2J7IA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterodimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j7iA00
1GBRA 1T3LA 1PWTA 2RQRA 3REAB 3REBB 5IHKA 4KRTA 2K3BA 2YUQA 4HVWA 3THKA 2D1XA 1ZUKA 4RTTA 3A98A 4Z8AA 1UECA 2LP5A 2L3SA 4EIKA 2EYZA 1IO6A 3QWXX 4D8KA 1M27C 1T3SA 2HEQA 1K9AA 3H0FA 3LH5A 2J6KA 1KIKA 2JM8A 2FPDA 2A37A 4LN2A 5GJWB 1M3AA 1AD5A 2GBQA 5I22A 1RLQC 2JM9A 2CT3A 2KRNA 3EG1A 1JXMA 2JS0A 4M4ZA 1BB9A 4HXJA 1B3QA 2RQWA 1PRLC 2EKHA 2SEMA 4OMMA 1I0CA 1QLYA 2RPNA 4LE9A 2CUBA 2PNIA 2V1RA 4OMLA 2KXCA 3PVQA 2KYMA 1U06A 1PRMC 4LUDA 4AFQC 1JU5C 2BZYA 3SHWA 2W10A 2ECZA 4QT7A 4Z89A 5FW9A 2DL3A 1WYXA 1QKXA 1PKSA 5FWCA 1ZLMA 3M0SA 2F2XA 2KE9A 1YN8A 1X6BA 2FPFA 4RTXA 1GFDA 3I35A 1AEYA 1K76A 2YUPA 1RLPC 2EW3A 2O88A 2HSPA 2CT4A 3KFVA 1CKBA 1ARKA 2X3XD 2DA9A 2DE0X 4IIMA 2A08A 4OMOA 4J9FA 4JPBW 2GTJA 1T0HA 1KFZA 3NPFA 1ZBJA 1K0XA 2K79A 1N5ZA 3RNJA 4J9HA 1Y57A 1ZUYA 2C0IA 2YDLA 1MV3A 1Y0MA 3EG0A 4F16A 4RTWA 3ZL7C 2A36A 2JTEA 1SHGA 5HCKA 2HCKA 2O9SA 2FPEA 1OOTA 1W6XA 2D8JA 2EYXA 2KGTA 2EPDA 2OJ2A 2O9VA 1OPLA 2CSIA 3VS4A 1B07A 3I5RA 4CC7A 1OPKA 4IIOA 4GBQA 1ABQA 2J6OA 1M3CA 1X2KA 4OMNA 2FRYA 3UATA 2L3QA 4ZNXA 1KJWA 3ULRB 2NWMA 1WI7A 2ABLA 4A63B 5I11A 4JJCA 1SEMA 3VS3A 1KSWA 2G6FX 1U3OA 3M0RA 1ZUUA 2DLPA 2DM1A 2KROA 2ED0A 3JV3A 1YP5A 1E6HA 2C0OA 2KXDA 2QDLA 5ECAA 3I5SA 3NMZC 1UFFA 2JW4A 1K4US 1WXBA 1M8MA 2HBWA 2DMOA 2LZ6B 2LQNA 3U23A 2GTOA 2FEIA 1UUEA 2XMFA 2KBTA 1OEBA 1UTIA 4LNPA 1BK2A 1SPKA 2DYBA 4X1VA 2KEAA 2MCNA 2VVKA 3UA6A 3VRZA 1AWJA 1RI9A 1K1ZA 4JJBA 2FG0A 3VS5A 1FMKA 1ZSGA 3M0QA 3EHRA 5IHNA 2E5KA 5IH2A 1UE9A 2DRKA 1G83A 1HD3A 4OMQA 1M30A 2L2PA 2DJQA 3UF4A 2LQWA 1UHFA 3PE0A 2KT1A 5GJVB 2RMOA 2F2VA 2YUOA 2CH4A 4R0KA 2DILA 2JXBA 3H0HA 2EBPA 2H8HA 2ENMA 1E6GA 3CQTA 1AZEA 3UA7A 2RF0A 4J9GA 1WDXA 2YSQA 1UDLA 2AKLA 1WXTA 2X3WD 3NHNA 3C0CA 2J7IA 1JXOA 2V1QA 4RTVA 1AWOA 1H92A 1HSQA 4ORZA 1NLOC 1X27A 1NYGA 1A0NB 3EHQA 4OMPA 2P4RA 1Z9ZA 2ESWA 2CH4W 3M0PA 2EYYA 4AFZC 1SSHA 1X43A 1I1JA 2LJ0A 2AK5A 2AZVA 1EFNA 2IIMA 2J05A 1WIEA 1YNZA 2CDTA 2O31A 3M0TA 2LX7A 1U5SA 1LCKA 4J9CA 1I07A 1VA7A 1K0SA 2EGEA 1GL5A 1GFCA 2OAWA 3VS7A 2I0NA 5L23A 2AKKA 1TUDA 4D8DA 1WLPB 4FSSA 3QWYA 3TSZA 3IQLA 2MIOA 1GBQA 2SRCA 1ABOA 3VS0A 2LNHB 1BBZA 2RQVA 4J9IA 4RTZA 2JMCA 1OV3A 2RN8A 2D0NA 2EGCA 2VKNA 1AWWA 2GQIA 3VS1A 2JT4A 1AVZC 2KRMA 2BZ8A 1RUWA 2GNCA 4LUEA 2L0AA 2EYWA 2M51A 2FO0A 2F2WA 2DRMA 2NUZA 2ROLA 1UHCA 2CSQA 1AWXA 1NG2A 1AOJA 1GRIA 2RNAA 2BZXA 2OI3A 2LJ3A 1QCFA 2L3PA 2EVRA 1SRLA 2DL4A 2MOXA 4ESRA 4WCIA 1ZX6A 4AFSC 1PNJA 1W1FA 2JMAA 1VYTA 2K6DA 1H3HA 2KYBA 3R6NA 2JS2A 2PZ1A 2RQUA 4HCKA 2ROTA 2M0YA 3NGPA 2DNUA 4RUGA 2W0ZA 4RTYA 2DBMA 1X2QA 2VWFA 2DBKA 2CUDA 1WFWA 1BU1A 4DEXA 1FYNA 3VRYA 4JJDA 4HVUA 2DL8A 2YUNA 2AZSA 5IXBA 1E7OA 1NEGA 2O2OA 5FWBA 2LMJA 1WA7A 2DX1A 4CC4B 2EGAA 2KT8A 1CSKA 1JEGA 2DL5A 1QWFA 4Y92A 2KNBB 1WX6A 4F17A 1YCSB 1NEBA 3SEMA 1VYVA 2RQTA 2C0TA 3M0UA 4K11A 1H8KA 2B86A 2K9GA 2CREA 1HJDA 1XOVA 2D8HA 4J9DA 5IXFA 4AFUC 1SHFA 1UGVA 4JZ3A 4JZ4A 4J9BA 4Z88A 1MUZA 1Z9QA 1S1NA 1X69A 3VS6A 4F14A 1J3TA 1GCQA 4CC2A 4AG1C 1JQQA 1WXUA 4HVVA 3H0IA 1W70A 2BTTA 2KR3A 4J9EA 1AZGB 1X6GA 1JO8A 3FJ5A 2DF6A 3EG2A 2EQIA 1QKWA 2ED1A 3EGUA 1V1CA 2J6FA 2KRSA 4RTUA 2LJ1A 3RBBB 3I9QA 2FRWA 4AG2C 4DEYA 2A28A 1UJYA 2YT6A 2DL7A 1SRMA 5IHIA 4GLMA 1YWOA 1QWEA 1VYUA 1TG0A 4CC3A 3H41A 3O5ZA 1PHTA 5EC7A 2GGRA 3TSWA 2HDAA 3EG3A 1PKTA 2PTKA 3GBQA 1UJ0A 1GCQC 4E6RA 3TVTA 1M3BA 1T0JA 1GCPA 1MV0B 1TUCA 2DVJA 1NM7A 1UG1A 2K7AA 2K2MA 2LCSA 2J06A 1G2BA 3VS2A 1CKAA 1NLPC 1YWPA 1NYFA 3PVLA
chains in the Genus database with same CATH superfamily
1W4SA 1ZBXA 4PLLA 2RQRA 4KRTA 5GAOr 2YUQA 4HVWA 3THKA 1VQNA 1VQNQ 4EIKA 2L3SA 3FC3A 1M27C 5LJ5d 2HEQA 1K9AA 2J6KA 1N27A 3X25B 2JM8A 2MWPA 4DBRA 1M2VB 1IGUA 5C6SA 1AD5A 2QGGA 5GAMh 2CT3A 1RAHB 2KRNA 2QEXT 2MF2A 3TREA 3JB9I 1PRLC 2SEMA 3MP8A 1D3BA 1LVKA 5CIUA 5IT9E 2RPNA 3A5ZB 1MNDA 5LJ3d 2E3HA 1QVPA 4OMLA 2RH2A 2OTJQ 2CKKA 5CCAA 2XG8D 3CCVQ 4LUDA 3OW2A 3G6ET 3OY9A 4C92F 4Z89A 1M1FA 2QQSA 4Y28E 5KYUA 1PKSA 4YTLA 3CCLQ 1ZLMA 2F2XA 4FT4A 3CMAA 1YN8A 3JCMJ 2FPFA 4RTXA 4C5GA 1VQOQ 2AIRB 1GFDA 1AEYA 1K76A 4C0GA 4A4FA 2YWWA 3CCUQ 1MMAA 4BI8B 4QVDA 1N9RA 4OMOA 1Y07A 4A4HA 5D6YA 2GTJA 1M90R 4IUQA 4MZTA 2ZPEB 3E9FA 1K0XA 3JRZA 2P0KA 4M75E 3RNJA 4J9HA 2R58A 1Y57A 1N8RC 1ZQ1A 3V7SA 2C0IA 5CQXA 3V8KA 2PU9B 2YDLA 1MV3A 3OSVA 5CKFA 3RESA 1SHGA 2HCKA 3JCMc 3TCJA 4FIBA 5GAN2 1OOTA 1OI1A 4M75G 2EPDA 3EGDB 1OPLA 2CSIA 2V26A 2CYZB 3M58A 4CC7A 3EFOB 1OPKA 2DTIA 1X2KA 2L3QA 3JB9D 4ZNXA 4XTVA 1YHQA 1YHQQ 3CBMA 3EFRA 3JCMb 2VUBA 3M0RA 1YJWQ 1ZUUA 1FMWA 2MWOA 3SWNA 2KROA 4LDYA 3JV3A 4NL3A 1E6HA 3JAME 4PJOD 1KD1C 5ECAA 3NMZC 5GAOm 2QK0A 1D09B 1OZ3A 4M7AA 3L1AA 1VQ5T 4M75B 4M7DC 2HBWA 2LZ6B 3U23A 4KGXB 4JDSA 1WNLA 2YRCA 5DLQE 3OYLA 3CCQA 2KBTA 1OEBA 1UTIA 2ZPHB 5FROA 1YI2T 2KEAA 2VVKA 1YJ9A 1PM3A 2QA4Q 2DPPB 3QZ9B 3EH1A 4OMFB 3RMSA 2FG0A 4VUBA 3G1JA 2X9HA 2KDSA 3LGLA 5J26A 1M1KC 4A53A 2HBPA 3QKJA 3EHRA 1Q86C 2CZ0B 5KYYA 1G83A 3OB9A 1M30A 4HCBA 1K9MR 3NTKA 3CMET 2E3IA 3HFOA 2RMOA 3CCET 1YJNQ 1ZSZB 1F1BB 2JXBA 4RCCA 2E1HA 5AT1B 5FRMA 2BUDA 1E6GA 2ENMA 3RERA 1QQJA 5KYXA 3CQTA 1BI3A 2JUFA 2YSQA 1JJ2S 3S6WA 1UDLA 2AKLA 3HRTA 3NHNA 2J7IA 1Y71A 1QVFP 1WJRA 4FW2A 1NLOC 1X27A 3PT9A 3RIRA 2CH4W 3JSCA 1QP3A 3VYGA 1C0MA 1NE8A 4AFZC 4ATOA 4J6YA 3MP6A 4F7UE 1G3TA 1WIEA 2O31A 3M0TA 1U5SA 2M02A 2OTLT 3EGDA 1I07A 1I81A 2VB6A 2ZCFB 3GNFB 1K0SA 1GL5A 3VS7A 4D8DA 4FSSA 1BI1A 3CC7A 4BE0A 4F7UG 1WHMA 3MHXA 2QEXQ 4PJOE 3JB9G 2SRCA 2QYZA 3VJPA 4O6JA 3OYJA 4BE1A 2E6ZA 2RQVA 2FL7A 4RTZA 2D0NA 1MNEA 2VKNA 3JCMg 2GQIA 4BY6B 1VQ7T 2KRMA 1EIFA 2GNCA 4LUEA 1H3ZA 4PJOG 2L0AA 1EZZB 4X9DA 2EYWA 2CP5A 4AT1B 4M77A 3G6EQ 5KH6A 3CCJT 2RJFA 1NG2A 2FYKA 4KT0E 2GQVA 3QDFA 4PK4A 3CCMT 2B8AA 4KUIA 2MOXA 2VC8A 2HQHA 2FVUA 4OB3B 2ROTA 3NGPA 3I56Q 4E7KA 2ZPGB 4FYVB 3P8HA 1KK7A 1VQ4Q 1TXQA 2LDMA 1WFWA 4PJOB 1D1BA 4M75C 3L42A 4DEXA 4OB2B 2DL8A 2YUNA 1M2OA 4HA8A 1BIBA 1X6OA 2EQJA 1WHHA 2DX1A 2LMJA 4OB0B 1WJSA 2KT8A 2R5AA 4C8QA 1CSKA 2A7YA 