2VYTA

The mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
RDDFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX COMB ON MIDLEG-LIKE PROTEIN 2
publication title The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 53
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA01
3LH0A 3MP1A 4C5EA 4UC4A 5FROA 3GOXA 2EQJA 4II1A 4BD3A 3S3MA 1RI0A 3OQ5A 2RJCA 4BE1A 2E6NA 4PL6A 2HQEA 1OI1A 2EFIA 2R58A 2JZ2A 2O4XB 3P8HA 4Z02A 4C5HA 3OMCA 4NS5A 4IUVA 2RJDA 4IKFA 3BDLA 3OYFA 4CRIA 3FLGA 3PFSA 3MEVA 3L2VA 2RO0A 5J26A 3L2RA 2EQKA 2M0OA 3LYIA 3OYJA 3UT1A 3ME9A 2E5QA 2LVMA 3OY9A 2HQXA 2RHIA 2O4XA 2R5AA 2BUDA 3OYKA 4FU6A 4L59A 2NLUA 3PNWC 3OYIA 4EDUA 3NTHA 2M16A 3ASKA 1WJRA 4QW2A 3LLRA 3E9FA 3DLMA 2EQUA 5D6YA 5D6XA 4E7KA 4IUQA 2VYTA 4QQGA 4C5IA 3MP6A 3P8DA 3ZEHA 4Q5WA 3L2WA 2RI3A 3S3NA 3MP8A 4A4EA 3MEWA 5KE3A 3MO8A 5KCOA 2RHXA 4X34A 3EAEA 3OYMA 3F70A 4N4GA 3UWNA 3LGFA 2MWOA 3LGLA 3S6WA 2K3XA 5KH6A 3OS1A 4BE0A 5C0MA 4B9WA 3FDRA 1MHNA 2RHZA 1H3ZA 5FRMA 2RHYA 5M9OA 3L2UA 2PQWA 2DAQA 3DB3A 2RHUA 3OS0A 3PMIA 5C6SA 5IAYA 3OYHA 4PLLA 1OZ2A 4QVZA 2MWPA 3C4SA 3OYBA 3CEYA 3QKJA 3L2QA 1N27A 3H8ZA 3NTIA 4IURA 1WJQA 4IUUA 1WJSA 2GF7A 4A4GA 2EQMA 3S3OA 2K3YA 3E9GA 5CIUA 2X4WA 3L42A 3OB9A 3QBYA 2BKDN 3MEAA 2X4YA 3DB4A 4E7HA 1XNIA 2QQSA 2XK0A 4E7IA 2X35A 4A4FA 1G5VA 2G3RA 4A4HA 4BDZA 3OYEA 1SSFA 2XDPA 4B9XA 3QIIA 3OYCA 3Q1JA 4OVAA 4FL6A 5KCHA 5FRNA 2CKKA 2L89A 3H6ZA 2L8DA 4BACA 4N4IA 5KE2A 4E7LA 2BIVA 4BE2A 2RI5A 4PLIA 3OYDA 3FEOA 2X4XA 3NTKA 5IN1A 2GFUA 2F5KA 3KUFA 3OYLA 3OYNA 3OYAA 5D6WA 2RJFA 2M1HA 2LDMA 2D9TA 2LRQA 3LX7A 4ZTFA 3OYGA 1OYXA 2DIQA 4N4HA 2WACA 3M9QA 4IUTA 4QQ6A 2FHDA 2RJEA 4ZTJA 1KHCA 2B8AA 2R57A 4LD6A 4QQDA 2LCCA 2GFAA 3SD4A 3OS2A 4BDYA 4IUPA 4HCZA 5J39A 4E7JA 2QQRA 3FC3A 4GY5A 2JTFA 1OZ3A 2L3RA 3O8VA 3MEUA 3OMGA 4RG2A 2EKOA 4C5GA 2DIGA 2P0KA 2R5MA 2LTOA 1WGSA 2RI2A 3QJ6A 2YRVA 3META 3OA6A 3PMTA 2IG0A
chains in the Genus database with same CATH superfamily
1SG5A 2GQVA 2JT4A 9ATCB 1MMGA 4ME7A 2R58A 4C5HA 4C8QE 3OMCA 4ZNXA 1TTHB 4CRIA 5A2QE 1BK2A 1WXBA 1YWPA 5J26A 4JRKA 3CD6T 4OB2B 4OMQA 4HVUA 2P84A 3BFMA 2R5AA 5LL6S 5HK3A 2PNIA 3M0RA 2MCNA 1G3WA 5A0DA 3SEMA 1RUWA 4XU0A 3CXCP 2FYKA 3OBWA 4OGEA 3VS0A 4HCCA 4ATOA 1M1KU 4C92C 4JPBW 3THKA 3UWNA 1YJWA 2XIDA 1HXDA 2RMOA 1YJWQ 1H3ZA 2SRCA 4NL3A 1HD3A 2E5KA 2K4YA 4N0AA 2D0QB 5LJ3f 5LJ5e 3L2QA 5GAOr 2QA4A 4J8OA 2DL8A 3JRZA 1MV3A 3G4ST 4C0DC 4DEXA 2OAUA 2QA4Q 3JCMX 2GF7A 4A4GA 1Q82R 1PWTA 4JZ4A 1YIJT 2XMFA 4M75G 5KYUA 4J7FA 2FG0A 3EFOB 4J9IA 2J06A 1NG2A 1BYMA 2YLBA 5FRNA 4M78E 2ZPHB 4BACA 3RKXA 1SPKA 1VQPT 2COYA 1BCMA 2HDAA 3OYNA 2KSSA 1G3SA 3X24B 4EMGA 1VOMA 3JCMQ 1ZSZC 1PRMC 3CCQT 1M30A 4RTYA 1JXOA 5LJ5j 4M77B 5FU7C 4PK4A 4HKEA 4M77D 2SEMA 3M53A 1N9SA 1WHGA 3EGDB 5DM7R 4M75C 2ESWA 3MP1A 3QZ9B 4CC3A 4J9HA 2D8HA 4RTVA 1OU8A 2RJCA 1B7TA 2LQ8A 1ABOA 3P8HA 4JZ3A 3A8GB 1M1KR 3MEVA 1MUZA 2CSIA 4ELYC 2KQWA 1I4K1 3VYHB 1RAHB 4ORZA 4B6MA 4WCIA 4L59A 4JRPA 4RTUA 4OMLA 1PKSA 3CCMT 5D6XA 1VQ5A 2VYTA 1VQ4T 3ZEHA 1C0MA 4M78C 4C8QF 1YITQ 4E7ZA 1VQ5Q 1BI3A 2X4JA 4X9CA 4AT1B 1WDXA 4OMFB 2A3LA 2RHYA 4M7AF 1ZUUA 4HVVA 1WZOA 1OPLA 1N27A 3EGUA 2DZ9A 1B3QA 1Q86C 1X2QA 3M56A 2EQMA 3S3OA 2L3QA 2EW3A 2CP0A 3DB4A 2M02A 3RR6A 2FPFA 2NYSA 2KDSA 4BDZA 3OYEA 3Q1JA 3CPFA 3TQ7P 3RBBB 3CCVA 4KUDK 2K6DA 4CC7A 2K5FA 5D6WA 2RJFA 3JCMJ 3V7RA 3CCVQ 2BZYA 1SRMA 3M0PA 1S72T 2ZAEA 3RMSA 1QCNA 1J3TA 2FHDA 5KYXA 5A0GA 1PG5B 3LWIA 2KXCA 1Q81U 2CZ1B 3A8LB 3R6OA 4AFZC 3CC2Q 1PSEA 1UTIA 2YRVA 4IURA 1YP5A 1LNXA 2M9UA 2RK1A 3CC4T 4BE1A 3RNJA 4BE0A 3V8JA 4J83A 4TVRA 1M5Q1 2DA9A 1MNEA 3M0UA 2GTJA 4X9DA 1ACMB 2QQ9A 2LVMA 3CQTA 1AWXA 3VS1A 3OYIA 1W2BA 3E1SA 5D6YA 3QSUA 3H9NA 3J81E 3EAEA 2KYMA 1RABB 3CCLA 2D1XA 3GPLA 2KRSA 2F2XA 3JCMd 1CKAA 2RHUA 3OYHA 1PCXA 1X69A 5KYUB 1GFCA 1UEBA 2DRMA 2DXBA 4L6V5 2JM8A 4BY6C 1M90U 1WJQA 1KJWA 2EGCA 1NEGA 1WJSA 3E19A 3PTAA 2JXBA 1ZA1B 2KK4A 1X27A 4PJMA 4M77F 3QBYA 2BKDN 2HKNA 2X4YA 4E7HA 1VQ6T 3A1PA 3WXMB 2ECZA 3TU4K 3TCJA 4RTWA 5FLXE 2JM9A 2KRMA 1Q81R 2QQAA 4LUEA 4PJJA 4E7LA 3NTKA 2F5KA 2KMTA 3JCMb 1WI7A 1Q7YU 1FX7A 3QUIA 2FZGB 2FEIA 3HRSA 2LCLA 1QCOA 1U1SA 5GAMd 2GNCA 4GY5A 2BZ8A 1VQKA 1HYOA 1QLYA 3JCMc 1VQKQ 2DL5A 3LH0A 4OF1A 3I56T 4UC4A 3GNFB 4DEYA 3OYYA 1G83A 5LJ3e 3CCEA 4VUBA 1UFFA 1CKBA 3VRYA 2NWMA 2ZCFB 3PFSA 2E6ZA 2DPPB 3LYIA 3M0TA 3GBQA 2HQXA 3SWNC 2VGNA 2GBQA 1JQQA 2YUOA 3JCMh 2HMAA 2QEXA 2FPEA 5KYYA 1M90R 3MO8A 3OYMA 2QEXQ 3OS1A 3WVDB 2EBPA 5GAOq 2LMJA 4LDVA 3QWXX 3O5ZA 1IB8A 1VUBA 1QKXA 2K79A 5LJ3j 1JU5C 3M4YA 3X20B 4XTUA 3G71A 3UATA 4EPCA 1FWZA 4FM4B 1RI9A 4E47A 4M75A 3L42A 3G71Q 1Q7YR 2X35A 2MOXA 4MMKA 2P0PA 4HCKA 2JNGA 2CH4W 1X6OA 1YN8A 1VQ8T 2ZPGB 4OP0A 3M59A 4XTWA 2J6OA 2L8DA 2WSFE 5KYXB 2M51A 5GAMh 2CZ6B 4DBHA 2VXFA 2DL4A 2WACA 1K0XA 4IUTA 2C0IA 1MMDA 4R0KA 2QDLA 1WXTA 2R57A 2HEQA 2KXDA 3OS2A 4BDYA 4HCZA 1W70A 2W0ZA 2E12A 3C12A 2JTEA 2GCXA 2V8KA 4RG2A 1TUCA 4PJOF 1TS9A 2DIGA 1X6BA 3X26B 3CC7A 3HTRA 1PNJA 3QJ6A 1MMAA 2DTIA 5CVIA 4PJLA 1WQWA 1JJ2A 1NPPA 3NGPA 3OA6A 3EFOA 1RAIB 3TSZA 2OAWA 3CC7Q 4JJBA 3CMET 3HPWA 2VC8A 5KYWB 2IPOB 1VQ7T 4KRTA 4A54A 4WTOB 1C6VX 3AHUA 5L8RE 3L2RA 5I11A 1Y07A 1U8RA 3VUBA 3PNWC 1K73U 1M8VA 2NUZA 4GLMA 2F2VA 2EQUA 2DM1A 3DLMA 2QXFA 4IUQA 2EPDA 4L5GA 4Q5WA 2Z0WA 1M2OA 3CPWA 1NLOC 4FYWB 2MWOA 1FMVA 1AZGB 3FDRA 3EGDA 4J9BA 1XTDA 1NYGA 7AT1B 1F1BB 1QCFA 3EG1A 5C6SA 4XTVA 3CEYA 3VUZA 4LDYA 3CCJT 4OMMA 1JRIA 1WLPB 4M7DF 2G6FX 2YUPA 1IRXA 3REBB 1TG0A 5CKEA 5KCHA 2RN8A 4J6YA 2KT8A 2EYWA 4N4IA 1JBMA 4BE2A 4PLIA 2DE0X 5IN1A 2CREA 2L2PA 3QYGB 4C92B 2QK0A 4MZPA 3BY7A 3OSSC 1OU9A 4PJNA 3URGA 4C92D 2CS7A 1YI2A 1D0YA 5FWBA 3I35A 3V8KA 1YI2Q 2F69A 4LD6A 2GFAA 3SD4A 1I81A 3SB2A 1YNZA 1K8AR 3FIFA 2CZ0B 3C94A 3H0IA 1QVGS 2ZGWA 4C0DB 2R5MA 3OW2A 1O9SA 1K9MC 3RMQA 1N8RU 1W6XA 1NJIU 4CI0C 1K73R 3S3MA 3AT1B 4ZGJB 4IKFA 1VQOQ 4Z02A 1Y57A 4XAXB 1VYUA 2X3WD 3NPFA 3CBMA 3L2VA 4F7UF 1ZUKA 1KQSA 3OY9A 2EGAA 4KH1B 4C92G 5KYYB 2VGMA 1KC8U 2NLUA 4MDXA 3FB9A 1RADB 1YJWT 2KI7A 2BE9B 2K9GA 2CZ7B 5GAN5 4HT8A 3RKYA 5GMKm 3KXTA 2RA2A 4FT4A 3VS5A 2RHXA 5FU7B 3LW5E 5ECAA 1G3YA 1ZHIA 2K3XA 2LNVA 2XKOC 4RCCA 4DOVA 3FJPA 2QA4T 1YFNA 2CP3A 5M9OA 1B07A 4M75B 2PVGB 2RQUA 4M7AE 2MWPA 1H8KA 4M75D 1TXQA 2CP6A 2V1RA 1OULA 4IUUA 4C8QG 1MGQA 1U5SA 2DJZA 2Y90A 2DEUA 4DBFA 1QVFA 3UA6A 2CDTA 1K9AA 4J9DA 1H3HA 1KD1U 3ZL7C 1VQ9T 4FYYB 2RQTA 4M78B 2BIVA 2QTXA 3OYDA 4RG8A 3SWNA 3KUFA 1AOJA 2LT1A 3OYAA 4OB0B 1N8RR 1M27C 1UGSB 3OYGA 3EH1A 4N4HA 3VJPA 2E3IA 2I0NA 3JCMg 4RUGA 2CUDA 4QQ6A 2HL5C 2QYZA 1SEMA 1MNDA 2COZA 5LJ5d 2DL7A 4KGXB 2MAMA 4AG2C 3MEUA 