2J7IA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterodimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j7iA00
2A28A 2GTOA 1UTIA 1UG1A 2ROLA 1HD3A 4JZ4A 1M27C 2FG0A 2O9VA 2LMJA 1PHTA 2O88A 2KRMA 4J9CA 2LJ0A 3M0TA 5GJWB 1E6GA 2OAWA 4RTVA 2K3BA 4J9BA 2DMOA 2GGRA 1BU1A 3UA7A 1HJDA 3NHNA 1X2KA 1G83A 4J9HA 1VYUA 1X27A 4LN2A 2FPEA 1GCPA 1CKBA 4OMLA 2YDLA 1AOJA 2XMFA 4IIOA 2F2XA 1W1FA 2A36A 2DILA 1WIEA 2J6KA 2DNUA 5ECAA 2KYBA 2OI3A 1H8KA 2VWFA 4CC7A 4OMNA 1X6GA 2C0IA 2KR3A 3VS0A 1NYGA 4X1VA 2V1QA 2CREA 4QT7A 1QCFA 1JXMA 1G2BA 1Z9QA 2EVRA 4F17A 1M3CA 1MV3A 3H41A 2B86A 2CSIA 5FWBA 1K0XA 2D8JA 4WCIA 2L3SA 4D8DA 1VYVA 4DEXA 2EYXA 4AFUC 2BZXA 1AWOA 1WX6A 2PZ1A 5IHIA 1Y0MA 4HXJA 3TSZA 1SHFA 2DBMA 1KFZA 4AFZC 3SHWA 2AKLA 4CC3A 5IH2A 2ABLA 2JM9A 4HVWA 2KNBB 4JPBW 2C0TA 3VS4A 2K79A 5I22A 1TUCA 1M30A 1E6HA 2FPFA 2A37A 3I35A 3VS2A 3CQTA 1GBRA 2ENMA 1K1ZA 4JZ3A 2EGCA 5L23A 1K0SA 1GCQC 2RQTA 3SEMA 1NG2A 4FSSA 1U06A 3I9QA 1SRLA 5IHNA 1ZUYA 1U5SA 2EKHA 1UGVA 1TG0A 2JMCA 3VRZA 1QLYA 5HCKA 4F16A 5GJVB 1MV0B 4KRTA 1NLPC 2DRMA 3QWXX 2SEMA 2VKNA 4M4ZA 2K7AA 1UJ0A 3THKA 2KROA 1LCKA 1WI7A 1VA7A 4RTYA 3LH5A 2W0ZA 2JXBA 1UECA 3QWYA 4J9GA 3UF4A 2ED1A 4J9EA 3NPFA 2LP5A 2CDTA 1JEGA 2CH4W 2E5KA 1KJWA 2J7IA 1Z9ZA 2IIMA 1SPKA 3I5RA 3VRYA 1B07A 2GQIA 3M0SA 2ESWA 1IO6A 5EC7A 3EHRA 2DJQA 1I1JA 2AK5A 2A08A 3VS3A 1UFFA 1FYNA 1PWTA 4LUEA 1GFCA 1PRMC 1M3BA 3UA6A 2JTEA 2DX1A 3H0IA 4CC4B 2O31A 4JJDA 1M8MA 2G6FX 2D8HA 1X2QA 2AKKA 2LJ3A 1CSKA 2DA9A 2YT6A 1OEBA 2GNCA 1AZGB 3NGPA 2ECZA 2JS0A 3FJ5A 1GRIA 4Z8AA 1TUDA 2D1XA 2FO0A 1HSQA 2D0NA 2KGTA 1Y57A 4Z88A 3M0PA 2LZ6B 1OPLA 2DLPA 1B3QA 1UE9A 2EGAA 4OMMA 2RQWA 4AFQC 1I07A 1H3HA 1AWWA 2DE0X 5IHKA 1ZUKA 1SRMA 2KT1A 1JU5C 4OMPA 1A0NB 1PNJA 2YSQA 1YP5A 2F2WA 3M0UA 1WDXA 2RPNA 3EG2A 5I11A 1ZX6A 4EIKA 2ED0A 1QKXA 1QKWA 2L2PA 2O2OA 1JO8A 1UUEA 4OMQA 2EYWA 1V1CA 2KE9A 2DL7A 2PNIA 1UHCA 1J3TA 2JM8A 2K9GA 2M51A 4A63B 2K2MA 4LUDA 2AZSA 1T3SA 2RQUA 2L3PA 1PKTA 2V1RA 1AZEA 4HVUA 1OPKA 4RTTA 4R0KA 2JMAA 2NUZA 2H8HA 2DBKA 1BBZA 2M0YA 2ROTA 1NLOC 2EQIA 1YWPA 1EFNA 2DL5A 3O5ZA 2GBQA 2RNAA 1M3AA 2RQVA 1WA7A 1KSWA 3R6NA 1GFDA 1T0JA 2K6DA 3I5SA 2LCSA 1NM7A 1WXBA 2HBWA 4RTUA 4D8KA 4F14A 4JJCA 3RNJA 2CT3A 1VYTA 4ZNXA 1QWEA 2KXCA 3VS7A 4GLMA 2VVKA 4RTWA 2EBPA 3PE0A 1W70A 3PVQA 2KRSA 3ULRB 2X3XD 1JQQA 2L3QA 1MUZA 4DEYA 2YUPA 2CH4A 2OJ2A 1W6XA 3EG1A 4LE9A 1GCQA 3EGUA 2RF0A 1ABQA 1WFWA 1FMKA 1YWOA 1QWFA 1ABOA 1X43A 2DF6A 1NEGA 1ZUUA 2KYMA 2J6FA 2DRKA 2J6OA 1WLPB 1SEMA 2RMOA 1RI9A 1WYXA 4E6RA 1T3LA 3RBBB 1X69A 5FW9A 2RN8A 4Y92A 1ARKA 2P4RA 1AEYA 1RUWA 3VS1A 4RTXA 3U23A 2CUDA 2BTTA 3TSWA 1PRLC 1RLPC 1YN8A 2FEIA 4HVVA 2MCNA 1ZBJA 2GTJA 2DVJA 2MIOA 3NMZC 2NWMA 1SHGA 2MOXA 1E7OA 1S1NA 2JW4A 5IXFA 2JS2A 1GL5A 1GBQA 2LNHB 1RLQC 3M0QA 2I0NA 3GBQA 2CT4A 4J9FA 4GBQA 1I0CA 1JXOA 2KBTA 1K76A 2FPDA 3PVLA 3A98A 3H0FA 4RUGA 2X3WD 1BB9A 3M0RA 1UJYA 3TVTA 4ORZA 2CSQA 2JT4A 3VS6A 2PTKA 1CKAA 2RQRA 1SSHA 4OMOA 1OV3A 2KT8A 4LNPA 5IXBA 3H0HA 4J9IA 2AZVA 3ZL7C 2HDAA 2LQNA 5FWCA 3REBB 1K9AA 2C0OA 2HCKA 3UATA 2BZYA 3REAB 1WXTA 3EHQA 2CUBA 1XOVA 4CC2A 1NYFA 3IQLA 4IIMA 2DL8A 2KRNA 2O9SA 2EPDA 1BK2A 1PKSA 1U3OA 2BZ8A 4AFSC 2QDLA 1OOTA 4K11A 3EG0A 4AG1C 1X6BA 1T0HA 1K4US 2FRWA 2W10A 4JJBA 2J05A 2DYBA 2F2VA 1N5ZA 2EGEA 4HCKA 3C0CA 1KIKA 3VS5A 1H92A 2HSPA 2L0AA 2YUQA 1AD5A 4Z89A 2FRYA 3EG3A 2LX7A 2YUNA 1AWXA 2EYYA 2HEQA 1UHFA 2DL3A 2DL4A 2EYZA 3KFVA 3JV3A 1ZLMA 4ESRA 4AG2C 1AVZC 2LJ1A 4RTZA 2SRCA 1ZSGA 2DM1A 1YNZA 2EW3A 2KEAA 1NEBA 1AWJA 2KXDA 1UDLA 1YCSB 4J9DA 2J06A 2LQWA 2YUOA 1WXUA
chains in the Genus database with same CATH superfamily
2A28A 1Y7XA 2RHXA 3V8LA 1HD3A 5IAYA 5HK3A 3JB9G 1EIFA 4N4IA 2LJ0A 3M0TA 3CC2T 3CPWP 1Q7YR 2DFUA 4OGCA 3X28B 2GGRA 1UGSB 3CCVQ 1HJDA 3CXCA 1G8XA 5CR2A 3CCST 1G83A 4BE2A 5CK9A 1XNIA 2PUOB 3JCMh 1MHNA 4BE0A 1CKBA 2Y90A 4MDXA 1AOJA 3MJXA 4C5IA 2XK0A 2A36A 2J6KA 3CCVA 2OI3A 2P0KA 1B34A 5LJ3h 4OMNA 1X6GA 3UWNA 4PFZA 2BE9B 2KR3A 5CCAA 2CREA 3I56T 3LW5E 3QZ5B 4C92B 1JXMA 2EJFA 1KQ2A 5FU6C 2FVUA 2WSCE 1M3CA 4JRPA 3A5ZB 2H3JA 4B9WA 5FWBA 3AHUA 4JRKA 3CCRT 2DJZA 1ZSZB 4AFUC 4IUUA 1OU9A 4HXJA 1WJQA 3OYLA 2ATCB 1VQMQ 5IH2A 4HVWA 4XQ3A 1WHLA 4E7ZA 2M9UA 3VS4A 1N8RR 2PUKB 3G6EA 3FIFA 1BCOA 1E6HA 2A37A 3CQTA 1NJIC 3CCJT 2PVOB 5LJ3j 2ENMA 2COZA 4JZ3A 2EGCA 1HXDA 5CKHA 1GCQC 2NUPB 4Y28E 1NG2A 1TUGB 2V8JA 4FSSA 3NTHA 5GAN5 1QW1A 1SRLA 1H3ZA 1UGVA 2JMCA 3VRZA 1IXDA 4JS5A 1VQ9T 1YCYA 2E64A 4PFOA 1NLPC 2MWPA 2VKNA 4M4ZA 3M55A 3GPLA 2OTJT 3THKA 1ACMB 2COYA 1WHJA 4PL6A 3EG9B 4GLKA 4M75C 4MZTA 2I2LA 1Q7YC 4HCBA 2ED1A 1WJSA 2WSEE 5GAMd 4J9EA 1XQHA 2CDTA 4M78G 1JEGA 2J7IA 3CCUQ 2V8KA 2EFIA 1SPKA 2RJDA 4QVZA 1ZSZC 3BDLA 4XTYA 4A4KA 3INZA 4PJLA 3QPHA 2A08A 2DETA 3OYNA 1HYOA 4C0DB 2QA4T 2QK0A 5KYXB 1VQOQ 1PRMC 1QVGP 3UA6A 2E1HA 4J6WA 4CC4B 2O31A 3CCLT 2G6FX 2D8HA 1D1CA 2DKGA 2DA9A 5KYYB 1OEBA 1AZGB 9ATCB 1GRIA 5AT1B 4Z8AA 1K9MU 1TUDA 2D1XA 2ZPGB 1YI2Q 2D0NA 2E6NA 3C95A 2K4YA 4Z88A 4M75D 3M0PA 1OPLA 2YHTA 1TH7A 2RHZA 3ZBDA 1I07A 1H3HA 1AWWA 2VYTA 3SFMA 2DE0X 1M2OA 2KT1A 3X24B 1B7TA 2JTFA 4OGEA 1PNJA 2V8IA 2YSQA 3E2UA 4IUQA 5DLOA 4M77F 4FYWB 3CCMA 1TWBA 1QMCA 2F2WA 3M0UA 4V2SA 1YI2A 5I11A 4QQDA 2KVQG 3CBOA 1ZA1B 1D3BA 5CQYA 3L2RA 3L42A 2O2OA 4KULA 4R55A 3CEYA 3QBYA 2XU8A 2YRCA 2EKOA 4OMQA 4PK4A 2CZ1B 4FYYB 2LC4A 1VQ4T 1UHCA 2QG9B 2JM8A 1N8RC 5CO7A 3LWIA 4NS5A 3UPUA 2QGGA 3ME9A 3GP8A 1KQSS 1RAAB 1AZEA 2PU9B 5GAMe 1G3TA 1OPKA 2CP5A 2B8AA 3BE3A 1VIFA 1YHQT 5GAN2 2M0YA 2EQIA 2RI2A 3KXTA 5AYFA 2VB6A 2CZ0B 2RNAA 5EG2A 5KE3A 4MZPA 1KSWA 3R6NA 3TREA 2XKOC 3M53A 1PSFA 1K8AU 4F14A 1VOMA 2X4XA 4F7UF 3AT1B 4C8QC 4XTZA 2RHIA 2LT1A 4PFPA 2VVKA 2EBPA 2QQSA 4M7DF 3JCMP 1IHVA 3PT9A 4NL2A 3PVQA 4NL3A 4ELYC 3ULRB 2NUTB 2L3QA 4ME7A 4DEYA 2CH4A 2CS7A 3LX7A 3MEVA 1JJ2P 1GCQA 1WFWA 5CAIA 2KAFA 3JCMd 1NEGA 3S3MA 3OYYA 4KGVB 2LDMA 1ZUUA 2QGFB 2KYMA 5I21A 2E5QA 2R5MA 5LJ5h 3MO8A 1VQNT 3V7CA 4C92F 3KBGA 1OU8A 4UC4A 4HT8A 2HQHA 4C8QD 1S72T 1AEYA 1RUWA 5LJ3g 3U23A 2CUDA 4M75A 5KH6A 1PRLC 1RLPC 2JUFA 4HVVA 2RI5A 2DVJA 1FX7A 