4F7UA

The 6s snrnp assembly intermediate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
b'MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
molecule tags Splicing
source organism Mus musculus
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
total genus 17
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uA00
5GAN5 4M75B 4M77C 2YLBA 4XU3A 4F7UB 1KQ1A 4XU2A 4M77A 2EAYA 4PJOG 5LJ3e 4EMGA 1MGQA 4M7AE 3RKXA 5CAIA 1TH7A 3GIBA 3SWNB 4M77G 5LJ3f 1HXDA 4NOYA 4NL3A 1LJOA 3PGGA 5GAN2 2DZ9A 5GMKl 4PJOA 4M7AD 1HK9A 2K57A 3JCMd 4JUVA 5LJ5d 2HNIA 4J5YA 5GANf 3QHSA 2E65A 5LJ3h 5GMKh 1N9RA 5GAMj 2YHTA 4EMHA 5GMKi 4HT9A 5GAOr 5GAOn 1LNXA 1Y96A 2RB6A 2Y90A 3L1AA 4XU1A 3FIFA 3SWNA 5DY9A 4PJOF 3L2ZA 4N0AC 4M7AB 4XTVA 3JCMP 3EFSA 1I8FA 4X9DA 5GAMd 4PJOC 4M78B 1U1TA 3JCMc 4A54A 4PJOD 3AHUA 4M7AA 2EWNA 2E41A 4EMKA 2DTHA 4M75E 2EJGA 4M78F 3RESA 2JN0A 3JB9H 4XTZA 3JB9I 4EMKB 4C92F 1X01A 4M78D 1JBMA 4M75D 4MMLA 3RKWA 5GMKm 4M77E 1LOJA 2E10A 3JCMh 5GAOq 1YCYA 3JB9F 4M7DA 4NL2A 1WNLA 3QUIA 4M7DF 4XTUA 3JB9J 4M77D 4XTXA 1U1SA 5GAOm 4HT8A 4M7DC 4C8QD 4C92A 4PJOE 3VU3C 3HFOA 4XTWA 5GANj 1D3BA 5LJ5g 1B34A 4X9CA 4M75C 3V8JA 5GAOp 3V8LA 5I21A 4C8QE 2CGHA 3JCMJ 4M7AF 3M4GA 2DTIA 5GAOl 4M78E 4M75F 1BIBA 3SB2A 4M75A 1M5Q1 2VC8A 4C92G 2RA2A 3JCMQ 3JCMf 2E1HA 5LJ5f 4PNOA 3JCMe 3RUXA 4M77F 5GANd 4M7DD 3JB9G 4OP0A 4C92B 4F7UG 1WQ7A 3QO3A 4J6YA 2EJ9A 2RD1A 2DTOA 2FYKA 2QTXA 4JRKA 4M77B 4C92D 4WF2A 5GMKe 1B34B 1I5LA 4XQ3A 4QVCA 5GAN3 3JCMg 4F7UA 5GANg 1M8VA 1Y96B 4JLIA 4J6XA 3FB9A 1BIAA 3V7CA 2FB7A 3HFNA 3RIRA 5GAMe 4C8QG 2VXFA 3RERA 3SWNC 4M75G 3BY7A 2I2LA 2VXEA 3V7SA 4M78A 4HA8A 5LJ5h 2DXUA 2YLCA 1N9SA 2EJFA 5GAN6 2DKGA 4PJOB 4C92E 3QSUA 1I81A 3INZA 4M78G 5GAMh 3EFRA 3V7RA 4DQ2A 2DVEA 3V8KA 3HSBA 4N0AA 4C8QA 5LJ5e 4M7DE 5GAN7 4J6WA 1WPYA 4EMKC 3JB9D 3FJPA 2DXTA 5GAMf 1I4K1 1WQWA 4C8QB 3BDUA 3JCMX 4C8QC 4C92C 4F7UE 2E64A 4RCBA 1JRIA 2RM4A 3BFMA 4M78C 4QVDA 3JCMW 4M7DG 4C8QF 5GMKj 2ZGWA 5LJ3j 4JRIA 5LJ5j 4M7DB 3JCMV 3JCMb 5GAMg 4XU0A 3RKYA 4XTYA 2DEQA 4M7AG 4MMKA 5GANe 4A53A 5GAN8 3BW1A 5GAN4 1D3BB 2DZCA 5LJ3d 2DJZA 1KQ2A 4RCCA 4Y91A 5LJ3g 4V2SA 1H641 4F7UF 4M7AC 5GANh
chains in the Genus database with same CATH superfamily
2K9GA 1Q86R 1XQHA 1RAGB 4XU2A 3QYGB 2O31A 2CSIA 2V8IA 1K9MR 1HXDA 4NOYA 3ER0A 2F5TX 1RLPC 2QYZA 1DJ7B 4EMHA 4Q5WA 3E1SA 1S1NA 1Y96A 4CC3A 3EG2A 2NUTA 3CCMQ 5AT1B 4XTVA 3PE0A 4F16A 4OB1B 3JCMc 4OMMA 3OMGA 2X4JA 2DTHA 4M75E 2KYBA 3FRNA 1VQ6A 1H92A 4IIMA 1RACB 1UUEA 3GP8A 2HSPA 1AVZC 2E10A 1YIJA 1VQPT 2JS2A 3EGXB 2RF0A 2ZPGB 6AT1B 1SSFA 1G8XA 2JMCA 2P0PA 3RNJA 1ZSZA 4M75C 3DKMA 4M7AF 2F2XA 3M4GA 1UJ0A 2QAZA 2VC8A 5CKEA 3X26B 5A0DA 1ZA1B 4HCZA 2E1HA 1E6GA 3QWYA 1SEMA 2DL7A 3JV3A 3QO3A 5GMKm 4FSXA 4J7FA 3OSVA 3EFOA 1WA7A 3X20B 3ZBDA 2RI3A 5FWBA 4LXCA 1IO6A 1VQ7T 3OYLA 3SWNC 1NLPC 4M78A 3CXCP 1YIJQ 3CMAA 2EQMA 4J9BA 2R57A 3G4SQ 2PVOB 1OV3A 2FPFA 2M9UA 1YHQQ 3FJPA 2DXTA 4M7DG 2BKDN 2EYZA 1ZUYA 4FW1A 4JRIA 2X4YA 4N4IA 1UHCA 2H3EB 2D0QB 3OQ5A 2JS0A 4M7AG 3OBYA 1SSHA 1VQKQ 1W2BS 2RQTA 1MMAA 2K79A 4FT4A 3EGXA 5LJ3g 3QZ9B 1C0MA 1YJWQ 2RHIA 1K73R 2JOYA 2PQWA 1OX8A 3VKIA 4ZGDB 2ESWA 3ME9A 4GLKA 1D0YA 4JJCA 3C4SA 5FU6B 2FZCB 1M9SA 2KVQG 2NUZA 5GMKl 1HK9A 3U23A 5HCKA 1YITT 2A08A 1NLOC 3FEOA 5GMKh 3G4SA 1D1AA 2RB6A 4B9XA 2KXDA 2E5KA 3M9QA 1Z9ZA 2MWOA 2RNAA 3OS5A 4LUDA 1VQOA 1VQKA 4M78B 3MEWA 2DRKA 2A37A 3JB9H 3RKWA 4C0GA 1T0JA 1AZGB 4NL2A 3I35A 4J9FA 5FRMA 1WXBA 1QQJA 1H8KA 3TSZA 2K3BA 3P8HA 4BACA 2DETA 4L6V5 3VRZA 3CCJT 3NTKA 4PNOA 1OEBA 3WXMB 4C92D 1OU9A 1MHNA 3O5ZA 1TOVA 2SEMA 4PLLA 2LJ3A 1X43A 2HSEB 4E7ZA 1BIAA 4K11A 1K9MC 2FPEA 4CC7A 1GBQA 3VS0A 1PWTA 2DKGA 2EKHA 4CC2A 1VQNQ 1OQKA 4F7UE 4CRIA 3GLXA 1OX9A 5LJ3j 3OY9A 4HCBA 1Q7YR 1BBZA 1U06A 5CK9A 2ROTA 5DLQE 5LJ3d 2DJZA 1YJWT 2E6NA 2YDLA 4V2SA 4MDXA 2LQWA 2FRYA 4FM4B 4FSSA 4F7UB 4LDWA 1KFZA 2FO0A 3UATA 4FYXB 2DEUA 4R0KA 2CT4A 1OULA 2J06A 3L2QA 1GFDA 2ATCB 1MGQA 3J80E 4DEXA 1TH7A 2CP6A 2F5KA 2X9HA 4PJOA 1W4SA 1UFFA 1K0SA 2XU8A 4ANJA 4BDZA 4XU1A 3OYGA 3CBPA 3QJYA 4LUEA 4QKUA 4IIOA 3JCMP 3H41A 5GAMd 5J3BA 5CKDA 2ZAEA 3REAB 1Q7YU 4EDUA 2O4XA 1ZSZB 2JN0A 2M16A 1C1AA 2J7IA 3AT1B 3VS4A 2DA9A 3UA6A 3CCUA 5GAOq 1BI1A 1N6AA 2XD0A 4M7DC 3M54A 1HD3A 1K1ZA 2RN8A 5KH6A 3SDZA 2HZYA 1ZHIA 4RUGA 1VQ9Q 4KRTA 3A8MB 3CXCA 4P5NA 1CKBA 2RQUA 5GMKe 4WF2A 1UB4A 1B34B 3H0IA 4E7JA 4F7UA 1QVGA 5GANg 2R5AA 2F1LA 5I2MA 2VXFA 2ECZA 1M90U 2DL3A 3OW2S 4RTVA 2LRQA 1NEBA 1WJRA 5GAN6 4PJOB 3JSCA 1T3SA 3UA7A 2E4HA 2GFUA 3NPFA 4E47A 2CT3A 2KGTA 2L0AA 3H0HA 1M3AA 2VASA 5GAMf 2DD5A 1J3TA 2P0QA 1VQ9A 2RM4A 3CMAQ 2FHDA 5LL6S 1RAEB 3I56T 1YHQA 2DYBA 4HKEA 5GAN8 3CC2T 1YJNT 2DZCA 2E5QA 4A63B 3VJPA 4C5EA 5KYWB 5D7UA 4MDWA 1JJ2A 8ATCB 2VGNA 5IAYA 1OU8A 3REBB 4E7IA 4ZGEB 2QG9B 1I0CA 3M0PA 2KRMA 3JCMd 4M4ZA 4J5YA 2E3HA 2LVMA 3QHSA 1QKWA 5GAOr 2VUBA 2ZPHB 2BTTA 1SKUB 2JJ9A 3CCRQ 3MEAA 3OA6A 4PJOF 4A4KA 2DXBA 3EFSA 1Q86C 5HKCA 2GCXA 2PNIA 4FW2A 4M78F 3LYIA 3CEYA 3M4YA 4C92F 5EC7A 1K9MU 3CCLQ 1ABOA 4ZNXA 1AZEA 2EPDA 1YITA 2KR3A 2DPPB 1BYMA 1MV3A 4HT8A 1KIKA 2RPNA 4XTWA 4RTXA 4AFZC 3CCRA 2FVUA 2G3RA 4ORZA 2CUDA 2QEXT 3CMEA 2RA2A 3JCMf 2A3LA 3RUXA 4Z89A 3CCJQ 3CCVT 3KXTA 4BI8B 2RD1A 1LPLA 2DTOA 2MMPA 3OB9A 5KYWA 1PC0A 2RJFA 3CCLA 1R8OB 3QDFA 2YUOA 3CC4Q 2CZ0B 4OMFB 4RG2A 3RIRA 3OYAA 1JO8A 1OPLA 3RERA 3BY7A 2QA4T 2QGFB 3CCUT 2DXUA 2F2VA 3CCEA 1IHWA 1G5VA 1SF9A 1NPPA 3IQLA 4VUBA 4C0ZA 1K8AR 3MEUA 5CR2A 3CCMT 2M0OA 5GAMg 1QVFA 3RKYA 1M2OA 5KYYB 4MMKA 1A0NB 1PRMC 4A53A 4PK4A 2RHYA 3CC4A 2D1XA 2DL5A 1TUCA 4RTZA 3R6OA 1M2VB 4IUTA 5IHNA 4JZ3A 1VQ8T 2YUQA 1U5SA 4E7KA 4JRQA 4M77A 3M0UA 3RDVA 4FYWB 2GTOA 3GF5A 3MCAB 2BIVA 2IPOB 2MWPA 2ZZDA 3OYIA 4E7HA 2K3XA 1GCQA 2OTJQ 2QQBA 1VQ6T 3OYKA 1ZBJA 3DB4A 1Q81R 1KD1U 3VS1A 2Y4XA 4XAXB 2HBWA 1SPKA 2B86A 1OOTA 2OAWA 1AHJB 3NTIA 1M1GA 2DBMA 1X01A 2O2OA 1I1JA 4PKCC 1QVGS 1PSEA 3JB9J 1PD1A 2RJCA 4XTXA 1U1SA 3SEMA 1AWWA 1PHTA 2KRSA 4Y28E 1G3SA 1B34A 1W1FA 2DRMA 4X9CA 3V8JA 1NYFA 4IUPA 1EIFA 2LP5A 4JDSA 2RO0A 3VUBA 5FROA 1VQOQ 4KH1B 4HVWA 2CP5A 3HRTA 2V1QA 2XG8D 2H8HA 5GAN3 3KBGA 1R77A 2COZA 5HK3A 4PJMA 1B3QA 5KYXA 1N8RU 5FRNA 4M78G 2VWFA 2RHZA 3V8KA 2OTLQ 2XDBA 5GAN7 3JB9D 3BFMA 3CCET 1ZQ1A 3OYMA 3QZ5B 3OYJA 1X2QA 4AG1C 1SG5A 4KUIA 2L8DA 1YWOA 4J9GA 3E19A 2EFIA 4FIBA 1SHGA 4M77C 1NJIC 1RI9A 2QEXA 2EQUA 2J05A 1RLQC 4JLGA 4M77G 5ECAA 2DAQA 4NL3A 4QW2A 1ARKA 5GANf 4PJLA 2K7AA 4HT9A 2OTLA 4JS5A 1G3YA 1OYXA 2CH4A 3ZL7C 2E41A 2P0KA 3X28B 4DBFA 2K5FA 3JB9F 2RQRA 2ABLA 3C95A 3GPLA 3META 1H3HA 1RAHB 2QK0A 1G2BA 3CPWS 1W6XA 1PNJA 5I22A 2E70A 3JCMe 1GBRA 4AFQC 2FYKA 1YNZA 4J7IA 1I5LA 1WJQA 3UPUA 3M0RA 2LC4A 1YJNA 4KGXB 3X25B 