2J7IA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterodimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j7iA00
4DEXA 1BB9A 2BZXA 2RQVA 2KRNA 2RQTA 1SRMA 1JXOA 4LN2A 4CC2A 1B07A 3I5SA 1NYGA 3O5ZA 5EC7A 3ZL7C 2RMOA 1AWJA 1H92A 1X2QA 1GFDA 2KXDA 2LNHB 2EQIA 1FYNA 1LCKA 1J3TA 4RTUA 3H0FA 1B3QA 1W70A 2L3PA 3EG1A 1RI9A 1PWTA 2ABLA 2ROLA 1I07A 1WXTA 1SEMA 2AKKA 1UUEA 2EBPA 3ULRB 5L23A 2MCNA 2RN8A 1QKXA 1SHFA 1K76A 1RLQC 3KFVA 3QWYA 3NPFA 1WXBA 4FSSA 4OMLA 4F14A 2JMCA 2KT8A 5FWBA 1SHGA 2DBMA 2EPDA 1M3AA 1UE9A 2C0OA 1CKBA 1GBRA 2YSQA 4JZ3A 2JS2A 4QT7A 2C0TA 1AOJA 3R6NA 4LUEA 3SHWA 5ECAA 2VVKA 1GCPA 1RLPC 2A08A 3NGPA 1NEGA 2F2XA 1W1FA 3EG2A 2M0YA 2CT3A 2JW4A 2ECZA 1W6XA 4RTZA 1NYFA 4HVUA 1WLPB 2DVJA 2F2VA 1T3LA 5FWCA 1GRIA 1VYVA 3CQTA 4JZ4A 1KJWA 1QKWA 4JPBW 1UTIA 2AKLA 1TUDA 1NM7A 4HXJA 1U06A 2D8HA 2J6OA 4K11A 4LE9A 2KNBB 2P4RA 4J9CA 4RTWA 5I11A 2J7IA 2RNAA 3U23A 1V1CA 2PZ1A 3RBBB 4HVVA 1PKTA 1UECA 2L2PA 2W0ZA 4IIMA 2DNUA 1UJ0A 3VRYA 2EYWA 1EFNA 1UHFA 4J9IA 3TSWA 2J05A 1MV0B 3EHQA 1ABQA 2A28A 3C0CA 2CSIA 5IHIA 1Z9QA 2K79A 2O9VA 1E6GA 1UJYA 2ED0A 2EYZA 2GNCA 2JMAA 1I1JA 2LP5A 2RQRA 2GBQA 4AFQC 3EG3A 4D8DA 2PTKA 3LH5A 3M0UA 4J9FA 3NHNA 1SSHA 2B86A 1JU5C 2K9GA 5IHNA 2RQWA 2FO0A 2RF0A 2LQNA 4AFUC 2LX7A 2CUDA 2LQWA 1ZX6A 2OI3A 4DEYA 3M0SA 2L0AA 3M0QA 3M0RA 2MOXA 1Z9ZA 2EKHA 2NWMA 2J6FA 2CUBA 2GQIA 1M3BA 3TVTA 5HCKA 1S1NA 1AWXA 1ZUUA 4KRTA 1K9AA 3PVLA 1PHTA 1X6BA 1BBZA 4J9DA 2RPNA 1WDXA 5GJVB 1YNZA 1M27C 2J06A 4GBQA 2A36A 2MIOA 2PNIA 2EGCA 1K4US 2YDLA 1AWOA 2KRSA 3M0PA 1PRLC 2LMJA 1UGVA 1UHCA 2HEQA 4Z88A 2KEAA 1IO6A 2L3QA 4X1VA 3H0IA 1KFZA 2H8HA 4RUGA 4CC3A 2JS0A 3PVQA 1AZGB 2DL3A 1JQQA 1XOVA 2YUPA 1OPKA 4RTYA 2X3WD 1OV3A 3NMZC 2DRKA 5IH2A 2FRWA 1WA7A 1I0CA 2JTEA 2O88A 3I35A 2KGTA 4Z89A 1WI7A 4J9EA 1VA7A 1HJDA 2GTOA 2X3XD 3UATA 2LJ3A 3VS4A 2ROTA 2DM1A 1OEBA 4D8KA 1U5SA 2I0NA 2ESWA 2CSQA 4JJBA 2YT6A 3EHRA 5GJWB 1X43A 2EVRA 1M8MA 3I5RA 2EW3A 3UA6A 1K0SA 1K0XA 4RTVA 4AG1C 2KR3A 3QWXX 2VKNA 4Y92A 2KROA 2RQUA 1GCQA 1NEBA 2ED1A 1H3HA 3EGUA 2O9SA 2JT4A 2C0IA 2DRMA 2DMOA 1G83A 1WXUA 2FEIA 3THKA 1ABOA 2YUNA 1E7OA 2BZYA 3VS0A 1KIKA 3REAB 4A63B 1KSWA 2DILA 1GCQC 1NLPC 4HCKA 2VWFA 1QCFA 4J9GA 1A0NB 5FW9A 3VS3A 1YCSB 2K7AA 2XMFA 1HD3A 4J9BA 4WCIA 2DL4A 2SEMA 2W10A 1K1ZA 1GL5A 2V1QA 2A37A 1QLYA 2D0NA 2KBTA 3FJ5A 1HSQA 1UDLA 1WYXA 2DBKA 1NG2A 2YUOA 3H0HA 1VYUA 2D1XA 2DE0X 2L3SA 2CH4A 1UG1A 1YWPA 1ZSGA 4J9HA 3RNJA 2ENMA 2CT4A 1RUWA 2JM9A 2O2OA 1GBQA 2EYYA 2DJQA 2KT1A 2OJ2A 1MUZA 2K6DA 2FPEA 3VS7A 1M3CA 2LJ0A 2LCSA 2DF6A 1H8KA 4JJCA 2G6FX 1AD5A 2JXBA 2K3BA 4OMPA 1JXMA 5I22A 2DYBA 2BTTA 3UA7A 4OMNA 2FPFA 2GTJA 3TSZA 3A98A 1TG0A 1G2BA 1BU1A 2LZ6B 1X6GA 2KYBA 4LUDA 1T0HA 4AFZC 1PKSA 2F2WA 1X69A 1MV3A 1TUCA 3UF4A 4AFSC 1ZUYA 2GGRA 1GFCA 1SPKA 2J6KA 2OAWA 2EGAA 2DL8A 2DX1A 1ZUKA 1ZLMA 1WFWA 2NUZA 4Z8AA 4ORZA 3I9QA 4JJDA 2KRMA 3REBB 4CC4B 1Y0MA 3EG0A 4RTTA 2O31A 2IIMA 2DLPA 1T3SA 2K2MA 5IXFA 2BZ8A 2KXCA 2AZSA 2HDAA 3M0TA 1ZBJA 2QDLA 5IHKA 2JM8A 2E5KA 3VS1A 2EGEA 3VS6A 1OOTA 3PE0A 3VRZA 2DL7A 4OMQA 1QWFA 4F16A 1YWOA 1VYTA 5IXBA 1JO8A 3VS5A 1AVZC 4GLMA 1UFFA 2KE9A 1JEGA 1FMKA 4RTXA 4EIKA 1X2KA 1N5ZA 3GBQA 2AZVA 1M30A 1ARKA 1YP5A 1OPLA 1QWEA 4ESRA 1AZEA 1YN8A 2FG0A 2KYMA 4OMMA 2LJ1A 2HSPA 2HCKA 3IQLA 4CC7A 4LNPA 2FRYA 1PRMC 1E6HA 2CDTA 2AK5A 4ZNXA 1BK2A 1WX6A 4M4ZA 1X27A 2YUQA 1CSKA 1U3OA 2DA9A 2CH4W 4IIOA 2HBWA 2EYXA 1PNJA 1NLOC 4R0KA 2V1RA 4F17A 1Y57A 4AG2C 1T0JA 1SRLA 2CREA 1AWWA 4HVWA 1WIEA 2M51A 3H41A 4OMOA 1AEYA 2DL5A 2SRCA 1CKAA 3SEMA 2D8JA 2FPDA 3JV3A 3VS2A 4E6RA
chains in the Genus database with same CATH superfamily
4DEXA 1BB9A 1TXQA 2CZ6B 3BDUA 3G71T 3M58A 4KGXB 1VQPT 2A3LA 3ME9A 1WQ7A 3OS5A 2VB6A 2MF2A 4XTZA 1QCOA 5CKHA 3HFOA 1YIJT 2CS7A 1WJQA 4RG2A 4A54A 4RMOA 2EQIA 1LCKA 1J3TA 3QXEB 2K5LA 2KVQG 5KE3A 3EG1A 1ZSZC 1XJWB 4IURA 1RI9A 1PWTA 1OULA 1WXTA 1UUEA 2MCNA 3V7CA 4BD3A 2QQSA 4JDSA 1NZ9A 5KE2A 3KFVA 3OMGA 3NPFA 3QWYA 4F14A 2KT8A 3HRTA 2NUTB 5FWBA 1D1BA 2R58A 3GNGA 2DBMA 2ZPIB 3NTIA 2COYA 5CKEA 1GBRA 4MDWA 1SSFA 3A5ZB 2C0TA 2EJ9A 4AT1B 4A4FA 1D0ZA 1YJNT 3M55A 4RG8A 1I5OB 4M75A 3NGPA 3RMSA 4M7AB 1TOVA 5CQXA 3CCVA 4OB0B 1Q7YU 2KK4A 1W6XA 1VQ5A 4HVUA 2DVJA 4E7HA 3OYDA 1KJWA 1QKWA 3CMET 2ZAEA 2AKLA 1NM7A 1OZ2A 4FT2A 4ATOA 4VUBA 3M59A 4QVZA 2RH2A 4BI4A 1QVFP 3QZ9B 4RTWA 2DD5A 2Y4XA 1K8AU 3JCMP 3RBBB 4PJOG 4HVVA 3C94A 2ATCB 2QK0A 2QI2A 3CCVQ 2MWOA 1VQ9T 4IIMA 2EYWA 3EGXB 1VQ5Q 4PJOD 3TSWA 4LDUA 3BDLA 4ZGJB 5IHIA 1Z9QA 2K79A 2O9VA 3CCST 1UJYA 2GNCA 4AFQC 2QA4A 2RQRA 2GBQA 2HQXA 2LT1A 3A8OB 1PC0A 2K4YA 3FIFA 3QYGB 3V7SA 3M5AA 1PG5B 1QCNA 1SSHA 3JRZA 2B86A 1M4ZA 1QVFS 4IUQA 4MZPA 1OYXA 4AFUC 2FL7A 2LQWA 5LJ5e 2OI3A 1HK9A 2LRQA 3MPUB 2L0AA 3M0QA 4M7DB 3OBWA 2MOXA 2NWMA 3CXCS 4BDZA 4XK8E 2PUOB 1S1NA 1AWXA 4KRTA 3PVLA 4J9DA 2QA4Q 2JZ2A 2HBPA 4KH1B 1WGSA 2J06A 2JJ9A 2MIOA 2PNIA 2KRSA 1AHJB 3A1PA 4Z88A 3OYGA 5LJ5f 2QTVA 1VQOT 2H8HA 4RUGA 2RO0A 3OYMA 2E4HA 3RESA 3LGFA 5GAOp 3CCRT 2Y4YA 3UWNA 2YUPA 2DJZA 2DETA 3FDRA 1OV3A 1S72T 3PIPA 2M02A 3VKIA 3SDZA 3TU4K 5AYFA 2AT1B 1WA7A 2RK2A 4C92F 2ZZDA 2KGTA 2E5QA 2GTOA 2KI7A 3ZBDA 4M75B 4BUGA 1QVFA 1PSEA 2DM1A 1U5SA 1D1AA 1F1BB 1RAIB 3UT1A 2GF7A 4ME7A 3JB9J 3I5RA 2EW3A 3JCMe 1BIAA 3CXCA 2NLUA 3GPLA 2KROA 5GMKh 2K3YA 1EZZB 1GCQA 1H3HA 2NYSA 2VGMA 2EIFA 1G83A 3THKA 3OBYA 1KG1A 5CO7A 1E7OA 3CMAA 1GCQC 4QKUA 4IUTA 3PMTA 3JCMQ 2DYIA 2QXFA 2KDSA 4FYVB 2HD0A 3BE3A 5D7UA 4M77A 3MEVA 4L5GA 4C8QA 1GL5A 2X4WA 3WVEB 5GANj 3OW2P 2DK3A 4CI0C 4C8QE 1BIBA 3FJ5A 3EH2A 1WYXA 1UDLA 2DBKA 1TTHB 1YI2T 3CCUA 2DE0X 4C8QC 1JJ2S 4AMCA 2M1HA 2ENMA 5CKDA 2JM9A 3CMAQ 2PVOB 5CCAA 3TQ7P 1GBQA 2VV5A 1K73U 3C12A 4OB1B 1M3CA 1BCMA 5GAOm 4X9CA 3MO8A 4C0DB 1KHIA 1JXMA 5KYUA 4J5YA 2DYBA 1H641 3RIRA 3AT1B 2WSCE 3A98A 1BU1A 5CVIA 3OW2S 2KYBA 4AFZC 5LJ5d 4NOYA 4FYWB 2K57A 3CCUQ 5DLQE 3PTAA 3G4SA 1GFCA 3LYIA 1KQSP 3QKJA 2HZYA 1BCOA 1VOMA 4KUIA 1N8RU 1JBMA 3I56T 4KT0E 4IUVA 3QJ6A 2COWA 2RJFA 4XTXA 4Z8AA 4PL6A 3E9FA 5GAMj 2KRMA 4OGCA 4GLKA 1OI1A 2KXCA 2AZSA 2HKQB 4M7AF 1N9RA 2XDDA 5I21A 