2VYTA

The mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
RDDFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX COMB ON MIDLEG-LIKE PROTEIN 2
publication title The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 53
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA01
2RHYA 2HQXA 2VYTA 4GY5A 4PLLA 4Q5WA 3OYIA 2R58A 2L8DA 4A4FA 3BDLA 3Q1JA 3PFSA 3DB4A 2R5MA 5KH6A 3L2QA 3ME9A 2XDPA 5KE2A 4FL6A 3H8ZA 4C5GA 2EFIA 2L3RA 4BACA 2DAQA 2M1HA 4C5EA 5J39A 3OYHA 2DIGA 4IUQA 5CIUA 2RJEA 2WACA 2PQWA 4ZTFA 2GFAA 2LCCA 3H6ZA 4N4GA 1WJSA 2RHIA 2R57A 2DIQA 2RI3A 3OB9A 4UC4A 2QQSA 3LX7A 5D6WA 3DLMA 3OYNA 3MEVA 2R5AA 3OMCA 2RHZA 4BD3A 3QJ6A 3P8HA 4LD6A 3OS0A 3E9GA 4IUUA 3UT1A 2O4XA 3MEUA 3SD4A 3OYFA 3FDRA 4BE0A 1G5VA 5J26A 3PMTA 3UWNA 3OYGA 3OYJA 3NTIA 3PMIA 1RI0A 2RO0A 3FEOA 4B9XA 3GOXA 4E7JA 2O4XB 3OYBA 2G3RA 4BDYA 4E7IA 5FRNA 4CRIA 2EQKA 2X4YA 4E7LA 3MEWA 3FC3A 1OZ2A 2RHUA 3O8VA 2E6NA 5KE3A 3OS2A 3OYKA 3MEAA 3ZEHA 3S6WA 4PLIA 2YRVA 2LDMA 4QVZA 2M16A 4N4IA 5D6YA 4EDUA 4X34A 2F5KA 4ZTJA 2EQMA 4A4GA 4A4EA 3MP8A 5C6SA 4QQGA 1WJRA 3LLRA 3S3OA 3MP1A 2X4WA 3QBYA 3S3MA 4OVAA 3OYMA 4IKFA 5FRMA 1WGSA 3P8DA 3NTKA 1OI1A 2JTFA 3M9QA 4L59A 2FHDA 2E5QA 3OY9A 3OYDA 2EKOA 3MO8A 3L2WA 2QQRA 2RJCA 2GF7A 3L2VA 2RJDA 4FU6A 5KCOA 3KUFA 2X35A 4PL6A 4BDZA 5IAYA 4E7HA 3LGFA 3OYEA 4QQDA 2BIVA 1XNIA 1SSFA 2K3YA 5C0MA 2IG0A 3MP6A 4IUTA 2BKDN 2B8AA 4E7KA 2CKKA 4N4HA 3OYCA 4QW2A 3EAEA 4NS5A 5FROA 4II1A 4BE2A 2LRQA 2RI2A 2GFUA 5M9OA 4BE1A 2RI5A 3L2RA 2XK0A 3L42A 2P0KA 3OYLA 1OZ3A 3PNWC 3QIIA 4QQ6A 4IUPA 2D9TA 3OQ5A 4IUVA 5KCHA 3OYAA 4Z02A 1KHCA 1MHNA 4C5IA 2X4XA 3C4SA 3E9FA 3OA6A 4HCZA 3LYIA 2HQEA 3F70A 3FLGA 2NLUA 3OMGA 3LH0A 5D6XA 3META 2JZ2A 3LGLA 2MWPA 1OYXA 3DB3A 2LTOA 2RJFA 2BUDA 1N27A 2EQUA 2L89A 3CEYA 4IURA 2RHXA 3S3NA 4C5HA 3ASKA 2MWOA 4A4HA 2LVMA 3L2UA 2M0OA 1WJQA 3NTHA 4RG2A 3QKJA 3OS1A 1H3ZA 4B9WA 2EQJA 2K3XA 5IN1A
chains in the Genus database with same CATH superfamily
1Y07A 3EFSA 2AK5A 5LJ3g 2XDPA 3M53A 2OAUA 3A8LB 1BK2A 3UPUA 1M90R 1ZLMA 4C5EA 3OYHA 2HBPA 1PKSA 1UG1A 1R77A 2QDLA 3OW2A 1U5SA 3OMCA 5CKEA 3VS6A 2CP2A 1VQ6Q 1NYGA 1NYFA 1K76A 3OYJA 4LDVA 1GL5A 2K3BA 3HRSA 2EQKA 1OZ2A 3X20B 2EGEA 3ZEHA 5CO7A 1U3OA 2M16A 1VQLT 1VQ4A 4AMCA 2EYZA 2YDLA 5GANg 2M0YA 4JRIA 3MP8A 3VYGA 1VIEA 1WGSA 5GAMe 3NTKA 2JTFA 2H3JA 2FHDA 1H8KA 1WXTA 3KUFA 4HVWA 2HSEB 2MAMA 3RR6A 1Q7YC 2X3XD 1G3YA 1IGUA 3KXTA 4M78C 1X69A 1AOJA 4DBRA 2LRQA 4IIMA 2QEXT 1BIAA 2KT8A 1QVPA 5KYXB 3SWNB 5CKBA 1UGQB 3ULRB 4M4ZA 1WHLA 3C4SA 4XTUA 2OTJA 1VQPT 5GAOl 1UDLA 2FYKA 3SB2A 3URGA 1IREB 1Q82U 2PZ1A 2YHTA 2DK3A 2JM9A 3V8LA 2X9HA 4C0DC 3SWNA 4B9WA 5A0LA 4GY5A 4C8QF 4DBHA 1YJNT 3VV0A 4M7AG 4M7AE 5LJ3h 2RD1A 1OV3A 2EYWA 3RUXA 1E7OA 4ZTFA 1BCMA 1KG1A 3GF5A 1YWOA 3JV3A 3PIOA 4E7SA 4AG2C 1YJWT 1RUWA 3R6OA 1WNLA 1VOMA 4K11A 2DTOA 3WXMB 3JAME 5HKCA 2YWWA 1N9SA 2FVUA 3FC3A 2LNHB 3EGDB 1ZUYA 2DPPB 4C92D 3CCEQ 4J7IA 1B3QA 3BW1A 4QVZA 1K8AU 5LJ5j 1GCQC 2QDYB 3CC4Q 4J9GA 2O2OA 2DD5A 5I2MA 2VXEA 3JCMh 3TCJA 3CCJA 2QGFB 3PVLA 4JRQA 4HVVA 5GAOr 1UGPB 3EGDA 3P8DA 3OY9A 2VGMA 5GAN2 3CCUA 4J9CA 1AVZC 4OMFB 1QCNA 3QO3A 2PU9B 2JOYA 2GQIA 4KT0E 3CD6Q 4QQDA 2E64A 2XDDA 2NWMA 2D1XA 4II1A 3QHSA 2OTLA 2PUOB 1WDXA 2IPOB 1KSWA 4EIKA 2JS0A 1KJWA 2DYIA 4C8QC 4J5YA 1R0BG 2YSQA 2KYBA 5GMKl 4EMGA 1MNEA 2NUPB 4L5GA 3I55A 3X25B 1R0CB 1TTHB 2DXBA 4LDUA 2LX7A 4EMKA 2F2WA 4DQ2A 2EQJA 2MK5A 1JQQA 5GAN8 4D6WA 3G4SQ 1VQOT 2FO0A 3T9NA 5KH6A 2C0TA 1KQSP 2KT1A 2QASA 2F5TX 4NOYA 3JB9G 2NUPA 1YIJQ 2DAQA 3CXCP 2XD0A 3RIRA 3VS4A 2YUOA 5CKDA 3TSWA 1SPKA 5D6WA 4LUEA 1KC8R 2RHZA 3WVDB 3I56A 1J3TA 1QQJA 5J26A 1S72A 5KYUB 2RO0A 5LJ5e 2JXBA 3EG2A 2CGHA 3M0RA 3ZFJA 2QYZA 4J9EA 1K9MC 3QG1A 5A0GA 1K73C 2DETA 4M75B 4M75G 4OB2B 2RQUA 3M4GA 4M75E 1KD1R 3S3OA 2WSFE 2QI2A 3S3MA 3J80E 4PNOA 3EGXB 2DL5A 4ELYC 1VQ6A 5KCOA 2VVKA 1RI9A 4MDWA 4AFZC 4X1VA 5IXFA 2DXCA 2CUDA 4M77B 1D3BB 4M77G 1Q7YU 1SRMA 3CPFA 4N4HA 4QW2A 3HRTA 4M77E 1WZOA 1OU8A 1KHIA 4DEXA 4ELZC 2DVJA 3L42A 3OYLA 9ATCB 3VUBA 3BE3A 3CCST 2K2VA 3J7AF 1GFDA 4LDYA 4PJOA 1BCOA 2RQTA 3QSUA 1ZHIA 3N5BB 2MWPA 2LTOA 3JCMJ 2DE0X 3ZBDA 5CCAA 4RMOA 1UHFA 5D7UA 2QK0A 2E12A 3Q1JA 2LQNA 2K5IA 3VS7A 3VS1A 1VUBA 2K9GA 2LQWA 4M7DB 1AZGB 4M7DG 4M7DE 1TWBA 1NJIR 3CCRT 5CIUA 2QA4Q 2Y90A 3GPLA 1Y96B 4OGEA 3EFOB 1B07A 1OULA 4HVUA 3SD4A 3TVTA 3G71Q 3FEOA 1U1TA 2C06A 2RQWA 2KRSA 2GCXA 4HKEA 3O8VA 1MMGA 1BI1A 1VQ7T 2YRVA 2DA9A 1YJ9T 2KI7A 1GXIE 2F5KA 1BI2A 1UJYA 2KRNA 5DLQE 2XHCA 5CQXA 3THKA 5C6SA 2E3IA 3C94A 3H9NA 3CCVQ 2MMPA 2K5FA 4XTVA 1QP2A 1BI3A 2RQVA 3MO8A 2GF7A 4RTTA 2CP5A 1M4ZA 1M5Q1 2J7IA 4JZ3A 2XIDA 1H641 2VV5A 2CKKA 3EH1A 1I4K1 1LCKA 4M78D 3CCEA 1PSFA 4OMOA 3M59A 5LJ3d 5GAMh 1YITT 2ZCFB 1WIEA 2PTKA 3E9FA 3CC4A 1VQ8Q 1T0JA 3X26B 3LH0A 1GCPA 2RK1A 1RLQC 2KE9A 3CCMA 4GLKA 1T0HA 1B34B 1JO8A 4EPCA 3PTAA 1PD1A 2MWOA 2LT1A 1WJQA 3MHXA 4XU3A 5IN1A 1VQKT 3CD6A 1TUDA 5FWBA 2KNBB 1AT1B 2O88A 2CP6A 4PJNA 2D8HA 1B34A 1U1SA 4OB3B 3JCMd 2CSQA 2GFAA 2LCCA 3QXEB 2BTTA 3UF4A 3NFCA 5IXBA 4BD3A 2BE7D 2R5AA 3OS0A 4BE0A 4MZPA 5CQYA 3PMTA 3UWNA 1Q82R 2QXFA 2COYA 1W4SA 3GOXA 4JJCA 2CDTA 3M4YA 2ZPBB 3G4SA 4JPBW 3M58A 2QTXA 2LDMA 1VQLQ 2J06A 2QTVA 1TXQA 2SEMA 1OEBA 1M3AA 1M8VA 1C0MA 1YIJA 1K0SA 1LVKA 4QQGA 3C95A 2KVQG 2KSSA 3VS5A 3OYMA 3EG0A 2SRCA 3QZ5B 4ESRA 1N8RU 2O9SA 1MV3A 2RJDA 4WTOB 1YFNA 1X6OA 1X75C 2P84A 2ROLA 5I11A 1FYNA 2A08A 2Y4YA 5GMKm 2F69A 3PE0A 2QEXQ 1QVGS 1X2QA 2ZGWA 1KIKA 2DJZA 1AEYA 2A7YA 2JN0A 3JCMV 3QDRB 2FRYA 2LQ8A 5AT1B 4IUPA 3TSZA 1K8AR 4XU2A 2X4JA 2VASA 2YUQA 2DLPA 4C8QD 5KYYB 1VQPQ 1YBYA 4J9FA 2L2PA 4RG8A 3CEYA 3E2UA 3M56A 2LNVA 3U23A 3JB9J 4KGVB 1QVFP 5HK0A 2VYTA 2XG8D 4LD9K 4JJDA 4A4FA 1D0XA 5KYYA 4RTUA 2HZYA 2GNCA 2XDBA 4BI3A 2L3RA 4BACA 1WQWA 4IUQA 4PFOA 1Q86C 2VUBA 2HL3A 4CC2A 1NZ9A 1O75A 1W2BP 3GP8A 1D1BA 1YJWQ 2V1QA 1PWTA 1PD0A 5GANf 2MCNA 2H3EB 1CKBA 2X3WD 3HFOA 2LP5A 3JCMb 4M75F 5CAIA 1UECA 5DY9A 4PFPA 4FT2A 4FYVB 1G83A 5GAN4 1Q81U 2Z0WA 1UGRB 4ZNXA 4KGZB 3WVEB 2CUBA 3CBPA 2LX9A 1M90C 5GJWB 1N6AA 2RN8A 2P4TA 3X24B 3OBWA 2QA4A 1RLPC 1RAFB 5LJ5h 4OVAA 4M77F 1K4US 4ZN1A 2D6FA 3KBGA 1M1FA 1OU9A 3L2WA 3E1SA 1M9SA 5FW9A 4YTLA 2RB6A 4C92A 3G71A 1CKAA 5IAYA 2XI9A 4JS4A 4F7UB 3MPUB 1M1KU 3JCMg 4NS5A 1W2BS 1I81A 2XK0A 1CSKA 4B6MA 2AZVA 4QQ6A 4JLGA 1SHFA 2OI3A 3BDUA 2VXFA 1HYOA 4PJLA 4JLIA 3H41A 3FLGA 1MMDA 4BB7A 4ANJA 3L2ZA 3JCMc 3RKXA 4F7UA 5GMKj 4M7DF 1ZBXA 2FRWA 4N0AC 1UEBA 2YUNA 2E70A 5GAN5 2K3XA 2HQXA 3H0IA 1IZ6A 1I07A 2R58A 1VQOQ 2YRCA 5FU7B 2R5MA 1Q7YR 3HHTB 1TOVA 2D0QB 3H8ZA 4M75C 2L3SA 2XU8A 1OOTA 2KROA 1WXUA 2CYZB 4N4GA 