2VYTA

The mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
RDDFHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQMNTSSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Malignant Brain Tumor Repeats of Human Scml2 Bind to Peptides Containing Monomethylated Lysine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SEX COMB ON MIDLEG-LIKE PROTEIN 2
total genus 53
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vytA01
3CEYA 1MHNA 4BACA 5D6XA 4BDZA 5KCOA 2LDMA 3DLMA 3META 2BIVA 3OQ5A 3P8DA 4PL6A 5C0MA 3NTIA 3OYEA 2YRVA 2JTFA 3OS0A 1KHCA 5J39A 1OZ3A 3OYMA 3H8ZA 4C5HA 2RJFA 5D6WA 4IUPA 2R58A 4NS5A 3MEVA 4X34A 2LTOA 3E9FA 3S6WA 5KE2A 3OYFA 3L2UA 2EQUA 1XNIA 4BE0A 2EQJA 2F5KA 4QQ6A 3NTKA 3UT1A 2IG0A 4GY5A 4BD3A 3OYJA 4E7JA 2HQEA 1OZ2A 2LVMA 2RJDA 3PFSA 2FHDA 4IUUA 4C5IA 3PMIA 3H6ZA 4A4EA 4QVZA 3Q1JA 2B8AA 4IKFA 4B9WA 4OVAA 3LLRA 3FLGA 4ZTFA 2G3RA 5FROA 2BUDA 3GOXA 2LCCA 2RHIA 4FU6A 2QQRA 3OA6A 3UWNA 2PQWA 2O4XB 3F70A 4QQGA 3ZEHA 4A4HA 3C4SA 3FEOA 5KE3A 4E7IA 4E7KA 4E7HA 4E7LA 1WJQA 4BE2A 2LRQA 3L2VA 4QW2A 2DAQA 3OS1A 2GF7A 3OB9A 4CRIA 3QJ6A 4N4IA 5KH6A 4L59A 5M9OA 3MEAA 2RI5A 3O8VA 3OMGA 4IURA 3L2WA 3S3MA 4Z02A 1OYXA 2M16A 2X4XA 3LX7A 3PNWC 3P8HA 3LYIA 4A4FA 2RI3A 3E9GA 2WACA 1WGSA 2K3YA 3MO8A 1OI1A 4PLIA 4B9XA 3OYHA 3EAEA 4FL6A 4PLLA 2JZ2A 1N27A 4RG2A 5D6YA 2RJCA 2X35A 5J26A 1G5VA 2X4YA 3OS2A 4HCZA 3LGLA 4IUVA 3NTHA 2EQKA 3L2RA 2GFAA 2QQSA 2RHZA 3LGFA 2E5QA 2CKKA 2MWPA 3OYLA 4ZTJA 1SSFA 3MP8A 2MWOA 3KUFA 3OYGA 2EKOA 3QKJA 3DB3A 3OYBA 2DIQA 2EFIA 5IN1A 4IUTA 3OYNA 2EQMA 3M9QA 2M1HA 4BDYA 5FRMA 2RHXA 2R5AA 3OYDA 3S3NA 1WJSA 2O4XA 3ASKA 2L8DA 3SD4A 2R5MA 2P0KA 2X4WA 2RI2A 5C6SA 2RO0A 2RHUA 4BE1A 3L2QA 2K3XA 2E6NA 5FRNA 3S3OA 4UC4A 3L42A 4Q5WA 5IAYA 4EDUA 3QBYA 3MEWA 3PMTA 3OY9A 3OYAA 4C5EA 3FDRA 4N4HA 4QQDA 2DIGA 2M0OA 2XK0A 3FC3A 3LH0A 2R57A 2NLUA 3BDLA 3MEUA 2GFUA 4A4GA 2RJEA 2XDPA 2L89A 3QIIA 1H3ZA 2HQXA 3OYIA 4C5GA 3ME9A 3OYCA 2VYTA 1RI0A 3MP6A 4LD6A 3DB4A 2L3RA 5CIUA 4II1A 3OMCA 2D9TA 3MP1A 4IUQA 4N4GA 3OYKA 1WJRA 2RHYA 5KCHA 2BKDN
chains in the Genus database with same CATH superfamily
2HEQA 4MMKA 1UB4A 2JNGA 4CI0C 2RF0A 3E19A 1VQ7A 4F7UF 2FRYA 2YDLA 1WXUA 4RTVA 5KYUA 3L2UA 4LDYA 3G6ET 3GPLA 5HCKA 4WTOB 2F69A 4M7AG 2EYXA 2X51A 1VQ4Q 2LCCA 3CPFA 4PNOA 4PJJA 3U23A 1VQMA 5GAMj 3UA6A 2DERA 4E7SA 2HL3A 1ZBJA 2KY9A 1VQ8Q 4QVCA 3VV0A 3QDFA 4CRIA 2RM4A 3S3MA 1PWTA 5FWBA 4XTUA 1D0ZA 3CCVA 2WACA 1R77A 1NEBA 2HMAA 4FL6A 3CCSQ 1QVGP 2CUDA 1GFCA 2KEAA 5LL6S 3NTHA 4M75C 2DA9A 2QI2A 3OYBA 1JJ2P 2EQMA 3ER0A 5FRMA 1K73R 1WHJA 5GANg 1TS9A 3CCMA 2AIRB 1VQ6A 1QCFA 2CH4W 1OULA 4LE9A 4CC3A 3L42A 1VQLA 2XG8D 1T3SA 3A8GB 3OY9A 3OYAA 2YUPA 3FC3A 3VU3C 1WYXA 2O9VA 5DY9A 1M5Q1 1FYNA 2OTLQ 1KQSP 3EFOB 2HKNA 2F2WA 1X6OA 1WPYA 3DB4A 2EYQA 5CIUA 3RBBB 1VOMA 3G71T 4II1A 2RD1A 1VQPT 3BDUA 1C0MA 4BDZA 2MIOA 2XD0A 1R0BG 2BIVA 5C0MA 1YJ9T 4LXCA 2YRVA 2DVEA 1IXDA 1VQLQ 1QP2A 4PJLA 1W6XA 3VUZA 4PJOD 1MUZA 1MGQA 2V8KA 4OMNA 4BD3A 1R0CB 4HCCA 3CCEQ 2PTKA 1QCOA 2QTVA 2QQAA 4M78D 4LDXA 3GOXA 2A0FB 3JV3A 1Z9QA 3UF4A 2AKLA 3HPWA 1M90C 2KI7A 2DAQA 5KH6A 5CR2A 1AHJB 3EHQA 2LCSA 3OMGA 1BBZA 2MI6A 1C6VX 4OB2B 3M0PA 5DM7R 4OP0A 4XU0A 5IHIA 2KRNA 3HRUA 1K9MC 1VQ8A 2B86A 2L3SA 4PJOF 3LGLA 2CKKA 1UE9A 4C92B 1QCNA 2XKOC 1I5LA 5HKCA 2LP5A 1Q81R 2COZA 2P4TA 1YCYA 1R8OB 2AZSA 1Q86U 1KC8U 2RI2A 1WHKA 4M75G 4Z8AA 4XQ3A 4EMGA 5GANf 1BI1A 4UC4A 4EDUA 3GF5A 2F1LA 3A8LB 2KT1A 4MDXA 2KYBA 5CKDA 5FWCA 1K0XA 1GRIA 2LNVA 1ZUUA 1I81A 1TTHB 5GANd 1WNLA 2VGMA 4M7DG 5LJ5g 2GQIA 4PJOA 3VS2A 3CCLA 3OMCA 3MP1A 4IUQA 3HHTB 4MMLA 2GQVA 4M75A 5KCOA 3CCRA 1NJIC 3I5RA 4JLIA 4BI8B 1TUDA 2KRSA 2RPNA 2RJFA 2M51A 3NGPA 3OW2S 3S6WA 2I2LA 1A0NB 1N8RC 3REBB 1WHLA 4VUBA 1WXBA 2OAUA 1VQMQ 3RESA 2DYIA 1PKSA 2JS2A 4RKUE 3REAB 4E7IA 2HZYA 2J06A 4BUGA 4JLGA 2HQHA 4PKCC 2XMFA 3CCQA 2WSCE 1NJIR 1OYXA 1IRXA 4M7DB 5GAOl 1X69A 2FEIA 4PJOG 2OTLT 2YSQA 1JU5C 3VS1A 4C8QA 1WDXA 5GAOn 4GLKA 4FYVB 4M7DD 4J7FA 4C0GA 2EFIA 4M7AD 4C0DB 4BDYA 2F5TX 1ABQA 1X2KA 2O88A 1LJOA 4D8KA 2VV5A 2QQBA 3EG9B 3GBQA 3TU4K 3JCMJ 2GCXA 2IIMA 1I07A 2RA2A 1QLYA 4F17A 4MDWA 1PKTA 2LZ6B 1W2BS 2VKNA 3RMSA 1O9SA 1XQHA 2O01E 3VS5A 5CO7A 3X25B 5CQXA 5I2SA 1TOVA 2L3QA 3WVEB 3M53A 2QA4T 1J3TA 1KD1U 3CEYA 1G2BA 2DRKA 1TUCA 2ED1A 1OX8A 1G3SA 2LX9A 1QVGA 3SFMA 2CZ7B 1VQNT 2OJ2A 4JRIA 1SPKA 4FIBA 3OSVA 3FB9A 1YJWT 1K73U 1K76A 3VS3A 1HD3A 2RJDA 3J81E 1Q82U 3Q1JA 4JRKA 2LQNA 1GBRA 1S72A 1ZUYA 4M7AF 1YJNA 3UWNA 4QQGA 2E6ZA 4L5GA 4A54A 2COYA 4KT0E 4YTLA 4F7UA 1AOJA 4M4ZA 4C92C 4M7AC 3OS1A 3A1PA 3M4YA 2E5KA 4ELZC 4Z02A 4C8QB 5KYWB 5LJ3j 3MO8A 4B9XA 4PLIA 4C92E 1JXMA 1SHFA 1N27A 1MMDA 3JB9F 3TCJA 1G8XA 5AYFA 2MOXA 3BW1A 5LJ3g 1VQ9T 1QMCA 4XTYA 2EKOA 3M0QA 3EFOA 1QW1A 1ZHIA 2CSIA 3OYDA 3PVQA 1YHQA 1YITA 5EG2A 4F7UE 3TVTA 2OX7A 2XU8A 2XDDA 2K4YA 5C6SA 4BE1A 2ENMA 1CKBA 3TQ7P 3JCMf 2AKKA 4J9IA 4CC4B 3CCSA 4FSSA 1GL5A 3SWNC 2JS0A 1N9RA 2MF2A 3CCUT 2QDLA 2KBTA 3ME9A 1GXIE 3M5AA 1K8AU 3M0RA 2H3JA 3OS5A 4J9GA 4EMKC 1CSKA 5FU6B 1T0HA 4P5NA 4XTXA 1LNXA 1UJYA 1Y57A 1KHCA 5GAOp 3H8ZA 1ABOA 2LQWA 2EYZA 2R58A 1B07A 4QT7A 3UT1A 4EMKA 3QZ5B 3OYJA 4CC2A 4DEXA 1RAEB 2DMOA 1ZSGA 2E70A 4F7UB 5D7UA 1WQWA 1X43A 4C92A 3C4SA 1MMGA 2DO3A 2DTIA 3I55Q 1RAGB 4DOWA 5GMKi 1S72T 1E7OA 4C0DC 2M16A 4QVDA 5CKFA 1OU9A 3QSUA 2EKHA 1BCOA 1VQPQ 3V8LA 4M7DA 1CKAA 3JCMb 1TXQA 3CMAQ 2QEXA 2M1HA 4V2SA 4M78F 1ZX6A 3O5ZA 3JCMh 1SKUB 1BCMA 1QVFP 3SWNA 4KH0B 1DJ7B 1LPLA 3QBYA 3MCAB 4FYXB 4M7AA 2XIDA 4WCIA 1BKBA 4AFUC 1B34A 2LT1A 3G4SA 2K5IA 2WSFE 3G7ZA 4LDWA 2HQXA 4C8QE 2FO0A 3QWYA 1RI0A 1UGSB 1AWJA 2ZPHB 3CC4T 4XK8E 1AZEA 1BK2A 2PUKB 1WJRA 2V1QA 1G83A 3X20B 3RMQA 3LWHA 3P8DA 3NTIA 3QWXX 4E6RA 3E9FA 2K3BA 4J7IA 1VUBA 2P84A 5GAOr 2VASA 4E7JA 4C5IA 2CREA 2H3EB 5LJ3h 1UFFA 3H6ZA 1ZUKA 1VQ4A 2ZPGB 2D8HA 3JRZA 2NUPB 2E65A 4LNPA 3ZEHA 4J9CA 5CVIA 1VQ9Q 2VB6A 1D3BA 3JCMg 2BE7D 3CCRQ 4FT2A 2RQUA 3L2WA 1Y0MA 3RR6A 3V7SA 4M75B 2PU9B 1O75A 1EFNA 1GCQA 1IO6A 1KG1A 1NEGA 2ROTA 1FMKA 1YP5A 1VQLT 3RKWA 3ZBDA 4HCZA 1VQ6Q 2EBPA 3PE0A 3QHSA 4M77F 2MWPA 3OYLA 3V7RA 2HBPA 5GAMg 3UDCA 1VQKA 3CCJA 3G1JA 2GGRA 2RHXA 1PD1A 1YBYA 3S3NA 2MMPA 2YWWA 2CP0A 1OPLA 4A4KA 3JCMV 5FRNA 2HCKA 1KJWA 1SRMA 2AZVA 2JN0A 1JEGA 1ZA1B 1M90U 5GAN6 3LH0A 4TVRA 4ZGEB 1SF9A 2XDPA 1VYVA 4M7DE 3HSBA 2FG0A 3RIRA 3RNJA 5GMKl 3SDZA 5CAIA 1UECA 2XI9A 3EG3A 3MKDA 5KYUB 3LWIA 3T9NA 3OYKA 1ZBXA 2E10A 3CMEA 2BKDN 3CC7T 5I22A 1VQ5T 2DILA 5IHNA 1VQMT 2KR3A 8ATCB 1OZ3A 2DTHA 3JCMe 2JM8A 2CSQA 4NS5A 2J6KA 1U1TA 2JUFA 2EQUA 1Q81U 2I0NA 4HVUA 2KGTA 4GY5A 4BY6B 3E1SA 4X1VA 3VYGA 4JZ3A 2B8AA 5GAN3 4KBMB 