OL0A 2FG0A 2OM2A 4XH9B 4YXWA 4KYIB 421PA 2HCKA 1RRPA 3ZDQA 2D4HA 1XMJA 4OQLA 2ZE5A 1UJYA 4DB4A 4A0FA 4KCGA 8OHMA 4J9CA 3HJNA 3EZFA 2EQIA 2KEAA 1JB1A 1HUQA 1E79D 5FUXA 4KSCA 1E9RA 3KFXA 4IHQA 4DCSA 4NE2A 1SXJD 4LZZA 3I4LA 1OH7A 2D7DA 4DWJA 5IH2A 3PE0A 1Z0JA 3FKSD 4UNRA 4PSAA 2ED1A 1P75A 4Z8XA 2D62A 3KKPA 3OESA 3LNCA 1UM8A 1NBME 2JTEA 1W0KD 3RNJA 1KJZA 3THOA 4Q4JB 4Z51A 5G3ZA 1GIAA 3K09A 4QGGA 3G0HA 2C9OA 1TUIA 5G41A 3U23A 1II8B 2XSZD 2OBMA 1F2TB 1ZM7A 2FFAA 4B3CA 4CT4B 3T1TA 1FPMA 2HCBA 3RRNA 4IIMA 1SPKA 1KY3A 2V7QA 5GJWB 3K8YA 2GXUA 2C04A 2HT6A 3C16C 3JVVA 1DAGA 1E2PA 5E7MA 3L0OA 3EC2A 4BWYA 4CC3A 4DEXA 5C46F 5EUQB 1P7CA 3L82B 2QEQA 3WYFA 4IIOA 1WP9A 3FKQA 3R8CA 3FMPB 5J47A 2VHCA 1Q57A 3DZDA 1KDOA 1ZM2A 4M53A 1AKYA 4OMLA 2O9SA 4RTTA 2ODBA 1KDRA 2R6AA 5EXSA 3W90A 4E5UA 4PSKA 4DSTA 3ICQB 5F3WB 1G8YA 2QPTA 2QTHA 2FN4A 1W1FA 4JLPA 4QC2A 4RUGA 2CHGA 1CRQA 2R65A 1OFHA 1GTVA 4DDTA 4BFVA 1HT2E 3CONA 3R7WB 3RS2A 1T6NA 5EXTA 3KQKA 4C7OB 4BEJA 1UEJA 2ZSBA 2DFKB 2IL1A 3AP1A 3L0SA 4MRVA 5HTKA 5KSOA 1TTTA 1KDTA 4KI0A 4OHVA 2VP5A 1EFCA 2FZLA 4WVFA 3HP1A 2QU8A 4NH0A 1KIKA 1M7BA 2KBTA 1Q3HA 4LYHA 4I81A 2CCKA 2GF9A 3U61B 2WWIA 1B07A 2OXCA 2NO9A 3AF2A 3E2IA 4RJLA 4M1TA 1OKKA 2N42A 4DSOA 2QP3A 1ZD9A 1CSKA 2ERYA 1LY1A 2GNOA 3WNCA 2G1KA 4MA4A 3EPKA 1PHTA 1E0KA 1JR3E 2OXRA 1S0UA 2PJRA 1W36B 1M34E 4V0LA 1UTIA 1YZGA 3KKQA 2J0UB 3CRRA 2HXSA 1XWIA 1B23P 4M1WA 4Q4HB 2ZRFA 1Y0MA 5DE3A 1M74A 4A4DA 4OQFA 3U7HB 2HYIC 3EXAA 1Z6AA 1NBMD 4I1SA 3M0TA 5FBRB 1ZW6A 4IFEA 4D80A 3LXXA 3KUCA 1JEEA 4PZYA 1W0JD 3IKJA 4Q1AA 4AFQC 3EW9A 1M2OB 3SJBA 1P72A 3RSOA 4MDEA 4IVQA 3H84A 2ABLA 2MIOA 1II0A 5JLJA 3D8BA 5ECAA 3WMGA 2GCOA 4BLRA 4PSVA 5H70A 2KR3A 1XTIA 4M1SA 1CLUA 1OIVA 1NYGA 5FWCA 3KZ1E 4FIDA 2OCYC 2MMGA 5LPNA 1X6GA 3SJZA 3RRMA 2QA5A 3K0CC 1P2TA 4KITB 3TQCA 1SVKA 3K9LA 5AJVB 3RRYA 1BMFD 1ZIPA 1FFHA 1COWD 4GSYA 2GK7A 3RRZA 3A4MA 4B47A 2WTUA 3SC3A 1Q22A 1YRBA 3X1WA 1W36D 1W4BA 2BZ8A 3CH5A 3LRPA 1DAFA 5KDDA 2A37A 2FH5B 2HLDD 4DLUA 1I2DA 2IT1A 1SVMA 2J45A 3BH6A 2H5EA 1SHKA 3SEAA 2O8DB 1XEFA 1ABOA 2FPDA 2Q21A 3EIHA 4LUDA 1AD5A 3CW2A 2LCSA 1CBUA 3BD9A 2ORWA 4B76A 4LC1A 4EQ6B 1E6GA 5KYKA 1AS2A 3T1VA 5DH9A 4A9AA 2RCNA 4L9WA 2IXFA 2KE9A 2R9VA 1U8YA 1KI8A 1JR3D 2ZITA 2CNWD 4OKSA 5BYKA 1Q12A 4DCUA 2AHOA 2PTKA 1ZRHA 2Q3HA 3QKSA 1CRPA 2NG1A 3AVTA 1ZD8A 5DI3A 2CCJA 1UG1A 1ONBA 3CRW1 1XJQA 3P27A 4EUNA 1ARKA 4HSEA 3QY0A 4HVWA 1HE8B 3ONWA 1CKBA 2DFNA 3KKMA 2YWEA 2JXBA 3KUDA 3SYKA 3X2SA 1KMHB 2IS1A 1QLYA 1NN5A 2C0IA 4JBWA 5KPJA 3TVTA 1U99A 1I4DD 1T9HA 2FEOA 2ZRCA 2QUZA 4G01B 4KSBA 4Q00A 1NM7A 1US8A 3K9HA 4DDUA 3IQXA 3UXMA 4Q9LA 3Q9LA 4QJ3A 2D3WA 1PRLC 3KJEA 2AKKA 2CH4A 3RVBA 2Z43A 1O87A 4ZV4A 3UK6A 5IK2D 4LDJA 2IUTA 4B43A 4QHSA 4XSHA 2LJ3A 1FP6A 2KSQA 4EPRA 2BWJA 2QT0A 2H16A 3AVQA 3CR8A 1KO5A 5DN6A 3K0AA 1AJEA 2Q9CA 2VSOA 2W2TA 3A4NA 3GJ6A 2CBZA 3B8HA 5TV2A 2DL3A 3QBVA 1QRAA 1R0YA 1ZP6A 3OF5A 5FBVB 3AKCA 3UA6A 1SVSA 3CNNA 2VP2A 4HDQB 4MYHA 3EHQA 1YR8A 1OLOA 1GOTA 2CEAA 2WAXA 1FQKA 3IIMA 3UWOA 1IXZA 2V6IA 5C2JB 1JAIA 2OCPA 2XNSA 2NQ2C 2ZJ2A 3B1XA 3IHLA 2DL5A 2DJQA 4TL6A 5C18A 1N0UA 1MR3F 2CUDA 3LXRA 4KLNA 4A2QA 4TZ0A 3MJRA 4OMPA 4FCTA 4JMPA 2OFXA 3P20A 2ZUCA 5FPKA 1XB2A 4X1VA 1G2BA 1AZEA 2DVJA 2FFHA 2JATA 3AKYA 4UNSA 4YC7A 3UPUA 1IN8A 4D8KA 2W10A 1VMAA 1KMQA 2EYUA 2IBMA 3NBZC 3VTKA 1N5IA 1EGAA 2OLJA 3ZS9A 4BUJA 2XEXA 1T3SA 1UBCA 3UWKA 3AVVA 1WXQA 1NN1A 3CX6A 4LX0A 5KU1A 4IDQA 4PO8A 4MKIA 2ZR9A 3PENA 4WBSA 2FA9A 1HY3A 3CWQA 3OIYA 5FTMA 2PJZA 2BVNA 1JQJC 3KQNA 5B58C 4HAYA 2R6FA 4JIMA 621PA 3THYA 2DMOA 4TT3A 2O8FB 2FSGA 2DY1A 5FH9A 4D25A 1KK0A 1EWQA 4BZPA 2QP4A 5FUVA 5EP4A 3VS1A 2W0MA 