2J7IA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterodimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j7iA00
1WIEA 1YNZA 2ED0A 1RLPC 1S1NA 1AWJA 4HXJA 1SSHA 2FPFA 4F16A 2L3SA 2O31A 2EPDA 2KT8A 1M27C 1IO6A 1M3AA 2EYZA 2RNAA 4J9IA 2D8JA 4AG1C 5IXFA 5ECAA 5FW9A 1X2KA 1Y0MA 4CC4B 4CC3A 2KRNA 2DF6A 1GCQA 3M0QA 3LH5A 1UHCA 1WLPB 2KE9A 1SPKA 2AZSA 2HSPA 3M0TA 4Z8AA 1QKXA 2RQRA 1ZUKA 3H0HA 1H92A 1QCFA 1ZUYA 2DJQA 3M0UA 3UA6A 1X27A 1FYNA 4ESRA 1X6GA 1QWFA 1WXUA 2BZ8A 1NYGA 1NLPC 1J3TA 2CH4A 4K11A 2LZ6B 4WCIA 2CT4A 1M30A 4A63B 4HVWA 2CREA 3I5SA 1OV3A 2CDTA 4J9CA 1AOJA 1WYXA 1HJDA 4RTTA 4JJBA 1H3HA 1ZUUA 4DEYA 1YCSB 2DRMA 3PVLA 2D1XA 3QWYA 3I35A 3SEMA 2CH4W 1JEGA 3I5RA 1GL5A 4FSSA 1BB9A 1NM7A 1KSWA 3VS6A 3CQTA 2DLPA 1GFCA 1W70A 2AKLA 4OMQA 2EYXA 5IHNA 2F2VA 2E5KA 1SRLA 2DMOA 2EYYA 2FRYA 4J9HA 2LNHB 2C0IA 5I22A 2DBMA 1WFWA 1E7OA 1WX6A 2KXCA 2DL5A 1MV3A 4KRTA 1U3OA 4DEXA 1CKAA 1NYFA 3H41A 2P4RA 1PRLC 1WA7A 3REBB 1ZBJA 2LX7A 3PVQA 3VS3A 3ZL7C 1N5ZA 1CSKA 2BZYA 3GBQA 4LN2A 3RNJA 1OPKA 2OI3A 2RQTA 2KBTA 1UE9A 2BZXA 1GCPA 2GQIA 2KXDA 5IXBA 1WXTA 1NLOC 2M51A 1MV0B 1QLYA 4Z89A 1E6HA 1M3CA 2DRKA 2OJ2A 1Z9QA 2LQWA 1YWOA 1X2QA 3VS5A 4IIMA 5EC7A 3VRZA 1UHFA 4RTUA 2A28A 2RF0A 2GGRA 2K9GA 2JS0A 1X6BA 4JZ3A 3M0SA 3RBBB 2DL3A 1K0XA 1FMKA 1H8KA 2DL4A 2ROTA 4IIOA 2MCNA 2ECZA 2ESWA 2J06A 4OMPA 1GFDA 2L0AA 1W1FA 2EGEA 1HD3A 4RUGA 1JXMA 1GCQC 2DL7A 2KYBA 2BTTA 2O2OA 1G2BA 1XOVA 2RQUA 2YSQA 2HCKA 1KIKA 2DA9A 2FG0A 2SEMA 2LJ3A 3KFVA 1NG2A 2IIMA 2V1RA 2NWMA 2DBKA 1RUWA 1UFFA 3EG2A 1U06A 1I07A 3UA7A 4EIKA 3EG1A 1MUZA 2ROLA 4Z88A 3TSZA 1AZGB 4LNPA 1BBZA 1UUEA 3R6NA 1SEMA 1AEYA 1UGVA 2FPDA 3JV3A 3A98A 5IH2A 1UJYA 1B3QA 2GTJA 4X1VA 2JS2A 2LCSA 2FRWA 1AVZC 4OMOA 2A36A 1UECA 1K9AA 2DYBA 2AZVA 2X3WD 4GBQA 3VS7A 1GBQA 3ULRB 2LMJA 2JT4A 4F14A 2FO0A 2RQVA 2DILA 1WDXA 2YUNA 2D0NA 1WXBA 2L2PA 3NGPA 2CUDA 1PRMC 4RTZA 2FEIA 2RPNA 2SRCA 1T3SA 1PHTA 1KJWA 2RN8A 1V1CA 3UF4A 3VS2A 2NUZA 1ZX6A 2AK5A 3EHRA 2RQWA 1JXOA 1GRIA 2DE0X 1OPLA 4RTWA 1A0NB 2DX1A 1VYVA 1K0SA 1ARKA 2CSIA 2YT6A 4AFUC 1AWXA 1ABQA 1W6XA 4GLMA 1VYTA 2PTKA 2LJ0A 1T3LA 3QWXX 2ED1A 1PKTA 2V1QA 2JM8A 1SHFA 1EFNA 2FPEA 1ABOA 2DVJA 1UG1A 2LP5A 1JQQA 2EGCA 2W0ZA 2HDAA 2CUBA 1WI7A 2JW4A 3VS4A 2ABLA 1RLQC 3U23A 4D8DA 1QKWA 1LCKA 2YUPA 4HVUA 3PE0A 1TUDA 4J9GA 1PNJA 2M0YA 1NEGA 1QWEA 2J6KA 1UJ0A 1I1JA 4HCKA 5IHKA 2DL8A 2VWFA 2MIOA 4JJDA 3C0CA 4Y92A 4M4ZA 2GNCA 4AFSC 2EYWA 3THKA 2B86A 4JJCA 4RTXA 2L3PA 4J9EA 1M3BA 3VRYA 4ZNXA 4JPBW 4R0KA 2K79A 1BK2A 1T0JA 1VYUA 2KROA 1TG0A 1JU5C 4RTYA 3EHQA 2HEQA 2I0NA 3VS0A 2C0TA 1RI9A 2JM9A 3EG3A 1OEBA 4J9DA 3H0IA 1SHGA 2PZ1A 2J7IA 4J9BA 2G6FX 3VS1A 5I11A 4LUEA 3REAB 4AFQC 3EG0A 1M8MA 1GBRA 3NPFA 2CT3A 3FJ5A 3NMZC 4OMLA 2OAWA 2VVKA 1KFZA 2KR3A 1SRMA 2HBWA 5GJWB 3TSWA 2CSQA 2PNIA 2F2WA 4AFZC 1PKSA 2K2MA 2LJ1A 4F17A 2YUQA 5L23A 1I0CA 1Y57A 1YWPA 1YP5A 1HSQA 2LQNA 5GJVB 1B07A 2EGAA 2JTEA 4AG2C 1JO8A 2X3XD 1CKBA 1OOTA 2JMAA 2ENMA 1AZEA 1G83A 2K3BA 3EGUA 2A37A 5HCKA 4CC2A 1ZLMA 2EKHA 2VKNA 2RMOA 2KRSA 1AWOA 3H0FA 1AWWA 5FWBA 4E6RA 2C0OA 3IQLA 4QT7A 3SHWA 4CC7A 2MOXA 3M0RA 2J6FA 1ZSGA 2KRMA 2EW3A 4LUDA 1YN8A 1AD5A 4OMNA 1K76A 2EBPA 1VA7A 2F2XA 2JMCA 2K7AA 2GTOA 3TVTA 1T0HA 2J6OA 4J9FA 2KNBB 1X69A 2J05A 2W10A 5FWCA 4D8KA 2L3QA 1K1ZA 2EQIA 3NHNA 1UTIA 2JXBA 4HVVA 2GBQA 2DNUA 4LE9A 1U5SA 2O88A 4RTVA 2A08A 1X43A 5IHIA 1NEBA 1K4US 3O5ZA 2H8HA 2QDLA 4ORZA 2KT1A 1BU1A 1Z9ZA 2YUOA 4JZ4A 2O9SA 1E6GA 3M0PA 2O9VA 3UATA 1PWTA 1TUCA 3I9QA 2D8HA 2XMFA 4OMMA 2EVRA 2DM1A 2KYMA 2KGTA 2AKKA 1UDLA 2KEAA 2YDLA 2K6DA
chains in the Genus database with same CATH superfamily
1WIEA 1BI0A 4C92G 3UWNA 1RLPC 1S1NA 1VQOT 3JCMb 3CMAT 2RI5A 2HD0A 3UDCA 2EQKA 1UGQB 2KT8A 3RESA 5EG2A 5C0MA 1M3AA 1RAFB 2RNAA 4AG1C 2KI7A 5IXFA 4R55A 4J7IA 4JJNK 4M7AB 2DF6A 1GCQA 1FMWA 3LH5A 1UHCA 3HPWA 2KE9A 4J5YA 1ZA1B 1YIJQ 3LLRA 4PFOA 3CCLQ 4OGEA 4Z8AA 2KY9A 1ZUKA 2QYZA 3CCET 1H92A 2EJFA 2XICA 5GANd 4PLLA 3LX7A 2ATCB 3NFCA 5CQXA 1ZUYA 4NS5A 1YHQT 1M90C 3UA6A 2ZPFB 3JCMg 1FYNA 4ESRA 1NJIU 4DBHA 2DD4A 4EPCA 4NL3A 1J3TA 3A8OB 3OYMA 1IRXA 4M75E 3QO3A 4K11A 4WCIA 2CZ1B 2CT4A 1SKUB 4A63B 3JAME 4N4GA 4J9CA 1HJDA 3HP9A 4JJBA 4M7DB 1YCSB 1WQ7A 3I35A 4M75G 1IXDA 3JB9F 3I5RA 2EJ9A 1WJSA 2QK0A 2LX9A 3QYGB 5GMKm 5FU6B 3N5BB 3G4SA 2LVMA 2DXTA 3BE3A 4PL6A 2LNVA 4FL6A 4M78B 4J9HA 1WZOA 5I22A 3V8KA 3HTRA 1WX6A 1Q7YC 4J6WA 1VQPA 1U3OA 3H41A 1BYMA 2RJDA 2LX7A 2QQSA 3JCMd 2BZYA 5CKDA 2JTMA 3M59A 4C5HA 1Q86U 5LJ3j 2OI3A 1Q81C 3V7RA 4C92E 4XTYA 4M75D 4FYYB 1UE9A 1VQLA 2DTOA 3BFMA 4XTXA 5A2QE 1VQMA 1G3TA 5DY9A 4PNOA 2DETA 1M3CA 2FZGB 2OJ2A 1RABB 1RAIB 4TVRA 3LH0A 4B6MA 4RTUA 2RF0A 2K9GA 3OYAA 2YWWA 3M0SA 1YJNT 4DA4A 1FMKA 4C5IA 2DL4A 1LPLA 2ROTA 5CAIA 3CXCA 5LJ5e 4XAXB 1GFDA 2KVQG 4M75A 3VU3C 1HD3A 1WHJA 4N0AC 4ZGDB 3CCLT 3DLMA 4M75F 2E64A 4LD9K 1KK7A 1I8FA 3S3MA 1VQLQ 3KBGA 3KFVA 3CC2A 2V1RA 4ELYC 4F7UB 1IHWA 2KK4A 1RUWA 1UFFA 1YITQ 3QJ6A 3CCMQ 3CPWP 1I07A 4PJJA 5KCOA 4EMHA 1BI2A 3E2UA 2H3JA 3CC4Q 5LL6S 4Z88A 2EWNA 2E70A 4LNPA 4GLKA 1VQPQ 3EG9B 5GAN4 1UGVA 5GAMg 2COWA 4FW2A 3EH2A 4F7UE 1PSFA 3I56T 3DB4A 2FRWA 5GANh 3OYGA 4MZPA 3FEOA 3META 1BI1A 4OVAA 2QAZA 4OMOA 3RR6A 5CCAA 1OZ3A 1VQKT 2BIVA 2YUNA 3CMAQ 4C8QE 1Q81R 2RI2A 2JVVA 2JN0A 1T3SA 4L6V5 1KJWA 3J7AF 3OS0A 1WNLA 3CCJT 2JNGA 3VS2A 4M7AF 4PJOD 1ZX6A 3EHRA 2PU9B 1JXOA 2COYA 3LWIA 1D0YA 4LD6A 4AT1B 4LXCA 2YT6A 1ABQA 1PD0A 1FMVA 4A4KA 2XDBA 2VUBA 3CC2Q 4C8QB 4M78A 2JJ9A 3SWNB 3OYCA 3M56A 2FPEA 2YRDA 1MMAA 1YJWQ 5HY6A 2HDAA 4DBRA 1RLQC 4D8DA 1QKWA 2E10A 2QDYB 4HVUA 3PE0A 1TUDA 3MO8A 2VB6A 1XNIA 4PJOF 4M7AD 1NJIC 2XDPA 4M77D 3EAEA 2XD0A 2ZAEA 2DL8A 4M78C 1WHGA 2MIOA 2NUTA 2XKOC 4M4ZA 1YJWA 2RM4A 4JLIA 2K5FA 4HKEA 2EYWA 2VXEA 4RTXA 3CCVT 2L3PA 4J9EA 4YTLA 4ZNXA 1Y07A 3X20B 2K79A 3H8ZA 5IN1A 2I0NA 2E3IA 1FWZA 2C0TA 4X9CA 1OEBA 4FT2A 1OULA 3H0IA 1K73U 3CC4A 2DXUA 2FL7A 4M75B 3QIIA 4XU2A 3MKDA 1K9MU 1ZSZA 1VQ5T 1S72A 1ZSZB 1KFZA 3VUZA 3GIBA 4PJOC 2CSQA 2GFUA 2F2WA 5FU7C 4E7KA 3OBWA 4AFZC 1PKSA 5L23A 1OX8A 1VQ9T 1KHCA 1YWPA 4J7FA 2E3HA 