4ZTFA 3CCEA 4DEYA 1W2BA 3UATA 2EGAA 1GFDA 4OMPA 4OMOA 1K8AR 3RKXA 2KE9A 4EMKB 5IT9E 4E7ZA 4OMMA 4ELYC 3MEAA 2AHJB 4IURA 4CC7A 2RQTA 1PRMC 2DX1A 2X4XA 1D0YA 1QP3A 3V7CA 6AT1B 4AFSC 4J6XA 1YI2A 1LOJA 3EAEA 3VS4A 2EQKA 4RMOA 2DRMA 1SSFA 3MP8A 1WA7A 3OYGA 3QKJA 2DIQA 4IUTA 1X27A 2EJFA 4M75F 1ACMB 3A98A 3JB9J 1SG5A 3JB9I 2RQRA 3G4SQ 3R6OA 5GAN4 1XOVA 2RO0A 5GMKj 3G71Q 3WVDB 2O31A 2EWNA 2JT4A 2DL7A 2DLPA 2M9UA 4PJMA 5GJVB 4C5EA 2XK0A 1HK9A 4EPCA 1OV3A 3M0TA 4RTWA 5CKHA 4M77E 3EG0A 1BI2A 2OTJT 1MMNA 4KGXB 4JS5A 2YRCA 1VQ6T 5CQYA 1ZA2B 1KFZA 3JSCA 1VQKT 4OMQA 2EYWA 3I35A 2DNUA 3P8BB 2FYKA 3UPUA 3PGGA 1UHCA 3IQLA 2LJ0A 3L2ZA 3RUXA 1M9SA 3CD6Q 3CMET 5FU6C 1YITQ 3M57A 3GLXA 3KXTA 1NE8A 3R6NA 3EG1A 2JMCA 1KQ1A 1NPRA 4LUEA 1U06A 2FHDA 2EIFA 4Y28E 5LJ5f 2E41A 4OVAA 1RI9A 2RHIA 3HFOA 4FU6A 1JBMA 3DKMA 2O4XB 1F1BB 3F70A 3WXMB 5KE3A 3CD6T 2P4RA 5FW9A 4R0KA 1BI3A 3DLLA 1WX6A 1H641 3RDVA 4L59A 1YJWQ 2RI5A 4J83A 2HAXA 2D0QB 3UA7A 4BI3A 3BY7A 4ZGJB 2IVWA 5GAN7 2HSEB 2CH4A 4F7UG 2JZ2A 2X35A 5J26A 2X4YA 2K79A 3CCMT 4A53A 1H92A 1UUEA 1Q7YR 1UDLA 2DEUA 3QYGB 3OYNA 4ORZA 1K73C 4NL3A 2L8DA 2QA4A 1YJ9A 4NL2A 2R5MA 2FPEA 2ZGWA 1UTIA 2DF6A 2KRMA 3JCMW 1KK7A 3NFCA 4M77A 4XAXB 2E6NA 5IAYA 1OX9A 1Q82R 1VQ8T 1OOTA 4OF1A 1E6HA 2DIGA 3M56A 2O2OA 3I55A 2DXCA 4BI4A 1VQ4T 2L89A 4RG8A 2K2MA 4AG2C 3OBYA 4DBRA 1RLPC 2GTJA 1WHHA 2KROA 1RAIB 2LT4A 2V1RA 1MNDA 1KSWA 2DZCA 2QASA 2QTXA 5GAN8 3META 2E64A 4XTWA 3OYEA 3CMAA 7AT1B 3M59A 3OYMA 1TH7A 3A8OB 5GAOq 2EAYA 1Y71A 2P0PA 3ZFJA 2L5QA 2C0IA 4BB7A 3CCLT 2EJ9A 2LX7A 1WHGA 2OI3A 4QVZA 2YLCA 3FLGA 1YIJQ 4JUVA 5I21A 2VVKA 1YFNA 4E7HA 4E7LA 5GAMd 1K0SA 2FPFA 4M77D 4O5VA 1PSEA 2LJ1A 2DKGA 3QO3A 1KD1R 3D7SB 1M4ZA 3OW2A 3RKYA 2LJ3A 5D6YA 2RJCA 3PT9A 2RHZA 1YJWA 2E5QA 2F2VA 3I55T 4KGVB 1YHQQ 4OMLA 1YWOA 2BZYA 1V29B 3THKA 1YJNT 4M77G 1M1KC 3C0CA 2SRCA 1QKWA 4DQ2A 1MV3A 3VYHB 3CCQQ 3MEWA 4N0AC 5GAN5 1M3BA 1D0XA 1KQ2A 3FDRA 1ZSZA 1X01A 3HRTA 4ZN3A 3JCMd 2EW3A 1P92A 4M78C 4R56A 4HKEA 3OYCA 4KUDK 1UEBA 2JOYA 3EGXA 3NPFA 3CCJQ 4PFZA 4JJNK 4Z88A 1MHNA 1NYGA 1PC0A 3DLMA 1VQOQ 1LCKA 2QYZA 1QWFA 4HT9A 3HKSA 1SSHA 3CD6A 3OS0A 3X26B 4MZPA 3JB9G 2C0OA 4IUPA 4HVVA 1Y96A 5KE2A 2JM9A 2OTJA 4BE0A 2F5KA 1QVGS 2SEMA 1TWBA 5FU7C 4L6V5 2HQEA 1OZ2A 3PMIA 4A4EA 4J9FA 4ME7A 4NOYA 2BUDA 1X2QA 3CBOA 2V26A 3ULRB 1UGRB 1NZ9A 2BZXA 1JJ2A 5CKBA 2L3PA 2X3XD 2GF7A 3CC7Q 1YHQT 1M1GA 1Y07A 2ZPIB 2KMTA 1QVFA 1YWPA 4F04B 2QG9B 4X9DA 5LJ5j 1OI1A 1EIFA 4RUGA 4XTZA 1M3AA 1RL2A 3V8JA 1WXTA 3BFMA 1I0CA 2QQSA 2EVRA 3LH5A 4PFOA 4M78G 3PIPA 2DM1A 2YUQA 3DB3A 2KNBB 1PNJA 4FW2A 4OMFB 1N5ZA 4B6MA 1SEMA 2DJQA 1XJWB 2EJGA 4EMHA 1Q95G 1Q82C 2ZPBB 3VJPA 5KYXA 4PJOC 1PHTA 1I1JA 1VIEA 4LD9K 1AT1B 2A7YA 1Z9ZA 4O6JA 1M8VA 2ABLA 3I56A 3EGXB 1OPKA 1JB0E 2HBWA 2R57A 4JJCA 2JTEA 3BDLA 5A0DA 1Q86C 1KC8C 2VWFA 2KDSA 4X9CA 2C06A 3M4GA 4C8QD 3GNFB 2PUOB 3M58A 5HK0A 4M7AE 4LN2A 4N4GA 2LC4A 1MNEA 1IREB 1RAAB 1PSFA 4BACA 3CBPA 1RABB 4Y92A 2XICA 1KIKA 3VS7A 3KFVA 3VKIA 4C5HA 1TG0A 3CCMQ 2DE0X 2H8HA 4AG1C 3PIOA 3MEVA 5A2QE 2JXBA 3CQTA 3AHUA 1VQ9A 4IUUA 1Q86R 1KC8R 1X6BA 4JRQA 2D0NA 2GTOA 3NMZC 2C0TA 2FZKB 2RK2A 2DBKA 3EGUA 4WF2A 2Y90A 3EGDB 2V8JA 4RTZA 2MPXC 2O9SA 2VC8A 3C95A 1AD5A 3PNWC 3P8HA 3MPUB 3EH2A 1BB9A 3CXCP 2QXFA 3URGA 4DOVA 2HSPA 1G5VA 4Y91A 1YITT 9ATCB 5IXBA 1EX4A 1AWXA 3CPWP 1K8AC 5IXFA 1VQKQ 3FRNA 2W0ZA 4ZNXA 1OEBA 2EPDA 1AZGB 1FMVA 1RUWA 1WHMA 2BTTA 1BIAA 1HXDA 2CP6A 2P0KA 4E2FB 2PVDB 1NPPA 3CC4Q 2KVQG 2E3IA 2XDBA 3CCJT 4F14A 2D6FA 1HJDA 1JO8A 1N6AA 5GANj 2NLUA 3EFSA 2AT1B 4OB1B 2VXFA 3J80E 5GMKh 2CP5A 2MAMA 1H3ZA 3OYIA 2EYYA 2A37A 2ROLA 1IHWA 2RN8A 2VYTA 3MP6A 4HXJA 3RERA 1D1AA 3CXCA 2KSSA 4RTTA 2DXUA 2D9TA 3FJ5A 1M2VB 3HL8A 4E47A 2DXTA 3EG9A 2FZGB 2JTFA 1SHGA 3QYHB 2OTJQ 1PG5B 4HA8A 4ATOA 4M77B 3I56T 4QQ6A 2QQ9A 3TSZA 1ZQ1A 3N5BB 1QKXA 8AT1B 2FPDA 3CC2Q 4B9WA 1VIFA 1ARKA 2E12A 2G3RA 3CPWS 5FROA 4MZTA 1GCQC 2PQWA 4GBQA 4A4HA 3CCVT 1GBQA 2RQVA 3VS6A 4FYYB 2L0AA 4R55A 2LRQA 1W1FA 4QW2A 4FT4A 3M54A 3LX7A 1VQOT 5I2MA 4D6WA 4HVWA 3E9GA 2K3YA 1OQKA 1ZSZC 4XU1A 5L23A 4RG2A 3OYYA 2EGCA 1S1NA 2QK0A 3CCQT 3L2RA 1IZ6A 1KQSA 5GAMe 4RTUA 1E6GA 2DVJA 2CGHA 2HNIA 2E4HA 3E2UA 4BY6C 1SRLA 2ATCB 1LVKA 4JS4A 2HDAA 3C12A 2X4WA 3CBMA 2K7AA 2RHUA 1BI0A 1WI7A 2DPPB 1PRLC 2FL7A 3I56Q 3VRZA 3SWNB 3LW5E 2M02A 4OGCA 3CXCS 2OTLA 1KHIA 1RACB 4XU2A 1VQNA 1M2VA 1Y96B 2ZPEB 5FLXE 1AWWA 4C5GA 4DA4A 1M30A 1H3HA 3ZL7C 1JQQA 2Y4XA 4FYWB 1D1CA 4JPBW 2RHYA 3JB9H 1W70A 5LJ5d 3CCET 1YCSB 2CP2A 4PL6A 2J05A 4K11A 1KD1C 4M78B 4C92G 2BZ8A 1Q7YU 1BU1A 4LUDA 2CYZB 1N9SA 4X34A 3OYFA 1K9MR 2YUNA 2NUTB 1MMAA 4J9EA 1NM7A 3NTKA 2J7IA 5LJ5e 3PFSA 3JCMc 4IKFA 4OB0B 2J6OA 3TEEA 2DL3A 5CCAA 2OAWA 3CCUQ 2A08A 5I11A 1H8KA 3HP9A 4C8QF 2NUPA 1D09B 1M90R 3EH1A 2CT3A 2D1XA 3L2VA 3QZ9B 4J9DA 5KYYA 2D8JA 3G6EQ 1NG2A 4N4IA 5M9OA 3TREA 1D3BB 2GNCA 2RQWA 4A4FA 1VYUA 1WGSA 4PLLA 1B34B 3M0SA 2CDTA 2EGEA 2PVOB 1IGUA 1UGPB 3H0HA 3V8KA 5IHKA 2GFAA 4AMCA 2HKQB 2J6FA 1K4US 2VUBA 2K5LA 2CS7A 1I5OB 4RCCA 4XTVA 5IN1A 5DLQE 2A3LA 2R5AA 1YJ9Q 3MJXA 2JTMA 4J6WA 4J8OA 4Q5WA 2DL8A 4KRTA 1NJIU 2K5FA 1BYMA 2Y4YA 3EHRA 1T0JA 1FXXA 4DBFA 2GFUA 2QGGA 3TSWA 2RJEA 3CC7A 5GANh 3QJYA 2KQWA 2IPOB 4N0AA 3QPHA 3OW2P 4GLMA 1YI2Q 3SHWA 3EG2A 2CUBA 2KT8A 3CCLQ 2LMJA 4KUIA 3OQ5A 3VRYA 2V8IA 1M2OA 2NUTA 2L2PA 4ESRA 1V76A 3L1AA 3CCVQ 3QDRB 4PJOE 3EGDA 1WQ7A 3GP8A 3JAME 2ECZA 1M1KU 2DJZA 4PK4A 2DK3A 1UJ0A 3JCMQ 2IG0A 3I5SA 5A0GA 2LVMA 2ZPFB 3SB2A 3CMAT 4JJDA 2K57A 3H9NA 5KYYB 2X3WD 2W10A 1GCPA 2LCLA 3EFRA 3KBGA 2MYSA 3PVLA 3OA6A 1YIJA 4M7DF 3BE3A 2NYSA 3FEOA 1NBEB 1UG1A 1YI2T 4AFZC 2QEXT 5GAMf 1YNZA 4HT8A 3O8VA 3JCMX 3HTRA 3LYIA 2HL5C 4LDUA 3H41A 3QG1A 3A5ZB 3QXEB 3A8HB 3OS2A 4JRPA 1Y7XA 1TUGB 3G6EA 2GBQA 5LJ3e 5LJ5h 2JMAA 2KXCA 3M9QA 1X75C 4C0FA 3ASKA 5HK3A 1PCXA 2ZCFB 4M7AB 5A0LA 3S3OA 2DD4A 2K2VA 2JVVA 5KYXB 1M27C 4JDSA 1VQ5Q 4QQDA 5J3BA 3CPWA 1B3QA 3FJPA 2DD5A 1ZLMA 2ZAEA 3QIIA 3NHNA 1TU0B 3C94A 2RH2A 1QVFS 2CT4A 2E1HA 2A36A 4J5YA 3JB9D 2M0YA 3AT1B 2KXDA 4ANJA 4M78E 4A63B 5KCHA 2FRWA 4FM4B 1U8RA 4QKUA 4PFPA 3JCMP 2MK5A 2BE9B 1FX7A 1VQOA 4RTXA 1AVZC 1PM3A 1VQPA 5J39A 1QQJA 2LNHB 3X24B 2DL4A 2E3HA 2HD0A 1RAFB 3CCUA 2QA4Q 2LTOA 4IIOA 2QEXQ 2K6DA 2X9HA 5EC7A 4EIKA 1M3CA 2Z0WA 5HY6A 1G3WA 2LQ8A 5CKEA 3X28B 3GNGA 1IB8A 5GAOm 3HRSA 3M0UA 1RAHB 1IHVA 1YJNQ 5GAMh 1YN8A 4KULA 2QQRA 1BIBA 2DEQA 2FB7A 4E7KA 1RLQC 2ZZDA 2JJ9A 3OB9A 3QJ6A 3SEMA 1C1AA 2QGFB 1U1SA 1W4SA 4FCYA 4D8DA 2QDYB 4MZMA 3OYHA 1WZOA 4J9BA 1G3YA 1XTDA 1U3OA 4C8QC 1VQNQ 1K1ZA 4IUVA 2YRDA 3FIFA 4J6YA 2MWOA 5GMKm 1ZSZB 1VA7A 4C0ZA 2CP3A 4DBHA 4OGEA 4KGZB 5DLOA 4JZ4A 4RCBA 