2NWMA

Solution structure of the first sh3 domain of human vinexin and its interaction with the peptides from vinculin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
MKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEGEHHGRLGIFPANYVEVLPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinexin
publication title Solution structure of the first SH3 domain of human vinexin and its interaction with vinculin peptides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2nwmA00
3ULRB 2MOXA 2KYMA 4CC7A 2CDTA 2L0AA 4JZ3A 2DRKA 1WYXA 2EYYA 2RF0A 4Z8AA 4AG1C 4FSSA 2AKLA 1QWFA 2RNAA 1AWOA 3EG1A 1B07A 4J9CA 1WXUA 2K9GA 5FW9A 3EHRA 1M3BA 2VKNA 1VYTA 4J9HA 2KGTA 2YSQA 3REAB 2YUOA 2RQTA 2RQVA 4OMNA 4ORZA 1FMKA 1ZUYA 3JV3A 1AVZC 2ECZA 3FJ5A 2KRSA 4JPBW 3VS5A 3I35A 2KE9A 2JS2A 2D8JA 2KT1A 2LQWA 1RLQC 4D8KA 4RTZA 5FWBA 1TG0A 1SEMA 3RNJA 5IHIA 2RQRA 1KSWA 2ED1A 2K2MA 2ABLA 4KRTA 2DJQA 1PHTA 2NUZA 1UG1A 2EGAA 1ZUUA 1OV3A 2GNCA 2LZ6B 1UFFA 4RUGA 5IHKA 4LN2A 3UA6A 4X1VA 1OEBA 2KRMA 4OMMA 1K9AA 1UGVA 2EVRA 1WXTA 4RTYA 2PNIA 1X69A 2D1XA 1QCFA 2RPNA 1RUWA 1X6BA 2GGRA 3H0IA 1JQQA 4ESRA 2VVKA 2DX1A 4HVVA 1WA7A 4AFZC 1YP5A 2EYZA 2J6FA 1BB9A 2L3PA 1CSKA 1UJ0A 4Z89A 1X27A 4JJCA 2HCKA 2A28A 2YUPA 1SHFA 1PKTA 4IIOA 1Y57A 2D8HA 2GBQA 3EG3A 2F2XA 2NWMA 4CC2A 2EW3A 2LQNA 3SEMA 4GBQA 4K11A 2XMFA 1UE9A 3ZL7C 2SRCA 2KRNA 3SHWA 2VWFA 2CSQA 1MV3A 3VS4A 4A63B 2E5KA 2C0TA 1JU5C 1LCKA 1ZBJA 2LJ0A 4JJDA 3M0QA 2CH4W 2RN8A 3GBQA 2EGEA 2RMOA 4J9GA 1KJWA 5EC7A 2LP5A 1NEGA 2CUBA 2L3SA 2KT8A 1GFCA 2LMJA 2JMCA 3H0HA 4D8DA 3M0SA 4OMLA 1M3AA 1PWTA 1KIKA 2JM8A 2J05A 4F17A 1K0SA 1GBRA 1ZSGA 2DF6A 1M3CA 1M30A 2KROA 3C0CA 3PVQA 3I9QA 3PE0A 4LUEA 1H3HA 4AFSC 4DEXA 2O31A 1OPLA 2K6DA 1WIEA 1NG2A 3NGPA 2OAWA 2FPDA 3TVTA 2HEQA 2CREA 3REBB 2DE0X 1UUEA 2DL7A 2K7AA 1QWEA 5HCKA 1Y0MA 4DEYA 5I11A 2AKKA 1NYFA 3UATA 2F2WA 3M0TA 3I5SA 1GCPA 2ROTA 3M0PA 2MCNA 1Z9QA 1UECA 3O5ZA 1EFNA 1X43A 2KNBB 2PTKA 2ROLA 2GTOA 5GJVB 2EKHA 2FEIA 2J6KA 2LX7A 1GFDA 2SEMA 1N5ZA 2H8HA 4JZ4A 5ECAA 2K3BA 3VS1A 1W6XA 3NMZC 1E7OA 2V1RA 2DM1A 1PNJA 1GCQC 4HVWA 4R0KA 4OMOA 1BBZA 1SRLA 3QWXX 5I22A 1G2BA 1AOJA 2HDAA 2EGCA 4QT7A 4OMPA 1OPKA 1V1CA 2FPFA 3VS2A 1K76A 4M4ZA 4E6RA 4GLMA 2PZ1A 5IHNA 2DA9A 1AWXA 1A0NB 1ZUKA 2OI3A 4J9DA 1HD3A 3R6NA 4LNPA 1PRMC 1S1NA 1M27C 2IIMA 1YCSB 2W0ZA 3EG0A 1WX6A 4IIMA 2DNUA 1CKBA 2K79A 4EIKA 1H8KA 1TUDA 1KFZA 1W1FA 2CSIA 3UF4A 2DMOA 1WXBA 1ZLMA 1ZX6A 4WCIA 2F2VA 1K4US 1YN8A 1WDXA 3CQTA 1B3QA 2G6FX 3NPFA 3U23A 2O9VA 5L23A 2MIOA 4RTVA 1X2QA 2KXDA 1JXMA 2HSPA 2M0YA 1K1ZA 1JEGA 1WFWA 1I07A 4HCKA 2C0IA 1MV0B 1JXOA 4HVUA 2BTTA 3QWYA 1PRLC 1MUZA 2YT6A 4J9EA 2AK5A 2A08A 1AD5A 1YWPA 2X3WD 2A37A 2BZXA 2EYXA 2I0NA 4F16A 2EQIA 1WLPB 2FRWA 3NHNA 2DBMA 1AZEA 1GL5A 1VYUA 1UHCA 3IQLA 4RTUA 1K0XA 1X6GA 1AWWA 2AZSA 1ARKA 2KBTA 2YUNA 3VS6A 3VS7A 4AFUC 2DBKA 4J9FA 2DYBA 1UHFA 1TUCA 2EBPA 4LE9A 1VYVA 1NLOC 2L3QA 1YNZA 4Z88A 2JTEA 2O2OA 1AWJA 1T0JA 2GQIA 2DL3A 1BU1A 2LNHB 5FWCA 3KFVA 3TSWA 2CT4A 1T3LA 2CUDA 1JO8A 2J7IA 4AFQC 2KXCA 4J9IA 2JMAA 2YUQA 2L2PA 4RTWA 1HSQA 3M0UA 1SPKA 2JS0A 2YDLA 1NYGA 4LUDA 2W10A 1GBQA 5IXFA 2ESWA 1CKAA 1W70A 4JJBA 5GJWB 4ZNXA 4CC4B 2V1QA 1T3SA 2HBWA 1J3TA 2X3XD 2LCSA 4J9BA 4RTTA 3VS3A 2ED0A 3VRYA 1QLYA 4Y92A 3VRZA 3RBBB 4F14A 5IH2A 3EG2A 1WI7A 2DLPA 2EPDA 1QKWA 2KR3A 3I5RA 1FYNA 1NLPC 3EHQA 3A98A 4AG2C 1RLPC 1XOVA 3H41A 2C0OA 2RQUA 1GRIA 4OMQA 2CH4A 1E6HA 1I1JA 2EYWA 2CT3A 2DL8A 3M0RA 3PVLA 3THKA 2QDLA 1X2KA 4RTXA 2DL5A 1BK2A 2DVJA 3H0FA 2DILA 2FG0A 1AZGB 2LJ1A 1NM7A 2BZ8A 2JM9A 2D0NA 1M8MA 3EGUA 3LH5A 2KEAA 1ABQA 1ABOA 1UDLA 1E6GA 1YWOA 2BZYA 1U5SA 1U06A 1SHGA 2AZVA 1OOTA 3VS0A 1SRMA 4CC3A 1I0CA 2B86A 2KYBA 2RQWA 2J06A 1U3OA 1UJYA 2DRMA 2M51A 2A36A 2FRYA 2JT4A 1IO6A 2JW4A 1QKXA 2ENMA 3UA7A 2J6OA 1G83A 1PKSA 2O88A 1H92A 1UTIA 2JXBA 2FO0A 1VA7A 2FPEA 1AEYA 1HJDA 2OJ2A 3TSZA 1GCQA 5IXBA 2O9SA 2LJ3A 2DL4A 1T0HA 1Z9ZA 1SSHA 2P4RA 1RI9A 4HXJA 2GTJA 1NEBA
chains in the Genus database with same CATH superfamily
2Y4XA 1YI2T 5GAOl 2L0AA 2DRKA 2COZA 1VIEA 2RJFA 3A8MB 3SB2A 5GAMg 4FCYA 1VQ4Q 1TS9A 1B07A 3GF5A 4KGZB 1VQ9T 2K9GA 3NFCA 1LJOA 3X20B 2KGTA 1M1KC 4F7UG 2RQTA 3HPWA 4ORZA 3E9FA 1ZUYA 2E3HA 1KQSS 3EFOA 4M77G 5DY9A 2KRSA 4JPBW 4BDYA 1YITA 1VQ7T 1D3BA 3CMAQ 4PJOF 3UWNA 2RQRA 1RAHB 3OYHA 2ZGWA 2ED1A 4M7AF 5GANe 1MMGA 1Y96B 2GFAA 2GQVA 2ZPEB 4C8QA 2NUZA 4LD6A 1D1AA 3PMTA 3SFMA 2NUPA 4PLLA 1WHLA 4E7LA 2DEQA 1QVFA 1X01A 4RUGA 2PUKB 2ZCFB 1JJ2P 2EWNA 2XIDA 2P0QA 3MEVA 3WXMB 3CCJT 1WGSA 2A3LA 4X1VA 4OMMA 1MMNA 2EVRA 1C0MA 3OYGA 2PNIA 1X69A 4J5YA 5KYXB 2GGRA 2QG9B 2G3RA 4XTXA 2JZ2A 3C12A 1KD1U 1V76A 2LRQA 5GAOp 2DETA 4PJOB 4HVVA 3HRUA 2PU9B 2EYZA 4M7AB 2V8IA 1UJ0A 2MAMA 4M77D 2DTHA 4JLIA 2YUPA 1M2VA 1YJWT 4EMKA 3LGFA 4IIOA 3L2QA 4B9WA 3EG3A 2F2XA 2GF7A 3M4GA 3M55A 2EW3A 3SEMA 1N27A 2FHDA 5I21A 1XTDA 1KHCA 4PJMA 5IN1A 2C0TA 1SSFA 1IGUA 1LCKA 2X4XA 3MO8A 4JJDA 4L59A 4KH1B 2CH4W 2RN8A 3GBQA 5HK3A 1WHGA 2RMOA 4C8QE 1KJWA 3N5BB 2BUDA 2LP5A 1BCOA 2DXTA 2L3SA 3EGXA 2LMJA 3H0HA 1UB4A 3PTAA 4EDUA 1TH7A 4PJOG 2RJDA 3G71A 2JM8A 4M7AG 3HTRA 2DF6A 3CCEA 4Y91A 1M3CA 3PIOA 1RI0A 3QHSA 3CCSA 3PVQA 1M1KU 3NTIA 4J83A 1H3HA 4AFSC 2RHYA 2O31A 1OPLA 2K6DA 1RL2A 2FPDA 2HEQA 1Y0MA 4FYYB 3M59A 3X28B 4FYXB 2F2WA 1X75C 3JCMJ 3OQ5A 3M0TA 1VQKT 2MF2A 5GAMe 1GCPA 2ROTA 1D0ZA 1EFNA 1X43A 1Y71A 4NL3A 3MEUA 1M4ZA 2FEIA 3FC3A 1YJ9T 1VQNT 3M4YA 1GFDA 1R77A 2SEMA 3HP9A 1YI2A 1Q82C 1W6XA 4QVZA 4LDUA 5DM7R 1VQMT 2V1RA 2DM1A 2GCXA 2NLUA 2V26A 3HRSA 1W2BS 1GCQC 2XU8A 1VQ9A 2CZ6B 4OMOA 1SRLA 2ZPFB 4PJOD 2EYQA 5LJ3g 2HDAA 4KUIA 4OMPA 4LDWA 3VYHB 3V8LA 3LH0A 5GAN8 2FB7A 4M4ZA 1G5VA 1RADB 3RERA 1VQ7A 4M77C 4OGEA 4PK4A 1YCSB 3L2RA 5GAN3 3EFSA 4DBHA 2LQ8A 2PVOB 3AT1B 5KYNA 4BDZA 5LJ3d 4IIMA 3OW2A 4EIKA 5LJ3h 1W1FA 2CSIA 3M58A 3L2WA 5LJ5f 1WXBA 1ZLMA 3QBYA 2IG0A 1YN8A 2G6FX 3L42A 2O9VA 5L23A 3QPHA 1QVPA 2RI3A 4FM4B 5HY6A 2K57A 1JXMA 3CCJA 1K1ZA 3DB4A 4C5IA 2EJGA 5KYYB 4HCKA 5GAOm 4OB3B 1VQPT 3RIRA 2OTJQ 2HKNA 1JXOA 1VOMA 4C92B 4ZGDB 2YT6A 4DQ2A 5KCOA 5KE3A 2AK5A 5CKHA 2A08A 5A0LA 5LJ3j 1QW1A 1ZA2B 3X26B 1FX7A 