2DM1A

Solution structure of the second sh3 domain of human protein vav-2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
GSSGSSGGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein vav-2
publication title Solution structure of the second SH3 domain of human protein vav-2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dm1A00
2CH4A 1SPKA 1ZBJA 1JO8A 3RBBB 2F2WA 4RTTA 3IQLA 2OJ2A 1MV3A 3UF4A 3FJ5A 3H0FA 4AFQC 4J9FA 1FMKA 4RTWA 5ECAA 2LQWA 4OMOA 1W6XA 4J9EA 1UUEA 2KRMA 3VS4A 2LZ6B 2M0YA 2A28A 1NM7A 2EYZA 3M0SA 3H0HA 1MV0B 1ABOA 2EGCA 3PVLA 2RQVA 2KNBB 5IHKA 2DA9A 2RQWA 1UDLA 2HDAA 1BBZA 2AZSA 4GLMA 4HCKA 1I0CA 4OMNA 3EG1A 2BTTA 2MIOA 3EHQA 2GGRA 1TUDA 3EG2A 2J06A 2CH4W 2J7IA 2OI3A 1WDXA 5FWCA 4D8KA 1ZSGA 1WYXA 2HSPA 2DM1A 3TSWA 2D8HA 2BZ8A 4M4ZA 2JM9A 1J3TA 2VWFA 2EBPA 2KRNA 2DRMA 1BK2A 2CREA 2RN8A 4F14A 1PKTA 3VS3A 4E6RA 3R6NA 2V1RA 2D8JA 2LQNA 1ZUYA 4Z8AA 2K3BA 3TSZA 1TUCA 1X2QA 2ROTA 4HVWA 2CT3A 2J6OA 1RI9A 4ORZA 3VRZA 1WFWA 2YT6A 1K4US 1X6BA 2L2PA 1GL5A 1AEYA 2F2VA 1KIKA 2ED0A 3NPFA 4AG2C 1K76A 3VRYA 1M8MA 4LE9A 2LJ1A 2C0IA 2DMOA 1AOJA 2XMFA 3EHRA 1M27C 1QWEA 2EGAA 2EKHA 2J6FA 2EQIA 4EIKA 2DLPA 1OPLA 1SEMA 1QKXA 4RTYA 1SRLA 4J9GA 1NYFA 1QCFA 1UTIA 2GTOA 2DYBA 4OMLA 2KR3A 1IO6A 2NUZA 3I5RA 2LJ0A 2YUPA 2EVRA 3H0IA 4FSSA 2RQUA 2H8HA 1Y57A 1PKSA 2FO0A 2ABLA 4LUEA 1W70A 1X6GA 4JJCA 1JXOA 1PHTA 2DF6A 4CC7A 4AFUC 1HD3A 2DL8A 4CC3A 3M0TA 2DBMA 2DX1A 4X1VA 1WA7A 1X43A 4Z89A 3VS1A 1XOVA 1GBRA 1GCQA 2EYYA 2EW3A 2RQRA 3RNJA 1WI7A 2YUQA 2PNIA 2ESWA 2ROLA 3REBB 1GBQA 1K0SA 2KYBA 2M51A 1GFDA 2J6KA 2W10A 4D8DA 2YUNA 1YN8A 4RTVA 1OEBA 1I07A 1ZX6A 2BZYA 2JMCA 1NEBA 1RLQC 2AKLA 4ZNXA 4F17A 1SRMA 1U5SA 1M3BA 4CC2A 5HCKA 2LCSA 1MUZA 2AKKA 2D0NA 1ZUKA 2CUDA 2KT8A 2LMJA 1K9AA 1AWJA 2AK5A 4HVVA 4GBQA 3ZL7C 1ARKA 2K2MA 1ABQA 2VVKA 2FEIA 2KBTA 3KFVA 1JXMA 2ENMA 2A36A 5IXFA 2DILA 1RUWA 1PRMC 1U3OA 2C0TA 1WX6A 4Z88A 4JPBW 2JS0A 4J9CA 2RNAA 2JW4A 1AZEA 2DBKA 2GBQA 5GJVB 2AZVA 1E6GA 1YP5A 1ZUUA 2X3WD 3NHNA 2GQIA 2YSQA 1AWXA 1AD5A 2YDLA 3UA6A 2KGTA 4OMPA 1H3HA 1SHGA 1NYGA 4AFZC 1VA7A 2SEMA 1H92A 1UHFA 4K11A 1T0HA 2A37A 5I11A 3THKA 4Y92A 1FYNA 3SHWA 1X27A 1X69A 2L3SA 2D1XA 4JJDA 5EC7A 3UA7A 4AFSC 3ULRB 2X3XD 2VKNA 3CQTA 1N5ZA 2IIMA 1VYTA 2DVJA 4IIMA 2EGEA 4ESRA 4RTUA 3REAB 1NLOC 2DL3A 2I0NA 1UG1A 2K6DA 1AZGB 4IIOA 4J9DA 4HXJA 1UECA 2RPNA 1OV3A 1WXTA 1G2BA 2V1QA 2SRCA 1WXUA 1AVZC 2L3QA 1Z9ZA 2JS2A 1JU5C 1VYVA 3TVTA 3VS2A 2W0ZA 1WIEA 3C0CA 2KXCA 2DRKA 1LCKA 5FWBA 4HVUA 1X2KA 1UJYA 2HEQA 2CT4A 1JEGA 1CKBA 3I9QA 1BU1A 1B07A 2FRWA 1NLPC 2JMAA 2ECZA 4JZ3A 4R0KA 3M0UA 2JM8A 2DL4A 4RTZA 2O31A 1QKWA 1SHFA 1RLPC 3VS6A 2B86A 2QDLA 2EYXA 4LN2A 3A98A 4JZ4A 2EPDA 4QT7A 2DNUA 2DL5A 1AWWA 2NWMA 1H8KA 2P4RA 2CDTA 2DJQA 1NG2A 2YUOA 4J9BA 2KEAA 1HJDA 1UHCA 1WLPB 4OMMA 3NGPA 1HSQA 2MOXA 1B3QA 2FPEA 2GNCA 2LJ3A 2PZ1A 1EFNA 1YWOA 1JQQA 2JXBA 1S1NA 1T3SA 2FPFA 3PVQA 2KYMA 2O2OA 1KFZA 2CSIA 1M3AA 4CC4B 4LNPA 5IHNA 5FW9A 2K79A 1U06A 1T3LA 4A63B 3LH5A 1GCQC 2JTEA 3H41A 2DE0X 2RF0A 2FG0A 3QWXX 4F16A 1W1FA 3EGUA 2HCKA 4DEXA 5L23A 2K7AA 4RTXA 2LX7A 4OMQA 2BZXA 2DL7A 3QWYA 2EYWA 2O9VA 1CKAA 2PTKA 1Y0MA 2GTJA 2KT1A 1SSHA 1PWTA 1OPKA 1PNJA 1E6HA 1Z9QA 3SEMA 4J9HA 4WCIA 2KROA 3I5SA 1OOTA 3EG0A 1BB9A 5GJWB 5IHIA 2G6FX 1K0XA 2KRSA 4RUGA 2RMOA 1UJ0A 3VS0A 2O88A 1GRIA 2HBWA 1K1ZA 4LUDA 3M0RA 1QWFA 3PE0A 2O9SA 2FPDA 3JV3A 2A08A 1VYUA 1UE9A 1T0JA 2JT4A 3M0PA 1M30A 1KSWA 2L0AA 2ED1A 3VS5A 5I22A 1M3CA 3U23A 1GFCA 1I1JA 5IXBA 4KRTA 3GBQA 2KXDA 3EG3A 4JJBA 1PRLC 4DEYA 2FRYA 1TG0A 2LP5A 1GCPA 2L3PA 4AG1C 5IH2A 2E5KA 1UGVA 2C0OA 3UATA 2J05A 2LNHB 1ZLMA 1A0NB 1G83A 4J9IA 2OAWA 2MCNA 2F2XA 1KJWA 2CUBA 2CSQA 1WXBA 3O5ZA 1AWOA 1E7OA 2K9GA 1NEGA 3I35A 1V1CA 3M0QA 1QLYA 1UFFA 3NMZC 3VS7A 1YCSB 1YWPA 1YNZA 2KE9A 2RQTA 1CSKA
chains in the Genus database with same CATH superfamily
1ZBJA 1JO8A 5J3BA 5CKBA 3RBBB 4RTTA 4LD6A 1MV3A 1VQPQ 3FJ5A 3CBMA 1FMKA 2MWPA 4LDUA 4MZTA 5ECAA 3MPUB 5GMKe 4OMOA 4ZN1A 1JBMA 1VIFA 3PMIA 2NUTB 2YXYA 2A28A 4JLGA 1NM7A 1LVKA 3CEYA 3OYNA 2COWA 4XTUA 3H0HA 3VV0A 3I55A 1Q82C 2DA9A 1UDLA 3PFSA 4O6JA 5KCOA 4GLMA 2AZSA 4N4IA 3L2VA 4A4FA 5CKEA 5CCAA 3CC2Q 5CVIA 2J06A 2CH4W 3LGLA 2DFUA 1KQSS 3FEOA 3G71Q 1KD1R 4M4ZA 1J3TA 4M75B 2EBPA 3CMET 4RG2A 1YJ9Q 1QP2A 2DRMA 3CCJA 4Z02A 1SSFA 4M7AA 1KQ2A 3OS1A 3PGGA 2DKGA 2QQ9A 1VQPT 4XU0A 2QI2A 2LTOA 4DA4A 2CT3A 3CCQA 2Y4XA 2Y90A 4L6V5 2ZPIB 2FZGB 1WFWA 2VC8A 3RDVA 1K4US 3PIOA 4RMOA 4JRPA 2DYIA 2ED0A 1BI0A 3NPFA 4KGZB 4AG2C 1M1KC 3X24B 4BE1A 4CRIA 1RL2A 2YRCA 2C0IA 1M27C 1QWEA 2EQIA 5EG2A 8ATCB 1OI1A 4WF2A 3QZ9B 1R0CB 1FWZA 5LJ5f 1UGPB 2M1HA 2RA2A 4OMLA 1K9MU 3PIPA 1IO6A 3EAEA 4N0AC 3I5RA 2YUPA 4PK4A 1WQWA 1YHQA 3ASKA 3C95A 2FO0A 2K5IA 5FROA 4IUTA 1X6GA 4QVZA 4XTXA 4A54A 3A5ZB 5KYXA 2KMTA 5GAMf 1HD3A 3M0TA 2DPPB 1BCOA 4E7KA 3HFNA 5KE3A 3V7CA 4C5EA 1GBRA 3V7RA 2NUTA 2RQRA 2VGMA 4BI4A 3LWIA 1WI7A 3OW2S 5GANf 1MMGA 1VQ7A 3GLXA 2L89A 3M59A 1PG5B 4JLIA 2DERA 4BE2A 1ZX6A 2JMCA 3MEVA 1TOVA 1M8VA 3RERA 1G8XA 1JB0E 3CBOA 4XU1A 1Y07A 4BUGA 2CZ1B 3LGFA 4A4KA 4N4HA 1OQKA 2OTJA 1MUZA 3OBWA 4PFOA 2FHDA 2LMJA 4GLKA 3VUZA 1QCNA 4M75A 4KGXB 4HVVA 3OYDA 2JN0A 1K73C 5FU7B 1WQ7A 3HTRA 2VVKA 2E65A 2HMAA 3JRZA 2ENMA 1RAHB 1BI1A 5KYYB 1N8RU 1YCYA 1WX6A 2ZPBB 1TXQA 3OS5A 3I55Q 1BI2A 3CMAT 4M7DD 3M54A 2D0QB 3JCMf 4ELZC 4QW2A 3CPWA 2CZ6B 3NHNA 2GQIA 1AD5A 3DLLA 2EQUA 1D3BB 3E9GA 1VQLT 4A4HA 4AFZC 2EFIA 1YITT 5I11A 1TTHB 3MCAB 5GAOr 3BDLA 2BIVA 3CBPA 1KK7A 1VOMA 3CCJQ 2LQKA 2FL7A 1JJ2A 2L3SA 4AFSC 3S6WA 2X3XD 4FM4B 1N5ZA 2EGEA 3V8LA 4ESRA 4C8QD 1RI0A 2CYZB 2P4TA 3SWNC 4YTLA 1NLOC 1UG1A 1Y96B 3E2UA 1VQOA 1UECA 1QQJA 3CCQQ 1OV3A 1G2BA 1PC0A 2QXFA 2WSCE 1RAGB 1Z9ZA 2QQBA 1JU5C 3TVTA 5KYWB 3UWNA 2IG0A 1Q7YR 2QA4A 1YI2T 1XTDA 2HEQA 4WTOB 3SFMA 2RI3A 3I56T 1Q82U 2K3XA 3EGXB 2JMAA 3I55T 3EH2A 3NTIA 3J80E 2WACA 4RKUE 4XK8E 2RK1A 3OYBA 2P0KA 2LT4A 1QKWA 1SHFA 1KG1A 2OX7A 1RLPC 4JRIA 1RADB 4KUDK 2QDLA 1PD0A 2FZCB 2DXCA 2EPDA 4JZ4A 2DL5A 2LCCA 2NWMA 3HPWA 2DJQA 1NG2A 4OGCA 2M16A 2KEAA 3ER0A 5GMKj 1HJDA 3G4SA 3N5BB 1WLPB 1QMCA 5FU6C 