1VYTA 2ED0A 1YIJT 3GIBA 2PVGB 5GANe 1X6GA 3PTAA 3G71A 3CC2A 1I8FA 3CCST 2YHTA 1AEYA 1MV0B 5IH2A 3L2QA 2K3XA 1HSQA 2PZ1A 3OSSC 4XU3A 2K9GA 4C92D 1N8RU 3PMTA 2DXBA 4IIMA 1M1KR 3CCRT 4N4HA 2M0OA 4M78A 1G3TA 1RADB 2ESWA 5FU7B 2NUZA 3I9QA 3MEUA 5LJ3f 4JJBA 2YXYA 2DBMA 1JJ2S 3INZA 2QAZA 1UGQB 5GMKe 2A28A 1VQ7T 2AK5A 4DBQA 5LJ3d 5D6XA 3QUIA 2JW4A 2CZ1B 2LDMA 2COWA 1WFWA 5L8RE 1W2BP 2DFUA 1UGVA 3J7AF 3H0FA 1OU8A 5CK9A 1D1BA 3G4ST 5D6WA 2EQIA 4C92F 1XNIA 1QWEA 2EQJA 4PJOB 5ECAA 1NYFA 1KQSS 2YUOA 4M75E 1U5SA 2CP7A 3LLRA 2DYBA 2FVUA 5GAN2 2P0QA 1M8MA 4J9HA 5KYNA 1B7TA 1N8RR 1AWOA 1FWZA 2FZCB 2YLBA 2MCNA 4FSXA 2YT6A 3MHXA 1WJQA 2RMOA 4BE2A 4RTYA 1T3LA 2XHCA 1I4K1 1FMWA 4AT1B 2VXEA 5KYWA 2CZ6B 2CZ0B 2VGNA 2RI3A 4FW1A 1JRIA 4F16A 4HCKA 3VS0A 3CMEQ 2DZ9A 4AFQC 3LGFA 4PJNA 4KH1B 4M75D 4ZTJA 2DETA 3CC4A 3KUFA 1V1CA 1EZZB 3A8MB 1IGQA 1NLPC 2RK1A 2RB6A 1TSFA 1PD0A 4LDVA 1WJSA 2O4XA 1Q81C 3SD4A 1QVPA 4C8QG 1WIEA 1M1FA 3OBWA 2F2XA 2X4JA 4OB3B 1UHFA 1VQ7Q 1WLPB 2DL5A 1VQ5A 2G6FX 2RNAA 3HFNA 5AT1B 1NLOC 1S72Q 2DTOA 3VUBA 3M55A 4ZGDB 1K9MU 2KK4A 3CC2T 2KAFA 2NWMA 4A4GA 2KYMA 2WSEE 2LQKA 3H0IA 1JXOA 4HCBA 4LD6A 1HYOA 2L3RA 1K9AA 4Z89A 1Q7YC 4M77C 4ZN1A 4M7DC 5GJWB 2PNIA
chains in the Genus database with same CATH topology
3CCET 2DZCA 5FU6B 2QTXA 4MMKA 5GAN8 3META 4P5NA 4PL6A 2E64A 4XTXA 1UB4A 1LNXA 1KD1C 4XTWA 2JNGA 4M78B 3OYEA 4C92G 1KHCA 5GAOp 3CMAA 4CI0C 3E19A 3OYMA 3M59A 3H8ZA 1Q7YU 1VQ7A 1TH7A 4F7UF 2CYZB 3A8OB 5GAOq 2R58A 2EAYA 2QA4A 1N9SA 4X34A 1Y71A 3OYFA 3L2UA 4LDYA 3G6ET 3UT1A 2P0PA 3NTKA 4EMKA 3QZ5B 3OYJA 3GPLA 3ZFJA 2F69A 2L5QA 5LJ5e 3PFSA 4BB7A 3CCLT 4M7AG 2EJ9A 3JCMc 2E70A 4QVZA 2YLCA 4F7UB 4IKFA 4OB0B 3FLGA 3TEEA 5CCAA 1WQWA 4JUVA 2LCCA 5I21A 3CPFA 4PNOA 3HP9A 4C8QF 1VQMA 5GAMj 4C92A 3C4SA 4E7HA 4E7LA 2DO3A 2DTIA 5GAMd 2KY9A 4M77D 4QVCA 4O5VA 3L2VA 3QZ9B 3VV0A 4DOWA 4CRIA 5GMKi 1S72T 2RM4A 4N4IA 1PSEA 5M9OA 3TREA 3S3MA 2DKGA 1D3BB 4C0DC 4XTUA 2M16A 4QVDA 3QO3A 4A4FA 3CCVA 1M4ZA 3OW2A 2WACA 1WGSA 3RKYA 4FL6A 4PLLA 1B34B 5CKFA 5D6YA 2PVOB 2RJCA 3PT9A 1UGPB 5LL6S 3QSUA 3NTHA 3V8KA 2GFAA 2RHZA 1YJWA 2E5QA 4M75C 3V8LA 2VUBA 2K5LA 3I55T 2CS7A 4RCCA 4M7DA 2QI2A 4XTVA 3OYBA 3JCMb 5IN1A 5DLQE 2A3LA 2EQMA 2QEXA 2M1HA 3ER0A 5FRMA 2R5AA 5GANg 4V2SA 4M78F 1V29B 3CCMA 1YJNT 2JTMA 4J6WA 4M77G 3JCMh 1VQ6A 1M1KC 4J8OA 3SWNA 4DQ2A 1DJ7B 3L42A 4Q5WA 3VYHB 1VQLA 2XG8D 3MCAB 3A8GB 3MEWA 3QBYA 3OY9A 4N0AC 5GAN5 3OYAA 1NJIU 4M7AA 1KQ2A 3FDRA 2XIDA 3FC3A 1X01A 2K5FA 2HAXA 1BYMA 3VU3C 1BKBA 2Y4YA 3HRTA 1FXXA 5DY9A 1B34A 2GFUA 1M5Q1 2LT1A 4ZN3A 2K5IA 2RJEA 3JCMd 3G4SA 3CC7A 5GANh 2WSFE 1P92A 4M78C 3G7ZA 4LDWA 2HQXA 4R56A 4C8QE 3QJYA 2KQWA 1X6OA 4HKEA 3OYCA 1WPYA 4N0AA 4KUDK 1RI0A 1UEBA 1UGSB 2JOYA 3DB4A 2ZPHB 3QPHA 2EYQA 5CIUA 3G71T 3CC4T 4XK8E 4II1A 2RD1A 1VQPT 3BDUA 2PUKB 1WJRA 4JJNK 1MHNA 3X20B 4BDZA 4KUIA 3RMQA 3DLMA 2XD0A 3LWHA 2BIVA 3OQ5A 3P8DA 4HT9A 3HKSA 5C0MA 2V8IA 1YJ9T 3NTIA 3CD6A 2YRVA 2DVEA 3OS0A 3L1AA 3X26B 4MZPA 3JB9G 4PJOE 3QDRB 1WQ7A 3GP8A 1QP2A 3VUZA 3JAME 4IUPA 1Y96A 1M1KU 2DJZA 3E9FA 5KE2A 4PJOD 2DK3A 2OTJA 3JCMQ 2F5KA 4BE0A 1QVGS 2IG0A 4J7IA 1MGQA 1VUBA 2V8KA 5FU7C 4BD3A 5A0GA 5GAOr 4L6V5 2HQEA 4E7JA 1OZ2A 2LVMA 2ZPFB 4C5IA 4HCCA 3SB2A 5LJ3h 3PMIA 3CMAT 3H6ZA 4A4EA 1VQ4A 2ZPGB 2QQAA 2K57A 3JRZA 4ME7A 4M78D 4LDXA 4NOYA 2BUDA 3GOXA 2LCLA 3EFRA 2E65A 3CBOA 3KBGA 3OA6A 1YIJA 4M7DF 3ZEHA 5CVIA 3FEOA 3HPWA 1UGRB 1YI2T 1D3BA 1NZ9A 1M90C 1JJ2A 5CKBA 3JCMg 2DAQA 2QEXT 2GF7A 4FT2A 5GAMf 5KH6A 5CR2A 1YHQT 1AHJB 4HT8A 3O8VA 3OMGA 1M1GA 3L2WA 1Y07A 2ZPIB 2MI6A 3JCMX 2KMTA 4OB2B 1QVFA 3V7SA 5DM7R 3LYIA 4LDUA 4M75B 4OP0A 4X9DA 3QG1A 2PU9B 4XU0A 1O75A 5LJ5j 1OI1A 1KG1A 1EIFA 3HRUA 4XTZA 1K9MC 3A5ZB 3QXEB 1VQ8A 3A8HB 1RL2A 3OS2A 4JRPA 3RKWA 4PJOF 4HCZA 1Y7XA 3LGLA 3ZBDA 1VQLT 3V8JA 3G6EA 3BFMA 2QQSA 3QHSA 2CKKA 4M77F 2MWPA 3OYLA 4C92B 3V7RA 2HBPA 4M78G 5LJ3e 5GAMg 3PIPA 2XKOC 3DB3A 1I5LA 3UDCA 5HKCA 1VQKA 5LJ5h 3CCJA 3M9QA 4OMFB 2P4TA 1YCYA 1X75C 1R8OB 2RHXA 1YBYA 3S3NA 4C0FA 3ASKA 1Q86U 1KC8U 2MMPA 2EJGA 4EMHA 5HK3A 2ZCFB 2RI2A 4A4KA 1Q82C 2ZPBB 4M75G 3VJPA 4M7AB 4XQ3A 4EMGA 3JCMV 5A0LA 5GANf 3S3OA 5FRNA 4PJOC 1BI1A 2DD4A 2K2VA 4UC4A 1VIEA 4EDUA 3GF5A 2A7YA 2JVVA 4LD9K 3A8LB 4O6JA 1M8VA 4JDSA 2JN0A 3I56A 4QQDA 1M90U 4MDXA 5J3BA 1JB0E 5GAN6 3LH0A 5CKDA 2R57A 3CPWA 3BDLA 3FJPA 4TVRA 2LNVA 2DD5A 5A0DA 1Q86C 1KC8C 4ZGEB 2XDPA 2KDSA 3QIIA 4M7DE 3HSBA 1I81A 4X9CA 5GANd 1WNLA 3C94A 3RIRA 5GMKl 3SDZA 2C06A 3M4GA 2VGMA 2RH2A 4C8QD 5CAIA 1QVFS 2XI9A 4M7DC 4M7DG 2E1HA 3GNFB 2PUOB 5LJ5g 4J5YA 3JB9D 4PJOA 3LWIA 3CCLA 3M58A 3OMCA 5HK0A 4M7AE 3T9NA 3MP1A 4IUQA 2LC4A 3HHTB 4MMLA 4M78E 4N4GA 1ZBXA 2E10A 2GQVA 2BKDN 5KCHA 3OYKA 3CMEA 1IREB 4FM4B 3CC7T 1PSFA 1U8RA 4BACA 3CBPA 4M75A 1VQ5T 5KCOA 3CCRA 2XICA 1NJIC 1VQMT 3JCMP 1FX7A 4JLIA 1VQOA 4BI8B 1VQPA 5J39A 1OZ3A 3VKIA 4C5HA 2RJFA 2DTHA 3X24B 3JCMe 2HD0A 4NS5A 3PIOA 3CCUA 3MEVA 5A2QE 3OW2S 1U1TA 2JUFA 2LTOA 3S6WA 2I2LA 2EQUA 1N8RC 1Q81U 3AHUA 4GY5A 4BY6B 5HY6A 3X28B 1G3WA 2LQ8A 5CKEA 1VQ9A 3E1SA 3GNGA 4IUUA 4VUBA 3VYGA 5GAOm 4JRQA 2B8AA 3HRSA 5GAN3 4KBMB 4ZTFA 3CCEA 5GAMh 2OAUA 3RESA 1W2BA 4KULA 2QQRA 1BIBA 2DEQA 2FB7A 4RKUE 3RKXA 4E7IA 4BUGA 4E7KA 2RK2A 4EMKB 5IT9E 4WF2A 2Y90A 4JLGA 2V8JA 2ZZDA 3OB9A 4PKCC 3QJ6A 4ELYC 3MEAA 2WSCE 3CCQA 2AHJB 4IURA 2VC8A 3C95A 4M7DB 1OYXA 2X4XA 5GAOl 3PNWC 3P8HA 1QP3A 3V7CA 1U1SA 4PJOG 1W4SA 2OTLT 2QDYB 4MZMA 4J6XA 3OYHA 1LOJA 3EAEA 2QXFA 3URGA 4DOVA 1YI2A 1G5VA 1G3YA 1XTDA 4Y91A 4C8QC 1YITT 4IUVA 2EQKA 4RMOA 4C8QA 3FIFA 4J6YA 5GAOn 1K8AC 1SSFA 3MP8A 2MWOA 5GMKm 4GLKA 2XDDA 4C0ZA 3OYGA 4M7DD 3QKJA 3FRNA 4J7FA 4C0GA 2DIQA 4OGEA 2EFIA 4M7AD 4C0DB 4IUTA 5DLOA 4RCBA 2EJFA 4BDYA 4M75F 2F5TX 1YIJT 3JB9J 3GIBA 1BIAA 2PVGB 1HXDA 1LJOA 5GANe 3JB9I 2P0KA 3PTAA 3G71A 3R6OA 3CC2A 5GAN4 2VV5A 1I8FA 1XOVA 2RO0A 3CCST 2QQBA 2YHTA 5GMKj 3TU4K 2PVDB 1NPPA 3WVDB 2GCXA 2KVQG 3L2QA 2EWNA 2K3XA 3JCMJ 2XDBA 3CCJT 3OSSC 4XU3A 2D6FA 4C92D 1N8RU 2RA2A 2M9UA 2DXBA 3PMTA 4C5EA 3CCRT 4N4HA 4MDWA 2M0OA 2XK0A 4M78A 1N6AA 1HK9A 2NLUA 3EFSA 4EPCA 1G3TA 5FU7B 5GANj 1W2BS 3MEUA 3RMSA 5LJ3f 4OB1B 2VXFA 3J80E 1O9SA 1XQHA 2MAMA 2O01E 5CKHA 5CO7A 5GMKh 1H3ZA 3X25B 5CQXA 4M77E 3OYIA 5I2SA 1BI2A 2OTJT 3WVEB 1JJ2S 2VYTA 3M53A 4JS5A 3INZA 3MP6A 2QA4T 1VQ6T 5CQYA 3RERA 3CXCA 1UGQB 2KSSA 5GMKe 2DXUA 2D9TA 1VQ7T 3JSCA 1VQKT 5LJ3d 1KD1U 3CEYA 5D6XA 3QUIA 3HL8A 2CZ1B 2LDMA 5L8RE 4E47A 2DXTA 3P8BB 3J7AF 2FYKA 3UPUA 3PGGA 2JTFA 1G3SA 2LX9A 5CK9A 1QVGA 3L2ZA 3RUXA 1M9SA 3G4ST 3SFMA 2CZ7B 3CMET 3QYHB 5D6WA 5FU6C 1VQNT 4HA8A 4JRIA 3M57A 4ATOA 4FIBA 3OSVA 4C92F 1YJ9A 3GLXA 3KXTA 4M77B 1XNIA 3I56T 