3M56A 2RM4A 2E5KA 3V8KA 3VS6A 3G4SQ 2O4XA 4OMQA 2QEXA 1RAAB 1YWOA 1VYTA 1JJ2A 2CKKA 1JO8A 3I55T 1AVZC 3PIOA 2DXBA 1YBYA 2XICA 3GBQA 3QBYA 1RADB 1M30A 2QASA 1OPLA 2EJGA 2ZPBB 4OP0A 4C0FA 3SD4A 4M78A 4M78E 3O8VA 1D09B 2QGGA 4J8OA 2FRYA 3OW2A 1PRMC 1E6HA 4M78C 4ZGEB 2CDTA 3GF5A 1SG5A 1WJSA 3MHXA 3QPHA 2QEXQ 3JCMJ 1KQ1A 2F1LA 1BK2A 1WX6A 3JCMd 4FU6A 4DBFA 5HKCA 2OTLA 1OZ3A 3F70A 3CD6T 2H3JA 3RDVA 2QQ9A 2HBWA 1VQ4T 2V1RA 1M2VB 2AHJB 2E3HA 4F17A 1FWZA 1Y57A 3AHUA 4M77B 4BE1A 2QQBA 4HVWA 1JB0E 3JCMX 4BY6B 1IB8A 4B9XA 2DEUA 3CCMA 4M7DF 3E19A 2FPDA 3VS2A 3H8ZA 2KRNA 1NJIR 2OTLQ 5C0MA 1SRMA 1B07A 1KQSA 2VGNA 4DBQA 2P4TA 4FL6A 2RMOA 2QYZA 3HRSA 1GFDA 5DM7R 2KXDA 5KYUB 3ER0A 2CP7A 3RR6A 3UPUA 2CP6A 4RTUA 2WSFE 3H0FA 2LCCA 1Q81R 1VQKA 1Q7YR 1PSFA 3CCMQ 2NUTA 3QDRB 5CQYA 4C0ZA 3VV0A 2X4JA 2RN8A 4HA8A 1RLQC 4XQ3A 4FSSA 4FYXB 2XDPA 4PKCC 1VQ7A 4QVDA 1M3AA 1UE9A 1D0YA 1CKBA 3WXMB 5LJ5h 4M7AE 2JS2A 5LJ3e 4P5NA 1KD1R 2VVKA 3OQ5A 1GCPA 2PVGB 4M75F 1VQKQ 5J39A 1M1KU 4M7AC 3EG2A 4MZTA 2WSEE 3LGLA 3QUIA 1GRIA 4BACA 1V76A 2DXCA 3L2QA 3X28B 1G8XA 1VQ7Q 1TUDA 4Z02A 1U1SA 6AT1B 1MHNA 3VU3C 4K11A 4J9CA 5I11A 4NL2A 1M90R 2RNAA 2CP0A 3U23A 2QAZA 2PZ1A 1RAGB 3QDFA 2YXYA 1VQ5T 4PJNA 3ASKA 1PKTA 3G1JA 1M2OA 3P8BB 5KYWB 4ZTFA 1UJ0A 2HAXA 5FRMA 1Q82R 2HQHA 4DBHA 1IGUA 3CPWS 2E6ZA 3C0CA 1YFNA 5GAOn 1KC8R 1VQ8A 1E6GA 4ANJA 1VQLA 3EG3A 3CCJT 4D8DA 3LH5A 1K73C 2GFAA 5GANg 5IHNA 4MDXA 4M7DE 2B8AA 1Q86C 2RF0A 2LQNA 2CUDA 2E6NA 4DEYA 2RJEA 5I2MA 4JRPA 4M7DC 2KSSA 4F7UG 3PNWC 3L2RA 4PJOB 2J6FA 2JTMA 2CUBA 1M3BA 2RK1A 3HRUA 3FJPA 2LVMA 1R0BG 4MZMA 1VQ8Q 2D6FA 5FU7B 1WDXA 4UC4A 1N8RC 5GJVB 1VQLQ 1YNZA 1M27C 1RI0A 1K4US 1LOJA 2LQKA 1YITA 3M0PA 4LDYA 4C92G 5LJ3j 2ZPGB 1RABB 1UHCA 1ZA1B 1IO6A 2FZGB 5GMKl 4X1VA 1PCXA 2FB7A 4O5VA 1IGQA 1PD0A 4IUUA 4JS5A 1OX8A 3CCLA 1XOVA 2I2LA 3CPWA 2X3WD 4HT9A 3TCJA 4M75E 5IH2A 5GAMg 2FZCB 3OY9A 2OX7A 1WHHA 2JTEA 1YITQ 3CC4A 3I35A 1M8VA 1HJDA 2Z0WA 3CBMA 4M75C 1VQNA 3JCMg 2X3XD 2LJ3A 2ROTA 1BI3A 4RCBA 4D8KA 3EFSA 2ESWA 2I0NA 1I81A 2DTOA 1MMAA 1G5VA 4JJBA 4ELYC 3E9GA 3EFRA 3S3MA 1YHQA 5GAN7 5LJ3d 3HP9A 5GJWB 2JVVA 2EVRA 3UA6A 3CCLQ 1K0SA 1K0XA 1LJOA 4RTVA 4AG1C 2KR3A 3OYHA 2XKOC 2VKNA 4Y92A 5CKBA 3LWHA 4BE0A 1NEBA 8AT1B 2K5FA 3G6EA 2JT4A 5D6XA 3CC4Q 2FEIA 2IVWA 3CXCP 1ABOA 4PJJA 3DLLA 1VQNQ 2E70A 3REAB 1QCFA 1A0NB 1R77A 1YHQQ 2XMFA 3BY7A 1HD3A 1C1AA 2MWPA 4J9BA 4KGZB 2DL4A 2SEMA 4ZTJA 3QHSA 3SWNB 4M77F 4IUPA 3FB9A 3INZA 4C8QF 1QLYA 3LLRA 3OYBA 3G71A 2MYSA 3CMAT 3OMCA 2YUOA 2VXFA 3G6EQ 2D1XA 2KQWA 4E7SA 1YIJA 5FROA 1RUWA 5GANe 2COZA 3HPWA 1UB4A 2DJQA 2OJ2A 1MUZA 2K6DA 2FPEA 1WHMA 3MP1A 3ZFJA 4C0DC 1H8KA 1QP2A 1SKUB 3P8DA 2K3BA 4OMPA 4PLLA 1RAHB 2FPFA 3S3NA 2IG0A 3CCUT 1OU9A 2LZ6B 4LUDA 3G71Q 4X34A 1X69A 1DJ7B 3UF4A 2EYQA 1YIJQ 2V26A 1R0CB 4PFOA 5GANf 4QQDA 2JTFA 1ZLMA 2QG9B 1WFWA 4Y91A 1XTDA 2NUZA 3CBPA 3MEAA 4Y28E 1XQHA 1M1KC 4EMKB 2XK0A 2CP2A 1U1TA 4HCBA 2DLPA 1G3WA 1OQKA 3DLMA 3G4ST 2HDAA 2QDLA 4OMFB 2EGEA 5HY6A 3CMEA 1OOTA 3PE0A 3VRZA 5GAMe 1ZHIA 1VIFA 3CC7T 1KK7A 5KYYB 3X24B 3VS5A 8ATCB 3V8JA 1UFFA 1X2KA 2V8JA 1ARKA 3RUXA 1R8OB 4XTWA 1Y7XA 1YN8A 3MP6A 1GXIE 4M78F 1JJ2P 2LJ1A 3HSBA 1PD1A 2QEXT 2XG8D 4CC7A 4LNPA 2DEQA 3L2UA 3PGGA 2X4YA 3CMEQ 4C5EA 5GAMf 5HK0A 1VQMT 2CZ7B 2AK5A 3H6ZA 1WHJA 1M2VA 3MP8A 3JAME 3V7RA 3OYJA 1X27A 3JCMf 3QO3A 2R57A 4OB2B 1MMNA 1UGQB 1U3OA 4M77E 4QW2A 3GLXA 4IIOA 3QG1A 2VASA 1NLOC 3QSUA 4II1A 9ATCB 2QGFB 5IAYA 4XTYA 3BW1A 4M77C 1T0JA 1SRLA 3GIBA 3JCMc 1ZA2B 1AWWA 2M51A 4BY6C 2CP5A 4R56A 5C6SA 3PFSA 2GCXA 2OTLT 1CKAA 1EX4A 4PJOF 4E7ZA 1G3SA 2BZXA 2K5IA 2EKOA 2VXEA 1Q86U 5FRNA 2LNVA 2L8DA 1JXOA 2OAUA 2FVUA 4LN2A 4CC2A 2JN0A 1D0XA 3O5ZA 4N0AA 3EH1A 4FIBA 1K9MR 2DTIA 1D3BA 2DD4A 3JB9G 2LX9A 5GANd 3CCMT 1VQOA 1TUGB 1BI2A 1YJ9T 2RI3A 1B3QA 2L3PA 5KYNA 3S3OA 3OYYA 2DPPB 2ROLA 3JB9D 1I07A 3QJYA 4NL3A 1SEMA 3FC3A 2EBPA 5L23A 4OGEA 1QKXA 3CCQT 5LJ3g 4RKUE 1WXBA 4OMLA 4F7UA 3PT9A 5L8RE 1X6OA 1MNEA 4ELZC 4XTVA 1VQKT 2YSQA 1BYMA 4JZ3A 2EQJA 1VQOQ 1AOJA 3R6NA 3OYEA 5ECAA 2A08A 2E12A 1WJRA 2ZPHB 1XNIA 2F2XA 1Q81C 1Y96B 2A0FB 3HTRA 5GAN3 2DZCA 2CT3A 2JW4A 2LT4A 2ECZA 1VQ7T 4RCCA 1T3LA 2YRCA 1VYVA 3JCMb 1UTIA 3L2WA 2QQAA 3CC2A 3FRNA 5GAMd 2J6OA 5KYWA 3CEYA 3OB9A 4LE9A 2KNBB 2P4RA 1Y07A 2E1HA 2J7IA 5IT9E 2HSEB 4C5GA 4E7KA 2L2PA 2W0ZA 2YLBA 3J80E 2DNUA 2L5QA 3MEUA 4JUVA 3VRYA 1EFNA 1UHFA 4J9IA 5GAN2 2OTJA 2YLCA 2J05A 1YI2A 1MV0B 4J7IA 1X01A 1V29B 4MMKA 2A28A 3RKYA 2CSIA 3CC2Q 2HQEA 1BKBA 2JMAA 2LP5A 3L2ZA 3M0UA 4J9FA 3OS1A 3NHNA 3MCAB 5DY9A 4PJOA 1JU5C 1M90C 2RHXA 4PJOE 2FO0A 3OS2A 2LX7A 4OF1A 4DOWA 1ZX6A 3M0RA 4PJOC 1Z9ZA 2OTJQ 1Q82C 3T9NA 1VQ8T 1YI2Q 2DIGA 5FU6B 2RB6A 5HCKA 4WTOB 1PHTA 2X35A 1X6BA 5FU7C 3D7SB 1TWBA 1VIEA 2F5KA 2CZ1B 2V8IA 1QMCA 1W2BS 4GBQA 1D3BB 3HL8A 3JB9I 2VUBA 2YDLA 1PRLC 4B6MA 1NPRA 2HEQA 1FXXA 3EAEA 4L6V5 3H0IA 4CC3A 4FCYA 2JS0A 5DLOA 3OYNA 4HCZA 1QW1A 5GMKe 1JQQA 1K8AR 3S6WA 4RTYA 1OPKA 4F7UB 5GANh 2VYTA 1UGSB 1VUBA 3NMZC 5GAOl 4FSXA 2FRWA 3JCMV 3M4YA 2O88A 4A4GA 1WI7A 1WHGA 3MKDA 3CPWP 3NTKA 4Q5WA 1IREB 3HHTB 1UEBA 3CCLT 4LXCA 1H3ZA 2EQKA 3Q1JA 5EG2A 4C92B 2ZCFB 3EHRA 4XTUA 2RHUA 1C0MA 5LJ3f 4A53A 4M77G 3CCVT 1IRXA 3OYCA 4C8QG 3C95A 3HFNA 3CC4T 4OVAA 5A0DA 3RKWA 2EJFA 2EWNA 3PMIA 2RQUA 1VQNT 3OA6A 4R55A 4C0GA 3X25B 4C8QD 2C0IA 1W2BA 1VQ4A 3VUZA 1KHCA 2YUNA 3SWNA 3EGDA 2BZYA 3URGA 3VS0A 4DOVA 3M9QA 1NLPC 2VWFA 3OYLA 4J9GA 2CZ0B 2KY9A 3M53A 1YJWA 2KMTA 3SWNC 2W10A 1K1ZA 3OS0A 5GAMh 3G6ET 2P84A 2F69A 3L2VA 4FT4A 5CIUA 2D0NA 2C06A 5GAN4 4A4EA 3JCMh 1HSQA 5GAOr 1NG2A 4FM4B 1VYUA 2L3SA 3TEEA 1VQ4Q 2L89A 4J9HA 3CCEA 2MAMA 2DFUA 4FW2A 2X4XA 2QA4T 3P8HA 2RJDA 2EYYA 3LX7A 5J3BA 4BI8B 4OB3B 2DF6A 1YJWQ 2AIRB 2MK5A 5I22A 2BTTA 4OMNA 3TSZA 2DXTA 4N4GA 1G2BA 2P0KA 3KXTA 2XHCA 2DERA 1X6GA 5GMKj 1T0HA 1ZSZA 1RL2A 1PKSA 2F2WA 5D6YA 2RJCA 3DKMA 4JJNK 1SPKA 3CCEQ 3VUBA 4C92D 2J6KA 2BUDA 2OAWA 4B9WA 4EMKA 1M1FA 2BKDN 2DX1A 2E41A 3LH0A 4J7FA 4GY5A 5KCHA 2BE9B 2GFUA 4ORZA 4EMKC 4CC4B 4RTTA 1NJIU 2IIMA 1T3SA 2HMAA 3LW5E 5IXFA 2BZ8A 4M78G 2LDMA 5KYYA 2M9UA 3A8HB 