3CXCS 5GMKl 3OSVA 4C5IA 2XI9A 5KYYA 1JQQA 2K3YA 2MMPA 2QGGA 3CD6T 1S1NA 2FPFA 3OYIA 1QVGP 2G3RA 3HP9A 3MHXA 3PVQA 1Q95G 4C0FA 1VQ7Q 2XHCA 5FW9A 3CCQT 4PJNA 4XAXB 4A63B 1MGQA 4ZN3A 2RJEA 3A8MB 2LDMA 1MNDA 1U1SA 4OF1A 3JB9D 4M7DF 3QWXX 4ZTFA 5LJ5h 4DEXA 1EIFA 3QPHA 4X9DA 2K7AA 1FXXA 5HK0A 1M1KU 2LX7A 2BZXA 3QWYA 2EYWA 1D3BA 2R57A 4FU6A 1W2BS 4M7AD 2M9UA 2DXUA 4M7DB 4MMKA 2OTJQ 3X20B 1PWTA 2EWNA 5IHIA 2KRSA 1UJ0A 3S3NA 1VQ8T 4JUVA 5GAMh 3M0RA 3OYLA 4XTWA 1G5VA 3ZBDA 3JV3A 2A08A 1T0JA 2DTIA 2ED1A 3VS5A 3PT9A 2X4YA 1Y96A 3MJXA 1M3CA 2WSEE 3U23A 1VQ5A 2EQMA 4C8QF 2KXDA 5GANh 1TG0A 2LP5A 4DOVA 4M7DE 2L3PA 3HFOA 2C0OA 5KYWA 4EMKC 2J05A 2EJFA 5GAN2 2DO3A 1VQ4A 1A0NB 2RHYA 1AT1B 1G83A 1H641 2D6FA 4P5NA 1VQNA 2DD5A 3O5ZA 5LJ3e 3GNGA 1NEGA 3I35A 3EGXA 3SB2A 1K8AC 1OYXA 1FMWA 1UFFA 3NMZC 1YNZA 3QJYA 1M90U 3HRSA 4NL2A 2WSFE 3QDRB 1K9MC 2O01E 1XQHA 2HD0A 1MMNA 2E3IA 2MWOA 3DLMA 1M2VB 2I2LA 1KC8R 5CAIA 5C0MA 4C8QE 2LQWA 5CR2A 3CCUA 1ACMB 1S72T 1VQKT 1UUEA 1VQOQ 2KRMA 2XKOC 2E5QA 1I81A 1KHIA 2M0YA 2M0OA 4HKEA 1TWBA 2DVEA 4F7UB 3JCMh 1IXDA 4FW2A 3TEEA 3M4YA 3E19A 2RQVA 2KNBB 2QA4Q 5IHKA 1MMDA 1KQSA 3OYKA 3CCEQ 2RQWA 2E4HA 5FRMA 2QAZA 2EYQA 1I0CA 2FVUA 3EG1A 2BTTA 2MIOA 5GAOp 4IUUA 2GGRA 4MDXA 1PSFA 1Q86R 4LDWA 4M75D 3DKMA 5D6YA 3EGDB 2X4WA 4D8KA 3H9NA 2PUOB 3OYYA 3JB9F 2DM1A 3TSWA 4VUBA 5FLXE 4M7DA 1BIAA 4LDXA 2VWFA 2KRNA 4E7LA 5D6WA 4F7UE 3M4GA 3C12A 4M7AF 1Q81U 4EMHA 3G4SQ 5KCHA 3VS3A 4E6RA 1YFNA 3CCRT 3OSSC 4MMLA 4Z8AA 2K3BA 1OU9A 3WXMB 1P92A 2DXBA 4HVWA 1RI9A 5LL6S 1HYOA 3A8LB 3VRZA 2YT6A 1I4K1 2DTOA 2L3RA 1G3TA 3URGA 4PJOA 1BCMA 5GAN4 1VQ6T 1KIKA 4II1A 4IUVA 2LJ1A 5D7UA 4DBHA 2XMFA 5CO7A 2DLPA 2KDSA 4PLLA 1SEMA 1VQ9A 1OX8A 3CCET 1SRLA 1NYFA 4KULA 1WZOA 4M7AE 3CCLT 3JB9I 3NTHA 2QG9B 4V2SA 1M5Q1 1XNIA 2RQUA 1Y57A 1PKSA 2DEQA 1TU0B 3CCVT 4FSXA 1JXOA 1PHTA 1VIEA 2DF6A 1M2VA 4E7SA 4AFUC 4F04B 4CC3A 1VQ5Q 2DBMA 2OTLT 2DX1A 5I2SA 5KYXB 4R55A 1XOVA 2GQVA 4Q5WA 2EW3A 2YRVA 3RNJA 4F7UA 2PNIA 1VQ4Q 2ESWA 5CQYA 3AHUA 1VQNQ 2K2VA 2V8KA 2M51A 5IN1A 5GAOm 2J6KA 4C8QC 3LX7A 4D8DA 1D1AA 1UGSB 2YUNA 3NFCA 4RTVA 4HT8A 1V76A 1NEBA 1KQ1A 4ANJA 2E64A 1SRMA 1U5SA 2LCSA 3JCMc 4E7IA 3EGDA 1U8RA 5LJ3g 6AT1B 2AKKA 2AT1B 2HAXA 2KT8A 4M75F 3OS2A 2AK5A 2K4YA 4RCCA 2X51A 5GAOl 5IT9E 2KBTA 3P8BB 3CCUQ 1JXMA 1ZSZB 1YJNA 3L1AA 2RJCA 2A36A 3LW5E 2K57A 4C0DB 3Q1JA 1TSFA 4JPBW 4PL6A 3GPLA 1YJWA 2X4JA 1DJ7B 1AZEA 4J7IA 3OMGA 2F5TX 1NPRA 1ZUUA 4LDYA 2KGTA 4OMPA 2XD0A 1SHGA 1NYGA 4M75E 2AHJB 3M5AA 2PU9B 2SEMA 1H92A 3LWHA 4J7FA 3AT1B 5CQXA 1VUBA 1N8RR 2HL5C 3GOXA 1K8AU 2E6ZA 5A0DA 1JJ2P 1WHLA 2D1XA 4JJDA 5EC7A 3ULRB 4PFZA 2GFUA 1YIJA 2V8IA 2IIMA 2DIGA 4OB1B 2R58A 2RJFA 4RTUA 3L2UA 4JDSA 3OYMA 3D7SB 3CC2T 2E70A 2PVOB 1AZGB 3QG1A 4IIOA 4J9DA 4M7AC 2CP3A 3G71T 2CP5A 2V1QA 1SF9A 4KH0B 2SRCA 4PLIA 1BI3A 1RAIB 3MO8A 2X4XA 1WXUA 1IRXA 1YJ9T 5AYFA 3C0CA 4DQ2A 2KXCA 5KYNA 3G1JA 3QXEB 3T9NA 3X28B 2DZ9A 2RHXA 3JCMQ 2CT4A 1JEGA 3X25B 3JCMV 3I9QA 1NLPC 1VQ9Q 2A7YA 2DL4A 2DAQA 1OZ3A 2DJZA 3CXCA 5DY9A 3VS6A 2KAFA 2B86A 1GXIE 1M90C 5LJ5g 3CCSA 2DNUA 3G6EA 3M56A 2P4RA 4BB7A 2DIQA 2YUOA 4J9BA 1UGQB 2RHUA 4PFPA 4A53A 3NGPA 2HNIA 2PQWA 2ATCB 3V8JA 4J6WA 1M2OA 3VUBA 1V29B 2GNCA 4FYVB 1R77A 1ZSZA 1RAAB 3QZ5B 5GAMg 3QO3A 1WHJA 1Q82R 1T3SA 1C0MA 3H8ZA 5LJ3d 4C5GA 2YRDA 3SD4A 1W2BA 3BDUA 1M3AA 1BKBA 3OYGA 3QYGB 3A1PA 3L42A 2E41A 3LH5A 4C92F 2CZ7B 2RK2A 2DE0X 2FG0A 4F16A 2V26A 4C0ZA 4M77B 2E1HA 2HCKA 4B6MA 2DL7A 2O9VA 1O75A 4C92B 1Y0MA 2GTJA 2XIDA 2QEXA 3QSUA 4XQ3A 1PNJA 1Z9QA 4WCIA 3OS0A 3I5SA 3EG0A 1N27A 1BB9A 3L2ZA 2Y4YA 4RUGA 4PJLA 2RHZA 4J83A 1Q81C 2CKKA 1UGRB 4LUDA 1YJNQ 1QP3A 4BE0A 2AIRB 1MNEA 3PE0A 4M75C 4PJOD 4KT0E 2JT4A 3V8KA 2L0AA 5I22A 4M77E 4J5YA 4PKCC 3UT1A 4D6WA 4BY6B 1QVPA 1GFCA 3BE3A 4KRTA 4JJBA 1PRLC 1H3ZA 4C92E 1NE8A 4JS5A 1YJWQ 1M1KR 4AG1C 2R5AA 1ZLMA 2P0PA 3EFRA 2C06A 3M55A 2MCNA 2F2XA 2NYSA 1KJWA 2CUBA 1WXBA 1AWOA 1E7OA 3RMQA 4M78F 2VUBA 4BI3A 2VGNA 1QLYA 3VS7A 1YWPA 3CC7A 2HBPA 2KE9A 2HZYA 3H6ZA 5KH6A 3CC4A 5GMKm 4OGEA 4FIBA 1IGQA 4M78B 4A4GA 1SPKA 1TUGB 4FYYB 2YWWA 4RCBA 1YIJQ 2F2WA 3IQLA 2OJ2A 5A0GA 5KE2A 2FYKA 3UF4A 1QVFS 2XDDA 4LD9K 3H0FA 3EH1A 4HCBA 1R0BG 4DBFA 3VYGA 1YHQQ 4XTVA 4M7DG 4ZGJB 4J9EA 4OB2B 1ZBXA 3VS4A 2LZ6B 2H3EB 2QASA 4J6YA 3S3OA 2EJGA 3CCJT 2VXFA 1MV0B 3PVLA 3RKWA 1Y71A 1KQSP 4ZGEB 2RJDA 1M90R 4M78E 2HDAA 2E10A 4PJJA 1BBZA 1RAEB 2EQKA 4OVAA 3EHQA 2VASA 3M57A 3TU4K 1TUDA 4M77A 4PJMA 2J7IA 1WDXA 3CCSQ 4C92A 2HSPA 3FC3A 2KQWA 4C8QG 1K73R 3FB9A 1PD1A 2JM9A 3G6EQ 4NS5A 5DLQE 2BUDA 1M1FA 1BK2A 1ZHIA 1W4SA 1X01A 3JCMb 4F14A 5GAN5 3OMCA 1NZ9A 4GY5A 1PKTA 3R6NA 2LRQA 4L59A 2KI7A 5CKDA 3TSZA 1NJIC 2PVGB 2ZPFB 1C1AA 2ROTA 5FU7C 3MP6A 1HXDA 2QYZA 1YHQT 4PJOF 2L2PA 3VYHB 3OA6A 1AEYA 1IGUA 1I8FA 2JNGA 3CMEA 1K76A 3VRYA 3JCMP 3A8HB 3KXTA 1Q7YU 4PJOB 3FRNA 3EHRA 2FZKB 2EGAA 4EIKA 2J6FA 4F7UG 4J9GA 1WHMA 2QEXQ 1UTIA 3J81E 2DYBA 3NTKA 1D0ZA 4DBQA 1VQPA 2DK3A 2NUZA 3P8HA 2LJ0A 5D6XA 3OYAA 1VQ7T 3GIBA 1IREB 4M78A 2EVRA 4FSSA 5GMKh 1EZZB 3CCST 1M1GA 4LUEA 1NPPA 4JJCA 4PJOE 4FYXB 5GMKi 1FMVA 2OTJT 4X1VA 2EKOA 1X43A 4Z89A 1GCQA 2EYYA 3JB9G 4F7UF 3P8DA 3JCMW 1GBQA 1K0SA 2KYBA 4M7AG 2DZCA 1GFDA 3C4SA 3META 2W10A 4XTYA 4EMGA 4IKFA 2ZPGB 2BZYA 4QQGA 3G7ZA 3OY9A 1RLQC 3CC7Q 2RI2A 3CC4Q 4ZNXA 1M3BA 4CC2A 5HCKA 2DXTA 2D0NA 1ZUKA 2CUDA 3FIFA 1O9SA 1X6OA 1K9AA 1AWJA 4GBQA 2K2MA 1ABQA 1KHCA 2HKQB 5AT1B 2JJ9A 1I5LA 1B34B 5IXFA 3PTAA 1PRMC 1U3OA 4FL6A 2A0FB 4RG8A 3M58A 2COZA 4XU2A 3MEUA 3JAME 4J9CA 2JW4A 2JTFA 2HQXA 2KY9A 5HKCA 1WJQA 4J6XA 1E6GA 2X3WD 2YSQA 1BYMA 2L8DA 1AWXA 2XDPA 3ME9A 1VQOT 2XICA 1H3HA 1UB4A 1VA7A 1UHFA 4FYWB 5LJ5e 2CP6A 2PVDB 1FYNA 1EX4A 1Y7XA 3KUFA 1X27A 2CGHA 2QA4T 5A0LA 1X69A 2RB6A 1D0XA 3CMAA 4J8OA 3VKIA 3BW1A 2A3LA 3LYIA 2HL3A 1VYTA 2DVJA 4M7DC 2ZZDA 5DM7R 1AHJB 4FCYA 2RI5A 4KGVB 3REAB 1F1BB 2DL3A 3HKSA 1KC8U 4HXJA 4TVRA 5GAMe 2RPNA 1FX7A 2QDYB 3OW2A 3HSBA 1VQLA 2QQRA 1OU8A 1VYVA 1YITA 2W0ZA 1LCKA 3RKYA 4M75G 3G4ST 3CMEQ 4HVUA 5GANe 1X2KA 4IURA 2PUKB 3CCMA 1G3SA 1CKBA 1K8AR 1B07A 4HCCA 4QQ6A 3JB9J 4PJOC 2ECZA 5GAOn 4JZ3A 4R0KA 2OAUA 