4F7UA

The 6s snrnp assembly intermediate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 17
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uA00
2VXFA 1I5LA 2K57A 3QUIA 2RM4A 4XU3A 4EMHA 1N9RA 2FYKA 5LJ5e 3JCMe 3RKWA 1JRIA 1TH7A 2EJ9A 2ZGWA 4PJOC 3M4GA 4HT9A 4M7AA 3RIRA 1BIBA 4JRKA 5GANe 1WQ7A 5DY9A 4F7UG 3HFNA 4M77G 3JB9H 4M7AF 4XTYA 4V2SA 4M77E 2DJZA 5GAN3 3GIBA 3RKXA 2VC8A 3JCMd 4M75B 3JCMg 4M7AB 5LJ5g 4M7AD 4M78A 3JCMV 5GAN5 3JB9F 2DVEA 3RKYA 5LJ3e 4C92G 3JCMJ 4XQ3A 3JB9D 1JBMA 1B34B 4M78F 4C92E 5GANd 2YLCA 4M78D 5GMKi 4X9DA 3JCMX 5GMKm 3QSUA 1M8VA 5LJ5f 5GMKe 4M7DD 2EJFA 1Y96B 4J6YA 1WQWA 5LJ3d 3JCMc 4M78C 5GAMg 4XU0A 2VXEA 4EMGA 1D3BA 3V8JA 4M77A 4XTUA 2YHTA 4M7DC 5GAN8 4M75A 3SB2A 1LNXA 4C8QG 3L1AA 4EMKA 4M77F 3L2ZA 5GAOm 1MGQA 3RERA 3FJPA 1D3BB 4M75F 4RCBA 5GAOn 4F7UB 4F7UE 5GAMf 1B34A 4M77B 4C92A 4M75D 5GAOp 1WPYA 4XTZA 4EMKB 4C92F 4JUVA 1N9SA 5GMKl 4PJOG 4C92B 3FIFA 1I8FA 1Y96A 3V8LA 5GANg 3HFOA 5GAN2 4M75C 4NL3A 4M7AC 4PJOE 4WF2A 4J6WA 1KQ1A 3EFSA 3JCMf 2FB7A 2DEQA 2RA2A 2DTOA 3BFMA 4NL2A 3HSBA 1I4K1 3QO3A 4XU1A 4XTWA 5LJ3g 3EFRA 5LJ5h 3JCMQ 2DTIA 1LJOA 2EWNA 5GANf 2DZ9A 3INZA 4XU2A 4XTVA 4F7UA 3RUXA 1I81A 5GAOl 1WNLA 3SWNA 2DTHA 5LJ5j 5GAOr 4J6XA 4MMKA 4N0AA 3PGGA 4OP0A 4F7UF 5GAN4 3JB9I 4C8QB 4C8QE 3V7CA 1LOJA 5LJ3f 2E1HA 4M77D 1M5Q1 4DQ2A 3SWNB 4JRIA 4PJOA 2RD1A 4M78G 3BY7A 2EAYA 4M78E 5GAMh 4HA8A 4PJOF 2QTXA 5GAOq 2E10A 4C92D 3V7RA 3JCMP 4M77C 4NOYA 4M7DG 2DKGA 2YLBA 3RESA 4PJOB 2E64A 4Y91A 4A53A 5GAN6 5GAMj 4N0AC 3BW1A 4M7DE 4MMLA 4EMKC 4QVDA 2JN0A 2E41A 5GMKh 3AHUA 4C92C 1X01A 1HK9A 4QVCA 2DXUA 3JCMh 5GMKj 5GAN7 4C8QA 2E65A 2CGHA 3JCMb 4PNOA 4M75G 2I2LA 5GANh 4M7AG 4C8QF 5LJ5d 4M75E 4M7AE 3VU3C 4HT8A 4XTXA 4C8QD 4J5YA 1KQ2A 4RCCA 3JB9G 1HXDA 5GANj 3FB9A 5GAMe 3QHSA 1U1TA 1U1SA 3BDUA 5CAIA 4M7DA 5I21A 2DZCA 5LJ3h 4JLIA 2RB6A 4M78B 3V7SA 1H641 2Y90A 1BIAA 2DXTA 2HNIA 4C8QC 3V8KA 3JB9J 4X9CA 3JCMW 3SWNC 4A54A 4M7DF 4PJOD 5LJ3j 4M7DB 2EJGA 1YCYA 5GAMd
chains in the Genus database with same CATH superfamily
1I5LA 1KJWA 1BCOA 1IGQA 4BDYA 2EJ9A 3LGLA 3ME9A 3VS5A 2DJZA 3JCMd 2EYXA 1M9SA 5I2SA 2DETA 1EIFA 3MEUA 4BI8B 1YITQ 2RQVA 1B34B 4J9BA 5EG2A 5FROA 3H0FA 4A63B 5LJ5f 1IHVA 1X6OA 3TEEA 3I9QA 3JCMc 2JXBA 2EW3A 2HQXA 3TCJA 1PG5B 2C06A 2V8KA 2LX7A 1C1AA 4J9FA 2RI5A 3FDRA 4F7UB 4WTOB 1TS9A 3FIFA 5GANg 3PE0A 4X34A 4M75C 3X24B 3M0RA 4BDZA 4HCBA 1QP2A 2A7YA 2DMOA 2DTOA 1LCKA 2YSQA 3BFMA 2NYSA 3M58A 3A98A 4IUUA 2GTJA 2DL7A 4J6XA 3I56Q 2MMPA 2WSCE 1X27A 3PGGA 2XIDA 2HDAA 4OB0B 5FU6C 4LE9A 1WJRA 1D0YA 2E70A 2BKDN 2YLBA 1VQMT 3G4SA 1YJNQ 2XDPA 1N27A 4EIKA 1G2BA 2ZZDA 3PT9A 1W70A 2ZPHB 2VVKA 1M4ZA 5GANh 2PQWA 4MDXA 4M7AE 5IT9E 1OQKA 1HJDA 5GANj 3EAEA 2EYQA 2X4JA 1M8MA 2Y4YA 4QT7A 1BIAA 2ATCB 1TU0B 2RM4A 1SPKA 3OYIA 4C0GA 3OBWA 5I2MA 4E6RA 2B8AA 3EH1A 4E7LA 3P8HA 1SSHA 1OX8A 1AWOA 1FMVA 4F7UG 1PSEA 2JS0A 3JB9H 5HCKA 5KCOA 7AT1B 4PFPA 1O75A 2YUPA 3JCMg 3ASKA 3CCUQ 4XQ3A 3CD6Q 5L8RE 2COWA 4DBHA 5GMKe 1PC0A 3A8MB 4BE0A 1M1GA 4M78C 1MHNA 1XNIA 4GBQA 3T9NA 3UDCA 3X20B 8AT1B 2COZA 5C6SA 4A4FA 4F7UE 3KXTA 4JDSA 4AMCA 3CC7T 4EMKB 2VYTA 1XTDA 3PTAA 1VQ5A 1KSWA 3CC7A 1ACMB 2KSSA 1WJSA 3HRUA 3QXEB 3HSBA 4OB2B 2MOXA 4LUEA 3MP8A 3HP9A 2PNIA 1VQ4A 1NYGA 4MZTA 4R0KA 5KH6A 2DO3A 2EYYA 2R5AA 4N0AA 3JB9I 4Z02A 2JTMA 1M90R 2E5QA 2E12A 3CCQQ 2LQKA 3CCJQ 3V7RA 4PK4A 1MNEA 4A53A 1RAFB 1W2BP 2BTTA 3BDLA 4RTVA 4HVVA 1UEBA 2HQHA 2EQJA 3PMTA 2PU9B 3CMAA 2OTLT 1WDXA 2FPDA 3HKSA 1WJQA 1IHWA 4LXCA 2OTLA 5CKEA 3C4SA 4OB1B 3V8KA 2J7IA 1LVKA 5AT1B 4KGXB 4LDYA 3CBMA 1C6VX 2F2VA 3OB9A 1E6GA 4CC7A 2FZGB 2KGTA 3A1PA 5CKFA 5IXBA 1YP5A 2B86A 1IRXA 2CT4A 2LMJA 4XTYA 3NGPA 3UA7A 4JZ3A 1VQPT 2DD4A 3TU4K 2EFIA 2MF2A 1S72Q 1G83A 2MIOA 1WHJA 1M8VA 1OI1A 2EJFA 3GOXA 2X4YA 2HMAA 1N8RR 4IURA 4Z88A 2KXDA 2O9VA 5FWBA 3V8JA 3UATA 4ELZC 1VQNQ 2A08A 1UGQB 2AKLA 4M77F 2DVJA 5GAOm 5GAMf 2C0IA 4M77B 4M75D 2D8JA 3MPUB 5FU7B 1EX4A 2DIQA 3QZ9B 2X51A 5IHNA 3WXMB 4AT1B 2FB7A 2DEQA 1OZ3A 4HCZA 4L6V5 3OYGA 1WXBA 2Y4XA 3OYHA 1VIEA 2LJ1A 3NTKA 2HSPA 2O88A 4EDUA 2VUBA 2WACA 2QTXA 1AWWA 3QPHA 4Y92A 4JS4A 1WHMA 2EKOA 2NWMA 1CKBA 1D0ZA 2MAMA 3GNGA 1D1BA 2DRMA 4PNOA 3PIPA 1RUWA 2RNAA 1Q81R 3QBYA 2RHIA 4A54A 4HVWA 2DERA 1B07A 3CMEQ 1QCNA 4RTUA 1X2QA 4O5VA 2RHUA 2RQWA 4C5IA 3A8GB 1QWEA 4M77G 1UGPB 4MDWA 4J9DA 1H3HA 2E3HA 5GAN3 2LCCA 1ZUKA 3EFOA 4C0ZA 3P8DA 4JJCA 4LNPA 3RR6A 2KK4A 4M78D 3L2RA 2BE7D 2KAFA 3M53A 1WQWA 5LJ3d 4ME7A 1VQMQ 1KC8U 1K8AU 4J7IA 2GNCA 4EMKA 1T0HA 2RPNA 4M75F 1KD1U 2F69A 1ZA1B 1VIFA 4PJOE 1VUBA 4QQDA 2FRWA 1ARKA 5CKDA 4KUIA 2VV5A 4NL2A 4XTWA 3JCMQ 2RMOA 1YBYA 3INZA 5FWCA 1WI7A 3EGUA 3MEAA 2P0PA 2DJQA 5GAN4 1M90C 1EFNA 5HK3A 3HL8A 4JZ4A 3M0UA 3VUBA 1NEBA 4A4EA 1Q82C 4EMKC 4QVDA 1ZA2B 1TSFA 3NFCA 1UGSB 5GAN7 3SHWA 2KROA 2VASA 2CGHA 5LJ5d 1UTIA 1NE8A 4HT8A 3CD6T 4E7SA 2M51A 2A37A 2EVRA 1IREB 1BKBA 5D7UA 2JTFA 5A0DA 2GBQA 2DF6A 3CD6A 2QEXQ 3I5RA 2DAQA 2VGMA 1OPLA 1GXIE 2OTJQ 2EJGA 1PM3A 1VQ9T 1VA7A 1Q95G 3G7ZA 1TH7A 5KCHA 1NJIR 2JUFA 3M4GA 3HRTA 2AZSA 1FMWA 4JRKA 1VQ9A 2M1HA 4N4HA 2XMFA 4M7AD 1ZUUA 2YUOA 1NLOC 4MZPA 4E47A 1AOJA 4M78F 2DD5A 1YJ9T 3LYIA 4AG1C 5CKBA 3I5SA 1N8RC 1FMKA 1Y96B 1RL2A 1YJ9A 4FIBA 5DM7R 4XU0A 4EMGA 5A0GA 4M77A 2YHTA 2DIGA 4RCBA 3CCQT 2XDDA 5GAOp 2OTLQ 3IQLA 1KIKA 4F04B 3NHNA 2IVWA 1ZSZA 4BE1A 3CCQA 2YWWA 3HFOA 3J81E 5KYWB 3GP8A 2X9HA 1K4US 2RJDA 3H41A 3DKMA 1UUEA 1X69A 1UHFA 5GAOl 3MP6A 3DLMA 1NG2A 2ESWA 2KNBB 4OMQA 5FRNA 3H0IA 2DRKA 5DLQE 2EAYA 2I0NA 1DJ7B 3GBQA 1AT1B 2FO0A 1QLYA 4M77C 1VQPQ 2QAZA 4M7DE 5FU7C 2L3SA 4DEYA 4JLGA 1YJWT 4N4GA 2KYMA 1ABQA 4C5EA 2C0TA 2NUPB 1YJWA 1G3TA 2F2XA 4PKCC 4RG8A 1JO8A 1JJ2P 1U1TA 2JTEA 1S72T 5CAIA 4PLLA 3JAME 1Q81C 4LN2A 3CCST 2F2WA 1XOVA 3VS0A 4PL6A 1QVFA 2O01E 1BCMA 1S72A 2CP2A 1Y0MA 4OMMA 2QI2A 3JCMe 3OYFA 1RABB 4PLIA 2QGGA 1JRIA 2ZCFB 4CC3A 1MMDA 2OAWA 1W6XA 1QVGA 4M7AF 2DL5A 2VC8A 2BZXA 4M7AB 2O4XB 4M4ZA 2LZ6B 2D0NA 1G8XA 1V29B 2YT6A 4JPBW 4PJJA 2DBKA 3M0SA 2P84A 2YRVA 1QP3A 2FPEA 4M75A 1ABOA 2CZ0B 1IXDA 2QQSA 1OV3A 2O9SA 1MGQA 2J06A 2KI7A 4IKFA 3FJ5A 2RHXA 5IN1A 1M2VB 1E6HA 2NUTB 1N5ZA 2CSQA 2DFUA 2VKNA 4WF2A 3MCAB 1BBZA 5A0LA 2CZ6B 1YN8A 2MI6A 2KXCA 2JVVA 1WNLA 4F7UF 1GFCA 1LOJA 4J7FA 3U23A 3EG9A 3LWHA 2RD1A 4L5GA 1ZSGA 1UGVA 3S3MA 2DILA 2RJCA 3CMET 3M9QA 1OZ2A 5CO7A 2E41A 4E2FB 2V26A 3CMEA 5HK0A 2EGEA 2KQWA 2K9GA 2DL3A 3OYKA 2SEMA 1VQLQ 2EYZA 1OU8A 3LH0A 2I2LA 4M7AG 1O9SA 2CYZB 4ANJA 5IAYA 3OMGA 3LW5E 3M0TA 1CKAA 1YFNA 2RN8A 2AT1B 2HNIA 2A0FB 1QCFA 3JCMW 3VRZA 2LCSA 4BY6B 3ZFJA 5GAMd 2EYWA 1NJIC 4QVZA 1JJ2S 1MNDA 2P4RA 1EZZB 3I35A 1WXUA 1VQMA 2DM1A 2K5IA 3RNJA 2D1XA 5IHKA 3RDVA 2DL4A 