3OMGA 1VIEA 4C8QC 1TOVA 3MCAB 2RI2A 2D8JA 1KC8R 3CD6A 1WX6A 2E41A 3META 3PMTA 3C95A 4MZTA 5FROA 2RQWA 4BD3A 5GAOl 3CD6Q 1RI0A 2EAYA 4WF2A 1GRIA 2DXCA 1YBYA 1TUGB 3D7SB 3QO3A 2BE7D 2K7AA 3GIBA 4M78G 2DL3A 4RKUE 2DTOA 4EIKA 2KBTA 2QI2A 4LXCA 1OOTA 1OQKA 2HSEB 4EMKC 1WPYA 2AKKA 2V8IA 1KFZA 2RM4A 3M54A 1JB0E 5GAMg 3S3NA 2FL7A 3MP6A 3EG2A 2HCKA 4FW1A 1WHKA 4N4GA 3G4SA 2C0OA 2CSQA 1NYFA 4KGZB 3CXCA 5IXFA 3G4SQ 3M0SA 1KSWA 1T3SA 3JB9F 2PQWA 3DB3A 3UPUA 1KD1R 1YIJQ 5GAOp 2L0AA 1H92A 3PVQA 4RCBA 5IH2A 2BZXA 4JJCA 1YITA 3R6NA 5CIUA 4BI4A 1VQPA 1SHGA 1OPKA 1QVGP 1KIKA 4M77E 1VQPQ 5IHKA 1WYXA 3CMAA 2F5TX 5AT1B 1X43A 2XD0A 3CMAQ 1GCPA 4O5VA 1VQNA 3M4GA 1H641 2ABLA 2HBWA 1BB9A 1VQNQ 5D7UA 1ZQ1A 5LJ5h 8ATCB 1AVZC 2LRQA 2JW4A 4AFUC 4XTYA 2MIOA 1M9SA 2K5LA 4C0FA 1Y0MA 1UGQB 5I2MA 4BY6B 2L3RA 3O8VA 2HBPA 2DLPA 1I1JA 5L23A 3I5RA 3HKSA 2EJGA 2EGEA 2EQJA 2K57A 4C0ZA 2HQEA 2EYZA 3RESA 4F14A 4HA8A 4M75F 3BDLA 3C0CA 1VQ4A 4JJDA 2OTLA 1WHMA 5GANe 2XDDA 3CC2A 1VQ4Q 2OTLQ 3MKDA 5CKBA 3HL8A 4KT0E 1M3CA 3QWYA 4ZGEB 4XQ3A 6AT1B 2LC4A 2MYSA 3UDCA 3CCLT 2EYQA 3HSBA 1UG1A 1EZZB 3RUXA 2DBMA 2YRDA 3SDZA 3VS7A 1A0NB 1BKBA 3UF4A 1RAEB 1M3AA 5KYWA 3I5SA 2ENMA 4JS5A 1TUDA 3QKJA 1IHWA 1FXXA 3H8ZA 4DBRA 4LE9A 3A98A 4JS4A 3H0HA 2E3HA 4NL2A 4Z89A 3OB9A 5HKCA 3MEAA 5GANj 2XK0A 3SWNB 4A4HA 3RKWA 1S72A 3QIIA 2A28A 1WFWA 2XG8D 1R77A 1S72Q 1RAFB 2DXTA 1VQMA 5KE2A 1XOVA 2RD1A 5GAN6 2RI5A 3M57A 2OJ2A 3FEOA 3QJYA 1VQMQ 2JJ9A 3LX7A 2KROA 1I8FA 5AYFA 1VQKT 1IZ6A 3QXEB 1SKUB 1IGQA 1WXUA 5EC7A 2WSEE 1OZ3A 2FPDA 5FW9A 2C06A 3CCET 2PZ1A 4P5NA 4PJOE 5HK0A 3T9NA 5DY9A 2PUKB 1DJ7B 2FZKB 2B86A 1YHQT 2F1LA 1W1FA 4O6JA 3VS3A 3GLXA 1JXMA 2DK3A 4MMLA 2A08A 4C92A 1LPLA 2EQKA 4AG1C 3OYJA 3IQLA 3BE3A 1UJ0A 3RERA 1QKWA 1RLQC 2QTVA 2X3XD 2XICA 1YCSB 1XJWB 2EWNA 4Y91A 3LLRA 3E9FA 1TU0B 2KE9A 4XTZA 5GMKe 2EYYA 3PGGA 2RH2A 4A4EA 1LOJA 1TH7A 4LD9K 5KE3A 2CT4A 3JV3A 4CC4B 3INZA 2LCSA 5KH6A 1Z9ZA 1Q82C 1U06A 4XU1A 2RHZA 1YJ9T 2CUBA 3G71T 3CCUT 3OS0A 4XK8E 2DXUA 2DZCA 1RL2A 1GBQA 4C8QA 2DERA 1N6AA 5LJ3d 1UDLA 2AZSA 4QT7A 1OV3A 2X4WA 1OEBA 1HSQA 4PJOC 1ZSZA 4M7DE 2BTTA 4B9XA 3I55A 3QG1A 4KULA 5J3BA 2RQVA 3I55Q 5GMKj 1I0CA 3MHXA 2A37A 2K2MA 3QYHB 2DFUA 1JEGA 1OX9A 3OYLA 2RNAA 1M8MA 1RLPC 1EX4A 4FYXB 3EG9B 3MJXA 3SHWA 2OI3A 1R0CB 3I56A 1E6GA 5IHNA 4ZTJA 4RTZA 1ZA2B 4QVCA 1UGRB 3CC7T 3I56Q 4E7JA 1AWWA 3KBGA 3PIPA 2EJ9A 1Q86U 1M1KC 2ZPIB 1W4SA 2JUFA 2EKOA 2DNUA 2KGTA 2V8JA 4BI3A 2KT1A 2IG0A 3N5BB 1KG1A 1WHLA 4ZGDB 3OQ5A 4PL6A 2PVDB 4IUVA 1VQLT 2HQHA 4M78A 4JLIA 2O88A 4XU3A 1PM3A 4E6RA 4KGVB 2QAZA 2DYBA 3CCRT 2VXEA 3CBPA 4J9FA 3UT1A 5GMKi 3ER0A 1C1AA 4F7UE 1LCKA 2OTJA 1ABQA 1PRLC 2P4TA 1PKTA 1AWOA 3UA7A 4M7DC 3RDVA 2M16A 2OTJQ 2LT4A 2YDLA 1ZBXA 5A0LA 3MEWA 5LJ5g 5KCOA 3JAME 4EMHA 1D0ZA 5LJ3h 4BB7A 3GF5A 5GAOn 4A53A 5CO7A 1AZEA 1T0HA 1QVPA 3C4SA 3VS2A 3G6ET 2FRWA 3VV0A 1VQ8A 1NPRA 2QG9B 2FO0A 3HRUA 2EIFA 4XTXA 1VQ8Q 2QGGA 5GJWB 3ULRB 2E10A 2EVRA 1ZX6A 3VU3C 2XHCA 5FU6C 2L5QA 1KK7A 3L1AA 4D6WA 4OGCA 5FWCA 2H3JA 4F16A 2V26A 2K5IA 1Q86R 4ELZC 3CCST 1BBZA 2O9VA 2DTHA 2PUOB 2IVWA 2ZPBB 1K0SA 1BIAA 5GANf 2YT6A 2HSPA 2RJEA 2VVKA 4JDSA 1NZ9A 2ED0A 3REAB 1NE8A 2GTOA 2KEAA 1GFDA 1YJNT 1ZSGA 2H3EB 2VWFA 2DVEA 1ZUYA 1GCQC 1YWOA 4FCYA 5CKDA 2E6NA 1OI1A 2EFIA 4A63B 4J9GA 3EGXB 1D1BA 2RO0A 2AIRB 1V29B 4PNOA 3ME9A 2E5QA 4FT2A 2EKHA 2NUTB 2HAXA 2V1QA 2BUDA 3OYKA 4FU6A 3FRNA 4OMNA 1QW1A 4QKUA 4QW2A 1V1CA 1VQOA 1SHFA 1VA7A 1FMWA 1NEBA 2GQIA 2AKLA 3EG0A 3F70A 4C8QB 1V76A 3H0FA 5CKHA 3JCMf 4BUGA 2DVJA 4D8KA 4C8QD 3L2UA 1NBEB 1ZBJA 1M2VA 5IAYA 2CH4A 2KR3A 1X75C 2CP2A 3NFCA 1ZSZB 1W2BS 2DETA 1Q81C 2WSCE 2KNBB 3JSCA 2YSQA 3EFSA 5IHIA 3X25B 2A7YA 5IT9E 2JS0A 2G3RA 4IIOA 4EMKB 2J7IA 3JCMP 1SSFA 1QP3A 2ATCB 2H8HA 2AZVA 4HXJA 2L89A 4LUDA 2RF0A 4J7IA 3TEEA 1X2KA 1OYXA 2DIQA 3HHTB 1IO6A 1NLPC 4Y28E 4ESRA 2DMOA 5GAMf 3BW1A 1EFNA 2LCCA 2KAFA 5J39A 4LDXA 4M7AG 2RK2A 2RPNA 1VIFA 2KY9A 2PTKA 2ZZDA 4F04B 2QGFB 1D1AA 2CP5A 2JMCA 4M78D 3GOXA 2LP5A 1U3OA 2VKNA 3V8LA 2L3SA 1NJIR 4NS5A 2RJDA 1M90C 3FLGA 4M75E 3EH2A 4PJOA 2E70A 2A0FB 4FSSA 2LQWA 3E2UA 1R8OB 2LZ6B 3NTHA 3LWHA 1WJRA 2LQNA 4E7KA 4QVDA 4QQGA 3LH5A 2RI3A 4J6XA 5GAN2 4M7AC 2E64A 4Z8AA 3LGFA 1M4ZA 4B9WA 1WHHA 2DD5A 5FRMA 2QASA 1Q7YC 2D0NA 2HNIA 2QDYB 2LJ1A 1YITT 2COWA 2XU8A 4PLLA 1VQ5T 2E1HA 3QDRB 1SF9A 1VQ9A 5GAN3 1IREB 3L2ZA 3J7AF 3CMAT 2MF2A 1VQ9Q 4NOYA 2RB6A 3H41A 4FSXA 2OX7A 2JMAA 1VQNT 1XNIA 2QQSA 2EYXA 4IIMA 3FJ5A 1U1TA 1RACB 1YIJA 1Y96A 4C92F 5CK9A 4LDUA 2LQKA 2DYIA 4FW2A 1WIEA 4M7DA 3OS5A 3I9QA 1HJDA 1KHIA 2ED1A 2PVOB 2B8AA 5HCKA 4IUPA 4R55A 2D6FA 4GBQA 5CAIA 5LJ3g 3X28B 3CCVT 2RQRA 3CCQA 1K4US 1O75A 2VASA 3QZ5B 1M1FA 3CCQQ 3M55A 4JRQA 2LJ3A 4ANJA 4JUVA 2IIMA 5GJVB 2OTLT 4PFZA 1QP2A 5HY6A 3CC2T 4M77G 2JZ2A 4X1VA 1PD1A 3A8HB 4J9EA 3OYFA 4E2FB 1W2BP 4RMOA 1AWJA 2QQBA 8AT1B 1X01A 2L3PA 1BU1A 1PC0A 2DILA 3EG3A 1FYNA 2O4XA 3EG9A 2LNHB 1JJ2S 2MK5A 1AHJB 2AK5A 4AMCA 2AHJB 4C5IA 1XQHA 1M2VB 3M0QA 4X34A 3TREA 4F7UA 3CCMA 3LGLA 4OB1B 3EHQA 1B34A 3CCMQ 1K9MU 4J5YA 1UHFA 1WA7A 4ZN1A 5CR2A 5I22A 2CYZB 3VKIA 1VYTA 4JLGA 2DJQA 4J9CA 2DD4A 4M77C 5CKFA 1YCYA 2K3YA 3CPWS 2VUBA 1GCQA 2I2LA 1I5LA 5GANd 1KQ2A 4A4FA 1VQMT 2XDPA 2X51A 2K2VA 4M78F 4DA4A 2XI9A 5CQXA 1UGVA 1QVGA 1K8AC 2J6FA 4JJNK 2NUPA 3ZBDA 2GFUA 2MI6A 5I21A 5GAOm 1GXIE 3QDFA 4Z88A 4RTXA 2LDMA 2D9TA 2HZYA 3OSVA 4DOWA 3J80E 2HD0A 1EIFA 4LNPA 1K73C 2HL3A 4QQDA 1HK9A 3GNGA 1VYVA 2QQRA 2HKQB 2JTFA 2EJFA 2P0KA 2W10A 4OMOA 3JCMe 2FB7A 1ZLMA 1GBRA 4BI8B 4PJOB 4OMPA 4GLKA 4II1A 3QPHA 4PJOD 2DX1A 3JCMV 1FMKA 3A8OB 1UE9A 3EHRA 3CC4A 3CCLQ 1E7OA 2CP7A 1K9MR 3CC4Q 2CGHA 3PT9A 3KFVA 3OW2S 5IXBA 2LX9A 1D3BA 1I07A 3MP8A 1ARKA 3HP9A 4PFOA 1BI1A 4F17A 3S6WA 5C0MA 5GAN7 1KQSS 1UECA 5GAMe 1WHJA 2DAQA 4PJOG 1MMNA 4KUIA 1E6HA 5GANh 1OX8A 1OZ2A 2JN0A 2ZPEB 4QVZA 2QEXT 3M58A 2EQIA 2YUNA 2PU9B 3EGXA 2KVQG 2YUQA 1PD0A 1N5ZA 1Y96B 3E9GA 3I55T 2NUTA 4ZN3A 3VYGA 1S1NA 1N8RC 1G3TA 1K76A 3G7ZA 1NJIC 4Y92A 4M7DB 4FL6A 2CKKA 1BIBA 3A5ZB 1VQ6A 1R0BG 4M7DD 2YLCA 5DLOA 3HRTA 4LDWA 1NM7A 2M0YA 2Y4YA 1VQ6Q 2J05A 2FZCB 1Q95G 4LN2A 2M1HA 4RTTA 4ZTFA 1RAAB 1KC8C 1LVKA 4CC2A 1QVFS 3CCEQ 1D0XA 1IXDA 5GAMj 3TSWA 5LJ5f 1JJ2P 4M7AA 1YHQA 4A4KA 2C0TA 2O9SA 4N0AC 2Y4XA 1YHQQ 5KYNA 4KBMB 1TWBA 4C5GA 1WGSA 1UJYA 2E65A 4C5EA 4EMKA 5FU6B 5GAN8 1RAGB 4HT9A 3SFMA 2O4XB 4C0GA 2KYBA 4M7DG 2OTJT 1QWFA 2FRYA 4PKCC 1UGPB 3OBYA 5CQYA 1PSFA 2JTMA 2JS2A 2M0OA 3QHSA 2MMPA 4OB3B 4YTLA 3CPWP 4F7UB 2YHTA 1YJ9A 1T0JA 4EDUA 1M1GA 1KD1C 1B34B 1AD5A 3CCUA 3GP8A 1YJ9Q 1WQ7A 2FVUA 1CSKA 4M4ZA 3CCUQ 4HVWA 2LX7A 3WVEB 1MHNA 2DKGA 2ZPFB 2JOYA 