3CCRQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccrQ00
3CCUQ 3CCRQ 3CD6Q 2OTJQ 1QVGP 3CXCP 2QEXQ 3CC4Q 3CCJQ 3CCMQ 1S72Q 1VQ6Q 3G6EQ 1VQ8Q 1VQPQ 1Q82R 3CCSQ 1YHQQ 1JJ2P 1KQSP 1VQNQ 1N8RR 2QA4Q 1Q81R 1KC8R 1K73R 3CCQQ 1NJIR 3G4SQ 3OW2P 1YI2Q 3G71Q 1VQ5Q 1VQ7Q 3CCLQ 1M1KR 1Q86R 3CC7Q 1VQOQ 3CMAQ 1VQ4Q 1KD1R 1YJNQ 2OTLQ 1VQMQ 1Q7YR 1YJ9Q 1VQLQ 3CCEQ 3CPWP 3CC2Q 1M90R 1VQ9Q 3CCVQ 3I55Q 1K8AR 1YIJQ 1YJWQ 1VQKQ 1QVFP 1K9MR 1YITQ 3I56Q 1W2BP 3CMEQ
chains in the Genus database with same CATH superfamily
2D1XA 2BZYA 3CPWS 4ANJA 3CCSQ 2DL5A 2DL3A 2A08A 4V2SA 1Q81R 1KC8R 2CUBA 3RMSA 4M78E 1K4US 4FU6A 1NG2A 2AKLA 1BIAA 1M5Q1 1PWTA 1UECA 3I9QA 3OYFA 2OTJT 2Z0WA 4EPCA 2XIDA 3V8LA 1YHQQ 4BI3A 1ZSZA 2LTOA 3EFSA 4JJNK 4C0ZA 3G71T 4A63B 2QTVA 5AYFA 3OS0A 2E70A 2YUNA 3JB9H 4FM4B 3MEVA 1V29B 4M7DD 1NYFA 1YIJA 2AZVA 1RABB 2DIGA 1UGPB 4M4ZA 4ORZA 1MGQA 2YRVA 5IHIA 5GAMj 1VQ6T 2DL7A 4OMFB 1T0JA 1UUEA 5KYYB 1W2BS 3BW1A 4IIMA 1K73U 3L1AA 2ESWA 3HFOA 2I2LA 5KE3A 2CZ6B 2HL3A 1RADB 4PL6A 1OPLA 2EWNA 1D1CA 3VRYA 1YBYA 2DBKA 1Q81U 1KC8U 3UDCA 4BE1A 4M77C 5IXBA 2HQHA 3OYAA 4E7HA 4Y91A 3X28B 1NLPC 2NUZA 4PJOE 4RTUA 1VQLA 1FX7A 5LJ3f 2A0FB 4J9FA 2JMAA 3M57A 2EGCA 4KUIA 2M51A 5GANh 1IHWA 1X6GA 3VUBA 1WXUA 3QPHA 2QEXQ 2HKQB 3D7SB 3JCMh 4PFZA 3ZBDA 2EGAA 1AEYA 4IUPA 1JJ2A 3M0SA 1P92A 5LJ5g 2CH4W 4PFPA 3QIIA 4F7UG 4OMLA 3I55A 1JB0E 2NUPB 1WYXA 4J7IA 2F2VA 2RJDA 1TTHB 2JJ9A 5CKBA 3UT1A 2OX7A 2CP2A 2PVDB 1YITQ 1IGUA 3I35A 4WF2A 4RTYA 4L5GA 4C5EA 2YUPA 1ZLMA 5D6XA 2CH4A 2KXDA 1CKAA 1NPRA 4J6YA 4LDXA 5CKEA 4X9CA 4F04B 3PIOA 2BZ8A 3ER0A 4J9BA 3EG2A 4IUQA 1K1ZA 1K8AR 2VVKA 3OBYA 5GAMd 1YI2T 5IN1A 4KRTA 4QVCA 5CKHA 5GAN8 3WVEB 3CCLT 5IT9E 1JEGA 2DX1A 2SEMA 3URGA 1MUZA 2EJGA 1RUWA 1G5VA 3M5AA 3CD6T 4EMHA 5CAIA 4JJCA 3JCMV 3CC7T 3M0TA 4JLGA 1AWOA 1XNIA 2NWMA 1SHFA 2QASA 2EKOA 2F5TX 2ZPGB 4M75D 4J7FA 3THKA 1ZQ1A 2E41A 4XTZA 1S72T 3OBWA 1VQ5A 2CT4A 4ELZC 4DOVA 1QCOA 1QWFA 1ZSGA 4N4HA 1K9MC 3CC4T 1ZHIA 4MDWA 4O6JA 2DEQA 2E3IA 3JCMJ 1KSWA 4C5HA 1UJYA 3CC4Q 1VQ6Q 5LJ3d 2KNBB 5LJ5h 3TU4K 3AHUA 2KI7A 1X75C 3NTIA 1M8VA 1U06A 4M77B 4VUBA 2KQWA 4J8OA 1AVZC 4E2FB 1XTDA 2KEAA 1H3HA 4A4HA 5KYWB 1VQNT 1RAAB 2CKKA 1KFZA 2JUFA 4BY6C 1BIBA 4PFOA 5C0MA 3VU3C 3EGXB 3NMZC 1VQ4T 1LNXA 5EG2A 4JRIA 4M75A 4WTOB 3I55T 1GRIA 5CCAA 2C0TA 4XU3A 4O5VA 4C92G 2D0QB 4Z89A 3M56A 1EZZB 1SG5A 5KCOA 1WHLA 2ATCB 2HZYA 2O9VA 2P0QA 1H641 1XOVA 3CCQQ 3RKYA 2VUBA 5CO7A 2LRQA 1JU5C 1QKWA 3CQTA 4PLIA 2EYZA 1K9MU 2HSPA 3OYGA 3REAB 4NL2A 3G6ET 2HBPA 1UGSB 1VQLQ 1PD1A 2RHYA 3RIRA 2LVMA 3LYIA 1M90U 4P5NA 1OU9A 4WCIA 3HL8A 1UGQB 1KQ2A 1E7OA 1U5SA 1VQNA 4LUDA 2VV5A 2FB7A 3G7ZA 4ATOA 2O4XA 4M77D 2DZ9A 3UPUA 3QYGB 4PJLA 2MCNA 3E9GA 2AHJB 2P0KA 4M78C 5IAYA 2JOYA 1AZEA 3HPWA 5GMKh 1VQMA 2JMCA 1UFFA 4RTTA 3FC3A 1LCKA 4ZGEB 2RQTA 1QVFP 5CK9A 1V76A 4QQ6A 2BIVA 2LNHB 7AT1B 3EHRA 4RTVA 4M75G 2DLPA 3H0HA 1KIKA 3OYBA 2JN0A 2FRYA 3PTAA 1WI7A 2ABLA 1GBRA 2YUQA 4QQGA 4AT1B 4M7DC 1HSQA 1KQSS 5HK0A 2RO0A 4M7DA 3H9NA 3TREA 3JCMd 1VQ5T 1YWOA 1QVGP 3MCAB 4M78A 1M8MA 5D6YA 1DJ7B 2DZCA 1PKTA 5LJ5f 5FROA 3PT9A 3OW2P 2EPDA 4A4EA 4BY6B 1MNEA 2XK0A 3OYKA 1ZX6A 2P4RA 2MIOA 3CC7A 1M1KU 4M7AA 3DLLA 4E7SA 3CMAA 1M2VB 4ELYC 3VKIA 2L0AA 3CCLA 2RN8A 2EW3A 3CCRQ 4JJDA 4F7UF 2JS0A 2HNIA 2P0PA 2AIRB 2RQWA 2FPDA 4Z88A 1N8RR 2D6FA 4M7DE 3CBPA 3JCMg 3QZ9B 1G2BA 1QVPA 2XDBA 2V1RA 2JTMA 3G71Q 4EDUA 1KD1C 1NZ9A 4OB2B 1UTIA 4IUUA 2R57A 1QVGS 2LC4A 2ROTA 2A7YA 4NS5A 4LD6A 1Q86C 5L8RE 4IURA 4JZ4A 2VGNA 1AOJA 3OA6A 1D3BB 2HKNA 1OEBA 1W1FA 3EG1A 4XTVA 5GAN2 1B34B 1VYVA 1BI3A 2G6FX 5I21A 1M3BA 1H8KA 2DAQA 5DLQE 3I5SA 1ZBXA 1O75A 3JSCA 2J05A 5LJ3h 1KJWA 4DBQA 4XK8E 3ULRB 3RERA 1K0XA 1K0SA 3H8ZA 1Q82R 4PJOG 2DXBA 4LD9K 5KE2A 4RTZA 2C0OA 2XDDA 2HAXA 1BKBA 1TUDA 4AFSC 2NYSA 4KH1B 1N6AA 3O8VA 2RHZA 4BACA 2HD0A 2LMJA 2ED1A 4KH0B 4DEXA 4FYVB 1Q81C 4XQ3A 1KC8C 2W10A 2DD4A 2ECZA 4J6WA 1QLYA 1M1FA 1KQSA 3NPFA 4C92C 3FB9A 3HFNA 5LJ5j 2RQVA 3QJ6A 4C8QE 2FZKB 3UATA 1VQ9A 1WQWA 1X01A 2JZ2A 1QW1A 3CCLQ 1KQ1A 3CMAQ 2EBPA 4PJOA 4QT7A 1W6XA 2JTFA 3JCMQ 3TQ7P 4E7JA 3A8GB 1VIFA 4X1VA 2EAYA 4BB7A 4CC4B 2GGRA 2ZPFB 3FDRA 3G4SQ 