2J7IA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterodimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j7iA00
5FWBA 2A08A 2CUBA 2K79A 2AK5A 1YP5A 2RPNA 3SEMA 2LJ3A 1SSHA 2KT1A 3VS7A 2C0OA 1A0NB 1HJDA 1E6GA 5HCKA 1WDXA 1X2KA 1ZBJA 1TUCA 4WCIA 2O31A 1OPKA 4CC3A 4RTWA 4CC2A 5I22A 4HVUA 2VKNA 3M0RA 4RUGA 3H0FA 2JS0A 1VYVA 2K6DA 4OMMA 1KFZA 2GQIA 1X69A 2OJ2A 2GGRA 3I5RA 1E6HA 2DBMA 3H0IA 2JMCA 2KRSA 2K7AA 3NPFA 2JM9A 1AOJA 2MOXA 2ED1A 3PVLA 1QKXA 2EYXA 1YCSB 1K76A 1G83A 2W10A 1SPKA 1YWPA 5IHNA 2JTEA 2CSQA 2SRCA 4Z88A 1M3AA 1NLOC 1UFFA 1RLPC 3QWYA 1AVZC 1CKAA 2IIMA 1W70A 2RN8A 2EQIA 5GJWB 3ULRB 1M3BA 2KE9A 1N5ZA 4ORZA 2KEAA 2HCKA 2DMOA 4IIOA 1HD3A 1WI7A 1SHFA 2ROTA 1AWJA 2DLPA 1GFDA 2O9SA 2J6FA 4AG1C 3TSWA 1OEBA 4AFUC 3M0SA 2YDLA 4ZNXA 4JZ3A 1OPLA 3TVTA 1GL5A 3TSZA 1T3SA 2CDTA 2YT6A 1NEGA 2DL5A 2GNCA 1Z9ZA 2J6OA 1BB9A 1GCPA 2DBKA 3VS5A 1WYXA 1ABQA 2J7IA 4HXJA 2KGTA 2D0NA 4AFQC 2DILA 1RUWA 2RQTA 1UE9A 1AWWA 3EGUA 1WXUA 1FYNA 4AG2C 1K4US 1GCQC 2HSPA 1SRMA 1I1JA 1TG0A 1ZLMA 2EKHA 2KXDA 3VS6A 4J9EA 2G6FX 5IH2A 1U3OA 2J05A 2D8HA 1WLPB 2A37A 3KFVA 3UATA 1EFNA 1RLQC 2LQNA 1VYUA 1JO8A 3VS0A 1E7OA 2JMAA 1MUZA 2EPDA 1AWXA 1UJ0A 4M4ZA 1WA7A 4OMQA 2K9GA 2NUZA 1CKBA 1B3QA 1X43A 2F2XA 1HSQA 4RTZA 1K1ZA 4HCKA 1Y57A 1PRLC 2MCNA 1ZX6A 1K0SA 1SEMA 2F2VA 4GLMA 1LCKA 2FPDA 2H8HA 4GBQA 4OMLA 1MV0B 1TUDA 1OOTA 2LMJA 3PE0A 4J9CA 4JZ4A 2DL3A 4X1VA 1BBZA 2JT4A 1VA7A 2KROA 3O5ZA 1GFCA 2RNAA 2FPEA 4JJCA 2LZ6B 2DRKA 3VS1A 4J9GA 1M8MA 4CC7A 3REAB 2XMFA 2J06A 1AEYA 2NWMA 1H92A 2YUQA 2ESWA 1BK2A 2KYBA 2LP5A 2ED0A 2EBPA 4Z89A 1GBQA 3UF4A 5L23A 2OI3A 4OMOA 1XOVA 2MIOA 4RTTA 2EGCA 1UUEA 2B86A 1WXTA 1X6GA 3I9QA 2RQVA 2SEMA 1UGVA 2L3PA 1YNZA 3REBB 1MV3A 2PNIA 1VYTA 2D8JA 2M0YA 4A63B 1K0XA 1H8KA 4HVWA 2KRMA 3PVQA 3EG1A 3SHWA 2DX1A 1X27A 1ZUUA 4AFSC 2L3QA 2QDLA 2AZSA 4F14A 4LUEA 2JW4A 5IHIA 4D8DA 2A28A 3H0HA 2JXBA 1IO6A 3RBBB 2AKLA 2EYYA 2PTKA 4Z8AA 2KNBB 4OMPA 1NYFA 3CQTA 5I11A 1NEBA 1PKTA 1J3TA 2O9VA 2LCSA 2X3XD 1G2BA 2HBWA 1M27C 1UTIA 1SRLA 3R6NA 1T3LA 1JQQA 4OMNA 2RQUA 4QT7A 3ZL7C 1U5SA 3EG3A 5ECAA 2J6KA 1AD5A 1I07A 4LE9A 4J9DA 2L0AA 2P4RA 2W0ZA 1QWFA 2EGEA 5FW9A 2YUOA 1GRIA 1KIKA 2DYBA 1QKWA 1T0JA 1JXMA 2DE0X 4RTYA 3UA7A 2DL8A 1NG2A 1PWTA 2M51A 2LJ0A 3FJ5A 1ARKA 3THKA 2O88A 2KXCA 2DJQA 4KRTA 2BTTA 1W1FA 2K2MA 1NM7A 3LH5A 3M0PA 3VS3A 2LNHB 3UA6A 1KSWA 2RQRA 3NGPA 3H41A 2EW3A 1X2QA 4D8KA 2V1RA 1WXBA 2CT4A 2KRNA 2FO0A 2JM8A 4FSSA 1W6XA 2C0IA 2DA9A 2CT3A 1M30A 1FMKA 1H3HA 2LX7A 4AFZC 4LNPA 2ROLA 2OAWA 1U06A 1NLPC 2K3BA 1QWEA 2HEQA 3M0UA 2FPFA 3QWXX 2VWFA 4EIKA 3A98A 4Y92A 2RF0A 4RTVA 2DRMA 1PNJA 5IHKA 1KJWA 2JS2A 2YUNA 1BU1A 2D1XA 3NMZC 2CUDA 1M3CA 2HDAA 2AKKA 4DEXA 2V1QA 1UG1A 2DM1A 1ABOA 3EHQA 2AZVA 4J9BA 1Y0MA 1ZUKA 4HVVA 2ECZA 2GTJA 1SHGA 4E6RA 2KR3A 1YN8A 2BZ8A 1UDLA 3C0CA 1QCFA 4IIMA 3VRYA 2DVJA 1GCQA 2KT8A 5IXFA 3M0TA 4J9HA 2CH4W 2YUPA 2LQWA 2I0NA 4ESRA 1UJYA 3RNJA 2ENMA 1CSKA 2KYMA 4F16A 2BZXA 1RI9A 2DNUA 4J9FA 1I0CA 2KBTA 4JJBA 2DL4A 2E5KA 1UECA 4RTUA 1YWOA 1ZUYA 3VS4A 3EG0A 3I35A 2ABLA 2EYZA 4RTXA 3IQLA 2EVRA 1OV3A 2GBQA 2YSQA 4LUDA 4R0KA 5IXBA 1X6BA 2C0TA 1WFWA 1WIEA 1PHTA 1PRMC 2CH4A 5EC7A 3M0QA 4DEYA 4LN2A 2FRYA 1AZEA 2DL7A 2DF6A 3NHNA 1UHFA 2VVKA 1JU5C 2X3WD 2L3SA 3GBQA 3EG2A 4F17A 1V1CA 2FRWA 1B07A 1PKSA 4J9IA 1AWOA 1QLYA 1WX6A 1AZGB 2GTOA 1T0HA 4CC4B 3VS2A 3U23A 1S1NA 1K9AA 2FG0A 2F2WA 2RQWA 2EGAA 1JXOA 4K11A 3VRZA 2RMOA 2CSIA 2O2OA 2EYWA 5FWCA 4JJDA 2PZ1A 5GJVB 2BZYA 2CREA 1GBRA 2LJ1A 3EHRA 1NYGA 1UHCA 1JEGA 4JPBW 3I5SA 1ZSGA 2FEIA 2A36A 3JV3A 2L2PA 1Z9QA
chains in the Genus database with same CATH superfamily
3PMIA 3G6EQ 1PG5B 1YJWQ 4PLIA 2I2LA 3LH0A 2K2VA 1A0NB 1OX8A 5A0DA 1ZBJA 2RI3A 4WCIA 3CCJQ 3JB9F 2D9TA 4RTWA 5KE2A 2QAZA 5I22A 2VV5A 5GAMh 2CP6A 3E19A 1I5LA 1RAGB 2GQIA 3T9NA 1X69A 3V7RA 2WSCE 2XG8D 3F70A 3OA6A 2ATCB 2EJFA 4PJOB 4C92A 2DTIA 1QVGA 4HT8A 2W10A 3JAME 1RABB 3PTAA 4BDYA 2BUDA 2CP0A 2K5FA 2RJFA 2YRCA 2RN8A 4BY6C 3LGFA 3N5BB 1M3BA 3LWHA 5J26A 1N5ZA 3FC3A 4A4FA 2ZGWA 2P4TA 1WI7A 4MZPA 1SHFA 3SB2A 1AWJA 4FT4A 4PKCC 3X24B 2J6FA 4AG1C 1OEBA 5GANe 5GMKh 4GY5A 4JZ3A 3OW2P 1GL5A 3X25B 1LNXA 2JUFA 4IUVA 3O8VA 2J6OA 1GCPA 1NBEB 2GFUA 3CCUQ 2DBKA 2V8IA 2DVEA 2J7IA 3HKSA 3HPWA 3JRZA 1WQWA 2ZPIB 3SWNC 1WHJA 2QK0A 3PGGA 4M78D 2QA4Q 1BI3A 2HQEA 4F7UF 1QP2A 2EKHA 3JB9J 3VS6A 2KI7A 4J9EA 2G6FX 5CKBA 2J05A 2D8HA 2A37A 1NE8A 3UATA 1EFNA 3C4SA 4PNOA 3OW2S 1VQ9A 3MPUB 1M1KR 4LDWA 1BCMA 2PVOB 1BKBA 5LJ3g 4P5NA 5FRMA 2BIVA 3RKXA 5D7UA 2XI9A 2M0OA 2CGHA 3A8LB 3CCQQ 1K0SA 1SEMA 2F2VA 4GLMA 4KUIA 3LX7A 1BYMA 3LGLA 1KC8R 3ZEHA 4A54A 2YXYA 1TUDA 2MMPA 1OOTA 1QVGP 1VQOQ 3MEUA 3OS5A 1UB4A 2DL3A 5CCAA 2MF2A 1WZOA 1D0ZA 1M5Q1 2H3EB 4KULA 2RM4A 1DJ7B 4X34A 3REAB 4UC4A 2DIGA 2QDYB 2AIRB 2EQUA 4C8QF 2M9UA 2DJZA 4ANJA 1YJNT 2EKOA 4Z89A 1PM3A 1WJQA 5GAMe 3UF4A 1VIEA 2OI3A 3QYHB 3JCMP 5CKEA 1VQ8T 2E3HA 2CP7A 4DBFA 3L2WA 3S6WA 4ZTJA 2JTMA 1OULA 2SEMA 4QVZA 1UGVA 3CMAA 1VQNQ 3HFOA 2M0YA 3CCLT 4RG2A 3I55A 4A63B 4M75D 1K0XA 3MP1A 4XTZA 4O5VA 1VQLT 1YJNA 4C0ZA 1M90C 5LJ3d 1YHQQ 2LQKA 2P0QA 3DB4A 3CC2A 2E4HA 4M77F 4MDWA 2JXBA 4EPCA 4NS5A 3A8HB 3BE3A 3EG9A 1Y07A 4OMPA 1PKTA 3CBMA 1QMCA 3CCEA 3EFOB 2DTHA 1N8RC 1VQ8A 4M7DF 1V29B 1G2BA 5CVIA 2HBWA 4M7AB 2JOYA 3L2UA 1SRLA 2YLCA 3M4GA 4C8QA 4OMNA 4C8QD 2RQUA 2AHJB 3EG3A 1AD5A 3G4SA 1RAHB 4QKUA 4JS5A 2GFAA 1N27A 1QKWA 3OYFA 3FLGA 2AT1B 4C92E 2Y90A 2GF7A 4PJOD 3UA7A 4LDXA 1PWTA 4KBMB 4HCZA 4WF2A 3I56T 1VUBA 2V8KA 3FJ5A 5GANg 2O88A 3HL8A 4F7UA 1VQMA 2VUBA 3OSVA 1B34A 1W1FA 3LH5A 2K3XA 5EG2A 1Q81R 3UA6A 1YIJT 2ZCFB 2NUPA 2EW3A 1VQ4T 4D8KA 5LJ5f 1M9SA 1QVPA 4Y91A 4PJOC 1ZBXA 2KRNA 4ZN3A 1XJWB 2BE9B 4M7AC 1IGUA 2R57A 4C5HA 1W6XA 2C0IA 4XTXA 2RK1A 1ZSZC 3QDRB 1FMVA 1FMKA 1QP3A 1M1FA 2X4YA 3RMQA 1TS9A 2ROLA 1NLPC 2ZPHB 2E10A 2K3BA 3G71Q 1WGSA 4JS4A 2FPFA 2E6ZA 3PT9A 5GAN5 4C0FA 5CR2A 2HKQB 1G3SA 3A98A 1YIJQ 3G71A 1VQNT 2XDPA 4E7KA 2R5MA 1G8XA 2DRMA 1KJWA 1MMGA 2LDMA 2JS2A 2YUNA 2HNIA 4M7DA 1M3CA 2AKKA 4DEXA 3J81E 1UG1A 1V76A 1OU8A 3CCVQ 3CC7Q 2EWNA 2HZYA 4E47A 