2K3XA

Solution structure of eaf3 chromo barrel domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
115
Chain Sequence
MVDLEQEFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Chromatin modification-related protein EAF3
publication title Structural Basis for the Recognition of Methylated Histone H3K36 by the Eaf3 Subunit of Histone Deacetylase Complex Rpd3S.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k3xA00
3MEAA 3PMIA 1KHCA 2K3YA 3S3NA 3H6ZA 3NTHA 2EKOA 3OQ5A 3L2WA 3OYNA 4X34A 2RHZA 3FC3A 5FRMA 5C6SA 3OYMA 2F5KA 4QVZA 3S3MA 3QBYA 2QQRA 5J39A 3L2QA 3CEYA 3LYIA 5KCHA 5J26A 5FROA 4IUQA 3OYJA 4IURA 2GFUA 5KCOA 3OYEA 4E7HA 5D6WA 3LX7A 2G3RA 4N4HA 4FU6A 4IKFA 2EFIA 2L89A 4PLIA 4BACA 4E7LA 2GF7A 4L59A 2R58A 3P8HA 4A4FA 2EQJA 3MP6A 3META 2YRVA 4C5IA 2R5MA 2M16A 5D6XA 1G5VA 2HQXA 3KUFA 1OZ3A 2O4XB 2QQSA 3OA6A 3LLRA 3LGFA 4ZTFA 3C4SA 4HCZA 4FL6A 3PMTA 5IN1A 1OYXA 3OS2A 2PQWA 3PFSA 3SD4A 5KE3A 3OYLA 4B9XA 4IUUA 2RHUA 3Q1JA 4IUTA 4Z02A 2EQKA 3OYIA 2L3RA 3OS1A 2B8AA 1RI0A 3FDRA 2VYTA 3DB4A 2BIVA 4A4GA 2JTFA 3MP8A 3NTKA 2FHDA 5M9OA 4NS5A 1WJSA 3OYDA 3BDLA 4C5HA 1MHNA 2RHXA 1OZ2A 2LVMA 2RO0A 3QKJA 4N4GA 4A4HA 2LCCA 3L42A 4OVAA 3ZEHA 3OYAA 2RHIA 2M0OA 5C0MA 2XK0A 2LTOA 3OS0A 2X4XA 4PL6A 4A4EA 3MP1A 4BE0A 1H3ZA 1WJQA 2R57A 4IUPA 2LDMA 2RHYA 2GFAA 3MEWA 3OMGA 2EQUA 3P8DA 2MWOA 2MWPA 2BUDA 2D9TA 4EDUA 4LD6A 3OYCA 3M9QA 3OB9A 4QQ6A 4QW2A 3MEUA 2RJEA 2P0KA 3S6WA 2E5QA 3ASKA 2L8DA 3LGLA 3PNWC 3GOXA 2RI5A 4QQGA 2RJDA 3F70A 4BE2A 3OYFA 3L2RA 2EQMA 1WJRA 2R5AA 2HQEA 2XDPA 1XNIA 3DLMA 4N4IA 2E6NA 2M1HA 5KE2A 4E7KA 2K3XA 3L2UA 2IG0A 2RI2A 2X4YA 4QQDA 4E7IA 5D6YA 3OYHA 3MO8A 2JZ2A 3NTIA 2O4XA 4BD3A 4C5EA 4B9WA 4BE1A 4GY5A 4IUVA 4C5GA 3OYGA 3H8ZA 2CKKA 3EAEA 4CRIA 2X4WA 3QIIA 3QJ6A 5IAYA 3LH0A 1N27A 2LRQA 3OY9A 4Q5WA 5CIUA 3O8VA 2DIGA 5FRNA 3FEOA 5KH6A 4ZTJA 2RJFA 3E9FA 2DIQA 2RI3A 3OYBA 1SSFA 4BDZA 3UT1A 2RJCA 2WACA 4II1A 1WGSA 3E9GA 1OI1A 4E7JA 4PLLA 3L2VA 3OMCA 2BKDN 3UWNA 2X35A 3ME9A 4RG2A 2DAQA 3FLGA 3DB3A 4UC4A 2NLUA 4BDYA 3S3OA 3OYKA 3MEVA
chains in the Genus database with same CATH superfamily
1ACMB 2K5LA 3QDFA 2D0NA 1UFFA 1BCOA 3NPFA 2A36A 4OMMA 4KH0B 4N0AC 1C6VX 3OQ5A 2ZZDA 1VQ7A 2CZ7B 2K6DA 4JS5A 2F5KA 2AK5A 2CUDA 5CKEA 5I2SA 3CC2A 4A53A 3E19A 1YBYA 2EJ9A 1K8AC 2EQJA 5LJ5e 3QWXX 5D6XA 1TOVA 4AFZC 4C0DB 1VQKA 2EYXA 3RR6A 1MMAA 3CCUQ 5IHIA 4HCZA 1VQ8A 1B07A 2KYBA 1QP2A 2E65A 2L3RA 3M56A 4PJOE 3CCJA 3A98A 3M5AA 3NTKA 1U1SA 4WF2A 1EIFA 3V7CA 3CPWA 1D1AA 2DL4A 1K76A 1VYTA 4KUIA 3J7AF 2LTOA 3H0FA 2HL3A 1M2VB 2VASA 3CXCS 1O75A 1WZOA 3MEUA 1X2QA 4BY6C 4AFSC 3SHWA 4JRQA 2J6KA 1X01A 2DTOA 4XTUA 1KC8C 1YJWA 3A8MB 3RDVA 3CCEQ 3RBBB 2K3XA 2CT3A 1VIFA 3RIRA 3N5BB 1RAGB 5GAOl 3JCMb 2EJGA 4BE1A 1Q86C 3GIBA 4ZN3A 3HRTA 5IAYA 3EGDB 4JZ4A 2GCXA 2H3JA 1K73R 2NUPB 2PVOB 5KH6A 3VS7A 2QEXA 2JOYA 1HSQA 1D0ZA 1QLYA 3HFOA 1R8OB 2IIMA 3REAB 3UWNA 2DXCA 2LJ1A 3IQLA 5GANf 1JJ2S 4OMOA 3X20B 2PTKA 2RM4A 3PIPA 4FIBA 2RHZA 1BKBA 1W1FA 2FZKB 1A0NB 3LYIA 4Z89A 3VRZA 5GMKi 4IURA 3JCMX 3VYGA 3CCRQ 2ED1A 3META 2PU9B 2YUNA 2PVGB 2ZPFB 1FMWA 1Q81C 1SRMA 4D8DA 3FDRA 3M0UA 1VQ5A 1VQMQ 4OB1B 1W2BP 2CS7A 3NGPA 5GANe 1M1GA 1G8XA 4PNOA 4C5HA 1PCXA 4N4GA 4Y92A 2EW3A 2QXFA 3JCMV 2H8HA 5DY9A 1F1BB 3GF5A 1YJ9T 3CC4A 3CC7Q 2AZVA 1YIJQ 3G4SQ 1VQ6A 2KI7A 1SEMA 3PNWC 1UUEA 1ABQA 1FXXA 3PIOA 8AT1B 3O5ZA 3JB9G 1NYFA 1RI9A 5CQXA 3QWYA 3M0TA 1BBZA 1TSFA 2C06A 2JM9A 4OF1A 3CCLA 3G71T 2O4XA 5GAN8 1PRMC 3QG1A 4C5GA 3CCVA 2CZ0B 4Q5WA 1H3HA 4OGEA 1D0XA 3CCQA 2Y4XA 2YLBA 4O6JA 4WTOB 2L3SA 7AT1B 1SPKA 4M7DG 3UF4A 3S3OA 4C92A 4RTYA 3VYHB 1M1KU 2JJ9A 1D3BA 3E2UA 1WXBA 3NTHA 1WHHA 4IIMA 3L2WA 1GXIE 4RKUE 4E47A 5CKFA 5DLOA 2QGFB 4PJLA 4PK4A 3OYJA 4OB0B 4BACA 3RKYA 2HKNA 2ENMA 2R5MA 5KYYA 4N0AA 4PJOG 1X27A 1C1AA 1VQNQ 1S72A 2XDDA 5KE3A 2LC4A 3J80E 1N5ZA 3KXTA 2RD1A 4C8QD 1WJSA 4JRIA 1UGPB 5EG2A 1UTIA 3CMAT 2Y90A 2DZCA 1H3ZA 3ZFJA 2LDMA 1BIBA 2CZ1B 4PFPA 4QVDA 4Z88A 5FU6C 3OB9A 2X4JA 4LN2A 3FIFA 4RTWA 3OYFA 3G6ET 4M77B 5GAMg 1YITA 2LJ3A 2KEAA 2P84A 1GFCA 4J83A 3L2UA 1K9AA 2QAZA 4AFUC 1WYXA 1ZBJA 5KYUB 4C5EA 1WQWA 3JCMg 4IIOA 3WVDB 2MMPA 2CP3A 3OS5A 2E10A 2QYZA 2CZ6B 1PSFA 2D8HA 2FRYA 5FW9A 4C92F 2BTTA 4J9HA 1QWEA 2RK1A 4HXJA 4J7IA 3JB9J 2LCLA 1VQ4A 1K9MC 2O88A 3SWNC 2JMCA 4JJCA 5CVIA 1ZHIA 2LQKA 1K8AR 3V8KA 2QASA 3FC3A 5FRMA 2ECZA 3QBYA 3JCMW 4IUQA 2LQNA 4J9IA 3OYEA 2NUTB 3LX7A 1NLOC 2L89A 2OTJA 2DD4A 4C8QF 4LUEA 1GCQC 1ZSGA 1X43A 3M4YA 5A0GA 4KBMB 4GLMA 3ER0A 2SRCA 3OW2A 4DEYA 5GAN2 3JCMh 3CBMA 2CH4W 2HSEB 1YI2A 4J9GA 2DXTA 4ZGDB 2E5KA 4HT8A 1B7TA 2HL5C 1KC8R 3A5ZB 4C92E 2A37A 2BE9B 2ZPIB 3GNGA 3A8LB 2GFAA 3P8DA 2BUDA 3M59A 1Q86R 2O31A 3KBGA 1I81A 1YJNQ 5GAOp 2XG8D 2KXDA 3JCMP 4KH1B 1QVFS 4QQGA 2RN8A 2QQ9A 1QVGP 4M77D 4X9DA 2HDAA 3CC7A 1YJ9Q 1XNIA 2KBTA 1WPYA 3JSCA 1NJIU 2RI2A 4YTLA 2JNGA 4MZTA 2VGNA 5FLXE 4DBHA 1M90R 3CCET 4FM4B 5LJ3e 3A1PA 4X9CA 3OYGA 3VS4A 4JDSA 1N27A 5GAN6 3OY9A 4OMFB 1IRXA 9ATCB 1SHGA 4M7DA 3E9FA 3EG9A 4M78B 3LH5A 4M75C 3VS3A 3E9GA 5CO7A 1V76A 2DK3A 1VQPA 3HRUA 1W70A 1M3CA 2PUKB 3FLGA 3CCMT 3L2ZA 2Y4YA 3OYKA 4JUVA 3CCSA 2K3YA 1VQOQ 3PT9A 1Q81R 1G3WA 2XIDA 1KD1U 3EG3A 4A63B 2HD0A 5J39A 5J26A 2CP5A 2X9HA 1AEYA 4HCCA 2R58A 1VYUA 2YRVA 4D8KA 1FYNA 2DRMA 1IO6A 2FVUA 2KSSA 2VB6A 4C0DC 1K0SA 2ROLA 3CCRT 2L3QA 2IVWA 2QA4T 1XQHA 2A7YA 3PFSA 3C94A 4IUTA 2EGAA 3R6NA 2EQIA 3DB4A 3WXMB 3FB9A 2V1QA 1WXTA 2Z0WA 3VU3C 4DBQA 4DEXA 2LCCA 1TG0A 2V8JA 2OX7A 1VQMT 1Q7YC 1JXOA 5C0MA 3JCMd 5A2QE 4IUPA 3EGUA 1JRIA 2RHYA 2RMOA 2HKQB 2MWPA 4ANJA 2GQVA 4LD6A 1N8RU 3M9QA 2DMOA 4KT0E 1YIJT 4PJJA 5GANj 3G4ST 4CI0C 3CMAQ 2AIRB 2L2PA 2EQMA 2HQEA 1KQSP 1X6GA 3VS2A 3H0IA 5HY6A 1Q82C 3CXCA 1AOJA 2W0ZA 3I5RA 2JZ2A 3VS5A 4FYXB 2EAYA 3C95A 1PKSA 1KD1C 2DRKA 3CD6Q 5CIUA 1SF9A 2CSQA 2O9VA 4M78D 5KYWB 3I55Q 1IHVA 1Y96A 3UT1A 2LX7A 1OI1A 4XTWA 2E41A 1I0CA 1UJYA 4PFOA 3VV0A 1KHCA 3OYYA 2DXUA 2EBPA 3PE0A 3OYNA 4E6RA 4TVRA 2QG9B 3SWNA 2ZPHB 2DD5A 3GP8A 4EMGA 2XU8A 4M7AB 3ZBDA 3QZ5B 4IKFA 1JJ2A 2P0PA 4L59A 2ROTA 2COZA 3MP6A 1U1TA 3MJXA 1D09B 3I56Q 2I0NA 4QKUA 2A08A 1OYXA 4KGZB 4M7DE 1G2BA 2GQIA 4JS4A 4JPBW 1VQNT 4OMNA 2QQBA 4C92G 2DTIA 4C8QC 3QKJA 4A4HA 1GCQA 1U8RA 3OS0A 2X4XA 3SB2A 2D0QB 2M9UA 1RAEB 3NFCA 2ESWA 2EQUA 5GMKh 3PTAA 4D6WA 2EYWA 2RJEA 1ZLMA 2V8KA 3TCJA 2IPOB 2MIOA 3BFMA 1IB8A 2FYKA 3DLMA 1EX4A 1AWJA 4N4IA 1TUDA 2E4HA 1N6AA 2IG0A 2PNIA 3RERA 1RLPC 1K9MR 2L3PA 4C8QG 3OYHA 5GAOq 1X6OA 3RMSA 2DEUA 1M2OA 3EFOA 4IUVA 2DTHA 4J8OA 2KQWA 2PZ1A 1RACB 3HFNA 1JQQA 3V7RA 2EGEA 2E64A 1WLPB 5GAOm 2XICA 4F7UB 3CPWP 3OYBA 1SSFA 2EGCA 4J9CA 1YP5A 4II1A 2BE7D 4JLIA 3PVQA 