2O01E 4PJJA 4Q5WA 5D6XA 3ME9A 4F17A 1YCSB 2C06A 2QQBA 4E7HA 2F5KA 3SEMA 4OVAA 4M78E 3I55A 1D0ZA 4FCYA 4JUVA 2GCXA 3AT1B 3OYYA 5IXFA 2XIDA 3V7CA 2EQMA 1B34B 1M1GA 5GANd 4F14A 3EG9B 1JB0E 1JQQA 1W70A 2BTTA 2COZA 1AZGB 4GY5A 4M78G 5KE3A 4N0AC 1HK9A 1R77A 4C8QC 1PSEA 4XU1A 1ZSZC 2KRSA 3META 1DJ7B 3L2UA 2P0QA 1K8AU 1IB8A 2ZGWA 2ZZDA 3VV0A 4BI4A 4NOYA 3C94A 1YWOA 1VYUA 4E7JA 3P8DA 1VQ5Q 3O5ZA 4EDUA 1PHTA 4ZGDB 3CMAT 1VIEA 3AHUA 1PSFA 2VASA 1PKTA 2XDDA 4E6RA 1KC8U 1M3BA 1T0JA 1YI2Q 1KQSS 4QQDA 1LPLA 2KK4A 1TUCA 2HAXA 2Y4XA 3PFSA 1G2BA 2DKGA 1OU9A 3PNWC 1T3LA 3REBB 5IHKA 1RAIB 3E1SA 2O4XB 4NS5A 4M7AF 4Z8AA 1UECA 2EYZA 2QQ9A 3CMEQ 1T3SA 1RACB 3M56A 3CCEA 2FPDA 3CCEQ 2XDBA 4HT8A 2GBQA 4BY6C 1RLQC 2JM9A 2JOYA 2COWA 2L3RA 1JXMA 2JS0A 4HXJA 1B3QA 2K57A 2G3RA 3GNGA 2EKHA 4OMMA 1R8OB 1I0CA 3TQ7P 1Q95G 1OU8A 1RL2A 5LJ5g 1KG1A 1RI0A 3X20B 2QDYB 2Z0WA 4FSXA 4KUDK 2XD0A 4AFQC 2BZYA 2VGNA 3SHWA 2W10A 2ECZA 5J39A 3URGA 4QT7A 2BE7D 2OTLA 5FW9A 1WYXA 1QKXA 3HTRA 3HP9A 3V7RA 1FMVA 5KYWA 1B34A 3A8OB 5L8RE 4AMCA 4HCZA 1K73U 3OYGA 2LT4A 1X6BA 1JJ2P 4PJOC 2WSCE 3JCMf 2I2LA 3ZEHA 2NUPB 5LJ3g 2O88A 2HSPA 1QVGS 1VQMA 4IUPA 1BYMA 2DA9A 2PUOB 2A08A 2XU8A 4BACA 3RUXA 4OP0A 2RJCA 3NTHA 3NPFA 1VQ7Q 2Y90A 1ZBJA 2QQRA 1K9MC 2XDPA 2EQUA 2JZ2A 2WSFE 1ZUYA 2RB6A 4B6MA 1O75A 3CCJA 3ZL7C 2A36A 2JTEA 2QXFA 2M0OA 2O9SA 1W6XA 4ZN1A 1IXDA 4L59A 2D8JA 3CCMQ 2KMTA 3EAEA 3EGXB 3OS1A 3OYNA 3VS4A 1NJIU 2RHUA 2J6OA 1UGPB 2FRYA 4A4EA 1KJWA 2X51A 3ULRB 2NWMA 1W2BS 4KGVB 4DOWA 2O4XA 1VQKT 1SEMA 4J6WA 3VS3A 5CAIA 3M9QA 3G71A 3WXMB 4M77F 2DLPA 2DM1A 1D1CA 3S3MA 5A0DA 1R0BG 2LRQA 3I5SA 5KCOA 2V8IA 4E47A 2Y4YA 2FB7A 2JW4A 3OBWA 1K4US 2QQAA 1WXBA 4KULA 1Y7XA 2DMOA 5AYFA 3CC7T 2FEIA 3BDUA 1SSFA 1IREB 1Q7YU 1IHWA 2DYBA 3SB2A 4X1VA 2MCNA 1TTHB 2E10A 4JJBA 5HK3A 1TWBA 2QTVA 3VS5A 2EJFA 1FMKA 2RI3A 2AHJB 2RI2A 3F70A 4C8QF 1ZSGA 3M0QA 4C92D 1SF9A 5IH2A 3HSBA 1UE9A 2DRKA 1MGQA 2E12A 2NUTB 4OMQA 3O8VA 2LQWA 4PFPA 1UHFA 1ZHIA 2KT1A 5GJVB 3CMAQ 4A4GA 3JB9H 2NUPA 2DTHA 4JRQA 3H0HA 2EBPA 4KGZB 1AZEA 3UA7A 4J9GA 8AT1B 3CEYA 2RK2A 1UEBA 4XK8E 1WXTA 2X3WD 3M59A 4QKUA 3OYMA 4KH0B 2EIFA 2DD5A 3VYHB 5GAN4 2V1QA 1H92A 3TEEA 5GMKe 1PC0A 1P92A 1D0XA 3M55A 1A0NB 1BCOA 5A0GA 4OMPA 2P4RA 4MDXA 2EYYA 4F04B 3PMIA 1X43A 1I1JA 2LJ0A 2IIMA 2J05A 3UPUA 1V29B 2V8JA 3FLGA 2LX7A 3EGXA 3JCMW 3I55T 2OAWA 4M7DA 2KI7A 2LVMA 2X4JA 3JCMe 1KQSP 3TSZA 3QPHA 2RA2A 2FHDA 3S3OA 3IQLA 5LJ5f 1ABOA 4ZTFA 2LNHB 3X28B 3L2QA 2DIGA 4C5HA 4OF1A 2EGCA 3VS1A 2CP2A 3CPWS 2BZ8A 4J7FA 3RDVA 1M2VA 2LC4A 1K8AR 4HCCA 2DRMA 2ROLA 3G7ZA 1UHCA 1AWXA 3A8LB 1I8FA 5LJ3f 2OI3A 3CBOA 4C92E 3CCQQ 3PIOA 1QCFA 4FW1A 3GIBA 1QVFA 4J7IA 2IG0A 1SRLA 1NPRA 2DL4A 1KC8R 3QO3A 2BIVA 3OMGA 1YJ9Q 1PNJA 2JMAA 4EMGA 4XU2A 4C5IA 5GAMd 3R6NA 2JS2A 4ZGJB 2PZ1A 2D6FA 2BE9B 2DNUA 3QYHB 4RUGA 2VV5A 2DBMA 4C92G 4J5YA 2EQKA 3G4SA 1Q81U 2DBKA 4PNOA 2MI6A 3ZBDA 4IUVA 1KHCA 1OX8A 3VRYA 2E64A 2AZSA 1IGQA 5FWBA 1WA7A 2EGAA 2XICA 3OYHA 2RHXA 2KSSA 4JRIA 3PTAA 2DIQA 2KNBB 3LGFA 1LOJA 2AT1B 2JJ9A 3M0UA 1HJDA 2D8HA 4J9DA 3JCMQ 1QVGP 4AFUC 4JZ4A 5LJ5j 2A0FB 4J9BA 3V8LA 1MUZA 1J3TA 4C92B 4E7SA 2V8KA 2HMAA 1OX9A 2E70A 3SDZA 1WXUA 2KR3A 4M78D 1VQKA 1D0YA 2CP0A 1QKWA 3M53A 2J6FA 1VQ9T 2LX9A 2CGHA 4RTUA 4CRIA 3JCMh 3X24B 1XTDA 2FRWA 4E7LA 3WVDB 2EJ9A 4C0DB 4AG2C 4DEYA 2FZGB 1LJOA 1M8VA 3EFOA 2DL7A 2QTXA 5LJ3j 4L5GA 1WPYA 2GFAA 5GANg 3CC7Q 1TS9A 3GLXA 2HDAA 3EG3A 1K73R 4KBMB 3ER0A 2RHZA 3QDRB 1NBEB 3E2UA 3MEWA 1VQMT 3QG1A 5KE2A 3CBPA 3OYFA 4C0FA 2LT1A 4PJNA 4PL6A 2IVWA 1XNIA 1W2BP 4CI0C 3RR6A 3J81E 3DKMA 1NLPC 4V2SA 3PVLA 2ZPFB 1TOVA 4O5VA 3LW5E 2K3BA 4M75A 3JB9J 3MEUA 4DA4A 2D1XA 2DZCA 2L89A 1ZUKA 2JN0A 2LP5A 5GAMf 2PVOB 1IO6A 3QWXX 3CC2A 5DY9A 2FZCB 4LDUA 4F7UB 3QSUA 1KIKA 4DOVA 3GPLA 1X01A 4FYXB 1B7TA 3CPFA 2A37A 3FJPA 2MMPA 5GJWB 2ZPBB 1HXDA 5DM7R 5FU7B 1M3AA 1NJIR 3VUBA 5LJ5e 4RG2A 2EKOA 3EG1A 4M4ZA 5IAYA 2RQWA 3D7SB 3L2VA 4PJLA 5CKHA 4QVCA 3G71T 2RJEA 4JS5A 2V1RA 4XTXA 4N0AA 3CXCS 2KYMA 1LNXA 1ZSZA 1OULA 1VOMA 2CP6A 4X34A 1JU5C 2RI5A 2VYTA 4JS4A 3LWHA 1TU0B 5LJ3e 2F1LA 2PVDB 5GMKm 4JJNK 3I55Q 2A3LA 5FWCA 5GAN7 1ZA2B 4RCBA 1YCYA 3HPWA 2M1HA 1WQ7A 4QQ6A 2P84A 1Q7YR 2E5QA 3I35A 1UGQB 1RLPC 2EW3A 3DB3A 1U1SA 1CKBA 3KFVA 4BDZA 3M5AA 1GXIE 1FX7A 4GLKA 2E4HA 4J9FA 4JPBW 1T0HA 1VQ8A 4NL2A 3CCST 1G3SA 5GMKi 4RKUE 2OX7A 4HT9A 2OTJT 2X4WA 4F16A 3A8HB 4M7DF 2LCLA 4C92C 2HQXA 3Q1JA 1KHIA 2EYXA 4Z02A 2O9VA 3CCLT 1B07A 2GF7A 3OW2S 4M78B 4IIOA 1VQ6T 1M3CA 4OMNA 4R56A 1VQOT 3KXTA 4C0DC 4DBFA 1WI7A 3CPWP 5I11A 4JJCA 4M7AD 3ASKA 3KBGA 3WVEB 1U3OA 1Q82R 1C6VX 4F7UA 1Y96B 5LJ5h 1YP5A 1M9SA 3MP1A 2KXDA 2EAYA 1HYOA 1JJ2A 1BI2A 4JRKA 3S3NA 1M8MA 3J7AF 4A4KA 1IRXA 2GTOA 2M16A 1UUEA 3A8MB 3QHSA 5GAOq 2CP3A 2XMFA 2K3XA 4PJOA 4LNPA 2P0PA 4BD3A 4X9CA 1BK2A 1SPKA 3BE3A 2HL3A 2DVEA 2VXFA 3UA6A 1KQ1A 2NYSA 1WHJA 3CCRT 1VQLA 1K1ZA 5LJ3h 3J80E 4XTUA 3DLLA 1WQWA 4E7IA 1K8AC 2WACA 2DTOA 4MDWA 3CD6A 3GP8A 4PKCC 1VQ9A 1VQ9Q 5GANf 4XAXB 5FU7C 3N5BB 2HSEB 1TUGB 2OTLQ 5GAMe 1D3BB 2H3EB 1HD3A 3H6ZA 2K4YA 3A8GB 4JLIA 2DYIA 3MCAB 1KC8C 3C4SA 1BI0A 2F2VA 2L5QA 3EG9A 4R0KA 1EX4A 1VQMQ 2RF0A 3T9NA 1WDXA 1S72A 1RAFB 2M9UA 3G4ST 1JXOA 2DD4A 4ZTJA 2RM4A 5EG2A 1AWOA 1Q81R 2CS7A 5CQYA 4DBHA 5FLXE 4ORZA 1NYGA 3EHQA 1Z9ZA 2EYQA 3KUFA 3M0PA 3QIIA 4FM4B 3CCJQ 1JBMA 2AK5A 4QQGA 2AZVA 3H8ZA 4LD6A 1BKBA 1YNZA 1RAEB 4XTYA 4P5NA 1LCKA 1VUBA 3CC4A 4M7AE 2R5MA 2OAUA 2EGEA 1GFCA 4M78A 5L23A 2CZ7B 2DXBA 3M4GA 1TUDA 2DEQA 3OYAA 3HRUA 3QUIA 3VKIA 4IKFA 2LNVA 4MMKA 3RKXA 2YHTA 2ATCB 1GBQA 1YITA 2ZPIB 2DZ9A 4C5EA 1YBYA 3X26B 5GMKj 1MMDA 4MZPA 4BE2A 4M7AG 2PVGB 4M77D 1OV3A 4M75F 3G71Q 1Y96A 2QI2A 2DEUA 2JT4A 1VQPA 5I2SA 4HKEA 5GANj 2M51A 4N4HA 2F2WA 1K73C 2CSQA 5HY6A 4M78C 1RAAB 5C0MA 3LWIA 2RNAA 4D6WA 1PD0A 2BZXA 1N8RU 2LJ3A 2XHCA 4BI3A 2L3PA 2EVRA 3SWNB 2E6NA 5KYNA 1QW1A 2RJDA 2YLCA 4WCIA 1XQHA 3FIFA 1W1FA 2F5TX 2K6DA 4UC4A 4M7AB 4HCKA 4C8QD 5CKEA 2W0ZA 1UGSB 4B9WA 2HZYA 5GMKl 3CXCP 1X2QA 1ZA1B 2VWFA 5HKCA 2LTOA 2JTMA 4ELZC 1FYNA 4JRPA 3CCSA 4HVUA 3CCSQ 5IXBA 3QZ5B 1NEGA 3MPUB 4E2FB 