4J9BA 3QHSA 1UGQB 3M5AA 4BB7A 2MWPA 3MEWA 5GAN8 4L59A 1Y71A 3GNFB 4ELZC 4M7AF 2BZ8A 1UDLA 3C0CA 3GNGA 3RUXA 1GCQA 4J9HA 1YCYA 4FW2A 1NZ9A 5KYWB 1X75C 3BY7A 2QEXA 3OYEA 2BZXA 1RI9A 4J9FA 1KQ1A 2QQSA 3NTHA 3MJXA 1MNEA 2L8DA 3VS4A 5CK9A 5LJ5j 2A0FB 5CQYA 1NPRA 5IXBA 1YJ9Q 5GAN3 3HTRA 5IN1A 1PRMC 1VQ8Q 3CC4A 1B34B 4M77G 1Q82R 1KQSA 1AZEA 2VC8A 5CKHA 3NHNA 3CXCA 1BI1A 3SD4A 4ELYC 3MP8A 2K5IA 2L3SA 4F17A 4J6WA 1AWOA 1HXDA 3INZA 1QLYA 3GLXA 1JJ2S 4N0AA 2YRVA 1Q7YR 3META 4M7DC 2FG0A 2F2WA 5I2MA 2IVWA 2RQWA 3V8JA 1JXOA 4K11A 3CCRA 4E7SA 3RIRA 2MPXC 2EYWA 3CMEQ 5GMKl 3FJPA 1PC0A 1U1TA 5GMKi 4BACA 1NYGA 1UHCA 3QZ9B 3X28B 3VJPA 1ZSGA 3V8LA 2FEIA 2A36A 3OYDA 3JV3A 2L2PA 1Z9QA 2CUBA 5I21A 3CC7A 1YP5A 2LJ3A 2DERA 1SSHA 2A7YA 2KT1A 5HK3A 4OB1B 4DBQA 4E7IA 3TU4K 3I55T 2X4XA 5AT1B 1HJDA 3NTIA 1KQ2A 1WDXA 1OPKA 3M54A 4CC3A 3OY9A 4E2FB 3JCMW 2DKGA 4CC2A 1XQHA 4RUGA 2JS0A 4C92B 2K6DA 3Q1JA 2L5QA 4OF1A 1YIJA 3H0IA 3JCMg 2KRSA 3NPFA 4PLLA 4ZGJB 3JCMJ 1AOJA 2MOXA 8ATCB 5GAOm 3L2ZA 1Q7YU 1G83A 1WHKA 1YWPA 3HRUA 5IHNA 2WACA 2CSQA 1VQKA 9ATCB 1UFFA 2FZGB 3QWYA 4LXCA 1VQ4Q 2EQIA 3ULRB 3M58A 2XU8A 4M77B 4ORZA 2HCKA 2OAUA 4IIOA 1MMDA 3JB9I 4TVRA 2ROTA 1VQ9Q 3MKDA 1OZ3A 4EMKC 3TSWA 4AFUC 1PCXA 1IZ6A 3A8OB 2DETA 3C12A 5L8RE 4NL3A 3E9FA 2CDTA 2YT6A 2DL5A 1R8OB 1Z9ZA 1BB9A 1YJ9T 4OGCA 3EH1A 3VS5A 3EFOA 3OYYA 1ABQA 4X9CA 2QA4A 2DFUA 8AT1B 5GAOn 4AMCA 2DILA 1RUWA 1UE9A 2XIDA 1AWWA 3MEVA 2CZ0B 3EGUA 4VUBA 1SRMA 1FX7A 1ZLMA 2NYSA 1JRIA 4HT9A 4Z02A 4YTLA 4QQ6A 2KVQG 4J8OA 2DPPB 5FRNA 2E12A 2X51A 2HSEB 7AT1B 2EPDA 1UJ0A 4M4ZA 3CD6Q 4C92C 4OMQA 1CKBA 1B3QA 1D1BA 1HYOA 1UGSB 3I56A 1HSQA 4RG8A 1PRLC 1VOMA 2MCNA 2E64A 1HK9A 3G6ET 4BI8B 4C92D 1LCKA 3ASKA 2H8HA 1MMNA 4OMLA 4N4HA 1R0CB 3HSBA 2BKDN 1D1CA 4X1VA 4PFZA 3OW2A 4J7FA 2G3RA 1ACMB 4CRIA 4JRIA 4LDYA 1WHLA 2EIFA 2RHYA 2HAXA 2BE7D 1GFCA 2RNAA 1S72T 4M75E 4JJCA 1TXQA 1WJRA 2DRKA 1M1KC 2XICA 4RCCA 3CC4T 1H92A 3SDZA 2ESWA 2ZPGB 1K73C 1G3TA 2ED0A 2HQHA 4PJNA 3OMGA 2CP2A 5L23A 5J39A 3ME9A 4ZGDB 1VQ5Q 3QJ6A 2MIOA 1JB0E 5LJ5g 2EGCA 4DA4A 2VXEA 1D0YA 4IUUA 3JCMV 2QEXT 4PJOF 5D6WA 1EZZB 2PNIA 3QZ5B 1H8KA 1ZQ1A 4F7UG 3QIIA 4HVWA 5I2SA 2KRMA 3CCRQ 3EG1A 5KYUB 2DX1A 1VQOA 1X27A 1ZUUA 1OX9A 1M1KU 1VQKQ 1D09B 2CZ6B 4F14A 2E6NA 3VUBA 2JW4A 4EMHA 3OYJA 2PVGB 3NTKA 3CMET 2A28A 3H0HA 1IXDA 2AKLA 2EYYA 1K8AR 3I56Q 2KNBB 3M9QA 4B9WA 2FYKA 4PJMA 2LCSA 2X3XD 3MCAB 5LJ5d 1M27C 2E5QA 2F69A 1UTIA 1YJWT 2MK5A 4J6XA 4XU3A 4QT7A 2QG9B 3ZL7C 3QYGB 5DM7R 4LE9A 5J3BA 2P4RA 4XTWA 2F1LA 1G3YA 1KD1C 5FW9A 3QJYA 1M90R 1TOVA 2YUOA 3CCJT 1KIKA 2QQBA 2DL8A 2KSSA 2PQWA 1NG2A 3H8ZA 3JB9H 4M75C 3CXCS 2K3YA 4XU0A 4QW2A 3OBYA 1ZA1B 1ARKA 3THKA 1XNIA 2KXCA 4KH1B 1VQPQ 4KRTA 4MMLA 2L3RA 2CP5A 2BTTA 5GAOl 3G7ZA 4BI4A 1W2BP 3VS3A 1VQMT 2LNHB 2EQMA 2CS7A 5D6XA 3OYNA 3CCVA 1X2QA 3FB9A 4QQGA 1K73R 4A4HA 2V1RA 5GAMj 2LC4A 2HL5C 3TCJA 2PU9B 1WHHA 1I8FA 2DD5A 4FSSA 4J6YA 1JJ2A 2O01E 1M30A 3GIBA 1BCOA 4LNPA 1TU0B 1RI0A 4C8QC 4C5IA 4FSXA 1NJIR 4F04B 2HEQA 3M0UA 2LCCA 4C0DB 4JRPA 5LL6S 2R58A 4Y92A 1WHMA 1N9RA 3HRTA 1PSEA 4MMKA 3WVDB 3GOXA 4WTOB 3OYMA 3BDLA 3MO8A 1K8AC 2RB6A 2D1XA 5GMKj 1OU9A 2OTLA 2XHCA 2DM1A 3M57A 1ABOA 3ZFJA 1EIFA 3G6EA 3OYKA 3CBOA 2LNVA 1LJOA 2MWOA 1IHVA 2KR3A 1P92A 4C8QB 3DKMA 1NJIC 1QVFP 2I0NA 4ESRA 2E65A 1UJYA 3OYIA 4ATOA 4RCBA 1VQ7Q 2KYMA 2DNUA 3L1AA 2DL4A 3RDVA 4M77A 1UECA 4RTUA 3CCST 1QCNA 1ZUYA 3EG0A 5KYUA 2KQWA 2LCLA 3IQLA 2EVRA 1OV3A 2GQVA 2YSQA 5GAN4 3KXTA 2RH2A 1RAIB 1VQ5T 1QCOA 4C8QG 4BUGA 3M0QA 5KYYA 4DEYA 1M2VB 4HCBA 3EG9B 1YJ9A 3ER0A 2DF6A 4PFOA 1UHFA 2QA4T 4J9IA 2FHDA 1AZGB 2GTOA 2M16A 1VQKT 3VS2A 1S1NA 1Q82U 1K9AA 2ZPFB 3CCSQ 1YHQA 3EFRA 1OQKA 5LJ5e 4M7DE 2EGAA 5LJ5h 1K9MR 3OYAA 1SF9A 2M02A 3OS0A 4C92G 4MDXA 2EJ9A 2CREA 5FU7C 3H9NA 2LJ1A 4PJLA 3CCMA 2HKNA 4C92F 5LJ3j 2A08A 2K79A 2COZA 2AK5A 2RPNA 3SEMA 2DTOA 1BI0A 3JCMQ 2QQRA 1M90U 3D7SB 2C0OA 4F7UB 4E7LA 1E6GA 4KGZB 4JJNK 1X2KA 4N4IA 4A4EA 1TUCA 2O31A 4BE0A 1Q7YC 2NUPB 3H0FA 1VYVA 2FB7A 3QDFA 3OBWA 1ZHIA 1KC8C 3MEAA 3S3MA 2GGRA 2RA2A 2DXBA 2DBMA 3RR6A 2JMCA 1Y7XA 3CC7T 5KCHA 4FT2A 2K5LA 2ED1A 3PVLA 3X26B 2M1HA 2EYXA 4XTVA 4N0AC 2MAMA 3PFSA 1SPKA 2SRCA 1PSFA 4A53A 1YJNQ 1C0MA 5FU7B 1AVZC 3JCMf 2IIMA 1W70A 4BD3A 5GJWB 3X20B 2KE9A 1QVGS 2CP3A 2KEAA 3CD6T 2DMOA 3DB3A 1BIAA 5A0LA 2IPOB 2O9SA 3CCRT 2VXFA 1NJIU 3OSSC 3M0SA 4ZNXA 1OPLA 3TSZA 4OB2B 5GAOq 4FCYA 1WYXA 4HXJA 3KBGA 2D0NA 3CEYA 4AFQC 2QYZA 3CCQT 1KHCA 3BFMA 3EFSA 1G3WA 3G71T 4M78A 4JUVA 4JLIA 5KYNA 1WXUA 1FYNA 4B9XA 1GCQC 2HSPA 1I1JA 1Q81U 2EAYA 1TG0A 3L2VA 4J5YA 2WSFE 1SG5A 5IH2A 1U3OA 3SWNA 1WLPB 2QTXA 3KFVA 1N9SA 2PUOB 2LTOA 2LQNA 1MNDA 3VS0A 1WQ7A 2JMAA 4M7AG 5C0MA 1MUZA 3SWNB 2QXFA 3QBYA 2RI5A 1AWXA 5CIUA 2RJDA 1RAEB 1RACB 1KD1U 4LD9K 1F1BB 2JZ2A 4KH0B 2K9GA 2NUZA 5GANj 1TWBA 4HA8A 1X43A 5KYXB 4M75F 2LVMA 1K1ZA 3CD6A 3VUZA 3JCMh 2YWWA 4AT1B 2EQKA 3LYIA 2FPDA 5A2QE 1WPYA 4M78G 3CCUT 2FZKB 2RK2A 3TQ7P 2LMJA 3WXMB 4J9CA 1VQPA 4MZTA 1M2OA 4RKUE 2YRDA 4DOVA 3OYGA 1BBZA 2JT4A 4NOYA 1VA7A 2KROA 3O5ZA 4BE1A 2WSEE 1I4K1 2LT1A 3MHXA 2FPEA 1VQNA 1ZSZA 2CZ1B 1M8MA 4CC7A 2XMFA 3J80E 2NWMA 5KCOA 2IG0A 1BK2A 3QO3A 4PFPA 1KHIA 4KT0E 2LP5A 2EBPA 2EFIA 1K8AU 1GBQA 2P84A 3S3NA 2X9HA 1XOVA 1YI2Q 3E9GA 3V7CA 1UUEA 5GANd 1QW1A 2MI6A 3I9QA 2RQVA 1YNZA 4E7ZA 3REBB 3CCEQ 3C95A 1MGQA 1VYTA 2D8JA 1VQ6T 4MZMA 3PVQA 3SHWA 4GLKA 4AFSC 4IURA 4L6V5 3CPWA 2L3QA 2QDLA 3TEEA 2AZSA 1MHNA 5GANh 3E1SA 4LUEA 2DXTA 2DAQA 2PTKA 3S3OA 1NYFA 2OTJA 1NEBA 3LW5E 1J3TA 3CMAQ 2O9VA 3OB9A 4IUPA 3E2UA 4JDSA 3CCET 1H641 4CI0C 4DOWA 4FM4B 4XK8E 1VQ5A 1JQQA 3A5ZB 1U5SA 5ECAA 1I07A 4QQDA 3FIFA 4J9DA 4M7DG 2W0ZA 1VQ7T 1D3BB 4BY6B 2EGEA 5GAN6 4ZGEB 4OVAA 2DYBA 4C5GA 1JXMA 4C0GA 1AT1B 4RTYA 2RI2A 2DD4A 4XTYA 2M51A 5LJ3h 3CMEA 4N4GA 1B7TA 2DJQA 2PVDB 4HCCA 4XTUA 5A0GA 4E7HA 2K2MA 1AHJB 1NM7A 2FVUA 4M77D 4II1A 3NGPA 1R0BG 1WXBA 1N6AA 2CT4A 3HFNA 1H3ZA 2FO0A 2JM8A 3P8DA 4M7AD 1VQ9T 2XKOC 1YFNA 2DA9A 2ZZDA 2CT3A 3CC4Q 5GMKm 2LX7A 5DY9A 1U06A 2KAFA 1IHWA 2XK0A 1TUGB 3V8KA 2XDBA 1PD0A 2YLBA 1UGRB 3URGA 4EIKA 1G5VA 5FU6B 