1IGUA 2YRCA 3NTIA 1M3BA 4JRIA 2DO3A 2MPXC 1AT1B 4MDWA 2KRNA 2E4HA 3M5AA 5GMKl 5GMKh 3PVLA 1QQJA 2NUPB 3HFNA 4E7IA 2VV5A 3CXCS 1G5VA 3JB9J 4F7UG 3PIOA 3U23A 1QMCA 1P92A 2P4RA 3JB9I 3H6ZA 1N9RA 3TVTA 2XDBA 4AFQC 3CBOA 2K3BA 2X4XA 3RIRA 3VS6A 2A36A 3MPUB 4HCBA 5I2SA 2DBKA 3A8MB 1JO8A 3M9QA 1LJOA 2P0QA 4FYVB 1K8AU 3OW2P 1PHTA 3P8BB 4J6WA 3FC3A 2X9HA 4DQ2A 1SSHA 4XU2A 1VQLA 5DLQE 1VQLQ 2AT1B 3CCRA 1YI2T 3NHNA 1MV0B 3OYBA 2ROTA 3CCRQ 2GGRA 4M77A 1KQSP 4D8DA 3BDUA 3CMEA 2O2OA 2YXYA 4KH0B 1UUEA 1D3BB 4PFPA 1VQ7A 3CMEQ 3NMZC 2RHIA 1VQOT 1VQ7Q 3ZFJA 3JCMW 1BI0A 1WNLA 2YWWA 2J6KA 2VB6A 3ASKA 3V7SA 2DRKA 4K11A 3P8DA 3L2WA 3G6EA 1TSFA 4V2SA 1IHVA 3G6EQ 4AFSC 3HFOA 4E7SA 5CCAA 1SRLA 3DKMA 4MZMA 4DBQA 3PE0A 3PMIA 1QVFP 2DEQA 1BI2A 1I5OB 3VS4A 1D1CA 3JB9D 1G2BA 3CCSA 3CCJA 1Z9QA 1X6GA 3DLLA 3CCSQ 3CCJQ 2O31A 1Y7XA 1KQ1A 3V7CA 3OYCA 4OVAA 1UB4A 4R56A 1UHCA 2O01E 1QWEA 5GAN4 1K1ZA 2CT3A 5EG2A 4C92E 3VRZA 1AEYA 4M7AB 4FIBA 1Y71A 1Q82U 2JVVA 1YJNA 3EFRA 1GL5A 4M7AD 2LJ0A 3JB9H 1T3LA 2F2WA 1YJNQ 2ROLA 1D09B 1KHCA 2DF6A 1G8XA 3JB9G 1BCOA 2LTOA 3G1JA 5GANg
chains in the Genus database with same CATH topology
1DJ7B 3CMET 2OTLT 2GQVA 3HPWA 1QP2A 2VC8A 5HY6A 4ME7A 3CC2T 1VQ7T 4M77G 2R58A 2JZ2A 4C5HA 4C8QE 4A54A 1YHQT 3OMCA 4O6JA 3A8HB 3GLXA 3AHUA 3OYFA 4CRIA 2DK3A 4MMLA 5L8RE 5A2QE 4C92A 5J26A 4RMOA 4JRKA 2QQBA 2EQKA 1X01A 3OYJA 3L2RA 3CD6T 4OB2B 3RERA 2O4XA 2XICA 2R5AA 3BFMA 5LL6S 5HK3A 1Y07A 4Y91A 2EWNA 1G3WA 3VUBA 3PNWC 5A0DA 1U8RA 1JJ2S 1AHJB 1K73U 1M8VA 3LLRA 4XU0A 3E9FA 3DLMA 2EQUA 2QXFA 4XTZA 2AHJB 4IUQA 5GMKe 2FYKA 3PGGA 3OBWA 4L5GA 4OGEA 4C5IA 2RH2A 4Q5WA 1XQHA 1LOJA 1TH7A 4A4EA 4HCCA 5KE3A 4LD9K 4ATOA 1M1KU 3CPWA 4X34A 4C92C 3TREA 4F7UA 3CCMA 3INZA 3UWNA 2MWOA 3LGLA 2XIDA 1HXDA 5KH6A 1YJWA 1Q82C 4OB1B 4XU1A 3FDRA 1B34A 1K9MU 1H3ZA 2RHZA 4J5YA 1XTDA 1YJ9T 4ZN1A 5CR2A 2CYZB 4NL3A 3VKIA 3G71T 3CCUT 3OS0A 4JLGA 5C6SA 4XTVA 4XK8E 2DXUA 2K4YA 4N0AA 2D0QB 5LJ3f 3CEYA 5LJ5e 2DD4A 2DZCA 4LDYA 3VUZA 3L2QA 3CCJT 4M77C 5GAOr 1RL2A 4J8OA 2QA4A 4C8QA 1N6AA 5LJ3d 3JRZA 1JRIA 3G4ST 4C0DC 2OAUA 5CKFA 1YCYA 1G5VA 3JCMX 2GF7A 4A4GA 2K3YA 2X4WA 3CPWS 1JJ2A 2VUBA 2I2LA 1YIJT 1I5LA 4M75G 4M7DF 4PJOC 4J7FA 5GANd 1KQ2A 4A4FA 1VQMT 4M7DE 5CKEA 2XDPA 4B9XA 2K2VA 4M78F 3I55A 4DA4A 2XI9A 3QG1A 4KULA 5CQXA 2YLBA 4J6YA 5J3BA 5KCHA 5FRNA 1BYMA 4M78E 1QVGA 2ZPHB 4BACA 4N4IA 5GMKj 1JBMA 3MHXA 4JJNK 3RKXA 4BE2A 3QYHB 4PLIA 5IN1A 1VQPT 3QYGB 3ZBDA 2GFUA 2MI6A 4C92B 5I21A 3OYLA 4MZPA 5GAOm 3OYNA 2KSSA 1GXIE 3BY7A 3OSSC 2LDMA 1G3SA 2D9TA 3URGA 3X24B 4C92D 4EMGA 2CS7A 3JCMQ 3OSVA 1YI2A 4DOWA 3J80E 3CCQT 2HD0A 3I56A 1EIFA 3V8KA 4ZTJA 2F69A 1K73C 4LD6A 4QQDA 2GFAA 3SD4A 4QVCA 1HK9A 1UGRB 3CC7T 3GNGA 1I81A 3SB2A 4E7JA 2QQRA 5LJ5j 4M77B 3KBGA 5FU7C 3PIPA 3FIFA 2CZ0B 2EJ9A 2JTFA 1Q86U 1M1KC 3C94A 2ZPIB 1W4SA 2JUFA 2ZGWA 4HKEA 4M77D 2EJFA 2EKOA 4C0DB 1QVGS 2P0KA 2R5MA 3JCMe 2FB7A 3OW2A 1O9SA 2V8JA 3M53A 4BI3A 3RMQA 1N8RU 1K9MC 1N9SA 5DM7R 2IG0A 3N5BB 4M75C 3MP1A 3QZ9B 4BI8B 4CI0C 1NJIU 4PJOB 4GLKA 1KG1A 4II1A 3QPHA 4ZGDB 3S3MA 3OQ5A 2RJCA 4PJOD 2LQ8A 4PL6A 4ZGJB 3P8HA 3JCMV 2PVDB 4Z02A 4IKFA 4IUVA 1VQLT 4XAXB 3A8GB 3A8OB 4M78A 4JLIA 4XU3A 3CBMA 3MEVA 3L2VA 3CC4A 4F7UF 3CCRT 2VXEA 3CBPA 3UT1A 1KQSA 5GMKi 3ER0A 3OY9A 4C92G 4F7UE 2CGHA 2VGMA 2KQWA 1I4K1 3PT9A 3VYHB 4ELYC 1KC8U 2OTJA 4L59A 4JRPA 2NLUA 2P4TA 3OW2S 4MDXA 2LX9A 3FB9A 4M7DC 2M16A 2LT4A 3CCMT 1YJWT 5D6XA 2CZ7B 5GAN5 4HT8A 1D3BA 1ZBXA 2VYTA 3RKYA 5A0LA 5GMKm 3KXTA 1VQ4T 3ZEHA 1VQ5A 4M78C 3MP8A 2RA2A 4C8QF 3MEWA 5LJ5g 4FT4A 3HP9A 2RHXA 5KCOA 1BI1A 1BI3A 2X4JA 4X9CA 5FU7B 4EMHA 3JAME 3LW5E 1G3YA 1ZHIA 2K3XA 2LNVA 2XKOC 4RCCA 3S6WA 5LJ3h 4BB7A 5C0MA 5GAN7 4OMFB 4DOVA 3GF5A 2A3LA 2RHYA 3FJPA 5M9OA 2QA4T 1KQSS 4M7AF 5GAOn 5GAMe 4M75B 2PVGB 5CO7A 4A53A 2DAQA 4PJOG 4KUIA 5GANh 1QVPA 1OZ2A 2ZPEB 2JN0A 2MWPA 3C4SA 4QVZA 4M7AE 4M75D 3G6ET 2QEXT 3VV0A 1N27A 1VQ8A 1NPRA 3M58A 2DZ9A 3HRUA 2PU9B 4IUUA 4C8QG 2EIFA 2KVQG 4XTXA 1Q86C 1MGQA 1Y96B 3M56A 2DJZA 2EQMA 3S3OA 2Y90A 3E9GA 3I55T 2E10A 4ZN3A 3VYGA 3VU3C 1QVFA 2XHCA 1N8RC 3DB4A 1G3TA 5FU6C 2L5QA 3G7ZA 1NJIC 2KDSA 4BDZA 3OYEA 3L1AA 4D6WA 1KD1U 3Q1JA 4M7DB 4FL6A 4OGCA 1VQ9T 2H3JA 3CPFA 2CKKA 1BIBA 3A5ZB 5DY9A 1VQ6A 4M7DD 2YLCA 5DLOA 3HRTA 4LDWA 2K5IA 2BIVA 2QTXA 4M78B 4ELZC 3OYDA 2Y4YA 4RG8A 3CCST 3CCVA 4KUDK 3SWNA 2DTHA 3KUFA 2K5FA 2LT1A 5D6WA 3OYAA 2RJFA 3JCMJ 2M1HA 4OB0B 3V7RA 2PUOB 2IVWA 4ZTFA 1UGSB 3OYGA 2ZPBB 1KC8C 4N4HA 3VJPA 1BIAA 5GANf 3JCMg 1S72T 1QVFS 3RMSA 4QQ6A 2FHDA 2RJEA 5GAMj 5A0GA 4JDSA 1NZ9A 5LJ5f 4M7AA 3LWIA 1YHQA 4A4KA 1NE8A 1Q81U 2CZ1B 3A8LB 5LJ5d 4N0AC 3R6OA 2MAMA 1YJNT 2Y4XA 1PSEA 3MEUA 3OMGA 1VIEA 4C8QC 4KBMB 4C5GA 3MCAB 1WGSA 2RI2A 2E65A 3CD6A 2DVEA 2YRVA 2E41A 3META 4IURA 3PMTA 3C95A 4MZTA 1LNXA 5FROA 4C5EA 4EMKA 5FU6B 5GAN8 2M9UA 4BD3A 5GAOl 4HT9A 2RK1A 1RI0A 2EAYA 4WF2A 5CKDA 3CC4T 2E6NA 3SFMA 2DXCA 4BE1A 1OI1A 2EFIA 1YBYA 2O4XB 4C0GA 4BE0A 3V8JA 4M7DG 3QO3A 4J83A 4TVRA 1M5Q1 2OTJT 4PKCC 1UGPB 3OBYA 4X9DA 1PSFA 5CQYA 4M78G 2JTMA 2RO0A 3GIBA 2M0OA 1V29B 3QHSA 2QQ9A 4RKUE 4PNOA 2DTOA 3ME9A 2E5QA 2LVMA 2MMPA 4FT2A 4OB3B 2QI2A 2HAXA 4YTLA 2BUDA 3OYKA 4FU6A 4EMKC 4F7UB 1WPYA 2V8IA 2YHTA 1YJ9A 3FRNA 4EDUA 3OYIA 1QW1A 1M1GA 2RM4A 3M54A 1JB0E 3E1SA 4QW2A 1W2BA 1B34B 1KD1C 3CCUA 5D6YA 3GP8A 5GAMg 1WQ7A 2FVUA 1VQOA 3S3NA 2FL7A 3MP6A 3QSUA 3J81E 3EAEA 3F70A 4N4GA 3G4SA 4C8QB 3CCLA 5CKHA 3JCMf 3WVEB 4BUGA 3CXCA 3GPLA 1MHNA 4C8QD 3L2UA 3JCMd 2DKGA 3JB9F 2PQWA 3DB3A 3UPUA 2RHUA 2ZPFB 3OYHA 2JOYA 5IAYA 5GAOp 1X75C 3NFCA 1UEBA 5GANg 2DXBA 3NTIA 4L6V5 1W2BS 4RCBA 1Q81C 4BY6C 1M90U 4JRIA 1WJQA 1YITA 2DO3A 1WJSA 3E19A 4MDWA 2WSCE 3PTAA 3M5AA 2KK4A 5CIUA 5GMKl 4BI4A 1VQPA 5GMKh 3QBYA 4M77F 2BKDN 2X4YA 3JSCA 4E7HA 3EFSA 3HFNA 4M77E 2A7YA 3WXMB 3X25B 3CMAA 2VV5A 2F5TX 2G3RA 3CXCS 4E7IA 4EMKB 3TU4K 5IT9E 4F7UG 3JCMP 3JB9J 1SSFA 1QP3A 3PIOA 2XD0A 3TCJA 4O5VA 1VQNA 5FLXE 3M4GA 1P92A 1H641 3JB9I 2QQAA 2L89A 3H6ZA 1N9RA 4E7LA 2XDBA 3CBOA 2X4XA 3NTKA 4J7IA 3RIRA 1ZQ1A 2F5KA 2KMTA 3TEEA 3JCMb 5LJ5h 4HCBA 5I2SA 2LRQA 3A8MB 4XTYA 1OYXA 2DIQA 3HHTB 4Y28E 1Q7YU 3M9QA 1FX7A 1LJOA 1M9SA 2P0QA 3QUIA 3BW1A 5GAMf 1K8AU 2K5LA 3HRSA 2LCCA 4C0FA 2KAFA 2LCLA 3P8BB 1U1SA 5GAMd 5J39A 4LDXA 4J6WA 1UGQB 3FC3A 4M7AG 4GY5A 5I2MA 4DQ2A 2RK2A 4XU2A 1VQLA 5DLQE 4BY6B 2L3RA 1VQKA 1VIFA 3O8VA 2KY9A 2HBPA 2ZZDA 3CCRA 3JCMc 1YI2T 3OYBA 3HKSA 3LH0A 4OF1A 4M78D 4UC4A 3I56T 2EJGA 3GNFB 2EQJA 3GOXA 4M77A 2K57A 4C0ZA 3OYYA 5LJ3e 3CCEA 3V8LA 2HQEA 3BDUA 4VUBA 3RESA 4HA8A 4NS5A 1VQ6T 4M75F 2RJDA 3BDLA 2ZCFB 3CMEA 1VQ4A 2OTLA 1M90C 3FLGA 3PFSA 2E6ZA 2DPPB 