3M0TA 1ZBJA 5IHKA 3QYHB 3VS1A 1N27A 2EFIA 1BI0A 4M78D 2KAFA 2CYZB 2DL7A 5GMKi 1QWFA 2DKGA 1Q81U 3QIIA 4XAXB 4GLMA 3FLGA 4RTXA 4EIKA 1N5ZA 2AZVA 1LPLA 1YP5A 1N9SA 4JRQA 4EMHA 2JOYA 2FG0A 2KYMA 3M57A 5KH6A 2HSPA 4HCCA 1NE8A 3L42A 4PFZA 2HCKA 1VQ6A 5FLXE 2DIQA 4F04B 2LQ8A 1FX7A 1K73R 3EG9A 4KBMB 1O9SA 3GP8A 3A8LB 2RI2A 1U8RA 4ZNXA 1Q86R 1KD1U 2E64A 5LL6S 3CCJA 2YUQA 3EGDB 4HT8A 4EDUA 4XU3A 4E7LA 1TH7A 4PNOA 2DA9A 2CH4W 3FEOA 4D6WA 4BI3A 2G3RA 4R0KA 4XU0A 1VQPA 4JS4A 4AG2C 1VQ6Q 1N8RR 4V2SA 2EQMA 3MJXA 3H41A 1EIFA 4OMOA 2DL5A 3SEMA 2D8JA 3JV3A 4E6RA 1M90U 1UGRB 1AT1B 3CCJQ 2RQVA 4EPCA 2XIDA 2RQTA 5GAN6 3I5SA 1NYGA 4PLIA 5GAOq 1QVPA 5EC7A 3ZL7C 3J7AF 1MMDA 3DB4A 1AWJA 1H92A 1Q82U 1QP3A 1X2QA 1VQPQ 4M7AG 3RERA 2LNHB 1WHKA 1FYNA 4HKEA 5A0GA 1KC8U 3G7ZA 2CP3A 1W70A 3VYHB 1ZSZB 4M7AD 4JRKA 2ABLA 4TVRA 1YJNA 2AKKA 3ULRB 1SHFA 2JNGA 3OSSC 1K76A 4KUDK 4J6YA 1ZQ1A 4JLGA 3RKXA 4F7UF 1KQ2A 2XU8A 2JMCA 4EMGA 3JSCA 1SHGA 4E2FB 2EPDA 1SF9A 4A4HA 2XD0A 1Y96A 2C0OA 3A8MB 1K9MC 4E7IA 2X9HA 4QT7A 1JRIA 4L59A 4LUEA 3HKSA 3SHWA 3UDCA 1WQWA 4ZGDB 1RLPC 1PM3A 3DB3A 2P0QA 1NEGA 1W1FA 2M0YA 3M54A 4XU1A 1YJNQ 1Y71A 2F5TX 2PUKB 2V8KA 1G3YA 2MPXC 4RTZA 1NYFA 3RMQA 1WLPB 2F2VA 5FWCA 4ZN3A 1VQ9A 3CQTA 2ZPFB 4JZ4A 5HK3A 1WNLA 4JPBW 3EFOA 4J6WA 3OYFA 4HXJA 5A0LA 1U06A 2D8HA 4E7JA 3M4GA 1ACMB 2X51A 5M9OA 1UGPB 2NUPA 1V1CA 4BB7A 4M7DG 3CCSA 1HYOA 3L1AA 5A2QE 2DO3A 1UECA 5LJ3h 1P92A 2WACA 3EG9B 3BFMA 4M7DD 3CBOA 1M9SA 3CC2T 1VQ9Q 2E65A 3MEWA 4KULA 3X20B 3EHQA 4KGVB 1ABQA 1YCYA 2DAQA 1RAFB 5LJ5j 3OYIA 2CGHA 2ED0A 2EYZA 3CPFA 4DA4A 1I1JA 2K2VA 4PK4A 2PTKA 4DBRA 3E1SA 2K9GA 3ZEHA 3CCSQ 4PFPA 2RQWA 2M16A 2OTJT 2HL5C 2FZKB 3M0SA 5GAN5 2EKHA 1TS9A 3SB2A 2GQIA 5FU6C 3TVTA 1FMVA 1ZUUA 1K9AA 1BBZA 1M1KR 2RPNA 1D1CA 4N0AC 1FMWA 4IKFA 1MMGA 3CCRA 4QQ6A 2O01E 4M75G 1Q95G 4NS5A 2E3IA 2A36A 2EGCA 4J83A 1AWOA 1M5Q1 4A4KA 3OYKA 2LMJA 1S72A 1UGVA 2H3EB 2GQVA 4M75D 5CK9A 1NJIC 2KEAA 2L3QA 5AT1B 1KFZA 4F7UE 2FHDA 1TU0B 2EAYA 2YRDA 2XI9A 3PVQA 1AZGB 2DL3A 2LC4A 5KYXA 3OSVA 1B34A 3QZ5B 1QVGP 3CC7A 5CAIA 2DZ9A 4BDYA 1I8FA 2MMPA 3CCRQ 2DRKA 1Q7YC 4J6XA 2E10A 1OU8A 4C92A 1I0CA 2RHZA 4Z89A 4J9EA 1VA7A 4C92E 1S72Q 1RAEB 2QQRA 3UATA 3VS4A 1OEBA 3X26B 2CSQA 2RD1A 2YT6A 4C92C 1W4SA 2LTOA 1KQSS 1X43A 4E47A 1M8MA 2QTXA 3GOXA 1VQMA 3CC7Q 1K8AC 1IHVA 3QWXX 3EFOB 1KD1C 4LDXA 1QVGS 2HKNA 5J26A 2QDYB 2ED1A 2PQWA 3EGUA 2O9SA 3JB9H 2DRMA 2DMOA 1WXUA 2NUPB 1QQJA 1KIKA 4LD6A 4A63B 1KSWA 3R6OA 2DILA 4XU2A 4HCKA 1G3TA 2Y90A 5FW9A 3VS3A 1YCSB 1BI1A 2K7AA 4PJLA 4WCIA 4QVCA 1W2BP 1IHWA 3LWIA 4FW1A 1VQMQ 2V1QA 2A37A 3META 3J81E 2KBTA 2RA2A 5GMKm 3H0HA 2PU9B 2HNIA 1IZ6A 1I5LA 2CH4A 4C8QB 1UG1A 1YWPA 1O75A 1ZSGA 2RHIA 3RNJA 2CT4A 2O2OA 1YJWT 1WHLA 1VQLT 2KT1A 1TSFA 1NBEB 3VS7A 1YJ9A 3H9NA 2LJ0A 2LCSA 4FYYB 3OYAA 4LDVA 4DQ2A 4JJCA 1KC8C 2G6FX 1AD5A 2JXBA 5CKFA 3UA7A 2DVEA 1WPYA 2GTJA 3I56A 3A8GB 1TG0A 2ZGWA 2IPOB 1B7TA 3C4SA 3E2UA 3CCET 2LCLA 3CCQA 2DXUA 1IXDA 1MV3A 1TUCA 2M0OA 1M1GA 4AFSC 2MI6A 1QVGA 1I4K1 3NTHA 1ZUYA 2GGRA 1LVKA 4X9DA 2EGAA 2DL8A 4YTLA 2RI5A 1ZUKA 5IN1A 1YJ9Q 4LDWA 3TREA 1MGQA 3I9QA 1YITT 2DTHA 4JJDA 3KBGA 2YWWA 3REBB 3I56Q 1Y0MA 3EG0A 3N5BB 2RHYA 4N4HA 5CR2A 2O31A 3I55A 2P0PA 3SFMA 2FYKA 2K2MA 5KYXB 1LNXA 3JCMW 4QQGA 1B34B 3CCQQ 4M7AA 3JB9F 2D0QB 4N4IA 1K9MU 2JM8A 1X75C 4CRIA 7AT1B 1NPPA 2ZPEB 1OX9A 2L3RA 3VJPA 4C5IA 4F16A 2BE7D 4LD9K 2VC8A 5IXBA 2KE9A 1JEGA 4O6JA 2D9TA 1FMKA 1HXDA 4BE2A 2O4XB 1QWEA 4WF2A 4ESRA 3I55Q 1AZEA 2PVDB 2YRVA 3CD6A 1N6AA 4M77D 4OMMA 4MMLA 2EQUA 3IQLA 2R5MA 3NFCA 1YHQT 4JRIA 1MNDA 3VYGA 2A7YA 3WVDB 5I2SA 1ZBXA 3EGXA 4M78B 4JLIA 4PJMA 4M4ZA 4ZN1A 1CSKA 1RACB 4KH0B 2BIVA 4C5HA 1C6VX 1VQ6T 2EYXA 1PNJA 5KCOA 3V8LA 3CD6Q 5GAN8 5D6WA 3GNFB 2CREA 2R5AA 2YHTA 1WIEA 1WZOA 2HL3A 5LJ5g 2XDBA 1AEYA 2JUFA 2SRCA 3KUFA 4M7DA 2K3XA
chains in the Genus database with same CATH topology
4DEXA 1BB9A 2BZXA 2RQVA 2KRNA 2RQTA 1SRMA 1JXOA 4LN2A 4CC2A 1B07A 3I5SA 1NYGA 3O5ZA 5EC7A 3ZL7C 2RMOA 1AWJA 1H92A 1X2QA 1GFDA 2KXDA 2LNHB 2EQIA 1FYNA 1LCKA 1J3TA 4RTUA 3H0FA 1B3QA 1W70A 2L3PA 3EG1A 1RI9A 1PWTA 2ABLA 2ROLA 1I07A 1WXTA 1SEMA 2AKKA 1UUEA 2EBPA 3ULRB 5L23A 2MCNA 2RN8A 1QKXA 1SHFA 1K76A 1RLQC 3KFVA 3QWYA 3NPFA 1WXBA 4FSSA 4OMLA 4F14A 2JMCA 2KT8A 5FWBA 1SHGA 2DBMA 2EPDA 1M3AA 1UE9A 2C0OA 1CKBA 1GBRA 2YSQA 4JZ3A 2JS2A 4QT7A 2C0TA 1AOJA 3R6NA 4LUEA 3SHWA 5ECAA 2VVKA 1GCPA 1RLPC 2A08A 3NGPA 1NEGA 2F2XA 1W1FA 3EG2A 2M0YA 2CT3A 2JW4A 2ECZA 1W6XA 4RTZA 1NYFA 4HVUA 1WLPB 2DVJA 2F2VA 1T3LA 5FWCA 1GRIA 1VYVA 3CQTA 4JZ4A 1KJWA 1QKWA 4JPBW 1UTIA 2AKLA 1TUDA 1NM7A 4HXJA 1U06A 2D8HA 2J6OA 4K11A 4LE9A 2KNBB 2P4RA 4J9CA 4RTWA 5I11A 2J7IA 2RNAA 3U23A 1V1CA 2PZ1A 3RBBB 4HVVA 1PKTA 1UECA 2L2PA 2W0ZA 4IIMA 2DNUA 1UJ0A 3VRYA 2EYWA 1EFNA 1UHFA 4J9IA 3TSWA 2J05A 1MV0B 3EHQA 1ABQA 2A28A 3C0CA 2CSIA 5IHIA 1Z9QA 2K79A 2O9VA 1E6GA 1UJYA 2ED0A 2EYZA 2GNCA 2JMAA 1I1JA 2LP5A 2RQRA 2GBQA 4AFQC 3EG3A 4D8DA 2PTKA 3LH5A 3M0UA 4J9FA 3NHNA 1SSHA 2B86A 1JU5C 2K9GA 5IHNA 2RQWA 2FO0A 2RF0A 2LQNA 4AFUC 2LX7A 2CUDA 2LQWA 1ZX6A 2OI3A 4DEYA 3M0SA 2L0AA 3M0QA 3M0RA 2MOXA 1Z9ZA 2EKHA 2NWMA 2J6FA 2CUBA 2GQIA 1M3BA 3TVTA 5HCKA 1S1NA 1AWXA 1ZUUA 4KRTA 1K9AA 3PVLA 1PHTA 1X6BA 1BBZA 4J9DA 2RPNA 1WDXA 5GJVB 1YNZA 1M27C 2J06A 4GBQA 2A36A 2MIOA 2PNIA 2EGCA 1K4US 2YDLA 1AWOA 2KRSA 3M0PA 1PRLC 2LMJA 1UGVA 1UHCA 2HEQA 4Z88A 2KEAA 1IO6A 2L3QA 4X1VA 3H0IA 1KFZA 2H8HA 4RUGA 4CC3A 2JS0A 3PVQA 1AZGB 2DL3A 1JQQA 1XOVA 2YUPA 1OPKA 4RTYA 2X3WD 1OV3A 3NMZC 2DRKA 5IH2A 2FRWA 1WA7A 1I0CA 2JTEA 2O88A 3I35A 2KGTA 4Z89A 1WI7A 4J9EA 1VA7A 1HJDA 2GTOA 2X3XD 3UATA 2LJ3A 3VS4A 2ROTA 2DM1A 1OEBA 4D8KA 1U5SA 2I0NA 2ESWA 2CSQA 4JJBA 2YT6A 3EHRA 5GJWB 1X43A 2EVRA 1M8MA 3I5RA 2EW3A 3UA6A 1K0SA 1K0XA 4RTVA 4AG1C 2KR3A 3QWXX 2VKNA 4Y92A 2KROA 2RQUA 1GCQA 1NEBA 2ED1A 1H3HA 3EGUA 2O9SA 2JT4A 2C0IA 2DRMA 2DMOA 1G83A 1WXUA 2FEIA 3THKA 1ABOA 2YUNA 1E7OA 2BZYA 3VS0A 1KIKA 3REAB 4A63B 1KSWA 2DILA 1GCQC 1NLPC 4HCKA 2VWFA 1QCFA 4J9GA 1A0NB 5FW9A 3VS3A 1YCSB 2K7AA 2XMFA 1HD3A 4J9BA 4WCIA 2DL4A 2SEMA 2W10A 1K1ZA 