4F7UA

The 6s snrnp assembly intermediate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uA00
4C92G 4PJOE 5GAN5 2E64A 5GANf 1MGQA 5LJ5f 2DXUA 3RUXA 4XU2A 5CAIA 4C8QB 4XU1A 1JRIA 1X01A 4PJOA 3V8KA 2EAYA 5GAOn 3V7SA 2RA2A 5GAMe 1I8FA 1Y96B 4M78A 2FYKA 4XTZA 4XU3A 2FB7A 3JCMd 4M78C 4XTUA 2DXTA 4M7AG 5GAN7 2ZGWA 4N0AC 1H641 3QO3A 4C8QF 4V2SA 3JCMW 1D3BA 2QTXA 4M75B 2VXEA 4C8QE 4PJOD 5LJ5j 4JUVA 3RKXA 5LJ3g 3BW1A 4OP0A 3BFMA 5GAN6 5GAMh 5GANh 2RB6A 5LJ5h 3AHUA 3JCMP 4XTVA 1B34B 5DY9A 2EJFA 4JLIA 4M7AB 5I21A 3RIRA 3L1AA 4J6YA 1Y96A 3JCMc 3HFOA 3FJPA 4M75E 3SWNA 2Y90A 5GMKh 3JB9H 4M7DB 4MMLA 5GAMf 1U1SA 2YLCA 4F7UG 2EJ9A 3RKYA 3JCMg 3EFSA 4NL2A 3JCMX 4M75A 3JB9G 4M78G 5GMKl 4M7AF 2K57A 4M7AE 4DQ2A 5LJ3e 3RERA 1YCYA 4RCCA 4PJOC 3V8JA 3EFRA 3JCMV 4M77B 4EMKA 4M7DF 2DZCA 4EMHA 4M7DE 1M8VA 4C92B 4X9CA 4F7UB 3QUIA 5GAOl 4M75D 4Y91A 2DTHA 4XTYA 5GAN3 1BIBA 5GAMj 5GANj 4NOYA 3JCMe 2I2LA 4J5YA 2DKGA 4M77F 4C8QA 1BIAA 1I4K1 4M77E 3JCMQ 4C8QC 2YLBA 3FIFA 4C92F 4EMGA 4C92E 3L2ZA 4F7UF 2RD1A 5LJ5d 5GMKj 3JB9F 2YHTA 4X9DA 2RM4A 4PJOG 5LJ3f 3SWNC 3JCMh 2VXFA 2E1HA 4C8QD 4M75C 1WPYA 3RKWA 1U1TA 3RESA 5GAN8 1WQWA 2CGHA 2DEQA 4JRKA 5GAOq 1B34A 4M7AA 3VU3C 3BY7A 3JCMf 4EMKC 4PJOB 1LNXA 1JBMA 5LJ3d 4M7AC 1KQ1A 4PNOA 3PGGA 1KQ2A 4XTXA 5LJ5g 2VC8A 4J6XA 4M78B 5LJ3j 5GAOr 4M7DA 2DTIA 1M5Q1 4M7DC 5GAOp 4RCBA 3V8LA 4XTWA 5LJ3h 2HNIA 3GIBA 2E65A 3QSUA 3HFNA 1N9RA 1D3BB 4PJOF 4M7AD 5GAMd 2DZ9A 4XQ3A 1WQ7A 1HXDA 5GMKm 1WNLA 5GANd 4F7UE 4M77A 5GAN2 4M75G 4JRIA 4M78F 2DVEA 1HK9A 4M78E 4M77C 4HA8A 5GAN4 3JB9I 1I5LA 2DJZA 4C92A 2E41A 4M7DD 2EWNA 4F7UA 1N9SA 4C92C 1TH7A 5GANe 5GMKi 5LJ5e 3HSBA 4QVCA 3SWNB 4N0AA 4WF2A 5GAOm 4HT8A 1LJOA 2DTOA 4A54A 4M77D 4QVDA 3V7CA 2EJGA 3BDUA 5GMKe 4M7DG 1I81A 3FB9A 3INZA 4C92D 3JB9J 4HT9A 4MMKA 3SB2A 4XU0A 4A53A 5GAMg 3QHSA 3JCMJ 2E10A 1LOJA 4M78D 4C8QG 5GANg 3JB9D 3JCMb 4EMKB 4J6WA 4NL3A 4M77G 3V7RA 4M75F 3M4GA 2JN0A
chains in the Genus database with same CATH superfamily
2F2XA 4OMLA 2KAFA 4ATOA 2K6DA 1MNDA 1JRIA 2AIRB 8ATCB 1T3LA 3UPUA 2LX9A 5I2SA 3JCMW 4M75B 1YWOA 4JUVA 3EG9A 4J83A 4ME7A 2RK1A 2JUFA 3JCMc 2DA9A 3JB9H 4MMLA 4E7ZA 3CCSA 4M7AE 4JS5A 2OTJT 5LJ3e 4BACA 3CCLQ 2PZ1A 2HBWA 3G71Q 2F5KA 1SPKA 4F7UB 1TUGB 1U5SA 5GAN3 1OX9A 1N27A 1K8AU 2MAMA 3MP1A 1VUBA 2QG9B 2LJ1A 2MIOA 5FRMA 1LCKA 3L2VA 2VASA 2O88A 5KYNA 3OYCA 2VKNA 4D8DA 2HKQB 3G4SA 5GAN8 5DLOA 2DO3A 1IZ6A 2XIDA 3CBPA 1B34A 3JCMf 2LX7A 2RK2A 1UUEA 1JJ2S 1YIJQ 3TCJA 5KYUA 2E65A 3HFNA 2CZ1B 1VQLQ 4OVAA 1HXDA 1I5LA 2FPEA 3VRZA 2DNUA 1X6OA 2JTFA 4QVCA 1VQMT 3WVDB 1Q86U 3C4SA 2D1XA 1G3TA 2GF7A 4LD9K 4BI4A 1RLQC 2K2MA 4E7HA 2QQRA 3A8GB 2LCSA 4J6WA 1IGQA 1E6HA 1ZX6A 3LH5A 3RDVA 3UWNA 2IVWA 2WSEE 5HK0A 1K1ZA 5LJ5f 3M54A 5FRNA 1ZSZB 4BE2A 2DXBA 2K3XA 1NJIR 1R0BG 2L2PA 4J8OA 5KYXB 1IB8A 3CD6T 1Y0MA 1IHVA 3RMSA 5GAN6 3EHQA 1I5OB 2HKNA 5DY9A 1E6GA 2Y90A 3DLLA 1VQ8Q 3RKYA 4M75A 2DILA 5GMKl 1M3CA 2JTMA 3RERA 2RJEA 2QA4A 4DBQA 3TVTA 4M77B 1AWWA 1YJNA 5CVIA 1M8VA 4ZGEB 2JS0A 2QA4T 1QWFA 3CCUT 3QJYA 1R8OB 1WHKA 4NOYA 2K3YA 3VYGA 2ED1A 4DBHA 4C8QA 1Q81C 1ZSGA 3WVEB 2WACA 3OYDA 2RMOA 1X43A 2L3RA 2VXFA 1WXBA 1AZGB 4M75C 1H3HA 3G6EQ 4AFQC 5GJWB 3BY7A 3TREA 2O4XA 2RQUA 3PGGA 2R5AA 2W0ZA 4FYVB 1QP2A 2X3WD 1NM7A 4M7DA 2DRMA 2DX1A 3CC7T 2KRSA 1N9RA 4PJOF 4A4EA 1BCOA 3JB9I 3GNFB 1MV3A 2DJZA 4C5IA 3PMIA 4C0GA 2CZ7B 3CCMA 2JNGA 4E7KA 1BCMA 4J9DA 2NUPA 1WX6A 3BDUA 1I81A 1JB0E 1GBRA 4MMKA 4ZN1A 1PM3A 1U8RA 2VGNA 1ZHIA 5EC7A 4OF1A 4JJNK 2AHJB 2XKOC 3VV0A 2X35A 2GTOA 4J9EA 1GXIE 2RJDA 3CCRT 1D1CA 3M0PA 5GAMe 4RKUE 2SRCA 1VQ4A 1NG2A 1N8RU 2ZPGB 3H0FA 5IXBA 4P5NA 2AZVA 3X26B 3MKDA 1Q82R 3BFMA 4J9HA 2BZYA 1YBYA 2E6ZA 2L5QA 3OYYA 5J26A 2QGFB 2FG0A 2ZPBB 3Q1JA 2KXDA 3LLRA 1D0XA 3EFSA 4NL2A 3EFRA 4BE1A 3OYLA 1K9MU 4RG8A 2DE0X 3HTRA 2PVGB 4IUTA 3M53A 4OB3B 2KNBB 1M3BA 4PFOA 1ZSZC 4F7UF 3FRNA 4FIBA 4BY6B 3E2UA 1YN8A 2HQEA 2HMAA 2ED0A 2YUPA 2PUKB 3MCAB 4LDWA 3I5RA 2HD0A 5L8RE 1KQSP 2XU8A 3OSVA 1CSKA 2LQKA 1PG5B 1UGSB 2LQNA 2KI7A 1M1KC 4AFZC 2G6FX 4O5VA 1M5Q1 4HVWA 2HNIA 2EVRA 3OMGA 5CKFA 3PVQA 1VQKQ 3LWHA 3EGDB 1WIEA 4IUQA 2QXFA 1H3ZA 4M77C 3JAME 2BE9B 1Y07A 1F1BB 3MPUB 1VQ7A 1EX4A 3GPLA 1PKTA 4BDZA 2C0OA 4RMOA 1X6GA 1ZLMA 2KBTA 1G3SA 2A08A 4PJMA 5FROA 2BUDA 4ESRA 4DBRA 2KMTA 2DAQA 2F2VA 3URGA 2B86A 2LQ8A 2JMAA 1WHGA 1M2VA 3A1PA 2D6FA 1KFZA 3PT9A 1KC8U 1IREB 2M51A 4M78A 4XU3A 4OB0B 4J7FA 1KHIA 1HD3A 4KH1B 2QTXA 1GCPA 1AWXA 2V8IA 4ELZC 3RKXA 3E19A 5GAMh 5GANh 4HCZA 3RIRA 2XDPA 2XICA 4J6YA 5IHKA 1YITA 1KQSA 2YWWA 3FJPA 4OMNA 1VQNA 2DL3A 4FL6A 1VQOA 3JCMV 2KVQG 4EMHA 3TEEA 1VQOT 1WHHA 1KD1C 2DIQA 3CCVT 3OW2S 5CKEA 4JRPA 2I2LA 4M77F 4TVRA 4DEYA 3JCMQ 4C92E 1QCFA 4R56A 2KRNA 2JM9A 3U23A 2EQIA 4PJOG 1LVKA 2L0AA 4PK4A 4KT0E 1UHCA 1UGQB 2X3XD 4N4IA 5D6YA 2IIMA 4L59A 3CCJQ 1QWEA 1JU5C 3PMTA 2XK0A 3L2RA 2EYWA 1RAIB 2RHXA 2C06A 1VQ9Q 2V26A 1TUDA 3H6ZA 2DVEA 3QG1A 3RR6A 1WYXA 4A4KA 2YT6A 1S72A 4E47A 3QYGB 3OYJA 5A0GA 3EG1A 2RH2A 1GFCA 4PL6A 3CMAQ 1UHFA 4QVDA 4VUBA 1RUWA 2HL3A 5A2QE 3EFOA 4AG2C 2OTLQ 3QHSA 1YP5A 1WLPB 4BY6C 1K0XA 2X9HA 2QEXQ 4BI8B 4RTWA 4C0FA 4KH0B 2J6KA 2YUQA 5GAOn 3D7SB 1K0SA 2KQWA 3CC2Q 1Q7YC 1YHQA 3QKJA 3MEVA 1NEBA 1QVFP 4KUDK 2RHIA 1M90C 3OB9A 1N6AA 2DBMA 1QCNA 1PRLC 1YWPA 2LMJA 2NLUA 4GBQA 2ENMA 3M4YA 4LXCA 3EG0A 4F7UG 1GFDA 3I56A 2HQXA 2FPFA 1M1GA 4EMKA 1M4ZA 1XJWB 2I0NA 2FPDA 4Z8AA 4DEXA 2CP0A 3FIFA 4AT1B 1UFFA 5AYFA 1VQ5Q 2FZGB 3L2ZA 2XDBA 1UGVA 3HRSA 1B7TA 3OS1A 1YI2A 1MMAA 2RJCA 2AK5A 2LCCA 4CC3A 3M55A 1T3SA 3TSWA 4HXJA 4K11A 2CGHA 3UT1A 1WXUA 4EMKC 3MHXA 2D0NA 1UDLA 2MPXC 5DLQE 1U06A 4M7AD 1QW1A 1WNLA 2MI6A 1QVFA 4HVUA 3C0CA 1UJ0A 4EIKA 2AKKA 2R57A 1YJWA 3CCQA 1C1AA 2KRMA 2BZ8A 4BDYA 5GAOm 1WA7A 1H92A 3V7CA 3TSZA 2EQJA 1Q86R 4MZPA 1V1CA 1WXTA 1M9SA 1K73U 2IPOB 5CKBA 3V7RA 2H3EB 5LJ3d 4DBFA 4F14A 1QVGP 1MGQA 1JEGA 2QASA 4DOWA 1C0MA 2ZZDA 4AG1C 4E2FB 2XMFA 3CCET 1SRMA 4XTUA 4RUGA 1RAFB 4IUVA 4UC4A 4C8QE 5KCHA 4BUGA 1AT1B 3CMEA 2KR3A 3M0RA 4OP0A 4PLLA 3X25B 4XTVA 2EJFA 2X4XA 3CMET 4OB2B 5GMKh 3OS0A 3ZBDA 1SG5A 3JCMg 3HPWA 2EFIA 4RTTA 3CC4Q 3EGXB 3OYIA 2CKKA 4M7DE 1G2BA 3C95A 3CEYA 3AT1B 3G1JA 3OYHA 1YCSB 2V1RA 2QQSA 3G71A 4J9IA 1ZUKA 4QKUA 3CCLT 3CPFA 3VUBA 3G71T 2OTJA 1IGUA 3A5ZB 4L5GA 3WXMB 1OQKA 2E1HA 3RESA 1KSWA 1WJQA 3FDRA 2KDSA 1AVZC 2E4HA 2LNHB 1QVGA 3IQLA 4XTXA 5LJ5g 1ZQ1A 1AEYA 4XTWA 3QSUA 2CYZB 2QDLA 3NTIA 1WQ7A 2DMOA 1RLPC 3LGLA 2OAUA 1OZ3A 1SKUB 3EH2A 4RTVA 1BYMA 1VYUA 2IG0A 3QBYA 1ACMB 1NLPC 2MK5A 5CQYA 1LJOA 3M0SA 1YIJT 1VQLA 4JDSA 1HSQA 1IRXA 3FB9A 2KY9A 3SB2A 1VQLT 3CCSQ 1LOJA 2BKDN 2JW4A 2L3QA 2X4YA 2CUDA 4M78D 3OSSC 1UECA 2LZ6B 5M9OA 1EIFA 2E3IA 