4M75E 4PJOA 1D3BB 5GANe 2XDDA 1VQ7A 2E70A 3LYIA 3CC2A 2HQXA 2RHIA 5CKBA 1VQOT 3SWNC 3ZFJA 3HL8A 4KT0E 3JCMW 1BI0A 2VGNA 1R8OB 3NTHA 1WNLA 3LWHA 3ASKA 1WJRA 4XQ3A 3V7SA 4ZGEB 3JCMh 4E7KA 2LC4A 4QVDA 4QQGA 3UDCA 2EYQA 3CCLT 3P8DA 3L2WA 3G6EA 2QEXA 2RI3A 4J6XA 4V2SA 3HSBA 5GAN2 3MO8A 4M7AC 2E64A 3OYMA 3OS1A 3LGFA 3RUXA 3HFOA 3WVDB 5GAOq 1M4ZA 4B9WA 4LDVA 3SDZA 2DD5A 5FRMA 5CCAA 1Q7YC 2HNIA 2QDYB 3DKMA 4MZMA 1BKBA 1YITT 3PMIA 2XU8A 4PLLA 1VQ5T 1VUBA 2E1HA 3QDRB 4JS5A 2DEQA 3QKJA 1FXXA 3H8ZA 1BI2A 5LJ3j 1VQ9A 3M4YA 3X20B 5GAN3 4XTUA 1IREB 3G71A 3L2ZA 3J7AF 4JS4A 3CMAT 2MF2A 3JB9D 4NL2A 1FWZA 4FM4B 4E47A 4NOYA 4M75A 4EPCA 3CCSA 2RB6A 3L42A 3OB9A 4FSXA 3CCJA 5HKCA 3MEAA 5GANj 1VQNT 3DLLA 1XNIA 2QQSA 2XK0A 3SWNB 2X35A 4MMKA 2P0PA 4A4HA 1Y7XA 3RKWA 1KQ1A 1S72A 3V7CA 2JNGA 1U1TA 1X6OA 3QIIA 3OYCA 4OVAA 1VQ8T 2XG8D 1UB4A 1Y96A 2ZPGB 4OP0A 2O01E 3M59A 5GAN4 4R56A 1YIJA 4C92F 2DXTA 2L8DA 4XTWA 5CK9A 4LDUA 1VQMA 5KE2A 2WSFE 1XOVA 2RD1A 5EG2A 2RI5A 3M57A 4C92E 5GAN6 3FEOA 3QJYA 5GAMh 2LQKA 2CZ6B 4M7AB 4FIBA 1Y71A 1Q82U 2JVVA 1YJNA 2VXFA 3EFRA 3LX7A 4M7DA 4M7AD 3OS5A 3JB9H 2WACA 4IUTA 1KHIA 1I8FA 5AYFA 2PVOB 1VQKT 1KHCA 2B8AA 2R57A 3OS2A 4BDYA 1IZ6A 4IUPA 4HCZA 4R55A 3QXEB 2D6FA 2E12A 3C12A 5CAIA 5LJ3g 3X28B 3CCVT 3CCQA 3JB9G 1K8AC 2WSEE 2GCXA 1OZ3A 1O75A 2V8KA 4RG2A 3QZ5B 4PJOF 1M1FA 3M55A 2DIGA 3CC7A 3X26B 2LTOA 4P5NA 4JRQA 3QJ6A 5CVIA 2C06A 2DTIA 3CCET 4JUVA 1WQWA 3T9NA 5HK0A 1NPPA 4PJOE 3OA6A 2PUKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH0 A;  3MP1 A;  4C5E A;  4UC4 A;  5FRO A;  3GOX A;  2EQJ A;  4II1 A;  4BD3 A;  3S3M A;  1RI0 A;  3OQ5 A;  2RJC A;  4BE1 A;  2E6N A;  4PL6 A;  2HQE A;  1OI1 A;  2EFI A;  2R58 A;  2JZ2 A;  2O4X B;  3P8H A;  4Z02 A;  4C5H A;  3OMC A;  4NS5 A;  4IUV A;  2RJD A;  4IKF A;  3BDL A;  3OYF A;  4CRI A;  3FLG A;  3PFS A;  3MEV A;  3L2V A;  2RO0 A;  5J26 A;  3L2R A;  2EQK A;  2M0O A;  3LYI A;  3OYJ A;  3UT1 A;  3ME9 A;  2E5Q A;  2LVM A;  3OY9 A;  2HQX A;  2RHI A;  2O4X A;  2R5A A;  2BUD A;  3OYK A;  4FU6 A;  4L59 A;  2NLU A;  3PNW C;  3OYI A;  4EDU A;  3NTH A;  2M16 A;  3ASK A;  1WJR A;  4QW2 A;  3LLR A;  3E9F A;  3DLM A;  2EQU A;  5D6Y A;  5D6X A;  4E7K A;  4IUQ A;  2VYT A;  4QQG A;  4C5I A;  3MP6 A;  3P8D A;  3ZEH A;  4Q5W A;  3L2W A;  2RI3 A;  3S3N A;  3MP8 A;  4A4E A;  3MEW A;  5KE3 A;  3MO8 A;  5KCO A;  2RHX A;  4X34 A;  3EAE A;  3OYM A;  3F70 A;  4N4G A;  3UWN A;  3LGF A;  2MWO A;  3LGL A;  3S6W A;  2K3X A;  5KH6 A;  3OS1 A;  4BE0 A;  5C0M A;  4B9W A;  3FDR A;  1MHN A;  2RHZ A;  1H3Z A;  5FRM A;  2RHY A;  5M9O A;  3L2U A;  2PQW A;  2DAQ A;  3DB3 A;  2RHU A;  3OS0 A;  3PMI A;  5C6S A;  5IAY A;  3OYH A;  4PLL A;  1OZ2 A;  4QVZ A;  2MWP A;  3C4S A;  3OYB A;  3CEY A;  3QKJ A;  3L2Q A;  1N27 A;  3H8Z A;  3NTI A;  4IUR A;  1WJQ A;  4IUU A;  1WJS A;  2GF7 A;  4A4G A;  2EQM A;  3S3O A;  2K3Y A;  3E9G A;  5CIU A;  2X4W A;  3L42 A;  3OB9 A;  3QBY A;  2BKD N;  3MEA A;  2X4Y A;  3DB4 A;  4E7H A;  1XNI A;  2QQS A;  2XK0 A;  4E7I A;  2X35 A;  4A4F A;  1G5V A;  2G3R A;  4A4H A;  4BDZ A;  3OYE A;  1SSF A;  2XDP A;  4B9X A;  3QII A;  3OYC A;  3Q1J A;  4OVA A;  4FL6 A;  5KCH A;  5FRN A;  2CKK A;  2L89 A;  3H6Z A;  2L8D A;  4BAC A;  4N4I A;  5KE2 A;  4E7L A;  2BIV A;  4BE2 A;  2RI5 A;  4PLI A;  3OYD A;  3FEO A;  2X4X A;  3NTK A;  5IN1 A;  2GFU A;  2F5K A;  3KUF A;  3OYL A;  3OYN A;  3OYA A;  5D6W A;  2RJF A;  2M1H A;  2LDM A;  2D9T A;  2LRQ A;  3LX7 A;  4ZTF A;  3OYG A;  1OYX A;  2DIQ A;  4N4H A;  2WAC A;  3M9Q A;  4IUT A;  4QQ6 A;  2FHD A;  2RJE A;  4ZTJ A;  1KHC A;  2B8A A;  2R57 A;  4LD6 A;  4QQD A;  2LCC A;  2GFA A;  3SD4 A;  3OS2 A;  4BDY A;  4IUP A;  4HCZ A;  5J39 A;  4E7J A;  2QQR A;  3FC3 A;  4GY5 A;  2JTF A;  1OZ3 A;  2L3R A;  3O8V A;  3MEU A;  3OMG A;  4RG2 A;  2EKO A;  4C5G A;  2DIG A;  2P0K A;  2R5M A;  2LTO A;  1WGS A;  2RI2 A;  3QJ6 A;  2YRV A;  3MET A;  3OA6 A;  3PMT A;  2IG0 A; 
#chains in the Genus database with same CATH topology
 1SG5 A;  2GQV A;  2JT4 A;  9ATC B;  1MMG A;  4ME7 A;  2R58 A;  4C5H A;  4C8Q E;  3OMC A;  4ZNX A;  1TTH B;  4CRI A;  5A2Q E;  1BK2 A;  1WXB A;  1YWP A;  5J26 A;  4JRK A;  3CD6 T;  4OB2 B;  4OMQ A;  4HVU A;  2P84 A;  3BFM A;  2R5A A;  5LL6 S;  5HK3 A;  2PNI A;  3M0R A;  2MCN A;  1G3W A;  5A0D A;  3SEM A;  1RUW A;  4XU0 A;  3CXC P;  2FYK A;  3OBW A;  4OGE A;  3VS0 A;  4HCC A;  4ATO A;  1M1K U;  4C92 C;  4JPB W;  3THK A;  3UWN A;  1YJW A;  2XID A;  1HXD A;  2RMO A;  1YJW Q;  1H3Z A;  2SRC A;  4NL3 A;  1HD3 A;  2E5K A;  2K4Y A;  4N0A A;  2D0Q B;  5LJ3 f;  5LJ5 e;  3L2Q A;  5GAO r;  2QA4 A;  4J8O A;  2DL8 A;  3JRZ A;  1MV3 A;  3G4S T;  4C0D C;  4DEX A;  2OAU A;  2QA4 Q;  3JCM X;  2GF7 A;  4A4G A;  1Q82 R;  1PWT A;  4JZ4 A;  1YIJ T;  2XMF A;  4M75 G;  5KYU A;  4J7F A;  2FG0 A;  3EFO B;  4J9I A;  2J06 A;  1NG2 A;  1BYM A;  2YLB A;  5FRN A;  4M78 E;  2ZPH B;  4BAC A;  3RKX A;  1SPK A;  1VQP T;  2COY A;  1BCM A;  2HDA A;  3OYN A;  2KSS A;  1G3S A;  3X24 B;  4EMG A;  1VOM A;  3JCM Q;  1ZSZ C;  1PRM C;  3CCQ T;  1M30 A;  4RTY A;  1JXO A;  5LJ5 j;  4M77 B;  5FU7 C;  4PK4 A;  4HKE A;  4M77 D;  2SEM A;  3M53 A;  1N9S A;  1WHG A;  3EGD B;  5DM7 R;  4M75 C;  2ESW A;  3MP1 A;  3QZ9 B;  4CC3 A;  4J9H A;  2D8H A;  4RTV A;  1OU8 A;  2RJC A;  1B7T A;  2LQ8 A;  1ABO A;  3P8H A;  4JZ3 A;  3A8G B;  1M1K R;  3MEV A;  1MUZ A;  2CSI A;  4ELY C;  2KQW A;  1I4K 1;  3VYH B;  1RAH B;  4ORZ A;  4B6M A;  4WCI A;  4L59 A;  4JRP A;  4RTU A;  4OML A;  1PKS A;  3CCM T;  5D6X A;  1VQ5 A;  2VYT A;  1VQ4 T;  3ZEH A;  1C0M A;  4M78 C;  4C8Q F;  1YIT Q;  4E7Z A;  1VQ5 Q;  1BI3 A;  2X4J A;  4X9C A;  4AT1 B;  1WDX A;  4OMF B;  2A3L A;  2RHY A;  4M7A F;  1ZUU A;  4HVV A;  1WZO A;  1OPL A;  1N27 A;  3EGU A;  2DZ9 A;  1B3Q A;  1Q86 C;  1X2Q A;  3M56 A;  2EQM A;  3S3O A;  2L3Q A;  2EW3 A;  2CP0 A;  3DB4 A;  2M02 A;  3RR6 A;  2FPF A;  2NYS A;  2KDS A;  4BDZ A;  3OYE A;  3Q1J A;  3CPF A;  3TQ7 P;  3RBB B;  3CCV A;  4KUD K;  2K6D A;  4CC7 A;  2K5F A;  5D6W A;  2RJF A;  3JCM J;  3V7R A;  3CCV Q;  2BZY A;  1SRM A;  3M0P A;  1S72 T;  2ZAE A;  3RMS A;  1QCN A;  1J3T A;  2FHD A;  5KYX A;  5A0G A;  1PG5 B;  3LWI A;  2KXC A;  1Q81 U;  2CZ1 B;  3A8L B;  3R6O A;  4AFZ C;  3CC2 Q;  1PSE A;  1UTI A;  2YRV A;  4IUR A;  1YP5 A;  1LNX A;  2M9U A;  2RK1 A;  3CC4 T;  4BE1 A;  3RNJ A;  4BE0 A;  3V8J A;  4J83 A;  4TVR A;  1M5Q 1;  2DA9 A;  1MNE A;  3M0U A;  2GTJ A;  4X9D A;  1ACM B;  2QQ9 A;  2LVM A;  3CQT A;  1AWX A;  3VS1 A;  3OYI A;  1W2B A;  3E1S A;  5D6Y A;  3QSU A;  