2DM1A

Solution structure of the second sh3 domain of human protein vav-2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
GSSGSSGGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein vav-2
publication title Solution structure of the second SH3 domain of human protein vav-2
rcsb
source organism Homo sapiens
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dm1A00
2C0TA 3NPFA 5GJWB 4F17A 4LN2A 2DRMA 2JT4A 1AWJA 1WYXA 2RQVA 1YWPA 2ABLA 5IH2A 1KIKA 1VYUA 2OAWA 5IXBA 1KFZA 1UDLA 2EW3A 2DNUA 2LQWA 2DM1A 3NMZC 3M0QA 4J9FA 1AWOA 1OPKA 2JTEA 2KT8A 2J6KA 3EG2A 4IIMA 2JW4A 1X6GA 2MIOA 5IHNA 5I22A 1WFWA 2YUPA 3EG0A 1PKTA 4OMOA 4CC7A 1RUWA 2O2OA 1J3TA 2YUNA 4D8KA 3O5ZA 1I1JA 1UECA 1GBRA 3REBB 3NGPA 4LE9A 1PNJA 3PE0A 2EYZA 1H92A 1SRLA 1UGVA 2KT1A 2VVKA 2GTJA 1TUDA 4J9IA 4Z88A 4LNPA 2FG0A 2ECZA 4CC2A 4DEXA 3SEMA 2K7AA 3I5SA 2J6OA 3ULRB 2LJ0A 3QWXX 1FYNA 1TUCA 2O31A 1TG0A 4CC4B 1BB9A 5HCKA 1ZBJA 1K76A 1NG2A 1RLQC 2DE0X 1HSQA 4K11A 2CT3A 3EGUA 4AFZC 4Z89A 1GCQC 1UJYA 2EYWA 1QWFA 4LUEA 1U3OA 2RNAA 2CH4A 2K9GA 1JO8A 3UA6A 1UTIA 1Y0MA 1BU1A 2DL4A 3LH5A 2ROLA 1NEGA 1X69A 2ED0A 4HCKA 2FPEA 2JS2A 4RTUA 2SRCA 1VYVA 2M51A 2HDAA 2KEAA 4AG2C 1GCPA 2CT4A 2DLPA 2ED1A 2DL3A 4JJBA 2JXBA 2D0NA 2GBQA 1CKAA 2EGCA 2KROA 1A0NB 2KRMA 3U23A 2BZYA 4J9HA 1I0CA 3A98A 4RTYA 1H3HA 4JPBW 2K79A 1PKSA 1XOVA 4RTVA 2HSPA 3UA7A 4FSSA 1SEMA 3EG1A 1CKBA 1ZSGA 1N5ZA 1H8KA 1KSWA 1WDXA 1RLPC 2FPFA 2KRNA 1U5SA 2KE9A 2CSIA 1ZLMA 1LCKA 2PTKA 2H8HA 4Z8AA 2A28A 2DYBA 5I11A 1JQQA 1T0JA 1UHCA 2LZ6B 1K4US 2JM9A 1SHGA 1V1CA 4RUGA 1X2KA 4A63B 2KGTA 2DBMA 2EGAA 2LX7A 4ORZA 2O9SA 2F2WA 2KBTA 3TVTA 2C0OA 4LUDA 1T3LA 2GQIA 1WLPB 2KRSA 5GJVB 2EQIA 2YDLA 3IQLA 2LCSA 2F2VA 4D8DA 2RPNA 1NYFA 2DRKA 2IIMA 2CH4W 2OJ2A 1ZUYA 3CQTA 2X3XD 1BK2A 5IHIA 2KYMA 2CREA 2O88A 2GGRA 3VS0A 3PVLA 2L3SA 3VS1A 1GCQA 4EIKA 4ZNXA 4CC3A 1PRLC 2O9VA 2W0ZA 4AFUC 1EFNA 4RTXA 1Y57A 2LJ3A 3VS7A 2V1RA 3EHRA 4JZ3A 4RTZA 2PZ1A 1X43A 2JMAA 3ZL7C 2E5KA 2EYYA 3THKA 1WX6A 4J9CA 2J06A 3NHNA 2EPDA 2RQTA 1Z9QA 1AWWA 3M0RA 4M4ZA 1E7OA 2K6DA 3UATA 3VRZA 1UG1A 2FRWA 4J9GA 2K2MA 5FWCA 2J7IA 2F2XA 2LP5A 1ZX6A 2EYXA 4F16A 2KYBA 2AZVA 2MCNA 2YUOA 3VS5A 1NLOC 1K0SA 4WCIA 1X27A 1JXMA 2DL8A 4GBQA 1WXTA 1BBZA 2YSQA 4OMPA 2G6FX 2JS0A 3TSZA 3GBQA 2W10A 1Z9ZA 2ESWA 2FRYA 3EG3A 1YNZA 5FWBA 4QT7A 2HBWA 4F14A 4E6RA 2C0IA 2DMOA 1JU5C 1K1ZA 1ARKA 2CSQA 1WXUA 2CUBA 2AK5A 2EVRA 1QCFA 2FEIA 2RN8A 2HEQA 2ROTA 2L3QA 2K3BA 1GBQA 2B86A 4J9DA 2BZ8A 2A08A 3PVQA 1GFDA 1OEBA 2FO0A 1B07A 2L3PA 1ABOA 4HVUA 4IIOA 1ZUUA 1QKWA 3RBBB 4Y92A 1S1NA 4RTTA 1RI9A 2EGEA 1QWEA 2D1XA 2JMCA 1YCSB 5IHKA 1AOJA 2LQNA 1AWXA 3VS2A 2L0AA 1FMKA 2JM8A 1HD3A 1QKXA 3M0TA 1NYGA 2DL5A 3VS3A 3SHWA 1JEGA 1X6BA 3RNJA 2QDLA 1G83A 1UHFA 1M3CA 2A36A 4OMLA 3VRYA 1W6XA 1JXOA 1SSHA 2DBKA 3UF4A 3TSWA 1YWOA 2YUQA 3M0SA 1AVZC 1AZEA 4HVWA 1GL5A 1M3BA 4J9EA 3I35A 2RQUA 2J6FA 1MV3A 1NEBA 1UE9A 3H0HA 2LNHB 1E6HA 2NWMA 5L23A 1ZUKA 4AG1C 2GNCA 1OPLA 4J9BA 4JZ4A 2LJ1A 4AFQC 3KFVA 1MUZA 3I9QA 3JV3A 4AFSC 2AKLA 2D8JA 1NM7A 4JJCA 3I5RA 1VYTA 1B3QA 3VS4A 3H0FA 2V1QA 1PHTA 1GRIA 1QLYA 3VS6A 1M27C 1SHFA 4RTWA 1I07A 2RQWA 2J05A 2XMFA 2MOXA 5ECAA 1UFFA 1PRMC 2DILA 2FPDA 1AEYA 2VWFA 4OMQA 2OI3A 2A37A 2HCKA 1M30A 3EHQA 2KR3A 1X2QA 1OOTA 1W70A 2RF0A 2L2PA 1T3SA 2GTOA 4R0KA 2AZSA 2DX1A 1M3AA 1PWTA 1WI7A 3R6NA 4KRTA 1HJDA 1SRMA 3M0PA 1CSKA 1OV3A 2DF6A 2KNBB 1G2BA 1VA7A 3FJ5A 2DJQA 1WIEA 2RQRA 5EC7A 1T0HA 3REAB 4OMNA 4OMMA 2AKKA 1UJ0A 2KXDA 2KXCA 4ESRA 2CUDA 1WA7A 2EBPA 1MV0B 1IO6A 1K0XA 1YP5A 2M0YA 5FW9A 2DL7A 5IXFA 2DA9A 1AD5A 1NLPC 2X3WD 2D8HA 4GLMA 2SEMA 1GFCA 1YN8A 4HVVA 2EKHA 4HXJA 1KJWA 4JJDA 2PNIA 3H41A 1AZGB 2BZXA 1ABQA 2ENMA 2I0NA 2LMJA 2P4RA 1WXBA 2YT6A 1W1FA 3H0IA 2CDTA 1M8MA 4X1VA 1SPKA 2RMOA 1U06A 1K9AA 4DEYA 2VKNA 1UUEA 2BTTA 3QWYA 3C0CA 1E6GA 2NUZA 3M0UA 2DVJA
chains in the Genus database with same CATH superfamily
1XQHA 2EQMA 1O75A 3JCMe 3G6EA 2JVVA 1VQMT 1UGPB 1AWJA 3JCMb 1YIJA 3DB4A 2RQVA 3PFSA 2ABLA 4KUDK 1VYUA 2OAWA 1FWZA 5IXBA 1S72Q 1M2OA 4B9WA 1UDLA 3G6EQ 3X26B 1VQ8T 1LPLA 2E41A 3M56A 4J9FA 1YIJQ 1PD1A 2J6KA 3S6WA 1X6GA 5GMKm 2MIOA 3CCET 2DFUA 3QKJA 3BW1A 1IZ6A 4E2FB 4D6WA 1GBRA 1QVPA 3REBB 2RD1A 4EMHA 1RAAB 5KE3A 2BKDN 5KYWA 5KYNA 2YHTA 4Z88A 2OTJA 4J9IA 1KQSS 1NE8A 5HY6A 3SEMA 1G3YA 3ULRB 3GOXA 1JJ2S 3JB9D 2DJZA 5FU6C 5IT9E 3GLXA 3CC4T 1RLQC 2DE0X 4OVAA 4M75E 3HRUA 2OTJQ 1V29B 4AFZC 2P0KA 3CD6T 1UJYA 2EYWA 4M77A 3MEUA 3RERA 3NFCA 5GAMe 3KXTA 2CH4A 1YI2A 4BE2A 3JCMJ 5LJ5g 1UTIA 1VQPA 2K5FA 4HT9A 5LJ3h 3NTKA 3TU4K 3LH5A 5FU6B 2DZCA 3OBYA 4HCKA 4V2SA 3ZFJA 2K2VA 1YI2Q 2KEAA 1VQPQ 1VQNA 1WNLA 4E47A 2DL3A 2DXTA 1K8AC 3P8DA 4Q5WA 2KRMA 3U23A 4J9HA 2E3HA 1GXIE 2HSEB 1H3HA 2K79A 1TSFA 5GMKj 1VQNQ 7AT1B 4R55A 1Y71A 1VQ4A 5GAN4 2RK1A 3EG1A 2RK2A 4BI8B 1H8KA 3HP9A 2COYA 4OGEA 3GF5A 1RLPC 1N8RU 2KE9A 5D6YA 2E65A 2HBPA 1VQ4Q 2PTKA 2H8HA 4C8QG 2XU8A 1UEBA 3QYHB 2A28A 2DYBA 2KK4A 2QEXQ 3EGXA 1M4ZA 2FVUA 5GANg 5GAN6 2ZCFB 3CCVT 2QDYB 2LQKA 3QUIA 5CQYA 1Y07A 1BI3A 4BE0A 2L5QA 4MDXA 2KGTA 3RUXA 2P0PA 2LX7A 4L5GA 4ME7A 4C5IA 2PUOB 2C0OA 1OX9A 1PD0A 2WACA 1ZSZC 1KHIA 3RIRA 1NJIC 2NUTB 3L2QA 2KRSA 2EQIA 3IQLA 2RPNA 4ZN1A 2CP6A 4XU1A 2XKOC 4X9CA 3CQTA 2X3XD 2KYMA 2QGGA 2ZGWA 5GAOl 1HK9A 4A4EA 3PVLA 4XTVA 1GCQA 4ZNXA 3HPWA 1PSEA 4A53A 3CPWS 1KC8R 3M58A 1BKBA 1EFNA 4B9XA 3JB9F 1MMDA 2VV5A 2E10A 3ASKA 1I4K1 3EHRA 5GAN7 4JS5A 1Q81R 1WJQA 1I81A 2PZ1A 3M57A 3THKA 3TQ7P 3G71T 1Z9QA 3PIPA 2NLUA 1WHMA 3QZ5B 3CCMT 2DAQA 2RHYA 1K73U 1M2VA 2FRWA 5FROA 2K2MA 2J7IA 4PJLA 2EYXA 3CC7Q 3OYMA 2AZVA 2MCNA 3MO8A 4LDYA 2YUOA 3E1SA 2GQVA 1K0SA 4ZN3A 2YSQA 4OMPA 2CP7A 3GBQA 2DIGA 4OGCA 3CC2T 2ESWA 1QQJA 2V8KA 3DLLA 2HBWA 3HHTB 2O01E 4E6RA 2C0IA 3CCST 2DMOA 3L1AA 1VQ6A 2RJEA 4BY6C 4A4HA 2CUBA 1MNEA 3URGA 2RI5A 2RN8A 4IUQA 5CAIA 3A5ZB 2B86A 2BZ8A 1SKUB 3OS1A 1FMVA 2L3PA 1ABOA 4HVUA 4CI0C 4C92G 4BY6B 3OSVA 2PVOB 1C6VX 3INZA 4KGVB 4M77G 2JMCA 1B34B 1IRXA 4OP0A 2JM8A 4JRQA 1HD3A 4MMLA 1QKXA 2HQXA 3QDRB 1VQLT 1JEGA 1X6BA 1YBYA 1UHFA 1M3CA 1D1CA 4M7DG 1QW1A 1WGSA 1JXOA 1SSHA 2RHZA 2DBKA 3UF4A 2YUQA 