3M0UA 2JM8A 1K9MR 1PM3A 4RTZA 2O31A 2XDBA 3CXCP 4ZTJA 1B7TA 1Q86U 4AMCA 5DLOA 2F69A 4LN2A 3A98A 2FB7A 2XU8A 1ZA2B 1AWWA 5CKHA 3QJ6A 1H8KA 2RO0A 2CDTA 3QDFA 4QQDA 2COYA 1YI2A 4OMMA 5J39A 4MZMA 1OX9A 2CP7A 1B3QA 1IHVA 4X34A 2LJ3A 3I56A 3HL8A 1EFNA 1YWOA 2JXBA 1B34A 1WHKA 3FLGA 5HY6A 3QUIA 1OULA 4KH1B 1NJIU 2JVVA 4EPCA 1W2BP 4M77D 2LT1A 1ZA1B 4A4EA 4X9CA 4LNPA 5IHNA 4FT2A 1U06A 1T3LA 1C6VX 3JCMe 2JTEA 4C92D 3C94A 3MP8A 3RKXA 4OP0A 3GNFB 8AT1B 1QVGS 3WVEB 4N0AA 2LC4A 5L23A 4RTXA 4C5HA 1VQ5T 4OMQA 3JB9H 4AT1B 3CPWP 1CKAA 2PTKA 2LQ8A 3V7SA 1PCXA 1SKUB 1OPKA 1E6HA 3CD6A 3SWNB 1VQ4T 2KROA 1OOTA 2CZ0B 4QVDA 4B9WA 1K0XA 1VQNT 2G6FX 4MDWA 2EJ9A 3LH0A 2HQEA 2RMOA 3PNWC 3O8VA 2LNVA 2ZAEA 1GRIA 2FPDA 2JOYA 1VYUA 1UE9A 4ATOA 2P84A 4HA8A 1I1JA 3M9QA 3GBQA 3OQ5A 3EG3A 4E7ZA 4DEYA 4BDYA 3HRTA 1GCPA 3FDRA 1UGVA 4N4GA 2YHTA 3MP1A 2OAWA 3CCUT 1Q7YC 4BD3A 1VQ8A 4OMFB 1QVFA 4M78D 3M0QA 1VQMA 5LJ3j 4DBRA 1YCSB 4E47A 5FU6B 2DEUA 5GAN7 1LPLA 3RR6A 1CSKA 2CH4A 2CP2A 1WHGA 2Z0WA 3KBGA 3CMAQ 1M4ZA 2M02A 4M77G 2VV5A 4IUQA 2GFAA 2RH2A 2YLBA 4AFQC 4J9FA 4RTWA 4C92G 5CIUA 3HRUA 2MK5A 2XG8D 1W6XA 1KD1U 1N9SA 3MKDA 2YLCA 1VQLQ 2RM4A 2MAMA 1R8OB 2EYZA 3M0SA 1YITQ 2IPOB 3LLRA 1ABOA 2EGCA 3R6OA 3DB4A 5GAN6 1QW1A 2EQJA 3L2RA 3WVDB 3CCMQ 2MF2A 1X75C 4HCKA 3OYJA 4OMNA 3ZFJA 4M77F 3QYHB 4PNOA 5GANg 1S72A 1VQKA 3EG2A 2H3JA 4KUIA 2OI3A 5FWCA 2V8JA 1ZSGA 1G3WA 1WYXA 2D8HA 2BZ8A 3GF5A 2BKDN 4DOWA 3SWNA 2CREA 5KYUB 2RN8A 1QCOA 3VJPA 1YI2Q 2V1RA 2D8JA 2LQNA 1VQ9T 1ZUYA 4C0GA 2K5FA 3I56Q 3L2QA 1TUCA 1X2QA 4EMKB 3EG9B 2QQSA 4M78G 2J6OA 2GF7A 4ORZA 4CI0C 4MZPA 1X6BA 1ZSZC 5CKFA 1GL5A 3GP8A 2F2VA 5LJ3h 3RESA 2QGFB 5GAOq 3OYHA 1M8MA 4LE9A 1BIBA 4C0DC 2F1LA 2X9HA 2DMOA 1AOJA 5CK9A 2EKHA 1OPLA 3CCRA 1QKXA 5LJ5j 2QTXA 4RTYA 1QCFA 3CCMT 2GTOA 3JCMg 2ZGWA 5J26A 2KR3A 3CD6Q 2LVMA 4LDVA 4EDUA 5I21A 2LCLA 3H0IA 3RUXA 2DTHA 2H8HA 3MEWA 2ABLA 4BDZA 1VQ6A 4E7HA 1D0YA 1W70A 2QTVA 9ATCB 5GAMj 4CC7A 1WGSA 2DL8A 1KC8C 4ME7A 4FW1A 3TQ7P 1WA7A 5I2MA 3CCEA 3VS1A 2CP0A 2EAYA 4B9XA 5GAN3 4ELYC 4JS4A 3CCLA 5GANj 2YUQA 3OB9A 2KVQG 2ROLA 3REBB 5LJ5d 2NUPB 2QK0A 1YJNT 1VQ8Q 1YN8A 3CCVA 1OEBA 1I07A 2D9TA 3VU3C 3A8OB 1VQMQ 3DB3A 3JCMX 3RIRA 2KSSA 2AKLA 2VXEA 4F17A 2CS7A 1Q86C 1YJWT 2P0QA 2OTLA 3S3MA 4Y28E 1G3YA 1IHWA 4PJOG 2JUFA 2QQAA 2XK0A 5GAMd 3TCJA 3ZL7C 1ARKA 5KYUA 4BI8B 4QKUA 2FEIA 3KFVA 3EFOB 2BE7D 4LXCA 1N9RA 2K5LA 2MI6A 3F70A 5GANd 5FRNA 2DILA 2L5QA 3UPUA 1RUWA 4E2FB 4EMKA 3EG9A 2C0TA 1IB8A 4Z88A 3CPFA 3ZEHA 2JS0A 1YIJT 2RNAA 3E1SA 2DBKA 1LNXA 2GBQA 2O4XB 2E6NA 5GJVB 2AZVA 1YP5A 1JRIA 1NBEB 1U1TA 2GCXA 2YDLA 3UA6A 1I5OB 1IZ6A 1S72Q 1VQKQ 4Y91A 2ZPHB 4O5VA 4K11A 2DD4A 1T0HA 2A37A 5IAYA 3THKA 4Y92A 4NL3A 3SHWA 3JSCA 3CPWS 3UDCA 1Q81R 4M77C 3SDZA 4JRKA 1VQMT 3UA7A 4ZGDB 3HHTB 4XU3A 3MEAA 2RHIA 2VKNA 3CQTA 4C92C 4IIMA 3FJPA 1HK9A 1D09B 2X35A 3J7AF 2I0NA 2K6DA 2JTMA 7AT1B 3JCMd 2EIFA 3OW2P 1WXTA 1JJ2S 4C8QB 3G6ET 3QHSA 1AVZC 2L3QA 2JS2A 3VS2A 3A8GB 1XJWB 1WIEA 2DRKA 4KBMB 5FWBA 4FT4A 1UJYA 4BY6C 3L2WA 2JZ2A 1BU1A 2NUPA 2FRWA 3INZA 3CCRQ 1WPYA 2LX9A 3CC2A 2HSEB 2EYXA 1OZ2A 3G71A 4QT7A 2VB6A 1RABB 5HK3A 2ZCFB 1YJ9A 1K73U 1PSEA 1VQ6Q 2HKNA 1UHCA 2ZPEB 1TH7A 4M78C 1HSQA 2MOXA 3EFOA 2FPEA 2QEXT 4XTZA 1KD1C 1MHNA 2PZ1A 3OYCA 1QVGA 5A2QE 3BY7A 3JCMJ 2KYMA 3CCLQ 3QIIA 1LOJA 3QBYA 2E12A 2DETA 2O2OA 1KFZA 4OB0B 3RMSA 2CSIA 4UC4A 4CC4B 2K79A 1GCQC 1SG5A 1RAFB 3QKJA 3OYEA 3CCVQ 3M53A 2O4XA 3H41A 2RF0A 5C6SA 1W1FA 3EGUA 4E7JA 3X26B 1D1BA 1UEBA 2MPXC 3OYFA 4HT9A 2MYSA 4OB3B 3E9FA 2KT1A 2OTLQ 1MMAA 1SSHA 2NLUA 3PMTA 3SEMA 4J9HA 1WJRA 1M9SA 1YBYA 2VYTA 5GJWB 4M7AB 2KK4A 1ZQ1A 1WHHA 1N6AA 1N8RC 4QVCA 1NJIR 5GAN8 3VS0A 3TREA 2O88A 2HBWA 1WNLA 1K1ZA 2BE9B 1QWFA 2F5KA 2O9SA 3CC7T 3M0PA 3CC4T 1M30A 1KSWA 4JRQA 2HQHA 4L5GA 5IXBA 4BACA 1LJOA 4C8QA 2FRYA 2IVWA 1RACB 5IH2A 2E5KA 3UATA 2LNHB 2RD1A 4J9IA 2E3HA 2CSQA 3OBYA 4NOYA 2K9GA 5L8RE 1QVFP 1V1CA 1WJSA 2B8AA 2R5MA 5LJ3f 1D1CA 4HCZA 4JJNK 1TS9A 4R56A 4IUPA 3BFMA 2RQTA 3EFSA 5M9OA
chains in the Genus database with same CATH topology
2CH4A 1SPKA 1ZBJA 1JO8A 3RBBB 2F2WA 4RTTA 3IQLA 2OJ2A 1MV3A 3UF4A 3FJ5A 3H0FA 4AFQC 4J9FA 1FMKA 4RTWA 5ECAA 2LQWA 4OMOA 1W6XA 4J9EA 1UUEA 2KRMA 3VS4A 2LZ6B 2M0YA 2A28A 1NM7A 2EYZA 3M0SA 3H0HA 1MV0B 1ABOA 2EGCA 3PVLA 2RQVA 2KNBB 5IHKA 2DA9A 2RQWA 1UDLA 2HDAA 1BBZA 2AZSA 4GLMA 4HCKA 1I0CA 4OMNA 3EG1A 2BTTA 2MIOA 3EHQA 2GGRA 1TUDA 3EG2A 2J06A 2CH4W 2J7IA 2OI3A 1WDXA 5FWCA 4D8KA 1ZSGA 1WYXA 2HSPA 2DM1A 3TSWA 2D8HA 2BZ8A 4M4ZA 2JM9A 1J3TA 2VWFA 2EBPA 2KRNA 2DRMA 1BK2A 2CREA 2RN8A 4F14A 1PKTA 3VS3A 4E6RA 3R6NA 2V1RA 2D8JA 2LQNA 1ZUYA 4Z8AA 2K3BA 3TSZA 1TUCA 1X2QA 2ROTA 4HVWA 2CT3A 2J6OA 1RI9A 4ORZA 3VRZA 1WFWA 2YT6A 1K4US 1X6BA 2L2PA 1GL5A 1AEYA 2F2VA 1KIKA 2ED0A 3NPFA 4AG2C 1K76A 3VRYA 1M8MA 4LE9A 2LJ1A 2C0IA 2DMOA 1AOJA 2XMFA 3EHRA 1M27C 1QWEA 2EGAA 2EKHA 2J6FA 2EQIA 4EIKA 2DLPA 1OPLA 1SEMA 1QKXA 4RTYA 1SRLA 4J9GA 1NYFA 1QCFA 1UTIA 2GTOA 2DYBA 4OMLA 2KR3A 1IO6A 2NUZA 3I5RA 2LJ0A 2YUPA 2EVRA 3H0IA 4FSSA 2RQUA 2H8HA 1Y57A 1PKSA 2FO0A 2ABLA 4LUEA 1W70A 1X6GA 4JJCA 1JXOA 1PHTA 2DF6A 4CC7A 4AFUC 1HD3A 2DL8A 4CC3A 3M0TA 2DBMA 2DX1A 4X1VA 1WA7A 1X43A 4Z89A 3VS1A 1XOVA 1GBRA 1GCQA 2EYYA 2EW3A 2RQRA 3RNJA 1WI7A 2YUQA 2PNIA 2ESWA 2ROLA 3REBB 1GBQA 1K0SA 2KYBA 2M51A 1GFDA 2J6KA 2W10A 4D8DA 2YUNA 1YN8A 4RTVA 1OEBA 1I07A 1ZX6A 2BZYA 2JMCA 1NEBA 1RLQC 2AKLA 4ZNXA 4F17A 1SRMA 1U5SA 1M3BA 4CC2A 5HCKA 2LCSA 1MUZA 2AKKA 2D0NA 1ZUKA 2CUDA 2KT8A 2LMJA 1K9AA 1AWJA 2AK5A 4HVVA 4GBQA 3ZL7C 1ARKA 2K2MA 1ABQA 2VVKA 2FEIA 2KBTA 3KFVA 1JXMA 2ENMA 2A36A 5IXFA 2DILA 1RUWA 1PRMC 1U3OA 2C0TA 1WX6A 4Z88A 4JPBW 2JS0A 4J9CA 2RNAA 2JW4A 1AZEA 2DBKA 2GBQA 5GJVB 2AZVA 1E6GA 1YP5A 1ZUUA 2X3WD 3NHNA 2GQIA 2YSQA 1AWXA 1AD5A 2YDLA 3UA6A 2KGTA 4OMPA 1H3HA 1SHGA 1NYGA 4AFZC 1VA7A 2SEMA 1H92A 1UHFA 4K11A 1T0HA 2A37A 5I11A 3THKA 4Y92A 1FYNA 3SHWA 1X27A 1X69A 2L3SA 2D1XA 4JJDA 5EC7A 3UA7A 4AFSC 3ULRB 2X3XD 2VKNA 3CQTA 1N5ZA 2IIMA 1VYTA 2DVJA 4IIMA 2EGEA 4ESRA 4RTUA 3REAB 1NLOC 2DL3A 2I0NA 1UG1A 2K6DA 1AZGB 4IIOA 4J9DA 4HXJA 1UECA 2RPNA 1OV3A 1WXTA 1G2BA 