2DM1A

Solution structure of the second sh3 domain of human protein vav-2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
GSSGSSGGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human protein vav-2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Protein vav-2
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dm1A00
3VS3A 5FWBA 2BZ8A 1GFDA 3M0SA 1JO8A 3ZL7C 1CSKA 3PVQA 4HXJA 3EG0A 2O9VA 4J9GA 1HSQA 1NLOC 2DLPA 2DMOA 1UDLA 2GNCA 2A36A 1SHFA 4AG2C 3CQTA 3VS6A 1MV0B 3EG1A 4OMNA 1NG2A 3M0TA 3TVTA 5IHIA 4Y92A 2K6DA 4X1VA 2ROLA 4A63B 4J9CA 5EC7A 1K1ZA 2EQIA 2KR3A 1VYVA 1W6XA 1KFZA 2RNAA 5IH2A 3UA6A 1Z9ZA 2AKLA 2SEMA 1WXUA 4QT7A 4K11A 1Z9QA 4RUGA 2AK5A 1RLQC 3SHWA 3UF4A 2K79A 3M0UA 4CC4B 2GGRA 3LH5A 2ABLA 1M3CA 1PRLC 2CUBA 2J7IA 1SRLA 2DL8A 2LMJA 1ZX6A 2DL3A 2A08A 2PZ1A 2CUDA 2KGTA 2ED1A 1JXOA 1B3QA 2LQNA 1WX6A 1UGVA 2EW3A 4JJBA 1GCPA 3M0RA 1MV3A 1WYXA 5IXFA 2V1RA 2RQRA 2YUNA 2D8JA 2EYYA 4HCKA 4KRTA 1BBZA 3NGPA 1GBRA 1MUZA 4DEXA 1CKAA 1ZUUA 1YWOA 1AZEA 1X2KA 1SEMA 3VS7A 4D8KA 1VYUA 1QWEA 2LQWA 2JS0A 5IXBA 4RTVA 1X69A 2KXDA 4LE9A 4AG1C 1T3LA 1ZBJA 2KNBB 4JJDA 3PVLA 1X43A 1KIKA 1WI7A 2LP5A 1K76A 2L3QA 2MCNA 2O31A 3ULRB 2MIOA 2DX1A 3PE0A 4RTXA 4Z8AA 4CC7A 3M0PA 1WDXA 2HBWA 1PNJA 2DL5A 2LZ6B 2O9SA 2DE0X 2KE9A 5GJVB 3VS5A 2RQWA 1OPLA 1BB9A 2DRMA 2DJQA 1E7OA 1X6GA 2BZXA 3A98A 4GBQA 1PKTA 1YNZA 1YWPA 3O5ZA 4LUDA 1TUDA 2DF6A 3U23A 2CT4A 1X27A 2PNIA 1WLPB 4AFUC 1QLYA 2ROTA 1UE9A 1UHCA 1QKWA 1PRMC 4CC3A 1AD5A 2JW4A 5GJWB 4OMMA 2A28A 1UHFA 2YSQA 2DYBA 2AZVA 4HVUA 1ZSGA 4JPBW 4JZ4A 1GBQA 2EVRA 3JV3A 4OMOA 5FW9A 2FEIA 1H3HA 1JQQA 1X6BA 2EKHA 2KYMA 4LN2A 3I9QA 2EYWA 4HVVA 2YUPA 2DNUA 1E6HA 4FSSA 4HVWA 2CH4W 2ESWA 3VS1A 1PHTA 1K0SA 2D1XA 1ABQA 2J6OA 4OMQA 4F16A 2GQIA 3IQLA 1SRMA 2EBPA 3RNJA 3EG3A 3RBBB 2CDTA 2KRMA 2HCKA 2JM9A 1M30A 4CC2A 1UJYA 1BU1A 3NMZC 1FYNA 3I5RA 1OV3A 2ECZA 1AWWA 1IO6A 2KRSA 1VYTA 2DILA 2CREA 1QCFA 1WA7A 2L2PA 1VA7A 1QKXA 2RN8A 4R0KA 5I11A 2FG0A 1UG1A 4ESRA 2JT4A 4J9FA 1H8KA 3VS0A 1AWOA 1ABOA 4RTWA 2FPFA 2RQUA 2C0IA 2GTJA 2LX7A 3UA7A 3SEMA 2C0OA 2EYXA 2L0AA 3THKA 4RTUA 2ENMA 2RPNA 2JS2A 4Z89A 2IIMA 2DL4A 4JZ3A 1EFNA 1TUCA 2F2WA 2H8HA 1UUEA 2L3PA 2L3SA 1I07A 2FRYA 2RQVA 2DVJA 3QWXX 4M4ZA 1OPKA 2CSQA 3REBB 2OAWA 4AFSC 1NEGA 2VVKA 1TG0A 2J6FA 1K0XA 3NPFA 1UFFA 2DBMA 2KT8A 1G83A 2NUZA 1ARKA 2JMAA 4OMPA 4RTTA 4J9EA 5HCKA 1M3AA 2EGCA 2BTTA 1WXBA 2DL7A 4WCIA 4LUEA 1T0JA 2DRKA 2X3XD 2DM1A 4RTYA 2YDLA 2KROA 2YUOA 5L23A 3I35A 1LCKA 1SSHA 2HDAA 2KEAA 4D8DA 2O88A 2LJ3A 1UTIA 1ZUKA 3VS4A 1HJDA 2G6FX 1RI9A 2V1QA 1NM7A 4LNPA 1GCQA 1AWXA 5IHNA 4J9HA 1I0CA 1YCSB 2RF0A 3H0HA 1OEBA 4JJCA 4IIMA 1AEYA 3QWYA 1V1CA 2W0ZA 3R6NA 1JU5C 2SRCA 1U5SA 2GTOA 1G2BA 2M51A 2AKKA 1QWFA 1NYFA 4AFQC 1Y57A 1RLPC 2JM8A 5I22A 1NLPC 1GCQC 1PKSA 2J06A 5ECAA 2CSIA 2K3BA 2NWMA 1KJWA 2JMCA 1RUWA 3TSZA 3EHQA 3GBQA 2OJ2A 1I1JA 2B86A 1KSWA 3EHRA 5FWCA 2KBTA 1AZGB 2MOXA 4J9IA 1NEBA 1PWTA 1Y0MA 2DA9A 3C0CA 1T3SA 2K9GA 1AWJA 1ZLMA 2GBQA 2LJ0A 2EPDA 2CH4A 1E6GA 1H92A 4E6RA 2D8HA 2JXBA 3REAB 3H41A 1OOTA 2EGAA 4IIOA 2X3WD 1U3OA 1SPKA 2K2MA 2J05A 1W1FA 2F2XA 2K7AA 4ORZA 1X2QA 1K4US 4Z88A 2RMOA 3NHNA 4F17A 1AOJA 4J9DA 2I0NA 2YT6A 2LJ1A 3TSWA 2KRNA 2C0TA 4GLMA 2FPDA 4DEYA 1XOVA 1M8MA 1GRIA 2E5KA 2KXCA 2RQTA 3H0FA 2VWFA 1B07A 2LNHB 1JEGA 3FJ5A 1CKBA 2AZSA 1S1NA 1SHGA 2EGEA 2YUQA 2W10A 1U06A 2KYBA 2FRWA 3VRZA 1K9AA 1W70A 1BK2A 3EG2A 2O2OA 1A0NB 5IHKA 3I5SA 2FO0A 2A37A 1AVZC 3H0IA 1T0HA 3EGUA 1M3BA 2LCSA 3UATA 1WXTA 2HSPA 1GFCA 2BZYA 1J3TA 2KT1A 2JTEA 2M0YA 2QDLA 4ZNXA 1FMKA 4EIKA 1N5ZA 1WIEA 1GL5A 1UJ0A 4RTZA 1UECA 2F2VA 2FPEA 2J6KA 4OMLA 2ED0A 1HD3A 2XMFA 2EYZA 2CT3A 3VRYA 1JXMA 3KFVA 4AFZC 2OI3A 2D0NA 1ZUYA 2PTKA 2HEQA 2VKNA 3VS2A 2P4RA 4F14A 1YP5A 2DBKA 1YN8A 3M0QA 1M27C 4J9BA 1NYGA 1WFWA
chains in the Genus database with same CATH superfamily
1JJ2S 3CPWS 3EGDB 1M90R 1K9MC 2I2LA 1R0BG 4M75G 1NLOC 2DMOA 2D6FA 4OB3B 3EG1A 3TVTA 1YHQA 2K6DA 4X1VA 4J9CA 5EC7A 3OS2A 1K1ZA 3I55A 3UPUA 4PNOA 2DETA 4II1A 1O9SA 1W6XA 3GPLA 3CCJA 3GLXA 2ZZDA 3CC7Q 4XTXA 5CIUA 2SEMA 1KHIA 2QQBA 3CCMA 1Z9QA 4RUGA 2AK5A 3SHWA 3UF4A 2GGRA 4M7AC 5A0DA 1M3CA 1PRLC 2DL8A 4DA4A 2DL3A 5DM7R 2CUDA 2ED1A 3MEAA 1R8OB 1WHMA 2LQNA 1VQ8T 3V8KA 1PSFA 3GNFB 2M02A 2M0OA 2YLBA 3OBYA 4PJOG 3TU4K 1IREB 1JJ2P 3A8LB 4DEXA 1N9SA 4C5GA 1NPPA 1OU8A 2EQJA 1SEMA 1VYUA 2E6NA 2DIGA 4FT2A 5IXBA 4M77D 4RTVA 1SSFA 3TCJA 1ZBJA 4ATOA 1KIKA 3RERA 1WI7A 2FHDA 3VYHB 1Q82C 1VQMQ 2L3QA 1VQNT 4X9CA 2DX1A 4RTXA 2V8IA 1X6OA 4PJNA 2K3YA 3M0PA 1WDXA 6AT1B 3RDVA 4A54A 2HL5C 4C92E 1OPLA 1WNLA 4J7FA 2DRMA 3E9GA 4X34A 1ACMB 1E7OA 3A98A 1YWPA 1M1GA 3H9NA 3U23A 2ROTA 2RHUA 1UHCA 1B34A 1QKWA 4FL6A 4CC3A 1AD5A 2EQMA 2A28A 3MJXA 4PJOB 3G6ET 1YIJA 5DLOA 1H3ZA 2DTIA 3JV3A 1M2VB 3MEVA 3CCLQ 4N0AA 3CC7A 3QG1A 1X6BA 2OTJA 2EKHA 1AT1B 3NTKA 5GAN7 1HXDA 2EYWA 4HVVA 2ZAEA 3T9NA 2CH4W 1YI2Q 2G3RA 3NTIA 4M78G 3INZA 2CP5A 5I2MA 1QVGS 2EBPA 4MDXA 4MZMA 4FYYB 4MZPA 3RESA 2X51A 1YITA 4J5YA 3L2VA 3UDCA 2HQEA 3I5RA 1AWWA 4E47A 2CREA 1WA7A 2L2PA 2DZ9A 3MP8A 1W2BP 3OS5A 2JT4A 3G71Q 5KE3A 3VS0A 1ABOA 1NPRA 4XTUA 2GTJA 2LX7A 2R5AA 3OW2S 3EFRA 1HYOA 3VJPA 3SEMA 2DZCA 1VQ6Q 4PJMA 1Q81C 1M4ZA 2EYXA 2RPNA 2IIMA 5GMKi 4WF2A 1FMVA 1Q7YC 3FC3A 1UUEA 4OMFB 2XD0A 1PG5B 3I56T 4M4ZA 4XU0A 1M9SA 3JCMe 2XDBA 1VQ6A 1PD0A 2LTOA 3P8HA 1K0XA 3CCQT 2QQSA 2LQKA 5IT9E 2KT8A 4IUQA 4M7AA 4JLIA 4OMPA 2JTMA 2HAXA 1Q82U 5J39A 1MMAA 2ZCFB 2LCLA 1M3AA 2EGCA 2BTTA 4FW1A 2DXTA 4M77B 4EMHA 3V7CA 4WCIA 5GANg 3CCQQ 1Q82R 1DJ7B 4YTLA 4BI8B 1O75A 3OB9A 2NUPB 5C6SA 1LCKA 3X28B 3I56Q 1PM3A 2O88A 1NJIC 2LJ3A 4M75E 1UTIA 1ZUKA 2G6FX 5CQYA 1RAAB 2DD4A 3JCMV 3OYLA 1WHLA 4NL3A 3QIIA 4JDSA 1YHQT 1YI2A 5IHNA 2YRDA 1W2BA 1K8AC 3H0HA 3QDRB 3CCEA 2L89A 3OYAA 4CRIA 1V76A 1BI1A 1U5SA 2M51A 2MF2A 1QWFA 4R56A 3VV0A 1RLPC 5KYXB 1QCNA 1PKSA 1ZHIA 1BYMA 3OYHA 4C8QA 3PIOA 4WTOB 1VQ8A 3I56A 4KGVB 1I1JA 3CMAQ 2VXEA 4AMCA 1KSWA 2YHTA 4C8QG 5FWCA 2MOXA 2ZPGB 5D6WA 4J9IA 2Y90A 5C0MA 3FLGA 2VV5A 3LGFA 1VQ9A 3G71T 1B7TA 2KMTA 2ATCB 4JRQA 3C95A 4PJOF 4KBMB 4M7AD 1AWJA 2XK0A 4N0AC 