2P4RA 4RUGA 1ZUYA 2ED0A 1Y57A 2GBQA 4AMCA 4DOVA 2DO3A 1D0YA 1VQLA 3G71A 3QO3A 2LZ6B 2EKOA 2OTLA 3TVTA 2C0IA 4M75A 4X34A 4HA8A 3H0HA 2OJ2A 1UGVA 2HCKA 4M7AD 4M75D 5CKHA 3NMZC 2K79A 4XAXB 5EC7A 3QUIA 4OB2B 3CCMQ 4LD9K 1ZSZB 2DNUA 4XU1A 1BB9A 3MCAB 5HK0A 2FEIA 3DLLA 1YN8A 1OOTA 3OBYA 5HCKA 2QQSA 2O4XB 2JMAA 4XTVA 4F17A 1M30A 4AG1C 1H641 3C12A 2EQKA 3EGXA 4LDXA 4EIKA 1ZA2B 5AYFA 2F2XA 3UDCA 1IREB 1PD1A 3A8GB 1B34A 1ABOA 4FYWB 4FYYB 4XU0A 1AVZC 4JJBA 2QA4Q 1VQ7T 1OX9A 3OMGA 1I07A 2HSPA 1JB0E 2D9TA 2KE9A 1VQ9Q 1G3SA 2P4TA 4J6WA 4ELYC 1EZZB 2A3LA 4MMLA 5KYXB 5DM7R 2K5IA 1M3BA 1YJNT 2FG0A 3INZA 4M77C 2KRSA 1OU9A 1W2BA 2E6NA 1OQKA 1FWZA 1M2VA 3JCMQ 1UGQB 2V8IA 1LCKA 2DL7A 3QIIA 5CKBA 1AWXA 3MHXA 4B6MA 1E6HA 3RMQA 1M1FA 3MKDA 1Z9ZA 2LCSA 2CREA 4C0FA 3L2VA 1GFDA 1IGUA 4M75F 2DAQA 3G6EA 2NLUA 3EGDA 5LJ3j 1NEGA 1MGQA 4AT1B 1YJWT 1PSEA 3OYMA 3RESA 1VQOT 3M4GA 2CYZB 1UGRB 2O9SA 5IXFA 4MZMA 2EPDA 3GNFB 4E7LA 4OB3B 4CC2A 4KGXB 3M0SA 1Q7YR 1CKAA 4FSXA 4RG8A 1WX6A 4ZTFA 1QCFA 3PMTA 2RK2A 1NBEB 4KRTA 2RHUA 1OEBA 3URGA 1RI0A 1E6GA 5L23A 1MV3A 1UGSB 4HCKA 4ZGEB 5CR2A 1SHFA 2CT4A 1T0JA 2XK0A 4PL6A 1Q82R 4RCCA 3M53A 1D1CA 2X3XD 1SRLA 4M75E 2DM1A 5AT1B 1QCNA 2P0KA 4C8QA 2JXBA 2DL5A 2X3WD 4LE9A 2LNHB 4C0ZA 1NPPA 1QWFA 3CCUA 1H92A 3VS6A 2XD0A 1U06A 2DZ9A 3SDZA 1W2BS 1QVFA 3BY7A 1IZ6A 3FRNA 2FZGB 4KGVB 1HK9A 4FYVB 2AHJB 1TWBA 3CD6T 4M78C 3CC4T 1H8KA 1WGSA 1OPLA 4PJNA 3OMCA 4DQ2A 3I55T 1VQ6T 3ME9A 1UB4A 1WHGA 2DBMA 4BDYA 3DB3A 1M1KC 2BZYA 3QZ9B 4V2SA 1K73U 3CCEA 5IHKA 3CCLT 2V26A 1VOMA 2EKHA 5FROA 2K5FA 2CP6A 2DL3A 1X75C 1HXDA 3JRZA 3AT1B 1OZ3A 1M27C 5IN1A 3VKIA 3I56T 4ZNXA 4B9XA 4RTTA 3Q1JA 2HBWA 3OYIA 2YRCA 2B8AA 4GBQA 5GAMf 4A4GA 3SEMA 2MOXA 4M7DB 1UDLA 2K2VA 5GAN4 4OVAA 3CPFA 2DKGA 3ZEHA 2NUZA 3VUZA 2LT1A 2LMJA 3JCMf 3EG2A 2M02A 4HT9A 1R77A 1ZUUA 1W6XA 3MEWA 2MWOA 1I5OB 4EDUA 1JXMA 2LX9A 2WSCE 2VXEA 1HD3A 3ASKA 2L8DA 1RAHB 1KIKA 3GOXA 3CMET 5D7UA 3CCRA 2QA4A 4R56A 2EVRA 4LXCA 2LQWA 2R5AA 2KT8A 4F16A 3JB9I 5GAN7 4PJOB 1VQ7Q 1QCOA 4E7KA 1RABB 1KSWA 1M8MA 2X51A 4ZN1A 1KQ2A 3OW2P 5LJ5j 1U5SA 5GAMe 2E70A 2SEMA 1NLPC 2G6FX 4NL2A 5I21A 5L8RE 4A54A 3CC2Q 1VQMA 2AZSA 2OAUA 3P8BB 4FT4A 1QMCA 1WXUA 1WI7A 1VQKQ 4M77A 3M54A 2JUFA 2BZXA 1VQ8Q 3I9QA 2HAXA 2JT4A 5KYUA 1YIJA 3CCJQ 2YHTA 1OULA 1J3TA 2GNCA 3TQ7P 3QDRB 1GRIA 5LJ3h 3G4SA 1CSKA 4UC4A 2XKOC 1ZUKA 2E6ZA 2JVVA 3FJ5A 2HNIA 4C8QE 1JBMA 3AHUA 2LNVA 5IH2A 3OSSC 4QVZA 3OSVA 1ARKA 1XOVA 5I11A 2DFUA 4M7AC 2GF7A 4OGCA 4C5IA 2KK4A 1YJWQ 2JS2A 2ZPGB 4X1VA 1WA7A 5CQYA 1IXDA 2EIFA 1B3QA 2YXYA 4EMKB 3EFRA 2KT1A 3CBOA 4XK8E 1Y0MA 2DLPA 1QQJA 1FMVA 4EMHA 1QVPA 3QXEB 2RHIA 3V8LA 3BW1A 4AFQC 2ABLA 4M75G 4A4EA 3MP1A 1IHWA 1QW1A 3JCMc 3QHSA 1KK7A 4JJDA 1RLQC 2DYIA 5I2MA 1BU1A 1LOJA 2BZ8A 1MMNA 3NHNA 2NWMA 3HHTB 1YHQT 1VQ9T 2K2MA 2XDBA 2RA2A 4PJMA 3T9NA 5IT9E 3L2RA 1N9SA 1QP3A 4PJOD 5FU7B 1NJIC 1JO8A 2QGGA 5KE2A 4HCBA 5J3BA 1VQNA 1PKTA 1GBRA 4M77F 1AT1B 3U23A 1NYGA 3H8ZA 3EAEA 3LWIA 4CRIA 1KG1A 1TU0B 2PUOB 2F2WA 2H3EB 2CSIA 1K4US 1T0HA 1V29B 3WVEB 3E1SA 3M0PA 2WACA 1VQ5Q 4JJNK 2ZPEB 3UA7A 2C0TA 2V1RA 2CGHA 3TU4K 1QVGS 2XHCA 1NE8A 1BK2A 2A28A 2QTVA 4HVVA 4ELZC 2OI3A 4M78A 2QQAA 3CC4Q 5C6SA 4RTUA 5LJ3d 2GTJA 4JZ3A 3CEYA 3CXCP 1VQ6Q 5LJ5g 5KCOA 4DBRA 2VV5A 2VGMA 1ZSZC 2RQRA 5KYNA 2DE0X 2I2LA 4XTZA 1UE9A 2KRNA 1K8AU 2QI2A 4FW1A 4JRKA 3OA6A 4J5YA 3CCLQ 3KFVA 1TXQA 1VQPT 3GBQA 4M77E 4F04B 3OS1A 3EG0A 1LNXA 2KDSA 1UECA 1XJWB 1D1BA 2JTFA 2M51A 4NS5A 3OYDA 1OU8A 2RQWA 3CCST 2MCNA 1GL5A 2YWWA 4J9DA 1Q95G 2COYA 5CK9A 3GPLA 4O5VA 2R57A 1N8RC 1TTHB 2HQHA 3OBWA 3ULRB 2FZCB 3HSBA 4OP0A 2B86A 1JU5C 4J7FA 1RADB 3F70A 1JJ2P 4BE2A 2D8JA 2HMAA 1E7OA 1CKBA 5IHNA 1WJRA 2QTXA 1X6BA 1KC8U 5LJ5h 4PKCC 1PD0A 2E3IA 4QQDA 4QVCA 5GJVB 2J7IA 1M1KR 1Q86U 3LH0A 4Z8AA 5HK3A 3CMEQ 2LRQA 2LQ8A 4RTXA 1T3SA 4HVWA 2WSEE 2C0OA 2RJFA 3EH1A 3EGXB 3HKSA 2KY9A 1S72Q 2VVKA 1B34B 1N9RA 2L5QA 1LPLA 4A4KA 1YJNA 2JW4A 4M78F 3QSUA 3A8OB 1M90U 5I22A 3FJPA 2FPEA 3PMIA 1KQSS 5GMKe 2ATCB 2K7AA 5KYWA 1YJ9A 1RUWA 1V1CA 1X2KA 5IXBA 4ORZA 2QK0A 3S3MA 2HEQA 1NG2A 2K4YA 1G3TA 1ZBXA 4R0KA 3EFSA 1NPRA 1AD5A 2EFIA 1IGQA 1PC0A 1RAIB 2FO0A 4A4FA 3PGGA 2L0AA 1YITQ 3LGFA 2FPFA 5GANg 3RUXA 1YWPA 2KRMA 4HKEA 1Q81U 3EH2A 2E3HA 4IUUA 1ZQ1A 2RNAA 3RNJA 2RPNA 4J9BA 4LUDA 4M7AA 3G7ZA 1Z9QA 3RKXA 2FHDA 1I4K1 1MHNA 2GTOA 2RHXA 3L42A 4RMOA 2DETA 4KUDK 1I5LA 4LNPA 1VQOA 2VC8A 3LWHA 4OMPA 1UG1A 4BE0A 1VQ4Q 4ZGJB 4VUBA 4M78E 2FPDA 1MUZA 2KMTA 1PHTA 3TREA 1WFWA 3X28B 2JM8A 2RJDA 1TUCA 2KXCA 2KROA 2FRWA 1M90C 3VS1A 4GY5A 1RAAB 1BI2A 2J06A 2DEQA 3QJ6A 4C92B 1YHQQ 2OTJQ 2KAFA 3O8VA 5FRNA 1NM7A 2CP0A 2DXBA 1D3BB 5LJ5d 3FEOA 5GANh 3CC2T 5GAOr 1OPKA 2RI3A 3BE3A 4XQ3A 1X69A 2F1LA 1VQKT 1YI2Q 3SFMA 4NL3A 1VQ8T 2AKLA 4ME7A 5GAMj 5GAN5 3CCJT 4BB7A 3CMAA 3D7SB 5KYYB 4F7UA 1K0XA 3MPUB 1YFNA 4C8QB 2KVQG 4CC7A 1AHJB 3THKA 2YUOA 1PRLC 2G3RA 4N4HA 4KULA 4MDXA 2YSQA 3CD6A 1BI1A 3HPWA 2LJ0A 4M7AF 4M77G 3CPWS 2DVJA 3C4SA 4BI4A 2NUPA 3I55A 4ATOA 1BCMA 1JEGA 2KNBB 1RL2A 3PVLA 1ZSZA 3MP8A 4M7DC 3M57A 2P0QA 1GBQA 4ESRA 3BDUA 1VQLT 5DLQE 1NJIR 1WHMA 2JS0A 1FMKA 2OTLT 1XTDA 1TUGB 2F69A 1DJ7B 2E12A 3M0RA 1VQPQ 2QEXT 4BI3A 1WHJA 3VS0A 2RB6A 3M55A 2FL7A 3CQTA 1G3YA 2MI6A 4BY6B 1YCYA 3EHQA 3CCSQ 2DL8A 1ZX6A 3I56A 2KYMA 1KHIA 4PJOC 1R0CB 2YT6A 1EFNA 4XTYA 5D6YA 3MO8A 4BD3A 2VUBA 1Y71A 4C92D 5KYXA 5A0DA 4CC4B 1Y07A 4MZPA 2X4WA 1P92A 4M7AE 2DIGA 1KD1R 1I8FA 1M3AA 2DIQA 2XI9A 3JAME 2RJCA 2RQUA 2K9GA 4FSSA 4PLLA 1UHFA 2E1HA 4F7UF 3CMEA 2RF0A 2BKDN 1K9MU 5CAIA 5GJWB 2J6FA 1M9SA 1M5Q1 5GANd 4LDVA 3REBB 3TEEA 1VQ5T 3MEAA 3I35A 5FWCA 2F2VA 5ECAA 3H6ZA 4DOWA 1K1ZA 1C0MA 1VUBA 4F14A 3QJYA 2O01E 3X24B 1MNEA 2HZYA 4E7SA 1M8VA 3V8JA 1QVFP 3P8HA 3LW5E 4J9FA 4FT2A 4CC3A 2HQXA 3X26B 2OAWA 1N8RR 2PQWA 4EMKC 3OYLA 1YCSB 2MPXC 2DILA 2BIVA 2YLCA 2ZGWA 2K3BA 2RO0A 1PG5B 3CCVT 4WCIA 4M78G 2NYSA 3UATA 3CCQT 4BI8B 2J6OA 4F7UE 1R0BG 4FW2A 2F5TX 4QQ6A 3VRYA 4LDYA 2RQTA 3JCMJ 1QKXA 3CCMA 2DJQA 3S6WA 5HKCA 4LDWA 2EYZA 4L6V5 2KR3A 1I1JA 1WNLA 1W4SA 2XDPA 5FU7C 2M1HA 5LJ3g 2PVDB 3EG9B 4XU3A 2EWNA 1T3LA 4GLKA 2YUQA 4DBFA 3H41A 5FWBA 2AT1B 2QDLA 1G83A 2RQVA 2LP5A 1AWWA 5CKDA 1MNDA 4BDZA 2CP7A 1YHQA 1YWOA 2D6FA 5GAMh 1VQ9A 1S72T 1SKUB 1VIEA 4PFZA 2MF2A 3V7SA 1BYMA 1K73C 4JRPA 1RAFB 4OMLA 5LL6S 3CCUT 2LT4A 1O9SA 3JCMe 5LJ3f 4HVUA 5KCHA 1AZEA 4QT7A 2GFUA 4E7HA 3GLXA 2VKNA 2A0FB 2DVEA 4PLIA 1QVGA 1PM3A 2DBKA 3H9NA 1WHLA 1U3OA 1NZ9A 1G5VA 3KUFA 1HYOA 3LLRA 4J6XA 1AZGB 3JB9D 5GMKj 5GAOn 4FL6A 1YITT 4Z02A 3VUBA 3JB9H 2CH4A 2RH2A 4AG2C 2VYTA 2AKKA 1PWTA 2MYSA 3BDLA 3OYAA 2M0OA 4RTZA 1ZA1B 2DJZA 5A0LA 2EYQA 3L1AA 2YRDA 