2RF0A 4RTVA 2QEXQ 3BW1A 5GAN2 3L2RA 2A3LA 5IHKA 2P0PA 4FW1A 2EQJA 4DBRA 2HBPA 3NMZC 2RHZA 4R56A 2HDAA 3JCMc 3TREA 1N8RR 3EHQA 1FWZA 2AZVA 3OMCA 3VU3C 3PIPA 4HVVA 3DLMA 2Y4YA 3QUIA 3R6OA 4M77E 1W2BA 1SHGA 4E6RA 2CZ7B 2X35A 4IIMA 2X4WA 1Q86R 6AT1B 5IAYA 5IXFA 5GAMg 2VGMA 2YUPA 1VQ4A 4Y28E 3RNJA 5FU6C 1KQSS 4EMKA 2JTFA 2E5KA 3RKWA 2VB6A 1Y96A 3NFCA 1D0XA 3CCVT 5KH6A 1TH7A 1R77A 2EYZA 1RADB 4R0KA 3UDCA 1X6BA 2C0TA 5AYFA 3JCMd 1YI2T 3RMSA 3PIOA 1D3BA 1PHTA 4O6JA 4IUQA 2CH4A 2RO0A 3V7SA 1JJ2P 2Y4XA 2ZPEB 4LN2A 3CXCP 1MMAA 2FRYA 2OTJQ 2RJEA 1VQ6Q 2LX9A 2VVKA 2DK3A 2K57A 2XD0A 2X3WD 3EG2A 2QGFB 1V1CA 2FRWA 1B07A 2ZAEA 3OYBA 1JBMA 5M9OA 1IREB 2QI2A 4CC4B 3P8BB 3U23A 4DBHA 4M78E 1VQLQ 3JCMX 3L2QA 5KYXA 4XU2A 3VRZA 1KD1R 2RMOA 4FYYB 2CSIA 2O2OA 2VGNA 2NLUA 2DZ9A 2DO3A 4FL6A 5FWCA 1X6OA 4JJDA 1RL2A 3EHRA 1GXIE 2JNGA 2DEQA 4IUTA 1YI2A 2D6FA 1KC8U 5FWBA 4RMOA 1IRXA 3EGXB 4M78C 4KUDK 3VS7A 4OB3B 1IGQA 5GAN7 5HCKA 1S72Q 1M4ZA 3ZBDA 1UEBA 2CYZB 4J83A 3CMAT 1SSFA 1SKUB 2PUKB 4HVUA 2VKNA 3M0RA 3JCMe 3A1PA 4OMMA 1K9MC 4M78F 1KFZA 5HK0A 3I5RA 2OJ2A 1E6HA 3EGDA 2K7AA 2JM9A 4OMFB 2LRQA 1QKXA 4M75G 1WNLA 4X9DA 4B6MA 1YCSB 1K76A 2JTEA 3GP8A 3CCMT 4Z88A 1Q86U 1M3AA 1NLOC 3G4ST 4KGVB 1RLPC 5KYWA 4C5EA 2KDSA 1CKAA 5CQXA 1KG1A 2K4YA 5CKDA 3I55Q 4A4KA 4D6WA 3QSUA 4HKEA 1YHQT 4LD6A 1HD3A 4LDVA 4FIBA 2YHTA 4ZN1A 1O9SA 2DLPA 1GFDA 2X4JA 2RHXA 4PK4A 3QPHA 4DQ2A 2YDLA 4PJOG 1I5OB 3TVTA 2NUTB 1T3SA 1NEGA 2GNCA 2DXCA 5DLQE 3UT1A 3CC2T 2CKKA 3FRNA 1PD1A 3JB9D 2KGTA 5GAOp 4KGXB 1RAFB 1D1AA 2RQTA 1LVKA 3M59A 5FROA 5FLXE 4AG2C 1K4US 2GCXA 4M7DD 2F5KA 2RJCA 1QQJA 3CPWP 3RKYA 2KXDA 4JRKA 4EMGA 5HY6A 4JLGA 3KUFA 4M78B 1M2VA 4QVDA 1RLQC 2DIQA 1Q81C 3HHTB 1VYUA 1JO8A 1BI2A 1E7OA 2P0KA 3CCQA 2HMAA 2QQ9A 1WA7A 3HP9A 1WJSA 5GMKe 3FDRA 2JVVA 4M75A 2F2XA 4RTZA 4HCKA 2F5TX 1Y57A 2MYSA 1ZX6A 1FMWA 3QG1A 2COWA 1M8VA 4GBQA 4M75B 1MV0B 4FYXB 3JCMb 3FEOA 5CKFA 3CBPA 1VQMQ 2E3IA 3PE0A 2V8JA 4ME7A 4JZ4A 4LDUA 4NL2A 1I81A 1LPLA 3UWNA 3OYHA 5C6SA 2OTLT 2QASA 4PJJA 3JSCA 2LQ8A 3QXEB 1RAAB 1YITQ 2LZ6B 3VS1A 4J9GA 2J06A 1AEYA 2YUQA 2EJGA 2KYBA 1OZ2A 4FYVB 4M7AE 1ZSZB 3OS2A 3G4SQ 1C6VX 3VYHB 4OMOA 5LJ3e 4M77C 4RTTA 3C94A 3RERA 1VIFA 2B86A 1W2BS 4BI3A 1WXTA 1X6GA 2DZCA 2L3PA 3PNWC 3EH2A 1MV3A 4PL6A 4L5GA 5IT9E 1YBYA 1C1AA 4XQ3A 2NUTA 5CAIA 3OS1A 4XAXB 3VKIA 1VQOT 4M7DB 3CC2Q 5IHIA 5GAMd 3OYCA 4D8DA 3EGDB 1IO6A 3RBBB 2JN0A 4Z8AA 4PJOA 1Q95G 5I11A 2E70A 1W4SA 2H3JA 2HD0A 4BDZA 2QQAA 4QVCA 3M4YA 2KY9A 3R6NA 1T3LA 1XTDA 1WHGA 3LLRA 4F7UE 2J6KA 5HKCA 2L0AA 1BIBA 1QWFA 3M53A 4FYWB 1GRIA 1NPPA 5KYYB 3M55A 1U1SA 1T0JA 4A4GA 2DE0X 1YITA 3AT1B 2KMTA 1FXXA 2D0QB 3EGXA 2LJ0A 3LWIA 2RD1A 4EDUA 3DLLA 2KK4A 3A8MB 4OGEA 5CO7A 2VASA 1M1GA 4V2SA 4C8QE 2O4XB 4E7JA 4XU1A 1VQLA 2HQXA 1KK7A 3M0PA 2B8AA 1KSWA 2RQRA 1TTHB 1ZA2B 3H41A 3GPLA 3JB9G 2OTLQ 4PJOE 2RHUA 1O75A 3GF5A 3CPWS 1H3HA 1QVFA 4AFZC 3CPFA 4FU6A 3A8GB 2OAWA 5DLOA 3EAEA 1QWEA 3QWXX 2VWFA 2HL3A 3UPUA 2COYA 2QGGA 3PMTA 5LJ3f 2RHIA 1U8RA 3M56A 2EYQA 4BE2A 4J7IA 3OQ5A 2DXUA 1BU1A 2Z0WA 2CUDA 1S72A 4ZTFA 3VV0A 3CCUA 3CCLQ 2V1QA 1K9MU 3HRSA 1OYXA 3P8HA 1Y0MA 1ZUKA 3L42A 2ECZA 2GTJA 3QKJA 3SFMA 2VYTA 2E1HA 3CCMQ 3CCLA 1TSFA 1OI1A 1YN8A 4M7AA 1N8RU 1QCFA 2LT4A 3VRYA 2DVJA 2KT8A 3RESA 3M0TA 4OB0B 2CH4W 2LQWA 1K73U 1QVFS 3G1JA 2ENMA 5GANf 3CCSA 1CSKA 4F16A 3H6ZA 1I0CA 2KBTA 4JJBA 1EX4A 1YWOA 2QTVA 5GAMf 3I35A 4R55A 1X01A 2ABLA 4RTXA 4EMKB 2GBQA 2ZPBB 4LUDA 1VQ6A 1Q82C 1IB8A 2FL7A 1Y96B 1WFWA 1YITT 1WIEA 3BDUA 1KQSP 2DYIA 5EC7A 3CCJA 3OYLA 2FZCB 2DL7A 1Q86C 2JJ9A 1JU5C 3VYGA 3GBQA 4OP0A 1PKSA 1YJWA 2XDDA 2R5AA 5GAOr 3MP6A 2OX7A 1VQPT 1WX6A 2E41A 1UGPB 1T0HA 4Q5WA 5KE3A 1VQ7A 2O4XA 4JRQA 1LOJA 2C06A 5D6YA 2PZ1A 5GJVB 2BZYA 4IKFA 1GBRA 3J7AF 4C0DC 2L89A 1JEGA 4JPBW 3I5SA 3AHUA 2V26A 2OTJT 3WVEB 2DEUA 1PNJA 3CQTA
chains in the Genus database with same CATH topology
5FWBA 2A08A 2CUBA 2K79A 2AK5A 1YP5A 2RPNA 3SEMA 2LJ3A 1SSHA 2KT1A 3VS7A 2C0OA 1A0NB 1HJDA 1E6GA 5HCKA 1WDXA 1X2KA 1ZBJA 1TUCA 4WCIA 2O31A 1OPKA 4CC3A 4RTWA 4CC2A 5I22A 4HVUA 2VKNA 3M0RA 4RUGA 3H0FA 2JS0A 1VYVA 2K6DA 4OMMA 1KFZA 2GQIA 1X69A 2OJ2A 2GGRA 3I5RA 1E6HA 2DBMA 3H0IA 2JMCA 2KRSA 2K7AA 3NPFA 2JM9A 1AOJA 2MOXA 2ED1A 3PVLA 1QKXA 2EYXA 1YCSB 1K76A 1G83A 2W10A 1SPKA 1YWPA 5IHNA 2JTEA 2CSQA 2SRCA 4Z88A 1M3AA 1NLOC 1UFFA 1RLPC 3QWYA 1AVZC 1CKAA 2IIMA 1W70A 2RN8A 2EQIA 5GJWB 3ULRB 1M3BA 2KE9A 1N5ZA 4ORZA 2KEAA 2HCKA 2DMOA 4IIOA 1HD3A 1WI7A 1SHFA 2ROTA 1AWJA 2DLPA 1GFDA 2O9SA 2J6FA 4AG1C 3TSWA 1OEBA 4AFUC 3M0SA 2YDLA 4ZNXA 4JZ3A 1OPLA 3TVTA 1GL5A 3TSZA 1T3SA 2CDTA 2YT6A 1NEGA 2DL5A 2GNCA 1Z9ZA 2J6OA 1BB9A 1GCPA 2DBKA 3VS5A 1WYXA 1ABQA 2J7IA 4HXJA 2KGTA 2D0NA 4AFQC 2DILA 1RUWA 2RQTA 1UE9A 1AWWA 3EGUA 1WXUA 1FYNA 4AG2C 1K4US 1GCQC 2HSPA 1SRMA 1I1JA 1TG0A 1ZLMA 2EKHA 2KXDA 3VS6A 4J9EA 2G6FX 5IH2A 1U3OA 2J05A 2D8HA 1WLPB 2A37A 3KFVA 3UATA 1EFNA 1RLQC 2LQNA 1VYUA 1JO8A 3VS0A 1E7OA 2JMAA 1MUZA 2EPDA 1AWXA 1UJ0A 4M4ZA 1WA7A 4OMQA 2K9GA 2NUZA 1CKBA 1B3QA 1X43A 2F2XA 1HSQA 4RTZA 1K1ZA 4HCKA 1Y57A 1PRLC 2MCNA 1ZX6A 1K0SA 1SEMA 2F2VA 4GLMA 1LCKA 2FPDA 2H8HA 4GBQA 4OMLA 1MV0B 1TUDA 1OOTA 2LMJA 3PE0A 4J9CA 4JZ4A 2DL3A 4X1VA 1BBZA 2JT4A 1VA7A 2KROA 3O5ZA 1GFCA 2RNAA 2FPEA 4JJCA 2LZ6B 2DRKA 3VS1A 4J9GA 1M8MA 4CC7A 3REAB 2XMFA 2J06A 1AEYA 2NWMA 1H92A 2YUQA 2ESWA 1BK2A 2KYBA 2LP5A 2ED0A 2EBPA 4Z89A 1GBQA 3UF4A 5L23A 2OI3A 4OMOA 1XOVA 2MIOA 4RTTA 2EGCA 1UUEA 2B86A 1WXTA 1X6GA 3I9QA 2RQVA 2SEMA 1UGVA 2L3PA 1YNZA 3REBB 1MV3A 2PNIA 1VYTA 2D8JA 2M0YA 4A63B 1K0XA 1H8KA 4HVWA 2KRMA 3PVQA 3EG1A 3SHWA 2DX1A 1X27A 1ZUUA 4AFSC 2L3QA 2QDLA 2AZSA 4F14A 4LUEA 2JW4A 5IHIA 4D8DA 2A28A 3H0HA 2JXBA 1IO6A 3RBBB 2AKLA 2EYYA 2PTKA 4Z8AA 2KNBB 4OMPA 1NYFA 3CQTA 5I11A 1NEBA 1PKTA 1J3TA 2O9VA 2LCSA 2X3XD 1G2BA 2HBWA 1M27C 1UTIA 1SRLA 3R6NA 1T3LA 1JQQA 4OMNA 2RQUA 4QT7A 3ZL7C 1U5SA 3EG3A 5ECAA 2J6KA 1AD5A 1I07A 4LE9A 4J9DA 2L0AA 2P4RA 2W0ZA 1QWFA 2EGEA 5FW9A 2YUOA 1GRIA 1KIKA 2DYBA 1QKWA 1T0JA 1JXMA 2DE0X 4RTYA 3UA7A 2DL8A 1NG2A 1PWTA 2M51A 2LJ0A 3FJ5A 1ARKA 3THKA 2O88A 2KXCA 