3CCRQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccrQ00
1YI2Q 1YJWQ 1Q7YR 1VQOQ 1KD1R 2QA4Q 3G4SQ 1S72Q 1KQSP 1VQNQ 3CMEQ 3CC2Q 2OTJQ 1K9MR 3CCRQ 3CC7Q 1M90R 1VQLQ 2OTLQ 1VQ5Q 3CCMQ 1Q82R 1K8AR 3CCLQ 3CPWP 1YIJQ 1VQKQ 1QVFP 3CXCP 1QVGP 1Q86R 3CCJQ 3G71Q 1KC8R 3CCEQ 1N8RR 1K73R 3G6EQ 1VQPQ 3CCQQ 3CCVQ 1JJ2P 1YHQQ 1VQ6Q 1VQ9Q 3CCSQ 3CC4Q 3OW2P 3I56Q 1YJ9Q 1YJNQ 1M1KR 1YITQ 3CCUQ 1Q81R 3I55Q 1NJIR 3CMAQ 1VQ8Q 1VQ4Q 1VQMQ 1W2BP 1VQ7Q 2QEXQ 3CD6Q
chains in the Genus database with same CATH superfamily
4AFSC 1BI1A 4C0DB 1KD1R 1YBYA 1RAIB 2QGGA 3CCRQ 3CC2A 2E65A 2CP0A 2CP5A 4ZNXA 3O5ZA 4E7IA 1VQ6T 4BY6B 2SEMA 1XOVA 2K3BA 1GL5A 4D8KA 2X4WA 3WXMB 4FW1A 2A28A 5IHIA 3QYGB 4C92D 8ATCB 1UGPB 3X24B 2A0FB 5GMKm 1B3QA 2M51A 2EJGA 5EC7A 3LX7A 4FM4B 1D3BB 1ZA1B 2LZ6B 3VU3C 2EJ9A 2YLBA 2DL7A 1AZEA 3SWNB 3A98A 4XTZA 4CC3A 4R0KA 5KCOA 1N6AA 2GFUA 2LQWA 3FIFA 2EGAA 3IQLA 1VYUA 4O5VA 3J80E 2KK4A 1Y07A 2DIQA 2L89A 5FLXE 5GAN4 2A7YA 5KYYB 1EIFA 1N27A 4Z8AA 2K57A 1N9SA 1BIBA 1WJQA 3A8GB 2YRDA 1X6OA 2CH4A 2COYA 5HKCA 4J9BA 1HSQA 1H8KA 1VQ6A 4DOVA 3UT1A 1JBMA 1Q7YR 1U1TA 2DXTA 2NUPA 3VS0A 2LMJA 3PGGA 2W10A 3L42A 4C8QA 1W1FA 5AT1B 3GLXA 4QT7A 1M9SA 2G3RA 5FWBA 4RTZA 1SRLA 2C0TA 4IIMA 4KUDK 2KY9A 3DLMA 1SG5A 3NGPA 1Y96A 2DTIA 2R58A 2WSFE 3OS1A 3CXCP 3FLGA 3GF5A 3OYCA 4D8DA 2QI2A 2D9TA 1FWZA 1TG0A 1MMDA 4OGEA 3TCJA 1M1FA 1AT1B 1E6HA 4JDSA 4XTXA 2C0OA 1BU1A 2EGCA 3JSCA 1AEYA 2CGHA 3OYBA 4Y28E 2DLPA 4L6V5 1UGSB 4WF2A 2EQMA 1TUDA 5LJ5e 2DEUA 3G71Q 2L0AA 1KJWA 3G6EQ 2RD1A 2K5IA 2MWPA 1YN8A 1KD1U 2HNIA 4HCBA 2K2VA 3M4YA 2VXEA 1YJNQ 2EQKA 1KQSS 2GGRA 1AWJA 4GY5A 4J6WA 4BDYA 3P8HA 1PKSA 1H92A 2V8KA 2JN0A 1YCSB 1YIJT 3NTIA 1TXQA 2RJCA 3CBOA 5CKEA 1M3BA 3CMEA 2JXBA 5CVIA 4C8QF 4X9DA 4JLGA 4XTWA 2QQRA 1QQJA 2FRWA 2GNCA 2RI5A 2MPXC 2A37A 4PFOA 2RK2A 1YFNA 2J06A 1YI2Q 4AFQC 1XTDA 1M30A 4RG2A 1H641 4C5EA 3PVLA 2FPFA 5DM7R 3V8LA 2RB6A 3MEUA 1X27A 1U8RA 2EW3A 2HQXA 2XICA 1TUCA 1ZUYA 3SD4A 3OSVA 1XQHA 2KVQG 1OULA 3H9NA 5GANg 4C8QD 2DL4A 1OZ3A 1CKAA 2LDMA 4C0ZA 2NUPB 1AWWA 2FB7A 1YHQT 2PQWA 1Q82C 4C8QB 1YIJA 5KCHA 1WHJA 4M77D 2EKOA 1Q7YU 5DY9A 3MCAB 3TVTA 3VS1A 4IUUA 3VUBA 3LWIA 4B9XA 3VS3A 2XK0A 4B9WA 1HJDA 3M59A 1VQ8Q 1NM7A 4JZ4A 4BE0A 2OTLT 4M77B 3M53A 1VQNQ 2KROA 3N5BB 1X69A 2YUQA 2ABLA 3A8LB 2GFAA 4HVWA 4RTTA 1T0HA 3TU4K 1Y96B 1Q86R 2F2XA 2EYWA 3PE0A 4PJOC 3ME9A 2D1XA 1M2VA 3QWYA 1K73R 1I0CA 1M1KR 7AT1B 2DXBA 1YWOA 1Q95G 1X2QA 1K9MR 1Y7XA 4JJDA 4NOYA 2K3YA 1U1SA 4M75A 3P8DA 3M57A 1UG1A 3ZEHA 3RERA 5C0MA 1D09B 3FEOA 3OYFA 3VS4A 4F7UA 1HXDA 2YWWA 5M9OA 1WX6A 1HYOA 4II1A 2CUBA 2L8DA 2M1HA 3TEEA 1V76A 3HSBA 1I8FA 1OPLA 2HEQA 2ZPIB 5GAN3 5ECAA 3GNFB 4FU6A 4OF1A 2DFUA 2COZA 4PJOE 2OTLA 4N0AA 1K8AC 1AWXA 5D6WA 4C0DC 1WPYA 1JXOA 3ER0A 2CZ1B 5GAN2 2ATCB 1RAEB 1YITQ 4AT1B 3HRUA 1YNZA 2P0PA 2QDLA 4J9GA 5IT9E 3CC7T 4BY6C 1I4K1 2CUDA 2MYSA 1K8AU 3CCMT 2AHJB 1VQ7A 2I0NA 9ATCB 3RMQA 5LJ3h 2IVWA 3HRTA 3CPWP 1D1CA 3CEYA 2YHTA 2D8HA 1TU0B 1LOJA 4OMMA 2F69A 2ED1A 1K0SA 4C92C 1JJ2A 3VS5A 3JCMf 2EYYA 4ZTJA 2E4HA 4RUGA 3SWNC 1ZBXA 1RL2A 5LJ3e 1W2BA 2CP7A 2MWOA 3ZFJA 4OMOA 4V2SA 5GANd 2A36A 4M75F 1R0BG 4HCZA 2DVEA 5LJ5j 2K5LA 3CCJQ 2DL8A 4OP0A 4F7UF 4AFZC 2MIOA 3INZA 4KUIA 5KE3A 4J7IA 5I2SA 4EDUA 2LX9A 2ZAEA 4OMLA 1NJIR 2DL5A 3QUIA 1OOTA 2DERA 2DVJA 2J6OA 2MAMA 4FIBA 4EMKB 3CC7A 2KRNA 4M7AA 1OZ2A 3CCMA 1YCYA 1QVFA 3PNWC 2K2MA 4C92E 1B07A 1VQ8T 2DTOA 2KYBA 1M2VB 3QYHB 4QW2A 1M3AA 3CC4Q 2E3HA 2ROLA 4KBMB 3WVEB 1A0NB 4M75D 4M7DA 3C95A 4QQDA 5LJ5g 2DD4A 1WHMA 4N4GA 1K73U 2P0KA 2SRCA 1M1KU 4M75B 1VQKQ 4RTUA 2COWA 3CPFA 2Z0WA 3VRYA 3CCUT 2DXUA 2EIFA 4ZN1A 3CCVQ 3BY7A 2RNAA 3G4ST 1K9MU 3M0SA 1ZUUA 2DRMA 5D7UA 3RMSA 3M54A 3JCMJ 1T3LA 3CBPA 2KEAA 4OGCA 4PK4A 2RJFA 1KIKA 2DEQA 1QCNA 2QTVA 3OYKA 2DYBA 2JT4A 2GTOA 1SKUB 5GAMf 1MV3A 3KXTA 2L3QA 1BBZA 4BACA 5GAOn 3CCLT 4KGZB 3F70A 4LNPA 1RUWA 2EQIA 3JB9I 1VQPT 2LT1A 4M7AF 1FX7A 3A8HB 1PD0A 1KQ2A 1KC8C 3I56Q 2QK0A 1Q81R 3EHQA 2YUNA 4ELYC 2FEIA 2DYIA 4A4GA 4M7DF 2NYSA 3CCUA 1RLPC 4KRTA 2AIRB 3OYAA 4GLKA 4B6MA 2DPPB 5I2MA 4HA8A 2LQNA 3G4SA 2QDYB 4Z88A 2DX1A 1JJ2S 3H0IA 3TQ7P 2DNUA 2ZPFB 3M0PA 2DMOA 