1GL5A 2V1QA 2A37A 1QLYA 2D0NA 2KBTA 3FJ5A 1HSQA 1UDLA 1WYXA 2DBKA 1NG2A 2YUOA 3H0HA 1VYUA 2D1XA 2DE0X 2L3SA 2CH4A 1UG1A 1YWPA 1ZSGA 4J9HA 3RNJA 2ENMA 2CT4A 1RUWA 2JM9A 2O2OA 1GBQA 2EYYA 2DJQA 2KT1A 2OJ2A 1MUZA 2K6DA 2FPEA 3VS7A 1M3CA 2LJ0A 2LCSA 2DF6A 1H8KA 4JJCA 2G6FX 1AD5A 2JXBA 2K3BA 4OMPA 1JXMA 5I22A 2DYBA 2BTTA 3UA7A 4OMNA 2FPFA 2GTJA 3TSZA 3A98A 1TG0A 1G2BA 1BU1A 2LZ6B 1X6GA 2KYBA 4LUDA 1T0HA 4AFZC 1PKSA 2F2WA 1X69A 1MV3A 1TUCA 3UF4A 4AFSC 1ZUYA 2GGRA 1GFCA 1SPKA 2J6KA 2OAWA 2EGAA 2DL8A 2DX1A 1ZUKA 1ZLMA 1WFWA 2NUZA 4Z8AA 4ORZA 3I9QA 4JJDA 2KRMA 3REBB 4CC4B 1Y0MA 3EG0A 4RTTA 2O31A 2IIMA 2DLPA 1T3SA 2K2MA 5IXFA 2BZ8A 2KXCA 2AZSA 2HDAA 3M0TA 1ZBJA 2QDLA 5IHKA 2JM8A 2E5KA 3VS1A 2EGEA 3VS6A 1OOTA 3PE0A 3VRZA 2DL7A 4OMQA 1QWFA 4F16A 1YWOA 1VYTA 5IXBA 1JO8A 3VS5A 1AVZC 4GLMA 1UFFA 2KE9A 1JEGA 1FMKA 4RTXA 4EIKA 1X2KA 1N5ZA 3GBQA 2AZVA 1M30A 1ARKA 1YP5A 1OPLA 1QWEA 4ESRA 1AZEA 1YN8A 2FG0A 2KYMA 4OMMA 2LJ1A 2HSPA 2HCKA 3IQLA 4CC7A 4LNPA 2FRYA 1PRMC 1E6HA 2CDTA 2AK5A 4ZNXA 1BK2A 1WX6A 4M4ZA 1X27A 2YUQA 1CSKA 1U3OA 2DA9A 2CH4W 4IIOA 2HBWA 2EYXA 1PNJA 1NLOC 4R0KA 2V1RA 4F17A 1Y57A 4AG2C 1T0JA 1SRLA 2CREA 1AWWA 4HVWA 1WIEA 2M51A 3H41A 4OMOA 1AEYA 2DL5A 2SRCA 1CKAA 3SEMA 2D8JA 2FPDA 3JV3A 3VS2A 4E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEX A;  1BB9 A;  2BZX A;  2RQV A;  2KRN A;  2RQT A;  1SRM A;  1JXO A;  4LN2 A;  4CC2 A;  1B07 A;  3I5S A;  1NYG A;  3O5Z A;  5EC7 A;  3ZL7 C;  2RMO A;  1AWJ A;  1H92 A;  1X2Q A;  1GFD A;  2KXD A;  2LNH B;  2EQI A;  1FYN A;  1LCK A;  1J3T A;  4RTU A;  3H0F A;  1B3Q A;  1W70 A;  2L3P A;  3EG1 A;  1RI9 A;  1PWT A;  2ABL A;  2ROL A;  1I07 A;  1WXT A;  1SEM A;  2AKK A;  1UUE A;  2EBP A;  3ULR B;  5L23 A;  2MCN A;  2RN8 A;  1QKX A;  1SHF A;  1K76 A;  1RLQ C;  3KFV A;  3QWY A;  3NPF A;  1WXB A;  4FSS A;  4OML A;  4F14 A;  2JMC A;  2KT8 A;  5FWB A;  1SHG A;  2DBM A;  2EPD A;  1M3A A;  1UE9 A;  2C0O A;  1CKB A;  1GBR A;  2YSQ A;  4JZ3 A;  2JS2 A;  4QT7 A;  2C0T A;  1AOJ A;  3R6N A;  4LUE A;  3SHW A;  5ECA A;  2VVK A;  1GCP A;  1RLP C;  2A08 A;  3NGP A;  1NEG A;  2F2X A;  1W1F A;  3EG2 A;  2M0Y A;  2CT3 A;  2JW4 A;  2ECZ A;  1W6X A;  4RTZ A;  1NYF A;  4HVU A;  1WLP B;  2DVJ A;  2F2V A;  1T3L A;  5FWC A;  1GRI A;  1VYV A;  3CQT A;  4JZ4 A;  1KJW A;  1QKW A;  4JPB W;  1UTI A;  2AKL A;  1TUD A;  1NM7 A;  4HXJ A;  1U06 A;  2D8H A;  2J6O A;  4K11 A;  4LE9 A;  2KNB B;  2P4R A;  4J9C A;  4RTW A;  5I11 A;  2J7I A;  2RNA A;  3U23 A;  1V1C A;  2PZ1 A;  3RBB B;  4HVV A;  1PKT A;  1UEC A;  2L2P A;  2W0Z A;  4IIM A;  2DNU A;  1UJ0 A;  3VRY A;  2EYW A;  1EFN A;  1UHF A;  4J9I A;  3TSW A;  2J05 A;  1MV0 B;  3EHQ A;  1ABQ A;  2A28 A;  3C0C A;  2CSI A;  5IHI A;  1Z9Q A;  2K79 A;  2O9V A;  1E6G A;  1UJY A;  2ED0 A;  2EYZ A;  2GNC A;  2JMA A;  1I1J A;  2LP5 A;  2RQR A;  2GBQ A;  4AFQ C;  3EG3 A;  4D8D A;  2PTK A;  3LH5 A;  3M0U A;  4J9F A;  3NHN A;  1SSH A;  2B86 A;  1JU5 C;  2K9G A;  5IHN A;  2RQW A;  2FO0 A;  2RF0 A;  2LQN A;  4AFU C;  2LX7 A;  2CUD A;  2LQW A;  1ZX6 A;  2OI3 A;  4DEY A;  3M0S A;  2L0A A;  3M0Q A;  3M0R A;  2MOX A;  1Z9Z A;  2EKH A;  2NWM A;  2J6F A;  2CUB A;  2GQI A;  1M3B A;  3TVT A;  5HCK A;  1S1N A;  1AWX A;  1ZUU A;  4KRT A;  1K9A A;  3PVL A;  1PHT A;  1X6B A;  1BBZ A;  4J9D A;  2RPN A;  1WDX A;  5GJV B;  1YNZ A;  1M27 C;  2J06 A;  4GBQ A;  2A36 A;  2MIO A;  2PNI A;  2EGC A;  1K4U S;  2YDL A;  1AWO A;  2KRS A;  3M0P A;  1PRL C;  2LMJ A;  1UGV A;  1UHC A;  2HEQ A;  4Z88 A;  2KEA A;  1IO6 A;  2L3Q A;  4X1V A;  3H0I A;  1KFZ A;  2H8H A;  4RUG A;  4CC3 A;  2JS0 A;  3PVQ A;  1AZG B;  2DL3 A;  1JQQ A;  1XOV A;  2YUP A;  1OPK A;  4RTY A;  2X3W D;  1OV3 A;  3NMZ C;  2DRK A;  5IH2 A;  2FRW A;  1WA7 A;  1I0C A;  2JTE A;  2O88 A;  3I35 A;  2KGT A;  4Z89 A;  1WI7 A;  4J9E A;  1VA7 A;  1HJD A;  2GTO A;  2X3X D;  3UAT A;  2LJ3 A;  3VS4 A;  2ROT A;  2DM1 A;  1OEB A;  4D8K A;  1U5S A;  2I0N A;  2ESW A;  2CSQ A;  4JJB A;  2YT6 A;  3EHR A;  5GJW B;  1X43 A;  2EVR A;  1M8M A;  3I5R A;  2EW3 A;  3UA6 A;  1K0S A;  1K0X A;  4RTV A;  4AG1 C;  2KR3 A;  3QWX X;  2VKN A;  4Y92 A;  2KRO A;  2RQU A;  1GCQ A;  1NEB A;  2ED1 A;  1H3H A;  3EGU A;  2O9S A;  2JT4 A;  2C0I A;  2DRM A;  2DMO A;  1G83 A;  1WXU A;  2FEI A;  3THK A;  1ABO A;  2YUN A;  1E7O A;  2BZY A;  3VS0 A;  1KIK A;  3REA B;  4A63 B;  1KSW A;  2DIL A;  1GCQ C;  1NLP C;  4HCK A;  2VWF A;  1QCF A;  4J9G A;  1A0N B;  5FW9 A;  3VS3 A;  1YCS B;  2K7A A;  2XMF A;  1HD3 A;  4J9B A;  4WCI A;  2DL4 A;  2SEM A;  2W10 A;  1K1Z A;  1GL5 A;  2V1Q A;  2A37 A;  1QLY A;  2D0N A;  2KBT A;  3FJ5 A;  1HSQ A;  1UDL A;  1WYX A;  2DBK A;  1NG2 A;  2YUO A;  3H0H A;  1VYU A;  2D1X A;  2DE0 X;  2L3S A;  2CH4 A;  1UG1 A;  1YWP A;  1ZSG A;  4J9H A;  3RNJ A;  2ENM A;  2CT4 A;  1RUW A;  2JM9 A;  2O2O A;  1GBQ A;  2EYY A;  2DJQ A;  2KT1 A;  2OJ2 A;  1MUZ A;  2K6D A;  2FPE A;  3VS7 A;  1M3C A;  2LJ0 A;  2LCS A;  2DF6 A;  1H8K A;  4JJC A;  2G6F X;  1AD5 A;  2JXB A;  2K3B A;  4OMP A;  1JXM A;  5I22 A;  2DYB A;  2BTT A;  3UA7 A;  4OMN A;  2FPF A;  2GTJ A;  3TSZ A;  3A98 A;  1TG0 A;  1G2B A;  1BU1 A;  2LZ6 B;  1X6G A;  2KYB A;  4LUD A;  1T0H A;  4AFZ C;  1PKS A;  2F2W A;  1X69 A;  1MV3 A;  1TUC A;  3UF4 A;  4AFS C;  1ZUY A;  2GGR A;  1GFC A;  1SPK A;  2J6K A;  2OAW A;  2EGA A;  2DL8 A;  2DX1 A;  1ZUK A;  1ZLM A;  1WFW A;  2NUZ A;  4Z8A A;  4ORZ A;  3I9Q A;  4JJD A;  2KRM A;  3REB B;  4CC4 B;  1Y0M A;  3EG0 A;  4RTT A;  2O31 A;  2IIM A;  2DLP A;  1T3S A;  2K2M A;  5IXF A;  2BZ8 A;  2KXC A;  2AZS A;  2HDA A;  3M0T A;  1ZBJ A;  2QDL A;  5IHK A;  2JM8 A;  2E5K A;  3VS1 A;  2EGE A;  3VS6 A;  1OOT A;  3PE0 A;  3VRZ A;  2DL7 A;  4OMQ A;  1QWF A;  4F16 A;  1YWO A;  1VYT A;  5IXB A;  1JO8 A;  3VS5 A;  1AVZ C;  4GLM A;  1UFF A;  2KE9 A;  1JEG A;  1FMK A;  4RTX A;  4EIK A;  1X2K A;  1N5Z A;  3GBQ A;  2AZV A;  1M30 A;  1ARK A;  1YP5 A;  1OPL A;  1QWE A;  4ESR A;  1AZE A;  1YN8 A;  2FG0 A;  2KYM A;  4OMM A;  2LJ1 A;  2HSP A;  2HCK A;  3IQL A;  4CC7 A;  4LNP A;  2FRY A;  1PRM C;  1E6H A;  2CDT A;  2AK5 A;  4ZNX A;  1BK2 A;  1WX6 A;  4M4Z A;  1X27 A;  2YUQ A;  1CSK A;  1U3O A;  2DA9 A;  2CH4 W;  4IIO A;  2HBW A;  2EYX A;  1PNJ A;  1NLO C;  4R0K A;  2V1R A;  4F17 A;  1Y57 A;  4AG2 C;  1T0J A;  1SRL A;  2CRE A;  1AWW A;  4HVW A;  1WIE A;  2M51 A;  3H41 A;  4OMO A;  1AEY A;  2DL5 A;  2SRC A;  1CKA A;  3SEM A;  2D8J A;  2FPD A;  3JV3 A;  3VS2 A;  4E6R A; 