3H9N A;  3J81 E;  3EAE A;  2KYM A;  1RAB B;  3CCL A;  2D1X A;  3GPL A;  2KRS A;  2F2X A;  3JCM d;  1CKA A;  2RHU A;  3OYH A;  1PCX A;  1X69 A;  5KYU B;  1GFC A;  1UEB A;  2DRM A;  2DXB A;  4L6V 5;  2JM8 A;  4BY6 C;  1M90 U;  1WJQ A;  1KJW A;  2EGC A;  1NEG A;  1WJS A;  3E19 A;  3PTA A;  2JXB A;  1ZA1 B;  2KK4 A;  1X27 A;  4PJM A;  4M77 F;  3QBY A;  2BKD N;  2HKN A;  2X4Y A;  4E7H A;  1VQ6 T;  3A1P A;  3WXM B;  2ECZ A;  3TU4 K;  3TCJ A;  4RTW A;  5FLX E;  2JM9 A;  2KRM A;  1Q81 R;  2QQA A;  4LUE A;  4PJJ A;  4E7L A;  3NTK A;  2F5K A;  2KMT A;  3JCM b;  1WI7 A;  1Q7Y U;  1FX7 A;  3QUI A;  2FZG B;  2FEI A;  3HRS A;  2LCL A;  1QCO A;  1U1S A;  5GAM d;  2GNC A;  4GY5 A;  2BZ8 A;  1VQK A;  1HYO A;  1QLY A;  3JCM c;  1VQK Q;  2DL5 A;  3LH0 A;  4OF1 A;  3I56 T;  4UC4 A;  3GNF B;  4DEY A;  3OYY A;  1G83 A;  5LJ3 e;  3CCE A;  4VUB A;  1UFF A;  1CKB A;  3VRY A;  2NWM A;  2ZCF B;  3PFS A;  2E6Z A;  2DPP B;  3LYI A;  3M0T A;  3GBQ A;  2HQX A;  3SWN C;  2VGN A;  2GBQ A;  1JQQ A;  2YUO A;  3JCM h;  2HMA A;  2QEX A;  2FPE A;  5KYY A;  1M90 R;  3MO8 A;  3OYM A;  2QEX Q;  3OS1 A;  3WVD B;  2EBP A;  5GAO q;  2LMJ A;  4LDV A;  3QWX X;  3O5Z A;  1IB8 A;  1VUB A;  1QKX A;  2K79 A;  5LJ3 j;  1JU5 C;  3M4Y A;  3X20 B;  4XTU A;  3G71 A;  3UAT A;  4EPC A;  1FWZ A;  4FM4 B;  1RI9 A;  4E47 A;  4M75 A;  3L42 A;  3G71 Q;  1Q7Y R;  2X35 A;  2MOX A;  4MMK A;  2P0P A;  4HCK A;  2JNG A;  2CH4 W;  1X6O A;  1YN8 A;  1VQ8 T;  2ZPG B;  4OP0 A;  3M59 A;  4XTW A;  2J6O A;  2L8D A;  2WSF E;  5KYX B;  2M51 A;  5GAM h;  2CZ6 B;  4DBH A;  2VXF A;  2DL4 A;  2WAC A;  1K0X A;  4IUT A;  2C0I A;  1MMD A;  4R0K A;  2QDL A;  1WXT A;  2R57 A;  2HEQ A;  2KXD A;  3OS2 A;  4BDY A;  4HCZ A;  1W70 A;  2W0Z A;  2E12 A;  3C12 A;  2JTE A;  2GCX A;  2V8K A;  4RG2 A;  1TUC A;  4PJO F;  1TS9 A;  2DIG A;  1X6B A;  3X26 B;  3CC7 A;  3HTR A;  1PNJ A;  3QJ6 A;  1MMA A;  2DTI A;  5CVI A;  4PJL A;  1WQW A;  1JJ2 A;  1NPP A;  3NGP A;  3OA6 A;  3EFO A;  1RAI B;  3TSZ A;  2OAW A;  3CC7 Q;  4JJB A;  3CME T;  3HPW A;  2VC8 A;  5KYW B;  2IPO B;  1VQ7 T;  4KRT A;  4A54 A;  4WTO B;  1C6V X;  3AHU A;  5L8R E;  3L2R A;  5I11 A;  1Y07 A;  1U8R A;  3VUB A;  3PNW C;  1K73 U;  1M8V A;  2NUZ A;  4GLM A;  2F2V A;  2EQU A;  2DM1 A;  3DLM A;  2QXF A;  4IUQ A;  2EPD A;  4L5G A;  4Q5W A;  2Z0W A;  1M2O A;  3CPW A;  1NLO C;  4FYW B;  2MWO A;  1FMV A;  1AZG B;  3FDR A;  3EGD A;  4J9B A;  1XTD A;  1NYG A;  7AT1 B;  1F1B B;  1QCF A;  3EG1 A;  5C6S A;  4XTV A;  3CEY A;  3VUZ A;  4LDY A;  3CCJ T;  4OMM A;  1JRI A;  1WLP B;  4M7D F;  2G6F X;  2YUP A;  1IRX A;  3REB B;  1TG0 A;  5CKE A;  5KCH A;  2RN8 A;  4J6Y A;  2KT8 A;  2EYW A;  4N4I A;  1JBM A;  4BE2 A;  4PLI A;  2DE0 X;  5IN1 A;  2CRE A;  2L2P A;  3QYG B;  4C92 B;  2QK0 A;  4MZP A;  3BY7 A;  3OSS C;  1OU9 A;  4PJN A;  3URG A;  4C92 D;  2CS7 A;  1YI2 A;  1D0Y A;  5FWB A;  3I35 A;  3V8K A;  1YI2 Q;  2F69 A;  4LD6 A;  2GFA A;  3SD4 A;  1I81 A;  3SB2 A;  1YNZ A;  1K8A R;  3FIF A;  2CZ0 B;  3C94 A;  3H0I A;  1QVG S;  2ZGW A;  4C0D B;  2R5M A;  3OW2 A;  1O9S A;  1K9M C;  3RMQ A;  1N8R U;  1W6X A;  1NJI U;  4CI0 C;  1K73 R;  3S3M A;  3AT1 B;  4ZGJ B;  4IKF A;  1VQO Q;  4Z02 A;  1Y57 A;  4XAX B;  1VYU A;  2X3W D;  3NPF A;  3CBM A;  3L2V A;  4F7U F;  1ZUK A;  1KQS A;  3OY9 A;  2EGA A;  4KH1 B;  4C92 G;  5KYY B;  2VGM A;  1KC8 U;  2NLU A;  4MDX A;  3FB9 A;  1RAD B;  1YJW T;  2KI7 A;  2BE9 B;  2K9G A;  2CZ7 B;  5GAN 5;  4HT8 A;  3RKY A;  5GMK m;  3KXT A;  2RA2 A;  4FT4 A;  3VS5 A;  2RHX A;  5FU7 B;  3LW5 E;  5ECA A;  1G3Y A;  1ZHI A;  2K3X A;  2LNV A;  2XKO C;  4RCC A;  4DOV A;  3FJP A;  2QA4 T;  1YFN A;  2CP3 A;  5M9O A;  1B07 A;  4M75 B;  2PVG B;  2RQU A;  4M7A E;  2MWP A;  1H8K A;  4M75 D;  1TXQ A;  2CP6 A;  2V1R A;  1OUL A;  4IUU A;  4C8Q G;  1MGQ A;  1U5S A;  2DJZ A;  2Y90 A;  2DEU A;  4DBF A;  1QVF A;  3UA6 A;  2CDT A;  1K9A A;  4J9D A;  1H3H A;  1KD1 U;  3ZL7 C;  1VQ9 T;  4FYY B;  2RQT A;  4M78 B;  2BIV A;  2QTX A;  3OYD A;  4RG8 A;  3SWN A;  3KUF A;  1AOJ A;  2LT1 A;  3OYA A;  4OB0 B;  1N8R R;  1M27 C;  1UGS B;  3OYG A;  3EH1 A;  4N4H A;  3VJP A;  2E3I A;  2I0N A;  3JCM g;  4RUG A;  2CUD A;  4QQ6 A;  2HL5 C;  2QYZ A;  1SEM A;  1MND A;  2COZ A;  5LJ5 d;  2DL7 A;  4KGX B;  2MAM A;  4AG2 C;  3MEU A;  3OMG A;  1VIE A;  4C8Q C;  1TOV A;  3MCA B;  2RI2 A;  2D8J A;  1KC8 R;  3CD6 A;  1WX6 A;  2E41 A;  3MET A;  3PMT A;  3C95 A;  4MZT A;  5FRO A;  2RQW A;  4BD3 A;  5GAO l;  3CD6 Q;  1RI0 A;  2EAY A;  4WF2 A;  1GRI A;  2DXC A;  1YBY A;  1TUG B;  3D7S B;  3QO3 A;  2BE7 D;  2K7A A;  3GIB A;  4M78 G;  2DL3 A;  4RKU E;  2DTO A;  4EIK A;  2KBT A;  2QI2 A;  4LXC A;  1OOT A;  1OQK A;  2HSE B;  4EMK C;  1WPY A;  2AKK A;  2V8I A;  1KFZ A;  2RM4 A;  3M54 A;  1JB0 E;  5GAM g;  3S3N A;  2FL7 A;  3MP6 A;  3EG2 A;  2HCK A;  4FW1 A;  1WHK A;  4N4G A;  3G4S A;  2C0O A;  2CSQ A;  1NYF A;  4KGZ B;  3CXC A;  5IXF A;  3G4S Q;  3M0S A;  1KSW A;  1T3S A;  3JB9 F;  2PQW A;  3DB3 A;  3UPU A;  1KD1 R;  1YIJ Q;  5GAO p;  2L0A A;  1H92 A;  3PVQ A;  4RCB A;  5IH2 A;  2BZX A;  4JJC A;  1YIT A;  3R6N A;  5CIU A;  4BI4 A;  1VQP A;  1SHG A;  1OPK A;  1QVG P;  1KIK A;  4M77 E;  1VQP Q;  5IHK A;  1WYX A;  3CMA A;  2F5T X;  5AT1 B;  1X43 A;  2XD0 A;  3CMA Q;  1GCP A;  4O5V A;  1VQN A;  3M4G A;  1H64 1;  2ABL A;  2HBW A;  1BB9 A;  1VQN Q;  5D7U A;  1ZQ1 A;  5LJ5 h;  8ATC B;  1AVZ C;  2LRQ A;  2JW4 A;  4AFU C;  4XTY A;  2MIO A;  1M9S A;  2K5L A;  4C0F A;  1Y0M A;  1UGQ B;  5I2M A;  4BY6 B;  2L3R A;  3O8V A;  2HBP A;  2DLP A;  1I1J A;  5L23 A;  3I5R A;  3HKS A;  2EJG A;  2EGE A;  2EQJ A;  2K57 A;  4C0Z A;  2HQE A;  2EYZ A;  3RES A;  4F14 A;  4HA8 A;  4M75 F;  3BDL A;  3C0C A;  1VQ4 A;  4JJD A;  2OTL A;  1WHM A;  5GAN e;  2XDD A;  3CC2 A;  1VQ4 Q;  2OTL Q;  3MKD A;  5CKB A;  3HL8 A;  4KT0 E;  1M3C A;  3QWY A;  4ZGE B;  4XQ3 A;  6AT1 B;  2LC4 A;  2MYS A;  3UDC A;  3CCL T;  2EYQ A;  3HSB A;  1UG1 A;  1EZZ B;  3RUX A;  2DBM A;  2YRD A;  3SDZ A;  3VS7 A;  1A0N B;  1BKB A;  3UF4 A;  1RAE B;  1M3A A;  5KYW A;  3I5S A;  2ENM A;  4JS5 A;  1TUD A;  3QKJ A;  1IHW A;  1FXX A;  3H8Z A;  4DBR A;  4LE9 A;  3A98 A;  4JS4 A;  3H0H A;  2E3H A;  4NL2 A;  4Z89 A;  3OB9 A;  5HKC A;  3MEA A;  5GAN j;  2XK0 A;  3SWN B;  4A4H A;  3RKW A;  1S72 A;  3QII A;  2A28 A;  1WFW A;  2XG8 D;  1R77 A;  1S72 Q;  1RAF B;  2DXT A;  1VQM A;  5KE2 A;  1XOV A;  2RD1 A;  5GAN 6;  2RI5 A;  3M57 A;  2OJ2 A;  3FEO A;  3QJY A;  1VQM Q;  2JJ9 A;  3LX7 A;  2KRO A;  1I8F A;  5AYF A;  1VQK T;  