2DJQA 4KRTA 2BTTA 1W1FA 2K2MA 1NM7A 3LH5A 3M0PA 3VS3A 2LNHB 3UA6A 1KSWA 2RQRA 3NGPA 3H41A 2EW3A 1X2QA 4D8KA 2V1RA 1WXBA 2CT4A 2KRNA 2FO0A 2JM8A 4FSSA 1W6XA 2C0IA 2DA9A 2CT3A 1M30A 1FMKA 1H3HA 2LX7A 4AFZC 4LNPA 2ROLA 2OAWA 1U06A 1NLPC 2K3BA 1QWEA 2HEQA 3M0UA 2FPFA 3QWXX 2VWFA 4EIKA 3A98A 4Y92A 2RF0A 4RTVA 2DRMA 1PNJA 5IHKA 1KJWA 2JS2A 2YUNA 1BU1A 2D1XA 3NMZC 2CUDA 1M3CA 2HDAA 2AKKA 4DEXA 2V1QA 1UG1A 2DM1A 1ABOA 3EHQA 2AZVA 4J9BA 1Y0MA 1ZUKA 4HVVA 2ECZA 2GTJA 1SHGA 4E6RA 2KR3A 1YN8A 2BZ8A 1UDLA 3C0CA 1QCFA 4IIMA 3VRYA 2DVJA 1GCQA 2KT8A 5IXFA 3M0TA 4J9HA 2CH4W 2YUPA 2LQWA 2I0NA 4ESRA 1UJYA 3RNJA 2ENMA 1CSKA 2KYMA 4F16A 2BZXA 1RI9A 2DNUA 4J9FA 1I0CA 2KBTA 4JJBA 2DL4A 2E5KA 1UECA 4RTUA 1YWOA 1ZUYA 3VS4A 3EG0A 3I35A 2ABLA 2EYZA 4RTXA 3IQLA 2EVRA 1OV3A 2GBQA 2YSQA 4LUDA 4R0KA 5IXBA 1X6BA 2C0TA 1WFWA 1WIEA 1PHTA 1PRMC 2CH4A 5EC7A 3M0QA 4DEYA 4LN2A 2FRYA 1AZEA 2DL7A 2DF6A 3NHNA 1UHFA 2VVKA 1JU5C 2X3WD 2L3SA 3GBQA 3EG2A 4F17A 1V1CA 2FRWA 1B07A 1PKSA 4J9IA 1AWOA 1QLYA 1WX6A 1AZGB 2GTOA 1T0HA 4CC4B 3VS2A 3U23A 1S1NA 1K9AA 2FG0A 2F2WA 2RQWA 2EGAA 1JXOA 4K11A 3VRZA 2RMOA 2CSIA 2O2OA 2EYWA 5FWCA 4JJDA 2PZ1A 5GJVB 2BZYA 2CREA 1GBRA 2LJ1A 3EHRA 1NYGA 1UHCA 1JEGA 4JPBW 3I5SA 1ZSGA 2FEIA 2A36A 3JV3A 2L2PA 1Z9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWB A;  2A08 A;  2CUB A;  2K79 A;  2AK5 A;  1YP5 A;  2RPN A;  3SEM A;  2LJ3 A;  1SSH A;  2KT1 A;  3VS7 A;  2C0O A;  1A0N B;  1HJD A;  1E6G A;  5HCK A;  1WDX A;  1X2K A;  1ZBJ A;  1TUC A;  4WCI A;  2O31 A;  1OPK A;  4CC3 A;  4RTW A;  4CC2 A;  5I22 A;  4HVU A;  2VKN A;  3M0R A;  4RUG A;  3H0F A;  2JS0 A;  1VYV A;  2K6D A;  4OMM A;  1KFZ A;  2GQI A;  1X69 A;  2OJ2 A;  2GGR A;  3I5R A;  1E6H A;  2DBM A;  3H0I A;  2JMC A;  2KRS A;  2K7A A;  3NPF A;  2JM9 A;  1AOJ A;  2MOX A;  2ED1 A;  3PVL A;  1QKX A;  2EYX A;  1YCS B;  1K76 A;  1G83 A;  2W10 A;  1SPK A;  1YWP A;  5IHN A;  2JTE A;  2CSQ A;  2SRC A;  4Z88 A;  1M3A A;  1NLO C;  1UFF A;  1RLP C;  3QWY A;  1AVZ C;  1CKA A;  2IIM A;  1W70 A;  2RN8 A;  2EQI A;  5GJW B;  3ULR B;  1M3B A;  2KE9 A;  1N5Z A;  4ORZ A;  2KEA A;  2HCK A;  2DMO A;  4IIO A;  1HD3 A;  1WI7 A;  1SHF A;  2ROT A;  1AWJ A;  2DLP A;  1GFD A;  2O9S A;  2J6F A;  4AG1 C;  3TSW A;  1OEB A;  4AFU C;  3M0S A;  2YDL A;  4ZNX A;  4JZ3 A;  1OPL A;  3TVT A;  1GL5 A;  3TSZ A;  1T3S A;  2CDT A;  2YT6 A;  1NEG A;  2DL5 A;  2GNC A;  1Z9Z A;  2J6O A;  1BB9 A;  1GCP A;  2DBK A;  3VS5 A;  1WYX A;  1ABQ A;  2J7I A;  4HXJ A;  2KGT A;  2D0N A;  4AFQ C;  2DIL A;  1RUW A;  2RQT A;  1UE9 A;  1AWW A;  3EGU A;  1WXU A;  1FYN A;  4AG2 C;  1K4U S;  1GCQ C;  2HSP A;  1SRM A;  1I1J A;  1TG0 A;  1ZLM A;  2EKH A;  2KXD A;  3VS6 A;  4J9E A;  2G6F X;  5IH2 A;  1U3O A;  2J05 A;  2D8H A;  1WLP B;  2A37 A;  3KFV A;  3UAT A;  1EFN A;  1RLQ C;  2LQN A;  1VYU A;  1JO8 A;  3VS0 A;  1E7O A;  2JMA A;  1MUZ A;  2EPD A;  1AWX A;  1UJ0 A;  4M4Z A;  1WA7 A;  4OMQ A;  2K9G A;  2NUZ A;  1CKB A;  1B3Q A;  1X43 A;  2F2X A;  1HSQ A;  4RTZ A;  1K1Z A;  4HCK A;  1Y57 A;  1PRL C;  2MCN A;  1ZX6 A;  1K0S A;  1SEM A;  2F2V A;  4GLM A;  1LCK A;  2FPD A;  2H8H A;  4GBQ A;  4OML A;  1MV0 B;  1TUD A;  1OOT A;  2LMJ A;  3PE0 A;  4J9C A;  4JZ4 A;  2DL3 A;  4X1V A;  1BBZ A;  2JT4 A;  1VA7 A;  2KRO A;  3O5Z A;  1GFC A;  2RNA A;  2FPE A;  4JJC A;  2LZ6 B;  2DRK A;  3VS1 A;  4J9G A;  1M8M A;  4CC7 A;  3REA B;  2XMF A;  2J06 A;  1AEY A;  2NWM A;  1H92 A;  2YUQ A;  2ESW A;  1BK2 A;  2KYB A;  2LP5 A;  2ED0 A;  2EBP A;  4Z89 A;  1GBQ A;  3UF4 A;  5L23 A;  2OI3 A;  4OMO A;  1XOV A;  2MIO A;  4RTT A;  2EGC A;  1UUE A;  2B86 A;  1WXT A;  1X6G A;  3I9Q A;  2RQV A;  2SEM A;  1UGV A;  2L3P A;  1YNZ A;  3REB B;  1MV3 A;  2PNI A;  1VYT A;  2D8J A;  2M0Y A;  4A63 B;  1K0X A;  1H8K A;  4HVW A;  2KRM A;  3PVQ A;  3EG1 A;  3SHW A;  2DX1 A;  1X27 A;  1ZUU A;  4AFS C;  2L3Q A;  2QDL A;  2AZS A;  4F14 A;  4LUE A;  2JW4 A;  5IHI A;  4D8D A;  2A28 A;  3H0H A;  2JXB A;  1IO6 A;  3RBB B;  2AKL A;  2EYY A;  2PTK A;  4Z8A A;  2KNB B;  4OMP A;  1NYF A;  3CQT A;  5I11 A;  1NEB A;  1PKT A;  1J3T A;  2O9V A;  2LCS A;  2X3X D;  1G2B A;  2HBW A;  1M27 C;  1UTI A;  1SRL A;  3R6N A;  1T3L A;  1JQQ A;  4OMN A;  2RQU A;  4QT7 A;  3ZL7 C;  1U5S A;  3EG3 A;  5ECA A;  2J6K A;  1AD5 A;  1I07 A;  4LE9 A;  4J9D A;  2L0A A;  2P4R A;  2W0Z A;  1QWF A;  2EGE A;  5FW9 A;  2YUO A;  1GRI A;  1KIK A;  2DYB A;  1QKW A;  1T0J A;  1JXM A;  2DE0 X;  4RTY A;  3UA7 A;  2DL8 A;  1NG2 A;  1PWT A;  2M51 A;  2LJ0 A;  3FJ5 A;  1ARK A;  3THK A;  2O88 A;  2KXC A;  2DJQ A;  4KRT A;  2BTT A;  1W1F A;  2K2M A;  1NM7 A;  3LH5 A;  3M0P A;  3VS3 A;  2LNH B;  3UA6 A;  1KSW A;  2RQR A;  3NGP A;  3H41 A;  2EW3 A;  1X2Q A;  4D8K A;  2V1R A;  1WXB A;  2CT4 A;  2KRN A;  2FO0 A;  2JM8 A;  4FSS A;  1W6X A;  2C0I A;  2DA9 A;  2CT3 A;  1M30 A;  1FMK A;  1H3H A;  2LX7 A;  4AFZ C;  4LNP A;  2ROL A;  2OAW A;  1U06 A;  1NLP C;  2K3B A;  1QWE A;  2HEQ A;  3M0U A;  2FPF A;  3QWX X;  2VWF A;  4EIK A;  3A98 A;  4Y92 A;  2RF0 A;  4RTV A;  2DRM A;  1PNJ A;  5IHK A;  1KJW A;  2JS2 A;  2YUN A;  1BU1 A;  2D1X A;  3NMZ C;  2CUD A;  1M3C A;  2HDA A;  2AKK A;  4DEX A;  2V1Q A;  1UG1 A;  2DM1 A;  1ABO A;  3EHQ A;  2AZV A;  4J9B A;  1Y0M A;  1ZUK A;  4HVV A;  2ECZ A;  2GTJ A;  1SHG A;  4E6R A;  2KR3 A;  1YN8 A;  2BZ8 A;  1UDL A;  3C0C A;  1QCF A;  4IIM A;  3VRY A;  2DVJ A;  1GCQ A;  2KT8 A;  5IXF A;  3M0T A;  4J9H A;  2CH4 W;  2YUP A;  2LQW A;  2I0N A;  4ESR A;  1UJY A;  3RNJ A;  2ENM A;  1CSK A;  2KYM A;  4F16 A;  2BZX A;  1RI9 A;  2DNU A;  4J9F A;  1I0C A;  2KBT A;  4JJB A;  2DL4 A;  2E5K A;  1UEC A;  4RTU A;  1YWO A;  1ZUY A;  3VS4 A;  3EG0 A;  3I35 A;  2ABL A;  2EYZ A;  4RTX A;  3IQL A;  2EVR A;  1OV3 A;  2GBQ A;  2YSQ A;  4LUD A;  4R0K A;  5IXB A;  1X6B A;  2C0T A;  1WFW A;  1WIE A;  1PHT A;  1PRM C;  2CH4 A;  5EC7 A;  3M0Q A;  4DEY A;  4LN2 A;  2FRY A;  1AZE A;  2DL7 A;  2DF6 A;  3NHN A;  1UHF A;  2VVK A;  1JU5 C;  2X3W D;  2L3S A;  3GBQ A;  3EG2 A;  4F17 A;  1V1C A;  2FRW A;  1B07 A;  1PKS A;  4J9I A;  1AWO A;  1QLY A;  1WX6 A;  1AZG B;  2GTO A;  1T0H A;  4CC4 B;  3VS2 A;  3U23 A;  1S1N A;  1K9A A;  2FG0 A;  2F2W A;  2RQW A;  2EGA A;  1JXO A;  4K11 A;  3VRZ A;  2RMO A;  2CSI A;  2O2O A;  2EYW A;  5FWC A;  4JJD A;  2PZ1 A;  5GJV B;  2BZY A;  2CRE A;  1GBR A;  2LJ1 A;  3EHR A;  1NYG A;  1UHC A;  1JEG A;  4JPB W;  3I5S A;  1ZSG A;  2FEI A;  2A36 A;  3JV3 A;  2L2P A;  1Z9Q A; 