2P84A 3M0SA 3CCUQ 1AZEA 1IXDA 4HVWA 3TCJA 2DIQA 1M1KC 2J6FA 1UE9A 3CXCS 1TWBA 2DKGA 2M16A 3OQ5A 3SFMA 4PJOG 1KC8U 2AT1B 1RAGB 3SWNB 1ZUKA 4AG1C 4RKUE 1OPLA 2CP2A 2EJFA 1KK7A 3OYNA 2LJ1A 4EDUA 2PVGB 3J81E 3I5RA 1VYTA 1B3QA 3H0FA 4RTWA 3UT1A 2DERA 5ECAA 3CBMA 4JJNK 3OYFA 4XK8E 2QTXA 3JCMg 1W2BP 4J7IA 2KR3A 2EQKA 3A1PA 1W70A 2RF0A 3OB9A 2X51A 2MF2A 2KDSA 1VQMA 3OSSC 4DOWA 3JRZA 5I2MA 1BI1A 2DX1A 1M3AA 1QP3A 1PWTA 5KE2A 4OB1B 3G4ST 3EGDB 1M90R 2YLBA 1VQMQ 2KNBB 2K57A 2LT1A 1VQ8A 1G2BA 5GMKl 2PQWA 4LDWA 2RQRA 3V7SA 1D1AA 1QVFP 3CCEA 3QHSA 3JCMW 2HL5C 5DLOA 3UPUA 1WA7A 1VQ8Q 4J6YA 4C8QE 1D3BB 1MV0B 2RHIA 3CMAA 4Z02A 2E64A 3FJPA 4HT8A 4L59A 2KAFA 5FW9A 3J80E 3CCEQ 1AD5A 4KGZB 3X20B 2SEMA 3CCRA 2QQBA 4PL6A 2BZXA 2ATCB 2ENMA 2LMJA 3CC4A 2P4RA 1YJ9A 5GAMg 5A0DA 3QXEB 2CDTA 5GAOn 4DEYA 4FW2A 1UUEA 2NUZA 1N8RC 3M0UA 2FZCB 2C0TA 3NPFA 2M1HA 1KQ1A 3CC4Q 1AT1B 1YJ9Q 2JUFA 3JB9H 1WYXA 4II1A 3CD6Q 2Y4YA 1V76A 4FSXA 4JRKA 3ZBDA 1PC0A 2OAUA 3MEAA 5CR2A 2M02A 2LQWA 2RM4A 3M0QA 2KY9A 1AWOA 1OPKA 4IIMA 3EG2A 3L42A 3R6OA 2BE7D 5IHNA 4PJOD 4ZGJB 3RMQA 5I22A 5GAOp 4CC7A 3FEOA 3WVEB 4ZGDB 2DXCA 2EQJA 4N4GA 4DBHA 1PNJA 4HCBA 2EYZA 2GTJA 1TUDA 4LNPA 2ECZA 4DEXA 4HKEA 3QWXX 1TUCA 1TG0A 3I55T 1BB9A 5HK0A 1ZBJA 3HL8A 4J8OA 1K76A 1NG2A 4Y28E 3CCVA 3LX7A 3EGUA 5EG2A 2L8DA 4Z89A 5CCAA 2HQEA 3PNWC 1U3OA 2A0FB 2JTMA 4M75D 3UA6A 2DTOA 3CCVQ 2X9HA 5L8RE 1NEGA 1X69A 2ED0A 1M90U 1D0XA 2FPEA 5GMKi 1W2BA 1N9RA 3PTAA 2EQUA 5LJ3e 1VYVA 3LWHA 2HDAA 1XNIA 1GCPA 1YFNA 2CT4A 1HXDA 3TREA 4M78G 2ED1A 1K73C 2JXBA 2D0NA 2GBQA 5LJ5f 1VIFA 3A98A 3VV0A 4RTYA 4OMFB 4GLKA 1PKSA 1YJNT 3E19A 3UA7A 4E7KA 4C92E 3CMET 1Q7YU 1CKBA 1QVGA 1N5ZA 2R5AA 4NL2A 5LJ5j 4M77E 1KSWA 1XTDA 3NTHA 2QASA 4BE1A 2HKQB 1LNXA 4DBFA 3OYJA 4E7JA 1MHNA 4LD6A 3UDCA 3VYHB 5FU7C 2RJFA 4IURA 2QQSA 4C8QB 4M7DE 1TOVA 1K4US 1RI0A 2JM9A 3CCMA 1SHGA 2VGNA 3P8HA 3PMIA 4XTYA 6AT1B 5KYUB 5GMKh 3JCMP 5A0GA 2DBMA 5KYYB 4ORZA 2F2WA 1KHCA 3TVTA 3G71Q 3VUBA 5FRMA 4LDXA 5GANf 5FU7B 3CCMQ 2DTIA 3EFOB 4KGXB 1FXXA 2LCSA 2YDLA 4PJOE 2F2VA 4D8DA 5J3BA 4BDYA 1K9MR 4PJOF 1YJWT 2IIMA 4IUVA 3OA6A 1G5VA 4LXCA 1VUBA 3CC2A 2OJ2A 1JB0E 2X4WA 2VGMA 5GANj 1M5Q1 3I56T 3A8GB 4FYXB 2O88A 3CC2Q 2PVDB 4IKFA 3LYIA 2W0ZA 2L89A 1U1TA 2RI2A 3CCSQ 1G8XA 1Y57A 1BI0A 3HKSA 3L2VA 4RMOA 1WJSA 4JZ3A 3OYAA 3RESA 1OX8A 3FRNA 2EWNA 3FLGA 1X43A 2JMAA 3ZL7C 4IUPA 2CP0A 1KC8C 2VB6A 4PFOA 1WX6A 4MMKA 4M75F 4PJMA 4PNOA 2JZ2A 3M0RA 4FYYB 3A8LB 2RB6A 2K6DA 3VRZA 1UG1A 3OMGA 5FWCA 3META 3AHUA 2QK0A 4F16A 4JS4A 3M4GA 2KYBA 1P92A 1YITT 3E9GA 1NLOC 3MEVA 2XK0A 2QYZA 4F7UA 1X27A 1Q82C 2DL8A 4GBQA 1WXTA 1BBZA 2G6FX 1VQLQ 3TSZA 2KVQG 1YNZA 2NUTA 3E9FA 4E7LA 5D6WA 2LRQA 2EVRA 2IG0A 4XTZA 2QEXA 1QCFA 3D7SB 2E70A 4EPCA 2EJ9A 3CBPA 1MMNA 2HEQA 2ROTA 2ZPIB 4A4FA 3OYDA 2K3BA 1KQ2A 2A08A 1ZSZA 3BY7A 3HFNA 4EMKC 2R5MA 1I5LA 1TUGB 1VQOT 3CCQT 4OB0B 4B6MA 1IGUA 4C92B 4M7AG 1QWEA 5IHKA 4O6JA 3M59A 2XI9A 4M77B 1AWXA 4J7FA 2EFIA 2DEQA 1IHWA 2EIFA 4EMKB 5CKDA 4KULA 4RG8A 5GAN2 1K9MU 1WZOA 4PJOC 2FB7A 4Y91A 3KBGA 2XD0A 4M7DB 3TEEA 2EYQA 4J9EA 4QKUA 3I35A 3HFOA 3L2WA 3OS5A 2AIRB 1NEBA 3H0HA 4J6XA 3S3OA 2K5IA 1IB8A 2NWMA 4DOVA 5L23A 2QA4T 3JCMQ 2RJDA 2FL7A 3G4SQ 4PJOB 3OYCA 4PJNA 3M53A 4AFQC 1D0ZA 2CGHA 2QXFA 4AFSC 2LCCA 2D8JA 1NM7A 3LW5E 4KH1B 2DO3A 1RADB 3VS4A 4GY5A 3CC7A 4M75C 3EGXB 1GRIA 1QLYA 1X01A 2RQWA 3X24B 4OB2B 1PRMC 2DILA 2HNIA 2VWFA 2XICA 3N5BB 3L2UA 2A37A 2GCXA 1X2QA 1OOTA 1OU9A 3M4YA 1RABB 2COWA 2GTOA 4M78E 4M75B 2QI2A 1B34A 3SDZA 2VUBA 4PK4A 1ZBXA 4J5YA 1K8AR 1NPRA 2QQ9A 4BUGA 2DTHA 3QJ6A 3FB9A 2ZPHB 3JCMf 3GIBA 1MGQA 1WI7A 2VXEA 4JLIA 1HJDA 4PFPA 1D0YA 3FJ5A 5GAN3 1NPPA 1QCOA 5EC7A 1QVFS 4RG2A 4BI3A 5GAOr 4FU6A 2CUDA 1UGSB 1KD1R 1IO6A 3SD4A 2CZ6B 3SWNA 5CK9A 2DA9A 3MCAB 4C8QD 4E7HA 2CYZB 3CCLT 4JRPA 2E6NA 4HXJA 2X4YA 3I55A 4M7AD 2I0NA 4XU2A 1Q86R 2M0OA 3CCUA 1ZA2B 1Q7YC 1SPKA 4OF1A 5LJ5d 2K5LA 1NJIR 1G3WA 3SWNC 1E6GA 3QDFA 4F7UG 2DVJA 3I55Q 2R57A 4AT1B 4LN2A 3X25B 5LJ3g 1Y96B 3GNFB 2QQAA 5GAMf 1YWPA 5IH2A 1KIKA 5GAN8 1KFZA 2R58A 2EW3A 5A2QE 2F5KA 2KT8A 4JRIA 5CKBA 5GAMj 3EGDA 1WFWA 1H641 2O2OA 2DYIA 1Q81U 3C94A 3S3MA 2RH2A 1J3TA 2QG9B 3O5ZA 1UECA 3BE3A 4LD9K 4FCYA 2HMAA 3CMEA 3PE0A 1H92A 1SRLA 1R8OB 1B7TA 3CPWP 2K3YA 2KT1A 5GANd 2FG0A 1YJNQ 4ZGEB 2GFUA 1D3BA 2K7AA 3I5SA 2J6OA 2CKKA 2LJ0A 3CMEQ 4JLGA 4FIBA 2O31A 2MK5A 5HCKA 3QIIA 1OI1A 5KCOA 3MPUB 1HSQA 4K11A 2D9TA 4DA4A 2CP5A 1QWFA 2CZ0B 3FDRA 1OULA 4NS5A 2K9GA 5M9OA 4E7SA 1Y0MA 1K8AU 3DKMA 1KQSA 2ROLA 4O5VA 1JJ2A 3MKDA 1C0MA 2JS2A 1QVGP 1YJWA 4AG2C 3RKXA 1BYMA 2NUPB 2DLPA 3CCJT 4JJBA 2LNVA 3I56A 1RAIB 4M78B 1A0NB 4CRIA 3OYBA 1I0CA 5CIUA 4JPBW 4RTVA 1YJWQ 1KD1U 4C8QF 1SG5A 1KG1A 2IPOB 1N9SA 2ZZDA 4L6V5 3ZEHA 2FYKA 2DPPB 3I56Q 1LJOA 4M7AE 2OTLT 4C92D 4M7AF 1WDXA 3EG9B 2FPFA 3V8KA 3OYLA 3GP8A 2CSIA 4M77D 2E3IA 1VQKT 4Z8AA 1Q86U 2NYSA 2FZGB 3M5AA 1WHJA 3CD6A 1QCNA 1JQQA 2C06A 1T0JA 2LZ6B 1V1CA 3WVDB 4RUGA 3PT9A 3OYHA 4LDUA 4KUIA 4M7DD 2O9SA 2KBTA 5LJ5h 4YTLA 2RJCA 3MJXA 2FHDA 5GMKe 4LUDA 1YITA 2GQIA 1WLPB 3C12A 2MYSA 5GJVB 2EAYA 1R0BG 1VQ9T 1EZZB 2I2LA 1YITQ 2KMTA 2CREA 1M9SA 2GGRA 2BIVA 2YWWA 3DB3A 4X34A 3VS1A 4EIKA 3CXCP 1VQ6T 4CC3A 4J6WA 1K9MC 2QQRA 3E2UA 2DXBA 2Y90A 5IAYA 4F04B 4RCCA 4RTXA 2E1HA 2LJ3A 3VS7A 2ZPGB 3F70A 5I21A 4RTZA 1VQOA 3CCQA 2E5KA 3VYGA 3V7CA 3VUZA 4J9CA 2J06A 3NHNA 1G3SA 3JB9G 2ZPFB 1AWWA 2F69A 1G3TA 2MWPA 4BD3A 3CPWA 4M4ZA 1E7OA 4UC4A 1VQOQ 2GFAA 3CCQQ 1TXQA 2O4XB 2F2XA 2LP5A 1ZX6A 3MP8A 5KYUA 3VS5A 4E7IA 2JTFA 4WCIA 5KYYA 1X75C 4XTWA 5KYXB 5GAN5 4VUBA 2JS0A 2W10A 2DK3A 3LLRA 1PSFA 5FWBA 3JAME 4QT7A 2LDMA 3QZ9B 3LGFA 2GF7A 4C8QC 4WTOB 2AK5A 4C92F 2QA4A 5FLXE 2MWOA 2RHXA 5FRNA 1UB4A 1U1SA 2FEIA 3M9QA 4M77F 4M7AC 3M55A 1N27A 4HA8A 2L3QA 3H9NA 1GBQA 3L2ZA 3NTIA 3OYKA 1YHQT 1OEBA 2FO0A 2QA4Q 3RDVA 2XIDA 4IIOA 4AMCA 3G71A 4XTXA 1QKWA 3RBBB 2CZ7B 3GNGA 2B8AA 4Y92A 4F7UE 3JCMd 2DVEA 4XQ3A 4M7DF 1YCSB 3V7RA 1AOJA 2X4XA 2LQNA 4M7AB 2LTOA 3GPLA 2MI6A 3ER0A 4C5GA 3VS3A 4N4IA 4HCCA 1G83A 8AT1B 4A54A 2A36A 3OYYA 1ACMB 2QGFB 1YWOA 1AVZC 1YCYA 1WHLA 1M3BA 3CCSA 1M1GA 2RQUA 3CEYA 