3CCRQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccrQ00
3CD6Q 1VQNQ 1VQKQ 1VQMQ 1W2BP 1QVFP 3CCSQ 3CCVQ 1K73R 3CC7Q 3CMEQ 3CCUQ 1Q7YR 1QVGP 1VQ4Q 1YI2Q 1YJWQ 3CCMQ 3CPWP 3CMAQ 3OW2P 1VQPQ 1VQ9Q 1VQLQ 3G4SQ 3CCLQ 3G71Q 2QEXQ 1S72Q 1VQ7Q 1VQ8Q 2OTJQ 1KQSP 3I56Q 1Q82R 1YJ9Q 3CCEQ 3CC2Q 1VQ6Q 1Q86R 1KC8R 1YJNQ 3CCJQ 1K8AR 3G6EQ 3CCQQ 1KD1R 3CC4Q 1VQOQ 1N8RR 1M1KR 1JJ2P 1YITQ 1VQ5Q 1K9MR 1YIJQ 3CCRQ 2QA4Q 1NJIR 2OTLQ 1YHQQ 1M90R 3I55Q 3CXCP 1Q81R
chains in the Genus database with same CATH superfamily
2HD0A 3V8KA 3HRSA 3G6ET 3E9GA 2ROLA 5HY6A 1FX7A 1PWTA 3HRUA 3V8JA 1I1JA 2X51A 2MOXA 3L2RA 1AZEA 3QZ9B 2RD1A 1LCKA 1Q86R 1RLQC 1B07A 1KC8R 2E3HA 4RTUA 2AHJB 1ZLMA 4N4HA 2EGCA 3C95A 1M90U 1HD3A 1PG5B 4XAXB 3G71T 2NUPA 2LC4A 3M0UA 3EGDB 4X9CA 1MHNA 4RKUE 1JRIA 1QVPA 5KYXA 2HBWA 3CPWP 3QJYA 4LN2A 2E10A 2LX7A 4M77B 4O6JA 1NJIC 4CC4B 1V76A 3MEVA 3OQ5A 2FRWA 1M1KR 2E4HA 3EG2A 3CCLT 2XIDA 1TU0B 2RQRA 3L2UA 2EYQA 4M78C 3I56T 3GP8A 4IIMA 2G3RA 3MJXA 2QA4A 4C92E 2VV5A 2KQWA 2P4TA 5GMKi 1TG0A 1UJYA 2GCXA 3JB9H 4J6WA 4XU1A 4C0DC 4CI0C 1UB4A 2DEQA 3AT1B 4DBFA 5EG2A 2KR3A 3KBGA 2E70A 2FPEA 2BZ8A 2PNIA 1UGVA 5M9OA 4M77G 1X2QA 1WHMA 1WJQA 4ZGJB 3H6ZA 3CCUA 5IT9E 3LYIA 3O8VA 4F16A 2O4XA 1KSWA 2NLUA 3KUFA 2CP3A 3EG0A 4M78E 1VQMT 3FJPA 1JB0E 4O5VA 3EHQA 2DYIA 1JU5C 3WVDB 4C8QD 5LJ3j 1QQJA 4M77F 1IB8A 3FLGA 2LTOA 4BACA 4HKEA 3JCMg 2ED1A 5IHKA 1AOJA 2M1HA 1YI2Q 1CKAA 4F04B 2GQIA 2PVOB 1YJWA 1K8AU 1VQLA 3CC2Q 3X26B 5KYNA 2EVRA 4M7AE 2VYTA 4M7DD 2KAFA 4Y28E 3DKMA 4KUDK 1Y0MA 2MIOA 3A5ZB 4M75C 4E7IA 3OS1A 2GNCA 1VQKA 3SD4A 3RKYA 4C8QE 3MKDA 1PCXA 3CD6T 1QVGA 2HL5C 2C0TA 5I2SA 2QQBA 1RUWA 2YLBA 5LJ3h 3OYKA 3OW2A 5GANg 4Z02A 1QCFA 1Q7YU 1RADB 4PNOA 1Q81R 1C1AA 4N4GA 4DOVA 4PL6A 4QVDA 1ZX6A 5LJ5g 1UUEA 1HK9A 2O9SA 2O4XB 2M9UA 1KD1C 4IUPA 5KYYA 5J39A 2QDLA 3NTHA 3PT9A 2D8JA 5IN1A 3REBB 2R58A 3JCMd 4M75E 3QZ5B 4X1VA 4HCCA 2KROA 1IXDA 5CR2A 1WJSA 4L5GA 4E47A 2CT3A 2DIGA 1ZUYA 1VQ6T 2H8HA 1S1NA 2AZVA 3L2ZA 4FYYB 2YUPA 3CCEA 1QWEA 1Y71A 2EBPA 3CMEA 1Y7XA 1WX6A 2V1QA 1WXBA 2LMJA 1VQPA 3NTKA 2LDMA 4BDYA 4PK4A 3G6EQ 2DXBA 2KEAA 2F5TX 2A3LA 1OOTA 1K9MR 2EJGA 3J80E 1AWWA 2VWFA 1PM3A 3EH2A 1UTIA 5FU6B 5KYWA 4KGZB 1NPPA 4C92A 3G71Q 2F2VA 2OX7A 1SHFA 3OYFA 2HMAA 2RQWA 3VRYA 5GANd 3CBPA 1M90C 3TU4K 3JSCA 5GMKm 1MGQA 2A08A 5IXBA 5LJ5d 3FRNA 1X6BA 1W2BP 3DB3A 1JXOA 3NGPA 4JLGA 2FYKA 3CCLQ 5KYYB 1MNEA 1TWBA 3A8MB 2C06A 3BDLA 2JXBA 4M78A 3VRZA 2FRYA 4JJCA 1SHGA 1WHJA 1IREB 4IUTA 5LL6S 3CCQT 4QQ6A 1RAGB 4ELZC 5KCHA 3EH1A 3EG3A 1X69A 4WTOB 4RTYA 2P84A 2EQJA 1YJNQ 2COYA 3OYMA 1YCYA 2DD5A 3HPWA 3CMAT 3VS0A 4JRPA 2RI5A 3JB9I 3M57A 4M7AA 1QVFS 1G3WA 1KQSA 4QVZA 2MWOA 2EIFA 2AKKA 1VQMQ 4C92B 4BY6B 3PNWC 3CCMA 3OYLA 1Q82R 4OGCA 5CQXA 4Q5WA 2LCLA 3G1JA 1M2OA 2WSCE 1BYMA 3PGGA 5D7UA 4ZN3A 3I56A 5CKHA 2O88A 4OMFB 2VGMA 4BE0A 3CEYA 2RHZA 4FL6A 3EG1A 2ED0A 2V26A 2DO3A 2QG9B 5GAN6 3RNJA 2DBMA 3OYAA 1K8AC 3AHUA 2EQMA 4LUDA 1QWFA 2AKLA 2V8IA 1ZSZC 4AFZC 1SG5A 5HKCA 1N8RU 2O9VA 1N6AA 1LOJA 4PFOA 2GQVA 4M75A 3VV0A 1JQQA 2DL7A 3A8LB 1Q95G 2JM9A 5CIUA 1OYXA 2DK3A 3CD6Q 2DD4A 2DE0X 2C0OA 4PJMA 3MP8A 3A8GB 2L3RA 3VUBA 2XDDA 4KULA 1IO6A 1VQ4T 2NUTA 4M7AB 2PZ1A 1Q7YC 3PE0A 2L0AA 2PTKA 1BKBA 2EJ9A 2J05A 3OYDA 4C8QB 4F17A 1VQ6Q 3I5SA 1YCSB 1U8RA 3SHWA 4D8KA 4FW1A 2E65A 3H8ZA 2VASA 3VS1A 1N9RA 4AFSC 1YHQA 2D0NA 3N5BB 5IH2A 4M7AG 4M7DB 2OTJA 1Y96A 2EW3A 5GAMj 4LDUA 1RAIB 3NFCA 1YJWT 1U1SA 4B9XA 1VQLT 2I0NA 3HFOA 3LX7A 4V2SA 4C8QG 4M7AF 1D1AA 1VQ9Q 3PMIA 2R5AA 1IGUA 4XTWA 4JJBA 3QKJA 2LRQA 2FHDA 1VQKT 1U3OA 1QCNA 1EX4A 4C8QF 4JS5A 1NJIR 1SF9A 5GANf 4MZTA 3C0CA 3OYGA 3GBQA 5J3BA 2RQUA 4M7DG 2EKHA 3M54A 2FO0A 5LJ5f 3LGLA 4LDWA 2EQIA 3CC7A 1IHWA 3GNFB 1WIEA 3R6NA 2R57A 2LCSA 4KH1B 2JT4A 1H92A 1I81A 5KYUA 4M7DF 2RJFA 5GAN4 1X6OA 4LDVA 3ZBDA 1ARKA 3EGXB 4LXCA 3CCSQ 4J9DA 2O2OA 2H3JA 4J5YA 3MEUA 3CMAQ 1D3BA 1U5SA 1VQ8Q 1FMVA 2CSQA 3VU3C 1ZUKA 4Z89A 3LH0A 2PVGB 2ATCB 2AZSA 3CMET 3S6WA 3GPLA 2DNUA 3VS7A 1H3HA 2CH4A 2RHYA 3CCJA 2KE9A 4PFZA 2YWWA 1TH7A 2FZCB 1VQ5A 2L3PA 3GNGA 4FU6A 2PVDB 4OF1A 3A98A 3MHXA 4A4EA 1W1FA 2FEIA 4PJOC 4QVCA 2XDBA 3I5RA 3VS2A 2VKNA 