2V1QA 2SRCA 1WXUA 1AVZC 2L3QA 1Z9ZA 2JS2A 1JU5C 1VYVA 3TVTA 3VS2A 2W0ZA 1WIEA 3C0CA 2KXCA 2DRKA 1LCKA 5FWBA 4HVUA 1X2KA 1UJYA 2HEQA 2CT4A 1JEGA 1CKBA 3I9QA 1BU1A 1B07A 2FRWA 1NLPC 2JMAA 2ECZA 4JZ3A 4R0KA 3M0UA 2JM8A 2DL4A 4RTZA 2O31A 1QKWA 1SHFA 1RLPC 3VS6A 2B86A 2QDLA 2EYXA 4LN2A 3A98A 4JZ4A 2EPDA 4QT7A 2DNUA 2DL5A 1AWWA 2NWMA 1H8KA 2P4RA 2CDTA 2DJQA 1NG2A 2YUOA 4J9BA 2KEAA 1HJDA 1UHCA 1WLPB 4OMMA 3NGPA 1HSQA 2MOXA 1B3QA 2FPEA 2GNCA 2LJ3A 2PZ1A 1EFNA 1YWOA 1JQQA 2JXBA 1S1NA 1T3SA 2FPFA 3PVQA 2KYMA 2O2OA 1KFZA 2CSIA 1M3AA 4CC4B 4LNPA 5IHNA 5FW9A 2K79A 1U06A 1T3LA 4A63B 3LH5A 1GCQC 2JTEA 3H41A 2DE0X 2RF0A 2FG0A 3QWXX 4F16A 1W1FA 3EGUA 2HCKA 4DEXA 5L23A 2K7AA 4RTXA 2LX7A 4OMQA 2BZXA 2DL7A 3QWYA 2EYWA 2O9VA 1CKAA 2PTKA 1Y0MA 2GTJA 2KT1A 1SSHA 1PWTA 1OPKA 1PNJA 1E6HA 1Z9QA 3SEMA 4J9HA 4WCIA 2KROA 3I5SA 1OOTA 3EG0A 1BB9A 5GJWB 5IHIA 2G6FX 1K0XA 2KRSA 4RUGA 2RMOA 1UJ0A 3VS0A 2O88A 1GRIA 2HBWA 1K1ZA 4LUDA 3M0RA 1QWFA 3PE0A 2O9SA 2FPDA 3JV3A 2A08A 1VYUA 1UE9A 1T0JA 2JT4A 3M0PA 1M30A 1KSWA 2L0AA 2ED1A 3VS5A 5I22A 1M3CA 3U23A 1GFCA 1I1JA 5IXBA 4KRTA 3GBQA 2KXDA 3EG3A 4JJBA 1PRLC 4DEYA 2FRYA 1TG0A 2LP5A 1GCPA 2L3PA 4AG1C 5IH2A 2E5KA 1UGVA 2C0OA 3UATA 2J05A 2LNHB 1ZLMA 1A0NB 1G83A 4J9IA 2OAWA 2MCNA 2F2XA 1KJWA 2CUBA 2CSQA 1WXBA 3O5ZA 1AWOA 1E7OA 2K9GA 1NEGA 3I35A 1V1CA 3M0QA 1QLYA 1UFFA 3NMZC 3VS7A 1YCSB 1YWPA 1YNZA 2KE9A 2RQTA 1CSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH4 A;  1SPK A;  1ZBJ A;  1JO8 A;  3RBB B;  2F2W A;  4RTT A;  3IQL A;  2OJ2 A;  1MV3 A;  3UF4 A;  3FJ5 A;  3H0F A;  4AFQ C;  4J9F A;  1FMK A;  4RTW A;  5ECA A;  2LQW A;  4OMO A;  1W6X A;  4J9E A;  1UUE A;  2KRM A;  3VS4 A;  2LZ6 B;  2M0Y A;  2A28 A;  1NM7 A;  2EYZ A;  3M0S A;  3H0H A;  1MV0 B;  1ABO A;  2EGC A;  3PVL A;  2RQV A;  2KNB B;  5IHK A;  2DA9 A;  2RQW A;  1UDL A;  2HDA A;  1BBZ A;  2AZS A;  4GLM A;  4HCK A;  1I0C A;  4OMN A;  3EG1 A;  2BTT A;  2MIO A;  3EHQ A;  2GGR A;  1TUD A;  3EG2 A;  2J06 A;  2CH4 W;  2J7I A;  2OI3 A;  1WDX A;  5FWC A;  4D8K A;  1ZSG A;  1WYX A;  2HSP A;  2DM1 A;  3TSW A;  2D8H A;  2BZ8 A;  4M4Z A;  2JM9 A;  1J3T A;  2VWF A;  2EBP A;  2KRN A;  2DRM A;  1BK2 A;  2CRE A;  2RN8 A;  4F14 A;  1PKT A;  3VS3 A;  4E6R A;  3R6N A;  2V1R A;  2D8J A;  2LQN A;  1ZUY A;  4Z8A A;  2K3B A;  3TSZ A;  1TUC A;  1X2Q A;  2ROT A;  4HVW A;  2CT3 A;  2J6O A;  1RI9 A;  4ORZ A;  3VRZ A;  1WFW A;  2YT6 A;  1K4U S;  1X6B A;  2L2P A;  1GL5 A;  1AEY A;  2F2V A;  1KIK A;  2ED0 A;  3NPF A;  4AG2 C;  1K76 A;  3VRY A;  1M8M A;  4LE9 A;  2LJ1 A;  2C0I A;  2DMO A;  1AOJ A;  2XMF A;  3EHR A;  1M27 C;  1QWE A;  2EGA A;  2EKH A;  2J6F A;  2EQI A;  4EIK A;  2DLP A;  1OPL A;  1SEM A;  1QKX A;  4RTY A;  1SRL A;  4J9G A;  1NYF A;  1QCF A;  1UTI A;  2GTO A;  2DYB A;  4OML A;  2KR3 A;  1IO6 A;  2NUZ A;  3I5R A;  2LJ0 A;  2YUP A;  2EVR A;  3H0I A;  4FSS A;  2RQU A;  2H8H A;  1Y57 A;  1PKS A;  2FO0 A;  2ABL A;  4LUE A;  1W70 A;  1X6G A;  4JJC A;  1JXO A;  1PHT A;  2DF6 A;  4CC7 A;  4AFU C;  1HD3 A;  2DL8 A;  4CC3 A;  3M0T A;  2DBM A;  2DX1 A;  4X1V A;  1WA7 A;  1X43 A;  4Z89 A;  3VS1 A;  1XOV A;  1GBR A;  1GCQ A;  2EYY A;  2EW3 A;  2RQR A;  3RNJ A;  1WI7 A;  2YUQ A;  2PNI A;  2ESW A;  2ROL A;  3REB B;  1GBQ A;  1K0S A;  2KYB A;  2M51 A;  1GFD A;  2J6K A;  2W10 A;  4D8D A;  2YUN A;  1YN8 A;  4RTV A;  1OEB A;  1I07 A;  1ZX6 A;  2BZY A;  2JMC A;  1NEB A;  1RLQ C;  2AKL A;  4ZNX A;  4F17 A;  1SRM A;  1U5S A;  1M3B A;  4CC2 A;  5HCK A;  2LCS A;  1MUZ A;  2AKK A;  2D0N A;  1ZUK A;  2CUD A;  2KT8 A;  2LMJ A;  1K9A A;  1AWJ A;  2AK5 A;  4HVV A;  4GBQ A;  3ZL7 C;  1ARK A;  2K2M A;  1ABQ A;  2VVK A;  2FEI A;  2KBT A;  3KFV A;  1JXM A;  2ENM A;  2A36 A;  5IXF A;  2DIL A;  1RUW A;  1PRM C;  1U3O A;  2C0T A;  1WX6 A;  4Z88 A;  4JPB W;  2JS0 A;  4J9C A;  2RNA A;  2JW4 A;  1AZE A;  2DBK A;  2GBQ A;  5GJV B;  2AZV A;  1E6G A;  1YP5 A;  1ZUU A;  2X3W D;  3NHN A;  2GQI A;  2YSQ A;  1AWX A;  1AD5 A;  2YDL A;  3UA6 A;  2KGT A;  4OMP A;  1H3H A;  1SHG A;  1NYG A;  4AFZ C;  1VA7 A;  2SEM A;  1H92 A;  1UHF A;  4K11 A;  1T0H A;  2A37 A;  5I11 A;  3THK A;  4Y92 A;  1FYN A;  3SHW A;  1X27 A;  1X69 A;  2L3S A;  2D1X A;  4JJD A;  5EC7 A;  3UA7 A;  4AFS C;  3ULR B;  2X3X D;  2VKN A;  3CQT A;  1N5Z A;  2IIM A;  1VYT A;  2DVJ A;  4IIM A;  2EGE A;  4ESR A;  4RTU A;  3REA B;  1NLO C;  2DL3 A;  2I0N A;  1UG1 A;  2K6D A;  1AZG B;  4IIO A;  4J9D A;  4HXJ A;  1UEC A;  2RPN A;  1OV3 A;  1WXT A;  1G2B A;  2V1Q A;  2SRC A;  1WXU A;  1AVZ C;  2L3Q A;  1Z9Z A;  2JS2 A;  1JU5 C;  1VYV A;  3TVT A;  3VS2 A;  2W0Z A;  1WIE A;  3C0C A;  2KXC A;  2DRK A;  1LCK A;  5FWB A;  4HVU A;  1X2K A;  1UJY A;  2HEQ A;  2CT4 A;  1JEG A;  1CKB A;  3I9Q A;  1BU1 A;  1B07 A;  2FRW A;  1NLP C;  2JMA A;  2ECZ A;  4JZ3 A;  4R0K A;  3M0U A;  2JM8 A;  2DL4 A;  4RTZ A;  2O31 A;  1QKW A;  1SHF A;  1RLP C;  3VS6 A;  2B86 A;  2QDL A;  2EYX A;  4LN2 A;  3A98 A;  4JZ4 A;  2EPD A;  4QT7 A;  2DNU A;  2DL5 A;  1AWW A;  2NWM A;  1H8K A;  2P4R A;  2CDT A;  2DJQ A;  1NG2 A;  2YUO A;  4J9B A;  2KEA A;  1HJD A;  1UHC A;  1WLP B;  4OMM A;  3NGP A;  1HSQ A;  2MOX A;  1B3Q A;  2FPE A;  2GNC A;  2LJ3 A;  2PZ1 A;  1EFN A;  1YWO A;  1JQQ A;  2JXB A;  1S1N A;  1T3S A;  2FPF A;  3PVQ A;  2KYM A;  2O2O A;  1KFZ A;  2CSI A;  1M3A A;  4CC4 B;  4LNP A;  5IHN A;  5FW9 A;  2K79 A;  1U06 A;  1T3L A;  4A63 B;  3LH5 A;  1GCQ C;  2JTE A;  3H41 A;  2DE0 X;  2RF0 A;  2FG0 A;  3QWX X;  4F16 A;  1W1F A;  3EGU A;  2HCK A;  4DEX A;  5L23 A;  2K7A A;  4RTX A;  2LX7 A;  4OMQ A;  2BZX A;  2DL7 A;  3QWY A;  2EYW A;  2O9V A;  1CKA A;  2PTK A;  1Y0M A;  2GTJ A;  2KT1 A;  1SSH A;  1PWT A;  1OPK A;  1PNJ A;  1E6H A;  1Z9Q A;  3SEM A;  4J9H A;  4WCI A;  2KRO A;  3I5S A;  1OOT A;  3EG0 A;  1BB9 A;  5GJW B;  5IHI A;  2G6F X;  1K0X A;  2KRS A;  4RUG A;  2RMO A;  1UJ0 A;  3VS0 A;  2O88 A;  1GRI A;  2HBW A;  1K1Z A;  4LUD A;  3M0R A;  1QWF A;  3PE0 A;  2O9S A;  2FPD A;  3JV3 A;  2A08 A;  1VYU A;  1UE9 A;  1T0J A;  2JT4 A;  3M0P A;  1M30 A;  1KSW A;  2L0A A;  2ED1 A;  3VS5 A;  5I22 A;  1M3C A;  3U23 A;  1GFC A;  1I1J A;  5IXB A;  4KRT A;  3GBQ A;  2KXD A;  3EG3 A;  4JJB A;  1PRL C;  4DEY A;  2FRY A;  1TG0 A;  2LP5 A;  1GCP A;  2L3P A;  4AG1 C;  5IH2 A;  2E5K A;  1UGV A;  2C0O A;  3UAT A;  2J05 A;  2LNH B;  1ZLM A;  1A0N B;  1G83 A;  4J9I A;  2OAW A;  2MCN A;  2F2X A;  1KJW A;  2CUB A;  2CSQ A;  1WXB A;  3O5Z A;  1AWO A;  1E7O A;  2K9G A;  1NEG A;  3I35 A;  1V1C A;  3M0Q A;  1QLY A;  1UFF A;  3NMZ C;  3VS7 A;  1YCS B;  1YWP A;  1YNZ A;  2KE9 A;  2RQT A;  1CSK A; 