2DF6A 3KBGA 1W2BS 2HKQB 1MHNA 2OI3A 2QA4T 4M78A 2RJDA 4KT0E 1LNXA 2QAZA 3QIIA 1W4SA 4GBQA 4XK8E 2HSPA 2KRMA 2CP2A 3PIPA 4DA4A 3CPWS 2QGFB 3JB9G 1VQ5Q 1QWEA 4A4FA 4Z89A 1OU9A 2X51A 1B34A 3CCLA 2KR3A 3OYJA 1NJIU 1W70A 3L2QA 3PVQA 2D8JA 4M7DD 4PJMA 1VQPA 3FJ5A 3OYIA 3SHWA 1VIEA 1VQ9A 1XNIA 1UGQB 2XIDA 4M7DB 3CMEQ 2YT6A 5LJ5d 2F1LA 4XU1A 1G83A 2LJ0A 1WNLA 1AZGB 2LRQA 1T0JA 5HK0A 2LJ3A 3MKDA 4M77C 2FPEA 3L2RA 4E7ZA 4C92G 3TREA 3UPUA 1WQWA 5CKDA 3V7SA 1NE8A 2DA9A 1JEGA 4BI8B 3OW2A 1NLOC 2LNVA 4PL6A 5LJ3j 2E5QA 2K7AA 5CQXA 3CBMA 3OY9A 3M0UA 1PD1A 3CCVT 3CCQT 5IHNA 3G1JA 1UGRB 1BCMA 1ZUKA 2HMAA 2ZZDA 2RQTA 5C6SA 4R55A 2LTOA 4FSSA 2D0QB 2GQIA 1JXMA 3RKWA 4M78F 2KXDA 1VYVA 1D0YA 2KXCA 2VXFA 4C8QE 2YSQA 5KYXA 1X6GA 3PFSA 1JU5C 4BE1A 2CZ6B 3I9QA 1IHWA 2DILA 5KH6A 3DB4A 3TSZA 4KH1B 2AT1B 1YJWA 3JV3A 1LCKA 4M77E 1GCQA 1QVGA 5IH2A 2AZVA 4EMHA 3AT1B 5LJ3g 3EG9A 1GBRA 3CD6T 2HD0A 2YRCA 2CREA 1UTIA 5A0GA 4RG8A 3I55Q 3H6ZA 1AD5A 3GP8A 3M56A 3NMZC 2MF2A 1IHVA 3QJ6A 4PLIA 2VWFA 3V8JA 3X25B 3QHSA 3C12A 1Q81U 4M78D 3A8MB 3JCMb 5GMKi 4GLMA 2C06A 2QEXT 3MEVA 1GRIA 3CCQA 1QP2A 4M78B 4PJLA 2LCSA 2O2OA 1VQOQ 3RNJA 4K11A 1PHTA 4VUBA 4IUPA 1ZA2B 1RAAB 2KDSA 2DBMA 2X35A 2X9HA 1OEBA 2FZKB 2WACA 1B34B 2I2LA 4CC7A 2XU8A 3S3NA 1WGSA 2X3WD 3LWHA 3UA7A 2K3XA 3M5AA 2BZ8A 2GF7A 1KQ1A 1PC0A 5I11A 2FL7A 3Q1JA 3CD6A 2RH2A 1M90R 2E6NA 5A0DA 3G7ZA 5D6YA 1V1CA 2KYMA 4N4IA 4ELZC 4JJNK 4FCYA 5LJ5h 3RBBB 4EMKC 4J6XA 3PT9A 3VS7A 4X34A 3PTAA 3BW1A 2Y4XA 4KGVB 4PKCC 3H41A 1S72Q 3GNGA 2QEXA 1KD1C 4CRIA 6AT1B 5IAYA 1WHLA 4PFZA 2X4XA 4BD3A 4DOWA 1N8RR 1MGQA 3CMAT 1F1BB 4PNOA 4MMLA 2FPDA 3CCRT 4M75C 5CKBA 5KYXB 3M0RA 3QPHA 1WQ7A 4J9FA 4KULA 1VUBA 2WSCE 3CXCA 3RKXA 3A5ZB 5J3BA 2JTFA 2CKKA 5CKHA 1FXXA 3RDVA 1EFNA 3EG9B 5LJ3d 4KGXB 2PUOB 3E2UA 4HCKA 2CZ7B 4E2FB 2RI2A 4XTYA 5D6XA 2X3XD 2RM4A 4N0AC 5KYWA 2R5MA 4FSXA 1CSKA 2ESWA 3EHRA 4M77G 4HCCA 2JS0A 2EPDA 1O75A 1JQQA 2MOXA 1D0ZA 4M75E 4QKUA 2XHCA 1MMAA 3OBYA 5GAOq 4OB3B 4O6JA 2RQUA 2XDBA 2DZ9A 1QW1A 3CMAA 2JTMA 1Q7YC 3I5SA 4HT8A 1SHFA 2BUDA 2E12A 2HSEB 2DZCA 1M5Q1 1QWFA 5DLOA 1NG2A 3S6WA 3HFOA 4F04B 3BE3A 5CAIA 4Q5WA 2M9UA 1WHKA 3JCMc 2K6DA 2M0OA 1VQMQ 3OMCA 4JRPA 1AVZC 1KHIA 2HBPA 2V8JA 5CK9A 4C5HA 1RI9A 1PRLC 1TTHB 2EBPA 2RQWA 3OS5A 3OYYA 1PWTA 1KG1A 3CCEQ 3OSSC 4OMPA 1ABQA 1B7TA 2L3SA 4LUDA 8AT1B 2KMTA 4ZGDB 2KBTA 2ROTA 3MEWA 1M90U 5HK3A 4XU0A 3WVDB 4LE9A 1RAFB 1VQLQ 4C0FA 4QVCA 3HP9A 4AG2C 3HHTB 1M27C 4AFUC 4M7DC 1FMWA 2JW4A 2DAQA 2DK3A 3J81E 1YHQA 1WIEA 4E7KA 1VQ4Q 3TSWA 3UATA 4FYWB 2F2WA 2OTJQ 2OAUA 3OYLA 4E47A 1WHHA 3MP8A 3X20B 4D6WA 3G71T 3R6NA 1N8RU 1PNJA 3P8BB 3G6ET 4TVRA 1JRIA 2A08A 3JCMh 1YJNT 1SRMA 2CSIA 2RQRA 2DBKA 3REBB 4LDXA 4EMGA 2ZCFB 1JJ2P 3U23A 3CCSQ 1YJ9Q 2HL5C 5A2QE 5GAOl 3QKJA 1W2BP 3CQTA 2E1HA 1VA7A 2LJ1A 2R57A 2RQVA 1VIFA 2YUOA 5KYWB 3C94A 4FL6A 1WYXA 2O9SA 2QQ9A 3JCMe 1WHGA 1ZSGA 4M7DE 2HDAA 3LH0A 4HKEA 4QQ6A 4Y91A 1D0XA 3EG1A 1I07A 1VQ9Q 1YI2T 1X43A 1D1BA 2LT4A 3QO3A 1PRMC 2AKLA 4XAXB 5GMKl 3M58A 1ZBJA 5IHKA 3R6OA 2BIVA 1M4ZA 2V8IA 2RI3A 2VB6A 4J7FA 1UUEA 3QSUA 2KT8A 2EFIA 1QVFP 2EYQA 4MZTA 4WTOB 2RMOA 1WJRA 5FU7B 3V7RA 3M0TA 1JO8A 2HCKA 2JS2A 3G6EA 2F2VA 1RAGB 3BFMA 1YJNA 3ULRB 4LD9K 1PSFA 5L23A 4L5GA 3CC2Q 3MHXA 1O9SA 3V7CA 3GOXA 2BZXA 1E6GA 2NUZA 4M78C 4C5GA 2DXCA 1Q86C 4XTUA 4OMQA 2KQWA 1C1AA 1QLYA 3UWNA 3FJPA 2K79A 1K73C 2HL3A 1VQNT 1M1KC 1M3CA 1OX9A 3C0CA 1YJWQ 1K9AA 2C0IA 4DEXA 1S1NA 1Q86U 5LL6S 4FYYB 3E9FA 1K9MC 5GAMh 3VV0A 3H0FA 3I5RA 1PCXA 1NYFA 2YDLA 4J9CA 1NPRA 1RADB 1Z9QA 4JRIA 1WI7A 1KFZA 2EQJA 3JB9H 1UJ0A 2RHXA 3C4SA 4F7UB 3HRSA 3GIBA 3T9NA 1G3SA 1KK7A 2GCXA 4E7HA 2RHIA 5I22A 2BE9B 3VKIA 3H8ZA 4F17A 1AHJB 2MCNA 5GAMe 4DBFA 4M78E 4ZTFA 4J9DA 4MMKA 1MMNA 2O4XA 3UF4A 1M8VA 1VQ6Q 3E19A 3I35A 3HL8A 2P4RA 3DB3A 2JOYA 2JTEA 2E3IA 1V29B 1VQ8A 2EQUA 1QMCA 5A0LA 2ECZA 1G2BA 2K9GA 4BUGA 1VQNA 1MUZA 2JM9A 4QVZA 4RKUE 5I21A 4PJOG 4ESRA 2QASA 1YITT 3KFVA 4CI0C 2LP5A 1RACB 2R5AA 4DEYA 2LQ8A 3RIRA 2KGTA 2FYKA 2CZ0B 2RHUA 2ZPEB 2NWMA 4UC4A 4C92A 2QQBA 1D3BA 1GCQC 3SWNA 3RR6A 4ZGJB 2DJZA 2FZCB 1N9RA 4M7DG 2O9VA 1X6BA 3LYIA 2B8AA 3L1AA 2H3EB 4ORZA 5CQYA 4OB2B 1NJIC 