4BI3A 3QZ5B 1OYXA 3OMCA 5GANf 2YDLA 2PU9B 3OYKA 1VQMA 4PJOA 1T0HA 3I5SA 1AZEA 2CP2A 4KBMB 2DIGA 4ZNXA 5CIUA 2ROLA 5CR2A 1N8RR 2VXEA 5HKCA 2RQRA 4B6MA 1M1KR 3M5AA 3G4SQ 2F69A 4M7AB 3ASKA 1K8AC 2CSIA 2M02A 3KFVA 4PJLA 5FU6B 1W6XA 2EGAA 2LVMA 2DM1A 4PJOC 1G5VA 2XI9A 3CD6A 4QVZA 2V8JA 2A0FB 1NYGA 3MEWA 1FX7A 4HKEA 4JZ4A 3OYBA 1VQ8T 1UEBA 1I4K1 1XOVA 2C0IA 1OU8A 2GTJA 3VUZA 4RTZA 3OY9A 1MUZA 2O9VA 2DYBA 5EG2A 4JRKA 2PUOB 3SFMA 3CCUA 5A0DA 2XD0A 5CKDA 1Q86C 3PE0A 2HSPA 2FO0A 3TU4K 5LJ3h 1GRIA 2DL7A 2RO0A 5GAMd 5GANd 5GMKm 5IT9E 1HK9A 4M78E 2DL8A 2QK0A 1KJWA 5D7UA 2LNVA 4F7UA 2C0TA 5GMKi 4CRIA 3I9QA 1KG1A 3MEUA 1VIEA 2MWOA 3CC7A 2E5QA 4D6WA 2GQVA 1M8MA 3CPWP 1KD1R 2QA4Q 5A0LA 1MMDA 1YJNQ 2DRKA 3H9NA 2EGCA 1XNIA 3S3NA 2O01E 5GAN5 1QP3A 4XU2A 3VJPA 2HQHA 5KYYB 2EAYA 1YNZA 2YUOA 1D0YA 1RAAB 1H641 2DYIA 3UDCA 2ROTA 2EYYA 1TU0B 2J6OA 3CCRA 1GCQC 2YXYA 4ZTJA 4E7SA 2D8HA 1UB4A 1OU9A 1N5ZA 4GLKA 4JS4A 2QQ9A 5FWCA 4LUDA 3GP8A 2DTHA 5KH6A 3JCMe 1ZUYA 3CCMQ 1ZSZA 4ZGDB 2COYA 4ORZA 1PWTA 1FMWA 2BTTA 3EG3A 5KYXA 4ANJA 2P0KA 4HVVA 3CPWA 3CQTA 2L89A 3RBBB 3QXEB 4RTUA 3MP8A 1VOMA 1Q7YR 3QWYA 4FM4B 4M7AC 1H8KA 3THKA 2RNAA 5LJ3j 1FMKA 1M90R 4RCBA 1RAEB 5FU6C 1VQ4Q 2HZYA 1KQSS 4OMOA 1Z9QA 2VYTA 4RTYA 1QQJA 2KT1A 2NUTB 4M77A 5GAN2 1NJIU 1G3YA 4JRIA 4FT2A 3VS1A 1G8XA 1AWOA 5LJ5e 1AD5A 3SWNB 1XTDA 3VRYA 1N8RC 2DERA 3GOXA 4C92D 1JO8A 1NPRA 3JB9D 1TS9A 1PD1A 2LTOA 1FXXA 1HJDA 1PC0A 4C92G 5CCAA 4ELYC 1OULA 3P8DA 2DXTA 5GAN7 1SHFA 4LN2A 1I1JA 4V2SA 1K9MC 1Z9ZA 4CC2A 4KRTA 3T9NA 1X2KA 4IKFA 1LPLA 3G7ZA 1W70A 4EPCA 2QQAA 2HCKA 3JRZA 1VQ6A 4M7AF 1WHMA 2RF0A 3GBQA 2ZAEA 1AWJA 1VQ6T 3X20B 2FVUA 2QDYB 3QUIA 4PKCC 1TWBA 3N5BB 2A28A 2DETA 1UGRB 1R0CB 2DKGA 1VQ7Q 4OMMA 4E7LA 2LQWA 2YLBA 2FRWA 1P92A 2K5IA 4F04B 4J9FA 1VQPA 2COWA 3JCMh 3NHNA 2E3HA 4A4FA 3A8LB 3RKWA 3ME9A 4DA4A 1VQPT 3SHWA 1RI9A 4KULA 5GAOq 3CCVA 2X51A 3R6NA 2DTIA 4QW2A 2CSQA 4FCYA 2O2OA 2JT4A 4KGXB 2DBKA 1D3BB 3VYHB 1HYOA 1OEBA 2PTKA 3OYGA 3PVLA 2HBPA 3MEAA 3CCJT 1KC8C 2QQBA 2DEUA 5KCOA 1YITQ 4A4GA 1X2QA 5DM7R 1Q82U 1VQNQ 2CDTA 4L6V5 3JCMJ 1VQ9T 1VQOQ 3O5ZA 2GQIA 3LGFA 1MMGA 1VYTA 2CP6A 2FRYA 4J9GA 1Y71A 4C0DB 3FEOA 2FZCB 3RUXA 4RTXA 2AT1B 3RNJA 2K5LA 2M0YA 4IUUA 1PSFA 1K76A 2EYXA 2OTLT 1W2BA 2CT4A 3C12A 2H8HA 3X28B 4OMQA 3GNGA 1GL5A 2P0PA 2SEMA 1TG0A 4FW1A 2QEXT 2NUZA 2E5KA 4Z88A 3EGDA 1TOVA 4NS5A 3H0IA 2RB6A 2GNCA 1RAGB 2K9GA 1QVFS 3MP6A 1WHJA 2EJ9A 4GLMA 3JCMX 4DQ2A 1RAHB 3E1SA 3FC3A 1NE8A 2ABLA 4Y28E 2DZCA 3A98A 5CO7A 4C92B 4M75D 5GAMj 5GANj 1RADB 1S72Q 4B9XA 5HCKA 1BIAA 2DFUA 4D8KA 2L3PA 2RQVA 4LDUA 4EMGA 2EQKA 3MJXA 4BD3A 1VYVA 2EGEA 5LJ3f 9ATCB 4C8QD 5FU7B 1JXMA 5L23A 2EKOA 3M0TA 1KQ1A 4JJDA 4C5GA 3NGPA 1BI2A 2RI2A 2A37A 3LX7A 5GJVB 1TUCA 5HK3A 2RQTA 1BI3A 1YHQQ 3S3OA 4XQ3A 1K8AR 3EG9B 5GAN4 4M7DD 2ZPHB 3DLMA 2EKHA 5I11A 1QLYA 1ABOA 4CI0C 2A7YA 3FJ5A 4JLGA 3NFCA 2CP3A 2EJGA 2GFUA 4M7DG 2RI3A 3I56Q 3P8BB 3M57A 1YJ9A 4PFZA 2J7IA 2KXCA 2W10A 2DL5A 2DD4A 2E64A 1YJ9T 2FZKB 4XK8E 2CZ0B 2RA2A 4XTZA 2AZSA 3SEMA 2FB7A 3I55A 4M7AG 3FLGA 5FWBA 1UGPB 3HRTA 3LW5E 4LUEA 1YI2Q 1QVGS 3I55T 4FYXB 4AFSC 3AHUA 1MV0B 1B34B 4MDXA 3L1AA 2K3BA 2O31A 4M75E 4ZGJB 2YSQA 1NEGA 3A8HB 3CCEA 5KYUB 2M1HA 1NLOC 2PNIA 3H41A 1M3AA 2ZPEB 3H0HA 4Y91A 1ARKA 4XTYA 2ZPFB 1BIBA 1AOJA 3H8ZA 1YJWQ 4C0DC 3CCQQ 4OB1B 4ZN3A 1M2OA 5D6XA 4OGCA 4FYYB 3CC4T 1XQHA 1MHNA 2RPNA 4JJBA 1O75A 4O6JA 1FMVA 2HAXA 3OYAA 7AT1B 1DJ7B 2NWMA 1KQ2A 1I07A 2VC8A 2DK3A 2HEQA 5HY6A 1C6VX 2GGRA 5GAOp 1SRLA 1K73C 3CCLA 3QPHA 1JXOA 2GBQA 2DZ9A 1D1AA 2NYSA 3L42A 4LD6A 3CMEQ 4C92C 3GLXA 1W1FA 1TH7A 1ZBXA 3OYEA 2HSEB 3UA7A 4N0AA 3SDZA 1D09B 3JB9J 1SSFA 1WDXA 2E10A 4PFPA 2LCLA 3KBGA 4IIOA 4JJCA 2DVJA 5FU7C 2DF6A 4C8QB 2JOYA 3V8KA 1YIJA 3V7SA 3DB3A 3PIPA 2FYKA 3HP9A 3CCST 4YTLA 2OI3A 2ZGWA 4R55A 4N0AC 1BK2A 1FWZA 4LNPA 2OTJQ 2KT8A 2WSFE 4KGVB 3BW1A 1PRMC 2RJFA 4J9CA 1OI1A 2V1QA 2MF2A 4E6RA 1IXDA 5I21A 3UA6A 4JLIA 5J39A 3L2WA 2O4XB 2PVDB 2F5TX 1SSHA 4OMPA 4M7DB 5GAMf 1T0JA 2YLCA 2V8KA 2JXBA 2A36A 4M78G 4IURA 4A4HA 3QIIA 1EFNA 3VKIA 3CXCA 1IHWA 4E7IA 1WZOA 3EH1A 3LWIA 2XDDA 3LH0A 2K7AA 3G4ST 2H3JA 1NYFA 2XG8D 2FEIA 2LJ0A 2LT1A 3M56A 4FT4A 3J81E 2K4YA 1WJSA 4J5YA 4DOVA 1I0CA 4M77E 5C0MA 4J9BA 2NUPB 5IHNA 4C92F 3A8MB 2DD5A 5IHIA 5GMKj 1MMNA 3JB9F 4PJNA 5I2MA 2VGMA 3NTHA 1JJ2P 1WPYA 3OQ5A 1WQWA 2KROA 1WI7A 1VQ8A 4ZTFA 1VQMQ 1K9MR 4AMCA 2R5MA 1Q81U 1QKWA 2BE7D 2JTEA 2CP5A 3KUFA 1KIKA 3EGXA 4EDUA 4M4ZA 2YRDA 1N9SA 2Z0WA 1PD0A 5C6SA 2K2VA 4CC7A 1S1NA 5KE2A 2JVVA 3CD6Q 2DXCA 5ECAA 3G6EA 1OOTA 2VWFA 4MZTA 2O9SA 2VV5A 3DB4A 1CKBA 3O8VA 3G6ET 1BU1A 3CPWS 2ATCB 1OX8A 3META 1WHLA 3JCMd 2KK4A 1RACB 1EZZB 3NMZC 3QO3A 3R6OA 1YJNT 2HL5C 2JZ2A 2MMPA 1JJ2A 2P0QA 5KE3A 2K79A 2KYMA 1NBEB 1GCQA 3CCUQ 1SEMA 1U1SA 4KGZB 1A0NB 2ZPIB 2K57A 3UF4A 1YCYA 4RCCA 1X75C 4MZMA 1KC8R 4Y92A 2WSCE 5D6WA 4A63B 2D0QB 2RHUA 1ZUUA 2RHZA 2X4WA 4C8QC 5CQXA 5LJ5d 3HL8A 5FLXE 3VS4A 3M58A 3PFSA 4X9DA 2PVOB 3M59A 3CC7Q 1UTIA 3PNWC 4Q5WA 2L3SA 4QT7A 5IXFA 2K5FA 1M2VB 3OA6A 4M7AA 3VU3C 3CCMT 1LNXA 4HCBA 2EYQA 2P84A 4M78B 5GAOr 3EAEA 4M7DC 3V8LA 3GIBA 4J7IA 2E70A 2OAWA 4JPBW 2E41A 1KHCA 4FSSA 4II1A 5AT1B 5GANe 3GF5A 1UE9A 2QI2A 3CCRQ 2DTOA 3S6WA 4A54A 1UJYA 1G83A 3VS2A 1VQ4T 1M1KU 2P4TA 3INZA 5J3BA 2JJ9A 4M75F 1RI0A 2CP7A 1NZ9A 2J6FA 5CAIA 4GY5A 4BE0A 3KXTA 1BKBA 2CUBA 1Y7XA 1TTHB 1I8FA 1Y96B 3OS2A 3QYHB 3SD4A 3HHTB 1PCXA 3RMQA 1VQKA 3ER0A 4HCCA 4C8QF 2FHDA 2GFAA 4FW2A 2KEAA 1VQKT 4E7JA 2G3RA 2MCNA 3JCMP 3QDFA 4HCKA 2GCXA 2BIVA 3HFOA 1PNJA 2J06A 4JZ3A 1BI1A 2CH4A 4BB7A 4C5EA 3L2QA 3S3MA 2QAZA 3JB9G 1ZBJA 1OPKA 1PSEA 4M7DF 3JV3A 1SHGA 3QDRB 5CK9A 4KUIA 1G3WA 4JRQA 2RI5A 3L2UA 5KYYA 2EPDA 3EFOB 2YHTA 3OYFA 2Y4XA 2RM4A 3BE3A 2EIFA 1NJIC 2J05A 2YRCA 1TSFA 3VS5A 1K4US 1U1TA 4RG2A 1W2BS 1WJRA 2LJ3A 2DEQA 8AT1B 1VQ7T 5I22A 1KD1U 1JBMA 1Y57A 2LT4A 3EHRA 4PNOA 3OS5A 4OMFB 2OJ2A 4B9WA 3P8HA 4LDXA 1W2BP 2B8AA 4LDYA 3TQ7P 2M0OA 4HA8A 1RABB 3J7AF 3M0UA 4WF2A 3F70A 3OBWA 2X4JA 4PLIA 1X6BA 2R58A 4XU0A 1VQ6Q 4EMKB 1M1FA 1ABQA 3M4GA 3QZ9B 2BZXA 2JN0A 3OYMA 3CCJA 1YITT 4XU1A 2JMCA 1VQNT 6AT1B 2XHCA 4M78C 1VQ9A 2AKLA 4QQGA 1VQPQ 2KGTA 4PJOD 4FSXA 2NUTA 4OGEA 5LJ3g 5LJ5h 2MOXA 1K73R 3CCVQ 1Y96A 1TXQA 3CMAA 2JS2A 3SWNA 5LL6S 3OW2P 2OTLA 3CMAT 2QGGA 1SF9A 1Q7YU 3CBOA 2QEXA 1J3TA 3I35A 2EQUA 1M90U 2PQWA 1X69A 2P4RA 2VB6A 4Z02A 1PKSA 2RHYA 4XAXB 4N4HA 3CC2A 3MO8A 2KSSA 1V29B 2ESWA 2MWPA 2KE9A 3SWNC 3CC2T 4PJJA 4R0KA 2EYZA 3HKSA 2D8JA 3EGUA 4AFUC 2E12A 2QYZA 3X24B 1X27A 3VS6A 2LRQA 1MNEA 1M30A 2YRVA 1S72T 1B07A 1Q82C 4J6XA 2DPPB 4QQDA 3VS7A 1V76A 1OV3A 3ZEHA 1UG1A 4M75G 4M78F 1D1BA 5KYWB 3QWXX 3QJ6A 2EWNA 3BDLA 3M9QA 