2VYTA

The mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
RDDFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SEX COMB ON MIDLEG-LIKE PROTEIN 2
publication title The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA01
3MP6A 3LGFA 4A4GA 4IUQA 2GFAA 2IG0A 2X4YA 3FEOA 2L3RA 5KE2A 4NS5A 3OYBA 4BACA 4ZTJA 3PMTA 4Q5WA 5D6XA 4L59A 4PL6A 4EDUA 3QKJA 4C5EA 2QQSA 1XNIA 2EQUA 3PFSA 2RJDA 3PMIA 5CIUA 5D6YA 2F5KA 2MWPA 4PLIA 5FROA 4ZTFA 3QJ6A 5FRNA 2BIVA 2EKOA 2RHYA 3OYMA 5C0MA 3P8DA 2RHXA 3OYAA 2D9TA 1KHCA 5M9OA 2R58A 2HQXA 3NTIA 4BDZA 2YRVA 4BDYA 4E7LA 3MP8A 3OYEA 4N4IA 3LLRA 3DB4A 2M0OA 5KCOA 3E9GA 4FU6A 2P0KA 2RJFA 3FC3A 3H8ZA 2GFUA 3LH0A 2FHDA 2K3YA 3QIIA 4C5GA 3OYLA 2WACA 1G5VA 2HQEA 4BE2A 1OI1A 2XDPA 3S6WA 1SSFA 3OYJA 4E7HA 5J39A 2EQMA 4C5IA 4E7IA 3LYIA 3LX7A 3OA6A 4E7KA 2NLUA 2RO0A 2JZ2A 4CRIA 3L2UA 3MEVA 4HCZA 2O4XB 4LD6A 2RI3A 3ME9A 3FDRA 2JTFA 4QQGA 3KUFA 2RHZA 4GY5A 3OYGA 2PQWA 1WJRA 3NTKA 4IKFA 2RHIA 5D6WA 3OS0A 1OZ3A 4IUTA 2EQJA 3OYFA 3H6ZA 3MEAA 3CEYA 3S3OA 2G3RA 3O8VA 4QQ6A 3Q1JA 4X34A 4E7JA 5FRMA 3FLGA 3MEWA 3MEUA 5J26A 2VYTA 3ASKA 4FL6A 3L42A 3OYCA 5KH6A 2QQRA 4QQDA 1WJSA 5IN1A 3L2QA 3EAEA 3OMGA 2M1HA 2MWOA 2RJEA 4IUPA 3OQ5A 2BUDA 2R5MA 2RJCA 2LDMA 2O4XA 1MHNA 3UWNA 3OB9A 3OY9A 3L2RA 4BE0A 3GOXA 2RI2A 3LGLA 5IAYA 2K3XA 3L2WA 1RI0A 2DIGA 3C4SA 4A4HA 3OYKA 4II1A 2LTOA 4N4HA 1OYXA 4OVAA 4C5HA 4A4FA 3NTHA 4A4EA 1H3ZA 2B8AA 2L8DA 4BD3A 4UC4A 3OS1A 1OZ2A 3P8HA 4QVZA 3DB3A 4N4GA 2BKDN 4IUUA 3F70A 1WJQA 2X4XA 5KCHA 2LRQA 2X35A 3OS2A 3S3MA 3MP1A 1WGSA 3OYIA 3M9QA 3SD4A 2CKKA 2E6NA 2EQKA 2DAQA 3OYNA 2EFIA 3S3NA 3PNWC 2R5AA 3BDLA 3QBYA 4RG2A 4IURA 3META 2RI5A 2L89A 2LVMA 3OYHA 2DIQA 4QW2A 2R57A 3MO8A 4PLLA 4IUVA 2E5QA 2LCCA 3UT1A 3ZEHA 4B9WA 3DLMA 2M16A 3L2VA 2X4WA 2XK0A 3OYDA 4BE1A 3E9FA 5C6SA 2GF7A 5KE3A 4B9XA 1N27A 2RHUA 4Z02A 3OMCA
chains in the Genus database with same CATH superfamily
1X2KA 4A4GA 2FRYA 4BACA 3CCMQ 1IGQA 4EDUA 1PD0A 1M1KC 4F16A 5KYXA 1GCQA 2NUTA 4C8QC 3QJ6A 4J9HA 1OPKA 1I5LA 1BI2A 2EKOA 1JB0E 3JCMg 1KHCA 1NEGA 1YJWQ 4OMLA 2YRVA 3CC2A 1U5SA 5KYYA 1YJ9T 2FHDA 1BCOA 1G5VA 1AT1B 1RACB 2RPNA 3VS2A 1YITT 1AZEA 1M2VA 1EX4A 3FB9A 1QVFP 1O9SA 4QQGA 1P92A 1MGQA 4HXJA 3QSUA 5GAN8 3EGDB 2MYSA 3X20B 4FIBA 2EQJA 2ESWA 1N5ZA 4C8QB 5IHIA 5A2QE 3EG2A 2E70A 2FVUA 2VGMA 2EYWA 4M75C 4R56A 4XU0A 2EJGA 2RM4A 2XU8A 3OQ5A 5GAN4 4XAXB 3EHRA 2RK1A 1MHNA 3OY9A 2GNCA 2XICA 2AT1B 2DX1A 2P4TA 4LDYA 1RI0A 3OYKA 1KSWA 2KRNA 4C92E 1I8FA 1N8RR 2DE0X 2AIRB 2LTOA 1S72T 4CC2A 3QJYA 4FM4B 3PTAA 5GAOq 2HDAA 5L23A 1VQLT 1MV3A 1YCYA 2CSQA 4N4GA 8ATCB 2XG8D 2YWWA 5KCHA 1EZZB 4C92G 3OYNA 3S3NA 1YNZA 1IHVA 1RAEB 4RG2A 1WPYA 3CCRT 3M0TA 3CCJT 1YI2T 4M75B 2CP7A 1BIBA 2EKHA 2X51A 1C1AA 3OYDA 3DKMA 4JRIA 3MEAA 1K73R 4C8QD 4QVCA 4PFPA 2P0QA 5LJ3f 4M7DE 2LT1A 5FWBA 3MKDA 1LOJA 3I56A 1K0XA 1MMDA 2RJDA 3CD6T 1Y07A 1M8VA 3TEEA 3HTRA 2DL5A 2HQXA 1YIJA 3RBBB 1KQ1A 1D0ZA 4J9CA 2AK5A 2JTMA 2K79A 4M7DG 1YJNA 2P0KA 3KXTA 2LZ6B 1VQKQ 1G83A 1OI1A 2FZCB 5KYWB 2BTTA 3CCUQ 2NLUA 1UEBA 4RKUE 2RI3A 4RMOA 3KUFA 4MMKA 2VWFA 4M75D 1Q86R 3H0FA 1PKTA 3GIBA 2HKQB 5CVIA 2P0PA 2E64A 5HKCA 5FRMA 3OYCA 5GANf 1K1ZA 2HD0A 5LJ3h 1YHQA 2O4XA 2K6DA 4E2FB 1NPPA 1YJWA 2EYQA 3C4SA 3CC2T 4OB1B 3CCLT 2D6FA 1VQ7A 2LQWA 4OVAA 5I21A 1D0XA 1I81A 2LQ8A 4ZN3A 2X4XA 3BW1A 4LDWA 4DOWA 3VRYA 2WSEE 2DXUA 4KRTA 3JRZA 4M78C 3JSCA 3CC4Q 4AT1B 3CCQQ 2ZPFB 2DXBA 2F1LA 4IUVA 2LC4A 3UATA 2E41A 2EPDA 3RKYA 3OSVA 5IHNA 4LUDA 2MMPA 2AKLA 2PVGB 4L6V5 3REAB 3UA7A 2HEQA 3SWNA 3JCMf 1M27C 2HKNA 2HBPA 2L3RA 2OX7A 2DF6A 2EYYA 2M02A 3QKJA 2RQRA 2QEXQ 5FROA 3C12A 4FCYA 1MV0B 1PRMC 1KD1C 2LCSA 3EG1A 2YUOA 1JXOA 2FEIA 4E7LA 5GAN5 2LNHB 4N4IA 4M78B 4C0ZA 4OGCA 3O5ZA 1X69A 2K5IA 4KGVB 1MNEA 4P5NA 2DM1A 5GANd 2K3YA 4DBQA 3J7AF 1OOTA 4JUVA 1D1BA 5CCAA 3VKIA 3RESA 4OMMA 4GY5A 2RQVA 3TQ7P 1B34A 1IRXA 4HT8A 3JB9G 2RMOA 2O9VA 4DBFA 1NE8A 3M55A 2VYTA 2EVRA 3G71Q 3QPHA 3I56T 4RTTA 3L2QA 3JCMh 2FPFA 2DETA 2J6FA 2A7YA 1YIJT 1UDLA 2K3XA 2DIGA 3EGDA 4D8KA 2LJ1A 4M78D 3X25B 4UC4A 1UECA 2PUOB 3P8HA 2H3EB 1KG1A 1WQWA 4J6WA 3VUBA 5AYFA 1WJQA 1UB4A 1Y96B 1T3LA 2KNBB 1D1AA 3CCUA 4ANJA 1WHKA 1M9SA 4MDXA 2DTOA 3JCMJ 1K9AA 4KT0E 1WHHA 2EJFA 2RK2A 4JS5A 2L3QA 3PE0A 1SRMA 1UGQB 2MK5A 2O31A 2JMCA 3JB9H 2F2VA 1VQ6Q 2RB6A 1YFNA 1M90R 1YHQT 1WDXA 2QTVA 3PFSA 1XNIA 4C5EA 5D6YA 1YJWT 2KT1A 1WHLA 1YWOA 2NUTB 3I35A 1JQQA 3A8OB 1KIKA 2QA4A 1VOMA 2QGFB 1YN8A 3FJPA 1WIEA 3LH0A 2OJ2A 4WCIA 5KYYB 2HQEA 4PFOA 5GAMh 4AFQC 3CCQA 4F7UE 2K7AA 1U06A 4JZ4A 2DEQA 3ZBDA 2RO0A 1QP3A 3CMEQ 1UJYA 4AG1C 1QKXA 1M2VB 2ECZA 5CQXA 2DPPB 1M3BA 2A0FB 1PCXA 2J7IA 2RF0A 5GMKl 4F7UG 1VQPA 1ABOA 1KHIA 2CP5A 2V8JA 3G4SA 1OULA 1QLYA 1PRLC 1VYUA 1KC8R 4MMLA 4J9GA 4F04B 3UWNA 2CDTA 2NWMA 2GBQA 1VQ4A 1ZX6A 3CPFA 2D8JA 3CCEQ 5FLXE 2F69A 1K73C 4M78F 3EG9A 2CGHA 3M53A 3OS1A 2C06A 5DLQE 4M77C 2X35A 1H92A 1W70A 3MP1A 3M9QA 2CKKA 2E6NA 2DD4A 2XDBA 4JJBA 1RLPC 3OW2P 2P84A 3BDLA 4JDSA 2JTEA 3QZ5B 1GCPA 2KI7A 2Z0WA 1T0JA 1Q81C 1OU9A 1VQ9Q 1WLPB 3CCSA 3GBQA 1RL2A 3E9FA 4DBRA 4B9XA 5IH2A 3G71A 3OMCA 2YRDA 4EIKA 2WSCE 2GFAA 2IG0A 3EH2A 1AWOA 3OYBA 2F5TX 1QQJA 3N5BB 3RIRA 4N0AC 3QZ9B 3URGA 4JZ3A 4JJNK 2D9TA 3CC7Q 4M77B 4ELZC 1LVKA 1Q86C 2JS2A 4BI8B 1FYNA 2QDLA 1M4ZA 1J3TA 2F2WA 2DBKA 4OMPA 3JB9J 1CKBA 3CCUT 2DO3A 3V8LA 1Y0MA 3VU3C 3QIIA 1VQ5Q 1M30A 4MZTA 1X6BA 5J39A 2VXEA 2DL8A 3JCMP 2DRMA 3CCVA 1HSQA 3M57A 2DVEA 5CO7A 2J05A 4RCBA 4PJOC 3NTKA 5D6WA 4C0DC 1BCMA 4M78A 3VJPA 4OP0A 3E1SA 4VUBA 3RNJA 1WHJA 2KK4A 4KH0B 2A36A 1RLQC 5GAN6 2JM9A 3JAME 1VQOQ 2NUZA 4K11A 2RJCA 2XD0A 3THKA 5GAOp 3SWNC 5CKBA 4RUGA 2QA4T 4A4EA 2I2LA 3VS7A 1LNXA 2K2VA 1X01A 1TG0A 2JXBA 2G6FX 3CCQT 4PJOB 2AHJB 4C0DB 2ED0A 2DNUA 2L3SA 1QVFA 2JN0A 1TXQA 4HVUA 1HD3A 4LDXA 1VQNQ 1OX8A 2LCCA 2D0NA 3OW2S 3INZA 5A0DA 1RAAB 2YT6A 1VQPT 2V1QA 4CI0C 1MMAA 4CC4B 4WTOB 1Y96A 3KBGA 3FEOA 3SWNB 5CAIA 2HZYA 3G6EQ 3PMTA 3J80E 3PVLA 1VQ4T 1RI9A 4PLIA 1AHJB 2QTXA 4JPBW 1V1CA 5LJ5g 2DD5A 2EYZA 3CCEA 2KY9A 5M9OA 3NTIA 3G7ZA 1TUGB 3NGPA 2QXFA 2RH2A 1I0CA 1WXBA 5ECAA 2KYMA 3U23A 3DB4A 1QMCA 4KULA 1K8AR 4GLKA 2FRWA 2EQIA 4C5GA 2C0TA 1G3TA 3D7SB 1Q82U 1VQMQ 5I2MA 1U1SA 2BZ8A 3VS3A 2EGCA 4OMFB 2KE9A 3CCST 4F14A 1WNLA 1W6XA 2RHIA 2ROTA 3G71T 1T3SA 3NFCA 3ZFJA 2WSFE 3OYYA 1UGVA 3CCLA 3M0SA 2FPEA 3Q1JA 1B34B 1G3YA 1IREB 1GBQA 4C8QE 2QQRA 5GMKi 5IN1A 4ZGDB 3VS6A 5HY6A 1NEBA 3CC7A 4LE9A 2RI2A 4QVDA 1QWEA 1TUDA 4M77F 5GMKh 1Q81U 4DEYA 4AFUC 1YP5A 4C8QG 4GBQA 1Y71A 1AWWA 1G8XA 4XU1A 2KDSA 1WHMA 2BKDN 1XJWB 1M90C 1VQ5A 1U8RA 1UFFA 3M0UA 3CCVT 3A8HB 1FX7A 2GTOA 1M1GA 4M7AF 