5J39A 1M2VA 1NE8A 5A0LA 4CC3A 3LW5E 2MYSA 2D8HA 1UE9A 3H0FA 2ROLA 1RL2A 3GLXA 2BE7D 5CVIA 1PC0A 2ED0A 4F14A 1X2KA 2QI2A 4OMNA 1E6HA 3CEYA 5GANg 3QDRB 5HK3A 3G1JA 2X51A 3S3MA 4AFQC 4M7AE 3JB9I 4LNPA 1M30A 2NUTA 3GF5A 3GBQA 2JNGA 4PJJA 1YJ9Q 2X4WA 5D6WA 4FL6A 1Y96B 1IB8A 5GMKl 1YIJQ 1U1SA 1K9AA 2K6DA 3NFCA 4E7KA 4MMKA 1NEGA 2E3HA 1MNDA 4XU1A 4M75B 2DBMA 1T3SA 1ZBJA 1PSEA 4JS5A 1VQ4A 3JCMb 4HA8A 1VQ4Q 2OTLQ 1PSFA 2YDLA 4K11A 1JXOA 5KYUA 3I56T 2V8JA 1RAHB 1ZUYA 2MF2A 1SSFA 1W70A 1YCYA 3PMIA 1ZA2B 3A8OB 1T3LA 1BB9A 1Y71A 3I5RA 3FIFA 2J6FA 3LGFA 4ZGJB 2RQUA 2RMOA 3OYDA 2ZGWA 2J06A 1ZSZC 2LT4A 1FXXA 2M1HA 3HP9A 1YITA 2MK5A 1OYXA 2WSCE 1M27C 3CCUQ 4A4FA 1TG0A 4XTWA 3OYHA 2FZCB 1NBEB 2QQ9A 1JJ2P 1HYOA 1FYNA 2RK1A 3PFSA 2CREA 5FRNA 3H0IA 5IHNA 2DMOA 1WX6A 2BKDN 3JCMX 1I5LA 4PJOD 3JCMP 1BBZA 4ZN3A 3HRUA 5M9OA 3CC7Q 3A98A 2KT1A 1S72A 2CZ0B 4OF1A 4N0AC 2XKOC 5GAOq 2V26A 1VQ8Q 1GFCA 2KROA 4FSXA 3RR6A 3ZFJA 2OTLA 2SRCA 1UEBA 1VQ7Q 1OV3A 1J3TA 2PTKA 1B07A 2EFIA 3EH1A 1VQ9Q 3OYEA 4M77E 2DL4A 1YWPA 4RTXA 4D8KA 3P8DA 1M2OA 4C8QG 4J9EA 2YRCA 3SWNB 3INZA 1GCPA 3CPFA 2O01E 1VQ8T 1U8RA 1CKBA 1G3TA 3H41A 1Y57A 4XAXB 1K73C 2F69A 3PGGA 4X9DA 3CMET 3G6EQ 5FRMA 2GQIA 5FWCA 2VXFA 2R58A 1UGRB 3GIBA 3CCJT 3G4SA 4NL3A 2CS7A 4PJOF 3OS5A 1RAIB 3M55A 1SRLA 4ZNXA 1PG5B 2ZZDA 2LQWA 3OYYA 2KSSA 4IUTA 5IXFA 3P8HA 3TCJA 1Q95G 2V8IA 2M0YA 1B34A 2ENMA 2RPNA 4FSSA 2FZGB 1JXMA 1EFNA 2JXBA 5FLXE 4OB3B 3M54A 4TVRA 5GAN5 1WJSA 3PVLA 5LJ5e 3CBMA 1ZUUA 2PQWA 1VQLT 1K8AU 2MWPA 1QKXA 2E10A 2KVQG 1MMGA 3M9QA 4HCZA 1NEBA 2E12A 5GAN7 1I81A 3MP6A 1HJDA 2XI9A 3VJPA 1IGQA 3LWIA 5CQXA 1M90C 2MOXA 3M4YA 2A37A 1B3QA 3QWYA 4CI0C 5GANd 2WSFE 3CCEQ 2CT3A 1HXDA 3FJ5A 4MZTA 2D9TA 1N9SA 4BDYA 1BI1A 1IXDA 3M0UA 1N8RU 2PVGB 2DEUA 2LQ8A 3E2UA 2K2VA 2GFUA 1BI0A 4L59A 5KYWA 2RM4A 3CC4A 4ME7A 2L3RA 2RJFA 4PJOC 1R0BG 1U1TA 2FL7A 1TXQA 3GP8A 4MZMA 2E1HA 2LJ0A 4JRQA 3OS2A 2EQJA 5IHKA 4M7AF 4J83A 1WHKA 4R55A 3CBOA 4LUEA 2OTJA 2HDAA 4PJOB 1Y07A 2FO0A 4Z02A 2AK5A 2GTJA 2JW4A 2L2PA 4A53A 3G4ST 1YN8A 4XTYA 5GAMg 1G8XA 2O9SA 3TSWA 4MZPA 1RI0A 4J9IA 4PJMA 1CSKA 2MAMA 1QWEA 5GANf 3VS2A 1QCFA 4C8QD 1U3OA 1LPLA 3MP8A 1YJNT 3FLGA 3GPLA 2PUOB 1X6BA 3V7RA 1OU8A 2L3QA 4CRIA 2RI3A 2YLCA 2L89A 3RDVA 2PZ1A 3CXCA 3M58A 4M77G 2DVJA 2K5LA 1M3AA 4LDVA 1R77A 1D09B 1ACMB 3CCQA 2E6NA 3OYJA 1VQOA 4HVVA 4ZGDB 3UA7A 5GMKj 4X34A 2PUKB 3OYNA 3QUIA 2RB6A 1TWBA 3PNWC 1BYMA 1AT1B 2DERA 2X35A 1VUBA 5A2QE 4JUVA 4UC4A 3JCMW 3CCUA 2BUDA 1TH7A 2QQSA 3V7CA 2FYKA 1WLPB 5KYUB 5CR2A 3QXEB 3IQLA 4KUDK 1GL5A 1NM7A 2EQMA 1PNJA 3MHXA 4LDYA 1W4SA 1C6VX 2CZ1B 2KR3A 1HK9A 2H3EB 3R6NA 1WPYA 2CP5A 2DVEA 1NJIR 2DPPB 3MP1A 2MWOA 1UHCA 3CCMQ 3CCMT 1E6GA 2VWFA 1VQPA 4JLIA 1OZ3A 4OMQA 3TEEA 1W2BA 2W0ZA 2DJQA 2DETA 2G3RA 4C0FA 3CCET 2K3BA 2KY9A 5I2SA 3WVDB 2RQRA 3C95A 1NLOC 1TU0B 4IUVA 4C92D 2V8KA 3V7SA 2FG0A 1M4ZA 2CSIA 2XMFA 4ESRA 1YIJT 3PE0A 3R6OA 3A1PA 5KYXA 2E65A 4FIBA 1FMKA 2OAUA 4XTUA 5FW9A 1MV0B 3MEWA 2CP7A 4CC7A 2RD1A 1WHGA 3QKJA 3I56Q 3SEMA 2O31A 3VS1A 1WFWA 5KH6A 3A8HB 2QA4Q 2IVWA 2RHIA 2QGGA 1N27A 8AT1B 1C1AA 3OYIA 3CCST 2OI3A 2JTEA 4ZTFA 3CPWA 2ZCFB 4Y92A 3F70A 3DB3A 4DBFA 2GF7A 4BI4A 3NTKA 4JDSA 1D1AA 3NGPA 1K8AC 2RJCA 1B7TA 1VQKT 3GNGA 1UHFA 1XQHA 2E5QA 4AG2C 2K3XA 2RA2A 1QQJA 2A28A 2QTXA 3FRNA 2DIQA 2H3JA 2CUDA 3L2UA 1Y0MA 2JVVA 1FMWA 1IO6A 2RH2A 3CCRA 2C06A 3FJPA 2MMPA 3TSZA 2L3PA 3ASKA 3SWNC 3SFMA 3L2WA 1AD5A 4NOYA 2X3WD 3LGLA 1VQMT 4OGCA 2PNIA 5KYYA 3OYLA 1VQ9T 2J6KA 1YJWA 4OVAA 2KRNA 1OX8A 2GCXA 1VQKQ 1S1NA 4BE2A 3CCMA 2A3LA 2FEIA 2LZ6B 1KHCA 4LDUA 5GAMf 2FVUA 4KULA 2RI2A 3VRZA 2EVRA 3JV3A 3TVTA 4RMOA 2EYYA 3UF4A 3JB9J 1G3WA 3G6EA 3EGDA 1X27A 4QQDA 2KRSA 1OPKA 2DRKA 3L2ZA 2QQRA 3OSSC 1TUGB 3CCVA 2L3SA 4RG2A 4A54A 3OSVA 1JO8A 1YP5A 4ZTJA 4OMPA 3NTHA 5GAMe 2EKHA 3UWNA 3CC2A 4E7IA 4XU0A 1VQ7T 2V1QA 1Q86R 4M7DG 2CZ7B 1WNLA 4RUGA 2QEXT 1A0NB 2P4TA 4HCBA 1TUCA 3JB9F 1YFNA 2RHUA 1IRXA 2DA9A 2QDYB 4F17A 2CDTA 1YNZA 3OW2A 2FPFA 4LN2A 2KDSA 5GAOm 2XD0A 1WJRA 3QYHB 4HVUA 5FU6C 2JM8A 3VYHB 2AT1B 3DLMA 4OMOA 3ME9A 1WZOA 3L2VA 4M77F 3QG1A 2GQVA 1VQ8A 2K5FA 4GY5A 2DJZA 1I8FA 2EIFA 1QVGA 4RTWA 1R8OB 5A0GA 