2J7IA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterodimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j7iA00
2LX7A 2JW4A 2JXBA 5GJVB 1M3CA 3VRYA 1HSQA 1B3QA 1H92A 1HJDA 1TG0A 1TUDA 3JV3A 1K9AA 2V1RA 2PTKA 1SPKA 3EHQA 3REAB 2KEAA 4ZNXA 2DBMA 2K6DA 1K76A 2DMOA 2DL5A 1M3BA 2AKLA 2D8HA 5IHIA 1A0NB 1UG1A 3SEMA 4LUDA 2YUPA 2AK5A 2O2OA 2K7AA 1JU5C 4HVUA 2D8JA 4GLMA 2LJ3A 1I07A 1QWFA 2BZ8A 4ORZA 1JXMA 1PNJA 3VS1A 3RBBB 2M51A 3M0RA 1PWTA 3C0CA 2VWFA 3CQTA 4RTYA 2L3SA 3TSWA 1OEBA 2OAWA 4DEXA 1ABQA 3EG3A 1I1JA 2I0NA 1OOTA 1ZUUA 1S1NA 1QKXA 3UF4A 4LUEA 2RN8A 1WX6A 1MV3A 3GBQA 4KRTA 1E7OA 2A08A 2O9VA 2FPFA 2AZVA 3RNJA 4JZ3A 2CT3A 3I9QA 1SEMA 2GQIA 2KYMA 5IXFA 1M30A 1G2BA 2KROA 1AWWA 2EKHA 1M8MA 4AG1C 2YUQA 3IQLA 1X2KA 2FPDA 2K79A 4AG2C 2CH4A 3TSZA 4JZ4A 2MOXA 1UGVA 4HXJA 2JM9A 4IIMA 1VYUA 1UTIA 2EVRA 1N5ZA 2F2VA 2JS2A 5FWBA 1NM7A 4WCIA 4RTUA 2PNIA 1X6BA 3NMZC 5GJWB 2EQIA 3H0IA 5HCKA 4OMNA 2ESWA 2LCSA 1VA7A 2KRNA 1OV3A 2FPEA 1WA7A 1X6GA 3LH5A 1JXOA 1YNZA 1Z9QA 2CUDA 2L0AA 2FG0A 3O5ZA 4D8DA 2KE9A 4Z8AA 1SRMA 1NYGA 3ZL7C 1SSHA 2LMJA 1ABOA 1JEGA 1YN8A 2KNBB 4RTXA 5IHNA 3QWYA 2KT1A 2A37A 1JQQA 1QKWA 1VYVA 3R6NA 1AD5A 1RLPC 4LN2A 1QCFA 2EBPA 1GBQA 3VS3A 2RQTA 1K0SA 1J3TA 2KRSA 2CSQA 2LQNA 2OJ2A 5FWCA 2JS0A 4J9IA 4Z88A 1NLOC 2BZYA 4D8KA 2DJQA 1AVZC 1K4US 1WXTA 1CKBA 2KBTA 4J9EA 2DE0X 4HVWA 2CT4A 1PRLC 1MUZA 1GFCA 1JO8A 2XMFA 2DLPA 1QWEA 2J05A 2MCNA 3EG1A 1GCPA 1YP5A 3I35A 1WDXA 4IIOA 2HSPA 2BZXA 1FMKA 1VYTA 1ZUKA 2ECZA 2C0IA 2HDAA 2LNHB 4AFZC 4OMQA 2DRMA 2CUBA 1E6GA 1W6XA 1AOJA 3PE0A 4A63B 1OPKA 3FJ5A 3QWXX 4FSSA 2ABLA 4JJCA 2D1XA 1PKTA 1FYNA 3M0UA 4X1VA 1W70A 2EGCA 2L3QA 4LNPA 2KYBA 2RQVA 2DM1A 2VKNA 2CDTA 2K2MA 2K9GA 1ZX6A 2RNAA 4RTTA 5EC7A 2O88A 2EPDA 2DVJA 4Y92A 2LJ0A 5IXBA 4J9CA 2DL8A 2DL7A 4E6RA 1UJYA 4LE9A 1GCQC 3VS7A 1UHCA 4Z89A 2F2WA 5IH2A 2JM8A 2YSQA 2HBWA 2B86A 1CSKA 1M27C 4CC7A 2DNUA 2RQUA 1UFFA 2W10A 1WXUA 1ZLMA 1UDLA 3UA6A 2W0ZA 2C0TA 1X43A 4ESRA 1K1ZA 1Y0MA 1NG2A 4JJDA 3SHWA 4RTVA 1WIEA 2H8HA 2O31A 2EW3A 2EGEA 2RMOA 2J06A 5I11A 1PHTA 2LP5A 4OMMA 2HCKA 2DILA 5IHKA 2KR3A 2G6FX 1T0HA 4JPBW 1RLQC 1T0JA 2L3PA 1W1FA 2RPNA 2X3XD 1K0XA 1YCSB 3VS0A 4AFSC 1H8KA 2F2XA 1WI7A 2KGTA 1KIKA 2GGRA 1NYFA 4DEYA 1RI9A 1AWJA 1PRMC 3VRZA 2ROLA 2EYZA 1TUCA 1UE9A 2P4RA 4QT7A 1WYXA 1BBZA 1T3LA 2NUZA 1X2QA 2HEQA 2AZSA 1KJWA 2M0YA 1XOVA 1BB9A 3EGUA 3A98A 4CC2A 1SHFA 4J9DA 2RQWA 2GNCA 3EHRA 1WLPB 2LJ1A 3M0PA 2DA9A 2ENMA 4F16A 3PVLA 1EFNA 2J6OA 3PVQA 4J9FA 1AZGB 2GTOA 2V1QA 2EYYA 1RUWA 1WXBA 1U5SA 4K11A 1Y57A 1GL5A 3H41A 1UJ0A 1ZSGA 1UECA 2JTEA 1X27A 2A28A 2LQWA 4AFQC 4R0KA 1WFWA 2YUNA 3M0QA 4RTWA 2ED1A 1SHGA 4RUGA 2RF0A 1UUEA 2J6FA 4EIKA 2EYXA 2PZ1A 4OMPA 2CH4W 1AWOA 1GBRA 2DBKA 2NWMA 2KXCA 1AWXA 4GBQA 4JJBA 4HCKA 1GRIA 1UHFA 1H3HA 4J9HA 4M4ZA 1NEGA 2IIMA 1OPLA 2AKKA 3NHNA 1M3AA 1CKAA 4J9GA 2JT4A 1HD3A 2DYBA 4AFUC 5ECAA 1NLPC 1AEYA 2SRCA 1AZEA 3VS6A 2KXDA 4OMOA 3REBB 1I0CA 1GCQA 2YT6A 1BU1A 3VS5A 5FW9A 1IO6A 2RQRA 2CREA 1T3SA 2A36A 1SRLA 3VS4A 2JMCA 3H0FA 3UATA 1B07A 3I5RA 1ARKA 2FO0A 2LZ6B 1GFDA 4HVVA 2VVKA 2DF6A 1YWPA 4J9BA 4F17A 1G83A 2DX1A 3H0HA 3U23A 2J7IA 1U3OA 2ROTA 2MIOA 2L2PA 3VS2A 3I5SA 4CC3A 5L23A 2BTTA 1V1CA 2X3WD 3NGPA 1KFZA 3M0TA 2GTJA 1BK2A 2CSIA 3ULRB 4CC4B 2FRYA 1X69A 2C0OA 2EGAA 1U06A 1LCKA 2J6KA 2FEIA 2YUOA 3UA7A 4RTZA 2K3BA 1PKSA 2DL3A 3M0SA 2KRMA 2QDLA 2D0NA 2E5KA 1ZUYA 2JMAA 2SEMA 2KT8A 2FRWA 1Z9ZA 2EYWA 3NPFA 3EG0A 1E6HA 4OMLA 3THKA 4F14A 1QLYA 1MV0B 1YWOA 2OI3A 3TVTA 2DL4A 2GBQA 3KFVA 1NEBA 3EG2A 1ZBJA 1KSWA 2YDLA 5I22A 2DRKA 2O9SA 2ED0A
chains in the Genus database with same CATH superfamily
4X9DA 1RAIB 4PJOF 5GAMf 3PIOA 3GIBA 2MPXC 1M3CA 3VRYA 1K73C 2NYSA 3DLLA 3WVDB 1UGSB 2X4XA 1HSQA 1PSEA 3JCMX 3L42A 4BE1A 1FWZA 3CMAQ 2V8IA 1HJDA 2HKNA 4HCCA 1WQWA 2PTKA 4PLIA 2HZYA 2K2VA 5FRMA 3LWIA 2DBMA 4PKCC 1YI2T 2JUFA 2V8KA 2RH2A 2K6DA 1M1KC 2DL5A 5KE2A 2ATCB 1M3BA 2D8HA 2WSCE 1UG1A 4OB1B 3JB9G 2G3RA 3CC7T 2AK5A 3G71Q 3OS2A 1GXIE 4ZGEB 3URGA 2CZ1B 2PU9B 4HVUA 2D8JA 2LJ3A 2CKKA 4M78C 4WF2A 4BD3A 4AMCA 4C92E 2M51A 3M0RA 2PQWA 3MEAA 1YJNQ 1PWTA 4QW2A 3C0CA 2QI2A 2CP2A 1OEBA 3JCMd 4P5NA 5CCAA 3EG3A 2K3XA 3ASKA 2JTFA 3UF4A 4PJOE 2RN8A 1NPRA 2F69A 2K57A 1WX6A 3GNGA 3BFMA 5GANe 2QAZA 4KGZB 4MZTA 2WACA 4KRTA 3META 2FPFA 3RNJA 4JZ3A 2CT3A 5A0DA 2HQEA 1SEMA 2Z0WA 5CQXA 2KYMA 4M78D 4ZTFA 1JJ2P 2YUQA 3QZ9B 4PJOB 4II1A 3HKSA 2FPDA 3L2RA 5LJ3e 3LX7A 5GMKh 2CH4A 2KMTA 2QTXA 3CCLA 3G6EQ 4OMFB 3OBWA 1Q82U 2P0QA 2WSFE 1MMGA 2CZ6B 5GAN5 1UTIA 4OVAA 4PJJA 2EVRA 3TU4K 4IURA 3TEEA 3A8LB 4WCIA 1X6BA 3NMZC 4M77C 5GJWB 2LCSA 2KRNA 2FPEA 2PVOB 5KYNA 2X4WA 3E9FA 2QQRA 3CCSA 1JXOA 4DOVA 1VQ8A 4J8OA 3O5ZA 3PFSA 1W2BA 2HQXA 2RHZA 1SSHA 4RCBA 2ZAEA 4QVZA 4XTVA 5IHNA 2KT1A 4C92A 1RAAB 1IGUA 1QVPA 1SG5A 3I56A 1RLPC 2AT1B 2CYZB 4FYXB 4LDYA 4IUTA 3CPFA 2PVGB 4UC4A 1X6OA 5FWCA 1RL2A 1WPYA 3QO3A 3CCLT 2OTJQ 4D8KA 4M77D 2DJQA 1BCMA 3LYIA 1KC8R 2XDDA 5A0LA 2RK2A 4HKEA 3BW1A 4J9EA 2QDYB 3C95A 4M78A 1WNLA 4HCBA 4FW2A 1VQLQ 2XICA 1GFCA 1JO8A 1OU8A 3CCST 1NJIU 3X25B 1GCPA 4C0GA 1VQ8T 1YP5A 3I35A 2KY9A 1M90C 2HSPA 4X34A 3RKXA 3JRZA 3EGDB 3CCEQ 2C0IA 4DBFA 2HDAA 5FU7C 1XQHA 4KH0B 4ZTJA 2LNHB 1G3YA 3UDCA 4C0ZA 3CD6Q 2DKGA 2GF7A 5KCOA 1VQPA 3PE0A 4IUVA 3I56T 2VGNA 3FJ5A 2MMPA 3ER0A 3QWXX 4JJCA 4JS5A 2QA4Q 3S3OA 1K8AR 4B6MA 3S3NA 2K5IA 2KYBA 4X9CA 2K2MA 3BDUA 3VV0A 4MMKA 4EMHA 2DXCA 3MEVA 2JNGA 4RTTA 2EPDA 3PMTA 1D3BA 2R5MA 2LJ0A 1X01A 3UWNA 3H6ZA 2DL8A 2EWNA 2VC8A 1QP3A 3OYAA 4M77A 5CIUA 3VS7A 2JM8A 1PSFA 4C0DB 5FU6C 1NZ9A 2CZ7B 4CC7A 2DNUA 4CI0C 1VQ5Q 5DM7R 4PK4A 1M1GA 1Y96B 3QYHB 1VQPT 4M7AC 1UDLA 4RG2A 2P84A 2C0TA 2K5LA 4MDXA 3PMIA 2RI5A 3OYDA 1RACB 3CBPA 4BDZA 4A4KA 3QDFA 2KR3A 2FYKA 2G6FX 5HK0A 1W2BS 4JPBW 5C0MA 1T0JA 4VUBA 3EGXB 1Q86C 4M7AE 1PRMC 3VRZA 2ROLA 3OYKA 3P8HA 3MCAB 2M9UA 2JTMA 2QXFA 3PNWC 4KBMB 2DZCA 3HPWA 2FZCB 2QGFB 3A98A 4M7AD 3CCVT 3LGLA 1RAHB 2QGGA 1KD1C 1KHIA 1VQ9A 2E10A 1MNDA 4PJNA 1M1FA 2DA9A 3M4GA 2QK0A 1EFNA 2V8JA 2GTOA 4N4GA 2A0FB 2K3YA 2V1QA 2EYYA 3SWNB 4K11A 1Y07A 5LJ3g 3H41A 