2NWMA

Solution structure of the first sh3 domain of human vinexin and its interaction with the peptides from vinculin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
b'MKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEGEHHGRLGIFPANYVEVLPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinexin
publication title Solution structure of the first SH3 domain of human vinexin and its interaction with vinculin peptides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2nwmA00
2D0NA 1GBRA 2AZSA 2KNBB 2FPEA 2JM8A 1AVZC 3O5ZA 2FO0A 4J9DA 1K0SA 1BB9A 2JW4A 3EHRA 1T0HA 2ROLA 2LX7A 2BZXA 2RN8A 3VRYA 1WDXA 4RTWA 1M3BA 2G6FX 4ORZA 4WCIA 2FPFA 4JJDA 4J9EA 1SHFA 4LUEA 2HDAA 2DRKA 1ARKA 1ZUKA 4D8DA 1CSKA 2GGRA 4F17A 1X2QA 4OMMA 2KGTA 2C0OA 1YP5A 4E6RA 2KRSA 1M8MA 2CH4W 2LNHB 2X3WD 1U5SA 2DLPA 2J05A 1AWXA 1JQQA 2O88A 4CC2A 3UA6A 4IIOA 2JS2A 1M3AA 3THKA 2KR3A 3VS7A 3PVLA 2DF6A 4J9CA 1LCKA 3ULRB 1AEYA 1T0JA 4FSSA 1NLOC 1RUWA 1X6BA 2DILA 1FMKA 2H8HA 3SHWA 2YDLA 4Z8AA 4LNPA 1SHGA 2J6FA 2JMCA 1WXBA 1PRLC 3I5SA 2IIMA 3LH5A 2JS0A 1JO8A 5GJWB 2EGEA 1UDLA 1ZUUA 3H0HA 1QWEA 3REAB 5IXBA 1XOVA 2CDTA 1G83A 1X2KA 4GLMA 1PNJA 1W1FA 1WXUA 3M0PA 2EPDA 1AZEA 2DL8A 3EG2A 1WX6A 4K11A 2SEMA 1ZBJA 2HCKA 2MCNA 1SRLA 2DX1A 4DEXA 1X69A 5L23A 1KIKA 4EIKA 2D1XA 2OAWA 2RQVA 2RF0A 2EYYA 2XMFA 3VS0A 4AFUC 3A98A 3TSWA 1WXTA 2A08A 2DRMA 1W70A 1PHTA 4QT7A 1X27A 2CUBA 2ABLA 1AWOA 1NG2A 4CC4B 1RLPC 2GNCA 5FW9A 5FWCA 2DVJA 2DL5A 1KSWA 1V1CA 2W10A 4ZNXA 2AKLA 4J9BA 2PZ1A 1B07A 2GTOA 1OPKA 2KE9A 1SEMA 1E7OA 2BZYA 2KRNA 2KRMA 4OMNA 4Y92A 1GCPA 1ZUYA 1ZLMA 2V1QA 4JPBW 3SEMA 2L3PA 5IHKA 2HSPA 1UTIA 4AFQC 3M0UA 3RNJA 5ECAA 1MUZA 1SRMA 2A36A 1NYGA 3EHQA 3PE0A 1SPKA 1I0CA 1WYXA 2DMOA 2FPDA 3QWYA 4OMPA 5FWBA 2FRWA 1GCQC 1AD5A 1QWFA 2FG0A 2GQIA 4RTZA 2J7IA 1U06A 2EVRA 1NYFA 4RTUA 2W0ZA 1GRIA 2JM9A 1HD3A 2K2MA 3NPFA 1UUEA 3EG3A 1FYNA 2LP5A 1YN8A 3NMZC 4J9FA 1KFZA 1UG1A 4F16A 2CT4A 2V1RA 3ZL7C 3RBBB 1M30A 1NM7A 2DA9A 1QCFA 2CH4A 3M0QA 4GBQA 2EBPA 2EKHA 2DYBA 2LQNA 1H92A 2LCSA 2ED1A 2L0AA 2RQRA 2L2PA 3FJ5A 4X1VA 2YT6A 1WLPB 3QWXX 2K6DA 2RQUA 2EYWA 1X43A 4IIMA 1HJDA 4OMQA 4JZ3A 1JEGA 1GCQA 1UHFA 1BK2A 2A28A 1H3HA 2K9GA 4LN2A 4HCKA 4LE9A 3TSZA 2F2VA 1Y0MA 4J9GA 2B86A 2OI3A 3JV3A 2M0YA 2K3BA 1HSQA 2F2XA 2LMJA 1U3OA 2AK5A 2D8JA 2J06A 3EGUA 2DL4A 2OJ2A 2O31A 2JXBA 2HEQA 4RTTA 3UA7A 4RTYA 2DNUA 2L3SA 4JZ4A 2ROTA 1Y57A 4RTVA 2JT4A 1IO6A 4R0KA 2CSIA 1AOJA 2NUZA 2VKNA 1X6GA 1I07A 4F14A 2LJ0A 1PKSA 2NWMA 2P4RA 1S1NA 1TUDA 3H0FA 1UJ0A 2PTKA 1UHCA 4J9IA 2K79A 1UFFA 2GTJA 1AZGB 1ABOA 4RTXA 1YNZA 2I0NA 1BBZA 1WI7A 2RQTA 1OV3A 1CKBA 1JU5C 2A37A 3PVQA 2VVKA 1T3SA 1GBQA 1Z9ZA 3VS6A 3VS1A 2LJ3A 1RLQC 1UJYA 5GJVB 1GFCA 2DL7A 2CUDA 4HVWA 2GBQA 1A0NB 1SSHA 2KBTA 2C0TA 2SRCA 3H0IA 2MOXA 2EYXA 4AG1C 4AFSC 5EC7A 1J3TA 1WA7A 1M3CA 2O2OA 4JJCA 3EG1A 2CSQA 3VS5A 1VYTA 1K76A 1M27C 2DBMA 1JXMA 1ZX6A 2LQWA 2J6OA 1YWOA 4CC3A 2BTTA 3C0CA 2J6KA 1NLPC 2PNIA 1GL5A 4HXJA 2KT1A 1PRMC 2YUPA 3NGPA 1QKWA 1ABQA 1MV0B 2C0IA 2E5KA 3EG0A 1NEBA 4LUDA 2JMAA 3R6NA 3VS4A 2HBWA 2LZ6B 3M0TA 2KROA 3U23A 2EW3A 3I35A 1Z9QA 2BZ8A 4ESRA 4JJBA 4Z89A 2FEIA 2ECZA 1E6HA 3M0SA 1H8KA 4D8KA 1RI9A 2DL3A 3KFVA 3VRZA 1OPLA 2O9SA 3H41A 2D8HA 2ED0A 4HVVA 1K4US 3NHNA 5I22A 1QKXA 4DEYA 1CKAA 1OEBA 2YUNA 2RNAA 2CREA 4KRTA 2DE0X 2L3QA 2DJQA 2KXCA 1JXOA 3CQTA 1AWWA 2RMOA 1G2BA 2CT3A 1TG0A 2F2WA 2JTEA 1I1JA 3IQLA 1UECA 4J9HA 1AWJA 3UF4A 1PWTA 3VS3A 2KYMA 2O9VA 2RQWA 3M0RA 2ENMA 3REBB 5IH2A 1QLYA 1KJWA 2FRYA 2KXDA 2KYBA 2X3XD 3GBQA 4HVUA 2ESWA 2EQIA 5IHIA 1K0XA 2DM1A 1B3QA 1E6GA 1YWPA 2QDLA 3I5RA 2M51A 1N5ZA 2EGCA 1OOTA 2K7AA 1VYUA 4OMOA 2AKKA 1EFNA 4A63B 5IXFA 2YUOA 3TVTA 4OMLA 2AZVA 4Z88A 2EGAA 1MV3A 3UATA 1UE9A 3I9QA 1W6XA 4M4ZA 1T3LA 5IHNA 1VA7A 2YSQA 2YUQA 2KT8A 1ZSGA 1PKTA 5I11A 2DBKA 2KEAA 4AG2C 1VYVA 2VWFA 1NEGA 4AFZC 2LJ1A 1WFWA 1YCSB 1K9AA 2RPNA 1BU1A 2MIOA 1K1ZA 5HCKA 4RUGA 1GFDA 1TUCA 1UGVA 1WIEA 2EYZA 4CC7A 3VS2A
chains in the Genus database with same CATH superfamily
2D0NA 1ZHIA 2AZSA 2V26A 2JW4A 4IUQA 4PLIA 1YIJT 1WDXA 4F7UE 3EG9A 3GLXA 1QW1A 5GMKm 1SHFA 4DBQA 2LQ8A 4N4GA 5DY9A 4D8DA 3OYIA 1CSKA 1VQ9A 3EG9B 2VYTA 2F1LA 3OYCA 2C06A 2LNHB 1X01A 1U5SA 1VQ5A 5CIUA 1JQQA 4CC2A 1VQMA 3UA6A 4HCBA 4OGCA 2X4JA 2DD4A 1V76A 4UC4A 4PJOD 3EH1A 1I4K1 1Q95G 2NYSA 4A4HA 2L8DA 4E7KA 1LCKA 2QEXT 4RCBA 2QQSA 4YTLA 1RUWA 1M90U 3HFOA 1MMGA 4IUTA 4PJOC 3OBYA 1M8VA 3RIRA 2BE9B 2M1HA 4LNPA 3V7CA 1WXBA 4FT4A 4BUGA 3JCMQ 2ZZDA 4JRIA 4KH1B 1QVFA 1JO8A 5D7UA 3H0HA 1UDLA 1ZUUA 5IXBA 2X35A 2DTIA 4GLMA 1ZBXA 1PNJA 2LVMA 3BDLA 1WXUA 2WACA 4J6WA 2HKQB 5GAOn 3VUZA 2DX1A 4DEXA 5HKCA 1IHWA 2EJGA 3META 4EIKA 2D1XA 5GMKl 3C12A 1RACB 2RF0A 2XMFA 1VQ4Q 3A98A 2DEUA 4BI3A 2K3XA 4M78G 3CEYA 1RAHB 2ZPHB 2EQUA 4M7AF 4DBFA 3V8KA 2MWOA 1ZA1B 4J9BA 2GTOA 1OPKA 2E6ZA 5IAYA 4A53A 1TU0B 1G3SA 3MP8A 2E5QA 4OMNA 3VKIA 2DZ9A 3SEMA 1HK9A 2HL5C 1RL2A 2AT1B 1G8XA 3M0UA 4M75F 1YJ9Q 1NYGA 2DXCA 5GAOm 4E7ZA 3C4SA 2FPDA 4OMPA 5FWBA 4C92F 2HBPA 1W4SA 1VQ6Q 3CCMA 1GCQC 1JJ2P 5DLOA 5GAOp 3JCMW 3SB2A 2YRCA 2EVRA 5GAN6 1GRIA 3DLLA 1M5Q1 3MP6A 1H3ZA 1HD3A 4RKUE 1BYMA 2F5TX 1VQ8T 4OB3B 1VQ7Q 3OBWA 1FYNA 4BI8B 5GANh 4F16A 4XTXA 3A5ZB 2XU8A 5LJ5g 3JB9F 1NM7A 1IB8A 1QCFA 2ZPBB 2QDYB 1D1AA 5LJ3d 3MCAB 2ZGWA 1G5VA 4HT9A 2LCSA 1Q86U 4Z02A 3LGFA 1QQJA 1YIJQ 2RQUA 3SFMA 5KYYA 5FRMA 1BCMA 3CC2A 3HRSA 4JZ3A 2X4XA 1UHFA 1RAFB 1BK2A 2QQAA 5KYYB 4LN2A 3TSZA 4E7LA 2MMPA 4F7UA 2M9UA 2RI2A 4BE0A 2K3BA 3TREA 1QVFS 3L1AA 1HSQA 2RJCA 2E4HA 1U3OA 4VUBA 2G3RA 2COZA 3CCRT 3EGUA 1M1FA 5KYNA 5D6XA 5GAOl 3X25B 2EKOA 4LDXA 4QKUA 2FZCB 2ROTA 4IURA 2RA2A 3C95A 4DQ2A 2QEXQ 1M90C 2CSIA 2NUZA 2KI7A 1X6GA 3BFMA 4F14A 1UGQB 2LJ0A 3OS1A 1PKSA 2NWMA 4C92E 4J9IA 2K79A 2QXFA 1UFFA 3ASKA 5LJ5f 2YHTA 4J7FA 2JTMA 1WI7A 1JU5C 2A37A 1G3TA 3CCQA 3FIFA 2VVKA 3M54A 4B9WA 3FB9A 3OB9A 1IRXA 1VQPT 4HVWA 4PFOA 2IG0A 1SSHA 3CXCA 2C0TA 4C5EA 2SRCA 2EQMA 1NE8A 4Y91A 2F5KA 2NUPA 3L2ZA 3CCLA 1WA7A 4M7DD 2O2OA 2M02A 2YRDA 3I55A 3CCVT 3KXTA 4C8QF 1PG5B 2NUPB 4OB2B 2VV5A 4O6JA 4QVCA 1C1AA 2YLBA 1B34A 3HTRA 1ZSZA 2OTJA 4DBHA 1WZOA 4LDWA 