2QGGA 2E6NA 2X3XD 1OX9A 3GNFB 1OOTA 2K57A 2ENMA 2BUDA 2RHXA 1AZEA 2AHJB 3CEYA 2K3BA 2ZPGB 1EZZB 3EGUA 5HCKA 2X35A 1V29B 4JS5A 4J8OA 2OTLQ 2Y4YA 2OTJA 3M0RA 2J6FA 3OYJA 1ZSGA 3VYHB 1VQMQ 2D0QB 1YITA 1VQKA 4ANJA 1YN8A 4OMNA 2QASA 5CKHA 1K76A 4C92F 4M78D 4LDVA 3GPLA 3TVTA 1T0HA 3CCLA 5FWCA 4D8KA 2L3QA 1K1ZA 1Q7YU 2QQAA 1OU8A 2NUTB 1SSFA 1UTIA 1ZBXA 3VV0A 1YIJT 3FRNA 5GMKh 2LT1A 2I2LA 1Q82C 1X43A 3L2RA 4BACA 1Y7XA 1F1BB 1Z9ZA 2G3RA 4FT4A 4A4EA 1C1AA 2O9SA 3HRUA 1E6GA 3M0PA 3UATA 1M2VA 1KD1C 3I9QA 3MJXA 5DLQE 1N6AA 2DM1A 1M4ZA 1YI2Q 4JUVA 4BI3A 3DKMA 3MHXA 2K6DA 4NL2A 1BIBA 1AHJB 1BCOA 2YXYA 4DOVA 2JZ2A 4HXJA 5GMKj 4OB1B 4E2FB 3GNGA 4XTZA 4M75C 4L59A 2R58A 1FXXA 2LQKA 3SWNC 1M27C 2X4WA 4J9IA 1VQ7Q 2D8JA 2RHIA 4HCZA 3D7SB 1Y0MA 4KGZB 4CC4B 2KRNA 4M7DC 4A4GA 3OYIA 5CO7A 3H6ZA 5GAOp 3HSBA 2VGNA 3O8VA 1WLPB 2HSPA 4EMKA 4C8QF 2RA2A 3M4YA 3H0HA 4HA8A 2FYKA 1QCFA 4BDZA 4HCCA 4A4HA 2QEXQ 2QXFA 2EKOA 2FZCB 1Y71A 2RK1A 1KQ2A 1Q95G 3VKIA 1X6GA 2X4XA 5KCHA 3OYFA 3CC4T 1NLPC 3QUIA 1VIFA 2LZ6B 2RHUA 5FROA 2ZCFB 3HRTA 2CREA 3I5SA 1MNDA 5KYYB 2EAYA 4RTTA 2E6ZA 1VQOQ 1YHQQ 4DEYA 2YLBA 3PVLA 2D1XA 5KH6A 1IGUA 2CH4W 1VQ7T 4E7HA 1BB9A 1KSWA 2OAUA 3CBMA 3CQTA 3VS6A 4KUIA 2DLPA 1VQ6A 1GFCA 1MGQA 4BB7A 3CD6Q 1O75A 2DEUA 1DJ7B 2DMOA 1K9MR 4OMFB 3BW1A 2NUPB 4O5VA 2X4JA 4Y91A 5CQYA 3PFSA 2CKKA 4PKCC 4X34A 2KXCA 1MV3A 4KRTA 4DEXA 2Z0WA 4R56A 1NYFA 2P4RA 5GAOn 1ZBJA 3PVQA 4PJOE 4KGXB 2Y4XA 1VQ5Q 3MEUA 3RNJA 3UT1A 4XK8E 2RQTA 3QZ5B 4CI0C 2QA4A 2F5TX 3C95A 5GAOr 2GQIA 2PVGB 1HXDA 2RJCA 1I81A 3H9NA 4Z89A 1E6HA 2M02A 3VUBA 3MP1A 1X2QA 4IIMA 2GGRA 4PFPA 5GMKi 5LJ5j 1X6BA 1KD1U 4JZ3A 4PFZA 3RBBB 1K0XA 2DPPB 2OTJQ 3ZBDA 1H8KA 2XG8D 3JB9H 4IIOA 3QHSA 2HQXA 4M7DG 4M77C 2YLCA 2RJFA 4RUGA 2BKDN 3SDZA 2DL7A 1XOVA 2RQUA 3EH1A 1N9RA 9ATCB 2SEMA 2LC4A 1NG2A 2A3LA 2IIMA 4FW1A 3INZA 4DQ2A 1MNEA 5KYYA 2DBKA 1JRIA 1YIJA 5CR2A 4C5GA 3EG1A 5GAN3 1MUZA 5GAMf 2DO3A 1UB4A 2ROLA 1X75C 3TSZA 1B34B 2DERA 3S3NA 1VQNT 1UUEA 3R6NA 5HK3A 3QBYA 2A7YA 2DKGA 2V8KA 1B3QA 2P0PA 2GTJA 2JS2A 3SWNA 2A36A 1UECA 1QVPA 2JOYA 4JRQA 5IAYA 1VQ8Q 3CCRQ 1JBMA 2AZVA 3VS7A 3ULRB 3JCMQ 2GCXA 3A8MB 5GANe 1QVGA 1R8OB 2D0NA 5GAMd 2PUKB 2L2PA 3OS1A 2FEIA 4JRPA 3JB9G 3PMTA 2RH2A 2RN8A 3MEWA 4WF2A 2AK5A 5GMKe 1QW1A 2RQWA 2LCLA 2DE0X 1OPLA 2MK5A 2FHDA 1M1KR 5CKEA 3OS5A 4Y28E 4B9XA 2CSIA 4AFUC 1AWXA 2EYQA 1NPPA 1W6XA 3EGXA 4M7AC 1VYTA 2PTKA 2LJ0A 4EMGA 2RB6A 5FU7B 2QEXT 3EGXB 3RMSA 2ED1A 1R0BG 2NUPA 2QGFB 1EFNA 2RI3A 1ABOA 2DVJA 2HL5C 2CZ6B 2KSSA 3I56Q 1JQQA 2EGCA 3CCUA 3VS4A 2DTHA 4FM4B 5D6XA 4RCBA 1H641 4DOWA 3CCSA 1LCKA 4BE1A 5LJ5h 1PNJA 1IREB 2WSFE 4NOYA 3ER0A 4HCKA 1TUGB 3VJPA 5IHKA 4C0DB 2GQVA 4JJDA 3FC3A 5GAOq 3C0CA 4GY5A 3CCUQ 4V2SA 4AFSC 1ZSZC 2HQEA 3P8BB 1MMGA 2MI6A 5KYXA 4JPBW 2F5KA 3T9NA 1VQPT 2VV5A 3CBOA 1VYUA 4FCYA 4C92D 5C6SA 1RI9A 3JB9D 4XU3A 2JM9A 4BY6B 1GXIE 4J9DA 4JRKA 3V7CA 1LOJA 2PZ1A 2OX7A 5I11A 4FIBA 1KQ1A 2CP2A 5KYWA 2CT3A 3FJ5A 1QMCA 3NMZC 4OMLA 1HK9A 2VVKA 2KR3A 1SRMA 2P0QA 2HBWA 3BDLA 3TSWA 8AT1B 3LWHA 4C92A 4N4HA 3TQ7P 2HQHA 1PD1A 1Y57A 5A0DA 1WPYA 4KULA 3G71A 1B07A 1WJRA 2EGAA 3M55A 4AG2C 5CKFA 3HFNA 1JO8A 3V8LA 2RK2A 3CMEQ 1W2BA 1VQMT 1VQKQ 2JMAA 1H3ZA 1KQSP 5I21A 4X9DA 3CCQT 4OP0A 3SFMA 3OYEA 1ZLMA 3A1PA 2RMOA 4PJOA 1QP3A 5GANf 4OF1A 4PJOB 2C0OA 3IQLA 1YI2A 3OS2A 2WSCE 4CC7A 4UC4A 4C8QA 3JSCA 1AD5A 1PG5B 2KQWA 5GMKl 3NTHA 1VA7A 2F2XA 2JMCA 2QA4T 1OZ2A 2K7AA 3G4SQ 2GFAA 3RKWA 2KNBB 1X69A 2EQIA 2DEQA 2BE9B 4BE2A 4HT9A 2F69A 1JJ2A 3CMET 1U5SA 4PK4A 3ZEHA 2A08A 2HL3A 4QVCA 5IHIA 3JCMh 2QQRA 1NEBA 5KYXB 2DTIA 3CPFA 3O5ZA 2H8HA 2QDLA 4ORZA 2KT1A 1LNXA 2EJGA 2KDSA 3CC7Q 2PVOB 3TREA 3E9GA 2GF7A 3RIRA 2O9VA 1PWTA 4PJNA 2D8HA 2E65A 3G1JA 4J6YA 1VQ8A 2KYMA 2P84A 1MMNA 1KD1R 1UDLA 3PIPA 4VUBA 4RKUE 2YDLA 1WJQA 3TCJA 3CPWS 4B9WA 3RKXA 4F04B 1N8RC 1SF9A 2QA4Q 2ED0A 3CC2T 1AWJA 2O01E 3X26B 2MF2A 2CZ7B 4F16A 4FYWB 2L3SA 3QDFA 1M1KU 3A8GB 3M4GA 2IG0A 2O4XB 3C12A 1VIEA 4JLGA 1Q81U 5ECAA 4CC3A 1RAEB 4KBMB 4BUGA 4LDXA 2A0FB 4LDWA 4N0AA 3M0QA 3CCRT 3G7ZA 1M5Q1 1RAHB 1NE8A 1SPKA 2AZSA 3M0TA 3RMQA 3I55Q 3X24B 4OB2B 2C06A 1PSEA 2DIQA 2LQ8A 1D09B 4HT8A 3HFOA 1WXUA 2BZ8A 5HKCA 1NYGA 3CC7A 3DB3A 1M30A 4M7AE 2CDTA 1WYXA 2XI9A 4AMCA 2DRMA 3CCST 3QWYA 1IZ6A 2RD1A 1KHIA 1VUBA 3QKJA 1JEGA 2B8AA 4FSSA 1NM7A 1Y96A 1VQ9A 3GLXA 5LJ3g 1W70A 2AKLA 3JCMX 5LJ3e 3OW2A 2DZ9A 2KAFA 3EGDA 2F2VA 4E7IA 1QCNA 3I55T 3KUFA 2EYYA 2QTVA 3PGGA 4KUDK 4F7UA 4DBQA 3OYNA 2FRYA 2V8JA 1W2BS 2LNHB 3PNWC 2DBMA 4PJMA 2CS7A 2E4HA 5CK9A 4F7UF 1YJ9A 1VQ9Q 1VQ5A 1CKAA 4OGCA 3L2UA 5FLXE 3REBB 3CCUT 3VS3A 3ZL7C 1N5ZA 1CSKA 2MMPA 3GBQA 5IT9E 3QYHB 5KYUB 2DXBA 4KT0E 5FRMA 3JRZA 2BE7D 2L3RA 3CXCS 4C0GA 4IUVA 2CP7A 3MP6A 3EFRA 3G71Q 3J81E 3NTKA 1RAGB 2LCCA 4MMKA 1WXTA 2M51A 1QLYA 3P8DA 2DRKA 2LQWA 4HCBA 2DAQA 1EX4A 3MP8A 4F7UG 2FZKB 3VRZA 4ME7A 2A28A 5AYFA 3JCMf 2JS0A 1I5OB 1QVGS 1RACB 1IHVA 2MCNA 2ECZA 2ESWA 2XIDA 2L0AA 2YRVA 1ZHIA 1W1FA 2EGEA 4JRIA 2HKNA 1GCQC 4P5NA 2X9HA 2KYBA 5FU6C 2BTTA 2O2OA 5GAN2 2HCKA 3RDVA 2DA9A 2M1HA 2OTJT 2NWMA 2FB7A 3CD6A 1PC0A 1W4SA 1WGSA 1U06A 1IGQA 4KGVB 3UA7A 3NTIA 4EIKA 3CCJQ 1UGPB 2VYTA 4PLIA 4WTOB 2JUFA 1MMDA 3WXMB 1AZGB 2HSEB 1BBZA 3HRSA 2E12A 4M77F 2MWPA 1AEYA 1SG5A 4M77G 1B34A 5IH2A 2E1HA 3JCMV 3RUXA 2LCSA 4QQGA 5GAN8 5CKBA 3OBYA 5GANj 1IB8A 3CXCP 2DJZA 1K9AA 3CMAA 2X3WD 2NLUA 4E47A 2JT4A 4F14A 1RI0A 2DILA 1WDXA 1U1SA 2XU8A 4MDWA 1WXBA 4IUQA 3NGPA 2CUDA 1WHHA 1PRMC 1V76A 4RTZA 1KG1A 4D6WA 1M1FA 1PHTA 1V1CA 5J3BA 3LYIA 1VQ7A 1U8RA 2NUZA 5LJ3d 4M78F 1BIAA 4ZN3A 2EIFA 4M77B 3EFOB 4RTWA 2XHCA 3V7SA 3ZFJA 1VYVA 1K0SA 3CCMA 1ARKA 1UGSB 1M2OA 4MZMA 5AT1B 5L8RE 3EFSA 3VYGA 3QWXX 4ZN1A 1MHNA 3E19A 4J6XA 1PKTA 1D0ZA 2JM8A 3CCRA 1WQWA 4N4IA 1UG1A 4BI8B 3M57A 2LP5A 4RG2A 2HNIA 1N8RU 2JW4A 1M90R 2ABLA 3PT9A 3LW5E 3U23A 1YHQA 2M0YA 2K4YA 5GANg 1M90U 1QWEA 1UJ0A 1VQ6T 1G3WA 3EG9A 3A5ZB 2ZPIB 1VQ4T 4BE0A 3G4ST 2VWFA 3X28B 5KYWB 4Y92A 2GNCA 4Z02A 4IUPA 3THKA 2B86A 4JJCA 5GAMe 3S3OA 1K73R 1M3BA 2P0KA 3QZ9B 4ZGEB 1T0JA 2KROA 1K73C 4C92B 1TG0A 1JU5C 4C92C 4RTYA 3C4SA 