1NE8A 2EQJA 3FB9A 4QQ6A 1YJWT 1KQ1A 1NPRA 1K73U 4PJOB 2QQ9A 2RJDA 3J81E 2FHDA 2EIFA 1Q82U 1ZQ1A 3N5BB 4Y28E 1KQSS 4M75E 3Q1JA 4JRKA 5LJ5f 4B9WA 2E41A 4OVAA 1VIFA 3LLRA 1S72A 2E12A 2FVUA 2G3RA 5GAN2 5FROA 3CPWS 2RHIA 2P0QA 3HFOA 4FU6A 4M7AF 1YJNA 4MZTA 1JBMA 3DKMA 3UWNA 2PQWA 2O4XB 3F70A 4QQGA 2E6ZA 4L5GA 3WXMB 4A4HA 5KE3A 1FWZA 2YLBA 4A54A 4FSXA 3CCVT 3CD6T 3MHXA 4KT0E 4YTLA 1WJQA 1BI3A 4F7UA 3DLLA 4BE2A 4R55A 2LRQA 4C92C 4M7AC 4QW2A 1H641 3OS1A 2XHCA 1I4K1 4L59A 3M4YA 2RI5A 4FT4A 4J83A 4ELZC 2VXEA 2D0QB 3M54A 4Z02A 4BI3A 4C8QB 2CZ6B 3BY7A 2CZ0B 2IVWA 3LX7A 2VGNA 5I2MA 2RI3A 4D6WA 4ZGJB 1VQOT 1JRIA 5GAN7 3E9GA 2K3YA 3MO8A 5LJ3j 4B9XA 4PLIA 4C92E 4XU1A 4F7UG 1N27A 2JZ2A 4RG2A 2X35A 5J26A 3OYYA 2X4YA 3JB9F 3TCJA 5AYFA 3CCMT 3CCQT 3L2RA 1IZ6A 4A53A 3BW1A 2DZ9A 5GAMe 5LJ3g 1KQSA 3LGFA 1VQ9T 4M75D 4ZTJA 3CC4A 4XTYA 3KUFA 2EKOA 3A8MB 3QYGB 3OYNA 2CGHA 2HNIA 2RK1A 1QW1A 1ZHIA 4BY6C 1K73C 2RB6A 4NL3A 4LDVA 3OYDA 1WJSA 2O4XA 1YITA 1YHQA 1Q81C 4JS4A 2L8DA 3C12A 3SD4A 4NL2A 1QVPA 2R5MA 2X4WA 3CBMA 2XU8A 5EG2A 4C8QG 2ZGWA 2K4YA 4F7UE 5C6SA 2RHUA 1BI0A 2DPPB 4BE1A 3NFCA 3JCMW 4M77A 1M1FA 3OBWA 4XAXB 2E6NA 2X4JA 4OB3B 2FL7A 5IAYA 1VQ5A 3SWNB 4OF1A 3LW5E 1VQ8T 3HFNA 2DTOA 3VUBA 3M55A 3JCMf 2DIGA 4ZGDB 4OGCA 1K9MU 3M56A 3CXCS 2KK4A 3I55A 3CC2T 2DXCA 2KAFA 2OTLA 3CCSA 4A4GA 1KHIA 4BI4A 1VQ4T 2L89A 4RG8A 1N9RA 4XU2A 2MF2A 3SWNC 2WSEE 1Y96B 2LQKA 2ZPEB 5FLXE 3CCUT 1VQNA 4C5GA 3OBYA 3ME9A 4HCBA 4DA4A 1GXIE 4LD6A 2L3RA 2Y4XA 3M5AA 1K8AU 1Q7YC 2LT4A 4M77C 4ZN1A 2RHYA 2H3JA 3OS5A 3JB9H 4EMKC 5LJ5d
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEY A;  1MHN A;  4BAC A;  5D6X A;  4BDZ A;  5KCO A;  2LDM A;  3DLM A;  3MET A;  2BIV A;  3OQ5 A;  3P8D A;  4PL6 A;  5C0M A;  3NTI A;  3OYE A;  2YRV A;  2JTF A;  3OS0 A;  1KHC A;  5J39 A;  1OZ3 A;  3OYM A;  3H8Z A;  4C5H A;  2RJF A;  5D6W A;  4IUP A;  2R58 A;  4NS5 A;  3MEV A;  4X34 A;  2LTO A;  3E9F A;  3S6W A;  5KE2 A;  3OYF A;  3L2U A;  2EQU A;  1XNI A;  4BE0 A;  2EQJ A;  2F5K A;  4QQ6 A;  3NTK A;  3UT1 A;  2IG0 A;  4GY5 A;  4BD3 A;  3OYJ A;  4E7J A;  2HQE A;  1OZ2 A;  2LVM A;  2RJD A;  3PFS A;  2FHD A;  4IUU A;  4C5I A;  3PMI A;  3H6Z A;  4A4E A;  4QVZ A;  3Q1J A;  2B8A A;  4IKF A;  4B9W A;  4OVA A;  3LLR A;  3FLG A;  4ZTF A;  2G3R A;  5FRO A;  2BUD A;  3GOX A;  2LCC A;  2RHI A;  4FU6 A;  2QQR A;  3OA6 A;  3UWN A;  2PQW A;  2O4X B;  3F70 A;  4QQG A;  3ZEH A;  4A4H A;  3C4S A;  3FEO A;  5KE3 A;  4E7I A;  4E7K A;  4E7H A;  4E7L A;  1WJQ A;  4BE2 A;  2LRQ A;  3L2V A;  4QW2 A;  2DAQ A;  3OS1 A;  2GF7 A;  3OB9 A;  4CRI A;  3QJ6 A;  4N4I A;  5KH6 A;  4L59 A;  5M9O A;  3MEA A;  2RI5 A;  3O8V A;  3OMG A;  4IUR A;  3L2W A;  3S3M A;  4Z02 A;  1OYX A;  2M16 A;  2X4X A;  3LX7 A;  3PNW C;  3P8H A;  3LYI A;  4A4F A;  2RI3 A;  3E9G A;  2WAC A;  1WGS A;  2K3Y A;  3MO8 A;  1OI1 A;  4PLI A;  4B9X A;  3OYH A;  3EAE A;  4FL6 A;  4PLL A;  2JZ2 A;  1N27 A;  4RG2 A;  5D6Y A;  2RJC A;  2X35 A;  5J26 A;  1G5V A;  2X4Y A;  3OS2 A;  4HCZ A;  3LGL A;  4IUV A;  3NTH A;  2EQK A;  3L2R A;  2GFA A;  2QQS A;  2RHZ A;  3LGF A;  2E5Q A;  2CKK A;  2MWP A;  3OYL A;  4ZTJ A;  1SSF A;  3MP8 A;  2MWO A;  3KUF A;  3OYG A;  2EKO A;  3QKJ A;  3DB3 A;  3OYB A;  2DIQ A;  2EFI A;  5IN1 A;  4IUT A;  3OYN A;  2EQM A;  3M9Q A;  2M1H A;  4BDY A;  5FRM A;  2RHX A;  2R5A A;  3OYD A;  3S3N A;  1WJS A;  2O4X A;  3ASK A;  2L8D A;  3SD4 A;  2R5M A;  2P0K A;  2X4W A;  2RI2 A;  5C6S A;  2RO0 A;  2RHU A;  4BE1 A;  3L2Q A;  2K3X A;  2E6N A;  5FRN A;  3S3O A;  4UC4 A;  3L42 A;  4Q5W A;  5IAY A;  4EDU A;  3QBY A;  3MEW A;  3PMT A;  3OY9 A;  3OYA A;  4C5E A;  3FDR A;  4N4H A;  4QQD A;  2DIG A;  2M0O A;  2XK0 A;  3FC3 A;  3LH0 A;  2R57 A;  2NLU A;  3BDL A;  3MEU A;  2GFU A;  4A4G A;  2RJE A;  2XDP A;  2L89 A;  3QII A;  1H3Z A;  2HQX A;  3OYI A;  4C5G A;  3ME9 A;  3OYC A;  2VYT A;  1RI0 A;  3MP6 A;  4LD6 A;  3DB4 A;  2L3R A;  5CIU A;  4II1 A;  3OMC A;  2D9T A;  3MP1 A;  4IUQ A;  4N4G A;  3OYK A;  1WJR A;  2RHY A;  5KCH A;  2BKD N; 
#chains in the Genus database with same CATH topology
 2HEQ A;  4MMK A;  1UB4 A;  2JNG A;  4CI0 C;  2RF0 A;  3E19 A;  1VQ7 A;  4F7U F;  2FRY A;  2YDL A;  1WXU A;  4RTV A;  5KYU A;  3L2U A;  4LDY A;  3G6E T;  3GPL A;  5HCK A;  4WTO B;  2F69 A;  4M7A G;  2EYX A;  2X51 A;  1VQ4 Q;  2LCC A;  3CPF A;  4PNO A;  4PJJ A;  3U23 A;  1VQM A;  5GAM j;  3UA6 A;  2DER A;  4E7S A;  2HL3 A;  1ZBJ A;  2KY9 A;  1VQ8 Q;  4QVC A;  3VV0 A;  3QDF A;  4CRI A;  2RM4 A;  3S3M A;  1PWT A;  5FWB A;  4XTU A;  1D0Z A;  3CCV A;  2WAC A;  1R77 A;  1NEB A;  2HMA A;  4FL6 A;  3CCS Q;  1QVG P;  2CUD A;  1GFC A;  2KEA A;  5LL6 S;  3NTH A;  4M75 C;  2DA9 A;  2QI2 A;  3OYB A;  1JJ2 P;  2EQM A;  3ER0 A;  5FRM A;  1K73 R;  1WHJ A;  5GAN g;  1TS9 A;  3CCM A;  2AIR B;  1VQ6 A;  1QCF A;  2CH4 W;  1OUL A;  4LE9 A;  4CC3 A;  3L42 A;  1VQL A;  2XG8 D;  1T3S A;  3A8G B;  3OY9 A;  3OYA A;  2YUP A;  3FC3 A;  3VU3 C;  1WYX A;  2O9V A;  5DY9 A;  1M5Q 1;  1FYN A;  2OTL Q;  1KQS P;  3EFO B;  2HKN A;  2F2W A;  1X6O A;  1WPY A;  3DB4 A;  2EYQ A;  5CIU A;  3RBB B;  1VOM A;  3G71 T;  4II1 A;  2RD1 A;  1VQP T;  3BDU A;  1C0M A;  4BDZ A;  2MIO A;  2XD0 A;  1R0B G;  2BIV A;  5C0M A;  1YJ9 T;  4LXC A;  2YRV A;  2DVE A;  1IXD A;  1VQL Q;  1QP2 A;  4PJL A;  1W6X A;  3VUZ A;  4PJO D;  1MUZ A;  1MGQ A;  2V8K A;  4OMN A;  4BD3 A;  1R0C B;  4HCC A;  3CCE Q;  2PTK A;  1QCO A;  2QTV A;  2QQA A;  4M78 D;  4LDX A;  3GOX A;  2A0F B;  3JV3 A;  1Z9Q A;  3UF4 A;  2AKL A;  3HPW A;  1M90 C;  2KI7 A;  2DAQ A;  5KH6 A;  5CR2 A;  1AHJ B;  3EHQ A;  2LCS A;  3OMG A;  1BBZ A;  2MI6 A;  1C6V X;  4OB2 B;  3M0P A;  5DM7 R;  4OP0 A;  4XU0 A;  5IHI A;  2KRN A;  3HRU A;  1K9M C;  1VQ8 A;  2B86 A;  2L3S A;  4PJO F;  3LGL A;  2CKK A;  1UE9 A;  4C92 B;  1QCN A;  2XKO C;  1I5L A;  5HKC A;  2LP5 A;  1Q81 R;  2COZ A;  2P4T A;  1YCY A;  1R8O B;  2AZS A;  1Q86 U;  1KC8 U;  2RI2 A;  1WHK A;  4M75 G;  4Z8A A;  4XQ3 A;  4EMG A;  5GAN f;  1BI1 A;  4UC4 A;  4EDU A;  3GF5 A;  2F1L A;  3A8L B;  2KT1 A;  4MDX A;  2KYB A;  5CKD A;  5FWC A;  1K0X A;  1GRI A;  2LNV A;  1ZUU A;  1I81 A;  1TTH B;  5GAN d;  1WNL A;  2VGM A;  4M7D G;  5LJ5 g;  2GQI A;  4PJO A;  3VS2 A;  3CCL A;  3OMC A;  3MP1 A;  4IUQ A;  3HHT B;  4MML A;  2GQV A;  4M75 A;  5KCO A;  3CCR A;  1NJI C;  3I5R A;  4JLI A;  4BI8 B;  1TUD A;  2KRS A;  2RPN A;  2RJF A;  2M51 A;  3NGP A;  3OW2 S;  3S6W A;  2I2L A;  1A0N B;  1N8R C;  3REB B;  1WHL A;  4VUB A;  1WXB A;  2OAU A;  1VQM Q;  3RES A;  2DYI A;  1PKS A;  2JS2 A;  4RKU E;  3REA