2K5LA

Solution nmr structure of protein feoa from clostridium thermocellum, northeast structural genomics consortium target cmr17
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeoA
publication title Solution NMR Structure of Protein FeoA from Clostridium thermocellum, Northeast Structural Genomics Consortium Target CmR17
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Structural genomics, unknown function
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k5lA00
2GCXA 3MHXA 1QW1A 3HRTA 5CVIA 2QQ9A 4O5VA 2K4YA 1FWZA 2H3JA 3E19A 1BI2A 3GLXA 2LX9A 2K5LA 2K5FA 1P92A 2K5IA 1G3SA 3HRSA 4O6JA 1QVPA 2QQBA 1FX7A 1G3WA 1BI1A 1BI0A 1G3TA 1U8RA 1G3YA 1BI3A 3HRUA 2QQAA 1BYMA
chains in the Genus database with same CATH superfamily
2LCCA 5CR2A 2RA2A 2X9HA 1W2BA 2Y4XA 2P84A 4QT7A 1ABOA 2PUKB 1JU5C 1YFNA 4KT0E 1TSFA 2RJEA 3LGLA 1YWPA 2RI2A 3OYEA 3GP8A 2F5TX 2J05A 3I5SA 4XK8E 1LVKA 1UG1A 1MMGA 3V7CA 4Q5WA 2NLUA 1WGSA 1XTDA 4FW2A 1K9MC 1UGSB 1VQ7T 1YIJA 4OGEA 4M77B 1I5LA 2V8JA 3CPFA 4FSXA 4FYXB 1RACB 4J9BA 2EYWA 2D8HA 4A4FA 2KE9A 5CQXA 4OB3B 5A0GA 2JS2A 2YUQA 2XDBA 4TVRA 4CC4B 1UGQB 2E6ZA 3QYHB 1AT1B 3JCMe 4M75F 1WHGA 1BCMA 2JNGA 3C0CA 4O5VA 4QKUA 1QVFP 2O2OA 4M78E 4PJLA 3N5BB 6AT1B 3ZL7C 4OB2B 2K5FA 4J9EA 3CMAA 2LJ0A 2D1XA 5GAMh 3PMIA 2JJ9A 2EGCA 2EFIA 1ZUUA 4E7ZA 5FRNA 4IUUA 3CD6A 1KQSS 5GAN3 2JOYA 3PVLA 1VQPT 3CXCS 2RQRA 1C6VX 2K9GA 2DAQA 1B7TA 4FT4A 1VQNA 5CKDA 3UF4A 1EFNA 2EJGA 4JDSA 1TG0A 3M59A 4II1A 2O4XB 4ORZA 3G4SQ 4E47A 2VXFA 1QP3A 3HRTA 2K3BA 2RQUA 2KT8A 4FW1A 3S3OA 4OMPA 5I2MA 4AG1C 4XU1A 1WJRA 1PM3A 1UFFA 1AWXA 1X2QA 1JEGA 1TWBA 2LVMA 1U1TA 1EZZB 1KHCA 2L89A 3G1JA 5IN1A 3M4YA 4EMKB 3EFSA 1JRIA 4F7UB 2HD0A 2EIFA 4OMQA 3EG3A 2F2XA 3OYFA 2QAZA 2OI3A 4XU3A 1GFCA 1NJIC 1NBEB 5DLQE 5J3BA 4DBFA 5CKFA 3SDZA 4C92F 2ED1A 4M7AF 4OMFB 2G6FX 1UB4A 2R58A 4M75E 1U1SA 4HCBA 1YHQA 1AD5A 2I0NA 2RHIA 4KGVB 2MCNA 2EQMA 3RR6A 3PNWC 2V1QA 2GFUA 3OYNA 4RUGA 1VQ9T 3HKSA 5I2SA 2D8JA 2HMAA 4JJDA 3VUZA 3CC2A 2K3XA 4XTYA 4E7LA 5LJ5j 2EWNA 3A8GB 2VGNA 5GAOq 1OOTA 3C95A 1OPLA 2E3IA 4WF2A 4J7IA 4BY6B 3QPHA 2KGTA 5GAOp 2OJ2A 3OB9A 2HQEA 4QVDA 4X1VA 1QVGA 2F1LA 2CP2A 3CBPA 4IUQA 1ZX6A 5LJ5d 2RQVA 3S3NA 2E12A 1JBMA 2CKKA 2GTJA 1YJWT 3QKJA 1VQ5T 2MIOA 2QEXT 1TTHB 4XTZA 2E5KA 1E7OA 4M77A 4OGCA 4M7DF 3INZA 2GQVA 1VQ8T 1RI0A 2DPPB 3FJPA 3JB9J 1Q7YR 2BZ8A 2KDSA 1WQWA 4C92E 2QA4T 4M7AE 3KUFA 2DERA 1OZ3A 1QMCA 4L6V5 2RI5A 2EQUA 3VS2A 2DTIA 3CCSA 1TOVA 1U8RA 5GMKe 1BI3A 1V76A 5LJ3e 2OTJA 2EYZA 4PJOE 2DM1A 2RPNA 1JJ2A 2ZPIB 1YITT 1X01A 1N6AA 2BKDN 1D0ZA 5C6SA 4D8DA 2LT4A 4XTWA 3CPWS 2K5IA 4FCYA 5FU7C 3CC7T 3REAB 1B3QA 4AG2C 3QUIA 1D1AA 2YT6A 1KK7A 1I07A 3V8JA 1HD3A 2VVKA 4EDUA 3EFRA 4C8QB 2BE7D 2DXCA 2O4XA 1QCNA 1YN8A 3KXTA 3PIOA 2KT1A 4DOWA 3CCQQ 3QYGB 1D3BB 2VGMA 2ROLA 4DEYA 3OBYA 1SKUB 3OYAA 2RO0A 1EX4A 3G6EA 1VQMQ 1VYVA 4X34A 1YJ9T 2DRKA 3PGGA 3JB9G 1UHCA 2A37A 4RKUE 1Q95G 1Y57A 3A8LB 1Q82C 2M0YA 3REBB 2ENMA 3JCMV 2CT4A 5I21A 2HQHA 4EMKA 3CCMA 4FM4B 2FPEA 1BIBA 1OU8A 2P0KA 2ZPFB 2DZ9A 1K8AC 4JJBA 4XTVA 2DETA 1OPKA 1WHMA 3CCVA 2OTJQ 4J6YA 3ASKA 2K3YA 3S6WA 2ZGWA 4QQGA 1KD1R 2VASA 3OYCA 2DVJA 4JZ4A 4BDZA 2NYSA 3CMEA 2DTOA 1NJIU 1YJNQ 2CP3A 4PJOB 1VQ4A 3D7SB 4O6JA 3CCET 1TUDA 3NGPA 3I56T 2LCSA 1ZA2B 3NPFA 2L3QA 5DY9A 4M78G 3LX7A 2SEMA 3FRNA 3MP8A 3A98A 1N8RC 1R8OB 2QTXA 3H8ZA 3NTHA 2K79A 2JMAA 2OTLA 3OY9A 2D0QB 4DEXA 3JCMc 2CH4W 1X43A 4B9WA 5CKHA 1X2KA 1VQ6Q 1B34B 2O9SA 1KC8U 3JB9H 5KH6A 2LT1A 4OF1A 3I55Q 1QCFA 2DL5A 5GAN7 1M1KC 4R56A 4E7JA 5KYNA 4X9DA 2CP7A 4BDYA 4FU6A 1MMAA 1ZSGA 3EG2A 3CPWP 4E7IA 4Y28E 2JM9A 3MEVA 3JCMP 3V8LA 4BI3A 2KY9A 2AKLA 4ATOA 1VQLA 3PMTA 2DVEA 5GAN8 1G2BA 3QBYA 3JCMQ 5GANf 4PLIA 3FLGA 4N0AC 4MZPA 3TVTA 1BIAA 4BE2A 2E64A 3M57A 5KE2A 3EG9B 3OW2P 4FT2A 3EHQA 2WSFE 2HZYA 2ESWA 1WDXA 1C0MA 4OMOA 1WPYA 1NZ9A 5HCKA 1QP2A 4CC3A 3RBBB 1M8MA 1M1FA 1JB0E 5AT1B 2LC4A 1AZGB 4FYVB 4KGXB 1ZLMA 4X9CA 2P4TA 4M75G 1YI2A 4PNOA 1GCQA 4AFQC 4GBQA 1W6XA 2CZ7B 1BKBA 3G71T 3SWNC 2XMFA 3H0HA 3NFCA 3E9GA 3RKWA 1MV3A 3MEAA 1MHNA 4QW2A 2CUDA 2M51A 2CS7A 4ZTJA 1VQKT 4WTOB 1WNLA 1FXXA 1M2VB 4C8QA 2QQSA 1VYTA 3OBWA 1H3HA 1RUWA 1TXQA 4UC4A 2DD5A 4A4KA 1WXUA 1PKSA 2M0OA 3GIBA 5CQYA 2LP5A 2IG0A 4M77E 1D3BA 3UA6A 1VQOT 2MAMA 3OS0A 4ZTFA 2VYTA 1B07A 1ZSZC 3GF5A 4PJJA 3FC3A 1K1ZA 3BFMA 1GL5A 1WHKA 1YCYA 4HT8A 1WX6A 1W2BS 4GLKA 3VUBA 3U23A 5FLXE 2LTOA 1YBYA 1YIJT 1GBQA 4JZ3A 4IUVA 1DJ7B 1KFZA 4XU0A 1T0HA 2HL5C 1WYXA 3EGDB 3I56Q 4B9XA 3UT1A 4KRTA 1RAGB 3UDCA 3QXEB 1S72Q 5EG2A 2BIVA 4LDYA 2RD1A 1Q82U 3NTKA 2KROA 8AT1B 2KVQG 3JCMb 2E70A 3CC4Q 1QVFA 1HJDA 2AHJB 3M0QA 2P0PA 1K8AU 2E4HA 3H41A 2VB6A 2MF2A 4PJOA 3HTRA 5FWCA 4C92G 4M7AG 4Z89A 1D0YA 2DIGA 4M4ZA 2DBKA 3MKDA 2CGHA 3CMAT 4FL6A 2ZPGB 1HYOA 2LQKA 3TREA 3L42A 3CD6T 1FMKA 4BUGA 1FX7A 2KK4A 3PTAA 2PQWA 3E2UA 4HT9A 2R5AA 3G4SA 2RI3A 5KYWB 1QWFA 4DBRA 4L59A 2IVWA 4JRPA 4LDXA 4LD6A 3MEUA 3OS1A 1VQNT 3HFNA 1B34A 1JXOA 4XAXB 3ULRB 1N8RU 2DLPA 3EH2A 3UA7A 3JCMd 1WI7A 1M2OA 4MMLA 3PIPA 2XI9A 2RHZA 2QQBA 4F7UE 2RK1A 3BW1A 4PJMA 1WZOA 2RHYA 4GLMA 1VYUA 1M8VA 2L2PA 4IUPA 2GGRA 1ZUKA 3X26B 1KIKA 1K9MR 3CCLA 2SRCA 2V1RA 1FMVA 4JJCA 5KYUB 2K7AA 4FYYB 3FEOA 2AK5A 3MO8A 5FU7B 5FU6C 2YLCA 2LJ1A 3UPUA 2JVVA 3DB4A 4BI8B 1M1KU 2QYZA 3GBQA 5GANh 2YRDA 3LW5E 4M7DG 1AVZC 3EG9A 1Y96B 1X69A 3M55A 4BD3A 2DIQA 1P92A 1YHQT 2P0QA 1M90C 4J9IA 1MUZA 3CEYA 4M7DC 1E6HA 2DEQA 3QDFA 2NUTB 4C8QF 3OSSC 5LJ5f 2GBQA 4BACA 2DYBA 5KYYB 4RTZA 5CVIA 3CCUQ 1VQOQ 2ROTA 2ZPHB 1K4US 1ZBJA 4JLIA 5HKCA 4P5NA 1RAHB 2CUBA 2CZ0B 2RN8A 5CO7A 4M7DD 3C12A 3CC2T 1TS9A 4JUVA 2G3RA 2RJCA 1M2VA 2V26A 9ATCB 2J6OA 3CCJT 2DKGA 4QVCA 4Z02A 2FZCB 3CCLQ 2FRWA 1UHFA 5D7UA 4AT1B 4ME7A 2KQWA 3CCRQ 3PE0A 2FPDA 4HCZA 1G3YA 2OAWA 1QVGS 4XQ3A 1C1AA 3MCAB 1K73C 2DZCA 4AFUC 1Q81U 1U3OA 2JW4A 4PJOF 2DE0X 2ZZDA 1N9RA 3EGDA 3HP9A 1RLQC 2FZKB 2EPDA 2YWWA 5LJ5g 1NJIR 2QG9B 2DTHA 1JQQA 1UGPB 1UGRB 2FYKA 2JZ2A 3L2ZA 3SEMA 1Y7XA 1OQKA 1LNXA 2VWFA 1H3ZA 4LNPA 1ZA1B 3EFOB 3RMSA 4C0DC 3TCJA 3M54A 1WHHA 1VQ7Q 2VV5A 1G3SA 4C8QE 3J80E 4N4GA 2MK5A 2X51A 2YRCA 1KC8R 3X20B 2DYIA 3L2RA 2E5QA 2CZ1B 1SEMA 1N27A 2GQIA 1U5SA 1KQSP 3TEEA 5KYWA 5IHKA 1FMWA 2LX9A 