2K5LA

Solution nmr structure of protein feoa from clostridium thermocellum, northeast structural genomics consortium target cmr17
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeoA
publication title Solution NMR Structure of Protein FeoA from Clostridium thermocellum, Northeast Structural Genomics Consortium Target CmR17
rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Structural genomics, unknown function
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k5lA00
2QQ9A 3MHXA 1G3SA 4O5VA 1FX7A 2QQBA 3GLXA 3HRSA 2K5IA 2LX9A 5CVIA 2H3JA 1BI0A 1FWZA 3HRUA 1QW1A 1QVPA 2K4YA 3HRTA 1G3TA 3E19A 1BYMA 2K5LA 1BI1A 1P92A 2QQAA 1U8RA 1G3WA 2K5FA 2GCXA 1G3YA 1BI3A 4O6JA 1BI2A
chains in the Genus database with same CATH superfamily
2KRMA 4QT7A 3JAME 1VQKA 1VQKT 4HT9A 3KUFA 2CYZB 1KC8C 1X69A 3EFRA 2XI9A 3L2QA 3TVTA 3X24B 5GAMe 2FYKA 4CI0C 3LGLA 4RMOA 5FWBA 5KE2A 2LZ6B 1OZ3A 2J6FA 5GANj 4FYXB 1N8RR 4M75B 1KSWA 2KQWA 2ZPEB 4L5GA 4PJMA 1QVGP 2RHIA 2LQ8A 1IREB 5A0DA 2GNCA 2PZ1A 2BE9B 2BZYA 1Q7YR 4AFZC 4J9GA 4OMLA 3THKA 2MF2A 5HK0A 5GAN5 3MEWA 2KAFA 3M0UA 2HKQB 3OYFA 2DTIA 1WHJA 1G3YA 3OYBA 2KE9A 4II1A 3GIBA 1X2QA 4QVZA 4KBMB 4DBHA 2H3JA 3HRUA 3RESA 1OOTA 4LD6A 1QQJA 5HK3A 4C8QG 2OX7A 2O9SA 4M77G 2EIFA 1M2OA 3SDZA 2D6FA 2QYZA 2X4XA 4N4IA 2GTOA 2DE0X 1K73C 3CPWA 2LCLA 5FU6B 1IZ6A 3HPWA 2JJ9A 4DBFA 3CCLA 2DF6A 3ULRB 3I56Q 4HXJA 1YITT 1GFDA 2FPFA 3LGFA 1TUCA 2SRCA 5KCHA 1YHQT 4FU6A 5KYUB 2FRYA 1OULA 4EPCA 2EGAA 4C92F 1VQ7Q 1YFNA 1F1BB 1N8RU 3EAEA 3NMZC 2QA4Q 1GCQC 2QGFB 3CMAA 2VV5A 2YXYA 2BUDA 4Z89A 3KBGA 2MPXC 3KXTA 3RUXA 1Q7YU 4ELZC 2ZCFB 2RI5A 2RQTA 4JRKA 4RTXA 1B07A 4KUDK 2RJFA 4HCKA 3ZBDA 5CAIA 1N9RA 1QW1A 1M1GA 1PWTA 5GAOp 1VQNQ 1VA7A 1W2BP 1M1KC 2RNAA 4J9FA 3ZFJA 2K5LA 3VS4A 2D8JA 2EQKA 4O6JA 3CXCA 2IIMA 2K3BA 4R56A 3M0SA 5FU7B 3DKMA 2ROTA 1FYNA 1ZSGA 2COWA 2FPEA 1VYVA 2CDTA 4Z88A 4YTLA 4ZGEB 3QJ6A 2VXEA 4ZGJB 2X4JA 4E7IA 4QQGA 3A98A 1G3SA 5GANe 1FXXA 2XDDA 1TXQA 1WGSA 3JCMP 4ME7A 5HCKA 2DL4A 1RAGB 2GQIA 1W2BS 2ZPHB 2V26A 3OYYA 3FRNA 1M90C 2EYXA 2YRVA 2MMPA 1C0MA 2F2XA 5EC7A 2O31A 1U8RA 1EFNA 1LNXA 5LJ3f 3ME9A 4BI4A 5GMKm 2E6ZA 3I56T 3MP8A 3VS1A 1UE9A 2YUOA 2G6FX 1GFCA 2E6NA 4C5IA 1CSKA 2CZ0B 3JB9G 5KYYA 4BI8B 2FZCB 5KYWA 4A4HA 3OSSC 1ZBJA 2HBPA 2LQNA 4C0DB 2DZ9A 4PNOA 8AT1B 1VQ7T 4M78D 2K7AA 1BI3A 4M78E 2LMJA 3M55A 2PU9B 4M75F 1R0BG 1WIEA 1H92A 3NPFA 3URGA 5GMKh 2QG9B 4E7KA 2VXFA 1UHFA 3QDRB 4L6V5 3CC4Q 3EG2A 4C5EA 4M75D 2LP5A 4M7DF 4CC2A 3PMIA 4AT1B 3CEYA 5LJ5d 5GAN3 1D0ZA 3OYGA 3CCRQ 5IXFA 1VQNT 2E5KA 3BE3A 4C8QA 4CRIA 3VYGA 1HD3A 5GAMf 2B86A 2ZPFB 1WHMA 4M77A 1G2BA 2MIOA 3OYAA 4E2FB 1S72A 4J83A 2CS7A 2HEQA 4X9DA 2I2LA 3BY7A 2LNHB 1VQOA 1YWOA 2Y4XA 3GF5A 1VQOT 3CBMA 1PRMC 2F69A 2RN8A 3QUIA 2CGHA 3JB9I 3F70A 3EFSA 2DRMA 2K57A 2JNGA 1VOMA 3G71Q 2YHTA 2LQWA 1M3BA 1HK9A 1JQQA 2X4WA 4BY6C 5KH6A 5KYXA 2VB6A 4LN2A 1YP5A 4XTVA 4XK8E 4F7UB 1SSHA 2CSIA 3PIPA 2KXCA 4ZNXA 1VQ5Q 4JZ3A 5J3BA 4X9CA 3S3OA 3M56A 1HJDA 2JXBA 1RADB 2XIDA 4R0KA 1UGRB 1X01A 1X6OA 2ZAEA 5KYNA 1NYFA 5CCAA 1R8OB 2EBPA 1UDLA 1SHFA 3I9QA 3CCVA 4BY6B 1WPYA 4PK4A 5A2QE 3UPUA 1PKTA 5LJ5h 3SEMA 4OB1B 3L2RA 3QYGB 3CQTA 1KC8R 1WHHA 4FW1A 5J26A 1BB9A 3QYHB 3SWNC 4EMHA 1Q81U 2A08A 4E7ZA 2VGMA 3JCMd 2JTFA 3BDLA 2CH4W 2K2VA 1VQ4Q 2KSSA 4AG1C 1Y96B 1WXUA 2XDBA 2GGRA 2K79A 4CC3A 3CC4T 3CCEQ 2E4HA 2NLUA 1BCOA 3L2ZA 1V29B 4DEXA 2A28A 4IUQA 2EKOA 4J9BA 3SWNB 1H3HA 3I55A 3NTKA 3CCRT 2JVVA 3LW5E 3I55T 3OS5A 2DEQA 2FO0A 2HKNA 2COYA 5I2SA 1CKBA 1M8VA 3PIOA 3UATA 2LDMA 3GBQA 4LDVA 3V7RA 3CCSA 1KHCA 4E47A 1LCKA 1TU0B 1QVFA 1KQ2A 2KY9A 2CP5A 3KFVA 3ER0A 3X25B 3J80E 3OYEA 2DRKA 4L59A 2HL3A 2WSEE 1GCPA 3A1PA 4C92C 2HZYA 4HVWA 1TOVA 1YIJA 3M0QA 1MNDA 2L8DA 4NL3A 3I5SA 4TVRA 2LCCA 3JCMc 2VGNA 2MAMA 4KGXB 3OS2A 4KGZB 4DA4A 1MMNA 2MWPA 1KIKA 4JRQA 1M27C 3GNGA 1KC8U 1WQWA 1AWOA 2PQWA 1VQ5T 1K1ZA 3RNJA 8ATCB 1NLPC 3I35A 4IURA 4RKUE 2GQVA 3OMCA 2HSPA 2YUQA 1Q82R 1JRIA 5L8RE 2EQIA 4M78G 2C0IA 3A8LB 1D1BA 4HCZA 2DEUA 3NFCA 2DNUA 1NPPA 2CP7A 2RMOA 1ZQ1A 4XTWA 1FWZA 1VQ4A 1C1AA 1VQ4T 1TUGB 1TG0A 1YJ9Q 3V7CA 3VRYA 1B34B 3PMTA 4Y91A 4AG2C 4OP0A 5GJWB 3VS3A 3CD6Q 3CCET 4FT4A 1UB4A 2QQSA 1T3SA 2CP3A 3CCJQ 4RG2A 2EJFA 2DO3A 2E1HA 3M59A 4LD9K 2RI3A 1SF9A 2QXFA 3DB3A 3NTIA 4F04B 2RPNA 2M0YA 2RHZA 1SHGA 1MNEA 1K73U 3EGDA 2K3YA 2V8JA 2KMTA 2E41A 1VQ6A 1PG5B 2KI7A 2EYQA 4JJDA 5I2MA 1YI2Q 4J7FA 3OW2S 2YDLA 4MZTA 1M8MA 4RUGA 3SB2A 4A4GA 4LNPA 4ESRA 1KQSP 3M53A 1JXOA 4N4GA 2H8HA 2AKKA 4AMCA 1U1TA 2FVUA 1X27A 2HL5C 2CUBA 2FRWA 2YUPA 3FEOA 4ZN3A 5GAN2 5D6YA 4M75C 5IN1A 3LH0A 2P0PA 1Z9ZA 3MKDA 3FLGA 2EYWA 3QZ9B 2RQWA 2MCNA 1UGSB 4F7UE 1PD1A 1K9AA 2VWFA 2CZ1B 1K0SA 1M2VA 3M4GA 4BDYA 1XNIA 1QWEA 2MWOA 4M7DC 1NEBA 5GMKi 3OY9A 1MHNA 1OPLA 3X28B 2MI6A 1LJOA 3EG9A 3FDRA 4C0ZA 1R0CB 1KQSS 2L3SA 2DETA 2QQ9A 1VQ8Q 3EGUA 1M1KU 4ELYC 2KGTA 3PE0A 4M7DB 4JLIA 1VQLQ 2NUTB 3C0CA 1ABOA 3TEEA 4A54A 2RB6A 2DXCA 4C5HA 3LX7A 2BE7D 3P8HA 4ATOA 2CH4A 1EZZB 2D9TA 4BD3A 1VQ9A 4PJNA 2F5TX 2DAQA 2NUPA 2OJ2A 5FU6C 4GY5A 1VQ9T 1YJ9T 1KG1A 3C95A 2RJDA 2EGCA 1ZHIA 3CD6T 3BDUA 3JB9H 2BZ8A 2XU8A 5GAOr 4EMKC 4OB2B 3CCJT 5DLOA 1QVGS 1QP3A 3HTRA 2W0ZA 3CC2Q 2RQUA 2QQBA 1M90U 2DXUA 5EG2A 2OTJQ 2IVWA 3EGXA 3R6NA 4QVCA 2BTTA 1ZSZA 4M7AF 1WFWA 2E10A 1YITA 1EIFA 1YI2T 3JCMb 3OBWA 1LPLA 1YHQA 5CKHA 4EMKB 1BI1A 4E6RA 1B7TA 3O8VA 2JN0A 2DMOA 1OU8A 3M4YA 4ZTJA 1U3OA 4FSSA 2ATCB 5IHKA 4M78A 2YLBA 1GL5A 4PJOF 3EG1A 2GBQA 2RK1A 4Y92A 5DM7R 4IUPA 3GPLA 4LDYA 3HRTA 4PFOA 3VKIA 1WJSA 4DQ2A 1WXBA 4X1VA 1AD5A 3LLRA 4OVAA 1BYMA 1S1NA 1U1SA 4DEYA 3HHTB 1D3BB 4C92D 4C92E 3EG3A 2KYBA 3OYMA 2RD1A 4KUIA 3UA6A 1PRLC 2J06A 1XOVA 1PHTA 2L2PA 1RAIB 4XU1A 2F2VA 5FU7C 1AEYA 1PM3A 4E7JA 1H3ZA 3OS1A 2PVOB 3O5ZA 3MEUA 1D0YA 1WQ7A 1VQ8A 4FCYA 1ABQA 2V1QA 3EH2A 1Q86C 1VQ8T 2D1XA 3UT1A 3UA7A 4OMMA 2LT1A 1NLOC 3M0RA 2DK3A 5CR2A 4OGEA 2JTEA 1WHLA 1VQLT 2DIGA 2YRDA 3TU4K 3Q1JA 1YWPA 4PJJA 1P92A 2CKKA 4AFSC 2EJGA 3VS0A 1AWWA 1BCMA 4MMLA 1QVFP 4J6XA 4XTXA 4M77B 3WVDB 4A53A 3ZEHA 4DBQA 1OYXA 3HP9A 4XU2A 3CC2A 5GAN6 4PLIA 3CC2T 3NGPA 1OU9A 4C0DC 3QG1A 2RQVA 5KYUA 2NWMA 3TSZA 1AOJA 3D7SB 4IKFA 2OTJT 2O01E 3CBPA 1VQPQ 3H0FA 3I56A 2WSCE 