1TUCA 4MZTA 2DIQA 2L3QA 1VQ8A 3A8OB 4XK8E 2EGAA 4BY6B 2O4XA 3FDRA 2H8HA 4E7ZA 2IVWA 4FT4A 1PNJA 3RMQA 4M77C 1MGQA 3OBYA 1TSFA 3A8MB 2KY9A 4HCCA 3M0UA 2O31A 4XTYA 2W10A 1ZSZA 1FMWA 1D0ZA 5GAMd 1JU5C 1QKXA 2DL8A 1MMAA 2CSIA 4ZGJB 3CCLT 2CZ7B 1YN8A 4KBMB 2V8JA 4OMNA 3LWIA 3SEMA 2BZ8A 2E5QA 2EIFA 1T3LA 5I21A 3MKDA 2CZ1B 1XTDA 3LW5E 2FPEA 1SSFA 3HPWA 3FIFA 2HCKA 1ZBJA 4QT7A 4RTWA 4M7DC 5FROA 4D8DA 5L8RE 4FIBA 5GMKe 2P4RA 1VQLA 3CCSQ 2JT4A 4VUBA 2QQAA 3CMET 1WA7A 3F70A 3SHWA 1ZSGA 3TQ7P 1VQ9T 4JRKA 3A98A 2L89A 2MF2A 1ZUUA 2KGTA 3NTHA 4FW1A 2HEQA 2EPDA 8ATCB 4O6JA 2IG0A 1QW1A 3HP9A 3OYIA 1MNDA 2HQHA 1GBQA 3ER0A 1WXBA 3BDLA 1QKWA 3VS0A 4EMKB 2DZ9A 1TH7A 4JZ4A 2RMOA 2QEXA 2K7AA 2NUTB 4IIOA 1JEGA 2LCSA 3CCRQ 1VQ5T 4TVRA 2EJ9A 1QP3A 1WJSA 2JS2A 1Q86U 4UC4A 3CC2T 1OPKA 1QCOA 3P8HA 4LD6A 1C1AA 1LNXA 1RADB 1DJ7B 2DVEA 4PKCC 3I35A 3M54A 2NUTA 1HJDA 4OGCA 5GAN6 3O5ZA 2KMTA 2E6NA 2LQKA 3OYKA 1PRMC 1VQ7Q 3S6WA 1YJNA 1YJ9Q 4KH1B 3DKMA 1GBRA 1WJRA 1Z9ZA 1QVGA 1PG5B 2YXYA 4OB0B 1QWFA 2HKNA 1KC8C 3V8JA 2ED0A 4P5NA 4L59A 3OYDA 2RK2A 1YJWA 2LC4A 3HFNA 4V2SA 1JB0E 4J83A 2KEAA 2EJFA 3OW2P 3JCMP 3QDFA 1M3BA 3A8HB 2K3YA 3MP6A 3CMAT 5A0DA 1MMNA 4M7AD 2EBPA 4BE2A 1GFCA 1NLPC 4BE1A 7AT1B 5IHKA 2O9VA 1YITQ 2D9TA 4M78B 1X6BA 2RA2A 2F1LA 4MZMA 4EMHA 1KD1C 2KR3A 2HNIA 4XTWA 3OMGA 1I8FA 4OP0A 1KQSS 5FWCA 2DD4A 1OQKA 4PJOB 2J6OA 3CXCS 3ASKA 4A4HA 1N8RR 4FYYB 2LMJA 1H3ZA 2K57A 1VQKQ 1U06A 4M78A 2FEIA 3GNFB 5GAMg 1I5LA 2L8DA 2JUFA 5A2QE 1YHQT 3DB4A 3ME9A 8AT1B 2VWFA 4BI8B 3R6NA 2V1RA 2J05A 4FL6A 4C5GA 1UTIA 1NG2A 3CPWP 3RMSA 5LL6S 2JW4A 4C0GA 2F2XA 2K6DA 2PVOB 2RHIA 5LJ5d 5GANj 3OB9A 3OSSC 2KRMA 3MEVA 2D0NA 4CC3A 4FSXA 3PVQA 4XU0A 2QQ9A 4DBQA 1NEGA 1E6HA 4CRIA 2HL5C 1VQOA 1EIFA 3CC7T 2VKNA 4X34A 3FJPA 5KYWB 2YUPA 3TEEA 1NJIC 1ZX6A 4A4GA 1SF9A 2A3LA 1VQMT 1W2BA 2ECZA 4F7UF 5HY6A 1JRIA 3QPHA 1IXDA 2CH4W 3JCMQ 1RAEB 2FL7A 1IO6A 1FXXA 2MYSA 4PL6A 5KYWA 4KULA 1Q95G 4E7HA 2MOXA 3CPWS 4E7KA 2LZ6B 4Y92A 4LUDA 1Q81R 3EAEA 3NHNA 4AT1B 3V7SA 2K2MA 1GCQA 4RCCA 2RI5A 3JB9D 1PKTA 2CS7A 4Y28E 1C6VX 1OZ3A 3GLXA 2ZZDA 4AFSC 5KCHA 1VQ4Q 4GBQA 5I2SA 1AWJA 3EH2A 4JUVA 1SKUB 2DTIA 2JMCA 3D7SB 2ATCB 4C5HA 4OMLA 3EFRA 5GAOm 2OX7A 2KXDA 1VQNT 3P8BB 1WHMA 5GANe 1YCYA 1RAIB 2ZAEA 2A37A 5GAOp 2OJ2A 3L2QA 1M1KR 2BE9B 3SFMA 4MMLA 2EFIA 4C8QA 1ZA2B 3QWYA 4M75D 1OX9A 1WFWA 2HSPA 3RNJA 3PIPA 3CCSA 3GNGA 1I0CA 4J9DA 1FMKA 2DEUA 2HKQB 1HD3A 1ABOA 1ABQA 2QQSA 4KUDK 2ZPEB 5IT9E 4LNPA 1M8MA 1KK7A 3BY7A 1SEMA 3BFMA 3OYBA 2G3RA 4BDYA 4M77D 2CP3A 5HK3A 3V7RA 2DRKA 2DERA 1Y57A 5D6YA 2CH4A 4JRPA 2JTEA 1YI2T 4J7FA 2K5LA 3CCRA 3A5ZB 3LLRA 1RL2A 3MCAB 3CCQT 5IHIA 1I5OB 2E41A 4RTYA 3G6ET 3VJPA 2DXTA 2CREA 3OS5A 1F1BB 1Q82C 2QAZA 4Z89A 3VU3C 1AWXA 4XTZA 1XNIA 2QQBA 4C0FA 1K9MU 5FU7C 2NUZA 1JXMA 3SWNC 4M7DD 1K73U 2RI2A 1VQ7A 5LJ5g 5GAOq 1YJ9A 1TUGB 2DYBA 1IGQA 3H0HA 3OYAA 1KHCA 1MHNA 5HCKA 1VIFA 3QZ9B 2DX1A 5DM7R 4PJJA 5D6XA 1M2OA 2RH2A 2KAFA 2VGNA 2RJFA 4BY6C 1TU0B 2V8KA 3OS1A 1BKBA 5GMKh 4PLLA 4Q5WA 4C0ZA 3QYHB 3C12A 4WF2A 4DEYA 1VQ4T 5LJ3f 4CC7A 4NL2A 3JCMW 5ECAA 3EG3A 1YITA 2OTLQ 3AHUA 2DRMA 5IHNA 3X28B 3A1PA 3QJ6A 3CQTA 3UT1A 2CZ6B 1UJ0A 3I55Q 3PMIA 2EYQA 3M0TA 1WQ7A 4RKUE 1V29B 1VQKA 1QMCA 4Y91A 3MEAA 4KH0B 1Z9QA 4HT8A 4JDSA 1M3CA 3HRUA 4PLIA 1X2KA 2E10A 3M57A 2HAXA 1ACMB 1BI0A 3JCMf 3UATA 4QKUA 1JBMA 2KXCA 4AG1C 2OTJT 1NJIU 3CCLQ 1H92A 4WCIA 4J9HA 2V26A 1JJ2P 3I56Q 3L2VA 3EHRA 2X51A 3RERA 1KQSA 4M78F 4OMMA 4O5VA 2P0PA 4BI4A 1FMVA 4EMKC 1RAGB 4C92B 3CXCA 4C92G 1EZZB 5M9OA 3VRYA 4C92E 3FRNA 1EFNA 4PJOF 3QIIA 3OQ5A 1QVFS 1X43A 3FJ5A 4RTZA 2JVVA 3CMEQ 2GTJA 1WHKA 4F14A 1UHCA 3LYIA 1VQ9Q 1N27A 2Y4XA 1LOJA 2ESWA 2LVMA 1UGSB 5FU6B 1AWOA 3M0SA 2E6ZA 4F7UG 4FYWB 1NM7A 4HXJA 1OPLA 2GGRA 4F7UE 2RHYA 2CT4A 4J6YA 3VRZA 2A0FB 1WHGA 2M1HA 5J39A 4LDWA 1VQ5Q 1JJ2S 3CCJT 2E4HA 1NEBA 3CCVA 3RDVA 2R57A 1SSHA 3CC2Q 3RESA 1M1GA 3CCUT 4J6XA 2V8IA 3MEUA 3A8GB 1PM3A 2DF6A 1K9AA 4E7JA 3ZL7C 2O4XB 2L5QA 2AIRB 2EWNA 2ABLA 2ZPGB 4AFUC 2AKKA 1W1FA 2CT3A 4KRTA 5GAN7 2L3PA 3G7ZA 2OTLT 4MDXA 3CPWA 1I1JA 3V8KA 2C0IA 4FCYA 5CKFA 1ZSZB 1YNZA 3MP1A 1BIBA 4RTXA 3I55T 1GRIA 2P0QA 1WPYA 2AZSA 1OI1A 1BU1A 4PJOC 2EKOA 1BBZA 1AHJB 2DZCA 4PK4A 2BZYA 4FU6A 1T3SA 2X35A 3CMAQ 3EG9B 2B8AA 4RCBA 3QJYA 2LT4A 1VYUA 3GBQA 5KYXA 1G3TA 4M7AB 3DLLA 4Z02A 1FWZA 2D8JA 1G8XA 4DBFA 3I56T 3EG9A 3I9QA 1RAHB 3DB3A 1S72T 1QCFA 2DKGA 4E2FB 2G6FX 4CI0C 3REAB 1WI7A 3CBMA 3QKJA 1WX6A 5GJVB 4M7AA 5KYNA 5AYFA 3C0CA 2KK4A 3JCMX 1MV0B 1YHQQ 2EQIA 4ZGDB 4JJNK 4DOWA 2QG9B 5KE2A 4LDXA 2E5KA 2EW3A 1RAAB 4GLMA 2HDAA 4Z8AA 2CP7A 4OMPA 3H6ZA 3HTRA 2DJQA 2DO3A 4ATOA 3DLMA 3OYNA 1VQ6T 4OMQA 3E9GA 4IUUA 3UDCA 3OYFA 1G5VA 2DXUA 5GANh 2RPNA 3CCMQ 2FZKB 3IQLA 3NTIA 3PT9A 1KQ1A 1Y71A 5FRNA 2VC8A 4NL3A 1G3WA 4QVCA 2EYYA 2DL7A 1EX4A 4Z88A 3CC7Q 1VQPA 4XTXA 5L23A 2EJGA 1VQMQ 3INZA 2DBKA 4BUGA 5GAN3 2X4WA 3I5RA 1NPRA 3E19A 5FRMA 2AKLA 4R0KA 2FG0A 3M9QA 3JB9H 2QQRA 2LCLA 2RJCA 1NBEB 1ARKA 4E47A 4PFZA 2ZPIB 3G1JA 3LGFA 2BIVA 5I22A 5C0MA 4A54A 2BKDN 1NE8A 3LWHA 1U8RA 2OAWA 1HSQA 1M90U 1O9SA 3OSVA 5GAMf 1IHVA 1UUEA 3PNWC 4IUVA 2KQWA 1V1CA 1WHJA 3QWXX 2PVGB 1W70A 2DNUA 1QWEA 2I2LA 3CCLA 3META 4FM4B 4OB1B 2DL3A 2BUDA 1ZA1B 4J9IA 3S3NA 1MUZA 1YP5A 1A0NB 3GIBA 1VQNQ 2CP0A 3EHQA 1PSEA 5J3BA 5LJ3j 3MJXA 3HL8A 4FW2A 1K9MR 3HSBA 1IB8A 3VKIA 1SRLA 4M78G 1AD5A 1VA7A 5EG2A 2RNAA 4F04B 1K73R 4M78E 2E65A 2WSCE 2DBMA 5GMKi 3NMZC 1RABB 3CMEA 4KUIA 4PJOG 2RI3A 1W6XA 4AFQC 2DTHA 5KYUA 1LJOA 1VQ9A 2HMAA 4N0AA 4PJOE 4JS5A 3SDZA 1AWWA 1N8RC 2NYSA 2LJ0A 1RI0A 4R56A 2DILA 4C0DB 4E7IA 2X4YA 4E7LA 4RTVA 4ZN3A 2K4YA 5KE3A 3RKWA 2LJ3A 3CCET 4M75A 2DM1A 4EDUA 3OW2S 2ED1A 1YI2Q 2EQMA 3CC4T 1VQ5A 3FB9A 3EGXA 3QBYA 3CCQQ 1SHGA 4OF1A 3G6EQ 3CCMT 4J6WA 3CC2A 4C92F 1QVFA 1K1ZA 1BB9A 2VB6A 4L6V5 1JXOA 4M77A 1D3BA 1Y0MA 1Y7XA 3VYHB 3NPFA 3VS3A 2ENMA 2QGGA 3CD6T 2EVRA 2GQVA 1VYVA 2W0ZA 1PRLC 4IUTA 2EYXA 2MIOA 2J6FA 2PNIA 1IHWA 3EGUA 1RACB 1WLPB 1E6GA 3L2RA 2GBQA 5DLOA 2P0KA 3L1AA 5FLXE 4D8KA 2FZCB 2X4XA 2J6KA 2HQEA 3QYGB 4ZGEB 2AHJB 5LJ3e 2JZ2A 3LGLA 3M55A 2EGCA 2KYMA 1JJ2A 4F16A 4J8OA 2RHXA 1X27A 3M0PA 3VUZA 2PVDB 3RBBB 1D09B 1OYXA 4M7DA 2A28A 3G4ST 1G3SA 3CMAA 1Q81C 3RKYA 3JRZA 2JMAA 1Y96A 2HBWA 1YIJT 1ZUKA 2DIGA 2RJEA 3EFOA 4A53A 5EC7A 1KQ2A 2EKHA 4C8QB 2FB7A 4C8QG 1WYXA 4XAXB 4C8QE 4MMKA 1HK9A 4LE9A 3OYYA 3JCMe 5GAOn 4LN2A 3OYGA 2WSEE 2M51A 2ZPHB 2A36A 3PGGA 5CVIA 4ORZA 2YRDA 1V76A 2RHUA 4HT9A 4C92C 1FX7A 3OS2A 1M1KC 4QVDA 1YHQA 1QLYA 2COWA 3AT1B 4N4IA 2YLCA 3QUIA 1G2BA 1YWPA 2OTJQ 4A4EA 5LJ5f 2E3HA 4RUGA 1PCXA 2YT6A 4PJOD 2DMOA 5FU6C 1D1CA 4M7AF 4BDZA 2XICA 