4BRUA 1YHNA 4GT1A 1UHFA 4EKDA 3VRZA 4Z1MD 2AR7A 2H8KA 3E1SA 1QVAA 4NDZA 2DYBA 3TJZA 4CEHB 1Z9QA 3M0QA 2NZ8A 3U3JA 721PA 1IJFA 2WKQA 1OW3B 1L8QA 3NBYC 4OHXA 2WJVA 1J8MF 4P32A 4ESRA 1NSTA 1VG0B 3BBPA 4NU0A 2PEZA 4HDOB 4N0EA 4LHYA 5DNYB 5EE5B 5FOUA 3VR5A 4MKGA 3PEYA 4DLRA 1ESNA 2LMJA 2P6UA 3EZ2A 4I99A 4ARZA 1CEEA 1Q1QA 4C30A 2R6DA 5HR5A 4M1KA 5TDHA 1LV7A 1J99A 2EPDA 4JYCA 4R9UC 1DARA 1VG8A 3W5IA 3QVVA 2CJWB 3VKGA 1U0HC 1E9AA 2BV3A 4NYMQ 4OK6A 1DAEA 2JLUA 1OXXK 5DO9A 3HWSA 2JM9A 2F7SA 4V0NA 2NMVA 4MGKR 1CJKC 4F16A 5FUYA 1UBFA 2CDNA 5CB8A 1X8KA 1E32A 2NPIA 3BIFA 4W5JA 4MH0R 4WXPA 2JIZD 3I32A 1G8HA 4D0NA 5HCKA 1RUWA 1NRJB 3NVAA 2R2AA 1U0LA 5KTYA 1P3JA 1OXTA 2ZRBA 2WWFA 1YZLA 1MO6A 4PTLA 2WAYA 4JKYA 4CC7A 1G6OA 3MAAC 2B86A 3PV0A 4R2HA 4AG6A 2QI9C 1E2IA 4EJSB 2V3CC 2CCGA 1WYXA 4OHYA 3HYTA 4M0LA 1ZU5A 4C0JA 4D82A 2XZOA 1WF3A 4C0HA 2GJKA 4CRWB 3U3RA 2QE7A 4KLZA 5B64A 1T3LA 1H8ED 4TTPA 3F8TA 1TU3A 2B8WA 3QQ5A 2IWHA 1M3CA 1KY2A 2ZYUX 3I5RA 1G20E 2PCLA 4JLAA 3ICEA 3QI2A 1YR7A 2W00A 4CT5A 1XX6A 4DEYA 1NJGA 1E9FA 2ZRLA 4D4KA 3OHMA 5L3SA 3SZRA 2XGJA 4A92A 4J9HA 3RC3A 1HV8A 2ECZA 1CJVC 3KFVA 2Q0HA 1GKIA 3EG2A 3RC8A 3HDTA 1QHYA 1S4QA 1L4YA 4FN5A 4HUQA 4W5WA 4BFZA 3R6NA 2A5JA 4RCYA 2EYWA 4PX9A 4N0DA 2PX0A 2DCUA 4QNMA 4LJ4A 3AVYA 2BIFA 4QKQA 1WQ1R 2P6NA 1ZSGA 1Q3TA 4HUTA 5EJEA 4LJ8A 4TLEA 4Z1MA 2H1LA 1K8RA 3U7GA 4G5RA 6Q21A 3LA6A 5A0FA 3WXMA 1XTJA 4DCNA 1H3HA 1K6MA 3VMFA 4HXJA 3CRVA 2KYMA 1IO6A 1RFLA 3PCRB 1XJCA 4ZCMA 1VA7A 2ODNA 1AVZC 1N6RA 4ZDWA 4A82A 2W6ID 1WIEA 1TX4B 3Q5EA 3V00A 4LNPA 1M8PA 2W58A 4WXRA 1RE0A 1ZUHA 3I5XA 4TMTA 1D5CA 1A2BA 4URZR 1A2KC 2WMOB 3AF1A 1AWXA 4O2RA 3WP0A 4B3GA 4RZXA 2YUNA 3I92A 4L5BA 1W36C 4WAUA 5G40A 1FOEB 2P5TB 2ZJYA 4KBFA 4C0SA 3TRFA 4DLVA 3R9WA 2D2EA 1RJ9A 5HZHA 2YOFA 3ZLJA 3TQFA 4KU4A 2PH1A 3L0PA 2EWWA 2RMKA 2JLYA 1G7SA 3U7FB 1ZAKA 2YV5A 3A58B 3SU8A 3UATA 1SKYE 4NYIR 3NGPA 2ZRKA 2IYRA 2G0TA 2V1QA 4QHTA 4LJ7A 1X2QA 2RGBA 1W49A 2K3BA 2GDJA 1KO4A 1Z0FA 4DCTA 1E2NA 1RW4A 4IEIA 4NONA 5FR1A 5FOTA 2O2OA 3T1QA 4QJ5A 2R6GA 3VAAA 1TEXA 1G7TA 1AOJA 1N5JA 4OI4A 2NO6A 2B7BA 1U9IA 4OJQA 2PX3A 5K8IA 2ECKA 1SVOA 1OB2A 3QF4B 1N5LA 1BB9A 4XJXA 4BFUA 3KB1A 5CJPA 4XWKA 2AFHE 1FQJA 1OXSC 3SS8A 5M04A 2QBYA 2BCJQ 1S1MA 2Z83A 4MUBA 1WXTA 1XPUA 2FFBA 1E7OA 3NMZC 2BJVA 2ZQ5A 2RGNA 1E1RA 2W6JA 4IDHA 2VRWA 4XWOA 2JT4A 5B57C 1MO3A 1DAIA 1EFRD 5CIWA 1WRBA 4C0QC 1I07A 2EYYA 5IT5A 2AXPA 2FE4A 2ZTSA 1GVNB 2BHRA 3LV8A 4JBXA 4HAXA 1UPTA 2XNDA 4J9BA 3OZXA 2QAGA 3GLGE 4NCJA 1W4AA 3EG0A 4ZDIA 4TZ6A 3T12A 2P0EA 1J90A 2WV9A 4RD1A 5JWRA 2K9GA 4DLTA 3VR2A 5K8LA 4G5OA 2EW3A 3T35A 3GEEA 2O8CB 2C2HA 2EWVA 4TQ9A 4U00A 3MUFA 2J06A 4R98A 4A0HA 4URXR 1U06A 2YJTD 5EE0A 2F2VA 5J4KA 1HQCA 1W44A 3IPYA 1WXUA 4PANA 4L16A 2CK3A 4V0ME 4O3MA 2KBFA 1XD2A 1K0XA 4JSYA 1VIAA 2GVZC 1YNZA 3CRMA 4BPBA 2ZI9A 4Q4LA 2JM8A 3GLGB 1TF5A 4Q01A 2EYZA 4GOXA 4WIAA 4YMSA 4D81A 2W2VA 2BMDA 2ROLA 4HAUA 3SE0A 1TNDA 3TW8B 1R5BA 2RGDA 1KIMA 5AJZA 2WJGA 4ZPXA 3C5HA 5BN3A 2JLVA 2ZETA 1NI3A 2AKLA 3GJ4A 4M4SA 5DISB 1TF7A 2V55B 4Q47A 3WNBA 2F43B 4B75A 1VG9B 4GOJA 4YONB 4DSUA 1WDTA 1NL3A 4LJ6A 3RS0A 2PZFA 4IOMA 1SVWA 2XX3A 3MG9A 3AKDA 3OEED 3U44A 1H8KA 1T0HA 3IBGA 3V9PA 4S35A 2YZ2A 2F1RA 4TSFA 1ZMXA 2QENA 1E9DA 4RFSB 2PZEA 3REBB 1KSJA 2J7PD 1P62B 4OI0A 2NUZA 4MRPA 2VSXA 2O8BB 5JWHA 3EWSA 4FMCB 4M21A 4KHZA 1N5ZA 3RLFA 4KRTA 1HEIA 1QZXA 2IYTA 4M1OA 2LNHB 2VIIA 3KB2A 2L3SA 2HJVA 3CNOA 1XOVA 3Q7PA 1Z07A 1SZPA 1E1QA 2FMXA 3DKPA 2IS4A 2D0NA 1KNQA 3A1WA 1BS1A 1NLFA 2ONJA 1SXJA 1XTRA 3H41A 4GRAA 2FF7A 2OAP1 3FKSA 4V0KA 2VHJA 3ADBA 2AK2A 1KGDA 4BQSA 1Z6GA 4AFSC 5HE8A 2GGRA 2XB4A 4DXAA 3KJGA 1W0KA 2GJ8A 