2CZ7B 3H0HA 3CCQQ 2F5KA 3OYDA 2C0OA 3REAB 4HCBA 1SSFA 1YNZA 2EKHA 1GBQA 2O4XB 3PVLA 4MZMA 4F7UG 1QVFS 2QGGA 5GMKj 3T9NA 1R77A 2DXTA 1VQ7A 3M58A 5KYXB 1HYOA 3H41A 4EDUA 2LRQA 4BUGA 2QA4A 3HRSA 2DYIA 3M0PA 2QA4T 2O88A 2DPPB 1NEGA 3MEVA 4QQDA 1UGQB 4GLMA 2AT1B 3TCJA 1GCQA 2JS0A 2LJ3A 1EX4A 4M75E 1PD0A 3OYNA 5I22A 1LOJA 2FB7A 4O5VA 1K4US 1Q81R 1N9SA 4E7HA 2CT3A 1VQNA 1IHWA 2EW3A 3QIIA 1M5Q1 1E6HA 4HKEA 1YJNQ 1TH7A 2Y90A 4X34A 3V8JA 4M7DD 2L3QA 4M7DE 4J5YA 2CUDA 2RO0A 2DFUA 1Y71A 2CP0A 2DXBA 2RHYA 4LDUA 1XTDA 1I5OB 1ZBXA 4J8OA 2IG0A 2RJCA 4EMGA 4XTZA 2V8KA 2JM8A 3HKSA 1I1JA 1IB8A 2RHUA 3OYCA 2C0TA 1WXTA 5A0GA 2GTJA 5LJ3d 2JTMA 4K11A 2JS2A 1AT1B 1V1CA 1RAFB 3E19A 1B3QA 2DL3A 2DTHA 1JO8A 3M9QA 4OMOA 3ZL7C 4A63B 5C6SA 1HXDA 2K6DA 4QW2A 3L42A 1UGPB 1KD1C 2ESWA 1VYTA 3C12A 2OTLQ 2DBKA 2R5AA 2YSQA 2DILA 3I5RA 4Q5WA 1W70A 2EGEA 3UWNA 1G3TA 5LJ5j 1VQPT 3CCQA 2DJQA 3G6EQ 3MP6A 3CCQT 4LUEA 3SHWA 3L2WA 4BI3A 4R55A 4Z8AA 1K8AC 5LJ5g 1UGVA 4RTZA 3RERA 1O9SA 2A37A 3GP8A 2RJEA 4FYYB 4C92G 2GF7A 4BDZA 3CBOA 5GAMd 1YJWQ 3CCUQ 2M0OA 5CKEA 1TSFA 7AT1B 2HCKA 2VC8A 3A5ZB 3RMQA 2XHCA 2XICA 3CC7Q 4IUTA 3CC4A 4WF2A 1D09B 1NYGA 1SRMA 2LX9A 1FMVA 3TREA 2YWWA 1MGQA 1BIAA 3PFSA 2I0NA 5D6XA 5FRNA 4RG8A 1ZA2B 1OZ2A 2ZZDA 3VJPA 3CCRA 3RBBB 2DKGA 3PVQA 5CQYA 1YJNT 2ECZA 2GFUA 5GMKe 3JCMX 2R5MA 1ZUYA 4M7AC 3BW1A 2CSQA 1AZEA 4AFUC 2JM9A 2KT1A 3G4SQ 1JJ2A 4C8QF 2EQUA 2HD0A 1QCOA 2EVRA 2QI2A 3CCMQ 4J9CA 4M77F 2P4TA 1I0CA 3A8GB 3M0TA 1OI1A 1WNLA 3A8HB 4P5NA 1RI9A 1SG5A 3CPWP 4PJOC 1K9MC 3VRZA 3CPFA 2PTKA 2O9VA 1SPKA 2E3HA 2C06A 1H8KA 5I21A 1I4K1 4F7UA 2A7YA 1K73R 4OMNA 4M7AB 4C0GA 3G71A 1UECA 1N27A 3G71T 2CREA 3EFOA 3JCMg 3EGDB 2VYTA 1DJ7B 4V2SA 2AZSA 1MMGA 3OBYA 5GAMh 2P84A 2OTLT 3JCMh 4HA8A 2X3WD 3G7ZA 4PJOB 4D8KA 1VQ5A 1K0XA 3MP1A 1QKWA 1D1AA 5CKDA 3OB9A 1VQMQ 2NYSA 5HY6A 1VQKQ 2QEXQ 3G6ET 3CPWS 4ZGDB 5GAOm 3LH5A 3FJPA 4IUUA 1RUWA 1W4SA 2LC4A 3DB4A 1QMCA 4OMFB 4GBQA 1BI2A 3EH1A 5GAOl 3MEAA 5AYFA 2E64A 1WDXA 4HVUA 1M2VB 3CCUA 1A0NB 1WJQA 1YJWT 3CCUT 2K4YA 4M75G 2DYBA 1HSQA 2P0KA 3OYKA 1WX6A 3SWNA 3JCMJ 5CK9A 3CC7A 3CXCP 1TTHB 3FJ5A 3INZA 2FEIA 4FL6A 1GBRA 3EG9B 3CC7T 1M1KR 2ED0A 3CCEA 1Y57A 1FMWA 5LJ5e 1RLQC 1BKBA 2OAWA 4M7DG 1WA7A 3JB9J 1Y0MA 3PNWC 5FROA 4FM4B 1M4ZA 4J9EA 4N0AA 1QVPA 2JW4A 1H641 3E9GA 1O75A 1RLPC 3UF4A 1PSEA 2LJ1A 3SFMA 3N5BB 1JU5C 2DVEA 1KQ1A 3G4ST 1UJ0A 2WSFE 3QO3A 4Z02A 5GANd 3CCMT 2KDSA 3S3NA 4MDWA 5ECAA 4XTYA 3CXCS 2RHXA 2CP6A 4F14A 3PTAA 1J3TA 3M54A 1NJIC 3A8MB 3LWIA 4JJNK 3CCLQ 1M90R 3TSWA 4BACA 3E1SA 1VIFA 1RAEB 3UDCA 4C92A 3RKYA 2X51A 3JB9F 3X26B 1RACB 3EGXB 4RTTA 1QKXA 2BIVA 4MDXA 1ZSZB 3NHNA 2DLPA 3EHQA 1UG1A 2LX7A 4BE0A 4D8DA 2LVMA 3S3MA 2HBWA 2M02A 1D0XA 2DVJA 3JB9D 2HQEA 2KRNA 4BB7A 2M1HA 3CMAQ 2M9UA 2X3XD 4OB0B 1VQMT 2VUBA 2QEXA 4M78B 2KROA 2GFAA 1YCSB 5IAYA 2X9HA 2QEXT 3GLXA 2QAZA 4JDSA 2WACA 1Q86U 4KRTA 2SEMA 1RL2A 5FRMA 3RMSA 3JCMe 2VVKA 3U23A 2XMFA 3PGGA 4CC4B 3VS6A 1B34A 2YRCA 5C0MA 4XU3A 2HAXA 2FZKB 1WZOA 2IPOB 4BE1A 4FIBA 1X43A 2H3EB 2F2WA 4FW2A 5GANg 4RTYA 3G1JA 2KT8A 2RM4A 5CVIA 1YJ9A 5GANh 4A4FA 1PKSA 2XDPA 1E7OA 1KHIA 3CD6A 1JBMA 2DZCA 2J7IA 3DLMA 1N6AA 1RAAB 3CCJA 3PT9A 2E70A 1NPRA 4B9WA 5CKFA 1KJWA 1MV3A 2VKNA 1X6BA 2RA2A 4XTUA 3SD4A 4OGCA 1TUDA 2CP2A 4FYVB 3VS5A 5CO7A 3OA6A 2EWNA 1AZGB 4DOWA 3RKWA 1YI2A 1JEGA 1W6XA 5IT9E 1OQKA 2P0QA 2OI3A 3GNFB 3H8ZA 3J7AF 2GCXA 1MMAA 3OYIA 3WXMB 2E5QA 4UC4A 4FT2A 2VASA 2E3IA 4QQ6A 4M7AD 1KD1R 4RTVA 4M7AE 2L3RA 1QCNA 2A36A 4J6WA 3CCLT 5D7UA 2QK0A 3QXEB 2RQRA 3VUZA 2KK4A 2MK5A 2AKLA 1AVZC 4PJOD 4ZN1A 3QDFA 1E6GA 4NS5A 1I5LA 1CKAA 4PJOE 1ARKA 4M75A 4B9XA 4WTOB 4JRPA 2AIRB 3OQ5A 4EIKA 1M3AA 4RCCA 4HVVA 4RTUA 1K8AR 3JSCA 1Q82C 3QWYA 3JV3A 2DX1A 5KYYB 1SRLA 3CMAT 2LJ0A 1AHJB 5KYWB 4M7DA 1I8FA 5FWCA 2NUTA 4PKCC 3RR6A 4GLKA 2QQAA 4M4ZA 3AT1B 2R58A 4J9DA 2EAYA 2KNBB 4E7SA 1C6VX 1T0JA 4C8QC 4JUVA 3FIFA 2DA9A 4M77C 2YT6A 1V76A 3BFMA 5CIUA 2RK2A 1VQLA 3OYLA 2HDAA 1YN8A 1SEMA 1ZLMA 1OX8A 1RAHB 1M9SA 3ASKA 1Y7XA 2ZGWA 4E7LA 1PNJA 2MYSA 3OW2A 4KH0B 5DY9A 4A4KA 4KULA 2DD5A 2L89A 2DBMA 1S72Q 3JCMW 1JJ2P 1X6GA 1FX7A 2EPDA 4C8QB 1QWFA 3EHRA 1VQOQ 5J39A 3HFNA 3QHSA 4BE2A 4PLLA 3RKXA 2F1LA 4J9IA 2PVDB 1KD1U 4F16A 1UFFA 5LJ5f 4HCCA 5KCOA 4EMKA 1QCFA 1NG2A 3V7SA 2OTJA 1ZA1B 4OMPA 2J6OA 1K9MR 2AZVA 4PJLA 4NOYA 1YCYA 2DL5A 2QDLA 2ENMA 2KXDA 1VUBA 2DERA 2A3LA 2XKOC 2DL8A 1Z9QA 4A4EA 1KQSA 1K8AU 1JJ2S 2AK5A 1MMDA 2A0FB 1M1FA 3LWHA 1D3BA 1UJYA 1U06A 2B8AA 1M3CA 1PCXA 1QP2A 2FHDA 4KH1B 4M78F 3CCVQ 1BU1A 3H0IA 2DTOA 2NUZA 4FYWB 5GMKl 2E65A 1NBEB 1N8RC 4XQ3A 1NM7A 3MCAB 2HMAA 2ROLA 4IUVA 3QWXX 1WI7A 1Q7YC 1D1CA 5LL6S 1N5ZA 2LNVA 1QVGA 2QASA 4QKUA 2BKDN 2DM1A 2BZXA 3VU3C 3QKJA 2PNIA 2FZGB 3QPHA 1X75C 2RH2A 1TS9A 2QTXA 2HNIA 2EQJA 5IH2A 2O2OA 4ZTFA 4C5GA 3NTHA 3I55Q 1VIEA 1SKUB 1WYXA 3JCMf 2QTVA 1Q95G 1AWXA 2HQXA 2KRSA 4RTWA 1NZ9A 1WLPB 3OSVA 1KFZA 2LTOA 1K9MU 1GRIA 3CCSQ 2L3PA 1IHVA 3VS7A 1S72T 1T0HA 4WCIA 5IHIA 3MJXA 2LT4A 4KT0E 3M57A 4PFZA 3C94A 4JJCA 3JCMQ 1M30A 2D0QB 3VS2A 4JS5A 5GAN8 5HKCA 4ORZA 2K3XA 3EG0A 4LE9A 2MOXA 1FMKA 4CC7A 1OX9A 3C4SA 1YIJQ 5FLXE 2X4YA 1UEBA 1BBZA 4F17A 2Y4YA 5CKBA 1VQPA 2ZPIB 2M51A 1IGUA 2KEAA 1OEBA 2O4XA 5KE3A 1NJIR 2K5FA 4M7AG 1NE8A 1WHGA 4OMQA 1W1FA 3MPUB 2PUKB 2DJZA 1G83A 5IHNA 3RDVA 1LVKA 1UTIA 1YBYA 4KGVB 3R6OA 4JRIA 4J9HA 3EFOB 3M5AA 2QQRA 4PJOG 2QDYB 5GJVB 4XAXB 1IGQA 4LDWA 5IXBA 3E2UA 5LJ3j 1I81A 4DOVA 1G5VA 1RABB 3MHXA 3CCVT 2RI2A 4AFQC 2FG0A 5GAOq 3CMEQ 2KYMA 2DD4A 1JB0E 5LJ3g 3OMGA 2AHJB 2COZA 5L23A 2W10A 2HQHA 4MMKA 5LJ3h 4JZ4A 4JPBW 1BK2A 3VYHB 2ZPGB 1IXDA 2DIQA 2J6KA 2KVQG 4XU0A 2ABLA 2HSEB 1W2BA 1YJNA 1Y07A 4DBRA 3OS0A 4B6MA 3A8OB 4N0AC 2K5IA 4J6YA 3TQ7P 2JUFA 5A0LA 2KBTA 2LQKA 5D6WA 2CT4A 4JS4A 2ZPBB 4MZPA 1XJWB 2RF0A 4J7IA 2EFIA 2OAUA 3QZ5B 5DLQE 2PUOB 4C8QD 1RI0A 4C8QE 1TWBA 1JXMA 1VQ6Q 4M77D 4M77E 2XG8D 1IO6A 5GAMj 1NJIU 3CCST 4FSXA 4ANJA 3GOXA 1BIBA 2EYYA 2X35A 3HFOA 5AT1B 3META 5GAMg 6AT1B 1MV0B 3V8KA 3REBB 2D8HA 2R57A 3E9FA 2OTLA 3AHUA 1X2KA 4QVDA 3DLLA 2XK0A 4JJBA 2JMAA 2L5QA 2FL7A 3S6WA 1YIJT 2K9GA 2J05A 1AWJA 3G6EA 3IQLA 3OYJA 2ED1A 2KR3A 5GANf 2V8IA 3JCMV 4Y28E 3VV0A 5I11A 3L1AA 1VYUA 4C92B 1K76A 1Y96A 4C0FA 4LXCA 5GAOn 4PFPA 2JMCA 2FPDA 3L2VA 1U5SA 1YJWA 4N4HA 3RIRA 2CZ6B 4VUBA 3X20B 4NL2A 3CMEA 1Q81C 3CMET 2EJ9A 1Q86R 3QSUA 3QBYA 2Z0WA 1GXIE 3FB9A 5CQXA 3P8BB 2L0AA 3J81E 4JLGA 3H6ZA 9ATCB 2D0NA 3OW2P 1UHCA 3VUBA 1QLYA 3FC3A 3QJYA 1VQ9Q 1ZUUA 2G3RA 2YUNA 1G8XA 4OB3B 3V8LA 2P4RA 2K2MA 2EQMA 2EYZA 3LYIA 1OPKA 1T3LA 1G3WA 1XQHA 3G4SA 4LUDA 3CCMA 1OV3A 2JZ2A 1ZUKA 1PSFA 3HL8A 1ACMB 2NUPB 5LJ3e 1BI0A 3OYHA 4M7AA 1ZSZC 4HT8A 1PC0A 3P8DA 2XD0A 2JOYA 3MO8A 1VQ6T 3L2UA 2PVGB 4IIMA 4LDXA 5M9OA 1YITQ 2E12A 1KK7A 5FW9A 2V1RA 4M78C 4PJOA 1YHQQ 1ZX6A 1MUZA 1WHKA 3HSBA 2M16A 1WJRA 4OF1A 3JRZA 2YLCA 5GAN4 4PL6A 4F7UF 1UUEA 4IIOA 1I07A 4RCBA 5GAN7 4D6WA 2LCSA 3WVEB 2DL7A 2JT4A 3H9NA 1Q82U 1IRXA 1VQMA