2LQWA 1WFWA 1SF9A 2YUNA 3M0QA 3OYYA 4RTWA 2CZ0B 1F1BB 3ZFJA 1OX8A 2J6FA 1SKUB 3WVEB 4XTWA 5GMKe 2BUDA 3VJPA 4F04B 2DVEA 2EYQA 4JJBA 1IZ6A 1NPPA 1GRIA 3CCRT 3A5ZB 4J9HA 1NEGA 2IIMA 4AT1B 5M9OA 3NHNA 2DXTA 2JT4A 4B9XA 1XTDA 2DYBA 4AFUC 1HK9A 1M2VB 3RKYA 1AEYA 1NLPC 1QVFA 5GAN4 1R8OB 1AZEA 4YTLA 4OMOA 4L59A 1VQ9T 3MO8A 5KYXA 3REBB 4QQGA 2YT6A 4C5HA 5FW9A 2RQRA 2CREA 1SRLA 4JRIA 2JMCA 5DLQE 3OS0A 1AT1B 3OMCA 3KUFA 3JCMc 2DEUA 1GFDA 3OS5A 2NLUA 8AT1B 2DF6A 1M5Q1 4IUQA 4M7AA 3GF5A 4F17A 4CC3A 3L2ZA 4M75G 2BTTA 1V1CA 3NGPA 1D09B 1VQMA 3CCQQ 2LRQA 2EGAA 1U06A 2KAFA 1PKSA 2D6FA 4J5YA 4XU3A 1PM3A 1KHCA 5GAN6 3CPWA 1K73R 3E9GA 2FRWA 2QQSA 1Z9ZA 2EYWA 3AT1B 3CCMA 2COWA 5GANd 2DL4A 2QQBA 2YXYA 2MWOA 4J7FA 2EQMA 3JB9I 2LX7A 3BDLA 2JW4A 2OTLQ 4QVDA 4F7UG 4BUGA 5LJ5j 3MP8A 3J81E 1TUDA 2XDBA 3BY7A 3SD4A 4A4FA 4C8QG 3M53A 3EHQA 1OQKA 4KGXB 2KEAA 2BE7D 4ZNXA 2DAQA 3QZ5B 3CMEQ 1VQMT 4JLGA 4O5VA 2AKLA 2O01E 3M5AA 4Q5WA 3SEMA 4LUDA 1RAGB 1C0MA 3EFRA 2K7AA 1YJWQ 2KSSA 1VQ6A 1JU5C 3CC2Q 3X26B 5GAMj 1IGQA 5LJ3f 2HQHA 4DBRA 5GAN3 3JCMV 5DY9A 1UEBA 4OB2B 1OI1A 1H3ZA 1K9MU 2F1LA 3J80E 2EQUA 1YIJA 2VWFA 3CQTA 4RTYA 2L3SA 4EMKC 4XU2A 1OOTA 1ZUUA 3QYGB 5GAOl 3JCMg 1EZZB 1MV3A 1E7OA 3L2VA 3I9QA 2R58A 3VYGA 2KROA 2EKHA 1M8MA 2LNVA 2RB6A 3RMSA 1N9SA 2L5QA 2VV5A 4WTOB 1X2KA 3KBGA 5GMKl 2EQJA 2YRCA 5CAIA 4JZ4A 3X24B 4M7DG 2JJ9A 2JM9A 2LQ8A 4IIMA 1YIJT 5FWBA 1NM7A 2QG9B 4RTUA 2RI3A 3H0IA 5HCKA 4OMNA 3JB9D 1VA7A 5GAMh 1OV3A 1WA7A 3P8BB 1YNZA 1Z9QA 3X28B 4D8DA 3ZL7C 1QVGP 3RERA 5KYWA 1VQOA 2LMJA 4RTXA 2HL5C 3PGGA 2CP7A 4M78F 2E4HA 2RJCA 2FZKB 1VQ4A 4A54A 1AD5A 4LN2A 2EBPA 4BY6C 4LDUA 4OB0B 2CSQA 1I81A 3V8JA 2OJ2A 3EAEA 3CC4A 4PLLA 3CPWP 1YI2Q 1NLOC 2BZYA 3G7ZA 1AVZC 1K4US 2BIVA 4FL6A 3OMGA 4HVWA 3CC7Q 1NE8A 2XDPA 2OAUA 1PRLC 5CKDA 1MUZA 4XQ3A 1N9RA 2DLPA 3CCJQ 2E12A 1QWEA 3EG1A 4TVRA 4IIOA 1NBEB 2BZXA 1FMKA 1VYTA 1ZUKA 2ECZA 1FX7A 4ATOA 1VQOT 1VUBA 3OYCA 4BB7A 4EMKA 3G71T 5FLXE 1VQ4T 1AOJA 4C92B 3C94A 2D1XA 1PKTA 2RHXA 4M78E 1FYNA 5GAN7 3GLXA 1YJNT 2HNIA 2EGCA 3CC4T 4M77F 2RQVA 3JCMf 2VKNA 2CDTA 3EH2A 3M58A 1FXXA 2KI7A 4M78B 1ZX6A 1LOJA 2EIFA 3NTIA 5EC7A 3MP6A 1N8RC 3EFSA 4J9CA 1UJYA 4KULA 3OW2P 1UHCA 2PVDB 1MMNA 1VIFA 1BI1A 4HCZA 2YSQA 3OYHA 2HBWA 3G1JA 2E41A 2E6ZA 3VUZA 3LGFA 4JRQA 5GMKi 1OZ2A 3RDVA 1UFFA 2W10A 2YWWA 4PFOA 1TS9A 1X43A 2VGMA 1YHQA 4JJDA 3SHWA 4C92G 4QVCA 2RMOA 1WJQA 2J06A 4JLIA 2FVUA 1OYXA 1VQLA 2LX9A 1K9MR 1D0XA 2LP5A 2HCKA 2HMAA 5IHKA 5KYUA 1QCNA 1T0HA 4OGCA 3QG1A 4R55A 3HRUA 4M77E 1W1FA 2KQWA 2RPNA 2RJEA 2F2XA 2LVMA 3OYBA 2KGTA 2GGRA 1NYFA 4DEYA 1TUCA 2P4RA 3CCLQ 2LT1A 4PJOG 2BE9B 1YJ9A 1T3LA 5KYYA 1BI3A 3CD6A 1X2QA 3QPHA 1KJWA 2M0YA 4M77B 2NUPA 1PCXA 2CP5A 2EFIA 3EGUA 1I5LA 2XK0A 4CC2A 4PL6A 3F70A 2RM4A 2XKOC 3VU3C 1WLPB 4NS5A 2LJ1A 3M0PA 3CCSQ 2DO3A 1IHWA 1VQ8Q 3QHSA 4MMLA 4F16A 3GOXA 3PVQA 2J6OA 4J9FA 2DTHA 1K73U 1LVKA 4JRKA 1YHQT 4A4HA 3RKWA 1RUWA 1U5SA 2FB7A 1GL5A 1SSFA 2JZ2A 3OSSC 1X27A 1VQLT 3OYJA 3WXMB 4IUUA 1SHGA 1FMWA 1HXDA 2IVWA 3I56Q 1R0CB 5IAYA 1M1KU 3EH1A 4EIKA 1FMVA 4RMOA 2EYXA 2PZ1A 4PJMA 2CH4W 2NWMA 2KXCA 4HCKA 2DK3A 2E3HA 3C4SA 1YJ9T 2Y90A 3CD6T 2AKKA 4LDWA 1M3AA 4FW1A 4M7AF 1HD3A 1O9SA 4HT8A 2QA4T 2KXDA 1BU1A 3VS5A 4E7SA 4A4EA 1T3SA 2QASA 2B8AA 3FRNA 5FU7B 3UATA 4R56A 5EG2A 3M4YA 1Y7XA 1ARKA 1KQSA 2LZ6B 5A0GA 3CCVA 4J9BA 2ZGWA 1U3OA 4QQDA 1WHLA 5J3BA 2ROTA 3E1SA 2MIOA 1RABB 2L2PA 1VQPQ 2QYZA 1ACMB 3OYNA 2GTJA 4M75F 3ULRB 4CC4B 1X69A 2C0OA 1D0ZA 2FRYA 4EMGA 3V8KA 1KK7A 2FEIA 3QIIA 4PFPA 2YLCA 3M0SA 1PD0A 2JOYA 3JB9J 2JMAA 1N8RU 2E3IA 4NL2A 3MP1A 3EG0A 1E6HA 4OMLA 2EAYA 3THKA 1QLYA 1MV0B 1TWBA 2OI3A 1YWOA 3DB4A 3TVTA 2GBQA 3FIFA 1M8VA 2YDLA 5KYXB 5I22A 3CCRA 4IKFA 4M75C 2JXBA 3Q1JA 5GJVB 5FU6B 4ME7A 5GANg 1W2BP 1B3QA 4LD9K 1H92A 1VQNA 2COZA 4E47A 4M7AB 1YITA 3PT9A 1K9AA 2V1RA 2GCXA 3REAB 1ZQ1A 1ZSZC 3I55A 2DMOA 1A0NB 3S6WA 2YUPA 4E7KA 4BACA 4FU6A 2IPOB 4M75E 2LCLA 1BI2A 3OYEA 1IREB 1Q81C 1I07A 4XK8E 3CXCA 3A8GB 4ORZA 3X20B 1TXQA 5HKCA 4IUPA 4M75D 2VUBA 3M56A 1KC8C 5LL6S 2O4XA 2DPPB 3DB3A 2YHTA 4C8QC 4NL3A 3TSWA 4FYVB 5CKBA 1VIEA 1M90U 2I0NA 1VQNT 1S1NA 1QKXA 1YITT 1BIAA 4LUEA 1LPLA 5LJ3j 2A3LA 1VQ9Q 3A1PA 2ZCFB 2A08A 3I55T 2DTOA 1D1CA 2DIGA 4C5EA 3OYFA 2AZVA 3PIPA 3FEOA 4LDVA 2F5KA 2GQIA 4J6WA 2ZZDA 1G2BA 2P0PA 4Z02A 4AG1C 3JAME 2CGHA 4HT9A 2MWPA 4JUVA 1OZ3A 2ZPBB 3T9NA 1C1AA 5AYFA 5IN1A 1KQSS 1K8AC 3TSZA 1UGVA 4C8QD 1RADB 1N5ZA 2E65A 2F2VA 1S72A 1JBMA 2JS2A 5CKEA 4XAXB 2NUTA 3OB9A 1G8XA 2L3RA 4JRPA 3QSUA 3CBMA 1X6GA 3LH5A 4XU0A 1XJWB 1OULA 3NTKA 3J7AF 3H9NA 2E5QA 4BI4A 4ZGDB 3TCJA 3HSBA 2KE9A 2X4JA 1HYOA 3A8OB 4M75A 1QCOA 1VQKA 1U1TA 2KNBB 1M1KR 3QWYA 2OX7A 2A37A 1VQ7A 1JQQA 1QKWA 2M0OA 3ZBDA 4M7DC 4KGVB 2KK4A 2DETA 5HK3A 1QCFA 3VS3A 1K0SA 5GAOr 5GANf 1ZSZA 5I2SA 2KRSA 2LT4A 4V2SA 2EQKA 2JS0A 4LD6A 1TH7A 4J9IA 4Z88A 3OY9A 2H3EB 4RKUE 1VQMQ 2V26A 4NOYA 1KQ1A 1S72T 2DE0X 2X9HA 3MJXA 3JB9F 1Q86U 4XU1A 4F7UA 5I2MA 2GQVA 5CK9A 2MCNA 3CCMQ 2RI2A 1Q7YC 3OYGA 4PNOA 1BI0A 3L1AA 4C8QA 2MYSA 3FLGA 1VQKT 5CKHA 4M7DD 4DQ2A 4AFZC 2F5TX 2DRMA 1YJWT 3CXCS 2CUBA 1KD1U 3G4SA 1E6GA 1VQ7T 4HA8A 4CRIA 1PD1A 4A4GA 1BYMA 3MEWA 4A63B 3CBOA 1OPKA 1QP2A 5IT9E 3ZEHA 2D9TA 1N8RR 4KT0E 4X1VA 1W70A 3RMQA 2L3QA 5D6XA 4LNPA 2MK5A 3FB9A 3CCUA 2QTVA 1Q81U 1B7TA 1Q82C 1BIBA 3OS1A 4E7IA 2MI6A 2K9GA 5LJ5h 1MHNA 2RNAA 4OGEA 5FROA 1VQ6Q 1EIFA 1WHGA 2DVJA 1QW1A 5GAN8 2HBPA 2QEXA 1MMDA 2DL7A 4E6RA 3MPUB 1GCQC 5I21A 1YIJQ 1WHKA 4Z89A 2DFUA 2M02A 5IH2A 1QVFP 3UPUA 5LJ5d 2B86A 1CSKA 1M27C 4EMKB 3G4ST 3CMAA 2XG8D 1PG5B 1EX4A 1WJSA 5KE3A 1ZLMA 3VUBA 3QUIA 3UA6A 2W0ZA 4ESRA 1K1ZA 3EFOA 3DLMA 1OU9A 1Y0MA 1NG2A 4ELYC 4KUDK 5DLOA 2X35A 2O31A 2DERA 3OYIA 2EW3A 2EGEA 4M7DA 5HY6A 3G71A 3OYLA 5I11A 1PHTA 4GLKA 1WHMA 3CCUT 5GAMd 4PFZA 2FL7A 2E6NA 2L3PA 5L8RE 1IB8A 1K0XA 2X3XD 3VS0A 1H8KA 1KIKA 3LH0A 3FDRA 1RI9A 1AWJA 1UGRB 4BE2A 3MKDA 2M16A 1YJNA 1UE9A 1M90R 2QEXT 4QT7A 1RAEB 1NJIC 4OP0A 4Y91A 1BBZA 1JB0E 2K5FA 2LQKA 4N4HA 2DIQA 2XI9A 1XOVA 1BB9A 4B9WA 4C92C 3CMAT 2LTOA 4J9DA 3M54A 2R5AA 2RQWA 3EHRA 5D6YA 5GMKj 