1ZBXA 2BZXA 2E12A 2EYXA 2I0NA 4J6YA 4F16A 4AMCA 1QP2A 2DBMA 2EQJA 3E2UA 4E7HA 1VYUA 3GNGA 1K0XA 1X6GA 4M78B 1VQLQ 1YJWA 3QZ5B 3VS6A 3A5ZB 2RHIA 2ZPGB 2DYBA 2KSSA 4Z88A 2L3QA 4A4HA 3P8BB 2MMPA 1K8AC 3V7CA 2P4TA 3VJPA 2O2OA 1AWJA 4ZN3A 1UGPB 2HBPA 1DJ7B 3QZ9B 2J7IA 3PGGA 2E70A 4Z02A 2B8AA 1Q82U 3JSCA 1IB8A 2L2PA 1K73C 2K2VA 4PLIA 3I55T 3ZFJA 1I4K1 3A8GB 3OS5A 1OQKA 3NTHA 4FT2A 4PJOC 3INZA 2EQKA 1J3TA 3LYIA 2X3XD 4M7AC 5A0GA 2ZAEA 2ED0A 3LLRA 3VRYA 3VRZA 2NUTA 1M8VA 3H9NA 1QVFS 2L3RA 3EG2A 4FYWB 2FL7A 2F69A 4EMHA 1FYNA 3A98A 1VQKA 1XOVA 3H41A 5D6YA 2RQUA 1GRIA 1Q86R 1VQOT 5LJ3e 2CH4A 1YJ9A 1E6HA 2CP7A 1VQNA 5CQXA 4OB0B 4MZMA 3VUBA 3TCJA 1VUBA 2DL8A 3C95A 1KQ2A 3URGA 4NS5A 2K5LA 4C92D 1VQMA 1JJ2A 5A2QE 2BKDN 2FG0A 4M7DA 4M77E 1BI2A 3GOXA 4BE2A 3SDZA 3EG9B 3CXCP 1ABOA 1UDLA 1E6GA 1U5SA 2L5QA 2CP5A 5C6SA 3EGDA 4B6MA 3CCQT 1FMWA 1MHNA 4GLKA 1OOTA 4M78D 2EKOA 1Q7YR 4CC3A 3JCMX 1WQWA 3E9GA 2B86A 2KYBA 2J06A 2EIFA 2C06A 2FRYA 3CCUQ 1LOJA 3GLXA 2DFUA 2ENMA 2J6OA 3C4SA 1IREB 2E1HA 1UTIA 5GAN6 2FO0A 1YITT 3RKYA 2E5QA 4O5VA 1G3SA 1K8AU 2QDYB 2WACA 2E41A 4XTUA 1BI0A 2AT1B 5GAN7 2M02A 2P4RA 4E7IA 4HXJA 3VUZA 5D6XA 2KYMA 2CDTA 4XU3A 2DTOA 2AHJB 1VQPA 1KC8C 4RMOA 3OYKA 1M1GA 1PD0A 2RF0A 2AKLA 1QWFA 1K73U 1KK7A 4PNOA 1QVGA 1WXUA 4X34A 4PKCC 2VKNA 3CBPA 4M7DE 1FMKA 4IUUA 3P8DA 3FJ5A 2K5IA 4J7FA 3VS5A 2KT1A 2LCCA 1YI2Q 2HQEA 4OF1A 4IKFA 1TG0A 1P92A 4RCBA 2QEXT 3JCMP 2LNVA 1OU9A 4DBFA 3H8ZA 4A4FA 1I8FA 2VV5A 3J81E 1OV3A 2GNCA 4ME7A 3GPLA 4PJOE 5IHKA 3CPWP 5KYUA 4M7AE 3SWNA 4F7UF 1WHKA 1C6VX 3UA6A 3FJPA 1OEBA 2QQ9A 3I55A 1VQ7Q 3Q1JA 1WXTA 1S72T 2RPNA 1RUWA 2EJ9A 4KULA 3OW2S 1X6BA 3H0IA 1JQQA 4Q5WA 4ESRA 1Q81R 2VVKA 5DLQE 1WA7A 4D6WA 2NYSA 1OI1A 1YP5A 1QP3A 1BB9A 2L3PA 1WHHA 3G71T 3CCLT 1CSKA 4C5HA 2LQKA 1X27A 2LCLA 4E7JA 2DD4A 2XKOC 1PKTA 1ZSZA 2GBQA 4OP0A 4FT4A 2X51A 2KI7A 2XMFA 3ER0A 1UE9A 2SRCA 2KRNA 2VB6A 1VQOA 3OMGA 2DXUA 1HXDA 5I2MA 3VS4A 4A63B 2DYIA 2M1HA 1JU5C 2MPXC 2QI2A 1ZBJA 2HZYA 2LJ0A 3M0QA 2EJFA 4KUDK 1TTHB 3S3OA 2EGEA 4J9GA 1TOVA 5EC7A 5FU6B 1NEGA 2JOYA 1ZHIA 3FLGA 2KT8A 1GFCA 1KC8U 2JMCA 3M0SA 1YJWQ 2RI2A 2QGFB 5LJ5g 1KIKA 4PJLA 1MNEA 4F17A 1H3ZA 1K0SA 1ZSGA 1M1FA 1IRXA 3V8JA 3CCQA 2XD0A 2KROA 3C0CA 1I81A 4ELZC 3I9QA 3UT1A 3PE0A 2P84A 1VQ6Q 2RK1A 4M75B 1WIEA 2OAWA 3OSVA 2DE0X 1UUEA 2K7AA 5HCKA 2OX7A 4BY6B 1U1SA 5LJ5d 4JRIA 1NYFA 3DLMA 5LJ5h 4A4GA 2DERA 3M54A 2YLBA 3MKDA 3QKJA 3I5SA 2MCNA 3GP8A 2KNBB 2PTKA 1B34B 2LX7A 2ZPBB 2HL3A 2BE7D 2DIGA 1PC0A 5ECAA 2K3BA 4EPCA 3I56T 5KE2A 4P5NA 1XQHA 2E64A 1E7OA 1U1TA 5FU7B 3OYEA 4LDXA 3M53A 4ZTJA 3O8VA 2HQXA 4C0DB 5LJ5j 2DZCA 2KQWA 2A0FB 4M75G 4BI8B 1VQKQ 1VQ8T 3G6EA 3VS2A 1K76A 2CS7A 3PIPA 1VQ5T 1YCYA 2QGGA 4XU1A 2KVQG 5IHNA 1F1BB 1WPYA 2EQUA 3HKSA 1A0NB 1VQNQ 5I2SA 4LNPA 1S1NA 1M27C 2A7YA 3VYGA 2W0ZA 2L8DA 1G3WA 1VQMQ 2QEXA 1JJ2S 3V8KA 3QG1A 3OY9A 2QQBA 2K79A 4PJJA 3META 2F2VA 1WDXA 3NPFA 3CC4A 2DXCA 2KXDA 2M0YA 2K4YA 2OTLT 2QK0A 2WSEE 1PG5B 5HK0A 2QTVA 5FRMA 2VGNA 2C0IA 5KCHA 1S72A 1BIBA 2RI5A 2BTTA 3L2ZA 1PRLC 1MUZA 3FRNA 1N8RC 2KMTA 2CYZB 2F5KA 3M57A 1JB0E 4BI3A 5GAN4 4M75D 3CXCA 3ZEHA 4WTOB 1D1CA 1QVGP 2VYTA 3CCLA 1OULA 4E7SA 1UHCA 4QQDA 3J80E 5GANf 3H6ZA 4XQ3A 3OYMA 4X9CA 3G4ST 3EG9A 1NZ9A 4QVDA 1VQPQ 1BI1A 4MMKA 4LE9A 1VYVA 3S3MA 1Y07A 1WJSA 2QA4Q 1M90C 3CMAT 5DLOA 2XICA 2DL3A 2RH2A 4E7KA 1T3LA 1JO8A 2YHTA 4AFQC 2FYKA 4MDWA 4PFZA 4A53A 2JTMA 3BW1A 2O4XB 2JMAA 3M0UA 4DOWA 3L1AA 1TUGB 1GBQA 3BFMA 3BDUA 1CKAA 1W70A 4RG2A 3OBWA 3EFRA 2V1QA 2HBWA 4A54A 2X4WA 1R0CB 2LCSA 3JCMb 1BIAA 3X25B 1QLYA 4Y92A 1XNIA 2R58A 3PMIA 3RBBB 4F14A 1WI7A 3CMEQ 2DLPA 2VGMA 3QJYA 4QW2A 3JB9H 1NLPC 4ZN1A 4C92F 3FEOA 3I55Q 3PT9A 2C0OA 1SF9A 1N8RR 3RKWA 4N4GA 2XDBA 5AYFA 1RABB 1I1JA 3CCMT 2D6FA 3M0RA 3CC7Q 3I56A 3PVLA 3CPWA 3F70A 4M78F 5KYWB 1BK2A 3FB9A 3H0FA 3P8HA 3OYIA 1NPPA 1GXIE 4FIBA 1D09B 2EAYA 2X4YA 2BZ8A 2JM9A 2ZPIB 1VQ8A 1N8RU 1VQ5A 1M90R 1M2OA 4J6XA 2X4JA 2YRCA 3VS0A 4F04B 1M9SA 3RESA 1Q86C 5GAMf 1PCXA 2LDMA 4OB1B 4BY6C 2WSFE 5CCAA 2LVMA 3TQ7P 3OS1A 1UJYA 2M51A 2A36A 4HT9A 2BIVA 5IAYA 5CQYA 3PNWC 1PKSA 2ZZDA 1H92A 2XG8D 2COYA 4II1A 2RJCA 4EMGA 1VA7A 4C5EA 1AEYA 1HJDA 3TSZA 1GCQA 5IXBA 1T0HA 3EFOB 3CCQQ 1V29B 2GTJA 1NLOC 2OTLA 3ULRB 2MOXA 5FU7C 4CC7A 3DKMA 1D3BB 3JB9F 4JZ3A 1YBYA 4F7UA 4ATOA 2H3EB 4AG1C 1Q7YC 2V8JA 4FSSA 1AWOA 2RNAA 2M0OA 3CCVT 4C92G 4M77A 2M9UA 4J9CA 4C8QB 5FW9A 3EHRA 1VYTA 4IUPA 2YSQA 4J9HA 2NUPB 1YITQ 2RQVA 4OMNA 2CGHA 4MDXA 1ZQ1A 3I35A 3MP1A 2JS2A 2D8JA 2FZKB 1NJIC 2LQWA 1RLQC 3G4SA 4M78G 4RTZA 1WJQA 1KSWA 2DD5A 2K2MA 4BD3A 2DJQA 2MK5A 1PHTA 2KDSA 4DOVA 3EH1A 3CMAA 2EGAA 3OS0A 1UEBA 3X24B 2RK2A 4LN2A 4UC4A 1IGQA 2YXYA 3CD6T 3CC2T 2R57A 2RHXA 1M2VB 4B9XA 4EMKB 2KRMA 1K9AA 1UGVA 2DO3A 1EZZB 1WZOA 1B34A 1QCFA 2D1XA 3CCRT 4XU0A 1WHJA 1Y96A 2DPPB 2EQMA 4F7UE 1OX8A 5GAOn 2OTJT 2DX1A 3R6OA 3HFOA 2LTOA 1Q86U 2HKQB 2HCKA 3JB9G 1G8XA 1SHFA 1Y57A 2D8HA 2NWMA 2LC4A 2LQNA 5GMKh 1S72Q 3ZL7C 3OS2A 1VQLT 2VWFA 5KYXA 4FSXA 2CSQA 4LDVA 4DBRA 2E5KA 4JJNK 3CCMA 4R55A 3GIBA 4PJOA 3CXCS 4M7AA 1UGQB 3G71Q 2JTFA 1Q81C 1NJIR 2CUBA 3LGLA 3CCEQ 4C8QD 1M5Q1 3CCSQ 1Q7YU 1M3AA 2DVEA 1IZ6A 1YIJT 4C0ZA 1ACMB 2K3YA 4XK8E 2P0KA 5GMKj 1RAGB 1JBMA 1MNDA 4DEXA 2PVGB 3MJXA 1K9MR 1NG2A 2VASA 3M56A 3G6ET 2CREA 2DL7A 1MMDA 3JB9D 2MI6A 3M0PA 5J3BA 4JRPA 3RKXA 9ATCB 1UECA 3O5ZA 4FYVB 2O01E 4LDYA 2ROLA 1O9SA 1KQ1A 4N0AC 3V7SA 2QQAA 1VQ9Q 3VS1A 2DKGA 3JRZA 3CC4T 1FWZA 3CCVA 1PNJA 4HVWA 2HNIA 1BBZA 5I22A 1G2BA 4C92C 1KG1A 2EGCA 2L89A 2E65A 2LT4A 2QQRA 3UPUA 3S6WA 3JCMQ 2CKKA 5GANd 4E6RA 4GLMA 2PZ1A 4VUBA 3RR6A 1G3YA 3D7SB 5GANh 1AWXA 5GAOq 3HSBA 2OI3A 4J9DA 1Q95G 3FDRA 1HD3A 3R6NA 2HD0A 2DXBA 1OYXA 4JRKA 2QASA 3I56Q 3CPWS 5CAIA 1WX6A 4M78C 4V2SA 3TEEA 3OYLA 2DNUA 1CKBA 2VUBA 1H8KA 3UF4A 5CVIA 1K4US 1ZX6A 3CCJQ 5CO7A 3CQTA 1B3QA 3U23A 1YHQT 4BB7A 5GMKe 1VQ8Q 2MIOA 3CBOA 4RTVA 1VQ5Q 2RB6A 4LD9K 4M75F 3CD6A 3CC2A 1WFWA 5GANj 1Q81U 4HT8A 1MV0B 3QWYA 3CCRA 2X9HA 1AHJB 2VXFA 4J9EA 4BUGA 5CKBA 1I5LA 2K3XA 1YWPA 2X3WD 2OTJA 5GAN5 6AT1B 3A8LB 1WLPB 5CK9A 3MCAB 3QUIA 1WNLA 1GL5A 4QQ6A 2DTIA 4RTUA 3OYFA 1AWWA 1YJNT 2E10A 