4CC7A 1UHFA 2R57A 2E5QA 2QGGA 1YCSB 5J3BA 5IT9E 1M1FA 1PSEA 4M75E 3JCMV 3WVEB 3M56A 1XTDA 3LWIA 2HL3A 4L59A 1UGSB 3QG1A 3SDZA 4M75G 3OS5A 2PZ1A 3OYMA 3OYAA 5GAMg 2FZKB 4FYYB 2E3HA 2VVKA 3LLRA 2VKNA 4FU6A 3A8GB 1ZBXA 4X9CA 4DEXA 2EGAA 2H3JA 4PJOF 1KC8C 5D7UA 4PJLA 3V7RA 5EG2A 3MPUB 3OSSC 1QVGA 2JZ2A 1ACMB 1IO6A 4M77A 1GBRA 4PJNA 3CBMA 1UTIA 5GANe 4XK8E 2LJ3A 4E6RA 3S3OA 3I55Q 1G3SA 1WJSA 2DFUA 1JJ2P 3M4GA 1UJ0A 4KBMB 5HK3A 4RCCA 4HCCA 4J83A 4M7AA 5LJ3j 2QQAA 3CCET 2E65A 2DEUA 3VV0A 3QYGB 2X3XD 1IXDA 4FSXA 1OU8A 4RTUA 1JO8A 4N0AA 2CH4A 2CZ7B 1VQ8Q 2EYXA 3EG9B 1DJ7B 3CCMA 3OS2A 3M0RA 1OEBA 3JCMb 1AOJA 2VV5A 4J6XA 3CXCA 2DJQA 2ZCFB 4IURA 3META 3EFOB 1K9MU 2X4WA 2GF7A 2HMAA 4RTWA 1B3QA 3J81E 5CKFA 3R6NA 3A98A 5LJ5f 4PJOA 2X4YA 2DA9A 4Q5WA 5LJ3d 2L0AA 3CC7T 5GANj 1M1KU 4Y28E 1KQSA 4ZTFA 1PD1A 1VUBA 1SEMA 2YUQA 5C0MA 2KXCA 2DZ9A 2CH4W 2OAWA 3REBB 1D0YA 1N9RA 2DERA 3OYEA 1Q7YC 2ROLA 3HRSA 1AZGB 5KCOA 3SB2A 2EAYA 1VQ5T 3M59A 3FC3A 2M51A 4M78E 1NYGA 1UUEA 2VB6A 2KT8A 4V2SA 3EGXA 2K4YA 3S6WA 1SSFA 1VYVA 3QDFA 3OYJA 1TS9A 2DTHA 3HPWA 3BY7A 3LYIA 4E7KA 3JCMQ 3VS4A 4CRIA 1NPRA 4ZNXA 3ME9A 2OTLQ 2EJ9A 2JMAA 2RHZA 1WJRA 4LXCA 2D0QB 4M78G 5GJVB 1VQOT 4X1VA 4J5YA 4RTXA 3L1AA 1Z9QA 1YWPA 1M8MA 2QYZA 3EAEA 3OMGA 4Y92A 5LJ5h 1D3BA 1UGPB 4RG8A 4Z8AA 4L5GA 1KQ2A 1ZA2B 1JJ2S 4RTZA 1R77A 1H641 3FJ5A 1MMGA 3I5RA 4C5HA 1OYXA 1TU0B 3CMAQ 2B8AA 4BD3A 2W10A 3CQTA 4MZMA 4HT9A 3EH1A 1KJWA 2DAQA 1NJIC 2HCKA 1BKBA 4XQ3A 4XTXA 2AZSA 4R0KA 3M54A 4BI4A 1K9MR 1H3HA 3ZEHA 4JRQA 1K8AC 2IIMA 1GFCA 3I55A 4OB0B 1VQKA 2RHUA 2HQHA 1I07A 3JCMd 2KSSA 5GAMf 5CKHA 4ZTJA 3MCAB 1NM7A 1RAHB 4DA4A 2QQSA 2YRCA 1IGUA 1N6AA 2RHYA 5GAN7 1YITQ 5FWCA 2EW3A 1R0CB 3EHQA 1G3WA 2DXTA 4BDZA 5GJWB 2SRCA 4A63B 2Y4XA 2LMJA 2A37A 3CCMT 3H9NA 1QKWA 4QKUA 4JJDA 2XDPA 4EPCA 1N9SA 1R0BG 3RUXA 2QQ9A 4HCZA 2JNGA 2JTFA 1D09B 2YUPA 2DK3A 2DMOA 1WXUA 3JV3A 3HL8A 2CS7A 3QXEB 4WF2A 2YLCA 3JCMc 4DQ2A 1H8KA 2CP0A 1VQLQ 2KRSA 2LX7A 2MWOA 3X24B 4JLIA 3CC4A 2LDMA 1ZHIA 2CREA 1NLPC 3VS0A 1UG1A 3UDCA 5CK9A 2DTIA 1WXTA 3GOXA 1N8RC 2ZZDA 4LDUA 3V7CA 1TH7A 1YI2Q 2NUPB 1Q95G 3SEMA 1WYXA 2XDDA 1OZ2A 2YLBA 1X75C 4AG2C 3UA6A 5GAMd 3OBWA 1RAGB 2VXFA 2OAUA 4DBHA 2QEXA 4PNOA 2OTLA 2MI6A 3OBYA 1FWZA 1OPLA 4RTVA 3CD6Q 1BBZA 1EFNA 3GF5A 3QWXX 4KH1B 5CKEA 2MCNA 3FRNA 1K0SA 3X28B 3MP6A 1BIAA 5FU6C 2KGTA 5D6XA 2QDYB 1BI1A 1TWBA 1SRLA 2BIVA 2XHCA 4NOYA 3LH5A 3P8DA 3EFOA 2R58A 1KD1U 4BDYA 2K57A 1ZUYA 2KQWA 5HK0A 1NZ9A 4M7AC 2QAZA 2WACA 1ABQA 3LX7A 2DL4A 2XKOC 5FU6B 2W0ZA 3OYGA 4PFZA 1ZLMA 2LX9A 3I55T 2ZPIB 1VQKT 3GP8A 2RQTA 3CC2Q 2QASA 3O8VA 3T9NA 4QQ6A 5GAOm 2DL7A 4PK4A 4BB7A 5J26A 1MMNA 1XOVA 3ASKA 2ZAEA 2PU9B 5GAN2 4QQDA 4BY6C 2K3BA 2JVVA 2VASA 2DL3A 3OB9A 2L3PA 3L2RA 4BE0A 4M7AB 1OV3A 1WZOA 2HSPA 5KYUB 1BB9A 4OB3B 4MZPA 3NTHA 1ZQ1A 2C0OA 2PVDB 1RUWA 2K5FA 3G1JA 1VQ6A 1Y7XA 3P8BB 2CP3A 2V1RA 2EQKA 2DILA 4MDWA 3QBYA 4X9DA 3C95A 1ZUUA 1AWXA 4BY6B 2GGRA 4EMKA 4M77D 2PNIA 2HNIA 2M0YA 3ULRB 3CBPA 3CC4T 2HL5C 4FYXB 2ED1A 3UF4A 4IIOA 3OYIA 2EQUA 3CMEA 3RR6A 4HCBA 2CUDA 2DKGA 1GFDA 4M7AD 1KD1R 2ZPEB 4Y91A 1UHCA 4FW2A 3TSWA 1S1NA 5FW9A 4ATOA 1MNDA 2EGEA 1A0NB 2EWNA 2FB7A 1PWTA 4BI3A 2A28A 2QEXT 5CR2A 2OTLT 3EGXB 4KGZB 3OA6A 3I56Q 3VRZA 2ZGWA 1K4US 1JRIA 1QVPA 2QQBA 4ELYC 4OMNA 4JRPA 3HHTB 1YJNQ 3RDVA 2KBTA 4ZN1A 4HA8A 2KRMA 4F7UF 3L42A 3E2UA 5KH6A 3PVQA 1VA7A 4O6JA 2ZPHB 2HAXA 2M1HA 2O2OA 3JCMX 2KROA 3JB9I 2BUDA 2HBWA 3C0CA 4PJOD 1D3BB 3LGLA 3L2WA 5GAN3 2FZGB 1VQ9A 5A0LA 4ZGEB 4C0FA 2CUBA 2E5KA 3RKWA 2AKKA 1AD5A 4CC3A 1K73U 1CKAA 1QP2A 2QK0A 2PVOB 3RERA 7AT1B 3HFOA 1HJDA 1AVZC 4OF1A 1NBEB 1YHQQ 4E47A 1SF9A 2JW4A 2A08A 3OYHA 4QW2A 3TU4K 3MO8A 4AFSC 3X26B 3KFVA 3L2VA 2Y4YA 2NUPA 1VQ7Q 2ABLA 3CPWP 1W2BP 2CZ0B 4D6WA 2H8HA 2ZPBB 2DXCA 4IUQA 4BUGA 1JJ2A 4EMGA 4PL6A 4FW1A 3GPLA 3RKXA 1U1TA 4ZGJB 1X2QA 4GLMA 3M4YA 2QG9B 1BI3A 2JT4A 4QT7A 1Q86U 8AT1B 2DRKA 3MP8A 2J06A 4O5VA 4DOVA 5LJ3e 1LJOA 1VQ6T 4C92C 4JLGA 4F7UA 4Z89A 1JU5C 2FO0A 3OYLA 1VQOA 4LNPA 4A4KA 4E7IA 3A5ZB 2CT3A 4IIMA 3MEVA 2DYIA 3VS5A 3ER0A 4FSSA 4F17A 3V8KA 4IKFA 4J7IA 4KUDK 1F1BB 3OS0A 3LW5E 2BZXA 2KYBA 1OZ3A 2DZCA 2LNVA 2VUBA 2O88A 2FPDA 2MOXA 2LJ0A 4E7JA 3L2ZA 2GQIA 4FL6A 2RQUA 1I5OB 5IXBA 2CZ1B 3NPFA 1WI7A 3CMET 1EIFA 1Q82R 4AMCA 4J6YA 2J6KA 4C92B 5CQYA 4ESRA 4M7DC 1VIEA 1GXIE 2YSQA 4Z88A 5FU7C 1VQNA 5L8RE 1PNJA 2K5LA 1PG5B 2BE9B 4LN2A 1IZ6A 1SPKA 3G6EA 4E7SA 2LRQA 3H41A 4C0GA 2JUFA 2LT4A 1TUCA 4J9EA 2GCXA 2RI5A 5I22A 2LVMA 4J9BA 3EG0A 1Q81R 5IHKA 2JOYA 5KYUA 3AHUA 3NMZC 5LJ5e 3IQLA 1M5Q1 3PGGA 4BE1A 1E7OA 5GAOn 4M7DB 2OTJQ 4XTZA 2C0IA 2XI9A 5FU7B 5IXFA 4A53A 1BK2A 2RQWA 1XQHA 2CZ6B 3EFRA 5KE2A 1VQMA 3SHWA 4XTWA 3CPWS 1W2BS 2KVQG 4LUEA 1UE9A 2SEMA 4EMHA 3TSZA 5FRNA 2F5KA 1VQ9T 4C92D 2RHXA 3I9QA 2DJZA 3UPUA 1NG2A 3JCMe 4HVVA 4HVWA 1QVFS 2M0OA 1C6VX 2MAMA 3E9GA 2LQKA 2RJFA 1V29B 1OX9A 1CSKA 1TSFA 1QCFA 2GFUA 2MF2A 3M0PA 2YDLA 1ZSZA 3MJXA 4E7HA 1SKUB 1X43A 4JS4A 2D8HA 2EQMA 2RNAA 3FDRA 2CSIA 2PQWA 3E19A 1IB8A 2BE7D 5KYNA 4IUTA 3H6ZA 3CEYA 2XMFA 2DYBA 3FLGA 2QA4Q 3MEWA 1T0HA 2ENMA 4M7DD 3TREA 5LJ5j 4IUPA 1BYMA 4EMKC 2AZVA 1QVGP 5IAYA 1FMKA 1WA7A 1B7TA 4OMOA 4A4HA 1FXXA 4N4HA 1LCKA 1E6HA 4C8QF 2L8DA 3DLLA 2RA2A 4IUUA 2X9HA 1VQPQ 3S3MA 2ATCB 2J6OA 3G4SQ 5GANh 1M90U 3TCJA 2EFIA 2OI3A 3QO3A 2LP5A 3HFNA 4J9FA 3AT1B 2K2MA 3I5SA 3QUIA 1VQ4Q 2YUNA 3UT1A 1ZBJA 2DBMA 4JJCA 5GAMe 3A1PA 4HCKA 4EMKB 1G2BA 2FG0A 5DM7R 1X6GA 2ZPGB 1RABB 5LJ5d 3VYGA 2JM8A 3MHXA 4XTVA 3RMSA 4FT2A 2E3IA 2LCLA 3PMIA 1VQNT 4C92F 3CXCP 1O75A 1YBYA 2E12A 2IPOB 4M75F 1M3AA 1AWJA 3V7SA 5AT1B 3CCSQ 1QCOA 2L2PA 3VYHB 5HCKA 3G6ET 1WX6A 3GLXA 4J8OA 1Y57A 2GTJA 1UGRB 1AEYA 3GNGA 1M1KR 2KMTA 1KC8U 1PSFA 1YJ9Q 3L2UA 1KQSP 4LD6A 4NL3A 1VIFA 1YJNT 1GL5A 4C8QA 1V76A 1FMWA 1BI0A 3OYFA 2OTJA 1GCQC 1VQ8A 4M7DF 1VQMT 3CBOA 3OW2A 3BE3A 5GAMj 1GRIA 1QCNA 2K9GA 1QW1A 2IVWA 3WXMB 1WFWA 3CCVQ 4FYWB 4LDVA 5LL6S 1VYTA 1QWFA 3RMQA 1PM3A 3NHNA 2V8KA 3QHSA 1QVGS 1H3ZA 3EGUA 2YXYA 5DLOA 1S72Q 4XU2A 1OQKA 2EIFA 3JB9D 3HRTA 9ATCB 4XTYA 2KXDA 4C92A 5KYXB 2R5AA 4M75A 1VQ7T 2BZYA 3A8MB 2L89A 3WVDB 1C0MA 1SG5A 3CCRQ 3CCJQ 5I2SA 1HK9A 4PLLA 3H0HA 1I1JA 3LGFA 5GMKm 1NLOC 4NS5A 4PJMA 1RAIB 3EG3A 4M4ZA 2E10A 5CIUA 3HKSA 4TVRA 4J9DA 2MWPA 3A8LB 4J7FA 5I11A 1SHGA 2I0NA 2RN8A 3PIOA 1RAFB 1JEGA 3HSBA 1KK7A 1LPLA 2E4HA 3V8JA 3CXCS 1Q7YU 4M7DA 1BU1A 2V26A 1Q82C 1TTHB 4F7UB 5KYWA 4HKEA 2O9SA 2NYSA 5GAOr 1Z9ZA 1D1CA 4KUIA 1W4SA 4FYVB 2KAFA 3CMAA 4ME7A 3LWHA 1WQ7A 4M77E 3EFSA 1KQSS 1K76A 3HP9A 4XTUA 2B86A 3JCMW 4PKCC 3MEUA 1E6GA 4OMQA 2R5MA 2EBPA 4M77G 5EC7A 1RADB 4R55A 4JRKA 6AT1B 4M7AE 