2K5LA

Solution nmr structure of protein feoa from clostridium thermocellum, northeast structural genomics consortium target cmr17
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords FeoA
publication title Solution NMR Structure of Protein FeoA from Clostridium thermocellum, Northeast Structural Genomics Consortium Target CmR17
rcsb
source organism Clostridium thermocellum atcc 27405
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k5lA00
1G3WA 2K5IA 1BI2A 3HRSA 1FWZA 1QW1A 2QQ9A 1FX7A 1BI3A 1BI0A 2H3JA 1G3SA 2GCXA 2K4YA 4O5VA 5CVIA 4O6JA 3MHXA 3E19A 1U8RA 3HRTA 1BYMA 1P92A 3GLXA 2QQBA 1BI1A 2LX9A 2K5FA 1QVPA 1G3TA 2QQAA 3HRUA 1G3YA 2K5LA
chains in the Genus database with same CATH superfamily
4C92E 1IRXA 4RTUA 4JPBW 1PM3A 4FM4B 3JCMc 4CC4B 4C8QB 2RQVA 2VV5A 1JRIA 4J83A 5CAIA 2X4YA 4ORZA 4M7DG 1MV3A 1MNDA 4F16A 3JCMP 3OYYA 3MJXA 5CKFA 3TSWA 4AG2C 4F04B 4M7DA 1GCQC 2CZ1B 2P4TA 2YLCA 4X1VA 5CKEA 3QDFA 1UTIA 3LYIA 3CCVT 3JAME 4ELYC 3JCMe 2KY9A 3LH0A 2ED1A 2HBPA 3L2VA 4CC7A 1IGQA 1UGRB 4XTVA 1YWOA 1KIKA 3CCSA 1MUZA 1N8RR 3KXTA 3ME9A 1KC8R 5FRMA 2K6DA 2LCLA 3PVLA 1V29B 1UECA 3ZFJA 3LWHA 3G71A 4J7FA 4JRIA 5IXFA 2LQKA 5KH6A 1VQMA 2KNBB 2F5KA 5I11A 1U8RA 3HRTA 1D3BA 5CQXA 1CKBA 1TH7A 4JZ3A 2E3IA 2EYYA 2NUTA 3EGDB 3J81E 1SF9A 1YITQ 1XOVA 3HL8A 1SRMA 4QVZA 1TXQA 1QVFA 2VGMA 1FYNA 1WGSA 3GF5A 1IXDA 3OYKA 2AHJB 4JLGA 4N0AC 1YJWQ 5FWBA 3X26B 2M16A 1NLPC 4E47A 4J6YA 3CC4Q 1VQPA 1QWFA 1D1CA 3KFVA 2CT4A 4XU3A 4MZTA 1V76A 1OU8A 1WHKA 3OYNA 3EFOA 4LE9A 2FPEA 1CSKA 2JOYA 4XU2A 4C8QG 2ZPEB 1M8MA 2KBTA 2O9SA 1VQ6T 3CCET 1TG0A 3CCLQ 5CQYA 2CSQA 3S3NA 3H6ZA 3QJ6A 4C8QA 4BY6B 2V1QA 2VWFA 3OMGA 1UJYA 4JJBA 5CR2A 2EYWA 3CMET 5GAMg 1AEYA 3J80E 3E9GA 1VQNT 4P5NA 1M30A 2PVDB 3M0PA 2C0TA 2AK5A 3RBBB 1N8RC 1NE8A 1KC8C 2D9TA 1PHTA 2FL7A 3OYCA 1I07A 4FYYB 2J7IA 2ZZDA 2LCSA 1AVZC 2Y4YA 1W2BS 2LCCA 3GPLA 1D1BA 4IUUA 1SKUB 4C8QD 2DL5A 1ZUUA 2LX9A 3BFMA 3G6ET 1M2VB 4D8KA 3CCQQ 4OMNA 4DBRA 2F2WA 2FYKA 2EGAA 3X25B 4MDWA 2WSEE 1PC0A 1AT1B 1I5OB 3JCMJ 1N9SA 1VQ4Q 3FRNA 5GAOn 2DJZA 2JTFA 2H8HA 4K11A 2AT1B 3AHUA 4C5HA 3S3OA 2QTVA 1UEBA 1MGQA 1QVPA 3X20B 5GANd 5GANe 4OMLA 2IVWA 2XDDA 1HSQA 4BE0A 2EAYA 3FDRA 1H8KA 2LJ3A 1VQOQ 2FZKB 4AFZC 3EGDA 3TVTA 1BI3A 2HBWA 3CCJT 3QUIA 2FRWA 5GAMh 2DTHA 2XIDA 1VQ8A 3CC2T 4C8QF 1PRLC 2HL3A 1Y96A 1UGPB 1RAHB 4A4KA 1ZSGA 2RO0A 4AT1B 3E1SA 3OYDA 4OVAA 2QTXA 1K0XA 4JS5A 2KYBA 2RI3A 1U06A 5IN1A 1E6GA 3CPWS 2OTJT 2I0NA 2DD5A 1WXBA 2D0QB 2RQUA 3G4SA 5KYWB 1YHQT 2V8IA 4PLIA 3M58A 4Y92A 1NJIR 2JMCA 2Y4XA 2A0FB 2QI2A 1S72Q 3MP1A 1Z9QA 3LLRA 1TTHB 2LP5A 3EHQA 1JBMA 1TUCA 3CD6T 2EVRA 3CC7T 2XD0A 1Q95G 2QASA 1VQLA 5IHKA 3HHTB 4FYVB 2GTJA 2EPDA 2CP6A 2M0YA 1KSWA 3EG1A 3OB9A 3SWNB 4N4HA 3QYHB 2DXBA 2DJQA 2DILA 2ZPGB 2QK0A 1LPLA 1M2VA 5KE2A 2W0ZA 1RI9A 4AG1C 3VS7A 3META 2CH4W 4Y28E 2CGHA 2L0AA 2RF0A 8ATCB 2CZ0B 3EH1A 3O8VA 1OX9A 2K3BA 2MYSA 5HK0A 3NTHA 3HPWA 2OTLT 1JB0E 3M4YA 1WPYA 3EG3A 1ARKA 2DNUA 1FMKA 2OI3A 3V7CA 5GAOm 3P8HA 1YI2Q 2H3EB 2LQWA 4RUGA 1YJ9A 2LJ0A 4M7AD 2K7AA 1T3SA 5GMKj 4RTXA 5M9OA 3RMSA 5I2MA 4M77C 3PFSA 4J9IA 5KYXB 1YFNA 2VXFA 4E7LA 4MDXA 2CP3A 4OB2B 2LQNA 2PTKA 4ZGEB 1HYOA 1G3YA 2DL8A 1RUWA 2CSIA 1GFCA 4N4GA 2A3LA 3OY9A 4RTYA 4KUIA 2QGGA 3OW2P 1OZ2A 1OYXA 3L2QA 1AZGB 1G83A 1PCXA 2HAXA 2CP0A 4C0GA 5DLOA 4HT9A 4A4EA 3RUXA 5GMKl 3OW2A 1PD1A 5KYWA 2P0KA 1RL2A 2LZ6B 4E7HA 4M7AF 2X35A 1M5Q1 3ZEHA 3M56A 1W70A 4RG8A 4XQ3A 4F7UE 5KYNA 2B8AA 3VJPA 3C95A 1QVFS 2VUBA 1X6GA 3HSBA 1VQ5A 2BKDN 3BDLA 4DA4A 1YBYA 2O4XB 3SWNA 3OYEA 5LJ5d 3FB9A 3CCMA 5LJ5e 3DB4A 1VIFA 3VYGA 1FX7A 1X75C 4JRKA 2YHTA 5GMKh 3JB9D 2A37A 2CZ6B 5HCKA 1SPKA 4EMKC 4B9WA 4ELZC 1QKWA 4KULA 4RTZA 1KQ2A 1Y7XA 3I5SA 1JJ2P 2BTTA 1AOJA 3URGA 4XAXB 3VS0A 4WF2A 4OMOA 1NG2A 4X9DA 5J39A 2R58A 2P0QA 1M1KR 3CCSQ 2X51A 1JJ2A 4OB1B 1YIJA 1G3SA 1O75A 2DA9A 3G71Q 1IHVA 3G1JA 2DEUA 2L2PA 1K73R 2KROA 1VQMQ 4M78B 1UFFA 2O01E 2X3WD 5KYXA 1NLOC 1YNZA 3QPHA 5LJ3d 5LJ3e 2P84A 3CC4T 4XU0A 3D7SB 2YUPA 3JB9F 3L42A 3M4GA 2HZYA 4QKUA 4IIMA 1AWWA 4X34A 1QVGA 2HD0A 1WJSA 4OMPA 3R6NA 1F1BB 1WHLA 4OB3B 3LWIA 3CXCP 4M7DC 4R56A 1D09B 2YUNA 3U23A 2L8DA 3OYLA 1VOMA 1ZHIA 2QQAA 3QDRB 4XTYA 2KT1A 2JW4A 4LDVA 2E5KA 3I56A 4E7JA 1VQ7A 2HMAA 2CREA 5IT9E 1AWOA 4L59A 1KD1R 3NFCA 1VQPQ 3M0RA 3JB9H 1M3BA 1WHJA 1U3OA 2V8JA 3E19A 1X2QA 1WNLA 2OX7A 4FW2A 5L23A 2CDTA 4HKEA 1JEGA 4DBQA 1LNXA 1YJNA 2FVUA 1NPPA 4M77D 1QCOA 3NHNA 3CCQT 1WDXA 1Q7YU 4A53A 1U5SA 2A7YA 5GAMf 2DL3A 1VQ4T 2O4XA 3OSSC 1ACMB 4ZGDB 1M1KC 3SD4A 2OAWA 2HQEA 1K9MR 1FMWA 3JB9I 2DK3A 4OMQA 4ZTFA 1K73C 1WI7A 3SHWA 3M53A 2QXFA 4C0DB 1BK2A 1VQOT 3PMTA 4J9HA 2NLUA 1RAFB 2GNCA 3A8OB 4WCIA 1PNJA 1M3CA 4PFZA 4M78G 4R55A 3M55A 1SRLA 1YIJT 4M77F 3P8DA 5CO7A 3G7ZA 4FSXA 3PGGA 4M78A 2HEQA 2EFIA 2RHUA 1ZQ1A 1OPLA 2CP5A 4C8QC 2K3XA 5C0MA 1VQKA 1MNEA 3I55A 1TWBA 1WYXA 5D7UA 2MWOA 4LDUA 4B9XA 2JMAA 1VQ8Q 5D6XA 3HRUA 1S72T 5GMKi 4M78D 4XK8E 4DQ2A 5FW9A 3SDZA 2RHZA 4M75E 4AFSC 4E7SA 3OYIA 1E6HA 4FCYA 2KR3A 3MHXA 1AD5A 2XKOC 3EG2A 1WLPB 3G4SQ 3C12A 4E7IA 3TQ7P 1AWJA 1K9MC 1XTDA 2EQMA 2FZGB 5EC7A 3A8LB 4MZMA 2WSCE 4FU6A 4C5GA 3CBOA 3NMZC 3JCMd 1PSFA 1OQKA 3M5AA 1NZ9A 4KGVB 1Q81U 1VQLQ 2MAMA 2RQTA 2AKLA 3V8KA 1M27C 2HQXA 2E4HA 3PE0A 4M78F 2RH2A 4A4HA 2K5LA 1UGVA 1RADB 4M7DD 2XHCA 4HCBA 1ABQA 5EG2A 1YI2T 2DMOA 1W1FA 1M90U 2EGCA 3WXMB 2AKKA 3S3MA 5FU6B 2MPXC 2ZPBB 2DVJA 4A4FA 1A0NB 2QAZA 1K8AU 2DXCA 5CKBA 2ZCFB 2G6FX 1ZSZB 5LL6S 3SB2A 4EMHA 1BCOA 3A8HB 4PJJA 3L2RA 3AT1B 1S1NA 2CP2A 2IG0A 2LQ8A 2MIOA 4JJDA 5GAN3 4MMLA 5GJWB 1YJ9Q 2CUBA 5IHNA 2V1RA 2E3HA 3VS4A 4J6XA 1PKTA 3OYGA 1Q86U 1I0CA 3NTIA 2BE7D 4NL2A 2R57A 2KT8A 2COZA 3OYFA 1DJ7B 3VS1A 4OF1A 4M7DF 5GAN4 4LUEA 4QVDA 3S6WA 3OYBA 4PJNA 1NEGA 1QCNA 1OX8A 1YCYA 1RLPC 2PZ1A 3QBYA 3VRYA 3MCAB 5GAMj 2MWPA 3C4SA 2VYTA 3Q1JA 2ECZA 1MMNA 1Z9ZA 2A28A 4M7AC 1WXTA 3MO8A 4HT8A 2X4XA 1RABB 2KEAA 2K9GA 3UA7A 2JT4A 5A0LA 2ZAEA 2EBPA 1SHGA 2ROLA 1I5LA 3OYHA 1IHWA 3RDVA 3VUBA 2YRCA 4EPCA 2DD4A 2X3XD 3M0SA 4ME7A 1N6AA 4Y91A 1QVGS 2EYXA 2R5AA 2J6FA 2RJFA 2VC8A 3H0HA 3JCMb 1M4ZA 1VQ5Q 2ABLA 2JUFA 2RHIA 3L2UA 4F7UB 1KQSP 4PFOA 4EMGA 4LUDA 3CCST 3CCMQ 2O88A 4RMOA 1LOJA 1QCFA 4RCCA 