2DM1A

Solution structure of the second sh3 domain of human protein vav-2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
b'GSSGSSGGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein vav-2
publication title Solution structure of the second SH3 domain of human protein vav-2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dm1A00
2PTKA 4J9BA 1WXUA 2CSIA 4LN2A 1ARKA 4HVUA 4CC4B 5L23A 2NUZA 2YUNA 1YWOA 2KR3A 5GJWB 1H92A 4FSSA 4D8DA 2RQUA 1KSWA 3UATA 1HJDA 1BK2A 1BU1A 1YP5A 1ZSGA 2MIOA 3IQLA 2A28A 2DJQA 2CH4W 3VS5A 1UFFA 1UECA 4J9GA 3U23A 3EG3A 4RTYA 4JZ3A 4RTTA 5FWBA 4CC2A 2KBTA 4GBQA 2CT4A 2W10A 1GL5A 3PVLA 1TUDA 2PZ1A 1WIEA 1JXOA 1T3LA 1U5SA 1Y0MA 1UJYA 1W6XA 1X27A 1GRIA 1MUZA 2LQNA 3M0TA 2O2OA 2EW3A 2A36A 2AZVA 1X2KA 2FG0A 2DA9A 2BZXA 2X3XD 4QT7A 2O31A 3EHQA 1QKXA 1XOVA 3SHWA 2LQWA 1PWTA 5IH2A 1YNZA 2BZYA 1AWJA 1UTIA 2DILA 1M30A 3ZL7C 2EVRA 1I07A 2F2VA 1FMKA 2D8HA 2GNCA 1E7OA 2OJ2A 2D8JA 1UE9A 4Y92A 4OMMA 2L3QA 4EIKA 2DL7A 1B07A 1GCQC 3NGPA 2KXCA 4KRTA 1MV0B 1WI7A 2VKNA 1PKTA 2J06A 1OPKA 3TSWA 1CKAA 1X43A 1QKWA 4LNPA 2DRKA 2RPNA 4F14A 5ECAA 1B3QA 1RUWA 4J9EA 2GQIA 1W1FA 2L2PA 2KT1A 1GCQA 2SEMA 2FPFA 1GFDA 2HBWA 1NG2A 1RLPC 2J05A 4Z8AA 1K1ZA 3H0HA 4HVVA 3TSZA 1AEYA 1Y57A 4HCKA 2JS0A 5IHIA 1K0XA 2KT8A 1PRMC 4RUGA 1ABOA 2LMJA 1OV3A 1YN8A 2GGRA 1E6HA 4ESRA 4J9DA 4AG2C 2EGCA 1FYNA 1M3AA 2K9GA 4DEXA 4IIMA 2YUOA 4Z88A 1U06A 1NEGA 1K76A 1M27C 2B86A 2C0TA 3M0UA 4IIOA 2KEAA 1UUEA 3A98A 2YSQA 1I1JA 5I11A 3I5SA 2ROLA 3VS3A 1ABQA 2FPEA 1GBRA 2L0AA 2W0ZA 2JW4A 2P4RA 3TVTA 2HEQA 2K2MA 1AOJA 3I9QA 2A08A 2K6DA 2HDAA 4A63B 4AG1C 1NEBA 1CKBA 1WX6A 2EKHA 1PNJA 1VYVA 1K9AA 1X6GA 5IHNA 2FRYA 2J7IA 3H0IA 1WDXA 2H8HA 2M51A 2EBPA 3I35A 5IHKA 4LUDA 2DVJA 1QLYA 3EHRA 1HSQA 4DEYA 5IXFA 2QDLA 2AK5A 2FO0A 2JT4A 2O88A 4RTXA 2LNHB 4AFQC 1N5ZA 2YUQA 4JJCA 4D8KA 3O5ZA 4GLMA 4AFSC 3PE0A 4CC3A 3CQTA 1NM7A 1AZGB 3GBQA 4HVWA 3VRZA 2J6KA 1M3CA 2DBMA 2EGEA 2J6OA 2KNBB 2X3WD 2JMAA 4RTUA 2LP5A 1U3OA 2EYWA 4X1VA 1BBZA 1JEGA 2IIMA 2GTOA 1KFZA 2DL3A 2DLPA 2DL5A 2DMOA 1UDLA 2L3PA 3NPFA 2MCNA 1G2BA 3M0RA 1ZLMA 2FRWA 4LE9A 4RTVA 1WXBA 1VYTA 5FWCA 1H3HA 2EYYA 2JM8A 3VS0A 2JS2A 2LJ0A 1SEMA 1RI9A 1YCSB 1K4US 1OPLA 3NMZC 1ZUYA 1E6GA 3EG1A 2DX1A 3UA6A 1X69A 2AKLA 4J9CA 2FPDA 2RN8A 2GTJA 1SRMA 4K11A 2V1RA 2M0YA 2HCKA 2DBKA 3UA7A 2DE0X 2GBQA 1T0JA 3C0CA 2EYZA 5EC7A 1UHFA 2F2XA 1WLPB 1X2QA 1M3BA 1PKSA 2KYBA 1SPKA 1GFCA 3RBBB 4OMPA 1UHCA 3R6NA 3ULRB 1ZUUA 3LH5A 1NLPC 4J9FA 2JXBA 2KE9A 1AWXA 2AKKA 4JZ4A 2EPDA 1H8KA 3JV3A 4CC7A 4WCIA 2O9VA 3VS7A 1X6BA 4ZNXA 4R0KA 1S1NA 1VYUA 2DM1A 1M8MA 1OEBA 2DYBA 2D1XA 2MOXA 2LX7A 1JXMA 5GJVB 1G83A 2ENMA 2CT3A 1CSKA 1OOTA 3RNJA 2EQIA 2FEIA 2KGTA 3SEMA 1TG0A 2D0NA 3VS1A 4M4ZA 1A0NB 1SRLA 3VRYA 2BTTA 1JO8A 1JU5C 2VWFA 4F17A 1PRLC 2ED1A 2A37A 2DNUA 2XMFA 4JJBA 3VS6A 4OMQA 2JMCA 4Z89A 2DF6A 4OMLA 4F16A 5FW9A 4OMOA 3PVQA 2KXDA 1QWEA 2RQWA 1NYGA 2CDTA 2I0NA 1WA7A 3REAB 2HSPA 2RNAA 3EGUA 1T0HA 3FJ5A 3I5RA 1PHTA 2ABLA 2PNIA 2KRMA 2LCSA 1SHFA 1WXTA 2AZSA 2EYXA 2E5KA 2LJ1A 4ORZA 3VS2A 1V1CA 2SRCA 2C0IA 3EG2A 3VS4A 2NWMA 1AD5A 2ECZA 1AVZC 2CSQA 3H41A 3M0QA 4OMNA 3M0PA 1NLOC 2ROTA 1YWPA 2ESWA 2C0OA 3REBB 3NHNA 2RQRA 1UG1A 2DL4A 2KROA 2JTEA 2VVKA 4J9IA 2EGAA 1AWOA 2RF0A 1UJ0A 4HXJA 2J6FA 1QWFA 1KIKA 2L3SA 1ZX6A 3H0FA 5HCKA 1LCKA 1WYXA 3UF4A 2CUBA 1RLQC 1GCPA 1AZEA 2G6FX 4AFUC 1ZBJA 1UGVA 1GBQA 4JJDA 1Z9QA 4AFZC 2YT6A 1HD3A 2BZ8A 2CUDA 1Z9ZA 1QCFA 1AWWA 3M0SA 2OAWA 1VA7A 3KFVA 1KJWA 1K0SA 2K7AA 2LJ3A 1EFNA 1J3TA 4JPBW 4LUEA 2RQVA 5IXBA 2K3BA 1T3SA 2DL8A 2RQTA 4E6RA 2CH4A 2LZ6B 1TUCA 3QWYA 1SHGA 2K79A 1I0CA 3QWXX 4RTZA 5I22A 2ED0A 1SSHA 2KRNA 2KRSA 3EG0A 1JQQA 2O9SA 2JM9A 4J9HA 4RTWA 3THKA 1ZUKA 2RMOA 1BB9A 2DRMA 1NYFA 1MV3A 2F2WA 2OI3A 2V1QA 2KYMA 2YUPA 2YDLA 2CREA 1IO6A 1WFWA 1W70A
chains in the Genus database with same CATH superfamily