4J9IA 2RD1A 2COZA 1HXDA 4NL2A 3PT9A 3VS1A 3CCLQ 4QVZA 3DB3A 4YTLA 2COWA 3GNFB 3F70A 3JB9F 1ZA1B 1WGSA 2CP6A 3SD4A 1YJ9A 3C94A 2MIOA 4LD9K 4M7AG 1FMVA 2MPXC 2DLPA 1NJIU 1YITA 1ARKA 1IHWA 2DIQA 2OTJT 3ZL7C 2E1HA 1VQ8T 1ZSZC 4RTYA 4A54A 1PKSA 5GAOl 2Y90A 3M0QA 1K8AU 1W1FA 2KR3A 1WHGA 1ZSGA 2FYKA 4OB2B 4PJOE 5CKDA 3QWYA 4OGEA 3HRUA 2X3WD 1NYFA 1U3OA 5LJ3g 3QDRB 3QYHB 2V8IA 2HSEB 1Q7YR 2E6ZA 1B07A 1S72A 3H8ZA 4B6MA 2LQNA 4PJOG 3H0IA 2CT4A 5A0GA 1PHTA 1VQLA 5GMKe 1TOVA 4BE2A 2JJ9A 3TVTA 1ZSZB 3BDUA 4C5IA 4ORZA 5DY9A 2O4XB 3SFMA 2GQVA 2JS0A 2DVJA 2A3LA 2F2XA 3CCRA 2P4RA 2COYA 3CCJA 3CPWA 1YI2A 1W2BA 1ZUKA 4FT4A 2VC8A 3R6OA 2O01E 2M9UA 2G3RA 4X34A 3M58A 1I4K1 1M3CA 2X4JA 3PIPA 4XU3A 1JXMA 2FL7A 2RJEA 1PC0A 4PJJA 1HYOA 2YHTA 2KEAA 3VUZA 3CD6A 5GANg 1X27A 4II1A 1N8RU 2PTKA 1YIJQ 1R8OB 4A4FA 1MUZA 3G4ST 1M2OA 2PUKB 2L5QA 4KGXB 1X6OA 4AFZC 2CP2A 1SSHA 2XIDA 2VGNA 4E7ZA 1KFZA 1NJIR 3PNWC 3FIFA 2QI2A 3M5AA 1K9MC 3CMAT 1JBMA 4D8DA 2CYZB 4B9WA 3BFMA 3DLMA 2M16A 5GMKj 2XK0A 5C6SA 5KE3A 1N27A 2D1XA 4Z02A 1SHFA
chains in the Genus database with same CATH topology
5GAOn 4M7DB 4A4GA 4XTZA 2XI9A 5FU7B 3JCMd 2KSSA 2GFAA 2IG0A 2WSCE 4A53A 5GAMf 5CKHA 1XQHA 2CZ6B 2F5TX 3EFRA 3MCAB 5KE2A 3OYBA 4BACA 4ZTJA 1VQMA 4EDUA 4XTWA 1M1KC 3CPWS 4DA4A 2KVQG 3N5BB 1W2BS 2QQSA 4EMHA 5FRNA 2F5KA 3RIRA 4C8QC 3QJ6A 1VQ9T 1I5LA 4N0AC 1BI2A 1N6AA 2EKOA 2RHYA 3QZ9B 3URGA 1JB0E 3JCMg 4C92D 5GAN7 2RHXA 4JJNK 2D9TA 4M77B 4ELZC 1Q86C 1KHCA 2DJZA 4BI8B 3UPUA 1G3WA 2DXTA 2YRVA 4BDZA 1M4ZA 3JCMe 2Y4XA 3CC2A 1QVFS 2M0OA 2MAMA 3E9GA 2LQKA 3CCMT 2RJFA 3JB9J 1V29B 3CCUT 2DO3A 2GFUA 2MF2A 3V8LA 1YJ9T 3VU3C 2FHDA 3QIIA 1G5VA 4E7HA 2XDPA 4JS4A 4MZTA 5J39A 2VXEA 1YITT 2EQMA 4EPCA 1N9SA 3JCMP 3RUXA 3FB9A 2QQ9A 4HCZA 3CCVA 1O9SA 2JNGA 3FDRA 3M57A 2JTFA 4QQGA 1P92A 1MGQA 2DVEA 2PQWA 5CO7A 2DK3A 3E19A 4RCBA 5GAN8 3NTKA 3QSUA 4PJOC 5D6WA 4C0DC 3X20B 4FIBA 4M78A 3VJPA 3HL8A 4IUTA 2CS7A 2EQJA 3QXEB 4WF2A 3H6ZA 4OP0A 3CEYA 4C8QB 3E1SA 2YLCA 5A2QE 4VUBA 3FLGA 3JCMc 3MEWA 2E70A 4DQ2A 2FVUA 2KK4A 2VGMA 4M7DD 4M75C 4R56A 4XU0A 2EJGA 5GAN6 2RM4A 2XU8A 3JAME 2MWOA 3TREA 4IUPA 3OQ5A 4JLIA 3X24B 5LJ5j 1BYMA 3G71A 3CC4A 5GAN4 2RJCA 4XAXB 4EMKC 2LDMA 2XD0A 1ZHIA 2RK1A 1MHNA 3UDCA 5CK9A 3OY9A 2XICA 2DTIA 3GOXA 2P4TA 5IAYA 4LDYA 1RI0A 3OYKA 4A4HA 4C92E 5GAOp 1N8RC 1I8FA 1FXXA 5CKBA 3SWNC 2ZZDA 4LDUA 3V7CA 1TH7A 2QA4T 2LTOA 4N4HA 1S72T 3QJYA 4FM4B 3PTAA 4A4EA 5GAOq 4C8QF 2I2LA 2L8DA 1M1KU 1LNXA 2XDDA 2K2VA 3DLLA 2RA2A 1X01A 1OZ2A 1YCYA 2YLBA 1VQLT 1X75C 4N4GA 4IUUA 5GAMd 2XG8D 3OBWA 5KCHA 3CCQT 4PJOB 2AHJB 3S3MA 2VXFA 4C0DB 1M90U 2OAUA 5GANh 2QEXA 4C92G 3TCJA 3OYNA 4PNOA 2EFIA 3S3NA 1QVFA 3QO3A 3HFNA 2OTLA 2JN0A 4RG2A 2MI6A 1WPYA 3OBYA 3CCRT 1FWZA 3CCJT 1YI2T 3QUIA 4M75B 4LDXA 3UT1A 2LCCA 1BIBA 1VQ5T 3GF5A 3OW2S 3INZA 5CKEA 5A0DA 5GAMe 3FRNA 3OYDA 1VQPT 4EMKB 3DKMA 4JRIA 3MEAA 3X28B 5DM7R 3MP6A 1BIAA 2ZPGB 4CI0C 4C8QD 4QVCA 5LJ5d 3VYGA 1Y96A 3KBGA 5FU6C 3MHXA 3FEOA 4XTVA 3SWNB 2P0QA 5CAIA 5LJ3f 3PMTA 5D6XA 4M7DE 3J80E 2QDYB 2LT1A 4FT2A 3RMSA 2LCLA 1BI1A 1LOJA 3I56A 2RJDA 3PMIA 1VQ4T 1VQ5A 1VQNT 3CD6T 4PLIA 1AHJB 4C92F 2QTXA 1O75A 1Y07A 2BIVA 2XHCA 4NOYA 3TEEA 5LJ5g 1M8VA 1YBYA 2E12A 2DD5A 3P8DA 4M75F 3CCEA 2KY9A 5M9OA 2R58A 2HQXA 3G7ZA 3NTIA 1YIJA 1KD1U 3V7SA 2QXFA 2RH2A 4BDYA 2K57A 1KQ1A 2JTMA 3DB4A 2KQWA 4M7DG 4KULA 3VYHB 1YJNA 4GLKA 3G6ET 2P0KA 5HK0A 3KXTA 1NZ9A 3GLXA 4J8OA 4M7AC 4C5GA 1UGRB 2WACA 1G3TA 1Q82U 1OI1A 3GNGA 5I2MA 2KMTA 1KC8U 3LX7A 1PSFA 1U1SA 2NLUA 3L2UA 1UEBA 4LD6A 4RKUE 2RI3A 4OMFB 2XKOC 4RMOA 4NL3A 3CCST 5FU6B 3KUFA 1VIFA 3OYGA 4MMKA 1WNLA 1YJNT 2LX9A 3I55T 4M75D 2RHIA 2ZPIB 1VQKT 3GP8A 3G71T 3NFCA 4C8QA 3ZFJA 2WSFE 1BI0A 3OYYA 3OYFA 3GIBA 3CCLA 2OTJA 5CVIA 2P0PA 3O8VA 2E64A 4QQ6A 3Q1JA 3T9NA 5HKCA 1B34B 5GAOm 1VQ8A 1G3YA 5FRMA 4M7DF 1IREB 4BB7A 1VQMT 5J26A 1XOVA 3ASKA 5GAN2 2PU9B 3OYCA 5GANf 4C8QE 2HD0A 2QQRA 3CBOA 5GMKi 4QQDA 4BY6C 5IN1A 4ZGDB 3OW2A 2JVVA 5GAMj 5LJ3h 5HY6A 1YHQA 2O4XA 1QW1A 2IVWA 3OB9A 1NPPA 3L2RA 3CC7A 4BE0A 4M7AB 2RI2A 3WXMB 4QVDA 2EYQA 5LL6S 4LDVA 1YJWA 3C4SA 4M77F 5GMKh 3CC2T 4OB1B 3CCLT 1Q81U 2D6FA 3RMQA 1VQ7A 2V8KA 3QHSA 1VQKA 4OB3B 4MZPA 4OVAA 4C8QG 1Y71A 3NTHA 1ZQ1A 1QVGS 1H3ZA 4XU1A 5I21A 2PVDB 2KDSA 4PJOD 2K5FA 1I81A 2LQ8A 5DLOA 2BKDN 1VQ6A 4ZN3A 1Y7XA 3P8BB 4XU2A 2X4XA 3BW1A 2EIFA 4LDWA 4DOWA 3JB9D 1U8RA 3HRTA 2WSEE 2DXUA 2EQKA 4XTYA 3JRZA 3CCVT 4M78C 4C92A 3JSCA 4MDWA 3A8HB 1FX7A 2R5AA 3QBYA 1M1GA 2ZPFB 4M75A 4M7AF 2DXBA 1VQ7T 4X9DA 3A8MB 2L89A 3C95A 3WVDB 2R57A 4BY6B 4IUVA 2E5QA 2LC4A 5J3BA 2E41A 4EMKA 5IT9E 1M1FA 4M77D 3RKYA 3OSVA 1PSEA 4M75E 5I2SA 2MMPA 2HNIA 1HK9A 2PVGB 4L6V5 3JCMV 3WVEB 4PLLA 3M56A 1XTDA 3LGFA 3SWNA 5GMKm 3JCMf 3CBPA 3LWIA 2HBPA 2L3RA 4NS5A 3CC4T 1VQ6T 4L59A 1UGSB 3QKJA 2E10A 5CIUA 2EQUA 3HKSA 4TVRA 3OYIA 3CMEA 1M90C 2MWPA 3A8LB 3QG1A 3SDZA 4J7FA 5FROA 4HCBA 4M75G 3C12A 3OS5A 3OYMA 2DKGA 3OYAA 3PIOA 5GAMg 1KD1C 4M7AD 2ZPEB 3HSBA 4Y91A 4E7LA 5GAN5 4N4IA 4M78B 3LLRA 4C0ZA 3V8JA 4OGCA 4FU6A 3A8GB 3CXCS 1Q7YU 1ZBXA 4ATOA 4M7DA 2K5IA 2EWNA 2FB7A 4P5NA 4X9CA 4BI3A 5GANd 1Q82C 4F7UB 2QEXT 2K3YA 4HKEA 2H3JA 4PJOF 5CR2A 1KC8C 2OTLT 3V7RA 3J7AF 5EG2A 5GAOr 3OSSC 1QVGA 3OA6A 4JUVA 4KUIA 2JZ2A 5CCAA 3VKIA 3RESA 2ZGWA 1JRIA 1W4SA 4M77A 1QVPA 4GY5A 2QQBA 2KAFA 3CBMA 4ELYC 5GANe 3CMAA 4ME7A 3LWHA 1B34A 4JRPA 1WQ7A 4XK8E 4M77E 3S3OA 3EFSA 4HT8A 1KQSS 3HP9A 3HHTB 3JB9G 4XTUA 3JCMW 4PKCC 4ZN1A 3MEUA 1NE8A 3M55A 2VYTA 4HA8A 4F7UF 3L42A 3QPHA 5KH6A 4B9XA 3I56T 4O6JA 1G3SA 1WJSA 2ZPHB 3JCMh 3M4GA 3L2QA 2HAXA 2M1HA 3JCMX 4KBMB 5HK3A 4RCCA 2BUDA 2R5MA 3JB9I 4HCCA 4J83A 4E7IA 4M7AA 5LJ3j 1D3BB 2QQAA 3CCET 2E65A 2A7YA 1YIJT 3LGLA 4M77G 2K3XA 3VV0A 3L2WA 5GAN3 4R55A 2DIGA 4JRKA 1VQ9A 3QYGB 4ZGEB 5A0LA 4C0FA 4M7AE 2RD1A 3RKWA 1HXDA 4FSXA 4N0AA 4NL2A 3PT9A 4M78D 3X25B 4UC4A 1K73U 2PUOB 3P8HA 2CZ7B 3DB3A 1QP2A 4QVZA 4YTLA 1WQWA 3GNFB 4J6WA 1KG1A 3F70A 2PVOB 1DJ7B 3VUBA 5AYFA 1WJQA 3CCMA 3JB9F 3RERA 3OS2A 1UB4A 1Y96B 1WGSA 3CCUA 3SD4A 1YJ9A 1M9SA 3C94A 4MDXA 2DTOA 3HFOA 3JCMJ 4LD9K 3JCMb 2VV5A 4KT0E 4J6XA 4OF1A 3CXCA 4M7AG 1NJIU 2ZCFB 4E47A 2EJFA 2RK2A 4IURA 1YITA 3META 4JS5A 3OYHA 2DIQA 4QW2A 3TU4K 3MO8A 3X26B 2OTJT 1K9MU 3L2VA 2Y4YA 2E1HA 1VQ8T 2X4WA 4A54A 5GAOl 2GF7A 2Y90A 1UGQB 1K8AU 2CZ0B 3J81E 5CKFA 4D6WA 4IUQA 2ZPBB 2DXCA 5LJ5f 4PJOA 4BUGA 2X4YA 3JB9H 1JJ2A 2RB6A 4EMGA 4Q5WA 5LJ3d 1YHQT 4PL6A 2FYKA 3CC7T 3PFSA 1XNIA 4OB2B 4C5EA 5D6YA 3GPLA 5GANj 4Y28E 3RKXA 4ZTFA 1YJWT 1U1TA 1KQSA 4ZGJB 5CKDA 1VUBA 4PJOE 3M4YA 4OGEA 1BI3A 5C0MA 3HRUA 2DZ9A 5LJ3g 3QDRB 3QYHB 1Q86U 1N9RA 2V8IA 3MP8A 