chains in the Genus database with same CATH topology
3JAME 2RHUA 3OYCA 1VQKA 1YIJA 4C8QC 4JUVA 3FIFA 1VQKT 2L8DA 5A0GA 4HT9A 4M77C 3KUFA 4NL3A 4TVRA 2CYZB 2LCCA 3BFMA 2RK2A 2XI9A 3EFRA 5CIUA 3JCMc 5LJ3d 3L2QA 1VQLA 2VGNA 2MAMA 3OYLA 3X24B 2JTMA 3OS2A 5GAMe 2FYKA 4CI0C 1M9SA 3ASKA 4DA4A 1Y7XA 2ZGWA 3E19A 3LGLA 4RMOA 4E7LA 5KE2A 1OZ3A 2DTHA 2MWPA 3M9QA 3OW2A 5DY9A 5GANj 4JRQA 4A4KA 5C6SA 3GNGA 4M75B 4KULA 1KC8U 1WQWA 1HXDA 2DD5A 2L89A 3L42A 4QW2A 1UGPB 2KQWA 1KD1C 3JCMW 2ZPEB 2PQWA 4L5GA 3C12A 1VQ5T 1FX7A 4C8QB 2R5AA 2RHIA 2LQ8A 1IREB 4IURA 4Q5WA 4RKUE 3HFNA 5A0DA 5J39A 2GQVA 3OMCA 3QHSA 4BE2A 1JRIA 4PLLA 3RKXA 3UWNA 5L8RE 1G3TA 4M78G 2PVDB 1KD1U 5LJ5j 3A8LB 1VQPT 3CCQA 2MF2A 5LJ5f 4HCCA 5HK0A 1VQMA 5KCOA 5GAN5 4EMKA 3MP6A 3MEWA 3CCQT 2KAFA 3OYFA 3V7SA 3L2WA 2DTIA 4HCZA 1G3YA 3NFCA 4BI3A 4R55A 3OYBA 1K8AC 2OTJA 4II1A 5LJ5g 3GIBA 1NPPA 4QVZA 3RERA 4NOYA 4KBMB 1YCYA 1O9SA 3GP8A 1VUBA 1ZQ1A 2H3JA 4XTWA 1FWZA 3HRUA 2RJEA 3RESA 2A3LA 1VQ4A 2XKOC 1VQ4T 4A4EA 4C92G 2GF7A 4BDZA 4LD6A 1KQSA 5HK3A 3CBOA 1K8AU 5GAMd 4EMGA 3V7CA 1JJ2S 2M0OA 1B34B 5CKEA 4C8QG 3PMTA 4Y91A 1M1FA 4OP0A 2VC8A 4M77G 2EIFA 1D3BA 3A5ZB 3LWHA 3CCET 3RMQA 2B8AA 2XHCA 3HKSA 4FT4A 3SDZA 2XICA 2X4XA 1UB4A 4N4IA 2QQSA 2D6FA 1K73C 4IUTA 3CPWA 1QP2A 2FHDA 3CC4A 4RG2A 4WF2A 2EJFA 2DO3A 2LCLA 2LX9A 2E1HA 3M59A 4M78F 5FU6B 3TREA 1MGQA 4LD9K 1BIAA 2RI3A 1IZ6A 3PFSA 3HPWA 3CCLA 2QXFA 3DB3A 3NTIA 5D6XA 2DTOA 5GMKl 5FRNA 2RHZA 2E65A 1YITT 1N8RC 3LGFA 4RG8A 1OZ2A 2ZZDA 1K73U 2K3YA 2V8JA 2KMTA 2E41A 4XQ3A 3MCAB 3VJPA 5KCHA 3CCRA 4FU6A 2DKGA 1YHQT 1VQ6A 4IUVA 2EYQA 5I2MA 5CQYA 1YJNT 4PJOE 4J7FA 2GFUA 5GMKe 3OW2S 4EPCA 3JCMX 4MZTA 2R5MA 3SB2A 4C92F 4A4GA 4M7AC 3BW1A 1Q7YC 1N8RU 3EAEA 3M53A 4N4GA 1JJ2A 4C8QF 2EQUA 2HD0A 2QI2A 5LL6S 2LNVA 1QVGA 1U1TA 4M77F 3CMAA 2P4TA 2BKDN 3A8GB 2FVUA 1OI1A 3VU3C 2VV5A 1WNLA 2BUDA 3QKJA 3FEOA 3A8HB 3KBGA 3QPHA 4P5NA 4ZN3A 5GAN2 1X75C 4M75C 5D6YA 3KXTA 2RH2A 5IN1A 3RUXA 1Q7YU 3LH0A 2P0PA 4ELZC 4PJOC 1K9MC 3FLGA 2ZCFB 2QTXA 3CPFA 2HNIA 2RI5A 2EQJA 3QZ9B 4JRKA 1UGSB 4F7UE 4ZTFA 4C5GA 2RJFA 3NTHA 2C06A 4KUDK 5I21A 1VIEA 3ZBDA 5CAIA 1N9RA 1I4K1 2CZ1B 2A7YA 4F7UA 3JCMf 1QW1A 1M1GA 4M7AB 4C0GA 3M4GA 4BDYA 3G71A 5GAOp 1N27A 1XNIA 2HQXA 3G71T 1NZ9A 2MWOA 4M7DC 3OSVA 2LTOA 1K9MU 1M1KC 3JCMg 5GMKi 2VYTA 1DJ7B 3OY9A 1MHNA 3X28B 1S72T 2MI6A 3ZFJA 4V2SA 1LJOA 2K5LA 2LT4A 3M57A 4KT0E 3OBYA 5GAMh 2OTLT 3JCMh 4HA8A 3C94A 3JCMQ 3FDRA 4C0ZA 2EQKA 1KQSS 2D0QB 4O6JA 3CXCA 3G7ZA 2QQ9A 4JS5A 4PJOB 5GAN8 5HKCA 1VQ5A 3MP1A 4R56A 2K3XA 5CKDA 1M1KU 3OB9A 4ELYC 5FU7B 5HY6A 3DKMA 3C4SA 5FLXE 2X4YA 3G6ET 3CPWS 4ZGDB 1UEBA 5GAOm 4M7DB 4JLIA 3FJPA 2Y4YA 5CKBA 4YTLA 1VQPA 4IUUA 2ZPIB 4ZGEB 1W4SA 2LC4A 2O4XA 3QJ6A 3TEEA 3DB4A 5KE3A 4A54A 2RB6A 4OMFB 2K5FA 2VXEA 1NE8A 2DXCA 4M7AG 4C5HA 3LX7A 4ZGJB 2X4JA 1BI2A 5GAOl 2PUKB 4E7IA 2DJZA 3MEAA 3P8HA 1G3SA 4QQGA 1FXXA 5AYFA 5GANe 2XDDA 1WGSA 4ATOA 2E64A 3JCMP 2D9TA 4ME7A 4BD3A 1VQ9A 2F5TX 2DAQA 3CCUA 1W2BS 5FU6C 4GY5A 1VQ9T 2ZPHB 1WJQA 1YBYA 1YJ9T 1YJWT 3CCUT 2K4YA 1KC8C 3R6OA 1KG1A 4JRIA 3OYYA 3C95A 4M75G 3FRNA 3M5AA 2RJDA 1M90C 1ZHIA 2QQRA 2QDYB 4PJOG 3CD6T 2P0KA 3BDUA 3OYKA 2YRVA 3JB9H 5GAOr 2XU8A 3SWNA 3JCMJ 4EMKC 5CK9A 3CC7A 4XAXB 2MMPA 3INZA 4FL6A 3CC7T 4OB2B 3CCJT 1U8RA 5DLOA 3CCEA 1QVGS 4LDWA 1QP3A 5LJ3j 1I81A 1LNXA 4DOVA 5LJ3f 5LJ5e 1G5VA 3MHXA 3CCVT 1BKBA 2RI2A 3ME9A 4BI4A 5GMKm 4M7DG 2E6ZA 2QQBA 3I56T 3JB9J 1M90U 2DXUA 5GAOq 3MP8A 3PNWC 4FM4B 5FROA 2DD4A 1JB0E 1M4ZA 5EG2A 5LJ3g 4N0AA 2IVWA 1QVPA 3OMGA 2AHJB 4QVCA 2E6NA 4C5IA 1H641 2CZ0B 4MMKA 5LJ3h 2E10A 3E9GA 3JB9G 1O75A 1YITA 1EIFA 4BI8B 3VYHB 1YI2T 3JCMb 1PSEA 3OBWA 2ZPGB 3SFMA 3OSSC 4A4HA 1YHQA 5CKHA 4EMKB 3N5BB 1BI1A 2DIQA 2HBPA 4C0DB 2DZ9A 2KVQG 4PNOA 4XU0A 2JN0A 3O8VA 4ZTJA 1VQ7T 3M4YA 4M78D 2DVEA 1YJNA 1BI3A 1W2BA 1Y07A 4M78E 1KQ1A 3OS0A 3G4ST 3M55A 2PU9B 2WSFE 3A8OB 3QO3A 4M75F 4Z02A 4N0AC 5GANd 4M78A 2YLBA 3CCMT 4PJOF 2K5IA 2KDSA 4J6YA 3S3NA 4MDWA 3URGA 5GMKh 2JUFA 2RK1A 2RHXA 4XTYA 4IUPA 5A0LA 5DM7R 3CXCS 3GPLA 2LQKA 4LDYA 3HRTA 5D6WA 3VKIA 3PTAA 4E7KA 2VXFA 4L6V5 1WJSA 3QDRB 4JS4A 4DQ2A 2ZPBB 3M54A 3LLRA 4OVAA 1NJIC 4C5EA 1BYMA 3A8MB 3LWIA 4MZPA 4M75D 1U1SA 4J7IA 4JJNK 4M7DF 3HHTB 1D3BB 4C92D 2EFIA 3PMIA 4C92E 3E1SA 2OAUA 3QZ5B 4BACA 1VIFA 5DLQE 3UDCA 3OYMA 2PUOB 2RD1A 4C8QD 4KUIA 4C92A 1RI0A 3CEYA 5LJ5d 4C8QE 5GAN3 3RKYA 1XOVA 3OYGA 4M77D 1VQNT 4M77E 2XG8D 3X26B 3JB9F 4C8QA 4XU1A 4CRIA 5GAMj 3VYGA 3CCST 4FSXA 1NJIU 5FU7C 5GAMf 2ZPFB 2BIVA 3GOXA 4M77A 4MDXA 4E7JA 1H3ZA 1BIBA 2X35A 3OS1A 3HFOA 2PVOB 3MEUA 4BE0A 1WQ7A 3OYAA 3META 5GAMg 2LVMA 3S3MA 1S72A 1VQ8A 3V8KA 4J83A 2CS7A 2R57A 1Q86C 1VQ8T 3E9FA 2OTLA 3JB9D 2HQEA 4X9DA 4BB7A 3AHUA 2I2LA 4QVDA 3DLLA 2M1HA 3BY7A 2M9UA 1VQOA 2Y4XA 2XK0A 3UT1A 4OB0B 3GF5A 1VQMT 2L5QA 2VUBA 1VQOT 3CBMA 4M78B 2FL7A 2GFAA 2LT1A 2QEXA 5IAYA 2F69A 3S6WA 2QEXT 1YIJT 3GLXA 2DK3A 5CR2A 4JDSA 4OGEA 1VQLT 3QUIA 4M7AF 2WACA 2CGHA 1Q86U 2DIGA 3JB9I 1RL2A 3G6EA 5FRMA 3F70A 3RMSA 3OYJA 3JCMe 3TU4K 3EFSA 3Q1JA 2K57A 2JNGA 3PGGA 5GANf 2V8IA 1B34A 2YHTA 3JCMV 1P92A 5C0MA 2CKKA 4Y28E 3VV0A 4XU3A 2EJGA 2HAXA 3L1AA 4C92B 1Y96A 4C0FA 1HK9A 2X4WA 4BY6C 5KH6A 4BE1A 4FIBA 5GANg 4MMLA 5GAOn 2RM4A 4J6XA 4XTVA 4XK8E 4F7UB 4XTXA 5CVIA 4M77B 1YJ9A 3PIPA 5GANh 3L2VA 1YJWA 4A4FA 3WVDB 4N4HA 3RIRA 4A53A 3ZEHA 1OYXA 3HP9A 2CZ6B 2XDPA 5J3BA 4XU2A 4VUBA 4X9CA 1KHIA 3CD6A 1JBMA 2DZCA 3S3OA 3CC2A 3DLMA 3M56A 5GAN6 3X20B 4PLIA 3CC2T 4NL2A 