2NWMA

Solution structure of the first sh3 domain of human vinexin and its interaction with the peptides from vinculin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
MKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEGEHHGRLGIFPANYVEVLPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Vinexin
publication title Solution structure of the first SH3 domain of human vinexin and its interaction with vinculin peptides
pubmed doi rcsb
source organism Homo sapiens
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2nwmA00
3EHRA 1UJYA 4DEYA 2JMCA 2L3SA 3NHNA 2AKLA 1UDLA 2DL7A 2KYMA 1WDXA 1ZLMA 2EQIA 2FPFA 3TVTA 4RTUA 3VRYA 1WLPB 2OI3A 2QDLA 1M30A 2V1RA 1GBRA 2L2PA 2K2MA 2FRWA 1T0HA 1BK2A 3KFVA 2ED1A 3THKA 3ULRB 2LX7A 2JM9A 5IH2A 1AWXA 2ABLA 1H92A 2KT8A 2DA9A 4ESRA 2AK5A 2RNAA 3SHWA 2VKNA 1Z9QA 2KRNA 2RPNA 1PRMC 1W6XA 1U5SA 1ZSGA 2DBMA 2DMOA 2EBPA 2O88A 3NGPA 4J9IA 2SEMA 2DF6A 2KR3A 1GBQA 2DLPA 1NEGA 1QWEA 2C0OA 3M0UA 1TUDA 3TSWA 2CDTA 2ECZA 2V1QA 4LNPA 1HSQA 2D8HA 4J9EA 1NLOC 1OV3A 2KRMA 2KT1A 1E6GA 4HXJA 4RTYA 1SEMA 1V1CA 2KYBA 2JT4A 3M0SA 1AWOA 2PZ1A 2YSQA 3VS3A 2F2VA 1ARKA 5HCKA 2I0NA 2LJ1A 2RMOA 4AFUC 1AWWA 3R6NA 1YWOA 2VWFA 4CC2A 2IIMA 2DL4A 2P4RA 1I1JA 2ED0A 1Y0MA 3M0PA 2JTEA 2O9VA 3PE0A 1KFZA 4E6RA 1WI7A 2HCKA 3NPFA 4J9BA 1SHFA 1I07A 2C0TA 1SHGA 4A63B 5ECAA 2FG0A 4LUDA 3UF4A 2PTKA 1KSWA 1M8MA 1RLQC 4JJCA 2LMJA 3M0QA 1QLYA 4WCIA 2EGCA 4GBQA 2E5KA 1K76A 4JJBA 1AD5A 2DRMA 2CT4A 2YT6A 2RQUA 1X69A 1WXBA 1U3OA 3UATA 1K0XA 2DL3A 1PNJA 2A08A 4JZ4A 1ZUUA 1W70A 3CQTA 1JU5C 2KRSA 2KNBB 2X3XD 3EHQA 2FEIA 3REBB 2EYXA 2CSQA 4J9FA 2CH4A 2LNHB 4IIOA 2NWMA 3LH5A 1GRIA 1KJWA 1GCQA 2O9SA 2ROTA 2MCNA 1NLPC 4HVUA 1JXOA 2A36A 1OEBA 1M27C 4K11A 2GGRA 4LE9A 4CC3A 5IXFA 2LQNA 4OMQA 2RQTA 1YWPA 2YDLA 4JJDA 1CSKA 2W10A 1T0JA 1GCQC 1XOVA 2KBTA 2EYYA 3NMZC 4F16A 1B07A 1YP5A 2XMFA 2L3PA 3GBQA 2EGAA 5I22A 1AWJA 1GCPA 4RUGA 1UTIA 2YUQA 4EIKA 4R0KA 2K7AA 2DJQA 1H8KA 1AZEA 1M3AA 3M0TA 1CKAA 5IHIA 1WA7A 1WX6A 1WXTA 1JQQA 4OMNA 2KE9A 1M3CA 2K9GA 4RTZA 1PHTA 4RTXA 4J9HA 1SPKA 5FWCA 1YN8A 1X2KA 2F2WA 4AG2C 1RI9A 3VS2A 1PKSA 4HVVA 2KEAA 2AKKA 1T3LA 2JS0A 2RQRA 2FPEA 1BU1A 2BTTA 1E6HA 1X2QA 3VS1A 4OMLA 3TSZA 2DX1A 4HCKA 1W1FA 1VYTA 2B86A 1I0CA 1T3SA 1JO8A 1H3HA 2CUBA 1JXMA 2LQWA 3EGUA 2J05A 1GFCA 1AEYA 1NEBA 1QWFA 2DL8A 2NUZA 2EVRA 1UGVA 2DE0X 3FJ5A 3VS7A 2VVKA 3VS6A 1CKBA 2GNCA 4OMOA 2J6OA 2F2XA 4OMMA 2A28A 2M0YA 4QT7A 1QCFA 1Y57A 2JM8A 1OOTA 3UA6A 1ZUKA 2A37A 2J7IA 2G6FX 2K79A 1HD3A 1WXUA 1X43A 3ZL7C 4CC4B 1ZUYA 3RBBB 2CH4W 3RNJA 1HJDA 2CUDA 3REAB 1LCKA 4X1VA 2YUPA 4LUEA 4F17A 1NG2A 4D8DA 2PNIA 4M4ZA 4ZNXA 1KIKA 2KROA 2YUOA 1UE9A 1K1ZA 1QKXA 2KGTA 2DNUA 3I5SA 3QWYA 4OMPA 2OAWA 2FO0A 3H0HA 3C0CA 2HDAA 1UFFA 1TUCA 1UECA 2KXCA 2ESWA 2AZVA 4Z88A 2EYWA 2J6KA 3M0RA 1IO6A 1AOJA 3EG0A 1WYXA 1MUZA 2MOXA 1YCSB 4GLMA 2BZYA 1FYNA 3PVLA 1G83A 2J6FA 3EG1A 2JXBA 2MIOA 4Z89A 2K3BA 2CREA 5EC7A 1K4US 4JZ3A 1NM7A 2JMAA 2O2OA 4HVWA 2D0NA 2RQVA 3SEMA 2FPDA 1AVZC 1G2BA 1J3TA 3VS0A 1WIEA 4AG1C 1MV0B 4J9DA 4RTWA 5L23A 1FMKA 2EPDA 3IQLA 1VA7A 1Z9ZA 2RN8A 3VRZA 2EKHA 4DEXA 2GTJA 1VYUA 2BZXA 2CSIA 1BBZA 3VS4A 2HEQA 2EGEA 4AFQC 3EG3A 1B3QA 1RUWA 4Z8AA 4J9GA 1S1NA 1SRMA 2DRKA 1ABOA 2ENMA 3VS5A 2EW3A 1E7OA 3H41A 4JPBW 3H0IA 2GQIA 2LZ6B 5I11A 1K9AA 1N5ZA 1PWTA 1YNZA 4IIMA 1RLPC 1WFWA 1PRLC 2LJ3A 1GL5A 2CT3A 5IXBA 1UG1A 2AZSA 5IHNA 2DBKA 5FWBA 4F14A 2DL5A 2DM1A 4FSSA 1X27A 2W0ZA 2BZ8A 4Y92A 2SRCA 2H8HA 1UHCA 1QKWA 1GFDA 2HSPA 1OPKA 2M51A 1PKTA 2KXDA 1BB9A 1NYGA 2D1XA 2RF0A 1A0NB 2DVJA 3PVQA 4KRTA 2FRYA 1VYVA 2JS2A 3A98A 3EG2A 5GJWB 2OJ2A 4LN2A 4RTTA 1M3BA 2LJ0A 2LP5A 3I5RA 2K6DA 1ABQA 2D8JA 2HBWA 4ORZA 3U23A 2GBQA 1UJ0A 3O5ZA 4RTVA 2O31A 5FW9A 1EFNA 2DILA 4CC7A 1UHFA 1TG0A 4AFSC 3I9QA 2GTOA 4AFZC 1K0SA 2X3WD 1OPLA 4D8KA 2RQWA 1X6BA 5IHKA 1AZGB 1ZBJA 2YUNA 2C0IA 2EYZA 4J9CA 3UA7A 1MV3A 3QWXX 2L3QA 1UUEA 2L0AA 3I35A 5GJVB 3H0FA 2ROLA 1SSHA 2LCSA 2JW4A 2DYBA 1SRLA 1U06A 2J06A 1ZX6A 3JV3A 1X6GA 1NYFA 1JEGA
chains in the Genus database with same CATH superfamily
4DBRA 2D6FA 5GMKj 4DBHA 2L3SA 2RI3A 1HXDA 1UGQB 1UDLA 2AKLA 5KYWA 4ZGDB 3ZFJA 2JTMA 5DLOA 4BD3A 1OU8A 4FW2A 3L2QA 2L2PA 4HCBA 3SWNA 1YBYA 1T0HA 3QO3A 1VQKT 1OI1A 1RAAB 2M9UA 3QYGB 3OQ5A 1PD0A 2JVVA 5IH2A 3CC2A 1QVPA 3OYIA 1KHIA 2KT8A 3MKDA 2P84A 3SWNC 4E7HA 4OF1A 2VKNA 3CC4A 2KRNA 4IUPA 1PRMC 5GANe 1U5SA 2EBPA 2O88A 4FT2A 2R5AA 4E7KA 2ZGWA 1GBQA 2EIFA 1QWEA 3M0UA 1TUDA 2RH2A 1RADB 4BY6B 5GAN2 1WQ7A 4E7SA 3O8VA 5I21A 2DD4A 4HXJA 1VQ8A 4M7AG 3JB9D 4C92B 1PD1A 2HQXA 3DKMA 3V7SA 3V7CA 3VJPA 2V8JA 1YHQQ 2YSQA 4OGCA 4E7IA 2F2VA 4MZMA 2RMOA 2LJ1A 2MI6A 3J81E 1I1JA 2ED0A 4WTOB 3M0PA 2Y90A 3M54A 2O9VA 4R56A 3PE0A 2DZ9A 3N5BB 4M7DF 2IVWA 2YRVA 4E6RA 1K9MC 4J9BA 1SHFA 3CCJT 4PJOD 3CCEA 1SHGA 1HK9A 1YCYA 1WNLA 5KYWB 4J6YA 3G4SQ 1VQOA 5J39A 1VQ9A 3J80E 1TS9A 1ZQ1A 2EGCA 3Q1JA 3SWNB 3EGXA 1K76A 3V8JA 2QA4Q 1VQMT 1B34B 2L5QA 2YT6A 1WXBA 4J6XA 1K0XA 1PNJA 2DAQA 5CQXA 1W70A 2E4HA 2KQWA 1K8AR 2LNVA 2KNBB 2X3XD 5J3BA 1YJWT 2EYXA 1PM3A 3LH5A 2O9SA 2ROTA 2GFUA 2FYKA 5GAMf 3TCJA 2A36A 2CP0A 4MZPA 4M7DC 4K11A 2GGRA 4CC3A 2H3JA 2BUDA 4PL6A 3CPWP 2LQNA 4BI8B 3CCQT 3HFOA 4OMQA 1MMNA 2RQTA 1Q7YR 1WGSA 2L3RA 3V8KA 2KBTA 3G71Q 1YP5A 2L3PA 4KBMB 4Y28E 2RHIA 2PU9B 3HRUA 1H3ZA 4EIKA 1X01A 2DJQA 1VQ5T 3MEUA 5I2MA 1NPRA 1M3AA 2CZ1B 4EMHA 1LJOA 4M77D 5EG2A 5CKBA 4CI0C 5IHIA 3JB9F 3HTRA 2E41A 3CCVT 1PHTA 2VC8A 4KUIA 4M75D 3JCMV 2CP6A 4QQGA 2AHJB 1K9MR 4CRIA 2OTJQ 4AG2C 1HYOA 3CCSQ 2CP7A 2DXCA 1YJNQ 3F70A 3A8OB 1YHQA 3OYLA 2X4XA 3E9GA 4BDZA 3V7RA 4QVCA 4PJJA 2HSEB 1R77A 4PJOF 1I0CA 3DB3A 3I55Q 3QSUA 1W4SA 3JRZA 1BIBA 3CCMQ 2RA2A 2H3EB 2MWPA 3M53A 4JRIA 1NEBA 2EKOA 1QWFA 1Y71A 1M1KU 2DE0X 3RR6A 2C06A 2F5TX 4M7DB 2MF2A 2CZ0B 4PJOE 2X4JA 4GLKA 3G4SA 3WVEB 5GAOm 4E7JA 1VQKQ 2A37A 2CP3A 4CC4B 2G6FX 1X43A 4F7UA 1HJDA 2K3XA 3CCRA 1NG2A 4B6MA 3ER0A 3VKIA 2QQ9A 3CC2T 1BYMA 2EYQA 2KROA 3LGLA 3JCMe 1K1ZA 1QKXA 4NS5A 1Q81U 3C0CA 1G8XA 1IHWA 2QEXQ 4ZN1A 2EYWA 1IO6A 2RJFA 1AOJA 5CKFA 4MDXA 3OYCA 3EG0A 4DBFA 4M78A 2BZYA 1JJ2A 4FYVB 4OB3B 3BY7A 5GAN7 3MP6A 4Z89A 