2OAUA 1JJ2S 3CCQA 2EQJA 2QGGA 3OYHA 3CXCP 3EAEA 3OYJA 2L0AA 5GMKj 2Z0WA 5LJ3j 1UUEA 1VQMA 1UGVA 2MWOA 2XHCA 2HKQB 2CP5A 1ACMB 3HRUA 1RABB 2YLBA 2FL7A 3VS6A 2PVOB 3BY7A 1M1GA 1K9MU 4A53A 2R57A 5LJ3d 4JPBW 4RTTA 1H641 3G6ET 3H9NA 4GY5A 1VQPQ 4M77G 3E9FA 5CIUA 5KYUA 3SWNB 2DL8A 1UECA 5GAOm 3VYHB 3G7ZA 4IURA 1ZBXA 1BYMA 3X28B 2XD0A 4V2SA 3CCMT 2AIRB 4C0ZA 3TSWA 2BE9B 4RG8A 1FWZA 1PWTA 2X4WA 2XDPA 3TQ7P 1YJNA 5HK3A 1NYGA 3HRSA 1Y96A 3A8OB 2A3LA 3UWNA 3M0UA 1ZQ1A 2WSCE 3EG1A 1WHLA 2DL7A 1NEGA 1NYFA 4F16A 3VYGA 2XK0A 4J9CA 1I5OB 1ZSZB 3CMET 1O75A 5A0LA 4A4GA 2L3SA 1VQ4T 1OX8A 3JCMJ 2NUTA 1SSHA 2HKNA 2QTVA 5KYYA 4C0GA 1FYNA 2EAYA 5LJ5h 3DLMA 1YJWA 2DILA 1D1CA 5GMKm 2JUFA 5DLOA 3NHNA 1MNDA 1M90U 2VUBA 1VQ6A 1I1JA 4NOYA 2KYBA 3I55A 2EBPA 1VQ8A 1VIFA 2OTLT 3MJXA 2PUOB 4N4HA 2E6NA 1BI2A 1MMDA 3CQTA 4AFSC 4JJNK 1NLOC 2L5QA 5IT9E 2QA4A 4F7UA 3M0PA 2EJFA 1VQ9Q 2FEIA 1IXDA 4LE9A 2KMTA 2NUPB 2A28A 2DF6A 1QKXA 2A0FB 4OP0A 3CPWA 2XKOC 3EHRA 2CSIA 3JB9D 3M56A 4D6WA 1CKAA 2EGEA 1Q82R 2QK0A 2FO0A 1VIEA 1OYXA 2D6FA 2DJZA 4PLLA 2CDTA 1BCOA 1QVPA 3KFVA 1PKTA 2RNAA 1K8AR 1VQLT 3CC7A 3AHUA 2AT1B 4J7FA 2CZ6B 4C0FA 3OW2A 1OX9A 5GAN5 1IHVA 1AWOA 2RQWA 2FPFA 2VKNA 1K73U 3LWHA 4L5GA 2PNIA 3EFOA 2COZA 3P8HA 5GJWB 4ZGJB 5FRMA 2MWPA 3OYBA 1Y71A 2XICA 1YJWQ 3RNJA 1AOJA 1VQ5Q 1AEYA 4F04B 4M78C 1R0CB 2QEXQ 1PRLC 4A4EA 1YI2T 3SFMA 1YJ9A 4M77F 3BDLA 4J5YA 1VQ8Q 2X4YA 2GNCA 1O9SA 1N8RR 4A54A 2F69A 3L2WA 4M78D 2KBTA 2QA4Q 2O9VA 2RJFA 2E65A 2W10A 5FU6B 2LZ6B 3V8KA 1G3WA 1VUBA 1G8XA 4QVZA 4N0AA 3KBGA 1RAAB 1K9AA 3EH1A 1LJOA 4K11A 2R5MA 4LUDA 2BUDA 1HSQA 1I0CA 4OMNA 2D0NA 1W70A 3L1AA 2BZXA 2LDMA 3QZ5B 2HSEB 2K5LA 1YITQ 1ZUYA 2COWA 2PU9B 3FJ5A 3JAME 1M1KR 2JTMA 1AHJB 3QJYA 4PFPA 4M7DB 1PD0A 5D6XA 3CCEA 2QQAA 3CC7Q 3C94A 2FG0A 1QW1A 2XU8A 3I56A 2KEAA 3SWNA 2JMCA 3IQLA 3VS4A 2QQ9A 1S72A 2B86A 2AZVA 1RI9A 2K4YA 2KI7A 1OEBA 1PRMC 1ZHIA 4KBMB 2HQXA 3OSVA 3CBOA 3CC4A 4JRQA 3QWYA 3A8MB 2IIMA 1IGQA 5IXBA 2RK2A 1TUGB 5GAN6 4ZN1A 1Y07A 2GCXA 4HCCA 4OMMA 2Y4YA 3TU4K 3C4SA 4M75C 1YJ9Q 1XQHA 3S3MA 2KR3A 1WJQA 1ZSZA 2RQTA 1K76A 3JCMf 2FB7A 4M75D 2K57A 1T0JA 3OS2A 2OX7A 3OYLA 4F7UF 3JB9I 4LD9K 4OB1B 4LN2A 4QQDA 3VS3A 2F2WA 3EGUA 1YWOA 2B8AA 4C8QG 1OI1A 2HBWA 3LH5A 3OYDA 2QDLA 3DB3A 1GBRA 1AZEA 1UTIA 1KJWA 2KAFA 3QSUA 3CCEQ 3BDUA 2J6KA 2BZYA 1WXBA 2XIDA 1Q81R 2YUPA 1N5ZA 5C0MA 1LCKA 4C0DB 1Q86C 5GAMj 2NUPA 2WACA 3OS5A 2EW3A 1SF9A 5GANj 3P8DA 4A63B 2V8KA 3P8BB 3VS0A 3SHWA 1M3CA 2LX7A 2P4RA 2EQKA 5GAMd 2LNHB 2X3XD 2FRYA 2QDYB 3FDRA 3JCMg 3ER0A 1KQ2A 2J06A 3JCMX 1X6GA 2MYSA 4BI4A 5CK9A 5GAMe 1VQKA 2DJQA 4DBQA 1R0BG 2WSEE 4AMCA 1RL2A 4HVVA 2ABLA 4C92C 5GANe 1BI1A 4PK4A 4M7AC 1WXTA 4PJOG 1UJ0A 4HKEA 4KH0B 2E10A 3Q1JA 4Y92A 2YRVA 3CCUA 3QG1A 1QQJA 1RAEB 4XU2A 5A0DA 1VQOA 2M02A 2LRQA 4ELYC 4RTWA 4C92D 5GMKi 5KCHA 4M7AD 2F5KA 5IH2A 1A0NB 1SRMA 4EMHA 2ECZA 4PJOC 3VV0A 1CKBA 2PVDB 1G3TA 1PSFA 4EMGA 1T3LA 2K6DA 1PD1A 3OMGA 1UE9A 4PJOD 3RMQA 2XG8D 4KUIA 4A4HA 1GXIE 2C0TA 2DRMA 3H0IA 1WLPB 3THKA 3M9QA 4PL6A 5GAOl 2CYZB 2KRNA 2DMOA 3JRZA 2DBMA 1K0SA 2RMOA 1KQ1A 3CCRA 1YNZA 3GOXA 2EYYA 1PHTA 2BTTA 4J9HA 3G71Q 2LQNA 1V29B 1PG5B 3O8VA 4E6RA 4M7DA 3VS1A 2LNVA 2F2VA 1KHIA 1WJSA 2DNUA 2XDDA 4XTXA 2C06A 3L2QA 1VQKQ 1SHFA 2YDLA 1WIEA 3R6NA 1IGUA 2ZPEB 1H92A 3EGXB 4NS5A 5J26A 1I4K1 3O5ZA 5A2QE 1W2BP 4RTUA 4RTXA 1M3AA 3M58A 3OYMA 3A1PA 3QZ9B 2M16A 5DM7R 2FZGB 1SHGA 1AWWA 1GCPA 1XNIA 5GMKl 1VQ7A 3OA6A 4KUDK 4CI0C 2EYXA 3M0RA 4R55A 2EGAA 1F1BB 1IRXA 3F70A 2JN0A 1M90R 5ECAA 4Y91A 3RDVA 1YIJQ 3JCMh 3QIIA 1V1CA 1PNJA 2W0ZA 4FYWB 2RHXA 3GLXA 4JS5A 4MZTA 1BU1A 4LDUA 4RCBA 5LJ3f 4DBHA 1KSWA 1KQSA 4NL3A 3QWXX 3E1SA 2PVGB 1TH7A 4OMLA 4J8OA 3SB2A 8ATCB 3CXCA 1SRLA 4C5HA 4B6MA 3CCQT 1WHJA 4ANJA 3DKMA 4HA8A 1QKWA 4ZGEB 3I35A 1NG2A 4RCCA 1VQMT 1M4ZA 1VQPA 3CMAQ 4F17A 4JS4A 1YCSB 2JXBA 4LDVA 3ME9A 4AFZC 3TSZA 4IUTA 4M78B 2DD4A 2ED0A 4PKCC 1QCOA 3CD6Q 5FROA 2KSSA 4J9DA 4J83A 2YSQA 4VUBA 1M9SA 1TU0B 3CCST 4J9GA 3RERA 1K73R 2JS0A 2KXDA 3PFSA 3QO3A 4XTUA 1Q86U 2L3RA 2M1HA 1VQNQ 2DL3A 1MGQA 2OTJT 3MP1A 2YUNA 2ZCFB 2DK3A 3PT9A 1KC8C 4D8KA 2RH2A 1Z9ZA 1BBZA 2RF0A 3MHXA 5CKBA 3OYGA 4ELZC 5LJ3g 1YJNT 1NPPA 4RMOA 2DFUA 3CCJA 2KRSA 3T9NA 1G83A 1JO8A 5CCAA 4ZNXA 5GAN2 1Z9QA 4E2FB 4RG2A 3NTIA 1SSFA 3JCMW 1GFDA 1N9SA 1OULA 1Q7YC 2KYMA 1NM7A 5LJ5e 2GF7A 2H3EB 2VXEA 4KULA 1VQ6T 1MNEA 1K0XA 2E3HA 1VQ9A 2HSPA 3I55T 1YHQQ 2NUZA 4E7KA 4MDXA 5D6WA 1VA7A 1UEBA 1LPLA 3HSBA 2DO3A 4M75B 3ZBDA 4LXCA 4IIOA 4M77C 2AZSA 1I8FA 2O01E 1U06A 1WQ7A 2DL4A 1NEBA 3CCVT 3BE3A 4J9FA 5J39A 4F14A 4BE0A 3CC2Q 1GRIA 3PVQA 3JV3A 2ATCB 4M77D 3URGA 5GAOn 3EGXA 3X24B 4DA4A 2HAXA 2L8DA 2NWMA 2MI6A 1QVGP 5IHNA 3CCJQ 1RAFB 3RIRA 5KYXB 2QASA 1IZ6A 3GNGA 2DXUA 2CP6A 5CKEA 1WA7A 1BB9A 2EYQA 2X4XA 1VQ5A 2CREA 1BK2A 2LJ3A 2CT3A 3RUXA 1X6OA 3WVEB 2QEXA 2X35A 2EKOA 2V8IA 4BB7A 3M5AA 1M27C 5HY6A 1OZ2A 1OU9A 1J3TA 2H3JA 5CAIA 3OW2S 1W4SA 3ZEHA 4JRIA 1HK9A 5M9OA 4C5EA 2L3PA 5KE3A 2HEQA 1TUCA 5EC7A 3FB9A 3RKYA 2YXYA 2O31A 1T3SA 3LGFA 4PFOA 5GMKh 2FVUA 5LJ3h 5GJVB 1KD1C 1QWEA 2X3WD 5L23A 2J7IA 3L2UA 1LOJA 3ZFJA 4M7DE 3QHSA 1SPKA 3I9QA 4F7UG 1X75C 4RTVA 1YITA 3CCSQ 1UJYA 2YHTA 1IREB 3LLRA 4C92B 2GTOA 1E6GA 4M7AB 2K2MA 1JJ2P 3L2VA 3DLLA 4EMKC 3H6ZA 4IKFA 4MZMA 1ARKA 2A36A 1D0XA 4M78A 3RESA 2O88A 2EQIA 3RKXA 3M0SA 3I5RA 4C5GA 5IXFA 4DOVA 3HFOA 5GAOr 1HXDA 1CSKA 2CSQA 4LUEA 7AT1B 4E7HA 2J6FA 1NLPC 3X25B 1BI0A 1PCXA 1M5Q1 1VOMA 2PZ1A 1S72T 2FHDA 1M30A 3OYYA 4CC2A 2HL3A 2LQWA 3CC4T 2I2LA 1IB8A 4KGZB 4EPCA 2IPOB 1KG1A 2VC8A 2A08A 3OMCA 4HXJA 3VU3C 4R0KA 4J6XA 2HDAA 3MEWA 2HBPA 3META 3G6EQ 2JM8A 3NMZC 4PFZA 4JLGA 3QJ6A 2D9TA 1IHWA 5AYFA 4NL2A 2GFAA 4EIKA 2RB6A 4C5IA 4HCKA 4CRIA 2RJDA 4BY6C 2MOXA 4E7SA 3R6OA 3CCMQ 3OQ5A 3SD4A 3V7SA 2DXBA 1ABQA 2C0OA 3WVDB 1PC0A 2YUOA 1X27A 2MMPA 2KRMA 4ESRA 3CCVQ 3MPUB 2JTFA 3HHTB 2EJ9A 2QXFA 3VS5A 2QI2A 1MV0B 1Q7YU 4YTLA 5GAMf 2JT4A 2LMJA 3H0FA 3GPLA 5I22A 2RM4A 3HPWA 4CC7A 3CMEQ 3HL8A 4HVUA 2ZPBB 1VQ4Q 4M75A 3A5ZB 3OYKA 2E41A 3MP6A 1R77A 1H8KA 3VJPA 3V7RA 2DEUA 1RLPC 3LWIA 2KXCA 1AWJA 1I81A 3VRZA 3VS7A 3J7AF 5LL6S 3QDRB 4BE1A 1OV3A 4MDWA 4ZN3A 4QQ6A 2H8HA 2QQRA 1W1FA 5HK0A 2EKHA 3EG0A 4FSSA 2DA9A 3M0TA 2AKKA 2JTEA 2M9UA 3JB9F 2Y90A 1XJWB 4DQ2A 4Z8AA 4KH1B 2OTLQ 4Z88A 2EVRA 5IAYA 4WCIA 3AT1B 2E1HA 3WXMB 1M3BA 1D1BA 3J81E 5KYXA 2MPXC 4RTYA 1QVFS 1JXMA 1RAIB 1MMNA 1GCQC 5D6YA 4ZGDB 2K2VA 2KNBB 4N4IA 2HCKA 1WFWA 3FIFA 4OB0B 4LDWA 2COYA 2HNIA 2LQ8A 1G5VA 1YP5A 2A7YA 1NPRA 2DX1A 5FWBA 2C0IA 4HVWA 3LYIA 3G4ST 5GAMg 2PTKA 2RHUA 3CCUT 1XOVA 4JRKA 5GANg 1Q81C 1IO6A 4PJNA 3OYIA 4C8QC 2QGFB 1Y0MA 5I11A 1VQLQ 5IHIA 5KCOA 2LCLA 4MMKA 3CBMA 3VRYA 2CH4A 2X4JA 3M53A 1NE8A 1UDLA 1D09B 5FW9A 3M4GA 4M78F 4IIMA 2CP0A 4C8QD 4OVAA 5GAN4 3LH0A 1PSEA 3CCLT 3VKIA 1QLYA 1S1NA 3G71A 3GNFB 4C92A 4M7AA 5GANd 3JSCA 3UATA 1EIFA 1RADB 1KD1U 3E19A 1Q86R 3CCRT 1YI2Q 3A8HB 1SG5A 4J6WA 2ZAEA 1X6BA 5L8RE 2DXTA 4FIBA