4HXJA 2YUPA 3NGPA 3EG0A 4LUDA 2JMAA 4X34A 1ZSZB 1M4ZA 2HL3A 5GAN2 2EW3A 3I35A 2XD0A 2QTXA 4C0DB 3JCMf 2LTOA 2MPXC 2FEIA 6AT1B 2RJEA 1RAEB 5IT9E 1VQ4A 3VRZA 3QDRB 2D6FA 2LT4A 4HVVA 2RM4A 2LC4A 1ZQ1A 5AYFA 5GAMg 1VQ8Q 3CCJA 1M9SA 2YUNA 1YITT 2CREA 4QQDA 2RHYA 2KXCA 1MMAA 1NZ9A 1M1GA 1TG0A 5A0LA 1I1JA 1WHGA 2V8KA 4J9HA 3UF4A 2RK1A 1D3BA 4FT2A 1K73R 1Q86C 4EMKA 3M0RA 1XNIA 2ENMA 2COWA 3REBB 1QLYA 2FRYA 2X3XD 3GBQA 1KD1U 1H641 2JJ9A 5GMKh 2ESWA 2EQIA 3DKMA 1YJ9A 5LJ5h 1YHQT 1BI0A 2MYSA 4RMOA 1MGQA 2Y4YA 4OMOA 4A63B 4C8QE 5J26A 4N4HA 1ZSZC 3LWIA 3F70A 2AZVA 3FJPA 2R58A 2EGAA 3S3NA 1VQ7A 1MV3A 1UE9A 4L59A 4C0DC 1T3LA 5IHNA 1VA7A 3CCRQ 4PJJA 1D1BA 5LJ5e 1O75A 2EFIA 2YXYA 1K9AA 1KQ1A 2A0FB 1BU1A 5GAMf 2L3RA 3CXCS 4B9XA 1K1ZA 2JN0A 3OS5A 1GFDA 2LMJA 2I2LA 1UGVA 1WIEA 1D0XA 4M7AB 3SDZA 4CC7A 2DAQA 2KNBB 2FPEA 3L2QA 2FO0A 4J9DA 1N8RU 1KQ2A 3G1JA 4XU3A 2DK3A 3CMET 1T0HA 2ROLA 2FZKB 2LX7A 2QTVA 3CBPA 3VRYA 5FLXE 2G6FX 3UWNA 2FPFA 4J9EA 8ATCB 3NTKA 2RHIA 4C92A 3HHTB 1QVFP 1ARKA 3TQ7P 1VQPQ 3GOXA 4M75B 2XKOC 1X2QA 4EMKC 2KSSA 5GANj 4MZPA 1YP5A 2LCCA 1BIBA 4C92B 2CH4W 2PUKB 1N9SA 2QEXA 2DLPA 2J05A 3TU4K 2EWNA 2HMAA 2E64A 3CCVQ 4HA8A 2B8AA 3QYHB 1M3AA 4OB0B 1PC0A 3JCMe 1NJIU 3JCMV 4HCCA 3INZA 4M7DF 4XTUA 2DXUA 4FSSA 1X6BA 1FMKA 3BE3A 3G7ZA 4M7AD 2YDLA 3A8LB 4Z8AA 1SHGA 1NPRA 3I5SA 1PRLC 1QP3A 1ZA2B 2IIMA 2CZ0B 2JNGA 4M7AC 3QXEB 1G83A 4M77G 2DVEA 3CD6T 2EPDA 4M75D 1AZEA 4FW2A 2EQKA 2SEMA 2IPOB 3BW1A 4ZTFA 5FU6B 2R5MA 4BACA 1X6OA 5L23A 2D0QB 4J7IA 2EYYA 1YITQ 1WXTA 2A08A 3FLGA 4IUPA 4C92C 1WHHA 4C0GA 1X27A 2X51A 2KK4A 4IKFA 5A0GA 1MMDA 1RLPC 2GNCA 4WTOB 3GNFB 3M4YA 5GAMh 3JB9D 3QBYA 3QUIA 1KSWA 2RB6A 1G3YA 1RAGB 1KD1C 1B07A 2KE9A 3GF5A 3MO8A 4BB7A 3JB9H 1YHQQ 4Y92A 1GCPA 1ZUYA 3S6WA 1VQKT 1R8OB 2L3PA 3QZ9B 3M4GA 5GAMe 4Q5WA 3MKDA 4M7DE 3V8LA 1VQ8A 3PE0A 1SPKA 1UEBA 1WYXA 4XTZA 3QWYA 3PFSA 2QASA 1WJSA 2CS7A 4M78F 1QWFA 2GQIA 2DEQA 1U06A 3RESA 2W0ZA 3CC4Q 4A4FA 1YBYA 4C8QA 1UUEA 1M1KR 2O01E 5CCAA 4F7UG 3P8DA 1TOVA 2LP5A 4C8QB 5KYUA 5J3BA 2CH4A 4JUVA 2CP6A 4E2FB 2OTLT 3M0QA 5D6WA 1HYOA 3CMEQ 2L2PA 3FJ5A 4X1VA 5KYUB 3OW2P 1WHMA 1IGUA 1WJRA 2EYWA 3M57A 2CP3A 4OMQA 1AT1B 1GCQA 3CCST 1K8AU 2XDDA 2K9GA 3G4ST 2LNVA 4EMHA 4OF1A 2P4TA 1M1KC 1Y0MA 3M58A 3UDCA 1IGQA 4XTWA 3L2RA 4NOYA 2M0YA 2VASA 4ZGDB 4MMLA 2F2XA 2O4XB 2J06A 2DL4A 3CXCP 2O31A 1UGPB 1OQKA 2HEQA 4RTTA 1NJIC 2DFUA 3CCEA 1D09B 1SG5A 2L3SA 5GMKj 5LJ5j 2JUFA 1Y57A 2DERA 4R0KA 2ZAEA 4C8QD 1AOJA 4DOWA 2LRQA 5KCOA 1K9MU 2P4RA 1VQOT 1UJ0A 2CP7A 1U8RA 5AT1B 2HQHA 1UHCA 4C8QC 2VC8A 3PGGA 2GTJA 1AZGB 2PUOB 1VQPA 2I0NA 1UB4A 3EAEA 2P0PA 3G6ET 1KC8U 1OV3A 3CD6Q 2PU9B 1LOJA 2KDSA 3PVQA 1GBQA 2DKGA 2EJFA 4QVZA 2DL7A 1Q7YU 4JLIA 2QA4A 2KBTA 2GF7A 1FMVA 4XQ3A 1R77A 2MOXA 2EYXA 5I21A 3LGLA 4NS5A 1M3CA 2CSQA 3PIPA 1JXMA 1ZX6A 2PVDB 3URGA 2J6OA 3GNGA 2RJDA 2M0OA 4CC3A 5M9OA 5KE2A 1UGRB 1N9RA 2X9HA 2FYKA 1KG1A 1PRMC 1QKWA 5HY6A 3A8HB 1MV0B 4RG8A 1VQKQ 5CO7A 3R6OA 3VJPA 1YFNA 5GANd 1FXXA 1M90R 4JJBA 3CPWA 1BCOA 2QQRA 3M0SA 1YITA 3OYDA 2R5AA 4D8KA 2DL3A 1VQ9T 2D8HA 2ED0A 1VIFA 3MEVA 5I22A 3RKYA 1Q81U 4MZTA 4XAXB 4M7AE 2EAYA 4M7DA 2XHCA 2L3QA 4LDVA 1G2BA 2RHUA 4CRIA 1Q82U 4PJMA 1VQNT 3OY9A 2OTLQ 1D0YA 1PD1A 1AWJA 1YHQA 4M7DB 1PWTA 3VS3A 3NTHA 4GY5A 4ANJA 2RQWA 4PKCC 2CGHA 4O5VA 5IH2A 1KJWA 3WXMB 4M75E 5CKHA 3M5AA 1RAAB 3DLMA 2ZPIB 1K8AC 4JS4A 1G3WA 3CCSQ 2DO3A 4II1A 1B3QA 1TTHB 3JCMg 1E6GA 1YWPA 3I5RA 3VUBA 1OOTA 1VYUA 1N6AA 3G4SQ 1S72T 2YUOA 3FEOA 4RCCA 2M16A 5CK9A 1KQSA 4OMLA 4C5IA 1I8FA 3RMSA 1MNDA 4RG2A 3I9QA 4C92G 5GAMj 3E19A 2KT8A 5GAOr 1I5OB 2DBKA 2ATCB 4AG2C 2VWFA 3RUXA 1LPLA 3CMAQ 1NEGA 5LL6S 4AFZC 2LJ1A 1WFWA 3FRNA 2FHDA 4FCYA 2VGMA 3PMTA 3OYEA 3CMEA 1OU8A 4PFPA 1Y07A 2MIOA 5GAN5 2E6NA 4RUGA 4LDUA 1VQOQ 2KRNA 2EYZA 3A8GB 1GBRA 3RR6A 2CZ7B 4BI4A 2JM8A 3O5ZA 5KH6A 4MDXA 2K57A 4PJNA 3HRTA 1BB9A 3EHRA 4L6V5 1K0SA 4M7DC 2F69A 2LCLA 2Y90A 5CKDA 2BZXA 3G6EQ 1KC8C 1M3BA 1TS9A 2HSEB 4JJDA 2X4WA 3RERA 2PVOB 1AHJB 2DRKA 1MNEA 1ZUKA 2LQKA 1Q7YC 4F17A 1MHNA 4OMMA 1Q86R 2BUDA 5DM7R 4E6RA 1M8MA 2BIVA 3M53A 3VV0A 3SWNB 4M78B 3J7AF 2X3WD 3LLRA 1RABB 1AWXA 2O88A 3AHUA 4IIOA 3CPWS 1VQLT 1M2OA 3OYJA 3CBOA 1C0MA 3EH2A 2DF6A 1OYXA 4FSXA 1NLOC 2DILA 3CC7T 4ZGEB 4PJOG 2DXBA 2QI2A 4J6XA 2MF2A 3CD6A 3OYBA 2E12A 4KH0B 5GJWB 2EGEA 1QWEA 1XOVA 4BD3A 1X2KA 1W1FA 4MDWA 3M55A 3M0PA 2QK0A 4J6YA 4J8OA 4AMCA 1O9SA 3L2UA 1VQ9Q 2P0KA 2L89A 4JJNK 3EG2A 3OYNA 1ZBJA 2MCNA 1SRLA 1VQ6A 5C0MA 1X69A 3G71T 4M78D 1Q81C 1KIKA 3JRZA 2OAWA 3FC3A 4LDYA 1OZ3A 3DB3A 4L5GA 4AFUC 5LJ5d 1P92A 5J39A 3OS0A 4F04B 1D1CA 4QT7A 3SWNC 4M78C 1VQNQ 1KQSS 1AWOA 4DOVA 1NG2A 1TXQA 3PT9A 5FW9A 5FWCA 3CC4T 2DVJA 1VQKA 2DL5A 2DIQA 5A2QE 4M7AA 1V1CA 2W10A 4ZNXA 4M77F 2AKLA 2JOYA 2QQBA 3ZEHA 2AIRB 2PZ1A 3GIBA 1SEMA 1E7OA 2BZYA 1YIJA 2GCXA 3EGDA 1ZLMA 2V1QA 3OS2A 3HKSA 2WSCE 2ZCFB 2QGFB 4R56A 3EFOB 3QIIA 4KUIA 2HSPA 1UTIA 4AFQC 1S72Q 2BE7D 1Y71A 3RNJA 3N5BB 5ECAA 1WGSA 3EGDB 1SRMA 3CCQT 2A36A 3A8MB 4M75A 2DIGA 2COYA 3KUFA 4PLLA 3LYIA 2RK2A 3OMGA 3MJXA 1AD5A 1RADB 2FG0A 4HCZA 4RTZA 1QMCA 2XICA 3JCMh 1JB0E 4B6MA 1YJWT 4RTUA 5I2MA 2OTLA 3V8JA 2K2MA 3KBGA 3NPFA 1YI2T 4PK4A 2HZYA 5HK3A 3EG3A 1YN8A 1UG1A 2RO0A 3I55T 3JSCA 2CT4A 2V1RA 3ZL7C 1WHLA 3A8OB 3RBBB 1WNLA 1EIFA 1WQ7A 4KBMB 4FYVB 3J80E 2DYBA 2LQNA 3CCSA 3LW5E 1PCXA 1H92A 3VYGA 5EG2A 3QWXX 3G4SA 1SSFA 2K6DA 2HKNA 3JCMX 2GQVA 3SD4A 4IIMA 1HJDA 4QQ6A 1YJNT 1JEGA 3GPLA 1WPYA 2A28A 4JLGA 3PIOA 1H3HA 2OAUA 3NTIA 2ZPGB 2CP0A 1SF9A 4KUDK 4HCKA 9ATCB 4J9GA 1MMNA 4FU6A 1KD1R 2B86A 1IZ6A 2NLUA 1U1SA 4M77E 1FWZA 2MWPA 2AK5A 3ER0A 2D8JA 3HRUA 1VQLQ 1JRIA 2JXBA 3CCJT 1IHVA 1VQOA 4JRPA 4JZ4A 4M75C 5CVIA 4RTVA 2JT4A 3CC7Q 2CP2A 2VKNA 2D9TA 4BE2A 3G6EA 2PTKA 4ELZC 3HSBA 4RTXA 1YNZA 3Q1JA 2DPPB 5LJ3g 1LVKA 4FIBA 1CKBA 4N4IA 2XK0A 3MP1A 2Z0WA 1OX8A 5GAMd 2MAMA 3VS1A 1UJYA 5GJVB 1GFCA 1N8RR 2CUDA 3L42A 3G71Q 2GBQA 4P5NA 1OU9A 1C6VX 3X20B 5KYXA 4QQGA 2QAZA 4AG1C 4AFSC 5EC7A 1J3TA 2K5IA 4JJCA 3EG1A 1VYTA 3I56T 2HD0A 1K76A 1M27C 2DBMA 5KYXB 1F1BB 2OX7A 3E2UA 2VXFA 4DBRA 3OSVA 1U1TA 1WHJA 2RH2A 4EMGA 3C0CA 5FU6C 4M7DG 3OMCA 