3G71A 2QXFA 3EGDA 4M75F 3SEMA 2FPDA 2ZPIB 1D0XA 4C8QG 2VASA 4JRPA 1ZSZA 3OB9A 5GANh 3CMAT 1KG1A 4PLIA 2VV5A 2VB6A 4AMCA 4DEXA 2OAUA 2A3LA 1VYUA 3CCJQ 2OTJA 3CCSA 4AFQC 1WHKA 1YJNA 2QYZA 4LD9K 2RO0A 2RJDA 4Z8AA 4J9GA 4QVZA 1SRMA 4A4HA 3CCET 4HKEA 1E7OA 3L42A 1VQOT 1MGQA 2GQIA 1K9AA 3OSSC 1VQMQ 1PWTA 1VQ9T 2ZPEB 1YNZA 3I55A 2DIGA 1MNDA 1WFWA 2LJ3A 1GL5A 4M77C 4QKUA 5IXBA 2CKKA 3UPUA 1UG1A 2AZSA 2DEUA 4XU3A 4F14A 3JCMc 1M1FA 2DL5A 4M75C 1Q82U 5HK0A 1ZBXA 1UHCA 3QPHA 1TTHB 3PMIA 2BE7D 1M1GA 2RF0A 3X20B 1VQKA 2DVJA 1A0NB 1VYVA 2JS2A 3EG2A 4ZN3A 4LN2A 2LJ0A 2K6DA 1ABQA 1JBMA 2RK1A 3QG1A 2ZZDA 1RABB 3SFMA 4FYXB 1XTDA 2QG9B 2XIDA 4N0AC 4QVDA 1FMWA 5M9OA 3O5ZA 3CPWS 1VQ5Q 3MO8A 2LQKA 2DVEA 4O5VA 1Q81C 1YJ9Q 2QEXA 4CC7A 2QTVA 1TG0A 4VUBA 3I9QA 3CCVQ 5GAOr 5CKDA 4ZTFA 2RQWA 2DTIA 2NUPB 4M78G 4XTUA 4LDXA 1ZBJA 4RG2A 3JB9H 1MV3A 4HCZA 1WHGA 3QWXX 5IAYA 4LXCA 1JJ2P 2KSSA 4KGVB 1UUEA 2EQUA 5GAMe 4M77B 4ELYC 3HFNA 3GPLA 1YHQT 3H0FA 3L2VA 3OMGA 4M75B 2D0QB 3S3MA 1Y96A 1X6GA 4A4KA 4EDUA 1UJYA 4DEYA 5CQYA 2JMCA 1WJSA 3RESA 2KYMA 2EFIA 1RAGB 5LJ5g 2FPFA 3TVTA 1WLPB 3OYGA 5GAN5 1M1KR 2OI3A 2QDLA 1W2BA 2YLBA 4C0FA 1D3BB 1GBRA 4PFZA 2X35A 9ATCB 2YWWA 1BK2A 2ED1A 3THKA 1VQLA 1G3SA 2DK3A 2LDMA 1LPLA 4ZGJB 3G4ST 4N4HA 3A8LB 1VQMA 5FU6C 3VYHB 2MWOA 2QDYB 4IKFA 1M8VA 2DA9A 1WHJA 3VUBA 4AT1B 3OA6A 3CC2Q 1KC8U 1KD1U 1OZ2A 3CCRT 2DMOA 2DBMA 2DO3A 2F69A 2RHYA 1D0YA 1Q82C 1NEGA 4PKCC 1Q81R 3E1SA 2K57A 2V1QA 2O4XB 3C4SA 5LJ3g 4ANJA 2L89A 3MCAB 1KQSA 2E6ZA 4RTYA 3TQ7P 2KYBA 3M0SA 4C92F 3X26B 3A8HB 2FZKB 4AFUC 4M7AA 2G3RA 3LH0A 1V76A 4CC2A 2IIMA 2MYSA 3HRTA 1VQ5A 4C5GA 3BFMA 3JCMh 1BI0A 2JTEA 3H6ZA 1YJ9A 3X24B 4C92E 5KE2A 5GMKe 3CMAQ 1WJQA 3OS1A 3CCVA 2WSEE 3MHXA 3NPFA 4HT9A 1QMCA 2ZPFB 4D6WA 4A63B 1FWZA 2FG0A 1UGRB 3OYEA 4QW2A 4MMLA 3PIOA 1KSWA 1LNXA 1M8MA 1M2VB 4HCCA 2OTJT 5FU6B 4BUGA 3CCEQ 1QLYA 3CCST 4GBQA 1D1AA 4KUDK 3PIPA 3M58A 2VGMA 4Z02A 3JCMf 1AD5A 1VQ9Q 2DXUA 3UATA 2DL3A 2DEQA 2KAFA 2A08A 4PNOA 2XI9A 4JZ4A 4N4IA 1ZUUA 2D9TA 3ME9A 3EG9B 2DERA 1VQ6A 1BIAA 3I55T 3EHQA 4LDVA 2FEIA 3CBOA 4RKUE 2DTOA 3BE3A 2CH4A 4RG8A 3ZEHA 2NWMA 3VUZA 4J6WA 2HBPA 1H641 2EJGA 1UB4A 2MK5A 4E7LA 1JXOA 1Q82R 3G1JA 4YTLA 5IXFA 1W2BP 1M2OA 1Y07A 3CPWA 5KYUB 1VUBA 4JJDA 4PFOA 1T0JA 4ATOA 1XOVA 4F16A 2CS7A 4C0DC 3CXCP 3GNGA 1K73U 4KT0E 3P8BB 3QZ5B 2YUQA 4BI4A 4R0KA 3CC7Q 2K7AA 5KYYB 1KC8C 2HKNA 1K8AC 1KD1C 3M0TA 3FJPA 5CR2A 1WHHA 5CKEA 2NUTA 1SKUB 1JQQA 2WSCE 4A53A 4RTXA 2E70A 3WXMB 5GAOq 3OS2A 2QEXT 3OYKA 2HMAA 1PKSA 4HVVA 2KEAA 1T3LA 1N6AA 1DJ7B 1KQSP 3H8ZA 4PJNA 4E2FB 1Q7YC 2FZCB 1VQNA 2YHTA 1VQPT 4OMLA 2E1HA 3D7SB 1I4K1 1JO8A 4JUVA 1I5LA 2CUBA 1X6OA 1JXMA 2HD0A 2LQWA 2EJ9A 2J05A 3CMAA 4FT4A 1WQWA 2BIVA 2DL8A 2K3YA 1JJ2S 1UGVA 3FJ5A 4PJMA 4J7FA 2VVKA 3JCMd 1CKBA 4DQ2A 2DFUA 4OMOA 2J6OA 2F2XA 2A28A 2E12A 2QK0A 1D09B 2JM8A 2PVOB 4C0DB 1EIFA 1ZUKA 2K79A 1HD3A 2L8DA 3RBBB 2DETA 2CH4W 2M0OA 1OU9A 3FRNA 4X9CA 3HKSA 1LCKA 4M7DE 2HNIA 3CD6Q 2YUPA 1VQLT 4BI3A 5GAMh 2RJEA 5I2SA 4WF2A 2YUOA 4A54A 2XDPA 1UE9A 3CCRQ 4M78D 2HDAA 1KC8R 1KD1R 3PTAA 2ESWA 2GFAA 2IG0A 5FU7C 3M0RA 5DLQE 4DOVA 1YCSB 1XJWB 2V8IA 4GLMA 1OULA 3FC3A 2JXBA 2MIOA 3QYHB 2K3BA 1ZHIA 1TWBA 2O01E 2K5FA 1UGSB 2HZYA 2RQVA 1K73C 2AT1B 2RHUA 2VGNA 3CC7A 4AG1C 2X4YA 4RTWA 5L23A 2EPDA 3SB2A 5KYNA 3MEVA 5CCAA 1VA7A 4C8QA 3VRZA 1YJ9T 4GY5A 2EJFA 1PSFA 2CSIA 4L59A 4E7ZA 2HEQA 2EGEA 1VQ7A 3EG3A 1B3QA 1RUWA 3L2WA 1D0ZA 3VYGA 3LWHA 3MEWA 2DRKA 3M57A 4X9DA 1ABOA 1NZ9A 3H0IA 2LT4A 5I11A 2X4WA 2XICA 4F7UF 1RAHB 1RLPC 4IIMA 1QVGA 3META 2CT3A 3EFRA 3PFSA 3OW2P 2CP2A 3EGXB 5KE3A 3MP8A 5FU7B 4PFPA 2DBKA 2KI7A 5GMKh 1X27A 3M4YA 4A4GA 3VU3C 1VQ6T 3CCLA 1OX8A 3OS5A 3OYDA 1PKTA 3GP8A 2KXDA 3QDFA 4JJNK 1I5OB 3PVQA 2CYZB 2DXBA 1TUGB 5KCHA 2LX9A 4RTTA 5LJ5j 3I5RA 3CD6A 1RI0A 2MPXC 2X51A 1NPPA 1OQKA 1UJ0A 5KYXA 2JJ9A 4ME7A 2EWNA 1W2BS 4RTVA 3AHUA 1K73R 5GAMd 4EPCA 2DILA 2K5LA 3A8MB 2GTOA 2I2LA 3CXCS 2X3WD 2M02A 4D8KA 4J83A 8ATCB 5IHKA 1N9RA 1AZGB 1N8RU 1JB0E 3ZBDA 1WHLA 2GQVA 4J9CA 1QQJA 1G5VA 2OTLA 3CBMA 3HSBA 4M7DG 3G7ZA 1VQPQ 4M77F 2JUFA 5AYFA 5LJ3j 2ROLA 1VQNT 2E6NA 3LYIA 3QKJA 2DYBA 4M78C 2J06A 2M1HA 3A1PA 3JV3A 5GAOl 1NYFA 1KQSS 2LRQA 1RAFB 5CIUA 2DL7A 4M77E 2YRDA 2BE9B 1WJRA 1ZLMA 5GMKi 4R55A 4C0GA 3VRYA 1IREB 1M30A 2CGHA 3OYJA 2K2MA 4M75E 1VOMA 4IUVA 3LLRA 4RMOA 3ULRB 1ZSZC 2JM9A 1TXQA 1AWXA 1H92A 3CPFA 3HHTB 5GANg 3LWIA 3G6EQ 1VQLQ 2AK5A 2RNAA 1YITT 3SHWA 2R58A 4J5YA 4F7UB 1QVGP 3EAEA 2CZ6B 1W6XA 1ZSGA 2IPOB 4XU0A 3NGPA 3QUIA 1BKBA 2E3HA 2Z0WA 2KR3A 5KCOA 1RAEB 1XNIA 2C0OA 1UGPB 1M1KC 2CDTA 2ECZA 4JS4A 1HSQA 1S72Q 4M7AD 2D8HA 4J9EA 1OV3A 5CAIA 2KT1A 1YIJT 1AWOA 1IXDA 1XQHA 1F1BB 2PZ1A 1QP2A 3H9NA 3JB9G 3PGGA 5HCKA 3C95A 4M78B 3R6NA 2VWFA 1RL2A 4C5EA 2P4RA 1X75C 1Y0MA 3FB9A 5D6WA 1FX7A 3OY9A 1PSEA 3CC7T 3EGDB 4IURA 1SF9A 2HCKA 1VQ4A 1I81A 1IGUA 2XK0A 2V8KA 4KH1B 1I07A 2C0TA 5ECAA 2HQHA 1ZSZB 4FYWB 4C5HA 4PJOG 4LDWA 2PTKA 4QQDA 1N8RC 2F1LA 2KMTA 1RLQC 4JJCA 3SDZA 2Y4XA 4II1A 2P4TA 1VQ7T 1VQPA 3C12A 1BI1A 2Y4YA 4JJBA 2DRMA 4XTYA 1X69A 3M55A 1U3OA 4BACA 1D1CA 2RHZA 3TEEA 3JCMP 3EFOA 1JU5C 2KRSA 1BI3A 3QIIA 2OX7A 3REBB 1FXXA 1QVFS 4J9FA 2QI2A 3S3NA 4IIOA 1VQ6Q 3LGFA 4HT8A 2GCXA 1KJWA 1GCQA 3J7AF 4HVUA 4XU1A 4LD6A 3JCMX 4NL2A 3CCLT 3OW2S 2EQJA 2YDLA 2W10A 1GCQC 3G6EA 2R57A 1LOJA 4FW1A 3S6WA 3GBQA 5J26A 3CXCA 2LVMA 1AWJA 3M5AA 1MNEA 3BW1A 3CD6T 1UTIA 3SD4A 3A5ZB 2EQKA 4M7AF 5GMKl 4A4EA 4OB2B 1WA7A 1WX6A 1WXTA 5LJ5f 4EMKA 2K9GA 5FWCA 1YN8A 5GAN6 1S72A 1X2KA 4M75G 1RI9A 3CCUT 4FIBA 5CK9A 2AKKA 2XD0A 4JLIA 4TVRA 3MPUB 3E2UA 3HRSA 2JS0A 2RQRA 2FPEA 4O6JA 3RMSA 1E6HA 1X2QA 1N8RR 2DX1A 2ZPHB 1KHCA 4HCKA 3VV0A 1W1FA 2ZCFB 2OTLT 2B86A 1NJIU 1VQNQ 1T3SA 3CMEA 2NLUA 2KDSA 3OYYA 4KULA 1VIEA 4KGZB 5A0LA 3DLLA 2EVRA 1R8OB 4BB7A 3MEAA 5A0GA 1WPYA 2COYA 2K5IA 4OB0B 2GNCA 4M7AC 5LJ3f 2WACA 4OMMA 1NE8A 1Y96B 2M0YA 3DLMA 4Y91A 1MMGA 1Y57A 1OOTA 1OZ3A 2XU8A 3EH1A 4C5IA 2J7IA 1WXUA 1NBEB 4LUEA 4F17A 1MMDA 1FMVA 1PG5B 3RKWA 1QW1A 2PNIA 4M4ZA 4ZNXA 4JLGA 1TOVA 1YITQ 1KIKA 3JCMb 3GLXA 1UEBA 2DKGA 2DNUA 4OMPA 4FM4B 2FO0A 2YRCA 2DPPB 5GAN4 2KXCA 2AZVA 4C92A 