2YLCA 4DQ2A 2V26A 4M7AD 3L2UA 3CCJT 2EAYA 2ED0A 1TSFA 2M0YA 3JRZA 3JB9J 5FRNA 3GBQA 2CYZB 3EG2A 4M7AB 2QTXA 4FT2A 4LD6A 3JB9F 1U5SA 1VYTA 2PUKB 1GXIE 2DRKA 4RMOA 3SDZA 3OW2P 1TH7A 1NEGA 4WCIA 1YITA 3VS2A 4C8QC 3OYEA 3MEAA 1QVFS 1DJ7B 4NL2A 2JMAA 4HXJA 1OI1A 4MDWA 2CH4W 4LUEA 4L59A 5FU6B 1NBEB 4J9HA 3CC4T 3VYHB 4F14A 5CO7A 2VYTA 1UEBA 1MNEA 1BIAA 2OX7A 4JRKA 1BB9A 4IKFA 1Y0MA 3E1SA 1PG5B 4C92F 5GJWB 5GANf 1VQKT 1GBQA 4LDYA 2PVDB 2QA4A 2IIMA 2HQEA 4RTYA 1QVGP 1TOVA 2V1QA 2O4XB 3LLRA 3CCJA 4Y92A 3JCMX 2KAFA 3SB2A 1U3OA 1GFCA 1N5ZA 1UECA 3JCMg 2EYXA 3FB9A 3LGLA 3EFRA 4A63B 5FW9A 2H3JA 2ZPGB 4Z02A 4X9CA 1KQSA 4LXCA 4M78G 5GAOp 1YIJQ 1BKBA 1ZSZA 4E6RA 1PKTA 1TWBA 3REAB 3OA6A 2MK5A 4ME7A 1XJWB 2GBQA 4HVUA 2H8HA 4MDXA 3FRNA 2RHYA 3M4GA 2BZYA 1ABOA 3A8OB 3CC4A 5HCKA 1Q81C 1HD3A 2VASA 4EIKA 4C92B 4J9IA 3X28B 3EGXA 2VVKA 1ACMB 5CKFA 3I56T 2E6ZA 2DE0X 3S3OA 1VQKA 3EFSA 2M16A 1BYMA 5EG2A 5CR2A 3CCVA 2DL3A 4AG1C 3HPWA 2E70A 5GAMj 5GJVB 4JJCA 4A4KA 4E7SA 2YRVA 2J7IA 1GCPA 2JVVA 1GFDA 2D6FA 3HTRA 5KE2A 4JPBW 1YHQQ 4A53A 4R56A 2L5QA 3EH2A 4NL3A 4OB0B 2J6FA 1AOJA 1UHCA 4LN2A 1G8XA 2PVGB 4OMFB 1IZ6A 1VQ5T 2EVRA 3A1PA 2JUFA 3D7SB 4HT9A 1IB8A 1OV3A 5FU7C 1NZ9A 2OTLQ 4XQ3A 2HKNA 1Q82R 2ENMA 2LCLA 5J39A 5FROA 4DBRA 5CCAA 2OJ2A 4J9EA 4CC2A 5GAMg 1P92A 2RO0A 1ZHIA 5CIUA 2D0NA 2B86A 3CMET 4P5NA 4M77A 3AHUA 2LQKA 3QBYA 3I56A 2EJFA 1VQ7Q 4N4HA 2LNHB 1IRXA 2Y90A 1RLQC 1LPLA 1IGQA 4J5YA 1WDXA 4A4EA 2QXFA 4PLLA 4IUQA 3OW2S 3OYDA 2E41A 2O31A 2YUPA 3DLLA 2L3RA 1LJOA 3JCMd 1IREB 2O88A 3JCMQ 3VUZA 2GQVA 1QKXA 1NPPA 1ZQ1A 3HKSA 3EH1A 4LDWA 1VQ5A 1ZSZB 3UA6A 1IGUA 1UJYA 2VC8A 3JAME 2DETA 2RF0A 1IXDA 2AZSA 2P4TA 4RTXA 1FYNA 4C8QG 5LJ5f 2DD5A 4IUTA 5GAN5 1OYXA 3EG0A 1UE9A 3CC7Q 1QVGS 3CCMQ 1K8AR 4RTVA 1M8MA 2DO3A 2J05A 4FT4A 3RUXA 5GANj 3EGXB 4LDVA 3I55T 2X4JA 4HVVA 4IIOA 2CT3A 2EGEA 4M77F 2HAXA 4XTVA 1MV0B 3URGA 1FMVA 4JJBA 1SPKA 4F7UE 2CS7A 3UDCA 3QXEB 3QWXX 2BKDN 1MMGA 3QZ9B 3CCRA 3X26B 2MI6A 1X75C 5IXFA 5KYUA 4KH0B 2KT1A 1X01A 2PU9B 1UB4A 1WA7A 1VQOT 1G3WA 3L2ZA 2RN8A 1TUGB 1ARKA 1W6XA 2XDDA 3NTKA 2CT4A 2P84A 3M9QA 3OYGA 1M90C 1EZZB 2PZ1A 1C0MA 2VUBA 3ZBDA 1G5VA 1NLPC 2X4YA 3VRZA 3JCMW 1D1AA 4RTWA 5GAMd 2VGNA 1Q82U 2XDPA 2ZPHB 1I1JA 1I5LA 2LVMA 3I55A 3OS2A 2E64A 4M7AC 1UFFA 4EMKA 2L2PA 3FDRA 4PJNA 5GMKh 1Y71A 2XG8D 3LW5E 5IXBA 3OYMA 4JZ3A 4BI4A 2CP3A 1J3TA 3H0HA 2HQHA 2VKNA 1YWPA 4X1VA 1VQ7T 1N8RC 1S72T 1X2KA 1VOMA 3CCUQ 5FU6C 3O8VA 5FWCA 1OX8A 3G4SQ 5GMKe 4JS4A 1AWOA 3EAEA 3OS0A 1BI0A 1VQOA 3QDFA 1SSHA 2JM8A 3QDRB 3EG3A 1UHFA 1I81A 2XI9A 1M2OA 2KI7A 4IUVA 4M7AE 4PJJA 3MJXA 4IURA 4FYVB 1OPKA 3CXCS 1K0XA 3JCMP 1Z9ZA 1K1ZA 3CCLQ 2FRYA 4BB7A 5IN1A 2KSSA 4MZPA 4E7JA 5DLQE 2XKOC 4FW2A 1K4US 5AYFA 5HY6A 1YP5A 3DKMA 1VQPQ 2VV5A 2FHDA 3J7AF 4YTLA 2GTJA 2RHZA 4NS5A 1BI2A 3BDLA 1BI3A 1ZLMA 1FMKA 3PIOA 3EGDA 3HFNA 4OMNA 1S72A 2AK5A 2CDTA 2L3PA 4E7LA 4J6YA 2Y4YA 2RK1A 1KC8R 3ASKA 3RESA 4OB1B 3G71A 5KYUB 2NLUA 4ATOA 2F5TX 2DJQA 4ZN3A 2AKKA 4M75G 1BK2A 5GAN8 4MZMA 1R0CB 4C0GA 1SHGA 2QA4Q 4F7UG 1WFWA 1I5OB 2HZYA 1QP3A 4DBQA 2M02A 3CPWA 2EYZA 1RABB 2PVOB 2QQSA 2EKHA 3THKA 5LJ3f 4PFPA 1VQMT 3EFOA 1QVPA 1RAHB 5GAOr 4ZGEB 4QQGA 4PJOA 2KE9A 1SEMA 2O01E 3MO8A 5J26A 1YI2A 1CKBA 1SSFA 3CCET 5KYNA 3QG1A 2DTHA 2PNIA 1PM3A 1G3TA 2ZGWA 3VYGA 2NUTA 3PMTA 1C6VX 1WXBA 3GPLA 2P0QA 2JZ2A 4XU3A 2RJEA 3OB9A 1VQLT 3VJPA 4RCBA 2BTTA 2F5KA 1MNDA 1HK9A 3QZ5B 2G6FX 1IO6A 2E5KA 1KHCA 1QKWA 4A54A 4BI3A 2IPOB 1K76A 3CCQQ 3MP1A 1VQ4T 3OMGA 2VGMA 2QYZA 1PSEA 2OTJT 1H3ZA 2PTKA 2RA2A 2ZPBB 3META 1H3HA 1QCFA 3LGFA 1WLPB 3M55A 2LC4A 3NTHA 1VQMA 2KNBB 1R8OB 1SF9A 3L2WA 1R77A 2JJ9A 3PMIA 2YXYA 3CCST 1YJ9T 2K4YA 2FZGB 3MPUB 4QVDA 2FG0A 1BCOA 3CCEA 1JB0E 2LX7A 4A4HA 4JRQA 1OU8A 4PJOF 4F16A 1WZOA 1G3YA 4M7AG 1KSWA 1ZSZC 3CD6Q 2QG9B 1M1GA 4FYXB 3EGDB 1OQKA 3NHNA 2IG0A 2XMFA 2JMCA 1VQLA 1VQ9T 2EWNA 4EPCA 2FVUA 1UDLA 1T3SA 3OYNA 2K5FA 3OQ5A 4J8OA 1WXTA 5L8RE 3OYHA 3BDUA 3NFCA 2QEXQ 3M0QA 3EGUA 2E10A 4JS5A 4ANJA 5GMKj 1VQ4A 4AMCA 3MP6A 2OTJA 1KC8U 2A3LA 2W0ZA 3KUFA 1TS9A 5KYYA 3JCMV 2CP6A 2JNGA 5FRMA 2DIGA 3FC3A 1QCOA 4RCCA 1UGVA 2FO0A 4PJOD 2LCCA 5GANh 3EFOB 3CC2T 4CC4B 3CCSA 1YJ9A 2HBWA 4PJOB 2KRSA 3VS6A 4M4ZA 3ZL7C 4BDZA 1E7OA 4LDUA 2WSEE 5GANe 1U06A 3SFMA 5GAN6 4DBHA 1NYGA 2MMPA 4J83A 1EX4A 4OVAA 4JUVA 2BE7D 3L2VA 4BE2A 1LVKA 2NUTB 4XU2A 3OBWA 4C5IA 1YJWT 3S3MA 3QJYA 2RPNA 4JLIA 1KQSP 1NEBA 3RKYA 2QQAA 2DM1A 5GAN7 3LH5A 2OAWA 2XD0A 1RI0A 3NPFA 1WXUA 3JB9D 1WJSA 1ZX6A 2J6KA 1Y57A 2DKGA 3SEMA 2CSQA 5GAOm 3E9GA 3V8KA 2V1RA 3CMAQ