4PJOB 3VV0A 3G71T 1P92A 2JM8A 2DXTA 4PNOA 2K2VA 1KQSA 1KFZA 1NJIU 3CBMA 1VQMT 3LX7A 3C0CA 2K5IA 4Q5WA 4DBHA 3CCRA 4LNPA 3BE3A 4CC3A 1PKSA 1T0HA 1ZSZA 2M9UA 2DBMA 2J05A 4L5GA 4XTUA 3ER0A 1G2BA 2FRYA 5GAN6 3GNFB 4FL6A 2CYZB 4LD6A 4NS5A 3M9QA 3QJYA 4PLLA 4KH0B 5IAYA 1MMDA 1YIJQ 2XDBA 1T3LA 4Z8AA 1GRIA 2KMTA 2O2OA 1C1AA 3VS5A 3QO3A 1D0YA 4UC4A 3FJ5A 1X27A 3H41A 4A4GA 1QW1A 2XDPA 4LDXA 2WSFE 2VXEA 2JVVA 4BD3A 4NOYA 3EG9B 3OA6A 4HA8A 1VQPT 3PMIA 4C8QE 2DIQA 3FEOA 2QA4A 2L5QA 1ZLMA 3SWNC 5GAOp 2JTMA 1BIAA 5CIUA 1C6VX 3QYGB 1SSFA 1MMAA 3I56Q 1Q82U 3HKSA 3PIOA 1VQ7Q 2AZSA 3I5RA 3OBWA 2YSQA 2DVEA 2LT1A 4MZPA 4XTZA 5CKHA 1BI1A 4J9FA 5A0GA 4C5EA 2L3QA 1WQWA 1X01A 3RMQA 3CMAA 2YXYA 2PVOB 3PNWC 4M4ZA 1YJNQ 4XTXA 3V8LA 4ESRA 3MEUA 3WVEB 4PJOG 4F7UA 1K4US 1IREB 3GLXA 3M59A 1PSEA 1RAAB 4KGZB 2DEQA 3H0FA 4PJOA 2L89A 2M02A 2DAQA 1N5ZA 4ZNXA 5CCAA 4HVVA 3FC3A 4B6MA 3OQ5A 4QVCA 1PD0A 1GL5A 2HSEB 3A8GB 4MMKA 2DE0X 5I2SA 4X9CA 2K4YA 3QWYA 4PJOD 2RHXA 1VQ8T 3QXEB 1D1AA 9ATCB 2D6FA 3QIIA 2FB7A 3SFMA 4FT4A 4HCCA 3EG9A 3CCUA 3LH5A 1VQKQ 3X28B 3I55Q 4LDYA 1M8VA 2KK4A 4GLKA 4A63B 2JS2A 3RKYA 2V8KA 3G4ST 2GBQA 1KJWA 2QA4T 1KHIA 3EFSA 1EZZB 2ATCB 1N27A 1ZUKA 5DY9A 1W6XA 2BZXA 3MEAA 4XU1A 2KXCA 2M1HA 2FPDA 3QHSA 2RQWA 1JO8A 2HL5C 2RA2A 5KYUB 1VQ9A 2ZPIB 2EWNA 2DRMA 5J3BA 2J6KA 2DYBA 4PJOF 3JCMg 1VQLT 4RTTA 3M57A 3OYJA 1BB9A 4QQGA 4C92B 2DXUA 4AMCA 1QWEA 4M7AE 1BI2A 4M75B 2KQWA 2MCNA 5KYYB 1CKAA 1PG5B 3MKDA 2PU9B 5GAMe 2JM9A 3M0UA 2DYIA 4RG2A 5HK3A 4M78C 4E7KA 3H9NA 3JCMQ 3JCMX 1H3HA 2FO0A 1I1JA 2EW3A 3GOXA 2HNIA 2EJ9A 2GTOA 4J9DA 2X4WA 4FIBA 2PNIA 3L1AA 3MEWA 4OMFB 1KD1U 1ABOA 3INZA 1AWXA 1YJ9T 1VYTA 2EKHA 4IURA 4QQDA 1BIBA 1G5VA 1MMGA 1ZUYA 3BDUA 2LC4A 4J9BA 4ANJA 4OGEA 2GFUA 1QQJA 2M51A 3DB3A 1WA7A 2NUZA 1V1CA 2AZVA 3OSVA 1BKBA 1LVKA 1B07A 1UB4A 3I35A 2CKKA 2SEMA 3JCMh 2EYQA 4O5VA 1W2BP 1K9AA 1GBQA 2EJFA 2ESWA 2DL7A 4FSSA 3JCMW 1UUEA 2IIMA 1NM7A 4ZTJA 1JXMA 3VKIA 1W2BA 3THKA 2FHDA 3CXCA 2DIGA 2LX7A 2BE9B 5FU7B 3HTRA 4Z88A 2P0PA 2J6OA 2YUQA 4HVWA 4RTWA 4OP0A 1O9SA 1Y07A 5J26A 4C92G 1MV0B 5KYUA 2K57A 2JTEA 4M75G 4C0DC 2AIRB 2KXDA 2VB6A 2BIVA 4C92A 4BUGA 2ED0A 4HVUA 1VQ5T 3REBB 4M75A 5FRNA 1VYVA 2PVGB 2RJEA 5CK9A 4L6V5 5IHIA 3CCMT 5KYYA 4E6RA 1BYMA 5LJ5f 2GF7A 1H92A 4IUPA 1D0XA 2HQHA 3CCVA 5GANj 3CBPA 4DOVA 4N4IA 3QKJA 2HKNA 1OV3A 2F1LA 3CPWP 4C92D 5HY6A 2OJ2A 4XTWA 2IPOB 5GANg 2E41A 2FZCB 2VASA 2XU8A 1NEBA 4D8DA 2FEIA 5FLXE 2DRKA 4DEYA 3CPWA 4C0ZA 4C5IA 3MP8A 5I21A 4YTLA 1IGUA 2SRCA 2KSSA 3L2WA 3FLGA 2V26A 1R77A 2LNHB 5D6YA 2I2LA 3CCRQ 3F70A 4R0KA 2RNAA 4O6JA 2R5MA 4BB7A 4M77E 1KK7A 1G3TA 4CRIA 2BUDA 3DKMA 2JS0A 4C92F 2RMOA 2QGFB 3DLLA 2GQVA 2MOXA 1N8RU 1KC8U 1X43A 3UA6A 5GMKe 2L3SA 3I56T 2HKQB 1VQ7T 3TSZA 1EFNA 4JRPA 1LJOA 3C94A 3A1PA 4D6WA 1HJDA 1WXUA 3EFRA 4PL6A 2XK0A 4F17A 1X69A 3CCEA 5GANh 2QA4Q 1VQ6A 2DETA 1EX4A 1X6OA 4HCKA 2PUKB 4ZGJB 5AYFA 3HP9A 3HFNA 3BW1A 2XICA 3CMEA 1YJNT 4KUDK 4JS4A 2DBKA 2KDSA 1VQNA 3TREA 1WHGA 2CUDA 1UJ0A 5FU6C 1ZA1B 3QG1A 3UF4A 1ZSZC 4Z89A 4ZN3A 2QEXA 2CT3A 1BU1A 2JJ9A 2LTOA 5GAN5 1VA7A 1ZX6A 4LD9K 4GBQA 2PUOB 1M2OA 3CMAQ 3G6EA 3OW2S 2ROTA 3UT1A 1OU9A 4BACA 3QWXX 2RN8A 2DLPA 2QYZA 1QLYA 3JSCA 1R8OB 5C6SA 3MEVA 2W10A 4M78E 3V7SA 4A54A 2J06A 1PWTA 2FPFA 1Q7YC 8AT1B 2QG9B 4F14A 7AT1B 3OS1A 3CEYA 4KGXB 5I22A 4JUVA 3A5ZB 1ZBXA 1UHCA 2MK5A 2VVKA 4BY6C 1QVFP 2HCKA 1WHMA 4J6WA 1VQKT 2P4RA 2LVMA 4IUQA 3I55T 1UG1A 3CCJA 1Y0MA 3CC2A 2F2XA 2YDLA 3V8JA 5KCOA 2EQJA 2G3RA 3GP8A 3EH2A 3DLMA 3PIPA 5CKDA 1Y96B 1Q81R 3FIFA 3M0TA 4II1A 2PQWA 1NPRA 3ASKA 4BDYA 3H8ZA 5GJVB 2D1XA 2X4JA 2E10A 4HCZA 2EYZA 2OTJA 1JJ2S 4M7DE 3EAEA 3CCUQ 5LJ5j 1M1FA 1YHQA 1M90R 4LXCA 4JJNK 1WHHA 4PJOC 3I9QA 2F69A 5LJ5g 1K8AR 3CD6A 5FROA 1OEBA 3CC7A 1WX6A 4BI3A 3EG0A 1TS9A 4LN2A 4J7IA 1VQ9Q 5GAN8 2BZ8A 4RKUE 2XG8D 2LDMA 3JCMf 5GAN7 1RAGB 1GFDA 2QEXT 1YP5A 1Q86R 1W4SA 3RERA 1M9SA 2X9HA 1HD3A 3CXCS 4JLIA 2M0OA 3UPUA 4KRTA 2DM1A 1RACB 5LJ3j 1J3TA 4M7AB 2QQSA 4ATOA 1K0SA 2KI7A 1H641 3UWNA 1KHCA 2OTLA 2E12A 3CQTA 2DL4A 5LJ3g 3RR6A 3JV3A 1GCQA 3A98A 1OPKA 3UATA 4DOWA 1Q81C 1TUGB 2YUOA 2EIFA 1Y71A 3FJPA 1N9RA 2E6NA 3TCJA 4IUTA 4J8OA 2JXBA 2YRDA 2DZCA 5LJ5h 4DEXA 1XQHA 2E5QA 3LW5E 3OS5A 3VYHB 4EDUA 1JU5C 1M90C 3O5ZA 2DF6A 3GBQA 3OMCA 1KQ1A 2RB6A 3J7AF 1HXDA 3TU4K 1K8AC 3TEEA 4OMMA 2ZGWA 3ZBDA 3JRZA 3UDCA 2KAFA 3ZL7C 2VGNA 1OOTA 2KRSA 4JRQA 2E6ZA 3HFOA 1KG1A 5GAOq 2DTIA 5A2QE 2MI6A 2GFAA 3LGLA 1Q86C 2QQBA 1NYFA 5IH2A 4BI8B 2DTOA 2QQRA 5LJ3h 1UE9A 2DZ9A 4N0AA 5GAOl 3ULRB 2EGEA 1G3WA 4ZN1A 1QP3A 2QQ9A 3RKWA 2RD1A 5KCHA 3EGUA 4JJCA 2RI2A 4F7UG 3MP6A 2LRQA 2NYSA 4LDWA 2XI9A 1YN8A 1B7TA 1IO6A 1JQQA 2ZPFB 2JN0A 1SSHA 2ENMA 4M7AG 2DO3A 3VRZA 1JXOA 2EQIA 1UHFA 4CI0C 2A08A 1X2KA 3M54A 5L8RE 1U1SA 2CZ7B 4E7ZA 3CCVQ 4M7AA 1QP2A 1YWPA 1SHFA 3E9FA 2RK1A 1WZOA 4J9EA 1VIEA 1UDLA 3CCRT 4KBMB 1AHJB 5GANf 2KVQG 5GAN2 1YITA 5DM7R 3P8BB 1IB8A 1C0MA 4FW1A 4KH1B 1Q82R 1K76A 2HDAA 4PFPA 5ECAA 1YJWA 2C06A 1FMVA 2KGTA 1WIEA 2DX1A 4OB0B 1M1GA 2QDLA 3CC4A 5IXBA 2Y90A 4BDZA 3X24B 4PJMA 2O9VA 2D8HA 2NUPB 1WQ7A 4C92C 2E1HA 2C0IA 1GXIE 1GBRA 1NJIC 4M75C 3H0IA 2O31A 3CCLA 1FWZA 2BZYA 5AT1B 1I4K1 3QZ9B 2RM4A 1BI0A 4V2SA 4VUBA 2GCXA 3MPUB 1R0BG 4F7UF 1M1KU 3QSUA 3GNGA 1XNIA 1UGSB 2F5TX 4M77B 1PRMC 4RTVA 1H3ZA 2Z0WA 2DERA 3VS3A 3JB9G 1K73U 3PT9A 4QW2A 3RNJA 1I8FA 2LNVA 2WACA 1RAEB 4AFUC 1R0CB 3RESA 2RK2A 5HKCA 1VQ6Q 3CCEQ 4Z02A 3CPFA 1IZ6A 3CMAT 1K1ZA 2RI5A 5CVIA 4C0FA 5GAMd 3CCQA 4FYWB 3OS2A 1EIFA 3CMEQ 4PJOE 3GIBA 3RIRA 4JZ4A 1VQ4A 1VQNQ 1WFWA 5GMKm 5A0DA 1Y57A 3NGPA 4IUVA 2QEXQ 3VS2A 2COWA 2E64A 1TU0B 2LMJA 1I81A 3VS6A 4EIKA 1Q82C 2JNGA 1D0ZA 4KT0E 4BI4A 4WTOB 2NWMA 1TOVA 3M0QA 3OS0A 1NBEB 1YCSB 3G6EQ 1GCPA 2EKOA 2JZ2A 2K5FA 1VQOA 2OAUA 3EGXB 4RCBA 4J5YA 1OULA 2COYA 1VYUA 3V7RA 2CS7A 2RJCA 4HXJA 1B34B 5FU7C 1YITT 1ZA2B 2EQKA 2C0OA 2E65A 2K3YA 2KRNA 3E2UA 2GQIA 5GAOr 4NL3A 2B86A 1TUDA 2K79A 3NPFA 1RI0A 4EMKB 1SEMA 1YJWT 2VKNA 1QVGP 4TVRA 2CH4A 2DFUA 3PTAA 3QZ5B 3OYAA 1K9MU 1FXXA 1RLQC 2NUPA 1G8XA 4J9GA 3CCUT 1M3AA 1T0JA 2D8JA 4PK4A 1ZBJA 3CCJQ 2E70A 4AFQC 3CC2Q 2YLBA 1KQSS 4CC2A 3CCLT 1XJWB 1S72A 2DKGA 4M77G 5FWCA 3WVDB 2K2MA 3N5BB 4E2FB 4M77A 3LGFA 1VUBA 4IIOA 3KUFA 1VQ9T 2OTJQ 3A8MB 3EHRA 5KE3A 1HK9A 2RHYA 2H3JA 1OZ3A 2LJ1A 2EQUA 3PVQA 2YRVA 1YHQQ 1X6BA 1NYGA 4M7DB 3L2ZA 3BY7A 4GLMA 4GY5A 3VUZA 3JB9J 3CD6Q 2DPPB 3HRSA 2A36A 3CC7Q 2YT6A 3SEMA 4OGCA 2HSPA 4M75D 2GGRA 1BCMA 3KBGA 2CP7A 4FT2A 1YI2A 4QT7A 2MF2A 2YWWA 3OBYA 2ZPHB 3T9NA 1RAIB 3EGXA 3VU3C 3IQLA 2KYMA 1TSFA 2F2VA 1D3BB 1B34A 1AZEA 1LCKA 4JDSA 4PJLA 2NUTB 2XMFA 3R6OA 1B3QA 2OTLQ 4BE1A 5LJ3f 1U1TA 1UGQB 1WJQA 1QMCA 4QQ6A 4BE2A 1OI1A 5D6WA 1QKXA 1Q7YR 2MMPA 2L3RA 4EMKA 1WJRA 2L3PA 2FG0A 1SG5A 4M75F 2KRMA 2RJDA 2RPNA 2RQRA 3REAB 2EJGA 3JCMV 1KD1C 4IKFA 1E7OA 4PKCC 1BBZA 2D0NA 2LT4A 6AT1B 3OYMA 5DLQE 3NTKA 3RKXA 4FYXB 4DBFA 3EFOB 4J9CA 1MHNA 2QDYB 2KE9A