2LJ0A 4ZGEB 4M78D 1E6GA 5LJ3f 1TSFA 4C8QC 4DBFA 3CCRQ 4FM4B 1BCOA 2D8HA 2JXBA 3CCLT 1OOTA 1XQHA 2QA4A 4IIOA 3OYBA 3OSVA 3S3OA 1VQPT 2LNVA 4ZN1A 5HK0A 2J05A 1W1FA 2A3LA 2VB6A 2EYQA 4UC4A 4MMKA 1U1SA 4Z88A 2B8AA 3NHNA 2QA4Q 4HCBA 2CZ7B 2I0NA 2YT6A 2CYZB 3TSWA 3CCRA 4GLMA 3V7SA 2CP3A 1XOVA 1VQ5T 1GRIA 1G3WA 1Y7XA 1PCXA 2CP0A 2LNHB 8AT1B 2BUDA 2DEQA 1CKBA 1S1NA 2YUQA 1VQ9Q 2QTXA 1K9AA 2KDSA 2OTJT 3CCMQ 3JCMc 5IHKA 1M1FA 3V8JA 1Q81U 1RACB 1UGPB 2EAYA 3EGUA 3RKYA 1JJ2A 2E12A 4EPCA 3UATA 2KY9A 2P4TA 1MHNA 2KT1A 2VGMA 1N27A 1WJRA 2QDLA 1YJWA 2YRVA 4M77A 1UJ0A 4RTZA 3OY9A 3BDLA 2J6KA 2LQ8A 1VQ7A 1ZA1B 1HD3A 4OF1A 2EYZA 1K73C 1OX9A 3QYGB 5GMKe 3JRZA 2RD1A 1QP2A 2D0NA 1Y07A 2PTKA 2HEQA 1BIBA 2VKNA 3CCLA 1TOVA 4M77C 3M0QA 3OYNA 2QXFA 1AEYA 2K5FA 4HCKA 1G83A 2RA2A 5CK9A 2DO3A 2BZ8A 3E1SA 3ZL7C 1JO8A 4E7ZA 1GFDA 5GAOp 3CBPA 3JB9D 2O9VA 4V2SA 3LH0A 1QVPA 4E7JA 2DLPA 1VQKQ 3G1JA 1XNIA 4OMNA 3M0TA 3P8BB 5IHIA 1W2BS 2ROLA 2HNIA 3CCMT 2D0QB 2L3RA 5IH2A 1VIEA 5IAYA 2PU9B 2P0QA 3M57A 1UGQB 3HPWA 2XU8A 4F7UF 2GQVA 4XAXB 3M0UA 2CUBA 3V7RA 3OYCA 2LMJA 4PFPA 4KH0B 3JSCA 2K4YA 4B9XA 2FZCB 2CP2A 1OZ3A 1Q95G 1WX6A 3MHXA 4PK4A 2JUFA 1I8FA 1GCPA 1F1BB 3M0RA 2RJCA 1WYXA 2VYTA 5IXFA 1RAIB 2K5LA 2LCCA 5GAN2 1N8RU 2QEXA 4KRTA 1BBZA 3BW1A 1MUZA 4M78E 1K73U 2HZYA 3VS7A 4M7DB 4QVDA 1QWEA 2F69A 2EJFA 4KH1B 3OS1A 3EFSA 5KE2A 2AIRB 3EFOA 1BIAA 2KXDA 2P84A 2DERA 4RG2A 2KNBB 4E7IA 2DTHA 2LP5A 2MCNA 5GAMe 2MIOA 3PE0A 4Z8AA 3CMAT 4FU6A 4CC7A 4M75D 1UGSB 1PNJA 4E7KA 1K9MU 5GAMj 2LZ6B 5GJVB 4HCCA 3VS5A 2RQWA 5FRMA 1BB9A 5GAMh 2BZXA 1X6GA 2DJQA 3JCMd 3I55Q 4GBQA 3O5ZA 4LUDA 2MI6A 5CCAA 3PFSA 5I21A 3OYGA 4AFUC 2CS7A 3VU3C 4EMKB 1RL2A 1JRIA 1B34B 1EZZB 5GJWB 2IG0A 3PMTA 1KQ1A 1UHFA 2YSQA 2AT1B 4DOWA 2AZVA 4JZ4A 3EGXA 1RAHB 5A2QE 3H8ZA 4XTVA 1VQLT 2OTLT 5FW9A 2EJ9A 4NS5A 1M2VA 1JQQA 5LJ5d 5GAOq 4DQ2A 2RH2A 2KYMA 4LN2A 2ZPBB 4XQ3A 5LJ3j 4LDXA 1NZ9A 4HVWA 2DEUA 2YWWA 2DD5A 5GMKl 2D1XA 4O6JA 5GANf 3V8LA 3HL8A 3P8DA 1U8RA 3RMSA 2CDTA 2HCKA 2JM9A 1YJNQ 2DKGA 1G3SA 1BU1A 3PNWC 3PT9A 3RUXA 1TUGB 1TTHB 1IO6A 2KRSA 4M77E 3CD6T 1VYTA 2DILA 1QCFA 3F70A 3OA6A 2MWOA 3DLMA 3M59A 3EGXB 5I11A 3QYHB 1UG1A 4LDWA 3FRNA 4IUVA 1RAGB 4J9FA 1N6AA 2AHJB 5KYUA 2QA4T 1AWOA 1QP3A 2FPFA 2DXCA 5FRNA 3UA7A 1YJNA 1ZBXA 2P0KA 2E5QA 2L0AA 2ENMA 4Z89A 2CKKA 5GAMd 4OB0B 3OYIA 1EFNA 1TUCA 2H8HA 2RHYA 1WJQA 1KC8R 1SF9A 3CCJT 3QWXX 1X01A 3A8MB 4ANJA 2EWNA 4GY5A 4J8OA 1TU0B 1WHKA 1TG0A 2J6FA 3NPFA 1UFFA 1VOMA 2DBMA 2X9HA 4FSXA 4Y91A 1ARKA 2JMAA 1LPLA 4KUDK 3CCUT 1JB0E 4M7DA 4C8QD 4IURA 2HSEB 4FYXB 3OW2P 5LJ5h 3C4SA 3OYMA 3L2ZA 4JS4A 1N8RC 1WHHA 2YDLA 1WZOA 3WVEB 3PGGA 1YI2T 3JCMf 2HMAA 2LT4A 1IRXA 3FEOA 4D8DA 4QW2A 1K8AU 1D0YA 4M7DC 4E7HA 1NM7A 3G4ST 3JCMX 1Q81R 3CD6Q 1BI2A 2RF0A 1OEBA 4JJCA 4IIMA 3JCMb 3L2RA 2VUBA 4C92C 1H641 1U1TA 5DLQE 4M75A 1G2BA 4M78C 1S72A 1KQSS 4M77G 1D09B 2XHCA 2BIVA 3MP1A 2JM8A 1IXDA 5I22A 3TREA 4VUBA 4BACA 5GANe 2ZPIB 3OYFA 2CSIA 1NBEB 2Z0WA 2JMCA 1RUWA 5GANj 3TSZA 3GBQA 2RJDA 2JJ9A 2KK4A 3TQ7P 3EHRA 2COWA 4DBHA 2HKQB 4B6MA 3CCSA 1NEBA 2HKNA 2CP6A 1PWTA 3QUIA 1ZSZC 4HKEA 4F7UB 3EG9A 1Q86U 3C0CA 4F7UA 3M9QA 1T3SA 2K9GA 2GBQA 2EPDA 2RHIA 3CMEQ 4BDZA 2QDYB 4XU1A 2CZ0B 2EQKA 4EMKA 2E41A 3SB2A 1OU9A 3H41A 2EGAA 3HRUA 2X3WD 4PJOA 4XTWA 4E7SA 1V29B 4QQGA 4RKUE 1NJIU 2F2XA 1KQSP 2L8DA 1VQ8Q 3OBWA 1VQKA 3QXEB 1D3BB 1G5VA 4IUUA 2R58A 2XI9A 2PVOB 4EMKC 4F17A 2X4XA 4M75F 1X75C 1QMCA 1FWZA 2C0TA 1TH7A 4Z02A 3ZFJA 4KGXB 2KXCA 2QASA 2O4XB 1B07A 2VWFA 1MGQA 4OB2B 1YJ9Q 2JTFA 3A8HB 2EGEA 2W10A 1W70A 3EG2A 2O2OA 4M77F 1KHCA 3SDZA 1TWBA 3H0IA 4XU2A 4GLKA 1M1KR 2DTOA 2LCSA 2DPPB 4M78F 1VQOQ 2BZYA 3QDFA 4BDYA 5KCOA 5L8RE 2JTEA 4ZNXA 1FMKA 4EIKA 1N5ZA 1UECA 3M5AA 2HD0A 3FJPA 1VQLA 2GCXA 2OTLA 1IGUA 2QQAA 2CT3A 2V8JA 3VRYA 4BY6C 7AT1B 5HKCA 3KFVA 4AFZC 4HT8A 4AT1B 2LRQA 3OW2A 2OI3A 1VQ4Q 3X25B 3MEUA 2LX9A 1ZUYA 1AHJB 3OMCA 5CO7A 4KT0E 2FYKA 1OI1A 4F14A 1ZQ1A 1YP5A 1KC8U 1JBMA 2EIFA 2DYIA 1M27C 2COYA 2V26A 4BE0A 4C0GA 3VS3A 5FWBA 8ATCB 3M0SA 4HXJA 4M7DE 3CCSQ 1MMDA 4J9GA 2GNCA 4AG2C 4B9WA 4DBQA 1UDLA 1MV0B 1KQSA 3GP8A 4Y92A 4A63B 4JRPA 3JCMP 2EQIA 2KR3A 1VYVA 4BB7A 3VYGA 1NJIR 1KFZA 1VQNQ 2RNAA 3HSBA 3UA6A 2QTVA 2AKLA 3G71A 4QT7A 4K11A 2QQ9A 1QVFS 2QG9B 2C06A 4CC4B 3PIPA 4M75C 2J7IA 1SRLA 3GOXA 2A08A 3CC7T 1K8AR 2COZA 3CCVQ 2D9TA 1JXOA 1B3QA 1WQ7A 4MDWA 1UGVA 1VQPA 4JJBA 5KYYB 1YITQ 3DLLA 2V1RA 2YUNA 2D8JA 2DVEA 1GBRA 5D7UA 3M54A 1AZEA 1X2KA 2CZ1B 4A53A 4D8KA 5KYXA 1ZSZA 3OS0A 3EH1A 2DK3A 5GAOm 3PMIA 2EFIA 1X69A 4LE9A 1SG5A 2JNGA 4AG1C 3A8GB 4A4EA 4JJDA 2OTJQ 4LDYA 3CCEQ 2DJZA 2JN0A 1RAEB 4PFOA 3HHTB 2O31A 3ULRB 5D6YA 1YIJQ 3Q1JA 2O9SA 2DE0X 2M9UA 1C1AA 3ER0A 5GAMg 1YNZA 1Q7YR 2NUTA 1TUDA 1K9MR 1ZA2B 2DF6A 3CCRT 1X27A 2PNIA 3HP9A 5LJ5f 1PRMC 2A0FB 4M7DG 4J7IA 2R57A 5LJ5e 2E65A 2ZGWA 3O8VA 4OMMA 1C0MA 2KQWA 2V8KA 4QVZA 1YJWT 5LJ5j 2VC8A 1VQ5A 4HVUA 3M53A 4JPBW 3X24B 4JLGA 2Y4YA 1OQKA 2KI7A 4HA8A 2EVRA 2HL3A 1M1KC 2FEIA 2F5TX 4Y28E 5IN1A 1QQJA 3MEWA 1VQNA 4BD3A 3I9QA 2ZPEB 2BE9B 4IUPA 2YUPA 2X4JA 2DNUA 4FSSA 4M7AB 4BUGA 4M75B 1M5Q1 1PHTA 4ME7A 1QVFA 3BFMA 4OMQA 4F16A 1RADB 2VASA 1IGQA 3RNJA 4EDUA 4J6XA 2LDMA 3EG3A 4ELYC 3RBBB 2RHZA 1M30A 2GFUA 4ELZC 1UJYA 3CCUQ 3NMZC 4C92B 1FYNA 1MNDA 1OV3A 1Q86R 1VQKT 3S3NA 3CC4T 4M78B 3CPWA 1M8VA 4C0DB 1N8RR 1NE8A 4N4IA 3JCMW 2MMPA 2FG0A 2PQWA 3DKMA 4OB1B 4ZN3A 3CD6A 1H8KA 3M4YA 4RTWA 3JAME 3ASKA 2C0IA 4BI4A 5GANh 2L5QA 4X9DA 2C0OA 4XTYA 4RTUA 4F7UG 2JS2A 4R55A 3HTRA 3HFNA 3JB9H 3JB9I 1I5OB 1G3YA 1I07A 4M7AE 2RQVA 1N9RA 4M7DF 2CSQA 3REBB 3QZ5B 4Q5WA 2OAWA 2QGGA 5LJ3e 2QGFB 1M90U 2XKOC 3EH2A 3FDRA 3LW5E 1TXQA 4QVCA 3CXCS 4IKFA 3AT1B 4J9EA 2MWPA 4C92F 4JS5A 1WXBA 2E10A 3M55A 2FZGB 4LUEA 3SWNC 2DRKA 2CGHA 1OULA 2X3XD 3LX7A 1LOJA 5KYWA 2DM1A 1IHWA 2XDDA 4RTYA 4TVRA 1QVGA 3CC2Q 3I35A 5GAOl 5DY9A 3CCUA 1SSHA 4F7UE 1WHGA 3URGA 2KEAA 4J83A 3UT1A 3JCMQ 3VS4A 2X35A 1HJDA 4PL6A 1P92A 3CC2T 1RI9A 2V1QA 1QW1A 4LNPA 2PUKB 2KAFA 3FIFA 3OYEA 1VQ6T 2F5KA 4E7LA 1I0CA 2OAUA 1YCSB 4RCBA 2EQUA 2KSSA 4MMLA 2JZ2A 3R6NA 1JU5C 2ZPFB 5A0GA 3OQ5A 3CPWP 1FXXA 2AKKA 