3NTIA 4M78A 2FL7A 3E19A 4C92E 1ZUYA 3C95A 2CH4W 1KK7A 2K5LA 3CQTA 2EKHA 2EGCA 2HBWA 5CCAA 1TTHB 2RQTA 1YWOA 3OYMA 3PIOA 5KYWA 1NM7A 1VYTA 4OGEA 1N9SA 2LT1A 3X26B 4RMOA 1HSQA 5FRMA 3WVEB 3CCRT 3L2VA 4OMLA 3NTHA 5CQXA 1QMCA 2CSIA 1LJOA 5GANf 1SEMA 2CH4A 3EGDA 2L3RA 1I81A 1VQ9Q 3TSWA 1R77A 1PKSA 3C0CA 5J3BA 3QZ5B 4M77D 1VYUA 2C0OA 2QEXT 1Q86R 2HL5C 3TSZA 4KGZB 2OTJT 1M1FA 4QW2A 2E10A 3A8OB 3H0HA 2E64A 4Y91A 2QEXA 3THKA 4MMLA 1XQHA 4DBRA 1YJ9Q 2OTJA 2LC4A 2D0QB 4D8KA 4JJNK 3JCMh 2NUPA 2XU8A 5IH2A 3CPWP 5CVIA 5I11A 2L5QA 2HCKA 2ROLA 5AYFA 3J7AF 3OS2A 1ZLMA 2HL3A 3EG3A 5KE2A 3V7SA 3OSVA 2Y90A 2CP3A 3FEOA 5M9OA 3OW2A 1QWFA 1J3TA 2L8DA 5KYXA 1RLQC 2WSEE 3QUIA 3CBOA 1RAGB 1N9RA 1WX6A 2V1QA 3MO8A 4M7AA 1KQSA 2O4XA 3VS3A 3SDZA 3H9NA 1I5OB 3RKXA 3OYAA 1H8KA 1X6BA 3OYBA 1YI2T 1X6GA 3C12A 3JB9D 2HKNA 4J83A 1GFDA 4FYVB 1KFZA 3CXCP 2J6OA 1T3LA 1G3SA 2JW4A 3A8LB 3QSUA 1YI2A 1UB4A 3JV3A 3KBGA 1OU9A 1M3AA 3X28B 4C5HA 1K9MR 4E7ZA 3L1AA 1W1FA 1YJWQ 3QG1A 1FXXA 2KMTA 1B34A 4IUQA 3S3NA 4XTZA 1SF9A 4II1A 2HD0A 4C0DC 2KBTA 3VS6A 2RI2A 4M7AC 2DX1A 2FRYA 2QQ9A 4J6WA 1VQPA 1QVGP 3CCSQ 3CCVQ 2RA2A 1I4K1 2RI3A 3EFRA 2PVGB 4F7UA 3VYHB 1QKWA 2DA9A 1K76A 2DYBA 2JM9A 2SRCA 4C8QB 1K8AR 3JSCA 3OYYA 2P4TA 4PJOF 2KRMA 5CR2A 1ZHIA 3QJYA 1E7OA 4PJOB 1Q7YU 5D6YA 3L42A 2V8JA 1WYXA 4KGVB 2ZAEA 4FW1A 2E65A 3OY9A 2KRSA 2PZ1A 1ZQ1A 1KHCA 3CCEQ 3LLRA 2OX7A 2EIFA 4XTXA 4J5YA 2BIVA 4J8OA 3QHSA 4OMNA 2J6KA 2YDLA 1YNZA 3CPWS 2LQNA 1RI9A 2QGFB 2O31A 1SHGA 3FC3A 1NEGA 2K57A 3M59A 1JXOA 2IG0A 4J9IA 1PHTA 1BIBA 1GBRA 1RAEB 5GJWB 2JNGA 2K7AA 3CCLT 1W2BS 3VKIA 3JB9F 5LJ3e 4ZNXA 1Q82U 2YLCA 2DXBA 3CCLA 4Z8AA 5GMKm 4PJNA 3EG1A 4NS5A 2L89A 2VXEA 1OYXA 4AFQC 3CXCS 4CC2A 3DB3A 3TREA 1M1KU 4BY6C 4C8QG 2J05A 2DXCA 3FJPA 3PVQA 4N4IA 4IIMA 1D1AA 1I1JA 2K4YA 3VS7A 4QQ6A 4KRTA 4PJOG 3R6OA 1OOTA 3OMCA 5CQYA 1VQLT 9ATCB 2DTIA 2M0OA 2RJFA 2QQBA 2M16A 2RK1A 2X3WD 1K73R 4L59A 1VQLA 1BYMA 4C8QE 1SKUB 1UHCA 2E1HA 1Q86C 1OX9A 4JRIA 2BZYA 3OYEA 2BZ8A 4UC4A 3BY7A 3TQ7P 3JCMP 1K1ZA 3UPUA 2DKGA 3C94A 3VS1A 4E7HA 3BW1A 4RTXA 2JN0A 2RHYA 1D09B 4PJMA 3META 3QWYA 5EC7A 2H3EB 4BUGA 2D6FA 2CP7A 2H8HA 4PFZA 3JB9G 2FG0A 2RB6A 3QWXX 5KYYB 2MPXC 4M7DF 2CREA 1P92A 4M7DB 4FYWB 1OEBA 1TWBA 1JEGA 3RKWA 3CCRQ 2QA4T 2RQRA 1K0SA 3LWIA 4DOVA 3HFNA 4BB7A 4R55A 1GL5A 3EG2A 2QA4A 4ZTFA 1NYFA 1X75C 1VQ8T 2YRCA 4J9HA 3X25B 3I55T 2E6ZA 4HXJA 2ED1A 1SHFA 1TG0A 3FRNA 2JJ9A 3CCMT 2K2VA 3EH2A 3I55A 1QCOA 5DLOA 2ENMA 1K9MC 1UJ0A 1WZOA 2CUBA 2K3YA 2HBPA 3N5BB 2PTKA 3QKJA 4E7IA 1Q81U 2LRQA 4KUDK 3CC4Q 2LT4A 1YIJT 2PUOB 5GAN2 1PCXA 4FT4A 1X2KA 2HKQB 3HHTB 1YIJA 3HRSA 4F16A 5LJ3g 2A36A 2AKKA 2CT3A 5HY6A 5GAOr 2COYA 1WXTA 3OYDA 1K8AC 2JOYA 2EQKA 4K11A 1M5Q1 1AZEA 4PJOA 4RTTA 3GF5A 5GAOq 4TVRA 4M7DG 1WFWA 1YI2Q 3UWNA 3VS4A 2GQVA 2KEAA 1QQJA 1IO6A 4WCIA 4MZMA 4QVCA 3CEYA 2GF7A 3QYGB 3JCMb 4OMPA 3L2WA 4FL6A 2F5KA 4M75E 1PWTA 2ECZA 1U3OA 4A4HA 3GLXA 3H8ZA 1HXDA 5ECAA 3SD4A 1U1SA 1GCQA 1V76A 5LJ3h 1H641 4C8QC 3MEWA 2L0AA 4X9CA 5LJ3j 2XK0A 2OJ2A 4FCYA 2CP5A 4PJOC 4B9XA 4HT9A 4ZGJB 5DY9A 1VQ7T 4HCKA 1QVPA 4JRPA 4V2SA 2ZPBB 2QASA 2JMAA 5LJ5g 1AHJB 3JCMV 2FVUA 2V8IA 1VQ7A 4ZTJA 1JBMA 3M55A 4IIOA 5GANd 2DYIA 3CCVT 5FW9A 2DLPA 3QYHB 5A2QE 2KY9A 1RAHB 4ORZA 2WSFE 2RF0A 4EPCA 1U06A 4RUGA 3VRYA 1OPKA 3CCSA 3CCVA 1TUGB 4AFUC 1K0XA 2JM8A 1VQ6T 1GCQC 1VQOT 3DLLA 3CC2Q 1AD5A 3L2ZA 1D3BB 5GAOn 1VQ6A 1G3YA 2LJ3A 1VQOA 1AZGB 2PVDB 4C92F 4OMOA 3REBB 2JMCA 4RKUE 5GMKl 4C92B 1NJIU 2DK3A 1RAIB 4BD3A 1R0BG 2HAXA 3JRZA 3QO3A 2AIRB 3QIIA 5LJ5h 2HZYA 1GBQA 1WHLA 1K73C 3CCET 1WLPB 2EGAA 5LJ5j 4LD9K 2XICA 3ULRB 3GPLA 3S3OA 4DBQA 3CCEA 3OSSC 3SWNB 2RH2A 1I0CA 4M78E 1UFFA 4A4KA 3CCLQ 1NPRA 2FHDA 3RESA 5CIUA 5GAN6 2RQUA 2R57A 3J80E 3HTRA 1X01A 2XI9A 2K3BA 2HQEA 1VOMA 1G5VA 4FW2A 4KH1B 3O8VA 2CP6A 3A5ZB 2KYBA 2YXYA 1RAAB 1HYOA 2DBMA 2NLUA 5KYYA 3BE3A 5GAMe 4P5NA 4M7DA 3M54A 1AWXA 4RTWA 2FYKA 1M3CA 2F1LA 2KDSA 3G1JA 2XDBA 4RTZA 5CK9A 2VB6A 2HSEB 2XD0A 1VYVA 4C92G 2OI3A 4FT2A 1I07A 1U8RA 2MWOA 1NZ9A 3PFSA 2EQUA 2K6DA 2P0QA 4CI0C 5D6XA 8ATCB 1Z9ZA 2EQMA 4M7DC 2E5KA 3P8BB 2D9TA 2RK2A 1FX7A 3UT1A 1M2OA 3G4ST 2DE0X 2MWPA 3OS1A 4X1VA 3E9GA 3VJPA 1Y96A 1FYNA 2LQWA 4ATOA 1C0MA 4VUBA 4YTLA 4CC4B 4RG2A 1MMGA 1XJWB 4FYXB 4D8DA 2E3IA 4XTVA 1VQKT 2G6FX 2W10A 2AHJB 4F17A 4QQGA 2X35A 3M5AA 4D6WA 2QA4Q 3QDRB 4GLKA 3OYLA 3F70A 1VQKA 3R6NA 2CKKA 2K79A 3QJ6A 4NOYA 1VQ8Q 2QK0A 4J9EA 3I55Q 2L2PA 4DA4A 1RACB 3AHUA 4RTYA 3CCMQ 3CCRA 1WGSA 4FM4B 4OMFB 2LCLA 3G71T 2F5TX 1IZ6A 3RBBB 4C8QD 1KQ2A 3FB9A 5LL6S 3G71A 2L3PA 1M3BA 2X4WA 4DEXA 4Y28E 4LD6A 3EFOB 2JS2A 4PJOD 2QDLA 1YIJQ 2CUDA 5J39A 4B6MA 1R8OB 4XU3A 4EMHA 1UDLA 4ZN3A 2KR3A 3VUZA 1Q7YR 3O5ZA 3RIRA 1YWPA 2A28A 1GCPA 2CZ7B 4BI4A 3CC4T 3MKDA 1VQ5T 1G3WA 5GAN5 3JCMJ 1WHGA 3CC4A 2KVQG 1UGRB 2DPPB 4JJBA 1WIEA 1VQ4T 1IB8A 3TVTA 4J6YA 5GJVB 3G6ET 1YHQT 5GAMg 3EGXB 1UG1A 1D3BA 3DB4A 4J9CA 3G6EA 1YHQA 2P0KA 4A4GA 2QYZA 4C92A 4ELYC 4JS5A 2QG9B 1TOVA 4GY5A 2FEIA 3V8LA 2ZPEB 4AFSC 1TXQA 3CMAT 3JCMf 2AZVA 1Q82R 2H3JA 2ABLA 2EWNA 3NMZC 2RHZA 3PVLA 3SWNA 2DTHA 1M2VA 5KYUB 3OYCA 5KE3A 4LUDA 4MMKA 2NUTA 1PD1A 3HPWA 1FWZA 2ZPIB 4LDUA 1QVFP 1VQ7Q 1B3QA 1M1KR 1GRIA 1M27C 4OGCA 2NUZA 2W0ZA 5GAMh 4J9GA 5GAMj 4N0AC 1N6AA 1UECA 3CBPA 1H3ZA 4C92C 1HK9A 4DBFA 3ZEHA 4ZGDB 3OS0A 2LP5A 1ZBJA 2CS7A 4C8QF 1VQ6Q 3VU3C 1KC8R 4RCCA 1JXMA 1MMAA 1VQOQ 2BE9B 4KH0B 4FSSA 3BDUA 4PFOA 3PMIA 3E2UA 2FPFA 3SWNC 1NPPA 3M0PA 1KD1R 2YRDA 3Q1JA 1AEYA 2CDTA 1PD0A 4JRQA 1R0CB 2ZGWA 3CC2T 4HCCA 1IGUA 1Q86U 1JU5C 3OBYA 2YUQA 1WQ7A 1X43A 2KRNA 3A8HB 3M57A 3CC2A 4FSXA 4R56A 2E6NA 3RKYA 2OAUA 3M4YA 1Z9QA 3LGFA 2DEUA 3OS5A 3MJXA 1ZSZB 1D0XA 1SRLA 1JJ2A 4M7DD 1WHKA 1F1BB 1B7TA 3VYGA 2XHCA 1M90U 5IXFA 4FU6A 1CSKA 3SB2A 1LNXA 2LJ0A 2LQ8A 1V1CA 2K3XA 3RMQA 2Z0WA 1MV3A 4ZGEB 3EHRA 2LNVA 2GCXA 1KQ1A 3EFSA 4F14A 4AG2C 4E7JA 4XU1A 4FYYB 4XU2A 3RUXA 1MMNA 3VS2A 2EPDA 3NPFA 1BI3A 1YITT 2GGRA 1BB9A 2X4XA 3E9FA 4LDWA 3SFMA 1D1CA 2R5MA 1YITA 2LDMA 1Y71A 3L2UA 4HA8A 2ROTA 1NLPC 1JQQA 2GFUA 1S1NA 1BI2A 2KE9A 4IUVA 1K9MU 1ZX6A 5GMKh 1QVFS 2DXUA 4PJLA 5GMKj 1BK2A 2ZPGB 2VGNA 3CPFA 5L23A 2IIMA 4BI3A 1KG1A 4HKEA 3UF4A 1QVGS 1BI1A 3ZL7C 4LDXA 1N8RU 3G4SQ 2DXTA 1PSFA 1OULA 1PNJA 3LH5A 2CZ1B 2MK5A 1KHIA 1YCYA 2VXFA 5LJ5e 1Q7YC 3I56T 2MYSA 4OF1A 3OQ5A 2FZKB 1K9AA 3I56A 4M77E 3FLGA 4M75B 4BACA 1VQKQ 3GNFB 1RI0A 2CP0A 5IHIA 1YJNT 2E4HA 2PVOB 4OB3B 6AT1B 5C0MA 3VV0A 1BI0A 2LNHB 3S6WA 4X9DA 3PNWC 1H92A 4ESRA 3EGXA 2QXFA 1YJNA 4C0FA 3RMSA 2QTVA 2J6FA 1LPLA 1PRLC 5FU6B 5GAN8 4C5GA 4XK8E 2BUDA 3RERA 1SRMA 1AWJA 4KBMB 3G71Q 1NBEB 2EBPA 3KUFA 2K5FA 3MP1A 2LVMA 4JUVA 2XG8D 3D7SB 1I8FA 3EG9B 1UE9A 1TUDA 2V1RA 