4J9DA 4C8QC 4DA4A 1YJNA 1OI1A 3CCRT 3CXCP 1MV3A 2GNCA 2X4XA 4C92E 1Q82U 2MI6A 2COWA 2C0IA 2DILA 2BTTA 4HKEA 2DXTA 3X26B 5GAOn 2YHTA 1AWWA 3RESA 3LWHA 1AWJA 1WXBA 1YJ9T 1AZGB 2XU8A 2DTIA 1M90R 2L5QA 4GLKA 2LX9A 1AWXA 2OTJQ 1ABOA 3CCJQ 4E7ZA 4HT9A 2EGEA 2EQIA 1KD1U 4FW2A 3M0QA 3HKSA 1QP2A 3EG9B 2B86A 2JM9A 1Q86U 4JS4A 3M53A 4C92A 2EJFA 3QDFA 3CD6A 3N5BB 1LOJA 3Q1JA 2L8DA 3EFOB 1QVFS 4J6XA 3CD6Q 2XG8D 3L2QA 1RLQC 1WDXA 2RF0A 3OYCA 2DTOA 1LJOA 3MPUB 4M77A 1ZUKA 1UJ0A 5L23A 2D8JA 3SB2A 5GAN4 3QWXX 1BCMA 2QDLA 2QYZA 1UGVA 1XJWB 4FT2A 4DBRA 2K2MA 3S6WA 4BD3A 3J7AF 1W2BP 1ZA1B 4F7UA 4C0DB 3EGXA 1K76A 3HRSA 4RCBA 4JRPA 1OZ2A 2A36A 4M75C 2RHXA 3KBGA 4KGXB 5LJ3g 1EX4A 2DKGA 4C92F 1G3SA 1TOVA 1QMCA 3VS6A 2VASA 5J3BA 2XDPA 1UDLA 5CQYA 3WXMB 2YLBA 3PIPA 1VQPT 5FWBA 3C4SA 1I07A 2LQNA 3OB9A 1EIFA 2QXFA 4PK4A 8ATCB 4FYYB 1WIEA 1RLPC 2F2XA 2QG9B 2COZA 3O5ZA 1Z9ZA 1M3CA 3P8BB 2LDMA 4YTLA 2OJ2A 2O2OA 4FW1A 3META 5GAOr 2DXCA 3X25B 4J5YA 4EMKA 1IREB 4FT4A 2DRMA 3T9NA 2DFUA 4PNOA 1M1GA 1RAFB 2IPOB 1H3ZA 3CMEA 4B6MA 3HSBA 2ZPEB 2K4YA 3VUZA 2LP5A 4C0GA 3RNJA 3JCMe 1AHJB 1YJWT 1O9SA 2VC8A 4OGEA 2VGMA 5HCKA 1VYUA 1SPKA 4BE0A 1YHQT 1RACB 3A5ZB 2O4XB 4D8DA 4RG8A 4AG1C 1GBQA 4GBQA 1ABQA 3H6ZA 5EC7A 2PVOB 2Y90A 1K9MR 4E6RA 4N0AA 2LCCA 2GBQA 4R0KA 4Z8AA 1JRIA 2LCLA 2K57A 1MHNA 2MPXC 5KCHA 4B9XA 2AZSA 4J9CA 2KMTA 1NPPA 1YHQA 4M78B 2BE9B 4M78G 2R5MA 1VQKA 2FRWA 3BFMA 1WJQA 3VS7A 5KYXB 1YJWQ 1MMDA 4M78F 2M02A 5FU6B 5D7UA 4LDWA 1QP3A 2YUOA 4ZN1A 5GAOl 2RK2A 2DL8A 3E1SA 3U23A 4M7AB 4M7AG 5AT1B 5C6SA 3CCSA 1I0CA 1C0MA 4OMMA 1RI9A 2VKNA 3ZL7C 3SD4A 2YT6A 4JPBW 4MDXA 4BI8B 3JB9D 1N9RA 4PLLA 4N4GA 2DXUA 1IHVA 3LX7A 4M7DF 1X2QA 3MJXA 2QQAA 3MKDA 1WHJA 1YITT 1Q7YC 1PRMC 2FHDA 4F7UB 3S3NA 1WHMA 4RKUE 1KD1R 1YJNQ 1D3BA 2XICA 4A4GA 4KBMB 4KGZB 1WXTA 3KUFA 2QAZA 3MEAA 3PMTA 2RI5A 1Y7XA 3RBBB 4GLMA 4QVDA 4E7LA 4CC2A 1K73R 4D6WA 5GMKe 6AT1B 2Y4XA 4FYXB 4FYWB 3CCEA 2M9UA 3M4GA 1PKSA 2LT1A 2LJ1A 2VYTA 2DYBA 1WHHA 2YXYA 2RNAA 5DY9A 1Q7YR 3GNFB 1NYGA 4AFUC 1RAEB 2E64A 3OYMA 2LCSA 4EMGA 2CSQA 2QK0A 1JJ2S 2EQKA 3QO3A 1FMVA 5DM7R 1TSFA 1VA7A 3JRZA 1BCOA 1D0ZA 2QQBA 3J80E 2CP0A 2ZAEA 4L6V5 3EAEA 3CCVQ 1ZSZB 1RAGB 2ZPIB 4OP0A 4HXJA 4C0DC 4OB0B 3A8MB 3BE3A 1H92A 3OMCA 3QZ5B 3HTRA 4C5IA 4KGVB 3CCUT 2JS2A 3QBYA 2KYBA 3RMQA 3REBB 4JRKA 2F5KA 2FPEA 2LJ3A 2E5KA 3OQ5A 1IZ6A 4N4IA 2EQUA 2DNUA 3L42A 4OB1B 3KXTA 3EG9A 1JBMA 2K79A 1VQOT 1D0YA 1OULA 4MMLA 2COYA 2E6ZA 4Q5WA 4C8QF 2KE9A 2JT4A 1M1KR 5GJVB 1M1KC 2M0OA 3SWNA 3EG3A 1GXIE 3VYGA 3V8JA 1PCXA 4XTXA 5ECAA 3G71A 4J9GA 2VB6A 3OW2S 1PHTA 1JQQA 2M16A 2QGFB 4EIKA 1GFDA 2NUTB 2KRMA 3OY9A 2QEXA 5CKDA 1Y96A 4J9HA 2IG0A 3A8LB 1VQ7A 1VQOQ 3CC2T 1BU1A 2J7IA 3CPWP 1WA7A 4DQ2A 4HT8A 2DF6A 1VYTA 2Y4YA 5GANe 3OS1A 2OAWA 1OQKA 1S72Q 2KGTA 4LXCA 3CCVT 5GJWB 3X20B 3QSUA 3X24B 2DM1A 2D0NA 1V1CA 2DK3A 5DLOA 2X4YA 1D1BA 1KG1A 2X4JA 1Z9QA 1GCQA 2CYZB 5GANj 1I4K1 3C12A 1GCQC 4C92B 5LL6S 3J81E 4Y28E 1UB4A 2DO3A 2EYQA 2CGHA 1Q7YU 2XHCA 3HHTB 3V8KA 2CP3A 1FWZA 4QW2A 3DB4A 4EMKB 1KK7A 4M7AC 5A0DA 3EG0A 2O88A 5KYNA 1VQ5Q 3OMGA 4C8QA 3KFVA 1OOTA 3RKXA 1VQMQ 4IIOA 1Q82C 2X9HA 5LJ3e 1QVFA 2X3XD 4M75F 2DE0X 2ZPBB 3VS3A 2EYXA 3HRTA 1HD3A 1MMAA 3UA6A 1G83A 2KAFA 3BY7A 3RUXA 1VQNQ 2R5AA 2LQKA 5CIUA 3MEUA 3QHSA 1F1BB 4JJBA 5GMKm 3CMAT 3M0RA 4M7DB 2VXEA 4DEYA 2ZPHB 3C0CA 3NHNA 2K9GA 5GAMh 3SDZA 4KT0E 2EJ9A 2HCKA 3EGDB 1X69A 2H8HA 2BZXA 2NLUA 3ZEHA 3JAME 4EMKC 3BDLA 1YJ9A 2KT8A 3CCJA 2B8AA 4R56A 4XU2A 3PVQA 4IKFA 9ATCB 3CC2Q 5FU7C 5CKFA 1BK2A 4M7AD 4AFZC 1NJIU 3VV0A 3DKMA 2QA4T 1G3YA 3EFRA 1X43A 2AKKA 1YI2A 3M0PA 2YSQA 3JB9G 1I1JA 4II1A 2P84A 2HEQA 1QCNA 2WSEE 5HKCA 4M78D 2EYWA 2HQXA 5GAN3 3JCMf 2E4HA 5GAOp 2F1LA 5HY6A 1SRMA 1BI2A 3S3OA 1I5OB 1WGSA 5LJ5d 2HQEA 2QA4A 2HSEB 2KK4A 4FCYA 1M9SA 1SF9A 4HCKA 5I11A 3SHWA 4C5GA 3MO8A 2WACA 3VS5A 3EHQA 1VOMA 1PRLC 5GMKi 2YRDA 3FEOA 3VS0A 1SSHA 2OTLT 2DD5A 4RCCA 2KXCA 4QKUA 3L2RA 4AMCA 4C8QB 1PM3A 1D0XA 1PD0A 4A4KA 4BUGA 4F16A 2K7AA 5LJ3j 2GFAA 2DTHA 4F7UE 1SHGA 4LE9A 3LH0A 3BDUA 5FU7B 2KYMA 4PJNA 1ARKA 3E9FA 1NJIC 2K5IA 2HBWA 2I0NA 2GTOA 2K3YA 3CMEQ 2LX7A 2F2WA 5I2MA 2CP6A 1N5ZA 4B9WA 5J26A 3AT1B 2IIMA 1VQPQ 4DBHA 2YWWA 3QJYA 2LNVA 3EFOA 3C94A 3RKWA 4HCCA 4JZ3A 1SEMA 3VS4A 2RJEA 2HL5C 3LLRA 4E47A 5IH2A 3JCMc 5GAN6 4DOWA 1OX9A 2PU9B 5I22A 2HMAA 1VQ6A 4BDZA 1UG1A 4HVWA 3CXCS 3E19A 3GOXA 3CCQT 2NUPA 1LVKA 1KQSP 3EH2A 3I56A 1SKUB 3EGUA 2J6OA 2KBTA 1YI2Q 4M75E 4QVZA 3LH5A 2DYIA 1TS9A 1YCSB 1VIEA 1WQ7A 1N8RC 1R0CB 1KHIA 4PKCC 1T0HA 3I55Q 1MMNA 1X6OA 3M59A