3L2VA 2K5LA 5GAN8 3QYGB 2V8IA 5D6YA 3V7SA 2PNIA 1XQHA 2DYIA 3V7RA 2C0IA 4C0ZA 1NEBA 3R6NA 1N8RC 1NJIR 2HBWA 2CYZB 2DETA 3M0TA 2KROA 2DTOA 1HXDA 2HQEA 2EQJA 4PJLA 2K4YA 1Y7XA 1Z9QA 3OYFA 3QJ6A 3CCQQ 4ZN1A 4Z89A 1SKUB 2ECZA 1JBMA 1E6HA 4HKEA 1H8KA 3KFVA 4BE1A 4N0AA 2P84A 1VOMA 5LJ3f 4J5YA 1YJWQ 1KQSP 1VQNA 5GANf 3CCRA 1XJWB 2BKDN 1QKXA 2YRVA 1D0ZA 1IXDA 2O4XA 1YI2Q 1OEBA 3CCLQ 2RNAA 1RAIB 4KRTA 2DE0X 1AWWA 1I5LA 2RMOA 3I55Q 1PD0A 4D6WA 1QVGA 2CT3A 2JTEA 1IREB 1B7TA 3S3OA 2XDPA 2P0QA 4JDSA 2KAFA 4FYYB 3CMAT 4EPCA 2O9VA 2OTJQ 2VB6A 4LD9K 2KXDA 1S72A 2KYBA 4PFZA 2VUBA 4HVUA 3HFNA 4XK8E 5IHIA 1YJNQ 4XU1A 2DM1A 3JCMP 4M78E 1N5ZA 3PNWC 2EGCA 4BDYA 3CCUT 3LH0A 1EFNA 5IXFA 1PSFA 3TVTA 1KK7A 4XTVA 4Z88A 2KVQG 5C6SA 1QVPA 2ZPEB 4M4ZA 1ZSGA 3L2WA 3X24B 3CCJQ 4FYXB 4FW1A 3CCVA 2RI3A 3PTAA 3MHXA 1VUBA 2LX9A 4FYWB 4M77A 4N0AC 1FMWA 3ME9A 5HCKA 4OMFB 2K3YA 1WHKA 4E7SA 3PMIA 3VS2A 3HL8A 1AVZC 5FRNA 4M77B 3QJYA 2DD5A 3NFCA 2LT1A 3BDUA 2RN8A 2JTFA 4RTWA 4ORZA 4WCIA 5GAN4 1BKBA 4LUEA 3JCMJ 3EFRA 2HDAA 2VGNA 1YCYA 3QO3A 2GGRA 8AT1B 1ACMB 2KGTA 3MPUB 2C0OA 1VQLA 1KHIA 1W2BA 5LJ3h 5KYWA 2KRSA 4X9CA 5GAN3 1TH7A 3CC7A 3X26B 1K8AR 3I56Q 2JS2A 4OP0A 5KYWB 4HT8A 1EZZB 4J83A 4Y28E 2KR3A 3THKA 1VIEA 3VS7A 2YWWA 1FX7A 3PVLA 4J9CA 3ULRB 5HK0A 1AEYA 1T0JA 2KY9A 4KGZB 4OGEA 1VQ5T 2H8HA 3SHWA 4DA4A 1VQMT 5LJ3e 3OYLA 3QSUA 1N27A 3LWHA 2QYZA 4M77D 2J6FA 3QPHA 5GANe 2JMCA 3LH5A 3TCJA 1QVGS 2JS0A 4M7AG 3REAB 2CDTA 4M77C 3G71A 3WVDB 3OYHA 2H3EB 4PNOA 4ZGJB 1K9MR 2CZ1B 2DL8A 1WX6A 4K11A 2HCKA 1RI0A 4F7UB 5A0DA 3S3MA 4QW2A 2RQVA 1K73U 1TUGB 4M75G 3VS0A 3CC4A 1KC8R 3TSWA 1QP2A 3TEEA 2DRMA 4PJOF 1W70A 4XU2A 2K2VA 1PHTA 2CUBA 4C0FA 3O8VA 2ABLA 2CZ6B 3OW2A 5FROA 2RD1A 3C94A 3OYMA 4KULA 1Q7YR 3CCET 2A7YA 4WF2A 4CC4B 1GXIE 4A4GA 3OYYA 5KE3A 3LX7A 3JB9I 4IUUA 2YLCA 2ZPFB 2KRMA 4OB1B 1K9MC 4JRQA 3JB9G 4JPBW 2KMTA 1OZ2A 3OQ5A 5IHKA 3CCUQ 1YJWA 5KCHA 5GMKi 1MUZA 4A54A 3UPUA 3EHQA 2DJZA 3OYGA 1I0CA 1YI2A 2DMOA 3E9FA 2E41A 2FRWA 2QG9B 2J7IA 4M78A 2QQ9A 3SWNA 4FM4B 2HNIA 1NYFA 2QA4T 2JM9A 4ZTJA 2EIFA 1OX9A 2RHXA 4A4KA 4E47A 3HP9A 3RKWA 2L5QA 5CQYA 3CCMT 3NMZC 3QHSA 1Y96A 4J9FA 4NL2A 2E65A 1KFZA 3VU3C 2DTHA 2JVVA 1W2BS 1M30A 2WSFE 2DA9A 2GFUA 4C5GA 3ZFJA 1B34B 1I81A 4GBQA 2EBPA 2EKHA 1Q81R 1YJNA 1Y96B 2ED1A 2L0AA 2RQRA 2YT6A 1WLPB 5CAIA 3JB9J 2X4YA 3UT1A 5CKBA 1BIAA 2A3LA 2VXEA 5CKEA 1Q82R 1X43A 3H8ZA 3DB4A 4PJOE 2E1HA 2FB7A 4LXCA 3WVEB 2RI5A 3H9NA 3M59A 1JJ2A 3VYHB 2FVUA 4TVRA 4BDZA 4LE9A 2F2VA 4E7HA 2OI3A 3JV3A 3M9QA 3CC2T 1XTDA 4R55A 4BY6B 5GAN7 1X75C 3X28B 2OJ2A 1EX4A 4E7IA 4JS5A 3UA7A 4CI0C 4RTYA 2DNUA 1VQ5Q 3EFSA 1QCNA 1IO6A 2H3JA 1VQMQ 4XU0A 3JCMb 1I07A 2K5FA 1PSEA 2MI6A 3E9GA 1D3BB 1Q82C 3MEWA 4EMKB 2E3IA 3QDFA 1BI2A 1S1NA 1TUDA 3H0FA 4ME7A 2E70A 3FDRA 5CKFA 4C8QG 1ABOA 3OW2S 1OI1A 5IN1A 4XTYA 1BBZA 3T9NA 2AHJB 3EFOA 2RQTA 4KGVB 2QGGA 1T3SA 2HQXA 4EDUA 1Z9ZA 2FL7A 3VS6A 5GMKe 2LJ3A 3RMQA 1RLQC 2LDMA 5DLQE 4OVAA 3OYKA 3I56A 3P8HA 2EJ9A 1A0NB 3OYAA 1K73C 1QCOA 1V29B 2PVGB 4MZMA 3H0IA 3RKXA 5FU7B 1R0CB 3QG1A 2FZGB 3VS5A 1BI1A 2XI9A 3QZ5B 5I2SA 3JCMc 3CCEQ 4BY6C 4X9DA 3M56A 2XDBA 2LQWA 4KGXB 2XIDA 3ZBDA 1YWOA 3E1SA 2BTTA 2J6KA 2DZCA 3CCLT 1QVGP 7AT1B 2MK5A 3JCMd 1NLPC 2EYQA 1GL5A 2KT1A 2RJFA 2CKKA 1UGSB 1ABQA 1PM3A 5LJ3j 2E5KA 3AT1B 3VS4A 2LZ6B 3CBMA 4FL6A 2NUTA 3U23A 4GLKA 1DJ7B 4ELYC 2KQWA 2OTJT 2CP5A 2BZ8A 1M1KU 4ESRA 4IUVA 3J81E 4C5HA 1NBEB 4QVDA 1RI9A 1OPLA 2O9SA 4V2SA 5CR2A 2NUTB 2V8JA 4JRKA 3H41A 2PQWA 1TWBA 2QA4Q 3BY7A 1K4US 3NHNA 3RDVA 1LJOA 3HPWA 4DEYA 1CKAA 4F7UF 1LNXA 4ATOA 3CMAA 1VQ4T 3OSSC 2DJQA 3CQTA 1JXOA 3CCMQ 3OA6A 1JJ2S 2IVWA 2F2WA 5FU7C 2R57A 3MEUA 3QKJA 1WJQA 3IQLA 1UECA 2E3HA 2Y4XA 4LD6A 2KYMA 4MMKA 3H6ZA 4A4EA 4AT1B 2GFAA 3CCUA 2RHZA 3CPFA 1R0BG 4KT0E 1KHCA 1M2VA 3EGXA 4E7JA 2HAXA 1K0XA 3A1PA 2QDLA 2E10A 2M51A 4C92D 2K7AA 2AKKA 1TSFA 1M2VB 3EGXB 3GP8A 1YJ9T 5CQXA 5L8RE 4PL6A 3CC2Q 3D7SB 3MEAA 5GANg 3UATA 1W6XA 2YSQA 2YUQA 1VQ6T 4PJOA 1PKTA 1BI3A 5I11A 1W2BP 2KEAA 1VYVA 2DXTA 3CPWP 5GAOq 3P8BB 4NL3A 1VQ7T 4PJOB 2JZ2A 2XG8D 1YCSB 3JAME 1NPPA 1WQWA 2WSEE 2RPNA 4ZN3A 1OULA 1TUCA
chains in the Genus database with same CATH topology
2D0NA 1GBRA 2AZSA 2KNBB 2FPEA 2JM8A 1AVZC 3O5ZA 2FO0A 4J9DA 1K0SA 1BB9A 2JW4A 3EHRA 1T0HA 2ROLA 2LX7A 2BZXA 2RN8A 3VRYA 1WDXA 4RTWA 1M3BA 2G6FX 4ORZA 4WCIA 2FPFA 4JJDA 4J9EA 1SHFA 4LUEA 2HDAA 2DRKA 1ARKA 1ZUKA 4D8DA 1CSKA 2GGRA 4F17A 1X2QA 4OMMA 2KGTA 2C0OA 1YP5A 4E6RA 2KRSA 1M8MA 2CH4W 2LNHB 2X3WD 1U5SA 2DLPA 2J05A 1AWXA 1JQQA 2O88A 4CC2A 3UA6A 4IIOA 2JS2A 1M3AA 3THKA 2KR3A 3VS7A 3PVLA 2DF6A 4J9CA 1LCKA 3ULRB 1AEYA 1T0JA 4FSSA 1NLOC 1RUWA 1X6BA 2DILA 1FMKA 2H8HA 3SHWA 2YDLA 4Z8AA 4LNPA 1SHGA 2J6FA 2JMCA 1WXBA 1PRLC 3I5SA 2IIMA 3LH5A 2JS0A 1JO8A 5GJWB 2EGEA 1UDLA 1ZUUA 3H0HA 1QWEA 3REAB 5IXBA 1XOVA 2CDTA 1G83A 1X2KA 4GLMA 1PNJA 1W1FA 1WXUA 3M0PA 2EPDA 1AZEA 2DL8A 3EG2A 1WX6A 4K11A 2SEMA 1ZBJA 2HCKA 2MCNA 1SRLA 2DX1A 4DEXA 1X69A 5L23A 1KIKA 4EIKA 2D1XA 2OAWA 2RQVA 2RF0A 2EYYA 2XMFA 3VS0A 4AFUC 3A98A 3TSWA 1WXTA 2A08A 2DRMA 1W70A 1PHTA 4QT7A 1X27A 2CUBA 2ABLA 1AWOA 1NG2A 4CC4B 1RLPC 2GNCA 5FW9A 5FWCA 2DVJA 2DL5A 1KSWA 1V1CA 2W10A 4ZNXA 2AKLA 4J9BA 2PZ1A 1B07A 2GTOA 1OPKA 2KE9A 1SEMA 1E7OA 2BZYA 2KRNA 2KRMA 4OMNA 4Y92A 1GCPA 1ZUYA 1ZLMA 2V1QA 4JPBW 3SEMA 2L3PA 5IHKA 2HSPA 1UTIA 4AFQC 3M0UA 3RNJA 5ECAA 1MUZA 1SRMA 2A36A 1NYGA 3EHQA 3PE0A 1SPKA 1I0CA 1WYXA 2DMOA 2FPDA 3QWYA 4OMPA 5FWBA 2FRWA 1GCQC 1AD5A 1QWFA 2FG0A 2GQIA 4RTZA 2J7IA 1U06A 2EVRA 1NYFA 4RTUA 2W0ZA 1GRIA 2JM9A 1HD3A 2K2MA 3NPFA 1UUEA 3EG3A 1FYNA 2LP5A 1YN8A 3NMZC 4J9FA 1KFZA 1UG1A 4F16A 2CT4A 2V1RA 3ZL7C 3RBBB 1M30A 1NM7A 2DA9A 1QCFA 2CH4A 3M0QA 4GBQA 2EBPA 2EKHA 2DYBA 2LQNA 1H92A 2LCSA 2ED1A 2L0AA 2RQRA 2L2PA 3FJ5A 4X1VA 2YT6A 1WLPB 3QWXX 2K6DA 2RQUA 2EYWA 1X43A 4IIMA 1HJDA 4OMQA 4JZ3A 1JEGA 1GCQA 1UHFA 1BK2A 2A28A 1H3HA 2K9GA 4LN2A 4HCKA 4LE9A 3TSZA 2F2VA 1Y0MA 4J9GA 2B86A 2OI3A 3JV3A 2M0YA 2K3BA 1HSQA 2F2XA 2LMJA 1U3OA 2AK5A 2D8JA 2J06A 3EGUA 2DL4A 2OJ2A 2O31A 2JXBA 2HEQA 4RTTA 3UA7A 4RTYA 2DNUA 2L3SA 4JZ4A 2ROTA 1Y57A 4RTVA 2JT4A 1IO6A 4R0KA 2CSIA 