2AZSA 1ARKA 2KBTA 3OYDA 3VS7A 2I2LA 5KYYA 4AFUC 2DBKA 2JN0A 3MP8A 8ATCB 1NE8A 1TUCA 4C92A 2EBPA 1U8RA 1YNZA 1VQLA 1QCNA 2VC8A 1KQSP 2DK3A 1T0JA 3ASKA 2DIQA 4M7DF 2NUTB 5FWCA 3KFVA 3M5AA 3TSWA 2CUDA 3BY7A 4EMKC 2KXCA 1BYMA 5CKDA 4J9IA 2YUQA 4RTWA 1HSQA 5EG2A 4M78A 1SPKA 2JS0A 4PJNA 1NYGA 2DEUA 3G4SQ 5IXFA 1YIJA 4R56A 4MZTA 4JJBA 3JB9J 4CC4B 5HKCA 2CP3A 1T3SA 2CP6A 1QMCA 3BDLA 3V7RA 5A0DA 4WF2A 2HQHA 5GAMd 4KGXB 1EX4A 5GAMh 3JB9I 5IH2A 3JCMf 3WVEB 2D0QB 2HL5C 1G3TA 2H3JA 3CPFA 1PSFA 1FMVA 1QKWA 4M7DB 1OU8A 3I5RA 4RG8A 1KD1R 2E6NA 2GFUA 1YJ9Q 5CKEA 4KT0E 2JJ9A 1EIFA 5FRNA 3EGDB 2R5AA 4FU6A 3OYNA 2EYWA 4C92E 2Y4YA 1PD1A 5GAMj 1X2KA 2DL5A 1Y7XA 3L2VA 3C94A 3MPUB 1AZGB 3OA6A 2LJ1A 4RKUE 4QVCA 2D0NA 3EGUA 3LH5A 2YLCA 2FZCB 2KEAA 1YWOA 4M78E 2E3IA 1LNXA 3MEAA 2XDDA 2AZVA 3LWHA 4M7DG 2FVUA 2MYSA 2CP2A 3CCMQ 1BCMA 1I0CA 1OZ3A 2RQWA 4PFPA 2F5TX 2MWPA 1AT1B 3RMSA 4XU2A 3OB9A 1QKXA 1WHMA 1M1KR 1VQ4T 4L5GA 1G83A 1VQ6T 2O88A 1LVKA 3L2UA 2QYZA 5J39A 1TSFA 2FPEA 3QYHB 3RDVA 1YHQA 3CCUA 2LJ3A 4PFOA 1Z9ZA 1SSHA 5IT9E 1RI9A 2COWA 5LJ5e 5GMKl 4C0GA 5KH6A 2JUFA 1QVGS 1WYXA 2EYYA 4BE0A 4Z8AA 3EG1A 4DBQA 1PSEA 3OSSC 4HKEA 1M3BA 3A8OB 4XTYA 2OAUA 3REAB 4BACA 2YUOA 5FROA 4ZTFA 2RHUA 5D6WA 1BKBA 4JLGA 3RUXA 3S3NA 3JV3A 1AVZC 2ECZA 5KYUB 3HRTA 4M7DD 3SWNB 1YJNA 4JUVA 1W2BP 2KE9A 4QKUA 2VXEA 4FW2A 3QDRB 2PVDB 2MWOA 3J7AF 3VKIA 4D8KA 5FWBA 2XHCA 2CP0A 1SEMA 3RNJA 1MMAA 5IHIA 3A1PA 3CCVQ 2ABLA 4KRTA 3FIFA 4HCCA 1UG1A 4YTLA 1ZUUA 3KBGA 3WVDB 3MHXA 2LZ6B 1SG5A 1UFFA 2P0PA 1NBEB 4E47A 4JRQA 4TVRA 1N9SA 2LX9A 3JAME 4OGCA 1ZSZB 2IVWA 4M7AD 5FU6C 4XTZA 2IPOB 4RTYA 3QDFA 1TXQA 1D0XA 3G1JA 4J7IA 5FLXE 1RAFB 2ATCB 4Y28E 4C0FA 4AFZC 4HCBA 2J6FA 4Z89A 3OMCA 3T9NA 4JJCA 2HSEB 2A28A 3CD6Q 1FXXA 4FL6A 4M75C 1VQOQ 3CC2Q 1OX9A 2RJEA 4CC2A 4GBQA 4K11A 1D1BA 4C8QF 5J26A 3SD4A 4DA4A 3SHWA 3CCRQ 4A4KA 1MV3A 1SKUB 1WJRA 2Z0WA 4J8OA 5CR2A 4L6V5 1RAIB 4PL6A 3EAEA 1B7TA 2ZPHB 3E1SA 2QA4T 4KH0B 1M90U 4OVAA 2F1LA 3DB3A 4MZPA 1D0YA 4D8DA 4OMLA 3DLLA 3VU3C 1PWTA 3TREA 3MP6A 4RCCA 2J05A 1GBRA 1IXDA 1Q82R 4C0DC 1M30A 3NTKA 4IUTA 3OYJA 3RMQA 2KK4A 4LUEA 4BI4A 4M7DC 2WSCE 3NGPA 4A4EA 3TVTA 3REBB 1QWEA 4DEYA 5I11A 2HMAA 1VQ4A 1VQ6A 2AKKA 3OYBA 3UATA 2QTXA 2E6ZA 3CMET 1YIJQ 1OZ2A 1Z9QA 1QVFP 1KQSA 1ZA1B 3QYGB 8AT1B 2GTOA 5GJVB 2EKHA 3LW5E 2J6KA 5CIUA 1C1AA 4O6JA 1N5ZA 3QJ6A 1N6AA 2H8HA 4JZ4A 2DZ9A 2M16A 4N4IA 4M75A 1RACB 2YRDA 3NMZC 2YRVA 3G6EQ 4KBMB 3A8HB 4LXCA 1K9MC 4R0KA 1IHWA 3QWXX 3CC7T 4CRIA 1AOJA 4C8QG 3LWIA 4QT7A 1OPKA 1V1CA 2FPFA 2RO0A 4XAXB 2DJZA 2DA9A 1WQ7A 2QEXQ 1ZUKA 2R5MA 1PRMC 2IIMA 4ELYC 2YWWA 4FW1A 5M9OA 3EG0A 3CC4Q 7AT1B 1KFZA 1TUDA 2DMOA 4WCIA 4JS4A 3EGXB 4N4HA 2XI9A 1HYOA 1X2QA 3E19A 4NL2A 4MMLA 2QXFA 2JNGA 3GNFB 2HSPA 3KUFA 3JCMg 1JEGA 5GMKm 1I07A 1R8OB 2QAZA 1TU0B 1K8AR 4HVUA 1N9RA 2FZGB 3CCLQ 4M75E 1AD5A 2E4HA 2A37A 1PM3A 4IURA 2CZ7B 2EQIA 3SWNC 1W4SA 2FRWA 5GMKi 3HFNA 3NHNA 3JCMd 1YHQQ 1AZEA 1K73R 3JCMh 3IQLA 3ME9A 4JS5A 2V8KA 3MEWA 2RM4A 2DAQA 2YUNA 4HA8A 2D9TA 2K5FA 4J9FA 1UHFA 1KHIA 2JTEA 3VV0A 5LJ3f 1NJIU 2JVVA 3OYCA 2GQIA 4XTVA 5AT1B 1YFNA 1BU1A 2LNHB 2XDPA 4JDSA 2CT4A 3QO3A 2QA4A 1ZSZC 2PUOB 2QQSA 4E7ZA 1YJNQ 2YDLA 4ANJA 4C5GA 3ZBDA 4ZGEB 4LUDA 2W10A 3LX7A 5GANg 1IHVA 3G7ZA 1K9MU 2ESWA 5GJWB 5CKFA 2CZ1B 4ZNXA 4AT1B 1I5OB 2EFIA 4X9DA 4ZGJB 2PQWA 3QIIA 1RAEB 4J9BA 4RTTA 3VS3A 4CI0C 3BE3A 2KY9A 4GY5A 1NPRA 2EPDA 2O4XA 1W2BA 2KR3A 1X6OA 3OW2P 1TWBA 3EHQA 4AG2C 1O75A 1RLPC 5C0MA 3KXTA 4KGVB 4QQGA 3CMEA 2BE9B 3HHTB 4OMQA 3PFSA 3OYAA 1BI3A 4M77F 2CT3A 3CEYA 1UGSB 1RAAB 3THKA 2QDLA 4RTXA 3JCMc 3CCUT 2DVJA 3OBYA 2DILA 3OYYA 5GAOr 4OB2B 4NOYA 5LL6S 2RD1A 3M9QA 3AHUA 2Y90A 1NM7A 4XTWA 3CC7A 3TU4K 1M8MA 4IUVA 1QQJA 1JRIA 3JCMV 1H641 1ABQA 1XJWB 2BZYA 3UDCA 1KD1C 2AIRB 2X35A 1U06A 5D7UA 1LPLA 4C8QC 3CCET 1SHGA 1HK9A 3CCST 1KC8R 3HL8A 1VIFA 3EH2A 3QXEB 1SRMA 5GAN2 2KAFA 4F7UB 4IUQA 3JCMe 1U3OA 4E2FB 2DRMA 5L8RE 5KYWA 3CBMA 2JT4A 4N0AA 1IO6A 1MGQA 2JW4A 2XK0A 2LT1A 4M77B 3UA7A 3JCMW 4BE1A 1QCOA 2JXBA 2OTLQ 4OMFB 1UGRB 2OJ2A 2HAXA 2CZ0B 2O9SA 3QSUA 4HCZA 2DL4A 2RHZA 2RA2A 1R0BG 4J6WA 1NEBA
chains in the Genus database with same CATH topology
3ULRB 2MOXA 2KYMA 4CC7A 2CDTA 2L0AA 4JZ3A 2DRKA 1WYXA 2EYYA 2RF0A 4Z8AA 4AG1C 4FSSA 2AKLA 1QWFA 2RNAA 1AWOA 3EG1A 1B07A 4J9CA 1WXUA 2K9GA 5FW9A 3EHRA 1M3BA 2VKNA 1VYTA 4J9HA 2KGTA 2YSQA 3REAB 2YUOA 2RQTA 2RQVA 4OMNA 4ORZA 1FMKA 1ZUYA 3JV3A 1AVZC 2ECZA 3FJ5A 2KRSA 4JPBW 3VS5A 3I35A 2KE9A 2JS2A 2D8JA 2KT1A 2LQWA 1RLQC 4D8KA 4RTZA 5FWBA 1TG0A 1SEMA 3RNJA 5IHIA 2RQRA 1KSWA 2ED1A 2K2MA 2ABLA 4KRTA 2DJQA 1PHTA 2NUZA 1UG1A 2EGAA 1ZUUA 1OV3A 2GNCA 2LZ6B 1UFFA 4RUGA 5IHKA 4LN2A 3UA6A 4X1VA 1OEBA 2KRMA 4OMMA 1K9AA 1UGVA 2EVRA 1WXTA 4RTYA 2PNIA 1X69A 2D1XA 1QCFA 2RPNA 1RUWA 1X6BA 2GGRA 3H0IA 1JQQA 4ESRA 2VVKA 2DX1A 4HVVA 1WA7A 4AFZC 1YP5A 2EYZA 2J6FA 1BB9A 2L3PA 1CSKA 1UJ0A 4Z89A 1X27A 4JJCA 2HCKA 2A28A 2YUPA 1SHFA 1PKTA 4IIOA 1Y57A 2D8HA 2GBQA 3EG3A 2F2XA 2NWMA 4CC2A 2EW3A 2LQNA 3SEMA 4GBQA 4K11A 2XMFA 1UE9A 3ZL7C 2SRCA 2KRNA 3SHWA 2VWFA 2CSQA 1MV3A 3VS4A 4A63B 2E5KA 2C0TA 1JU5C 1LCKA 1ZBJA 2LJ0A 4JJDA 3M0QA 2CH4W 2RN8A 3GBQA 2EGEA 2RMOA 4J9GA 1KJWA 5EC7A 2LP5A 1NEGA 2CUBA 2L3SA 2KT8A 1GFCA 2LMJA 2JMCA 3H0HA 4D8DA 3M0SA 4OMLA 1M3AA 1PWTA 1KIKA 2JM8A 2J05A 4F17A 1K0SA 1GBRA 1ZSGA 2DF6A 1M3CA 1M30A 2KROA 3C0CA 3PVQA 3I9QA 3PE0A 4LUEA 1H3HA 4AFSC 4DEXA 2O31A 1OPLA 2K6DA 1WIEA 1NG2A 3NGPA 2OAWA 2FPDA 3TVTA 2HEQA 2CREA 3REBB 2DE0X 1UUEA 2DL7A 2K7AA 1QWEA 5HCKA 1Y0MA 4DEYA 5I11A 2AKKA 1NYFA 3UATA 2F2WA 3M0TA 3I5SA 1GCPA 2ROTA 3M0PA 2MCNA 1Z9QA 1UECA 3O5ZA 1EFNA 1X43A 2KNBB 2PTKA 2ROLA 2GTOA 5GJVB 2EKHA 2FEIA 2J6KA 2LX7A 1GFDA 2SEMA 1N5ZA 2H8HA 4JZ4A 5ECAA 2K3BA 3VS1A 1W6XA 3NMZC 1E7OA 2V1RA 2DM1A 1PNJA 1GCQC 4HVWA 4R0KA 4OMOA 1BBZA 1SRLA 3QWXX 5I22A 1G2BA 1AOJA 2HDAA 2EGCA 4QT7A 4OMPA 1OPKA 1V1CA 2FPFA 3VS2A 1K76A 4M4ZA 4E6RA 4GLMA 2PZ1A 5IHNA 2DA9A 1AWXA 1A0NB 1ZUKA 2OI3A 4J9DA 1HD3A 3R6NA 4LNPA 1PRMC 1S1NA 1M27C 2IIMA 1YCSB 2W0ZA 3EG0A 1WX6A 4IIMA 2DNUA 1CKBA 2K79A 4EIKA 1H8KA 1TUDA 1KFZA 1W1FA 2CSIA 3UF4A 2DMOA 1WXBA 1ZLMA 