5FRNA 5D7UA 4A53A 3PVLA 1AZGB 2K4YA 1RAFB 4FCYA 1VQOQ 4KH1B 1Y57A 3OBYA 3JCMJ 1ZSGA 1UECA 4AFQC 2A28A 4E7JA 4FT4A 3JCMh 2ED1A 4PJOC 1VQ4Q 4RUGA 3CCJT 4BY6B 4C5IA 5KYUB 2E70A 2ZPGB 1WJRA 3G6EA 2EJ9A 2HSEB 4OMPA 2DBKA 2RO0A 3BE3A 4DBQA 1AWXA 1B34A 3CC4Q 3SFMA 2PUOB 1LJOA 4M4ZA 3L2WA 2VYTA 4C92D 3L2UA 1MNEA 2XHCA 1CKAA 4Y28E 1JJ2S 3EG9A 4J9GA 4BI3A 5KYYB 1Q7YU 4ANJA 1MGQA 2NUPB 1IXDA 5ECAA 1UB4A 3VS6A 2RHYA 1GCQA 2JVVA 2YLBA 3RUXA 3OW2S 2A36A 3VS4A 4EDUA 2ZPIB 4QQ6A 4O6JA 1YCYA 1V76A 1M9SA 4PJOD 2VVKA 2M1HA 3D7SB 2DX1A 2L89A 1OX9A 2D0QB 3HTRA 3INZA 3HRTA 3I5SA 5L23A 4JJNK 2FZGB 2X4YA 3G6ET 1KFZA 1Q86R 2CSIA 2OTJA 1TU0B 2J6KA 4E7ZA 5CO7A 2DL3A 2KRMA 2QDLA 2D0NA 1ZUYA 2RHIA 2LCCA 2KT8A 2DYIA 4F14A 1KD1R 1LNXA 1N6AA 2EJGA 2L8DA 4XTZA 3KFVA 3CCEA 3EG2A 3R6OA 1KSWA 5GAOp 1D3BB 4LDXA 4M78G 4C0FA 4GY5A 3FC3A 2GFAA 1QMCA 3MEUA 4PJLA 3GPLA 7AT1B 1TG0A 1Q81R 2QA4A 1ZHIA 3JV3A 2WSEE 1SPKA 2OTJT 1K76A 2VB6A 2RHUA 2RJFA 1YHQQ 5IHIA 4PJOA 2O2OA 5LJ5e 2IG0A 4L5GA 4J7IA 4GLMA 4J6YA 1QWFA 2BZ8A 1JXMA 1PNJA 3VS1A 3PTAA 3RIRA 3RBBB 1G3TA 1WHJA 3GNFB 3FJPA 2P4TA 3CCET 3V7SA 2DZ9A 3NFCA 1YJ9Q 3H8ZA 2CP3A 1P92A 5KCHA 1VQ5A 4C0DC 1Q95G 3HFOA 2OAWA 4DEXA 1ABQA 5GAMe 2YRVA 3OQ5A 1I1JA 4C5GA 3V7CA 1R77A 1I4K1 4M77G 4FYWB 4QKUA 3GBQA 2O9VA 4EPCA 5J39A 3M59A 5IXFA 1M30A 1AWWA 5C6SA 2DTIA 3GP8A 4J83A 3IQLA 1WZOA 2K79A 2X51A 5D6WA 4AG2C 4E7LA 2MOXA 4HXJA 4L6V5 2DD4A 2ZPFB 3M57A 1VYUA 1W4SA 4N4IA 1WHHA 2MF2A 3QBYA 2I2LA 3MHXA 2PNIA 2EQIA 2O4XB 2ESWA 3HRSA 1VQ5T 3TQ7P 3SB2A 2CUDA 2L0AA 2FG0A 3C12A 3EGDA 4Z8AA 1SRMA 2GFUA 1NYGA 2JN0A 3VKIA 1D0YA 4ZGJB 1ABOA 1JEGA 1YN8A 3DKMA 3SWNC 3E2UA 3JCMe 1VYVA 3R6NA 1Y71A 4F7UF 1G3WA 3CCVQ 1GBQA 2RQTA 4MZMA 1J3TA 2LQNA 2CS7A 4J6XA 4RCCA 2ZPHB 5GAOm 1Q7YR 5J26A 1RI0A 4C8QF 1IRXA 1BKBA 1WXTA 1K9MC 1CKBA 2KBTA 3CEYA 3HHTB 2A7YA 4XTUA 5CR2A 2CT4A 2HL3A 3JB9H 2YRDA 1D1BA 2NUTB 2XMFA 4FSXA 5GMKm 2J05A 3LW5E 2ZPEB 1PC0A 2RK1A 1WDXA 2XIDA 1MMAA 5GANj 9ATCB 1G3SA 2DXBA 2E1HA 1R0BG 4M75B 4OMQA 3CCRQ 1WGSA 2DXUA 1QQJA 3LLRA 3QXEB 1Q82R 1W6XA 1Y96A 2FHDA 3OYMA 2MAMA 1IHVA 1VQNQ 4FSSA 6AT1B 1I8FA 2ABLA 1KG1A 1YITQ 3UT1A 3CCQA 3M0UA 3V7RA 1ZSZB 1N27A 4F7UE 4ELZC 3TREA 4BI8B 2RA2A 1D1AA 5KH6A 3I55Q 4M7AG 2COYA 1XNIA 1C6VX 2DM1A 4BE0A 2DD5A 3QKJA 3EGXA 4C8QE 4DA4A 2CP0A 2O88A 4F7UB 2QQAA 4Y92A 2LC4A 5IXBA 3NTHA 4XTYA 2OTLA 3L2QA 4LE9A 1TOVA 1TTHB 4M7DF 5A2QE 4ZN1A 1M2OA 4DOWA 2F2WA 5CVIA 4C8QB 2HKQB 1QVGA 3OSVA 2VASA 1JRIA 2RQUA 2XU8A 2KDSA 1WXUA 2AIRB 1BCOA 2XD0A 1KQSP 3P8DA 3SWNA 5GANh 3CMEA 5LJ5g 3CCQT 4N0AC 3JCMb 2KVQG 4RTVA 1WIEA 4FIBA 2H8HA 1NJIR 1YJWA 3CC2A 4JS4A 4OMMA 2DILA 1RLQC 1YCSB 4AFSC 1WI7A 4FYYB 2AHJB 4MZPA 4RG8A 5LJ3h 5CQYA 1YBYA 2EYZA 5GAMg 4OF1A 1WYXA 1YFNA 1ZA2B 1G5VA 4ZN3A 2BKDN 2OTLT 2NUZA 2HEQA 2AZSA 2EJFA 2P0KA 1M2VA 1S72Q 2HD0A 3JCMQ 2Y4XA 3HP9A 3E19A 1SHFA 3QDRB 1WQ7A 4M7DE 2GNCA 5LJ3d 2CP6A 5GAOn 3M9QA 2ENMA 2LDMA 4DBHA 3LWHA 1DJ7B 3CMET 4FM4B 3EFOB 4MDWA 5CKFA 1WXBA 1VQKQ 1UJ0A 5KYWB 2JTEA 3QJYA 3HFNA 4R0KA 4M7DB 3CC2T 1VQ7Q 2PUKB 1VOMA 4D6WA 2RF0A 1UUEA 3V8LA 3CCMT 1X75C 2R57A 1JJ2A 5GAOq 1AWOA 1GBRA 1AHJB 3RESA 2DEQA 4GBQA 1UHFA 1U8RA 1H3HA 8ATCB 1UGQB 3JCMW 2C06A 1OPLA 3CXCP 2H3JA 3M55A 2VXFA 3OW2A 2E64A 2SRCA 1KC8U 1I0CA 2DJZA 3O8VA 3JSCA 2RD1A 4E7HA 1IO6A 2RJDA 4KUIA 4FT2A 2EKOA 1H641 3H0FA 4JDSA 1B07A 1QVFS 3I5RA 2FO0A 4XTXA 3A8MB 1O75A 3VYHB 4HVVA 1YWPA 4LXCA 1G83A 3H0HA 3U23A 2HAXA 1I5OB 2J7IA 3G4SQ 1VQ6T 3VS2A 4N0AA 3RR6A 1UGPB 2X3WD 1YI2A 1QVGS 3M0TA 1BK2A 3QJ6A 3A8HB 1LCKA 2YUOA 3SDZA 3UA7A 4RTZA 4C92F 5LJ5f 2K3BA 3N5BB 3CC7A 5AT1B 2QQ9A 3CCUQ 1B34B 4BDYA 2E5KA 3OA6A 1KQ2A 1ZBXA 2Y4YA 1TUGB 2SEMA 4OB3B 1TSFA 3KXTA 3S3MA 3AHUA 1K8AU 3CCJA 3NPFA 3EG9B 2VXEA 4E2FB 3HL8A 1V29B 1ZA1B 3JCMP 1NEBA 3ME9A 5GAN2 1ZBJA 1U1SA 3CPWS 2DRKA 1M4ZA 2QEXQ 2O9SA 2ED0A
chains in the Genus database with same CATH topology
2LX7A 2JW4A 2JXBA 5GJVB 1M3CA 3VRYA 1HSQA 1B3QA 1H92A 1HJDA 1TG0A 1TUDA 3JV3A 1K9AA 2V1RA 2PTKA 1SPKA 3EHQA 3REAB 2KEAA 4ZNXA 2DBMA 2K6DA 1K76A 2DMOA 2DL5A 1M3BA 2AKLA 2D8HA 5IHIA 1A0NB 1UG1A 3SEMA 4LUDA 2YUPA 2AK5A 2O2OA 2K7AA 1JU5C 4HVUA 2D8JA 4GLMA 2LJ3A 1I07A 1QWFA 2BZ8A 4ORZA 1JXMA 1PNJA 3VS1A 3RBBB 2M51A 3M0RA 1PWTA 3C0CA 2VWFA 3CQTA 4RTYA 2L3SA 3TSWA 1OEBA 2OAWA 4DEXA 1ABQA 3EG3A 1I1JA 2I0NA 1OOTA 1ZUUA 1S1NA 1QKXA 3UF4A 4LUEA 2RN8A 1WX6A 1MV3A 3GBQA 4KRTA 1E7OA 2A08A 2O9VA 2FPFA 2AZVA 3RNJA 4JZ3A 2CT3A 3I9QA 1SEMA 2GQIA 2KYMA 5IXFA 1M30A 1G2BA 2KROA 1AWWA 2EKHA 1M8MA 4AG1C 2YUQA 3IQLA 1X2KA 2FPDA 2K79A 4AG2C 2CH4A 3TSZA 4JZ4A 2MOXA 1UGVA 4HXJA 2JM9A 4IIMA 1VYUA 1UTIA 2EVRA 1N5ZA 2F2VA 2JS2A 5FWBA 1NM7A 4WCIA 4RTUA 2PNIA 1X6BA 3NMZC 5GJWB 2EQIA 3H0IA 5HCKA 4OMNA 2ESWA 2LCSA 1VA7A 2KRNA 1OV3A 2FPEA 1WA7A 1X6GA 3LH5A 1JXOA 1YNZA 1Z9QA 2CUDA 2L0AA 2FG0A 3O5ZA 4D8DA 2KE9A 4Z8AA 1SRMA 1NYGA 3ZL7C 1SSHA 2LMJA 1ABOA 1JEGA 1YN8A 2KNBB 4RTXA 5IHNA 3QWYA 2KT1A 2A37A 1JQQA 1QKWA 1VYVA 3R6NA 1AD5A 1RLPC 4LN2A 1QCFA 2EBPA 1GBQA 3VS3A 2RQTA 1K0SA 1J3TA 2KRSA 2CSQA 2LQNA 2OJ2A 5FWCA 2JS0A 4J9IA 4Z88A 1NLOC 2BZYA 4D8KA 2DJQA 1AVZC 1K4US 1WXTA 1CKBA 2KBTA 4J9EA 2DE0X 4HVWA 2CT4A 1PRLC 1MUZA 1GFCA 1JO8A 2XMFA 2DLPA 1QWEA 2J05A 2MCNA 3EG1A 1GCPA 1YP5A 3I35A 1WDXA 4IIOA 2HSPA 2BZXA 1FMKA 1VYTA 1ZUKA 2ECZA 2C0IA 2HDAA 2LNHB 4AFZC 4OMQA 2DRMA 2CUBA 1E6GA 1W6XA 1AOJA 3PE0A 4A63B 1OPKA 3FJ5A 3QWXX 4FSSA 2ABLA 4JJCA 2D1XA 1PKTA 1FYNA 3M0UA 4X1VA 1W70A 2EGCA 2L3QA 4LNPA 2KYBA 2RQVA 2DM1A 2VKNA 2CDTA 2K2MA 2K9GA 1ZX6A 2RNAA 4RTTA 5EC7A 2O88A 2EPDA 2DVJA 4Y92A 2LJ0A 5IXBA 4J9CA 2DL8A 2DL7A 4E6RA 1UJYA 4LE9A 1GCQC 3VS7A 1UHCA 4Z89A 2F2WA 5IH2A 2JM8A 2YSQA 2HBWA 2B86A 1CSKA 1M27C 4CC7A 2DNUA 2RQUA 1UFFA 2W10A 1WXUA 1ZLMA 1UDLA 3UA6A 2W0ZA 2C0TA 1X43A 4ESRA 1K1ZA 1Y0MA 1NG2A 4JJDA 3SHWA 4RTVA 1WIEA 2H8HA 2O31A 2EW3A 2EGEA 2RMOA 2J06A 5I11A 1PHTA 2LP5A 4OMMA 2HCKA 2DILA 5IHKA 2KR3A 2G6FX 1T0HA 4JPBW 1RLQC 1T0JA 2L3PA 1W1FA 2RPNA 2X3XD 1K0XA 1YCSB 3VS0A 4AFSC 1H8KA 2F2XA 1WI7A 2KGTA 1KIKA 2GGRA 1NYFA 4DEYA 1RI9A 1AWJA 1PRMC 3VRZA 2ROLA 2EYZA 1TUCA 1UE9A 2P4RA 