4QKUA 4NL3A 2LTOA 2LX9A 5I22A 1VQ8A 3EG0A 3MHXA 4BE2A 3M56A 5KYUA 2M02A 2YUNA 1AVZC 2PUKB 4O6JA 1YCSB 4KULA 2DZ9A 3CCMA 2KT1A 3CCUT 4JJDA 4OP0A 3V7CA 4DOWA 3OW2P 1M1KC 2KT8A 3CCUA 1VQ5Q 3CC7Q 4C92D 1PKTA 3OYNA 1UJYA 2ED0A 1KQSP 4ZN1A 1TUCA 1T3SA 2R58A 1PRMC 3SEMA 1QW1A 1VQ4Q 2DNUA 2GFAA 1A0NB 4XAXB 4C8QA 2FZCB 2G3RA 1ZBXA 3LX7A 3G6EQ 3H6ZA 1YHQQ 1U5SA 4M75G 1KC8C 3M0QA 4GLMA 1RLPC 2M0YA 5I21A 4JLIA 4IUPA 4M78B 4OVAA 3OYJA 1KD1C 5CKHA 1K73U 2AK5A 2QDYB 4LDVA 3ZBDA 3CMAQ 1SSFA 1QKXA 5GANe 2JZ2A 5FLXE 3AT1B 2MCNA 2X3XD 2RJEA 3EHQA 3ER0A 3GIBA 3CCJT 2ZPFB 2HEQA 1T0JA 1WHHA 3WVDB 2DVEA 3CPWA 3KFVA 1HD3A 4IUTA 4CRIA 4HVUA 3JCMX 5GMKi 3CCJA 4Q5WA 2D8HA 2RO0A 3REAB 4KT0E 3UA6A 4XTUA 1JB0E 3MEVA 1W2BA 1SG5A 2GQIA 1BU1A 3EGDB 1WA7A 1WPYA 5KYNA 5J26A 4B9WA 1Y7XA 2XKOC 3L2QA 3CXCA 2GTOA 1RADB 1ZSZC 1M30A 1MUZA 5HKCA 3E1SA 2A3LA 1MV0B 2VWFA 5LJ3f 2QQAA 4DQ2A 3OA6A 4M78G 2M9UA 4AFZC 2K2MA 1W4SA 4Z89A 2QQRA 1VQNT 2L3QA 3OW2S 4E7KA 1Y57A 3QDFA 2DL8A 5KYXB 2JT4A 2EQIA 1VQNA 4C0DB 1KQSS 2IPOB 2O2OA 2DZCA 5D6WA 1Y07A 3JB9J 3URGA
chains in the Genus database with same CATH topology
1I5LA 3M59A 1R8OB 2K57A 4XU3A 4EMHA 1VQ9T 2IG0A 3G7ZA 4BDYA 1TH7A 2EJ9A 5KCHA 2JUFA 3M4GA 4ZN3A 3HRTA 3VUZA 3RIRA 1BIBA 4JRKA 3LGLA 1VQ9A 2CZ7B 3ME9A 4BI4A 3CC4T 2M1HA 2DJZA 1VQ5T 4N4HA 3JCMd 4M7AD 1M9SA 5I2SA 2JNGA 3CCLT 1W2BS 1G3WA 3VKIA 1EIFA 5GAN5 3MEUA 4BI8B 5LJ3e 4MZPA 4E47A 3JCMJ 3CC4A 1Q82U 1B34B 4M78F 2DD5A 2YLCA 1YJ9T 3LYIA 2KVQG 1UGRB 2DXBA 2DPPB 5EG2A 5FROA 3CCLA 5CKBA 5GMKm 1VQ4T 5LJ5f 1N8RC 4NS5A 1X6OA 3TEEA 1Y96B 1RL2A 4J6YA 3JCMc 1YJ9A 3G6ET 4FIBA 2HQXA 5GAMg 2L89A 1YHQT 3TCJA 5DM7R 4XU0A 2VXEA 1OYXA 1D3BA 4EMGA 2V8KA 2C06A 3DB4A 5A0GA 4M77A 3CXCS 2YHTA 2DIGA 3DB3A 3TREA 1M1KU 4BY6C 4C8QG 3G6EA 1YHQA 2P0KA 4A4GA 3FJPA 2DXCA 4RCBA 3CCQT 2RI5A 3FDRA 4F7UB 2XDDA 4C92A 4ELYC 4N4IA 5GAOp 2K4YA 4JS5A 2IVWA 4QQ6A 4BE1A 4PJOG 3CCQA 3R6OA 4GY5A 3FIFA 3V8LA 5GANg 3HFOA 4X34A 4M75C 3X24B 2ZPEB 3J81E 3GP8A 4BDZA 3CMAT 3JCMf 2RJDA 4HCBA 1QP2A 2A7YA 2DTOA 3BFMA 3DKMA 3OMCA 2H3JA 3M58A 5CQYA 1VQLT 2DTIA 2EWNA 2M0OA 2RJFA 4IUUA 2QQBA 2M16A 2RHZA 2RK1A 5GAOl 3MP6A 3SWNA 2DTHA 3DLMA 3OYCA 4J6XA 4L59A 5KE3A 4MMKA 2MMPA 2WSCE 3PGGA 3HPWA 1FWZA 1VQLA 2ZPIB 2XIDA 1BYMA 4C8QE 4OB0B 4LDUA 2E1HA 5FU6C 1Q86C 5FRNA 1WJRA 4JRIA 3OYEA 4UC4A 5DLQE 3BY7A 2E70A 2EAYA 4OGCA 5GAMh 1DJ7B 3JCMP 3UPUA 4M77C 2BKDN 2DKGA 2YLBA 3C94A 3G4SA 5GAMj 1VQMT 4M7DE 4E7HA 4N0AC 1N6AA 3BW1A 5FU7C 2XDPA 1N27A 3CBPA 2JN0A 1H3ZA 2RHYA 2ZZDA 3PT9A 4C92C 1HK9A 3ZEHA 4ZGDB 4JLGA 1YJWT 3OS0A 2ZPHB 3META 1M4ZA 4N4GA 2CS7A 4BUGA 4C5EA 5GANh 2PQWA 4C8QF 2D6FA 4MDXA 4M7AE 1YJWA 3VU3C 5IT9E 1G3TA 4RCCA 4PKCC 4RG8A 5GANj 3JB9G 3EAEA 2EYQA 1U1TA 2X4JA 1S72T 3BDUA 4PLLA 5CAIA 3JAME 3PMIA 1Q81C 3CCST 2RB6A 1XOVA 2Y4YA 1BIAA 4PL6A 4M7DF 1P92A 3SWNC 1NPPA 2O01E 1QVFA 1S72A 4M7DB 3Q1JA 2QI2A 2RM4A 3JCMe 3OYIA 3OYFA 3RKWA 4JRQA 4PLIA 1JRIA 4C0GA 2ZGWA 3OBWA 5I2MA 2QA4T 3CC2T 2ZCFB 4HCCA 1Q86U 2B8AA 4E7LA 3OBYA 3P8HA 1WQ7A 4F7UG 3A8HB 1PSEA 3HFNA 3M57A 4DOVA 3LWIA 1QVGA 3JB9H 4M7AF 4BB7A 5KCOA 4R55A 1O75A 2VC8A 3JCMg 2QA4A 4M7AB 4FSXA 4R56A 4ZTFA 2O4XB 3CC2A 1X75C 2E6NA 1VQ8T 3RKYA 3ASKA 4XQ3A 2OAUA 3X25B 3M4YA 3I55T 2E6ZA 5L8RE 3LGFA 1V29B 3OS5A 3FRNA 3CCMT 2K2VA 5GMKe 3I55A 1JJ2A 4M7DD 5DLOA 3A8MB 4BE0A 1M1GA 4M78C 1MHNA 1XNIA 3VYGA 1K9MC 2XHCA 3T9NA 3UDCA 1M90U 2YRVA 1QP3A 4FU6A 3X20B 2K3YA 4M75A 1LNXA 2HBPA 3SB2A 2CZ0B 3N5BB 2QQSA 3QKJA 4E7IA 1Q81U 1MGQA 2LQ8A 5C6SA 2LRQA 4IKFA 4A4FA 2RHXA 4F7UE 5IN1A 3KXTA 4KUDK 4JDSA 3CC7T 2K3XA 4EMKB 2VYTA 1XTDA 2LT4A 3RMQA 1YIJT 2PUOB 3PTAA 1VQ5A 5GAN2 4FT4A 4ZGEB 3CC7A 4WF2A 2LNVA 3MCAB 2GCXA 5A0LA 1KQ1A 2KSSA 2CZ6B 1WJSA 3EFSA 3HHTB 3HRUA 1YIJA 3QXEB 3HRSA 3HSBA 4OB2B 4E7JA 4XU1A 2MI6A 5LJ3g 3MP8A 3HP9A 1VQ4A 4XU2A 2JVVA 3RUXA 1WNLA 4MZTA 5HY6A 5KH6A 2DO3A 5GAOr 2R5AA 3OYDA 1K8AC 1BI3A 4N0AA 1YITT 2JOYA 4F7UF 2EQKA 2X4XA 3JB9I 3E9FA 4LDWA 1LOJA 3SFMA 4Z02A 1M5Q1 2JTMA 4J7FA 2E5QA 2E12A 4PJOA 3LWHA 2RD1A 2R5MA 3GF5A 4L5GA 2LDMA 1Y71A 2LQKA 3L2UA 3FC3A 1YITA 4HA8A 5GAOq 3S3MA 2RJCA 2GFUA 4TVRA 3V7RA 4M7DG 1BI2A 4IUVA 3CMET 4A53A 3UWNA 1K9MU 3M9QA 2GQVA 1OZ2A 5CO7A 2E41A 5GMKh 1QVFS 4MZMA 4QVCA 3CMEA 3BDLA 5HK0A 2DXUA 1UEBA 2KQWA 3CEYA 2GF7A 2EQJA 3PMTA 5GMKj 2PU9B 2ZPGB 2VGNA 3CPFA 3QYGB 3OYKA 3CMAA 3JCMb 2OTLT 3LH0A 3L2WA 2I2LA 4M7AG 1O9SA 3HKSA 4FL6A 2F5KA 4BI3A 4HKEA 2CYZB 4M75E 5IAYA 1WJQA 3OMGA 1KG1A 1QVGS 4A4HA 3GLXA 1BI1A 3H8ZA 1HXDA 2OTLA 3SD4A 1U1SA 3C4SA 5CKEA 4LDXA 3LW5E 1N8RU 5LJ3h 1H641 4OB1B 2DXTA 2HNIA 3MEWA 4C8QC 1PSFA 3V8KA 4X9CA 3JCMW 5LJ3j 2XK0A 2CZ1B 1YCYA 1KHIA 4BY6B 2VXFA 3ZFJA 5GAMd 5LJ5e 1NJIC 1Q7YC 3I56T 4LDYA 3CBMA 4QVZA 1JJ2S 4PJOC 3OB9A 1VQMA 4B9XA 4HT9A 2K5IA 4OF1A 3OQ5A 4ZGJB 5CKFA 5DY9A 1VQ7T 1QVPA 4JRPA 3I56A 2ZPBB 4XTYA 4V2SA 4M77E 3NTIA 3FLGA 4M75B 5LJ5g 4BACA 1AHJB 3GNFB 4M78A 1RI0A 3JCMV 2FVUA 1VQPT 2DD4A 2V8IA 1VQ7A 1YJNT 2FL7A 4ZTJA 1JBMA 3M55A 2PVOB 3E19A 4OB3B 4C92E 5GANd 3C95A 2EFIA 2MF2A 3VV0A 1BI0A 5C0MA 3S6WA 4X9DA 3PNWC 3CCVT 1M8VA 3QYHB 5A2QE 2KY9A 1OI1A 2QXFA 1YJNA 2WSFE 4C0FA 2EJFA 2K5LA 3GOXA 4EPCA 2X4YA 3CCSA 4IURA 3CCVA 3RMSA 5FU6B 1VQ6T 3V8JA 4ELZC 5GAN8 4C5GA 5CCAA 1VQOT 1UGQB 4XK8E 2BUDA 3DLLA 4M77F 3L2ZA 5GAOm 3OYMA 3RERA 3PIOA 1D3BB 5GAOn 4KBMB 5GAMf 4M77B 1VQ6A 1G3YA 4M75D 5FU7B 2DIQA 1VQOA 2PVDB 3KUFA 3QZ9B 4C92F 2K5FA 3MP1A 2LVMA 1N9SA 2XG8D 2LT1A 4JUVA 4OGEA 4RKUE 3X26B 5GMKl 4C92B 4RMOA 1I8FA 1NJIU 5FRMA 4NL3A 3WVEB 3CCRT 3L2VA 2LTOA 2DK3A 2LX9A 3WXMB 4BD3A 1VQ8A 2HAXA 2FB7A 3MHXA 3NTHA 4BE2A 3JRZA 2DEQA 3M56A 5CQXA 3QO3A 3QIIA 5LJ5h 2PUKB 4O6JA 1LJOA 1OZ3A 4KULA 2DZ9A 4HCZA 5GANf 1K73C 4L6V5 3CCET 3CCMA 2L3RA 1I81A 3OYGA 5LJ5j 4LD9K 2XICA 2Y4XA 5J3BA 3OYHA 1VIEA 3NTKA 4OP0A 3QZ5B 3GPLA 3CCUT 3S3OA 3V7CA 4DOWA 4M77D 3CCEA 1M1KC 3OSSC 3SWNB 2QEXT 2RH2A 4EDUA 2VUBA 4M78E 2WACA 3CCUA 2OTJT 2QTXA 1M1FA 4QW2A 2E10A 3QPHA 4A4KA 4C92D 3A8OB 1NPRA 2FHDA 3RESA 3OYNA 4JS4A 5CIUA 2E64A 4Y91A 2EKOA 5GAN6 4ZN1A 2QEXA 2R57A 4MMLA 1XQHA 2R58A 3J80E 1QW1A 2OTJA 2LC4A 1X01A 2D0QB 4JJNK 2XI9A 3JCMh 2GFAA 2HQEA 2XU8A 2MAMA 4XAXB 4C8QA 3GNGA 2G3RA 1G5VA 1ZBXA 3LX7A 3O8VA 3H6ZA 4PNOA 5CVIA 3A5ZB 3PIPA 4M75G 2L5QA 1KC8C 2NLUA 5AYFA 3J7AF 5GAMe 4P5NA 3OS2A 4M7DA 5KE2A 5I21A 3V7SA 4JLIA 4IUPA 4M78B 3OSVA 4OVAA 3OYJA 1KD1C 2Y90A 3M54A 3QBYA 3FEOA 5CKHA 2RHIA 5M9OA 4A54A 3OW2A 1K73U 2L8DA 2WSEE 2QDYB 3QUIA 3CBOA 4LDVA 1N9RA 2FYKA 3ZBDA 3MO8A 1SSFA 4M7AA 4O5VA 2RHUA 2KDSA 2O4XA 4C5IA 2JZ2A 5GANe 1KQSA 5FLXE 3A8GB 4M77G 1UGPB 4MDWA 3SDZA 2RJEA 2XDBA 3ER0A 5CK9A 5GAN3 2LCCA 3RKXA 3OYAA 2ZPFB 3CCJT 2XD0A 3GIBA 4C0ZA 3OYBA 3P8DA 