4OP0A 1WXUA 3MEUA 3OYNA 1S72T 1D1BA 2KR3A 3QG1A 1OX8A 3P8HA 2JN0A 3G6EA 1HJDA 2R5MA 2P0PA 5FRMA 1ZSGA 3MHXA 3IQLA 2DJQA 3VS5A 3CCMQ 2F69A 3EFOB 2FB7A 1BKBA 3CCQA 2EQJA 5D6WA 3EG3A 3M5AA 4RTYA 2PUOB 2CZ6B 4M7DF 4FYWB 4IUUA 3PVLA 1WIEA 1W2BA 1YHQQ 2CP5A 1Y0MA 1W6XA 1GRIA 3CEYA 3MPUB 5A0DA 1QMCA 1RAEB 1WJSA 1MNDA 1VQ5Q 4JRKA 2A36A 1W4SA 3I55A 3PMIA 3SHWA 2LQWA 5IH2A 2EAYA 2BE9B 2BZYA 1UTIA 2DXCA 5GAN5 1Q7YC 2OTJT 1Q81C 2GNCA 4V2SA 2HL3A 3META 1M4ZA 2DL7A 3OYJA 2KXCA 4KRTA 1WI7A 2K5LA 3TU4K 4LNPA 2DRKA 3JCMP 2PUKB 1Q86C 1RUWA 3ZBDA 2HMAA 5CQXA 3OYHA 5KYWA 2SEMA 3CCUA 4M7AA 3QDRB 4QQ6A 3CCSQ 1NG2A 3OYGA 3MKDA 1KQSS 2ZPEB 1U1TA 4J6XA 4HVVA 1D1AA 3S3OA 3FEOA 3OW2P 1N9SA 4BE1A 1Y57A 1VQMA 3GPLA 1ABOA 4Q5WA 3EGDB 5GAMd 1OV3A 1YN8A 1E6HA 4ESRA 4C92F 4AG2C 2DXTA 3JB9H 4OF1A 2EGCA 4C8QA 4LDUA 1VQ8T 2CP6A 2K9GA 2XD0A 1VQKT 3CD6A 2GFUA 2QG9B 3L2UA 3ME9A 1R0BG 1EX4A 3EGDA 4FIBA 1K76A 3CC7Q 1IGQA 3M0UA 3A98A 5I11A 1VQOA 3I5SA 2E1HA 1Q7YU 2RHXA 1Q81U 3VS3A 2FPEA 5I2MA 2DZ9A 5LJ5f 8ATCB 3MP8A 2OTJA 3TVTA 2HEQA 1GXIE 4XTXA 3CMAT 4A63B 1BIAA 1NEBA 2VC8A 1CKBA 1Q86U 1WX6A 3HFNA 3JCMg 3M58A 5IHNA 1QCOA 1M9SA 3S6WA 4HA8A 5IHKA 2DVJA 1LJOA 1HSQA 3OYCA 5AT1B 1WGSA 3CC2T 4IUQA 2JT4A 1M2VB 2DEQA 2O88A 5LJ5h 1N8RC 1FXXA 2ZPFB 4RTXA 5GAMe 1IREB 4WF2A 5A0LA 5I2SA 4AFQC 4BDZA 4JJCA 4GLMA 4C0GA 4CC3A 1NM7A 1AZGB 3VRZA 4XU3A 4B6MA 1M3CA 1BYMA 2J6OA 2KNBB 1KD1C 2JMAA 4BI4A 2LP5A 1U3OA 1M2VA 2IIMA 3OYAA 1VQNA 3S3NA 4LDWA 2DL3A 4E7JA 1D3BA 2O01E 1VQ8A 1G2BA 1VQKA 1RL2A 4RTVA 1WZOA 4M77F 1WXBA 4BUGA 4M77D 2Y4YA 2RHYA 1RI9A 4XTVA 2LTOA 5GMKe 1K9MC 1OPLA 2FVUA 2DX1A 5GAN4 4M7DB 2AKLA 2FPDA 1H3ZA 4KT0E 2RN8A 4D6WA 2GTJA 3TREA 1VIFA 3BDLA 3A8OB 2DE0X 2GBQA 4QVDA 4M75C 5EC7A 1YIJA 2F2XA 1WLPB 3OQ5A 3CMAA 1WHLA 4M7DA 4BY6B 1V76A 1VQ7Q 3RBBB 1VQPQ 3M57A 1UHCA 4PL6A 1ZUUA 5HKCA 1NLPC 1X01A 1UEBA 1EZZB 4M7AG 3OMCA 4LD9K 1NPRA 4JZ4A 1YJWT 3JV3A 4PJOF 3NTIA 4ZNXA 1RI0A 2DM1A 1OEBA 5GANd 3QHSA 2GFAA 3OYBA 5J3BA 5GJVB 1N8RU 4HCCA 1G83A 3CBMA 3CC2A 4A4KA 2AIRB 1OOTA 2B8AA 4JLGA 1YITQ 4N0AC 2CS7A 3A8LB 2QQRA 3SEMA 1PM3A 1I81A 2M1HA 1KD1U 3O8VA 2BTTA 1JU5C 2KMTA 1OULA 3OYYA 5IN1A 2WSEE 4E7ZA 1W2BP 4C8QG 1M2OA 3PGGA 2V8IA 3CMEQ 2ED1A 2X51A 2KI7A 1M1KC 2RHUA 4JJBA 1JRIA 3L42A 4X34A 1XNIA 2DF6A 4F16A 4FW1A 3PVQA 4RKUE 3RKXA 1QWEA 2RQWA 4Y91A 2CDTA 3HFOA 3F70A 3PT9A 4PJLA 2ABLA 1WJQA 3TCJA 1PD1A 1SHFA 4EDUA 2E5KA 2Y4XA 2GF7A 2FZCB 1ZA2B 3INZA 2DEUA 5I21A 1AVZC 2E4HA 1LNXA 2EJFA 1BCMA 1MNEA 3J7AF 1NLOC 4A4FA 1SSFA 2ROTA 4C92A 1YWPA 3TEEA 1YBYA 5KYUB 2DZCA 3HKSA 5GAN3 1UG1A 3JCMQ 3V7CA 4J8OA 5GANe 3CPWA 2JTEA 2E70A 3EH1A 3MEWA 4ELZC 1YJWA 1XQHA 4L6V5 2J6FA 1QWFA 3QIIA 5KYUA 3X24B 2E65A 1UGPB 4BI8B 4E7LA 1LCKA 2OTLT 1WYXA 3GF5A 1YJ9Q 4AFUC 1LPLA 1UGVA 5CKEA 5KE2A 4AFZC 3EGXB 2R57A 4JLIA 4MDWA 3RDVA 1M1KU 3JB9G 1AWWA 3M0SA 5KYXA 3EFSA 1SF9A 1J3TA 4JPBW 2RQVA 5M9OA 2K3BA 2DL8A 5GAMf 3G71Q 3EGXA 4E6RA 1LVKA 1YJNQ 4TVRA 1NBEB 3QWYA 2LX9A 2JM9A 5GAOq 3THKA 3CCEA 1BB9A 1I4K1 2DRMA 1NYFA 1MV3A 2OI3A 2V1QA 2KYMA 1N9RA 1U1SA 2CP7A 4M7AD 4M77B 1IO6A 1W70A 2YRCA 2PTKA 4J9BA 3RMQA 1LOJA 4PLLA 1C0MA 4LN2A 4M7DG 1MHNA 4HVUA 4CC4B 1IXDA 1TSFA 2NUZA 1VUBA 2YUNA 3SB2A 1H92A 4FSSA 4ATOA 3UATA 1BK2A 4JJNK 1YP5A 2MIOA 4QVZA 4E2FB 2L8DA 4PFOA 2A28A 3CC4Q 2QGGA 5GAMh 4M77A 5GAOm 2F5KA 2RK2A 4J9GA 3FB9A 1VQLA 4KGXB 2W10A 1GL5A 2MYSA 3CPFA 3ZFJA 4E7KA 4C8QD 2PQWA 2PVDB 6AT1B 5KYNA 1MUZA 2DK3A 4NL2A 5D6YA 3CXCA 2OTLA 1WNLA 1Y96A 2DA9A 2X3XD 4P5NA 3OYLA 1QVFA 4PJOB 2P4TA 2QA4T 2NYSA 5GMKh 2D6FA 1PWTA 1YNZA 2K57A 3CCLT 1M5Q1 3FIFA 1AT1B 2F2VA 1DJ7B 2D8HA 3CCQT 2JNGA 1UE9A 4FYXB 2JVVA 1VQ9Q 4OMMA 2L3QA 2E64A 1ZSZC 1B07A 3NGPA 4HCBA 4PJOA 4M78F 1OPKA 4XU2A 1ACMB 2DFUA 4M78D 2RPNA 4F14A 3QUIA 1B3QA 1RADB 1RABB 3BFMA 4XU0A 2M02A 5LJ3f 2GQIA 2L2PA 3I55T 1YI2Q 2FPFA 5LJ5g 1GFDA 2XICA 2X9HA 3KXTA 1RACB 1K1ZA 4DQ2A 1VQ4T 4XQ3A 2RI3A 3C12A 3SWNA 1AEYA 1BI3A 2JS0A 4O6JA 2H3EB 3E2UA 2KT8A 1Y71A 3FRNA 1PRMC 1N6AA 3QXEB 1NJIR 3QZ9B 4RUGA 2JZ2A 2LMJA 2V26A 4FM4B 1N27A 3E9GA 1TU0B 4DBFA 1M3AA 1JB0E 4EMKC 3G6EQ 2YUOA 1NEGA 1M27C 4BD3A 3SD4A 2COWA 1VIEA 1OU8A 2HD0A 1UUEA 1BI1A 2YSQA 1D0ZA 1VQMT 1NZ9A 2JOYA 4C0FA 2QA4A 2L0AA 3CCLA 5GAN7 1I5OB 2G3RA 2P4RA 5DLQE 3GP8A 2K2MA 4B9XA 2K6DA 3OYIA 2LT4A 3CD6T 1KQSA 4M7DD 1FWZA 1K9AA 1X6GA 2J7IA 3DLLA 1ZBXA 4M7AE 2O4XB 2EBPA 3LLRA 4HT9A 3M53A 4LUDA 3EHRA 1QLYA 5GANh 4B9WA 1VQOT 1QVGS 5IXFA 2YWWA 3BY7A 2FO0A 4C5HA 2VXFA 3CCMA 3LH0A 1VQ4A 2XHCA 3OS1A 2LNHB 2O4XA 3CPWP 2AT1B 4M77G 4Y28E 3O5ZA 4AFSC 5KYWB 3DB4A 4HVWA 4M7AB 2DBMA 2RI2A 3OMGA 2FZKB 2X3WD 3CCUQ 4C8QE 4X1VA 3X28B 2GTOA 2DLPA 2DL5A 2DMOA 1UDLA 2RA2A 3M0RA 1ZLMA 4LE9A 2FRWA 2K5FA 4BACA 1MMAA 1OU9A 3CBPA 1S72Q 2JM8A 3H9NA 3VS0A 3CCJT 