4QT7A 1WYXA 1BBZA 1T3LA 2NUZA 1X2QA 2HEQA 2AZSA 1KJWA 2M0YA 1XOVA 1BB9A 3EGUA 3A98A 4CC2A 1SHFA 4J9DA 2RQWA 2GNCA 3EHRA 1WLPB 2LJ1A 3M0PA 2DA9A 2ENMA 4F16A 3PVLA 1EFNA 2J6OA 3PVQA 4J9FA 1AZGB 2GTOA 2V1QA 2EYYA 1RUWA 1WXBA 1U5SA 4K11A 1Y57A 1GL5A 3H41A 1UJ0A 1ZSGA 1UECA 2JTEA 1X27A 2A28A 2LQWA 4AFQC 4R0KA 1WFWA 2YUNA 3M0QA 4RTWA 2ED1A 1SHGA 4RUGA 2RF0A 1UUEA 2J6FA 4EIKA 2EYXA 2PZ1A 4OMPA 2CH4W 1AWOA 1GBRA 2DBKA 2NWMA 2KXCA 1AWXA 4GBQA 4JJBA 4HCKA 1GRIA 1UHFA 1H3HA 4J9HA 4M4ZA 1NEGA 2IIMA 1OPLA 2AKKA 3NHNA 1M3AA 1CKAA 4J9GA 2JT4A 1HD3A 2DYBA 4AFUC 5ECAA 1NLPC 1AEYA 2SRCA 1AZEA 3VS6A 2KXDA 4OMOA 3REBB 1I0CA 1GCQA 2YT6A 1BU1A 3VS5A 5FW9A 1IO6A 2RQRA 2CREA 1T3SA 2A36A 1SRLA 3VS4A 2JMCA 3H0FA 3UATA 1B07A 3I5RA 1ARKA 2FO0A 2LZ6B 1GFDA 4HVVA 2VVKA 2DF6A 1YWPA 4J9BA 4F17A 1G83A 2DX1A 3H0HA 3U23A 2J7IA 1U3OA 2ROTA 2MIOA 2L2PA 3VS2A 3I5SA 4CC3A 5L23A 2BTTA 1V1CA 2X3WD 3NGPA 1KFZA 3M0TA 2GTJA 1BK2A 2CSIA 3ULRB 4CC4B 2FRYA 1X69A 2C0OA 2EGAA 1U06A 1LCKA 2J6KA 2FEIA 2YUOA 3UA7A 4RTZA 2K3BA 1PKSA 2DL3A 3M0SA 2KRMA 2QDLA 2D0NA 2E5KA 1ZUYA 2JMAA 2SEMA 2KT8A 2FRWA 1Z9ZA 2EYWA 3NPFA 3EG0A 1E6HA 4OMLA 3THKA 4F14A 1QLYA 1MV0B 1YWOA 2OI3A 3TVTA 2DL4A 2GBQA 3KFVA 1NEBA 3EG2A 1ZBJA 1KSWA 2YDLA 5I22A 2DRKA 2O9SA 2ED0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LX7 A;  2JW4 A;  2JXB A;  5GJV B;  1M3C A;  3VRY A;  1HSQ A;  1B3Q A;  1H92 A;  1HJD A;  1TG0 A;  1TUD A;  3JV3 A;  1K9A A;  2V1R A;  2PTK A;  1SPK A;  3EHQ A;  3REA B;  2KEA A;  4ZNX A;  2DBM A;  2K6D A;  1K76 A;  2DMO A;  2DL5 A;  1M3B A;  2AKL A;  2D8H A;  5IHI A;  1A0N B;  1UG1 A;  3SEM A;  4LUD A;  2YUP A;  2AK5 A;  2O2O A;  2K7A A;  1JU5 C;  4HVU A;  2D8J A;  4GLM A;  2LJ3 A;  1I07 A;  1QWF A;  2BZ8 A;  4ORZ A;  1JXM A;  1PNJ A;  3VS1 A;  3RBB B;  2M51 A;  3M0R A;  1PWT A;  3C0C A;  2VWF A;  3CQT A;  4RTY A;  2L3S A;  3TSW A;  1OEB A;  2OAW A;  4DEX A;  1ABQ A;  3EG3 A;  1I1J A;  2I0N A;  1OOT A;  1ZUU A;  1S1N A;  1QKX A;  3UF4 A;  4LUE A;  2RN8 A;  1WX6 A;  1MV3 A;  3GBQ A;  4KRT A;  1E7O A;  2A08 A;  2O9V A;  2FPF A;  2AZV A;  3RNJ A;  4JZ3 A;  2CT3 A;  3I9Q A;  1SEM A;  2GQI A;  2KYM A;  5IXF A;  1M30 A;  1G2B A;  2KRO A;  1AWW A;  2EKH A;  1M8M A;  4AG1 C;  2YUQ A;  3IQL A;  1X2K A;  2FPD A;  2K79 A;  4AG2 C;  2CH4 A;  3TSZ A;  4JZ4 A;  2MOX A;  1UGV A;  4HXJ A;  2JM9 A;  4IIM A;  1VYU A;  1UTI A;  2EVR A;  1N5Z A;  2F2V A;  2JS2 A;  5FWB A;  1NM7 A;  4WCI A;  4RTU A;  2PNI A;  1X6B A;  3NMZ C;  5GJW B;  2EQI A;  3H0I A;  5HCK A;  4OMN A;  2ESW A;  2LCS A;  1VA7 A;  2KRN A;  1OV3 A;  2FPE A;  1WA7 A;  1X6G A;  3LH5 A;  1JXO A;  1YNZ A;  1Z9Q A;  2CUD A;  2L0A A;  2FG0 A;  3O5Z A;  4D8D A;  2KE9 A;  4Z8A A;  1SRM A;  1NYG A;  3ZL7 C;  1SSH A;  2LMJ A;  1ABO A;  1JEG A;  1YN8 A;  2KNB B;  4RTX A;  5IHN A;  3QWY A;  2KT1 A;  2A37 A;  1JQQ A;  1QKW A;  1VYV A;  3R6N A;  1AD5 A;  1RLP C;  4LN2 A;  1QCF A;  2EBP A;  1GBQ A;  3VS3 A;  2RQT A;  1K0S A;  1J3T A;  2KRS A;  2CSQ A;  2LQN A;  2OJ2 A;  5FWC A;  2JS0 A;  4J9I A;  4Z88 A;  1NLO C;  2BZY A;  4D8K A;  2DJQ A;  1AVZ C;  1K4U S;  1WXT A;  1CKB A;  2KBT A;  4J9E A;  2DE0 X;  4HVW A;  2CT4 A;  1PRL C;  1MUZ A;  1GFC A;  1JO8 A;  2XMF A;  2DLP A;  1QWE A;  2J05 A;  2MCN A;  3EG1 A;  1GCP A;  1YP5 A;  3I35 A;  1WDX A;  4IIO A;  2HSP A;  2BZX A;  1FMK A;  1VYT A;  1ZUK A;  2ECZ A;  2C0I A;  2HDA A;  2LNH B;  4AFZ C;  4OMQ A;  2DRM A;  2CUB A;  1E6G A;  1W6X A;  1AOJ A;  3PE0 A;  4A63 B;  1OPK A;  3FJ5 A;  3QWX X;  4FSS A;  2ABL A;  4JJC A;  2D1X A;  1PKT A;  1FYN A;  3M0U A;  4X1V A;  1W70 A;  2EGC A;  2L3Q A;  4LNP A;  2KYB A;  2RQV A;  2DM1 A;  2VKN A;  2CDT A;  2K2M A;  2K9G A;  1ZX6 A;  2RNA A;  4RTT A;  5EC7 A;  2O88 A;  2EPD A;  2DVJ A;  4Y92 A;  2LJ0 A;  5IXB A;  4J9C A;  2DL8 A;  2DL7 A;  4E6R A;  1UJY A;  4LE9 A;  1GCQ C;  3VS7 A;  1UHC A;  4Z89 A;  2F2W A;  5IH2 A;  2JM8 A;  2YSQ A;  2HBW A;  2B86 A;  1CSK A;  1M27 C;  4CC7 A;  2DNU A;  2RQU A;  1UFF A;  2W10 A;  1WXU A;  1ZLM A;  1UDL A;  3UA6 A;  2W0Z A;  2C0T A;  1X43 A;  4ESR A;  1K1Z A;  1Y0M A;  1NG2 A;  4JJD A;  3SHW A;  4RTV A;  1WIE A;  2H8H A;  2O31 A;  2EW3 A;  2EGE A;  2RMO A;  2J06 A;  5I11 A;  1PHT A;  2LP5 A;  4OMM A;  2HCK A;  2DIL A;  5IHK A;  2KR3 A;  2G6F X;  1T0H A;  4JPB W;  1RLQ C;  1T0J A;  2L3P A;  1W1F A;  2RPN A;  2X3X D;  1K0X A;  1YCS B;  3VS0 A;  4AFS C;  1H8K A;  2F2X A;  1WI7 A;  2KGT A;  1KIK A;  2GGR A;  1NYF A;  4DEY A;  1RI9 A;  1AWJ A;  1PRM C;  3VRZ A;  2ROL A;  2EYZ A;  1TUC A;  1UE9 A;  2P4R A;  4QT7 A;  1WYX A;  1BBZ A;  1T3L A;  2NUZ A;  1X2Q A;  2HEQ A;  2AZS A;  1KJW A;  2M0Y A;  1XOV A;  1BB9 A;  3EGU A;  3A98 A;  4CC2 A;  1SHF A;  4J9D A;  2RQW A;  2GNC A;  3EHR A;  1WLP B;  2LJ1 A;  3M0P A;  2DA9 A;  2ENM A;  4F16 A;  3PVL A;  1EFN A;  2J6O A;  3PVQ A;  4J9F A;  1AZG B;  2GTO A;  2V1Q A;  2EYY A;  1RUW A;  1WXB A;  1U5S A;  4K11 A;  1Y57 A;  1GL5 A;  3H41 A;  1UJ0 A;  1ZSG A;  1UEC A;  2JTE A;  1X27 A;  2A28 A;  2LQW A;  4AFQ C;  4R0K A;  1WFW A;  2YUN A;  3M0Q A;  4RTW A;  2ED1 A;  1SHG A;  4RUG A;  2RF0 A;  1UUE A;  2J6F A;  4EIK A;  2EYX A;  2PZ1 A;  4OMP A;  2CH4 W;  1AWO A;  1GBR A;  2DBK A;  2NWM A;  2KXC A;  1AWX A;  4GBQ A;  4JJB A;  4HCK A;  1GRI A;  1UHF A;  1H3H A;  4J9H A;  4M4Z A;  1NEG A;  2IIM A;  1OPL A;  2AKK A;  3NHN A;  1M3A A;  1CKA A;  4J9G A;  2JT4 A;  1HD3 A;  2DYB A;  4AFU C;  5ECA A;  1NLP C;  1AEY A;  2SRC A;  1AZE A;  3VS6 A;  2KXD A;  4OMO A;  3REB B;  1I0C A;  1GCQ A;  2YT6 A;  1BU1 A;  3VS5 A;  5FW9 A;  1IO6 A;  2RQR A;  2CRE A;  1T3S A;  2A36 A;  1SRL A;  3VS4 A;  2JMC A;  3H0F A;  3UAT A;  1B07 A;  3I5R A;  1ARK A;  2FO0 A;  2LZ6 B;  1GFD A;  4HVV A;  2VVK A;  2DF6 A;  1YWP A;  4J9B A;  4F17 A;  1G83 A;  2DX1 A;  3H0H A;  3U23 A;  2J7I A;  1U3O A;  2ROT A;  2MIO A;  2L2P A;  3VS2 A;  3I5S A;  4CC3 A;  5L23 A;  2BTT A;  1V1C A;  2X3W D;  3NGP A;  1KFZ A;  3M0T A;  2GTJ A;  1BK2 A;  2CSI A;  3ULR B;  4CC4 B;  2FRY A;  1X69 A;  2C0O A;  2EGA A;  1U06 A;  1LCK A;  2J6K A;  2FEI A;  2YUO A;  3UA7 A;  4RTZ A;  2K3B A;  1PKS A;  2DL3 A;  3M0S A;  2KRM A;  2QDL A;  2D0N A;  2E5K A;  1ZUY A;  2JMA A;  2SEM A;  2KT8 A;  2FRW A;  1Z9Z A;  2EYW A;  3NPF A;  3EG0 A;  1E6H A;  4OML A;  3THK A;  4F14 A;  1QLY A;  1MV0 B;  1YWO A;  2OI3 A;  3TVT A;  2DL4 A;  2GBQ A;  3KFV A;  1NEB A;  3EG2 A;  1ZBJ A;  1KSW A;  2YDL A;  5I22 A;  2DRK A;  2O9S A;  2ED0 A; 