1RL2A 2CREA 1FYNA 3UATA 4CC4B 4FYWB 1M27C 1VA7A 4X1VA 1VQ5A 2VVKA 2LC4A 3ZL7C 2E6NA 5GMKe 1E7OA 1OPLA 1YHQT 1QMCA 4HT9A 1IO6A 2EBPA 4IIMA 1GBQA 2JM8A 1VQ5T 4C8QG 3OW2A 2DLPA 4LE9A 4NL3A 4F17A 4QQ6A 2FL7A 4PJOE 1QVPA 1Q95G 2DXUA 1X01A 1NPPA 1QCOA 5CKHA 3NPFA 4MDWA 3M0QA 3I56T 1CKAA 3REAB 1W4SA 4F16A 3ZFJA 1D3BA 1WFWA 4X34A 5LJ5j 1R77A 1OZ2A 1VIFA 2CZ6B 3VS3A 1KK7A 4C0ZA 2LP5A 2CT3A 2DL4A 3JSCA 1ZA2B 1B3QA 3E9GA 2EW3A 2COZA 1ZA1B 1YI2T 4Z89A 3V8JA 1AHJB 4X9CA 3CBMA 5GAOl 2ZCFB 2QTVA 2D9TA 2HDAA 1D0ZA 1U3OA 2F2WA 2KYBA 2M16A 2M9UA 2RD1A 5IH2A 2YUNA 1O9SA 1YFNA 2LDMA 1QKXA 3ULRB 4N4GA 1YJ9Q 2CH4W 3J80E 1YJWT 3EG2A 3CCQT 5IN1A 1BB9A 4PJOB 2OX7A 2VUBA 2L8DA 3A8OB 2ECZA 3PIOA 3CC4A 3I55Q 4LDVA 2DJQA 3E9FA 1Q81R 3DKMA 5FW9A 2EQMA 1JQQA 4C5HA 2CS7A 4F7UE 3REBB 5IAYA 3LYIA 3C94A 1BBZA 4C92A 3HSBA 3CXCS 4WCIA 2MYSA 1WGSA 4HT8A 4WTOB 1PHTA 4M77D 2RQWA 3OYNA 4IUPA 3CCEQ 2F1LA 3PTAA 4A53A 5GAMg 3HRUA 3OBYA 5GANg 2RN8A 5KYWA 3JCMb 4FU6A 1K9AA 3CXCP 3VS0A 2A3LA 2Y4YA 1BI0A 4M77G 3NTKA
chains in the Genus database with same CATH topology
4C92G 4C0FA 5CCAA 2VV5A 3DB4A 3O8VA 3G6ET 2KAFA 4ATOA 1JRIA 3CPWS 4ELYC 5GAOn 3P8DA 2KQWA 3META 1Q7YC 3JCMd 2KK4A 3UPUA 2DXTA 1YHQA 3QKJA 3MEVA 5GAN7 2LX9A 4KUDK 3QO3A 5I2SA 4V2SA 3JCMW 2RHIA 4M75B 1K9MC 3R6OA 1YJNT 1M90C 3OB9A 4JUVA 1N6AA 2JZ2A 2MMPA 1JJ2A 3T9NA 4J83A 2P0QA 4ME7A 5KE3A 4IKFA 2RK1A 2JUFA 3JCMc 3G7ZA 2NLUA 3JB9H 4MMLA 3M4YA 2QQAA 4EPCA 1U1SA 4F7UG 3JRZA 3I56A 2HQXA 1VQ6A 2ZPIB 3CCSA 4M7AF 2K57A 4M7AE 4JS5A 2OTJT 5LJ3e 4BACA 1YCYA 1M1GA 4RCCA 1X75C 4MZMA 4EMKA 1M4ZA 2WSCE 5D6WA 1VQ6T 3X20B 2F5KA 2FVUA 2QDYB 2D0QB 2RHUA 4F7UB 2RHZA 3QUIA 4PKCC 2X4WA 3N5BB 5GAN3 1UGRB 1N27A 1K8AU 2DKGA 2MAMA 3MP1A 4E7LA 4C8QC 2YLBA 3FIFA 5CQXA 1VUBA 5AYFA 2XDBA 3L2ZA 5LJ5d 3HL8A 5FLXE 5FRMA 3HRSA 3M58A 1P92A 3PFSA 4X9DA 2K5IA 2PVOB 3M59A 3OS1A 1YI2A 3L2VA 1VQPA 2RJCA 3PNWC 4Q5WA 3JCMh 2LCCA 3OYCA 3M55A 4A4FA 3G4SA 2K5FA 3A8LB 3ME9A 3RKWA 5DLOA 5GAN8 2CGHA 3UT1A 4DA4A 1VQPT 4KULA 2DO3A 1IZ6A 2XIDA 3CBPA 5GAOq 1B34A 3OA6A 3VU3C 3CCVA 4M7AA 3JCMf 4EMKC 2RK2A 1LNXA 3CCMT 3MHXA 4HCBA 2EYQA 4M78B 5GAOr 1JJ2S 2DTIA 3EAEA 4QW2A 3TCJA 4M7DC 3V8LA 3GIBA 2E65A 4J7IA 5DLQE 3HFNA 1D3BB 4M7AD 1QW1A 2CZ1B 4OVAA 1HXDA 3VYHB 1WNLA 2MI6A 1QVFA 2E70A 1I5LA 3OYGA 2E41A 1KHCA 2HBPA 2R57A 4II1A 3MEAA 5GANe 1YJWA 3GF5A 3CCJT 3CCQA 1KC8C 1X6OA 2JTFA 4QVCA 4BDYA 1VQMT 2QQBA 5GAOm 3WVDB 5KCOA 2QI2A 1Q86U 2DTOA 3S6WA 4A54A 4A4GA 5DM7R 3C4SA 3V7CA 1Q82U 2EQJA 1VQ4T 1G3TA 2GF7A 1M1KU 2P4TA 3INZA 5J3BA 4BI4A 4LD9K 4MZPA 4L6V5 4E7HA 1M9SA 3JCMJ 1VQ9T 1K73U 2QQRA 3LGFA 3A8GB 5CKBA 4J6WA 3V7RA 4M75F 1RI0A 5LJ3d 3UWNA 2IVWA 1Y71A 1NZ9A 2WSEE 4C0DB 1MGQA 3FEOA 3M54A 5HK0A 3RUXA 5LJ5f 5CAIA 5FRNA 4DOWA 4GY5A 4BE2A 4BE0A 2DXBA 2K3XA 2ZZDA 3KXTA 1BKBA 2K5LA 1Y7XA 4IUUA 1I8FA 1PSFA 3CCET 1Y96B 3OS2A 3QYHB 4J8OA 4XTUA 1W2BA 3SD4A 2OTLT 3C12A 3HHTB 3RMQA 3X28B 4IUVA 3GNGA 1VQKA 3ER0A 4UC4A 2P0PA 4C8QF 2FHDA 2GFAA 4HCCA 4C8QE 5KCHA 2QEXT 3CD6T 1KD1C 4BUGA 3RMSA 3CMEA 4OP0A 4PLLA 4NS5A 5GAN6 4E7JA 2RB6A 2G3RA 3X25B 1VQKT 3JCMP 4XTVA 5DY9A 2EJFA 2GCXA 2X4XA 3CMET 2BIVA 3HFOA 4OB2B 3MP6A 3GP8A 2Y90A 5GMKh 3DLLA 3OS0A 1QVFS 3ZBDA 1BI1A 4C5EA 2EJ9A 3RKYA 3JCMg 4BB7A 3JCMX 3L2QA 3S3MA 4M75A 3JB9G 3HPWA 5GMKl 2JTMA 2EFIA 3E1SA 4DQ2A 3RERA 2RJEA 2QA4A 3FC3A 1NE8A 1PSEA 4M77B 3OYIA 2CKKA 4Y28E 2DZCA 1YJNA 4M7DF 5CVIA 4M7DE 1M8VA 5CO7A 4ZGEB 4C92B 3C95A 2QA4T 3CEYA 3QDRB 4M75D 5CK9A 4KUIA 3CCUT 3QJYA 5GAMj 1R8OB 5GANj 1G3WA 2K3YA 4NOYA 3VYGA 4B9XA 3OYHA 4JRQA 4C8QA 1BIAA 2QQSA 2RI5A 1Q81C 3L2UA 3G71A 4EMGA 4LDUA 2EQKA 4BD3A 3WVEB 2WACA 2YHTA 3OYFA 2Y4XA 3CCLT 3OYDA 2RM4A 3CPFA 5LJ3f 2EIFA 3VUBA 3G71T 2OTJA 2L3RA 1NJIC 3A5ZB 2VXFA 4L5GA 2E1HA 3WXMB 4C8QD 4M75C 5FU7B 1U1TA 4RG2A 3RESA 1W2BS 1WJRA 1WJQA 2DEQA 3FDRA 2KDSA 1VQ7T 3BY7A 3TREA 1KD1U 2EKOA 1JBMA 2LT4A 1QVGA 1KQ1A 2O4XA 3PGGA 4PNOA 2R5AA 4C5GA 1BI2A 3OS5A 2RI2A 1QP2A 4OMFB 4XTXA 4B9WA 5LJ5g 3LX7A 4M7DA 5HK3A 1ZQ1A 3P8HA 3CC7T 4LDXA 4XTWA 3QSUA 1BI3A 2CYZB 1N9RA 3S3OA 2B8AA 4PJOF 3NTIA 4XQ3A 1WQ7A 4A4EA 4LDYA 2M0OA 3LGLA 5GAN4 4M7DD 4HA8A 3GNFB 3JB9I 2OAUA 2DJZA 3PMIA 2ZPHB 4C5IA 1OZ3A 2CZ7B 3DLMA 4C0GA 1BYMA 2IG0A 3QBYA 3J7AF 4CI0C 5CQYA 3CCMA 4WF2A 3F70A 2JNGA 1LJOA 2A7YA 3OBWA 4E7KA 1YIJT 1VQLA 2X4JA 3NFCA 4JLGA 2EJGA 4JDSA 2GFUA 3BDUA 4PLIA 4M7DG 1I81A 2R58A 3FB9A 1JB0E 2RI3A 2KY9A 4MMKA 3P8BB 4XU0A 3SB2A 1VQLT 1LOJA 2BKDN 4M78D 2X4YA 4EMKB 4ZN1A 1M1FA 3M57A 3OSSC 2VGNA 1YJ9A 1U8RA 5M9OA 1EIFA 1ZHIA 3M4GA 3QZ9B 4OF1A 2JN0A 4BI3A 2AHJB 3QZ5B 4JJNK 1OYXA 2XKOC 3OMCA 2DD4A 3VV0A 2E64A 5GANf 1YJ9T 2X35A 3OYMA 3CCJA 1YITT 2RJDA 1GXIE 3CCRT 2PU9B 3OYKA 4XU1A 1VQMA 4PJOA 4XK8E 2CZ0B 1VQNT 5GAMe 2RA2A 4RKUE 4KBMB 2DIGA 4XTZA 1VQ4A 3I55A 2FB7A 5CIUA 2XHCA 3FLGA 4M78C 1N8RU 4M7AG 1UGPB 2ZPGB 3HRTA 3LW5E 1QVGS 5CR2A 1VQ9A 4QQGA 2VXEA 4P5NA 3I55T 4PJOD 5HKCA 4FSXA 3X26B 5LJ3g 4OGEA 3AHUA 3BFMA 5LJ5h 3M5AA 1YBYA 1B34B 2E6ZA 2F69A 2L5QA 3OYYA 3ASKA 5J26A 4M7AB 1K8AC 4MDXA 3L1AA 1Y96A 3CMAA 4M75E 3SWNA 4ZGJB 2ZPBB 5LL6S 5FU6B 3Q1JA 3A8HB 3LLRA 3EFSA 2LVMA 2M1HA 4NL2A 3CCEA 2OTLA 3CMAT 1Q7YU 4PJOC 3CBOA 1G5VA 2XI9A 3EFRA 3CD6A 2QEXA 4BE1A 3OYLA 1K9MU 4QVZA 2ZPEB 2EQUA 2V8JA 2PQWA 4RG8A 1M90U 4Y91A 4XTYA 2PVGB 2ZPFB 1BIBA 3M53A 3MEWA 1FX7A 4IUTA 4HKEA 4Z02A 3OYBA 3H8ZA 4OB3B 4C0DC 1VQ8T 2RHYA 1UEBA 1I4K1 4XAXB 4N4HA 4OB1B 4ZN3A 1XOVA 3MO8A 2KSSA 3CC2A 5D6XA 4F7UF 4OGCA 3FRNA 1V29B 4FIBA 3CC4T 4BY6B 1XQHA 3VUZA 2HQEA 1MHNA 2MWPA 3SWNC 3CC2T 3HKSA 3OY9A 2PUKB 1O75A 2E12A 3MCAB 4LDWA 2HD0A 4O6JA 5L8RE 3X24B 2XU8A 5EG2A 2HAXA 2LRQA 3OSVA 4JRKA 2YRVA 2PUOB 3SFMA 3OYAA 3CCUA 5A0DA 1S72T 2LQKA 2XD0A 1DJ7B 5CKDA 1Q86C 1UGSB 1Q82C 1KQ2A 1M1KC 2VC8A 2DK3A 4J6XA 5HY6A 4O5VA 1M5Q1 5GAOp 3TU4K 2DPPB 5LJ3h 1K73C 2HNIA 4QQDA 3CCLA 3QPHA 3OMGA 2RO0A 5GAMd 2DZ9A 5CKFA 5GANd 3ZEHA 5GMKm 3LWHA 5IT9E 4IUQA 2QXFA 4M75G 4M78F 1HK9A 4M78E 3L42A 4M77C 1H3ZA 3JAME 2LNVA 3QJ6A 4LD6A 1Y07A 2EWNA 3BDLA 3M9QA 4C92C 3GLXA 4F7UA 1RL2A 1TH7A 5GMKi 1ZBXA 4CRIA 3OYEA 1VQ7A 4N0AA 3SDZA 1KG1A 3GPLA 1VQ5A 4BDZA 2LC4A 3MEUA 2E6NA 1VIEA 4RMOA 5GMKe 2MWOA 3CC7A 1YHQT 2E5QA 1G3SA 4D6WA 3JB9J 4HT9A 2GQVA 1SSFA 1VQ5T 2E10A 4C8QG 3OW2A 2LCLA 3KBGA 5FROA 2BUDA 2KMTA 2DAQA 5A0LA 4NL3A 3URGA 2LQ8A 4QQ6A 3S3NA 1XNIA 2FL7A 2O01E 1QVPA 4PJOE 5GAN5 5FU7C 2DXUA 2D6FA 1QP3A 4XU2A 4C8QB 1X01A 3PT9A 3VJPA 1KC8U 1IREB 1NPPA 2EAYA 2JOYA 5CKHA 3V7SA 3V8KA 1YIJA 4MDWA 3I56T 3DB3A 4M78A 2FYKA 3HP9A 4XU3A 4OB0B 3PIPA 3CCST 4YTLA 1W4SA 4J7FA 2ZGWA 4R55A 1KHIA 4N0AC 1H641 1FWZA 3ZFJA 1D3BA 2QTXA 3UDCA 4X34A 2V8IA 5LJ5j 1OZ2A 2WSFE 3E19A 3RKXA 3BW1A 