2DM1A

Solution structure of the second sh3 domain of human protein vav-2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
GSSGSSGGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human protein vav-2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Protein vav-2
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dm1A00
2PTKA 2M51A 5GJVB 2GTJA 2LX7A 3M0PA 5IH2A 1JU5C 2FG0A 1YNZA 1GFCA 2O9SA 2BZYA 2YT6A 2LQWA 2J6OA 2KXDA 1ABQA 1UECA 1V1CA 2J05A 2RN8A 3M0UA 3PVLA 3I35A 5FW9A 1AZEA 3VS5A 1NM7A 1AD5A 2NWMA 3FJ5A 3UA7A 2L2PA 1G2BA 1GRIA 3H0IA 3VS6A 3H0FA 4LN2A 2GNCA 1YWOA 2ROTA 2DMOA 4OMMA 1RI9A 1X6GA 1A0NB 1M3CA 2RF0A 1QLYA 1WA7A 1UG1A 3VRZA 2RQVA 1BK2A 4F14A 5IHIA 1WI7A 2DJQA 4OMPA 1WIEA 1WXBA 1UTIA 1M27C 4JJDA 4J9DA 2KRNA 2CT4A 4JZ3A 1Z9QA 5FWCA 1JQQA 3VS7A 1B07A 4AG1C 2DILA 2JMAA 3NMZC 2MIOA 4Y92A 4JPBW 2VWFA 3TSWA 4AFUC 2JS0A 1M8MA 2KE9A 2KRMA 2V1RA 2F2VA 1M3AA 1X6BA 1IO6A 1RLQC 4AFSC 3JV3A 1TUCA 2EYYA 3RNJA 3QWXX 1T3LA 2CH4A 2LP5A 4DEXA 2SEMA 1M3BA 2HCKA 1S1NA 2JTEA 2DBMA 2LJ1A 1GFDA 1NEGA 1ZX6A 1ZUKA 1K0XA 1WXUA 1PRMC 2W0ZA 1BBZA 2CREA 1B3QA 1VYTA 1X2QA 2J6FA 2AZSA 2NUZA 1PKSA 1EFNA 2K79A 2KT8A 2KT1A 3PE0A 5IHNA 1GCQA 2KBTA 1UGVA 1FMKA 5GJWB 1VA7A 3I9QA 4FSSA 2DM1A 1SPKA 2AK5A 2RQRA 2VKNA 4RTXA 2BTTA 1UHCA 2LZ6B 2A08A 4Z89A 2C0IA 5IXBA 2DVJA 4IIOA 4A63B 4F16A 2FPEA 2X3WD 2CUDA 2YUQA 2DLPA 2F2WA 2C0OA 2EKHA 1SHFA 4WCIA 4K11A 1OV3A 1NLOC 2DE0X 4JJCA 2KEAA 2FRWA 4RTUA 2RNAA 1Z9ZA 1RUWA 2ROLA 2A28A 2K2MA 1CSKA 3M0RA 2KYMA 4HXJA 4AFZC 2KGTA 4CC3A 2LNHB 2OAWA 4HVVA 3REBB 1J3TA 1AWJA 2EYWA 4ORZA 3REAB 2V1QA 3A98A 4OMOA 1PRLC 1WX6A 1I0CA 2GTOA 1RLPC 1H8KA 2YUNA 1ZLMA 2JW4A 4D8KA 1W1FA 2A36A 5I11A 2HSPA 4J9FA 2O9VA 2W10A 2OI3A 2LJ0A 2L3QA 2YUOA 2EGEA 4QT7A 2LMJA 3M0SA 3GBQA 1GL5A 2K3BA 4EIKA 3THKA 2DL3A 2CDTA 2PZ1A 1TG0A 2EYXA 2KYBA 3H41A 4J9HA 3UF4A 2LQNA 1T0JA 4GLMA 1X2KA 1WDXA 1GCPA 1AEYA 2K9GA 2ESWA 3TSZA 1ZBJA 4R0KA 4CC4B 1XOVA 1MV3A 1UUEA 2VVKA 2ED1A 1YWPA 2X3XD 1HD3A 1KSWA 1SHGA 2JM8A 1I1JA 3QWYA 2O88A 2EPDA 1E6HA 2EGCA 2D0NA 1ZSGA 1YP5A 2ENMA 2EGAA 1PHTA 2CT3A 4RUGA 3U23A 5I22A 1JEGA 3IQLA 2GGRA 2D8HA 2D8JA 2KRSA 1JXOA 1GBQA 2DA9A 1X27A 4HVUA 2L0AA 3I5SA 4LNPA 1AWWA 1OPKA 1QWEA 1CKBA 1TUDA 1UDLA 2IIMA 1H3HA 1UE9A 1QWFA 1ARKA 3KFVA 2CSQA 1AWXA 1VYUA 1UHFA 1UFFA 2A37A 3SHWA 3M0QA 1HSQA 2DL5A 1JXMA 2LCSA 3NGPA 1T3SA 2G6FX 4J9EA 3SEMA 1BB9A 1GBRA 4GBQA 2L3PA 1NEBA 1K76A 2RQWA 1NYGA 2LJ3A 1OPLA 2HBWA 4HVWA 2DL4A 3O5ZA 2HEQA 1QKXA 2EQIA 2H8HA 5L23A 1Y0MA 2DL8A 4DEYA 1UJ0A 4E6RA 2SRCA 4D8DA 2EBPA 3NHNA 2F2XA 2MCNA 1QCFA 3EG3A 2DL7A 1K1ZA 2DYBA 2KR3A 2FPDA 2EVRA 5FWBA 1U3OA 3VS4A 1U06A 3I5RA 2QDLA 1N5ZA 4LUDA 2XMFA 1Y57A 1PWTA 1OOTA 2JMCA 2FRYA 2GBQA 3EG0A 2BZ8A 3ZL7C 2DNUA 3EGUA 1OEBA 3UA6A 2AKLA 2KROA 4OMLA 1M30A 2RMOA 1T0HA 2FO0A 4RTWA 1MUZA 3EHRA 3C0CA 2CSIA 5IHKA 1GCQC 5IXFA 5HCKA 3VRYA 2AKKA 2B86A 1BU1A 1CKAA 4J9CA 3VS3A 4ZNXA 1I07A 4KRTA 2O31A 1K0SA 2CUBA 3NPFA 2DRKA 1YN8A 4OMQA 3UATA 4CC2A 1HJDA 1NLPC 1UJYA 1JO8A 2OJ2A 2DRMA 2D1XA 5EC7A 1AWOA 1G83A 3VS0A 4M4ZA 1WFWA 1QKWA 4OMNA 5ECAA 2HDAA 4RTZA 1PNJA 3EG1A 2EW3A 2L3SA 1SSHA 2AZVA 1ZUUA 4IIMA 2K6DA 2MOXA 2JT4A 1AOJA 2DX1A 2J7IA 2YSQA 2JM9A 1NG2A 3VS1A 1AZGB 1MV0B 2O2OA 1U5SA 3H0HA 2I0NA 2K7AA 4AG2C 3ULRB 1W6XA 2KXCA 4ESRA 1W70A 2E5KA 4J9IA 1WXTA 1WYXA 4X1VA 2BZXA 4CC7A 3PVQA 2ABLA 3VS2A 1WLPB 1LCKA 1PKTA 2KNBB 4J9GA 4Z88A 4F17A 1E7OA 2FEIA 1K4US 1ZUYA 1ABOA 1X69A 4Z8AA 3RBBB 4HCKA 4J9BA 4JZ4A 3TVTA 1K9AA 2EYZA 3EG2A 1SRMA 2C0TA 3CQTA 4RTYA 3EHQA 1VYVA 4JJBA 2J06A 2RQUA 4RTVA 1X43A 2J6KA 2CH4W 1KFZA 1KJWA 3M0TA 2ECZA 1E6GA 2DF6A 1FYNA 1KIKA 2P4RA 2RQTA 2YDLA 4LUEA 1SRLA 4LE9A 4RTTA 2RPNA 1SEMA 1H92A 2PNIA 2JXBA 1YCSB 2FPFA 2GQIA 3LH5A 1NYFA 2DBKA 2M0YA 3R6NA 2ED0A 2YUPA 2JS2A 1AVZC 4AFQC
chains in the Genus database with same CATH superfamily
4M77C 2M51A 2GTJA 2K2VA 2LX7A 3L1AA 5A0LA 1Q7YU 3RIRA 1JU5C 2DIGA 2JNGA 1HYOA 2O9SA 1YIJQ 1Q86C 5CVIA 1ABQA 1I8FA 4IUQA 5GAOq 5KYWB 1VQOQ 3BDUA 4RMOA 4B9WA 2JJ9A 1AD5A 3UA7A 4XTWA 1O9SA 4PJOG 4M77A 1ZSZA 4KGZB 1MMAA 4E2FB 1GRIA 2H3JA 1VQ6A 4MDWA 3MEUA 1WHGA 5LJ3j 3RKXA 1YWOA 2CS7A 2ROTA 3NTKA 1M1KR 1X6GA 3MHXA 4E7HA 3BE3A 5KE3A 4OVAA 1WGSA 4LDXA 4M78A 4OMFB 3NFCA 2FZGB 5IHIA 1WI7A 4OP0A 4OMPA 4IURA 1OULA 1M27C 4J9DA 2CT4A 4JZ3A 3OYCA 2MAMA 3G71Q 1VQNQ 1QCOA 3NMZC 2F69A 1LNXA 4M78E 3QZ5B 5A0GA 1NBEB 1OZ2A 1XJWB 2M1HA 4KUDK 3LX7A 2V1RA 1RAGB 3HKSA 4C92D 2AHJB 2XIDA 1I4K1 1KK7A 3I56T 2XG8D 2DXCA 3QWXX 3RDVA 1Q86R 1QVGP 4O5VA 2VGMA 2HCKA 1S1NA 3DB3A 2JTEA 1VQLA 2RK1A 1GFDA 2CKKA 1NEGA 5KYUB 1PRMC 2W0ZA 2Y4XA 1PC0A 1EFNA 1LPLA 2K79A 3PE0A 5IHNA 4PFOA 1VQ4Q 5I2MA 3I9QA 1D09B 2RQRA 1RACB 2VKNA 4WTOB 1UHCA 4Z89A 2C0IA 4NS5A 4F7UF 3JCMc 4A63B 4QVCA 4BY6C 3CD6Q 4V2SA 2F2WA 1SHFA 3EGXA 3RKWA 3AT1B 4JJCA 1NLOC 1QQJA 4PJJA 5FU7C 1KQSP 1R77A 1RUWA 2LQKA 4XTXA 5CIUA 1M1GA 1CSKA 2KAFA 2KYMA 4HXJA 2H3EB 3EG9A 4HVVA 3REBB 1J3TA 2F5KA 4ORZA 1YJNA 1X75C 2LT1A 3A98A 1I0CA 1ZLMA 2O4XB 2JW4A 1XTDA 3LGFA 1W1FA 4FYXB 5AYFA 5I11A 3JRZA 3EFRA 3PT9A 2E65A 2E5QA 2OI3A 4C92E 2L3QA 3RMQA 1K73U 4A54A 4PLLA 4EMKC 1WHJA 1QVGS 1TG0A 2KYBA 1KQ2A 3H41A 1PD0A 1WPYA 2DTOA 1G8XA 3OYYA 3RKYA 1QP2A 1NJIU 3QBYA 2MI6A 4MZPA 3CC7Q 1IB8A 2VVKA 2ED1A 2VASA 2RJCA 3MP8A 1KQSA 5GAMg 1G5VA 2ENMA 2ZPEB 1IZ6A 4J83A 1PHTA 2AIRB 1YIJT 3OBYA 2YLCA 5GAMd 2GGRA 2D8HA 5KCOA 1GBQA 1X27A 4OF1A 4PFZA 3CCQT 5CQXA 3QJ6A 3VKIA 1AWWA 1KC8U 1YJWA 4ZN1A 1TUDA 3M59A 1M2VB 4FSXA 2GQVA 1UE9A 4KH1B 4C5GA 3PNWC 3R6OA 3M5AA 1YJ9T 2KY9A 2RHUA 1UFFA 1YHQT 4NOYA 1HSQA 3OS2A 3CCLT 2DL5A 3CCEQ 2WSEE 3C95A 3FRNA 5CAIA 4MDXA 3EFSA 3JCMb 3OA6A 1GBRA 1KD1R 3OMCA 3OB9A 2RQWA 1UGRB 1VQ9Q 1OPLA 5KYYB 4RG8A 4II1A 2E64A 4HVWA 3O5ZA 3ER0A 2A0FB 3CCJA 3CD6T 1BCOA 2HEQA 3EAEA 2H8HA 4C0ZA 4QVDA 4E6RA 2EBPA 1AT1B 2F2XA 3CPWS 2P84A 1K1ZA 2KR3A 4FCYA 3VS4A 2QDLA 2CZ1B 2DYIA 1FMVA 1RL2A 1OOTA 4M75C 3EG0A 3CCLQ 1V29B 3EGUA 1M5Q1 2AKLA 4FW1A 1M30A 3C94A 2RMOA 3CMAT 3HFOA 4TVRA 5C0MA 1ZSZB 1Q82R 4B6MA 1MUZA 5M9OA 2CSIA 3GNGA 1KIKA 2AKKA 3CEYA 1I07A 4M77B 4M75A 1K0SA 3NPFA 1VQMQ 