1NE8A 1SEMA 3OYFA 1YCSB 1K4US 4A4HA 3NMZC 1OZ3A 3A8HB 1X69A 4YTLA 3FJPA 4C8QB 3QO3A 4J5YA 4K11A 1SRMA 2V1RA 3RKWA 2HCKA 3LWHA 3BW1A 2DAQA 4FYYB 2LRQA 4PJOG 4M78E 1PD0A 2ZZDA 1VQNT 1M3BA 1WJRA 2E6ZA 4JRPA 1PKSA 2KYBA 3VYGA 2DYIA 4C92D 2XG8D 3HSBA 2I2LA 1TH7A 4R55A 5KYYA 4ZGDB 2AKKA 3I56T 3X20B 4J83A 1NJIC 2E6NA 3VS7A 2OTJQ 2XDPA 5FU7C 3RUXA 1M8MA 3X26B 2MOXA 4M78B 2QDYB 5GAOl 1CSKA 3X25B 3RNJA 1R77A 2EQIA 4CRIA 3UT1A 4M4ZA 1YIJT 3QKJA 2RO0A 4XTZA 1KG1A 2ZGWA 2E3HA 4M78A 4QQGA 3J80E 1K73R 1WQ7A 4N0AA 4F7UF 2A37A 2XMFA 2CYZB 2KK4A 4BB7A 3CC7A 3CXCP 3M4GA 3PTAA 3ER0A 1QVFP 2KXDA 3CCJA 2QAZA 3QYGB 5HK0A 1FMVA 2P0KA 4J6YA 3V7RA 2RNAA 3EGUA 1PHTA 2PNIA 2MWOA 2HQHA 2E10A 2LCSA 1FMWA 3QZ5B 2AZSA 1D3BB 2XIDA 1V1CA 3V7SA 1VQ7T 3VS4A 1RAGB 1VQ8Q 1VQKQ 2VB6A 4M7DE 4FSXA 4A4GA 4OMNA 4IUVA 5GAMg 3G4ST 3ZEHA 3JSCA 5GAMj 2ESWA 5GMKm 2RD1A 1D09B 3NHNA 2RQRA 2DXUA 2R5AA 2HL5C 1D0YA 3S3MA 1NJIU 3JAME 3I56A 3KBGA 1TTHB 4JDSA 1AWOA 4FYVB 1Y7XA 2GCXA 2QYZA 2V8KA 3H0FA 5HCKA 4A54A 3LW5E 1KHCA 3CMAQ 5C0MA 3QPHA 1RLQC 2G6FX 1ZBJA 2FHDA 4KUDK 2ZPIB 1GBQA 4QKUA 3ASKA 4PFZA 1G8XA 2EWNA 3RESA 2LDMA 1Z9ZA 1QCFA 2FZGB 3H6ZA 5CCAA 1K0SA 4A53A 4C8QC 5GAOr 2JTFA 2OAUA 3OBWA 4CI0C 1I8FA 3CC2Q 1VQ6T 3OYMA 4LUEA 2DD4A 1T3SA 2COZA 3WVEB 2JTMA 2LZ6B 4ZN3A 4PJOD 3JRZA 3JCMX 2VYTA 3QWXX 4RTZA 2M16A 5I22A 1F1BB 3A8GB 2D0QB 1JQQA 2O9SA 4RTWA 2R58A 2DVEA 1ZUKA 3Q1JA 3R6OA 2MF2A 5CK9A 2E41A 4FCYA 2F2WA 4PJNA 3OBYA 3VRYA 3L2RA 1MMGA 1VQ7A 2LC4A 5D6XA 4C92E 1ARKA 1KQSP 2L5QA 3JCMb 3G4SA 3CCVT 4OB1B 5CVIA 2CH4W 2QASA 3U23A 5LJ3g 4NOYA 4IUPA 5LJ3j 5FWBA 3HHTB 4PJJA 2KBTA 1PC0A 2CT4A 2EQUA 1YITA 1X6OA 4PLIA 3CCET 1TUDA 2PZ1A 1JXOA 3JCMV 1T3LA 4C92B 1U5SA 4PNOA 3G1JA 3L2QA 1UJYA 3HPWA 2JJ9A 2LQNA 3M0TA 1KC8R 2O2OA 2EW3A 5HK3A 1X2KA 4QT7A 3E1SA 4M78G 2QTXA 1M1FA 2O31A 2X4XA 3L2WA 1QKXA 3GIBA 1HXDA 2WACA 1YJWQ 1AWJA 2DILA 1M30A 1QVPA 3OS5A 3ZL7C 2ZPGB 1I07A 1Q82R 1E7OA 3M55A 4RG8A 4FW2A 2F1LA 1VQLT 2ATCB 4EIKA 3VV0A 2VUBA 1GCQC 1VQ6A 3C95A 4OB2B 1MV0B 1PKTA 1G3SA 2IVWA 1X43A 1QKWA 5CR2A 1C1AA 5ECAA 5GANg 1JJ2S 5KYXB 4XTWA 4F7UB 2M9UA 5J39A 2KT1A 1MGQA 2BUDA 5FU6B 3A8MB 4DOWA 2PU9B 2HBWA 2HKQB 2E3IA 4PK4A 4ANJA 4BE2A 5DM7R 4XAXB 2COYA 4M7DC 4F7UA 1K0XA 4KUIA 2KDSA 4M77E 1OQKA 2QEXT 5KE3A 5CAIA 3CCVA 2BE7D 3T9NA 3PMTA 2GGRA 1IB8A 4J9DA 3VU3C 4OGCA 4LDVA 2XDBA 2LCLA 4BY6C 4C0ZA 3HL8A 4IIMA 4Z88A 2B86A 2C0TA 2KEAA 4E47A 2XU8A 5IT9E 2DPPB 1I1JA 2EIFA 3N5BB 5GAN2 2QQBA 2E5QA 2QTVA 2ROLA 5GAN8 3M4YA 5C6SA 4XTUA 1HYOA 2DJZA 3QJYA 1PCXA 4PJOE 1Y96B 1AOJA 2QK0A 3PFSA 2A08A 2YRVA 2L3RA 3UWNA 4PJMA 2OTLQ 2NUTB 2EKHA 1SKUB 1VYVA 4M75F 3H0IA 2H8HA 2D9TA 4M75D 1QP2A 3I35A 5KCOA 1QCNA 5GMKl 2CZ7B 2RHZA 4DEYA 2QDLA 3OW2S 4MZTA 2NUTA 3JB9J 1M90R 4JUVA 1Q7YR 3WVDB 5CKDA 5AYFA 3PE0A 2KAFA 1KC8C 3CQTA 3GBQA 2QEXA 1ZHIA 2EGEA 3PIOA 3CCRT 4RTUA 4DBQA 1BBZA 4GLKA 1JEGA 5FROA 2NUPA 1OZ2A 4VUBA 3OSVA 3SWNB 2L3PA 4OMFB 3NPFA 5CKBA 1Q82C 5FWCA 2EYYA 1TWBA 2DTIA 5LJ5j 2XKOC 1WHKA 2VGNA 1ZUYA 1E6GA 2XK0A 3CCMT 4C92G 4LXCA 3H8ZA 3UA6A 5CKFA 2LCCA 2RK1A 4J9CA 2ZCFB 2HAXA 2M0YA 2DBKA 2K5IA 2RH2A 1YHQT 2H3JA 2EYZA 3UPUA 3C4SA 1UHFA 4ZN1A 2RJCA 1VQ5T 1QVGA 1GFCA 3QYHB 3R6NA 3ULRB 2FL7A 2LVMA 4J9FA 2JXBA 2KE9A 1OX9A 1AWXA 3M56A 2QA4Q 1C6VX 1H8KA 3CCLQ 1WHHA 2O9VA 4ZGEB 3JCMW 5GANf 3EG9A 2DYBA 3CCQQ 1JXMA 3JB9F 2ENMA 4O5VA 4F7UG 2ZPHB 2FEIA 1IHWA 1KC8U 1TG0A 1EIFA 3VS1A 4QVCA 3OA6A 2JUFA 1BIBA 4M77C 1NPPA 2VWFA 3I55Q 4LDXA 3CCRA 4Z02A 1PRLC 3CCST 2DNUA 1Q82U 4WTOB 1IGUA 2CP2A 2JMCA 2QQSA 4Z89A 4UC4A 4OMLA 3KUFA 3E9FA 1VQ4Q 2MAMA 5FW9A 4OMOA 2LQKA 1RAHB 1X75C 3NTKA 3FLGA 1WA7A 4N4HA 2PVOB 3REAB 4X9CA 3P8BB 5DY9A 1N8RR 1T0HA 3FJ5A 1P92A 1RAFB 3GOXA 4GY5A 5LL6S 1MMDA 4C0DB 4ORZA 2VXEA 2KVQG 3OS0A 2SRCA 3EFOA 2C0IA 2RJDA 1KD1R 2NWMA 2DD5A 2P0QA 3A1PA 1YHQA 4NS5A 2RI5A 3M0QA 1BI2A 3JCMJ 3M0PA 1QW1A 4PJOC 4E7SA 2BIVA 2C0OA 1VQ5A 1M90C 3CC7T 2BKDN 1MMNA 4M75E 2DTHA 4BE0A 4DBHA 4KBMB 3BDUA 4ZTFA 2KROA 1R0CB 4L59A 4X9DA 1VQMQ 2VVKA 3HRUA 1K9MR 2CZ1B 4J9IA 4IUTA 4KGZB 2XDDA 1AHJB 2EGAA 1HK9A 2DO3A 2WSFE 4HXJA 3JCMd 1UGRB 1KIKA 1M8VA 2HQXA 4IKFA 2NLUA 1ZX6A 1OI1A 3M59A 3P8DA 5HY6A 3SWNC 3RR6A 5KYYB 1RAAB 3CD6Q 2EFIA 4M75B 4JJDA 2CZ0B 2WSCE 1Q95G 2YT6A 1U8RA 3SFMA 3L1AA 1W2BS 5GMKi 3QDFA 4RMOA 3OY9A 4JS4A 5A2QE 1S72A 2OAWA 