chains in the Genus database with same CATH topology
3MEVA 2LCCA 5CR2A 2RA2A 3JCMP 3VYGA 2XK0A 3V8LA 4BI3A 2Y4XA 4C5HA 3CMET 1O75A 2KY9A 1W2BA 5A0LA 2PUKB 3CCQT 1VQLA 4ATOA 3PMTA 2DVEA 5GAN8 4A4GA 1VQ4T 3DKMA 4HA8A 3JCMJ 4KT0E 3QBYA 3JCMQ 4ZGEB 4C0GA 5GANf 4PLIA 2EAYA 4RCCA 5LJ5h 3FLGA 4N0AC 1VQMT 2RJEA 4MZPA 1M4ZA 3LGLA 2RI2A 3DLMA 1VQPA 3OYEA 3GP8A 1YJWA 2F5TX 4JS4A 1BIAA 4BE2A 2E64A 4LDVA 5GMKm 3M57A 2JUFA 3ME9A 4XK8E 5KE2A 5DLOA 4IUTA 3V7CA 4M78B 4FT2A 2DD4A 2NLUA 4Q5WA 1WGSA 4PKCC 1XTDA 2WSFE 1M90U 2VUBA 5FROA 1K9MC 1VQ6A 2KSSA 4NOYA 1WPYA 1NZ9A 1UGSB 4J83A 1QP2A 1VQ7T 1YIJA 3I55A 4VUBA 1M1FA 1JB0E 1M9SA 1VIFA 1VQ8A 4OGEA 3CCST 2OTLT 3RERA 2LC4A 2PUOB 4M77B 4N4HA 1I5LA 2E6NA 1BI2A 4X9CA 3PFSA 3QO3A 2P4TA 2V8JA 3CPFA 2L3RA 4M75G 4PNOA 4XTUA 4FSXA 4JJNK 1YI2A 2L5QA 2M1HA 2QA4A 5IT9E 4F7UA 1MGQA 4A4FA 2OTJT 2EJFA 2CZ7B 3MP1A 1BKBA 2ZCFB 2DK3A 3PT9A 5CQXA 3SWNC 3G71T 1KC8C 4OB3B 5A0GA 2XDBA 2RH2A 3NFCA 3E9GA 4TVRA 2KMTA 1UGQB 3RKWA 2E6ZA 3QYHB 3JCMe 3MHXA 4M75F 5CKBA 3MEAA 1MHNA 3OYGA 4OP0A 3CPWA 4ELZC 5LJ3g 4QW2A 2CS7A 2XKOC 4ZTJA 1YJNT 1NPPA 3JB9D 1VQKT 2JNGA 3M56A 4O5VA 4RMOA 3CCJA 4D6WA 1WNLA 1FXXA 4M78E 3N5BB 1VIEA 1OYXA 4OB2B 2K5FA 3T9NA 4C8QA 2QQSA 2D6FA 5CCAA 3OBWA 3CMAA 2DJZA 4PLLA 5GAN2 5GAMh 3PMIA 1QVPA 4UC4A 2DD5A 1Q82U 4A4KA 2M0OA 3GIBA 4RG2A 3NTIA 5CQYA 2EFIA 5FRNA 1SSFA 3JCMW 1VQLT 2IG0A 4M77E 1N9SA 3CC7A 1Q7YC 1D3BA 4IUUA 3AHUA 1VQOT 3CD6A 2MAMA 3OS0A 4ZTFA 4J7FA 1KQSS 2VYTA 2CZ6B 3GF5A 4C0FA 5GAN3 2JOYA 3OW2A 5GAN5 3FC3A 5LJ5e 1VQPT 2GF7A 3BFMA 3CXCS 1K73U 1YCYA 3LWHA 2VXEA 4L5GA 4HT8A 1W2BS 2DAQA 4FT4A 3P8HA 4KULA 4ZGJB 5FRMA 2MWPA 3OYBA 1VQNA 1Y71A 2XICA 1VQ6T 5CKDA 4GLKA 3VUBA 1VQ9A 5FLXE 2EJGA 4JDSA 2LTOA 1YBYA 4M78C 3I55T 1YIJT 4II1A 3M59A 4IUVA 2O4XB 1DJ7B 4XU0A 4E7KA 4A4EA 5D6WA 4E47A 4MDXA 2VXFA 1QP3A 3HRTA 4B9XA 1YI2T 1UEBA 3SFMA 3UT1A 1YJ9A 2DO3A 3HSBA 4M75B 4M77F 3UDCA 3QXEB 3ZBDA 3BDLA 3S3OA 4J5YA 5I2MA 5EG2A 2X4YA 2BIVA 4M77C 4LDYA 4XU1A 1I8FA 1O9SA 2RD1A 2O01E 1WJRA 3NTKA 2F69A 1WQ7A 4M78D 4A54A 3L2WA 2KVQG 3JCMb 2E70A 1QVFA 2RJFA 2LVMA 2E65A 5FU6B 1U1TA 2AHJB 3CCVT 3V8KA 1G3WA 2P0PA 1VUBA 5J39A 1KHCA 4QVZA 4BE0A 4N0AA 1K8AU 3KBGA 2L89A 4M77D 1Q86U 2MF2A 4PJOA 5IN1A 4C92G 3M4YA 4M7AG 4EMKB 1LJOA 3EFSA 2R5MA 3URGA 2BUDA 2DIGA 3X24B 1JRIA 5GAOn 4DA4A 4F7UB 2HD0A 2HAXA 2CGHA 2EIFA 2L8DA 3L1AA 3CMAT 2MI6A 3OYFA 2LDMA 4FL6A 3QZ5B 4XU3A 2ZPGB 1NJIC 2LQKA 5DLQE 3TREA 3RIRA 5J3BA 3L42A 2K5LA 5CKFA 3SDZA 4C92F 1IZ6A 3GNGA 2DXUA 4M7AF 4OMFB 2PU9B 5CKEA 3CD6T 1UB4A 2EYQA 2X4XA 4BUGA 2R58A 3JAME 1FX7A 1VQ5A 4M75E 1U1SA 2JTMA 4HCBA 1AHJB 2KK4A 3QJYA 3RUXA 4M7DB 1X6OA 3WVEB 3PTAA 1YHQA 5D6XA 3CCEA 2QQAA 2PQWA 2RHIA 2QEXA 2X35A 4HT9A 2R5AA 2EKOA 3G4SA 2V8IA 3C94A 4BB7A 1QW1A 2EQMA 2RI3A 2XU8A 3M5AA 3I56A 4L59A 2IVWA 3SWNA 4JRPA 5HY6A 3PNWC 4LDXA 2QQ9A 3MEUA 4LD6A 1OZ2A 3OS1A 1S72A 3HFNA 1VQNT 2K4YA 2GFUA 2H3JA 1B34A 4XAXB 5CAIA 3OYNA 1N8RU 1VQ9T 1ZHIA 3HKSA 5I2SA 3JCMd 3OW2S 4KBMB 2HQXA 3OSVA 1W4SA 3CBOA 4JRIA 3ZEHA 4MMLA 3CC4A 3PIPA 4JRQA 1HK9A 2XI9A 5M9OA 2RHZA 2QQBA 4C5EA 4F7UE 3A8MB 2RK1A 5KE3A 3BW1A 2RHYA 2RK2A 3VUZA 3FB9A 5GAN6 3CC2A 1M8VA 2K3XA 4IUPA 4ZN1A 1Y07A 3RKYA 2GCXA 3X26B 4HCCA 3LGFA 4XTYA 5GMKh 4E7LA 2FVUA 5LJ3h 2Y4YA 5LJ5j 3TU4K 2EWNA 3A8GB 1KD1C 3C4SA 4M75C 2VGNA 5GAOq 3CCLA 3C95A 1LOJA 1XQHA 4WF2A 3L2UA 4J7IA 3S3MA 3ZFJA 4BY6B 3QPHA 5GAOp 3QHSA 4M7DE 3OB9A 1WJQA 2HQEA 4F7UG 1X75C 1YITA 3FEOA 4QVDA 3MO8A 1QVGA 5FU7B 5FU6C 2YHTA 1IREB 2YLCA 3CBPA 3LLRA 4IUQA 3JCMf 4C92B 2JVVA 3UPUA 3DB4A 4M7AB 4BI8B 5LJ5d 1M1KU 2FB7A 4M75D 2K57A 3OS2A 3S3NA 5GANh 3L2VA 3DLLA 3OYLA 4EMKC 3LW5E 4F7UF 2E12A 3JB9I 4LD9K 3H6ZA 4OB1B 1JBMA 4M7DG 4IKFA 4MZMA 1Y96B 4M78A 4QQDA 3RESA 2CKKA 3RKXA 3M55A 1YJWT 2B8AA 2DIQA 3QKJA 4BD3A 4C8QG 1VQ5T 1OI1A 4C5GA 4DOVA 1P92A 3OYDA 3HFOA 1YHQT 2P0QA 5GAOr 3DB3A 2QEXT 4XTZA 1HXDA 4E7HA 4M77A 4OGCA 4M7DF 1M90C 3X25B 1BI0A 2KAFA 3CEYA 3QSUA 4M7DC 3INZA 1M5Q1 2DEQA 2GQVA 4C8QF 3OSSC 5LJ5f 1RI0A 1S72T 4BACA 1VQ8T 2DPPB 3BDUA 3FJPA 3JB9J 2FHDA 5CVIA 3OYYA 2KDSA 2XIDA 1WQWA 4C92E 5C0MA 3CC4T 2I2LA 4C0DB 1Q86C 2QA4T 4EPCA 4M7AE 2ZPHB 3KUFA 5GAMj 5HKCA 2VC8A 4JLIA 1KG1A 4P5NA 1OZ3A 2CZ0B 2WACA 3OMCA 3OS5A 5CO7A 4M7DD 4L6V5 2RI5A 2EQUA 3VU3C 3C12A 4J6XA 5GANj 2DTIA 4JUVA 3CC2T 3CCSA 3P8DA 2G3RA 3MEWA 2HBPA 2RJCA 2V8KA 3META 3P8BB 1U8RA 5GMKe 1BI3A 5LJ3e 4JLGA 3QJ6A 2EQKA 2OTJA 5GAMd 2D9TA 4PJOE 5AYFA 3CCJT 2QDYB 3FDRA 2DKGA 4NL2A 2GFAA 1JJ2A 4QVCA 2ZPIB 1YITT 2RB6A 4C5IA 1X01A 4Z02A 3JCMg 4CRIA 1N6AA 3ER0A 2BKDN 2RJDA 4BY6C 1KQ2A 5C6SA 3R6OA 3JCMX 3OQ5A 2LT4A 4XTWA 3SD4A 4BI4A 5CK9A 5GAMe 1VQKA 3V7SA 2DXBA 3CPWS 2K5IA 5FU7C 2WSEE 3WVDB 3CC7T 4ME7A 1RL2A 4C92C 5GANe 2KQWA 1BI1A 4M7AC 3QUIA 4PJOG 4HKEA 4HCZA 2MMPA 1G3YA 2E10A 3V8JA 3Q1JA 1QVGS 2JTFA 3HHTB 4EDUA 2EJ9A 4XQ3A 2QXFA 2QI2A 2YRVA 1Q7YU 3EFRA 4YTLA 4C8QB 3CCUA 3MCAB 3QG1A 5GAMf 3GPLA 1K73C 2DZCA 4XU2A 5A0DA 1VQOA 1Q81U 2LRQA 4ELYC 2DXCA 4C92D 2O4XA 2RM4A 5GMKi 3HPWA 5KCHA 2F5KA 4M7AD 4PJOF 2ZZDA 1N9RA 3KXTA 3PIOA 4EMHA 3HL8A 3HP9A 4DOWA 4PJOC 3QYGB 5LJ5g 1D3BB 2ZPBB 2VGMA 4M75A 3A5ZB 3OBYA 2E41A 3MP6A 3OYKA 3VV0A 2DTHA 3VJPA 3V7RA 3OYAA 3LWIA 1UGPB 2RO0A 2PVDB 1I81A 1UGRB 2FYKA 2JZ2A 3G6EA 1G3TA 3J7AF 5LL6S 1PSFA 3QDRB 4EMGA 4X34A 3L2ZA 3PGGA 4MDWA 4ZN3A 4BE1A 3JB9G 1Y7XA 1YJ9T 1LNXA 4QQ6A 3OMGA 2QQRA 4RKUE 1H3ZA 5HK0A 4PJOD 3RMQA 3A8LB 1Q82C 3RMSA 2XG8D 4KUIA 4C0DC 4A4HA 1GXIE 3JCMV 5I21A 3TCJA 