1OX8A 4ZTFA 3X26B 1NYFA 4AFQC 3JCMJ 5HY6A 2VGNA 1UGRB 2J06A 1BI0A 2XIDA 5GAN3 2NWMA 4MZTA 1KJWA 4C0FA 3EHQA 3EGDA 4PJJA 2EJGA 1D0ZA 3CC2A 2KBTA 2QI2A 3NFCA 4BI3A 1I4K1 4IUTA 3A1PA 4FYVB 5GMKh 3JB9G 3OYKA 4N4GA 5GMKj 4JUVA 3ME9A 5I2SA 4QKUA 2CH4A 1SKUB 1H92A 2NUPA 3RKXA 3MO8A 2Y4XA 1PD1A 5LJ3g 4NL2A 2VXFA 3REAB 2K3XA 1TS9A 1U3OA 5AT1B 3J80E 5EG2A 2K2MA 1XTDA 1YHQQ 2K7AA 2X4YA 1X2QA 4C92G 2RMOA 3QKJA 2E3HA 2JOYA 1KG1A 1R77A 2KRNA 2MAMA 2GFAA 2PVDB 1M90C 5FU7C 4DEYA 3R6OA 3G6EA 2E5KA 3H0FA 3A8OB 2AZSA 1SHGA 1U06A 2FRWA 2KYBA 3VRZA 1KD1R 2FZKB 1A0NB 3C94A 2OX7A 1Y96B 2FO0A 1AVZC 1T0HA 4J6YA 4ZGJB 1PC0A 1M3BA 2QEXQ 3ZBDA 4D6WA 1EX4A 3LWHA 4PFZA 2NLUA 1HK9A 2F2VA 1BCMA 5KCHA 3QO3A 3BE3A 2FPEA 2ED0A 1YITT 1JXMA 3JB9F 4L5GA 1YIJT 3QHSA 1C6VX 4KGZB 4HT9A 3GF5A 3RKWA 3LYIA 4C0DC 3VS2A 1Y71A 3GIBA 2O4XA 1OYXA 2WSFE 1D1BA 2DBKA 3L2WA 1YN8A 3QJ6A 3LWIA 3SWNA 4J9BA 4FYWB 3SWNB 5CKBA 1CSKA 3PVQA 1MMGA 2RJEA 3EG0A 5CKHA 4C0ZA 3CC4Q 1HSQA 1YBYA 2A36A 1SHFA 2OTLQ 3CQTA 3VS6A 1VQLQ 1NG2A 3CMAA 4JRKA 4LD9K 4C5HA 3RR6A 4A4FA 1VQOA 3EG9B 5KYNA 2PUOB 3JB9J 5J26A 3CCVT 1Z9ZA 1S72T 1IHVA 2A7YA 2K2VA 4JJNK 5D6XA 1WXUA 3RMQA 3I55T 1RLQC 2K79A 2H3EB 3LH5A 2ABLA 2KVQG 4OP0A 3DB4A 4F04B 2DXUA 1QCOA 3QJYA 4C8QE 1ZX6A 2PZ1A 2KGTA 2E4HA 1PSEA 1WGSA 1VQ7Q 5LL6S 2WSEE 2EW3A 3CXCA 4DBRA 5KYUB 1MV3A 5GAOr 1YJWQ 4N4HA 2RQRA 2EYYA 2RM4A 3NGPA 1KK7A 3OYJA 1CKAA 1ZUUA 1YWOA 2LQWA 3QSUA 1ZSZB 2JS0A 3CCVA 2E3IA 3CCQA 3J7AF 1W4SA 4OGEA 1EIFA 4KUIA 2YXYA 3PTAA 1T3LA 4OVAA 2M16A 5GAOn 4C8QB 2MYSA 3PVLA 2DXBA 5AYFA 1X43A 5CKDA 4BY6B 1FMWA 2DAQA 2BE7D 1K76A 5J3BA 1YJ9T 4RCCA 5CVIA 1YFNA 2HBWA 3N5BB 3HRSA 2DL5A 5LJ3h 2HQHA 2KE9A 1G3TA 4FT4A 3QZ9B 4NOYA 1PKTA 4EMGA 4OGCA 5A0LA 4LXCA 2XDPA 2LC4A 2QEXT 4P5NA 2CT4A 3HFOA 1BI3A 1QVGP 1WLPB 1VQOT 1QLYA 1UE9A 3EAEA 1MNEA 3KXTA 1Q7YU 5HK3A 2HBPA 2JW4A 3M58A 2QK0A 3OSSC 2PVGB 1KD1U 3AHUA 5KH6A 3E19A 2DYBA 2E1HA 1ZSGA 1GBQA 1KQ2A 1VQ9T 1I5LA 2XICA 4OMOA 1VQ5Q 1H3HA 3M4GA 1IZ6A 1D1CA 3H6ZA 3D7SB 4LDUA 3VKIA 3M56A 1E6HA 3CPFA 3VS1A 2ESWA 4XK8E 3ZEHA 3WVDB 2H3JA 3QPHA 1D0XA 4BE2A 1K0SA 4JRIA 3L1AA 4FCYA 1ABQA 2J6OA 2GQIA 3IQLA 3EFOB 1SRMA 5CR2A 3META 5FU6B 4CC2A 2KRMA 5FLXE 2RI5A 1OZ2A 2ECZA 2RHXA 4BE1A 2RI2A 3G4SQ 1VA7A 2M1HA 1QKXA 2RN8A 4FIBA 4R0KA 3TEEA 1YJ9A 3G4SA 1UEBA 4RG8A 1FX7A 3HKSA 3WXMB 5M9OA 4ESRA 1RI0A 1WQWA 4M7AF 2O01E 3KUFA 5FROA 2RQUA 4ZTJA 2QYZA 5GMKm 2LT1A 1VQ4T 5CQXA 5LJ3d 5GAN5 4LD6A 3THKA 3SFMA 2DL4A 4JZ3A 1QVFP 1VQPQ 2F2WA 2L3PA 3J81E 2L3SA 2FRYA 4J6WA 2DVJA 2FVUA 2F1LA 5GAN4 1OPKA 2WACA 1D3BA 4PKCC 2RI3A 4AFSC 1NEGA 2VVKA 1WHJA 5KYYA 1BKBA 3X20B 2NUZA 2DIQA 1VQMA 4RTTA 2NYSA 2X4WA 3FB9A 4L59A 4C5IA 5HCKA 1YCYA 5GAN8 1LJOA 2DL7A 3L42A 4O5VA 3OMGA 1T0JA 2QQRA 4M7DD 3JCMg 2KROA 2YUOA 5L23A 2CZ6B 3NTHA 1Y96A 4XTZA 2HDAA 2LVMA 3UWNA 5FU7B 2WSCE 2R5MA 2IVWA 2MPXC 1GCQA 1AWXA 2E70A 4J9HA 5GAN6 2ZPHB 9ATCB 2E6ZA 4A4HA 3VUBA 3LGLA 1YJNT 4M7AG 2K5IA 2QAZA 3QWYA 5GAMf 1VQ4A 1V1CA 4PJLA 2W0ZA 2SRCA 2GTOA 3KBGA 1IB8A 1VIFA 1Y57A 3CMET 1M2OA 1NLPC 1GCQC 5ECAA 3CCJQ 4RMOA 2K3BA 1LVKA 2YLCA 4PJOE 4XU3A 2OJ2A 4C92A 2B86A 1Q86C 2K57A 1AZGB 1VQMT 3BDUA 4M78A 3RIRA 4PLIA 2E64A 4QQ6A 2RK2A 1I81A 1Y0MA 2DA9A 1ZLMA 2NUTB 3QBYA 2IPOB 3HRTA 5KYWB 4PJOD 4E6RA 3L2QA 4E2FB 2EKOA 4C5EA 3OYYA 4L6V5 3A5ZB 4FW2A 4LDVA 1MMNA 1M1KU 3JCMh 1SPKA 3CBOA 4CI0C 3CEYA 3G7ZA 2FB7A 1D1AA 4ORZA 4A4KA 3L2UA 1XJWB 3CC4A 1K4US 1G8XA 1K73R 2GF7A 1GXIE 2XG8D 4KULA 4HCZA 3VUZA 4C92D 5CKEA 1AOJA 4J9DA 2LJ1A 2DFUA 1UB4A 4PJOC 2FPDA 2CP7A 4PLLA 4A4GA 1WJSA 3CMEA 1M8MA 1VUBA 1KD1C 4C8QF 2RQTA 2RK1A 1JEGA 3FJ5A 3E2UA 3MPUB 1KC8C 2RB6A 2RJFA 1BK2A 3I5SA 1LNXA 3BY7A 2A37A 3GNGA 3S6WA 4ZGDB 1VQ7T 2RO0A 4QQDA 3CCST 3MKDA 3MP6A 1WXTA 2HSPA 1GFCA 4DOVA 5CKFA 5GANd 1J3TA 1RABB 2HQXA 2FL7A 2M0YA 1GL5A 1WIEA 3CXCP 5FU6C 4OMLA 1RAFB 2XMFA 3C12A 1S72Q 2BKDN 2JVVA 3LLRA 5LJ5g 2MK5A 3SD4A 3CCET 2P0PA 3G6EQ 3S3MA 3OYDA 1R0CB 2P4RA 5CAIA 2YRCA 3CBMA 3MCAB 3E9FA 3DB3A 1WPYA 1NYGA 1WFWA
chains in the Genus database with same CATH topology
3VS3A 5FWBA 2BZ8A 1GFDA 3M0SA 1JO8A 3ZL7C 1CSKA 3PVQA 4HXJA 3EG0A 2O9VA 4J9GA 1HSQA 1NLOC 2DLPA 2DMOA 1UDLA 2GNCA 2A36A 1SHFA 4AG2C 3CQTA 3VS6A 1MV0B 3EG1A 4OMNA 1NG2A 3M0TA 3TVTA 5IHIA 4Y92A 2K6DA 4X1VA 2ROLA 4A63B 4J9CA 5EC7A 1K1ZA 2EQIA 2KR3A 1VYVA 1W6XA 1KFZA 2RNAA 5IH2A 3UA6A 1Z9ZA 2AKLA 2SEMA 1WXUA 4QT7A 4K11A 1Z9QA 4RUGA 2AK5A 1RLQC 3SHWA 3UF4A 2K79A 3M0UA 4CC4B 2GGRA 3LH5A 2ABLA 1M3CA 1PRLC 2CUBA 2J7IA 1SRLA 2DL8A 2LMJA 1ZX6A 2DL3A 2A08A 2PZ1A 2CUDA 2KGTA 2ED1A 1JXOA 1B3QA 2LQNA 1WX6A 1UGVA 2EW3A 4JJBA 1GCPA 3M0RA 1MV3A 1WYXA 5IXFA 2V1RA 2RQRA 2YUNA 2D8JA 2EYYA 4HCKA 4KRTA 1BBZA 3NGPA 1GBRA 1MUZA 4DEXA 1CKAA 1ZUUA 1YWOA 1AZEA 1X2KA 1SEMA 3VS7A 4D8KA 1VYUA 1QWEA 2LQWA 2JS0A 5IXBA 4RTVA 1X69A 2KXDA 4LE9A 4AG1C 1T3LA 1ZBJA 2KNBB 4JJDA 3PVLA 1X43A 1KIKA 1WI7A 2LP5A 1K76A 2L3QA 2MCNA 2O31A 3ULRB 2MIOA 2DX1A 3PE0A 4RTXA 4Z8AA 4CC7A 3M0PA 1WDXA 2HBWA 1PNJA 2DL5A 2LZ6B 2O9SA 2DE0X 2KE9A 5GJVB 3VS5A 2RQWA 1OPLA 1BB9A 2DRMA 2DJQA 1E7OA 1X6GA 2BZXA 3A98A 4GBQA 1PKTA 1YNZA 1YWPA 3O5ZA 4LUDA 1TUDA 2DF6A 3U23A 2CT4A 1X27A 2PNIA 1WLPB 4AFUC 1QLYA 2ROTA 1UE9A 1UHCA 1QKWA 1PRMC 4CC3A 1AD5A 2JW4A 5GJWB 4OMMA 2A28A 1UHFA 2YSQA 2DYBA 2AZVA 4HVUA 1ZSGA 4JPBW 4JZ4A 1GBQA 2EVRA 3JV3A 4OMOA 5FW9A 2FEIA 1H3HA 1JQQA 1X6BA 2EKHA 2KYMA 4LN2A 3I9QA 2EYWA 4HVVA 2YUPA 2DNUA 1E6HA 4FSSA 4HVWA 2CH4W 2ESWA 3VS1A 1PHTA 1K0SA 2D1XA 1ABQA 2J6OA 4OMQA 4F16A 2GQIA 3IQLA 1SRMA 2EBPA 3RNJA 3EG3A 3RBBB 2CDTA 2KRMA 2HCKA 2JM9A 1M30A 4CC2A 1UJYA 1BU1A 3NMZC 1FYNA 3I5RA 1OV3A 2ECZA 1AWWA 1IO6A 2KRSA 1VYTA 2DILA 2CREA 1QCFA 1WA7A 2L2PA 1VA7A 1QKXA 2RN8A 4R0KA 5I11A 2FG0A 1UG1A 4ESRA 2JT4A 4J9FA 1H8KA 3VS0A 1AWOA 1ABOA 4RTWA 2FPFA 2RQUA 2C0IA 2GTJA 2LX7A 3UA7A 3SEMA 2C0OA 2EYXA 2L0AA 3THKA 4RTUA 2ENMA 2RPNA 2JS2A 4Z89A 2IIMA 2DL4A 4JZ3A 1EFNA 1TUCA 2F2WA 2H8HA 1UUEA 2L3PA 2L3SA 1I07A 2FRYA 2RQVA 2DVJA 3QWXX 4M4ZA 1OPKA 2CSQA 3REBB 2OAWA 4AFSC 1NEGA 2VVKA 1TG0A 2J6FA 1K0XA 3NPFA 1UFFA 2DBMA 2KT8A 1G83A 2NUZA 1ARKA 2JMAA 4OMPA 4RTTA 4J9EA 5HCKA 