3KFVA 1KJWA 4L5GA 3SDZA 1I5LA 1VQOQ 3CCSA 4M75A 4OVAA 2QGFB 5IXBA 3PIPA 2CH4A 3URGA 3GLXA 1I0CA 2RHIA 2ED0A 1SSHA 2KRNA 3EG0A 3M54A 2HKNA 1YFNA 1IZ6A 1WPYA 2RMOA 2HSEB 2YUPA 2YDLA 1KHIA 2CSIA 2CGHA 5L23A 5A0GA 1YWOA 5GJWB 1M90U 1M1KR 2DETA 4D8DA 3CCJQ 2RQUA 1KSWA 3AHUA 3MP6A 2Z0WA 5DLOA 3DKMA 2YLBA 2ZAEA 1BU1A 1V29B 2EKOA 3JCMe 1UFFA 1RAIB 1UECA 3BE3A 4A4EA 2YLCA 4MMLA 4JZ3A 4RTTA 3MP1A 1KK7A 2LNVA 4II1A 3GNFB 4CC2A 4HT8A 4GBQA 3PNWC 2EYQA 4DBRA 2DTOA 3L2ZA 2L89A 2P84A 4PFPA 1X27A 4J7IA 1VQNQ 2C06A 4EMHA 3QBYA 3UDCA 2AZVA 1TXQA 2FG0A 1VQPT 5CKHA 2BZXA 2X4WA 2GQVA 3E19A 3VYHB 3OSSC 3EHQA 1XOVA 4ELYC 3I56Q 1WHJA 2EVRA 1FMKA 2EQMA 3LX7A 2OJ2A 2D8JA 1SG5A 4C0DC 1B34B 4XTYA 4Y92A 5CIUA 3C94A 3QJ6A 2OX7A 1YITT 5D7UA 2VKNA 2J06A 3TSWA 3G7ZA 5IAYA 1CKAA 1G3YA 4M7AC 2X4JA 1YIJQ 2QXFA 3EAEA 4J9EA 4FL6A 1O9SA 1WQWA 2K2VA 1B34A 2KY9A 1W1FA 5LJ3d 1GCQA 3CMET 1QP3A 5GMKj 1WHMA 2HNIA 1RLPC 2J05A 3LYIA 2PVGB 4Z8AA 3H0HA 1QVGP 1UGSB 8AT1B 3TSZA 3MCAB 9ATCB 2DIQA 3OB9A 4DOVA 4HCKA 5IHIA 2XI9A 1G5VA 3MO8A 4E7HA 3TQ7P 3EH2A 5GAOp 4RCCA 3HTRA 3WXMB 3MEVA 3MEAA 1JBMA 4AT1B 4LDYA 1FYNA 2IG0A 4DEXA 2HZYA 4KULA 3OYDA 4MMKA 3G4SQ 2LQ8A 2MMPA 4XU1A 4XK8E 1U06A 1OYXA 2HBPA 3RKYA 4IIOA 1VQPA 4ZTJA 3NTHA 1QQJA 4M78C 2KQWA 1ABQA 1G3TA 4KGVB 2AHJB 4E7IA 1GBRA 3V8KA 4M75G 1JJ2A 2W0ZA 2JW4A 3HP9A 2X35A 5FLXE 4JS5A 1D0XA 2RJFA 4OB0B 3I9QA 1YCYA 1IHVA 2HDAA 4AG1C 3HRTA 1YJ9T 4FU6A 2K3YA 5LJ3e 2EJ9A 1K73C 4FT4A 1PNJA 4C5EA 4N4GA 2FRYA 3LGFA 1WDXA 2M51A 4JRIA 2DERA 1K9MU 3VUZA 1XJWB 1K8AR 4FT2A 3CMEA 2MK5A 2V8JA 1TS9A 2AK5A 2YHTA 1VQ6Q 1XTDA 4F7UE 3G71T 1YJNT 1H641 2CP0A 4F04B 1N5ZA 2YUQA 3RERA 4D8KA 1ZSZB 1VOMA 2J6KA 2KSSA 3VUBA 4LD6A 2EJGA 2LT1A 1PSFA 5CO7A 2MI6A 2EYWA 3CBOA 1PSEA 4PKCC 5CQYA 2YRDA 1KFZA 1IRXA 1D1CA 5GANj 2MCNA 2FYKA 3V8LA 1ZSZA 1VYTA 4J7FA 1H3HA 2DXBA 2JS2A 2LJ0A 5L8RE 3CCVQ 3LGLA 3EG1A 3CC4T 3JCMf 2QQAA 1ZA1B 4MZPA 2A0FB 5KH6A 3LWIA 2EQKA 4RG2A 1UB4A 4EPCA 3HRSA 3CCEQ 3UA7A 1T0JA 3C0CA 3M9QA 4ME7A 1X2QA 4EMGA 1K73U 3JB9I 1YJ9A 2K4YA 3OW2A 1SPKA 4OMPA 4EMKB 4QQDA 2QQ9A 3LH5A 1KQ1A 2ZPBB 2EPDA 4HCZA 3VKIA 4CC7A 4WCIA 1X6BA 4R0KA 1S1NA 1VYUA 2RM4A 3JCMh 1VQ9T 2D1XA 3QSUA 3FC3A 1G3WA 2LX7A 4EMKA 4BI3A 1VQLQ 2VASA 2CT3A 3CPWS 3G71A 5LJ5d 2Y90A 2IPOB 2KGTA 1YJNA 2D0NA 1WHGA 4M7AF 3MJXA 1A0NB 4ZGJB 2CKKA 1SRLA 2E12A 1JO8A 4OB3B 2MPXC 4F17A 5GAOn 1YI2T 5FRNA 1PG5B 4MZMA 1M1GA 3RIRA 4N4IA 3VS6A 4OGEA 4OMQA 2M0OA 2X4YA 3V8JA 1BI0A 7AT1B 3OYEA 2RJEA 2QI2A 2F5TX 1NYGA 2I0NA 4C8QF 5GAN6 4KH0B 2HSPA 5J26A 2QEXQ 3I5RA 2K3XA 4IURA 2NUPB 3CC4A 1Q81R 2KRMA 4J6WA 2DKGA 3GNGA 1WXTA 2EYXA 4C92C 2LJ1A 4BDYA 4DA4A 3VS2A 2DIGA 3EG2A 1AD5A 3A5ZB 1K8AC 2ECZA 2CSQA 3H41A 2VGMA 3D7SB 3G6ET 4QW2A 1Q86R 3L2VA 2MWPA 5KCHA 3REBB 1TOVA 3EFRA 2DL4A 4HKEA 3NFCA 3OYKA 1KQ2A 1BCOA 3DLMA 4NL3A 5LJ5e 1R8OB 2RF0A 1UJ0A 2L3SA 1VQ9A 3JCMc 2RB6A 3RMSA 1Y07A 3UF4A 2CUBA 1AZEA 1GCPA 3OS2A 1FX7A 5FU6C 1Z9QA 2YXYA 1HD3A 4JRQA 5EG2A 2BZ8A 2CUDA 3EG9B 1UGQB 3FDRA 3J81E 4AMCA 1YI2A 1ZQ1A 1VA7A 4R56A 2K7AA 3CXCS 2LJ3A 1EFNA 3AT1B 4C5IA 1QVFS 1TUGB 4KH1B 2RQTA 5FU7B 2CP3A 1TUCA 1SHGA 2K79A 3DB3A 2KRSA 2A7YA 4C5GA 4J9HA 3JB9D 4RCBA 5LJ3h 1JJ2P 3CCUT 3CCRQ 2VV5A 2HQEA 1B7TA 2A3LA 4MDXA 2CREA 1K8AU 1WFWA 3VJPA 1O75A
chains in the Genus database with same CATH topology
2PTKA 4J9BA 1WXUA 2CSIA 4LN2A 1ARKA 4HVUA 4CC4B 5L23A 2NUZA 2YUNA 1YWOA 2KR3A 5GJWB 1H92A 4FSSA 4D8DA 2RQUA 1KSWA 3UATA 1HJDA 1BK2A 1BU1A 1YP5A 1ZSGA 2MIOA 3IQLA 2A28A 2DJQA 2CH4W 3VS5A 1UFFA 1UECA 4J9GA 3U23A 3EG3A 4RTYA 4JZ3A 4RTTA 5FWBA 4CC2A 2KBTA 4GBQA 2CT4A 2W10A 1GL5A 3PVLA 1TUDA 2PZ1A 1WIEA 1JXOA 1T3LA 1U5SA 1Y0MA 1UJYA 1W6XA 1X27A 1GRIA 1MUZA 2LQNA 3M0TA 2O2OA 2EW3A 2A36A 2AZVA 1X2KA 2FG0A 2DA9A 2BZXA 2X3XD 4QT7A 2O31A 3EHQA 1QKXA 1XOVA 3SHWA 2LQWA 1PWTA 5IH2A 1YNZA 2BZYA 1AWJA 1UTIA 2DILA 1M30A 3ZL7C 2EVRA 1I07A 2F2VA 1FMKA 2D8HA 2GNCA 1E7OA 2OJ2A 2D8JA 1UE9A 4Y92A 4OMMA 2L3QA 4EIKA 2DL7A 1B07A 1GCQC 3NGPA 2KXCA 4KRTA 1MV0B 1WI7A 2VKNA 1PKTA 2J06A 1OPKA 3TSWA 1CKAA 1X43A 1QKWA 4LNPA 2DRKA 2RPNA 4F14A 5ECAA 1B3QA 1RUWA 4J9EA 2GQIA 1W1FA 2L2PA 2KT1A 1GCQA 2SEMA 2FPFA 1GFDA 2HBWA 1NG2A 1RLPC 2J05A 4Z8AA 1K1ZA 3H0HA 4HVVA 3TSZA 1AEYA 1Y57A 4HCKA 2JS0A 5IHIA 1K0XA 2KT8A 1PRMC 4RUGA 1ABOA 2LMJA 1OV3A 1YN8A 2GGRA 1E6HA 