2MIOA 3NMZC 1VQPT 3OYFA 4TVRA 1BCMA 1E7OA 2KK4A 4M78B 1ZSZA 4C0GA 1WQ7A 2JS2A 1IHWA 2LQ8A 2R58A 3JCMb 2E10A 1WHHA 1M90U 2ZCFB 2X3WD 1BB9A 1RI0A 1M8VA 4Y91A 3M0RA 1UJYA 3TVTA 2CSQA 2LTOA 2PTKA 5LJ5j 3OS1A 1CKAA 4J83A 2CP6A 3M4YA 4OMOA 1IGUA 4LNPA 5IXBA 4C8QE 3A8GB 4FM4B 3JCMV 1NPRA 2HDAA 3BY7A 2DD4A 2LQNA 3CCVT 1K9AA 2HCKA 1VQ9A 2P4TA 2ZPHB 1XOVA 3T9NA 4CC2A 3EGXA 3JCMe 1M2VB 1BI3A 3OYDA 3FJPA 2FYKA 2BZ8A 2EYQA 4AFSC 2YRDA 3CBPA 1MNEA 2KI7A 5GMKl 2QI2A 4GY5A 2GQVA 4PKCC 1KIKA 2FB7A 2WACA 2LX7A 2YUNA 1AWXA 2EYYA 2HEQA 5A2QE 4L6V5 3V7RA 2DL3A 2DL4A 5GAOl 2EYZA 4PJOF 2E3HA 2X4JA 4PNOA 4RTZA 2LJ1A 4VUBA 1BI2A 4WF2A 2HQEA 4QVCA 3CXCP 4C5GA 1IZ6A 5A0LA 1N6AA 3R6OA 4J9DA 3HSBA 3E1SA 3JB9F 1VQMT 3QDRB 4C8QA 1SKUB 1UTIA 4OP0A 1C1AA 4JZ4A 3MP6A 2FG0A 4B6MA 3OYCA 2O9VA 4KH0B 1PHTA 3J80E 1E6GA 2OAWA 4J9BA 2DMOA 4A4HA 3TEEA 2EJGA 1Q86U 2YWWA 4DBFA 4Q5WA 4RCBA 1LOJA 2YXYA 3HP9A 1FXXA 2DAQA 4ATOA 3JCMW 1OI1A 1VYUA 2CZ7B 1YHQQ 1X27A 2DTOA 4LN2A 2EIFA 2KY9A 3OW2S 1QVFS 5GANh 2LT4A 1M9SA 4M75G 1BKBA 2O01E 1IRXA 2DILA 2JN0A 5ECAA 5KCOA 4XTUA 3G71T 2VWFA 4CC7A 2HQXA 2C0IA 4E7KA 3VS0A 3VUBA 1NYGA 4E2FB 3QXEB 2V1QA 2D6FA 3CMEQ 1YHQA 1VUBA 1QCFA 3CCUT 2F69A 2EQJA 1G2BA 3M4GA 1Z9QA 2MMPA 4OF1A 3META 2EVRA 2DD5A 3PFSA 2B86A 3DLLA 3TCJA 4HCCA 2L3SA 1TU0B 4KUIA 1VQOT 2EWNA 3CMEA 2EYXA 2BZXA 1AWOA 4E7JA 3MEWA 1W2BS 1R0CB 2EAYA 1SHFA 2DBMA 4DBQA 3RKWA 1ZBXA 4ZTJA 4QKUA 3MP8A 3CMAT 4PLIA 5GAMf 5GANj 3WVDB 2KNBB 4MMLA 2JZ2A 1K73U 5I22A 4M77B 1M30A 2FPFA 3I35A 1Y71A 3ZFJA 4JRQA 4FYXB 3HFOA 1S72Q 3RKYA 1D09B 4EDUA 1K0SA 1VQ7T 2RQTA 3SEMA 3I9QA 1BI1A 2DTHA 5IHNA 1ZUYA 1ZHIA 1U5SA 2EKHA 1TG0A 1UB4A 1QLYA 4OB1B 2DRMA 2XDPA 4OMFB 5LJ5g 1S72A 3RMQA 2OAUA 1BIAA 2L89A 2LNVA 3EAEA 3QSUA 2RB6A 1VQPA 1KJWA 4RG8A 4J6YA 1Z9ZA 2IIMA 4KUDK 3FLGA 3VRYA 1B07A 5GMKe 4F7UB 2ESWA 3EHRA 2M1HA 1I1JA 2OX7A 3VS3A 2QQBA 1YFNA 5D7UA 3X25B 2A0FB 5KCHA 4M7DB 1GFCA 1D0XA 2XI9A 4M77C 1M8MA 1X2QA 3L2UA 1KC8R 2YT6A 2GNCA 4M7AG 4E7IA 2EQMA 1HSQA 1YIJQ 2KGTA 4ELZC 1N9RA 1B3QA 4L59A 5GMKm 2CYZB 3BDUA 4OMMA 4J8OA 2RQWA 2HNIA 3X20B 4JJNK 3P8DA 1M2VA 2NYSA 4J7FA 1YP5A 3QDFA 1NJIU 3GNFB 1RABB 2RPNA 5HK0A 1RADB 5GAOm 1N9SA 1YIJA 1QKXA 1QKWA 4E47A 1OYXA 1FWZA 3EFRA 1JO8A 3I55Q 2DL7A 2PNIA 3A8LB 1J3TA 3HRTA 2EQUA 3OSSC 4A63B 4M77D 1EZZB 2RQUA 2L3PA 1PKTA 1LJOA 2V1RA 4O6JA 1YITQ 4RTTA 4R0KA 2XG8D 3JCMf 3M9QA 3I55A 2DBKA 1TSFA 1IGQA 3M59A 1BBZA 2ROTA 1YWPA 1EFNA 1Q7YU 1VQMA 1QQJA 3G1JA 5CKDA 2LCSA 1WXBA 3EGDB 2HBWA 4RTUA 4D8KA 4MZMA 4BE1A 2CT3A 1U8RA 1VYTA 2DERA 3O8VA 4JLGA 1MMAA 2VV5A 1KG1A 1KHCA 2K3XA 4II1A 4QQGA 4C92C 3JB9J 2ZPFB 1JQQA 2AIRB 4M77E 3HRSA 5FROA 3G71Q 2YLBA 3EG1A 1MMNA 1RAHB 3OS2A 3EH1A 2COWA 4PJMA 5GAOn 1X43A 4FYVB 3OB9A 5CQXA 1VIEA 2DRKA 2J6FA 3G71A 1VQ6Q 1RI9A 2L3RA 1JBMA 5GANg 1KQ1A 2HD0A 3OYKA 2CP3A 3RBBB 1KC8C 4PJOB 1Y96B 4Y92A 5FRMA 2DO3A 3CCUA 3M56A 4EMGA 1TTHB 1UGPB 3TSWA 2XDDA 3CMAQ 3QYGB 3A8HB 2CP7A 4C92D 2GTJA 1VQ6A 1KQSA 3P8BB 2MOXA 1N8RU 3LWHA 4KT0E 3GIBA 1VQOA 4X34A 4F7UE 2RM4A 1GL5A 1GBQA 1RAFB 4Z02A 2HKQB 1NZ9A 1VQ7Q 1QP3A 4M7DE 3CMAA 2JVVA 4RUGA 2FPDA 3PVLA 3NFCA 1EX4A 4M77A 3VS6A 4ZGEB 1VQ7A 4ZGJB 3H0HA 3L1AA 2QEXQ 2IPOB 4KGZB 2HSEB 1QCOA 4XK8E 3REBB 3REAB 1WXTA 4C92E 2VXFA 4C0DC 5KYWB 1M1GA 3FDRA 1M5Q1 2DXBA 2XICA 4LDVA 4PJOC 2KRNA 1WJRA 1U3OA 2QEXA 1OOTA 3QO3A 1Q82R 3EG0A 3PGGA 2O4XB 1PG5B 3CPWS 3DB3A 1H92A 2P0PA 2L0AA 4A4EA 3CMET 2ZPIB 3RR6A 4F7UA 2DIGA 3OYEA 1WNLA 1V76A 2CP0A 5KYUB 1OX9A 2E65A 2QYZA 3KFVA 1ZLMA 1AVZC 3JCMX 1XJWB 1SF9A 2DM1A 1YNZA 3OQ5A 2KEAA 5A0GA 5GAOp 3V8KA 4XTXA 1NEBA 4BB7A 1AT1B 1AWJA 2P0QA 1UDLA 5J3BA 4PJOD 1WGSA 3FB9A 1RAGB 2FL7A 2ROLA 1M27C 5LJ3d 2PQWA 5GAN8 3ER0A 4C92A 3F70A 2O88A 1K8AC 3JB9D 4RTVA 2K3BA 4A4GA 3OMGA 1BU1A 1M1KR 3UA7A 5KE2A 3RIRA 5D6YA 1WQWA 3OYHA 2DXUA 2FZKB 4J9HA 4DA4A 1VQLQ 4M75F 3HTRA 4OMLA 2YDLA 4IIOA 4OVAA 4PJNA 2F2XA 1WIEA 2DNUA 1MNDA 2KYBA 3VYGA 1H8KA 4PJOE 3RDVA 4A54A 1I5OB 3P8HA 1Q81U 4JUVA 3TU4K 1I81A 4CRIA 4X1VA 1VQLA 4QT7A 1G3WA 2Y4XA 2NUPA 1KD1U 4HT9A 1MV3A 3H41A 3D7SB 1QVPA 2HBPA 4LDUA 3HL8A 3EGDA 3A8OB 2D8JA 4WCIA 2DZ9A 3VV0A 4DEXA 1Q82C 1OZ2A 1U1TA 5IHIA 1Y0MA 3WVEB 4PLLA 2ZAEA 4EMKB 1KFZA 1H641 2CGHA 2AKLA 3EG9A 1XTDA 4CC3A 1D0YA 3FRNA 4JPBW 3E9FA 2C0TA 1YIJT 1B34B 1TUCA 1TXQA 2RI3A 1RACB 5LJ3e 2MWOA 3UT1A 2XDBA 2BUDA 3NTKA 2P84A 2RD1A 4M78C 3EFSA 1QVGS 4LD9K 5D6WA 1U06A 1RAIB 4LDWA 2RJFA 3CC7Q 4FW2A 4C5EA 5KYXA 5HCKA 4PJOA 1TOVA 4DOVA 5GJVB 4KRTA 1V29B 3I55T 1BYMA 3OYGA 2SEMA 3RMSA 3EH2A 3OW2A 1QVFA 2DPPB 2K7AA 5IN1A 3UDCA 1UJ0A 5KYYA 1LCKA 4RTYA 2E3IA 1RL2A 3CC7A 3QWYA 4J9GA 3UF4A 3G4ST 1YITT 4RG2A 3NPFA 2LP5A 2BKDN 1M1KC 5DM7R 2JJ9A 2HAXA 2EJ9A 1PC0A 3M0SA 3A1PA 4E7HA 1X75C 1IO6A 5EC7A 4M78D 2DJQA 2AK5A 3QIIA 4EMKC 4P5NA 1FYNA 4RKUE 4LUEA 3JCMc 2EQKA 1M3BA 2JTEA 4M7AF 3H0IA 4XTVA 4MDWA 1W2BA 4KH1B 1BIBA 2AKKA 1AHJB 1CSKA 1X6OA 2LX9A 2K57A 3NGPA 2ECZA 2JS0A 3FJ5A 3GLXA 1Y57A 2LZ6B 2DLPA 2OTLQ 2EGAA 5CVIA 4AFQC 4ANJA 4L5GA 3J7AF 1ZUKA 1SRMA 4OMPA 1JU5C 1A0NB 5CIUA 1UGRB 1WDXA 2ED0A 4M78E 1VQ6T 1JRIA 1OULA 2HL5C 2L2PA 4X9DA 2VASA 5DY9A 2X4WA 2OTLA 2F5KA 2EYWA 1V1CA 4JRIA 5GAOr 1YJ9Q 2KE9A 2F1LA 2ZGWA 4LDYA 4JDSA 2XIDA 1MMDA 2K9GA 2M51A 1PCXA 5KYUA 1JJ2S 3FEOA 3PMTA 4D6WA 2AZSA 2CZ6B 5GAN4 2NUTA 1T3SA 1GXIE 5C6SA 3L2ZA 4A53A 4BACA 1I4K1 4KGXB 3OYBA 4HVUA 2NUZA 2H8HA 2K2VA 3S6WA 1YJ9A 3JSCA 2D9TA 2ZZDA 4XU1A 2DL5A 3O5ZA 2GBQA 2HKNA 3WXMB 1P92A 1WA7A 3MHXA 1T0JA 4FT2A 3QZ9B 2C06A 3BFMA 2R5AA 1NM7A 5D6XA 1D3BB 5LJ5d 4JJCA 2R57A 4LXCA 4ZNXA 1M1FA 4EMHA 4ZGDB 1QWEA 2K5IA 4RTWA 6AT1B 2QEXT 1W70A 4C0ZA 3OYMA 2KQWA 5FRNA 2MYSA 2BE7D 3FC3A 1MUZA 4J6XA 2E12A 3CC4Q 4LE9A 4M78A 5FU6B 3EGUA 2RF0A 1ABQA 1Y07A 1FMKA 3OY9A 1QWFA 1KQSP 3QUIA 3DLMA 1YJWQ 2J6OA 1SEMA 2RMOA 4C8QG 1PM3A 1WYXA 3C12A 4E6RA 3CC4A 1WHGA 1X69A 5FW9A 2RN8A 2P4RA 2Z0WA 1I5LA 3MKDA 1WHKA 5CKBA 3M57A 1OZ3A 2FEIA 2FHDA 1YJWA 4XU0A 4LDXA 2QTVA 5A0DA 2DIQA 3BW1A 1S1NA 1C6VX 5IXFA 2XHCA 1RLQC 1VQKT 2IVWA 3M0QA 5GAN3 2H3EB 4EMKA 3MP1A 3GBQA 4XTWA 4RMOA 3H8ZA 1TS9A 2QXFA 5CKEA 2KBTA 1K76A 