1SG5A 3TU4K 2J6KA 5A0DA 5D7UA 3PMTA 4LDYA 5CKHA 3S3OA 3L2ZA 1WYXA 1MUZA 2F5KA 2MOXA 1QVGS 3PVLA 4MMKA 1GXIE 1YIJQ 3EG1A 2CREA 5LJ5d 2ATCB 2FHDA 3R6OA 4JZ3A 2JMAA 2QQSA 2O2OA 4HVWA 3FIFA 4C8QD 4KH0B 2RHXA 5GAOp 3EH2A 3QXEB 1AVZC 3NFCA 2DIQA 3KXTA 1G2BA 1J3TA 1M9SA 1WIEA 2CZ7B 2E65A 3CBPA 4LDUA 1OX9A 1OYXA 3RMQA 2QQRA 4M7AB 1O75A 3PT9A 5DM7R 1Z9ZA 2GTJA 2FB7A 3GOXA 2BZXA 1C0MA 5D6XA 4NL3A 1B34A 1VQ4T 2LTOA 4ELZC 1YI2Q 3NTIA 1VQ7Q 3I56T 3GNFB 5L8RE 3JB9J 2LZ6B 1QVFA 4OB1B 1N5ZA 3OYHA 4C0ZA 1P92A 5LJ3d 2JTFA 2LCCA 1C6VX 4N4GA 1NJIC 1MMAA 3HP9A 5A2QE 4X34A 3TREA 3OW2A 4KGXB 4BDYA 5IN1A 1IB8A 1U1TA 2SRCA 4BE1A 1QKWA 1R0BG 1BB9A 4OP0A 1KK7A 2D1XA 3CCLQ 5HKCA 1R0CB 2CP5A 3QJYA 3RUXA 1M3BA 2LP5A 5CVIA 2MAMA 5GAN8 1I8FA 2B8AA 2D8JA 2HBWA 4ORZA 4IUTA 3JCMJ 4PJLA 3QHSA 1YITA 3G6ET 1BCOA 4FU6A 4OGEA 3OSVA 4J7IA 1EFNA 5GANj 2PUKB 1UHFA 4C92G 4AFSC 4ZGEB 3RDVA 3FDRA 1K0SA 4C8QF 3CCUQ 2NUTB 5GAMg 1YIJA 2JZ2A 3CEYA 1S72T 3OYNA 2E64A 3UA7A 2EQMA 3OYAA 2L3QA 1Y7XA 3UT1A 2L0AA 3I35A 4C8QE 2FZGB 1SSHA 4OVAA 1KQ2A 2OTLQ 4M7DA 3P8HA 1SRLA 4XTZA 5C0MA 2RB6A 2COWA 3JCMQ 1NJIR 3EHRA 3CMET 8AT1B 3NHNA 6AT1B 1WDXA 5KH6A 2EQIA 2DYIA 4RTUA 2YXYA 1IGQA 2RD1A 4FL6A 2V1RA 2FRWA 5D6YA 1YI2A 3KFVA 5LJ5e 2QGGA 2LX7A 3KUFA 1TH7A 4PK4A 4B9XA 4C8QC 2ABLA 3L1AA 4MZTA 1PC0A 3QJ6A 4Q5WA 1QVFP 4ESRA 2QTXA 1Q86U 3BDUA 3OYMA 3X25B 1Z9QA 1EX4A 1G3WA 2RPNA 3LW5E 2P0PA 3E19A 4XTWA 3JAME 2X9HA 2DJZA 1KQ1A 4J9IA 2SEMA 2DF6A 3L2UA 2KY9A 2DLPA 3UDCA 3TSWA 1EZZB 3X28B 4LNPA 2VUBA 4F7UE 1PCXA 2PQWA 1NLOC 2KRMA 1E6GA 1D1BA 2HQEA 1SEMA 1V1CA 2LCLA 2JT4A 2LC4A 1YFNA 3M4GA 2E3IA 4EMGA 2FVUA 3M56A 3VS3A 1ARKA 5LJ3e 2I0NA 2P0KA 4M78F 1AWWA 2JN0A 1YWOA 2VXEA 2DL4A 2E5QA 1U1SA 3QBYA 2GF7A 1KFZA 2ZAEA 2HL5C 1WI7A 2YLCA 5FROA 1M90U 2M16A 2XKOC 4M78E 1WHMA 1LVKA 3FEOA 5FRNA 3CCUA 2P0QA 1N9SA 4LUDA 1VQ4Q 2LT1A 3UF4A 2QA4A 2HKQB 4C8QB 4L5GA 3PNWC 3DB4A 4JRQA 2LMJA 3M0QA 4IUUA 4XQ3A 4WCIA 2ZPGB 2E5KA 4PJOA 3I56Q 4A4FA 2CT4A 2RQUA 2COZA 4FSXA 4FYYB 2VYTA 3OYBA 5GAOn 3CQTA 2QQAA 3ASKA 4XAXB 3CC4T 2XG8D 4PJOC 4RCCA 1WZOA 2CSQA 3QZ9B 2LNHB 1GRIA 3L2RA 1AHJB 2MCNA 1NLPC 2KVQG 1C1AA 1OEBA 1M27C 4LE9A 5HK3A 3BDLA 1VQ8T 1YWPA 3OMCA 1CSKA 4JDSA 3NMZC 2EYYA 2PVDB 1B07A 2XMFA 4PLLA 2EGAA 5I22A 4JS5A 3RKYA 1GCPA 4BE2A 4RUGA 1Q86C 1IHVA 2A7YA 1ACMB 1AZEA 1H8KA 2NUPA 4JRKA 1AT1B 1CKAA 4OMNA 2KE9A 1M3CA 1MHNA 2E10A 4RTZA 5KYXB 4J9HA 1SPKA 1QP3A 4XK8E 2F2WA 1SSFA 3E9FA 3VS2A 4M77A 2RM4A 2BKDN 1Q95G 2EAYA 1BU1A 5GANf 2BTTA 4M75A 3VS1A 3CCMA 4RCBA 3OBYA 1BCMA 3TSZA 5LL6S 2DXTA 1VYTA 2HAXA 4PJOB 3HPWA 1H3HA 2HL3A 3EGUA 2WSFE 4NOYA 1GFCA 1YJWQ 1AEYA 4HA8A 1D3BA 5CO7A 2NUZA 3CMEQ 3VS7A 3VS6A 1M90C 4F7UG 4N0AA 3CCQQ 3HL8A 4QT7A 3JCMW 2NYSA 4F04B 1QCFA 3UA6A 2K4YA 2AIRB 3INZA 3ZL7C 2V26A 1ZUYA 3I56A 3RNJA 3OBWA 5FLXE 2CUDA 3GF5A 3GIBA 3REAB 1YI2T 4X1VA 3URGA 4D8DA 1QCOA 1N27A 4IUQA 4C92D 4BE0A 3FLGA 3OS0A 1B7TA 2KGTA 3I5SA 3QWYA 2OAWA 2O4XA 3WVDB 1TSFA 3JB9I 1Q86R 3H0HA 3MJXA 1UFFA 1TUCA 1UECA 3QDRB 4Z88A 1V29B 2PUOB 1M5Q1 5GMKm 5AT1B 3AT1B 1FYNA 1G83A 2J6FA 2JOYA 5LJ5h 3T9NA 5EC7A 1K4US 2RJCA 1NM7A 4XTVA 2R5MA 2JNGA 2D0NA 2KK4A 5C6SA 1G3TA 3VS0A 1M4ZA 1MV0B 4J9DA 3UWNA 1FMKA 3IQLA 4DBQA 3CCJA 5GANd 1M2VA 2DD5A 4V2SA 2RN8A 1BI2A 2EKHA 1BBZA 4XU2A 3VS4A 4M77G 3RIRA 1G3YA 1O9SA 1M90R 3V8LA 1RAIB 3EFSA 1S1NA 5FRMA 2PVGB 2ENMA 1QCNA 3VS5A 4M7AE 2EW3A 3EG9A 3H41A 4JPBW 4UC4A 2QA4T 2QQBA 2FL7A 4DOWA 4EMKC 4J8OA 4B9WA 4L6V5 1K8AU 5LJ3h 2RI2A 5GAMj 1JRIA 1PRLC 2XDDA 5GAN3 1IRXA 1YJWA 5DY9A 3CC4Q 5IHNA 5FWBA 2DM1A 4FSSA 2W0ZA 2BZ8A 4Y92A 1ZA1B 5KYUA 2H8HA 3RERA 1GFDA 3CCQA 2HSPA 1OPKA 2M51A 3EFOB 3LX7A 3RKXA 1Q7YU 1NYGA 4MDWA 2XHCA 2ZPBB 4KRTA 3OYFA 2FRYA 3A98A 2VXFA 5GJWB 2OJ2A 1VQ8Q 4OMFB 5KYYA 4FCYA 3G71T 3U23A 3JCMg 2A0FB 2GBQA 2K2VA 1U8RA 2DZCA 1IZ6A 2QAZA 3A8GB 2O31A 5FW9A 2RI5A 3M59A 3NTHA 4DA4A 2QASA 1K9MU 2DTHA 4AFZC 3NTKA 1OPLA 3P8DA 2RK2A 1X6BA 3M9QA 1ZA2B 2YUNA 1YJNT 4QQ6A 2C0IA 3KBGA 2EYZA 1TU0B 4EMKB 4E47A 4M7DD 4BY6C 1VQOQ 2XDBA 4XTXA 1VIFA 5IT9E 4C92C 2LQ8A 5GJVB 1RACB 4P5NA 2LCSA 2JW4A 5HY6A 3C94A 3CCMT 2QGFB 7AT1B 4ZTJA 1U06A 2MMPA 3JSCA 1ZX6A 3MP1A 1JEGA
chains in the Genus database with same CATH topology
3EHRA 1UJYA 4DEYA 2JMCA 2L3SA 3NHNA 2AKLA 1UDLA 2DL7A 2KYMA 1WDXA 1ZLMA 2EQIA 2FPFA 3TVTA 4RTUA 3VRYA 1WLPB 2OI3A 2QDLA 1M30A 2V1RA 1GBRA 2L2PA 2K2MA 2FRWA 1T0HA 1BK2A 3KFVA 2ED1A 3THKA 3ULRB 2LX7A 2JM9A 5IH2A 1AWXA 2ABLA 1H92A 2KT8A 2DA9A 4ESRA 2AK5A 2RNAA 3SHWA 2VKNA 1Z9QA 2KRNA 2RPNA 1PRMC 1W6XA 1U5SA 1ZSGA 2DBMA 2DMOA 2EBPA 2O88A 3NGPA 4J9IA 2SEMA 2DF6A 2KR3A 1GBQA 2DLPA 1NEGA 1QWEA 2C0OA 3M0UA 1TUDA 3TSWA 2CDTA 2ECZA 2V1QA 4LNPA 1HSQA 2D8HA 4J9EA 1NLOC 1OV3A 2KRMA 2KT1A 1E6GA 4HXJA 4RTYA 1SEMA 1V1CA 2KYBA 2JT4A 3M0SA 1AWOA 2PZ1A 2YSQA 3VS3A 2F2VA 1ARKA 5HCKA 2I0NA 2LJ1A 2RMOA 4AFUC 1AWWA 3R6NA 1YWOA 2VWFA 4CC2A 2IIMA 2DL4A 2P4RA 1I1JA 2ED0A 1Y0MA 3M0PA 2JTEA 2O9VA 3PE0A 1KFZA 4E6RA 1WI7A 2HCKA 3NPFA 4J9BA 1SHFA 1I07A 2C0TA 1SHGA 4A63B 5ECAA 2FG0A 4LUDA 3UF4A 2PTKA 1KSWA 1M8MA 1RLQC 4JJCA 2LMJA 3M0QA 1QLYA 4WCIA 2EGCA 4GBQA 2E5KA 1K76A 4JJBA 1AD5A 2DRMA 2CT4A 2YT6A 2RQUA 1X69A 1WXBA 1U3OA 3UATA 1K0XA 2DL3A 1PNJA 2A08A 4JZ4A 1ZUUA 1W70A 3CQTA 1JU5C 2KRSA 2KNBB 2X3XD 3EHQA 2FEIA 3REBB 2EYXA 2CSQA 4J9FA 2CH4A 2LNHB 4IIOA 2NWMA 3LH5A 1GRIA 1KJWA 1GCQA 2O9SA 2ROTA 2MCNA 1NLPC 4HVUA 1JXOA 2A36A 1OEBA 1M27C 4K11A 2GGRA 4LE9A 4CC3A 5IXFA 2LQNA 4OMQA 2RQTA 1YWPA 2YDLA 4JJDA 1CSKA 2W10A 1T0JA 1GCQC 1XOVA 2KBTA 2EYYA 3NMZC 4F16A 1B07A 1YP5A 2XMFA 2L3PA 3GBQA 2EGAA 5I22A 1AWJA 1GCPA 4RUGA 1UTIA 2YUQA 4EIKA 4R0KA 2K7AA 2DJQA 1H8KA 1AZEA 1M3AA 3M0TA 1CKAA 5IHIA 1WA7A 1WX6A 1WXTA 1JQQA 4OMNA 2KE9A 1M3CA 2K9GA 4RTZA 1PHTA 4RTXA 4J9HA 1SPKA 5FWCA 1YN8A 1X2KA 2F2WA 4AG2C 1RI9A 3VS2A 1PKSA 4HVVA 2KEAA 2AKKA 1T3LA 2JS0A 2RQRA 2FPEA 1BU1A 2BTTA 1E6HA 1X2QA 3VS1A 4OMLA 3TSZA 2DX1A 4HCKA 1W1FA 1VYTA 2B86A 1I0CA 1T3SA 1JO8A 1H3HA 2CUBA 1JXMA 2LQWA 3EGUA 2J05A 1GFCA 1AEYA 1NEBA 1QWFA 2DL8A 2NUZA 2EVRA 1UGVA 2DE0X 3FJ5A 3VS7A 2VVKA 3VS6A 1CKBA 2GNCA 4OMOA 2J6OA 2F2XA 4OMMA 2A28A 2M0YA 4QT7A 1QCFA 1Y57A 2JM8A 