3CC2T 2RO0A 2OTJA 1JEGA 4XQ3A 2YRVA 3M54A 3L2RA 2EWNA 1KQSA 1QWFA 4Y92A 4ZN3A 3CCVA 1WX6A 2HD0A 1NJIC 2E65A 1NEBA 5GAMg 3SD4A 3FB9A 2RQTA 4K11A 4LXCA 3PIPA 2K9GA 5KYYB 3CCLA 1KD1U 1XOVA 5KCHA 1SHFA 1UGVA 1VQ6A 1VQ6Q 3OYBA 1VQOA 9ATCB 1FXXA 4AG1C 1SKUB 3TU4K 3CCUA 3H0IA 2K5LA 4J9EA 5KYXB 1JO8A 3FJ5A 2LCCA 1Q82U 3I56T 5GANe 2ED1A 3EGUA 5FU6B 3UT1A 2LJ1A 1VQ4T 3I9QA 2A28A 1M1KU 4M77E 3EFSA 4JLGA 3FRNA 2K2VA 2LQKA 2DERA 4GLMA 2DXUA 1TG0A 1BIAA 7AT1B 4BDYA 1Q7YC 1Q86U 2HKQB 3LYIA 1WHLA 1O9SA 3OW2P 2DO3A 2PTKA 4ZGEB 1UJ0A 3JCMX 5GAN5 3TVTA 4M77G 4XTZA 1MV0B 2DVJA 3CCRA 1UG1A 2K7AA 4PFOA 3CCRQ 2K2MA 5CVIA 2J06A 4E7ZA 3VS2A 1CKAA 5A2QE 1YWPA 1NYFA 1VQ8T 3M4YA 2MPXC 4PJMA 1GBRA 4F7UF 1PWTA 2YRDA 3REAB 3JB9F 3PMTA 4RTTA 4FU6A 3A98A 4C8QE 1YJWA 1KQ2A 4D8KA 3LH5A 3H0FA 3LLRA 1QVGA 2KVQG 3OYKA 1IHVA 3L2WA 1U8RA 2JNGA 4LN2A 4EMKB 2L8DA 4PJOF 1YIJT 5I22A 4M77B 1XJWB 2QAZA 5DLOA 4C8QG 2DETA 3BFMA 3UDCA 1BB9A 4LDWA 3G4SQ 4LD9K 1H641 2NUTA 1QLYA 2QGFB 1OYXA 6AT1B 4N4GA 1Q82C 3RKYA 1MMNA 3P8BB 3HFNA 2CUBA 4J6XA 2PNIA 4LE9A 2QA4A 2KXCA 3PVQA 1U06A 3SWNC 2LQ8A 1PRMC 5FRNA 2X4XA 3C12A 3RMQA 1U1TA 4IUUA 4M7AC 4OGCA 2DL3A 5GMKh 3JCMV 1PG5B 2EJGA 1QCOA 1VIFA 1D1AA 3LH0A 3M0SA 1W2BA 2KAFA 3OMCA 2XKOC 2KE9A 1V76A 4C8QB 1YJNA 2RHYA 5GANh 4XTWA 2YUPA 1FWZA 3OS5A 2RK1A 5I2MA 2CT4A 1VQLT 1ARKA 2X3XD 5GAN8 1VQKQ 2DE0X 4IIMA 3LX7A 3CD6T 1KFZA 3INZA 2K79A 1N5ZA 3PGGA 2GFUA 3DB4A 1Y0MA 1ACMB 3EG0A 4RTWA 4M78F 5HCKA 2FPEA 5HK0A 2KGTA 1S72T 2OJ2A 5D7UA 1WJQA 2HQEA 3HRSA 3I5RA 4LDVA 1Q81C 2DK3A 5FU6C 5GAN6 4GBQA 1ABQA 4R55A 2X35A 3MKDA 3UATA 2QEXA 8ATCB 2MK5A 2ABLA 4A63B 1JRIA 2XI9A 3M57A 1KSWA 2G6FX 3JCMP 3RKWA 4C0ZA 3CC2Q 3E19A 1QCNA 1YFNA 2ED0A 3CC4T 3HL8A 4EMKA 2C0OA 2QDLA 1G3WA 4EMHA 1UFFA 3MEVA 5CK9A 3G6EA 2LQNA 4B9XA 3HKSA 3OBYA 1NZ9A 3OS2A 1YITT 3DLMA 5IN1A 2QG9B 3VRZA 1QMCA 1AWJA 1RI9A 1VQPT 2DFUA 4MZMA 2E41A 1I5OB 1WGSA 1TSFA 2PQWA 1PCXA 2CP7A 3L2ZA 5GAOp 3I56A 1M90U 1OQKA 4EMKC 2CZ1B 3C95A 1VQ4A 5IHNA 2E5KA 1VQNT 1M5Q1 4M77C 1AT1B 2L2PA 2DJQA 1IZ6A 4FYYB 3UF4A 1N8RR 2JTFA 3PE0A 1N9SA 2YUOA 2BKDN 2CH4A 2X4YA 1MHNA 4C92A 2DILA 2XK0A 3GOXA 4TVRA 4N4IA 2CZ6B 2H8HA 2QASA 3QJYA 3EH2A 3OYIA 3CPWA 2VGMA 4ELYC 4II1A 2H3JA 3C0CA 3NTIA 2D9TA 4BB7A 3BDLA 3E9GA 4RTVA 5KYWB 5LL6S 1HSQA 5GAOn 1VQ8Q 2KQWA 1PD1A 1BCMA 2R57A 1I5LA 2ESWA 4IUTA 5M9OA 4J83A 2NLUA 1N6AA 1SSHA 4M7DD 2K3YA 4FT2A 5GAMj 1X75C 5J3BA 3CCVT 1EFNA 2CDTA 3JCMd 2K5FA 4OB1B 4J9CA 4LDXA 4RMOA 1VA7A 5CO7A 1YIJA 5GAN3 1YIJQ 1KD1R 2I0NA 3VUZA 2AKKA 1RAGB 1VQ5A 1WLPB 3QWYA 1UGRB 4FL6A 2MIOA 3VU3C 2VXEA 4BUGA 3CCUT 3VS0A 3GF5A 1OZ2A 2RHIA 3BW1A 1BBZA 4A54A 3OYEA 1YI2A 1M4ZA 2KY9A 4J9IA 2MYSA 1AHJB 3V8JA 2JMCA 2RN8A 3OA6A 1M90C 1AWWA 4ANJA 1RABB 1AVZC 4MMLA 1RUWA 3R6OA 5GAOl 5CR2A 1QP2A 3OQ5A 1M1KR 2COYA 2FO0A 2NUZA 1NPPA 4ME7A 1WHGA 1Q86R 2K5IA 2HL5C 1AOJA 1G8XA 1G3YA 1GRIA 1K9MU 3OYDA 3CMEA 1C1AA 4ESRA 3H9NA 1ZX6A 3OSSC 4AFSC 2JVVA 1VYTA 1VQLQ 1H3HA 2KYBA 1RADB 2DXTA 2RQUA 1UB4A 2M0YA 3CD6Q 2D0QB 4RTYA 4EPCA 2HNIA 4XU0A 2CUDA 5A0LA 1YHQT 1BU1A 4JJDA 2F69A 1YJWT 2EFIA 1E7OA 2O2OA 3MO8A 3QYGB 3SFMA 4CC4B 5CKDA 2DL5A 2P4TA 4J8OA 2MAMA 1TH7A 2DXCA 4OGEA 2RD1A 2YXYA 4QW2A 4PFZA 2PUKB 1SG5A 1VYVA 4M7DE 4Y91A 2C0TA 1S72Q 1H8KA 2B86A 5I21A 2CREA 2DAQA 3A1PA 5KYUB 2DJZA 4XU3A 3CCQT 4JZ3A 2WSEE 2HKNA 4Z88A 3QXEB 1WHKA 1Z9QA 1S1NA 1X69A 3VS6A 1G5VA 1YJ9T 1GCQA 4CC2A 4WF2A 2QA4T 4HVVA 3FEOA 3BY7A 2IPOB 4M7DG 1QVFS 1X6GA 4DBQA 3MJXA 1R0CB 2DF6A 3EG2A 2EQIA 1V1CA 4RG8A 4FYWB 3OS0A 5CKBA 1VQ7A 3FDRA 3RBBB 4DQ2A 4IURA 3CC4Q 3QBYA 2ZAEA 1UJYA 2YLBA 4L6V5 2YT6A 1SRMA 5IHIA 4KH1B 2FZKB 1QWEA 4CC3A 4WTOB 3MEAA 3H41A 3UWNA 3ZFJA 5EC7A 5D6WA 2GGRA 3TSWA 1YJNT 1YITQ 3OYCA 3GBQA 1GCQC 3CXCA 3CCMA 1GCPA 1MMGA 4M75D 3QJ6A 4PLIA 4QVZA 1I4K1 1NM7A 1WZOA 4M7DB 2LCSA 3HHTB 1VQPQ 3NFCA
chains in the Genus database with same CATH topology
1GBRA 1T3LA 1PWTA 2RQRA 3REAB 3REBB 5IHKA 4KRTA 2K3BA 2YUQA 4HVWA 3THKA 2D1XA 1ZUKA 4RTTA 3A98A 4Z8AA 1UECA 2LP5A 2L3SA 4EIKA 2EYZA 1IO6A 3QWXX 4D8KA 1M27C 1T3SA 2HEQA 1K9AA 3H0FA 3LH5A 2J6KA 1KIKA 2JM8A 2FPDA 2A37A 4LN2A 5GJWB 1M3AA 1AD5A 2GBQA 5I22A 1RLQC 2JM9A 2CT3A 2KRNA 3EG1A 1JXMA 2JS0A 4M4ZA 1BB9A 4HXJA 1B3QA 2RQWA 1PRLC 2EKHA 2SEMA 4OMMA 1I0CA 1QLYA 2RPNA 4LE9A 2CUBA 2PNIA 2V1RA 4OMLA 2KXCA 3PVQA 2KYMA 1U06A 1PRMC 4LUDA 4AFQC 1JU5C 2BZYA 3SHWA 2W10A 2ECZA 4QT7A 4Z89A 5FW9A 2DL3A 1WYXA 1QKXA 1PKSA 5FWCA 1ZLMA 3M0SA 2F2XA 2KE9A 1YN8A 1X6BA 2FPFA 4RTXA 1GFDA 3I35A 1AEYA 1K76A 2YUPA 1RLPC 2EW3A 2O88A 2HSPA 2CT4A 3KFVA 1CKBA 1ARKA 2X3XD 2DA9A 2DE0X 4IIMA 2A08A 4OMOA 4J9FA 4JPBW 2GTJA 1T0HA 1KFZA 3NPFA 1ZBJA 1K0XA 2K79A 1N5ZA 3RNJA 4J9HA 1Y57A 1ZUYA 2C0IA 2YDLA 1MV3A 1Y0MA 3EG0A 4F16A 4RTWA 3ZL7C 2A36A 2JTEA 1SHGA 5HCKA 2HCKA 2O9SA 2FPEA 1OOTA 1W6XA 2D8JA 2EYXA 2KGTA 2EPDA 2OJ2A 2O9VA 1OPLA 2CSIA 3VS4A 1B07A 3I5RA 4CC7A 1OPKA 4IIOA 4GBQA 1ABQA 2J6OA 1M3CA 1X2KA 4OMNA 2FRYA 3UATA 2L3QA 4ZNXA 1KJWA 3ULRB 2NWMA 1WI7A 2ABLA 4A63B 5I11A 4JJCA 1SEMA 3VS3A 1KSWA 2G6FX 1U3OA 3M0RA 1ZUUA 2DLPA 2DM1A 2KROA 2ED0A 3JV3A 1YP5A 1E6HA 2C0OA 2KXDA 2QDLA 5ECAA 3I5SA 3NMZC 1UFFA 2JW4A 1K4US 1WXBA 1M8MA 2HBWA 2DMOA 2LZ6B 2LQNA 3U23A 2GTOA 2FEIA 1UUEA 2XMFA 2KBTA 1OEBA 1UTIA 4LNPA 1BK2A 1SPKA 2DYBA 4X1VA 2KEAA 2MCNA 2VVKA 3UA6A 3VRZA 1AWJA 1RI9A 1K1ZA 4JJBA 2FG0A 3VS5A 1FMKA 1ZSGA 3M0QA 3EHRA 5IHNA 2E5KA 5IH2A 1UE9A 2DRKA 1G83A 1HD3A 4OMQA 1M30A 2L2PA 2DJQA 3UF4A 2LQWA 1UHFA 3PE0A 2KT1A 5GJVB 2RMOA 2F2VA 2YUOA 2CH4A 4R0KA 2DILA 2JXBA 3H0HA 2EBPA 2H8HA 2ENMA 1E6GA 3CQTA 1AZEA 3UA7A 2RF0A 4J9GA 1WDXA 2YSQA 1UDLA 2AKLA 1WXTA 2X3WD 3NHNA 3C0CA 2J7IA 1JXOA 2V1QA 4RTVA 1AWOA 1H92A 1HSQA 4ORZA 1NLOC 1X27A 1NYGA 1A0NB 3EHQA 4OMPA 2P4RA 1Z9ZA 2ESWA 2CH4W 3M0PA 2EYYA 4AFZC 1SSHA 1X43A 1I1JA 2LJ0A 2AK5A 2AZVA 1EFNA 2IIMA 2J05A 1WIEA 1YNZA 2CDTA 2O31A 3M0TA 2LX7A 1U5SA 1LCKA 4J9CA 1I07A 1VA7A 1K0SA 2EGEA 1GL5A 1GFCA 2OAWA 3VS7A 2I0NA 5L23A 2AKKA 1TUDA 4D8DA 1WLPB 4FSSA 3QWYA 3TSZA 3IQLA 2MIOA 1GBQA 2SRCA 1ABOA 3VS0A 2LNHB 1BBZA 2RQVA 4J9IA 4RTZA 2JMCA 1OV3A 2RN8A 