3WVDB 2DVEA 3CPWA 1YI2T 4C92G 3C12A 3JB9D 4J83A 4FT2A 4IUTA 4CRIA 1U8RA 2MWOA 1G3SA 1NZ9A 2KK4A 3A8LB 4M78D 4Q5WA 5GMKi 3JCMX 3L2RA 3CCJA 3QSUA 3PFSA 1YI2A 2EQUA 1UB4A 2KAFA 3M53A 1WQWA 2RO0A 5LJ3d 4ME7A 2P0QA 4CI0C 4KT0E 5D6XA 1KC8U 1K8AU 3KBGA 2EQMA 4J7IA 4XTUA 4M7DC 3X28B 3P8BB 4C5HA 1JB0E 2D9TA 3MEVA 3L1AA 4EMKA 1W2BA 2RK2A 3QG1A 4M75F 1FX7A 3UT1A 1FXXA 2KMTA 1B34A 4IUQA 3S3NA 3G4ST 1KD1U 2MWPA 3OS1A 3TU4K 1WPYA 4XTZA 2F69A 3E9GA 4II1A 1VIFA 2HD0A 3VJPA 1Y96A 4C0DC 4PJOE 1VUBA 2RI2A 4QQDA 5J26A 4M7AC 4ATOA 4B9WA 2QQ9A 1Y7XA 4J6WA 1VQPA 5CKDA 2XKOC 4KUIA 2VV5A 4VUBA 2RA2A 4NL2A 4YTLA 4RG2A 3L2QA 1I4K1 3CXCA 2RI3A 4XTWA 3JCMQ 3EFRA 2PVGB 1YBYA 3INZA 5HKCA 4XTVA 4F7UA 3MEAA 1VQKT 3E1SA 2P0PA 3VYHB 2A3LA 2AHJB 4QQGA 2X35A 3M5AA 4D6WA 5GAN4 1M90C 3QDRB 4GLKA 4C8QB 3OYLA 3JSCA 5LJ3f 2QQAA 4DQ2A 3OA6A 3OYYA 3F70A 5HK3A 1VQKA 4M78G 2P4TA 3HL8A 2CKKA 2M9UA 4PJOF 3VUBA 3QJ6A 4NOYA 5CR2A 1W4SA 1ZHIA 3QJYA 4PJOB 1Q7YU 4A4EA 1Q82C 4EMKC 4QVDA 4DA4A 5D6YA 2QQRA 1VQNT 3L42A 2V8JA 3OW2S 4E7KA 3AHUA 3NFCA 1UGSB 5GAN7 3CCRA 2E65A 2CGHA 3OY9A 1VQNA 1WGSA 4FM4B 4OMFB 2LCLA 4C0DB 1ZQ1A 1KHCA 5LJ5d 3G71T 1KQSS 3LLRA 2F5TX 1IZ6A 1NE8A 2EIFA 4XTXA 4J5YA 4C8QD 2BIVA 4HT8A 1KQ2A 3CD6T 4J8OA 3FB9A 3QHSA 5LL6S 1IREB 1BKBA 3G71A 2X4WA 2JTFA 2DZCA 5A0DA 4Y28E 4LD6A 3CPWS 3CD6A 5D6WA 1Y07A 3JB9J 2DAQA 3JB9F 2VGMA 4PJOD 1GXIE 3URGA 2EJGA 5J39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXF A;  1I5L A;  2K57 A;  3QUI A;  2RM4 A;  4XU3 A;  4EMH A;  1N9R A;  2FYK A;  5LJ5 e;  3JCM e;  3RKW A;  1JRI A;  1TH7 A;  2EJ9 A;  2ZGW A;  4PJO C;  3M4G A;  4HT9 A;  4M7A A;  3RIR A;  1BIB A;  4JRK A;  5GAN e;  1WQ7 A;  5DY9 A;  4F7U G;  3HFN A;  4M77 G;  3JB9 H;  4M7A F;  4XTY A;  4V2S A;  4M77 E;  2DJZ A;  5GAN 3;  3GIB A;  3RKX A;  2VC8 A;  3JCM d;  4M75 B;  3JCM g;  4M7A B;  5LJ5 g;  4M7A D;  4M78 A;  3JCM V;  5GAN 5;  3JB9 F;  2DVE A;  3RKY A;  5LJ3 e;  4C92 G;  3JCM J;  4XQ3 A;  3JB9 D;  1JBM A;  1B34 B;  4M78 F;  4C92 E;  5GAN d;  2YLC A;  4M78 D;  5GMK i;  4X9D A;  3JCM X;  5GMK m;  3QSU A;  1M8V A;  5LJ5 f;  5GMK e;  4M7D D;  2EJF A;  1Y96 B;  4J6Y A;  1WQW A;  5LJ3 d;  3JCM c;  4M78 C;  5GAM g;  4XU0 A;  2VXE A;  4EMG A;  1D3B A;  3V8J A;  4M77 A;  4XTU A;  2YHT A;  4M7D C;  5GAN 8;  4M75 A;  3SB2 A;  1LNX A;  4C8Q G;  3L1A A;  4EMK A;  4M77 F;  3L2Z A;  5GAO m;  1MGQ A;  3RER A;  3FJP A;  1D3B B;  4M75 F;  4RCB A;  5GAO n;  4F7U B;  4F7U E;  5GAM f;  1B34 A;  4M77 B;  4C92 A;  4M75 D;  5GAO p;  1WPY A;  4XTZ A;  4EMK B;  4C92 F;  4JUV A;  1N9S A;  5GMK l;  4PJO G;  4C92 B;  3FIF A;  1I8F A;  1Y96 A;  3V8L A;  5GAN g;  3HFO A;  5GAN 2;  4M75 C;  4NL3 A;  4M7A C;  4PJO E;  4WF2 A;  4J6W A;  1KQ1 A;  3EFS A;  3JCM f;  2FB7 A;  2DEQ A;  2RA2 A;  2DTO A;  3BFM A;  4NL2 A;  3HSB A;  1I4K 1;  3QO3 A;  4XU1 A;  4XTW A;  5LJ3 g;  3EFR A;  5LJ5 h;  3JCM Q;  2DTI A;  1LJO A;  2EWN A;  5GAN f;  2DZ9 A;  3INZ A;  4XU2 A;  4XTV A;  4F7U A;  3RUX A;  1I81 A;  5GAO l;  1WNL A;  3SWN A;  2DTH A;  5LJ5 j;  5GAO r;  4J6X A;  4MMK A;  4N0A A;  3PGG A;  4OP0 A;  4F7U F;  5GAN 4;  3JB9 I;  4C8Q B;  4C8Q E;  3V7C A;  1LOJ A;  5LJ3 f;  2E1H A;  4M77 D;  1M5Q 1;  4DQ2 A;  3SWN B;  4JRI A;  4PJO A;  2RD1 A;  4M78 G;  3BY7 A;  2EAY A;  4M78 E;  5GAM h;  4HA8 A;  4PJO F;  2QTX A;  5GAO q;  2E10 A;  4C92 D;  3V7R A;  3JCM P;  4M77 C;  4NOY A;  4M7D G;  2DKG A;  2YLB A;  3RES A;  4PJO B;  2E64 A;  4Y91 A;  4A53 A;  5GAN 6;  5GAM j;  4N0A C;  3BW1 A;  4M7D E;  4MML A;  4EMK C;  4QVD A;  2JN0 A;  2E41 A;  5GMK h;  3AHU A;  4C92 C;  1X01 A;  1HK9 A;  4QVC A;  2DXU A;  3JCM h;  5GMK j;  5GAN 7;  4C8Q A;  2E65 A;  2CGH A;  3JCM b;  4PNO A;  4M75 G;  2I2L A;  5GAN h;  4M7A G;  4C8Q F;  5LJ5 d;  4M75 E;  4M7A E;  3VU3 C;  4HT8 A;  4XTX A;  4C8Q D;  4J5Y A;  1KQ2 A;  4RCC A;  3JB9 G;  1HXD A;  5GAN j;  3FB9 A;  5GAM e;  3QHS A;  1U1T A;  1U1S A;  3BDU A;  5CAI A;  4M7D A;  5I21 A;  2DZC A;  5LJ3 h;  4JLI A;  2RB6 A;  4M78 B;  3V7S A;  1H64 1;  2Y90 A;  1BIA A;  2DXT A;  2HNI A;  4C8Q C;  3V8K A;  3JB9 J;  4X9C A;  3JCM W;  3SWN C;  4A54 A;  4M7D F;  4PJO D;  5LJ3 j;  4M7D B;  2EJG A;  1YCY A;  5GAM d; 
#chains in the Genus database with same CATH topology
 1I5L A;  1KJW A;  1BCO A;  1IGQ A;  4BDY A;  2EJ9 A;  3LGL A;  3ME9 A;  3VS5 A;  2DJZ A;  3JCM d;  2EYX A;  1M9S A;  5I2S A;  2DET A;  1EIF A;  3MEU A;  4BI8 B;  1YIT Q;  2RQV A;  1B34 B;  4J9B A;  5EG2 A;  5FRO A;  3H0F A;  4A63 B;  5LJ5 f;  1IHV A;  1X6O A;  3TEE A;  3I9Q A;  3JCM c;  2JXB A;  2EW3 A;  2HQX A;  3TCJ A;  1PG5 B;  2C06 A;  2V8K A;  2LX7 A;  1C1A A;  4J9F A;  2RI5 A;  3FDR A;  4F7U B;  4WTO B;  1TS9 A;  3FIF A;  5GAN g;  3PE0 A;  4X34 A;  4M75 C;  3X24 B;  3M0R A;  4BDZ A;  4HCB A;  1QP2 A;  2A7Y A;  2DMO A;  2DTO A;  1LCK A;  2YSQ A;  3BFM A;  2NYS A;  3M58 A;  3A98 A;  4IUU A;  2GTJ A;  2DL7 A;  4J6X A;  3I56 Q;  2MMP A;  2WSC E;  1X27 A;  3PGG A;  2XID A;  2HDA A;  4OB0 B;  5FU6 C;  4LE9 A;  1WJR A;  1D0Y A;  2E70 A;  2BKD N;  2YLB A;  1VQM T;  3G4S A;  1YJN Q;  2XDP A;  1N27 A;  4EIK A;  1G2B A;  2ZZD A;  3PT9 A;  1W70 A;  2ZPH B;  2VVK A;  1M4Z A;  5GAN h;  2PQW A;  4MDX A;  4M7A E;  5IT9 E;  1OQK A;  1HJD A;  5GAN j;  3EAE A;  2EYQ A;  2X4J A;  1M8M A;  2Y4Y A;  4QT7 A;  1BIA A;  2ATC B;  1TU0 B;  2RM4 A;  1SPK A;  3OYI A;  4C0G A;  3OBW A;  5I2M A;  4E6R A;  2B8A A;  3EH1 A;  4E7L A;  3P8H A;  1SSH A;  1OX8 A;  1AWO A;  1FMV A;  4F7U G;  1PSE A;  2JS0 A;  3JB9 H;  5HCK A;  5KCO A;  7AT1 B;  4PFP A;  1O75 A;  2YUP A;  3JCM g;  3ASK A;  3CCU Q;  4XQ3 A;  3CD6 Q;  5L8R E;  2COW A;  4DBH A;  5GMK e;  1PC0 A;  3A8M B;  4BE0 A;  1M1G A;  4M78 C;  1MHN A;  1XNI A;  4GBQ A;  3T9N A;  3UDC A;  3X20 B;  8AT1 B;  2COZ A;  5C6S A;  4A4F A;  4F7U E;  3KXT A;  4JDS A;  4AMC A;  3CC7 T;  4EMK B;  2VYT A;  1XTD A;  3PTA A;  1VQ5 A;  1KSW A;  3CC7 A;  1ACM B;  2KSS A;  1WJS A;  3HRU A;  3QXE B;  3HSB A;  4OB2 B;  2MOX A;  4LUE A;  3MP8 A;  3HP9 A;  2PNI A;  1VQ4 A;  1NYG A;  4MZT A;  4R0K A;  5KH6 A;  2DO3 A;  2EYY A;  2R5A A;  4N0A A;  3JB9 I;  4Z02 A;  2JTM A;  1M90 R;  2E5Q A;  2E12 A;  3CCQ Q;  2LQK A;  3CCJ Q;  3V7R A;  4PK4 A;  1MNE A;  4A53 A;  1RAF B;  1W2B P;  2BTT A;  3BDL A;  4RTV A;  4HVV A;  1UEB A;  2HQH A;  2EQJ A;  3PMT A;  2PU9 B;  3CMA A;  2OTL T;  1WDX A;  2FPD A;  3HKS A;  1WJQ A;  1IHW A;  4LXC A;  2OTL A;  5CKE A;  3C4S A;  4OB1 B;  3V8K A;  2J7I A;  1LVK A;  5AT1 B;  4KGX B;  4LDY A;  3CBM A;  1C6V X;  2F2V A;  3OB9 A;  1E6G A;  4CC7 A;  2FZG B;  2KGT A;  3A1P A;  5CKF A;  5IXB A;  