2VYTA

The mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'RDDFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX COMB ON MIDLEG-LIKE PROTEIN 2
publication title The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 53
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA01
2HQEA 2QQRA 3QIIA 3QJ6A 4C5IA 5FRNA 4QQDA 4QW2A 3MO8A 3OMCA 3OA6A 3OS1A 3L2QA 3L2UA 2HQXA 5IAYA 2RHZA 5C6SA 3LX7A 2L8DA 2MWOA 3NTHA 2L3RA 4IUQA 1OZ3A 4BACA 4B9XA 4B9WA 3OYCA 2IG0A 4IKFA 4E7KA 4UC4A 3PFSA 3UT1A 4Q5WA 4LD6A 4RG2A 4QQ6A 3LH0A 3L2WA 2BUDA 2M1HA 3P8DA 4N4HA 2E5QA 4QVZA 3E9FA 4X34A 3OS2A 3OYLA 4EDUA 3PMTA 3E9GA 5M9OA 4E7IA 2R5MA 2M16A 3OYBA 3OMGA 2R5AA 1N27A 2LVMA 5J26A 3OS0A 2RJFA 2X4YA 2RO0A 2D9TA 3ZEHA 3NTKA 2GFUA 2CKKA 2RHYA 4ZTFA 4QQGA 3S6WA 4C5EA 1WJRA 3PNWC 3MP1A 4FU6A 3ME9A 3SD4A 2M0OA 2MWPA 2JZ2A 4PLIA 2PQWA 1OI1A 4IUUA 3MP6A 4IURA 3OY9A 4BD3A 4C5GA 1SSFA 3Q1JA 3DB3A 4GY5A 5J39A 2LDMA 1MHNA 3MEAA 1OZ2A 5FRMA 3OYHA 3DB4A 3LLRA 3O8VA 2E6NA 3PMIA 3QBYA 4A4FA 1RI0A 2RI2A 2RJDA 3C4SA 5CIUA 3H8ZA 3S3MA 3FLGA 3S3NA 3CEYA 3DLMA 2LRQA 3NTIA 3M9QA 4L59A 2DIQA 2LCCA 4N4GA 2EQKA 2JTFA 3F70A 5KCHA 2DIGA 3L42A 4NS5A 3MEVA 3L2VA 4BDZA 5D6WA 3OYMA 2G3RA 4PL6A 5KE3A 1KHCA 3P8HA 1XNIA 3GOXA 2XDPA 3OB9A 2YRVA 3OYFA 5KCOA 3BDLA 4N4IA 2K3XA 3UWNA 2R58A 3LYIA 3META 2BKDN 3OYNA 2B8AA 3OQ5A 3MP8A 3QKJA 4A4GA 4BE1A 3ASKA 5KE2A 1OYXA 4A4EA 2BIVA 4C5HA 3FC3A 2GFAA 2FHDA 4Z02A 3S3OA 2EQUA 3KUFA 3OYKA 3MEWA 2EFIA 3OYEA 1H3ZA 2XK0A 4E7JA 3FDRA 4FL6A 4OVAA 4II1A 4BE0A 4CRIA 3OYDA 3OYJA 4PLLA 2P0KA 2L89A 3LGFA 2RI5A 2EQMA 3LGLA 5C0MA 3L2RA 2F5KA 1WJQA 1WJSA 2R57A 2EQJA 4A4HA 5IN1A 5FROA 4E7LA 2RHUA 2RHXA 2RI3A 4IUPA 2WACA 2O4XA 2X35A 5KH6A 2DAQA 4ZTJA 2LTOA 2RHIA 2RJEA 4HCZA 2GF7A 2NLUA 3H6ZA 3EAEA 2X4XA 4E7HA 1WGSA 2EKOA 4BE2A 3FEOA 5D6XA 5D6YA 2RJCA 4BDYA 2X4WA 3OYAA 2QQSA 3OYIA 2K3YA 2VYTA 4IUVA 4IUTA 3MEUA 2O4XB 3OYGA 1G5VA
chains in the Genus database with same CATH superfamily
1RUWA 1BI1A 3X25B 2EIFA 3MO8A 1R77A 2PVDB 4M77E 3OA6A 5LJ3h 4KULA 3NTHA 1SPKA 2L3RA 2KEAA 4LD6A 4JS4A 4X1VA 4PJLA 1G3WA 1TUCA 2RPNA 1W70A 5KYUA 1QCNA 4C92D 4HVUA 1YJNQ 3QYHB 5GAOm 4KT0E 1N5ZA 2K5LA 1TXQA 2MWPA 2DJZA 2LC4A 1WA7A 2DERA 3JCMg 3KXTA 1X69A 1B7TA 2V26A 4M75A 1K73C 1K8AC 1RABB 2KBTA 2E6NA 2KGTA 5GMKh 1AVZC 3RKYA 3V8LA 2QEXQ 2GTJA 1UDLA 4FSSA 4HVWA 2EQKA 3TREA 3L42A 4NS5A 1SSHA 1JJ2S 1M2VB 3QWYA 4AFSC 4JLGA 1M3BA 1B3QA 3P8HA 1XNIA 5GAMf 3JB9H 4HVVA 4FIBA 3CC7T 2YHTA 4M7DC 2XDPA 2YRVA 4Y92A 4PJOC 3M0RA 4FSXA 4ATOA 2HSPA 2K5IA 3HRTA 3LYIA 2EGAA 1UGPB 4MZTA 4EMKB 3QKJA 4OMMA 2ZPBB 4WF2A 3RIRA 4D8KA 4JRPA 3MEWA 4C0ZA 1FMVA 3CBMA 2FRYA 4WCIA 4M7AF 3PT9A 1IHWA 4PLLA 1QP2A 2RI5A 1K1ZA 3RKWA 5GAN3 1NJIU 2EJGA 1E7OA 2YUOA 4J7IA 2FEIA 3EFOA 3NFCA 1G83A 1YIJQ 1CKAA 2YUNA 3BE3A 1ZQ1A 4K11A 3OYAA 4AFQC 3EFRA 2QQRA 2OJ2A 1VQLA 2RHZA 3LX7A 1YCYA 2MK5A 3INZA 1OZ3A 1PCXA 4RKUE 1ZBJA 1I1JA 1BKBA 2EYZA 4QVZA 2GCXA 4C92A 3CC7Q 2BE9B 4B6MA 1N8RU 2O9VA 2D9TA 3CC4T 4C5EA 5CKEA 2L5QA 3MP1A 5KYWA 2VUBA 2PU9B 4LDUA 4C5GA 4CC2A 4GY5A 1QCFA 5J39A 3CMEA 1VQ8T 1N9RA 8AT1B 2RMOA 3LLRA 3J7AF 3GIBA 1M90R 1KG1A 1R8OB 2HMAA 2YUPA 3I56A 4M75C 5I2SA 2LQWA 2DBKA 2KAFA 1YI2T 2E70A 4RCBA 5GANd 2LCLA 1BB9A 4KBMB 4M78D 4XU3A 3MP8A 2QQAA 2DEQA 5GANj 1OYXA 1XQHA 2BIVA 3M5AA 2XMFA 2KRSA 1BIBA 1K9MR 1YBYA 1X75C 5LJ5f 4GLMA 3L2RA 3CCVA 1KK7A 2VV5A 3CC4Q 1Z9QA 2DEUA 2QYZA 2AK5A 5KYNA 1KFZA 2DZCA 2HL3A 2X4XA 5GAN5 4M7AC 1TWBA 2DXTA 3CC2T 2QQSA 4OGEA 1VQMA 3PE0A 4IUVA 4LDXA 2CYZB 1JXMA 2O4XB 4ZGDB 4J9GA 3CXCP 5GAOr 1VIFA 2V8KA 5GJVB 2RH2A 4CC4B 5GANe 3M0QA 1GBQA 1RLQC 4FYVB 3TEEA 1QVGA 3LH0A 2X9HA 3P8DA 3CBPA 1G3SA 3G6EA 1ZSZB 4ORZA 1BYMA 3OMGA 4M77F 2COWA 2VC8A 2PNIA 1UTIA 3RERA 3MJXA 2LNVA 3HL8A 3NGPA 2MI6A 1QW1A 2RN8A 2EGEA 2M0OA 2AHJB 2O2OA 1NPPA 3MP6A 3OSVA 5CK9A 1WHJA 2DXBA 1Q7YR 2E64A 2KE9A 2KNBB 3MEAA 4EPCA 2P4RA 3OW2P 3DB4A 3GNFB 4C0DC 2RJDA 3C4SA 2RQWA 1MNDA 3M9QA 3HP9A 1I07A 1UHCA 5KCHA 3CCMQ 1A0NB 2ESWA 4AT1B 1VIEA 3NMZC 4OB1B 3CC2Q 2ZGWA 2NUPA 4M78A 2F2WA 3I9QA 2OX7A 5GJWB 1NEGA 3E2UA 2JN0A 2XU8A 3H0IA 4HCCA 5GAMh 1HD3A 3I55Q 1VQ9Q 1UJYA 2J6KA 3SWNB 1RADB 1RAIB 5KE2A 2K57A 3CCET 1CKBA 1UE9A 3L1AA 3RKXA 4OMLA 4ZGEB 2ENMA 2DX1A 2QQ9A 2P0KA 2FRWA 3LGLA 5C0MA 4E7LA 2DTIA 4BY6C 4F7UE 2RI3A 2OTJQ 2QI2A 2RJEA 3VYGA 3CCUT 3QDFA 1Y57A 1YI2A 1T3SA 3A5ZB 4LUEA 2RF0A 4XTVA 1UGVA 4CC3A 3ER0A 2HQEA 3FIFA 2KYBA 4C8QB 1WXTA 1BBZA 3CD6A 5D7UA 2FZCB 2IG0A 3C94A 4CC7A 4HT8A 2JUFA 3L2WA 3JCMb 3JB9D 2M1HA 2K6DA 4FCYA 2D8HA 1N27A 3JCMX 1VQ5Q 1VQ7Q 1MNEA 1QQJA 2RO0A 1VQ6A 2YXYA 5DLQE 3NTKA 1KC8C 2L2PA 2XIDA 1PG5B 4FU6A 2DD5A 2JM9A 3E19A 3A1PA 1K0XA 1OI1A 1NJIR 2HNIA 2DF6A 3M0SA 4EMGA 1AWXA 4M77C 2E5KA 1HK9A 4Y91A 5FRMA 2FZGB 3DKMA 2EVRA 3GP8A 5AYFA 1K4US 3CMAA 1U5SA 3CCUQ 1RACB 2PVGB 4EMHA 5D6WA 1HYOA 5IHNA 4F7UG 1KQSP 3M58A 2CT4A 2QTXA 3EH1A 4PNOA 5KCOA 4J9CA 3VS3A 1YWOA 3OYNA 1Y7XA 1RAHB 1K76A 3ASKA 2JTEA 2KR3A 5A2QE 1ABQA 5GAN2 1KQ2A 1N8RR 1PSEA 3G71T 2ED0A 4BE0A 4LD9K 4J5YA 1ZUYA 1LJOA 3T9NA 4LDVA 5LL6S 1V76A 2FVUA 3QSUA 2RD1A 1G3YA 5FWCA 2IIMA 1D0XA 1YITA 3TQ7P 5LJ5h 2QGGA 1WLPB 1HXDA 3VV0A 2XD0A 3C12A 2EPDA 3OYIA 2VYTA 2MPXC 1KD1C 2E4HA 3OYGA 1RI9A 2C0IA 3QYGB 3QIIA 2HZYA 4J9FA 2IPOB 1LVKA 4XTWA 4PFOA 1Q82C 2FG0A 2HD0A 2MWOA 3CCSA 2CUDA 1X01A 3OYCA 1GL5A 5I2MA 4RG2A 2H8HA 1QVGS 4QQ6A 1YHQQ 2CGHA 3OS2A 1M2VA 3V7RA 2DO3A 1XTDA 4AG1C 3TCJA 2M16A 1D1AA 3JCMf 1X27A 4KH1B 4OMPA 4HT9A 1M30A 2KRNA 3M56A 1GCPA 1QVPA 3JCMJ 2CKKA 4EMKA 5CAIA 1VQKA 2PQWA 3GPLA 3DLLA 3OY9A 3G71Q 3LW5E 1SSFA 2RA2A 3JB9J 3CCJQ 5KYYA 1ZLMA 4C8QE 2P0PA 2ZAEA 2DRMA 1YJ9T 3EHQA 4A4FA 4FYYB 3S3MA 1SG5A 1LCKA 1JJ2P 1D0YA 2HSEB 4OB3B 2LCSA 5GANg 4BDZA 4JZ3A 3QG1A 2OTLT 3RESA 3A8OB 2KY9A 2CH4A 1GCQC 3BDLA 2DXCA 2YRCA 1VQNT 1I81A 2I0NA 2I2LA 1S72T 3JB9I 1VQ4T 3UA6A 4KUDK 4E2FB 4A4EA 2A0FB 3UF4A 4Z02A 1WHMA 2ATCB 2EFIA 1W6XA 1M5Q1 2ZPEB 4AMCA 4M7DA 3X28B 4PJOA 1WYXA 2K2MA 4XTZA 4OMOA 2V1RA 4GBQA 2G6FX 5FU7B 2L3PA 2E12A 1YJNT 2B86A 4BE2A 2DETA 1D1CA 2A7YA 1AWJA 1QLYA 2FO0A 2A28A 3A8GB 2NUTB 4F7UF 5FRNA 1MV0B 1UB4A 3OMCA 5IAYA 5C6SA 3EGDB 4C92G 1Q7YU 2QEXT 4Q5WA 3WXMB 2RQRA 1B07A 1WIEA 2EW3A 2OTLQ 1K73R 5M9OA 3E9GA 1OEBA 1PD0A 5A0LA 3OYBA 1W2BP 2F2VA 2BZYA 4AG2C 4JZ4A 1ZHIA 1VQ4Q 8ATCB 3PNWC 2RK1A 2D0QB 1M4ZA 3OYYA 3VU3C 4EMKC 1TS9A 3LWIA 4J83A 4J6XA 1ZSGA 2JOYA 2EJFA 1M3AA 1IGUA 3QBYA 3X26B 2WSFE 3JCMW 2MAMA 4QKUA 4E7SA 2QA4A 2DBMA 2HL5C 3CCRA 1UUEA 1YIJT 1QWFA 2HEQA 3A8MB 3OYFA 1I5LA 1D3BA 3G4SA 2B8AA 1T0HA 1M1KC 2GQIA 2FHDA 4DQ2A 5IXFA 1TU0B 1YFNA 2LMJA 1I0CA 3REAB 1WI7A 3OYJA 1VQLQ 2QTVA 