4QVDA 2BUDA 2LNHB 3HSBA 2VXFA 4QQ6A 2K3XA 3QG1A 4XTUA 3WXMB 3OYGA 3I9QA 2E4HA 3JV3A 1H3ZA 2AKLA 5AYFA 1U8RA 4JJCA 3CMAT 3CXCA 3EAEA 4KH0B 4ANJA 3FC3A 3CPFA 2P4TA 1I5OB 3CCLA 5GAMd 4QVZA 1SHFA 3CCRT 2HAXA 4MDWA 3H6ZA 1Q81C 1WHKA 2J05A 2JJ9A 2MOXA 1UFFA 2FPDA 5CO7A 2LT4A 1AEYA 4OMQA 1VQLA 2PU9B 2DEUA 2HCKA 3VKIA 4C92A 3CCLQ 1YJ9T 3EHQA 5CQXA 2PUKB 4KT0E 2L2PA 1T3SA 2OX7A 4R0KA 2AZSA 1K73R 3KUFA 2L3RA 4EMKA 3OW2P 4M78D 2KQWA 2MAMA 3A8HB 4KRTA 5J26A 9ATCB 2ZPEB 2E12A 3AT1B 3S3NA 4IUTA 3Q1JA 1CSKA 2DF6A 2G3RA 1JRIA 5I2SA 4M7DA 4C92C 5HKCA 1WIEA 1WHGA 3REAB 1IREB 2LX9A 4OMNA 4M77C 1PG5B 2X4JA 4OMMA 4X9DA 2KXDA 4A4GA 5KYWB 1VQ7T 4MZTA 4ESRA 2DETA 3OS0A 2A7YA 2EBPA 1K0XA 1YP5A 2M0YA 4BB7A 5IXFA 3C4SA 4N0AA 4PJOA 1NLPC 2X3WD 2D8HA 4GLMA 1GFCA 5AT1B 4M7DC 4HVVA 3ME9A 1KJWA 4JJDA 3H41A 1BCOA 1AZGB 1KD1C 3RMSA 2LVMA 2ZAEA 2YT6A 1W1FA 2QAZA 1SSFA 5C6SA 3H0IA 1M8MA 3JCMh 2FZKB 2RMOA 1K9AA 3C0CA 1VQ5T 3LH0A 5A0LA 4PLLA 1RL2A 4N0AC 5IN1A 5GJWB 4F17A 1D1BA 3J7AF 4F7UB 2DD4A 2DRMA 2JT4A 1Q86C 3OMCA 4QW2A 3G4SA 1XJWB 4DBQA 3EFSA 4M75A 4FL6A 4ELZC 2DNUA 3CCJA 2DM1A 2RO0A 3NMZC 3PIOA 4QQDA 2JTEA 3EFRA 5LJ3f 2JW4A 1BCMA 4ATOA 5D6XA 4J83A 2YUPA 3EG0A 1PKTA 4OMOA 1RUWA 2H3EB 2YUNA 4D8KA 1I1JA 3CCJQ 3JSCA 4QVCA 3NGPA 1PCXA 4LE9A 1ZSZB 1UGVA 3MEWA 5LJ3j 2OTLA 4XU0A 2VVKA 1O9SA 3OY9A 4CC2A 1KQSP 1VQKA 2A3LA 2AHJB 4XU3A 1FYNA 1JJ2P 1W2BS 4CC4B 1BI2A 2OTLQ 3A8MB 5GAMh 1R77A 2CT3A 1RACB 2KI7A 3JB9J 1GCQC 2V8JA 4LUEA 1VQKQ 3V8JA 1Q82R 2RNAA 1OU8A 4PFZA 1S72T 4M78F 1JO8A 2F1LA 5DM7R 3G6ET 3BFMA 1Y7XA 2Z0WA 1WQWA 1BU1A 2DL4A 2HL3A 2CZ1B 2EKOA 1YIJT 1QP2A 1QVGS 3LWIA 4RTUA 2SRCA 4LDVA 3RKYA 2M51A 1Y96A 3QO3A 1VQ9A 5CVIA 1WQ7A 1CKAA 2LC4A 2EGCA 3QPHA 2KROA 2BZYA 1MMAA 1NBEB 1M90C 3OW2A 4PJJA 1RAHB 1UGQB 1XOVA 2HSPA 4FSSA 1VQ9Q 2RI3A 1SEMA 1ZSGA 2XDBA 1TS9A 1PM3A 1AHJB 1OYXA 8ATCB 2OTJT 2KRNA 1U5SA 1VQ6Q 5DLQE 1ZLMA 1WPYA 1LCKA 3JB9I 1TU0B 3DLMA 1M2VB 5KH6A 4NL3A 1HYOA 1C1AA 2F5TX 5I11A 1OQKA 2K4YA 3P8BB 1UHCA 3HTRA 4FW1A 3JCMX 1X2KA 4A63B 2RA2A 2MMPA 2EGAA 1QMCA 3FIFA 2KSSA 4FYVB 1YI2T 2E5QA 4QQGA 1VQPT 2IVWA 1T3LA 3QJYA 2RHUA 3PMTA 5LJ5e 3O8VA 1IGQA 1NYFA 2DRKA 2V8IA 1VQNT 2CH4W 2ZPBB 4DBRA 1ZUYA 3HRTA 1BK2A 5IHIA 1YJNA 2WSEE 2M9UA 3VS0A 2L3SA 2NUPA 1WHHA 1IHVA 1PRLC 1VQ4T 2O9VA 3EH2A 4WF2A 1W4SA 4M78A 4AFUC 3QYGB 2QEXT 1R0CB 4FT4A 2JOYA 2JN0A 1TTHB 2XDDA 1YHQA 2V1RA 4ELYC 3M54A 3T9NA 1VOMA 4OB3B 4MZMA 2EYYA 2EPDA 3EG9A 3VJPA 3HRSA 4ZTJA 2RQTA 1YHQQ 2VASA 5DY9A 4PKCC 1Q82U 3H8ZA 1BIBA 4M78C 5GANe 1TH7A 2D0QB 3UATA 3QBYA 2H3JA 4J9GA 3QSUA 4C5EA 2Y4XA 3V8LA 4M75G 1JXMA 1Z9ZA 2FRYA 3EG3A 1WJRA 2HKNA 4F14A 2HZYA 1JU5C 1K1ZA 1ARKA 2CSQA 1WXUA 4XAXB 1X6OA 1Q95G 2CS7A 5GAOm 2YRVA 3PGGA 3MHXA 4C0ZA 2YRDA 4J9DA 4C0DC 3PVQA 1DJ7B 1F1BB 1GFDA 3OBWA 1B07A 2VYTA 5J39A 1ZUUA 1Q7YR 4JDSA 1NJIU 4A4KA 4N4HA 1S1NA 4RTTA 1RI9A 2EGEA 3CC7T 2D1XA 5CKHA 2WSCE 2LQ8A 1M8VA 2HD0A 3VS2A 3CMAQ 1FMKA 2L0AA 4C0DB 1M1KR 3M0TA 4NOYA 1NYGA 2DL5A 3SHWA 3CCRQ 3RNJA 2QDLA 3VU3C 3BDUA 4OMLA 3RR6A 3VRYA 1W6XA 2O4XA 2DXUA 3A8OB 2WSFE 3TSWA 1GL5A 4IUUA 1MV3A 4C0GA 5KYXA 1E6HA 2DD5A 5GAOq 1FX7A 3EH1A 2COZA 2LCLA 3MP1A 2X35A 2EJGA 3BDLA 1VQ7A 3L2RA 2GNCA 3LGLA 4J9BA 4JZ4A 1M1FA 3KFVA 1MUZA 5D7UA 4JUVA 5GANh 3C95A 1VQ7Q 2V1QA 1PHTA 1LOJA 1ZQ1A 3VS6A 1M27C 3OYEA 3X28B 3JCMV 1I07A 2VC8A 4KBMB 1OZ2A 2XMFA 5KCHA 4C8QA 5C0MA 2OI3A 3CCUT 5LJ3d 1M30A 5CKFA 2XHCA 4MZPA 1VQ5A 3CBOA 4EMGA 1MNDA 4M7AA 2D6FA 1UGRB 2XDPA 2HQHA 2DZ9A 4BACA 3OW2S 4RCBA 1NZ9A 1OZ3A 1I8FA 3EFOA 3R6NA 1VQ5Q 2E6ZA 5CKEA 4C0FA 1RAEB 1SRMA 2YXYA 3G1JA 4E7ZA 3M0PA 1JBMA 2YLCA 1OV3A 3OS2A 3G7ZA 1MMGA 1VA7A 2DJQA 3RKWA 1T0HA 4TVRA 2YRCA 1FMWA 1ZHIA 2AKKA 1UJ0A 2KXCA 4P5NA 5LL6S 4BDZA 1BIAA 1RAFB 1EIFA 2XG8D 3SB2A 4BI4A 3MP6A 4FYWB 2DL7A 5HK3A 2BE9B 3UWNA 3OYIA 2QTVA 2P0QA 1YN8A 1N6AA 4F7UF 1N8RR 4C5HA 2EKHA 2PNIA 4FM4B 1QVFA 1EX4A 1ABQA 2MPXC 1WXBA 1SF9A 4HCZA 4PLIA 1M1KU 4X1VA 2V26A 2JNGA 1LVKA 1U06A 4ZTFA 4R56A 1ZA1B 2VKNA 2BTTA 3QWYA 1D09B 3JCMc 2CP3A 4DQ2A 1VIEA 1S72A 4FT2A
chains in the Genus database with same CATH topology
2C0TA 3NPFA 5GJWB 4F17A 4LN2A 2DRMA 2JT4A 1AWJA 1WYXA 2RQVA 1YWPA 2ABLA 5IH2A 1KIKA 1VYUA 2OAWA 5IXBA 1KFZA 1UDLA 2EW3A 2DNUA 2LQWA 2DM1A 3NMZC 3M0QA 4J9FA 1AWOA 1OPKA 2JTEA 2KT8A 2J6KA 3EG2A 4IIMA 2JW4A 1X6GA 2MIOA 5IHNA 5I22A 1WFWA 2YUPA 3EG0A 1PKTA 4OMOA 4CC7A 1RUWA 2O2OA 1J3TA 2YUNA 4D8KA 3O5ZA 1I1JA 1UECA 1GBRA 3REBB 3NGPA 4LE9A 1PNJA 3PE0A 2EYZA 1H92A 1SRLA 1UGVA 2KT1A 2VVKA 2GTJA 1TUDA 4J9IA 4Z88A 4LNPA 2FG0A 2ECZA 4CC2A 4DEXA 3SEMA 2K7AA 3I5SA 2J6OA 3ULRB 2LJ0A 3QWXX 1FYNA 1TUCA 2O31A 1TG0A 4CC4B 1BB9A 5HCKA 1ZBJA 1K76A 1NG2A 1RLQC 2DE0X 1HSQA 4K11A 2CT3A 3EGUA 4AFZC 4Z89A 1GCQC 1UJYA 2EYWA 1QWFA 4LUEA 1U3OA 2RNAA 2CH4A 2K9GA 1JO8A 3UA6A 1UTIA 1Y0MA 1BU1A 2DL4A 3LH5A 2ROLA 1NEGA 1X69A 2ED0A 4HCKA 2FPEA 2JS2A 4RTUA 2SRCA 1VYVA 2M51A 2HDAA 2KEAA 4AG2C 1GCPA 2CT4A 2DLPA 2ED1A 2DL3A 4JJBA 2JXBA 2D0NA 2GBQA 1CKAA 2EGCA 2KROA 1A0NB 2KRMA 3U23A 2BZYA 4J9HA 1I0CA 3A98A 4RTYA 1H3HA 4JPBW 2K79A 1PKSA 1XOVA 4RTVA 2HSPA 3UA7A 4FSSA 1SEMA 3EG1A 1CKBA 1ZSGA 1N5ZA 1H8KA 1KSWA 1WDXA 1RLPC 2FPFA 2KRNA 1U5SA 2KE9A 2CSIA 1ZLMA 1LCKA 2PTKA 2H8HA 4Z8AA 2A28A 2DYBA 5I11A 1JQQA 1T0JA 1UHCA 2LZ6B 1K4US 2JM9A 1SHGA 1V1CA 4RUGA 1X2KA 4A63B 2KGTA 2DBMA 2EGAA 2LX7A 4ORZA 2O9SA 2F2WA 2KBTA 3TVTA 2C0OA 4LUDA 1T3LA 2GQIA 1WLPB 2KRSA 5GJVB 2EQIA 2YDLA 3IQLA 2LCSA 2F2VA 4D8DA 2RPNA 1NYFA 2DRKA 2IIMA 2CH4W 2OJ2A 1ZUYA 3CQTA 2X3XD 1BK2A 5IHIA 2KYMA 2CREA 2O88A 2GGRA 3VS0A 3PVLA 2L3SA 3VS1A 1GCQA 4EIKA 4ZNXA 4CC3A 1PRLC 2O9VA 2W0ZA 4AFUC 1EFNA 4RTXA 1Y57A 2LJ3A 3VS7A 2V1RA 3EHRA 4JZ3A 4RTZA 2PZ1A 1X43A 2JMAA 3ZL7C 2E5KA 2EYYA 3THKA 1WX6A 4J9CA 2J06A 3NHNA 2EPDA 2RQTA 1Z9QA 1AWWA 3M0RA 4M4ZA 1E7OA 2K6DA 3UATA 3VRZA 1UG1A 2FRWA 4J9GA 2K2MA 5FWCA 2J7IA 2F2XA 2LP5A 1ZX6A 2EYXA 4F16A 2KYBA 2AZVA 2MCNA 2YUOA 3VS5A 1NLOC 1K0SA 4WCIA 1X27A 1JXMA 2DL8A 4GBQA 1WXTA 1BBZA 2YSQA 4OMPA 2G6FX 2JS0A 3TSZA 3GBQA 2W10A 1Z9ZA 2ESWA 2FRYA 3EG3A 1YNZA 5FWBA 4QT7A 2HBWA 4F14A 4E6RA 2C0IA 2DMOA 1JU5C 1K1ZA 1ARKA 2CSQA 1WXUA 2CUBA 