chains in the Genus database with same CATH topology
3CCUQ 3CCRQ 3CD6Q 2OTJQ 1QVGP 3CXCP 2QEXQ 3CC4Q 3CCJQ 3CCMQ 1S72Q 1VQ6Q 3G6EQ 1VQ8Q 1VQPQ 1Q82R 3CCSQ 1YHQQ 1JJ2P 1KQSP 1VQNQ 1N8RR 2QA4Q 1Q81R 1KC8R 1K73R 3CCQQ 1NJIR 3G4SQ 3OW2P 1YI2Q 3G71Q 1VQ5Q 1VQ7Q 3CCLQ 1M1KR 1Q86R 3CC7Q 1VQOQ 3CMAQ 1VQ4Q 1KD1R 1YJNQ 2OTLQ 1VQMQ 1Q7YR 1YJ9Q 1VQLQ 3CCEQ 3CPWP 3CC2Q 1M90R 1VQ9Q 3CCVQ 3I55Q 1K8AR 1YIJQ 1YJWQ 1VQKQ 1QVFP 1K9MR 1YITQ 3I56Q 1W2BP 3CMEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Q;  3CCR Q;  3CD6 Q;  2OTJ Q;  1QVG P;  3CXC P;  2QEX Q;  3CC4 Q;  3CCJ Q;  3CCM Q;  1S72 Q;  1VQ6 Q;  3G6E Q;  1VQ8 Q;  1VQP Q;  1Q82 R;  3CCS Q;  1YHQ Q;  1JJ2 P;  1KQS P;  1VQN Q;  1N8R R;  2QA4 Q;  1Q81 R;  1KC8 R;  1K73 R;  3CCQ Q;  1NJI R;  3G4S Q;  3OW2 P;  1YI2 Q;  3G71 Q;  1VQ5 Q;  1VQ7 Q;  3CCL Q;  1M1K R;  1Q86 R;  3CC7 Q;  1VQO Q;  3CMA Q;  1VQ4 Q;  1KD1 R;  1YJN Q;  2OTL Q;  1VQM Q;  1Q7Y R;  1YJ9 Q;  1VQL Q;  3CCE Q;  3CPW P;  3CC2 Q;  1M90 R;  1VQ9 Q;  3CCV Q;  3I55 Q;  1K8A R;  1YIJ Q;  1YJW Q;  1VQK Q;  1QVF P;  1K9M R;  1YIT Q;  3I56 Q;  1W2B P;  3CME Q; 
#chains in the Genus database with same CATH topology
 2D1X A;  2BZY A;  3CPW S;  4ANJ A;  3CCS Q;  2DL5 A;  2DL3 A;  2A08 A;  4V2S A;  1Q81 R;  1KC8 R;  2CUB A;  3RMS A;  4M78 E;  1K4U S;  4FU6 A;  1NG2 A;  2AKL A;  1BIA A;  1M5Q 1;  1PWT A;  1UEC A;  3I9Q A;  3OYF A;  2OTJ T;  2Z0W A;  4EPC A;  2XID A;  3V8L A;  1YHQ Q;  4BI3 A;  1ZSZ A;  2LTO A;  3EFS A;  4JJN K;  4C0Z A;  3G71 T;  4A63 B;  2QTV A;  5AYF A;  3OS0 A;  2E70 A;  2YUN A;  3JB9 H;  4FM4 B;  3MEV A;  1V29 B;  4M7D D;  1NYF A;  1YIJ A;  2AZV A;  1RAB B;  2DIG A;  1UGP B;  4M4Z A;  4ORZ A;  1MGQ A;  2YRV A;  5IHI A;  5GAM j;  1VQ6 T;  2DL7 A;  4OMF B;  1T0J A;  1UUE A;  5KYY B;  1W2B S;  3BW1 A;  4IIM A;  1K73 U;  3L1A A;  2ESW A;  3HFO A;  2I2L A;  5KE3 A;  2CZ6 B;  2HL3 A;  1RAD B;  4PL6 A;  1OPL A;  2EWN A;  1D1C A;  3VRY A;  1YBY A;  2DBK A;  1Q81 U;  1KC8 U;  3UDC A;  4BE1 A;  4M77 C;  5IXB A;  2HQH A;  3OYA A;  4E7H A;  4Y91 A;  3X28 B;  1NLP C;  2NUZ A;  4PJO E;  4RTU A;  1VQL A;  1FX7 A;  5LJ3 f;  2A0F B;  4J9F A;  2JMA A;  3M57 A;  2EGC A;  4KUI A;  2M51 A;  5GAN h;  1IHW A;  1X6G A;  3VUB A;  1WXU A;  3QPH A;  2QEX Q;  2HKQ B;  3D7S B;  3JCM h;  4PFZ A;  3ZBD A;  2EGA A;  1AEY A;  4IUP A;  1JJ2 A;  3M0S A;  1P92 A;  5LJ5 g;  2CH4 W;  4PFP A;  3QII A;  4F7U G;  4OML A;  3I55 A;  1JB0 E;  2NUP B;  1WYX A;  4J7I A;  2F2V A;  2RJD A;  1TTH B;  2JJ9 A;  5CKB A;  3UT1 A;  2OX7 A;  2CP2 A;  2PVD B;  1YIT Q;  1IGU A;  3I35 A;  4WF2 A;  4RTY A;  4L5G A;  4C5E A;  2YUP A;  1ZLM A;  5D6X A;  2CH4 A;  2KXD A;  1CKA A;  1NPR A;  4J6Y A;  4LDX A;  5CKE A;  4X9C A;  4F04 B;  3PIO A;  2BZ8 A;  3ER0 A;  4J9B A;  3EG2 A;  4IUQ A;  1K1Z A;  1K8A R;  2VVK A;  3OBY A;  5GAM d;  1YI2 T;  5IN1 A;  4KRT A;  4QVC A;  5CKH A;  5GAN 8;  3WVE B;  3CCL T;  5IT9 E;  1JEG A;  2DX1 A;  2SEM A;  3URG A;  1MUZ A;  2EJG A;  1RUW A;  1G5V A;  3M5A A;  3CD6 T;  4EMH A;  5CAI A;  4JJC A;  3JCM V;  3CC7 T;  3M0T A;  4JLG A;  1AWO A;  1XNI A;  2NWM A;  1SHF A;  2QAS A;  2EKO A;  2F5T X;  2ZPG B;  4M75 D;  4J7F A;  3THK A;  1ZQ1 A;  2E41 A;  4XTZ A;  1S72 T;  3OBW A;  1VQ5 A;  2CT4 A;  4ELZ C;  4DOV A;  1QCO A;  1QWF A;  1ZSG A;  4N4H A;  1K9M C;  3CC4 T;  1ZHI A;  4MDW A;  4O6J A;  2DEQ A;  2E3I A;  3JCM J;  1KSW A;  4C5H A;  1UJY A;  3CC4 Q;  1VQ6 Q;  5LJ3 d;  2KNB B;  5LJ5 h;  3TU4 K;  3AHU A;  2KI7 A;  1X75 C;  3NTI A;  1M8V A;  1U06 A;  4M77 B;  4VUB A;  2KQW A;  4J8O A;  1AVZ C;  4E2F B;  1XTD A;  2KEA A;  1H3H A;  4A4H A;  5KYW B;  1VQN T;  1RAA B;  2CKK A;  1KFZ A;  2JUF A;  4BY6 C;  1BIB A;  4PFO A;  5C0M A;  3VU3 C;  3EGX