3M54A 4EMKA 3CCMA 3M9QA 4PL6A 2VV5A 4FM4B 2M9UA 5GAOl 2CYZB 2Y90A 3JB9F 4DQ2A 1BIBA 1G3SA 2P0KA 2ZPFB 3JRZA 4C8QE 2DZ9A 5IAYA 3J80E 1K8AC 4N4GA 4XTVA 1KQ1A 2E1HA 3WXMB 3CCRA 3J81E 3GOXA 3CCVA 1QVFS 3X20B 4J6YA 3ASKA 1V29B 5D6YA 2K2VA 4ZGDB 3O8VA 4N4IA 3L2RA 4M7DA 2E5QA 3FIFA 2CZ1B 2K3YA 3S6WA 1N27A 2LNVA 2ZGWA 4QQGA 4LDWA 4OB0B 3OYCA 2HNIA 2LQ8A 1KHIA 1WJSA 2XDDA 3TEEA 4BDZA 1G5VA 2A7YA 3CMEA 2OAUA 2DTOA 2LX9A 1NPRA 4XTXA 1JJ2S 3CCQA 2EQJA 1NJIU 2C06A 4PJOB 3L2QA 1VQ4A 3OYHA 4O6JA 3CCET 2ZPEB 3EAEA 3LYIA 3OYJA 5GMKj 3G4ST 4NS5A 5J26A 5LJ3j 1I4K1 5GAMg 5A2QE 1VQMA 2MWOA 2RHUA 3CCUT 2XHCA 3I56T 1XOVA 3HRUA 3M58A 4JRKA 5GANg 3OYMA 1Q81C 2YLBA 3QZ9B 2M16A 5DM7R 5DY9A 3OYIA 4M78G 2FL7A 4C8QC 3LX7A 3FRNA 2PVOB 3BY7A 3MP8A 1M1GA 1K9MU 1N8RC 5KCOA 1R8OB 2QTXA 3H8ZA 4A53A 1XNIA 2LCLA 2R57A 3NTHA 4MMKA 5LJ3d 3CBMA 5GMKl 2X4JA 3M53A 1H641 1NE8A 3G6ET 1VQ7A 4GY5A 3OA6A 3M4GA 4KUDK 4M77G 4CI0C 2OTLA 3E9FA 4M78F 4R55A 4C8QD 3OY9A 4OVAA 2D0QB 5CIUA 3SWNB 5GAOm 5GAN4 3VYHB 3F70A 3LH0A 3G7ZA 3JCMc 2JN0A 1PSEA 4IURA 1ZBXA 5CKHA 4B9WA 3CCLT 1BYMA 1B34B 4Y91A 3VKIA 3X28B 1KC8U 2XD0A 3JB9H 3G71A 3GNFB 3CCMT 4C92A 4V2SA 5KH6A 2LT1A 4M7AA 4OF1A 4C0ZA 3JCMh 5GANd 3JSCA 3QIIA 4RG8A 1EIFA 1KD1U 1FWZA 2X4WA 2XDPA 5GAN7 2RHXA 3E19A 3GLXA 3CCRT 4JS5A 3A8HB 4MZTA 4LDUA 4RCBA 1YJNA 5HK3A 5LJ3f 1M1KC 3HRSA 1Y96A 4R56A 4E7JA 4J6WA 3A8OB 2A3LA 3UWNA 1KQSA 4X9DA 4NL3A 2WSCE 1ZQ1A 5L8RE 2DXTA 2PVGB 1TH7A 3E1SA 4FIBA 4FU6A 4BDYA 4J8OA 3SB2A 4E7IA 4Y28E 3CXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GCX A;  3MHX A;  1QW1 A;  3HRT A;  5CVI A;  2QQ9 A;  4O5V A;  2K4Y A;  1FWZ A;  2H3J A;  3E19 A;  1BI2 A;  3GLX A;  2LX9 A;  2K5L A;  2K5F A;  1P92 A;  2K5I A;  1G3S A;  3HRS A;  4O6J A;  1QVP A;  2QQB A;  1FX7 A;  1G3W A;  1BI1 A;  1BI0 A;  1G3T A;  1U8R A;  1G3Y A;  1BI3 A;  3HRU A;  2QQA A;  1BYM A; 
#chains in the Genus database with same CATH topology
 2LCC A;  5CR2 A;  2RA2 A;  2X9H A;  1W2B A;  2Y4X A;  2P84 A;  4QT7 A;  1ABO A;  2PUK B;  1JU5 C;  1YFN A;  4KT0 E;  1TSF A;  2RJE A;  3LGL A;  1YWP A;  2RI2 A;  3OYE A;  3GP8 A;  2F5T X;  2J05 A;  3I5S A;  4XK8 E;  1LVK A;  1UG1 A;  1MMG A;  3V7C A;  4Q5W A;  2NLU A;  1WGS A;  1XTD A;  4FW2 A;  1K9M C;  1UGS B;  1VQ7 T;  1YIJ A;  4OGE A;  4M77 B;  1I5L A;  2V8J A;  3CPF A;  4FSX A;  4FYX B;  1RAC B;  4J9B A;  2EYW A;  2D8H A;  4A4F A;  2KE9 A;  5CQX A;  4OB3 B;  5A0G A;  2JS2 A;  2YUQ A;  2XDB A;  4TVR A;  4CC4 B;  1UGQ B;  2E6Z A;  3QYH B;  1AT1 B;  3JCM e;  4M75 F;  1WHG A;  1BCM A;  2JNG A;  3C0C A;  4O5V A;  4QKU A;  1QVF P;  2O2O A;  4M78 E;  4PJL A;  3N5B B;  6AT1 B;  3ZL7 C;  4OB2 B;  2K5F A;  4J9E A;  3CMA A;  2LJ0 A;  2D1X A;  5GAM h;  3PMI A;  2JJ9 A;  2EGC A;  2EFI A;  1ZUU A;  4E7Z A;  5FRN A;  4IUU A;  3CD6 A;  1KQS S;  5GAN 3;  2JOY A;  3PVL A;  1VQP T;  3CXC S;  2RQR A;  1C6V X;  2K9G A;  2DAQ A;  1B7T A;  4FT4 A;  1VQN A;  5CKD A;  3UF4 A;  1EFN A;  2EJG A;  4JDS A;  1TG0 A;  3M59 A;  4II1 A;  2O4X B;  4ORZ A;  3G4S Q;  4E47 A;  2VXF A;  1QP3 A;  3HRT A;  2K3B A;  2RQU A;  2KT8 A;  4FW1 A;  3S3O A;  4OMP A;  5I2M A;  4AG1 C;  4XU1 A;  1WJR A;  1PM3 A;  1UFF A;  1AWX A;  1X2Q A;  1JEG A;  1TWB A;  2LVM A;  1U1T A;  1EZZ B;  1KHC A;  2L89 A;  3G1J A;  5IN1 A;  3M4Y A;  4EMK B;  3EFS A;  1JRI A;  4F7U B;  2HD0 A;  2EIF A;  4OMQ A;  3EG3 A;  2F2X A;  3OYF A;  2QAZ A;  2OI3 A;  4XU3 A;  1GFC A;  1NJI C;  1NBE B;  5DLQ E;  5J3B A;  4DBF A;  5CKF A;  3SDZ A;  4C92 F;  2ED1 A;  4M7A F;  4OMF B;  2G6F X;  1UB4 A;  2R58 A;  4M75 E;  1U1S A;  4HCB A;  1YHQ A;  1AD5 A;  2I0N A;  2RHI A;  4KGV B;  2MCN A;  2EQM A;  3RR6 A;  3PNW C;  2V1Q A;  2GFU A;  3OYN A;  4RUG A;  1VQ9 T;  3HKS A;  5I2S A;  2D8J A;  2HMA A;  4JJD A;  3VUZ A;  3CC2 A;  2K3X A;  4XTY A;  4E7L A;  5LJ5 j;  2EWN A;  3A8G B;  2VGN A;  5GAO q;  1OOT A;  3C95 A;  1OPL A;  2E3I A;  4WF2 A;  4J7I A;  4BY6 B;  3QPH A;  2KGT A;  5GAO p;  2OJ2 A;  3OB9 A;  2HQE A;  4QVD A;  4X1V A;  1QVG A;  2F1L A;  2CP2 A;  3CBP A;  4IUQ A;  1ZX6 A;  5LJ5 d;  2RQV A;  3S3N A;  2E12 A;  1JBM A;  2CKK A;  2GTJ A;  1YJW T;  3QKJ A;  1VQ5 T;  2MIO A;  2QEX T;  1TTH B;  4XTZ A;  2E5K A;  1E7O A;  4M77 A;  4OGC A;  4M7D F;  3INZ A;  2GQV A;  1VQ8 T;  1RI0 A;  2DPP B;  3FJP A;  3JB9 J;  1Q7Y R;  2BZ8 A;  2KDS A;  1WQW A;  4C92 E;  2QA4 T;  4M7A E;  3KUF A;  2DER A;  1OZ3 A;  1QMC A;  4L6V 5;  2RI5 A;  2EQU A;  3VS2 A;  2DTI A;  3CCS A;  1TOV A;  1U8R A;  5GMK e;  1BI3 A;  1V76 A;  5LJ3 e;  2OTJ A;  2EYZ A;  4PJO E;  2DM1 A;  2RPN A;  1JJ2 A;  2ZPI B;  1YIT T;  1X01 A;  1N6A A;  2BKD N;  1D0Z A;  5C6S A;  4D8D A;  2LT4 A;  4XTW A;  3CPW S;  2K5I A;  4FCY A;  5FU7 C;  3CC7 T;  3REA B;  1B3Q A;  4AG2 C;  3QUI A;  1D1A A;  2YT6 A;  1KK7 A;  1I07 A;  3V8J A;  1HD3 A;  2VVK A;  4EDU A;  3EFR A;  4C8Q B;  2BE7 D;  2DXC A;  2O4X A;  1QCN A;  1YN8 A;  3KXT A;  3PIO A;  2KT1 A;  4DOW A;  3CCQ Q;  3QYG B;  1D3B B;  2VGM A;  2ROL A;  4DEY A;  3OBY A;  1SKU B;  3OYA A;  2RO0 A;  1EX4 A;  3G6E A;  1VQM Q;  1VYV A;  4X34 A;  1YJ9 T;  2DRK A;  3PGG A;  3JB9 G;  1UHC A;  2A37 A;  4RKU E;  1Q95 G;  1Y57 A;  3A8L B;  1Q82 C;  2M0Y A;  3REB B;  2ENM A;  3JCM V;  2CT4 A;  5I21 A;  2HQH A;  4EMK A;  3CCM A;  4FM4 B;  2FPE A;  1BIB A;  1OU8 A;  2P0K A;  2ZPF B;  2DZ9 A;  1K8A C;  4JJB A;  4XTV A;  2DET A;  1OPK A;  1WHM A;  3CCV A;  2OTJ Q;  4J6Y A;  3ASK A;  2K3Y A;  3S6W A;  2ZGW A;  4QQG A;  1KD1 R;  2VAS A;  3OYC A;  2DVJ A;  4JZ4 A;  4BDZ A;  2NYS A;  3CME A;  2DTO A;  1NJI U;  1YJN Q;  2CP3 A;  4PJO B;  1VQ4 A;  3D7S B;  4O6J A;  3CCE T;  1TUD A;  3NGP A;  3I56 T;  2LCS A;  1ZA2 B;  3NPF A;  2L3Q A;  5DY9 A;  4M78 G;  3LX7 A;  2SEM A;  3FRN A;  3MP8 A;  3A98 A;  1N8R C;  1R8O B;  2QTX A;  3H8Z A;  3NTH A;  2K79 A;  2JMA A;  2OTL A;  3OY9 A;  2D0Q B;  4DEX A;  3JCM c;  2CH4 W;  1X43 A;  4B9W A;  5CKH A;  1X2K A;  1VQ6 Q;  1B34 B;  2O9S A;  1KC8 U;  3JB9 H;  5KH6 A;  2LT1 A;  4OF1 A;  3I55 Q;  1QCF A;  2DL5 A;  5GAN 7;  1M1K C;  4R56 A;  4E7J A;  5KYN A;  4X9D A;  2CP7 A;  4BDY A;  4FU6 A;  1MMA A;  1ZSG A;  3EG2 A;  3CPW P;  