1YP5 A;  2B86 A;  1IRX A;  2CT4 A;  2LMJ A;  4XTY A;  3NGP A;  3UA7 A;  4JZ3 A;  1VQP T;  2DD4 A;  3TU4 K;  2EFI A;  2MF2 A;  1S72 Q;  1G83 A;  2MIO A;  1WHJ A;  1M8V A;  1OI1 A;  2EJF A;  3GOX A;  2X4Y A;  2HMA A;  1N8R R;  4IUR A;  4Z88 A;  2KXD A;  2O9V A;  5FWB A;  3V8J A;  3UAT A;  4ELZ C;  1VQN Q;  2A08 A;  1UGQ B;  2AKL A;  4M77 F;  2DVJ A;  5GAO m;  5GAM f;  2C0I A;  4M77 B;  4M75 D;  2D8J A;  3MPU B;  5FU7 B;  1EX4 A;  2DIQ A;  3QZ9 B;  2X51 A;  5IHN A;  3WXM B;  4AT1 B;  2FB7 A;  2DEQ A;  1OZ3 A;  4HCZ A;  4L6V 5;  3OYG A;  1WXB A;  2Y4X A;  3OYH A;  1VIE A;  2LJ1 A;  3NTK A;  2HSP A;  2O88 A;  4EDU A;  2VUB A;  2WAC A;  2QTX A;  1AWW A;  3QPH A;  4Y92 A;  4JS4 A;  1WHM A;  2EKO A;  2NWM A;  1CKB A;  1D0Z A;  2MAM A;  3GNG A;  1D1B A;  2DRM A;  4PNO A;  3PIP A;  1RUW A;  2RNA A;  1Q81 R;  3QBY A;  2RHI A;  4A54 A;  4HVW A;  2DER A;  1B07 A;  3CME Q;  1QCN A;  4RTU A;  1X2Q A;  4O5V A;  2RHU A;  2RQW A;  4C5I A;  3A8G B;  1QWE A;  4M77 G;  1UGP B;  4MDW A;  4J9D A;  1H3H A;  2E3H A;  5GAN 3;  2LCC A;  1ZUK A;  3EFO A;  4C0Z A;  3P8D A;  4JJC A;  4LNP A;  3RR6 A;  2KK4 A;  4M78 D;  3L2R A;  2BE7 D;  2KAF A;  3M53 A;  1WQW A;  5LJ3 d;  4ME7 A;  1VQM Q;  1KC8 U;  1K8A U;  4J7I A;  2GNC A;  4EMK A;  1T0H A;  2RPN A;  4M75 F;  1KD1 U;  2F69 A;  1ZA1 B;  1VIF A;  4PJO E;  1VUB A;  4QQD A;  2FRW A;  1ARK A;  5CKD A;  4KUI A;  2VV5 A;  4NL2 A;  4XTW A;  3JCM Q;  2RMO A;  1YBY A;  3INZ A;  5FWC A;  1WI7 A;  3EGU A;  3MEA A;  2P0P A;  2DJQ A;  5GAN 4;  1M90 C;  1EFN A;  5HK3 A;  3HL8 A;  4JZ4 A;  3M0U A;  3VUB A;  1NEB A;  4A4E A;  1Q82 C;  4EMK C;  4QVD A;  1ZA2 B;  1TSF A;  3NFC A;  1UGS B;  5GAN 7;  3SHW A;  2KRO A;  2VAS A;  2CGH A;  5LJ5 d;  1UTI A;  1NE8 A;  4HT8 A;  3CD6 T;  4E7S A;  2M51 A;  2A37 A;  2EVR A;  1IRE B;  1BKB A;  5D7U A;  2JTF A;  5A0D A;  2GBQ A;  2DF6 A;  3CD6 A;  2QEX Q;  3I5R A;  2DAQ A;  2VGM A;  1OPL A;  1GXI E;  2OTJ Q;  2EJG A;  1PM3 A;  1VQ9 T;  1VA7 A;  1Q95 G;  3G7Z A;  1TH7 A;  5KCH A;  1NJI R;  2JUF A;  3M4G A;  3HRT A;  2AZS A;  1FMW A;  4JRK A;  1VQ9 A;  2M1H A;  4N4H A;  2XMF A;  4M7A D;  1ZUU A;  2YUO A;  1NLO C;  4MZP A;  4E47 A;  1AOJ A;  4M78 F;  2DD5 A;  1YJ9 T;  3LYI A;  4AG1 C;  5CKB A;  3I5S A;  1N8R C;  1FMK A;  1Y96 B;  1RL2 A;  1YJ9 A;  4FIB A;  5DM7 R;  4XU0 A;  4EMG A;  5A0G A;  4M77 A;  2YHT A;  2DIG A;  4RCB A;  3CCQ T;  2XDD A;  5GAO p;  2OTL Q;  3IQL A;  1KIK A;  4F04 B;  3NHN A;  2IVW A;  1ZSZ A;  4BE1 A;  3CCQ A;  2YWW A;  3HFO A;  3J81 E;  5KYW B;  3GP8 A;  2X9H A;  1K4U S;  2RJD A;  3H41 A;  3DKM A;  1UUE A;  1X69 A;  1UHF A;  5GAO l;  3MP6 A;  3DLM A;  1NG2 A;  2ESW A;  2KNB B;  4OMQ A;  5FRN A;  3H0I A;  2DRK A;  5DLQ E;  2EAY A;  2I0N A;  1DJ7 B;  3GBQ A;  1AT1 B;  2FO0 A;  1QLY A;  4M77 C;  1VQP Q;  2QAZ A;  4M7D E;  5FU7 C;  2L3S A;  4DEY A;  4JLG A;  1YJW T;  4N4G A;  2KYM A;  1ABQ A;  4C5E A;  2C0T A;  2NUP B;  1YJW A;  1G3T A;  2F2X A;  4PKC C;  4RG8 A;  1JO8 A;  1JJ2 P;  1U1T A;  2JTE A;  1S72 T;  5CAI A;  4PLL A;  3JAM E;  1Q81 C;  4LN2 A;  3CCS T;  2F2W A;  1XOV A;  3VS0 A;  4PL6 A;  1QVF A;  2O01 E;  1BCM A;  1S72 A;  2CP2 A;  1Y0M A;  4OMM A;  2QI2 A;  3JCM e;  3OYF A;  1RAB B;  4PLI A;  2QGG A;  1JRI A;  2ZCF B;  4CC3 A;  1MMD A;  2OAW A;  1W6X A;  1QVG A;  4M7A F;  2DL5 A;  2VC8 A;  2BZX A;  4M7A B;  2O4X B;  4M4Z A;  2LZ6 B;  2D0N A;  1G8X A;  1V29 B;  2YT6 A;  4JPB W;  4PJJ A;  2DBK A;  3M0S A;  2P84 A;  2YRV A;  1QP3 A;  2FPE A;  4M75 A;  1ABO A;  2CZ0 B;  1IXD A;  2QQS A;  1OV3 A;  2O9S A;  1MGQ A;  2J06 A;  2KI7 A;  4IKF A;  3FJ5 A;  2RHX A;  5IN1 A;  1M2V B;  1E6H A;  2NUT B;  1N5Z A;  2CSQ A;  2DFU A;  2VKN A;  4WF2 A;  3MCA B;  1BBZ A;  5A0L A;  2CZ6 B;  1YN8 A;  2MI6 A;  2KXC A;  2JVV A;  1WNL A;  4F7U F;  1GFC A;  1LOJ A;  4J7F A;  3U23 A;  3EG9 A;  3LWH A;  2RD1 A;  4L5G A;  1ZSG A;  1UGV A;  3S3M A;  2DIL A;  2RJC A;  3CME T;  3M9Q A;  1OZ2 A;  5CO7 A;  2E41 A;  4E2F B;  2V26 A;  3CME A;  5HK0 A;  2EGE A;  2KQW A;  2K9G A;  2DL3 A;  3OYK A;  2SEM A;  1VQL Q;  2EYZ A;  1OU8 A;  3LH0 A;  2I2L A;  4M7A G;  1O9S A;  2CYZ B;  4ANJ A;  5IAY A;  3OMG A;  3LW5 E;  3M0T A;  1CKA A;  1YFN A;  2RN8 A;  2AT1 B;  2HNI A;  2A0F B;  1QCF A;  3JCM W;  3VRZ A;  2LCS A;  4BY6 B;  3ZFJ A;  5GAM d;  2EYW A;  1NJI C;  4QVZ A;  1JJ2 S;  1MND A;  2P4R A;  1EZZ B;  3I35 A;  1WXU A;  1VQM A;  2DM1 A;  2K5I A;  3RNJ A;  2D1X A;  5IHK A;  3RDV A;  2DL4 A;  3NTI A;  4M78 A;  2FL7 A;  3E19 A;  4C92 E;  1ZUY A;  3C95 A;  2CH4 W;  1KK7 A;  2K5L A;  3CQT A;  2EKH A;  2EGC A;  2HBW A;  5CCA A;  1TTH B;  2RQT A;  1YWO A;  3OYM A;  3PIO A;  5KYW A;  1NM7 A;  1VYT A;  4OGE A;  1N9S A;  2LT1 A;  3X26 B;  4RMO A;  1HSQ A;  5FRM A;  3WVE B;  3CCR T;  3L2V A;  4OML A;  3NTH A;  5CQX A;  1QMC A;  2CSI A;  1LJO A;  5GAN f;  1SEM A;  2CH4 A;  3EGD A;  2L3R A;  1I81 A;  1VQ9 Q;  3TSW A;  1R77 A;  1PKS A;  3C0C A;  5J3B A;  3QZ5 B;  4M77 D;  1VYU A;  2C0O A;  2QEX T;  1Q86 R;  2HL5 C;  3TSZ A;  4KGZ B;  2OTJ T;  1M1F A;  4QW2 A;  2E10 A;  3A8O B;  3H0H A;  2E64 A;  4Y91 A;  2QEX A;  3THK A;  4MML A;  1XQH A;  4DBR A;  1YJ9 Q;  2OTJ A;  2LC4 A;  2D0Q B;  4D8K A;  4JJN K;  3JCM h;  2NUP A;  2XU8 A;  5IH2 A;  3CPW P;  5CVI A;  5I11 A;  2L5Q A;  2HCK A;  2ROL A;  5AYF A;  3J7A F;  3OS2 A;  1ZLM A;  2HL3 A;  3EG3 A;  5KE2 A;  3V7S A;  3OSV A;  2Y90 A;  2CP3 A;  3FEO A;  5M9O A;  3OW2 A;  1QWF A;  1J3T A;  2L8D A;  5KYX A;  1RLQ C;  2WSE E;  3QUI A;  3CBO A;  1RAG B;  1N9R A;  1WX6 A;  2V1Q A;  3MO8 A;  4M7A A;  1KQS A;  2O4X A;  3VS3 A;  3SDZ A;  3H9N A;  1I5O B;  3RKX A;  3OYA A;  1H8K A;  1X6B A;  3OYB A;  1YI2 T;  1X6G A;  3C12 A;  3JB9 D;  2HKN A;  4J83 A;  1GFD A;  4FYV B;  1KFZ A;  3CXC P;  2J6O A;  1T3L A;  1G3S A;  2JW4 A;  3A8L B;  3QSU A;  1YI2 A;  1UB4 A;  3JV3 A;  3KBG A;  1OU9 A;  1M3A A;  3X28 B;  4C5H A;  1K9M R;  4E7Z A;  3L1A A;  1W1F A;  1YJW Q;  3QG1 A;  1FXX A;  2KMT A;  1B34 A;  4IUQ A;  3S3N A;  4XTZ A;  1SF9 A;  4II1 A;  2HD0 A;  4C0D C;  2KBT A;  3VS6 A;  2RI2 A;  4M7A C;  2DX1 A;  2FRY A;  2QQ9 A;  4J6W A;  1VQP A;  1QVG P;  3CCS Q;  3CCV Q;  2RA2 A;  1I4K 1;  2RI3 A;  3EFR A;  2PVG B;  4F7U A;  3VYH B;  1QKW A;  2DA9 A;  1K76 A;  2DYB A;  2JM9 A;  2SRC A;  4C8Q B;  1K8A R;  3JSC A;  3OYY A;  2P4T A;  4PJO F;  2KRM A;  5CR2 A;  1ZHI A;  3QJY A;  1E7O A;  4PJO B;  1Q7Y U;  5D6Y A;  3L42 A;  2V8J A;  1WYX A;  4KGV B;  2ZAE A;  4FW1 A;  2E65 A;  3OY9 A;  2KRS A;  2PZ1 A;  1ZQ1 A;  1KHC A;  3CCE Q;  3LLR A;  2OX7 A;  2EIF A;  4XTX A;  4J5Y A;  2BIV A;  