#chains in the Genus database with same CATH topology
 3PMI A;  3G6E Q;  1PG5 B;  1YJW Q;  4PLI A;  2I2L A;  3LH0 A;  2K2V A;  1A0N B;  1OX8 A;  5A0D A;  1ZBJ A;  2RI3 A;  4WCI A;  3CCJ Q;  3JB9 F;  2D9T A;  4RTW A;  5KE2 A;  2QAZ A;  5I22 A;  2VV5 A;  5GAM h;  2CP6 A;  3E19 A;  1I5L A;  1RAG B;  2GQI A;  3T9N A;  1X69 A;  3V7R A;  2WSC E;  2XG8 D;  3F70 A;  3OA6 A;  2ATC B;  2EJF A;  4PJO B;  4C92 A;  2DTI A;  1QVG A;  4HT8 A;  2W10 A;  3JAM E;  1RAB B;  3PTA A;  4BDY A;  2BUD A;  2CP0 A;  2K5F A;  2RJF A;  2YRC A;  2RN8 A;  4BY6 C;  3LGF A;  3N5B B;  1M3B A;  3LWH A;  5J26 A;  1N5Z A;  3FC3 A;  4A4F A;  2ZGW A;  2P4T A;  1WI7 A;  4MZP A;  1SHF A;  3SB2 A;  1AWJ A;  4FT4 A;  4PKC C;  3X24 B;  2J6F A;  4AG1 C;  1OEB A;  5GAN e;  5GMK h;  4GY5 A;  4JZ3 A;  3OW2 P;  1GL5 A;  3X25 B;  1LNX A;  2JUF A;  4IUV A;  3O8V A;  2J6O A;  1GCP A;  1NBE B;  2GFU A;  3CCU Q;  2DBK A;  2V8I A;  2DVE A;  2J7I A;  3HKS A;  3HPW A;  3JRZ A;  1WQW A;  2ZPI B;  3SWN C;  1WHJ A;  2QK0 A;  3PGG A;  4M78 D;  2QA4 Q;  1BI3 A;  2HQE A;  4F7U F;  1QP2 A;  2EKH A;  3JB9 J;  3VS6 A;  2KI7 A;  4J9E A;  2G6F X;  5CKB A;  2J05 A;  2D8H A;  2A37 A;  1NE8 A;  3UAT A;  1EFN A;  3C4S A;  4PNO A;  3OW2 S;  1VQ9 A;  3MPU B;  1M1K R;  4LDW A;  1BCM A;  2PVO B;  1BKB A;  5LJ3 g;  4P5N A;  5FRM A;  2BIV A;  3RKX A;  5D7U A;  2XI9 A;  2M0O A;  2CGH A;  3A8L B;  3CCQ Q;  1K0S A;  1SEM A;  2F2V A;  4GLM A;  4KUI A;  3LX7 A;  1BYM A;  3LGL A;  1KC8 R;  3ZEH A;  4A54 A;  2YXY A;  1TUD A;  2MMP A;  1OOT A;  1QVG P;  1VQO Q;  3MEU A;  3OS5 A;  1UB4 A;  2DL3 A;  5CCA A;  2MF2 A;  1WZO A;  1D0Z A;  1M5Q 1;  2H3E B;  4KUL A;  2RM4 A;  1DJ7 B;  4X34 A;  3REA B;  4UC4 A;  2DIG A;  2QDY B;  2AIR B;  2EQU A;  4C8Q F;  2M9U A;  2DJZ A;  4ANJ A;  1YJN T;  2EKO A;  4Z89 A;  1PM3 A;  1WJQ A;  5GAM e;  3UF4 A;  1VIE A;  2OI3 A;  3QYH B;  3JCM P;  5CKE A;  1VQ8 T;  2E3H A;  2CP7 A;  4DBF A;  3L2W A;  3S6W A;  4ZTJ A;  2JTM A;  1OUL A;  2SEM A;  4QVZ A;  1UGV A;  3CMA A;  1VQN Q;  3HFO A;  2M0Y A;  3CCL T;  4RG2 A;  3I55 A;  4A63 B;  4M75 D;  1K0X A;  3MP1 A;  4XTZ A;  4O5V A;  1VQL T;  1YJN A;  4C0Z A;  1M90 C;  5LJ3 d;  1YHQ Q;  2LQK A;  2P0Q A;  3DB4 A;  3CC2 A;  2E4H A;  4M77 F;  4MDW A;  2JXB A;  4EPC A;  4NS5 A;  3A8H B;  3BE3 A;  3EG9 A;  1Y07 A;  4OMP A;  1PKT A;  3CBM A;  1QMC A;  3CCE A;  3EFO B;  2DTH A;  1N8R C;  1VQ8 A;  4M7D F;  1V29 B;  1G2B A;  5CVI A;  2HBW A;  4M7A B;  2JOY A;  3L2U A;  1SRL A;  2YLC A;  3M4G A;  4C8Q A;  4OMN A;  4C8Q D;  2RQU A;  2AHJ B;  3EG3 A;  1AD5 A;  3G4S A;  1RAH B;  4QKU A;  4JS5 A;  2GFA A;  1N27 A;  1QKW A;  3OYF A;  3FLG A;  2AT1 B;  4C92 E;  2Y90 A;  2GF7 A;  4PJO D;  3UA7 A;  4LDX A;  1PWT A;  4KBM B;  4HCZ A;  4WF2 A;  3I56 T;  1VUB A;  2V8K A;  3FJ5 A;  5GAN g;  2O88 A;  3HL8 A;  4F7U A;  1VQM A;  2VUB A;  3OSV A;  1B34 A;  1W1F A;  3LH5 A;  2K3X A;  5EG2 A;  1Q81 R;  3UA6 A;  1YIJ T;  2ZCF B;  2NUP A;  2EW3 A;  1VQ4 T;  4D8K A;  5LJ5 f;  1M9S A;  1QVP A;  4Y91 A;  4PJO C;  1ZBX A;  2KRN A;  4ZN3 A;  1XJW B;  2BE9 B;  4M7A C;  1IGU A;  2R57 A;  4C5H A;  1W6X A;  2C0I A;  4XTX A;  2RK1 A;  1ZSZ C;  3QDR B;  1FMV A;  1FMK A;  1QP3 A;  1M1F A;  2X4Y A;  3RMQ A;  1TS9 A;  2ROL A;  1NLP C;  2ZPH B;  2E10 A;  2K3B A;  3G71 Q;  1WGS A;  4JS4 A;  2FPF A;  2E6Z A;  3PT9 A;  5GAN 5;  4C0F A;  5CR2 A;  2HKQ B;  1G3S A;  3A98 A;  1YIJ Q;  3G71 A;  1VQN T;  2XDP A;  4E7K A;  2R5M A;  1G8X A;  2DRM A;  1KJW A;  1MMG A;  2LDM A;  2JS2 A;  2YUN A;  2HNI A;  4M7D A;  1M3C A;  2AKK A;  4DEX A;  3J81 E;  1UG1 A;  1V76 A;  1OU8 A;  3CCV Q;  3CC7 Q;  2EWN A;  2HZY A;  4E47 A;  4J9B A;  3QHS A;  1UGQ B;  3M5A A;  4BB7 A;  2MWP A;  3MEW A;  5GAN 8;  4L59 A;  1Y71 A;  3GNF B;  4ELZ C;  4M7A F;  2BZ8 A;  1UDL A;  3C0C A;  3GNG A;  3RUX A;  1GCQ A;  4J9H A;  1YCY A;  4FW2 A;  1NZ9 A;  5KYW B;  1X75 C;  3BY7 A;  2QEX A;  3OYE A;  2BZX A;  1RI9 A;  4J9F A;  1KQ1 A;  2QQS A;  3NTH A;  3MJX A;  1MNE A;  2L8D A;  3VS4 A;  5CK9 A;  5LJ5 j;  2A0F B;  5CQY A;  1NPR A;  5IXB A;  1YJ9 Q;  5GAN 3;  3HTR A;  5IN1 A;  1PRM C;  1VQ8 Q;  3CC4 A;  1B34 B;  4M77 G;  1Q82 R;  1KQS A;  1AZE A;  2VC8 A;  5CKH A;  3NHN A;  3CXC A;  1BI1 A;  3SD4 A;  4ELY C;  3MP8 A;  2K5I A;  2L3S A;  4F17 A;  4J6W A;  1AWO A;  1HXD A;  3INZ A;  1QLY A;  3GLX A;  1JJ2 S;  4N0A A;  2YRV A;  1Q7Y R;  3MET A;  4M7D C;  2FG0 A;  2F2W A;  5I2M A;  2IVW A;  2RQW A;  3V8J A;  1JXO A;  4K11 A;  3CCR A;  4E7S A;  3RIR A;  2MPX C;  2EYW A;  3CME Q;  5GMK l;  3FJP A;  1PC0 A;  1U1T A;  5GMK i;  4BAC A;  1NYG A;  1UHC A;  3QZ9 B;  3X28 B;  3VJP A;  1ZSG A;  3V8L A;  2FEI A;  2A36 A;  3OYD A;  3JV3 A;  2L2P A;  1Z9Q A;  2CUB A;  5I21 A;  3CC7 A;  1YP5 A;  2LJ3 A;  2DER A;  1SSH A;  2A7Y A;  2KT1 A;  5HK3 A;  4OB1 B;  4DBQ A;  4E7I A;  3TU4 K;  3I55 T;  2X4X A;  5AT1 B;  1HJD A;  3NTI A;  1KQ2 A;  1WDX A;  1OPK A;  3M54 A;  4CC3 A;  3OY9 A;  4E2F B;  3JCM W;  2DKG A;  4CC2 A;  1XQH A;  4RUG A;  2JS0 A;  4C92 B;  2K6D A;  3Q1J A;  2L5Q A;  4OF1 A;  1YIJ A;  3H0I A;  3JCM g;  2KRS A;  3NPF A;  4PLL A;  4ZGJ B;  3JCM J;  1AOJ A;  2MOX A;  8ATC B;  5GAO m;  3L2Z A;  1Q7Y U;  1G83 A;  1WHK A;  1YWP A;  3HRU A;  5IHN A;  2WAC A;  2CSQ A;  1VQK A;  9ATC B;  1UFF A;  2FZG B;  3QWY A;  4LXC A;  1VQ4 Q;  2EQI A;  3ULR B;  3M58 A;  2XU8 A;  4M77 B;  4ORZ A;  2HCK A;  2OAU A;  4IIO A;  1MMD A;  3JB9 I;  4TVR A;  2ROT A;  1VQ9 Q;  3MKD A;  1OZ3 A;  4EMK C;  3TSW A;  4AFU C;  1PCX A;  1IZ6 A;  3A8O B;  2DET A;  3C12 A;  5L8R E;  4NL3 A;  3E9F A;  2CDT