chains in the Genus database with same CATH topology
5CCAA 4RKUE 2XG8D 2LDMA 4C92E 3JCMf 5GAN7 3JB9F 3FC3A 3L42A 3M4GA 3OQ5A 4QVCA 4FM4B 3JCMc 3A8GB 2QEXT 4MMKA 4C8QB 4X34A 5I2SA 1QVGA 2HD0A 1W4SA 1WJSA 1M9SA 2K4YA 2VV5A 1JRIA 4J83A 4X9CA 5CAIA 4OB3B 3LWIA 2X4YA 4M7DC 3CXCS 4R56A 4M7DG 4JLIA 2L8DA 3OYLA 2M0OA 3UPUA 3JCMP 1ZHIA 3OYYA 2QQAA 5CKFA 5LJ3j 3QDRB 4XTYA 4M7AB 4PJOD 2RHXA 1VQ8T 2QQSA 3QXEB 4LDVA 4ATOA 4M7DA 3I56A 4E7JA 1VQ7A 1H641 2CZ1B 2P4TA 2YLCA 5IT9E 4L59A 5CKEA 3UWNA 1KHCA 3NFCA 2E12A 3LYIA 2OTLA 3CCVT 3JB9H 3JAME 5LJ3g 2D6FA 4ELYC 3QIIA 2FB7A 3JCMe 3SFMA 2KY9A 4FT4A 3LH0A 4HCCA 2HBPA 2V8JA 3E19A 3L2VA 4DOWA 3CCUA 1WNLA 3X28B 1Q81C 4LDYA 1M8VA 2KK4A 4HKEA 1UGRB 4XTVA 2EIFA 1Y71A 4GLKA 1LNXA 1YJNA 3RKYA 2V8KA 1N9RA 1NPPA 2E6NA 2FVUA 3FJPA 4IUTA 4M77D 3TCJA 3G4ST 4J8OA 3CCSA 3CCQT 2QA4T 1KHIA 3EFSA 2DZCA 3KXTA 3ME9A 5LJ5h 1Q7YU 5FRMA 4A53A 2LCLA 1V29B 3ZFJA 5GAMf 2A7YA 3LWHA 3G71A 1N27A 4J7FA 1XQHA 4JRIA 5DY9A 1VQ4T 1K8AU 2E5QA 2O4XA 3LW5E 3MEAA 3OS5A 2LQKA 4XU1A 3VYHB 3OSSC 4EDUA 1M90C 2M1HA 4ZGDB 5KH6A 4XU0A 1VQMA 2F5KA 3QHSA 1M1KC 2RA2A 1VQ9A 3SD4A 3OMCA 2ZPIB 3HRTA 1U8RA 2HQEA 1D3BA 5CQXA 2EWNA 5J3BA 1KQ1A 1TH7A 4PJOF 2RB6A 3JCMg 1VQLT 1HXDA 3J7AF 3JB9I 3M57A 3OYJA 3TU4K 2DK3A 4QQGA 4C92B 2DXUA 4ZTFA 1K73C 1K8AC 3J81E 3TEEA 4M7AE 1BI2A 1XOVA 3HL8A 4M75B 4QVZA 2KQWA 3M53A 2QXFA 2ZGWA 3ZBDA 4C0DB 3JRZA 1QVFA 2VGMA 3UDCA 1VQOT 3PMTA 2KAFA 1WGSA 2VGNA 3GF5A 2NLUA 3OYKA 2AHJB 4JRQA 2E6ZA 3HFOA 4JLGA 4C8QA 1KG1A 2PU9B 4N0AC 5GAMe 5GAOq 2DTIA 3A8OB 4RG2A 5A2QE 5HK3A 2MI6A 4M78C 4E7KA 2GFAA 3LGLA 3X26B 1Q86C 4M78G 2M16A 2QQBA 3JCMQ 4E47A 3M55A 4BI8B 4R55A 3JCMX 1YIJT 4M77F 4J6YA 2DTOA 2QQRA 3P8DA 5LJ3h 2DZ9A 5CO7A 3G7ZA 1VQPA 1KQ2A 4N0AA 5GAOl 3GOXA 2HNIA 1G3WA 4FSXA 4XU3A 3PGGA 4MZTA 4M78A 3OYNA 4ZN1A 2EFIA 2RHUA 1ZQ1A 1QP3A 2QQ9A 2EJ9A 2RD1A 2JOYA 2K3XA 4XU2A 3RKWA 4C8QC 2X4WA 2RI2A 4F7UG 4C8QG 5C0MA 4FIBA 2ZPEB 1VQKA 3MP6A 3MEWA 3L1AA 4OMFB 3I55A 1VQ6T 3CCET 1KD1U 2LRQA 4LDWA 2XI9A 3INZA 5CQYA 2MWOA 1YJ9T 3S3NA 3H6ZA 3QJ6A 4LDUA 4IURA 2ZPFB 1BIBA 4QQDA 2JN0A 4B9XA 4BY6B 1G5VA 3BDUA 3OMGA 5CR2A 4M7AG 5D6XA 3HRUA 3CMET 2DO3A 2LC4A 5GAMg 4CI0C 3J80E 2GFUA 3E9GA 4OGEA 5GMKi 3DB3A 1S72T 1VQNT 4P5NA 3M54A 4M78D 4XK8E 5L8RE 1U1SA 2CZ7B 3OSVA 2PVDB 4DQ2A 4M7AA 1QP2A 1BKBA 1UB4A 3SDZA 2CKKA 2RHZA 4M75E 1N8RC 1NE8A 3E9FA 2D9TA 3JCMh 1KC8C 2RK1A 2EYQA 2FL7A 3OYCA 3OYIA 1VIEA 4O5VA 2ZZDA 2Y4YA 1W2BS 2LCCA 3MHXA 3GPLA 3CCRT 2EJFA 4IUUA 4KBMB 1AHJB 4C8QD 2KVQG 5GANf 2XKOC 5GAN2 2LX9A 1YITA 5DM7R 3JCMW 3BFMA 3P8BB 3C12A 3G6ET 4E7IA 3RERA 2FYKA 1K9MC 1XTDA 4ZTJA 3X25B 4MDWA 3VKIA 1W2BA 2EQMA 2WSEE 3JCMJ 2FHDA 1N9SA 3CXCA 3A8LB 3FRNA 2DIGA 5GAOn 4MZMA 2DJZA 1YJWA 2JTFA 2WSCE 4FU6A 4C5GA 5FU7B 2C06A 3CBOA 4OB0B 1M1GA 3JCMd 2P0PA 1PSFA 3CC4A 3M5AA 1NZ9A 3AHUA 2Y90A 4C5HA 4BDZA 3S3OA 3X24B 1Q81U 2MAMA 1UEBA 1MGQA 4OP0A 1WQ7A 3V8KA 4C92C 2E1HA 1O9SA 1QVPA 1Y07A 5J26A 4C92G 3OYEA 1GXIE 3X20B 2HQXA 2K57A 4M78F 2RH2A 4A4HA 5GANd 2K5LA 4M75C 5GANe 1NJIC 2IVWA 2XDDA 4BE0A 4M75G 2EAYA 2XHCA 4C0DC 4HCBA 3CCLA 3FDRA 4M7DD 5EG2A 1FWZA 1I4K1 1YI2T 2BIVA 4C92A 3QZ9B 2RM4A 1BI3A 1BI0A 4BUGA 4VUBA 4V2SA 1VQ5T 3CCJT 3QUIA 1M90U 4M75A 2GCXA 5FRNA 5GAMh 2DTHA 2XIDA 1VQ8A 3CC2T 4F7UF 1M1KU 4C8QF 2PVGB 2RJEA 3QSUA 3GNGA 1XNIA 5CK9A 4L6V5 3CCMT 1UGSB 2F5TX 4M77B 1BYMA 3WXMB 1H3ZA 1Y96A 3S3MA 1UGPB 2GF7A 5FU6B 4IUPA 5LJ5f 4A4KA 2RO0A 2ZPBB 4A4FA 3CCVA 3JB9G 3E1SA 3PT9A 4OVAA 4QW2A 3OYDA 5GANj 3CBPA 2DXCA 4DOVA 2QTXA 5CKBA 2ZCFB 4JS5A 2RI3A 1I8FA 5IN1A 2LNVA 2WACA 5LL6S 4N4IA 3QKJA 3SB2A 3RESA 2RK2A 4C92D 4EMHA 5HY6A 3A8HB 5HKCA 3L2RA 4Z02A 3CPWS 2OTJT 4XTWA 2IG0A 2LQ8A 2DD5A 2D0QB 3CPFA 4MMLA 5GANg 2E41A 5GAN3 1IZ6A 3CMAT 3G4SA 2RI5A 2XU8A 5CVIA 4C0FA 5GAMd 3CCQA 4J6XA 5FLXE 3OYGA 1YHQT 3NTIA 2V8IA 4PLIA 4NL2A 3OS2A 1Q86U 1EIFA 2R57A 3CPWA 3M58A 4PJOE 3GIBA 3OYFA 2Y4XA 1DJ7B 3RIRA 2QI2A 4C0ZA 1VQ4A 3MP1A 4C5IA 3LLRA 3MP8A 4OF1A 4M7DF 5GAN4 5I21A 4QVDA 5GMKm 5A0DA 4YTLA 3S6WA 1JBMA 3OYBA 2KSSA 4IUVA 3L2WA 3CD6T 3FLGA 1YCYA 3CC7T 2XD0A 2E64A 5D6YA 1VQLA 2I2LA 1I81A 3QBYA 3HHTB 1Q82C 3MCAB 3F70A 2JNGA 4KT0E 4BI4A 5GAMj 3OS0A 2MWPA 4O6JA 3C4SA 2VYTA 3Q1JA 2EKOA 2R5MA 2JZ2A 3OB9A 4BB7A 2K5FA 3SWNB 4M77E 1VQOA 4N4HA 2OAUA 1G3TA 3QYHB 4RCBA 4M7AC 3MO8A 4CRIA 4HT8A 2X4XA 4J5YA 2BUDA 2DXBA 2ZPGB 3DKMA 3V7RA 2CS7A 4C92F 2RJCA 3DLLA 5KE2A 1B34B 2GQVA 5FU7C 5A0LA 1YITT 3META 2EQKA 4Y28E 2CGHA 1N8RU 1KC8U 2E65A 2CZ0B 2K3YA 5GMKe 3OYHA 1I5LA 5GAOr 4NL3A 3O8VA 3I56T 3VUBA 4EPCA 1VQ7T 2DD4A 1RI0A 4JRPA 1LJOA 5HK0A 3NTHA 4EMKB 1YJWT 3C94A 3HPWA 4D6WA 2OTLT 1JB0E 4ME7A 1N6AA 3EFRA 1WPYA 3M4YA 4TVRA 4PL6A 4Y91A 2XK0A 1QVGS 3PTAA 3QZ5B 2R5AA 5GANh 3OYAA 3CCEA 1K9MU 1VQ6A 1FXXA 3V7CA 5GAOm 3P8HA 2RJFA 2VC8A 3JCMb 3CCUT 1YJ9A 1X6OA 1M4ZA 2PUKB 4ZGJB 5AYFA 4M7AD 2JUFA 3HP9A 5GMKj 3HFNA 2E70A 2RHIA 3L2UA 4F7UB 3BW1A 2YLBA 2XICA 5M9OA 3RMSA 3CMEA 5I2MA 4EMGA 1YJNT 1KQSS 3CCST 4KUDK 4JS4A 4M77C 3CCLT 1S72A 4RMOA 1LOJA 2DKGA 2KDSA 3PFSA 4M77G 3TREA 1VQNA 5FU6C 4RCCA 4PJOB 2VXFA 3VV0A 3WVDB 1P92A 3G71T 3QG1A 4E7LA 2DXTA 4PNOA 3N5BB 4MDXA 4OB2B 4ZGEB 2K2VA 1KQSA 4ZN3A 2QEXA 3CBMA 4M77A 1VQMT 1NJIU 1G3YA 3LGFA 1VUBA 3LX7A 2K5IA 2LTOA 3KUFA 4Q5WA 5GAN5 1VQ9T 4N4GA 3CCRA 3A8MB 2A3LA 3OY9A 4LD9K 4KUIA 1HK9A 2PUOB 5KE3A 2RHYA 2H3JA 1OZ3A 2M9UA 4L5GA 4XTUA 1OZ2A 3ER0A 3G6EA 3OW2S 3UT1A 1OYXA 2EQUA 5GAN6 3L2QA 3GNFB 4BACA 2YRVA 4FL6A 2CYZB 4LD6A 4NS5A 2HAXA 3M9QA 3QJYA 4PLLA 