2D0NA 2EGCA 2VKNA 1AWWA 2GQIA 3VS1A 2JT4A 1AVZC 2KRMA 2BZ8A 1RUWA 2GNCA 4LUEA 2L0AA 2EYWA 2M51A 2FO0A 2F2WA 2DRMA 2NUZA 2ROLA 1UHCA 2CSQA 1AWXA 1NG2A 1AOJA 1GRIA 2RNAA 2BZXA 2OI3A 2LJ3A 1QCFA 2L3PA 2EVRA 1SRLA 2DL4A 2MOXA 4ESRA 4WCIA 1ZX6A 4AFSC 1PNJA 1W1FA 2JMAA 1VYTA 2K6DA 1H3HA 2KYBA 3R6NA 2JS2A 2PZ1A 2RQUA 4HCKA 2ROTA 2M0YA 3NGPA 2DNUA 4RUGA 2W0ZA 4RTYA 2DBMA 1X2QA 2VWFA 2DBKA 2CUDA 1WFWA 1BU1A 4DEXA 1FYNA 3VRYA 4JJDA 4HVUA 2DL8A 2YUNA 2AZSA 5IXBA 1E7OA 1NEGA 2O2OA 5FWBA 2LMJA 1WA7A 2DX1A 4CC4B 2EGAA 2KT8A 1CSKA 1JEGA 2DL5A 1QWFA 4Y92A 2KNBB 1WX6A 4F17A 1YCSB 1NEBA 3SEMA 1VYVA 2RQTA 2C0TA 3M0UA 4K11A 1H8KA 2B86A 2K9GA 2CREA 1HJDA 1XOVA 2D8HA 4J9DA 5IXFA 4AFUC 1SHFA 1UGVA 4JZ3A 4JZ4A 4J9BA 4Z88A 1MUZA 1Z9QA 1S1NA 1X69A 3VS6A 4F14A 1J3TA 1GCQA 4CC2A 4AG1C 1JQQA 1WXUA 4HVVA 3H0IA 1W70A 2BTTA 2KR3A 4J9EA 1AZGB 1X6GA 1JO8A 3FJ5A 2DF6A 3EG2A 2EQIA 1QKWA 2ED1A 3EGUA 1V1CA 2J6FA 2KRSA 4RTUA 2LJ1A 3RBBB 3I9QA 2FRWA 4AG2C 4DEYA 2A28A 1UJYA 2YT6A 2DL7A 1SRMA 5IHIA 4GLMA 1YWOA 1QWEA 1VYUA 1TG0A 4CC3A 3H41A 3O5ZA 1PHTA 5EC7A 2GGRA 3TSWA 2HDAA 3EG3A 1PKTA 2PTKA 3GBQA 1UJ0A 1GCQC 4E6RA 3TVTA 1M3BA 1T0JA 1GCPA 1MV0B 1TUCA 2DVJA 1NM7A 1UG1A 2K7AA 2K2MA 2LCSA 2J06A 1G2BA 3VS2A 1CKAA 1NLPC 1YWPA 1NYFA 3PVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GBR A;  1T3L A;  1PWT A;  2RQR A;  3REA B;  3REB B;  5IHK A;  4KRT A;  2K3B A;  2YUQ A;  4HVW A;  3THK A;  2D1X A;  1ZUK A;  4RTT A;  3A98 A;  4Z8A A;  1UEC A;  2LP5 A;  2L3S A;  4EIK A;  2EYZ A;  1IO6 A;  3QWX X;  4D8K A;  1M27 C;  1T3S A;  2HEQ A;  1K9A A;  3H0F A;  3LH5 A;  2J6K A;  1KIK A;  2JM8 A;  2FPD A;  2A37 A;  4LN2 A;  5GJW B;  1M3A A;  1AD5 A;  2GBQ A;  5I22 A;  1RLQ C;  2JM9 A;  2CT3 A;  2KRN A;  3EG1 A;  1JXM A;  2JS0 A;  4M4Z A;  1BB9 A;  4HXJ A;  1B3Q A;  2RQW A;  1PRL C;  2EKH A;  2SEM A;  4OMM A;  1I0C A;  1QLY A;  2RPN A;  4LE9 A;  2CUB A;  2PNI A;  2V1R A;  4OML A;  2KXC A;  3PVQ A;  2KYM A;  1U06 A;  1PRM C;  4LUD A;  4AFQ C;  1JU5 C;  2BZY A;  3SHW A;  2W10 A;  2ECZ A;  4QT7 A;  4Z89 A;  5FW9 A;  2DL3 A;  1WYX A;  1QKX A;  1PKS A;  5FWC A;  1ZLM A;  3M0S A;  2F2X A;  2KE9 A;  1YN8 A;  1X6B A;  2FPF A;  4RTX A;  1GFD A;  3I35 A;  1AEY A;  1K76 A;  2YUP A;  1RLP C;  2EW3 A;  2O88 A;  2HSP A;  2CT4 A;  3KFV A;  1CKB A;  1ARK A;  2X3X D;  2DA9 A;  2DE0 X;  4IIM A;  2A08 A;  4OMO A;  4J9F A;  4JPB W;  2GTJ A;  1T0H A;  1KFZ A;  3NPF A;  1ZBJ A;  1K0X A;  2K79 A;  1N5Z A;  3RNJ A;  4J9H A;  1Y57 A;  1ZUY A;  2C0I A;  2YDL A;  1MV3 A;  1Y0M A;  3EG0 A;  4F16 A;  4RTW A;  3ZL7 C;  2A36 A;  2JTE A;  1SHG A;  5HCK A;  2HCK A;  2O9S A;  2FPE A;  1OOT A;  1W6X A;  2D8J A;  2EYX A;  2KGT A;  2EPD A;  2OJ2 A;  2O9V A;  1OPL A;  2CSI A;  3VS4 A;  1B07 A;  3I5R A;  4CC7 A;  1OPK A;  4IIO A;  4GBQ A;  1ABQ A;  2J6O A;  1M3C A;  1X2K A;  4OMN A;  2FRY A;  3UAT A;  2L3Q A;  4ZNX A;  1KJW A;  3ULR B;  2NWM A;  1WI7 A;  2ABL A;  4A63 B;  5I11 A;  4JJC A;  1SEM A;  3VS3 A;  1KSW A;  2G6F X;  1U3O A;  3M0R A;  1ZUU A;  2DLP A;  2DM1 A;  2KRO A;  2ED0 A;  3JV3 A;  1YP5 A;  1E6H A;  2C0O A;  2KXD A;  2QDL A;  5ECA A;  3I5S A;  3NMZ C;  1UFF A;  2JW4 A;  1K4U S;  1WXB A;  1M8M A;  2HBW A;  2DMO A;  2LZ6 B;  2LQN A;  3U23 A;  2GTO A;  2FEI A;  1UUE A;  2XMF A;  2KBT A;  1OEB A;  1UTI A;  4LNP A;  1BK2 A;  1SPK A;  2DYB A;  4X1V A;  2KEA A;  2MCN A;  2VVK A;  3UA6 A;  3VRZ A;  1AWJ A;  1RI9 A;  1K1Z A;  4JJB A;  2FG0 A;  3VS5 A;  1FMK A;  1ZSG A;  3M0Q A;  3EHR A;  5IHN A;  2E5K A;  5IH2 A;  1UE9 A;  2DRK A;  1G83 A;  1HD3 A;  4OMQ A;  1M30 A;  2L2P A;  2DJQ A;  3UF4 A;  2LQW A;  1UHF A;  3PE0 A;  2KT1 A;  5GJV B;  2RMO A;  2F2V A;  2YUO A;  2CH4 A;  4R0K A;  2DIL A;  2JXB A;  3H0H A;  2EBP A;  2H8H A;  2ENM A;  1E6G A;  3CQT A;  1AZE A;  3UA7 A;  2RF0 A;  4J9G A;  1WDX A;  2YSQ A;  1UDL A;  2AKL A;  1WXT A;  2X3W D;  3NHN A;  3C0C A;  2J7I A;  1JXO A;  2V1Q A;  4RTV A;  1AWO A;  1H92 A;  1HSQ A;  4ORZ A;  1NLO C;  1X27 A;  1NYG A;  1A0N B;  3EHQ A;  4OMP A;  2P4R A;  1Z9Z A;  2ESW A;  2CH4 W;  3M0P A;  2EYY A;  4AFZ C;  1SSH A;  1X43 A;  1I1J A;  2LJ0 A;  2AK5 A;  2AZV A;  1EFN A;  2IIM A;  2J05 A;  1WIE A;  1YNZ A;  2CDT A;  2O31 A;  3M0T A;  2LX7 A;  1U5S A;  1LCK A;  4J9C A;  1I07 A;  1VA7 A;  1K0S A;  2EGE A;  1GL5 A;  1GFC A;  2OAW A;  3VS7 A;  2I0N A;  5L23 A;  2AKK A;  1TUD A;  4D8D A;  1WLP B;  4FSS A;  3QWY A;  3TSZ A;  3IQL A;  2MIO A;  1GBQ A;  2SRC A;  1ABO A;  3VS0 A;  2LNH B;  1BBZ A;  2RQV A;  4J9I A;  4RTZ A;  2JMC A;  1OV3 A;  2RN8 A;  2D0N A;  2EGC A;  2VKN A;  1AWW A;  2GQI A;  3VS1 A;  2JT4 A;  1AVZ C;  2KRM A;  2BZ8 A;  1RUW A;  2GNC A;  4LUE A;  2L0A A;  2EYW A;  2M51 A;  2FO0 A;  2F2W A;  2DRM A;  2NUZ A;  2ROL A;  1UHC A;  2CSQ A;  1AWX A;  1NG2 A;  1AOJ A;  1GRI A;  2RNA A;  2BZX A;  2OI3 A;  2LJ3 A;  1QCF A;  2L3P A;  2EVR A;  1SRL A;  2DL4 A;  2MOX A;  4ESR A;  4WCI A;  1ZX6 A;  4AFS C;  1PNJ A;  1W1F A;  2JMA A;  1VYT A;  2K6D A;  1H3H A;  2KYB A;  3R6N A;  2JS2 A;  2PZ1 A;  2RQU A;  4HCK A;  2ROT A;  2M0Y A;  3NGP A;  2DNU A;  4RUG A;  2W0Z A;  4RTY A;  2DBM A;  1X2Q A;  2VWF A;  2DBK A;  2CUD A;  1WFW A;  1BU1 A;  4DEX A;  1FYN A;  3VRY A;  4JJD A;  4HVU A;  2DL8 A;  2YUN A;  2AZS A;  5IXB A;  1E7O A;  1NEG A;  2O2O A;  5FWB A;  2LMJ A;  1WA7 A;  2DX1 A;  4CC4 B;  2EGA A;  2KT8 A;  1CSK A;  1JEG A;  2DL5 A;  1QWF A;  4Y92 A;  2KNB B;  1WX6 A;  4F17 A;  1YCS B;  1NEB A;  3SEM A;  1VYV A;  2RQT A;  2C0T A;  3M0U A;  4K11 A;  1H8K A;  2B86 A;  2K9G A;  2CRE A;  1HJD A;  1XOV A;  2D8H A;  4J9D A;  5IXF A;  4AFU C;  1SHF A;  1UGV A;  4JZ3 A;  4JZ4 A;  4J9B A;  4Z88 A;  1MUZ A;  1Z9Q A;  1S1N A;  1X69 A;  3VS6 A;  4F14 A;  1J3T A;  1GCQ A;  4CC2 A;  4AG1 C;  1JQQ A;  1WXU A;  4HVV A;  3H0I A;  1W70 A;  2BTT A;  2KR3 A;  4J9E A;  1AZG B;  1X6G A;  1JO8 A;  3FJ5 A;  2DF6 A;  3EG2 A;  2EQI A;  1QKW A;  2ED1 A;  3EGU A;  1V1C A;  2J6F A;  2KRS A;  4RTU A;  2LJ1 A;  3RBB B;  3I9Q A;  2FRW A;  4AG2 C;  4DEY A;  2A28 A;  1UJY A;  2YT6 A;  2DL7 A;  1SRM A;  5IHI A;  4GLM A;  1YWO A;  1QWE A;  1VYU A;  1TG0 A;  4CC3 A;  3H41 A;  3O5Z A;  1PHT A;  5EC7 A;  2GGR A;  3TSW A;  2HDA A;  3EG3 A;  1PKT A;  2PTK A;  3GBQ A;  1UJ0 A;  1GCQ C;  4E6R A;  3TVT A;  1M3B A;  1T0J A;  1GCP A;  1MV0 B;  1TUC A;  2DVJ A;  1NM7 A;  1UG1 A;  2K7A A;  2K2M A;  2LCS A;  2J06 A;  1G2B A;  3VS2 A;  1CKA A;  1NLP C;  1YWP A;  1NYF A;  3PVL A; 