1ZX6A 4WCIA 2F2VA 1K4US 1YN8A 1WDXA 3CQTA 1B3QA 2G6FX 3NPFA 3U23A 2O9VA 5L23A 2MIOA 4RTVA 1X2QA 2KXDA 1JXMA 2HSPA 2M0YA 1K1ZA 1JEGA 1WFWA 1I07A 4HCKA 2C0IA 1MV0B 1JXOA 4HVUA 2BTTA 3QWYA 1PRLC 1MUZA 2YT6A 4J9EA 2AK5A 2A08A 1AD5A 1YWPA 2X3WD 2A37A 2BZXA 2EYXA 2I0NA 4F16A 2EQIA 1WLPB 2FRWA 3NHNA 2DBMA 1AZEA 1GL5A 1VYUA 1UHCA 3IQLA 4RTUA 1K0XA 1X6GA 1AWWA 2AZSA 1ARKA 2KBTA 2YUNA 3VS6A 3VS7A 4AFUC 2DBKA 4J9FA 2DYBA 1UHFA 1TUCA 2EBPA 4LE9A 1VYVA 1NLOC 2L3QA 1YNZA 4Z88A 2JTEA 2O2OA 1AWJA 1T0JA 2GQIA 2DL3A 1BU1A 2LNHB 5FWCA 3KFVA 3TSWA 2CT4A 1T3LA 2CUDA 1JO8A 2J7IA 4AFQC 2KXCA 4J9IA 2JMAA 2YUQA 2L2PA 4RTWA 1HSQA 3M0UA 1SPKA 2JS0A 2YDLA 1NYGA 4LUDA 2W10A 1GBQA 5IXFA 2ESWA 1CKAA 1W70A 4JJBA 5GJWB 4ZNXA 4CC4B 2V1QA 1T3SA 2HBWA 1J3TA 2X3XD 2LCSA 4J9BA 4RTTA 3VS3A 2ED0A 3VRYA 1QLYA 4Y92A 3VRZA 3RBBB 4F14A 5IH2A 3EG2A 1WI7A 2DLPA 2EPDA 1QKWA 2KR3A 3I5RA 1FYNA 1NLPC 3EHQA 3A98A 4AG2C 1RLPC 1XOVA 3H41A 2C0OA 2RQUA 1GRIA 4OMQA 2CH4A 1E6HA 1I1JA 2EYWA 2CT3A 2DL8A 3M0RA 3PVLA 3THKA 2QDLA 1X2KA 4RTXA 2DL5A 1BK2A 2DVJA 3H0FA 2DILA 2FG0A 1AZGB 2LJ1A 1NM7A 2BZ8A 2JM9A 2D0NA 1M8MA 3EGUA 3LH5A 2KEAA 1ABQA 1ABOA 1UDLA 1E6GA 1YWOA 2BZYA 1U5SA 1U06A 1SHGA 2AZVA 1OOTA 3VS0A 1SRMA 4CC3A 1I0CA 2B86A 2KYBA 2RQWA 2J06A 1U3OA 1UJYA 2DRMA 2M51A 2A36A 2FRYA 2JT4A 1IO6A 2JW4A 1QKXA 2ENMA 3UA7A 2J6OA 1G83A 1PKSA 2O88A 1H92A 1UTIA 2JXBA 2FO0A 1VA7A 2FPEA 1AEYA 1HJDA 2OJ2A 3TSZA 1GCQA 5IXBA 2O9SA 2LJ3A 2DL4A 1T0HA 1Z9ZA 1SSHA 2P4RA 1RI9A 4HXJA 2GTJA 1NEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULR B;  2MOX A;  2KYM A;  4CC7 A;  2CDT A;  2L0A A;  4JZ3 A;  2DRK A;  1WYX A;  2EYY A;  2RF0 A;  4Z8A A;  4AG1 C;  4FSS A;  2AKL A;  1QWF A;  2RNA A;  1AWO A;  3EG1 A;  1B07 A;  4J9C A;  1WXU A;  2K9G A;  5FW9 A;  3EHR A;  1M3B A;  2VKN A;  1VYT A;  4J9H A;  2KGT A;  2YSQ A;  3REA B;  2YUO A;  2RQT A;  2RQV A;  4OMN A;  4ORZ A;  1FMK A;  1ZUY A;  3JV3 A;  1AVZ C;  2ECZ A;  3FJ5 A;  2KRS A;  4JPB W;  3VS5 A;  3I35 A;  2KE9 A;  2JS2 A;  2D8J A;  2KT1 A;  2LQW A;  1RLQ C;  4D8K A;  4RTZ A;  5FWB A;  1TG0 A;  1SEM A;  3RNJ A;  5IHI A;  2RQR A;  1KSW A;  2ED1 A;  2K2M A;  2ABL A;  4KRT A;  2DJQ A;  1PHT A;  2NUZ A;  1UG1 A;  2EGA A;  1ZUU A;  1OV3 A;  2GNC A;  2LZ6 B;  1UFF A;  4RUG A;  5IHK A;  4LN2 A;  3UA6 A;  4X1V A;  1OEB A;  2KRM A;  4OMM A;  1K9A A;  1UGV A;  2EVR A;  1WXT A;  4RTY A;  2PNI A;  1X69 A;  2D1X A;  1QCF A;  2RPN A;  1RUW A;  1X6B A;  2GGR A;  3H0I A;  1JQQ A;  4ESR A;  2VVK A;  2DX1 A;  4HVV A;  1WA7 A;  4AFZ C;  1YP5 A;  2EYZ A;  2J6F A;  1BB9 A;  2L3P A;  1CSK A;  1UJ0 A;  4Z89 A;  1X27 A;  4JJC A;  2HCK A;  2A28 A;  2YUP A;  1SHF A;  1PKT A;  4IIO A;  1Y57 A;  2D8H A;  2GBQ A;  3EG3 A;  2F2X A;  2NWM A;  4CC2 A;  2EW3 A;  2LQN A;  3SEM A;  4GBQ A;  4K11 A;  2XMF A;  1UE9 A;  3ZL7 C;  2SRC A;  2KRN A;  3SHW A;  2VWF A;  2CSQ A;  1MV3 A;  3VS4 A;  4A63 B;  2E5K A;  2C0T A;  1JU5 C;  1LCK A;  1ZBJ A;  2LJ0 A;  4JJD A;  3M0Q A;  2CH4 W;  2RN8 A;  3GBQ A;  2EGE A;  2RMO A;  4J9G A;  1KJW A;  5EC7 A;  2LP5 A;  1NEG A;  2CUB A;  2L3S A;  2KT8 A;  1GFC A;  2LMJ A;  2JMC A;  3H0H A;  4D8D A;  3M0S A;  4OML A;  1M3A A;  1PWT A;  1KIK A;  2JM8 A;  2J05 A;  4F17 A;  1K0S A;  1GBR A;  1ZSG A;  2DF6 A;  1M3C A;  1M30 A;  2KRO A;  3C0C A;  3PVQ A;  3I9Q A;  3PE0 A;  4LUE A;  1H3H A;  4AFS C;  4DEX A;  2O31 A;  1OPL A;  2K6D A;  1WIE A;  1NG2 A;  3NGP A;  2OAW A;  2FPD A;  3TVT A;  2HEQ A;  2CRE A;  3REB B;  2DE0 X;  1UUE A;  2DL7 A;  2K7A A;  1QWE A;  5HCK A;  1Y0M A;  4DEY A;  5I11 A;  2AKK A;  1NYF A;  3UAT A;  2F2W A;  3M0T A;  3I5S A;  1GCP A;  2ROT A;  3M0P A;  2MCN A;  1Z9Q A;  1UEC A;  3O5Z A;  1EFN A;  1X43 A;  2KNB B;  2PTK A;  2ROL A;  2GTO A;  5GJV B;  2EKH A;  2FEI A;  2J6K A;  2LX7 A;  1GFD A;  2SEM A;  1N5Z A;  2H8H A;  4JZ4 A;  5ECA A;  2K3B A;  3VS1 A;  1W6X A;  3NMZ C;  1E7O A;  2V1R A;  2DM1 A;  1PNJ A;  1GCQ C;  4HVW A;  4R0K A;  4OMO A;  1BBZ A;  1SRL A;  3QWX X;  5I22 A;  1G2B A;  1AOJ A;  2HDA A;  2EGC A;  4QT7 A;  4OMP A;  1OPK A;  1V1C A;  2FPF A;  3VS2 A;  1K76 A;  4M4Z A;  4E6R A;  4GLM A;  2PZ1 A;  5IHN A;  2DA9 A;  1AWX A;  1A0N B;  1ZUK A;  2OI3 A;  4J9D A;  1HD3 A;  3R6N A;  4LNP A;  1PRM C;  1S1N A;  1M27 C;  2IIM A;  1YCS B;  2W0Z A;  3EG0 A;  1WX6 A;  4IIM A;  2DNU A;  1CKB A;  2K79 A;  4EIK A;  1H8K A;  1TUD A;  1KFZ A;  1W1F A;  2CSI A;  3UF4 A;  2DMO A;  1WXB A;  1ZLM A;  1ZX6 A;  4WCI A;  2F2V A;  1K4U S;  1YN8 A;  1WDX A;  3CQT A;  1B3Q A;  2G6F X;  3NPF A;  3U23 A;  2O9V A;  5L23 A;  2MIO A;  4RTV A;  1X2Q A;  2KXD A;  1JXM A;  2HSP A;  2M0Y A;  1K1Z A;  1JEG A;  1WFW A;  1I07 A;  4HCK A;  2C0I A;  1MV0 B;  1JXO A;  4HVU A;  2BTT A;  3QWY A;  1PRL C;  1MUZ A;  2YT6 A;  4J9E A;  2AK5 A;  2A08 A;  1AD5 A;  1YWP A;  2X3W D;  2A37 A;  2BZX A;  2EYX A;  2I0N A;  4F16 A;  2EQI A;  1WLP B;  2FRW A;  3NHN A;  2DBM A;  1AZE A;  1GL5 A;  1VYU A;  1UHC A;  3IQL A;  4RTU A;  1K0X A;  1X6G A;  1AWW A;  2AZS A;  1ARK A;  2KBT A;  2YUN A;  3VS6 A;  3VS7 A;  4AFU C;  2DBK A;  4J9F A;  2DYB A;  1UHF A;  1TUC A;  2EBP A;  4LE9 A;  1VYV A;  1NLO C;  2L3Q A;  1YNZ A;  4Z88 A;  2JTE A;  2O2O A;  1AWJ A;  1T0J A;  2GQI A;  2DL3 A;  1BU1 A;  2LNH B;  5FWC A;  3KFV A;  3TSW A;  2CT4 A;  1T3L A;  2CUD A;  1JO8 A;  2J7I A;  4AFQ C;  2KXC A;  4J9I A;  2JMA A;  2YUQ A;  2L2P A;  4RTW A;  1HSQ A;  3M0U A;  1SPK A;  2JS0 A;  2YDL A;  1NYG A;  4LUD A;  2W10 A;  1GBQ A;  5IXF A;  2ESW A;  1CKA A;  1W70 A;  4JJB A;  5GJW B;  4ZNX A;  4CC4 B;  2V1Q A;  1T3S A;  2HBW A;  1J3T A;  2X3X D;  2LCS A;  4J9B A;  4RTT A;  3VS3 A;  2ED0 A;  3VRY A;  1QLY A;  4Y92 A;  3VRZ A;  3RBB B;  4F14 A;  5IH2 A;  3EG2 A;  1WI7 A;  2DLP A;  2EPD A;  1QKW A;  2KR3 A;  3I5R A;  1FYN A;  1NLP C;  3EHQ A;  3A98 A;  4AG2 C;  1RLP C;  1XOV A;  3H41 A;  2C0O A;  2RQU A;  1GRI A;  4OMQ A;  2CH4 A;  1E6H A;  1I1J A;  2EYW A;  2CT3 A;  2DL8 A;  3M0R A;  3PVL A;  3THK A;  2QDL A;  1X2K A;  4RTX A;  2DL5 A;  1BK2 A;  2DVJ A;  3H0F A;  2DIL A;  2FG0 A;  1AZG B;  2LJ1 A;  1NM7 A;  2BZ8 A;  2JM9 A;  2D0N A;  1M8M A;  3EGU A;  3LH5 A;  2KEA A;  1ABQ A;  1ABO A;  1UDL A;  1E6G A;  1YWO A;  2BZY A;  1U5S A;  1U06 A;  1SHG A;  2AZV A;  1OOT A;  3VS0 A;  1SRM A;  4CC3 A;  1I0C A;  2B86 A;  2KYB A;  2RQW A;  2J06 A;  1U3O A;  1UJY A;  2DRM A;  2M51 A;  2A36 A;  2FRY A;  2JT4 A;  1IO6 A;  2JW4 A;  1QKX A;  2ENM A;  3UA7 A;  2J6O A;  1G83 A;  1PKS A;  2O88 A;  1H92 A;  1UTI A;  2JXB A;  2FO0 A;  1VA7 A;  2FPE A;  1AEY A;  1HJD A;  2OJ2 A;  3TSZ A;  1GCQ A;  5IXB A;  2O9S A;  2LJ3 A;  2DL4 A;  1T0H A;  1Z9Z A;  1SSH A;  2P4R A;  1RI9 A;  4HXJ A;  2GTJ A;  1NEB A; 