1Q7YU 2HBPA 3JV3A 2QDYB 5FU6B 4RCBA 4J9EA 3CBPA 4MMKA 4FCYA 1VQ4T 2E5QA 1KQ1A 2ZCFB 4M7DD 2NUTA 1VQLQ 3G71Q 3C0CA 1MMGA 2OTLQ 2VXFA 1Y96B 3HP9A 2X4YA 4E7IA 2QEXQ 1Q82U 1KFZA 3NTIA 4M7AG 1SG5A 2GGRA 2CKKA 2DYBA 4RTVA 1WIEA 1FX7A 1VA7A 1OX8A 3RKWA 2XMFA 2OTJT 4PJOA 1UEBA 4L5GA 3SWNB 4E7JA 3M58A 3EHRA 3R6OA 1QKWA 6AT1B 2DX1A 4P5NA 4RG2A 2EYYA 1YI2T 3MEVA 3HL8A 3QYHB 4BUGA 4M4ZA 3S3NA 1KJWA 2J05A 5GMKm 4XU2A 2ZAEA 2M0YA 5GAMd 4DA4A 2CP2A 3OW2S 3QYGB 3L2QA 2QQRA 3JB9F 1S1NA 1LJOA 1WHKA 5D6WA 2K57A 4FU6A 1WDXA 5GMKl 1OV3A 3I5SA 3M0QA 1KQSA 2M16A 4K11A 3X25B 1AWOA 3VJPA 3HTRA 2DERA 1WQ7A 1LVKA 3OS2A 1SSHA 3SD4A 3CC7T 3J81E 1GCPA 1BI0A 1M4ZA 4C0GA 1BIAA 5GAN3 1VYVA 2JTEA 4E2FB 2VWFA 2YDLA 4LDUA 5M9OA 4EPCA 4Y28E 2ZPBB 1OZ2A 2LVMA 2MK5A 4R55A 1UJ0A 4Y91A 4F7UG 4M7DF 1TS9A 1TH7A 1YNZA 4J6YA 1WJQA 4EMKA 2FB7A 1NEBA 3OYCA 1MV0B 3EFOB 4QW2A 3G6EQ 1HJDA 2JN0A 2EJFA 3LGLA 2DPPB 2RI5A 3QPHA 4OMQA 4JLGA 2CUBA 3CCVQ 2MAMA 4E7ZA 4NOYA 2O2OA 4XTXA 2COWA 3CCQQ 3EG1A 2DF6A 4B9WA 3HRSA 4PJOF 1UHCA 1MMDA 8ATCB 4C92C 2D1XA 3UA6A 3TSWA 2KGTA 3TSZA 3A8HB 1PNJA 4MDWA 5LJ5f 4ZTJA 2CDTA 3G1JA 4M75B 2YUPA 1Y7XA 2W10A 3DKMA 3UPUA 5CCAA 2DA9A 1BI3A 2JTMA 2X35A 3ZL7C 2WSFE
chains in the Genus database with same CATH topology
3CCJT 4JUVA 3CCSA 2K5LA 3QZ9B 4BB7A 2K3YA 3CMAA 3PT9A 4N0AC 4PJOD 4F7UA 4V2SA 1K73U 1G3WA 2XIDA 3OQ5A 1KD1U 3CCEA 2ZZDA 1VQ7A 2CZ7B 3CCLT 4JS5A 3JB9F 2F5KA 2HD0A 5CKEA 5J39A 4C8QB 2KVQG 5J26A 5FROA 2K5FA 1AHJB 5I2SA 4N4HA 2G3RA 4KULA 4MDXA 1X75C 3CC2A 4A53A 1HXDA 3E19A 1YBYA 2EJ9A 3JRZA 4HCCA 2R58A 3CD6A 1BI1A 3HPWA 5FU6B 2EQJA 5LJ5e 1K8AC 2YRVA 4M7AF 4M77G 5D6XA 4C0DB 2FVUA 2KSSA 4C0DC 3CPWS 1VQKA 1OZ3A 3CCRT 2IVWA 2QA4T 1XQHA 3C4SA 4HCZA 4BI4A 5IN1A 3I55A 2A7YA 1VQ8A 1QP2A 2E65A 3VKIA 3PFSA 5GAN5 3I56T 4B9XA 3C94A 3Q1JA 4IUTA 3OYIA 2L3RA 4ATOA 3M56A 2B8AA 3CCJA 4PJOE 3DB4A 3WXMB 5GAMf 1RL2A 3FB9A 3M5AA 4A4GA 3GIBA 3MP8A 3NTKA 4M7DC 4M7DB 1U1SA 3M57A 2P0QA 3VU3C 4WF2A 2LCCA 1EIFA 2K2VA 2V8JA 3V7CA 3CPWA 3BDUA 4OVAA 3CPFA 2DKGA 3ZEHA 5GAN4 1VQMT 1VQLT 5DLQE 3VUZA 2LT1A 5C0MA 3JCMd 4KUIA 1Q7YC 2LTOA 3JCMf 2OTLT 3J7AF 5A2QE 1XTDA 2F69A 1DJ7B 4IUPA 2E12A 2RHYA 1JRIA 4HT9A 3MEWA 2MWOA 2MWPA 3CXCS 4EDUA 4BI3A 2LX9A 1O75A 2QEXT 2WSCE 2GQVA 4LD6A 1N8RU 2RB6A 3M55A 3M9QA 2FL7A 2VXEA 3MEUA 4KT0E 1G3YA 1YIJT 2MI6A 4BY6B 4BY6C 1YCYA 2L8DA 3ASKA 3GOXA 4JRQA 3CMET 3CCRA 5GANj 2QA4A 4R56A 3G4ST 4CI0C 1X01A 2DTOA 4XTUA 1KC8C 2EQMA 2HQEA 2R5AA 3I56A 3A8MB 1YJWA 3JB9I 5GAN7 4PJOB 1KHIA 4PJOC 4E7KA 1Q82C 2K3XA 5HY6A 3CXCA 1VIFA 4ZN1A 1KQ2A 4XTYA 5D6YA 3MO8A 2JZ2A 3N5BB 3RIRA 5LJ5j 5GAOl 5GAMe 4BD3A 3JCMb 2E70A 2EJGA 4NL2A 5I21A 4BE1A 1Q86C 2VUBA 1Y71A 2EAYA 3C95A 4C92D 5L8RE 5A0DA 4A54A 1Y07A 4MZPA 2X4WA 3HRTA 4ZN3A 1VQMA 5IAYA 1KD1C 2OAUA 1P92A 3P8BB 4FT4A 2GCXA 2H3JA 5CIUA 4M7AE 2DIGA 1I8FA 2PVOB 5KH6A 4M77A 4M78D 2QEXA 3M54A 2DIQA 2JUFA 2JOYA 2XI9A 3JAME 1Y96A 3UT1A 2RJCA 2HAXA 3HFOA 1R8OB 1OI1A 1YIJA 4PLLA 2YHTA 2E1HA 4XTWA 4F7UF 3CMEA 3QDRB 2BKDN 2E41A 5LJ3h 5CAIA 3UWNA 3G4SA 1K9MU 2DXCA 4UC4A 1M5Q1 1M9SA 5GANd 4LDVA 5GANf 2XKOC 3VV0A 3TEEA 1JJ2S 1VQ5T 3MEAA 1KHCA 2E6ZA 3OYYA 2JVVA 2HNIA 3X20B 3H6ZA 2DXUA 4C8QE 4DOWA 2RM4A 1JBMA 3PIPA 3AHUA 4FIBA 3OYNA 2LNVA 2RHZA 4TVRA 1BKBA 3OSSC 1VUBA 4QVZA 3OSVA 3QJYA 2O01E 1XOVA 3LYIA 2ZPHB 2DD5A 3SWNA 3X24B 4EMGA 2XU8A 3GP8A 5GMKi 4M7AB 3ZBDA 4M7AC 4IURA 3JCMX 3QZ5B 4IKFA 1M8VA 1JJ2A 2P0PA 2GF7A 3V8JA 4L59A 3VYGA 3P8HA 4OGCA 3MP6A 3META 4C5IA 1U1TA 3LW5E 2KK4A 2PU9B 2ZPGB 4FT2A 2PVGB 2HQXA 2ZPFB 1Q81C 3X26B 5CQYA 2EIFA 1OYXA 2PQWA 4EMKB 4EMKC 3OYLA 4M7DE 3EFRA 4JS4A 3CBOA 4XK8E 3FDRA 1VQ5A 1VQNT 4OB1B 2BIVA 2CS7A 2QQBA 4C92G 1M1GA 5GANe 2DTIA 2YLCA 2ZGWA 4C8QC 4EMHA 4PNOA 4C5HA 2RO0A 3QKJA 4N4GA 4A4HA 2QXFA 1QVPA 3JCMV 3QXEB 5DY9A 2RHIA 3CCVT 3V8LA 3BW1A 1U8RA 3GF5A 1YJ9T 4M78G 3OS0A 2X4XA 4M75G 3SB2A 4A4EA 2D0QB 3MP1A 2M9UA 3CC4A 3NFCA 3PTAA 2EQUA 4BI8B 5GMKh 1QW1A 3JCMc 3QHSA 3CCQT 4F7UE 5I2MA 1LOJA 1VQ6A 2F5TX 4QQ6A 4D6WA 4LDYA 3JCMJ 2RJEA 3CCMA 2V8KA 3HHTB 3S6WA 4LDWA 3TCJA 5HKCA 1YHQT 3PNWC 1VQ9T 2XDBA 1FXXA 3PIOA 4L6V5 2RA2A 3BFMA 3T9NA 5IT9E 3JB9G 3L2RA 2FYKA 1WNLA 1N9SA 1QP3A 1W4SA 2XDPA 3DLMA 5CQXA 5FU7B 5FU7C 4N4IA 1NJIC 2M1HA 5LJ3g 5KE2A 2PVDB 4XU3A 4HCBA 2EWNA 5J3BA 1N6AA 2IG0A 4OF1A 2C06A 3CCLA 3G71T 1VQNA 1K9MC 3RERA 4C8QG 3OYHA 5GAOq 1X6OA 3RMSA 2O4XA 4M77F 5GAN8 4GLKA 3QG1A 4IUVA 4C5GA 3H8ZA 3EAEA 3LWIA 2DTHA 4CRIA 3CCVA 2CZ0B 4J8OA 2KQWA 1KG1A 3HFNA 2PUOB 4Q5WA 4OGEA 3V7RA 2E64A 3CCQA 2Y4XA 4M7DA 5GAOm 2XICA 4F7UB 5CKDA 3OYBA 1SSFA 1V29B 2YLBA 3E1SA 4O6JA 3WVEB 4BDZA 2WACA 4II1A 1YHQA 4JLIA 2D6FA 5GAMh 1VQ9A 1S72T 4JJNK 2ZPEB 2CGHA 3TU4K 4M7DG 3S3OA 4C92A 1VIEA 2MF2A 4DOVA 3V7SA 3VYHB 1QVGS 1M1KU 2XHCA 2DO3A 1NE8A 1BYMA 1K73C 1D3BA 1VQLA 4JRPA 3G71A 3QO3A 3NTHA 2EKOA 5LL6S 4ELZC 2OTLA 3L2WA 4M78A 1GXIE 4RKUE 4M75A 2QQAA 4X34A 4HA8A 3CCUT 5C6SA 2LT4A 4E47A 5LJ3d 1O9SA 3JCMe 5LJ3f 4M7AD 3CEYA 4M75D 5CKHA 5CKFA 5KCHA 5DLOA 5LJ5g 4XAXB 3OYJA 2GFUA 4OB0B 5KCOA 4E7HA 2VV5A 3GLXA 3QUIA 4OB2B 4LD9K 2VGMA 2DVEA 4PLIA 4BACA 1QVGA 3RKYA 4XU1A 3MCAB 2I2LA 5HK0A 4XTZA 3DLLA 2R5MA 1K8AU 1NZ9A 2QI2A 3OBYA 3KUFA 4N0AA 2QQSA 2O4XB 4JRKA 4PJOG 3OA6A 3LLRA 4J5YA 4J6XA 3JB9D 5GMKj 5GAOn 4XTVA 4FL6A 1S72A 2XDDA 5KE3A 2LC4A 1H641 3C12A 4M77E 4Z02A 3VUBA 3J80E 2EQKA 1YITT 1VQPT 3OS1A 4LDXA 3JB9H 5AYFA 3UDCA 2RH2A 3KXTA 2VYTA 1LNXA 2KDSA 1IREB 2RD1A 3A8GB 4C8QD 2JTFA 1B34A 4NS5A 1WJSA 3OYDA 4JRIA 1UGPB 3BDLA 3CCST 5EG2A 4XU0A 3CMAT 2Y90A 3OYAA 2M0OA 2DJZA 5CK9A 5A0LA 3GPLA 1VQ7T 2EYQA 3L1AA 1Q7YU 4O5VA 2DZCA 1H3ZA 3ZFJA 2R57A 2LDMA 1BIBA 3OMGA 1N8RC 2CZ1B 2HBPA 1JB0E 2D9TA 3OBWA 4QVDA 2QDYB 1G3SA 2P4TA 4J6WA 3OB9A 4RCBA 5FU6C 2A3LA 4MMLA 4OP0A 4ELYC 3CBPA 4MMKA 3HSBA 2X4JA 1VQ4T 2E5QA 1KQ1A 2ZCFB 4J7FA 5DM7R 2K5IA 3F70A 3FIFA 4BE2A 1YJNT 4M7DD 3OYFA 3G6ET 1WJRA 2QTXA 3INZA 4M77B 4M77C 5GAMg 1YITA 1W2BA 2E6NA 2VXFA 4J83A 3L2UA 1KC8U 1Y96B 5LJ5h 1FWZA 3HP9A 4PKCC 2X4YA 4QQDA 4E7IA 1Q82U 3NTIA 4QVCA 3JCMQ 4M7AG 4C5EA 1UGQB 1WQWA 2V8IA 1G5VA 2CKKA 3JCMg 3WVDB 3QIIA 1Q86U 2MMPA 3LH0A 5HK3A 1FX7A 2LRQA 2LQ8A 3OS5A 2WSEE 2E10A 3RKWA 2CZ6B 5CKBA 3MHXA 2RJFA 1PSFA 2OTJT 4C92F 3HKSA 3RMQA 4PJOA 1UEBA 2KY9A 1M1FA 2RK1A 4J7IA 3JB9J 1VQ4A 2LCLA 1B34B 4L5GA 1N9RA 2L5QA 3SWNC 3SWNB 3M58A 4C0FA 3L2VA 4E7JA 3R6OA 4A4KA 1YJNA 4M78F 3QSUA 3A8OB 4M75F 1ZHIA 4P5NA 2DAQA 4RG2A 5CVIA 3G6EA 2NLUA 1M90U 5LJ3j 3FJPA 2LQKA 3MEVA 1YI2T 3HL8A 3QYHB 1MGQA 3PMIA 3V8KA 4BUGA 3S3NA 1KQSS 5GMKe 1YJWT 5GMKm 4XU2A 1YJ9A 3FC3A 5GAMd 5FRMA 1PSEA 4DA4A 3OYMA 3RESA 3QYGB 3QBYA 2K4YA 2QQRA 3M4GA 3L2QA 3OW2S 