2K5LA

Solution nmr structure of protein feoa from clostridium thermocellum, northeast structural genomics consortium target cmr17
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeoA
publication title Solution NMR Structure of Protein FeoA from Clostridium thermocellum, Northeast Structural Genomics Consortium Target CmR17
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Structural genomics, unknown function
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k5lA00
2K4YA 2QQAA 1G3SA 1QW1A 1FWZA 1BI0A 1G3YA 1QVPA 1BYMA 3HRSA 2K5IA 3MHXA 2QQ9A 1FX7A 2GCXA 5CVIA 4O6JA 3GLXA 2H3JA 1P92A 2LX9A 1G3TA 1BI3A 2K5FA 1BI2A 1BI1A 1U8RA 1G3WA 2K5LA 4O5VA 3E19A 2QQBA 3HRTA 3HRUA
chains in the Genus database with same CATH superfamily
1Z9QA 1S72Q 2A7YA 1VQ8T 3NTKA 2QQSA 4PJOD 1BI0A 5FWCA 1IGUA 3MP1A 2I2LA 2K3BA 1UFFA 3HP9A 2YRCA 4ZTFA 2KEAA 1V29B 2EKHA 2V8IA 3V8LA 3THKA 4J9EA 4ORZA 3QZ9B 3OQ5A 4LUDA 4NL2A 2DRKA 1XQHA 2A3LA 4PJNA 3CMAA 1WHGA 2GFAA 2ED1A 1WQWA 1VQ9T 1TTHB 4OMMA 4M78C 3CD6A 3CCVT 1K4US 3RERA 3OYEA 1R77A 3VJPA 1Y71A 1QQJA 2IG0A 1MNDA 3NGPA 5GMKh 2HL5C 2LNHB 1OU9A 1WA7A 2LC4A 5DM7R 3CMEA 2RJDA 4QQ6A 1RI9A 4BUGA 2V26A 4LDVA 1M1KR 1GFDA 1M2VB 2COWA 5CK9A 3I5SA 2ZPHB 2H3EB 2JVVA 2YSQA 2KGTA 2XICA 1GRIA 2BZYA 3VU3C 4M7AC 4M7AE 1NPRA 4MDXA 4K11A 5D6XA 3QKJA 5FU6B 3LGLA 2K9GA 1VQPA 1IO6A 4OMOA 1KC8R 1YHQQ 3QUIA 4XU1A 4LXCA 1J3TA 3PMIA 1MMAA 5I21A 4DBQA 2LVMA 1O9SA 1YITA 3OYGA 3CPWS 2DEUA 2C0TA 3CD6T 3V8JA 2LX7A 3X26B 5KYYA 2PVGB 2L0AA 1JB0E 3RBBB 4X34A 2XMFA 4E2FB 1N8RC 5I11A 3X24B 2PVDB 2MK5A 1MV0B 3CMET 4ZNXA 2DBKA 3QXEB 3RESA 1N6AA 1UE9A 2Y4XA 4M75F 2LMJA 1RLPC 2DL4A 2BZ8A 3CCLQ 2YWWA 1QP3A 2DERA 2EW3A 2RQTA 2JNGA 1Y7XA 5LJ3e 1N5ZA 4MDWA 3O5ZA 3A8MB 2NUTB 4IUPA 1E7OA 2OI3A 3H0HA 1RAFB 1OPLA 1FX7A 2GQIA 2PNIA 1KIKA 2CZ0B 2FG0A 2JMCA 3GBQA 2IPOB 3V8KA 3OYAA 2R57A 1NM7A 1VQPT 4M77C 4M77E 2LJ1A 2XDBA 3G6ET 3A8LB 3LW5E 2CP7A 2QDYB 2HZYA 1EX4A 3EH2A 1YITT 5HK3A 4FSXA 1GCPA 3OSVA 2EYWA 1KD1U 3MHXA 4BDZA 4M75C 1Y0MA 2FO0A 3OYFA 1WI7A 1VQ7Q 3CBPA 2WACA 4XU3A 4FIBA 2FRWA 2EJGA 1XOVA 2WSEE 2HBPA 4EMKC 3FJPA 3M0SA 2RQRA 2X4JA 2KYMA 2YLBA 2LQWA 1QWFA 4XAXB 1RACB 3I55Q 1Q86R 4JPBW 3FJ5A 2DTIA 2ZPIB 3RR6A 3JCMQ 3DKMA 3OSSC 4E7KA 2CGHA 2CREA 1UHFA 3CC7Q 4IUUA 1K9MC 2VKNA 1AWWA 3QDFA 2R58A 5CKDA 1KQSA 2K57A 1ACMB 4C0DC 4A4HA 4V2SA 4XK8E 3LGFA 3I56A 4IURA 2K7AA 4A4EA 1RAEB 1YI2A 2HBWA 4BE2A 1H3HA 3CCQQ 1WLPB 1T0HA 4OMQA 4RTXA 1UGVA 4CRIA 2DF6A 1GFCA 1U1TA 1I1JA 4LDXA 2DETA 1Y07A 2GNCA 2O9SA 1Q86C 4M7DD 3VS0A 3MJXA 2FVUA 1W2BP 1KK7A 1XTDA 3WVEB 2ROTA 1OEBA 1Q7YR 3IQLA 1WNLA 1G8XA 3MEWA 3JCMb 2JT4A 4GY5A 2F5KA 3FB9A 3KBGA 1YJ9Q 3URGA 3QHSA 1OX9A 1YCSB 3OW2A 2AHJB 5DLOA 1CSKA 3NPFA 2X4YA 2Y4YA 1KD1R 3DB4A 3HSBA 1YWOA 1VQ4A 2RQVA 4FU6A 4C5IA 2L3QA 1QVFA 2YT6A 3J80E 4PLLA 3RIRA 3OA6A 3L2QA 5CQYA 2F2XA 2HEQA 2KT1A 4DBRA 4DEXA 2K79A 3I56T 3HRUA 3BW1A 4C8QF 2COZA 1TXQA 2XDDA 1YI2T 1QLYA 3R6NA 1HD3A 4LD9K 4C92F 2LCLA 2ROLA 1K8AU 3EFOA 4IIOA 3GLXA 2VGNA 3QYGB 1BI3A 1JQQA 4BY6B 4M7AB 3M59A 4TVRA 2BIVA 1PSFA 3JCMV 2O2OA 2ZPFB 4HVWA 2JOYA 1NZ9A 5GAOm 4A54A 4ZN1A 4M78A 2B86A 3HRSA 3JCMX 2SRCA 2EWNA 2CZ1B 1NLOC 1K73U 5CAIA 3EHRA 1VQ4T 2QEXA 3JSCA 4JLIA 3G71Q 3E19A 3JCMf 3CBOA 4EMGA 3I35A 3CC4Q 4R56A 5IHKA 2VXEA 2RHXA 3SD4A 5GAMj 1MMGA 1WHJA 3A8OB 2VB6A 2LNVA 1EFNA 1MNEA 4LDUA 2OTJQ 1UHCA 2C06A 3CCEQ 2DEQA 3E9GA 3OMCA 4Y92A 5CVIA 4F7UG 1Y96B 1I4K1 4MMKA 1BKBA 3LWHA 4O5VA 2QQBA 4RTZA 2CZ6B 2X4WA 2DD5A 4PFZA 2F69A 3C4SA 4P5NA 4PJMA 3D7SB 1D3BB 2RO0A 3JRZA 1FMVA 5IHNA 2RQUA 1WXUA 1QCOA 4LD6A 2DD4A 2JTEA 3M58A 3CCJQ 4XTXA 1MV3A 4E7LA 4M77B 4ELZC 1R0CB 1O75A 1TWBA 4A53A 1YJWA 5KE2A 3JB9H 3OYNA 4FCYA 1Q82R 1QCFA 2QEXT 3QIIA 1G3SA 4RG2A 2JUFA 2KRMA 3C95A 2GQVA 2NLUA 3VRZA 4JJBA 5A0DA 2RH2A 2E65A 3UATA 1M1FA 2JZ2A 2G6FX 2HDAA 2LTOA 4JRKA 1VQNT 2O88A 3OBWA 1K0XA 3H8ZA 2E5KA 5FRMA 4PFPA 3SFMA 5IXBA 1R8OB 1JEGA 3WXMB 1AT1B 4J5YA 4PNOA 1K9AA 2DYBA 4QQGA 4J8OA 5KYXA 3JCMh 1W2BS 1VYVA 3ME9A 1E6HA 3QPHA 2W0ZA 3JB9D 1P92A 1PD1A 1OPKA 4HA8A 3S3NA 2LQKA 3V7RA 4CC3A 3BY7A 4OB2B 3OYKA 1AHJB 1Q82C 2DAQA 1LCKA 2E3HA 5GAN7 1OI1A 2PTKA 1I5OB 1VQ6T 3ULRB 4C0DB 1VA7A 1YJWT 4M75A 1KHCA 2Z0WA 3QSUA 2PU9B 1PRMC 1SSFA 1WJSA 2D0NA 2LJ0A 4AG2C 4EMKA 1IXDA 1ZSGA 1LVKA 1YFNA 4OB0B 2GFUA 1RI0A 3VUBA 3RKXA 2RM4A 2NUPA 5L23A 4JRIA 1VOMA 2XDPA 1D1AA 3CC2T 2DIQA 3JCMg 4D8DA 4PFOA 4IKFA 2DIGA 4XQ3A 1ZBJA 2LP5A 1JU5C 1Q81U 3TSZA 5GMKi 3REAB 2KI7A 3PT9A 2CYZB 5GANe 5DLQE 1NJIC 8AT1B 4R0KA 4IUVA 2DXCA 3OY9A 4MZMA 5IAYA 1G5VA 1RL2A 2K3XA 2QTXA 1FMWA 2V8JA 2PUOB 1YHQA 1GBRA 1NEGA 5LJ3j 3U23A 3META 3J7AF 2DM1A 3M56A 4PJOF 1U06A 5LJ5f 3OYLA 2DVEA 1SSHA 4BI4A 3QWYA 4JLGA 3QWXX 2M0OA 1B3QA 1VQLT 4A4GA 2GGRA 4PLIA 2DVJA 2DXUA 1H8KA 2J6KA 2QA4Q 4ZN3A 2O9VA 4JRPA 2K5IA 3C94A 1M1GA 3CCUQ 3OYYA 4C8QG 3AHUA 3M0QA 4N4GA 3SWNA 1ABQA 2OTLQ 3EG3A 3TREA 2Y90A 1N8RU 5FLXE 2L3PA 4C92G 1M2OA 1T3LA 4OMLA 2RJFA 4N4HA 4OB3B 3CCLA 4QVDA 1SRLA 2K6DA 4X9CA 1K76A 3M5AA 4J9BA 3CPWA 2CKKA 3H9NA 1QP2A 4A4KA 2LT4A 3UA7A 1T3SA 1YHQT 4KBMB 1YJNA 5AT1B 3OMGA 4OF1A 1TUCA 3P8HA 4BI8B 4J6XA 1QVGP 3FEOA 3VRYA 2EFIA 1W4SA 1WHMA 4ZGDB 4E7JA 1G2BA 1RLQC 3JV3A 3PIOA 3R6OA 4F16A 1GCQC 4BDYA 4CC7A 2X35A 1PHTA 4M78E 1ZUKA 1M27C 1VQ7A 2ABLA 3QBYA 5CCAA 2MF2A 4C0FA 3L42A 1AWXA 1C0MA 1D1BA 5A2QE 4B6MA 1WIEA 1YWPA 1E6GA 5KYYB 1ZUYA 2E12A 5LJ5h 1UJYA 3PE0A 3X28B 1QVPA 4C8QA 3ZFJA 4M78D 4Q5WA 3CCLT 2QQ9A 5KYUA 1PWTA 2KDSA 3I55A 2E4HA 2XHCA 1R0BG 4WCIA 3CC7A 1QWEA 3E9FA 1AVZC 5GJWB 1IGQA 2LQ8A 2NWMA 4B9XA 1K0SA 4BI3A 3C12A 4HVUA 1YJNT 2MWOA 2ECZA 5I2MA 2DTOA 3OYMA 5FU7C 2E6ZA 5A0LA 1K9MU 5GAN6 3OB9A 2KROA 2KMTA 1M90U 1ZLMA 2RB6A 3CMAT 3CCQA 1SPKA 3S3OA 3QYHB 5GAN4 4JJDA 4ZGJB 1VQ7T 4L6V5 3F70A 4F7UF 4M7AD 4ZTJA 4R55A 3L2ZA 1VIFA 5LJ5g 1HYOA 4LDYA 1FMKA 1U5SA 1M1KC 4GLMA 1IB8A 3QJYA 1D0ZA 1WXBA 2PQWA 3AT1B 2CUDA 1UTIA 1IREB 2KE9A 4IUTA 3Q1JA 5LJ5d 1YJ9A 1TS9A 2ZAEA 3I55T 2XKOC 4F14A 1WHHA 2RJCA 1B34A 2O4XA 2M1HA 1KC8C 1B7TA 3CC7T 2M16A 1X2KA 1Z9ZA 5GMKe 4KRTA 2DXTA 1G83A 1M2VA 4KGVB 2DZCA 2RI2A 2LQNA 4FSSA 4HCKA 2YHTA 5AYFA 3KFVA 2X51A 1KQ1A 1UGPB 2C0OA 5FRNA 2F5TX 1GXIE 1IZ6A 2DNUA 1N27A 3E1SA 