1M9SA 2HZYA 2HEQA 3VS0A 2VXFA 4XTUA 3WVDB 3X25B 1S72Q 4QQ6A 4XQ3A 1M1KC 1SHGA 7AT1B 2J7IA 4J9BA 2G6FX 3VS1A 2EQUA 4LUEA 4AFQC 3EG0A 5GAN6 1GBRA 5GAMj 4II1A 3NPFA 3HL8A 3GOXA 2OAWA 3ASKA 4BI4A 5GJWB 2ZPEB 2PNIA 4A53A 3L2WA 3FDRA 4F17A 2LJ1A 2YUQA 1I0CA 1YP5A 3OA6A 3RKYA 4E7JA 3ME9A 2LQNA 5GJVB 2ZGWA 4QVZA 4QVDA 3S6WA 3OYBA 4ZTFA 5J26A 4XTVA 2A37A 2EKHA 1NPRA 1Q86R 3L1AA 2CP0A 1YJ9T 2KRSA 1XJWB 1AWOA 1AWWA 1ZA2B 3SHWA 8ATCB 1KQSS 4LUDA 4MZTA 3G6ET 2YRCA 2MYSA 2CGHA 2GTOA 1TH7A 1M2VB 2W10A 2ZPHB 1VQNA 2E5QA 2JXBA 2X4YA 1M1GA 1ZQ1A 5LJ5d 2O88A 5D6WA 3OYDA 4RTVA 3A8LB 1K4US 1YFNA 2VASA 1Q86C 1KC8C 1BU1A 4JZ4A 1D1CA 1QP2A 4LDUA 5CVIA 1RL2A 2XMFA 5GAN5 3JCMW 1P92A 2ZPBB 2D9TA 4KH0B 2AKKA 1C6VX 2KEAA 4C5EA 2LDMA 1N9SA 2E41A 3OYYA 2L89A 1D3BB 1RAAB 2PUOB 5LJ5f 3RERA 2DFUA 1YNZA 5KYNA 1SSHA 2QQ9A 2FPFA 1VQ4A 2O31A 2EPDA 5GAN7 4PJOG 3JCMe 2IPOB 1IO6A 2EYZA 3AT1B 5FW9A 1Q7YR 1X2KA 2KMTA 1Y96B 1FX7A 2DXCA 1LVKA 4M78E 1QKXA 2RQRA 2HBPA 4RCCA 2JTFA 3CCMT 3I56A 1G3SA 3PMIA 2DJQA 3M0UA 4BD3A 4KH1B 1X27A 3TEEA 5J39A 2RO0A 1QWFA 2QEXA 3OSVA 3C94A 3FJPA 2CH4A 1LJOA 3GF5A 2HKQB 3JB9J 5DM7R 4HVWA 3OW2P 4M7AG 1OV3A 3E1SA 3V8JA 1AOJA 1K8AR 1H3HA 3CCQQ 1ZUUA 3SEMA 3DLLA 3CCJA 1GL5A 2P4TA 3CPWA 2V26A 3HKSA 3PIOA 4M77A 4OMQA 4ZGJB 2EYXA 5IHNA 1TSFA 1TS9A 2E5KA 1SRLA 4C8QC 1OU9A 5M9OA 5GAMh 2C0IA 3CCQA 3QJYA 1W2BP 3OMGA 1WFWA 1XQHA 1E7OA 3EGDB 1VQ6Q 2DL5A 1TXQA 4FYXB 1PRLC 1WA7A 2EFIA 2K5IA 4FSXA 4ZTJA 4LN2A 1OPKA 3QDRB 2RHYA 4C8QD 1WHKA 1N8RR 3OYKA 2DVEA 2KBTA 5GAOm 2BZXA 1GCPA 3OYLA 1OYXA 1TU0B 2KXDA 1S72T 4E7ZA 5IXBA 1YJWT 1NLOC 1MV0B 2L8DA 1Z9QA 3CCVA 2X51A 1YWOA 5FRNA 1TWBA 3VS5A 1YCYA 5EC7A 1UHFA 1QCOA 3QPHA 4M77E 1D0XA 3MEAA 1QVGP 1VQ4Q 3G71T 2DL3A 2RJEA 3GP8A 1X01A 1YITT 2J06A 4OMPA 1KC8U 4FYVB 2MPXC 3CCVQ 5D6YA 1JXMA 3M54A 5HK0A 2YSQA 1G2BA 4EMKC 5A0GA 3LGFA 2AIRB 4Q5WA 3BY7A 1KIKA 1I5LA 2FG0A 3P8HA 3PTAA 1PM3A 2LJ3A 2DYIA 4QW2A 3CBPA 4E7SA 3JB9I 3A8HB 3FIFA 3JCMc 3CCEQ 4IUTA 1K8AC 5A0LA 3EG2A 2K5LA 4M7AA 3M9QA 3WVEB 1R77A 4IUUA 2LTOA 4CRIA 2L5QA 1O9SA 1TOVA 3QSUA 1BKBA 2CP3A 2EQJA 3TU4K 1I4K1 1SEMA 1UGRB 2FPDA 2PVDB 3JV3A 2WSEE 3G6EQ 1EIFA 3CMEA 4XU1A 3A98A 2M0OA 1UJYA 4X1VA 1G5VA 4A54A 1AVZC 1YI2T 4A4FA 1QVFS 2DYBA 1Q82U 4GBQA 1GBQA 1YBYA 2LMJA 4M7DA 2FO0A 1HYOA 2RQVA 2M16A 3G6EA 4M78G 3SD4A 3JCMJ 3JCMP 2RPNA 2SRCA 2LT4A 3UPUA 4EMKB 3LGLA 3SB2A 3UF4A 2OTLT 5GAOl 2XDDA 1D1AA 4OB0B 4L5GA 1VQOA 1M8VA 1GRIA 1A0NB 2DX1A 4M7DF 2CP5A 2QQBA 4GLMA 5KE3A 1T3LA 2F1LA 2CZ0B 3URGA 4C0FA 3QXEB 2V1QA 3OMCA 1SHFA 2O4XA 1R0CB 4EDUA 4C0ZA 3KXTA 1Q82R 2QTXA 1VQ8T 3M53A 3CCEA 2HMAA 2W0ZA 2CUBA 1WI7A 4J83A 2VC8A 1B7TA 2YUPA 1BCMA 1X6OA 1C0MA 2YHTA 4J9GA 1NJIR 2K3YA 2H3EB 1NEGA 4ELZC 4QQDA 2J6KA 1I1JA 5I2SA 1D3BA 2MWOA 2CYZB 2NYSA 3CC7T 4M7DD 2LRQA 4IURA 3M5AA 2R5AA 3Q1JA 3VRYA 3OB9A 4QKUA 1JB0E 4R0KA 1BK2A 5LJ3h 1D1BA 3AHUA 1NBEB 5DLOA 4O6JA 3EHQA 2R5MA 1N27A 1VOMA 1YJNA 5LJ3f 1QVFP 2R57A 4BY6C 3EFOA 2QG9B 3J80E 3EG3A 2CP6A 3E9FA 3R6OA 4MDXA 5KE2A 4JS4A 4M7DE 3REAB 1OQKA 1M8MA 1UEBA 1VQNQ 3BDUA 4C8QG 1YJNQ 2MAMA 4RG8A 1U1TA 2M9UA 4MMLA 3L42A 1ACMB 4RMOA 3M58A 2K2MA 5KYUA 5LJ5g 4E7LA 2XK0A 4ATOA 2DIGA 1HSQA 4IKFA 1K8AU 1G3YA 4DBFA 2JTEA 1VQLT 3OW2S 4BDYA 4PJLA 1CKBA 3I55A 2VGMA 2COZA 4LDYA 2RHZA 3HHTB 1G83A 2V8IA 4CC2A 2VKNA 4C0DC 1BI3A 2K3XA 3CCSQ 2FVUA 1JJ2P 3L2QA 3QG1A 3H0FA 5FWBA 4E6RA 4QT7A 2PQWA 3CD6T 2DK3A 2MOXA 3MPUB 2DD5A 5I2MA 2KRMA 3F70A 1KQSA 1QVFA 2EW3A 2DZCA 3OSSC 3FB9A 1TTHB 2EBPA 3OQ5A 1AT1B 3L2VA 2J6OA 3L2ZA 4J9FA 1NZ9A 2J05A 1WHLA 2HAXA 3NHNA 3FLGA 1WHMA 4HVVA 2GBQA 2DNUA 1OI1A 4LE9A 4OB3B 3OY9A 2Y90A 2EQMA 1RADB 4XTWA 4XU0A 2QI2A 4JDSA 2AT1B 1PCXA 3MEVA 6AT1B 1K9MC 2YUOA 1KC8R 1QQJA 2K2VA 5D7UA 2WACA 1TUCA 1XTDA 2ZZDA 1YJ9Q 2D6FA 4OMMA 5CIUA 2EVRA 3OYHA 2KGTA 3MCAB 1G8XA 1JJ2S 4FU6A 2OTLA 2IVWA
chains in the Genus database with same CATH topology
1WIEA 1YNZA 2ED0A 1RLPC 1S1NA 1AWJA 4HXJA 1SSHA 2FPFA 4F16A 2L3SA 2O31A 2EPDA 2KT8A 1M27C 1IO6A 1M3AA 2EYZA 2RNAA 4J9IA 2D8JA 4AG1C 5IXFA 5ECAA 5FW9A 1X2KA 1Y0MA 4CC4B 4CC3A 2KRNA 2DF6A 1GCQA 3M0QA 3LH5A 1UHCA 1WLPB 2KE9A 1SPKA 2AZSA 2HSPA 3M0TA 4Z8AA 1QKXA 2RQRA 1ZUKA 3H0HA 1H92A 1QCFA 1ZUYA 2DJQA 3M0UA 3UA6A 1X27A 1FYNA 4ESRA 1X6GA 1QWFA 1WXUA 2BZ8A 1NYGA 1NLPC 1J3TA 2CH4A 4K11A 2LZ6B 4WCIA 2CT4A 1M30A 4A63B 4HVWA 2CREA 3I5SA 1OV3A 2CDTA 4J9CA 1AOJA 1WYXA 1HJDA 4RTTA 4JJBA 1H3HA 1ZUUA 4DEYA 1YCSB 2DRMA 3PVLA 2D1XA 3QWYA 3I35A 3SEMA 2CH4W 1JEGA 3I5RA 1GL5A 4FSSA 1BB9A 1NM7A 1KSWA 3VS6A 3CQTA 2DLPA 1GFCA 1W70A 2AKLA 4OMQA 2EYXA 5IHNA 2F2VA 2E5KA 1SRLA 2DMOA 2EYYA 2FRYA 4J9HA 2LNHB 2C0IA 5I22A 2DBMA 1WFWA 1E7OA 1WX6A 2KXCA 2DL5A 1MV3A 4KRTA 1U3OA 4DEXA 1CKAA 1NYFA 3H41A 2P4RA 1PRLC 1WA7A 3REBB 1ZBJA 2LX7A 3PVQA 3VS3A 3ZL7C 1N5ZA 1CSKA 2BZYA 3GBQA 4LN2A 3RNJA 1OPKA 2OI3A 2RQTA 2KBTA 1UE9A 2BZXA 1GCPA 2GQIA 2KXDA 5IXBA 1WXTA 1NLOC 2M51A 1MV0B 1QLYA 4Z89A 1E6HA 1M3CA 2DRKA 2OJ2A 1Z9QA 2LQWA 1YWOA 1X2QA 3VS5A 4IIMA 5EC7A 3VRZA 1UHFA 4RTUA 2A28A 2RF0A 2GGRA 2K9GA 2JS0A 1X6BA 4JZ3A 3M0SA 3RBBB 2DL3A 1K0XA 1FMKA 1H8KA 2DL4A 2ROTA 4IIOA 2MCNA 2ECZA 2ESWA 2J06A 4OMPA 1GFDA 2L0AA 1W1FA 2EGEA 1HD3A 4RUGA 1JXMA 1GCQC 2DL7A 2KYBA 2BTTA 2O2OA 1G2BA 1XOVA 2RQUA 2YSQA 2HCKA 1KIKA 2DA9A 2FG0A 2SEMA 2LJ3A 3KFVA 1NG2A 2IIMA 2V1RA 2NWMA 2DBKA 1RUWA 1UFFA 3EG2A 1U06A 1I07A 3UA7A 4EIKA 3EG1A 1MUZA 2ROLA 4Z88A 3TSZA 1AZGB 4LNPA 1BBZA 1UUEA 3R6NA 1SEMA 1AEYA 1UGVA 2FPDA 3JV3A 3A98A 5IH2A 1UJYA 1B3QA 2GTJA 4X1VA 2JS2A 2LCSA 2FRWA 1AVZC 4OMOA 2A36A 1UECA 1K9AA 2DYBA 2AZVA 2X3WD 4GBQA 3VS7A 1GBQA 3ULRB 2LMJA 2JT4A 4F14A 2FO0A 2RQVA 2DILA 1WDXA 2YUNA 2D0NA 1WXBA 2L2PA 3NGPA 2CUDA 1PRMC 4RTZA 2FEIA 2RPNA 2SRCA 1T3SA 1PHTA 1KJWA 2RN8A 1V1CA 3UF4A 3VS2A 2NUZA 1ZX6A 2AK5A 3EHRA 2RQWA 1JXOA 1GRIA 2DE0X 1OPLA 4RTWA 1A0NB 2DX1A 1VYVA 1K0SA 1ARKA 2CSIA 2YT6A 4AFUC 1AWXA 1ABQA 1W6XA 4GLMA 1VYTA 2PTKA 2LJ0A 1T3LA 3QWXX 2ED1A 1PKTA 2V1QA 2JM8A 1SHFA 1EFNA 2FPEA 1ABOA 2DVJA 1UG1A 2LP5A 1JQQA 2EGCA 2W0ZA 2HDAA 2CUBA 1WI7A 2JW4A 3VS4A 2ABLA 1RLQC 3U23A 4D8DA 1QKWA 1LCKA 2YUPA 