1JBMA 4TVRA 2QI2A 4RG2A 1AZGB 2XHCA 1ZQ1A 3CCQA 3GIBA 4A4KA 2EYYA 3V7SA 4GLKA 2P0KA 4C0GA 1CKBA 1ZSZA 1UE9A 4GBQA 5CCAA 1JO8A 3SWNC 3OYEA 2YLCA 1Q86U 2XU8A 3QWYA 1MMDA 1N8RC 4IURA 4UC4A 4HCBA 5GAN8 1MUZA 4FIBA 2GFUA 4EPCA 4N0AC 5DY9A 1JJ2P 2CH4W 2QA4Q 5FLXE 3CC4A 3CXCP 2J6FA 2X4XA 2YSQA 4J9GA 1NG2A 3QYGB 2MAMA 3HRTA 2M51A 1OEBA 4OMOA 3TVTA 1UG1A 4E7JA 2KK4A 4VUBA 3M4GA 1RAAB 4C92D 2MPXC 4ORZA 1G8XA 2JZ2A 4RTZA 4XTVA 3WVEB 4ELYC 4AFQC 2IPOB 4E7HA 3LWIA 3QUIA 3CCUQ 2L8DA 3L2QA 1OV3A 2EFIA 4F7UA 3L42A 1GXIE 2DJQA 2DXUA 2SEMA 3CCMT 4LUEA 4Y91A 4OMMA 1UFFA 3CBOA 1UHCA 2HQHA 2V1RA 4M78D 5GAOr 1QMCA 2CSIA 2ECZA 2KMTA 2HNIA 1YJWQ 2AIRB 1NYFA 1MV0B 1VQLQ 3OY9A 3L2VA 1VQ4A 3QIIA 3T9NA 7AT1B 4E2FB 1WPYA 2BE7D 3S3MA 1QKWA 4A4FA 3G7ZA 3U23A 1SRMA 2YUNA 3UPUA 3Q1JA 4RTWA 2YUOA 2CP6A 4QKUA 2K9GA 5KCOA 1M90R 1WJRA 1VQKQ 2L2PA 2DF6A 1BI3A 1BB9A 2OTLA 4M7AD 3M0SA 2M02A 3HP9A 1T0HA 2F5KA 1I5OB 4KH0B 1ACMB 3E2UA 2CREA 1W4SA 5GAN3 3C4SA 1MMNA 2NUPB 2RJDA 1UDLA 1YITA 1WLPB 1VIEA 2Y4YA 3QPHA 2XK0A 4AFUC 5KYXB 1K76A 1CSKA 2RI2A 2DERA 3VS3A 4KUIA 1K1ZA 5I2MA 3MEWA 1X27A 4R55A 3M9QA 2KI7A 1BI2A 3INZA 4A53A 1G5VA 2QQAA 1KHIA 2ESWA 1K9AA 2CKKA 3CCEQ 2DPPB 3REAB 5GAOl 4DBHA 4XK8E 3CMEQ 4M75D 4LDYA 3PFSA 3EHRA 1VQPQ 2JVVA 3RERA 1N27A 4YTLA 2G6FX 2GFAA 1YHQT 1VQNT 1S72A 3VS6A 2DVEA 2ZZDA 1D0XA 2OTJT 1SSFA 3QHSA 1UHFA 1T3LA 2E6NA 5GAMg 3OYYA 1G3TA 1MV3A 3A1PA 2HQEA 4EMHA 1M1GA 2CS7A 2V8JA 3LLRA 2RNAA 4HCKA 5FW9A 3EGUA 1G3YA 1PRMC 2XI9A 4J9IA 4GLMA 3LGFA 4PKCC 3S3NA 5FU7B 4FCYA 1BIAA 4J9CA 3SWNA 3OS0A 1Q86C 1YWOA 1OX8A 4LD9K 2FB7A 1O9SA 4MZMA 3PMTA 1PKTA 2CUBA 3FJ5A 1PNJA 3V7RA 1OZ3A 3EFOA 3CC7T 3NMZC 1SKUB 4HT8A 4PLLA 4ATOA 2B86A 2JNGA 1VQ7T 3RMQA 4AT1B 1AVZC 4HVVA 4ZNXA 4FT2A 3BE3A 1GFDA 2NWMA 1R0CB 2F69A 2RMOA 1Q7YR 2CZ7B 4FSXA 4EMKC 5CVIA 1OU9A 2RF0A 3M0QA 1WFWA 4FT4A 4A63B 2KSSA 4PJNA 1NE8A 2YT6A 4J8OA 4CRIA 4RMOA 4J6XA 2QGGA 1YIJA 3IQLA 3V8LA 4EIKA 3LWHA 3CCMQ 3CCJT 2RJCA 2CP2A 1VQ5T 4A54A 3I56Q 4JRIA 3OS2A 2DXTA 4LDXA 3QBYA 3OBWA 4OP0A 2J7IA 3VKIA 1OU8A 1X75C 3SEMA 1UJ0A 4II1A 3HFNA 3UA7A 1K73U 2QXFA 1W6XA 1KQ1A 5J26A 4BI8B 3JCMe 1HJDA 1WXTA 2X9HA 1Q82U 1B3QA 3EAEA 4NL2A 2COZA 1NZ9A 3EFOB 1QVFA 4OB2B 3CBMA 5GJVB 1SEMA 4PJJA 1I0CA 2LQWA 3H0IA 9ATCB 1YJ9T 1NYGA 2X4JA 2JMCA 4FM4B 5KYWB 3JB9J 1H8KA 3CC4T 2F2XA 2YHTA 2MI6A 2XDPA 2ZPFB 3FIFA 3JCMb 4RTTA 1R0BG 1JJ2S 2DTIA 3E1SA 2MWPA 1M8VA 3CXCS 4ZTFA 2RJEA 4WCIA 4C5EA 5GANe 1XQHA 2QTXA 1VQOA 3OBYA 2P0QA 1KFZA 2L3SA 4C0ZA 3RDVA 5LJ5e 1WA7A 1PSFA 2DZ9A 1WHHA 2KRSA 2DTHA 2LJ0A 4M78B 2HEQA 4B9WA 2LT4A 1GL5A 4XTXA 4C92G 2HCKA 2RH2A 4M77C 2ZPBB 1YHQQ 2JOYA 3PIPA 1V29B 1MMGA 4C0DB 3MO8A 1U1TA 3VS4A 3CPWS 1EIFA 3BY7A 2GTOA 2HL3A 2CZ0B 3VS5A 2OTJQ 2M16A 2BZYA 3OSSC 2PUKB 2DJZA 4C92F 2RO0A 2QEXA 3CCVT 2M0YA 2LP5A 3FEOA 3UDCA 5HCKA 2QQ9A 3OYJA 1N9SA 3PIOA 2X3WD 1X43A 2RPNA 1ZBJA 3OYHA 4JS4A 5GAOm 1TXQA 1WQWA 2IVWA 1M5Q1 2NYSA 4M78G 5HK3A 4FSSA 5AYFA 2KNBB 4X9DA 2OTLT 4M77E 2DM1A 2QQSA 4BI3A 2KVQG 1PHTA 3D7SB 1DJ7B 3M56A 2DA9A 2KY9A 4M4ZA 2DFUA 4OB3B 5D6YA 1N8RR 2XD0A 4M78F 2GGRA 4C0FA 1KK7A 1K0SA 4KT0E 1C6VX 5CKFA 3CC7Q 4WF2A 4IUQA 2RQVA 1VQNA 1UGSB 4J6YA 4BE2A 1YITT 3X25B 2PQWA 3TSWA 3M55A 5LJ3g 3JRZA 4RCBA 4NL3A 1BIBA 1FYNA 5GJWB 4R0KA 2LJ1A 4KGVB 1NLOC 4BI4A 4M75B 4B6MA 2DILA 1B7TA 2LT1A 5KH6A 2WSEE 2VXFA 1RAHB 2EQKA 2P4RA 3SFMA 1QVGP 1XOVA 5GANj 1D1CA 1WHGA 3OW2P 1KG1A 8AT1B 3JCMh 4QW2A 1UGRB 4F7UE 4EMGA 3DLMA 1KHCA 1M1FA 3MCAB 3RKWA 1M3AA 2K5FA 5LJ5j 2EYXA 3NHNA 2NUTB 3CCJQ 2RI3A 1D1BA 1GBQA 2ZPHB 3J81E 1VQ5Q 1S72T 1TSFA 4OMLA 4J9BA 2KRMA 4DBRA 3QO3A 2MMPA 3OYNA 5GAMf 4XU0A 1G83A 2HBPA 4M75G 1VQ7A 1M3BA 3MEAA 4RG8A 3CCQQ 2WSFE 2Y90A 1K73C 2DKGA 5GAN7 2LJ3A 1VYUA 4M75F 3DLLA 4QT7A 5GANh 2HSEB 3JCMc 3VUZA 4IKFA 1OULA 2X4YA 2E6ZA 4ZN1A 3FB9A 2Z0WA 3JCMX 2KYMA 1Y96B 3C94A 2LNHB 5LJ5h 1M2VA 1I07A 3EFSA 3CC4Q 1M9SA 1VA7A 1WHKA 4NS5A 2QTVA 3H41A 3M59A 3X28B 3QYHB 3GLXA 3URGA 3CCRA 4RTVA 1X6GA 2A37A 2EAYA 2PU9B 2RHIA 3F70A 2A36A 2X4WA 5CKEA 2A28A 2D9TA 4XTUA 3VYHB 4MMLA 3TCJA 4QQDA 5FU6C 1UGQB 4Z8AA 1YBYA 4JZ3A 1LNXA 3ZL7C 2RHUA 2GBQA 4MDWA 5A2QE 2HKQB 3ULRB 1HXDA 4DEYA 2EYZA 