#chains in the Genus database with same CATH topology
 4X9D A;  1RAI B;  4PJO F;  5GAM f;  3PIO A;  3GIB A;  2MPX C;  1M3C A;  3VRY A;  1K73 C;  2NYS A;  3DLL A;  3WVD B;  1UGS B;  2X4X A;  1HSQ A;  1PSE A;  3JCM X;  3L42 A;  4BE1 A;  1FWZ A;  3CMA Q;  2V8I A;  1HJD A;  2HKN A;  4HCC A;  1WQW A;  2PTK A;  4PLI A;  2HZY A;  2K2V A;  5FRM A;  3LWI A;  2DBM A;  4PKC C;  1YI2 T;  2JUF A;  2V8K A;  2RH2 A;  2K6D A;  1M1K C;  2DL5 A;  5KE2 A;  2ATC B;  1M3B A;  2D8H A;  2WSC E;  1UG1 A;  4OB1 B;  3JB9 G;  2G3R A;  3CC7 T;  2AK5 A;  3G71 Q;  3OS2 A;  1GXI E;  4ZGE B;  3URG A;  2CZ1 B;  2PU9 B;  4HVU A;  2D8J A;  2LJ3 A;  2CKK A;  4M78 C;  4WF2 A;  4BD3 A;  4AMC A;  4C92 E;  2M51 A;  3M0R A;  2PQW A;  3MEA A;  1YJN Q;  1PWT A;  4QW2 A;  3C0C A;  2QI2 A;  2CP2 A;  1OEB A;  3JCM d;  4P5N A;  5CCA A;  3EG3 A;  2K3X A;  3ASK A;  2JTF A;  3UF4 A;  4PJO E;  2RN8 A;  1NPR A;  2F69 A;  2K57 A;  1WX6 A;  3GNG A;  3BFM A;  5GAN e;  2QAZ A;  4KGZ B;  4MZT A;  2WAC A;  4KRT A;  3MET A;  2FPF A;  3RNJ A;  4JZ3 A;  2CT3 A;  5A0D A;  2HQE A;  1SEM A;  2Z0W A;  5CQX A;  2KYM A;  4M78 D;  4ZTF A;  1JJ2 P;  2YUQ A;  3QZ9 B;  4PJO B;  4II1 A;  3HKS A;  2FPD A;  3L2R A;  5LJ3 e;  3LX7 A;  5GMK h;  2CH4 A;  2KMT A;  2QTX A;  3CCL A;  3G6E Q;  4OMF B;  3OBW A;  1Q82 U;  2P0Q A;  2WSF E;  1MMG A;  2CZ6 B;  5GAN 5;  1UTI A;  4OVA A;  4PJJ A;  2EVR A;  3TU4 K;  4IUR A;  3TEE A;  3A8L B;  4WCI A;  1X6B A;  3NMZ C;  4M77 C;  5GJW B;  2LCS A;  2KRN A;  2FPE A;  2PVO B;  5KYN A;  2X4W A;  3E9F A;  2QQR A;  3CCS A;  1JXO A;  4DOV A;  1VQ8 A;  4J8O A;  3O5Z A;  3PFS A;  1W2B A;  2HQX A;  2RHZ A;  1SSH A;  4RCB A;  2ZAE A;  4QVZ A;  4XTV A;  5IHN A;  2KT1 A;  4C92 A;  1RAA B;  1IGU A;  1QVP A;  1SG5 A;  3I56 A;  1RLP C;  2AT1 B;  2CYZ B;  4FYX B;  4LDY A;  4IUT A;  3CPF A;  2PVG B;  4UC4 A;  1X6O A;  5FWC A;  1RL2 A;  1WPY A;  3QO3 A;  3CCL T;  2OTJ Q;  4D8K A;  4M77 D;  2DJQ A;  1BCM A;  3LYI A;  1KC8 R;  2XDD A;  5A0L A;  2RK2 A;  4HKE A;  3BW1 A;  4J9E A;  2QDY B;  3C95 A;  4M78 A;  1WNL A;  4HCB A;  4FW2 A;  1VQL Q;  2XIC A;  1GFC A;  1JO8 A;  1OU8 A;  3CCS T;  1NJI U;  3X25 B;  1GCP A;  4C0G A;  1VQ8 T;  1YP5 A;  3I35 A;  2KY9 A;  1M90 C;  2HSP A;  4X34 A;  3RKX A;  3JRZ A;  3EGD B;  3CCE Q;  2C0I A;  4DBF A;  2HDA A;  5FU7 C;  1XQH A;  4KH0 B;  4ZTJ A;  2LNH B;  1G3Y A;  3UDC A;  4C0Z A;  3CD6 Q;  2DKG A;  2GF7 A;  5KCO A;  1VQP A;  3PE0 A;  4IUV A;  3I56 T;  2VGN A;  3FJ5 A;  2MMP A;  3ER0 A;  3QWX X;  4JJC A;  4JS5 A;  2QA4 Q;  3S3O A;  1K8A R;  4B6M A;  3S3N A;  2K5I A;  2KYB A;  4X9C A;  2K2M A;  3BDU A;  3VV0 A;  4MMK A;  4EMH A;  2DXC A;  3MEV A;  2JNG A;  4RTT A;  2EPD A;  3PMT A;  1D3B A;  2R5M A;  2LJ0 A;  1X01 A;  3UWN A;  3H6Z A;  2DL8 A;  2EWN A;  2VC8 A;  1QP3 A;  3OYA A;  4M77 A;  5CIU A;  3VS7 A;  2JM8 A;  1PSF A;  4C0D B;  5FU6 C;  1NZ9 A;  2CZ7 B;  4CC7 A;  2DNU A;  4CI0 C;  1VQ5 Q;  5DM7 R;  4PK4 A;  1M1G A;  1Y96 B;  3QYH B;  1VQP T;  4M7A C;  1UDL A;  4RG2 A;  2P84 A;  2C0T A;  2K5L A;  4MDX A;  3PMI A;  2RI5 A;  3OYD A;  1RAC B;  3CBP A;  4BDZ A;  4A4K A;  3QDF A;  2KR3 A;  2FYK A;  2G6F X;  5HK0 A;  1W2B S;  4JPB W;  5C0M A;  1T0J A;  4VUB A;  3EGX B;  1Q86 C;  4M7A E;  1PRM C;  3VRZ A;  2ROL A;  3OYK A;  3P8H A;  3MCA B;  2M9U A;  2JTM A;  2QXF A;  3PNW C;  4KBM B;  2DZC A;  3HPW A;  2FZC B;  2QGF B;  3A98 A;  4M7A D;  3CCV T;  3LGL A;  1RAH B;  2QGG A;  1KD1 C;  1KHI A;  1VQ9 A;  2E10 A;  1MND A;  4PJN A;  1M1F A;  2DA9 A;  3M4G A;  2QK0 A;  1EFN A;  2V8J A;  2GTO A;  4N4G A;  2A0F B;  2K3Y A;  2V1Q A;  2EYY A;  3SWN B;  4K11 A;  1Y07 A;  5LJ3 g;  3H41 A;  2LQW A;  1WFW A;  1SF9 A;  2YUN A;  3M0Q A;  3OYY A;  4RTW A;  2CZ0 B;  1F1B B;  3ZFJ A;  1OX8 A;  2J6F A;  1SKU B;  3WVE B;  4XTW A;  5GMK e;  2BUD A;  3VJP A;  4F04 B;  2DVE A;  2EYQ A;  4JJB A;  1IZ6 A;  1NPP A;  1GRI A;  3CCR T;  3A5Z B;  4J9H A;  1NEG A;  2IIM A;  4AT1 B;  5M9O A;  3NHN A;  2DXT A;  2JT4 A;  4B9X A;  1XTD A;  2DYB A;  4AFU C;  1HK9 A;  1M2V B;  3RKY A;  1AEY A;  1NLP C;  1QVF A;  5GAN 4;  1R8O B;  1AZE A;  4YTL A;  4OMO A;  4L59 A;  1VQ9 T;  3MO8 A;  5KYX A;  3REB B;  4QQG A;  2YT6 A;  4C5H A;  5FW9 A;  2RQR A;  2CRE A;  1SRL A;  4JRI A;  2JMC A;  5DLQ E;  3OS0 A;  1AT1 B;  3OMC A;  3KUF A;  3JCM c;  2DEU A;  1GFD A;  3OS5 A;  2NLU A;  8AT1 B;  2DF6 A;  1M5Q 1;  4IUQ A;  4M7A A;  3GF5 A;  4F17 A;  4CC3 A;  3L2Z A;  4M75 G;  2BTT A;  1V1C A;  3NGP A;  1D09 B;  1VQM A;  3CCQ Q;  2LRQ A;  2EGA A;  1U06 A;  2KAF A;  1PKS A;  2D6F A;  4J5Y A;  4XU3 A;  1PM3 A;  1KHC A;  5GAN 6;  3CPW A;  1K73 R;  3E9G A;  2FRW A;  2QQS A;  1Z9Z A;  2EYW A;  3AT1 B;  3CCM A;  2COW A;  5GAN d;  2DL4 A;  2QQB A;  2YXY A;  2MWO A;  4J7F A;  2EQM A;  3JB9 I;  2LX7 A;  3BDL A;  2JW4 A;  2OTL Q;  4QVD A;  4F7U G;  4BUG A;  5LJ5 j;  3MP8 A;  3J81 E;  1TUD A;  2XDB A;  3BY7 A;  3SD4 A;  4A4F A;  4C8Q G;  3M53 A;  3EHQ A;  1OQK A;  4KGX B;  2KEA A;  2BE7 D;  4ZNX A;  2DAQ A;  3QZ5 B;  3CME Q;  1VQM T;  4JLG A;  4O5V A;  2AKL A;  2O01 E;  3M5A A;  4Q5W A;  3SEM A;  4LUD A;  1RAG B;  1C0M A;  3EFR A;  2K7A A;  1YJW Q;  2KSS A;  1VQ6 A;  1JU5 C;  3CC2 Q;  3X26 B;  5GAM j;  1IGQ A;  5LJ3 f;  2HQH A;  4DBR A;  5GAN 3;  3JCM V;  5DY9 A;  1UEB A;  4OB2 B;  1OI1 A;  1H3Z A;  1K9M U;  2F1L A;  3J80 E;  2EQU A;  1YIJ A;  2VWF A;  3CQT A;  4RTY A;  2L3S A;  4EMK C;  4XU2 A;  1OOT A;  1ZUU A;  3QYG B;  5GAO l;  3JCM g;  1EZZ B;  1MV3 A;  1E7O A;  3L2V A;  3I9Q A;  2R58 A;  3VYG A;  2KRO A;  2EKH A;  1M8M A;  2LNV A;  2RB6 A;  3RMS