1M3AA 2EGCA 2BTTA 1WXBA 2DL7A 4WCIA 4LUEA 1T0JA 2DRKA 2X3XD 2DM1A 4RTYA 2YDLA 2KROA 2YUOA 5L23A 3I35A 1LCKA 1SSHA 2HDAA 2KEAA 4D8DA 2O88A 2LJ3A 1UTIA 1ZUKA 3VS4A 1HJDA 2G6FX 1RI9A 2V1QA 1NM7A 4LNPA 1GCQA 1AWXA 5IHNA 4J9HA 1I0CA 1YCSB 2RF0A 3H0HA 1OEBA 4JJCA 4IIMA 1AEYA 3QWYA 1V1CA 2W0ZA 3R6NA 1JU5C 2SRCA 1U5SA 2GTOA 1G2BA 2M51A 2AKKA 1QWFA 1NYFA 4AFQC 1Y57A 1RLPC 2JM8A 5I22A 1NLPC 1GCQC 1PKSA 2J06A 5ECAA 2CSIA 2K3BA 2NWMA 1KJWA 2JMCA 1RUWA 3TSZA 3EHQA 3GBQA 2OJ2A 1I1JA 2B86A 1KSWA 3EHRA 5FWCA 2KBTA 1AZGB 2MOXA 4J9IA 1NEBA 1PWTA 1Y0MA 2DA9A 3C0CA 1T3SA 2K9GA 1AWJA 1ZLMA 2GBQA 2LJ0A 2EPDA 2CH4A 1E6GA 1H92A 4E6RA 2D8HA 2JXBA 3REAB 3H41A 1OOTA 2EGAA 4IIOA 2X3WD 1U3OA 1SPKA 2K2MA 2J05A 1W1FA 2F2XA 2K7AA 4ORZA 1X2QA 1K4US 4Z88A 2RMOA 3NHNA 4F17A 1AOJA 4J9DA 2I0NA 2YT6A 2LJ1A 3TSWA 2KRNA 2C0TA 4GLMA 2FPDA 4DEYA 1XOVA 1M8MA 1GRIA 2E5KA 2KXCA 2RQTA 3H0FA 2VWFA 1B07A 2LNHB 1JEGA 3FJ5A 1CKBA 2AZSA 1S1NA 1SHGA 2EGEA 2YUQA 2W10A 1U06A 2KYBA 2FRWA 3VRZA 1K9AA 1W70A 1BK2A 3EG2A 2O2OA 1A0NB 5IHKA 3I5SA 2FO0A 2A37A 1AVZC 3H0IA 1T0HA 3EGUA 1M3BA 2LCSA 3UATA 1WXTA 2HSPA 1GFCA 2BZYA 1J3TA 2KT1A 2JTEA 2M0YA 2QDLA 4ZNXA 1FMKA 4EIKA 1N5ZA 1WIEA 1GL5A 1UJ0A 4RTZA 1UECA 2F2VA 2FPEA 2J6KA 4OMLA 2ED0A 1HD3A 2XMFA 2EYZA 2CT3A 3VRYA 1JXMA 3KFVA 4AFZC 2OI3A 2D0NA 1ZUYA 2PTKA 2HEQA 2VKNA 3VS2A 2P4RA 4F14A 1YP5A 2DBKA 1YN8A 3M0QA 1M27C 4J9BA 1NYGA 1WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS3 A;  5FWB A;  2BZ8 A;  1GFD A;  3M0S A;  1JO8 A;  3ZL7 C;  1CSK A;  3PVQ A;  4HXJ A;  3EG0 A;  2O9V A;  4J9G A;  1HSQ A;  1NLO C;  2DLP A;  2DMO A;  1UDL A;  2GNC A;  2A36 A;  1SHF A;  4AG2 C;  3CQT A;  3VS6 A;  1MV0 B;  3EG1 A;  4OMN A;  1NG2 A;  3M0T A;  3TVT A;  5IHI A;  4Y92 A;  2K6D A;  4X1V A;  2ROL A;  4A63 B;  4J9C A;  5EC7 A;  1K1Z A;  2EQI A;  2KR3 A;  1VYV A;  1W6X A;  1KFZ A;  2RNA A;  5IH2 A;  3UA6 A;  1Z9Z A;  2AKL A;  2SEM A;  1WXU A;  4QT7 A;  4K11 A;  1Z9Q A;  4RUG A;  2AK5 A;  1RLQ C;  3SHW A;  3UF4 A;  2K79 A;  3M0U A;  4CC4 B;  2GGR A;  3LH5 A;  2ABL A;  1M3C A;  1PRL C;  2CUB A;  2J7I A;  1SRL A;  2DL8 A;  2LMJ A;  1ZX6 A;  2DL3 A;  2A08 A;  2PZ1 A;  2CUD A;  2KGT A;  2ED1 A;  1JXO A;  1B3Q A;  2LQN A;  1WX6 A;  1UGV A;  2EW3 A;  4JJB A;  1GCP A;  3M0R A;  1MV3 A;  1WYX A;  5IXF A;  2V1R A;  2RQR A;  2YUN A;  2D8J A;  2EYY A;  4HCK A;  4KRT A;  1BBZ A;  3NGP A;  1GBR A;  1MUZ A;  4DEX A;  1CKA A;  1ZUU A;  1YWO A;  1AZE A;  1X2K A;  1SEM A;  3VS7 A;  4D8K A;  1VYU A;  1QWE A;  2LQW A;  2JS0 A;  5IXB A;  4RTV A;  1X69 A;  2KXD A;  4LE9 A;  4AG1 C;  1T3L A;  1ZBJ A;  2KNB B;  4JJD A;  3PVL A;  1X43 A;  1KIK A;  1WI7 A;  2LP5 A;  1K76 A;  2L3Q A;  2MCN A;  2O31 A;  3ULR B;  2MIO A;  2DX1 A;  3PE0 A;  4RTX A;  4Z8A A;  4CC7 A;  3M0P A;  1WDX A;  2HBW A;  1PNJ A;  2DL5 A;  2LZ6 B;  2O9S A;  2DE0 X;  2KE9 A;  5GJV B;  3VS5 A;  2RQW A;  1OPL A;  1BB9 A;  2DRM A;  2DJQ A;  1E7O A;  1X6G A;  2BZX A;  3A98 A;  4GBQ A;  1PKT A;  1YNZ A;  1YWP A;  3O5Z A;  4LUD A;  1TUD A;  2DF6 A;  3U23 A;  2CT4 A;  1X27 A;  2PNI A;  1WLP B;  4AFU C;  1QLY A;  2ROT A;  1UE9 A;  1UHC A;  1QKW A;  1PRM C;  4CC3 A;  1AD5 A;  2JW4 A;  5GJW B;  4OMM A;  2A28 A;  1UHF A;  2YSQ A;  2DYB A;  2AZV A;  4HVU A;  1ZSG A;  4JPB W;  4JZ4 A;  1GBQ A;  2EVR A;  3JV3 A;  4OMO A;  5FW9 A;  2FEI A;  1H3H A;  1JQQ A;  1X6B A;  2EKH A;  2KYM A;  4LN2 A;  3I9Q A;  2EYW A;  4HVV A;  2YUP A;  2DNU A;  1E6H A;  4FSS A;  4HVW A;  2CH4 W;  2ESW A;  3VS1 A;  1PHT A;  1K0S A;  2D1X A;  1ABQ A;  2J6O A;  4OMQ A;  4F16 A;  2GQI A;  3IQL A;  1SRM A;  2EBP A;  3RNJ A;  3EG3 A;  3RBB B;  2CDT A;  2KRM A;  2HCK A;  2JM9 A;  1M30 A;  4CC2 A;  1UJY A;  1BU1 A;  3NMZ C;  1FYN A;  3I5R A;  1OV3 A;  2ECZ A;  1AWW A;  1IO6 A;  2KRS A;  1VYT A;  2DIL A;  2CRE A;  1QCF A;  1WA7 A;  2L2P A;  1VA7 A;  1QKX A;  2RN8 A;  4R0K A;  5I11 A;  2FG0 A;  1UG1 A;  4ESR A;  2JT4 A;  4J9F A;  1H8K A;  3VS0 A;  1AWO A;  1ABO A;  4RTW A;  2FPF A;  2RQU A;  2C0I A;  2GTJ A;  2LX7 A;  3UA7 A;  3SEM A;  2C0O A;  2EYX A;  2L0A A;  3THK A;  4RTU A;  2ENM A;  2RPN A;  2JS2 A;  4Z89 A;  2IIM A;  2DL4 A;  4JZ3 A;  1EFN A;  1TUC A;  2F2W A;  2H8H A;  1UUE A;  2L3P A;  2L3S A;  1I07 A;  2FRY A;  2RQV A;  2DVJ A;  3QWX X;  4M4Z A;  1OPK A;  2CSQ A;  3REB B;  2OAW A;  4AFS C;  1NEG A;  2VVK A;  1TG0 A;  2J6F A;  1K0X A;  3NPF A;  1UFF A;  2DBM A;  2KT8 A;  1G83 A;  2NUZ A;  1ARK A;  2JMA A;  4OMP A;  4RTT A;  4J9E A;  5HCK A;  1M3A A;  2EGC A;  2BTT A;  1WXB A;  2DL7 A;  4WCI A;  4LUE A;  1T0J A;  2DRK A;  2X3X D;  2DM1 A;  4RTY A;  2YDL A;  2KRO A;  2YUO A;  5L23 A;  3I35 A;  1LCK A;  1SSH A;  2HDA A;  2KEA A;  4D8D A;  2O88 A;  2LJ3 A;  1UTI A;  1ZUK A;  3VS4 A;  1HJD A;  2G6F X;  1RI9 A;  2V1Q A;  1NM7 A;  4LNP A;  1GCQ A;  1AWX A;  5IHN A;  4J9H A;  1I0C A;  1YCS B;  2RF0 A;  3H0H A;  1OEB A;  4JJC A;  4IIM A;  1AEY A;  3QWY A;  1V1C A;  2W0Z A;  3R6N A;  1JU5 C;  2SRC A;  1U5S A;  2GTO A;  1G2B A;  2M51 A;  2AKK A;  1QWF A;  1NYF A;  4AFQ C;  1Y57 A;  1RLP C;  2JM8 A;  5I22 A;  1NLP C;  1GCQ C;  1PKS A;  2J06 A;  5ECA A;  2CSI A;  2K3B A;  2NWM A;  1KJW A;  2JMC A;  1RUW A;  3TSZ A;  3EHQ A;  3GBQ A;  2OJ2 A;  1I1J A;  2B86 A;  1KSW A;  3EHR A;  5FWC A;  2KBT A;  1AZG B;  2MOX A;  4J9I A;  1NEB A;  1PWT A;  1Y0M A;  2DA9 A;  3C0C A;  1T3S A;  2K9G A;  1AWJ A;  1ZLM A;  2GBQ A;  2LJ0 A;  2EPD A;  2CH4 A;  1E6G A;  1H92 A;  4E6R A;  2D8H A;  2JXB A;  3REA B;  3H41 A;  1OOT A;  2EGA A;  4IIO A;  2X3W D;  1U3O A;  1SPK A;  2K2M A;  2J05 A;  1W1F A;  2F2X A;  2K7A A;  4ORZ A;  1X2Q A;  1K4U S;  4Z88 A;  2RMO A;  3NHN A;  4F17 A;  1AOJ A;  4J9D A;  2I0N A;  2YT6 A;  2LJ1 A;  3TSW A;  2KRN A;  2C0T A;  4GLM A;  2FPD A;  4DEY A;  1XOV A;  1M8M A;  1GRI A;  2E5K A;  2KXC A;  2RQT A;  3H0F A;  2VWF A;  1B07 A;  2LNH B;  1JEG A;  3FJ5 A;  1CKB A;  2AZS A;  1S1N A;  1SHG A;  2EGE A;  2YUQ A;  2W10 A;  1U06 A;  2KYB A;  2FRW A;  3VRZ A;  1K9A A;  1W70 A;  1BK2 A;  3EG2 A;  2O2O A;  1A0N B;  5IHK A;  3I5S A;  2FO0 A;  2A37 A;  1AVZ C;  3H0I A;  1T0H A;  3EGU A;  1M3B A;  2LCS A;  3UAT A;  1WXT A;  2HSP A;  1GFC A;  2BZY A;  1J3T A;  2KT1 A;  2JTE A;  2M0Y A;  2QDL A;  4ZNX A;  1FMK A;  4EIK A;  1N5Z A;  1WIE A;  1GL5 A;  1UJ0 A;  4RTZ A;  1UEC A;  2F2V A;  2FPE A;  2J6K A;  4OML A;  2ED0 A;  1HD3 A;  2XMF A;  2EYZ A;  2CT3 A;  3VRY A;  1JXM A;  3KFV A;  4AFZ C;  2OI3 A;  2D0N A;  1ZUY A;  2PTK A;  2HEQ A;  2VKN A;  3VS2 A;  2P4R A;  4F14 A;  1YP5 A;  2DBK A;  1YN8 A;  3M0Q A;  1M27 C;  4J9B A;  1NYG A;  1WFW A; 