3A98A 3H0FA 3CCQQ 4J5YA 2M16A 2MF2A 5LJ5e 1O9SA 1YJNQ 3EFOB 1MGQA 2Y4YA 2RQRA 3KUFA 4E7LA 3GOXA 4M75B 3ZL7C 4DBHA 1VQ5T 3CXCS 3H9NA 3CCQA 3C4SA 2BZYA 2GF7A 3G4SQ 3G6EQ 2CUBA 1YJNA 3NTIA 4M7DC 1VQLT 2E6ZA 4IIMA 2DL8A 3SB2A 2O9SA 2EPDA 2HZYA 3H6ZA 3URGA 4J7IA 2QDLA 4K11A 1WZOA 1T0HA 1K4US 4FCYA 2W10A 4JJBA 4N4HA 1K9MR 4FT4A 2J05A 5LJ3f 3JRZA 2DYBA 1N5ZA 3G4SA 1D0ZA 3SWNB 1YITA 3VYHB 1OX8A 1JB0E 3VS5A 4BDZA 4E7SA 2YUQA 1AD5A 4Z89A 3CCEQ 1KC8U 3JV3A 1R77A 3CBMA 2RK1A 2KDSA 4ESRA 4AG2C 2DK3A 4YTLA 1UEBA 2VGNA 4O5VA 2VUBA 4HCZA 3JAME 4M7DD 3CCEA 2K5FA 2X51A 3EGXB 4ZN3A 2KXDA 1YCSB 3JCMJ 1Q95G 1LVKA 1X01A 5GANd 3N5BB 2J06A 2LQWA 1WXUA 2GTOA 3VJPA 3TQ7P 1UG1A 2FZGB 3PNWC 5GAOq 1I8FA 2DXCA 2LMJA 5GAMg 2KRMA 1BI0A 4J9CA 2DEUA 2K3YA 3OBYA 4NOYA 5GJWB 3QYHB 1DJ7B 1YBYA 5KYNA 1MMGA 7AT1B 2MK5A 3LLRA 3NHNA 1D1BA 4N4GA 2QQRA 1K8AR 2KSSA 3CC7T 1X2KA 2QAZA 3OYIA 1ZQ1A 4XU2A 2AT1B 2FPEA 2LVMA 3SWNC 1GCPA 2XMFA 3OA6A 2RHYA 2V26A 8ATCB 1VQ8Q 3DB4A 4IUVA 1W1FA 3CCMQ 4C8QB 3CPWA 4QW2A 4IURA 2PVDB 1SSFA 2DYIA 1FMVA 1O75A 4EPCA 2BIVA 4WTOB 4B9XA 4M7AB 1VQ8A 3PMIA 4F17A 2WSFE 4DOWA 2CSIA 1K0XA 1ZA2B 1QCNA 2CP2A 5J26A 1G3SA 2X9HA 4D8DA 2RJEA 1VYVA 5HKCA 3PIOA 1K9MC 1WX6A 2PZ1A 3DKMA 3QKJA 3LH0A 3CD6Q 3TSZA 4F04B 2QQ9A 5GANe 1WHMA 4AFZC 3SHWA 2ABLA 3QJYA 2JM9A 2X4YA 2VXEA 2L5QA 3OSVA 2DXTA 2GCXA 2K79A 3L2QA 3OW2P 1QVFP 2ZPEB 5GAN7 3VS2A 4IKFA 1LPLA 3V8JA 2OTLT 5GMKh 1GBRA 4M75E 1KHIA 1K1ZA 5L23A 3CC2Q 3CD6A 1N27A 2GFAA 2IG0A 1M90R 2JTMA 1NBEB 4IUTA 4M7DA 3LGFA 3VKIA 3OMCA 2E41A 4C5HA 3CCSQ 1Q81R 4F16A 1MV0B 4C0FA 3QWXX 1VQKQ 1YJ9T 5C0MA 2K5LA 1KD1R 3CC2A 2L8DA 2KROA 1FMWA 1WI7A 1VA7A 2KMTA 4HA8A 4FL6A 2RH2A 5IT9E 3LH5A 2W0ZA 4BI3A 4M7AC 2JXBA 1UECA 3CCSA 4AMCA 3ZEHA 1W2BP 2F5TX 8AT1B 3I56Q 5FU7B 2E70A 3S3NA 2CH4W 2E5KA 4IUPA 4BY6B 3I5RA 1VQKA 3RKXA 2GQIA 4BI4A 3VUZA 2DEQA 5GMKj 2RHUA 1VQ5Q 3OYAA 3JCMg 1UFFA 1NE8A 1PD0A 2LCLA 1PWTA 3RERA 3CCRQ 2DTIA 3EFOA 2HMAA 3I56A 2DX1A 2JNGA 2LCCA 4JJDA 3HFNA 2MAMA 4DBRA 2LJ3A 3ASKA 1Q82U 3RUXA 2YLCA 1VQ5A 3A8MB 2AHJB 4LD6A 2FO0A 3QG1A 3RESA 3CC4T 3CCRA 4M7AD 3CCJQ 1UE9A 4N0AC 4ZN1A 4OB3B 3M5AA 3SD4A 5IHKA 1D1AA 1QVGA 2QTXA 1SG5A 3HRUA 3GNGA 5GMKi 5LJ5f 1YJWT 3EG2A 1ZX6A 4EIKA 5FLXE 3SWNA 1VQ9Q 5LL6S 1M4ZA 4M77G 1UUEA 3CCJA 2FZCB 4BDYA 4DQ2A 2OTJQ 5FU7C 1U1SA 2YRVA 4MMKA 4BY6C 2K2MA 4LUDA 4XAXB 1Q86R 2JOYA 3J81E 2QDYB 1C0MA 3PTAA 1R0BG 1OQKA 2JMAA 2QASA 3HKSA 1M90C 4M7AE 2DZCA 1NLOC 2OTJA 1UGQB 1Q81C 4OB0B 2VGMA 5I2MA 4CI0C 1M3AA 2RQVA 1M1KU 1GFDA 2QA4Q 2K6DA 1W4SA 3I5SA 3CCQT 1KD1C 3RNJA 1Y96A 2NLUA 1YJNT 2DVEA 2HL3A 2KXCA 2LQKA 2A7YA 2QQAA 3CCLQ 2VC8A 5HY6A 3VS7A 4GLMA 1IB8A 3V7SA 1R8OB 4F7UG 3M58A 3PE0A 3QJ6A 3JB9H 2KRSA 2X3XD 2QA4A 4M7DG 4JLIA 3JCMQ 2YUPA 2OJ2A 3C94A 1W6XA 3X26B 1RAEB 4AT1B 2GFUA 3CPFA 3G6ET 3E9GA 5J39A 3MEAA 4BD3A 3CCLA 3L2WA 3PIPA 1WPYA 1YWOA 4C8QF 1ABOA 2DF6A 4FU6A 2XD0A 2G3RA 1WLPB 5GAN6 3OS5A 1K73R 1T3LA 2E4HA 1ARKA 1VQ4Q 4A4FA 4C92G 3VS1A 3CCET 4RTXA 1JJ2A 2BTTA 4M7AA 5L8RE 3HHTB 4JS4A 1YN8A 1QP2A 2MCNA 3VU3C 5GAMh 1ZBJA 2CKKA 2NWMA 1SHGA 5KYWA 2JW4A 3SDZA 1PD1A 2M0OA 1VQ4A 3S3OA 2LNHB 2I0NA 2CT4A 4KBMB 3G7ZA 4J9FA 4GBQA 5CKFA 1I0CA 4R56A 1JXOA 4HKEA 2O4XA 1LNXA 2M02A 4ORZA 2JT4A 2LRQA 4BUGA 1Q86C 2RO0A 1SSHA 4FW1A 1OV3A 2KT8A 4RCCA 2X35A 4J9IA 3OYJA 2AZVA 5FWCA 1KK7A 2PVGB 4N0AA 2C0OA 3UATA 3LYIA 2ZPBB 4PJJA 2A3LA 3EHQA 4X9CA 5GAMj 4QQ6A 3Q1JA 3GF5A 3L2VA 1NYFA 3IQLA 5GANf 1BK2A 1PKSA 3JB9I 3M54A 4OB2B 1VQ8T 4AG1C 1X6BA 2FRWA 2RJCA 3CCMT 2D0QB 1YI2T 1VQNQ 2F2VA 3QHSA 3MPUB 4FSXA 2EGEA 4HCKA 3C0CA 2HSPA 5DLQE 3OS0A 2FRYA 3EG3A 2MI6A 1UHFA 1NJIR 3MCAB 4ZTFA 1G3YA 3HPWA 1VQPQ 4XU3A 1VQNA 3LGLA 1NPPA 2SRCA 1F1BB 1ZSGA 4QVDA 2MPXC 4PJOG 2EW3A 5I2SA 1HK9A 1IREB 2RK2A 3OBWA 5M9OA 1PSEA 2RA2A 1K73C 3CD6T 3MEUA 4FIBA 1G5VA 3E19A 2YUOA 4BI8B 4M78F
chains in the Genus database with same CATH topology
2A28A 2GTOA 1UTIA 1UG1A 2ROLA 1HD3A 4JZ4A 1M27C 2FG0A 2O9VA 2LMJA 1PHTA 2O88A 2KRMA 4J9CA 2LJ0A 3M0TA 5GJWB 1E6GA 2OAWA 4RTVA 2K3BA 4J9BA 2DMOA 2GGRA 1BU1A 3UA7A 1HJDA 3NHNA 1X2KA 1G83A 4J9HA 1VYUA 1X27A 4LN2A 2FPEA 1GCPA 1CKBA 4OMLA 2YDLA 1AOJA 2XMFA 4IIOA 2F2XA 1W1FA 2A36A 2DILA 1WIEA 2J6KA 2DNUA 5ECAA 2KYBA 2OI3A 1H8KA 2VWFA 4CC7A 4OMNA 1X6GA 2C0IA 2KR3A 3VS0A 1NYGA 4X1VA 2V1QA 2CREA 4QT7A 1QCFA 1JXMA 1G2BA 1Z9QA 2EVRA 4F17A 1M3CA 1MV3A 3H41A 2B86A 2CSIA 5FWBA 1K0XA 2D8JA 4WCIA 2L3SA 4D8DA 1VYVA 4DEXA 2EYXA 4AFUC 2BZXA 1AWOA 1WX6A 2PZ1A 5IHIA 1Y0MA 4HXJA 3TSZA 1SHFA 2DBMA 1KFZA 4AFZC 3SHWA 2AKLA 4CC3A 5IH2A 2ABLA 2JM9A 4HVWA 2KNBB 4JPBW 2C0TA 3VS4A 2K79A 5I22A 1TUCA 1M30A 1E6HA 2FPFA 2A37A 3I35A 3VS2A 3CQTA 1GBRA 2ENMA 1K1ZA 4JZ3A 2EGCA 5L23A 1K0SA 1GCQC 2RQTA 3SEMA 1NG2A 4FSSA 1U06A 3I9QA 1SRLA 5IHNA 1ZUYA 1U5SA 2EKHA 1UGVA 1TG0A 2JMCA 3VRZA 1QLYA 5HCKA 4F16A 5GJVB 1MV0B 4KRTA 1NLPC 2DRMA 3QWXX 2SEMA 2VKNA 4M4ZA 2K7AA 1UJ0A 3THKA 2KROA 1LCKA 1WI7A 1VA7A 4RTYA 3LH5A 2W0ZA 2JXBA 1UECA 3QWYA 4J9GA 3UF4A 2ED1A 4J9EA 3NPFA 2LP5A 2CDTA 1JEGA 2CH4W 2E5KA 1KJWA 2J7IA 1Z9ZA 2IIMA 1SPKA 3I5RA 3VRYA 1B07A 2GQIA 3M0SA 2ESWA 1IO6A 5EC7A 3EHRA 2DJQA 1I1JA 2AK5A 2A08A 3VS3A 1UFFA 1FYNA 1PWTA 4LUEA 1GFCA 1PRMC 1M3BA 3UA6A 2JTEA 2DX1A 3H0IA 4CC4B 2O31A 4JJDA 1M8MA 2G6FX 2D8HA 1X2QA 2AKKA 2LJ3A 1CSKA 2DA9A 2YT6A 1OEBA 2GNCA 1AZGB 3NGPA 2ECZA 2JS0A 3FJ5A 1GRIA 4Z8AA 1TUDA 2D1XA 2FO0A 1HSQA 2D0NA 2KGTA 1Y57A 4Z88A 3M0PA 2LZ6B 1OPLA 2DLPA 1B3QA 1UE9A 2EGAA 4OMMA 2RQWA 4AFQC 1I07A 1H3HA 1AWWA 2DE0X 5IHKA 1ZUKA 1SRMA 2KT1A 1JU5C 4OMPA 1A0NB 1PNJA 2YSQA 1YP5A 2F2WA 3M0UA 1WDXA 2RPNA 3EG2A 5I11A 1ZX6A 4EIKA 2ED0A 1QKXA 1QKWA 2L2PA 2O2OA 1JO8A 1UUEA 4OMQA 2EYWA 1V1CA 2KE9A 2DL7A 2PNIA 1UHCA 1J3TA 2JM8A 2K9GA 2M51A 4A63B 2K2MA 4LUDA 2AZSA 1T3SA 2RQUA 2L3PA 1PKTA 2V1RA 1AZEA 4HVUA 1OPKA 4RTTA 4R0KA 2JMAA 2NUZA 2H8HA 2DBKA 1BBZA 2M0YA 2ROTA 1NLOC 2EQIA 1YWPA 1EFNA 2DL5A 3O5ZA 2GBQA 2RNAA 1M3AA 2RQVA 1WA7A 1KSWA 3R6NA 1GFDA 1T0JA 2K6DA 3I5SA 2LCSA 1NM7A 1WXBA 2HBWA 4RTUA 4D8KA 4F14A 4JJCA 3RNJA 2CT3A 1VYTA 4ZNXA 1QWEA 2KXCA 3VS7A 4GLMA 2VVKA 4RTWA 2EBPA 3PE0A 