5IAYA 5DLOA 4C0GA 4HT9A 5KCHA 4M7DB 2XDBA 3L2ZA 4A4EA 3BY7A 4GY5A 3JSCA 1R8OB 3RUXA 5C6SA 3MEVA 2KMTA 5GMKl 3OW2A 4M78E 3QO3A 3VUZA 3V7SA 3JB9J 2P0KA 4UC4A 1RL2A 4A54A 4E7HA 4M7AF 2DPPB 3HRSA 4A4GA 1QW1A 1Q7YC 2XDPA 4LDXA 2X35A 2WSFE 2VXEA 1M5Q1 2JVVA 4BD3A 4OGCA 3OS1A 3ZEHA 4NOYA 3M56A 3OA6A 4RG8A 3CEYA 4HA8A 4XQ3A 1VQPT 3PMIA 4M75D 4JUVA 4F7UE 4C8QE 2B8AA 3A5ZB 3KBGA 2DIQA 3VJPA 3FEOA 2QA4A 4FT2A 1ZBXA 2L5QA 3C95A 4BY6C 3SWNC 1QVFS 2VUBA 1YI2A 3HSBA 4J6WA 1VQKT 2LVMA 5GAOp 2MF2A 4IUQA 3I55T 2JTMA 1VQ5A 2BKDN 3OBYA 3CCJA 2ZPHB 3BDLA 3CC2A 3V8JA 4DA4A 1YBYA 2O4XB 2EQJA 3SWNA 3T9NA 5KCOA 1BIAA 2G3RA 3FB9A 5CIUA 3VU3C 3DB4A 5LJ5e 5LJ5d 3CCMA 1VIFA 3VYGA 3GP8A 1FX7A 1X75C 4JRKA 3QYGB 2YHTA 5GMKh 3JB9D 1SSFA 3DLMA 3PIPA 5CKDA 2CZ6B 1Q82U 1Y96B 1D3BB 1B34A 3FIFA 3HKSA 3PIOA 4II1A 4JDSA 2PQWA 4EMKC 1NPRA 3R6OA 3ASKA 4B9WA 4ELZC 4BDYA 4BE1A 3H8ZA 3OBWA 1U1TA 5LJ3f 4KULA 2X4JA 2LT1A 2DVEA 1UGQB 1WJQA 1Y7XA 2E10A 4HCZA 4MZPA 4XTZA 1BI1A 4QQ6A 5CKHA 2OTJA 4BE2A 1OI1A 5A0GA 1JJ2S 5D6WA 4C5EA 4M7DE 3URGA 1WQWA 2MMPA 3EAEA 4XAXB 1X01A 2L3RA 4EMKA 3RMQA 3CMAA 2PVOB 4WF2A 5LJ5j 1WJRA 1M1FA 4X9DA 3PNWC 1YHQA 5J39A 1K73U 2R58A 2P0QA 4M75F 4XTXA 1JJ2A 4JJNK 3V8LA 2RJDA 4OB1B 1YIJA 1G3SA 1O75A 3MEUA 1KD1C 2EJGA 3JCMV 4IKFA 4PJOC 2F69A 3WVEB 4PJOG 5LJ5g 4PKCC 4F7UA 2LT4A 3OYMA 5DLQE 1IREB 3CD6A 3GLXA 3NTKA 3RKXA 5FROA 1MHNA 3M59A 4M78B 3CC7A 2O01E 1PSEA 4BI3A 3QPHA 2DEQA 4J7IA 5LJ3d 4PJOA 2L89A 5LJ3e 5GAN8 3CC4T 2QDYB 2DAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3W A;  2K5I A;  1BI2 A;  3HRS A;  1FWZ A;  1QW1 A;  2QQ9 A;  1FX7 A;  1BI3 A;  1BI0 A;  2H3J A;  1G3S A;  2GCX A;  2K4Y A;  4O5V A;  5CVI A;  4O6J A;  3MHX A;  3E19 A;  1U8R A;  3HRT A;  1BYM A;  1P92 A;  3GLX A;  2QQB A;  1BI1 A;  2LX9 A;  2K5F A;  1QVP A;  1G3T A;  2QQA A;  3HRU A;  1G3Y A;  2K5L A; 
#chains in the Genus database with same CATH topology
 4C92 E;  1IRX A;  4RTU A;  4JPB W;  1PM3 A;  4FM4 B;  3JCM c;  4CC4 B;  4C8Q B;  2RQV A;  2VV5 A;  1JRI A;  4J83 A;  5CAI A;  2X4Y A;  4ORZ A;  4M7D G;  1MV3 A;  1MND A;  4F16 A;  3JCM P;  3OYY A;  3MJX A;  5CKF A;  3TSW A;  4AG2 C;  4F04 B;  4M7D A;  1GCQ C;  2CZ1 B;  2P4T A;  2YLC A;  4X1V A;  5CKE A;  3QDF A;  1UTI A;  3LYI A;  3CCV T;  3JAM E;  4ELY C;  3JCM e;  2KY9 A;  3LH0 A;  2ED1 A;  2HBP A;  3L2V A;  4CC7 A;  1IGQ A;  1UGR B;  4XTV A;  1YWO A;  1KIK A;  3CCS A;  1MUZ A;  1N8R R;  3KXT A;  3ME9 A;  1KC8 R;  5FRM A;  2K6D A;  2LCL A;  3PVL A;  1V29 B;  1UEC A;  3ZFJ A;  3LWH A;  3G71 A;  4J7F A;  4JRI A;  5IXF A;  2LQK A;  5KH6 A;  1VQM A;  2KNB B;  2F5K A;  5I11 A;  1U8R A;  3HRT A;  1D3B A;  5CQX A;  1CKB A;  1TH7 A;  4JZ3 A;  2E3I A;  2EYY A;  2NUT A;  3EGD B;  3J81 E;  1SF9 A;  1YIT Q;  1XOV A;  3HL8 A;  1SRM A;  4QVZ A;  1TXQ A;  1QVF A;  2VGM A;  1FYN A;  1WGS A;  3GF5 A;  1IXD A;  3OYK A;  2AHJ B;  4JLG A;  4N0A C;  1YJW Q;  5FWB A;  3X26 B;  2M16 A;  1NLP C;  4E47 A;  4J6Y A;  3CC4 Q;  1VQP A;  1QWF A;  1D1C A;  3KFV A;  2CT4 A;  4XU3 A;  4MZT A;  1V76 A;  1OU8 A;  1WHK A;  3OYN A;  3EFO A;  4LE9 A;  2FPE A;  1CSK A;  2JOY A;  4XU2 A;  4C8Q G;  2ZPE B;  1M8M A;  2KBT A;  2O9S A;  1VQ6 T;  3CCE T;  1TG0 A;  3CCL Q;  5CQY A;  2CSQ A;  3S3N A;  3H6Z A;  3QJ6 A;  4C8Q A;  4BY6 B;  2V1Q A;  2VWF A;  3OMG A;  1UJY A;  4JJB A;  5CR2 A;  2EYW A;  3CME T;  5GAM g;  1AEY A;  3J80 E;  3E9G A;  1VQN T;  4P5N A;  1M30 A;  2PVD B;  3M0P A;  2C0T A;  2AK5 A;  3RBB B;  1N8R C;  1NE8 A;  1KC8 C;  2D9T A;  1PHT A;  2FL7 A;  3OYC A;  1I07 A;  4FYY B;  2J7I A;  2ZZD A;  2LCS A;  1AVZ C;  2Y4Y A;  1W2B S;  2LCC A;  3GPL A;  1D1B A;  4IUU A;  1SKU B;  4C8Q D;  2DL5 A;  1ZUU A;  2LX9 A;  3BFM A;  3G6E T;  1M2V B;  4D8K A;  3CCQ Q;  4OMN A;  4DBR A;  2F2W A;  2FYK A;  2EGA A;  3X25 B;  4MDW A;  2WSE E;  1PC0 A;  1AT1 B;  1I5O B;  3JCM J;  1N9S A;  1VQ4 Q;  3FRN A;  5GAO n;  2DJZ A;  2JTF A;  2H8H A;  4K11 A;  2AT1 B;  3AHU A;  4C5H A;  3S3O A;  2QTV A;  1UEB A;  1MGQ A;  1QVP A;  3X20 B;  5GAN d;  5GAN e;  4OML A;  2IVW A;  2XDD A;  1HSQ A;  4BE0 A;  2EAY A;  3FDR A;  1H8K A;  2LJ3 A;  1VQO Q;  2FZK B;  4AFZ C;  3EGD A;  3TVT A;  1BI3 A;  2HBW A;  3CCJ T;  3QUI A;  2FRW A;  5GAM h;  2DTH A;  2XID A;  1VQ8 A;  3CC2 T;  4C8Q F;  1PRL C;  2HL3 A;  1Y96 A;  1UGP B;  1RAH B;  4A4K A;  1ZSG A;  2RO0 A;  4AT1 B;  3E1S A;  3OYD A;  4OVA A;  2QTX A;  1K0X A;  4JS5 A;  2KYB A;  2RI3 A;  1U06 A;  5IN1 A;  1E6G A;  3CPW S;  2OTJ T;  2I0N A;  2DD5 A;  1WXB A;  2D0Q B;  2RQU A;  3G4S A;  5KYW B;  1YHQ T;  2V8I A;  4PLI A;  3M58 A;  4Y92 A;  1NJI R;  2JMC A;  2Y4X A;  2A0F B;  2QI2 A;  1S72 Q;  3MP1 A;  1Z9Q A;  3LLR A;  1TTH B;  2LP5 A;  3EHQ A;  1JBM A;  1TUC A;  3CD6 T;  2EVR A;  3CC7 T;  2XD0 A;  1Q95 G;  2QAS A;  1VQL A;  5IHK A;  3HHT B;  4FYV B;  2GTJ A;  2EPD A;  2CP6 A;  2M0Y A;  1KSW A;  3EG1 A;  3OB9 A;  3SWN B;  4N4H A;  3QYH B;  2DXB A;  2DJQ A;  2DIL A;  2ZPG B;  2QK0 A;  1LPL A;  1M2V A;  5KE2 A;  2W0Z A;  1RI9 A;  4AG1 C;  3VS7 A;  3MET A;  2CH4 W;  4Y28 E;  2CGH A;  2L0A A;  2RF0 A;  8ATC B;  2CZ0 B;  3EH1 A;  3O8V A;  1OX9 A;  2K3B A;  2MYS A;  5HK0 A;  3NTH A;  3HPW A;  2OTL T;  1JB0 E;  3M4Y A;  1WPY A;  3EG3 A;  1ARK A;  2DNU A;  1FMK A;  2OI3 A;  3V7C A;  5GAO m;  3P8H A;  1YI2 Q;  2H3E B;  2LQW A;  4RUG A;  1YJ9 A;  2LJ0 A;  4M7A D;  2K7A A;  1T3S A;  5GMK j;  4RTX A;  5M9O A;  3RMS A;  5I2M A;  4M77 C;  3PFS A;  4J9I A;  5KYX B;  1YFN A;  2VXF A;  4E7L A;  4MDX A;  2CP3 A;  4OB2 B;  2LQN A;  2PTK A;  4ZGE B;  1HYO A;  1G3Y A;  2DL8 A;  1RUW A;  2CSI A;  1GFC A;  4N4G A;  2A3L A;  3OY9 A;  4RTY A;  4KUI A;  2QGG A;  3OW2 P;  1OZ2 A;  1OYX A;  3L2Q A;  1AZG B;  1G83 A;  1PCX A;  2HAX A;  2CP0 A;  4C0G A;  5DLO A;  4HT9 A;  4A4E A;  3RUX A;  5GMK l;  3OW2 A;  1PD1 A;  5KYW A;  2P0K A;  1RL2 A;  2LZ6 B;  4E7H A;  4M7A F;  2X35 A;  1M5Q 1;  3ZEH A;  3M56 A;  1W70 A;  4RG8 A;  4XQ3 A;  4F7U E;  5KYN A;  2B8A A;  3VJP A;  3C95 A;  1QVF S;  2VUB A;  1X6G A;  3HSB A;  1VQ5 A;  2BKD N;  3BDL A;  4DA4 A;  1YBY A;  2O4X B;  3SWN A;  3OYE A;  5LJ5 d;  3FB9 A;  3CCM A;  5LJ5 