1LB1B 2NWMA 2OCAA 2JS2A 4MDFA 3HYRA 4LUCA 4OBEA 2F9LA 4XSGA 2WKRA 1LW7A 2DNUA 1LVGA 2QL6A 3MD0A 4B3DA 4RCZA 1S1NA 4HZUA 4UJ3A 1S8FA 2D1XA 3MWLA 4TTQA 4HLUC 1E2DA 3KDSE 3THXB 2P6RA 1AGPA 2C9YA 3B1YA 4MGIR 3THWB 2G83A 2ZR0A 1VYTA 4PFSA 1GL9B 4AY2A 5GJVB 4JYBA 2E87A 2AKAB 4DLZA 3P1JA 2ZI3A 3W3AA 1S9DA 2Q3FA 2WPDD 4TLAA 4Q1FA 3UA7A 821PA 2J0SA 2YSQA 2LX7A 4LBZA 1X6BA 1OE0A 2RGGA 2CVHA 2DWOA 2ZVPX 2OV2A 5I11A 4MRRA 1Z2AA 4IVPA 4HAZA 1N5KA 1GL6A 2F2WA 3AP2A 3ULRB 1XZQA 3VRYA 1ZC3A 3TIFA 3WBJA 2GBQA 1Q1ZA 3A1VA 1N25A 4B35A 4EFLA 3TKLA 3I1FA 3Q7QA 3TE6A 4AKIA 1C1YA 3B2EA 4JZKA 1TQ2A 5BXQC 2FOLA 4TL9A 4IOJA 4CZ2A 4A2PA 1YZQA 1YZTA 3VU9B 1FL9A 4E6RA 1XXHE 4JT2A 4KFTA 4LWZA 4PQYA 4DIDA 5B30A 3DL0A 1BBZA 1Q0UA 3TH5A 4JJCA 4IRUB 2QT1A 5CDFA 2VA8A 3QKRA 1X3SA 2FGKA 5FTNA 1XEWY 5GJCA 3NC1C 4R2IA 4WZBE 2KROA 2IIMA 2BKUA 2BMEA 3CF0A 3MFYA 2FSHA 3QOFA 3F5FA 5HKKD 2WMNB 5BW8A 3P32A 3GFPA 1TUCA 3GJXC 4IEEA 5EP3A 4TYYA 1M27C 5JJLA 2ZRDA 3B85A 2DM1A 2DB3A 2YOGA 1L2TA 2PLRA 3U4QA 4JL8A 4DCVA 1WMSA 4IOLA 4MYCA 4A0GA 3EG1A 1XXHB 4LJAA 4I4LA 2UZIR 1OH6A 5UKDA 4B48A 2JS0A 3MMPA 3SBEA 5JS8A 2G77B 2L0XA 4RTUA 4TWZA 1E2LA 3FMOB 1IBRA 1NBMA 3EIQA 1KI6A 3QJYA 5CLLA 3IILA 5CM9C 1A7JA 1H65A 1Z0IA 1G8GA 4EFMA 3M0RA 4LHZA 1PZNA 1ZD1A 3Q5DA 4P4UA 4Q1CA 4FCVA 1RVDA 2PZ1A 1W0JA 4HLCA 4Z54A 4B71A 2JLXA 4ZDKA 1GUAA 3ZVRA 3W6NA 4EJSC 3WNDA 1VCMA 3EG3A 4GP7A 2JDID 1G41A 2QSZA 1LFDB 4G3XA 4GBMA 1E3MA 2BBTA 2QORA 2IEYA 1S3GA 3BFKA 1SGWA 3IBYA 3ECCA 1LCKA 2GTJA 2ENMA 2V54A 3R9XA 1KK3A 1OFTA 2DWPA 1QDEA 2ZE7A 1G7CA 2H92A 4BFWA 2XB2A 2G6BA 1QHSA 2VHUA 3AVWA 1W2GA 5GADl 2ZRGA 4JVNA 3QG5A 1MABA 4DLYA 3CPJB 4Q21A 4IXNA 4HZIA 3NBFA 2YNMA 3W8NA 2F55A 4Y92A 1BMFA 1YVDA 1DO2A 2OFWA 1T4GA 4F4IA 1G64A 4DUGA 2HLDA 2ZUDA 2FFQA 2QMHA 1GNPA 4EPWA 2YT6A 5P21A 4PPFA 5JBQA 2DL4A 1XCPA 4AYXA 1WA5A 4RTWA 4TLDA 5HE9A 1PV4A 3QUSA 1TUEA 2G88A 3GLFE 1I4LD 4PQFA 4G5GA 3EAQA 2RQUA 3REAB 2GETA 2IYYA 1X27A 1VPLA 5E7IA 1AM4D 2AZSA 3WRXC 5FBQB 1U8AA 3NDBB 1NN3A 2IC5A 2ONKA 3D6TB 4PAQA 5J4YA 2IYZA 4DBLC 2XAUA 1NYFA 3BFXA 4WZ6A 4LJ5A 2FV8A 3BRWD 1G21E 2WJYA 4N1AA 3CNLA 2W0ZA 3I5SA 1K0SA 5EE1A 1AN0A 4KV9A 2VEDA 2WJIA 1WLPB 5E7JA 4CW7A 1GNRA 4LBVA 1SHZA 3REGA 5SZHB 4MRNA 2C0TA 3B6EA 1DPFA 4A15A 4BLTA 2GBLC 2ZRMA 3TUZC 1MH1A 2CL7X 4PHFA 3U3KA 3GLFB 3LBHA 1U5SA 2ZI5A 3CZPA 3RWMB 4JS0A 4YXWD 1UUEA 1BYIA 3NTUA 4A1FA 4B2IA 1FNMA 1UJ2A 1YCSB 3I5YA 2O0HA 1YZNA 2J0QA 3VNUA 1QHHA 1AS3A 1QHGA 2P5SA 1ZM4A 1GM5A 3K0FA 1RI9A 3FB4A 1G3UA 4Q4AA 4OQMA 3AUYA 1SRLA 1JJVA 2AK3A 2PT7A 2IW3A 1KO7A 4LOAA 2O8DA 2Y8EA 2P67A 1H8HA 1Q20A 1HD3A 2FGJA 4IKEA 4RZUA 1XMVA 3IEUA 1QWFA 4FSSA 2IYWA 5IK2A 4EQ6A 4RZ2A 1W70A 3J81k 1T0JB 4Q48A 4Q66C 2CSIA 4UQOA 1M30A 2D74A 1G18A 3NHNA 5TVKA 4RTYA 4Q7KA 4BLSA 1Z5ZA 4R71A 4D26A 2JMAA 1Z6YA 2RNAA 4J9FA 2W83A 2XJ9A 2J1LA 4PC1A 1OB5A 2G0NA 1P2VA 1UADA 3S1AA 3CKLA 2CDTA 3QWYA 2K2MA 2V7QD 1EX6A 1UJ0A 5EZ6B 4F93B 2XZLA 4NP6A 1ZCBA 2AD5A 3E5HA 1OSNA 3AVXA 3EPJA 3WY9A 4D8DA 3VS3A 1S2MA 2XMFA 1Z0DA 1N6OA 3WBKA 4GOKA 3KKNA 5CK4A 3MSXA 3GLHA 2K5UA 1UKYA 2HV8A 5D3MA 1XTSA 1Z8FA 2EFCB 2L0AA 4C4PA 2X3WD 1H92A 5DHAA 1Q1EA 4W9MC 1N6KA 1W7AA 4XOIA 1JI0A 1X69A 3M4YA 2VHTA 4OI2A 1JPJA 2FPEA 2H8HA 3VFDA 1CJTC 2KRMA 1IQPA 2AZVA 1QG4A 1KI9A 2CLDX 3CF6R 3L8ZA 4PHGA 5FUWA 3W8RA 1M7HA 2NZJA 2OSBA 5JJKA 3PUZA 4G5SA 2HDNB 1HJDA 2BKEA 3I72A 1GRQA 2GCOB 4HB0A 2ERXA 5SZIA 1RRCA 4ITRC 3T06B 3KXLA 4AYWA 5JI3E 2VLIA 3ADKA 3SQWA 3X1DA 1PWTA 1T5LA 2ANCA 1NVUQ 1W46A 4M2LA 3TUJC 1SULA 4QM7A 1MT0A 4NHOA 2CXXA 1UEIA 2AWNA 3EARA 4LPKA 1NG9A 2OHFA 1F5NA 1N3BA 5ANRB 1VIYA 3QG1A 3T1OA 1IN4A 2G1JA 2V1XA 3EA0A 3LLMA 5EXPA 1WXBA 