1VOMA 5C6SA 2BIVA 5ECAA 1ZBXA 2EGEA 2KGTA 3EGDA 1OX9A 4NOYA 1KQ2A 1YIJT 4EDUA 1KC8U 1TOVA 4L59A 3BFMA 2FZKB 4M77A 2E1HA 1BI0A 1OQKA 5KYUB 2OAUA 1OPLA 3UWNA 1YJ9A 1GBRA 2J06A 4HT9A 3RMSA 3ZFJA 1T3SA 1GRIA 3OMGA 1W2BS 2MYSA 5FROA 2K7AA 3R6OA 3OA6A 1RAEB 4PJOE 4DQ2A 4L6V5 1VQ4Q 3HKSA 3HSBA 3I55A 2ENMA 1RABB 2B8AA 1D3BB 2DXCA 1TUDA 1FXXA 2LX9A 1PD1A 1KQSP 2K6DA 1M8MA 1M1KU 2EJFA 3BW1A 1KD1R 2YRVA 3ER0A 1VIFA 2OTLQ 2D8HA 2K4YA 4IUUA 1ABOA 3J7AF 3QWXX 2JMAA 3OYBA 3M58A 3G4SA 3RKXA 4C92C 4BY6C 4BDZA 2HSPA 3H9NA 8ATCB 3THKA 4OGEA 1Y57A 4J9FA 1YITQ 5GAOn 1LVKA 3E19A 3I35A 2LQNA 5CKBA 5CK9A 1ZSZB 4RTXA 2CP7A 3CPFA 2EGAA 4HVWA 2XG8D 3CCVA 3MP1A 1VQOT 4J7FA 1H641 1OPKA 2CP5A 2E5KA 2EWNA 2DL5A 1OZ2A 2C0IA 1SRLA 2OAWA 2DIQA 5I21A 2L3QA 2LZ6B 1M4ZA 2HQXA 5CQYA 5A0GA 2RN8A 2CUDA 2DLPA 2K3YA 1I8FA 1S72Q 2JUFA 1WHLA 1ZHIA 3JCMJ 1T0JA 3ZEHA 4DA4A 3H0HA 2M0OA 2VC8A 2KRNA 3PTAA 2K3BA 2DETA 4ZTJA 2QEXT 2GTJA 1YWPA 1ABQA 2YXYA 3JCMQ 3CQTA 1WNLA 1F1BB 1XTDA 2ZCFB 3OYCA 4JRQA 2NUZA 1YJNT 4M7AC 3H0FA 2IG0A 1GFCA 1W70A 2A0FB 2QDYB 4IUVA 1RI0A 2XMFA 2CZ1B 4F7UB 3QXEB 1QP2A 4C5HA 4CC2A 5AT1B 1IZ6A 2FPDA 3OB9A 4J83A 4JJDA 2MF2A 2PUOB 4C8QC 2XICA 2FPFA 1Q81U 2JJ9A 2DRMA 2YRDA 3I9QA 2P0PA 2DRKA 2D6FA 2ZPGB 2DBKA 5IHIA 4J9HA 5LJ3f 1NPRA 4XU2A 1I5LA 1BCMA 1XJWB 2BKDN 1WI7A 2I2LA 1WDXA 3OYIA 2VB6A 1TUCA 2ZPEB 4M7DC 1SSHA 3UA6A 5GAN2 3QDRB 2LQ8A 2DVJA 4F7UG 4KGXB 2CYZB 2X3XD 3JB9D 4PJOA 1Y07A 3RR6A 4BUGA 4BB7A 5EC7A 1KJWA 4E7KA 1E7OA 5DLQE 3EFRA 4E7SA 2GF7A 4PFPA 4E7ZA 2K5IA 1JEGA 4F7UF 1K8AR 3PVLA 1K9MU 5FRNA 3LH5A 1MNDA 4RUGA 3TEEA 1YIJQ 1VYVA 3X24B 2BUDA 1FMKA 3META 4N4IA 1QVGS 3HTRA 1H3ZA 3OW2S 5FWBA 2O01E 1KC8C 1YI2A 4M7DE 2DAQA 2JW4A 4N0AA 4D6WA 1AWJA 3WXMB 1EZZB 3CC2A 5KE2A 5I22A 2MK5A 4DBQA 3P8HA 2DL8A 4DEXA 3E9FA 1M30A 1NM7A 4F14A 2QASA 3M53A 3FC3A 4CC7A 2R5MA 1FWZA 1YNZA 3JCMW 2RA2A 1P92A 1MMAA 3OS5A 3RBBB 4AG2C 1UEBA 3PVQA 1M1KC 2RM4A 3DB4A 1OI1A 4AMCA 1IRXA 5GMKe 2FG0A 4OMNA 1X2KA 4JLIA 3UT1A 2MCNA 5GAMd 4PJOB 4R56A 3TSZA 2BE9B 4JZ4A 1ZA1B 2JN0A 1PD0A 2SRCA 2KXCA 3CCRT 5KE3A 4E7LA 4E6RA 2ABLA 2BTTA 1NBEB 2J6OA 1BBZA 1BCOA 1VQ9T 1VQOQ 5I11A 3SWNB 1IGQA 3TQ7P 3V7CA 2HAXA 1EFNA 2KYBA 1VYTA 1GCQC 2OI3A 2HKNA 4P5NA 2KT1A 3GOXA 2JTMA 1AWXA 1QKXA 5FWCA 1RLPC 5FRMA 2CT4A 2HZYA 5D6WA 3MPUB 2E41A 4PJOG 3M0RA 3G6EA 1RL2A 1XNIA 2K2VA 1LJOA 4Y92A 3RUXA 4HVUA 2DTOA 2E3IA 3OSVA 5GAOq 2DEUA 1WQ7A 3QJ6A 1JJ2A 2QEXQ 4PJOF 3P8BB 4Z88A 4D8DA 5DM7R 3CXCA 1X01A 3I55T 3G71A 3CCST 1G2BA 1E6GA 4BD3A 2L89A 1IHVA 2LQKA 4JUVA 1VQ8T 1AEYA 2DZCA 2E64A 5CO7A 3S3OA 3QSUA 5CKDA 2KXDA 4X34A 4XU3A 1K73R 2DYBA 4CC3A 2JTFA 5DLOA 5GAMe 1KQSS 3O5ZA 4C8QA 3NTIA 3X20B 3CCLA 4J9EA 4OB1B 2ZGWA 3M0TA 4LNPA 1Q81C 4HA8A 2RHXA 3CPWA 3FDRA 3G4ST 2K57A 5D6XA 2Y4XA 4M77D 2DL3A 5GMKj 2QK0A 1VQNQ 4IIOA 4A4HA 1LPLA 1V1CA 3GF5A 2HDAA 3UF4A 4PJLA 2K79A 2OJ2A 5IHNA 4A4GA 4M7DA 2VVKA 2FL7A 2RB6A 3HHTB 3RESA 2JTEA 1YFNA 2YDLA 1YJNA 2L5QA 1BU1A 3M4YA 2D1XA 4GY5A 3HL8A 3ASKA 4JRKA 3OMCA 2EPDA 5C0MA 2YRCA 2LCCA 1D09B 1VQMA 1BK2A 1N5ZA 2QA4T 3A8HB 1C0MA 1R8OB 3EG9A 5L23A 1K9MC 2K3XA 2ZAEA 1NEGA 1E6HA 4PLIA 3SB2A 6AT1B 5GMKh 2KBTA 2FVUA 2CZ6B 2K2MA 1D0YA 1TTHB 2XKOC 1UGPB 4HXJA 1RI9A 4JJNK 4OMQA 2DL4A 1PC0A 1I4K1 4KRTA 2ZPIB 4BE1A 2RK1A 4K11A 1BI1A 1PKSA 1VQ7Q 1NLPC 4RCCA 4C5IA 2W10A 1WXUA 3CCUT 1PRLC 1NJIU 2KT8A 2F2WA 1QP3A 4OB0B 3L2WA 3SDZA 2F1LA 3JCMf 2D0QB 1JXMA 3EGXA 4EMKA 5IAYA 1PSEA 3JV3A 2QYZA 2EKOA 2JS0A 3CD6A 4ZGDB 3KFVA 4LD6A 2E12A 1K0XA 1ZSGA 1YN8A 3QG1A 4MDXA 1WZOA 3VYGA 1AWOA 4C5GA 3M0PA 3JCMP 4QQGA 2W0ZA 2WACA 3CCRQ 2LVMA 1M27C 4ME7A 4MMKA 2E5QA 3P8DA 3A8OB 2O31A 5HK0A 3LW5E 2RK2A 4FYVB 1SPKA 3EG9B 1A0NB 2JS2A 1GCPA 3MP6A 1YP5A 4FYXB 2EQUA 2IIMA 1HYOA 4JDSA 1QCOA 2AK5A 1VQ6A 1GCQA 3TREA 4FYWB 1QW1A 4FW2A 1B34A 3UATA 1Q82C 5LJ3d 2COWA 5FU7C 4AG1C 3JB9G 1AD5A 1G3SA 4XTYA 1YJ9Q 2A7YA 5GAMh 3BDUA 1KIKA 4ZGEB 2V8KA 1YI2T 1QLYA 2ROTA 4MZPA 2VXEA 3NPFA 1RAFB 1TUGB 4EMKB 2FZGB 5GAN5 2AT1B 3I55Q 1UECA 3JB9F 2QAZA 4HCZA 3CC2T 2QQRA 4DOWA 2H3EB 1VUBA 5A0LA 3RIRA 3CCET 1VQ9A 2K5LA 4PJOD 4XQ3A 1AT1B 4J7IA 4KBMB 3JAME 1VQPT 3JCMV 3KXTA 1NEBA 3QDFA 1AHJB 5GAOp 5A0DA 2EYWA 1O75A 3L1AA 1WGSA 1ZA2B 3C12A 1U06A 2VGNA 3G4SQ 1Z9QA 2CP0A 2JM8A 1KD1U 4LE9A 2DX1A 3M5AA 1W2BA 1D0ZA 4JPBW 1J3TA 1K4US 3ME9A 1R77A 1FMWA 1ZUUA 2YUQA 2VUBA 5L8RE 2KDSA 5IXFA 1B34B 1Z9ZA 2X35A 2BZXA 4ESRA 1QVFP 3CCVQ 4ANJA 1RACB 2RQTA 2CGHA 3CCSA 1M3CA 2LNVA 4OMPA 4OVAA 2QGFB 5LJ3e 3CMAA 1M2VB 3VJPA 1VQ8A 1HSQA 2J6KA 4XTZA 1TS9A 2DMOA 5GMKl 5CAIA 1WYXA 2CDTA
chains in the Genus database with same CATH topology
3CD6Q 1VQNQ 1VQKQ 1VQMQ 1W2BP 1QVFP 3CCSQ 3CCVQ 1K73R 3CC7Q 3CMEQ 3CCUQ 1Q7YR 1QVGP 1VQ4Q 1YI2Q 1YJWQ 3CCMQ 3CPWP 3CMAQ 3OW2P 1VQPQ 1VQ9Q 1VQLQ 3G4SQ 3CCLQ 3G71Q 2QEXQ 1S72Q 1VQ7Q 1VQ8Q 2OTJQ 1KQSP 3I56Q 1Q82R 1YJ9Q 3CCEQ 3CC2Q 1VQ6Q 1Q86R 1KC8R 1YJNQ 3CCJQ 1K8AR 3G6EQ 3CCQQ 1KD1R 3CC4Q 1VQOQ 1N8RR 1M1KR 1JJ2P 1YITQ 1VQ5Q 1K9MR 1YIJQ 3CCRQ 2QA4Q 1NJIR 2OTLQ 1YHQQ 1M90R 3I55Q 3CXCP 1Q81R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Q;  1VQN Q;  1VQK Q;  1VQM Q;  1W2B P;  1QVF P;  3CCS Q;  3CCV Q;  1K73 R;  3CC7 Q;  3CME Q;  3CCU Q;  1Q7Y R;  1QVG P;  1VQ4 Q;  1YI2 Q;  1YJW Q;  3CCM Q;  3CPW P;  3CMA Q;  3OW2 P;  1VQP Q;  1VQ9 Q;  1VQL Q;  3G4S Q;  3CCL Q;  3G71 Q;  2QEX Q;  1S72 Q;  1VQ7 Q;  1VQ8 Q;  2OTJ Q;  1KQS P;  3I56 Q;  1Q82 R;  1YJ9 Q;  3CCE Q;  3CC2 Q;  1VQ6 Q;  1Q86 R;  1KC8 R;  1YJN Q;  3CCJ Q;  1K8A R;  3G6E Q;  3CCQ Q;  1KD1 R;  3CC4 Q;  1VQO Q;  1N8R R;  1M1K R;  1JJ2 P;  1YIT Q;  1VQ5 Q;  1K9M R;  1YIJ Q;  3CCR Q;  2QA4 Q;  1NJI R;  2OTL Q;  1YHQ Q;  1M90 R;  3I55 Q;  3CXC P;  1Q81 R; 
#chains in the Genus database with same CATH topology
 2HD0 A;  3V8K A;  3HRS A;  3G6E T;  3E9G A;  2ROL A;  5HY6 A;  1FX7 A;  1PWT A;  3HRU A;  3V8J A;  1I1J A;  2X51 A;  2MOX A;  3L2R A;  1AZE A;  3QZ9 B;  2RD1 A;  1LCK A;  1Q86 R;  1RLQ C;  1B07 A;  1KC8 R;  2E3H A;  4RTU A;  2AHJ B;  1ZLM A;  4N4H A;  2EGC A;  3C95 A;  1M90 U;  1HD3 A;  1PG5 B;  4XAX B;  3G71 T;  2NUP A;  2LC4 A;  3M0U A;  3EGD B;  4X9C A;  1MHN A;  4RKU E;  1JRI A;  1QVP A;  5KYX A;  2HBW A;  3CPW P;  3QJY A;  4LN2 A;  2E10 A;  2LX7 A;  4M77 B;  4O6J A;  1NJI C;  4CC4 B;  1V76 A;  3MEV A;  3OQ5 A;  2FRW A;  1M1K R;  2E4H A;  3EG2 A;  3CCL T;  2XID A;  1TU0 B;  2RQR A;  3L2U A;  2EYQ A;  4M78 C;  3I56 T;  3GP8 A;  4IIM A;  2G3R A;  3MJX A;  2QA4 A;  4C92 E;  2VV5 A;  2KQW A;  2P4T A;  5GMK i;  1TG0 A;  1UJY A;  2GCX A;  3JB9 H;  4J6W A;  4XU1 A;  4C0D C;  4CI0 C;  1UB4 A;  2DEQ A;  3AT1 B;  4DBF A;  5EG2 A;  2KR3 A;  3KBG A;  2E70 A;  2FPE A;  2BZ8 A;  2PNI A;  1UGV A;  5M9O A;  4M77 G;  1X2Q A;  1WHM A;  1WJQ A;  4ZGJ B;  3H6Z A;  3CCU A;  5IT9 E;  3LYI A;  3O8V A;  4F16 A;  2O4X A;  1KSW A;  2NLU A;  3KUF A;  2CP3 A;  3EG0 A;  4M78 E;  1VQM T;  3FJP A;  1JB0 E;  4O5V A;  3EHQ A;  2DYI A;  1JU5 C;  3WVD B;  4C8Q D;  5LJ3 j;  1QQJ A;  4M77 F;  1IB8 A;  3FLG A;  2LTO A;  4BAC A;  4HKE A;  3JCM g;  2ED1 A;  5IHK A;  1AOJ A;  2M1H A;  1YI2 Q;  1CKA A;  4F04 B;  2GQI A;  2PVO B;  1YJW A;  1K8A U;  1VQL A;  3CC2 Q;  3X26 B;  5KYN A;  2EVR A;  4M7A E;  2VYT A;  4M7D D;  2KAF A;  4Y28 E;  3DKM A;  4KUD K;  1Y0M A;  2MIO A;  3A5Z B;  4M75 C;  4E7I A;  3OS1 A;  2GNC A;  1VQK A;  3SD4 A;  3RKY A;  4C8Q E;  3MKD A;  1PCX A;  3CD6 T;  1QVG A;  2HL5 C;  2C0T A;  5I2S A;  2QQB A;  1RUW A;  2YLB A;  5LJ3 h;  3OYK A;  3OW2 A;  5GAN g;  4Z02 A;  1QCF A;  1Q7Y U;  1RAD B;  4PNO A;  1Q81 R;  1C1A A;  4N4G A;  4DOV A;  4PL6 A;  4QVD A;  1ZX6 A;  5LJ5 g;  1UUE A;  1HK9 A;  2O9S A;  2O4X B;  2M9U A;  1KD1 C;  4IUP A;  5KYY A;  5J39 A;  2QDL A;  3NTH A;  3PT9 A;  2D8J A;  5IN1 A;  3REB B;  2R58 A;  3JCM d;  4M75 E;  3QZ5 B;  4X1V A;  4HCC A;  2KRO A;  1IXD A;  5CR2 A;  1WJS A;  4L5G A;  4E47 A;  2CT3 A;  2DIG A;  1ZUY A;  1VQ6 T;  2H8H A;  1S1N A;  2AZV A;  3L2Z A;  4FYY B;  2YUP A;  3CCE A;  1QWE A;  1Y71 A;  2EBP A;  3CME A;  1Y7X A;  1WX6 A;  2V1Q A;  1WXB A;  2LMJ A;  1VQP A;  3NTK A;  2LDM A;  4BDY A;  4PK4 A;  3G6E Q;  2DXB A;  2KEA A;  2F5T X;  2A3L A;  1OOT A;  1K9M R;  2EJG A;  3J80 E;  1AWW A;  2VWF A;  1PM3 A;  3EH2 A;  1UTI A;  5FU6 B;  5KYW A;  4KGZ B;  1NPP A;  4C92 A;  3G71 Q;  2F2V A;  2OX7 A;  1SHF