1AOJA 2NUZA 2VKNA 1X6GA 1I07A 4F14A 2LJ0A 1PKSA 2NWMA 2P4RA 1S1NA 1TUDA 3H0FA 1UJ0A 2PTKA 1UHCA 4J9IA 2K79A 1UFFA 2GTJA 1AZGB 1ABOA 4RTXA 1YNZA 2I0NA 1BBZA 1WI7A 2RQTA 1OV3A 1CKBA 1JU5C 2A37A 3PVQA 2VVKA 1T3SA 1GBQA 1Z9ZA 3VS6A 3VS1A 2LJ3A 1RLQC 1UJYA 5GJVB 1GFCA 2DL7A 2CUDA 4HVWA 2GBQA 1A0NB 1SSHA 2KBTA 2C0TA 2SRCA 3H0IA 2MOXA 2EYXA 4AG1C 4AFSC 5EC7A 1J3TA 1WA7A 1M3CA 2O2OA 4JJCA 3EG1A 2CSQA 3VS5A 1VYTA 1K76A 1M27C 2DBMA 1JXMA 1ZX6A 2LQWA 2J6OA 1YWOA 4CC3A 2BTTA 3C0CA 2J6KA 1NLPC 2PNIA 1GL5A 4HXJA 2KT1A 1PRMC 2YUPA 3NGPA 1QKWA 1ABQA 1MV0B 2C0IA 2E5KA 3EG0A 1NEBA 4LUDA 2JMAA 3R6NA 3VS4A 2HBWA 2LZ6B 3M0TA 2KROA 3U23A 2EW3A 3I35A 1Z9QA 2BZ8A 4ESRA 4JJBA 4Z89A 2FEIA 2ECZA 1E6HA 3M0SA 1H8KA 4D8KA 1RI9A 2DL3A 3KFVA 3VRZA 1OPLA 2O9SA 3H41A 2D8HA 2ED0A 4HVVA 1K4US 3NHNA 5I22A 1QKXA 4DEYA 1CKAA 1OEBA 2YUNA 2RNAA 2CREA 4KRTA 2DE0X 2L3QA 2DJQA 2KXCA 1JXOA 3CQTA 1AWWA 2RMOA 1G2BA 2CT3A 1TG0A 2F2WA 2JTEA 1I1JA 3IQLA 1UECA 4J9HA 1AWJA 3UF4A 1PWTA 3VS3A 2KYMA 2O9VA 2RQWA 3M0RA 2ENMA 3REBB 5IH2A 1QLYA 1KJWA 2FRYA 2KXDA 2KYBA 2X3XD 3GBQA 4HVUA 2ESWA 2EQIA 5IHIA 1K0XA 2DM1A 1B3QA 1E6GA 1YWPA 2QDLA 3I5RA 2M51A 1N5ZA 2EGCA 1OOTA 2K7AA 1VYUA 4OMOA 2AKKA 1EFNA 4A63B 5IXFA 2YUOA 3TVTA 4OMLA 2AZVA 4Z88A 2EGAA 1MV3A 3UATA 1UE9A 3I9QA 1W6XA 4M4ZA 1T3LA 5IHNA 1VA7A 2YSQA 2YUQA 2KT8A 1ZSGA 1PKTA 5I11A 2DBKA 2KEAA 4AG2C 1VYVA 2VWFA 1NEGA 4AFZC 2LJ1A 1WFWA 1YCSB 1K9AA 2RPNA 1BU1A 2MIOA 1K1ZA 5HCKA 4RUGA 1GFDA 1TUCA 1UGVA 1WIEA 2EYZA 4CC7A 3VS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0N A;  1GBR A;  2AZS A;  2KNB B;  2FPE A;  2JM8 A;  1AVZ C;  3O5Z A;  2FO0 A;  4J9D A;  1K0S A;  1BB9 A;  2JW4 A;  3EHR A;  1T0H A;  2ROL A;  2LX7 A;  2BZX A;  2RN8 A;  3VRY A;  1WDX A;  4RTW A;  1M3B A;  2G6F X;  4ORZ A;  4WCI A;  2FPF A;  4JJD A;  4J9E A;  1SHF A;  4LUE A;  2HDA A;  2DRK A;  1ARK A;  1ZUK A;  4D8D A;  1CSK A;  2GGR A;  4F17 A;  1X2Q A;  4OMM A;  2KGT A;  2C0O A;  1YP5 A;  4E6R A;  2KRS A;  1M8M A;  2CH4 W;  2LNH B;  2X3W D;  1U5S A;  2DLP A;  2J05 A;  1AWX A;  1JQQ A;  2O88 A;  4CC2 A;  3UA6 A;  4IIO A;  2JS2 A;  1M3A A;  3THK A;  2KR3 A;  3VS7 A;  3PVL A;  2DF6 A;  4J9C A;  1LCK A;  3ULR B;  1AEY A;  1T0J A;  4FSS A;  1NLO C;  1RUW A;  1X6B A;  2DIL A;  1FMK A;  2H8H A;  3SHW A;  2YDL A;  4Z8A A;  4LNP A;  1SHG A;  2J6F A;  2JMC A;  1WXB A;  1PRL C;  3I5S A;  2IIM A;  3LH5 A;  2JS0 A;  1JO8 A;  5GJW B;  2EGE A;  1UDL A;  1ZUU A;  3H0H A;  1QWE A;  3REA B;  5IXB A;  1XOV A;  2CDT A;  1G83 A;  1X2K A;  4GLM A;  1PNJ A;  1W1F A;  1WXU A;  3M0P A;  2EPD A;  1AZE A;  2DL8 A;  3EG2 A;  1WX6 A;  4K11 A;  2SEM A;  1ZBJ A;  2HCK A;  2MCN A;  1SRL A;  2DX1 A;  4DEX A;  1X69 A;  5L23 A;  1KIK A;  4EIK A;  2D1X A;  2OAW A;  2RQV A;  2RF0 A;  2EYY A;  2XMF A;  3VS0 A;  4AFU C;  3A98 A;  3TSW A;  1WXT A;  2A08 A;  2DRM A;  1W70 A;  1PHT A;  4QT7 A;  1X27 A;  2CUB A;  2ABL A;  1AWO A;  1NG2 A;  4CC4 B;  1RLP C;  2GNC A;  5FW9 A;  5FWC A;  2DVJ A;  2DL5 A;  1KSW A;  1V1C A;  2W10 A;  4ZNX A;  2AKL A;  4J9B A;  2PZ1 A;  1B07 A;  2GTO A;  1OPK A;  2KE9 A;  1SEM A;  1E7O A;  2BZY A;  2KRN A;  2KRM A;  4OMN A;  4Y92 A;  1GCP A;  1ZUY A;  1ZLM A;  2V1Q A;  4JPB W;  3SEM A;  2L3P A;  5IHK A;  2HSP A;  1UTI A;  4AFQ C;  3M0U A;  3RNJ A;  5ECA A;  1MUZ A;  1SRM A;  2A36 A;  1NYG A;  3EHQ A;  3PE0 A;  1SPK A;  1I0C A;  1WYX A;  2DMO A;  2FPD A;  3QWY A;  4OMP A;  5FWB A;  2FRW A;  1GCQ C;  1AD5 A;  1QWF A;  2FG0 A;  2GQI A;  4RTZ A;  2J7I A;  1U06 A;  2EVR A;  1NYF A;  4RTU A;  2W0Z A;  1GRI A;  2JM9 A;  1HD3 A;  2K2M A;  3NPF A;  1UUE A;  3EG3 A;  1FYN A;  2LP5 A;  1YN8 A;  3NMZ C;  4J9F A;  1KFZ A;  1UG1 A;  4F16 A;  2CT4 A;  2V1R A;  3ZL7 C;  3RBB B;  1M30 A;  1NM7 A;  2DA9 A;  1QCF A;  2CH4 A;  3M0Q A;  4GBQ A;  2EBP A;  2EKH A;  2DYB A;  2LQN A;  1H92 A;  2LCS A;  2ED1 A;  2L0A A;  2RQR A;  2L2P A;  3FJ5 A;  4X1V A;  2YT6 A;  1WLP B;  3QWX X;  2K6D A;  2RQU A;  2EYW A;  1X43 A;  4IIM A;  1HJD A;  4OMQ A;  4JZ3 A;  1JEG A;  1GCQ A;  1UHF A;  1BK2 A;  2A28 A;  1H3H A;  2K9G A;  4LN2 A;  4HCK A;  4LE9 A;  3TSZ A;  2F2V A;  1Y0M A;  4J9G A;  2B86 A;  2OI3 A;  3JV3 A;  2M0Y A;  2K3B A;  1HSQ A;  2F2X A;  2LMJ A;  1U3O A;  2AK5 A;  2D8J A;  2J06 A;  3EGU A;  2DL4 A;  2OJ2 A;  2O31 A;  2JXB A;  2HEQ A;  4RTT A;  3UA7 A;  4RTY A;  2DNU A;  2L3S A;  4JZ4 A;  2ROT A;  1Y57 A;  4RTV A;  2JT4 A;  1IO6 A;  4R0K A;  2CSI A;  1AOJ A;  2NUZ A;  2VKN A;  1X6G A;  1I07 A;  4F14 A;  2LJ0 A;  1PKS A;  2NWM A;  2P4R A;  1S1N A;  1TUD A;  3H0F A;  1UJ0 A;  2PTK A;  1UHC A;  4J9I A;  2K79 A;  1UFF A;  2GTJ A;  1AZG B;  1ABO A;  4RTX A;  1YNZ A;  2I0N A;  1BBZ A;  1WI7 A;  2RQT A;  1OV3 A;  1CKB A;  1JU5 C;  2A37 A;  3PVQ A;  2VVK A;  1T3S A;  1GBQ A;  1Z9Z A;  3VS6 A;  3VS1 A;  2LJ3 A;  1RLQ C;  1UJY A;  5GJV B;  1GFC A;  2DL7 A;  2CUD A;  4HVW A;  2GBQ A;  1A0N B;  1SSH A;  2KBT A;  2C0T A;  2SRC A;  3H0I A;  2MOX A;  2EYX A;  4AG1 C;  4AFS C;  5EC7 A;  1J3T A;  1WA7 A;  1M3C A;  2O2O A;  4JJC A;  3EG1 A;  2CSQ A;  3VS5 A;  1VYT A;  1K76 A;  1M27 C;  2DBM A;  1JXM A;  1ZX6 A;  2LQW A;  2J6O A;  1YWO A;  4CC3 A;  2BTT A;  3C0C A;  2J6K A;  1NLP C;  2PNI A;  1GL5 A;  4HXJ A;  2KT1 A;  1PRM C;  2YUP A;  3NGP A;  1QKW A;  1ABQ A;  1MV0 B;  2C0I A;  2E5K A;  3EG0 A;  1NEB A;  4LUD A;  2JMA A;  3R6N A;  3VS4 A;  2HBW A;  2LZ6 B;  3M0T A;  2KRO A;  3U23 A;  2EW3 A;  3I35 A;  1Z9Q A;  2BZ8 A;  4ESR A;  4JJB A;  4Z89 A;  2FEI A;  2ECZ A;  1E6H A;  3M0S A;  1H8K A;  4D8K A;  1RI9 A;  2DL3 A;  3KFV A;  3VRZ A;  1OPL A;  2O9S A;  3H41 A;  2D8H A;  2ED0 A;  4HVV A;  1K4U S;  3NHN A;  5I22 A;  1QKX A;  4DEY A;  1CKA A;  1OEB A;  2YUN A;  2RNA A;  2CRE A;  4KRT A;  2DE0 X;  2L3Q A;  2DJQ A;  2KXC A;  1JXO A;  3CQT A;  1AWW A;  2RMO A;  1G2B A;  2CT3 A;  1TG0 A;  2F2W A;  2JTE A;  1I1J A;  3IQL A;  1UEC A;  4J9H A;  1AWJ A;  3UF4 A;  1PWT A;  3VS3 A;  2KYM A;  2O9V A;  2RQW A;  3M0R A;  2ENM A;  3REB B;  5IH2 A;  1QLY A;  1KJW A;  2FRY A;  2KXD A;  2KYB A;  2X3X D;  3GBQ A;  4HVU A;  2ESW A;  2EQI A;  5IHI A;  1K0X A;  2DM1 A;  1B3Q A;  1E6G A;  1YWP A;  2QDL A;  3I5R A;  2M51 A;  1N5Z A;  2EGC A;  1OOT A;  2K7A A;  1VYU A;  4OMO A;  2AKK A;  1EFN A;  4A63 B;  5IXF A;  2YUO A;  3TVT A;  4OML A;  2AZV A;  4Z88 A;  2EGA A;  1MV3 A;  3UAT A;  1UE9 A;  3I9Q A;  1W6X A;  4M4Z A;  1T3L A;  5IHN A;  1VA7 A;  2YSQ A;  2YUQ A;  2KT8 A;  1ZSG A;  1PKT A;  5I11 A;  2DBK A;  2KEA A;  4AG2 C;  1VYV A;  2VWF A;  1NEG A;  4AFZ C;  2LJ1 A;  1WFW A;  1YCS B;  1K9A A;  2RPN A;  1BU1 A;  2MIO A;  1K1Z A;  5HCK A;  4RUG A;  1GFD A;  1TUC A;  1UGV A;  1WIE A;  2EYZ A;  4CC7 A;  3VS2 A; 