2OTJT 2JUFA 4OMQA 4CC2A 3G4SA 1HJDA 2XHCA 6AT1B 1MNEA 4JLIA 3A8GB 4DBQA 5LJ5e 4LD9K 3OW2P 2L89A 1S72T 2QQAA 2K5LA 4OB1B 2EQJA 2L8DA 1S72A 4RTZA 1OQKA 2JTFA 2OTJQ 2EQKA 2DD5A 3EG1A 3MPUB 2EW3A 1TH7A 1WHMA 2L3SA 4IIMA 1TOVA 3SWNA 1DJ7B 4PJOC 2DJZA 5EG2A 2E41A 1NG2A 1I5OB 1UGSB 2KDSA 3EFOA 4M78D 5GANh 1NE8A 3EGDB 4C5EA 1VOMA 3LLRA 2O2OA 2HL3A 5GMKm 4E7SA 2RA2A 3CCRA 2K7AA 4M75E 3G4ST 1W6XA 2E5KA 3G6ET 2BZXA 3PTAA 3VS2A 3L42A 2P0KA 5CKDA 2IG0A 4E7ZA 1ZUYA 4OB3B 1X69A 4F7UG 2K3YA 2E4HA 2X35A 3LWHA 1K73R 3G71A 3EG2A 4DBFA 3CCQA 1N9RA 4Q5WA 2C0TA 3CQTA 1KD1U 1VQ6T 4RTYA 2QEXQ 3CC2Q 2XICA 1X43A 3HRSA 3CC2T 1M9SA 3M0TA 2QXFA 1E6GA 2DF6A 3OYAA 2P4RA 3MJXA 2RQTA 2XI9A 4JRIA 3CC4T 2HMAA 2RPNA 3MO8A 4X9DA 2FPFA 2EQMA 2K57A 2YUPA 2E6ZA 2JS2A 4AFQC 3D7SB 3QPHA 5GJVB 4FT4A 3X24B 3L2WA 1IGQA 2FG0A 4FU6A 4E7KA 3P8BB 1RAAB 3JCMg 2YT6A 2LQWA 2HL5C 1VQ4A 2KXDA 4ZGJB 2JVVA 2E12A 3CMEQ 3I35A 5FW9A 1AZEA 3FJ5A 2L2PA 3X20B 1G2BA 3L2QA 1RAEB 1K8AR 1N8RC 4PJOB 1M90R 4LN2A 2BKDN 2E3HA 4M75D 1A0NB 1M3CA 5KYYA 2RF0A 2HAXA 2P0PA 4MMLA 1QLYA 2EYQA 2RHXA 2HZYA 3VRZA 2RQVA 5KYXA 4ELYC 4F14A 2XK0A 5GMKe 4F7UA 2DJQA 1U1TA 2HBPA 3ASKA 2BUDA 1UTIA 5CK9A 4JJDA 3GP8A 1VQNT 3JB9G 2WACA 2ZAEA 1VQKT 1JQQA 4M77D 4QKUA 3KBGA 4AG1C 2JMAA 3A8OB 4Y92A 3EGXB 4JPBW 2E1HA 2VWFA 5GAN5 2KSSA 1ACMB 1C6VX 1B34B 2JS0A 4N4GA 2KE9A 3QYHB 1SSFA 3MCAB 3J7AF 1Y7XA 1M3AA 4X34A 2QASA 5LJ5g 3CCMA 4PJOA 1WQ7A 1RLQC 1OYXA 1VQPQ 1M4ZA 2M0OA 3M56A 3RNJA 2FL7A 4XU3A 5FRNA 2SEMA 3DB4A 2K4YA 3MEVA 4BACA 2DBMA 3V8JA 2LJ1A 4BDZA 2YLBA 3OYJA 4D6WA 2XDBA 2CZ0B 2KI7A 1B3QA 1VYTA 1X2QA 1N8RR 2NUZA 3V8KA 3PGGA 2KT1A 2KBTA 3JCMV 1UGVA 5GJWB 1NPPA 3S3MA 3RUXA 2DTIA 2AK5A 2CZ7B 3CXCA 5GAN6 1C1AA 1TTHB 1YHQA 2DVJA 4IIOA 4M7AB 5AT1B 1OX8A 2YUQA 3SD4A 1K9MU 1OV3A 1N6AA 2DE0X 5IT9E 2KEAA 2CGHA 3FEOA 4IUUA 4C8QF 2CP3A 2DXTA 3CCUA 2VV5A 2RNAA 5IN1A 1I81A 2A28A 5FU7B 2X4YA 4XTZA 2FYKA 2RHIA 3H9NA 3ZFJA 4CRIA 1WHHA 2JOYA 4PJMA 1AWJA 3REAB 4QVZA 4PL6A 1PRLC 1WX6A 4M7AG 3CCEA 2GTOA 1RLPC 3SDZA 1H8KA 5GAOp 2DIQA 4FYWB 3QZ9B 2CYZB 3CCST 2PUKB 3QHSA 2FHDA 3CC4A 2LJ0A 5GAMj 3M54A 2MWOA 3CCJQ 4QT7A 2LMJA 2D9TA 3GBQA 2XU8A 3THKA 3OYBA 3EFOB 2EWNA 4BI3A 4J9HA 1BI0A 4C0DB 2LQNA 1T0JA 4KT0E 4GLMA 2FB7A 1IREB 3HRUA 3MP6A 5GANg 1M1KU 1TU0B 3VV0A 5LJ3h 1JJ2A 1ZBJA 3JB9D 4NL2A 4A4FA 1XOVA 3E19A 1MV3A 4KGXB 5GMKj 1Q95G 2EIFA 2O88A 1XQHA 4ANJA 1KHCA 3PMTA 4PNOA 3UWNA 1VQKQ 1D3BB 4YTLA 4M7DC 3U23A 4J6XA 1H641 5I22A 5KE2A 2RI3A 1JEGA 1D0YA 3IQLA 1YJWT 1QVPA 2LX9A 1JXOA 1ZHIA 1Q7YR 3G4SQ 4HVUA 4M7AC 5L8RE 2DTHA 1OPKA 2HNIA 4J7IA 1QWEA 1QW1A 1UDLA 2LCCA 1VQ7A 4Y91A 2EKOA 1EIFA 3GLXA 3FLGA 2CSQA 3JCMe 3CCSA 3E9GA 2JZ2A 1VQ8A 3SHWA 3M0QA 4DOVA 2LCSA 4DQ2A 4JLGA 3SEMA 1VQPT 1UEBA 3C12A 1I5LA 5FRMA 4BI4A 3JSCA 3TEEA 1JBMA 5C6SA 2HBWA 3CCRQ 2DL4A 1YJ9A 2P0QA 3JCMd 3UT1A 3G6EA 3HRTA 4E7LA 1PSEA 4FL6A 1UJ0A 2HQEA 4LDWA 2YRDA 2SRCA 4Y28E 2Y4YA 3NHNA 2MCNA 3EG3A 1VQ5Q 4ELZC 2EVRA 3GF5A 1N5ZA 1R0BG 3CCUT 4LDYA 3EGDA 1XNIA 1PWTA 2ZZDA 4XU1A 2JMCA 2DZCA 2FRYA 3VJPA 2BZ8A 1Q82C 3DLLA 3V8LA 4A4GA 1YIJA 3VYGA 1T0HA 4M75B 3PMIA 4C8QG 5GAMf 2QA4Q 2FO0A 3EHRA 4C8QC 2XDDA 4MZTA 4IUPA 4KRTA 2DVEA 5J39A 2CUBA 3OYKA 2DRKA 2MF2A 4PLIA 4QW2A 1VQ6Q 2V8JA 3DKMA 3TU4K 3LW5E 3E1SA 3HP9A 4B9XA 1SKUB 2AT1B 1JO8A 5GAOm 3PIPA 1BIBA 2DRMA 2D1XA 4HKEA 4M4ZA 3LWIA 4ZN3A 1QKWA 4OMNA 2A3LA 1QCNA 3MEAA 3CMAA 3H8ZA 1LVKA 3CMEA 4FIBA 2VC8A 2K6DA 2M02A 3CCMT 5LJ5j 2JT4A 1D0XA 4M77E 1W4SA 1Q81U 2YSQA 2JM9A 1AZGB 5HKCA 1M8VA 1MV0B 2FZCB 1M90U 3H0HA 2I0NA 3M9QA 4A4KA 3JCMJ 3HL8A 2MWPA 2KXCA 1WQWA 4ESRA 4J9IA 4P5NA 3PVQA 4M7AF 5GAMh 3QJYA 1LCKA 1PKTA 4F17A 4Z88A 2V26A 1E7OA 3G7ZA 2BE7D 3OY9A 3RBBB 4C8QA 3JB9J 1BIAA 3FJPA 2HD0A 5CKBA 1MMGA 3X25B 1K9AA 2EYZA 5A2QE 2HQXA 3SB2A 1BI3A 4N0AC 2DXUA 1Q81C 1KD1C 1JJ2S 2RQUA 4RTVA 8ATCB 2J6KA 1KFZA 1KJWA 4F7UB 2LTOA 4LUEA 3GOXA 4C8QD 1YCSB 5GAN2 3A8MB 3ME9A 2M0YA 2PVOB 3LYIA 3OBWA 3C4SA 2PTKA 2KMTA 1PD1A 2MK5A 3A5ZB 3M0PA 4EMGA 2EJGA 3S6WA 1GFCA 2I2LA 2DAQA 2WSCE 2J6OA 2CP2A 3CCVA 1UECA 1V1CA 2RN8A 1YBYA 1YJNQ 3PVLA 4PK4A 5LJ3e 3J81E 1GXIE 1PG5B 2NWMA 2ZCFB 3OMGA 4M78G 2QGGA 1KQSS 2GFUA 1YHQQ 1IGUA 3H0FA 3NTIA 1PSFA 2GNCA 1YITT 2P4TA 5GAOr 2DMOA 3CBPA 1RI9A 3ZBDA 5LL6S 5LJ5h 4C8QB 3JCMf 1VQLT 1TXQA 2RD1A 1BK2A 1Q81R 4XQ3A 3BW1A 3WXMB 1WIEA 3JB9F 1SF9A 4KUIA 2LDMA 4PJLA 1G3YA 4FW2A 3I55Q 3ZEHA 3QSUA 4RKUE 5LJ3f 1Z9QA 3OSSC 1Y71A 5FWCA 4DBRA 3TREA 4CI0C 1B07A 2FVUA 2DILA 5A0DA 1YJNT 2MIOA 1ZA1B 3CC7A 3TSWA 4BUGA 2YRCA 3G1JA 2RK2A 3WVEB 3CC4Q 4C92B 5KCHA 2NUPA 1BKBA 1VQ9T 1X6BA 1IO6A 3QIIA 4ATOA 2VUBA 3JV3A 1KHIA 1TUCA 1T3LA 1R0CB 2CH4A 2PUOB 2LP5A 4DEXA 1OZ3A 1QVFA 1M3BA 2QQ9A 3NTHA 1YI2A 1TWBA 5FLXE 1ZX6A 4M7DE 1K0XA 2DZ9A 3HHTB 1ZSZC 2M9UA 2CREA 1K73C 2QYZA 2J6FA 4JRQA 2L3RA 4MMKA 2KT8A 2KVQG 5DM7R 4PFPA 3LH0A 5I2SA 4MZMA 3OS1A 2ZGWA 4DA4A 4RTXA 1FWZA 2LRQA 1WHLA 4M78C 1RADB 4F16A 3VYHB 3QXEB 5KH6A 4IUTA 4NL3A 2X3WD 2ZPBB 1UGQB 2RO0A 2C0OA 2D0QB 4WCIA 3I56A 4FYVB 3M4GA 2XKOC 7AT1B 3MP1A 1N8RU 1OU9A 2E70A 2ROLA 1VQ7Q 2K2MA 3M0RA 3CCET 3HTRA 2D6FA 4CC3A 2OTLQ 4M75F 2EYWA 1NJIC 1D3BA 3O8VA 1VQOA 5CR2A 3CCLA 3Q1JA 2ATCB 4FT2A 4F04B 1M1FA 2HSPA 5D6XA 1B34A 2O9VA 3OW2S 2YUOA 1ZA2B 1U1SA 4M77F 3M0SA 1O75A 2X4WA 2DPPB 4HCZA 4M78B 3F70A 4JRPA 2DL3A 2CDTA 2PZ1A 2EYXA 3P8DA 4M77G 1VQMA 3VUBA 4KULA 3PIOA 1Q82U 3JAME 5J3BA 2OTLT 2K9GA 4J6WA 3MEWA 1BCMA 3JB9H 2E10A 4XTVA 3TSZA 1FMWA 4CC4B 1VIFA 4XU2A 4ZTFA 3AHUA 2JTMA 3CCVT 3TCJA 1UUEA 1YWPA 1HD3A 4JS5A 1TS9A 2QA4A 2EPDA 1E6HA 4IUVA 2PVGB 2DKGA 2VB6A 4GLKA 3FDRA 2CT3A 2B8AA 4J5YA 2DEQA 1WJSA 3OQ5A 2KRSA 4M7DB 4ZGEB 2DA9A 4J8OA 2L0AA 4EMKA 4EMKB 2R57A 1VQLQ 4LNPA 3N5BB 1VQ4T 1BI2A 2RI5A 1CKBA 2E6NA 4KBMB 2VXFA 5LJ3d 2EFIA 1OI1A 3L2UA 3OYMA 5GAN3 1H3HA 4XTUA 1QWFA 2DK3A 1ARKA 3CMAQ 2YXYA 1M2OA 3KFVA 2DERA 1VYUA 1UHFA 4A4HA 1M90C 3NGPA 2O01E 3OS5A 4J9EA 1BB9A 5KYXB 4N4IA 2L3PA 4EDUA 3L2ZA 1K76A 2QEXA 1NYGA 1YCYA 4IKFA 2LJ3A 3CC2A 2VGNA 3BY7A 3CCJT 3CD6A 4OB0B 1QKXA 3SWNC 4RCCA 1Y0MA 4DEYA 1KC8C 3RERA 3GIBA 1PCXA 5DLOA 4UC4A 4C8QE 2Z0WA 1QCFA 3LGLA 2DYBA 2FPDA 4JJNK 