3OYEA 1Q7YC 3HRSA 5KCOA 3SB2A 4O5VA 4DOVA 2EAYA 3A8OB 1LJOA 5LJ3e 2E6ZA 3M59A 4C92C 2QA4A 4JLGA 3FC3A 4F7UA 3H8ZA 1S72A 3FJPA 4M78E 3LH0A 4PJOG 5A0GA 3OYLA 1VQLA 4V2SA 5GMKe 2K4YA 2HQEA 4BE2A 1VQOA 5GAMh 3S6WA 1SSFA 3OYJA 4A4KA 2DTHA 3CCQA 4F7UE 3HPWA 3BDUA 3BY7A 3A5ZB 3LYIA 3ZBDA 2DEQA 5DY9A 4C5IA 2RO0A 3JCMQ 4E7KA 1QP3A 4CRIA 1NPRA 3MEVA 2O4XB 3SFMA 2GQVA 3ME9A 5CQXA 2DPPB 2A3LA 2EJ9A 2RHZA 3ER0A 1WJRA 3CCRA 3V8KA 4IKFA 2D0QB 4J7IA 4M78G 3CPWA 3CCJA 4KUDK 3OS0A 3LW5E 1YI2A 1W2BA 1OZ3A 2DZCA 2LNVA 2VUBA 4FT4A 2VC8A 3R6OA 2O01E 2M9UA 2G3RA 4X34A 5GMKl 4E7JA 3M58A 1VQOT 4F7UG 1VQPA 3L2ZA 4J5YA 1I4K1 4FL6A 2X4JA 1KHIA 3L1AA 2V8JA 3PIPA 3G4SA 2CZ1B 3CMET 1EIFA 5LJ5h 3EAEA 3OMGA 2FL7A 4XU3A 2RJEA 1D3BA 1UGPB 4MMLA 4J6YA 4RG8A 4C92B 2YHTA 3UWNA 5CQYA 4M7DC 1VIEA 4L5GA 3VUZA 1VQ4A 5FU7C 1GXIE 1VQNA 3CD6A 5GANg 3CPFA 1KQ2A 1JJ2S 1H641 4II1A 1N8RU 4C5HA 1OYXA 1R8OB 2F69A 4A4FA 5FLXE 4M78F 1K73C 5L8RE 2B8AA 2K5LA 4BD3A 2CGHA 3M53A 3OS1A 3G4ST 2C06A 5DLQE 2PUKB 2L5QA 1IZ6A 3G6EA 1X6OA 4M77C 2LRQA 2X35A 4C0GA 4MZMA 3MP1A 2XIDA 4HT9A 3M9QA 2VGNA 2CKKA 2E6NA 2DD4A 2XDBA 2DAQA 1NJIC 2JUFA 3PNWC 3FIFA 1BKBA 4XQ3A 2QI2A 3BDLA 4JDSA 4XTXA 2LT4A 3QZ5B 2GCXA 2RI5A 2LVMA 3M5AA 1Q81C 1K9MC 3CMAT 1JBMA 2JOYA 3M54A 4BI4A 3ZEHA 3AHUA 3CCSA 4JRQA 2CYZB 4B9WA 3BFMA 3DLMA 2M16A 5GMKj 5LJ5e 1M5Q1 3PGGA 1K8AC 2XK0A 1RL2A 4BE1A 3E9FA 3I55A 5C6SA 5KE3A 4OB0B 1N27A 2RHUA 4Z02A 3OMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP6 A;  3LGF A;  4A4G A;  4IUQ A;  2GFA A;  2IG0 A;  2X4Y A;  3FEO A;  2L3R A;  5KE2 A;  4NS5 A;  3OYB A;  4BAC A;  4ZTJ A;  3PMT A;  4Q5W A;  5D6X A;  4L59 A;  4PL6 A;  4EDU A;  3QKJ A;  4C5E A;  2QQS A;  1XNI A;  2EQU A;  3PFS A;  2RJD A;  3PMI A;  5CIU A;  5D6Y A;  2F5K A;  2MWP A;  4PLI A;  5FRO A;  4ZTF A;  3QJ6 A;  5FRN A;  2BIV A;  2EKO A;  2RHY A;  3OYM A;  5C0M A;  3P8D A;  2RHX A;  3OYA A;  2D9T A;  1KHC A;  5M9O A;  2R58 A;  2HQX A;  3NTI A;  4BDZ A;  2YRV A;  4BDY A;  4E7L A;  3MP8 A;  3OYE A;  4N4I A;  3LLR A;  3DB4 A;  2M0O A;  5KCO A;  3E9G A;  4FU6 A;  2P0K A;  2RJF A;  3FC3 A;  3H8Z A;  2GFU A;  3LH0 A;  2FHD A;  2K3Y A;  3QII A;  4C5G A;  3OYL A;  2WAC A;  1G5V A;  2HQE A;  4BE2 A;  1OI1 A;  2XDP A;  3S6W A;  1SSF A;  3OYJ A;  4E7H A;  5J39 A;  2EQM A;  4C5I A;  4E7I A;  3LYI A;  3LX7 A;  3OA6 A;  4E7K A;  2NLU A;  2RO0 A;  2JZ2 A;  4CRI A;  3L2U A;  3MEV A;  4HCZ A;  2O4X B;  4LD6 A;  2RI3 A;  3ME9 A;  3FDR A;  2JTF A;  4QQG A;  3KUF A;  2RHZ A;  4GY5 A;  3OYG A;  2PQW A;  1WJR A;  3NTK A;  4IKF A;  2RHI A;  5D6W A;  3OS0 A;  1OZ3 A;  4IUT A;  2EQJ A;  3OYF A;  3H6Z A;  3MEA A;  3CEY A;  3S3O A;  2G3R A;  3O8V A;  4QQ6 A;  3Q1J A;  4X34 A;  4E7J A;  5FRM A;  3FLG A;  3MEW A;  3MEU A;  5J26 A;  2VYT A;  3ASK A;  4FL6 A;  3L42 A;  3OYC A;  5KH6 A;  2QQR A;  4QQD A;  1WJS A;  5IN1 A;  3L2Q A;  3EAE A;  3OMG A;  2M1H A;  2MWO A;  2RJE A;  4IUP A;  3OQ5 A;  2BUD A;  2R5M A;  2RJC A;  2LDM A;  2O4X A;  1MHN A;  3UWN A;  3OB9 A;  3OY9 A;  3L2R A;  4BE0 A;  3GOX A;  2RI2 A;  3LGL A;  5IAY A;  2K3X A;  3L2W A;  1RI0 A;  2DIG A;  3C4S A;  4A4H A;  3OYK A;  4II1 A;  2LTO A;  4N4H A;  1OYX A;  4OVA A;  4C5H A;  4A4F A;  3NTH A;  4A4E A;  1H3Z A;  2B8A A;  2L8D A;  4BD3 A;  4UC4 A;  3OS1 A;  1OZ2 A;  3P8H A;  4QVZ A;  3DB3 A;  4N4G A;  2BKD N;  4IUU A;  3F70 A;  1WJQ A;  2X4X A;  5KCH A;  2LRQ A;  2X35 A;  3OS2 A;  3S3M A;  3MP1 A;  1WGS A;  3OYI A;  3M9Q A;  3SD4 A;  2CKK A;  2E6N A;  2EQK A;  2DAQ A;  3OYN A;  2EFI A;  3S3N A;  3PNW C;  2R5A A;  3BDL A;  3QBY A;  4RG2 A;  4IUR A;  3MET A;  2RI5 A;  2L89 A;  2LVM A;  3OYH A;  2DIQ A;  4QW2 A;  2R57 A;  3MO8 A;  4PLL A;  4IUV A;  2E5Q A;  2LCC A;  3UT1 A;  3ZEH A;  4B9W A;  3DLM A;  2M16 A;  3L2V A;  2X4W A;  2XK0 A;  3OYD A;  4BE1 A;  3E9F A;  5C6S A;  2GF7 A;  5KE3 A;  4B9X A;  1N27 A;  2RHU A;  4Z02 A;  3OMC A; 
#chains in the Genus database with same CATH topology
 1X2K A;  4A4G A;  2FRY A;  4BAC A;  3CCM Q;  1IGQ A;  4EDU A;  1PD0 A;  1M1K C;  4F16 A;  5KYX A;  1GCQ A;  2NUT A;  4C8Q C;  3QJ6 A;  4J9H A;  1OPK A;  1I5L A;  1BI2 A;  2EKO A;  1JB0 E;  3JCM g;  1KHC A;  1NEG A;  1YJW Q;  4OML A;  2YRV A;  3CC2 A;  1U5S A;  5KYY A;  1YJ9 T;  2FHD A;  1BCO A;  1G5V A;  1AT1 B;  1RAC B;  2RPN A;  3VS2 A;  1YIT T;  1AZE A;  1M2V A;  1EX4 A;  3FB9 A;  1QVF P;  1O9S A;  4QQG A;  1P92 A;  1MGQ A;  4HXJ A;  3QSU A;  5GAN 8;  3EGD B;  2MYS A;  3X20 B;  4FIB A;  2EQJ A;  2ESW A;  1N5Z A;  4C8Q B;  5IHI A;  5A2Q E;  3EG2 A;  2E70 A;  2FVU A;  2VGM A;  2EYW A;  4M75 C;  4R56 A;  4XU0 A;  2EJG A;  2RM4 A;  2XU8 A;  3OQ5 A;  5GAN 4;  4XAX B;  3EHR A;  2RK1 A;  1MHN A;  3OY9 A;  2GNC A;  2XIC A;  2AT1 B;  2DX1 A;  2P4T A;  4LDY A;  1RI0 A;  3OYK A;  1KSW A;  2KRN A;  4C92 E;  1I8F A;  1N8R R;  2DE0 X;  2AIR B;  2LTO A;  1S72 T;  4CC2 A;  3QJY A;  4FM4 B;  3PTA A;  5GAO q;  2HDA A;  5L23 A;  1VQL T;  1MV3 A;  1YCY A;  2CSQ A;  4N4G A;  8ATC B;  2XG8 D;  2YWW A;  5KCH A;  1EZZ B;  4C92 G;  3OYN A;  3S3N A;  1YNZ A;  1IHV A;  1RAE B;  4RG2 A;  1WPY A;  3CCR T;  3M0T A;  3CCJ T;  1YI2 T;  4M75 B;  2CP7 A;  1BIB A;  2EKH A;  2X51 A;  1C1A A;  3OYD A;  3DKM A;  4JRI A;  3MEA A;  1K73 R;  4C8Q D;  4QVC A;  4PFP A;  2P0Q A;  5LJ3 f;  4M7D E;  2LT1 A;  5FWB A;  3MKD A;  1LOJ A;  3I56 A;  1K0X A;  1MMD A;  2RJD A;  3CD6 T;  1Y07 A;  1M8V A;  3TEE A;  3HTR A;  2DL5 A;  2HQX A;  1YIJ A;  3RBB B;  1KQ1 A;  1D0Z A;  4J9C A;  2AK5 A;  2JTM A;  2K79 A;  4M7D G;  1YJN A;  2P0K A;  3KXT A;  2LZ6 B;  1VQK Q;  1G83 A;  1OI1 A;  2FZC B;  5KYW B;  2BTT A;  3CCU Q;  2NLU A;  1UEB A;  4RKU E;  2RI3 A;  4RMO A;  3KUF A;  4MMK A;  2VWF A;  4M75 D;  1Q86 R;  3H0F A;  1PKT A;  3GIB A;  2HKQ B;  5CVI A;  2P0P A;  2E64 A;  5HKC A;  5FRM A;  3OYC A;  5GAN f;  1K1Z A;  2HD0 A;  5LJ3 h;  1YHQ A;  2O4X A;  2K6D A;  4E2F B;  1NPP A;  1YJW A;  2EYQ A;  3C4S A;  3CC2 T;  4OB1 B;  3CCL T;  2D6F A;  1VQ7 A;  2LQW A;  4OVA A;  5I21 A;  1D0X A;  1I81 A;  2LQ8 A;  4ZN3 A;  2X4X A;  3BW1 A;  4LDW A;  4DOW A;  3VRY A;  2WSE E;  2DXU A;  4KRT A;  3JRZ A;  4M78 C;  3JSC A;  3CC4 Q;  4AT1 B;  3CCQ Q;  2ZPF B;  2DXB A;  2F1L A;  4IUV A;  2LC4 A;  3UAT A;  2E41 A;  2EPD A;  3RKY A;  3OSV A;  5IHN A;  4LUD A;  2MMP A;  2AKL A;  2PVG B;  4L6V 5;  3REA B;  3UA7 A;  2HEQ A;  3SWN A;  3JCM f;  1M27 C;  2HKN A;  2HBP A;  2L3R A;  2OX7 A;  2DF6 A;  2EYY A;  2M02 A;  3QKJ A;  2RQR A;  2QEX Q;  5FRO A;  3C12 A;  4FCY A;  1MV0 B;  1PRM C;  1KD1 C;  2LCS A;  3EG1 A;  