4ELZC 2RJFA 1VIFA 1OI1A 5GAMh 5GANh 2MF2A 2CZ6B 4HCZA 5I21A 4JLIA 5J39A 3RIRA 2XDPA 2XICA 3L2WA 2O4XB 2PVDB 4J6YA 4C0ZA 1YITA 3CCRA 1KQSA 2F5TX 3JSCA 3FJPA 4M7DB 1VQNA 3E9GA 5GAMf 4ZTJA 2YLCA 2V8KA 1UB4A 4FL6A 4M78G 4IURA 4A4HA 1VQOA 1YI2T 3QIIA 3VKIA 4GLKA 3CXCA 4JS4A 2QQ9A 4E7IA 3V8JA 3JCMV 2KVQG 3LWIA 2XDDA 3LH0A 4EMHA 1AHJB 3TEEA 1VQOT 3G4ST 2H3JA 4X9CA 3CBMA 2XG8D 2ZCFB 5GAOl 2DTHA 2LT1A 3M56A 3NTKA 2DIQA 2D9TA 4FT4A 5KH6A 3J81E 3CCVT 3OW2S 2K4YA 1WJSA 3JCMe 5CKEA 4JRPA 2I2LA 4J5YA 4M77F 4DOVA 4M77E 4TVRA 3JCMQ 5C0MA 4ZGDB 2M16A 4C92F 4C92E 3A8MB 2DD5A 2M9UA 2RD1A 4R56A 5GMKj 3JB9F 5I2MA 1O9SA 2VGMA 4PJOG 2P0KA 4KT0E 3NTHA 1UGQB 2LDMA 3CPWA 4N4GA 1WPYA 4N4IA 2L89A 3J80E 3OQ5A 1WQWA 3QXEB 3MP8A 1YJWT 3CCQT 5IN1A 5D6YA 4PJOB 4FM4B 4M7AC 4L59A 1VQ8A 4ZTFA 2VUBA 3PMTA 5LJ3j 2L8DA 2XK0A 2R5MA 1Q81U 3A8OB 3L2RA 4RCBA 3PIOA 5FU6C 3CC4A 4LDVA 2RHXA 3E9FA 3DKMA 1KQSS 2VYTA 2EQMA 4C5HA 2C06A 2CS7A 3KUFA 4F7UE 4M77A 5IAYA 5GAN2 1NJIU 1G3YA 3H6ZA 2DVEA 3LYIA 4FT2A 4JRIA 3C94A 3QG1A 4EDUA 4C92A 1N9SA 4A4KA 5LJ5e 1S72A 3CXCS 4E47A 3HSBA 3QYGB 3SWNB 5A0GA 3OYJA 1XTDA 1WGSA 4HT8A 2RH2A 4PL6A 4QVDA 4M77D 4VUBA 1N8RC 3GOXA 3OYNA 4C92D 4IUPA 5A2QE 1NPRA 5C6SA 2K2VA 3PTAA 4A53A 5GAMg 3HRUA 3QHSA 3JB9D 3OBYA 5GANg 4BY6C 5KE2A 3JCMb 4FU6A 2JVVA 2LTOA 2A3LA 2DXCA 1BI0A 2Y4YA 4M77G 1FXXA 4BI8B 3G6EA 4MZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 G;  4PJO E;  5GAN 5;  2E64 A;  5GAN f;  1MGQ A;  5LJ5 f;  2DXU A;  3RUX A;  4XU2 A;  5CAI A;  4C8Q B;  4XU1 A;  1JRI A;  1X01 A;  4PJO A;  3V8K A;  2EAY A;  5GAO n;  3V7S A;  2RA2 A;  5GAM e;  1I8F A;  1Y96 B;  4M78 A;  2FYK A;  4XTZ A;  4XU3 A;  2FB7 A;  3JCM d;  4M78 C;  4XTU A;  2DXT A;  4M7A G;  5GAN 7;  2ZGW A;  4N0A C;  1H64 1;  3QO3 A;  4C8Q F;  4V2S A;  3JCM W;  1D3B A;  2QTX A;  4M75 B;  2VXE A;  4C8Q E;  4PJO D;  5LJ5 j;  4JUV A;  3RKX A;  5LJ3 g;  3BW1 A;  4OP0 A;  3BFM A;  5GAN 6;  5GAM h;  5GAN h;  2RB6 A;  5LJ5 h;  3AHU A;  3JCM P;  4XTV A;  1B34 B;  5DY9 A;  2EJF A;  4JLI A;  4M7A B;  5I21 A;  3RIR A;  3L1A A;  4J6Y A;  1Y96 A;  3JCM c;  3HFO A;  3FJP A;  4M75 E;  3SWN A;  2Y90 A;  5GMK h;  3JB9 H;  4M7D B;  4MML A;  5GAM f;  1U1S A;  2YLC A;  4F7U G;  2EJ9 A;  3RKY A;  3JCM g;  3EFS A;  4NL2 A;  3JCM X;  4M75 A;  3JB9 G;  4M78 G;  5GMK l;  4M7A F;  2K57 A;  4M7A E;  4DQ2 A;  5LJ3 e;  3RER A;  1YCY A;  4RCC A;  4PJO C;  3V8J A;  3EFR A;  3JCM V;  4M77 B;  4EMK A;  4M7D F;  2DZC A;  4EMH A;  4M7D E;  1M8V A;  4C92 B;  4X9C A;  4F7U B;  3QUI A;  5GAO l;  4M75 D;  4Y91 A;  2DTH A;  4XTY A;  5GAN 3;  1BIB A;  5GAM j;  5GAN j;  4NOY A;  3JCM e;  2I2L A;  4J5Y A;  2DKG A;  4M77 F;  4C8Q A;  1BIA A;  1I4K 1;  4M77 E;  3JCM Q;  4C8Q C;  2YLB A;  3FIF A;  4C92 F;  4EMG A;  4C92 E;  3L2Z A;  4F7U F;  2RD1 A;  5LJ5 d;  5GMK j;  3JB9 F;  2YHT A;  4X9D A;  2RM4 A;  4PJO G;  5LJ3 f;  3SWN C;  3JCM h;  2VXF A;  2E1H A;  4C8Q D;  4M75 C;  1WPY A;  3RKW A;  1U1T A;  3RES A;  5GAN 8;  1WQW A;  2CGH A;  2DEQ A;  4JRK A;  5GAO q;  1B34 A;  4M7A A;  3VU3 C;  3BY7 A;  3JCM f;  4EMK C;  4PJO B;  1LNX A;  1JBM A;  5LJ3 d;  4M7A C;  1KQ1 A;  4PNO A;  3PGG A;  1KQ2 A;  4XTX A;  5LJ5 g;  2VC8 A;  4J6X A;  4M78 B;  5LJ3 j;  5GAO r;  4M7D A;  2DTI A;  1M5Q 1;  4M7D C;  5GAO p;  4RCB A;  3V8L A;  4XTW A;  5LJ3 h;  2HNI A;  3GIB A;  2E65 A;  3QSU A;  3HFN A;  1N9R A;  1D3B B;  4PJO F;  4M7A D;  5GAM d;  2DZ9 A;  4XQ3 A;  1WQ7 A;  1HXD A;  5GMK m;  1WNL A;  5GAN d;  4F7U E;  4M77 A;  5GAN 2;  4M75 G;  4JRI A;  4M78 F;  2DVE A;  1HK9 A;  4M78 E;  4M77 C;  4HA8 A;  5GAN 4;  3JB9 I;  1I5L A;  2DJZ A;  4C92 A;  2E41 A;  4M7D D;  2EWN A;  4F7U A;  1N9S A;  4C92 C;  1TH7 A;  5GAN e;  5GMK i;  5LJ5 e;  3HSB A;  4QVC A;  3SWN B;  4N0A A;  4WF2 A;  5GAO m;  4HT8 A;  1LJO A;  2DTO A;  4A54 A;  4M77 D;  4QVD A;  3V7C A;  2EJG A;  3BDU A;  5GMK e;  4M7D G;  1I81 A;  3FB9 A;  3INZ A;  4C92 D;  3JB9 J;  4HT9 A;  4MMK A;  3SB2 A;  4XU0 A;  4A53 A;  5GAM g;  3QHS A;  3JCM J;  2E10 A;  1LOJ A;  4M78 D;  4C8Q G;  5GAN g;  3JB9 D;  3JCM b;  4EMK B;  4J6W A;  4NL3 A;  4M77 G;  3V7R A;  4M75 F;  3M4G A;  2JN0 A; 
#chains in the Genus database with same CATH topology
 2F2X A;  4OML A;  2KAF A;  4ATO A;  2K6D A;  1MND A;  1JRI A;  2AIR B;  8ATC B;  1T3L A;  3UPU A;  2LX9 A;  5I2S A;  3JCM W;  4M75 B;  1YWO A;  4JUV A;  3EG9 A;  4J83 A;  4ME7 A;  2RK1 A;  2JUF A;  3JCM c;  2DA9 A;  3JB9 H;  4MML A;  4E7Z A;  3CCS A;  4M7A E;  4JS5 A;  2OTJ T;  5LJ3 e;  4BAC A;  3CCL Q;  2PZ1 A;  2HBW A;  3G71 Q;  2F5K A;  1SPK A;  4F7U B;  1TUG B;  1U5S A;  5GAN 3;  1OX9 A;  1N27 A;  1K8A U;  2MAM A;  3MP1 A;  1VUB A;  2QG9 B;  2LJ1 A;  2MIO A;  5FRM A;  1LCK A;  3L2V A;  2VAS A;  2O88 A;  5KYN A;  3OYC A;  2VKN A;  4D8D A;  2HKQ B;  3G4S A;  5GAN 8;  5DLO A;  2DO3 A;  1IZ6 A;  2XID A;  3CBP A;  1B34 A;  3JCM f;  2LX7 A;  2RK2 A;  1UUE A;  1JJ2 S;  1YIJ Q;  3TCJ A;  5KYU A;  2E65 A;  3HFN A;  2CZ1 B;  1VQL Q;  4OVA A;  1HXD A;  1I5L A;  2FPE A;  3VRZ A;  2DNU A;  1X6O A;  2JTF A;  4QVC A;  1VQM T;  3WVD B;  1Q86 U;  3C4S A;  2D1X A;  1G3T A;  2GF7 A;  4LD9 K;  4BI4 A;  1RLQ C;  2K2M A;  4E7H A;  2QQR A;  3A8G B;  2LCS A;  4J6W A;  1IGQ A;  1E6H A;  1ZX6 A;  3LH5 A;  3RDV A;  3UWN A;  2IVW A;  2WSE E;  5HK0 A;  1K1Z A;  5LJ5 f;  3M54 A;  5FRN A;  1ZSZ B;  4BE2 A;  2DXB A;  2K3X A;  1NJI R;  1R0B G;  2L2P A;  4J8O A;  5KYX B;  1IB8 A;  3CD6 T;  1Y0M A;  1IHV A;  3RMS A;  5GAN 6;  3EHQ A;  1I5O B;  2HKN A;  5DY9 A;  1E6G A;  2Y90 A;  3DLL A;  1VQ8 Q;  3RKY A;  4M75 A;  2DIL A;  5GMK l;  1M3C A;  2JTM A;  3RER A;  2RJE A;  2QA4 A;  4DBQ A;  3TVT A;  4M77 B;  1AWW A;  1YJN A;  5CVI A;  1M8V A;  4ZGE B;  2JS0 A;  2QA4 T;  1QWF A;  3CCU T;  3QJY A;  1R8O B;  1WHK A;  4NOY A;  2K3Y A;  3VYG A;  2ED1 A;  4DBH A;  4C8Q A;  1Q81 C;  1ZSG A;  3WVE B;  2WAC A;  3OYD A;  2RMO A;  1X43 A;  2L3R A;  2VXF A;  1WXB A;  1AZG B;  4M75 C;  1H3H A;  3G6E Q;  4AFQ C;  5GJW B;  3BY7 A;  3TRE A;  2O4X A;  2RQU A;  3PGG A;  2R5A A;  2W0Z A;  4FYV B;  1QP2 A;  2X3W D;  1NM7 A;  4M7D A;  2DRM A;  2DX1 A;  3CC7 T;  2KRS A;  1N9R A;  4PJO F;  4A4E A;  1BCO A;  3JB9 I;  3GNF B;  1MV3 A;  2DJZ A;  4C5I A;  3PMI A;  4C0G A;  2CZ7 B;  3CCM A;  2JNG A;  4E7K A;  1BCM A;  4J9D A;  2NUP A;  1WX6 A;  3BDU A;  1I81 A;  1JB0 E;  1GBR A;  4MMK A;  4ZN1 A;  1PM3 A;  1U8R A;  2VGN A;  1ZHI A;  5EC7 A;  4OF1 A;  4JJN K;  2AHJ B;  2XKO C;  3VV0 A;  2X35 A;  2GTO A;  4J9E A;  1GXI E;  2RJD A;  3CCR T;  1D1C A;  3M0P A;  5GAM e;  4RKU E;  2SRC A;  1VQ4 A;  1NG2 A;  1N8R