2O9SA 1T0JA 4JRKA 5IN1A 1FXXA 2RHUA 2ZCFB 2M9UA 2VWFA 2JXBA 2L3SA 1WHGA 3NPFA 1WQ7A 3QUIA 1JEGA 3HPWA 1C6VX 3WVEB 5I22A 1BCMA 2ZPHB 2DJQA 1KQ1A 1Q86U 4F17A 2LJ1A 2DLPA 1MMNA 4B9XA 1NZ9A 1YJWA 5L23A 4M7AA 2LX9A 2FPDA 4A63B 1H641 2BUDA 1D0ZA 4PFZA 2CH4W 2WSEE 3UDCA 5GAN4 1IB8A 3EFSA 3GBQA 1BI2A 3I56Q 3A8HB 1YJNA 3JCMh 2FYKA 2PUOB 4ZNXA 2EKHA 4QQGA 4OB2B 3G1JA 1AZGB 3VS1A 3KBGA 3QZ5B 4GLKA 2RM4A 1H8KA 2ZZDA 1Q81R 4RTYA 1OZ2A 2BZ8A 3EG9B 3OYHA 2VB6A 1I5OB 1C0MA 2NYSA 1VQPA 1WZOA 5CIUA 2DA9A 2L0AA 1XJWB 2WSCE 3RUXA 4JUVA 4KGVB 1D1BA 3UPUA 5KE3A 1Y96A 4C8QF 1YP5A 2GNCA 2FB7A 2CZ7B 3TU4K 4M77D 2R58A 3JSCA 2K3BA 4KH0B 1M1FA 1PHTA 4R0KA 4BUGA 1WQWA 1Z9ZA 3QO3A 4F7UB 3OYDA 4LDWA 3CXCA 3AT1B 4BI8B 3LGFA 2LQ8A 3I35A 2DL7A 2Y90A 2F5KA 4PJMA 1T3LA 2E3HA 1MGQA 3UATA 4ZTJA 1B34B 1ZSZC 2DAQA 3V7SA 3PIOA 2KQWA 3G6EQ 3CPWP 1PSFA 1SHGA 2EKOA 2KT8A 3M0PA 4N0AC 2CDTA 1RAEB 4LN2A 1ZUUA 1ZA2B 4JPBW 4XAXB 2YT6A 3QJ6A 2XHCA 2X51A 2HQXA 2EQIA 4BACA 1KSWA 2CP0A 3QDRB 4F16A 3E9FA 3CCMT 4Y28E 3VKIA 4J6WA 3OW2A 3CC7A 3EGXA 1V29B 2P84A 2X4YA 4E6RA 1X43A 1BIAA 3ZEHA 4FT2A 5EC7A 5LJ3d 4FYWB 3OSSC 4IIOA 3I55T 1VQ9T 1MMDA 4ZGJB 2LJ0A 2DM1A 4KGZB 5LJ3j 3MCAB 5GAOn 1RL2A 1WX6A 2F5TX 2EAYA 3QZ9B 3SWNC 3ZFJA 3ULRB 5AT1B 1M1GA 1M90C 1RI0A 2KXCA 2K79A 4L59A 2DIQA 4DA4A 2YLBA 3EHRA 2OTJT 2A36A 4DBFA 1IO6A 1KIKA 4M77A 4MZMA 2J6FA 5GAOq 5IXBA 4RTWA 3UWNA 4FM4B 2F1LA 1PNJA 3X24B 4RMOA 2CSIA 1PM3A 5LJ3e 4C5HA 2GFAA 1H3HA 1OOTA 4DOWA 4RTTA 5GMKj 1H3ZA 2EYYA 1K9MC 4OVAA 4NL2A 4C8QC 2YDLA 4HKEA 1VOMA 2M0YA 3CD6Q 4O5VA 4KGXB 4FW2A 4XQ3A 3CC4A 2MYSA 2RHXA 1VQ5T 4IUPA 1VQ7T 1QMCA 2H3EB 5CR2A 1K73U 1K8AU 4E7HA 1WGSA 4MZPA 2XICA 2K5FA 3EFOB 5GAN6 2GBQA 3JB9G 1VQ8A 3CQTA 1QVGP 1DJ7B 5GMKe 3CCQT 2DK3A 3I5SA 1D09B 1M27C 4D8DA 4EDUA 3PMTA 2ZPIB 2MCNA 5DLOA 1TG0A 3RR6A 3CMAQ 1SHFA 4X9CA 2GFUA 2RHYA 1NEBA 4C92B 5GANf 1KQSA 2DL4A 2YSQA 3CCLT 3DB3A 4OGCA 2JS2A 2QAZA 1BI0A 1K0SA 2KI7A 1NE8A 1VQOQ 2RI2A 5KYWB 5DM7R 1VYVA 1Y0MA 1W4SA 3CCMA 1LPLA 5DY9A 3L2VA 4RTXA 2LP5A 1OPKA 1Q86R 3CC2A 1SEMA 5GAN7 3OB9A 1N9SA 5GMKl 1UGSB 4M7DG 3EGDA 3JCMQ 1NLOC 2CSQA 3FC3A 3CCQQ 4PJOG 1ZUKA 4E47A 1X2KA 1M3CA 1S1NA 3HRSA 5A0DA 2CT3A 1QVFP 2EBPA 3CXCS 1GCQA 4ELYC 3CCSQ 1YHQT 4XU2A 1OU9A 4D6WA 1EZZB 4L6V5 2AZSA 3PGGA 4M75E 3TSZA 2NLUA 4LXCA 2H3JA 3EAEA 2XDBA 1GBRA 1FMKA 3OS5A 3N5BB 4J9DA 3CCLQ 2X4JA 2HKQB 1AZEA 4C5IA 1VQKQ 2AT1B 2DZ9A 2X3WD 3EG0A 3CCJT 4IUQA 4OP0A 2QASA 4IKFA 1NPRA 1Q81U 3UT1A 3M0UA 1NBEB 4N4HA 3OYLA 1ZBXA 4E7IA 2XG8D 2C06A 2FL7A 2RJFA 2OI3A 4Z88A 2MMPA 3VRZA 2QG9B 1NJIC 2EJ9A 3CCEA 4PLIA 3HTRA 4DOVA 5FWBA 4X9DA 2CP2A 1AHJB 4DEYA 2LRQA 2J7IA 3NTIA 4OMQA 3CCUA 5FW9A 2K4YA 2G3RA 4PL6A 3JCMV 2JM8A 4F14A 4A54A 1IZ6A 5FU7C 2BE7D 4M75G 5KYXB 4C92E 1UG1A 3OQ5A 2DFUA 2E65A 2DKGA 1N8RC 2XK0A 4FL6A 1E6GA 1NG2A 3M53A 3J80E 1QKWA 2O01E 2EYQA 3M0TA 3JAME 1WPYA 2DL5A 5GAMd 1X6BA 2X35A 2RQVA 2LTOA 3H6ZA 2DTHA 2YLCA 1I4K1 2A08A 5GAMj 3JCMP 2LNHB 3JRZA 5D6YA 4E7ZA 1TH7A 1W2BA 1G5VA 4QQDA 4M7AG 2GGRA 3VUZA 3TSWA 2ROTA 2Y4YA 2F2XA 4ELZC 3VRYA 4BI3A 5LJ3g 2E5QA 1UHFA 2ROLA 2R5MA 3SEMA 2R5AA 5J26A 2D6FA 4P5NA 1PKSA 4HA8A 4NL3A 2A3LA 1PC0A 2DL8A 2CP6A 4MMKA 3EG2A 3CCRQ 5GAMe 3S6WA 1SRLA 3ZBDA 4QVCA 1UECA 1VYUA 2LT1A 1KQSS 1KHIA 3G71A 3Q1JA 2J06A 3G4SQ 4F7UA 5GANh 1MMGA 2RQTA 4ESRA 1WDXA 1VQLT 1K8AR 2DVJA 5CO7A 2DD4A 1U8RA 3G7ZA 1OX8A 4LNPA 4J9BA 2XI9A 3H41A 4N4GA 5I21A 2DIGA 3MEVA 1WHHA 1OQKA 3VJPA 1V1CA 2KT1A 3GOXA 1MUZA 1HSQA 3V8KA 2ECZA 2DILA 1WHLA 2W0ZA 1RLPC 3RMSA 2M51A 4NOYA 2EWNA 2RQUA 3MHXA 4E7JA 5CKBA 1KC8U 3CMET 1JU5C 3FRNA 4JRIA 1X6GA 1YJWQ 3H0HA 1IHVA 1Q95G 2O4XA 3QJYA 2RHIA 4RCCA 3I56T 1AWWA 3RMQA 1FYNA 4V2SA 1YWPA 2DYBA 3VS2A 2DMOA 4C8QD 5A0GA 4QW2A 4A4KA 2EYXA 2HBPA 1ZSZA 4M75F 1YJ9A 2HAXA 4M78E 1AOJA 1NM7A 2DVEA 4AFZC 5LJ5d 1KJWA 3VS5A 3VS0A 2FPFA 4E7KA 3PFSA 4JRQA 4N0AA 3LH5A 1GRIA 1QWEA 1FWZA 2P0QA 4ME7A 5LJ5j 2OTLA 2CP5A 1VQPQ 2CREA 3HSBA 2DYIA 2LVMA 3OS0A 3H0FA 1AT1B 3CCVT 4HCBA 3BDUA 4JDSA 1VQNA 1OPLA 1S72A 1VQ4A 2COYA 3IQLA 3FB9A 1NYFA 2KSSA 3ME9A 2O31A 2JZ2A 3HHTB 3C0CA 1VQMT 4BD3A 4YTLA 1M8MA 4RTUA 3CMEQ 3TVTA 2D8JA 3VYHB 1U3OA 4R55A 2DPPB 2E41A 4PKCC 4RG8A 3ZL7C 3U23A 1GXIE 2F69A 4FT4A 1KD1U 2LX7A 4M77G 2MIOA 3NHNA 1YN8A 1M2OA 5KYYB 5LJ5e 1R0CB 3OBWA 4OB0B 1Q82U 3JV3A 3G6ET 3SWNA 4JLIA 4DBRA 4QVDA 5GMKm 1WHKA 4N4IA 5CKHA 2CP7A 2JMCA 3CPWA 1N6AA 1SRMA 2QEXA 2YRDA 3VS7A 2J05A 4II1A 4QT7A 1VUBA 4CRIA 2VKNA 4M78G 4C92F 1TOVA 3CCVQ 5IT9E 4A4HA 4M7DB 4J9IA 2DNUA 2JJ9A 4OMNA 1Y07A 2GF7A 4PJOB 3R6NA 4XTXA 3JCMc 1QCOA 4C8QA 4HCKA 2QGFB 1VQMQ 1BCOA 4IUTA 1W2BS 3HRUA 2KMTA 5CQYA 3GF5A 1K9AA 3OS1A 1Y71A 5I11A 4BI4A 5CKFA 4MMLA 4FYXB 2DXUA 2L8DA 2O88A 2LZ6B 4XU1A 1G8XA 1LNXA 1PRMC 1W1FA 1M8VA 1YIJA 2YWWA 1U06A 2DL3A 3BW1A 2JTMA 1BU1A 1U1TA 3FJPA 3M59A 3LWHA 1RAFB 2VASA 2J6OA 4WTOB 2QK0A 5J3BA 3SD4A 1UEBA 5HY6A 4IUUA 1JB0E 1J3TA 4IURA 1Q81C 3THKA 2LDMA 1JRIA 2KYMA 2K9GA 4J6YA 3PMIA 3CD6T 4L5GA 1OU8A 4ANJA 1AWOA 2DE0X 1NLPC 5KYUB 1X6OA 3RNJA 5HCKA 1VQ6T 4C0FA 4LE9A 4PJJA 1E6HA 4RUGA 2EQUA 3SDZA 3KUFA 2CZ6B 6AT1B 1D3BB 2DRKA 3M4GA 5GAMg 1VQ8Q 3UA7A 5GAOp 2V1QA 2DTOA 2AIRB 2W10A 2C0OA 4M75B 2L89A 1OULA 1XOVA 4VUBA 2R57A 2JS0A 5FROA 3BFMA 2SEMA 4Z89A 5GMKi 3CMAT 1YI2Q 3FEOA 2LT4A 2RJCA 5EG2A 3PVLA 2D0NA 1NYGA 4C92C 1EFNA 2NUZA 2NWMA 3GLXA 3E1SA 1M9SA 3L2UA 2HCKA 2GQVA 2KXDA 5IHKA 2M02A 3X20B 2LQKA 4B9WA 5CQXA 1VQOT 1RAAB 1G3TA 5CCAA 5GAN8 1M1KU 2OAWA 1PKTA 4OMFB 2FPEA 2VXFA 2X3XD 4M7DE 4M7AB 4M78F 2E1HA 5KYXA 1VQ6Q 1YITT 4PJOE 4PJNA 2HKNA 4ZN1A 1KC8R 4JJDA 1CSKA 4J9EA 1OX9A 5GAOl 5IH2A 2BTTA 3R6OA 2HDAA 2PZ1A 4JJBA 1BI3A 2MOXA 1R0BG 3O8VA 1JXOA 4XU0A 4Z8AA 4O6JA 2XDDA 1YNZA 3H8ZA 3CCST 3FLGA 2EGCA 2AKKA 3JCMd 3S3NA 4MDWA 1EX4A 3OYMA 4A53A 1QVFA 4M4ZA 3A8LB 1KHCA 2ZPFB 2CZ1B 2P4TA 2PVOB 1UFFA 1Q7YC 2RNAA 3REBB 3QHSA 3L2ZA 3CPWS 2E6ZA 2VGNA 1Y96B 1VQKT 3MPUB 2L3QA 1ZX6A 4KUIA 4XTYA 4C0DB 3OYEA 3FDRA 1IGQA 3VS4A 4DBQA 1EIFA 1BK2A 5HKCA 1PD1A 2V8IA 1ACMB 1YITQ 4BB7A 2HQHA 1IRXA 4XTUA 2NUTA 2JT4A 4JS5A 4PFPA 3JCMe 2PUKB 3EH2A 3I55A 1VQ9A 2CP3A 4CI0C 2RK2A 1RAGB 4JJNK 5LJ5g 3MEUA 5LJ3f 1KD1R 2ED1A 2Y4XA 4J7FA 1MV3A 1WXBA 1ZA1B 3A98A 3L2QA 4OF1A 2JW4A 3CCEQ 1Q82R 9ATCB 4BY6B 2OTJA 1AEYA 4X34A 4LUDA 5CVIA 2K2VA 4AFUC 3M57A 3BY7A 5ECAA 4J9HA 3PTAA 4R56A 2K7AA 3I5RA 1PWTA 3HFNA 2AZVA 3EGXB 2PTKA 2MF2A 4IIMA 4DEXA 1ABOA 1GFCA 4M78C 3M4YA 4FW1A 3MKDA 5CKDA 1VQOA 3OW2S 1WFWA 1VQ5A 3CEYA 1VQ7A 1QKXA 1G2BA 1SKUB 3C95A 2VXEA 1JJ2A 1IREB 3RDVA 4M7DD 1Q86C 2FZKB 2V8JA 3CPFA 4C0GA 4JJCA 4M7AE 4PJOD 2RB6A 2BZXA 3V7CA 2KK4A 1VA7A 2K3XA 2KROA 3QWXX 3META 2BKDN 