#chains in the Genus database with same CATH topology
 1JJ2 S;  3CPW S;  3EGD B;  1M90 R;  1K9M C;  2I2L A;  1R0B G;  4M75 G;  1NLO C;  2DMO A;  2D6F A;  4OB3 B;  3EG1 A;  3TVT A;  1YHQ A;  2K6D A;  4X1V A;  4J9C A;  5EC7 A;  3OS2 A;  1K1Z A;  3I55 A;  3UPU A;  4PNO A;  2DET A;  4II1 A;  1O9S A;  1W6X A;  3GPL A;  3CCJ A;  3GLX A;  2ZZD A;  3CC7 Q;  4XTX A;  5CIU A;  2SEM A;  1KHI A;  2QQB A;  3CCM A;  1Z9Q A;  4RUG A;  2AK5 A;  3SHW A;  3UF4 A;  2GGR A;  4M7A C;  5A0D A;  1M3C A;  1PRL C;  2DL8 A;  4DA4 A;  2DL3 A;  5DM7 R;  2CUD A;  2ED1 A;  3MEA A;  1R8O B;  1WHM A;  2LQN A;  1VQ8 T;  3V8K A;  1PSF A;  3GNF B;  2M02 A;  2M0O A;  2YLB A;  3OBY A;  4PJO G;  3TU4 K;  1IRE B;  1JJ2 P;  3A8L B;  4DEX A;  1N9S A;  4C5G A;  1NPP A;  1OU8 A;  2EQJ A;  1SEM A;  1VYU A;  2E6N A;  2DIG A;  4FT2 A;  5IXB A;  4M77 D;  4RTV A;  1SSF A;  3TCJ A;  1ZBJ A;  4ATO A;  1KIK A;  3RER A;  1WI7 A;  2FHD A;  3VYH B;  1Q82 C;  1VQM Q;  2L3Q A;  1VQN T;  4X9C A;  2DX1 A;  4RTX A;  2V8I A;  1X6O A;  4PJN A;  2K3Y A;  3M0P A;  1WDX A;  6AT1 B;  3RDV A;  4A54 A;  2HL5 C;  4C92 E;  1OPL A;  1WNL A;  4J7F A;  2DRM A;  3E9G A;  4X34 A;  1ACM B;  1E7O A;  3A98 A;  1YWP A;  1M1G A;  3H9N A;  3U23 A;  2ROT A;  2RHU A;  1UHC A;  1B34 A;  1QKW A;  4FL6 A;  4CC3 A;  1AD5 A;  2EQM A;  2A28 A;  3MJX A;  4PJO B;  3G6E T;  1YIJ A;  5DLO A;  1H3Z A;  2DTI A;  3JV3 A;  1M2V B;  3MEV A;  3CCL Q;  4N0A A;  3CC7 A;  3QG1 A;  1X6B A;  2OTJ A;  2EKH A;  1AT1 B;  3NTK A;  5GAN 7;  1HXD A;  2EYW A;  4HVV A;  2ZAE A;  3T9N A;  2CH4 W;  1YI2 Q;  2G3R A;  3NTI A;  4M78 G;  3INZ A;  2CP5 A;  5I2M A;  1QVG S;  2EBP A;  4MDX A;  4MZM A;  4FYY B;  4MZP A;  3RES A;  2X51 A;  1YIT A;  4J5Y A;  3L2V A;  3UDC A;  2HQE A;  3I5R A;  1AWW A;  4E47 A;  2CRE A;  1WA7 A;  2L2P A;  2DZ9 A;  3MP8 A;  1W2B P;  3OS5 A;  2JT4 A;  3G71 Q;  5KE3 A;  3VS0 A;  1ABO A;  1NPR A;  4XTU A;  2GTJ A;  2LX7 A;  2R5A A;  3OW2 S;  3EFR A;  1HYO A;  3VJP A;  3SEM A;  2DZC A;  1VQ6 Q;  4PJM A;  1Q81 C;  1M4Z A;  2EYX A;  2RPN A;  2IIM A;  5GMK i;  4WF2 A;  1FMV A;  1Q7Y C;  3FC3 A;  1UUE A;  4OMF B;  2XD0 A;  1PG5 B;  3I56 T;  4M4Z A;  4XU0 A;  1M9S A;  3JCM e;  2XDB A;  1VQ6 A;  1PD0 A;  2LTO A;  3P8H A;  1K0X A;  3CCQ T;  2QQS A;  2LQK A;  5IT9 E;  2KT8 A;  4IUQ A;  4M7A A;  4JLI A;  4OMP A;  2JTM A;  2HAX A;  1Q82 U;  5J39 A;  1MMA A;  2ZCF B;  2LCL A;  1M3A A;  2EGC A;  2BTT A;  4FW1 A;  2DXT A;  4M77 B;  4EMH A;  3V7C A;  4WCI A;  5GAN g;  3CCQ Q;  1Q82 R;  1DJ7 B;  4YTL A;  4BI8 B;  1O75 A;  3OB9 A;  2NUP B;  5C6S A;  1LCK A;  3X28 B;  3I56 Q;  1PM3 A;  2O88 A;  1NJI C;  2LJ3 A;  4M75 E;  1UTI A;  1ZUK A;  2G6F X;  5CQY A;  1RAA B;  2DD4 A;  3JCM V;  3OYL A;  1WHL A;  4NL3 A;  3QII A;  4JDS A;  1YHQ T;  1YI2 A;  5IHN A;  2YRD A;  1W2B A;  1K8A C;  3H0H A;  3QDR B;  3CCE A;  2L89 A;  3OYA A;  4CRI A;  1V76 A;  1BI1 A;  1U5S A;  2M51 A;  2MF2 A;  1QWF A;  4R56 A;  3VV0 A;  1RLP C;  5KYX B;  1QCN A;  1PKS A;  1ZHI A;  1BYM A;  3OYH A;  4C8Q A;  3PIO A;  4WTO B;  1VQ8 A;  3I56 A;  4KGV B;  1I1J A;  3CMA Q;  2VXE A;  4AMC A;  1KSW A;  2YHT A;  4C8Q G;  5FWC A;  2MOX A;  2ZPG B;  5D6W A;  4J9I A;  2Y90 A;  5C0M A;  3FLG A;  2VV5 A;  3LGF A;  1VQ9 A;  3G71 T;  1B7T A;  2KMT A;  2ATC B;  4JRQ A;  3C95 A;  4PJO F;  4KBM B;  4M7A D;  1AWJ A;  2XK0 A;  4N0A C;  2LJ0 A;  4ZGE B;  4M78 D;  1E6G A;  5LJ3 f;  1TSF A;  4C8Q C;  4DBF A;  3CCR Q;  4FM4 B;  1BCO A;  2D8H A;  2JXB A;  3CCL T;  1OOT A;  1XQH A;  2QA4 A;  4IIO A;  3OYB A;  3OSV A;  3S3O A;  1VQP T;  2LNV A;  4ZN1 A;  5HK0 A;  2J05 A;  1W1F A;  2A3L A;  2VB6 A;  2EYQ A;  4UC4 A;  4MMK A;  1U1S A;  4Z88 A;  2B8A A;  3NHN A;  2QA4 Q;  4HCB A;  2CZ7 B;  2I0N A;  2YT6 A;  2CYZ B;  3TSW A;  3CCR A;  4GLM A;  3V7S A;  2CP3 A;  1XOV A;  1VQ5 T;  1GRI A;  1G3W A;  1Y7X A;  1PCX A;  2CP0 A;  2LNH B;  8AT1 B;  2BUD A;  2DEQ A;  1CKB A;  1S1N A;  2YUQ A;  1VQ9 Q;  2QTX A;  1K9A A;  2KDS A;  2OTJ T;  3CCM Q;  3JCM c;  5IHK A;  1M1F A;  3V8J A;  1Q81 U;  1RAC B;  1UGP B;  2EAY A;  3EGU A;  3RKY A;  1JJ2 A;  2E12 A;  4EPC A;  3UAT A;  2KY9 A;  2P4T A;  1MHN A;  2KT1 A;  2VGM A;  1N27 A;  1WJR A;  2QDL A;  1YJW A;  2YRV A;  4M77 A;  1UJ0 A;  4RTZ A;  3OY9 A;  3BDL A;  2J6K A;  2LQ8 A;  1VQ7 A;  1ZA1 B;  1HD3 A;  4OF1 A;  2EYZ A;  1K73 C;  1OX9 A;  3QYG B;  5GMK e;  3JRZ A;  2RD1 A;  1QP2 A;  2D0N A;  1Y07 A;  2PTK A;  2HEQ A;  1BIB A;  2VKN A;  3CCL A;  1TOV A;  4M77 C;  3M0Q A;  3OYN A;  2QXF A;  1AEY A;  2K5F A;  4HCK A;  1G83 A;  2RA2 A;  5CK9 A;  2DO3 A;  2BZ8 A;  3E1S A;  3ZL7 C;  1JO8 A;  4E7Z A;  1GFD A;  5GAO p;  3CBP A;  3JB9 D;  2O9V A;  4V2S A;  3LH0 A;  1QVP A;  4E7J A;  2DLP A;  1VQK Q;  3G1J A;  1XNI A;  4OMN A;  3M0T A;  3P8B B;  5IHI A;  1W2B S;  2ROL A;  2HNI A;  3CCM T;  2D0Q B;  2L3R A;  5IH2 A;  1VIE A;  5IAY A;  2PU9 B;  2P0Q A;  3M57 A;  1UGQ B;  3HPW A;  2XU8 A;  4F7U F;  2GQV A;  4XAX B;  3M0U A;  2CUB A;  3V7R A;  3OYC A;  2LMJ A;  4PFP A;  4KH0 B;  3JSC A;  2K4Y A;  4B9X A;  2FZC B;  2CP2 A;  1OZ3 A;  1Q95 G;  1WX6 A;  3MHX A;  4PK4 A;  2JUF A;  1I8F A;  1GCP A;  1F1B B;  3M0R A;  2RJC A;  1WYX A;  2VYT A;  5IXF A;  1RAI B;  2K5L A;  2LCC A;  5GAN 2;  1N8R U;  2QEX A;  4KRT A;  1BBZ A;  3BW1 A;  1MUZ A;  4M78 E;  1K73 U;  2HZY A;  3VS7 A;  4M7D B;  4QVD A;  1QWE A;  2F69 A;  2EJF A;  4KH1 B;  3OS1 A;  3EFS A;  5KE2 A;  2AIR B;  3EFO A;  1BIA A;  2KXD A;  2P84 A;  2DER A;  4RG2 A;  2KNB B;  4E7I