A;  3OYF A;  2HMA A;  2RQW A;  3VRY A;  5GAN d;  3CBP A;  1M90 C;  3TU4 K;  3JSC A;  5GMK m;  1MGQ A;  2A08 A;  5IXB A;  5LJ5 d;  3FRN A;  1X6B A;  1W2B P;  3DB3 A;  1JXO A;  3NGP A;  4JLG A;  2FYK A;  3CCL Q;  5KYY B;  1MNE A;  1TWB A;  3A8M B;  2C06 A;  3BDL A;  2JXB A;  4M78 A;  3VRZ A;  2FRY A;  4JJC A;  1SHG A;  1WHJ A;  1IRE B;  4IUT A;  5LL6 S;  3CCQ T;  4QQ6 A;  1RAG B;  4ELZ C;  5KCH A;  3EH1 A;  3EG3 A;  1X69 A;  4WTO B;  4RTY A;  2P84 A;  2EQJ A;  1YJN Q;  2COY A;  3OYM A;  1YCY A;  2DD5 A;  3HPW A;  3CMA T;  3VS0 A;  4JRP A;  2RI5 A;  3JB9 I;  3M57 A;  4M7A A;  1QVF S;  1G3W A;  1KQS A;  4QVZ A;  2MWO A;  2EIF A;  2AKK A;  1VQM Q;  4C92 B;  4BY6 B;  3PNW C;  3CCM A;  3OYL A;  1Q82 R;  4OGC A;  5CQX A;  4Q5W A;  2LCL A;  3G1J A;  1M2O A;  2WSC E;  1BYM A;  3PGG A;  5D7U A;  4ZN3 A;  3I56 A;  5CKH A;  2O88 A;  4OMF B;  2VGM A;  4BE0 A;  3CEY A;  2RHZ A;  4FL6 A;  3EG1 A;  2ED0 A;  2V26 A;  2DO3 A;  2QG9 B;  5GAN 6;  3RNJ A;  2DBM A;  3OYA A;  1K8A C;  3AHU A;  2EQM A;  4LUD A;  1QWF A;  2AKL A;  2V8I A;  1ZSZ C;  4AFZ C;  1SG5 A;  5HKC A;  1N8R U;  2O9V A;  1N6A A;  1LOJ A;  4PFO A;  2GQV A;  4M75 A;  3VV0 A;  1JQQ A;  2DL7 A;  3A8L B;  1Q95 G;  2JM9 A;  5CIU A;  1OYX A;  2DK3 A;  3CD6 Q;  2DD4 A;  2DE0 X;  2C0O A;  4PJM A;  3MP8 A;  3A8G B;  2L3R A;  3VUB A;  2XDD A;  4KUL A;  1IO6 A;  1VQ4 T;  2NUT A;  4M7A B;  2PZ1 A;  1Q7Y C;  3PE0 A;  2L0A A;  2PTK A;  1BKB A;  2EJ9 A;  2J05 A;  3OYD A;  4C8Q B;  4F17 A;  1VQ6 Q;  3I5S A;  1YCS B;  1U8R A;  3SHW A;  4D8K A;  4FW1 A;  2E65 A;  3H8Z A;  2VAS A;  3VS1 A;  1N9R A;  4AFS C;  1YHQ A;  2D0N A;  3N5B B;  5IH2 A;  4M7A G;  4M7D B;  2OTJ A;  1Y96 A;  2EW3 A;  5GAM j;  4LDU A;  1RAI B;  3NFC A;  1YJW T;  1U1S A;  4B9X A;  1VQL T;  2I0N A;  3HFO A;  3LX7 A;  4V2S A;  4C8Q G;  4M7A F;  1D1A A;  1VQ9 Q;  3PMI A;  2R5A A;  1IGU A;  4XTW A;  4JJB A;  3QKJ A;  2LRQ A;  2FHD A;  1VQK T;  1U3O A;  1QCN A;  1EX4 A;  4C8Q F;  4JS5 A;  1NJI R;  1SF9 A;  5GAN f;  4MZT A;  3C0C A;  3OYG A;  3GBQ A;  5J3B A;  2RQU A;  4M7D G;  2EKH A;  3M54 A;  2FO0 A;  5LJ5 f;  3LGL A;  4LDW A;  2EQI A;  3CC7 A;  1IHW A;  3GNF B;  1WIE A;  3R6N A;  2R57 A;  2LCS A;  4KH1 B;  2JT4 A;  1H92 A;  1I81 A;  5KYU A;  4M7D F;  2RJF A;  5GAN 4;  1X6O A;  4LDV A;  3ZBD A;  1ARK A;  3EGX B;  4LXC A;  3CCS Q;  4J9D A;  2O2O A;  2H3J A;  4J5Y A;  3MEU A;  3CMA Q;  1D3B A;  1U5S A;  1VQ8 Q;  1FMV A;  2CSQ A;  3VU3 C;  1ZUK A;  4Z89 A;  3LH0 A;  2PVG B;  2ATC B;  2AZS A;  3CME T;  3S6W A;  3GPL A;  2DNU A;  3VS7 A;  1H3H A;  2CH4 A;  2RHY A;  3CCJ A;  2KE9 A;  4PFZ A;  2YWW A;  1TH7 A;  2FZC B;  1VQ5 A;  2L3P A;  3GNG A;  4FU6 A;  2PVD B;  4OF1 A;  3A98 A;  3MHX A;  4A4E A;  1W1F A;  2FEI A;  4PJO C;  4QVC A;  2XDB A;  3I5R A;  3VS2 A;  2VKN A;  1JBM A;  4TVR A;  2QI2 A;  4RG2 A;  1AZG B;  2XHC A;  1ZQ1 A;  3CCQ A;  3GIB A;  4A4K A;  2EYY A;  3V7S A;  4GLK A;  2P0K A;  4C0G A;  1CKB A;  1ZSZ A;  1UE9 A;  4GBQ A;  5CCA A;  1JO8 A;  3SWN C;  3OYE A;  2YLC A;  1Q86 U;  2XU8 A;  3QWY A;  1MMD A;  1N8R C;  4IUR A;  4UC4 A;  4HCB A;  5GAN 8;  1MUZ A;  4FIB A;  2GFU A;  4EPC A;  4N0A C;  5DY9 A;  1JJ2 P;  2CH4 W;  2QA4 Q;  5FLX E;  3CC4 A;  3CXC P;  2J6F A;  2X4X A;  2YSQ A;  4J9G A;  1NG2 A;  3QYG B;  2MAM A;  3HRT A;  2M51 A;  1OEB A;  4OMO A;  3TVT A;  1UG1 A;  4E7J A;  2KK4 A;  4VUB A;  3M4G A;  1RAA B;  4C92 D;  2MPX C;  4ORZ A;  1G8X A;  2JZ2 A;  4RTZ A;  4XTV A;  3WVE B;  4ELY C;  4AFQ C;  2IPO B;  4E7H A;  3LWI A;  3QUI A;  3CCU Q;  2L8D A;  3L2Q A;  1OV3 A;  2EFI A;  4F7U A;  3L42 A;  1GXI E;  2DJQ A;  2DXU A;  2SEM A;  3CCM T;  4LUE A;  4Y91 A;  4OMM A;  1UFF A;  3CBO A;  1UHC A;  2HQH A;  2V1R A;  4M78 D;  5GAO r;  1QMC A;  2CSI A;  2ECZ A;  2KMT A;  2HNI A;  1YJW Q;  2AIR B;  1NYF A;  1MV0 B;  1VQL Q;  3OY9 A;  3L2V A;  1VQ4 A;  3QII A;  3T9N A;  7AT1 B;  4E2F B;  1WPY A;  2BE7 D;  3S3M A;  1QKW A;  4A4F A;  3G7Z A;  3U23 A;  1SRM A;  2YUN A;  3UPU A;  3Q1J A;  4RTW A;  2YUO A;  2CP6 A;  4QKU A;  2K9G A;  5KCO A;  1M90 R;  1WJR A;  1VQK Q;  2L2P A;  2DF6 A;  1BI3 