4A4GA 4M77B 3EG3A 4MDXA 1HJDA 3CCQA 3JB9F 5FU6C 4DBHA 3OYKA 2LQNA 3RBBB 3M55A 1VYTA 2KDSA 2EQMA 2VVKA 3GNGA 3CBOA 1WJSA 3URGA 1JO8A 2EYWA 2CS7A 1ARKA 2Z0WA 5KH6A 4HCZA 1I8FA 2QA4T 1M90U 2C0TA 4ZN3A 3CCRT 3HKSA 1OV3A 3CCLA 2K3YA 2NUPB 4M78B 2ZPGB 2COZA 4RTVA 1TSFA 2VGMA 2JNGA 3KFVA 1FMWA 2QDYB 4TVRA 1QP3A 1O9SA 3G4ST 3M54A 2OAUA 4UC4A 3V8JA 3P8BB 1TUGB 3PIPA 1C1AA 2IVWA 5HK3A 3SB2A 1P92A 2ABLA 3WVDB 1LOJA 2KRMA 1K9MU 1UGQB 5FU6B 1TTHB 4ZTFA 1X2QA 3EG9A 1WJRA 1WXUA 2GTOA 7AT1B 2AKLA 3AHUA 5FLXE 1O75A 1GFDA 4HXJA 2KVQG 5IHIA 4M7DF 1MMAA 2D1XA 1MHNA 1JQQA 2LJ3A 4PK4A 1F1BB 2QDLA 3QPHA 4PJOF 1YHQA 1UJ0A 3VUBA 1YCSB 2HBWA 3EGUA 2JMAA 3DLMA 4M75D 3VS6A 1UGRB 2XKOC 2CZ0B 4J8OA 2LCCA 1YJWT 2JTFA 3F70A 3HFOA 2QA4Q 2SRCA 4F04B 1WNLA 1QVFS 1U1SA 3QXEB 1JBMA 3FJ5A 3SHWA 2E3IA 1FX7A 1IXDA 2A37A 4BE1A 3CCJA 4KRTA 1M1KR 1PRLC 3PVQA 3S3OA 3OBYA 1TUDA 3EG1A 3D7SB 3O5ZA 4EIKA 2YUQA 3H9NA 1B34A 2QXFA 1H92A 1YJ9Q 2JVVA 4LDYA 3J81E 5L8RE 1VQPT 2QQBA 1WJQA 2EQJA 3SFMA 1SF9A 2WACA 4C8QG 2CUBA 4XK8E 4M7AD 2E10A 5D6XA 4RTZA 4BDYA 1AD5A 2X4WA 5HK0A 1VQNQ 1S72Q
chains in the Genus database with same CATH topology
1BI1A 3QYGB 2EIFA 3QIIA 3X25B 3JB9G 1VQ8A 3MO8A 2PVDB 4M77E 3OS1A 5LJ3h 1Y71A 4XTWA 4BI4A 5CKFA 3OA6A 4MMLA 1Q82C 2DXUA 2HD0A 2L8DA 2MWOA 3NTHA 4KULA 2L3RA 3CCSA 1DJ7B 1X01A 5GMKe 3OYCA 3CCQT 4XU1A 2DK3A 1LNXA 4LD6A 4RG2A 5I2MA 4JS4A 1QVGS 4QQ6A 1M8VA 2CGHA 3OS2A 3V7RA 2DO3A 1XTDA 1YIJA 4EDUA 1G3WA 3PMTA 3TCJA 2M16A 3JCMf 2ZPIB 5DLOA 3BW1A 4M7AF 4HT9A 2JTMA 1U1TA 3FJPA 3M59A 4C92D 3LWHA 3M56A 4X9CA 1QVPA 2GFUA 2CKKA 2RHYA 3QYHB 5GAOm 3JCMJ 4EMKA 5CAIA 1VQKA 4KT0E 4C92B 5J3BA 3SD4A 2K5LA 1UEBA 2MWPA 2DJZA 5HY6A 5GANf 2PQWA 2LC4A 4IUUA 1JB0E 3GPLA 3DLLA 3CCLT 4IURA 3JCMg 3LW5E 3OY9A 1SSFA 1Q81C 3DB3A 4OGCA 2LDMA 1JRIA 2RA2A 3KXTA 3JB9J 1BI0A 4M75A 4C8QE 1K73C 1NE8A 2P0PA 1K8AC 4J6YA 2E6NA 3PMIA 1YJ9T 5GMKh 4A4FA 2RI2A 3RKYA 3V8LA 1KQSA 3S3MA 3CD6T 4L5GA 5DM7R 1W4SA 2EQKA 4OB3B 3TREA 3L42A 4NS5A 5GANg 3CCMA 1JJ2S 5DY9A 3L2VA 4BDZA 3QG1A 4JLGA 2OTLT 3CC2A 3P8HA 1XNIA 5GAMf 3JB9H 3RESA 4FIBA 5GAN7 2YHTA 3CC7T 3A8OB 4M7DC 2XDPA 3OB9A 2KY9A 2YRVA 1X6OA 4PJOC 3BDLA 4FSXA 2DXCA 1VQNT 2K5IA 4ATOA 1I81A 3HRTA 2I2LA 1VQ6T 4C0FA 1N9SA 3LYIA 5GMKl 3JB9I 1UGPB 4MZTA 1VQ4T 4EMKB 1S72T 3QKJA 1UGSB 4KUDK 4M7DG 2ZPBB 3JCMQ 4WF2A 3RIRA 4A4EA 3FC3A 4PJOG 4E47A 4Z02A 2EQUA 3SDZA 3KUFA 4JRPA 3MEWA 2CZ6B 2EFIA 4C0ZA 2ZPEB 1M5Q1 1D3BB 3CBMA 3HRSA 3M4GA 5GAMg 5GAOp 4M7DA 5A0DA 3PT9A 3X28B 2DTOA 4PLLA 3CXCS 1QP2A 4ELYC 4XTZA 4M75B 4PJOA 2L89A 1YHQT 2RI5A 3RKWA 5GAN3 4XU2A 1NJIU 1XOVA 4VUBA 2R57A 2EJGA 4D6WA 5FROA 4J7IA 3BFMA 4L6V5 3NFCA 3PGGA 5FU7B 4M75E 5GMKi 3CMAT 2NLUA 2E12A 2H3JA 3EAEA 1YJNT 2XDBA 1ZQ1A 4BE2A 3FEOA 3OS5A 2LT4A 2A7YA 2RJCA 5EG2A 3N5BB 3OYAA 2X4JA 3A8GB 3EFRA 2QQRA 4C92C 4F7UF 4C5IA 1UB4A 5FRNA 3OMCA 3GLXA 3E1SA 1M9SA 3L2UA 5IAYA 1VQLA 2DZ9A 2GQVA 2RHZA 5C6SA 3LX7A 1YCYA 3CCJT 1KD1C 3X20B 4IUQA 3INZA 1OZ3A 2LQKA 4B9WA 5CQXA 4OP0A 4C92G 1VQOT 1Q7YU 1NPRA 1Q81U 2QEXT 3UT1A 4Q5WA 4IKFA 1G3TA 4RKUE 3WXMB 5CCAA 4N4HA 1BKBA 4QVZA 5GAN8 2GCXA 3OYLA 1M1KU 1ZBXA 3E9GA 5M9OA 4C92A 2XG8D 5A0LA 3OYBA 4E7IA 1N8RU 2C06A 2FL7A 4OMFB 2VXFA 4M7DE 2RJFA 4M7AB 4M78F 2D9TA 2E1HA 3CC4T 1ZHIA 2MMPA 1YITT 4PJOE 4ZN1A 4C5EA 3PNWC 5CKEA 2L5QA 3MP1A 2RK1A 2D0QB 2EJ9A 5GAOl 2VUBA 4PLIA 5CQYA 3CCEA 1NJIC 2PU9B 1M4ZA 4LDUA 3OYYA 4C5GA 3R6OA 3VU3C 4GY5A 4DOVA 4EMKC 5J39A 3LWIA 4J83A 3CMEA 1BI3A 4J6XA 1VQ8T 1N9RA 4X9DA 2JOYA 2EJFA 3LLRA 3O8VA 4XU0A 3QBYA 3J7AF 4O6JA 2XDDA 3GIBA 3H8ZA 3CCST 3FLGA 3X26B 1AHJB 3JCMd 3S3NA 2LRQA 3NTIA 1R8OB 4MDWA 1KG1A 2WSFE 3CCUA 2MAMA 4M75C 3I56A 3JCMW 5I2SA 2QA4A 2K4YA 3OYMA 2G3RA 2KAFA 4PL6A 4A53A 3CCRA 1QVFA 3A8LB 1YIJT 1KHCA 3JCMV 1YI2T 2ZPFB 2CZ1B 4A54A 1IZ6A 2E70A 2P4TA 3A8MB 2PVOB 5FU7C 4M75G 4RCBA 3OYFA 5GANd 1Q7YC 1I5LA 1D3BA 3QHSA 3G4SA 2LCLA 4KBMB 4C92E 4M78D 4XU3A 3L2ZA 2B8AA 3OQ5A 3MP8A 3CPWS 2E6ZA 2QQAA 2VGNA 1Y96B 1M1KC 2DEQA 1VQKT 2E65A 5GANj 1OYXA 1XQHA 2BIVA 2DKGA 2FHDA 1N8RC 4DQ2A 3M5AA 4XTYA 4KUIA 4C0DB 3OYEA 2XK0A 3FDRA 4FL6A 3M53A 1BIBA 3J80E 3OYJA 1YBYA 1X75C 4JRKA 1EIFA 2O01E 5LJ5f 3L2RA 2EYQA 3CCVA 5HKCA 2VV5A 5IN1A 2V8IA 1WPYA 3JAME 1FXXA 2RHUA 5GAMd 4BB7A 2X35A 4XTUA 2ZCFB 2LTOA 4JS5A 2M9UA 2DZCA 2DTHA 2YLCA 3H6ZA 3JCMe 2PUKB 2X4XA 1I4K1 3I55A 1VQ9A 5GAN5 5GAMj 3JCMP 4CI0C 3JRZA 4M7AC 5D6YA 2RK2A 1WQ7A 2DXTA 3QUIA 1TH7A 2QQSA 4OGEA 1VQMA 1W2BA 3CC2T 4JJNK 4IUVA 5LJ5g 3MEUA 2CYZB 2O4XB 5LJ3f 3HPWA 4LDXA 4ZGDB 1G5VA 3WVEB 2Y4XA 2ZPHB 4J7FA 5GAOr 4QQDA 1VIFA 2V8KA 4M7AG 1KQ1A 1Q86U 3VUZA 3L2QA 2RH2A 4OF1A 5GANe 3TEEA 1NZ9A 2Y4YA 4B9XA 1YJWA 4ELZC 4M7AA 2LX9A 1QVGA 4BI3A 4HT8A 1H641 3LH0A 4BY6B 2BUDA 5LJ3g 2OTJA 3P8DA 3CBPA 2E5QA 1G3SA 4X34A 2WSEE 3UDCA 3G6EA 4DA4A 5CVIA 2K2VA 2R5MA 3EFSA 3OMGA 5GAN4 1BYMA 4M77F 2R5AA 3BY7A 3M57A 5J26A 3PTAA 2D6FA 2VC8A 4P5NA 1BI2A 4R56A 4HA8A 4NL3A 2A3LA 3A8HB 3RERA 1YJNA 3JCMh 2FYKA 4MMKA 2PUOB 4QQGA 2LNVA 3HL8A 3HFNA 2MI6A 1QW1A 3S6WA 5GAMe 3ZBDA 4QVCA 4OB2B 2M0OA 2AHJB 3KBGA 2LT1A 3QZ5B 1KQSS 1NPPA 3MP6A 3OSVA 4GLKA 1KHIA 3G71A 2RM4A 2MF2A 2DXBA 3Q1JA 2ZZDA 5CK9A 4F7UA 2E64A 3MEAA 4EPCA 5GANh 1OZ2A 3OYHA 4M78C 3M4YA 3DB4A 1VQPA 1VQLT 5CO7A 3GNFB 4C0DC 2RJDA 5CIUA 2DD4A 3C4SA 5CKDA 3OW2S 1VQOA 3G7ZA 1U8RA 1VQ5A 3CEYA 2WSCE 1VQ7A 3M9QA 3HP9A 2XI9A 3RUXA 4N4GA 5KCHA 3C95A 2VXEA 5I21A 2DIGA 1IREB 4JUVA 1JJ2A 3MEVA 1VIEA 1Q86C 2V8JA 3VJPA 3UPUA 5KE3A 4M7DD 3CPFA 4C0GA 4OB1B 1Y96A 2ZGWA 4C8QF 3GOXA 4M7AE 4PJOD 4M78A 2RB6A 2FB7A 3V7CA 3V8KA 2CZ7B 3TU4K 2KK4A 2JN0A 2XU8A 2K3XA 4M77D 4HCCA 2R58A 5GAMh 3JSCA 3META 2BKDN 3RMSA 4A4GA 4NOYA 1M1FA 2EWNA 3MHXA 4M77B 3SWNB 5KE2A 4MDXA 3CCQA 3JB9F 2K57A 5FU6C 3CCET 3L1AA 3OYKA 4BUGA 4E7JA 1WQWA 3RKXA 5CKBA 3QO3A 4F7UB 3OYDA 1KC8U 4LDWA 4ZGEB 3CXCA 3CMET 3M55A 2QQ9A 2KDSA 2P0KA 4BI8B 3FRNA 3LGFA 2LQ8A 2EQMA 3LGLA 4JRIA 2Y90A 3GNGA 5C0MA 2F5KA 3CBOA 1WJSA 3URGA 1MGQA 4E7LA 2DTIA 4BY6C 4F7UE 2RI3A 2CS7A 2O4XA 3QJYA 5KH6A 4ZTJA 1B34B 2DAQA 3V7SA 2QI2A 2RHIA 2RJEA 2KQWA 4HCZA 4RCCA 3VYGA 3PIOA 3I56T 3RMQA 1PSFA 3CCUT 1I8FA 2QA4T 1YI2A 2EKOA 1M90U 4ZN3A 3CCRT 3A5ZB 4V2SA 3HKSA 4N0AC 3CCLA 2K3YA 4XTVA 4M78B 2ZPGB 4XAXB 3ER0A 2VGMA 2HQEA 2JNGA 4C8QD 3QJ6A 2QDYB 4TVRA 2XHCA 4QW2A 1QP3A 4A4KA 5A0GA 1O9SA 3G4ST 3FIFA 2HQXA 2HBPA 4M75F 1YJ9A 2HAXA 4C8QB 4M78E 3CD6A 2DVEA 3OYGA 4BACA 5LJ5d 3M54A 3C94A 2IG0A 2OAUA 4E7KA 4UC4A 3PFSA 2JUFA 4N0AA 3P8BB 3V8JA 4JRQA 3QDRB 3PIPA 3L2WA 2IVWA 3JCMb 5HK3A 3JB9D 2M1HA 1FWZA 2P0QA 4ME7A 3E9FA 5LJ5j 3CCMT 4Y28E 2OTLA 3SB2A 3VKIA 1P92A 4J6WA 3OW2A 3CC7A 3HSBA 1V29B 