A;  1N9S A;  2L5Q A;  2VV5 A;  4WTO B;  1X2K A;  3KBG A;  5GMK l;  2EQJ A;  2YRC A;  5CAI A;  4JZ4 A;  3X24 B;  4M7D G;  2JJ9 A;  2JM9 A;  2LQ8 A;  4IIM A;  1YIJ T;  5FWB A;  1NM7 A;  2QG9 B;  4RTU A;  2RI3 A;  3H0I A;  5HCK A;  4OMN A;  3JB9 D;  1VA7 A;  5GAM h;  1OV3 A;  1WA7 A;  3P8B B;  1YNZ A;  1Z9Q A;  3X28 B;  4D8D A;  3ZL7 C;  1QVG P;  3RER A;  5KYW A;  1VQO A;  2LMJ A;  4RTX A;  2HL5 C;  3PGG A;  2CP7 A;  4M78 F;  2E4H A;  2RJC A;  2FZK B;  1VQ4 A;  4A54 A;  1AD5 A;  4LN2 A;  2EBP A;  4BY6 C;  4LDU A;  4OB0 B;  2CSQ A;  1I81 A;  3V8J A;  2OJ2 A;  3EAE A;  3CC4 A;  4PLL A;  3CPW P;  1YI2 Q;  1NLO C;  2BZY A;  3G7Z A;  1AVZ C;  1K4U S;  2BIV A;  4FL6 A;  3OMG A;  4HVW A;  3CC7 Q;  1NE8 A;  2XDP A;  2OAU A;  1PRL C;  5CKD A;  1MUZ A;  4XQ3 A;  1N9R A;  2DLP A;  3CCJ Q;  2E12 A;  1QWE A;  3EG1 A;  4TVR A;  4IIO A;  1NBE B;  2BZX A;  1FMK A;  1VYT A;  1ZUK A;  2ECZ A;  1FX7 A;  4ATO A;  1VQO T;  1VUB A;  3OYC A;  4BB7 A;  4EMK A;  3G71 T;  5FLX E;  1VQ4 T;  1AOJ A;  4C92 B;  3C94 A;  2D1X A;  1PKT A;  2RHX A;  4M78 E;  1FYN A;  5GAN 7;  3GLX A;  1YJN T;  2HNI A;  2EGC A;  3CC4 T;  4M77 F;  2RQV A;  3JCM f;  2VKN A;  2CDT A;  3EH2 A;  3M58 A;  1FXX A;  2KI7 A;  4M78 B;  1ZX6 A;  1LOJ A;  2EIF A;  3NTI A;  5EC7 A;  3MP6 A;  1N8R C;  3EFS A;  4J9C A;  1UJY A;  4KUL A;  3OW2 P;  1UHC A;  2PVD B;  1MMN A;  1VIF A;  1BI1 A;  4HCZ A;  2YSQ A;  3OYH A;  2HBW A;  3G1J A;  2E41 A;  2E6Z A;  3VUZ A;  3LGF A;  4JRQ A;  5GMK i;  1OZ2 A;  3RDV A;  1UFF A;  2W10 A;  2YWW A;  4PFO A;  1TS9 A;  1X43 A;  2VGM A;  1YHQ A;  4JJD A;  3SHW A;  4C92 G;  4QVC A;  2RMO A;  1WJQ A;  2J06 A;  4JLI A;  2FVU A;  1OYX A;  1VQL A;  2LX9 A;  1K9M R;  1D0X A;  2LP5 A;  2HCK A;  2HMA A;  5IHK A;  5KYU A;  1QCN A;  1T0H A;  4OGC A;  3QG1 A;  4R55 A;  3HRU A;  4M77 E;  1W1F A;  2KQW A;  2RPN A;  2RJE A;  2F2X A;  2LVM A;  3OYB A;  2KGT A;  2GGR A;  1NYF A;  4DEY A;  1TUC A;  2P4R A;  3CCL Q;  2LT1 A;  4PJO G;  2BE9 B;  1YJ9 A;  1T3L A;  5KYY A;  1BI3 A;  3CD6 A;  1X2Q A;  3QPH A;  1KJW A;  2M0Y A;  4M77 B;  2NUP A;  1PCX A;  2CP5 A;  2EFI A;  3EGU A;  1I5L A;  2XK0 A;  4CC2 A;  4PL6 A;  3F70 A;  2RM4 A;  2XKO C;  3VU3 C;  1WLP B;  4NS5 A;  2LJ1 A;  3M0P A;  3CCS Q;  2DO3 A;  1IHW A;  1VQ8 Q;  3QHS A;  4MML A;  4F16 A;  3GOX A;  3PVQ A;  2J6O A;  4J9F A;  2DTH A;  1K73 U;  1LVK A;  4JRK A;  1YHQ T;  4A4H A;  3RKW A;  1RUW A;  1U5S A;  2FB7 A;  1GL5 A;  1SSF A;  2JZ2 A;  3OSS C;  1X27 A;  1VQL T;  3OYJ A;  3WXM B;  4IUU A;  1SHG A;  1FMW A;  1HXD A;  2IVW A;  3I56 Q;  1R0C B;  5IAY A;  1M1K U;  3EH1 A;  4EIK A;  1FMV A;  4RMO A;  2EYX A;  2PZ1 A;  4PJM A;  2CH4 W;  2NWM A;  2KXC A;  4HCK A;  2DK3 A;  2E3H A;  3C4S A;  1YJ9 T;  2Y90 A;  3CD6 T;  2AKK A;  4LDW A;  1M3A A;  4FW1 A;  4M7A F;  1HD3 A;  1O9S A;  4HT8 A;  2QA4 T;  2KXD A;  1BU1 A;  3VS5 A;  4E7S A;  4A4E A;  1T3S A;  2QAS A;  2B8A A;  3FRN A;  5FU7 B;  3UAT A;  4R56 A;  5EG2 A;  3M4Y A;  1Y7X A;  1ARK A;  1KQS A;  2LZ6 B;  5A0G A;  3CCV A;  4J9B A;  2ZGW A;  1U3O A;  4QQD A;  1WHL A;  5J3B A;  2ROT A;  3E1S A;  2MIO A;  1RAB B;  2L2P A;  1VQP Q;  2QYZ A;  1ACM B;  3OYN A;  2GTJ A;  4M75 F;  3ULR B;  4CC4 B;  1X69 A;  2C0O A;  1D0Z A;  2FRY A;  4EMG A;  3V8K A;  1KK7 A;  2FEI A;  3QII A;  4PFP A;  2YLC A;  3M0S A;  1PD0 A;  2JOY A;  3JB9 J;  2JMA A;  1N8R U;  2E3I A;  4NL2 A;  3MP1 A;  3EG0 A;  1E6H A;  4OML A;  2EAY A;  3THK A;  1QLY A;  1MV0 B;  1TWB A;  2OI3 A;  1YWO A;  3DB4 A;  3TVT A;  2GBQ A;  3FIF A;  1M8V A;  2YDL A;  5KYX B;  5I22 A;  3CCR A;  4IKF A;  4M75 C;  2JXB A;  3Q1J A;  5GJV B;  5FU6 B;  4ME7 A;  5GAN g;  1W2B P;  1B3Q A;  4LD9 K;  1H92 A;  1VQN A;  2COZ A;  4E47 A;  4M7A B;  1YIT A;  3PT9 A;  1K9A A;  2V1R A;  2GCX A;  3REA B;  1ZQ1 A;  1ZSZ C;  3I55 A;  2DMO A;  1A0N B;  3S6W A;  2YUP A;  4E7K A;  4BAC A;  4FU6 A;  2IPO B;  4M75 E;  2LCL A;  1BI2 A;  3OYE A;  1IRE B;  1Q81 C;  1I07 A;  4XK8 E;  3CXC A;  3A8G B;  4ORZ A;  3X20 B;  1TXQ A;  5HKC A;  4IUP A;  4M75 D;  2VUB A;  3M56 A;  1KC8 C;  5LL6 S;  2O4X A;  2DPP B;  3DB3 A;  2YHT A;  4C8Q C;  4NL3 A;  3TSW A;  4FYV B;  5CKB A;  1VIE A;  1M90 U;  2I0N A;  1VQN T;  1S1N A;  1QKX A;  1YIT T;  1BIA A;  4LUE A;  1LPL A;  5LJ3 j;  2A3L A;  1VQ9 Q;  3A1P A;  2ZCF B;  2A08 A;  3I55 T;  2DTO A;  1D1C A;  2DIG A;  4C5E A;  3OYF A;  2AZV A;  3PIP A;  3FEO A;  4LDV A;  2F5K A;  2GQI A;  4J6W A;  2ZZD A;  1G2B A;  2P0P A;  4Z02 A;  4AG1 C;  3JAM E;  2CGH A;  4HT9 A;  2MWP A;  4JUV A;  1OZ3 A;  2ZPB B;  3T9N A;  1C1A A;  5AYF A;  5IN1 A;  1KQS S;  1K8A C;  3TSZ A;  1UGV A;  4C8Q D;  1RAD B;  1N5Z A;  2E65 A;  2F2V A;  1S72 A;  1JBM A;  2JS2 A;  5CKE A;  4XAX B;  2NUT A;  3OB9 A;  1G8X A;  2L3R A;  4JRP A;  3QSU A;  3CBM A;  1X6G A;  3LH5 A;  4XU0 A;  1XJW B;  1OUL A;  3NTK A;  3J7A F;  3H9N A;  2E5Q A;  4BI4 A;  4ZGD B;  3TCJ A;  3HSB A;  2KE9 A;  2X4J A;  1HYO A;  3A8O B;  4M75 A;  1QCO A;  1VQK A;  1U1T A;  2KNB B;  1M1K R;  3QWY A;  2OX7 A;  2A37 A;  1VQ7 A;  1JQQ A;  1QKW A;  2M0O A;  3ZBD A;  4M7D C;  4KGV B;  2KK4 A;  2DET A;  5HK3 A;  1QCF A;  3VS3 A;  1K0S A;  5GAO r;  5GAN f;  1ZSZ A;  5I2S A;  2KRS A;  2LT4 A;  4V2S A;  2EQK A;  2JS0 A;  4LD6 A;  1TH7 A;  4J9I A;  4Z88 A;  3OY9 A;  2H3E B;  4RKU E;  1VQM Q;  2V26 A;  4NOY A;  1KQ1 A;  1S72 T;  2DE0 X;  2X9H A;  3MJX A;  3JB9 F;  1Q86 U;  4XU1 A;  4F7U A;  5I2M A;  2GQV A;  5CK9 A;  2MCN A;  3CCM Q;  2RI2 A;  1Q7Y C;  3OYG A;  4PNO A;  1BI0 A;  3L1A A;  4C8Q A;  2MYS A;  3FLG A;  1VQK T;  5CKH A;  4M7D D;  4DQ2 A;  4AFZ C;  2F5T X;  2DRM A;  1YJW T;  3CXC S;  2CUB A;  1KD1 U;  3G4S A;  1E6G A;  1VQ7 T;  4HA8 A;  4CRI A;  1PD1 A;  4A4G A;  1BYM A;  3MEW A;  4A63 B;  3CBO A;  1OPK A;  1QP2 A;  5IT9 E;  3ZEH A;  2D9T A;  1N8R R;  4KT0 E;  4X1V A;  1W70 A;  3RMQ A;  2L3Q A;  5D6X A;  4LNP A;  2MK5 A;  3FB9 A;  3CCU A;  2QTV A;  1Q81 U;  1B7T A;  1Q82 C;  1BIB A;  3OS1 A;  4E7I A;  2MI6 A;  2K9G A;  5LJ5 h;  1MHN A;  