A;  2YT6 A;  2DL5 A;  1R8O B;  1Z9Z A;  1BB9 A;  1YJ9 T;  4OGC A;  3EH1 A;  3VS5 A;  3EFO A;  3OYY A;  1ABQ A;  4X9C A;  2QA4 A;  2DFU A;  8AT1 B;  5GAO n;  4AMC A;  2DIL A;  1RUW A;  1UE9 A;  2XID A;  1AWW A;  3MEV A;  2CZ0 B;  3EGU A;  4VUB A;  1SRM A;  1FX7 A;  1ZLM A;  2NYS A;  1JRI A;  4HT9 A;  4Z02 A;  4YTL A;  4QQ6 A;  2KVQ G;  4J8O A;  2DPP B;  5FRN A;  2E12 A;  2X51 A;  2HSE B;  7AT1 B;  2EPD A;  1UJ0 A;  4M4Z A;  3CD6 Q;  4C92 C;  4OMQ A;  1CKB A;  1B3Q A;  1D1B A;  1HYO A;  1UGS B;  3I56 A;  1HSQ A;  4RG8 A;  1PRL C;  1VOM A;  2MCN A;  2E64 A;  1HK9 A;  3G6E T;  4BI8 B;  4C92 D;  1LCK A;  3ASK A;  2H8H A;  1MMN A;  4OML A;  4N4H A;  1R0C B;  3HSB A;  2BKD N;  1D1C A;  4X1V A;  4PFZ A;  3OW2 A;  4J7F A;  2G3R A;  1ACM B;  4CRI A;  4JRI A;  4LDY A;  1WHL A;  2EIF A;  2RHY A;  2HAX A;  2BE7 D;  1GFC A;  2RNA A;  1S72 T;  4M75 E;  4JJC A;  1TXQ A;  1WJR A;  2DRK A;  1M1K C;  2XIC A;  4RCC A;  3CC4 T;  1H92 A;  3SDZ A;  2ESW A;  2ZPG B;  1K73 C;  1G3T A;  2ED0 A;  2HQH A;  4PJN A;  3OMG A;  2CP2 A;  5L23 A;  5J39 A;  3ME9 A;  4ZGD B;  1VQ5 Q;  3QJ6 A;  2MIO A;  1JB0 E;  5LJ5 g;  2EGC A;  4DA4 A;  2VXE A;  1D0Y A;  4IUU A;  3JCM V;  2QEX T;  4PJO F;  5D6W A;  1EZZ B;  2PNI A;  3QZ5 B;  1H8K A;  1ZQ1 A;  4F7U G;  3QII A;  4HVW A;  5I2S A;  2KRM A;  3CCR Q;  3EG1 A;  5KYU B;  2DX1 A;  1VQO A;  1X27 A;  1ZUU A;  1OX9 A;  1M1K U;  1VQK Q;  1D09 B;  2CZ6 B;  4F14 A;  2E6N A;  3VUB A;  2JW4 A;  4EMH A;  3OYJ A;  2PVG B;  3NTK A;  3CME T;  2A28 A;  3H0H A;  1IXD A;  2AKL A;  2EYY A;  1K8A R;  3I56 Q;  2KNB B;  3M9Q A;  4B9W A;  2FYK A;  4PJM A;  2LCS A;  2X3X D;  3MCA B;  5LJ5 d;  1M27 C;  2E5Q A;  2F69 A;  1UTI A;  1YJW T;  2MK5 A;  4J6X A;  4XU3 A;  4QT7 A;  2QG9 B;  3ZL7 C;  3QYG B;  5DM7 R;  4LE9 A;  5J3B A;  2P4R A;  4XTW A;  2F1L A;  1G3Y A;  1KD1 C;  5FW9 A;  3QJY A;  1M90 R;  1TOV A;  2YUO A;  3CCJ T;  1KIK A;  2QQB A;  2DL8 A;  2KSS A;  2PQW A;  1NG2 A;  3H8Z A;  3JB9 H;  4M75 C;  3CXC S;  2K3Y A;  4XU0 A;  4QW2 A;  3OBY A;  1ZA1 B;  1ARK A;  3THK A;  1XNI A;  2KXC A;  4KH1 B;  1VQP Q;  4KRT A;  4MML A;  2L3R A;  2CP5 A;  2BTT A;  5GAO l;  3G7Z A;  4BI4 A;  1W2B P;  3VS3 A;  1VQM T;  2LNH B;  2EQM A;  2CS7 A;  5D6X A;  3OYN A;  3CCV A;  1X2Q A;  3FB9 A;  4QQG A;  1K73 R;  4A4H A;  2V1R A;  5GAM j;  2LC4 A;  2HL5 C;  3TCJ A;  2PU9 B;  1WHH A;  1I8F A;  2DD5 A;  4FSS A;  4J6Y A;  1JJ2 A;  2O01 E;  1M30 A;  3GIB A;  1BCO A;  4LNP A;  1TU0 B;  1RI0 A;  4C8Q C;  4C5I A;  4FSX A;  1NJI R;  4F04 B;  2HEQ A;  3M0U A;  2LCC A;  4C0D B;  4JRP A;  5LL6 S;  2R58 A;  4Y92 A;  1WHM A;  1N9R A;  3HRT A;  1PSE A;  4MMK A;  3WVD B;  3GOX A;  4WTO B;  3OYM A;  3BDL A;  3MO8 A;  1K8A C;  2RB6 A;  2D1X A;  5GMK j;  1OU9 A;  2OTL A;  2XHC A;  2DM1 A;  3M57 A;  1ABO A;  3ZFJ A;  1EIF A;  3G6E A;  3OYK A;  3CBO A;  2LNV A;  1LJO A;  2MWO A;  1IHV A;  2KR3 A;  1P92 A;  4C8Q B;  3DKM A;  1NJI C;  1QVF P;  2I0N A;  4ESR A;  2E65 A;  1UJY A;  3OYI A;  4ATO A;  4RCB A;  1VQ7 Q;  2KYM A;  2DNU A;  3L1A A;  2DL4 A;  3RDV A;  4M77 A;  1UEC A;  4RTU A;  3CCS T;  1QCN A;  1ZUY A;  3EG0 A;  5KYU A;  2KQW A;  2LCL A;  3IQL A;  2EVR A;  1OV3 A;  2GQV A;  2YSQ A;  5GAN 4;  3KXT A;  2RH2 A;  1RAI B;  1VQ5 T;  1QCO A;  4C8Q G;  4BUG A;  3M0Q A;  5KYY A;  4DEY A;  1M2V B;  4HCB A;  3EG9 B;  1YJ9 A;  3ER0 A;  2DF6 A;  4PFO A;  1UHF A;  2QA4 T;  4J9I A;  2FHD A;  1AZG B;  2GTO A;  2M16 A;  1VQK T;  3VS2 A;  1S1N A;  1Q82 U;  1K9A A;  2ZPF B;  3CCS Q;  1YHQ A;  3EFR A;  1OQK A;  5LJ5 e;  4M7D E;  2EGA A;  5LJ5 h;  1K9M R;  3OYA A;  1SF9 A;  2M02 A;  3OS0 A;  4C92 G;  4MDX A;  2EJ9 A;  2CRE A;  5FU7 C;  3H9N A;  2LJ1 A;  4PJL A;  3CCM A;  2HKN A;  4C92 F;  5LJ3 j;  2A08 A;  2K79 A;  2COZ A;  2AK5 A;  2RPN A;  3SEM A;  2DTO A;  1BI0 A;  3JCM Q;  2QQR A;  1M90 U;  3D7S B;  2C0O A;  4F7U B;  4E7L A;  1E6G A;  4KGZ B;  4JJN K;  1X2K A;  4N4I A;  4A4E A;  1TUC A;  2O31 A;  4BE0 A;  1Q7Y C;  2NUP B;  3H0F A;  1VYV A;  2FB7 A;  3QDF A;  3OBW A;  1ZHI A;  1KC8 C;  3MEA A;  3S3M A;  2GGR A;  2RA2 A;  2DXB A;  2DBM A;  3RR6 A;  2JMC A;  1Y7X A;  3CC7 T;  5KCH A;  4FT2 A;  2K5L A;  2ED1 A;  3PVL A;  3X26 B;  2M1H A;  2EYX A;  4XTV A;  4N0A C;  2MAM A;  3PFS A;  1SPK A;  2SRC A;  1PSF A;  4A53 A;  1YJN Q;  1C0M A;  5FU7 B;  1AVZ C;  3JCM f;  2IIM A;  1W70 A;  4BD3 A;  5GJW B;  3X20 B;  2KE9 A;  1QVG S;  2CP3 A;  2KEA A;  3CD6 T;  2DMO A;  3DB3 A;  1BIA A;  5A0L A;  2IPO B;  2O9S A;  3CCR T;  2VXF A;  1NJI U;  3OSS C;  3M0S A;  4ZNX A;  1OPL A;  3TSZ A;  4OB2 B;  5GAO q;  4FCY A;  1WYX A;  4HXJ A;  3KBG A;  2D0N A;  3CEY A;  4AFQ C;  2QYZ A;  3CCQ T;  1KHC A;  3BFM A;  3EFS A;  1G3W A;  3G71 T;  4M78 A;  4JUV A;  4JLI A;  5KYN A;  1WXU A;  1FYN A;  4B9X A;  1GCQ C;  2HSP A;  1I1J A;  1Q81 U;  2EAY A;  1TG0 A;  3L2V A;  4J5Y A;  2WSF E;  1SG5 A;  5IH2 A;  1U3O A;  3SWN A;  1WLP B;  2QTX A;  3KFV A;  1N9S A;  2PUO B;  2LTO A;  2LQN A;  1MND A;  3VS0 A;  1WQ7 A;  2JMA A;  4M7A G;  5C0M A;  1MUZ A;  3SWN B;  2QXF A;  3QBY A;  2RI5 A;  1AWX A;  5CIU A;  2RJD A;  1RAE B;  1RAC B;  1KD1 U;  4LD9 K;  1F1B B;  2JZ2 A;  4KH0 B;  2K9G A;  2NUZ A;  5GAN j;  1TWB A;  4HA8 A;  1X43 A;  5KYX B;  4M75 F;  2LVM A;  1K1Z A;  3CD6 A;  3VUZ A;  3JCM h;  2YWW A;  4AT1 B;  2EQK A;  3LYI A;  2FPD A;  5A2Q E;  1WPY A;  4M78 G;  3CCU T;  2FZK B;  2RK2 A;  3TQ7 P;  2LMJ A;  3WXM B;  4J9C A;  1VQP A;  4MZT A;  1M2O A;  4RKU E;  2YRD A;  4DOV A;  3OYG A;  1BBZ A;  2JT4 A;  4NOY A;  1VA7 A;  2KRO A;  3O5Z A;  4BE1 A;  2WSE E;  1I4K 1;  2LT1 A;  3MHX A;  2FPE A;  1VQN A;  1ZSZ A;  2CZ1 B;  1M8M A;  4CC7 A;  2XMF A;  3J80 E;  2NWM A;  5KCO A;  2IG0 A;  1BK2 A;  3QO3 A;  4PFP A;  1KHI A;  4KT0 E;  2LP5 A;  2EBP A;  2EFI A;  1K8A U;  1GBQ A;  2P84 A;  3S3N A;  2X9H A;  1XOV A;  1YI2 Q;  3E9G A;  3V7C A;  1UUE A;  5GAN d;  1QW1 A;  2MI6 A;  3I9Q A;  2RQV A;  1YNZ A;  4E7Z A;  3REB B;  3CCE Q;  3C95 A;  1MGQ A;  1VYT A;  2D8J A;  1VQ6 T;  