B;  4E7I A;  2HZY A;  2J06 A;  4BUG A;  4JLG A;  2HQH A;  4PKC C;  2XMF A;  3CCQ A;  2WSC E;  1NJI R;  1OYX A;  1IRX A;  4M7D B;  5GAO l;  1X69 A;  2FEI A;  4PJO G;  2OTL T;  2YSQ A;  1JU5 C;  3VS1 A;  4C8Q A;  1WDX A;  5GAO n;  4GLK A;  4FYV B;  4M7D D;  4J7F A;  4C0G A;  2EFI A;  4M7A D;  4C0D B;  4BDY A;  2F5T X;  1ABQ A;  1X2K A;  2O88 A;  1LJO A;  4D8K A;  2VV5 A;  2QQB A;  3EG9 B;  3GBQ A;  3TU4 K;  3JCM J;  2GCX A;  2IIM A;  1I07 A;  2RA2 A;  1QLY A;  4F17 A;  4MDW A;  1PKT A;  2LZ6 B;  1W2B S;  2VKN A;  3RMS A;  1O9S A;  1XQH A;  2O01 E;  3VS5 A;  5CO7 A;  3X25 B;  5CQX A;  5I2S A;  1TOV A;  2L3Q A;  3WVE B;  3M53 A;  2QA4 T;  1J3T A;  1KD1 U;  3CEY A;  1G2B A;  2DRK A;  1TUC A;  2ED1 A;  1OX8 A;  1G3S A;  2LX9 A;  1QVG A;  3SFM A;  2CZ7 B;  1VQN T;  2OJ2 A;  4JRI A;  1SPK A;  4FIB A;  3OSV A;  3FB9 A;  1YJW T;  1K73 U;  1K76 A;  3VS3 A;  1HD3 A;  2RJD A;  3J81 E;  1Q82 U;  3Q1J A;  4JRK A;  2LQN A;  1GBR A;  1S72 A;  1ZUY A;  4M7A F;  1YJN A;  3UWN A;  4QQG A;  2E6Z A;  4L5G A;  4A54 A;  2COY A;  4KT0 E;  4YTL A;  4F7U A;  1AOJ A;  4M4Z A;  4C92 C;  4M7A C;  3OS1 A;  3A1P A;  3M4Y A;  2E5K A;  4ELZ C;  4Z02 A;  4C8Q B;  5KYW B;  5LJ3 j;  3MO8 A;  4B9X A;  4PLI A;  4C92 E;  1JXM A;  1SHF A;  1N27 A;  1MMD A;  3JB9 F;  3TCJ A;  1G8X A;  5AYF A;  2MOX A;  3BW1 A;  5LJ3 g;  1VQ9 T;  1QMC A;  4XTY A;  2EKO A;  3M0Q A;  3EFO A;  1QW1 A;  1ZHI A;  2CSI A;  3OYD A;  3PVQ A;  1YHQ A;  1YIT A;  5EG2 A;  4F7U E;  3TVT A;  2OX7 A;  2XU8 A;  2XDD A;  2K4Y A;  5C6S A;  4BE1 A;  2ENM A;  1CKB A;  3TQ7 P;  3JCM f;  2AKK A;  4J9I A;  4CC4 B;  3CCS A;  4FSS A;  1GL5 A;  3SWN C;  2JS0 A;  1N9R A;  2MF2 A;  3CCU T;  2QDL A;  2KBT A;  3ME9 A;  1GXI E;  3M5A A;  1K8A U;  3M0R A;  2H3J A;  3OS5 A;  4J9G A;  4EMK C;  1CSK A;  5FU6 B;  1T0H A;  4P5N A;  4XTX A;  1LNX A;  1UJY A;  1Y57 A;  1KHC A;  5GAO p;  3H8Z A;  1ABO A;  2LQW A;  2EYZ A;  2R58 A;  1B07 A;  4QT7 A;  3UT1 A;  4EMK A;  3QZ5 B;  3OYJ A;  4CC2 A;  4DEX A;  1RAE B;  2DMO A;  1ZSG A;  2E70 A;  4F7U B;  5D7U A;  1WQW A;  1X43 A;  4C92 A;  3C4S A;  1MMG A;  2DO3 A;  2DTI A;  3I55 Q;  1RAG B;  4DOW A;  5GMK i;  1S72 T;  1E7O A;  4C0D C;  2M16 A;  4QVD A;  5CKF A;  1OU9 A;  3QSU A;  2EKH A;  1BCO A;  1VQP Q;  3V8L A;  4M7D A;  1CKA A;  3JCM b;  1TXQ A;  3CMA Q;  2QEX A;  2M1H A;  4V2S A;  4M78 F;  1ZX6 A;  3O5Z A;  3JCM h;  1SKU B;  1BCM A;  1QVF P;  3SWN A;  4KH0 B;  1DJ7 B;  1LPL A;  3QBY A;  3MCA B;  4FYX B;  4M7A A;  2XID A;  4WCI A;  1BKB A;  4AFU C;  1B34 A;  2LT1 A;  3G4S A;  2K5I A;  2WSF E;  3G7Z A;  4LDW A;  2HQX A;  4C8Q E;  2FO0 A;  3QWY A;  1RI0 A;  1UGS B;  1AWJ A;  2ZPH B;  3CC4 T;  4XK8 E;  1AZE A;  1BK2 A;  2PUK B;  1WJR A;  2V1Q A;  1G83 A;  3X20 B;  3RMQ A;  3LWH A;  3P8D A;  3NTI A;  3QWX X;  4E6R A;  3E9F A;  2K3B A;  4J7I A;  1VUB A;  2P84 A;  5GAO r;  2VAS A;  4E7J A;  4C5I A;  2CRE A;  2H3E B;  5LJ3 h;  1UFF A;  3H6Z A;  1ZUK A;  1VQ4 A;  2ZPG B;  2D8H A;  3JRZ A;  2NUP B;  2E65 A;  4LNP A;  3ZEH A;  4J9C A;  5CVI A;  1VQ9 Q;  2VB6 A;  1D3B A;  3JCM g;  2BE7 D;  3CCR Q;  4FT2 A;  2RQU A;  3L2W A;  1Y0M A;  3RR6 A;  3V7S A;  4M75 B;  2PU9 B;  1O75 A;  1EFN A;  1GCQ A;  1IO6 A;  1KG1 A;  1NEG A;  2ROT A;  1FMK A;  1YP5 A;  1VQL T;  3RKW A;  3ZBD A;  4HCZ A;  1VQ6 Q;  2EBP A;  3PE0 A;  3QHS A;  4M77 F;  2MWP A;  3OYL A;  3V7R A;  2HBP A;  5GAM g;  3UDC A;  1VQK A;  3CCJ A;  3G1J A;  2GGR A;  2RHX A;  1PD1 A;  1YBY A;  3S3N A;  2MMP A;  2YWW A;  2CP0 A;  1OPL A;  4A4K A;  3JCM V;  5FRN A;  2HCK A;  1KJW A;  1SRM A;  2AZV A;  2JN0 A;  1JEG A;  1ZA1 B;  1M90 U;  5GAN 6;  3LH0 A;  4TVR A;  4ZGE B;  1SF9 A;  2XDP A;  1VYV A;  4M7D E;  3HSB A;  2FG0 A;  3RIR A;  3RNJ A;  5GMK l;  3SDZ A;  5CAI A;  1UEC A;  2XI9 A;  3EG3 A;  3MKD A;  5KYU B;  3LWI A;  3T9N A;  3OYK A;  1ZBX A;  2E10 A;  3CME A;  2BKD N;  3CC7 T;  5I22 A;  1VQ5 T;  2DIL A;  5IHN A;  1VQM T;  2KR3 A;  8ATC B;  1OZ3 A;  2DTH A;  3JCM e;  2JM8 A;  2CSQ A;  4NS5 A;  2J6K A;  1U1T A;  2JUF A;  2EQU A;  1Q81 U;  2I0N A;  4HVU A;  2KGT A;  4GY5 A;  4BY6 B;  3E1S A;  4X1V A;  3VYG A;  4JZ3 A;  2B8A A;  5GAN 3;  4KBM B;  4ZTF A;  3CCE A;  4DEY A;  1W2B A;  3UAT A;  2EGA A;  1GFD A;  4OMP A;  4OMO A;  1K8A R;  3RKX A;  2KE9 A;  4EMK B;  5IT9 E;  4E7Z A;  4OMM A;  4ELY C;  3MEA A;  2AHJ B;  4IUR A;  4CC7 A;  2RQT A;  1PRM C;  2DX1 A;  2X4X A;  1D0Y A;  1QP3 A;  3V7C A;  6AT1 B;  4AFS C;  4J6X A;  1YI2 A;  1LOJ A;  3EAE A;  3VS4 A;  2EQK A;  4RMO A;  2DRM A;  1SSF A;  3MP8 A;  1WA7 A;  3OYG A;  3QKJ A;  2DIQ A;  4IUT A;  1X27 A;  2EJF A;  4M75 F;  1ACM B;  3A98 A;  3JB9 J;  1SG5 A;  3JB9 I;  2RQR A;  3G4S Q;  3R6O A;  5GAN 4;  1XOV A;  2RO0 A;  5GMK j;  3G71 Q;  3WVD B;  2O31 A;  2EWN A;  2JT4 A;  2DL7 A;  2DLP A;  2M9U A;  4PJM A;  5GJV B;  4C5E A;  2XK0 A;  1HK9 A;  4EPC A;  1OV3 A;  3M0T A;  4RTW A;  5CKH A;  4M77 E;  3EG0 A;  1BI2 A;  2OTJ T;  1MMN A;  4KGX B;  4JS5 A;  2YRC A;  1VQ6 T;  5CQY A;  1ZA2 B;  1KFZ A;  3JSC A;  1VQK T;  4OMQ A;  2EYW A;  3I35 A;  2DNU A;  3P8B B;  2FYK A;  3UPU A;  3PGG A;  1UHC A;  3IQL A;  2LJ0 A;  3L2Z A;  3RUX A;  1M9S A;  3CD6 Q;  3CME T;  5FU6 C;  1YIT Q;  3M57 A;  3GLX A;  3KXT A;  1NE8 A;  3R6N A;  3EG1 A;  2JMC A;  1KQ1 A;  1NPR A;  4LUE A;  1U06 A;  2FHD A;  2EIF A;  4Y28 E;  5LJ5 f;  2E41 A;  4OVA A;  1RI9 A;  2RHI A;  3HFO A;  4FU6 A;  1JBM A;  3DKM A;  2O4X B;  1F1B B;  3F70 A;  3WXM B;  5KE3 A;  3CD6 T;  2P4R A;  5FW9 A;  4R0K A;  1BI3 A;  3DLL A;  1WX6 A;  1H64 1;  3RDV A;  4L59 A;  1YJW Q;  2RI5 A;  4J83 A;  2HAX A;  2D0Q B;  3UA7 A;  4BI3 A;  3BY7 A;  4ZGJ B;  2IVW A;  5GAN 7;  2HSE B;  2CH4 A;  4F7U G;  2JZ2 A;  2X35 A;  5J26 A;  2X4Y A;  2K79 A;  3CCM T;  4A53 A;  1H92 A;  1UUE A;  1Q7Y R;  1UDL A;  2DEU A;  3QYG B;  3OYN A;  4ORZ A;  1K73 C;  4NL3 A;  2L8D A;  2QA4 A;  1YJ9 A;  4NL2 A;  2R5M A;  2FPE A;  2ZGW A;  1UTI A;  2DF6 A;  2KRM A;  3JCM W;  1KK7 A;  3NFC A;  4M77 A;  4XAX B;  2E6N A;  5IAY A;  1OX9 A;  1Q82 R;  1VQ8 T;  1OOT A;  4OF1 A;  1E6H A;  2DIG A;  3M56 A;  2O2O A;  3I55 A;  2DXC A;  4BI4 A;  1VQ4 T;  2L89 A;  4RG8 A;  2K2M A;  4AG2 C;  3OBY A;  4DBR A;  1RLP C;  2GTJ A;  1WHH A;  2KRO A;  1RAI B;  2LT4 A;  2V1R A;  1MND A;  1KSW A;  2DZC A;  2QAS A;  2QTX A;  5GAN 8;  3MET A;  2E64 A;  4XTW A;  3OYE A;  3CMA A;  7AT1 B;  3M59 A;  3OYM A;  1TH7 A;  3A8O B;  5GAO q;  2EAY A;  1Y71 A;  2P0P A;  3ZFJ A;  2L5Q A;  2C0I A;  4BB7 A;  3CCL T;  2EJ9 A;  2LX7 A;  1WHG A;  2OI3 A;  4QVZ A;  2YLC A;  3FLG A;  