#chains in the Genus database with same CATH topology
 2Y4X A;  1YI2 T;  5GAO l;  2L0A A;  2DRK A;  2COZ A;  1VIE A;  2RJF A;  3A8M B;  3SB2 A;  5GAM g;  4FCY A;  1VQ4 Q;  1TS9 A;  1B07 A;  3GF5 A;  4KGZ B;  1VQ9 T;  2K9G A;  3NFC A;  1LJO A;  3X20 B;  2KGT A;  1M1K C;  4F7U G;  2RQT A;  3HPW A;  4ORZ A;  3E9F A;  1ZUY A;  2E3H A;  1KQS S;  3EFO A;  4M77 G;  5DY9 A;  2KRS A;  4JPB W;  4BDY A;  1YIT A;  1VQ7 T;  1D3B A;  3CMA Q;  4PJO F;  3UWN A;  2RQR A;  1RAH B;  3OYH A;  2ZGW A;  2ED1 A;  4M7A F;  5GAN e;  1MMG A;  1Y96 B;  2GFA A;  2GQV A;  2ZPE B;  4C8Q A;  2NUZ A;  4LD6 A;  1D1A A;  3PMT A;  3SFM A;  2NUP A;  4PLL A;  1WHL A;  4E7L A;  2DEQ A;  1QVF A;  1X01 A;  4RUG A;  2PUK B;  2ZCF B;  1JJ2 P;  2EWN A;  2XID A;  2P0Q A;  3MEV A;  3WXM B;  3CCJ T;  1WGS A;  2A3L A;  4X1V A;  4OMM A;  1MMN A;  2EVR A;  1C0M A;  3OYG A;  2PNI A;  1X69 A;  4J5Y A;  5KYX B;  2GGR A;  2QG9 B;  2G3R A;  4XTX A;  2JZ2 A;  3C12 A;  1KD1 U;  1V76 A;  2LRQ A;  5GAO p;  2DET A;  4PJO B;  4HVV A;  3HRU A;  2PU9 B;  2EYZ A;  4M7A B;  2V8I A;  1UJ0 A;  2MAM A;  4M77 D;  2DTH A;  4JLI A;  2YUP A;  1M2V A;  1YJW T;  4EMK A;  3LGF A;  4IIO A;  3L2Q A;  4B9W A;  3EG3 A;  2F2X A;  2GF7 A;  3M4G A;  3M55 A;  2EW3 A;  3SEM A;  1N27 A;  2FHD A;  5I21 A;  1XTD A;  1KHC A;  4PJM A;  5IN1 A;  2C0T A;  1SSF A;  1IGU A;  1LCK A;  2X4X A;  3MO8 A;  4JJD A;  4L59 A;  4KH1 B;  2CH4 W;  2RN8 A;  3GBQ A;  5HK3 A;  1WHG A;  2RMO A;  4C8Q E;  1KJW A;  3N5B B;  2BUD A;  2LP5 A;  1BCO A;  2DXT A;  2L3S A;  3EGX A;  2LMJ A;  3H0H A;  1UB4 A;  3PTA A;  4EDU A;  1TH7 A;  4PJO G;  2RJD A;  3G71 A;  2JM8 A;  4M7A G;  3HTR A;  2DF6 A;  3CCE A;  4Y91 A;  1M3C A;  3PIO A;  1RI0 A;  3QHS A;  3CCS A;  3PVQ A;  1M1K U;  3NTI A;  4J83 A;  1H3H A;  4AFS C;  2RHY A;  2O31 A;  1OPL A;  2K6D A;  1RL2 A;  2FPD A;  2HEQ A;  1Y0M A;  4FYY B;  3M59 A;  3X28 B;  4FYX B;  2F2W A;  1X75 C;  3JCM J;  3OQ5 A;  3M0T A;  1VQK T;  2MF2 A;  5GAM e;  1GCP A;  2ROT A;  1D0Z A;  1EFN A;  1X43 A;  1Y71 A;  4NL3 A;  3MEU A;  1M4Z A;  2FEI A;  3FC3 A;  1YJ9 T;  1VQN T;  3M4Y A;  1GFD A;  1R77 A;  2SEM A;  3HP9 A;  1YI2 A;  1Q82 C;  1W6X A;  4QVZ A;  4LDU A;  5DM7 R;  1VQM T;  2V1R A;  2DM1 A;  2GCX A;  2NLU A;  2V26 A;  3HRS A;  1W2B S;  1GCQ C;  2XU8 A;  1VQ9 A;  2CZ6 B;  4OMO A;  1SRL A;  2ZPF B;  4PJO D;  2EYQ A;  5LJ3 g;  2HDA A;  4KUI A;  4OMP A;  4LDW A;  3VYH B;  3V8L A;  3LH0 A;  5GAN 8;  2FB7 A;  4M4Z A;  1G5V A;  1RAD B;  3RER A;  1VQ7 A;  4M77 C;  4OGE A;  4PK4 A;  1YCS B;  3L2R A;  5GAN 3;  3EFS A;  4DBH A;  2LQ8 A;  2PVO B;  3AT1 B;  5KYN A;  4BDZ A;  5LJ3 d;  4IIM A;  3OW2 A;  4EIK A;  5LJ3 h;  1W1F A;  2CSI A;  3M58 A;  3L2W A;  5LJ5 f;  1WXB A;  1ZLM A;  3QBY A;  2IG0 A;  1YN8 A;  2G6F X;  3L42 A;  2O9V A;  5L23 A;  3QPH A;  1QVP A;  2RI3 A;  4FM4 B;  5HY6 A;  2K57 A;  1JXM A;  3CCJ A;  1K1Z A;  3DB4 A;  4C5I A;  2EJG A;  5KYY B;  4HCK A;  5GAO m;  4OB3 B;  1VQP T;  3RIR A;  2OTJ Q;  2HKN A;  1JXO A;  1VOM A;  4C92 B;  4ZGD B;  2YT6 A;  4DQ2 A;  5KCO A;  5KE3 A;  2AK5 A;  5CKH A;  2A08 A;  5A0L A;  5LJ3 j;  1QW1 A;  1ZA2 B;  3X26 B;  1FX7 A;  1ZBX A;  2BZX A;  2E12 A;  2EYX A;  2I0N A;  4J6Y A;  4F16 A;  4AMC A;  1QP2 A;  2DBM A;  2EQJ A;  3E2U A;  4E7H A;  1VYU A;  3GNG A;  1K0X A;  1X6G A;  4M78 B;  1VQL Q;  1YJW A;  3QZ5 B;  3VS6 A;  3A5Z B;  2RHI A;  2ZPG B;  2DYB A;  2KSS A;  4Z88 A;  2L3Q A;  4A4H A;  3P8B B;  2MMP A;  1K8A C;  3V7C A;  2P4T A;  3VJP A;  2O2O A;  1AWJ A;  4ZN3 A;  1UGP B;  2HBP A;  1DJ7 B;  3QZ9 B;  2J7I A;  3PGG A;  2E70 A;  4Z02 A;  2B8A A;  1Q82 U;  3JSC A;  1IB8 A;  2L2P A;  1K73 C;  2K2V A;  4PLI A;  3I55 T;  3ZFJ A;  1I4K 1;  3A8G B;  3OS5 A;  1OQK A;  3NTH A;  4FT2 A;  4PJO C;  3INZ A;  2EQK A;  1J3T A;  3LYI A;  2X3X D;  4M7A C;  5A0G A;  2ZAE A;  2ED0 A;  3LLR A;  3VRY A;  3VRZ A;  2NUT A;  1M8V A;  3H9N A;  1QVF S;  2L3R A;  3EG2 A;  4FYW B;  2FL7 A;  2F69 A;  4EMH A;  1FYN A;  3A98 A;  1VQK A;  1XOV A;  3H41 A;  5D6Y A;  2RQU A;  1GRI A;  1Q86 R;  1VQO T;  5LJ3 e;  2CH4 A;  1YJ9 A;  1E6H A;  2CP7 A;  1VQN A;  5CQX A;  4OB0 B;  4MZM A;  3VUB A;  3TCJ A;  1VUB A;  2DL8 A;  3C95 A;  1KQ2 A;  3URG A;  4NS5 A;  2K5L A;  4C92 D;  1VQM A;  1JJ2 A;  5A2Q E;  2BKD N;  2FG0 A;  4M7D A;  4M77 E;  1BI2 A;  3GOX A;  4BE2 A;  3SDZ A;  3EG9 B;  3CXC P;  1ABO A;  1UDL A;  1E6G A;  1U5S A;  2L5Q A;  2CP5 A;  5C6S A;  3EGD A;  4B6M A;  3CCQ T;  1FMW A;  1MHN A;  4GLK A;  1OOT A;  4M78 D;  2EKO A;  1Q7Y R;  4CC3 A;  3JCM X;  1WQW A;  3E9G A;  2B86 A;  2KYB A;  2J06 A;  2EIF A;  2C06 A;  2FRY A;  3CCU Q;  1LOJ A;  3GLX A;  2DFU A;  2ENM A;  2J6O A;  3C4S A;  1IRE B;  2E1H A;  1UTI A;  5GAN 6;  2FO0 A;  1YIT T;  3RKY A;  2E5Q A;  4O5V A;  1G3S A;  1K8A U;  2QDY B;  2WAC A;  2E41 A;  4XTU A;  1BI0 A;  2AT1 B;  5GAN 7;  2M02 A;  2P4R A;  4E7I A;  4HXJ A;  3VUZ A;  5D6X A;  2KYM A;  2CDT A;  4XU3 A;  2DTO A;  2AHJ B;  1VQP A;  1KC8 C;  4RMO A;  3OYK A;  1M1G A;  1PD0 A;  2RF0 A;  2AKL A;  1QWF A;  1K73 U;  1KK7 A;  4PNO A;  1QVG A;  1WXU A;  4X34 A;  4PKC C;  2VKN A;  3CBP A;  4M7D E;  1FMK A;  4IUU A;  3P8D A;  3FJ5 A;  2K5I A;  4J7F A;  3VS5 A;  2KT1 A;  2LCC A;  1YI2 Q;  2HQE A;  4OF1 A;  4IKF A;  1TG0 A;  1P92 A;  4RCB A;  2QEX T;  3JCM P;  2LNV A;  1OU9 A;  4DBF A;  3H8Z A;  4A4F A;  1I8F A;  2VV5 A;  3J81 E;  1OV3 A;  2GNC A;  4ME7 A;  3GPL A;  4PJO E;  5IHK A;  3CPW