1W70A 3PVQA 2KRSA 3ULRB 2X3XD 1JQQA 2L3QA 1MUZA 4DEYA 2YUPA 2CH4A 2OJ2A 1W6XA 3EG1A 4LE9A 1GCQA 3EGUA 2RF0A 1ABQA 1WFWA 1FMKA 1YWOA 1QWFA 1ABOA 1X43A 2DF6A 1NEGA 1ZUUA 2KYMA 2J6FA 2DRKA 2J6OA 1WLPB 1SEMA 2RMOA 1RI9A 1WYXA 4E6RA 1T3LA 3RBBB 1X69A 5FW9A 2RN8A 4Y92A 1ARKA 2P4RA 1AEYA 1RUWA 3VS1A 4RTXA 3U23A 2CUDA 2BTTA 3TSWA 1PRLC 1RLPC 1YN8A 2FEIA 4HVVA 2MCNA 1ZBJA 2GTJA 2DVJA 2MIOA 3NMZC 2NWMA 1SHGA 2MOXA 1E7OA 1S1NA 2JW4A 5IXFA 2JS2A 1GL5A 1GBQA 2LNHB 1RLQC 3M0QA 2I0NA 3GBQA 2CT4A 4J9FA 4GBQA 1I0CA 1JXOA 2KBTA 1K76A 2FPDA 3PVLA 3A98A 3H0FA 4RUGA 2X3WD 1BB9A 3M0RA 1UJYA 3TVTA 4ORZA 2CSQA 2JT4A 3VS6A 2PTKA 1CKAA 2RQRA 1SSHA 4OMOA 1OV3A 2KT8A 4LNPA 5IXBA 3H0HA 4J9IA 2AZVA 3ZL7C 2HDAA 2LQNA 5FWCA 3REBB 1K9AA 2C0OA 2HCKA 3UATA 2BZYA 3REAB 1WXTA 3EHQA 2CUBA 1XOVA 4CC2A 1NYFA 3IQLA 4IIMA 2DL8A 2KRNA 2O9SA 2EPDA 1BK2A 1PKSA 1U3OA 2BZ8A 4AFSC 2QDLA 1OOTA 4K11A 3EG0A 4AG1C 1X6BA 1T0HA 1K4US 2FRWA 2W10A 4JJBA 2J05A 2DYBA 2F2VA 1N5ZA 2EGEA 4HCKA 3C0CA 1KIKA 3VS5A 1H92A 2HSPA 2L0AA 2YUQA 1AD5A 4Z89A 2FRYA 3EG3A 2LX7A 2YUNA 1AWXA 2EYYA 2HEQA 1UHFA 2DL3A 2DL4A 2EYZA 3KFVA 3JV3A 1ZLMA 4ESRA 4AG2C 1AVZC 2LJ1A 4RTZA 2SRCA 1ZSGA 2DM1A 1YNZA 2EW3A 2KEAA 1NEBA 1AWJA 2KXDA 1UDLA 1YCSB 4J9DA 2J06A 2LQWA 2YUOA 1WXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A28 A;  2GTO A;  1UTI A;  1UG1 A;  2ROL A;  1HD3 A;  4JZ4 A;  1M27 C;  2FG0 A;  2O9V A;  2LMJ A;  1PHT A;  2O88 A;  2KRM A;  4J9C A;  2LJ0 A;  3M0T A;  5GJW B;  1E6G A;  2OAW A;  4RTV A;  2K3B A;  4J9B A;  2DMO A;  2GGR A;  1BU1 A;  3UA7 A;  1HJD A;  3NHN A;  1X2K A;  1G83 A;  4J9H A;  1VYU A;  1X27 A;  4LN2 A;  2FPE A;  1GCP A;  1CKB A;  4OML A;  2YDL A;  1AOJ A;  2XMF A;  4IIO A;  2F2X A;  1W1F A;  2A36 A;  2DIL A;  1WIE A;  2J6K A;  2DNU A;  5ECA A;  2KYB A;  2OI3 A;  1H8K A;  2VWF A;  4CC7 A;  4OMN A;  1X6G A;  2C0I A;  2KR3 A;  3VS0 A;  1NYG A;  4X1V A;  2V1Q A;  2CRE A;  4QT7 A;  1QCF A;  1JXM A;  1G2B A;  1Z9Q A;  2EVR A;  4F17 A;  1M3C A;  1MV3 A;  3H41 A;  2B86 A;  2CSI A;  5FWB A;  1K0X A;  2D8J A;  4WCI A;  2L3S A;  4D8D A;  1VYV A;  4DEX A;  2EYX A;  4AFU C;  2BZX A;  1AWO A;  1WX6 A;  2PZ1 A;  5IHI A;  1Y0M A;  4HXJ A;  3TSZ A;  1SHF A;  2DBM A;  1KFZ A;  4AFZ C;  3SHW A;  2AKL A;  4CC3 A;  5IH2 A;  2ABL A;  2JM9 A;  4HVW A;  2KNB B;  4JPB W;  2C0T A;  3VS4 A;  2K79 A;  5I22 A;  1TUC A;  1M30 A;  1E6H A;  2FPF A;  2A37 A;  3I35 A;  3VS2 A;  3CQT A;  1GBR A;  2ENM A;  1K1Z A;  4JZ3 A;  2EGC A;  5L23 A;  1K0S A;  1GCQ C;  2RQT A;  3SEM A;  1NG2 A;  4FSS A;  1U06 A;  3I9Q A;  1SRL A;  5IHN A;  1ZUY A;  1U5S A;  2EKH A;  1UGV A;  1TG0 A;  2JMC A;  3VRZ A;  1QLY A;  5HCK A;  4F16 A;  5GJV B;  1MV0 B;  4KRT A;  1NLP C;  2DRM A;  3QWX X;  2SEM A;  2VKN A;  4M4Z A;  2K7A A;  1UJ0 A;  3THK A;  2KRO A;  1LCK A;  1WI7 A;  1VA7 A;  4RTY A;  3LH5 A;  2W0Z A;  2JXB A;  1UEC A;  3QWY A;  4J9G A;  3UF4 A;  2ED1 A;  4J9E A;  3NPF A;  2LP5 A;  2CDT A;  1JEG A;  2CH4 W;  2E5K A;  1KJW A;  2J7I A;  1Z9Z A;  2IIM A;  1SPK A;  3I5R A;  3VRY A;  1B07 A;  2GQI A;  3M0S A;  2ESW A;  1IO6 A;  5EC7 A;  3EHR A;  2DJQ A;  1I1J A;  2AK5 A;  2A08 A;  3VS3 A;  1UFF A;  1FYN A;  1PWT A;  4LUE A;  1GFC A;  1PRM C;  1M3B A;  3UA6 A;  2JTE A;  2DX1 A;  3H0I A;  4CC4 B;  2O31 A;  4JJD A;  1M8M A;  2G6F X;  2D8H A;  1X2Q A;  2AKK A;  2LJ3 A;  1CSK A;  2DA9 A;  2YT6 A;  1OEB A;  2GNC A;  1AZG B;  3NGP A;  2ECZ A;  2JS0 A;  3FJ5 A;  1GRI A;  4Z8A A;  1TUD A;  2D1X A;  2FO0 A;  1HSQ A;  2D0N A;  2KGT A;  1Y57 A;  4Z88 A;  3M0P A;  2LZ6 B;  1OPL A;  2DLP A;  1B3Q A;  1UE9 A;  2EGA A;  4OMM A;  2RQW A;  4AFQ C;  1I07 A;  1H3H A;  1AWW A;  2DE0 X;  5IHK A;  1ZUK A;  1SRM A;  2KT1 A;  1JU5 C;  4OMP A;  1A0N B;  1PNJ A;  2YSQ A;  1YP5 A;  2F2W A;  3M0U A;  1WDX A;  2RPN A;  3EG2 A;  5I11 A;  1ZX6 A;  4EIK A;  2ED0 A;  1QKX A;  1QKW A;  2L2P A;  2O2O A;  1JO8 A;  1UUE A;  4OMQ A;  2EYW A;  1V1C A;  2KE9 A;  2DL7 A;  2PNI A;  1UHC A;  1J3T A;  2JM8 A;  2K9G A;  2M51 A;  4A63 B;  2K2M A;  4LUD A;  2AZS A;  1T3S A;  2RQU A;  2L3P A;  1PKT A;  2V1R A;  1AZE A;  4HVU A;  1OPK A;  4RTT A;  4R0K A;  2JMA A;  2NUZ A;  2H8H A;  2DBK A;  1BBZ A;  2M0Y A;  2ROT A;  1NLO C;  2EQI A;  1YWP A;  1EFN A;  2DL5 A;  3O5Z A;  2GBQ A;  2RNA A;  1M3A A;  2RQV A;  1WA7 A;  1KSW A;  3R6N A;  1GFD A;  1T0J A;  2K6D A;  3I5S A;  2LCS A;  1NM7 A;  1WXB A;  2HBW A;  4RTU A;  4D8K A;  4F14 A;  4JJC A;  3RNJ A;  2CT3 A;  1VYT A;  4ZNX A;  1QWE A;  2KXC A;  3VS7 A;  4GLM A;  2VVK A;  4RTW A;  2EBP A;  3PE0 A;  1W70 A;  3PVQ A;  2KRS A;  3ULR B;  2X3X D;  1JQQ A;  2L3Q A;  1MUZ A;  4DEY A;  2YUP A;  2CH4 A;  2OJ2 A;  1W6X A;  3EG1 A;  4LE9 A;  1GCQ A;  3EGU A;  2RF0 A;  1ABQ A;  1WFW A;  1FMK A;  1YWO A;  1QWF A;  1ABO A;  1X43 A;  2DF6 A;  1NEG A;  1ZUU A;  2KYM A;  2J6F A;  2DRK A;  2J6O A;  1WLP B;  1SEM A;  2RMO A;  1RI9 A;  1WYX A;  4E6R A;  1T3L A;  3RBB B;  1X69 A;  5FW9 A;  2RN8 A;  4Y92 A;  1ARK A;  2P4R A;  1AEY A;  1RUW A;  3VS1 A;  4RTX A;  3U23 A;  2CUD A;  2BTT A;  3TSW A;  1PRL C;  1RLP C;  1YN8 A;  2FEI A;  4HVV A;  2MCN A;  1ZBJ A;  2GTJ A;  2DVJ A;  2MIO A;  3NMZ C;  2NWM A;  1SHG A;  2MOX A;  1E7O A;  1S1N A;  2JW4 A;  5IXF A;  2JS2 A;  1GL5 A;  1GBQ A;  2LNH B;  1RLQ C;  3M0Q A;  2I0N A;  3GBQ A;  2CT4 A;  4J9F A;  4GBQ A;  1I0C A;  1JXO A;  2KBT A;  1K76 A;  2FPD A;  3PVL A;  3A98 A;  3H0F A;  4RUG A;  2X3W D;  1BB9 A;  3M0R A;  1UJY A;  3TVT A;  4ORZ A;  2CSQ A;  2JT4 A;  3VS6 A;  2PTK A;  1CKA A;  2RQR A;  1SSH A;  4OMO A;  1OV3 A;  2KT8 A;  4LNP A;  5IXB A;  3H0H A;  4J9I A;  2AZV A;  3ZL7 C;  2HDA A;  2LQN A;  5FWC A;  3REB B;  1K9A A;  2C0O A;  2HCK A;  3UAT A;  2BZY A;  3REA B;  1WXT A;  3EHQ A;  2CUB A;  1XOV A;  4CC2 A;  1NYF A;  3IQL A;  4IIM A;  2DL8 A;  2KRN A;  2O9S A;  2EPD A;  1BK2 A;  1PKS A;  1U3O A;  2BZ8 A;  4AFS C;  2QDL A;  1OOT A;  4K11 A;  3EG0 A;  4AG1 C;  1X6B A;  1T0H A;  1K4U S;  2FRW A;  2W10 A;  4JJB A;  2J05 A;  2DYB A;  2F2V A;  1N5Z A;  2EGE A;  4HCK A;  3C0C A;  1KIK A;  3VS5 A;  1H92 A;  2HSP A;  2L0A A;  2YUQ A;  1AD5 A;  4Z89 A;  2FRY A;  3EG3 A;  2LX7 A;  2YUN A;  1AWX A;  2EYY A;  2HEQ A;  1UHF A;  2DL3 A;  2DL4 A;  2EYZ A;  3KFV A;  3JV3 A;  1ZLM A;  4ESR A;  4AG2 C;  1AVZ C;  2LJ1 A;  4RTZ A;  2SRC A;  1ZSG A;  2DM1 A;  1YNZ A;  2EW3 A;  2KEA A;  1NEB A;  1AWJ A;  2KXD A;  1UDL A;  1YCS B;  4J9D A;  2J06 A;  2LQW A;  2YUO A;  1WXU A; 