1N6AA 2XIDA 3CCJA 3PT9A 4C0DC 2E70A 3CMEA 1UGRB 3QG1A 1X01A 1NPRA 1X6OA 1Q81C 4B9WA 5CKFA 3CMET 2EJ9A 5CCAA 1R8OB 3QSUA 3QBYA 4IKFA 2OTJT 1GXIE 2O01E 3CBPA 3FB9A 5CQXA 3CCVA 3P8BB 4BY6B 1WPYA 5A2QE 3UPUA 2RA2A 3I56A 2WSCE 2CZ7B 4XTUA 3SD4A 3J81E 2F5KA 4JLGA 4OGCA 3OYDA 3H6ZA 5LJ5h 4OB1B 3L2RA 3QYGB 5CO7A 3OA6A 4HCBA 1SSFA 3VUBA 2EWNA 1Q81U 5J26A 3QYHB 3SWNC 3QJYA 3RKWA 4DOWA 4EMHA 3FC3A 1YI2A 2G3RA 2VGMA 3JCMd 4OB3B 3V8LA 2JTFA 3BDLA 5IT9E 2K2VA 2P0QA 2KSSA 2O4XB 4F7UG 4MZMA 1QVFS 2EQMA 5GMKj 3LYIA 3T9NA 2DXTA 1G3WA 1Y96B 3GNFB 3H8ZA 2GCXA 3M58A 1VQ7A 3J7AF 4EDUA 3OYIA 2XDBA 1XQHA 3WXMB 2LRQA 3G4SA 2E5QA 4BUGA 3CCMA 2JZ2A 4UC4A 4FT2A 2QA4A 4QQ6A 4M7AD 1PSFA 3HL8A 3CC4T 3HRSA 4M7AE 5LJ3e 2L3RA 2QA4T 1BI0A 3OYHA 2NLUA 2DPPB 3L2ZA 4M7AA 1V29B 4HT8A 3MEVA 4J6WA 4QQDA 3CCLT 1UGQB 3TCJA 3P8DA 2EKOA 4IUQA 3SWNB 2XD0A 2JOYA 3QXEB 3MO8A 3VUZA 2KK4A 4M75E 3I55A 1VQ6T 3NTKA 3CCRT 4PJOD 4ZN1A 3OYNA 3L2UA 2JVVA 2PVGB 3LW5E 4NS5A 3I55T 5M9OA 1I5LA 3OS5A 4LDXA 4M75A 2DEQA 2E12A 4B9XA 1LOJA 4JRPA 4M78C 2FB7A 4O5VA 5I2SA 4PJOA 1N9SA 3OQ5A 1M8VA 4E7HA 3PIOA 4RCCA 2LDMA 1VQNA 3HSBA 4LDVA 3V7RA 2M16A 3QIIA 1KHCA 1WJRA 1M5Q1 3JSCA 4OF1A 4HKEA 3JRZA 3CCSA 1Q82C 1TH7A 2YLCA 2Y90A 4X34A 3V8JA 4E47A 5GAN4 4PL6A 4F7UF 1QVFA 4M7DD 1KQ2A 2KY9A 4RCBA 4M7DE 4J5YA 5GAN7 2RO0A 4D6WA 3CMAT 1AHJB 4M7DA 1I8FA 1Y71A 2DXBA 2RHYA 3ER0A 4PKCC 3WVEB 4LDUA 4GLKA 3X25B 3J80E 2QQAA 1XTDA 3OYEA 2WSEE 4L59A 1ZBXA 4J8OA 1Q82U 4C92C 2IG0A 2R58A 2RJCA 4XTZA 2V8KA 2EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ9 A;  3MHX A;  1G3S A;  4O5V A;  1FX7 A;  2QQB A;  3GLX A;  3HRS A;  2K5I A;  2LX9 A;  5CVI A;  2H3J A;  1BI0 A;  1FWZ A;  3HRU A;  1QW1 A;  1QVP A;  2K4Y A;  3HRT A;  1G3T A;  3E19 A;  1BYM A;  2K5L A;  1BI1 A;  1P92 A;  2QQA A;  1U8R A;  1G3W A;  2K5F A;  2GCX A;  1G3Y A;  1BI3 A;  4O6J A;  1BI2 A; 
#chains in the Genus database with same CATH topology
 2KRM A;  4QT7 A;  3JAM E;  1VQK A;  1VQK T;  4HT9 A;  3KUF A;  2CYZ B;  1KC8 C;  1X69 A;  3EFR A;  2XI9 A;  3L2Q A;  3TVT A;  3X24 B;  5GAM e;  2FYK A;  4CI0 C;  3LGL A;  4RMO A;  5FWB A;  5KE2 A;  2LZ6 B;  1OZ3 A;  2J6F A;  5GAN j;  4FYX B;  1N8R R;  4M75 B;  1KSW A;  2KQW A;  2ZPE B;  4L5G A;  4PJM A;  1QVG P;  2RHI A;  2LQ8 A;  1IRE B;  5A0D A;  2GNC A;  2PZ1 A;  2BE9 B;  2BZY A;  1Q7Y R;  4AFZ C;  4J9G A;  4OML A;  3THK A;  2MF2 A;  5HK0 A;  5GAN 5;  3MEW A;  2KAF A;  3M0U A;  2HKQ B;  3OYF A;  2DTI A;  1WHJ A;  1G3Y A;  3OYB A;  2KE9 A;  4II1 A;  3GIB A;  1X2Q A;  4QVZ A;  4KBM B;  4DBH A;  2H3J A;  3HRU A;  3RES A;  1OOT A;  4LD6 A;  1QQJ A;  5HK3 A;  4C8Q G;  2OX7 A;  2O9S A;  4M77 G;  2EIF A;  1M2O A;  3SDZ A;  2D6F A;  2QYZ A;  2X4X A;  4N4I A;  2GTO A;  2DE0 X;  1K73 C;  3CPW A;  2LCL A;  5FU6 B;  1IZ6 A;  3HPW A;  2JJ9 A;  4DBF A;  3CCL A;  2DF6 A;  3ULR B;  3I56 Q;  4HXJ A;  1YIT T;  1GFD A;  2FPF A;  3LGF A;  1TUC A;  2SRC A;  5KCH A;  1YHQ T;  4FU6 A;  5KYU B;  2FRY A;  1OUL A;  4EPC A;  2EGA A;  4C92 F;  1VQ7 Q;  1YFN A;  1F1B B;  1N8R U;  3EAE A;  3NMZ C;  2QA4 Q;  1GCQ C;  2QGF B;  3CMA A;  2VV5 A;  2YXY A;  2BUD A;  4Z89 A;  3KBG A;  2MPX C;  3KXT A;  3RUX A;  1Q7Y U;  4ELZ C;  2ZCF B;  2RI5 A;  2RQT A;  4JRK A;  4RTX A;  1B07 A;  4KUD K;  2RJF A;  4HCK A;  3ZBD A;  5CAI A;  1N9R A;  1QW1 A;  1M1G A;  1PWT A;  5GAO p;  1VQN Q;  1VA7 A;  1W2B P;  1M1K C;  2RNA A;  4J9F A;  3ZFJ A;  2K5L A;  3VS4 A;  2D8J A;  2EQK A;  4O6J A;  3CXC A;  2IIM A;  2K3B A;  4R56 A;  3M0S A;  5FU7 B;  3DKM A;  2ROT A;  1FYN A;  1ZSG A;  2COW A;  2FPE A;  1VYV A;  2CDT A;  4Z88 A;  4YTL A;  4ZGE B;  3QJ6 A;  2VXE A;  4ZGJ B;  2X4J A;  4E7I A;  4QQG A;  3A98 A;  1G3S A;  5GAN e;  1FXX A;  2XDD A;  1TXQ A;  1WGS A;  3JCM P;  4ME7 A;  5HCK A;  2DL4 A;  1RAG B;  2GQI A;  1W2B S;  2ZPH B;  2V26 A;  3OYY A;  3FRN A;  1M90 C;  2EYX A;  2YRV A;  2MMP A;  1C0M A;  2F2X A;  5EC7 A;  2O31 A;  1U8R A;  1EFN A;  1LNX A;  5LJ3 f;  3ME9 A;  4BI4 A;  5GMK m;  2E6Z A;  3I56 T;  3MP8 A;  3VS1 A;  1UE9 A;  2YUO A;  2G6F X;  1GFC A;  2E6N A;  4C5I A;  1CSK A;  2CZ0 B;  3JB9 G;  5KYY A;  4BI8 B;  2FZC B;  5KYW A;  4A4H A;  3OSS C;  1ZBJ A;  2HBP A;  2LQN A;  4C0D B;  2DZ9 A;  4PNO A;  8AT1 B;  1VQ7 T;  4M78 D;  2K7A A;  1BI3 A;  4M78 E;  2LMJ A;  3M55 A;  2PU9 B;  4M75 F;  1R0B G;  1WIE A;  1H92 A;  3NPF A;  3URG A;  5GMK h;  2QG9 B;  4E7K A;  2VXF A;  1UHF A;  3QDR B;  4L6V 5;  3CC4 Q;  3EG2 A;  4C5E A;  4M75 D;  2LP5 A;  4M7D F;  4CC2 A;  3PMI A;  4AT1 B;  3CEY A;  5LJ5 d;  5GAN 3;  1D0Z A;  3OYG A;  3CCR Q;  5IXF A;  1VQN T;  2E5K A;  3BE3 A;  4C8Q A;  4CRI A;  3VYG A;  1HD3 A;  5GAM f;  2B86 A;  2ZPF B;  1WHM A;  4M77 A;  1G2B A;  2MIO A;  3OYA A;  4E2F B;  1S72 A;  4J83 A;  2CS7 A;  2HEQ A;  4X9D A;  2I2L A;  3BY7 A;  2LNH B;  1VQO A;  1YWO A;  2Y4X A;  3GF5 A;  1VQO T;  3CBM A;  1PRM C;  2F69 A;  2RN8 A;  3QUI A;  2CGH A;  3JB9 I;  3F70 A;  3EFS A;  2DRM A;  2K57 A;  2JNG A;  1VOM A;  3G71 Q;  2YHT A;  2LQW A;  1M3B A;  1HK9 A;  1JQQ A;  2X4W A;  4BY6 C;  5KH6 A;  5KYX A;  2VB6 A;  4LN2 A;  1YP5 A;  4XTV A;  4XK8 E;  4F7U B;  1SSH A;  2CSI A;  3PIP A;  2KXC A;  4ZNX A;  1VQ5 Q;  4JZ3 A;  5J3B A;  4X9C A;  3S3O A;  3M56 A;  1HJD A;  2JXB A;  1RAD B;  2XID A;  4R0K A;  1UGR B;  1X01 A;  1X6O A;  2ZAE A;  5KYN A;  1NYF A;  5CCA A;  1R8O B;  2EBP A;  1UDL A;  1SHF A;  3I9Q A;  3CCV A;  4BY6 B;  1WPY A;  4PK4 A;  5A2Q E;  3UPU A;  1PKT A;  5LJ5 h;  3SEM A;  4OB1 B;  3L2R A;  3QYG B;  3CQT A;  1KC8 R;  1WHH A;  4FW1 A;  5J26 A;  1BB9 A;  3QYH B;  3SWN C;  4EMH A;  1Q81 U;  2A08 A;  4E7Z A;  2VGM A;  3JCM d;  2JTF A;  3BDL A;  2CH4 W;  2K2V A;  1VQ4 Q;  2KSS A;  4AG1 C;  1Y96 B;  1WXU A;  2XDB A;  2GGR A;  2K79 A;  4CC3 A;  3CC4 T;  3CCE Q;  2E4H A;  2NLU A;  1BCO A;  3L2Z A;  1V29 B;  4DEX A;  2A28 A;  4IUQ A;  2EKO A;  4J9B A;  3SWN B;  1H3H A;  3I55 A;  3NTK A;  3CCR T;  2JVV A;  3LW5 E;  3I55 T;  3OS5 A;  2DEQ A;  2FO0 A;  2HKN A;  2COY A;  5I2S A;  1CKB A;  1M8V A;  3PIO A;  3UAT A;  2LDM A;  3GBQ A;  4LDV A;  3V7R A;  3CCS A;  1KHC A;  4E47 A;  1LCK A;  1TU0 B;  1QVF A;  1KQ2 A;  2KY9 A;  2CP5 A;  3KFV A;  3ER0 A;  3X25 B;  3J80 E;  3OYE A;  2DRK A;  4L59 A;  2HL3 A;  2WSE E;  1GCP A;  3A1P A;  4C92 C;  2HZY A;  4HVW A;  1TOV A;  1YIJ A;  3M0Q A;  1MND A;  2L8D A;  4NL3 A;  3I5S A;  4TVR A;  2LCC A;  3JCM c;  2VGN A;  2MAM A;  4KGX B;  3OS2 A;  4KGZ B;  4DA4 A;  1MMN A;  2MWP A;  1KIK A;  4JRQ A;  1M27 C;  3GNG A;  1KC8 U;  1WQW A;  1AWO A;  2PQW A;  1VQ5 T;  1K1Z A;  3RNJ A;  8ATC B;  1NLP C;  3I35 A;  4IUR A;  4RKU E;  2GQV A;  3OMC A;  2HSP A;  2YUQ A;  1Q82 R;  1JRI A;  5L8R E;  2EQI A;  4M78 G;  2C0I A;  3A8L B;  1D1B A;  4HCZ A;  2DEU A;  3NFC A;  2DNU A;  1NPP A;  2CP7 A;  2RMO A;  1ZQ1 A;  4XTW A;  1FWZ A;  1VQ4 A;  1C1A A;  1VQ4 T;  1TUG B;  1TG0 A;  1YJ9 Q;  3V7C A;  3VRY A;  1B34 B;  3PMT A;  4Y91 A;  4AG2 C;  4OP0 A;  5GJW B;  3VS3 A;  3CD6 Q;  3CCE T;  4FT4 A;  1UB4 A;  2QQS A;  1T3S A;  2CP3 A;  3CCJ Q;  4RG2 A;  2EJF A;  2DO3 A;  2E1H A;  3M59 A;  4LD9 K;  2RI3 A;  1SF9 A;  2QXF A;  3DB3 A;  3NTI A;  4F04 B;  2RPN A;  2M0Y A;  2RHZ A;  1SHG A;  1MNE A;  1K73 U;  3EGD A;  2K3Y A;  2V8J A;  2KMT A;  2E41 A;  1VQ6 A;  1PG5 B;  2KI7 A;  2EYQ A;  4JJD A;  5I2M A;  1YI2 Q;  4J7F A;  3OW2 S;  2YDL A;  4MZT A;  1M8M A;  4RUG A;  3SB2 A;  4A4G A;  4LNP A;  4ESR A;  1KQS P;  3M53 A;  1JXO A;  4N4G A;  2H8H A;  2AKK A;  4AMC A;  1U1T A;  2FVU A;  1X27 A;  2HL5 C;  2CUB A;  2FRW A;  2YUP A;  3FEO A;  4ZN3 A;  5GAN 2;  5D6Y A;  4M75 C;  5IN1 A;  3LH0 A;  2P0P A;  1Z9Z A;  3MKD A;  3FLG A;  2EYW A;  3QZ9 B;  2RQW A;  2MCN A;  1UGS B;  4F7U E;  1PD1 A;  1K9A A;  2VWF A;  2CZ1 B;  1K0S A;  1M2V A;  3M4G A;  4BDY A;  1XNI A;  1QWE A;  2MWO A;  4M7D C;  1NEB A;  5GMK i;  3OY9 A;  1MHN A;  1OPL A;  3X28 B;  2MI6 A;  1LJO A;  3EG9 A;  3FDR A;  4C0Z A;  1R0C B;  1KQS S;  2L3S A;  2DET A;  2QQ9 A;  1VQ8 Q;  3EGU A;  1M1K U;  4ELY C;  2KGT A;  3PE0 A;  4M7D B;  4JLI A;  1VQL Q;  2NUT B;  3C0C A;  1ABO A;  3TEE A;  4A54 A;  2RB6 A;  2DXC A;  4C5H A;  3LX7 A;  2BE7 D;  3P8H A;  4ATO A;  2CH4 A;  1EZZ B;  2D9T A;  4BD3 A;  1VQ9 A;  4PJN A;  2F5T X;  2DAQ A;  2NUP A;  2OJ2 A;  5FU6 C;  4GY5 A;  1VQ9 T;  1YJ9 T;  1KG1 A;  3C95 A;  2RJD A;  2EGC A;  1ZHI A;  3CD6 T;  3BDU A;  3JB9 H;  2BZ8 A;  2XU8 A;  5GAO r;  4EMK C;  4OB2 B;  3CCJ T;  5DLO A;  1QVG S;  1QP3 A;  3HTR A;  2W0Z A;  3CC2 Q;  2RQU A;  2QQB A;  1M90 U;  2DXU A;  5EG2 A;  2OTJ Q;  2IVW A;  3EGX A;  3R6N A;  4QVC A;  2BTT A;  1ZSZ A;  4M7A F;  1WFW A;  2E10 A;  1YIT A;  1EIF A;  1YI2 T;  3JCM b;  3OBW A;  1LPL A;  1YHQ A;  5CKH A;  4EMK B;  1BI1 A;  4E6R A;  1B7T A;  3O8V A;  2JN0 A;  2DMO A;  1OU8 A;  3M4Y A;  4ZTJ A;  1U3O A;  4FSS A;  2ATC B;  5IHK A;  4M78 A;  2YLB A;  1GL5 A;  4PJO F;  3EG1 A;  2GBQ A;  2RK1 A;  4Y92 A;  5DM7 R;  4IUP A;  3GPL A;  4LDY A;  3HRT A;  4PFO A;  3VKI A;  1WJS A;  4DQ2 A;  1WXB A;  4X1V A;  1AD5 A;  3LLR A;  4OVA A;  1BYM A;  1S1N A;  1U1S A;  4DEY A;  3HHT B;  1D3B B;  4C92 D;  4C92 E;  3EG3 A;  2KYB A;  3OYM A;  2RD1 A;  4KUI A;  3UA6 A;  1PRL C;  2J06 A;  1XOV A;  1PHT A;  2L2P A;  1RAI B;  4XU1 A;  2F2V A;  5FU7 C;  1AEY A;  1PM3 A;  4E7J A;  1H3Z A;  3OS1 A;  2PVO B;  3O5Z A;  3MEU A;  1D0Y A;  1WQ7 A;  1VQ8 A;  4FCY A;  1ABQ A;  2V1Q A;  3EH2 A;  1Q86 C;  1VQ8 T;  2D1X A;  3UT1 A;  3UA7 A;  4OMM A;  2LT1 A;  1NLO C;  3M0R A;  2DK3 A;  5CR2 A;  4OGE A;  2JTE A;  1WHL A;  1VQL T;  2DIG A;  2YRD A;  3TU4 K;  3Q1J A;  1YWP A;  4PJJ A;  1P92 A;  2CKK A;  4AFS C;  2EJG A;  3VS0 A;  1AWW A;  1BCM A;  4MML A;  1QVF P;  4J6X A;  4XTX A;  4M77 B;  3WVD B;  4A53 A;  3ZEH A;  4DBQ A;  1OYX A;  3HP9 A;  4XU2 A;  3CC2 A;  5GAN 6;  4PLI A;  3CC2 T;  3NGP A;  1OU9 A;  4C0D C;  3QG1 A;  2RQV A;  5KYU A;  2NWM A;  3TSZ A;  1AOJ A;  3D7S B;  4IKF A;  2OTJ T;  2O01 E;  3CBP A;  1VQP Q;  3H0F A;  3I56 A;  2WSC E;  2CZ7 B;  3H0H A;  3CCQ Q;  2F5K A;  3OYD A;  2C0O A;  3REA B;  4HCB A;  1SSF A;  1YNZ A;  2EKH A;  1GBQ A;  2O4X B;  3PVL A;  4MZM A;  4F7U G;  1QVF S;  2QGG A;  5GMK j;  3T9N A;  1R77 A;  2DXT A;  1VQ7 A;  3M58 A;  5KYX B;  1HYO A;  3H41 A;  4EDU A;  2LRQ A;  4BUG A;  2QA4 A;  3HRS A;  2DYI A;  3M0P A;  2QA4 T;  2O88 A;  2DPP B;  1NEG A;  3MEV A;  4QQD A;  1UGQ B;  4GLM A;  2AT1 B;  3TCJ A;  1GCQ A;  2JS0 A;  2LJ3 A;  1EX4 A;  4M75 E;  1PD0 A;  3OYN A;  5I22 A;  1LOJ A;  2FB7 A;  4O5V A;  1K4U S;  1Q81 R;  1N9S A;  4E7H A;  2CT3 A;  1VQN A;  1IHW A;  2EW3 A;  3QII A;  1M5Q 1;  1E6H A;  4HKE A;  1YJN Q;  1TH7 A;  2Y90 A;  4X34 A;  3V8J A;  4M7D D;  2L3Q A;  4M7D E;  4J5Y A;  2CUD A;  2RO0 A;  2DFU A;  1Y71 A;  2CP0 A;  2DXB A;  2RHY A;  4LDU A;  1XTD A;  1I5O B;  1ZBX A;  4J8O A;  2IG0 A;  2RJC A;  4EMG A;  4XTZ A;  2V8K A;  2JM8 A;  3HKS A;  1I1J A;  1IB8 A;  2RHU A;  3OYC A;  2C0T A;  1WXT A;  5A0G A;  2GTJ A;  5LJ3 d;  2JTM A;  4K11 A;  2JS2 A;  1AT1 B;  1V1C A;  1RAF B;  3E19 A;  1B3Q A;  2DL3 A;  2DTH A;  1JO8 A;  3M9Q A;  4OMO A;  3ZL7 C;  4A63 B;  5C6S A;  1HXD A;  2K6D A;  4QW2 A;  3L42 A;  1UGP B;  1KD1 C;  2ESW A;  1VYT A;  3C12 A;  2OTL Q;  2DBK A;  2R5A A;  2YSQ A;  2DIL A;  3I5R A;  4Q5W A;  1W70 A;  2EGE A;  3UWN A;  1G3T A;  5LJ5 j;  1VQP T;  3CCQ A;  2DJQ A;  3G6E Q;  3MP6 A;  3CCQ T;  4LUE A;  3SHW A;  3L2W A;  4BI3 A;  4R55 A;  4Z8A A;  1K8A C;  5LJ5 g;  1UGV A;  4RTZ A;  3RER A;  1O9S A;  2A37 A;  3GP8 A;  2RJE A;  4FYY B;  4C92 G;  2GF7 A;  4BDZ A;  3CBO A;  5GAM d;  1YJW Q;  3CCU Q;  2M0O A;  5CKE A;  1TSF A;  7AT1 B;  2HCK A;  2VC8 A;  3A5Z B;  3RMQ A;  2XHC A;  2XIC A;  3CC7 Q;  4IUT A;  3CC4 A;  4WF2 A;  1D09 B;  1NYG A;  1SRM A;  2LX9 A;  1FMV A;  3TRE A;  2YWW A;  1MGQ A;  1BIA A;  3PFS A;  2I0N A;  5D6X A;  5FRN A;  4RG8 A;  1ZA2 B;  1OZ2 A;  2ZZD A;  3VJP A;  3CCR A;  3RBB B;  2DKG A;  3PVQ A;  5CQY A;  1YJN T;  2ECZ A;  2GFU A;  5GMK e;  3JCM X;  2R5M A;  1ZUY A;  4M7A C;  3BW1 A;  2CSQ A;  1AZE A;  4AFU C;  2JM9 A;  2KT1 A;  3G4S Q;  1JJ2 A;  4C8Q F;  2EQU A;  2HD0 A;  1QCO A;  2EVR A;  2QI2 A;  3CCM Q;  4J9C A;  4M77 F;  2P4T A;  1I0C A;  3A8G B;  3M0T A;  1OI1 A;  1WNL A;  3A8H B;  4P5N A;  1RI9 A;  1SG5 A;  3CPW P;  4PJO C;  1K9M