B;  3NMZ C;  1VQ4 T;  1LNX A;  5EG2 A;  4JRI A;  4M75 A;  4WTO B;  3I55 T;  1GRI A;  5CCA A;  2C0T A;  4XU3 A;  4O5V A;  4C92 G;  2D0Q B;  4Z89 A;  3M56 A;  1EZZ B;  1SG5 A;  5KCO A;  1WHL A;  2ATC B;  2HZY A;  2O9V A;  2P0Q A;  1H64 1;  1XOV A;  3CCQ Q;  3RKY A;  2VUB A;  5CO7 A;  2LRQ A;  1JU5 C;  1QKW A;  3CQT A;  4PLI A;  2EYZ A;  1K9M U;  2HSP A;  3OYG A;  3REA B;  4NL2 A;  3G6E T;  2HBP A;  1UGS B;  1VQL Q;  1PD1 A;  2RHY A;  3RIR A;  2LVM A;  3LYI A;  1M90 U;  4P5N A;  1OU9 A;  4WCI A;  3HL8 A;  1UGQ B;  1KQ2 A;  1E7O A;  1U5S A;  1VQN A;  4LUD A;  2VV5 A;  2FB7 A;  3G7Z A;  4ATO A;  2O4X A;  4M77 D;  2DZ9 A;  3UPU A;  3QYG B;  4PJL A;  2MCN A;  3E9G A;  2AHJ B;  2P0K A;  4M78 C;  5IAY A;  2JOY A;  1AZE A;  3HPW A;  5GMK h;  1VQM A;  2JMC A;  1UFF A;  4RTT A;  3FC3 A;  1LCK A;  4ZGE B;  2RQT A;  1QVF P;  5CK9 A;  1V76 A;  4QQ6 A;  2BIV A;  2LNH B;  7AT1 B;  3EHR A;  4RTV A;  4M75 G;  2DLP A;  3H0H A;  1KIK A;  3OYB A;  2JN0 A;  2FRY A;  3PTA A;  1WI7 A;  2ABL A;  1GBR A;  2YUQ A;  4QQG A;  4AT1 B;  4M7D C;  1HSQ A;  1KQS S;  5HK0 A;  2RO0 A;  4M7D A;  3H9N A;  3TRE A;  3JCM d;  1VQ5 T;  1YWO A;  1QVG P;  3MCA B;  4M78 A;  1M8M A;  5D6Y A;  1DJ7 B;  2DZC A;  1PKT A;  5LJ5 f;  5FRO A;  3PT9 A;  3OW2 P;  2EPD A;  4A4E A;  4BY6 B;  1MNE A;  2XK0 A;  3OYK A;  1ZX6 A;  2P4R A;  2MIO A;  3CC7 A;  1M1K U;  4M7A A;  3DLL A;  4E7S A;  3CMA A;  1M2V B;  4ELY C;  3VKI A;  2L0A A;  3CCL A;  2RN8 A;  2EW3 A;  3CCR Q;  4JJD A;  4F7U F;  2JS0 A;  2HNI A;  2P0P A;  2AIR B;  2RQW A;  2FPD A;  4Z88 A;  1N8R R;  2D6F A;  4M7D E;  3CBP A;  3JCM g;  3QZ9 B;  1G2B A;  1QVP A;  2XDB A;  2V1R A;  2JTM A;  3G71 Q;  4EDU A;  1KD1 C;  1NZ9 A;  4OB2 B;  1UTI A;  4IUU A;  2R57 A;  1QVG S;  2LC4 A;  2ROT A;  2A7Y A;  4NS5 A;  4LD6 A;  1Q86 C;  5L8R E;  4IUR A;  4JZ4 A;  2VGN A;  1AOJ A;  3OA6 A;  1D3B B;  2HKN A;  1OEB A;  1W1F A;  3EG1 A;  4XTV A;  5GAN 2;  1B34 B;  1VYV A;  1BI3 A;  2G6F X;  5I21 A;  1M3B A;  1H8K A;  2DAQ A;  5DLQ E;  3I5S A;  1ZBX A;  1O75 A;  3JSC A;  2J05 A;  5LJ3 h;  1KJW A;  4DBQ A;  4XK8 E;  3ULR B;  3RER A;  1K0X A;  1K0S A;  3H8Z A;  1Q82 R;  4PJO G;  2DXB A;  4LD9 K;  5KE2 A;  4RTZ A;  2C0O A;  2XDD A;  2HAX A;  1BKB A;  1TUD A;  4AFS C;  2NYS A;  4KH1 B;  1N6A A;  3O8V A;  2RHZ A;  4BAC A;  2HD0 A;  2LMJ A;  2ED1 A;  4KH0 B;  4DEX A;  4FYV B;  1Q81 C;  4XQ3 A;  1KC8 C;  2W10 A;  2DD4 A;  2ECZ A;  4J6W A;  1QLY A;  1M1F A;  1KQS A;  3NPF A;  4C92 C;  3FB9 A;  3HFN A;  5LJ5 j;  2RQV A;  3QJ6 A;  4C8Q E;  2FZK B;  3UAT A;  1VQ9 A;  1WQW A;  1X01 A;  2JZ2 A;  1QW1 A;  3CCL Q;  1KQ1 A;  3CMA Q;  2EBP A;  4PJO A;  4QT7 A;  1W6X A;  2JTF A;  3JCM Q;  3TQ7 P;  4E7J A;  3A8G B;  1VIF A;  4X1V A;  2EAY A;  4BB7 A;  4CC4 B;  2GGR A;  2ZPF B;  3FDR A;  3G4S Q;  5J39 A;  1M2V A;  1NE8 A;  5A0L A;  4CC3 A;  3LW5 E;  2MYS A;  2D8H A;  1UE9 A;  3H0F A;  2ROL A;  1RL2 A;  3GLX A;  2BE7 D;  5CVI A;  1PC0 A;  2ED0 A;  4F14 A;  1X2K A;  2QI2 A;  4OMN A;  1E6H A;  3CEY A;  5GAN g;  3QDR B;  5HK3 A;  3G1J A;  2X51 A;  3S3M A;  4AFQ C;  4M7A E;  3JB9 I;  4LNP A;  1M30 A;  2NUT A;  3GF5 A;  3GBQ A;  2JNG A;  4PJJ A;  1YJ9 Q;  2X4W A;  5D6W A;  4FL6 A;  1Y96 B;  1IB8 A;  5GMK l;  1YIJ Q;  1U1S A;  1K9A A;  2K6D A;  3NFC A;  4E7K A;  4MMK A;  1NEG A;  2E3H A;  1MND A;  4XU1 A;  4M75 B;  2DBM A;  1T3S A;  1ZBJ A;  1PSE A;  4JS5 A;  1VQ4 A;  3JCM b;  4HA8 A;  1VQ4 Q;  2OTL Q;  1PSF A;  2YDL A;  4K11 A;  1JXO A;  5KYU A;  3I56 T;  2V8J A;  1RAH B;  1ZUY A;  2MF2 A;  1SSF A;  1W70 A;  1YCY A;  3PMI A;  1ZA2 B;  3A8O B;  1T3L A;  1BB9 A;  1Y71 A;  3I5R A;  3FIF A;  2J6F A;  3LGF A;  4ZGJ B;  2RQU A;  2RMO A;  3OYD A;  2ZGW A;  2J06 A;  1ZSZ C;  2LT4 A;  1FXX A;  2M1H A;  3HP9 A;  1YIT A;  2MK5 A;  1OYX A;  2WSC E;  1M27 C;  3CCU Q;  4A4F A;  1TG0 A;  4XTW A;  3OYH A;  2FZC B;  1NBE B;  2QQ9 A;  1JJ2 P;  1HYO A;  1FYN A;  2RK1 A;  3PFS A;  2CRE A;  5FRN A;  3H0I A;  5IHN A;  2DMO A;  1WX6 A;  2BKD N;  3JCM X;  1I5L A;  4PJO D;  3JCM P;  1BBZ A;  4ZN3 A;  3HRU A;  5M9O A;  3CC7 Q;  3A98 A;  2KT1 A;  1S72 