2M9UA 4M75E 1EIFA 2DTHA 2LX9A 2E6NA 5CO7A 4M77D 4OMFB 4WTOB 3HRTA 4DBHA 1A0NB 2VV5A 1JRIA 5J26A 3G4SQ 2A36A 2GBQA 3OW2P 2OJ2A 3RDVA 1LOJA 1YJ9T 1UEBA 2BZXA 2HQHA 4JRQA 4DOWA 2MAMA 2MWPA 4EMHA 5KYWA 3UPUA 4M75D 2FB7A 3RKWA 3OYJA 2VC8A 4ELYC 1U1SA 2A08A 3EGXA 2JW4A 1D0YA 2EGEA 2XU8A 3G71A 1OULA 4M7DF 1ZBXA 3EGDB 1RAAB 3CC4A 1QVGS 2W10A 3CCSA 4ATOA 3A5ZB 4PJOG 3RNJA 3J81E 1OZ3A 1EZZB 3EGUA 2LJ3A 4OGEA 2OTJA 1WPYA 1MMNA 3LH0A 3CCEA 2HNIA 4GBQA 3MO8A 2MPXC 8ATCB 2ZPGB 4GLKA 1BK2A 4OMPA 4NS5A 2CSIA 3E2UA 2CZ7B 2K4YA 1VYUA 2YXYA 3M53A 1VQMA 3SB2A 1WJQA 2QASA 2KNBB 4D8KA 1QKXA 3REBB 2DL5A 3CCJA 1VUBA 3G6EQ 4AFSC 1XJWB 1VQ5Q 5HK0A 3EFOB 1X69A 2LCCA 3T9NA 4XTUA 3SWNC 3M4GA 4RMOA 1YIJQ 4EDUA 4HVVA 3G71T 2YLCA 2BE7D 4M78B 3CC4T 3NTIA 3LWIA 3TU4K 1TU0B 2CP5A 2ENMA 2EGAA 3CCST 2KXCA 4J6WA 4DEYA 1TOVA 2K3YA 5EC7A 4E7HA 3ER0A 2OTJT 4B9WA 2P0KA 1VQKQ 1KHIA 3CCET 2L2PA 4ME7A 4PJOA 3BFMA 3HFNA 4J9CA 3RKYA 2K2MA 1G3YA 1NE8A 1ZSZA 2V1QA 2LZ6B 3M0TA 6AT1B 2MMPA 3DLMA 1VQMT 1Q7YC 2VXFA 3M0RA 4F04B 3CCJT 2QDLA 2HKQB 1KD1C 2V1RA 5ECAA 3OS0A 2KBTA 1UGQB 4LE9A 5GAOq 3FC3A 2MI6A 5GANj 4KGZB 4VUBA 2PVOB 1GCQA 3UDCA 4MZTA 2IVWA 1TG0A 2RHZA 2AZVA 3EG9A 3QDRB 2DO3A 4C8QC 4C8QE 1AWJA 1K1ZA 4N4IA 3H0FA 2RA2A 1PKTA 4C92C 3OYHA 1BCMA 2RHUA 2V8KA 5FROA 3EHQA 5LL6S 4X9DA 2CT4A 2AZSA 3KXTA 4N0AA 1W2BA 2XI9A 3OYCA 3VUZA 1JJ2P 4ESRA 3PFSA 2GTJA 2ED0A 3MPUB 1T0JA 2KAFA 2EQJA 2QGGA 3CEYA 3M55A 1YBYA 4CC2A 4LN2A 3UF4A 4KGXB 2EQUA 1JXOA 1NBEB 5GAMf 2WSFE 1AZGB 1NJIU 1ZA1B 2JS0A 5KYXB 3SHWA 4RTWA 4OMNA 3MCAB 2CP6A 5GAOn 2QI2A 1M30A 2DRMA 1F1BB 2GCXA 2FHDA 4M77G 2DL7A 4XTWA 2AIRB 3GNGA 1PCXA 2IIMA 2VUBA 1CKAA 3CXCP 1HJDA 4RTUA 3JB9F 2HMAA 1QMCA 2QA4A 9ATCB 4M75B 3JCMJ 4J9IA 1NLPC 1K8AR 2RPNA 1M8MA 3CCUA 1AEYA 1RUWA 1X6BA 4KT0E 3CCMQ 1NYFA 2KT8A 4J9HA 1UDLA 2OTLA 3BDUA 4EMKB 3L2WA 1BU1A 4FYWB 1KQ2A 3VS4A 2EQMA 3HTRA 3LYIA 5D7UA 1S72A 3V7SA 3S6WA 2JXBA 2NUPB 1RAGB 1MUZA 4J7IA 2B8AA 2HSEB 1K73R 4F7UA 3OYIA 2RK2A 3VKIA 3RMSA 3GP8A 4E47A 1NYGA 3A98A 2FPEA 3EG2A 5M9OA 3HPWA 2EVRA 2GTOA 2MIOA 1K8AC 2QG9B 3CCRQ 1W70A 2CH4A 2VGMA 3H6ZA 4M7DG 1M3CA 4FW2A 2EQKA 3C0CA 4FT4A 2QA4T 5GAMh 2D6FA 3S3MA 2JM9A 3OYBA 1AWOA 2MYSA 3HKSA 4QW2A 3CCUT 2LT1A 1S1NA 1TUDA 4C5EA 4HT9A 4DOVA 2OTLT 1MGQA 1CKBA 3MKDA 1NG2A 2KRSA 3MEUA 2LCSA 5GJVB 4JZ4A 1S72T 3ZEHA 3X20B 2YRVA 4PKCC 1LPLA 3PTAA 2HQXA 3SWNB 3GF5A 2D8JA 3ZL7C 2JM8A 1JBMA 2QAZA 4E7SA 1SHFA 3P8DA 3EAEA 5GAN5 2ZGWA 4RTYA 5GANd 2MOXA 1VQNQ 1N9RA 1VIEA 4CI0C 1WHKA 4JZ3A 2I0NA 3M57A 3L2VA 3GNFB 5GAMg 5GMKj 5HY6A 2HD0A 3OS1A 5CKEA 3JCMe 2RHYA 2HSPA 2KYBA 2ZPEB 3QZ5B 2QTVA 2E3IA 3A8GB 5CIUA 4M7DA 4OB1B 2P84A 5GAMd 1JJ2S 4A63B 1M4ZA 5LJ3f 4Z89A 1VQOQ 3WVDB 4UC4A 2DX1A 3PMTA 5L8RE 1VQ6Q 1RADB 3FLGA 1M1KU 1X2QA 2JS2A 1TSFA 2FZKB 5CQXA 1OQKA 2QQAA 2VWFA 3VS7A 2NYSA 2YUQA 1GL5A 1HSQA 4PJOC 4PJOE 1AZEA 2SEMA 4HKEA 2J05A 2FYKA 2R5AA 4C8QB 1H92A 1V1CA 1OU8A 4Z88A 4PJJA 4J9FA 5KYUB 1ZSZC 4ANJA 2DE0X 5GAOl 1KC8U 1OV3A 2VASA 2JTMA 4DA4A 4QVZA 2F2VA 2L8DA 3BE3A 2K5LA 4E7ZA 3CXCS 4M78F 3CC2Q 1UB4A 4HXJA 2MCNA 1HK9A 1XNIA 2P0PA 3GOXA 4Z8AA 1M8VA 1WX6A 4XTZA 1H3ZA 3M54A 4AMCA 2YRDA 1Q81R 5J3BA 1SEMA 3ZBDA 3X25B 1OZ2A 2CT3A 3FRNA 1X43A 2DZ9A 2AKKA 3EG0A 4JJCA 3V7CA 1JO8A 4BD3A 1RAIB 3G4SA 3L2UA 1I5LA 1NEBA 4AFZC 1BIAA 1YP5A 3PVLA 3ASKA 1X27A 2X4XA 1OYXA 7AT1B 5KYNA 1C1AA 3OS5A 2RHIA 4N0AC 1WHLA 4M7AF 1ZHIA 2KQWA 1VQLQ 2EYZA 4C92A 3MP6A 3CBMA 2DILA 1VYTA 1PNJA 1D0XA 2KRNA 4WF2A 5LJ3h 4EIKA 1B34B 2O4XB 1PSEA 3QG1A 2CSQA 1Q95G 5CKHA 1Q81C 1BYMA 2QQRA 2FPDA 2D0QB 4PJLA 2OAWA 1SF9A 3HL8A 5A0GA 1N8RR 3JB9G 2FZCB 2RN8A 4AG1C 1AD5A 1V76A 2EJFA 3PNWC 1VQ8Q 2M51A 1UUEA 2C0IA 2DKGA 4BY6C 4X1VA 3JCMW 2XD0A 3RUXA 2O01E 2CP0A 4C5HA 2KVQG 2M02A 2DXBA 2HQEA 3G4ST 3VS2A 3G6EA 4FL6A 1TH7A 1VQ5A 4RKUE 2L89A 2VVKA 2P4RA 1Q86U 1QVGA 2LRQA 1SKUB 2LDMA 5LJ3g 1VQ9Q 2EYXA 1YIJA 1WQ7A 3SDZA 3L1AA 5GAN3 1QW1A 3CCVQ 2DL3A 4M77F 3VV0A 2E1HA 4JJNK 2RI5A 4IIMA 2KY9A 5KYWB 2JJ9A 3P8BB 2DL8A 5LJ5e 1KQSP 5LJ3d 3DLLA 3EGXB 5IHIA 4F7UE 3O8VA 1KFZA 5GMKl 2X3WD 3NFCA 1VQKA 2EQIA 1ZA2B 2BE9B 5GAN2 2DK3A 5HCKA 1QCNA 3MP8A 3CCQT 3OS2A 1WZOA 1X75C 1M9SA 3OYDA 1IRXA 1BCOA 2PUKB 3NTHA 2YUPA 2PZ1A 2EYQA 1YJNQ 2X9HA 2JMAA 5FW9A 2E70A 4HCBA 2A0FB 1VQ5T 1Q7YU 4C5GA 1UJ0A 5KE3A 1RABB 4AFQC 4KH0B 2DJQA 4HCCA 1K9MR 2R5MA 1YNZA 2CUBA 3CMAQ 1D1CA 1ZUUA 1YIJT 3EG1A 2P4TA 1M90R 2J06A 3CD6Q 3DB3A 4LUEA 4RTVA 1G3TA 1QVFP 4JDSA 1ABOA 3TSWA 2EYYA 4A4FA 2E64A 1BB9A 2CDTA 1VQKT 5KCHA 2ZZDA 4FYXB 4L5GA 4RTTA 3H0IA 2EPDA 3CMEQ 3EFRA 2NUTA 5HKCA 2BTTA 5DY9A 4Y91A 5J39A 3LH5A 5CKFA 2H3JA 2RF0A 3QO3A 2L3RA 2AKLA 1D09B 4PJOB 4FYYB 5EG2A 5IH2A 2ESWA 2A37A 3OBYA 4XTYA 1M90C 1ZSZB 1PC0A 4M7DC 1PD0A 2DMOA 1VQPQ 4M7DE 4J7FA 1SG5A 4LNPA 3QJ6A 1U3OA 3FIFA 4MMLA 1YITQ 1BBZA 5CR2A 3FDRA 4RCCA 4CC4B 4FW1A 3I9QA 4ZGEB 3UWNA 1I07A 5GAOr 2P0QA 2DLPA 3G1JA 2RQWA 4XU2A 2E5QA 1SRMA 5C0MA 1PG5B 3EG9B 4M78G 2YUNA 3CCMA 3I5RA 3H41A 1UGRB 3VYHB 1UGSB 5IT9E 1BIBA 1I0CA 3EGDA 1FXXA 1M5Q1 2L3SA 1AOJA 4OGCA 3VS5A 3GPLA 5GAOp 4F17A 2EKOA 2J6FA 2G3RA 2GF7A 3GIBA 1QKWA 4KUIA 1MMDA 4QKUA 1HXDA 4MZPA 5GAN8 3UT1A 1LNXA 1GBQA 4M7AG 3CCRA 5FU7B 4OVAA 3TEEA 1Q82U 2DPPB 2D1XA 3HHTB 2HKNA 1KQSS 4E7IA 2FPFA 4AFUC 4QT7A 5KH6A 1BI1A 1OX8A 4PK4A 3CCMT 2K2VA 3INZA 4C92E 4IUQA 3M0UA 4J83A 5FWBA 5GANf 1KSWA 3BDLA 4Z02A 2O31A 3EFSA 4PL6A 4FT2A 1WFWA 2FL7A 4C8QD 3VS1A 2RNAA 2NUZA 2AK5A 1N9SA 1U8RA 2HL3A 4C92D 3M4YA 2QK0A 2DYIA 1TUGB 2F2WA 2RMOA 3CCSQ 2CP3A 2FEIA 1I81A 2XG8D 1M3AA 3OW2S 1FWZA 1VQNA 1YN8A 4JS4A 2F1LA 3TVTA 4BE1A 4F7UB 2M0YA 3TQ7P 3CCRT 2D9TA 3I56Q 1QVFS 4M4ZA 1KJWA 3JB9I 1YI2Q 2QGFB 5C6SA 1X6GA 4M7AA 1WGSA 4XU0A 3RMQA 2ATCB 2JTFA 1LJOA 4J9GA 1VQMQ 2EAYA 3MEAA 2FRYA 2QYZA 4C0ZA 1UECA 2DBMA 2DJZA 2CP2A 4YTLA 4BB7A 2E10A 2COYA 4FYVB 1VQOA 4JS5A 4M75G 3G7ZA 1H641 2VYTA 1VQ6A 1WDXA 4KULA 2H8HA 5KCOA 4QQDA 1FYNA 3PVQA 3VS6A 1W6XA 3VYGA 4J9DA 2KXDA 4EPCA 3CQTA 1VQ4Q 1KG1A 3NHNA 3SEMA 2DA9A 5FU6C 4NOYA 2KR3A 5GANh 4L59A 2HCKA 4C0GA 2D8HA 1Y96A 1NPPA 1UG1A 3LLRA 1G3WA 3CC2A 4KH1B 4OP0A 4RUGA 1JJ2A 2AT1B 1D3BA 4Y28E 5IXFA 4QVCA 1DJ7B 1YCYA 2EJ9A 2ZCFB 4M77A 1W1FA 3M9QA 2EIFA 4RCBA 3KUFA 2RD1A 2WSCE 4E6RA 1PKSA 2RJEA 5IN1A 1M3BA 2BUDA 1VQOT 2J7IA 4JUVA 1SHGA 4M7DB 1NJIR 2L5QA 1K73C 2JN0A 2CS7A 5GMKm 2HAXA 3A8HB 4KUDK 1IHWA 1ZX6A 2CH4W 1VQLA 2OX7A 5GANg 1IHVA 4HCZA 3CXCA 4D6WA 2QEXQ 2YDLA 3A1PA 5D6YA 3CPWP 1WYXA 2EGCA 3PIPA 1ZQ1A 3JB9J 2YUOA 4HT8A 4DBFA 3UA6A 1OOTA 4NL3A 3JAME 1C6VX 2FZGB 5I22A 3TCJA 2RK1A 2KK4A 4O6JA 4BACA 2KSSA 3CPFA 1VQ8A 5LJ5j 2X3XD 1B07A 4BE0A 1PM3A 3EH1A 1JXMA 2BKDN 3JCMd 3MEVA 1X01A 4LDWA 3JCMc 5I2SA 1MHNA 4DQ2A 1Y57A 2EBPA 1WXTA 3VS3A 4FM4B 3PGGA 3M0PA 1ARKA 4RG8A 1BI2A 1WJRA 3L2RA 3NMZC 2DFUA 3HFOA 5GAMe 1VQ9A 1YJWQ 3JCMP 4AT1B 4XTVA 3CCVA 4J6YA 1RAHB 2XIDA 2XK0A 1I8FA 3N5BB 2ZPBB 3LX7A 2J6OA 1X6OA 5CKBA 4C92B 4II1A 2A28A 2E41A 2K5FA 2OAUA 2RI3A 5D6WA 2QXFA 1PRLC