4HVUA 3PE0A 1TUDA 4J9GA 1PNJA 2M0YA 1NEGA 1QWEA 2J6KA 1UJ0A 1I1JA 4HCKA 5IHKA 2DL8A 2VWFA 2MIOA 4JJDA 3C0CA 4Y92A 4M4ZA 2GNCA 4AFSC 2EYWA 3THKA 2B86A 4JJCA 4RTXA 2L3PA 4J9EA 1M3BA 3VRYA 4ZNXA 4JPBW 4R0KA 2K79A 1BK2A 1T0JA 1VYUA 2KROA 1TG0A 1JU5C 4RTYA 3EHQA 2HEQA 2I0NA 3VS0A 2C0TA 1RI9A 2JM9A 3EG3A 1OEBA 4J9DA 3H0IA 1SHGA 2PZ1A 2J7IA 4J9BA 2G6FX 3VS1A 5I11A 4LUEA 3REAB 4AFQC 3EG0A 1M8MA 1GBRA 3NPFA 2CT3A 3FJ5A 3NMZC 4OMLA 2OAWA 2VVKA 1KFZA 2KR3A 1SRMA 2HBWA 5GJWB 3TSWA 2CSQA 2PNIA 2F2WA 4AFZC 1PKSA 2K2MA 2LJ1A 4F17A 2YUQA 5L23A 1I0CA 1Y57A 1YWPA 1YP5A 1HSQA 2LQNA 5GJVB 1B07A 2EGAA 2JTEA 4AG2C 1JO8A 2X3XD 1CKBA 1OOTA 2JMAA 2ENMA 1AZEA 1G83A 2K3BA 3EGUA 2A37A 5HCKA 4CC2A 1ZLMA 2EKHA 2VKNA 2RMOA 2KRSA 1AWOA 3H0FA 1AWWA 5FWBA 4E6RA 2C0OA 3IQLA 4QT7A 3SHWA 4CC7A 2MOXA 3M0RA 2J6FA 1ZSGA 2KRMA 2EW3A 4LUDA 1YN8A 1AD5A 4OMNA 1K76A 2EBPA 1VA7A 2F2XA 2JMCA 2K7AA 2GTOA 3TVTA 1T0HA 2J6OA 4J9FA 2KNBB 1X69A 2J05A 2W10A 5FWCA 4D8KA 2L3QA 1K1ZA 2EQIA 3NHNA 1UTIA 2JXBA 4HVVA 2GBQA 2DNUA 4LE9A 1U5SA 2O88A 4RTVA 2A08A 1X43A 5IHIA 1NEBA 1K4US 3O5ZA 2H8HA 2QDLA 4ORZA 2KT1A 1BU1A 1Z9ZA 2YUOA 4JZ4A 2O9SA 1E6GA 3M0PA 2O9VA 3UATA 1PWTA 1TUCA 3I9QA 2D8HA 2XMFA 4OMMA 2EVRA 2DM1A 2KYMA 2KGTA 2AKKA 1UDLA 2KEAA 2YDLA 2K6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIE A;  1YNZ A;  2ED0 A;  1RLP C;  1S1N A;  1AWJ A;  4HXJ A;  1SSH A;  2FPF A;  4F16 A;  2L3S A;  2O31 A;  2EPD A;  2KT8 A;  1M27 C;  1IO6 A;  1M3A A;  2EYZ A;  2RNA A;  4J9I A;  2D8J A;  4AG1 C;  5IXF A;  5ECA A;  5FW9 A;  1X2K A;  1Y0M A;  4CC4 B;  4CC3 A;  2KRN A;  2DF6 A;  1GCQ A;  3M0Q A;  3LH5 A;  1UHC A;  1WLP B;  2KE9 A;  1SPK A;  2AZS A;  2HSP A;  3M0T A;  4Z8A A;  1QKX A;  2RQR A;  1ZUK A;  3H0H A;  1H92 A;  1QCF A;  1ZUY A;  2DJQ A;  3M0U A;  3UA6 A;  1X27 A;  1FYN A;  4ESR A;  1X6G A;  1QWF A;  1WXU A;  2BZ8 A;  1NYG A;  1NLP C;  1J3T A;  2CH4 A;  4K11 A;  2LZ6 B;  4WCI A;  2CT4 A;  1M30 A;  4A63 B;  4HVW A;  2CRE A;  3I5S A;  1OV3 A;  2CDT A;  4J9C A;  1AOJ A;  1WYX A;  1HJD A;  4RTT A;  4JJB A;  1H3H A;  1ZUU A;  4DEY A;  1YCS B;  2DRM A;  3PVL A;  2D1X A;  3QWY A;  3I35 A;  3SEM A;  2CH4 W;  1JEG A;  3I5R A;  1GL5 A;  4FSS A;  1BB9 A;  1NM7 A;  1KSW A;  3VS6 A;  3CQT A;  2DLP A;  1GFC A;  1W70 A;  2AKL A;  4OMQ A;  2EYX A;  5IHN A;  2F2V A;  2E5K A;  1SRL A;  2DMO A;  2EYY A;  2FRY A;  4J9H A;  2LNH B;  2C0I A;  5I22 A;  2DBM A;  1WFW A;  1E7O A;  1WX6 A;  2KXC A;  2DL5 A;  1MV3 A;  4KRT A;  1U3O A;  4DEX A;  1CKA A;  1NYF A;  3H41 A;  2P4R A;  1PRL C;  1WA7 A;  3REB B;  1ZBJ A;  2LX7 A;  3PVQ A;  3VS3 A;  3ZL7 C;  1N5Z A;  1CSK A;  2BZY A;  3GBQ A;  4LN2 A;  3RNJ A;  1OPK A;  2OI3 A;  2RQT A;  2KBT A;  1UE9 A;  2BZX A;  1GCP A;  2GQI A;  2KXD A;  5IXB A;  1WXT A;  1NLO C;  2M51 A;  1MV0 B;  1QLY A;  4Z89 A;  1E6H A;  1M3C A;  2DRK A;  2OJ2 A;  1Z9Q A;  2LQW A;  1YWO A;  1X2Q A;  3VS5 A;  4IIM A;  5EC7 A;  3VRZ A;  1UHF A;  4RTU A;  2A28 A;  2RF0 A;  2GGR A;  2K9G A;  2JS0 A;  1X6B A;  4JZ3 A;  3M0S A;  3RBB B;  2DL3 A;  1K0X A;  1FMK A;  1H8K A;  2DL4 A;  2ROT A;  4IIO A;  2MCN A;  2ECZ A;  2ESW A;  2J06 A;  4OMP A;  1GFD A;  2L0A A;  1W1F A;  2EGE A;  1HD3 A;  4RUG A;  1JXM A;  1GCQ C;  2DL7 A;  2KYB A;  2BTT A;  2O2O A;  1G2B A;  1XOV A;  2RQU A;  2YSQ A;  2HCK A;  1KIK A;  2DA9 A;  2FG0 A;  2SEM A;  2LJ3 A;  3KFV A;  1NG2 A;  2IIM A;  2V1R A;  2NWM A;  2DBK A;  1RUW A;  1UFF A;  3EG2 A;  1U06 A;  1I07 A;  3UA7 A;  4EIK A;  3EG1 A;  1MUZ A;  2ROL A;  4Z88 A;  3TSZ A;  1AZG B;  4LNP A;  1BBZ A;  1UUE A;  3R6N A;  1SEM A;  1AEY A;  1UGV A;  2FPD A;  3JV3 A;  3A98 A;  5IH2 A;  1UJY A;  1B3Q A;  2GTJ A;  4X1V A;  2JS2 A;  2LCS A;  2FRW A;  1AVZ C;  4OMO A;  2A36 A;  1UEC A;  1K9A A;  2DYB A;  2AZV A;  2X3W D;  4GBQ A;  3VS7 A;  1GBQ A;  3ULR B;  2LMJ A;  2JT4 A;  4F14 A;  2FO0 A;  2RQV A;  2DIL A;  1WDX A;  2YUN A;  2D0N A;  1WXB A;  2L2P A;  3NGP A;  2CUD A;  1PRM C;  4RTZ A;  2FEI A;  2RPN A;  2SRC A;  1T3S A;  1PHT A;  1KJW A;  2RN8 A;  1V1C A;  3UF4 A;  3VS2 A;  2NUZ A;  1ZX6 A;  2AK5 A;  3EHR A;  2RQW A;  1JXO A;  1GRI A;  2DE0 X;  1OPL A;  4RTW A;  1A0N B;  2DX1 A;  1VYV A;  1K0S A;  1ARK A;  2CSI A;  2YT6 A;  4AFU C;  1AWX A;  1ABQ A;  1W6X A;  4GLM A;  1VYT A;  2PTK A;  2LJ0 A;  1T3L A;  3QWX X;  2ED1 A;  1PKT A;  2V1Q A;  2JM8 A;  1SHF A;  1EFN A;  2FPE A;  1ABO A;  2DVJ A;  1UG1 A;  2LP5 A;  1JQQ A;  2EGC A;  2W0Z A;  2HDA A;  2CUB A;  1WI7 A;  2JW4 A;  3VS4 A;  2ABL A;  1RLQ C;  3U23 A;  4D8D A;  1QKW A;  1LCK A;  2YUP A;  4HVU A;  3PE0 A;  1TUD A;  4J9G A;  1PNJ A;  2M0Y A;  1NEG A;  1QWE A;  2J6K A;  1UJ0 A;  1I1J A;  4HCK A;  5IHK A;  2DL8 A;  2VWF A;  2MIO A;  4JJD A;  3C0C A;  4Y92 A;  4M4Z A;  2GNC A;  4AFS C;  2EYW A;  3THK A;  2B86 A;  4JJC A;  4RTX A;  2L3P A;  4J9E A;  1M3B A;  3VRY A;  4ZNX A;  4JPB W;  4R0K A;  2K79 A;  1BK2 A;  1T0J A;  1VYU A;  2KRO A;  1TG0 A;  1JU5 C;  4RTY A;  3EHQ A;  2HEQ A;  2I0N A;  3VS0 A;  2C0T A;  1RI9 A;  2JM9 A;  3EG3 A;  1OEB A;  4J9D A;  3H0I A;  1SHG A;  2PZ1 A;  2J7I A;  4J9B A;  2G6F X;  3VS1 A;  5I11 A;  4LUE A;  3REA B;  4AFQ C;  3EG0 A;  1M8M A;  1GBR A;  3NPF A;  2CT3 A;  3FJ5 A;  3NMZ C;  4OML A;  2OAW A;  2VVK A;  1KFZ A;  2KR3 A;  1SRM A;  2HBW A;  5GJW B;  3TSW A;  2CSQ A;  2PNI A;  2F2W A;  4AFZ C;  1PKS A;  2K2M A;  2LJ1 A;  4F17 A;  2YUQ A;  5L23 A;  1I0C A;  1Y57 A;  1YWP A;  1YP5 A;  1HSQ A;  2LQN A;  5GJV B;  1B07 A;  2EGA A;  2JTE A;  4AG2 C;  1JO8 A;  2X3X D;  1CKB A;  1OOT A;  2JMA A;  2ENM A;  1AZE A;  1G83 A;  2K3B A;  3EGU A;  2A37 A;  5HCK A;  4CC2 A;  1ZLM A;  2EKH A;  2VKN A;  2RMO A;  2KRS A;  1AWO A;  3H0F A;  1AWW A;  5FWB A;  4E6R A;  2C0O A;  3IQL A;  4QT7 A;  3SHW A;  4CC7 A;  2MOX A;  3M0R A;  2J6F A;  1ZSG A;  2KRM A;  2EW3 A;  4LUD A;  1YN8 A;  1AD5 A;  4OMN A;  1K76 A;  2EBP A;  1VA7 A;  2F2X A;  2JMC A;  2K7A A;  2GTO A;  3TVT A;  1T0H A;  2J6O A;  4J9F A;  2KNB B;  1X69 A;  2J05 A;  2W10 A;  5FWC A;  4D8K A;  2L3Q A;  1K1Z A;  2EQI A;  3NHN A;  1UTI A;  2JXB A;  4HVV A;  2GBQ A;  2DNU A;  4LE9 A;  1U5S A;  2O88 A;  4RTV A;  2A08 A;  1X43 A;  5IHI A;  1NEB A;  1K4U S;  3O5Z A;  2H8H A;  2QDL A;  4ORZ A;  2KT1 A;  1BU1 A;  1Z9Z A;  2YUO A;  4JZ4 A;  2O9S A;  1E6G A;  3M0P A;  2O9V A;  3UAT A;  1PWT A;  1TUC A;  3I9Q A;  2D8H A;  2XMF A;  4OMM A;  2EVR A;  2DM1 A;  2KYM A;  2KGT A;  2AKK A;  1UDL A;  2KEA A;  2YDL A;  2K6D A; 