3JCMW 3S3MA 2CYZB 1VQOT 1G3TA 4IUQA 1ZBXA 1UGRB 3EFSA 1LJOA 3OYEA 5D6WA 3LX7A 4MZMA 1NPRA 2K57A 4FU6A 2EFIA 2L89A 5GMKl 1M1KC 3GNFB 4E7LA 2OTJA 2DD4A 4A4FA 4C8QF 3PGGA 1KQSA 4OB3B 2M16A 3X25B 4FSXA 3VJPA 3M4YA 4RG8A 1WQ7A 3LGFA 4KBMB 5A0GA 4ZTFA 3ER0A 3OW2A 3PMTA 2RK2A 5GANg 3RUXA 3OS2A 4HKEA 1Q81U 5GAN2 3SD4A 3JCMh 3CC7T 3CBMA 3J81E 1BI0A 1M4ZA 2RHUA 4IUUA 1ZQ1A 4C0GA 1YI2A 1BIAA 2DXTA 3URGA 4M7AA 1RI0A 3G7ZA 5GAN3 3RKXA 4ZGDB 4LDUA 2FHDA 5M9OA 4EPCA 4Y28E 1I4K1 2ZPBB 1UGSB 4HT8A 1MHNA 1OZ2A 2LVMA 2RHXA 4ZGEB 5CR2A 4R55A 3L42A 3A5ZB 4Y91A 4RMOA 4C92E 4F7UG 1I5LA 2XK0A 1VQOA 4KUDK 2VC8A 4M7DF 3LWHA 4PL6A 1TH7A 4RCCA 2ZPIB 4BE0A 3M53A 3GNGA 3A8LB 1WJQA 4J6YA 4EMKA 2GFAA 3P8DA 4ZGJB 2BUDA 3M59A 4VUBA 2FB7A 1I81A 3KBGA 4M78E 5GAOp 3OYCA 2XG8D 4M75E 2Y4YA 4QW2A 3JCMP 2JN0A 2P0KA 4C8QA 2EJFA 2KMTA 1QVFS 3TREA 3LGLA 2DPPB 3X28B 2RI5A 4QQGA 2RJDA 3QPHA 4JLGA 2QQ9A 4M77D 4X9DA 3CC7A 2MAMA 1XNIA 4C0ZA 1NPPA 4NOYA 1M90C 1WPYA 3JSCA 3CCUA 4XTXA 1NJIU 2RI2A 4YTLA 2JNGA 4MZTA 2VGNA 5FLXE 2XD0A 3CCET 4FM4B 4B9WA 3HRSA 5LJ3e 2DZ9A 4PJOF 4GY5A 3SDZA 1W2BS 4X9CA 3OYGA 1QVFA 3BY7A 1BI2A 1IZ6A 2DEQA 3QJ6A 4JDSA 4C92C 4C92B 1N27A 2KAFA 5GAN6 3OY9A 3O8VA 4OMFB 3FRNA 5FRNA 2DXBA 1D3BB 5LJ5d 3FEOA 5GANh 3A8HB 1HK9A 4MDWA 5LJ5f 4ZTJA 3CC2T 2AHJB 3E9FA 5GAOr 2RI3A 3CD6T 4M78B 4M78C 4M75B 4XQ3A 4M75C 3CC4T 1Y7XA 1WGSA 3E9GA 1VQKT 5CO7A 3DKMA 3SFMA 2DK3A 4NL3A 3HRUA 5CCAA 3UPUA 1VQPA 3OMCA 1BI3A 4DQ2A 3I55T 1VQ8T 1VQ6T 2PUKB 2JTMA 2X35A 1UB4A 3ME9A 3FLGA 4ME7A 3DB3A 5GAMj 3CCMT 3L2ZA 2WSFE 4BDYA 3OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEA A;  3PMI A;  1KHC A;  2K3Y A;  3S3N A;  3H6Z A;  3NTH A;  2EKO A;  3OQ5 A;  3L2W A;  3OYN A;  4X34 A;  2RHZ A;  3FC3 A;  5FRM A;  5C6S A;  3OYM A;  2F5K A;  4QVZ A;  3S3M A;  3QBY A;  2QQR A;  5J39 A;  3L2Q A;  3CEY A;  3LYI A;  5KCH A;  5J26 A;  5FRO A;  4IUQ A;  3OYJ A;  4IUR A;  2GFU A;  5KCO A;  3OYE A;  4E7H A;  5D6W A;  3LX7 A;  2G3R A;  4N4H A;  4FU6 A;  4IKF A;  2EFI A;  2L89 A;  4PLI A;  4BAC A;  4E7L A;  2GF7 A;  4L59 A;  2R58 A;  3P8H A;  4A4F A;  2EQJ A;  3MP6 A;  3MET A;  2YRV A;  4C5I A;  2R5M A;  2M16 A;  5D6X A;  1G5V A;  2HQX A;  3KUF A;  1OZ3 A;  2O4X B;  2QQS A;  3OA6 A;  3LLR A;  3LGF A;  4ZTF A;  3C4S A;  4HCZ A;  4FL6 A;  3PMT A;  5IN1 A;  1OYX A;  3OS2 A;  2PQW A;  3PFS A;  3SD4 A;  5KE3 A;  3OYL A;  4B9X A;  4IUU A;  2RHU A;  3Q1J A;  4IUT A;  4Z02 A;  2EQK A;  3OYI A;  2L3R A;  3OS1 A;  2B8A A;  1RI0 A;  3FDR A;  2VYT A;  3DB4 A;  2BIV A;  4A4G A;  2JTF A;  3MP8 A;  3NTK A;  2FHD A;  5M9O A;  4NS5 A;  1WJS A;  3OYD A;  3BDL A;  4C5H A;  1MHN A;  2RHX A;  1OZ2 A;  2LVM A;  2RO0 A;  3QKJ A;  4N4G A;  4A4H A;  2LCC A;  3L42 A;  4OVA A;  3ZEH A;  3OYA A;  2RHI A;  2M0O A;  5C0M A;  2XK0 A;  2LTO A;  3OS0 A;  2X4X A;  4PL6 A;  4A4E A;  3MP1 A;  4BE0 A;  1H3Z A;  1WJQ A;  2R57 A;  4IUP A;  2LDM A;  2RHY A;  2GFA A;  3MEW A;  3OMG A;  2EQU A;  3P8D A;  2MWO A;  2MWP A;  2BUD A;  2D9T A;  4EDU A;  4LD6 A;  3OYC A;  3M9Q A;  3OB9 A;  4QQ6 A;  4QW2 A;  3MEU A;  2RJE A;  2P0K A;  3S6W A;  2E5Q A;  3ASK A;  2L8D A;  3LGL A;  3PNW C;  3GOX A;  2RI5 A;  4QQG A;  2RJD A;  3F70 A;  4BE2 A;  3OYF A;  3L2R A;  2EQM A;  1WJR A;  2R5A A;  2HQE A;  2XDP A;  1XNI A;  3DLM A;  4N4I A;  2E6N A;  2M1H A;  5KE2 A;  4E7K A;  2K3X A;  3L2U A;  2IG0 A;  2RI2 A;  2X4Y A;  4QQD A;  4E7I A;  5D6Y A;  3OYH A;  3MO8 A;  2JZ2 A;  3NTI A;  2O4X A;  4BD3 A;  4C5E A;  4B9W A;  4BE1 A;  4GY5 A;  4IUV A;  4C5G A;  3OYG A;  3H8Z A;  2CKK A;  3EAE A;  4CRI A;  2X4W A;  3QII A;  3QJ6 A;  5IAY A;  3LH0 A;  1N27 A;  2LRQ A;  3OY9 A;  4Q5W A;  5CIU A;  3O8V A;  2DIG A;  5FRN A;  3FEO A;  5KH6 A;  4ZTJ A;  2RJF A;  3E9F A;  2DIQ A;  2RI3 A;  3OYB A;  1SSF A;  4BDZ A;  3UT1 A;  2RJC A;  2WAC A;  4II1 A;  1WGS A;  3E9G A;  1OI1 A;  4E7J A;  4PLL A;  3L2V A;  3OMC A;  2BKD N;  3UWN A;  2X35 A;  3ME9 A;  4RG2 A;  2DAQ A;  3FLG A;  3DB3 A;  4UC4 A;  2NLU A;  4BDY A;  3S3O A;  3OYK A;  3MEV A; 
#chains in the Genus database with same CATH topology
 1ACM B;  2K5L A;  3QDF A;  2D0N A;  1UFF A;  1BCO A;  3NPF A;  2A36 A;  4OMM A;  4KH0 B;  4N0A C;  1C6V X;  3OQ5 A;  2ZZD A;  1VQ7 A;  2CZ7 B;  2K6D A;  4JS5 A;  2F5K A;  2AK5 A;  2CUD A;  5CKE A;  5I2S A;  3CC2 A;  4A53 A;  3E19 A;  1YBY A;  2EJ9 A;  1K8A C;  2EQJ A;  5LJ5 e;  3QWX X;  5D6X A;  1TOV A;  4AFZ C;  4C0D B;  1VQK A;  2EYX A;  3RR6 A;  1MMA A;  3CCU Q;  5IHI A;  4HCZ A;  1VQ8 A;  1B07 A;  2KYB A;  1QP2 A;  2E65 A;  2L3R A;  3M56 A;  4PJO E;  3CCJ A;  3A98 A;  3M5A A;  3NTK A;  1U1S A;  4WF2 A;  1EIF A;  3V7C A;  3CPW A;  1D1A A;  2DL4 A;  1K76 A;  1VYT A;  4KUI A;  3J7A F;  2LTO A;  3H0F A;  2HL3 A;  1M2V B;  2VAS A;  3CXC S;  1O75 A;  1WZO A;  3MEU A;  1X2Q A;  4BY6 C;  4AFS C;  3SHW A;  4JRQ A;  2J6K A;  1X01 A;  2DTO A;  4XTU A;  1KC8 C;  1YJW A;  3A8M B;  3RDV A;  3CCE Q;  3RBB B;  2K3X A;  2CT3 A;  1VIF A;  3RIR A;  3N5B B;  1RAG B;  5GAO l;  3JCM b;  2EJG A;  4BE1 A;  1Q86 C;  3GIB A;  4ZN3 A;  3HRT A;  5IAY A;  3EGD B;  4JZ4 A;  2GCX A;  2H3J A;  1K73 R;  2NUP B;  2PVO B;  5KH6 A;  3VS7 A;  2QEX A;  2JOY A;  1HSQ A;  1D0Z A;  1QLY A;  3HFO A;  1R8O B;  2IIM A;  3REA B;  3UWN A;  2DXC A;  2LJ1 A;  3IQL A;  5GAN f;  1JJ2 S;  4OMO A;  3X20 B;  2PTK A;  2RM4 A;  3PIP A;  4FIB A;  2RHZ A;  1BKB A;  1W1F A;  2FZK B;  1A0N B;  3LYI A;  4Z89 A;  3VRZ A;  5GMK i;  4IUR A;  3JCM X;  3VYG A;  3CCR Q;  2ED1 A;  3MET A;  2PU9 B;  2YUN A;  2PVG B;  2ZPF B;  1FMW A;  1Q81 C;  1SRM A;  4D8D A;  3FDR A;  3M0U A;  1VQ5 A;  1VQM Q;  4OB1 B;  1W2B P;  2CS7 A;  3NGP A;  5GAN e;  1M1G A;  1G8X A;  4PNO A;  4C5H A;  1PCX A;  4N4G A;  4Y92 A;  2EW3 A;  2QXF A;  3JCM V;  2H8H A;  5DY9 A;  1F1B B;  3GF5 A;  1YJ9 T;  3CC4 A;  3CC7 Q;  2AZV A;  1YIJ Q;  3G4S Q;  1VQ6 A;  2KI7 A;  1SEM A;  3PNW C;  1UUE A;  1ABQ A;  1FXX A;  3PIO A;  8AT1 B;  3O5Z A;  3JB9 G;  1NYF A;  1RI9 A;  5CQX A;  3QWY A;  3M0T A;  1BBZ A;  1TSF A;  2C06 A;  2JM9 A;  4OF1 A;  3CCL A;  3G71 T;  2O4X A;  5GAN 8;  1PRM C;  3QG1 A;  4C5G A;  3CCV A;  2CZ0 B;  4Q5W A;  1H3H A;  4OGE A;  1D0X A;  3CCQ A;  2Y4X A;  2YLB A;  4O6J A;  4WTO B;  2L3S A;  7AT1 B;  1SPK A;  4M7D G;  3UF4 A;  3S3O A;  4C92 A;  4RTY A;  3VYH B;  1M1K U;  2JJ9 A;  1D3B A;  3E2U A;  1WXB A;  3NTH A;  1WHH A;  4IIM A;  3L2W A;  1GXI E;  4RKU E;  4E47 A;  5CKF A;  5DLO A;  2QGF B;  4PJL A;  4PK4 A;  3OYJ A;  4OB0 B;  4BAC A;  3RKY A;  2HKN A;  2ENM A;  2R5M A;  5KYY A;  4N0A A;  4PJO G;  1X27 A;  1C1A A;  