chains in the Genus database with same CATH topology
1YI2Q 1YJWQ 1Q7YR 1VQOQ 1KD1R 2QA4Q 3G4SQ 1S72Q 1KQSP 1VQNQ 3CMEQ 3CC2Q 2OTJQ 1K9MR 3CCRQ 3CC7Q 1M90R 1VQLQ 2OTLQ 1VQ5Q 3CCMQ 1Q82R 1K8AR 3CCLQ 3CPWP 1YIJQ 1VQKQ 1QVFP 3CXCP 1QVGP 1Q86R 3CCJQ 3G71Q 1KC8R 3CCEQ 1N8RR 1K73R 3G6EQ 1VQPQ 3CCQQ 3CCVQ 1JJ2P 1YHQQ 1VQ6Q 1VQ9Q 3CCSQ 3CC4Q 3OW2P 3I56Q 1YJ9Q 1YJNQ 1M1KR 1YITQ 3CCUQ 1Q81R 3I55Q 1NJIR 3CMAQ 1VQ8Q 1VQ4Q 1VQMQ 1W2BP 1VQ7Q 2QEXQ 3CD6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Q;  1YJW Q;  1Q7Y R;  1VQO Q;  1KD1 R;  2QA4 Q;  3G4S Q;  1S72 Q;  1KQS P;  1VQN Q;  3CME Q;  3CC2 Q;  2OTJ Q;  1K9M R;  3CCR Q;  3CC7 Q;  1M90 R;  1VQL Q;  2OTL Q;  1VQ5 Q;  3CCM Q;  1Q82 R;  1K8A R;  3CCL Q;  3CPW P;  1YIJ Q;  1VQK Q;  1QVF P;  3CXC P;  1QVG P;  1Q86 R;  3CCJ Q;  3G71 Q;  1KC8 R;  3CCE Q;  1N8R R;  1K73 R;  3G6E Q;  1VQP Q;  3CCQ Q;  3CCV Q;  1JJ2 P;  1YHQ Q;  1VQ6 Q;  1VQ9 Q;  3CCS Q;  3CC4 Q;  3OW2 P;  3I56 Q;  1YJ9 Q;  1YJN Q;  1M1K R;  1YIT Q;  3CCU Q;  1Q81 R;  3I55 Q;  1NJI R;  3CMA Q;  1VQ8 Q;  1VQ4 Q;  1VQM Q;  1W2B P;  1VQ7 Q;  2QEX Q;  3CD6 Q; 
#chains in the Genus database with same CATH topology
 4AFS C;  1BI1 A;  4C0D B;  1KD1 R;  1YBY A;  1RAI B;  2QGG A;  3CCR Q;  3CC2 A;  2E65 A;  2CP0 A;  2CP5 A;  4ZNX A;  3O5Z A;  4E7I A;  1VQ6 T;  4BY6 B;  2SEM A;  1XOV A;  2K3B A;  1GL5 A;  4D8K A;  2X4W A;  3WXM B;  4FW1 A;  2A28 A;  5IHI A;  3QYG B;  4C92 D;  8ATC B;  1UGP B;  3X24 B;  2A0F B;  5GMK m;  1B3Q A;  2M51 A;  2EJG A;  5EC7 A;  3LX7 A;  4FM4 B;  1D3B B;  1ZA1 B;  2LZ6 B;  3VU3 C;  2EJ9 A;  2YLB A;  2DL7 A;  1AZE A;  3SWN B;  3A98 A;  4XTZ A;  4CC3 A;  4R0K A;  5KCO A;  1N6A A;  2GFU A;  2LQW A;  3FIF A;  2EGA A;  3IQL A;  1VYU A;  4O5V A;  3J80 E;  2KK4 A;  1Y07 A;  2DIQ A;  2L89 A;  5FLX E;  5GAN 4;  2A7Y A;  5KYY B;  1EIF A;  1N27 A;  4Z8A A;  2K57 A;  1N9S A;  1BIB A;  1WJQ A;  3A8G B;  2YRD A;  1X6O A;  2CH4 A;  2COY A;  5HKC A;  4J9B A;  1HSQ A;  1H8K A;  1VQ6 A;  4DOV A;  3UT1 A;  1JBM A;  1Q7Y R;  1U1T A;  2DXT A;  2NUP A;  3VS0 A;  2LMJ A;  3PGG A;  2W10 A;  3L42 A;  4C8Q A;  1W1F A;  5AT1 B;  3GLX A;  4QT7 A;  1M9S A;  2G3R A;  5FWB A;  4RTZ A;  1SRL A;  2C0T A;  4IIM A;  4KUD K;  2KY9 A;  3DLM A;  1SG5 A;  3NGP A;  1Y96 A;  2DTI A;  2R58 A;  2WSF E;  3OS1 A;  3CXC P;  3FLG A;  3GF5 A;  3OYC A;  4D8D A;  2QI2 A;  2D9T A;  1FWZ A;  1TG0 A;  1MMD A;  4OGE A;  3TCJ A;  1M1F A;  1AT1 B;  1E6H A;  4JDS A;  4XTX A;  2C0O A;  1BU1 A;  2EGC A;  3JSC A;  1AEY A;  2CGH A;  3OYB A;  4Y28 E;  2DLP A;  4L6V 5;  1UGS B;  4WF2 A;  2EQM A;  1TUD A;  5LJ5 e;  2DEU A;  3G71 Q;  2L0A A;  1KJW A;  3G6E Q;  2RD1 A;  2K5I A;  2MWP A;  1YN8 A;  1KD1 U;  2HNI A;  4HCB A;  2K2V A;  3M4Y A;  2VXE A;  1YJN Q;  2EQK A;  1KQS S;  2GGR A;  1AWJ A;  4GY5 A;  4J6W A;  4BDY A;  3P8H A;  1PKS A;  1H92 A;  2V8K A;  2JN0 A;  1YCS B;  1YIJ T;  3NTI A;  1TXQ A;  2RJC A;  3CBO A;  5CKE A;  1M3B A;  3CME A;  2JXB A;  5CVI A;  4C8Q F;  4X9D A;  4JLG A;  4XTW A;  2QQR A;  1QQJ A;  2FRW A;  2GNC A;  2RI5 A;  2MPX C;  2A37 A;  4PFO A;  2RK2 A;  1YFN A;  2J06 A;  1YI2 Q;  4AFQ C;  1XTD A;  1M30 A;  4RG2 A;  1H64 1;  4C5E A;  3PVL A;  2FPF A;  5DM7 R;  3V8L A;  2RB6 A;  3MEU A;  1X27 A;  1U8R A;  2EW3 A;  2HQX A;  2XIC A;  1TUC A;  1ZUY A;  3SD4 A;  3OSV A;  1XQH A;  2KVQ G;  1OUL A;  3H9N A;  5GAN g;  4C8Q D;  2DL4 A;  1OZ3 A;  1CKA A;  2LDM A;  4C0Z A;  2NUP B;  1AWW A;  2FB7 A;  1YHQ T;  2PQW A;  1Q82 C;  4C8Q B;  1YIJ A;  5KCH A;  1WHJ A;  4M77 D;  2EKO A;  1Q7Y U;  5DY9 A;  3MCA B;  3TVT A;  3VS1 A;  4IUU A;  3VUB A;  3LWI A;  4B9X A;  3VS3 A;  2XK0 A;  4B9W A;  1HJD A;  3M59 A;  1VQ8 Q;  1NM7 A;  4JZ4 A;  4BE0 A;  2OTL T;  4M77 