3CCQA 3CD6Q 3HFNA 2EYWA 3CCSA 2I2LA 3CCQT 1VUBA 4X34A 2EJFA 2L2PA 1I81A 1Q86U 3EFRA 1TUDA 4Y92A 1BCOA 3UDCA 2K5IA 3P8DA 5LJ5e 2LT4A 3JCMX 3PIPA 3OYEA 3I55T 2KT1A 3QWXX 4QVZA 2VV5A 2K6DA 2MAMA 3UT1A 2WSFE 2F2WA 3H0FA 4XTYA 3RMSA 2D9TA 1PRLC 4B9WA 5CKFA 3SFMA 4BE2A 4RCCA 3NTHA 3OYCA 3TCJA 2LCLA 5GAN5 4BI4A 1X75C 3G71A 1KQ1A 1VYTA 2YT6A 4C0FA 2ENMA 3RKXA 3OW2P 2K3YA 2R5MA 2OTLT 2DXCA 1AOJA 3CCMA 4YTLA 4KH0B 1Q82R 3S3OA 2WSCE 3EGDA 4IUUA 4N0AC 1VQ4T 2ROLA 2J6FA 5CIUA 1YITQ 2NWMA 1AWOA 1KHIA 4PJOD 4DOWA 3LGFA 4LDYA 4LD9K 1M3CA 1ABQA 3RESA 4ZN1A 2XDDA 4RMOA 2L3QA 1M90C 4M78D 2X3XD 2YWWA 4DA4A 4MMLA 3QDRB 4M77E 4M7DA 2QA4A 3L2RA 2X4WA 3OS0A 2CS7A 2EGAA 4XTUA 3VS6A 5GAOm 3PVLA 3SD4A 1D3BA 1NEGA 3L2UA 5CQYA 4M75F 1VQ4Q 1ZX6A 4BE0A 4FCYA 4JRKA 3VUZA 3CC7Q 1BCMA 3CBOA 1G3TA 1NG2A 4QVCA 1NYGA 3V7CA 1VIFA 1VQ6Q 2RMOA 2V1RA 1D0ZA 1AT1B 4BY6C 1N5ZA 3V7SA 4HVVA 2GBQA 2KT8A 3QSUA 2XICA 3LX7A 1QKXA 1M90R 3A98A 2CZ7B 3QJ6A 4LN2A 3PVQA 1JRIA 2DIGA 5L8RE 3JCMb 2EQJA 1FMVA 3EAEA 3EHQA 3CBMA 1TUGB 4ELZC 3MP1A 2BE7D 2AT1B 1IXDA 2Z0WA 2O01E 5L23A 5GANh 5FLXE 2JNGA 1QVPA 7AT1B 3CCJA 2QASA 2K5LA 4M7AE 1EFNA 3GIBA 1JXMA 1UGSB 3PGGA 1VYUA 2DZ9A 1YHQT 1WYXA 4M7AD 2DE0X 5J39A 3LGLA 3OYHA 4PFOA 1YBYA 1ZLMA 3J81E 5DM7R 1VOMA 1M8MA 3TQ7P 2PTKA 1U1TA 3CXCS 4A54A 5IHKA 1Q81C 2RJEA 3I5SA 5HY6A 2LX7A 2HBPA 1WNLA 1O9SA 2RI2A 4J9IA 1TU0B 2C0TA 2DIQA 1FYNA 2DVJA 2KY9A 4C8QE 2OAUA 4BY6B 2RQVA 2LT1A 2R58A 3ZFJA 2KAFA 4PFPA 3C0CA 4JPBW 2D0NA 5EG2A 2DMOA 4PFZA 1WI7A 1WDXA 3QBYA 2QDLA 3S6WA 1WQ7A 5LJ3e 2ZPBB 1MNEA 1KQSP 1WHMA 2DM1A 2CH4W 3JCMg 4JRPA 2CDTA 1LCKA 1SRLA 2COWA 1QMCA 4OMLA 5FU6C 2KEAA 4RTYA 3JAME 2BE9B 2PUOB 4Z02A 3CCLT 4C92E 4KGVB 1MUZA 1GCQC 5D6XA 3S3NA 1KD1C 3V7RA 4DOVA 1PM3A 3EGUA 3CCVA 4EMKC 2O4XB 2DX1A 2E64A 4RCBA 1KD1R 2LMJA 4FYYB 2JT4A 4KULA 4R56A 3I5RA 3QIIA 2JUFA 2HAXA 1WFWA 4M7AC 2YLBA 1IREB 3QXEB 1GFCA 2XK0A 1OZ2A 5C0MA 2EBPA 1YJWA 1UGPB 5GAN2 1WX6A 1M1KU 2F69A 1VQ7Q 5DLOA 2DL4A 2HKQB 1N9RA 1UEBA 2CP7A 5GAOn 2CYZB 2L3SA 1KJWA 4C0DB 1GRIA 1JU5C 5DY9A 3SWNA 4ESRA 3NMZC 4IUVA 4O6JA 4E7SA 3RMQA 1M3BA 3JB9I 1R0CB 2P4RA 4M75D 4LDXA 2JZ2A 1VIEA 2EKOA 3EG0A 4N4HA 8AT1B 3I56A 1MMNA 3HFOA 2KMTA 2NUPA 5GAOp 4JJDA 4E6RA 1HYOA 2DTIA 2GQIA 3SB2A 1GCPA 1Z9QA 1X69A 1U8RA 2XDPA 2SRCA 2YUPA 4OP0A 3A8LB 3JB9G 1WIEA 2RK1A 2FG0A 4JLIA 4E2FB 4J6XA 5CKBA 1WXUA 4RTWA 2QQAA 3CQTA 2HQHA 2EGCA 2AZVA 2NYSA 4OVAA 3EG1A 3MJXA 5AYFA 3INZA 3VYGA 3VRYA 4Z88A 2K2MA 1VQ8A 4PJJA 1ACMB 3CCUQ 2WSEE 4C8QC 2AHJB 3DB3A 4Z8AA 5D6WA 1S72T 5CVIA 2CP0A 3G6EA 2X4XA 2MI6A 2DEQA 2YUNA 1YJ9T 1VQNA 3CPFA 3MEVA 4OMPA 3THKA 2VYTA 3CD6T 2EYXA 5IH2A 4C5HA 4C0DC 3M56A 2O88A 3I55Q 2EAYA 3A8OB 3DLMA 4EMGA 2QA4Q 1K76A 1NPRA 1D1BA 5LJ3f 1WZOA 2C0OA 4NS5A 2KXCA 1SHFA 3GOXA 1AEYA 2EVRA 2JTMA 2BZXA 5IXFA 3NGPA 2QGGA 2KBTA 3FIFA 2GGRA 2YRCA 4PJOC 1FWZA 2AKKA 2WACA 1NBEB 4MZTA 3CMET 1GXIE 2L3PA 2JTFA 2EQIA 3MO8A 5KCHA 3GNFB 2KROA 4BI3A 1YCYA 1QLYA 1M27C 3P8BB 2XI9A 2HCKA 4LDVA 1UGRB 4EPCA 5GAOl 4M78E 4JS4A 2B8AA 5IHIA 2EYYA 3I55A 1M2VA 5GANd 3QYHB 1YI2Q 3M58A 1R0BG 1BK2A 4FL6A 3FDRA 2C0IA 2MIOA 3VS7A 1M8VA 2QQSA 3CC2Q 4A4FA 1RAFB 4M75G 2LJ0A 2VXEA 1YIJT 3A5ZB 3HL8A 1UECA 1SRMA 2FPDA 2RJDA 5CQXA 1GL5A 1XOVA 3C12A 4X1VA 4LD6A 4N0AA 4C8QA 3OYYA 2V8KA 1TXQA 4AT1B 3PT9A 4ELYC 4PL6A 4ATOA 3LLRA 3O8VA 1K73U 2LCCA 4E7LA 2DILA 3GNGA 1IB8A 2FL7A 1VQMA 1VQ5T 4J9EA 5LJ5j 3PIOA 2C06A 3CC2A 4DBHA 1T0HA 1JQQA 1WGSA 2RQWA 2CUBA 2P4TA 1QWEA 1EX4A 1FMWA 4M75B 1HSQA 1VQOT 3S3MA 1WLPB 3C94A 3TVTA 3SWNB 1QW1A 3SHWA 2CKKA 1QVFS 2K57A 1QP3A 5LJ5d 2HNIA 4JZ4A 1UE9A 5GAMj 2YRVA 2Y90A 3CCEQ 2MK5A 1N27A 1CSKA 2X35A 2COYA 1FX7A 2EWNA 2LNVA 1Y7XA 2NUPB 1JXOA 1KHCA 1LOJA 2YRDA 1D1CA 5HK0A 3VU3C 2LCSA 5LJ5g 3HPWA 3M5AA 1VQLT 2E3IA 3OYNA 4OB0B 2D6FA 4C92G 3JCMQ 4M7DD 3GBQA 3OBWA 1K73C 1VQ4A 3EH2A 5IN1A 1KK7A 4J8OA 5KYNA 2FB7A 2PVDB 1Y57A 4EIKA 2QI2A 1WHHA 4DBRA 1EZZB 1VQ5A 1RL2A 1ZSGA 4KT0E 2D8JA 2XHCA 2DVEA 2Y4YA 2RH2A 2DLPA 4J6WA 1WPYA 3G71T 1IGQA 1WQWA 2ZPIB 1X6GA 4C5IA 4M78C 4A4HA 1AD5A 2VB6A 2GF7A 1U3OA 4MZMA 3JCMV 4XU0A 4D8KA 1K4US 2HL5C 3OMCA 1MV0B 2HQEA 2CREA 2IIMA 4F04B 3AHUA 2O9VA 2LQ8A 3H6ZA 1YJ9Q 2L89A 1QCOA 3CPWP 3T9NA 2EQKA 1RABB 5CAIA 1JB0E 3EFOB 1KQSS 1BI2A 4HXJA 4RG8A 4JUVA 2J6KA 2E65A 5GMKi 2EIFA 4L59A 2E6ZA 1LNXA 3L1AA 5KE3A 1NJIR 2E12A 2X51A 4M7AB 4X9DA 1Q82U 4HVUA 2LZ6B 3OSSC 4EMKA 4RKUE 2KE9A 2M51A 1RADB 3CC4T 3MKDA 3MP8A 5GANj 3ZEHA 3JCMJ 1X6BA 2BUDA 2KDSA 5FU7B 2L3RA 4J83A 2V26A 2LNHB 1QCNA 3DLLA 1JEGA 4LNPA 4C92B 4J6YA 2EJ9A 3CCQQ 3CD6A 2KRNA 2HMAA 3HHTB 1NZ9A 4B6MA 1KC8U 4DBQA 1K0XA 2A7YA 2ED1A 4C8QG 1XTDA 2A36A 3VV0A 2YLCA 2DJQA 2W10A 3BDLA 3EGDB 2HEQA 2DF6A 5KE2A 3G71Q 3MHXA 1YWPA 1WHGA 1NM7A 4IURA 1KSWA 4C92C 3JCMW 3Q1JA 1QVGP 4WTOB 1PKSA 4M7DB 5J26A 4D6WA 1AWXA 1D3BB 3UF4A 2K4YA 3MP6A 1QCFA 2K2VA 3CCSQ 1VQPQ 2LDMA 2FEIA 1TSFA 1OPKA 4XK8E 1BI0A 3MPUB 2QTVA 1BU1A 1RI0A 2BZYA 2X3WD 2M02A 2MYSA 3CMAT 4ZGJB 1JJ2P 1LJOA 3QG1A 3RR6A 3R6NA 5LJ3h 1WXTA 4QT7A 1IGUA 5A0LA 5KYUB 2P84A 1ZUKA 3LH0A 3M55A 1M4ZA 5FU7C 2AK5A 1ZUUA 2HD0A 2M1HA 1N8RC 2EJGA 4GY5A 2GFAA 1MNDA 3E9GA 4AMCA 1NJIU 3HRUA 1QWFA 1KC8C 4KGZB 3HTRA 4N4GA 3QUIA 4M7DF 2QDYB 2GNCA 2KYMA 4PJOE 3OW2A 4ZTJA 1VQPA 4OMNA 2LTOA 3V8LA 3M57A 1MMGA 3NFCA 1X27A 2J6OA 1BIBA 1VQ9T 5I11A 1YP5A 4M77F 2ZPEB 4OMQA 1AWJA 4JJNK 5FWCA 5GAMe 9ATCB 2VGMA 2MOXA 2QQRA 1UDLA 1PSFA 5LJ5h 4GLMA 2PVGB 3TEEA 3VS5A 4BD3A 1IRXA 2DL8A 4OB3B 3VYHB 1Y71A 2XIDA 1I4K1 2KSSA 4C8QB 3BDUA 5A2QE 1Q95G 5GMKj 2ZGWA 4LE9A 1YI2A 5GJWB 1KQSA 4FU6A 4LDUA 2IVWA 1PCXA 5GJVB 1IHVA 1VYVA 3M53A 3D7SB 4OGCA 1VQLQ 1H641 1WHKA 5D6YA 2LQKA 2YSQA 2PZ1A 1YFNA 4A4EA 2FRWA 2HL3A 3URGA 1Q81U 2CZ6B 4PJOG 3M59A 2D8HA 4AFSC 1PG5B 1Q82C 2H3JA 1OZ3A 1YJ9A 1VQNT 4AFUC 3G6ET 2DBKA 3WVEB 1YI2T 2QXFA 3E2UA 2CP3A 2AIRB 2FZGB 3PNWC 4AG2C 1W70A 3I9QA 3L2ZA 1UHFA 3LWIA 3FC3A 5IT9E 3NHNA 3EG9B 2AZSA 2DYIA 5KCOA 4QQGA 4XTZA 3CCRT 2DERA 3JCMh 2JW4A 3OYBA 5FW9A 4A4GA 1VA7A 4C92A 2DD4A 2LX9A 5I21A 4J9HA 3KUFA 4ZN3A 1N8RR 3PMTA 2JMAA 4KBMB 4M7DE 3FLGA 4ZTFA 2LJ1A 1S72Q 1K8AU 4XQ3A 5CCAA 3LWHA 2ZPFB 3M0TA 3QKJA 1C6VX 4FT2A 3FB9A 2MF2A 1MMDA 4CI0C 2W0ZA 2LQNA 3TREA 4IUQA 1W2BA 1TWBA 1Q7YC 1N9SA 3OYFA 2RHXA 1VQMQ 5C6SA 3J7AF 2GQVA 4ME7A 1V76A 3OS2A 1Y07A 4HCCA 2XMFA 3FJ5A 3BE3A 3UWNA 5IXBA 2ED0A 2YXYA 3E9FA 1D09B 3LH5A 3TSWA 5GANe 4KUDK 2QEXQ 1F1BB 3BW1A 3H8ZA 1HJDA 4J9DA 2DO3A 4RTUA 4WCIA 2EYQA 4XU3A 1B7TA 1VQKT 3A1PA 2KI7A 1TTHB 2A0FB 5I2SA 1P92A 2O9SA 2IG0A 3G4ST 3I56Q 2JXBA 2CP2A 2KK4A 1D0XA 1G3WA 1ZBXA 2MPXC 3M0QA 1I8FA 3L2VA 4PLIA 2KNBB 4M7AA 2GTJA 2ZCFB 3PTAA 4C5GA 3VS3A 3OS1A 4EMKB 2OTJT 4J9CA 4L5GA 1H3ZA 3F70A 1BKBA 4M77D 5KYYA 4JJBA 