4XU1A 3LH5A 2LJ1A 3OYCA 1H3HA 3M0QA 3KFVA 3NGPA 1NPPA 3CC7A 2JJ9A 4HCKA 3JSCA 4C5IA 2COZA 3OA6A 4HCZA 3M5AA 1VQMA 3CBOA 1N9RA 2FPFA 1KC8U 2O01E 4PJMA 2DFUA 1M30A 2M9UA 3V7CA 4A4KA 2E1HA 1QVGP 4IURA 5GANd 5IH2A 4R55A 4FYXB 1IRXA 1TS9A 4FSSA 1N5ZA 1UE9A 1XOVA 3L2UA 1PC0A 2IIMA 2M0OA 1BYMA 1TG0A 4F17A 2JM8A 1D0YA 3PFSA 1WHHA 2F2VA 4E6RA 4J9BA 1UGVA 1PHTA 1S1NA 1UB4A 4X9DA 5CK9A 1KFZA 2RF0A 2RQRA 3REBB 2KBTA 3CCJQ 1KD1U 2WACA 2PQWA 4CC4B 2QA4T 1ZSZC 1XJWB 2ZPFB 3LX7A 2L0AA 3CCUQ 2GTOA 4HCBA 2JTMA 2JNGA 2XKOC 3G71T 2I0NA 4B9XA 1VYTA 1X6GA 2FPDA 3MEWA 1VQNA 3JB9I 2KDSA 3EG1A 1K8AC 2AT1B 2MPXC 2C0OA 1YCSB 3J81E 4M7AC 3UA6A 2DEQA 2FZGB 4ZTJA 4LXCA 3HKSA 2PUKB 1UFFA 4A63B 1K0XA 2ROTA 4IKFA 3CCVT 1NLOC 1SG5A 3UA7A 4XQ3A 1M27C 2EAYA 4X9CA 3H0FA 2BZXA 4HA8A 1LPLA 3I5SA 6AT1B 3TU4K 2RM4A 5CR2A 4KGXB 3OYEA 1ZQ1A 3JB9F 1M2VB 1AZEA 5GAMj 3TREA 1D1AA 2MI6A 2GFUA 2YLBA 2HD0A 1R8OB 1YJNQ 1B7TA 2B86A 1YI2A 1Q86R 1VQ8T 2M02A 2NLUA 4DA4A 5CKHA 3CCQA 1M2VA 4DOVA 4ME7A 3G6EA 1OX8A 3VS2A 1S72Q 1HXDA 2EQUA 2K79A 1XQHA 1P92A 2DL4A 4JJBA 4RG2A 1X01A 2XMFA 2CZ0B
chains in the Genus database with same CATH topology
3GNFB 5GAMg 1VQKT 5AYFA 3CD6A 2KK4A 2L8DA 3JCMX 1Y07A 1I5LA 3EFSA 2JUFA 5A2QE 4ZGDB 1YHQT 3DB4A 5LJ3g 3ME9A 2XDPA 4DOWA 4JJNK 4LDXA 5KE2A 4BI8B 4FL6A 3M53A 2OAUA 3A8LB 4C5GA 3UPUA 4C5EA 3OYHA 2HBPA 3RMSA 5LL6S 1B34A 1U1SA 4OB3B 4C0GA 3JCMd 2GFAA 2LCCA 3H6ZA 3QXEB 2PVOB 2RHIA 5LJ5d 5GANj 4ATOA 2DO3A 3OB9A 3NFCA 3OSSC 3OW2A 3DLMA 3OYNA 3MEVA 2R5AA 3OMCA 5CKEA 4BD3A 1VQ6T 3OS0A 3E9GA 4IUUA 3UDCA 3OYFA 4BE0A 4MZPA 5CQYA 1G5VA 2DXUA 3PMTA 3UWNA 5GANh 3OYJA 3NTIA 3PT9A 4FSXA 2QXFA 4LDVA 1KQ1A 1Y71A 4XU0A 1W4SA 3GOXA 3HRSA 2QQ9A 5FRNA 2VC8A 2EQKA 4CRIA 3M4YA 2ZPBB 1G3WA 4NL3A 1OZ2A 4QVCA 3G4SA 3X20B 3ZEHA 1VQOA 3M58A 1EIFA 2QTXA 2LDMA 5CO7A 2M16A 1VQLT 3CC7T 1VQ4A 4X34A 3FJPA 1M8VA 1NJIC 3TEEA 1YIJA 1VQPA 4XTXA 2EJGA 4A4GA 5GANg 2A3LA 3MP8A 4JRIA 3INZA 4QQGA 3VYGA 1VQMT 1W2BA 4BUGA 5GAN3 2X4WA 3C95A 1NPRA 2KVQG 2KSSA 3E19A 3OYMA 5FRMA 1VIEA 1WGSA 5GAMe 4F7UF 5HY6A 3NTKA 2JTFA 2H3JA 3M9QA 2FHDA 1JRIA 3QPHA 3QZ5B 3JB9H 1N8RU 2QQRA 3JCMQ 2LCLA 2RJCA 2FL7A 2RJDA 4E47A 1X6OA 3KUFA 1FXXA 1X75C 2MAMA 1Q7YC 4PL6A 1G3YA 2ZPIB 4KULA 4E7HA 3LGFA 3KXTA 3CPWS 2BIVA 5C0MA 4E7KA 4A54A 2BKDN 1NE8A 3LWHA 2Y4YA 5GMKm 2F69A 1U8RA 4M78C 3EAEA 1QVGS 2LRQA 3V7SA 2QEXT 1M90U 4RCCA 2ZGWA 2RI5A 1O9SA 3JB9D 2DJZA 3OSVA 2A7YA 2CS7A 4Y28E 5GAMf 1BIAA 2JN0A 1QVPA 3JCMV 3QDRB 1OZ3A 2LQ8A 3PNWC 3SWNB 4IUPA 2KQWA 4IUVA 3GLXA 1UGQB 4XU2A 5CKBA 2X4JA 2ZZDA 2PVGB 5KCHA 5I2SA 3C4SA 4XTUA 4C8QD 2OTJA 4JUVA 2I2LA 1VQPT 1YBYA 5GAOl 3CCLA 2FYKA 2DTIA 3META 3SB2A 3URGA 4FM4B 4OB1B 1IREB 2BUDA 4RG8A 1Q82U 3CEYA 3M56A 2LNVA 3S3NA 4C5HA 2YHTA 2DK3A 3EFRA 5GAOm 3JB9J 3V8LA 3GIBA 4C0DC 5HK0A 3SWNA 4B9WA 1VQNT 3P8BB 1PSEA 2VYTA 2XG8D 5A0LA 4GY5A 4LD9K 5GANe 5J3BA 4C8QF 1YCYA 4A4FA 5LJ3j 1YJNT 3HL8A 5GAOp 3VV0A 3HSBA 3L2QA 4M7AG 3VKIA 2XDBA 4M78G 3SFMA 4BI3A 4MMLA 2EFIA 2L3RA 5EG2A 4BACA 1WQWA 4M7AE 5LJ3h 4M78E 2RD1A 4C8QA 4M75D 2E65A 2WSCE 5GMKi 3PIPA 3RUXA 4IUQA 1Q86C 2VUBA 3CCSA 4ZTFA 3GNGA 1NZ9A 1O75A 3CMEA 4KUIA 1KG1A 3GF5A 4PJOG 3GP8A 2RI3A 3PIOA 2QQSA 4KUDK 2DTHA 1LJOA 2ZPEB 5IT9E 1VQ9A 4N0AA 4PJOE 1YJWT 3R6OA 4JS5A 1WNLA 5GANf 2DTOA 3SDZA 1N8RC 1RI0A 3BY7A 3HFOA 3WXMB 3JAME 3JCMb 4R56A 5HKCA 3BFMA 3CC4T 4M75F 5CAIA 3OYBA 5DY9A 2G3RA 4BDYA 4C0DB 4E7IA 2X4YA 4E7LA 1N9SA 2FVUA 4FT2A 4M77D 4ZN3A 3FC3A 5GAN4 1Q81U 5HK3A 1UGRB 2DPPB 2K4YA 5KE3A 3RKWA 4C92D 3V7RA 3CCET 4J7IA 4M75A 3WVEB 3BW1A 4QVZA 3CBPA 2LX9A 1K8AU 1M90C 5D6YA 4JRPA 4EDUA 3OW2S 5LJ5j 1N6AA 2QDYB 1YI2T 4J7FA 2EQMA 2P4TA 2DD5A 2K5LA 3FB9A 2VXEA 5I2MA 3JCMh 3X24B 3OBWA 3TCJA 3CCJA 3A5ZB 3CCRA 2QA4A 3LLRA 3QBYA 1RL2A 3MCAB 4JRQA 3CCQT 5GAOr 5LJ5h 4OF1A 4M77F 4OVAA 1UGPB 2E41A 3CCMT 4J6WA 3G6ET 4ZN1A 3P8DA 3OY9A 3CC2A 2VGMA 3VJPA 4C92F 1QVFA 2D6FA 3KBGA 5GAN2 2DXTA 4L6V5 3OS5A 1M1FA 3CCUA 3L2WA 3E1SA 1Q82C 4OMFB 1M9SA 4M77A 1D3BA 1Y7XA 4YTLA 3VYHB 3QO3A 2RB6A 2PU9B 4C92A 3VU3C 3G71A 2JOYA 4KT0E 4XTZA 5IAYA 3CD6T 4QQDA 1XNIA 2QQBA 2GQVA 4C0FA 2XI9A 1K9MU 4IUTA 4JS4A 2E64A 4F7UB 1M1KU 5FU7C 2XDDA 3JCMg 3SWNC 4NS5A 4II1A 1W2BS 4M78A 2RI2A 1K73U 1VQ7A 4M7DD 3QHSA 5LJ5g 1I81A 3L2RA 2XK0A 5DLOA 5GAOq 2P0KA 2OTLA 2PUOB 4QQ6A 1YJ9A 3L1AA 4JLGA 5FLXE 3OYAA 1KHCA 1MHNA 3BDUA 2VXFA 2X4XA 4C8QC 1VIFA 3QZ9B 4J5YA 4JLIA 2HQEA 3FLGA 5DM7R 3QYGB 4ZGEB 5D6XA 4BB7A 2AHJB 5LJ3e 3L2ZA 5GMKl 2JZ2A 2RH2A 3LGLA 3M55A 2KAFA 4L5GA 3RKXA 3JCMc 2VGNA 4EMGA 3X25B 2RJFA 4BY6C 4F7UA 3I55A 1JJ2A 2DXBA 4J8OA 4LDUA 1ZBXA 5GMKj 2RHXA 4M7DF 4N0AC 1UEBA 3VUZA 2PVDB 2V8KA 4EMKA 3OS1A 2E70A 1BKBA 5GAN5 4DQ2A 2EQJA 1OYXA 2K3XA 5GMKh 4D6WA 5GAN8 4M7DA 4PLLA 2HQXA 3G4ST 4Q5WA 1IZ6A 1G3SA 2R58A 4C0ZA 3CMAA 3QYHB 1VQOT 3C12A 5FU7B 3RKYA 1Q81C 2R5MA 3T9NA 5KH6A 4WF2A 3HHTB 3JRZA 1VQ4T 5LJ3f 2D0QB 2F5TX 3H8ZA 4NOYA 3JB9G 1Y96A 2DAQA 4M75C 4NL2A 1YIJT 3JCMW 2DIGA 2XU8A 2XD0A 2RJEA 1YITA 4A53A 3AHUA 3RIRA 1KQ2A 4C8QB 2CYZB 4N4GA 2FB7A 4MZTA 4C8QG 5CKDA 2DIQA 5D6WA 1VQ8A 4XAXB 3X28B 3A8OB 4MMKA 4XK8E 4C8QE 2RHZA 3QJ6A 1HK9A 3WVDB 3I56A 3UT1A 4BY6B 2CZ6B 2O4XA 3OYYA 3JCMe 3FDRA 5GAOn 5J26A 3OYGA 2WSEE 1S72A 2IVWA 4FT4A 3PMIA 2RO0A 2ZPHB 2EYQA 5LJ5e 1WQ7A 3RMQA 3PGGA 2CGHA 4RKUE 5CVIA 3ZFJA 1V29B 4M77C 1MGQA 3OBYA 1VQKA 2RHUA 3A8MB 4HT9A 4C92C 1FX7A 4Y91A 3OS2A 3MEAA 1K9MC 2KY9A 4HCCA 1M1KC 4QVDA 4JDSA 4HT8A 3HRUA 3QG1A 4PLIA 1YHQA 5A0GA 4XTYA 2E10A 4N4IA 1K73C 2YLCA 3QUIA 3M57A 5GAMd 4M75B 2HAXA 1BI0A 4M75G 3JCMf 4OB2B 1JBMA 3M4GA 4A4EA 2OTJT 4M75E 1NJIU 4ZGJB 5LJ5f 3S3OA 2WSFE 2QI2A 3CCLT 2CZ7B 3S3MA 4KBMB 3J80E 2V8JA 3LWIA 4PNOA 2E5QA 4ELYC 1VQ6A 2EIFA 4PJOD 5I21A 2CZ1B 1XTDA 5FU6C 3LW5E 5KCOA 3L2VA 4MDWA 4M7AF 3RERA 4BDZA 1KQSA 4M78F 2DXCA 4O5VA 2P0PA 1SSFA 3HPWA 4M77B 4BI4A 1D3BB 2XICA 3FIFA 4M77G 4XU1A 4EMKC 1Q7YU 4C92B 3CPFA 4N4HA 3OYCA 3CXCA 4QW2A 3HRTA 4C92G 4M7DC 4M77E 5FROA 5L8RE 5M9OA 4FIBA 4C92E 1KHIA 5GMKe 4ELZC 1NPPA 3FRNA 3L42A 3OYLA 3VUBA 3CC7A 4PJOF 1VQLA 3QIIA 3OQ5A 3CCST 1QVFS 4VUBA 2K2VA 2QQAA 3JSCA 2JVVA 4C5IA 1VQ5A 3J7AF 3CMET 3OA6A 4HCZA 3M5AA 1VQMA 3CBOA 3LYIA 1N9RA 4LDYA 3F70A 1KC8U 4PJOA 2O01E 1VQ9T 4JRKA 3QSUA 1ZHIA 3N5BB 2MWPA 2M9UA 4A4KA 3V7CA 2LTOA 3JCMJ 2E1HA 1N27A 2L89A 2MF2A 4IURA 5GANd 4R55A 2Y4XA 1LOJA 1XOVA 5FU6B 2LVMA 1UGSB 3ZBDA 5CCAA 4RMOA 3L2UA 2M0OA 3NTHA 1BYMA 2E6ZA 4F7UG 4O6JA 2IG0A 1QW1A 4F7UE 2RHYA 3HP9A 3OYIA 2E12A 3ER0A 3BDLA 3Q1JA 4J6YA 2K5IA 3PFSA 4EMKB 1VUBA 4M7DB 2DZ9A 4M7DG 1TH7A 2QEXA 1UB4A 4X9DA 4M7DE 2M1HA 5CK9A 5J39A 4LDWA 1VQ5T 4TVRA 3CCRT 5CIUA 1KD1U 2Y90A 