#chains in the Genus database with same CATH topology
 2D0N A;  1ZHI A;  2AZS A;  2V26 A;  2JW4 A;  4IUQ A;  4PLI A;  1YIJ T;  1WDX A;  4F7U E;  3EG9 A;  3GLX A;  1QW1 A;  5GMK m;  1SHF A;  4DBQ A;  2LQ8 A;  4N4G A;  5DY9 A;  4D8D A;  3OYI A;  1CSK A;  1VQ9 A;  3EG9 B;  2VYT A;  2F1L A;  3OYC A;  2C06 A;  2LNH B;  1X01 A;  1U5S A;  1VQ5 A;  5CIU A;  1JQQ A;  4CC2 A;  1VQM A;  3UA6 A;  4HCB A;  4OGC A;  2X4J A;  2DD4 A;  1V76 A;  4UC4 A;  4PJO D;  3EH1 A;  1I4K 1;  1Q95 G;  2NYS A;  4A4H A;  2L8D A;  4E7K A;  1LCK A;  2QEX T;  4RCB A;  2QQS A;  4YTL A;  1RUW A;  1M90 U;  3HFO A;  1MMG A;  4IUT A;  4PJO C;  3OBY A;  1M8V A;  3RIR A;  2BE9 B;  2M1H A;  4LNP A;  3V7C A;  1WXB A;  4FT4 A;  4BUG A;  3JCM Q;  2ZZD A;  4JRI A;  4KH1 B;  1QVF A;  1JO8 A;  5D7U A;  3H0H A;  1UDL A;  1ZUU A;  5IXB A;  2X35 A;  2DTI A;  4GLM A;  1ZBX A;  1PNJ A;  2LVM A;  3BDL A;  1WXU A;  2WAC A;  4J6W A;  2HKQ B;  5GAO n;  3VUZ A;  2DX1 A;  4DEX A;  5HKC A;  1IHW A;  2EJG A;  3MET A;  4EIK A;  2D1X A;  5GMK l;  3C12 A;  1RAC B;  2RF0 A;  2XMF A;  1VQ4 Q;  3A98 A;  2DEU A;  4BI3 A;  2K3X A;  4M78 G;  3CEY A;  1RAH B;  2ZPH B;  2EQU A;  4M7A F;  4DBF A;  3V8K A;  2MWO A;  1ZA1 B;  4J9B A;  2GTO A;  1OPK A;  2E6Z A;  5IAY A;  4A53 A;  1TU0 B;  1G3S A;  3MP8 A;  2E5Q A;  4OMN A;  3VKI A;  2DZ9 A;  3SEM A;  1HK9 A;  2HL5 C;  1RL2 A;  2AT1 B;  1G8X A;  3M0U A;  4M75 F;  1YJ9 Q;  1NYG A;  2DXC A;  5GAO m;  4E7Z A;  3C4S A;  2FPD A;  4OMP A;  5FWB A;  4C92 F;  2HBP A;  1W4S A;  1VQ6 Q;  3CCM A;  1GCQ C;  1JJ2 P;  5DLO A;  5GAO p;  3JCM W;  3SB2 A;  2YRC A;  2EVR A;  5GAN 6;  1GRI A;  3DLL A;  1M5Q 1;  3MP6 A;  1H3Z A;  1HD3 A;  4RKU E;  1BYM A;  2F5T X;  1VQ8 T;  4OB3 B;  1VQ7 Q;  3OBW A;  1FYN A;  4BI8 B;  5GAN h;  4F16 A;  4XTX A;  3A5Z B;  2XU8 A;  5LJ5 g;  3JB9 F;  1NM7 A;  1IB8 A;  1QCF A;  2ZPB B;  2QDY B;  1D1A A;  5LJ3 d;  3MCA B;  2ZGW A;  1G5V A;  4HT9 A;  2LCS A;  1Q86 U;  4Z02 A;  3LGF A;  1QQJ A;  1YIJ Q;  2RQU A;  3SFM A;  5KYY A;  5FRM A;  1BCM A;  3CC2 A;  3HRS A;  4JZ3 A;  2X4X A;  1UHF A;  1RAF B;  1BK2 A;  2QQA A;  5KYY B;  4LN2 A;  3TSZ A;  4E7L A;  2MMP A;  4F7U A;  2M9U A;  2RI2 A;  4BE0 A;  2K3B A;  3TRE A;  1QVF S;  3L1A A;  1HSQ A;  2RJC A;  2E4H A;  1U3O A;  4VUB A;  2G3R A;  2COZ A;  3CCR T;  3EGU A;  1M1F A;  5KYN A;  5D6X A;  5GAO l;  3X25 B;  2EKO A;  4LDX A;  4QKU A;  2FZC B;  2ROT A;  4IUR A;  2RA2 A;  3C95 A;  4DQ2 A;  2QEX Q;  1M90 C;  2CSI A;  2NUZ A;  2KI7 A;  1X6G A;  3BFM A;  4F14 A;  1UGQ B;  2LJ0 A;  3OS1 A;  1PKS A;  2NWM A;  4C92 E;  4J9I A;  2K79 A;  2QXF A;  1UFF A;  3ASK A;  5LJ5 f;  2YHT A;  4J7F A;  2JTM A;  1WI7 A;  1JU5 C;  2A37 A;  1G3T A;  3CCQ A;  3FIF A;  2VVK A;  3M54 A;  4B9W A;  3FB9 A;  3OB9 A;  1IRX A;  1VQP T;  4HVW A;  4PFO A;  2IG0 A;  1SSH A;  3CXC A;  2C0T A;  4C5E A;  2SRC A;  2EQM A;  1NE8 A;  4Y91 A;  2F5K A;  2NUP A;  3L2Z A;  3CCL A;  1WA7 A;  4M7D D;  2O2O A;  2M02 A;  2YRD A;  3I55 A;  3CCV T;  3KXT A;  4C8Q F;  1PG5 B;  2NUP B;  4OB2 B;  2VV5 A;  4O6J A;  4QVC A;  1C1A A;  2YLB A;  1B34 A;  3HTR A;  1ZSZ A;  2OTJ A;  4DBH A;  1WZO A;  4LDW A;  4HXJ A;  2YUP A;  3NGP A;  3EG0 A;  4LUD A;  2JMA A;  4X34 A;  1ZSZ B;  1M4Z A;  2HL3 A;  5GAN 2;  2EW3 A;  3I35 A;  2XD0 A;  2QTX A;  4C0D B;  3JCM f;  2LTO A;  2MPX C;  2FEI A;  6AT1 B;  2RJE A;  1RAE B;  5IT9 E;  1VQ4 A;  3VRZ A;  3QDR B;  2D6F A;  2LT4 A;  4HVV A;  2RM4 A;  2LC4 A;  1ZQ1 A;  5AYF A;  5GAM g;  1VQ8 Q;  3CCJ A;  1M9S A;  2YUN A;  1YIT T;  2CRE A;  4QQD A;  2RHY A;  2KXC A;  1MMA A;  1NZ9 A;  1M1G A;  1TG0 A;  5A0L A;  1I1J A;  1WHG A;  2V8K A;  4J9H A;  3UF4 A;  2RK1 A;  1D3B A;  4FT2 A;  1K73 R;  1Q86 C;  4EMK A;  3M0R A;  1XNI A;  2ENM A;  2COW A;  3REB B;  1QLY A;  2FRY A;  2X3X D;  3GBQ A;  1KD1 U;  1H64 1;  2JJ9 A;  5GMK h;  2ESW A;  2EQI A;  3DKM A;  1YJ9 A;  5LJ5 h;  1YHQ T;  1BI0 A;  2MYS A;  4RMO A;  1MGQ A;  2Y4Y A;  4OMO A;  4A63 B;  4C8Q E;  5J26 A;  4N4H A;  1ZSZ C;  3LWI A;  3F70 A;  2AZV A;  3FJP A;  2R58 A;  2EGA A;  3S3N A;  1VQ7 A;  1MV3 A;  1UE9 A;  4L59 A;  4C0D C;  1T3L A;  5IHN A;  1VA7 A;  3CCR Q;  4PJJ A;  1D1B A;  5LJ5 e;  1O75 A;  2EFI A;  2YXY A;  1K9A A;  1KQ1 A;  2A0F B;  1BU1 A;  5GAM f;  2L3R A;  3CXC S;  4B9X A;  1K1Z A;  2JN0 A;  3OS5 A;  1GFD A;  2LMJ A;  2I2L A;  1UGV A;  1WIE A;  1D0X A;  4M7A B;  3SDZ A;  4CC7 A;  2DAQ A;  2KNB B;  2FPE A;  3L2Q A;  2FO0 A;  4J9D A;  1N8R U;  1KQ2 A;  3G1J A;  4XU3 A;  2DK3 A;  3CME T;  1T0H A;  2ROL A;  2FZK B;  2LX7 A;  2QTV A;  3CBP A;  3VRY A;  5FLX E;  2G6F X;  3UWN A;  2FPF A;  4J9E A;  8ATC B;  3NTK A;  2RHI A;  4C92 A;  3HHT B;  1QVF P;  1ARK A;  3TQ7 P;  1VQP Q;  3GOX A;  4M75 B;  2XKO C;  1X2Q A;  4EMK C;  2KSS A;  5GAN j;  4MZP A;  1YP5 A;  2LCC A;  1BIB A;  4C92 B;  2CH4 W;  2PUK B;  1N9S A;  2QEX A;  2DLP A;  2J05 A;  3TU4 K;  2EWN A;  2HMA A;  2E64 A;  3CCV Q;  4HA8 A;  2B8A A;  3QYH B;  1M3A A;  4OB0 B;  1PC0 A;  3JCM e;  1NJI U;  3JCM V;  4HCC A;  3INZ A;  4M7D F;  4XTU A;  2DXU A;  4FSS A;  1X6B A;  1FMK A;  3BE3 A;  3G7Z A;  4M7A D;  2YDL A;  3A8L B;  4Z8A A;  1SHG A;  1NPR A;  3I5S A;  1PRL C;  1QP3 A;  1ZA2 B;  2IIM A;  2CZ0 B;  2JNG A;  4M7A C;  3QXE B;  1G83 A;  4M77 G;  2DVE A;  3CD6 T;  2EPD A;  4M75 D;  1AZE A;  4FW2 A;  2EQK A;  2SEM A;  2IPO B;  3BW1 A;  4ZTF A;  5FU6 B;  2R5M A;  4BAC A;  1X6O A;  5L23 A;  2D0Q B;  4J7I A;  2EYY