1IZ6 A;  3QXE B;  1SKU B;  1IGQ A;  1WXU A;  5EC7 A;  2WSE E;  1OZ3 A;  2FPD A;  5FW9 A;  2C06 A;  3CCE T;  2PZ1 A;  4P5N A;  4PJO E;  5HK0 A;  3T9N A;  5DY9 A;  2PUK B;  1DJ7 B;  2FZK B;  2B86 A;  1YHQ T;  2F1L A;  1W1F A;  4O6J A;  3VS3 A;  3GLX A;  1JXM A;  2DK3 A;  4MML A;  2A08 A;  4C92 A;  1LPL A;  2EQK A;  4AG1 C;  3OYJ A;  3IQL A;  3BE3 A;  1UJ0 A;  3RER A;  1QKW A;  1RLQ C;  2QTV A;  2X3X D;  2XIC A;  1YCS B;  1XJW B;  2EWN A;  4Y91 A;  3LLR A;  3E9F A;  1TU0 B;  2KE9 A;  4XTZ A;  5GMK e;  2EYY A;  3PGG A;  2RH2 A;  4A4E A;  1LOJ A;  1TH7 A;  4LD9 K;  5KE3 A;  2CT4 A;  3JV3 A;  4CC4 B;  3INZ A;  2LCS A;  5KH6 A;  1Z9Z A;  1Q82 C;  1U06 A;  4XU1 A;  2RHZ A;  1YJ9 T;  2CUB A;  3G71 T;  3CCU T;  3OS0 A;  4XK8 E;  2DXU A;  2DZC A;  1RL2 A;  1GBQ A;  4C8Q A;  2DER A;  1N6A A;  5LJ3 d;  1UDL A;  2AZS A;  4QT7 A;  1OV3 A;  2X4W A;  1OEB A;  1HSQ A;  4PJO C;  1ZSZ A;  4M7D E;  2BTT A;  4B9X A;  3I55 A;  3QG1 A;  4KUL A;  5J3B A;  2RQV A;  3I55 Q;  5GMK j;  1I0C A;  3MHX A;  2A37 A;  2K2M A;  3QYH B;  2DFU A;  1JEG A;  1OX9 A;  3OYL A;  2RNA A;  1M8M A;  1RLP C;  1EX4 A;  4FYX B;  3EG9 B;  3MJX A;  3SHW A;  2OI3 A;  1R0C B;  3I56 A;  1E6G A;  5IHN A;  4ZTJ A;  4RTZ A;  1ZA2 B;  4QVC A;  1UGR B;  3CC7 T;  3I56 Q;  4E7J A;  1AWW A;  3KBG A;  3PIP A;  2EJ9 A;  1Q86 U;  1M1K C;  2ZPI B;  1W4S A;  2JUF A;  2EKO A;  2DNU A;  2KGT A;  2V8J A;  4BI3 A;  2KT1 A;  2IG0 A;  3N5B B;  1KG1 A;  1WHL A;  4ZGD B;  3OQ5 A;  4PL6 A;  2PVD B;  4IUV A;  1VQL T;  2HQH A;  4M78 A;  4JLI A;  2O88 A;  4XU3 A;  1PM3 A;  4E6R A;  4KGV B;  2QAZ A;  2DYB A;  3CCR T;  2VXE A;  3CBP A;  4J9F A;  3UT1 A;  5GMK i;  3ER0 A;  1C1A A;  4F7U E;  1LCK A;  2OTJ A;  1ABQ A;  1PRL C;  2P4T A;  1PKT A;  1AWO A;  3UA7 A;  4M7D C;  3RDV A;  2M16 A;  2OTJ Q;  2LT4 A;  2YDL A;  1ZBX A;  5A0L A;  3MEW A;  5LJ5 g;  5KCO A;  3JAM E;  4EMH A;  1D0Z A;  5LJ3 h;  4BB7 A;  3GF5 A;  5GAO n;  4A53 A;  5CO7 A;  1AZE A;  1T0H A;  1QVP A;  3C4S A;  3VS2 A;  3G6E T;  2FRW A;  3VV0 A;  1VQ8 A;  1NPR A;  2QG9 B;  2FO0 A;  3HRU A;  2EIF A;  4XTX A;  1VQ8 Q;  2QGG A;  5GJW B;  3ULR B;  2E10 A;  2EVR A;  1ZX6 A;  3VU3 C;  2XHC A;  5FU6 C;  2L5Q A;  1KK7 A;  3L1A A;  4D6W A;  4OGC A;  5FWC A;  2H3J A;  4F16 A;  2V26 A;  2K5I A;  1Q86 R;  4ELZ C;  3CCS T;  1BBZ A;  2O9V A;  2DTH A;  2PUO B;  2IVW A;  2ZPB B;  1K0S A;  1BIA A;  5GAN f;  2YT6 A;  2HSP A;  2RJE A;  2VVK A;  4JDS A;  1NZ9 A;  2ED0 A;  3REA B;  1NE8 A;  2GTO A;  2KEA A;  1GFD A;  1YJN T;  1ZSG A;  2H3E B;  2VWF A;  2DVE A;  1ZUY A;  1GCQ C;  1YWO A;  4FCY A;  5CKD A;  2E6N A;  1OI1 A;  2EFI A;  4A63 B;  4J9G A;  3EGX B;  1D1B A;  2RO0 A;  2AIR B;  1V29 B;  4PNO A;  3ME9 A;  2E5Q A;  4FT2 A;  2EKH A;  2NUT B;  2HAX A;  2V1Q A;  2BUD A;  3OYK A;  4FU6 A;  3FRN A;  4OMN A;  1QW1 A;  4QKU A;  4QW2 A;  1V1C A;  1VQO A;  1SHF A;  1VA7 A;  1FMW A;  1NEB A;  2GQI A;  2AKL A;  3EG0 A;  3F70 A;  4C8Q B;  1V76 A;  3H0F A;  5CKH A;  3JCM f;  4BUG A;  2DVJ A;  4D8K A;  4C8Q D;  3L2U A;  1NBE B;  1ZBJ A;  1M2V A;  5IAY A;  2CH4 A;  2KR3 A;  1X75 C;  2CP2 A;  3NFC A;  1ZSZ B;  1W2B S;  2DET A;  1Q81 C;  2WSC E;  2KNB B;  3JSC A;  2YSQ A;  3EFS A;  5IHI A;  3X25 B;  2A7Y A;  5IT9 E;  2JS0 A;  2G3R A;  4IIO A;  4EMK B;  2J7I A;  3JCM P;  1SSF A;  1QP3 A;  2ATC B;  2H8H A;  2AZV A;  4HXJ A;  2L89 A;  4LUD A;  2RF0 A;  4J7I A;  3TEE A;  1X2K A;  1OYX A;  2DIQ A;  3HHT B;  1IO6 A;  1NLP C;  4Y28 E;  4ESR A;  2DMO A;  5GAM f;  3BW1 A;  1EFN A;  2LCC A;  2KAF A;  5J39 A;  4LDX A;  4M7A G;  2RK2 A;  2RPN A;  1VIF A;  2KY9 A;  2PTK A;  2ZZD A;  4F04 B;  2QGF B;  1D1A A;  2CP5 A;  2JMC A;  4M78 D;  3GOX A;  2LP5 A;  1U3O A;  2VKN A;  3V8L A;  2L3S A;  1NJI R;  4NS5 A;  2RJD A;  1M90 C;  3FLG A;  4M75 E;  3EH2 A;  4PJO A;  2E70 A;  2A0F B;  4FSS A;  2LQW A;  3E2U A;  1R8O B;  2LZ6 B;  3NTH A;  3LWH A;  1WJR A;  2LQN A;  4E7K A;  4QVD A;  4QQG A;  3LH5 A;  2RI3 A;  4J6X A;  5GAN 2;  4M7A C;  2E64 A;  4Z8A A;  3LGF A;  1M4Z A;  4B9W A;  1WHH A;  2DD5 A;  5FRM A;  2QAS A;  1Q7Y C;  2D0N A;  2HNI A;  2QDY B;  2LJ1 A;  1YIT T;  2COW A;  2XU8 A;  4PLL A;  1VQ5 T;  2E1H A;  3QDR B;  1SF9 A;  1VQ9 A;  5GAN 3;  1IRE B;  3L2Z A;  3J7A F;  3CMA T;  2MF2 A;  1VQ9 Q;  4NOY A;  2RB6 A;  3H41 A;  4FSX A;  2OX7 A;  2JMA A;  1VQN T;  1XNI A;  2QQS A;  2EYX A;  4IIM A;  3FJ5 A;  1U1T A;  1RAC B;  1YIJ A;  1Y96 A;  4C92 F;  5CK9 A;  4LDU A;  2LQK A;  2DYI A;  4FW2 A;  1WIE A;  4M7D A;  3OS5 A;  3I9Q A;  1HJD A;  1KHI A;  2ED1 A;  2PVO B;  2B8A A;  5HCK A;  4IUP A;  4R55 A;  2D6F A;  4GBQ A;  5CAI A;  5LJ3 g;  3X28 B;  3CCV T;  2RQR A;  3CCQ A;  1K4U S;  1O75 A;  2VAS A;  3QZ5 B;  1M1F A;  3CCQ Q;  3M55 A;  4JRQ A;  2LJ3 A;  4ANJ A;  4JUV A;  2IIM A;  5GJV B;  2OTL T;  4PFZ A;  1QP2 A;  5HY6 A;  3CC2 T;  4M77 G;  2JZ2 A;  4X1V A;  1PD1 A;  3A8H B;  4J9E A;  3OYF A;  4E2F B;  1W2B P;  4RMO A;  1AWJ A;  2QQB A;  8AT1 B;  1X01 A;  2L3P A;  1BU1 A;  1PC0 A;  2DIL A;  3EG3 A;  1FYN A;  2O4X A;  3EG9 A;  2LNH B;  1JJ2 S;  2MK5 A;  1AHJ B;  2AK5 A;  4AMC A;  2AHJ B;  4C5I A;  1XQH A;  1M2V B;  3M0Q A;  4X34 A;  3TRE A;  4F7U A;  3CCM A;  3LGL A;  4OB1 B;  3EHQ A;  1B34 A;  3CCM Q;  1K9M U;  4J5Y A;  1UHF A;  1WA7 A;  4ZN1 A;  5CR2 A;  5I22 A;  2CYZ B;  3VKI A;  1VYT A;  4JLG A;  2DJQ A;  4J9C A;  2DD4 A;  4M77 C;  5CKF A;  1YCY A;  2K3Y A;  3CPW S;  2VUB A;  1GCQ A;  2I2L A;  1I5L A;  5GAN d;  1KQ2 A;  4A4F A;  1VQM T;  2XDP A;  2X51 A;  2K2V A;  4M78 F;  4DA4 A;  2XI9 A;  5CQX A;  1UGV A;  1QVG A;  1K8A C;  2J6F A;  4JJN K;  2NUP A;  3ZBD A;  2GFU A;  2MI6 A;  5I21 A;  5GAO m;  1GXI E;  3QDF A;  4Z88 A;  4RTX A;  2LDM A;  2D9T A;  2HZY A;  3OSV A;  4DOW A;  3J80 E;  2HD0 A;  1EIF A;  4LNP A;  1K73 C;  2HL3 A;  4QQD A;  1HK9 A;  3GNG A;  1VYV A;  2QQR A;  2HKQ B;  2JTF A;  2EJF A;  2P0K A;  2W10 A;  4OMO A;  3JCM e;  2FB7 A;  1ZLM A;  1GBR A;  4BI8 B;  4PJO B;  4OMP A;  4GLK A;  4II1 A;  3QPH A;  4PJO D;  2DX1 A;  3JCM V;  1FMK A;  3A8O B;  1UE9 A;  3EHR A;  3CC4 A;  3CCL Q;  1E7O A;  2CP7 A;  1K9M R;  3CC4 Q;  2CGH A;  3PT9 A;  3KFV A;  3OW2 S;  5IXB A;  2LX9 A;  1D3B A;  1I07 A;  3MP8 A;  1ARK A;  3HP9 A;  4PFO A;  1BI1 A;  4F17 A;  3S6W A;  5C0M A;  5GAN 7;  1KQS S;  1UEC A;  5GAM e;  1WHJ A;  2DAQ A;  4PJO G;  1MMN A;  4KUI A;  1E6H A;  5GAN h;  1OX8 A;  1OZ2 A;  2JN0 A;  2ZPE B;  4QVZ A;  2QEX T;  3M58 A;  2EQI A;  2YUN A;  2PU9 B;  3EGX A;  2KVQ G;  2YUQ A;  1PD0 A;  1N5Z A;  1Y96 B;  3E9G A;  3I55 T;  2NUT