1YIJ Q;  4JUV A;  5I21 A;  2VVK A;  1YFN A;  4E7H A;  4E7L A;  5GAM d;  1K0S A;  2FPF A;  4M77 D;  4O5V A;  1PSE A;  2LJ1 A;  2DKG A;  3QO3 A;  1KD1 R;  3D7S B;  1M4Z A;  3OW2 A;  3RKY A;  2LJ3 A;  5D6Y A;  2RJC A;  3PT9 A;  2RHZ A;  1YJW A;  2E5Q A;  2F2V A;  3I55 T;  4KGV B;  1YHQ Q;  4OML A;  1YWO A;  2BZY A;  1V29 B;  3THK A;  1YJN T;  4M77 G;  1M1K C;  3C0C A;  2SRC A;  1QKW A;  4DQ2 A;  1MV3 A;  3VYH B;  3CCQ Q;  3MEW A;  4N0A C;  5GAN 5;  1M3B A;  1D0X A;  1KQ2 A;  3FDR A;  1ZSZ A;  1X01 A;  3HRT A;  4ZN3 A;  3JCM d;  2EW3 A;  1P92 A;  4M78 C;  4R56 A;  4HKE A;  3OYC A;  4KUD K;  1UEB A;  2JOY A;  3EGX A;  3NPF A;  3CCJ Q;  4PFZ A;  4JJN K;  4Z88 A;  1MHN A;  1NYG A;  1PC0 A;  3DLM A;  1VQO Q;  1LCK A;  2QYZ A;  1QWF A;  4HT9 A;  3HKS A;  1SSH A;  3CD6 A;  3OS0 A;  3X26 B;  4MZP A;  3JB9 G;  2C0O A;  4IUP A;  4HVV A;  1Y96 A;  5KE2 A;  2JM9 A;  2OTJ A;  4BE0 A;  2F5K A;  1QVG S;  2SEM A;  1TWB A;  5FU7 C;  4L6V 5;  2HQE A;  1OZ2 A;  3PMI A;  4A4E A;  4J9F A;  4ME7 A;  4NOY A;  2BUD A;  1X2Q A;  3CBO A;  2V26 A;  3ULR B;  1UGR B;  1NZ9 A;  2BZX A;  1JJ2 A;  5CKB A;  2L3P A;  2X3X D;  2GF7 A;  3CC7 Q;  1YHQ T;  1M1G A;  1Y07 A;  2ZPI B;  2KMT A;  1QVF A;  1YWP A;  4F04 B;  2QG9 B;  4X9D A;  5LJ5 j;  1OI1 A;  1EIF A;  4RUG A;  4XTZ A;  1M3A A;  1RL2 A;  3V8J A;  1WXT A;  3BFM A;  1I0C A;  2QQS A;  2EVR A;  3LH5 A;  4PFO A;  4M78 G;  3PIP A;  2DM1 A;  2YUQ A;  3DB3 A;  2KNB B;  1PNJ A;  4FW2 A;  4OMF B;  1N5Z A;  4B6M A;  1SEM A;  2DJQ A;  1XJW B;  2EJG A;  4EMH A;  1Q95 G;  1Q82 C;  2ZPB B;  3VJP A;  5KYX A;  4PJO C;  1PHT A;  1I1J A;  1VIE A;  4LD9 K;  1AT1 B;  2A7Y A;  1Z9Z A;  4O6J A;  1M8V A;  2ABL A;  3I56 A;  3EGX B;  1OPK A;  1JB0 E;  2HBW A;  2R57 A;  4JJC A;  2JTE A;  3BDL A;  5A0D A;  1Q86 C;  1KC8 C;  2VWF A;  2KDS A;  4X9C A;  2C06 A;  3M4G A;  4C8Q D;  3GNF B;  2PUO B;  3M58 A;  5HK0 A;  4M7A E;  4LN2 A;  4N4G A;  2LC4 A;  1MNE A;  1IRE B;  1RAA B;  1PSF A;  4BAC A;  3CBP A;  1RAB B;  4Y92 A;  2XIC A;  1KIK A;  3VS7 A;  3KFV A;  3VKI A;  4C5H A;  1TG0 A;  3CCM Q;  2DE0 X;  2H8H A;  4AG1 C;  3PIO A;  3MEV A;  5A2Q E;  2JXB A;  3CQT A;  3AHU A;  1VQ9 A;  4IUU A;  1Q86 R;  1KC8 R;  1X6B A;  4JRQ A;  2D0N A;  2GTO A;  3NMZ C;  2C0T A;  2FZK B;  2RK2 A;  2DBK A;  3EGU A;  4WF2 A;  2Y90 A;  3EGD B;  2V8J A;  4RTZ A;  2MPX C;  2O9S A;  2VC8 A;  3C95 A;  1AD5 A;  3PNW C;  3P8H A;  3MPU B;  3EH2 A;  1BB9 A;  3CXC P;  2QXF A;  3URG A;  4DOV A;  2HSP A;  1G5V A;  4Y91 A;  1YIT T;  9ATC B;  5IXB A;  1EX4 A;  1AWX A;  3CPW P;  1K8A C;  5IXF A;  1VQK Q;  3FRN A;  2W0Z A;  4ZNX A;  1OEB A;  2EPD A;  1AZG B;  1FMV A;  1RUW A;  1WHM A;  2BTT A;  1BIA A;  1HXD A;  2CP6 A;  2P0K A;  4E2F B;  2PVD B;  1NPP A;  3CC4 Q;  2KVQ G;  2E3I A;  2XDB A;  3CCJ T;  4F14 A;  2D6F A;  1HJD A;  1JO8 A;  1N6A A;  5GAN j;  2NLU A;  3EFS A;  2AT1 B;  4OB1 B;  2VXF A;  3J80 E;  5GMK h;  2CP5 A;  2MAM A;  1H3Z A;  3OYI A;  2EYY A;  2A37 A;  2ROL A;  1IHW A;  2RN8 A;  2VYT A;  3MP6 A;  4HXJ A;  3RER A;  1D1A A;  3CXC A;  2KSS A;  4RTT A;  2DXU A;  2D9T A;  3FJ5 A;  1M2V B;  3HL8 A;  4E47 A;  2DXT A;  3EG9 A;  2FZG B;  2JTF A;  1SHG A;  3QYH B;  2OTJ Q;  1PG5 B;  4HA8 A;  4ATO A;  4M77 B;  3I56 T;  4QQ6 A;  2QQ9 A;  3TSZ A;  1ZQ1 A;  3N5B B;  1QKX A;  8AT1 B;  2FPD A;  3CC2 Q;  4B9W A;  1VIF A;  1ARK A;  2E12 A;  2G3R A;  3CPW S;  5FRO A;  4MZT A;  1GCQ C;  2PQW A;  4GBQ A;  4A4H A;  3CCV T;  1GBQ A;  2RQV A;  3VS6 A;  4FYY B;  2L0A A;  4R55 A;  2LRQ A;  1W1F A;  4QW2 A;  4FT4 A;  3M54 A;  3LX7 A;  1VQO T;  5I2M A;  4D6W A;  4HVW A;  3E9G A;  2K3Y A;  1OQK A;  1ZSZ C;  4XU1 A;  5L23 A;  4RG2 A;  3OYY A;  2EGC A;  1S1N A;  2QK0 A;  3CCQ T;  3L2R A;  1IZ6 A;  1KQS A;  5GAM e;  4RTU A;  1E6G A;  2DVJ A;  2CGH A;  2HNI A;  2E4H A;  3E2U A;  4BY6 C;  1SRL A;  2ATC B;  1LVK A;  4JS4 A;  2HDA A;  3C12 A;  2X4W A;  3CBM A;  2K7A A;  2RHU A;  1BI0 A;  1WI7 A;  2DPP B;  1PRL C;  2FL7 A;  3I56 Q;  3VRZ A;  3SWN B;  3LW5 E;  2M02 A;  4OGC A;  3CXC S;  2OTL A;  1KHI A;  1RAC B;  4XU2 A;  1VQN A;  1M2V A;  1Y96 B;  2ZPE B;  5FLX E;  1AWW A;  4C5G A;  4DA4 A;  1M30 A;  1H3H A;  3ZL7 C;  1JQQ A;  2Y4X A;  4FYW B;  1D1C A;  4JPB W;  2RHY A;  3JB9 H;  1W70 A;  5LJ5 d;  3CCE T;  1YCS B;  2CP2 A;  4PL6 A;  2J05 A;  4K11 A;  1KD1 C;  4M78 B;  4C92 G;  2BZ8 A;  1Q7Y U;  1BU1 A;  4LUD A;  2CYZ B;  1N9S A;  4X34 A;  3OYF A;  1K9M R;  2YUN A;  2NUT B;  1MMA A;  4J9E A;  1NM7 A;  3NTK A;  2J7I A;  5LJ5 e;  3PFS A;  3JCM c;  4IKF A;  4OB0 B;  2J6O A;  3TEE A;  2DL3 A;  5CCA A;  2OAW A;  3CCU Q;  2A08 A;  5I11 A;  1H8K A;  3HP9 A;  4C8Q F;  2NUP A;  1D09 B;  1M90 R;  3EH1 A;  2CT3 A;  2D1X A;  3L2V A;  3QZ9 B;  4J9D A;  5KYY A;  2D8J A;  3G6E Q;  1NG2 A;  4N4I A;  5M9O A;  3TRE A;  1D3B B;  2GNC A;  2RQW A;  4A4F A;  1VYU A;  1WGS A;  4PLL A;  1B34 B;  3M0S A;  2CDT A;  2EGE A;  2PVO B;  1IGU A;  1UGP B;  3H0H A;  3V8K A;  5IHK A;  2GFA A;  4AMC A;  2HKQ B;  2J6F A;  1K4U S;  2VUB A;  2K5L A;  2CS7 A;  1I5O B;  4RCC A;  4XTV A;  5IN1 A;  5DLQ E;  2A3L A;  2R5A A;  1YJ9 Q;  3MJX A;  2JTM A;  4J6W A;  4J8O A;  4Q5W A;  2DL8 A;  4KRT A;  1NJI U;  2K5F A;  1BYM A;  2Y4Y A;  3EHR A;  1T0J A;  1FXX A;  4DBF A;  2GFU A;  2QGG A;  3TSW A;  2RJE A;  3CC7 A;  5GAN h;  3QJY A;  2KQW A;  2IPO B;  4N0A A;  3QPH A;  3OW2 P;  4GLM A;  1YI2 Q;  3SHW A;  3EG2 A;  2CUB A;  2KT8 A;  3CCL Q;  2LMJ A;  4KUI A;  3OQ5 A;  3VRY A;  2V8I A;  1M2O A;  2NUT A;  2L2P A;  4ESR A;  1V76 A;  3L1A A;  3CCV Q;  3QDR B;  4PJO E;  3EGD A;  1WQ7 A;  3GP8 A;  3JAM E;  2ECZ A;  1M1K U;  2DJZ A;  4PK4 A;  2DK3 A;  1UJ0 A;  3JCM Q;  2IG0 A;  3I5S A;  5A0G A;  2LVM A;  2ZPF B;  3SB2 A;  3CMA T;  4JJD A;  2K57 A;  3H9N A;  5KYY B;  2X3W D;  2W10 A;  1GCP A;  2LCL A;  3EFR A;  3KBG A;  2MYS A;  3PVL A;  3OA6 A;  1YIJ A;  4M7D F;  3BE3 A;  2NYS A;  3FEO A;  1NBE B;  1UG1 A;  1YI2 T;  4AFZ C;  2QEX T;  5GAM f;  1YNZ A;  4HT8 A;  3O8V A;  3JCM X;  3HTR A;  3LYI A;  2HL5 C;  4LDU A;  3H41 A;  3QG1 A;  3A5Z B;  3QXE B;  3A8H B;  3OS2 A;  4JRP A;  1Y7X A;  1TUG B;  3G6E A;  2GBQ A;  5LJ3 e;  5LJ5 h;  2JMA A;  2KXC A;  3M9Q A;  1X75 C;  4C0F A;  3ASK A;  5HK3 A;  1PCX A;  2ZCF B;  4M7A B;  5A0L A;  3S3O A;  2DD4 A;  2K2V A;  2JVV A;  5KYX B;  1M27 C;  4JDS A;  1VQ5 Q;  4QQD A;  5J3B A;  3CPW A;  1B3Q A;  3FJP A;  2DD5 A;  1ZLM A;  2ZAE A;  3QII A;  3NHN A;  1TU0 B;  3C94 A;  2RH2 A;  1QVF S;  2CT4 A;  2E1H A;  2A36 A;  4J5Y A;  3JB9 D;  2M0Y A;  3AT1 B;  2KXD A;  4ANJ A;  4M78 