chains in the Genus database with same CATH topology
2A7YA 5GAN2 2DK3A 1VQ8T 3BFMA 3SFMA 1R8OB 3NTKA 3HFNA 3MP8A 2QQSA 3CCQT 4PJOD 3WXMB 3OS2A 4J5YA 1BI0A 3RKYA 1G3YA 1NE8A 4PNOA 3MP1A 4QQGA 1X75C 1M9SA 4J8OA 2I2LA 3OYDA 3JCMh 2MMPA 1W2BS 3DLMA 1VQMT 3ME9A 1Q7YC 2PUKB 3QPHA 3NTHA 3HP9A 3JB9D 1P92A 2VXFA 2EYQA 4HA8A 3S3NA 2LQKA 3V7RA 4ZTFA 3BY7A 4OB2B 3OYKA 1AHJB 1Q82C 2DAQA 2E70A 1V29B 3CCJT 4HCBA 1VQ5T 1KD1C 4PJOA 5GAN7 1Q7YU 2V8IA 1OI1A 3OS0A 3V8LA 4C5GA 5KE3A 1UGQB 5GAOq 3QZ9B 3OQ5A 3FC3A 1VQ6T 4NL2A 2MI6A 4C0DB 5GANj 1XQHA 2A3LA 4HCCA 4VUBA 2PVOB 3UDCA 3CMAA 2GFAA 2R5MA 4MZTA 1YJWT 4M75A 1KHCA 1WQWA 1VQ9T 2IVWA 3QSUA 2RHZA 2PU9B 1YIJT 2P4TA 3QDRB 4M78C 3CD6A 1SSFA 1WJSA 2DO3A 3CCVT 3DB3A 4C8QC 4C8QE 3OYEA 3RERA 1G3TA 4JDSA 4N4IA 3VJPA 1Y71A 4EMKA 2RA2A 2IG0A 4C92C 3OYHA 4OB0B 2GFUA 2RHUA 2V8KA 5FROA 4A4FA 5LL6S 2E64A 1RI0A 4X9DA 5GMKh 3VUBA 3RKXA 2LC4A 2RM4A 1VQKT 5KCHA 5DM7R 4N0AA 3KXTA 1W2BA 2ZZDA 4JRIA 4L5GA 3CMEA 2XI9A 2XDPA 3OYCA 2RJDA 3EFRA 3VUZA 3CC2T 4M7AF 4QQ6A 2DIQA 3JCMg 4BUGA 4IKFA 3PFSA 5HKCA 2DIGA 5DY9A 4LDVA 4XQ3A 4Y91A 5J39A 5CKFA 2H3JA 1Q81U 5GMKi 3QO3A 2KAFA 2L3RA 2EQJA 3M55A 3CEYA 3PT9A 1YBYA 5CK9A 2ZPHB 2JVVA 2CYZB 4PJOB 5EG2A 5DLQE 5GANe 1NJIC 2XICA 2EQUA 4IUVA 2DXCA 5GAMf 3VU3C 3OBYA 3OY9A 4MZMA 5IAYA 4XTYA 4M7AC 4M7AE 1G5VA 1NPRA 2WSFE 1RL2A 4MDXA 1M90C 2K3XA 5D6XA 3QKJA 2QTXA 5FU6B 3LGLA 2V8JA 2PUOB 1NJIU 1VQPA 1YHQA 4M7DC 4M7DE 3QUIA 4XU1A 3MCAB 4J7FA 5LJ3j 5GAOn 2QI2A 3QJ6A 3META 2GCXA 3J7AF 3FIFA 3PMIA 2FHDA 3M56A 4MMLA 4PJOF 5I21A 2LVMA 5LJ5f 1O9SA 4M77G 3OYLA 3OYGA 1YITA 2DVEA 4XTWA 4BI4A 3CPWS 5CR2A 3FDRA 4JLGA 3GNGA 3CD6T 4RCCA 3V8JA 2VUBA 2M0OA 3X26B 1VQLT 4A4GA 3UWNA 4ZGEB 3JB9F 4PLIA 5GAOr 2DXUA 2P0QA 2PVGB 2QA4A 1JB0E 4ZN3A 4M75B 4XU2A 4JRPA 3JCMJ 4X34A 2E5QA 2K5IA 1N8RC 3CCUA 5C0MA 3C94A 1M1GA 4M78G 3CCMA 3OYYA 3X24B 4KT0E 4C8QG 3AHUA 1UGRB 3VYHB 2PVDB 4N4GA 1UGSB 3SWNA 2OTLA 3CMET 5IT9E 3BDUA 1BIBA 3TREA 2Y90A 4EMKB 5FLXE 3QXEB 3RESA 4C92G 3L2WA 1N8RU 1FXXA 1M5Q1 1N6AA 1KQ2A 2EQMA 2RJFA 3LYIA 2Y4XA 4M75F 4N4HA 4OGCA 5GAOp 3GPLA 4OB3B 3V7SA 1S72A 3S6WA 3CCLA 2EKOA 1QP3A 4QVDA 2G3RA 2JNGA 1Y7XA 2GF7A 2B8AA 4J7IA 4MDWA 4X9CA 5LJ3e 3GIBA 3M5AA 3A8MB 4F7UA 4IUPA 3OYIA 1FX7A 2CKKA 3CPWA 4KUIA 1QP2A 2CZ0B 3V8KA 4A4KA 2LT4A 3OYAA 2RK2A 3VKIA 2R57A 3RMSA 1YHQT 4KBMB 4M77C 4M77E 4E47A 3GP8A 1YJNA 1VQPT 2XDBA 3G6ET 1HXDA 3A8LB 5M9OA 3LW5E 3OMGA 4MZPA 4OF1A 3HPWA 3UT1A 5GAN8 3P8HA 2QDYB 4BI8B 1LNXA 4J6XA 1YITT 4M7AG 3CCRA 3FEOA 5FU7B 5HK3A 4FSXA 4OVAA 2EFIA 1K8AC 3TEEA 1W4SA 3OSVA 1Q82U 4ZGDB 4E7JA 2DPPB 2VGMA 3H6ZA 1KD1U 3PIOA 3HHTB 4M7DG 3R6OA 3MHXA 4BDYA 4BDZA 2EQKA 2X35A 1KQSS 4FT4A 4M75C 4M78E 4E7IA 3OYFA 5GAMh 2QA4T 2D6FA 1VQ7A 3S3MA 3CBPA 3QBYA 5CCAA 2WACA 2MF2A 3OYBA 5KH6A 3HKSA 1BI1A 4QW2A 4C0FA 3L42A 3CCUT 4XU3A 4FIBA 2LT1A 2EJGA 1XOVA 2K2VA 2WSEE 3INZA 5A2QE 3CCMT 4C92E 4IUQA 2HBPA 4C5EA 4EMKC 4HT9A 4DOVA 4J83A 2OTLT 3FJPA 5GANf 1MGQA 3BDLA 2X4JA 4Z02A 2E12A 5LJ5h 3EFSA 3MEUA 2YLBA 3X28B 1QVPA 4PL6A 4C8QA 1S72T 3ZEHA 3X20B 4FT2A 4XAXB 2YRVA 4PKCC 4M78D 4Q5WA 3ZFJA 3PTAA 3CCLT 2QQ9A 2KDSA 2FL7A 4C8QD 2HQXA 2XHCA 3I55A 3SWNB 3GF5A 2DTIA 2ZPIB 3JCMQ 1N9SA 1U8RA 3DKMA 3OSSC 4E7KA 2CGHA 3M4YA 1JBMA 4C92D 3CC7A 3E9FA 4IUUA 2LQ8A 4B9XA 1K9MC 3P8DA 3EAEA 5GAN5 4BI3A 1I81A 2XG8D 2ZGWA 3C12A 1YJNT 3OW2S 1FWZA 2MWOA 2R58A 5GANd 5I2MA 5CKDA 4JS4A 1N9RA 1VIEA 4CI0C 1KQSA 2DTOA 2K57A 5FU7C 2E6ZA 5A0LA 3OYMA 4C0DC 4BE1A 3M57A 4F7UB 4A4HA 3L2VA 1K9MU 5GAN6 3CCRT 3GNFB 4XK8E 3LGFA 2D9TA 3I56A 4V2SA 3OB9A 5GAMg 5GMKj 1QVFS 4IURA 4A4EA 2KMTA 1M90U 2RB6A 5HY6A 3CMAT 2HD0A 3CCQA 4BE2A 3OS1A 5CKEA 3JCMe 3JB9I 2RHYA 1YI2A 3S3OA 5C6SA 4CRIA 1WGSA 4XU0A 3QYHB 4M7AA 5GAN4 4ZGJB 1U1TA 3RMQA 1VQ7T 2ZPEB 3QZ5B 4L6V5 2JTFA 1LJOA 2EAYA 3F70A 3MEAA 4F7UF 4M7AD 4LDXA 3A8GB 5CIUA 4R55A 3L2ZA 4C0ZA 4ZTJA 1VIFA 2DJZA 5LJ5g 4OB1B 4M7DA 5GAMd 1JJ2S 4LDYA 1Y07A 4YTLA 4BB7A 1Q86C 1M1KC 4M7DD 1M4ZA 2E10A 5LJ3f 3QJYA 1VQOA 4JS5A 4M75G 2FVUA 3WVDB 2PQWA 3G7ZA 1H641 4UC4A 3PMTA 1XTDA 3WVEB 2VYTA 1VQ6A 5L8RE 3FLGA 1WNLA 3MEWA 3JCMb 1M1KU 1IREB 4GY5A 4KULA 2F5KA 4IUTA 3Q1JA 3FB9A 5LJ5d 1YJ9A 5KCOA 3KBGA 4QQDA 3URGA 3QHSA 3I55T 3OW2A 2AHJB 2XKOC 5CQXA 5DLOA 2QQAA 2RJCA 1B34A 2O4XA 2X4YA 2Y4YA 2M1HA 3DB4A 4PJOC 3HSBA 1KC8C 3VYGA 4PJOE 4HKEA 4EPCA 2FYKA 1VQ4A 2R5AA 4C8QB 3CC7T 2M16A 4FU6A 4C5IA 1KG1A 1QVFA 5GMKe 3J80E 4PLLA 5FU6C 4NOYA 2DXTA 3RIRA 5GAOl 5GANh 4L59A 3OA6A 3L2QA 1KC8U 4C0GA 1Y96A 2JTMA 4DA4A 4QVZA 2DZCA 1NPPA 5CQYA 2L8DA 2RI2A 3LLRA 1G3WA 2K5LA 2YHTA 3CXCS 5AYFA 3I56T 3HRUA 4M78F 3CC2A 1UB4A 3BW1A 4OP0A 1KQ1A 4C8QF 2XDDA 1JJ2A 1YI2T 1UGPB 1D3BA 1HK9A 5FRNA 2F5TX 4Y28E 4LD9K 1XNIA 2P0PA 4C92F 4QVCA 3GOXA 1M8VA 1DJ7B 1YCYA 4XTZA 2EJ9A 2ZCFB 1GXIE 1IZ6A 1H3ZA 2LCLA 3M54A 1N27A 3E1SA 4M77A 2M9UA 5J3BA 4M75E 3ZBDA 1EIFA 1K8AU 2DTHA 3X25B 1OZ2A 3GLXA 3FRNA 2LX9A 3M9QA 2DZ9A 2EIFA 2VGNA 4RCBA 3KUFA 1BI3A 3QYGB 2E6NA 2RD1A 5CO7A 2WSCE 4M77D 4BY6B 2RJEA 5IN1A 2BUDA 1VQOT 3V7CA 4OMFB 4M7AB 4BD3A 3HRTA 3M59A 4TVRA 4JUVA 2BIVA 1PSFA 3G4SA 2VV5A 1JRIA 5J26A 3L2UA 1I5LA 3JCMV 2ZPFB 1BIAA 4M7DB 2JOYA 2L5QA 1K73C 3ASKA 1NZ9A 5GAOm 2X4XA 1LOJA 1OYXA 1YJ9T 1UEBA 4A54A 4ZN1A 4M78A 3OS5A 2RHIA 2JN0A 2CS7A 3HRSA 4JRQA 5GMKm 3JCMX 4DOWA 2MAMA 2HAXA 2MWPA 2EWNA 3A8HB 4N0AC 4EMHA 3UPUA 4KUDK 4M75D 2CZ1B 1VQLA 2FB7A 3RKWA 1ZHIA 1K73U 2KQWA 5CAIA 2VC8A 4HCZA 4ELYC 5GANg 1U1SA 3OYJA 4C92A 3CXCA 1VQ4T 2QEXA 3MP6A 