1N27A 2LVMA 3JCMX 3OS0A 3CCVT 4HCBA 3WVDB 1LOJA 2X4YA 3BDUA 2RO0A 4JDSA 1VQNA 1K9MU 1BIAA 3ZEHA 4FT2A 1VQ6A 5DLQE 1UGQB 5LJ3d 1S72A 5FU6B 1VQ4A 3NTKA 3OSSC 4ZTFA 1KC8C 3FB9A 1WJRA 2XIDA 4FU6A 3I55T 2DD5A 2KSSA 3ME9A 1VQ9T 4ZGJB 3AHUA 3E19A 5LJ3j 2JZ2A 3HHTB 1OI1A 3MCAB 5FLXE 1O75A 2HNIA 5GAOn 1VQMT 1RL2A 2F5TX 2EAYA 4BD3A 2KVQG 4YTLA 3QZ9B 4M7DF 4EMGA 3SWNC 3ZFJA 1MHNA 4M77C 3VYHB 1HK9A 4Y91A 2DPPB 3QPHA 4PJOF 4R55A 1YHQA 2E41A 5FRMA 1M1GA 1M90C 4PKCC 4RG8A 3VUBA 3DKMA 1RI0A 3GP8A 1GXIE 2F69A 4FT4A 5AYFA 1KD1U 3DLMA 4M75D 1UGRB 2DIQA 2CZ0B 2XKOC 2LCCA 4J8OA 4L59A 4M77G 2JTFA 3F70A 3CMAA 2YLBA 2PVGB 3HFOA 5LJ5e 4EMHA 3OBWA 4OB0B 5D6WA 1Q82U 2OTJT 1WNLA 3G6ET 1QVFS 3SWNA 4JLIA 4M77A 4MZMA 4F7UG 3M58A 1U1SA 4QVDA 2QTXA 3QXEB 5GMKm 1JBMA 4PNOA 5KCOA 5GAOq 4N4IA 3UWNA 5CKHA 4FM4B 3OYNA 1FX7A 3CPWA 1Y7XA 4BE1A 3CCJA 1N6AA 3ASKA 3X24B 4RMOA 5A2QE 5LJ3e 4C5HA 2GFAA 4DOWA 5GAN2 3S3OA 3OBYA 2QEXA 1KQ2A 5GMKj 1PSEA 1H3ZA 1K9MC 4OVAA 3G71T 4II1A 1B34A 1VUBA 2QXFA 4NL2A 4CRIA 4J5YA 4C8QC 4BE0A 4LD9K 1LJOA 4M78G 3T9NA 2JVVA 4HKEA 4LDYA 3J81E 4LDVA 5LL6S 2FVUA 5L8RE 3QSUA 4C92F 5IT9E 4O5VA 1VQPT 2QQBA 1WJQA 2EQJA 2RD1A 4A4HA 1G3YA 4XQ3A 3SFMA 3CC4A 2RHXA 1VQ5T 4IUPA 2WACA 1YITA 4C8QG 5LJ5h 1VQ7T 4M7DB 1Y07A 2GF7A 5CR2A 4XK8E 4M7AD 1HXDA 1K73U 2E10A 1K8AU 4PJOB 3VV0A 4E7HA 1WGSA 4XTXA 1YJWT 3JCMc 2XD0A 4MZPA 5D6XA 4BDYA 4C8QA 3C12A 2X4WA 5HK0A 3OYIA 2VYTA 2XICA 4IUTA 1W2BS 2K5FA 3HRUA 5GAN6 2KMTA 3GF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQE A;  2QQR A;  3QII A;  3QJ6 A;  4C5I A;  5FRN A;  4QQD A;  4QW2 A;  3MO8 A;  3OMC A;  3OA6 A;  3OS1 A;  3L2Q A;  3L2U A;  2HQX A;  5IAY A;  2RHZ A;  5C6S A;  3LX7 A;  2L8D A;  2MWO A;  3NTH A;  2L3R A;  4IUQ A;  1OZ3 A;  4BAC A;  4B9X A;  4B9W A;  3OYC A;  2IG0 A;  4IKF A;  4E7K A;  4UC4 A;  3PFS A;  3UT1 A;  4Q5W A;  4LD6 A;  4RG2 A;  4QQ6 A;  3LH0 A;  3L2W A;  2BUD A;  2M1H A;  3P8D A;  4N4H A;  2E5Q A;  4QVZ A;  3E9F A;  4X34 A;  3OS2 A;  3OYL A;  4EDU A;  3PMT A;  3E9G A;  5M9O A;  4E7I A;  2R5M A;  2M16 A;  3OYB A;  3OMG A;  2R5A A;  1N27 A;  2LVM A;  5J26 A;  3OS0 A;  2RJF A;  2X4Y A;  2RO0 A;  2D9T A;  3ZEH A;  3NTK A;  2GFU A;  2CKK A;  2RHY A;  4ZTF A;  4QQG A;  3S6W A;  4C5E A;  1WJR A;  3PNW C;  3MP1 A;  4FU6 A;  3ME9 A;  3SD4 A;  2M0O A;  2MWP A;  2JZ2 A;  4PLI A;  2PQW A;  1OI1 A;  4IUU A;  3MP6 A;  4IUR A;  3OY9 A;  4BD3 A;  4C5G A;  1SSF A;  3Q1J A;  3DB3 A;  4GY5 A;  5J39 A;  2LDM A;  1MHN A;  3MEA A;  1OZ2 A;  5FRM A;  3OYH A;  3DB4 A;  3LLR A;  3O8V A;  2E6N A;  3PMI A;  3QBY A;  4A4F A;  1RI0 A;  2RI2 A;  2RJD A;  3C4S A;  5CIU A;  3H8Z A;  3S3M A;  3FLG A;  3S3N A;  3CEY A;  3DLM A;  2LRQ A;  3NTI A;  3M9Q A;  4L59 A;  2DIQ A;  2LCC A;  4N4G A;  2EQK A;  2JTF A;  3F70 A;  5KCH A;  2DIG A;  3L42 A;  4NS5 A;  3MEV A;  3L2V A;  4BDZ A;  5D6W A;  3OYM A;  2G3R A;  4PL6 A;  5KE3 A;  1KHC A;  3P8H A;  1XNI A;  3GOX A;  2XDP A;  3OB9 A;  2YRV A;  3OYF A;  5KCO A;  3BDL A;  4N4I A;  2K3X A;  3UWN A;  2R58 A;  3LYI A;  3MET A;  2BKD N;  3OYN A;  2B8A A;  3OQ5 A;  3MP8 A;  3QKJ A;  4A4G A;  4BE1 A;  3ASK A;  5KE2 A;  1OYX A;  4A4E A;  2BIV A;  4C5H A;  3FC3 A;  2GFA A;  2FHD A;  4Z02 A;  3S3O A;  2EQU A;  3KUF A;  3OYK A;  3MEW A;  2EFI A;  3OYE A;  1H3Z A;  2XK0 A;  4E7J A;  3FDR A;  4FL6 A;  4OVA A;  4II1 A;  4BE0 A;  4CRI A;  3OYD A;  3OYJ A;  4PLL A;  2P0K A;  2L89 A;  3LGF A;  2RI5 A;  2EQM A;  3LGL A;  5C0M A;  3L2R A;  2F5K A;  1WJQ A;  1WJS A;  2R57 A;  2EQJ A;  4A4H A;  5IN1 A;  5FRO A;  4E7L A;  2RHU A;  2RHX A;  2RI3 A;  4IUP A;  2WAC A;  2O4X A;  2X35 A;  5KH6 A;  2DAQ A;  4ZTJ A;  2LTO A;  2RHI A;  2RJE A;  4HCZ A;  2GF7 A;  2NLU A;  3H6Z A;  3EAE A;  2X4X A;  4E7H A;  1WGS A;  2EKO A;  4BE2 A;  3FEO A;  5D6X A;  5D6Y A;  2RJC A;  4BDY A;  2X4W A;  3OYA A;  2QQS A;  3OYI A;  2K3Y A;  2VYT A;  4IUV A;  4IUT A;  3MEU A;  2O4X B;  3OYG A;  1G5V A; 
#chains in the Genus database with same CATH topology
 1RUW A;  1BI1 A;  3X25 B;  2EIF A;  3MO8 A;  1R77 A;  2PVD B;  4M77 E;  3OA6 A;  5LJ3 h;  4KUL A;  3NTH A;  1SPK A;  2L3R A;  2KEA A;  4LD6 A;  4JS4 A;  4X1V A;  4PJL A;  1G3W A;  1TUC A;  2RPN A;  1W70 A;  5KYU A;  1QCN A;  4C92 D;  4HVU A;  1YJN Q;  3QYH B;  5GAO m;  4KT0 E;  1N5Z A;  2K5L A;  1TXQ A;  2MWP A;  2DJZ A;  2LC4 A;  1WA7 A;  2DER A;  3JCM g;  3KXT A;  1X69 A;  1B7T A;  2V26 A;  4M75 A;  1K73 C;  1K8A C;  1RAB B;  2KBT A;  2E6N A;  2KGT A;  5GMK h;  1AVZ C;  3RKY A;  3V8L A;  2QEX Q;  2GTJ A;  1UDL A;  4FSS A;  4HVW A;  2EQK A;  3TRE A;  3L42 A;  4NS5 A;  1SSH A;  1JJ2 S;  1M2V B;  3QWY A;  4AFS C;  4JLG A;  1M3B A;  1B3Q A;  3P8H A;  1XNI A;  5GAM f;  3JB9 H;  4HVV A;  4FIB A;  3CC7 T;  2YHT A;  4M7D C;  2XDP A;  2YRV A;  4Y92 A;  4PJO C;  3M0R A;  4FSX A;  4ATO A;  2HSP A;  2K5I A;  3HRT A;  3LYI A;  2EGA A;  1UGP B;  4MZT A;  4EMK B;  3QKJ A;  4OMM A;  2ZPB B;  4WF2 A;  3RIR A;  4D8K A;  4JRP A;  3MEW A;  4C0Z A;  1FMV A;  3CBM A;  2FRY A;  4WCI A;  4M7A F;  3PT9 A;  1IHW A;  4PLL A;  1QP2 A;  2RI5 A;  1K1Z A;  3RKW A;  5GAN 3;  1NJI U;  2EJG A;  1E7O A;  2YUO A;  4J7I A;  2FEI A;  3EFO A;  3NFC A;  1G83 A;  1YIJ Q;  1CKA A;  2YUN A;  3BE3 A;  1ZQ1 A;  4K11 A;  3OYA A;  4AFQ C;  3EFR A;  2QQR A;  2OJ2 A;  1VQL A;  2RHZ A;  3LX7 A;  1YCY A;  2MK5 A;  3INZ A;  1OZ3 A;  1PCX A;  4RKU E;  1ZBJ A;  1I1J A;  1BKB A;  2EYZ A;  4QVZ A;  2GCX A;  4C92 A;  3CC7 Q;  2BE9 B;  4B6M A;  1N8R U;  2O9V A;  2D9T A;  3CC4 T;  4C5E A;  5CKE A;  2L5Q A;  3MP1 A;  5KYW A;  2VUB A;  2PU9 B;  4LDU A;  4C5G A;  4CC2 A;  4GY5 A;  1QCF A;  5J39 A;  3CME A;  1VQ8 T;  1N9R A;  8AT1 B;  2RMO A;  3LLR A;  3J7A F;  3GIB A;  1M90 R;  1KG1 A;  1R8O B;  2HMA A;  2YUP A;  3I56 A;  4M75 C;  5I2S A;  2LQW A;  2DBK A;  2KAF A;  1YI2 T;  2E70 A;  4RCB A;  5GAN d;  2LCL A;  1BB9 A;  4KBM B;  4M78 D;  4XU3 A;  3MP8 A;  2QQA A;  2DEQ A;  5GAN j;  1OYX A;  1XQH A;  2BIV A;  3M5A A;  2XMF A;  2KRS A;  1BIB A;  1K9M R;  1YBY A;  1X75 C;  5LJ5 f;  4GLM A;  3L2R A;  3CCV A;  1KK7 A;  2VV5 A;  3CC4 Q;  1Z9Q A;  2DEU A;  2QYZ A;  2AK5 A;  5KYN A;  1KFZ A;  2DZC A;  2HL3 A;  2X4X A;  5GAN 5;  4M7A C;  1TWB A;  2DXT A;  3CC2 T;  2QQS A;  4OGE A;  1VQM A;  3PE0 A;  4IUV A;  4LDX A;  2CYZ B;  1JXM A;  2O4X B;  4ZGD B;  4J9G A;  3CXC P;  5GAO r;  1VIF A;  2V8K A;  5GJV B;  2RH2 A;  4CC4 B;  5GAN e;  3M0Q A;  1GBQ A;  1RLQ C;  4FYV B;  3TEE A;  1QVG A;  3LH0 A;  2X9H A;  3P8D A;  3CBP A;  1G3S A;  3G6E A;  1ZSZ B;  4ORZ A;  1BYM A;  3OMG A;  