B;  3M53 A;  1VQN Q;  2KRO A;  3N5B B;  1X69 A;  2YUQ A;  2ABL A;  3A8L B;  2GFA A;  4HVW A;  4RTT A;  1T0H A;  3TU4 K;  1Y96 B;  1Q86 R;  2F2X A;  2EYW A;  3PE0 A;  4PJO C;  3ME9 A;  2D1X A;  1M2V A;  3QWY A;  1K73 R;  1I0C A;  1M1K R;  7AT1 B;  2DXB A;  1YWO A;  1Q95 G;  1X2Q A;  1K9M R;  1Y7X A;  4JJD A;  4NOY A;  2K3Y A;  1U1S A;  4M75 A;  3P8D A;  3M57 A;  1UG1 A;  3ZEH A;  3RER A;  5C0M A;  1D09 B;  3FEO A;  3OYF A;  3VS4 A;  4F7U A;  1HXD A;  2YWW A;  5M9O A;  1WX6 A;  1HYO A;  4II1 A;  2CUB A;  2L8D A;  2M1H A;  3TEE A;  1V76 A;  3HSB A;  1I8F A;  1OPL A;  2HEQ A;  2ZPI B;  5GAN 3;  5ECA A;  3GNF B;  4FU6 A;  4OF1 A;  2DFU A;  2COZ A;  4PJO E;  2OTL A;  4N0A A;  1K8A C;  1AWX A;  5D6W A;  4C0D C;  1WPY A;  1JXO A;  3ER0 A;  2CZ1 B;  5GAN 2;  2ATC B;  1RAE B;  1YIT Q;  4AT1 B;  3HRU A;  1YNZ A;  2P0P A;  2QDL A;  4J9G A;  5IT9 E;  3CC7 T;  4BY6 C;  1I4K 1;  2CUD A;  2MYS A;  1K8A U;  3CCM T;  2AHJ B;  1VQ7 A;  2I0N A;  9ATC B;  3RMQ A;  5LJ3 h;  2IVW A;  3HRT A;  3CPW P;  1D1C A;  3CEY A;  2YHT A;  2D8H A;  1TU0 B;  1LOJ A;  4OMM A;  2F69 A;  2ED1 A;  1K0S A;  4C92 C;  1JJ2 A;  3VS5 A;  3JCM f;  2EYY A;  4ZTJ A;  2E4H A;  4RUG A;  3SWN C;  1ZBX A;  1RL2 A;  5LJ3 e;  1W2B A;  2CP7 A;  2MWO A;  3ZFJ A;  4OMO A;  4V2S A;  5GAN d;  2A36 A;  4M75 F;  1R0B G;  4HCZ A;  2DVE A;  5LJ5 j;  2K5L A;  3CCJ Q;  2DL8 A;  4OP0 A;  4F7U F;  4AFZ C;  2MIO A;  3INZ A;  4KUI A;  5KE3 A;  4J7I A;  5I2S A;  4EDU A;  2LX9 A;  2ZAE A;  4OML A;  1NJI R;  2DL5 A;  3QUI A;  1OOT A;  2DER A;  2DVJ A;  2J6O A;  2MAM A;  4FIB A;  4EMK B;  3CC7 A;  2KRN A;  4M7A A;  1OZ2 A;  3CCM A;  1YCY A;  1QVF A;  3PNW C;  2K2M A;  4C92 E;  1B07 A;  1VQ8 T;  2DTO A;  2KYB A;  1M2V B;  3QYH B;  4QW2 A;  1M3A A;  3CC4 Q;  2E3H A;  2ROL A;  4KBM B;  3WVE B;  1A0N B;  4M75 D;  4M7D A;  3C95 A;  4QQD A;  5LJ5 g;  2DD4 A;  1WHM A;  4N4G A;  1K73 U;  2P0K A;  2SRC A;  1M1K U;  4M75 B;  1VQK Q;  4RTU A;  2COW A;  3CPF A;  2Z0W A;  3VRY A;  3CCU T;  2DXU A;  2EIF A;  4ZN1 A;  3CCV Q;  3BY7 A;  2RNA A;  3G4S T;  1K9M U;  3M0S A;  1ZUU A;  2DRM A;  5D7U A;  3RMS A;  3M54 A;  3JCM J;  1T3L A;  3CBP A;  2KEA A;  4OGC A;  4PK4 A;  2RJF A;  1KIK A;  2DEQ A;  1QCN A;  2QTV A;  3OYK A;  2DYB A;  2JT4 A;  2GTO A;  1SKU B;  5GAM f;  1MV3 A;  3KXT A;  2L3Q A;  1BBZ A;  4BAC A;  5GAO n;  3CCL T;  4KGZ B;  3F70 A;  4LNP A;  1RUW A;  2EQI A;  3JB9 I;  1VQP T;  2LT1 A;  4M7A F;  1FX7 A;  3A8H B;  1PD0 A;  1KQ2 A;  1KC8 C;  3I56 Q;  2QK0 A;  1Q81 R;  3EHQ A;  2YUN A;  4ELY C;  2FEI A;  2DYI A;  4A4G A;  4M7D F;  2NYS A;  3CCU A;  1RLP C;  4KRT A;  2AIR B;  3OYA A;  4GLK A;  4B6M A;  2DPP B;  5I2M A;  4HA8 A;  2LQN A;  3G4S A;  2QDY B;  4Z88 A;  2DX1 A;  1JJ2 S;  3H0I A;  3TQ7 P;  2DNU A;  2ZPF B;  3M0P A;  2DMO A;  2DF6 A;  3KBG A;  1W2B S;  2HKQ B;  1MHN A;  2OI3 A;  2QA4 T;  4M78 A;  2RJD A;  4KT0 E;  1LNX A;  2QAZ A;  3QII A;  1W4S A;  4GBQ A;  4XK8 E;  2HSP A;  2KRM A;  2CP2 A;  3PIP A;  4DA4 A;  3CPW S;  2QGF B;  3JB9 G;  1VQ5 Q;  1QWE A;  4A4F A;  4Z89 A;  1OU9 A;  2X51 A;  1B34 A;  3CCL A;  2KR3 A;  3OYJ A;  1NJI U;  1W70 A;  3L2Q A;  3PVQ A;  2D8J A;  4M7D D;  4PJM A;  1VQP A;  3FJ5 A;  3OYI A;  3SHW A;  1VIE A;  1VQ9 A;  1XNI A;  1UGQ B;  2XID A;  4M7D B;  3CME Q;  2YT6 A;  5LJ5 d;  2F1L A;  4XU1 A;  1G83 A;  2LJ0 A;  1WNL A;  1AZG B;  2LRQ A;  1T0J A;  5HK0 A;  2LJ3 A;  3MKD A;  4M77 C;  2FPE A;  3L2R A;  4E7Z A;  4C92 G;  3TRE A;  3UPU A;  1WQW A;  5CKD A;  3V7S A;  1NE8 A;  2DA9 A;  1JEG A;  4BI8 B;  3OW2 A;  1NLO C;  2LNV A;  4PL6 A;  5LJ3 j;  2E5Q A;  2K7A A;  5CQX A;  3CBM A;  3OY9 A;  3M0U A;  1PD1 A;  3CCV T;  3CCQ T;  5IHN A;  3G1J A;  1UGR B;  1BCM A;  1ZUK A;  2HMA A;  2ZZD A;  2RQT A;  5C6S A;  4R55 A;  2LTO A;  4FSS A;  2D0Q B;  2GQI A;  1JXM A;  3RKW A;  4M78 F;  2KXD A;  1VYV A;  1D0Y A;  2KXC A;  2VXF A;  4C8Q E;  2YSQ A;  5KYX A;  1X6G A;  3PFS A;  1JU5 C;  4BE1 A;  2CZ6 B;  3I9Q A;  1IHW A;  2DIL A;  5KH6 A;  3DB4 A;  3TSZ A;  4KH1 B;  2AT1 B;  1YJW A;  3JV3 A;  1LCK A;  4M77 E;  1GCQ A;  1QVG A;  5IH2 A;  2AZV