3CBMA 4D6WA 3JSCA 2XU8A 5D6YA 4JLIA 3G71A 4M7DF 1ZBXA 3E19A 3JCMf 3CBOA 3CC4A 4EMGA 3PIPA 4WF2A 1VQNA 5LJ3h 4R56A 1ZQ1A 3JB9J 1QVGS 4ATOA 3CCSA 1B34B 2O4XB 2VXEA 1PSEA 3QG1A 2RHXA 3SD4A 4HT8A 5GAMj 3A5ZB 4PJOG 3A8OB 5CKHA 3J81E 1OZ3A 4NL3A 1Q81C 3JAME 2LNVA 1BYMA 2QQRA 4LDUA 4OGEA 2OTJA 1WPYA 2D0QB 3HL8A 3LH0A 2C06A 3CCEA 2HNIA 3TCJA 2RK1A 5A0GA 2DEQA 2KK4A 3E9GA 3MO8A 3OMCA 5CVIA 4O6JA 4F7UG 1Y96B 2KSSA 3CPFA 4BACA 3JB9G 1VQ8A 2EJFA 3PNWC 5LJ5j 1I4K1 4MMKA 2ZPGB 4GLKA 1BKBA 3LWHA 4O5VA 2QQBA 4BE0A 2CZ7B 4NS5A 2CZ6B 2X4WA 2DKGA 2DD5A 2K4YA 4BY6C 2BKDN 3JCMW 3JCMd 3M53A 3MEVA 2F69A 1VQMA 2XD0A 3C4SA 4P5NA 1X01A 3SB2A 3RUXA 2O01E 1WJQA 4LDWA 3JCMc 1D3BB 1MHNA 2RO0A 3JRZA 5I2SA 4C5HA 2KVQG 2DXBA 2HQEA 4DQ2A 3G4ST 3G6EA 3CCJA 4FL6A 4LD6A 1TH7A 1VUBA 2DD4A 3M58A 4RKUE 4XTXA 4E7LA 4M77B 1VQ5A 5HK0A 2L89A 4ELZC 4FM4B 1O75A 3PGGA 4RG8A 1BI2A 1WJRA 2LCCA 3L2RA 1Q86U 1QVGA 2LRQA 3T9NA 4XTUA 2LDMA 3SWNC 4A53A 3HFOA 3M4GA 4RMOA 5KE2A 5GAMe 1YJWA 1VQ9A 5LJ3g 3JCMP 1YIJA 3JB9H 1WQ7A 3OYNA 2QEXT 3QIIA 1G3SA 3L1AA 4XTVA 1QW1A 4RG2A 2JUFA 3SDZA 4J6YA 4EDUA 5GAN3 3G71T 4M77F 3VV0A 2E1HA 4JJNK 2RI5A 2XIDA 2XK0A 2YLCA 3C95A 1I8FA 3N5BB 2ZPBB 2GQVA 3NTIA 4M78B 3LWIA 2NLUA 3CC4T 3TU4K 3LX7A 2KY9A 3CCST 3P8BB 5A0DA 2RH2A 4J6WA 2E65A 2K3YA 5LJ5e 1M1FA 2JZ2A 1X6OA 5CKBA 5LJ3d 3DLLA 2LTOA 4JRKA 4C92B 4E7HA 1VQNT 4F7UE 4II1A 3OBWA 2E41A 3O8VA 2K5FA 5GMKl 3CCVA 2OAUA 3ER0A 2OTJT 3NFCA 2RI3A 4B9WA 1VQKA 2P0KA 3H8ZA 5D6WA 1KHIA 2QXFA 3CCET 5FRMA 4ME7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4Y A;  2QQA A;  1G3S A;  1QW1 A;  1FWZ A;  1BI0 A;  1G3Y A;  1QVP A;  1BYM A;  3HRS A;  2K5I A;  3MHX A;  2QQ9 A;  1FX7 A;  2GCX A;  5CVI A;  4O6J A;  3GLX A;  2H3J A;  1P92 A;  2LX9 A;  1G3T A;  1BI3 A;  2K5F A;  1BI2 A;  1BI1 A;  1U8R A;  1G3W A;  2K5L A;  4O5V A;  3E19 A;  2QQB A;  3HRT A;  3HRU A; 
#chains in the Genus database with same CATH topology
 1Z9Q A;  1S72 Q;  2A7Y A;  1VQ8 T;  3NTK A;  2QQS A;  4PJO D;  1BI0 A;  5FWC A;  1IGU A;  3MP1 A;  2I2L A;  2K3B A;  1UFF A;  3HP9 A;  2YRC A;  4ZTF A;  2KEA A;  1V29 B;  2EKH A;  2V8I A;  3V8L A;  3THK A;  4J9E A;  4ORZ A;  3QZ9 B;  3OQ5 A;  4LUD A;  4NL2 A;  2DRK A;  1XQH A;  2A3L A;  4PJN A;  3CMA A;  1WHG A;  2GFA A;  2ED1 A;  1WQW A;  1VQ9 T;  1TTH B;  4OMM A;  4M78 C;  3CD6 A;  3CCV T;  1K4U S;  3RER A;  3OYE A;  1R77 A;  3VJP A;  1Y71 A;  1QQJ A;  2IG0 A;  1MND A;  3NGP A;  5GMK h;  2HL5 C;  2LNH B;  1OU9 A;  1WA7 A;  2LC4 A;  5DM7 R;  3CME A;  2RJD A;  4QQ6 A;  1RI9 A;  4BUG A;  2V26 A;  4LDV A;  1M1K R;  1GFD A;  1M2V B;  2COW A;  5CK9 A;  3I5S A;  2ZPH B;  2H3E B;  2JVV A;  2YSQ A;  2KGT A;  2XIC A;  1GRI A;  2BZY A;  3VU3 C;  4M7A C;  4M7A E;  1NPR A;  4MDX A;  4K11 A;  5D6X A;  3QKJ A;  5FU6 B;  3LGL A;  2K9G A;  1VQP A;  1IO6 A;  4OMO A;  1KC8 R;  1YHQ Q;  3QUI A;  4XU1 A;  4LXC A;  1J3T A;  3PMI A;  1MMA A;  5I21 A;  4DBQ A;  2LVM A;  1O9S A;  1YIT A;  3OYG A;  3CPW S;  2DEU A;  2C0T A;  3CD6 T;  3V8J A;  2LX7 A;  3X26 B;  5KYY A;  2PVG B;  2L0A A;  1JB0 E;  3RBB B;  4X34 A;  2XMF A;  4E2F B;  1N8R C;  5I11 A;  3X24 B;  2PVD B;  2MK5 A;  1MV0 B;  3CME T;  4ZNX A;  2DBK A;  3QXE B;  3RES A;  1N6A A;  1UE9 A;  2Y4X A;  4M75 F;  2LMJ A;  1RLP C;  2DL4 A;  2BZ8 A;  3CCL Q;  2YWW A;  1QP3 A;  2DER A;  2EW3 A;  2RQT A;  2JNG A;  1Y7X A;  5LJ3 e;  1N5Z A;  4MDW A;  3O5Z A;  3A8M B;  2NUT B;  4IUP A;  1E7O A;  2OI3 A;  3H0H A;  1RAF B;  1OPL A;  1FX7 A;  2GQI A;  2PNI A;  1KIK A;  2CZ0 B;  2FG0 A;  2JMC A;  3GBQ A;  2IPO B;  3V8K A;  3OYA A;  2R57 A;  1NM7 A;  1VQP T;  4M77 C;  4M77 E;  2LJ1 A;  2XDB A;  3G6E T;  3A8L B;  3LW5 E;  2CP7 A;  2QDY B;  2HZY A;  1EX4 A;  3EH2 A;  1YIT T;  5HK3 A;  4FSX A;  1GCP A;  3OSV A;  2EYW A;  1KD1 U;  3MHX A;  4BDZ A;  4M75 C;  1Y0M A;  2FO0 A;  3OYF A;  1WI7 A;  1VQ7 Q;  3CBP A;  2WAC A;  4XU3 A;  4FIB A;  2FRW A;  2EJG A;  1XOV A;  2WSE E;  2HBP A;  4EMK C;  3FJP A;  3M0S A;  2RQR A;  2X4J A;  2KYM A;  2YLB A;  2LQW A;  1QWF A;  4XAX B;  1RAC B;  3I55 Q;  1Q86 R;  4JPB W;  3FJ5 A;  2DTI A;  2ZPI B;  3RR6 A;  3JCM Q;  3DKM A;  3OSS C;  4E7K A;  2CGH A;  2CRE A;  1UHF A;  3CC7 Q;  4IUU A;  1K9M C;  2VKN A;  1AWW A;  3QDF A;  2R58 A;  5CKD A;  1KQS A;  2K57 A;  1ACM B;  4C0D C;  4A4H A;  4V2S A;  4XK8 E;  3LGF A;  3I56 A;  4IUR A;  2K7A A;  4A4E A;  1RAE B;  1YI2 A;  2HBW A;  4BE2 A;  1H3H A;  3CCQ Q;  1WLP B;  1T0H A;  4OMQ A;  4RTX A;  1UGV A;  4CRI A;  2DF6 A;  1GFC A;  1U1T A;  1I1J A;  4LDX A;  2DET A;  1Y07 A;  2GNC A;  2O9S A;  1Q86 C;  4M7D D;  3VS0 A;  3MJX A;  2FVU A;  1W2B P;  1KK7 A;  1XTD A;  3WVE B;  2ROT A;  1OEB A;  1Q7Y R;  3IQL A;  1WNL A;  1G8X A;  3MEW A;  3JCM b;  2JT4 A;  4GY5 A;  2F5K A;  3FB9 A;  3KBG A;  1YJ9 Q;  3URG A;  3QHS A;  1OX9 A;  1YCS B;  3OW2 A;  2AHJ B;  5DLO A;  1CSK A;  3NPF A;  2X4Y A;  2Y4Y A;  1KD1 R;  3DB4 A;  3HSB A;  1YWO A;  1VQ4 A;  2RQV A;  4FU6 A;  4C5I A;  2L3Q A;  1QVF A;  2YT6 A;  3J80 E;  4PLL A;  3RIR A;  3OA6 A;  3L2Q A;  5CQY A;  2F2X A;  2HEQ A;  2KT1 A;  4DBR A;  4DEX A;  2K79 A;  3I56 T;  3HRU A;  3BW1 A;  4C8Q F;  2COZ A;  1TXQ A;  2XDD A;  1YI2 T;  1QLY A;  3R6N A;  1HD3 A;  4LD9 K;  4C92 F;  2LCL A;  2ROL A;  1K8A U;  3EFO A;  4IIO A;  3GLX A;  2VGN A;  3QYG B;  1BI3 A;  1JQQ A;  4BY6 B;  4M7A B;  3M59 A;  4TVR A;  2BIV A;  1PSF A;  3JCM V;  2O2O A;  2ZPF B;  4HVW A;  2JOY A;  1NZ9 A;  5GAO m;  4A54 A;  4ZN1 A;  4M78 A;  2B86 A;  3HRS A;  3JCM X;  2SRC A;  2EWN A;  2CZ1 B;  1NLO C;  1K73 U;  5CAI A;  3EHR A;  1VQ4 T;  2QEX A;  3JSC A;  4JLI A;  3G71 Q;  3E19 A;  3JCM f;  3CBO A;  4EMG A;  3I35 A;  3CC4 Q;  4R56 A;  5IHK A;  2VXE A;  2RHX A;  3SD4 A;  5GAM j;  1MMG A;  1WHJ A;  3A8O B;  2VB6 A;  2LNV A;  1EFN A;  1MNE A;  4LDU A;  2OTJ Q;  1UHC A;  2C06 A;  3CCE Q;  2DEQ A;  3E9G A;  3OMC A;  4Y92 A;  5CVI A;  4F7U G;  1Y96 B;  1I4K 1;  4MMK A;  1BKB A;  3LWH A;  4O5V A;  2QQB A;  4RTZ A;  2CZ6 B;  2X4W A;  2DD5 A;  4PFZ A;  2F69 A;  3C4S A;  4P5N A;  4PJM A;  3D7S B;  1D3B B;  2RO0 A;  3JRZ A;  1FMV A;  5IHN A;  2RQU A;  1WXU A;  1QCO A;  4LD6 A;  