4M77 F;  2COW A;  2VC8 A;  2PNI A;  1UTI A;  3RER A;  3MJX A;  2LNV A;  3HL8 A;  3NGP A;  2MI6 A;  1QW1 A;  2RN8 A;  2EGE A;  2M0O A;  2AHJ B;  2O2O A;  1NPP A;  3MP6 A;  3OSV A;  5CK9 A;  1WHJ A;  2DXB A;  1Q7Y R;  2E64 A;  2KE9 A;  2KNB B;  3MEA A;  4EPC A;  2P4R A;  3OW2 P;  3DB4 A;  3GNF B;  4C0D C;  2RJD A;  3C4S A;  2RQW A;  1MND A;  3M9Q A;  3HP9 A;  1I07 A;  1UHC A;  5KCH A;  3CCM Q;  1A0N B;  2ESW A;  4AT1 B;  1VIE A;  3NMZ C;  4OB1 B;  3CC2 Q;  2ZGW A;  2NUP A;  4M78 A;  2F2W A;  3I9Q A;  2OX7 A;  5GJW B;  1NEG A;  3E2U A;  2JN0 A;  2XU8 A;  3H0I A;  4HCC A;  5GAM h;  1HD3 A;  3I55 Q;  1VQ9 Q;  1UJY A;  2J6K A;  3SWN B;  1RAD B;  1RAI B;  5KE2 A;  2K57 A;  3CCE T;  1CKB A;  1UE9 A;  3L1A A;  3RKX A;  4OML A;  4ZGE B;  2ENM A;  2DX1 A;  2QQ9 A;  2P0K A;  2FRW A;  3LGL A;  5C0M A;  4E7L A;  2DTI A;  4BY6 C;  4F7U E;  2RI3 A;  2OTJ Q;  2QI2 A;  2RJE A;  3VYG A;  3CCU T;  3QDF A;  1Y57 A;  1YI2 A;  1T3S A;  3A5Z B;  4LUE A;  2RF0 A;  4XTV A;  1UGV A;  4CC3 A;  3ER0 A;  2HQE A;  3FIF A;  2KYB A;  4C8Q B;  1WXT A;  1BBZ A;  3CD6 A;  5D7U A;  2FZC B;  2IG0 A;  3C94 A;  4CC7 A;  4HT8 A;  2JUF A;  3L2W A;  3JCM b;  3JB9 D;  2M1H A;  2K6D A;  4FCY A;  2D8H A;  1N27 A;  3JCM X;  1VQ5 Q;  1VQ7 Q;  1MNE A;  1QQJ A;  2RO0 A;  1VQ6 A;  2YXY A;  5DLQ E;  3NTK A;  1KC8 C;  2L2P A;  2XID A;  1PG5 B;  4FU6 A;  2DD5 A;  2JM9 A;  3E19 A;  3A1P A;  1K0X A;  1OI1 A;  1NJI R;  2HNI A;  2DF6 A;  3M0S A;  4EMG A;  1AWX A;  4M77 C;  2E5K A;  1HK9 A;  4Y91 A;  5FRM A;  2FZG B;  3DKM A;  2EVR A;  3GP8 A;  5AYF A;  1K4U S;  3CMA A;  1U5S A;  3CCU Q;  1RAC B;  2PVG B;  4EMH A;  5D6W A;  1HYO A;  5IHN A;  4F7U G;  1KQS P;  3M58 A;  2CT4 A;  2QTX A;  3EH1 A;  4PNO A;  5KCO A;  4J9C A;  3VS3 A;  1YWO A;  3OYN A;  1Y7X A;  1RAH B;  1K76 A;  3ASK A;  2JTE A;  2KR3 A;  5A2Q E;  1ABQ A;  5GAN 2;  1KQ2 A;  1N8R R;  1PSE A;  3G71 T;  2ED0 A;  4BE0 A;  4LD9 K;  4J5Y A;  1ZUY A;  1LJO A;  3T9N A;  4LDV A;  5LL6 S;  1V76 A;  2FVU A;  3QSU A;  2RD1 A;  1G3Y A;  5FWC A;  2IIM A;  1D0X A;  1YIT A;  3TQ7 P;  5LJ5 h;  2QGG A;  1WLP B;  1HXD A;  3VV0 A;  2XD0 A;  3C12 A;  2EPD A;  3OYI A;  2VYT A;  2MPX C;  1KD1 C;  2E4H A;  3OYG A;  1RI9 A;  2C0I A;  3QYG B;  3QII A;  2HZY A;  4J9F A;  2IPO B;  1LVK A;  4XTW A;  4PFO A;  1Q82 C;  2FG0 A;  2HD0 A;  2MWO A;  3CCS A;  2CUD A;  1X01 A;  3OYC A;  1GL5 A;  5I2M A;  4RG2 A;  2H8H A;  1QVG S;  4QQ6 A;  1YHQ Q;  2CGH A;  3OS2 A;  1M2V A;  3V7R A;  2DO3 A;  1XTD A;  4AG1 C;  3TCJ A;  2M16 A;  1D1A A;  3JCM f;  1X27 A;  4KH1 B;  4OMP A;  4HT9 A;  1M30 A;  2KRN A;  3M56 A;  1GCP A;  1QVP A;  3JCM J;  2CKK A;  4EMK A;  5CAI A;  1VQK A;  2PQW A;  3GPL A;  3DLL A;  3OY9 A;  3G71 Q;  3LW5 E;  1SSF A;  2RA2 A;  3JB9 J;  3CCJ Q;  5KYY A;  1ZLM A;  4C8Q E;  2P0P A;  2ZAE A;  2DRM A;  1YJ9 T;  3EHQ A;  4A4F A;  4FYY B;  3S3M A;  1SG5 A;  1LCK A;  1JJ2 P;  1D0Y A;  2HSE B;  4OB3 B;  2LCS A;  5GAN g;  4BDZ A;  4JZ3 A;  3QG1 A;  2OTL T;  3RES A;  3A8O B;  2KY9 A;  2CH4 A;  1GCQ C;  3BDL A;  2DXC A;  2YRC A;  1VQN T;  1I81 A;  2I0N A;  2I2L A;  1S72 T;  3JB9 I;  1VQ4 T;  3UA6 A;  4KUD K;  4E2F B;  4A4E A;  2A0F B;  3UF4 A;  4Z02 A;  1WHM A;  2ATC B;  2EFI A;  1W6X A;  1M5Q 1;  2ZPE B;  4AMC A;  4M7D A;  3X28 B;  4PJO A;  1WYX A;  2K2M A;  4XTZ A;  4OMO A;  2V1R A;  4GBQ A;  2G6F X;  5FU7 B;  2L3P A;  2E12 A;  1YJN T;  2B86 A;  4BE2 A;  2DET A;  1D1C A;  2A7Y A;  1AWJ A;  1QLY A;  2FO0 A;  2A28 A;  3A8G B;  2NUT B;  4F7U F;  5FRN A;  1MV0 B;  1UB4 A;  3OMC A;  5IAY A;  5C6S A;  3EGD B;  4C92 G;  1Q7Y U;  2QEX T;  4Q5W A;  3WXM B;  2RQR A;  1B07 A;  1WIE A;  2EW3 A;  2OTL Q;  1K73 R;  5M9O A;  3E9G A;  1OEB A;  1PD0 A;  5A0L A;  3OYB A;  1W2B P;  2F2V A;  2BZY A;  4AG2 C;  4JZ4 A;  1ZHI A;  1VQ4 Q;  8ATC B;  3PNW C;  2RK1 A;  2D0Q B;  1M4Z A;  3OYY A;  3VU3 C;  4EMK C;  1TS9 A;  3LWI A;  4J83 A;  4J6X A;  1ZSG A;  2JOY A;  2EJF A;  1M3A A;  1IGU A;  3QBY A;  3X26 B;  2WSF E;  3JCM W;  2MAM A;  4QKU A;  4E7S A;  2QA4 A;  2DBM A;  2HL5 C;  3CCR A;  1UUE A;  1YIJ T;  1QWF A;  2HEQ A;  3A8M B;  3OYF A;  1I5L A;  1D3B A;  3G4S A;  2B8A A;  1T0H A;  1M1K C;  2GQI A;  2FHD A;  4DQ2 A;  5IXF A;  1TU0 B;  1YFN A;  2LMJ A;  1I0C A;  3REA B;  1WI7 A;  3OYJ A;  1VQL Q;  2QTV A;  2O9S A;  1T0J A;  4JRK A;  5IN1 A;  1FXX A;  2RHU A;  2ZCF B;  2M9U A;  2VWF A;  2JXB A;  2L3S A;  1WHG A;  3NPF A;  1WQ7 A;  3QUI A;  1JEG A;  3HPW A;  1C6V X;  3WVE B;  5I22 A;  1BCM A;  2ZPH B;  2DJQ A;  1KQ1 A;  1Q86 U;  4F17 A;  2LJ1 A;  2DLP A;  1MMN A;  4B9X A;  1NZ9 A;  1YJW A;  5L23 A;  4M7A A;  2LX9 A;  2FPD A;  4A63 B;  1H64 1;  2BUD A;  1D0Z A;  4PFZ A;  2CH4 W;  2WSE E;  3UDC A;  5GAN 4;  1IB8 A;  3EFS A;  3GBQ A;  1BI2 A;  3I56 Q;  3A8H B;  1YJN A;  3JCM h;  2FYK A;  2PUO B;  4ZNX A;  2EKH A;  4QQG A;  4OB2 B;  3G1J A;  1AZG B;  3VS1 A;  3KBG A;  3QZ5 B;  4GLK A;  2RM4 A;  1H8K A;  2ZZD A;  1Q81 R;  4RTY A;  1OZ2 A;  2BZ8 A;  3EG9 B;  3OYH A;  2VB6 A;  1I5O B;  1C0M A;  2NYS A;  1VQP A;  1WZO A;  5CIU A;  2DA9 A;  2L0A A;  1XJW B;  2WSC E;  3RUX A;  4JUV A;  4KGV B;  1D1B A;  3UPU A;  5KE3 A;  1Y96 A;  4C8Q F;  1YP5 A;  2GNC A;  2FB7 A;  2CZ7 B;  3TU4 K;  4M77 D;  2R58 A;  3JSC A;  2K3B A;  4KH0 B;  1M1F A;  1PHT A;  4R0K A;  4BUG A;  1WQW A;  1Z9Z A;  3QO3 A;  4F7U B;  3OYD A;  4LDW A;  3CXC A;  3AT1 B;  4BI8 B;  3LGF A;  2LQ8 A;  3I35 A;  2DL7 A;  2Y90 A;  2F5K A;  4PJM A;  1T3L A;  2E3H A;  1MGQ A;  3UAT A;  4ZTJ A;  1B34 B;  1ZSZ C;  2DAQ A;  3V7S A;  3PIO A;  2KQW A;  3G6E Q;  3CPW P;  1PSF A;  1SHG A;  2EKO A;  2KT8 A;  3M0P A;  4N0A C;  2CDT A;  1RAE B;  4LN2 A;  1ZUU A;  1ZA2 B;  4JPB W;  4XAX B;  2YT6 A;  3QJ6 A;  2XHC A;  2X51 A;  2HQX A;  2EQI A;  4BAC A;  1KSW A;  2CP0 A;  3QDR B;  4F16 A;  3E9F A;  3CCM T;  4Y28 E;  3VKI A;  4J6W A;  3OW2 A;  3CC7 A;  3EGX A;  1V29 B;  2P84 A;  2X4Y A;  4E6R A;  1X43 A;  1BIA A;  3ZEH A;  4FT2 A;  5EC7 A;  5LJ3 d;  4FYW B;  3OSS C;  4IIO A;  3I55 T;  1VQ9 T;  1MMD A;  4ZGJ B;  2LJ0 A;  2DM1 A;  4KGZ B;  5LJ3 j;  3MCA B;  5GAO n;  1RL2 A;  1WX6 A;  2F5T X;  2EAY A;  3QZ9 B;  3SWN C;  3ZFJ A;  3ULR B;  5AT1 B;  1M1G A;  1M90 C;  1RI0 A;  2KXC A;  2K79 A;  4L59 A;  2DIQ A;  4DA4 A;  2YLB A;  3EHR A;  2OTJ T;  2A36 A;  4DBF A;  1IO6 A;  1KIK A;  4M77 A;  4MZM A;  2J6F A;  5GAO q;  5IXB A;  4RTW A;  3UWN A;  4FM4 B;  2F1L A;  1PNJ A;  3X24 B;  4RMO A;  2CSI A;  1PM3 A;  5LJ3 e;  4C5H A;  2GFA A;  1H3H A;  1OOT A;  4DOW A;  4RTT A;  5GMK j;  1H3Z A;  