1JJ2S 2EJ9A 2WACA 2PQWA 3GPLA 3CCJT 3CCVA 2QA4T 1Y96B 1QP3A 1WJSA 2R57A 4OGEA 1Q86U 4UC4A 2ZPFB 3LX7A 3RESA 3CC2T 1M1GA 4HCBA 3CCUT 3P8HA 2JTMA 4J6XA 4LD6A 2JNGA 2V8IA 3MEUA 3SD4A 3A8GB 1LNXA 1DJ7B 2DVEA 4PKCC 2XKOC 3G71T 3M54A 3FEOA 4B9XA 4E7JA 2O4XB 2L5QA 2EWNA 1U1TA 4OGCA 2C06A 2ZPGB 5GAN6 3MEWA 4HKEA 2GCXA 1VQNA 2KMTA 3O8VA 3JB9I 2E6NA 2KDSA 2LQKA 3OYKA 1K8AC 1BI1A 1VQ7T 3S6WA 1YJNA 2YRVA 5GAN7 3G7ZA 2OTLT 4MDXA 1YJ9T 3J81E 3CPWA 4M7AC 3DKMA 3V8KA 1GXIE 2F5KA 2DEQA 1BI2A 4ZTJA 5DLQE 2XHCA 3HKSA 5CKFA 5CQXA 2PUKB 5C6SA 1WJRA 1QVGA 3MP1A 4OB0B 1BIBA 3C94A 2MMPA 4IKFA 1KC8C 3CCVT 3V8JA 3I55T 2K5FA 2P0QA 1WPYA 4XTVA 4P5NA 1OI1A 4L59A 1QP2A 2RK2A 3OYDA 1BI3A 4PJOC 1YJWA 2EKOA 3MO8A 2LC4A 4XQ3A 1AHJB 3HFNA 1JB0E 2DZCA 4V2SA 2EAYA 4J83A 2GF7A 4X9CA 4FU6A 2EJFA 2X35A 3JCMP 1M4ZA 4HA8A 3TU4K 1M5Q1 2RM4A 5CR2A 3OYEA 3A8HB 2XIDA 1ZQ1A 2K3YA 1H641 3MP6A 3CMAT 3JB9F 2VV5A 2B8AA 5A0DA 4RCBA 2CKKA 5GAMj 3QJYA 2LT4A 4M7AD 3TREA 1I4K1 4BE2A 2MI6A 4M78D 3CCEA 2GFUA 1PSFA 2YLBA 4BE1A 2HD0A 1R8OB 3M59A 5LJ3d 1G3TA 4M7AB 5GAMh 3DLLA 2D9TA 1YITT 4M78B 2ZCFB 2RA2A 4Z02A 1FWZA 4MZMA 4EMHA 3E9FA 1YI2A 1KD1C 3CC4A 2HNIA 4XTWA 3OMGA 3X26B 2NLUA 1VQ8T 1I8FA 3LH0A 4OP0A 4DA4A 5CKHA 2RK1A 3I56T 3CCQA 1KQSS 4DOVA 4ME7A 3CCMA 3G6EA 2DD4A 3DB3A 1S72T 4PJOB 1HXDA 2EQUA 2DKGA 4GLKA 1B34B 4EPCA 3PTAA 1XQHA 4CI0C 3ASKA 1P92A 2MWOA 4A4HA 3CXCS 2LT1A 1WJQA 4RG2A 3CBMA 3QKJA 1H3ZA 3MHXA 4XU3A 2K57A 1X01A 4M7AA 2CZ0B 5IN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHY A;  2HQX A;  2VYT A;  4GY5 A;  4PLL A;  4Q5W A;  3OYI A;  2R58 A;  2L8D A;  4A4F A;  3BDL A;  3Q1J A;  3PFS A;  3DB4 A;  2R5M A;  5KH6 A;  3L2Q A;  3ME9 A;  2XDP A;  5KE2 A;  4FL6 A;  3H8Z A;  4C5G A;  2EFI A;  2L3R A;  4BAC A;  2DAQ A;  2M1H A;  4C5E A;  5J39 A;  3OYH A;  2DIG A;  4IUQ A;  5CIU A;  2RJE A;  2WAC A;  2PQW A;  4ZTF A;  2GFA A;  2LCC A;  3H6Z A;  4N4G A;  1WJS A;  2RHI A;  2R57 A;  2DIQ A;  2RI3 A;  3OB9 A;  4UC4 A;  2QQS A;  3LX7 A;  5D6W A;  3DLM A;  3OYN A;  3MEV A;  2R5A A;  3OMC A;  2RHZ A;  4BD3 A;  3QJ6 A;  3P8H A;  4LD6 A;  3OS0 A;  3E9G A;  4IUU A;  3UT1 A;  2O4X A;  3MEU A;  3SD4 A;  3OYF A;  3FDR A;  4BE0 A;  1G5V A;  5J26 A;  3PMT A;  3UWN A;  3OYG A;  3OYJ A;  3NTI A;  3PMI A;  1RI0 A;  2RO0 A;  3FEO A;  4B9X A;  3GOX A;  4E7J A;  2O4X B;  3OYB A;  2G3R A;  4BDY A;  4E7I A;  5FRN A;  4CRI A;  2EQK A;  2X4Y A;  4E7L A;  3MEW A;  3FC3 A;  1OZ2 A;  2RHU A;  3O8V A;  2E6N A;  5KE3 A;  3OS2 A;  3OYK A;  3MEA A;  3ZEH A;  3S6W A;  4PLI A;  2YRV A;  2LDM A;  4QVZ A;  2M16 A;  4N4I A;  5D6Y A;  4EDU A;  4X34 A;  2F5K A;  4ZTJ A;  2EQM A;  4A4G A;  4A4E A;  3MP8 A;  5C6S A;  4QQG A;  1WJR A;  3LLR A;  3S3O A;  3MP1 A;  2X4W A;  3QBY A;  3S3M A;  4OVA A;  3OYM A;  4IKF A;  5FRM A;  1WGS A;  3P8D A;  3NTK A;  1OI1 A;  2JTF A;  3M9Q A;  4L59 A;  2FHD A;  2E5Q A;  3OY9 A;  3OYD A;  2EKO A;  3MO8 A;  3L2W A;  2QQR A;  2RJC A;  2GF7 A;  3L2V A;  2RJD A;  4FU6 A;  5KCO A;  3KUF A;  2X35 A;  4PL6 A;  4BDZ A;  5IAY A;  4E7H A;  3LGF A;  3OYE A;  4QQD A;  2BIV A;  1XNI A;  1SSF A;  2K3Y A;  5C0M A;  2IG0 A;  3MP6 A;  4IUT A;  2BKD N;  2B8A A;  4E7K A;  2CKK A;  4N4H A;  3OYC A;  4QW2 A;  3EAE A;  4NS5 A;  5FRO A;  4II1 A;  4BE2 A;  2LRQ A;  2RI2 A;  2GFU A;  5M9O A;  4BE1 A;  2RI5 A;  3L2R A;  2XK0 A;  3L42 A;  2P0K A;  3OYL A;  1OZ3 A;  3PNW C;  3QII A;  4QQ6 A;  4IUP A;  2D9T A;  3OQ5 A;  4IUV A;  5KCH A;  3OYA A;  4Z02 A;  1KHC A;  1MHN A;  4C5I A;  2X4X A;  3C4S A;  3E9F A;  3OA6 A;  4HCZ A;  3LYI A;  2HQE A;  3F70 A;  3FLG A;  2NLU A;  3OMG A;  3LH0 A;  5D6X A;  3MET A;  2JZ2 A;  3LGL A;  2MWP A;  1OYX A;  3DB3 A;  2LTO A;  2RJF A;  2BUD A;  1N27 A;  2EQU A;  2L89 A;  3CEY A;  4IUR A;  2RHX A;  3S3N A;  4C5H A;  3ASK A;  2MWO A;  4A4H A;  2LVM A;  3L2U A;  2M0O A;  1WJQ A;  3NTH A;  4RG2 A;  3QKJ A;  3OS1 A;  1H3Z A;  4B9W A;  2EQJ A;  2K3X A;  5IN1 A; 
#chains in the Genus database with same CATH topology
 1Y07 A;  3EFS A;  2AK5 A;  5LJ3 g;  2XDP A;  3M53 A;  2OAU A;  3A8L B;  1BK2 A;  3UPU A;  1M90 R;  1ZLM A;  4C5E A;  3OYH A;  2HBP A;  1PKS A;  1UG1 A;  1R77 A;  2QDL A;  3OW2 A;  1U5S A;  3OMC A;  5CKE A;  3VS6 A;  2CP2 A;  1VQ6 Q;  1NYG A;  1NYF A;  1K76 A;  3OYJ A;  4LDV A;  1GL5 A;  2K3B A;  3HRS A;  2EQK A;  1OZ2 A;  3X20 B;  2EGE A;  3ZEH A;  5CO7 A;  1U3O A;  2M16 A;  1VQL T;  1VQ4 A;  4AMC A;  2EYZ A;  2YDL A;  5GAN g;  2M0Y A;  4JRI A;  3MP8 A;  3VYG A;  1VIE A;  1WGS A;  5GAM e;  3NTK A;  2JTF A;  2H3J A;  2FHD A;  1H8K A;  1WXT A;  3KUF A;  4HVW A;  2HSE B;  2MAM A;  3RR6 A;  1Q7Y C;  2X3X D;  1G3Y A;  1IGU A;  3KXT A;  4M78 C;  1X69 A;  1AOJ A;  4DBR A;  2LRQ A;  4IIM A;  2QEX T;  1BIA A;  2KT8 A;  1QVP A;  5KYX B;  3SWN B;  5CKB A;  1UGQ B;  3ULR B;  4M4Z A;  1WHL A;  3C4S A;  4XTU A;  2OTJ A;  1VQP T;  5GAO l;  1UDL A;  2FYK A;  3SB2 A;  3URG A;  1IRE B;  1Q82 U;  2PZ1 A;  2YHT A;  2DK3 A;  2JM9 A;  3V8L A;  2X9H A;  4C0D C;  3SWN A;  4B9W A;  5A0L A;  4GY5 A;  4C8Q F;  4DBH A;  1YJN T;  3VV0 A;  4M7A G;  4M7A E;  5LJ3 h;  2RD1 A;  1OV3 A;  2EYW A;  3RUX A;  1E7O A;  4ZTF A;  1BCM A;  1KG1 A;  3GF5 A;  1YWO A;  3JV3 A;  3PIO A;  4E7S A;  4AG2 C;  1YJW T;  1RUW A;  3R6O A;  1WNL A;  1VOM A;  4K11 A;  2DTO A;  3WXM B;  3JAM E;  5HKC A;  2YWW A;  1N9S A;  2FVU A;  3FC3 A;  2LNH B;  3EGD B;  1ZUY A;  2DPP B;  4C92 D;  3CCE Q;  4J7I A;  1B3Q A;  3BW1 A;  4QVZ A;  1K8A U;  5LJ5 j;  1GCQ C;  2QDY B;  3CC4 Q;  4J9G A;  2O2O A;  2DD5 A;  5I2M A;  2VXE A;  3JCM h;  3TCJ A;  3CCJ A;  2QGF B;  3PVL A;  4JRQ A;  4HVV A;  5GAO r;  1UGP B;  3EGD A;  3P8D A;  3OY9 A;  2VGM A;  5GAN 2;  3CCU A;  4J9C A;  1AVZ C;  4OMF B;  1QCN A;  3QO3 A;  2PU9 B;  2JOY A;  2GQI A;  4KT0 E;  3CD6 Q;  4QQD A;  2E64 A;  2XDD A;  2NWM A;  2D1X A;  4II1 A;  3QHS A;  2OTL A;  2PUO B;  1WDX A;  2IPO B;  1KSW A;  4EIK A;  2JS0 A;  1KJW A;  2DYI A;  4C8Q C;  4J5Y A;  1R0B G;  2YSQ A;  2KYB A;  5GMK l;  4EMG A;  1MNE A;  2NUP B;  4L5G A;  3I55 A;  3X25 B;  1R0C B;  1TTH B;  2DXB A;  4LDU A;  2LX7 A;  4EMK A;  2F2W A;  4DQ2 A;  2EQJ A;  2MK5 A;  1JQQ A;  5GAN 8;  4D6W A;  3G4S Q;  1VQO T;  2FO0 A;  3T9N A;  5KH6 A;  2C0T A;  1KQS P;  2KT1 A;  2QAS A;  2F5T X;  4NOY A;  3JB9 G;  2NUP A;  1YIJ Q;  2DAQ A;  3CXC P;  2XD0 A;  3RIR A;  3VS4 A;  2YUO A;  5CKD A;  3TSW A;  1SPK A;  5D6W A;  4LUE A;  1KC8 R;  2RHZ A;  3WVD B;  3I56 A;  1J3T A;  1QQJ A;  5J26 A;  1S72 A;  5KYU B;  2RO0 A;  5LJ5 e;  2JXB A;  3EG2 A;  2CGH A;  3M0R A;  3ZFJ A;  