2EW3A 2CSQA 4UC4A 3OYDA 2CGHA 3M0SA 2OTJA 3A8HB 3G1JA 1IZ6A 1XJWB 1RAAB 2RK2A 3G7ZA 1M5Q1 5LJ5f 1VQ8Q 3RBBB 4F7UG 1Y0MA 2RI5A 2QTXA 1V1CA 4M77B 2JTEA 1VQ5Q 4R55A 4CC4B 1YCSB 1W2BP 1PD0A 1YN8A 1FMKA 5CO7A 1QP2A 3ULRB 1QVFP 1WJSA 1O75A 2EGEA 1VQ7A 4HA8A 2HDAA 1VQMT 4FYVB 2BZ8A 1M30A 3PFSA 4DQ2A 2AKLA 1UJYA 2I0NA 4OF1A 4C8QF 3EG3A 4F14A 4QQDA 5CKHA 3CCST 3CCVQ 1B07A 4RTTA 1OI1A 2MCNA 4BB7A 3X24B 2HKNA 2QQ9A 2RHUA 1RAIB 2OX7A 2OJ2A 2VVKA 3L42A 4Y91A 4QQ6A 2M0YA 1WHLA 4F17A 3VS2A 1V29B 4D8DA 2VKNA 4TVRA 3HP9A 4BE1A 3QPHA 4BDYA 4OMOA 5M9OA 1ZSZC 1UG1A 1TG0A 3HKSA 4OGEA 2JM9A 3EG9A 3EH1A 2YHTA 1KC8R 3G6EQ 3ASKA 5KYXB 3CPWA 1X2KA 1KG1A 5KYUA 1X6OA 2JM8A 4DEYA 1I5OB 3LW5E 2A28A 2DNUA 1JBMA 4IKFA 1E7OA 3WVDB 1M1FA 2KQWA 2XKOC 1LVKA 1K9AA 4C8QD 1PKTA 1M1KR 3HRSA 2JVVA 3CC7A 1RUWA 4M75A 3H9NA 1G83A 1I07A 1NE8A 2FZKB 2OI3A 3PMIA 4BUGA 1VQLA 1ZA2B 1TS9A 2PUKB 1Y96B 1FXXA 3CMEQ 2NUTB 2HQXA 1YJNQ 4HCKA 1BB9A 5A0GA 4O5VA 1S72A 3KFVA 5GAMh 2PU9B 4GBQA 3HSBA 1E6HA 3TU4K 1XNIA 3EHRA 1WHJA 1K8AC 1JJ2S 1UGVA 3A8GB 4MZPA 4PJNA 3JRZA 4QVDA 2NLUA 3L2WA 1UTIA 1UGQB 3CC7T 1M1KC 2G6FX 4II1A 1CKAA 2V8JA 2DK3A 1BI3A 3N5BB 5GAN4 2CZ1B 4OB2B 1KQ2A 2DFUA 1T3LA 4F7UF 2L5QA
chains in the Genus database with same CATH topology
3R6OA 2YLBA 2LDMA 1IREB 3QXEB 4IUTA 1VQ8T 4XK8E 1BI0A 1XQHA 4E7KA 1RI0A 4M77A 4XU2A 4JRQA 2XK0A 3QYGB 1OZ2A 5C0MA 1YJWA 2V8IA 4ZGJB 1UGPB 1HXDA 4NOYA 3ER0A 3CMAT 1LJOA 5GAN2 3QG1A 3GF5A 2F5TX 3MCAB 1M1KU 2F69A 2BIVA 2MWPA 5DLOA 2ZZDA 5LJ3h 1DJ7B 1N9RA 4EMHA 4Q5WA 3E1SA 5A0LA 1UEBA 3OYIA 4E7HA 2K3XA 5GAOn 1Y96A 2CYZB 4C0DB 2QQBA 1VQ6T 3OYKA 3SWNA 5DY9A 3DB4A 1KD1U 4XTVA 2Y4XA 3LH0A 3M55A 1M4ZA 5FU7C 2HD0A 4IUVA 4OB1B 4XAXB 3JCMc 2M1HA 3OMGA 4O6JA 2X4JA 1N8RC 2DTHA 4M75E 2EJGA 3FRNA 4GY5A 1VQ6A 1AHJB 3NTIA 3RMQA 1M1GA 2GFAA 3GP8A 3JB9I 1X01A 3E9GA 4M75D 1NJIU 3HRUA 4PKCC 4LDXA 1QVGS 2E10A 1YIJA 1VQPT 2JZ2A 1KC8C 1VIEA 4N4GA 2EKOA 3QUIA 4M7DF 4N4HA 1PSEA 3JB9J 2RJCA 2ZPGB 1U1SA 4XTXA 2QDYB 1SSFA 3I56A 4PJOE 3OW2A 4ZTJA 2P0PA 3HFOA 2KMTA 1VQPA 4Y28E 1G3SA 1B34A 4X9CA 4M75C 3DKMA 2LTOA 3V8JA 3M57A 3V8LA 5GAOp 4M7AF 3M4GA 2DTIA 3NFCA 4IUPA 1EIFA 1BIBA 3SB2A 1VQ9T 5CKEA 2VC8A 4JDSA 2RO0A 3VUBA 5FROA 3X26B 5A0DA 1Q7YU 4HCZA 2E1HA 1U8RA 4M77F 2XDPA 3JB9G 4OP0A 3A8LB 2ZPEB 4C8QE 3QO3A 5GMKm 4JJNK 3HRTA 2RK1A 2XG8D 4FSXA 4J7FA 3OSVA 5GAN3 3KBGA 3X20B 3ZBDA 2RI3A 4JLIA 4J6XA 5CKBA 5GAMe 1VQ7T 2VGMA 2QQAA 3SWNC 3OYLA 2QQRA 4M78A 5HK3A 1PSFA 5LJ5h 1N8RU 5FRNA 4OVAA 4M7AC 2PVGB 3TEEA 2EQMA 3CMAA 5AYFA 3INZA 2R57A 4M78G 3VYGA 4BD3A 2RHZA 4OB3B 3V8KA 2PVOB 2XDBA 2M9UA 3VYHB 5GAN7 1Y71A 3JB9D 1VQ8A 2XIDA 3FJPA 2DXTA 1I4K1 2KSSA 4C8QB 2WSEE 3BDUA 4C8QC 2AHJB 3DB3A 5A2QE 3BFMA 4M7DG 3CCET 1ZQ1A 5D6WA 3OYMA 2BKDN 1S72T 5GMKj 2ZGWA 3QZ5B 5CVIA 1YI2A 4JRIA 1KQSA 2X4YA 4N4IA 3G6EA 4FU6A 4LDUA 3OYJA 2D0QB 2IVWA 3OQ5A 2X4XA 2MI6A 2DEQA 1YJ9T 1VQNA 3OBYA 4M7AG 3CPFA 3M53A 3MEVA 4KUIA 2L8DA 1W2BS 4OGCA 3E19A 4FT4A 2EFIA 4FIBA 5LJ3g 2VYTA 3QZ9B 3CD6T 1H641 5D6YA 2RHIA 2LQKA 4M77C 1NJIC 2JOYA 2PQWA 4C5HA 3VKIA 4ZGDB 2QEXA 4C0DC 3M56A 4A4EA 3URGA 2EQUA 3ME9A 4GLKA 1Q81U 2CZ6B 2EAYA 3A8OB 3DLMA 4PJOG 3M59A 4EMGA 3C4SA 1NPRA 4JLGA 4M77G 5FU6B 5LJ3f 2DAQA 1M9SA 2H3JA 2KVQG 4NS5A 4NL3A 1Q82C 4QW2A 5GMKl 1HK9A 1OZ3A 1YJ9A 1VQNT 5GANf 3GOXA 1YITT 3FEOA 5GMKh 3G4SA 3G6ET 2JTMA 4HT9A 3WVEB 1YI2T 2OTLA 2QXFA 4JS5A 2RB6A 4B9XA 3PNWC 1G3YA 2MWOA 3M9QA 3FIFA 3OS5A 3L2ZA 3LWIA 1VQOA 1VQKA 4PJOC 4M78B 3FC3A 3MEWA 1FWZA 1OYXA 5IT9E 2WACA 4MZTA 2E41A 2P0KA 3CMET 1GXIE 3X28B 2K5FA 2JTFA 5KCOA 4QQGA 3MO8A 3JB9H 4XTZA 3CCRT 3RKWA 4C0GA 5KCHA 3GNFB 3JCMh 4BI3A 1YCYA 3C95A 3JB9F 4NL2A 3OYBA 3P8BB 2XI9A 3GPLA 3META 4A4GA 5FRMA 4C92A 4LDVA 1UGRB 2DD4A 2LX9A 5I21A 4EPCA 5GAOl 3P8HA 3KUFA 4M78E 3CPWS 4JS4A 2B8AA 4BACA 4ZN3A 3I55A 4L6V5 3CCJT 3NTKA 3PMTA 5GANd 2E70A 4PNOA 3JCMe 3QYHB 3WXMB 3M58A 4KBMB 4M7DE 2FYKA 3FLGA 4J7IA 4C92D 4ZTFA 1I5LA 1WJQA 3UPUA 1MHNA 3FDRA 4FL6A 4XQ3A 5CCAA 3LWHA 1K8AU 2LC4A 2ZPFB 4PLLA 3QKJA 1YJNA 4FT2A 3X25B 1M8VA 3FB9A 1BIAA 2MF2A 2QQSA 3HFNA 4CI0C 3CCQA 1K9MC 4A4FA 4M75G 3CCSA 2I2LA 2VXEA 1YIJT 3A5ZB 3CCQT 3HL8A 4IUQA 3TREA 1W2BA 1VUBA 1Q7YC 1N9SA 4X34A 2RHXA 3OYFA 2EJFA 2DKGA 1I81A 2RJDA 5CQXA 1Q86U 1XOVA 3C12A 3EFRA 2GQVA 4LD6A 5C6SA 3J7AF 4ME7A 3UDCA 4N0AA 2K5IA 3OYYA 1Y07A 3P8DA 4C8QA 5LJ5e 2V8KA 3OS2A 4HCCA 3PT9A 4ELYC 2LT4A 4PL6A 3LLRA 3JCMX 4ATOA 3UWNA 3O8VA 1K73U 4F7UE 3PIPA 3OYEA 2LCCA 3I55T 3E9FA 4E7LA 4CRIA 4QVZA 3GNGA 1VQ5T 2FL7A 2VV5A 3GLXA 5LJ3j 1VQMA 3OY9A 2MAMA 5LJ5j 3UT1A 4HCBA 2WSFE 3PIOA 2C06A 4XTYA 3CC2A 3RMSA 5GANe 4KUDK 2D9TA 5CK9A 3BW1A 1WGSA 3H8ZA 5CKFA 3SFMA 4B9WA 5DLQE 5LJ3d 2DJZA 4BE2A 1YJWT 2E6NA 4RCCA 2P4TA 3NTHA 3OYCA 4V2SA 3TCJA 4MDXA 2DO3A 2LCLA 2EYQA 5GAN5 4FM4B 4M75B 4BI4A 4XU3A 1X75C 4F7UB 3G71A 4LDWA 1VQKT 1KQ1A 1VQOT 5I2SA 3L2QA 3S3MA 1MGQA 4C0FA 3J80E 1P92A 3RKXA 2IG0A 1TH7A 3C94A 2F5KA 2K3YA 1QW1A 3SWNB 2R5MA 2OTLT 2CKKA 4PJOA 1QVFS 1W4SA 2K57A 3G4ST 2DXCA 1QP3A 5LJ5d 2HNIA 3CCMA 5GAMj 4YTLA 2YRVA 2XU8A 3S3OA 2KK4A 4BDZA 1G3WA 2Y90A 4XU1A 2WSCE 1ZBXA 3OYGA 3CBPA 3QJYA 4IUUA 4N0AC 1VQ4T 1N27A 3JCMP 1I8FA 5GAMd 3L2VA 4PLIA 5CIUA 2X35A 5J3BA 1KHIA 4PJOD 5CKDA 4M7AA 2EWNA 1FX7A 4DOWA 3LGFA 2O4XA 2ZCFB 4LDYA 4EDUA 2LNVA 1Y7XA 4ZN1A 3RESA 3PTAA 4LD9K 2JN0A 4C5GA 2XDDA 2M16A 4RMOA 3OS1A 1KHCA 4EMKB 1M90C 4M78D 2OTJT 4DA4A 4MMLA 3QDRB 4M77E 1LOJA 4L5GA 3CCUA 5GAOq 4M7DA 2QA4A 1H3ZA 1BI1A 5HK0A 3L2RA 1N6AA 2X4WA 3OS0A 2CS7A 3F70A 1BKBA 4XTUA 4M77D 2XD0A 5GAOm 4M7DC 3M54A 3VU3C 3SD4A 1D3BA 5KH6A 5LJ5g 4UC4A 3SDZA 3HPWA 3OYDA 1ZHIA 3L2UA 2CGHA 5CQYA 2OTJA 3A8HB 4M75F 3M5AA 1IZ6A 1VQLT 3OYNA 2RK2A 3G7ZA 1M5Q1 4OB0B 3A8MB 4BE0A 4C92G 2D6FA 3JCMQ 3CXCA 5LJ5f 4M7DD 4P5NA 3OBWA 1K73C 4F7UG 4JRKA 5GMKe 2RI5A 2QTXA 4M77B 3VUZA 1VQ4A 4WF2A 1UB4A 1B34B 3CBOA 4R55A 1G3TA 4QVCA 5IN1A 4E7JA 4F7UA 1QVGA 5GANg 4J8OA 3V7CA 2R5AA 5CO7A 5I2MA 1QP2A 1VIFA 2FB7A 1WJSA 2PVDB 2VXFA 1M90U 1O75A 1VQ7A 2QI2A 4BY6C 3OW2S 3V7SA 4HA8A 1VQMT 2LRQA 1VQ5A 1WJRA 1RL2A 5GAN6 4PJOB 3QSUA 3JSCA 4KT0E 2XICA 2XHCA 3PFSA 4DQ2A 2DVEA 2GFUA 2Y4YA 2RH2A 3LX7A 4E47A 4J6WA 1WPYA 2CZ7B 3G71T 3QJ6A 5GAMf 1WQWA 2DD5A 2ZPIB 2P0QA 1VQ9A 4C5IA 1JRIA 2RM4A 4M78C 4OF1A 4A4HA 2DIGA 2GF7A 4C8QF 5L8RE 2FHDA 4MZMA 5LL6S 3JCMV 3JCMb 2EQJA 4QQDA 5CKHA 3CCST 3EAEA 4XU0A 3OMCA 1OI1A 4BB7A 3CBMA 3X24B 3I56T 4HKEA 2HQEA 2QQ9A 5GAN8 1YHQA 3CC2T 1YJNT 2RHUA 2DZCA 2E5QA 4ELZC 3L42A 3MP1A 4Y91A 4QQ6A 3VJPA 2O01E 3AHUA 1V29B 5GANh 2LQ8A 4C5EA 2JNGA 3H6ZA 1QVPA 5FLXE 4TVRA 3CCJA 3HP9A 4MDWA 2L89A 3QPHA 4BDYA 4BE1A 2VGNA 1JJ2A 5IAYA 5M9OA 3T9NA 2EQKA 2K5LA 4M7AE 5CAIA 3GIBA 1JB0E 4E7IA 3HKSA 4ZGEB 