2EYY A;  1K9M C;  4OVA A;  4NL2 A;  4C8Q C;  2YDL A;  4HKE A;  1VOM A;  2M0Y A;  3CD6 Q;  4O5V A;  4KGX B;  4FW2 A;  4XQ3 A;  3CC4 A;  2MYS A;  2RHX A;  1VQ5 T;  4IUP A;  1VQ7 T;  1QMC A;  2H3E B;  5CR2 A;  1K73 U;  1K8A U;  4E7H A;  1WGS A;  4MZP A;  2XIC A;  2K5F A;  3EFO B;  5GAN 6;  2GBQ A;  3JB9 G;  1VQ8 A;  3CQT A;  1QVG P;  1DJ7 B;  5GMK e;  3CCQ T;  2DK3 A;  3I5S A;  1D09 B;  1M27 C;  4D8D A;  4EDU A;  3PMT A;  2ZPI B;  2MCN A;  5DLO A;  1TG0 A;  3RR6 A;  3CMA Q;  1SHF A;  4X9C A;  2GFU A;  2RHY A;  1NEB A;  4C92 B;  5GAN f;  1KQS A;  2DL4 A;  2YSQ A;  3CCL T;  3DB3 A;  4OGC A;  2JS2 A;  2QAZ A;  1BI0 A;  1K0S A;  2KI7 A;  1NE8 A;  1VQO Q;  2RI2 A;  5KYW B;  5DM7 R;  1VYV A;  1Y0M A;  1W4S A;  3CCM A;  1LPL A;  5DY9 A;  3L2V A;  4RTX A;  2LP5 A;  1OPK A;  1Q86 R;  3CC2 A;  1SEM A;  5GAN 7;  3OB9 A;  1N9S A;  5GMK l;  1UGS B;  4M7D G;  3EGD A;  3JCM Q;  1NLO C;  2CSQ A;  3FC3 A;  3CCQ Q;  4PJO G;  1ZUK A;  4E47 A;  1X2K A;  1M3C A;  1S1N A;  3HRS A;  5A0D A;  2CT3 A;  1QVF P;  2EBP A;  3CXC S;  1GCQ A;  4ELY C;  3CCS Q;  1YHQ T;  4XU2 A;  1OU9 A;  4D6W A;  1EZZ B;  4L6V 5;  2AZS A;  3PGG A;  4M75 E;  3TSZ A;  2NLU A;  4LXC A;  2H3J A;  3EAE A;  2XDB A;  1GBR A;  1FMK A;  3OS5 A;  3N5B B;  4J9D A;  3CCL Q;  2X4J A;  2HKQ B;  1AZE A;  4C5I A;  1VQK Q;  2AT1 B;  2DZ9 A;  2X3W D;  3EG0 A;  3CCJ T;  4IUQ A;  4OP0 A;  2QAS A;  4IKF A;  1NPR A;  1Q81 U;  3UT1 A;  3M0U A;  1NBE B;  4N4H A;  3OYL A;  1ZBX A;  4E7I A;  2XG8 D;  2C06 A;  2FL7 A;  2RJF A;  2OI3 A;  4Z88 A;  2MMP A;  3VRZ A;  2QG9 B;  1NJI C;  2EJ9 A;  3CCE A;  4PLI A;  3HTR A;  4DOV A;  5FWB A;  4X9D A;  2CP2 A;  1AHJ B;  4DEY A;  2LRQ A;  2J7I A;  3NTI A;  4OMQ A;  3CCU A;  5FW9 A;  2K4Y A;  2G3R A;  4PL6 A;  3JCM V;  2JM8 A;  4F14 A;  4A54 A;  1IZ6 A;  5FU7 C;  2BE7 D;  4M75 G;  5KYX B;  4C92 E;  1UG1 A;  3OQ5 A;  2DFU A;  2E65 A;  2DKG A;  1N8R C;  2XK0 A;  4FL6 A;  1E6G A;  1NG2 A;  3M53 A;  3J80 E;  1QKW A;  2O01 E;  2EYQ A;  3M0T A;  3JAM E;  1WPY A;  2DL5 A;  5GAM d;  1X6B A;  2X35 A;  2RQV A;  2LTO A;  3H6Z A;  2DTH A;  2YLC A;  1I4K 1;  2A08 A;  5GAM j;  3JCM P;  2LNH B;  3JRZ A;  5D6Y A;  4E7Z A;  1TH7 A;  1W2B A;  1G5V A;  4QQD A;  4M7A G;  2GGR A;  3VUZ A;  3TSW A;  2ROT A;  2Y4Y A;  2F2X A;  4ELZ C;  3VRY A;  4BI3 A;  5LJ3 g;  2E5Q A;  1UHF A;  2ROL A;  2R5M A;  3SEM A;  2R5A A;  5J26 A;  2D6F A;  4P5N A;  1PKS A;  4HA8 A;  4NL3 A;  2A3L A;  1PC0 A;  2DL8 A;  2CP6 A;  4MMK A;  3EG2 A;  3CCR Q;  5GAM e;  3S6W A;  1SRL A;  3ZBD A;  4QVC A;  1UEC A;  1VYU A;  2LT1 A;  1KQS S;  1KHI A;  3G71 A;  3Q1J A;  2J06 A;  3G4S Q;  4F7U A;  5GAN h;  1MMG A;  2RQT A;  4ESR A;  1WDX A;  1VQL T;  1K8A R;  2DVJ A;  5CO7 A;  2DD4 A;  1U8R A;  3G7Z A;  1OX8 A;  4LNP A;  4J9B A;  2XI9 A;  3H41 A;  4N4G A;  5I21 A;  2DIG A;  3MEV A;  1WHH A;  1OQK A;  3VJP A;  1V1C A;  2KT1 A;  3GOX A;  1MUZ A;  1HSQ A;  3V8K A;  2ECZ A;  2DIL A;  1WHL A;  2W0Z A;  1RLP C;  3RMS A;  2M51 A;  4NOY A;  2EWN A;  2RQU A;  3MHX A;  4E7J A;  5CKB A;  1KC8 U;  3CME T;  1JU5 C;  3FRN A;  4JRI A;  1X6G A;  1YJW Q;  3H0H A;  1IHV A;  1Q95 G;  2O4X A;  3QJY A;  2RHI A;  4RCC A;  3I56 T;  1AWW A;  3RMQ A;  1FYN A;  4V2S A;  1YWP A;  2DYB A;  3VS2 A;  2DMO A;  4C8Q D;  5A0G A;  4QW2 A;  4A4K A;  2EYX A;  2HBP A;  1ZSZ A;  4M75 F;  1YJ9 A;  2HAX A;  4M78 E;  1AOJ A;  1NM7 A;  2DVE A;  4AFZ C;  5LJ5 d;  1KJW A;  3VS5 A;  3VS0 A;  2FPF A;  4E7K A;  3PFS A;  4JRQ A;  4N0A A;  3LH5 A;  1GRI A;  1QWE A;  1FWZ A;  2P0Q A;  4ME7 A;  5LJ5 j;  2OTL A;  2CP5 A;  1VQP Q;  2CRE A;  3HSB A;  2DYI A;  2LVM A;  3OS0 A;  3H0F A;  1AT1 B;  3CCV T;  4HCB A;  3BDU A;  4JDS A;  1VQN A;  1OPL A;  1S72 A;  1VQ4 A;  2COY A;  3IQL A;  3FB9 A;  1NYF A;  2KSS A;  3ME9 A;  2O31 A;  2JZ2 A;  3HHT B;  3C0C A;  1VQM T;  4BD3 A;  4YTL A;  1M8M A;  4RTU A;  3CME Q;  3TVT A;  2D8J A;  3VYH B;  1U3O A;  4R55 A;  2DPP B;  2E41 A;  4PKC C;  4RG8 A;  3ZL7 C;  3U23 A;  1GXI E;  2F69 A;  4FT4 A;  1KD1 U;  2LX7 A;  4M77 G;  2MIO A;  3NHN A;  1YN8 A;  1M2O A;  5KYY B;  5LJ5 e;  1R0C B;  3OBW A;  4OB0 B;  1Q82 U;  3JV3 A;  3G6E T;  3SWN A;  4JLI A;  4DBR A;  4QVD A;  5GMK m;  1WHK A;  4N4I A;  5CKH A;  2CP7 A;  2JMC A;  3CPW A;  1N6A A;  1SRM A;  2QEX A;  2YRD A;  3VS7 A;  2J05 A;  4II1 A;  4QT7 A;  1VUB A;  4CRI A;  2VKN A;  4M78 G;  4C92 F;  1TOV A;  3CCV Q;  5IT9 E;  4A4H A;  4M7D B;  4J9I A;  2DNU A;  2JJ9 A;  4OMN A;  1Y07 A;  2GF7 A;  4PJO B;  3R6N A;  4XTX A;  3JCM c;  1QCO A;  4C8Q A;  4HCK A;  2QGF B;  1VQM Q;  1BCO A;  4IUT A;  1W2B S;  3HRU A;  2KMT A;  5CQY A;  3GF5 A;  1K9A A;  3OS1 A;  1Y71 A;  5I11 A;  4BI4 A;  5CKF A;  4MML A;  4FYX B;  2DXU A;  2L8D A;  2O88 A;  2LZ6 B;  4XU1 A;  1G8X A;  1LNX A;  1PRM C;  1W1F A;  1M8V A;  1YIJ A;  2YWW A;  1U06 A;  2DL3 A;  3BW1 A;  2JTM A;  1BU1 A;  1U1T A;  3FJP A;  3M59 A;  3LWH A;  1RAF B;  2VAS A;  2J6O A;  4WTO B;  2QK0 A;  5J3B A;  3SD4 A;  1UEB A;  5HY6 A;  4IUU A;  1JB0 E;  1J3T A;  4IUR A;  1Q81 C;  3THK A;  2LDM A;  1JRI A;  2KYM A;  2K9G A;  4J6Y A;  3PMI A;  3CD6 T;  4L5G A;  1OU8 A;  4ANJ A;  1AWO A;  2DE0 X;  1NLP C;  5KYU B;  1X6O A;  3RNJ A;  5HCK A;  1VQ6 T;  4C0F A;  4LE9 A;  4PJJ A;  1E6H A;  4RUG A;  2EQU A;  3SDZ A;  3KUF A;  2CZ6 B;  6AT1 B;  1D3B B;  2DRK A;  3M4G A;  5GAM g;  1VQ8 Q;  3UA7 A;  5GAO p;  2V1Q A;  2DTO A;  2AIR B;  2W10 A;  2C0O A;  4M75 B;  2L89 A;  1OUL A;  1XOV A;  4VUB A;  2R57 A;  2JS0 A;  5FRO A;  3BFM A;  2SEM A;  4Z89 A;  5GMK i;  3CMA T;  1YI2 Q;  3FEO A;  2LT4 A;  2RJC A;  5EG2 A;  3PVL A;  2D0N A;  1NYG A;  4C92 C;  1EFN A;  2NUZ A;  2NWM A;  3GLX A;  3E1S A;  1M9S A;  3L2U A;  2HCK A;  2GQV A;  2KXD A;  5IHK A;  2M02 A;  3X20 B;  2LQK A;  4B9W A;  5CQX A;  1VQO T;  1RAA B;  1G3T A;  5CCA A;  5GAN 8;  1M1K U;  2OAW A;  1PKT A;  4OMF B;  2FPE A;  2VXF A;  2X3X D;  4M7D E;  4M7A B;  4M78 F;  2E1H A;  5KYX A;  1VQ6 Q;  1YIT T;  4PJO E;  4PJN A;  2HKN A;  4ZN1 A;  1KC8 R;  4JJD A;  1CSK A;  4J9E A;  1OX9 A;  5GAO l;  5IH2 A;  2BTT A;  3R6O A;  2HDA A;  2PZ1 A;  4JJB A;  1BI3 A;  2MOX A;  1R0B G;  3O8V A;  1JXO A;  4XU0 A;  4Z8A A;  4O6J A;  2XDD A;  1YNZ A;  3H8Z A;  3CCS T;  3FLG A;  2EGC A;  2AKK A;  3JCM d;  3S3N A;  4MDW A;  1EX4 A;  3OYM A;  4A53 A;  1QVF A;  4M4Z A;  3A8L B;  1KHC A;  2ZPF B;  2CZ1 B;  2P4T A;  2PVO B;  1UFF A;  1Q7Y C;  2RNA A;  3REB B;  3QHS A;  3L2Z A;  3CPW S;  2E6Z A;  2VGN A;  1Y96 B;  1VQK T;  3MPU B;  2L3Q A;  1ZX6 A;  4KUI A;  4XTY A;  4C0D B;  3OYE