#chains in the Genus database with same CATH topology
 1W4S A;  1ZBX A;  4PLL A;  2RQR A;  4KRT A;  5GAO r;  2YUQ A;  4HVW A;  3THK A;  1VQN A;  1VQN Q;  4EIK A;  2L3S A;  3FC3 A;  1M27 C;  5LJ5 d;  2HEQ A;  1K9A A;  2J6K A;  1N27 A;  3X25 B;  2JM8 A;  2MWP A;  4DBR A;  1M2V B;  1IGU A;  5C6S A;  1AD5 A;  2QGG A;  5GAM h;  2CT3 A;  1RAH B;  2KRN A;  2QEX T;  2MF2 A;  3TRE A;  3JB9 I;  1PRL C;  2SEM A;  3MP8 A;  1D3B A;  1LVK A;  5CIU A;  5IT9 E;  2RPN A;  3A5Z B;  1MND A;  5LJ3 d;  2E3H A;  1QVP A;  4OML A;  2RH2 A;  2OTJ Q;  2CKK A;  5CCA A;  2XG8 D;  3CCV Q;  4LUD A;  3OW2 A;  3G6E T;  3OY9 A;  4C92 F;  4Z89 A;  1M1F A;  2QQS A;  4Y28 E;  5KYU A;  1PKS A;  4YTL A;  3CCL Q;  1ZLM A;  2F2X A;  4FT4 A;  3CMA A;  1YN8 A;  3JCM J;  2FPF A;  4RTX A;  4C5G A;  1VQO Q;  2AIR B;  1GFD A;  1AEY A;  1K76 A;  4C0G A;  4A4F A;  2YWW A;  3CCU Q;  1MMA A;  4BI8 B;  4QVD A;  1N9R A;  4OMO A;  1Y07 A;  4A4H A;  5D6Y A;  2GTJ A;  1M90 R;  4IUQ A;  4MZT A;  2ZPE B;  3E9F A;  1K0X A;  3JRZ A;  2P0K A;  4M75 E;  3RNJ A;  4J9H A;  2R58 A;  1Y57 A;  1N8R C;  1ZQ1 A;  3V7S A;  2C0I A;  5CQX A;  3V8K A;  2PU9 B;  2YDL A;  1MV3 A;  3OSV A;  5CKF A;  3RES A;  1SHG A;  2HCK A;  3JCM c;  3TCJ A;  4FIB A;  5GAN 2;  1OOT A;  1OI1 A;  4M75 G;  2EPD A;  3EGD B;  1OPL A;  2CSI A;  2V26 A;  2CYZ B;  3M58 A;  4CC7 A;  3EFO B;  1OPK A;  2DTI A;  1X2K A;  2L3Q A;  3JB9 D;  4ZNX A;  4XTV A;  1YHQ A;  1YHQ Q;  3CBM A;  3EFR A;  3JCM b;  2VUB A;  3M0R A;  1YJW Q;  1ZUU A;  1FMW A;  2MWO A;  3SWN A;  2KRO A;  4LDY A;  3JV3 A;  4NL3 A;  1E6H A;  3JAM E;  4PJO D;  1KD1 C;  5ECA A;  3NMZ C;  5GAO m;  2QK0 A;  1D09 B;  1OZ3 A;  4M7A A;  3L1A A;  1VQ5 T;  4M75 B;  4M7D C;  2HBW A;  2LZ6 B;  3U23 A;  4KGX B;  4JDS A;  1WNL A;  2YRC A;  5DLQ E;  3OYL A;  3CCQ A;  2KBT A;  1OEB A;  1UTI A;  2ZPH B;  5FRO A;  1YI2 T;  2KEA A;  2VVK A;  1YJ9 A;  1PM3 A;  2QA4 Q;  2DPP B;  3QZ9 B;  3EH1 A;  4OMF B;  3RMS A;  2FG0 A;  4VUB A;  3G1J A;  2X9H A;  2KDS A;  3LGL A;  5J26 A;  1M1K C;  4A53 A;  2HBP A;  3QKJ A;  3EHR A;  1Q86 C;  2CZ0 B;  5KYY A;  1G83 A;  3OB9 A;  1M30 A;  4HCB A;  1K9M R;  3NTK A;  3CME T;  2E3I A;  3HFO A;  2RMO A;  3CCE T;  1YJN Q;  1ZSZ B;  1F1B B;  2JXB A;  4RCC A;  2E1H A;  5AT1 B;  5FRM A;  2BUD A;  1E6G A;  2ENM A;  3RER A;  1QQJ A;  5KYX A;  3CQT A;  1BI3 A;  2JUF A;  2YSQ A;  1JJ2 S;  3S6W A;  1UDL A;  2AKL A;  3HRT A;  3NHN A;  2J7I A;  1Y71 A;  1QVF P;  1WJR A;  4FW2 A;  1NLO C;  1X27 A;  3PT9 A;  3RIR A;  2CH4 W;  3JSC A;  1QP3 A;  3VYG A;  1C0M A;  1NE8 A;  4AFZ C;  4ATO A;  4J6Y A;  3MP6 A;  4F7U E;  1G3T A;  1WIE A;  2O31 A;  3M0T A;  1U5S A;  2M02 A;  2OTL T;  3EGD A;  1I07 A;  1I81 A;  2VB6 A;  2ZCF B;  3GNF B;  1K0S A;  1GL5 A;  3VS7 A;  4D8D A;  4FSS A;  1BI1 A;  3CC7 A;  4BE0 A;  4F7U G;  1WHM A;  3MHX A;  2QEX Q;  4PJO E;  3JB9 G;  2SRC A;  2QYZ A;  3VJP A;  4O6J A;  3OYJ A;  4BE1 A;  2E6Z A;  2RQV A;  2FL7 A;  4RTZ A;  2D0N A;  1MNE A;  2VKN A;  3JCM g;  2GQI A;  4BY6 B;  1VQ7 T;  2KRM A;  1EIF A;  2GNC A;  4LUE A;  1H3Z A;  4PJO G;  2L0A A;  1EZZ B;  4X9D A;  2EYW A;  2CP5 A;  4AT1 B;  4M77 A;  3G6E Q;  5KH6 A;  3CCJ T;  2RJF A;  1NG2 A;  2FYK A;  4KT0 E;  2GQV A;  3QDF A;  4PK4 A;  3CCM T;  2B8A A;  4KUI A;  2MOX A;  2VC8 A;  2HQH A;  2FVU A;  4OB3 B;  2ROT A;  3NGP A;  3I56 Q;  4E7K A;  2ZPG B;  4FYV B;  3P8H A;  1KK7 A;  1VQ4 Q;  1TXQ A;  2LDM A;  1WFW A;  4PJO B;  1D1B A;  4M75 C;  3L42 A;  4DEX A;  4OB2 B;  2DL8 A;  2YUN A;  1M2O A;  4HA8 A;  1BIB A;  1X6O A;  2EQJ A;  1WHH A;  2DX1 A;  2LMJ A;  4OB0 B;  1WJS A;  2KT8 A;  2R5A A;  4C8Q A;  1CSK A;  2A7Y A;  2O01 E;  4PJJ A;  4Q5W A;  5D6X A;  3ME9 A;  4F17 A;  1YCS B;  2C06 A;  2QQB A;  4E7H A;  2F5K A;  3SEM A;  4OVA A;  4M78 E;  3I55 A;  1D0Z A;  4FCY A;  4JUV A;  2GCX A;  3AT1 B;  3OYY A;  5IXF A;  2XID A;  3V7C A;  2EQM A;  1B34 B;  1M1G A;  5GAN d;  4F14 A;  3EG9 B;  1JB0 E;  1JQQ A;  1W70 A;  2BTT A;  2COZ A;  1AZG B;  4GY5 A;  4M78 G;  5KE3 A;  4N0A C;  1HK9 A;  1R77 A;  4C8Q C;  1PSE A;  4XU1 A;  1ZSZ C;  2KRS A;  3MET A;  1DJ7 B;  3L2U A;  2P0Q A;  1K8A U;  1IB8 A;  2ZGW A;  2ZZD A;  3VV0 A;  4BI4 A;  4NOY A;  3C94 A;  1YWO A;  1VYU A;  4E7J A;  3P8D A;  1VQ5 Q;  3O5Z A;  4EDU A;  1PHT A;  4ZGD B;  3CMA T;  1VIE A;  3AHU A;  1PSF A;  2VAS A;  1PKT A;  2XDD A;  4E6R A;  1KC8 U;  1M3B A;  1T0J A;  1YI2 Q;  1KQS S;  4QQD A;  1LPL A;  2KK4 A;  1TUC A;  2HAX A;  2Y4X A;  3PFS A;  1G2B A;  2DKG A;  1OU9 A;  3PNW C;  1T3L A;  3REB B;  5IHK A;  1RAI B;  3E1S A;  2O4X B;  4NS5 A;  4M7A F;  4Z8A A;  1UEC A;  2EYZ A;  2QQ9 A;  3CME Q;  1T3S A;  1RAC B;  3M56 A;  3CCE A;  2FPD A;  3CCE Q;  2XDB A;  4HT8 A;  2GBQ A;  4BY6 C;  1RLQ C;  2JM9 A;  2JOY A;  2COW A;  2L3R A;  1JXM A;  2JS0 A;  4HXJ A;  1B3Q A;  2K57 A;  2G3R A;  3GNG A;  2EKH A;  4OMM A;  1R8O B;  1I0C A;  3TQ7 P;  1Q95 G;  1OU8 A;  1RL2 A;  5LJ5 g;  1KG1 A;  1RI0 A;  3X20 B;  2QDY B;  2Z0W A;  4FSX A;  4KUD K;  2XD0 A;  4AFQ C;  2BZY A;  2VGN A;  3SHW A;  2W10 A;  2ECZ A;  5J39 A;  3URG A;  4QT7 A;  2BE7 D;  2OTL A;  5FW9 A;  1WYX A;  1QKX A;  3HTR A;  3HP9 A;  3V7R A;  1FMV A;  5KYW A;  1B34 A;  3A8O B;  5L8R E;  4AMC A;  4HCZ A;  1K73 U;  3OYG A;  2LT4 A;  1X6B A;  1JJ2 P;  4PJO C;  2WSC E;  3JCM f;  2I2L A;  3ZEH A;  2NUP B;  5LJ3 g;  2O88 A;  2HSP A;  1QVG S;  1VQM A;  4IUP A;  1BYM A;  2DA9 A;  2PUO B;  2A08 A;  2XU8 A;  4BAC A;  3RUX A;  4OP0 A;  2RJC A;  3NTH A;  3NPF A;  1VQ7 Q;  2Y90 A;  1ZBJ A;  2QQR A;  1K9M C;  2XDP A;  2EQU A;  2JZ2 A;  2WSF