U;  2ZPG B;  3H0F A;  5IXB A;  4P5N A;  2AZV A;  3X26 B;  3MKD A;  1Q82 R;  3BFM A;  4J9H A;  2BZY A;  1YBY A;  2E6Z A;  2L5Q A;  3OYY A;  5J26 A;  2QGF B;  2FG0 A;  2ZPB B;  3Q1J A;  2KXD A;  3LLR A;  1D0X A;  3EFS A;  4NL2 A;  3EFR A;  4BE1 A;  3OYL A;  1K9M U;  4RG8 A;  2DE0 X;  3HTR A;  2PVG B;  4IUT A;  3M53 A;  4OB3 B;  2KNB B;  1M3B A;  4PFO A;  1ZSZ C;  4F7U F;  3FRN A;  4FIB A;  4BY6 B;  3E2U A;  1YN8 A;  2HQE A;  2HMA A;  2ED0 A;  2YUP A;  2PUK B;  3MCA B;  4LDW A;  3I5R A;  2HD0 A;  5L8R E;  1KQS P;  2XU8 A;  3OSV A;  1CSK A;  2LQK A;  1PG5 B;  1UGS B;  2LQN A;  2KI7 A;  1M1K C;  4AFZ C;  2G6F X;  4O5V A;  1M5Q 1;  4HVW A;  2HNI A;  2EVR A;  3OMG A;  5CKF A;  3PVQ A;  1VQK Q;  3LWH A;  3EGD B;  1WIE A;  4IUQ A;  2QXF A;  1H3Z A;  4M77 C;  3JAM E;  2BE9 B;  1Y07 A;  1F1B B;  3MPU B;  1VQ7 A;  1EX4 A;  3GPL A;  1PKT A;  4BDZ A;  2C0O A;  4RMO A;  1X6G A;  1ZLM A;  2KBT A;  1G3S A;  2A08 A;  4PJM A;  5FRO A;  2BUD A;  4ESR A;  4DBR A;  2KMT A;  2DAQ A;  2F2V A;  3URG A;  2B86 A;  2LQ8 A;  2JMA A;  1WHG A;  1M2V A;  3A1P A;  2D6F A;  1KFZ A;  3PT9 A;  1KC8 U;  1IRE B;  2M51 A;  4M78 A;  4XU3 A;  4OB0 B;  4J7F A;  1KHI A;  1HD3 A;  4KH1 B;  2QTX A;  1GCP A;  1AWX A;  2V8I A;  4ELZ C;  3RKX A;  3E19 A;  5GAM h;  5GAN h;  4HCZ A;  3RIR A;  2XDP A;  2XIC A;  4J6Y A;  5IHK A;  1YIT A;  1KQS A;  2YWW A;  3FJP A;  4OMN A;  1VQN A;  2DL3 A;  4FL6 A;  1VQO A;  3JCM V;  2KVQ G;  4EMH A;  3TEE A;  1VQO T;  1WHH A;  1KD1 C;  2DIQ A;  3CCV T;  3OW2 S;  5CKE A;  4JRP A;  2I2L A;  4M77 F;  4TVR A;  4DEY A;  3JCM Q;  4C92 E;  1QCF A;  4R56 A;  2KRN A;  2JM9 A;  3U23 A;  2EQI A;  4PJO G;  1LVK A;  2L0A A;  4PK4 A;  4KT0 E;  1UHC A;  1UGQ B;  2X3X D;  4N4I A;  5D6Y A;  2IIM A;  4L59 A;  3CCJ Q;  1QWE A;  1JU5 C;  3PMT A;  2XK0 A;  3L2R A;  2EYW A;  1RAI B;  2RHX A;  2C06 A;  1VQ9 Q;  2V26 A;  1TUD A;  3H6Z A;  2DVE A;  3QG1 A;  3RR6 A;  1WYX A;  4A4K A;  2YT6 A;  1S72 A;  4E47 A;  3QYG B;  3OYJ A;  5A0G A;  3EG1 A;  2RH2 A;  1GFC A;  4PL6 A;  3CMA Q;  1UHF A;  4QVD A;  4VUB A;  1RUW A;  2HL3 A;  5A2Q E;  3EFO A;  4AG2 C;  2OTL Q;  3QHS A;  1YP5 A;  1WLP B;  4BY6 C;  1K0X A;  2X9H A;  2QEX Q;  4BI8 B;  4RTW A;  4C0F A;  4KH0 B;  2J6K A;  2YUQ A;  5GAO n;  3D7S B;  1K0S A;  2KQW A;  3CC2 Q;  1Q7Y C;  1YHQ A;  3QKJ A;  3MEV A;  1NEB A;  1QVF P;  4KUD K;  2RHI A;  1M90 C;  3OB9 A;  1N6A A;  2DBM A;  1QCN A;  1PRL C;  1YWP A;  2LMJ A;  2NLU A;  4GBQ A;  2ENM A;  3M4Y A;  4LXC A;  3EG0 A;  4F7U G;  1GFD A;  3I56 A;  2HQX A;  2FPF A;  1M1G A;  4EMK A;  1M4Z A;  1XJW B;  2I0N A;  2FPD A;  4Z8A A;  4DEX A;  2CP0 A;  3FIF A;  4AT1 B;  1UFF A;  5AYF A;  1VQ5 Q;  2FZG B;  3L2Z A;  2XDB A;  1UGV A;  3HRS A;  1B7T A;  3OS1 A;  1YI2 A;  1MMA A;  2RJC A;  2AK5 A;  2LCC A;  4CC3 A;  3M55 A;  1T3S A;  3TSW A;  4HXJ A;  4K11 A;  2CGH A;  3UT1 A;  1WXU A;  4EMK C;  3MHX A;  2D0N A;  1UDL A;  2MPX C;  5DLQ E;  1U06 A;  4M7A D;  1QW1 A;  1WNL A;  2MI6 A;  1QVF A;  4HVU A;  3C0C A;  1UJ0 A;  4EIK A;  2AKK A;  2R57 A;  1YJW A;  3CCQ A;  1C1A A;  2KRM A;  2BZ8 A;  4BDY A;  5GAO m;  1WA7 A;  1H92 A;  3V7C A;  3TSZ A;  2EQJ A;  1Q86 R;  4MZP A;  1V1C A;  1WXT A;  1M9S A;  1K73 U;  2IPO B;  5CKB A;  3V7R A;  2H3E B;  5LJ3 d;  4DBF A;  4F14 A;  1QVG P;  1MGQ A;  1JEG A;  2QAS A;  4DOW A;  1C0M A;  2ZZD A;  4AG1 C;  4E2F B;  2XMF A;  3CCE T;  1SRM A;  4XTU A;  4RUG A;  1RAF B;  4IUV A;  4UC4 A;  4C8Q E;  5KCH A;  4BUG A;  1AT1 B;  3CME A;  2KR3 A;  3M0R A;  4OP0 A;  4PLL A;  3X25 B;  4XTV A;  2EJF A;  2X4X A;  3CME T;  4OB2 B;  5GMK h;  3OS0 A;  3ZBD A;  1SG5 A;  3JCM g;  3HPW A;  2EFI A;  4RTT A;  3CC4 Q;  3EGX B;  3OYI A;  2CKK A;  4M7D E;  1G2B A;  3C95 A;  3CEY A;  3AT1 B;  3G1J A;  3OYH A;  1YCS B;  2V1R A;  2QQS A;  3G71 A;  4J9I A;  1ZUK A;  4QKU A;  3CCL T;  3CPF A;  3VUB A;  3G71 T;  2OTJ A;  1IGU A;  3A5Z B;  4L5G A;  3WXM B;  1OQK A;  2E1H A;  3RES A;  1KSW A;  1WJQ A;  3FDR A;  2KDS A;  1AVZ C;  2E4H A;  2LNH B;  1QVG A;  3IQL A;  4XTX A;  5LJ5 g;  1ZQ1 A;  1AEY A;  4XTW A;  3QSU A;  2CYZ B;  2QDL A;  3NTI A;  1WQ7 A;  2DMO A;  1RLP C;  3LGL A;  2OAU A;  1OZ3 A;  1SKU B;  3EH2 A;  4RTV A;  1BYM A;  1VYU A;  2IG0 A;  3QBY A;  1ACM B;  1NLP C;  2MK5 A;  5CQY A;  1LJO A;  3M0S A;  1YIJ T;  1VQL A;  4JDS A;  1HSQ A;  1IRX A;  3FB9 A;  2KY9 A;  3SB2 A;  1VQL T;  3CCS Q;  1LOJ A;  2BKD N;  2JW4 A;  2L3Q A;  2X4Y A;  2CUD A;  4M78 D;  3OSS C;  1UEC A;  2LZ6 B;  5M9O A;  1EIF A;  2E3I A;  4BI3 A;  3QZ5 B;  1OYX A;  3OMC A;  5GAN f;  2YDL A;  2PU9 B;  3OYK A;  1VQM A;  4PJO A;  1T0H A;  3I5S A;  1AZE A;  2CP2 A;  4KBM B;  2DIG A;  4ZNX A;  5CIU A;  2ROL A;  5CR2 A;  1N8R R;  2VXE A;  5HKC A;  2RQR A;  4B6M A;  1M1K R;  3M5A A;  3G4S Q;  2F69 A;  4M7A B;  3ASK A;  1K8A C;  2CSI A;  2M02 A;  3KFV A;  4PJL A;  5FU6 B;  1W6X A;  2EGA A;  2LVM A;  2DM1 A;  4PJO C;  1G5V A;  2XI9 A;  3CD6 A;  4QVZ A;  2V8J A;  2A0F B;  1NYG A;  3MEW A;  1FX7 A;  4HKE A;  4JZ4 A;  3OYB A;  1VQ8 T;  1UEB A;  1I4K 1;  1XOV A;  2C0I A;  1OU8 A;  2GTJ A;  3VUZ A;  4RTZ A;  3OY9 A;  1MUZ A;  2O9V A;  2DYB A;  5EG2 A;  4JRK A;  2PUO B;  3SFM A;  3CCU A;  5A0D A;  2XD0 A;  5CKD A;  1Q86 C;  3PE0 A;  2HSP A;  2FO0 A;  3TU4 K;  5LJ3 h;  1GRI A;  2DL7 A;  2RO0 A;  5GAM d;  5GAN d;  5GMK m;  5IT9 E;  1HK9 A;  4M78 E;  2DL8 A;  2QK0 A;  1KJW A;  5D7U A;  2LNV A;  4F7U A;  2C0T A;  5GMK i;  4CRI A;  3I9Q A;  1KG1 A;  3MEU A;  1VIE A;  2MWO A;  3CC7 A;  2E5Q A;  4D6W A;  2GQV A;  1M8M A;  3CPW P;  1KD1 R;  2QA4 Q;  5A0L A;  1MMD A;  1YJN Q;  2DRK A;  3H9N A;  2EGC A;  1XNI A;  3S3N A;  2O01 E;  5GAN 5;  1QP3 A;  4XU2 A;  3VJP A;  2HQH A;  5KYY B;  2EAY A;  1YNZ A;  2YUO A;  1D0Y A;  1RAA B;  1H64 1;  2DYI A;  3UDC A;  2ROT A;  2EYY A;  1TU0 B;  2J6O A;  3CCR A;  1GCQ C;  2YXY A;  4ZTJ A;  4E7S A;  2D8H A;  1UB4 A;  1OU9 A;  1N5Z A;  4GLK A;  4JS4 A;  2QQ9 A;  5FWC A;  4LUD A;  3GP8 A;  2DTH A;  5KH6 A;  3JCM e;  1ZUY A;  3CCM Q;  1ZSZ A;  4ZGD B;  2COY A;  4ORZ A;  1PWT A;  1FMW A;  2BTT A;  3EG3 A;  5KYX A;  4ANJ A;  2P0K A;  4HVV A;  3CPW A;  3CQT A;  2L89 A;  3RBB B;  3QXE B;  4RTU A;  3MP8 A;  1VOM A;  1Q7Y R;  3QWY A;  4FM4 B;  4M7A C;  1H8K A;  3THK A;  2RNA A;  5LJ3 j;  1FMK A;  1M90 R;  4RCB A;  1RAE B;  5FU6 C;  1VQ4 Q;  2HZY A;  1KQS S;  4OMO A;  1Z9Q A;  2VYT A;  4RTY A;  1QQJ A;  2KT1 A;  2NUT B;  4M77 A;  5GAN 2;  1NJI U;  1G3Y A;  4JRI A;  4FT2 A;  3VS1 A;  1G8X A;  1AWO A;  5LJ5 e;  1AD5 A;  3SWN B;  1XTD A;  3VRY A;  1N8R C;  2DER A;  3GOX A;  4C92 D;  1JO8 