A;  1YIT Q;  1WXT A;  2A08 A;  3FLG A;  4IUP A;  4C92 C;  1WHH A;  4C0G A;  1X27 A;  2X51 A;  2KK4 A;  4IKF A;  5A0G A;  1MMD A;  1RLP C;  2GNC A;  4WTO B;  3GNF B;  3M4Y A;  5GAM h;  3JB9 D;  3QBY A;  3QUI A;  1KSW A;  2RB6 A;  1G3Y A;  1RAG B;  1KD1 C;  1B07 A;  2KE9 A;  3GF5 A;  3MO8 A;  4BB7 A;  3JB9 H;  1YHQ Q;  4Y92 A;  1GCP A;  1ZUY A;  3S6W A;  1VQK T;  1R8O B;  2L3P A;  3QZ9 B;  3M4G A;  5GAM e;  4Q5W A;  3MKD A;  4M7D E;  3V8L A;  1VQ8 A;  3PE0 A;  1SPK A;  1UEB A;  1WYX A;  4XTZ A;  3QWY A;  3PFS A;  2QAS A;  1WJS A;  2CS7 A;  4M78 F;  1QWF A;  2GQI A;  2DEQ A;  1U06 A;  3RES A;  2W0Z A;  3CC4 Q;  4A4F A;  1YBY A;  4C8Q A;  1UUE A;  1M1K R;  2O01 E;  5CCA A;  4F7U G;  3P8D A;  1TOV A;  2LP5 A;  4C8Q B;  5KYU A;  5J3B A;  2CH4 A;  4JUV A;  2CP6 A;  4E2F B;  2OTL T;  3M0Q A;  5D6W A;  1HYO A;  3CME Q;  2L2P A;  3FJ5 A;  4X1V A;  5KYU B;  3OW2 P;  1WHM A;  1IGU A;  1WJR A;  2EYW A;  3M57 A;  2CP3 A;  4OMQ A;  1AT1 B;  1GCQ A;  3CCS T;  1K8A U;  2XDD A;  2K9G A;  3G4S T;  2LNV A;  4EMH A;  4OF1 A;  2P4T A;  1M1K C;  1Y0M A;  3M58 A;  3UDC A;  1IGQ A;  4XTW A;  3L2R A;  4NOY A;  2M0Y A;  2VAS A;  4ZGD B;  4MML A;  2F2X A;  2O4X B;  2J06 A;  2DL4 A;  3CXC P;  2O31 A;  1UGP B;  1OQK A;  2HEQ A;  4RTT A;  1NJI C;  2DFU A;  3CCE A;  1D09 B;  1SG5 A;  2L3S A;  5GMK j;  5LJ5 j;  2JUF A;  1Y57 A;  2DER A;  4R0K A;  2ZAE A;  4C8Q D;  1AOJ A;  4DOW A;  2LRQ A;  5KCO A;  1K9M U;  2P4R A;  1VQO T;  1UJ0 A;  2CP7 A;  1U8R A;  5AT1 B;  2HQH A;  1UHC A;  4C8Q C;  2VC8 A;  3PGG A;  2GTJ A;  1AZG B;  2PUO B;  1VQP A;  2I0N A;  1UB4 A;  3EAE A;  2P0P A;  3G6E T;  1KC8 U;  1OV3 A;  3CD6 Q;  2PU9 B;  1LOJ A;  2KDS A;  3PVQ A;  1GBQ A;  2DKG A;  2EJF A;  4QVZ A;  2DL7 A;  1Q7Y U;  4JLI A;  2QA4 A;  2KBT A;  2GF7 A;  1FMV A;  4XQ3 A;  1R77 A;  2MOX A;  2EYX A;  5I21 A;  3LGL A;  4NS5 A;  1M3C A;  2CSQ A;  3PIP A;  1JXM A;  1ZX6 A;  2PVD B;  3URG A;  2J6O A;  3GNG A;  2RJD A;  2M0O A;  4CC3 A;  5M9O A;  5KE2 A;  1UGR B;  1N9R A;  2X9H A;  2FYK A;  1KG1 A;  1PRM C;  1QKW A;  5HY6 A;  3A8H B;  1MV0 B;  4RG8 A;  1VQK Q;  5CO7 A;  3R6O A;  3VJP A;  1YFN A;  5GAN d;  1FXX A;  1M90 R;  4JJB A;  3CPW A;  1BCO A;  2QQR A;  3M0S A;  1YIT A;  3OYD A;  2R5A A;  4D8K A;  2DL3 A;  1VQ9 T;  2D8H A;  2ED0 A;  1VIF A;  3MEV A;  5I22 A;  3RKY A;  1Q81 U;  4MZT A;  4XAX B;  4M7A E;  2EAY A;  4M7D A;  2XHC A;  2L3Q A;  4LDV A;  1G2B A;  2RHU A;  4CRI A;  1Q82 U;  4PJM A;  1VQN T;  3OY9 A;  2OTL Q;  1D0Y A;  1PD1 A;  1AWJ A;  1YHQ A;  4M7D B;  1PWT A;  3VS3 A;  3NTH A;  4GY5 A;  4ANJ A;  2RQW A;  4PKC C;  2CGH A;  4O5V A;  5IH2 A;  1KJW A;  3WXM B;  4M75 E;  5CKH A;  3M5A A;  1RAA B;  3DLM A;  2ZPI B;  1K8A C;  4JS4 A;  1G3W A;  3CCS Q;  2DO3 A;  4II1 A;  1B3Q A;  1TTH B;  3JCM g;  1E6G A;  1YWP A;  3I5R A;  3VUB A;  1OOT A;  1VYU A;  1N6A A;  3G4S Q;  1S72 T;  2YUO A;  3FEO A;  4RCC A;  2M16 A;  5CK9 A;  1KQS A;  4OML A;  4C5I A;  1I8F A;  3RMS A;  1MND A;  4RG2 A;  3I9Q A;  4C92 G;  5GAM j;  3E19 A;  2KT8 A;  5GAO r;  1I5O B;  2DBK A;  2ATC B;  4AG2 C;  2VWF A;  3RUX A;  1LPL A;  3CMA Q;  1NEG A;  5LL6 S;  4AFZ C;  2LJ1 A;  1WFW A;  3FRN A;  2FHD A;  4FCY A;  2VGM A;  3PMT A;  3OYE A;  3CME A;  1OU8 A;  4PFP A;  1Y07 A;  2MIO A;  5GAN 5;  2E6N A;  4RUG A;  4LDU A;  1VQO Q;  2KRN A;  2EYZ A;  3A8G B;  1GBR A;  3RR6 A;  2CZ7 B;  4BI4 A;  2JM8 A;  3O5Z A;  5KH6 A;  4MDX A;  2K57 A;  4PJN A;  3HRT A;  1BB9 A;  3EHR A;  4L6V 5;  1K0S A;  4M7D C;  2F69 A;  2LCL A;  2Y90 A;  5CKD A;  2BZX A;  3G6E Q;  1KC8 C;  1M3B A;  1TS9 A;  2HSE B;  4JJD A;  2X4W A;  3RER A;  2PVO B;  1AHJ B;  2DRK A;  1MNE A;  1ZUK A;  2LQK A;  1Q7Y C;  4F17 A;  1MHN A;  4OMM A;  1Q86 R;  2BUD A;  5DM7 R;  4E6R A;  1M8M A;  2BIV A;  3M53 A;  3VV0 A;  3SWN B;  4M78 B;  3J7A F;  2X3W D;  3LLR A;  1RAB B;  1AWX A;  2O88 A;  3AHU A;  4IIO A;  3CPW S;  1VQL T;  1M2O A;  3OYJ A;  3CBO A;  1C0M A;  3EH2 A;  2DF6 A;  1OYX A;  4FSX A;  1NLO C;  2DIL A;  3CC7 T;  4ZGE B;  4PJO G;  2DXB A;  2QI2 A;  4J6X A;  2MF2 A;  3CD6 A;  3OYB A;  2E12 A;  4KH0 B;  5GJW B;  2EGE A;  1QWE A;  1XOV A;  4BD3 A;  1X2K A;  1W1F A;  4MDW A;  3M55 A;  3M0P A;  2QK0 A;  4J6Y A;  4J8O A;  4AMC A;  1O9S A;  3L2U A;  1VQ9 Q;  2P0K A;  2L89 A;  4JJN K;  3EG2 A;  3OYN A;  1ZBJ A;  2MCN A;  1SRL A;  1VQ6 A;  5C0M A;  1X69 A;  3G71 T;  4M78 D;  1Q81 C;  1KIK A;  3JRZ A;  2OAW A;  3FC3 A;  4LDY A;  1OZ3 A;  3DB3 A;  4L5G A;  4AFU C;  5LJ5 d;  1P92 A;  5J39 A;  3OS0 A;  4F04 B;  1D1C A;  4QT7 A;  3SWN C;  4M78 C;  1VQN Q;  1KQS S;  1AWO A;  4DOV A;  1NG2 A;  1TXQ A;  3PT9 A;  5FW9 A;  5FWC A;  3CC4 T;  2DVJ A;  1VQK A;  2DL5 A;  2DIQ A;  5A2Q E;  4M7A A;  1V1C A;  2W10 A;  4ZNX A;  4M77 F;  2AKL A;  2JOY A;  2QQB A;  3ZEH A;  2AIR B;  2PZ1 A;  3GIB A;  1SEM A;  1E7O A;  2BZY A;  1YIJ A;  2GCX A;  3EGD A;  1ZLM A;  2V1Q A;  3OS2 A;  3HKS A;  2WSC E;  2ZCF B;  2QGF B;  4R56 A;  3EFO B;  3QII A;  4KUI A;  2HSP A;  1UTI A;  4AFQ C;  1S72 Q;  2BE7 D;  1Y71 A;  3RNJ A;  3N5B B;  5ECA A;  1WGS A;  3EGD B;  1SRM A;  3CCQ T;  2A36 A;  3A8M B;  4M75 A;  2DIG A;  2COY A;  3KUF A;  4PLL A;  3LYI A;  2RK2 A;  3OMG A;  3MJX A;  1AD5 A;  1RAD B;  2FG0 A;  4HCZ A;  4RTZ A;  1QMC A;  2XIC A;  3JCM h;  1JB0 E;  4B6M A;  1YJW T;  4RTU A;  5I2M A;  2OTL A;  3V8J A;  2K2M A;  3KBG A;  3NPF A;  1YI2 T;  4PK4 A;  2HZY A;  5HK3 A;  3EG3 A;  1YN8 A;  1UG1 A;  2RO0 A;  3I55 T;  3JSC A;  2CT4 A;  2V1R A;  3ZL7 C;  1WHL A;  3A8O B;  3RBB B;  1WNL A;  1EIF A;  1WQ7 A;  4KBM B;  4FYV B;  3J80 E;  2DYB A;  2LQN A;  3CCS A;  3LW5 E;  1PCX A;  1H92 A;  3VYG A;  5EG2 A;  3QWX X;  3G4S A;  1SSF A;  2K6D A;  2HKN A;  3JCM X;  2GQV A;  3SD4 A;  4IIM A;  1HJD A;  4QQ6 A;  1YJN T;  1JEG A;  3GPL A;  1WPY A;  2A28 A;  4JLG A;  3PIO A;  1H3H A;  2OAU A;  3NTI A;  2ZPG B;  2CP0 A;  1SF9 A;  4KUD K;  4HCK A;  9ATC B;  4J9G A;  1MMN A;  4FU6 A;  1KD1 R;  2B86 A;  1IZ6 A;  2NLU A;  1U1S A;  4M77 E;  1FWZ A;  2MWP A;  2AK5 A;  3ER0 A;  2D8J A;  3HRU A;  