A;  3FDR A;  1IGQ A;  3VS4 A;  4DBQ A;  1EIF A;  1BK2 A;  5HKC A;  1PD1 A;  2V8I A;  1ACM B;  1YIT Q;  4BB7 A;  2HQH A;  1IRX A;  4XTU A;  2NUT A;  2JT4 A;  4JS5 A;  4PFP A;  3JCM e;  2PUK B;  3EH2 A;  3I55 A;  1VQ9 A;  2CP3 A;  4CI0 C;  2RK2 A;  1RAG B;  4JJN K;  5LJ5 g;  3MEU A;  5LJ3 f;  1KD1 R;  2ED1 A;  2Y4X A;  4J7F A;  1MV3 A;  1WXB A;  1ZA1 B;  3A98 A;  3L2Q A;  4OF1 A;  2JW4 A;  3CCE Q;  1Q82 R;  9ATC B;  4BY6 B;  2OTJ A;  1AEY A;  4X34 A;  4LUD A;  5CVI A;  2K2V A;  4AFU C;  3M57 A;  3BY7 A;  5ECA A;  4J9H A;  3PTA A;  4R56 A;  2K7A A;  3I5R A;  1PWT A;  3HFN A;  2AZV A;  3EGX B;  2PTK A;  2MF2 A;  4IIM A;  4DEX A;  1ABO A;  1GFC A;  4M78 C;  3M4Y A;  4FW1 A;  3MKD A;  5CKD A;  1VQO A;  3OW2 S;  1WFW A;  1VQ5 A;  3CEY A;  1VQ7 A;  1QKX A;  1G2B A;  1SKU B;  3C95 A;  2VXE A;  1JJ2 A;  1IRE B;  3RDV A;  4M7D D;  1Q86 C;  2FZK B;  2V8J A;  3CPF A;  4C0G A;  4JJC A;  4M7A E;  4PJO D;  2RB6 A;  2BZX A;  3V7C A;  2KK4 A;  1VA7 A;  2K3X A;  2KRO A;  3QWX X;  3MET A;  2BKD N;  4A4G A;  4M77 B;  3EG3 A;  4MDX A;  1HJD A;  3CCQ A;  3JB9 F;  5FU6 C;  4DBH A;  3OYK A;  2LQN A;  3RBB B;  3M55 A;  1VYT A;  2KDS A;  2EQM A;  2VVK A;  3GNG A;  3CBO A;  1WJS A;  3URG A;  1JO8 A;  2EYW A;  2CS7 A;  1ARK A;  2Z0W A;  5KH6 A;  4HCZ A;  1I8F A;  2QA4 T;  1M90 U;  2C0T A;  4ZN3 A;  3CCR T;  3HKS A;  1OV3 A;  3CCL A;  2K3Y A;  2NUP B;  4M78 B;  2ZPG B;  2COZ A;  4RTV A;  1TSF A;  2VGM A;  2JNG A;  3KFV A;  1FMW A;  2QDY B;  4TVR A;  1QP3 A;  1O9S A;  3G4S T;  3M54 A;  2OAU A;  4UC4 A;  3V8J A;  3P8B B;  1TUG B;  3PIP A;  1C1A A;  2IVW A;  5HK3 A;  3SB2 A;  1P92 A;  2ABL A;  3WVD B;  1LOJ A;  2KRM A;  1K9M U;  1UGQ B;  5FU6 B;  1TTH B;  4ZTF A;  1X2Q A;  3EG9 A;  1WJR A;  1WXU A;  2GTO A;  7AT1 B;  2AKL A;  3AHU A;  5FLX E;  1O75 A;  1GFD A;  4HXJ A;  2KVQ G;  5IHI A;  4M7D F;  1MMA A;  2D1X A;  1MHN A;  1JQQ A;  2LJ3 A;  4PK4 A;  1F1B B;  2QDL A;  3QPH A;  4PJO F;  1YHQ A;  1UJ0 A;  3VUB A;  1YCS B;  2HBW A;  3EGU A;  2JMA A;  3DLM A;  4M75 D;  3VS6 A;  1UGR B;  2XKO C;  2CZ0 B;  4J8O A;  2LCC A;  1YJW T;  2JTF A;  3F70 A;  3HFO A;  2QA4 Q;  2SRC A;  4F04 B;  1WNL A;  1QVF S;  1U1S A;  3QXE B;  1JBM A;  3FJ5 A;  3SHW A;  2E3I A;  1FX7 A;  1IXD A;  2A37 A;  4BE1 A;  3CCJ A;  4KRT A;  1M1K R;  1PRL C;  3PVQ A;  3S3O A;  3OBY A;  1TUD A;  3EG1 A;  3D7S B;  3O5Z A;  4EIK A;  2YUQ A;  3H9N A;  1B34 A;  2QXF A;  1H92 A;  1YJ9 Q;  2JVV A;  4LDY A;  3J81 E;  5L8R E;  1VQP T;  2QQB A;  1WJQ A;  2EQJ A;  3SFM A;  1SF9 A;  2WAC A;  4C8Q G;  2CUB A;  4XK8 E;  4M7A D;  2E10 A;  5D6X A;  4RTZ A;  4BDY A;  1AD5 A;  2X4W A;  5HK0 A;  1VQN Q;  1S72 Q; 
#chains in the Genus database with same CATH homology
 1BI1 A;  3QYG B;  2EIF A;  3QII A;  3X25 B;  3JB9 G;  1VQ8 A;  3MO8 A;  2PVD B;  4M77 E;  3OS1 A;  5LJ3 h;  1Y71 A;  4XTW A;  4BI4 A;  5CKF A;  3OA6 A;  4MML A;  1Q82 C;  2DXU A;  2HD0 A;  2L8D A;  2MWO A;  3NTH A;  4KUL A;  2L3R A;  3CCS A;  1DJ7 B;  1X01 A;  5GMK e;  3OYC A;  3CCQ T;  4XU1 A;  2DK3 A;  1LNX A;  4LD6 A;  4RG2 A;  5I2M A;  4JS4 A;  1QVG S;  4QQ6 A;  1M8V A;  2CGH A;  3OS2 A;  3V7R A;  2DO3 A;  1XTD A;  1YIJ A;  4EDU A;  1G3W A;  3PMT A;  3TCJ A;  2M16 A;  3JCM f;  2ZPI B;  5DLO A;  3BW1 A;  4M7A F;  4HT9 A;  2JTM A;  1U1T A;  3FJP A;  3M59 A;  4C92 D;  3LWH A;  3M56 A;  4X9C A;  1QVP A;  2GFU A;  2CKK A;  2RHY A;  3QYH B;  5GAO m;  3JCM J;  4EMK A;  5CAI A;  1VQK A;  4KT0 E;  4C92 B;  5J3B A;  3SD4 A;  2K5L A;  1UEB A;  2MWP A;  2DJZ A;  5HY6 A;  5GAN f;  2PQW A;  2LC4 A;  4IUU A;  1JB0 E;  3GPL A;  3DLL A;  3CCL T;  4IUR A;  3JCM g;  3LW5 E;  3OY9 A;  1SSF A;  1Q81 C;  3DB3 A;  4OGC A;  2LDM A;  1JRI A;  2RA2 A;  3KXT A;  3JB9 J;  1BI0 A;  4M75 A;  4C8Q E;  1K73 C;  1NE8 A;  2P0P A;  1K8A C;  4J6Y A;  2E6N A;  3PMI A;  1YJ9 T;  5GMK h;  4A4F A;  2RI2 A;  3RKY A;  3V8L A;  1KQS A;  3S3M A;  3CD6 T;  4L5G A;  5DM7 R;  1W4S A;  2EQK A;  4OB3 B;  3TRE A;  3L42 A;  4NS5 A;  5GAN g;  3CCM A;  1JJ2 S;  5DY9 A;  3L2V A;  4BDZ A;  3QG1 A;  4JLG A;  2OTL T;  3CC2 A;  3P8H A;  1XNI A;  5GAM f;  3JB9 H;  3RES A;  4FIB A;  5GAN 7;  2YHT A;  3CC7 T;  3A8O B;  4M7D C;  2XDP A;  3OB9 A;  2KY9 A;  2YRV A;  1X6O A;  4PJO C;  3BDL A;  4FSX A;  2DXC A;  1VQN T;  2K5I A;  4ATO A;  1I81 A;  3HRT A;  2I2L A;  1VQ6 T;  4C0F A;  1N9S A;  3LYI A;  5GMK l;  3JB9 I;  1UGP B;  4MZT A;  1VQ4 T;  4EMK B;  1S72 T;  3QKJ A;  1UGS B;  4KUD K;  4M7D G;  2ZPB B;  3JCM Q;  4WF2 A;  3RIR A;  4A4E A;  3FC3 A;  4PJO G;  4E47 A;  4Z02 A;  2EQU A;  3SDZ A;  3KUF A;  4JRP A;  3MEW A;  2CZ6 B;  2EFI A;  4C0Z A;  2ZPE B;  1M5Q 1;  1D3B B;  3CBM A;  3HRS A;  3M4G A;  5GAM g;  5GAO p;  4M7D A;  5A0D A;  3PT9 A;  3X28 B;  2DTO A;  4PLL A;  3CXC S;  1QP2 A;  4ELY C;  4XTZ A;  4M75 B;  4PJO A;  2L89 A;  1YHQ T;  2RI5 A;  3RKW A;  5GAN 3;  4XU2 A;  1NJI U;  1XOV A;  4VUB A;  2R57 A;  2EJG A;  4D6W A;  5FRO A;  4J7I A;  3BFM A;  4L6V 5;  3NFC A;  3PGG A;  5FU7 B;  4M75 E;  5GMK i;  3CMA T;  2NLU A;  2E12 A;  2H3J A;  3EAE A;  1YJN T;  2XDB A;  1ZQ1 A;  4BE2 A;  3FEO A;  3OS5 A;  2LT4 A;  2A7Y A;  2RJC A;  5EG2 A;  3N5B B;  3OYA A;  2X4J A;  3A8G B;  3EFR A;  2QQR A;  4C92 C;  4F7U F;  4C5I A;  1UB4 A;  5FRN A;  3OMC A;  3GLX A;  3E1S A;  1M9S A;  3L2U A;  5IAY A;  1VQL A;  2DZ9 A;  2GQV A;  2RHZ A;  5C6S A;  3LX7 A;  1YCY A;  3CCJ T;  1KD1 C;  3X20 B;  4IUQ A;  3INZ A;  1OZ3 A;  2LQK A;  4B9W A;  5CQX A;  4OP0 A;  4C92 G;  1VQO T;  1Q7Y U;  1NPR A;  1Q81 U;  2QEX T;  3UT1 A;  4Q5W A;  4IKF A;  1G3T A;  4RKU E;  3WXM B;  5CCA A;  4N4H A;  1BKB A;  4QVZ A;  5GAN 8;  2GCX A;  3OYL A;  1M1K U;  1ZBX A;  3E9G A;  5M9O A;  4C92 A;  2XG8 D;  5A0L A;  3OYB A;  4E7I A;  1N8R U;  2C06 A;  2FL7 A;  4OMF B;  2VXF A;  4M7D E;  2RJF A;  4M7A B;  4M78 F;  2D9T A;  2E1H A;  3CC4 T;  1ZHI A;  2MMP A;  1YIT T;  4PJO E;  4ZN1 A;  4C5E A;  3PNW C;  5CKE A;  2L5Q A;  3MP1 A;  2RK1 A;  2D0Q B;  2EJ9 A;  5GAO l;  2VUB A;  4PLI A;  5CQY A;  3CCE A;  1NJI C;  2PU9 B;  1M4Z A;  4LDU A;  3OYY A;  4C5G A;  3R6O A;  3VU3 C;  4GY5 A;  4DOV A;  4EMK C;  5J39 A;  3LWI A;  4J83 A;  3CME A;  1BI3 A;  4J6X A;  1VQ8 T;  1N9R A;  4X9D A;  2JOY A;  2EJF A;  3LLR A;  3O8V A;  4XU0 A;  3QBY A;  3J7A F;  4O6J A;  2XDD A;  3GIB A;  3H8Z A;  3CCS T;  3FLG A;  3X26 B;  1AHJ B;  3JCM d;  3S3N A;  2LRQ A;  3NTI A;  1R8O B;  4MDW A;  1KG1 A;  2WSF E;  3CCU A;  2MAM A;  4M75 C;  3I56 A;  3JCM W;  5I2S A;  2QA4 A;  2K4Y A;  3OYM A;  2G3R A;  2KAF A;  4PL6 A;  4A53 