E;  1ZUY A;  2RB6 A;  4B6M A;  1O75 A;  3CCJ A;  3ZL7 C;  2A36 A;  2JTE A;  2QXF A;  2M0O A;  2O9S A;  1W6X A;  4ZN1 A;  1IXD A;  4L59 A;  2D8J A;  3CCM Q;  2KMT A;  3EAE A;  3EGX B;  3OS1 A;  3OYN A;  3VS4 A;  1NJI U;  2RHU A;  2J6O A;  1UGP B;  2FRY A;  4A4E A;  1KJW A;  2X51 A;  3ULR B;  2NWM A;  1W2B S;  4KGV B;  4DOW A;  2O4X A;  1VQK T;  1SEM A;  4J6W A;  3VS3 A;  5CAI A;  3M9Q A;  3G71 A;  3WXM B;  4M77 F;  2DLP A;  2DM1 A;  1D1C A;  3S3M A;  5A0D A;  1R0B G;  2LRQ A;  3I5S A;  5KCO A;  2V8I A;  4E47 A;  2Y4Y A;  2FB7 A;  2JW4 A;  3OBW A;  1K4U S;  2QQA A;  1WXB A;  4KUL A;  1Y7X A;  2DMO A;  5AYF A;  3CC7 T;  2FEI A;  3BDU A;  1SSF A;  1IRE B;  1Q7Y U;  1IHW A;  2DYB A;  3SB2 A;  4X1V A;  2MCN A;  1TTH B;  2E10 A;  4JJB A;  5HK3 A;  1TWB A;  2QTV A;  3VS5 A;  2EJF A;  1FMK A;  2RI3 A;  2AHJ B;  2RI2 A;  3F70 A;  4C8Q F;  1ZSG A;  3M0Q A;  4C92 D;  1SF9 A;  5IH2 A;  3HSB A;  1UE9 A;  2DRK A;  1MGQ A;  2E12 A;  2NUT B;  4OMQ A;  3O8V A;  2LQW A;  4PFP A;  1UHF A;  1ZHI A;  2KT1 A;  5GJV B;  3CMA Q;  4A4G A;  3JB9 H;  2NUP A;  2DTH A;  4JRQ A;  3H0H A;  2EBP A;  4KGZ B;  1AZE A;  3UA7 A;  4J9G A;  8AT1 B;  3CEY A;  2RK2 A;  1UEB A;  4XK8 E;  1WXT A;  2X3W D;  3M59 A;  4QKU A;  3OYM A;  4KH0 B;  2EIF A;  2DD5 A;  3VYH B;  5GAN 4;  2V1Q A;  1H92 A;  3TEE A;  5GMK e;  1PC0 A;  1P92 A;  1D0X A;  3M55 A;  1A0N B;  1BCO A;  5A0G A;  4OMP A;  2P4R A;  4MDX A;  2EYY A;  4F04 B;  3PMI A;  1X43 A;  1I1J A;  2LJ0 A;  2IIM A;  2J05 A;  3UPU A;  1V29 B;  2V8J A;  3FLG A;  2LX7 A;  3EGX A;  3JCM W;  3I55 T;  2OAW A;  4M7D A;  2KI7 A;  2LVM A;  2X4J A;  3JCM e;  1KQS P;  3TSZ A;  3QPH A;  2RA2 A;  2FHD A;  3S3O A;  3IQL A;  5LJ5 f;  1ABO A;  4ZTF A;  2LNH B;  3X28 B;  3L2Q A;  2DIG A;  4C5H A;  4OF1 A;  2EGC A;  3VS1 A;  2CP2 A;  3CPW S;  2BZ8 A;  4J7F A;  3RDV A;  1M2V A;  2LC4 A;  1K8A R;  4HCC A;  2DRM A;  2ROL A;  3G7Z A;  1UHC A;  1AWX A;  3A8L B;  1I8F A;  5LJ3 f;  2OI3 A;  3CBO A;  4C92 E;  3CCQ Q;  3PIO A;  1QCF A;  4FW1 A;  3GIB A;  1QVF A;  4J7I A;  2IG0 A;  1SRL A;  1NPR A;  2DL4 A;  1KC8 R;  3QO3 A;  2BIV A;  3OMG A;  1YJ9 Q;  1PNJ A;  2JMA A;  4EMG A;  4XU2 A;  4C5I A;  5GAM d;  3R6N A;  2JS2 A;  4ZGJ B;  2PZ1 A;  2D6F A;  2BE9 B;  2DNU A;  3QYH B;  4RUG A;  2VV5 A;  2DBM A;  4C92 G;  4J5Y A;  2EQK A;  3G4S A;  1Q81 U;  2DBK A;  4PNO A;  2MI6 A;  3ZBD A;  4IUV A;  1KHC A;  1OX8 A;  3VRY A;  2E64 A;  2AZS A;  1IGQ A;  5FWB A;  1WA7 A;  2EGA A;  2XIC A;  3OYH A;  2RHX A;  2KSS A;  4JRI A;  3PTA A;  2DIQ A;  2KNB B;  3LGF A;  1LOJ A;  2AT1 B;  2JJ9 A;  3M0U A;  1HJD A;  2D8H A;  4J9D A;  3JCM Q;  1QVG P;  4AFU C;  4JZ4 A;  5LJ5 j;  2A0F B;  4J9B A;  3V8L A;  1MUZ A;  1J3T A;  4C92 B;  4E7S A;  2V8K A;  2HMA A;  1OX9 A;  2E70 A;  3SDZ A;  1WXU A;  2KR3 A;  4M78 D;  1VQK A;  1D0Y A;  2CP0 A;  1QKW A;  3M53 A;  2J6F A;  1VQ9 T;  2LX9 A;  2CGH A;  4RTU A;  4CRI A;  3JCM h;  3X24 B;  1XTD A;  2FRW A;  4E7L A;  3WVD B;  2EJ9 A;  4C0D B;  4AG2 C;  4DEY A;  2FZG B;  1LJO A;  1M8V A;  3EFO A;  2DL7 A;  2QTX A;  5LJ3 j;  4L5G A;  1WPY A;  2GFA A;  5GAN g;  3CC7 Q;  1TS9 A;  3GLX A;  2HDA A;  3EG3 A;  1K73 R;  4KBM B;  3ER0 A;  2RHZ A;  3QDR B;  1NBE B;  3E2U A;  3MEW A;  1VQM T;  3QG1 A;  5KE2 A;  3CBP A;  3OYF A;  4C0F A;  2LT1 A;  4PJN A;  4PL6 A;  2IVW A;  1XNI A;  1W2B P;  4CI0 C;  3RR6 A;  3J81 E;  3DKM A;  1NLP C;  4V2S A;  3PVL A;  2ZPF B;  1TOV A;  4O5V A;  3LW5 E;  2K3B A;  4M75 A;  3JB9 J;  3MEU A;  4DA4 A;  2D1X A;  2DZC A;  2L89 A;  1ZUK A;  2JN0 A;  2LP5 A;  5GAM f;  2PVO B;  1IO6 A;  3QWX X;  3CC2 A;  5DY9 A;  2FZC B;  4LDU A;  4F7U B;  3QSU A;  1KIK A;  4DOV A;  3GPL A;  1X01 A;  4FYX B;  1B7T A;  3CPF A;  2A37 A;  3FJP A;  2MMP A;  5GJW B;  2ZPB B;  1HXD A;  5DM7 R;  5FU7 B;  1M3A A;  1NJI R;  3VUB A;  5LJ5 e;  4RG2 A;  2EKO A;  3EG1 A;  4M4Z A;  5IAY A;  2RQW A;  3D7S B;  3L2V A;  4PJL A;  5CKH A;  4QVC A;  3G71 T;  2RJE A;  4JS5 A;  2V1R A;  4XTX A;  4N0A A;  3CXC S;  2KYM A;  1LNX A;  1ZSZ A;  1OUL A;  1VOM A;  2CP6 A;  4X34 A;  1JU5 C;  2RI5 A;  2VYT A;  4JS4 A;  3LWH A;  1TU0 B;  5LJ3 e;  2F1L A;  2PVD B;  5GMK m;  4JJN K;  3I55 Q;  2A3L A;  5FWC A;  5GAN 7;  1ZA2 B;  4RCB A;  1YCY A;  3HPW A;  2M1H A;  1WQ7 A;  4QQ6 A;  2P84 A;  1Q7Y R;  2E5Q A;  3I35 A;  1UGQ B;  1RLP C;  2EW3 A;  3DB3 A;  1U1S A;  1CKB A;  3KFV A;  4BDZ A;  3M5A A;  1GXI E;  1FX7 A;  4GLK A;  2E4H A;  4J9F A;  4JPB W;  1T0H A;  1VQ8 A;  4NL2 A;  3CCS T;  1G3S A;  5GMK i;  4RKU E;  2OX7 A;  4HT9 A;  2OTJ T;  2X4W A;  4F16 A;  3A8H B;  4M7D F;  2LCL A;  4C92 C;  2HQX A;  3Q1J A;  1KHI A;  2EYX A;  4Z02 A;  2O9V A;  3CCL T;  1B07 A;  2GF7 A;  3OW2 S;  4M78 B;  4IIO A;  1VQ6 T;  1M3C A;  4OMN A;  4R56 A;  1VQO T;  3KXT A;  4C0D C;  4DBF A;  1WI7 A;  3CPW P;  5I11 A;  4JJC A;  4M7A D;  3ASK A;  3KBG A;  3WVE B;  1U3O A;  1Q82 R;  1C6V X;  4F7U A;  1Y96 B;  5LJ5 h;  1YP5 A;  1M9S A;  3MP1 A;  2KXD A;  2EAY A;  1HYO A;  1JJ2 A;  1BI2 A;  4JRK A;  3S3N A;  1M8M A;  3J7A F;  4A4K A;  1IRX A;  2GTO A;  2M16 A;  1UUE A;  3A8M B;  3QHS A;  5GAO q;  2CP3 A;  2XMF A;  2K3X A;  4PJO A;  4LNP A;  2P0P A;  4BD3 A;  4X9C A;  1BK2 A;  1SPK A;  3BE3 A;  2HL3 A;  2DVE A;  2VXF A;  3UA6 A;  1KQ1 A;  2NYS A;  1WHJ A;  3CCR T;  1VQL A;  1K1Z A;  5LJ3 h;  3J80 E;  4XTU A;  3DLL A;  1WQW A;  4E7I A;  1K8A C;  2WAC A;  2DTO A;  4MDW A;  3CD6 A;  3GP8 A;  4PKC C;  1VQ9 A;  1VQ9 Q;  5GAN f;  4XAX B;  5FU7 C;  3N5B B;  2HSE B;  1TUG B;  2OTL Q;  5GAM e;  1D3B B;  2H3E B;  1HD3 A;  3H6Z A;  2K4Y A;  3A8G B;  4JLI A;  2DYI A;  3MCA B;  1KC8 C;  3C4S A;  1BI0 A;  2F2V A;  2L5Q A;  3EG9 A;  4R0K A;  1EX4 A;  1VQM Q;  2RF0 A;  3T9N A;  1WDX A;  1S72 A;  1RAF B;  2M9U A;  3G4S T;  1JXO A;  2DD4 A;  4ZTJ A;  2RM4 A;  5EG2 A;  1AWO A;  1Q81 R;  2CS7 A;  5CQY A;  4DBH A;  5FLX E;  4ORZ A;  1NYG A;  3EHQ A;  1Z9Z A;  2EYQ A;  3KUF A;  3M0P A;  3QII A;  4FM4 B;  3CCJ Q;  1JBM A;  2AK5 A;  4QQG A;  2AZV A;  3H8Z A;  