1VQL Q;  1JRI A;  2JXB A;  3CCJ T;  1IHV A;  1VQO A;  4JRP A;  4JZ4 A;  4M75 C;  5CVI A;  4RTV A;  2JT4 A;  3CC7 Q;  2CP2 A;  2VKN A;  2D9T A;  4BE2 A;  3G6E A;  2PTK A;  4ELZ C;  3HSB A;  4RTX A;  1YNZ A;  3Q1J A;  2DPP B;  5LJ3 g;  1LVK A;  4FIB A;  1CKB A;  4N4I A;  2XK0 A;  3MP1 A;  2Z0W A;  1OX8 A;  5GAM d;  2MAM A;  3VS1 A;  1UJY A;  5GJV B;  1GFC A;  1N8R R;  2CUD A;  3L42 A;  3G71 Q;  2GBQ A;  4P5N A;  1OU9 A;  1C6V X;  3X20 B;  5KYX A;  4QQG A;  2QAZ A;  4AG1 C;  4AFS C;  5EC7 A;  1J3T A;  2K5I A;  4JJC A;  3EG1 A;  1VYT A;  3I56 T;  2HD0 A;  1K76 A;  1M27 C;  2DBM A;  5KYX B;  1F1B B;  2OX7 A;  3E2U A;  2VXF A;  4DBR A;  3OSV A;  1U1T A;  1WHJ A;  2RH2 A;  4EMG A;  3C0C A;  5FU6 C;  4M7D G;  3OMC A;  3L2V A;  2K5L A;  5GAN 8;  3QYG B;  2V8I A;  5D6Y A;  3V7S A;  2PNI A;  1XQH A;  2DYI A;  3V7R A;  2C0I A;  4C0Z A;  1NEB A;  3R6N A;  1N8R C;  1NJI R;  2HBW A;  2CYZ B;  2DET A;  3M0T A;  2KRO A;  2DTO A;  1HXD A;  2HQE A;  2EQJ A;  4PJL A;  2K4Y A;  1Y7X A;  1Z9Q A;  3OYF A;  3QJ6 A;  3CCQ Q;  4ZN1 A;  4Z89 A;  1SKU B;  2ECZ A;  1JBM A;  1E6H A;  4HKE A;  1H8K A;  3KFV A;  4BE1 A;  4N0A A;  2P84 A;  1VOM A;  5LJ3 f;  4J5Y A;  1YJW Q;  1KQS P;  1VQN A;  5GAN f;  3CCR A;  1XJW B;  2BKD N;  1QKX A;  2YRV A;  1D0Z A;  1IXD A;  2O4X A;  1YI2 Q;  1OEB A;  3CCL Q;  2RNA A;  1RAI B;  4KRT A;  2DE0 X;  1AWW A;  1I5L A;  2RMO A;  3I55 Q;  1PD0 A;  4D6W A;  1QVG A;  2CT3 A;  2JTE A;  1IRE B;  1B7T A;  3S3O A;  2XDP A;  2P0Q A;  4JDS A;  2KAF A;  4FYY B;  3CMA T;  4EPC A;  2O9V A;  2OTJ Q;  2VB6 A;  4LD9 K;  2KXD A;  1S72 A;  2KYB A;  4PFZ A;  2VUB A;  4HVU A;  3HFN A;  4XK8 E;  5IHI A;  1YJN Q;  4XU1 A;  2DM1 A;  3JCM P;  4M78 E;  1N5Z A;  3PNW C;  2EGC A;  4BDY A;  3CCU T;  3LH0 A;  1EFN A;  5IXF A;  1PSF A;  3TVT A;  1KK7 A;  4XTV A;  4Z88 A;  2KVQ G;  5C6S A;  1QVP A;  2ZPE B;  4M4Z A;  1ZSG A;  3L2W A;  3X24 B;  3CCJ Q;  4FYX B;  4FW1 A;  3CCV A;  2RI3 A;  3PTA A;  3MHX A;  1VUB A;  2LX9 A;  4FYW B;  4M77 A;  4N0A C;  1FMW A;  3ME9 A;  5HCK A;  4OMF B;  2K3Y A;  1WHK A;  4E7S A;  3PMI A;  3VS2 A;  3HL8 A;  1AVZ C;  5FRN A;  4M77 B;  3QJY A;  2DD5 A;  3NFC A;  2LT1 A;  3BDU A;  2RN8 A;  2JTF A;  4RTW A;  4ORZ A;  4WCI A;  5GAN 4;  1BKB A;  4LUE A;  3JCM J;  3EFR A;  2HDA A;  2VGN A;  1YCY A;  3QO3 A;  2GGR A;  8AT1 B;  1ACM B;  2KGT A;  3MPU B;  2C0O A;  1VQL A;  1KHI A;  1W2B A;  5LJ3 h;  5KYW A;  2KRS A;  4X9C A;  5GAN 3;  1TH7 A;  3CC7 A;  3X26 B;  1K8A R;  3I56 Q;  2JS2 A;  4OP0 A;  5KYW B;  4HT8 A;  1EZZ B;  4J83 A;  4Y28 E;  2KR3 A;  3THK A;  1VIE A;  3VS7 A;  2YWW A;  1FX7 A;  3PVL A;  4J9C A;  3ULR B;  5HK0 A;  1AEY A;  1T0J A;  2KY9 A;  4KGZ B;  4OGE A;  1VQ5 T;  2H8H A;  3SHW A;  4DA4 A;  1VQM T;  5LJ3 e;  3OYL A;  3QSU A;  1N27 A;  3LWH A;  2QYZ A;  4M77 D;  2J6F A;  3QPH A;  5GAN e;  2JMC A;  3LH5 A;  3TCJ A;  1QVG S;  2JS0 A;  4M7A G;  3REA B;  2CDT A;  4M77 C;  3G71 A;  3WVD B;  3OYH A;  2H3E B;  4PNO A;  4ZGJ B;  1K9M R;  2CZ1 B;  2DL8 A;  1WX6 A;  4K11 A;  2HCK A;  1RI0 A;  4F7U B;  5A0D A;  3S3M A;  4QW2 A;  2RQV A;  1K73 U;  1TUG B;  4M75 G;  3VS0 A;  3CC4 A;  1KC8 R;  3TSW A;  1QP2 A;  3TEE A;  2DRM A;  4PJO F;  1W70 A;  4XU2 A;  2K2V A;  1PHT A;  2CUB A;  4C0F A;  3O8V A;  2ABL A;  2CZ6 B;  3OW2 A;  5FRO A;  2RD1 A;  3C94 A;  3OYM A;  4KUL A;  1Q7Y R;  3CCE T;  2A7Y A;  4WF2 A;  4CC4 B;  1GXI E;  4A4G A;  3OYY A;  5KE3 A;  3LX7 A;  3JB9 I;  4IUU A;  2YLC A;  2ZPF B;  2KRM A;  4OB1 B;  1K9M C;  4JRQ A;  3JB9 G;  4JPB W;  2KMT A;  1OZ2 A;  3OQ5 A;  5IHK A;  3CCU Q;  1YJW A;  5KCH A;  5GMK i;  1MUZ A;  4A54 A;  3UPU A;  3EHQ A;  2DJZ A;  3OYG A;  1I0C A;  1YI2 A;  2DMO A;  3E9F A;  2E41 A;  2FRW A;  2QG9 B;  2J7I A;  4M78 A;  2QQ9 A;  3SWN A;  4FM4 B;  2HNI A;  1NYF A;  2QA4 T;  2JM9 A;  4ZTJ A;  2EIF A;  1OX9 A;  2RHX A;  4A4K A;  4E47 A;  3HP9 A;  3RKW A;  2L5Q A;  5CQY A;  3CCM T;  3NMZ C;  3QHS A;  1Y96 A;  4J9F A;  4NL2 A;  2E65 A;  1KFZ A;  3VU3 C;  2DTH A;  2JVV A;  1W2B S;  1M30 A;  2WSF E;  2DA9 A;  2GFU A;  4C5G A;  3ZFJ A;  1B34 B;  1I81 A;  4GBQ A;  2EBP A;  2EKH A;  1Q81 R;  1YJN A;  1Y96 B;  2ED1 A;  2L0A A;  2RQR A;  2YT6 A;  1WLP B;  5CAI A;  3JB9 J;  2X4Y A;  3UT1 A;  5CKB A;  1BIA A;  2A3L A;  2VXE A;  5CKE A;  1Q82 R;  1X43 A;  3H8Z A;  3DB4 A;  4PJO E;  2E1H A;  2FB7 A;  4LXC A;  3WVE B;  2RI5 A;  3H9N A;  3M59 A;  1JJ2 A;  3VYH B;  2FVU A;  4TVR A;  4BDZ A;  4LE9 A;  2F2V A;  4E7H A;  2OI3 A;  3JV3 A;  3M9Q A;  3CC2 T;  1XTD A;  4R55 A;  4BY6 B;  5GAN 7;  1X75 C;  3X28 B;  2OJ2 A;  1EX4 A;  4E7I A;  4JS5 A;  3UA7 A;  4CI0 C;  4RTY A;  2DNU A;  1VQ5 Q;  3EFS A;  1QCN A;  1IO6 A;  2H3J A;  1VQM Q;  4XU0 A;  3JCM b;  1I07 A;  2K5F A;  1PSE A;  2MI6 A;  3E9G A;  1D3B B;  1Q82 C;  3MEW A;  4EMK B;  2E3I A;  3QDF A;  1BI2 A;  1S1N A;  1TUD A;  3H0F A;  4ME7 A;  2E70 A;  3FDR A;  5CKF A;  4C8Q G;  1ABO A;  3OW2 S;  1OI1 A;  5IN1 A;  4XTY A;  1BBZ A;  3T9N A;  2AHJ B;  3EFO A;  2RQT A;  4KGV B;  2QGG A;  1T3S A;  2HQX A;  4EDU A;  1Z9Z A;  2FL7 A;  3VS6 A;  5GMK e;  2LJ3 A;  3RMQ A;  1RLQ C;  2LDM A;  5DLQ E;  4OVA A;  3OYK A;  3I56 A;  3P8H A;  2EJ9 A;  1A0N B;  3OYA A;  1K73 C;  1QCO A;  1V29 B;  2PVG B;  4MZM A;  3H0I A;  3RKX A;  5FU7 B;  1R0C B;  3QG1 A;  2FZG B;  3VS5 A;  1BI1 A;  2XI9 A;  3QZ5 B;  5I2S A;  3JCM c;  3CCE Q;  4BY6 C;  4X9D A;  3M56 A;  2XDB A;  2LQW A;  4KGX B;  2XID A;  3ZBD A;  1YWO A;  3E1S A;  2BTT A;  2J6K A;  2DZC A;  3CCL T;  1QVG P;  7AT1 B;  2MK5 A;  3JCM d;  1NLP C;  2EYQ A;  1GL5 A;  2KT1 A;  2RJF A;  2CKK A;  1UGS B;  1ABQ A;  1PM3 A;  5LJ3 j;  2E5K A;  3AT1 B;  3VS4 A;  2LZ6 B;  3CBM A;  4FL6 A;  2NUT A;  3U23 A;  4GLK A;  1DJ7 B;  4ELY C;  2KQW A;  2OTJ T;  2CP5 A;  2BZ8 A;  1M1K U;  4ESR A;  4IUV A;  3J81 E;  4C5H A;  1NBE B;  4QVD A;  1RI9 A;  1OPL A;  2O9S A;  4V2S A;  5CR2 A;  2NUT B;  2V8J A;  4JRK A;  3H41 A;  2PQW A;  1TWB A;  2QA4 Q;  3BY7 A;  1K4U S;  3NHN A;  3RDV A;  1LJO A;  3HPW A;  4DEY A;  1CKA A;  4F7U F;  1LNX A;  4ATO A;  3CMA A;  1VQ4 T;  3OSS C;  2DJQ A;  3CQT A;  1JXO A;  3CCM Q;  3OA6 A;  1JJ2 S;  2IVW A;  2F2W A;  5FU7 C;  2R57 A;  3MEU A;  3QKJ A;  1WJQ A;  3IQL A;  1UEC A;  2E3H A;  2Y4X A;  4LD6 A;  2KYM A;  4MMK A;  3H6Z A;  4A4E A;  4AT1 B;  2GFA A;  3CCU A;  2RHZ A;  3CPF A;  1R0B G;  4KT0 E;  1KHC A;  1M2V A;  3EGX A;  4E7J A;  2HAX A;  1K0X A;  3A1P A;  2QDL A;  2E10 A;  2M51 A;  4C92 D;  2K7A A;  2AKK A;  1TSF A;  1M2V B;  3EGX B;  3GP8 A;  1YJ9 T;  5CQX A;  5L8R E;  4PL6 A;  3CC2 Q;  3D7S B;  3MEA A;  5GAN g;  3UAT A;  1W6X A;  2YSQ A;  2YUQ A;  1VQ6 T;  4PJO A;  1PKT A;  1BI3 A;  5I11 A;  1W2B P;  2KEA A;  1VYV A;  2DXT A;  3CPW P;  5GAO q;  3P8B B;  4NL3 A;  1VQ7 T;  4PJO B;  2JZ2 A;  2XG8 D;  1YCS B;  3JAM E;  1NPP A;  1WQW A;  2WSE E;  2RPN A;  4ZN3 A;  1OUL A;  1TUC A; 