2YUO A;  1JXO A;  2FEI A;  4E7L A;  5GAN 5;  2LNH B;  4N4I A;  4M78 B;  4C0Z A;  4OGC A;  3O5Z A;  1X69 A;  2K5I A;  4KGV B;  1MNE A;  4P5N A;  2DM1 A;  5GAN d;  2K3Y A;  4DBQ A;  3J7A F;  1OOT A;  4JUV A;  1D1B A;  5CCA A;  3VKI A;  3RES A;  4OMM A;  4GY5 A;  2RQV A;  3TQ7 P;  1B34 A;  1IRX A;  4HT8 A;  3JB9 G;  2RMO A;  2O9V A;  4DBF A;  1NE8 A;  3M55 A;  2VYT A;  2EVR A;  3G71 Q;  3QPH A;  3I56 T;  4RTT A;  3L2Q A;  3JCM h;  2FPF A;  2DET A;  2J6F A;  2A7Y A;  1YIJ T;  1UDL A;  2K3X A;  2DIG A;  3EGD A;  4D8K A;  2LJ1 A;  4M78 D;  3X25 B;  4UC4 A;  1UEC A;  2PUO B;  3P8H A;  2H3E B;  1KG1 A;  1WQW A;  4J6W A;  3VUB A;  5AYF A;  1WJQ A;  1UB4 A;  1Y96 B;  1T3L A;  2KNB B;  1D1A A;  3CCU A;  4ANJ A;  1WHK A;  1M9S A;  4MDX A;  2DTO A;  3JCM J;  1K9A A;  4KT0 E;  1WHH A;  2EJF A;  2RK2 A;  4JS5 A;  2L3Q A;  3PE0 A;  1SRM A;  1UGQ B;  2MK5 A;  2O31 A;  2JMC A;  3JB9 H;  2F2V A;  1VQ6 Q;  2RB6 A;  1YFN A;  1M90 R;  1YHQ T;  1WDX A;  2QTV A;  3PFS A;  1XNI A;  4C5E A;  5D6Y A;  1YJW T;  2KT1 A;  1WHL A;  1YWO A;  2NUT B;  3I35 A;  1JQQ A;  3A8O B;  1KIK A;  2QA4 A;  1VOM A;  2QGF B;  1YN8 A;  3FJP A;  1WIE A;  3LH0 A;  2OJ2 A;  4WCI A;  5KYY B;  2HQE A;  4PFO A;  5GAM h;  4AFQ C;  3CCQ A;  4F7U E;  2K7A A;  1U06 A;  4JZ4 A;  2DEQ A;  3ZBD A;  2RO0 A;  1QP3 A;  3CME Q;  1UJY A;  4AG1 C;  1QKX A;  1M2V B;  2ECZ A;  5CQX A;  2DPP B;  1M3B A;  2A0F B;  1PCX A;  2J7I A;  2RF0 A;  5GMK l;  4F7U G;  1VQP A;  1ABO A;  1KHI A;  2CP5 A;  2V8J A;  3G4S A;  1OUL A;  1QLY A;  1PRL C;  1VYU A;  1KC8 R;  4MML A;  4J9G A;  4F04 B;  3UWN A;  2CDT A;  2NWM A;  2GBQ A;  1VQ4 A;  1ZX6 A;  3CPF A;  2D8J A;  3CCE Q;  5FLX E;  2F69 A;  1K73 C;  4M78 F;  3EG9 A;  2CGH A;  3M53 A;  3OS1 A;  2C06 A;  5DLQ E;  4M77 C;  2X35 A;  1H92 A;  1W70 A;  3MP1 A;  3M9Q A;  2CKK A;  2E6N A;  2DD4 A;  2XDB A;  4JJB A;  1RLP C;  3OW2 P;  2P84 A;  3BDL A;  4JDS A;  2JTE A;  3QZ5 B;  1GCP A;  2KI7 A;  2Z0W A;  1T0J A;  1Q81 C;  1OU9 A;  1VQ9 Q;  1WLP B;  3CCS A;  3GBQ A;  1RL2 A;  3E9F A;  4DBR A;  4B9X A;  5IH2 A;  3G71 A;  3OMC A;  2YRD A;  4EIK A;  2WSC E;  2GFA A;  2IG0 A;  3EH2 A;  1AWO A;  3OYB A;  2F5T X;  1QQJ A;  3N5B B;  3RIR A;  4N0A C;  3QZ9 B;  3URG A;  4JZ3 A;  4JJN K;  2D9T A;  3CC7 Q;  4M77 B;  4ELZ C;  1LVK A;  1Q86 C;  2JS2 A;  4BI8 B;  1FYN A;  2QDL A;  1M4Z A;  1J3T A;  2F2W A;  2DBK A;  4OMP A;  3JB9 J;  1CKB A;  3CCU T;  2DO3 A;  3V8L A;  1Y0M A;  3VU3 C;  3QII A;  1VQ5 Q;  1M30 A;  4MZT A;  1X6B A;  5J39 A;  2VXE A;  2DL8 A;  3JCM P;  2DRM A;  3CCV A;  1HSQ A;  3M57 A;  2DVE A;  5CO7 A;  2J05 A;  4RCB A;  4PJO C;  3NTK A;  5D6W A;  4C0D C;  1BCM A;  4M78 A;  3VJP A;  4OP0 A;  3E1S A;  4VUB A;  3RNJ A;  1WHJ A;  2KK4 A;  4KH0 B;  2A36 A;  1RLQ C;  5GAN 6;  2JM9 A;  3JAM E;  1VQO Q;  2NUZ A;  4K11 A;  2RJC A;  2XD0 A;  3THK A;  5GAO p;  3SWN C;  5CKB A;  4RUG A;  2QA4 T;  4A4E A;  2I2L A;  3VS7 A;  1LNX A;  2K2V A;  1X01 A;  1TG0 A;  2JXB A;  2G6F X;  3CCQ T;  4PJO B;  2AHJ B;  4C0D B;  2ED0 A;  2DNU A;  2L3S A;  1QVF A;  2JN0 A;  1TXQ A;  4HVU A;  1HD3 A;  4LDX A;  1VQN Q;  1OX8 A;  2LCC A;  2D0N A;  3OW2 S;  3INZ A;  5A0D A;  1RAA B;  2YT6 A;  1VQP T;  2V1Q A;  4CI0 C;  1MMA A;  4CC4 B;  4WTO B;  1Y96 A;  3KBG A;  3FEO A;  3SWN B;  5CAI A;  2HZY A;  3G6E Q;  3PMT A;  3J80 E;  3PVL A;  1VQ4 T;  1RI9 A;  4PLI A;  1AHJ B;  2QTX A;  4JPB W;  1V1C A;  5LJ5 g;  2DD5 A;  2EYZ A;  3CCE A;  2KY9 A;  5M9O A;  3NTI A;  3G7Z A;  1TUG B;  3NGP A;  2QXF A;  2RH2 A;  1I0C A;  1WXB A;  5ECA A;  2KYM A;  3U23 A;  3DB4 A;  1QMC A;  4KUL A;  1K8A R;  4GLK A;  2FRW A;  2EQI A;  4C5G A;  2C0T A;  1G3T A;  3D7S B;  1Q82 U;  1VQM Q;  5I2M A;  1U1S A;  2BZ8 A;  3VS3 A;  2EGC A;  4OMF B;  2KE9 A;  3CCS T;  4F14 A;  1WNL A;  1W6X A;  2RHI A;  2ROT A;  3G71 T;  1T3S A;  3NFC A;  3ZFJ A;  2WSF E;  3OYY A;  1UGV A;  3CCL A;  3M0S A;  2FPE A;  3Q1J A;  1B34 B;  1G3Y A;  1IRE B;  1GBQ A;  4C8Q E;  2QQR A;  5GMK i;  5IN1 A;  4ZGD B;  3VS6 A;  5HY6 A;  1NEB A;  3CC7 A;  4LE9 A;  2RI2 A;  4QVD A;  1QWE A;  1TUD A;  4M77 F;  5GMK h;  1Q81 U;  4DEY A;  4AFU C;  1YP5 A;  4C8Q G;  4GBQ A;  1Y71 A;  1AWW A;  1G8X A;  4XU1 A;  2KDS A;  1WHM A;  2BKD N;  1XJW B;  1M90 C;  1VQ5 A;  1U8R A;  1UFF A;  3M0U A;  3CCV T;  3A8H B;  1FX7 A;  2GTO A;  1M1G A;  4M7A F;  4CC7 A;  1UHF A;  2R57 A;  2E5Q A;  2QGG A;  1YCS B;  5J3B A;  5IT9 E;  1M1F A;  1PSE A;  4M75 E;  3JCM V;  3WVE B;  3M56 A;  1XTD A;  3LWI A;  2HL3 A;  4L59 A;  1UGS B;  3QG1 A;  3SDZ A;  4M75 G;  3OS5 A;  2PZ1 A;  3OYM A;  3OYA A;  5GAM g;  2FZK B;  4FYY B;  2E3H A;  2VVK A;  3LLR A;  2VKN A;  4FU6 A;  3A8G B;  1ZBX A;  4X9C A;  4DEX A;  2EGA A;  2H3J A;  4PJO F;  1KC8 C;  5D7U A;  4PJL A;  3V7R A;  5EG2 A;  3MPU B;  3OSS C;  1QVG A;  2JZ2 A;  1ACM B;  1IO6 A;  4M77 A;  1GBR A;  4PJN A;  3CBM A;  1UTI A;  5GAN e;  4XK8 E;  2LJ3 A;  4E6R A;  3S3O A;  3I55 Q;  1G3S A;  1WJS A;  2DFU A;  1JJ2 P;  3M4G A;  1UJ0 A;  4KBM B;  5HK3 A;  4RCC A;  4HCC A;  4J83 A;  4M7A A;  5LJ3 j;  2QQA A;  3CCE T;  2E65 A;  2DEU A;  3VV0 A;  3QYG B;  2X3X D;  1IXD A;  4FSX A;  1OU8 A;  4RTU A;  1JO8 A;  4N0A A;  2CH4 A;  2CZ7 B;  1VQ8 Q;  2EYX A;  3EG9 B;  1DJ7 B;  3CCM A;  3OS2 A;  3M0R A;  1OEB A;  3JCM b;  1AOJ A;  2VV5 A;  4J6X A;  3CXC A;  2DJQ A;  2ZCF B;  4IUR A;  3MET A;  3EFO B;  1K9M U;  2X4W A;  2GF7 A;  2HMA A;  4RTW A;  1B3Q A;  3J81 E;  5CKF A;  3R6N A;  3A98 A;  5LJ5 f;  4PJO A;  2X4Y A;  2DA9 A;  4Q5W A;  5LJ3 d;  2L0A A;  3CC7 T;  5GAN j;  1M1K U;  4Y28 E;  1KQS A;  4ZTF A;  1PD1 A;  1VUB A;  1SEM A;  2YUQ A;  5C0M A;  2KXC A;  2DZ9 A;  2CH4 W;  2OAW A;  3REB B;  1D0Y A;  1N9R A;  2DER A;  3OYE A;  1Q7Y C;  2ROL A;  3HRS A;  1AZG B;  5KCO A;  3SB2 A;  2EAY A;  1VQ5 T;  3M59 A;  3FC3 A;  2M51 A;  4M78 E;  1NYG A;  1UUE A;  2VB6 A;  2KT8 A;  4V2S A;  3EGX A;  2K4Y A;  3S6W A;  1SSF A;  1VYV A;  3QDF A;  3OYJ A;  1TS9 A;  2DTH A;  3HPW A;  3BY7 A;  3LYI A;  4E7K A;  3JCM Q;  3VS4 A;  4CRI A;  1NPR A;  4ZNX A;  3ME9 A;  2OTL Q;  2EJ9 A;  2JMA A;  2RHZ A;  1WJR A;  4LXC A;  2D0Q B;  4M78 G;  5GJV B;  1VQO T;  4X1V A;  4J5Y A;  4RTX A;  3L1A A;  1Z9Q A;  1YWP A;  1M8M A;  2QYZ A;  3EAE A;  3OMG A;  4Y92 A;  5LJ5 h;  1D3B A;  1UGP B;  4RG8 A;  4Z8A A;  4L5G A;  1KQ2 A;  1ZA2 B;  1JJ2 S;  4RTZ A;  1R77 A;  1H64 1;  3FJ5 A;  1MMG A;  3I5R A;  4C5H A;  1OYX A;  1TU0 B;  3CMA Q;  2B8A A;  4BD3 A;  2W10 A;  3CQT A;  4MZM A;  4HT9 A;  3EH1 A;  1KJW A;  2DAQ A;  1NJI C;  2HCK