#chains in the Genus database with same CATH topology
 4DEX A;  1BB9 A;  1TXQ A;  2CZ6 B;  3BDU A;  3G71 T;  3M58 A;  4KGX B;  1VQP T;  2A3L A;  3ME9 A;  1WQ7 A;  3OS5 A;  2VB6 A;  2MF2 A;  4XTZ A;  1QCO A;  5CKH A;  3HFO A;  1YIJ T;  2CS7 A;  1WJQ A;  4RG2 A;  4A54 A;  4RMO A;  2EQI A;  1LCK A;  1J3T A;  3QXE B;  2K5L A;  2KVQ G;  5KE3 A;  3EG1 A;  1ZSZ C;  1XJW B;  4IUR A;  1RI9 A;  1PWT A;  1OUL A;  1WXT A;  1UUE A;  2MCN A;  3V7C A;  4BD3 A;  2QQS A;  4JDS A;  1NZ9 A;  5KE2 A;  3KFV A;  3OMG A;  3NPF A;  3QWY A;  4F14 A;  2KT8 A;  3HRT A;  2NUT B;  5FWB A;  1D1B A;  2R58 A;  3GNG A;  2DBM A;  2ZPI B;  3NTI A;  2COY A;  5CKE A;  1GBR A;  4MDW A;  1SSF A;  3A5Z B;  2C0T A;  2EJ9 A;  4AT1 B;  4A4F A;  1D0Z A;  1YJN T;  3M55 A;  4RG8 A;  1I5O B;  4M75 A;  3NGP A;  3RMS A;  4M7A B;  1TOV A;  5CQX A;  3CCV A;  4OB0 B;  1Q7Y U;  2KK4 A;  1W6X A;  1VQ5 A;  4HVU A;  2DVJ A;  4E7H A;  3OYD A;  1KJW A;  1QKW A;  3CME T;  2ZAE A;  2AKL A;  1NM7 A;  1OZ2 A;  4FT2 A;  4ATO A;  4VUB A;  3M59 A;  4QVZ A;  2RH2 A;  4BI4 A;  1QVF P;  3QZ9 B;  4RTW A;  2DD5 A;  2Y4X A;  1K8A U;  3JCM P;  3RBB B;  4PJO G;  4HVV A;  3C94 A;  2ATC B;  2QK0 A;  2QI2 A;  3CCV Q;  2MWO A;  1VQ9 T;  4IIM A;  2EYW A;  3EGX B;  1VQ5 Q;  4PJO D;  3TSW A;  4LDU A;  3BDL A;  4ZGJ B;  5IHI A;  1Z9Q A;  2K79 A;  2O9V A;  3CCS T;  1UJY A;  2GNC A;  4AFQ C;  2QA4 A;  2RQR A;  2GBQ A;  2HQX A;  2LT1 A;  3A8O B;  1PC0 A;  2K4Y A;  3FIF A;  3QYG B;  3V7S A;  3M5A A;  1PG5 B;  1QCN A;  1SSH A;  3JRZ A;  2B86 A;  1M4Z A;  1QVF S;  4IUQ A;  4MZP A;  1OYX A;  4AFU C;  2FL7 A;  2LQW A;  5LJ5 e;  2OI3 A;  1HK9 A;  2LRQ A;  3MPU B;  2L0A A;  3M0Q A;  4M7D B;  3OBW A;  2MOX A;  2NWM A;  3CXC S;  4BDZ A;  4XK8 E;  2PUO B;  1S1N A;  1AWX A;  4KRT A;  3PVL A;  4J9D A;  2QA4 Q;  2JZ2 A;  2HBP A;  4KH1 B;  1WGS A;  2J06 A;  2JJ9 A;  2MIO A;  2PNI A;  2KRS A;  1AHJ B;  3A1P A;  4Z88 A;  3OYG A;  5LJ5 f;  2QTV A;  1VQO T;  2H8H A;  4RUG A;  2RO0 A;  3OYM A;  2E4H A;  3RES A;  3LGF A;  5GAO p;  3CCR T;  2Y4Y A;  3UWN A;  2YUP A;  2DJZ A;  2DET A;  3FDR A;  1OV3 A;  1S72 T;  3PIP A;  2M02 A;  3VKI A;  3SDZ A;  3TU4 K;  5AYF A;  2AT1 B;  1WA7 A;  2RK2 A;  4C92 F;  2ZZD A;  2KGT A;  2E5Q A;  2GTO A;  2KI7 A;  3ZBD A;  4M75 B;  4BUG A;  1QVF A;  1PSE A;  2DM1 A;  1U5S A;  1D1A A;  1F1B B;  1RAI B;  3UT1 A;  2GF7 A;  4ME7 A;  3JB9 J;  3I5R A;  2EW3 A;  3JCM e;  1BIA A;  3CXC A;  2NLU A;  3GPL A;  2KRO A;  5GMK h;  2K3Y A;  1EZZ B;  1GCQ A;  1H3H A;  2NYS A;  2VGM A;  2EIF A;  1G83 A;  3THK A;  3OBY A;  1KG1 A;  5CO7 A;  1E7O A;  3CMA A;  1GCQ C;  4QKU A;  4IUT A;  3PMT A;  3JCM Q;  2DYI A;  2QXF A;  2KDS A;  4FYV B;  2HD0 A;  3BE3 A;  5D7U A;  4M77 A;  3MEV A;  4L5G A;  4C8Q A;  1GL5 A;  2X4W A;  3WVE B;  5GAN j;  3OW2 P;  2DK3 A;  4CI0 C;  4C8Q E;  1BIB A;  3FJ5 A;  3EH2 A;  1WYX A;  1UDL A;  2DBK A;  1TTH B;  1YI2 T;  3CCU A;  2DE0 X;  4C8Q C;  1JJ2 S;  4AMC A;  2M1H A;  2ENM A;  5CKD A;  2JM9 A;  3CMA Q;  2PVO B;  5CCA A;  3TQ7 P;  1GBQ A;  2VV5 A;  1K73 U;  3C12 A;  4OB1 B;  1M3C A;  1BCM A;  5GAO m;  4X9C A;  3MO8 A;  4C0D B;  1KHI A;  1JXM A;  5KYU A;  4J5Y A;  2DYB A;  1H64 1;  3RIR A;  3AT1 B;  2WSC E;  3A98 A;  1BU1 A;  5CVI A;  3OW2 S;  2KYB A;  4AFZ C;  5LJ5 d;  4NOY A;  4FYW B;  2K57 A;  3CCU Q;  5DLQ E;  3PTA A;  3G4S A;  1GFC A;  3LYI A;  1KQS P;  3QKJ A;  2HZY A;  1BCO A;  1VOM A;  4KUI A;  1N8R U;  1JBM A;  3I56 T;  4KT0 E;  4IUV A;  3QJ6 A;  2COW A;  2RJF A;  4XTX A;  4Z8A A;  4PL6 A;  3E9F A;  5GAM j;  2KRM A;  4OGC A;  4GLK A;  1OI1 A;  2KXC A;  2AZS A;  2HKQ B;  4M7A F;  1N9R A;  2XDD A;  5I21 A;  3M56 A;  2RM4 A;  2E5K A;  3V8K A;  3VS6 A;  3G4S Q;  2O4X A;  4OMQ A;  2QEX A;  1RAA B;  1YWO A;  1VYT A;  1JJ2 A;  2CKK A;  1JO8 A;  3I55 T;  1AVZ C;  3PIO A;  2DXB A;  1YBY A;  2XIC A;  3GBQ A;  3QBY A;  1RAD B;  1M30 A;  2QAS A;  1OPL A;  2EJG A;  2ZPB B;  4OP0 A;  4C0F A;  3SD4 A;  4M78 A;  4M78 E;  3O8V A;  1D09 B;  2QGG A;  4J8O A;  2FRY A;  3OW2 A;  1PRM C;  1E6H A;  4M78 C;  4ZGE B;  2CDT A;  3GF5 A;  1SG5 A;  1WJS A;  3MHX A;  3QPH A;  2QEX Q;  3JCM J;  1KQ1 A;  2F1L A;  1BK2 A;  1WX6 A;  3JCM d;  4FU6 A;  4DBF A;  5HKC A;  2OTL A;  1OZ3 A;  3F70 A;  3CD6 T;  2H3J A;  3RDV A;  2QQ9 A;  2HBW A;  1VQ4 T;  2V1R A;  1M2V B;  2AHJ B;  2E3H A;  4F17 A;  1FWZ A;  1Y57 A;  3AHU A;  4M77 B;  4BE1 A;  2QQB A;  4HVW A;  1JB0 E;  3JCM X;  4BY6 B;  1IB8 A;  4B9X A;  2DEU A;  3CCM A;  4M7D F;  3E19 A;  2FPD A;  3VS2 A;  3H8Z A;  2KRN A;  1NJI R;  2OTL Q;  5C0M A;  1SRM A;  1B07 A;  1KQS A;  2VGN A;  4DBQ A;  2P4T A;  4FL6 A;  2RMO A;  2QYZ A;  3HRS A;  1GFD A;  5DM7 R;  2KXD A;  5KYU B;  3ER0 A;  2CP7 A;  3RR6 A;  3UPU A;  2CP6 A;  4RTU A;  2WSF E;  3H0F A;  2LCC A;  1Q81 R;  1VQK A;  1Q7Y R;  1PSF A;  3CCM Q;  2NUT A;  3QDR B;  5CQY A;  4C0Z A;  3VV0 A;  2X4J A;  2RN8 A;  4HA8 A;  1RLQ C;  4XQ3 A;  4FSS A;  4FYX B;  2XDP A;  4PKC C;  1VQ7 A;  4QVD A;  1M3A A;  1UE9 A;  1D0Y A;  1CKB A;  3WXM B;  5LJ5 h;  4M7A E;  2JS2 A;  5LJ3 e;  4P5N A;  1KD1 R;  2VVK A;  3OQ5 A;  1GCP A;  2PVG B;  4M75 F;  1VQK Q;  5J39 A;  1M1K U;  4M7A C;  3EG2 A;  4MZT A;  2WSE E;  3LGL A;  3QUI A;  1GRI A;  4BAC A;  1V76 A;  2DXC A;  3L2Q A;  3X28 B;  1G8X A;  1VQ7 Q;  1TUD A;  4Z02 A;  1U1S A;  6AT1 B;  1MHN A;  3VU3 C;  4K11 A;  4J9C A;  5I11 A;  4NL2 A;  1M90 R;  2RNA A;  2CP0 A;  3U23 A;  2QAZ A;  2PZ1 A;  1RAG B;  3QDF A;  2YXY A;  1VQ5 T;  4PJN A;  3ASK A;  1PKT A;  3G1J A;  1M2O A;  3P8B B;  5KYW B;  4ZTF A;  1UJ0 A;  2HAX A;  5FRM