1VQN Q;  1S72 A;  2XDD A;  5KE3 A;  2LC4 A;  3J80 E;  1N5Z A;  3KXT A;  2RD1 A;  4C8Q D;  1WJS A;  4JRI A;  1UGP B;  5EG2 A;  1UTI A;  3CMA T;  2Y90 A;  2DZC A;  1H3Z A;  3ZFJ A;  2LDM A;  1BIB A;  2CZ1 B;  4PFP A;  4QVD A;  4Z88 A;  5FU6 C;  3OB9 A;  2X4J A;  4LN2 A;  3FIF A;  4RTW A;  3OYF A;  3G6E T;  4M77 B;  5GAM g;  1YIT A;  2LJ3 A;  2KEA A;  2P84 A;  1GFC A;  4J83 A;  3L2U A;  1K9A A;  2QAZ A;  4AFU C;  1WYX A;  1ZBJ A;  5KYU B;  4C5E A;  1WQW A;  3JCM g;  4IIO A;  3WVD B;  2MMP A;  2CP3 A;  3OS5 A;  2E10 A;  2QYZ A;  2CZ6 B;  1PSF A;  2D8H A;  2FRY A;  5FW9 A;  4C92 F;  2BTT A;  4J9H A;  1QWE A;  2RK1 A;  4HXJ A;  4J7I A;  3JB9 J;  2LCL A;  1VQ4 A;  1K9M C;  2O88 A;  3SWN C;  2JMC A;  4JJC A;  5CVI A;  1ZHI A;  2LQK A;  1K8A R;  3V8K A;  2QAS A;  3FC3 A;  5FRM A;  2ECZ A;  3QBY A;  3JCM W;  4IUQ A;  2LQN A;  4J9I A;  3OYE A;  2NUT B;  3LX7 A;  1NLO C;  2L89 A;  2OTJ A;  2DD4 A;  4C8Q F;  4LUE A;  1GCQ C;  1ZSG A;  1X43 A;  3M4Y A;  5A0G A;  4KBM B;  4GLM A;  3ER0 A;  2SRC A;  3OW2 A;  4DEY A;  5GAN 2;  3JCM h;  3CBM A;  2CH4 W;  2HSE B;  1YI2 A;  4J9G A;  2DXT A;  4ZGD B;  2E5K A;  4HT8 A;  1B7T A;  2HL5 C;  1KC8 R;  3A5Z B;  4C92 E;  2A37 A;  2BE9 B;  2ZPI B;  3GNG A;  3A8L B;  2GFA A;  3P8D A;  2BUD A;  3M59 A;  1Q86 R;  2O31 A;  3KBG A;  1I81 A;  1YJN Q;  5GAO p;  2XG8 D;  2KXD A;  3JCM P;  4KH1 B;  1QVF S;  4QQG A;  2RN8 A;  2QQ9 A;  1QVG P;  4M77 D;  4X9D A;  2HDA A;  3CC7 A;  1YJ9 Q;  1XNI A;  2KBT A;  1WPY A;  3JSC A;  1NJI U;  2RI2 A;  4YTL A;  2JNG A;  4MZT A;  2VGN A;  5FLX E;  4DBH A;  1M90 R;  3CCE T;  4FM4 B;  5LJ3 e;  3A1P A;  4X9C A;  3OYG A;  3VS4 A;  4JDS A;  1N27 A;  5GAN 6;  3OY9 A;  4OMF B;  1IRX A;  9ATC B;  1SHG A;  4M7D A;  3E9F A;  3EG9 A;  4M78 B;  3LH5 A;  4M75 C;  3VS3 A;  3E9G A;  5CO7 A;  1V76 A;  2DK3 A;  1VQP A;  3HRU A;  1W70 A;  1M3C A;  2PUK B;  3FLG A;  3CCM T;  3L2Z A;  2Y4Y A;  3OYK A;  4JUV A;  3CCS A;  2K3Y A;  1VQO Q;  3PT9 A;  1Q81 R;  1G3W A;  2XID A;  1KD1 U;  3EG3 A;  4A63 B;  2HD0 A;  5J39 A;  5J26 A;  2CP5 A;  2X9H A;  1AEY A;  4HCC A;  2R58 A;  1VYU A;  2YRV A;  4D8K A;  1FYN A;  2DRM A;  1IO6 A;  2FVU A;  2KSS A;  2VB6 A;  4C0D C;  1K0S A;  2ROL A;  3CCR T;  2L3Q A;  2IVW A;  2QA4 T;  1XQH A;  2A7Y A;  3PFS A;  3C94 A;  4IUT A;  2EGA A;  3R6N A;  2EQI A;  3DB4 A;  3WXM B;  3FB9 A;  2V1Q A;  1WXT A;  2Z0W A;  3VU3 C;  4DBQ A;  4DEX A;  2LCC A;  1TG0 A;  2V8J A;  2OX7 A;  1VQM T;  1Q7Y C;  1JXO A;  5C0M A;  3JCM d;  5A2Q E;  4IUP A;  3EGU A;  1JRI A;  2RHY A;  2RMO A;  2HKQ B;  2MWP A;  4ANJ A;  2GQV A;  4LD6 A;  1N8R U;  3M9Q A;  2DMO A;  4KT0 E;  1YIJ T;  4PJJ A;  5GAN j;  3G4S T;  4CI0 C;  3CMA Q;  2AIR B;  2L2P A;  2EQM A;  2HQE A;  1KQS P;  1X6G A;  3VS2 A;  3H0I A;  5HY6 A;  1Q82 C;  3CXC A;  1AOJ A;  2W0Z A;  3I5R A;  2JZ2 A;  3VS5 A;  4FYX B;  2EAY A;  3C95 A;  1PKS A;  1KD1 C;  2DRK A;  3CD6 Q;  5CIU A;  1SF9 A;  2CSQ A;  2O9V A;  4M78 D;  5KYW B;  3I55 Q;  1IHV A;  1Y96 A;  3UT1 A;  2LX7 A;  1OI1 A;  4XTW A;  2E41 A;  1I0C A;  1UJY A;  4PFO A;  3VV0 A;  1KHC A;  3OYY A;  2DXU A;  2EBP A;  3PE0 A;  3OYN A;  4E6R A;  4TVR A;  2QG9 B;  3SWN A;  2ZPH B;  2DD5 A;  3GP8 A;  4EMG A;  2XU8 A;  4M7A B;  3ZBD A;  3QZ5 B;  4IKF A;  1JJ2 A;  2P0P A;  4L59 A;  2ROT A;  2COZ A;  3MP6 A;  1U1T A;  3MJX A;  1D09 B;  3I56 Q;  2I0N A;  4QKU A;  2A08 A;  1OYX A;  4KGZ B;  4M7D E;  1G2B A;  2GQI A;  4JS4 A;  4JPB W;  1VQN T;  4OMN A;  2QQB A;  4C92 G;  2DTI A;  4C8Q C;  3QKJ A;  4A4H A;  1GCQ A;  1U8R A;  3OS0 A;  2X4X A;  3SB2 A;  2D0Q B;  2M9U A;  1RAE B;  3NFC A;  2ESW A;  2EQU A;  5GMK h;  3PTA A;  4D6W A;  2EYW A;  2RJE A;  1ZLM A;  2V8K A;  3TCJ A;  2IPO B;  2MIO A;  3BFM A;  1IB8 A;  2FYK A;  3DLM A;  1EX4 A;  1AWJ A;  4N4I A;  1TUD A;  2E4H A;  1N6A A;  2IG0 A;  2PNI A;  3RER A;  1RLP C;  1K9M R;  2L3P A;  4C8Q G;  3OYH A;  5GAO q;  1X6O A;  3RMS A;  2DEU A;  1M2O A;  3EFO A;  4IUV A;  2DTH A;  4J8O A;  2KQW A;  2PZ1 A;  1RAC B;  3HFN A;  1JQQ A;  3V7R A;  2EGE A;  2E64 A;  1WLP B;  5GAO m;  2XIC A;  4F7U B;  3CPW P;  3OYB A;  1SSF A;  2EGC A;  4J9C A;  1YP5 A;  4II1 A;  2BE7 D;  4JLI A;  3PVQ A;  2P4R A;  4RUG A;  1ZUY A;  2ED0 A;  1Y57 A;  2GBQ A;  4AMC A;  4DOV A;  2DO3 A;  1D0Y A;  1VQL A;  3G71 A;  3QO3 A;  2LZ6 B;  2EKO A;  2OTL A;  3TVT A;  2C0I A;  4M75 A;  4X34 A;  4HA8 A;  3H0H A;  2OJ2 A;  1UGV A;  2HCK A;  4M7A D;  4M75 D;  5CKH A;  3NMZ C;  2K79 A;  4XAX B;  5EC7 A;  3QUI A;  4OB2 B;  3CCM Q;  4LD9 K;  1ZSZ B;  2DNU A;  4XU1 A;  1BB9 A;  3MCA B;  5HK0 A;  2FEI A;  3DLL A;  1YN8 A;  1OOT A;  3OBY A;  5HCK A;  2QQS A;  2O4X B;  2JMA A;  4XTV A;  4F17 A;  1M30 A;  4AG1 C;  1H64 1;  3C12 A;  2EQK A;  3EGX A;  4LDX A;  4EIK A;  1ZA2 B;  5AYF A;  2F2X A;  3UDC A;  1IRE B;  1PD1 A;  3A8G B;  1B34 A;  1ABO A;  4FYW B;  4FYY B;  4XU0 A;  1AVZ C;  4JJB A;  2QA4 Q;  1VQ7 T;  1OX9 A;  3OMG A;  1I07 A;  2HSP A;  1JB0 E;  2D9T A;  2KE9 A;  1VQ9 Q;  1G3S A;  2P4T A;  4J6W A;  4ELY C;  1EZZ B;  2A3L A;  4MML A;  5KYX B;  5DM7 R;  2K5I A;  1M3B A;  1YJN T;  2FG0 A;  3INZ A;  4M77 C;  2KRS A;  1OU9 A;  1W2B A;  2E6N A;  1OQK A;  1FWZ A;  1M2V A;  3JCM Q;  1UGQ B;  2V8I A;  1LCK A;  2DL7 A;  3QII A;  5CKB A;  1AWX A;  3MHX A;  4B6M A;  1E6H A;  3RMQ A;  1M1F A;  3MKD A;  1Z9Z A;  2LCS A;  2CRE A;  4C0F A;  3L2V A;  1GFD A;  1IGU A;  4M75 F;  2DAQ A;  3G6E A;  2NLU A;  3EGD A;  5LJ3 j;  1NEG A;  1MGQ A;  4AT1 B;  1YJW T;  1PSE A;  3OYM A;  3RES A;  1VQO T;  3M4G A;  2CYZ B;  1UGR B;  2O9S A;  5IXF A;  4MZM A;  2EPD A;  3GNF B;  4E7L A;  4OB3 B;  4CC2 A;  4KGX B;  3M0S A;  1Q7Y R;  1CKA A;  4FSX A;  4RG8 A;  1WX6 A;  4ZTF A;  1QCF A;  3PMT A;  2RK2 A;  1NBE B;  4KRT A;  2RHU A;  1OEB A;  3URG A;  1RI0 A;  1E6G A;  5L23 A;  1MV3 A;  1UGS B;  4HCK A;  4ZGE B;  5CR2 A;  1SHF A;  2CT4 A;  1T0J A;  2XK0 A;  4PL6 A;  1Q82 R;  4RCC A;  3M53 A;  1D1C A;  2X3X D;  1SRL A;  4M75 E;  2DM1 A;  5AT1 B;  1QCN A;  2P0K A;  4C8Q A;  2JXB A;  2DL5 A;  2X3W D;  4LE9 A;  2LNH B;  4C0Z A;  1NPP A;  1QWF A;  3CCU A;  1H92 A;  3VS6 A;  2XD0 A;  1U06 A;  2DZ9 A;  3SDZ A;  1W2B S;  1QVF A;  3BY7 A;  1IZ6 A;  3FRN A;  2FZG B;  4KGV B;  1HK9 A;  4FYV B;  2AHJ B;  1TWB A;  3CD6 T;  4M78 C;  3CC4 T;  1H8K A;  1WGS A;  1OPL A;  4PJN A;  3OMC A;  4DQ2 A;  3I55 T;  1VQ6 T;  3ME9 A;  1UB4 A;  1WHG A;  2DBM A;  4BDY A;  3DB3 A;  1M1K C;  2BZY A;  3QZ9 B;  4V2S A;  1K73 U;  3CCE A;  5IHK A;  3CCL T;  2V26 A;  1VOM A;  2EKH A;  5FRO A;  2K5F A;  2CP6 A;  2DL3 A;  1X75 