A;  1NPR A;  3JB9 D;  1TS9 A;  1PD1 A;  2LTO A;  1FXX A;  1HJD A;  1PC0 A;  4C92 G;  5CCA A;  4ELY C;  1OUL A;  3P8D A;  2DXT A;  5GAN 7;  1SHF A;  4LN2 A;  1I1J A;  4V2S A;  1K9M C;  1Z9Z A;  4CC2 A;  4KRT A;  3T9N A;  1X2K A;  4IKF A;  1LPL A;  3G7Z A;  1W70 A;  4EPC A;  2QQA A;  2HCK A;  3JRZ A;  1VQ6 A;  4M7A F;  1WHM A;  2RF0 A;  3GBQ A;  2ZAE A;  1AWJ A;  1VQ6 T;  3X20 B;  2FVU A;  2QDY B;  3QUI A;  4PKC C;  1TWB A;  3N5B B;  2A28 A;  2DET A;  1UGR B;  1R0C B;  2DKG A;  1VQ7 Q;  4OMM A;  4E7L A;  2LQW A;  2YLB A;  2FRW A;  1P92 A;  2K5I A;  4F04 B;  4J9F A;  1VQP A;  2COW A;  3JCM h;  3NHN A;  2E3H A;  4A4F A;  3A8L B;  3RKW A;  3ME9 A;  4DA4 A;  1VQP T;  3SHW A;  1RI9 A;  4KUL A;  5GAO q;  3CCV A;  2X51 A;  3R6N A;  2DTI A;  4QW2 A;  2CSQ A;  4FCY A;  2O2O A;  2JT4 A;  4KGX B;  2DBK A;  1D3B B;  3VYH B;  1HYO A;  1OEB A;  2PTK A;  3OYG A;  3PVL A;  2HBP A;  3MEA A;  3CCJ T;  1KC8 C;  2QQB A;  2DEU A;  5KCO A;  1YIT Q;  4A4G A;  1X2Q A;  5DM7 R;  1Q82 U;  1VQN Q;  2CDT A;  4L6V 5;  3JCM J;  1VQ9 T;  1VQO Q;  3O5Z A;  2GQI A;  3LGF A;  1MMG A;  1VYT A;  2CP6 A;  2FRY A;  4J9G A;  1Y71 A;  4C0D B;  3FEO A;  2FZC B;  3RUX A;  4RTX A;  2AT1 B;  3RNJ A;  2K5L A;  2M0Y A;  4IUU A;  1PSF A;  1K76 A;  2EYX A;  2OTL T;  1W2B A;  2CT4 A;  3C12 A;  2H8H A;  3X28 B;  4OMQ A;  3GNG A;  1GL5 A;  2P0P A;  2SEM A;  1TG0 A;  4FW1 A;  2QEX T;  2NUZ A;  2E5K A;  4Z88 A;  3EGD A;  1TOV A;  4NS5 A;  3H0I A;  2RB6 A;  2GNC A;  1RAG B;  2K9G A;  1QVF S;  3MP6 A;  1WHJ A;  2EJ9 A;  4GLM A;  3JCM X;  4DQ2 A;  1RAH B;  3E1S A;  3FC3 A;  1NE8 A;  2ABL A;  4Y28 E;  2DZC A;  3A98 A;  5CO7 A;  4C92 B;  4M75 D;  5GAM j;  5GAN j;  1RAD B;  1S72 Q;  4B9X A;  5HCK A;  1BIA A;  2DFU A;  4D8K A;  2L3P A;  2RQV A;  4LDU A;  4EMG A;  2EQK A;  3MJX A;  4BD3 A;  1VYV A;  2EGE A;  5LJ3 f;  9ATC B;  4C8Q D;  5FU7 B;  1JXM A;  5L23 A;  2EKO A;  3M0T A;  1KQ1 A;  4JJD A;  4C5G A;  3NGP A;  1BI2 A;  2RI2 A;  2A37 A;  3LX7 A;  5GJV B;  1TUC A;  5HK3 A;  2RQT A;  1BI3 A;  1YHQ Q;  3S3O A;  4XQ3 A;  1K8A R;  3EG9 B;  5GAN 4;  4M7D D;  2ZPH B;  3DLM A;  2EKH A;  5I11 A;  1QLY A;  1ABO A;  4CI0 C;  2A7Y A;  3FJ5 A;  4JLG A;  3NFC A;  2CP3 A;  2EJG A;  2GFU A;  4M7D G;  2RI3 A;  3I56 Q;  3P8B B;  3M57 A;  1YJ9 A;  4PFZ A;  2J7I A;  2KXC A;  2W10 A;  2DL5 A;  2DD4 A;  2E64 A;  1YJ9 T;  2FZK B;  4XK8 E;  2CZ0 B;  2RA2 A;  4XTZ A;  2AZS A;  3SEM A;  2FB7 A;  3I55 A;  4M7A G;  3FLG A;  5FWB A;  1UGP B;  3HRT A;  3LW5 E;  4LUE A;  1YI2 Q;  1QVG S;  3I55 T;  4FYX B;  4AFS C;  3AHU A;  1MV0 B;  1B34 B;  4MDX A;  3L1A A;  2K3B A;  2O31 A;  4M75 E;  4ZGJ B;  2YSQ A;  1NEG A;  3A8H B;  3CCE A;  5KYU B;  2M1H A;  1NLO C;  2PNI A;  3H41 A;  1M3A A;  2ZPE B;  3H0H A;  4Y91 A;  1ARK A;  4XTY A;  2ZPF B;  1BIB A;  1AOJ A;  3H8Z A;  1YJW Q;  4C0D C;  3CCQ Q;  4OB1 B;  4ZN3 A;  1M2O A;  5D6X A;  4OGC A;  4FYY B;  3CC4 T;  1XQH A;  1MHN A;  2RPN A;  4JJB A;  1O75 A;  4O6J A;  1FMV A;  2HAX A;  3OYA A;  7AT1 B;  1DJ7 B;  2NWM A;  1KQ2 A;  1I07 A;  2VC8 A;  2DK3 A;  2HEQ A;  5HY6 A;  1C6V X;  2GGR A;  5GAO p;  1SRL A;  1K73 C;  3CCL A;  3QPH A;  1JXO A;  2GBQ A;  2DZ9 A;  1D1A A;  2NYS A;  3L42 A;  4LD6 A;  3CME Q;  4C92 C;  3GLX A;  1W1F A;  1TH7 A;  1ZBX A;  3OYE A;  2HSE B;  3UA7 A;  4N0A A;  3SDZ A;  1D09 B;  3JB9 J;  1SSF A;  1WDX A;  2E10 A;  4PFP A;  2LCL A;  3KBG A;  4IIO A;  4JJC A;  2DVJ A;  5FU7 C;  2DF6 A;  4C8Q B;  2JOY A;  3V8K A;  1YIJ A;  3V7S A;  3DB3 A;  3PIP A;  2FYK A;  3HP9 A;  3CCS T;  4YTL A;  2OI3 A;  2ZGW A;  4R55 A;  4N0A C;  1BK2 A;  1FWZ A;  4LNP A;  2OTJ Q;  2KT8 A;  2WSF E;  4KGV B;  3BW1 A;  1PRM C;  2RJF A;  4J9C A;  1OI1 A;  2V1Q A;  2MF2 A;  4E6R A;  1IXD A;  5I21 A;  3UA6 A;  4JLI A;  5J39 A;  3L2W A;  2O4X B;  2PVD B;  2F5T X;  1SSH A;  4OMP A;  4M7D B;  5GAM f;  1T0J A;  2YLC A;  2V8K A;  2JXB A;  2A36 A;  4M78 G;  4IUR A;  4A4H A;  3QII A;  1EFN A;  3VKI A;  3CXC A;  1IHW A;  4E7I A;  1WZO A;  3EH1 A;  3LWI A;  2XDD A;  3LH0 A;  2K7A A;  3G4S T;  2H3J A;  1NYF A;  2XG8 D;  2FEI A;  2LJ0 A;  2LT1 A;  3M56 A;  4FT4 A;  3J81 E;  2K4Y A;  1WJS A;  4J5Y A;  4DOV A;  1I0C A;  4M77 E;  5C0M A;  4J9B A;  2NUP B;  5IHN A;  4C92 F;  3A8M B;  2DD5 A;  5IHI A;  5GMK j;  1MMN A;  3JB9 F;  4PJN A;  5I2M A;  2VGM A;  3NTH A;  1JJ2 P;  1WPY A;  3OQ5 A;  1WQW A;  2KRO A;  1WI7 A;  1VQ8 A;  4ZTF A;  1VQM Q;  1K9M R;  4AMC A;  2R5M A;  1Q81 U;  1QKW A;  2BE7 D;  2JTE A;  2CP5 A;  3KUF A;  1KIK A;  3EGX A;  4EDU A;  4M4Z A;  2YRD A;  1N9S A;  2Z0W A;  1PD0 A;  5C6S A;  2K2V A;  4CC7 A;  1S1N A;  5KE2 A;  2JVV A;  3CD6 Q;  2DXC A;  5ECA A;  3G6E A;  1OOT A;  2VWF A;  4MZT A;  2O9S A;  2VV5 A;  3DB4 A;  1CKB A;  3O8V A;  3G6E T;  1BU1 A;  3CPW S;  2ATC B;  1OX8 A;  3MET A;  1WHL A;  3JCM d;  2KK4 A;  1RAC B;  1EZZ B;  3NMZ C;  3QO3 A;  3R6O A;  1YJN T;  2HL5 C;  2JZ2 A;  2MMP A;  1JJ2 A;  2P0Q A;  5KE3 A;  2K79 A;  2KYM A;  1NBE B;  1GCQ A;  3CCU Q;  1SEM A;  1U1S A;  4KGZ B;  1A0N B;  2ZPI B;  2K57 A;  3UF4 A;  1YCY A;  4RCC A;  1X75 C;  4MZM A;  1KC8 R;  4Y92 A;  2WSC E;  5D6W A;  4A63 B;  2D0Q B;  2RHU A;  1ZUU A;  2RHZ A;  2X4W A;  4C8Q C;  5CQX A;  5LJ5 d;  3HL8 A;  5FLX E;  3VS4 A;  3M58 A;  3PFS A;  4X9D A;  2PVO B;  3M59 A;  3CC7 Q;  1UTI A;  3PNW C;  4Q5W A;  2L3S A;  4QT7 A;  5IXF A;  2K5F A;  1M2V B;  3OA6 A;  4M7A A;  3VU3 C;  3CCM T;  1LNX A;  4HCB A;  2EYQ A;  2P84 A;  4M78 B;  5GAO r;  3EAE A;  4M7D C;  3V8L A;  3GIB A;  4J7I A;  2E70 A;  2OAW A;  4JPB W;  2E41 A;  1KHC A;  4FSS A;  4II1 A;  5AT1 B;  5GAN e;  3GF5 A;  1UE9 A;  2QI2 A;  3CCR Q;  2DTO A;  3S6W A;  4A54 A;  1UJY A;  1G83 A;  3VS2 A;  1VQ4 T;  1M1K U;  2P4T A;  3INZ A;  5J3B A;  2JJ9 A;  4M75 F;  1RI0 A;  2CP7 A;  1NZ9 A;  2J6F A;  5CAI A;  4GY5 A;  4BE0 A;  3KXT A;  1BKB A;  2CUB A;  1Y7X A;  1TTH B;  1I8F A;  1Y96 B;  3OS2 A;  3QYH B;  3SD4 A;  3HHT B;  1PCX A;  3RMQ A;  1VQK A;  3ER0 A;  4HCC A;  4C8Q F;  2FHD A;  2GFA A;  4FW2 A;  2KEA A;  1VQK T;  4E7J A;  2G3R A;  2MCN A;  3JCM P;  3QDF A;  4HCK A;  2GCX A;  2BIV A;  3HFO A;  1PNJ A;  2J06 A;  4JZ3 A;  1BI1 A;  2CH4 A;  4BB7 A;  4C5E A;  3L2Q A;  3S3M A;  2QAZ A;  3JB9 G;  1ZBJ A;  1OPK A;  1PSE A;  4M7D F;  3JV3 A;  1SHG A;  3QDR B;  5CK9 A;  4KUI A;  1G3W A;  4JRQ A;  2RI5 A;  3L2U A;  5KYY A;  2EPD A;  3EFO B;  2YHT A;  3OYF A;  2Y4X A;  2RM4 A;  3BE3 A;  2EIF A;  1NJI C;  2J05 A;  2YRC A;  1TSF A;  3VS5 A;  1K4U S;  1U1T A;  4RG2 A;  1W2B S;  1WJR A;  2LJ3 A;  2DEQ A;  8AT1 B;  1VQ7 T;  5I22 A;  1KD1 U;  