A;  1Q82 R;  2HQH A;  4DBH A;  1IGU A;  3CPW S;  2E6Z A;  3C0C A;  1YFN A;  5GAO n;  1KC8 R;  1VQ8 A;  1E6G A;  4ANJ A;  1VQL A;  3EG3 A;  3CCJ T;  4D8D A;  3LH5 A;  1K73 C;  2GFA A;  5GAN g;  5IHN A;  4MDX A;  4M7D E;  2B8A A;  1Q86 C;  2RF0 A;  2LQN A;  2CUD A;  2E6N A;  4DEY A;  2RJE A;  5I2M A;  4JRP A;  4M7D C;  2KSS A;  4F7U G;  3PNW C;  3L2R A;  4PJO B;  2J6F A;  2JTM A;  2CUB A;  1M3B A;  2RK1 A;  3HRU A;  3FJP A;  2LVM A;  1R0B G;  4MZM A;  1VQ8 Q;  2D6F A;  5FU7 B;  1WDX A;  4UC4 A;  1N8R C;  5GJV B;  1VQL Q;  1YNZ A;  1M27 C;  1RI0 A;  1K4U S;  1LOJ A;  2LQK A;  1YIT A;  3M0P A;  4LDY A;  4C92 G;  5LJ3 j;  2ZPG B;  1RAB B;  1UHC A;  1ZA1 B;  1IO6 A;  2FZG B;  5GMK l;  4X1V A;  1PCX A;  2FB7 A;  4O5V A;  1IGQ A;  1PD0 A;  4IUU A;  4JS5 A;  1OX8 A;  3CCL A;  1XOV A;  2I2L A;  3CPW A;  2X3W D;  4HT9 A;  3TCJ A;  4M75 E;  5IH2 A;  5GAM g;  2FZC B;  3OY9 A;  2OX7 A;  1WHH A;  2JTE A;  1YIT Q;  3CC4 A;  3I35 A;  1M8V A;  1HJD A;  2Z0W A;  3CBM A;  4M75 C;  1VQN A;  3JCM g;  2X3X D;  2LJ3 A;  2ROT A;  1BI3 A;  4RCB A;  4D8K A;  3EFS A;  2ESW A;  2I0N A;  1I81 A;  2DTO A;  1MMA A;  1G5V A;  4JJB A;  4ELY C;  3E9G A;  3EFR A;  3S3M A;  1YHQ A;  5GAN 7;  5LJ3 d;  3HP9 A;  5GJW B;  2JVV A;  2EVR A;  3UA6 A;  3CCL Q;  1K0S A;  1K0X A;  1LJO A;  4RTV A;  4AG1 C;  2KR3 A;  3OYH A;  2XKO C;  2VKN A;  4Y92 A;  5CKB A;  3LWH A;  4BE0 A;  1NEB A;  8AT1 B;  2K5F A;  3G6E A;  2JT4 A;  5D6X A;  3CC4 Q;  2FEI A;  2IVW A;  3CXC P;  1ABO A;  4PJJ A;  3DLL A;  1VQN Q;  2E70 A;  3REA B;  1QCF A;  1A0N B;  1R77 A;  1YHQ Q;  2XMF A;  3BY7 A;  1HD3 A;  1C1A A;  2MWP A;  4J9B A;  4KGZ B;  2DL4 A;  2SEM A;  4ZTJ A;  3QHS A;  3SWN B;  4M77 F;  4IUP A;  3FB9 A;  3INZ A;  4C8Q F;  1QLY A;  3LLR A;  3OYB A;  3G71 A;  2MYS A;  3CMA T;  3OMC A;  2YUO A;  2VXF A;  3G6E Q;  2D1X A;  2KQW A;  4E7S A;  1YIJ A;  5FRO A;  1RUW A;  5GAN e;  2COZ A;  3HPW A;  1UB4 A;  2DJQ A;  2OJ2 A;  1MUZ A;  2K6D A;  2FPE A;  1WHM A;  3MP1 A;  3ZFJ A;  4C0D C;  1H8K A;  1QP2 A;  1SKU B;  3P8D A;  2K3B A;  4OMP A;  4PLL A;  1RAH B;  2FPF A;  3S3N A;  2IG0 A;  3CCU T;  1OU9 A;  2LZ6 B;  4LUD A;  3G71 Q;  4X34 A;  1X69 A;  1DJ7 B;  3UF4 A;  2EYQ A;  1YIJ Q;  2V26 A;  1R0C B;  4PFO A;  5GAN f;  4QQD A;  2JTF A;  1ZLM A;  2QG9 B;  1WFW A;  4Y91 A;  1XTD A;  2NUZ A;  3CBP A;  3MEA A;  4Y28 E;  1XQH A;  1M1K C;  4EMK B;  2XK0 A;  2CP2 A;  1U1T A;  4HCB A;  2DLP A;  1G3W A;  1OQK A;  3DLM A;  3G4S T;  2HDA A;  2QDL A;  4OMF B;  2EGE A;  5HY6 A;  3CME A;  1OOT A;  3PE0 A;  3VRZ A;  5GAM e;  1ZHI A;  1VIF A;  3CC7 T;  1KK7 A;  5KYY B;  3X24 B;  3VS5 A;  8ATC B;  3V8J A;  1UFF A;  1X2K A;  2V8J A;  1ARK A;  3RUX A;  1R8O B;  4XTW A;  1Y7X A;  1YN8 A;  3MP6 A;  1GXI E;  4M78 F;  1JJ2 P;  2LJ1 A;  3HSB A;  1PD1 A;  2QEX T;  2XG8 D;  4CC7 A;  4LNP A;  2DEQ A;  3L2U A;  3PGG A;  2X4Y A;  3CME Q;  4C5E A;  5GAM f;  5HK0 A;  1VQM T;  2CZ7 B;  2AK5 A;  3H6Z A;  1WHJ A;  1M2V A;  3MP8 A;  3JAM E;  3V7R A;  3OYJ A;  1X27 A;  3JCM f;  3QO3 A;  2R57 A;  4OB2 B;  1MMN A;  1UGQ B;  1U3O A;  4M77 E;  4QW2 A;  3GLX A;  4IIO A;  3QG1 A;  2VAS A;  1NLO C;  3QSU A;  4II1 A;  9ATC B;  2QGF B;  5IAY A;  4XTY A;  3BW1 A;  4M77 C;  1T0J A;  1SRL A;  3GIB A;  3JCM c;  1ZA2 B;  1AWW A;  2M51 A;  4BY6 C;  2CP5 A;  4R56 A;  5C6S A;  3PFS A;  2GCX A;  2OTL T;  1CKA A;  1EX4 A;  4PJO F;  4E7Z A;  1G3S A;  2BZX A;  2K5I A;  2EKO A;  2VXE A;  1Q86 U;  5FRN A;  2LNV A;  2L8D A;  1JXO A;  2OAU A;  2FVU A;  4LN2 A;  4CC2 A;  2JN0 A;  1D0X A;  3O5Z A;  4N0A A;  3EH1 A;  4FIB A;  1K9M R;  2DTI A;  1D3B A;  2DD4 A;  3JB9 G;  2LX9 A;  5GAN d;  3CCM T;  1VQO A;  1TUG B;  1BI2 A;  1YJ9 T;  2RI3 A;  1B3Q A;  2L3P A;  5KYN A;  3S3O A;  3OYY A;  2DPP B;  2ROL A;  3JB9 D;  1I07 A;  3QJY A;  4NL3 A;  1SEM A;  3FC3 A;  2EBP A;  5L23 A;  4OGE A;  1QKX A;  3CCQ T;  5LJ3 g;  4RKU E;  1WXB A;  4OML A;  4F7U A;  3PT9 A;  5L8R E;  1X6O A;  1MNE A;  4ELZ C;  4XTV A;  1VQK T;  2YSQ A;  1BYM A;  4JZ3 A;  2EQJ A;  1VQO Q;  1AOJ A;  3R6N A;  3OYE A;  5ECA A;  2A08 A;  2E12 A;  1WJR A;  2ZPH B;  1XNI A;  2F2X A;  1Q81 C;  1Y96 B;  2A0F B;  3HTR A;  5GAN 3;  2DZC A;  2CT3 A;  2JW4 A;  2LT4 A;  2ECZ A;  1VQ7 T;  4RCC A;  1T3L A;  2YRC A;  1VYV A;  3JCM b;  1UTI A;  3L2W A;  2QQA A;  3CC2 A;  3FRN A;  5GAM d;  2J6O A;  5KYW A;  3CEY A;  3OB9 A;  4LE9 A;  2KNB B;  2P4R A;  1Y07 A;  2E1H A;  2J7I A;  5IT9 E;  2HSE B;  4C5G A;  4E7K A;  2L2P A;  2W0Z A;  2YLB A;  3J80 E;  2DNU A;  2L5Q A;  3MEU A;  4JUV A;  3VRY A;  1EFN A;  1UHF A;  4J9I A;  5GAN 2;  2OTJ A;  2YLC A;  2J05 A;  1YI2 A;  1MV0 B;  4J7I A;  1X01 A;  1V29 B;  4MMK A;  2A28 A;  3RKY A;  2CSI A;  3CC2 Q;  2HQE A;  1BKB A;  2JMA A;  2LP5 A;  3L2Z A;  3M0U A;  4J9F A;  3OS1 A;  3NHN A;  3MCA B;  5DY9 A;  4PJO A;  1JU5 C;  1M90 C;  2RHX A;  4PJO E;  2FO0 A;  3OS2 A;  2LX7 A;  4OF1 A;  4DOW A;  1ZX6 A;  3M0R A;  4PJO C;  1Z9Z A;  2OTJ Q;  1Q82 C;  3T9N A;  1VQ8 T;  1YI2 Q;  2DIG A;  5FU6 B;  2RB6 A;  5HCK A;  4WTO B;  1PHT A;  2X35 A;  1X6B A;  5FU7 C;  3D7S B;  1TWB A;  1VIE A;  2F5K A;  2CZ1 B;  2V8I A;  1QMC A;  1W2B S;  4GBQ A;  1D3B B;  3HL8 A;  3JB9 I;  2VUB A;  2YDL A;  1PRL C;  4B6M A;  1NPR A;  2HEQ A;  1FXX A;  3EAE A;  4L6V 5;  3H0I A;  4CC3 A;  4FCY A;  2JS0 A;  5DLO A;  3OYN A;  4HCZ A;  1QW1 A;  5GMK e;  1JQQ A;  1K8A R;  3S6W A;  4RTY A;  1OPK A;  4F7U B;  5GAN h;  2VYT A;  1UGS B;  1VUB A;  3NMZ C;  5GAO l;  4FSX A;  2FRW A;  3JCM V;  3M4Y A;  2O88 A;  4A4G A;  1WI7 A;  1WHG A;  3MKD A;  3CPW P;  3NTK A;  4Q5W A;  1IRE B;  3HHT B;  1UEB A;  3CCL T;  4LXC A;  1H3Z A;  2EQK A;  3Q1J A;  5EG2 A;  4C92 B;  2ZCF B;  3EHR A;  4XTU A;  2RHU A;  1C0M A;  5LJ3 f;  4A53 A;  4M77 G;  3CCV T;  1IRX A;  3OYC A;  4C8Q G;  3C95 A;  3HFN A;  3CC4 T;  4OVA A;  5A0D A;  3RKW A;  2EJF A;  2EWN A;  3PMI A;  2RQU A;  1VQN T;  3OA6 A;  4R55 A;  4C0G A;  3X25 B;  4C8Q D;  2C0I A;  1W2B A;  1VQ4 A;  3VUZ A;  1KHC A;  2YUN A;  