1KQSS 1UGSB 3PGGA 2DZ9A 1BI2A 4OGEA 1YHQT 4M7AD 4RG8A 3JCMd 4JUVA 5J39A 3LGLA 4J5YA 3OYHA 2LVMA 3QHSA 2E65A 1YBYA 2YHTA 2EIFA 5GMKi 3J81E 4L59A 5GAOr 3ASKA 2VUBA 2ZPHB 1LNXA 2E6ZA 3L1AA 3MEAA 5KE3A 5DM7R 3OA6A 3CPWA 1KG1A 4PJOF 2E12A 1X6OA 4M7AB 4A4KA 2DXBA 3EFSA 4X9DA 5HKCA 1Q82U 1Q86C 2GCXA 1U1TA 3OSSC 3CXCS 4A54A 4EMKA 3LW5E 4RKUE 4M78F 3LYIA 1Q81C 2RJEA 3CEYA 3M4YA 4C92F 5HY6A 1JBMA 1K9MU 4IKFA 3WVDB 3CC4T 1M1FA 2HBPA 2KQWA 1WNLA 1YITA 1O9SA 2RI2A 2DPPB 3MP8A 2XKOC 1BYMA 4HT8A 4C8QD 2DIQA 4XTWA 5GANj 3ZEHA 3HRSA 3JCMJ 2JVVA 2KY9A 2BUDA 2KDSA 2OAUA 5FU7B 4BY6B 2L3RA 4J83A 2FVUA 2G3RA 2LT1A 2R58A 3ZFJA 3CCRA 2KAFA 4M75A 2QEXT 3CMEA 2RA2A 5EG2A 3JCMf 1NE8A 2A3LA 3QBYA 3RUXA 3DLLA 3CCVT 3PMIA 4BI8B 4BUGA 3S6WA 4C92B 3KXTA 1VQLA 1WQ7A 4J6YA 2EJ9A 2RD1A 2DTOA 5LJ3e 2ZPBB 2MMPA 3OB9A 3CD6A 2RJFA 3CCLA 3JCMg 1R8OB 3HHTB 4JRPA 1NZ9A 2PUKB 1KC8U 1Y96B 2CZ0B 4OMFB 4RG2A 1FXXA 2A7YA 3RIRA 2HQXA 4C8QG 1XTDA 5FU6C 3OYAA 3RERA 3BY7A 3JAME 2QA4T 3VV0A 3CCUT 2PUOB 2DXUA 2YLCA 4Z02A 3BDLA 5A0GA 4O5VA 1S72A 3CCLT 3CCEA 4C92E 5GAMh 2PU9B 5D6XA 3S3NA 1KD1C 3V7RA 3HSBA 4DOVA 5KE2A 3TU4K 1G5VA 1XNIA 1K8AC 3CCVA 4EMKC 3MHXA 1NPPA 1JJ2S 2O4XB 4IURA 4MZPA 3A8GB 4VUBA 3JRZA 4C92C 2E64A 2NLUA 4RCBA 4QVDA 3CC7A 3JCMW 3L2WA 4C0ZA 1UGQB 3Q1JA 3CC7T 1M1KC 3MEUA 4M7DB 5J26A 4D6WA 5CR2A 3CCMT 2M0OA 4II1A 5GAMg 1QVFA 3RKYA 4KULA 4MMKA 2V8JA 4R56A 2DK3A 4A53A 1BI3A 3N5BB 3QIIA 5GAN4 2CZ1B 1D3BB 2JUFA 2RHYA 2HAXA 3CC4A 4OB2B 1KQ2A 2K4YA 3MP6A 2K2VA 4F7UF 2L5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 5;  4M75 B;  4M77 C;  2YLB A;  4XU3 A;  4F7U B;  1KQ1 A;  4XU2 A;  4M77 A;  2EAY A;  4PJO G;  5LJ3 e;  4EMG A;  1MGQ A;  4M7A E;  3RKX A;  5CAI A;  1TH7 A;  3GIB A;  3SWN B;  4M77 G;  5LJ3 f;  1HXD A;  4NOY A;  4NL3 A;  1LJO A;  3PGG A;  5GAN 2;  2DZ9 A;  5GMK l;  4PJO A;  4M7A D;  1HK9 A;  2K57 A;  3JCM d;  4JUV A;  5LJ5 d;  2HNI A;  4J5Y A;  5GAN f;  3QHS A;  2E65 A;  5LJ3 h;  5GMK h;  1N9R A;  5GAM j;  2YHT A;  4EMH A;  5GMK i;  4HT9 A;  5GAO r;  5GAO n;  1LNX A;  1Y96 A;  2RB6 A;  2Y90 A;  3L1A A;  4XU1 A;  3FIF A;  3SWN A;  5DY9 A;  4PJO F;  3L2Z A;  4N0A C;  4M7A B;  4XTV A;  3JCM P;  3EFS A;  1I8F A;  4X9D A;  5GAM d;  4PJO C;  4M78 B;  1U1T A;  3JCM c;  4A54 A;  4PJO D;  3AHU A;  4M7A A;  2EWN A;  2E41 A;  4EMK A;  2DTH A;  4M75 E;  2EJG A;  4M78 F;  3RES A;  2JN0 A;  3JB9 H;  4XTZ A;  3JB9 I;  4EMK B;  4C92 F;  1X01 A;  4M78 D;  1JBM A;  4M75 D;  4MML A;  3RKW A;  5GMK m;  4M77 E;  1LOJ A;  2E10 A;  3JCM h;  5GAO q;  1YCY A;  3JB9 F;  4M7D A;  4NL2 A;  1WNL A;  3QUI A;  4M7D F;  4XTU A;  3JB9 J;  4M77 D;  4XTX A;  1U1S A;  5GAO m;  4HT8 A;  4M7D C;  4C8Q D;  4C92 A;  4PJO E;  3VU3 C;  3HFO A;  4XTW A;  5GAN j;  1D3B A;  5LJ5 g;  1B34 A;  4X9C A;  4M75 C;  3V8J A;  5GAO p;  3V8L A;  5I21 A;  4C8Q E;  2CGH A;  3JCM J;  4M7A F;  3M4G A;  2DTI A;  5GAO l;  4M78 E;  4M75 F;  1BIB A;  3SB2 A;  4M75 A;  1M5Q 1;  2VC8 A;  4C92 G;  2RA2 A;  3JCM Q;  3JCM f;  2E1H A;  5LJ5 f;  4PNO A;  3JCM e;  3RUX A;  4M77 F;  5GAN d;  4M7D D;  3JB9 G;  4OP0 A;  4C92 B;  4F7U G;  1WQ7 A;  3QO3 A;  4J6Y A;  2EJ9 A;  2RD1 A;  2DTO A;  2FYK A;  2QTX A;  4JRK A;  4M77 B;  4C92 D;  4WF2 A;  5GMK e;  1B34 B;  1I5L A;  4XQ3 A;  4QVC A;  5GAN 3;  3JCM g;  4F7U A;  5GAN g;  1M8V A;  1Y96 B;  4JLI A;  4J6X A;  3FB9 A;  1BIA A;  3V7C A;  2FB7 A;  3HFN A;  3RIR A;  5GAM e;  4C8Q G;  2VXF A;  3RER A;  3SWN C;  4M75 G;  3BY7 A;  2I2L A;  2VXE A;  3V7S A;  4M78 A;  4HA8 A;  5LJ5 h;  2DXU A;  2YLC A;  1N9S A;  2EJF A;  5GAN 6;  2DKG A;  4PJO B;  4C92 E;  3QSU A;  1I81 A;  3INZ A;  4M78 G;  5GAM h;  3EFR A;  3V7R A;  4DQ2 A;  2DVE A;  3V8K A;  3HSB A;  4N0A A;  4C8Q A;  5LJ5 e;  4M7D E;  5GAN 7;  4J6W A;  1WPY A;  4EMK C;  3JB9 D;  3FJP A;  2DXT A;  5GAM f;  1I4K 1;  1WQW A;  4C8Q B;  3BDU A;  3JCM X;  4C8Q C;  4C92 C;  4F7U E;  2E64 A;  4RCB A;  1JRI A;  2RM4 A;  3BFM A;  4M78 C;  4QVD A;  3JCM W;  4M7D G;  4C8Q F;  5GMK j;  2ZGW A;  5LJ3 j;  4JRI A;  5LJ5 j;  4M7D B;  3JCM V;  3JCM b;  5GAM g;  4XU0 A;  3RKY A;  4XTY A;  2DEQ A;  4M7A G;  4MMK A;  5GAN e;  4A53 A;  5GAN 8;  3BW1 A;  5GAN 4;  1D3B B;  2DZC A;  5LJ3 d;  2DJZ A;  1KQ2 A;  4RCC A;  4Y91 A;  5LJ3 g;  4V2S A;  1H64 1;  4F7U F;  4M7A C;  5GAN h; 
#chains in the Genus database with same CATH topology
 2K9G A;  1Q86 R;  1XQH A;  1RAG B;  4XU2 A;  3QYG B;  2O31 A;  2CSI A;  2V8I A;  1K9M R;  1HXD A;  4NOY A;  3ER0 A;  2F5T X;  1RLP C;  2QYZ A;  1DJ7 B;  4EMH A;  4Q5W A;  3E1S A;  1S1N A;  1Y96 A;  4CC3 A;  3EG2 A;  2NUT A;  3CCM Q;  5AT1 B;  4XTV A;  3PE0 A;  4F16 A;  4OB1 B;  3JCM c;  4OMM A;  3OMG A;  2X4J A;  2DTH A;  4M75 E;  2KYB A;  3FRN A;  1VQ6 A;  1H92 A;  4IIM A;  1RAC B;  1UUE A;  3GP8 A;  2HSP A;  1AVZ C;  2E10 A;  1YIJ A;  1VQP T;  2JS2 A;  3EGX B;  2RF0 A;  2ZPG B;  6AT1 B;  1SSF A;  1G8X A;  2JMC A;  2P0P A;  3RNJ A;  1ZSZ A;  4M75 C;  3DKM A;  4M7A F;  2F2X A;  3M4G A;  1UJ0 A;  2QAZ A;  2VC8 A;  5CKE A;  3X26 B;  5A0D A;  1ZA1 B;  4HCZ A;  2E1H A;  1E6G A;  3QWY A;  1SEM A;  2DL7 A;  3JV3 A;  3QO3 A;  5GMK m;  4FSX A;  4J7F A;  3OSV A;  3EFO A;  1WA7 A;  3X20 B;  3ZBD A;  2RI3 A;  5FWB A;  4LXC A;  1IO6 A;  1VQ7 T;  3OYL A;  3SWN C;  1NLP C;  4M78 A;  3CXC P;  1YIJ Q;  3CMA A;  2EQM A;  4J9B A;  2R57 A;  3G4S Q;  2PVO B;  1OV3 A;  2FPF A;  2M9U A;  1YHQ Q;  3FJP A;  2DXT A;  4M7D G;  2BKD N;  2EYZ A;  1ZUY A;  4FW1 A;  4JRI A;  2X4Y A;  4N4I A;  1UHC A;  2H3E B;  2D0Q B;  3OQ5 A;  2JS0 A;  4M7A G;  3OBY A;  1SSH A;  1VQK Q;  1W2B S;  2RQT A;  1MMA A;  2K79 A;  4FT4 A;  3EGX A;  5LJ3 g;  3QZ9 B;  1C0M A;  1YJW Q;  2RHI A;  1K73 R;  2JOY A;  2PQW A;  1OX8 A;  3VKI A;  4ZGD B;  2ESW A;  3ME9 A;  4GLK A;  1D0Y A;  4JJC A;  3C4S A;  5FU6 B;  2FZC B;  1M9S A;  2KVQ G;  2NUZ A;  5GMK l;  1HK9 A;  3U23 A;  5HCK A;  1YIT T;  2A08 A;  1NLO C;  3FEO A;  5GMK h;  3G4S A;  1D1A A;  2RB6 A;  4B9X A;  2KXD A;  2E5K A;  3M9Q A;  1Z9Z A;  2MWO A;  2RNA A;  3OS5 A;  4LUD A;  1VQO A;  1VQK A;  4M78 B;  3MEW A;  2DRK A;  2A37 A;  3JB9 H;  3RKW A;  4C0G A;  1T0J A;  1AZG B;  4NL2 A;  3I35 A;  4J9F A;  5FRM A;  1WXB A;  1QQJ A;  1H8K A;  3TSZ A;  2K3B A;  3P8H A;  4BAC A;  2DET A;  4L6V 5;  3VRZ A;  3CCJ T;  3NTK A;  4PNO A;  1OEB A;  3WXM B;  4C92 D;  1OU9 A;  1MHN A;  3O5Z A;  1TOV A;  2SEM A;  4PLL A;  2LJ3 A;  1X43 A;  2HSE B;  4E7Z A;  1BIA A;  4K11 A;  1K9M C;  2FPE A;  4CC7 A;  1GBQ A;  3VS0 A;  1PWT A;  2DKG A;  2EKH A;  4CC2 A;  1VQN Q;  1OQK A;  4F7U E;  4CRI A;  3GLX A;  1OX9 A;  5LJ3 j;  3OY9 A;  4HCB A;  1Q7Y R;  1BBZ A;  1U06 A;  5CK9 A;  2ROT A;  5DLQ E;  5LJ3 d;  2DJZ A;  1YJW T;  2E6N A;  2YDL A;  4V2S A;  4MDX A;  2LQW A;  2FRY A;  4FM4 B;  4FSS A;  4F7U B;  4LDW A;  1KFZ A;  2FO0 A;  3UAT A;  4FYX B;  2DEU A;  4R0K A;  2CT4 A;  1OUL A;  2J06 A;  3L2Q A;  1GFD A;  2ATC B;  1MGQ A;  3J80 E;  4DEX A;  1TH7 A;  2CP6 A;  2F5K A;  2X9H A;  4PJO A;  1W4S A;  1UFF A;  1K0S A;  2XU8 A;  4ANJ A;  4BDZ A;  4XU1 A;  3OYG A;  3CBP A;  3QJY A;  4LUE A;  4QKU A;  4IIO A;  3JCM P;  3H41 A;  5GAM d;  5J3B A;  5CKD A;  2ZAE A;  3REA B;  1Q7Y U;  4EDU A;  2O4X A;  1ZSZ B;  2JN0 A;  2M16 A;  1C1A A;  2J7I A;  3AT1 B;  3VS4 A;  2DA9 A;  3UA6 A;  3CCU A;  5GAO q;  1BI1 A;  1N6A A;  2XD0 A;  4M7D C;  3M54 A;  1HD3 A;  1K1Z A;  2RN8 A;  5KH6 A;  3SDZ A;  2HZY A;  1ZHI A;  4RUG A;  1VQ9 Q;  4KRT A;  3A8M B;  3CXC A;  4P5N A;  1CKB A;  2RQU A;  5GMK e;  4WF2 A;  1UB4 A;  1B34 B;  3H0I A;  4E7J A;  4F7U A;  1QVG A;  5GAN g;  2R5A A;  2F1L A;  5I2M A;  2VXF A;  2ECZ A;  1M90 U;  2DL3 A;  3OW2 S;  4RTV A;  2LRQ A;  1NEB A;  1WJR A;  5GAN 6;  4PJO B;  3JSC A;  1T3S A;  3UA7 A;  2E4H A;  2GFU A;  3NPF A;  4E47 A;  2CT3 A;  2KGT A;  2L0A A;  3H0H A;  1M3A A;  2VAS A;  5GAM f;  2DD5 A;  1J3T A;  2P0Q A;  1VQ9 A;  2RM4 A;  3CMA Q;  2FHD A;  5LL6 S;  1RAE B;  3I56 T;  1YHQ A;  2DYB A;  4HKE A;  5GAN 8;  3CC2 T;  1YJN T;  2DZC A;  2E5Q A;  4A63 B;  3VJP A;  4C5E A;  5KYW B;  5D7U A;  4MDW A;  1JJ2 A;  8ATC B;  2VGN A;  5IAY A;  1OU8 A;  3REB B;  4E7I A;  4ZGE B;  2QG9 B;  1I0C A;  3M0P A;  2KRM A;  3JCM d;  4M4Z A;  4J5Y A;  2E3H A;  2LVM A;  3QHS A;  1QKW A;  5GAO r;  2VUB A;  2ZPH B;  2BTT A;  1SKU B;  2JJ9 A;  3CCR Q;  3MEA A;  3OA6 A;  4PJO F;  4A4K A;  2DXB A;  3EFS A;  1Q86 C;  5HKC A;  2GCX A;  2PNI A;  4FW2 A;  4M78 F;  3LYI A;  3CEY A;  3M4Y A;  4C92 F;  5EC7 A;  1K9M U;  3CCL Q;  1ABO A;  4ZNX A;  1AZE A;  2EPD A;  1YIT A;  2KR3 A;  2DPP B;  1BYM A;  1MV3 A;  4HT8 A;  1KIK A;  2RPN A;  4XTW A;  4RTX A;  4AFZ C;  3CCR A;  2FVU A;  2G3R A;  4ORZ A;  2CUD A;  2QEX T;  3CME A;  2RA2 A;  3JCM f;  2A3L A;  3RUX A;  4Z89 A;  3CCJ Q;  3CCV T;  3KXT A;  4BI8 B;  2RD1 A;  1LPL A;  2DTO A;  2MMP A;  3OB9 A;  5KYW A;  1PC0 A;  2RJF A;  3CCL A;  1R8O B;  3QDF A;  2YUO A;  3CC4 Q;  2CZ0 B;  4OMF B;  4RG2 A;  3RIR A;  3OYA A;  1JO8 A;  1OPL A;  3RER A;  3BY7 A;  2QA4 T;  2QGF B;  3CCU T;  2DXU A;  2F2V A;  3CCE A;  1IHW A;  1G5V A;  1SF9 A;  1NPP A;  3IQL A;  4VUB A;  4C0Z A;  1K8A R;  3MEU A;  5CR2 A;  3CCM T;  2M0O A;  5GAM g;  1QVF A;  3RKY A;  1M2O A;  5KYY B;  4MMK A;  1A0N B;  1PRM C;  4A53 A;  4PK4 A;  2RHY A;  3CC4 A;  2D1X A;  2DL5 A;  1TUC A;  4RTZ A;  3R6O A;  1M2V B;  4IUT A;  5IHN A;  4JZ3 A;  1VQ8 T;  2YUQ A;  1U5S A;  4E7K A;  4JRQ A;  4M77 A;  3M0U A;  3RDV A;  4FYW B;  2GTO A;  3GF5 A;  3MCA B;  2BIV A;  2IPO B;  2MWP A;  2ZZD A;  3OYI A;  4E7H A;  2K3X A;  1GCQ A;  2OTJ Q;  2QQB A;  1VQ6 T;  3OYK A;  1ZBJ A;  3DB4 A;  1Q81 R;  1KD1 U;  3VS1 A;  2Y4X A;  4XAX B;  2HBW A;  1SPK A;  2B86 A;  1OOT A;  2OAW A;  1AHJ B;  3NTI A;  1M1G A;  2DBM A;  1X01 A;  2O2O A;  1I1J A;  4PKC C;  1QVG S;  1PSE A;  3JB9 J;  1PD1 A;  2RJC A;  4XTX A;  1U1S A;  3SEM A;  1AWW A;  1PHT A;  2KRS A;  4Y28 E;  1G3S A;  1B34 A;  1W1F A;  2DRM A;  4X9C A;  3V8J A;  1NYF A;  4IUP A;  1EIF A;  2LP5 A;  4JDS A;  2RO0 A;  3VUB A;  5FRO A;  1VQO Q;  4KH1 B;  4HVW A;  2CP5 A;  3HRT A;  2V1Q A;  2XG8 D;  2H8H A;  5GAN 3;  3KBG A;  1R77 A;  2COZ A;  5HK3 A;  4PJM A;  1B3Q A;  5KYX A;  1N8R U;  5FRN A;  4M78 G;  2VWF A;  2RHZ A;  3V8K A;  2OTL Q;  2XDB A;  5GAN 7;  3JB9 D;  3BFM A;  3CCE T;  1ZQ1 A;  3OYM A;  3QZ5 B;  3OYJ A;  1X2Q A;  4AG1 C;  1SG5 A;  4KUI A;  2L8D A;  1YWO A;  4J9G A;  3E19 A;  2EFI A;  4FIB A;  1SHG A;  4M77 C;  1NJI C;  1RI9 A;  2QEX A;  2EQU A;  2J05 A;  1RLQ C;  4JLG A;  4M77 G;  5ECA A;  2DAQ A;  4NL3 A;  4QW2 A;  1ARK A;  5GAN f;  4PJL A;  2K7A A;  4HT9 A;  2OTL A;  4JS5 A;  1G3Y A;  1OYX A;  2CH4 A;  3ZL7 C;  2E41 A;  2P0K A;  3X28 B;  4DBF A;  2K5F A;  3JB9 F;  2RQR A;  2ABL A;  3C95 A;  3GPL A;  3MET A;  1H3H A;  1RAH B;  2QK0 A;  1G2B A;  3CPW S;  1W6X A;  1PNJ A;  5I22 A;  2E70 A;  3JCM e;  1GBR A;  4AFQ C;  2FYK A;  1YNZ A;  4J7I A;  1I5L A;  1WJQ A;  3UPU A;  3M0R A;  2LC4 A;  1YJN A;  4KGX B;  3X25 B;  3CCQ A;  3CD6 Q;  3HFN A;  2EYW A;  3CCS A;  2I2L A;  3CCQ T;  1VUB A;  4X34 A;  2EJF A;  2L2P A;  1I81 A;  1Q86 U;  3EFR A;  1TUD A;  4Y92 A;  1BCO A;  3UDC A;  2K5I A;  3P8D A;  5LJ5 e;  2LT4 A;  3JCM X;  3PIP A;  3OYE A;  3I55 T;  2KT1 A;  3QWX X;  4QVZ A;  2VV5 A;  2K6D A;  2MAM A;  3UT1 A;  2WSF E;  2F2W A;  3H0F A;  4XTY A;  3RMS A;  2D9T A;  1PRL C;  4B9W A;  5CKF A;  3SFM A;  4BE2 A;  4RCC A;  3NTH A;  3OYC A;  3TCJ A;  2LCL A;  5GAN 5;  4BI4 A;  1X75 C;  3G71 A;  1KQ1 A;  1VYT A;  2YT6 A;  4C0F A;  2ENM A;  3RKX A;  3OW2 P;  2K3Y A;  2R5M A;  2OTL T;  2DXC A;  1AOJ A;  3CCM A;  4YTL A;  4KH0 B;  1Q82 R;  3S3O A;  2WSC E;  3EGD A;  4IUU A;  4N0A C;  1VQ4 T;  2ROL A;  2J6F A;  5CIU A;  1YIT Q;  2NWM A;  1AWO A;  1KHI A;  4PJO D;  4DOW A;  3LGF A;  4LDY A;  4LD9 K;  1M3C A;  1ABQ A;  3RES A;  4ZN1 A;  2XDD A;  4RMO A;  2L3Q A;  1M90 C;  4M78 D;  2X3X D;  2YWW A;  4DA4 A;  4MML A;  3QDR B;  4M77 E;  4M7D A;  2QA4 A;  3L2R A;  2X4W A;  3OS0 A;  2CS7 A;  2EGA A;  4XTU A;  3VS6 A;  5GAO m;  3PVL A;  3SD4 A;  1D3B A;  1NEG A;  3L2U A;  5CQY A;  4M75 F;  1VQ4 Q;  1ZX6 A;  4BE0 A;  4FCY A;  4JRK A;  3VUZ A;  3CC7 Q;  1BCM A;  3CBO A;  1G3T A;  1NG2 A;  4QVC A;  1NYG A;  3V7C A;  1VIF A;  1VQ6 Q;  2RMO A;  2V1R A;  1D0Z A;  1AT1 B;  4BY6 C;  1N5Z A;  3V7S A;  4HVV A;  2GBQ A;  2KT8 A;  3QSU A;  2XIC A;  3LX7 A;  1QKX A;  1M90 R;  3A98 A;  2CZ7 B;  3QJ6 A;  4LN2 A;  3PVQ A;  1JRI A;  2DIG A;  5L8R E;  3JCM b;  2EQJ A;  1FMV A;  3EAE A;  3EHQ A;  3CBM A;  1TUG B;  4ELZ C;  3MP1 A;  2BE7 D;  2AT1 B;  1IXD A;  2Z0W A;  2O01 E;  5L23 A;  5GAN h;  5FLX E;  2JNG A;  1QVP A;  7AT1 B;  3CCJ A;  2QAS A;  2K5L A;  4M7A E;  1EFN A;  3GIB A;  1JXM A;  1UGS B;  3PGG A;  1VYU A;  2DZ9 A;  1YHQ T;  1WYX A;  4M7A D;  2DE0 X;  5J39 A;  3LGL A;  3OYH A;  4PFO A;  1YBY A;  1ZLM A;  3J81 E;  5DM7 R;  1VOM A;  1M8M A;  3TQ7 P;  2PTK A;  1U1T A;  3CXC S;  4A54 A;  5IHK A;  1Q81 C;  2RJE A;  3I5S A;  5HY6 A;  2LX7 A;  2HBP A;  1WNL A;  1O9S A;  2RI2 A;  4J9I A;  1TU0 B;  2C0T A;  2DIQ A;  1FYN A;  2DVJ A;  2KY9 A;  4C8Q E;  2OAU A;  4BY6 B;  2RQV A;  2LT1 A;  2R58 A;  3ZFJ A;  2KAF A;  4PFP A;  3C0C A;  4JPB W;  2D0N A;  5EG2 A;  2DMO A;  4PFZ A;  1WI7 A;  1WDX A;  3QBY A;  2QDL A;  3S6W