2AK5A 2D8HA 2RH5A 4JPBW 1R6BX 4LV5B 4TN1A 4NYMR 3FGNA 3M0UA 2RHMA 3DEFA 5DLQC 1K76A 3LH5A 4MGYR 3EPHA 4DIEA 3PITA 4HB3A 3WHLA 2YKGA 1U90A 4XIGS 3ZIAA 3UG6A 1QHNA 4HAVA 1CP2A 1HURA 2O0JA 1FYNA 3U3MA 1ELOA 2OI3A 1F2UA 3EC1A 1AWOA 3OE7D 1ZUNB 4FMCF 2F3TA 4EAQA 5IRCD 5JEEA 2C8VA 2I4IA 1G17A 3X1YA 2AN9A 2A7QA 2QP9X 2R44A 2RKOA 1E96A 3VHXA 4B74A 5KNBA 1MV3A 1DAKA 1OHHD 2ZRJA 2FRWA 4Q02A 4EIWA 4LSGA 1ZINA 4JVMA 3VS2A 3FDIA 2ZR7A 4JZ3A 1YR9A 1Z2CA 3WMEA 4EIKA 2GHIA 4TYWA 3KKOA 2B92A 4AK9A 3C4JA 2H7VA 5DI3B 3HR8A 1NEBA 3KXIA 4J0QA 4A8JA 2AWOA 1TAGA 2JIZA 3P26A 4GMXA 1NMXA 4M9SA 4O2LA 1E2EA 2JA1A 2QN6A 4BLQA 2J05A 2IF2A 2NO0A 3EZ7A 2VBCA 2F1HA 3BB3A 3QXSA 5FL3A 5FOVA 3WRYC 4J9GA 2GCNA 3I62A 4JL5A 4OYHA 3HR7A 1LF0A 2D8JA 3LWNA 2LQWA 1IM2A 1W5TA 2DFTA 2VHQA 1FUUA 2PZGA 3ASYA 1GAJA 3VR3A 1A1VA 1US8B 1SQ5A 4PC6A 1EFNA 4QXAA 5GJVC 2TMKA 3I35A 5L3RA 4EPYA 5CITA 1NLYA 3GJ5A 3H1TA 3IO5A 3GCGA 4IVRA 3GLIA 3ZD7A 3A36A 1Q21A 1CS4C 1DG3A 4FXPA 1VYUA 3UMSA 1DO0A 2GXQA 4M9QA 4ZO4A 3H4MA 1CKEA 1VDZA 3FJ5A 4M22A 2CREA 2FRYA 4NKRA 1ZYUA 2HYDA 4YDSA 4BE7B 2BZYA 3EZ6A 4KO8A 4TYPA 1TUDA 2CJWA 2E9SA 2PCJA 2VPPA 1DELA 3A8TA 3FMIA 3AF0A 3H86A 3K0AB 4MRSA 3BXZA 3SQXA 2GILA 2CUBA 3MCAA 4US2R 5FPHA 2YINC 2GESA 5KOYA 3W6OA 1HYQA 3CUEF 1NMYA 3QE0A 3G5UA 1V43A 2AX4A 1E2FA 3SYNA 2EBPA 2YUQA 1K4US 2WVJA 3IQWA 2J7IA 2WWHA 2KE5A 2REXB 3TNFA 1W4CA 3ZQJA 1E2MA 2BEKA 1TEVA 3R9IA 5A4JA 4J9IA 3QF7A 1HTWA 2QMUA 4TYQA 4QGHA 4CEJB 2IK8A 4LJYA 4EJSA 3T5DA 1BOFA 4EDHA 2JJ1D 1DTSA 3LW8A 1QHXA 2YWGA 3NG1A 4PAMA 3W3ZB 3T34A 3EA5A 4PO1A 2HEIA 4QOSA 3JZAA 3N70A 3FMFA 3TR5A 2MCNA 2K79A 5FI0B 2RAPA 3OEHD 4PPNA 2LQNA 2FJUA 5AUPB 4E03A 2BDTA 3LX8A 1SRMA 2BM1A 1UF9A 1OIXA 2QPAA 3NHBA 2AFIE 1UE9A 1GG2A 3THYB 2K6DA 4GLMA 4A63B 3ZZ0A 3BGWA 2ZSAA 2JW4A 1IJEA 4AYTA 1W2HA 2ZI4A 1PLKA 5C4GB 2CL6X 1E2GA 2YWFA 1AQYA 5FL7A 3H0HA 3VNVA 3SNHA 3DVLA 4AFUC 3NH6A 1XPRA 1A4RA 2PBRA 1S96A 1YU9A 2A30A 2N46A 2WSSA 2ZVQX 4MYTA 2CMKA 4HB4A 1QKXA 4JVSB 3OIWA 2ZPTX 4QFMA 3W9YA 3RYTC 2FO0A 1GDDA 3W6PA 1KHTA 2GZDA 2IXEA 3OIVA 1T3HA 4M9ZA 1MO4A 1R8QA 5FPSA 2IS6A 1XD8A 4FMBB 4QG7A 3ND9A 1GCQC 1KZ7B 2YUOA 1RPZA 3WMFA 1N6PA 2QAJA 4ARZB 2JJ2D 1NG1A 2ZJAA 4MYUA 2FZ4A 2XOKA 3DDCA 4OMOA 1JBKA 1PLLA 1CKAA 1W1WA 3EX7C 3VR6A 3QKUA 3ZS8A 2ZYTX 1R5OA 4OHWA 1QCFA 4NPHA 2VKNA 4UXHA 3ZVLA 4URWR 4L8GA 4XD7D 4P33A 1G5PA 1T91A 3OFNA 4TYNA 4LYAA 4PC3A 3RS4A 4FW9A 3C8UA 5IF9A 4WZAE 5H68A 2AL7A 3LQQA 3VS7A 4FMDB 1X2KA 4KXFB 2A2ZA 1C9KA 1JQLB 2QGZA 4ASUA 1EFRA 4PC7A 4D6PA 4BASA 4LGMA 4AG1C 3PEVA 5EP2A 3CZQA 4UJ5A 4EPVA 3RABA 521PA 3V4FA 4TT3D 3FHTA 1A5TA 5KSPA 5JRZA 5EC7A 1DVRA 3L2OB 4Q7JB 3UMRA 5JSZA 3DPUA 3KXKA 2BMFA 1WCV1 2WBLC 2DBMA 2KB0A 1QHIA 1WBDA 2FSFA 1K5DA 2J6OA 4PPGA 4FWTA 4D4LA 3B82A 1KK1A 3K09C 2ZEJA 4LBYA 1L4UA 1ZUUA 2X2FA 2ZROA 4G0NA 4PZZA 5KUTA 1UDLA 2BMJA 4ZKEA 3C0CA 2YOHA 4CC2A 2A36A 4LUEA 3B1WA 5IXBA 2FG5A 1M3AA 4HLQB 4CYMA 4ZKDA 1ZU4A 1JO8A 3NEYA 2ZYVX 1VCNA 3O8RA 1ZM9A 1CTQA 1U0JA 2VWFA 3TBKA 3K0CA 3IHWA 2O5VA 5FTKA 5L3SB 2VP0A 2W2XA 2ZAMA 3GJ3A 4TTRA 2XJ4A 2FEMA 3T5GA 1WB9A 1MRSA 2REOA 1XU4A 4Q03A 1Z6TA 4HVUA 2H18A 1M8MA 4HUQB 4V0OA 1IY1A 2F1IA 2VH5R 2ZI6A 2Z4RA 2QNRA 3LLUA 3RBBB 5IHKA 1WDXA 2HBWA 3NKVA 1O3YA 2IYUA 1CJMA 2I3BA 3F0TA 3TW4A 1BU1A 2RMOA 1G1MA 1ZUKA 1OT3A 1R0WA 1U2RA 2Q9AA 2WWWA 3NBXX 3AQ4A 4D4MA 3GD7A 4US1R 3VX4A 4WA7A 3BOSA 1ZM3A 3IIKA 1NKSA 3CM0A 4ZCIA 1AZSC 2J46A 4DVGA 1MOZA 1P4SA 2A5GA 2GAAA 2J0VA 1GBRA 2ORVA 2J7PA 4G1UC 3B9PA 4Q1EA 4F7WA 2ZU0C 1Z47A 4KFRA 2E5KA 221PA 4M9XA 2ANBA 1E2QA 2ATVA 1G9XA 4Q7MB 3K0SA 1N6NA 5AJXA 4C0BA 3ADCA 1FW6A 2XXAA 1YQTA 3DO6A 1NP6A 3CX7A 2IEZA 4DT1B 4RTVA 2RQWA 4BFTA 2XITA 1Z0KA 4LV8B 3QWXX 1OXVA 3PUXA 2NTYC 5FTJA 2ZS8A 3C15C 1RRFA 1LNZA 4I1UA 1YWOA 1BIFA 1EWRA 1NVVQ 1XMSA 4ORZA 1RJ9B 4Q5IA 5J4LA 2EFGA 2WSMA 4HDCA 3T61A 1FX0A 4HYYA 4JLDA 4B44A 4IDOA 3FFAA 1W6XA 4HCKA 1ZNYA 1N2CE 1GL7A