2QYZ A;  4J9E A;  1K9M C;  3QG1 A;  5A0G A;  1K73 C;  2DET A;  4M75 B;  4M75 G;  4OB2 B;  2RQU A;  3M4G A;  4M75 E;  1KD1 R;  3S3O A;  2WSF E;  2QI2 A;  3S3M A;  3J80 E;  4PNO A;  3EGX B;  2DL5 A;  4ELY C;  1VQ6 A;  5KCO A;  2VVK A;  1RI9 A;  4MDW A;  4AFZ C;  4X1V A;  5IXF A;  2DXC A;  2CUD A;  4M77 B;  1D3B B;  4M77 G;  1Q7Y U;  1SRM A;  3CPF A;  4N4H A;  4QW2 A;  3HRT A;  4M77 E;  1WZO A;  1OU8 A;  1KHI A;  4DEX A;  4ELZ C;  2DVJ A;  3L42 A;  3OYL A;  9ATC B;  3VUB A;  3BE3 A;  3CCS T;  2K2V A;  3J7A F;  1GFD A;  4LDY A;  4PJO A;  1BCO A;  2RQT A;  3QSU A;  1ZHI A;  3N5B B;  2MWP A;  2LTO A;  3JCM J;  2DE0 X;  3ZBD A;  5CCA A;  4RMO A;  1UHF A;  5D7U A;  2QK0 A;  2E12 A;  3Q1J A;  2LQN A;  2K5I A;  3VS7 A;  3VS1 A;  1VUB A;  2K9G A;  2LQW A;  4M7D B;  1AZG B;  4M7D G;  4M7D E;  1TWB A;  1NJI R;  3CCR T;  5CIU A;  2QA4 Q;  2Y90 A;  3GPL A;  1Y96 B;  4OGE A;  3EFO B;  1B07 A;  1OUL A;  4HVU A;  3SD4 A;  3TVT A;  3G71 Q;  3FEO A;  1U1T A;  2C06 A;  2RQW A;  2KRS A;  2GCX A;  4HKE A;  3O8V A;  1MMG A;  1BI1 A;  1VQ7 T;  2YRV A;  2DA9 A;  1YJ9 T;  2KI7 A;  1GXI E;  2F5K A;  1BI2 A;  1UJY A;  2KRN A;  5DLQ E;  2XHC A;  5CQX A;  3THK A;  5C6S A;  2E3I A;  3C94 A;  3H9N A;  3CCV Q;  2MMP A;  2K5F A;  4XTV A;  1QP2 A;  1BI3 A;  2RQV A;  3MO8 A;  2GF7 A;  4RTT A;  2CP5 A;  1M4Z A;  1M5Q 1;  2J7I A;  4JZ3 A;  2XID A;  1H64 1;  2VV5 A;  2CKK A;  3EH1 A;  1I4K 1;  1LCK A;  4M78 D;  3CCE A;  1PSF A;  4OMO A;  3M59 A;  5LJ3 d;  5GAM h;  1YIT T;  2ZCF B;  1WIE A;  2PTK A;  3E9F A;  3CC4 A;  1VQ8 Q;  1T0J A;  3X26 B;  3LH0 A;  1GCP A;  2RK1 A;  1RLQ C;  2KE9 A;  3CCM A;  4GLK A;  1T0H A;  1B34 B;  1JO8 A;  4EPC A;  3PTA A;  1PD1 A;  2MWO A;  2LT1 A;  1WJQ A;  3MHX A;  4XU3 A;  5IN1 A;  1VQK T;  3CD6 A;  1TUD A;  5FWB A;  2KNB B;  1AT1 B;  2O88 A;  2CP6 A;  4PJN A;  2D8H A;  1B34 A;  1U1S A;  4OB3 B;  3JCM d;  2CSQ A;  2GFA A;  2LCC A;  3QXE B;  2BTT A;  3UF4 A;  3NFC A;  5IXB A;  4BD3 A;  2BE7 D;  2R5A A;  3OS0 A;  4BE0 A;  4MZP A;  5CQY A;  3PMT A;  3UWN A;  1Q82 R;  2QXF A;  2COY A;  1W4S A;  3GOX A;  4JJC A;  2CDT A;  3M4Y A;  2ZPB B;  3G4S A;  4JPB W;  3M58 A;  2QTX A;  2LDM A;  1VQL Q;  2J06 A;  2QTV A;  1TXQ A;  2SEM A;  1OEB A;  1M3A A;  1M8V A;  1C0M A;  1YIJ A;  1K0S A;  1LVK A;  4QQG A;  3C95 A;  2KVQ G;  2KSS A;  3VS5 A;  3OYM A;  3EG0 A;  2SRC A;  3QZ5 B;  4ESR A;  1N8R U;  2O9S A;  1MV3 A;  2RJD A;  4WTO B;  1YFN A;  1X6O A;  1X75 C;  2P84 A;  2ROL A;  5I11 A;  1FYN A;  2A08 A;  2Y4Y A;  5GMK m;  2F69 A;  3PE0 A;  2QEX Q;  1QVG S;  1X2Q A;  2ZGW A;  1KIK A;  2DJZ A;  1AEY A;  2A7Y A;  2JN0 A;  3JCM V;  3QDR B;  2FRY A;  2LQ8 A;  5AT1 B;  4IUP A;  3TSZ A;  1K8A R;  4XU2 A;  2X4J A;  2VAS A;  2YUQ A;  2DLP A;  4C8Q D;  5KYY B;  1VQP Q;  1YBY A;  4J9F A;  2L2P A;  4RG8 A;  3CEY A;  3E2U A;  3M56 A;  2LNV A;  3U23 A;  3JB9 J;  4KGV B;  1QVF P;  5HK0 A;  2VYT A;  2XG8 D;  4LD9 K;  4JJD A;  4A4F A;  1D0X A;  5KYY A;  4RTU A;  2HZY A;  2GNC A;  2XDB A;  4BI3 A;  2L3R A;  4BAC A;  1WQW A;  4IUQ A;  4PFO A;  1Q86 C;  2VUB A;  2HL3 A;  4CC2 A;  1NZ9 A;  1O75 A;  1W2B P;  3GP8 A;  1D1B A;  1YJW Q;  2V1Q A;  1PWT A;  1PD0 A;  5GAN f;  2MCN A;  2H3E B;  1CKB A;  2X3W D;  3HFO A;  2LP5 A;  3JCM b;  4M75 F;  5CAI A;  1UEC A;  5DY9 A;  4PFP A;  4FT2 A;  4FYV B;  1G83 A;  5GAN 4;  1Q81 U;  2Z0W A;  1UGR B;  4ZNX A;  4KGZ B;  3WVE B;  2CUB A;  3CBP A;  2LX9 A;  1M90 C;  5GJW B;  1N6A A;  2RN8 A;  2P4T A;  3X24 B;  3OBW A;  2QA4 A;  1RLP C;  1RAF B;  5LJ5 h;  4OVA A;  4M77 F;  1K4U S;  4ZN1 A;  2D6F A;  3KBG A;  1M1F A;  1OU9 A;  3L2W A;  3E1S A;  1M9S A;  5FW9 A;  4YTL A;  2RB6 A;  4C92 A;  3G71 A;  1CKA A;  5IAY A;  2XI9 A;  4JS4 A;  4F7U B;  3MPU B;  1M1K U;  3JCM g;  4NS5 A;  1W2B S;  1I81 A;  2XK0 A;  1CSK A;  4B6M A;  2AZV A;  4QQ6 A;  4JLG A;  1SHF A;  2OI3 A;  3BDU A;  2VXF A;  1HYO A;  4PJL A;  4JLI A;  3H41 A;  3FLG A;  1MMD A;  4BB7 A;  4ANJ A;  3L2Z A;  3JCM c;  3RKX A;  4F7U A;  5GMK j;  4M7D F;  1ZBX A;  2FRW A;  4N0A C;  1UEB A;  2YUN A;  2E70 A;  5GAN 5;  2K3X A;  2HQX A;  3H0I A;  1IZ6 A;  1I07 A;  2R58 A;  1VQO Q;  2YRC A;  5FU7 B;  2R5M A;  1Q7Y R;  3HHT B;  1TOV A;  2D0Q B;  3H8Z A;  4M75 C;  2L3S A;  2XU8 A;  1OOT A;  2KRO A;  1WXU A;  2CYZ B;  4N4G A;  1TUC A;  4MZT A;  2DIQ A;  2L3Q A;  1VQ8 A;  3A8O B;  4XK8 E;  2EGA A;  4BY6 B;  2O4X A;  3FDR A;  2H8H A;  4E7Z A;  2IVW A;  4FT4 A;  1PNJ A;  3RMQ A;  4M77 C;  1MGQ A;  3OBY A;  1TSF A;  3A8M B;  2KY9 A;  4HCC A;  3M0U A;  2O31 A;  4XTY A;  2W10 A;  1ZSZ A;  1FMW A;  1D0Z A;  5GAM d;  1JU5 C;  1QKX A;  2DL8 A;  1MMA A;  2CSI A;  4ZGJ B;  3CCL T;  2CZ7 B;  1YN8 A;  4KBM B;  2V8J A;  4OMN A;  3LWI A;  3SEM A;  2BZ8 A;  2E5Q A;  2EIF A;  1T3L A;  5I21 A;  3MKD A;  2CZ1 B;  1XTD A;  3LW5 E;  2FPE A;  1SSF A;  3HPW A;  3FIF A;  2HCK A;  1ZBJ A;  4QT7 A;  4RTW A;  4M7D C;  5FRO A;  4D8D A;  5L8R E;  4FIB A;  5GMK e;  2P4R A;  1VQL A;  3CCS Q;  2JT4 A;  4VUB A;  2QQA A;  3CME T;  1WA7 A;  3F70 A;  3SHW A;  1ZSG A;  3TQ7 P;  1VQ9 T;  4JRK A;  3A98 A;  2L89 A;  2MF2 A;  1ZUU A;  2KGT A;  3NTH A;  4FW1 A;  2HEQ A;  2EPD A;  8ATC B;  4O6J A;  2IG0 A;  1QW1 A;  3HP9 A;  3OYI A;  1MND A;  2HQH A;  1GBQ A;  3ER0 A;  1WXB A;  3BDL A;  1QKW A;  3VS0 A;  4EMK B;  2DZ9 A;  1TH7 A;  4JZ4 A;  2RMO A;  2QEX A;  2K7A A;  2NUT B;  4IIO A;  1JEG A;  2LCS A;  3CCR Q;  1VQ5 T;  4TVR A;  2EJ9 A;  1QP3 A;  1WJS A;  2JS2 A;  1Q86 U;  4UC4 A;  3CC2 T;  1OPK A;  1QCO A;  3P8H A;  4LD6 A;  1C1A A;  1LNX A;  1RAD B;  1DJ7 B;  2DVE A;  4PKC C;  3I35 A;  3M54 A;  2NUT A;  1HJD A;  4OGC A;  5GAN 6;  3O5Z A;  2KMT A;  2E6N A;  2LQK A;  3OYK A;  1PRM C;  1VQ7 Q;  3S6W A;  1YJN A;  1YJ9 Q;  4KH1 B;  3DKM A;  1GBR A;  1WJR A;  1Z9Z A;  1QVG A;  1PG5 B;  2YXY A;  4OB0 B;  1QWF A;  2HKN A;  1KC8 C;  3V8J A;  2ED0 A;  4P5N A;  4L59 A;  3OYD A;  2RK2 A;  1YJW A;  2LC4 A;  3HFN A;  4V2S A;  1JB0 E;  4J83 A;  2KEA A;  2EJF A;  3OW2 P;  3JCM P;  3QDF A;  1M3B A;  3A8H B;  2K3Y A;  3MP6 A;  3CMA T;  5A0D A;  1MMN A;  4M7A D;  2EBP A;  4BE2 A;  1GFC A;  1NLP C;  4BE1 A;  7AT1 B;  5IHK A;  2O9V A;  1YIT Q;  2D9T A;  4M78 B;  1X6B A;  2RA2 A;  2F1L A;  4MZM A;  4EMH A;  1KD1 C;  2KR3 A;  2HNI A;  4XTW A;  3OMG A;  1I8F A;  4OP0 A;  1KQS S;  5FWC A;  2DD4 A;  1OQK A;  4PJO B;  2J6O A;  3CXC S;  3ASK A;  4A4H A;  1N8R R;  4FYY B;  2LMJ A;  1H3Z A;  2K57 A;  1VQK Q;  1U06 A;  4M78 A;  2FEI A;  3GNF B;  5GAM g;  1I5L A;  2L8D A;  2JUF A;  5A2Q E;  1YHQ T;  