A;  4ZN3 A;  3VYG A;  1S1N A;  1N8R C;  1G3T A;  1K76 A;  3G7Z A;  1NJI C;  4Y92 A;  4M7D B;  4FL6 A;  2CKK A;  1BIB A;  3A5Z B;  1VQ6 A;  1R0B G;  4M7D D;  2YLC A;  5DLO A;  3HRT A;  4LDW A;  1NM7 A;  2M0Y A;  2Y4Y A;  1VQ6 Q;  2J05 A;  2FZC B;  1Q95 G;  4LN2 A;  2M1H A;  4RTT A;  4ZTF A;  1RAA B;  1KC8 C;  1LVK A;  4CC2 A;  1QVF S;  3CCE Q;  1D0X A;  1IXD A;  5GAM j;  3TSW A;  5LJ5 f;  1JJ2 P;  4M7A A;  1YHQ A;  4A4K A;  2C0T A;  2O9S A;  4N0A C;  2Y4X A;  1YHQ Q;  5KYN A;  4KBM B;  1TWB A;  4C5G A;  1WGS A;  1UJY A;  2E65 A;  4C5E A;  4EMK A;  5FU6 B;  5GAN 8;  1RAG B;  4HT9 A;  3SFM A;  2O4X B;  4C0G A;  2KYB A;  4M7D G;  2OTJ T;  1QWF A;  2FRY A;  4PKC C;  1UGP B;  3OBY A;  5CQY A;  1PSF A;  2JTM A;  2JS2 A;  2M0O A;  3QHS A;  2MMP A;  4OB3 B;  4YTL A;  3CPW P;  4F7U B;  2YHT A;  1YJ9 A;  1T0J A;  4EDU A;  1M1G A;  1KD1 C;  1B34 B;  1AD5 A;  3CCU A;  3GP8 A;  1YJ9 Q;  1WQ7 A;  2FVU A;  1CSK A;  4M4Z A;  3CCU Q;  4HVW A;  2LX7 A;  3WVE B;  1MHN A;  2DKG A;  2ZPF B;  2JOY A;  1IGU A;  2YRC A;  3NTI A;  1M3B A;  4JRI A;  2DO3 A;  2MPX C;  1AT1 B;  4MDW A;  2KRN A;  2E4H A;  3M5A A;  5GMK l;  5GMK h;  3PVL A;  1QQJ A;  2NUP B;  3HFN A;  4E7I A;  2VV5 A;  3CXC S;  1G5V A;  3JB9 J;  4F7U G;  3PIO A;  3U23 A;  1QMC A;  1P92 A;  2P4R A;  3JB9 I;  3H6Z A;  1N9R A;  3TVT A;  2XDB A;  4AFQ C;  3CBO A;  2K3B A;  2X4X A;  3RIR A;  3VS6 A;  2A36 A;  3MPU B;  4HCB A;  5I2S A;  2DBK A;  3A8M B;  1JO8 A;  3M9Q A;  1LJO A;  2P0Q A;  4FYV B;  1K8A U;  3OW2 P;  1PHT A;  3P8B B;  4J6W A;  3FC3 A;  2X9H A;  4DQ2 A;  1SSH A;  4XU2 A;  1VQL A;  5DLQ E;  1VQL Q;  2AT1 B;  3CCR A;  1YI2 T;  3NHN A;  1MV0 B;  3OYB A;  2ROT A;  3CCR Q;  2GGR A;  4M77 A;  1KQS P;  4D8D A;  3BDU A;  3CME A;  2O2O A;  2YXY A;  4KH0 B;  1UUE A;  1D3B B;  4PFP A;  1VQ7 A;  3CME Q;  3NMZ C;  2RHI A;  1VQO T;  1VQ7 Q;  3ZFJ A;  3JCM W;  1BI0 A;  1WNL A;  2YWW A;  2J6K A;  2VB6 A;  3ASK A;  3V7S A;  2DRK A;  4K11 A;  3P8D A;  3L2W A;  3G6E A;  1TSF A;  4V2S A;  1IHV A;  3G6E Q;  4AFS C;  3HFO A;  4E7S A;  5CCA A;  1SRL A;  3DKM A;  4MZM A;  4DBQ A;  3PE0 A;  3PMI A;  1QVF P;  2DEQ A;  1BI2 A;  1I5O B;  3VS4 A;  1D1C A;  3JB9 D;  1G2B A;  3CCS A;  3CCJ A;  1Z9Q A;  1X6G A;  3DLL A;  3CCS Q;  3CCJ Q;  2O31 A;  1Y7X A;  1KQ1 A;  3V7C A;  3OYC A;  4OVA A;  1UB4 A;  4R56 A;  1UHC A;  2O01 E;  1QWE A;  5GAN 4;  1K1Z A;  2CT3 A;  5EG2 A;  4C92 E;  3VRZ A;  1AEY A;  4M7A B;  4FIB A;  1Y71 A;  1Q82 U;  2JVV A;  1YJN A;  3EFR A;  1GL5 A;  4M7A D;  2LJ0 A;  3JB9 H;  1T3L A;  2F2W A;  1YJN Q;  2ROL A;  1D09 B;  1KHC A;  2DF6 A;  1G8X A;  3JB9 G;  1BCO A;  2LTO A;  3G1J A;  5GAN g; 
#chains in the Genus database with same CATH homology
 1DJ7 B;  3CME T;  2OTL T;  2GQV A;  3HPW A;  1QP2 A;  2VC8 A;  5HY6 A;  4ME7 A;  3CC2 T;  1VQ7 T;  4M77 G;  2R58 A;  2JZ2 A;  4C5H A;  4C8Q E;  4A54 A;  1YHQ T;  3OMC A;  4O6J A;  3A8H B;  3GLX A;  3AHU A;  3OYF A;  4CRI A;  2DK3 A;  4MML A;  5L8R E;  5A2Q E;  4C92 A;  5J26 A;  4RMO A;  4JRK A;  2QQB A;  2EQK A;  1X01 A;  3OYJ A;  3L2R A;  3CD6 T;  4OB2 B;  3RER A;  2O4X A;  2XIC A;  2R5A A;  3BFM A;  5LL6 S;  5HK3 A;  1Y07 A;  4Y91 A;  2EWN A;  1G3W A;  3VUB A;  3PNW C;  5A0D A;  1U8R A;  1JJ2 S;  1AHJ B;  1K73 U;  1M8V A;  3LLR A;  4XU0 A;  3E9F A;  3DLM A;  2EQU A;  2QXF A;  4XTZ A;  2AHJ B;  4IUQ A;  5GMK e;  2FYK A;  3PGG A;  3OBW A;  4L5G A;  4OGE A;  4C5I A;  2RH2 A;  4Q5W A;  1XQH A;  1LOJ A;  1TH7 A;  4A4E A;  4HCC A;  5KE3 A;  4LD9 K;  4ATO A;  1M1K U;  3CPW A;  4X34 A;  4C92 C;  3TRE A;  4F7U A;  3CCM A;  3INZ A;  3UWN A;  2MWO A;  3LGL A;  2XID A;  1HXD A;  5KH6 A;  1YJW A;  1Q82 C;  4OB1 B;  4XU1 A;  3FDR A;  1B34 A;  1K9M U;  1H3Z A;  2RHZ A;  4J5Y A;  1XTD A;  1YJ9 T;  4ZN1 A;  5CR2 A;  2CYZ B;  4NL3 A;  3VKI A;  3G71 T;  3CCU T;  3OS0 A;  4JLG A;  5C6S A;  4XTV A;  4XK8 E;  2DXU A;  2K4Y A;  4N0A A;  2D0Q B;  5LJ3 f;  3CEY A;  5LJ5 e;  2DD4 A;  2DZC A;  4LDY A;  3VUZ A;  3L2Q A;  3CCJ T;  4M77 C;  5GAO r;  1RL2 A;  4J8O A;  2QA4 A;  4C8Q A;  1N6A A;  5LJ3 d;  3JRZ A;  1JRI A;  3G4S T;  4C0D C;  2OAU A;  5CKF A;  1YCY A;  1G5V A;  3JCM X;  2GF7 A;  4A4G A;  2K3Y A;  2X4W A;  3CPW S;  1JJ2 A;  2VUB A;  2I2L A;  1YIJ T;  1I5L A;  4M75 G;  4M7D F;  4PJO C;  4J7F A;  5GAN d;  1KQ2 A;  4A4F A;  1VQM T;  4M7D E;  5CKE A;  2XDP A;  4B9X A;  2K2V A;  4M78 F;  3I55 A;  4DA4 A;  2XI9 A;  3QG1 A;  4KUL A;  5CQX A;  2YLB A;  4J6Y A;  5J3B A;  5KCH A;  5FRN A;  1BYM A;  4M78 E;  1QVG A;  2ZPH B;  4BAC A;  4N4I A;  5GMK j;  1JBM A;  3MHX A;  4JJN K;  3RKX A;  4BE2 A;  3QYH B;  4PLI A;  5IN1 A;  1VQP T;  3QYG B;  3ZBD A;  2GFU A;  2MI6 A;  4C92 B;  5I21 A;  3OYL A;  4MZP A;  5GAO m;  3OYN A;  2KSS A;  1GXI E;  3BY7 A;  3OSS C;  2LDM A;  1G3S A;  2D9T A;  3URG A;  3X24 B;  4C92 D;  4EMG A;  2CS7 A;  3JCM Q;  3OSV A;  1YI2 A;  4DOW A;  3J80 E;  3CCQ T;  2HD0 A;  3I56 A;  1EIF A;  3V8K A;  4ZTJ A;  2F69 A;  1K73 C;  4LD6 A;  4QQD A;  2GFA A;  3SD4 A;  4QVC A;  1HK9 A;  1UGR B;  3CC7 T;  3GNG A;  1I81 A;  3SB2 A;  4E7J A;  2QQR A;  5LJ5 j;  4M77 B;  3KBG A;  5FU7 C;  3PIP A;  3FIF A;  2CZ0 B;  2EJ9 A;  2JTF A;  1Q86 U;  1M1K C;  3C94 A;  2ZPI B;  1W4S A;  2JUF A;  2ZGW A;  4HKE A;  4M77 D;  2EJF A;  2EKO A;  4C0D B;  1QVG S;  2P0K A;  2R5M A;  3JCM e;  2FB7 A;  3OW2 A;  1O9S A;  2V8J A;  3M53 A;  4BI3 A;  3RMQ A;  1N8R U;  1K9M C;  1N9S A;  5DM7 R;  2IG0 A;  3N5B B;  4M75 C;  3MP1 A;  3QZ9 B;  4BI8 B;  4CI0 C;  1NJI U;  4PJO B;  4GLK A;  1KG1 A;  4II1 A;  3QPH A;  4ZGD B;  3S3M A;  3OQ5 A;  2RJC A;  4PJO D;  2LQ8 A;  4PL6 A;  4ZGJ B;  3P8H A;  3JCM V;  2PVD B;  4Z02 A;  4IKF A;  4IUV A;  1VQL T;  4XAX B;  3A8G B;  3A8O B;  4M78 A;  4JLI A;  4XU3 A;  3CBM A;  3MEV A;  3L2V A;  3CC4 A;  4F7U F;  3CCR T;  2VXE A;  3CBP A;  3UT1 A;  1KQS A;  5GMK i;  3ER0 A;  3OY9 A;  4C92 G;  4F7U E;  2CGH A;  2VGM A;  2KQW A;  1I4K 1;  3PT9 A;  3VYH B;  4ELY C;  1KC8 U;  2OTJ A;  4L59 A;  4JRP A;  2NLU A;  2P4T A;  3OW2 S;  4MDX A;  2LX9 A;  3FB9 A;  4M7D C;  2M16 A;  2LT4 A;  3CCM T;  1YJW T;  5D6X A;  2CZ7 B;  5GAN 5;  4HT8 A;  1D3B A;  1ZBX A;  2VYT A;  3RKY A;  5A0L A;  5GMK m;  3KXT A;  1VQ4 T;  3ZEH A;  1VQ5 A;  4M78 C;  3MP8 A;  2RA2 A;  4C8Q F;  3MEW A;  5LJ5 g;  4FT4 A;  3HP9 A;  2RHX A;  5KCO A;  1BI1 A;  1BI3 A;  2X4J A;  4X9C A;  5FU7 B;  4EMH A;  3JAM E;  3LW5 E;  1G3Y A;  1ZHI A;  2K3X A;  2LNV A;  2XKO C;  4RCC A;  3S6W A;  5LJ3 h;  4BB7 A;  5C0M A;  5GAN 7;  4OMF B;  4DOV A;  3GF5 A;  2A3L