4ESRA 4J9DA 4AG2C 2EGCA 1FYNA 1M3AA 2K9GA 4DEXA 4IIMA 2YUOA 4Z88A 1U06A 1NEGA 1K76A 1M27C 2B86A 2C0TA 3M0UA 4IIOA 2KEAA 1UUEA 3A98A 2YSQA 1I1JA 5I11A 3I5SA 2ROLA 3VS3A 1ABQA 2FPEA 1GBRA 2L0AA 2W0ZA 2JW4A 2P4RA 3TVTA 2HEQA 2K2MA 1AOJA 3I9QA 2A08A 2K6DA 2HDAA 4A63B 4AG1C 1NEBA 1CKBA 1WX6A 2EKHA 1PNJA 1VYVA 1K9AA 1X6GA 5IHNA 2FRYA 2J7IA 3H0IA 1WDXA 2H8HA 2M51A 2EBPA 3I35A 5IHKA 4LUDA 2DVJA 1QLYA 3EHRA 1HSQA 4DEYA 5IXFA 2QDLA 2AK5A 2FO0A 2JT4A 2O88A 4RTXA 2LNHB 4AFQC 1N5ZA 2YUQA 4JJCA 4D8KA 3O5ZA 4GLMA 4AFSC 3PE0A 4CC3A 3CQTA 1NM7A 1AZGB 3GBQA 4HVWA 3VRZA 2J6KA 1M3CA 2DBMA 2EGEA 2J6OA 2KNBB 2X3WD 2JMAA 4RTUA 2LP5A 1U3OA 2EYWA 4X1VA 1BBZA 1JEGA 2IIMA 2GTOA 1KFZA 2DL3A 2DLPA 2DL5A 2DMOA 1UDLA 2L3PA 3NPFA 2MCNA 1G2BA 3M0RA 1ZLMA 2FRWA 4LE9A 4RTVA 1WXBA 1VYTA 5FWCA 1H3HA 2EYYA 2JM8A 3VS0A 2JS2A 2LJ0A 1SEMA 1RI9A 1YCSB 1K4US 1OPLA 3NMZC 1ZUYA 1E6GA 3EG1A 2DX1A 3UA6A 1X69A 2AKLA 4J9CA 2FPDA 2RN8A 2GTJA 1SRMA 4K11A 2V1RA 2M0YA 2HCKA 2DBKA 3UA7A 2DE0X 2GBQA 1T0JA 3C0CA 2EYZA 5EC7A 1UHFA 2F2XA 1WLPB 1X2QA 1M3BA 1PKSA 2KYBA 1SPKA 1GFCA 3RBBB 4OMPA 1UHCA 3R6NA 3ULRB 1ZUUA 3LH5A 1NLPC 4J9FA 2JXBA 2KE9A 1AWXA 2AKKA 4JZ4A 2EPDA 1H8KA 3JV3A 4CC7A 4WCIA 2O9VA 3VS7A 1X6BA 4ZNXA 4R0KA 1S1NA 1VYUA 2DM1A 1M8MA 1OEBA 2DYBA 2D1XA 2MOXA 2LX7A 1JXMA 5GJVB 1G83A 2ENMA 2CT3A 1CSKA 1OOTA 3RNJA 2EQIA 2FEIA 2KGTA 3SEMA 1TG0A 2D0NA 3VS1A 4M4ZA 1A0NB 1SRLA 3VRYA 2BTTA 1JO8A 1JU5C 2VWFA 4F17A 1PRLC 2ED1A 2A37A 2DNUA 2XMFA 4JJBA 3VS6A 4OMQA 2JMCA 4Z89A 2DF6A 4OMLA 4F16A 5FW9A 4OMOA 3PVQA 2KXDA 1QWEA 2RQWA 1NYGA 2CDTA 2I0NA 1WA7A 3REAB 2HSPA 2RNAA 3EGUA 1T0HA 3FJ5A 3I5RA 1PHTA 2ABLA 2PNIA 2KRMA 2LCSA 1SHFA 1WXTA 2AZSA 2EYXA 2E5KA 2LJ1A 4ORZA 3VS2A 1V1CA 2SRCA 2C0IA 3EG2A 3VS4A 2NWMA 1AD5A 2ECZA 1AVZC 2CSQA 3H41A 3M0QA 4OMNA 3M0PA 1NLOC 2ROTA 1YWPA 2ESWA 2C0OA 3REBB 3NHNA 2RQRA 1UG1A 2DL4A 2KROA 2JTEA 2VVKA 4J9IA 2EGAA 1AWOA 2RF0A 1UJ0A 4HXJA 2J6FA 1QWFA 1KIKA 2L3SA 1ZX6A 3H0FA 5HCKA 1LCKA 1WYXA 3UF4A 2CUBA 1RLQC 1GCPA 1AZEA 2G6FX 4AFUC 1ZBJA 1UGVA 1GBQA 4JJDA 1Z9QA 4AFZC 2YT6A 1HD3A 2BZ8A 2CUDA 1Z9ZA 1QCFA 1AWWA 3M0SA 2OAWA 1VA7A 3KFVA 1KJWA 1K0SA 2K7AA 2LJ3A 1EFNA 1J3TA 4JPBW 4LUEA 2RQVA 5IXBA 2K3BA 1T3SA 2DL8A 2RQTA 4E6RA 2CH4A 2LZ6B 1TUCA 3QWYA 1SHGA 2K79A 1I0CA 3QWXX 4RTZA 5I22A 2ED0A 1SSHA 2KRNA 2KRSA 3EG0A 1JQQA 2O9SA 2JM9A 4J9HA 4RTWA 3THKA 1ZUKA 2RMOA 1BB9A 2DRMA 1NYFA 1MV3A 2F2WA 2OI3A 2V1QA 2KYMA 2YUPA 2YDLA 2CREA 1IO6A 1WFWA 1W70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTK A;  4J9B A;  1WXU A;  2CSI A;  4LN2 A;  1ARK A;  4HVU A;  4CC4 B;  5L23 A;  2NUZ A;  2YUN A;  1YWO A;  2KR3 A;  5GJW B;  1H92 A;  4FSS A;  4D8D A;  2RQU A;  1KSW A;  3UAT A;  1HJD A;  1BK2 A;  1BU1 A;  1YP5 A;  1ZSG A;  2MIO A;  3IQL A;  2A28 A;  2DJQ A;  2CH4 W;  3VS5 A;  1UFF A;  1UEC A;  4J9G A;  3U23 A;  3EG3 A;  4RTY A;  4JZ3 A;  4RTT A;  5FWB A;  4CC2 A;  2KBT A;  4GBQ A;  2CT4 A;  2W10 A;  1GL5 A;  3PVL A;  1TUD A;  2PZ1 A;  1WIE A;  1JXO A;  1T3L A;  1U5S A;  1Y0M A;  1UJY A;  1W6X A;  1X27 A;  1GRI A;  1MUZ A;  2LQN A;  3M0T A;  2O2O A;  2EW3 A;  2A36 A;  2AZV A;  1X2K A;  2FG0 A;  2DA9 A;  2BZX A;  2X3X D;  4QT7 A;  2O31 A;  3EHQ A;  1QKX A;  1XOV A;  3SHW A;  2LQW A;  1PWT A;  5IH2 A;  1YNZ A;  2BZY A;  1AWJ A;  1UTI A;  2DIL A;  1M30 A;  3ZL7 C;  2EVR A;  1I07 A;  2F2V A;  1FMK A;  2D8H A;  2GNC A;  1E7O A;  2OJ2 A;  2D8J A;  1UE9 A;  4Y92 A;  4OMM A;  2L3Q A;  4EIK A;  2DL7 A;  1B07 A;  1GCQ C;  3NGP A;  2KXC A;  4KRT A;  1MV0 B;  1WI7 A;  2VKN A;  1PKT A;  2J06 A;  1OPK A;  3TSW A;  1CKA A;  1X43 A;  1QKW A;  4LNP A;  2DRK A;  2RPN A;  4F14 A;  5ECA A;  1B3Q A;  1RUW A;  4J9E A;  2GQI A;  1W1F A;  2L2P A;  2KT1 A;  1GCQ A;  2SEM A;  2FPF A;  1GFD A;  2HBW A;  1NG2 A;  1RLP C;  2J05 A;  4Z8A A;  1K1Z A;  3H0H A;  4HVV A;  3TSZ A;  1AEY A;  1Y57 A;  4HCK A;  2JS0 A;  5IHI A;  1K0X A;  2KT8 A;  1PRM C;  4RUG A;  1ABO A;  2LMJ A;  1OV3 A;  1YN8 A;  2GGR A;  1E6H A;  4ESR A;  4J9D A;  4AG2 C;  2EGC A;  1FYN A;  1M3A A;  2K9G A;  4DEX A;  4IIM A;  2YUO A;  4Z88 A;  1U06 A;  1NEG A;  1K76 A;  1M27 C;  2B86 A;  2C0T A;  3M0U A;  4IIO A;  2KEA A;  1UUE A;  3A98 A;  2YSQ A;  1I1J A;  5I11 A;  3I5S A;  2ROL A;  3VS3 A;  1ABQ A;  2FPE A;  1GBR A;  2L0A A;  2W0Z A;  2JW4 