C;  1HXD A;  3JRZ A;  3AT1 B;  1OZ3 A;  1M27 C;  5IN1 A;  3VKI A;  3I56 T;  4ZNX A;  4B9X A;  4RTT A;  3Q1J A;  2HBW A;  3OYI A;  2YRC A;  2B8A A;  4GBQ A;  5GAM f;  4A4G A;  3SEM A;  2MOX A;  4M7D B;  1UDL A;  2K2V A;  5GAN 4;  4OVA A;  3CPF A;  2DKG A;  3ZEH A;  2NUZ A;  3VUZ A;  2LT1 A;  2LMJ A;  3JCM f;  3EG2 A;  2M02 A;  4HT9 A;  1R77 A;  1ZUU A;  1W6X A;  3MEW A;  2MWO A;  1I5O B;  4EDU A;  1JXM A;  2LX9 A;  2WSC E;  2VXE A;  1HD3 A;  3ASK A;  2L8D A;  1RAH B;  1KIK A;  3GOX A;  3CME T;  5D7U A;  3CCR A;  2QA4 A;  4R56 A;  2EVR A;  4LXC A;  2LQW A;  2R5A A;  2KT8 A;  4F16 A;  3JB9 I;  5GAN 7;  4PJO B;  1VQ7 Q;  1QCO A;  4E7K A;  1RAB B;  1KSW A;  1M8M A;  2X51 A;  4ZN1 A;  1KQ2 A;  3OW2 P;  5LJ5 j;  1U5S A;  5GAM e;  2E70 A;  2SEM A;  1NLP C;  2G6F X;  4NL2 A;  5I21 A;  5L8R E;  4A54 A;  3CC2 Q;  1VQM A;  2AZS A;  2OAU A;  3P8B B;  4FT4 A;  1QMC A;  1WXU A;  1WI7 A;  1VQK Q;  4M77 A;  3M54 A;  2JUF A;  2BZX A;  1VQ8 Q;  3I9Q A;  2HAX A;  2JT4 A;  5KYU A;  1YIJ A;  3CCJ Q;  2YHT A;  1OUL A;  1J3T A;  2GNC A;  3TQ7 P;  3QDR B;  1GRI A;  5LJ3 h;  3G4S A;  1CSK A;  4UC4 A;  2XKO C;  1ZUK A;  2E6Z A;  2JVV A;  3FJ5 A;  2HNI A;  4C8Q E;  1JBM A;  3AHU A;  2LNV A;  5IH2 A;  3OSS C;  4QVZ A;  3OSV A;  1ARK A;  1XOV A;  5I11 A;  2DFU A;  4M7A C;  2GF7 A;  4OGC A;  4C5I A;  2KK4 A;  1YJW Q;  2JS2 A;  2ZPG B;  4X1V A;  1WA7 A;  5CQY A;  1IXD A;  2EIF A;  1B3Q A;  2YXY A;  4EMK B;  3EFR A;  2KT1 A;  3CBO A;  4XK8 E;  1Y0M A;  2DLP A;  1QQJ A;  1FMV A;  4EMH A;  1QVP A;  3QXE B;  2RHI A;  3V8L A;  3BW1 A;  4AFQ C;  2ABL A;  4M75 G;  4A4E A;  3MP1 A;  1IHW A;  1QW1 A;  3JCM c;  3QHS A;  1KK7 A;  4JJD A;  1RLQ C;  2DYI A;  5I2M A;  1BU1 A;  1LOJ A;  2BZ8 A;  1MMN A;  3NHN A;  2NWM A;  3HHT B;  1YHQ T;  1VQ9 T;  2K2M A;  2XDB A;  2RA2 A;  4PJM A;  3T9N A;  5IT9 E;  3L2R A;  1N9S A;  1QP3 A;  4PJO D;  5FU7 B;  1NJI C;  1JO8 A;  2QGG A;  5KE2 A;  4HCB A;  5J3B A;  1VQN A;  1PKT A;  1GBR A;  4M77 F;  1AT1 B;  3U23 A;  1NYG A;  3H8Z A;  3EAE A;  3LWI A;  4CRI A;  1KG1 A;  1TU0 B;  2PUO B;  2F2W A;  2H3E B;  2CSI A;  1K4U S;  1T0H A;  1V29 B;  3WVE B;  3E1S A;  3M0P A;  2WAC A;  1VQ5 Q;  4JJN K;  2ZPE B;  3UA7 A;  2C0T A;  2V1R A;  2CGH A;  3TU4 K;  1QVG S;  2XHC A;  1NE8 A;  1BK2 A;  2A28 A;  2QTV A;  4HVV A;  4ELZ C;  2OI3 A;  4M78 A;  2QQA A;  3CC4 Q;  5C6S A;  4RTU A;  5LJ3 d;  2GTJ A;  4JZ3 A;  3CEY A;  3CXC P;  1VQ6 Q;  5LJ5 g;  5KCO A;  4DBR A;  2VV5 A;  2VGM A;  1ZSZ C;  2RQR A;  5KYN A;  2DE0 X;  2I2L A;  4XTZ A;  1UE9 A;  2KRN A;  1K8A U;  2QI2 A;  4FW1 A;  4JRK A;  3OA6 A;  4J5Y A;  3CCL Q;  3KFV A;  1TXQ A;  1VQP T;  3GBQ A;  4M77 E;  4F04 B;  3OS1 A;  3EG0 A;  1LNX A;  2KDS A;  1UEC A;  1XJW B;  1D1B A;  2JTF A;  2M51 A;  4NS5 A;  3OYD A;  1OU8 A;  2RQW A;  3CCS T;  2MCN A;  1GL5 A;  2YWW A;  4J9D A;  1Q95 G;  2COY A;  5CK9 A;  3GPL A;  4O5V A;  2R57 A;  1N8R C;  1TTH B;  2HQH A;  3OBW A;  3ULR B;  2FZC B;  3HSB A;  4OP0 A;  2B86 A;  1JU5 C;  4J7F A;  1RAD B;  3F70 A;  1JJ2 P;  4BE2 A;  2D8J A;  2HMA A;  1E7O A;  1CKB A;  5IHN A;  1WJR A;  2QTX A;  1X6B A;  1KC8 U;  5LJ5 h;  4PKC C;  1PD0 A;  2E3I A;  4QQD A;  4QVC A;  5GJV B;  2J7I A;  1M1K R;  1Q86 U;  3LH0 A;  4Z8A A;  5HK3 A;  3CME Q;  2LRQ A;  2LQ8 A;  4RTX A;  1T3S A;  4HVW A;  2WSE E;  2C0O A;  2RJF A;  3EH1 A;  3EGX B;  3HKS A;  2KY9 A;  1S72 Q;  2VVK A;  1B34 B;  1N9R A;  2L5Q A;  1LPL A;  4A4K A;  1YJN A;  2JW4 A;  4M78 F;  3QSU A;  3A8O B;  1M90 U;  5I22 A;  3FJP A;  2FPE A;  3PMI A;  1KQS S;  5GMK e;  2ATC B;  2K7A A;  5KYW A;  1YJ9 A;  1RUW A;  1V1C A;  1X2K A;  5IXB A;  4ORZ A;  2QK0 A;  3S3M A;  2HEQ A;  1NG2 A;  2K4Y A;  1G3T A;  1ZBX A;  4R0K A;  3EFS A;  1NPR A;  1AD5 A;  2EFI A;  1IGQ A;  1PC0 A;  1RAI B;  2FO0 A;  4A4F A;  3PGG A;  2L0A A;  1YIT Q;  3LGF A;  2FPF A;  5GAN g;  3RUX A;  1YWP A;  2KRM A;  4HKE A;  1Q81 U;  3EH2 A;  2E3H A;  4IUU A;  1ZQ1 A;  2RNA A;  3RNJ A;  2RPN A;  4J9B A;  4LUD A;  4M7A A;  3G7Z A;  1Z9Q A;  3RKX A;  2FHD A;  1I4K 1;  1MHN A;  2GTO A;  2RHX A;  3L42 A;  4RMO A;  2DET A;  4KUD K;  1I5L A;  4LNP A;  1VQO A;  2VC8 A;  3LWH A;  4OMP A;  1UG1 A;  4BE0 A;  1VQ4 Q;  4ZGJ B;  4VUB A;  4M78 E;  2FPD A;  1MUZ A;  2KMT A;  1PHT A;  3TRE A;  1WFW A;  3X28 B;  2JM8 A;  2RJD A;  1TUC A;  2KXC A;  2KRO A;  2FRW A;  1M90 C;  3VS1 A;  4GY5 A;  1RAA B;  1BI2 A;  2J06 A;  2DEQ A;  3QJ6 A;  4C92 B;  1YHQ Q;  2OTJ Q;  2KAF A;  3O8V A;  5FRN A;  1NM7 A;  2CP0 A;  2DXB A;  1D3B B;  5LJ5 d;  3FEO A;  5GAN h;  3CC2 T;  5GAO r;  1OPK A;  2RI3 A;  3BE3 A;  4XQ3 A;  1X69 A;  2F1L A;  1VQK T;  1YI2 Q;  3SFM A;  4NL3 A;  1VQ8 T;  2AKL A;  4ME7 A;  5GAM j;  5GAN 5;  3CCJ T;  4BB7 A;  3CMA A;  3D7S B;  5KYY B;  4F7U A;  1K0X A;  3MPU B;  1YFN A;  4C8Q B;  2KVQ G;  4CC7 A;  1AHJ B;  3THK A;  2YUO A;  1PRL C;  2G3R A;  4N4H A;  4KUL A;  4MDX A;  2YSQ A;  3CD6 A;  1BI1 A;  3HPW A;  2LJ0 A;  4M7A F;  4M77 G;  3CPW S;  2DVJ A;  3C4S A;  4BI4 A;  2NUP A;  3I55 A;  4ATO A;  1BCM A;  1JEG A;  2KNB B;  1RL2 A;  3PVL A;  1ZSZ A;  3MP8 A;  4M7D C;  3M57 A;  2P0Q A;  1GBQ A;  4ESR A;  3BDU A;  1VQL T;  5DLQ E;  1NJI R;  1WHM A;  2JS0 A;  1FMK A;  2OTL T;  1XTD A;  1TUG B;  2F69 A;  1DJ7 B;  2E12 A;  3M0R A;  1VQP Q;  2QEX T;  4BI3 A;  1WHJ A;  3VS0 A;  2RB6 A;  3M55 A;  2FL7 A;  3CQT A;  1G3Y A;  2MI6 A;  4BY6 B;  1YCY A;  3EHQ A;  3CCS Q;  2DL8 A;  1ZX6 A;  3I56 A;  2KYM A;  1KHI A;  4PJO C;  1R0C B;  2YT6 A;  1EFN A;  4XTY A;  5D6Y A;  3MO8 A;  4BD3 A;  2VUB A;  1Y71 A;  4C92 D;  5KYX A;  5A0D A;  4CC4 B;  1Y07 A;  4MZP A;  2X4W A;  1P92 A;  4M7A E;  2DIG A;  1KD1 R;  1I8F A;  1M3A A;  2DIQ A;  2XI9 A;  3JAM E;  2RJC A;  2RQU A;  2K9G A;  4FSS A;  4PLL A;  1UHF A;  2E1H A;  4F7U F;  3CME A;  2RF0 A;  2BKD N;  1K9M U;  5CAI A;  5GJW B;  2J6F A;  1M9S A;  1M5Q 1;  5GAN d;  4LDV A;  3REB B;  3TEE A;  1VQ5 T;  3MEA A;  3I35 A;  5FWC A;  2F2V A;  5ECA A;  3H6Z A;  4DOW A;  1K1Z A;  1C0M A;  1VUB A;  4F14 A;  3QJY A;  2O01 E;  3X24 B;  1MNE A;  2HZY A;  4E7S A;  1M8V A;  3V8J A;  1QVF P;  3P8H A;  3LW5 E;  4J9F A;  4FT2 A;  4CC3 A;  2HQX A;  3X26 B;  2OAW A;  1N8R R;  2PQW A;  4EMK C;  3OYL A;  1YCS B;  2MPX C;  2DIL A;  2BIV A;  2YLC A;  2ZGW A;  2K3B A;  2RO0 A;  1PG5 B;  3CCV T;  4WCI A;  4M78 G;  2NYS A;  3UAT A;  3CCQ T;  4BI8 B;  2J6O A;  4F7U E;  1R0B G;  4FW2 A;  2F5T X;  4QQ6 A;  3VRY A;  4LDY A;  2RQT A;  3JCM J;  1QKX A;  3CCM A;  2DJQ A;  3S6W A;  5HKC A;  4LDW A;  2EYZ A;  4L6V 5;  2KR3 A;  1I1J A;  1WNL