A;  2CZ0 B;  4OF1 A;  4N0A C;  2XKO C;  5GAO q;  2V26 A;  1VQ8 Q;  1GFC A;  2KRO A;  4FSX A;  3RR6 A;  3ZFJ A;  2OTL A;  2SRC A;  1UEB A;  1VQ7 Q;  1OV3 A;  1J3T A;  2PTK A;  1B07 A;  2EFI A;  3EH1 A;  1VQ9 Q;  3OYE A;  4M77 E;  2DL4 A;  1YWP A;  4RTX A;  4D8K A;  3P8D A;  1M2O A;  4C8Q G;  4J9E A;  2YRC A;  3SWN B;  3INZ A;  1GCP A;  3CPF A;  2O01 E;  1VQ8 T;  1U8R A;  1CKB A;  1G3T A;  3H41 A;  1Y57 A;  4XAX B;  1K73 C;  2F69 A;  3PGG A;  4X9D A;  3CME T;  3G6E Q;  5FRM A;  2GQI A;  5FWC A;  2VXF A;  2R58 A;  1UGR B;  3GIB A;  3CCJ T;  3G4S A;  4NL3 A;  2CS7 A;  4PJO F;  3OS5 A;  1RAI B;  3M55 A;  1SRL A;  4ZNX A;  1PG5 B;  2ZZD A;  2LQW A;  3OYY A;  2KSS A;  4IUT A;  5IXF A;  3P8H A;  3TCJ A;  1Q95 G;  2V8I A;  2M0Y A;  1B34 A;  2ENM A;  2RPN A;  4FSS A;  2FZG B;  1JXM A;  1EFN A;  2JXB A;  5FLX E;  4OB3 B;  3M54 A;  4TVR A;  5GAN 5;  1WJS A;  3PVL A;  5LJ5 e;  3CBM A;  1ZUU A;  2PQW A;  1VQL T;  1K8A U;  2MWP A;  1QKX A;  2E10 A;  2KVQ G;  1MMG A;  3M9Q A;  4HCZ A;  1NEB A;  2E12 A;  5GAN 7;  1I81 A;  3MP6 A;  1HJD A;  2XI9 A;  3VJP A;  1IGQ A;  3LWI A;  5CQX A;  1M90 C;  2MOX A;  3M4Y A;  2A37 A;  1B3Q A;  3QWY A;  4CI0 C;  5GAN d;  2WSF E;  3CCE Q;  2CT3 A;  1HXD A;  3FJ5 A;  4MZT A;  2D9T A;  1N9S A;  4BDY A;  1BI1 A;  1IXD A;  3M0U A;  1N8R U;  2PVG B;  2DEU A;  2LQ8 A;  3E2U A;  2K2V A;  2GFU A;  1BI0 A;  4L59 A;  5KYW A;  2RM4 A;  3CC4 A;  4ME7 A;  2L3R A;  2RJF A;  4PJO C;  1R0B G;  1U1T A;  2FL7 A;  1TXQ A;  3GP8 A;  4MZM A;  2E1H A;  2LJ0 A;  4JRQ A;  3OS2 A;  2EQJ A;  5IHK A;  4M7A F;  4J83 A;  1WHK A;  4R55 A;  3CBO A;  4LUE A;  2OTJ A;  2HDA A;  4PJO B;  1Y07 A;  2FO0 A;  4Z02 A;  2AK5 A;  2GTJ A;  2JW4 A;  2L2P A;  4A53 A;  3G4S T;  1YN8 A;  4XTY A;  5GAM g;  1G8X A;  2O9S A;  3TSW A;  4MZP A;  1RI0 A;  4J9I A;  4PJM A;  1CSK A;  2MAM A;  1QWE A;  5GAN f;  3VS2 A;  1QCF A;  4C8Q D;  1U3O A;  1LPL A;  3MP8 A;  1YJN T;  3FLG A;  3GPL A;  2PUO B;  1X6B A;  3V7R A;  1OU8 A;  2L3Q A;  4CRI A;  2RI3 A;  2YLC A;  2L89 A;  3RDV A;  2PZ1 A;  3CXC A;  3M58 A;  4M77 G;  2DVJ A;  2K5L A;  1M3A A;  4LDV A;  1R77 A;  1D09 B;  1ACM B;  3CCQ A;  2E6N A;  3OYJ A;  1VQO A;  4HVV A;  4ZGD B;  3UA7 A;  5GMK j;  4X34 A;  2PUK B;  3OYN A;  3QUI A;  2RB6 A;  1TWB A;  3PNW C;  1BYM A;  1AT1 B;  2DER A;  2X35 A;  1VUB A;  5A2Q E;  4JUV A;  4UC4 A;  3JCM W;  3CCU A;  2BUD A;  1TH7 A;  2QQS A;  3V7C A;  2FYK A;  1WLP B;  5KYU B;  5CR2 A;  3QXE B;  3IQL A;  4KUD K;  1GL5 A;  1NM7 A;  2EQM A;  1PNJ A;  3MHX A;  4LDY A;  1W4S A;  1C6V X;  2CZ1 B;  2KR3 A;  1HK9 A;  2H3E B;  3R6N A;  1WPY A;  2CP5 A;  2DVE A;  1NJI R;  2DPP B;  3MP1 A;  2MWO A;  1UHC A;  3CCM Q;  3CCM T;  1E6G A;  2VWF A;  1VQP A;  4JLI A;  1OZ3 A;  4OMQ A;  3TEE A;  1W2B A;  2W0Z A;  2DJQ A;  2DET A;  2G3R A;  4C0F A;  3CCE T;  2K3B A;  2KY9 A;  5I2S A;  3WVD B;  2RQR A;  3C95 A;  1NLO C;  1TU0 B;  4IUV A;  4C92 D;  2V8K A;  3V7S A;  2FG0 A;  1M4Z A;  2CSI A;  2XMF A;  4ESR A;  1YIJ T;  3PE0 A;  3R6O A;  3A1P A;  5KYX A;  2E65 A;  4FIB A;  1FMK A;  2OAU A;  4XTU A;  5FW9 A;  1MV0 B;  3MEW A;  2CP7 A;  4CC7 A;  2RD1 A;  1WHG A;  3QKJ A;  3I56 Q;  3SEM A;  2O31 A;  3VS1 A;  1WFW A;  5KH6 A;  3A8H B;  2QA4 Q;  2IVW A;  2RHI A;  2QGG A;  1N27 A;  8AT1 B;  1C1A A;  3OYI A;  3CCS T;  2OI3 A;  2JTE A;  4ZTF A;  3CPW A;  2ZCF B;  4Y92 A;  3F70 A;  3DB3 A;  4DBF A;  2GF7 A;  4BI4 A;  3NTK A;  4JDS A;  1D1A A;  3NGP A;  1K8A C;  2RJC A;  1B7T A;  1VQK T;  3GNG A;  1UHF A;  1XQH A;  2E5Q A;  4AG2 C;  2K3X A;  2RA2 A;  1QQJ A;  2A28 A;  2QTX A;  3FRN A;  2DIQ A;  2H3J A;  2CUD A;  3L2U A;  1Y0M A;  2JVV A;  1FMW A;  1IO6 A;  2RH2 A;  3CCR A;  2C06 A;  3FJP A;  2MMP A;  3TSZ A;  2L3P A;  3ASK A;  3SWN C;  3SFM A;  3L2W A;  1AD5 A;  4NOY A;  2X3W D;  3LGL A;  1VQM T;  4OGC A;  2PNI A;  5KYY A;  3OYL A;  1VQ9 T;  2J6K A;  1YJW A;  4OVA A;  2KRN A;  1OX8 A;  2GCX A;  1VQK Q;  1S1N A;  4BE2 A;  3CCM A;  2A3L A;  2FEI A;  2LZ6 B;  1KHC A;  4LDU A;  5GAM f;  2FVU A;  4KUL A;  2RI2 A;  3VRZ A;  2EVR A;  3JV3 A;  3TVT A;  4RMO A;  2EYY A;  3UF4 