4E7I A;  4Y28 E;  2JM9 A;  3MEV A;  3JCM P;  3V8L A;  4BI3 A;  2KY9 A;  2AKL A;  4ATO A;  1VQL A;  3PMT A;  2DVE A;  5GAN 8;  1G2B A;  3QBY A;  3JCM Q;  5GAN f;  4PLI A;  3FLG A;  4N0A C;  4MZP A;  3TVT A;  1BIA A;  4BE2 A;  2E64 A;  3M57 A;  5KE2 A;  3EG9 B;  3OW2 P;  4FT2 A;  3EHQ A;  2WSF E;  2HZY A;  2ESW A;  1WDX A;  1C0M A;  4OMO A;  1WPY A;  1NZ9 A;  5HCK A;  1QP2 A;  4CC3 A;  3RBB B;  1M8M A;  1M1F A;  1JB0 E;  5AT1 B;  2LC4 A;  1AZG B;  4FYV B;  4KGX B;  1ZLM A;  4X9C A;  2P4T A;  4M75 G;  1YI2 A;  4PNO A;  1GCQ A;  4AFQ C;  4GBQ A;  1W6X A;  2CZ7 B;  1BKB A;  3G71 T;  3SWN C;  2XMF A;  3H0H A;  3NFC A;  3E9G A;  3RKW A;  1MV3 A;  3MEA A;  1MHN A;  4QW2 A;  2CUD A;  2M51 A;  2CS7 A;  4ZTJ A;  1VQK T;  4WTO B;  1WNL A;  1FXX A;  1M2V B;  4C8Q A;  2QQS A;  1VYT A;  3OBW A;  1H3H A;  1RUW A;  1TXQ A;  4UC4 A;  2DD5 A;  4A4K A;  1WXU A;  1PKS A;  2M0O A;  3GIB A;  5CQY A;  2LP5 A;  2IG0 A;  4M77 E;  1D3B A;  3UA6 A;  1VQO T;  2MAM A;  3OS0 A;  4ZTF A;  2VYT A;  1B07 A;  1ZSZ C;  3GF5 A;  4PJJ A;  3FC3 A;  1K1Z A;  3BFM A;  1GL5 A;  1WHK A;  1YCY A;  4HT8 A;  1WX6 A;  1W2B S;  4GLK A;  3VUB A;  3U23 A;  5FLX E;  2LTO A;  1YBY A;  1YIJ T;  1GBQ A;  4JZ3 A;  4IUV A;  1DJ7 B;  1KFZ A;  4XU0 A;  1T0H A;  2HL5 C;  1WYX A;  3EGD B;  3I56 Q;  4B9X A;  3UT1 A;  4KRT A;  1RAG B;  3UDC A;  3QXE B;  1S72 Q;  5EG2 A;  2BIV A;  4LDY A;  2RD1 A;  1Q82 U;  3NTK A;  2KRO A;  8AT1 B;  2KVQ G;  3JCM b;  2E70 A;  3CC4 Q;  1QVF A;  1HJD A;  2AHJ B;  3M0Q A;  2P0P A;  1K8A U;  2E4H A;  3H41 A;  2VB6 A;  2MF2 A;  4PJO A;  3HTR A;  5FWC A;  4C92 G;  4M7A G;  4Z89 A;  1D0Y A;  2DIG A;  4M4Z A;  2DBK A;  3MKD A;  2CGH A;  3CMA T;  4FL6 A;  2ZPG B;  1HYO A;  2LQK A;  3TRE A;  3L42 A;  3CD6 T;  1FMK A;  4BUG A;  1FX7 A;  2KK4 A;  3PTA A;  2PQW A;  3E2U A;  4HT9 A;  2R5A A;  3G4S A;  2RI3 A;  5KYW B;  1QWF A;  4DBR A;  4L59 A;  2IVW A;  4JRP A;  4LDX A;  4LD6 A;  3MEU A;  3OS1 A;  1VQN T;  3HFN A;  1B34 A;  1JXO A;  4XAX B;  3ULR B;  1N8R U;  2DLP A;  3EH2 A;  3UA7 A;  3JCM d;  1WI7 A;  1M2O A;  4MML A;  3PIP A;  2XI9 A;  2RHZ A;  2QQB A;  4F7U E;  2RK1 A;  3BW1 A;  4PJM A;  1WZO A;  2RHY A;  4GLM A;  1VYU A;  1M8V A;  2L2P A;  4IUP A;  2GGR A;  1ZUK A;  3X26 B;  1KIK A;  1K9M R;  3CCL A;  2SRC A;  2V1R A;  1FMV A;  4JJC A;  5KYU B;  2K7A A;  4FYY B;  3FEO A;  2AK5 A;  3MO8 A;  5FU7 B;  5FU6 C;  2YLC A;  2LJ1 A;  3UPU A;  2JVV A;  3DB4 A;  4BI8 B;  1M1K U;  2QYZ A;  3GBQ A;  5GAN h;  2YRD A;  3LW5 E;  4M7D G;  1AVZ C;  3EG9 A;  1Y96 B;  1X69 A;  3M55 A;  4BD3 A;  2DIQ A;  1P92 A;  1YHQ T;  2P0Q A;  1M90 C;  4J9I A;  1MUZ A;  3CEY A;  4M7D C;  1E6H A;  2DEQ A;  3QDF A;  2NUT B;  4C8Q F;  3OSS C;  5LJ5 f;  2GBQ A;  4BAC A;  2DYB A;  5KYY B;  4RTZ A;  5CVI A;  3CCU Q;  1VQO Q;  2ROT A;  2ZPH B;  1K4U S;  1ZBJ A;  4JLI A;  5HKC A;  4P5N A;  1RAH B;  2CUB A;  2CZ0 B;  2RN8 A;  5CO7 A;  4M7D D;  3C12 A;  3CC2 T;  1TS9 A;  4JUV A;  2G3R A;  2RJC A;  1M2V A;  2V26 A;  9ATC B;  2J6O A;  3CCJ T;  2DKG A;  4QVC A;  4Z02 A;  2FZC B;  3CCL Q;  2FRW A;  1UHF A;  5D7U A;  4AT1 B;  4ME7 A;  2KQW A;  3CCR Q;  3PE0 A;  2FPD A;  4HCZ A;  1G3Y A;  2OAW A;  1QVG S;  4XQ3 A;  1C1A A;  3MCA B;  1K73 C;  2DZC A;  4AFU C;  1Q81 U;  1U3O A;  2JW4 A;  4PJO F;  2DE0 X;  2ZZD A;  1N9R A;  3EGD A;  3HP9 A;  1RLQ C;  2FZK B;  2EPD A;  2YWW A;  5LJ5 g;  1NJI R;  2QG9 B;  2DTH A;  1JQQ A;  1UGP B;  1UGR B;  2FYK A;  2JZ2 A;  3L2Z A;  3SEM A;  1Y7X A;  1OQK A;  1LNX A;  2VWF A;  1H3Z A;  4LNP A;  1ZA1 B;  3EFO B;  3RMS A;  4C0D C;  3TCJ A;  3M54 A;  1WHH A;  1VQ7 Q;  2VV5 A;  1G3S A;  4C8Q E;  3J80 E;  4N4G A;  2MK5 A;  2X51 A;  2YRC A;  1KC8 R;  3X20 B;  2DYI A;  3L2R A;  2E5Q A;  2CZ1 B;  1SEM A;  1N27 A;  2GQI A;  1U5S A;  1KQS P;  3TEE A;  5KYW A;  5IHK A;  1FMW A;  2LX9 A;  2OAU A;  1JJ2 S;  3CCQ A;  2EQJ A;  2QGG A;  3OYH A;  3CXC P;  3EAE A;  3OYJ A;  2L0A A;  5GMK j;  2Z0W A;  5LJ3 j;  1UUE A;  1VQM A;  1UGV A;  2MWO A;  2XHC A;  2HKQ B;  2CP5 A;  1ACM B;  3HRU A;  1RAB B;  2YLB A;  2FL7 A;  3VS6 A;  2PVO B;  3BY7 A;  1M1G A;  1K9M U;  4A53 A;  2R57 A;  5LJ3 d;  4JPB W;  4RTT A;  1H64 1;  3G6E T;  3H9N A;  4GY5 A;  1VQP Q;  4M77 G;  3E9F A;  5CIU A;  5KYU A;  3SWN B;  2DL8 A;  1UEC A;  5GAO m;  3VYH B;  3G7Z A;  4IUR A;  1ZBX A;  1BYM A;  3X28 B;  2XD0 A;  4V2S A;  3CCM T;  2AIR B;  4C0Z A;  3TSW A;  2BE9 B;  4RG8 A;  1FWZ A;  1PWT A;  2X4W A;  2XDP A;  3TQ7 P;  1YJN A;  5HK3 A;  1NYG A;  3HRS A;  1Y96 A;  3A8O B;  2A3L A;  3UWN A;  3M0U A;  1ZQ1 A;  2WSC E;  3EG1 A;  1WHL A;  2DL7 A;  1NEG A;  1NYF A;  4F16 A;  3VYG A;  2XK0 A;  4J9C A;  1I5O B;  1ZSZ B;  3CME T;  1O75 A;  5A0L A;  4A4G A;  2L3S A;  1VQ4 T;  1OX8 A;  3JCM J;  2NUT A;  1SSH A;  2HKN A;  2QTV A;  5KYY A;  4C0G A;  1FYN A;  2EAY A;  5LJ5 h;  3DLM A;  1YJW A;  2DIL A;  1D1C A;  5GMK m;  2JUF A;  5DLO A;  3NHN A;  1MND A;  1M90 U;  2VUB A;  1VQ6 A;  1I1J A;  4NOY A;  2KYB A;  3I55 A;  2EBP A;  1VQ8 A;  1VIF A;  2OTL T;  3MJX A;  2PUO B;  4N4H A;  2E6N A;  1BI2 A;  1MMD A;  3CQT A;  4AFS C;  4JJN K;  1NLO C;  2L5Q A;  5IT9 E;  2QA4 A;  4F7U A;  3M0P A;  2EJF A;  1VQ9 Q;  2FEI A;  1IXD A;  4LE9 A;  2KMT A;  2NUP B;  2A28 A;  2DF6 A;  1QKX A;  2A0F B;  4OP0 A;  3CPW A;  2XKO C;  3EHR A;  2CSI A;  3JB9 D;  3M56 A;  4D6W A;  1CKA A;  2EGE A;  1Q82 R;  2QK0 A;  2FO0 A;  1VIE A;  1OYX A;  2D6F A;  2DJZ A;  4PLL A;  2CDT A;  1BCO A;  1QVP A;  3KFV A;  1PKT A;  2RNA A;  1K8A R;  1VQL T;  3CC7 A;  3AHU A;  2AT1 B;  4J7F A;  2CZ6 B;  4C0F A;  3OW2 A;  1OX9 A;  5GAN 5;  1IHV A;  1AWO A;  2RQW A;  2FPF A;  2VKN A;  1K73 U;  3LWH A;  4L5G A;  2PNI A;  3EFO A;  2COZ A;  3P8H A;  5GJW B;  4ZGJ B;  5FRM A;  2MWP A;  3OYB A;  1Y71 A;  2XIC A;  1YJW Q;  3RNJ A;  1AOJ A;  1VQ5 Q;  1AEY A;  4F04 B;  4M78 C;  1R0C B;  2QEX Q;  1PRL C;  4A4E A;  1YI2 T;  3SFM A;  1YJ9 A;  4M77 F;  3BDL A;  4J5Y A;  1VQ8 Q;  2X4Y A;  2GNC A;  1O9S A;  1N8R R;  4A54 A;  2F69 A;  3L2W A;  4M78 D;  2KBT A;  2QA4 Q;  2O9V A;  2RJF A;  2E65 A;  2W10 A;  5FU6 B;  2LZ6 B;  3V8K A;  1G3W A;  1VUB A;  1G8X