A;  2DTH A;  2LP5 A;  2MCN A;  5GAM e;  2MIO A;  3PE0 A;  4Z8A A;  3CMA T;  4FU6 A;  4CC7 A;  4M75 D;  1UGS B;  1PNJ A;  4E7K A;  1K9M U;  5GAM j;  2LZ6 B;  5GJV B;  4HCC A;  3VS5 A;  2RQW A;  5FRM A;  1BB9 A;  5GAM h;  2BZX A;  1X6G A;  2DJQ A;  3JCM d;  3I55 Q;  4GBQ A;  3O5Z A;  4LUD A;  2MI6 A;  5CCA A;  3PFS A;  5I21 A;  3OYG A;  4AFU C;  2CS7 A;  3VU3 C;  4EMK B;  1RL2 A;  1JRI A;  1B34 B;  1EZZ B;  5GJW B;  2IG0 A;  3PMT A;  1KQ1 A;  1UHF A;  2YSQ A;  2AT1 B;  4DOW A;  2AZV A;  4JZ4 A;  3EGX A;  1RAH B;  5A2Q E;  3H8Z A;  4XTV A;  1VQL T;  2OTL T;  5FW9 A;  2EJ9 A;  4NS5 A;  1M2V A;  1JQQ A;  5LJ5 d;  5GAO q;  4DQ2 A;  2RH2 A;  2KYM A;  4LN2 A;  2ZPB B;  4XQ3 A;  5LJ3 j;  4LDX A;  1NZ9 A;  4HVW A;  2DEU A;  2YWW A;  2DD5 A;  5GMK l;  2D1X A;  4O6J A;  5GAN f;  3V8L A;  3HL8 A;  3P8D A;  1U8R A;  3RMS A;  2CDT A;  2HCK A;  2JM9 A;  1YJN Q;  2DKG A;  1G3S A;  1BU1 A;  3PNW C;  3PT9 A;  3RUX A;  1TUG B;  1TTH B;  1IO6 A;  2KRS A;  4M77 E;  3CD6 T;  1VYT A;  2DIL A;  1QCF A;  3F70 A;  3OA6 A;  2MWO A;  3DLM A;  3M59 A;  3EGX B;  5I11 A;  3QYH B;  1UG1 A;  4LDW A;  3FRN A;  4IUV A;  1RAG B;  4J9F A;  1N6A A;  2AHJ B;  5KYU A;  2QA4 T;  1AWO A;  1QP3 A;  2FPF A;  2DXC A;  5FRN A;  3UA7 A;  1YJN A;  1ZBX A;  2P0K A;  2E5Q A;  2L0A A;  2ENM A;  4Z89 A;  2CKK A;  5GAM d;  4OB0 B;  3OYI A;  1EFN A;  1TUC A;  2H8H A;  2RHY A;  1WJQ A;  1KC8 R;  1SF9 A;  3CCJ T;  3QWX X;  1X01 A;  3A8M B;  4ANJ A;  2EWN A;  4GY5 A;  4J8O A;  1TU0 B;  1WHK A;  1TG0 A;  2J6F A;  3NPF A;  1UFF A;  1VOM A;  2DBM A;  2X9H A;  4FSX A;  4Y91 A;  1ARK A;  2JMA A;  1LPL A;  4KUD K;  3CCU T;  1JB0 E;  4M7D A;  4C8Q D;  4IUR A;  2HSE B;  4FYX B;  3OW2 P;  5LJ5 h;  3C4S A;  3OYM A;  3L2Z A;  4JS4 A;  1N8R C;  1WHH A;  2YDL A;  1WZO A;  3WVE B;  3PGG A;  1YI2 T;  3JCM f;  2HMA A;  2LT4 A;  1IRX A;  3FEO A;  4D8D A;  4QW2 A;  1K8A U;  1D0Y A;  4M7D C;  4E7H A;  1NM7 A;  3G4S T;  3JCM X;  1Q81 R;  3CD6 Q;  1BI2 A;  2RF0 A;  1OEB A;  4JJC A;  4IIM A;  3JCM b;  3L2R A;  2VUB A;  4C92 C;  1H64 1;  1U1T A;  5DLQ E;  4M75 A;  1G2B A;  4M78 C;  1S72 A;  1KQS S;  4M77 G;  1D09 B;  2XHC A;  2BIV A;  3MP1 A;  2JM8 A;  1IXD A;  5I22 A;  3TRE A;  4VUB A;  4BAC A;  5GAN e;  2ZPI B;  3OYF A;  2CSI A;  1NBE B;  2Z0W A;  2JMC A;  1RUW A;  5GAN j;  3TSZ A;  3GBQ A;  2RJD A;  2JJ9 A;  2KK4 A;  3TQ7 P;  3EHR A;  2COW A;  4DBH A;  2HKQ B;  4B6M A;  3CCS A;  1NEB A;  2HKN A;  2CP6 A;  1PWT A;  3QUI A;  1ZSZ C;  4HKE A;  4F7U B;  3EG9 A;  1Q86 U;  3C0C A;  4F7U A;  3M9Q A;  1T3S A;  2K9G A;  2GBQ A;  2EPD A;  2RHI A;  3CME Q;  4BDZ A;  2QDY B;  4XU1 A;  2CZ0 B;  2EQK A;  4EMK A;  2E41 A;  3SB2 A;  1OU9 A;  3H41 A;  2EGA A;  3HRU A;  2X3W D;  4PJO A;  4XTW A;  4E7S A;  1V29 B;  4QQG A;  4RKU E;  1NJI U;  2F2X A;  1KQS P;  2L8D A;  1VQ8 Q;  3OBW A;  1VQK A;  3QXE B;  1D3B B;  1G5V A;  4IUU A;  2R58 A;  2XI9 A;  2PVO B;  4EMK C;  4F17 A;  2X4X A;  4M75 F;  1X75 C;  1QMC A;  1FWZ A;  2C0T A;  1TH7 A;  4Z02 A;  3ZFJ A;  4KGX B;  2KXC A;  2QAS A;  2O4X B;  1B07 A;  2VWF A;  1MGQ A;  4OB2 B;  1YJ9 Q;  2JTF A;  3A8H B;  2EGE A;  2W10 A;  1W70 A;  3EG2 A;  2O2O A;  4M77 F;  1KHC A;  3SDZ A;  1TWB A;  3H0I A;  4XU2 A;  4GLK A;  1M1K R;  2DTO A;  2LCS A;  2DPP B;  4M78 F;  1VQO Q;  2BZY A;  3QDF A;  4BDY A;  5KCO A;  5L8R E;  2JTE A;  4ZNX A;  1FMK A;  4EIK A;  1N5Z A;  1UEC A;  3M5A A;  2HD0 A;  3FJP A;  1VQL A;  2GCX A;  2OTL A;  1IGU A;  2QQA A;  2CT3 A;  2V8J A;  3VRY A;  4BY6 C;  7AT1 B;  5HKC A;  3KFV A;  4AFZ C;  4HT8 A;  4AT1 B;  2LRQ A;  3OW2 A;  2OI3 A;  1VQ4 Q;  3X25 B;  3MEU A;  2LX9 A;  1ZUY A;  1AHJ B;  3OMC A;  5CO7 A;  4KT0 E;  2FYK A;  1OI1 A;  4F14 A;  1ZQ1 A;  1YP5 A;  1KC8 U;  1JBM A;  2EIF A;  2DYI A;  1M27 C;  2COY A;  2V26 A;  4BE0 A;  4C0G A;  3VS3 A;  5FWB A;  8ATC B;  3M0S A;  4HXJ A;  4M7D E;  3CCS Q;  1MMD A;  4J9G A;  2GNC A;  4AG2 C;  4B9W A;  4DBQ A;  1UDL A;  1MV0 B;  1KQS A;  3GP8 A;  4Y92 A;  4A63 B;  4JRP A;  3JCM P;  2EQI A;  2KR3 A;  1VYV A;  4BB7 A;  3VYG A;  1NJI R;  1KFZ A;  1VQN Q;  2RNA A;  3HSB A;  3UA6 A;  2QTV A;  2AKL A;  3G71 A;  4QT7 A;  4K11 A;  2QQ9 A;  1QVF S;  2QG9 B;  2C06 A;  4CC4 B;  3PIP A;  4M75 C;  2J7I A;  1SRL A;  3GOX A;  2A08 A;  3CC7 T;  1K8A R;  2COZ A;  3CCV Q;  2D9T A;  1JXO A;  1B3Q A;  1WQ7 A;  4MDW A;  1UGV A;  1VQP A;  4JJB A;  5KYY B;  1YIT Q;  3DLL A;  2V1R A;  2YUN A;  2D8J A;  2DVE A;  1GBR A;  5D7U A;  3M54 A;  1AZE A;  1X2K A;  2CZ1 B;  4A53 A;  4D8K A;  5KYX A;  1ZSZ A;  3OS0 A;  3EH1 A;  2DK3 A;  5GAO m;  3PMI A;  2EFI A;  1X69 A;  4LE9 A;  1SG5 A;  2JNG A;  4AG1 C;  3A8G B;  4A4E A;  4JJD A;  2OTJ Q;  4LDY A;  3CCE Q;  2DJZ A;  2JN0 A;  1RAE B;  4PFO A;  3HHT B;  2O31 A;  3ULR B;  5D6Y A;  1YIJ Q;  3Q1J A;  2O9S A;  2DE0 X;  2M9U A;  1C1A A;  3ER0 A;  5GAM g;  1YNZ A;  1Q7Y R;  2NUT A;  1TUD A;  1K9M R;  1ZA2 B;  2DF6 A;  3CCR T;  1X27 A;  2PNI A;  3HP9 A;  5LJ5 f;  1PRM C;  2A0F B;  4M7D G;  4J7I A;  2R57 A;  5LJ5 e;  2E65 A;  2ZGW A;  3O8V A;  4OMM A;  1C0M A;  2KQW A;  2V8K A;  4QVZ A;  1YJW T;  5LJ5 j;  2VC8 A;  1VQ5 A;  4HVU A;  3M53 A;  4JPB W;  3X24 B;  4JLG A;  2Y4Y A;  1OQK A;  2KI7 A;  4HA8 A;  2EVR A;  2HL3 A;  1M1K C;  2FEI A;  2F5T X;  4Y28 E;  5IN1 A;  1QQJ A;  3MEW A;  1VQN A;  4BD3 A;  3I9Q A;  2ZPE B;  2BE9 B;  4IUP A;  2YUP A;  2X4J A;  2DNU A;  4FSS A;  4M7A B;  4BUG A;  4M75 B;  1M5Q 1;  1PHT A;  4ME7 A;  1QVF A;  3BFM A;  4OMQ A;  4F16 A;  1RAD B;  2VAS A;  1IGQ A;  3RNJ A;  4EDU A;  4J6X A;  2LDM A;  3EG3 A;  4ELY C;  3RBB B;  2RHZ A;  1M30 A;  2GFU A;  4ELZ C;  1UJY A;  3CCU Q;  3NMZ C;  4C92 B;  1FYN A;  1MND A;  1OV3 A;  1Q86 R;  1VQK T;  3S3N A;  3CC4 T;  4M78 B;  3CPW A;  1M8V A;  4C0D B;  1N8R R;  1NE8 A;  4N4I A;  3JCM W;  2MMP A;  2FG0 A;  2PQW A;  3DKM A;  4OB1 B;  4ZN3 A;  3CD6 A;  1H8K A;  3M4Y A;  4RTW A;  3JAM E;  3ASK A;  2C0I A;  4BI4 A;  5GAN h;  2L5Q A;  4X9D A;  2C0O A;  4XTY A;  4RTU A;  4F7U G;  2JS2 A;  4R55 A;  3HTR A;  3HFN A;  3JB9 