1JBM A;  1Y57 A;  2LT4 A;  3EHR A;  4PNO A;  3OS5 A;  4OMF B;  2OJ2 A;  4B9W A;  3P8H A;  4LDX A;  1W2B P;  2B8A A;  4LDY A;  3TQ7 P;  2M0O A;  4HA8 A;  1RAB B;  3J7A F;  3M0U A;  4WF2 A;  3F70 A;  3OBW A;  2X4J A;  4PLI A;  1X6B A;  2R58 A;  4XU0 A;  1VQ6 Q;  4EMK B;  1M1F A;  1ABQ A;  3M4G A;  3QZ9 B;  2BZX A;  2JN0 A;  3OYM A;  3CCJ A;  1YIT T;  4XU1 A;  2JMC A;  1VQN T;  6AT1 B;  2XHC A;  4M78 C;  1VQ9 A;  2AKL A;  4QQG A;  1VQP Q;  2KGT A;  4PJO D;  4FSX A;  2NUT A;  4OGE A;  5LJ3 g;  5LJ5 h;  2MOX A;  1K73 R;  3CCV Q;  1Y96 A;  1TXQ A;  3CMA A;  2JS2 A;  3SWN A;  5LL6 S;  3OW2 P;  2OTL A;  3CMA T;  2QGG A;  1SF9 A;  1Q7Y U;  3CBO A;  2QEX A;  1J3T A;  3I35 A;  2EQU A;  1M90 U;  2PQW A;  1X69 A;  2P4R A;  2VB6 A;  4Z02 A;  1PKS A;  2RHY A;  4XAX B;  4N4H A;  3CC2 A;  3MO8 A;  2KSS A;  1V29 B;  2ESW A;  2MWP A;  2KE9 A;  3SWN C;  3CC2 T;  4PJJ A;  4R0K A;  2EYZ A;  3HKS A;  2D8J A;  3EGU A;  4AFU C;  2E12 A;  2QYZ A;  3X24 B;  1X27 A;  3VS6 A;  2LRQ A;  1MNE A;  1M30 A;  2YRV A;  1S72 T;  1B07 A;  1Q82 C;  4J6X A;  2DPP B;  4QQD A;  3VS7 A;  1V76 A;  1OV3 A;  3ZEH A;  1UG1 A;  4M75 G;  4M78 F;  1D1B A;  5KYW B;  3QWX X;  3QJ6 A;  2EWN A;  3BDL A;  3M9Q A;  1RL2 A;  2CRE A;  1FYN A;  3UAT A;  4CC4 B;  4FYW B;  1M27 C;  1VA7 A;  4X1V A;  1VQ5 A;  2VVK A;  2LC4 A;  3ZL7 C;  2E6N A;  5GMK e;  1E7O A;  1OPL A;  1YHQ T;  1QMC A;  4HT9 A;  1IO6 A;  2EBP A;  4IIM A;  1GBQ A;  2JM8 A;  1VQ5 T;  4C8Q G;  3OW2 A;  2DLP A;  4LE9 A;  4NL3 A;  4F17 A;  4QQ6 A;  2FL7 A;  4PJO E;  1QVP A;  1Q95 G;  2DXU A;  1X01 A;  1NPP A;  1QCO A;  5CKH A;  3NPF A;  4MDW A;  3M0Q A;  3I56 T;  1CKA A;  3REA B;  1W4S A;  4F16 A;  3ZFJ A;  1D3B A;  1WFW A;  4X34 A;  5LJ5 j;  1R77 A;  1OZ2 A;  1VIF A;  2CZ6 B;  3VS3 A;  1KK7 A;  4C0Z A;  2LP5 A;  2CT3 A;  2DL4 A;  3JSC A;  1ZA2 B;  1B3Q A;  3E9G A;  2EW3 A;  2COZ A;  1ZA1 B;  1YI2 T;  4Z89 A;  3V8J A;  1AHJ B;  4X9C A;  3CBM A;  5GAO l;  2ZCF B;  2QTV A;  2D9T A;  2HDA A;  1D0Z A;  1U3O A;  2F2W A;  2KYB A;  2M16 A;  2M9U A;  2RD1 A;  5IH2 A;  2YUN A;  1O9S A;  1YFN A;  2LDM A;  1QKX A;  3ULR B;  4N4G A;  1YJ9 Q;  2CH4 W;  3J80 E;  1YJW T;  3EG2 A;  3CCQ T;  5IN1 A;  1BB9 A;  4PJO B;  2OX7 A;  2VUB A;  2L8D A;  3A8O B;  2ECZ A;  3PIO A;  3CC4 A;  3I55 Q;  4LDV A;  2DJQ A;  3E9F A;  1Q81 R;  3DKM A;  5FW9 A;  2EQM A;  1JQQ A;  4C5H A;  2CS7 A;  4F7U E;  3REB B;  5IAY A;  3LYI A;  3C94 A;  1BBZ A;  4C92 A;  3HSB A;  3CXC S;  4WCI A;  2MYS A;  1WGS A;  4HT8 A;  4WTO B;  1PHT A;  4M77 D;  2RQW A;  3OYN A;  4IUP A;  3CCE Q;  2F1L A;  3PTA A;  4A53 A;  5GAM g;  3HRU A;  3OBY A;  5GAN g;  2RN8 A;  5KYW A;  3JCM b;  4FU6 A;  1K9A A;  3CXC P;  3VS0 A;  2A3L A;  2Y4Y A;  1BI0 A;  4M77 G;  3NTK A; 
#chains in the Genus database with same CATH homology
 4C92 G;  4C0F A;  5CCA A;  2VV5 A;  3DB4 A;  3O8V A;  3G6E T;  2KAF A;  4ATO A;  1JRI A;  3CPW S;  4ELY C;  5GAO n;  3P8D A;  2KQW A;  3MET A;  1Q7Y C;  3JCM d;  2KK4 A;  3UPU A;  2DXT A;  1YHQ A;  3QKJ A;  3MEV A;  5GAN 7;  2LX9 A;  4KUD K;  3QO3 A;  5I2S A;  4V2S A;  3JCM W;  2RHI A;  4M75 B;  1K9M C;  3R6O A;  1YJN T;  1M90 C;  3OB9 A;  4JUV A;  1N6A A;  2JZ2 A;  2MMP A;  1JJ2 A;  3T9N A;  4J83 A;  2P0Q A;  4ME7 A;  5KE3 A;  4IKF A;  2RK1 A;  2JUF A;  3JCM c;  3G7Z A;  2NLU A;  3JB9 H;  4MML A;  3M4Y A;  2QQA A;  4EPC A;  1U1S A;  4F7U G;  3JRZ A;  3I56 A;  2HQX A;  1VQ6 A;  2ZPI B;  3CCS A;  4M7A F;  2K57 A;  4M7A E;  4JS5 A;  2OTJ T;  5LJ3 e;  4BAC A;  1YCY A;  1M1G A;  4RCC A;  1X75 C;  4MZM A;  4EMK A;  1M4Z A;  2WSC E;  5D6W A;  1VQ6 T;  3X20 B;  2F5K A;  2FVU A;  2QDY B;  2D0Q B;  2RHU A;  4F7U B;  2RHZ A;  3QUI A;  4PKC C;  2X4W A;  3N5B B;  5GAN 3;  1UGR B;  1N27 A;  1K8A U;  2DKG A;  2MAM A;  3MP1 A;  4E7L A;  4C8Q C;  2YLB A;  3FIF A;  5CQX A;  1VUB A;  5AYF A;  2XDB A;  3L2Z A;  5LJ5 d;  3HL8 A;  5FLX E;  5FRM A;  3HRS A;  3M58 A;  1P92 A;  3PFS A;  4X9D A;  2K5I A;  2PVO B;  3M59 A;  3OS1 A;  1YI2 A;  3L2V A;  1VQP A;  2RJC A;  3PNW C;  4Q5W A;  3JCM h;  2LCC A;  3OYC A;  3M55 A;  4A4F A;  3G4S A;  2K5F A;  3A8L B;  3ME9 A;  3RKW A;  5DLO A;  5GAN 8;  2CGH A;  3UT1 A;  4DA4 A;  1VQP T;  4KUL A;  2DO3 A;  1IZ6 A;  2XID A;  3CBP A;  5GAO q;  1B34 A;  3OA6 A;  3VU3 C;  3CCV A;  4M7A A;  3JCM f;  4EMK C;  2RK2 A;  1LNX A;  3CCM T;  3MHX A;  4HCB A;  2EYQ A;  4M78 B;  5GAO r;  1JJ2 S;  2DTI A;  3EAE A;  4QW2 A;  3TCJ A;  4M7D C;  3V8L A;  3GIB A;  2E65 A;  4J7I A;  5DLQ E;  3HFN A;  1D3B B;  4M7A D;  1QW1 A;  2CZ1 B;  4OVA A;  1HXD A;  3VYH B;  1WNL A;  2MI6 A;  1QVF A;  2E70 A;  1I5L A;  3OYG A;  2E41 A;  1KHC A;  2HBP A;  2R57 A;  4II1 A;  3MEA A;  5GAN e;  1YJW A;  3GF5 A;  3CCJ T;  3CCQ A;  1KC8 C;  1X6O A;  2JTF A;  4QVC A;  4BDY A;  1VQM T;  2QQB A;  5GAO m;  3WVD B;  5KCO A;  2QI2 A;  1Q86 U;  2DTO A;  3S6W A;  4A54 A;  4A4G A;  5DM7 R;  3C4S A;  3V7C A;  1Q82 U;  2EQJ A;  1VQ4 T;  1G3T A;  2GF7 A;  1M1K U;  2P4T A;  3INZ A;  5J3B A;  4BI4 A;  4LD9 K;  4MZP A;  4L6V 5;  4E7H A;  1M9S A;  3JCM J;  1VQ9 T;  1K73 U;  2QQR A;  3LGF A;  3A8G B;  5CKB A;  4J6W A;  3V7R A;  4M75 F;  1RI0 A;  5LJ3 d;  3UWN A;  2IVW A;  1Y71 A;  1NZ9 A;  2WSE E;  4C0D B;  1MGQ A;  3FEO A;  3M54 A;  5HK0 A;  3RUX A;  5LJ5 f;  5CAI A;  5FRN A;  4DOW A;  4GY5 A;  4BE2 A;  4BE0 A;  2DXB A;  2K3X A;  2ZZD A;  3KXT A;  1BKB A;  2K5L A;  1Y7X A;  4IUU A;  1I8F A;  1PSF A;  3CCE T;  1Y96 B;  3OS2 A;  3QYH B;  4J8O A;  4XTU A;  1W2B A;  3SD4 A;  2OTL T;  3C12 A;  3HHT B;  3RMQ A;  3X28 B;  4IUV A;  3GNG A;  1VQK A;  3ER0 A;  4UC4 A;  2P0P A;  4C8Q F;  2FHD A;  2GFA A;  4HCC A;  4C8Q E;  5KCH A;  2QEX T;  3CD6 T;  1KD1 C;  4BUG A;  3RMS A;  3CME A;  4OP0 A;  4PLL A;  4NS5 A;  5GAN 6;  4E7J A;  2RB6 A;  2G3R A;  3X25 B;  1VQK T;  3JCM P;  4XTV A;  5DY9 A;  2EJF A;  2GCX A;  2X4X A;  3CME T;  2BIV A;  3HFO A;  4OB2 B;  3MP6 A;  3GP8 A;  2Y90 A;  5GMK h;  3DLL A;  3OS0 A;  1QVF S;  3ZBD A;  1BI1 A;  4C5E A;  2EJ9 A;  3RKY A;  3JCM g;  4BB7 A;  3JCM X;  3L2Q A;  3S3M A;  4M75 A;  3JB9 G;  3HPW A;  5GMK l;  2JTM A;  2EFI A;  3E1S A;  4DQ2 A;  3RER A;  2RJE A;  2QA4 A;  3FC3 A;  1NE8 A;  1PSE A;  4M77 B;  3OYI A;  2CKK A;  4Y28 E;  2DZC A;  1YJN A;  4M7D F;  5CVI A;  4M7D E;  1M8V A;  5CO7 A;  4ZGE B;  4C92 B;  3C95 A;  2QA4 T;  3CEY A;  3QDR B;  4M75 D;  5CK9 A;  4KUI A;  3CCU T;  3QJY A;  5GAM j;  1R8O B;  5GAN j;  1G3W A;  2K3Y A;  4NOY A;  3VYG A;  4B9X A;  3OYH A;  4JRQ A;  4C8Q A;  1BIA A;  2QQS A;  2RI5 A;  1Q81 C;  3L2U A;  3G71 A;  4EMG A;  4LDU A;  2EQK