#chains in the Genus database with same CATH topology
 1ZBJ A;  1JO8 A;  5J3B A;  5CKB A;  3RBB B;  4RTT A;  4LD6 A;  1MV3 A;  1VQP Q;  3FJ5 A;  3CBM A;  1FMK A;  2MWP A;  4LDU A;  4MZT A;  5ECA A;  3MPU B;  5GMK e;  4OMO A;  4ZN1 A;  1JBM A;  1VIF A;  3PMI A;  2NUT B;  2YXY A;  2A28 A;  4JLG A;  1NM7 A;  1LVK A;  3CEY A;  3OYN A;  2COW A;  4XTU A;  3H0H A;  3VV0 A;  3I55 A;  1Q82 C;  2DA9 A;  1UDL A;  3PFS A;  4O6J A;  5KCO A;  4GLM A;  2AZS A;  4N4I A;  3L2V A;  4A4F A;  5CKE A;  5CCA A;  3CC2 Q;  5CVI A;  2J06 A;  2CH4 W;  3LGL A;  2DFU A;  1KQS S;  3FEO A;  3G71 Q;  1KD1 R;  4M4Z A;  1J3T A;  4M75 B;  2EBP A;  3CME T;  4RG2 A;  1YJ9 Q;  1QP2 A;  2DRM A;  3CCJ A;  4Z02 A;  1SSF A;  4M7A A;  1KQ2 A;  3OS1 A;  3PGG A;  2DKG A;  2QQ9 A;  1VQP T;  4XU0 A;  2QI2 A;  2LTO A;  4DA4 A;  2CT3 A;  3CCQ A;  2Y4X A;  2Y90 A;  4L6V 5;  2ZPI B;  2FZG B;  1WFW A;  2VC8 A;  3RDV A;  1K4U S;  3PIO A;  4RMO A;  4JRP A;  2DYI A;  2ED0 A;  1BI0 A;  3NPF A;  4KGZ B;  4AG2 C;  1M1K C;  3X24 B;  4BE1 A;  4CRI A;  1RL2 A;  2YRC A;  2C0I A;  1M27 C;  1QWE A;  2EQI A;  5EG2 A;  8ATC B;  1OI1 A;  4WF2 A;  3QZ9 B;  1R0C B;  1FWZ A;  5LJ5 f;  1UGP B;  2M1H A;  2RA2 A;  4OML A;  1K9M U;  3PIP A;  1IO6 A;  3EAE A;  4N0A C;  3I5R A;  2YUP A;  4PK4 A;  1WQW A;  1YHQ A;  3ASK A;  3C95 A;  2FO0 A;  2K5I A;  5FRO A;  4IUT A;  1X6G A;  4QVZ A;  4XTX A;  4A54 A;  3A5Z B;  5KYX A;  2KMT A;  5GAM f;  1HD3 A;  3M0T A;  2DPP B;  1BCO A;  4E7K A;  3HFN A;  5KE3 A;  3V7C A;  4C5E A;  1GBR A;  3V7R A;  2NUT A;  2RQR A;  2VGM A;  4BI4 A;  3LWI A;  1WI7 A;  3OW2 S;  5GAN f;  1MMG A;  1VQ7 A;  3GLX A;  2L89 A;  3M59 A;  1PG5 B;  4JLI A;  2DER A;  4BE2 A;  1ZX6 A;  2JMC A;  3MEV A;  1TOV A;  1M8V A;  3RER A;  1G8X A;  1JB0 E;  3CBO A;  4XU1 A;  1Y07 A;  4BUG A;  2CZ1 B;  3LGF A;  4A4K A;  4N4H A;  1OQK A;  2OTJ A;  1MUZ A;  3OBW A;  4PFO A;  2FHD A;  2LMJ A;  4GLK A;  3VUZ A;  1QCN A;  4M75 A;  4KGX B;  4HVV A;  3OYD A;  2JN0 A;  1K73 C;  5FU7 B;  1WQ7 A;  3HTR A;  2VVK A;  2E65 A;  2HMA A;  3JRZ A;  2ENM A;  1RAH B;  1BI1 A;  5KYY B;  1N8R U;  1YCY A;  1WX6 A;  2ZPB B;  1TXQ A;  3OS5 A;  3I55 Q;  1BI2 A;  3CMA T;  4M7D D;  3M54 A;  2D0Q B;  3JCM f;  4ELZ C;  4QW2 A;  3CPW A;  2CZ6 B;  3NHN A;  2GQI A;  1AD5 A;  3DLL A;  2EQU A;  1D3B B;  3E9G A;  1VQL T;  4A4H A;  4AFZ C;  2EFI A;  1YIT T;  5I11 A;  1TTH B;  3MCA B;  5GAO r;  3BDL A;  2BIV A;  3CBP A;  1KK7 A;  1VOM A;  3CCJ Q;  2LQK A;  2FL7 A;  1JJ2 A;  2L3S A;  4AFS C;  3S6W A;  2X3X D;  4FM4 B;  1N5Z A;  2EGE A;  3V8L A;  4ESR A;  4C8Q D;  1RI0 A;  2CYZ B;  2P4T A;  3SWN C;  4YTL A;  1NLO C;  1UG1 A;  1Y96 B;  3E2U A;  1VQO A;  1UEC A;  1QQJ A;  3CCQ Q;  1OV3 A;  1G2B A;  1PC0 A;  2QXF A;  2WSC E;  1RAG B;  1Z9Z A;  2QQB A;  1JU5 C;  3TVT A;  5KYW B;  3UWN A;  2IG0 A;  1Q7Y R;  2QA4 A;  1YI2 T;  1XTD A;  2HEQ A;  4WTO B;  3SFM A;  2RI3 A;  3I56 T;  1Q82 U;  2K3X A;  3EGX B;  2JMA A;  3I55 T;  3EH2 A;  3NTI A;  3J80 E;  2WAC A;  4RKU E;  4XK8 E;  2RK1 A;  3OYB A;  2P0K A;  2LT4 A;  1QKW A;  1SHF A;  1KG1 A;  2OX7 A;  1RLP C;  4JRI A;  1RAD B;  4KUD K;  2QDL A;  1PD0 A;  2FZC B;  2DXC A;  2EPD A;  4JZ4 A;  2DL5 A;  2LCC A;  2NWM A;  3HPW A;  2DJQ A;  1NG2 A;  4OGC A;  2M16 A;  2KEA A;  3ER0 A;  5GMK j;  1HJD A;  3G4S A;  3N5B B;  1WLP B;  1QMC A;  5FU6 C;  3CXC S;  5GMK l;  3OSV A;  4C5I A;  2XI9 A;  5KYY A;  1JQQ A;  2K3Y A;  2MMP A;  2QGG A;  3CD6 T;  1S1N A;  2FPF A;  3OYI A;  1QVG P;  2G3R A;  3HP9 A;  3MHX A;  3PVQ A;  1Q95 G;  4C0F A;  1VQ7 Q;  2XHC A;  5FW9 A;  3CCQ T;  4PJN A;  4XAX B;  4A63 B;  1MGQ A;  4ZN3 A;  2RJE A;  3A8M B;  2LDM A;  1MND A;  1U1S A;  4OF1 A;  3JB9 D;  4M7D F;  3QWX X;  4ZTF A;  5LJ5 h;  4DEX A;  1EIF A;  3QPH A;  4X9D A;  2K7A A;  1FXX A;  5HK0 A;  1M1K U;  2LX7 A;  2BZX A;  3QWY A;  2EYW A;  1D3B A;  2R57 A;  4FU6 A;  1W2B S;  4M7A D;  2M9U A;  2DXU A;  4M7D B;  4MMK A;  2OTJ Q;  3X20 B;  1PWT A;  2EWN A;  5IHI A;  2KRS A;  1UJ0 A;  3S3N A;  1VQ8 T;  4JUV A;  5GAM h;  3M0R A;  3OYL A;  4XTW A;  1G5V A;  3ZBD A;  3JV3 A;  2A08 A;  1T0J A;  2DTI A;  2ED1 A;  3VS5 A;  3PT9 A;  2X4Y A;  1Y96 A;  3MJX A;  1M3C A;  2WSE E;  3U23 A;  1VQ5 A;  2EQM A;  4C8Q F;  2KXD A;  5GAN h;  1TG0 A;  2LP5 A;  4DOV A;  4M7D E;  2L3P A;  3HFO A;  2C0O A;  5KYW A;  4EMK C;  2J05 A;  2EJF A;  5GAN 2;  2DO3 A;  1VQ4 A;  1A0N B;  2RHY A;  1AT1 B;  1G83 A;  1H64 1;  2D6F A;  4P5N A;  1VQN A;  2DD5 A;  3O5Z A;  5LJ3 e;  3GNG A;  1NEG A;  3I35 A;  3EGX A;  3SB2 A;  1K8A C;  1OYX A;  1FMW A;  1UFF A;  3NMZ C;  1YNZ A;  3QJY A;  1M90 U;  3HRS A;  4NL2 A;  2WSF E;  3QDR B;  1K9M C;  2O01 E;  1XQH A;  2HD0 A;  1MMN A;  2E3I A;  2MWO A;  3DLM A;  1M2V B;  2I2L A;  1KC8 R;  5CAI A;  5C0M A;  4C8Q E;  2LQW A;  5CR2 A;  3CCU A;  1ACM B;  1S72 T;  1VQK T;  1UUE A;  1VQO Q;  2KRM A;  2XKO C;  2E5Q A;  1I81 A;  1KHI A;  2M0Y A;  2M0O A;  4HKE A;  1TWB A;  2DVE A;  4F7U B;  3JCM h;  1IXD A;  4FW2 A;  3TEE A;  3M4Y A;  3E19 A;  2RQV A;  2KNB B;  2QA4 Q;  5IHK A;  1MMD A;  1KQS A;  3OYK A;  3CCE Q;  2RQW A;  2E4H A;  5FRM A;  2QAZ A;  2EYQ A;  1I0C A;  2FVU A;  3EG1 A;  2BTT A;  2MIO A;  5GAO p;  4IUU A;  2GGR A;  4MDX A;  1PSF A;  1Q86 R;  4LDW A;  4M75 D;  3DKM A;  5D6Y A;  3EGD B;  2X4W A;  4D8K A;  3H9N A;  2PUO B;  3OYY A;  3JB9 F;  2DM1 A;  3TSW A;  4VUB A;  5FLX E;  4M7D A;  1BIA A;  4LDX A;  2VWF A;  2KRN A;  4E7L A;  5D6W A;  4F7U E;  3M4G A;  3C12 A;  4M7A F;  1Q81 