chains in the Genus database with same CATH superfamily
1ZA1B 1OFUX 3NS7A 3PFCA 2I6QA 1YKGA 5JFTA 1ZSZC 5L7TA 3H16A 1TO6A 4BRZA 1I5OB 3P0FA 1TKAA 4NL2A 4OBBA 3H5OA 3LKBA 4RTXA 3KDPA 3SOPA 3BM5A 2BFFA 2JOYA 3Q12A 3RJMA 4P3YA 2I1WA 4DJFC 5BT9A 2DAQA 5L23A 3DZFA 2FEIA 4NMXB 1CR0A 3NIBA 1T1EA 1IHUA 1MNQA 3JAWA 1UDCA 4UOEA 4FW2A 4KX3A 1JR6A 3L42A 4RD6A 4M60A 4UW9A 2RI5A 3L4KA 2NAPA 1IVNA 2XYGA 2O8EA 3WG9A 4ND6A 2IP4A 1YITA 4MV0A 5GANh 2O5RA 1JTEA 1K8XB 4OBXA 1JQ3A 3P2OA 3V1YA 2YQZA 3TSZA 3RV4A 3QV1A 2O7QA 3VR2D 1PYGA 2I1QA 4KQJA 3GFFA 3M53A 3WNZA 4F9GA 1R4AA 2NU8A 4UUMA 1SUWA 4XYGA 1TRKA 2FPFA 4MYDA 4ANJA 4ZHQB 3FTQA 1BKDR 1DAHA 1TDJA 2GFIA 2ACVA 4Z86A 3V7SA 2PXHA 2YDXA 3ASZA 1TYDE 4Q9IA 5BSEA 4R0NA 3UMBA 1A97A 3EUFA 3S2ZA 3W3AH 4S1PA 4M7WA 5FW9A 2F8MA 2DEQA 1PFWA 4RKQA 2Z5LA 2VJNA 5GANe 3BJMA 5LB2A 2IE0A 1T8PA 3C5CA 5K0GA 4AURA 4J76A 1TW2A 4ZNXA 3QTLA 2NTVA 4XWGA 2P11A 3A1EA 5JWOA 4E4YA 4I6GA 3FJOA 1OWPA 4TMVA 3U4QB 1VFPA 2O4CA 2CS7A 2YIMA 1RPAA 2FSIA 4BGVA 3OPYB 4X20B 4BLOA 4CMCA 3VS5A 5DYGA 5IH3A 2G07A 2VP9A 2IV7A 2FN7A 1KI6B 4TS3A 2PU5A 2NXWA 4DR1B 5F2KA 4QG3A 1XZPA 3IBSA 4ES6A 3EOBI 1OA1A 4A2CA 2YRXA 4B82A 1I0LA 4D99A 1TMOA 4H1UA 4Z9FA 2FWRA 4L7QA 4V2SA 5J4HA 2XA9A 4QPPA 3Q8XB 4XYBA 5DRTA 1WOMA 4NBTA 1DC7A 1E1MA 3CR7A 3KJNA 1X92A 2HF2A 3G68A 2NZ2A 5EOVA 3ZJTA 4ZOCA 2FXVA 2RQTA 3U1VA 2YVUA 3TVDA 2QY6A 2RM4A 1R6DA 3ED1A 1WOYA 1PJZA 2V74B 3GDOA 1EFAA 4OQEA 2Q5IA 2KGTA 3STTA 1GU1A 4B33A 1MG0A 2EVWX 5HHTA 3K9BA 4EUSA 2W4QA 1IOVA 5ECWA 3RBZA 3NTKA 3C8HA 4L6AA 4II3A 1ZITA 3BDIA 5A4DA 1VPDA 3W9UA 3FM9A 1ECCA 2ZWOA 1UPBA 4R40A 1J00A 3HP4A 3W5BA 2P9FA 2VUTA 4ZDJA 3X25B 1MOPA 1XZCA 3DZHA 2HF8A 3CT4A 2EX4A 3AI1A 1L7VC 1XZKA 4JELA 5U9CA 2EFJA 2PWZA 3I42A 5J2UB 4D9JA 3H2YA 3HU3A 3KR0A 4MCAA 1TQHA 1OX9A 3CC2A 2KHZA 1RXIA 3KPYA 1SBQA 4PBSA 5C8DA 3BXGA 3RTGA 2FTKE 3BWBA 3JAME 5BV1A 1OH5A 1LV8A 4MXDA 1QB7A 2W2KA 4MUFA 3UJHA 4F2DA 4RH0A 1MAVA 2M51A 1A5AB 3HI4A 2V4MA 5E6RB 3ROGA 1UP4A 4JBYA 4OOFA 3MEUA 1JTVA 3GT3A 5FRDA 4RZSA 2CXHA 5ALFA 1ESZA 5DEOA 4CUJA 5K3BA 4YJFB 3UAGA 4X6XA 2E4AA 3OX4A 1UQRA 4RW0A 4RKWA 1TM5E 3U60B 3I6QA 1QUEA 3MRSA 3MEAA 2OILA 4C5CA 1N5OX 3PMIA 2V7XA 4CM8A 4EUHA 3A6DA 2Q3LA 2FN8A 1NVXQ 4ZTBA 4NBNA 1K98A 1Y5RA 2F1KA 2X3XD 2KT8A 4N5HX 1ODSA 5JTUA 2JLWA 2BBOA 3VR3D 1QQ7A 2GLTA 3BERA 1XLTA 5JDCC 4EM6A 2RGAA 1WEKA 2Z3VA 4YMWA 4YJ3A 3IUEA 1IVYA 2CL0X 1H1TA 1M1KC 2E0IA 1XE3A 1JFSA 2CZ7B 1KRXA 1YJWT 4HS9A 3M9XA 5LXTA 3MJXA 5GWXA 4IOKA 3AXSA 4CKYA 3UKDA 3DZ8A 1GU0A 4HK4A 4DANA 1F48A 2ZPGB 1P4GA 2VNJA 1RLQC 1QXSA 3I2GA 4IR7A 2XCQA 2ZS7A 1LTHR 4ZCPA 4DRXB 1VLJA 3HFOA 1PL6A 1BW9A 4RDCA 1UKZA 1D6JA 2XTAA 5J3BA 3CQ9A 4IXTA 3FTDA 3FCCA 1A9RA 3X1KA 2QE7D 4DL9A 4ITVA 1R8JA 4CG0A 4M0MA 3MP1A 3N0XA 3A98A 3QV2A 4XU0A 3L4EA 4BX9A 1JXMA 1UOPA 2C57A 3DCIA 5AOBA 1HNZB 4WQMA 3HYLA 4CTMA 1ZUYA 5DWVA 4LRXA 1OI7A 2E48A 2CMGA 4D0LB 3V2HA 3OKCA 3E9CA 4GE3A 4B09A 1MGQA 2GBFA 4X84A 2OLEA 1YGPA 1Q2XA 1IHDA 4UZFA 1P9WA 2OSVA 1SG0A 1AV6A 2FZKB 1M72A 1EH5A 1MW8X 1PJRA 2R0QC 3RKUA 2G67A 3FUCA 3OOJA 4CUZA 4M86A 3SFVA 2D1TA 1TQ6A 3VNSA 1M7GA 3DMRA 1WKBA 4A4EA 1SOWA 2LW7A 1P5ZB 2UVQA 1RAHA 5HRUA 2HJWA 3D2AA 3RVSA 2H4XA 3RBVA 3U4HA 2HMAA 4MUGA 2EG5A 1YB4A 2Y05A 4ESVA 1WLYA 3H05A 2VZEA 3FDJA 4E09A 5BSFA 1UT8A 3L40A 4TQAA 1XKXA 1JLSA 1J0XO 1GRRA 5F73A 2IS2A 2G25A 3JASA 1UANA 1MMGA 3HUFA 2YHTA 3E84A 2QQ0A 3O8CA 1VP9A 5HK3A 4GLBA 1AF4A 