3DB4 A;  3ME9 A;  8AT1 B;  2VWF A;  4BI8 B;  3R6N A;  2V1R A;  2J05 A;  4FL6 A;  4C5G A;  1UTI A;  1NG2 A;  3CPW P;  3RMS A;  5LL6 S;  2JW4 A;  4C0G A;  2F2X A;  2K6D A;  2PVO B;  2RHI A;  5LJ5 d;  5GAN j;  3OB9 A;  3OSS C;  2KRM A;  3MEV A;  2D0N A;  4CC3 A;  4FSX A;  3PVQ A;  4XU0 A;  2QQ9 A;  4DBQ A;  1NEG A;  1E6H A;  4CRI A;  2HL5 C;  1VQO A;  1EIF A;  3CC7 T;  2VKN A;  4X34 A;  3FJP A;  5KYW B;  2YUP A;  3TEE A;  1NJI C;  1ZX6 A;  4A4G A;  1SF9 A;  2A3L A;  1VQM T;  1W2B A;  2ECZ A;  4F7U F;  5HY6 A;  1JRI A;  3QPH A;  1IXD A;  2CH4 W;  3JCM Q;  1RAE B;  2FL7 A;  1IO6 A;  1FXX A;  2MYS A;  4PL6 A;  5KYW A;  4KUL A;  1Q95 G;  4E7H A;  2MOX A;  3CPW S;  4E7K A;  2LZ6 B;  4Y92 A;  4LUD A;  1Q81 R;  3EAE A;  3NHN A;  4AT1 B;  3V7S A;  2K2M A;  1GCQ A;  4RCC A;  2RI5 A;  3JB9 D;  1PKT A;  2CS7 A;  4Y28 E;  1C6V X;  1OZ3 A;  3GLX A;  2ZZD A;  4AFS C;  5KCH A;  1VQ4 Q;  4GBQ A;  5I2S A;  1AWJ A;  3EH2 A;  4JUV A;  1SKU B;  2DTI A;  2JMC A;  3D7S B;  2ATC B;  4C5H A;  4OML A;  3EFR A;  5GAO m;  2OX7 A;  2KXD A;  1VQN T;  3P8B B;  1WHM A;  5GAN e;  1YCY A;  1RAI B;  2ZAE A;  2A37 A;  5GAO p;  2OJ2 A;  3L2Q A;  1M1K R;  2BE9 B;  3SFM A;  4MML A;  2EFI A;  4C8Q A;  1ZA2 B;  3QWY A;  4M75 D;  1OX9 A;  1WFW A;  2HSP A;  3RNJ A;  3PIP A;  3CCS A;  3GNG A;  1I0C A;  4J9D A;  1FMK A;  2DEU A;  2HKQ B;  1HD3 A;  1ABO A;  1ABQ A;  2QQS A;  4KUD K;  2ZPE B;  5IT9 E;  4LNP A;  1M8M A;  1KK7 A;  3BY7 A;  1SEM A;  3BFM A;  3OYB A;  2G3R A;  4BDY A;  4M77 D;  2CP3 A;  5HK3 A;  3V7R A;  2DRK A;  2DER A;  1Y57 A;  5D6Y A;  2CH4 A;  4JRP A;  2JTE A;  1YI2 T;  4J7F A;  2K5L A;  3CCR A;  3A5Z B;  3LLR A;  1RL2 A;  3MCA B;  3CCQ T;  5IHI A;  1I5O B;  2E41 A;  4RTY A;  3G6E T;  3VJP A;  2DXT A;  2CRE A;  3OS5 A;  1F1B B;  1Q82 C;  2QAZ A;  4Z89 A;  3VU3 C;  1AWX A;  4XTZ A;  1XNI A;  2QQB A;  4C0F A;  1K9M U;  5FU7 C;  2NUZ A;  1JXM A;  3SWN C;  4M7D D;  1K73 U;  2RI2 A;  1VQ7 A;  5LJ5 g;  5GAO q;  1YJ9 A;  1TUG B;  2DYB A;  1IGQ A;  3H0H A;  3OYA A;  1KHC A;  1MHN A;  5HCK A;  1VIF A;  3QZ9 B;  2DX1 A;  5DM7 R;  4PJJ A;  5D6X A;  1M2O A;  2RH2 A;  2KAF A;  2VGN A;  2RJF A;  4BY6 C;  1TU0 B;  2V8K A;  3OS1 A;  1BKB A;  5GMK h;  4PLL A;  4Q5W A;  4C0Z A;  3QYH B;  3C12 A;  4WF2 A;  4DEY A;  1VQ4 T;  5LJ3 f;  4CC7 A;  4NL2 A;  3JCM W;  5ECA A;  3EG3 A;  1YIT A;  2OTL Q;  3AHU A;  2DRM A;  5IHN A;  3X28 B;  3A1P A;  3QJ6 A;  3CQT A;  3UT1 A;  2CZ6 B;  1UJ0 A;  3I55 Q;  3PMI A;  2EYQ A;  3M0T A;  1WQ7 A;  4RKU E;  1V29 B;  1VQK A;  1QMC A;  4Y91 A;  3MEA A;  4KH0 B;  1Z9Q A;  4HT8 A;  4JDS A;  1M3C A;  3HRU A;  4PLI A;  1X2K A;  2E10 A;  3M57 A;  2HAX A;  1ACM B;  1BI0 A;  3JCM f;  3UAT A;  4QKU A;  1JBM A;  2KXC A;  4AG1 C;  2OTJ T;  1NJI U;  3CCL Q;  1H92 A;  4WCI A;  4J9H A;  2V26 A;  1JJ2 P;  3I56 Q;  3L2V A;  3EHR A;  2X51 A;  3RER A;  1KQS A;  4M78 F;  4OMM A;  4O5V A;  2P0P A;  4BI4 A;  1FMV A;  4EMK C;  1RAG B;  4C92 B;  3CXC A;  4C92 G;  1EZZ B;  5M9O A;  3VRY A;  4C92 E;  3FRN A;  1EFN A;  4PJO F;  3QII A;  3OQ5 A;  1QVF S;  1X43 A;  3FJ5 A;  4RTZ A;  2JVV A;  3CME Q;  2GTJ A;  1WHK A;  4F14 A;  1UHC A;  3LYI A;  1VQ9 Q;  1N27 A;  2Y4X A;  1LOJ A;  2ESW A;  2LVM A;  1UGS B;  5FU6 B;  1AWO A;  3M0S A;  2E6Z A;  4F7U G;  4FYW B;  1NM7 A;  4HXJ A;  1OPL A;  2GGR A;  4F7U E;  2RHY A;  2CT4 A;  4J6Y A;  3VRZ A;  2A0F B;  1WHG A;  2M1H A;  5J39 A;  4LDW A;  1VQ5 Q;  1JJ2 S;  3CCJ T;  2E4H A;  1NEB A;  3CCV A;  3RDV A;  2R57 A;  1SSH A;  3CC2 Q;  3RES A;  1M1G A;  3CCU T;  4J6X A;  2V8I A;  3MEU A;  3A8G B;  1PM3 A;  2DF6 A;  1K9A A;  4E7J A;  3ZL7 C;  2O4X B;  2L5Q A;  2AIR B;  2EWN A;  2ABL A;  2ZPG B;  4AFU C;  2AKK A;  1W1F A;  2CT3 A;  4KRT A;  5GAN 7;  2L3P A;  3G7Z A;  2OTL T;  4MDX A;  3CPW A;  1I1J A;  3V8K A;  2C0I A;  4FCY A;  5CKF A;  1ZSZ B;  1YNZ A;  3MP1 A;  1BIB A;  4RTX A;  3I55 T;  1GRI A;  2P0Q A;  1WPY A;  2AZS A;  1OI1 A;  1BU1 A;  4PJO C;  2EKO A;  1BBZ A;  1AHJ B;  2DZC A;  4PK4 A;  2BZY A;  4FU6 A;  1T3S A;  2X35 A;  3CMA Q;  3EG9 B;  2B8A A;  4RCB A;  3QJY A;  2LT4 A;  1VYU A;  3GBQ A;  5KYX A;  1G3T A;  4M7A B;  3DLL A;  4Z02 A;  1FWZ A;  2D8J A;  1G8X A;  4DBF A;  3I56 T;  3EG9 A;  3I9Q A;  1RAH B;  3DB3 A;  1S72 T;  1QCF A;  2DKG A;  4E2F B;  2G6F X;  4CI0 C;  3REA B;  1WI7 A;  3CBM A;  3QKJ A;  1WX6 A;  5GJV B;  4M7A A;  5KYN A;  5AYF A;  3C0C A;  2KK4 A;  3JCM X;  1MV0 B;  1YHQ Q;  2EQI A;  4ZGD B;  4JJN K;  4DOW A;  2QG9 B;  5KE2 A;  4LDX A;  2E5K A;  2EW3 A;  1RAA B;  4GLM A;  2HDA A;  4Z8A A;  2CP7 A;  4OMP A;  3H6Z A;  3HTR A;  2DJQ A;  2DO3 A;  4ATO A;  3DLM A;  3OYN A;  1VQ6 T;  4OMQ A;  3E9G A;  4IUU A;  3UDC A;  3OYF A;  1G5V A;  2DXU A;  5GAN h;  2RPN A;  3CCM Q;  2FZK B;  3IQL A;  3NTI A;  3PT9 A;  1KQ1 A;  1Y71 A;  5FRN A;  2VC8 A;  4NL3 A;  1G3W A;  4QVC A;  2EYY A;  2DL7 A;  1EX4 A;  4Z88 A;  3CC7 Q;  1VQP A;  4XTX A;  5L23 A;  2EJG A;  1VQM Q;  3INZ A;  2DBK A;  4BUG A;  5GAN 3;  2X4W A;  3I5R A;  1NPR A;  3E19 A;  5FRM A;  2AKL A;  4R0K A;  2FG0 A;  3M9Q A;  3JB9 H;  2QQR A;  2LCL A;  2RJC A;  1NBE B;  1ARK A;  4E47 A;  4PFZ A;  2ZPI B;  3G1J A;  3LGF A;  2BIV A;  5I22 A;  5C0M A;  4A54 A;  2BKD N;  1NE8 A;  3LWH A;  1U8R A;  2OAW A;  1HSQ A;  1M90 U;  1O9S A;  3OSV A;  5GAM f;  1IHV A;  1UUE A;  3PNW C;  4IUV A;  2KQW A;  1V1C A;  1WHJ A;  3QWX X;  2PVG B;  1W70 A;  2DNU A;  1QWE A;  2I2L A;  3CCL A;  3MET A;  4FM4 B;  4OB1 B;  2DL3 A;  2BUD A;  1ZA1 B;  4J9I A;  3S3N A;  1MUZ A;  1YP5 A;  1A0N B;  3GIB A;  1VQN Q;  2CP0 A;  3EHQ A;  1PSE A;  5J3B A;  5LJ3 j;  3MJX A;  3HL8 A;  4FW2 A;  1K9M R;  3HSB A;  1IB8 A;  3VKI A;  1SRL A;  4M78 G;  1AD5 A;  1VA7 A;  5EG2 A;  2RNA A;  4F04 B;  1K73 R;  4M78 E;  2E65 A;  2WSC E;  2DBM A;  5GMK i;  3NMZ C;  1RAB B;  3CME A;  4KUI A;  4PJO G;  2RI3 A;  1W6X A;  4AFQ C;  2DTH A;  5KYU A;  1LJO A;  1VQ9 A;  2HMA A;  4N0A A;  4PJO E;  4JS5 A;  3SDZ A;  1AWW A;  1N8R C;  2NYS A;  2LJ0 A;  1RI0 A;  4R56 A;  2DIL A;  4C0D B;  4E7I A;  2X4Y A;  4E7L A;  4RTV A;  4ZN3 A;  2K4Y A;  5KE3 A;  3RKW A;  2LJ3 A;  3CCE T;  4M75 A;  2DM1 A;  4EDU A;  3OW2 S;  2ED1 A;  1YI2 Q;  2EQM A;  3CC4 T;  1VQ5 A;  3FB9 A;  3EGX A;  3QBY A;  3CCQ Q;  1SHG A;  4OF1 A;  3G6E Q;  3CCM T;  4J6W A;  3CC2 A;  4C92 F;  1QVF A;  1K1Z A;  1BB9 A;  2VB6 A;  4L6V 5;  1JXO A;  4M77 A;  1D3B A;  1Y0M A;  1Y7X A;  3VYH B;  3NPF A;  3VS3 A;  2ENM A;  2QGG A;  3CD6 T;  2EVR A;  2GQV A;  1VYV A;  2W0Z A;  1PRL C;  4IUT A;  2EYX A;  2MIO A;  2J6F