#chains in the Genus database with same CATH topology
 1WIE A;  1BI0 A;  4C92 G;  3UWN A;  1RLP C;  1S1N A;  1VQO T;  3JCM b;  3CMA T;  2RI5 A;  2HD0 A;  3UDC A;  2EQK A;  1UGQ B;  2KT8 A;  3RES A;  5EG2 A;  5C0M A;  1M3A A;  1RAF B;  2RNA A;  4AG1 C;  2KI7 A;  5IXF A;  4R55 A;  4J7I A;  4JJN K;  4M7A B;  2DF6 A;  1GCQ A;  1FMW A;  3LH5 A;  1UHC A;  3HPW A;  2KE9 A;  4J5Y A;  1ZA1 B;  1YIJ Q;  3LLR A;  4PFO A;  3CCL Q;  4OGE A;  4Z8A A;  2KY9 A;  1ZUK A;  2QYZ A;  3CCE T;  1H92 A;  2EJF A;  2XIC A;  5GAN d;  4PLL A;  3LX7 A;  2ATC B;  3NFC A;  5CQX A;  1ZUY A;  4NS5 A;  1YHQ T;  1M90 C;  3UA6 A;  2ZPF B;  3JCM g;  1FYN A;  4ESR A;  1NJI U;  4DBH A;  2DD4 A;  4EPC A;  4NL3 A;  1J3T A;  3A8O B;  3OYM A;  1IRX A;  4M75 E;  3QO3 A;  4K11 A;  4WCI A;  2CZ1 B;  2CT4 A;  1SKU B;  4A63 B;  3JAM E;  4N4G A;  4J9C A;  1HJD A;  3HP9 A;  4JJB A;  4M7D B;  1YCS B;  1WQ7 A;  3I35 A;  4M75 G;  1IXD A;  3JB9 F;  3I5R A;  2EJ9 A;  1WJS A;  2QK0 A;  2LX9 A;  3QYG B;  5GMK m;  5FU6 B;  3N5B B;  3G4S A;  2LVM A;  2DXT A;  3BE3 A;  4PL6 A;  2LNV A;  4FL6 A;  4M78 B;  4J9H A;  1WZO A;  5I22 A;  3V8K A;  3HTR A;  1WX6 A;  1Q7Y C;  4J6W A;  1VQP A;  1U3O A;  3H41 A;  1BYM A;  2RJD A;  2LX7 A;  2QQS A;  3JCM d;  2BZY A;  5CKD A;  2JTM A;  3M59 A;  4C5H A;  1Q86 U;  5LJ3 j;  2OI3 A;  1Q81 C;  3V7R A;  4C92 E;  4XTY A;  4M75 D;  4FYY B;  1UE9 A;  1VQL A;  2DTO A;  3BFM A;  4XTX A;  5A2Q E;  1VQM A;  1G3T A;  5DY9 A;  4PNO A;  2DET A;  1M3C A;  2FZG B;  2OJ2 A;  1RAB B;  1RAI B;  4TVR A;  3LH0 A;  4B6M A;  4RTU A;  2RF0 A;  2K9G A;  3OYA A;  2YWW A;  3M0S A;  1YJN T;  4DA4 A;  1FMK A;  4C5I A;  2DL4 A;  1LPL A;  2ROT A;  5CAI A;  3CXC A;  5LJ5 e;  4XAX B;  1GFD A;  2KVQ G;  4M75 A;  3VU3 C;  1HD3 A;  1WHJ A;  4N0A C;  4ZGD B;  3CCL T;  3DLM A;  4M75 F;  2E64 A;  4LD9 K;  1KK7 A;  1I8F A;  3S3M A;  1VQL Q;  3KBG A;  3KFV A;  3CC2 A;  2V1R A;  4ELY C;  4F7U B;  1IHW A;  2KK4 A;  1RUW A;  1UFF A;  1YIT Q;  3QJ6 A;  3CCM Q;  3CPW P;  1I07 A;  4PJJ A;  5KCO A;  4EMH A;  1BI2 A;  3E2U A;  2H3J A;  3CC4 Q;  5LL6 S;  4Z88 A;  2EWN A;  2E70 A;  4LNP A;  4GLK A;  1VQP Q;  3EG9 B;  5GAN 4;  1UGV A;  5GAM g;  2COW A;  4FW2 A;  3EH2 A;  4F7U E;  1PSF A;  3I56 T;  3DB4 A;  2FRW A;  5GAN h;  3OYG A;  4MZP A;  3FEO A;  3MET A;  1BI1 A;  4OVA A;  2QAZ A;  4OMO A;  3RR6 A;  5CCA A;  1OZ3 A;  1VQK T;  2BIV A;  2YUN A;  3CMA Q;  4C8Q E;  1Q81 R;  2RI2 A;  2JVV A;  2JN0 A;  1T3S A;  4L6V 5;  1KJW A;  3J7A F;  3OS0 A;  1WNL A;  3CCJ T;  2JNG A;  3VS2 A;  4M7A F;  4PJO D;  1ZX6 A;  3EHR A;  2PU9 B;  1JXO A;  2COY A;  3LWI A;  1D0Y A;  4LD6 A;  4AT1 B;  4LXC A;  2YT6 A;  1ABQ A;  1PD0 A;  1FMV A;  4A4K A;  2XDB A;  2VUB A;  3CC2 Q;  4C8Q B;  4M78 A;  2JJ9 A;  3SWN B;  3OYC A;  3M56 A;  2FPE A;  2YRD A;  1MMA A;  1YJW Q;  5HY6 A;  2HDA A;  4DBR A;  1RLQ C;  4D8D A;  1QKW A;  2E10 A;  2QDY B;  4HVU A;  3PE0 A;  1TUD A;  3MO8 A;  2VB6 A;  1XNI A;  4PJO F;  4M7A D;  1NJI C;  2XDP A;  4M77 D;  3EAE A;  2XD0 A;  2ZAE A;  2DL8 A;  4M78 C;  1WHG A;  2MIO A;  2NUT A;  2XKO C;  4M4Z A;  1YJW A;  2RM4 A;  4JLI A;  2K5F A;  4HKE A;  2EYW A;  2VXE A;  4RTX A;  3CCV T;  2L3P A;  4J9E A;  4YTL A;  4ZNX A;  1Y07 A;  3X20 B;  2K79 A;  3H8Z A;  5IN1 A;  2I0N A;  2E3I A;  1FWZ A;  2C0T A;  4X9C A;  1OEB A;  4FT2 A;  1OUL A;  3H0I A;  1K73 U;  3CC4 A;  2DXU A;  2FL7 A;  4M75 B;  3QII A;  4XU2 A;  3MKD A;  1K9M U;  1ZSZ A;  1VQ5 T;  1S72 A;  1ZSZ B;  1KFZ A;  3VUZ A;  3GIB A;  4PJO C;  2CSQ A;  2GFU A;  2F2W A;  5FU7 C;  4E7K A;  3OBW A;  4AFZ C;  1PKS A;  5L23 A;  1OX8 A;  1VQ9 T;  1KHC A;  1YWP A;  4J7F A;  2E3H A;  2QGG A;  2E6N A;  2X3X D;  1OX9 A;  3GNF B;  1OOT A;  2K57 A;  2ENM A;  2BUD A;  2RHX A;  1AZE A;  2AHJ B;  3CEY A;  2K3B A;  2ZPG B;  1EZZ B;  3EGU A;  5HCK A;  2X35 A;  1V29 B;  4JS5 A;  4J8O A;  2OTL Q;  2Y4Y A;  2OTJ A;  3M0R A;  2J6F A;  3OYJ A;  1ZSG A;  3VYH B;  1VQM Q;  2D0Q B;  1YIT A;  1VQK A;  4ANJ A;  1YN8 A;  4OMN A;  2QAS A;  5CKH A;  1K76 A;  4C92 F;  4M78 D;  4LDV A;  3GPL A;  3TVT A;  1T0H A;  3CCL A;  5FWC A;  4D8K A;  2L3Q A;  1K1Z A;  1Q7Y U;  2QQA A;  1OU8 A;  2NUT B;  1SSF A;  1UTI A;  1ZBX A;  3VV0 A;  1YIJ T;  3FRN A;  5GMK h;  2LT1 A;  2I2L A;  1Q82 C;  1X43 A;  3L2R A;  4BAC A;  1Y7X A;  1F1B B;  1Z9Z A;  2G3R A;  4FT4 A;  4A4E A;  1C1A A;  2O9S A;  3HRU A;  1E6G A;  3M0P A;  3UAT A;  1M2V A;  1KD1 C;  3I9Q A;  3MJX A;  5DLQ E;  1N6A A;  2DM1 A;  1M4Z A;  1YI2 Q;  4JUV A;  4BI3 A;  3DKM A;  3MHX A;  2K6D A;  4NL2 A;  1BIB A;  1AHJ B;  1BCO A;  2YXY A;  4DOV A;  2JZ2 A;  4HXJ A;  5GMK j;  4OB1 B;  4E2F B;  3GNG A;  4XTZ A;  4M75 C;  4L59 A;  2R58 A;  1FXX A;  2LQK A;  3SWN C;  1M27 C;  2X4W A;  4J9I A;  1VQ7 Q;  2D8J A;  2RHI A;  4HCZ A;  3D7S B;  1Y0M A;  4KGZ B;  4CC4 B;  2KRN A;  4M7D C;  4A4G A;  3OYI A;  5CO7 A;  3H6Z A;  5GAO p;  3HSB A;  2VGN A;  3O8V A;  1WLP B;  2HSP A;  4EMK A;  4C8Q F;  2RA2 A;  3M4Y A;  3H0H A;  4HA8 A;  2FYK A;  1QCF A;  4BDZ A;  4HCC A;  4A4H A;  2QEX Q;  2QXF A;  2EKO A;  2FZC B;  1Y71 A;  2RK1 A;  1KQ2 A;  1Q95 G;  3VKI A;  1X6G A;  2X4X A;  5KCH A;  3OYF A;  3CC4 T;  1NLP C;  3QUI A;  1VIF A;  2LZ6 B;  2RHU A;  5FRO A;  2ZCF B;  3HRT A;  2CRE A;  3I5S A;  1MND A;  5KYY B;  2EAY A;  4RTT A;  2E6Z A;  1VQO Q;  1YHQ Q;  4DEY A;  2YLB A;  3PVL A;  2D1X A;  5KH6 A;  1IGU A;  2CH4 W;  1VQ7 T;  4E7H A;  1BB9 A;  1KSW A;  2OAU A;  3CBM A;  3CQT A;  3VS6 A;  4KUI A;  2DLP A;  1VQ6 A;  1GFC A;  1MGQ A;  4BB7 A;  3CD6 Q;  1O75 A;  2DEU A;  1DJ7 B;  2DMO A;  1K9M