A;  4QVZ A;  4N0A A;  3KBG A;  1RAA B;  1K9A A;  3EH1 A;  1LJO A;  4K11 A;  2R5M A;  4LUD A;  2BUD A;  1HSQ A;  1I0C A;  4OMN A;  2D0N A;  1W70 A;  3L1A A;  2BZX A;  2LDM A;  3QZ5 B;  2HSE B;  2K5L A;  1YIT Q;  1ZUY A;  2COW A;  2PU9 B;  3FJ5 A;  3JAM E;  1M1K R;  2JTM A;  1AHJ B;  3QJY A;  4PFP A;  4M7D B;  1PD0 A;  5D6X A;  3CCE A;  2QQA A;  3CC7 Q;  3C94 A;  2FG0 A;  1QW1 A;  2XU8 A;  3I56 A;  2KEA A;  3SWN A;  2JMC A;  3IQL A;  3VS4 A;  2QQ9 A;  1S72 A;  2B86 A;  2AZV A;  1RI9 A;  2K4Y A;  2KI7 A;  1OEB A;  1PRM C;  1ZHI A;  4KBM B;  2HQX A;  3OSV A;  3CBO A;  3CC4 A;  4JRQ A;  3QWY A;  3A8M B;  2IIM A;  1IGQ A;  5IXB A;  2RK2 A;  1TUG B;  5GAN 6;  4ZN1 A;  1Y07 A;  2GCX A;  4HCC A;  4OMM A;  2Y4Y A;  3TU4 K;  3C4S A;  4M75 C;  1YJ9 Q;  1XQH A;  3S3M A;  2KR3 A;  1WJQ A;  1ZSZ A;  2RQT A;  1K76 A;  3JCM f;  2FB7 A;  4M75 D;  2K57 A;  1T0J A;  3OS2 A;  2OX7 A;  3OYL A;  4F7U F;  3JB9 I;  4LD9 K;  4OB1 B;  4LN2 A;  4QQD A;  3VS3 A;  2F2W A;  3EGU A;  1YWO A;  2B8A A;  4C8Q G;  1OI1 A;  2HBW A;  3LH5 A;  3OYD A;  2QDL A;  3DB3 A;  1GBR A;  1AZE A;  1UTI A;  1KJW A;  2KAF A;  3QSU A;  3CCE Q;  3BDU A;  2J6K A;  2BZY A;  1WXB A;  2XID A;  1Q81 R;  2YUP A;  1N5Z A;  5C0M A;  1LCK A;  4C0D B;  1Q86 C;  5GAM j;  2NUP A;  2WAC A;  3OS5 A;  2EW3 A;  1SF9 A;  5GAN j;  3P8D A;  4A63 B;  2V8K A;  3P8B B;  3VS0 A;  3SHW A;  1M3C A;  2LX7 A;  2P4R A;  2EQK A;  5GAM d;  2LNH B;  2X3X D;  2FRY A;  2QDY B;  3FDR A;  3JCM g;  3ER0 A;  1KQ2 A;  2J06 A;  3JCM X;  1X6G A;  2MYS A;  4BI4 A;  5CK9 A;  5GAM e;  1VQK A;  2DJQ A;  4DBQ A;  1R0B G;  2WSE E;  4AMC A;  1RL2 A;  4HVV A;  2ABL A;  4C92 C;  5GAN e;  1BI1 A;  4PK4 A;  4M7A C;  1WXT A;  4PJO G;  1UJ0 A;  4HKE A;  4KH0 B;  2E10 A;  3Q1J A;  4Y92 A;  2YRV A;  3CCU A;  3QG1 A;  1QQJ A;  1RAE B;  4XU2 A;  5A0D A;  1VQO A;  2M02 A;  2LRQ A;  4ELY C;  4RTW A;  4C92 D;  5GMK i;  5KCH A;  4M7A D;  2F5K A;  5IH2 A;  1A0N B;  1SRM A;  4EMH A;  2ECZ A;  4PJO C;  3VV0 A;  1CKB A;  2PVD B;  1G3T A;  1PSF A;  4EMG A;  1T3L A;  2K6D A;  1PD1 A;  3OMG A;  1UE9 A;  4PJO D;  3RMQ A;  2XG8 D;  4KUI A;  4A4H A;  1GXI E;  2C0T A;  2DRM A;  3H0I A;  1WLP B;  3THK A;  3M9Q A;  4PL6 A;  5GAO l;  2CYZ B;  2KRN A;  2DMO A;  3JRZ A;  2DBM A;  1K0S A;  2RMO A;  1KQ1 A;  3CCR A;  1YNZ A;  3GOX A;  2EYY A;  1PHT A;  2BTT A;  4J9H A;  3G71 Q;  2LQN A;  1V29 B;  1PG5 B;  3O8V A;  4E6R A;  4M7D A;  3VS1 A;  2LNV A;  2F2V A;  1KHI A;  1WJS A;  2DNU A;  2XDD A;  4XTX A;  2C06 A;  3L2Q A;  1VQK Q;  1SHF A;  2YDL A;  1WIE A;  3R6N A;  1IGU A;  2ZPE B;  1H92 A;  3EGX B;  4NS5 A;  5J26 A;  1I4K 1;  3O5Z A;  5A2Q E;  1W2B P;  4RTU A;  4RTX A;  1M3A A;  3M58 A;  3OYM A;  3A1P A;  3QZ9 B;  2M16 A;  5DM7 R;  2FZG B;  1SHG A;  1AWW A;  1GCP A;  1XNI A;  5GMK l;  1VQ7 A;  3OA6 A;  4KUD K;  4CI0 C;  2EYX A;  3M0R A;  4R55 A;  2EGA A;  1F1B B;  1IRX A;  3F70 A;  2JN0 A;  1M90 R;  5ECA A;  4Y91 A;  3RDV A;  1YIJ Q;  3JCM h;  3QII A;  1V1C A;  1PNJ A;  2W0Z A;  4FYW B;  2RHX A;  3GLX A;  4JS5 A;  4MZT A;  1BU1 A;  4LDU A;  4RCB A;  5LJ3 f;  4DBH A;  1KSW A;  1KQS A;  4NL3 A;  3QWX X;  3E1S A;  2PVG B;  1TH7 A;  4OML A;  4J8O A;  3SB2 A;  8ATC B;  3CXC A;  1SRL A;  4C5H A;  4B6M A;  3CCQ T;  1WHJ A;  4ANJ A;  3DKM A;  4HA8 A;  1QKW A;  4ZGE B;  3I35 A;  1NG2 A;  4RCC A;  1VQM T;  1M4Z A;  1VQP A;  3CMA Q;  4F17 A;  4JS4 A;  1YCS B;  2JXB A;  4LDV A;  3ME9 A;  4AFZ C;  3TSZ A;  4IUT A;  4M78 B;  2DD4 A;  2ED0 A;  4PKC C;  1QCO A;  3CD6 Q;  5FRO A;  2KSS A;  4J9D A;  4J83 A;  2YSQ A;  4VUB A;  1M9S A;  1TU0 B;  3CCS T;  4J9G A;  3RER A;  1K73 R;  2JS0 A;  2KXD A;  3PFS A;  3QO3 A;  4XTU A;  1Q86 U;  2L3R A;  2M1H A;  1VQN Q;  2DL3 A;  1MGQ A;  2OTJ T;  3MP1 A;  2YUN A;  2ZCF B;  2DK3 A;  3PT9 A;  1KC8 C;  4D8K A;  2RH2 A;  1Z9Z A;  1BBZ A;  2RF0 A;  3MHX A;  5CKB A;  3OYG A;  4ELZ C;  5LJ3 g;  1YJN T;  1NPP A;  4RMO A;  2DFU A;  3CCJ A;  2KRS A;  3T9N A;  1G83 A;  1JO8 A;  5CCA A;  4ZNX A;  5GAN 2;  1Z9Q A;  4E2F B;  4RG2 A;  3NTI A;  1SSF A;  3JCM W;  1GFD A;  1N9S A;  1OUL A;  1Q7Y C;  2KYM A;  1NM7 A;  5LJ5 e;  2GF7 A;  2H3E B;  2VXE A;  4KUL A;  1VQ6 T;  1MNE A;  1K0X A;  2E3H A;  1VQ9 A;  2HSP A;  3I55 T;  1YHQ Q;  2NUZ A;  4E7K A;  4MDX A;  5D6W A;  1VA7 A;  1UEB A;  1LPL A;  3HSB A;  2DO3 A;  4M75 B;  3ZBD A;  4LXC A;  4IIO A;  4M77 C;  2AZS A;  1I8F A;  2O01 E;  1U06 A;  1WQ7 A;  2DL4 A;  1NEB A;  3CCV T;  3BE3 A;  4J9F A;  5J39 A;  4F14 A;  4BE0 A;  3CC2 Q;  1GRI A;  3PVQ A;  3JV3 A;  2ATC B;  4M77 D;  3URG A;  5GAO n;  3EGX A;  3X24 B;  4DA4 A;  2HAX A;  2L8D A;  2NWM A;  2MI6 A;  1QVG P;  5IHN A;  3CCJ Q;  1RAF B;  3RIR A;  5KYX B;  2QAS A;  1IZ6 A;  3GNG A;  2DXU A;  2CP6 A;  5CKE A;  1WA7 A;  1BB9 A;  2EYQ A;  2X4X A;  1VQ5 A;  2CRE A;  1BK2 A;  2LJ3 A;  2CT3 A;  3RUX A;  1X6O A;  3WVE B;  2QEX A;  2X35 A;  2EKO A;  2V8I A;  4BB7 A;  3M5A A;  1M27 C;  5HY6 A;  1OZ2 A;  1OU9 A;  1J3T A;  2H3J A;  5CAI A;  3OW2 S;  1W4S A;  3ZEH A;  4JRI A;  1HK9 A;  5M9O A;  4C5E A;  2L3P A;  5KE3 A;  2HEQ A;  1TUC A;  5EC7 A;  3FB9 A;  3RKY A;  2YXY A;  2O31 A;  1T3S A;  3LGF A;  4PFO A;  5GMK h;  2FVU A;  5LJ3 h;  5GJV B;  1KD1 C;  1QWE A;  2X3W D;  5L23 A;  2J7I A;  3L2U A;  1LOJ A;  3ZFJ A;  4M7D E;  3QHS A;  1SPK A;  3I9Q A;  4F7U G;  1X75 C;  4RTV A;  1YIT A;  3CCS Q;  1UJY A;  2YHT A;  1IRE B;  3LLR A;  4C92 B;  2GTO A;  1E6G A;  4M7A B;  2K2M A;  1JJ2 P;  3L2V A;  3DLL A;  4EMK C;  3H6Z A;  4IKF A;  4MZM A;  1ARK A;  2A36 A;  1D0X A;  4M78 A;  3RES A;  2O88 A;  2EQI A;  3RKX A;  3M0S A;  3I5R A;  4C5G A;  5IXF A;  4DOV A;  3HFO A;  5GAO r;  1HXD A;  1CSK A;  2CSQ A;  4LUE A;  7AT1 B;  4E7H A;  2J6F A;  1NLP C;  3X25 B;  1BI0 A;  1PCX A;  1M5Q 1;  1VOM A;  2PZ1 A;  1S72 T;  2FHD A;  1M30 A;  3OYY A;  4CC2 A;  2HL3 A;  2LQW A;  3CC4 T;  2I2L A;  1IB8 A;  4KGZ B;  4EPC A;  2IPO B;  1KG1 A;  2VC8 A;  2A08 A;  3OMC A;  4HXJ A;  3VU3 C;  4R0K A;  4J6X A;  2HDA A;  3MEW A;  2HBP A;  3MET A;  3G6E Q;  2JM8 A;  3NMZ C;  4PFZ A;  4JLG A;  3QJ6 A;  2D9T A;  1IHW A;  5AYF A;  4NL2 A;  2GFA A;  