A;  3JB9 J;  1G3W A;  3G6E A;  3EGD A;  1X27 A;  4QQD A;  2KRS A;  1OPK A;  2DRK A;  3L2Z A;  2QQR A;  3OSS C;  1TUG B;  3CCV A;  2L3S A;  4RG2 A;  4A54 A;  3OSV A;  1JO8 A;  1YP5 A;  4ZTJ A;  4OMP A;  3NTH A;  5GAM e;  2EKH A;  3UWN A;  3CC2 A;  4E7I A;  4XU0 A;  1VQ7 T;  2V1Q A;  1Q86 R;  4M7D G;  2CZ7 B;  1WNL A;  4RUG A;  2QEX T;  1A0N B;  2P4T A;  4HCB A;  1TUC A;  3JB9 F;  1YFN A;  2RHU A;  1IRX A;  2DA9 A;  2QDY B;  4F17 A;  2CDT A;  1YNZ A;  3OW2 A;  2FPF A;  4LN2 A;  2KDS A;  5GAO m;  2XD0 A;  1WJR A;  3QYH B;  4HVU A;  5FU6 C;  2JM8 A;  3VYH B;  2AT1 B;  3DLM A;  4OMO A;  3ME9 A;  1WZO A;  3L2V A;  4M77 F;  3QG1 A;  2GQV A;  1VQ8 A;  2K5F A;  4GY5 A;  2DJZ A;  1I8F A;  2EIF A;  1QVG A;  4RTW A;  1R8O B;  5A0G A;  4J9D A;  4C8Q C;  4DA4 A;  1YJN A;  1OI1 A;  3CCR T;  3CXC P;  1MV3 A;  2GNC A;  2X4X A;  4C92 E;  1Q82 U;  2MI6 A;  2COW A;  2C0I A;  2DIL A;  2BTT A;  4HKE A;  2DXT A;  3X26 B;  5GAO n;  2YHT A;  1AWW A;  3RES A;  3LWH A;  1AWJ A;  1WXB A;  1YJ9 T;  1AZG B;  2XU8 A;  2DTI A;  1M90 R;  2L5Q A;  4GLK A;  2LX9 A;  1AWX A;  2OTJ Q;  1ABO A;  3CCJ Q;  4E7Z A;  4HT9 A;  2EGE A;  2EQI A;  1KD1 U;  4FW2 A;  3M0Q A;  3HKS A;  1QP2 A;  3EG9 B;  2B86 A;  2JM9 A;  1Q86 U;  4JS4 A;  3M53 A;  4C92 A;  2EJF A;  3QDF A;  3CD6 A;  3N5B B;  1LOJ A;  3Q1J A;  2L8D A;  3EFO B;  1QVF S;  4J6X A;  3CD6 Q;  2XG8 D;  3L2Q A;  1RLQ C;  1WDX A;  2RF0 A;  3OYC A;  2DTO A;  1LJO A;  3MPU B;  4M77 A;  1ZUK A;  1UJ0 A;  5L23 A;  2D8J A;  3SB2 A;  5GAN 4;  3QWX X;  1BCM A;  2QDL A;  2QYZ A;  1UGV A;  1XJW B;  4FT2 A;  4DBR A;  2K2M A;  3S6W A;  4BD3 A;  3J7A F;  1W2B P;  1ZA1 B;  4F7U A;  4C0D B;  3EGX A;  1K76 A;  3HRS A;  4RCB A;  4JRP A;  1OZ2 A;  2A36 A;  4M75 C;  2RHX A;  3KBG A;  4KGX B;  5LJ3 g;  1EX4 A;  2DKG A;  4C92 F;  1G3S A;  1TOV A;  1QMC A;  3VS6 A;  2VAS A;  5J3B A;  2XDP A;  1UDL A;  5CQY A;  3WXM B;  2YLB A;  3PIP A;  1VQP T;  5FWB A;  3C4S A;  1I07 A;  2LQN A;  3OB9 A;  1EIF A;  2QXF A;  4PK4 A;  8ATC B;  4FYY B;  1WIE A;  1RLP C;  2F2X A;  2QG9 B;  2COZ A;  3O5Z A;  1Z9Z A;  1M3C A;  3P8B B;  2LDM A;  4YTL A;  2OJ2 A;  2O2O A;  4FW1 A;  3MET A;  5GAO r;  2DXC A;  3X25 B;  4J5Y A;  4EMK A;  1IRE B;  4FT4 A;  2DRM A;  3T9N A;  2DFU A;  4PNO A;  1M1G A;  1RAF B;  2IPO B;  1H3Z A;  3CME A;  4B6M A;  3HSB A;  2ZPE B;  2K4Y A;  3VUZ A;  2LP5 A;  4C0G A;  3RNJ A;  3JCM e;  1AHJ B;  1YJW T;  1O9S A;  2VC8 A;  4OGE A;  2VGM A;  5HCK A;  1VYU A;  1SPK A;  4BE0 A;  1YHQ T;  1RAC B;  3A5Z B;  2O4X B;  4D8D A;  4RG8 A;  4AG1 C;  1GBQ A;  4GBQ A;  1ABQ A;  3H6Z A;  5EC7 A;  2PVO B;  2Y90 A;  1K9M R;  4E6R A;  4N0A A;  2LCC A;  2GBQ A;  4R0K A;  4Z8A A;  1JRI A;  2LCL A;  2K57 A;  1MHN A;  2MPX C;  5KCH A;  4B9X A;  2AZS A;  4J9C A;  2KMT A;  1NPP A;  1YHQ A;  4M78 B;  2BE9 B;  4M78 G;  2R5M A;  1VQK A;  2FRW A;  3BFM A;  1WJQ A;  3VS7 A;  5KYX B;  1YJW Q;  1MMD A;  4M78 F;  2M02 A;  5FU6 B;  5D7U A;  4LDW A;  1QP3 A;  2YUO A;  4ZN1 A;  5GAO l;  2RK2 A;  2DL8 A;  3E1S A;  3U23 A;  4M7A B;  4M7A G;  5AT1 B;  5C6S A;  3CCS A;  1I0C A;  1C0M A;  4OMM A;  1RI9 A;  2VKN A;  3ZL7 C;  3SD4 A;  2YT6 A;  4JPB W;  4MDX A;  4BI8 B;  3JB9 D;  1N9R A;  4PLL A;  4N4G A;  2DXU A;  1IHV A;  3LX7 A;  4M7D F;  1X2Q A;  3MJX A;  2QQA A;  3MKD A;  1WHJ A;  1YIT T;  1Q7Y C;  1PRM C;  2FHD A;  4F7U B;  3S3N A;  1WHM A;  4RKU E;  1KD1 R;  1YJN Q;  1D3B A;  2XIC A;  4A4G A;  4KBM B;  4KGZ B;  1WXT A;  3KUF A;  2QAZ A;  3MEA A;  3PMT A;  2RI5 A;  1Y7X A;  3RBB B;  4GLM A;  4QVD A;  4E7L A;  4CC2 A;  1K73 R;  4D6W A;  5GMK e;  6AT1 B;  2Y4X A;  4FYX B;  4FYW B;  3CCE A;  2M9U A;  3M4G A;  1PKS A;  2LT1 A;  2LJ1 A;  2VYT A;  2DYB A;  1WHH A;  2YXY A;  2RNA A;  5DY9 A;  1Q7Y R;  3GNF B;  1NYG A;  4AFU C;  1RAE B;  2E64 A;  3OYM A;  2LCS A;  4EMG A;  2CSQ A;  2QK0 A;  1JJ2 S;  2EQK A;  3QO3 A;  1FMV A;  5DM7 R;  1TSF A;  1VA7 A;  3JRZ A;  1BCO A;  1D0Z A;  2QQB A;  3J80 E;  2CP0 A;  2ZAE A;  4L6V 5;  3EAE A;  3CCV Q;  1ZSZ B;  1RAG B;  2ZPI B;  4OP0 A;  4HXJ A;  4C0D C;  4OB0 B;  3A8M B;  3BE3 A;  1H92 A;  3OMC