4J8O A;  3QHS A;  4OMN A;  2J6K A;  2YDL A;  1YNZ A;  3CPW S;  2LQN A;  1RI9 A;  2QGF B;  2O31 A;  1SHG A;  3FC3 A;  1NEG A;  2K57 A;  3M59 A;  1JXO A;  2IG0 A;  4J9I A;  1PHT A;  1BIB A;  1GBR A;  1RAE B;  5GJW B;  2JNG A;  2K7A A;  3CCL T;  1W2B S;  3VKI A;  3JB9 F;  5LJ3 e;  4ZNX A;  1Q82 U;  2YLC A;  2DXB A;  3CCL A;  4Z8A A;  5GMK m;  4PJN A;  3EG1 A;  4NS5 A;  2L89 A;  2VXE A;  1OYX A;  4AFQ C;  3CXC S;  4CC2 A;  3DB3 A;  3TRE A;  1M1K U;  4BY6 C;  4C8Q G;  2J05 A;  2DXC A;  3FJP A;  3PVQ A;  4N4I A;  4IIM A;  1D1A A;  1I1J A;  2K4Y A;  3VS7 A;  4QQ6 A;  4KRT A;  4PJO G;  3R6O A;  1OOT A;  3OMC A;  5CQY A;  1VQL T;  9ATC B;  2DTI A;  2M0O A;  2RJF A;  2QQB A;  2M16 A;  2RK1 A;  2X3W D;  1K73 R;  4L59 A;  1VQL A;  1BYM A;  4C8Q E;  1SKU B;  1UHC A;  2E1H A;  1Q86 C;  1OX9 A;  4JRI A;  2BZY A;  3OYE A;  2BZ8 A;  4UC4 A;  3BY7 A;  3TQ7 P;  3JCM P;  1K1Z A;  3UPU A;  2DKG A;  3C94 A;  3VS1 A;  4E7H A;  3BW1 A;  4RTX A;  2JN0 A;  2RHY A;  1D09 B;  4PJM A;  3MET A;  3QWY A;  5EC7 A;  2H3E B;  4BUG A;  2D6F A;  2CP7 A;  2H8H A;  4PFZ A;  3JB9 G;  2FG0 A;  2RB6 A;  3QWX X;  5KYY B;  2MPX C;  4M7D F;  2CRE A;  1P92 A;  4M7D B;  4FYW B;  1OEB A;  1TWB A;  1JEG A;  3RKW A;  3CCR Q;  2QA4 T;  2RQR A;  1K0S A;  3LWI A;  4DOV A;  3HFN A;  4BB7 A;  4R55 A;  1GL5 A;  3EG2 A;  2QA4 A;  4ZTF A;  1NYF A;  1X75 C;  1VQ8 T;  2YRC A;  4J9H A;  3X25 B;  3I55 T;  2E6Z A;  4HXJ A;  2ED1 A;  1SHF A;  1TG0 A;  3FRN A;  2JJ9 A;  3CCM T;  2K2V A;  3EH2 A;  3I55 A;  1QCO A;  5DLO A;  2ENM A;  1K9M C;  1UJ0 A;  1WZO A;  2CUB A;  2K3Y A;  2HBP A;  3N5B B;  2PTK A;  3QKJ A;  4E7I A;  1Q81 U;  2LRQ A;  4KUD K;  3CC4 Q;  2LT4 A;  1YIJ T;  2PUO B;  5GAN 2;  1PCX A;  4FT4 A;  1X2K A;  2HKQ B;  3HHT B;  1YIJ A;  3HRS A;  4F16 A;  5LJ3 g;  2A36 A;  2AKK A;  2CT3 A;  5HY6 A;  5GAO r;  2COY A;  1WXT A;  3OYD A;  1K8A C;  2JOY A;  2EQK A;  4K11 A;  1M5Q 1;  1AZE A;  4PJO A;  4RTT A;  3GF5 A;  5GAO q;  4TVR A;  4M7D G;  1WFW A;  1YI2 Q;  3UWN A;  3VS4 A;  2GQV A;  2KEA A;  1QQJ A;  1IO6 A;  4WCI A;  4MZM A;  4QVC A;  3CEY A;  2GF7 A;  3QYG B;  3JCM b;  4OMP A;  3L2W A;  4FL6 A;  2F5K A;  4M75 E;  1PWT A;  2ECZ A;  1U3O A;  4A4H A;  3GLX A;  3H8Z A;  1HXD A;  5ECA A;  3SD4 A;  1U1S A;  1GCQ A;  1V76 A;  5LJ3 h;  1H64 1;  4C8Q C;  3MEW A;  2L0A A;  4X9C A;  5LJ3 j;  2XK0 A;  2OJ2 A;  4FCY A;  2CP5 A;  4PJO C;  4B9X A;  4HT9 A;  4ZGJ B;  5DY9 A;  1VQ7 T;  4HCK A;  1QVP A;  4JRP A;  4V2S A;  2ZPB B;  2QAS A;  2JMA A;  5LJ5 g;  1AHJ B;  3JCM V;  2FVU A;  2V8I A;  1VQ7 A;  4ZTJ A;  1JBM A;  3M55 A;  4IIO A;  5GAN d;  2DYI A;  3CCV T;  5FW9 A;  2DLP A;  3QYH B;  5A2Q E;  2KY9 A;  1RAH B;  4ORZ A;  2WSF E;  2RF0 A;  4EPC A;  1U06 A;  4RUG A;  3VRY A;  1OPK A;  3CCS A;  3CCV A;  1TUG B;  4AFU C;  1K0X A;  2JM8 A;  1VQ6 T;  1GCQ C;  1VQO T;  3DLL A;  3CC2 Q;  1AD5 A;  3L2Z A;  1D3B B;  5GAO n;  1VQ6 A;  1G3Y A;  2LJ3 A;  1VQO A;  1AZG B;  2PVD B;  4C92 F;  4OMO A;  3REB B;  2JMC A;  4RKU E;  5GMK l;  4C92 B;  1NJI U;  2DK3 A;  1RAI B;  4BD3 A;  1R0B G;  2HAX A;  3JRZ A;  3QO3 A;  2AIR B;  3QII A;  5LJ5 h;  2HZY A;  1GBQ A;  1WHL A;  1K73 C;  3CCE T;  1WLP B;  2EGA A;  5LJ5 j;  4LD9 K;  2XIC A;  3ULR B;  3GPL A;  3S3O A;  4DBQ A;  3CCE A;  3OSS C;  3SWN B;  2RH2 A;  1I0C A;  4M78 E;  1UFF A;  4A4K A;  3CCL Q;  1NPR A;  2FHD A;  3RES A;  5CIU A;  5GAN 6;  2RQU A;  2R57 A;  3J80 E;  3HTR A;  1X01 A;  2XI9 A;  2K3B A;  2HQE A;  1VOM A;  1G5V A;  4FW2 A;  4KH1 B;  3O8V A;  2CP6 A;  3A5Z B;  2KYB A;  2YXY A;  1RAA B;  1HYO A;  2DBM A;  2NLU A;  5KYY A;  3BE3 A;  5GAM e;  4P5N A;  4M7D A;  3M54 A;  1AWX A;  4RTW A;  2FYK A;  1M3C A;  2F1L A;  2KDS A;  3G1J A;  2XDB A;  4RTZ A;  5CK9 A;  2VB6 A;  2HSE B;  2XD0 A;  1VYV A;  4C92 G;  2OI3 A;  4FT2 A;  1I07 A;  1U8R A;  2MWO A;  1NZ9 A;  3PFS A;  2EQU A;  2K6D A;  2P0Q A;  4CI0 C;  5D6X A;  8ATC B;  1Z9Z A;  2EQM A;  4M7D C;  2E5K A;  3P8B B;  2D9T A;  2RK2 A;  1FX7 A;  3UT1 A;  1M2O A;  3G4S T;  2DE0 X;  2MWP A;  3OS1 A;  4X1V A;  3E9G A;  3VJP A;  1Y96 A;  1FYN A;  2LQW A;  4ATO A;  1C0M A;  4VUB A;  4YTL A;  4CC4 B;  4RG2 A;  1MMG A;  1XJW B;  4FYX B;  4D8D A;  2E3I A;  4XTV A;  1VQK T;  2G6F X;  2W10 A;  2AHJ B;  4F17 A;  4QQG A;  2X35 A;  3M5A A;  4D6W A;  2QA4 Q;  3QDR B;  4GLK A;  3OYL A;  3F70 A;  1VQK A;  3R6N A;  2CKK A;  2K79 A;  3QJ6 A;  4NOY A;  1VQ8 Q;  2QK0 A;  4J9E A;  3I55 Q;  2L2P A;  4DA4 A;  1RAC B;  3AHU A;  4RTY A;  3CCM Q;  3CCR A;  1WGS A;  4FM4 B;  4OMF B;  2LCL A;  3G71 T;  2F5T X;  1IZ6 A;  3RBB B;  4C8Q D;  1KQ2 A;  3FB9 A;  5LL6 S;  3G71 A;  2L3P A;  1M3B A;  2X4W A;  4DEX A;  4Y28 E;  4LD6 A;  3EFO B;  2JS2 A;  4PJO D;  2QDL A;  1YIJ Q;  2CUD A;  5J39 A;  4B6M A;  1R8O B;  4XU3 A;  4EMH A;  1UDL A;  4ZN3 A;  2KR3 A;  3VUZ A;  1Q7Y R;  3O5Z A;  3RIR A;  1YWP A;  2A28 A;  1GCP A;  2CZ7 B;  4BI4 A;  3CC4 T;  3MKD A;  1VQ5 T;  1G3W A;  5GAN 5;  3JCM J;  1WHG A;  3CC4 A;  2KVQ G;  1UGR B;  2DPP B;  4JJB A;  1WIE A;  1VQ4 T;  1IB8 A;  3TVT A;  4J6Y A;  5GJV B;  3G6E T;  1YHQ T;  5GAM g;  3EGX B;  1UG1 A;  1D3B A;  3DB4 A;  4J9C A;  3G6E A;  1YHQ A;  2P0K A;  4A4G A;  2QYZ A;  4C92 A;  4ELY C;  4JS5 A;  2QG9 B;  1TOV A;  4GY5 A;  2FEI A;  3V8L A;  2ZPE B;  4AFS C;  1TXQ A;  3CMA T;  3JCM f;  2AZV A;  1Q82 R;  2H3J A;  2ABL A;  2EWN A;  3NMZ C;  2RHZ A;  3PVL A;  3SWN A;  2DTH A;  1M2V A;  5KYU B;  3OYC A;  5KE3 A;  4LUD A;  4MMK A;  2NUT A;  1PD1 A;  3HPW A;  1FWZ A;  2ZPI B;  4LDU A;  1QVF P;  1VQ7 Q;  1B3Q A;  1M1K R;  1GRI A;  1M27 C;  4OGC A;  2NUZ A;  2W0Z A;  5GAM h;  4J9G A;  5GAM j;  4N0A C;  1N6A A;  1UEC A;  3CBP A;  1H3Z A;  4C92 C;  1HK9 A;  4DBF A;  3ZEH A;  4ZGD B;  3OS0 A;  2LP5 A;  1ZBJ A;  2CS7 A;  4C8Q F;  1VQ6 Q;  3VU3 C;  1KC8 R;  4RCC A;  1JXM A;  1MMA A;  1VQO Q;  2BE9 B;  4KH0 B;  4FSS A;  3BDU A;  4PFO A;  3PMI A;  3E2U A;  2FPF A;  3SWN C;  1NPP A;  3M0P A;  1KD1 R;  2YRD A;  3Q1J A;  1AEY A;  2CDT A;  1PD0 A;  4JRQ A;  1R0C B;  2ZGW A;  3CC2 T;  4HCC A;  1IGU A;  1Q86 U;  1JU5 C;  3OBY A;  2YUQ A;  1WQ7 A;  1X43 A;  2KRN A;  3A8H B;  3M57 A;  3CC2 A;  4FSX A;  4R56 A;  2E6N A;  3RKY A;  2OAU A;  3M4Y A;  1Z9Q A;  3LGF A;  2DEU A;  3OS5 A;  3MJX A;  1ZSZ B;  1D0X A;  1SRL A;  1JJ2 A;  4M7D D;  1WHK A;  1F1B B;  1B7T A;  3VYG A;  2XHC A;  1M90 U;  5IXF A;  4FU6 A;  1CSK A;  3SB2 A;  1LNX A;  2LJ0 A;  2LQ8 A;  1V1C A;  2K3X A;  3RMQ A;  2Z0W A;  1MV3 A;  4ZGE B;  3EHR A;  2LNV A;  2GCX A;  1KQ1 A;  3EFS A;  4F14 A;  4AG2 C;  4E7J A;  4XU1 A;  4FYY B;  4XU2 A;  3RUX