4LD6 A;  1BKB A;  1YNZ A;  1RAE B;  4XTY A;  4P5N A;  1LCK A;  1VUB A;  3CC4 A;  4M7A E;  2R5M A;  2OAU A;  2EGE A;  1GFC A;  4M78 A;  5L23 A;  2CZ7 B;  2DXB A;  3M4G A;  1TUD A;  2DEQ A;  3OYA A;  3HRU A;  3QUI A;  3VKI A;  4IKF A;  2LNV A;  4MMK A;  3RKX A;  2YHT A;  2ATC B;  1GBQ A;  1YIT A;  2ZPI B;  2DZ9 A;  4C5E A;  1YBY A;  3X26 B;  5GMK j;  1MMD A;  4MZP A;  4BE2 A;  4M7A G;  2PVG B;  4M77 D;  1OV3 A;  4M75 F;  3G71 Q;  1Y96 A;  2QI2 A;  2DEU A;  2JT4 A;  1VQP A;  5I2S A;  4HKE A;  5GAN j;  2M51 A;  4N4H A;  2F2W A;  1K73 C;  2CSQ A;  5HY6 A;  4M78 C;  1RAA B;  5C0M A;  3LWI A;  2RNA A;  4D6W A;  1PD0 A;  2BZX A;  1N8R U;  2LJ3 A;  2XHC A;  4BI3 A;  2L3P A;  2EVR A;  3SWN B;  2E6N A;  5KYN A;  1QW1 A;  2RJD A;  2YLC A;  4WCI A;  1XQH A;  3FIF A;  1W1F A;  2F5T X;  2K6D A;  4UC4 A;  4M7A B;  4HCK A;  4C8Q D;  5CKE A;  2W0Z A;  1UGS B;  4B9W A;  2HZY A;  5GMK l;  3CXC P;  1X2Q A;  1ZA1 B;  2VWF A;  5HKC A;  2LTO A;  2JTM A;  4ELZ C;  1FYN A;  4JRP A;  3CCS A;  4HVU A;  3CCS Q;  5IXB A;  3QZ5 B;  1NEG A;  3MPU B;  4E2F B;  3CC2 T;  2RO0 A;  2OTJ A;  1JEG A;  4XQ3 A;  2YRV A;  3M54 A;  3L2R A;  2EWN A;  1KQS A;  1QWF A;  4Y92 A;  4ZN3 A;  3CCV A;  1WX6 A;  2HD0 A;  1NJI C;  2E65 A;  1NEB A;  5GAM g;  3SD4 A;  3FB9 A;  2RQT A;  4K11 A;  4LXC A;  3PIP A;  2K9G A;  5KYY B;  3CCL A;  1KD1 U;  1XOV A;  5KCH A;  1SHF A;  1UGV A;  1VQ6 A;  1VQ6 Q;  3OYB A;  1VQO A;  9ATC B;  1FXX A;  4AG1 C;  1SKU B;  3TU4 K;  3CCU A;  3H0I A;  2K5L A;  4J9E A;  5KYX B;  1JO8 A;  3FJ5 A;  2LCC A;  1Q82 U;  3I56 T;  5GAN e;  2ED1 A;  3EGU A;  5FU6 B;  3UT1 A;  2LJ1 A;  1VQ4 T;  3I9Q A;  2A28 A;  1M1K U;  4M77 E;  3EFS A;  4JLG A;  3FRN A;  2K2V A;  2LQK A;  2DER A;  4GLM A;  2DXU A;  1TG0 A;  1BIA A;  7AT1 B;  4BDY A;  1Q7Y C;  1Q86 U;  2HKQ B;  3LYI A;  1WHL A;  1O9S A;  3OW2 P;  2DO3 A;  2PTK A;  4ZGE B;  1UJ0 A;  3JCM X;  5GAN 5;  3TVT A;  4M77 G;  4XTZ A;  1MV0 B;  2DVJ A;  3CCR A;  1UG1 A;  2K7A A;  4PFO A;  3CCR Q;  2K2M A;  5CVI A;  2J06 A;  4E7Z A;  3VS2 A;  1CKA A;  5A2Q E;  1YWP A;  1NYF A;  1VQ8 T;  3M4Y A;  2MPX C;  4PJM A;  1GBR A;  4F7U F;  1PWT A;  2YRD A;  3REA B;  3JB9 F;  3PMT A;  4RTT A;  4FU6 A;  3A98 A;  4C8Q E;  1YJW A;  1KQ2 A;  4D8K A;  3LH5 A;  3H0F A;  3LLR A;  1QVG A;  2KVQ G;  3OYK A;  1IHV A;  3L2W A;  1U8R A;  2JNG A;  4LN2 A;  4EMK B;  2L8D A;  4PJO F;  1YIJ T;  5I22 A;  4M77 B;  1XJW B;  2QAZ A;  5DLO A;  4C8Q G;  2DET A;  3BFM A;  3UDC A;  1BB9 A;  4LDW A;  3G4S Q;  4LD9 K;  1H64 1;  2NUT A;  1QLY A;  2QGF B;  1OYX A;  6AT1 B;  4N4G A;  1Q82 C;  3RKY A;  1MMN A;  3P8B B;  3HFN A;  2CUB A;  4J6X A;  2PNI A;  4LE9 A;  2QA4 A;  2KXC A;  3PVQ A;  1U06 A;  3SWN C;  2LQ8 A;  1PRM C;  5FRN A;  2X4X A;  3C12 A;  3RMQ A;  1U1T A;  4IUU A;  4M7A C;  4OGC A;  2DL3 A;  5GMK h;  3JCM V;  1PG5 B;  2EJG A;  1QCO A;  1VIF A;  1D1A A;  3LH0 A;  3M0S A;  1W2B A;  2KAF A;  3OMC A;  2XKO C;  2KE9 A;  1V76 A;  4C8Q B;  1YJN A;  2RHY A;  5GAN h;  4XTW A;  2YUP A;  1FWZ A;  3OS5 A;  2RK1 A;  5I2M A;  2CT4 A;  1VQL T;  1ARK A;  2X3X D;  5GAN 8;  1VQK Q;  2DE0 X;  4IIM A;  3LX7 A;  3CD6 T;  1KFZ A;  3INZ A;  2K79 A;  1N5Z A;  3PGG A;  2GFU A;  3DB4 A;  1Y0M A;  1ACM B;  3EG0 A;  4RTW A;  4M78 F;  5HCK A;  2FPE A;  5HK0 A;  2KGT A;  1S72 T;  2OJ2 A;  5D7U A;  1WJQ A;  2HQE A;  3HRS A;  3I5R A;  4LDV A;  1Q81 C;  2DK3 A;  5FU6 C;  5GAN 6;  4GBQ A;  1ABQ A;  4R55 A;  2X35 A;  3MKD A;  3UAT A;  2QEX A;  8ATC B;  2MK5 A;  2ABL A;  4A63 B;  1JRI A;  2XI9 A;  3M57 A;  1KSW A;  2G6F X;  3JCM P;  3RKW A;  4C0Z A;  3CC2 Q;  3E19 A;  1QCN A;  1YFN A;  2ED0 A;  3CC4 T;  3HL8 A;  4EMK A;  2C0O A;  2QDL A;  1G3W A;  4EMH A;  1UFF A;  3MEV A;  5CK9 A;  3G6E A;  2LQN A;  4B9X A;  3HKS A;  3OBY A;  1NZ9 A;  3OS2 A;  1YIT T;  3DLM A;  5IN1 A;  2QG9 B;  3VRZ A;  1QMC A;  1AWJ A;  1RI9 A;  1VQP T;  2DFU A;  4MZM A;  2E41 A;  1I5O B;  1WGS A;  1TSF A;  2PQW A;  1PCX A;  2CP7 A;  3L2Z A;  5GAO p;  3I56 A;  1M90 U;  1OQK A;  4EMK C;  2CZ1 B;  3C95 A;  1VQ4 A;  5IHN A;  2E5K A;  1VQN T;  1M5Q 1;  4M77 C;  1AT1 B;  2L2P A;  2DJQ A;  1IZ6 A;  4FYY B;  3UF4 A;  1N8R R;  2JTF A;  3PE0 A;  1N9S A;  2YUO A;  2BKD N;  2CH4 A;  2X4Y A;  1MHN A;  4C92 A;  2DIL A;  2XK0 A;  3GOX A;  4TVR A;  4N4I A;  2CZ6 B;  2H8H A;  2QAS A;  3QJY A;  3EH2 A;  3OYI A;  3CPW A;  2VGM A;  4ELY C;  4II1 A;  2H3J A;  3C0C A;  3NTI A;  2D9T A;  4BB7 A;  3BDL A;  3E9G A;  4RTV A;  5KYW B;  5LL6 S;  1HSQ A;  5GAO n;  1VQ8 Q;  2KQW A;  1PD1 A;  1BCM A;  2R57 A;  1I5L A;  2ESW A;  4IUT A;  5M9O A;  4J83 A;  2NLU A;  1N6A A;  1SSH A;  4M7D D;  2K3Y A;  4FT2 A;  5GAM j;  1X75 C;  5J3B A;  3CCV T;  1EFN A;  2CDT A;  3JCM d;  2K5F A;  4OB1 B;  4J9C A;  4LDX A;  4RMO A;  1VA7 A;  5CO7 A;  1YIJ A;  5GAN 3;  1YIJ Q;  1KD1 R;  2I0N A;  3VUZ A;  2AKK A;  1RAG B;  1VQ5 A;  1WLP B;  3QWY A;  1UGR B;  4FL6 A;  2MIO A;  3VU3 C;  2VXE A;  4BUG A;  3CCU T;  3VS0 A;  3GF5 A;  1OZ2 A;  2RHI A;  3BW1 A;  1BBZ A;  4A54 A;  3OYE A;  1YI2 A;  1M4Z A;  2KY9 A;  4J9I A;  2MYS A;  1AHJ B;  3V8J A;  2JMC A;  2RN8 A;  3OA6 A;  1M90 C;  1AWW A;  4ANJ A;  1RAB B;  1AVZ C;  4MML A;  1RUW A;  3R6O A;  5GAO l;  5CR2 A;  1QP2 A;  3OQ5 A;  1M1K R;  2COY A;  2FO0 A;  2NUZ A;  1NPP A;  4ME7 A;  1WHG A;  1Q86 R;  2K5I A;  2HL5 C;  1AOJ A;  1G8X A;  1G3Y A;  1GRI A;  1K9M U;  3OYD A;  3CME A;  1C1A A;  4ESR A;  3H9N A;  1ZX6 A;  3OSS C;  4AFS C;  2JVV A;  1VYT A;  1VQL Q;  1H3H A;  2KYB A;  1RAD B;  2DXT A;  2RQU A;  1UB4 A;  2M0Y A;  3CD6 Q;  2D0Q B;  4RTY A;  4EPC A;  2HNI A;  4XU0 A;  2CUD A;  5A0L A;  1YHQ T;  1BU1 A;  4JJD A;  2F69 A;  1YJW T;  2EFI A;  1E7O A;  2O2O A;  3MO8 A;  3QYG B;  3SFM A;  4CC4 B;  5CKD A;  2DL5 A;  2P4T A;  4J8O A;  2MAM A;  1TH7 A;  2DXC A;  4OGE A;  2RD1 A;  2YXY A;  4QW2 A;  4PFZ A;  2PUK B;  1SG5 A;  1VYV A;  4M7D E;  4Y91 A;  2C0T A;  1S72 Q;  1H8K A;  2B86 A;  5I21 A;  2CRE A;  2DAQ A;  3A1P A;  5KYU B;  2DJZ A;  4XU3 A;  3CCQ T;  4JZ3 A;  2WSE E;  2HKN A;  4Z88 A;  3QXE B;  1WHK A;  1Z9Q A;  1S1N A;  1X69 A;  3VS6 A;  1G5V A;  1YJ9 T;  1GCQ A;  4CC2 A;  4WF2 A;  2QA4 T;  4HVV A;  3FEO A;  3BY7 A;  2IPO B;  4M7D G;  1QVF S;  1X6G A;  4DBQ A;  3MJX A;  1R0C B;  2DF6 A;  3EG2 A;  2EQI A;  1V1C A;  4RG8 A;  4FYW B;  3OS0 A;  5CKB A;  1VQ7 A;  3FDR A;  3RBB B;  4DQ2 A;  4IUR A;  3CC4 Q;  3QBY A;  2ZAE A;  1UJY A;  2YLB A;  4L6V 5;  2YT6 A;  1SRM A;  5IHI A;  4KH1 B;  2FZK B;  1QWE A;  4CC3 A;  4WTO B;  3MEA A;  3H41 A;  3UWN A;  3ZFJ A;  5EC7 A;  5D6W A;  2GGR A;  3TSW A;  1YJN T;  1YIT Q;  3OYC A;  3GBQ A;  1GCQ C;  3CXC A;  3CCM A;  1GCP A;  1MMG A;  4M75 D;  3QJ6 A;  4PLI A;  4QVZ A;  1I4K 1;  1NM7 A;  1WZO A;  4M7D B;  2LCS A;  3HHT B;  1VQP Q;  3NFC A; 