A;  1W4S A;  2XDP A;  5FU7 C;  2M1H A;  5LJ3 g;  2PVD B;  3EG9 B;  4XU3 A;  2EWN A;  1T3L A;  4GLK A;  2YUQ A;  4DBF A;  3H41 A;  5FWB A;  2AT1 B;  2QDL A;  1G83 A;  2RQV A;  2LP5 A;  1AWW A;  5CKD A;  1MND A;  4BDZ A;  2CP7 A;  1YHQ A;  1YWO A;  2D6F A;  5GAM h;  1VQ9 A;  1S72 T;  1SKU B;  1VIE A;  4PFZ A;  2MF2 A;  3V7S A;  1BYM A;  1K73 C;  4JRP A;  1RAF B;  4OML A;  5LL6 S;  3CCU T;  2LT4 A;  1O9S A;  3JCM e;  5LJ3 f;  4HVU A;  5KCH A;  1AZE A;  4QT7 A;  2GFU A;  4E7H A;  3GLX A;  2VKN A;  2A0F B;  2DVE A;  4PLI A;  1QVG A;  1PM3 A;  2DBK A;  3H9N A;  1WHL A;  1U3O A;  1NZ9 A;  1G5V A;  3KUF A;  1HYO A;  3LLR A;  4J6X A;  1AZG B;  3JB9 D;  5GMK j;  5GAO n;  4FL6 A;  1YIT T;  4Z02 A;  3VUB A;  3JB9 H;  2CH4 A;  2RH2 A;  4AG2 C;  2VYT A;  2AKK A;  1PWT A;  2MYS A;  3BDL A;  3OYA A;  2M0O A;  4RTZ A;  1ZA1 B;  2DJZ A;  5A0L A;  2EYQ A;  3L1A A;  2YRD A;  1Q7Y U;  2HBP A;  3JV3 A;  2QDY B;  5FU6 B;  4RCB A;  4J9E A;  3CBP A;  4MMK A;  4FCY A;  1VQ4 T;  2E5Q A;  1KQ1 A;  2ZCF B;  4M7D D;  2NUT A;  1VQL Q;  3G71 Q;  3C0C A;  1MMG A;  2OTL Q;  2VXF A;  1Y96 B;  3HP9 A;  2X4Y A;  4E7I A;  2QEX Q;  1Q82 U;  1KFZ A;  3NTI A;  4M7A G;  1SG5 A;  2GGR A;  2CKK A;  2DYB A;  4RTV A;  1WIE A;  1FX7 A;  1VA7 A;  1OX8 A;  3RKW A;  2XMF A;  2OTJ T;  4PJO A;  1UEB A;  4L5G A;  3SWN B;  4E7J A;  3M58 A;  3EHR A;  3R6O A;  1QKW A;  6AT1 B;  2DX1 A;  4P5N A;  4RG2 A;  2EYY A;  1YI2 T;  3MEV A;  3HL8 A;  3QYH B;  4BUG A;  4M4Z A;  3S3N A;  1KJW A;  2J05 A;  5GMK m;  4XU2 A;  2ZAE A;  2M0Y A;  5GAM d;  4DA4 A;  2CP2 A;  3OW2 S;  3QYG B;  3L2Q A;  2QQR A;  3JB9 F;  1S1N A;  1LJO A;  1WHK A;  5D6W A;  2K57 A;  4FU6 A;  1WDX A;  5GMK l;  1OV3 A;  3I5S A;  3M0Q A;  1KQS A;  2M16 A;  4K11 A;  3X25 B;  1AWO A;  3VJP A;  3HTR A;  2DER A;  1WQ7 A;  1LVK A;  3OS2 A;  1SSH A;  3SD4 A;  3CC7 T;  3J81 E;  1GCP A;  1BI0 A;  1M4Z A;  4C0G A;  1BIA A;  5GAN 3;  1VYV A;  2JTE A;  4E2F B;  2VWF A;  2YDL A;  4LDU A;  5M9O A;  4EPC A;  4Y28 E;  2ZPB B;  1OZ2 A;  2LVM A;  2MK5 A;  4R55 A;  1UJ0 A;  4Y91 A;  4F7U G;  4M7D F;  1TS9 A;  1TH7 A;  1YNZ A;  4J6Y A;  1WJQ A;  4EMK A;  2FB7 A;  1NEB A;  3OYC A;  1MV0 B;  3EFO B;  4QW2 A;  3G6E Q;  1HJD A;  2JN0 A;  2EJF A;  3LGL A;  2DPP B;  2RI5 A;  3QPH A;  4OMQ A;  4JLG A;  2CUB A;  3CCV Q;  2MAM A;  4E7Z A;  4NOY A;  2O2O A;  4XTX A;  2COW A;  3CCQ Q;  3EG1 A;  2DF6 A;  4B9W A;  3HRS A;  4PJO F;  1UHC A;  1MMD A;  8ATC B;  4C92 C;  2D1X A;  3UA6 A;  3TSW A;  2KGT A;  3TSZ A;  3A8H B;  1PNJ A;  4MDW A;  5LJ5 f;  4ZTJ A;  2CDT A;  3G1J A;  4M75 B;  2YUP A;  1Y7X A;  2W10 A;  3DKM A;  3UPU A;  5CCA A;  2DA9 A;  1BI3 A;  2JTM A;  2X35 A;  3ZL7 C;  2WSF E; 
#chains in the Genus database with same CATH homology
 3CCJ T;  4JUV A;  3CCS A;  2K5L A;  3QZ9 B;  4BB7 A;  2K3Y A;  3CMA A;  3PT9 A;  4N0A C;  4PJO D;  4F7U A;  4V2S A;  1K73 U;  1G3W A;  2XID A;  3OQ5 A;  1KD1 U;  3CCE A;  2ZZD A;  1VQ7 A;  2CZ7 B;  3CCL T;  4JS5 A;  3JB9 F;  2F5K A;  2HD0 A;  5CKE A;  5J39 A;  4C8Q B;  2KVQ G;  5J26 A;  5FRO A;  2K5F A;  1AHJ B;  5I2S A;  4N4H A;  2G3R A;  4KUL A;  4MDX A;  1X75 C;  3CC2 A;  4A53 A;  1HXD A;  3E19 A;  1YBY A;  2EJ9 A;  3JRZ A;  4HCC A;  2R58 A;  3CD6 A;  1BI1 A;  3HPW A;  5FU6 B;  2EQJ A;  5LJ5 e;  1K8A C;  2YRV A;  4M7A F;  4M77 G;  5D6X A;  4C0D B;  2FVU A;  2KSS A;  4C0D C;  3CPW S;  1VQK A;  1OZ3 A;  3CCR T;  2IVW A;  2QA4 T;  1XQH A;  3C4S A;  4HCZ A;  4BI4 A;  5IN1 A;  3I55 A;  2A7Y A;  1VQ8 A;  1QP2 A;  2E65 A;  3VKI A;  3PFS A;  5GAN 5;  3I56 T;  4B9X A;  3C94 A;  3Q1J A;  4IUT A;  3OYI A;  2L3R A;  4ATO A;  3M56 A;  2B8A A;  3CCJ A;  4PJO E;  3DB4 A;  3WXM B;  5GAM f;  1RL2 A;  3FB9 A;  3M5A A;  4A4G A;  3GIB A;  3MP8 A;  3NTK A;  4M7D C;  4M7D B;  1U1S A;  3M57 A;  2P0Q A;  3VU3 C;  4WF2 A;  2LCC A;  1EIF A;  2K2V A;  2V8J A;  3V7C A;  3CPW A;  3BDU A;  4OVA A;  3CPF A;  2DKG A;  3ZEH A;  5GAN 4;  1VQM T;  1VQL T;  5DLQ E;  3VUZ A;  2LT1 A;  5C0M A;  3JCM d;  4KUI A;  1Q7Y C;  2LTO A;  3JCM f;  2OTL T;  3J7A F;  5A2Q E;  1XTD A;  2F69 A;  1DJ7 B;  4IUP A;  2E12 A;  2RHY A;  1JRI A;  4HT9 A;  3MEW A;  2MWO A;  2MWP A;  3CXC S;  4EDU A;  4BI3 A;  2LX9 A;  1O75 A;  2QEX T;  2WSC E;  2GQV A;  4LD6 A;  1N8R U;  2RB6 A;  3M55 A;  3M9Q A;  2FL7 A;  2VXE A;  3MEU A;  4KT0 E;  1G3Y A;  1YIJ T;  2MI6 A;  4BY6 B;  4BY6 C;  1YCY A;  2L8D A;  3ASK A;  3GOX A;  4JRQ A;  3CME T;  3CCR A;  5GAN j;  2QA4 A;  4R56 A;  3G4S T;  4CI0 C;  1X01 A;  2DTO A;  4XTU A;  1KC8 C;  2EQM A;  2HQE A;  2R5A A;  3I56 A;  3A8M B;  1YJW A;  3JB9 I;  5GAN 7;  4PJO B;  1KHI A;  4PJO C;  4E7K A;  1Q82 C;  2K3X A;  5HY6 A;  3CXC A;  1VIF A;  4ZN1 A;  1KQ2 A;  4XTY A;  5D6Y A;  3MO8 A;  2JZ2 A;  3N5B B;  3RIR A;  5LJ5 j;  5GAO l;  5GAM e;  4BD3 A;  3JCM b;  2E70 A;  2EJG A;  4NL2 A;  5I21 A;  4BE1 A;  1Q86 C;  2VUB A;  1Y71 A;  2EAY A;  3C95 A;  4C92 D;  5L8R E;  5A0D A;  4A54 A;  1Y07 A;  4MZP A;  2X4W A;  3HRT A;  4ZN3 A;  1VQM A;  5IAY A;  1KD1 C;  2OAU A;  1P92 A;  3P8B B;  4FT4 A;  2GCX A;  2H3J A;  5CIU A;  4M7A E;  2DIG A;  1I8F A;  2PVO B;  5KH6 A;  4M77 A;  4M78 D;  2QEX A;  3M54 A;  2DIQ A;  2JUF A;  2JOY A;  2XI9 A;  3JAM E;  1Y96 A;  3UT1 A;  2RJC A;  2HAX A;  3HFO A;  1R8O B;  1OI1 A;  1YIJ A;  4PLL A;  2YHT A;  2E1H A;  4XTW A;  4F7U F;  3CME A;  3QDR B;  2BKD N;  2E41 A;  5LJ3 h;  5CAI A;  3UWN A;  3G4S A;  1K9M U;  2DXC A;  4UC4 A;  1M5Q 1;  1M9S A;  5GAN d;  4LDV A;  5GAN f;  2XKO C;  3VV0 A;  3TEE A;  1JJ2 S;  1VQ5 T;  3MEA A;  1KHC A;  2E6Z A;  3OYY A;  2JVV A;  2HNI A;  3X20 B;  3H6Z A;  2DXU A;  4C8Q E;  4DOW A;  2RM4 A;  1JBM A;  3PIP A;  3AHU A;  4FIB A;  3OYN A;  2LNV A;  2RHZ A;  4TVR A;  1BKB A;  3OSS C;  1VUB A;  4QVZ A;  3OSV A;  3QJY A;  2O01 E;  1XOV A;  3LYI A;  2ZPH B;  2DD5 A;  3SWN A;  3X24 B;  4EMG A;  2XU8 A;  3GP8 A;  5GMK i;  4M7A B;  3ZBD A;  4M7A C;  4IUR A;  3JCM X;  3QZ5 B;  4IKF A;  1M8V A;  1JJ2 A;  2P0P A;  2GF7 A;  3V8J A;  4L59 A;  3VYG A;  3P8H A;  4OGC A;  3MP6 A;  3MET A;  4C5I A;  1U1T A;  3LW5 E;  2KK4 A;  2PU9 B;  2ZPG B;  4FT2 A;  2PVG B;  2HQX A;  2ZPF B;  1Q81 C;  3X26 B;  5CQY A;  2EIF A;  1OYX A;  2PQW A;  4EMK B;  4EMK C;  3OYL A;  4M7D E;  3EFR A;  4JS4 A;  3CBO A;  4XK8 E;  3FDR A;  1VQ5 A;  1VQN T;  4OB1 B;  2BIV A;  2CS7 A;  2QQB A;  4C92 G;  1M1G A;  5GAN e;  2DTI A;  2YLC A;  2ZGW A;  4C8Q C;  4EMH A;  4PNO A;  4C5H A;  2RO0 A;  3QKJ A;  4N4G A;  4A4H A;  2QXF A;  1QVP A;  3JCM V;  3QXE B;  5DY9 A;  2RHI A;  3CCV T;  3V8L A;  3BW1 