P;  5KYU A;  4M7A E;  3SWN A;  4F7U F;  1WHK A;  1C6V X;  3UA6 A;  3FJP A;  1OEB A;  2QQ9 A;  3I55 A;  1VQ7 Q;  3Q1J A;  1WXT A;  1S72 T;  2RPN A;  1RUW A;  2EJ9 A;  4KUL A;  3OW2 S;  1X6B A;  3H0I A;  1JQQ A;  4Q5W A;  4ESR A;  1Q81 R;  2VVK A;  5DLQ E;  1WA7 A;  4D6W A;  2NYS A;  1OI1 A;  1YP5 A;  1QP3 A;  1BB9 A;  2L3P A;  1WHH A;  3G71 T;  3CCL T;  1CSK A;  4C5H A;  2LQK A;  1X27 A;  2LCL A;  4E7J A;  2DD4 A;  2XKO C;  1PKT A;  1ZSZ A;  2GBQ A;  4OP0 A;  4FT4 A;  2X51 A;  2KI7 A;  2XMF A;  3ER0 A;  1UE9 A;  2SRC A;  2KRN A;  2VB6 A;  1VQO A;  3OMG A;  2DXU A;  1HXD A;  5I2M A;  3VS4 A;  4A63 B;  2DYI A;  2M1H A;  1JU5 C;  2MPX C;  2QI2 A;  1ZBJ A;  2HZY A;  2LJ0 A;  3M0Q A;  2EJF A;  4KUD K;  1TTH B;  3S3O A;  2EGE A;  4J9G A;  1TOV A;  5EC7 A;  5FU6 B;  1NEG A;  2JOY A;  1ZHI A;  3FLG A;  2KT8 A;  1GFC A;  1KC8 U;  2JMC A;  3M0S A;  1YJW Q;  2RI2 A;  2QGF B;  5LJ5 g;  1KIK A;  4PJL A;  1MNE A;  4F17 A;  1H3Z A;  1K0S A;  1ZSG A;  1M1F A;  1IRX A;  3V8J A;  3CCQ A;  2XD0 A;  2KRO A;  3C0C A;  1I81 A;  4ELZ C;  3I9Q A;  3UT1 A;  3PE0 A;  2P84 A;  1VQ6 Q;  2RK1 A;  4M75 B;  1WIE A;  2OAW A;  3OSV A;  2DE0 X;  1UUE A;  2K7A A;  5HCK A;  2OX7 A;  4BY6 B;  1U1S A;  5LJ5 d;  4JRI A;  1NYF A;  3DLM A;  5LJ5 h;  4A4G A;  2DER A;  3M54 A;  2YLB A;  3MKD A;  3QKJ A;  3I5S A;  2MCN A;  3GP8 A;  2KNB B;  2PTK A;  1B34 B;  2LX7 A;  2ZPB B;  2HL3 A;  2BE7 D;  2DIG A;  1PC0 A;  5ECA A;  2K3B A;  4EPC A;  3I56 T;  5KE2 A;  4P5N A;  1XQH A;  2E64 A;  1E7O A;  1U1T A;  5FU7 B;  3OYE A;  4LDX A;  3M53 A;  4ZTJ A;  3O8V A;  2HQX A;  4C0D B;  5LJ5 j;  2DZC A;  2KQW A;  2A0F B;  4M75 G;  4BI8 B;  1VQK Q;  1VQ8 T;  3G6E A;  3VS2 A;  1K76 A;  2CS7 A;  3PIP A;  1VQ5 T;  1YCY A;  2QGG A;  4XU1 A;  2KVQ G;  5IHN A;  1F1B B;  1WPY A;  2EQU A;  3HKS A;  1A0N B;  1VQN Q;  5I2S A;  4LNP A;  1S1N A;  1M27 C;  2A7Y A;  3VYG A;  2W0Z A;  2L8D A;  1G3W A;  1VQM Q;  2QEX A;  1JJ2 S;  3V8K A;  3QG1 A;  3OY9 A;  2QQB A;  2K79 A;  4PJJ A;  3MET A;  2F2V A;  1WDX A;  3NPF A;  3CC4 A;  2DXC A;  2KXD A;  2M0Y A;  2K4Y A;  2OTL T;  2QK0 A;  2WSE E;  1PG5 B;  5HK0 A;  2QTV A;  5FRM A;  2VGN A;  2C0I A;  5KCH A;  1S72 A;  1BIB A;  2RI5 A;  2BTT A;  3L2Z A;  1PRL C;  1MUZ A;  3FRN A;  1N8R C;  2KMT A;  2CYZ B;  2F5K A;  3M57 A;  1JB0 E;  4BI3 A;  5GAN 4;  4M75 D;  3CXC A;  3ZEH A;  4WTO B;  1D1C A;  1QVG P;  2VYT A;  3CCL A;  1OUL A;  4E7S A;  1UHC A;  4QQD A;  3J80 E;  5GAN f;  3H6Z A;  4XQ3 A;  3OYM A;  4X9C A;  3G4S T;  3EG9 A;  1NZ9 A;  4QVD A;  1VQP Q;  1BI1 A;  4MMK A;  4LE9 A;  1VYV A;  3S3M A;  1Y07 A;  1WJS A;  2QA4 Q;  1M90 C;  3CMA T;  5DLO A;  2XIC A;  2DL3 A;  2RH2 A;  4E7K A;  1T3L A;  1JO8 A;  2YHT A;  4AFQ C;  2FYK A;  4MDW A;  4PFZ A;  4A53 A;  2JTM A;  3BW1 A;  2O4X B;  2JMA A;  3M0U A;  4DOW A;  3L1A A;  1TUG B;  1GBQ A;  3BFM A;  3BDU A;  1CKA A;  1W70 A;  4RG2 A;  3OBW A;  3EFR A;  2V1Q A;  2HBW A;  4A54 A;  2X4W A;  1R0C B;  2LCS A;  3JCM b;  1BIA A;  3X25 B;  1QLY A;  4Y92 A;  1XNI A;  2R58 A;  3PMI A;  3RBB B;  4F14 A;  1WI7 A;  3CME Q;  2DLP A;  2VGM A;  3QJY A;  4QW2 A;  3JB9 H;  1NLP C;  4ZN1 A;  4C92 F;  3FEO A;  3I55 Q;  3PT9 A;  2C0O A;  1SF9 A;  1N8R R;  3RKW A;  4N4G A;  2XDB A;  5AYF A;  1RAB B;  1I1J A;  3CCM T;  2D6F A;  3M0R A;  3CC7 Q;  3I56 A;  3PVL A;  3CPW A;  3F70 A;  4M78 F;  5KYW B;  1BK2 A;  3FB9 A;  3H0F A;  3P8H A;  3OYI A;  1NPP A;  1GXI E;  4FIB A;  1D09 B;  2EAY A;  2X4Y A;  2BZ8 A;  2JM9 A;  2ZPI B;  1VQ8 A;  1N8R U;  1VQ5 A;  1M90 R;  1M2O A;  4J6X A;  2X4J A;  2YRC A;  3VS0 A;  4F04 B;  1M9S A;  3RES A;  1Q86 C;  5GAM f;  1PCX A;  2LDM A;  4OB1 B;  4BY6 C;  2WSF E;  5CCA A;  2LVM A;  3TQ7 P;  3OS1 A;  1UJY A;  2M51 A;  2A36 A;  4HT9 A;  2BIV A;  5IAY A;  5CQY A;  3PNW C;  1PKS A;  2ZZD A;  1H92 A;  2XG8 D;  2COY A;  4II1 A;  2RJC A;  4EMG A;  1VA7 A;  4C5E A;  1AEY A;  1HJD A;  3TSZ A;  1GCQ A;  5IXB A;  1T0H A;  3EFO B;  3CCQ Q;  1V29 B;  2GTJ A;  1NLO C;  2OTL A;  3ULR B;  2MOX A;  5FU7 C;  4CC7 A;  3DKM A;  1D3B B;  3JB9 F;  4JZ3 A;  1YBY A;  4F7U A;  4ATO A;  2H3E B;  4AG1 C;  1Q7Y C;  2V8J A;  4FSS A;  1AWO A;  2RNA A;  2M0O A;  3CCV T;  4C92 G;  4M77 A;  2M9U A;  4J9C A;  4C8Q B;  5FW9 A;  3EHR A;  1VYT A;  4IUP A;  2YSQ A;  4J9H A;  2NUP B;  1YIT Q;  2RQV A;  4OMN A;  2CGH A;  4MDX A;  1ZQ1 A;  3I35 A;  3MP1 A;  2JS2 A;  2D8J A;  2FZK B;  1NJI C;  2LQW A;  1RLQ C;  3G4S A;  4M78 G;  4RTZ A;  1WJQ A;  1KSW A;  2DD5 A;  2K2M A;  4BD3 A;  2DJQ A;  2MK5 A;  1PHT A;  2KDS A;  4DOV A;  3EH1 A;  3CMA A;  2EGA A;  3OS0 A;  1UEB A;  3X24 B;  2RK2 A;  4LN2 A;  4UC4 A;  1IGQ A;  2YXY A;  3CD6 T;  3CC2 T;  2R57 A;  2RHX A;  1M2V B;  4B9X A;  4EMK B;  2KRM A;  1K9A A;  1UGV A;  2DO3 A;  1EZZ B;  1WZO A;  1B34 A;  1QCF A;  2D1X A;  3CCR T;  4XU0 A;  1WHJ A;  1Y96 A;  2DPP B;  2EQM A;  4F7U E;  1OX8 A;  5GAO n;  2OTJ T;  2DX1 A;  3R6O A;  3HFO A;  2LTO A;  1Q86 U;  2HKQ B;  2HCK A;  3JB9 G;  1G8X A;  1SHF A;  1Y57 A;  2D8H A;  2NWM A;  2LC4 A;  2LQN A;  5GMK h;  1S72 Q;  3ZL7 C;  3OS2 A;  1VQL T;  2VWF A;  5KYX A;  4FSX A;  2CSQ A;  4LDV A;  4DBR A;  2E5K A;  4JJN K;  3CCM A;  4R55 A;  3GIB A;  4PJO A;  3CXC S;  4M7A A;  1UGQ B;  3G71 Q;  2JTF A;  1Q81 C;  1NJI R;  2CUB A;  3LGL A;  3CCE Q;  4C8Q D;  1M5Q 1;  3CCS Q;  1Q7Y U;  1M3A A;  2DVE A;  1IZ6 A;  1YIJ T;  4C0Z A;  1ACM B;  2K3Y A;  4XK8 E;  2P0K A;  5GMK j;  1RAG B;  1JBM A;  1MND A;  4DEX A;  2PVG B;  3MJX A;  1K9M R;  1NG2 A;  2VAS A;  3M56 A;  3G6E T;  2CRE A;  2DL7 A;  1MMD A;  3JB9 D;  2MI6 A;  3M0P A;  5J3B A;  4JRP A;  3RKX A;  9ATC B;  1UEC A;  3O5Z A;  4FYV B;  2O01 E;  4LDY A;  2ROL A;  1O9S A;  1KQ1 A;  4N0A C;  3V7S A;  2QQA A;  1VQ9 Q;  3VS1 A;  2DKG A;  3JRZ A;  3CC4 T;  1FWZ A;  3CCV A;  1PNJ A;  4HVW A;  2HNI A;  1BBZ A;  5I22 A;  1G2B A;  4C92 C;  1KG1 A;  2EGC A;  2L89 A;  2E65 A;  2LT4 A;  2QQR A;  3UPU A;  3S6W A;  3JCM Q;  2CKK A;  5GAN d;  4E6R A;  4GLM A;  2PZ1 A;  4VUB A;  3RR6 A;  1G3Y A;  3D7S B;  5GAN h;  1AWX A;  