2AK5A 2EVRA 1QCFA 2FEIA 2RN8A 2HEQA 2ROTA 2L3QA 2K3BA 1GBQA 2B86A 4J9DA 2BZ8A 2A08A 3PVQA 1GFDA 1OEBA 2FO0A 1B07A 2L3PA 1ABOA 4HVUA 4IIOA 1ZUUA 1QKWA 3RBBB 4Y92A 1S1NA 4RTTA 1RI9A 2EGEA 1QWEA 2D1XA 2JMCA 1YCSB 5IHKA 1AOJA 2LQNA 1AWXA 3VS2A 2L0AA 1FMKA 2JM8A 1HD3A 1QKXA 3M0TA 1NYGA 2DL5A 3VS3A 3SHWA 1JEGA 1X6BA 3RNJA 2QDLA 1G83A 1UHFA 1M3CA 2A36A 4OMLA 3VRYA 1W6XA 1JXOA 1SSHA 2DBKA 3UF4A 3TSWA 1YWOA 2YUQA 3M0SA 1AVZC 1AZEA 4HVWA 1GL5A 1M3BA 4J9EA 3I35A 2RQUA 2J6FA 1MV3A 1NEBA 1UE9A 3H0HA 2LNHB 1E6HA 2NWMA 5L23A 1ZUKA 4AG1C 2GNCA 1OPLA 4J9BA 4JZ4A 2LJ1A 4AFQC 3KFVA 1MUZA 3I9QA 3JV3A 4AFSC 2AKLA 2D8JA 1NM7A 4JJCA 3I5RA 1VYTA 1B3QA 3VS4A 3H0FA 2V1QA 1PHTA 1GRIA 1QLYA 3VS6A 1M27C 1SHFA 4RTWA 1I07A 2RQWA 2J05A 2XMFA 2MOXA 5ECAA 1UFFA 1PRMC 2DILA 2FPDA 1AEYA 2VWFA 4OMQA 2OI3A 2A37A 2HCKA 1M30A 3EHQA 2KR3A 1X2QA 1OOTA 1W70A 2RF0A 2L2PA 1T3SA 2GTOA 4R0KA 2AZSA 2DX1A 1M3AA 1PWTA 1WI7A 3R6NA 4KRTA 1HJDA 1SRMA 3M0PA 1CSKA 1OV3A 2DF6A 2KNBB 1G2BA 1VA7A 3FJ5A 2DJQA 1WIEA 2RQRA 5EC7A 1T0HA 3REAB 4OMNA 4OMMA 2AKKA 1UJ0A 2KXDA 2KXCA 4ESRA 2CUDA 1WA7A 2EBPA 1MV0B 1IO6A 1K0XA 1YP5A 2M0YA 5FW9A 2DL7A 5IXFA 2DA9A 1AD5A 1NLPC 2X3WD 2D8HA 4GLMA 2SEMA 1GFCA 1YN8A 4HVVA 2EKHA 4HXJA 1KJWA 4JJDA 2PNIA 3H41A 1AZGB 2BZXA 1ABQA 2ENMA 2I0NA 2LMJA 2P4RA 1WXBA 2YT6A 1W1FA 3H0IA 2CDTA 1M8MA 4X1VA 1SPKA 2RMOA 1U06A 1K9AA 4DEYA 2VKNA 1UUEA 2BTTA 3QWYA 3C0CA 1E6GA 2NUZA 3M0UA 2DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0T A;  3NPF A;  5GJW B;  4F17 A;  4LN2 A;  2DRM A;  2JT4 A;  1AWJ A;  1WYX A;  2RQV A;  1YWP A;  2ABL A;  5IH2 A;  1KIK A;  1VYU A;  2OAW A;  5IXB A;  1KFZ A;  1UDL A;  2EW3 A;  2DNU A;  2LQW A;  2DM1 A;  3NMZ C;  3M0Q A;  4J9F A;  1AWO A;  1OPK A;  2JTE A;  2KT8 A;  2J6K A;  3EG2 A;  4IIM A;  2JW4 A;  1X6G A;  2MIO A;  5IHN A;  5I22 A;  1WFW A;  2YUP A;  3EG0 A;  1PKT A;  4OMO A;  4CC7 A;  1RUW A;  2O2O A;  1J3T A;  2YUN A;  4D8K A;  3O5Z A;  1I1J A;  1UEC A;  1GBR A;  3REB B;  3NGP A;  4LE9 A;  1PNJ A;  3PE0 A;  2EYZ A;  1H92 A;  1SRL A;  1UGV A;  2KT1 A;  2VVK A;  2GTJ A;  1TUD A;  4J9I A;  4Z88 A;  4LNP A;  2FG0 A;  2ECZ A;  4CC2 A;  4DEX A;  3SEM A;  2K7A A;  3I5S A;  2J6O A;  3ULR B;  2LJ0 A;  3QWX X;  1FYN A;  1TUC A;  2O31 A;  1TG0 A;  4CC4 B;  1BB9 A;  5HCK A;  1ZBJ A;  1K76 A;  1NG2 A;  1RLQ C;  2DE0 X;  1HSQ A;  4K11 A;  2CT3 A;  3EGU A;  4AFZ C;  4Z89 A;  1GCQ C;  1UJY A;  2EYW A;  1QWF A;  4LUE A;  1U3O A;  2RNA A;  2CH4 A;  2K9G A;  1JO8 A;  3UA6 A;  1UTI A;  1Y0M A;  1BU1 A;  2DL4 A;  3LH5 A;  2ROL A;  1NEG A;  1X69 A;  2ED0 A;  4HCK A;  2FPE A;  2JS2 A;  4RTU A;  2SRC A;  1VYV A;  2M51 A;  2HDA A;  2KEA A;  4AG2 C;  1GCP A;  2CT4 A;  2DLP A;  2ED1 A;  2DL3 A;  4JJB A;  2JXB A;  2D0N A;  2GBQ A;  1CKA A;  2EGC A;  2KRO A;  1A0N B;  2KRM A;  3U23 A;  2BZY A;  4J9H A;  1I0C A;  3A98 A;  4RTY A;  1H3H A;  4JPB W;  2K79 A;  1PKS A;  1XOV A;  4RTV A;  2HSP A;  3UA7 A;  4FSS A;  1SEM A;  3EG1 A;  1CKB A;  1ZSG A;  1N5Z A;  1H8K A;  1KSW A;  1WDX A;  1RLP C;  2FPF A;  2KRN A;  1U5S A;  2KE9 A;  2CSI A;  1ZLM A;  1LCK A;  2PTK A;  2H8H A;  4Z8A A;  2A28 A;  2DYB A;  5I11 A;  1JQQ A;  1T0J A;  1UHC A;  2LZ6 B;  1K4U S;  2JM9 A;  1SHG A;  1V1C A;  4RUG A;  1X2K A;  4A63 B;  2KGT A;  2DBM A;  2EGA A;  2LX7 A;  4ORZ A;  2O9S A;  2F2W A;  2KBT A;  3TVT A;  2C0O A;  4LUD A;  1T3L A;  2GQI A;  1WLP B;  2KRS A;  5GJV B;  2EQI A;  2YDL A;  3IQL A;  2LCS A;  2F2V A;  4D8D A;  2RPN A;  1NYF A;  2DRK A;  2IIM A;  2CH4 W;  2OJ2 A;  1ZUY A;  3CQT A;  2X3X D;  1BK2 A;  5IHI A;  2KYM A;  2CRE A;  2O88 A;  2GGR A;  3VS0 A;  3PVL A;  2L3S A;  3VS1 A;  1GCQ A;  4EIK A;  4ZNX A;  4CC3 A;  1PRL C;  2O9V A;  2W0Z A;  4AFU C;  1EFN A;  4RTX A;  1Y57 A;  2LJ3 A;  3VS7 A;  2V1R A;  3EHR A;  4JZ3 A;  4RTZ A;  2PZ1 A;  1X43 A;  2JMA A;  3ZL7 C;  2E5K A;  2EYY A;  3THK A;  1WX6 A;  4J9C A;  2J06 A;  3NHN A;  2EPD A;  2RQT A;  1Z9Q A;  1AWW A;  3M0R A;  4M4Z A;  1E7O A;  2K6D A;  3UAT A;  3VRZ A;  1UG1 A;  2FRW A;  4J9G A;  2K2M A;  5FWC A;  2J7I A;  2F2X A;  2LP5 A;  1ZX6 A;  2EYX A;  4F16 A;  2KYB A;  2AZV A;  2MCN A;  2YUO A;  3VS5 A;  1NLO C;  1K0S A;  4WCI A;  1X27 A;  1JXM A;  2DL8 A;  4GBQ A;  1WXT A;  1BBZ A;  2YSQ A;  4OMP A;  2G6F X;  2JS0 A;  3TSZ A;  3GBQ A;  2W10 A;  1Z9Z A;  2ESW A;  2FRY A;  3EG3 A;  1YNZ A;  5FWB A;  4QT7 A;  2HBW A;  4F14 A;  4E6R A;  2C0I A;  2DMO A;  1JU5 C;  1K1Z A;  1ARK A;  2CSQ A;  1WXU A;  2CUB A;  2AK5 A;  2EVR A;  1QCF A;  2FEI A;  2RN8 A;  2HEQ A;  2ROT A;  2L3Q A;  2K3B A;  1GBQ A;  2B86 A;  4J9D A;  2BZ8 A;  2A08 A;  3PVQ A;  1GFD A;  1OEB A;  2FO0 A;  1B07 A;  2L3P A;  1ABO A;  4HVU A;  4IIO A;  1ZUU A;  1QKW A;  3RBB B;  4Y92 A;  1S1N A;  4RTT A;  1RI9 A;  2EGE A;  1QWE A;  2D1X A;  2JMC A;  1YCS B;  5IHK A;  1AOJ A;  2LQN A;  1AWX A;  3VS2 A;  2L0A A;  1FMK A;  2JM8 A;  1HD3 A;  1QKX A;  3M0T A;  1NYG A;  2DL5 A;  3VS3 A;  3SHW A;  1JEG A;  1X6B A;  3RNJ A;  2QDL A;  1G83 A;  1UHF A;  1M3C A;  2A36 A;  4OML A;  3VRY A;  1W6X A;  1JXO A;  1SSH A;  2DBK A;  3UF4 A;  3TSW A;  1YWO A;  2YUQ A;  3M0S A;  1AVZ C;  1AZE A;  4HVW A;  1GL5 A;  1M3B A;  4J9E A;  3I35 A;  2RQU A;  2J6F A;  1MV3 A;  1NEB A;  1UE9 A;  3H0H A;  2LNH B;  1E6H A;  2NWM A;  5L23 A;  1ZUK A;  4AG1 C;  2GNC A;  1OPL A;  4J9B A;  4JZ4 A;  2LJ1 A;  4AFQ C;  3KFV A;  1MUZ A;  3I9Q A;  3JV3 A;  4AFS C;  2AKL A;  2D8J A;  1NM7 A;  4JJC A;  3I5R A;  1VYT A;  1B3Q A;  3VS4 A;  3H0F A;  2V1Q A;  1PHT A;  1GRI A;  1QLY A;  3VS6 A;  1M27 C;  1SHF A;  4RTW A;  1I07 A;  2RQW A;  2J05 A;  2XMF A;  2MOX A;  5ECA A;  1UFF A;  1PRM C;  2DIL A;  2FPD A;  1AEY A;  2VWF A;  4OMQ A;  2OI3 A;  2A37 A;  2HCK A;  1M30 A;  3EHQ A;  2KR3 A;  1X2Q A;  1OOT A;  1W70 A;  2RF0 A;  2L2P A;  1T3S A;  2GTO A;  4R0K A;  2AZS A;  2DX1 A;  1M3A A;  1PWT A;  1WI7 A;  3R6N A;  4KRT A;  1HJD A;  1SRM A;  3M0P A;  1CSK A;  1OV3 A;  2DF6 A;  2KNB B;  1G2B A;  1VA7 A;  3FJ5 A;  2DJQ A;  1WIE A;  2RQR A;  5EC7 A;  1T0H A;  3REA B;  4OMN A;  4OMM A;  2AKK A;  1UJ0 A;  2KXD A;  2KXC A;  4ESR A;  2CUD A;  1WA7 A;  2EBP A;  1MV0 B;  1IO6 A;  1K0X A;  1YP5 A;  2M0Y A;  5FW9 A;  2DL7 A;  5IXF A;  2DA9 A;  1AD5 A;  1NLP C;  2X3W D;  2D8H A;  4GLM A;  2SEM A;  1GFC A;  1YN8 A;  4HVV A;  2EKH A;  4HXJ A;  1KJW A;  4JJD A;  2PNI A;  3H41 A;  1AZG B;  2BZX A;  1ABQ A;  2ENM A;  2I0N A;  2LMJ A;  2P4R A;  1WXB A;  2YT6 A;  1W1F A;  3H0I A;  2CDT A;  1M8M A;  4X1V A;  1SPK A;  2RMO A;  1U06 A;  1K9A A;  4DEY A;  2VKN A;  1UUE A;  2BTT A;  3QWY A;  3C0C A;  1E6G A;  2NUZ A;  3M0U A;  2DVJ A; 