A;  1MMN A;  3VS2 A;  2EPD A;  3NPF A;  1BI3 A;  1YIT T;  2GGR A;  1BB9 A;  2X4X A;  3E9F A;  4LDW A;  3SFM A;  1D1C A;  2R5M A;  1YIT A;  2LDM A;  1Y71 A;  3L2U A;  4HA8 A;  2ROT A;  1NLP C;  1JQQ A;  2GFU A;  1S1N A;  1BI2 A;  2KE9 A;  4IUV A;  1K9M U;  1ZX6 A;  5GMK h;  1QVF S;  2DXU A;  4PJL A;  5GMK j;  1BK2 A;  2ZPG B;  2VGN A;  3CPF A;  5L23 A;  2IIM A;  4BI3 A;  1KG1 A;  4HKE A;  3UF4 A;  1QVG S;  1BI1 A;  3ZL7 C;  4LDX A;  1N8R U;  3G4S Q;  2DXT A;  1PSF A;  1OUL A;  1PNJ A;  3LH5 A;  2CZ1 B;  2MK5 A;  1KHI A;  1YCY A;  2VXF A;  5LJ5 e;  1Q7Y C;  3I56 T;  2MYS A;  4OF1 A;  3OQ5 A;  2FZK B;  1K9A A;  3I56 A;  4M77 E;  3FLG A;  4M75 B;  4BAC A;  1VQK Q;  3GNF B;  1RI0 A;  2CP0 A;  5IHI A;  1YJN T;  2E4H A;  2PVO B;  4OB3 B;  6AT1 B;  5C0M A;  3VV0 A;  1BI0 A;  2LNH B;  3S6W A;  4X9D A;  3PNW C;  1H92 A;  4ESR A;  3EGX A;  2QXF A;  1YJN A;  4C0F A;  3RMS A;  2QTV A;  2J6F A;  1LPL A;  1PRL C;  5FU6 B;  5GAN 8;  4C5G A;  4XK8 E;  2BUD A;  3RER A;  1SRM A;  1AWJ A;  4KBM B;  3G71 Q;  1NBE B;  2EBP A;  3KUF A;  2K5F A;  3MP1 A;  2LVM A;  4JUV A;  2XG8 D;  3D7S B;  1I8F A;  3EG9 B;  1UE9 A;  1TUD A;  2V1R A;  4QKU A;  4NL3 A;  2LTO A;  2LX9 A;  5I22 A;  1VQ8 A;  3EG0 A;  3MHX A;  4BE2 A;  3M56 A;  5KYU A;  2M02 A;  2YUN A;  1AVZ C;  2PUK B;  4O6J A;  1YCS B;  4KUL A;  2DZ9 A;  3CCM A;  2KT1 A;  3CCU T;  4JJD A;  4OP0 A;  3V7C A;  4DOW A;  3OW2 P;  1M1K C;  2KT8 A;  3CCU A;  1VQ5 Q;  3CC7 Q;  4C92 D;  1PKT A;  3OYN A;  1UJY A;  2ED0 A;  1KQS P;  4ZN1 A;  1TUC A;  1T3S A;  2R58 A;  1PRM C;  3SEM A;  1QW1 A;  1VQ4 Q;  2DNU A;  2GFA A;  1A0N B;  4XAX B;  4C8Q A;  2FZC B;  2G3R A;  1ZBX A;  3LX7 A;  3G6E Q;  3H6Z A;  1YHQ Q;  1U5S A;  4M75 G;  1KC8 C;  3M0Q A;  4GLM A;  1RLP C;  2M0Y A;  5I21 A;  4JLI A;  4IUP A;  4M78 B;  4OVA A;  3OYJ A;  1KD1 C;  5CKH A;  1K73 U;  2AK5 A;  2QDY B;  4LDV A;  3ZBD A;  3CMA Q;  1SSF A;  1QKX A;  5GAN e;  2JZ2 A;  5FLX E;  3AT1 B;  2MCN A;  2X3X D;  2RJE A;  3EHQ A;  3ER0 A;  3GIB A;  3CCJ T;  2ZPF B;  2HEQ A;  1T0J A;  1WHH A;  3WVD B;  2DVE A;  3CPW A;  3KFV A;  1HD3 A;  4IUT A;  4CRI A;  4HVU A;  3JCM X;  5GMK i;  3CCJ A;  4Q5W A;  2D8H A;  2RO0 A;  3REA B;  4KT0 E;  3UA6 A;  4XTU A;  1JB0 E;  3MEV A;  1W2B A;  1SG5 A;  2GQI A;  1BU1 A;  3EGD B;  1WA7 A;  1WPY A;  5KYN A;  5J26 A;  4B9W A;  1Y7X A;  2XKO C;  3L2Q A;  3CXC A;  2GTO A;  1RAD B;  1ZSZ C;  1M30 A;  1MUZ A;  5HKC A;  3E1S A;  2A3L A;  1MV0 B;  2VWF A;  5LJ3 f;  2QQA A;  4DQ2 A;  3OA6 A;  4M78 G;  2M9U A;  4AFZ C;  2K2M A;  1W4S A;  4Z89 A;  2QQR A;  1VQN T;  2L3Q A;  3OW2 S;  4E7K A;  1Y57 A;  3QDF A;  2DL8 A;  5KYX B;  2JT4 A;  2EQI A;  1VQN A;  4C0D B;  1KQS S;  2IPO B;  2O2O A;  2DZC A;  5D6W A;  1Y07 A;  3JB9 J;  3URG A; 
#chains in the Genus database with same CATH homology
 1I5L A;  3M59 A;  1R8O B;  2K57 A;  4XU3 A;  4EMH A;  1VQ9 T;  2IG0 A;  3G7Z A;  4BDY A;  1TH7 A;  2EJ9 A;  5KCH A;  2JUF A;  3M4G A;  4ZN3 A;  3HRT A;  3VUZ A;  3RIR A;  1BIB A;  4JRK A;  3LGL A;  1VQ9 A;  2CZ7 B;  3ME9 A;  4BI4 A;  3CC4 T;  2M1H A;  2DJZ A;  1VQ5 T;  4N4H A;  3JCM d;  4M7A D;  1M9S A;  5I2S A;  2JNG A;  3CCL T;  1W2B S;  1G3W A;  3VKI A;  1EIF A;  5GAN 5;  3MEU A;  4BI8 B;  5LJ3 e;  4MZP A;  4E47 A;  3JCM J;  3CC4 A;  1Q82 U;  1B34 B;  4M78 F;  2DD5 A;  2YLC A;  1YJ9 T;  3LYI A;  2KVQ G;  1UGR B;  2DXB A;  2DPP B;  5EG2 A;  5FRO A;  3CCL A;  5CKB A;  5GMK m;  1VQ4 T;  5LJ5 f;  1N8R C;  4NS5 A;  1X6O A;  3TEE A;  1Y96 B;  1RL2 A;  4J6Y A;  3JCM c;  1YJ9 A;  3G6E T;  4FIB A;  2HQX A;  5GAM g;  2L89 A;  1YHQ T;  3TCJ A;  5DM7 R;  4XU0 A;  2VXE A;  1OYX A;  1D3B A;  4EMG A;  2V8K A;  2C06 A;  3DB4 A;  5A0G A;  4M77 A;  3CXC S;  2YHT A;  2DIG A;  3DB3 A;  3TRE A;  1M1K U;  4BY6 C;  4C8Q G;  3G6E A;  1YHQ A;  2P0K A;  4A4G A;  3FJP A;  2DXC A;  4RCB A;  3CCQ T;  2RI5 A;  3FDR A;  4F7U B;  2XDD A;  4C92 A;  4ELY C;  4N4I A;  5GAO p;  2K4Y A;  4JS5 A;  2IVW A;  4QQ6 A;  4BE1 A;  4PJO G;  3CCQ A;  3R6O A;  4GY5 A;  3FIF A;  3V8L A;  5GAN g;  3HFO A;  4X34 A;  4M75 C;  3X24 B;  2ZPE B;  3J81 E;  3GP8 A;  4BDZ A;  3CMA T;  3JCM f;  2RJD A;  4HCB A;  1QP2 A;  2A7Y A;  2DTO A;  3BFM A;  3DKM A;  3OMC A;  2H3J A;  3M58 A;  5CQY A;  1VQL T;  2DTI A;  2EWN A;  2M0O A;  2RJF A;  4IUU A;  2QQB A;  2M16 A;  2RHZ A;  2RK1 A;  5GAO l;  3MP6 A;  3SWN A;  2DTH A;  3DLM A;  3OYC A;  4J6X A;  4L59 A;  5KE3 A;  4MMK A;  2MMP A;  2WSC E;  3PGG A;  3HPW A;  1FWZ A;  1VQL A;  2ZPI B;  2XID A;  1BYM A;  4C8Q E;  4OB0 B;  4LDU A;  2E1H A;  5FU6 C;  1Q86 C;  5FRN A;  1WJR A;  4JRI A;  3OYE A;  4UC4 A;  5DLQ E;  3BY7 A;  2E70 A;  2EAY A;  4OGC A;  5GAM h;  1DJ7 B;  3JCM P;  3UPU A;  4M77 C;  2BKD N;  2DKG A;  2YLB A;  3C94 A;  3G4S A;  5GAM j;  1VQM T;  4M7D E;  4E7H A;  4N0A C;  1N6A A;  3BW1 A;  5FU7 C;  2XDP A;  1N27 A;  3CBP A;  2JN0 A;  1H3Z A;  2RHY A;  2ZZD A;  3PT9 A;  4C92 C;  1HK9 A;  3ZEH A;  4ZGD B;  4JLG A;  1YJW T;  3OS0 A;  2ZPH B;  3MET A;  1M4Z A;  4N4G A;  2CS7 A;  4BUG A;  4C5E A;  5GAN h;  2PQW A;  4C8Q F;  2D6F A;  4MDX A;  4M7A E;  1YJW A;  3VU3 C;  5IT9 E;  1G3T A;  4RCC A;  4PKC C;  4RG8 A;  5GAN j;  3JB9 G;  3EAE A;  2EYQ A;  1U1T A;  2X4J A;  1S72 T;  3BDU A;  4PLL A;  5CAI A;  3JAM E;  3PMI A;  1Q81 C;  3CCS T;  2RB6 A;  1XOV A;  2Y4Y A;  1BIA A;  4PL6 A;  4M7D F;  1P92 A;  3SWN C;  1NPP A;  2O01 E;  1QVF A;  1S72 A;  4M7D B;  3Q1J A;  2QI2 A;  2RM4 A;  3JCM e;  3OYI A;  3OYF A;  3RKW A;  4JRQ A;  4PLI A;  1JRI A;  4C0G A;  2ZGW A;  3OBW A;  5I2M A;  2QA4 T;  3CC2 T;  2ZCF B;  4HCC A;  1Q86 U;  2B8A A;  4E7L A;  3OBY A;  3P8H A;  1WQ7 A;  4F7U G;  3A8H B;  1PSE A;  3HFN A;  3M57 A;  4DOV A;  3LWI A;  1QVG A;  3JB9 H;  4M7A F;  4BB7 A;  5KCO A;  4R55 A;  1O75 A;  2VC8 A;  3JCM g;  2QA4 A;  4M7A B;  4FSX A;  4R56 A;  4ZTF A;  2O4X B;  3CC2 A;  1X75 C;  2E6N A;  1VQ8 T;  3RKY A;  3ASK A;  4XQ3 A;  2OAU A;  3X25 B;  3M4Y A;  3I55 T;  2E6Z A;  5L8R E;  3LGF A;  1V29 B;  3OS5 A;  3FRN A;  3CCM T;  2K2V A;  5GMK e;  3I55 A;  1JJ2 A;  4M7D D;  5DLO A;  3A8M B;  4BE0 A;  1M1G A;  4M78 C;  1MHN A;  1XNI A;  3VYG A;  1K9M C;  2XHC A;  3T9N A;  3UDC A;  1M90 U;  2YRV A;  1QP3 A;  4FU6 A;  3X20 B;  2K3Y A;  4M75 A;  1LNX A;  2HBP A;  3SB2 A;  2CZ0 B;  3N5B B;  2QQS A;  3QKJ A;  4E7I A;  1Q81 U;  1MGQ A;  2LQ8 A;  5C6S A;  2LRQ A;  4IKF A;  4A4F A;  2RHX A;  4F7U E;  5IN1 A;  3KXT A;  4KUD K;  4JDS A;  3CC7 T;  2K3X A;  4EMK B;  2VYT A;  1XTD A;  2LT4 A;  3RMQ A;  1YIJ T;  2PUO B;  3PTA A;  1VQ5 A;  5GAN 2;  4FT4 A;  4ZGE B;  3CC7 A;  