A;  1BB9 A;  2OTL A;  4M7A D;  3M0S A;  2M02 A;  3HP9 A;  1T0H A;  2F5K A;  1I5O B;  4KH0 B;  1ACM B;  3E2U A;  2CRE A;  1W4S A;  5GAN 3;  3C4S A;  1MMN A;  2NUP B;  2RJD A;  1UDL A;  1YIT A;  1WLP B;  1VIE A;  2Y4Y A;  3QPH A;  2XK0 A;  4AFU C;  5KYX B;  1K76 A;  1CSK A;  2RI2 A;  2DER A;  3VS3 A;  4KUI A;  1K1Z A;  5I2M A;  3MEW A;  1X27 A;  4R55 A;  3M9Q A;  2KI7 A;  1BI2 A;  3INZ A;  4A53 A;  1G5V A;  2QQA A;  1KHI A;  2ESW A;  1K9A A;  2CKK A;  3CCE Q;  2DPP B;  3REA B;  5GAO l;  4DBH A;  4XK8 E;  3CME Q;  4M75 D;  4LDY A;  3PFS A;  3EHR A;  1VQP Q;  2JVV A;  3RER A;  1N27 A;  4YTL A;  2G6F X;  2GFA A;  1YHQ T;  1VQN T;  1S72 A;  3VS6 A;  2DVE A;  2ZZD A;  1D0X A;  2OTJ T;  1SSF A;  3QHS A;  1UHF A;  1T3L A;  2E6N A;  5GAM g;  3OYY A;  1G3T A;  1MV3 A;  3A1P A;  2HQE A;  4EMH A;  1M1G A;  2CS7 A;  2V8J A;  3LLR A;  2RNA A;  4HCK A;  5FW9 A;  3EGU A;  1G3Y A;  1PRM C;  2XI9 A;  4J9I A;  4GLM A;  3LGF A;  4PKC C;  3S3N A;  5FU7 B;  4FCY A;  1BIA A;  4J9C A;  3SWN A;  3OS0 A;  1Q86 C;  1YWO A;  1OX8 A;  4LD9 K;  2FB7 A;  1O9S A;  4MZM A;  3PMT A;  1PKT A;  2CUB A;  3FJ5 A;  1PNJ A;  3V7R A;  1OZ3 A;  3EFO A;  3CC7 T;  3NMZ C;  1SKU B;  4HT8 A;  4PLL A;  4ATO A;  2B86 A;  2JNG A;  1VQ7 T;  3RMQ A;  4AT1 B;  1AVZ C;  4HVV A;  4ZNX A;  4FT2 A;  3BE3 A;  1GFD A;  2NWM A;  1R0C B;  2F69 A;  2RMO A;  1Q7Y R;  2CZ7 B;  4FSX A;  4EMK C;  5CVI A;  1OU9 A;  2RF0 A;  3M0Q A;  1WFW A;  4FT4 A;  4A63 B;  2KSS A;  4PJN A;  1NE8 A;  2YT6 A;  4J8O A;  4CRI A;  4RMO A;  4J6X A;  2QGG A;  1YIJ A;  3IQL A;  3V8L A;  4EIK A;  3LWH A;  3CCM Q;  3CCJ T;  2RJC A;  2CP2 A;  1VQ5 T;  4A54 A;  3I56 Q;  4JRI A;  3OS2 A;  2DXT A;  4LDX A;  3QBY A;  3OBW A;  4OP0 A;  2J7I A;  3VKI A;  1OU8 A;  1X75 C;  3SEM A;  1UJ0 A;  4II1 A;  3HFN A;  3UA7 A;  1K73 U;  2QXF A;  1W6X A;  1KQ1 A;  5J26 A;  4BI8 B;  3JCM e;  1HJD A;  1WXT A;  2X9H A;  1Q82 U;  1B3Q A;  3EAE A;  4NL2 A;  2COZ A;  1NZ9 A;  3EFO B;  1QVF A;  4OB2 B;  3CBM A;  5GJV B;  1SEM A;  4PJJ A;  1I0C A;  2LQW A;  3H0I A;  9ATC B;  1YJ9 T;  1NYG A;  2X4J A;  2JMC A;  4FM4 B;  5KYW B;  3JB9 J;  1H8K A;  3CC4 T;  2F2X A;  2YHT A;  2MI6 A;  2XDP A;  2ZPF B;  3FIF A;  3JCM b;  4RTT A;  1R0B G;  1JJ2 S;  2DTI A;  3E1S A;  2MWP A;  1M8V A;  3CXC S;  4ZTF A;  2RJE A;  4WCI A;  4C5E A;  5GAN e;  1XQH A;  2QTX A;  1VQO A;  3OBY A;  2P0Q A;  1KFZ A;  2L3S A;  4C0Z A;  3RDV A;  5LJ5 e;  1WA7 A;  1PSF A;  2DZ9 A;  1WHH A;  2KRS A;  2DTH A;  2LJ0 A;  4M78 B;  2HEQ A;  4B9W A;  2LT4 A;  1GL5 A;  4XTX A;  4C92 G;  2HCK A;  2RH2 A;  4M77 C;  2ZPB B;  1YHQ Q;  2JOY A;  3PIP A;  1V29 B;  1MMG A;  4C0D B;  3MO8 A;  1U1T A;  3VS4 A;  3CPW S;  1EIF A;  3BY7 A;  2GTO A;  2HL3 A;  2CZ0 B;  3VS5 A;  2OTJ Q;  2M16 A;  2BZY A;  3OSS C;  2PUK B;  2DJZ A;  4C92 F;  2RO0 A;  2QEX A;  3CCV T;  2M0Y A;  2LP5 A;  3FEO A;  3UDC A;  5HCK A;  2QQ9 A;  3OYJ A;  1N9S A;  3PIO A;  2X3W D;  1X43 A;  2RPN A;  1ZBJ A;  3OYH A;  4JS4 A;  5GAO m;  1TXQ A;  1WQW A;  2IVW A;  1M5Q 1;  2NYS A;  4M78 G;  5HK3 A;  4FSS A;  5AYF A;  2KNB B;  4X9D A;  2OTL T;  4M77 E;  2DM1 A;  2QQS A;  4BI3 A;  2KVQ G;  1PHT A;  3D7S B;  1DJ7 B;  3M56 A;  2DA9 A;  2KY9 A;  4M4Z A;  2DFU A;  4OB3 B;  5D6Y A;  1N8R R;  2XD0 A;  4M78 F;  2GGR A;  4C0F A;  1KK7 A;  1K0S A;  4KT0 E;  1C6V X;  5CKF A;  3CC7 Q;  4WF2 A;  4IUQ A;  2RQV A;  1VQN A;  1UGS B;  4J6Y A;  4BE2 A;  1YIT T;  3X25 B;  2PQW A;  3TSW A;  3M55 A;  5LJ3 g;  3JRZ A;  4RCB A;  4NL3 A;  1BIB A;  1FYN A;  5GJW B;  4R0K A;  2LJ1 A;  4KGV B;  1NLO C;  4BI4 A;  4M75 B;  4B6M A;  2DIL A;  1B7T A;  2LT1 A;  5KH6 A;  2WSE E;  2VXF A;  1RAH B;  2EQK A;  2P4R A;  3SFM A;  1QVG P;  1XOV A;  5GAN j;  1D1C A;  1WHG A;  3OW2 P;  1KG1 A;  8AT1 B;  3JCM h;  4QW2 A;  1UGR B;  4F7U E;  4EMG A;  3DLM A;  1KHC A;  1M1F A;  3MCA B;  3RKW A;  1M3A A;  2K5F A;  5LJ5 j;  2EYX A;  3NHN A;  2NUT B;  3CCJ Q;  2RI3 A;  1D1B A;  1GBQ A;  2ZPH B;  3J81 E;  1VQ5 Q;  1S72 T;  1TSF A;  4OML A;  4J9B A;  2KRM A;  4DBR A;  3QO3 A;  2MMP A;  3OYN A;  5GAM f;  4XU0 A;  1G83 A;  2HBP A;  4M75 