#chains in the Genus database with same CATH topology
 1XQH A;  2EQM A;  1O75 A;  3JCM e;  3G6E A;  2JVV A;  1VQM T;  1UGP B;  1AWJ A;  3JCM b;  1YIJ A;  3DB4 A;  2RQV A;  3PFS A;  2ABL A;  4KUD K;  1VYU A;  2OAW A;  1FWZ A;  5IXB A;  1S72 Q;  1M2O A;  4B9W A;  1UDL A;  3G6E Q;  3X26 B;  1VQ8 T;  1LPL A;  2E41 A;  3M56 A;  4J9F A;  1YIJ Q;  1PD1 A;  2J6K A;  3S6W A;  1X6G A;  5GMK m;  2MIO A;  3CCE T;  2DFU A;  3QKJ A;  3BW1 A;  1IZ6 A;  4E2F B;  4D6W A;  1GBR A;  1QVP A;  3REB B;  2RD1 A;  4EMH A;  1RAA B;  5KE3 A;  2BKD N;  5KYW A;  5KYN A;  2YHT A;  4Z88 A;  2OTJ A;  4J9I A;  1KQS S;  1NE8 A;  5HY6 A;  3SEM A;  1G3Y A;  3ULR B;  3GOX A;  1JJ2 S;  3JB9 D;  2DJZ A;  5FU6 C;  5IT9 E;  3GLX A;  3CC4 T;  1RLQ C;  2DE0 X;  4OVA A;  4M75 E;  3HRU A;  2OTJ Q;  1V29 B;  4AFZ C;  2P0K A;  3CD6 T;  1UJY A;  2EYW A;  4M77 A;  3MEU A;  3RER A;  3NFC A;  5GAM e;  3KXT A;  2CH4 A;  1YI2 A;  4BE2 A;  3JCM J;  5LJ5 g;  1UTI A;  1VQP A;  2K5F A;  4HT9 A;  5LJ3 h;  3NTK A;  3TU4 K;  3LH5 A;  5FU6 B;  2DZC A;  3OBY A;  4HCK A;  4V2S A;  3ZFJ A;  2K2V A;  1YI2 Q;  2KEA A;  1VQP Q;  1VQN A;  1WNL A;  4E47 A;  2DL3 A;  2DXT A;  1K8A C;  3P8D A;  4Q5W A;  2KRM A;  3U23 A;  4J9H A;  2E3H A;  1GXI E;  2HSE B;  1H3H A;  2K79 A;  1TSF A;  5GMK j;  1VQN Q;  7AT1 B;  4R55 A;  1Y71 A;  1VQ4 A;  5GAN 4;  2RK1 A;  3EG1 A;  2RK2 A;  4BI8 B;  1H8K A;  3HP9 A;  2COY A;  4OGE A;  3GF5 A;  1RLP C;  1N8R U;  2KE9 A;  5D6Y A;  2E65 A;  2HBP A;  1VQ4 Q;  2PTK A;  2H8H A;  4C8Q G;  2XU8 A;  1UEB A;  3QYH B;  2A28 A;  2DYB A;  2KK4 A;  2QEX Q;  3EGX A;  1M4Z A;  2FVU A;  5GAN g;  5GAN 6;  2ZCF B;  3CCV T;  2QDY B;  2LQK A;  3QUI A;  5CQY A;  1Y07 A;  1BI3 A;  4BE0 A;  2L5Q A;  4MDX A;  2KGT A;  3RUX A;  2P0P A;  2LX7 A;  4L5G A;  4ME7 A;  4C5I A;  2PUO B;  2C0O A;  1OX9 A;  1PD0 A;  2WAC A;  1ZSZ C;  1KHI A;  3RIR A;  1NJI C;  2NUT B;  3L2Q A;  2KRS A;  2EQI A;  3IQL A;  2RPN A;  4ZN1 A;  2CP6 A;  4XU1 A;  2XKO C;  4X9C A;  3CQT A;  2X3X D;  2KYM A;  2QGG A;  2ZGW A;  5GAO l;  1HK9 A;  4A4E A;  3PVL A;  4XTV A;  1GCQ A;  4ZNX A;  3HPW A;  1PSE A;  4A53 A;  3CPW S;  1KC8 R;  3M58 A;  1BKB A;  1EFN A;  4B9X A;  3JB9 F;  1MMD A;  2VV5 A;  2E10 A;  3ASK A;  1I4K 1;  3EHR A;  5GAN 7;  4JS5 A;  1Q81 R;  1WJQ A;  1I81 A;  2PZ1 A;  3M57 A;  3THK A;  3TQ7 P;  3G71 T;  1Z9Q A;  3PIP A;  2NLU A;  1WHM A;  3QZ5 B;  3CCM T;  2DAQ A;  2RHY A;  1K73 U;  1M2V A;  2FRW A;  5FRO A;  2K2M A;  2J7I A;  4PJL A;  2EYX A;  3CC7 Q;  3OYM A;  2AZV A;  2MCN A;  3MO8 A;  4LDY A;  2YUO A;  3E1S A;  2GQV A;  1K0S A;  4ZN3 A;  2YSQ A;  4OMP A;  2CP7 A;  3GBQ A;  2DIG A;  4OGC A;  3CC2 T;  2ESW A;  1QQJ A;  2V8K A;  3DLL A;  2HBW A;  3HHT B;  2O01 E;  4E6R A;  2C0I A;  3CCS T;  2DMO A;  3L1A A;  1VQ6 A;  2RJE A;  4BY6 C;  4A4H A;  2CUB A;  1MNE A;  3URG A;  2RI5 A;  2RN8 A;  4IUQ A;  5CAI A;  3A5Z B;  2B86 A;  2BZ8 A;  1SKU B;  3OS1 A;  1FMV A;  2L3P A;  1ABO A;  4HVU A;  4CI0 C;  4C92 G;  4BY6 B;  3OSV A;  2PVO B;  1C6V X;  3INZ A;  4KGV B;  4M77 G;  2JMC A;  1B34 B;  1IRX A;  4OP0 A;  2JM8 A;  4JRQ A;  1HD3 A;  4MML A;  1QKX A;  2HQX A;  3QDR B;  1VQL T;  1JEG A;  1X6B A;  1YBY A;  1UHF A;  1M3C A;  1D1C A;  4M7D G;  1QW1 A;  1WGS A;  1JXO A;  1SSH A;  2RHZ A;  2DBK A;  3UF4 A;  2YUQ A;  2P84 A;  3M0S A;  3CCU Q;  1AZE A;  1IXD A;  4HVW A;  3TCJ A;  2DIQ A;  1M1K C;  2J6F A;  1UE9 A;  3CXC S;  1TWB A;  2DKG A;  2M16 A;  3OQ5 A;  3SFM A;  4PJO G;  1KC8 U;  2AT1 B;  1RAG B;  3SWN B;  1ZUK A;  4AG1 C;  4RKU E;  1OPL A;  2CP2 A;  2EJF A;  1KK7 A;  3OYN A;  2LJ1 A;  4EDU A;  2PVG B;  3J81 E;  3I5R A;  1VYT A;  1B3Q A;  3H0F A;  4RTW A;  3UT1 A;  2DER A;  5ECA A;  3CBM A;  4JJN K;  3OYF A;  4XK8 E;  2QTX A;  3JCM g;  1W2B P;  4J7I A;  2KR3 A;  2EQK A;  3A1P A;  1W70 A;  2RF0 A;  3OB9 A;  2X51 A;  2MF2 A;  2KDS A;  1VQM A;  3OSS C;  4DOW A;  3JRZ A;  5I2M A;  1BI1 A;  2DX1 A;  1M3A A;  1QP3 A;  1PWT A;  5KE2 A;  4OB1 B;  3G4S T;  3EGD B;  1M90 R;  2YLB A;  1VQM Q;  2KNB B;  2K57 A;  2LT1 A;  1VQ8 A;  1G2B A;  5GMK l;  2PQW A;  4LDW A;  2RQR A;  3V7S A;  1D1A A;  1QVF P;  3CCE A;  3QHS A;  3JCM W;  2HL5 C;  5DLO A;  3UPU A;  1WA7 A;  1VQ8 Q;  4J6Y A;  4C8Q E;  1D3B B;  1MV0 B;  2RHI A;  3CMA A;  4Z02 A;  2E64 A;  3FJP A;  4HT8 A;  4L59 A;  2KAF A;  5FW9 A;  3J80 E;  3CCE Q;  1AD5 A;  4KGZ B;  3X20 B;  2SEM A;  3CCR A;  2QQB A;  4PL6 A;  2BZX A;  2ATC B;  2ENM A;  2LMJ A;  3CC4 A;  2P4R A;  1YJ9 A;  5GAM g;  5A0D A;  3QXE B;  2CDT A;  5GAO n;  4DEY A;  4FW2 A;  1UUE A;  2NUZ A;  1N8R C;  3M0U A;  2FZC B;  2C0T A;  3NPF A;  2M1H A;  1KQ1 A;  3CC4 Q;  1AT1 B;  1YJ9 Q;  2JUF A;  3JB9 H;  1WYX A;  4II1 A;  3CD6 Q;  2Y4Y A;  1V76 A;  4FSX A;  4JRK A;  3ZBD A;  1PC0 A;  2OAU A;  3MEA A;  5CR2 A;  2M02 A;  2LQW A;  2RM4 A;  3M0Q A;  2KY9 A;  1AWO A;  1OPK A;  4IIM A;  3EG2 A;  3L42 A;  3R6O A;  2BE7 D;  5IHN A;  4PJO D;  4ZGJ B;  3RMQ A;  5I22 A;  5GAO p;  4CC7 A;  3FEO A;  3WVE B;  4ZGD B;  2DXC A;  2EQJ A;  4N4G A;  4DBH A;  1PNJ A;  4HCB A;  2EYZ A;  2GTJ A;  1TUD A;  4LNP A;  2ECZ A;  4DEX A;  4HKE A;  3QWX X;  1TUC A;  1TG0 A;  3I55 T;  1BB9 A;  5HK0 A;  1ZBJ A;  3HL8 A;  4J8O A;  1K76 A;  1NG2 A;  4Y28 E;  3CCV A;  3LX7 A;  3EGU A;  5EG2 A;  2L8D A;  4Z89 A;  5CCA A;  2HQE A;  3PNW C;  1U3O A;  2A0F B;  2JTM A;  4M75 D;  3UA6 A;  2DTO A;  3CCV Q;  2X9H A;  5L8R E;  1NEG A;  1X69 A;  2ED0 A;  1M90 U;  1D0X A;  2FPE A;  5GMK i;  1W2B A;  