A;  1BKB A;  4XQ3 A;  4XTX A;  2AZS A;  4R0K A;  3M54 A;  4BI4 A;  1K9M R;  1H3H A;  3ZEH A;  4JRQ A;  1K8A C;  2IIM A;  1GFC A;  3I55 A;  4OB0 B;  1VQK A;  2RHU A;  2HQH A;  1I07 A;  3JCM d;  2KSS A;  5GAM f;  5CKH A;  4ZTJ A;  3MCA B;  1NM7 A;  1RAH B;  4DA4 A;  2QQS A;  2YRC A;  1IGU A;  1N6A A;  2RHY A;  5GAN 7;  1YIT Q;  5FWC A;  2EW3 A;  1R0C B;  3EHQ A;  1G3W A;  2DXT A;  4BDZ A;  5GJW B;  2SRC A;  4A63 B;  2Y4X A;  2LMJ A;  2A37 A;  3CCM T;  3H9N A;  1QKW A;  4QKU A;  4JJD A;  2XDP A;  4EPC A;  1N9S A;  1R0B G;  3RUX A;  2QQ9 A;  4HCZ A;  2JNG A;  2JTF A;  1D09 B;  2YUP A;  2DK3 A;  2DMO A;  1WXU A;  3JV3 A;  3HL8 A;  2CS7 A;  3QXE B;  4WF2 A;  2YLC A;  3JCM c;  4DQ2 A;  1H8K A;  2CP0 A;  1VQL Q;  2KRS A;  2LX7 A;  2MWO A;  3X24 B;  4JLI A;  3CC4 A;  2LDM A;  1ZHI A;  2CRE A;  1NLP C;  3VS0 A;  1UG1 A;  3UDC A;  5CK9 A;  2DTI A;  1WXT A;  3GOX A;  1N8R C;  2ZZD A;  4LDU A;  3V7C A;  1TH7 A;  1YI2 Q;  2NUP B;  1Q95 G;  3SEM A;  1WYX A;  2XDD A;  1OZ2 A;  2YLB A;  1X75 C;  4AG2 C;  3UA6 A;  5GAM d;  3OBW A;  1RAG B;  2VXF A;  2OAU A;  4DBH A;  2QEX A;  4PNO A;  2OTL A;  2MI6 A;  3OBY A;  1FWZ A;  1OPL A;  4RTV A;  3CD6 Q;  1BBZ A;  1EFN A;  3GF5 A;  3QWX X;  4KH1 B;  5CKE A;  2MCN A;  3FRN A;  1K0S A;  3X28 B;  3MP6 A;  1BIA A;  5FU6 C;  2KGT A;  5D6X A;  2QDY B;  1BI1 A;  1TWB A;  1SRL A;  2BIV A;  2XHC A;  4NOY A;  3LH5 A;  3P8D A;  3EFO A;  2R58 A;  1KD1 U;  4BDY A;  2K57 A;  1ZUY A;  2KQW A;  5HK0 A;  1NZ9 A;  4M7A C;  2QAZ A;  2WAC A;  1ABQ A;  3LX7 A;  2DL4 A;  2XKO C;  5FU6 B;  2W0Z A;  3OYG A;  4PFZ A;  1ZLM A;  2LX9 A;  3I55 T;  2ZPI B;  1VQK T;  3GP8 A;  2RQT A;  3CC2 Q;  2QAS A;  3O8V A;  3T9N A;  4QQ6 A;  5GAO m;  2DL7 A;  4PK4 A;  4BB7 A;  5J26 A;  1MMN A;  1XOV A;  3ASK A;  2ZAE A;  2PU9 B;  5GAN 2;  4QQD A;  4BY6 C;  2K3B A;  2JVV A;  2VAS A;  2DL3 A;  3OB9 A;  2L3P A;  3L2R A;  4BE0 A;  4M7A B;  1OV3 A;  1WZO A;  2HSP A;  5KYU B;  1BB9 A;  4OB3 B;  4MZP A;  3NTH A;  1ZQ1 A;  2C0O A;  2PVD B;  1RUW A;  2K5F A;  3G1J A;  1VQ6 A;  1Y7X A;  3P8B B;  2CP3 A;  2V1R A;  2EQK A;  2DIL A;  4MDW A;  3QBY A;  4X9D A;  3C95 A;  1ZUU A;  1AWX A;  4BY6 B;  2GGR A;  4EMK A;  4M77 D;  2PNI A;  2HNI A;  2M0Y A;  3ULR B;  3CBP A;  3CC4 T;  2HL5 C;  4FYX B;  2ED1 A;  3UF4 A;  4IIO A;  3OYI A;  2EQU A;  3CME A;  3RR6 A;  4HCB A;  2CUD A;  2DKG A;  1GFD A;  4M7A D;  1KD1 R;  2ZPE B;  4Y91 A;  1UHC A;  4FW2 A;  3TSW A;  1S1N A;  5FW9 A;  4ATO A;  1MND A;  2EGE A;  1A0N B;  2EWN A;  2FB7 A;  1PWT A;  4BI3 A;  2A28 A;  2QEX T;  5CR2 A;  2OTL T;  3EGX B;  4KGZ B;  3OA6 A;  3I56 Q;  3VRZ A;  2ZGW A;  1K4U S;  1JRI A;  1QVP A;  2QQB A;  4ELY C;  4OMN A;  4JRP A;  3HHT B;  1YJN Q;  3RDV A;  2KBT A;  4ZN1 A;  4HA8 A;  2KRM A;  4F7U F;  3L42 A;  3E2U A;  5KH6 A;  3PVQ A;  1VA7 A;  4O6J A;  2ZPH B;  2HAX A;  2M1H A;  2O2O A;  3JCM X;  2KRO A;  3JB9 I;  2BUD A;  2HBW A;  3C0C A;  4PJO D;  1D3B B;  3LGL A;  3L2W A;  5GAN 3;  2FZG B;  1VQ9 A;  5A0L A;  4ZGE B;  4C0F A;  2CUB A;  2E5K A;  3RKW A;  2AKK A;  1AD5 A;  4CC3 A;  1K73 U;  1CKA A;  1QP2 A;  2QK0 A;  2PVO B;  3RER A;  7AT1 B;  3HFO A;  1HJD A;  1AVZ C;  4OF1 A;  1NBE B;  1YHQ Q;  4E47 A;  1SF9 A;  2JW4 A;  2A08 A;  3OYH A;  4QW2 A;  3TU4 K;  3MO8 A;  4AFS C;  3X26 B;  3KFV A;  3L2V A;  2Y4Y A;  2NUP A;  1VQ7 Q;  2ABL A;  3CPW P;  1W2B P;  2CZ0 B;  4D6W A;  2H8H A;  2ZPB B;  2DXC A;  4IUQ A;  4BUG A;  1JJ2 A;  4EMG A;  4PL6 A;  4FW1 A;  3GPL A;  3RKX A;  1U1T A;  4ZGJ B;  1X2Q A;  4GLM A;  3M4Y A;  2QG9 B;  1BI3 A;  2JT4 A;  4QT7 A;  1Q86 U;  8AT1 B;  2DRK A;  3MP8 A;  2J06 A;  4O5V A;  4DOV A;  5LJ3 e;  1LJO A;  1VQ6 T;  4C92 C;  4JLG A;  4F7U A;  4Z89 A;  1JU5 C;  2FO0 A;  3OYL A;  1VQO A;  4LNP A;  4A4K A;  4E7I A;  3A5Z B;  2CT3 A;  4IIM A;  3MEV A;  2DYI A;  3VS5 A;  3ER0 A;  4FSS A;  4F17 A;  3V8K A;  4IKF A;  4J7I A;  4KUD K;  1F1B B;  3OS0 A;  3LW5 E;  2BZX A;  2KYB A;  1OZ3 A;  2DZC A;  2LNV A;  2VUB A;  2O88 A;  2FPD A;  2MOX A;  2LJ0 A;  4E7J A;  3L2Z A;  2GQI A;  4FL6 A;  2RQU A;  1I5O B;  5IXB A;  2CZ1 B;  3NPF A;  1WI7 A;  3CME T;  1EIF A;  1Q82 R;  4AMC A;  4J6Y A;  2J6K A;  4C92 B;  5CQY A;  4ESR A;  4M7D C;  1VIE A;  1GXI E;  2YSQ A;  4Z88 A;  5FU7 C;  1VQN A;  5L8R E;  1PNJ A;  2K5L A;  1PG5 B;  2BE9 B;  4LN2 A;  1IZ6 A;  1SPK A;  3G6E A;  4E7S A;  2LRQ A;  3H41 A;  4C0G A;  2JUF A;  2LT4 A;  1TUC A;  4J9E A;  2GCX A;  2RI5 A;  5I22 A;  2LVM A;  4J9B A;  3EG0 A;  1Q81 R;  5IHK A;  2JOY A;  5KYU A;  3AHU A;  3NMZ C;  5LJ5 e;  3IQL A;  1M5Q 1;  3PGG A;  4BE1 A;  1E7O A;  5GAO n;  4M7D B;  2OTJ Q;  4XTZ A;  2C0I A;  2XI9 A;  5FU7 B;  5IXF A;  4A53 A;  1BK2 A;  2RQW A;  1XQH A;  2CZ6 B;  3EFR A;  5KE2 A;  1VQM A;  3SHW A;  4XTW A;  3CPW S;  1W2B S;  2KVQ G;  4LUE A;  1UE9 A;  2SEM A;  4EMH A;  3TSZ A;  5FRN A;  2F5K A;  1VQ9 T;  4C92 D;  2RHX A;  3I9Q A;  2DJZ A;  3UPU A;  1NG2 A;  3JCM e;  4HVV A;  4HVW A;  1QVF S;  2M0O A;  1C6V X;  2MAM A;  3E9G A;  2LQK A;  2RJF A;  1V29 B;  1OX9 A;  1CSK A;  1TSF A;  1QCF A;  2GFU A;  2MF2 A;  3M0P A;  2YDL A;  1ZSZ A;  3MJX A;  4E7H A;  1SKU B;  1X43 A;  4JS4 A;  2D8H A;  2EQM A;  2RNA A;  3FDR A;  2CSI A;  2PQW A;  3E19 A;  1IB8 A;  2BE7 D;  5KYN A;  4IUT A;  3H6Z A;  3CEY A;  2XMF A;  2DYB A;  3FLG A;  2QA4 Q;  3MEW A;  1T0H A;  2ENM A;  4M7D D;  3TRE A;  5LJ5 j;  4IUP A;  1BYM A;  4EMK C;  2AZV A;  1QVG P;  5IAY A;  1FMK A;  1WA7 A;  1B7T A;  4OMO A;  4A4H A;  1FXX A;  4N4H A;  1LCK A;  1E6H A;  4C8Q F;  2L8D A;  3DLL A;  2RA2 A;  4IUU A;  2X9H A;  1VQP Q;  3S3M A;  2ATC B;  2J6O A;  3G4S Q;  5GAN h;  1M90 U;  3TCJ A;  2EFI A;  2OI3 A;  3QO3 A;  2LP5 A;  3HFN A;  4J9F A;  3AT1 B;  2K2M A;  3I5S A;  3QUI A;  1VQ4 Q;  2YUN A;  3UT1 A;  1ZBJ A;  2DBM A;  4JJC A;  5GAM e;  3A1P A;  4HCK A;  4EMK B;  1G2B A;  2FG0 A;  5DM7 R;  1X6G A;  2ZPG B;  1RAB B;  5LJ5 d;  3VYG A;  2JM8 A;  3MHX A;  4XTV A;  3RMS A;  4FT2 A;  2E3I A;  2LCL A;  3PMI A;  1VQN T;  4C92 F;  3CXC P;  1O75 A;  1YBY A;  2E12 A;  2IPO B;  4M75 F;  1M3A A;  1AWJ A;  3V7S A;  5AT1 B;  3CCS Q;  1QCO A;  2L2P A;  3VYH B;  5HCK A;  3G6E T;  1WX6 A;  3GLX A;  4J8O A;  1Y57 A;  2GTJ A;  1UGR B;  1AEY A;  3GNG A;  1M1K R;  2KMT A;  1KC8 U;  1PSF A;  1YJ9 Q;  3L2U A;  1KQS P;  4LD6 A;  4NL3 A;  1VIF A;  1YJN T;  1GL5 A;  4C8Q A;  1V76 A;  1FMW A;  1BI0 A;  3OYF A;  2OTJ A;  1GCQ C;  1VQ8 A;  4M7D F;  1VQM T;  3CBO A;  3OW2 A;  3BE3 A;  5GAM j;  1GRI A;  1QCN A;  2K9G A;  1QW1 A;  2IVW A;  3WXM B;  