A;  4EMH A;  3AT1 B;  5LJ3 g;  3EG9 A;  1GBR A;  3CD6 T;  2HD0 A;  2YRC A;  2CRE A;  1UTI A;  5A0G A;  4RG8 A;  3I55 Q;  3H6Z A;  1AD5 A;  3GP8 A;  3M56 A;  3NMZ C;  2MF2 A;  1IHV A;  3QJ6 A;  4PLI A;  2VWF A;  3V8J A;  3X25 B;  3QHS A;  3C12 A;  1Q81 U;  4M78 D;  3A8M B;  3JCM b;  5GMK i;  4GLM A;  2C06 A;  2QEX T;  3MEV A;  1GRI A;  3CCQ A;  1QP2 A;  4M78 B;  4PJL A;  2LCS A;  2O2O A;  1VQO Q;  3RNJ A;  4K11 A;  1PHT A;  4VUB A;  4IUP A;  1ZA2 B;  1RAA B;  2KDS A;  2DBM A;  2X35 A;  2X9H A;  1OEB A;  2FZK B;  2WAC A;  1B34 B;  2I2L A;  4CC7 A;  2XU8 A;  3S3N A;  1WGS A;  2X3W D;  3LWH A;  3UA7 A;  2K3X A;  3M5A A;  2BZ8 A;  2GF7 A;  1KQ1 A;  1PC0 A;  5I11 A;  2FL7 A;  3Q1J A;  3CD6 A;  2RH2 A;  1M90 R;  2E6N A;  5A0D A;  3G7Z A;  5D6Y A;  1V1C A;  2KYM A;  4N4I A;  4ELZ C;  4JJN K;  4FCY A;  5LJ5 h;  3RBB B;  4EMK C;  4J6X A;  3PT9 A;  3VS7 A;  4X34 A;  3PTA A;  3BW1 A;  2Y4X A;  4KGV B;  4PKC C;  3H41 A;  1S72 Q;  3GNG A;  2QEX A;  1KD1 C;  4CRI A;  6AT1 B;  5IAY A;  1WHL A;  4PFZ A;  2X4X A;  4BD3 A;  4DOW A;  1N8R R;  1MGQ A;  3CMA T;  1F1B B;  4PNO A;  4MML A;  2FPD A;  3CCR T;  4M75 C;  5CKB A;  5KYX B;  3M0R A;  3QPH A;  1WQ7 A;  4J9F A;  4KUL A;  1VUB A;  2WSC E;  3CXC A;  3RKX A;  3A5Z B;  5J3B A;  2JTF A;  2CKK A;  5CKH A;  1FXX A;  3RDV A;  1EFN A;  3EG9 B;  5LJ3 d;  4KGX B;  2PUO B;  3E2U A;  4HCK A;  2CZ7 B;  4E2F B;  2RI2 A;  4XTY A;  5D6X A;  2X3X D;  2RM4 A;  4N0A C;  5KYW A;  2R5M A;  4FSX A;  1CSK A;  2ESW A;  3EHR A;  4M77 G;  4HCC A;  2JS0 A;  2EPD A;  1O75 A;  1JQQ A;  2MOX A;  1D0Z A;  4M75 E;  4QKU A;  2XHC A;  1MMA A;  3OBY A;  5GAO q;  4OB3 B;  4O6J A;  2RQU A;  2XDB A;  2DZ9 A;  1QW1 A;  3CMA A;  2JTM A;  1Q7Y C;  3I5S A;  4HT8 A;  1SHF A;  2BUD A;  2E12 A;  2HSE B;  2DZC A;  1M5Q 1;  1QWF A;  5DLO A;  1NG2 A;  3S6W A;  3HFO A;  4F04 B;  3BE3 A;  5CAI A;  4Q5W A;  2M9U A;  1WHK A;  3JCM c;  2K6D A;  2M0O A;  1VQM Q;  3OMC A;  4JRP A;  1AVZ C;  1KHI A;  2HBP A;  2V8J A;  5CK9 A;  4C5H A;  1RI9 A;  1PRL C;  1TTH B;  2EBP A;  2RQW A;  3OS5 A;  3OYY A;  1PWT A;  1KG1 A;  3CCE Q;  3OSS C;  4OMP A;  1ABQ A;  1B7T A;  2L3S A;  4LUD A;  8AT1 B;  2KMT A;  4ZGD B;  2KBT A;  2ROT A;  3MEW A;  1M90 U;  5HK3 A;  4XU0 A;  3WVD B;  4LE9 A;  1RAF B;  1VQL Q;  4C0F A;  4QVC A;  3HP9 A;  4AG2 C;  3HHT B;  1M27 C;  4AFU C;  4M7D C;  1FMW A;  2JW4 A;  2DAQ A;  2DK3 A;  3J81 E;  1YHQ A;  1WIE A;  4E7K A;  1VQ4 Q;  3TSW A;  3UAT A;  4FYW B;  2F2W A;  2OTJ Q;  2OAU A;  3OYL A;  4E47 A;  1WHH A;  3MP8 A;  3X20 B;  4D6W A;  3G71 T;  3R6N A;  1N8R U;  1PNJ A;  3P8B B;  3G6E T;  4TVR A;  1JRI A;  2A08 A;  3JCM h;  1YJN T;  1SRM A;  2CSI A;  2RQR A;  2DBK A;  3REB B;  4LDX A;  4EMG A;  2ZCF B;  1JJ2 P;  3U23 A;  3CCS Q;  1YJ9 Q;  2HL5 C;  5A2Q E;  5GAO l;  3QKJ A;  1W2B P;  3CQT A;  2E1H A;  1VA7 A;  2LJ1 A;  2R57 A;  2RQV A;  1VIF A;  2YUO A;  5KYW B;  3C94 A;  4FL6 A;  1WYX A;  2O9S A;  2QQ9 A;  3JCM e;  1WHG A;  1ZSG A;  4M7D E;  2HDA A;  3LH0 A;  4HKE A;  4QQ6 A;  4Y91 A;  1D0X A;  3EG1 A;  1I07 A;  1VQ9 Q;  1YI2 T;  1X43 A;  1D1B A;  2LT4 A;  3QO3 A;  1PRM C;  2AKL A;  4XAX B;  5GMK l;  3M58 A;  1ZBJ A;  5IHK A;  3R6O A;  2BIV A;  1M4Z A;  2V8I A;  2RI3 A;  2VB6 A;  4J7F A;  1UUE A;  3QSU A;  2KT8 A;  2EFI A;  1QVF P;  2EYQ A;  4MZT A;  4WTO B;  2RMO A;  1WJR A;  5FU7 B;  3V7R A;  3M0T A;  1JO8 A;  2HCK A;  2JS2 A;  3G6E A;  2F2V A;  1RAG B;  3BFM A;  1YJN A;  3ULR B;  4LD9 K;  1PSF A;  5L23 A;  4L5G A;  3CC2 Q;  3MHX A;  1O9S A;  3V7C A;  3GOX A;  2BZX A;  1E6G A;  2NUZ A;  4M78 C;  4C5G A;  2DXC A;  1Q86 C;  4XTU A;  4OMQ A;  2KQW A;  1C1A A;  1QLY A;  3UWN A;  3FJP A;  2K79 A;  1K73 C;  2HL3 A;  1VQN T;  1M1K C;  1M3C A;  1OX9 A;  3C0C A;  1YJW Q;  1K9A A;  2C0I A;  4DEX A;  1S1N A;  1Q86 U;  5LL6 S;  4FYY B;  3E9F A;  1K9M C;  5GAM h;  3VV0 A;  3H0F A;  3I5R A;  1PCX A;  1NYF A;  2YDL A;  4J9C A;  1NPR A;  1RAD B;  1Z9Q A;  4JRI A;  1WI7 A;  1KFZ A;  2EQJ A;  3JB9 H;  1UJ0 A;  2RHX A;  3C4S A;  4F7U B;  3HRS A;  3GIB A;  3T9N A;  1G3S A;  1KK7 A;  2GCX A;  4E7H A;  2RHI