G;  1VQ7 A;  1M3B A;  3MEA A;  4RG8 A;  3CCQ Q;  2WSF E;  2Y90 A;  1K73 C;  2DKG A;  5GAN 7;  2LJ3 A;  1VYU A;  4M75 F;  3DLL A;  4QT7 A;  5GAN h;  2HSE B;  3JCM c;  3VUZ A;  4IKF A;  1OUL A;  2X4Y A;  2E6Z A;  4ZN1 A;  3FB9 A;  2Z0W A;  3JCM X;  2KYM A;  1Y96 B;  3C94 A;  2LNH B;  5LJ5 h;  1M2V A;  1I07 A;  3EFS A;  3CC4 Q;  1M9S A;  1VA7 A;  1WHK A;  4NS5 A;  2QTV A;  3H41 A;  3M59 A;  3X28 B;  3QYH B;  3GLX A;  3URG A;  3CCR A;  4RTV A;  1X6G A;  2A37 A;  2EAY A;  2PU9 B;  2RHI A;  3F70 A;  2A36 A;  2X4W A;  5CKE A;  2A28 A;  2D9T A;  4XTU A;  3VYH B;  4MML A;  3TCJ A;  4QQD A;  5FU6 C;  1UGQ B;  4Z8A A;  1YBY A;  4JZ3 A;  1LNX A;  3ZL7 C;  2RHU A;  2GBQ A;  4MDW A;  5A2Q E;  2HKQ B;  3ULR B;  1HXD A;  4DEY A;  2EYZ A;  1VOM A;  5C6S A;  2BIV A;  5ECA A;  1ZBX A;  2EGE A;  2KGT A;  3EGD A;  1OX9 A;  4NOY A;  1KQ2 A;  1YIJ T;  4EDU A;  1KC8 U;  1TOV A;  4L59 A;  3BFM A;  2FZK B;  4M77 A;  2E1H A;  1BI0 A;  1OQK A;  5KYU B;  2OAU A;  1OPL A;  3UWN A;  1YJ9 A;  1GBR A;  2J06 A;  4HT9 A;  3RMS A;  3ZFJ A;  1T3S A;  1GRI A;  3OMG A;  1W2B S;  2MYS A;  5FRO A;  2K7A A;  3R6O A;  3OA6 A;  1RAE B;  4PJO E;  4DQ2 A;  4L6V 5;  1VQ4 Q;  3HKS A;  3HSB A;  3I55 A;  2ENM A;  1RAB B;  2B8A A;  1D3B B;  2DXC A;  1TUD A;  1FXX A;  2LX9 A;  1PD1 A;  1KQS P;  2K6D A;  1M8M A;  1M1K U;  2EJF A;  3BW1 A;  1KD1 R;  2YRV A;  3ER0 A;  1VIF A;  2OTL Q;  2D8H A;  2K4Y A;  4IUU A;  1ABO A;  3J7A F;  3QWX X;  2JMA A;  3OYB A;  3M58 A;  3G4S A;  3RKX A;  4C92 C;  4BY6 C;  4BDZ A;  2HSP A;  3H9N A;  8ATC B;  3THK A;  4OGE A;  1Y57 A;  4J9F A;  1YIT Q;  5GAO n;  1LVK A;  3E19 A;  3I35 A;  2LQN A;  5CKB A;  5CK9 A;  1ZSZ B;  4RTX A;  2CP7 A;  3CPF A;  2EGA A;  4HVW A;  2XG8 D;  3CCV A;  3MP1 A;  1VQO T;  4J7F A;  1H64 1;  1OPK A;  2CP5 A;  2E5K A;  2EWN A;  2DL5 A;  1OZ2 A;  2C0I A;  1SRL A;  2OAW A;  2DIQ A;  5I21 A;  2L3Q A;  2LZ6 B;  1M4Z A;  2HQX A;  5CQY A;  5A0G A;  2RN8 A;  2CUD A;  2DLP A;  2K3Y A;  1I8F A;  1S72 Q;  2JUF A;  1WHL A;  1ZHI A;  3JCM J;  1T0J A;  3ZEH A;  4DA4 A;  3H0H A;  2M0O A;  2VC8 A;  2KRN A;  3PTA A;  2K3B A;  2DET A;  4ZTJ A;  2QEX T;  2GTJ A;  1YWP A;  1ABQ A;  2YXY A;  3JCM Q;  3CQT A;  1WNL A;  1F1B B;  1XTD A;  2ZCF B;  3OYC A;  4JRQ A;  2NUZ A;  1YJN T;  4M7A C;  3H0F A;  2IG0 A;  1GFC A;  1W70 A;  2A0F B;  2QDY B;  4IUV A;  1RI0 A;  2XMF A;  2CZ1 B;  4F7U B;  3QXE B;  1QP2 A;  4C5H A;  4CC2 A;  5AT1 B;  1IZ6 A;  2FPD A;  3OB9 A;  4J83 A;  4JJD A;  2MF2 A;  2PUO B;  4C8Q C;  2XIC A;  2FPF A;  1Q81 U;  2JJ9 A;  2DRM A;  2YRD A;  3I9Q A;  2P0P A;  2DRK A;  2D6F A;  2ZPG B;  2DBK A;  5IHI A;  4J9H A;  5LJ3 f;  1NPR A;  4XU2 A;  1I5L A;  1BCM A;  1XJW B;  2BKD N;  1WI7 A;  2I2L A;  1WDX A;  3OYI A;  2VB6 A;  1TUC A;  2ZPE B;  4M7D C;  1SSH A;  3UA6 A;  5GAN 2;  3QDR B;  2LQ8 A;  2DVJ A;  4F7U G;  4KGX B;  2CYZ B;  2X3X D;  3JB9 D;  4PJO A;  1Y07 A;  3RR6 A;  4BUG A;  4BB7 A;  5EC7 A;  1KJW A;  4E7K A;  1E7O A;  5DLQ E;  3EFR A;  4E7S A;  2GF7 A;  4PFP A;  4E7Z A;  2K5I A;  1JEG A;  4F7U F;  1K8A R;  3PVL A;  1K9M U;  5FRN A;  3LH5 A;  1MND A;  4RUG A;  3TEE A;  1YIJ Q;  1VYV A;  3X24 B;  2BUD A;  1FMK A;  3MET A;  4N4I A;  1QVG S;  3HTR A;  1H3Z A;  3OW2 S;  5FWB A;  2O01 E;  1KC8 C;  1YI2 A;  4M7D E;  2DAQ A;  2JW4 A;  4N0A A;  4D6W A;  1AWJ A;  3WXM B;  1EZZ B;  3CC2 A;  5KE2 A;  5I22 A;  2MK5 A;  4DBQ A;  3P8H A;  2DL8 A;  4DEX A;  3E9F A;  1M30 A;  1NM7 A;  4F14 A;  2QAS A;  3M53 A;  3FC3 A;  4CC7 A;  2R5M A;  1FWZ A;  1YNZ A;  3JCM W;  2RA2 A;  1P92 A;  1MMA A;  3OS5 A;  3RBB B;  4AG2 C;  1UEB A;  3PVQ A;  1M1K C;  2RM4 A;  3DB4 A;  1OI1 A;  4AMC A;  1IRX A;  5GMK e;  2FG0 A;  4OMN A;  1X2K A;  4JLI A;  3UT1 A;  2MCN A;  5GAM d;  4PJO B;  4R56 A;  3TSZ A;  2BE9 B;  4JZ4 A;  1ZA1 B;  2JN0 A;  1PD0 A;  2SRC A;  2KXC A;  3CCR T;  5KE3 A;  4E7L A;  4E6R A;  2ABL A;  2BTT A;  1NBE B;  2J6O A;  1BBZ A;  1BCO A;  1VQ9 T;  1VQO Q;  5I11 A;  3SWN B;  1IGQ A;  3TQ7 P;  3V7C A;  2HAX A;  1EFN A;  2KYB A;  1VYT A;  1GCQ C;  2OI3 A;  2HKN A;  4P5N A;  2KT1 A;  3GOX A;  2JTM A;  1AWX A;  