C;  3VRZ A;  3CPF A;  2PTK A;  2O9V A;  1SPK A;  2E3H A;  2C06 A;  1H8K A;  5I21 A;  1I4K 1;  4F7U A;  2A7Y A;  1K73 R;  4OMN A;  4M7A B;  4C0G A;  3G71 A;  1UEC A;  1N27 A;  3G71 T;  2CRE A;  3EFO A;  3JCM g;  3EGD B;  2VYT A;  1DJ7 B;  4V2S A;  2AZS A;  1MMG A;  3OBY A;  5GAM h;  2P84 A;  2OTL T;  3JCM h;  4HA8 A;  2X3W D;  3G7Z A;  4PJO B;  4D8K A;  1VQ5 A;  1K0X A;  3MP1 A;  1QKW A;  1D1A A;  5CKD A;  3OB9 A;  1VQM Q;  2NYS A;  5HY6 A;  1VQK Q;  2QEX Q;  3G6E T;  3CPW S;  4ZGD B;  5GAO m;  3LH5 A;  3FJP A;  4IUU A;  1RUW A;  1W4S A;  2LC4 A;  3DB4 A;  1QMC A;  4OMF B;  4GBQ A;  1BI2 A;  3EH1 A;  5GAO l;  3MEA A;  5AYF A;  2E64 A;  1WDX A;  4HVU A;  1M2V B;  3CCU A;  1A0N B;  1WJQ A;  1YJW T;  3CCU T;  2K4Y A;  4M75 G;  2DYB A;  1HSQ A;  2P0K A;  3OYK A;  1WX6 A;  3SWN A;  3JCM J;  5CK9 A;  3CC7 A;  3CXC P;  1TTH B;  3FJ5 A;  3INZ A;  2FEI A;  4FL6 A;  1GBR A;  3EG9 B;  3CC7 T;  1M1K R;  2ED0 A;  3CCE A;  1Y57 A;  1FMW A;  5LJ5 e;  1RLQ C;  1BKB A;  2OAW A;  4M7D G;  1WA7 A;  3JB9 J;  1Y0M A;  3PNW C;  5FRO A;  4FM4 B;  1M4Z A;  4J9E A;  4N0A A;  1QVP A;  2JW4 A;  1H64 1;  3E9G A;  1O75 A;  1RLP C;  3UF4 A;  1PSE A;  2LJ1 A;  3SFM A;  3N5B B;  1JU5 C;  2DVE A;  1KQ1 A;  3G4S T;  1UJ0 A;  2WSF E;  3QO3 A;  4Z02 A;  5GAN d;  3CCM T;  2KDS A;  3S3N A;  4MDW A;  5ECA A;  4XTY A;  3CXC S;  2RHX A;  2CP6 A;  4F14 A;  3PTA A;  1J3T A;  3M54 A;  1NJI C;  3A8M B;  3LWI A;  4JJN K;  3CCL Q;  1M90 R;  3TSW A;  4BAC A;  3E1S A;  1VIF A;  1RAE B;  3UDC A;  4C92 A;  3RKY A;  2X51 A;  3JB9 F;  3X26 B;  1RAC B;  3EGX B;  4RTT A;  1QKX A;  2BIV A;  4MDX A;  1ZSZ B;  3NHN A;  2DLP A;  3EHQ A;  1UG1 A;  2LX7 A;  4BE0 A;  4D8D A;  2LVM A;  3S3M A;  2HBW A;  2M02 A;  1D0X A;  2DVJ A;  3JB9 D;  2HQE A;  2KRN A;  4BB7 A;  2M1H A;  3CMA Q;  2M9U A;  2X3X D;  4OB0 B;  1VQM T;  2VUB A;  2QEX A;  4M78 B;  2KRO A;  2GFA A;  1YCS B;  5IAY A;  2X9H A;  2QEX T;  3GLX A;  2QAZ A;  4JDS A;  2WAC A;  1Q86 U;  4KRT A;  2SEM A;  1RL2 A;  5FRM A;  3RMS A;  3JCM e;  2VVK A;  3U23 A;  2XMF A;  3PGG A;  4CC4 B;  3VS6 A;  1B34 A;  2YRC A;  5C0M A;  4XU3 A;  2HAX A;  2FZK B;  1WZO A;  2IPO B;  4BE1 A;  4FIB A;  1X43 A;  2H3E B;  2F2W A;  4FW2 A;  5GAN g;  4RTY A;  3G1J A;  2KT8 A;  2RM4 A;  5CVI A;  1YJ9 A;  5GAN h;  4A4F A;  1PKS A;  2XDP A;  1E7O A;  1KHI A;  3CD6 A;  1JBM A;  2DZC A;  2J7I A;  3DLM A;  1N6A A;  1RAA B;  3CCJ A;  3PT9 A;  2E70 A;  1NPR A;  4B9W A;  5CKF A;  1KJW A;  1MV3 A;  2VKN A;  1X6B A;  2RA2 A;  4XTU A;  3SD4 A;  4OGC A;  1TUD A;  2CP2 A;  4FYV B;  3VS5 A;  5CO7 A;  3OA6 A;  2EWN A;  1AZG B;  4DOW A;  3RKW A;  1YI2 A;  1JEG A;  1W6X A;  5IT9 E;  1OQK A;  2P0Q A;  2OI3 A;  3GNF B;  3H8Z A;  3J7A F;  2GCX A;  1MMA A;  3OYI A;  3WXM B;  2E5Q A;  4UC4 A;  4FT2 A;  2VAS A;  2E3I A;  4QQ6 A;  4M7A D;  1KD1 R;  4RTV A;  4M7A E;  2L3R A;  1QCN A;  2A36 A;  4J6W A;  3CCL T;  5D7U A;  2QK0 A;  3QXE B;  2RQR A;  3VUZ A;  2KK4 A;  2MK5 A;  2AKL A;  1AVZ C;  4PJO D;  4ZN1 A;  3QDF A;  1E6G A;  4NS5 A;  1I5L A;  1CKA A;  4PJO E;  1ARK A;  4M75 A;  4B9X A;  4WTO B;  4JRP A;  2AIR B;  3OQ5 A;  4EIK A;  1M3A A;  4RCC A;  4HVV A;  4RTU A;  1K8A R;  3JSC A;  1Q82 C;  3QWY A;  3JV3 A;  2DX1 A;  5KYY B;  1SRL A;  3CMA T;  2LJ0 A;  1AHJ B;  5KYW B;  4M7D A;  1I8F A;  5FWC A;  2NUT A;  4PKC C;  3RR6 A;  4GLK A;  2QQA A;  4M4Z A;  3AT1 B;  2R58 A;  4J9D A;  2EAY A;  2KNB B;  4E7S A;  1C6V X;  1T0J A;  4C8Q C;  4JUV A;  3FIF A;  2DA9 A;  4M77 C;  2YT6 A;  1V76 A;  3BFM A;  5CIU A;  2RK2 A;  1VQL A;  3OYL A;  2HDA A;  1YN8 A;  1SEM A;  1ZLM A;  1OX8 A;  1RAH B;  1M9S A;  3ASK A;  1Y7X A;  2ZGW A;  4E7L A;  1PNJ A;  2MYS A;  3OW2 A;  4KH0 B;  5DY9 A;  4A4K A;  4KUL A;  2DD5 A;  2L89 A;  2DBM A;  1S72 Q;  3JCM W;  1JJ2 P;  1X6G A;  1FX7 A;  2EPD A;  4C8Q B;  1QWF A;  3EHR A;  1VQO Q;  5J39 A;  3HFN A;  3QHS A;  4BE2 A;  4PLL A;  3RKX A;  2F1L A;  4J9I A;  2PVD B;  1KD1 U;  4F16 A;  1UFF A;  5LJ5 f;  4HCC A;  5KCO A;  4EMK A;  1QCF A;  1NG2 A;  3V7S A;  2OTJ A;  1ZA1 B;  4OMP A;  2J6O A;  1K9M R;  2AZV A;  4PJL A;  4NOY A;  1YCY A;  2DL5 A;  2QDL A;  2ENM A;  2KXD A;  1VUB A;  2DER A;  2A3L A;  2XKO C;  2DL8 A;  1Z9Q A;  4A4E A;  1KQS A;  1K8A U;  1JJ2 S;  2AK5 A;  1MMD A;  2A0F B;  1M1F A;  3LWH A;  1D3B A;  1UJY A;  1U06 A;  2B8A A;  1M3C A;  1PCX A;  1QP2 A;  2FHD A;  4KH1 B;  4M78 F;  3CCV Q;  1BU1 A;  3H0I A;  2DTO A;  2NUZ A;  4FYW B;  5GMK l;  2E65 A;  1NBE B;  1N8R C;  4XQ3 A;  1NM7 A;  3MCA B;  2HMA A;  2ROL A;  4IUV A;  3QWX X;  1WI7 A;  1Q7Y C;  1D1C A;  5LL6 S;  1N5Z A;  2LNV A;  1QVG A;  2QAS A;  4QKU A;  2BKD N;  2DM1 A;  2BZX A;  3VU3 C;  3QKJ A;  2PNI A;  2FZG B;  3QPH A;  1X75 C;  2RH2 A;  1TS9 A;  2QTX A;  2HNI A;  2EQJ A;  5IH2 A;  2O2O A;  4ZTF A;  4C5G A;  3NTH A;  3I55 Q;  1VIE A;  1SKU B;  1WYX A;  3JCM f;  2QTV A;  1Q95 G;  1AWX A;  2HQX A;  2KRS A;  4RTW A;  1NZ9 A;  1WLP B;  3OSV A;  1KFZ A;  2LTO A;  1K9M U;  1GRI A;  3CCS Q;  2L3P A;  1IHV A;  3VS7 A;  1S72 T;  1T0H A;  4WCI A;  5IHI A;  3MJX A;  2LT4 A;  4KT0 E;  3M57 A;  4PFZ A;  3C94 A;  4JJC A;  3JCM Q;  1M30 A;  2D0Q B;  3VS2 A;  4JS5 A;  5GAN 8;  5HKC A;  4ORZ A;  2K3X A;  3EG0 A;  4LE9 A;  2MOX A;  1FMK A;  4CC7 A;  1OX9 A;  3C4S A;  1YIJ Q;  5FLX E;  2X4Y A;  1UEB A;  1BBZ A;  4F17 A;  2Y4Y A;  5CKB A;  1VQP A;  2ZPI B;  2M51 A;  1IGU A;  2KEA A;  1OEB A;  2O4X A;  5KE3 A;  1NJI R;  2K5F A;  4M7A G;  1NE8 A;  1WHG A;  4OMQ A;  1W1F A;  3MPU B;  2PUK B;  2DJZ A;  1G83 A;  5IHN A;  3RDV A;  1LVK A;  1UTI A;  1YBY A;  4KGV B;  3R6O A;  4JRI A;  4J9H A;  3EFO B;  3M5A A;  2QQR A;  4PJO G;  2QDY B;  5GJV B;  4XAX B;  1IGQ A;  4LDW A;  5IXB A;  3E2U A;  5LJ3 j;  1I81 A;  4DOV A;  1G5V A;  1RAB B;  3MHX A;  3CCV T;  2RI2 A;  4AFQ C;  2FG0 A;  5GAO q;  3CME Q;  2KYM A;  2DD4 A;  1JB0 E;  5LJ3 g;  3OMG A;  2AHJ B;  2COZ A;  5L23 A;  2W10 A;  2HQH A;  4MMK A;  5LJ3 h;  4JZ4 A;  4JPB W;  1BK2 A;  3VYH B;  2ZPG B;  1IXD A;  2DIQ A;  2J6K A;  2KVQ G;  4XU0 A;  2ABL A;  2HSE B;  1W2B A;  1YJN A;  1Y07 A;  4DBR A;  3OS0 A;  4B6M A;  3A8O B;  