H;  3JB9 I;  1I5O B;  1G3Y A;  1I07 A;  4M7A E;  2RQV A;  1N9R A;  4M7D F;  2CSQ A;  3REB B;  3QZ5 B;  4Q5W A;  2OAW A;  2QGG A;  5LJ3 e;  2QGF B;  1M90 U;  2XKO C;  3EH2 A;  3FDR A;  3LW5 E;  1TXQ A;  4QVC A;  3CXC S;  4IKF A;  3AT1 B;  4J9E A;  2MWP A;  4C92 F;  4JS5 A;  1WXB A;  2E10 A;  3M55 A;  2FZG B;  4LUE A;  3SWN C;  2DRK A;  2CGH A;  1OUL A;  2X3X D;  3LX7 A;  1LOJ A;  5KYW A;  2DM1 A;  1IHW A;  2XDD A;  4RTY A;  4TVR A;  1QVG A;  3CC2 Q;  3I35 A;  5GAO l;  5DY9 A;  3CCU A;  1SSH A;  4F7U E;  1WHG A;  3URG A;  2KEA A;  4J83 A;  3UT1 A;  3JCM Q;  3VS4 A;  2X35 A;  1HJD A;  4PL6 A;  1P92 A;  3CC2 T;  1RI9 A;  2V1Q A;  1QW1 A;  4LNP A;  2PUK B;  2KAF A;  3FIF A;  3OYE A;  1VQ6 T;  2F5K A;  4E7L A;  1I0C A;  2OAU A;  1YCS B;  4RCB A;  2EQU A;  2KSS A;  4MML A;  2JZ2 A;  3R6N A;  1JU5 C;  2ZPF B;  5A0G A;  3OQ5 A;  3CPW P;  1FXX A;  2AKK A;  1OX8 A;  4ZTF A;  3X26 B;  1NYF A;  4AFQ C;  3JCM J;  5HY6 A;  2VGN A;  1UGR B;  2J06 A;  1BI0 A;  2XID A;  5GAN 3;  2NWM A;  4MZT A;  1KJW A;  4C0F A;  3EHQ A;  3EGD A;  4PJJ A;  2EJG A;  1D0Z A;  3CC2 A;  2KBT A;  2QI2 A;  3NFC A;  4BI3 A;  1I4K 1;  4IUT A;  3A1P A;  4FYV B;  5GMK h;  3JB9 G;  3OYK A;  4N4G A;  5GMK j;  4JUV A;  3ME9 A;  5I2S A;  4QKU A;  2CH4 A;  1SKU B;  1H92 A;  2NUP A;  3RKX A;  3MO8 A;  2Y4X A;  1PD1 A;  5LJ3 g;  4NL2 A;  2VXF A;  3REA B;  2K3X A;  1TS9 A;  1U3O A;  5AT1 B;  3J80 E;  5EG2 A;  2K2M A;  1XTD A;  1YHQ Q;  2K7A A;  2X4Y A;  1X2Q A;  4C92 G;  2RMO A;  3QKJ A;  2E3H A;  2JOY A;  1KG1 A;  1R77 A;  2KRN A;  2MAM A;  2GFA A;  2PVD B;  1M90 C;  5FU7 C;  4DEY A;  3R6O A;  3G6E A;  2E5K A;  3H0F A;  3A8O B;  2AZS A;  1SHG A;  1U06 A;  2FRW A;  2KYB A;  3VRZ A;  1KD1 R;  2FZK B;  1A0N B;  3C94 A;  2OX7 A;  1Y96 B;  2FO0 A;  1AVZ C;  1T0H A;  4J6Y A;  4ZGJ B;  1PC0 A;  1M3B A;  2QEX Q;  3ZBD A;  4D6W A;  1EX4 A;  3LWH A;  4PFZ A;  2NLU A;  1HK9 A;  2F2V A;  1BCM A;  5KCH A;  3QO3 A;  3BE3 A;  2FPE A;  2ED0 A;  1YIT T;  1JXM A;  3JB9 F;  4L5G A;  1YIJ T;  3QHS A;  1C6V X;  4KGZ B;  4HT9 A;  3GF5 A;  3RKW A;  3LYI A;  4C0D C;  3VS2 A;  1Y71 A;  3GIB A;  2O4X A;  1OYX A;  2WSF E;  1D1B A;  2DBK A;  3L2W A;  1YN8 A;  3QJ6 A;  3LWI A;  3SWN A;  4J9B A;  4FYW B;  3SWN B;  5CKB A;  1CSK A;  3PVQ A;  1MMG A;  2RJE A;  3EG0 A;  5CKH A;  4C0Z A;  3CC4 Q;  1HSQ A;  1YBY A;  2A36 A;  1SHF A;  2OTL Q;  3CQT A;  3VS6 A;  1VQL Q;  1NG2 A;  3CMA A;  4JRK A;  4LD9 K;  4C5H A;  3RR6 A;  4A4F A;  1VQO A;  3EG9 B;  5KYN A;  2PUO B;  3JB9 J;  5J26 A;  3CCV T;  1Z9Z A;  1S72 T;  1IHV A;  2A7Y A;  2K2V A;  4JJN K;  5D6X A;  1WXU A;  3RMQ A;  3I55 T;  1RLQ C;  2K79 A;  2H3E B;  3LH5 A;  2ABL A;  2KVQ G;  4OP0 A;  3DB4 A;  4F04 B;  2DXU A;  1QCO A;  3QJY A;  4C8Q E;  1ZX6 A;  2PZ1 A;  2KGT A;  2E4H A;  1PSE A;  1WGS A;  1VQ7 Q;  5LL6 S;  2WSE E;  2EW3 A;  3CXC A;  4DBR A;  5KYU B;  1MV3 A;  5GAO r;  1YJW Q;  4N4H A;  2RQR A;  2EYY A;  2RM4 A;  3NGP A;  1KK7 A;  3OYJ A;  1CKA A;  1ZUU A;  1YWO A;  2LQW A;  3QSU A;  1ZSZ B;  2JS0 A;  3CCV A;  2E3I A;  3CCQ A;  3J7A F;  1W4S A;  4OGE A;  1EIF A;  4KUI A;  2YXY A;  3PTA A;  1T3L A;  4OVA A;  2M16 A;  5GAO n;  4C8Q B;  2MYS A;  3PVL A;  2DXB A;  5AYF A;  1X43 A;  5CKD A;  4BY6 B;  1FMW A;  2DAQ A;  2BE7 D;  1K76 A;  5J3B A;  1YJ9 T;  4RCC A;  5CVI A;  1YFN A;  2HBW A;  3N5B B;  3HRS A;  2DL5 A;  5LJ3 h;  2HQH A;  2KE9 A;  1G3T A;  4FT4 A;  3QZ9 B;  4NOY A;  1PKT A;  4EMG A;  4OGC A;  5A0L A;  4LXC A;  2XDP A;  2LC4 A;  2QEX T;  4P5N A;  2CT4 A;  3HFO A;  1BI3 A;  1QVG P;  1WLP B;  1VQO T;  1QLY A;  1UE9 A;  3EAE A;  1MNE A;  3KXT A;  1Q7Y U;  5HK3 A;  2HBP A;  2JW4 A;  3M58 A;  2QK0 A;  3OSS C;  2PVG B;  1KD1 U;  3AHU A;  5KH6 A;  3E19 A;  2DYB A;  2E1H A;  1ZSG A;  1GBQ A;  1KQ2 A;  1VQ9 T;  1I5L A;  2XIC A;  4OMO A;  1VQ5 Q;  1H3H A;  3M4G A;  1IZ6 A;  1D1C A;  3H6Z A;  3D7S B;  4LDU A;  3VKI A;  3M56 A;  1E6H A;  3CPF A;  3VS1 A;  2ESW A;  4XK8 E;  3ZEH A;  3WVD B;  2H3J A;  3QPH A;  1D0X A;  4BE2 A;  1K0S A;  4JRI A;  3L1A A;  4FCY A;  1ABQ A;  2J6O A;  2GQI A;  3IQL A;  3EFO B;  1SRM A;  5CR2 A;  3MET A;  5FU6 B;  4CC2 A;  2KRM A;  5FLX E;  2RI5 A;  1OZ2 A;  2ECZ A;  2RHX A;  4BE1 A;  2RI2 A;  3G4S Q;  1VA7 A;  2M1H A;  1QKX A;  2RN8 A;  4FIB A;  4R0K A;  3TEE A;  1YJ9 A;  3G4S A;  1UEB A;  4RG8 A;  1FX7 A;  3HKS A;  3WXM B;  5M9O A;  4ESR A;  1RI0 A;  1WQW A;  4M7A F;  2O01 E;  3KUF A;  5FRO A;  2RQU A;  4ZTJ A;  2QYZ A;  5GMK m;  2LT1 A;  1VQ4 T;  5CQX A;  5LJ3 d;  5GAN 5;  4LD6 A;  3THK A;  3SFM A;  2DL4 A;  4JZ3 A;  1QVF P;  1VQP Q;  2F2W A;  2L3P A;  3J81 E;  2L3S A;  2FRY A;  4J6W A;  2DVJ A;  2FVU A;  2F1L A;  5GAN 4;  1OPK A;  2WAC A;  1D3B A;  4PKC C;  2RI3 A;  4AFS C;  1NEG A;  2VVK A;  1WHJ A;  5KYY A;  1BKB A;  3X20 B;  2NUZ A;  2DIQ A;  1VQM A;  4RTT A;  2NYS A;  2X4W A;  3FB9 A;  4L59 A;  4C5I A;  5HCK A;  1YCY A;  5GAN 8;  1LJO A;  2DL7 A;  3L42 A;  4O5V A;  3OMG A;  1T0J A;  2QQR A;  4M7D D;  3JCM g;  2KRO A;  2YUO A;  5L23 A;  2CZ6 B;  3NTH A;  1Y96 A;  4XTZ A;  2HDA A;  2LVM A;  3UWN A;  5FU7 B;  2WSC E;  2R5M A;  2IVW A;  2MPX C;  1GCQ A;  1AWX A;  2E70 A;  4J9H A;  5GAN 6;  2ZPH B;  9ATC B;  2E6Z A;  4A4H A;  3VUB A;  3LGL A;  1YJN T;  4M7A G;  2K5I A;  2QAZ A;  3QWY A;  5GAM f;  1VQ4 A;  1V1C A;  4PJL A;  2W0Z A;  2SRC A;  2GTO A;  3KBG A;  1IB8 A;  1VIF A;  1Y57 A;  3CME T;  1M2O A;  1NLP C;  1GCQ C;  5ECA A;  3CCJ Q;  4RMO A;  2K3B A;  1LVK A;  2YLC A;  4PJO E;  4XU3 A;  2OJ2 A;  4C92 A;  2B86 A;  1Q86 C;  2K57 A;  1AZG B;  1VQM T;  3BDU A;  4M78 A;  3RIR A;  4PLI A;  2E64 A;  4QQ6 A;  2RK2 A;  1I81 A;  1Y0M A;  2DA9 A;  1ZLM A;  2NUT B;  3QBY A;  2IPO B;  3HRT A;  5KYW B;  4PJO D;  4E6R A;  3L2Q A;  4E2F B;  2EKO A;  4C5E A;  3OYY A;  4L6V 5;  3A5Z B;  4FW2 A;  4LDV A;  1MMN A;  1M1K U;  3JCM h;  1SPK A;  3CBO A;  4CI0 C;  3CEY A;  3G7Z A;  2FB7 A;  1D1A A;  4ORZ A;  4A4K A;  3L2U A;  1XJW B;  3CC4 A;  1K4U S;  1G8X A;  1K73 R;  2GF7 A;  1GXI E;  2XG8 D;  4KUL A;  4HCZ A;  3VUZ A;  4C92 D;  5CKE A;  1AOJ A;  4J9D A;  2LJ1 A;  2DFU A;  1UB4 A;  4PJO C;  2FPD A;  2CP7 A;  4PLL A;  4A4G A;  1WJS A;  3CME A;  1M8M A;  1VUB A;  1KD1 C;  4C8Q F;  2RQT A;  2RK1 A;  1JEG A;  3FJ5 A;  3E2U A;  3MPU B;  1KC8 C;  2RB6 A;  2RJF A;  1BK2 A;  3I5S A;  1LNX A;  3BY7 A;  2A37 A;  3GNG A;  3S6W A;  4ZGD B;  1VQ7 T;  2RO0 A;  4QQD A;  3CCS T;  3MKD A;  3MP6 A;  1WXT A;  2HSP A;  1GFC A;  4DOV A;  5CKF A;  5GAN d;  1J3T A;  1RAB B;  2HQX A;  2FL7 A;  2M0Y A;  1GL5 A;  1WIE A;  3CXC P;  5FU6 C;  4OML A;  1RAF B;  2XMF A;  3C12 A;  1S72 Q;  2BKD N;  2JVV A;  3LLR A;  5LJ5 g;  2MK5 A;  3SD4 A;  3CCE T;  2P0P A;  3G6E Q;  3S3M A;  3OYD A;  1R0C B;  2P4R A;  5CAI A;  2YRC A;  3CBM A;  3MCA B;  3E9F A;  3DB3 A;  1WPY A;  1NYG A;  1WFW A; 