U;  4EMH A;  3G4S Q;  5KCH A;  3VS3 A;  4E6R A;  1YFN A;  3CCR T;  3OSS C;  4MML A;  4Z8A A;  2K3B A;  1OU9 A;  3WXM B;  1P92 A;  2DXB A;  4HVW A;  1RI9 A;  5LL6 S;  1HYO A;  3A8L B;  3VRZ A;  2YT6 A;  1I4K 1;  2DTO A;  2L3R A;  1G3T A;  3URG A;  4PJO A;  1BCM A;  5GAN 4;  1VQ6 T;  1KIK A;  4II1 A;  4IUV A;  2LJ1 A;  5D7U A;  4DBH A;  2XMF A;  5CO7 A;  2DLP A;  2KDS A;  4PLL A;  1SEM A;  1VQ9 A;  1OX8 A;  3CCE T;  1SRL A;  1NYF A;  4KUL A;  1WZO A;  4M7A E;  3CCL T;  3JB9 I;  3NTH A;  2QG9 B;  4V2S A;  1M5Q 1;  1XNI A;  2RQU A;  1Y57 A;  1PKS A;  2DEQ A;  1TU0 B;  3CCV T;  4FSX A;  1JXO A;  1PHT A;  1VIE A;  2DF6 A;  1M2V A;  4E7S A;  4AFU C;  4F04 B;  4CC3 A;  1VQ5 Q;  2DBM A;  2OTL T;  2DX1 A;  5I2S A;  5KYX B;  4R55 A;  1XOV A;  2GQV A;  4Q5W A;  2EW3 A;  2YRV A;  3RNJ A;  4F7U A;  2PNI A;  1VQ4 Q;  2ESW A;  5CQY A;  3AHU A;  1VQN Q;  2K2V A;  2V8K A;  2M51 A;  5IN1 A;  5GAO m;  2J6K A;  4C8Q C;  3LX7 A;  4D8D A;  1D1A A;  1UGS B;  2YUN A;  3NFC A;  4RTV A;  4HT8 A;  1V76 A;  1NEB A;  1KQ1 A;  4ANJ A;  2E64 A;  1SRM A;  1U5S A;  2LCS A;  3JCM c;  4E7I A;  3EGD A;  1U8R A;  5LJ3 g;  6AT1 B;  2AKK A;  2AT1 B;  2HAX A;  2KT8 A;  4M75 F;  3OS2 A;  2AK5 A;  2K4Y A;  4RCC A;  2X51 A;  5GAO l;  5IT9 E;  2KBT A;  3P8B B;  3CCU Q;  1JXM A;  1ZSZ B;  1YJN A;  3L1A A;  2RJC A;  2A36 A;  3LW5 E;  2K57 A;  4C0D B;  3Q1J A;  1TSF A;  4JPB W;  4PL6 A;  3GPL A;  1YJW A;  2X4J A;  1DJ7 B;  1AZE A;  4J7I A;  3OMG A;  2F5T X;  1NPR A;  1ZUU A;  4LDY A;  2KGT A;  4OMP A;  2XD0 A;  1SHG A;  1NYG A;  4M75 E;  2AHJ B;  3M5A A;  2PU9 B;  2SEM A;  1H92 A;  3LWH A;  4J7F A;  3AT1 B;  5CQX A;  1VUB A;  1N8R R;  2HL5 C;  3GOX A;  1K8A U;  2E6Z A;  5A0D A;  1JJ2 P;  1WHL A;  2D1X A;  4JJD A;  5EC7 A;  3ULR B;  4PFZ A;  2GFU A;  1YIJ A;  2V8I A;  2IIM A;  2DIG A;  4OB1 B;  2R58 A;  2RJF A;  4RTU A;  3L2U A;  4JDS A;  3OYM A;  3D7S B;  3CC2 T;  2E70 A;  2PVO B;  1AZG B;  3QG1 A;  4IIO A;  4J9D A;  4M7A C;  2CP3 A;  3G71 T;  2CP5 A;  2V1Q A;  1SF9 A;  4KH0 B;  2SRC A;  4PLI A;  1BI3 A;  1RAI B;  3MO8 A;  2X4X A;  1WXU A;  1IRX A;  1YJ9 T;  5AYF A;  3C0C A;  4DQ2 A;  2KXC A;  5KYN A;  3G1J A;  3QXE B;  3T9N A;  3X28 B;  2DZ9 A;  2RHX A;  3JCM Q;  2CT4 A;  1JEG A;  3X25 B;  3JCM V;  3I9Q A;  1NLP C;  1VQ9 Q;  2A7Y A;  2DL4 A;  2DAQ A;  1OZ3 A;  2DJZ A;  3CXC A;  5DY9 A;  3VS6 A;  2KAF A;  2B86 A;  1GXI E;  1M90 C;  5LJ5 g;  3CCS A;  2DNU A;  3G6E A;  3M56 A;  2P4R A;  4BB7 A;  2DIQ A;  2YUO A;  4J9B A;  1UGQ B;  2RHU A;  4PFP A;  4A53 A;  3NGP A;  2HNI A;  2PQW A;  2ATC B;  3V8J A;  4J6W A;  1M2O A;  3VUB A;  1V29 B;  2GNC A;  4FYV B;  1R77 A;  1ZSZ A;  1RAA B;  3QZ5 B;  5GAM g;  3QO3 A;  1WHJ A;  1Q82 R;  1T3S A;  1C0M A;  3H8Z A;  5LJ3 d;  4C5G A;  2YRD A;  3SD4 A;  1W2B A;  3BDU A;  1M3A A;  1BKB A;  3OYG A;  3QYG B;  3A1P A;  3L42 A;  2E41 A;  3LH5 A;  4C92 F;  2CZ7 B;  2RK2 A;  2DE0 X;  2FG0 A;  4F16 A;  2V26 A;  4C0Z A;  4M77 B;  2E1H A;  2HCK A;  4B6M A;  2DL7 A;  2O9V A;  1O75 A;  4C92 B;  1Y0M A;  2GTJ A;  2XID A;  2QEX A;  3QSU A;  4XQ3 A;  1PNJ A;  1Z9Q A;  4WCI A;  3OS0 A;  3I5S A;  3EG0 A;  1N27 A;  1BB9 A;  3L2Z A;  2Y4Y A;  4RUG A;  4PJL A;  2RHZ A;  4J83 A;  1Q81 C;  2CKK A;  1UGR B;  4LUD A;  1YJN Q;  1QP3 A;  4BE0 A;  2AIR B;  1MNE A;  3PE0 A;  4M75 C;  4PJO D;  4KT0 E;  2JT4 A;  3V8K A;  2L0A A;  5I22 A;  4M77 E;  4J5Y A;  4PKC C;  3UT1 A;  4D6W A;  4BY6 B;  1QVP A;  1GFC A;  3BE3 A;  4KRT A;  4JJB A;  1PRL C;  1H3Z A;  4C92 E;  1NE8 A;  4JS5 A;  1YJW Q;  1M1K R;  4AG1 C;  2R5A A;  1ZLM A;  2P0P A;  3EFR A;  2C06 A;  3M55 A;  2MCN A;  2F2X A;  2NYS A;  1KJW A;  2CUB A;  1WXB A;  1AWO A;  1E7O A;  3RMQ A;  4M78 F;  2VUB A;  4BI3 A;  2VGN A;  1QLY A;  3VS7 A;  1YWP A;  3CC7 A;  2HBP A;  2KE9 A;  2HZY A;  3H6Z A;  5KH6 A;  3CC4 A;  5GMK m;  4OGE A;  4FIB A;  1IGQ A;  4M78 B;  4A4G A;  1SPK A;  1TUG B;  4FYY B;  2YWW A;  4RCB A;  1YIJ Q;  2F2W A;  3IQL A;  2OJ2 A;  5A0G A;  5KE2 A;  2FYK A;  3UF4 A;  1QVF S;  2XDD A;  4LD9 K;  3H0F A;  3EH1 A;  4HCB A;  1R0B G;  4DBF A;  3VYG A;  1YHQ Q;  4XTV A;  4M7D G;  4ZGJ B;  4J9E A;  4OB2 B;  1ZBX A;  3VS4 A;  2LZ6 B;  2H3E B;  2QAS A;  4J6Y A;  3S3O A;  2EJG A;  3CCJ T;  2VXF A;  1MV0 B;  3PVL A;  3RKW A;  1Y71 A;  1KQS P;  4ZGE B;  2RJD A;  1M90 R;  4M78 E;  2HDA A;  2E10 A;  4PJJ A;  1BBZ A;  1RAE B;  2EQK A;  4OVA A;  3EHQ A;  2VAS A;  3M57 A;  3TU4 K;  1TUD A;  4M77 A;  4PJM A;  2J7I A;  1WDX A;  3CCS Q;  4C92 A;  2HSP A;  3FC3 A;  2KQW A;  4C8Q G;  1K73 R;  3FB9 A;  1PD1 A;  2JM9 A;  3G6E Q;  4NS5 A;  5DLQ E;  2BUD A;  1M1F A;  1BK2 A;  1ZHI A;  1W4S A;  1X01 A;  3JCM b;  4F14 A;  5GAN 5;  3OMC A;  1NZ9 A;  4GY5 A;  1PKT A;  3R6N A;  2LRQ A;  4L59 A;  2KI7 A;  5CKD A;  3TSZ A;  1NJI C;  2PVG B;  2ZPF B;  1C1A A;  2ROT A;  5FU7 C;  3MP6 A;  1HXD A;  2QYZ A;  1YHQ T;  4PJO F;  2L2P A;  3VYH B;  3OA6 A;  1AEY A;  1IGU A;  1I8F A;  2JNG A;  3CME A;  1K76 A;  3VRY A;  3JCM P;  3A8H B;  3KXT A;  1Q7Y U;  4PJO B;  3FRN A;  3EHR A;  2FZK B;  2EGA A;  4EIK A;  2J6F A;  4F7U G;  4J9G A;  1WHM A;  2QEX Q;  1UTI A;  3J81 E;  2DYB A;  3NTK A;  1D0Z A;  4DBQ A;  1VQP A;  2DK3 A;  2NUZ A;  3P8H A;  2LJ0 A;  5D6X A;  3OYA A;  1VQ7 T;  3GIB A;  1IRE B;  4M78 A;  2EVR A;  4FSS A;  5GMK h;  1EZZ B;  3CCS T;  1M1G A;  4LUE A;  1NPP A;  4JJC A;  4PJO E;  4FYX B;  5GMK i;  1FMV A;  2OTJ T;  4X1V A;  2EKO A;  1X43 A;  4Z89 A;  1GCQ A;  2EYY A;  3JB9 G;  4F7U F;  3P8D A;  3JCM W;  1GBQ A;  1K0S A;  2KYB A;  4M7A G;  2DZC A;  1GFD A;  3C4S A;  3MET A;  2W10 A;  4XTY A;  4EMG A;  4IKF A;  2ZPG B;  2BZY A;  4QQG A;  3G7Z A;  3OY9 A;  1RLQ C;  3CC7 Q;  2RI2 A;  3CC4 Q;  4ZNX A;  1M3B A;  4CC2 A;  5HCK A;  2DXT A;  2D0N A;  1ZUK A;  2CUD A;  3FIF A;  1O9S A;  1X6O A;  1K9A A;  1AWJ A;  4GBQ A;  2K2M A;  1ABQ A;  1KHC A;  2HKQ B;  5AT1 B;  2JJ9 A;  1I5L A;  1B34 B;  5IXF A;  3PTA A;  1PRM C;  1U3O A;  4FL6 A;  2A0F B;  4RG8 A;  3M58 A;  2COZ A;  4XU2 A;  3MEU A;  3JAM E;  4J9C A;  