1D0ZA 2EP8A 4WY5A 1LLQA 3BJIC 4R9NA 2O1EA 3KR9A 5L95A 1KQSA 2R1UA 3TIVA 4I6EA 3NDRA 4BKQA 1POXA 3M1AA 1WVIA 5DBHX 1M33A 1FK8A 3CR3C 2EGGA 1XMJA 1UJYA 1I7PA 4ZYUA 3D0OA 1QR2A 3FB9A 5IH2A 5ES4B 2D62A 1G8JA 4EY4A 3THOA 5CUQA 4GPEA 4QGGA 1GPWB 1Z4JA 3K8YA 1NF9A 5GAN6 1DAGA 1X7WB 4CC3A 1GT6A 4IIOA 1W6RA 4C3OB 3FMPB 2IFTA 4Z5XA 2DXIA 4HVAA 3IE1A 1YDWA 3TEJA 3V33A 3PP8A 2ZR8A 4ZVLA 4KI0A 4N4AA 1KIKA 2KBTA 5JDIC 4J3JA 3FPSA 3AF2A 3RR6A 5ETJA 5BWNA 1ZD9A 2GNOA 1JHZA 3H13A 3JYNA 2PJRA 2EX0A 3FROA 4NZZA 4M1WA 5A0TA 5K0TA 1Y0MA 3I56T 4IP0A 1Z6AA 1DZ3A 3LU1A 2JCXA 3DO5A 1JEEA 4E51A 1KYWA 1DBQA 4UEQA 1P72A 1K88A 4BXOA 2W90A 3D8BA 2WLSA 1WB6A 5FWCA 4DDMA 5HP4A 4C8QF 1HOTA 1X6GA 2WI8A 3HCBA 5JVDF 5E9AA 3K9LA 5EN4A 5K4HA 4C8QC 3LRPA 1FFWA 1SVMA 3EGXA 2Y1CA 2HFKA 5EZSA 5KYKA 1LDBA 1O6GA 1Z4PX 3NLLA 4F2WA 1PL8A 2EF0A 4HYEA 2BRUA 4UCXA 2GYWA 4P7BA 1ZD8A 4PJOG 2ADMA 1M6EX 5IJAA 1FDTA 1OTHA 3PUIA 2BFBA 4RLQA 4DG8A 4HVWA 3INZA 5CNIA 5EAIA 3Q9SA 1G5IA 1ABBA 2IX9A 2JIOA 2DM6A 2FEWB 4KQXA 1YUBA 2P5UA 2CH4A 1DXYA 4QHSA 5TPZA 4FB4A 2G28A 3AVQA 2K2WA 1O1YA 3MWFA 1J39A 3FCYA 2RKBA 1QRAA 3KT3A 3QPCA 3UA6A 1JS1X 5EWJB 5K0CA 2V6IA 1BVRA 5HILA 3DV2A 1UC4B 2VJBA 1TCVA 3P20A 2ZUCA 4W99A 4YC7A 3EDRA 1I1NA 4KIJA 5KU1A 4BNHA 3RIHA 1DEHA 2CXSA 1NJIR 3KQNA 5D5QA 3TTYA 3VU0A 2DMOA 3ORSA 4REMA 1K73R 3BRCA 1ZH8A 3AUTA 2XADA 4DA0A 2F5TX 5LLTA 1H2YA 4N0EA 3ENWA 1RU3A 3L6BA 4LFCB 3EZ2A 3RCBA 4M1KA 3LVFO 3WDMA 2G09A 1Y6GA 2HA0A 2IY9A 1U0HC 3C12A 2BV3A 5J23A 3VRHA 3JSAA 5FUYA 1QRDA 1LBSA 4F84A 4WXPA 5T6BA 2ZRBA 2Y76A 2WAYA 4R2HA 4C4YA 4V39A 1WYXA 2YXYA 2ZW9A 5GONB 1BD4A 4MROA 2CNDA 4CRWB 1NYQA 1IY9A 5B64A 1A9YA 2OBXA 4P54A 5EJ8A 1Y7XA 2PUOB 2B4QA 5LUBA 4GOND 3K30A 3CLSC 3KFVA 3RC8A 3AEKB 1KF0A 1EX9A 2A5JA 3JU3A 2NW6A 2OXEA 3TEMA 5IVPA 4RHXA 1K8RA 4RKRA 4F7DA 1XTJA 3CRVA 5EQDA 4AAYA 4O0LA 5KNDD 2ODNA 2PBFA 3ROMA 3OTHA 2Y67A 3W06A 2W58A 4HDNA 2QM3A 4WASA 3I92A 4WJZA 3AOEA 1P1BA 5E6UB 1V48A 4ID3A 4LG1A 4EI2A 2RJCA 1X94A 5AW9A 4J6EA 2V9ZA 4IDCA 2G0TA 2K3BA 4BO5A 4DCTA 4IEIA 4JUIA 5FOTA 1AZWA 1PN3A 1TPYA 4N6GA 5AHWA 5IBPA 4TSRA 4OJQA 1SVOA 4DUZB 2FW9A 3MK31 5KH6A 1JI3A 4C0ZA 4AS1A 1PSZA 1QK5A 2W6JA 5B57C 1U8XX 3KRTA 2CUTA 3ZU5A 3KP1A 2NUBA 1BXGA 4AF6A 2P0EA 4MV1A 4DUPA 1J0DA 1YVRA 1U5CA 1HQCA 1QDLB 1TM4E 3L8HA 3N3BC 4E47A 3H0CA 3ND5A 4B1FA 2ZATA 2JLAA 2WJGA 2Z2JA 3X1MA 1N3IA 4FUQA 2VJLA 1UJ4A 3O8NA 1TTQB 1T0HA 1IVSA 2ZPHB 4E5MA 2YZ2A 2RC5A 3RVJA 4AQ7A 2IUFA 5F7ZA 1OBOA 2D5BA 4GOOD 5B3JC 4AU1A 3ESCA 4FMCB 1Z5VA 1Q0ZA 4M1OA 5F33A 2X6QA 3GVHA 2D0NA 3OE4A 1Z0SA 3BQ9A 1XTRA 1C8LA 1T2UA 3O0DA 1KGDA 1GXIE 1LB1B 4F60A 2TYSB 2YY7A 4BLUA 3JAWB 3H1FA 2WD9A 4KDRA 1MVOA 1V16A 4F9FA 1CC1S 4EMHA 1UXIA 3QLUC 3LOQA 1L5ZA 3UJ7A 4YI3A 2CHFA 2CUKA 2F2WA 3AP2A 2MK5A 5JW6A 2GJ4A 2XYVA 2V97A 4UUOA 1KE1A 2LQKA 1R4NA 3SSAA 5HRAA 4E6RA 3R6TA 3TH5A 2DKGA 4BWFB 1KQOA 5J63A 1KS2A 1HTBA 2NNWB 4PJJA 2BKUA 2FSHA 4YRMA 3I9MA 5EP3A 4P6VF 3W4KA 1XVLA 4IOLA 3VR4H 1OH6A 4LJAA 3IQEA 2PR7A 4JZYA 4CKBB 2ZULA 3OO0A 3IHKA 4QFDA 2PZ1A 1WHKA 1SPXA 1E1CA 2BDEA 3JQ8A 3L2QA 1HFJA 2X8LA 3O91A 2OYCA 1NBIA 4LS3A 4M9CA 2WMDA 1CUDA 2G6BA 4DRYA 3PT9A 4Q21A 4AY6A 4Y92A 1Y1LA 1T4GA 1V95A 1TD9A 2YWWA 5FJIA 2G71A 5AW0A 1PEKE 2CFOA 1Y1TA 2DL4A 4AYXA 5HE9A 3AT1B 2OQ2A 1GZ4A 1Y42X 2IC5A 1ZR4A 3G71T 2DKOA 3HL0A 4GR5A 1AO0A 4LJ5A 4ZODA 3MRTA 3KELA 2CJYA 3PIIA 4FW1A 1SHZA 2EJWA 1MVLA 3RGGA 1WEHA 1ZOSA 1JYFA 2OC9A 3NHYA 1QHGA 4RQTA 3LX4A 1G21B 3QEMB 1KPHA 2PDAA 1U3UA 3S3TA 4IKEA 1XMVA 1WUJS 3UCXA 3GRAA 4XTYA 2ZYDA 4FJ1A 1HG1A 2XJ9A 5A4FS 4MKZA 4I5EA 1T3GA 2IHUA 1AK9A 4RYDA 2ZIXB 1Z8FA 4X7MA 1ESDA 4W9MC 1DCFA 3KAKA 3OZIA 2WKWA 3VFDA 3CF6R 