A;  2RHY A;  3FJP A;  5M9O A;  2QA4 T;  1KQS S;  4M7A F;  5GAO n;  5GAM e;  4M75 B;  2PVG B;  5CO7 A;  4A53 A;  2DAQ A;  4PJO G;  4KUI A;  5GAN h;  1QVP A;  1OZ2 A;  2ZPE B;  2JN0 A;  2MWP A;  3C4S A;  4QVZ A;  4M7A E;  4M75 D;  3G6E T;  2QEX T;  3VV0 A;  1N27 A;  1VQ8 A;  1NPR A;  3M58 A;  2DZ9 A;  3HRU A;  2PU9 B;  4IUU A;  4C8Q G;  2EIF A;  2KVQ G;  4XTX A;  1Q86 C;  1MGQ A;  1Y96 B;  3M56 A;  2DJZ A;  2EQM A;  3S3O A;  2Y90 A;  3E9G A;  3I55 T;  2E10 A;  4ZN3 A;  3VYG A;  3VU3 C;  1QVF A;  2XHC A;  1N8R C;  3DB4 A;  1G3T A;  5FU6 C;  2L5Q A;  3G7Z A;  1NJI C;  2KDS A;  4BDZ A;  3OYE A;  3L1A A;  4D6W A;  1KD1 U;  3Q1J A;  4M7D B;  4FL6 A;  4OGC A;  1VQ9 T;  2H3J A;  3CPF A;  2CKK A;  1BIB A;  3A5Z B;  5DY9 A;  1VQ6 A;  4M7D D;  2YLC A;  5DLO A;  3HRT A;  4LDW A;  2K5I A;  2BIV A;  2QTX A;  4M78 B;  4ELZ C;  3OYD A;  2Y4Y A;  4RG8 A;  3CCS T;  3CCV A;  4KUD K;  3SWN A;  2DTH A;  3KUF A;  2K5F A;  2LT1 A;  5D6W A;  3OYA A;  2RJF A;  3JCM J;  2M1H A;  4OB0 B;  3V7R A;  2PUO B;  2IVW A;  4ZTF A;  1UGS B;  3OYG A;  2ZPB B;  1KC8 C;  4N4H A;  3VJP A;  1BIA A;  5GAN f;  3JCM g;  1S72 T;  1QVF S;  3RMS A;  4QQ6 A;  2FHD A;  2RJE A;  5GAM j;  5A0G A;  4JDS A;  1NZ9 A;  5LJ5 f;  4M7A A;  3LWI A;  1YHQ A;  4A4K A;  1NE8 A;  1Q81 U;  2CZ1 B;  3A8L B;  5LJ5 d;  4N0A C;  3R6O A;  2MAM A;  1YJN T;  2Y4X A;  1PSE A;  3MEU A;  3OMG A;  1VIE A;  4C8Q C;  4KBM B;  4C5G A;  3MCA B;  1WGS A;  2RI2 A;  2E65 A;  3CD6 A;  2DVE A;  2YRV A;  2E41 A;  3MET A;  4IUR A;  3PMT A;  3C95 A;  4MZT A;  1LNX A;  5FRO A;  4C5E A;  4EMK A;  5FU6 B;  5GAN 8;  2M9U A;  4BD3 A;  5GAO l;  4HT9 A;  2RK1 A;  1RI0 A;  2EAY A;  4WF2 A;  5CKD A;  3CC4 T;  2E6N A;  3SFM A;  2DXC A;  4BE1 A;  1OI1 A;  2EFI A;  1YBY A;  2O4X B;  4C0G A;  4BE0 A;  3V8J A;  4M7D G;  3QO3 A;  4J83 A;  4TVR A;  1M5Q 1;  2OTJ T;  4PKC C;  1UGP B;  3OBY A;  4X9D A;  1PSF A;  5CQY A;  4M78 G;  2JTM A;  2RO0 A;  3GIB A;  2M0O A;  1V29 B;  3QHS A;  2QQ9 A;  4RKU E;  4PNO A;  2DTO A;  3ME9 A;  2E5Q A;  2LVM A;  2MMP A;  4FT2 A;  4OB3 B;  2QI2 A;  2HAX A;  4YTL A;  2BUD A;  3OYK A;  4FU6 A;  4EMK C;  4F7U B;  1WPY A;  2V8I A;  2YHT A;  1YJ9 A;  3FRN A;  4EDU A;  3OYI A;  1QW1 A;  1M1G A;  2RM4 A;  3M54 A;  1JB0 E;  3E1S A;  4QW2 A;  1W2B A;  1B34 B;  1KD1 C;  3CCU A;  5D6Y A;  3GP8 A;  5GAM g;  1WQ7 A;  2FVU A;  1VQO A;  3S3N A;  2FL7 A;  3MP6 A;  3QSU A;  3J81 E;  3EAE A;  3F70 A;  4N4G A;  3G4S A;  4C8Q B;  3CCL A;  5CKH A;  3JCM f;  3WVE B;  4BUG A;  3CXC A;  3GPL A;  1MHN A;  4C8Q D;  3L2U A;  3JCM d;  2DKG A;  3JB9 F;  2PQW A;  3DB3 A;  3UPU A;  2RHU A;  2ZPF B;  3OYH A;  2JOY A;  5IAY A;  5GAO p;  1X75 C;  3NFC A;  1UEB A;  5GAN g;  2DXB A;  3NTI A;  4L6V 5;  1W2B S;  4RCB A;  1Q81 C;  4BY6 C;  1M90 U;  4JRI A;  1WJQ A;  1YIT A;  2DO3 A;  1WJS A;  3E19 A;  4MDW A;  2WSC E;  3PTA A;  3M5A A;  2KK4 A;  5CIU A;  5GMK l;  4BI4 A;  1VQP A;  5GMK h;  3QBY A;  4M77 F;  2BKD N;  2X4Y A;  3JSC A;  4E7H A;  3EFS A;  3HFN A;  4M77 E;  2A7Y A;  3WXM B;  3X25 B;  3CMA A;  2VV5 A;  2F5T X;  2G3R A;  3CXC S;  4E7I A;  4EMK B;  3TU4 K;  5IT9 E;  4F7U G;  3JCM P;  3JB9 J;  1SSF A;  1QP3 A;  3PIO A;  2XD0 A;  3TCJ A;  4O5V A;  1VQN A;  5FLX E;  3M4G A;  1P92 A;  1H64 1;  3JB9 I;  2QQA A;  2L89 A;  3H6Z A;  1N9R A;  4E7L A;  2XDB A;  3CBO A;  2X4X A;  3NTK A;  4J7I A;  3RIR A;  1ZQ1 A;  2F5K A;  2KMT A;  3TEE A;  3JCM b;  5LJ5 h;  4HCB A;  5I2S A;  2LRQ A;  3A8M B;  4XTY A;  1OYX A;  2DIQ A;  3HHT B;  4Y28 E;  1Q7Y U;  3M9Q A;  1FX7 A;  1LJO A;  1M9S A;  2P0Q A;  3QUI A;  3BW1 A;  5GAM f;  1K8A U;  2K5L A;  3HRS A;  2LCC A;  4C0F A;  2KAF A;  2LCL A;  3P8B B;  1U1S A;  5GAM d;  5J39 A;  4LDX A;  4J6W A;  1UGQ B;  3FC3 A;  4M7A G;  4GY5 A;  5I2M A;  4DQ2 A;  2RK2 A;  4XU2 A;  1VQL A;  5DLQ E;  4BY6 B;  2L3R A;  1VQK A;  1VIF A;  3O8V A;  2KY9 A;  2HBP A;  2ZZD A;  3CCR A;  3JCM c;  1YI2 T;  3OYB A;  3HKS A;  3LH0 A;  4OF1 A;  4M78 D;  4UC4 A;  3I56 T;  2EJG A;  3GNF B;  2EQJ A;  3GOX A;  4M77 A;  2K57 A;  4C0Z A;  3OYY A;  5LJ3 e;  3CCE A;  3V8L A;  2HQE A;  3BDU A;  4VUB A;  3RES A;  4HA8 A;  4NS5 A;  1VQ6 T;  4M75 F;  2RJD A;  3BDL A;  2ZCF B;  3CME A;  1VQ4 A;  2OTL A;  1M90 C;  3FLG A;  3PFS A;  2E6Z A;  2DPP B;  4M75 E;  4PJO A;  1D3B B;  5GAN e;  2XDD A;  1VQ7 A;  2E70 A;  3LYI A;  3CC2 A;  2HQX A;  2RHI A;  5CKB A;  1VQO T;  3SWN C;  3ZFJ A;  3HL8 A;  4KT0 E;  3JCM W;  1BI0 A;  2VGN A;  1R8O B;  3NTH A;  1WNL A;  3LWH A;  3ASK A;  1WJR A;  4XQ3 A;  3V7S A;  4ZGE B;  3JCM h;  4E7K A;  2LC4 A;  4QVD A;  4QQG A;  3UDC A;  2EYQ A;  3CCL T;  3P8D A;  3L2W A;  3G6E A;  2QEX A;  2RI3 A;  4J6X A;  4V2S A;  3HSB A;  5GAN 2;  3MO8 A;  4M7A C;  2E64 A;  3OYM A;  3OS1 A;  3LGF A;  3RUX A;  3HFO A;  3WVD B;  5GAO q;  1M4Z A;  4B9W A;  4LDV A;  3SDZ A;  2DD5 A;  5FRM A;  5CCA A;  1Q7Y C;  2HNI A;  2QDY B;  3DKM A;  4MZM A;  1BKB A;  1YIT T;  3PMI A;  2XU8 A;  4PLL A;  1VQ5 T;  1VUB A;  2E1H A;  3QDR B;  4JS5 A;  2DEQ A;  3QKJ A;  1FXX A;  3H8Z A;  1BI2 A;  5LJ3 j;  1VQ9 A;  3M4Y A;  3X20 B;  5GAN 3;  4XTU A;  1IRE B;  3G71 A;  3L2Z A;  3J7A F;  4JS4 A;  3CMA T;  2MF2 A;  3JB9 D;  4NL2 A;  1FWZ A;  4FM4 B;  4E47 A;  4NOY A;  4M75 A;  4EPC A;  3CCS A;  2RB6 A;  3L42 A;  3OB9 A;  4FSX A;  3CCJ A;  5HKC A;  3MEA A;  5GAN j;  1VQN T;  3DLL A;  1XNI A;  2QQS A;  2XK0 A;  3SWN B;  2X35 A;  4MMK A;  2P0P A;  4A4H A;  1Y7X A;  3RKW A;  1KQ1 A;  1S72 A;  3V7C A;  2JNG A;  1U1T A;  1X6O A;  3QII A;  3OYC A;  4OVA A;  1VQ8 T;  2XG8 D;  1UB4 A;  1Y96 A;  2ZPG B;  4OP0 A;  2O01 E;  3M59 A;  5GAN 4;  4R56 A;  1YIJ A;  4C92 F;  2DXT A;  2L8D A;  4XTW A;  5CK9 A;  4LDU A;  1VQM A;  5KE2 A;  2WSF E;  1XOV A;  2RD1 A;  5EG2 A;  2RI5 A;  3M57 A;  4C92 E;  5GAN 6;  3FEO A;  3QJY A;  5GAM h;  2LQK A;  2CZ6 B;  4M7A B;  4FIB A;  1Y71 A;  1Q82 U;  2JVV A;  1YJN A;  2VXF A;  3EFR A;  3LX7 A;  4M7D A;  4M7A D;  3OS5 A;  3JB9 H;  2WAC A;  4IUT A;  1KHI A;  1I8F A;  5AYF A;  2PVO B;  1VQK T;  1KHC A;  2B8A A;  2R57 A;  3OS2 A;  4BDY A;  1IZ6 A;  4IUP A;  4HCZ A;  4R55 A;  3QXE B;  2D6F A;  2E12 A;  3C12 A;  5CAI A;  5LJ3 g;  3X28 B;  3CCV T;  3CCQ A;  3JB9 G;  1K8A C;  2WSE E;  2GCX A;  1OZ3 A;  1O75 A;  2V8K A;  4RG2 A;  3QZ5 B;  4PJO F;  1M1F A;  3M55 A;  2DIG A;  3CC7 A;  3X26 B;  2LTO A;  4P5N A;  4JRQ A;  3QJ6 A;  5CVI A;  2C06 A;  2DTI A;  3CCE T;  4JUV A;  1WQW A;  3T9N A;  5HK0 A;  1NPP A;  4PJO E;  3OA6 A;  2PUK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...