#chains in the Genus database with same CATH topology
 2A28 A;  1Y7X A;  2RHX A;  3V8L A;  1HD3 A;  5IAY A;  5HK3 A;  3JB9 G;  1EIF A;  4N4I A;  2LJ0 A;  3M0T A;  3CC2 T;  3CPW P;  1Q7Y R;  2DFU A;  4OGC A;  3X28 B;  2GGR A;  1UGS B;  3CCV Q;  1HJD A;  3CXC A;  1G8X A;  5CR2 A;  3CCS T;  1G83 A;  4BE2 A;  5CK9 A;  1XNI A;  2PUO B;  3JCM h;  1MHN A;  4BE0 A;  1CKB A;  2Y90 A;  4MDX A;  1AOJ A;  3MJX A;  4C5I A;  2XK0 A;  2A36 A;  2J6K A;  3CCV A;  2OI3 A;  2P0K A;  1B34 A;  5LJ3 h;  4OMN A;  1X6G A;  3UWN A;  4PFZ A;  2BE9 B;  2KR3 A;  5CCA A;  2CRE A;  3I56 T;  3LW5 E;  3QZ5 B;  4C92 B;  1JXM A;  2EJF A;  1KQ2 A;  5FU6 C;  2FVU A;  2WSC E;  1M3C A;  4JRP A;  3A5Z B;  2H3J A;  4B9W A;  5FWB A;  3AHU A;  4JRK A;  3CCR T;  2DJZ A;  1ZSZ B;  4AFU C;  4IUU A;  1OU9 A;  4HXJ A;  1WJQ A;  3OYL A;  2ATC B;  1VQM Q;  5IH2 A;  4HVW A;  4XQ3 A;  1WHL A;  4E7Z A;  2M9U A;  3VS4 A;  1N8R R;  2PUK B;  3G6E A;  3FIF A;  1BCO A;  1E6H A;  2A37 A;  3CQT A;  1NJI C;  3CCJ T;  2PVO B;  5LJ3 j;  2ENM A;  2COZ A;  4JZ3 A;  2EGC A;  1HXD A;  5CKH A;  1GCQ C;  2NUP B;  4Y28 E;  1NG2 A;  1TUG B;  2V8J A;  4FSS A;  3NTH A;  5GAN 5;  1QW1 A;  1SRL A;  1H3Z A;  1UGV A;  2JMC A;  3VRZ A;  1IXD A;  4JS5 A;  1VQ9 T;  1YCY A;  2E64 A;  4PFO A;  1NLP C;  2MWP A;  2VKN A;  4M4Z A;  3M55 A;  3GPL A;  2OTJ T;  3THK A;  1ACM B;  2COY A;  1WHJ A;  4PL6 A;  3EG9 B;  4GLK A;  4M75 C;  4MZT A;  2I2L A;  1Q7Y C;  4HCB A;  2ED1 A;  1WJS A;  2WSE E;  5GAM d;  4J9E A;  1XQH A;  2CDT A;  4M78 G;  1JEG A;  2J7I A;  3CCU Q;  2V8K A;  2EFI A;  1SPK A;  2RJD A;  4QVZ A;  1ZSZ C;  3BDL A;  4XTY A;  4A4K A;  3INZ A;  4PJL A;  3QPH A;  2A08 A;  2DET A;  3OYN A;  1HYO A;  4C0D B;  2QA4 T;  2QK0 A;  5KYX B;  1VQO Q;  1PRM C;  1QVG P;  3UA6 A;  2E1H A;  4J6W A;  4CC4 B;  2O31 A;  3CCL T;  2G6F X;  2D8H A;  1D1C A;  2DKG A;  2DA9 A;  5KYY B;  1OEB A;  1AZG B;  9ATC B;  1GRI A;  5AT1 B;  4Z8A A;  1K9M U;  1TUD A;  2D1X A;  2ZPG B;  1YI2 Q;  2D0N A;  2E6N A;  3C95 A;  2K4Y A;  4Z88 A;  4M75 D;  3M0P A;  1OPL A;  2YHT A;  1TH7 A;  2RHZ A;  3ZBD A;  1I07 A;  1H3H A;  1AWW A;  2VYT A;  3SFM A;  2DE0 X;  1M2O A;  2KT1 A;  3X24 B;  1B7T A;  2JTF A;  4OGE A;  1PNJ A;  2V8I A;  2YSQ A;  3E2U A;  4IUQ A;  5DLO A;  4M77 F;  4FYW B;  3CCM A;  1TWB A;  1QMC A;  2F2W A;  3M0U A;  4V2S A;  1YI2 A;  5I11 A;  4QQD A;  2KVQ G;  3CBO A;  1ZA1 B;  1D3B A;  5CQY A;  3L2R A;  3L42 A;  2O2O A;  4KUL A;  4R55 A;  3CEY A;  3QBY A;  2XU8 A;  2YRC A;  2EKO A;  4OMQ A;  4PK4 A;  2CZ1 B;  4FYY B;  2LC4 A;  1VQ4 T;  1UHC A;  2QG9 B;  2JM8 A;  1N8R C;  5CO7 A;  3LWI A;  4NS5 A;  3UPU A;  2QGG A;  3ME9 A;  3GP8 A;  1KQS S;  1RAA B;  1AZE A;  2PU9 B;  5GAM e;  1G3T A;  1OPK A;  2CP5 A;  2B8A A;  3BE3 A;  1VIF A;  1YHQ T;  5GAN 2;  2M0Y A;  2EQI A;  2RI2 A;  3KXT A;  5AYF A;  2VB6 A;  2CZ0 B;  2RNA A;  5EG2 A;  5KE3 A;  4MZP A;  1KSW A;  3R6N A;  3TRE A;  2XKO C;  3M53 A;  1PSF A;  1K8A U;  4F14 A;  1VOM A;  2X4X A;  4F7U F;  3AT1 B;  4C8Q C;  4XTZ A;  2RHI A;  2LT1 A;  4PFP A;  2VVK A;  2EBP A;  2QQS A;  4M7D F;  3JCM P;  1IHV A;  3PT9 A;  4NL2 A;  3PVQ A;  4NL3 A;  4ELY C;  3ULR B;  2NUT B;  2L3Q A;  4ME7 A;  4DEY A;  2CH4 A;  2CS7 A;  3LX7 A;  3MEV A;  1JJ2 P;  1GCQ A;  1WFW A;  5CAI A;  2KAF A;  3JCM d;  1NEG A;  3S3M A;  3OYY A;  4KGV B;  2LDM A;  1ZUU A;  2QGF B;  2KYM A;  5I21 A;  2E5Q A;  2R5M A;  5LJ5 h;  3MO8 A;  1VQN T;  3V7C A;  4C92 F;  3KBG A;  1OU8 A;  4UC4 A;  4HT8 A;  2HQH A;  4C8Q D;  1S72 T;  1AEY A;  1RUW A;  5LJ3 g;  3U23 A;  2CUD A;  4M75 A;  5KH6 A;  1PRL C;  1RLP C;  2JUF A;  4HVV A;  2RI5 A;  2DVJ A;  1FX7 A;  2MIO A;  3NMZ C;  1VQP T;  3OYF A;  4TVR A;  1BCM A;  1E7O A;  2KK4 A;  4M78 B;  1ZSZ A;  4C0G A;  1WQ7 A;  2JS2 A;  1IHW A;  2LQ8 A;  2R58 A;  3JCM b;  2E10 A;  1WHH A;  1M90 U;  2ZCF B;  2X3W D;  1BB9 A;  1RI0 A;  1M8V A;  4Y91 A;  3M0R A;  1UJY A;  3TVT A;  2CSQ A;  2LTO A;  2PTK A;  5LJ5 j;  3OS1 A;  1CKA A;  4J83 A;  2CP6 A;  3M4Y A;  4OMO A;  1IGU A;  4LNP A;  5IXB A;  4C8Q E;  3A8G B;  4FM4 B;  3JCM V;  1NPR A;  2HDA A;  3BY7 A;  2DD4 A;  2LQN A;  3CCV T;  1K9A A;  2HCK A;  1VQ9 A;  2P4T A;  2ZPH B;  1XOV A;  3T9N A;  4CC2 A;  3EGX A;  3JCM e;  1M2V B;  1BI3 A;  3OYD A;  3FJP A;  2FYK A;  2BZ8 A;  2EYQ A;  4AFS C;  2YRD A;  3CBP A;  1MNE A;  2KI7 A;  5GMK l;  2QI2 A;  4GY5 A;  2GQV A;  4PKC C;  1KIK A;  2FB7 A;  2WAC A;  2LX7 A;  2YUN A;  1AWX A;  2EYY A;  2HEQ A;  5A2Q E;  4L6V 5;  3V7R A;  2DL3 A;  2DL4 A;  5GAO l;  2EYZ A;  4PJO F;  2E3H A;  2X4J A;  4PNO A;  4RTZ A;  2LJ1 A;  4VUB A;  1BI2 A;  4WF2 A;  2HQE A;  4QVC A;  3CXC P;  4C5G A;  1IZ6 A;  5A0L A;  1N6A A;  3R6O A;  4J9D A;  3HSB A;  3E1S A;  3JB9 F;  1VQM T;  3QDR B;  4C8Q A;  1SKU B;  1UTI A;  4OP0 A;  1C1A A;  4JZ4 A;  3MP6 A;  2FG0 A;  4B6M A;  3OYC A;  2O9V A;  4KH0 B;  1PHT A;  3J80 E;  1E6G A;  2OAW A;  4J9B A;  2DMO A;  4A4H A;  3TEE A;  2EJG A;  1Q86 U;  2YWW A;  4DBF A;  4Q5W A;  4RCB A;  1LOJ A;  2YXY A;  3HP9 A;  1FXX A;  2DAQ A;  4ATO A;  3JCM W;  1OI1 A;  1VYU A;  2CZ7 B;  1YHQ Q;  1X27 A;  2DTO A;  4LN2 A;  2EIF A;  2KY9 A;  3OW2 S;  1QVF S;  5GAN h;  2LT4 A;  1M9S A;  4M75 G;  1BKB A;  2O01 E;  1IRX A;  2DIL A;  2JN0 A;  5ECA A;  5KCO A;  4XTU A;  3G71 T;  2VWF A;  4CC7 A;  2HQX A;  2C0I A;  4E7K A;  3VS0 A;  3VUB A;  1NYG A;  4E2F B;  3QXE B;  2V1Q A;  2D6F A;  3CME Q;  1YHQ A;  1VUB A;  1QCF A;  3CCU T;  2F69 A;  2EQJ A;  1G2B A;  3M4G A;  1Z9Q A;  2MMP A;  4OF1 A;  3MET A;  2EVR A;  2DD5 A;  3PFS A;  2B86 A;  3DLL A;  3TCJ A;  4HCC A;  2L3S A;  1TU0 B;  4KUI A;  1VQO T;  2EWN A;  3CME A;  2EYX A;  2BZX A;  1AWO A;  4E7J A;  3MEW A;  1W2B S;  1R0C B;  2EAY A;  1SHF A;  2DBM A;  4DBQ A;  3RKW A;  1ZBX A;  4ZTJ A;  4QKU A;  3MP8 A;  3CMA T;  4PLI A;  5GAM f;  5GAN j;  3WVD B;  2KNB B;  4MML A;  2JZ2 A;  1K73 U;  5I22 A;  4M77 B;  1M30 A;  2FPF A;  3I35 A;  1Y71 A;  3ZFJ A;  4JRQ A;  4FYX B;  3HFO A;  1S72 Q;  3RKY A;  1D09 B;  4EDU A;  1K0S A;  1VQ7 T;  2RQT A;  3SEM A;  3I9Q A;  1BI1 A;  2DTH A;  5IHN A;  1ZUY A;  1ZHI A;  1U5S A;  2EKH A;  1TG0 A;  1UB4 A;  1QLY A;  4OB1 B;  2DRM A;  2XDP A;  4OMF B;  5LJ5 g;  1S72 A;  3RMQ A;  2OAU A;  1BIA A;  2L89 A;  2LNV A;  3EAE A;  3QSU A;  2RB6 A;  1VQP A;  1KJW A;  4RG8 A;  4J6Y A;  1Z9Z A;  2IIM A;  4KUD K;  3FLG A;  3VRY A;  1B07 A;  5GMK e;  4F7U B;  2ESW A;  3EHR A;  2M1H A;  1I1J A;  2OX7 A;  3VS3 A;  2QQB A;  1YFN A;  5D7U A;  3X25 B;  2A0F B;  5KCH A;  4M7D B;  1GFC A;  1D0X A;  2XI9 A;  4M77 C;  1M8M A;  1X2Q A;  3L2U A;  1KC8 R;  2YT6 A;  2GNC A;  4M7A G;  4E7I A;  2EQM A;  1HSQ A;  1YIJ Q;  2KGT A;  4ELZ C;  1N9R A;  1B3Q A;  4L59 A;  5GMK m;  2CYZ B;  3BDU A;  4OMM A;  4J8O A;  2RQW A;  2HNI A;  3X20 B;  4JJN K;  3P8D A;  1M2V A;  2NYS A;  4J7F A;  1YP5 A;  3QDF A;  1NJI U;  3GNF B;  1RAB B;  2RPN A;  5HK0 A;  1RAD B;  5GAO m;  1N9S A;  1YIJ A;  1QKX A;  1QKW A;  4E47 A;  1OYX A;  1FWZ A;  3EFR A;  1JO8 A;  3I55 Q;  2DL7 A;  2PNI A;  3A8L B;  1J3T A;  3HRT A;  2EQU A;  3OSS C;  4A63 B;  4M77 D;  1EZZ B;  2RQU A;  2L3P A;  1PKT A;  1LJO A;  2V1R A;  4O6J A;  1YIT Q;  4RTT A;  4R0K A;  2XG8 D;  3JCM f;  3M9Q A;  3I55 A;  2DBK A;  1TSF A;  1IGQ A;  3M59 A;  1BBZ A;  2ROT A;  1YWP A;  1EFN A;  1Q7Y U;  1VQM A;  1QQJ A;  3G1J A;  5CKD A;  2LCS A;  1WXB A;  3EGD B;  2HBW A;  4RTU A;  4D8K A;  4MZM A;  4BE1 A;  2CT3 A;  1U8R A;  1VYT A;  2DER A;  3O8V A;  4JLG A;  1MMA A;  2VV5 A;  1KG1 A;  1KHC A;  2K3X A;  4II1 A;  4QQG A;  4C92 C;  3JB9 J;  2ZPF B;  1JQQ A;  2AIR B;  4M77 E;  3HRS A;  5FRO A;  3G71 Q;  2YLB A;  3EG1 A;  1MMN A;  1RAH B;  3OS2 A;  3EH1 A;  2COW A;  4PJM A;  5GAO n;  1X43 A;  4FYV B;  3OB9 A;  5CQX A;  1VIE A;  2DRK A;  2J6F A;  3G71 A;  1VQ6 Q;  1RI9 A;  2L3R A;  1JBM A;  5GAN g;  1KQ1 A;  2HD0 A;  3OYK A;  2CP3 A;  3RBB B;  1KC8 C;  4PJO B;  1Y96 B;  4Y92 A;  5FRM A;  2DO3 A;  3CCU A;  3M56 A;  4EMG A;  1TTH B;  1UGP B;  3TSW A;  2XDD A;  3CMA Q;  3QYG B;  3A8H B;  2CP7 A;  4C92 D;  2GTJ A;  1VQ6 A;  1KQS A;  3P8B B;  2MOX A;  1N8R U;  3LWH A;  4KT0 E;  3GIB A;  1VQO A;  4X34 A;  4F7U E;  2RM4 A;  1GL5 A;  1GBQ A;  1RAF B;  4Z02 A;  2HKQ B;  1NZ9 A;  1VQ7 Q;  1QP3 A;  4M7D E;  3CMA A;  2JVV A;  4RUG A;  2FPD A;  3PVL A;  3NFC A;  1EX4 A;  4M77 A;  3VS6 A;  4ZGE B;  1VQ7 A;  4ZGJ B;  3H0H A;  3L1A A;  2QEX Q;  2IPO B;  4KGZ B;  2HSE B;  1QCO A;  4XK8 E;  3REB B;  3REA B;  1WXT A;  4C92 E;  2VXF A;  4C0D C;  5KYW B;  1M1G A;  3FDR A;  1M5Q 1;  2DXB A;  2XIC A;  4LDV A;  4PJO C;  2KRN A;  1WJR A;  1U3O A;  2QEX A;  1OOT A;  3QO3 A;  1Q82 R;  3EG0 A;  3PGG A;  2O4X B;  1PG5 B;  3CPW S;  3DB3 A;  1H92 A;  2P0P A;  2L0A A;  4A4E A;  3CME T;  2ZPI B;  3RR6 A;  4F7U A;  2DIG A;  3OYE A;  1WNL A;  1V76 A;  2CP0 A;  5KYU B;  1OX9 A;  2E65 A;  2QYZ A;  3KFV A;  1ZLM A;  1AVZ C;  3JCM X;  1XJW B;  1SF9 A;  2DM1 A;  1YNZ A;  3OQ5 A;  2KEA A;  5A0G A;  5GAO p;  3V8K A;  4XTX A;  1NEB A;  4BB7 A;  1AT1 B;  1AWJ A;  2P0Q A;  1UDL A;  5J3B A;  4PJO D;  1WGS A;  3FB9 A;  1RAG B;  2FL7 A;  2ROL A;  1M27 C;  5LJ3 d;  2PQW A;  5GAN 8;  3ER0 A;  4C92 A;  3F70 A;  2O88 A;  1K8A C;  3JB9 D;  4RTV A;  2K3B A;  4A4G A;  3OMG A;  1BU1 A;  1M1K R;  3UA7 A;  5KE2 A;  3RIR A;  5D6Y A;  1WQW A;  3OYH A;  2DXU A;  2FZK B;  4J9H A;  4DA4 A;  1VQL Q;  4M75 F;  3HTR A;  4OML A;  2YDL A;  4IIO A;  4OVA A;  4PJN A;  2F2X A;  1WIE A;  2DNU A;  1MND A;  2KYB A;  3VYG A;  1H8K A;  4PJO E;  3RDV A;  4A54 A;  1I5O B;  3P8H A;  1Q81 U;  4JUV A;  3TU4 K;  1I81 A;  4CRI A;  4X1V A;  1VQL A;  4QT7 A;  1G3W A;  2Y4X A;  2NUP A;  1KD1 U;  4HT9 A;  1MV3 A;  3H41 A;  3D7S B;  1QVP A;  2HBP A;  4LDU A;  3HL8 A;  3EGD A;  3A8O B;  2D8J A;  4WCI A;  2DZ9 A;  3VV0 A;  4DEX A;  1Q82 C;  1OZ2 A;  1U1T A;  5IHI A;  1Y0M A;  3WVE B;  4PLL A;  2ZAE A;  4EMK B;  1KFZ A;  1H64 1;  2CGH A;  2AKL A;  3EG9 A;  1XTD A;  4CC3 A;  1D0Y A;  3FRN A;  4JPB W;  3E9F A;  2C0T A;  1YIJ T;  1B34 B;  1TUC A;  1TXQ A;  2RI3 A;  1RAC B;  5LJ3 e;  2MWO A;  3UT1 A;  2XDB A;  2BUD A;  3NTK A;  2P84 A;  2RD1 A;  4M78 C;  3EFS A;  1QVG S;  4LD9 K;  5D6W A;  1U06 A;  1RAI B;  4LDW A;  2RJF A;  3CC7 Q;  4FW2 A;  4C5E A;  5KYX A;  5HCK A;  4PJO A;  1TOV A;  4DOV A;  5GJV B;  4KRT A;  1V29 B;  3I55 T;  1BYM A;  3OYG A;  2SEM A;  3RMS A;  3EH2 A;  3OW2 A;  1QVF A;  2DPP B;  2K7A A;  5IN1 A;  3UDC A;  1UJ0 A;  5KYY A;  1LCK A;  4RTY A;  2E3I A;  1RL2 A;  3CC7 A;  3QWY A;  4J9G A;  3UF4 A;  3G4S T;  1YIT T;  4RG2 A;  3NPF A;  2LP5 A;  2BKD N;  1M1K C;  5DM7 R;  2JJ9 A;  2HAX A;  2EJ9 A;  1PC0 A;  3M0S A;  3A1P A;  4E7H A;  1X75 C;  1IO6 A;  5EC7 A;  4M78 D;  2DJQ A;  2AK5 A;  3QII A;  4EMK C;  4P5N A;  1FYN A;  4RKU E;  4LUE A;  3JCM c;  2EQK A;  1M3B A;  2JTE A;  4M7A F;  3H0I A;  4XTV A;  4MDW A;  1W2B A;  4KH1 B;  1BIB A;  2AKK A;  1AHJ B;  1CSK A;  1X6O A;  2LX9 A;  2K57 A;  3NGP A;  2ECZ A;  2JS0 A;  3FJ5 A;  3GLX A;  1Y57 A;  2LZ6 B;  2DLP A;  2OTL Q;  2EGA A;  5CVI A;  4AFQ C;  4ANJ A;  4L5G A;  3J7A F;  1ZUK A;  1SRM A;  4OMP A;  1JU5 C;  1A0N B;  5CIU A;  1UGR B;  1WDX A;  2ED0 A;  4M78 E;  1VQ6 T;  1JRI A;  1OUL A;  2HL5 C;  2L2P A;  4X9D A;  2VAS A;  5DY9 A;  2X4W A;  2OTL A;  2F5K A;  2EYW A;  1V1C A;  4JRI A;  5GAO r;  1YJ9 Q;  2KE9 A;  2F1L A;  2ZGW A;  4LDY A;  4JDS A;  2XID A;  1MMD A;  2K9G A;  2M51 A;  1PCX A;  5KYU A;  1JJ2 S;  3FEO A;  3PMT A;  4D6W A;  2AZS A;  2CZ6 B;  5GAN 4;  2NUT A;  1T3S A;  1GXI E;  5C6S A;  3L2Z A;  4A53 A;  4BAC A;  1I4K 1;  4KGX B;  3OYB A;  4HVU A;  