1YB1A 3VPGA 4FLMA 3HJBA 4BQIA 3OYMA 4AYWA 3TUJC 2ANCA 3IAHA 2DUJA 1IQUA 3V97A 1IN4A 3EA0A 5FAKA 1HNXB 2J4DA 4DARA 4FL6A 1O6CA 1FYNA 4MWBA 1OZ3A 1NRXA 4MWSA 5IRCD 1BN7A 1V4VA 2AE2A 1GYQA 3NDJA 1T5DX 1V8PA 3SLGA 5IXSA 3NHLA 4OD0A 7AT1A 4MUNA 1G3SA 3FVVA 1IQRA 3KOUA 4AJJA 2HMTA 1PJ2A 3DMTA 4YCNA 3KSRA 2QQAA 4BLQA 1VFNA 2OHHA 4HEA6 3BB3A 3QXSA 3WRYC 2AT1B 4F7UE 2VHQA 3RGWS 3IIEA 2JH3A 2WSIA 1EUDB 5GAMf 4O5OA 5G02A 3BIWA 3WDSA 4L50A 4NFYA 5DM60 3MCAA 3MOSA 2GESA 5DXFA 2H4JA 2REXB 4MINA 1AZLA 5DNDA 3DHEA 3ZQJA 5JPCA 3IP7A 2W2KB 3N59A 4QQGA 3T5DA 5ER6A 2GEJA 4PAMA 4XYEA 1DC5A 4Y1EA 2HEIA 3WDLA 2X7HA 4TS4A 4OA5A 4I3HA 5CGQB 1R0RE 3S2SA 3MTAA 3U40A 4CLOB 3LOPA 4A63B 1FFYA 1W2HA 3ZWVA 2ZI4A 1PLKA 1DQZA 2Q1UA 3H0HA 5FP0A 4EMUA 2X40A 1S96A 1KTIA 4HB4A 1G20A 1XU9A 4X3OA 5FPSA 3RUAA 1FFCA 3ZHYA 1JA9A 1R5OA 3RJ9A 4Y6RA 3S44A 2VNAA 3RYCB 4O3FA 1UXHA 4PS1A 4JT8A 1V7CA 4E31A 5JQWA 4WKCA 3UMRA 3G1TA 1SIOA 1YFKA 1RJGA 1CUFA 1G5HA 2P0AA 1XI2A 1ZUUA 4NRDA 4OTZA 3QVXA 4CM1A 2A36A 4B84A 3P9CA 3O8RA 3B48A 4LXTA 3BL6A 3LMKA 1DFGA 2HGZA 3DAYA 3RG8A 3ZD9A 2BZSA 3GT0A 4Q03A 1Z6TA 2DF8A 5LJ3h 3ORRA 1IY1A 2QUIA 5IN1A 2QASA 5LXTB 3MXTA 4MR9A 4BP8A 1BU1A 2IOHA 2P9TA 3EJWA 3G4SQ 3KM0A 3WGMA 4WA7A 2GAAA 2J0VA 3CZMA 4S0XA 3V4SA 4RG8A 3SC6A 4IGEA 4IHJF 2Q4DA 4OUDA 1YJAA 3PIOA 1KEZA 2XUQA 1KKUA 2XBMA 2ZS8A 3C15C 4GXNA 2OD2A 1RJ9B 4MCHA 3G2JA 2EFGA 1MJGA 1N2CE 3MUOA 1CFZA 3K70B 3EHDA 3KEQA 4IDNA 4XSVA 4TTVA 4Z1MD 1CRLA 5I4CA 3I23A 3BE6A 3N0WA 3D7SA 4G0ZA 3P8HA 4ZTFA 4PIPA 5AJWA 5LU9A 4UAVA 4QJ4A 3CCMT 2YASA 4BE1A 2N3ZA 1T8UA 4LXCA 5A0GA 4ACAA 3LQ4A 1XDBA 1JEAA 1TMKA 2WOJA 1KSFX 4OQXA 1Q95A 3FYUB 1L4NA 4D3DA 2ECFA 4OV6B 1L5GB 3GRCA 3OA2A 3TFWA 3U7IA 4UDYX 2R1VB 3L5OA 1XD2B 5EFOA 3EZGA 2CNBA 2MTBA 3TIGA 3ZGZA 1Q11A 3D6FA 2Q3EA 3I3SR 4EBBA 2J09A 2WSLA 2QJWA 5BR7A 1LC3A 2IX3A 2ZXUA 1U8UA 2C98A 4CMEA 5B37A 3KR2A 4FEEA 4F7UF 1VE1A 2DECA 5DGIA 2JTFA 2AD1A 4L2IB 1HLGA 1G8AA 5DHRA 1DJ7B 4QA9A 2OE2A 3R6OA 3ZOZA 1PQWA 2I34A 4HWRA 4Q9JA 4WA8A 4E15A 3M3PA 1HDEA 3ETLA 2EZ8A 3VVBA 1UOOA 4PLYA 2QOEA 3WWEA 4YDHB 5JTTA 4BDTA 3WOVA 2C29D 4CDNA 3JASB 4J6XA 1OULA 3WVEB 1Y82A 5F1OA 1CULC 1QIDA 4UHKA 3DBRB 4HX2A 1J25A 5FLEX 2BUAA 3PHLA 3QPWA 5HK9A 3OF2A 5CDSA 3OAAD 4DBVO 4OAPA 1UOQA 4LK3A 1G8FA 1XHFA 3UA4A 3WLEA 2AS0A 4RPKA 2VL7A 1PJ4A 5T7BA 3MHTA 5BWMA 5BQ5A 1KIAA 2EEZA 3IRUA 2FMIA 4Q4HA 3AVUA 1EXMA 1QFZA 5E95A 1E3WA 4F17A 3OCXA 4L4ZA 3DZBA 1Y71A 4WGFA 1Z63A 3R20A 1G19A 1N0VC 2MIIA 1FVOA 3CPEA 3SYTA 4H3VA 3RTAA 4DHEA 2OAWA 1R0SA 3DR5A 4PSUA 5EUBA 2LKCA 2H1VA 3OZCA 4Z2YA 1KZ6A 3O2JA 1I24A 3D6AA 4JRIA 4AVYA 3EK2A 5LBTA 1YAJA 2WTEA 3CX4A 4G23A 5HMMA 1IHPA 3CEYA 3VO8A 2QTLA 2B1RA 4FILA 2JIBA 4M78G 4UTNA 1YVEI 3U2QA 3U5TA 2CXOA 4BJ6A 4URVR 1NQXA 4ABYA 4RK5A 3QM1A 1KI7A 2RG7A 5HCIA 2QX9A 3NDPA 2ETVA 4RF3A 2WIFA 2E37A 2LDMA 2Q3MA 4MLZA 2OJ2A 5GAMg 1KMHA 3N8GA 2BTTA 1RIFA 5CVTA 4ALLA 5BSWA 1QF7A 3FWNA 3K0FB 2DBKA 1M1ZA 2X77A 2AEFA 1OR8A 1DI0A 2GCPA 1VKJA 2KRSA 4GXQA 1NEGA 5L3VA 3U4MA 5FA5A 5K8VA 3OOWA 3OZFA 2L2PA 1VXOA 3X1ZA 3K1YA 3UAYA 3AEXA 3LQRA 4PQEA 4PZAA 1HDGO 1R6AA 4N01A 4PWYA 2NU9A 3LBNA 2P9BA 2A5YB 4V1CB 3FFWA 3DW1X 2B7CA 2XYPA 4G84A 2QY9A 1H8HD 2WSYB 2R5AA 3CKKA 4RVHA 3BFVA 2IIPA 5FTLA 5KSZA 2BFBB 3CCJA 4DM3A 2CLCX 5KDLA 3D02A 3L3BA 2EVRA 5IAJA 5H16A 3UF0A 2EATA 1P0IA 3NC0C 1H8EA 4JS4A 3OHPA 1N6IA 3SD4A 1G4AE 4JB3A 1X7YA 1AWJA 1EUZA 4FFDA 3E5NA 1VPTA 1PNVA 1Y5IA 4LJ9A 2XUOA 4MEBA 5K3SA 2GKSA 1JLLA 3EG5A 4YCDA 4W8HA 2B4AA 4C9BA 5FBLB 3TUIC 3KVVA 4BNJA 4J0FA 5AM5A 2W6IA 3BTVA 1U2DC 3BWEA 2Y68A 5LD2B 1CQWA 2Q5CA 2ZB2A 2O6LA 4UNNA 4JBIA 3QJ5A 4B3HA 4IKFA 4FFNA 2C4TA 3I9JA 4YYEA 3A70A 