R;  4OMF B;  3BW1 A;  2NUP B;  4O5V A;  2X4J A;  4Y91 A;  5CQY A;  3PFS A;  2CKK A;  4PKC C;  4X34 A;  2KXC A;  1MV3 A;  4KRT A;  4DEX A;  2Z0W A;  4R56 A;  1NYF A;  2P4R A;  5GAO n;  1ZBJ A;  3PVQ A;  4PJO E;  4KGX B;  2Y4X A;  1VQ5 Q;  3MEU A;  3RNJ A;  3UT1 A;  4XK8 E;  2RQT A;  3QZ5 B;  4CI0 C;  2QA4 A;  2F5T X;  3C95 A;  5GAO r;  2GQI A;  2PVG B;  1HXD A;  2RJC A;  1I81 A;  3H9N A;  4Z89 A;  1E6H A;  2M02 A;  3VUB A;  3MP1 A;  1X2Q A;  4IIM A;  2GGR A;  4PFP A;  5GMK i;  5LJ5 j;  1X6B A;  1KD1 U;  4JZ3 A;  4PFZ A;  3RBB B;  1K0X A;  2DPP B;  2OTJ Q;  3ZBD A;  1H8K A;  2XG8 D;  3JB9 H;  4IIO A;  3QHS A;  2HQX A;  4M7D G;  4M77 C;  2YLC A;  2RJF A;  4RUG A;  2BKD N;  3SDZ A;  2DL7 A;  1XOV A;  2RQU A;  3EH1 A;  1N9R A;  9ATC B;  2SEM A;  2LC4 A;  1NG2 A;  2A3L A;  2IIM A;  4FW1 A;  3INZ A;  4DQ2 A;  1MNE A;  5KYY A;  2DBK A;  1JRI A;  1YIJ A;  5CR2 A;  4C5G A;  3EG1 A;  5GAN 3;  1MUZ A;  5GAM f;  2DO3 A;  1UB4 A;  2ROL A;  1X75 C;  3TSZ A;  1B34 B;  2DER A;  3S3N A;  1VQN T;  1UUE A;  3R6N A;  5HK3 A;  3QBY A;  2A7Y A;  2DKG A;  2V8K A;  1B3Q A;  2P0P A;  2GTJ A;  2JS2 A;  3SWN A;  2A36 A;  1UEC A;  1QVP A;  2JOY A;  4JRQ A;  5IAY A;  1VQ8 Q;  3CCR Q;  1JBM A;  2AZV A;  3VS7 A;  3ULR B;  3JCM Q;  2GCX A;  3A8M B;  5GAN e;  1QVG A;  1R8O B;  2D0N A;  5GAM d;  2PUK B;  2L2P A;  3OS1 A;  2FEI A;  4JRP A;  3JB9 G;  3PMT A;  2RH2 A;  2RN8 A;  3MEW A;  4WF2 A;  2AK5 A;  5GMK e;  1QW1 A;  2RQW A;  2LCL A;  2DE0 X;  1OPL A;  2MK5 A;  2FHD A;  1M1K R;  5CKE A;  3OS5 A;  4Y28 E;  4B9X A;  2CSI A;  4AFU C;  1AWX A;  2EYQ A;  1NPP A;  1W6X A;  3EGX A;  4M7A C;  1VYT A;  2PTK A;  2LJ0 A;  4EMG A;  2RB6 A;  5FU7 B;  2QEX T;  3EGX B;  3RMS A;  2ED1 A;  1R0B G;  2NUP A;  2QGF B;  1EFN A;  2RI3 A;  1ABO A;  2DVJ A;  2HL5 C;  2CZ6 B;  2KSS A;  3I56 Q;  1JQQ A;  2EGC A;  3CCU A;  3VS4 A;  2DTH A;  4FM4 B;  5D6X A;  4RCB A;  1H64 1;  4DOW A;  3CCS A;  1LCK A;  4BE1 A;  5LJ5 h;  1PNJ A;  1IRE B;  2WSF E;  4NOY A;  3ER0 A;  4HCK A;  1TUG B;  3VJP A;  5IHK A;  4C0D B;  2GQV A;  4JJD A;  3FC3 A;  5GAO q;  3C0C A;  4GY5 A;  3CCU Q;  4V2S A;  4AFS C;  1ZSZ C;  2HQE A;  3P8B B;  1MMG A;  2MI6 A;  5KYX A;  4JPB W;  2F5K A;  3T9N A;  1VQP T;  2VV5 A;  3CBO A;  1VYU A;  4FCY A;  4C92 D;  5C6S A;  1RI9 A;  3JB9 D;  4XU3 A;  2JM9 A;  4BY6 B;  1GXI E;  4J9D A;  4JRK A;  3V7C A;  1LOJ A;  2PZ1 A;  2OX7 A;  5I11 A;  4FIB A;  1KQ1 A;  2CP2 A;  5KYW A;  2CT3 A;  3FJ5 A;  1QMC A;  3NMZ C;  4OML A;  1HK9 A;  2VVK A;  2KR3 A;  1SRM A;  2P0Q A;  2HBW A;  3BDL A;  3TSW A;  8AT1 B;  3LWH A;  4C92 A;  4N4H A;  3TQ7 P;  2HQH A;  1PD1 A;  1Y57 A;  5A0D A;  1WPY A;  4KUL A;  3G71 A;  1B07 A;  1WJR A;  2EGA A;  3M55 A;  4AG2 C;  5CKF A;  3HFN A;  1JO8 A;  3V8L A;  2RK2 A;  3CME Q;  1W2B A;  1VQM T;  1VQK Q;  2JMA A;  1H3Z A;  1KQS P;  5I21 A;  4X9D A;  3CCQ T;  4OP0 A;  3SFM A;  3OYE A;  1ZLM A;  3A1P A;  2RMO A;  4PJO A;  1QP3 A;  5GAN f;  4OF1 A;  4PJO B;  2C0O A;  3IQL A;  1YI2 A;  3OS2 A;  2WSC E;  4CC7 A;  4UC4 A;  4C8Q A;  3JSC A;  1AD5 A;  1PG5 B;  2KQW A;  5GMK l;  3NTH A;  1VA7 A;  2F2X A;  2JMC A;  2QA4 T;  1OZ2 A;  2K7A A;  3G4S Q;  2GFA A;  3RKW A;  2KNB B;  1X69 A;  2EQI A;  2DEQ A;  2BE9 B;  4BE2 A;  4HT9 A;  2F69 A;  1JJ2 A;  3CME T;  1U5S A;  4PK4 A;  3ZEH A;  2A08 A;  2HL3 A;  4QVC A;  5IHI A;  3JCM h;  2QQR A;  1NEB A;  5KYX B;  2DTI A;  3CPF A;  3O5Z A;  2H8H A;  2QDL A;  4ORZ A;  2KT1 A;  1LNX A;  2EJG A;  2KDS A;  3CC7 Q;  2PVO B;  3TRE A;  3E9G A;  2GF7 A;  3RIR A;  2O9V A;  1PWT A;  4PJN A;  2D8H A;  2E65 A;  3G1J A;  4J6Y A;  1VQ8 A;  2KYM A;  2P84 A;  1MMN A;  1KD1 R;  1UDL A;  3PIP A;  4VUB A;  4RKU E;  2YDL A;  1WJQ A;  3TCJ A;  3CPW S;  4B9W A;  3RKX A;  4F04 B;  1N8R C;  1SF9 A;  2QA4 Q;  2ED0 A;  3CC2 T;  1AWJ A;  2O01 E;  3X26 B;  2MF2 A;  2CZ7 B;  4F16 A;  4FYW B;  2L3S A;  3QDF A;  1M1K U;  3A8G B;  3M4G A;  2IG0 A;  2O4X B;  3C12 A;  1VIE A;  4JLG A;  1Q81 U;  5ECA A;  4CC3 A;  1RAE B;  4KBM B;  4BUG A;  4LDX A;  2A0F B;  4LDW A;  4N0A A;  3M0Q A;  3CCR T;  3G7Z A;  1M5Q 1;  1RAH B;  1NE8 A;  1SPK A;  2AZS A;  3M0T A;  3RMQ A;  3I55 Q;  3X24 B;  4OB2 B;  2C06 A;  1PSE A;  2DIQ A;  2LQ8 A;  1D09 B;  4HT8 A;  3HFO A;  1WXU A;  2BZ8 A;  5HKC A;  1NYG A;  3CC7 A;  3DB3 A;  1M30 A;  4M7A E;  2CDT A;  1WYX A;  2XI9 A;  4AMC A;  2DRM A;  3CCS T;  3QWY A;  1IZ6 A;  2RD1 A;  1KHI A;  1VUB A;  3QKJ A;  1JEG A;  2B8A A;  4FSS A;  1NM7 A;  1Y96 A;  1VQ9 A;  3GLX A;  5LJ3 g;  1W70 A;  2AKL A;  3JCM X;  5LJ3 e;  3OW2 A;  2DZ9 A;  2KAF A;  3EGD A;  2F2V A;  4E7I A;  1QCN A;  3I55 T;  3KUF A;  2EYY A;  2QTV A;  3PGG A;  4KUD K;  4F7U A;  4DBQ A;  3OYN A;  2FRY A;  2V8J A;  1W2B S;  2LNH B;  3PNW C;  2DBM A;  4PJM A;  2CS7 A;  2E4H A;  5CK9 A;  4F7U F;  1YJ9 A;  1VQ9 Q;  1VQ5 A;  1CKA A;  4OGC A;  3L2U A;  5FLX E;  3REB B;  3CCU T;  3VS3 A;  3ZL7 C;  1N5Z A;  1CSK A;  2MMP A;  3GBQ A;  5IT9 E;  3QYH B;  5KYU B;  2DXB A;  4KT0 E;  5FRM A;  3JRZ A;  2BE7 D;  2L3R A;  3CXC S;  4C0G A;  4IUV A;  2CP7 A;  3MP6 A;  3EFR A;  3G71 Q;  3J81 E;  3NTK A;  1RAG B;  2LCC A;  4MMK A;  1WXT A;  2M51 A;  1QLY A;  3P8D A;  2DRK A;  2LQW A;  4HCB A;  2DAQ A;  1EX4 A;  3MP8 A;  4F7U G;  2FZK B;  3VRZ A;  4ME7 A;  2A28 A;  5AYF A;  3JCM f;  2JS0 A;  1I5O B;  1QVG S;  1RAC B;  1IHV A;  2MCN A;  2ECZ A;  2ESW A;  2XID A;  2L0A A;  2YRV A;  1ZHI A;  1W1F A;  2EGE A;  4JRI A;  2HKN A;  1GCQ C;  4P5N A;  2X9H A;  2KYB A;  5FU6 C;  2BTT A;  2O2O A;  5GAN 2;  2HCK A;  3RDV A;  2DA9 A;  2M1H A;  2OTJ T;  2NWM A;  2FB7 A;  3CD6 A;  1PC0 A;  1W4S A;  1WGS A;  1U06 A;  1IGQ A;  4KGV B;  3UA7 A;  3NTI A;  4EIK A;  3CCJ Q;  1UGP B;  2VYT A;  4PLI A;  4WTO B;  2JUF A;  1MMD A;  3WXM B;  1AZG B;  2HSE B;  1BBZ A;  3HRS A;  2E12 A;  4M77 F;  2MWP A;  1AEY A;  1SG5 A;  4M77 G;  1B34 A;  5IH2 A;  2E1H A;  3JCM V;  3RUX A;  2LCS A;  4QQG A;  5GAN 8;  5CKB A;  3OBY A;  5GAN j;  1IB8 A;  3CXC P;  2DJZ A;  1K9A A;  3CMA A;  