3CC7T 3E9FA 1U06A 4LUDA 1Y07A 1Y57A 2LT4A 2PU9B 3A8LB 2GBQA 2LNVA 3ZL7C 3UA6A 1R8OB 2KROA 4OMLA 1OX9A 2X9HA 3M4YA 5DLQE 3OSVA 4RTWA 1UGPB 3JCMh 5I21A 1VUBA 4XK8E 5IHKA 5IXFA 5HCKA 3VRYA 2B86A 1BU1A 1KG1A 5CQYA 3VS3A 5IAYA 4ZTJA 2VYTA 3CPFA 3CPWA 9ATCB 1UJYA 3JCMP 3HPWA 2OJ2A 2FZKB 5EC7A 1G83A 4BY6B 1P92A 1X01A 4M7DG 4C5HA 5ECAA 5HY6A 3VU3C 4C0DC 4F7UE 2NUTA 3CCVQ 1PNJA 3J80E 2BE9B 2QG9B 4BE1A 1ZUUA 4R55A 3QDFA 4BB7A 2J7IA 3VS1A 1LOJA 2RHYA 3RMSA 1K9MR 2RH2A 4AG2C 3ULRB 2DETA 1M2VA 1B7TA 3CCMQ 1W70A 4OGCA 1WYXA 4X1VA 4XTYA 2ABLA 3MKDA 2GFAA 3META 3SWNB 3SFMA 1K4US 1ABOA 4Z8AA 3I55A 2CP6A 1SG5A 4JZ4A 4J9BA 2C06A 4RCBA 4EPCA 3QYGB 3TVTA 5GANe 1Y96B 1RAFB 2HKQB 1JB0E 1SRMA 1W2BS 3HFNA 1WHKA 3EHQA 1OU8A 1D0ZA 1VQ9A 5GMKh 4JJBA 2RJFA 4M75G 2ZPGB 1FYNA 2COZA 4A4EA 3QO3A 4KGVB 1SRLA 1KQ1A 2QA4T 2RJDA 2CP7A 1ZQ1A 4LE9A 4XU0A 4RTTA 1SEMA 1H92A 4BDYA 2PNIA 1UB4A 2JXBA 2V8IA 2DBKA 1JRIA 2ED0A 2Y90A 5LJ3g 3V7RA 1YI2Q 1AVZC 2MPXC 2DO3A 4OGEA 2QGFB 1RABB 3CCUQ 5CKFA 5IH2A 4Z02A 4DOWA 1KC8R 1YNZA 4HA8A 1FXXA 1W2BP 1K9MC 1QVFS 1WJRA 2BZYA 5GAMe 1RI0A 4LD6A 2R5MA 2J05A 3M0UA 1W2BA 1U8RA 3VS5A 1NM7A 3QDRB 4N4HA 2QQBA 4FYYB 3H0IA 3VS6A 3OS0A 5J26A 1WZOA 5HK3A 2NLUA 1NJIR 2K5FA 2YRVA 2X51A 3I56Q 4OMMA 5CKHA 1D1AA 1WA7A 2DD4A 1UG1A 3L2VA 4LDUA 2PQWA 3T9NA 1S72Q 2HSEB 2OTJA 5GAOl 4JUVA 2OTLA 1WXBA 4O6JA 2KRNA 1VIEA 2R5AA 2X4JA 3VS7A 3UPUA 4HT8A 4M7AD 1LJOA 1BI1A 5DY9A 3M53A 3G71T 5CO7A 5CCAA 3OYDA 1F1BB 2OX7A 4AFUC 5GAN4 1M8MA 3S3OA 2KRMA 3I55T 4M7DF 2F2VA 4WF2A 1VQKA 3CXCS 3M55A 3FIFA 4AFSC 2EYYA 5D6WA 2QTVA 1N27A 3CBMA 5GANj 4HCBA 4E47A 4C0GA 4HT9A 3VUZA 1YITQ 2LQ8A 3RR6A 2MYSA 4FM4B 1ZUKA 1V76A 1WXUA 2EJ9A 2XDPA 3M57A 1BBZA 2RJEA 3GNFB 2AZSA 3CCQQ 1PKSA 2O4XA 4X9CA 1GCQA 1VQOT 1FMKA 2ZPFB 3FC3A 1VA7A 2DXBA 2NUTB 3INZA 4FSSA 2DM1A 3X26B 1SPKA 2QK0A 2BTTA 4C92F 2LZ6B 2A08A 3QKJA 1TUGB 5IXBA 1IHWA 1RAIB 4VUBA 4BI8B 2E3IA 2FPEA 1M1KC 2CUDA 1G3WA 2DLPA 3DLMA 1NZ9A 2EKHA 1QVGA 4K11A 3G6EQ 4C92C 2FRWA 5D7UA 4RTUA 2HQHA 1Z9ZA 3CBOA 2V8KA 4L59A 4LXCA 4AFZC 2KGTA 3OYGA 2DFUA 1IXDA 2LNHB 2OAWA 4L6V5 1MMNA 2JN0A 4AT1B 4PJNA 2V1QA 4OMOA 4ZGDB 2IVWA 3OYHA 2YUNA 5KYNA 1VQNA 4D8KA 3FB9A 1VQ8T 2A36A 3JCMW 4M7DA 3E2UA 4J9FA 1HXDA 2W10A 2BIVA 1MHNA 1YI2T 3EH2A 2COYA 2QAZA 4E7JA 4J7FA 2MMPA 2EGEA 1G3SA 3QUIA 1GL5A 2K3BA 4EIKA 5HK0A 2ZPHB 1FX7A 2RM4A 1X6OA 5GANd 1HK9A 1EZZB 3UF4A 1VQ7T 4C92A 2GCXA 2K5IA 1X2KA 1WDXA 1GCPA 3TQ7P 4M7DD 1AEYA 2QEXT 2ESWA 4M7AE 4R0KA 2M16A 3A8HB 3OYIA 1ZBXA 2F1LA 4BD3A 2X3XD 4M7AA 1WNLA 4JRKA 2OAUA 1KSWA 2CP0A 1SHGA 4J6YA 1I1JA 2JM8A 3QWYA 2EGCA 1ZSGA 2D0NA 1YP5A 5GMKl 2EGAA 4PJOE 4XAXB 2CZ6B 5LJ5d 4RUGA 1VQPA 2K3XA 4EMHA 2EQUA 2D8JA 3V7SA 1IHVA 3I5SA 5FU6B 2L5QA 8AT1B 4PJOF 3S3NA 4RG2A 2IIMA 1RAHB 2PVDB 1K8AU 2EJFA 1AWXA 2A37A 3X28B 1JXMA 3URGA 2VXEA 3L2RA 1T3SA 2G6FX 5D6YA 2GF7A 2COWA 1QVFP 2HKNA 4QQGA 4GBQA 1NEBA 1QMCA 4OB2B 2RI2A 1YFNA 5LJ5f 3OYEA 2IPOB 2EQIA 2YWWA 1VQMT 5L23A 1H3ZA 3QG1A 2DL8A 1AHJB 3CCRT 4D8DA 4L5GA 2QI2A 1Q7YC 2DL7A 4ME7A 3KXTA 5GANf 2LCLA 5KYWA 5FWBA 1U3OA 1WJQA 3I5RA 2RHZA 4C5IA 2XMFA 5KYUA 4JDSA 2DNUA 1OEBA 1Y96A 4QQDA 2NYSA 1C0MA 1BYMA 1EX4A 5FROA 3C0CA 4BE0A 2CP5A 3KUFA 2KK4A 1D1BA 2ZPIB 1GCQC 3H6ZA 1K8AC 1CKAA 1Q86U 2YHTA 4J9CA 4E7IA 2LC4A 4ZNXA 2O31A 1YN8A 3UATA 5CKEA 2WSFE 1NLPC 4GY5A 3A1PA 1NPRA 3JB9I 1YJWQ 1AWOA 4HCCA 3M58A 3VS0A 1WFWA 4A53A 4QQ6A 2HDAA 4C92G 3P8HA 5GAN7 2X4XA 3BDLA 3EH1A 5GAOn 1SSHA 2LVMA 2AZVA 3HSBA 4PJOD 2MOXA 1MNDA 1IRXA 1AOJA 2QTXA 5GAN8 3UDCA 2DX1A 3OYFA 2F5TX 1N9SA 3WVDB 4JS4A 1U5SA 3GPLA 4KH0B 2QDYB 1PM3A 2XD0A 1WXTA 2QQSA 4CC7A 4DBHA 1VQ5T 1TSFA 3OW2A 3JCMX 1G3TA 3RESA 1WLPB 2KNBB 3OYLA 4J9GA 2FEIA 2G3RA 3CMET 3CCSQ 3PFSA 1VQ8Q 4R56A 5FU6C 4BE2A 3OYNA 1MGQA 4HCKA 4LDVA 2QQRA 2A7YA 1MMDA 4PKCC 4C0FA 4AMCA 2R58A 1VYVA 3BFMA 3V7CA 4M78F 5GMKi 2J06A 1YJ9Q 2DEUA 2CH4W 2KQWA 2ECZA 2EAYA 1QP3A 3CPWP 2YDLA 1D1CA 3EG9B 3JCMQ 2RB6A 1JJ2P 2GQIA 3LH5A 1VQ5A 2NUPB 4N0AA 1NYFA 3R6NA 3CXCP 1YITA
chains in the Genus database with same CATH topology
2PTKA 2M51A 5GJVB 2GTJA 2LX7A 3M0PA 5IH2A 1JU5C 2FG0A 1YNZA 1GFCA 2O9SA 2BZYA 2YT6A 2LQWA 2J6OA 2KXDA 1ABQA 1UECA 1V1CA 2J05A 2RN8A 3M0UA 3PVLA 3I35A 5FW9A 1AZEA 3VS5A 1NM7A 1AD5A 2NWMA 3FJ5A 3UA7A 2L2PA 1G2BA 1GRIA 3H0IA 3VS6A 3H0FA 4LN2A 2GNCA 1YWOA 2ROTA 2DMOA 4OMMA 1RI9A 1X6GA 1A0NB 1M3CA 2RF0A 1QLYA 1WA7A 1UG1A 3VRZA 2RQVA 1BK2A 4F14A 5IHIA 1WI7A 2DJQA 4OMPA 1WIEA 1WXBA 1UTIA 1M27C 4JJDA 4J9DA 2KRNA 2CT4A 4JZ3A 1Z9QA 5FWCA 1JQQA 3VS7A 1B07A 4AG1C 2DILA 2JMAA 3NMZC 2MIOA 4Y92A 4JPBW 2VWFA 3TSWA 4AFUC 2JS0A 1M8MA 2KE9A 2KRMA 2V1RA 2F2VA 1M3AA 1X6BA 1IO6A 1RLQC 4AFSC 3JV3A 1TUCA 2EYYA 3RNJA 3QWXX 1T3LA 2CH4A 2LP5A 4DEXA 2SEMA 1M3BA 2HCKA 1S1NA 2JTEA 2DBMA 2LJ1A 1GFDA 1NEGA 1ZX6A 1ZUKA 1K0XA 1WXUA 1PRMC 2W0ZA 1BBZA 2CREA 1B3QA 1VYTA 1X2QA 2J6FA 2AZSA 2NUZA 1PKSA 1EFNA 2K79A 2KT8A 2KT1A 3PE0A 5IHNA 1GCQA 2KBTA 1UGVA 1FMKA 5GJWB 1VA7A 3I9QA 4FSSA 2DM1A 1SPKA 2AK5A 2RQRA 2VKNA 4RTXA 2BTTA 1UHCA 2LZ6B 2A08A 4Z89A 2C0IA 5IXBA 2DVJA 4IIOA 4A63B 4F16A 2FPEA 2X3WD 2CUDA 2YUQA 2DLPA 2F2WA 2C0OA 2EKHA 1SHFA 4WCIA 4K11A 1OV3A 1NLOC 2DE0X 4JJCA 2KEAA 2FRWA 4RTUA 2RNAA 1Z9ZA 1RUWA 2ROLA 2A28A 2K2MA 1CSKA 3M0RA 2KYMA 4HXJA 4AFZC 2KGTA 4CC3A 2LNHB 2OAWA 4HVVA 3REBB 1J3TA 1AWJA 2EYWA 4ORZA 3REAB 2V1QA 3A98A 4OMOA 1PRLC 1WX6A 1I0CA 2GTOA 1RLPC 1H8KA 2YUNA 1ZLMA 2JW4A 4D8KA 1W1FA 2A36A 5I11A 2HSPA 4J9FA 2O9VA 2W10A 2OI3A 2LJ0A 2L3QA 2YUOA 2EGEA 4QT7A 2LMJA 3M0SA 3GBQA 1GL5A 2K3BA 4EIKA 3THKA 2DL3A 2CDTA 2PZ1A 1TG0A 2EYXA 2KYBA 3H41A 4J9HA 3UF4A 2LQNA 1T0JA 4GLMA 1X2KA 1WDXA 1GCPA 1AEYA 2K9GA 2ESWA 3TSZA 1ZBJA 4R0KA 4CC4B 1XOVA 1MV3A 1UUEA 2VVKA 2ED1A 1YWPA 2X3XD 1HD3A 1KSWA 1SHGA 2JM8A 1I1JA 3QWYA 2O88A 2EPDA 1E6HA 2EGCA 2D0NA 1ZSGA 1YP5A 2ENMA 2EGAA 1PHTA 2CT3A 4RUGA 3U23A 5I22A 1JEGA 3IQLA 2GGRA 2D8HA 2D8JA 2KRSA 1JXOA 1GBQA 2DA9A 1X27A 4HVUA 2L0AA 3I5SA 4LNPA 1AWWA 1OPKA 1QWEA 1CKBA 1TUDA 1UDLA 2IIMA 1H3HA 1UE9A 1QWFA 1ARKA 3KFVA 2CSQA 1AWXA 1VYUA 1UHFA 1UFFA 2A37A 3SHWA 3M0QA 1HSQA 2DL5A 1JXMA 2LCSA 3NGPA 1T3SA 2G6FX 4J9EA 