A;  1U8R A;  3GF5 A;  1YJ9 T;  4M78 G;  3OS0 A;  2X4X A;  4M75 G;  3SB2 A;  4A4E A;  2D0Q B;  3MP1 A;  2M9U A;  3CC4 A;  3NFC A;  3PTA A;  2EQU A;  4BI8 B;  5GMK h;  1QW1 A;  3JCM c;  3QHS A;  3CCQ T;  4F7U E;  5I2M A;  1LOJ A;  1VQ6 A;  2F5T X;  4QQ6 A;  4D6W A;  4LDY A;  3JCM J;  2RJE A;  3CCM A;  2V8K A;  3HHT B;  3S6W A;  4LDW A;  3TCJ A;  5HKC A;  1YHQ T;  3PNW C;  1VQ9 T;  2XDB A;  1FXX A;  3PIO A;  4L6V 5;  2RA2 A;  3BFM A;  3T9N A;  5IT9 E;  3JB9 G;  3L2R A;  2FYK A;  1WNL A;  1N9S A;  1QP3 A;  1W4S A;  2XDP A;  3DLM A;  5CQX A;  5FU7 B;  5FU7 C;  4N4I A;  1NJI C;  2M1H A;  5LJ3 g;  5KE2 A;  2PVD B;  4XU3 A;  4HCB A;  2EWN A;  5J3B A;  1N6A A;  2IG0 A;  4OF1 A;  2C06 A;  3CCL A;  3G71 T;  1VQN A;  1K9M C;  3RER A;  4C8Q G;  3OYH A;  5GAO q;  1X6O A;  3RMS A;  2O4X A;  4M77 F;  5GAN 8;  4GLK A;  3QG1 A;  4IUV A;  4C5G A;  3H8Z A;  3EAE A;  3LWI A;  2DTH A;  4CRI A;  3CCV A;  2CZ0 B;  4J8O A;  2KQW A;  1KG1 A;  3HFN A;  2PUO B;  4Q5W A;  4OGE A;  3V7R A;  2E64 A;  3CCQ A;  2Y4X A;  4M7D A;  5GAO m;  2XIC A;  4F7U B;  5CKD A;  3OYB A;  1SSF A;  1V29 B;  2YLB A;  3E1S A;  4O6J A;  3WVE B;  4BDZ A;  2WAC A;  4II1 A;  1YHQ A;  4JLI A;  2D6F A;  5GAM h;  1VQ9 A;  1S72 T;  4JJN K;  2ZPE B;  2CGH A;  3TU4 K;  4M7D G;  3S3O A;  4C92 A;  1VIE A;  2MF2 A;  4DOV A;  3V7S A;  3VYH B;  1QVG S;  1M1K U;  2XHC A;  2DO3 A;  1NE8 A;  1BYM A;  1K73 C;  1D3B A;  1VQL A;  4JRP A;  3G71 A;  3QO3 A;  3NTH A;  2EKO A;  5LL6 S;  4ELZ C;  2OTL A;  3L2W A;  4M78 A;  1GXI E;  4RKU E;  4M75 A;  2QQA A;  4X34 A;  4HA8 A;  3CCU T;  5C6S A;  2LT4 A;  4E47 A;  5LJ3 d;  1O9S A;  3JCM e;  5LJ3 f;  4M7A D;  3CEY A;  4M75 D;  5CKH A;  5CKF A;  5KCH A;  5DLO A;  5LJ5 g;  4XAX B;  3OYJ A;  2GFU A;  4OB0 B;  5KCO A;  4E7H A;  2VV5 A;  3GLX A;  3QUI A;  4OB2 B;  4LD9 K;  2VGM A;  2DVE A;  4PLI A;  4BAC A;  1QVG A;  3RKY A;  4XU1 A;  3MCA B;  2I2L A;  5HK0 A;  4XTZ A;  3DLL A;  2R5M A;  1K8A U;  1NZ9 A;  2QI2 A;  3OBY A;  3KUF A;  4N0A A;  2QQS A;  2O4X B;  4JRK A;  4PJO G;  3OA6 A;  3LLR A;  4J5Y A;  4J6X A;  3JB9 D;  5GMK j;  5GAO n;  4XTV A;  4FL6 A;  1S72 A;  2XDD A;  5KE3 A;  2LC4 A;  1H64 1;  3C12 A;  4M77 E;  4Z02 A;  3VUB A;  3J80 E;  2EQK A;  1YIT T;  1VQP T;  3OS1 A;  4LDX A;  3JB9 H;  5AYF A;  3UDC A;  2RH2 A;  3KXT A;  2VYT A;  1LNX A;  2KDS A;  1IRE B;  2RD1 A;  3A8G B;  4C8Q D;  2JTF A;  1B34 A;  4NS5 A;  1WJS A;  3OYD A;  4JRI A;  1UGP B;  3BDL A;  3CCS T;  5EG2 A;  4XU0 A;  3CMA T;  2Y90 A;  3OYA A;  2M0O A;  2DJZ A;  5CK9 A;  5A0L A;  3GPL A;  1VQ7 T;  2EYQ A;  3L1A A;  1Q7Y U;  4O5V A;  2DZC A;  1H3Z A;  3ZFJ A;  2R57 A;  2LDM A;  1BIB A;  3OMG A;  1N8R C;  2CZ1 B;  2HBP A;  1JB0 E;  2D9T A;  3OBW A;  4QVD A;  2QDY B;  1G3S A;  2P4T A;  4J6W A;  3OB9 A;  4RCB A;  5FU6 C;  2A3L A;  4MML A;  4OP0 A;  4ELY C;  3CBP A;  4MMK A;  3HSB A;  2X4J A;  1VQ4 T;  2E5Q A;  1KQ1 A;  2ZCF B;  4J7F A;  5DM7 R;  2K5I A;  3F70 A;  3FIF A;  4BE2 A;  1YJN T;  4M7D D;  3OYF A;  3G6E T;  1WJR A;  2QTX A;  3INZ A;  4M77 B;  4M77 C;  5GAM g;  1YIT A;  1W2B A;  2E6N A;  2VXF A;  4J83 A;  3L2U A;  1KC8 U;  1Y96 B;  5LJ5 h;  1FWZ A;  3HP9 A;  4PKC C;  2X4Y A;  4QQD A;  4E7I A;  1Q82 U;  3NTI A;  4QVC A;  3JCM Q;  4M7A G;  4C5E A;  1UGQ B;  1WQW A;  2V8I A;  1G5V A;  2CKK A;  3JCM g;  3WVD B;  3QII A;  1Q86 U;  2MMP A;  3LH0 A;  5HK3 A;  1FX7 A;  2LRQ A;  2LQ8 A;  3OS5 A;  2WSE E;  2E10 A;  3RKW A;  2CZ6 B;  5CKB A;  3MHX A;  2RJF A;  1PSF A;  2OTJ T;  4C92 F;  3HKS A;  3RMQ A;  4PJO A;  1UEB A;  2KY9 A;  1M1F A;  2RK1 A;  4J7I A;  3JB9 J;  1VQ4 A;  2LCL A;  1B34 B;  4L5G A;  1N9R A;  2L5Q A;  3SWN C;  3SWN B;  3M58 A;  4C0F A;  3L2V A;  4E7J A;  3R6O A;  4A4K A;  1YJN A;  4M78 F;  3QSU A;  3A8O B;  4M75 F;  1ZHI A;  4P5N A;  2DAQ A;  4RG2 A;  5CVI A;  3G6E A;  2NLU A;  1M90 U;  5LJ3 j;  3FJP A;  2LQK A;  3MEV A;  1YI2 T;  3HL8 A;  3QYH B;  1MGQ A;  3PMI A;  3V8K A;  4BUG A;  3S3N A;  1KQS S;  5GMK e;  1YJW T;  5GMK m;  4XU2 A;  1YJ9 A;  3FC3 A;  5GAM d;  5FRM A;  1PSE A;  4DA4 A;  3OYM A;  3RES A;  3QYG B;  3QBY A;  2K4Y A;  2QQR A;  3M4G A;  3L2Q A;  3OW2 S;  3JCM W;  3S3M A;  2CYZ B;  1VQO T;  1G3T A;  4IUQ A;  1ZBX A;  1UGR B;  3EFS A;  1LJO A;  3OYE A;  5D6W A;  3LX7 A;  4MZM A;  1NPR A;  2K57 A;  4FU6 A;  2EFI A;  2L89 A;  5GMK l;  1M1K C;  3GNF B;  4E7L A;  2OTJ A;  2DD4 A;  4A4F A;  4C8Q F;  3PGG A;  1KQS A;  4OB3 B;  2M16 A;  3X25 B;  4FSX A;  3VJP A;  3M4Y A;  4RG8 A;  1WQ7 A;  3LGF A;  4KBM B;  5A0G A;  4ZTF A;  3ER0 A;  3OW2 A;  3PMT A;  2RK2 A;  5GAN g;  3RUX A;  3OS2 A;  4HKE A;  1Q81 U;  5GAN 2;  3SD4 A;  3JCM h;  3CC7 T;  3CBM A;  3J81 E;  1BI0 A;  1M4Z A;  2RHU A;  4IUU A;  1ZQ1 A;  4C0G A;  1YI2 A;  1BIA A;  2DXT A;  3URG A;  4M7A A;  1RI0 A;  3G7Z A;  5GAN 3;  3RKX A;  4ZGD B;  4LDU A;  2FHD A;  5M9O A;  4EPC A;  4Y28 E;  1I4K 1;  2ZPB B;  1UGS B;  4HT8 A;  1MHN A;  1OZ2 A;  2LVM A;  2RHX A;  4ZGE B;  5CR2 A;  4R55 A;  3L42 A;  3A5Z B;  4Y91 A;  4RMO A;  4C92 E;  4F7U G;  1I5L A;  2XK0 A;  1VQO A;  4KUD K;  2VC8 A;  4M7D F;  3LWH A;  4PL6 A;  1TH7 A;  4RCC A;  2ZPI B;  4BE0 A;  3M53 A;  3GNG A;  3A8L B;  1WJQ A;  4J6Y A;  4EMK A;  2GFA A;  3P8D A;  4ZGJ B;  2BUD A;  3M59 A;  4VUB A;  2FB7 A;  1I81 A;  3KBG A;  4M78 E;  5GAO p;  3OYC A;  2XG8 D;  4M75 E;  2Y4Y A;  4QW2 A;  3JCM P;  2JN0 A;  2P0K A;  4C8Q A;  2EJF A;  2KMT A;  1QVF S;  3TRE A;  3LGL A;  2DPP B;  3X28 B;  2RI5 A;  4QQG A;  2RJD A;  3QPH A;  4JLG A;  2QQ9 A;  4M77 D;  4X9D A;  3CC7 A;  2MAM A;  1XNI A;  4C0Z A;  1NPP A;  4NOY A;  1M90 C;  1WPY A;  3JSC A;  3CCU A;  4XTX A;  1NJI U;  2RI2 A;  4YTL A;  2JNG A;  4MZT A;  2VGN A;  5FLX E;  2XD0 A;  3CCE T;  4FM4 B;  4B9W A;  3HRS A;  5LJ3 e;  2DZ9 A;  4PJO F;  4GY5 A;  3SDZ A;  1W2B S;  4X9C A;  3OYG A;  1QVF A;  3BY7 A;  1BI2 A;  1IZ6 A;  2DEQ A;  3QJ6 A;  4JDS A;  4C92 C;  4C92 B;  1N27 A;  2KAF A;  5GAN 6;  3OY9 A;  3O8V A;  4OMF B;  3FRN A;  5FRN A;  2DXB A;  1D3B B;  5LJ5 d;  3FEO A;  5GAN h;  3A8H B;  1HK9 A;  4MDW A;  5LJ5 f;  4ZTJ A;  3CC2 T;  2AHJ B;  3E9F A;  5GAO r;  2RI3 A;  3CD6 T;  4M78 B;  4M78 C;  4M75 B;  4XQ3 A;  4M75 C;  3CC4 T;  1Y7X A;  1WGS A;  3E9G A;  1VQK T;  5CO7 A;  3DKM A;  3SFM A;  2DK3 A;  4NL3 A;  3HRU A;  5CCA A;  3UPU A;  1VQP A;  3OMC A;  1BI3 A;  4DQ2 A;  3I55 T;  1VQ8 T;  1VQ6 T;  2PUK B;  2JTM A;  2X35 A;  1UB4 A;  3ME9 A;  3FLG A;  4ME7 A;  3DB3 A;  5GAM j;  3CCM T;  3L2Z A;  2WSF E;  4BDY A;  3OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...