A;  1WQ7 A;  5LJ3 e;  2ZPB B;  1MNE A;  1KQS P;  1WHM A;  2DM1 A;  2CH4 W;  3JCM g;  4JRP A;  2CDT A;  1LCK A;  1SRL A;  2COW A;  1QMC A;  4OML A;  5FU6 C;  2KEA A;  4RTY A;  3JAM E;  2BE9 B;  2PUO B;  4Z02 A;  3CCL T;  4C92 E;  4KGV B;  1MUZ A;  1GCQ C;  5D6X A;  3S3N A;  1KD1 C;  3V7R A;  4DOV A;  1PM3 A;  3EGU A;  3CCV A;  4EMK C;  2O4X B;  2DX1 A;  2E64 A;  4RCB A;  1KD1 R;  2LMJ A;  4FYY B;  2JT4 A;  4KUL A;  4R56 A;  3I5R A;  3QII A;  2JUF A;  2HAX A;  1WFW A;  4M7A C;  2YLB A;  1IRE B;  3QXE B;  1GFC A;  2XK0 A;  1OZ2 A;  5C0M A;  2EBP A;  1YJW A;  1UGP B;  5GAN 2;  1WX6 A;  1M1K U;  2F69 A;  1VQ7 Q;  5DLO A;  2DL4 A;  2HKQ B;  1N9R A;  1UEB A;  2CP7 A;  5GAO n;  2CYZ B;  2L3S A;  1KJW A;  4C0D B;  1GRI A;  1JU5 C;  5DY9 A;  3SWN A;  4ESR A;  3NMZ C;  4IUV A;  4O6J A;  4E7S A;  3RMQ A;  1M3B A;  3JB9 I;  1R0C B;  2P4R A;  4M75 D;  4LDX A;  2JZ2 A;  1VIE A;  2EKO A;  3EG0 A;  4N4H A;  8AT1 B;  3I56 A;  1MMN A;  3HFO A;  2KMT A;  2NUP A;  5GAO p;  4JJD A;  4E6R A;  1HYO A;  2DTI A;  2GQI A;  3SB2 A;  1GCP A;  1Z9Q A;  1X69 A;  1U8R A;  2XDP A;  2SRC A;  2YUP A;  4OP0 A;  3A8L B;  3JB9 G;  1WIE A;  2RK1 A;  2FG0 A;  4JLI A;  4E2F B;  4J6X A;  5CKB A;  1WXU A;  4RTW A;  2QQA A;  3CQT A;  2HQH A;  2EGC A;  2AZV A;  2NYS A;  4OVA A;  3EG1 A;  3MJX A;  5AYF A;  3INZ A;  3VYG A;  3VRY A;  4Z88 A;  2K2M A;  1VQ8 A;  4PJJ A;  1ACM B;  3CCU Q;  2WSE E;  4C8Q C;  2AHJ B;  3DB3 A;  4Z8A A;  5D6W A;  1S72 T;  5CVI A;  2CP0 A;  3G6E A;  2X4X A;  2MI6 A;  2DEQ A;  2YUN A;  1YJ9 T;  1VQN A;  3CPF A;  3MEV A;  4OMP A;  3THK A;  2VYT A;  3CD6 T;  2EYX A;  5IH2 A;  4C5H A;  4C0D C;  3M56 A;  2O88 A;  3I55 Q;  2EAY A;  3A8O B;  3DLM A;  4EMG A;  2QA4 Q;  1K76 A;  1NPR A;  1D1B A;  5LJ3 f;  1WZO A;  2C0O A;  4NS5 A;  2KXC A;  1SHF A;  3GOX A;  1AEY A;  2EVR A;  2JTM A;  2BZX A;  5IXF A;  3NGP A;  2QGG A;  2KBT A;  3FIF A;  2GGR A;  2YRC A;  4PJO C;  1FWZ A;  2AKK A;  2WAC A;  1NBE B;  4MZT A;  3CME T;  1GXI E;  2L3P A;  2JTF A;  2EQI A;  3MO8 A;  5KCH A;  3GNF B;  2KRO A;  4BI3 A;  1YCY A;  1QLY A;  1M27 C;  3P8B B;  2XI9 A;  2HCK A;  4LDV A;  1UGR B;  4EPC A;  5GAO l;  4M78 E;  4JS4 A;  2B8A A;  5IHI A;  2EYY A;  3I55 A;  1M2V A;  5GAN d;  3QYH B;  1YI2 Q;  3M58 A;  1R0B G;  1BK2 A;  4FL6 A;  3FDR A;  2C0I A;  2MIO A;  3VS7 A;  1M8V A;  2QQS A;  3CC2 Q;  4A4F A;  1RAF B;  4M75 G;  2LJ0 A;  2VXE A;  1YIJ T;  3A5Z B;  3HL8 A;  1UEC A;  1SRM A;  2FPD A;  2RJD A;  5CQX A;  1GL5 A;  1XOV A;  3C12 A;  4X1V A;  4LD6 A;  4N0A A;  4C8Q A;  3OYY A;  2V8K A;  1TXQ A;  4AT1 B;  3PT9 A;  4ELY C;  4PL6 A;  4ATO A;  3LLR A;  3O8V A;  1K73 U;  2LCC A;  4E7L A;  2DIL A;  3GNG A;  1IB8 A;  2FL7 A;  1VQM A;  1VQ5 T;  4J9E A;  5LJ5 j;  3PIO A;  2C06 A;  3CC2 A;  4DBH A;  1T0H A;  1JQQ A;  1WGS A;  2RQW A;  2CUB A;  2P4T A;  1QWE A;  1EX4 A;  1FMW A;  4M75 B;  1HSQ A;  1VQO T;  3S3M A;  1WLP B;  3C94 A;  3TVT A;  3SWN B;  1QW1 A;  3SHW A;  2CKK A;  1QVF S;  2K57 A;  1QP3 A;  5LJ5 d;  2HNI A;  4JZ4 A;  1UE9 A;  5GAM j;  2YRV A;  2Y90 A;  3CCE Q;  2MK5 A;  1N27 A;  1CSK A;  2X35 A;  2COY A;  1FX7 A;  2EWN A;  2LNV A;  1Y7X A;  2NUP B;  1JXO A;  1KHC A;  1LOJ A;  2YRD A;  1D1C A;  5HK0 A;  3VU3 C;  2LCS A;  5LJ5 g;  3HPW A;  3M5A A;  1VQL T;  2E3I A;  3OYN A;  4OB0 B;  2D6F A;  4C92 G;  3JCM Q;  4M7D D;  3GBQ A;  3OBW A;  1K73 C;  1VQ4 A;  3EH2 A;  5IN1 A;  1KK7 A;  4J8O A;  5KYN A;  2FB7 A;  2PVD B;  1Y57 A;  4EIK A;  2QI2 A;  1WHH A;  4DBR A;  1EZZ B;  1VQ5 A;  1RL2 A;  1ZSG A;  4KT0 E;  2D8J A;  2XHC A;  2DVE A;  2Y4Y A;  2RH2 A;  2DLP A;  4J6W A;  1WPY A;  3G71 T;  1IGQ A;  1WQW A;  2ZPI B;  1X6G A;  4C5I A;  4M78 C;  4A4H A;  1AD5 A;  2VB6 A;  2GF7 A;  1U3O A;  4MZM A;  3JCM V;  4XU0 A;  4D8K A;  1K4U S;  2HL5 C;  3OMC A;  1MV0 B;  2HQE A;  2CRE A;  2IIM A;  4F04 B;  3AHU A;  2O9V A;  2LQ8 A;  3H6Z A;  1YJ9 Q;  2L89 A;  1QCO A;  3CPW P;  3T9N A;  2EQK A;  1RAB B;  5CAI A;  1JB0 E;  3EFO B;  1KQS S;  1BI2 A;  4HXJ A;  4RG8 A;  4JUV A;  2J6K A;  2E65 A;  5GMK i;  2EIF A;  4L59 A;  2E6Z A;  1LNX A;  3L1A A;  5KE3 A;  1NJI R;  2E12 A;  2X51 A;  4M7A B;  4X9D A;  1Q82 U;  4HVU A;  2LZ6 B;  3OSS C;  4EMK A;  4RKU E;  2KE9 A;  2M51 A;  1RAD B;  3CC4 T;  3MKD A;  3MP8 A;  5GAN j;  3ZEH A;  3JCM J;  1X6B A;  2BUD A;  2KDS A;  5FU7 B;  2L3R A;  4J83 A;  2V26 A;  2LNH B;  1QCN A;  3DLL A;  1JEG A;  4LNP A;  4C92 B;  4J6Y A;  2EJ9 A;  3CCQ Q;  3CD6 A;  2KRN A;  2HMA A;  3HHT B;  1NZ9 A;  4B6M A;  1KC8 U;  4DBQ A;  1K0X A;  2A7Y A;  2ED1 A;  4C8Q G;  1XTD A;  2A36 A;  3VV0 A;  2YLC A;  2DJQ A;  2W10 A;  3BDL A;  3EGD B;  2HEQ A;  2DF6 A;  5KE2 A;  3G71 Q;  3MHX A;  1YWP A;  1WHG A;  1NM7 A;  4IUR A;  1KSW A;  4C92 C;  3JCM W;  3Q1J A;  1QVG P;  4WTO B;  1PKS A;  4M7D B;  5J26 A;  4D6W A;  1AWX A;  1D3B B;  3UF4 A;  2K4Y A;  3MP6 A;  1QCF A;  2K2V A;  3CCS Q;  1VQP Q;  2LDM A;  2FEI A;  1TSF A;  1OPK A;  4XK8 E;  1BI0 A;  3MPU B;  2QTV A;  1BU1 A;  1RI0 A;  2BZY A;  2X3W D;  2M02 A;  2MYS A;  3CMA T;  4ZGJ B;  1JJ2 P;  1LJO A;  3QG1 A;  3RR6 A;  3R6N A;  5LJ3 h;  1WXT A;  4QT7 A;  1IGU A;  5A0L A;  5KYU B;  2P84 A;  1ZUK A;  3LH0 A;  3M55 A;  1M4Z A;  5FU7 C;  2AK5 A;  1ZUU A;  2HD0 A;  2M1H A;  1N8R C;  2EJG A;  4GY5 A;  2GFA A;  1MND A;  3E9G A;  4AMC A;  1NJI U;  3HRU A;  1QWF A;  1KC8 C;  4KGZ B;  3HTR A;  4N4G A;  3QUI A;  4M7D F;  2QDY B;  2GNC A;  2KYM A;  4PJO E;  3OW2 A;  4ZTJ A;  1VQP A;  4OMN A;  2LTO A;  3V8L A;  3M57 A;  1MMG A;  3NFC A;  1X27 A;  2J6O A;  1BIB A;  1VQ9 T;  5I11 A;  1YP5 A;  4M77 F;  2ZPE B;  4OMQ A;  1AWJ A;  4JJN K;  5FWC A;  5GAM e;  9ATC B;  2VGM A;  2MOX A;  2QQR A;  1UDL A;  1PSF A;  5LJ5 h;  4GLM A;  2PVG B;  3TEE A;  3VS5 A;  4BD3 A;  1IRX A;  2DL8 A;  4OB3 B;  3VYH B;  1Y71 A;  2XID A;  1I4K 1;  2KSS A;  4C8Q B;  3BDU A;  5A2Q E;  1Q95 G;  5GMK j;  2ZGW A;  4LE9 A;  1YI2 A;  5GJW B;  1KQS A;  4FU6 A;  4LDU A;  2IVW A;  1PCX A;  5GJV B;  1IHV A;  1VYV A;  3M53 A;  3D7S B;  4OGC A;  1VQL Q;  1H64 1;  1WHK A;  5D6Y A;  2LQK A;  2YSQ A;  2PZ1 A;  1YFN A;  4A4E A;  2FRW A;  2HL3 A;  3URG A;  1Q81 U;  2CZ6 B;  4PJO G;  3M59 A;  2D8H A;  4AFS C;  1PG5 B;  1Q82 C;  2H3J A;  1OZ3 A;  1YJ9 A;  1VQN T;  4AFU C;  3G6E T;  2DBK A;  3WVE B;  1YI2 T;  2QXF A;  3E2U A;  2CP3 A;  2AIR B;  2FZG B;  3PNW C;  4AG2 C;  1W70 A;  3I9Q A;  3L2Z A;  1UHF A;  3LWI A;  3FC3 A;  5IT9 E;  3NHN A;  3EG9 B;  2AZS A;  2DYI A;  5KCO A;  4QQG A;  4XTZ A;  3CCR T;  2DER A;  3JCM h;  2JW4 A;  3OYB A;  5FW9 A;  4A4G A;  1VA7 A;  4C92 A;  2DD4 A;  2LX9 A;  5I21 A;  4J9H