3SEMA 1BB9A 1GBRA 4GBQA 2L3PA 1NEBA 1K76A 2RQWA 1NYGA 2LJ3A 1OPLA 2HBWA 4HVWA 2DL4A 3O5ZA 2HEQA 1QKXA 2EQIA 2H8HA 5L23A 1Y0MA 2DL8A 4DEYA 1UJ0A 4E6RA 2SRCA 4D8DA 2EBPA 3NHNA 2F2XA 2MCNA 1QCFA 3EG3A 2DL7A 1K1ZA 2DYBA 2KR3A 2FPDA 2EVRA 5FWBA 1U3OA 3VS4A 1U06A 3I5RA 2QDLA 1N5ZA 4LUDA 2XMFA 1Y57A 1PWTA 1OOTA 2JMCA 2FRYA 2GBQA 3EG0A 2BZ8A 3ZL7C 2DNUA 3EGUA 1OEBA 3UA6A 2AKLA 2KROA 4OMLA 1M30A 2RMOA 1T0HA 2FO0A 4RTWA 1MUZA 3EHRA 3C0CA 2CSIA 5IHKA 1GCQC 5IXFA 5HCKA 3VRYA 2AKKA 2B86A 1BU1A 1CKAA 4J9CA 3VS3A 4ZNXA 1I07A 4KRTA 2O31A 1K0SA 2CUBA 3NPFA 2DRKA 1YN8A 4OMQA 3UATA 4CC2A 1HJDA 1NLPC 1UJYA 1JO8A 2OJ2A 2DRMA 2D1XA 5EC7A 1AWOA 1G83A 3VS0A 4M4ZA 1WFWA 1QKWA 4OMNA 5ECAA 2HDAA 4RTZA 1PNJA 3EG1A 2EW3A 2L3SA 1SSHA 2AZVA 1ZUUA 4IIMA 2K6DA 2MOXA 2JT4A 1AOJA 2DX1A 2J7IA 2YSQA 2JM9A 1NG2A 3VS1A 1AZGB 1MV0B 2O2OA 1U5SA 3H0HA 2I0NA 2K7AA 4AG2C 3ULRB 1W6XA 2KXCA 4ESRA 1W70A 2E5KA 4J9IA 1WXTA 1WYXA 4X1VA 2BZXA 4CC7A 3PVQA 2ABLA 3VS2A 1WLPB 1LCKA 1PKTA 2KNBB 4J9GA 4Z88A 4F17A 1E7OA 2FEIA 1K4US 1ZUYA 1ABOA 1X69A 4Z8AA 3RBBB 4HCKA 4J9BA 4JZ4A 3TVTA 1K9AA 2EYZA 3EG2A 1SRMA 2C0TA 3CQTA 4RTYA 3EHQA 1VYVA 4JJBA 2J06A 2RQUA 4RTVA 1X43A 2J6KA 2CH4W 1KFZA 1KJWA 3M0TA 2ECZA 1E6GA 2DF6A 1FYNA 1KIKA 2P4RA 2RQTA 2YDLA 4LUEA 1SRLA 4LE9A 4RTTA 2RPNA 1SEMA 1H92A 2PNIA 2JXBA 1YCSB 2FPFA 2GQIA 3LH5A 1NYFA 2DBKA 2M0YA 3R6NA 2ED0A 2YUPA 2JS2A 1AVZC 4AFQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTK A;  2M51 A;  5GJV B;  2GTJ A;  2LX7 A;  3M0P A;  5IH2 A;  1JU5 C;  2FG0 A;  1YNZ A;  1GFC A;  2O9S A;  2BZY A;  2YT6 A;  2LQW A;  2J6O A;  2KXD A;  1ABQ A;  1UEC A;  1V1C A;  2J05 A;  2RN8 A;  3M0U A;  3PVL A;  3I35 A;  5FW9 A;  1AZE A;  3VS5 A;  1NM7 A;  1AD5 A;  2NWM A;  3FJ5 A;  3UA7 A;  2L2P A;  1G2B A;  1GRI A;  3H0I A;  3VS6 A;  3H0F A;  4LN2 A;  2GNC A;  1YWO A;  2ROT A;  2DMO A;  4OMM A;  1RI9 A;  1X6G A;  1A0N B;  1M3C A;  2RF0 A;  1QLY A;  1WA7 A;  1UG1 A;  3VRZ A;  2RQV A;  1BK2 A;  4F14 A;  5IHI A;  1WI7 A;  2DJQ A;  4OMP A;  1WIE A;  1WXB A;  1UTI A;  1M27 C;  4JJD A;  4J9D A;  2KRN A;  2CT4 A;  4JZ3 A;  1Z9Q A;  5FWC A;  1JQQ A;  3VS7 A;  1B07 A;  4AG1 C;  2DIL A;  2JMA A;  3NMZ C;  2MIO A;  4Y92 A;  4JPB W;  2VWF A;  3TSW A;  4AFU C;  2JS0 A;  1M8M A;  2KE9 A;  2KRM A;  2V1R A;  2F2V A;  1M3A A;  1X6B A;  1IO6 A;  1RLQ C;  4AFS C;  3JV3 A;  1TUC A;  2EYY A;  3RNJ A;  3QWX X;  1T3L A;  2CH4 A;  2LP5 A;  4DEX A;  2SEM A;  1M3B A;  2HCK A;  1S1N A;  2JTE A;  2DBM A;  2LJ1 A;  1GFD A;  1NEG A;  1ZX6 A;  1ZUK A;  1K0X A;  1WXU A;  1PRM C;  2W0Z A;  1BBZ A;  2CRE A;  1B3Q A;  1VYT A;  1X2Q A;  2J6F A;  2AZS A;  2NUZ A;  1PKS A;  1EFN A;  2K79 A;  2KT8 A;  2KT1 A;  3PE0 A;  5IHN A;  1GCQ A;  2KBT A;  1UGV A;  1FMK A;  5GJW B;  1VA7 A;  3I9Q A;  4FSS A;  2DM1 A;  1SPK A;  2AK5 A;  2RQR A;  2VKN A;  4RTX A;  2BTT A;  1UHC A;  2LZ6 B;  2A08 A;  4Z89 A;  2C0I A;  5IXB A;  2DVJ A;  4IIO A;  4A63 B;  4F16 A;  2FPE A;  2X3W D;  2CUD A;  2YUQ A;  2DLP A;  2F2W A;  2C0O A;  2EKH A;  1SHF A;  4WCI A;  4K11 A;  1OV3 A;  1NLO C;  2DE0 X;  4JJC A;  2KEA A;  2FRW A;  4RTU A;  2RNA A;  1Z9Z A;  1RUW A;  2ROL A;  2A28 A;  2K2M A;  1CSK A;  3M0R A;  2KYM A;  4HXJ A;  4AFZ C;  2KGT A;  4CC3 A;  2LNH B;  2OAW A;  4HVV A;  3REB B;  1J3T A;  1AWJ A;  2EYW A;  4ORZ A;  3REA B;  2V1Q A;  3A98 A;  4OMO A;  1PRL C;  1WX6 A;  1I0C A;  2GTO A;  1RLP C;  1H8K A;  2YUN A;  1ZLM A;  2JW4 A;  4D8K A;  1W1F A;  2A36 A;  5I11 A;  2HSP A;  4J9F A;  2O9V A;  2W10 A;  2OI3 A;  2LJ0 A;  2L3Q A;  2YUO A;  2EGE A;  4QT7 A;  2LMJ A;  3M0S A;  3GBQ A;  1GL5 A;  2K3B A;  4EIK A;  3THK A;  2DL3 A;  2CDT A;  2PZ1 A;  1TG0 A;  2EYX A;  2KYB A;  3H41 A;  4J9H A;  3UF4 A;  2LQN A;  1T0J A;  4GLM A;  1X2K A;  1WDX A;  1GCP A;  1AEY A;  2K9G A;  2ESW A;  3TSZ A;  1ZBJ A;  4R0K A;  4CC4 B;  1XOV A;  1MV3 A;  1UUE A;  2VVK A;  2ED1 A;  1YWP A;  2X3X D;  1HD3 A;  1KSW A;  1SHG A;  2JM8 A;  1I1J A;  3QWY A;  2O88 A;  2EPD A;  1E6H A;  2EGC A;  2D0N A;  1ZSG A;  1YP5 A;  2ENM A;  2EGA A;  1PHT A;  2CT3 A;  4RUG A;  3U23 A;  5I22 A;  1JEG A;  3IQL A;  2GGR A;  2D8H A;  2D8J A;  2KRS A;  1JXO A;  1GBQ A;  2DA9 A;  1X27 A;  4HVU A;  2L0A A;  3I5S A;  4LNP A;  1AWW A;  1OPK A;  1QWE A;  1CKB A;  1TUD A;  1UDL A;  2IIM A;  1H3H A;  1UE9 A;  1QWF A;  1ARK A;  3KFV A;  2CSQ A;  1AWX A;  1VYU A;  1UHF A;  1UFF A;  2A37 A;  3SHW A;  3M0Q A;  1HSQ A;  2DL5 A;  1JXM A;  2LCS A;  3NGP A;  1T3S A;  2G6F X;  4J9E A;  3SEM A;  1BB9 A;  1GBR A;  4GBQ A;  2L3P A;  1NEB A;  1K76 A;  2RQW A;  1NYG A;  2LJ3 A;  1OPL A;  2HBW A;  4HVW A;  2DL4 A;  3O5Z A;  2HEQ A;  1QKX A;  2EQI A;  2H8H A;  5L23 A;  1Y0M A;  2DL8 A;  4DEY A;  1UJ0 A;  4E6R A;  2SRC A;  4D8D A;  2EBP A;  3NHN A;  2F2X A;  2MCN A;  1QCF A;  3EG3 A;  2DL7 A;  1K1Z A;  2DYB A;  2KR3 A;  2FPD A;  2EVR A;  5FWB A;  1U3O A;  3VS4 A;  1U06 A;  3I5R A;  2QDL A;  1N5Z A;  4LUD A;  2XMF A;  1Y57 A;  1PWT A;  1OOT A;  2JMC A;  2FRY A;  2GBQ A;  3EG0 A;  2BZ8 A;  3ZL7 C;  2DNU A;  3EGU A;  1OEB A;  3UA6 A;  2AKL A;  2KRO A;  4OML A;  1M30 A;  2RMO A;  1T0H A;  2FO0 A;  4RTW A;  1MUZ A;  3EHR A;  3C0C A;  2CSI A;  5IHK A;  1GCQ C;  5IXF A;  5HCK A;  3VRY A;  2AKK A;  2B86 A;  1BU1 A;  1CKA A;  4J9C A;  3VS3 A;  4ZNX A;  1I07 A;  4KRT A;  2O31 A;  1K0S A;  2CUB A;  3NPF A;  2DRK A;  1YN8 A;  4OMQ A;  3UAT A;  4CC2 A;  1HJD A;  1NLP C;  1UJY A;  1JO8 A;  2OJ2 A;  2DRM A;  2D1X A;  5EC7 A;  1AWO A;  1G83 A;  3VS0 A;  4M4Z A;  1WFW A;  1QKW A;  4OMN A;  5ECA A;  2HDA A;  4RTZ A;  1PNJ A;  3EG1 A;  2EW3 A;  2L3S A;  1SSH A;  2AZV A;  1ZUU A;  4IIM A;  2K6D A;  2MOX A;  2JT4 A;  1AOJ A;  2DX1 A;  2J7I A;  2YSQ A;  2JM9 A;  1NG2 A;  3VS1 A;  1AZG B;  1MV0 B;  2O2O A;  1U5S A;  3H0H A;  2I0N A;  2K7A A;  4AG2 C;  3ULR B;  1W6X A;  2KXC A;  4ESR A;  1W70 A;  2E5K A;  4J9I A;  1WXT A;  1WYX A;  4X1V A;  2BZX A;  4CC7 A;  3PVQ A;  2ABL A;  3VS2 A;  1WLP B;  1LCK A;  1PKT A;  2KNB B;  4J9G A;  4Z88 A;  4F17 A;  1E7O A;  2FEI A;  1K4U S;  1ZUY A;  1ABO A;  1X69 A;  4Z8A A;  3RBB B;  4HCK A;  4J9B A;  4JZ4 A;  3TVT A;  1K9A A;  2EYZ A;  3EG2 A;  1SRM A;  2C0T A;  3CQT A;  4RTY A;  3EHQ A;  1VYV A;  4JJB A;  2J06 A;  2RQU A;  4RTV A;  1X43 A;  2J6K A;  2CH4 W;  1KFZ A;  1KJW A;  3M0T A;  2ECZ A;  1E6G A;  2DF6 A;  1FYN A;  1KIK A;  2P4R A;  2RQT A;  2YDL A;  4LUE A;  1SRL A;  4LE9 A;  4RTT A;  2RPN A;  1SEM A;  1H92 A;  2PNI A;  2JXB A;  1YCS B;  2FPF A;  2GQI A;  3LH5 A;  1NYF A;  2DBK A;  2M0Y A;  3R6N A;  2ED0 A;  2YUP A;  2JS2 A;  1AVZ C;  4AFQ C; 