2DD4 A;  2JTE A;  3M58 A;  3CCJ Q;  4XTX A;  1MV3 A;  4E7L A;  4M77 B;  4ELZ C;  1R0C B;  1O75 A;  1TWB A;  4A53 A;  1YJW A;  5KE2 A;  3JB9 H;  3OYN A;  4FCY A;  1Q82 R;  1QCF A;  2QEX T;  3QII A;  1G3S A;  4RG2 A;  2JUF A;  2KRM A;  3C95 A;  2GQV A;  2NLU A;  3VRZ A;  4JJB A;  5A0D A;  2RH2 A;  2E65 A;  3UAT A;  1M1F A;  2JZ2 A;  2G6F X;  2HDA A;  2LTO A;  4JRK A;  1VQN T;  2O88 A;  3OBW A;  1K0X A;  3H8Z A;  2E5K A;  5FRM A;  4PFP A;  3SFM A;  5IXB A;  1R8O B;  1JEG A;  3WXM B;  1AT1 B;  4J5Y A;  4PNO A;  1K9A A;  2DYB A;  4QQG A;  4J8O A;  5KYX A;  3JCM h;  1W2B S;  1VYV A;  3ME9 A;  1E6H A;  3QPH A;  2W0Z A;  3JB9 D;  1P92 A;  1PD1 A;  1OPK A;  4HA8 A;  3S3N A;  2LQK A;  3V7R A;  4CC3 A;  3BY7 A;  4OB2 B;  3OYK A;  1AHJ B;  1Q82 C;  2DAQ A;  1LCK A;  2E3H A;  5GAN 7;  1OI1 A;  2PTK A;  1I5O B;  1VQ6 T;  3ULR B;  4C0D B;  1VA7 A;  1YJW T;  4M75 A;  1KHC A;  2Z0W A;  3QSU A;  2PU9 B;  1PRM C;  1SSF A;  1WJS A;  2D0N A;  2LJ0 A;  4AG2 C;  4EMK A;  1IXD A;  1ZSG A;  1LVK A;  1YFN A;  4OB0 B;  2GFU A;  1RI0 A;  3VUB A;  3RKX A;  2RM4 A;  2NUP A;  5L23 A;  4JRI A;  1VOM A;  2XDP A;  1D1A A;  3CC2 T;  2DIQ A;  3JCM g;  4D8D A;  4PFO A;  4IKF A;  2DIG A;  4XQ3 A;  1ZBJ A;  2LP5 A;  1JU5 C;  1Q81 U;  3TSZ A;  5GMK i;  3REA B;  2KI7 A;  3PT9 A;  2CYZ B;  5GAN e;  5DLQ E;  1NJI C;  8AT1 B;  4R0K A;  4IUV A;  2DXC A;  3OY9 A;  4MZM A;  5IAY A;  1G5V A;  1RL2 A;  2K3X A;  2QTX A;  1FMW A;  2V8J A;  2PUO B;  1YHQ A;  1GBR A;  1NEG A;  5LJ3 j;  3U23 A;  3MET A;  3J7A F;  2DM1 A;  3M56 A;  4PJO F;  1U06 A;  5LJ5 f;  3OYL A;  2DVE A;  1SSH A;  4BI4 A;  3QWY A;  4JLG A;  3QWX X;  2M0O A;  1B3Q A;  1VQL T;  4A4G A;  2GGR A;  4PLI A;  2DVJ A;  2DXU A;  1H8K A;  2J6K A;  2QA4 Q;  4ZN3 A;  2O9V A;  4JRP A;  2K5I A;  3C94 A;  1M1G A;  3CCU Q;  3OYY A;  4C8Q G;  3AHU A;  3M0Q A;  4N4G A;  3SWN A;  1ABQ A;  2OTL Q;  3EG3 A;  3TRE A;  2Y90 A;  1N8R U;  5FLX E;  2L3P A;  4C92 G;  1M2O A;  1T3L A;  4OML A;  2RJF A;  4N4H A;  4OB3 B;  3CCL A;  4QVD A;  1SRL A;  2K6D A;  4X9C A;  1K76 A;  3M5A A;  4J9B A;  3CPW A;  2CKK A;  3H9N A;  1QP2 A;  4A4K A;  2LT4 A;  3UA7 A;  1T3S A;  1YHQ T;  4KBM B;  1YJN A;  5AT1 B;  3OMG A;  4OF1 A;  1TUC A;  3P8H A;  4BI8 B;  4J6X A;  1QVG P;  3FEO A;  3VRY A;  2EFI A;  1W4S A;  1WHM A;  4ZGD B;  4E7J A;  1G2B A;  1RLQ C;  3JV3 A;  3PIO A;  3R6O A;  4F16 A;  1GCQ C;  4BDY A;  4CC7 A;  2X35 A;  1PHT A;  4M78 E;  1ZUK A;  1M27 C;  1VQ7 A;  2ABL A;  3QBY A;  5CCA A;  2MF2 A;  4C0F A;  3L42 A;  1AWX A;  1C0M A;  1D1B A;  5A2Q E;  4B6M A;  1WIE A;  1YWP A;  1E6G A;  5KYY B;  1ZUY A;  2E12 A;  5LJ5 h;  1UJY A;  3PE0 A;  3X28 B;  1QVP A;  4C8Q A;  3ZFJ A;  4M78 D;  4Q5W A;  3CCL T;  2QQ9 A;  5KYU A;  1PWT A;  2KDS A;  3I55 A;  2E4H A;  2XHC A;  1R0B G;  4WCI A;  3CC7 A;  1QWE A;  3E9F A;  1AVZ C;  5GJW B;  1IGQ A;  2LQ8 A;  2NWM A;  4B9X A;  1K0S A;  4BI3 A;  3C12 A;  4HVU A;  1YJN T;  2MWO A;  2ECZ A;  5I2M A;  2DTO A;  3OYM A;  5FU7 C;  2E6Z A;  5A0L A;  1K9M U;  5GAN 6;  3OB9 A;  2KRO A;  2KMT A;  1M90 U;  1ZLM A;  2RB6 A;  3CMA T;  3CCQ A;  1SPK A;  3S3O A;  3QYH B;  5GAN 4;  4JJD A;  4ZGJ B;  1VQ7 T;  4L6V 5;  3F70 A;  4F7U F;  4M7A D;  4ZTJ A;  4R55 A;  3L2Z A;  1VIF A;  5LJ5 g;  1HYO A;  4LDY A;  1FMK A;  1U5S A;  1M1K C;  4GLM A;  1IB8 A;  3QJY A;  1D0Z A;  1WXB A;  2PQW A;  3AT1 B;  2CUD A;  1UTI A;  1IRE B;  2KE9 A;  4IUT A;  3Q1J A;  5LJ5 d;  1YJ9 A;  1TS9 A;  2ZAE A;  3I55 T;  2XKO C;  4F14 A;  1WHH A;  2RJC A;  1B34 A;  2O4X A;  2M1H A;  1KC8 C;  1B7T A;  3CC7 T;  2M16 A;  1X2K A;  1Z9Z A;  5GMK e;  4KRT A;  2DXT A;  1G83 A;  1M2V A;  4KGV B;  2DZC A;  2RI2 A;  2LQN A;  4FSS A;  4HCK A;  2YHT A;  5AYF A;  3KFV A;  2X51 A;  1KQ1 A;  1UGP B;  2C0O A;  5FRN A;  2F5T X;  1GXI E;  1IZ6 A;  2DNU A;  1N27 A;  3E1S A;  2M9U A;  4M75 E;  1EIF A;  2DTH A;  2LX9 A;  2E6N A;  5CO7 A;  4M77 D;  4OMF B;  4WTO B;  3HRT A;  4DBH A;  1A0N B;  2VV5 A;  1JRI A;  5J26 A;  3G4S Q;  2A36 A;  2GBQ A;  3OW2 P;  2OJ2 A;  3RDV A;  1LOJ A;  1YJ9 T;  1UEB A;  2BZX A;  2HQH A;  4JRQ A;  4DOW A;  2MAM A;  2MWP A;  4EMH A;  5KYW A;  3UPU A;  4M75 D;  2FB7 A;  3RKW A;  3OYJ A;  2VC8 A;  4ELY C;  1U1S A;  2A08 A;  3EGX A;  2JW4 A;  1D0Y A;  2EGE A;  2XU8 A;  3G71 A;  1OUL A;  4M7D F;  1ZBX A;  3EGD B;  1RAA B;  3CC4 A;  1QVG S;  2W10 A;  3CCS A;  4ATO A;  3A5Z B;  4PJO G;  3RNJ A;  3J81 E;  1OZ3 A;  1EZZ B;  3EGU A;  2LJ3 A;  4OGE A;  2OTJ A;  1WPY A;  1MMN A;  3LH0 A;  3CCE A;  2HNI A;  4GBQ A;  3MO8 A;  2MPX C;  8ATC B;  2ZPG B;  4GLK A;  1BK2 A;  4OMP A;  4NS5 A;  2CSI A;  3E2U A;  2CZ7 B;  2K4Y A;  1VYU A;  2YXY A;  3M53 A;  1VQM A;  3SB2 A;  1WJQ A;  2QAS A;  2KNB B;  4D8K A;  1QKX A;  3REB B;  2DL5 A;  3CCJ A;  1VUB A;  3G6E Q;  4AFS C;  1XJW B;  1VQ5 Q;  5HK0 A;  3EFO B;  1X69 A;  2LCC A;  3T9N A;  4XTU A;  3SWN C;  3M4G A;  4RMO A;  1YIJ Q;  4EDU A;  4HVV A;  3G71 T;  2YLC A;  2BE7 D;  4M78 B;  3CC4 T;  3NTI A;  3LWI A;  3TU4 K;  1TU0 B;  2CP5 A;  2ENM A;  2EGA A;  3CCS T;  2KXC A;  4J6W A;  4DEY A;  1TOV A;  2K3Y A;  5EC7 A;  4E7H A;  3ER0 A;  2OTJ T;  4B9W A;  2P0K A;  1VQK Q;  1KHI A;  3CCE T;  2L2P A;  4ME7 A;  4PJO A;  3BFM A;  3HFN A;  4J9C A;  3RKY A;  2K2M A;  1G3Y A;  1NE8 A;  1ZSZ A;  2V1Q A;  2LZ6 B;  3M0T A;  6AT1 B;  2MMP A;  3DLM A;  1VQM T;  1Q7Y C;  2VXF A;  3M0R A;  4F04 B;  3CCJ T;  2QDL A;  2HKQ B;  1KD1 C;  2V1R A;  5ECA A;  3OS0 A;  2KBT A;  1UGQ B;  4LE9 A;  5GAO q;  3FC3 A;  2MI6 A;  5GAN j;  4KGZ B;  4VUB A;  2PVO B;  1GCQ A;  3UDC A;  4MZT A;  2IVW A;  1TG0 A;  2RHZ A;  2AZV A;  3EG9 A;  3QDR B;  2DO3 A;  4C8Q C;  4C8Q E;  1AWJ A;  1K1Z A;  4N4I A;  3H0F A;  2RA2 A;  1PKT A;  4C92 C;  3OYH A;  1BCM A;  2RHU A;  2V8K A;  5FRO A;  3EHQ A;  5LL6 S;  4X9D A;  2CT4 A;  2AZS A;  3KXT A;  4N0A A;  1W2B A;  2XI9 A;  3OYC A;  3VUZ A;  1JJ2 P;  4ESR A;  3PFS A;  2GTJ A;  2ED0 A;  3MPU B;  1T0J A;  2KAF A;  2EQJ A;  2QGG A;  3CEY A;  3M55 A;  1YBY A;  4CC2 A;  4LN2 A;  3UF4 A;  4KGX B;  2EQU A;  1JXO A;  1NBE B;  5GAM f;  2WSF E;  1AZG B;  1NJI U;  1ZA1 B;  2JS0 A;  5KYX