#chains in the Genus database with same CATH homology
 3VS3 A;  5FWB A;  2BZ8 A;  1GFD A;  3M0S A;  1JO8 A;  3ZL7 C;  1CSK A;  3PVQ A;  4HXJ A;  3EG0 A;  2O9V A;  4J9G A;  1HSQ A;  1NLO C;  2DLP A;  2DMO A;  1UDL A;  2GNC A;  2A36 A;  1SHF A;  4AG2 C;  3CQT A;  3VS6 A;  1MV0 B;  3EG1 A;  4OMN A;  1NG2 A;  3M0T A;  3TVT A;  5IHI A;  4Y92 A;  2K6D A;  4X1V A;  2ROL A;  4A63 B;  4J9C A;  5EC7 A;  1K1Z A;  2EQI A;  2KR3 A;  1VYV A;  1W6X A;  1KFZ A;  2RNA A;  5IH2 A;  3UA6 A;  1Z9Z A;  2AKL A;  2SEM A;  1WXU A;  4QT7 A;  4K11 A;  1Z9Q A;  4RUG A;  2AK5 A;  1RLQ C;  3SHW A;  3UF4 A;  2K79 A;  3M0U A;  4CC4 B;  2GGR A;  3LH5 A;  2ABL A;  1M3C A;  1PRL C;  2CUB A;  2J7I A;  1SRL A;  2DL8 A;  2LMJ A;  1ZX6 A;  2DL3 A;  2A08 A;  2PZ1 A;  2CUD A;  2KGT A;  2ED1 A;  1JXO A;  1B3Q A;  2LQN A;  1WX6 A;  1UGV A;  2EW3 A;  4JJB A;  1GCP A;  3M0R A;  1MV3 A;  1WYX A;  5IXF A;  2V1R A;  2RQR A;  2YUN A;  2D8J A;  2EYY A;  4HCK A;  4KRT A;  1BBZ A;  3NGP A;  1GBR A;  1MUZ A;  4DEX A;  1CKA A;  1ZUU A;  1YWO A;  1AZE A;  1X2K A;  1SEM A;  3VS7 A;  4D8K A;  1VYU A;  1QWE A;  2LQW A;  2JS0 A;  5IXB A;  4RTV A;  1X69 A;  2KXD A;  4LE9 A;  4AG1 C;  1T3L A;  1ZBJ A;  2KNB B;  4JJD A;  3PVL A;  1X43 A;  1KIK A;  1WI7 A;  2LP5 A;  1K76 A;  2L3Q A;  2MCN A;  2O31 A;  3ULR B;  2MIO A;  2DX1 A;  3PE0 A;  4RTX A;  4Z8A A;  4CC7 A;  3M0P A;  1WDX A;  2HBW A;  1PNJ A;  2DL5 A;  2LZ6 B;  2O9S A;  2DE0 X;  2KE9 A;  5GJV B;  3VS5 A;  2RQW A;  1OPL A;  1BB9 A;  2DRM A;  2DJQ A;  1E7O A;  1X6G A;  2BZX A;  3A98 A;  4GBQ A;  1PKT A;  1YNZ A;  1YWP A;  3O5Z A;  4LUD A;  1TUD A;  2DF6 A;  3U23 A;  2CT4 A;  1X27 A;  2PNI A;  1WLP B;  4AFU C;  1QLY A;  2ROT A;  1UE9 A;  1UHC A;  1QKW A;  1PRM C;  4CC3 A;  1AD5 A;  2JW4 A;  5GJW B;  4OMM A;  2A28 A;  1UHF A;  2YSQ A;  2DYB A;  2AZV A;  4HVU A;  1ZSG A;  4JPB W;  4JZ4 A;  1GBQ A;  2EVR A;  3JV3 A;  4OMO A;  5FW9 A;  2FEI A;  1H3H A;  1JQQ A;  1X6B A;  2EKH A;  2KYM A;  4LN2 A;  3I9Q A;  2EYW A;  4HVV A;  2YUP A;  2DNU A;  1E6H A;  4FSS A;  4HVW A;  2CH4 W;  2ESW A;  3VS1 A;  1PHT A;  1K0S A;  2D1X A;  1ABQ A;  2J6O A;  4OMQ A;  4F16 A;  2GQI A;  3IQL A;  1SRM A;  2EBP A;  3RNJ A;  3EG3 A;  3RBB B;  2CDT A;  2KRM A;  2HCK A;  2JM9 A;  1M30 A;  4CC2 A;  1UJY A;  1BU1 A;  3NMZ C;  1FYN A;  3I5R A;  1OV3 A;  2ECZ A;  1AWW A;  1IO6 A;  2KRS A;  1VYT A;  2DIL A;  2CRE A;  1QCF A;  1WA7 A;  2L2P A;  1VA7 A;  1QKX A;  2RN8 A;  4R0K A;  5I11 A;  2FG0 A;  1UG1 A;  4ESR A;  2JT4 A;  4J9F A;  1H8K A;  3VS0 A;  1AWO A;  1ABO A;  4RTW A;  2FPF A;  2RQU A;  2C0I A;  2GTJ A;  2LX7 A;  3UA7 A;  3SEM A;  2C0O A;  2EYX A;  2L0A A;  3THK A;  4RTU A;  2ENM A;  2RPN A;  2JS2 A;  4Z89 A;  2IIM A;  2DL4 A;  4JZ3 A;  1EFN A;  1TUC A;  2F2W A;  2H8H A;  1UUE A;  2L3P A;  2L3S A;  1I07 A;  2FRY A;  2RQV A;  2DVJ A;  3QWX X;  4M4Z A;  1OPK A;  2CSQ A;  3REB B;  2OAW A;  4AFS C;  1NEG A;  2VVK A;  1TG0 A;  2J6F A;  1K0X A;  3NPF A;  1UFF A;  2DBM A;  2KT8 A;  1G83 A;  2NUZ A;  1ARK A;  2JMA A;  4OMP A;  4RTT A;  4J9E A;  5HCK A;  1M3A A;  2EGC A;  2BTT A;  1WXB A;  2DL7 A;  4WCI A;  4LUE A;  1T0J A;  2DRK A;  2X3X D;  2DM1 A;  4RTY A;  2YDL A;  2KRO A;  2YUO A;  5L23 A;  3I35 A;  1LCK A;  1SSH A;  2HDA A;  2KEA A;  4D8D A;  2O88 A;  2LJ3 A;  1UTI A;  1ZUK A;  3VS4 A;  1HJD A;  2G6F X;  1RI9 A;  2V1Q A;  1NM7 A;  4LNP A;  1GCQ A;  1AWX A;  5IHN A;  4J9H A;  1I0C A;  1YCS B;  2RF0 A;  3H0H A;  1OEB A;  4JJC A;  4IIM A;  1AEY A;  3QWY A;  1V1C A;  2W0Z A;  3R6N A;  1JU5 C;  2SRC A;  1U5S A;  2GTO A;  1G2B A;  2M51 A;  2AKK A;  1QWF A;  1NYF A;  4AFQ C;  1Y57 A;  1RLP C;  2JM8 A;  5I22 A;  1NLP C;  1GCQ C;  1PKS A;  2J06 A;  5ECA A;  2CSI A;  2K3B A;  2NWM A;  1KJW A;  2JMC A;  1RUW A;  3TSZ A;  3EHQ A;  3GBQ A;  2OJ2 A;  1I1J A;  2B86 A;  1KSW A;  3EHR A;  5FWC A;  2KBT A;  1AZG B;  2MOX A;  4J9I A;  1NEB A;  1PWT A;  1Y0M A;  2DA9 A;  3C0C A;  1T3S A;  2K9G A;  1AWJ A;  1ZLM A;  2GBQ A;  2LJ0 A;  2EPD A;  2CH4 A;  1E6G A;  1H92 A;  4E6R A;  2D8H A;  2JXB A;  3REA B;  3H41 A;  1OOT A;  2EGA A;  4IIO A;  2X3W D;  1U3O A;  1SPK A;  2K2M A;  2J05 A;  1W1F A;  2F2X A;  2K7A A;  4ORZ A;  1X2Q A;  1K4U S;  4Z88 A;  2RMO A;  3NHN A;  4F17 A;  1AOJ A;  4J9D A;  2I0N A;  2YT6 A;  2LJ1 A;  3TSW A;  2KRN A;  2C0T A;  4GLM A;  2FPD A;  4DEY A;  1XOV A;  1M8M A;  1GRI A;  2E5K A;  2KXC A;  2RQT A;  3H0F A;  2VWF A;  1B07 A;  2LNH B;  1JEG A;  3FJ5 A;  1CKB A;  2AZS A;  1S1N A;  1SHG A;  2EGE A;  2YUQ A;  2W10 A;  1U06 A;  2KYB A;  2FRW A;  3VRZ A;  1K9A A;  1W70 A;  1BK2 A;  3EG2 A;  2O2O A;  1A0N B;  5IHK A;  3I5S A;  2FO0 A;  2A37 A;  1AVZ C;  3H0I A;  1T0H A;  3EGU A;  1M3B A;  2LCS A;  3UAT A;  1WXT A;  2HSP A;  1GFC A;  2BZY A;  1J3T A;  2KT1 A;  2JTE A;  2M0Y A;  2QDL A;  4ZNX A;  1FMK A;  4EIK A;  1N5Z A;  1WIE A;  1GL5 A;  1UJ0 A;  4RTZ A;  1UEC A;  2F2V A;  2FPE A;  2J6K A;  4OML A;  2ED0 A;  1HD3 A;  2XMF A;  2EYZ A;  2CT3 A;  3VRY A;  1JXM A;  3KFV A;  4AFZ C;  2OI3 A;  2D0N A;  1ZUY A;  2PTK A;  2HEQ A;  2VKN A;  3VS2 A;  2P4R A;  4F14 A;  1YP5 A;  2DBK A;  1YN8 A;  3M0Q A;  1M27 C;  4J9B A;  1NYG A;  1WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...