e;  3DB4 A;  1VIF A;  3VYG A;  1FX7 A;  1X75 C;  4JRK A;  2YHT A;  5GMK h;  3JB9 D;  2A37 A;  2CZ6 B;  5HCK A;  1SPK A;  4EMK C;  4B9W A;  4ELZ C;  1QKW A;  4KUL A;  4RTZ A;  1KQ2 A;  1Y7X A;  3I5S A;  1JJ2 P;  2BTT A;  1AOJ A;  3URG A;  4XAX B;  3VS0 A;  4WF2 A;  4OMO A;  1NG2 A;  4X9D A;  5J39 A;  2R58 A;  2P0Q A;  1M1K R;  3CCS Q;  2X51 A;  1JJ2 A;  4OB1 B;  1YIJ A;  1G3S A;  1O75 A;  2DA9 A;  3G71 Q;  1IHV A;  3G1J A;  2DEU A;  2L2P A;  1K73 R;  2KRO A;  1VQM Q;  4M78 B;  1UFF A;  2O01 E;  2X3W D;  5KYX A;  1NLO C;  1YNZ A;  3QPH A;  5LJ3 d;  5LJ3 e;  2P84 A;  3CC4 T;  4XU0 A;  3D7S B;  2YUP A;  3JB9 F;  3L42 A;  3M4G A;  2HZY A;  4QKU A;  4IIM A;  1AWW A;  4X34 A;  1QVG A;  2HD0 A;  1WJS A;  4OMP A;  3R6N A;  1F1B B;  1WHL A;  4OB3 B;  3LWI A;  3CXC P;  4M7D C;  4R56 A;  1D09 B;  2YUN A;  3U23 A;  2L8D A;  3OYL A;  1VOM A;  1ZHI A;  2QQA A;  3QDR B;  4XTY A;  2KT1 A;  2JW4 A;  4LDV A;  2E5K A;  3I56 A;  4E7J A;  1VQ7 A;  2HMA A;  2CRE A;  5IT9 E;  1AWO A;  4L59 A;  1KD1 R;  3NFC A;  1VQP Q;  3M0R A;  3JB9 H;  1M3B A;  1WHJ A;  1U3O A;  2V8J A;  3E19 A;  1X2Q A;  1WNL A;  2OX7 A;  4FW2 A;  5L23 A;  2CDT A;  4HKE A;  1JEG A;  4DBQ A;  1LNX A;  1YJN A;  2FVU A;  1NPP A;  4M77 D;  1QCO A;  3NHN A;  3CCQ T;  1WDX A;  1Q7Y U;  4A53 A;  1U5S A;  2A7Y A;  5GAM f;  2DL3 A;  1VQ4 T;  2O4X A;  3OSS C;  1ACM B;  4ZGD B;  1M1K C;  3SD4 A;  2OAW A;  2HQE A;  1K9M R;  1FMW A;  3JB9 I;  2DK3 A;  4OMQ A;  4ZTF A;  1K73 C;  1WI7 A;  3SHW A;  3M53 A;  2QXF A;  4C0D B;  1BK2 A;  1VQO T;  3PMT A;  4J9H A;  2NLU A;  1RAF B;  2GNC A;  3A8O B;  4WCI A;  1PNJ A;  1M3C A;  4PFZ A;  4M78 G;  4R55 A;  3M55 A;  1SRL A;  1YIJ T;  4M77 F;  3P8D A;  5CO7 A;  3G7Z A;  4FSX A;  3PGG A;  4M78 A;  2HEQ A;  2EFI A;  2RHU A;  1ZQ1 A;  1OPL A;  2CP5 A;  4C8Q C;  2K3X A;  5C0M A;  1VQK A;  1MNE A;  3I55 A;  1TWB A;  1WYX A;  5D7U A;  2MWO A;  4LDU A;  4B9X A;  2JMA A;  1VQ8 Q;  5D6X A;  3HRU A;  1S72 T;  5GMK i;  4M78 D;  4XK8 E;  4DQ2 A;  5FW9 A;  3SDZ A;  2RHZ A;  4M75 E;  4AFS C;  4E7S A;  3OYI A;  1E6H A;  4FCY A;  2KR3 A;  3MHX A;  1AD5 A;  2XKO C;  3EG2 A;  1WLP B;  3G4S Q;  3C12 A;  4E7I A;  3TQ7 P;  1AWJ A;  1K9M C;  1XTD A;  2EQM A;  2FZG B;  5EC7 A;  3A8L B;  4MZM A;  2WSC E;  4FU6 A;  4C5G A;  3CBO A;  3NMZ C;  3JCM d;  1PSF A;  1OQK A;  3M5A A;  1NZ9 A;  4KGV B;  1Q81 U;  1VQL Q;  2MAM A;  2RQT A;  2AKL A;  3V8K A;  1M27 C;  2HQX A;  2E4H A;  3PE0 A;  4M78 F;  2RH2 A;  4A4H A;  2K5L A;  1UGV A;  1RAD B;  4M7D D;  2XHC A;  4HCB A;  1ABQ A;  5EG2 A;  1YI2 T;  2DMO A;  1W1F A;  1M90 U;  2EGC A;  3WXM B;  2AKK A;  3S3M A;  5FU6 B;  2MPX C;  2ZPB B;  2DVJ A;  4A4F A;  1A0N B;  2QAZ A;  1K8A U;  2DXC A;  5CKB A;  2ZCF B;  2G6F X;  1ZSZ B;  5LL6 S;  3SB2 A;  4EMH A;  1BCO A;  3A8H B;  4PJJ A;  3L2R A;  3AT1 B;  1S1N A;  2CP2 A;  2IG0 A;  2LQ8 A;  2MIO A;  4JJD A;  5GAN 3;  4MML A;  5GJW B;  1YJ9 Q;  2CUB A;  5IHN A;  2V1R A;  2E3H A;  3VS4 A;  4J6X A;  1PKT A;  3OYG A;  1Q86 U;  1I0C A;  3NTI A;  2BE7 D;  4NL2 A;  2R57 A;  2KT8 A;  2COZ A;  3OYF A;  1DJ7 B;  3VS1 A;  4OF1 A;  4M7D F;  5GAN 4;  4LUE A;  4QVD A;  3S6W A;  3OYB A;  4PJN A;  1NEG A;  1QCN A;  1OX8 A;  1YCY A;  1RLP C;  2PZ1 A;  3QBY A;  3VRY A;  3MCA B;  5GAM j;  2MWP A;  3C4S A;  2VYT A;  3Q1J A;  2ECZ A;  1MMN A;  1Z9Z A;  2A28 A;  4M7A C;  1WXT A;  3MO8 A;  4HT8 A;  2X4X A;  1RAB B;  2KEA A;  2K9G A;  3UA7 A;  2JT4 A;  5A0L A;  2ZAE A;  2EBP A;  1SHG A;  2ROL A;  1I5L A;  3OYH A;  1IHW A;  3RDV A;  3VUB A;  2YRC A;  4EPC A;  2DD4 A;  2X3X D;  3M0S A;  4ME7 A;  1N6A A;  4Y91 A;  1QVG S;  2EYX A;  2R5A A;  2J6F A;  2RJF A;  2VC8 A;  3H0H A;  3JCM b;  1M4Z A;  1VQ5 Q;  2ABL A;  2JUF A;  2RHI A;  3L2U A;  4F7U B;  1KQS P;  4PFO A;  4EMG A;  4LUD A;  3CCS T;  3CCM Q;  2O88 A;  4RMO A;  1LOJ A;  1QCF A;  4RCC A;  4PJO B;  3VV0 A;  3G71 T;  1P92 A;  2JM8 A;  2DXT A;  4PNO A;  2K2V A;  1KQS A;  1KFZ A;  1NJI U;  3CBM A;  1VQM T;  3LX7 A;  3C0C A;  2K5I A;  4Q5W A;  4DBH A;  3CCR A;  4LNP A;  3BE3 A;  4CC3 A;  1PKS A;  1T0H A;  1ZSZ A;  2M9U A;  2DBM A;  2J05 A;  4L5G A;  4XTU A;  3ER0 A;  1G2B A;  2FRY A;  5GAN 6;  3GNF B;  4FL6 A;  2CYZ B;  4LD6 A;  4NS5 A;  3M9Q A;  3QJY A;  4PLL A;  4KH0 B;  5IAY A;  1MMD A;  1YIJ Q;  2XDB A;  1T3L A;  4Z8A A;  1GRI A;  2KMT A;  2O2O A;  1C1A A;  3VS5 A;  3QO3 A;  1D0Y A;  4UC4 A;  3FJ5 A;  1X27 A;  3H41 A;  4A4G A;  1QW1 A;  2XDP A;  4LDX A;  2WSF E;  2VXE A;  2JVV A;  4BD3 A;  4NOY A;  3EG9 B;  3OA6 A;  4HA8 A;  1VQP T;  3PMI A;  4C8Q E;  2DIQ A;  3FEO A;  2QA4 A;  2L5Q A;  1ZLM A;  3SWN C;  5GAO p;  2JTM A;  1BIA A;  5CIU A;  1C6V X;  3QYG B;  1SSF A;  1MMA A;  3I56 Q;  1Q82 U;  3HKS A;  3PIO A;  1VQ7 Q;  2AZS A;  3I5R A;  3OBW A;  2YSQ A;  2DVE A;  2LT1 A;  4MZP A;  4XTZ A;  5CKH A;  1BI1 A;  4J9F A;  5A0G A;  4C5E A;  2L3Q A;  1WQW A;  1X01 A;  3RMQ A;  3CMA A;  2YXY A;  2PVO B;  3PNW C;  4M4Z A;  1YJN Q;  4XTX A;  3V8L A;  4ESR A;  3MEU A;  3WVE B;  4PJO G;  4F7U A;  1K4U S;  1IRE B;  3GLX A;  3M59 A;  1PSE A;  1RAA B;  4KGZ B;  2DEQ A;  3H0F A;  4PJO A;  2L89 A;  2M02 A;  2DAQ A;  1N5Z A;  4ZNX A;  5CCA A;  4HVV A;  3FC3 A;  4B6M A;  3OQ5 A;  4QVC A;  1PD0 A;  1GL5 A;  2HSE B;  3A8G B;  4MMK A;  2DE0 X;  5I2S A;  4X9C A;  2K4Y A;  3QWY A;  4PJO D;  2RHX A;  1VQ8 T;  3QXE B;  1D1A A;  9ATC B;  2D6F A;  3QII A;  2FB7 A;  3SFM A;  4FT4 A;  4HCC A;  3EG9 A;  3CCU A;  3LH5 A;  1VQK Q;  3X28 B;  3I55 Q;  4LDY A;  1M8V A;  2KK4 A;  4GLK A;  4A63 B;  2JS2 A;  3RKY A;  2V8K A;  3G4S T;  2GBQ A;  1KJW A;  2QA4 T;  1KHI A;  3EFS A;  1EZZ B;  2ATC B;  1N27 A;  1ZUK A;  5DY9 A;  1W6X A;  2BZX A;  3MEA A;  4XU1 A;  2KXC A;  2M1H A;  2FPD A;  3QHS A;  2RQW A;  1JO8 A;  2HL5 C;  2RA2 A;  5KYU B;  1VQ9 A;  2ZPI B;  2EWN A;  2DRM A;  5J3B A;  2J6K A;  2DYB A;  4PJO F;  3JCM g;  1VQL T;  4RTT A;  3M57 A;  3OYJ A;  1BB9 A;  4QQG A;  4C92 B;  2DXU A;  4AMC A;  1QWE A;  4M7A E;  1BI2 A;  4M75 B;  2KQW A;  2MCN A;  5KYY B;  1CKA A;  1PG5 B;  3MKD A;  2PU9 B;  5GAM e;  2JM9 A;  3M0U A;  2DYI A;  4RG2 A;  5HK3 A;  4M78 