1QKX A;  5FWC A;  1RLP C;  5FRM A;  2CT4 A;  2HZY A;  5D6W A;  3MPU B;  2E41 A;  4PJO G;  3M0R A;  3G6E A;  1RL2 A;  1XNI A;  2K2V A;  1LJO A;  4Y92 A;  3RUX A;  4HVU A;  2DTO A;  2E3I A;  3OSV A;  5GAO q;  2DEU A;  1WQ7 A;  3QJ6 A;  1JJ2 A;  2QEX Q;  4PJO F;  3P8B B;  4Z88 A;  4D8D A;  5DM7 R;  3CXC A;  1X01 A;  3I55 T;  3G71 A;  3CCS T;  1G2B A;  1E6G A;  4BD3 A;  2L89 A;  1IHV A;  2LQK A;  4JUV A;  1VQ8 T;  1AEY A;  2DZC A;  2E64 A;  5CO7 A;  3S3O A;  3QSU A;  5CKD A;  2KXD A;  4X34 A;  4XU3 A;  1K73 R;  2DYB A;  4CC3 A;  2JTF A;  5DLO A;  5GAM e;  1KQS S;  3O5Z A;  4C8Q A;  3NTI A;  3X20 B;  3CCL A;  4J9E A;  4OB1 B;  2ZGW A;  3M0T A;  4LNP A;  1Q81 C;  4HA8 A;  2RHX A;  3CPW A;  3FDR A;  3G4S T;  2K57 A;  5D6X A;  2Y4X A;  4M77 D;  2DL3 A;  5GMK j;  2QK0 A;  1VQN Q;  4IIO A;  4A4H A;  1LPL A;  1V1C A;  3GF5 A;  2HDA A;  3UF4 A;  4PJL A;  2K79 A;  2OJ2 A;  5IHN A;  4A4G A;  4M7D A;  2VVK A;  2FL7 A;  2RB6 A;  3HHT B;  3RES A;  2JTE A;  1YFN A;  2YDL A;  1YJN A;  2L5Q A;  1BU1 A;  3M4Y A;  2D1X A;  4GY5 A;  3HL8 A;  3ASK A;  4JRK A;  3OMC A;  2EPD A;  5C0M A;  2YRC A;  2LCC A;  1D09 B;  1VQM A;  1BK2 A;  1N5Z A;  2QA4 T;  3A8H B;  1C0M A;  1R8O B;  3EG9 A;  5L23 A;  1K9M C;  2K3X A;  2ZAE A;  1NEG A;  1E6H A;  4PLI A;  3SB2 A;  6AT1 B;  5GMK h;  2KBT A;  2FVU A;  2CZ6 B;  2K2M A;  1D0Y A;  1TTH B;  2XKO C;  1UGP B;  4HXJ A;  1RI9 A;  4JJN K;  4OMQ A;  2DL4 A;  1PC0 A;  1I4K 1;  4KRT A;  2ZPI B;  4BE1 A;  2RK1 A;  4K11 A;  1BI1 A;  1PKS A;  1VQ7 Q;  1NLP C;  4RCC A;  4C5I A;  2W10 A;  1WXU A;  3CCU T;  1PRL C;  1NJI U;  2KT8 A;  2F2W A;  1QP3 A;  4OB0 B;  3L2W A;  3SDZ A;  2F1L A;  3JCM f;  2D0Q B;  1JXM A;  3EGX A;  4EMK A;  5IAY A;  1PSE A;  3JV3 A;  2QYZ A;  2EKO A;  2JS0 A;  3CD6 A;  4ZGD B;  3KFV A;  4LD6 A;  2E12 A;  1K0X A;  1ZSG A;  1YN8 A;  3QG1 A;  4MDX A;  1WZO A;  3VYG A;  1AWO A;  4C5G A;  3M0P A;  3JCM P;  4QQG A;  2W0Z A;  2WAC A;  3CCR Q;  2LVM A;  1M27 C;  4ME7 A;  4MMK A;  2E5Q A;  3P8D A;  3A8O B;  2O31 A;  5HK0 A;  3LW5 E;  2RK2 A;  4FYV B;  1SPK A;  3EG9 B;  1A0N B;  2JS2 A;  1GCP A;  3MP6 A;  1YP5 A;  4FYX B;  2EQU A;  2IIM A;  1HYO A;  4JDS A;  1QCO A;  2AK5 A;  1VQ6 A;  1GCQ A;  3TRE A;  4FYW B;  1QW1 A;  4FW2 A;  1B34 A;  3UAT A;  1Q82 C;  5LJ3 d;  2COW A;  5FU7 C;  4AG1 C;  3JB9 G;  1AD5 A;  1G3S A;  4XTY A;  1YJ9 Q;  2A7Y A;  5GAM h;  3BDU A;  1KIK A;  4ZGE B;  2V8K A;  1YI2 T;  1QLY A;  2ROT A;  4MZP A;  2VXE A;  3NPF A;  1RAF B;  1TUG B;  4EMK B;  2FZG B;  5GAN 5;  2AT1 B;  3I55 Q;  1UEC A;  3JB9 F;  2QAZ A;  4HCZ A;  3CC2 T;  2QQR A;  4DOW A;  2H3E B;  1VUB A;  5A0L A;  3RIR A;  3CCE T;  1VQ9 A;  2K5L A;  4PJO D;  4XQ3 A;  1AT1 B;  4J7I A;  4KBM B;  3JAM E;  1VQP T;  3JCM V;  3KXT A;  1NEB A;  3QDF A;  1AHJ B;  5GAO p;  5A0D A;  2EYW A;  1O75 A;  3L1A A;  1WGS A;  1ZA2 B;  3C12 A;  1U06 A;  2VGN A;  3G4S Q;  1Z9Q A;  2CP0 A;  2JM8 A;  1KD1 U;  4LE9 A;  2DX1 A;  3M5A A;  1W2B A;  1D0Z A;  4JPB W;  1J3T A;  1K4U S;  3ME9 A;  1R77 A;  1FMW A;  1ZUU A;  2YUQ A;  2VUB A;  5L8R E;  2KDS A;  5IXF A;  1B34 B;  1Z9Z A;  2X35 A;  2BZX A;  4ESR A;  1QVF P;  3CCV Q;  4ANJ A;  1RAC B;  2RQT A;  2CGH A;  3CCS A;  1M3C A;  2LNV A;  4OMP A;  4OVA A;  2QGF B;  5LJ3 e;  3CMA A;  1M2V B;  3VJP A;  1VQ8 A;  1HSQ A;  2J6K A;  4XTZ A;  1TS9 A;  2DMO A;  5GMK l;  5CAI A;  1WYX A;  2CDT A; 
#chains in the Genus database with same CATH homology
 3CD6 Q;  1VQN Q;  1VQK Q;  1VQM Q;  1W2B P;  1QVF P;  3CCS Q;  3CCV Q;  1K73 R;  3CC7 Q;  3CME Q;  3CCU Q;  1Q7Y R;  1QVG P;  1VQ4 Q;  1YI2 Q;  1YJW Q;  3CCM Q;  3CPW P;  3CMA Q;  3OW2 P;  1VQP Q;  1VQ9 Q;  1VQL Q;  3G4S Q;  3CCL Q;  3G71 Q;  2QEX Q;  1S72 Q;  1VQ7 Q;  1VQ8 Q;  2OTJ Q;  1KQS P;  3I56 Q;  1Q82 R;  1YJ9 Q;  3CCE Q;  3CC2 Q;  1VQ6 Q;  1Q86 R;  1KC8 R;  1YJN Q;  3CCJ Q;  1K8A R;  3G6E Q;  3CCQ Q;  1KD1 R;  3CC4 Q;  1VQO Q;  1N8R R;  1M1K R;  1JJ2 P;  1YIT Q;  1VQ5 Q;  1K9M R;  1YIJ Q;  3CCR Q;  2QA4 Q;  1NJI R;  2OTL Q;  1YHQ Q;  1M90 R;  3I55 Q;  3CXC P;  1Q81 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...