2X3W D;  2NLU A;  4E47 A;  2JT4 A;  4F14 A;  1RI0 A;  2DIL A;  1WDX A;  1U1S A;  2XU8 A;  4MDW A;  1WXB A;  4IUQ A;  3NGP A;  2CUD A;  1WHH A;  1PRM C;  1V76 A;  4RTZ A;  1KG1 A;  4D6W A;  1M1F A;  1PHT A;  1V1C A;  5J3B A;  3LYI A;  1VQ7 A;  1U8R A;  2NUZ A;  5LJ3 d;  4M78 F;  1BIA A;  4ZN3 A;  2EIF A;  4M77 B;  3EFO B;  4RTW A;  2XHC A;  3V7S A;  3ZFJ A;  1VYV A;  1K0S A;  3CCM A;  1ARK A;  1UGS B;  1M2O A;  4MZM A;  5AT1 B;  5L8R E;  3EFS A;  3VYG A;  3QWX X;  4ZN1 A;  1MHN A;  3E19 A;  4J6X A;  1PKT A;  1D0Z A;  2JM8 A;  3CCR A;  1WQW A;  4N4I A;  1UG1 A;  4BI8 B;  3M57 A;  2LP5 A;  4RG2 A;  2HNI A;  1N8R U;  2JW4 A;  1M90 R;  2ABL A;  3PT9 A;  3LW5 E;  3U23 A;  1YHQ A;  2M0Y A;  2K4Y A;  5GAN g;  1M90 U;  1QWE A;  1UJ0 A;  1VQ6 T;  1G3W A;  3EG9 A;  3A5Z B;  2ZPI B;  1VQ4 T;  4BE0 A;  3G4S T;  2VWF A;  3X28 B;  5KYW B;  4Y92 A;  2GNC A;  4Z02 A;  4IUP A;  3THK A;  2B86 A;  4JJC A;  5GAM e;  3S3O A;  1K73 R;  1M3B A;  2P0K A;  3QZ9 B;  4ZGE B;  1T0J A;  2KRO A;  1K73 C;  4C92 B;  1TG0 A;  1JU5 C;  4C92 C;  4RTY A;  3C4S A;  1M9S A;  2HZY A;  2HEQ A;  3VS0 A;  2VXF A;  4XTU A;  3WVD B;  3X25 B;  1S72 Q;  4QQ6 A;  4XQ3 A;  1M1K C;  1SHG A;  7AT1 B;  2J7I A;  4J9B A;  2G6F X;  3VS1 A;  2EQU A;  4LUE A;  4AFQ C;  3EG0 A;  5GAN 6;  1GBR A;  5GAM j;  4II1 A;  3NPF A;  3HL8 A;  3GOX A;  2OAW A;  3ASK A;  4BI4 A;  5GJW B;  2ZPE B;  2PNI A;  4A53 A;  3L2W A;  3FDR A;  4F17 A;  2LJ1 A;  2YUQ A;  1I0C A;  1YP5 A;  3OA6 A;  3RKY A;  4E7J A;  3ME9 A;  2LQN A;  5GJV B;  2ZGW A;  4QVZ A;  4QVD A;  3S6W A;  3OYB A;  4ZTF A;  5J26 A;  4XTV A;  2A37 A;  2EKH A;  1NPR A;  1Q86 R;  3L1A A;  2CP0 A;  1YJ9 T;  2KRS A;  1XJW B;  1AWO A;  1AWW A;  1ZA2 B;  3SHW A;  8ATC B;  1KQS S;  4LUD A;  4MZT A;  3G6E T;  2YRC A;  2MYS A;  2CGH A;  2GTO A;  1TH7 A;  1M2V B;  2W10 A;  2ZPH B;  1VQN A;  2E5Q A;  2JXB A;  2X4Y A;  1M1G A;  1ZQ1 A;  5LJ5 d;  2O88 A;  5D6W A;  3OYD A;  4RTV A;  3A8L B;  1K4U S;  1YFN A;  2VAS A;  1Q86 C;  1KC8 C;  1BU1 A;  4JZ4 A;  1D1C A;  1QP2 A;  4LDU A;  5CVI A;  1RL2 A;  2XMF A;  5GAN 5;  3JCM W;  1P92 A;  2ZPB B;  2D9T A;  4KH0 B;  2AKK A;  1C6V X;  2KEA A;  4C5E A;  2LDM A;  1N9S A;  2E41 A;  3OYY A;  2L89 A;  1D3B B;  1RAA B;  2PUO B;  5LJ5 f;  3RER A;  2DFU A;  1YNZ A;  5KYN A;  1SSH A;  2QQ9 A;  2FPF A;  1VQ4 A;  2O31 A;  2EPD A;  5GAN 7;  4PJO G;  3JCM e;  2IPO B;  1IO6 A;  2EYZ A;  3AT1 B;  5FW9 A;  1Q7Y R;  1X2K A;  2KMT A;  1Y96 B;  1FX7 A;  2DXC A;  1LVK A;  4M78 E;  1QKX A;  2RQR A;  2HBP A;  4RCC A;  2JTF A;  3CCM T;  3I56 A;  1G3S A;  3PMI A;  2DJQ A;  3M0U A;  4BD3 A;  4KH1 B;  1X27 A;  3TEE A;  5J39 A;  2RO0 A;  1QWF A;  2QEX A;  3OSV A;  3C94 A;  3FJP A;  2CH4 A;  1LJO A;  3GF5 A;  2HKQ B;  3JB9 J;  5DM7 R;  4HVW A;  3OW2 P;  4M7A G;  1OV3 A;  3E1S A;  3V8J A;  1AOJ A;  1K8A R;  1H3H A;  3CCQ Q;  1ZUU A;  3SEM A;  3DLL A;  3CCJ A;  1GL5 A;  2P4T A;  3CPW A;  2V26 A;  3HKS A;  3PIO A;  4M77 A;  4OMQ A;  4ZGJ B;  2EYX A;  5IHN A;  1TSF A;  1TS9 A;  2E5K A;  1SRL A;  4C8Q C;  1OU9 A;  5M9O A;  5GAM h;  2C0I A;  3CCQ A;  3QJY A;  1W2B P;  3OMG A;  1WFW A;  1XQH A;  1E7O A;  3EGD B;  1VQ6 Q;  2DL5 A;  1TXQ A;  4FYX B;  1PRL C;  1WA7 A;  2EFI A;  2K5I A;  4FSX A;  4ZTJ A;  4LN2 A;  1OPK A;  3QDR B;  2RHY A;  4C8Q D;  1WHK A;  1N8R R;  3OYK A;  2DVE A;  2KBT A;  5GAO m;  2BZX A;  1GCP A;  3OYL A;  1OYX A;  1TU0 B;  2KXD A;  1S72 T;  4E7Z A;  5IXB A;  1YJW T;  1NLO C;  1MV0 B;  2L8D A;  1Z9Q A;  3CCV A;  2X51 A;  1YWO A;  5FRN A;  1TWB A;  3VS5 A;  1YCY A;  5EC7 A;  1UHF A;  1QCO A;  3QPH A;  4M77 E;  1D0X A;  3MEA A;  1QVG P;  1VQ4 Q;  3G71 T;  2DL3 A;  2RJE A;  3GP8 A;  1X01 A;  1YIT T;  2J06 A;  4OMP A;  1KC8 U;  4FYV B;  2MPX C;  3CCV Q;  5D6Y A;  1JXM A;  3M54 A;  5HK0 A;  2YSQ A;  1G2B A;  4EMK C;  5A0G A;  3LGF A;  2AIR B;  4Q5W A;  3BY7 A;  1KIK A;  1I5L A;  2FG0 A;  3P8H A;  3PTA A;  1PM3 A;  2LJ3 A;  2DYI A;  4QW2 A;  3CBP A;  4E7S A;  3JB9 I;  3A8H B;  3FIF A;  3JCM c;  3CCE Q;  4IUT A;  1K8A C;  5A0L A;  3EG2 A;  2K5L A;  4M7A A;  3M9Q A;  3WVE B;  1R77 A;  4IUU A;  2LTO A;  4CRI A;  2L5Q A;  1O9S A;  1TOV A;  3QSU A;  1BKB A;  2CP3 A;  2EQJ A;  3TU4 K;  1I4K 1;  1SEM A;  1UGR B;  2FPD A;  2PVD B;  3JV3 A;  2WSE E;  3G6E Q;  1EIF A;  3CME A;  4XU1 A;  3A98 A;  2M0O A;  1UJY A;  4X1V A;  1G5V A;  4A54 A;  1AVZ C;  1YI2 T;  4A4F A;  1QVF S;  2DYB A;  1Q82 U;  4GBQ A;  1GBQ A;  1YBY A;  2LMJ A;  4M7D A;  2FO0 A;  1HYO A;  2RQV A;  2M16 A;  3G6E A;  4M78 G;  3SD4 A;  3JCM J;  3JCM P;  2RPN A;  2SRC A;  2LT4 A;  3UPU A;  4EMK B;  3LGL A;  3SB2 A;  3UF4 A;  2OTL T;  5GAO l;  2XDD A;  1D1A A;  4OB0 B;  4L5G A;  1VQO A;  1M8V A;  1GRI A;  1A0N B;  2DX1 A;  4M7D F;  2CP5 A;  2QQB A;  4GLM A;  5KE3 A;  1T3L A;  2F1L A;  2CZ0 B;  3URG A;  4C0F A;  3QXE B;  2V1Q A;  3OMC A;  1SHF A;  2O4X A;  1R0C B;  4EDU A;  4C0Z A;  3KXT A;  1Q82 R;  2QTX A;  1VQ8 T;  3M53 A;  3CCE A;  2HMA A;  2W0Z A;  2CUB A;  1WI7 A;  4J83 A;  2VC8 A;  1B7T A;  2YUP A;  1BCM A;  1X6O A;  1C0M A;  2YHT A;  4J9G A;  1NJI R;  2K3Y A;  2H3E B;  1NEG A;  4ELZ C;  4QQD A;  2J6K A;  1I1J A;  5I2S A;  1D3B A;  2MWO A;  2CYZ B;  2NYS A;  3CC7 T;  4M7D D;  2LRQ A;  4IUR A;  3M5A A;  2R5A A;  3Q1J A;  3VRY A;  3OB9 A;  4QKU A;  1JB0 E;  4R0K A;  1BK2 A;  5LJ3 h;  1D1B A;  3AHU A;  1NBE B;  5DLO A;  4O6J A;  3EHQ A;  2R5M A;  1N27 A;  1VOM A;  1YJN A;  5LJ3 f;  1QVF P;  2R57 A;  4BY6 C;  3EFO A;  2QG9 B;  3J80 E;  3EG3 A;  2CP6 A;  3E9F A;  3R6O A;  4MDX A;  5KE2 A;  4JS4 A;  4M7D E;  3REA B;  1OQK A;  1M8M A;  1UEB A;  1VQN Q;  3BDU A;  4C8Q G;  1YJN Q;  2MAM A;  4RG8 A;  1U1T A;  2M9U A;  4MML A;  3L42 A;  1ACM B;  4RMO A;  3M58 A;  2K2M A;  5KYU A;  5LJ5 g;  4E7L A;  2XK0 A;  4ATO A;  2DIG A;  1HSQ A;  4IKF A;  1K8A U;  1G3Y A;  4DBF A;  2JTE A;  1VQL T;  3OW2 S;  4BDY A;  4PJL A;  1CKB A;  3I55 A;  2VGM A;  2COZ A;  4LDY A;  2RHZ A;  3HHT B;  1G83 A;  2V8I A;  4CC2 A;  2VKN A;  4C0D C;  1BI3 A;  2K3X A;  3CCS Q;  2FVU A;  1JJ2 P;  3L2Q A;  3QG1 A;  3H0F A;  5FWB A;  4E6R A;  4QT7 A;  2PQW A;  3CD6 T;  2DK3 A;  2MOX A;  3MPU B;  2DD5 A;  5I2M A;  2KRM A;  3F70 A;  1KQS A;  1QVF A;  2EW3 A;  2DZC A;  3OSS C;  3FB9 A;  1TTH B;  2EBP A;  3OQ5 A;  1AT1 B;  3L2V A;  2J6O A;  3L2Z A;  4J9F A;  1NZ9 A;  2J05 A;  1WHL A;  2HAX A;  3NHN A;  3FLG A;  1WHM A;  4HVV A;  2GBQ A;  2DNU A;  1OI1 A;  4LE9 A;  4OB3 B;  3OY9 A;  2Y90 A;  2EQM A;  1RAD B;  4XTW A;  4XU0 A;  2QI2 A;  4JDS A;  2AT1 B;  1PCX A;  3MEV A;  6AT1 B;  1K9M C;  2YUO A;  1KC8 R;  1QQJ A;  2K2V A;  5D7U A;  2WAC A;  1TUC A;  1XTD A;  2ZZD A;  1YJ9 Q;  2D6F A;  4OMM A;  5CIU A;  2EVR A;  3OYH A;  2KGT A;  3MCA B;  1G8X A;  1JJ2 S;  4FU6 A;  2OTL A;  2IVW A; 