A;  3QZ5 B;  3HTR A;  4C5I A;  4KGV B;  3CCU T;  2JS2 A;  3QBY A;  2KYB A;  3RMQ A;  3REB B;  4JRK A;  2F5K A;  2FPE A;  2LJ3 A;  2E5K A;  3OQ5 A;  1IZ6 A;  4N4I A;  2EQU A;  2DNU A;  3L42 A;  4OB1 B;  3KXT A;  3EG9 A;  1JBM A;  2K79 A;  1VQO T;  1D0Y A;  1OUL A;  4MML A;  2COY A;  2E6Z A;  4Q5W A;  4C8Q F;  2KE9 A;  2JT4 A;  1M1K R;  5GJV B;  1M1K C;  2M0O A;  3SWN A;  3EG3 A;  1GXI E;  3VYG A;  3V8J A;  1PCX A;  4XTX A;  5ECA A;  3G71 A;  4J9G A;  2VB6 A;  3OW2 S;  1PHT A;  1JQQ A;  2M16 A;  2QGF B;  4EIK A;  1GFD A;  2NUT B;  2KRM A;  3OY9 A;  2QEX A;  5CKD A;  1Y96 A;  4J9H A;  2IG0 A;  3A8L B;  1VQ7 A;  1VQO Q;  3CC2 T;  1BU1 A;  2J7I A;  3CPW P;  1WA7 A;  4DQ2 A;  4HT8 A;  2DF6 A;  1VYT A;  2Y4Y A;  5GAN e;  3OS1 A;  2OAW A;  1OQK A;  1S72 Q;  2KGT A;  4LXC A;  3CCV T;  5GJW B;  3X20 B;  3QSU A;  3X24 B;  2DM1 A;  2D0N A;  1V1C A;  2DK3 A;  5DLO A;  2X4Y A;  1D1B A;  1KG1 A;  2X4J A;  1Z9Q A;  1GCQ A;  2CYZ B;  5GAN j;  1I4K 1;  3C12 A;  1GCQ C;  4C92 B;  5LL6 S;  3J81 E;  4Y28 E;  1UB4 A;  2DO3 A;  2EYQ A;  2CGH A;  1Q7Y U;  2XHC A;  3HHT B;  3V8K A;  2CP3 A;  1FWZ A;  4QW2 A;  3DB4 A;  4EMK B;  1KK7 A;  4M7A C;  5A0D A;  3EG0 A;  2O88 A;  5KYN A;  1VQ5 Q;  3OMG A;  4C8Q A;  3KFV A;  1OOT A;  3RKX A;  1VQM Q;  4IIO A;  1Q82 C;  2X9H A;  5LJ3 e;  1QVF A;  2X3X D;  4M75 F;  2DE0 X;  2ZPB B;  3VS3 A;  2EYX A;  3HRT A;  1HD3 A;  1MMA A;  3UA6 A;  1G83 A;  2KAF A;  3BY7 A;  3RUX A;  1VQN Q;  2R5A A;  2LQK A;  5CIU A;  3MEU A;  3QHS A;  1F1B B;  4JJB A;  5GMK m;  3CMA T;  3M0R A;  4M7D B;  2VXE A;  4DEY A;  2ZPH B;  3C0C A;  3NHN A;  2K9G A;  5GAM h;  3SDZ A;  4KT0 E;  2EJ9 A;  2HCK A;  3EGD B;  1X69 A;  2H8H A;  2BZX A;  2NLU A;  3ZEH A;  3JAM E;  4EMK C;  3BDL A;  1YJ9 A;  2KT8 A;  3CCJ A;  2B8A A;  4R56 A;  4XU2 A;  3PVQ A;  4IKF A;  9ATC B;  3CC2 Q;  5FU7 C;  5CKF A;  1BK2 A;  4M7A D;  4AFZ C;  1NJI U;  3VV0 A;  3DKM A;  2QA4 T;  1G3Y A;  3EFR A;  1X43 A;  2AKK A;  1YI2 A;  3M0P A;  2YSQ A;  3JB9 G;  1I1J A;  4II1 A;  2P84 A;  2HEQ A;  1QCN A;  2WSE E;  5HKC A;  4M78 D;  2EYW A;  2HQX A;  5GAN 3;  3JCM f;  2E4H A;  5GAO p;  2F1L A;  5HY6 A;  1SRM A;  1BI2 A;  3S3O A;  1I5O B;  1WGS A;  5LJ5 d;  2HQE A;  2QA4 A;  2HSE B;  2KK4 A;  4FCY A;  1M9S A;  1SF9 A;  4HCK A;  5I11 A;  3SHW A;  4C5G A;  3MO8 A;  2WAC A;  3VS5 A;  3EHQ A;  1VOM A;  1PRL C;  5GMK i;  2YRD A;  3FEO A;  3VS0 A;  1SSH A;  2OTL T;  2DD5 A;  4RCC A;  2KXC A;  4QKU A;  3L2R A;  4AMC A;  4C8Q B;  1PM3 A;  1D0X A;  1PD0 A;  4A4K A;  4BUG A;  4F16 A;  2K7A A;  5LJ3 j;  2GFA A;  2DTH A;  4F7U E;  1SHG A;  4LE9 A;  3LH0 A;  3BDU A;  5FU7 B;  2KYM A;  4PJN A;  1ARK A;  3E9F A;  1NJI C;  2K5I A;  2HBW A;  2I0N A;  2GTO A;  2K3Y A;  3CME Q;  2LX7 A;  2F2W A;  5I2M A;  2CP6 A;  1N5Z A;  4B9W A;  5J26 A;  3AT1 B;  2IIM A;  1VQP Q;  4DBH A;  2YWW A;  3QJY A;  2LNV A;  3EFO A;  3C94 A;  3RKW A;  4HCC A;  4JZ3 A;  1SEM A;  3VS4 A;  2RJE A;  2HL5 C;  3LLR A;  4E47 A;  5IH2 A;  3JCM c;  5GAN 6;  4DOW A;  1OX9 A;  2PU9 B;  5I22 A;  2HMA A;  1VQ6 A;  4BDZ A;  1UG1 A;  4HVW A;  3CXC S;  3E19 A;  3GOX A;  3CCQ T;  2NUP A;  1LVK A;  1KQS P;  3EH2 A;  3I56 A;  1SKU B;  3EGU A;  2J6O A;  2KBT A;  1YI2 Q;  4M75 E;  4QVZ A;  3LH5 A;  2DYI A;  1TS9 A;  1YCS B;  1VIE A;  1WQ7 A;  1N8R C;  1R0C B;  1KHI A;  4PKC C;  1T0H A;  3I55 Q;  1MMN A;  1X6O A;  3M59 A; 
#chains in the Genus database with same CATH homology
 3CCU Q;  3CCR Q;  3CD6 Q;  2OTJ Q;  1QVG P;  3CXC P;  2QEX Q;  3CC4 Q;  3CCJ Q;  3CCM Q;  1S72 Q;  1VQ6 Q;  3G6E Q;  1VQ8 Q;  1VQP Q;  1Q82 R;  3CCS Q;  1YHQ Q;  1JJ2 P;  1KQS P;  1VQN Q;  1N8R R;  2QA4 Q;  1Q81 R;  1KC8 R;  1K73 R;  3CCQ Q;  1NJI R;  3G4S Q;  3OW2 P;  1YI2 Q;  3G71 Q;  1VQ5 Q;  1VQ7 Q;  3CCL Q;  1M1K R;  1Q86 R;  3CC7 Q;  1VQO Q;  3CMA Q;  1VQ4 Q;  1KD1 R;  1YJN Q;  2OTL Q;  1VQM Q;  1Q7Y R;  1YJ9 Q;  1VQL Q;  3CCE Q;  3CPW P;  3CC2 Q;  1M90 R;  1VQ9 Q;  3CCV Q;  3I55 Q;  1K8A R;  1YIJ Q;  1YJW Q;  1VQK Q;  1QVF P;  1K9M R;  1YIT Q;  3I56 Q;  1W2B P;  3CME Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...