C;  4E7K A;  3H9N A;  3JCM Q;  3JCM X;  1H3H A;  2FO0 A;  1I1J A;  2EW3 A;  3GOX A;  2HNI A;  2EJ9 A;  2GTO A;  4J9D A;  2X4W A;  4FIB A;  2PNI A;  3L1A A;  3MEW A;  4OMF B;  1KD1 U;  1ABO A;  3INZ A;  1AWX A;  1YJ9 T;  1VYT A;  2EKH A;  4IUR A;  4QQD A;  1BIB A;  1G5V A;  1MMG A;  1ZUY A;  3BDU A;  2LC4 A;  4J9B A;  4ANJ A;  4OGE A;  2GFU A;  1QQJ A;  2M51 A;  3DB3 A;  1WA7 A;  2NUZ A;  1V1C A;  2AZV A;  3OSV A;  1BKB A;  1LVK A;  1B07 A;  1UB4 A;  3I35 A;  2CKK A;  2SEM A;  3JCM h;  2EYQ A;  4O5V A;  1W2B P;  1K9A A;  1GBQ A;  2EJF A;  2ESW A;  2DL7 A;  4FSS A;  3JCM W;  1UUE A;  2IIM A;  1NM7 A;  4ZTJ A;  1JXM A;  3VKI A;  1W2B A;  3THK A;  2FHD A;  3CXC A;  2DIG A;  2LX7 A;  2BE9 B;  5FU7 B;  3HTR A;  4Z88 A;  2P0P A;  2J6O A;  2YUQ A;  4HVW A;  4RTW A;  4OP0 A;  1O9S A;  1Y07 A;  5J26 A;  4C92 G;  1MV0 B;  5KYU A;  2K57 A;  2JTE A;  4M75 G;  4C0D C;  2AIR B;  2KXD A;  2VB6 A;  2BIV A;  4C92 A;  4BUG A;  2ED0 A;  4HVU A;  1VQ5 T;  3REB B;  4M75 A;  5FRN A;  1VYV A;  2PVG B;  2RJE A;  5CK9 A;  4L6V 5;  5IHI A;  3CCM T;  5KYY A;  4E6R A;  1BYM A;  5LJ5 f;  2GF7 A;  1H92 A;  4IUP A;  1D0X A;  2HQH A;  3CCV A;  5GAN j;  3CBP A;  4DOV A;  4N4I A;  3QKJ A;  2HKN A;  1OV3 A;  2F1L A;  3CPW P;  4C92 D;  5HY6 A;  2OJ2 A;  4XTW A;  2IPO B;  5GAN g;  2E41 A;  2FZC B;  2VAS A;  2XU8 A;  1NEB A;  4D8D A;  2FEI A;  5FLX E;  2DRK A;  4DEY A;  3CPW A;  4C0Z A;  4C5I A;  3MP8 A;  5I21 A;  4YTL A;  1IGU A;  2SRC A;  2KSS A;  3L2W A;  3FLG A;  2V26 A;  1R77 A;  2LNH B;  5D6Y A;  2I2L A;  3CCR Q;  3F70 A;  4R0K A;  2RNA A;  4O6J A;  2R5M A;  4BB7 A;  4M77 E;  1KK7 A;  1G3T A;  4CRI A;  2BUD A;  3DKM A;  2JS0 A;  4C92 F;  2RMO A;  2QGF B;  3DLL A;  2GQV A;  2MOX A;  1N8R U;  1KC8 U;  1X43 A;  3UA6 A;  5GMK e;  2L3S A;  3I56 T;  2HKQ B;  1VQ7 T;  3TSZ A;  1EFN A;  4JRP A;  1LJO A;  3C94 A;  3A1P A;  4D6W A;  1HJD A;  1WXU A;  3EFR A;  4PL6 A;  2XK0 A;  4F17 A;  1X69 A;  3CCE A;  5GAN h;  2QA4 Q;  1VQ6 A;  2DET A;  1EX4 A;  1X6O A;  4HCK A;  2PUK B;  4ZGJ B;  5AYF A;  3HP9 A;  3HFN A;  3BW1 A;  2XIC A;  3CME A;  1YJN T;  4KUD K;  4JS4 A;  2DBK A;  2KDS A;  1VQN A;  3TRE A;  1WHG A;  2CUD A;  1UJ0 A;  5FU6 C;  1ZA1 B;  3QG1 A;  3UF4 A;  1ZSZ C;  4Z89 A;  4ZN3 A;  2QEX A;  2CT3 A;  1BU1 A;  2JJ9 A;  2LTO A;  5GAN 5;  1VA7 A;  1ZX6 A;  4LD9 K;  4GBQ A;  2PUO B;  1M2O A;  3CMA Q;  3G6E A;  3OW2 S;  2ROT A;  3UT1 A;  1OU9 A;  4BAC A;  3QWX X;  2RN8 A;  2DLP A;  2QYZ A;  1QLY A;  3JSC A;  1R8O B;  5C6S A;  3MEV A;  2W10 A;  4M78 E;  3V7S A;  4A54 A;  2J06 A;  1PWT A;  2FPF A;  1Q7Y C;  8AT1 B;  2QG9 B;  4F14 A;  7AT1 B;  3OS1 A;  3CEY A;  4KGX B;  5I22 A;  4JUV A;  3A5Z B;  1ZBX A;  1UHC A;  2MK5 A;  2VVK A;  4BY6 C;  1QVF P;  2HCK A;  1WHM A;  4J6W A;  1VQK T;  2P4R A;  2LVM A;  4IUQ A;  3I55 T;  1UG1 A;  3CCJ A;  1Y0M A;  3CC2 A;  2F2X A;  2YDL A;  3V8J A;  5KCO A;  2EQJ A;  2G3R A;  3GP8 A;  3EH2 A;  3DLM A;  3PIP A;  5CKD A;  1Y96 B;  1Q81 R;  3FIF A;  3M0T A;  4II1 A;  2PQW A;  1NPR A;  3ASK A;  4BDY A;  3H8Z A;  5GJV B;  2D1X A;  2X4J A;  2E10 A;  4HCZ A;  2EYZ A;  2OTJ A;  1JJ2 S;  4M7D E;  3EAE A;  3CCU Q;  5LJ5 j;  1M1F A;  1YHQ A;  1M90 R;  4LXC A;  4JJN K;  1WHH A;  4PJO C;  3I9Q A;  2F69 A;  5LJ5 g;  1K8A R;  3CD6 A;  5FRO A;  1OEB A;  3CC7 A;  1WX6 A;  4BI3 A;  3EG0 A;  1TS9 A;  4LN2 A;  4J7I A;  1VQ9 Q;  5GAN 8;  2BZ8 A;  4RKU E;  2XG8 D;  2LDM A;  3JCM f;  5GAN 7;  1RAG B;  1GFD A;  2QEX T;  1YP5 A;  1Q86 R;  1W4S A;  3RER A;  1M9S A;  2X9H A;  1HD3 A;  3CXC S;  4JLI A;  2M0O A;  3UPU A;  4KRT A;  2DM1 A;  1RAC B;  5LJ3 j;  1J3T A;  4M7A B;  2QQS A;  4ATO A;  1K0S A;  2KI7 A;  1H64 1;  3UWN A;  1KHC A;  2OTL A;  2E12 A;  3CQT A;  2DL4 A;  5LJ3 g;  3RR6 A;  3JV3 A;  1GCQ A;  3A98 A;  1OPK A;  3UAT A;  4DOW A;  1Q81 C;  1TUG B;  2YUO A;  2EIF A;  1Y71 A;  3FJP A;  1N9R A;  2E6N A;  3TCJ A;  4IUT A;  4J8O A;  2JXB A;  2YRD A;  2DZC A;  5LJ5 h;  4DEX A;  1XQH A;  2E5Q A;  3LW5 E;  3OS5 A;  3VYH B;  4EDU A;  1JU5 C;  1M90 C;  3O5Z A;  2DF6 A;  3GBQ A;  3OMC A;  1KQ1 A;  2RB6 A;  3J7A F;  1HXD A;  3TU4 K;  1K8A C;  3TEE A;  4OMM A;  2ZGW A;  3ZBD A;  3JRZ A;  3UDC A;  2KAF A;  3ZL7 C;  2VGN A;  1OOT A;  2KRS A;  4JRQ A;  2E6Z A;  3HFO A;  1KG1 A;  5GAO q;  2DTI A;  5A2Q E;  2MI6 A;  2GFA A;  3LGL A;  1Q86 C;  2QQB A;  1NYF A;  5IH2 A;  4BI8 B;  2DTO A;  2QQR A;  5LJ3 h;  1UE9 A;  2DZ9 A;  4N0A A;  5GAO l;  3ULR B;  2EGE A;  1G3W A;  4ZN1 A;  1QP3 A;  2QQ9 A;  3RKW A;  2RD1 A;  5KCH A;  3EGU A;  4JJC A;  2RI2 A;  4F7U G;  3MP6 A;  2LRQ A;  2NYS A;  4LDW A;  2XI9 A;  1YN8 A;  1B7T A;  1IO6 A;  1JQQ A;  2ZPF B;  2JN0 A;  1SSH A;  2ENM A;  4M7A G;  2DO3 A;  3VRZ A;  1JXO A;  2EQI A;  1UHF A;  4CI0 C;  2A08 A;  1X2K A;  3M54 A;  5L8R E;  1U1S A;  2CZ7 B;  4E7Z A;  3CCV Q;  4M7A A;  1QP2 A;  1YWP A;  1SHF A;  3E9F A;  2RK1 A;  1WZO A;  4J9E A;  1VIE A;  1UDL A;  3CCR T;  4KBM B;  1AHJ B;  5GAN f;  2KVQ G;  5GAN 2;  1YIT A;  5DM7 R;  3P8B B;  1IB8 A;  1C0M A;  4FW1 A;  4KH1 B;  1Q82 R;  1K76 A;  2HDA A;  4PFP A;  5ECA A;  1YJW A;  2C06 A;  1FMV A;  2KGT A;  1WIE A;  2DX1 A;  4OB0 B;  1M1G A;  2QDL A;  3CC4 A;  5IXB A;  2Y90 A;  4BDZ A;  3X24 B;  4PJM A;  2O9V A;  2D8H A;  2NUP B;  1WQ7 A;  4C92 C;  2E1H A;  2C0I A;  1GXI E;  1GBR A;  1NJI C;  4M75 C;  3H0I A;  2O31 A;  3CCL A;  1FWZ A;  2BZY A;  5AT1 B;  1I4K 1;  3QZ9 B;  2RM4 A;  1BI0 A;  4V2S A;  4VUB A;  2GCX A;  3MPU B;  1R0B G;  4F7U F;  1M1K U;  3QSU A;  3GNG A;  1XNI A;  1UGS B;  2F5T X;  4M77 B;  1PRM C;  4RTV A;  1H3Z A;  2Z0W A;  2DER A;  3VS3 A;  3JB9 G;  1K73 U;  3PT9 A;  4QW2 A;  3RNJ A;  1I8F A;  2LNV A;  2WAC A;  1RAE B;  4AFU C;  1R0C B;  3RES A;  2RK2 A;  5HKC A;  1VQ6 Q;  3CCE Q;  4Z02 A;  3CPF A;  1IZ6 A;  3CMA T;  1K1Z A;  2RI5 A;  5CVI A;  4C0F A;  5GAM d;  3CCQ A;  4FYW B;  3OS2 A;  1EIF A;  3CME Q;  4PJO E;  3GIB A;  3RIR A;  4JZ4 A;  1VQ4 A;  1VQN Q;  1WFW A;  5GMK m;  5A0D A;  1Y57 A;  3NGP A;  4IUV A;  2QEX Q;  3VS2 A;  2COW A;  2E64 A;  1TU0 B;  2LMJ A;  1I81 A;  3VS6 A;  4EIK A;  1Q82 C;  2JNG A;  1D0Z A;  4KT0 