1WFW A;  3CCV Q;  4FYW B;  4LDV A;  5LL6 S;  1VYT A;  1QWF A;  3RMQ A;  1PM3 A;  3NHN A;  2V8K A;  3QHS A;  1QVG S;  1H3Z A;  3EGU A;  2YXY A;  5DLO A;  1S72 Q;  4XU2 A;  1OQK A;  2EIF A;  3JB9 D;  3HRT A;  9ATC B;  4XTY A;  2KXD A;  4C92 A;  5KYX B;  2R5A A;  4M75 A;  1VQ7 T;  2BZY A;  3A8M B;  2L89 A;  3WVD B;  1C0M A;  1SG5 A;  3CCR Q;  3CCJ Q;  5I2S A;  1HK9 A;  4PLL A;  3H0H A;  1I1J A;  3LGF A;  5GMK m;  1NLO C;  4NS5 A;  4PJM A;  1RAI B;  3EG3 A;  4M4Z A;  2E10 A;  5CIU A;  3HKS A;  4TVR A;  4J9D A;  2MWP A;  3A8L B;  4J7F A;  5I11 A;  1SHG A;  2I0N A;  2RN8 A;  3PIO A;  1RAF B;  1JEG A;  3HSB A;  1KK7 A;  1LPL A;  2E4H A;  3V8J A;  3CXC S;  1Q7Y U;  4M7D A;  1BU1 A;  2V26 A;  1Q82 C;  1TTH B;  4F7U B;  5KYW A;  4HKE A;  2O9S A;  2NYS A;  5GAO r;  1Z9Z A;  1D1C A;  4KUI A;  1W4S A;  4FYV B;  2KAF A;  3CMA A;  4ME7 A;  3LWH A;  1WQ7 A;  4M77 E;  3EFS A;  1KQS S;  1K76 A;  3HP9 A;  4XTU A;  2B86 A;  3JCM W;  4PKC C;  3MEU A;  1E6G A;  4OMQ A;  2R5M A;  2EBP A;  4M77 G;  5EC7 A;  1RAD B;  4R55 A;  4JRK A;  6AT1 B;  4M7A E;  4J9I A;  2RD1 A;  2COZ A;  1HXD A;  4NL2 A;  3PT9 A;  3VS1 A;  3CCL Q;  4QVZ A;  3DB3 A;  4YTL A;  2COW A;  3GNF B;  3F70 A;  3JB9 F;  1ZA1 B;  1WGS A;  2CP6 A;  3SD4 A;  1YJ9 A;  3C94 A;  2MIO A;  4LD9 K;  4M7A G;  1FMV A;  2MPX C;  2DLP A;  1NJI U;  1YIT A;  1ARK A;  1IHW A;  2DIQ A;  2OTJ T;  3ZL7 C;  2E1H A;  1VQ8 T;  1ZSZ C;  4RTY A;  4A54 A;  1PKS A;  5GAO l;  2Y90 A;  3M0Q A;  1K8A U;  1W1F A;  2KR3 A;  1WHG A;  1ZSG A;  2FYK A;  4OB2 B;  4PJO E;  5CKD A;  3QWY A;  4OGE A;  3HRU A;  2X3W D;  1NYF A;  1U3O A;  5LJ3 g;  3QDR B;  3QYH B;  2V8I A;  2HSE B;  1Q7Y R;  2E6Z A;  1B07 A;  1S72 A;  3H8Z A;  4B6M A;  2LQN A;  4PJO G;  3H0I A;  2CT4 A;  5A0G A;  1PHT A;  1VQL A;  5GMK e;  1TOV A;  4BE2 A;  2JJ9 A;  3TVT A;  1ZSZ B;  3BDU A;  4C5I A;  4ORZ A;  5DY9 A;  2O4X B;  3SFM A;  2GQV A;  2JS0 A;  2DVJ A;  2A3L A;  2F2X A;  3CCR A;  2P4R A;  2COY A;  3CCJ A;  3CPW A;  1YI2 A;  1W2B A;  1ZUK A;  4FT4 A;  2VC8 A;  3R6O A;  2O01 E;  2M9U A;  2G3R A;  4X34 A;  3M58 A;  1I4K 1;  1M3C A;  2X4J A;  3PIP A;  4XU3 A;  1JXM A;  2FL7 A;  2RJE A;  1PC0 A;  4PJJ A;  1HYO A;  2YHT A;  2KEA A;  3VUZ A;  3CD6 A;  5GAN g;  1X27 A;  4II1 A;  1N8R U;  2PTK A;  1YIJ Q;  1R8O B;  4A4F A;  1MUZ A;  3G4S T;  1M2O A;  2PUK B;  2L5Q A;  4KGX B;  1X6O A;  4AFZ C;  2CP2 A;  1SSH A;  2XID A;  2VGN A;  4E7Z A;  1KFZ A;  1NJI R;  3PNW C;  3FIF A;  2QI2 A;  3M5A A;  1K9M C;  3CMA T;  1JBM A;  4D8D A;  2CYZ B;  4B9W A;  3BFM A;  3DLM A;  2M16 A;  5GMK j;  2XK0 A;  5C6S A;  5KE3 A;  1N27 A;  2D1X A;  4Z02 A;  1SHF A; 
#chains in the Genus database with same CATH homology
 5GAO n;  4M7D B;  4A4G A;  4XTZ A;  2XI9 A;  5FU7 B;  3JCM d;  2KSS A;  2GFA A;  2IG0 A;  2WSC E;  4A53 A;  5GAM f;  5CKH A;  1XQH A;  2CZ6 B;  2F5T X;  3EFR A;  3MCA B;  5KE2 A;  3OYB A;  4BAC A;  4ZTJ A;  1VQM A;  4EDU A;  4XTW A;  1M1K C;  3CPW S;  4DA4 A;  2KVQ G;  3N5B B;  1W2B S;  2QQS A;  4EMH A;  5FRN A;  2F5K A;  3RIR A;  4C8Q C;  3QJ6 A;  1VQ9 T;  1I5L A;  4N0A C;  1BI2 A;  1N6A A;  2EKO A;  2RHY A;  3QZ9 B;  3URG A;  1JB0 E;  3JCM g;  4C92 D;  5GAN 7;  2RHX A;  4JJN K;  2D9T A;  4M77 B;  4ELZ C;  1Q86 C;  1KHC A;  2DJZ A;  4BI8 B;  3UPU A;  1G3W A;  2DXT A;  2YRV A;  4BDZ A;  1M4Z A;  3JCM e;  2Y4X A;  3CC2 A;  1QVF S;  2M0O A;  2MAM A;  3E9G A;  2LQK A;  3CCM T;  2RJF A;  3JB9 J;  1V29 B;  3CCU T;  2DO3 A;  2GFU A;  2MF2 A;  3V8L A;  1YJ9 T;  3VU3 C;  2FHD A;  3QII A;  1G5V A;  4E7H A;  2XDP A;  4JS4 A;  4MZT A;  5J39 A;  2VXE A;  1YIT T;  2EQM A;  4EPC A;  1N9S A;  3JCM P;  3RUX A;  3FB9 A;  2QQ9 A;  4HCZ A;  3CCV A;  1O9S A;  2JNG A;  3FDR A;  3M57 A;  2JTF A;  4QQG A;  1P92 A;  1MGQ A;  2DVE A;  2PQW A;  5CO7 A;  2DK3 A;  3E19 A;  4RCB A;  5GAN 8;  3NTK A;  3QSU A;  4PJO C;  5D6W A;  4C0D C;  3X20 B;  4FIB A;  4M78 A;  3VJP A;  3HL8 A;  4IUT A;  2CS7 A;  2EQJ A;  3QXE B;  4WF2 A;  3H6Z A;  4OP0 A;  3CEY A;  4C8Q B;  3E1S A;  2YLC A;  5A2Q E;  4VUB A;  3FLG A;  3JCM c;  3MEW A;  2E70 A;  4DQ2 A;  2FVU A;  2KK4 A;  2VGM A;  4M7D D;  4M75 C;  4R56 A;  4XU0 A;  2EJG A;  5GAN 6;  2RM4 A;  2XU8 A;  3JAM E;  2MWO A;  3TRE A;  4IUP A;  3OQ5 A;  4JLI A;  3X24 B;  5LJ5 j;  1BYM A;  3G71 A;  3CC4 A;  5GAN 4;  2RJC A;  4XAX B;  4EMK C;  2LDM A;  2XD0 A;  1ZHI A;  2RK1 A;  1MHN A;  3UDC A;  5CK9 A;  3OY9 A;  2XIC A;  2DTI A;  3GOX A;  2P4T A;  5IAY A;  4LDY A;  1RI0 A;  3OYK A;  4A4H A;  4C92 E;  5GAO p;  1N8R C;  1I8F A;  1FXX A;  5CKB A;  3SWN C;  2ZZD A;  4LDU A;  3V7C A;  1TH7 A;  2QA4 T;  2LTO A;  4N4H A;  1S72 T;  3QJY A;  4FM4 B;  3PTA A;  4A4E A;  5GAO q;  4C8Q F;  2I2L A;  2L8D A;  1M1K U;  1LNX A;  2XDD A;  2K2V A;  3DLL A;  2RA2 A;  1X01 A;  1OZ2 A;  1YCY A;  2YLB A;  1VQL T;  1X75 C;  4N4G A;  4IUU A;  5GAM d;  2XG8 D;  3OBW A;  5KCH A;  3CCQ T;  4PJO B;  2AHJ B;  3S3M A;  2VXF A;  4C0D B;  1M90 U;  2OAU A;  5GAN h;  2QEX A;  4C92 G;  3TCJ A;  3OYN A;  4PNO A;  2EFI A;  3S3N A;  1QVF A;  3QO3 A;  3HFN A;  2OTL A;  2JN0 A;  4RG2 A;  2MI6 A;  1WPY A;  3OBY A;  3CCR T;  1FWZ A;  3CCJ T;  1YI2 T;  3QUI A;  4M75 B;  4LDX A;  3UT1 A;  2LCC A;  1BIB A;  1VQ5 T;  3GF5 A;  3OW2 S;  3INZ A;  5CKE A;  5A0D A;  5GAM e;  3FRN A;  3OYD A;  1VQP T;  4EMK B;  3DKM A;  4JRI A;  3MEA A;  3X28 B;  5DM7 R;  3MP6 A;  1BIA A;  2ZPG B;  4CI0 C;  4C8Q D;  4QVC A;  5LJ5 d;  3VYG A;  1Y96 A;  3KBG A;  5FU6 C;  3MHX A;  3FEO A;  4XTV A;  3SWN B;  2P0Q A;  5CAI A;  5LJ3 f;  3PMT A;  5D6X A;  4M7D E;  3J80 E;  2QDY B;  2LT1 A;  4FT2 A;  3RMS A;  2LCL A;  1BI1 A;  1LOJ A;  3I56 A;  2RJD A;  3PMI A;  1VQ4 T;  1VQ5 A;  1VQN T;  3CD6 T;  4PLI A;  1AHJ B;  4C92 F;  2QTX A;  1O75 A;  1Y07 A;  2BIV A;  2XHC A;  4NOY A;  3TEE A;  5LJ5 g;  1M8V A;  1YBY A;  2E12 A;  2DD5 A;  3P8D A;  4M75 F;  3CCE A;  2KY9 A;  5M9O A;  2R58 A;  2HQX A;  3G7Z A;  3NTI A;  1YIJ A;  1KD1 U;  3V7S A;  2QXF A;  2RH2 A;  4BDY A;  2K57 A;  1KQ1 A;  2JTM A;  3DB4 A;  2KQW A;  4M7D G;  4KUL A;  3VYH B;  1YJN A;  4GLK A;  3G6E T;  2P0K A;  5HK0 A;  3KXT A;  1NZ9 A;  3GLX A;  4J8O A;  4M7A C;  4C5G A;  1UGR B;  2WAC A;  1G3T A;  1Q82 U;  1OI1 A;  3GNG A;  5I2M A;  2KMT A;  1KC8 U;  3LX7 A;  1PSF A;  1U1S A;  2NLU A;  3L2U A;  1UEB A;  4LD6 A;  4RKU E;  2RI3 A;  4OMF B;  2XKO C;  4RMO A;  4NL3 A;  3CCS T;  5FU6 B;  3KUF A;  1VIF A;  3OYG A;  4MMK A;  1WNL A;  1YJN T;  2LX9 A;  3I55 T;  4M75 D;  2RHI A;  2ZPI B;  1VQK T;  3GP8 A;  3G71 T;  