3SWN A;  3EGD A;  2BZY A;  3URG A;  3VS0 A;  4DOV A;  3M9Q A;  1NLP C;  2VWF A;  3OYL A;  4J9G A;  2CZ0 B;  2KY9 A;  3M53 A;  1YJW A;  2KMT A;  3SWN C;  2W10 A;  1K1Z A;  3OS0 A;  5GAM h;  3G6E T;  2P84 A;  2F69 A;  3L2V A;  4FT4 A;  5CIU A;  2D0N A;  2C06 A;  5GAN 4;  4A4E A;  3JCM h;  1HSQ A;  5GAO r;  1NG2 A;  4FM4 B;  1VYU A;  2L3S A;  3TEE A;  1VQ4 Q;  2L89 A;  4J9H A;  3CCE A;  2MAM A;  2DFU A;  4FW2 A;  2X4X A;  2QA4 T;  3P8H A;  2RJD A;  2EYY A;  3LX7 A;  5J3B A;  4BI8 B;  4OB3 B;  2DF6 A;  1YJW Q;  2AIR B;  2MK5 A;  5I22 A;  2BTT A;  4OMN A;  3TSZ A;  2DXT A;  4N4G A;  1G2B A;  2P0K A;  3KXT A;  2XHC A;  2DER A;  1X6G A;  5GMK j;  1T0H A;  1ZSZ A;  1RL2 A;  1PKS A;  2F2W A;  5D6Y A;  2RJC A;  3DKM A;  4JJN K;  1SPK A;  3CCE Q;  3VUB A;  4C92 D;  2J6K A;  2BUD A;  2OAW A;  4B9W A;  4EMK A;  1M1F A;  2BKD N;  2DX1 A;  2E41 A;  3LH0 A;  4J7F A;  4GY5 A;  5KCH A;  2BE9 B;  2GFU A;  4ORZ A;  4EMK C;  4CC4 B;  4RTT A;  1NJI U;  2IIM A;  1T3S A;  2HMA A;  3LW5 E;  5IXF A;  2BZ8 A;  4M78 G;  2LDM A;  5KYY A;  2M9U A;  3A8H B;  3M0T A;  1ZBJ A;  5IHK A;  3QYH B;  3VS1 A;  1N27 A;  2EFI A;  1BI0 A;  4M78 D;  2KAF A;  2CYZ B;  2DL7 A;  5GMK i;  1QWF A;  2DKG A;  1Q81 U;  3QII A;  4XAX B;  4GLM A;  3FLG A;  4RTX A;  4EIK A;  1N5Z A;  2AZV A;  1LPL A;  1YP5 A;  1N9S A;  4JRQ A;  4EMH A;  2JOY A;  2FG0 A;  2KYM A;  3M57 A;  5KH6 A;  2HSP A;  4HCC A;  1NE8 A;  3L42 A;  4PFZ A;  2HCK A;  1VQ6 A;  5FLX E;  2DIQ A;  4F04 B;  2LQ8 A;  1FX7 A;  1K73 R;  3EG9 A;  4KBM B;  1O9S A;  3GP8 A;  3A8L B;  2RI2 A;  1U8R A;  4ZNX A;  1Q86 R;  1KD1 U;  2E64 A;  5LL6 S;  3CCJ A;  2YUQ A;  3EGD B;  4HT8 A;  4EDU A;  4XU3 A;  4E7L A;  1TH7 A;  4PNO A;  2DA9 A;  2CH4 W;  3FEO A;  4D6W A;  4BI3 A;  2G3R A;  4R0K A;  4XU0 A;  1VQP A;  4JS4 A;  4AG2 C;  1VQ6 Q;  1N8R R;  4V2S A;  2EQM A;  3MJX A;  3H41 A;  1EIF A;  4OMO A;  2DL5 A;  3SEM A;  2D8J A;  3JV3 A;  4E6R A;  1M90 U;  1UGR B;  1AT1 B;  3CCJ Q;  2RQV A;  4EPC A;  2XID A;  2RQT A;  5GAN 6;  3I5S A;  1NYG A;  4PLI A;  5GAO q;  1QVP A;  5EC7 A;  3ZL7 C;  3J7A F;  1MMD A;  3DB4 A;  1AWJ A;  1H92 A;  1Q82 U;  1QP3 A;  1X2Q A;  1VQP Q;  4M7A G;  3RER A;  2LNH B;  1WHK A;  1FYN A;  4HKE A;  5A0G A;  1KC8 U;  3G7Z A;  2CP3 A;  1W70 A;  3VYH B;  1ZSZ B;  4M7A D;  4JRK A;  2ABL A;  4TVR A;  1YJN A;  2AKK A;  3ULR B;  1SHF A;  2JNG A;  3OSS C;  1K76 A;  4KUD K;  4J6Y A;  1ZQ1 A;  4JLG A;  3RKX A;  4F7U F;  1KQ2 A;  2XU8 A;  2JMC A;  4EMG A;  3JSC A;  1SHG A;  4E2F B;  2EPD A;  1SF9 A;  4A4H A;  2XD0 A;  1Y96 A;  2C0O A;  3A8M B;  1K9M C;  4E7I A;  2X9H A;  4QT7 A;  1JRI A;  4L59 A;  4LUE A;  3HKS A;  3SHW A;  3UDC A;  1WQW A;  4ZGD B;  1RLP C;  1PM3 A;  3DB3 A;  2P0Q A;  1NEG A;  1W1F A;  2M0Y A;  3M54 A;  4XU1 A;  1YJN Q;  1Y71 A;  2F5T X;  2PUK B;  2V8K A;  1G3Y A;  2MPX C;  4RTZ A;  1NYF A;  3RMQ A;  1WLP B;  2F2V A;  5FWC A;  4ZN3 A;  1VQ9 A;  3CQT A;  2ZPF B;  4JZ4 A;  5HK3 A;  1WNL A;  4JPB W;  3EFO A;  4J6W A;  3OYF A;  4HXJ A;  5A0L A;  1U06 A;  2D8H A;  4E7J A;  3M4G A;  1ACM B;  2X51 A;  5M9O A;  1UGP B;  2NUP A;  1V1C A;  4BB7 A;  4M7D G;  3CCS A;  1HYO A;  3L1A A;  5A2Q E;  2DO3 A;  1UEC A;  5LJ3 h;  1P92 A;  2WAC A;  3EG9 B;  3BFM A;  4M7D D;  3CBO A;  1M9S A;  3CC2 T;  1VQ9 Q;  2E65 A;  3MEW A;  4KUL A;  3X20 B;  3EHQ A;  4KGV B;  1ABQ A;  1YCY A;  2DAQ A;  1RAF B;  5LJ5 j;  3OYI A;  2CGH A;  2ED0 A;  2EYZ A;  3CPF A;  4DA4 A;  1I1J A;  2K2V A;  4PK4 A;  2PTK A;  4DBR A;  3E1S A;  2K9G A;  3ZEH A;  3CCS Q;  4PFP A;  2RQW A;  2M16 A;  2OTJ T;  2HL5 C;  2FZK B;  3M0S A;  5GAN 5;  2EKH A;  1TS9 A;  3SB2 A;  2GQI A;  5FU6 C;  3TVT A;  1FMV A;  1ZUU A;  1K9A A;  1BBZ A;  1M1K R;  2RPN A;  1D1C A;  4N0A C;  1FMW A;  4IKF A;  1MMG A;  3CCR A;  4QQ6 A;  2O01 E;  4M75 G;  1Q95 G;  4NS5 A;  2E3I A;  2A36 A;  2EGC A;  4J83 A;  1AWO A;  1M5Q 1;  4A4K A;  3OYK A;  2LMJ A;  1S72 A;  1UGV A;  2H3E B;  2GQV A;  4M75 D;  5CK9 A;  1NJI C;  2KEA A;  2L3Q A;  5AT1 B;  1KFZ A;  4F7U E;  2FHD A;  1TU0 B;  2EAY A;  2YRD A;  2XI9 A;  3PVQ A;  1AZG B;  2DL3 A;  2LC4 A;  5KYX A;  3OSV A;  1B34 A;  3QZ5 B;  1QVG P;  3CC7 A;  5CAI A;  2DZ9 A;  4BDY A;  1I8F A;  2MMP A;  3CCR Q;  2DRK A;  1Q7Y C;  4J6X A;  2E10 A;  1OU8 A;  4C92 A;  1I0C A;  2RHZ A;  4Z89 A;  4J9E A;  1VA7 A;  4C92 E;  1S72 Q;  1RAE B;  2QQR A;  3UAT A;  3VS4 A;  1OEB A;  3X26 B;  2CSQ A;  2RD1 A;  2YT6 A;  4C92 C;  1W4S A;  2LTO A;  1KQS S;  1X43 A;  4E47 A;  1M8M A;  2QTX A;  3GOX A;  1VQM A;  3CC7 Q;  1K8A C;  1IHV A;  3QWX X;  3EFO B;  1KD1 C;  4LDX A;  1QVG S;  2HKN A;  5J26 A;  2QDY B;  2ED1 A;  2PQW A;  3EGU A;  2O9S A;  3JB9 H;  2DRM A;  2DMO A;  1WXU A;  2NUP B;  1QQJ A;  1KIK A;  4LD6 A;  4A63 B;  1KSW A;  3R6O A;  2DIL A;  4XU2 A;  4HCK A;  1G3T A;  2Y90 A;  5FW9 A;  3VS3 A;  1YCS B;  1BI1 A;  2K7A A;  4PJL A;  4WCI A;  4QVC A;  1W2B P;  1IHW A;  3LWI A;  4FW1 A;  1VQM Q;  2V1Q A;  2A37 A;  3MET A;  3J81 E;  2KBT A;  2RA2 A;  5GMK m;  3H0H A;  2PU9 B;  2HNI A;  1IZ6 A;  1I5L A;  2CH4 A;  4C8Q B;  1UG1 A;  1YWP A;  1O75 A;  1ZSG A;  2RHI A;  3RNJ A;  2CT4 A;  2O2O A;  1YJW T;  1WHL A;  1VQL T;  2KT1 A;  1TSF A;  1NBE B;  3VS7 A;  1YJ9 A;  3H9N A;  2LJ0 A;  2LCS A;  4FYY B;  3OYA A;  4LDV A;  4DQ2 A;  4JJC A;  1KC8 C;  2G6F X;  1AD5 A;  2JXB A;  5CKF A;  3UA7 A;  2DVE A;  1WPY A;  2GTJ A;  3I56 A;  3A8G B;  1TG0 A;  2ZGW A;  2IPO B;  1B7T A;  3C4S A;  3E2U A;  3CCE T;  2LCL A;  3CCQ A;  2DXU A;  1IXD A;  1MV3 A;  1TUC A;  2M0O A;  1M1G A;  4AFS C;  2MI6 A;  1QVG A;  1I4K 1;  3NTH A;  1ZUY A;  2GGR A;  1LVK A;  4X9D A;  2EGA A;  2DL8 A;  4YTL A;  2RI5 A;  1ZUK A;  5IN1 A;  1YJ9 Q;  4LDW A;  3TRE A;  1MGQ A;  3I9Q A;  1YIT T;  2DTH A;  4JJD A;  3KBG A;  2YWW A;  3REB B;  3I56 Q;  1Y0M A;  3EG0 A;  3N5B B;  2RHY A;  4N4H A;  5CR2 A;  2O31 A;  3I55 A;  2P0P A;  3SFM A;  2FYK A;  2K2M A;  5KYX B;  1LNX A;  3JCM W;  4QQG A;  1B34 B;  3CCQ Q;  4M7A A;  3JB9 F;  2D0Q B;  4N4I A;  1K9M U;  2JM8 A;  1X75 C;  4CRI A;  7AT1 B;  1NPP A;  2ZPE B;  1OX9 A;  2L3R A;  3VJP A;  4C5I A;  4F16 A;  2BE7 D;  4LD9 K;  2VC8 A;  5IXB A;  2KE9 A;  1JEG A;  4O6J A;  2D9T A;  1FMK A;  1HXD A;  4BE2 A;  2O4X B;  1QWE A;  4WF2 A;  4ESR A;  3I55 Q;  1AZE A;  2PVD B;  2YRV A;  3CD6 A;  1N6A A;  4M77 D;  4OMM A;  4MML A;  2EQU A;  3IQL A;  2R5M A;  3NFC A;  1YHQ T;  4JRI A;  1MND A;  3VYG A;  2A7Y A;  3WVD B;  5I2S A;  1ZBX A;  3EGX A;  4M78 B;  4JLI A;  4PJM A;  4M4Z A;  4ZN1 A;  1CSK A;  1RAC B;  4KH0 B;  2BIV A;  4C5H A;  1C6V X;  1VQ6 T;  2EYX A;  1PNJ A;  5KCO A;  3V8L A;  3CD6 Q;  5GAN 8;  5D6W A;  3GNF B;  2CRE A;  2R5A A;  2YHT A;  1WIE A;  1WZO A;  2HL3 A;  5LJ5 g;  2XDB A;  1AEY A;  2JUF A;  2SRC A;  3KUF A;  4M7D A;  2K3X A; 