#chains in the Genus database with same CATH topology
 4M77 C;  2M51 A;  2GTJ A;  2K2V A;  2LX7 A;  3L1A A;  5A0L A;  1Q7Y U;  3RIR A;  1JU5 C;  2DIG A;  2JNG A;  1HYO A;  2O9S A;  1YIJ Q;  1Q86 C;  5CVI A;  1ABQ A;  1I8F A;  4IUQ A;  5GAO q;  5KYW B;  1VQO Q;  3BDU A;  4RMO A;  4B9W A;  2JJ9 A;  1AD5 A;  3UA7 A;  4XTW A;  1O9S A;  4PJO G;  4M77 A;  1ZSZ A;  4KGZ B;  1MMA A;  4E2F B;  1GRI A;  2H3J A;  1VQ6 A;  4MDW A;  3MEU A;  1WHG A;  5LJ3 j;  3RKX A;  1YWO A;  2CS7 A;  2ROT A;  3NTK A;  1M1K R;  1X6G A;  3MHX A;  4E7H A;  3BE3 A;  5KE3 A;  4OVA A;  1WGS A;  4LDX A;  4M78 A;  4OMF B;  3NFC A;  2FZG B;  5IHI A;  1WI7 A;  4OP0 A;  4OMP A;  4IUR A;  1OUL A;  1M27 C;  4J9D A;  2CT4 A;  4JZ3 A;  3OYC A;  2MAM A;  3G71 Q;  1VQN Q;  1QCO A;  3NMZ C;  2F69 A;  1LNX A;  4M78 E;  3QZ5 B;  5A0G A;  1NBE B;  1OZ2 A;  1XJW B;  2M1H A;  4KUD K;  3LX7 A;  2V1R A;  1RAG B;  3HKS A;  4C92 D;  2AHJ B;  2XID A;  1I4K 1;  1KK7 A;  3I56 T;  2XG8 D;  2DXC A;  3QWX X;  3RDV A;  1Q86 R;  1QVG P;  4O5V A;  2VGM A;  2HCK A;  1S1N A;  3DB3 A;  2JTE A;  1VQL A;  2RK1 A;  1GFD A;  2CKK A;  1NEG A;  5KYU B;  1PRM C;  2W0Z A;  2Y4X A;  1PC0 A;  1EFN A;  1LPL A;  2K79 A;  3PE0 A;  5IHN A;  4PFO A;  1VQ4 Q;  5I2M A;  3I9Q A;  1D09 B;  2RQR A;  1RAC B;  2VKN A;  4WTO B;  1UHC A;  4Z89 A;  2C0I A;  4NS5 A;  4F7U F;  3JCM c;  4A63 B;  4QVC A;  4BY6 C;  3CD6 Q;  4V2S A;  2F2W A;  1SHF A;  3EGX A;  3RKW A;  3AT1 B;  4JJC A;  1NLO C;  1QQJ A;  4PJJ A;  5FU7 C;  1KQS P;  1R77 A;  1RUW A;  2LQK A;  4XTX A;  5CIU A;  1M1G A;  1CSK A;  2KAF A;  2KYM A;  4HXJ A;  2H3E B;  3EG9 A;  4HVV A;  3REB B;  1J3T A;  2F5K A;  4ORZ A;  1YJN A;  1X75 C;  2LT1 A;  3A98 A;  1I0C A;  1ZLM A;  2O4X B;  2JW4 A;  1XTD A;  3LGF A;  1W1F A;  4FYX B;  5AYF A;  5I11 A;  3JRZ A;  3EFR A;  3PT9 A;  2E65 A;  2E5Q A;  2OI3 A;  4C92 E;  2L3Q A;  3RMQ A;  1K73 U;  4A54 A;  4PLL A;  4EMK C;  1WHJ A;  1QVG S;  1TG0 A;  2KYB A;  1KQ2 A;  3H41 A;  1PD0 A;  1WPY A;  2DTO A;  1G8X A;  3OYY A;  3RKY A;  1QP2 A;  1NJI U;  3QBY A;  2MI6 A;  4MZP A;  3CC7 Q;  1IB8 A;  2VVK A;  2ED1 A;  2VAS A;  2RJC A;  3MP8 A;  1KQS A;  5GAM g;  1G5V A;  2ENM A;  2ZPE B;  1IZ6 A;  4J83 A;  1PHT A;  2AIR B;  1YIJ T;  3OBY A;  2YLC A;  5GAM d;  2GGR A;  2D8H A;  5KCO A;  1GBQ A;  1X27 A;  4OF1 A;  4PFZ A;  3CCQ T;  5CQX A;  3QJ6 A;  3VKI A;  1AWW A;  1KC8 U;  1YJW A;  4ZN1 A;  1TUD A;  3M59 A;  1M2V B;  4FSX A;  2GQV A;  1UE9 A;  4KH1 B;  4C5G A;  3PNW C;  3R6O A;  3M5A A;  1YJ9 T;  2KY9 A;  2RHU A;  1UFF A;  1YHQ T;  4NOY A;  1HSQ A;  3OS2 A;  3CCL T;  2DL5 A;  3CCE Q;  2WSE E;  3C95 A;  3FRN A;  5CAI A;  4MDX A;  3EFS A;  3JCM b;  3OA6 A;  1GBR A;  1KD1 R;  3OMC A;  3OB9 A;  2RQW A;  1UGR B;  1VQ9 Q;  1OPL A;  5KYY B;  4RG8 A;  4II1 A;  2E64 A;  4HVW A;  3O5Z A;  3ER0 A;  2A0F B;  3CCJ A;  3CD6 T;  1BCO A;  2HEQ A;  3EAE A;  2H8H A;  4C0Z A;  4QVD A;  4E6R A;  2EBP A;  1AT1 B;  2F2X A;  3CPW S;  2P84 A;  1K1Z A;  2KR3 A;  4FCY A;  3VS4 A;  2QDL A;  2CZ1 B;  2DYI A;  1FMV A;  1RL2 A;  1OOT A;  4M75 C;  3EG0 A;  3CCL Q;  1V29 B;  3EGU A;  1M5Q 1;  2AKL A;  4FW1 A;  1M30 A;  3C94 A;  2RMO A;  3CMA T;  3HFO A;  4TVR A;  5C0M A;  1ZSZ B;  1Q82 R;  4B6M A;  1MUZ A;  5M9O A;  2CSI A;  3GNG A;  1KIK A;  2AKK A;  3CEY A;  1I07 A;  4M77 B;  4M75 A;  1K0S A;  3NPF A;  1VQM Q;  2OTJ T;  2JUF A;  4OMQ A;  4CC2 A;  3G4S A;  1HJD A;  2XHC A;  6AT1 B;  1MNE A;  4JLI A;  3A8G B;  4DBQ A;  5LJ5 e;  4LD9 K;  3OW2 P;  2L89 A;  1S72 T;  2QQA A;  2K5L A;  4OB1 B;  2EQJ A;  2L8D A;  1S72 A;  4RTZ A;  1OQK A;  2JTF A;  2OTJ Q;  2EQK A;  2DD5 A;  3EG1 A;  3MPU B;  2EW3 A;  1TH7 A;  1WHM A;  2L3S A;  4IIM A;  1TOV A;  3SWN A;  1DJ7 B;  4PJO C;  2DJZ A;  5EG2 A;  2E41 A;  1NG2 A;  1I5O B;  1UGS B;  2KDS A;  3EFO A;  4M78 D;  5GAN h;  1NE8 A;  3EGD B;  4C5E A;  1VOM A;  3LLR A;  2O2O A;  2HL3 A;  5GMK m;  4E7S A;  2RA2 A;  3CCR A;  2K7A A;  4M75 E;  3G4S T;  1W6X A;  2E5K A;  3G6E T;  2BZX A;  3PTA A;  3VS2 A;  3L42 A;  2P0K A;  5CKD A;  2IG0 A;  4E7Z A;  1ZUY A;  4OB3 B;  1X69 A;  4F7U G;  2K3Y A;  2E4H A;  2X35 A;  3LWH A;  1K73 R;  3G71 A;  3EG2 A;  4DBF A;  3CCQ A;  1N9R A;  4Q5W A;  2C0T A;  3CQT A;  1KD1 U;  1VQ6 T;  4RTY A;  2QEX Q;  3CC2 Q;  2XIC A;  1X43 A;  3HRS A;  3CC2 T;  1M9S A;  3M0T A;  2QXF A;  1E6G A;  2DF6 A;  3OYA A;  2P4R A;  3MJX A;  2RQT A;  2XI9 A;  4JRI A;  3CC4 T;  2HMA A;  2RPN A;  3MO8 A;  4X9D A;  2FPF A;  2EQM A;  2K57 A;  2YUP A;  2E6Z A;  2JS2 A;  4AFQ C;  3D7S B;  3QPH A;  5GJV B;  4FT4 A;  3X24 B;  3L2W A;  1IGQ A;  2FG0 A;  4FU6 A;  4E7K A;  3P8B B;  1RAA B;  3JCM g;  2YT6 A;  2LQW A;  2HL5 C;  1VQ4 A;  2KXD A;  4ZGJ B;  2JVV A;  2E12 A;  3CME Q;  3I35 A;  5FW9 A;  1AZE A;  3FJ5 A;  2L2P A;  3X20 B;  1G2B A;  3L2Q A;  1RAE B;  1K8A R;  1N8R C;  4PJO B;  1M90 R;  4LN2 A;  2BKD N;  2E3H A;  4M75 D;  1A0N B;  1M3C A;  5KYY A;  2RF0 A;  2HAX A;  2P0P A;  4MML A;  1QLY A;  2EYQ A;  2RHX A;  2HZY A;  3VRZ A;  2RQV A;  5KYX A;  4ELY C;  4F14 A;  2XK0 A;  5GMK e;  4F7U A;  2DJQ A;  1U1T A;  2HBP A;  3ASK A;  2BUD A;  1UTI A;  5CK9 A;  4JJD A;  3GP8 A;  1VQN T;  3JB9 G;  2WAC A;  2ZAE A;  1VQK T;  1JQQ A;  4M77 D;  4QKU A;  3KBG A;  4AG1 C;  2JMA A;  3A8O B;  4Y92 A;  3EGX B;  4JPB W;  2E1H A;  2VWF A;  5GAN 5;  2KSS A;  1ACM B;  1C6V X;  1B34 B;  2JS0 A;  4N4G A;  2KE9 A;  3QYH B;  1SSF A;  3MCA B;  3J7A F;  1Y7X A;  1M3A A;  4X34 A;  2QAS A;  5LJ5 g;  3CCM A;  4PJO A;  