1OOTA 3UA6A 1ZUKA 2A37A 2J7IA 2G6FX 2K79A 1HD3A 1WXUA 1X43A 3ZL7C 4CC4B 1ZUYA 3RBBB 2CH4W 3RNJA 1HJDA 2CUDA 3REAB 1LCKA 4X1VA 2YUPA 4LUEA 4F17A 1NG2A 4D8DA 2PNIA 4M4ZA 4ZNXA 1KIKA 2KROA 2YUOA 1UE9A 1K1ZA 1QKXA 2KGTA 2DNUA 3I5SA 3QWYA 4OMPA 2OAWA 2FO0A 3H0HA 3C0CA 2HDAA 1UFFA 1TUCA 1UECA 2KXCA 2ESWA 2AZVA 4Z88A 2EYWA 2J6KA 3M0RA 1IO6A 1AOJA 3EG0A 1WYXA 1MUZA 2MOXA 1YCSB 4GLMA 2BZYA 1FYNA 3PVLA 1G83A 2J6FA 3EG1A 2JXBA 2MIOA 4Z89A 2K3BA 2CREA 5EC7A 1K4US 4JZ3A 1NM7A 2JMAA 2O2OA 4HVWA 2D0NA 2RQVA 3SEMA 2FPDA 1AVZC 1G2BA 1J3TA 3VS0A 1WIEA 4AG1C 1MV0B 4J9DA 4RTWA 5L23A 1FMKA 2EPDA 3IQLA 1VA7A 1Z9ZA 2RN8A 3VRZA 2EKHA 4DEXA 2GTJA 1VYUA 2BZXA 2CSIA 1BBZA 3VS4A 2HEQA 2EGEA 4AFQC 3EG3A 1B3QA 1RUWA 4Z8AA 4J9GA 1S1NA 1SRMA 2DRKA 1ABOA 2ENMA 3VS5A 2EW3A 1E7OA 3H41A 4JPBW 3H0IA 2GQIA 2LZ6B 5I11A 1K9AA 1N5ZA 1PWTA 1YNZA 4IIMA 1RLPC 1WFWA 1PRLC 2LJ3A 1GL5A 2CT3A 5IXBA 1UG1A 2AZSA 5IHNA 2DBKA 5FWBA 4F14A 2DL5A 2DM1A 4FSSA 1X27A 2W0ZA 2BZ8A 4Y92A 2SRCA 2H8HA 1UHCA 1QKWA 1GFDA 2HSPA 1OPKA 2M51A 1PKTA 2KXDA 1BB9A 1NYGA 2D1XA 2RF0A 1A0NB 2DVJA 3PVQA 4KRTA 2FRYA 1VYVA 2JS2A 3A98A 3EG2A 5GJWB 2OJ2A 4LN2A 4RTTA 1M3BA 2LJ0A 2LP5A 3I5RA 2K6DA 1ABQA 2D8JA 2HBWA 4ORZA 3U23A 2GBQA 1UJ0A 3O5ZA 4RTVA 2O31A 5FW9A 1EFNA 2DILA 4CC7A 1UHFA 1TG0A 4AFSC 3I9QA 2GTOA 4AFZC 1K0SA 2X3WD 1OPLA 4D8KA 2RQWA 1X6BA 5IHKA 1AZGB 1ZBJA 2YUNA 2C0IA 2EYZA 4J9CA 3UA7A 1MV3A 3QWXX 2L3QA 1UUEA 2L0AA 3I35A 5GJVB 3H0FA 2ROLA 1SSHA 2LCSA 2JW4A 2DYBA 1SRLA 1U06A 2J06A 1ZX6A 3JV3A 1X6GA 1NYFA 1JEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHR A;  1UJY A;  4DEY A;  2JMC A;  2L3S A;  3NHN A;  2AKL A;  1UDL A;  2DL7 A;  2KYM A;  1WDX A;  1ZLM A;  2EQI A;  2FPF A;  3TVT A;  4RTU A;  3VRY A;  1WLP B;  2OI3 A;  2QDL A;  1M30 A;  2V1R A;  1GBR A;  2L2P A;  2K2M A;  2FRW A;  1T0H A;  1BK2 A;  3KFV A;  2ED1 A;  3THK A;  3ULR B;  2LX7 A;  2JM9 A;  5IH2 A;  1AWX A;  2ABL A;  1H92 A;  2KT8 A;  2DA9 A;  4ESR A;  2AK5 A;  2RNA A;  3SHW A;  2VKN A;  1Z9Q A;  2KRN A;  2RPN A;  1PRM C;  1W6X A;  1U5S A;  1ZSG A;  2DBM A;  2DMO A;  2EBP A;  2O88 A;  3NGP A;  4J9I A;  2SEM A;  2DF6 A;  2KR3 A;  1GBQ A;  2DLP A;  1NEG A;  1QWE A;  2C0O A;  3M0U A;  1TUD A;  3TSW A;  2CDT A;  2ECZ A;  2V1Q A;  4LNP A;  1HSQ A;  2D8H A;  4J9E A;  1NLO C;  1OV3 A;  2KRM A;  2KT1 A;  1E6G A;  4HXJ A;  4RTY A;  1SEM A;  1V1C A;  2KYB A;  2JT4 A;  3M0S A;  1AWO A;  2PZ1 A;  2YSQ A;  3VS3 A;  2F2V A;  1ARK A;  5HCK A;  2I0N A;  2LJ1 A;  2RMO A;  4AFU C;  1AWW A;  3R6N A;  1YWO A;  2VWF A;  4CC2 A;  2IIM A;  2DL4 A;  2P4R A;  1I1J A;  2ED0 A;  1Y0M A;  3M0P A;  2JTE A;  2O9V A;  3PE0 A;  1KFZ A;  4E6R A;  1WI7 A;  2HCK A;  3NPF A;  4J9B A;  1SHF A;  1I07 A;  2C0T A;  1SHG A;  4A63 B;  5ECA A;  2FG0 A;  4LUD A;  3UF4 A;  2PTK A;  1KSW A;  1M8M A;  1RLQ C;  4JJC A;  2LMJ A;  3M0Q A;  1QLY A;  4WCI A;  2EGC A;  4GBQ A;  2E5K A;  1K76 A;  4JJB A;  1AD5 A;  2DRM A;  2CT4 A;  2YT6 A;  2RQU A;  1X69 A;  1WXB A;  1U3O A;  3UAT A;  1K0X A;  2DL3 A;  1PNJ A;  2A08 A;  4JZ4 A;  1ZUU A;  1W70 A;  3CQT A;  1JU5 C;  2KRS A;  2KNB B;  2X3X D;  3EHQ A;  2FEI A;  3REB B;  2EYX A;  2CSQ A;  4J9F A;  2CH4 A;  2LNH B;  4IIO A;  2NWM A;  3LH5 A;  1GRI A;  1KJW A;  1GCQ A;  2O9S A;  2ROT A;  2MCN A;  1NLP C;  4HVU A;  1JXO A;  2A36 A;  1OEB A;  1M27 C;  4K11 A;  2GGR A;  4LE9 A;  4CC3 A;  5IXF A;  2LQN A;  4OMQ A;  2RQT A;  1YWP A;  2YDL A;  4JJD A;  1CSK A;  2W10 A;  1T0J A;  1GCQ C;  1XOV A;  2KBT A;  2EYY A;  3NMZ C;  4F16 A;  1B07 A;  1YP5 A;  2XMF A;  2L3P A;  3GBQ A;  2EGA A;  5I22 A;  1AWJ A;  1GCP A;  4RUG A;  1UTI A;  2YUQ A;  4EIK A;  4R0K A;  2K7A A;  2DJQ A;  1H8K A;  1AZE A;  1M3A A;  3M0T A;  1CKA A;  5IHI A;  1WA7 A;  1WX6 A;  1WXT A;  1JQQ A;  4OMN A;  2KE9 A;  1M3C A;  2K9G A;  4RTZ A;  1PHT A;  4RTX A;  4J9H A;  1SPK A;  5FWC A;  1YN8 A;  1X2K A;  2F2W A;  4AG2 C;  1RI9 A;  3VS2 A;  1PKS A;  4HVV A;  2KEA A;  2AKK A;  1T3L A;  2JS0 A;  2RQR A;  2FPE A;  1BU1 A;  2BTT A;  1E6H A;  1X2Q A;  3VS1 A;  4OML A;  3TSZ A;  2DX1 A;  4HCK A;  1W1F A;  1VYT A;  2B86 A;  1I0C A;  1T3S A;  1JO8 A;  1H3H A;  2CUB A;  1JXM A;  2LQW A;  3EGU A;  2J05 A;  1GFC A;  1AEY A;  1NEB A;  1QWF A;  2DL8 A;  2NUZ A;  2EVR A;  1UGV A;  2DE0 X;  3FJ5 A;  3VS7 A;  2VVK A;  3VS6 A;  1CKB A;  2GNC A;  4OMO A;  2J6O A;  2F2X A;  4OMM A;  2A28 A;  2M0Y A;  4QT7 A;  1QCF A;  1Y57 A;  2JM8 A;  1OOT A;  3UA6 A;  1ZUK A;  2A37 A;  2J7I A;  2G6F X;  2K79 A;  1HD3 A;  1WXU A;  1X43 A;  3ZL7 C;  4CC4 B;  1ZUY A;  3RBB B;  2CH4 W;  3RNJ A;  1HJD A;  2CUD A;  3REA B;  1LCK A;  4X1V A;  2YUP A;  4LUE A;  4F17 A;  1NG2 A;  4D8D A;  2PNI A;  4M4Z A;  4ZNX A;  1KIK A;  2KRO A;  2YUO A;  1UE9 A;  1K1Z A;  1QKX A;  2KGT A;  2DNU A;  3I5S A;  3QWY A;  4OMP A;  2OAW A;  2FO0 A;  3H0H A;  3C0C A;  2HDA A;  1UFF A;  1TUC A;  1UEC A;  2KXC A;  2ESW A;  2AZV A;  4Z88 A;  2EYW A;  2J6K A;  3M0R A;  1IO6 A;  1AOJ A;  3EG0 A;  1WYX A;  1MUZ A;  2MOX A;  1YCS B;  4GLM A;  2BZY A;  1FYN A;  3PVL A;  1G83 A;  2J6F A;  3EG1 A;  2JXB A;  2MIO A;  4Z89 A;  2K3B A;  2CRE A;  5EC7 A;  1K4U S;  4JZ3 A;  1NM7 A;  2JMA A;  2O2O A;  4HVW A;  2D0N A;  2RQV A;  3SEM A;  2FPD A;  1AVZ C;  1G2B A;  1J3T A;  3VS0 A;  1WIE A;  4AG1 C;  1MV0 B;  4J9D A;  4RTW A;  5L23 A;  1FMK A;  2EPD A;  3IQL A;  1VA7 A;  1Z9Z A;  2RN8 A;  3VRZ A;  2EKH A;  4DEX A;  2GTJ A;  1VYU A;  2BZX A;  2CSI A;  1BBZ A;  3VS4 A;  2HEQ A;  2EGE A;  4AFQ C;  3EG3 A;  1B3Q A;  1RUW A;  4Z8A A;  4J9G A;  1S1N A;  1SRM A;  2DRK A;  1ABO A;  2ENM A;  3VS5 A;  2EW3 A;  1E7O A;  3H41 A;  4JPB W;  3H0I A;  2GQI A;  2LZ6 B;  5I11 A;  1K9A A;  1N5Z A;  1PWT A;  1YNZ A;  4IIM A;  1RLP C;  1WFW A;  1PRL C;  2LJ3 A;  1GL5 A;  2CT3 A;  5IXB A;  1UG1 A;  2AZS A;  5IHN A;  2DBK A;  5FWB A;  4F14 A;  2DL5 A;  2DM1 A;  4FSS A;  1X27 A;  2W0Z A;  2BZ8 A;  4Y92 A;  2SRC A;  2H8H A;  1UHC A;  1QKW A;  1GFD A;  2HSP A;  1OPK A;  2M51 A;  1PKT A;  2KXD A;  1BB9 A;  1NYG A;  2D1X A;  2RF0 A;  1A0N B;  2DVJ A;  3PVQ A;  4KRT A;  2FRY A;  1VYV A;  2JS2 A;  3A98 A;  3EG2 A;  5GJW B;  2OJ2 A;  4LN2 A;  4RTT A;  1M3B A;  2LJ0 A;  2LP5 A;  3I5R A;  2K6D A;  1ABQ A;  2D8J A;  2HBW A;  4ORZ A;  3U23 A;  2GBQ A;  1UJ0 A;  3O5Z A;  4RTV A;  2O31 A;  5FW9 A;  1EFN A;  2DIL A;  4CC7 A;  1UHF A;  1TG0 A;  4AFS C;  3I9Q A;  2GTO A;  4AFZ C;  1K0S A;  2X3W D;  1OPL A;  4D8K A;  2RQW A;  1X6B A;  5IHK A;  1AZG B;  1ZBJ A;  2YUN A;  2C0I A;  2EYZ A;  4J9C A;  3UA7 A;  1MV3 A;  3QWX X;  2L3Q A;  1UUE A;  2L0A A;  3I35 A;  5GJV B;  3H0F A;  2ROL A;  1SSH A;  2LCS A;  2JW4 A;  2DYB A;  1SRL A;  1U06 A;  2J06 A;  1ZX6 A;  3JV3 A;  1X6G A;  1NYF A;  1JEG A; 
#chains in the Genus database with same CATH topology
 4DBR A;  2D6F A;  5GMK j;  4DBH A;  2L3S A;  2RI3 A;  1HXD A;  1UGQ B;  1UDL A;  2AKL A;  5KYW A;  4ZGD B;  3ZFJ A;  2JTM A;  5DLO A;  4BD3 A;  1OU8 A;  4FW2 A;  3L2Q A;  2L2P A;  4HCB A;  3SWN A;  1YBY A;  1T0H A;  3QO3 A;  1VQK T;  1OI1 A;  1RAA B;  2M9U A;  3QYG B;  3OQ5 A;  1PD0 A;  2JVV A;  5IH2 A;  3CC2 A;  1QVP A;  3OYI A;  1KHI A;  2KT8 A;  3MKD A;  2P84 A;  3SWN C;  4E7H A;  4OF1 A;  2VKN A;  3CC4 A;  2KRN A;  4IUP A;  1PRM C;  5GAN e;  1U5S A;  2EBP A;  2O88 A;  4FT2 A;  2R5A A;  4E7K A;  2ZGW A;  1GBQ A;  2EIF A;  1QWE A;  3M0U A;  1TUD A;  2RH2 A;  1RAD B;  4BY6 B;  5GAN 2;  1WQ7 A;  4E7S A;  3O8V A;  5I21 A;  2DD4 A;  4HXJ A;  1VQ8 A;  4M7A G;  3JB9 D;  4C92 B;  1PD1 A;  2HQX A;  3DKM A;  3V7S A;  3V7C A;  3VJP A;  2V8J A;  1YHQ Q;  2YSQ A;  4OGC A;  4E7I A;  2F2V A;  4MZM A;  2RMO A;  2LJ1 A;  2MI6 A;  3J81 E;  1I1J A;  2ED0 A;  4WTO B;  3M0P A;  2Y90 A;  3M54 A;  2O9V A;  4R56 A;  3PE0 A;  2DZ9 A;  3N5B B;  4M7D F;  2IVW A;  2YRV A;  4E6R A;  1K9M C;  4J9B A;  1SHF A;  3CCJ T;  4PJO D;  3CCE A;  1SHG A;  1HK9 A;  1YCY A;  1WNL A;  5KYW B;  4J6Y A;  3G4S Q;  1VQO A;  5J39 A;  1VQ9 A;  3J80 E;  1TS9 A;  1ZQ1 A;  2EGC A;  3Q1J A;  3SWN B;  3EGX A;  1K76 A;  3V8J A;  2QA4 Q;  1VQM T;  1B34 B;  2L5Q A;  2YT6 A;  1WXB A;  4J6X A;  1K0X A;  1PNJ A;  2DAQ A;  5CQX A;  1W70 A;  2E4H A;  2KQW A;  1K8A R;  2LNV A;  2KNB B;  2X3X D;  5J3B A;  1YJW T;  2EYX A;  1PM3 A;  3LH5 A;  2O9S A;  2ROT A;  2GFU A;  2FYK A;  5GAM f;  3TCJ A;  2A36 A;  2CP0 A;  4MZP A;  4M7D C;  4K11 A;  2GGR A;  4CC3 A;  2H3J A;  2BUD A;  4PL6 A;  3CPW P;  2LQN A;  4BI8 B;  3CCQ T;  3HFO A;  4OMQ A;  1MMN A;  2RQT A;  1Q7Y R;  1WGS A;  2L3R A;  3V8K A;  2KBT A;  3G71 Q;  1YP5 A;  2L3P A;  4KBM B;  4Y28 E;  2RHI A;  2PU9 B;  3HRU A;  1H3Z A;  4EIK A;  1X01 A;  2DJQ A;  1VQ5 T;  3MEU A;  5I2M A;  1NPR A;  1M3A A;  2CZ1 B;  4EMH A;  1LJO A;  4M77 D;  5EG2 A;  5CKB A;  4CI0 C;  5IHI A;  3JB9 F;  3HTR A;  2E41 A;  3CCV T;  1PHT A;  2VC8 A;  4KUI A;  4M75 D;  3JCM V;  2CP6 A;  4QQG A;  2AHJ B;  1K9M R;  4CRI A;  2OTJ Q;  4AG2 C;  1HYO A;  3CCS Q;  2CP7 A;  2DXC A;  1YJN Q;  3F70 A;  3A8O B;  1YHQ A;  3OYL A;  2X4X A;  3E9G A;  4BDZ A;  3V7R A;  4QVC A;  4PJJ A;  2HSE B;  1R77 A;  4PJO F;  1I0C A;  3DB3 A;  3I55 Q;  3QSU A;  1W4S A;  3JRZ A;  1BIB A;  3CCM Q;  2RA2 A;  2H3E B;  2MWP A;  3M53 A;  4JRI A;  1NEB A;  2EKO A;  1QWF A;  1Y71 A;  1M1K U;  2DE0 X;  3RR6 A;  2C06 A;  2F5T X;  4M7D B;  2MF2 A;  2CZ0 B;  4PJO E;  2X4J A;  4GLK A;  3G4S A;  3WVE B;  5GAO m;  4E7J A;  1VQK Q;  2A37 A;  2CP3 A;  4CC4 B;  2G6F X;  1X43 A;  4F7U A;  1HJD A;  2K3X A;  3CCR A;  1NG2 A;  4B6M A;  3ER0 A;  3VKI A;  2QQ9 A;  3CC2 T;  1BYM A;  2EYQ A;  2KRO A;  3LGL A;  3JCM e;  1K1Z A;  1QKX A;  4NS5 A;  1Q81 U;  3C0C A;  1G8X A;  1IHW A;  2QEX Q;  4ZN1 A;  2EYW A;  1IO6 A;  2RJF A;  1AOJ A;  5CKF A;  4MDX A;  3OYC A;  3EG0 A;  4DBF A;  4M78 A;  2BZY A;  1JJ2 A;  4FYV B;  4OB3 B;  3BY7 A;  5GAN 7;  3MP6 A;  4Z89 A;  3G71 A;  2QXF A;  3EGD A;  4M75 F;  3SEM A;  2FPD A;  2ZPI B;  1D0X A;  4C8Q G;  2VAS A;  4JRP A;  1ZSZ A;  3OB9 A;  5GAN h;  3CMA T;  1KG1 A;  4PLI A;  2VV5 A;  2VB6 A;  4AMC A;  4DEX A;  2OAU A;  2A3L A;  1VYU A;  3CCJ Q;  2OTJ A;  3CCS A;  4AFQ C;  1WHK A;  1YJN A;  2QYZ A;  4LD9 K;  2RO0 A;  2RJD A;  4Z8A A;  4J9G A;  4QVZ A;  1SRM A;  4A4H A;  3CCE T;  4HKE A;  1E7O A;  3L42 A;  1VQO T;  1MGQ A;  2GQI A;  1K9A A;  3OSS C;  1VQM Q;  1PWT A;  1VQ9 T;  2ZPE B;  1YNZ A;  3I55 A;  2DIG A;  1MND A;  1WFW A;  2LJ3 A;  1GL5 A;  4M77 C;  4QKU A;  5IXB A;  2CKK A;  3UPU A;  1UG1 A;  2AZS A;  2DEU A;  4XU3 A;  4F14 A;  3JCM c;  1M1F A;  2DL5 A;  4M75 C;  1Q82 U;  5HK0 A;  1ZBX A;  1UHC A;  3QPH A;  1TTH B;  3PMI A;  2BE7 D;  1M1G A;  2RF0 A;  3X20 B;  1VQK A;  2DVJ A;  1A0N B;  1VYV A;  2JS2 A;  3EG2 A;  4ZN3 A;  4LN2 A;  2LJ0 A;  2K6D A;  1ABQ A;  1JBM A;  2RK1 A;  3QG1 A;  2ZZD A;  1RAB B;  3SFM A;  4FYX B;  1XTD A;  2QG9 B;  2XID A;  4N0A C;  4QVD A;  1FMW A;  5M9O A;  3O5Z A;  3CPW S;  1VQ5 Q;  3MO8 A;  2LQK A;  2DVE A;  4O5V A;  1Q81 C;  1YJ9 Q;  2QEX A;  4CC7 A;  2QTV A;  1TG0 A;  4VUB A;  3I9Q A;  3CCV Q;  5GAO r;  5CKD A;  4ZTF A;  2RQW A;  2DTI A;  2NUP B;  4M78 G;  4XTU A;  4LDX A;  1ZBJ A;  4RG2 A;  3JB9 H;  1MV3 A;  4HCZ A;  1WHG A;  3QWX X;  5IAY A;  4LXC A;  1JJ2 P;  2KSS A;  4KGV B;  1UUE A;  2EQU A;  5GAM e;  4M77 B;  4ELY C;  3HFN A;  3GPL A;  1YHQ T;  3H0F A;  3L2V A;  3OMG A;  4M75 B;  2D0Q B;  3S3M A;  1Y96 A;  1X6G A;  4A4K A;  4EDU A;  1UJY A;  4DEY A;  5CQY A;  2JMC A;  1WJS A;  3RES A;  2KYM A;  2EFI A;  1RAG B;  5LJ5 g;  2FPF A;  3TVT A;  1WLP B;  3OYG A;  5GAN 5;  1M1K R;  2OI3 A;  2QDL A;  1W2B A;  2YLB A;  4C0F A;  1D3B B;  1GBR A;  4PFZ A;  2X35 A;  9ATC B;  2YWW A;  1BK2 A;  2ED1 A;  3THK A;  1VQL A;  1G3S A;  2DK3 A;  2LDM A;  1LPL A;  4ZGJ B;  3G4S T;  4N4H A;  3A8L B;  1VQM A;  5FU6 C;  3VYH B;  2MWO A;  2QDY B;  4IKF A;  1M8V A;  2DA9 A;  1WHJ A;  3VUB A;  4AT1 B;  3OA6 A;  3CC2 Q;  1KC8 U;  1KD1 U;  1OZ2 A;  3CCR T;  2DMO A;  2DBM A;  2DO3 A;  2F69 A;  2RHY A;  1D0Y A;  1Q82 C;  1NEG A;  4PKC C;  1Q81 R;  3E1S A;  2K57 A;  2V1Q A;  2O4X B;  3C4S A;  5LJ3 g;  4ANJ A;  2L89 A;  3MCA B;  1KQS A;  2E6Z A;  4RTY A;  3TQ7 P;  2KYB A;  3M0S A;  4C92 F;  3X26 B;  3A8H