2JW4 A;  2JTF A;  2HQX A;  2KY9 A;  5HKC A;  1WJQ A;  4J6X A;  1E6G A;  2X3W D;  2YSQ A;  1BYM A;  2L8D A;  1AWX A;  2XDP A;  3ME9 A;  1VQO T;  2XIC A;  1H3H A;  1UB4 A;  1VA7 A;  1UHF A;  4FYW B;  5LJ5 e;  2CP6 A;  2PVD B;  1FYN A;  1EX4 A;  1Y7X A;  3KUF A;  1X27 A;  2CGH A;  2QA4 T;  5A0L A;  1X69 A;  2RB6 A;  1D0X A;  3CMA A;  4J8O A;  3VKI A;  3BW1 A;  2A3L A;  3LYI A;  2HL3 A;  1VYT A;  2DVJ A;  4M7D C;  2ZZD A;  5DM7 R;  1AHJ B;  4FCY A;  2RI5 A;  4KGV B;  3REA B;  1F1B B;  2DL3 A;  3HKS A;  1KC8 U;  4HXJ A;  4TVR A;  5GAM e;  2RPN A;  1FX7 A;  2QDY B;  3OW2 A;  3HSB A;  1VQL A;  2QQR A;  1OU8 A;  1VYV A;  1YIT A;  2W0Z A;  1LCK A;  3RKY A;  4M75 G;  3G4S T;  3CME Q;  4HVU A;  5GAN e;  1X2K A;  4IUR A;  2PUK B;  3CCM A;  1G3S A;  1CKB A;  1K8A R;  1B07 A;  4HCC A;  4QQ6 A;  3JB9 J;  4PJO C;  2ECZ A;  5GAO n;  4JZ3 A;  4R0K A;  2OAU A;  3M0U A;  2JM8 A;  1K9M R;  1PM3 A;  4RTZ A;  2O31 A;  2XDB A;  3CXC P;  4ZTJ A;  1B7T A;  1Q86 U;  4AMC A;  5DLO A;  2F69 A;  4LN2 A;  3A98 A;  2FB7 A;  2XU8 A;  1ZA2 B;  1AWW A;  5CKH A;  3QJ6 A;  1H8K A;  2RO0 A;  2CDT A;  3QDF A;  4QQD A;  2COY A;  1YI2 A;  4OMM A;  5J39 A;  4MZM A;  1OX9 A;  2CP7 A;  1B3Q A;  1IHV A;  4X34 A;  2LJ3 A;  3I56 A;  3HL8 A;  1EFN A;  1YWO A;  2JXB A;  1B34 A;  1WHK A;  3FLG A;  5HY6 A;  3QUI A;  1OUL A;  4KH1 B;  1NJI U;  2JVV A;  4EPC A;  1W2B P;  4M77 D;  2LT1 A;  1ZA1 B;  4A4E A;  4X9C A;  4LNP A;  5IHN A;  4FT2 A;  1U06 A;  1T3L A;  1C6V X;  3JCM e;  2JTE A;  4C92 D;  3C94 A;  3MP8 A;  3RKX A;  4OP0 A;  3GNF B;  8AT1 B;  1QVG S;  3WVE B;  4N0A A;  2LC4 A;  5L23 A;  4RTX A;  4C5H A;  1VQ5 T;  4OMQ A;  3JB9 H;  4AT1 B;  3CPW P;  1CKA A;  2PTK A;  2LQ8 A;  3V7S A;  1PCX A;  1SKU B;  1OPK A;  1E6H A;  3CD6 A;  3SWN B;  1VQ4 T;  2KRO A;  1OOT A;  2CZ0 B;  4QVD A;  4B9W A;  1K0X A;  1VQN T;  2G6F X;  4MDW A;  2EJ9 A;  3LH0 A;  2HQE A;  2RMO A;  3PNW C;  3O8V A;  2LNV A;  2ZAE A;  1GRI A;  2FPD A;  2JOY A;  1VYU A;  1UE9 A;  4ATO A;  2P84 A;  4HA8 A;  1I1J A;  3M9Q A;  3GBQ A;  3OQ5 A;  3EG3 A;  4E7Z A;  4DEY A;  4BDY A;  3HRT A;  1GCP A;  3FDR A;  1UGV A;  4N4G A;  2YHT A;  3MP1 A;  2OAW A;  3CCU T;  1Q7Y C;  4BD3 A;  1VQ8 A;  4OMF B;  1QVF A;  4M78 D;  3M0Q A;  1VQM A;  5LJ3 j;  4DBR A;  1YCS B;  4E47 A;  5FU6 B;  2DEU A;  5GAN 7;  1LPL A;  3RR6 A;  1CSK A;  2CH4 A;  2CP2 A;  1WHG A;  2Z0W A;  3KBG A;  3CMA Q;  1M4Z A;  2M02 A;  4M77 G;  2VV5 A;  4IUQ A;  2GFA A;  2RH2 A;  2YLB A;  4AFQ C;  4J9F A;  4RTW A;  4C92 G;  5CIU A;  3HRU A;  2MK5 A;  2XG8 D;  1W6X A;  1KD1 U;  1N9S A;  3MKD A;  2YLC A;  1VQL Q;  2RM4 A;  2MAM A;  1R8O B;  2EYZ A;  3M0S A;  1YIT Q;  2IPO B;  3LLR A;  1ABO A;  2EGC A;  3R6O A;  3DB4 A;  5GAN 6;  1QW1 A;  2EQJ A;  3L2R A;  3WVD B;  3CCM Q;  2MF2 A;  1X75 C;  4HCK A;  3OYJ A;  4OMN A;  3ZFJ A;  4M77 F;  3QYH B;  4PNO A;  5GAN g;  1S72 A;  1VQK A;  3EG2 A;  2H3J A;  4KUI A;  2OI3 A;  5FWC A;  2V8J A;  1ZSG A;  1G3W A;  1WYX A;  2D8H A;  2BZ8 A;  3GF5 A;  2BKD N;  4DOW A;  3SWN A;  2CRE A;  5KYU B;  2RN8 A;  1QCO A;  3VJP A;  1YI2 Q;  2V1R A;  2D8J A;  2LQN A;  1VQ9 T;  1ZUY A;  4C0G A;  2K5F A;  3I56 Q;  3L2Q A;  1TUC A;  1X2Q A;  4EMK B;  3EG9 B;  2QQS A;  4M78 G;  2J6O A;  2GF7 A;  4ORZ A;  4CI0 C;  4MZP A;  1X6B A;  1ZSZ C;  5CKF A;  1GL5 A;  3GP8 A;  2F2V A;  5LJ3 h;  3RES A;  2QGF B;  5GAO q;  3OYH A;  1M8M A;  4LE9 A;  1BIB A;  4C0D C;  2F1L A;  2X9H A;  2DMO A;  1AOJ A;  5CK9 A;  2EKH A;  1OPL A;  3CCR A;  1QKX A;  5LJ5 j;  2QTX A;  4RTY A;  1QCF A;  3CCM T;  2GTO A;  3JCM g;  2ZGW A;  5J26 A;  2KR3 A;  3CD6 Q;  2LVM A;  4LDV A;  4EDU A;  5I21 A;  2LCL A;  3H0I A;  3RUX A;  2DTH A;  2H8H A;  3MEW A;  2ABL A;  4BDZ A;  1VQ6 A;  4E7H A;  1D0Y A;  1W70 A;  2QTV A;  9ATC B;  5GAM j;  4CC7 A;  1WGS A;  2DL8 A;  1KC8 C;  4ME7 A;  4FW1 A;  3TQ7 P;  1WA7 A;  5I2M A;  3CCE A;  3VS1 A;  2CP0 A;  2EAY A;  4B9X A;  5GAN 3;  4ELY C;  4JS4 A;  3CCL A;  5GAN j;  2YUQ A;  3OB9 A;  2KVQ G;  2ROL A;  3REB B;  5LJ5 d;  2NUP B;  2QK0 A;  1YJN T;  1VQ8 Q;  1YN8 A;  3CCV A;  1OEB A;  1I07 A;  2D9T A;  3VU3 C;  3A8O B;  1VQM Q;  3DB3 A;  3JCM X;  3RIR A;  2KSS A;  2AKL A;  2VXE A;  4F17 A;  2CS7 A;  1Q86 C;  1YJW T;  2P0Q A;  2OTL A;  3S3M A;  4Y28 E;  1G3Y A;  1IHW A;  4PJO G;  2JUF A;  2QQA A;  2XK0 A;  5GAM d;  3TCJ A;  3ZL7 C;  1ARK A;  5KYU A;  4BI8 B;  4QKU A;  2FEI A;  3KFV A;  3EFO B;  2BE7 D;  4LXC A;  1N9R A;  2K5L A;  2MI6 A;  3F70 A;  5GAN d;  5FRN A;  2DIL A;  2L5Q A;  3UPU A;  1RUW A;  4E2F B;  4EMK A;  3EG9 A;  2C0T A;  1IB8 A;  4Z88 A;  3CPF A;  3ZEH A;  2JS0 A;  1YIJ T;  2RNA A;  3E1S A;  2DBK A;  1LNX A;  2GBQ A;  2O4X B;  2E6N A;  5GJV B;  2AZV A;  1YP5 A;  1JRI A;  1NBE B;  1U1T A;  2GCX A;  2YDL A;  3UA6 A;  1I5O B;  1IZ6 A;  1S72 Q;  1VQK Q;  4Y91 A;  2ZPH B;  4O5V A;  4K11 A;  2DD4 A;  1T0H A;  2A37 A;  5IAY A;  3THK A;  4Y92 A;  4NL3 A;  3SHW A;  3JSC A;  3CPW S;  3UDC A;  1Q81 R;  4M77 C;  3SDZ A;  4JRK A;  1VQM T;  3UA7 A;  4ZGD B;  3HHT B;  4XU3 A;  3MEA A;  2RHI A;  2VKN A;  3CQT A;  4C92 C;  4IIM A;  3FJP A;  1HK9 A;  1D09 B;  2X35 A;  3J7A F;  2I0N A;  2K6D A;  2JTM A;  7AT1 B;  3JCM d;  2EIF A;  3OW2 P;  1WXT A;  1JJ2 S;  4C8Q B;  3G6E T;  3QHS A;  1AVZ C;  2L3Q A;  2JS2 A;  3VS2 A;  3A8G B;  1XJW B;  1WIE A;  2DRK A;  4KBM B;  5FWB A;  4FT4 A;  1UJY A;  4BY6 C;  3L2W A;  2JZ2 A;  1BU1 A;  2NUP A;  2FRW A;  3INZ A;  3CCR Q;  1WPY A;  2LX9 A;  3CC2 A;  2HSE B;  2EYX A;  1OZ2 A;  3G71 A;  4QT7 A;  2VB6 A;  1RAB B;  5HK3 A;  2ZCF B;  1YJ9 A;  1K73 U;  1PSE A;  1VQ6 Q;  2HKN A;  1UHC A;  2ZPE B;  1TH7 A;  4M78 C;  1HSQ A;  2MOX A;  3EFO A;  2FPE A;  2QEX T;  4XTZ A;  1KD1 C;  1MHN A;  2PZ1 A;  3OYC A;  1QVG A;  5A2Q E;  3BY7 A;  3JCM J;  2KYM A;  3CCL Q;  3QII A;  1LOJ A;  3QBY A;  2E12 A;  2DET A;  2O2O A;  1KFZ A;  4OB0 B;  3RMS A;  2CSI A;  4UC4 A;  4CC4 B;  2K79 A;  1GCQ C;  1SG5 A;  1RAF B;  3QKJ A;  3OYE A;  3CCV Q;  3M53 A;  2O4X A;  3H41 A;  2RF0 A;  5C6S A;  1W1F A;  3EGU A;  4E7J A;  3X26 B;  1D1B A;  1UEB A;  2MPX C;  3OYF A;  4HT9 A;  2MYS A;  4OB3 B;  3E9F A;  2KT1 A;  2OTL Q;  1MMA A;  1SSH A;  2NLU A;  3PMT A;  3SEM A;  4J9H A;  1WJR A;  1M9S A;  1YBY A;  2VYT A;  5GJW B;  4M7A B;  2KK4 A;  1ZQ1 A;  1WHH A;  1N6A A;  1N8R C;  4QVC A;  1NJI R;  5GAN 8;  3VS0 A;  3TRE A;  2O88 A;  2HBW A;  1WNL A;  1K1Z A;  2BE9 B;  1QWF A;  2F5K A;  2O9S A;  3CC7 T;  3M0P A;  3CC4 T;  1M30 A;  1KSW A;  4JRQ A;  2HQH A;  4L5G A;  5IXB A;  4BAC A;  1LJO A;  4C8Q A;  2FRY A;  2IVW A;  1RAC B;  5IH2 A;  2E5K A;  3UAT A;  2LNH B;  2RD1 A;  4J9I A;  2E3H A;  2CSQ A;  3OBY A;  4NOY A;  2K9G A;  5L8R E;  1QVF P;  1V1C A;  1WJS A;  2B8A A;  2R5M A;  5LJ3 f;  1D1C A;  4HCZ A;  4JJN K;  1TS9 A;  4R56 A;  4IUP A;  3BFM A;  2RQT A;  3EFS A;  5M9O A; 