2RNA A;  4OGE A;  5FRO A;  1VQ6 Q;  1EIF A;  1WHG A;  2DVJ A;  1QW1 A;  5GAN 8;  2HBP A;  2QEX A;  1MMD A;  2DL7 A;  4E6R A;  3MPU B;  1GCQ C;  5I21 A;  1YIJ Q;  1WHK A;  4Z89 A;  2DFU A;  2M02 A;  5IH2 A;  1QVF P;  3UPU A;  5LJ5 d;  2B86 A;  1CSK A;  1M27 C;  4EMK B;  3G4S T;  3CMA A;  2XG8 D;  1PG5 B;  1EX4 A;  1WJS A;  5KE3 A;  1ZLM A;  3VUB A;  3QUI A;  3UA6 A;  2W0Z A;  4ESR A;  1K1Z A;  3EFO A;  3DLM A;  1OU9 A;  1Y0M A;  1NG2 A;  4ELY C;  4KUD K;  5DLO A;  2X35 A;  2O31 A;  2DER A;  3OYI A;  2EW3 A;  2EGE A;  4M7D A;  5HY6 A;  3G71 A;  3OYL A;  5I11 A;  1PHT A;  4GLK A;  1WHM A;  3CCU T;  5GAM d;  4PFZ A;  2FL7 A;  2E6N A;  2L3P A;  5L8R E;  1IB8 A;  1K0X A;  2X3X D;  3VS0 A;  1H8K A;  1KIK A;  3LH0 A;  3FDR A;  1RI9 A;  1AWJ A;  1UGR B;  4BE2 A;  3MKD A;  2M16 A;  1YJN A;  1UE9 A;  1M90 R;  2QEX T;  4QT7 A;  1RAE B;  1NJI C;  4OP0 A;  4Y91 A;  1BBZ A;  1JB0 E;  2K5F A;  2LQK A;  4N4H A;  2DIQ A;  2XI9 A;  1XOV A;  1BB9 A;  4B9W A;  4C92 C;  3CMA T;  2LTO A;  4J9D A;  3M54 A;  2R5A A;  2RQW A;  3EHR A;  5D6Y A;  5GMK j;  5FRN A;  5D7U A;  4A53 A;  3PVL A;  1AZG B;  2K4Y A;  1RAF B;  4FCY A;  1VQO Q;  4KH1 B;  1Y57 A;  3OBY A;  3JCM J;  1ZSG A;  1UEC A;  4AFQ C;  2A28 A;  4E7J A;  4FT4 A;  3JCM h;  2ED1 A;  4PJO C;  1VQ4 Q;  4RUG A;  3CCJ T;  4BY6 B;  4C5I A;  5KYU B;  2E70 A;  2ZPG B;  1WJR A;  3G6E A;  2EJ9 A;  2HSE B;  4OMP A;  2DBK A;  2RO0 A;  3BE3 A;  4DBQ A;  1AWX A;  1B34 A;  3CC4 Q;  3SFM A;  2PUO B;  1LJO A;  4M4Z A;  3L2W A;  2VYT A;  4C92 D;  3L2U A;  1MNE A;  2XHC A;  1CKA A;  4Y28 E;  1JJ2 S;  3EG9 A;  4J9G A;  4BI3 A;  5KYY B;  1Q7Y U;  4ANJ A;  1MGQ A;  2NUP B;  1IXD A;  5ECA A;  1UB4 A;  3VS6 A;  2RHY A;  1GCQ A;  2JVV A;  2YLB A;  3RUX A;  3OW2 S;  2A36 A;  3VS4 A;  4EDU A;  2ZPI B;  4QQ6 A;  4O6J A;  1YCY A;  1V76 A;  1M9S A;  4PJO D;  2VVK A;  2M1H A;  3D7S B;  2DX1 A;  2L89 A;  1OX9 A;  2D0Q B;  3HTR A;  3INZ A;  3HRT A;  3I5S A;  5L23 A;  4JJN K;  2FZG B;  2X4Y A;  3G6E T;  1KFZ A;  1Q86 R;  2CSI A;  2OTJ A;  1TU0 B;  2J6K A;  4E7Z A;  5CO7 A;  2DL3 A;  2KRM A;  2QDL A;  2D0N A;  1ZUY A;  2RHI A;  2LCC A;  2KT8 A;  2DYI A;  4F14 A;  1KD1 R;  1LNX A;  1N6A A;  2EJG A;  2L8D A;  4XTZ A;  3KFV A;  3CCE A;  3EG2 A;  3R6O A;  1KSW A;  5GAO p;  1D3B B;  4LDX A;  4M78 G;  4C0F A;  4GY5 A;  3FC3 A;  2GFA A;  1QMC A;  3MEU A;  4PJL A;  3GPL A;  7AT1 B;  1TG0 A;  1Q81 R;  2QA4 A;  1ZHI A;  3JV3 A;  2WSE E;  1SPK A;  2OTJ T;  1K76 A;  2VB6 A;  2RHU A;  2RJF A;  1YHQ Q;  5IHI A;  4PJO A;  2O2O A;  5LJ5 e;  2IG0 A;  4L5G A;  4J7I A;  4GLM A;  4J6Y A;  1QWF A;  2BZ8 A;  1JXM A;  1PNJ A;  3VS1 A;  3PTA A;  3RIR A;  3RBB B;  1G3T A;  1WHJ A;  3GNF B;  3FJP A;  2P4T A;  3CCE T;  3V7S A;  2DZ9 A;  3NFC A;  1YJ9 Q;  3H8Z A;  2CP3 A;  1P92 A;  5KCH A;  1VQ5 A;  4C0D C;  1Q95 G;  3HFO A;  2OAW A;  4DEX A;  1ABQ A;  5GAM e;  2YRV A;  3OQ5 A;  1I1J A;  4C5G A;  3V7C A;  1R77 A;  1I4K 1;  4M77 G;  4FYW B;  4QKU A;  3GBQ A;  2O9V A;  4EPC A;  5J39 A;  3M59 A;  5IXF A;  1M30 A;  1AWW A;  5C6S A;  2DTI A;  3GP8 A;  4J83 A;  3IQL A;  1WZO A;  2K79 A;  2X51 A;  5D6W A;  4AG2 C;  4E7L A;  2MOX A;  4HXJ A;  4L6V 5;  2DD4 A;  2ZPF B;  3M57 A;  1VYU A;  1W4S A;  4N4I A;  1WHH A;  2MF2 A;  3QBY A;  2I2L A;  3MHX A;  2PNI A;  2EQI A;  2O4X B;  2ESW A;  3HRS A;  1VQ5 T;  3TQ7 P;  3SB2 A;  2CUD A;  2L0A A;  2FG0 A;  3C12 A;  3EGD A;  4Z8A A;  1SRM A;  2GFU A;  1NYG A;  2JN0 A;  3VKI A;  1D0Y A;  4ZGJ B;  1ABO A;  1JEG A;  1YN8 A;  3DKM A;  3SWN C;  3E2U A;  3JCM e;  1VYV A;  3R6N A;  1Y71 A;  4F7U F;  1G3W A;  3CCV Q;  1GBQ A;  2RQT A;  4MZM A;  1J3T A;  2LQN A;  2CS7 A;  4J6X A;  4RCC A;  2ZPH B;  5GAO m;  1Q7Y R;  5J26 A;  1RI0 A;  4C8Q F;  1IRX A;  1BKB A;  1WXT A;  1K9M C;  1CKB A;  2KBT A;  3CEY A;  3HHT B;  2A7Y A;  4XTU A;  5CR2 A;  2CT4 A;  2HL3 A;  3JB9 H;  2YRD A;  1D1B A;  2NUT B;  2XMF A;  4FSX A;  5GMK m;  2J05 A;  3LW5 E;  2ZPE B;  1PC0 A;  2RK1 A;  1WDX A;  2XID A;  1MMA A;  5GAN j;  9ATC B;  1G3S A;  2DXB A;  2E1H A;  1R0B G;  4M75 B;  4OMQ A;  3CCR Q;  1WGS A;  2DXU A;  1QQJ A;  3LLR A;  3QXE B;  1Q82 R;  1W6X A;  1Y96 A;  2FHD A;  3OYM A;  2MAM A;  1IHV A;  1VQN Q;  4FSS A;  6AT1 B;  1I8F A;  2ABL A;  1KG1 A;  1YIT Q;  3UT1 A;  3CCQ A;  3M0U A;  3V7R A;  1ZSZ B;  1N27 A;  4F7U E;  4ELZ C;  3TRE A;  4BI8 B;  2RA2 A;  1D1A A;  5KH6 A;  3I55 Q;  4M7A G;  2COY A;  1XNI A;  1C6V X;  2DM1 A;  4BE0 A;  2DD5 A;  3QKJ A;  3EGX A;  4C8Q E;  4DA4 A;  2CP0 A;  2O88 A;  4F7U B;  2QQA A;  4Y92 A;  2LC4 A;  5IXB A;  3NTH A;  4XTY A;  2OTL A;  3L2Q A;  4LE9 A;  1TOV A;  1TTH B;  4M7D F;  5A2Q E;  4ZN1 A;  1M2O A;  4DOW A;  2F2W A;  5CVI A;  4C8Q B;  2HKQ B;  1QVG A;  3OSV A;  2VAS A;  1JRI A;  2RQU A;  2XU8 A;  2KDS A;  1WXU A;  2AIR B;  1BCO A;  2XD0 A;  1KQS P;  3P8D A;  3SWN A;  5GAN h;  3CME A;  5LJ5 g;  3CCQ T;  4N0A C;  3JCM b;  2KVQ G;  4RTV A;  1WIE A;  4FIB A;  2H8H A;  1NJI R;  1YJW A;  3CC2 A;  4JS4 A;  4OMM A;  2DIL A;  1RLQ C;  1YCS B;  4AFS C;  1WI7 A;  4FYY B;  2AHJ B;  4MZP A;  4RG8 A;  5LJ3 h;  5CQY A;  1YBY A;  2EYZ A;  5GAM g;  4OF1 A;  1WYX A;  1YFN A;  1ZA2 B;  1G5V A;  4ZN3 A;  2BKD N;  2OTL T;  2NUZ A;  2HEQ A;  2AZS A;  2EJF A;  2P0K A;  1M2V A;  1S72 Q;  2HD0 A;  3JCM Q;  2Y4X A;  3HP9 A;  3E19 A;  1SHF A;  3QDR B;  1WQ7 A;  4M7D E;  2GNC A;  5LJ3 d;  2CP6 A;  5GAO n;  3M9Q A;  2ENM A;  2LDM A;  4DBH A;  3LWH A;  1DJ7 B;  3CME T;  4FM4 B;  3EFO B;  4MDW A;  5CKF A;  1WXB A;  1VQK Q;  1UJ0 A;  5KYW B;  2JTE A;  3QJY A;  3HFN A;  4R0K A;  4M7D B;  3CC2 T;  1VQ7 Q;  2PUK B;  1VOM A;  4D6W A;  2RF0 A;  1UUE A;  3V8L A;  3CCM T;  1X75 C;  2R57 A;  1JJ2 A;  5GAO q;  1AWO A;  1GBR A;  1AHJ B;  3RES A;  2DEQ A;  4GBQ A;  1UHF A;  1U8R A;  1H3H A;  8ATC B;  1UGQ B;  3JCM W;  2C06 A;  1OPL A;  3CXC P;  2H3J A;  3M55 A;  2VXF A;  3OW2 A;  2E64 A;  2SRC A;  1KC8 U;  1I0C A;  2DJZ A;  3O8V A;  3JSC A;  2RD1 A;  4E7H A;  1IO6 A;  2RJD A;  4KUI A;  4FT2 A;  2EKO A;  1H64 1;  3H0F A;  4JDS A;  1B07 A;  1QVF S;  3I5R A;  2FO0 A;  4XTX A;  3A8M B;  1O75 A;  3VYH B;  4HVV A;  1YWP A;  4LXC A;  1G83 A;  3H0H A;  3U23 A;  2HAX A;  1I5O B;  2J7I A;  3G4S Q;  1VQ6 T;  3VS2 A;  4N0A A;  3RR6 A;  1UGP B;  2X3W D;  1YI2 A;  1QVG S;  3M0T A;  1BK2 A;  3QJ6 A;  3A8H B;  1LCK A;  2YUO A;  3SDZ A;  3UA7 A;  4RTZ A;  4C92 F;  5LJ5 f;  2K3B A;  3N5B B;  3CC7 A;  5AT1 B;  2QQ9 A;  3CCU Q;  1B34 B;  4BDY A;  2E5K A;  3OA6 A;  1KQ2 A;  1ZBX A;  2Y4Y A;  1TUG B;  2SEM A;  4OB3 B;  1TSF A;  3KXT A;  3S3M A;  3AHU A;  1K8A U;  3CCJ A;  3NPF A;  3EG9 B;  2VXE A;  4E2F B;  3HL8 A;  1V29 B;  1ZA1 B;  3JCM P;  1NEB A;  3ME9 A;  5GAN 2;  1ZBJ A;  1U1S A;  3CPW S;  2DRK A;  1M4Z A;  2QEX Q;  2O9S A;  2ED0 A; 