4N0A C;  2K5I A;  4J6Y A;  3TQ7 P;  2JUF A;  5A0L A;  2KBT A;  2LQK A;  5D6W A;  2CT4 A;  4JS4 A;  2ZPB B;  4MZP A;  1XJW B;  2RF0 A;  4J7I A;  2EFI A;  2OAU A;  3QZ5 B;  5DLQ E;  2PUO B;  4C8Q D;  1RI0 A;  4C8Q E;  1TWB A;  1JXM A;  1VQ6 Q;  4M77 D;  4M77 E;  2XG8 D;  1IO6 A;  5GAM j;  1NJI U;  3CCS T;  4FSX A;  4ANJ A;  3GOX A;  1BIB A;  2EYY A;  2X35 A;  3HFO A;  5AT1 B;  3MET A;  5GAM g;  6AT1 B;  1MV0 B;  3V8K A;  3REB B;  2D8H A;  2R57 A;  3E9F A;  2OTL A;  3AHU A;  1X2K A;  4QVD A;  3DLL A;  2XK0 A;  4JJB A;  2JMA A;  2L5Q A;  2FL7 A;  3S6W A;  1YIJ T;  2K9G A;  2J05 A;  1AWJ A;  3G6E A;  3IQL A;  3OYJ A;  2ED1 A;  2KR3 A;  5GAN f;  2V8I A;  3JCM V;  4Y28 E;  3VV0 A;  5I11 A;  3L1A A;  1VYU A;  4C92 B;  1K76 A;  1Y96 A;  4C0F A;  4LXC A;  5GAO n;  4PFP A;  2JMC A;  2FPD A;  3L2V A;  1U5S A;  1YJW A;  4N4H A;  3RIR A;  2CZ6 B;  4VUB A;  3X20 B;  4NL2 A;  3CME A;  1Q81 C;  3CME T;  2EJ9 A;  1Q86 R;  3QSU A;  3QBY A;  2Z0W A;  1GXI E;  3FB9 A;  5CQX A;  3P8B B;  2L0A A;  3J81 E;  4JLG A;  3H6Z A;  9ATC B;  2D0N A;  3OW2 P;  1UHC A;  3VUB A;  1QLY A;  3FC3 A;  3QJY A;  1VQ9 Q;  1ZUU A;  2G3R A;  2YUN A;  1G8X A;  4OB3 B;  3V8L A;  2P4R A;  2K2M A;  2EQM A;  2EYZ A;  3LYI A;  1OPK A;  1T3L A;  1G3W A;  1XQH A;  3G4S A;  4LUD A;  3CCM A;  1OV3 A;  2JZ2 A;  1ZUK A;  1PSF A;  3HL8 A;  1ACM B;  2NUP B;  5LJ3 e;  1BI0 A;  3OYH A;  4M7A A;  1ZSZ C;  4HT8 A;  1PC0 A;  3P8D A;  2XD0 A;  2JOY A;  3MO8 A;  1VQ6 T;  3L2U A;  2PVG B;  4IIM A;  4LDX A;  5M9O A;  1YIT Q;  2E12 A;  1KK7 A;  5FW9 A;  2V1R A;  4M78 C;  4PJO A;  1YHQ Q;  1ZX6 A;  1MUZ A;  1WHK A;  3HSB A;  2M16 A;  1WJR A;  4OF1 A;  3JRZ A;  2YLC A;  5GAN 4;  4PL6 A;  4F7U F;  1UUE A;  4IIO A;  1I07 A;  4RCB A;  5GAN 7;  4D6W A;  2LCS A;  3WVE B;  2DL7 A;  2JT4 A;  3H9N A;  1Q82 U;  1IRX A;  1VQM A; 
#chains in the Genus database with same CATH homology
 3JAM E;  2RHU A;  3OYC A;  1VQK A;  1YIJ A;  4C8Q C;  4JUV A;  3FIF A;  1VQK T;  2L8D A;  5A0G A;  4HT9 A;  4M77 C;  3KUF A;  4NL3 A;  4TVR A;  2CYZ B;  2LCC A;  3BFM A;  2RK2 A;  2XI9 A;  3EFR A;  5CIU A;  3JCM c;  5LJ3 d;  3L2Q A;  1VQL A;  2VGN A;  2MAM A;  3OYL A;  3X24 B;  2JTM A;  3OS2 A;  5GAM e;  2FYK A;  4CI0 C;  1M9S A;  3ASK A;  4DA4 A;  1Y7X A;  2ZGW A;  3E19 A;  3LGL A;  4RMO A;  4E7L A;  5KE2 A;  1OZ3 A;  2DTH A;  2MWP A;  3M9Q A;  3OW2 A;  5DY9 A;  5GAN j;  4JRQ A;  4A4K A;  5C6S A;  3GNG A;  4M75 B;  4KUL A;  1KC8 U;  1WQW A;  1HXD A;  2DD5 A;  2L89 A;  3L42 A;  4QW2 A;  1UGP B;  2KQW A;  1KD1 C;  3JCM W;  2ZPE B;  2PQW A;  4L5G A;  3C12 A;  1VQ5 T;  1FX7 A;  4C8Q B;  2R5A A;  2RHI A;  2LQ8 A;  1IRE B;  4IUR A;  4Q5W A;  4RKU E;  3HFN A;  5A0D A;  5J39 A;  2GQV A;  3OMC A;  3QHS A;  4BE2 A;  1JRI A;  4PLL A;  3RKX A;  3UWN A;  5L8R E;  1G3T A;  4M78 G;  2PVD B;  1KD1 U;  5LJ5 j;  3A8L B;  1VQP T;  3CCQ A;  2MF2 A;  5LJ5 f;  4HCC A;  5HK0 A;  1VQM A;  5KCO A;  5GAN 5;  4EMK A;  3MP6 A;  3MEW A;  3CCQ T;  2KAF A;  3OYF A;  3V7S A;  3L2W A;  2DTI A;  4HCZ A;  1G3Y A;  3NFC A;  4BI3 A;  4R55 A;  3OYB A;  1K8A C;  2OTJ A;  4II1 A;  5LJ5 g;  3GIB A;  1NPP A;  4QVZ A;  3RER A;  4NOY A;  4KBM B;  1YCY A;  1O9S A;  3GP8 A;  1VUB A;  1ZQ1 A;  2H3J A;  4XTW A;  1FWZ A;  3HRU A;  2RJE A;  3RES A;  2A3L A;  1VQ4 A;  2XKO C;  1VQ4 T;  4A4E A;  4C92 G;  2GF7 A;  4BDZ A;  4LD6 A;  1KQS A;  5HK3 A;  3CBO A;  1K8A U;  5GAM d;  4EMG A;  3V7C A;  1JJ2 S;  2M0O A;  1B34 B;  5CKE A;  4C8Q G;  3PMT A;  4Y91 A;  1M1F A;  4OP0 A;  2VC8 A;  4M77 G;  2EIF A;  1D3B A;  3A5Z B;  3LWH A;  3CCE T;  3RMQ A;  2B8A A;  2XHC A;  3HKS A;  4FT4 A;  3SDZ A;  2XIC A;  2X4X A;  1UB4 A;  4N4I A;  2QQS A;  2D6F A;  1K73 C;  4IUT A;  3CPW A;  1QP2 A;  2FHD A;  3CC4 A;  4RG2 A;  4WF2 A;  2EJF A;  2DO3 A;  2LCL A;  2LX9 A;  2E1H A;  3M59 A;  4M78 F;  5FU6 B;  3TRE A;  1MGQ A;  4LD9 K;  1BIA A;  2RI3 A;  1IZ6 A;  3PFS A;  3HPW A;  3CCL A;  2QXF A;  3DB3 A;  3NTI A;  5D6X A;  2DTO A;  5GMK l;  5FRN A;  2RHZ A;  2E65 A;  1YIT T;  1N8R C;  3LGF A;  4RG8 A;  1OZ2 A;  2ZZD A;  1K73 U;  2K3Y A;  2V8J A;  2KMT A;  2E41 A;  4XQ3 A;  3MCA B;  3VJP A;  5KCH A;  3CCR A;  4FU6 A;  2DKG A;  1YHQ T;  1VQ6 A;  4IUV A;  2EYQ A;  5I2M A;  5CQY A;  1YJN T;  4PJO E;  4J7F A;  2GFU A;  5GMK e;  3OW2 S;  4EPC A;  3JCM X;  4MZT A;  2R5M A;  3SB2 A;  4C92 F;  4A4G A;  4M7A C;  3BW1 A;  1Q7Y C;  1N8R U;  3EAE A;  3M53 A;  4N4G A;  1JJ2 A;  4C8Q F;  2EQU A;  2HD0 A;  2QI2 A;  5LL6 S;  2LNV A;  1QVG A;  1U1T A;  4M77 F;  3CMA A;  2P4T A;  2BKD N;  3A8G B;  2FVU A;  1OI1 A;  3VU3 C;  2VV5 A;  1WNL A;  2BUD A;  3QKJ A;  3FEO A;  3A8H B;  3KBG A;  3QPH A;  4P5N A;  4ZN3 A;  5GAN 2;  1X75 C;  4M75 C;  5D6Y A;  3KXT A;  2RH2 A;  5IN1 A;  3RUX A;  1Q7Y U;  3LH0 A;  2P0P A;  4ELZ C;  4PJO C;  1K9M C;  3FLG A;  2ZCF B;  2QTX A;  3CPF A;  2HNI A;  2RI5 A;  2EQJ A;  3QZ9 B;  4JRK A;  1UGS B;  4F7U E;  4ZTF A;  4C5G A;  2RJF A;  3NTH A;  2C06 A;  4KUD K;  5I21 A;  1VIE A;  3ZBD A;  5CAI A;  1N9R A;  1I4K 1;  2CZ1 B;  2A7Y A;  4F7U A;  3JCM f;  1QW1 A;  1M1G A;  4M7A B;  4C0G A;  3M4G A;  4BDY A;  3G71 A;  5GAO p;  1N27 A;  1XNI A;  2HQX A;  3G71 T;  1NZ9 A;  2MWO A;  4M7D C;  3OSV A;  2LTO A;  1K9M U;  1M1K C;  3JCM g;  5GMK i;  2VYT A;  1DJ7 B;  3OY9 A;  1MHN A;  3X28 B;  1S72 T;  2MI6 A;  3ZFJ A;  4V2S A;  1LJO A;  2K5L A;  2LT4 A;  3M57 A;  4KT0 E;  3OBY A;  5GAM h;  2OTL T;  3JCM h;  4HA8 A;  3C94 A;  3JCM Q;  3FDR A;  4C0Z A;  2EQK A;  1KQS S;  2D0Q B;  4O6J A;  3CXC A;  3G7Z A;  2QQ9 A;  4JS5 A;  4PJO B;  5GAN 8;  5HKC A;  1VQ5 A;  3MP1 A;  4R56 A;  2K3X A;  5CKD A;  1M1K U;  3OB9 A;  4ELY C;  5FU7 B;  5HY6 A;  3DKM A;  3C4S A;  5FLX E;  2X4Y A;  3G6E T;  3CPW S;  4ZGD B;  1UEB A;  5GAO m;  4M7D B;  4JLI A;  3FJP A;  2Y4Y A;  5CKB A;  4YTL A;  1VQP A;  4IUU A;  2ZPI B;  4ZGE B;  1W4S A;  2LC4 A;  2O4X A;  3QJ6 A;  3TEE A;  3DB4 A;  5KE3 A;  4A54 A;  2RB6 A;  4OMF B;  2K5F A;  2VXE A;  1NE8 A;  2DXC A;  4M7A G;  4C5H A;  3LX7 A;  4ZGJ B;  2X4J A;  1BI2 A;  5GAO l;  2PUK B;  4E7I A;  2DJZ A;  3MEA A;  3P8H A;  1G3S A;  4QQG A;  