A;  2P4R A;  3TVT A;  2HEQ A;  2K2M A;  1AOJ A;  3I9Q A;  2A08 A;  2K6D A;  2HDA A;  4A63 B;  4AG1 C;  1NEB A;  1CKB A;  1WX6 A;  2EKH A;  1PNJ A;  1VYV A;  1K9A A;  1X6G A;  5IHN A;  2FRY A;  2J7I A;  3H0I A;  1WDX A;  2H8H A;  2M51 A;  2EBP A;  3I35 A;  5IHK A;  4LUD A;  2DVJ A;  1QLY A;  3EHR A;  1HSQ A;  4DEY A;  5IXF A;  2QDL A;  2AK5 A;  2FO0 A;  2JT4 A;  2O88 A;  4RTX A;  2LNH B;  4AFQ C;  1N5Z A;  2YUQ A;  4JJC A;  4D8K A;  3O5Z A;  4GLM A;  4AFS C;  3PE0 A;  4CC3 A;  3CQT A;  1NM7 A;  1AZG B;  3GBQ A;  4HVW A;  3VRZ A;  2J6K A;  1M3C A;  2DBM A;  2EGE A;  2J6O A;  2KNB B;  2X3W D;  2JMA A;  4RTU A;  2LP5 A;  1U3O A;  2EYW A;  4X1V A;  1BBZ A;  1JEG A;  2IIM A;  2GTO A;  1KFZ A;  2DL3 A;  2DLP A;  2DL5 A;  2DMO A;  1UDL A;  2L3P A;  3NPF A;  2MCN A;  1G2B A;  3M0R A;  1ZLM A;  2FRW A;  4LE9 A;  4RTV A;  1WXB A;  1VYT A;  5FWC A;  1H3H A;  2EYY A;  2JM8 A;  3VS0 A;  2JS2 A;  2LJ0 A;  1SEM A;  1RI9 A;  1YCS B;  1K4U S;  1OPL A;  3NMZ C;  1ZUY A;  1E6G A;  3EG1 A;  2DX1 A;  3UA6 A;  1X69 A;  2AKL A;  4J9C A;  2FPD A;  2RN8 A;  2GTJ A;  1SRM A;  4K11 A;  2V1R A;  2M0Y A;  2HCK A;  2DBK A;  3UA7 A;  2DE0 X;  2GBQ A;  1T0J A;  3C0C A;  2EYZ A;  5EC7 A;  1UHF A;  2F2X A;  1WLP B;  1X2Q A;  1M3B A;  1PKS A;  2KYB A;  1SPK A;  1GFC A;  3RBB B;  4OMP A;  1UHC A;  3R6N A;  3ULR B;  1ZUU A;  3LH5 A;  1NLP C;  4J9F A;  2JXB A;  2KE9 A;  1AWX A;  2AKK A;  4JZ4 A;  2EPD A;  1H8K A;  3JV3 A;  4CC7 A;  4WCI A;  2O9V A;  3VS7 A;  1X6B A;  4ZNX A;  4R0K A;  1S1N A;  1VYU A;  2DM1 A;  1M8M A;  1OEB A;  2DYB A;  2D1X A;  2MOX A;  2LX7 A;  1JXM A;  5GJV B;  1G83 A;  2ENM A;  2CT3 A;  1CSK A;  1OOT A;  3RNJ A;  2EQI A;  2FEI A;  2KGT A;  3SEM A;  1TG0 A;  2D0N A;  3VS1 A;  4M4Z A;  1A0N B;  1SRL A;  3VRY A;  2BTT A;  1JO8 A;  1JU5 C;  2VWF A;  4F17 A;  1PRL C;  2ED1 A;  2A37 A;  2DNU A;  2XMF A;  4JJB A;  3VS6 A;  4OMQ A;  2JMC A;  4Z89 A;  2DF6 A;  4OML A;  4F16 A;  5FW9 A;  4OMO A;  3PVQ A;  2KXD A;  1QWE A;  2RQW A;  1NYG A;  2CDT A;  2I0N A;  1WA7 A;  3REA B;  2HSP A;  2RNA A;  3EGU A;  1T0H A;  3FJ5 A;  3I5R A;  1PHT A;  2ABL A;  2PNI A;  2KRM A;  2LCS A;  1SHF A;  1WXT A;  2AZS A;  2EYX A;  2E5K A;  2LJ1 A;  4ORZ A;  3VS2 A;  1V1C A;  2SRC A;  2C0I A;  3EG2 A;  3VS4 A;  2NWM A;  1AD5 A;  2ECZ A;  1AVZ C;  2CSQ A;  3H41 A;  3M0Q A;  4OMN A;  3M0P A;  1NLO C;  2ROT A;  1YWP A;  2ESW A;  2C0O A;  3REB B;  3NHN A;  2RQR A;  1UG1 A;  2DL4 A;  2KRO A;  2JTE A;  2VVK A;  4J9I A;  2EGA A;  1AWO A;  2RF0 A;  1UJ0 A;  4HXJ A;  2J6F A;  1QWF A;  1KIK A;  2L3S A;  1ZX6 A;  3H0F A;  5HCK A;  1LCK A;  1WYX A;  3UF4 A;  2CUB A;  1RLQ C;  1GCP A;  1AZE A;  2G6F X;  4AFU C;  1ZBJ A;  1UGV A;  1GBQ A;  4JJD A;  1Z9Q A;  4AFZ C;  2YT6 A;  1HD3 A;  2BZ8 A;  2CUD A;  1Z9Z A;  1QCF A;  1AWW A;  3M0S A;  2OAW A;  1VA7 A;  3KFV A;  1KJW A;  1K0S A;  2K7A A;  2LJ3 A;  1EFN A;  1J3T A;  4JPB W;  4LUE A;  2RQV A;  5IXB A;  2K3B A;  1T3S A;  2DL8 A;  2RQT A;  4E6R A;  2CH4 A;  2LZ6 B;  1TUC A;  3QWY A;  1SHG A;  2K79 A;  1I0C A;  3QWX X;  4RTZ A;  5I22 A;  2ED0 A;  1SSH A;  2KRN A;  2KRS A;  3EG0 A;  1JQQ A;  2O9S A;  2JM9 A;  4J9H A;  4RTW A;  3THK A;  1ZUK A;  2RMO A;  1BB9 A;  2DRM A;  1NYF A;  1MV3 A;  2F2W A;  2OI3 A;  2V1Q A;  2KYM A;  2YUP A;  2YDL A;  2CRE A;  1IO6 A;  1WFW A;  1W70 A; 
#chains in the Genus database with same CATH topology
 4OP0 A;  1WXU A;  3MEU A;  3OYN A;  1S72 T;  1D1B A;  2KR3 A;  3QG1 A;  1OX8 A;  3P8H A;  2JN0 A;  3G6E A;  1HJD A;  2R5M A;  2P0P A;  5FRM A;  1ZSG A;  3MHX A;  3IQL A;  2DJQ A;  3VS5 A;  3CCM Q;  2F69 A;  3EFO B;  2FB7 A;  1BKB A;  3CCQ A;  2EQJ A;  5D6W A;  3EG3 A;  3M5A A;  4RTY A;  2PUO B;  2CZ6 B;  4M7D F;  4FYW B;  4IUU A;  3PVL A;  1WIE A;  1W2B A;  1YHQ Q;  2CP5 A;  1Y0M A;  1W6X A;  1GRI A;  3CEY A;  3MPU B;  5A0D A;  1QMC A;  1RAE B;  1WJS A;  1MND A;  1VQ5 Q;  4JRK A;  2A36 A;  1W4S A;  3I55 A;  3PMI A;  3SHW A;  2LQW A;  5IH2 A;  2EAY A;  2BE9 B;  2BZY A;  1UTI A;  2DXC A;  5GAN 5;  1Q7Y C;  2OTJ T;  1Q81 C;  2GNC A;  4V2S A;  2HL3 A;  3MET A;  1M4Z A;  2DL7 A;  3OYJ A;  2KXC A;  4KRT A;  1WI7 A;  2K5L A;  3TU4 K;  4LNP A;  2DRK A;  3JCM P;  2PUK B;  1Q86 C;  1RUW A;  3ZBD A;  2HMA A;  5CQX A;  3OYH A;  5KYW A;  2SEM A;  3CCU A;  4M7A A;  3QDR B;  4QQ6 A;  3CCS Q;  1NG2 A;  3OYG A;  3MKD A;  1KQS S;  2ZPE B;  1U1T A;  4J6X A;  4HVV A;  1D1A A;  3S3O A;  3FEO A;  3OW2 P;  1N9S A;  4BE1 A;  1Y57 A;  1VQM A;  3GPL A;  1ABO A;  4Q5W A;  3EGD B;  5GAM d;  1OV3 A;  1YN8 A;  1E6H A;  4ESR A;  4C92 F;  4AG2 C;  2DXT A;  3JB9 H;  4OF1 A;  2EGC A;  4C8Q A;  4LDU A;  1VQ8 T;  2CP6 A;  2K9G A;  2XD0 A;  1VQK T;  3CD6 A;  2GFU A;  2QG9 B;  3L2U A;  3ME9 A;  1R0B G;  1EX4 A;  3EGD A;  4FIB A;  1K76 A;  3CC7 Q;  1IGQ A;  3M0U A;  3A98 A;  5I11 A;  1VQO A;  3I5S A;  2E1H A;  1Q7Y U;  2RHX A;  1Q81 U;  3VS3 A;  2FPE A;  5I2M A;  2DZ9 A;  5LJ5 f;  8ATC B;  3MP8 A;  2OTJ A;  3TVT A;  2HEQ A;  1GXI E;  4XTX A;  3CMA T;  4A63 B;  1BIA A;  1NEB A;  2VC8 A;  1CKB A;  1Q86 U;  1WX6 A;  3HFN A;  3JCM g;  3M58 A;  5IHN A;  1QCO A;  1M9S A;  3S6W A;  4HA8 A;  5IHK A;  2DVJ A;  1LJO A;  1HSQ A;  3OYC A;  5AT1 B;  1WGS A;  3CC2 T;  4IUQ A;  2JT4 A;  1M2V B;  2DEQ A;  2O88 A;  5LJ5 h;  1N8R C;  1FXX A;  2ZPF B;  4RTX A;  5GAM e;  1IRE B;  4WF2 A;  5A0L A;  5I2S A;  4AFQ C;  4BDZ A;  4JJC A;  4GLM A;  4C0G A;  4CC3 A;  1NM7 A;  1AZG B;  3VRZ A;  4XU3 A;  4B6M A;  1M3C A;  1BYM A;  2J6O A;  2KNB B;  1KD1 C;  2JMA A;  4BI4 A;  2LP5 A;  1U3O A;  1M2V A;  2IIM A;  3OYA A;  1VQN A;  3S3N A;  4LDW A;  2DL3 A;  4E7J A;  1D3B A;  2O01 E;  1VQ8 A;  1G2B A;  1VQK A;  1RL2 A;  4RTV A;  1WZO A;  4M77 F;  1WXB A;  4BUG A;  4M77 D;  2Y4Y A;  2RHY A;  1RI9 A;  4XTV A;  2LTO A;  5GMK e;  1K9M C;  1OPL A;  2FVU A;  2DX1 A;  5GAN 4;  4M7D B;  2AKL A;  2FPD A;  1H3Z A;  4KT0 E;  2RN8 A;  4D6W A;  2GTJ A;  3TRE A;  1VIF A;  3BDL A;  3A8O B;  2DE0 X;  2GBQ A;  4QVD A;  4M75 C;  5EC7 A;  1YIJ A;  2F2X A;  1WLP B;  3OQ5 A;  3CMA A;  1WHL A;  4M7D A;  4BY6 B;  1V76 A;  1VQ7 Q;  3RBB B;  1VQP Q;  3M57 A;  1UHC A;  4PL6 A;  1ZUU A;  5HKC A;  1NLP C;  1X01 A;  1UEB A;  1EZZ B;  4M7A G;  3OMC A;  4LD9 K;  1NPR A;  4JZ4 A;  1YJW T;  3JV3 A;  4PJO F;  3NTI A;  4ZNX A;  1RI0 A;  2DM1 A;  1OEB A;  5GAN d;  3QHS A;  2GFA A;  3OYB A;  5J3B A;  5GJV B;  1N8R U;  4HCC A;  1G83 A;  3CBM A;  3CC2 A;  4A4K A;  2AIR B;  1OOT A;  2B8A A;  4JLG A;  1YIT Q;  4N0A C;  2CS7 A;  3A8L B;  2QQR A;  3SEM A;  1PM3 A;  1I81 A;  2M1H A;  1KD1 U;  3O8V A;  2BTT A;  1JU5 C;  2KMT A;  1OUL A;  3OYY A;  5IN1 A;  2WSE E;  4E7Z A;  1W2B P;  4C8Q G;  1M2O A;  3PGG A;  2V8I A;  3CME Q;  2ED1 A;  2X51 A;  2KI7 A;  1M1K C;  2RHU A;  4JJB A;  1JRI A;  3L42 A;  4X34 A;  1XNI A;  2DF6 A;  4F16 A;  4FW1 A;  3PVQ A;  4RKU E;  3RKX A;  1QWE A;  2RQW A;  4Y91 A;  2CDT A;  3HFO A;  3F70 A;  3PT9 A;  4PJL A;  2ABL A;  1WJQ A;  3TCJ A;  1PD1 A;  1SHF A;  4EDU A;  2E5K A;  2Y4X A;  2GF7 A;  2FZC B;  1ZA2 B;  3INZ A;  2DEU A;  5I21 A;  1AVZ C;  2E4H A;  1LNX A;  2EJF A;  1BCM A;  1MNE A;  3J7A F;  1NLO C;  4A4F A;  1SSF A;  2ROT A;  4C92 A;  1YWP A;  3TEE A;  1YBY A;  5KYU B;  2DZC A;  3HKS A;  5GAN 3;  1UG1 A;  3JCM Q;  3V7C A;  4J8O A;  5GAN e;  3CPW A;  2JTE A;  2E70 A;  3EH1 A;  3MEW A;  4ELZ C;  1YJW A;  1XQH A;  4L6V 5;  2J6F A;  1QWF A;  3QII A;  5KYU A;  3X24 B;  2E65 A;  1UGP B;  4BI8 B;  4E7L A;  1LCK A;  2OTL T;  1WYX A;  3GF5 A;  1YJ9 Q;  4AFU C;  1LPL A;  1UGV A;  5CKE A;  5KE2 A;  4AFZ C;  3EGX B;  2R57 A;  4JLI A;  4MDW A;  3RDV A;  1M1K U;  3JB9 G;  1AWW A;  3M0S A;  5KYX A;  3EFS A;  1SF9 A;  1J3T A;  4JPB W;  2RQV A;  5M9O A;  2K3B A;  2DL8 A;  5GAM f;  3G71 Q;  3EGX A;  4E6R A;  1LVK A;  1YJN Q;  4TVR A;  1NBE B;  3QWY A;  2LX9 A;  2JM9 A;  5GAO q;  3THK A;  3CCE A;  1BB9 A;  1I4K 1;  2DRM A;  1NYF A;  1MV3 A;  2OI3 A;  2V1Q A;  2KYM A;  1N9R A;  1U1S A;  2CP7 A;  4M7A D;  4M77 B;  1IO6 A;  1W70 A;  2YRC A;  2PTK A;  4J9B A;  3RMQ A;  1LOJ A;  4PLL A;  1C0M A;  4LN2 A;  4M7D G;  1MHN A;  4HVU A;  4CC4 B;  1IXD A;  1TSF A;  2NUZ A;  1VUB A;  2YUN A;  3SB2 A;  1H92 A;  4FSS A;  4ATO A;  3UAT A;  1BK2 A;  4JJN K;  1YP5 A;  2MIO A;  4QVZ A;  4E2F B;  2L8D A;  4PFO A;  2A28 A;  3CC4 Q;  2QGG A;  5GAM h;  4M77 A;  5GAO m;  2F5K A;  2RK2 A;  4J9G A;  3FB9 A;  1VQL A;  4KGX B;  2W10 A;  1GL5 A;  2MYS A;  3CPF A;  3ZFJ A;  4E7K A;  4C8Q D;  2PQW A;  2PVD B;  6AT1 B;  5KYN A;  1MUZ A;  2DK3 A;  4NL2 A;  5D6Y