5GAO q;  3HSB A;  2OI3 A;  4J9D A;  1Q95 G;  3FDR A;  1HD3 A;  3R6N A;  2HD0 A;  2DXB A;  1OYX A;  4JRK A;  2QAS A;  3I56 Q;  3CPW S;  5CAI A;  1WX6 A;  4M78 C;  4V2S A;  3TEE A;  3OYL A;  2DNU A;  1CKB A;  2VUB A;  1H8K A;  3UF4 A;  5CVI A;  1K4U S;  1ZX6 A;  3CCJ Q;  5CO7 A;  3CQT A;  1B3Q A;  3U23 A;  1YHQ T;  4BB7 A;  5GMK e;  1VQ8 Q;  2MIO A;  3CBO A;  4RTV A;  1VQ5 Q;  2RB6 A;  4LD9 K;  4M75 F;  3CD6 A;  3CC2 A;  1WFW A;  5GAN j;  1Q81 U;  4HT8 A;  1MV0 B;  3QWY A;  3CCR A;  2X9H A;  1AHJ B;  2VXF A;  4J9E A;  4BUG A;  5CKB A;  1I5L A;  2K3X A;  1YWP A;  2X3W D;  2OTJ A;  5GAN 5;  6AT1 B;  3A8L B;  1WLP B;  5CK9 A;  3MCA B;  3QUI A;  1WNL A;  1GL5 A;  4QQ6 A;  2DTI A;  4RTU A;  3OYF A;  1AWW A;  1YJN T;  2E10 A;  2AZS A;  1ARK A;  2KBT A;  3OYD A;  3VS7 A;  2I2L A;  5KYY A;  4AFU C;  2DBK A;  2JN0 A;  3MP8 A;  8ATC B;  1NE8 A;  1TUC A;  4C92 A;  2EBP A;  1U8R A;  1YNZ A;  1VQL A;  1QCN A;  2VC8 A;  1KQS P;  2DK3 A;  1T0J A;  3ASK A;  2DIQ A;  4M7D F;  2NUT B;  5FWC A;  3KFV A;  3M5A A;  3TSW A;  2CUD A;  3BY7 A;  4EMK C;  2KXC A;  1BYM A;  5CKD A;  4J9I A;  2YUQ A;  4RTW A;  1HSQ A;  5EG2 A;  4M78 A;  1SPK A;  2JS0 A;  4PJN A;  1NYG A;  2DEU A;  3G4S Q;  5IXF A;  1YIJ A;  4R56 A;  4MZT A;  4JJB A;  3JB9 J;  4CC4 B;  5HKC A;  2CP3 A;  1T3S A;  2CP6 A;  1QMC A;  3BDL A;  3V7R A;  5A0D A;  4WF2 A;  2HQH A;  5GAM d;  4KGX B;  1EX4 A;  5GAM h;  3JB9 I;  5IH2 A;  3JCM f;  3WVE B;  2D0Q B;  2HL5 C;  1G3T A;  2H3J A;  3CPF A;  1PSF A;  1FMV A;  1QKW A;  4M7D B;  1OU8 A;  3I5R A;  4RG8 A;  1KD1 R;  2E6N A;  2GFU A;  1YJ9 Q;  5CKE A;  4KT0 E;  2JJ9 A;  1EIF A;  5FRN A;  3EGD B;  2R5A A;  4FU6 A;  3OYN A;  2EYW A;  4C92 E;  2Y4Y A;  1PD1 A;  5GAM j;  1X2K A;  2DL5 A;  1Y7X A;  3L2V A;  3C94 A;  3MPU B;  1AZG B;  3OA6 A;  2LJ1 A;  4RKU E;  4QVC A;  2D0N A;  3EGU A;  3LH5 A;  2YLC A;  2FZC B;  2KEA A;  1YWO A;  4M78 E;  2E3I A;  1LNX A;  3MEA A;  2XDD A;  2AZV A;  3LWH A;  4M7D G;  2FVU A;  2MYS A;  2CP2 A;  3CCM Q;  1BCM A;  1I0C A;  1OZ3 A;  2RQW A;  4PFP A;  2F5T X;  2MWP A;  1AT1 B;  3RMS A;  4XU2 A;  3OB9 A;  1QKX A;  1WHM A;  1M1K R;  1VQ4 T;  4L5G A;  1G83 A;  1VQ6 T;  2O88 A;  1LVK A;  3L2U A;  2QYZ A;  5J39 A;  1TSF A;  2FPE A;  3QYH B;  3RDV A;  1YHQ A;  3CCU A;  2LJ3 A;  4PFO A;  1Z9Z A;  1SSH A;  5IT9 E;  1RI9 A;  2COW A;  5LJ5 e;  5GMK l;  4C0G A;  5KH6 A;  2JUF A;  1QVG S;  1WYX A;  2EYY A;  4BE0 A;  4Z8A A;  3EG1 A;  4DBQ A;  1PSE A;  3OSS C;  4HKE A;  1M3B A;  3A8O B;  4XTY A;  2OAU A;  3REA B;  4BAC A;  2YUO A;  5FRO A;  4ZTF A;  2RHU A;  5D6W A;  1BKB A;  4JLG A;  3RUX A;  3S3N A;  3JV3 A;  1AVZ C;  2ECZ A;  5KYU B;  3HRT A;  4M7D D;  3SWN B;  1YJN A;  4JUV A;  1W2B P;  2KE9 A;  4QKU A;  2VXE A;  4FW2 A;  3QDR B;  2PVD B;  2MWO A;  3J7A F;  3VKI A;  4D8K A;  5FWB A;  2XHC A;  2CP0 A;  1SEM A;  3RNJ A;  1MMA A;  5IHI A;  3A1P A;  3CCV Q;  2ABL A;  4KRT A;  3FIF A;  4HCC A;  1UG1 A;  4YTL A;  1ZUU A;  3KBG A;  3WVD B;  3MHX A;  2LZ6 B;  1SG5 A;  1UFF A;  2P0P A;  1NBE B;  4E47 A;  4JRQ A;  4TVR A;  1N9S A;  2LX9 A;  3JAM E;  4OGC A;  1ZSZ B;  2IVW A;  4M7A D;  5FU6 C;  4XTZ A;  2IPO B;  4RTY A;  3QDF A;  1TXQ A;  1D0X A;  3G1J A;  4J7I A;  5FLX E;  1RAF B;  2ATC B;  4Y28 E;  4C0F A;  4AFZ C;  4HCB A;  2J6F A;  4Z89 A;  3OMC A;  3T9N A;  4JJC A;  2HSE B;  2A28 A;  3CD6 Q;  1FXX A;  4FL6 A;  4M75 C;  1VQO Q;  3CC2 Q;  1OX9 A;  2RJE A;  4CC2 A;  4GBQ A;  4K11 A;  1D1B A;  4C8Q F;  5J26 A;  3SD4 A;  4DA4 A;  3SHW A;  3CCR Q;  4A4K A;  1MV3 A;  1SKU B;  1WJR A;  2Z0W A;  4J8O A;  5CR2 A;  4L6V 5;  1RAI B;  4PL6 A;  3EAE A;  1B7T A;  2ZPH B;  3E1S A;  2QA4 T;  4KH0 B;  1M90 U;  4OVA A;  2F1L A;  3DB3 A;  4MZP A;  1D0Y A;  4D8D A;  4OML A;  3DLL A;  3VU3 C;  1PWT A;  3TRE A;  3MP6 A;  4RCC A;  2J05 A;  1GBR A;  1IXD A;  1Q82 R;  4C0D C;  1M30 A;  3NTK A;  4IUT A;  3OYJ A;  3RMQ A;  2KK4 A;  4LUE A;  4BI4 A;  4M7D C;  2WSC E;  3NGP A;  4A4E A;  3TVT A;  3REB B;  1QWE A;  4DEY A;  5I11 A;  2HMA A;  1VQ4 A;  1VQ6 A;  2AKK A;  3OYB A;  3UAT A;  2QTX A;  2E6Z A;  3CME T;  1YIJ Q;  1OZ2 A;  1Z9Q A;  1QVF P;  1KQS A;  1ZA1 B;  3QYG B;  8AT1 B;  2GTO A;  5GJV B;  2EKH A;  3LW5 E;  2J6K A;  5CIU A;  1C1A A;  4O6J A;  1N5Z A;  3QJ6 A;  1N6A A;  2H8H A;  4JZ4 A;  2DZ9 A;  2M16 A;  4N4I A;  4M75 A;  1RAC B;  2YRD A;  3NMZ C;  2YRV A;  3G6E Q;  4KBM B;  3A8H B;  4LXC A;  1K9M C;  4R0K A;  1IHW A;  3QWX X;  3CC7 T;  4CRI A;  1AOJ A;  4C8Q G;  3LWI A;  4QT7 A;  1OPK A;  1V1C A;  2FPF A;  2RO0 A;  4XAX B;  2DJZ A;  2DA9 A;  1WQ7 A;  2QEX Q;  1ZUK A;  2R5M A;  1PRM C;  2IIM A;  4ELY C;  2YWW A;  4FW1 A;  5M9O A;  3EG0 A;  3CC4 Q;  7AT1 B;  1KFZ A;  1TUD A;  2DMO A;  4WCI A;  4JS4 A;  3EGX B;  4N4H A;  2XI9 A;  1HYO A;  1X2Q A;  3E19 A;  4NL2 A;  4MML A;  2QXF A;  2JNG A;  3GNF B;  2HSP A;  3KUF A;  3JCM g;  1JEG A;  5GMK m;  1I07 A;  1R8O B;  2QAZ A;  1TU0 B;  1K8A R;  4HVU A;  1N9R A;  2FZG B;  3CCL Q;  4M75 E;  1AD5 A;  2E4H A;  2A37 A;  1PM3 A;  4IUR A;  2CZ7 B;  2EQI A;  3SWN C;  1W4S A;  2FRW A;  5GMK i;  3HFN A;  3NHN A;  3JCM d;  1YHQ Q;  1AZE A;  1K73 R;  3JCM h;  3IQL A;  3ME9 A;  4JS5 A;  2V8K A;  3MEW A;  2RM4 A;  2DAQ A;  2YUN A;  4HA8 A;  2D9T A;  2K5F A;  4J9F A;  1UHF A;  1KHI A;  2JTE A;  3VV0 A;  5LJ3 f;  1NJI U;  2JVV A;  3OYC A;  2GQI A;  4XTV A;  5AT1 B;  1YFN A;  1BU1 A;  2LNH B;  2XDP A;  4JDS A;  2CT4 A;  3QO3 A;  2QA4 A;  1ZSZ C;  2PUO B;  2QQS A;  4E7Z A;  1YJN Q;  2YDL A;  4ANJ A;  4C5G A;  3ZBD A;  4ZGE B;  4LUD A;  2W10 A;  3LX7 A;  5GAN g;  1IHV A;  3G7Z A;  1K9M U;  2ESW A;  5GJW B;  5CKF A;  2CZ1 B;  4ZNX A;  4AT1 B;  1I5O B;  2EFI A;  4X9D A;  4ZGJ B;  2PQW A;  3QII A;  1RAE B;  4J9B A;  4RTT A;  3VS3 A;  4CI0 C;  3BE3 A;  2KY9 A;  4GY5 A;  1NPR A;  2EPD A;  2O4X A;  1W2B A;  2KR3 A;  1X6O A;  3OW2 P;  1TWB A;  3EHQ A;  4AG2 C;  1O75 A;  1RLP C;  5C0M A;  3KXT A;  4KGV B;  4QQG A;  3CME A;  2BE9 B;  3HHT B;  4OMQ A;  3PFS A;  3OYA A;  1BI3 A;  4M77 F;  2CT3 A;  3CEY A;  1UGS B;  1RAA B;  3THK A;  2QDL A;  4RTX A;  3JCM c;  3CCU T;  2DVJ A;  3OBY A;  2DIL A;  3OYY A;  5GAO r;  4OB2 B;  4NOY A;  5LL6 S;  2RD1 A;  3M9Q A;  3AHU A;  2Y90 A;  1NM7 A;  4XTW A;  3CC7 A;  3TU4 K;  1M8M A;  4IUV A;  1QQJ A;  1JRI A;  3JCM V;  1H64 1;  1ABQ A;  1XJW B;  2BZY A;  3UDC A;  1KD1 C;  2AIR B;  2X35 A;  1U06 A;  5D7U A;  1LPL A;  4C8Q C;  3CCE T;  1SHG A;  1HK9 A;  3CCS T;  1KC8 R;  3HL8 A;  1VIF A;  3EH2 A;  3QXE B;  1SRM A;  5GAN 2;  2KAF A;  4F7U B;  4IUQ A;  3JCM e;  1U3O A;  4E2F B;  2DRM A;  5L8R E;  5KYW A;  3CBM A;  2JT4 A;  4N0A A;  1IO6 A;  1MGQ A;  2JW4 A;  2XK0 A;  2LT1 A;  4M77 B;  3UA7 A;  3JCM W;  4BE1 A;  1QCO A;  2JXB A;  2OTL Q;  4OMF B;  1UGR B;  2OJ2 A;  2HAX A;  2CZ0 B;  2O9S A;  3QSU A;  4HCZ A;  2DL4 A;  2RHZ A;  2RA2 A;  1R0B G;  4J6W A;  1NEB A; 