1N9R A;  3PTA A;  2EQU A;  5LJ3 e;  1VYV A;  3LWH A;  2HDA A;  1XNI A;  1GCP A;  1YFN A;  2CT4 A;  1HXD A;  3TRE A;  4M78 G;  2ED1 A;  1K73 C;  2JXB A;  2D0N A;  2GBQ A;  5LJ5 f;  1VIF A;  3A98 A;  3VV0 A;  4RTY A;  4OMF B;  4GLK A;  1PKS A;  1YJN T;  3E19 A;  3UA7 A;  4E7K A;  4C92 E;  3CME T;  1Q7Y U;  1CKB A;  1QVG A;  1N5Z A;  2R5A A;  4NL2 A;  5LJ5 j;  4M77 E;  1KSW A;  1XTD A;  3NTH A;  2QAS A;  4BE1 A;  2HKQ B;  1LNX A;  4DBF A;  3OYJ A;  4E7J A;  1MHN A;  4LD6 A;  3UDC A;  3VYH B;  5FU7 C;  2RJF A;  4IUR A;  2QQS A;  4C8Q B;  4M7D E;  1TOV A;  1K4U S;  1RI0 A;  2JM9 A;  3CCM A;  1SHG A;  2VGN A;  3P8H A;  3PMI A;  4XTY A;  6AT1 B;  5KYU B;  5GMK h;  3JCM P;  5A0G A;  2DBM A;  5KYY B;  4ORZ A;  2F2W A;  1KHC A;  3TVT A;  3G71 Q;  3VUB A;  5FRM A;  4LDX A;  5GAN f;  5FU7 B;  3CCM Q;  2DTI A;  3EFO B;  4KGX B;  1FXX A;  2LCS A;  2YDL A;  4PJO E;  2F2V A;  4D8D A;  5J3B A;  4BDY A;  1K9M R;  4PJO F;  1YJW T;  2IIM A;  4IUV A;  3OA6 A;  1G5V A;  4LXC A;  1VUB A;  3CC2 A;  2OJ2 A;  1JB0 E;  2X4W A;  2VGM A;  5GAN j;  1M5Q 1;  3I56 T;  3A8G B;  4FYX B;  2O88 A;  3CC2 Q;  2PVD B;  4IKF A;  3LYI A;  2W0Z A;  2L89 A;  1U1T A;  2RI2 A;  3CCS Q;  1G8X A;  1Y57 A;  1BI0 A;  3HKS A;  3L2V A;  4RMO A;  1WJS A;  4JZ3 A;  3OYA A;  3RES A;  1OX8 A;  3FRN A;  2EWN A;  3FLG A;  1X43 A;  2JMA A;  3ZL7 C;  4IUP A;  2CP0 A;  1KC8 C;  2VB6 A;  4PFO A;  1WX6 A;  4MMK A;  4M75 F;  4PJM A;  4PNO A;  2JZ2 A;  3M0R A;  4FYY B;  3A8L B;  2RB6 A;  2K6D A;  3VRZ A;  1UG1 A;  3OMG A;  5FWC A;  3MET A;  3AHU A;  2QK0 A;  4F16 A;  4JS4 A;  3M4G A;  2KYB A;  1P92 A;  1YIT T;  3E9G A;  1NLO C;  3MEV A;  2XK0 A;  2QYZ A;  4F7U A;  1X27 A;  1Q82 C;  2DL8 A;  4GBQ A;  1WXT A;  1BBZ A;  2G6F X;  1VQL Q;  3TSZ A;  2KVQ G;  1YNZ A;  2NUT A;  3E9F A;  4E7L A;  5D6W A;  2LRQ A;  2EVR A;  2IG0 A;  4XTZ A;  2QEX A;  1QCF A;  3D7S B;  2E70 A;  4EPC A;  2EJ9 A;  3CBP A;  1MMN A;  2HEQ A;  2ROT A;  2ZPI B;  4A4F A;  3OYD A;  2K3B A;  1KQ2 A;  2A08 A;  1ZSZ A;  3BY7 A;  3HFN A;  4EMK C;  2R5M A;  1I5L A;  1TUG B;  1VQO T;  3CCQ T;  4OB0 B;  4B6M A;  1IGU A;  4C92 B;  4M7A G;  1QWE A;  5IHK A;  4O6J A;  3M59 A;  2XI9 A;  4M77 B;  1AWX A;  4J7F A;  2EFI A;  2DEQ A;  1IHW A;  2EIF A;  4EMK B;  5CKD A;  4KUL A;  4RG8 A;  5GAN 2;  1K9M U;  1WZO A;  4PJO C;  2FB7 A;  4Y91 A;  3KBG A;  2XD0 A;  4M7D B;  3TEE A;  2EYQ A;  4J9E A;  4QKU A;  3I35 A;  3HFO A;  3L2W A;  3OS5 A;  2AIR B;  1NEB A;  3H0H A;  4J6X A;  3S3O A;  2K5I A;  1IB8 A;  2NWM A;  4DOV A;  5L23 A;  2QA4 T;  3JCM Q;  2RJD A;  2FL7 A;  3G4S Q;  4PJO B;  3OYC A;  4PJN A;  3M53 A;  4AFQ C;  1D0Z A;  2CGH A;  2QXF A;  4AFS C;  2LCC A;  2D8J A;  1NM7 A;  3LW5 E;  4KH1 B;  2DO3 A;  1RAD B;  3VS4 A;  4GY5 A;  3CC7 A;  4M75 C;  3EGX B;  1GRI A;  1QLY A;  1X01 A;  2RQW A;  3X24 B;  4OB2 B;  1PRM C;  2DIL A;  2HNI A;  2VWF A;  2XIC A;  3N5B B;  3L2U A;  2A37 A;  2GCX A;  1X2Q A;  1OOT A;  1OU9 A;  3M4Y A;  1RAB B;  2COW A;  2GTO A;  4M78 E;  4M75 B;  2QI2 A;  1B34 A;  3SDZ A;  2VUB A;  4PK4 A;  1ZBX A;  4J5Y A;  1K8A R;  1NPR A;  2QQ9 A;  4BUG A;  2DTH A;  3QJ6 A;  3FB9 A;  2ZPH B;  3JCM f;  3GIB A;  1MGQ A;  1WI7 A;  2VXE A;  4JLI A;  1HJD A;  4PFP A;  1D0Y A;  3FJ5 A;  5GAN 3;  1NPP A;  1QCO A;  5EC7 A;  1QVF S;  4RG2 A;  4BI3 A;  5GAO r;  4FU6 A;  2CUD A;  1UGS B;  1KD1 R;  1IO6 A;  3SD4 A;  2CZ6 B;  3SWN A;  5CK9 A;  2DA9 A;  3MCA B;  4C8Q D;  4E7H A;  2CYZ B;  3CCL T;  4JRP A;  2E6N A;  4HXJ A;  2X4Y A;  3I55 A;  4M7A D;  2I0N A;  4XU2 A;  1Q86 R;  2M0O A;  3CCU A;  1ZA2 B;  1Q7Y C;  1SPK A;  4OF1 A;  5LJ5 d;  2K5L A;  1NJI R;  1G3W A;  3SWN C;  1E6G A;  3QDF A;  4F7U G;  2DVJ A;  3I55 Q;  2R57 A;  4AT1 B;  4LN2 A;  3X25 B;  5LJ3 g;  1Y96 B;  3GNF B;  2QQA A;  5GAM f;  1YWP A;  5IH2 A;  1KIK A;  5GAN 8;  1KFZ A;  2R58 A;  2EW3 A;  5A2Q E;  2F5K A;  2KT8 A;  4JRI A;  5CKB A;  5GAM j;  3EGD A;  1WFW A;  1H64 1;  2O2O A;  2DYI A;  1Q81 U;  3C94 A;  3S3M A;  2RH2 A;  1J3T A;  2QG9 B;  3O5Z A;  1UEC A;  3BE3 A;  4LD9 K;  4FCY A;  2HMA A;  3CME A;  3PE0 A;  1H92 A;  1SRL A;  1R8O B;  1B7T A;  3CPW P;  2K3Y A;  2KT1 A;  5GAN d;  2FG0 A;  1YJN Q;  4ZGE B;  2GFU A;  1D3B A;  2K7A A;  3I5S A;  2J6O A;  2CKK A;  2LJ0 A;  3CME Q;  4JLG A;  4FIB A;  2O31 A;  2MK5 A;  5HCK A;  3QII A;  1OI1 A;  5KCO A;  3MPU B;  1HSQ A;  4K11 A;  2D9T A;  4DA4 A;  2CP5 A;  1QWF A;  2CZ0 B;  3FDR A;  1OUL A;  4NS5 A;  2K9G A;  5M9O A;  4E7S A;  1Y0M A;  1K8A U;  3DKM A;  1KQS A;  2ROL A;  4O5V A;  1JJ2 A;  3MKD A;  1C0M A;  2JS2 A;  1QVG P;  1YJW A;  4AG2 C;  3RKX A;  1BYM A;  2NUP B;  2DLP A;  3CCJ T;  4JJB A;  2LNV A;  3I56 A;  1RAI B;  4M78 B;  1A0N B;  4CRI A;  3OYB A;  1I0C A;  5CIU A;  4JPB W;  4RTV A;  1YJW Q;  1KD1 U;  4C8Q F;  1SG5 A;  1KG1 A;  2IPO B;  1N9S A;  2ZZD A;  4L6V 5;  3ZEH A;  2FYK A;  2DPP B;  3I56 Q;  1LJO A;  4M7A E;  2OTL T;  4C92 D;  4M7A F;  1WDX A;  3EG9 B;  2FPF A;  3V8K A;  3OYL A;  3GP8 A;  2CSI A;  4M77 D;  2E3I A;  1VQK T;  4Z8A A;  1Q86 U;  2NYS A;  2FZG B;  3M5A A;  1WHJ A;  3CD6 A;  1QCN A;  1JQQ A;  2C06 A;  1T0J A;  2LZ6 B;  1V1C A;  3WVD B;  4RUG A;  3PT9 A;  3OYH A;  4LDU A;  4KUI A;  4M7D D;  2O9S A;  2KBT A;  5LJ5 h;  4YTL A;  2RJC A;  3MJX A;  2FHD A;  5GMK e;  4LUD A;  1YIT A;  2GQI A;  1WLP B;  3C12 A;  2MYS A;  5GJV B;  2EAY A;  1R0B G;  1VQ9 T;  1EZZ B;  2I2L A;  1YIT Q;  2KMT A;  2CRE A;  1M9S A;  2GGR A;  2BIV A;  2YWW A;  3DB3 A;  4X34 A;  3VS1 A;  4EIK A;  3CXC P;  1VQ6 T;  4CC3 A;  4J6W A;  1K9M C;  2QQR A;  3E2U A;  2DXB A;  2Y90 A;  5IAY A;  4F04 B;  4RCC A;  4RTX A;  2E1H A;  2LJ3 A;  3VS7 A;  2ZPG B;  3F70 A;  5I21 A;  4RTZ A;  1VQO A;  3CCQ A;  2E5K A;  3VYG A;  3V7C A;  3VUZ A;  4J9C A;  2J06 A;  3NHN A;  1G3S A;  3JB9 G;  2ZPF B;  1AWW A;  2F69 A;  1G3T A;  2MWP A;  4BD3 A;  3CPW A;  4M4Z A;  1E7O A;  4UC4 A;  1VQO Q;  2GFA A;  3CCQ Q;  1TXQ A;  2O4X B;  2F2X A;  2LP5 A;  1ZX6 A;  3MP8 A;  5KYU A;  3VS5 A;  4E7I A;  2JTF A;  4WCI A;  5KYY A;  1X75 C;  