B;  3SHW A;  4RTW A;  4OMN A;  3MCA B;  2CP6 A;  5GAO n;  2QI2 A;  1M30 A;  2DRM A;  1F1B B;  2GCX A;  2FHD A;  4M77 G;  2DL7 A;  4XTW A;  2AIR B;  3GNG A;  1PCX A;  2IIM A;  2VUB A;  1CKA A;  3CXC P;  1HJD A;  4RTU A;  3JB9 F;  2HMA A;  1QMC A;  2QA4 A;  9ATC B;  4M75 B;  3JCM J;  4J9I A;  1NLP C;  1K8A R;  2RPN A;  1M8M A;  3CCU A;  1AEY A;  1RUW A;  1X6B A;  4KT0 E;  3CCM Q;  1NYF A;  2KT8 A;  4J9H A;  1UDL A;  2OTL A;  3BDU A;  4EMK B;  3L2W A;  1BU1 A;  4FYW B;  1KQ2 A;  3VS4 A;  2EQM A;  3HTR A;  3LYI A;  5D7U A;  1S72 A;  3V7S A;  3S6W A;  2JXB A;  2NUP B;  1RAG B;  1MUZ A;  4J7I A;  2B8A A;  2HSE B;  1K73 R;  4F7U A;  3OYI A;  2RK2 A;  3VKI A;  3RMS A;  3GP8 A;  4E47 A;  1NYG A;  3A98 A;  2FPE A;  3EG2 A;  5M9O A;  3HPW A;  2EVR A;  2GTO A;  2MIO A;  1K8A C;  2QG9 B;  3CCR Q;  1W70 A;  2CH4 A;  2VGM A;  3H6Z A;  4M7D G;  1M3C A;  4FW2 A;  2EQK A;  3C0C A;  4FT4 A;  2QA4 T;  5GAM h;  2D6F A;  3S3M A;  2JM9 A;  3OYB A;  1AWO A;  2MYS A;  3HKS A;  4QW2 A;  3CCU T;  2LT1 A;  1S1N A;  1TUD A;  4C5E A;  4HT9 A;  4DOV A;  2OTL T;  1MGQ A;  1CKB A;  3MKD A;  1NG2 A;  2KRS A;  3MEU A;  2LCS A;  5GJV B;  4JZ4 A;  1S72 T;  3ZEH A;  3X20 B;  2YRV A;  4PKC C;  1LPL A;  3PTA A;  2HQX A;  3SWN B;  3GF5 A;  2D8J A;  3ZL7 C;  2JM8 A;  1JBM A;  2QAZ A;  4E7S A;  1SHF A;  3P8D A;  3EAE A;  5GAN 5;  2ZGW A;  4RTY A;  5GAN d;  2MOX A;  1VQN Q;  1N9R A;  1VIE A;  4CI0 C;  1WHK A;  4JZ3 A;  2I0N A;  3M57 A;  3L2V A;  3GNF B;  5GAM g;  5GMK j;  5HY6 A;  2HD0 A;  3OS1 A;  5CKE A;  3JCM e;  2RHY A;  2HSP A;  2KYB A;  2ZPE B;  3QZ5 B;  2QTV A;  2E3I A;  3A8G B;  5CIU A;  4M7D A;  4OB1 B;  2P84 A;  5GAM d;  1JJ2 S;  4A63 B;  1M4Z A;  5LJ3 f;  4Z89 A;  1VQO Q;  3WVD B;  4UC4 A;  2DX1 A;  3PMT A;  5L8R E;  1VQ6 Q;  1RAD B;  3FLG A;  1M1K U;  1X2Q A;  2JS2 A;  1TSF A;  2FZK B;  5CQX A;  1OQK A;  2QQA A;  2VWF A;  3VS7 A;  2NYS A;  2YUQ A;  1GL5 A;  1HSQ A;  4PJO C;  4PJO E;  1AZE A;  2SEM A;  4HKE A;  2J05 A;  2FYK A;  2R5A A;  4C8Q B;  1H92 A;  1V1C A;  1OU8 A;  4Z88 A;  4PJJ A;  4J9F A;  5KYU B;  1ZSZ C;  4ANJ A;  2DE0 X;  5GAO l;  1KC8 U;  1OV3 A;  2VAS A;  2JTM A;  4DA4 A;  4QVZ A;  2F2V A;  2L8D A;  3BE3 A;  2K5L A;  4E7Z A;  3CXC S;  4M78 F;  3CC2 Q;  1UB4 A;  4HXJ A;  2MCN A;  1HK9 A;  1XNI A;  2P0P A;  3GOX A;  4Z8A A;  1M8V A;  1WX6 A;  4XTZ A;  1H3Z A;  3M54 A;  4AMC A;  2YRD A;  1Q81 R;  5J3B A;  1SEM A;  3ZBD A;  3X25 B;  1OZ2 A;  2CT3 A;  3FRN A;  1X43 A;  2DZ9 A;  2AKK A;  3EG0 A;  4JJC A;  3V7C A;  1JO8 A;  4BD3 A;  1RAI B;  3G4S A;  3L2U A;  1I5L A;  1NEB A;  4AFZ C;  1BIA A;  1YP5 A;  3PVL A;  3ASK A;  1X27 A;  2X4X A;  1OYX A;  7AT1 B;  5KYN A;  1C1A A;  3OS5 A;  2RHI A;  4N0A C;  1WHL A;  4M7A F;  1ZHI A;  2KQW A;  1VQL Q;  2EYZ A;  4C92 A;  3MP6 A;  3CBM A;  2DIL A;  1VYT A;  1PNJ A;  1D0X A;  2KRN A;  4WF2 A;  5LJ3 h;  4EIK A;  1B34 B;  2O4X B;  1PSE A;  3QG1 A;  2CSQ A;  1Q95 G;  5CKH A;  1Q81 C;  1BYM A;  2QQR A;  2FPD A;  2D0Q B;  4PJL A;  2OAW A;  1SF9 A;  3HL8 A;  5A0G A;  1N8R R;  3JB9 G;  2FZC B;  2RN8 A;  4AG1 C;  1AD5 A;  1V76 A;  2EJF A;  3PNW C;  1VQ8 Q;  2M51 A;  1UUE A;  2C0I A;  2DKG A;  4BY6 C;  4X1V A;  3JCM W;  2XD0 A;  3RUX A;  2O01 E;  2CP0 A;  4C5H A;  2KVQ G;  2M02 A;  2DXB A;  2HQE A;  3G4S T;  3VS2 A;  3G6E A;  4FL6 A;  1TH7 A;  1VQ5 A;  4RKU E;  2L89 A;  2VVK A;  2P4R A;  1Q86 U;  1QVG A;  2LRQ A;  1SKU B;  2LDM A;  5LJ3 g;  1VQ9 Q;  2EYX A;  1YIJ A;  1WQ7 A;  3SDZ A;  3L1A A;  5GAN 3;  1QW1 A;  3CCV Q;  2DL3 A;  4M77 F;  3VV0 A;  2E1H A;  4JJN K;  2RI5 A;  4IIM A;  2KY9 A;  5KYW B;  2JJ9 A;  3P8B B;  2DL8 A;  5LJ5 e;  1KQS P;  5LJ3 d;  3DLL A;  3EGX B;  5IHI A;  4F7U E;  3O8V A;  1KFZ A;  5GMK l;  2X3W D;  3NFC A;  1VQK A;  2EQI A;  1ZA2 B;  2BE9 B;  5GAN 2;  2DK3 A;  5HCK A;  1QCN A;  3MP8 A;  3CCQ T;  3OS2 A;  1WZO A;  1X75 C;  1M9S A;  3OYD A;  1IRX A;  1BCO A;  2PUK B;  3NTH A;  2YUP A;  2PZ1 A;  2EYQ A;  1YJN Q;  2X9H A;  2JMA A;  5FW9 A;  2E70 A;  4HCB A;  2A0F B;  1VQ5 T;  1Q7Y U;  4C5G A;  1UJ0 A;  5KE3 A;  1RAB B;  4AFQ C;  4KH0 B;  2DJQ A;  4HCC A;  1K9M R;  2R5M A;  1YNZ A;  2CUB A;  3CMA Q;  1D1C A;  1ZUU A;  1YIJ T;  3EG1 A;  2P4T A;  1M90 R;  2J06 A;  3CD6 Q;  3DB3 A;  4LUE A;  4RTV A;  1G3T A;  1QVF P;  4JDS A;  1ABO A;  3TSW A;  2EYY A;  4A4F A;  2E64 A;  1BB9 A;  2CDT A;  1VQK T;  5KCH A;  2ZZD A;  4FYX B;  4L5G A;  4RTT A;  3H0I A;  2EPD A;  3CME Q;  3EFR A;  2NUT A;  5HKC A;  2BTT A;  5DY9 A;  4Y91 A;  5J39 A;  3LH5 A;  5CKF A;  2H3J A;  2RF0 A;  3QO3 A;  2L3R A;  2AKL A;  1D09 B;  4PJO B;  4FYY B;  5EG2 A;  5IH2 A;  2ESW A;  2A37 A;  3OBY A;  4XTY A;  1M90 C;  1ZSZ B;  1PC0 A;  4M7D C;  1PD0 A;  2DMO A;  1VQP Q;  4M7D E;  4J7F A;  1SG5 A;  4LNP A;  3QJ6 A;  1U3O A;  3FIF A;  4MML A;  1YIT Q;  1BBZ A;  5CR2 A;  3FDR A;  4RCC A;  4CC4 B;  4FW1 A;  3I9Q A;  4ZGE B;  3UWN A;  1I07 A;  5GAO r;  2P0Q A;  2DLP A;  3G1J A;  2RQW A;  4XU2 A;  2E5Q A;  1SRM A;  5C0M A;  1PG5 B;  3EG9 B;  4M78 G;  2YUN A;  3CCM A;  3I5R A;  3H41 A;  1UGR B;  3VYH B;  1UGS B;  5IT9 E;  1BIB A;  1I0C A;  3EGD A;  1FXX A;  1M5Q 1;  2L3S A;  1AOJ A;  4OGC A;  3VS5 A;  3GPL A;  5GAO p;  4F17 A;  2EKO A;  2J6F A;  2G3R A;  2GF7 A;  3GIB A;  1QKW A;  4KUI A;  1MMD A;  4QKU A;  1HXD A;  4MZP A;  5GAN 8;  3UT1 A;  1LNX A;  1GBQ A;  4M7A G;  3CCR A;  5FU7 B;  4OVA A;  3TEE A;  1Q82 U;  2DPP B;  2D1X A;  3HHT B;  2HKN A;  1KQS S;  4E7I A;  2FPF A;  4AFU C;  4QT7 A;  5KH6 A;  1BI1 A;  1OX8 A;  4PK4 A;  3CCM T;  2K2V A;  3INZ A;  4C92 E;  4IUQ A;  3M0U A;  4J83 A;  5FWB A;  5GAN f;  1KSW A;  3BDL A;  4Z02 A;  2O31 A;  3EFS A;  4PL6 A;  4FT2 A;  1WFW A;  2FL7 A;  4C8Q D;  3VS1 A;  2RNA A;  2NUZ A;  2AK5 A;  1N9S A;  1U8R A;  2HL3 A;  4C92 D;  3M4Y A;  2QK0 A;  2DYI A;  1TUG B;  2F2W A;  2RMO A;  3CCS Q;  2CP3 A;  2FEI A;  1I81 A;  2XG8 D;  1M3A A;  3OW2 S;  1FWZ A;  1VQN A;  1YN8 A;  4JS4 A;  2F1L A;  3TVT A;  4BE1 A;  4F7U B;  2M0Y A;  3TQ7 P;  3CCR T;  2D9T A;  3I56 Q;  1QVF S;  4M4Z A;  1KJW A;  3JB9 I;  1YI2 Q;  2QGF B;  5C6S A;  1X6G A;  4M7A A;  1WGS A;  4XU0 A;  