1WQ7 A;  1RLQ C;  1OYX A;  1VQP Q;  1M4Z A;  2M0O A;  3M56 A;  3RNJ A;  2FL7 A;  4XU3 A;  5FRN A;  2SEM A;  3DB4 A;  2K4Y A;  3MEV A;  4BAC A;  2DBM A;  3V8J A;  2LJ1 A;  4BDZ A;  2YLB A;  3OYJ A;  4D6W A;  2XDB A;  2CZ0 B;  2KI7 A;  1B3Q A;  1VYT A;  1X2Q A;  1N8R R;  2NUZ A;  3V8K A;  3PGG A;  2KT1 A;  2KBT A;  3JCM V;  1UGV A;  5GJW B;  1NPP A;  3S3M A;  3RUX A;  2DTI A;  2AK5 A;  2CZ7 B;  3CXC A;  5GAN 6;  1C1A A;  1TTH B;  1YHQ A;  2DVJ A;  4IIO A;  4M7A B;  5AT1 B;  1OX8 A;  2YUQ A;  3SD4 A;  1K9M U;  1OV3 A;  1N6A A;  2DE0 X;  5IT9 E;  2KEA A;  2CGH A;  3FEO A;  4IUU A;  4C8Q F;  2CP3 A;  2DXT A;  3CCU A;  2VV5 A;  2RNA A;  5IN1 A;  1I81 A;  2A28 A;  5FU7 B;  2X4Y A;  4XTZ A;  2FYK A;  2RHI A;  3H9N A;  3ZFJ A;  4CRI A;  1WHH A;  2JOY A;  4PJM A;  1AWJ A;  3REA B;  4QVZ A;  4PL6 A;  1PRL C;  1WX6 A;  4M7A G;  3CCE A;  2GTO A;  1RLP C;  3SDZ A;  1H8K A;  5GAO p;  2DIQ A;  4FYW B;  3QZ9 B;  2CYZ B;  3CCS T;  2PUK B;  3QHS A;  2FHD A;  3CC4 A;  2LJ0 A;  5GAM j;  3M54 A;  2MWO A;  3CCJ Q;  4QT7 A;  2LMJ A;  2D9T A;  3GBQ A;  2XU8 A;  3THK A;  3OYB A;  3EFO B;  2EWN A;  4BI3 A;  4J9H A;  1BI0 A;  4C0D B;  2LQN A;  1T0J A;  4KT0 E;  4GLM A;  2FB7 A;  1IRE B;  3HRU A;  3MP6 A;  5GAN g;  1M1K U;  1TU0 B;  3VV0 A;  5LJ3 h;  1JJ2 A;  1ZBJ A;  3JB9 D;  4NL2 A;  4A4F A;  1XOV A;  3E19 A;  1MV3 A;  4KGX B;  5GMK j;  1Q95 G;  2EIF A;  2O88 A;  1XQH A;  4ANJ A;  1KHC A;  3PMT A;  4PNO A;  3UWN A;  1VQK Q;  1D3B B;  4YTL A;  4M7D C;  3U23 A;  4J6X A;  1H64 1;  5I22 A;  5KE2 A;  2RI3 A;  1JEG A;  1D0Y A;  3IQL A;  1YJW T;  1QVP A;  2LX9 A;  1JXO A;  1ZHI A;  1Q7Y R;  3G4S Q;  4HVU A;  4M7A C;  5L8R E;  2DTH A;  1OPK A;  2HNI A;  4J7I A;  1QWE A;  1QW1 A;  1UDL A;  2LCC A;  1VQ7 A;  4Y91 A;  2EKO A;  1EIF A;  3GLX A;  3FLG A;  2CSQ A;  3JCM e;  3CCS A;  3E9G A;  2JZ2 A;  1VQ8 A;  3SHW A;  3M0Q A;  4DOV A;  2LCS A;  4DQ2 A;  4JLG A;  3SEM A;  1VQP T;  1UEB A;  3C12 A;  1I5L A;  5FRM A;  4BI4 A;  3JSC A;  3TEE A;  1JBM A;  5C6S A;  2HBW A;  3CCR Q;  2DL4 A;  1YJ9 A;  2P0Q A;  3JCM d;  3UT1 A;  3G6E A;  3HRT A;  4E7L A;  1PSE A;  4FL6 A;  1UJ0 A;  2HQE A;  4LDW A;  2YRD A;  2SRC A;  4Y28 E;  2Y4Y A;  3NHN A;  2MCN A;  3EG3 A;  1VQ5 Q;  4ELZ C;  2EVR A;  3GF5 A;  1N5Z A;  1R0B G;  3CCU T;  4LDY A;  3EGD A;  1XNI A;  1PWT A;  2ZZD A;  4XU1 A;  2JMC A;  2DZC A;  2FRY A;  3VJP A;  2BZ8 A;  1Q82 C;  3DLL A;  3V8L A;  4A4G A;  1YIJ A;  3VYG A;  1T0H A;  4M75 B;  3PMI A;  4C8Q G;  5GAM f;  2QA4 Q;  2FO0 A;  3EHR A;  4C8Q C;  2XDD A;  4MZT A;  4IUP A;  4KRT A;  2DVE A;  5J39 A;  2CUB A;  3OYK A;  2DRK A;  2MF2 A;  4PLI A;  4QW2 A;  1VQ6 Q;  2V8J A;  3DKM A;  3TU4 K;  3LW5 E;  3E1S A;  3HP9 A;  4B9X A;  1SKU B;  2AT1 B;  1JO8 A;  5GAO m;  3PIP A;  1BIB A;  2DRM A;  2D1X A;  4HKE A;  4M4Z A;  3LWI A;  4ZN3 A;  1QKW A;  4OMN A;  2A3L A;  1QCN A;  3MEA A;  3CMA A;  3H8Z A;  1LVK A;  3CME A;  4FIB A;  2VC8 A;  2K6D A;  2M02 A;  3CCM T;  5LJ5 j;  2JT4 A;  1D0X A;  4M77 E;  1W4S A;  1Q81 U;  2YSQ A;  2JM9 A;  1AZG B;  5HKC A;  1M8V A;  1MV0 B;  2FZC B;  1M90 U;  3H0H A;  2I0N A;  3M9Q A;  4A4K A;  3JCM J;  3HL8 A;  2MWP A;  2KXC A;  1WQW A;  4ESR A;  4J9I A;  4P5N A;  3PVQ A;  4M7A F;  5GAM h;  3QJY A;  1LCK A;  1PKT A;  4F17 A;  4Z88 A;  2V26 A;  1E7O A;  3G7Z A;  2BE7 D;  3OY9 A;  3RBB B;  4C8Q A;  3JB9 J;  1BIA A;  3FJP A;  2HD0 A;  5CKB A;  1MMG A;  3X25 B;  1K9A A;  2EYZ A;  5A2Q E;  2HQX A;  3SB2 A;  1BI3 A;  4N0A C;  2DXU A;  1Q81 C;  1KD1 C;  1JJ2 S;  2RQU A;  4RTV A;  8ATC B;  2J6K A;  1KFZ A;  1KJW A;  4F7U B;  2LTO A;  4LUE A;  3GOX A;  4C8Q D;  1YCS B;  5GAN 2;  3A8M B;  3ME9 A;  2M0Y A;  2PVO B;  3LYI A;  3OBW A;  3C4S A;  2PTK A;  2KMT A;  1PD1 A;  2MK5 A;  3A5Z B;  3M0P A;  4EMG A;  2EJG A;  3S6W A;  1GFC A;  2I2L A;  2DAQ A;  2WSC E;  2J6O A;  2CP2 A;  3CCV A;  1UEC A;  1V1C A;  2RN8 A;  1YBY A;  1YJN Q;  3PVL A;  4PK4 A;  5LJ3 e;  3J81 E;  1GXI E;  1PG5 B;  2NWM A;  2ZCF B;  3OMG A;  4M78 G;  2QGG A;  1KQS S;  2GFU A;  1YHQ Q;  1IGU A;  3H0F A;  3NTI A;  1PSF A;  2GNC A;  1YIT T;  2P4T A;  5GAO r;  2DMO A;  3CBP A;  1RI9 A;  3ZBD A;  5LL6 S;  5LJ5 h;  4C8Q B;  3JCM f;  1VQL T;  1TXQ A;  2RD1 A;  1BK2 A;  1Q81 R;  4XQ3 A;  3BW1 A;  3WXM B;  1WIE A;  3JB9 F;  1SF9 A;  4KUI A;  2LDM A;  4PJL A;  1G3Y A;  4FW2 A;  3I55 Q;  3ZEH A;  3QSU A;  4RKU E;  5LJ3 f;  1Z9Q A;  3OSS C;  1Y71 A;  5FWC A;  4DBR A;  3TRE A;  4CI0 C;  1B07 A;  2FVU A;  2DIL A;  5A0D A;  1YJN T;  2MIO A;  1ZA1 B;  3CC7 A;  3TSW A;  4BUG A;  2YRC A;  3G1J A;  2RK2 A;  3WVE B;  3CC4 Q;  4C92 B;  5KCH A;  2NUP A;  1BKB A;  1VQ9 T;  1X6B A;  1IO6 A;  3QII A;  4ATO A;  2VUB A;  3JV3 A;  1KHI A;  1TUC A;  1T3L A;  1R0C B;  2CH4 A;  2PUO B;  2LP5 A;  4DEX A;  1OZ3 A;  1QVF A;  1M3B A;  2QQ9 A;  3NTH A;  1YI2 A;  1TWB A;  5FLX E;  1ZX6 A;  4M7D E;  1K0X A;  2DZ9 A;  3HHT B;  1ZSZ C;  2M9U A;  2CRE A;  1K73 C;  2QYZ A;  2J6F A;  4JRQ A;  2L3R A;  4MMK A;  2KT8 A;  2KVQ G;  5DM7 R;  4PFP A;  3LH0 A;  5I2S A;  4MZM A;  3OS1 A;  2ZGW A;  4DA4 A;  4RTX A;  1FWZ A;  2LRQ A;  1WHL A;  4M78 C;  1RAD B;  4F16 A;  3VYH B;  3QXE B;  5KH6 A;  4IUT A;  4NL3 A;  2X3W D;  2ZPB B;  1UGQ B;  2RO0 A;  2C0O A;  2D0Q B;  4WCI A;  3I56 A;  4FYV B;  3M4G A;  2XKO C;  7AT1 B;  3MP1 A;  1N8R U;  1OU9 A;  2E70 A;  2ROL A;  1VQ7 Q;  2K2M A;  3M0R A;  3CCE T;  3HTR A;  2D6F A;  4CC3 A;  2OTL Q;  4M75 F;  2EYW A;  1NJI C;  1D3B A;  3O8V A;  1VQO A;  5CR2 A;  3CCL A;  3Q1J A;  2ATC B;  4FT2 A;  4F04 B;  1M1F A;  2HSP A;  5D6X A;  1B34 A;  2O9V A;  3OW2 S;  2YUO A;  1ZA2 B;  1U1S A;  4M77 F;  3M0S A;  1O75 A;  2X4W A;  2DPP B;  4HCZ A;  4M78 B;  3F70 A;  4JRP A;  2DL3 A;  2CDT A;  2PZ1 A;  2EYX A;  3P8D A;  4M77 G;  1VQM A;  3VUB A;  4KUL A;  3PIO A;  1Q82 U;  3JAM E;  5J3B A;  2OTL T;  2K9G A;  4J6W A;  3MEW A;  1BCM A;  3JB9 H;  2E10 A;  4XTV A;  3TSZ A;  1FMW A;  4CC4 B;  1VIF A;  4XU2 A;  4ZTF A;  3AHU A;  2JTM A;  3CCV T;  3TCJ A;  1UUE A;  1YWP A;  1HD3 A;  4JS5 