A;  5I22 A;  2BE9 B;  3VKI A;  3H8Z A;  4F17 A;  1AHJ B;  2MCN A;  5GAM e;  4DBF A;  4M78 E;  4ZTF A;  4J9D A;  4MMK A;  1MMN A;  2O4X A;  3UF4 A;  1M8V A;  1VQ6 Q;  3E19 A;  3I35 A;  3HL8 A;  2P4R A;  3DB3 A;  2JOY A;  2JTE A;  2E3I A;  1V29 B;  1VQ8 A;  2EQU A;  1QMC A;  5A0L A;  2ECZ A;  1G2B A;  2K9G A;  4BUG A;  1VQN A;  1MUZ A;  2JM9 A;  4QVZ A;  4RKU E;  5I21 A;  4PJO G;  4ESR A;  2QAS A;  1YIT T;  3KFV A;  4CI0 C;  2LP5 A;  1RAC B;  2R5A A;  4DEY A;  2LQ8 A;  3RIR A;  2KGT A;  2FYK A;  2CZ0 B;  2RHU A;  2ZPE B;  2NWM A;  4UC4 A;  4C92 A;  2QQB A;  1D3B A;  1GCQ C;  3SWN A;  3RR6 A;  4ZGJ B;  2DJZ A;  2FZC B;  1N9R A;  4M7D G;  2O9V A;  1X6B A;  3LYI A;  2B8A A;  3L1A A;  2H3E B;  4ORZ A;  5CQY A;  4OB2 B;  1NJI C;  2YLC A;  4DQ2 A;  2V26 A;  4M7A D;  3L2U A;  3CCJ T;  2EAY A;  2ED0 A;  1TSF A;  2M0Y A;  3JRZ A;  3JB9 J;  5FRN A;  3GBQ A;  2CYZ B;  3EG2 A;  4M7A B;  2QTX A;  4FT2 A;  4LD6 A;  3JB9 F;  1U5S A;  1VYT A;  2PUK B;  1GXI E;  2DRK A;  4RMO A;  3SDZ A;  3OW2 P;  1TH7 A;  1NEG A;  4WCI A;  1YIT A;  3VS2 A;  4C8Q C;  3OYE A;  3MEA A;  1QVF S;  1DJ7 B;  4NL2 A;  2JMA A;  4HXJ A;  1OI1 A;  4MDW A;  2CH4 W;  4LUE A;  4L59 A;  5FU6 B;  1NBE B;  4J9H A;  3CC4 T;  3VYH B;  4F14 A;  5CO7 A;  2VYT A;  1UEB A;  1MNE A;  1BIA A;  2OX7 A;  4JRK A;  1BB9 A;  4IKF A;  1Y0M A;  3E1S A;  1PG5 B;  4C92 F;  5GJW B;  5GAN f;  1VQK T;  1GBQ A;  4LDY A;  2PVD B;  2QA4 A;  2IIM A;  2HQE A;  4RTY A;  1QVG P;  1TOV A;  2V1Q A;  2O4X B;  3LLR A;  3CCJ A;  4Y92 A;  3JCM X;  2KAF A;  3SB2 A;  1U3O A;  1GFC A;  1N5Z A;  1UEC A;  3JCM g;  2EYX A;  3FB9 A;  3LGL A;  3EFR A;  4A63 B;  5FW9 A;  2H3J A;  2ZPG B;  4Z02 A;  4X9C A;  1KQS A;  4LXC A;  4M78 G;  5GAO p;  1YIJ Q;  1BKB A;  1ZSZ A;  4E6R A;  1PKT A;  1TWB A;  3REA B;  3OA6 A;  2MK5 A;  4ME7 A;  1XJW B;  2GBQ A;  4HVU A;  2H8H A;  4MDX A;  3FRN A;  2RHY A;  3M4G A;  2BZY A;  1ABO A;  3A8O B;  3CC4 A;  5HCK A;  1Q81 C;  1HD3 A;  2VAS A;  4EIK A;  4C92 B;  4J9I A;  3X28 B;  3EGX A;  2VVK A;  1ACM B;  5CKF A;  3I56 T;  2E6Z A;  2DE0 X;  3S3O A;  1VQK A;  3EFS A;  2M16 A;  1BYM A;  5EG2 A;  5CR2 A;  3CCV A;  2DL3 A;  4AG1 C;  3HPW A;  2E70 A;  5GAM j;  5GJV B;  4JJC A;  4A4K A;  4E7S A;  2YRV A;  2J7I A;  1GCP A;  2JVV A;  1GFD A;  2D6F A;  3HTR A;  5KE2 A;  4JPB W;  1YHQ Q;  4A53 A;  4R56 A;  2L5Q A;  3EH2 A;  4NL3 A;  4OB0 B;  2J6F A;  1AOJ A;  1UHC A;  4LN2 A;  1G8X A;  2PVG B;  4OMF B;  1IZ6 A;  1VQ5 T;  2EVR A;  3A1P A;  2JUF A;  3D7S B;  4HT9 A;  1IB8 A;  1OV3 A;  5FU7 C;  1NZ9 A;  2OTL Q;  4XQ3 A;  2HKN A;  1Q82 R;  2ENM A;  2LCL A;  5J39 A;  5FRO A;  4DBR A;  5CCA A;  2OJ2 A;  4J9E A;  4CC2 A;  5GAM g;  1P92 A;  2RO0 A;  1ZHI A;  5CIU A;  2D0N A;  2B86 A;  3CME T;  4P5N A;  4M77 A;  3AHU A;  2LQK A;  3QBY A;  3I56 A;  2EJF A;  1VQ7 Q;  4N4H A;  2LNH B;  1IRX A;  2Y90 A;  1RLQ C;  1LPL A;  1IGQ A;  4J5Y A;  1WDX A;  4A4E A;  2QXF A;  4PLL A;  4IUQ A;  3OW2 S;  3OYD A;  2E41 A;  2O31 A;  2YUP A;  3DLL A;  2L3R A;  1LJO A;  3JCM d;  1IRE B;  2O88 A;  3JCM Q;  3VUZ A;  2GQV A;  1QKX A;  1NPP A;  1ZQ1 A;  3HKS A;  3EH1 A;  4LDW A;  1VQ5 A;  1ZSZ B;  3UA6 A;  1IGU A;  1UJY A;  2VC8 A;  3JAM E;  2DET A;  2RF0 A;  1IXD A;  2AZS A;  2P4T A;  4RTX A;  1FYN A;  4C8Q G;  5LJ5 f;  2DD5 A;  4IUT A;  5GAN 5;  1OYX A;  3EG0 A;  1UE9 A;  3CC7 Q;  1QVG S;  3CCM Q;  1K8A R;  4RTV A;  1M8M A;  2DO3 A;  2J05 A;  4FT4 A;  3RUX A;  5GAN j;  3EGX B;  4LDV A;  3I55 T;  2X4J A;  4HVV A;  4IIO A;  2CT3 A;  2EGE A;  4M77 F;  2HAX A;  4XTV A;  1MV0 B;  3URG A;  1FMV A;  4JJB A;  1SPK A;  4F7U E;  2CS7 A;  3UDC A;  3QXE B;  3QWX X;  2BKD N;  1MMG A;  3QZ9 B;  3CCR A;  3X26 B;  2MI6 A;  1X75 C;  5IXF A;  5KYU A;  4KH0 B;  2KT1 A;  1X01 A;  2PU9 B;  1UB4 A;  1WA7 A;  1VQO T;  1G3W A;  3L2Z A;  2RN8 A;  1TUG B;  1ARK A;  1W6X A;  2XDD A;  3NTK A;  2CT4 A;  2P84 A;  3M9Q A;  3OYG A;  1M90 C;  1EZZ B;  2PZ1 A;  1C0M A;  2VUB A;  3ZBD A;  1G5V A;  1NLP C;  2X4Y A;  3VRZ A;  3JCM W;  1D1A A;  4RTW A;  5GAM d;  2VGN A;  1Q82 U;  2XDP A;  2ZPH B;  1I1J A;  1I5L A;  2LVM