4WF2 A;  2LNV A;  3MCA B;  2GCX A;  5A0L A;  1KQ1 A;  2KSS A;  2CZ6 B;  1WJS A;  3EFS A;  3HHT B;  3HRU A;  1YIJ A;  3QXE B;  3HRS A;  3HSB A;  4OB2 B;  4E7J A;  4XU1 A;  2MI6 A;  5LJ3 g;  3MP8 A;  3HP9 A;  1VQ4 A;  4XU2 A;  2JVV A;  3RUX A;  1WNL A;  4MZT A;  5HY6 A;  5KH6 A;  2DO3 A;  5GAO r;  2R5A A;  3OYD A;  1K8A C;  1BI3 A;  4N0A A;  1YIT T;  2JOY A;  4F7U F;  2EQK A;  2X4X A;  3JB9 I;  3E9F A;  4LDW A;  1LOJ A;  3SFM A;  4Z02 A;  1M5Q 1;  2JTM A;  4J7F A;  2E5Q A;  2E12 A;  4PJO A;  3LWH A;  2RD1 A;  2R5M A;  3GF5 A;  4L5G A;  2LDM A;  1Y71 A;  2LQK A;  3L2U A;  3FC3 A;  1YIT A;  4HA8 A;  5GAO q;  3S3M A;  2RJC A;  2GFU A;  4TVR A;  3V7R A;  4M7D G;  1BI2 A;  4IUV A;  3CME T;  4A53 A;  3UWN A;  1K9M U;  3M9Q A;  2GQV A;  1OZ2 A;  5CO7 A;  2E41 A;  5GMK h;  1QVF S;  4MZM A;  4QVC A;  3CME A;  3BDL A;  5HK0 A;  2DXU A;  1UEB A;  2KQW A;  3CEY A;  2GF7 A;  2EQJ A;  3PMT A;  5GMK j;  2PU9 B;  2ZPG B;  2VGN A;  3CPF A;  3QYG B;  3OYK A;  3CMA A;  3JCM b;  2OTL T;  3LH0 A;  3L2W A;  2I2L A;  4M7A G;  1O9S A;  3HKS A;  4FL6 A;  2F5K A;  4BI3 A;  4HKE A;  2CYZ B;  4M75 E;  5IAY A;  1WJQ A;  3OMG A;  1KG1 A;  1QVG S;  4A4H A;  3GLX A;  1BI1 A;  3H8Z A;  1HXD A;  2OTL A;  3SD4 A;  1U1S A;  3C4S A;  5CKE A;  4LDX A;  3LW5 E;  1N8R U;  5LJ3 h;  1H64 1;  4OB1 B;  2DXT A;  2HNI A;  3MEW A;  4C8Q C;  1PSF A;  3V8K A;  4X9C A;  3JCM W;  5LJ3 j;  2XK0 A;  2CZ1 B;  1YCY A;  1KHI A;  4BY6 B;  2VXF A;  3ZFJ A;  5GAM d;  5LJ5 e;  1NJI C;  1Q7Y C;  3I56 T;  4LDY A;  3CBM A;  4QVZ A;  1JJ2 S;  4PJO C;  3OB9 A;  1VQM A;  4B9X A;  4HT9 A;  2K5I A;  4OF1 A;  3OQ5 A;  4ZGJ B;  5CKF A;  5DY9 A;  1VQ7 T;  1QVP A;  4JRP A;  3I56 A;  2ZPB B;  4XTY A;  4V2S A;  4M77 E;  3NTI A;  3FLG A;  4M75 B;  5LJ5 g;  4BAC A;  1AHJ B;  3GNF B;  4M78 A;  1RI0 A;  3JCM V;  2FVU A;  1VQP T;  2DD4 A;  2V8I A;  1VQ7 A;  1YJN T;  2FL7 A;  4ZTJ A;  1JBM A;  3M55 A;  2PVO B;  3E19 A;  4OB3 B;  4C92 E;  5GAN d;  3C95 A;  2EFI A;  2MF2 A;  3VV0 A;  1BI0 A;  5C0M A;  3S6W A;  4X9D A;  3PNW C;  3CCV T;  1M8V A;  3QYH B;  5A2Q E;  2KY9 A;  1OI1 A;  2QXF A;  1YJN A;  2WSF E;  4C0F A;  2EJF A;  2K5L A;  3GOX A;  4EPC A;  2X4Y A;  3CCS A;  4IUR A;  3CCV A;  3RMS A;  5FU6 B;  1VQ6 T;  3V8J A;  4ELZ C;  5GAN 8;  4C5G A;  5CCA A;  1VQO T;  1UGQ B;  4XK8 E;  2BUD A;  3DLL A;  4M77 F;  3L2Z A;  5GAO m;  3OYM A;  3RER A;  3PIO A;  1D3B B;  5GAO n;  4KBM B;  5GAM f;  4M77 B;  1VQ6 A;  1G3Y A;  4M75 D;  5FU7 B;  2DIQ A;  1VQO A;  2PVD B;  3KUF A;  3QZ9 B;  4C92 F;  2K5F A;  3MP1 A;  2LVM A;  1N9S A;  2XG8 D;  2LT1 A;  4JUV A;  4OGE A;  4RKU E;  3X26 B;  5GMK l;  4C92 B;  4RMO A;  1I8F A;  1NJI U;  5FRM A;  4NL3 A;  3WVE B;  3CCR T;  3L2V A;  2LTO A;  2DK3 A;  2LX9 A;  3WXM B;  4BD3 A;  1VQ8 A;  2HAX A;  2FB7 A;  3MHX A;  3NTH A;  4BE2 A;  3JRZ A;  2DEQ A;  3M56 A;  5CQX A;  3QO3 A;  3QII A;  5LJ5 h;  2PUK B;  4O6J A;  1LJO A;  1OZ3 A;  4KUL A;  2DZ9 A;  4HCZ A;  5GAN f;  1K73 C;  4L6V 5;  3CCE T;  3CCM A;  2L3R A;  1I81 A;  3OYG A;  5LJ5 j;  4LD9 K;  2XIC A;  2Y4X A;  5J3B A;  3OYH A;  1VIE A;  3NTK A;  4OP0 A;  3QZ5 B;  3GPL A;  3CCU T;  3S3O A;  3V7C A;  4DOW A;  4M77 D;  3CCE A;  1M1K C;  3OSS C;  3SWN B;  2QEX T;  2RH2 A;  4EDU A;  2VUB A;  4M78 E;  2WAC A;  3CCU A;  2OTJ T;  2QTX A;  1M1F A;  4QW2 A;  2E10 A;  3QPH A;  4A4K A;  4C92 D;  3A8O B;  1NPR A;  2FHD A;  3RES A;  3OYN A;  4JS4 A;  5CIU A;  2E64 A;  4Y91 A;  2EKO A;  5GAN 6;  4ZN1 A;  2QEX A;  2R57 A;  4MML A;  1XQH A;  2R58 A;  3J80 E;  1QW1 A;  2OTJ A;  2LC4 A;  1X01 A;  2D0Q B;  4JJN K;  2XI9 A;  3JCM h;  2GFA A;  2HQE A;  2XU8 A;  2MAM A;  4XAX B;  4C8Q A;  3GNG A;  2G3R A;  1G5V A;  1ZBX A;  3LX7 A;  3O8V A;  3H6Z A;  4PNO A;  5CVI A;  3A5Z B;  3PIP A;  4M75 G;  2L5Q A;  1KC8 C;  2NLU A;  5AYF A;  3J7A F;  5GAM e;  4P5N A;  3OS2 A;  4M7D A;  5KE2 A;  5I21 A;  3V7S A;  4JLI A;  4IUP A;  4M78 B;  3OSV A;  4OVA A;  3OYJ A;  1KD1 C;  2Y90 A;  3M54 A;  3QBY A;  3FEO A;  5CKH A;  2RHI A;  5M9O A;  4A54 A;  3OW2 A;  1K73 U;  2L8D A;  2WSE E;  2QDY B;  3QUI A;  3CBO A;  4LDV A;  1N9R A;  2FYK A;  3ZBD A;  3MO8 A;  1SSF A;  4M7A A;  4O5V A;  2RHU A;  2KDS A;  2O4X A;  4C5I A;  2JZ2 A;  5GAN e;  1KQS A;  5FLX E;  3A8G B;  4M77 G;  1UGP B;  4MDW A;  3SDZ A;  2RJE A;  2XDB A;  3ER0 A;  5CK9 A;  5GAN 3;  2LCC A;  3RKX A;  3OYA A;  2ZPF B;  3CCJ T;  2XD0 A;  3GIB A;  4C0Z A;  3OYB A;  3P8D A;  3WVD B;  2DVE A;  3CPW A;  1YI2 T;  4C92 G;  3C12 A;  3JB9 D;  4J83 A;  4FT2 A;  4IUT A;  4CRI A;  1U8R A;  2MWO A;  1G3S A;  1NZ9 A;  2KK4 A;  3A8L B;  4M78 D;  4Q5W A;  5GMK i;  3JCM X;  3L2R A;  3CCJ A;  3QSU A;  3PFS A;  1YI2 A;  2EQU A;  1UB4 A;  2KAF A;  3M53 A;  1WQW A;  2RO0 A;  5LJ3 d;  4ME7 A;  2P0Q A;  4CI0 C;  4KT0 E;  5D6X A;  1KC8 U;  1K8A U;  3KBG A;  2EQM A;  4J7I A;  4XTU A;  4M7D C;  3X28 B;  3P8B B;  4C5H A;  1JB0 E;  2D9T A;  3MEV A;  3L1A A;  4EMK A;  1W2B A;  2RK2 A;  3QG1 A;  4M75 F;  1FX7 A;  3UT1 A;  1FXX A;  2KMT A;  1B34 A;  4IUQ A;  3S3N A;  3G4S T;  1KD1 U;  2MWP A;  3OS1 A;  3TU4 K;  1WPY A;  4XTZ A;  2F69 A;  3E9G A;  4II1 A;  1VIF A;  2HD0 A;  3VJP A;  1Y96 A;  4C0D C;  4PJO E;  1VUB A;  2RI2 A;  4QQD A;  5J26 A;  4M7A C;  4ATO A;  4B9W A;  2QQ9 A;  1Y7X A;  4J6W A;  1VQP A;  5CKD A;  2XKO C;  4KUI A;  2VV5 A;  4VUB A;  2RA2 A;  4NL2 A;  4YTL A;  4RG2 A;  3L2Q A;  1I4K 1;  3CXC A;  2RI3 A;  4XTW A;  3JCM Q;  3EFR A;  2PVG B;  1YBY A;  3INZ A;  5HKC A;  4XTV A;  4F7U A;  3MEA A;  1VQK T;  3E1S A;  2P0P A;  3VYH B;  2A3L A;  2AHJ B;  4QQG A;  2X35 A;  3M5A A;  4D6W A;  5GAN 4;  1M90 C;  3QDR B;  4GLK A;  4C8Q B;  3OYL A;  3JSC A;  5LJ3 f;  2QQA A;  4DQ2 A;  3OA6 A;  3OYY A;  3F70 A;  5HK3 A;  1VQK A;  4M78 G;  2P4T A;  3HL8 A;  2CKK A;  2M9U A;  4PJO F;  3VUB A;  3QJ6 A;  4NOY A;  5CR2 A;  1W4S A;  1ZHI A;  3QJY A;  4PJO B;  1Q7Y U;  4A4E A;  1Q82 C;  4EMK C;  4QVD A;  4DA4 A;  5D6Y A;  2QQR A;  1VQN T;  3L42 A;  2V8J A;  3OW2 S;  4E7K A;  3AHU A;  3NFC A;  1UGS B;  5GAN 7;  3CCR A;  2E65 A;  2CGH A;  3OY9 A;  1VQN A;  1WGS A;  4FM4 B;  4OMF B;  2LCL A;  4C0D B;  1ZQ1 A;  1KHC A;  5LJ5 d;  3G71 T;  1KQS S;  3LLR A;  2F5T X;  1IZ6 A;  1NE8 A;  2EIF A;  4XTX A;  4J5Y A;  4C8Q D;  2BIV A;  4HT8 A;  1KQ2 A;  3CD6 T;  4J8O A;  3FB9 A;  3QHS A;  5LL6 S;  1IRE B;  1BKB A;  3G71 A;  2X4W A;  2JTF A;  2DZC A;  5A0D A;  4Y28 E;  4LD6 A;  3CPW S;  3CD6 A;  5D6W A;  1Y07 A;  3JB9 J;  2DAQ A;  3JB9 F;  2VGM A;  4PJO D;  1GXI E;  3URG A;  2EJG A;  5J39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...