4MZM A;  3PVQ A;  3SHW A;  4GLK A;  4AFS C;  4IUR A;  4L6V 5;  3CPW A;  2L3Q A;  2QDL A;  3TEE A;  2AZS A;  1MHN A;  5GAN h;  3E1S A;  4LUE A;  2DXT A;  2DAQ A;  2PTK A;  3S3O A;  1NYF A;  2OTJ A;  1NEB A;  3LW5 E;  1J3T A;  3CMA Q;  2O9V A;  3OB9 A;  4IUP A;  3E2U A;  4JDS A;  3CCE T;  1H64 1;  4CI0 C;  4DOW A;  4FM4 B;  4XK8 E;  1VQ5 A;  1JQQ A;  3A5Z B;  1U5S A;  5ECA A;  1I07 A;  4QQD A;  3FIF A;  4J9D A;  4M7D G;  2W0Z A;  1VQ7 T;  1D3B B;  4BY6 B;  2EGE A;  5GAN 6;  4ZGE B;  4OVA A;  2DYB A;  4C5G A;  1JXM A;  4C0G A;  1AT1 B;  4RTY A;  2RI2 A;  2DD4 A;  4XTY A;  2M51 A;  5LJ3 h;  3CME A;  4N4G A;  1B7T A;  2DJQ A;  2PVD B;  4HCC A;  4XTU A;  5A0G A;  4E7H A;  2K2M A;  1AHJ B;  1NM7 A;  2FVU A;  4M77 D;  4II1 A;  3NGP A;  1R0B G;  1WXB A;  1N6A A;  2CT4 A;  3HFN A;  1H3Z A;  2FO0 A;  2JM8 A;  3P8D A;  4M7A D;  1VQ9 T;  2XKO C;  1YFN A;  2DA9 A;  2ZZD A;  2CT3 A;  3CC4 Q;  5GMK m;  2LX7 A;  5DY9 A;  1U06 A;  2KAF A;  1IHW A;  2XK0 A;  1TUG B;  3V8K A;  2XDB A;  1PD0 A;  2YLB A;  1UGR B;  3URG A;  4EIK A;  1G5V A;  5FU6 B;  2RF0 A;  4RTV A;  2QEX Q;  3BW1 A;  5GAN 2;  3L2R A;  2A3L A;  5IHK A;  2P0P A;  4FW1 A;  2EQJ A;  4DBR A;  2HBP A;  3NMZ C;  2RHZ A;  4R56 A;  2HDA A;  3JCM c;  3TRE A;  1N8R R;  3EHQ A;  1FWZ A;  2AZV A;  3OMC A;  3VU3 C;  3PIP A;  4HVV A;  3DLM A;  2Y4Y A;  3QUI A;  3R6O A;  4M77 E;  1W2B A;  1SHG A;  4E6R A;  2CZ7 B;  2X35 A;  4IIM A;  2X4W A;  1Q86 R;  6AT1 B;  5IAY A;  5IXF A;  5GAM g;  2VGM A;  2YUP A;  1VQ4 A;  4Y28 E;  3RNJ A;  5FU6 C;  1KQS S;  4EMK A;  2JTF A;  2E5K A;  3RKW A;  2VB6 A;  1Y96 A;  3NFC A;  1D0X A;  3CCV T;  5KH6 A;  1TH7 A;  1R77 A;  2EYZ A;  1RAD B;  4R0K A;  3UDC A;  1X6B A;  2C0T A;  5AYF A;  3JCM d;  1YI2 T;  3RMS A;  3PIO A;  1D3B A;  1PHT A;  4O6J A;  4IUQ A;  2CH4 A;  2RO0 A;  3V7S A;  1JJ2 P;  2Y4X A;  2ZPE B;  4LN2 A;  3CXC P;  1MMA A;  2FRY A;  2OTJ Q;  2RJE A;  1VQ6 Q;  2LX9 A;  2VVK A;  2DK3 A;  2K57 A;  2XD0 A;  2X3W D;  3EG2 A;  2QGF B;  1V1C A;  2FRW A;  1B07 A;  2ZAE A;  3OYB A;  1JBM A;  5M9O A;  1IRE B;  2QI2 A;  4CC4 B;  3P8B B;  3U23 A;  4DBH A;  4M78 E;  1VQL Q;  3JCM X;  3L2Q A;  5KYX A;  4XU2 A;  3VRZ A;  1KD1 R;  2RMO A;  4FYY B;  2CSI A;  2O2O A;  2VGN A;  2NLU A;  2DZ9 A;  2DO3 A;  4FL6 A;  5FWC A;  1X6O A;  4JJD A;  1RL2 A;  3EHR A;  1GXI E;  2JNG A;  2DEQ A;  4IUT A;  1YI2 A;  2D6F A;  1KC8 U;  5FWB A;  4RMO A;  1IRX A;  3EGX B;  4M78 C;  4KUD K;  3VS7 A;  4OB3 B;  1IGQ A;  5GAN 7;  5HCK A;  1S72 Q;  1M4Z A;  3ZBD A;  1UEB A;  2CYZ B;  4J83 A;  3CMA T;  1SSF A;  1SKU B;  2PUK B;  4HVU A;  2VKN A;  3M0R A;  3JCM e;  3A1P A;  4OMM A;  1K9M C;  4M78 F;  1KFZ A;  5HK0 A;  3I5R A;  2OJ2 A;  1E6H A;  3EGD A;  2K7A A;  2JM9 A;  4OMF B;  2LRQ A;  1QKX A;  4M75 G;  1WNL A;  4X9D A;  4B6M A;  1YCS B;  1K76 A;  2JTE A;  3GP8 A;  3CCM T;  4Z88 A;  1Q86 U;  1M3A A;  1NLO C;  3G4S T;  4KGV B;  1RLP C;  5KYW A;  4C5E A;  2KDS A;  1CKA A;  5CQX A;  1KG1 A;  2K4Y A;  5CKD A;  3I55 Q;  4A4K A;  4D6W A;  3QSU A;  4HKE A;  1YHQ T;  4LD6 A;  1HD3 A;  4LDV A;  4FIB A;  2YHT A;  4ZN1 A;  1O9S A;  2DLP A;  1GFD A;  2X4J A;  2RHX A;  4PK4 A;  3QPH A;  4DQ2 A;  2YDL A;  4PJO G;  1I5O B;  3TVT A;  2NUT B;  1T3S A;  1NEG A;  2GNC A;  2DXC A;  5DLQ E;  3UT1 A;  3CC2 T;  2CKK A;  3FRN A;  1PD1 A;  3JB9 D;  2KGT A;  5GAO p;  4KGX B;  1RAF B;  1D1A A;  2RQT A;  1LVK A;  3M59 A;  5FRO A;  5FLX E;  4AG2 C;  1K4U S;  2GCX A;  4M7D D;  2F5K A;  2RJC A;  1QQJ A;  3CPW P;  3RKY A;  2KXD A;  4JRK A;  4EMG A;  5HY6 A;  4JLG A;  3KUF A;  4M78 B;  1M2V A;  4QVD A;  1RLQ C;  2DIQ A;  1Q81 C;  3HHT B;  1VYU A;  1JO8 A;  1BI2 A;  1E7O A;  2P0K A;  3CCQ A;  2HMA A;  2QQ9 A;  1WA7 A;  3HP9 A;  1WJS A;  5GMK e;  3FDR A;  2JVV A;  4M75 A;  2F2X A;  4RTZ A;  4HCK A;  2F5T X;  1Y57 A;  2MYS A;  1ZX6 A;  1FMW A;  3QG1 A;  2COW A;  1M8V A;  4GBQ A;  4M75 B;  1MV0 B;  4FYX B;  3JCM b;  3FEO A;  5CKF A;  3CBP A;  1VQM Q;  2E3I A;  3PE0 A;  2V8J A;  4ME7 A;  4JZ4 A;  4LDU A;  4NL2 A;  1I81 A;  1LPL A;  3UWN A;  3OYH A;  5C6S A;  2OTL T;  2QAS A;  4PJJ A;  3JSC A;  2LQ8 A;  3QXE B;  1RAA B;  1YIT Q;  2LZ6 B;  3VS1 A;  4J9G A;  2J06 A;  1AEY A;  2YUQ A;  2EJG A;  2KYB A;  1OZ2 A;  4FYV B;  4M7A E;  1ZSZ B;  3OS2 A;  3G4S Q;  1C6V X;  3VYH B;  4OMO A;  5LJ3 e;  4M77 C;  4RTT A;  3C94 A;  3RER A;  1VIF A;  2B86 A;  1W2B S;  4BI3 A;  1WXT A;  1X6G A;  2DZC A;  2L3P A;  3PNW C;  3EH2 A;  1MV3 A;  4PL6 A;  4L5G A;  5IT9 E;  1YBY A;  1C1A A;  4XQ3 A;  2NUT A;  5CAI A;  3OS1 A;  4XAX B;  3VKI A;  1VQO T;  4M7D B;  3CC2 Q;  5IHI A;  5GAM d;  3OYC A;  4D8D A;  3EGD B;  1IO6 A;  3RBB B;  2JN0 A;  4Z8A A;  4PJO A;  1Q95 G;  5I11 A;  2E70 A;  1W4S A;  2H3J A;  2HD0 A;  4BDZ A;  2QQA A;  4QVC A;  3M4Y A;  2KY9 A;  3R6N A;  1T3L A;  1XTD A;  1WHG A;  3LLR A;  4F7U E;  2J6K A;  5HKC A;  2L0A A;  1BIB A;  1QWF A;  3M53 A;  4FYW B;  1GRI A;  1NPP A;  5KYY B;  3M55 A;  1U1S A;  1T0J A;  4A4G A;  2DE0 X;  1YIT A;  3AT1 B;  2KMT A;  1FXX A;  2D0Q B;  3EGX A;  2LJ0 A;  3LWI A;  2RD1 A;  4EDU A;  3DLL A;  2KK4 A;  3A8M B;  4OGE A;  5CO7 A;  2VAS A;  1M1G A;  4V2S A;  4C8Q E;  2O4X B;  4E7J A;  4XU1 A;  1VQL A;  2HQX A;  1KK7 A;  3M0P A;  2B8A A;  1KSW A;  2RQR A;  1TTH B;  1ZA2 B;  3H41 A;  3GPL A;  3JB9 G;  2OTL Q;  4PJO E;  2RHU A;  1O75 A;  3GF5 A;  3CPW S;  1H3H A;  1QVF A;  4AFZ C;  3CPF A;  4FU6 A;  3A8G B;  2OAW A;  5DLO A;  3EAE A;  1QWE A;  3QWX X;  2VWF A;  2HL3 A;  3UPU A;  2COY A;  2QGG A;  3PMT A;  5LJ3 f;  2RHI A;  1U8R A;  3M56 A;  2EYQ A;  4BE2 A;  4J7I A;  3OQ5 A;  2DXU A;  1BU1 A;  2Z0W A;  2CUD A;  1S72 A;  4ZTF A;  3VV0 A;  3CCU A;  3CCL Q;  2V1Q A;  1K9M U;  3HRS A;  1OYX A;  3P8H A;  1Y0M A;  1ZUK A;  3L42 A;  2ECZ A;  2GTJ A;  3QKJ A;  3SFM A;  2VYT A;  2E1H A;  3CCM Q;  3CCL A;  1TSF A;  1OI1 A;  1YN8 A;  4M7A A;  1N8R U;  1QCF A;  2LT4 A;  3VRY A;  2DVJ A;  2KT8 A;  3RES A;  3M0T A;  4OB0 B;  2CH4 W;  2LQW A;  1K73 U;  1QVF S;  3G1J A;  2ENM A;  5GAN f;  3CCS A;  1CSK A;  4F16 A;  3H6Z A;  1I0C A;  2KBT A;  4JJB A;  1EX4 A;  1YWO A;  2QTV A;  5GAM f;  3I35 A;  4R55 A;  1X01 A;  2ABL A;  4RTX A;  4EMK B;  2GBQ A;  2ZPB B;  4LUD A;  1VQ6 A;  1Q82 C;  1IB8 A;  2FL7 A;  1Y96 B;  1WFW A;  1YIT T;  1WIE A;  3BDU A;  1KQS P;  2DYI A;  5EC7 A;  3CCJ A;  3OYL A;  2FZC B;  2DL7 A;  1Q86 C;  2JJ9 A;  1JU5 C;  3VYG A;  3GBQ A;  4OP0 A;  1PKS A;  1YJW A;  2XDD A;  2R5A A;  5GAO r;  3MP6 A;  2OX7 A;  1VQP T;  1WX6 A;  2E41 A;  1UGP B;  1T0H A;  4Q5W A;  5KE3 A;  1VQ7 A;  2O4X A;  4JRQ A;  1LOJ A;  2C06 A;  5D6Y A;  2PZ1 A;  5GJV B;  2BZY A;  4IKF A;  1GBR A;  3J7A F;  4C0D C;  2L89 A;  1JEG A;  4JPB W;  3I5S A;  3AHU A;  2V26 A;  2OTJ T;  3WVE B;  2DEU A;  1PNJ A;  3CQT A; 