B;  2FZK B;  4AFU C;  4M7A A;  2G3R A;  3LH0 A;  1V76 A;  4CC2 A;  2IIM A;  2MYS A;  3HRT A;  1VQ5 A;  4C5G A;  3BFM A;  3JCM h;  1BI0 A;  2JTE A;  3H6Z A;  1YJ9 A;  3X24 B;  4C92 E;  5KE2 A;  5GMK e;  3CMA Q;  1WJQ A;  3OS1 A;  3CCV A;  2WSE E;  3MHX A;  3NPF A;  4HT9 A;  1QMC A;  2ZPF B;  4D6W A;  4A63 B;  1FWZ A;  2FG0 A;  1UGR B;  3OYE A;  4QW2 A;  4MML A;  3PIO A;  1KSW A;  1LNX A;  1M8M A;  1M2V B;  4HCC A;  2OTJ T;  5FU6 B;  4BUG A;  3CCE Q;  1QLY A;  3CCS T;  4GBQ A;  1D1A A;  4KUD K;  3PIP A;  3M58 A;  2VGM A;  4Z02 A;  3JCM f;  1AD5 A;  1VQ9 Q;  2DXU A;  3UAT A;  2DL3 A;  2DEQ A;  2KAF A;  2A08 A;  4PNO A;  2XI9 A;  4JZ4 A;  4N4I A;  1ZUU A;  2D9T A;  3ME9 A;  3EG9 B;  2DER A;  1VQ6 A;  1BIA A;  3I55 T;  3EHQ A;  4LDV A;  2FEI A;  3CBO A;  4RKU E;  2DTO A;  3BE3 A;  2CH4 A;  4RG8 A;  3ZEH A;  2NWM A;  3VUZ A;  4J6W A;  2HBP A;  1H64 1;  2EJG A;  1UB4 A;  2MK5 A;  4E7L A;  1JXO A;  1Q82 R;  3G1J A;  4YTL A;  5IXF A;  1W2B P;  1M2O A;  1Y07 A;  3CPW A;  5KYU B;  1VUB A;  4JJD A;  4PFO A;  1T0J A;  4ATO A;  1XOV A;  4F16 A;  2CS7 A;  4C0D C;  3CXC P;  3GNG A;  1K73 U;  4KT0 E;  3P8B B;  3QZ5 B;  2YUQ A;  4BI4 A;  4R0K A;  3CC7 Q;  2K7A A;  5KYY B;  1KC8 C;  2HKN A;  1K8A C;  1KD1 C;  3M0T A;  3FJP A;  5CR2 A;  1WHH A;  5CKE A;  2NUT A;  1SKU B;  1JQQ A;  2WSC E;  4A53 A;  4RTX A;  2E70 A;  3WXM B;  5GAO q;  3OS2 A;  2QEX T;  3OYK A;  2HMA A;  1PKS A;  4HVV A;  2KEA A;  1T3L A;  1N6A A;  1DJ7 B;  1KQS P;  3H8Z A;  4PJN A;  4E2F B;  1Q7Y C;  2FZC B;  1VQN A;  2YHT A;  1VQP T;  4OML A;  2E1H A;  3D7S B;  1I4K 1;  1JO8 A;  4JUV A;  1I5L A;  2CUB A;  1X6O A;  1JXM A;  2HD0 A;  2LQW A;  2EJ9 A;  2J05 A;  3CMA A;  4FT4 A;  1WQW A;  2BIV A;  2DL8 A;  2K3Y A;  1JJ2 S;  1UGV A;  3FJ5 A;  4PJM A;  4J7F A;  2VVK A;  3JCM d;  1CKB A;  4DQ2 A;  2DFU A;  4OMO A;  2J6O A;  2F2X A;  2A28 A;  2E12 A;  2QK0 A;  1D09 B;  2JM8 A;  2PVO B;  4C0D B;  1EIF A;  1ZUK A;  2K79 A;  1HD3 A;  2L8D A;  3RBB B;  2DET A;  2CH4 W;  2M0O A;  1OU9 A;  3FRN A;  4X9C A;  3HKS A;  1LCK A;  4M7D E;  2HNI A;  3CD6 Q;  2YUP A;  1VQL T;  4BI3 A;  5GAM h;  2RJE A;  5I2S A;  4WF2 A;  2YUO A;  4A54 A;  2XDP A;  1UE9 A;  3CCR Q;  4M78 D;  2HDA A;  1KC8 R;  1KD1 R;  3PTA A;  2ESW A;  2GFA A;  2IG0 A;  5FU7 C;  3M0R A;  5DLQ E;  4DOV A;  1YCS B;  1XJW B;  2V8I A;  4GLM A;  1OUL A;  3FC3 A;  2JXB A;  2MIO A;  3QYH B;  2K3B A;  1ZHI A;  1TWB A;  2O01 E;  2K5F A;  1UGS B;  2HZY A;  2RQV A;  1K73 C;  2AT1 B;  2RHU A;  2VGN A;  3CC7 A;  4AG1 C;  2X4Y A;  4RTW A;  5L23 A;  2EPD A;  3SB2 A;  5KYN A;  3MEV A;  5CCA A;  1VA7 A;  4C8Q A;  3VRZ A;  1YJ9 T;  4GY5 A;  2EJF A;  1PSF A;  2CSI A;  4L59 A;  4E7Z A;  2HEQ A;  2EGE A;  1VQ7 A;  3EG3 A;  1B3Q A;  1RUW A;  3L2W A;  1D0Z A;  3VYG A;  3LWH A;  3MEW A;  2DRK A;  3M57 A;  4X9D A;  1ABO A;  1NZ9 A;  3H0I A;  2LT4 A;  5I11 A;  2X4W A;  2XIC A;  4F7U F;  1RAH B;  1RLP C;  4IIM A;  1QVG A;  3MET A;  2CT3 A;  3EFR A;  3PFS A;  3OW2 P;  2CP2 A;  3EGX B;  5KE3 A;  3MP8 A;  5FU7 B;  4PFP A;  2DBK A;  2KI7 A;  5GMK h;  1X27 A;  3M4Y A;  4A4G A;  3VU3 C;  1VQ6 T;  3CCL A;  1OX8 A;  3OS5 A;  3OYD A;  1PKT A;  3GP8 A;  2KXD A;  3QDF A;  4JJN K;  1I5O B;  3PVQ A;  2CYZ B;  2DXB A;  1TUG B;  5KCH A;  2LX9 A;  4RTT A;  5LJ5 j;  3I5R A;  3CD6 A;  1RI0 A;  2MPX C;  2X51 A;  1NPP A;  1OQK A;  1UJ0 A;  5KYX A;  2JJ9 A;  4ME7 A;  2EWN A;  1W2B S;  4RTV A;  3AHU A;  1K73 R;  5GAM d;  4EPC A;  2DIL A;  2K5L A;  3A8M B;  2GTO A;  2I2L A;  3CXC S;  2X3W D;  2M02 A;  4D8K A;  4J83 A;  8ATC B;  5IHK A;  1N9R A;  1AZG B;  1N8R U;  1JB0 E;  3ZBD A;  1WHL A;  2GQV A;  4J9C A;  1QQJ A;  1G5V A;  2OTL A;  3CBM A;  3HSB A;  4M7D G;  3G7Z A;  1VQP Q;  4M77 F;  2JUF A;  5AYF A;  5LJ3 j;  2ROL A;  1VQN T;  2E6N A;  3LYI A;  3QKJ A;  2DYB A;  4M78 C;  2J06 A;  2M1H A;  3A1P A;  3JV3 A;  5GAO l;  1NYF A;  1KQS S;  2LRQ A;  1RAF B;  5CIU A;  2DL7 A;  4M77 E;  2YRD A;  2BE9 B;  1WJR A;  1ZLM A;  5GMK i;  4R55 A;  4C0G A;  3VRY A;  1IRE B;  1M30 A;  2CGH A;  3OYJ A;  2K2M A;  4M75 E;  1VOM A;  4IUV A;  3LLR A;  4RMO A;  3ULR B;  1ZSZ C;  2JM9 A;  1TXQ A;  1AWX A;  1H92 A;  3CPF A;  3HHT B;  5GAN g;  3LWI A;  3G6E Q;  1VQL Q;  2AK5 A;  2RNA A;  1YIT T;  3SHW A;  2R58 A;  4J5Y A;  4F7U B;  1QVG P;  3EAE A;  2CZ6 B;  1W6X A;  1ZSG A;  2IPO B;  4XU0 A;  3NGP A;  3QUI A;  1BKB A;  2E3H A;  2Z0W A;  2KR3 A;  5KCO A;  1RAE B;  1XNI A;  2C0O A;  1UGP B;  1M1K C;  2CDT A;  2ECZ A;  4JS4 A;  1HSQ A;  1S72 Q;  4M7A D;  2D8H A;  4J9E A;  1OV3 A;  5CAI A;  2KT1 A;  1YIJ T;  1AWO A;  1IXD A;  1XQH A;  1F1B B;  2PZ1 A;  1QP2 A;  3H9N A;  3JB9 G;  3PGG A;  5HCK A;  3C95 A;  4M78 B;  3R6N A;  2VWF A;  1RL2 A;  4C5E A;  2P4R A;  1X75 C;  1Y0M A;  3FB9 A;  5D6W A;  1FX7 A;  3OY9 A;  1PSE A;  3CC7 T;  3EGD B;  4IUR A;  1SF9 A;  2HCK A;  1VQ4 A;  1I81 A;  1IGU A;  2XK0 A;  2V8K A;  4KH1 B;  1I07 A;  2C0T A;  5ECA A;  2HQH A;  1ZSZ B;  4FYW B;  4C5H A;  4PJO G;  4LDW A;  2PTK A;  4QQD A;  1N8R C;  2F1L A;  2KMT A;  1RLQ C;  4JJC A;  3SDZ A;  2Y4X A;  4II1 A;  2P4T A;  1VQ7 T;  1VQP A;  3C12 A;  1BI1 A;  2Y4Y A;  4JJB A;  2DRM A;  4XTY A;  1X69 A;  3M55 A;  1U3O A;  4BAC A;  1D1C A;  2RHZ A;  3TEE A;  3JCM P;  3EFO A;  1JU5 C;  2KRS A;  1BI3 A;  3QII A;  2OX7 A;  3REB B;  1FXX A;  1QVF S;  4J9F A;  2QI2 A;  3S3N A;  4IIO A;  1VQ6 Q;  3LGF A;  4HT8 A;  2GCX A;  1KJW A;  1GCQ A;  3J7A F;  4HVU A;  4XU1 A;  4LD6 A;  3JCM X;  4NL2 A;  3CCL T;  3OW2 S;  2EQJ A;  2YDL A;  2W10 A;  1GCQ C;  3G6E A;  2R57 A;  1LOJ A;  4FW1 A;  3S6W A;  3GBQ A;  5J26 A;  3CXC A;  2LVM A;  1AWJ A;  3M5A A;  1MNE A;  3BW1 A;  3CD6 T;  1UTI A;  3SD4 A;  3A5Z B;  2EQK A;  4M7A F;  5GMK l;  4A4E A;  4OB2 B;  1WA7 A;  1WX6 A;  1WXT A;  5LJ5 f;  4EMK A;  2K9G A;  5FWC A;  1YN8 A;  5GAN 6;  1S72 A;  1X2K A;  4M75 G;  1RI9 A;  3CCU T;  4FIB A;  5CK9 A;  2AKK A;  2XD0 A;  4JLI A;  4TVR A;  3MPU B;  3E2U A;  3HRS A;  2JS0 A;  2RQR A;  2FPE A;  4O6J A;  3RMS A;  1E6H A;  1X2Q A;  1N8R R;  2DX1 A;  2ZPH B;  