4XTW A;  5KYX B;  5GAN 5;  4VUB A;  2JS0 A;  2W10 A;  2DK3 A;  3LLR A;  1PSF A;  5FWB A;  3JAM E;  4QT7 A;  2LDM A;  3QZ9 B;  3LGF A;  2GF7 A;  4C8Q C;  4WTO B;  2AK5 A;  4C92 F;  2QA4 A;  5FLX E;  2MWO A;  2RHX A;  5FRN A;  1UB4 A;  1U1S A;  2FEI A;  3M9Q A;  4M77 F;  4M7A C;  3M55 A;  1N27 A;  4HA8 A;  2L3Q A;  3H9N A;  1GBQ A;  3L2Z A;  3NTI A;  3OYK A;  1YHQ T;  1OEB A;  2FO0 A;  2QA4 Q;  3RDV A;  2XID A;  4IIO A;  4AMC A;  3G71 A;  4XTX A;  1QKW A;  3RBB B;  2CZ7 B;  3GNG A;  2B8A A;  4Y92 A;  4F7U E;  3JCM d;  2DVE A;  4XQ3 A;  4M7D F;  1YCS B;  3V7R A;  1AOJ A;  2X4X A;  2LQN A;  4M7A B;  2LTO A;  3GPL A;  2MI6 A;  3ER0 A;  4C5G A;  3VS3 A;  4N4I A;  4HCC A;  1G83 A;  8AT1 B;  4A54 A;  2A36 A;  3OYY A;  1ACM B;  2QGF B;  1YWO A;  1AVZ C;  1YCY A;  1WHL A;  1M3B A;  3CCS A;  1M1G A;  2RQU A;  3CEY A;  4QVD A;  2BUD A;  2LNH B;  3HSB A;  2VXF A;  4QQ6 A;  2K3X A;  3QG1 A;  4XTU A;  3WXM B;  3OYG A;  3I9Q A;  2E4H A;  3JV3 A;  1H3Z A;  2AKL A;  5AYF A;  1U8R A;  4JJC A;  3CMA T;  3CXC A;  3EAE A;  4KH0 B;  4ANJ A;  3FC3 A;  3CPF A;  2P4T A;  1I5O B;  3CCL A;  5GAM d;  4QVZ A;  1SHF A;  3CCR T;  2HAX A;  4MDW A;  3H6Z A;  1Q81 C;  1WHK A;  2J05 A;  2JJ9 A;  2MOX A;  1UFF A;  2FPD A;  5CO7 A;  2LT4 A;  1AEY A;  4OMQ A;  1VQL A;  2PU9 B;  2DEU A;  2HCK A;  3VKI A;  4C92 A;  3CCL Q;  1YJ9 T;  3EHQ A;  5CQX A;  2PUK B;  4KT0 E;  2L2P A;  1T3S A;  2OX7 A;  4R0K A;  2AZS A;  1K73 R;  3KUF A;  2L3R A;  4EMK A;  3OW2 P;  4M78 D;  2KQW A;  2MAM A;  3A8H B;  4KRT A;  5J26 A;  9ATC B;  2ZPE B;  2E12 A;  3AT1 B;  3S3N A;  4IUT A;  3Q1J A;  1CSK A;  2DF6 A;  2G3R A;  1JRI A;  5I2S A;  4M7D A;  4C92 C;  5HKC A;  1WIE A;  1WHG A;  3REA B;  1IRE B;  2LX9 A;  4OMN A;  4M77 C;  1PG5 B;  2X4J A;  4OMM A;  4X9D A;  2KXD A;  4A4G A;  5KYW B;  1VQ7 T;  4MZT A;  4ESR A;  2DET A;  3OS0 A;  2A7Y A;  2EBP A;  1K0X A;  1YP5 A;  2M0Y A;  4BB7 A;  5IXF A;  3C4S A;  4N0A A;  4PJO A;  1NLP C;  2X3W D;  2D8H A;  4GLM A;  1GFC A;  5AT1 B;  4M7D C;  4HVV A;  3ME9 A;  1KJW A;  4JJD A;  3H41 A;  1BCO A;  1AZG B;  1KD1 C;  3RMS A;  2LVM A;  2ZAE A;  2YT6 A;  1W1F A;  2QAZ A;  1SSF A;  5C6S A;  3H0I A;  1M8M A;  3JCM h;  2FZK B;  2RMO A;  1K9A A;  3C0C A;  1VQ5 T;  3LH0 A;  5A0L A;  4PLL A;  1RL2 A;  4N0A C;  5IN1 A;  5GJW B;  4F17 A;  1D1B A;  3J7A F;  4F7U B;  2DD4 A;  2DRM A;  2JT4 A;  1Q86 C;  3OMC A;  4QW2 A;  3G4S A;  1XJW B;  4DBQ A;  3EFS A;  4M75 A;  4FL6 A;  4ELZ C;  2DNU A;  3CCJ A;  2DM1 A;  2RO0 A;  3NMZ C;  3PIO A;  4QQD A;  2JTE A;  3EFR A;  5LJ3 f;  2JW4 A;  1BCM A;  4ATO A;  5D6X A;  4J83 A;  2YUP A;  3EG0 A;  1PKT A;  4OMO A;  1RUW A;  2H3E B;  2YUN A;  4D8K A;  1I1J A;  3CCJ Q;  3JSC A;  4QVC A;  3NGP A;  1PCX A;  4LE9 A;  1ZSZ B;  1UGV A;  3MEW A;  5LJ3 j;  2OTL A;  4XU0 A;  2VVK A;  1O9S A;  3OY9 A;  4CC2 A;  1KQS P;  1VQK A;  2A3L A;  2AHJ B;  4XU3 A;  1FYN A;  1JJ2 P;  1W2B S;  4CC4 B;  1BI2 A;  2OTL Q;  3A8M B;  5GAM h;  1R77 A;  2CT3 A;  1RAC B;  2KI7 A;  3JB9 J;  1GCQ C;  2V8J A;  4LUE A;  1VQK Q;  3V8J A;  1Q82 R;  2RNA A;  1OU8 A;  4PFZ A;  1S72 T;  4M78 F;  1JO8 A;  2F1L A;  5DM7 R;  3G6E T;  3BFM A;  1Y7X A;  2Z0W A;  1WQW A;  1BU1 A;  2DL4 A;  2HL3 A;  2CZ1 B;  2EKO A;  1YIJ T;  1QP2 A;  1QVG S;  3LWI A;  4RTU A;  2SRC A;  4LDV A;  3RKY A;  2M51 A;  1Y96 A;  3QO3 A;  1VQ9 A;  5CVI A;  1WQ7 A;  1CKA A;  2LC4 A;  2EGC A;  3QPH A;  2KRO A;  2BZY A;  1MMA A;  1NBE B;  1M90 C;  3OW2 A;  4PJJ A;  1RAH B;  1UGQ B;  1XOV A;  2HSP A;  4FSS A;  1VQ9 Q;  2RI3 A;  1SEM A;  1ZSG A;  2XDB A;  1TS9 A;  1PM3 A;  1AHJ B;  1OYX A;  8ATC B;  2OTJ T;  2KRN A;  1U5S A;  1VQ6 Q;  5DLQ E;  1ZLM A;  1WPY A;  1LCK A;  3JB9 I;  1TU0 B;  3DLM A;  1M2V B;  5KH6 A;  4NL3 A;  1HYO A;  1C1A A;  2F5T X;  5I11 A;  1OQK A;  2K4Y A;  3P8B B;  1UHC A;  3HTR A;  4FW1 A;  3JCM X;  1X2K A;  4A63 B;  2RA2 A;  2MMP A;  2EGA A;  1QMC A;  3FIF A;  2KSS A;  4FYV B;  1YI2 T;  2E5Q A;  4QQG A;  1VQP T;  2IVW A;  1T3L A;  3QJY A;  2RHU A;  3PMT A;  5LJ5 e;  3O8V A;  1IGQ A;  1NYF A;  2DRK A;  2V8I A;  1VQN T;  2CH4 W;  2ZPB B;  4DBR A;  1ZUY A;  3HRT A;  1BK2 A;  5IHI A;  1YJN A;  2WSE E;  2M9U A;  3VS0 A;  2L3S A;  2NUP A;  1WHH A;  1IHV A;  1PRL C;  1VQ4 T;  2O9V A;  3EH2 A;  4WF2 A;  1W4S A;  4M78 A;  4AFU C;  3QYG B;  2QEX T;  1R0C B;  4FT4 A;  2JOY A;  2JN0 A;  1TTH B;  2XDD A;  1YHQ A;  2V1R A;  4ELY C;  3M54 A;  3T9N A;  1VOM A;  4OB3 B;  4MZM A;  2EYY A;  2EPD A;  3EG9 A;  3VJP A;  3HRS A;  4ZTJ A;  2RQT A;  1YHQ Q;  2VAS A;  5DY9 A;  4PKC C;  1Q82 U;  3H8Z A;  1BIB A;  4M78 C;  5GAN e;  1TH7 A;  2D0Q B;  3UAT A;  3QBY A;  2H3J A;  4J9G A;  3QSU A;  4C5E A;  2Y4X A;  3V8L A;  4M75 G;  1JXM A;  1Z9Z A;  2FRY A;  3EG3 A;  1WJR A;  2HKN A;  4F14 A;  2HZY A;  1JU5 C;  1K1Z A;  1ARK A;  2CSQ A;  1WXU A;  4XAX B;  1X6O A;  1Q95 G;  2CS7 A;  5GAO m;  2YRV A;  3PGG A;  3MHX A;  4C0Z A;  2YRD A;  4J9D A;  4C0D C;  3PVQ A;  1DJ7 B;  1F1B B;  1GFD A;  3OBW A;  1B07 A;  2VYT A;  5J39 A;  1ZUU A;  1Q7Y R;  4JDS A;  1NJI U;  4A4K A;  4N4H A;  1S1N A;  4RTT A;  1RI9 A;  2EGE A;  3CC7 T;  2D1X A;  5CKH A;  2WSC E;  2LQ8 A;  1M8V A;  2HD0 A;  3VS2 A;  3CMA Q;  1FMK A;  2L0A A;  4C0D B;  1M1K R;  3M0T A;  4NOY A;  1NYG A;  2DL5 A;  3SHW A;  3CCR Q;  3RNJ A;  2QDL A;  3VU3 C;  3BDU A;  4OML A;  3RR6 A;  3VRY A;  1W6X A;  2O4X A;  2DXU A;  3A8O B;  2WSF E;  3TSW A;  1GL5 A;  4IUU A;  1MV3 A;  4C0G A;  5KYX A;  1E6H A;  2DD5 A;  5GAO q;  1FX7 A;  3EH1 A;  2COZ A;  2LCL A;  3MP1 A;  2X35 A;  2EJG A;  3BDL A;  1VQ7 A;  3L2R A;  2GNC A;  3LGL A;  4J9B A;  4JZ4 A;  1M1F A;  3KFV A;  1MUZ A;  5D7U A;  4JUV A;  5GAN h;  3C95 A;  1VQ7 Q;  2V1Q A;  1PHT A;  1LOJ A;  1ZQ1 A;  3VS6 A;  1M27 C;  3OYE A;  3X28 B;  3JCM V;  1I07 A;  2VC8 A;  4KBM B;  1OZ2 A;  2XMF A;  5KCH A;  4C8Q A;  5C0M A;  2OI3 A;  3CCU T;  5LJ3 d;  1M30 A;  5CKF A;  2XHC A;  4MZP A;  1VQ5 A;  3CBO A;  4EMG A;  1MND A;  4M7A A;  2D6F A;  1UGR B;  2XDP A;  2HQH A;  2DZ9 A;  4BAC A;  3OW2 S;  4RCB A;  1NZ9 A;  1OZ3 A;  1I8F A;  3EFO A;  3R6N A;  1VQ5 Q;  2E6Z A;  5CKE A;  4C0F A;  1RAE B;  1SRM A;  2YXY A;  3G1J A;  4E7Z A;  3M0P A;  1JBM A;  2YLC A;  1OV3 A;  3OS2 A;  3G7Z A;  1MMG A;  1VA7 A;  2DJQ A;  3RKW A;  1T0H A;  4TVR A;  2YRC A;  1FMW A;  1ZHI A;  2AKK A;  1UJ0 A;  2KXC A;  4P5N A;  5LL6 S;  4BDZ A;  1BIA A;  1RAF B;  1EIF A;  2XG8 D;  3SB2 A;  4BI4 A;  3MP6 A;  4FYW B;  2DL7 A;  5HK3 A;  2BE9 B;  3UWN A;  3OYI A;  2QTV A;  2P0Q A;  1YN8 A;  1N6A A;  4F7U F;  1N8R R;  4C5H A;  2EKH A;  2PNI A;  4FM4 B;  1QVF A;  1EX4 A;  1ABQ A;  2MPX C;  1WXB A;  1SF9 A;  4HCZ A;  4PLI A;  1M1K U;  4X1V A;  2V26 A;  2JNG A;  1LVK A;  1U06 A;  4ZTF A;  4R56 A;  1ZA1 B;  2VKN A;  2BTT A;  3QWY A;  1D09 B;  3JCM c;  2CP3 A;  4DQ2 A;  1VIE A;  1S72 A;  4FT2 A; 