E;  4A63 B;  5KCH A;  2FRW A;  4FM4 B;  1U8R A;  4QKU A;  4PFP A;  3JCM P;  2MK5 A;  2BE9 B;  1FX7 A;  1VQO A;  4RTX A;  1AVZ C;  1PM3 A;  1VQP A;  5J39 A;  1QQJ A;  2LNH B;  3X24 B;  2DL4 A;  2E3H A;  2HD0 A;  1RAF B;  3CCU A;  2QA4 Q;  2LTO A;  4IIO A;  2QEX Q;  2K6D A;  2X9H A;  5EC7 A;  4EIK A;  1M3C A;  2Z0W A;  5HY6 A;  1G3W A;  2LQ8 A;  5CKE A;  3X28 B;  3GNG A;  1IB8 A;  5GAO m;  3HRS A;  3M0U A;  1RAH B;  1IHV A;  1YJN Q;  5GAM h;  1YN8 A;  4KUL A;  2QQR A;  1BIB A;  2DEQ A;  2FB7 A;  4E7K A;  1RLQ C;  2ZZD A;  2JJ9 A;  3OB9 A;  3QJ6 A;  3SEM A;  1C1A A;  2QGF B;  1U1S A;  1W4S A;  4FCY A;  4D8D A;  2QDY B;  4MZM A;  3OYH A;  1WZO A;  4J9B A;  1G3Y A;  1XTD A;  1U3O A;  4C8Q C;  1VQN Q;  1K1Z A;  4IUV A;  2YRD A;  3FIF A;  4J6Y A;  2MWO A;  5GMK m;  1ZSZ B;  1VA7 A;  4C0Z A;  2CP3 A;  4DBH A;  4OGE A;  4KGZ B;  5DLO A;  4JZ4 A;  4RCB A;  1VYT A;  2ED0 A;  1YIJ T;  3GIB A;  2PVG B;  5GAN e;  1X6G A;  3PTA A;  3G71 A;  3CC2 A;  1I8F A;  3CCS T;  2YHT A;  1AEY A;  1MV0 B;  5IH2 A;  3L2Q A;  2K3X A;  1HSQ A;  2PZ1 A;  3OSS C;  4XU3 A;  2K9G A;  4C92 D;  1N8R U;  3PMT A;  2DXB A;  4IIM A;  1M1K R;  3CCR T;  4N4H A;  2M0O A;  4M78 A;  1G3T A;  1RAD B;  2ESW A;  5FU7 B;  2NUZ A;  3I9Q A;  3MEU A;  5LJ3 f;  4JJB A;  2YXY A;  2DBM A;  1JJ2 S;  3INZ A;  2QAZ A;  1UGQ B;  5GMK e;  2A28 A;  1VQ7 T;  2AK5 A;  4DBQ A;  5LJ3 d;  5D6X A;  3QUI A;  2JW4 A;  2CZ1 B;  2LDM A;  2COW A;  1WFW A;  5L8R E;  1W2B P;  2DFU A;  1UGV A;  3J7A F;  3H0F A;  1OU8 A;  5CK9 A;  1D1B A;  3G4S T;  5D6W A;  2EQI A;  4C92 F;  1XNI A;  1QWE A;  2EQJ A;  4PJO B;  5ECA A;  1NYF A;  1KQS S;  2YUO A;  4M75 E;  1U5S A;  2CP7 A;  3LLR A;  2DYB A;  2FVU A;  5GAN 2;  2P0Q A;  1M8M A;  4J9H A;  5KYN A;  1B7T A;  1N8R R;  1AWO A;  1FWZ A;  2FZC B;  2YLB A;  2MCN A;  4FSX A;  2YT6 A;  3MHX A;  1WJQ A;  2RMO A;  4BE2 A;  4RTY A;  1T3L A;  2XHC A;  1I4K 1;  1FMW A;  4AT1 B;  2VXE A;  5KYW A;  2CZ6 B;  2CZ0 B;  2VGN A;  2RI3 A;  4FW1 A;  1JRI A;  4F16 A;  4HCK A;  3VS0 A;  3CME Q;  2DZ9 A;  4AFQ C;  3LGF A;  4PJN A;  4KH1 B;  4M75 D;  4ZTJ A;  2DET A;  3CC4 A;  3KUF A;  1V1C A;  1EZZ B;  3A8M B;  1IGQ A;  1NLP C;  2RK1 A;  2RB6 A;  1TSF A;  1PD0 A;  4LDV A;  1WJS A;  2O4X A;  1Q81 C;  3SD4 A;  1QVP A;  4C8Q G;  1WIE A;  1M1F A;  3OBW A;  2F2X A;  2X4J A;  4OB3 B;  1UHF A;  1VQ7 Q;  1WLP B;  2DL5 A;  1VQ5 A;  2G6F X;  2RNA A;  3HFN A;  5AT1 B;  1NLO C;  1S72 Q;  2DTO A;  3VUB A;  3M55 A;  4ZGD B;  1K9M U;  2KK4 A;  3CC2 T;  2KAF A;  2NWM A;  4A4G A;  2KYM A;  2WSE E;  2LQK A;  3H0I A;  1JXO A;  4HCB A;  4LD6 A;  1HYO A;  2L3R A;  1K9A A;  4Z89 A;  1Q7Y C;  4M77 C;  4ZN1 A;  4M7D C;  5GJW B;  2PNI A; 
#chains in the Genus database with same CATH homology
 3CCE T;  2DZC A;  5FU6 B;  2QTX A;  4MMK A;  5GAN 8;  3MET A;  4P5N A;  4PL6 A;  2E64 A;  4XTX A;  1UB4 A;  1LNX A;  1KD1 C;  4XTW A;  2JNG A;  4M78 B;  3OYE A;  4C92 G;  1KHC A;  5GAO p;  3CMA A;  4CI0 C;  3E19 A;  3OYM A;  3M59 A;  3H8Z A;  1Q7Y U;  1VQ7 A;  1TH7 A;  4F7U F;  2CYZ B;  3A8O B;  5GAO q;  2R58 A;  2EAY A;  2QA4 A;  1N9S A;  4X34 A;  1Y71 A;  3OYF A;  3L2U A;  4LDY A;  3G6E T;  3UT1 A;  2P0P A;  3NTK A;  4EMK A;  3QZ5 B;  3OYJ A;  3GPL A;  3ZFJ A;  2F69 A;  2L5Q A;  5LJ5 e;  3PFS A;  4BB7 A;  3CCL T;  4M7A G;  2EJ9 A;  3JCM c;  2E70 A;  4QVZ A;  2YLC A;  4F7U B;  4IKF A;  4OB0 B;  3FLG A;  3TEE A;  5CCA A;  1WQW A;  4JUV A;  2LCC A;  5I21 A;  3CPF A;  4PNO A;  3HP9 A;  4C8Q F;  1VQM A;  5GAM j;  4C92 A;  3C4S A;  4E7H A;  4E7L A;  2DO3 A;  2DTI A;  5GAM d;  2KY9 A;  4M77 D;  4QVC A;  4O5V A;  3L2V A;  3QZ9 B;  3VV0 A;  4DOW A;  4CRI A;  5GMK i;  1S72 T;  2RM4 A;  4N4I A;  1PSE A;  5M9O A;  3TRE A;  3S3M A;  2DKG A;  1D3B B;  4C0D C;  4XTU A;  2M16 A;  4QVD A;  3QO3 A;  4A4F A;  3CCV A;  1M4Z A;  3OW2 A;  2WAC A;  1WGS A;  3RKY A;  4FL6 A;  4PLL A;  1B34 B;  5CKF A;  5D6Y A;  2PVO B;  2RJC A;  3PT9 A;  1UGP B;  5LL6 S;  3QSU A;  3NTH A;  3V8K A;  2GFA A;  2RHZ A;  1YJW A;  2E5Q A;  4M75 C;  3V8L A;  2VUB A;  2K5L A;  3I55 T;  2CS7 A;  4RCC A;  4M7D A;  2QI2 A;  4XTV A;  3OYB A;  3JCM b;  5IN1 A;  5DLQ E;  2A3L A;  2EQM A;  2QEX A;  2M1H A;  3ER0 A;  5FRM A;  2R5A A;  5GAN g;  4V2S A;  4M78 F;  1V29 B;  3CCM A;  1YJN T;  2JTM A;  4J6W A;  4M77 G;  3JCM h;  1VQ6 A;  1M1K C;  4J8O A;  3SWN A;  4DQ2 A;  1DJ7 B;  3L42 A;  4Q5W A;  3VYH B;  1VQL A;  2XG8 D;  3MCA B;  3A8G B;  3MEW A;  3QBY A;  3OY9 A;  4N0A C;  5GAN 5;  3OYA A;  1NJI U;  4M7A A;  1KQ2 A;  3FDR A;  2XID A;  3FC3 A;  1X01 A;  2K5F A;  2HAX A;  1BYM A;  3VU3 C;  1BKB A;  2Y4Y A;  3HRT A;  1FXX A;  5DY9 A;  1B34 A;  2GFU A;  1M5Q 1;  2LT1 A;  4ZN3 A;  2K5I A;  2RJE A;  3JCM d;  3G4S A;  3CC7 A;  5GAN h;  2WSF E;  1P92 A;  4M78 C;  3G7Z A;  4LDW A;  2HQX A;  4R56 A;  4C8Q E;  3QJY A;  2KQW A;  1X6O A;  4HKE A;  3OYC A;  1WPY A;  4N0A A;  4KUD K;  1RI0 A;  1UEB A;  1UGS B;  2JOY A;  3DB4 A;  2ZPH B;  3QPH A;  2EYQ A;  5CIU A;  3G71 T;  3CC4 T;  4XK8 E;  4II1 A;  2RD1 A;  1VQP T;  3BDU A;  2PUK B;  1WJR A;  4JJN K;  1MHN A;  3X20 B;  4BDZ A;  4KUI A;  3RMQ A;  3DLM A;  2XD0 A;  3LWH A;  2BIV A;  3OQ5 A;  3P8D A;  4HT9 A;  3HKS A;  5C0M A;  2V8I A;  1YJ9 T;  3NTI A;  3CD6 A;  2YRV A;  2DVE A;  3OS0 A;  3L1A A;  3X26 B;  4MZP A;  3JB9 G;  4PJO E;  3QDR B;  1WQ7 A;  3GP8 A;  1QP2 A;  3VUZ A;  3JAM E;  4IUP A;  1Y96 A;  1M1K U;  2DJZ A;  3E9F A;  5KE2 A;  4PJO D;  2DK3 A;  2OTJ A;  3JCM Q;  2F5K A;  4BE0 A;  1QVG S;  2IG0 A;  4J7I A;  1MGQ A;  1VUB A;  2V8K A;  5FU7 C;  4BD3 A;  5A0G A;  5GAO r;  4L6V 5;  2HQE A;  4E7J A;  1OZ2 A;  2LVM A;  2ZPF B;  4C5I A;  4HCC A;  3SB2 A;  5LJ3 h;  3PMI A;  3CMA T;  3H6Z A;  4A4E A;  1VQ4 A;  2ZPG B;  2QQA A;  2K57 A;  3JRZ A;  4ME7 A;  4M78 D;  4LDX A;  4NOY A;  2BUD A;  3GOX A;  2LCL A;  3EFR A;  2E65 A;  3CBO A;  3KBG A;  3OA6 A;  1YIJ A;  4M7D F;  3ZEH A;  5CVI A;  3FEO A;  3HPW A;  1UGR B;  1YI2 T;  1D3B A;  1NZ9 A;  1M90 C;  1JJ2 A;  5CKB A;  3JCM g;  2DAQ A;  2QEX T;  2GF7 A;  4FT2 A;  5GAM f;  5KH6 A;  5CR2 A;  1YHQ T;  1AHJ B;  4HT8 A;  3O8V A;  3OMG A;  1M1G A;  3L2W A;  1Y07 A;  2ZPI B;  2MI6 A;  3JCM X;  2KMT A;  4OB2 B;  1QVF A;  3V7S A;  5DM7 R;  3LYI A;  4LDU A;  4M75 B;  4OP0 A;  4X9D A;  3QG1 A;  2PU9 B;  4XU0 A;  1O75 A;  5LJ5 j;  1OI1 A;  1KG1 A;  1EIF A;  3HRU A;  4XTZ A;  1K9M C;  3A5Z B;  3QXE B;  1VQ8 A;  3A8H B;  1RL2 A;  3OS2 A;  4JRP A;  3RKW A;  4PJO F;  4HCZ A;  1Y7X A;  3LGL A;  3ZBD A;  1VQL T;  3V8J A;  3G6E A;  3BFM A;  2QQS A;  3QHS