A;  3CCR A;  1QVF A;  3A8L B;  1YIJ T;  1KHC A;  3JCM V;  1YI2 T;  2ZPF B;  2CZ1 B;  4A54 A;  1IZ6 A;  2E70 A;  2P4T A;  3A8M B;  2PVO B;  5FU7 C;  4M75 G;  4RCB A;  3OYF A;  5GAN d;  1Q7Y C;  1I5L A;  1D3B A;  3QHS A;  3G4S A;  2LCL A;  4KBM B;  4C92 E;  4M78 D;  4XU3 A;  3L2Z A;  2B8A A;  3OQ5 A;  3MP8 A;  3CPW S;  2E6Z A;  2QQA A;  2VGN A;  1Y96 B;  1M1K C;  2DEQ A;  1VQK T;  2E65 A;  5GAN j;  1OYX A;  1XQH A;  2BIV A;  2DKG A;  2FHD A;  1N8R C;  4DQ2 A;  3M5A A;  4XTY A;  4KUI A;  4C0D B;  3OYE A;  2XK0 A;  3FDR A;  4FL6 A;  3M53 A;  1BIB A;  3J80 E;  3OYJ A;  1YBY A;  1X75 C;  4JRK A;  1EIF A;  2O01 E;  5LJ5 f;  3L2R A;  2EYQ A;  3CCV A;  5HKC A;  2VV5 A;  5IN1 A;  2V8I A;  1WPY A;  3JAM E;  1FXX A;  2RHU A;  5GAM d;  4BB7 A;  2X35 A;  4XTU A;  2ZCF B;  2LTO A;  4JS5 A;  2M9U A;  2DZC A;  2DTH A;  2YLC A;  3H6Z A;  3JCM e;  2PUK B;  2X4X A;  1I4K 1;  3I55 A;  1VQ9 A;  5GAN 5;  5GAM j;  3JCM P;  4CI0 C;  3JRZ A;  4M7A C;  5D6Y A;  2RK2 A;  1WQ7 A;  2DXT A;  3QUI A;  1TH7 A;  2QQS A;  4OGE A;  1VQM A;  1W2B A;  3CC2 T;  4JJN K;  4IUV A;  5LJ5 g;  3MEU A;  2CYZ B;  2O4X B;  5LJ3 f;  3HPW A;  4LDX A;  4ZGD B;  1G5V A;  3WVE B;  2Y4X A;  2ZPH B;  4J7F A;  5GAO r;  4QQD A;  1VIF A;  2V8K A;  4M7A G;  1KQ1 A;  1Q86 U;  3VUZ A;  3L2Q A;  2RH2 A;  4OF1 A;  5GAN e;  3TEE A;  1NZ9 A;  2Y4Y A;  4B9X A;  1YJW A;  4ELZ C;  4M7A A;  2LX9 A;  1QVG A;  4BI3 A;  4HT8 A;  1H64 1;  3LH0 A;  4BY6 B;  2BUD A;  5LJ3 g;  2OTJ A;  3P8D A;  3CBP A;  2E5Q A;  1G3S A;  4X34 A;  2WSE E;  3UDC A;  3G6E A;  4DA4 A;  5CVI A;  2K2V A;  2R5M A;  3EFS A;  3OMG A;  5GAN 4;  1BYM A;  4M77 F;  2R5A A;  3BY7 A;  3M57 A;  5J26 A;  3PTA A;  2D6F A;  2VC8 A;  4P5N A;  1BI2 A;  4R56 A;  4HA8 A;  4NL3 A;  2A3L A;  3A8H B;  3RER A;  1YJN A;  3JCM h;  2FYK A;  4MMK A;  2PUO B;  4QQG A;  2LNV A;  3HL8 A;  3HFN A;  2MI6 A;  1QW1 A;  3S6W A;  5GAM e;  3ZBD A;  4QVC A;  4OB2 B;  2M0O A;  2AHJ B;  3KBG A;  2LT1 A;  3QZ5 B;  1KQS S;  1NPP A;  3MP6 A;  3OSV A;  4GLK A;  1KHI A;  3G71 A;  2RM4 A;  2MF2 A;  2DXB A;  3Q1J A;  2ZZD A;  5CK9 A;  4F7U A;  2E64 A;  3MEA A;  4EPC A;  5GAN h;  1OZ2 A;  3OYH A;  4M78 C;  3M4Y A;  3DB4 A;  1VQP A;  1VQL T;  5CO7 A;  3GNF B;  4C0D C;  2RJD A;  5CIU A;  2DD4 A;  3C4S A;  5CKD A;  3OW2 S;  1VQO A;  3G7Z A;  1U8R A;  1VQ5 A;  3CEY A;  2WSC E;  1VQ7 A;  3M9Q A;  3HP9 A;  2XI9 A;  3RUX A;  4N4G A;  5KCH A;  3C95 A;  2VXE A;  5I21 A;  2DIG A;  1IRE B;  4JUV A;  1JJ2 A;  3MEV A;  1VIE A;  1Q86 C;  2V8J A;  3VJP A;  3UPU A;  5KE3 A;  4M7D D;  3CPF A;  4C0G A;  4OB1 B;  1Y96 A;  2ZGW A;  4C8Q F;  3GOX A;  4M7A E;  4PJO D;  4M78 A;  2RB6 A;  2FB7 A;  3V7C A;  3V8K A;  2CZ7 B;  3TU4 K;  2KK4 A;  2JN0 A;  2XU8 A;  2K3X A;  4M77 D;  4HCC A;  2R58 A;  5GAM h;  3JSC A;  3MET A;  2BKD N;  3RMS A;  4A4G A;  4NOY A;  1M1F A;  2EWN A;  3MHX A;  4M77 B;  3SWN B;  5KE2 A;  4MDX A;  3CCQ A;  3JB9 F;  2K57 A;  5FU6 C;  3CCE T;  3L1A A;  3OYK A;  4BUG A;  4E7J A;  1WQW A;  3RKX A;  5CKB A;  3QO3 A;  4F7U B;  3OYD A;  1KC8 U;  4LDW A;  4ZGE B;  3CXC A;  3CME T;  3M55 A;  2QQ9 A;  2KDS A;  2P0K A;  4BI8 B;  3FRN A;  3LGF A;  2LQ8 A;  2EQM A;  3LGL A;  4JRI A;  2Y90 A;  3GNG A;  5C0M A;  2F5K A;  3CBO A;  1WJS A;  3URG A;  1MGQ A;  4E7L A;  2DTI A;  4BY6 C;  4F7U E;  2RI3 A;  2CS7 A;  2O4X A;  3QJY A;  5KH6 A;  4ZTJ A;  1B34 B;  2DAQ A;  3V7S A;  2QI2 A;  2RHI A;  2RJE A;  2KQW A;  4HCZ A;  4RCC A;  3VYG A;  3PIO A;  3I56 T;  3RMQ A;  1PSF A;  3CCU T;  1I8F A;  2QA4 T;  1YI2 A;  2EKO A;  1M90 U;  4ZN3 A;  3CCR T;  3A5Z B;  4V2S A;  3HKS A;  4N0A C;  3CCL A;  2K3Y A;  4XTV A;  4M78 B;  2ZPG B;  4XAX B;  3ER0 A;  2VGM A;  2HQE A;  2JNG A;  4C8Q D;  3QJ6 A;  2QDY B;  4TVR A;  2XHC A;  4QW2 A;  1QP3 A;  4A4K A;  5A0G A;  1O9S A;  3G4S T;  3FIF A;  2HQX A;  2HBP A;  4M75 F;  1YJ9 A;  2HAX A;  4C8Q B;  4M78 E;  3CD6 A;  2DVE A;  3OYG A;  4BAC A;  5LJ5 d;  3M54 A;  3C94 A;  2IG0 A;  2OAU A;  4E7K A;  4UC4 A;  3PFS A;  2JUF A;  4N0A A;  3P8B B;  3V8J A;  4JRQ A;  3QDR B;  3PIP A;  3L2W A;  2IVW A;  3JCM b;  5HK3 A;  3JB9 D;  2M1H A;  1FWZ A;  2P0Q A;  4ME7 A;  3E9F A;  5LJ5 j;  3CCM T;  4Y28 E;  2OTL A;  3SB2 A;  3VKI A;  1P92 A;  4J6W A;  3OW2 A;  3CC7 A;  3HSB A;  1V29 B;  1N27 A;  2LVM A;  3JCM X;  3OS0 A;  3CCV T;  4HCB A;  3WVD B;  1LOJ A;  2X4Y A;  3BDU A;  2RO0 A;  4JDS A;  1VQN A;  1K9M U;  1BIA A;  3ZEH A;  4FT2 A;  1VQ6 A;  5DLQ E;  1UGQ B;  5LJ3 d;  1S72 A;  5FU6 B;  1VQ4 A;  3NTK A;  3OSS C;  4ZTF A;  1KC8 C;  3FB9 A;  1WJR A;  2XID A;  4FU6 A;  3I55 T;  2DD5 A;  2KSS A;  3ME9 A;  1VQ9 T;  4ZGJ B;  3AHU A;  3E19 A;  5LJ3 j;  2JZ2 A;  3HHT B;  1OI1 A;  3MCA B;  5FLX E;  1O75 A;  2HNI A;  5GAO n;  1VQM T;  1RL2 A;  2F5T X;  2EAY A;  4BD3 A;  2KVQ G;  4YTL A;  3QZ9 B;  4M7D F;  4EMG A;  3SWN C;  3ZFJ A;  1MHN A;  4M77 C;  3VYH B;  1HK9 A;  4Y91 A;  2DPP B;  3QPH A;  4PJO F;  4R55 A;  1YHQ A;  2E41 A;  5FRM A;  1M1G A;  1M90 C;  4PKC C;  4RG8 A;  3VUB A;  3DKM A;  1RI0 A;  3GP8 A;  1GXI E;  2F69 A;  4FT4 A;  5AYF A;  1KD1 U;  3DLM A;  4M75 D;  1UGR B;  2DIQ A;  2CZ0 B;  2XKO C;  2LCC A;  4J8O A;  4L59 A;  4M77 G;  2JTF A;  3F70 A;  3CMA A;  2YLB A;  2PVG B;  3HFO A;  5LJ5 e;  4EMH A;  3OBW A;  4OB0 B;  5D6W A;  1Q82 U;  2OTJ T;  1WNL A;  3G6E T;  1QVF S;  3SWN A;  4JLI A;  4M77 A;  4MZM A;  4F7U G;  3M58 A;  1U1S A;  4QVD A;  2QTX A;  3QXE B;  5GMK m;  1JBM A;  4PNO A;  5KCO A;  5GAO q;  4N4I A;  3UWN A;  5CKH A;  4FM4 B;  3OYN A;  1FX7 A;  3CPW A;  1Y7X A;  4BE1 A;  3CCJ A;  1N6A A;  3ASK A;  3X24 B;  4RMO A;  5A2Q E;  5LJ3 e;  4C5H A;  2GFA A;  4DOW A;  5GAN 2;  3S3O A;  3OBY A;  2QEX A;  1KQ2 A;  5GMK j;  1PSE A;  1H3Z A;  1K9M C;  4OVA A;  3G71 T;  4II1 A;  1B34 A;  1VUB A;  2QXF A;  4NL2 A;  4CRI A;  4J5Y A;  4C8Q C;  4BE0 A;  4LD9 K;  1LJO A;  4M78 G;  3T9N A;  2JVV A;  4HKE A;  4LDY A;  3J81 E;  4LDV A;  5LL6 S;  2FVU A;  5L8R E;  3QSU A;  4C92 F;  5IT9 E;  4O5V A;  1VQP T;  2QQB A;  1WJQ A;  2EQJ A;  2RD1 A;  4A4H A;  1G3Y A;  4XQ3 A;  3SFM A;  3CC4 A;  2RHX A;  1VQ5 T;  4IUP A;  2WAC A;  1YIT A;  4C8Q G;  5LJ5 h;  1VQ7 T;  4M7D B;  1Y07 A;  2GF7 A;  5CR2 A;  4XK8 E;  4M7A D;  1HXD A;  1K73 U;  2E10 A;  1K8A U;  4PJO B;  3VV0 A;  4E7H A;  1WGS A;  4XTX A;  1YJW T;  3JCM c;  2XD0 A;  4MZP A;  5D6X A;  4BDY A;  4C8Q A;  3C12 A;  2X4W A;  5HK0 A;  3OYI A;  2VYT A;  2XIC A;  4IUT A;  1W2B S;  2K5F A;  3HRU A;  5GAN 6;  2KMT A;  3GF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...