2NUZ A;  2H8H A;  2K2V A;  3S6W A;  1YJ9 A;  3JSC A;  2D9T A;  2ZZD A;  4XU1 A;  2DL5 A;  3O5Z A;  2GBQ A;  2HKN A;  3WXM B;  1P92 A;  1WA7 A;  3MHX A;  1T0J A;  4FT2 A;  3QZ9 B;  2C06 A;  3BFM A;  2R5A A;  1NM7 A;  5D6X A;  1D3B B;  5LJ5 d;  4JJC A;  2R57 A;  4LXC A;  4ZNX A;  1M1F A;  4EMH A;  4ZGD B;  1QWE A;  2K5I A;  4RTW A;  6AT1 B;  2QEX T;  1W70 A;  4C0Z A;  3OYM A;  2KQW A;  5FRN A;  2MYS A;  2BE7 D;  3FC3 A;  1MUZ A;  4J6X A;  2E12 A;  3CC4 Q;  4LE9 A;  4M78 A;  5FU6 B;  3EGU A;  2RF0 A;  1ABQ A;  1Y07 A;  1FMK A;  3OY9 A;  1QWF A;  1KQS P;  3QUI A;  3DLM A;  1YJW Q;  2J6O A;  1SEM A;  2RMO A;  4C8Q G;  1PM3 A;  1WYX A;  3C12 A;  4E6R A;  3CC4 A;  1WHG A;  1X69 A;  5FW9 A;  2RN8 A;  2P4R A;  2Z0W A;  1I5L A;  3MKD A;  1WHK A;  5CKB A;  3M57 A;  1OZ3 A;  2FEI A;  2FHD A;  1YJW A;  4XU0 A;  4LDX A;  2QTV A;  5A0D A;  2DIQ A;  3BW1 A;  1S1N A;  1C6V X;  5IXF A;  2XHC A;  1RLQ C;  1VQK T;  2IVW A;  3M0Q A;  5GAN 3;  2H3E B;  4EMK A;  3MP1 A;  3GBQ A;  4XTW A;  4RMO A;  3H8Z A;  1TS9 A;  2QXF A;  5CKE A;  2KBT A;  1K76 A;  3A98 A;  3H0F A;  3CCQ Q;  4J5Y A;  2M16 A;  2MF2 A;  5LJ5 e;  1O9S A;  1YJN Q;  3EFO B;  1MGQ A;  2Y4Y A;  2RQR A;  3KUF A;  4E7L A;  3GOX A;  4M75 B;  3ZL7 C;  4DBH A;  1VQ5 T;  3CXC S;  3H9N A;  3CCQ A;  3C4S A;  2BZY A;  2GF7 A;  3G4S Q;  3G6E Q;  2CUB A;  1YJN A;  3NTI A;  4M7D C;  1VQL T;  2E6Z A;  4IIM A;  2DL8 A;  3SB2 A;  2O9S A;  2EPD A;  2HZY A;  3H6Z A;  3URG A;  4J7I A;  2QDL A;  4K11 A;  1WZO A;  1T0H A;  1K4U S;  4FCY A;  2W10 A;  4JJB A;  4N4H A;  1K9M R;  4FT4 A;  2J05 A;  5LJ3 f;  3JRZ A;  2DYB A;  1N5Z A;  3G4S A;  1D0Z A;  3SWN B;  1YIT A;  3VYH B;  1OX8 A;  1JB0 E;  3VS5 A;  4BDZ A;  4E7S A;  2YUQ A;  1AD5 A;  4Z89 A;  3CCE Q;  1KC8 U;  3JV3 A;  1R77 A;  3CBM A;  2RK1 A;  2KDS A;  4ESR A;  4AG2 C;  2DK3 A;  4YTL A;  1UEB A;  2VGN A;  4O5V A;  2VUB A;  4HCZ A;  3JAM E;  4M7D D;  3CCE A;  2K5F A;  2X51 A;  3EGX B;  4ZN3 A;  2KXD A;  1YCS B;  3JCM J;  1Q95 G;  1LVK A;  1X01 A;  5GAN d;  3N5B B;  2J06 A;  2LQW A;  1WXU A;  2GTO A;  3VJP A;  3TQ7 P;  1UG1 A;  2FZG B;  3PNW C;  5GAO q;  1I8F A;  2DXC A;  2LMJ A;  5GAM g;  2KRM A;  1BI0 A;  4J9C A;  2DEU A;  2K3Y A;  3OBY A;  4NOY A;  5GJW B;  3QYH B;  1DJ7 B;  1YBY A;  5KYN A;  1MMG A;  7AT1 B;  2MK5 A;  3LLR A;  3NHN A;  1D1B A;  4N4G A;  2QQR A;  1K8A R;  2KSS A;  3CC7 T;  1X2K A;  2QAZ A;  3OYI A;  1ZQ1 A;  4XU2 A;  2AT1 B;  2FPE A;  2LVM A;  3SWN C;  1GCP A;  2XMF A;  3OA6 A;  2RHY A;  2V26 A;  8ATC B;  1VQ8 Q;  3DB4 A;  4IUV A;  1W1F A;  3CCM Q;  4C8Q B;  3CPW A;  4QW2 A;  4IUR A;  2PVD B;  1SSF A;  2DYI A;  1FMV A;  1O75 A;  4EPC A;  2BIV A;  4WTO B;  4B9X A;  4M7A B;  1VQ8 A;  3PMI A;  4F17 A;  2WSF E;  4DOW A;  2CSI A;  1K0X A;  1ZA2 B;  1QCN A;  2CP2 A;  5J26 A;  1G3S A;  2X9H A;  4D8D A;  2RJE A;  1VYV A;  5HKC A;  3PIO A;  1K9M C;  1WX6 A;  2PZ1 A;  3DKM A;  3QKJ A;  3LH0 A;  3CD6 Q;  3TSZ A;  4F04 B;  2QQ9 A;  5GAN e;  1WHM A;  4AFZ C;  3SHW A;  2ABL A;  3QJY A;  2JM9 A;  2X4Y A;  2VXE A;  2L5Q A;  3OSV A;  2DXT A;  2GCX A;  2K79 A;  3L2Q A;  3OW2 P;  1QVF P;  2ZPE B;  5GAN 7;  3VS2 A;  4IKF A;  1LPL A;  3V8J A;  2OTL T;  5GMK h;  1GBR A;  4M75 E;  1KHI A;  1K1Z A;  5L23 A;  3CC2 Q;  3CD6 A;  1N27 A;  2GFA A;  2IG0 A;  1M90 R;  2JTM A;  1NBE B;  4IUT A;  4M7D A;  3LGF A;  3VKI A;  3OMC A;  2E41 A;  4C5H A;  3CCS Q;  1Q81 R;  4F16 A;  1MV0 B;  4C0F A;  3QWX X;  1VQK Q;  1YJ9 T;  5C0M A;  2K5L A;  1KD1 R;  3CC2 A;  2L8D A;  2KRO A;  1FMW A;  1WI7 A;  1VA7 A;  2KMT A;  4HA8 A;  4FL6 A;  2RH2 A;  5IT9 E;  3LH5 A;  2W0Z A;  4BI3 A;  4M7A C;  2JXB A;  1UEC A;  3CCS A;  4AMC A;  3ZEH A;  1W2B P;  2F5T X;  8AT1 B;  3I56 Q;  5FU7 B;  2E70 A;  3S3N A;  2CH4 W;  2E5K A;  4IUP A;  4BY6 B;  3I5R A;  1VQK A;  3RKX A;  2GQI A;  4BI4 A;  3VUZ A;  2DEQ A;  5GMK j;  2RHU A;  1VQ5 Q;  3OYA A;  3JCM g;  1UFF A;  1NE8 A;  1PD0 A;  2LCL A;  1PWT A;  3RER A;  3CCR Q;  2DTI A;  3EFO A;  2HMA A;  3I56 A;  2DX1 A;  2JNG A;  2LCC A;  4JJD A;  3HFN A;  2MAM A;  4DBR A;  2LJ3 A;  3ASK A;  1Q82 U;  3RUX A;  2YLC A;  1VQ5 A;  3A8M B;  2AHJ B;  4LD6 A;  2FO0 A;  3QG1 A;  3RES A;  3CC4 T;  3CCR A;  4M7A D;  3CCJ Q;  1UE9 A;  4N0A C;  4ZN1 A;  4OB3 B;  3M5A A;  3SD4 A;  5IHK A;  1D1A A;  1QVG A;  2QTX A;  1SG5 A;  3HRU A;  3GNG A;  5GMK i;  5LJ5 f;  1YJW T;  3EG2 A;  1ZX6 A;  4EIK A;  5FLX E;  3SWN A;  1VQ9 Q;  5LL6 S;  1M4Z A;  4M77 G;  1UUE A;  3CCJ A;  2FZC B;  4BDY A;  4DQ2 A;  2OTJ Q;  5FU7 C;  1U1S A;  2YRV A;  4MMK A;  4BY6 C;  2K2M A;  4LUD A;  4XAX B;  1Q86 R;  2JOY A;  3J81 E;  2QDY B;  1C0M A;  3PTA A;  1R0B G;  1OQK A;  2JMA A;  2QAS A;  3HKS A;  1M90 C;  4M7A E;  2DZC A;  1NLO C;  2OTJ A;  1UGQ B;  1Q81 C;  4OB0 B;  2VGM A;  5I2M A;  4CI0 C;  1M3A A;  2RQV A;  1M1K U;  1GFD A;  2QA4 Q;  2K6D A;  1W4S A;  3I5S A;  3CCQ T;  1KD1 C;  3RNJ A;  1Y96 A;  2NLU A;  1YJN T;  2DVE A;  2HL3 A;  2KXC A;  2LQK A;  2A7Y A;  2QQA A;  3CCL Q;  2VC8 A;  5HY6 A;  3VS7 A;  4GLM A;  1IB8 A;  3V7S A;  1R8O B;  4F7U G;  3M58 A;  3PE0 A;  3QJ6 A;  3JB9 H;  2KRS A;  2X3X D;  2QA4 A;  4M7D G;  4JLI A;  3JCM Q;  2YUP A;  2OJ2 A;  3C94 A;  1W6X A;  3X26 B;  1RAE B;  4AT1 B;  2GFU A;  3CPF A;  3G6E T;  3E9G A;  5J39 A;  3MEA A;  4BD3 A;  3CCL A;  3L2W A;  3PIP A;  1WPY A;  1YWO A;  4C8Q F;  1ABO A;  2DF6 A;  4FU6 A;  2XD0 A;  2G3R A;  1WLP B;  5GAN 6;  3OS5 A;  1K73 R;  1T3L A;  2E4H A;  1ARK A;  1VQ4 Q;  4A4F A;  4C92 G;  3VS1 A;  3CCE T;  4RTX A;  1JJ2 A;  2BTT A;  4M7A A;  5L8R E;  3HHT B;  4JS4 A;  1YN8 A;  1QP2 A;  2MCN A;  3VU3 C;  5GAM h;  1ZBJ A;  2CKK A;  2NWM A;  1SHG A;  5KYW A;  2JW4 A;  3SDZ A;  1PD1 A;  2M0O A;  1VQ4 A;  3S3O A;  2LNH B;  2I0N A;  2CT4 A;  4KBM B;  3G7Z A;  4J9F A;  4GBQ A;  5CKF A;  1I0C A;  4R56 A;  1JXO A;  4HKE A;  2O4X A;  1LNX A;  2M02 A;  4ORZ A;  2JT4 A;  2LRQ A;  4BUG A;  1Q86 C;  2RO0 A;  1SSH A;  4FW1 A;  1OV3 A;  2KT8 A;  4RCC A;  2X35 A;  4J9I A;  3OYJ A;  2AZV A;  5FWC A;  1KK7 A;  2PVG B;  4N0A A;  2C0O A;  3UAT A;  3LYI A;  2ZPB B;  4PJJ A;  2A3L A;  3EHQ A;  4X9C A;  5GAM j;  4QQ6 A;  3Q1J A;  3GF5 A;  3L2V A;  1NYF A;  3IQL A;  5GAN f;  1BK2 A;  1PKS A;  3JB9 I;  3M54 A;  4OB2 B;  1VQ8 T;  4AG1 C;  1X6B A;  2FRW A;  2RJC A;  3CCM T;  2D0Q B;  1YI2 T;  1VQN Q;  2F2V A;  3QHS A;  3MPU B;  4FSX A;  2EGE A;  4HCK A;  3C0C A;  2HSP A;  5DLQ E;  3OS0 A;  2FRY A;  3EG3 A;  2MI6 A;  1UHF A;  1NJI R;  3MCA B;  4ZTF A;  1G3Y A;  3HPW A;  1VQP Q;  4XU3 A;  1VQN A;  3LGL A;  1NPP A;  2SRC A;  1F1B B;  1ZSG A;  4QVD A;  2MPX C;  4PJO G;  2EW3 A;  5I2S A;  1HK9 A;  1IRE B;  2RK2 A;  3OBW A;  5M9O A;  1PSE A;  2RA2 A;  1K73 C;  3CD6 T;  3MEU A;  4FIB A;  1G5V A;  3E19 A;  2YUO A;  4BI8 B;  4M78 F; 