#chains in the Genus database with same CATH homology
 2D0N A;  1GBR A;  2AZS A;  2KNB B;  2FPE A;  2JM8 A;  1AVZ C;  3O5Z A;  2FO0 A;  4J9D A;  1K0S A;  1BB9 A;  2JW4 A;  3EHR A;  1T0H A;  2ROL A;  2LX7 A;  2BZX A;  2RN8 A;  3VRY A;  1WDX A;  4RTW A;  1M3B A;  2G6F X;  4ORZ A;  4WCI A;  2FPF A;  4JJD A;  4J9E A;  1SHF A;  4LUE A;  2HDA A;  2DRK A;  1ARK A;  1ZUK A;  4D8D A;  1CSK A;  2GGR A;  4F17 A;  1X2Q A;  4OMM A;  2KGT A;  2C0O A;  1YP5 A;  4E6R A;  2KRS A;  1M8M A;  2CH4 W;  2LNH B;  2X3W D;  1U5S A;  2DLP A;  2J05 A;  1AWX A;  1JQQ A;  2O88 A;  4CC2 A;  3UA6 A;  4IIO A;  2JS2 A;  1M3A A;  3THK A;  2KR3 A;  3VS7 A;  3PVL A;  2DF6 A;  4J9C A;  1LCK A;  3ULR B;  1AEY A;  1T0J A;  4FSS A;  1NLO C;  1RUW A;  1X6B A;  2DIL A;  1FMK A;  2H8H A;  3SHW A;  2YDL A;  4Z8A A;  4LNP A;  1SHG A;  2J6F A;  2JMC A;  1WXB A;  1PRL C;  3I5S A;  2IIM A;  3LH5 A;  2JS0 A;  1JO8 A;  5GJW B;  2EGE A;  1UDL A;  1ZUU A;  3H0H A;  1QWE A;  3REA B;  5IXB A;  1XOV A;  2CDT A;  1G83 A;  1X2K A;  4GLM A;  1PNJ A;  1W1F A;  1WXU A;  3M0P A;  2EPD A;  1AZE A;  2DL8 A;  3EG2 A;  1WX6 A;  4K11 A;  2SEM A;  1ZBJ A;  2HCK A;  2MCN A;  1SRL A;  2DX1 A;  4DEX A;  1X69 A;  5L23 A;  1KIK A;  4EIK A;  2D1X A;  2OAW A;  2RQV A;  2RF0 A;  2EYY A;  2XMF A;  3VS0 A;  4AFU C;  3A98 A;  3TSW A;  1WXT A;  2A08 A;  2DRM A;  1W70 A;  1PHT A;  4QT7 A;  1X27 A;  2CUB A;  2ABL A;  1AWO A;  1NG2 A;  4CC4 B;  1RLP C;  2GNC A;  5FW9 A;  5FWC A;  2DVJ A;  2DL5 A;  1KSW A;  1V1C A;  2W10 A;  4ZNX A;  2AKL A;  4J9B A;  2PZ1 A;  1B07 A;  2GTO A;  1OPK A;  2KE9 A;  1SEM A;  1E7O A;  2BZY A;  2KRN A;  2KRM A;  4OMN A;  4Y92 A;  1GCP A;  1ZUY A;  1ZLM A;  2V1Q A;  4JPB W;  3SEM A;  2L3P A;  5IHK A;  2HSP A;  1UTI A;  4AFQ C;  3M0U A;  3RNJ A;  5ECA A;  1MUZ A;  1SRM A;  2A36 A;  1NYG A;  3EHQ A;  3PE0 A;  1SPK A;  1I0C A;  1WYX A;  2DMO A;  2FPD A;  3QWY A;  4OMP A;  5FWB A;  2FRW A;  1GCQ C;  1AD5 A;  1QWF A;  2FG0 A;  2GQI A;  4RTZ A;  2J7I A;  1U06 A;  2EVR A;  1NYF A;  4RTU A;  2W0Z A;  1GRI A;  2JM9 A;  1HD3 A;  2K2M A;  3NPF A;  1UUE A;  3EG3 A;  1FYN A;  2LP5 A;  1YN8 A;  3NMZ C;  4J9F A;  1KFZ A;  1UG1 A;  4F16 A;  2CT4 A;  2V1R A;  3ZL7 C;  3RBB B;  1M30 A;  1NM7 A;  2DA9 A;  1QCF A;  2CH4 A;  3M0Q A;  4GBQ A;  2EBP A;  2EKH A;  2DYB A;  2LQN A;  1H92 A;  2LCS A;  2ED1 A;  2L0A A;  2RQR A;  2L2P A;  3FJ5 A;  4X1V A;  2YT6 A;  1WLP B;  3QWX X;  2K6D A;  2RQU A;  2EYW A;  1X43 A;  4IIM A;  1HJD A;  4OMQ A;  4JZ3 A;  1JEG A;  1GCQ A;  1UHF A;  1BK2 A;  2A28 A;  1H3H A;  2K9G A;  4LN2 A;  4HCK A;  4LE9 A;  3TSZ A;  2F2V A;  1Y0M A;  4J9G A;  2B86 A;  2OI3 A;  3JV3 A;  2M0Y A;  2K3B A;  1HSQ A;  2F2X A;  2LMJ A;  1U3O A;  2AK5 A;  2D8J A;  2J06 A;  3EGU A;  2DL4 A;  2OJ2 A;  2O31 A;  2JXB A;  2HEQ A;  4RTT A;  3UA7 A;  4RTY A;  2DNU A;  2L3S A;  4JZ4 A;  2ROT A;  1Y57 A;  4RTV A;  2JT4 A;  1IO6 A;  4R0K A;  2CSI A;  1AOJ A;  2NUZ A;  2VKN A;  1X6G A;  1I07 A;  4F14 A;  2LJ0 A;  1PKS A;  2NWM A;  2P4R A;  1S1N A;  1TUD A;  3H0F A;  1UJ0 A;  2PTK A;  1UHC A;  4J9I A;  2K79 A;  1UFF A;  2GTJ A;  1AZG B;  1ABO A;  4RTX A;  1YNZ A;  2I0N A;  1BBZ A;  1WI7 A;  2RQT A;  1OV3 A;  1CKB A;  1JU5 C;  2A37 A;  3PVQ A;  2VVK A;  1T3S A;  1GBQ A;  1Z9Z A;  3VS6 A;  3VS1 A;  2LJ3 A;  1RLQ C;  1UJY A;  5GJV B;  1GFC A;  2DL7 A;  2CUD A;  4HVW A;  2GBQ A;  1A0N B;  1SSH A;  2KBT A;  2C0T A;  2SRC A;  3H0I A;  2MOX A;  2EYX A;  4AG1 C;  4AFS C;  5EC7 A;  1J3T A;  1WA7 A;  1M3C A;  2O2O A;  4JJC A;  3EG1 A;  2CSQ A;  3VS5 A;  1VYT A;  1K76 A;  1M27 C;  2DBM A;  1JXM A;  1ZX6 A;  2LQW A;  2J6O A;  1YWO A;  4CC3 A;  2BTT A;  3C0C A;  2J6K A;  1NLP C;  2PNI A;  1GL5 A;  4HXJ A;  2KT1 A;  1PRM C;  2YUP A;  3NGP A;  1QKW A;  1ABQ A;  1MV0 B;  2C0I A;  2E5K A;  3EG0 A;  1NEB A;  4LUD A;  2JMA A;  3R6N A;  3VS4 A;  2HBW A;  2LZ6 B;  3M0T A;  2KRO A;  3U23 A;  2EW3 A;  3I35 A;  1Z9Q A;  2BZ8 A;  4ESR A;  4JJB A;  4Z89 A;  2FEI A;  2ECZ A;  1E6H A;  3M0S A;  1H8K A;  4D8K A;  1RI9 A;  2DL3 A;  3KFV A;  3VRZ A;  1OPL A;  2O9S A;  3H41 A;  2D8H A;  2ED0 A;  4HVV A;  1K4U S;  3NHN A;  5I22 A;  1QKX A;  4DEY A;  1CKA A;  1OEB A;  2YUN A;  2RNA A;  2CRE A;  4KRT A;  2DE0 X;  2L3Q A;  2DJQ A;  2KXC A;  1JXO A;  3CQT A;  1AWW A;  2RMO A;  1G2B A;  2CT3 A;  1TG0 A;  2F2W A;  2JTE A;  1I1J A;  3IQL A;  1UEC A;  4J9H A;  1AWJ A;  3UF4 A;  1PWT A;  3VS3 A;  2KYM A;  2O9V A;  2RQW A;  3M0R A;  2ENM A;  3REB B;  5IH2 A;  1QLY A;  1KJW A;  2FRY A;  2KXD A;  2KYB A;  2X3X D;  3GBQ A;  4HVU A;  2ESW A;  2EQI A;  5IHI A;  1K0X A;  2DM1 A;  1B3Q A;  1E6G A;  1YWP A;  2QDL A;  3I5R A;  2M51 A;  1N5Z A;  2EGC A;  1OOT A;  2K7A A;  1VYU A;  4OMO A;  2AKK A;  1EFN A;  4A63 B;  5IXF A;  2YUO A;  3TVT A;  4OML A;  2AZV A;  4Z88 A;  2EGA A;  1MV3 A;  3UAT A;  1UE9 A;  3I9Q A;  1W6X A;  4M4Z A;  1T3L A;  5IHN A;  1VA7 A;  2YSQ A;  2YUQ A;  2KT8 A;  1ZSG A;  1PKT A;  5I11 A;  2DBK A;  2KEA A;  4AG2 C;  1VYV A;  2VWF A;  1NEG A;  4AFZ C;  2LJ1 A;  1WFW A;  1YCS B;  1K9A A;  2RPN A;  1BU1 A;  2MIO A;  1K1Z A;  5HCK A;  4RUG A;  1GFD A;  1TUC A;  1UGV A;  1WIE A;  2EYZ A;  4CC7 A;  3VS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...