1KHC A;  4HCK A;  3VV0 A;  1W1F A;  2ZCF B;  2OTL T;  2B86 A;  1NJI U;  1VQN Q;  1T3S A;  3CME A;  2NLU A;  2KDS A;  3OYY A;  4KUL A;  1VIE A;  4KGZ B;  5A0L A;  3DLL A;  2EVR A;  1R8O B;  4BB7 A;  3MEA A;  5A0G A;  1WPY A;  2COY A;  2K5I A;  4OB0 B;  2GNC A;  4M7A C;  5LJ3 f;  2WAC A;  4OMM A;  1NE8 A;  1Y96 B;  2M0Y A;  3DLM A;  4Y91 A;  1MMG A;  1Y57 A;  1OOT A;  1OZ3 A;  2XU8 A;  3EH1 A;  4C5I A;  2J7I A;  1WXU A;  1NBE B;  4LUE A;  4F17 A;  1MMD A;  1FMV A;  1PG5 B;  3RKW A;  1QW1 A;  2PNI A;  4M4Z A;  4ZNX A;  4JLG A;  1TOV A;  1YIT Q;  1KIK A;  3JCM b;  3GLX A;  1UEB A;  2DKG A;  2DNU A;  4OMP A;  4FM4 B;  2FO0 A;  2YRC A;  2DPP B;  5GAN 4;  2KXC A;  2AZV A;  4C92 A;  1SG5 A;  3TU4 K;  2J6K A;  5A0D A;  5D7U A;  3PMT A;  4LDY A;  5CKH A;  3S3O A;  3L2Z A;  1WYX A;  1MUZ A;  2F5K A;  2MOX A;  1QVG S;  3PVL A;  4MMK A;  1GXI E;  1YIJ Q;  3EG1 A;  2CRE A;  5LJ5 d;  2ATC B;  2FHD A;  3R6O A;  4JZ3 A;  2JMA A;  2QQS A;  2O2O A;  4HVW A;  3FIF A;  4C8Q D;  4KH0 B;  2RHX A;  5GAO p;  3EH2 A;  3QXE B;  1AVZ C;  3NFC A;  2DIQ A;  3KXT A;  1G2B A;  1J3T A;  1M9S A;  1WIE A;  2CZ7 B;  2E65 A;  3CBP A;  4LDU A;  1OX9 A;  1OYX A;  3RMQ A;  2QQR A;  4M7A B;  1O75 A;  3PT9 A;  5DM7 R;  1Z9Z A;  2GTJ A;  2FB7 A;  3GOX A;  2BZX A;  1C0M A;  5D6X A;  4NL3 A;  1B34 A;  1VQ4 T;  2LTO A;  4ELZ C;  1YI2 Q;  3NTI A;  1VQ7 Q;  3I56 T;  3GNF B;  5L8R E;  3JB9 J;  2LZ6 B;  1QVF A;  4OB1 B;  1N5Z A;  3OYH A;  4C0Z A;  1P92 A;  5LJ3 d;  2JTF A;  2LCC A;  1C6V X;  4N4G A;  1NJI C;  1MMA A;  3HP9 A;  5A2Q E;  4X34 A;  3TRE A;  3OW2 A;  4KGX B;  4BDY A;  5IN1 A;  1IB8 A;  1U1T A;  2SRC A;  4BE1 A;  1QKW A;  1R0B G;  1BB9 A;  4OP0 A;  1KK7 A;  2D1X A;  3CCL Q;  5HKC A;  1R0C B;  2CP5 A;  3QJY A;  3RUX A;  1M3B A;  2LP5 A;  5CVI A;  2MAM A;  5GAN 8;  1I8F A;  2B8A A;  2D8J A;  2HBW A;  4ORZ A;  4IUT A;  3JCM J;  4PJL A;  3QHS A;  1YIT A;  3G6E T;  1BCO A;  4FU6 A;  4OGE A;  3OSV A;  4J7I A;  1EFN A;  5GAN j;  2PUK B;  1UHF A;  4C92 G;  4AFS C;  4ZGE B;  3RDV A;  3FDR A;  1K0S A;  4C8Q F;  3CCU Q;  2NUT B;  5GAM g;  1YIJ A;  2JZ2 A;  3CEY A;  1S72 T;  3OYN A;  2E64 A;  3UA7 A;  2EQM A;  3OYA A;  2L3Q A;  1Y7X A;  3UT1 A;  2L0A A;  3I35 A;  4C8Q E;  2FZG B;  1SSH A;  4OVA A;  1KQ2 A;  2OTL Q;  4M7D A;  3P8H A;  1SRL A;  4XTZ A;  5C0M A;  2RB6 A;  2COW A;  3JCM Q;  1NJI R;  3EHR A;  3CME T;  8AT1 B;  3NHN A;  6AT1 B;  1WDX A;  5KH6 A;  2EQI A;  2DYI A;  4RTU A;  2YXY A;  1IGQ A;  2RD1 A;  4FL6 A;  2V1R A;  2FRW A;  5D6Y A;  1YI2 A;  3KFV A;  5LJ5 e;  2QGG A;  2LX7 A;  3KUF A;  1TH7 A;  4PK4 A;  4B9X A;  4C8Q C;  2ABL A;  3L1A A;  4MZT A;  1PC0 A;  3QJ6 A;  4Q5W A;  1QVF P;  4ESR A;  2QTX A;  1Q86 U;  3BDU A;  3OYM A;  3X25 B;  1Z9Q A;  1EX4 A;  1G3W A;  2RPN A;  3LW5 E;  2P0P A;  3E19 A;  4XTW A;  3JAM E;  2X9H A;  2DJZ A;  1KQ1 A;  4J9I A;  2SEM A;  2DF6 A;  3L2U A;  2KY9 A;  2DLP A;  3UDC A;  3TSW A;  1EZZ B;  3X28 B;  4LNP A;  2VUB A;  4F7U E;  1PCX A;  2PQW A;  1NLO C;  2KRM A;  1E6G A;  1D1B A;  2HQE A;  1SEM A;  1V1C A;  2LCL A;  2JT4 A;  2LC4 A;  1YFN A;  3M4G A;  2E3I A;  4EMG A;  2FVU A;  3M56 A;  3VS3 A;  1ARK A;  5LJ3 e;  2I0N A;  2P0K A;  4M78 F;  1AWW A;  2JN0 A;  1YWO A;  2VXE A;  2DL4 A;  2E5Q A;  1U1S A;  3QBY A;  2GF7 A;  1KFZ A;  2ZAE A;  2HL5 C;  1WI7 A;  2YLC A;  5FRO A;  1M90 U;  2M16 A;  2XKO C;  4M78 E;  1WHM A;  1LVK A;  3FEO A;  5FRN A;  3CCU A;  2P0Q A;  1N9S A;  4LUD A;  1VQ4 Q;  2LT1 A;  3UF4 A;  2QA4 A;  2HKQ B;  4C8Q B;  4L5G A;  3PNW C;  3DB4 A;  4JRQ A;  2LMJ A;  3M0Q A;  4IUU A;  4XQ3 A;  4WCI A;  2ZPG B;  2E5K A;  4PJO A;  3I56 Q;  4A4F A;  2CT4 A;  2RQU A;  2COZ A;  4FSX A;  4FYY B;  2VYT A;  3OYB A;  5GAO n;  3CQT A;  2QQA A;  3ASK A;  4XAX B;  3CC4 T;  2XG8 D;  4PJO C;  4RCC A;  1WZO A;  2CSQ A;  3QZ9 B;  2LNH B;  1GRI A;  3L2R A;  1AHJ B;  2MCN A;  1NLP C;  2KVQ G;  1C1A A;  1OEB A;  1M27 C;  4LE9 A;  5HK3 A;  3BDL A;  1VQ8 T;  1YWP A;  3OMC A;  1CSK A;  4JDS A;  3NMZ C;  2EYY A;  2PVD B;  1B07 A;  2XMF A;  4PLL A;  2EGA A;  5I22 A;  4JS5 A;  3RKY A;  1GCP A;  4BE2 A;  4RUG A;  1Q86 C;  1IHV A;  2A7Y A;  1ACM B;  1AZE A;  1H8K A;  2NUP A;  4JRK A;  1AT1 B;  1CKA A;  4OMN A;  2KE9 A;  1M3C A;  1MHN A;  2E10 A;  4RTZ A;  5KYX B;  4J9H A;  1SPK A;  1QP3 A;  4XK8 E;  2F2W A;  1SSF A;  3E9F A;  3VS2 A;  4M77 A;  2RM4 A;  2BKD N;  1Q95 G;  2EAY A;  1BU1 A;  5GAN f;  2BTT A;  4M75 A;  3VS1 A;  3CCM A;  4RCB A;  3OBY A;  1BCM A;  3TSZ A;  5LL6 S;  2DXT A;  1VYT A;  2HAX A;  4PJO B;  3HPW A;  1H3H A;  2HL3 A;  3EGU A;  2WSF E;  4NOY A;  1GFC A;  1YJW Q;  1AEY A;  4HA8 A;  1D3B A;  5CO7 A;  2NUZ A;  3CME Q;  3VS7 A;  3VS6 A;  1M90 C;  4F7U G;  4N0A A;  3CCQ Q;  3HL8 A;  4QT7 A;  3JCM W;  2NYS A;  4F04 B;  1QCF A;  3UA6 A;  2K4Y A;  2AIR B;  3INZ A;  3ZL7 C;  2V26 A;  1ZUY A;  3I56 A;  3RNJ A;  3OBW A;  5FLX E;  2CUD A;  3GF5 A;  3GIB A;  3REA B;  1YI2 T;  4X1V A;  3URG A;  4D8D A;  1QCO A;  1N27 A;  4IUQ A;  4C92 D;  4BE0 A;  3FLG A;  3OS0 A;  1B7T A;  2KGT A;  3I5S A;  3QWY A;  2OAW A;  2O4X A;  3WVD B;  1TSF A;  3JB9 I;  1Q86 R;  3H0H A;  3MJX A;  1UFF A;  1TUC A;  1UEC A;  3QDR B;  4Z88 A;  1V29 B;  2PUO B;  1M5Q 1;  5GMK m;  5AT1 B;  3AT1 B;  1FYN A;  1G83 A;  2J6F A;  2JOY A;  5LJ5 h;  3T9N A;  5EC7 A;  1K4U S;  2RJC A;  1NM7 A;  4XTV A;  2R5M A;  2JNG A;  2D0N A;  2KK4 A;  5C6S A;  1G3T A;  3VS0 A;  1M4Z A;  1MV0 B;  4J9D A;  3UWN A;  1FMK A;  3IQL A;  4DBQ A;  3CCJ A;  5GAN d;  1M2V A;  2DD5 A;  4V2S A;  2RN8 A;  1BI2 A;  2EKH A;  1BBZ A;  4XU2 A;  3VS4 A;  4M77 G;  3RIR A;  1G3Y A;  1O9S A;  1M90 R;  3V8L A;  1RAI B;  3EFS A;  1S1N A;  5FRM A;  2PVG B;  2ENM A;  1QCN A;  3VS5 A;  4M7A E;  2EW3 A;  3EG9 A;  3H41 A;  4JPB W;  4UC4 A;  2QA4 T;  2QQB A;  2FL7 A;  4DOW A;  4EMK C;  4J8O A;  4B9W A;  4L6V 5;  1K8A U;  5LJ3 h;  2RI2 A;  5GAM j;  1JRI A;  1PRL C;  2XDD A;  5GAN 3;  1IRX A;  1YJW A;  5DY9 A;  3CC4 Q;  5IHN A;  5FWB A;  2DM1 A;  4FSS A;  2W0Z A;  2BZ8 A;  4Y92 A;  1ZA1 B;  5KYU A;  2H8H A;  3RER A;  1GFD A;  3CCQ A;  2HSP A;  1OPK A;  2M51 A;  3EFO B;  3LX7 A;  3RKX A;  1Q7Y U;  1NYG A;  4MDW A;  2XHC A;  2ZPB B;  4KRT A;  3OYF A;  2FRY A;  3A98 A;  2VXF A;  5GJW B;  2OJ2 A;  1VQ8 Q;  4OMF B;  5KYY A;  4FCY A;  3G71 T;  3U23 A;  3JCM g;  2A0F B;  2GBQ A;  2K2V A;  1U8R A;  2DZC A;  1IZ6 A;  2QAZ A;  3A8G B;  2O31 A;  5FW9 A;  2RI5 A;  3M59 A;  3NTH A;  4DA4 A;  2QAS A;  1K9M U;  2DTH A;  4AFZ C;  3NTK A;  1OPL A;  3P8D A;  2RK2 A;  1X6B A;  3M9Q A;  1ZA2 B;  2YUN A;  1YJN T;  4QQ6 A;  2C0I A;  3KBG A;  2EYZ A;  1TU0 B;  4EMK B;  4E47 A;  4M7D D;  4BY6 C;  1VQO Q;  2XDB A;  4XTX A;  1VIF A;  5IT9 E;  4C92 C;  2LQ8 A;  5GJV B;  1RAC B;  4P5N A;  2LCS A;  2JW4 A;  5HY6 A;  3C94 A;  3CCM T;  2QGF B;  7AT1 B;  4ZTJ A;  1U06 A;  2MMP A;  3JSC A;  1ZX6 A;  3MP1 A;  1JEG A; 