1N7IA 2ZE6A 1YRAA 1GFIA 5EA2A 2AX3A 2ZSEA 4RTLA 4OK5A 2DL7A 1C3JA 2I0NA 5DWQA 2YYZA 3NC4A 2Y6VA 3DMGA 2VBFA 3NTIA 4JDPA 1C7EA 1Q1BA 1M9NA 5TGTA 2GJ9A 4QL3A 1WPXA 4G4GA 3E7WA 4FHGA 1VQLQ 1H2ZA 4AFZC 4XPZA 2BFCA 1YIJA 4UHDA 3U26A 2MOXA 2LNVA 5TIIA 1TJNA 4C5IA 2RPNA 1CNMA 1L0BA 2DVEA 3NTOA 4PJLA 1G3QA 4AUNA 1BXRA 4JLKA 4MEAA 4RO0A 5HF5A 2VJYA 2ZSIA 4P9NA 2QVGA 1KOGA 4ZRMA 4LD9K 1HE5A 1Q0RA 4QNNA 2AFHA 3ROKA 4FUTA 1W0CA 2O8CA 2IJGX 5HYVA 2ZQYA 2HL3A 4DC1A 2CP0A 4HDNB 2JA2A 3TGPA 1GO2A 1VQMT 2NSLA 3CSDA 3I9QA 2M1ZA 2C97A 4RVDA 3R75A 1OV4A 2ZBFA 3VR6D 2AEMA 5AM3A 1BI1A 3EVNA 2IYSA 3TW8A 1GG8A 3Q6MA 4OMDA 4AZ0B 4ZIRA 5C31A 2PX4A 3K6KA 1RLPC 5DCWA 2G0AA 4FYJA 1W52X 2AI1A 2YCBA 2WZQA 3C3KA 2EIHA 1Z56C 2IY8A 3NIDB 4J9DA 1EIWA 3FUUA 4KP7A 2H11A 1SKMA 1LKZA 2PZJA 3KHTA 4GBED 1KBZA 5DWDA 4BVKA 1X86B 4GRDA 2C82A 2ZWPA 4YWJA 2FR1A 3QUAA 3VKWA 4A4GA 1GZHB 2FRXA 3C43A 1KZYC 1V11A 3FYDA 4NL3A 4X6LA 3ND8A 2D1RA 3BGDA 4U2DA 2AGVA 1DWOA 3OSZA 2EP7A 3MLAA 2GNPA 1O95D 1HZZC 2OESA 1GFZA 4JLIA 4J1TA 1T0HB 5JI2E 4GRIA 4M7DA 4EKGA 2NO4A 3NU1A 2P4SA 2HBYA 2HF9A 2GVNA 3EEBA 5H83A 1JKMA 1GZSA 1DOAA 3OZRA 1MZVA 5G2OA 5C5DA 1GL5A 4YP6A 5JS7A 4XYMA 1KDZA 3RSHA 1I3KA 2RHDA 4GMKA 1KYTA 1TC2A 1VG1A 1E0AA 4NS4A 1V16B 3JAKA 3FIFA 2AR0A 1R18A 4ZFNA 1E94E 2FG0A 3DHVA 4NBVA 4JNCA 2D0PB 1AKMA 4U2KA 1BXKA 3PWTA 1HUQA 4IHQA 4XAQA 2EJCA 2RIRA 1JHRA 2XB9A 3KKPA 2FVXA 1T1JA 5AVSA 3FPHA 1W581 4L07A 5KX5B 4B3CA 2HT6A 2E4VA 3TD6A 5L4LA 1PZXA 1ZQ1A 3WYFA 4P38A 2B78A 3R8CA 5J47A 1T1RA 4GVPA 1KDOA 4E30A 1KDVA 3OZGA 3W90A 4PSKA 1DBPA 2NP7A 2QPTA 2QTHA 1TAHA 2CHGA 2WNHA 4IIVA 3JQ8B 3KOOA 1GSOA 2ZSBA 5JUWA 5JE8A 4DILA 1A8IA 1PHTA 2HW8A 3K2BA 3GVIA 1TZJA 2UZ0A 1XWIA 5DM1A 3U7HB 4BJ5A 3CLSD 2B2XA 4WXHA 3E1KA 3WISA 1RABA 4IUTA 5EKTA 4FYPA 3W6ZA 4CF5A 5JXJA 4O4LF 4J9UE 4MNTA 4ZQHA 3TI7A 2BM8A 2YWXA 1T13A 2JEZA 2EARA 1OIVA 3STYA 4YXFA 3KZ1E 3WGGA 1HYGA 2NXJA 5IYZF 3AERA 1B93A 5F51A 5D8DA 3L7LA 3CZ9A 1HETA 3A28A 1OYOA 2LCSA 5CFRA 1PT5A 4RHCA 5F5NA 4QYIB 2KMTA 2CNWD 4Q4DA 2D13A 3HHEA 4YT2A 5CLJA 1ARKA 5HDBB 2AN5A 4FONA 1LPNA 4F4UA 2CB9A 4B17A 1I5EA 3O93A 2VPTA 3EGVA 2WJ3A 2D3WA 4E2FB 4MICA 1MQSA 4XWTA 4EPRA 1Z5WA 1GL3A 3VV0A 4B85A 1BFDA 3VOTA 3DULA 4UUBA 3E9DA 1GOTA 4AMUA 1FQKA 3IIMA 4LVCA 3ZKWA 3LSYA 2D5CA 3LO8A 1IN8A 1UBCA 3IJEB 2GFHA 7AT1B 1PFUA 4W1SA 3ZUPA 3C7CB 1BDMA 5B58C 3RUHA 1UINA 2R6FA 2FSGA 1EP9A 3DF7A 4NU5A 4W5OA 4JA2A 3V7YA 2A94A 2AR7A 2Q5LA 3HBLA 3P2MA 1T2FA 3GHHA 3JRNA 3K15A 1J8MF 2WNIA 2X0IA 3A1PA 1KQPA 3PEYA 5BUZA 3PC4A 1J99A 4UZSA 4CV0A 1XZNA 3O21A 2PL1A 1OXMA 4EENA 4OKNA 3GT4A 3MCAB 5AHOA 4F9TA 1LC0A 5DO9A 4R8LA 5D00A 3JRZA 1V37A 4U8HA 4FVTA 4Z2AA 1DUIA 4LE0A 2QW1A 3DMYA 1U0LA 3ZE1B 3C3JA 1E2IA 3HYTA 2R87A 4X1KA 1VQNQ 5GM1A 1XA3A 3EYAA 2J48A 1GU7A 3OHMA 3GNSA 4JLWA 2EFIA 3DE1X 4W5WA 4YAWA 4BAUA 1P29A 4JYPA 1G20B 3OZDA 1WXIA 2PU7A 2QYTA 4ZCSA 4A82A 4GPAA 3Q3CA 3AKZA 3A8MB 4WXRA 4JROA 4PHCA 4URZR 1JG6A 4QSMA 1BCSA 1W36C 1H69A 4DHWA 3RTBA 2WSBA 1A71A 5LJ5h 4HRXA 1SKYE 2OZLA 3SSOA 4DV1B 5F78A 3M89A 4B4KA 5M3BA 3PF8A 3N86A 3UOAB 1RWQA 5DSTA 1JDPA 3QYJA 4TQGA 1WLSA 5K0ZA 1XPUA 2FFBA 2ZPEB 5LP1A 3DNFA 4MR9B 4QW2A 2JT4A 4BE0A 3LE8A 5IT5A 2R7AA 4QTZA 4QO7A 4CI0C 3OZXA 4NS5A 3GLGE 2WV9A 1UPUA 4KBYA 5DCYA 2E1HA 1SEVA 3ZCPA 2NU7A 2HMWA 1ADFA 3DE7X 3EEFA 2DJ5A 2GKOA 4WOBA 4XVCA 3RROA 4V0ME 2B4RO 5EWLB 2BPOA 4OQZA 4I50F 3WK7A 4DR5B 2E4UA 2F1OA 3I04M 1I36A 4RPCA 5JSHA 5LJ5e 4RS3A 3JQ7A 3TZ6A 2AKLA 5H9WA 3HZRA 3O4RA 3EEIA 5FKJA 4XTWA 3D7LA 3RARA 3S1LA 3GRVA 3QVTA 2FMHA 3G59A 4R9SA 3D7SB 1P62B 3EVAA 3SDSA 2WT9A 5SY9A 2EKLA 2OBBA 1HM5A 3T52A 2EQAA 3M9WA 3KYDA 2YN4A 2HNKA 2OAP1 4EW