#chains in the Genus database with same CATH homology
 2C0T A;  3NPF A;  5GJW B;  4F17 A;  4LN2 A;  2DRM A;  2JT4 A;  1AWJ A;  1WYX A;  2RQV A;  1YWP A;  2ABL A;  5IH2 A;  1KIK A;  1VYU A;  2OAW A;  5IXB A;  1KFZ A;  1UDL A;  2EW3 A;  2DNU A;  2LQW A;  2DM1 A;  3NMZ C;  3M0Q A;  4J9F A;  1AWO A;  1OPK A;  2JTE A;  2KT8 A;  2J6K A;  3EG2 A;  4IIM A;  2JW4 A;  1X6G A;  2MIO A;  5IHN A;  5I22 A;  1WFW A;  2YUP A;  3EG0 A;  1PKT A;  4OMO A;  4CC7 A;  1RUW A;  2O2O A;  1J3T A;  2YUN A;  4D8K A;  3O5Z A;  1I1J A;  1UEC A;  1GBR A;  3REB B;  3NGP A;  4LE9 A;  1PNJ A;  3PE0 A;  2EYZ A;  1H92 A;  1SRL A;  1UGV A;  2KT1 A;  2VVK A;  2GTJ A;  1TUD A;  4J9I A;  4Z88 A;  4LNP A;  2FG0 A;  2ECZ A;  4CC2 A;  4DEX A;  3SEM A;  2K7A A;  3I5S A;  2J6O A;  3ULR B;  2LJ0 A;  3QWX X;  1FYN A;  1TUC A;  2O31 A;  1TG0 A;  4CC4 B;  1BB9 A;  5HCK A;  1ZBJ A;  1K76 A;  1NG2 A;  1RLQ C;  2DE0 X;  1HSQ A;  4K11 A;  2CT3 A;  3EGU A;  4AFZ C;  4Z89 A;  1GCQ C;  1UJY A;  2EYW A;  1QWF A;  4LUE A;  1U3O A;  2RNA A;  2CH4 A;  2K9G A;  1JO8 A;  3UA6 A;  1UTI A;  1Y0M A;  1BU1 A;  2DL4 A;  3LH5 A;  2ROL A;  1NEG A;  1X69 A;  2ED0 A;  4HCK A;  2FPE A;  2JS2 A;  4RTU A;  2SRC A;  1VYV A;  2M51 A;  2HDA A;  2KEA A;  4AG2 C;  1GCP A;  2CT4 A;  2DLP A;  2ED1 A;  2DL3 A;  4JJB A;  2JXB A;  2D0N A;  2GBQ A;  1CKA A;  2EGC A;  2KRO A;  1A0N B;  2KRM A;  3U23 A;  2BZY A;  4J9H A;  1I0C A;  3A98 A;  4RTY A;  1H3H A;  4JPB W;  2K79 A;  1PKS A;  1XOV A;  4RTV A;  2HSP A;  3UA7 A;  4FSS A;  1SEM A;  3EG1 A;  1CKB A;  1ZSG A;  1N5Z A;  1H8K A;  1KSW A;  1WDX A;  1RLP C;  2FPF A;  2KRN A;  1U5S A;  2KE9 A;  2CSI A;  1ZLM A;  1LCK A;  2PTK A;  2H8H A;  4Z8A A;  2A28 A;  2DYB A;  5I11 A;  1JQQ A;  1T0J A;  1UHC A;  2LZ6 B;  1K4U S;  2JM9 A;  1SHG A;  1V1C A;  4RUG A;  1X2K A;  4A63 B;  2KGT A;  2DBM A;  2EGA A;  2LX7 A;  4ORZ A;  2O9S A;  2F2W A;  2KBT A;  3TVT A;  2C0O A;  4LUD A;  1T3L A;  2GQI A;  1WLP B;  2KRS A;  5GJV B;  2EQI A;  2YDL A;  3IQL A;  2LCS A;  2F2V A;  4D8D A;  2RPN A;  1NYF A;  2DRK A;  2IIM A;  2CH4 W;  2OJ2 A;  1ZUY A;  3CQT A;  2X3X D;  1BK2 A;  5IHI A;  2KYM A;  2CRE A;  2O88 A;  2GGR A;  3VS0 A;  3PVL A;  2L3S A;  3VS1 A;  1GCQ A;  4EIK A;  4ZNX A;  4CC3 A;  1PRL C;  2O9V A;  2W0Z A;  4AFU C;  1EFN A;  4RTX A;  1Y57 A;  2LJ3 A;  3VS7 A;  2V1R A;  3EHR A;  4JZ3 A;  4RTZ A;  2PZ1 A;  1X43 A;  2JMA A;  3ZL7 C;  2E5K A;  2EYY A;  3THK A;  1WX6 A;  4J9C A;  2J06 A;  3NHN A;  2EPD A;  2RQT A;  1Z9Q A;  1AWW A;  3M0R A;  4M4Z A;  1E7O A;  2K6D A;  3UAT A;  3VRZ A;  1UG1 A;  2FRW A;  4J9G A;  2K2M A;  5FWC A;  2J7I A;  2F2X A;  2LP5 A;  1ZX6 A;  2EYX A;  4F16 A;  2KYB A;  2AZV A;  2MCN A;  2YUO A;  3VS5 A;  1NLO C;  1K0S A;  4WCI A;  1X27 A;  1JXM A;  2DL8 A;  4GBQ A;  1WXT A;  1BBZ A;  2YSQ A;  4OMP A;  2G6F X;  2JS0 A;  3TSZ A;  3GBQ A;  2W10 A;  1Z9Z A;  2ESW A;  2FRY A;  3EG3 A;  1YNZ A;  5FWB A;  4QT7 A;  2HBW A;  4F14 A;  4E6R A;  2C0I A;  2DMO A;  1JU5 C;  1K1Z A;  1ARK A;  2CSQ A;  1WXU A;  2CUB A;  2AK5 A;  2EVR A;  1QCF A;  2FEI A;  2RN8 A;  2HEQ A;  2ROT A;  2L3Q A;  2K3B A;  1GBQ A;  2B86 A;  4J9D A;  2BZ8 A;  2A08 A;  3PVQ A;  1GFD A;  1OEB A;  2FO0 A;  1B07 A;  2L3P A;  1ABO A;  4HVU A;  4IIO A;  1ZUU A;  1QKW A;  3RBB B;  4Y92 A;  1S1N A;  4RTT A;  1RI9 A;  2EGE A;  1QWE A;  2D1X A;  2JMC A;  1YCS B;  5IHK A;  1AOJ A;  2LQN A;  1AWX A;  3VS2 A;  2L0A A;  1FMK A;  2JM8 A;  1HD3 A;  1QKX A;  3M0T A;  1NYG A;  2DL5 A;  3VS3 A;  3SHW A;  1JEG A;  1X6B A;  3RNJ A;  2QDL A;  1G83 A;  1UHF A;  1M3C A;  2A36 A;  4OML A;  3VRY A;  1W6X A;  1JXO A;  1SSH A;  2DBK A;  3UF4 A;  3TSW A;  1YWO A;  2YUQ A;  3M0S A;  1AVZ C;  1AZE A;  4HVW A;  1GL5 A;  1M3B A;  4J9E A;  3I35 A;  2RQU A;  2J6F A;  1MV3 A;  1NEB A;  1UE9 A;  3H0H A;  2LNH B;  1E6H A;  2NWM A;  5L23 A;  1ZUK A;  4AG1 C;  2GNC A;  1OPL A;  4J9B A;  4JZ4 A;  2LJ1 A;  4AFQ C;  3KFV A;  1MUZ A;  3I9Q A;  3JV3 A;  4AFS C;  2AKL A;  2D8J A;  1NM7 A;  4JJC A;  3I5R A;  1VYT A;  1B3Q A;  3VS4 A;  3H0F A;  2V1Q A;  1PHT A;  1GRI A;  1QLY A;  3VS6 A;  1M27 C;  1SHF A;  4RTW A;  1I07 A;  2RQW A;  2J05 A;  2XMF A;  2MOX A;  5ECA A;  1UFF A;  1PRM C;  2DIL A;  2FPD A;  1AEY A;  2VWF A;  4OMQ A;  2OI3 A;  2A37 A;  2HCK A;  1M30 A;  3EHQ A;  2KR3 A;  1X2Q A;  1OOT A;  1W70 A;  2RF0 A;  2L2P A;  1T3S A;  2GTO A;  4R0K A;  2AZS A;  2DX1 A;  1M3A A;  1PWT A;  1WI7 A;  3R6N A;  4KRT A;  1HJD A;  1SRM A;  3M0P A;  1CSK A;  1OV3 A;  2DF6 A;  2KNB B;  1G2B A;  1VA7 A;  3FJ5 A;  2DJQ A;  1WIE A;  2RQR A;  5EC7 A;  1T0H A;  3REA B;  4OMN A;  4OMM A;  2AKK A;  1UJ0 A;  2KXD A;  2KXC A;  4ESR A;  2CUD A;  1WA7 A;  2EBP A;  1MV0 B;  1IO6 A;  1K0X A;  1YP5 A;  2M0Y A;  5FW9 A;  2DL7 A;  5IXF A;  2DA9 A;  1AD5 A;  1NLP C;  2X3W D;  2D8H A;  4GLM A;  2SEM A;  1GFC A;  1YN8 A;  4HVV A;  2EKH A;  4HXJ A;  1KJW A;  4JJD A;  2PNI A;  3H41 A;  1AZG B;  2BZX A;  1ABQ A;  2ENM A;  2I0N A;  2LMJ A;  2P4R A;  1WXB A;  2YT6 A;  1W1F A;  3H0I A;  2CDT A;  1M8M A;  4X1V A;  1SPK A;  2RMO A;  1U06 A;  1K9A A;  4DEY A;  2VKN A;  1UUE A;  2BTT A;  3QWY A;  3C0C A;  1E6G A;  2NUZ A;  3M0U A;  2DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...