#chains in the Genus database with same CATH homology
 5FWB A;  2A08 A;  2CUB A;  2K79 A;  2AK5 A;  1YP5 A;  2RPN A;  3SEM A;  2LJ3 A;  1SSH A;  2KT1 A;  3VS7 A;  2C0O A;  1A0N B;  1HJD A;  1E6G A;  5HCK A;  1WDX A;  1X2K A;  1ZBJ A;  1TUC A;  4WCI A;  2O31 A;  1OPK A;  4CC3 A;  4RTW A;  4CC2 A;  5I22 A;  4HVU A;  2VKN A;  3M0R A;  4RUG A;  3H0F A;  2JS0 A;  1VYV A;  2K6D A;  4OMM A;  1KFZ A;  2GQI A;  1X69 A;  2OJ2 A;  2GGR A;  3I5R A;  1E6H A;  2DBM A;  3H0I A;  2JMC A;  2KRS A;  2K7A A;  3NPF A;  2JM9 A;  1AOJ A;  2MOX A;  2ED1 A;  3PVL A;  1QKX A;  2EYX A;  1YCS B;  1K76 A;  1G83 A;  2W10 A;  1SPK A;  1YWP A;  5IHN A;  2JTE A;  2CSQ A;  2SRC A;  4Z88 A;  1M3A A;  1NLO C;  1UFF A;  1RLP C;  3QWY A;  1AVZ C;  1CKA A;  2IIM A;  1W70 A;  2RN8 A;  2EQI A;  5GJW B;  3ULR B;  1M3B A;  2KE9 A;  1N5Z A;  4ORZ A;  2KEA A;  2HCK A;  2DMO A;  4IIO A;  1HD3 A;  1WI7 A;  1SHF A;  2ROT A;  1AWJ A;  2DLP A;  1GFD A;  2O9S A;  2J6F A;  4AG1 C;  3TSW A;  1OEB A;  4AFU C;  3M0S A;  2YDL A;  4ZNX A;  4JZ3 A;  1OPL A;  3TVT A;  1GL5 A;  3TSZ A;  1T3S A;  2CDT A;  2YT6 A;  1NEG A;  2DL5 A;  2GNC A;  1Z9Z A;  2J6O A;  1BB9 A;  1GCP A;  2DBK A;  3VS5 A;  1WYX A;  1ABQ A;  2J7I A;  4HXJ A;  2KGT A;  2D0N A;  4AFQ C;  2DIL A;  1RUW A;  2RQT A;  1UE9 A;  1AWW A;  3EGU A;  1WXU A;  1FYN A;  4AG2 C;  1K4U S;  1GCQ C;  2HSP A;  1SRM A;  1I1J A;  1TG0 A;  1ZLM A;  2EKH A;  2KXD A;  3VS6 A;  4J9E A;  2G6F X;  5IH2 A;  1U3O A;  2J05 A;  2D8H A;  1WLP B;  2A37 A;  3KFV A;  3UAT A;  1EFN A;  1RLQ C;  2LQN A;  1VYU A;  1JO8 A;  3VS0 A;  1E7O A;  2JMA A;  1MUZ A;  2EPD A;  1AWX A;  1UJ0 A;  4M4Z A;  1WA7 A;  4OMQ A;  2K9G A;  2NUZ A;  1CKB A;  1B3Q A;  1X43 A;  2F2X A;  1HSQ A;  4RTZ A;  1K1Z A;  4HCK A;  1Y57 A;  1PRL C;  2MCN A;  1ZX6 A;  1K0S A;  1SEM A;  2F2V A;  4GLM A;  1LCK A;  2FPD A;  2H8H A;  4GBQ A;  4OML A;  1MV0 B;  1TUD A;  1OOT A;  2LMJ A;  3PE0 A;  4J9C A;  4JZ4 A;  2DL3 A;  4X1V A;  1BBZ A;  2JT4 A;  1VA7 A;  2KRO A;  3O5Z A;  1GFC A;  2RNA A;  2FPE A;  4JJC A;  2LZ6 B;  2DRK A;  3VS1 A;  4J9G A;  1M8M A;  4CC7 A;  3REA B;  2XMF A;  2J06 A;  1AEY A;  2NWM A;  1H92 A;  2YUQ A;  2ESW A;  1BK2 A;  2KYB A;  2LP5 A;  2ED0 A;  2EBP A;  4Z89 A;  1GBQ A;  3UF4 A;  5L23 A;  2OI3 A;  4OMO A;  1XOV A;  2MIO A;  4RTT A;  2EGC A;  1UUE A;  2B86 A;  1WXT A;  1X6G A;  3I9Q A;  2RQV A;  2SEM A;  1UGV A;  2L3P A;  1YNZ A;  3REB B;  1MV3 A;  2PNI A;  1VYT A;  2D8J A;  2M0Y A;  4A63 B;  1K0X A;  1H8K A;  4HVW A;  2KRM A;  3PVQ A;  3EG1 A;  3SHW A;  2DX1 A;  1X27 A;  1ZUU A;  4AFS C;  2L3Q A;  2QDL A;  2AZS A;  4F14 A;  4LUE A;  2JW4 A;  5IHI A;  4D8D A;  2A28 A;  3H0H A;  2JXB A;  1IO6 A;  3RBB B;  2AKL A;  2EYY A;  2PTK A;  4Z8A A;  2KNB B;  4OMP A;  1NYF A;  3CQT A;  5I11 A;  1NEB A;  1PKT A;  1J3T A;  2O9V A;  2LCS A;  2X3X D;  1G2B A;  2HBW A;  1M27 C;  1UTI A;  1SRL A;  3R6N A;  1T3L A;  1JQQ A;  4OMN A;  2RQU A;  4QT7 A;  3ZL7 C;  1U5S A;  3EG3 A;  5ECA A;  2J6K A;  1AD5 A;  1I07 A;  4LE9 A;  4J9D A;  2L0A A;  2P4R A;  2W0Z A;  1QWF A;  2EGE A;  5FW9 A;  2YUO A;  1GRI A;  1KIK A;  2DYB A;  1QKW A;  1T0J A;  1JXM A;  2DE0 X;  4RTY A;  3UA7 A;  2DL8 A;  1NG2 A;  1PWT A;  2M51 A;  2LJ0 A;  3FJ5 A;  1ARK A;  3THK A;  2O88 A;  2KXC A;  2DJQ A;  4KRT A;  2BTT A;  1W1F A;  2K2M A;  1NM7 A;  3LH5 A;  3M0P A;  3VS3 A;  2LNH B;  3UA6 A;  1KSW A;  2RQR A;  3NGP A;  3H41 A;  2EW3 A;  1X2Q A;  4D8K A;  2V1R A;  1WXB A;  2CT4 A;  2KRN A;  2FO0 A;  2JM8 A;  4FSS A;  1W6X A;  2C0I A;  2DA9 A;  2CT3 A;  1M30 A;  1FMK A;  1H3H A;  2LX7 A;  4AFZ C;  4LNP A;  2ROL A;  2OAW A;  1U06 A;  1NLP C;  2K3B A;  1QWE A;  2HEQ A;  3M0U A;  2FPF A;  3QWX X;  2VWF A;  4EIK A;  3A98 A;  4Y92 A;  2RF0 A;  4RTV A;  2DRM A;  1PNJ A;  5IHK A;  1KJW A;  2JS2 A;  2YUN A;  1BU1 A;  2D1X A;  3NMZ C;  2CUD A;  1M3C A;  2HDA A;  2AKK A;  4DEX A;  2V1Q A;  1UG1 A;  2DM1 A;  1ABO A;  3EHQ A;  2AZV A;  4J9B A;  1Y0M A;  1ZUK A;  4HVV A;  2ECZ A;  2GTJ A;  1SHG A;  4E6R A;  2KR3 A;  1YN8 A;  2BZ8 A;  1UDL A;  3C0C A;  1QCF A;  4IIM A;  3VRY A;  2DVJ A;  1GCQ A;  2KT8 A;  5IXF A;  3M0T A;  4J9H A;  2CH4 W;  2YUP A;  2LQW A;  2I0N A;  4ESR A;  1UJY A;  3RNJ A;  2ENM A;  1CSK A;  2KYM A;  4F16 A;  2BZX A;  1RI9 A;  2DNU A;  4J9F A;  1I0C A;  2KBT A;  4JJB A;  2DL4 A;  2E5K A;  1UEC A;  4RTU A;  1YWO A;  1ZUY A;  3VS4 A;  3EG0 A;  3I35 A;  2ABL A;  2EYZ A;  4RTX A;  3IQL A;  2EVR A;  1OV3 A;  2GBQ A;  2YSQ A;  4LUD A;  4R0K A;  5IXB A;  1X6B A;  2C0T A;  1WFW A;  1WIE A;  1PHT A;  1PRM C;  2CH4 A;  5EC7 A;  3M0Q A;  4DEY A;  4LN2 A;  2FRY A;  1AZE A;  2DL7 A;  2DF6 A;  3NHN A;  1UHF A;  2VVK A;  1JU5 C;  2X3W D;  2L3S A;  3GBQ A;  3EG2 A;  4F17 A;  1V1C A;  2FRW A;  1B07 A;  1PKS A;  4J9I A;  1AWO A;  1QLY A;  1WX6 A;  1AZG B;  2GTO A;  1T0H A;  4CC4 B;  3VS2 A;  3U23 A;  1S1N A;  1K9A A;  2FG0 A;  2F2W A;  2RQW A;  2EGA A;  1JXO A;  4K11 A;  3VRZ A;  2RMO A;  2CSI A;  2O2O A;  2EYW A;  5FWC A;  4JJD A;  2PZ1 A;  5GJV B;  2BZY A;  2CRE A;  1GBR A;  2LJ1 A;  3EHR A;  1NYG A;  1UHC A;  1JEG A;  4JPB W;  3I5S A;  1ZSG A;  2FEI A;  2A36 A;  3JV3 A;  2L2P A;  1Z9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...