#chains in the Genus database with same CATH homology
 2CH4 A;  1SPK A;  1ZBJ A;  1JO8 A;  3RBB B;  2F2W A;  4RTT A;  3IQL A;  2OJ2 A;  1MV3 A;  3UF4 A;  3FJ5 A;  3H0F A;  4AFQ C;  4J9F A;  1FMK A;  4RTW A;  5ECA A;  2LQW A;  4OMO A;  1W6X A;  4J9E A;  1UUE A;  2KRM A;  3VS4 A;  2LZ6 B;  2M0Y A;  2A28 A;  1NM7 A;  2EYZ A;  3M0S A;  3H0H A;  1MV0 B;  1ABO A;  2EGC A;  3PVL A;  2RQV A;  2KNB B;  5IHK A;  2DA9 A;  2RQW A;  1UDL A;  2HDA A;  1BBZ A;  2AZS A;  4GLM A;  4HCK A;  1I0C A;  4OMN A;  3EG1 A;  2BTT A;  2MIO A;  3EHQ A;  2GGR A;  1TUD A;  3EG2 A;  2J06 A;  2CH4 W;  2J7I A;  2OI3 A;  1WDX A;  5FWC A;  4D8K A;  1ZSG A;  1WYX A;  2HSP A;  2DM1 A;  3TSW A;  2D8H A;  2BZ8 A;  4M4Z A;  2JM9 A;  1J3T A;  2VWF A;  2EBP A;  2KRN A;  2DRM A;  1BK2 A;  2CRE A;  2RN8 A;  4F14 A;  1PKT A;  3VS3 A;  4E6R A;  3R6N A;  2V1R A;  2D8J A;  2LQN A;  1ZUY A;  4Z8A A;  2K3B A;  3TSZ A;  1TUC A;  1X2Q A;  2ROT A;  4HVW A;  2CT3 A;  2J6O A;  1RI9 A;  4ORZ A;  3VRZ A;  1WFW A;  2YT6 A;  1K4U S;  1X6B A;  2L2P A;  1GL5 A;  1AEY A;  2F2V A;  1KIK A;  2ED0 A;  3NPF A;  4AG2 C;  1K76 A;  3VRY A;  1M8M A;  4LE9 A;  2LJ1 A;  2C0I A;  2DMO A;  1AOJ A;  2XMF A;  3EHR A;  1M27 C;  1QWE A;  2EGA A;  2EKH A;  2J6F A;  2EQI A;  4EIK A;  2DLP A;  1OPL A;  1SEM A;  1QKX A;  4RTY A;  1SRL A;  4J9G A;  1NYF A;  1QCF A;  1UTI A;  2GTO A;  2DYB A;  4OML A;  2KR3 A;  1IO6 A;  2NUZ A;  3I5R A;  2LJ0 A;  2YUP A;  2EVR A;  3H0I A;  4FSS A;  2RQU A;  2H8H A;  1Y57 A;  1PKS A;  2FO0 A;  2ABL A;  4LUE A;  1W70 A;  1X6G A;  4JJC A;  1JXO A;  1PHT A;  2DF6 A;  4CC7 A;  4AFU C;  1HD3 A;  2DL8 A;  4CC3 A;  3M0T A;  2DBM A;  2DX1 A;  4X1V A;  1WA7 A;  1X43 A;  4Z89 A;  3VS1 A;  1XOV A;  1GBR A;  1GCQ A;  2EYY A;  2EW3 A;  2RQR A;  3RNJ A;  1WI7 A;  2YUQ A;  2PNI A;  2ESW A;  2ROL A;  3REB B;  1GBQ A;  1K0S A;  2KYB A;  2M51 A;  1GFD A;  2J6K A;  2W10 A;  4D8D A;  2YUN A;  1YN8 A;  4RTV A;  1OEB A;  1I07 A;  1ZX6 A;  2BZY A;  2JMC A;  1NEB A;  1RLQ C;  2AKL A;  4ZNX A;  4F17 A;  1SRM A;  1U5S A;  1M3B A;  4CC2 A;  5HCK A;  2LCS A;  1MUZ A;  2AKK A;  2D0N A;  1ZUK A;  2CUD A;  2KT8 A;  2LMJ A;  1K9A A;  1AWJ A;  2AK5 A;  4HVV A;  4GBQ A;  3ZL7 C;  1ARK A;  2K2M A;  1ABQ A;  2VVK A;  2FEI A;  2KBT A;  3KFV A;  1JXM A;  2ENM A;  2A36 A;  5IXF A;  2DIL A;  1RUW A;  1PRM C;  1U3O A;  2C0T A;  1WX6 A;  4Z88 A;  4JPB W;  2JS0 A;  4J9C A;  2RNA A;  2JW4 A;  1AZE A;  2DBK A;  2GBQ A;  5GJV B;  2AZV A;  1E6G A;  1YP5 A;  1ZUU A;  2X3W D;  3NHN A;  2GQI A;  2YSQ A;  1AWX A;  1AD5 A;  2YDL A;  3UA6 A;  2KGT A;  4OMP A;  1H3H A;  1SHG A;  1NYG A;  4AFZ C;  1VA7 A;  2SEM A;  1H92 A;  1UHF A;  4K11 A;  1T0H A;  2A37 A;  5I11 A;  3THK A;  4Y92 A;  1FYN A;  3SHW A;  1X27 A;  1X69 A;  2L3S A;  2D1X A;  4JJD A;  5EC7 A;  3UA7 A;  4AFS C;  3ULR B;  2X3X D;  2VKN A;  3CQT A;  1N5Z A;  2IIM A;  1VYT A;  2DVJ A;  4IIM A;  2EGE A;  4ESR A;  4RTU A;  3REA B;  1NLO C;  2DL3 A;  2I0N A;  1UG1 A;  2K6D A;  1AZG B;  4IIO A;  4J9D A;  4HXJ A;  1UEC A;  2RPN A;  1OV3 A;  1WXT A;  1G2B A;  2V1Q A;  2SRC A;  1WXU A;  1AVZ C;  2L3Q A;  1Z9Z A;  2JS2 A;  1JU5 C;  1VYV A;  3TVT A;  3VS2 A;  2W0Z A;  1WIE A;  3C0C A;  2KXC A;  2DRK A;  1LCK A;  5FWB A;  4HVU A;  1X2K A;  1UJY A;  2HEQ A;  2CT4 A;  1JEG A;  1CKB A;  3I9Q A;  1BU1 A;  1B07 A;  2FRW A;  1NLP C;  2JMA A;  2ECZ A;  4JZ3 A;  4R0K A;  3M0U A;  2JM8 A;  2DL4 A;  4RTZ A;  2O31 A;  1QKW A;  1SHF A;  1RLP C;  3VS6 A;  2B86 A;  2QDL A;  2EYX A;  4LN2 A;  3A98 A;  4JZ4 A;  2EPD A;  4QT7 A;  2DNU A;  2DL5 A;  1AWW A;  2NWM A;  1H8K A;  2P4R A;  2CDT A;  2DJQ A;  1NG2 A;  2YUO A;  4J9B A;  2KEA A;  1HJD A;  1UHC A;  1WLP B;  4OMM A;  3NGP A;  1HSQ A;  2MOX A;  1B3Q A;  2FPE A;  2GNC A;  2LJ3 A;  2PZ1 A;  1EFN A;  1YWO A;  1JQQ A;  2JXB A;  1S1N A;  1T3S A;  2FPF A;  3PVQ A;  2KYM A;  2O2O A;  1KFZ A;  2CSI A;  1M3A A;  4CC4 B;  4LNP A;  5IHN A;  5FW9 A;  2K79 A;  1U06 A;  1T3L A;  4A63 B;  3LH5 A;  1GCQ C;  2JTE A;  3H41 A;  2DE0 X;  2RF0 A;  2FG0 A;  3QWX X;  4F16 A;  1W1F A;  3EGU A;  2HCK A;  4DEX A;  5L23 A;  2K7A A;  4RTX A;  2LX7 A;  4OMQ A;  2BZX A;  2DL7 A;  3QWY A;  2EYW A;  2O9V A;  1CKA A;  2PTK A;  1Y0M A;  2GTJ A;  2KT1 A;  1SSH A;  1PWT A;  1OPK A;  1PNJ A;  1E6H A;  1Z9Q A;  3SEM A;  4J9H A;  4WCI A;  2KRO A;  3I5S A;  1OOT A;  3EG0 A;  1BB9 A;  5GJW B;  5IHI A;  2G6F X;  1K0X A;  2KRS A;  4RUG A;  2RMO A;  1UJ0 A;  3VS0 A;  2O88 A;  1GRI A;  2HBW A;  1K1Z A;  4LUD A;  3M0R A;  1QWF A;  3PE0 A;  2O9S A;  2FPD A;  3JV3 A;  2A08 A;  1VYU A;  1UE9 A;  1T0J A;  2JT4 A;  3M0P A;  1M30 A;  1KSW A;  2L0A A;  2ED1 A;  3VS5 A;  5I22 A;  1M3C A;  3U23 A;  1GFC A;  1I1J A;  5IXB A;  4KRT A;  3GBQ A;  2KXD A;  3EG3 A;  4JJB A;  1PRL C;  4DEY A;  2FRY A;  1TG0 A;  2LP5 A;  1GCP A;  2L3P A;  4AG1 C;  5IH2 A;  2E5K A;  1UGV A;  2C0O A;  3UAT A;  2J05 A;  2LNH B;  1ZLM A;  1A0N B;  1G83 A;  4J9I A;  2OAW A;  2MCN A;  2F2X A;  1KJW A;  2CUB A;  2CSQ A;  1WXB A;  3O5Z A;  1AWO A;  1E7O A;  2K9G A;  1NEG A;  3I35 A;  1V1C A;  3M0Q A;  1QLY A;  1UFF A;  3NMZ C;  3VS7 A;  1YCS B;  1YWP A;  1YNZ A;  2KE9 A;  2RQT A;  1CSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...