A;  1TS9 A;  2QA4 A;  2EPD A;  1E6H A;  4IUV A;  2PVG B;  2DKG A;  2VB6 A;  4GLK A;  3FDR A;  2CT3 A;  2B8A A;  4J5Y A;  2DEQ A;  1WJS A;  3OQ5 A;  2KRS A;  4M7D B;  4ZGE B;  2DA9 A;  4J8O A;  2L0A A;  4EMK A;  4EMK B;  2R57 A;  1VQL Q;  4LNP A;  3N5B B;  1VQ4 T;  1BI2 A;  2RI5 A;  1CKB A;  2E6N A;  4KBM B;  2VXF A;  5LJ3 d;  2EFI A;  1OI1 A;  3L2U A;  3OYM A;  5GAN 3;  1H3H A;  4XTU A;  1QWF A;  2DK3 A;  1ARK A;  3CMA Q;  2YXY A;  1M2O A;  3KFV A;  2DER A;  1VYU A;  1UHF A;  4A4H A;  1M90 C;  3NGP A;  2O01 E;  3OS5 A;  4J9E A;  1BB9 A;  5KYX B;  4N4I A;  2L3P A;  4EDU A;  3L2Z A;  1K76 A;  2QEX A;  1NYG A;  1YCY A;  4IKF A;  2LJ3 A;  3CC2 A;  2VGN A;  3BY7 A;  3CCJ T;  3CD6 A;  4OB0 B;  1QKX A;  3SWN C;  4RCC A;  1Y0M A;  4DEY A;  1KC8 C;  3RER A;  3GIB A;  1PCX A;  5DLO A;  4UC4 A;  4C8Q E;  2Z0W A;  1QCF A;  3LGL A;  2DYB A;  2FPD A;  4JJN K;  3CC7 T;  3E9F A;  1U06 A;  4LUD A;  1Y07 A;  1Y57 A;  2LT4 A;  2PU9 B;  3A8L B;  2GBQ A;  2LNV A;  3ZL7 C;  3UA6 A;  1R8O B;  2KRO A;  4OML A;  1OX9 A;  2X9H A;  3M4Y A;  5DLQ E;  3OSV A;  4RTW A;  1UGP B;  3JCM h;  5I21 A;  1VUB A;  4XK8 E;  5IHK A;  5IXF A;  5HCK A;  3VRY A;  2B86 A;  1BU1 A;  1KG1 A;  5CQY A;  3VS3 A;  5IAY A;  4ZTJ A;  2VYT A;  3CPF A;  3CPW A;  9ATC B;  1UJY A;  3JCM P;  3HPW A;  2OJ2 A;  2FZK B;  5EC7 A;  1G83 A;  4BY6 B;  1P92 A;  1X01 A;  4M7D G;  4C5H A;  5ECA A;  5HY6 A;  3VU3 C;  4C0D C;  4F7U E;  2NUT A;  3CCV Q;  1PNJ A;  3J80 E;  2BE9 B;  2QG9 B;  4BE1 A;  1ZUU A;  4R55 A;  3QDF A;  4BB7 A;  2J7I A;  3VS1 A;  1LOJ A;  2RHY A;  3RMS A;  1K9M R;  2RH2 A;  4AG2 C;  3ULR B;  2DET A;  1M2V A;  1B7T A;  3CCM Q;  1W70 A;  4OGC A;  1WYX A;  4X1V A;  4XTY A;  2ABL A;  3MKD A;  2GFA A;  3MET A;  3SWN B;  3SFM A;  1K4U S;  1ABO A;  4Z8A A;  3I55 A;  2CP6 A;  1SG5 A;  4JZ4 A;  4J9B A;  2C06 A;  4RCB A;  4EPC A;  3QYG B;  3TVT A;  5GAN e;  1Y96 B;  1RAF B;  2HKQ B;  1JB0 E;  1SRM A;  1W2B S;  3HFN A;  1WHK A;  3EHQ A;  1OU8 A;  1D0Z A;  1VQ9 A;  5GMK h;  4JJB A;  2RJF A;  4M75 G;  2ZPG B;  1FYN A;  2COZ A;  4A4E A;  3QO3 A;  4KGV B;  1SRL A;  1KQ1 A;  2QA4 T;  2RJD A;  2CP7 A;  1ZQ1 A;  4LE9 A;  4XU0 A;  4RTT A;  1SEM A;  1H92 A;  4BDY A;  2PNI A;  1UB4 A;  2JXB A;  2V8I A;  2DBK A;  1JRI A;  2ED0 A;  2Y90 A;  5LJ3 g;  3V7R A;  1YI2 Q;  1AVZ C;  2MPX C;  2DO3 A;  4OGE A;  2QGF B;  1RAB B;  3CCU Q;  5CKF A;  5IH2 A;  4Z02 A;  4DOW A;  1KC8 R;  1YNZ A;  4HA8 A;  1FXX A;  1W2B P;  1K9M C;  1QVF S;  1WJR A;  2BZY A;  5GAM e;  1RI0 A;  4LD6 A;  2R5M A;  2J05 A;  3M0U A;  1W2B A;  1U8R A;  3VS5 A;  1NM7 A;  3QDR B;  4N4H A;  2QQB A;  4FYY B;  3H0I A;  3VS6 A;  3OS0 A;  5J26 A;  1WZO A;  5HK3 A;  2NLU A;  1NJI R;  2K5F A;  2YRV A;  2X51 A;  3I56 Q;  4OMM A;  5CKH A;  1D1A A;  1WA7 A;  2DD4 A;  1UG1 A;  3L2V A;  4LDU A;  2PQW A;  3T9N A;  1S72 Q;  2HSE B;  2OTJ A;  5GAO l;  4JUV A;  2OTL A;  1WXB A;  4O6J A;  2KRN A;  1VIE A;  2R5A A;  2X4J A;  3VS7 A;  3UPU A;  4HT8 A;  4M7A D;  1LJO A;  1BI1 A;  5DY9 A;  3M53 A;  3G71 T;  5CO7 A;  5CCA A;  3OYD A;  1F1B B;  2OX7 A;  4AFU C;  5GAN 4;  1M8M A;  3S3O A;  2KRM A;  3I55 T;  4M7D F;  2F2V A;  4WF2 A;  1VQK A;  3CXC S;  3M55 A;  3FIF A;  4AFS C;  2EYY A;  5D6W A;  2QTV A;  1N27 A;  3CBM A;  5GAN j;  4HCB A;  4E47 A;  4C0G A;  4HT9 A;  3VUZ A;  1YIT Q;  2LQ8 A;  3RR6 A;  2MYS A;  4FM4 B;  1ZUK A;  1V76 A;  1WXU A;  2EJ9 A;  2XDP A;  3M57 A;  1BBZ A;  2RJE A;  3GNF B;  2AZS A;  3CCQ Q;  1PKS A;  2O4X A;  4X9C A;  1GCQ A;  1VQO T;  1FMK A;  2ZPF B;  3FC3 A;  1VA7 A;  2DXB A;  2NUT B;  3INZ A;  4FSS A;  2DM1 A;  3X26 B;  1SPK A;  2QK0 A;  2BTT A;  4C92 F;  2LZ6 B;  2A08 A;  3QKJ A;  1TUG B;  5IXB A;  1IHW A;  1RAI B;  4VUB A;  4BI8 B;  2E3I A;  2FPE A;  1M1K C;  2CUD A;  1G3W A;  2DLP A;  3DLM A;  1NZ9 A;  2EKH A;  1QVG A;  4K11 A;  3G6E Q;  4C92 C;  2FRW A;  5D7U A;  4RTU A;  2HQH A;  1Z9Z A;  3CBO A;  2V8K A;  4L59 A;  4LXC A;  4AFZ C;  2KGT A;  3OYG A;  2DFU A;  1IXD A;  2LNH B;  2OAW A;  4L6V 5;  1MMN A;  2JN0 A;  4AT1 B;  4PJN A;  2V1Q A;  4OMO A;  4ZGD B;  2IVW A;  3OYH A;  2YUN A;  5KYN A;  1VQN A;  4D8K A;  3FB9 A;  1VQ8 T;  2A36 A;  3JCM W;  4M7D A;  3E2U A;  4J9F A;  1HXD A;  2W10 A;  2BIV A;  1MHN A;  1YI2 T;  3EH2 A;  2COY A;  2QAZ A;  4E7J A;  4J7F A;  2MMP A;  2EGE A;  1G3S A;  3QUI A;  1GL5 A;  2K3B A;  4EIK A;  5HK0 A;  2ZPH B;  1FX7 A;  2RM4 A;  1X6O A;  5GAN d;  1HK9 A;  1EZZ B;  3UF4 A;  1VQ7 T;  4C92 A;  2GCX A;  2K5I A;  1X2K A;  1WDX A;  1GCP A;  3TQ7 P;  4M7D D;  1AEY A;  2QEX T;  2ESW A;  4M7A E;  4R0K A;  2M16 A;  3A8H B;  3OYI A;  1ZBX A;  2F1L A;  4BD3 A;  2X3X D;  4M7A A;  1WNL A;  4JRK A;  2OAU A;  1KSW A;  2CP0 A;  1SHG A;  4J6Y A;  1I1J A;  2JM8 A;  3QWY A;  2EGC A;  1ZSG A;  2D0N A;  1YP5 A;  5GMK l;  2EGA A;  4PJO E;  4XAX B;  2CZ6 B;  5LJ5 d;  4RUG A;  1VQP A;  2K3X A;  4EMH A;  2EQU A;  2D8J A;  3V7S A;  1IHV A;  3I5S A;  5FU6 B;  2L5Q A;  8AT1 B;  4PJO F;  3S3N A;  4RG2 A;  2IIM A;  1RAH B;  2PVD B;  1K8A U;  2EJF A;  1AWX A;  2A37 A;  3X28 B;  1JXM A;  3URG A;  2VXE A;  3L2R A;  1T3S A;  2G6F X;  5D6Y A;  2GF7 A;  2COW A;  1QVF P;  2HKN A;  4QQG A;  4GBQ A;  1NEB A;  1QMC A;  4OB2 B;  2RI2 A;  1YFN A;  5LJ5 f;  3OYE A;  2IPO B;  2EQI A;  2YWW A;  1VQM T;  5L23 A;  1H3Z A;  3QG1 A;  2DL8 A;  1AHJ B;  3CCR T;  4D8D A;  4L5G A;  2QI2 A;  1Q7Y C;  2DL7 A;  4ME7 A;  3KXT A;  5GAN f;  2LCL A;  5KYW A;  5FWB A;  1U3O A;  1WJQ A;  3I5R A;  2RHZ A;  4C5I A;  2XMF A;  5KYU A;  4JDS A;  2DNU A;  1OEB A;  1Y96 A;  4QQD A;  2NYS A;  1C0M A;  1BYM A;  1EX4 A;  5FRO A;  3C0C A;  4BE0 A;  2CP5 A;  3KUF A;  2KK4 A;  1D1B A;  2ZPI B;  1GCQ C;  3H6Z A;  1K8A C;  1CKA A;  1Q86 U;  2YHT A;  4J9C A;  4E7I A;  2LC4 A;  4ZNX A;  2O31 A;  1YN8 A;  3UAT A;  5CKE A;  2WSF E;  1NLP C;  4GY5 A;  3A1P A;  1NPR A;  3JB9 I;  1YJW Q;  1AWO A;  4HCC A;  3M58 A;  3VS0 A;  1WFW A;  4A53 A;  4QQ6 A;  2HDA A;  4C92 G;  3P8H A;  5GAN 7;  2X4X A;  3BDL A;  3EH1 A;  5GAO n;  1SSH A;  2LVM A;  2AZV A;  3HSB A;  4PJO D;  2MOX A;  1MND A;  1IRX A;  1AOJ A;  2QTX A;  5GAN 8;  3UDC A;  2DX1 A;  3OYF A;  2F5T X;  1N9S A;  3WVD B;  4JS4 A;  1U5S A;  3GPL A;  4KH0 B;  2QDY B;  1PM3 A;  2XD0 A;  1WXT A;  2QQS A;  4CC7 A;  4DBH A;  1VQ5 T;  1TSF A;  3OW2 A;  3JCM X;  1G3T A;  3RES A;  1WLP B;  2KNB B;  3OYL A;  4J9G A;  2FEI A;  2G3R A;  3CME T;  3CCS Q;  3PFS A;  1VQ8 Q;  4R56 A;  5FU6 C;  4BE2 A;  3OYN A;  1MGQ A;  4HCK A;  4LDV A;  2QQR A;  2A7Y A;  1MMD A;  4PKC C;  4C0F A;  4AMC A;  2R58 A;  1VYV A;  3BFM A;  3V7C A;  4M78 F;  5GMK i;  2J06 A;  1YJ9 Q;  2DEU A;  2CH4 W;  2KQW A;  2ECZ A;  2EAY A;  1QP3 A;  3CPW P;  2YDL A;  1D1C A;  3EG9 B;  3JCM Q;  2RB6 A;  1JJ2 P;  2GQI A;  3LH5 A;  1VQ5 A;  2NUP B;  4N0A A;  1NYF A;  3R6N A;  3CXC P;  1YIT A; 