4EIK A;  2RB6 A;  4C5I A;  4HCK A;  4CRI A;  2RJD A;  4BY6 C;  2MOX A;  4E7S A;  3R6O A;  3CCM Q;  3OQ5 A;  3SD4 A;  3V7S A;  2DXB A;  1ABQ A;  2C0O A;  3WVD B;  1PC0 A;  2YUO A;  1X27 A;  2MMP A;  2KRM A;  4ESR A;  3CCV Q;  3MPU B;  2JTF A;  3HHT B;  2EJ9 A;  2QXF A;  3VS5 A;  2QI2 A;  1MV0 B;  1Q7Y U;  4YTL A;  5GAM f;  2JT4 A;  2LMJ A;  3H0F A;  3GPL A;  5I22 A;  2RM4 A;  3HPW A;  4CC7 A;  3CME Q;  3HL8 A;  4HVU A;  2ZPB B;  1VQ4 Q;  4M75 A;  3A5Z B;  3OYK A;  2E41 A;  3MP6 A;  1R77 A;  1H8K A;  3VJP A;  3V7R A;  2DEU A;  1RLP C;  3LWI A;  2KXC A;  1AWJ A;  1I81 A;  3VRZ A;  3VS7 A;  3J7A F;  5LL6 S;  3QDR B;  4BE1 A;  1OV3 A;  4MDW A;  4ZN3 A;  4QQ6 A;  2H8H A;  2QQR A;  1W1F A;  5HK0 A;  2EKH A;  3EG0 A;  4FSS A;  2DA9 A;  3M0T A;  2AKK A;  2JTE A;  2M9U A;  3JB9 F;  2Y90 A;  1XJW B;  4DQ2 A;  4Z8A A;  4KH1 B;  2OTL Q;  4Z88 A;  2EVR A;  5IAY A;  4WCI A;  3AT1 B;  2E1H A;  3WXM B;  1M3B A;  1D1B A;  3J81 E;  5KYX A;  2MPX C;  4RTY A;  1QVF S;  1JXM A;  1RAI B;  1MMN A;  1GCQ C;  5D6Y A;  4ZGD B;  2K2V A;  2KNB B;  4N4I A;  2HCK A;  1WFW A;  3FIF A;  4OB0 B;  4LDW A;  2COY A;  2HNI A;  2LQ8 A;  1G5V A;  1YP5 A;  2A7Y A;  1NPR A;  2DX1 A;  5FWB A;  2C0I A;  4HVW A;  3LYI A;  3G4S T;  5GAM g;  2PTK A;  2RHU A;  3CCU T;  1XOV A;  4JRK A;  5GAN g;  1Q81 C;  1IO6 A;  4PJN A;  3OYI A;  4C8Q C;  2QGF B;  1Y0M A;  5I11 A;  1VQL Q;  5IHI A;  5KCO A;  2LCL A;  4MMK A;  3CBM A;  3VRY A;  2CH4 A;  2X4J A;  3M53 A;  1NE8 A;  1UDL A;  1D09 B;  5FW9 A;  3M4G A;  4M78 F;  4IIM A;  2CP0 A;  4C8Q D;  4OVA A;  5GAN 4;  3LH0 A;  1PSE A;  3CCL T;  3VKI A;  1QLY A;  1S1N A;  3G71 A;  3GNF B;  4C92 A;  4M7A A;  5GAN d;  3JSC A;  3UAT A;  1EIF A;  1RAD B;  1KD1 U;  3E19 A;  1Q86 R;  3CCR T;  1YI2 Q;  3A8H B;  1SG5 A;  4J6W A;  2ZAE A;  1X6B A;  5L8R E;  2DXT A;  4FIB A; 
#chains in the Genus database with same CATH homology
 3MEV A;  2LCC A;  5CR2 A;  2RA2 A;  3JCM P;  3VYG A;  2XK0 A;  3V8L A;  4BI3 A;  2Y4X A;  4C5H A;  3CME T;  1O75 A;  2KY9 A;  1W2B A;  5A0L A;  2PUK B;  3CCQ T;  1VQL A;  4ATO A;  3PMT A;  2DVE A;  5GAN 8;  4A4G A;  1VQ4 T;  3DKM A;  4HA8 A;  3JCM J;  4KT0 E;  3QBY A;  3JCM Q;  4ZGE B;  4C0G A;  5GAN f;  4PLI A;  2EAY A;  4RCC A;  5LJ5 h;  3FLG A;  4N0A C;  1VQM T;  2RJE A;  4MZP A;  1M4Z A;  3LGL A;  2RI2 A;  3DLM A;  1VQP A;  3OYE A;  3GP8 A;  1YJW A;  2F5T X;  4JS4 A;  1BIA A;  4BE2 A;  2E64 A;  4LDV A;  5GMK m;  3M57 A;  2JUF A;  3ME9 A;  4XK8 E;  5KE2 A;  5DLO A;  4IUT A;  3V7C A;  4M78 B;  4FT2 A;  2DD4 A;  2NLU A;  4Q5W A;  1WGS A;  4PKC C;  1XTD A;  2WSF E;  1M90 U;  2VUB A;  5FRO A;  1K9M C;  1VQ6 A;  2KSS A;  4NOY A;  1WPY A;  1NZ9 A;  1UGS B;  4J83 A;  1QP2 A;  1VQ7 T;  1YIJ A;  3I55 A;  4VUB A;  1M1F A;  1JB0 E;  1M9S A;  1VIF A;  1VQ8 A;  4OGE A;  3CCS T;  2OTL T;  3RER A;  2LC4 A;  2PUO B;  4M77 B;  4N4H A;  1I5L A;  2E6N A;  1BI2 A;  4X9C A;  3PFS A;  3QO3 A;  2P4T A;  2V8J A;  3CPF A;  2L3R A;  4M75 G;  4PNO A;  4XTU A;  4FSX A;  4JJN K;  1YI2 A;  2L5Q A;  2M1H A;  2QA4 A;  5IT9 E;  4F7U A;  1MGQ A;  4A4F A;  2OTJ T;  2EJF A;  2CZ7 B;  3MP1 A;  1BKB A;  2ZCF B;  2DK3 A;  3PT9 A;  5CQX A;  3SWN C;  3G71 T;  1KC8 C;  4OB3 B;  5A0G A;  2XDB A;  2RH2 A;  3NFC A;  3E9G A;  4TVR A;  2KMT A;  1UGQ B;  3RKW A;  2E6Z A;  3QYH B;  3JCM e;  3MHX A;  4M75 F;  5CKB A;  3MEA A;  1MHN A;  3OYG A;  4OP0 A;  3CPW A;  4ELZ C;  5LJ3 g;  4QW2 A;  2CS7 A;  2XKO C;  4ZTJ A;  1YJN T;  1NPP A;  3JB9 D;  1VQK T;  2JNG A;  3M56 A;  4O5V A;  4RMO A;  3CCJ A;  4D6W A;  1WNL A;  1FXX A;  4M78 E;  3N5B B;  1VIE A;  1OYX A;  4OB2 B;  2K5F A;  3T9N A;  4C8Q A;  2QQS A;  2D6F A;  5CCA A;  3OBW A;  3CMA A;  2DJZ A;  4PLL A;  5GAN 2;  5GAM h;  3PMI A;  1QVP A;  4UC4 A;  2DD5 A;  1Q82 U;  4A4K A;  2M0O A;  3GIB A;  4RG2 A;  3NTI A;  5CQY A;  2EFI A;  5FRN A;  1SSF A;  3JCM W;  1VQL T;  2IG0 A;  4M77 E;  1N9S A;  3CC7 A;  1Q7Y C;  1D3B A;  4IUU A;  3AHU A;  1VQO T;  3CD6 A;  2MAM A;  3OS0 A;  4ZTF A;  4J7F A;  1KQS S;  2VYT A;  2CZ6 B;  3GF5 A;  4C0F A;  5GAN 3;  2JOY A;  3OW2 A;  5GAN 5;  3FC3 A;  5LJ5 e;  1VQP T;  2GF7 A;  3BFM A;  3CXC S;  1K73 U;  1YCY A;  3LWH A;  2VXE A;  4L5G A;  4HT8 A;  1W2B S;  2DAQ A;  4FT4 A;  3P8H A;  4KUL A;  4ZGJ B;  5FRM A;  2MWP A;  3OYB A;  1VQN A;  1Y71 A;  2XIC A;  1VQ6 T;  5CKD A;  4GLK A;  3VUB A;  1VQ9 A;  5FLX E;  2EJG A;  4JDS A;  2LTO A;  1YBY A;  4M78 C;  3I55 T;  1YIJ T;  4II1 A;  3M59 A;  4IUV A;  2O4X B;  1DJ7 B;  4XU0 A;  4E7K A;  4A4E A;  5D6W A;  4E47 A;  4MDX A;  2VXF A;  1QP3 A;  3HRT A;  4B9X A;  1YI2 T;  1UEB A;  3SFM A;  3UT1 A;  1YJ9 A;  2DO3 A;  3HSB A;  4M75 B;  4M77 F;  3UDC A;  3QXE B;  3ZBD A;  3BDL A;  3S3O A;  4J5Y A;  5I2M A;  5EG2 A;  2X4Y A;  2BIV A;  4M77 C;  4LDY A;  4XU1 A;  1I8F A;  1O9S A;  2RD1 A;  2O01 E;  1WJR A;  3NTK A;  2F69 A;  1WQ7 A;  4M78 D;  4A54 A;  3L2W A;  2KVQ G;  3JCM b;  2E70 A;  1QVF A;  2RJF A;  2LVM A;  2E65 A;  5FU6 B;  1U1T A;  2AHJ B;  3CCV T;  3V8K A;  1G3W A;  2P0P A;  1VUB A;  5J39 A;  1KHC A;  4QVZ A;  4BE0 A;  4N0A A;  1K8A U;  3KBG A;  2L89 A;  4M77 D;  1Q86 U;  2MF2 A;  4PJO A;  5IN1 A;  4C92 G;  3M4Y A;  4M7A G;  4EMK B;  1LJO A;  3EFS A;  2R5M A;  3URG A;  2BUD A;  2DIG A;  3X24 B;  1JRI A;  5GAO n;  4DA4 A;  4F7U B;  2HD0 A;  2HAX A;  2CGH A;  2EIF A;  2L8D A;  3L1A A;  3CMA T;  2MI6 A;  3OYF A;  2LDM A;  4FL6 A;  3QZ5 B;  4XU3 A;  2ZPG B;  1NJI C;  2LQK A;  5DLQ E;  3TRE A;  3RIR A;  5J3B A;  3L42 A;  2K5L A;  5CKF A;  3SDZ A;  4C92 F;  1IZ6 A;  3GNG A;  2DXU A;  4M7A F;  4OMF B;  2PU9 B;  5CKE A;  3CD6 T;  1UB4 A;  2EYQ A;  2X4X A;  4BUG A;  2R58 A;  3JAM E;  1FX7 A;  1VQ5 A;  4M75 E;  1U1S A;  2JTM A;  4HCB A;  1AHJ B;  2KK4 A;  3QJY A;  3RUX A;  4M7D B;  1X6O A;  3WVE B;  3PTA A;  1YHQ A;  5D6X A;  3CCE A;  2QQA A;  2PQW A;  2RHI A;  2QEX A;  2X35 A;  4HT9 A;  2R5A A;  2EKO A;  3G4S A;  2V8I A;  3C94 A;  4BB7 A;  1QW1 A;  2EQM A;  2RI3 A;  2XU8 A;  3M5A A;  3I56 A;  4L59 A;  2IVW A;  3SWN A;  4JRP A;  5HY6 A;  3PNW C;  4LDX A;  2QQ9 A;  3MEU A;  4LD6 A;  1OZ2 A;  3OS1 A;  1S72 A;  