A;  4BD3 A;  3WVE B;  2WAC A;  2YHT A;  3OYF A;  2Y4X A;  3CCL T;  3OYD A;  2RM4 A;  3CPF A;  5LJ3 f;  2EIF A;  3VUB A;  3G71 T;  2OTJ A;  2L3R A;  1NJI C;  3A5Z B;  2VXF A;  4L5G A;  2E1H A;  3WXM B;  4C8Q D;  4M75 C;  5FU7 B;  1U1T A;  4RG2 A;  3RES A;  1W2B S;  1WJR A;  1WJQ A;  2DEQ A;  3FDR A;  2KDS A;  1VQ7 T;  3BY7 A;  3TRE A;  1KD1 U;  2EKO A;  1JBM A;  2LT4 A;  1QVG A;  1KQ1 A;  2O4X A;  3PGG A;  4PNO A;  2R5A A;  4C5G A;  1BI2 A;  3OS5 A;  2RI2 A;  1QP2 A;  4OMF B;  4XTX A;  4B9W A;  5LJ5 g;  3LX7 A;  4M7D A;  5HK3 A;  1ZQ1 A;  3P8H A;  3CC7 T;  4LDX A;  4XTW A;  3QSU A;  1BI3 A;  2CYZ B;  1N9R A;  3S3O A;  2B8A A;  4PJO F;  3NTI A;  4XQ3 A;  1WQ7 A;  4A4E A;  4LDY A;  2M0O A;  3LGL A;  5GAN 4;  4M7D D;  4HA8 A;  3GNF B;  3JB9 I;  2OAU A;  2DJZ A;  3PMI A;  2ZPH B;  4C5I A;  1OZ3 A;  2CZ7 B;  3DLM A;  4C0G A;  1BYM A;  2IG0 A;  3QBY A;  3J7A F;  4CI0 C;  5CQY A;  3CCM A;  4WF2 A;  3F70 A;  2JNG A;  1LJO A;  2A7Y A;  3OBW A;  4E7K A;  1YIJ T;  1VQL A;  2X4J A;  3NFC A;  4JLG A;  2EJG A;  4JDS A;  2GFU A;  3BDU A;  4PLI A;  4M7D G;  1I81 A;  2R58 A;  3FB9 A;  1JB0 E;  2RI3 A;  2KY9 A;  4MMK A;  3P8B B;  4XU0 A;  3SB2 A;  1VQL T;  1LOJ A;  2BKD N;  4M78 D;  2X4Y A;  4EMK B;  4ZN1 A;  1M1F A;  3M57 A;  3OSS C;  2VGN A;  1YJ9 A;  1U8R A;  5M9O A;  1EIF A;  1ZHI A;  3M4G A;  3QZ9 B;  4OF1 A;  2JN0 A;  4BI3 A;  2AHJ B;  3QZ5 B;  4JJN K;  1OYX A;  2XKO C;  3OMC A;  2DD4 A;  3VV0 A;  2E64 A;  5GAN f;  1YJ9 T;  2X35 A;  3OYM A;  3CCJ A;  1YIT T;  2RJD A;  1GXI E;  3CCR T;  2PU9 B;  3OYK A;  4XU1 A;  1VQM A;  4PJO A;  4XK8 E;  2CZ0 B;  1VQN T;  5GAM e;  2RA2 A;  4RKU E;  4KBM B;  2DIG A;  4XTZ A;  1VQ4 A;  3I55 A;  2FB7 A;  5CIU A;  2XHC A;  3FLG A;  4M78 C;  1N8R U;  4M7A G;  1UGP B;  2ZPG B;  3HRT A;  3LW5 E;  1QVG S;  5CR2 A;  1VQ9 A;  4QQG A;  2VXE A;  4P5N A;  3I55 T;  4PJO D;  5HKC A;  4FSX A;  3X26 B;  5LJ3 g;  4OGE A;  3AHU A;  3BFM A;  5LJ5 h;  3M5A A;  1YBY A;  1B34 B;  2E6Z A;  2F69 A;  2L5Q A;  3OYY A;  3ASK A;  5J26 A;  4M7A B;  1K8A C;  4MDX A;  3L1A A;  1Y96 A;  3CMA A;  4M75 E;  3SWN A;  4ZGJ B;  2ZPB B;  5LL6 S;  5FU6 B;  3Q1J A;  3A8H B;  3LLR A;  3EFS A;  2LVM A;  2M1H A;  4NL2 A;  3CCE A;  2OTL A;  3CMA T;  1Q7Y U;  4PJO C;  3CBO A;  1G5V A;  2XI9 A;  3EFR A;  3CD6 A;  2QEX A;  4BE1 A;  3OYL A;  1K9M U;  4QVZ A;  2ZPE B;  2EQU A;  2V8J A;  2PQW A;  4RG8 A;  1M90 U;  4Y91 A;  4XTY A;  2PVG B;  2ZPF B;  1BIB A;  3M53 A;  3MEW A;  1FX7 A;  4IUT A;  4HKE A;  4Z02 A;  3OYB A;  3H8Z A;  4OB3 B;  4C0D C;  1VQ8 T;  2RHY A;  1UEB A;  1I4K 1;  4XAX B;  4N4H A;  4OB1 B;  4ZN3 A;  1XOV A;  3MO8 A;  2KSS A;  3CC2 A;  5D6X A;  4F7U F;  4OGC A;  3FRN A;  1V29 B;  4FIB A;  3CC4 T;  4BY6 B;  1XQH A;  3VUZ A;  2HQE A;  1MHN A;  2MWP A;  3SWN C;  3CC2 T;  3HKS A;  3OY9 A;  2PUK B;  1O75 A;  2E12 A;  3MCA B;  4LDW A;  2HD0 A;  4O6J A;  5L8R E;  3X24 B;  2XU8 A;  5EG2 A;  2HAX A;  2LRQ A;  3OSV A;  4JRK A;  2YRV A;  2PUO B;  3SFM A;  3OYA A;  3CCU A;  5A0D A;  1S72 T;  2LQK A;  2XD0 A;  1DJ7 B;  5CKD A;  1Q86 C;  1UGS B;  1Q82 C;  1KQ2 A;  1M1K C;  2VC8 A;  2DK3 A;  4J6X A;  5HY6 A;  4O5V A;  1M5Q 1;  5GAO p;  3TU4 K;  2DPP B;  5LJ3 h;  1K73 C;  2HNI A;  4QQD A;  3CCL A;  3QPH A;  3OMG A;  2RO0 A;  5GAM d;  2DZ9 A;  5CKF A;  5GAN d;  3ZEH A;  5GMK m;  3LWH A;  5IT9 E;  4IUQ A;  2QXF A;  4M75 G;  4M78 F;  1HK9 A;  4M78 E;  3L42 A;  4M77 C;  1H3Z A;  3JAM E;  2LNV A;  3QJ6 A;  4LD6 A;  1Y07 A;  2EWN A;  3BDL A;  3M9Q A;  4C92 C;  3GLX A;  4F7U A;  1RL2 A;  1TH7 A;  5GMK i;  1ZBX A;  4CRI A;  3OYE A;  1VQ7 A;  4N0A A;  3SDZ A;  1KG1 A;  3GPL A;  1VQ5 A;  4BDZ A;  2LC4 A;  3MEU A;  2E6N A;  1VIE A;  4RMO A;  5GMK e;  2MWO A;  3CC7 A;  1YHQ T;  2E5Q A;  1G3S A;  4D6W A;  3JB9 J;  4HT9 A;  2GQV A;  1SSF A;  1VQ5 T;  2E10 A;  4C8Q G;  3OW2 A;  2LCL A;  3KBG A;  5FRO A;  2BUD A;  2KMT A;  2DAQ A;  5A0L A;  4NL3 A;  3URG A;  2LQ8 A;  4QQ6 A;  3S3N A;  1XNI A;  2FL7 A;  2O01 E;  1QVP A;  4PJO E;  5GAN 5;  5FU7 C;  2DXU A;  2D6F A;  1QP3 A;  4XU2 A;  4C8Q B;  1X01 A;  3PT9 A;  3VJP A;  1KC8 U;  1IRE B;  1NPP A;  2EAY A;  2JOY A;  5CKH A;  3V7S A;  3V8K A;  1YIJ A;  4MDW A;  3I56 T;  3DB3 A;  4M78 A;  2FYK A;  3HP9 A;  4XU3 A;  4OB0 B;  3PIP A;  3CCS T;  4YTL A;  1W4S A;  4J7F A;  2ZGW A;  4R55 A;  1KHI A;  4N0A C;  1H64 1;  1FWZ A;  3ZFJ A;  1D3B A;  2QTX A;  3UDC A;  4X34 A;  2V8I A;  5LJ5 j;  1OZ2 A;  2WSF E;  3E19 A;  3RKX A;  3BW1 A;  4ELZ C;  2RJF A;  1VIF A;  1OI1 A;  5GAM h;  5GAN h;  2MF2 A;  2CZ6 B;  4HCZ A;  5I21 A;  4JLI A;  5J39 A;  3RIR A;  2XDP A;  2XIC A;  3L2W A;  2O4X B;  2PVD B;  4J6Y A;  4C0Z A;  1YIT A;  3CCR A;  1KQS A;  2F5T X;  3JSC A;  3FJP A;  4M7D B;  1VQN A;  3E9G A;  5GAM f;  4ZTJ A;  2YLC A;  2V8K A;  1UB4 A;  4FL6 A;  4M78 G;  4IUR A;  4A4H A;  1VQO A;  1YI2 T;  3QII A;  3VKI A;  4GLK A;  3CXC A;  4JS4 A;  2QQ9 A;  4E7I A;  3V8J A;  3JCM V;  2KVQ G;  3LWI A;  2XDD A;  3LH0 A;  4EMH A;  1AHJ B;  3TEE A;  1VQO T;  3G4S T;  2H3J A;  4X9C A;  3CBM A;  2XG8 D;  2ZCF B;  5GAO l;  2DTH A;  2LT1 A;  3M56 A;  3NTK A;  2DIQ A;  2D9T A;  4FT4 A;  5KH6 A;  3J81 E;  3CCV T;  3OW2 S;  2K4Y A;  1WJS A;  3JCM e;  5CKE A;  4JRP A;  2I2L A;  4J5Y A;  4M77 F;  4DOV A;  4M77 E;  4TVR A;  3JCM Q;  5C0M A;  4ZGD B;  2M16 A;  4C92 F;  4C92 E;  3A8M B;  2DD5 A;  2M9U A;  2RD1 A;  4R56 A;  5GMK j;  3JB9 F;  5I2M A;  1O9S A;  2VGM A;  4PJO G;  2P0K A;  4KT0 E;  3NTH A;  1UGQ B;  2LDM A;  3CPW A;  4N4G A;  1WPY A;  4N4I A;  2L89 A;  3J80 E;  3OQ5 A;  1WQW A;  3QXE B;  3MP8 A;  1YJW T;  3CCQ T;  5IN1 A;  5D6Y A;  4PJO B;  4FM4 B;  4M7A C;  4L59 A;  1VQ8 A;  4ZTF A;  2VUB A;  3PMT A;  5LJ3 j;  2L8D A;  2XK0 A;  2R5M A;  1Q81 U;  3A8O B;  3L2R A;  4RCB A;  3PIO A;  5FU6 C;  3CC4 A;  4LDV A;  2RHX A;  3E9F A;  3DKM A;  1KQS S;  2VYT A;  2EQM A;  4C5H A;  2C06 A;  2CS7 A;  3KUF A;  4F7U E;  4M77 A;  5IAY A;  5GAN 2;  1NJI U;  1G3Y A;  3H6Z A;  2DVE A;  3LYI A;  4FT2 A;  4JRI A;  3C94 A;  3QG1 A;  4EDU A;  4C92 A;  1N9S A;  4A4K A;  5LJ5 e;  1S72 A;  3CXC S;  4E47 A;  3HSB A;  3QYG B;  3SWN B;  5A0G A;  3OYJ A;  1XTD A;  1WGS A;  4HT8 A;  2RH2 A;  4PL6 A;  4QVD A;  4M77 D;  4VUB A;  1N8R C;  3GOX A;  3OYN A;  4C92 D;  4IUP A;  5A2Q E;  1NPR A;  5C6S A;  2K2V A;  3PTA A;  4A53 A;  5GAM g;  3HRU A;  3QHS A;  3JB9 D;  3OBY A;  5GAN g;  4BY6 C;  5KE2 A;  3JCM b;  4FU6 A;  2JVV A;  2LTO A;  2A3L A;  2DXC A;  1BI0 A;  2Y4Y A;  4M77 G;  1FXX A;  4BI8 B;  3G6E A;  4MZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...