#chains in the Genus database with same CATH homology
 1WIE A;  1YNZ A;  2ED0 A;  1RLP C;  1S1N A;  1AWJ A;  4HXJ A;  1SSH A;  2FPF A;  4F16 A;  2L3S A;  2O31 A;  2EPD A;  2KT8 A;  1M27 C;  1IO6 A;  1M3A A;  2EYZ A;  2RNA A;  4J9I A;  2D8J A;  4AG1 C;  5IXF A;  5ECA A;  5FW9 A;  1X2K A;  1Y0M A;  4CC4 B;  4CC3 A;  2KRN A;  2DF6 A;  1GCQ A;  3M0Q A;  3LH5 A;  1UHC A;  1WLP B;  2KE9 A;  1SPK A;  2AZS A;  2HSP A;  3M0T A;  4Z8A A;  1QKX A;  2RQR A;  1ZUK A;  3H0H A;  1H92 A;  1QCF A;  1ZUY A;  2DJQ A;  3M0U A;  3UA6 A;  1X27 A;  1FYN A;  4ESR A;  1X6G A;  1QWF A;  1WXU A;  2BZ8 A;  1NYG A;  1NLP C;  1J3T A;  2CH4 A;  4K11 A;  2LZ6 B;  4WCI A;  2CT4 A;  1M30 A;  4A63 B;  4HVW A;  2CRE A;  3I5S A;  1OV3 A;  2CDT A;  4J9C A;  1AOJ A;  1WYX A;  1HJD A;  4RTT A;  4JJB A;  1H3H A;  1ZUU A;  4DEY A;  1YCS B;  2DRM A;  3PVL A;  2D1X A;  3QWY A;  3I35 A;  3SEM A;  2CH4 W;  1JEG A;  3I5R A;  1GL5 A;  4FSS A;  1BB9 A;  1NM7 A;  1KSW A;  3VS6 A;  3CQT A;  2DLP A;  1GFC A;  1W70 A;  2AKL A;  4OMQ A;  2EYX A;  5IHN A;  2F2V A;  2E5K A;  1SRL A;  2DMO A;  2EYY A;  2FRY A;  4J9H A;  2LNH B;  2C0I A;  5I22 A;  2DBM A;  1WFW A;  1E7O A;  1WX6 A;  2KXC A;  2DL5 A;  1MV3 A;  4KRT A;  1U3O A;  4DEX A;  1CKA A;  1NYF A;  3H41 A;  2P4R A;  1PRL C;  1WA7 A;  3REB B;  1ZBJ A;  2LX7 A;  3PVQ A;  3VS3 A;  3ZL7 C;  1N5Z A;  1CSK A;  2BZY A;  3GBQ A;  4LN2 A;  3RNJ A;  1OPK A;  2OI3 A;  2RQT A;  2KBT A;  1UE9 A;  2BZX A;  1GCP A;  2GQI A;  2KXD A;  5IXB A;  1WXT A;  1NLO C;  2M51 A;  1MV0 B;  1QLY A;  4Z89 A;  1E6H A;  1M3C A;  2DRK A;  2OJ2 A;  1Z9Q A;  2LQW A;  1YWO A;  1X2Q A;  3VS5 A;  4IIM A;  5EC7 A;  3VRZ A;  1UHF A;  4RTU A;  2A28 A;  2RF0 A;  2GGR A;  2K9G A;  2JS0 A;  1X6B A;  4JZ3 A;  3M0S A;  3RBB B;  2DL3 A;  1K0X A;  1FMK A;  1H8K A;  2DL4 A;  2ROT A;  4IIO A;  2MCN A;  2ECZ A;  2ESW A;  2J06 A;  4OMP A;  1GFD A;  2L0A A;  1W1F A;  2EGE A;  1HD3 A;  4RUG A;  1JXM A;  1GCQ C;  2DL7 A;  2KYB A;  2BTT A;  2O2O A;  1G2B A;  1XOV A;  2RQU A;  2YSQ A;  2HCK A;  1KIK A;  2DA9 A;  2FG0 A;  2SEM A;  2LJ3 A;  3KFV A;  1NG2 A;  2IIM A;  2V1R A;  2NWM A;  2DBK A;  1RUW A;  1UFF A;  3EG2 A;  1U06 A;  1I07 A;  3UA7 A;  4EIK A;  3EG1 A;  1MUZ A;  2ROL A;  4Z88 A;  3TSZ A;  1AZG B;  4LNP A;  1BBZ A;  1UUE A;  3R6N A;  1SEM A;  1AEY A;  1UGV A;  2FPD A;  3JV3 A;  3A98 A;  5IH2 A;  1UJY A;  1B3Q A;  2GTJ A;  4X1V A;  2JS2 A;  2LCS A;  2FRW A;  1AVZ C;  4OMO A;  2A36 A;  1UEC A;  1K9A A;  2DYB A;  2AZV A;  2X3W D;  4GBQ A;  3VS7 A;  1GBQ A;  3ULR B;  2LMJ A;  2JT4 A;  4F14 A;  2FO0 A;  2RQV A;  2DIL A;  1WDX A;  2YUN A;  2D0N A;  1WXB A;  2L2P A;  3NGP A;  2CUD A;  1PRM C;  4RTZ A;  2FEI A;  2RPN A;  2SRC A;  1T3S A;  1PHT A;  1KJW A;  2RN8 A;  1V1C A;  3UF4 A;  3VS2 A;  2NUZ A;  1ZX6 A;  2AK5 A;  3EHR A;  2RQW A;  1JXO A;  1GRI A;  2DE0 X;  1OPL A;  4RTW A;  1A0N B;  2DX1 A;  1VYV A;  1K0S A;  1ARK A;  2CSI A;  2YT6 A;  4AFU C;  1AWX A;  1ABQ A;  1W6X A;  4GLM A;  1VYT A;  2PTK A;  2LJ0 A;  1T3L A;  3QWX X;  2ED1 A;  1PKT A;  2V1Q A;  2JM8 A;  1SHF A;  1EFN A;  2FPE A;  1ABO A;  2DVJ A;  1UG1 A;  2LP5 A;  1JQQ A;  2EGC A;  2W0Z A;  2HDA A;  2CUB A;  1WI7 A;  2JW4 A;  3VS4 A;  2ABL A;  1RLQ C;  3U23 A;  4D8D A;  1QKW A;  1LCK A;  2YUP A;  4HVU A;  3PE0 A;  1TUD A;  4J9G A;  1PNJ A;  2M0Y A;  1NEG A;  1QWE A;  2J6K A;  1UJ0 A;  1I1J A;  4HCK A;  5IHK A;  2DL8 A;  2VWF A;  2MIO A;  4JJD A;  3C0C A;  4Y92 A;  4M4Z A;  2GNC A;  4AFS C;  2EYW A;  3THK A;  2B86 A;  4JJC A;  4RTX A;  2L3P A;  4J9E A;  1M3B A;  3VRY A;  4ZNX A;  4JPB W;  4R0K A;  2K79 A;  1BK2 A;  1T0J A;  1VYU A;  2KRO A;  1TG0 A;  1JU5 C;  4RTY A;  3EHQ A;  2HEQ A;  2I0N A;  3VS0 A;  2C0T A;  1RI9 A;  2JM9 A;  3EG3 A;  1OEB A;  4J9D A;  3H0I A;  1SHG A;  2PZ1 A;  2J7I A;  4J9B A;  2G6F X;  3VS1 A;  5I11 A;  4LUE A;  3REA B;  4AFQ C;  3EG0 A;  1M8M A;  1GBR A;  3NPF A;  2CT3 A;  3FJ5 A;  3NMZ C;  4OML A;  2OAW A;  2VVK A;  1KFZ A;  2KR3 A;  1SRM A;  2HBW A;  5GJW B;  3TSW A;  2CSQ A;  2PNI A;  2F2W A;  4AFZ C;  1PKS A;  2K2M A;  2LJ1 A;  4F17 A;  2YUQ A;  5L23 A;  1I0C A;  1Y57 A;  1YWP A;  1YP5 A;  1HSQ A;  2LQN A;  5GJV B;  1B07 A;  2EGA A;  2JTE A;  4AG2 C;  1JO8 A;  2X3X D;  1CKB A;  1OOT A;  2JMA A;  2ENM A;  1AZE A;  1G83 A;  2K3B A;  3EGU A;  2A37 A;  5HCK A;  4CC2 A;  1ZLM A;  2EKH A;  2VKN A;  2RMO A;  2KRS A;  1AWO A;  3H0F A;  1AWW A;  5FWB A;  4E6R A;  2C0O A;  3IQL A;  4QT7 A;  3SHW A;  4CC7 A;  2MOX A;  3M0R A;  2J6F A;  1ZSG A;  2KRM A;  2EW3 A;  4LUD A;  1YN8 A;  1AD5 A;  4OMN A;  1K76 A;  2EBP A;  1VA7 A;  2F2X A;  2JMC A;  2K7A A;  2GTO A;  3TVT A;  1T0H A;  2J6O A;  4J9F A;  2KNB B;  1X69 A;  2J05 A;  2W10 A;  5FWC A;  4D8K A;  2L3Q A;  1K1Z A;  2EQI A;  3NHN A;  1UTI A;  2JXB A;  4HVV A;  2GBQ A;  2DNU A;  4LE9 A;  1U5S A;  2O88 A;  4RTV A;  2A08 A;  1X43 A;  5IHI A;  1NEB A;  1K4U S;  3O5Z A;  2H8H A;  2QDL A;  4ORZ A;  2KT1 A;  1BU1 A;  1Z9Z A;  2YUO A;  4JZ4 A;  2O9S A;  1E6G A;  3M0P A;  2O9V A;  3UAT A;  1PWT A;  1TUC A;  3I9Q A;  2D8H A;  2XMF A;  4OMM A;  2EVR A;  2DM1 A;  2KYM A;  2KGT A;  2AKK A;  1UDL A;  2KEA A;  2YDL A;  2K6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...