A;  3I55 A;  3OS2 A;  2E64 A;  4M7A C;  1UFF A;  4EMK A;  2L2P A;  3FDR A;  4PJN A;  5GMK h;  1Y71 A;  2XG8 D;  3LW5 E;  5IXB A;  3OYM A;  4JZ3 A;  4BI4 A;  2CP3 A;  1J3T A;  3H0H A;  2HQH A;  2VKN A;  1YWP A;  4X1V A;  1VQ7 T;  1N8R C;  1S72 T;  1X2K A;  1VOM A;  3CCU Q;  5FU6 C;  3O8V A;  5FWC A;  1OX8 A;  3G4S Q;  5GMK e;  4JS4 A;  1AWO A;  3EAE A;  3OS0 A;  1BI0 A;  1VQO A;  3QDF A;  1SSH A;  2JM8 A;  3QDR B;  3EG3 A;  1UHF A;  1I81 A;  2XI9 A;  1M2O A;  2KI7 A;  4IUV A;  4M7A E;  4PJJ A;  3MJX A;  4IUR A;  4FYV B;  1OPK A;  3CXC S;  1K0X A;  3JCM P;  1Z9Z A;  1K1Z A;  3CCL Q;  2FRY A;  4BB7 A;  5IN1 A;  2KSS A;  4MZP A;  4E7J A;  5DLQ E;  2XKO C;  4FW2 A;  1K4U S;  5AYF A;  5HY6 A;  1YP5 A;  3DKM A;  1VQP Q;  2VV5 A;  2FHD A;  3J7A F;  4YTL A;  2GTJ A;  2RHZ A;  4NS5 A;  1BI2 A;  3BDL A;  1BI3 A;  1ZLM A;  1FMK A;  3PIO A;  3EGD A;  3HFN A;  4OMN A;  1S72 A;  2AK5 A;  2CDT A;  2L3P A;  4E7L A;  4J6Y A;  2Y4Y A;  2RK1 A;  1KC8 R;  3ASK A;  3RES A;  4OB1 B;  3G71 A;  5KYU B;  2NLU A;  4ATO A;  2F5T X;  2DJQ A;  4ZN3 A;  2AKK A;  4M75 G;  1BK2 A;  5GAN 8;  4MZM A;  1R0C B;  4C0G A;  1SHG A;  2QA4 Q;  4F7U G;  1WFW A;  1I5O B;  2HZY A;  1QP3 A;  4DBQ A;  2M02 A;  3CPW A;  2EYZ A;  1RAB B;  2PVO B;  2QQS A;  2EKH A;  3THK A;  5LJ3 f;  4PFP A;  1VQM T;  3EFO A;  1QVP A;  1RAH B;  5GAO r;  4ZGE B;  4QQG A;  4PJO A;  2KE9 A;  1SEM A;  2O01 E;  3MO8 A;  5J26 A;  1YI2 A;  1CKB A;  1SSF A;  3CCE T;  5KYN A;  3QG1 A;  2DTH A;  2PNI A;  1PM3 A;  1G3T A;  2ZGW A;  3VYG A;  2NUT A;  3PMT A;  1C6V X;  1WXB A;  3GPL A;  2P0Q A;  2JZ2 A;  4XU3 A;  2RJE A;  3OB9 A;  1VQL T;  3VJP A;  4RCB A;  2BTT A;  2F5K A;  1MND A;  1HK9 A;  3QZ5 B;  2G6F X;  1IO6 A;  2E5K A;  1KHC A;  1QKW A;  4A54 A;  4BI3 A;  2IPO B;  1K76 A;  3CCQ Q;  3MP1 A;  1VQ4 T;  3OMG A;  2VGM A;  2QYZ A;  1PSE A;  2OTJ T;  1H3Z A;  2PTK A;  2RA2 A;  2ZPB B;  3MET A;  1H3H A;  1QCF A;  3LGF A;  1WLP B;  3M55 A;  2LC4 A;  3NTH A;  1VQM A;  2KNB B;  1R8O B;  1SF9 A;  3L2W A;  1R77 A;  2JJ9 A;  3PMI A;  2YXY A;  3CCS T;  1YJ9 T;  2K4Y A;  2FZG B;  3MPU B;  4QVD A;  2FG0 A;  1BCO A;  3CCE A;  1JB0 E;  2LX7 A;  4A4H A;  4JRQ A;  1OU8 A;  4PJO F;  4F16 A;  1WZO A;  1G3Y A;  4M7A G;  1KSW A;  1ZSZ C;  3CD6 Q;  2QG9 B;  1M1G A;  4FYX B;  3EGD B;  1OQK A;  3NHN A;  2IG0 A;  2XMF A;  2JMC A;  1VQL A;  1VQ9 T;  2EWN A;  4EPC A;  2FVU A;  1UDL A;  1T3S A;  3OYN A;  2K5F A;  3OQ5 A;  4J8O A;  1WXT A;  5L8R E;  3OYH A;  3BDU A;  3NFC A;  2QEX Q;  3M0Q A;  3EGU A;  2E10 A;  4JS5 A;  4ANJ A;  5GMK j;  1VQ4 A;  4AMC A;  3MP6 A;  2OTJ A;  1KC8 U;  2A3L A;  2W0Z A;  3KUF A;  1TS9 A;  5KYY A;  3JCM V;  2CP6 A;  2JNG A;  5FRM A;  2DIG A;  3FC3 A;  1QCO A;  4RCC A;  1UGV A;  2FO0 A;  4PJO D;  2LCC A;  5GAN h;  3EFO B;  3CC2 T;  4CC4 B;  3CCS A;  1YJ9 A;  2HBW A;  4PJO B;  2KRS A;  3VS6 A;  4M4Z A;  3ZL7 C;  4BDZ A;  1E7O A;  4LDU A;  2WSE E;  5GAN e;  1U06 A;  3SFM A;  5GAN 6;  4DBH A;  1NYG A;  2MMP A;  4J83 A;  1EX4 A;  4OVA A;  4JUV A;  2BE7 D;  3L2V A;  4BE2 A;  1LVK A;  2NUT B;  4XU2 A;  3OBW A;  4C5I A;  1YJW T;  3S3M A;  3QJY A;  2RPN A;  4JLI A;  1KQS P;  1NEB A;  3RKY A;  2QQA A;  2DM1 A;  5GAN 7;  3LH5 A;  2OAW A;  2XD0 A;  1RI0 A;  3NPF A;  1WXU A;  3JB9 D;  1WJS A;  1ZX6 A;  2J6K A;  1Y57 A;  2DKG A;  3SEM A;  2CSQ A;  5GAO m;  3E9G A;  3V8K A;  2V1R A;  3CMA Q; 
#chains in the Genus database with same CATH homology
 1YI2 Q;  1YJW Q;  1Q7Y R;  1VQO Q;  1KD1 R;  2QA4 Q;  3G4S Q;  1S72 Q;  1KQS P;  1VQN Q;  3CME Q;  3CC2 Q;  2OTJ Q;  1K9M R;  3CCR Q;  3CC7 Q;  1M90 R;  1VQL Q;  2OTL Q;  1VQ5 Q;  3CCM Q;  1Q82 R;  1K8A R;  3CCL Q;  3CPW P;  1YIJ Q;  1VQK Q;  1QVF P;  3CXC P;  1QVG P;  1Q86 R;  3CCJ Q;  3G71 Q;  1KC8 R;  3CCE Q;  1N8R R;  1K73 R;  3G6E Q;  1VQP Q;  3CCQ Q;  3CCV Q;  1JJ2 P;  1YHQ Q;  1VQ6 Q;  1VQ9 Q;  3CCS Q;  3CC4 Q;  3OW2 P;  3I56 Q;  1YJ9 Q;  1YJN Q;  1M1K R;  1YIT Q;  3CCU Q;  1Q81 R;  3I55 Q;  1NJI R;  3CMA Q;  1VQ8 Q;  1VQ4 Q;  1VQM Q;  1W2B P;  1VQ7 Q;  2QEX Q;  3CD6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...