3NFC A;  4C8Q A;  3ZFJ A;  2WSF E;  1BI0 A;  3OYY A;  3OYF A;  3GIB A;  3CCL A;  2OTJ A;  5CVI A;  2P0P A;  3O8V A;  2E64 A;  4QQ6 A;  3Q1J A;  3T9N A;  5HKC A;  1B34 B;  5GAO m;  1VQ8 A;  1G3Y A;  5FRM A;  4M7D F;  1IRE B;  4BB7 A;  1VQM T;  5J26 A;  1XOV A;  3ASK A;  5GAN 2;  2PU9 B;  3OYC A;  5GAN f;  4C8Q E;  2HD0 A;  2QQR A;  3CBO A;  5GMK i;  4QQD A;  4BY6 C;  5IN1 A;  4ZGD B;  3OW2 A;  2JVV A;  5GAM j;  5LJ3 h;  5HY6 A;  1YHQ A;  2O4X A;  1QW1 A;  2IVW A;  3OB9 A;  1NPP A;  3L2R A;  3CC7 A;  4BE0 A;  4M7A B;  2RI2 A;  3WXM B;  4QVD A;  2EYQ A;  5LL6 S;  4LDV A;  1YJW A;  3C4S A;  4M77 F;  5GMK h;  3CC2 T;  4OB1 B;  3CCL T;  1Q81 U;  2D6F A;  3RMQ A;  1VQ7 A;  2V8K A;  3QHS A;  1VQK A;  4OB3 B;  4MZP A;  4OVA A;  4C8Q G;  1Y71 A;  3NTH A;  1ZQ1 A;  1QVG S;  1H3Z A;  4XU1 A;  5I21 A;  2PVD B;  2KDS A;  4PJO D;  2K5F A;  1I81 A;  2LQ8 A;  5DLO A;  2BKD N;  1VQ6 A;  4ZN3 A;  1Y7X A;  3P8B B;  4XU2 A;  2X4X A;  3BW1 A;  2EIF A;  4LDW A;  4DOW A;  3JB9 D;  1U8R A;  3HRT A;  2WSE E;  2DXU A;  2EQK A;  4XTY A;  3JRZ A;  3CCV T;  4M78 C;  4C92 A;  3JSC A;  4MDW A;  3A8H B;  1FX7 A;  2R5A A;  3QBY A;  1M1G A;  2ZPF B;  4M75 A;  4M7A F;  2DXB A;  1VQ7 T;  4X9D A;  3A8M B;  2L89 A;  3C95 A;  3WVD B;  2R57 A;  4BY6 B;  4IUV A;  2E5Q A;  2LC4 A;  5J3B A;  2E41 A;  4EMK A;  5IT9 E;  1M1F A;  4M77 D;  3RKY A;  3OSV A;  1PSE A;  4M75 E;  5I2S A;  2MMP A;  2HNI A;  1HK9 A;  2PVG B;  4L6V 5;  3JCM V;  3WVE B;  4PLL A;  3M56 A;  1XTD A;  3LGF A;  3SWN A;  5GMK m;  3JCM f;  3CBP A;  3LWI A;  2HBP A;  2L3R A;  4NS5 A;  3CC4 T;  1VQ6 T;  4L59 A;  1UGS B;  3QKJ A;  2E10 A;  5CIU A;  2EQU A;  3HKS A;  4TVR A;  3OYI A;  3CME A;  1M90 C;  2MWP A;  3A8L B;  3QG1 A;  3SDZ A;  4J7F A;  5FRO A;  4HCB A;  4M75 G;  3C12 A;  3OS5 A;  3OYM A;  2DKG A;  3OYA A;  3PIO A;  5GAM g;  1KD1 C;  4M7A D;  2ZPE B;  3HSB A;  4Y91 A;  4E7L A;  5GAN 5;  4N4I A;  4M78 B;  3LLR A;  4C0Z A;  3V8J A;  4OGC A;  4FU6 A;  3A8G B;  3CXC S;  1Q7Y U;  1ZBX A;  4ATO A;  4M7D A;  2K5I A;  2EWN A;  2FB7 A;  4P5N A;  4X9C A;  4BI3 A;  5GAN d;  1Q82 C;  4F7U B;  2QEX T;  2K3Y A;  4HKE A;  2H3J A;  4PJO F;  5CR2 A;  1KC8 C;  2OTL T;  3V7R A;  3J7A F;  5EG2 A;  5GAO r;  3OSS C;  1QVG A;  3OA6 A;  4JUV A;  4KUI A;  2JZ2 A;  5CCA A;  3VKI A;  3RES A;  2ZGW A;  1JRI A;  1W4S A;  4M77 A;  1QVP A;  4GY5 A;  2QQB A;  2KAF A;  3CBM A;  4ELY C;  5GAN e;  3CMA A;  4ME7 A;  3LWH A;  1B34 A;  4JRP A;  1WQ7 A;  4XK8 E;  4M77 E;  3S3O A;  3EFS A;  4HT8 A;  1KQS S;  3HP9 A;  3HHT B;  3JB9 G;  4XTU A;  3JCM W;  4PKC C;  4ZN1 A;  3MEU A;  1NE8 A;  3M55 A;  2VYT A;  4HA8 A;  4F7U F;  3L42 A;  3QPH A;  5KH6 A;  4B9X A;  3I56 T;  4O6J A;  1G3S A;  1WJS A;  2ZPH B;  3JCM h;  3M4G A;  3L2Q A;  2HAX A;  2M1H A;  3JCM X;  4KBM B;  5HK3 A;  4RCC A;  2BUD A;  2R5M A;  3JB9 I;  4HCC A;  4J83 A;  4E7I A;  4M7A A;  5LJ3 j;  1D3B B;  2QQA A;  3CCE T;  2E65 A;  2A7Y A;  1YIJ T;  3LGL A;  4M77 G;  2K3X A;  3VV0 A;  3L2W A;  5GAN 3;  4R55 A;  2DIG A;  4JRK A;  1VQ9 A;  3QYG B;  4ZGE B;  5A0L A;  4C0F A;  4M7A E;  2RD1 A;  3RKW A;  1HXD A;  4FSX A;  4N0A A;  4NL2 A;  3PT9 A;  4M78 D;  3X25 B;  4UC4 A;  1K73 U;  2PUO B;  3P8H A;  2CZ7 B;  3DB3 A;  1QP2 A;  4QVZ A;  4YTL A;  1WQW A;  3GNF B;  4J6W A;  1KG1 A;  3F70 A;  2PVO B;  1DJ7 B;  3VUB A;  5AYF A;  1WJQ A;  3CCM A;  3JB9 F;  3RER A;  3OS2 A;  1UB4 A;  1Y96 B;  1WGS A;  3CCU A;  3SD4 A;  1YJ9 A;  1M9S A;  3C94 A;  4MDX A;  2DTO A;  3HFO A;  3JCM J;  4LD9 K;  3JCM b;  2VV5 A;  4KT0 E;  4J6X A;  4OF1 A;  3CXC A;  4M7A G;  1NJI U;  2ZCF B;  4E47 A;  2EJF A;  2RK2 A;  4IUR A;  1YIT A;  3MET A;  4JS5 A;  3OYH A;  2DIQ A;  4QW2 A;  3TU4 K;  3MO8 A;  3X26 B;  2OTJ T;  1K9M U;  3L2V A;  2Y4Y A;  2E1H A;  1VQ8 T;  2X4W A;  4A54 A;  5GAO l;  2GF7 A;  2Y90 A;  1UGQ B;  1K8A U;  2CZ0 B;  3J81 E;  5CKF A;  4D6W A;  4IUQ A;  2ZPB B;  2DXC A;  5LJ5 f;  4PJO A;  4BUG A;  2X4Y A;  3JB9 H;  1JJ2 A;  2RB6 A;  4EMG A;  4Q5W A;  5LJ3 d;  1YHQ T;  4PL6 A;  2FYK A;  3CC7 T;  3PFS A;  1XNI A;  4OB2 B;  4C5E A;  5D6Y A;  3GPL A;  5GAN j;  4Y28 E;  3RKX A;  4ZTF A;  1YJW T;  1U1T A;  1KQS A;  4ZGJ B;  5CKD A;  1VUB A;  4PJO E;  3M4Y A;  4OGE A;  1BI3 A;  5C0M A;  3HRU A;  2DZ9 A;  5LJ3 g;  3QDR B;  3QYH B;  1Q86 U;  1N9R A;  2V8I A;  3MP8 A;  3OYE A;  1Q7Y C;  3HRS A;  5KCO A;  3SB2 A;  4O5V A;  4DOV A;  2EAY A;  3A8O B;  1LJO A;  5LJ3 e;  2E6Z A;  3M59 A;  4C92 C;  2QA4 A;  4JLG A;  3FC3 A;  4F7U A;  3H8Z A;  1S72 A;  3FJP A;  4M78 E;  3LH0 A;  4PJO G;  5A0G A;  3OYL A;  1VQL A;  4V2S A;  5GMK e;  2K4Y A;  2HQE A;  4BE2 A;  1VQO A;  5GAM h;  3S6W A;  1SSF A;  3OYJ A;  4A4K A;  2DTH A;  3CCQ A;  4F7U E;  3HPW A;  3BDU A;  3BY7 A;  3A5Z B;  3LYI A;  3ZBD A;  2DEQ A;  5DY9 A;  4C5I A;  2RO0 A;  3JCM Q;  4E7K A;  1QP3 A;  4CRI A;  1NPR A;  3MEV A;  2O4X B;  3SFM A;  2GQV A;  3ME9 A;  5CQX A;  2DPP B;  2A3L A;  2EJ9 A;  2RHZ A;  3ER0 A;  1WJR A;  3CCR A;  3V8K A;  4IKF A;  2D0Q B;  4J7I A;  4M78 G;  3CPW A;  3CCJ A;  4KUD K;  3OS0 A;  3LW5 E;  1YI2 A;  1W2B A;  1OZ3 A;  2DZC A;  2LNV A;  2VUB A;  4FT4 A;  2VC8 A;  3R6O A;  2O01 E;  2M9U A;  2G3R A;  4X34 A;  5GMK l;  4E7J A;  3M58 A;  1VQO T;  4F7U G;  1VQP A;  3L2Z A;  4J5Y A;  1I4K 1;  4FL6 A;  2X4J A;  1KHI A;  3L1A A;  2V8J A;  3PIP A;  3G4S A;  2CZ1 B;  3CME T;  1EIF A;  5LJ5 h;  3EAE A;  3OMG A;  2FL7 A;  4XU3 A;  2RJE A;  1D3B A;  1UGP B;  4MML A;  4J6Y A;  4RG8 A;  4C92 B;  2YHT A;  3UWN A;  5CQY A;  4M7D C;  1VIE A;  4L5G A;  3VUZ A;  1VQ4 A;  5FU7 C;  1GXI E;  1VQN A;  3CD6 A;  5GAN g;  3CPF A;  1KQ2 A;  1JJ2 S;  1H64 1;  4II1 A;  1N8R U;  4C5H A;  1OYX A;  1R8O B;  2F69 A;  4A4F A;  5FLX E;  4M78 F;  1K73 C;  5L8R E;  2B8A A;  2K5L A;  4BD3 A;  2CGH A;  3M53 A;  3OS1 A;  3G4S T;  2C06 A;  5DLQ E;  2PUK B;  2L5Q A;  1IZ6 A;  3G6E A;  1X6O A;  4M77 C;  2LRQ A;  2X35 A;  4C0G A;  4MZM A;  3MP1 A;  2XID A;  4HT9 A;  3M9Q A;  2VGN A;  2CKK A;  2E6N A;  2DD4 A;  2XDB A;  2DAQ A;  1NJI C;  2JUF A;  3PNW C;  3FIF A;  1BKB A;  4XQ3 A;  2QI2 A;  3BDL A;  4JDS A;  4XTX A;  2LT4 A;  3QZ5 B;  2GCX A;  2RI5 A;  2LVM A;  3M5A A;  1Q81 C;  1K9M C;  3CMA T;  1JBM A;  2JOY A;  3M54 A;  4BI4 A;  3ZEH A;  3AHU A;  3CCS A;  4JRQ A;  2CYZ B;  4B9W A;  3BFM A;  3DLM A;  2M16 A;  5GMK j;  5LJ5 e;  1M5Q 1;  3PGG A;  1K8A C;  2XK0 A;  1RL2 A;  4BE1 A;  3E9F A;  3I55 A;  5C6S A;  5KE3 A;  4OB0 B;  1N27 A;  2RHU A;  4Z02 A;  3OMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...