#chains in the Genus database with same CATH homology
 3EHR A;  1UJY A;  4DEY A;  2JMC A;  2L3S A;  3NHN A;  2AKL A;  1UDL A;  2DL7 A;  2KYM A;  1WDX A;  1ZLM A;  2EQI A;  2FPF A;  3TVT A;  4RTU A;  3VRY A;  1WLP B;  2OI3 A;  2QDL A;  1M30 A;  2V1R A;  1GBR A;  2L2P A;  2K2M A;  2FRW A;  1T0H A;  1BK2 A;  3KFV A;  2ED1 A;  3THK A;  3ULR B;  2LX7 A;  2JM9 A;  5IH2 A;  1AWX A;  2ABL A;  1H92 A;  2KT8 A;  2DA9 A;  4ESR A;  2AK5 A;  2RNA A;  3SHW A;  2VKN A;  1Z9Q A;  2KRN A;  2RPN A;  1PRM C;  1W6X A;  1U5S A;  1ZSG A;  2DBM A;  2DMO A;  2EBP A;  2O88 A;  3NGP A;  4J9I A;  2SEM A;  2DF6 A;  2KR3 A;  1GBQ A;  2DLP A;  1NEG A;  1QWE A;  2C0O A;  3M0U A;  1TUD A;  3TSW A;  2CDT A;  2ECZ A;  2V1Q A;  4LNP A;  1HSQ A;  2D8H A;  4J9E A;  1NLO C;  1OV3 A;  2KRM A;  2KT1 A;  1E6G A;  4HXJ A;  4RTY A;  1SEM A;  1V1C A;  2KYB A;  2JT4 A;  3M0S A;  1AWO A;  2PZ1 A;  2YSQ A;  3VS3 A;  2F2V A;  1ARK A;  5HCK A;  2I0N A;  2LJ1 A;  2RMO A;  4AFU C;  1AWW A;  3R6N A;  1YWO A;  2VWF A;  4CC2 A;  2IIM A;  2DL4 A;  2P4R A;  1I1J A;  2ED0 A;  1Y0M A;  3M0P A;  2JTE A;  2O9V A;  3PE0 A;  1KFZ A;  4E6R A;  1WI7 A;  2HCK A;  3NPF A;  4J9B A;  1SHF A;  1I07 A;  2C0T A;  1SHG A;  4A63 B;  5ECA A;  2FG0 A;  4LUD A;  3UF4 A;  2PTK A;  1KSW A;  1M8M A;  1RLQ C;  4JJC A;  2LMJ A;  3M0Q A;  1QLY A;  4WCI A;  2EGC A;  4GBQ A;  2E5K A;  1K76 A;  4JJB A;  1AD5 A;  2DRM A;  2CT4 A;  2YT6 A;  2RQU A;  1X69 A;  1WXB A;  1U3O A;  3UAT A;  1K0X A;  2DL3 A;  1PNJ A;  2A08 A;  4JZ4 A;  1ZUU A;  1W70 A;  3CQT A;  1JU5 C;  2KRS A;  2KNB B;  2X3X D;  3EHQ A;  2FEI A;  3REB B;  2EYX A;  2CSQ A;  4J9F A;  2CH4 A;  2LNH B;  4IIO A;  2NWM A;  3LH5 A;  1GRI A;  1KJW A;  1GCQ A;  2O9S A;  2ROT A;  2MCN A;  1NLP C;  4HVU A;  1JXO A;  2A36 A;  1OEB A;  1M27 C;  4K11 A;  2GGR A;  4LE9 A;  4CC3 A;  5IXF A;  2LQN A;  4OMQ A;  2RQT A;  1YWP A;  2YDL A;  4JJD A;  1CSK A;  2W10 A;  1T0J A;  1GCQ C;  1XOV A;  2KBT A;  2EYY A;  3NMZ C;  4F16 A;  1B07 A;  1YP5 A;  2XMF A;  2L3P A;  3GBQ A;  2EGA A;  5I22 A;  1AWJ A;  1GCP A;  4RUG A;  1UTI A;  2YUQ A;  4EIK A;  4R0K A;  2K7A A;  2DJQ A;  1H8K A;  1AZE A;  1M3A A;  3M0T A;  1CKA A;  5IHI A;  1WA7 A;  1WX6 A;  1WXT A;  1JQQ A;  4OMN A;  2KE9 A;  1M3C A;  2K9G A;  4RTZ A;  1PHT A;  4RTX A;  4J9H A;  1SPK A;  5FWC A;  1YN8 A;  1X2K A;  2F2W A;  4AG2 C;  1RI9 A;  3VS2 A;  1PKS A;  4HVV A;  2KEA A;  2AKK A;  1T3L A;  2JS0 A;  2RQR A;  2FPE A;  1BU1 A;  2BTT A;  1E6H A;  1X2Q A;  3VS1 A;  4OML A;  3TSZ A;  2DX1 A;  4HCK A;  1W1F A;  1VYT A;  2B86 A;  1I0C A;  1T3S A;  1JO8 A;  1H3H A;  2CUB A;  1JXM A;  2LQW A;  3EGU A;  2J05 A;  1GFC A;  1AEY A;  1NEB A;  1QWF A;  2DL8 A;  2NUZ A;  2EVR A;  1UGV A;  2DE0 X;  3FJ5 A;  3VS7 A;  2VVK A;  3VS6 A;  1CKB A;  2GNC A;  4OMO A;  2J6O A;  2F2X A;  4OMM A;  2A28 A;  2M0Y A;  4QT7 A;  1QCF A;  1Y57 A;  2JM8 A;  1OOT A;  3UA6 A;  1ZUK A;  2A37 A;  2J7I A;  2G6F X;  2K79 A;  1HD3 A;  1WXU A;  1X43 A;  3ZL7 C;  4CC4 B;  1ZUY A;  3RBB B;  2CH4 W;  3RNJ A;  1HJD A;  2CUD A;  3REA B;  1LCK A;  4X1V A;  2YUP A;  4LUE A;  4F17 A;  1NG2 A;  4D8D A;  2PNI A;  4M4Z A;  4ZNX A;  1KIK A;  2KRO A;  2YUO A;  1UE9 A;  1K1Z A;  1QKX A;  2KGT A;  2DNU A;  3I5S A;  3QWY A;  4OMP A;  2OAW A;  2FO0 A;  3H0H A;  3C0C A;  2HDA A;  1UFF A;  1TUC A;  1UEC A;  2KXC A;  2ESW A;  2AZV A;  4Z88 A;  2EYW A;  2J6K A;  3M0R A;  1IO6 A;  1AOJ A;  3EG0 A;  1WYX A;  1MUZ A;  2MOX A;  1YCS B;  4GLM A;  2BZY A;  1FYN A;  3PVL A;  1G83 A;  2J6F A;  3EG1 A;  2JXB A;  2MIO A;  4Z89 A;  2K3B A;  2CRE A;  5EC7 A;  1K4U S;  4JZ3 A;  1NM7 A;  2JMA A;  2O2O A;  4HVW A;  2D0N A;  2RQV A;  3SEM A;  2FPD A;  1AVZ C;  1G2B A;  1J3T A;  3VS0 A;  1WIE A;  4AG1 C;  1MV0 B;  4J9D A;  4RTW A;  5L23 A;  1FMK A;  2EPD A;  3IQL A;  1VA7 A;  1Z9Z A;  2RN8 A;  3VRZ A;  2EKH A;  4DEX A;  2GTJ A;  1VYU A;  2BZX A;  2CSI A;  1BBZ A;  3VS4 A;  2HEQ A;  2EGE A;  4AFQ C;  3EG3 A;  1B3Q A;  1RUW A;  4Z8A A;  4J9G A;  1S1N A;  1SRM A;  2DRK A;  1ABO A;  2ENM A;  3VS5 A;  2EW3 A;  1E7O A;  3H41 A;  4JPB W;  3H0I A;  2GQI A;  2LZ6 B;  5I11 A;  1K9A A;  1N5Z A;  1PWT A;  1YNZ A;  4IIM A;  1RLP C;  1WFW A;  1PRL C;  2LJ3 A;  1GL5 A;  2CT3 A;  5IXB A;  1UG1 A;  2AZS A;  5IHN A;  2DBK A;  5FWB A;  4F14 A;  2DL5 A;  2DM1 A;  4FSS A;  1X27 A;  2W0Z A;  2BZ8 A;  4Y92 A;  2SRC A;  2H8H A;  1UHC A;  1QKW A;  1GFD A;  2HSP A;  1OPK A;  2M51 A;  1PKT A;  2KXD A;  1BB9 A;  1NYG A;  2D1X A;  2RF0 A;  1A0N B;  2DVJ A;  3PVQ A;  4KRT A;  2FRY A;  1VYV A;  2JS2 A;  3A98 A;  3EG2 A;  5GJW B;  2OJ2 A;  4LN2 A;  4RTT A;  1M3B A;  2LJ0 A;  2LP5 A;  3I5R A;  2K6D A;  1ABQ A;  2D8J A;  2HBW A;  4ORZ A;  3U23 A;  2GBQ A;  1UJ0 A;  3O5Z A;  4RTV A;  2O31 A;  5FW9 A;  1EFN A;  2DIL A;  4CC7 A;  1UHF A;  1TG0 A;  4AFS C;  3I9Q A;  2GTO A;  4AFZ C;  1K0S A;  2X3W D;  1OPL A;  4D8K A;  2RQW A;  1X6B A;  5IHK A;  1AZG B;  1ZBJ A;  2YUN A;  2C0I A;  2EYZ A;  4J9C A;  3UA7 A;  1MV3 A;  3QWX X;  2L3Q A;  1UUE A;  2L0A A;  3I35 A;  5GJV B;  3H0F A;  2ROL A;  1SSH A;  2LCS A;  2JW4 A;  2DYB A;  1SRL A;  1U06 A;  2J06 A;  1ZX6 A;  3JV3 A;  1X6G A;  1NYF A;  1JEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...