E;  4BI4 A;  4WTO B;  2NWM A;  1TOV A;  3M0Q A;  3OS0 A;  1NBE B;  1YCS B;  3G6E Q;  1GCP A;  2EKO A;  2JZ2 A;  2K5F A;  1VQO A;  2OAU A;  3EGX B;  4RCB A;  4J5Y A;  1OUL A;  2COY A;  1VYU A;  3V7R A;  2CS7 A;  2RJC A;  4HXJ A;  1B34 B;  5FU7 C;  1YIT T;  1ZA2 B;  2EQK A;  2C0O A;  2E65 A;  2K3Y A;  2KRN A;  3E2U A;  2GQI A;  5GAO r;  4NL3 A;  2B86 A;  1TUD A;  2K79 A;  3NPF A;  1RI0 A;  4EMK B;  1SEM A;  1YJW T;  2VKN A;  1QVG P;  4TVR A;  2CH4 A;  2DFU A;  3PTA A;  3QZ5 B;  3OYA A;  1K9M U;  1FXX A;  1RLQ C;  2NUP A;  1G8X A;  4J9G A;  3CCU T;  1M3A A;  1T0J A;  2D8J A;  4PK4 A;  1ZBJ A;  3CCJ Q;  2E70 A;  4AFQ C;  3CC2 Q;  2YLB A;  1KQS S;  4CC2 A;  3CCL T;  1XJW B;  1S72 A;  2DKG A;  4M77 G;  5FWC A;  3WVD B;  2K2M A;  3N5B B;  4E2F B;  4M77 A;  3LGF A;  1VUB A;  4IIO A;  3KUF A;  1VQ9 T;  2OTJ Q;  3A8M B;  3EHR A;  5KE3 A;  1HK9 A;  2RHY A;  2H3J A;  1OZ3 A;  2LJ1 A;  2EQU A;  3PVQ A;  2YRV A;  1YHQ Q;  1X6B A;  1NYG A;  4M7D B;  3L2Z A;  3BY7 A;  4GLM A;  4GY5 A;  3VUZ A;  3JB9 J;  3CD6 Q;  2DPP B;  3HRS A;  2A36 A;  3CC7 Q;  2YT6 A;  3SEM A;  4OGC A;  2HSP A;  4M75 D;  2GGR A;  1BCM A;  3KBG A;  2CP7 A;  4FT2 A;  1YI2 A;  4QT7 A;  2MF2 A;  2YWW A;  3OBY A;  2ZPH B;  3T9N A;  1RAI B;  3EGX A;  3VU3 C;  3IQL A;  2KYM A;  1TSF A;  2F2V A;  1D3B B;  1B34 A;  1AZE A;  1LCK A;  4JDS A;  4PJL A;  2NUT B;  2XMF A;  3R6O A;  1B3Q A;  2OTL Q;  4BE1 A;  5LJ3 f;  1U1T A;  1UGQ B;  1WJQ A;  1QMC A;  4QQ6 A;  4BE2 A;  1OI1 A;  5D6W A;  1QKX A;  1Q7Y R;  2MMP A;  2L3R A;  4EMK A;  1WJR A;  2L3P A;  2FG0 A;  1SG5 A;  4M75 F;  2KRM A;  2RJD A;  2RPN A;  2RQR A;  3REA B;  2EJG A;  3JCM V;  1KD1 C;  4IKF A;  1E7O A;  4PKC C;  1BBZ A;  2D0N A;  2LT4 A;  6AT1 B;  3OYM A;  5DLQ E;  3NTK A;  3RKX A;  4FYX B;  4DBF A;  3EFO B;  4J9C A;  1MHN A;  2QDY B;  2KE9 A; 
#chains in the Genus database with same CATH homology
 5CCA A;  4RKU E;  2XG8 D;  2LDM A;  4C92 E;  3JCM f;  5GAN 7;  3JB9 F;  3FC3 A;  3L42 A;  3M4G A;  3OQ5 A;  4QVC A;  4FM4 B;  3JCM c;  3A8G B;  2QEX T;  4MMK A;  4C8Q B;  4X34 A;  5I2S A;  1QVG A;  2HD0 A;  1W4S A;  1WJS A;  1M9S A;  2K4Y A;  2VV5 A;  1JRI A;  4J83 A;  4X9C A;  5CAI A;  4OB3 B;  3LWI A;  2X4Y A;  4M7D C;  3CXC S;  4R56 A;  4M7D G;  4JLI A;  2L8D A;  3OYL A;  2M0O A;  3UPU A;  3JCM P;  1ZHI A;  3OYY A;  2QQA A;  5CKF A;  5LJ3 j;  3QDR B;  4XTY A;  4M7A B;  4PJO D;  2RHX A;  1VQ8 T;  2QQS A;  3QXE B;  4LDV A;  4ATO A;  4M7D A;  3I56 A;  4E7J A;  1VQ7 A;  1H64 1;  2CZ1 B;  2P4T A;  2YLC A;  5IT9 E;  4L59 A;  5CKE A;  3UWN A;  1KHC A;  3NFC A;  2E12 A;  3LYI A;  2OTL A;  3CCV T;  3JB9 H;  3JAM E;  5LJ3 g;  2D6F A;  4ELY C;  3QII A;  2FB7 A;  3JCM e;  3SFM A;  2KY9 A;  4FT4 A;  3LH0 A;  4HCC A;  2HBP A;  2V8J A;  3E19 A;  3L2V A;  4DOW A;  3CCU A;  1WNL A;  3X28 B;  1Q81 C;  4LDY A;  1M8V A;  2KK4 A;  4HKE A;  1UGR B;  4XTV A;  2EIF A;  1Y71 A;  4GLK A;  1LNX A;  1YJN A;  3RKY A;  2V8K A;  1N9R A;  1NPP A;  2E6N A;  2FVU A;  3FJP A;  4IUT A;  4M77 D;  3TCJ A;  3G4S T;  4J8O A;  3CCS A;  3CCQ T;  2QA4 T;  1KHI A;  3EFS A;  2DZC A;  3KXT A;  3ME9 A;  5LJ5 h;  1Q7Y U;  5FRM A;  4A53 A;  2LCL A;  1V29 B;  3ZFJ A;  5GAM f;  2A7Y A;  3LWH A;  3G71 A;  1N27 A;  4J7F A;  1XQH A;  4JRI A;  5DY9 A;  1VQ4 T;  1K8A U;  2E5Q A;  2O4X A;  3LW5 E;  3MEA A;  3OS5 A;  2LQK A;  4XU1 A;  3VYH B;  3OSS C;  4EDU A;  1M90 C;  2M1H A;  4ZGD B;  5KH6 A;  4XU0 A;  1VQM A;  2F5K A;  3QHS A;  1M1K C;  2RA2 A;  1VQ9 A;  3SD4 A;  3OMC A;  2ZPI B;  3HRT A;  1U8R A;  2HQE A;  1D3B A;  5CQX A;  2EWN A;  5J3B A;  1KQ1 A;  1TH7 A;  4PJO F;  2RB6 A;  3JCM g;  1VQL T;  1HXD A;  3J7A F;  3JB9 I;  3M57 A;  3OYJ A;  3TU4 K;  2DK3 A;  4QQG A;  4C92 B;  2DXU A;  4ZTF A;  1K73 C;  1K8A C;  3J81 E;  3TEE A;  4M7A E;  1BI2 A;  1XOV A;  3HL8 A;  4M75 B;  4QVZ A;  2KQW A;  3M53 A;  2QXF A;  2ZGW A;  3ZBD A;  4C0D B;  3JRZ A;  1QVF A;  2VGM A;  3UDC A;  1VQO T;  3PMT A;  2KAF A;  1WGS A;  2VGN A;  3GF5 A;  2NLU A;  3OYK A;  2AHJ B;  4JRQ A;  2E6Z A;  3HFO A;  4JLG A;  4C8Q A;  1KG1 A;  2PU9 B;  4N0A C;  5GAM e;  5GAO q;  2DTI A;  3A8O B;  4RG2 A;  5A2Q E;  5HK3 A;  2MI6 A;  4M78 C;  4E7K A;  2GFA A;  3LGL A;  3X26 B;  1Q86 C;  4M78 G;  2M16 A;  2QQB A;  3JCM Q;  4E47 A;  3M55 A;  4BI8 B;  4R55 A;  3JCM X;  1YIJ T;  4M77 F;  4J6Y A;  2DTO A;  2QQR A;  3P8D A;  5LJ3 h;  2DZ9 A;  5CO7 A;  3G7Z A;  1VQP A;  1KQ2 A;  4N0A A;  5GAO l;  3GOX A;  2HNI A;  1G3W A;  4FSX A;  4XU3 A;  3PGG A;  4MZT A;  4M78 A;  3OYN A;  4ZN1 A;  2EFI A;  2RHU A;  1ZQ1 A;  1QP3 A;  2QQ9 A;  2EJ9 A;  2RD1 A;  2JOY A;  2K3X A;  4XU2 A;  3RKW A;  4C8Q C;  2X4W A;  2RI2 A;  4F7U G;  4C8Q G;  5C0M A;  4FIB A;  2ZPE B;  1VQK A;  3MP6 A;  3MEW A;  3L1A A;  4OMF B;  3I55 A;  1VQ6 T;  3CCE T;  1KD1 U;  2LRQ A;  4LDW A;  2XI9 A;  3INZ A;  5CQY A;  2MWO A;  1YJ9 T;  3S3N A;  3H6Z A;  3QJ6 A;  4LDU A;  4IUR A;  2ZPF B;  1BIB A;  4QQD A;  2JN0 A;  4B9X A;  4BY6 B;  1G5V A;  3BDU A;  3OMG A;  5CR2 A;  4M7A G;  5D6X A;  3HRU A;  3CME T;  2DO3 A;  2LC4 A;  5GAM g;  4CI0 C;  3J80 E;  2GFU A;  3E9G A;  4OGE A;  5GMK i;  3DB3 A;  1S72 T;  1VQN T;  4P5N A;  3M54 A;  4M78 D;  4XK8 E;  5L8R E;  1U1S A;  2CZ7 B;  3OSV A;  2PVD B;  4DQ2 A;  4M7A A;  1QP2 A;  1BKB A;  1UB4 A;  3SDZ A;  2CKK A;  2RHZ A;  4M75 E;  1N8R C;  1NE8 A;  3E9F A;  2D9T A;  3JCM h;  1KC8 C;  2RK1 A;  2EYQ A;  2FL7 A;  3OYC A;  3OYI A;  1VIE A;  4O5V A;  2ZZD A;  2Y4Y A;  1W2B S;  2LCC A;  3MHX A;  3GPL A;  3CCR T;  2EJF A;  4IUU A;  4KBM B;  1AHJ B;  4C8Q D;  2KVQ G;  5GAN f;  2XKO C;  5GAN 2;  2LX9 A;  1YIT A;  5DM7 R;  3JCM W;  3BFM A;  3P8B B;  3C12 A;  3G6E T;  4E7I A;  3RER A;  2FYK A;  1K9M C;  1XTD A;  4ZTJ A;  3X25 B;  4MDW A;  3VKI A;  1W2B A;  2EQM A;  2WSE E;  3JCM J;  2FHD A;  1N9S A;  3CXC A;  3A8L B;  3FRN A;  2DIG A;  5GAO n;  4MZM A;  2DJZ A;  1YJW A;  2JTF A;  2WSC E;  4FU6 A;  4C5G A;  5FU7 B;  2C06 A;  3CBO A;  4OB0 B;  1M1G A;  3JCM d;  2P0P A;  1PSF A;  3CC4 A;  3M5A A;  1NZ9 A;  3AHU A;  2Y90 A;  4C5H A;  4BDZ A;  3S3O A;  3X24 B;  1Q81 U;  2MAM A;  1UEB A;  1MGQ A;  4OP0 A;  1WQ7 A;  3V8K A;  4C92 C;  2E1H A;  1O9S A;  1QVP A;  1Y07 A;  5J26 A;  4C92 G;  3OYE A;  1GXI E;  3X20 B;  2HQX A;  2K57 A;  4M78 F;  2RH2 A;  4A4H A;  5GAN d;  2K5L A;  4M75 C;  5GAN e;  1NJI C;  2IVW A;  2XDD A;  4BE0 A;  4M75 G;  2EAY A;  2XHC A;  4C0D C;  4HCB A;  3CCL A;  3FDR A;  4M7D D;  5EG2 A;  1FWZ A;  1I4K 1;  1YI2 T;  2BIV A;  4C92 A;  3QZ9 B;  2RM4 A;  1BI3 A;  1BI0 A;  4BUG A;  4VUB A;  4V2S A;  1VQ5 T;  3CCJ T;  3QUI A;  1M90 U;  4M75 A;  2GCX A;  5FRN A;  5GAM h;  2DTH A;  2XID A;  1VQ8 A;  3CC2 T;  4F7U F;  1M1K U;  4C8Q F;  2PVG B;  2RJE A;  3QSU A;  3GNG A;  1XNI A;  5CK9 A;  4L6V 5;  3CCM T;  1UGS B;  2F5T X;  4M77 B;  1BYM A;  3WXM B;  1H3Z A;  1Y96 A;  3S3M A;  1UGP B;  2GF7 A;  5FU6 B;  4IUP A;  5LJ5 f;  4A4K A;  2RO0 A;  2ZPB B;  4A4F A;  3CCV A;  3JB9 G;  3E1S A;  3PT9 A;  4OVA A;  4QW2 A;  3OYD A;  5GAN j;  3CBP A;  2DXC A;  4DOV A;  2QTX A;  5CKB A;  2ZCF B;  4JS5 A;  2RI3 A;  1I8F A;  5IN1 A;  2LNV A;  2WAC A;  5LL6 S;  4N4I A;  3QKJ A;  3SB2 A;  3RES A;  2RK2 A;  4C92 D;  4EMH A;  5HY6 A;  3A8H B;  5HKC A;  3L2R A;  4Z02 A;  3CPW S;  2OTJ T;  4XTW A;  2IG0 A;  2LQ8 A;  2DD5 A;  2D0Q B;  3CPF A;  4MML A;  5GAN g;  2E41 A;  5GAN 3;  1IZ6 A;  3CMA T;  3G4S A;  2RI5 A;  2XU8 A;  5CVI A;  4C0F A;  5GAM d;  3CCQ A;  4J6X A;  5FLX E;  3OYG A;  1YHQ T;  3NTI A;  2V8I A;  4PLI A;  4NL2 A;  3OS2 A;  1Q86 U;  1EIF A;  2R57 A;  3CPW A;  3M58 A;  4PJO E;  3GIB A;  3OYF A;  2Y4X A;  1DJ7 B;  3RIR A;  2QI2 A;  4C0Z A;  1VQ4 A;  3MP1 A;  4C5I A;  3LLR A;  3MP8 A;  4OF1 A;  4M7D F;  5GAN 4;  5I21 A;  4QVD A;  5GMK m;  5A0D A;  4YTL A;  3S6W A;  1JBM A;  3OYB A;  2KSS A;  4IUV A;  3L2W A;  3CD6 T;  3FLG A;  1YCY A;  3CC7 T;  2XD0 A;  2E64 A;  5D6Y A;  1VQL A;  2I2L A;  1I81 A;  3QBY A;  3HHT B;  1Q82 C;  3MCA B;  3F70 A;  2JNG A;  4KT0 E;  4BI4 A;  5GAM j;  3OS0 A;  2MWP A;  4O6J A;  3C4S A;  2VYT A;  3Q1J A;  2EKO A;  2R5M A;  2JZ2 A;  3OB9 A;  4BB7 A;  2K5F A;  3SWN B;  4M77 E;  1VQO A;  4N4H A;  2OAU A;  1G3T A;  3QYH B;  4RCB A;  4M7A C;  3MO8 A;  4CRI A;  4HT8 A;  2X4X A;  4J5Y A;  2BUD A;  2DXB A;  2ZPG B;  3DKM A;  3V7R A;  2CS7 A;  4C92 F;  2RJC A;  3DLL A;  5KE2 A;  1B34 B;  2GQV A;  5FU7 C;  5A0L A;  1YIT T;  3MET A;  2EQK A;  4Y28 E;  2CGH A;  1N8R U;  1KC8 U;  2E65 A;  2CZ0 B;  2K3Y A;  5GMK e;  3OYH A;  1I5L A;  5GAO r;  4NL3 A;  3O8V A;  3I56 T;  3VUB A;  4EPC A;  1VQ7 T;  2DD4 A;  1RI0 A;  4JRP A;  1LJO A;  5HK0 A;  3NTH A;  4EMK B;  1YJW T;  3C94 A;  3HPW A;  4D6W A;  2OTL T;  1JB0 E;  4ME7 A;  1N6A A;  3EFR A;  1WPY A;  3M4Y A;  4TVR A;  4PL6 A;  4Y91 A;  2XK0 A;  1QVG S;  3PTA A;  3QZ5 B;  2R5A A;  5GAN h;  3OYA A;  3CCE A;  1K9M U;  1VQ6 A;  1FXX A;  3V7C A;  5GAO m;  3P8H A;  2RJF A;  2VC8 A;  3JCM b;  3CCU T;  1YJ9 A;  1X6O A;  1M4Z A;  2PUK B;  4ZGJ B;  5AYF A;  4M7A D;  2JUF A;  3HP9 A;  5GMK j;  3HFN A;  2E70 A;  2RHI A;  3L2U A;  4F7U B;  3BW1 A;  2YLB A;  2XIC A;  5M9O A;  3RMS A;  3CME A;  5I2M A;  4EMG A;  1YJN T;  1KQS S;  3CCS T;  4KUD K;  4JS4 A;  4M77 C;  3CCL T;  1S72 A;  4RMO A;  1LOJ A;  2DKG A;  2KDS A;  3PFS A;  4M77 G;  3TRE A;  1VQN A;  5FU6 C;  4RCC A;  4PJO B;  2VXF A;  3VV0 A;  3WVD B;  1P92 A;  3G71 T;  3QG1 A;  4E7L A;  2DXT A;  4PNO A;  3N5B B;  4MDX A;  4OB2 B;  4ZGE B;  2K2V A;  1KQS A;  4ZN3 A;  2QEX A;  3CBM A;  4M77 A;  1VQM T;  1NJI U;  1G3Y A;  3LGF A;  1VUB A;  3LX7 A;  2K5I A;  2LTO A;  3KUF A;  4Q5W A;  5GAN 5;  1VQ9 T;  4N4G A;  3CCR A;  3A8M B;  2A3L A;  3OY9 A;  4LD9 K;  4KUI A;  1HK9 A;  2PUO B;  5KE3 A;  2RHY A;  2H3J A;  1OZ3 A;  2M9U A;  4L5G A;  4XTU A;  1OZ2 A;  3ER0 A;  3G6E A;  3OW2 S;  3UT1 A;  1OYX A;  2EQU A;  5GAN 6;  3L2Q A;  3GNF B;  4BAC A;  2YRV A;  4FL6 A;  2CYZ B;  4LD6 A;  4NS5 A;  2HAX A;  3M9Q A;  3QJY A;  4PLL A;  5IAY A;  5DLO A;  4C0G A;  4HT9 A;  5KCH A;  4M7D B;  2XDB A;  3L2Z A;  4A4E A;  3BY7 A;  4GY5 A;  3JSC A;  1R8O B;  3RUX A;  5C6S A;  3MEV A;  2KMT A;  5GMK l;  3OW2 A;  4M78 E;  3QO3 A;  3VUZ A;  3V7S A;  3JB9 J;  2P0K A;  4UC4 A;  1RL2 A;  4A54 A;  4E7H A;  4M7A F;  2DPP B;  3HRS A;  4A4G A;  1QW1 A;  1Q7Y C;  2XDP A;  4LDX A;  2X35 A;  2WSF E;  2VXE A;  1M5Q 1;  2JVV A;  4BD3 A;  4OGC A;  3OS1 A;  3ZEH A;  4NOY A;  3M56 A;  3OA6 A;  4RG8 A;  3CEY A;  4HA8 A;  4XQ3 A;  1VQP T;  3PMI A;  4M75 D;  4JUV A;  4F7U E;  4C8Q E;  2B8A A;  3A5Z B;  3KBG A;  2DIQ A;  3VJP A;  3FEO A;  2QA4 A;  4FT2 A;  1ZBX A;  2L5Q A;  3C95 A;  4BY6 C;  3SWN C;  1QVF S;  2VUB A;  1YI2 A;  3HSB A;  4J6W A;  1VQK T;  2LVM A;  5GAO p;  2MF2 A;  4IUQ A;  3I55 T;  2JTM A;  1VQ5 A;  2BKD N;  3OBY A;  3CCJ A;  2ZPH B;  3BDL A;  3CC2 A;  3V8J A;  4DA4 A;  1YBY A;  2O4X B;  2EQJ A;  3SWN A;  3T9N A;  5KCO A;  1BIA A;  2G3R A;  3FB9 A;  5CIU A;  3VU3 C;  3DB4 A;  5LJ5 e;  5LJ5 d;  3CCM A;  1VIF A;  3VYG A;  3GP8 A;  1FX7 A;  1X75 C;  4JRK A;  3QYG B;  2YHT A;  5GMK h;  3JB9 D;  1SSF A;  3DLM A;  3PIP A;  5CKD A;  2CZ6 B;  1Q82 U;  1Y96 B;  1D3B B;  1B34 A;  3FIF A;  3HKS A;  3PIO A;  4II1 A;  4JDS A;  2PQW A;  4EMK C;  1NPR A;  3R6O A;  3ASK A;  4B9W A;  4ELZ C;  4BDY A;  4BE1 A;  3H8Z A;  3OBW A;  1U1T A;  5LJ3 f;  4KUL A;  2X4J A;  2LT1 A;  2DVE A;  1UGQ B;  1WJQ A;  1Y7X A;  2E10 A;  4HCZ A;  4MZP A;  4XTZ A;  1BI1 A;  4QQ6 A;  5CKH A;  2OTJ A;  4BE2 A;  1OI1 A;  5A0G A;  1JJ2 S;  5D6W A;  4C5E A;  4M7D E;  3URG A;  1WQW A;  2MMP A;  3EAE A;  4XAX B;  1X01 A;  2L3R A;  4EMK A;  3RMQ A;  3CMA A;  2PVO B;  4WF2 A;  5LJ5 j;  1WJR A;  1M1F A;  4X9D A;  3PNW C;  1YHQ A;  5J39 A;  1K73 U;  2R58 A;  2P0Q A;  4M75 F;  4XTX A;  1JJ2 A;  4JJN K;  3V8L A;  2RJD A;  4OB1 B;  1YIJ A;  1G3S A;  1O75 A;  3MEU A;  1KD1 C;  2EJG A;  3JCM V;  4IKF A;  4PJO C;  2F69 A;  3WVE B;  4PJO G;  5LJ5 g;  4PKC C;  4F7U A;  2LT4 A;  3OYM A;  5DLQ E;  1IRE B;  3CD6 A;  3GLX A;  3NTK A;  3RKX A;  5FRO A;  1MHN A;  3M59 A;  4M78 B;  3CC7 A;  2O01 E;  1PSE A;  4BI3 A;  3QPH A;  2DEQ A;  4J7I A;  5LJ3 d;  4PJO A;  2L89 A;  5LJ3 e;  5GAN 8;  3CC4 T;  2QDY B;  2DAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...