A;  3KUF A;  4ZN3 A;  1N8R R;  3PMT A;  2JMA A;  4KBM B;  4M7D E;  3FLG A;  4ZTF A;  2LJ1 A;  1S72 Q;  1K8A U;  4XQ3 A;  5CCA A;  3LWH A;  2ZPF B;  3M0T A;  3QKJ A;  1C6V X;  4FT2 A;  3FB9 A;  2MF2 A;  1MMD A;  4CI0 C;  2W0Z A;  2LQN A;  3TRE A;  4IUQ A;  1W2B A;  1TWB A;  1Q7Y C;  1N9S A;  3OYF A;  2RHX A;  1VQM Q;  5C6S A;  3J7A F;  2GQV A;  4ME7 A;  1V76 A;  3OS2 A;  1Y07 A;  4HCC A;  2XMF A;  3FJ5 A;  3BE3 A;  3UWN A;  5IXB A;  2ED0 A;  2YXY A;  3E9F A;  1D09 B;  3LH5 A;  3TSW A;  5GAN e;  4KUD K;  2QEX Q;  1F1B B;  3BW1 A;  3H8Z A;  1HJD A;  4J9D A;  2DO3 A;  4RTU A;  4WCI A;  2EYQ A;  4XU3 A;  1B7T A;  1VQK T;  3A1P A;  2KI7 A;  1TTH B;  2A0F B;  5I2S A;  1P92 A;  2O9S A;  2IG0 A;  3G4S T;  3I56 Q;  2JXB A;  2CP2 A;  2KK4 A;  1D0X A;  1G3W A;  1ZBX A;  2MPX C;  3M0Q A;  1I8F A;  3L2V A;  4PLI A;  2KNB B;  4M7A A;  2GTJ A;  2ZCF B;  3PTA A;  4C5G A;  3VS3 A;  3OS1 A;  4EMK B;  2OTJ T;  4J9C A;  4L5G A;  1H3Z A;  3F70 A;  1BKB A;  4M77 D;  5KYY A;  4JJB A;  2EW3 A;  2CSQ A;  4UC4 A;  3OYD A;  2CGH A;  3M0S A;  2OTJ A;  3A8H B;  3G1J A;  1IZ6 A;  1XJW B;  1RAA B;  2RK2 A;  3G7Z A;  1M5Q 1;  5LJ5 f;  1VQ8 Q;  3RBB B;  4F7U G;  1Y0M A;  2RI5 A;  2QTX A;  1V1C A;  4M77 B;  2JTE A;  1VQ5 Q;  4R55 A;  4CC4 B;  1YCS B;  1W2B P;  1PD0 A;  1YN8 A;  1FMK A;  5CO7 A;  1QP2 A;  3ULR B;  1QVF P;  1WJS A;  1O75 A;  2EGE A;  1VQ7 A;  4HA8 A;  2HDA A;  1VQM T;  4FYV B;  2BZ8 A;  1M30 A;  3PFS A;  4DQ2 A;  2AKL A;  1UJY A;  2I0N A;  4OF1 A;  4C8Q F;  3EG3 A;  4F14 A;  4QQD A;  5CKH A;  3CCS T;  3CCV Q;  1B07 A;  4RTT A;  1OI1 A;  2MCN A;  4BB7 A;  3X24 B;  2HKN A;  2QQ9 A;  2RHU A;  1RAI B;  2OX7 A;  2OJ2 A;  2VVK A;  3L42 A;  4Y91 A;  4QQ6 A;  2M0Y A;  1WHL A;  4F17 A;  3VS2 A;  1V29 B;  4D8D A;  2VKN A;  4TVR A;  3HP9 A;  4BE1 A;  3QPH A;  4BDY A;  4OMO A;  5M9O A;  1ZSZ C;  1UG1 A;  1TG0 A;  3HKS A;  4OGE A;  2JM9 A;  3EG9 A;  3EH1 A;  2YHT A;  1KC8 R;  3G6E Q;  3ASK A;  5KYX B;  3CPW A;  1X2K A;  1KG1 A;  5KYU A;  1X6O A;  2JM8 A;  4DEY A;  1I5O B;  3LW5 E;  2A28 A;  2DNU A;  1JBM A;  4IKF A;  1E7O A;  3WVD B;  1M1F A;  2KQW A;  2XKO C;  1LVK A;  1K9A A;  4C8Q D;  1PKT A;  1M1K R;  3HRS A;  2JVV A;  3CC7 A;  1RUW A;  4M75 A;  3H9N A;  1G83 A;  1I07 A;  1NE8 A;  2FZK B;  2OI3 A;  3PMI A;  4BUG A;  1VQL A;  1ZA2 B;  1TS9 A;  2PUK B;  1Y96 B;  1FXX A;  3CME Q;  2NUT B;  2HQX A;  1YJN Q;  4HCK A;  1BB9 A;  5A0G A;  4O5V A;  1S72 A;  3KFV A;  5GAM h;  2PU9 B;  4GBQ A;  3HSB A;  1E6H A;  3TU4 K;  1XNI A;  3EHR A;  1WHJ A;  1K8A C;  1JJ2 S;  1UGV A;  3A8G B;  4MZP A;  4PJN A;  3JRZ A;  4QVD A;  2NLU A;  3L2W A;  1UTI A;  1UGQ B;  3CC7 T;  1M1K C;  2G6F X;  4II1 A;  1CKA A;  2V8J A;  2DK3 A;  1BI3 A;  3N5B B;  5GAN 4;  2CZ1 B;  4OB2 B;  1KQ2 A;  2DFU A;  1T3L A;  4F7U F;  2L5Q A; 
#chains in the Genus database with same CATH homology
 3R6O A;  2YLB A;  2LDM A;  1IRE B;  3QXE B;  4IUT A;  1VQ8 T;  4XK8 E;  1BI0 A;  1XQH A;  4E7K A;  1RI0 A;  4M77 A;  4XU2 A;  4JRQ A;  2XK0 A;  3QYG B;  1OZ2 A;  5C0M A;  1YJW A;  2V8I A;  4ZGJ B;  1UGP B;  1HXD A;  4NOY A;  3ER0 A;  3CMA T;  1LJO A;  5GAN 2;  3QG1 A;  3GF5 A;  2F5T X;  3MCA B;  1M1K U;  2F69 A;  2BIV A;  2MWP A;  5DLO A;  2ZZD A;  5LJ3 h;  1DJ7 B;  1N9R A;  4EMH A;  4Q5W A;  3E1S A;  5A0L A;  1UEB A;  3OYI A;  4E7H A;  2K3X A;  5GAO n;  1Y96 A;  2CYZ B;  4C0D B;  2QQB A;  1VQ6 T;  3OYK A;  3SWN A;  5DY9 A;  3DB4 A;  1KD1 U;  4XTV A;  2Y4X A;  3LH0 A;  3M55 A;  1M4Z A;  5FU7 C;  2HD0 A;  4IUV A;  4OB1 B;  4XAX B;  3JCM c;  2M1H A;  3OMG A;  4O6J A;  2X4J A;  1N8R C;  2DTH A;  4M75 E;  2EJG A;  3FRN A;  4GY5 A;  1VQ6 A;  1AHJ B;  3NTI A;  3RMQ A;  1M1G A;  2GFA A;  3GP8 A;  3JB9 I;  1X01 A;  3E9G A;  4M75 D;  1NJI U;  3HRU A;  4PKC C;  4LDX A;  1QVG S;  2E10 A;  1YIJ A;  1VQP T;  2JZ2 A;  1KC8 C;  1VIE A;  4N4G A;  2EKO A;  3QUI A;  4M7D F;  4N4H A;  1PSE A;  3JB9 J;  2RJC A;  2ZPG B;  1U1S A;  4XTX A;  2QDY B;  1SSF A;  3I56 A;  4PJO E;  3OW2 A;  4ZTJ A;  2P0P A;  3HFO A;  2KMT A;  1VQP A;  4Y28 E;  1G3S A;  1B34 A;  4X9C A;  4M75 C;  3DKM A;  2LTO A;  3V8J A;  3M57 A;  3V8L A;  5GAO p;  4M7A F;  3M4G A;  2DTI A;  3NFC A;  4IUP A;  1EIF A;  1BIB A;  3SB2 A;  1VQ9 T;  5CKE A;  2VC8 A;  4JDS A;  2RO0 A;  3VUB A;  5FRO A;  3X26 B;  5A0D A;  1Q7Y U;  4HCZ A;  2E1H A;  1U8R A;  4M77 F;  2XDP A;  3JB9 G;  4OP0 A;  3A8L B;  2ZPE B;  4C8Q E;  3QO3 A;  5GMK m;  4JJN K;  3HRT A;  2RK1 A;  2XG8 D;  4FSX A;  4J7F A;  3OSV A;  5GAN 3;  3KBG A;  3X20 B;  3ZBD A;  2RI3 A;  4JLI A;  4J6X A;  5CKB A;  5GAM e;  1VQ7 T;  2VGM A;  2QQA A;  3SWN C;  3OYL A;  2QQR A;  4M78 A;  5HK3 A;  1PSF A;  5LJ5 h;  1N8R U;  5FRN A;  4OVA A;  4M7A C;  2PVG B;  3TEE A;  2EQM A;  3CMA A;  5AYF A;  3INZ A;  2R57 A;  4M78 G;  3VYG A;  4BD3 A;  2RHZ A;  4OB3 B;  3V8K A;  2PVO B;  2XDB A;  2M9U A;  3VYH B;  5GAN 7;  1Y71 A;  3JB9 D;  1VQ8 A;  2XID A;  3FJP A;  2DXT A;  1I4K 1;  2KSS A;  4C8Q B;  2WSE E;  3BDU A;  4C8Q C;  2AHJ B;  3DB3 A;  5A2Q E;  3BFM A;  4M7D G;  3CCE T;  1ZQ1 A;  5D6W A;  3OYM A;  2BKD N;  1S72 T;  5GMK j;  2ZGW A;  3QZ5 B;  5CVI A;  1YI2 A;  4JRI A;  1KQS A;  2X4Y A;  4N4I A;  3G6E A;  4FU6 A;  4LDU A;  3OYJ A;  2D0Q B;  2IVW A;  3OQ5 A;  2X4X A;  2MI6 A;  2DEQ A;  1YJ9 T;  1VQN A;  3OBY A;  4M7A G;  3CPF A;  3M53 A;  3MEV A;  4KUI A;  2L8D A;  1W2B S;  4OGC A;  3E19 A;  4FT4 A;  2EFI A;  4FIB A;  5LJ3 g;  2VYT A;  3QZ9 B;  3CD6 T;  1H64 1;  5D6Y A;  2RHI A;  2LQK A;  4M77 C;  1NJI C;  2JOY A;  2PQW A;  4C5H A;  3VKI A;  4ZGD B;  2QEX A;  4C0D C;  3M56 A;  4A4E A;  3URG A;  2EQU A;  3ME9 A;  4GLK A;  1Q81 U;  2CZ6 B;  2EAY A;  3A8O B;  3DLM A;  4PJO G;  3M59 A;  4EMG A;  3C4S A;  1NPR A;  4JLG A;  4M77 G;  5FU6 B;  5LJ3 f;  2DAQ A;  1M9S A;  2H3J A;  2KVQ G;  4NS5 A;  4NL3 A;  1Q82 C;  4QW2 A;  5GMK l;  1HK9 A;  1OZ3 A;  1YJ9 A;  1VQN T;  5GAN f;  3GOX A;  1YIT T;  3FEO A;  5GMK h;  3G4S A;  3G6E T;  2JTM A;  4HT9 A;  3WVE B;  1YI2 T;  2OTL A;  2QXF A;  4JS5 A;  2RB6 A;  4B9X A;  3PNW C;  1G3Y A;  2MWO A;  3M9Q A;  3FIF A;  3OS5 A;  3L2Z A;  3LWI A;  1VQO A;  1VQK A;  4PJO C;  4M78 B;  3FC3 A;  3MEW A;  1FWZ A;  1OYX A;  5IT9 E;  2WAC A;  4MZT A;  2E41 A;  2P0K A;  3CME T;  1GXI E;  3X28 B;  2K5F A;  2JTF A;  5KCO A;  4QQG A;  3MO8 A;  3JB9 H;  4XTZ A;  3CCR T;  3RKW A;  4C0G A;  5KCH A;  3GNF B;  3JCM h;  4BI3 A;  1YCY A;  3C95 A;  3JB9 F;  4NL2 A;  3OYB A;  3P8B B;  2XI9 A;  3GPL A;  3MET A;  4A4G A;  5FRM A;  4C92 A;  4LDV A;  1UGR B;  2DD4 A;  2LX9 A;  5I21 A;  4EPC A;  5GAO l;  3P8H A;  3KUF A;  4M78 E;  3CPW