#chains in the Genus database with same CATH homology
 2LX7 A;  2JW4 A;  2JXB A;  5GJV B;  1M3C A;  3VRY A;  1HSQ A;  1B3Q A;  1H92 A;  1HJD A;  1TG0 A;  1TUD A;  3JV3 A;  1K9A A;  2V1R A;  2PTK A;  1SPK A;  3EHQ A;  3REA B;  2KEA A;  4ZNX A;  2DBM A;  2K6D A;  1K76 A;  2DMO A;  2DL5 A;  1M3B A;  2AKL A;  2D8H A;  5IHI A;  1A0N B;  1UG1 A;  3SEM A;  4LUD A;  2YUP A;  2AK5 A;  2O2O A;  2K7A A;  1JU5 C;  4HVU A;  2D8J A;  4GLM A;  2LJ3 A;  1I07 A;  1QWF A;  2BZ8 A;  4ORZ A;  1JXM A;  1PNJ A;  3VS1 A;  3RBB B;  2M51 A;  3M0R A;  1PWT A;  3C0C A;  2VWF A;  3CQT A;  4RTY A;  2L3S A;  3TSW A;  1OEB A;  2OAW A;  4DEX A;  1ABQ A;  3EG3 A;  1I1J A;  2I0N A;  1OOT A;  1ZUU A;  1S1N A;  1QKX A;  3UF4 A;  4LUE A;  2RN8 A;  1WX6 A;  1MV3 A;  3GBQ A;  4KRT A;  1E7O A;  2A08 A;  2O9V A;  2FPF A;  2AZV A;  3RNJ A;  4JZ3 A;  2CT3 A;  3I9Q A;  1SEM A;  2GQI A;  2KYM A;  5IXF A;  1M30 A;  1G2B A;  2KRO A;  1AWW A;  2EKH A;  1M8M A;  4AG1 C;  2YUQ A;  3IQL A;  1X2K A;  2FPD A;  2K79 A;  4AG2 C;  2CH4 A;  3TSZ A;  4JZ4 A;  2MOX A;  1UGV A;  4HXJ A;  2JM9 A;  4IIM A;  1VYU A;  1UTI A;  2EVR A;  1N5Z A;  2F2V A;  2JS2 A;  5FWB A;  1NM7 A;  4WCI A;  4RTU A;  2PNI A;  1X6B A;  3NMZ C;  5GJW B;  2EQI A;  3H0I A;  5HCK A;  4OMN A;  2ESW A;  2LCS A;  1VA7 A;  2KRN A;  1OV3 A;  2FPE A;  1WA7 A;  1X6G A;  3LH5 A;  1JXO A;  1YNZ A;  1Z9Q A;  2CUD A;  2L0A A;  2FG0 A;  3O5Z A;  4D8D A;  2KE9 A;  4Z8A A;  1SRM A;  1NYG A;  3ZL7 C;  1SSH A;  2LMJ A;  1ABO A;  1JEG A;  1YN8 A;  2KNB B;  4RTX A;  5IHN A;  3QWY A;  2KT1 A;  2A37 A;  1JQQ A;  1QKW A;  1VYV A;  3R6N A;  1AD5 A;  1RLP C;  4LN2 A;  1QCF A;  2EBP A;  1GBQ A;  3VS3 A;  2RQT A;  1K0S A;  1J3T A;  2KRS A;  2CSQ A;  2LQN A;  2OJ2 A;  5FWC A;  2JS0 A;  4J9I A;  4Z88 A;  1NLO C;  2BZY A;  4D8K A;  2DJQ A;  1AVZ C;  1K4U S;  1WXT A;  1CKB A;  2KBT A;  4J9E A;  2DE0 X;  4HVW A;  2CT4 A;  1PRL C;  1MUZ A;  1GFC A;  1JO8 A;  2XMF A;  2DLP A;  1QWE A;  2J05 A;  2MCN A;  3EG1 A;  1GCP A;  1YP5 A;  3I35 A;  1WDX A;  4IIO A;  2HSP A;  2BZX A;  1FMK A;  1VYT A;  1ZUK A;  2ECZ A;  2C0I A;  2HDA A;  2LNH B;  4AFZ C;  4OMQ A;  2DRM A;  2CUB A;  1E6G A;  1W6X A;  1AOJ A;  3PE0 A;  4A63 B;  1OPK A;  3FJ5 A;  3QWX X;  4FSS A;  2ABL A;  4JJC A;  2D1X A;  1PKT A;  1FYN A;  3M0U A;  4X1V A;  1W70 A;  2EGC A;  2L3Q A;  4LNP A;  2KYB A;  2RQV A;  2DM1 A;  2VKN A;  2CDT A;  2K2M A;  2K9G A;  1ZX6 A;  2RNA A;  4RTT A;  5EC7 A;  2O88 A;  2EPD A;  2DVJ A;  4Y92 A;  2LJ0 A;  5IXB A;  4J9C A;  2DL8 A;  2DL7 A;  4E6R A;  1UJY A;  4LE9 A;  1GCQ C;  3VS7 A;  1UHC A;  4Z89 A;  2F2W A;  5IH2 A;  2JM8 A;  2YSQ A;  2HBW A;  2B86 A;  1CSK A;  1M27 C;  4CC7 A;  2DNU A;  2RQU A;  1UFF A;  2W10 A;  1WXU A;  1ZLM A;  1UDL A;  3UA6 A;  2W0Z A;  2C0T A;  1X43 A;  4ESR A;  1K1Z A;  1Y0M A;  1NG2 A;  4JJD A;  3SHW A;  4RTV A;  1WIE A;  2H8H A;  2O31 A;  2EW3 A;  2EGE A;  2RMO A;  2J06 A;  5I11 A;  1PHT A;  2LP5 A;  4OMM A;  2HCK A;  2DIL A;  5IHK A;  2KR3 A;  2G6F X;  1T0H A;  4JPB W;  1RLQ C;  1T0J A;  2L3P A;  1W1F A;  2RPN A;  2X3X D;  1K0X A;  1YCS B;  3VS0 A;  4AFS C;  1H8K A;  2F2X A;  1WI7 A;  2KGT A;  1KIK A;  2GGR A;  1NYF A;  4DEY A;  1RI9 A;  1AWJ A;  1PRM C;  3VRZ A;  2ROL A;  2EYZ A;  1TUC A;  1UE9 A;  2P4R A;  4QT7 A;  1WYX A;  1BBZ A;  1T3L A;  2NUZ A;  1X2Q A;  2HEQ A;  2AZS A;  1KJW A;  2M0Y A;  1XOV A;  1BB9 A;  3EGU A;  3A98 A;  4CC2 A;  1SHF A;  4J9D A;  2RQW A;  2GNC A;  3EHR A;  1WLP B;  2LJ1 A;  3M0P A;  2DA9 A;  2ENM A;  4F16 A;  3PVL A;  1EFN A;  2J6O A;  3PVQ A;  4J9F A;  1AZG B;  2GTO A;  2V1Q A;  2EYY A;  1RUW A;  1WXB A;  1U5S A;  4K11 A;  1Y57 A;  1GL5 A;  3H41 A;  1UJ0 A;  1ZSG A;  1UEC A;  2JTE A;  1X27 A;  2A28 A;  2LQW A;  4AFQ C;  4R0K A;  1WFW A;  2YUN A;  3M0Q A;  4RTW A;  2ED1 A;  1SHG A;  4RUG A;  2RF0 A;  1UUE A;  2J6F A;  4EIK A;  2EYX A;  2PZ1 A;  4OMP A;  2CH4 W;  1AWO A;  1GBR A;  2DBK A;  2NWM A;  2KXC A;  1AWX A;  4GBQ A;  4JJB A;  4HCK A;  1GRI A;  1UHF A;  1H3H A;  4J9H A;  4M4Z A;  1NEG A;  2IIM A;  1OPL A;  2AKK A;  3NHN A;  1M3A A;  1CKA A;  4J9G A;  2JT4 A;  1HD3 A;  2DYB A;  4AFU C;  5ECA A;  1NLP C;  1AEY A;  2SRC A;  1AZE A;  3VS6 A;  2KXD A;  4OMO A;  3REB B;  1I0C A;  1GCQ A;  2YT6 A;  1BU1 A;  3VS5 A;  5FW9 A;  1IO6 A;  2RQR A;  2CRE A;  1T3S A;  2A36 A;  1SRL A;  3VS4 A;  2JMC A;  3H0F A;  3UAT A;  1B07 A;  3I5R A;  1ARK A;  2FO0 A;  2LZ6 B;  1GFD A;  4HVV A;  2VVK A;  2DF6 A;  1YWP A;  4J9B A;  4F17 A;  1G83 A;  2DX1 A;  3H0H A;  3U23 A;  2J7I A;  1U3O A;  2ROT A;  2MIO A;  2L2P A;  3VS2 A;  3I5S A;  4CC3 A;  5L23 A;  2BTT A;  1V1C A;  2X3W D;  3NGP A;  1KFZ A;  3M0T A;  2GTJ A;  1BK2 A;  2CSI A;  3ULR B;  4CC4 B;  2FRY A;  1X69 A;  2C0O A;  2EGA A;  1U06 A;  1LCK A;  2J6K A;  2FEI A;  2YUO A;  3UA7 A;  4RTZ A;  2K3B A;  1PKS A;  2DL3 A;  3M0S A;  2KRM A;  2QDL A;  2D0N A;  2E5K A;  1ZUY A;  2JMA A;  2SEM A;  2KT8 A;  2FRW A;  1Z9Z A;  2EYW A;  3NPF A;  3EG0 A;  1E6H A;  4OML A;  3THK A;  4F14 A;  1QLY A;  1MV0 B;  1YWO A;  2OI3 A;  3TVT A;  2DL4 A;  2GBQ A;  3KFV A;  1NEB A;  3EG2 A;  1ZBJ A;  1KSW A;  2YDL A;  5I22 A;  2DRK A;  2O9S A;  2ED0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...