A;  2CKK A;  4M77 F;  2MWP A;  3OYL A;  4C92 B;  3V7R A;  2HBP A;  4M78 G;  5LJ3 e;  5GAM g;  3PIP A;  2XKO C;  3DB3 A;  1I5L A;  3UDC A;  5HKC A;  1VQK A;  5LJ5 h;  3CCJ A;  3M9Q A;  4OMF B;  2P4T A;  1YCY A;  1X75 C;  1R8O B;  2RHX A;  1YBY A;  3S3N A;  4C0F A;  3ASK A;  1Q86 U;  1KC8 U;  2MMP A;  2EJG A;  4EMH A;  5HK3 A;  2ZCF B;  2RI2 A;  4A4K A;  1Q82 C;  2ZPB B;  4M75 G;  3VJP A;  4M7A B;  4XQ3 A;  4EMG A;  3JCM V;  5A0L A;  5GAN f;  3S3O A;  5FRN A;  4PJO C;  1BI1 A;  2DD4 A;  2K2V A;  4UC4 A;  1VIE A;  4EDU A;  3GF5 A;  2A7Y A;  2JVV A;  4LD9 K;  3A8L B;  4O6J A;  1M8V A;  4JDS A;  2JN0 A;  3I56 A;  4QQD A;  1M90 U;  4MDX A;  5J3B A;  1JB0 E;  5GAN 6;  3LH0 A;  5CKD A;  2R57 A;  3CPW A;  3BDL A;  3FJP A;  4TVR A;  2LNV A;  2DD5 A;  5A0D A;  1Q86 C;  1KC8 C;  4ZGE B;  2XDP A;  2KDS A;  3QII A;  4M7D E;  3HSB A;  1I81 A;  4X9C A;  5GAN d;  1WNL A;  3C94 A;  3RIR A;  5GMK l;  3SDZ A;  2C06 A;  3M4G A;  2VGM A;  2RH2 A;  4C8Q D;  5CAI A;  1QVF S;  2XI9 A;  4M7D C;  4M7D G;  2E1H A;  3GNF B;  2PUO B;  5LJ5 g;  4J5Y A;  3JB9 D;  4PJO A;  3LWI A;  3CCL A;  3M58 A;  3OMC A;  5HK0 A;  4M7A E;  3T9N A;  3MP1 A;  4IUQ A;  2LC4 A;  3HHT B;  4MML A;  4M78 E;  4N4G A;  1ZBX A;  2E10 A;  2GQV A;  2BKD N;  5KCH A;  3OYK A;  3CME A;  1IRE B;  4FM4 B;  3CC7 T;  1PSF A;  1U8R A;  4BAC A;  3CBP A;  4M75 A;  1VQ5 T;  5KCO A;  3CCR A;  2XIC A;  1NJI C;  1VQM T;  3JCM P;  1FX7 A;  4JLI A;  1VQO A;  4BI8 B;  1VQP A;  5J39 A;  1OZ3 A;  3VKI A;  4C5H A;  2RJF A;  2DTH A;  3X24 B;  3JCM e;  2HD0 A;  4NS5 A;  3PIO A;  3CCU A;  3MEV A;  5A2Q E;  3OW2 S;  1U1T A;  2JUF A;  2LTO A;  3S6W A;  2I2L A;  2EQU A;  1N8R C;  1Q81 U;  3AHU A;  4GY5 A;  4BY6 B;  5HY6 A;  3X28 B;  1G3W A;  2LQ8 A;  5CKE A;  1VQ9 A;  3E1S A;  3GNG A;  4IUU A;  4VUB A;  3VYG A;  5GAO m;  4JRQ A;  2B8A A;  3HRS A;  5GAN 3;  4KBM B;  4ZTF A;  3CCE A;  5GAM h;  2OAU A;  3RES A;  1W2B A;  4KUL A;  2QQR A;  1BIB A;  2DEQ A;  2FB7 A;  4RKU E;  3RKX A;  4E7I A;  4BUG A;  4E7K A;  2RK2 A;  4EMK B;  5IT9 E;  4WF2 A;  2Y90 A;  4JLG A;  2V8J A;  2ZZD A;  3OB9 A;  4PKC C;  3QJ6 A;  4ELY C;  3MEA A;  2WSC E;  3CCQ A;  2AHJ B;  4IUR A;  2VC8 A;  3C95 A;  4M7D B;  1OYX A;  2X4X A;  5GAO l;  3PNW C;  3P8H A;  1QP3 A;  3V7C A;  1U1S A;  4PJO G;  1W4S A;  2OTL T;  2QDY B;  4MZM A;  4J6X A;  3OYH A;  1LOJ A;  3EAE A;  2QXF A;  3URG A;  4DOV A;  1YI2 A;  1G5V A;  1G3Y A;  1XTD A;  4Y91 A;  4C8Q C;  1YIT T;  4IUV A;  2EQK A;  4RMO A;  4C8Q A;  3FIF A;  4J6Y A;  5GAO n;  1K8A C;  1SSF A;  3MP8 A;  2MWO A;  5GMK m;  4GLK A;  2XDD A;  4C0Z A;  3OYG A;  4M7D D;  3QKJ A;  3FRN A;  4J7F A;  4C0G A;  2DIQ A;  4OGE A;  2EFI A;  4M7A D;  4C0D B;  4IUT A;  5DLO A;  4RCB A;  2EJF A;  4BDY A;  4M75 F;  2F5T X;  1YIJ T;  3JB9 J;  3GIB A;  1BIA A;  2PVG B;  1HXD A;  1LJO A;  5GAN e;  3JB9 I;  2P0K A;  3PTA A;  3G71 A;  3R6O A;  3CC2 A;  5GAN 4;  2VV5 A;  1I8F A;  1XOV A;  2RO0 A;  3CCS T;  2QQB A;  2YHT A;  5GMK j;  3TU4 K;  2PVD B;  1NPP A;  3WVD B;  2GCX A;  2KVQ G;  3L2Q A;  2EWN A;  2K3X A;  3JCM J;  2XDB A;  3CCJ T;  3OSS C;  4XU3 A;  2D6F A;  4C92 D;  1N8R U;  2RA2 A;  2M9U A;  2DXB A;  3PMT A;  4C5E A;  3CCR T;  4N4H A;  4MDW A;  2M0O A;  2XK0 A;  4M78 A;  1N6A A;  1HK9 A;  2NLU A;  3EFS A;  4EPC A;  1G3T A;  5FU7 B;  5GAN j;  1W2B S;  3MEU A;  3RMS A;  5LJ3 f;  4OB1 B;  2VXF A;  3J80 E;  1O9S A;  1XQH A;  2MAM A;  2O01 E;  5CKH A;  5CO7 A;  5GMK h;  1H3Z A;  3X25 B;  5CQX A;  4M77 E;  3OYI A;  5I2S A;  1BI2 A;  2OTJ T;  3WVE B;  1JJ2 S;  2VYT A;  3M53 A;  4JS5 A;  3INZ A;  3MP6 A;  2QA4 T;  1VQ6 T;  5CQY A;  3RER A;  3CXC A;  1UGQ B;  2KSS A;  5GMK e;  2DXU A;  2D9T A;  1VQ7 T;  3JSC A;  1VQK T;  5LJ3 d;  1KD1 U;  3CEY A;  5D6X A;  3QUI A;  3HL8 A;  2CZ1 B;  2LDM A;  5L8R E;  4E47 A;  2DXT A;  3P8B B;  3J7A F;  2FYK A;  3UPU A;  3PGG A;  2JTF A;  1G3S A;  2LX9 A;  5CK9 A;  1QVG A;  3L2Z A;  3RUX A;  1M9S A;  3G4S T;  3SFM A;  2CZ7 B;  3CME T;  3QYH B;  5D6W A;  5FU6 C;  1VQN T;  4HA8 A;  4JRI A;  3M57 A;  4ATO A;  4FIB A;  3OSV A;  4C92 F;  1YJ9 A;  3GLX A;  3KXT A;  4M77 B;  1XNI A;  3I56 T;  1NE8 A;  2EQJ A;  3FB9 A;  4QQ6 A;  1YJW T;  1KQ1 A;  1NPR A;  1K73 U;  4PJO B;  2QQ9 A;  2RJD A;  3J81 E;  2FHD A;  2EIF A;  1Q82 U;  1ZQ1 A;  3N5B B;  4Y28 E;  1KQS S;  4M75 E;  3Q1J A;  4JRK A;  5LJ5 f;  4B9W A;  2E41 A;  4OVA A;  1VIF A;  3LLR A;  1S72 A;  2E12 A;  2FVU A;  2G3R A;  5GAN 2;  5FRO A;  3CPW S;  2RHI A;  2P0Q A;  3HFO A;  4FU6 A;  4M7A F;  1YJN A;  4MZT A;  1JBM A;  3DKM A;  3UWN A;  2PQW A;  2O4X B;  3F70 A;  4QQG A;  2E6Z A;  4L5G A;  3WXM B;  4A4H A;  5KE3 A;  1FWZ A;  2YLB A;  4A54 A;  4FSX A;  3CCV T;  3CD6 T;  3MHX A;  4KT0 E;  4YTL A;  1WJQ A;  1BI3 A;  4F7U A;  3DLL A;  4BE2 A;  4R55 A;  2LRQ A;  4C92 C;  4M7A C;  4QW2 A;  1H64 1;  3OS1 A;  2XHC A;  1I4K 1;  4L59 A;  3M4Y A;  2RI5 A;  4FT4 A;  4J83 A;  4ELZ C;  2VXE A;  2D0Q B;  3M54 A;  4Z02 A;  4BI3 A;  4C8Q B;  2CZ6 B;  3BY7 A;  2CZ0 B;  2IVW A;  3LX7 A;  2VGN A;  5I2M A;  2RI3 A;  4D6W A;  4ZGJ B;  1VQO T;  1JRI A;  5GAN 7;  3E9G A;  2K3Y A;  3MO8 A;  5LJ3 j;  4B9X A;  4PLI A;  4C92 E;  4XU1 A;  4F7U G;  1N27 A;  2JZ2 A;  4RG2 A;  2X35 A;  5J26 A;  3OYY A;  2X4Y A;  3JB9 F;  3TCJ A;  5AYF A;  3CCM T;  3CCQ T;  3L2R A;  1IZ6 A;  4A53 A;  3BW1 A;  2DZ9 A;  5GAM e;  5LJ3 g;  1KQS A;  3LGF A;  1VQ9 T;  4M75 D;  4ZTJ A;  3CC4 A;  4XTY A;  3KUF A;  2EKO A;  3A8M B;  3QYG B;  3OYN A;  2CGH A;  2HNI A;  2RK1 A;  1QW1 A;  1ZHI A;  4BY6 C;  1K73 C;  2RB6 A;  4NL3 A;  4LDV A;  3OYD A;  1WJS A;  2O4X A;  1YIT A;  1YHQ A;  1Q81 C;  4JS4 A;  2L8D A;  3C12 A;  3SD4 A;  4NL2 A;  1QVP A;  2R5M A;  2X4W A;  3CBM A;  2XU8 A;  5EG2 A;  4C8Q G;  2ZGW A;  2K4Y A;  4F7U E;  5C6S A;  2RHU A;  1BI0 A;  2DPP B;  4BE1 A;  3NFC A;  3JCM W;  4M77 A;  1M1F A;  3OBW A;  4XAX B;  2E6N A;  2X4J A;  4OB3 B;  2FL7 A;  5IAY A;  1VQ5 A;  3SWN B;  4OF1 A;  3LW5 E;  1VQ8 T;  3HFN A;  2DTO A;  3VUB A;  3M55 A;  3JCM f;  2DIG A;  4ZGD B;  4OGC A;  1K9M U;  3M56 A;  3CXC S;  2KK4 A;  3I55 A;  3CC2 T;  2DXC A;  2KAF A;  2OTL A;  3CCS A;  4A4G A;  1KHI A;  4BI4 A;  1VQ4 T;  2L89 A;  4RG8 A;  1N9R A;  4XU2 A;  2MF2 A;  3SWN C;  2WSE E;  1Y96 B;  2LQK A;  2ZPE B;  5FLX E;  3CCU T;  1VQN A;  4C5G A;  3OBY A;  3ME9 A;  4HCB A;  4DA4 A;  1GXI E;  4LD6 A;  2L3R A;  2Y4X A;  3M5A A;  1K8A U;  1Q7Y C;  2LT4 A;  4M77 C;  4ZN1 A;  2RHY A;  2H3J A;  3OS5 A;  3JB9 H;  4EMK C;  5LJ5 d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...