#chains in the Genus database with same CATH homology
 4DEX A;  1BB9 A;  2BZX A;  2RQV A;  2KRN A;  2RQT A;  1SRM A;  1JXO A;  4LN2 A;  4CC2 A;  1B07 A;  3I5S A;  1NYG A;  3O5Z A;  5EC7 A;  3ZL7 C;  2RMO A;  1AWJ A;  1H92 A;  1X2Q A;  1GFD A;  2KXD A;  2LNH B;  2EQI A;  1FYN A;  1LCK A;  1J3T A;  4RTU A;  3H0F A;  1B3Q A;  1W70 A;  2L3P A;  3EG1 A;  1RI9 A;  1PWT A;  2ABL A;  2ROL A;  1I07 A;  1WXT A;  1SEM A;  2AKK A;  1UUE A;  2EBP A;  3ULR B;  5L23 A;  2MCN A;  2RN8 A;  1QKX A;  1SHF A;  1K76 A;  1RLQ C;  3KFV A;  3QWY A;  3NPF A;  1WXB A;  4FSS A;  4OML A;  4F14 A;  2JMC A;  2KT8 A;  5FWB A;  1SHG A;  2DBM A;  2EPD A;  1M3A A;  1UE9 A;  2C0O A;  1CKB A;  1GBR A;  2YSQ A;  4JZ3 A;  2JS2 A;  4QT7 A;  2C0T A;  1AOJ A;  3R6N A;  4LUE A;  3SHW A;  5ECA A;  2VVK A;  1GCP A;  1RLP C;  2A08 A;  3NGP A;  1NEG A;  2F2X A;  1W1F A;  3EG2 A;  2M0Y A;  2CT3 A;  2JW4 A;  2ECZ A;  1W6X A;  4RTZ A;  1NYF A;  4HVU A;  1WLP B;  2DVJ A;  2F2V A;  1T3L A;  5FWC A;  1GRI A;  1VYV A;  3CQT A;  4JZ4 A;  1KJW A;  1QKW A;  4JPB W;  1UTI A;  2AKL A;  1TUD A;  1NM7 A;  4HXJ A;  1U06 A;  2D8H A;  2J6O A;  4K11 A;  4LE9 A;  2KNB B;  2P4R A;  4J9C A;  4RTW A;  5I11 A;  2J7I A;  2RNA A;  3U23 A;  1V1C A;  2PZ1 A;  3RBB B;  4HVV A;  1PKT A;  1UEC A;  2L2P A;  2W0Z A;  4IIM A;  2DNU A;  1UJ0 A;  3VRY A;  2EYW A;  1EFN A;  1UHF A;  4J9I A;  3TSW A;  2J05 A;  1MV0 B;  3EHQ A;  1ABQ A;  2A28 A;  3C0C A;  2CSI A;  5IHI A;  1Z9Q A;  2K79 A;  2O9V A;  1E6G A;  1UJY A;  2ED0 A;  2EYZ A;  2GNC A;  2JMA A;  1I1J A;  2LP5 A;  2RQR A;  2GBQ A;  4AFQ C;  3EG3 A;  4D8D A;  2PTK A;  3LH5 A;  3M0U A;  4J9F A;  3NHN A;  1SSH A;  2B86 A;  1JU5 C;  2K9G A;  5IHN A;  2RQW A;  2FO0 A;  2RF0 A;  2LQN A;  4AFU C;  2LX7 A;  2CUD A;  2LQW A;  1ZX6 A;  2OI3 A;  4DEY A;  3M0S A;  2L0A A;  3M0Q A;  3M0R A;  2MOX A;  1Z9Z A;  2EKH A;  2NWM A;  2J6F A;  2CUB A;  2GQI A;  1M3B A;  3TVT A;  5HCK A;  1S1N A;  1AWX A;  1ZUU A;  4KRT A;  1K9A A;  3PVL A;  1PHT A;  1X6B A;  1BBZ A;  4J9D A;  2RPN A;  1WDX A;  5GJV B;  1YNZ A;  1M27 C;  2J06 A;  4GBQ A;  2A36 A;  2MIO A;  2PNI A;  2EGC A;  1K4U S;  2YDL A;  1AWO A;  2KRS A;  3M0P A;  1PRL C;  2LMJ A;  1UGV A;  1UHC A;  2HEQ A;  4Z88 A;  2KEA A;  1IO6 A;  2L3Q A;  4X1V A;  3H0I A;  1KFZ A;  2H8H A;  4RUG A;  4CC3 A;  2JS0 A;  3PVQ A;  1AZG B;  2DL3 A;  1JQQ A;  1XOV A;  2YUP A;  1OPK A;  4RTY A;  2X3W D;  1OV3 A;  3NMZ C;  2DRK A;  5IH2 A;  2FRW A;  1WA7 A;  1I0C A;  2JTE A;  2O88 A;  3I35 A;  2KGT A;  4Z89 A;  1WI7 A;  4J9E A;  1VA7 A;  1HJD A;  2GTO A;  2X3X D;  3UAT A;  2LJ3 A;  3VS4 A;  2ROT A;  2DM1 A;  1OEB A;  4D8K A;  1U5S A;  2I0N A;  2ESW A;  2CSQ A;  4JJB A;  2YT6 A;  3EHR A;  5GJW B;  1X43 A;  2EVR A;  1M8M A;  3I5R A;  2EW3 A;  3UA6 A;  1K0S A;  1K0X A;  4RTV A;  4AG1 C;  2KR3 A;  3QWX X;  2VKN A;  4Y92 A;  2KRO A;  2RQU A;  1GCQ A;  1NEB A;  2ED1 A;  1H3H A;  3EGU A;  2O9S A;  2JT4 A;  2C0I A;  2DRM A;  2DMO A;  1G83 A;  1WXU A;  2FEI A;  3THK A;  1ABO A;  2YUN A;  1E7O A;  2BZY A;  3VS0 A;  1KIK A;  3REA B;  4A63 B;  1KSW A;  2DIL A;  1GCQ C;  1NLP C;  4HCK A;  2VWF A;  1QCF A;  4J9G A;  1A0N B;  5FW9 A;  3VS3 A;  1YCS B;  2K7A A;  2XMF A;  1HD3 A;  4J9B A;  4WCI A;  2DL4 A;  2SEM A;  2W10 A;  1K1Z A;  1GL5 A;  2V1Q A;  2A37 A;  1QLY A;  2D0N A;  2KBT A;  3FJ5 A;  1HSQ A;  1UDL A;  1WYX A;  2DBK A;  1NG2 A;  2YUO A;  3H0H A;  1VYU A;  2D1X A;  2DE0 X;  2L3S A;  2CH4 A;  1UG1 A;  1YWP A;  1ZSG A;  4J9H A;  3RNJ A;  2ENM A;  2CT4 A;  1RUW A;  2JM9 A;  2O2O A;  1GBQ A;  2EYY A;  2DJQ A;  2KT1 A;  2OJ2 A;  1MUZ A;  2K6D A;  2FPE A;  3VS7 A;  1M3C A;  2LJ0 A;  2LCS A;  2DF6 A;  1H8K A;  4JJC A;  2G6F X;  1AD5 A;  2JXB A;  2K3B A;  4OMP A;  1JXM A;  5I22 A;  2DYB A;  2BTT A;  3UA7 A;  4OMN A;  2FPF A;  2GTJ A;  3TSZ A;  3A98 A;  1TG0 A;  1G2B A;  1BU1 A;  2LZ6 B;  1X6G A;  2KYB A;  4LUD A;  1T0H A;  4AFZ C;  1PKS A;  2F2W A;  1X69 A;  1MV3 A;  1TUC A;  3UF4 A;  4AFS C;  1ZUY A;  2GGR A;  1GFC A;  1SPK A;  2J6K A;  2OAW A;  2EGA A;  2DL8 A;  2DX1 A;  1ZUK A;  1ZLM A;  1WFW A;  2NUZ A;  4Z8A A;  4ORZ A;  3I9Q A;  4JJD A;  2KRM A;  3REB B;  4CC4 B;  1Y0M A;  3EG0 A;  4RTT A;  2O31 A;  2IIM A;  2DLP A;  1T3S A;  2K2M A;  5IXF A;  2BZ8 A;  2KXC A;  2AZS A;  2HDA A;  3M0T A;  1ZBJ A;  2QDL A;  5IHK A;  2JM8 A;  2E5K A;  3VS1 A;  2EGE A;  3VS6 A;  1OOT A;  3PE0 A;  3VRZ A;  2DL7 A;  4OMQ A;  1QWF A;  4F16 A;  1YWO A;  1VYT A;  5IXB A;  1JO8 A;  3VS5 A;  1AVZ C;  4GLM A;  1UFF A;  2KE9 A;  1JEG A;  1FMK A;  4RTX A;  4EIK A;  1X2K A;  1N5Z A;  3GBQ A;  2AZV A;  1M30 A;  1ARK A;  1YP5 A;  1OPL A;  1QWE A;  4ESR A;  1AZE A;  1YN8 A;  2FG0 A;  2KYM A;  4OMM A;  2LJ1 A;  2HSP A;  2HCK A;  3IQL A;  4CC7 A;  4LNP A;  2FRY A;  1PRM C;  1E6H A;  2CDT A;  2AK5 A;  4ZNX A;  1BK2 A;  1WX6 A;  4M4Z A;  1X27 A;  2YUQ A;  1CSK A;  1U3O A;  2DA9 A;  2CH4 W;  4IIO A;  2HBW A;  2EYX A;  1PNJ A;  1NLO C;  4R0K A;  2V1R A;  4F17 A;  1Y57 A;  4AG2 C;  1T0J A;  1SRL A;  2CRE A;  1AWW A;  4HVW A;  1WIE A;  2M51 A;  3H41 A;  4OMO A;  1AEY A;  2DL5 A;  2SRC A;  1CKA A;  3SEM A;  2D8J A;  2FPD A;  3JV3 A;  3VS2 A;  4E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...