3RMQ A;  2ATC B;  2JTF A;  1LJO A;  4J9G A;  1VQM Q;  2EAY A;  3MEA A;  2FRY A;  2QYZ A;  4C0Z A;  1UEC A;  2DBM A;  2DJZ A;  2CP2 A;  4YTL A;  4BB7 A;  2E10 A;  2COY A;  4FYV B;  1VQO A;  4JS5 A;  4M75 G;  3G7Z A;  1H64 1;  2VYT A;  1VQ6 A;  1WDX A;  4KUL A;  2H8H A;  5KCO A;  4QQD A;  1FYN A;  3PVQ A;  3VS6 A;  1W6X A;  3VYG A;  4J9D A;  2KXD A;  4EPC A;  3CQT A;  1VQ4 Q;  1KG1 A;  3NHN A;  3SEM A;  2DA9 A;  5FU6 C;  4NOY A;  2KR3 A;  5GAN h;  4L59 A;  2HCK A;  4C0G A;  2D8H A;  1Y96 A;  1NPP A;  1UG1 A;  3LLR A;  1G3W A;  3CC2 A;  4KH1 B;  4OP0 A;  4RUG A;  1JJ2 A;  2AT1 B;  1D3B A;  4Y28 E;  5IXF A;  4QVC A;  1DJ7 B;  1YCY A;  2EJ9 A;  2ZCF B;  4M77 A;  1W1F A;  3M9Q A;  2EIF A;  4RCB A;  3KUF A;  2RD1 A;  2WSC E;  4E6R A;  1PKS A;  2RJE A;  5IN1 A;  1M3B A;  2BUD A;  1VQO T;  2J7I A;  4JUV A;  1SHG A;  4M7D B;  1NJI R;  2L5Q A;  1K73 C;  2JN0 A;  2CS7 A;  5GMK m;  2HAX A;  3A8H B;  4KUD K;  1IHW A;  1ZX6 A;  2CH4 W;  1VQL A;  2OX7 A;  5GAN g;  1IHV A;  4HCZ A;  3CXC A;  4D6W A;  2QEX Q;  2YDL A;  3A1P A;  5D6Y A;  3CPW P;  1WYX A;  2EGC A;  3PIP A;  1ZQ1 A;  3JB9 J;  2YUO A;  4HT8 A;  4DBF A;  3UA6 A;  1OOT A;  4NL3 A;  3JAM E;  1C6V X;  2FZG B;  5I22 A;  3TCJ A;  2RK1 A;  2KK4 A;  4O6J A;  4BAC A;  2KSS A;  3CPF A;  1VQ8 A;  5LJ5 j;  2X3X D;  1B07 A;  4BE0 A;  1PM3 A;  3EH1 A;  1JXM A;  2BKD N;  3JCM d;  3MEV A;  1X01 A;  4LDW A;  3JCM c;  5I2S A;  1MHN A;  4DQ2 A;  1Y57 A;  2EBP A;  1WXT A;  3VS3 A;  4FM4 B;  3PGG A;  3M0P A;  1ARK A;  4RG8 A;  1BI2 A;  1WJR A;  3L2R A;  3NMZ C;  2DFU A;  3HFO A;  5GAM e;  1VQ9 A;  1YJW Q;  3JCM P;  4AT1 B;  4XTV A;  3CCV A;  4J6Y A;  1RAH B;  2XID A;  2XK0 A;  1I8F A;  3N5B B;  2ZPB B;  3LX7 A;  2J6O A;  1X6O A;  5CKB A;  4C92 B;  4II1 A;  2A28 A;  2E41 A;  2K5F A;  2OAU A;  2RI3 A;  5D6W A;  2QXF A;  1PRL C; 
#chains in the Genus database with same CATH homology
 2A7Y A;  5GAN 2;  2DK3 A;  1VQ8 T;  3BFM A;  3SFM A;  1R8O B;  3NTK A;  3HFN A;  3MP8 A;  2QQS A;  3CCQ T;  4PJO D;  3WXM B;  3OS2 A;  4J5Y A;  1BI0 A;  3RKY A;  1G3Y A;  1NE8 A;  4PNO A;  3MP1 A;  4QQG A;  1X75 C;  1M9S A;  4J8O A;  2I2L A;  3OYD A;  3JCM h;  2MMP A;  1W2B S;  3DLM A;  1VQM T;  3ME9 A;  1Q7Y C;  2PUK B;  3QPH A;  3NTH A;  3HP9 A;  3JB9 D;  1P92 A;  2VXF A;  2EYQ A;  4HA8 A;  3S3N A;  2LQK A;  3V7R A;  4ZTF A;  3BY7 A;  4OB2 B;  3OYK A;  1AHJ B;  1Q82 C;  2DAQ A;  2E70 A;  1V29 B;  3CCJ T;  4HCB A;  1VQ5 T;  1KD1 C;  4PJO A;  5GAN 7;  1Q7Y U;  2V8I A;  1OI1 A;  3OS0 A;  3V8L A;  4C5G A;  5KE3 A;  1UGQ B;  5GAO q;  3QZ9 B;  3OQ5 A;  3FC3 A;  1VQ6 T;  4NL2 A;  2MI6 A;  4C0D B;  5GAN j;  1XQH A;  2A3L A;  4HCC A;  4VUB A;  2PVO B;  3UDC A;  3CMA A;  2GFA A;  2R5M A;  4MZT A;  1YJW T;  4M75 A;  1KHC A;  1WQW A;  1VQ9 T;  2IVW A;  3QSU A;  2RHZ A;  2PU9 B;  1YIJ T;  2P4T A;  3QDR B;  4M78 C;  3CD6 A;  1SSF A;  1WJS A;  2DO3 A;  3CCV T;  3DB3 A;  4C8Q C;  4C8Q E;  3OYE A;  3RER A;  1G3T A;  4JDS A;  4N4I A;  3VJP A;  1Y71 A;  4EMK A;  2RA2 A;  2IG0 A;  4C92 C;  3OYH A;  4OB0 B;  2GFU A;  2RHU A;  2V8K A;  5FRO A;  4A4F A;  5LL6 S;  2E64 A;  1RI0 A;  4X9D A;  5GMK h;  3VUB A;  3RKX A;  2LC4 A;  2RM4 A;  1VQK T;  5KCH A;  5DM7 R;  4N0A A;  3KXT A;  1W2B A;  2ZZD A;  4JRI A;  4L5G A;  3CME A;  2XI9 A;  2XDP A;  3OYC A;  2RJD A;  3EFR A;  3VUZ A;  3CC2 T;  4M7A F;  4QQ6 A;  2DIQ A;  3JCM g;  4BUG A;  4IKF A;  3PFS A;  5HKC A;  2DIG A;  5DY9 A;  4LDV A;  4XQ3 A;  4Y91 A;  5J39 A;  5CKF A;  2H3J A;  1Q81 U;  5GMK i;  3QO3 A;  2KAF A;  2L3R A;  2EQJ A;  3M55 A;  3CEY A;  3PT9 A;  1YBY A;  5CK9 A;  2ZPH B;  2JVV A;  2CYZ B;  4PJO B;  5EG2 A;  5DLQ E;  5GAN e;  1NJI C;  2XIC A;  2EQU A;  4IUV A;  2DXC A;  5GAM f;  3VU3 C;  3OBY A;  3OY9 A;  4MZM A;  5IAY A;  4XTY A;  4M7A C;  4M7A E;  1G5V A;  1NPR A;  2WSF E;  1RL2 A;  4MDX A;  1M90 C;  2K3X A;  5D6X A;  3QKJ A;  2QTX A;  5FU6 B;  3LGL A;  2V8J A;  2PUO B;  1NJI U;  1VQP A;  1YHQ A;  4M7D C;  4M7D E;  3QUI A;  4XU1 A;  3MCA B;  4J7F A;  5LJ3 j;  5GAO n;  2QI2 A;  3QJ6 A;  3MET A;  2GCX A;  3J7A F;  3FIF A;  3PMI A;  2FHD A;  3M56 A;  4MML A;  4PJO F;  5I21 A;  2LVM A;  5LJ5 f;  1O9S A;  4M77 G;  3OYL A;  3OYG A;  1YIT A;  2DVE A;  4XTW A;  4BI4 A;  3CPW S;  5CR2 A;  3FDR A;  4JLG A;  3GNG A;  3CD6 T;  4RCC A;  3V8J A;  2VUB A;  2M0O A;  3X26 B;  1VQL T;  4A4G A;  3UWN A;  4ZGE B;  3JB9 F;  4PLI A;  5GAO r;  2DXU A;  2P0Q A;  2PVG B;  2QA4 A;  1JB0 E;  4ZN3 A;  4M75 B;  4XU2 A;  4JRP A;  3JCM J;  4X34 A;  2E5Q A;  2K5I A;  1N8R C;  3CCU A;  5C0M A;  3C94 A;  1M1G A;  4M78 G;  3CCM A;  3OYY A;  3X24 B;  4KT0 E;  4C8Q G;  3AHU A;  1UGR B;  3VYH B;  2PVD B;  4N4G A;  1UGS B;  3SWN A;  2OTL A;  3CME T;  5IT9 E;  3BDU A;  1BIB A;  3TRE A;  2Y90 A;  4EMK B;  5FLX E;  3QXE B;  3RES A;  4C92 G;  3L2W A;  1N8R U;  1FXX A;  1M5Q 1;  1N6A A;  1KQ2 A;  2EQM A;  2RJF A;  3LYI A;  2Y4X A;  4M75 F;  4N4H A;  4OGC A;  5GAO p;  3GPL A;  4OB3 B;  3V7S A;  1S72 A;  3S6W A;  3CCL A;  2EKO A;  1QP3 A;  4QVD A;  2G3R A;  2JNG A;  1Y7X A;  2GF7 A;  2B8A A;  4J7I A;  4MDW A;  4X9C A;  5LJ3 e;  3GIB A;  3M5A A;  3A8M B;  4F7U A;  4IUP A;  3OYI A;  1FX7 A;  2CKK A;  3CPW A;  4KUI A;  1QP2 A;  2CZ0 B;  3V8K A;  4A4K A;  2LT4 A;  3OYA A;  2RK2 A;  3VKI A;  2R57 A;  3RMS A;  1YHQ T;  4KBM B;  4M77 C;  4M77 E;  4E47 A;  3GP8 A;  1YJN A;  1VQP T;  2XDB A;  3G6E T;  1HXD A;  3A8L B;  5M9O A;  3LW5 E;  3OMG A;  4MZP A;  4OF1 A;  3HPW A;  3UT1 A;  5GAN 8;  3P8H A;  2QDY B;  4BI8 B;  1LNX A;  4J6X A;  1YIT T;  4M7A G;  3CCR A;  3FEO A;  5FU7 B;  5HK3 A;  4FSX A;  4OVA A;  2EFI A;  1K8A C;  3TEE A;  1W4S A;  3OSV A;  1Q82 U;  4ZGD B;  4E7J A;  2DPP B;  2VGM A;  3H6Z A;  1KD1 U;  3PIO A;  3HHT B;  4M7D G;  3R6O A;  3MHX A;  4BDY A;  4BDZ A;  2EQK A;  2X35 A;  1KQS S;  4FT4 A;  4M75 C;  4M78 E;  4E7I A;  3OYF A;  5GAM h;  2QA4 T;  2D6F A;  1VQ7 A;  3S3M A;  3CBP A;  3QBY A;  5CCA A;  2WAC A;  2MF2 A;  3OYB A;  5KH6 A;  3HKS A;  1BI1 A;  4QW2 A;  4C0F A;  3L42 A;  3CCU T;  4XU3 A;  4FIB A;  2LT1 A;  2EJG A;  1XOV A;  2K2V A;  2WSE E;  3INZ A;  5A2Q E;  