3HFN A;  1VQN T;  2K4Y A;  2GFU A;  2H3J A;  1B34 A;  4XAX B;  5CAI A;  3OYN A;  1N8R U;  1VQ9 T;  1ZHI A;  3HKS A;  5I2S A;  3JCM d;  3OW2 S;  4KBM B;  2HQX A;  3OSV A;  1W4S A;  3CBO A;  4JRI A;  3ZEH A;  4MML A;  3CC4 A;  3PIP A;  4JRQ A;  1HK9 A;  2XI9 A;  5M9O A;  2RHZ A;  2QQB A;  4C5E A;  4F7U E;  3A8M B;  2RK1 A;  5KE3 A;  3BW1 A;  2RHY A;  2RK2 A;  3VUZ A;  3FB9 A;  5GAN 6;  3CC2 A;  1M8V A;  2K3X A;  4IUP A;  4ZN1 A;  1Y07 A;  3RKY A;  2GCX A;  3X26 B;  4HCC A;  3LGF A;  4XTY A;  5GMK h;  4E7L A;  2FVU A;  5LJ3 h;  2Y4Y A;  5LJ5 j;  3TU4 K;  2EWN A;  3A8G B;  1KD1 C;  3C4S A;  4M75 C;  2VGN A;  5GAO q;  3CCL A;  3C95 A;  1LOJ A;  1XQH A;  4WF2 A;  3L2U A;  4J7I A;  3S3M A;  3ZFJ A;  4BY6 B;  3QPH A;  5GAO p;  3QHS A;  4M7D E;  3OB9 A;  1WJQ A;  2HQE A;  4F7U G;  1X75 C;  1YIT A;  3FEO A;  4QVD A;  3MO8 A;  1QVG A;  5FU7 B;  5FU6 C;  2YHT A;  1IRE B;  2YLC A;  3CBP A;  3LLR A;  4IUQ A;  3JCM f;  4C92 B;  2JVV A;  3UPU A;  3DB4 A;  4M7A B;  4BI8 B;  5LJ5 d;  1M1K U;  2FB7 A;  4M75 D;  2K57 A;  3OS2 A;  3S3N A;  5GAN h;  3L2V A;  3DLL A;  3OYL A;  4EMK C;  3LW5 E;  4F7U F;  2E12 A;  3JB9 I;  4LD9 K;  3H6Z A;  4OB1 B;  1JBM A;  4M7D G;  4IKF A;  4MZM A;  1Y96 B;  4M78 A;  4QQD A;  3RES A;  2CKK A;  3RKX A;  3M55 A;  1YJW T;  2B8A A;  2DIQ A;  3QKJ A;  4BD3 A;  4C8Q G;  1VQ5 T;  1OI1 A;  4C5G A;  4DOV A;  1P92 A;  3OYD A;  3HFO A;  1YHQ T;  2P0Q A;  5GAO r;  3DB3 A;  2QEX T;  4XTZ A;  1HXD A;  4E7H A;  4M77 A;  4OGC A;  4M7D F;  1M90 C;  3X25 B;  1BI0 A;  2KAF A;  3CEY A;  3QSU A;  4M7D C;  3INZ A;  1M5Q 1;  2DEQ A;  2GQV A;  4C8Q F;  3OSS C;  5LJ5 f;  1RI0 A;  1S72 T;  4BAC A;  1VQ8 T;  2DPP B;  3BDU A;  3FJP A;  3JB9 J;  2FHD A;  5CVI A;  3OYY A;  2KDS A;  2XID A;  1WQW A;  4C92 E;  5C0M A;  3CC4 T;  2I2L A;  4C0D B;  1Q86 C;  2QA4 T;  4EPC A;  4M7A E;  2ZPH B;  3KUF A;  5GAM j;  5HKC A;  2VC8 A;  4JLI A;  1KG1 A;  4P5N A;  1OZ3 A;  2CZ0 B;  2WAC A;  3OMC A;  3OS5 A;  5CO7 A;  4M7D D;  4L6V 5;  2RI5 A;  2EQU A;  3VU3 C;  3C12 A;  4J6X A;  5GAN j;  2DTI A;  4JUV A;  3CC2 T;  3CCS A;  3P8D A;  2G3R A;  3MEW A;  2HBP A;  2RJC A;  2V8K A;  3MET A;  3P8B B;  1U8R A;  5GMK e;  1BI3 A;  5LJ3 e;  4JLG A;  3QJ6 A;  2EQK A;  2OTJ A;  5GAM d;  2D9T A;  4PJO E;  5AYF A;  3CCJ T;  2QDY B;  3FDR A;  2DKG A;  4NL2 A;  2GFA A;  1JJ2 A;  4QVC A;  2ZPI B;  1YIT T;  2RB6 A;  4C5I A;  1X01 A;  4Z02 A;  3JCM g;  4CRI A;  1N6A A;  3ER0 A;  2BKD N;  2RJD A;  4BY6 C;  1KQ2 A;  5C6S A;  3R6O A;  3JCM X;  3OQ5 A;  2LT4 A;  4XTW A;  3SD4 A;  4BI4 A;  5CK9 A;  5GAM e;  1VQK A;  3V7S A;  2DXB A;  3CPW S;  2K5I A;  5FU7 C;  2WSE E;  3WVD B;  3CC7 T;  4ME7 A;  1RL2 A;  4C92 C;  5GAN e;  2KQW A;  1BI1 A;  4M7A C;  3QUI A;  4PJO G;  4HKE A;  4HCZ A;  2MMP A;  1G3Y A;  2E10 A;  3V8J A;  3Q1J A;  1QVG S;  2JTF A;  3HHT B;  4EDU A;  2EJ9 A;  4XQ3 A;  2QXF A;  2QI2 A;  2YRV A;  1Q7Y U;  3EFR A;  4YTL A;  4C8Q B;  3CCU A;  3MCA B;  3QG1 A;  5GAM f;  3GPL A;  1K73 C;  2DZC A;  4XU2 A;  5A0D A;  1VQO A;  1Q81 U;  2LRQ A;  4ELY C;  2DXC A;  4C92 D;  2O4X A;  2RM4 A;  5GMK i;  3HPW A;  5KCH A;  2F5K A;  4M7A D;  4PJO F;  2ZZD A;  1N9R A;  3KXT A;  3PIO A;  4EMH A;  3HL8 A;  3HP9 A;  4DOW A;  4PJO C;  3QYG B;  5LJ5 g;  1D3B B;  2ZPB B;  2VGM A;  4M75 A;  3A5Z B;  3OBY A;  2E41 A;  3MP6 A;  3OYK A;  3VV0 A;  2DTH A;  3VJP A;  3V7R A;  3OYA A;  3LWI A;  1UGP B;  2RO0 A;  2PVD B;  1I81 A;  1UGR B;  2FYK A;  2JZ2 A;  3G6E A;  1G3T A;  3J7A F;  5LL6 S;  1PSF A;  3QDR B;  4EMG A;  4X34 A;  3L2Z A;  3PGG A;  4MDW A;  4ZN3 A;  4BE1 A;  3JB9 G;  1Y7X A;  1YJ9 T;  1LNX A;  4QQ6 A;  3OMG A;  2QQR A;  4RKU E;  1H3Z A;  5HK0 A;  4PJO D;  3RMQ A;  3A8L B;  1Q82 C;  3RMS A;  2XG8 D;  4KUI A;  4C0D C;  4A4H A;  1GXI E;  3JCM V;  5I21 A;  3TCJ A;  3M54 A;  4EMK A;  3CCM A;  3M9Q A;  4PL6 A;  2VV5 A;  4FM4 B;  2M9U A;  5GAO l;  2CYZ B;  2Y90 A;  3JB9 F;  4DQ2 A;  1BIB A;  1G3S A;  2P0K A;  2ZPF B;  3JRZ A;  4C8Q E;  2DZ9 A;  5IAY A;  3J80 E;  1K8A C;  4N4G A;  4XTV A;  1KQ1 A;  2E1H A;  3WXM B;  3CCR A;  3J81 E;  3GOX A;  3CCV A;  1QVF S;  3X20 B;  4J6Y A;  3ASK A;  1V29 B;  5D6Y A;  2K2V A;  4ZGD B;  3O8V A;  4N4I A;  3L2R A;  4M7D A;  2E5Q A;  3FIF A;  2CZ1 B;  2K3Y A;  3S6W A;  1N27 A;  2LNV A;  2ZGW A;  4QQG A;  4LDW A;  4OB0 B;  3OYC A;  2HNI A;  2LQ8 A;  1KHI A;  1WJS A;  2XDD A;  3TEE A;  4BDZ A;  1G5V A;  2A7Y A;  3CME A;  2OAU A;  2DTO A;  2LX9 A;  1NPR A;  4XTX A;  1JJ2 S;  3CCQ A;  2EQJ A;  1NJI U;  2C06 A;  4PJO B;  3L2Q A;  1VQ4 A;  3OYH A;  4O6J A;  3CCE T;  2ZPE B;  3EAE A;  3LYI A;  3OYJ A;  5GMK j;  3G4S T;  4NS5 A;  5J26 A;  5LJ3 j;  1I4K 1;  5GAM g;  5A2Q E;  1VQM A;  2MWO A;  2RHU A;  3CCU T;  2XHC A;  3I56 T;  1XOV A;  3HRU A;  3M58 A;  4JRK A;  5GAN g;  3OYM A;  1Q81 C;  2YLB A;  3QZ9 B;  2M16 A;  5DM7 R;  5DY9 A;  3OYI A;  4M78 G;  2FL7 A;  4C8Q C;  3LX7 A;  3FRN A;  2PVO B;  3BY7 A;  3MP8 A;  1M1G A;  1K9M U;  1N8R C;  5KCO A;  1R8O B;  2QTX A;  3H8Z A;  4A53 A;  1XNI A;  2LCL A;  2R57 A;  3NTH A;  4MMK A;  5LJ3 d;  3CBM A;  5GMK l;  2X4J A;  3M53 A;  1H64 1;  1NE8 A;  3G6E T;  1VQ7 A;  4GY5 A;  3OA6 A;  3M4G A;  4KUD K;  4M77 G;  4CI0 C;  2OTL A;  3E9F A;  4M78 F;  4R55 A;  4C8Q D;  3OY9 A;  4OVA A;  2D0Q B;  5CIU A;  3SWN B;  5GAO m;  5GAN 4;  3VYH B;  3F70 A;  3LH0 A;  3G7Z A;  3JCM c;  2JN0 A;  1PSE A;  4IUR A;  1ZBX A;  5CKH A;  4B9W A;  3CCL T;  1BYM A;  1B34 B;  4Y91 A;  3VKI A;  3X28 B;  1KC8 U;  2XD0 A;  3JB9 H;  3G71 A;  3GNF B;  3CCM T;  4C92 A;  4V2S A;  5KH6 A;  2LT1 A;  4M7A A;  4OF1 A;  4C0Z A;  3JCM h;  5GAN d;  3JSC A;  3QII A;  4RG8 A;  1EIF A;  1KD1 U;  1FWZ A;  2X4W A;  2XDP A;  5GAN 7;  2RHX A;  3E19 A;  3GLX A;  3CCR T;  4JS5 A;  3A8H B;  4MZT A;  4LDU A;  4RCB A;  1YJN A;  5HK3 A;  5LJ3 f;  1M1K C;  3HRS A;  1Y96 A;  4R56 A;  4E7J A;  4J6W A;  3A8O B;  2A3L A;  3UWN A;  1KQS A;  4X9D A;  4NL3 A;  2WSC E;  1ZQ1 A;  5L8R E;  2DXT A;  2PVG B;  1TH7 A;  3E1S A;  4FIB A;  4FU6 A;  4BDY A;  4J8O A;  3SB2 A;  4E7I A;  4Y28 E;  3CXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...