#chains in the Genus database with same CATH homology
 1GBR A;  1T3L A;  1PWT A;  2RQR A;  3REA B;  3REB B;  5IHK A;  4KRT A;  2K3B A;  2YUQ A;  4HVW A;  3THK A;  2D1X A;  1ZUK A;  4RTT A;  3A98 A;  4Z8A A;  1UEC A;  2LP5 A;  2L3S A;  4EIK A;  2EYZ A;  1IO6 A;  3QWX X;  4D8K A;  1M27 C;  1T3S A;  2HEQ A;  1K9A A;  3H0F A;  3LH5 A;  2J6K A;  1KIK A;  2JM8 A;  2FPD A;  2A37 A;  4LN2 A;  5GJW B;  1M3A A;  1AD5 A;  2GBQ A;  5I22 A;  1RLQ C;  2JM9 A;  2CT3 A;  2KRN A;  3EG1 A;  1JXM A;  2JS0 A;  4M4Z A;  1BB9 A;  4HXJ A;  1B3Q A;  2RQW A;  1PRL C;  2EKH A;  2SEM A;  4OMM A;  1I0C A;  1QLY A;  2RPN A;  4LE9 A;  2CUB A;  2PNI A;  2V1R A;  4OML A;  2KXC A;  3PVQ A;  2KYM A;  1U06 A;  1PRM C;  4LUD A;  4AFQ C;  1JU5 C;  2BZY A;  3SHW A;  2W10 A;  2ECZ A;  4QT7 A;  4Z89 A;  5FW9 A;  2DL3 A;  1WYX A;  1QKX A;  1PKS A;  5FWC A;  1ZLM A;  3M0S A;  2F2X A;  2KE9 A;  1YN8 A;  1X6B A;  2FPF A;  4RTX A;  1GFD A;  3I35 A;  1AEY A;  1K76 A;  2YUP A;  1RLP C;  2EW3 A;  2O88 A;  2HSP A;  2CT4 A;  3KFV A;  1CKB A;  1ARK A;  2X3X D;  2DA9 A;  2DE0 X;  4IIM A;  2A08 A;  4OMO A;  4J9F A;  4JPB W;  2GTJ A;  1T0H A;  1KFZ A;  3NPF A;  1ZBJ A;  1K0X A;  2K79 A;  1N5Z A;  3RNJ A;  4J9H A;  1Y57 A;  1ZUY A;  2C0I A;  2YDL A;  1MV3 A;  1Y0M A;  3EG0 A;  4F16 A;  4RTW A;  3ZL7 C;  2A36 A;  2JTE A;  1SHG A;  5HCK A;  2HCK A;  2O9S A;  2FPE A;  1OOT A;  1W6X A;  2D8J A;  2EYX A;  2KGT A;  2EPD A;  2OJ2 A;  2O9V A;  1OPL A;  2CSI A;  3VS4 A;  1B07 A;  3I5R A;  4CC7 A;  1OPK A;  4IIO A;  4GBQ A;  1ABQ A;  2J6O A;  1M3C A;  1X2K A;  4OMN A;  2FRY A;  3UAT A;  2L3Q A;  4ZNX A;  1KJW A;  3ULR B;  2NWM A;  1WI7 A;  2ABL A;  4A63 B;  5I11 A;  4JJC A;  1SEM A;  3VS3 A;  1KSW A;  2G6F X;  1U3O A;  3M0R A;  1ZUU A;  2DLP A;  2DM1 A;  2KRO A;  2ED0 A;  3JV3 A;  1YP5 A;  1E6H A;  2C0O A;  2KXD A;  2QDL A;  5ECA A;  3I5S A;  3NMZ C;  1UFF A;  2JW4 A;  1K4U S;  1WXB A;  1M8M A;  2HBW A;  2DMO A;  2LZ6 B;  2LQN A;  3U23 A;  2GTO A;  2FEI A;  1UUE A;  2XMF A;  2KBT A;  1OEB A;  1UTI A;  4LNP A;  1BK2 A;  1SPK A;  2DYB A;  4X1V A;  2KEA A;  2MCN A;  2VVK A;  3UA6 A;  3VRZ A;  1AWJ A;  1RI9 A;  1K1Z A;  4JJB A;  2FG0 A;  3VS5 A;  1FMK A;  1ZSG A;  3M0Q A;  3EHR A;  5IHN A;  2E5K A;  5IH2 A;  1UE9 A;  2DRK A;  1G83 A;  1HD3 A;  4OMQ A;  1M30 A;  2L2P A;  2DJQ A;  3UF4 A;  2LQW A;  1UHF A;  3PE0 A;  2KT1 A;  5GJV B;  2RMO A;  2F2V A;  2YUO A;  2CH4 A;  4R0K A;  2DIL A;  2JXB A;  3H0H A;  2EBP A;  2H8H A;  2ENM A;  1E6G A;  3CQT A;  1AZE A;  3UA7 A;  2RF0 A;  4J9G A;  1WDX A;  2YSQ A;  1UDL A;  2AKL A;  1WXT A;  2X3W D;  3NHN A;  3C0C A;  2J7I A;  1JXO A;  2V1Q A;  4RTV A;  1AWO A;  1H92 A;  1HSQ A;  4ORZ A;  1NLO C;  1X27 A;  1NYG A;  1A0N B;  3EHQ A;  4OMP A;  2P4R A;  1Z9Z A;  2ESW A;  2CH4 W;  3M0P A;  2EYY A;  4AFZ C;  1SSH A;  1X43 A;  1I1J A;  2LJ0 A;  2AK5 A;  2AZV A;  1EFN A;  2IIM A;  2J05 A;  1WIE A;  1YNZ A;  2CDT A;  2O31 A;  3M0T A;  2LX7 A;  1U5S A;  1LCK A;  4J9C A;  1I07 A;  1VA7 A;  1K0S A;  2EGE A;  1GL5 A;  1GFC A;  2OAW A;  3VS7 A;  2I0N A;  5L23 A;  2AKK A;  1TUD A;  4D8D A;  1WLP B;  4FSS A;  3QWY A;  3TSZ A;  3IQL A;  2MIO A;  1GBQ A;  2SRC A;  1ABO A;  3VS0 A;  2LNH B;  1BBZ A;  2RQV A;  4J9I A;  4RTZ A;  2JMC A;  1OV3 A;  2RN8 A;  2D0N A;  2EGC A;  2VKN A;  1AWW A;  2GQI A;  3VS1 A;  2JT4 A;  1AVZ C;  2KRM A;  2BZ8 A;  1RUW A;  2GNC A;  4LUE A;  2L0A A;  2EYW A;  2M51 A;  2FO0 A;  2F2W A;  2DRM A;  2NUZ A;  2ROL A;  1UHC A;  2CSQ A;  1AWX A;  1NG2 A;  1AOJ A;  1GRI A;  2RNA A;  2BZX A;  2OI3 A;  2LJ3 A;  1QCF A;  2L3P A;  2EVR A;  1SRL A;  2DL4 A;  2MOX A;  4ESR A;  4WCI A;  1ZX6 A;  4AFS C;  1PNJ A;  1W1F A;  2JMA A;  1VYT A;  2K6D A;  1H3H A;  2KYB A;  3R6N A;  2JS2 A;  2PZ1 A;  2RQU A;  4HCK A;  2ROT A;  2M0Y A;  3NGP A;  2DNU A;  4RUG A;  2W0Z A;  4RTY A;  2DBM A;  1X2Q A;  2VWF A;  2DBK A;  2CUD A;  1WFW A;  1BU1 A;  4DEX A;  1FYN A;  3VRY A;  4JJD A;  4HVU A;  2DL8 A;  2YUN A;  2AZS A;  5IXB A;  1E7O A;  1NEG A;  2O2O A;  5FWB A;  2LMJ A;  1WA7 A;  2DX1 A;  4CC4 B;  2EGA A;  2KT8 A;  1CSK A;  1JEG A;  2DL5 A;  1QWF A;  4Y92 A;  2KNB B;  1WX6 A;  4F17 A;  1YCS B;  1NEB A;  3SEM A;  1VYV A;  2RQT A;  2C0T A;  3M0U A;  4K11 A;  1H8K A;  2B86 A;  2K9G A;  2CRE A;  1HJD A;  1XOV A;  2D8H A;  4J9D A;  5IXF A;  4AFU C;  1SHF A;  1UGV A;  4JZ3 A;  4JZ4 A;  4J9B A;  4Z88 A;  1MUZ A;  1Z9Q A;  1S1N A;  1X69 A;  3VS6 A;  4F14 A;  1J3T A;  1GCQ A;  4CC2 A;  4AG1 C;  1JQQ A;  1WXU A;  4HVV A;  3H0I A;  1W70 A;  2BTT A;  2KR3 A;  4J9E A;  1AZG B;  1X6G A;  1JO8 A;  3FJ5 A;  2DF6 A;  3EG2 A;  2EQI A;  1QKW A;  2ED1 A;  3EGU A;  1V1C A;  2J6F A;  2KRS A;  4RTU A;  2LJ1 A;  3RBB B;  3I9Q A;  2FRW A;  4AG2 C;  4DEY A;  2A28 A;  1UJY A;  2YT6 A;  2DL7 A;  1SRM A;  5IHI A;  4GLM A;  1YWO A;  1QWE A;  1VYU A;  1TG0 A;  4CC3 A;  3H41 A;  3O5Z A;  1PHT A;  5EC7 A;  2GGR A;  3TSW A;  2HDA A;  3EG3 A;  1PKT A;  2PTK A;  3GBQ A;  1UJ0 A;  1GCQ C;  4E6R A;  3TVT A;  1M3B A;  1T0J A;  1GCP A;  1MV0 B;  1TUC A;  2DVJ A;  1NM7 A;  1UG1 A;  2K7A A;  2K2M A;  2LCS A;  2J06 A;  1G2B A;  3VS2 A;  1CKA A;  1NLP C;  1YWP A;  1NYF A;  3PVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...