S;  4JS4 A;  2B8A A;  4BAC A;  4ZN3 A;  3I55 A;  4L6V 5;  3CCJ T;  3NTK A;  3PMT A;  5GAN d;  2E70 A;  4PNO A;  3JCM e;  3QYH B;  3WXM B;  3M58 A;  4KBM B;  4M7D E;  2FYK A;  3FLG A;  4J7I A;  4C92 D;  4ZTF A;  1I5L A;  1WJQ A;  3UPU A;  1MHN A;  3FDR A;  4FL6 A;  4XQ3 A;  5CCA A;  3LWH A;  1K8A U;  2LC4 A;  2ZPF B;  4PLL A;  3QKJ A;  1YJN A;  4FT2 A;  3X25 B;  1M8V A;  3FB9 A;  1BIA A;  2MF2 A;  2QQS A;  3HFN A;  4CI0 C;  3CCQ A;  1K9M C;  4A4F A;  4M75 G;  3CCS A;  2I2L A;  2VXE A;  1YIJ T;  3A5Z B;  3CCQ T;  3HL8 A;  4IUQ A;  3TRE A;  1W2B A;  1VUB A;  1Q7Y C;  1N9S A;  4X34 A;  2RHX A;  3OYF A;  2EJF A;  2DKG A;  1I81 A;  2RJD A;  5CQX A;  1Q86 U;  1XOV A;  3C12 A;  3EFR A;  2GQV A;  4LD6 A;  5C6S A;  3J7A F;  4ME7 A;  3UDC A;  4N0A A;  2K5I A;  3OYY A;  1Y07 A;  3P8D A;  4C8Q A;  5LJ5 e;  2V8K A;  3OS2 A;  4HCC A;  3PT9 A;  4ELY C;  2LT4 A;  4PL6 A;  3LLR A;  3JCM X;  4ATO A;  3UWN A;  3O8V A;  1K73 U;  4F7U E;  3PIP A;  3OYE A;  2LCC A;  3I55 T;  3E9F A;  4E7L A;  4CRI A;  4QVZ A;  3GNG A;  1VQ5 T;  2FL7 A;  2VV5 A;  3GLX A;  5LJ3 j;  1VQM A;  3OY9 A;  2MAM A;  5LJ5 j;  3UT1 A;  4HCB A;  2WSF E;  3PIO A;  2C06 A;  4XTY A;  3CC2 A;  3RMS A;  5GAN e;  4KUD K;  2D9T A;  5CK9 A;  3BW1 A;  1WGS A;  3H8Z A;  5CKF A;  3SFM A;  4B9W A;  5DLQ E;  5LJ3 d;  2DJZ A;  4BE2 A;  1YJW T;  2E6N A;  4RCC A;  2P4T A;  3NTH A;  3OYC A;  4V2S A;  3TCJ A;  4MDX A;  2DO3 A;  2LCL A;  2EYQ A;  5GAN 5;  4FM4 B;  4M75 B;  4BI4 A;  4XU3 A;  1X75 C;  4F7U B;  3G71 A;  4LDW A;  1VQK T;  1KQ1 A;  1VQO T;  5I2S A;  3L2Q A;  3S3M A;  1MGQ A;  4C0F A;  3J80 E;  1P92 A;  3RKX A;  2IG0 A;  1TH7 A;  3C94 A;  2F5K A;  2K3Y A;  1QW1 A;  3SWN B;  2R5M A;  2OTL T;  2CKK A;  4PJO A;  1QVF S;  1W4S A;  2K57 A;  3G4S T;  2DXC A;  1QP3 A;  5LJ5 d;  2HNI A;  3CCM A;  5GAM j;  4YTL A;  2YRV A;  2XU8 A;  3S3O A;  2KK4 A;  4BDZ A;  1G3W A;  2Y90 A;  4XU1 A;  2WSC E;  1ZBX A;  3OYG A;  3CBP A;  3QJY A;  4IUU A;  4N0A C;  1VQ4 T;  1N27 A;  3JCM P;  1I8F A;  5GAM d;  3L2V A;  4PLI A;  5CIU A;  2X35 A;  5J3B A;  1KHI A;  4PJO D;  5CKD A;  4M7A A;  2EWN A;  1FX7 A;  4DOW A;  3LGF A;  2O4X A;  2ZCF B;  4LDY A;  4EDU A;  2LNV A;  1Y7X A;  4ZN1 A;  3RES A;  3PTA A;  4LD9 K;  2JN0 A;  4C5G A;  2XDD A;  2M16 A;  4RMO A;  3OS1 A;  1KHC A;  4EMK B;  1M90 C;  4M78 D;  2OTJ T;  4DA4 A;  4MML A;  3QDR B;  4M77 E;  1LOJ A;  4L5G A;  3CCU A;  5GAO q;  4M7D A;  2QA4 A;  1H3Z A;  1BI1 A;  5HK0 A;  3L2R A;  1N6A A;  2X4W A;  3OS0 A;  2CS7 A;  3F70 A;  1BKB A;  4XTU A;  4M77 D;  2XD0 A;  5GAO m;  4M7D C;  3M54 A;  3VU3 C;  3SD4 A;  1D3B A;  5KH6 A;  5LJ5 g;  4UC4 A;  3SDZ A;  3HPW A;  3OYD A;  1ZHI A;  3L2U A;  2CGH A;  5CQY A;  2OTJ A;  3A8H B;  4M75 F;  3M5A A;  1IZ6 A;  1VQL T;  3OYN A;  2RK2 A;  3G7Z A;  1M5Q 1;  4OB0 B;  3A8M B;  4BE0 A;  4C92 G;  2D6F A;  3JCM Q;  3CXC A;  5LJ5 f;  4M7D D;  4P5N A;  3OBW A;  1K73 C;  4F7U G;  4JRK A;  5GMK e;  2RI5 A;  2QTX A;  4M77 B;  3VUZ A;  1VQ4 A;  4WF2 A;  1UB4 A;  1B34 B;  3CBO A;  4R55 A;  1G3T A;  4QVC A;  5IN1 A;  4E7J A;  4F7U A;  1QVG A;  5GAN g;  4J8O A;  3V7C A;  2R5A A;  5CO7 A;  5I2M A;  1QP2 A;  1VIF A;  2FB7 A;  1WJS A;  2PVD B;  2VXF A;  1M90 U;  1O75 A;  1VQ7 A;  2QI2 A;  4BY6 C;  3OW2 S;  3V7S A;  4HA8 A;  1VQM T;  2LRQ A;  1VQ5 A;  1WJR A;  1RL2 A;  5GAN 6;  4PJO B;  3QSU A;  3JSC A;  4KT0 E;  2XIC A;  2XHC A;  3PFS A;  4DQ2 A;  2DVE A;  2GFU A;  2Y4Y A;  2RH2 A;  3LX7 A;  4E47 A;  4J6W A;  1WPY A;  2CZ7 B;  3G71 T;  3QJ6 A;  5GAM f;  1WQW A;  2DD5 A;  2ZPI B;  2P0Q A;  1VQ9 A;  4C5I A;  1JRI A;  2RM4 A;  4M78 C;  4OF1 A;  4A4H A;  2DIG A;  2GF7 A;  4C8Q F;  5L8R E;  2FHD A;  4MZM A;  5LL6 S;  3JCM V;  3JCM b;  2EQJ A;  4QQD A;  5CKH A;  3CCS T;  3EAE A;  4XU0 A;  3OMC A;  1OI1 A;  4BB7 A;  3CBM A;  3X24 B;  3I56 T;  4HKE A;  2HQE A;  2QQ9 A;  5GAN 8;  1YHQ A;  3CC2 T;  1YJN T;  2RHU A;  2DZC A;  2E5Q A;  4ELZ C;  3L42 A;  3MP1 A;  4Y91 A;  4QQ6 A;  3VJP A;  2O01 E;  3AHU A;  1V29 B;  5GAN h;  2LQ8 A;  4C5E A;  2JNG A;  3H6Z A;  1QVP A;  5FLX E;  4TVR A;  3CCJ A;  3HP9 A;  4MDW A;  2L89 A;  3QPH A;  4BDY A;  4BE1 A;  2VGN A;  1JJ2 A;  5IAY A;  5M9O A;  3T9N A;  2EQK A;  2K5L A;  4M7A E;  5CAI A;  3GIB A;  1JB0 E;  4E7I A;  3HKS A;  4ZGE B;  1KQS S;  1UGS B;  3PGG A;  2DZ9 A;  1BI2 A;  4OGE A;  1YHQ T;  4M7A D;  4RG8 A;  3JCM d;  4JUV A;  5J39 A;  3LGL A;  4J5Y A;  3OYH A;  2LVM A;  3QHS A;  2E65 A;  1YBY A;  2YHT A;  2EIF A;  5GMK i;  3J81 E;  4L59 A;  5GAO r;  3ASK A;  2VUB A;  2ZPH B;  1LNX A;  2E6Z A;  3L1A A;  3MEA A;  5KE3 A;  5DM7 R;  3OA6 A;  3CPW A;  1KG1 A;  4PJO F;  2E12 A;  1X6O A;  4M7A B;  4A4K A;  2DXB A;  3EFS A;  4X9D A;  5HKC A;  1Q82 U;  1Q86 C;  2GCX A;  1U1T A;  3OSS C;  3CXC S;  4A54 A;  4EMK A;  3LW5 E;  4RKU E;  4M78 F;  3LYI A;  1Q81 C;  2RJE A;  3CEY A;  3M4Y A;  4C92 F;  5HY6 A;  1JBM A;  1K9M U;  4IKF A;  3WVD B;  3CC4 T;  1M1F A;  2HBP A;  2KQW A;  1WNL A;  1YIT A;  1O9S A;  2RI2 A;  2DPP B;  3MP8 A;  2XKO C;  1BYM A;  4HT8 A;  4C8Q D;  2DIQ A;  4XTW A;  5GAN j;  3ZEH A;  3HRS A;  3JCM J;  2JVV A;  2KY9 A;  2BUD A;  2KDS A;  2OAU A;  5FU7 B;  4BY6 B;  2L3R A;  4J83 A;  2FVU A;  2G3R A;  2LT1 A;  2R58 A;  3ZFJ A;  3CCR A;  2KAF A;  4M75 A;  2QEX T;  3CME A;  2RA2 A;  5EG2 A;  3JCM f;  1NE8 A;  2A3L A;  3QBY A;  3RUX A;  3DLL A;  3CCV T;  3PMI A;  4BI8 B;  4BUG A;  3S6W A;  4C92 B;  3KXT A;  1VQL A;  1WQ7 A;  4J6Y A;  2EJ9 A;  2RD1 A;  2DTO A;  5LJ3 e;  2ZPB B;  2MMP A;  3OB9 A;  3CD6 A;  2RJF A;  3CCL A;  3JCM g;  1R8O B;  3HHT B;  4JRP A;  1NZ9 A;  2PUK B;  1KC8 U;  1Y96 B;  2CZ0 B;  4OMF B;  4RG2 A;  1FXX A;  2A7Y A;  3RIR A;  2HQX A;  4C8Q G;  1XTD A;  5FU6 C;  3OYA A;  3RER A;  3BY7 A;  3JAM E;  2QA4 T;  3VV0 A;  3CCU T;  2PUO B;  2DXU A;  2YLC A;  4Z02 A;  3BDL A;  5A0G A;  4O5V A;  1S72 A;  3CCL T;  3CCE A;  4C92 E;  5GAM h;  2PU9 B;  5D6X A;  3S3N A;  1KD1 C;  3V7R A;  3HSB A;  4DOV A;  5KE2 A;  3TU4 K;  1G5V A;  1XNI A;  1K8A C;  3CCV A;  4EMK C;  3MHX A;  1NPP A;  1JJ2 S;  2O4X B;  4IUR A;  4MZP A;  3A8G B;  4VUB A;  3JRZ A;  4C92 C;  2E64 A;  2NLU A;  4RCB A;  4QVD A;  3CC7 A;  3JCM W;  3L2W A;  4C0Z A;  1UGQ B;  3Q1J A;  3CC7 T;  1M1K C;  3MEU A;  4M7D B;  5J26 A;  4D6W A;  5CR2 A;  3CCM T;  2M0O A;  4II1 A;  5GAM g;  1QVF A;  3RKY A;  4KUL A;  4MMK A;  2V8J A;  4R56 A;  2DK3 A;  4A53 A;  1BI3 A;  3N5B B;  3QII A;  5GAN 4;  2CZ1 B;  1D3B B;  2JUF A;  2RHY A;  2HAX A;  3CC4 A;  4OB2 B;  1KQ2 A;  2K4Y A;  3MP6 A;  2K2V A;  4F7U F;  2L5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...