1FXX A;  5AYF A;  5GAN e;  2XDD A;  1WGS A;  4ATO A;  2E64 A;  3JCM P;  2D9T A;  4ME7 A;  4BD3 A;  1VQ9 A;  2F5T X;  2DAQ A;  3CCU A;  1W2B S;  5FU6 C;  4GY5 A;  1VQ9 T;  2ZPH B;  1WJQ A;  1YBY A;  1YJ9 T;  1YJW T;  3CCU T;  2K4Y A;  1KC8 C;  3R6O A;  1KG1 A;  4JRI A;  3OYY A;  3C95 A;  4M75 G;  3FRN A;  3M5A A;  2RJD A;  1M90 C;  1ZHI A;  2QQR A;  2QDY B;  4PJO G;  3CD6 T;  2P0K A;  3BDU A;  3OYK A;  2YRV A;  3JB9 H;  5GAO r;  2XU8 A;  3SWN A;  3JCM J;  4EMK C;  5CK9 A;  3CC7 A;  4XAX B;  2MMP A;  3INZ A;  4FL6 A;  3CC7 T;  4OB2 B;  3CCJ T;  1U8R A;  5DLO A;  3CCE A;  1QVG S;  4LDW A;  1QP3 A;  5LJ3 j;  1I81 A;  1LNX A;  4DOV A;  5LJ3 f;  5LJ5 e;  1G5V A;  3MHX A;  3CCV T;  1BKB A;  2RI2 A;  3ME9 A;  4BI4 A;  5GMK m;  4M7D G;  2E6Z A;  2QQB A;  3I56 T;  3JB9 J;  1M90 U;  2DXU A;  5GAO q;  3MP8 A;  3PNW C;  4FM4 B;  5FRO A;  2DD4 A;  1JB0 E;  1M4Z A;  5EG2 A;  5LJ3 g;  4N0A A;  2IVW A;  1QVP A;  3OMG A;  2AHJ B;  4QVC A;  2E6N A;  4C5I A;  1H64 1;  2CZ0 B;  4MMK A;  5LJ3 h;  2E10 A;  3E9G A;  3JB9 G;  1O75 A;  1YIT A;  1EIF A;  4BI8 B;  3VYH B;  1YI2 T;  3JCM b;  1PSE A;  3OBW A;  2ZPG B;  3SFM A;  3OSS C;  4A4H A;  1YHQ A;  5CKH A;  4EMK B;  3N5B B;  1BI1 A;  2DIQ A;  2HBP A;  4C0D B;  2DZ9 A;  2KVQ G;  4PNO A;  4XU0 A;  2JN0 A;  3O8V A;  4ZTJ A;  1VQ7 T;  3M4Y A;  4M78 D;  2DVE A;  1YJN A;  1BI3 A;  1W2B A;  1Y07 A;  4M78 E;  1KQ1 A;  3OS0 A;  3G4S T;  3M55 A;  2PU9 B;  2WSF E;  3A8O B;  3QO3 A;  4M75 F;  4Z02 A;  4N0A C;  5GAN d;  4M78 A;  2YLB A;  3CCM T;  4PJO F;  2K5I A;  2KDS A;  4J6Y A;  3S3N A;  4MDW A;  3URG A;  5GMK h;  2JUF A;  2RK1 A;  2RHX A;  4XTY A;  4IUP A;  5A0L A;  5DM7 R;  3CXC S;  3GPL A;  2LQK A;  4LDY A;  3HRT A;  5D6W A;  3VKI A;  3PTA A;  4E7K A;  2VXF A;  4L6V 5;  1WJS A;  3QDR B;  4JS4 A;  4DQ2 A;  2ZPB B;  3M54 A;  3LLR A;  4OVA A;  1NJI C;  4C5E A;  1BYM A;  3A8M B;  3LWI A;  4MZP A;  4M75 D;  1U1S A;  4J7I A;  4JJN K;  4M7D F;  3HHT B;  1D3B B;  4C92 D;  2EFI A;  3PMI A;  4C92 E;  3E1S A;  2OAU A;  3QZ5 B;  4BAC A;  1VIF A;  5DLQ E;  3UDC A;  3OYM A;  2PUO B;  2RD1 A;  4C8Q D;  4KUI A;  4C92 A;  1RI0 A;  3CEY A;  5LJ5 d;  4C8Q E;  5GAN 3;  3RKY A;  1XOV A;  3OYG A;  4M77 D;  1VQN T;  4M77 E;  2XG8 D;  3X26 B;  3JB9 F;  4C8Q A;  4XU1 A;  4CRI A;  5GAM j;  3VYG A;  3CCS T;  4FSX A;  1NJI U;  5FU7 C;  5GAM f;  2ZPF B;  2BIV A;  3GOX A;  4M77 A;  4MDX A;  4E7J A;  1H3Z A;  1BIB A;  2X35 A;  3OS1 A;  3HFO A;  2PVO B;  3MEU A;  4BE0 A;  1WQ7 A;  3OYA A;  3MET A;  5GAM g;  2LVM A;  3S3M A;  1S72 A;  1VQ8 A;  3V8K A;  4J83 A;  2CS7 A;  2R57 A;  1Q86 C;  1VQ8 T;  3E9F A;  2OTL A;  3JB9 D;  2HQE A;  4X9D A;  4BB7 A;  3AHU A;  2I2L A;  4QVD A;  3DLL A;  2M1H A;  3BY7 A;  2M9U A;  1VQO A;  2Y4X A;  2XK0 A;  3UT1 A;  4OB0 B;  3GF5 A;  1VQM T;  2L5Q A;  2VUB A;  1VQO T;  3CBM A;  4M78 B;  2FL7 A;  2GFA A;  2LT1 A;  2QEX A;  5IAY A;  2F69 A;  3S6W A;  2QEX T;  1YIJ T;  3GLX A;  2DK3 A;  5CR2 A;  4JDS A;  4OGE A;  1VQL T;  3QUI A;  4M7A F;  2WAC A;  2CGH A;  1Q86 U;  2DIG A;  3JB9 I;  1RL2 A;  3G6E A;  5FRM A;  3F70 A;  3RMS A;  3OYJ A;  3JCM e;  3TU4 K;  3EFS A;  3Q1J A;  2K57 A;  2JNG A;  3PGG A;  5GAN f;  2V8I A;  1B34 A;  2YHT A;  3JCM V;  1P92 A;  5C0M A;  2CKK A;  4Y28 E;  3VV0 A;  4XU3 A;  2EJG A;  2HAX A;  3L1A A;  4C92 B;  1Y96 A;  4C0F A;  1HK9 A;  2X4W A;  4BY6 C;  5KH6 A;  4BE1 A;  4FIB A;  5GAN g;  4MML A;  5GAO n;  2RM4 A;  4J6X A;  4XTV A;  4XK8 E;  4F7U B;  4XTX A;  5CVI A;  4M77 B;  1YJ9 A;  3PIP A;  5GAN h;  3L2V A;  1YJW A;  4A4F A;  3WVD B;  4N4H A;  3RIR A;  4A53 A;  3ZEH A;  1OYX A;  3HP9 A;  2CZ6 B;  2XDP A;  5J3B A;  4XU2 A;  4VUB A;  4X9C A;  1KHI A;  3CD6 A;  1JBM A;  2DZC A;  3S3O A;  3CC2 A;  3DLM A;  3M56 A;  5GAN 6;  3X20 B;  4PLI A;  3CC2 T;  4NL2 A;  1N6A A;  2XID A;  3CCJ A;  3PT9 A;  4C0D C;  2E70 A;  3CME A;  1UGR B;  3QG1 A;  1X01 A;  1NPR A;  1X6O A;  1Q81 C;  4B9W A;  5CKF A;  3CME T;  2EJ9 A;  5CCA A;  1R8O B;  3QSU A;  3QBY A;  4IKF A;  2OTJ T;  1GXI E;  2O01 E;  3CBP A;  3FB9 A;  5CQX A;  3CCV A;  3P8B B;  4BY6 B;  1WPY A;  5A2Q E;  3UPU A;  2RA2 A;  3I56 A;  2WSC E;  2CZ7 B;  4XTU A;  3SD4 A;  3J81 E;  2F5K A;  4JLG A;  4OGC A;  3OYD A;  3H6Z A;  5LJ5 h;  4OB1 B;  3L2R A;  3QYG B;  5CO7 A;  3OA6 A;  4HCB A;  1SSF A;  3VUB A;  2EWN A;  1Q81 U;  5J26 A;  3QYH B;  3SWN C;  3QJY A;  3RKW A;  4DOW A;  4EMH A;  3FC3 A;  1YI2 A;  2G3R A;  2VGM A;  3JCM d;  4OB3 B;  3V8L A;  2JTF A;  3BDL A;  5IT9 E;  2K2V A;  2P0Q A;  2KSS A;  2O4X B;  4F7U G;  4MZM A;  1QVF S;  2EQM A;  5GMK j;  3LYI A;  3T9N A;  2DXT A;  1G3W A;  1Y96 B;  3GNF B;  3H8Z A;  2GCX A;  3M58 A;  1VQ7 A;  3J7A F;  4EDU A;  3OYI A;  2XDB A;  1XQH A;  3WXM B;  2LRQ A;  3G4S A;  2E5Q A;  4BUG A;  3CCM A;  2JZ2 A;  4UC4 A;  4FT2 A;  2QA4 A;  4QQ6 A;  4M7A D;  1PSF A;  3HL8 A;  3CC4 T;  3HRS A;  4M7A E;  5LJ3 e;  2L3R A;  2QA4 T;  1BI0 A;  3OYH A;  2NLU A;  2DPP B;  3L2Z A;  4M7A A;  1V29 B;  4HT8 A;  3MEV A;  4J6W A;  4QQD A;  3CCL T;  1UGQ B;  3TCJ A;  3P8D A;  2EKO A;  4IUQ A;  3SWN B;  2XD0 A;  2JOY A;  3QXE B;  3MO8 A;  3VUZ A;  2KK4 A;  4M75 E;  3I55 A;  1VQ6 T;  3NTK A;  3CCR T;  4PJO D;  4ZN1 A;  3OYN A;  3L2U A;  2JVV A;  2PVG B;  3LW5 E;  4NS5 A;  3I55 T;  5M9O A;  1I5L A;  3OS5 A;  4LDX A;  4M75 A;  2DEQ A;  2E12 A;  4B9X A;  1LOJ A;  4JRP A;  4M78 C;  2FB7 A;  4O5V A;  5I2S A;  4PJO A;  1N9S A;  3OQ5 A;  1M8V A;  4E7H A;  3PIO A;  4RCC A;  2LDM A;  1VQN A;  3HSB A;  4LDV A;  3V7R A;  2M16 A;  3QII A;  1KHC A;  1WJR A;  1M5Q 1;  3JSC A;  4OF1 A;  4HKE A;  3JRZ A;  3CCS A;  1Q82 C;  1TH7 A;  2YLC A;  2Y90 A;  4X34 A;  3V8J A;  4E47 A;  5GAN 4;  4PL6 A;  4F7U F;  1QVF A;  4M7D D;  1KQ2 A;  2KY9 A;  4RCB A;  4M7D E;  4J5Y A;  5GAN 7;  2RO0 A;  4D6W A;  3CMA T;  1AHJ B;  4M7D A;  1I8F A;  1Y71 A;  2DXB A;  2RHY A;  3ER0 A;  4PKC C;  3WVE B;  4LDU A;  4GLK A;  3X25 B;  3J80 E;  2QQA A;  1XTD A;  3OYE A;  2WSE E;  4L59 A;  1ZBX A;  4J8O A;  1Q82 U;  4C92 C;  2IG0 A;  2R58 A;  2RJC A;  4XTZ A;  2V8K A;  2EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...