3CCM T;  4C92 E;  4IUQ A;  2HBP A;  4C5E A;  4EMK C;  4HT9 A;  4DOV A;  4J83 A;  2OTL T;  3FJP A;  5GAN f;  1MGQ A;  3BDL A;  2X4J A;  4Z02 A;  2E12 A;  5LJ5 h;  3EFS A;  3MEU A;  2YLB A;  3X28 B;  1QVP A;  4PL6 A;  4C8Q A;  1S72 T;  3ZEH A;  3X20 B;  4FT2 A;  4XAX B;  2YRV A;  4PKC C;  4M78 D;  4Q5W A;  3ZFJ A;  3PTA A;  3CCL T;  2QQ9 A;  2KDS A;  2FL7 A;  4C8Q D;  2HQX A;  2XHC A;  3I55 A;  3SWN B;  3GF5 A;  2DTI A;  2ZPI B;  3JCM Q;  1N9S A;  1U8R A;  3DKM A;  3OSS C;  4E7K A;  2CGH A;  3M4Y A;  1JBM A;  4C92 D;  3CC7 A;  3E9F A;  4IUU A;  2LQ8 A;  4B9X A;  1K9M C;  3P8D A;  3EAE A;  5GAN 5;  4BI3 A;  1I81 A;  2XG8 D;  2ZGW A;  3C12 A;  1YJN T;  3OW2 S;  1FWZ A;  2MWO A;  2R58 A;  5GAN d;  5I2M A;  5CKD A;  4JS4 A;  1N9R A;  1VIE A;  4CI0 C;  1KQS A;  2DTO A;  2K57 A;  5FU7 C;  2E6Z A;  5A0L A;  3OYM A;  4C0D C;  4BE1 A;  3M57 A;  4F7U B;  4A4H A;  3L2V A;  1K9M U;  5GAN 6;  3CCR T;  3GNF B;  4XK8 E;  3LGF A;  2D9T A;  3I56 A;  4V2S A;  3OB9 A;  5GAM g;  5GMK j;  1QVF S;  4IUR A;  4A4E A;  2KMT A;  1M90 U;  2RB6 A;  5HY6 A;  3CMA T;  2HD0 A;  3CCQ A;  4BE2 A;  3OS1 A;  5CKE A;  3JCM e;  3JB9 I;  2RHY A;  1YI2 A;  3S3O A;  5C6S A;  4CRI A;  1WGS A;  4XU0 A;  3QYH B;  4M7A A;  5GAN 4;  4ZGJ B;  1U1T A;  3RMQ A;  1VQ7 T;  2ZPE B;  3QZ5 B;  4L6V 5;  2JTF A;  1LJO A;  2EAY A;  3F70 A;  3MEA A;  4F7U F;  4M7A D;  4LDX A;  3A8G B;  5CIU A;  4R55 A;  3L2Z A;  4C0Z A;  4ZTJ A;  1VIF A;  2DJZ A;  5LJ5 g;  4OB1 B;  4M7D A;  5GAM d;  1JJ2 S;  4LDY A;  1Y07 A;  4YTL A;  4BB7 A;  1Q86 C;  1M1K C;  4M7D D;  1M4Z A;  2E10 A;  5LJ3 f;  3QJY A;  1VQO A;  4JS5 A;  4M75 G;  2FVU A;  3WVD B;  2PQW A;  3G7Z A;  1H64 1;  4UC4 A;  3PMT A;  1XTD A;  3WVE B;  2VYT A;  1VQ6 A;  5L8R E;  3FLG A;  1WNL A;  3MEW A;  3JCM b;  1M1K U;  1IRE B;  4GY5 A;  4KUL A;  2F5K A;  4IUT A;  3Q1J A;  3FB9 A;  5LJ5 d;  1YJ9 A;  5KCO A;  3KBG A;  4QQD A;  3URG A;  3QHS A;  3I55 T;  3OW2 A;  2AHJ B;  2XKO C;  5CQX A;  5DLO A;  2QQA A;  2RJC A;  1B34 A;  2O4X A;  2X4Y A;  2Y4Y A;  2M1H A;  3DB4 A;  4PJO C;  3HSB A;  1KC8 C;  3VYG A;  4PJO E;  4HKE A;  4EPC A;  2FYK A;  1VQ4 A;  2R5A A;  4C8Q B;  3CC7 T;  2M16 A;  4FU6 A;  4C5I A;  1KG1 A;  1QVF A;  5GMK e;  3J80 E;  4PLL A;  5FU6 C;  4NOY A;  2DXT A;  3RIR A;  5GAO l;  5GAN h;  4L59 A;  3OA6 A;  3L2Q A;  1KC8 U;  4C0G A;  1Y96 A;  2JTM A;  4DA4 A;  4QVZ A;  2DZC A;  1NPP A;  5CQY A;  2L8D A;  2RI2 A;  3LLR A;  1G3W A;  2K5L A;  2YHT A;  3CXC S;  5AYF A;  3I56 T;  3HRU A;  4M78 F;  3CC2 A;  1UB4 A;  3BW1 A;  4OP0 A;  1KQ1 A;  4C8Q F;  2XDD A;  1JJ2 A;  1YI2 T;  1UGP B;  1D3B A;  1HK9 A;  5FRN A;  2F5T X;  4Y28 E;  4LD9 K;  1XNI A;  2P0P A;  4C92 F;  4QVC A;  3GOX A;  1M8V A;  1DJ7 B;  1YCY A;  4XTZ A;  2EJ9 A;  2ZCF B;  1GXI E;  1IZ6 A;  1H3Z A;  2LCL A;  3M54 A;  1N27 A;  3E1S A;  4M77 A;  2M9U A;  5J3B A;  4M75 E;  3ZBD A;  1EIF A;  1K8A U;  2DTH A;  3X25 B;  1OZ2 A;  3GLX A;  3FRN A;  2LX9 A;  3M9Q A;  2DZ9 A;  2EIF A;  2VGN A;  4RCB A;  3KUF A;  1BI3 A;  3QYG B;  2E6N A;  2RD1 A;  5CO7 A;  2WSC E;  4M77 D;  4BY6 B;  2RJE A;  5IN1 A;  2BUD A;  1VQO T;  3V7C A;  4OMF B;  4M7A B;  4BD3 A;  3HRT A;  3M59 A;  4TVR A;  4JUV A;  2BIV A;  1PSF A;  3G4S A;  2VV5 A;  1JRI A;  5J26 A;  3L2U A;  1I5L A;  3JCM V;  2ZPF B;  1BIA A;  4M7D B;  2JOY A;  2L5Q A;  1K73 C;  3ASK A;  1NZ9 A;  5GAO m;  2X4X A;  1LOJ A;  1OYX A;  1YJ9 T;  1UEB A;  4A54 A;  4ZN1 A;  4M78 A;  3OS5 A;  2RHI A;  2JN0 A;  2CS7 A;  3HRS A;  4JRQ A;  5GMK m;  3JCM X;  4DOW A;  2MAM A;  2HAX A;  2MWP A;  2EWN A;  3A8H B;  4N0A C;  4EMH A;  3UPU A;  4KUD K;  4M75 D;  2CZ1 B;  1VQL A;  2FB7 A;  3RKW A;  1ZHI A;  1K73 U;  2KQW A;  5CAI A;  2VC8 A;  4HCZ A;  4ELY C;  5GAN g;  1U1S A;  3OYJ A;  4C92 A;  3CXC A;  1VQ4 T;  2QEX A;  3MP6 A;  3CBM A;  4D6W A;  3JSC A;  2XU8 A;  5D6Y A;  4JLI A;  3G71 A;  4M7D F;  1ZBX A;  3E19 A;  3JCM f;  3CBO A;  3CC4 A;  4EMG A;  3PIP A;  4WF2 A;  1VQN A;  5LJ3 h;  4R56 A;  1ZQ1 A;  3JB9 J;  1QVG S;  4ATO A;  3CCS A;  1B34 B;  2O4X B;  2VXE A;  1PSE A;  3QG1 A;  2RHX A;  3SD4 A;  4HT8 A;  5GAM j;  3A5Z B;  4PJO G;  3A8O B;  5CKH A;  3J81 E;  1OZ3 A;  4NL3 A;  1Q81 C;  3JAM E;  2LNV A;  1BYM A;  2QQR A;  4LDU A;  4OGE A;  2OTJ A;  1WPY A;  2D0Q B;  3HL8 A;  3LH0 A;  2C06 A;  3CCE A;  2HNI A;  3TCJ A;  2RK1 A;  5A0G A;  2DEQ A;  2KK4 A;  3E9G A;  3MO8 A;  3OMC A;  5CVI A;  4O6J A;  4F7U G;  1Y96 B;  2KSS A;  3CPF A;  4BAC A;  3JB9 G;  1VQ8 A;  2EJF A;  3PNW C;  5LJ5 j;  1I4K 1;  4MMK A;  2ZPG B;  4GLK A;  1BKB A;  3LWH A;  4O5V A;  2QQB A;  4BE0 A;  2CZ7 B;  4NS5 A;  2CZ6 B;  2X4W A;  2DKG A;  2DD5 A;  2K4Y A;  4BY6 C;  2BKD N;  3JCM W;  3JCM d;  3M53 A;  3MEV A;  2F69 A;  1VQM A;  2XD0 A;  3C4S A;  4P5N A;  1X01 A;  3SB2 A;  3RUX A;  2O01 E;  1WJQ A;  4LDW A;  3JCM c;  1D3B B;  1MHN A;  2RO0 A;  3JRZ A;  5I2S A;  4C5H A;  2KVQ G;  2DXB A;  2HQE A;  4DQ2 A;  3G4S T;  3G6E A;  3CCJ A;  4FL6 A;  4LD6 A;  1TH7 A;  1VUB A;  2DD4 A;  3M58 A;  4RKU E;  4XTX A;  4E7L A;  4M77 B;  1VQ5 A;  5HK0 A;  2L89 A;  4ELZ C;  4FM4 B;  1O75 A;  3PGG A;  4RG8 A;  1BI2 A;  1WJR A;  2LCC A;  3L2R A;  1Q86 U;  1QVG A;  2LRQ A;  3T9N A;  4XTU A;  2LDM A;  3SWN C;  4A53 A;  3HFO A;  3M4G A;  4RMO A;  5KE2 A;  5GAM e;  1YJW A;  1VQ9 A;  5LJ3 g;  3JCM P;  1YIJ A;  3JB9 H;  1WQ7 A;  3OYN A;  2QEX T;  3QII A;  1G3S A;  3L1A A;  4XTV A;  1QW1 A;  4RG2 A;  2JUF A;  3SDZ A;  4J6Y A;  4EDU A;  5GAN 3;  3G71 T;  4M77 F;  3VV0 A;  2E1H A;  4JJN K;  2RI5 A;  2XID A;  2XK0 A;  2YLC A;  3C95 A;  1I8F A;  3N5B B;  2ZPB B;  2GQV A;  3NTI A;  4M78 B;  3LWI A;  2NLU A;  3CC4 T;  3TU4 K;  3LX7 A;  2KY9 A;  3CCS T;  3P8B B;  5A0D A;  2RH2 A;  4J6W A;  2E65 A;  2K3Y A;  5LJ5 e;  1M1F A;  2JZ2 A;  1X6O A;  5CKB A;  5LJ3 d;  3DLL A;  2LTO A;  4JRK A;  4C92 B;  4E7H A;  1VQN T;  4F7U E;  4II1 A;  3OBW A;  2E41 A;  3O8V A;  2K5F A;  5GMK l;  3CCV A;  2OAU A;  3ER0 A;  2OTJ T;  3NFC A;  2RI3 A;  4B9W A;  1VQK A;  2P0K A;  3H8Z A;  5D6W A;  1KHI A;  2QXF A;  3CCE T;  5FRM A;  4ME7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...