#chains in the Genus database with same CATH homology
 3ULR B;  2MOX A;  2KYM A;  4CC7 A;  2CDT A;  2L0A A;  4JZ3 A;  2DRK A;  1WYX A;  2EYY A;  2RF0 A;  4Z8A A;  4AG1 C;  4FSS A;  2AKL A;  1QWF A;  2RNA A;  1AWO A;  3EG1 A;  1B07 A;  4J9C A;  1WXU A;  2K9G A;  5FW9 A;  3EHR A;  1M3B A;  2VKN A;  1VYT A;  4J9H A;  2KGT A;  2YSQ A;  3REA B;  2YUO A;  2RQT A;  2RQV A;  4OMN A;  4ORZ A;  1FMK A;  1ZUY A;  3JV3 A;  1AVZ C;  2ECZ A;  3FJ5 A;  2KRS A;  4JPB W;  3VS5 A;  3I35 A;  2KE9 A;  2JS2 A;  2D8J A;  2KT1 A;  2LQW A;  1RLQ C;  4D8K A;  4RTZ A;  5FWB A;  1TG0 A;  1SEM A;  3RNJ A;  5IHI A;  2RQR A;  1KSW A;  2ED1 A;  2K2M A;  2ABL A;  4KRT A;  2DJQ A;  1PHT A;  2NUZ A;  1UG1 A;  2EGA A;  1ZUU A;  1OV3 A;  2GNC A;  2LZ6 B;  1UFF A;  4RUG A;  5IHK A;  4LN2 A;  3UA6 A;  4X1V A;  1OEB A;  2KRM A;  4OMM A;  1K9A A;  1UGV A;  2EVR A;  1WXT A;  4RTY A;  2PNI A;  1X69 A;  2D1X A;  1QCF A;  2RPN A;  1RUW A;  1X6B A;  2GGR A;  3H0I A;  1JQQ A;  4ESR A;  2VVK A;  2DX1 A;  4HVV A;  1WA7 A;  4AFZ C;  1YP5 A;  2EYZ A;  2J6F A;  1BB9 A;  2L3P A;  1CSK A;  1UJ0 A;  4Z89 A;  1X27 A;  4JJC A;  2HCK A;  2A28 A;  2YUP A;  1SHF A;  1PKT A;  4IIO A;  1Y57 A;  2D8H A;  2GBQ A;  3EG3 A;  2F2X A;  2NWM A;  4CC2 A;  2EW3 A;  2LQN A;  3SEM A;  4GBQ A;  4K11 A;  2XMF A;  1UE9 A;  3ZL7 C;  2SRC A;  2KRN A;  3SHW A;  2VWF A;  2CSQ A;  1MV3 A;  3VS4 A;  4A63 B;  2E5K A;  2C0T A;  1JU5 C;  1LCK A;  1ZBJ A;  2LJ0 A;  4JJD A;  3M0Q A;  2CH4 W;  2RN8 A;  3GBQ A;  2EGE A;  2RMO A;  4J9G A;  1KJW A;  5EC7 A;  2LP5 A;  1NEG A;  2CUB A;  2L3S A;  2KT8 A;  1GFC A;  2LMJ A;  2JMC A;  3H0H A;  4D8D A;  3M0S A;  4OML A;  1M3A A;  1PWT A;  1KIK A;  2JM8 A;  2J05 A;  4F17 A;  1K0S A;  1GBR A;  1ZSG A;  2DF6 A;  1M3C A;  1M30 A;  2KRO A;  3C0C A;  3PVQ A;  3I9Q A;  3PE0 A;  4LUE A;  1H3H A;  4AFS C;  4DEX A;  2O31 A;  1OPL A;  2K6D A;  1WIE A;  1NG2 A;  3NGP A;  2OAW A;  2FPD A;  3TVT A;  2HEQ A;  2CRE A;  3REB B;  2DE0 X;  1UUE A;  2DL7 A;  2K7A A;  1QWE A;  5HCK A;  1Y0M A;  4DEY A;  5I11 A;  2AKK A;  1NYF A;  3UAT A;  2F2W A;  3M0T A;  3I5S A;  1GCP A;  2ROT A;  3M0P A;  2MCN A;  1Z9Q A;  1UEC A;  3O5Z A;  1EFN A;  1X43 A;  2KNB B;  2PTK A;  2ROL A;  2GTO A;  5GJV B;  2EKH A;  2FEI A;  2J6K A;  2LX7 A;  1GFD A;  2SEM A;  1N5Z A;  2H8H A;  4JZ4 A;  5ECA A;  2K3B A;  3VS1 A;  1W6X A;  3NMZ C;  1E7O A;  2V1R A;  2DM1 A;  1PNJ A;  1GCQ C;  4HVW A;  4R0K A;  4OMO A;  1BBZ A;  1SRL A;  3QWX X;  5I22 A;  1G2B A;  1AOJ A;  2HDA A;  2EGC A;  4QT7 A;  4OMP A;  1OPK A;  1V1C A;  2FPF A;  3VS2 A;  1K76 A;  4M4Z A;  4E6R A;  4GLM A;  2PZ1 A;  5IHN A;  2DA9 A;  1AWX A;  1A0N B;  1ZUK A;  2OI3 A;  4J9D A;  1HD3 A;  3R6N A;  4LNP A;  1PRM C;  1S1N A;  1M27 C;  2IIM A;  1YCS B;  2W0Z A;  3EG0 A;  1WX6 A;  4IIM A;  2DNU A;  1CKB A;  2K79 A;  4EIK A;  1H8K A;  1TUD A;  1KFZ A;  1W1F A;  2CSI A;  3UF4 A;  2DMO A;  1WXB A;  1ZLM A;  1ZX6 A;  4WCI A;  2F2V A;  1K4U S;  1YN8 A;  1WDX A;  3CQT A;  1B3Q A;  2G6F X;  3NPF A;  3U23 A;  2O9V A;  5L23 A;  2MIO A;  4RTV A;  1X2Q A;  2KXD A;  1JXM A;  2HSP A;  2M0Y A;  1K1Z A;  1JEG A;  1WFW A;  1I07 A;  4HCK A;  2C0I A;  1MV0 B;  1JXO A;  4HVU A;  2BTT A;  3QWY A;  1PRL C;  1MUZ A;  2YT6 A;  4J9E A;  2AK5 A;  2A08 A;  1AD5 A;  1YWP A;  2X3W D;  2A37 A;  2BZX A;  2EYX A;  2I0N A;  4F16 A;  2EQI A;  1WLP B;  2FRW A;  3NHN A;  2DBM A;  1AZE A;  1GL5 A;  1VYU A;  1UHC A;  3IQL A;  4RTU A;  1K0X A;  1X6G A;  1AWW A;  2AZS A;  1ARK A;  2KBT A;  2YUN A;  3VS6 A;  3VS7 A;  4AFU C;  2DBK A;  4J9F A;  2DYB A;  1UHF A;  1TUC A;  2EBP A;  4LE9 A;  1VYV A;  1NLO C;  2L3Q A;  1YNZ A;  4Z88 A;  2JTE A;  2O2O A;  1AWJ A;  1T0J A;  2GQI A;  2DL3 A;  1BU1 A;  2LNH B;  5FWC A;  3KFV A;  3TSW A;  2CT4 A;  1T3L A;  2CUD A;  1JO8 A;  2J7I A;  4AFQ C;  2KXC A;  4J9I A;  2JMA A;  2YUQ A;  2L2P A;  4RTW A;  1HSQ A;  3M0U A;  1SPK A;  2JS0 A;  2YDL A;  1NYG A;  4LUD A;  2W10 A;  1GBQ A;  5IXF A;  2ESW A;  1CKA A;  1W70 A;  4JJB A;  5GJW B;  4ZNX A;  4CC4 B;  2V1Q A;  1T3S A;  2HBW A;  1J3T A;  2X3X D;  2LCS A;  4J9B A;  4RTT A;  3VS3 A;  2ED0 A;  3VRY A;  1QLY A;  4Y92 A;  3VRZ A;  3RBB B;  4F14 A;  5IH2 A;  3EG2 A;  1WI7 A;  2DLP A;  2EPD A;  1QKW A;  2KR3 A;  3I5R A;  1FYN A;  1NLP C;  3EHQ A;  3A98 A;  4AG2 C;  1RLP C;  1XOV A;  3H41 A;  2C0O A;  2RQU A;  1GRI A;  4OMQ A;  2CH4 A;  1E6H A;  1I1J A;  2EYW A;  2CT3 A;  2DL8 A;  3M0R A;  3PVL A;  3THK A;  2QDL A;  1X2K A;  4RTX A;  2DL5 A;  1BK2 A;  2DVJ A;  3H0F A;  2DIL A;  2FG0 A;  1AZG B;  2LJ1 A;  1NM7 A;  2BZ8 A;  2JM9 A;  2D0N A;  1M8M A;  3EGU A;  3LH5 A;  2KEA A;  1ABQ A;  1ABO A;  1UDL A;  1E6G A;  1YWO A;  2BZY A;  1U5S A;  1U06 A;  1SHG A;  2AZV A;  1OOT A;  3VS0 A;  1SRM A;  4CC3 A;  1I0C A;  2B86 A;  2KYB A;  2RQW A;  2J06 A;  1U3O A;  1UJY A;  2DRM A;  2M51 A;  2A36 A;  2FRY A;  2JT4 A;  1IO6 A;  2JW4 A;  1QKX A;  2ENM A;  3UA7 A;  2J6O A;  1G83 A;  1PKS A;  2O88 A;  1H92 A;  1UTI A;  2JXB A;  2FO0 A;  1VA7 A;  2FPE A;  1AEY A;  1HJD A;  2OJ2 A;  3TSZ A;  1GCQ A;  5IXB A;  2O9S A;  2LJ3 A;  2DL4 A;  1T0H A;  1Z9Z A;  1SSH A;  2P4R A;  1RI9 A;  4HXJ A;  2GTJ A;  1NEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...