#chains in the Genus database with same CATH homology
 2PTK A;  2M51 A;  5GJV B;  2GTJ A;  2LX7 A;  3M0P A;  5IH2 A;  1JU5 C;  2FG0 A;  1YNZ A;  1GFC A;  2O9S A;  2BZY A;  2YT6 A;  2LQW A;  2J6O A;  2KXD A;  1ABQ A;  1UEC A;  1V1C A;  2J05 A;  2RN8 A;  3M0U A;  3PVL A;  3I35 A;  5FW9 A;  1AZE A;  3VS5 A;  1NM7 A;  1AD5 A;  2NWM A;  3FJ5 A;  3UA7 A;  2L2P A;  1G2B A;  1GRI A;  3H0I A;  3VS6 A;  3H0F A;  4LN2 A;  2GNC A;  1YWO A;  2ROT A;  2DMO A;  4OMM A;  1RI9 A;  1X6G A;  1A0N B;  1M3C A;  2RF0 A;  1QLY A;  1WA7 A;  1UG1 A;  3VRZ A;  2RQV A;  1BK2 A;  4F14 A;  5IHI A;  1WI7 A;  2DJQ A;  4OMP A;  1WIE A;  1WXB A;  1UTI A;  1M27 C;  4JJD A;  4J9D A;  2KRN A;  2CT4 A;  4JZ3 A;  1Z9Q A;  5FWC A;  1JQQ A;  3VS7 A;  1B07 A;  4AG1 C;  2DIL A;  2JMA A;  3NMZ C;  2MIO A;  4Y92 A;  4JPB W;  2VWF A;  3TSW A;  4AFU C;  2JS0 A;  1M8M A;  2KE9 A;  2KRM A;  2V1R A;  2F2V A;  1M3A A;  1X6B A;  1IO6 A;  1RLQ C;  4AFS C;  3JV3 A;  1TUC A;  2EYY A;  3RNJ A;  3QWX X;  1T3L A;  2CH4 A;  2LP5 A;  4DEX A;  2SEM A;  1M3B A;  2HCK A;  1S1N A;  2JTE A;  2DBM A;  2LJ1 A;  1GFD A;  1NEG A;  1ZX6 A;  1ZUK A;  1K0X A;  1WXU A;  1PRM C;  2W0Z A;  1BBZ A;  2CRE A;  1B3Q A;  1VYT A;  1X2Q A;  2J6F A;  2AZS A;  2NUZ A;  1PKS A;  1EFN A;  2K79 A;  2KT8 A;  2KT1 A;  3PE0 A;  5IHN A;  1GCQ A;  2KBT A;  1UGV A;  1FMK A;  5GJW B;  1VA7 A;  3I9Q A;  4FSS A;  2DM1 A;  1SPK A;  2AK5 A;  2RQR A;  2VKN A;  4RTX A;  2BTT A;  1UHC A;  2LZ6 B;  2A08 A;  4Z89 A;  2C0I A;  5IXB A;  2DVJ A;  4IIO A;  4A63 B;  4F16 A;  2FPE A;  2X3W D;  2CUD A;  2YUQ A;  2DLP A;  2F2W A;  2C0O A;  2EKH A;  1SHF A;  4WCI A;  4K11 A;  1OV3 A;  1NLO C;  2DE0 X;  4JJC A;  2KEA A;  2FRW A;  4RTU A;  2RNA A;  1Z9Z A;  1RUW A;  2ROL A;  2A28 A;  2K2M A;  1CSK A;  3M0R A;  2KYM A;  4HXJ A;  4AFZ C;  2KGT A;  4CC3 A;  2LNH B;  2OAW A;  4HVV A;  3REB B;  1J3T A;  1AWJ A;  2EYW A;  4ORZ A;  3REA B;  2V1Q A;  3A98 A;  4OMO A;  1PRL C;  1WX6 A;  1I0C A;  2GTO A;  1RLP C;  1H8K A;  2YUN A;  1ZLM A;  2JW4 A;  4D8K A;  1W1F A;  2A36 A;  5I11 A;  2HSP A;  4J9F A;  2O9V A;  2W10 A;  2OI3 A;  2LJ0 A;  2L3Q A;  2YUO A;  2EGE A;  4QT7 A;  2LMJ A;  3M0S A;  3GBQ A;  1GL5 A;  2K3B A;  4EIK A;  3THK A;  2DL3 A;  2CDT A;  2PZ1 A;  1TG0 A;  2EYX A;  2KYB A;  3H41 A;  4J9H A;  3UF4 A;  2LQN A;  1T0J A;  4GLM A;  1X2K A;  1WDX A;  1GCP A;  1AEY A;  2K9G A;  2ESW A;  3TSZ A;  1ZBJ A;  4R0K A;  4CC4 B;  1XOV A;  1MV3 A;  1UUE A;  2VVK A;  2ED1 A;  1YWP A;  2X3X D;  1HD3 A;  1KSW A;  1SHG A;  2JM8 A;  1I1J A;  3QWY A;  2O88 A;  2EPD A;  1E6H A;  2EGC A;  2D0N A;  1ZSG A;  1YP5 A;  2ENM A;  2EGA A;  1PHT A;  2CT3 A;  4RUG A;  3U23 A;  5I22 A;  1JEG A;  3IQL A;  2GGR A;  2D8H A;  2D8J A;  2KRS A;  1JXO A;  1GBQ A;  2DA9 A;  1X27 A;  4HVU A;  2L0A A;  3I5S A;  4LNP A;  1AWW A;  1OPK A;  1QWE A;  1CKB A;  1TUD A;  1UDL A;  2IIM A;  1H3H A;  1UE9 A;  1QWF A;  1ARK A;  3KFV A;  2CSQ A;  1AWX A;  1VYU A;  1UHF A;  1UFF A;  2A37 A;  3SHW A;  3M0Q A;  1HSQ A;  2DL5 A;  1JXM A;  2LCS A;  3NGP A;  1T3S A;  2G6F X;  4J9E A;  3SEM A;  1BB9 A;  1GBR A;  4GBQ A;  2L3P A;  1NEB A;  1K76 A;  2RQW A;  1NYG A;  2LJ3 A;  1OPL A;  2HBW A;  4HVW A;  2DL4 A;  3O5Z A;  2HEQ A;  1QKX A;  2EQI A;  2H8H A;  5L23 A;  1Y0M A;  2DL8 A;  4DEY A;  1UJ0 A;  4E6R A;  2SRC A;  4D8D A;  2EBP A;  3NHN A;  2F2X A;  2MCN A;  1QCF A;  3EG3 A;  2DL7 A;  1K1Z A;  2DYB A;  2KR3 A;  2FPD A;  2EVR A;  5FWB A;  1U3O A;  3VS4 A;  1U06 A;  3I5R A;  2QDL A;  1N5Z A;  4LUD A;  2XMF A;  1Y57 A;  1PWT A;  1OOT A;  2JMC A;  2FRY A;  2GBQ A;  3EG0 A;  2BZ8 A;  3ZL7 C;  2DNU A;  3EGU A;  1OEB A;  3UA6 A;  2AKL A;  2KRO A;  4OML A;  1M30 A;  2RMO A;  1T0H A;  2FO0 A;  4RTW A;  1MUZ A;  3EHR A;  3C0C A;  2CSI A;  5IHK A;  1GCQ C;  5IXF A;  5HCK A;  3VRY A;  2AKK A;  2B86 A;  1BU1 A;  1CKA A;  4J9C A;  3VS3 A;  4ZNX A;  1I07 A;  4KRT A;  2O31 A;  1K0S A;  2CUB A;  3NPF A;  2DRK A;  1YN8 A;  4OMQ A;  3UAT A;  4CC2 A;  1HJD A;  1NLP C;  1UJY A;  1JO8 A;  2OJ2 A;  2DRM A;  2D1X A;  5EC7 A;  1AWO A;  1G83 A;  3VS0 A;  4M4Z A;  1WFW A;  1QKW A;  4OMN A;  5ECA A;  2HDA A;  4RTZ A;  1PNJ A;  3EG1 A;  2EW3 A;  2L3S A;  1SSH A;  2AZV A;  1ZUU A;  4IIM A;  2K6D A;  2MOX A;  2JT4 A;  1AOJ A;  2DX1 A;  2J7I A;  2YSQ A;  2JM9 A;  1NG2 A;  3VS1 A;  1AZG B;  1MV0 B;  2O2O A;  1U5S A;  3H0H A;  2I0N A;  2K7A A;  4AG2 C;  3ULR B;  1W6X A;  2KXC A;  4ESR A;  1W70 A;  2E5K A;  4J9I A;  1WXT A;  1WYX A;  4X1V A;  2BZX A;  4CC7 A;  3PVQ A;  2ABL A;  3VS2 A;  1WLP B;  1LCK A;  1PKT A;  2KNB B;  4J9G A;  4Z88 A;  4F17 A;  1E7O A;  2FEI A;  1K4U S;  1ZUY A;  1ABO A;  1X69 A;  4Z8A A;  3RBB B;  4HCK A;  4J9B A;  4JZ4 A;  3TVT A;  1K9A A;  2EYZ A;  3EG2 A;  1SRM A;  2C0T A;  3CQT A;  4RTY A;  3EHQ A;  1VYV A;  4JJB A;  2J06 A;  2RQU A;  4RTV A;  1X43 A;  2J6K A;  2CH4 W;  1KFZ A;  1KJW A;  3M0T A;  2ECZ A;  1E6G A;  2DF6 A;  1FYN A;  1KIK A;  2P4R A;  2RQT A;  2YDL A;  4LUE A;  1SRL A;  4LE9 A;  4RTT A;  2RPN A;  1SEM A;  1H92 A;  2PNI A;  2JXB A;  1YCS B;  2FPF A;  2GQI A;  3LH5 A;  1NYF A;  2DBK A;  2M0Y A;  3R6N A;  2ED0 A;  2YUP A;  2JS2 A;  1AVZ C;  4AFQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...