A;  2PNI A;  1IHW A;  3EGU A;  1RAC B;  1WLP B;  1E6G A;  3L2R A;  2GBQ A;  5DLO A;  2P0K A;  3L1A A;  5FLX E;  4D8K A;  2FZC B;  2X4X A;  2J6K A;  2HQE A;  3QYG B;  4ZGE B;  2AHJ B;  5LJ3 e;  2JZ2 A;  3LGL A;  3M55 A;  2EGC A;  2KYM A;  1JJ2 A;  4F16 A;  4J8O A;  2RHX A;  1X27 A;  3M0P A;  3VUZ A;  2PVD B;  3RBB B;  1D09 B;  1OYX A;  4M7D A;  2A28 A;  3G4S T;  1G3S A;  3CMA A;  1Q81 C;  3RKY A;  3JRZ A;  2JMA A;  1Y96 A;  2HBW A;  1YIJ T;  1ZUK A;  2DIG A;  2RJE A;  3EFO A;  4A53 A;  5EC7 A;  1KQ2 A;  2EKH A;  4C8Q B;  2FB7 A;  4C8Q G;  1WYX A;  4XAX B;  4C8Q E;  4MMK A;  1HK9 A;  4LE9 A;  3OYY A;  3JCM e;  5GAO n;  4LN2 A;  3OYG A;  2WSE E;  2M51 A;  2ZPH B;  2A36 A;  3PGG A;  5CVI A;  4ORZ A;  2YRD A;  1V76 A;  2RHU A;  4HT9 A;  4C92 C;  1FX7 A;  3OS2 A;  1M1K C;  4QVD A;  1YHQ A;  1QLY A;  2COW A;  3AT1 B;  4N4I A;  2YLC A;  3QUI A;  1G2B A;  1YWP A;  2OTJ Q;  4A4E A;  5LJ5 f;  2E3H A;  4RUG A;  1PCX A;  2YT6 A;  4PJO D;  2DMO A;  5FU6 C;  1D1C A;  4M7A F;  4BDZ A;  2XIC A;  4XU1 A;  3LH5 A;  2LJ1 A;  3OYC A;  1H3H A;  3M0Q A;  3KFV A;  3NGP A;  1NPP A;  3CC7 A;  2JJ9 A;  4HCK A;  3JSC A;  4C5I A;  2COZ A;  3OA6 A;  4HCZ A;  3M5A A;  1VQM A;  3CBO A;  1N9R A;  2FPF A;  1KC8 U;  2O01 E;  4PJM A;  2DFU A;  1M30 A;  2M9U A;  3V7C A;  4A4K A;  2E1H A;  1QVG P;  4IUR A;  5GAN d;  5IH2 A;  4R55 A;  4FYX B;  1IRX A;  1TS9 A;  4FSS A;  1N5Z A;  1UE9 A;  1XOV A;  3L2U A;  1PC0 A;  2IIM A;  2M0O A;  1BYM A;  1TG0 A;  4F17 A;  2JM8 A;  1D0Y A;  3PFS A;  1WHH A;  2F2V A;  4E6R A;  4J9B A;  1UGV A;  1PHT A;  1S1N A;  1UB4 A;  4X9D A;  5CK9 A;  1KFZ A;  2RF0 A;  2RQR A;  3REB B;  2KBT A;  3CCJ Q;  1KD1 U;  2WAC A;  2PQW A;  4CC4 B;  2QA4 T;  1ZSZ C;  1XJW B;  2ZPF B;  3LX7 A;  2L0A A;  3CCU Q;  2GTO A;  4HCB A;  2JTM A;  2JNG A;  2XKO C;  3G71 T;  2I0N A;  4B9X A;  1VYT A;  1X6G A;  2FPD A;  3MEW A;  1VQN A;  3JB9 I;  2KDS A;  3EG1 A;  1K8A C;  2AT1 B;  2MPX C;  2C0O A;  1YCS B;  3J81 E;  4M7A C;  3UA6 A;  2DEQ A;  2FZG B;  4ZTJ A;  4LXC A;  3HKS A;  2PUK B;  1UFF A;  4A63 B;  1K0X A;  2ROT A;  4IKF A;  3CCV T;  1NLO C;  1SG5 A;  3UA7 A;  4XQ3 A;  1M27 C;  2EAY A;  4X9C A;  3H0F A;  2BZX A;  4HA8 A;  1LPL A;  3I5S A;  6AT1 B;  3TU4 K;  2RM4 A;  5CR2 A;  4KGX B;  3OYE A;  1ZQ1 A;  3JB9 F;  1M2V B;  1AZE A;  5GAM j;  3TRE A;  1D1A A;  2MI6 A;  2GFU A;  2YLB A;  2HD0 A;  1R8O B;  1YJN Q;  1B7T A;  2B86 A;  1YI2 A;  1Q86 R;  1VQ8 T;  2M02 A;  2NLU A;  4DA4 A;  5CKH A;  3CCQ A;  1M2V A;  4DOV A;  4ME7 A;  3G6E A;  1OX8 A;  3VS2 A;  1S72 Q;  1HXD A;  2EQU A;  2K79 A;  1XQH A;  1P92 A;  2DL4 A;  4JJB A;  4RG2 A;  1X01 A;  2XMF A;  2CZ0 B; 
#chains in the Genus database with same CATH homology
 3GNF B;  5GAM g;  1VQK T;  5AYF A;  3CD6 A;  2KK4 A;  2L8D A;  3JCM X;  1Y07 A;  1I5L A;  3EFS A;  2JUF A;  5A2Q E;  4ZGD B;  1YHQ T;  3DB4 A;  5LJ3 g;  3ME9 A;  2XDP A;  4DOW A;  4JJN K;  4LDX A;  5KE2 A;  4BI8 B;  4FL6 A;  3M53 A;  2OAU A;  3A8L B;  4C5G A;  3UPU A;  4C5E A;  3OYH A;  2HBP A;  3RMS A;  5LL6 S;  1B34 A;  1U1S A;  4OB3 B;  4C0G A;  3JCM d;  2GFA A;  2LCC A;  3H6Z A;  3QXE B;  2PVO B;  2RHI A;  5LJ5 d;  5GAN j;  4ATO A;  2DO3 A;  3OB9 A;  3NFC A;  3OSS C;  3OW2 A;  3DLM A;  3OYN A;  3MEV A;  2R5A A;  3OMC A;  5CKE A;  4BD3 A;  1VQ6 T;  3OS0 A;  3E9G A;  4IUU A;  3UDC A;  3OYF A;  4BE0 A;  4MZP A;  5CQY A;  1G5V A;  2DXU A;  3PMT A;  3UWN A;  5GAN h;  3OYJ A;  3NTI A;  3PT9 A;  4FSX A;  2QXF A;  4LDV A;  1KQ1 A;  1Y71 A;  4XU0 A;  1W4S A;  3GOX A;  3HRS A;  2QQ9 A;  5FRN A;  2VC8 A;  2EQK A;  4CRI A;  3M4Y A;  2ZPB B;  1G3W A;  4NL3 A;  1OZ2 A;  4QVC A;  3G4S A;  3X20 B;  3ZEH A;  1VQO A;  3M58 A;  1EIF A;  2QTX A;  2LDM A;  5CO7 A;  2M16 A;  1VQL T;  3CC7 T;  1VQ4 A;  4X34 A;  3FJP A;  1M8V A;  1NJI C;  3TEE A;  1YIJ A;  1VQP A;  4XTX A;  2EJG A;  4A4G A;  5GAN g;  2A3L A;  3MP8 A;  4JRI A;  3INZ A;  4QQG A;  3VYG A;  1VQM T;  1W2B A;  4BUG A;  5GAN 3;  2X4W A;  3C95 A;  1NPR A;  2KVQ G;  2KSS A;  3E19 A;  3OYM A;  5FRM A;  1VIE A;  1WGS A;  5GAM e;  4F7U F;  5HY6 A;  3NTK A;  2JTF A;  2H3J A;  3M9Q A;  2FHD A;  1JRI A;  3QPH A;  3QZ5 B;  3JB9 H;  1N8R U;  2QQR A;  3JCM Q;  2LCL A;  2RJC A;  2FL7 A;  2RJD A;  4E47 A;  1X6O A;  3KUF A;  1FXX A;  1X75 C;  2MAM A;  1Q7Y C;  4PL6 A;  1G3Y A;  2ZPI B;  4KUL A;  4E7H A;  3LGF A;  3KXT A;  3CPW S;  2BIV A;  5C0M A;  4E7K A;  4A54 A;  2BKD N;  1NE8 A;  3LWH A;  2Y4Y A;  5GMK m;  2F69 A;  1U8R A;  4M78 C;  3EAE A;  1QVG S;  2LRQ A;  3V7S A;  2QEX T;  1M90 U;  4RCC A;  2ZGW A;  2RI5 A;  1O9S A;  3JB9 D;  2DJZ A;  3OSV A;  2A7Y A;  2CS7 A;  4Y28 E;  5GAM f;  1BIA A;  2JN0 A;  1QVP A;  3JCM V;  3QDR B;  1OZ3 A;  2LQ8 A;  3PNW C;  3SWN B;  4IUP A;  2KQW A;  4IUV A;  3GLX A;  1UGQ B;  4XU2 A;  5CKB A;  2X4J A;  2ZZD A;  2PVG B;  5KCH A;  5I2S A;  3C4S A;  4XTU A;  4C8Q D;  2OTJ A;  4JUV A;  2I2L A;  1VQP T;  1YBY A;  5GAO l;  3CCL A;  2FYK A;  2DTI A;  3MET A;  3SB2 A;  3URG A;  4FM4 B;  4OB1 B;  1IRE B;  2BUD A;  4RG8 A;  1Q82 U;  3CEY A;  3M56 A;  2LNV A;  3S3N A;  4C5H A;  2YHT A;  2DK3 A;  3EFR A;  5GAO m;  3JB9 J;  3V8L A;  3GIB A;  4C0D C;  5HK0 A;  3SWN A;  4B9W A;  1VQN T;  3P8B B;  1PSE A;  2VYT A;  2XG8 D;  5A0L A;  4GY5 A;  4LD9 K;  5GAN e;  5J3B A;  4C8Q F;  1YCY A;  4A4F A;  5LJ3 j;  1YJN T;  3HL8 A;  5GAO p;  3VV0 A;  3HSB A;  3L2Q A;  4M7A G;  3VKI A;  2XDB A;  4M78 G;  3SFM A;  4BI3 A;  4MML A;  2EFI A;  2L3R A;  5EG2 A;  4BAC A;  1WQW A;  4M7A E;  5LJ3 h;  4M78 E;  2RD1 A;  4C8Q A;  4M75 D;  2E65 A;  2WSC E;  5GMK i;  3PIP A;  3RUX A;  4IUQ A;  1Q86 C;  2VUB A;  3CCS A;  4ZTF A;  3GNG A;  1NZ9 A;  1O75 A;  3CME A;  4KUI A;  1KG1 A;  3GF5 A;  4PJO G;  3GP8 A;  2RI3 A;  3PIO A;  2QQS A;  4KUD K;  2DTH A;  1LJO A;  2ZPE B;  5IT9 E;  1VQ9 A;  4N0A A;  4PJO E;  1YJW T;  3R6O A;  4JS5 A;  1WNL A;  5GAN f;  2DTO A;  3SDZ A;  1N8R C;  1RI0 A;  3BY7 A;  3HFO A;  3WXM B;  3JAM E;  3JCM b;  4R56 A;  5HKC A;  3BFM A;  3CC4 T;  4M75 F;  5CAI A;  3OYB A;  5DY9 A;  2G3R A;  4BDY A;  4C0D B;  4E7I A;  2X4Y A;  4E7L A;  1N9S A;  2FVU A;  4FT2 A;  4M77 D;  4ZN3 A;  3FC3 A;  5GAN 4;  1Q81 U;  5HK3 A;  1UGR B;  2DPP B;  2K4Y A;  5KE3 A;  3RKW A;  4C92 D;  3V7R A;  3CCE T;  4J7I A;  4M75 A;  3WVE B;  3BW1 A;  4QVZ A;  3CBP A;  2LX9 A;  1K8A U;  1M90 C;  5D6Y A;  4JRP A;  4EDU A;  3OW2 S;  5LJ5 j;  1N6A A;  2QDY B;  1YI2 T;  4J7F A;  2EQM A;  2P4T A;  2DD5 A;  2K5L A;  3FB9 A;  2VXE A;  5I2M A;  3JCM h;  3X24 B;  3OBW A;  3TCJ A;  3CCJ A;  3A5Z B;  3CCR A;  2QA4 A;  3LLR A;  3QBY A;  1RL2 A;  3MCA B;  4JRQ A;  3CCQ T;  5GAO r;  5LJ5 h;  4OF1 A;  4M77 F;  4OVA A;  1UGP B;  2E41 A;  3CCM T;  4J6W A;  3G6E T;  4ZN1 A;  3P8D A;  3OY9 A;  3CC2 A;  2VGM A;  3VJP A;  4C92 F;  1QVF A;  2D6F A;  3KBG A;  5GAN 2;  2DXT A;  4L6V 5;  3OS5 A;  1M1F A;  3CCU A;  3L2W A;  3E1S A;  1Q82 C;  4OMF B;  1M9S A;  4M77 A;  1D3B A;  1Y7X A;  4YTL A;  3VYH B;  3QO3 A;  2RB6 A;  2PU9 B;  4C92 A;  3VU3 C;  3G71 A;  2JOY A;  4KT0 E;  4XTZ A;  5IAY A;  3CD6 T;  4QQD A;  1XNI A;  2QQB A;  2GQV A;  4C0F A;  2XI9 A;  1K9M U;  4IUT A;  4JS4 A;  2E64 A;  4F7U B;  1M1K U;  5FU7 C;  2XDD A;  3JCM g;  3SWN C;  4NS5 A;  4II1 A;  1W2B S;  4M78 A;  2RI2 A;  1K73 U;  1VQ7 A;  4M7D D;  3QHS A;  5LJ5 g;  1I81 A;  3L2R A;  2XK0 A;  5DLO A;  5GAO q;  2P0K A;  2OTL A;  2PUO B;  4QQ6 A;  1YJ9 A;  3L1A A;  4JLG A;  5FLX E;  3OYA A;  1KHC A;  1MHN A;  3BDU A;  2VXF A;  2X4X A;  4C8Q C;  1VIF A;  3QZ9 B;  4J5Y A;  4JLI A;  2HQE A;  3FLG A;  5DM7 R;  3QYG B;  4ZGE B;  5D6X A;  4BB7 A;  2AHJ B;  5LJ3 e;  3L2Z A;  5GMK l;  2JZ2 A;  2RH2 A;  3LGL A;  3M55 A;  2KAF A;  4L5G A;  3RKX A;  3JCM c;  2VGN A;  4EMG A;  3X25 B;  2RJF A;  4BY6 C;  4F7U A;  3I55 A;  1JJ2 A;  2DXB A;  4J8O A;  4LDU A;  1ZBX A;  5GMK j;  2RHX A;  4M7D F;  4N0A C;  1UEB A;  3VUZ A;  2PVD B;  2V8K A;  4EMK A;  3OS1 A;  2E70 A;  1BKB A;  5GAN 5;  4DQ2 A;  2EQJ A;  1OYX A;  2K3X A;  5GMK h;  4D6W A;  5GAN 8;  4M7D A;  4PLL A;  2HQX A;  3G4S T;  4Q5W A;  1IZ6 A;  1G3S A;  2R58 A;  4C0Z A;  3CMA A;  3QYH B;  1VQO T;  3C12 A;  5FU7 B;  3RKY A;  1Q81 C;  2R5M A;  3T9N A;  5KH6 A;  4WF2 A;  3HHT B;  3JRZ A;  1VQ4 T;  5LJ3 f;  2D0Q B;  2F5T X;  3H8Z A;  4NOY A;  3JB9 G;  1Y96 A;  2DAQ A;  4M75 C;  4NL2 A;  1YIJ T;  3JCM W;  2DIG A;  2XU8 A;  2XD0 A;  2RJE A;  1YIT A;  4A53 A;  3AHU A;  3RIR A;  1KQ2 A;  4C8Q B;  2CYZ B;  4N4G A;  2FB7 A;  4MZT A;  4C8Q G;  5CKD A;  2DIQ A;  5D6W A;  1VQ8 A;  4XAX B;  3X28 B;  3A8O B;  4MMK A;  4XK8 E;  4C8Q E;  2RHZ A;  3QJ6 A;  1HK9 A;  3WVD B;  3I56 A;  3UT1 A;  4BY6 B;  2CZ6 B;  2O4X A;  3OYY A;  3JCM e;  3FDR A;  5GAO n;  5J26 A;  3OYG A;  2WSE E;  1S72 A;  2IVW A;  4FT4 A;  3PMI A;  2RO0 A;  2ZPH B;  2EYQ A;  5LJ5 e;  1WQ7 A;  3RMQ A;  3PGG A;  2CGH A;  4RKU E;  5CVI A;  3ZFJ A;  1V29 B;  4M77 C;  1MGQ A;  3OBY A;  1VQK A;  2RHU A;  3A8M B;  4HT9 A;  4C92 C;  1FX7 A;  4Y91 A;  3OS2 A;  3MEA A;  1K9M C;  2KY9 A;  4HCC A;  1M1K C;  4QVD A;  4JDS A;  4HT8 A;  3HRU A;  3QG1 A;  4PLI A;  1YHQ A;  5A0G A;  4XTY A;  2E10 A;  4N4I A;  1K73 C;  2YLC A;  3QUI A;  3M57 A;  5GAM d;  4M75 B;  2HAX A;  1BI0 A;  4M75 G;  3JCM f;  4OB2 B;  1JBM A;  3M4G A;  4A4E A;  2OTJ T;  4M75 E;  1NJI U;  4ZGJ B;  5LJ5 f;  3S3O A;  2WSF E;  2QI2 A;  3CCL T;  2CZ7 B;  3S3M A;  4KBM B;  3J80 E;  2V8J A;  3LWI A;  4PNO A;  2E5Q A;  4ELY C;  1VQ6 A;  2EIF A;  4PJO D;  5I21 A;  2CZ1 B;  1XTD A;  5FU6 C;  3LW5 E;  5KCO A;  3L2V A;  4MDW A;  4M7A F;  3RER A;  4BDZ A;  1KQS A;  4M78 F;  2DXC A;  4O5V A;  2P0P A;  1SSF A;  3HPW A;  4M77 B;  4BI4 A;  1D3B B;  2XIC A;  3FIF A;  4M77 G;  4XU1 A;  4EMK C;  1Q7Y U;  4C92 B;  3CPF A;  4N4H A;  3OYC A;  3CXC A;  4QW2 A;  3HRT A;  4C92 G;  4M7D C;  4M77 E;  5FRO A;  5L8R E;  5M9O A;  4FIB A;  4C92 E;  1KHI A;  5GMK e;  4ELZ C;  1NPP A;  3FRN A;  3L42 A;  3OYL A;  3VUB A;  3CC7 A;  4PJO F;  1VQL A;  3QII A;  3OQ5 A;  3CCS T;  1QVF S;  4VUB A;  2K2V A;  2QQA A;  3JSC A;  2JVV A;  4C5I A;  1VQ5 A;  3J7A F;  3CME T;  3OA6 A;  4HCZ A;  3M5A A;  1VQM A;  3CBO A;  3LYI A;  1N9R A;  4LDY A;  3F70 A;  1KC8 U;  4PJO A;  2O01 E;  1VQ9 T;  4JRK A;  3QSU A;  1ZHI A;  3N5B B;  2MWP A;  2M9U A;  4A4K A;  3V7C A;  2LTO A;  3JCM J;  2E1H A;  1N27 A;  2L89 A;  2MF2 A;  4IUR A;  5GAN d;  4R55 A;  2Y4X A;  1LOJ A;  1XOV A;  5FU6 B;  2LVM A;  1UGS B;  3ZBD A;  5CCA A;  4RMO A;  3L2U A;  2M0O A;  3NTH A;  1BYM A;  2E6Z A;  4F7U G;  4O6J A;  2IG0 A;  1QW1 A;  4F7U E;  2RHY A;  3HP9 A;  3OYI A;  2E12 A;  3ER0 A;  3BDL A;  3Q1J A;  4J6Y A;  2K5I A;  3PFS A;  4EMK B;  1VUB A;  4M7D B;  2DZ9 A;  4M7D G;  1TH7 A;  2QEX A;  1UB4 A;  4X9D A;  4M7D E;  2M1H A;  5CK9 A;  5J39 A;  4LDW A;  1VQ5 T;  4TVR A;  3CCR T;  5CIU A;  1KD1 U;  2Y90 A;  1JJ2 S;  2EJ9 A;  2WAC A;  2PQW A;  3GPL A;  3CCJ T;  3CCV A;  2QA4 T;  1Y96 B;  1QP3 A;  1WJS A;  2R57 A;  4OGE A;  1Q86 U;  4UC4 A;  2ZPF B;  3LX7 A;  3RES A;  3CC2 T;  1M1G A;  4HCB A;  3CCU T;  3P8H A;  2JTM A;  4J6X A;  4LD6 A;  2JNG A;  2V8I A;  3MEU A;  3SD4 A;  3A8G B;  1LNX A;  1DJ7 B;  2DVE A;  4PKC C;  2XKO C;  3G71 T;  3M54 A;  3FEO A;  4B9X A;  4E7J A;  2O4X B;  2L5Q A;  2EWN A;  1U1T A;  4OGC A;  2C06 A;  2ZPG B;  5GAN 6;  3MEW A;  4HKE A;  2GCX A;  1VQN A;  2KMT A;  3O8V A;  3JB9 I;  2E6N A;  2KDS A;  2LQK A;  3OYK A;  1K8A C;  1BI1 A;  1VQ7 T;  3S6W A;  1YJN A;  2YRV A;  5GAN 7;  3G7Z A;  2OTL T;  4MDX A;  1YJ9 T;  3J81 E;  3CPW A;  4M7A C;  3DKM A;  3V8K A;  1GXI E;  2F5K A;  2DEQ A;  1BI2 A;  4ZTJ A;  5DLQ E;  2XHC A;  3HKS A;  5CKF A;  5CQX A;  2PUK B;  5C6S A;  1WJR A;  1QVG A;  3MP1 A;  4OB0 B;  1BIB A;  3C94 A;  2MMP A;  4IKF A;  1KC8 C;  3CCV T;  3V8J A;  3I55 T;  2K5F A;  2P0Q A;  1WPY A;  4XTV A;  4P5N A;  1OI1 A;  4L59 A;  1QP2 A;  2RK2 A;  3OYD A;  1BI3 A;  4PJO C;  1YJW A;  2EKO A;  3MO8 A;  2LC4 A;  4XQ3 A;  1AHJ B;  3HFN A;  1JB0 E;  2DZC A;  4V2S A;  2EAY A;  4J83 A;  2GF7 A;  4X9C A;  4FU6 A;  2EJF A;  2X35 A;  3JCM P;  1M4Z A;  4HA8 A;  3TU4 K;  1M5Q 1;  2RM4 A;  5CR2 A;  3OYE A;  3A8H B;  2XID A;  1ZQ1 A;  2K3Y A;  1H64 1;  3MP6 A;  3CMA T;  3JB9 F;  2VV5 A;  2B8A A;  5A0D A;  4RCB A;  2CKK A;  5GAM j;  3QJY A;  2LT4 A;  4M7A D;  3TRE A;  1I4K 1;  4BE2 A;  2MI6 A;  4M78 D;  3CCE A;  2GFU A;  1PSF A;  2YLB A;  4BE1 A;  2HD0 A;  1R8O B;  3M59 A;  5LJ3 d;  1G3T A;  4M7A B;  5GAM h;  3DLL A;  2D9T A;  1YIT T;  4M78 B;  2ZCF B;  2RA2 A;  4Z02 A;  1FWZ A;  4MZM A;  4EMH A;  3E9F A;  1YI2 A;  1KD1 C;  3CC4 A;  2HNI A;  4XTW A;  3OMG A;  3X26 B;  2NLU A;  1VQ8 T;  1I8F A;  3LH0 A;  4OP0 A;  4DA4 A;  5CKH A;  2RK1 A;  3I56 T;  3CCQ A;  1KQS S;  4DOV A;  4ME7 A;  3CCM A;  3G6E A;  2DD4 A;  3DB3 A;  1S72 T;  4PJO B;  1HXD A;  2EQU A;  2DKG A;  4GLK A;  1B34 B;  4EPC A;  3PTA A;  1XQH A;  4CI0 C;  3ASK A;  1P92 A;  2MWO A;  4A4H A;  3CXC S;  2LT1 A;  1WJQ A;  4RG2 A;  3CBM A;  3QKJ A;  1H3Z A;  3MHX A;  4XU3 A;  2K57 A;  1X01 A;  4M7A A;  2CZ0 B;  5IN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...