#chains in the Genus database with same CATH homology
 2A28 A;  2GTO A;  1UTI A;  1UG1 A;  2ROL A;  1HD3 A;  4JZ4 A;  1M27 C;  2FG0 A;  2O9V A;  2LMJ A;  1PHT A;  2O88 A;  2KRM A;  4J9C A;  2LJ0 A;  3M0T A;  5GJW B;  1E6G A;  2OAW A;  4RTV A;  2K3B A;  4J9B A;  2DMO A;  2GGR A;  1BU1 A;  3UA7 A;  1HJD A;  3NHN A;  1X2K A;  1G83 A;  4J9H A;  1VYU A;  1X27 A;  4LN2 A;  2FPE A;  1GCP A;  1CKB A;  4OML A;  2YDL A;  1AOJ A;  2XMF A;  4IIO A;  2F2X A;  1W1F A;  2A36 A;  2DIL A;  1WIE A;  2J6K A;  2DNU A;  5ECA A;  2KYB A;  2OI3 A;  1H8K A;  2VWF A;  4CC7 A;  4OMN A;  1X6G A;  2C0I A;  2KR3 A;  3VS0 A;  1NYG A;  4X1V A;  2V1Q A;  2CRE A;  4QT7 A;  1QCF A;  1JXM A;  1G2B A;  1Z9Q A;  2EVR A;  4F17 A;  1M3C A;  1MV3 A;  3H41 A;  2B86 A;  2CSI A;  5FWB A;  1K0X A;  2D8J A;  4WCI A;  2L3S A;  4D8D A;  1VYV A;  4DEX A;  2EYX A;  4AFU C;  2BZX A;  1AWO A;  1WX6 A;  2PZ1 A;  5IHI A;  1Y0M A;  4HXJ A;  3TSZ A;  1SHF A;  2DBM A;  1KFZ A;  4AFZ C;  3SHW A;  2AKL A;  4CC3 A;  5IH2 A;  2ABL A;  2JM9 A;  4HVW A;  2KNB B;  4JPB W;  2C0T A;  3VS4 A;  2K79 A;  5I22 A;  1TUC A;  1M30 A;  1E6H A;  2FPF A;  2A37 A;  3I35 A;  3VS2 A;  3CQT A;  1GBR A;  2ENM A;  1K1Z A;  4JZ3 A;  2EGC A;  5L23 A;  1K0S A;  1GCQ C;  2RQT A;  3SEM A;  1NG2 A;  4FSS A;  1U06 A;  3I9Q A;  1SRL A;  5IHN A;  1ZUY A;  1U5S A;  2EKH A;  1UGV A;  1TG0 A;  2JMC A;  3VRZ A;  1QLY A;  5HCK A;  4F16 A;  5GJV B;  1MV0 B;  4KRT A;  1NLP C;  2DRM A;  3QWX X;  2SEM A;  2VKN A;  4M4Z A;  2K7A A;  1UJ0 A;  3THK A;  2KRO A;  1LCK A;  1WI7 A;  1VA7 A;  4RTY A;  3LH5 A;  2W0Z A;  2JXB A;  1UEC A;  3QWY A;  4J9G A;  3UF4 A;  2ED1 A;  4J9E A;  3NPF A;  2LP5 A;  2CDT A;  1JEG A;  2CH4 W;  2E5K A;  1KJW A;  2J7I A;  1Z9Z A;  2IIM A;  1SPK A;  3I5R A;  3VRY A;  1B07 A;  2GQI A;  3M0S A;  2ESW A;  1IO6 A;  5EC7 A;  3EHR A;  2DJQ A;  1I1J A;  2AK5 A;  2A08 A;  3VS3 A;  1UFF A;  1FYN A;  1PWT A;  4LUE A;  1GFC A;  1PRM C;  1M3B A;  3UA6 A;  2JTE A;  2DX1 A;  3H0I A;  4CC4 B;  2O31 A;  4JJD A;  1M8M A;  2G6F X;  2D8H A;  1X2Q A;  2AKK A;  2LJ3 A;  1CSK A;  2DA9 A;  2YT6 A;  1OEB A;  2GNC A;  1AZG B;  3NGP A;  2ECZ A;  2JS0 A;  3FJ5 A;  1GRI A;  4Z8A A;  1TUD A;  2D1X A;  2FO0 A;  1HSQ A;  2D0N A;  2KGT A;  1Y57 A;  4Z88 A;  3M0P A;  2LZ6 B;  1OPL A;  2DLP A;  1B3Q A;  1UE9 A;  2EGA A;  4OMM A;  2RQW A;  4AFQ C;  1I07 A;  1H3H A;  1AWW A;  2DE0 X;  5IHK A;  1ZUK A;  1SRM A;  2KT1 A;  1JU5 C;  4OMP A;  1A0N B;  1PNJ A;  2YSQ A;  1YP5 A;  2F2W A;  3M0U A;  1WDX A;  2RPN A;  3EG2 A;  5I11 A;  1ZX6 A;  4EIK A;  2ED0 A;  1QKX A;  1QKW A;  2L2P A;  2O2O A;  1JO8 A;  1UUE A;  4OMQ A;  2EYW A;  1V1C A;  2KE9 A;  2DL7 A;  2PNI A;  1UHC A;  1J3T A;  2JM8 A;  2K9G A;  2M51 A;  4A63 B;  2K2M A;  4LUD A;  2AZS A;  1T3S A;  2RQU A;  2L3P A;  1PKT A;  2V1R A;  1AZE A;  4HVU A;  1OPK A;  4RTT A;  4R0K A;  2JMA A;  2NUZ A;  2H8H A;  2DBK A;  1BBZ A;  2M0Y A;  2ROT A;  1NLO C;  2EQI A;  1YWP A;  1EFN A;  2DL5 A;  3O5Z A;  2GBQ A;  2RNA A;  1M3A A;  2RQV A;  1WA7 A;  1KSW A;  3R6N A;  1GFD A;  1T0J A;  2K6D A;  3I5S A;  2LCS A;  1NM7 A;  1WXB A;  2HBW A;  4RTU A;  4D8K A;  4F14 A;  4JJC A;  3RNJ A;  2CT3 A;  1VYT A;  4ZNX A;  1QWE A;  2KXC A;  3VS7 A;  4GLM A;  2VVK A;  4RTW A;  2EBP A;  3PE0 A;  1W70 A;  3PVQ A;  2KRS A;  3ULR B;  2X3X D;  1JQQ A;  2L3Q A;  1MUZ A;  4DEY A;  2YUP A;  2CH4 A;  2OJ2 A;  1W6X A;  3EG1 A;  4LE9 A;  1GCQ A;  3EGU A;  2RF0 A;  1ABQ A;  1WFW A;  1FMK A;  1YWO A;  1QWF A;  1ABO A;  1X43 A;  2DF6 A;  1NEG A;  1ZUU A;  2KYM A;  2J6F A;  2DRK A;  2J6O A;  1WLP B;  1SEM A;  2RMO A;  1RI9 A;  1WYX A;  4E6R A;  1T3L A;  3RBB B;  1X69 A;  5FW9 A;  2RN8 A;  4Y92 A;  1ARK A;  2P4R A;  1AEY A;  1RUW A;  3VS1 A;  4RTX A;  3U23 A;  2CUD A;  2BTT A;  3TSW A;  1PRL C;  1RLP C;  1YN8 A;  2FEI A;  4HVV A;  2MCN A;  1ZBJ A;  2GTJ A;  2DVJ A;  2MIO A;  3NMZ C;  2NWM A;  1SHG A;  2MOX A;  1E7O A;  1S1N A;  2JW4 A;  5IXF A;  2JS2 A;  1GL5 A;  1GBQ A;  2LNH B;  1RLQ C;  3M0Q A;  2I0N A;  3GBQ A;  2CT4 A;  4J9F A;  4GBQ A;  1I0C A;  1JXO A;  2KBT A;  1K76 A;  2FPD A;  3PVL A;  3A98 A;  3H0F A;  4RUG A;  2X3W D;  1BB9 A;  3M0R A;  1UJY A;  3TVT A;  4ORZ A;  2CSQ A;  2JT4 A;  3VS6 A;  2PTK A;  1CKA A;  2RQR A;  1SSH A;  4OMO A;  1OV3 A;  2KT8 A;  4LNP A;  5IXB A;  3H0H A;  4J9I A;  2AZV A;  3ZL7 C;  2HDA A;  2LQN A;  5FWC A;  3REB B;  1K9A A;  2C0O A;  2HCK A;  3UAT A;  2BZY A;  3REA B;  1WXT A;  3EHQ A;  2CUB A;  1XOV A;  4CC2 A;  1NYF A;  3IQL A;  4IIM A;  2DL8 A;  2KRN A;  2O9S A;  2EPD A;  1BK2 A;  1PKS A;  1U3O A;  2BZ8 A;  4AFS C;  2QDL A;  1OOT A;  4K11 A;  3EG0 A;  4AG1 C;  1X6B A;  1T0H A;  1K4U S;  2FRW A;  2W10 A;  4JJB A;  2J05 A;  2DYB A;  2F2V A;  1N5Z A;  2EGE A;  4HCK A;  3C0C A;  1KIK A;  3VS5 A;  1H92 A;  2HSP A;  2L0A A;  2YUQ A;  1AD5 A;  4Z89 A;  2FRY A;  3EG3 A;  2LX7 A;  2YUN A;  1AWX A;  2EYY A;  2HEQ A;  1UHF A;  2DL3 A;  2DL4 A;  2EYZ A;  3KFV A;  3JV3 A;  1ZLM A;  4ESR A;  4AG2 C;  1AVZ C;  2LJ1 A;  4RTZ A;  2SRC A;  1ZSG A;  2DM1 A;  1YNZ A;  2EW3 A;  2KEA A;  1NEB A;  1AWJ A;  2KXD A;  1UDL A;  1YCS B;  4J9D A;  2J06 A;  2LQW A;  2YUO A;  1WXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...