A;  3CXC A;  2OTL A;  1WNL A;  1Y96 A;  2DA9 A;  2X3X D;  4P5N A;  3OYL A;  1QVF A;  4PJO B;  2P4T A;  2QA4 T;  2NYS A;  5GMK h;  2D6F A;  1PWT A;  1YNZ A;  2K57 A;  3CCL T;  1M5Q 1;  3FIF A;  1AT1 B;  2F2V A;  1DJ7 B;  2D8H A;  3CCQ T;  2JNG A;  1UE9 A;  4FYX B;  2JVV A;  1VQ9 Q;  4OMM A;  2L3Q A;  2E64 A;  1ZSZ C;  1B07 A;  3NGP A;  4HCB A;  4PJO A;  4M78 F;  1OPK A;  4XU2 A;  1ACM B;  2DFU A;  4M78 D;  2RPN A;  4F14 A;  3QUI A;  1B3Q A;  1RAD B;  1RAB B;  3BFM A;  4XU0 A;  2M02 A;  5LJ3 f;  2GQI A;  2L2P A;  3I55 T;  1YI2 Q;  2FPF A;  5LJ5 g;  1GFD A;  2XIC A;  2X9H A;  3KXT A;  1RAC B;  1K1Z A;  4DQ2 A;  1VQ4 T;  4XQ3 A;  2RI3 A;  3C12 A;  3SWN A;  1AEY A;  1BI3 A;  2JS0 A;  4O6J A;  2H3E B;  3E2U A;  2KT8 A;  1Y71 A;  3FRN A;  1PRM C;  1N6A A;  3QXE B;  1NJI R;  3QZ9 B;  4RUG A;  2JZ2 A;  2LMJ A;  2V26 A;  4FM4 B;  1N27 A;  3E9G A;  1TU0 B;  4DBF A;  1M3A A;  1JB0 E;  4EMK C;  3G6E Q;  2YUO A;  1NEG A;  1M27 C;  4BD3 A;  3SD4 A;  2COW A;  1VIE A;  1OU8 A;  2HD0 A;  1UUE A;  1BI1 A;  2YSQ A;  1D0Z A;  1VQM T;  1NZ9 A;  2JOY A;  4C0F A;  2QA4 A;  2L0A A;  3CCL A;  5GAN 7;  1I5O B;  2G3R A;  2P4R A;  5DLQ E;  3GP8 A;  2K2M A;  4B9X A;  2K6D A;  3OYI A;  2LT4 A;  3CD6 T;  1KQS A;  4M7D D;  1FWZ A;  1K9A A;  1X6G A;  2J7I A;  3DLL A;  1ZBX A;  4M7A E;  2O4X B;  2EBP A;  3LLR A;  4HT9 A;  3M53 A;  4LUD A;  3EHR A;  1QLY A;  5GAN h;  4B9W A;  1VQO T;  1QVG S;  5IXF A;  2YWW A;  3BY7 A;  2FO0 A;  4C5H A;  2VXF A;  3CCM A;  3LH0 A;  1VQ4 A;  2XHC A;  3OS1 A;  2LNH B;  2O4X A;  3CPW P;  2AT1 B;  4M77 G;  4Y28 E;  3O5Z A;  4AFS C;  5KYW B;  3DB4 A;  4HVW A;  4M7A B;  2DBM A;  2RI2 A;  3OMG A;  2FZK B;  2X3W D;  3CCU Q;  4C8Q E;  4X1V A;  3X28 B;  2GTO A;  2DLP A;  2DL5 A;  2DMO A;  1UDL A;  2RA2 A;  3M0R A;  1ZLM A;  4LE9 A;  2FRW A;  2K5F A;  4BAC A;  1MMA A;  1OU9 A;  3CBP A;  1S72 Q;  2JM8 A;  3H9N A;  3VS0 A;  3CCJ T;  1NE8 A;  1SEM A;  3OYF A;  1YCS B;  1K4U S;  4A4H A;  3NMZ C;  1OZ3 A;  3A8H B;  1X69 A;  4YTL A;  3FJP A;  4C8Q B;  3QO3 A;  4J5Y A;  4K11 A;  1SRM A;  2V1R A;  3RKW A;  2HCK A;  3LWH A;  3BW1 A;  2DAQ A;  4FYY B;  2LRQ A;  4PJO G;  4M78 E;  1PD0 A;  2ZZD A;  1VQN T;  1M3B A;  1WJR A;  2E6Z A;  4JRP A;  1PKS A;  2KYB A;  3VYG A;  2DYI A;  4C92 D;  2XG8 D;  3HSB A;  2I2L A;  1TH7 A;  4R55 A;  5KYY A;  4ZGD B;  2AKK A;  3I56 T;  3X20 B;  4J83 A;  1NJI C;  2E6N A;  3VS7 A;  2OTJ Q;  2XDP A;  5FU7 C;  3RUX A;  1M8M A;  3X26 B;  2MOX A;  4M78 B;  2QDY B;  5GAO l;  1CSK A;  3X25 B;  3RNJ A;  1R77 A;  2EQI A;  4CRI A;  3UT1 A;  4M4Z A;  1YIJ T;  3QKJ A;  2RO0 A;  4XTZ A;  1KG1 A;  2ZGW A;  2E3H A;  4M78 A;  4QQG A;  3J80 E;  1K73 R;  1WQ7 A;  4N0A A;  4F7U F;  2A37 A;  2XMF A;  2CYZ B;  2KK4 A;  4BB7 A;  3CC7 A;  3CXC P;  3M4G A;  3PTA A;  3ER0 A;  1QVF P;  2KXD A;  3CCJ A;  2QAZ A;  3QYG B;  5HK0 A;  1FMV A;  2P0K A;  4J6Y A;  3V7R A;  2RNA A;  3EGU A;  1PHT A;  2PNI A;  2MWO A;  2HQH A;  2E10 A;  2LCS A;  1FMW A;  3QZ5 B;  2AZS A;  1D3B B;  2XID A;  1V1C A;  3V7S A;  1VQ7 T;  3VS4 A;  1RAG B;  1VQ8 Q;  1VQK Q;  2VB6 A;  4M7D E;  4FSX A;  4A4G A;  4OMN A;  4IUV A;  5GAM g;  3G4S T;  3ZEH A;  3JSC A;  5GAM j;  2ESW A;  5GMK m;  2RD1 A;  1D09 B;  3NHN A;  2RQR A;  2DXU A;  2R5A A;  2HL5 C;  1D0Y A;  3S3M A;  1NJI U;  3JAM E;  3I56 A;  3KBG A;  1TTH B;  4JDS A;  1AWO A;  4FYV B;  1Y7X A;  2GCX A;  2QYZ A;  2V8K A;  3H0F A;  5HCK A;  4A54 A;  3LW5 E;  1KHC A;  3CMA Q;  5C0M A;  3QPH A;  1RLQ C;  2G6F X;  1ZBJ A;  2FHD A;  4KUD K;  2ZPI B;  1GBQ A;  4QKU A;  3ASK A;  4PFZ A;  1G8X A;  2EWN A;  3RES A;  2LDM A;  1Z9Z A;  1QCF A;  2FZG B;  3H6Z A;  5CCA A;  1K0S A;  4A53 A;  4C8Q C;  5GAO r;  2JTF A;  2OAU A;  3OBW A;  4CI0 C;  1I8F A;  3CC2 Q;  1VQ6 T;  3OYM A;  4LUE A;  2DD4 A;  1T3S A;  2COZ A;  3WVE B;  2JTM A;  2LZ6 B;  4ZN3 A;  4PJO D;  3JRZ A;  3JCM X;  2VYT A;  3QWX X;  4RTZ A;  2M16 A;  5I22 A;  1F1B B;  3A8G B;  2D0Q B;  1JQQ A;  2O9S A;  4RTW A;  2R58 A;  2DVE A;  1ZUK A;  3Q1J A;  3R6O A;  2MF2 A;  5CK9 A;  2E41 A;  4FCY A;  2F2W A;  4PJN A;  3OBY A;  3VRY A;  3L2R A;  1MMG A;  1VQ7 A;  2LC4 A;  5D6X A;  4C92 E;  1ARK A;  1KQS P;  2L5Q A;  3JCM b;  3G4S A;  3CCV T;  4OB1 B;  5CVI A;  2CH4 W;  2QAS A;  3U23 A;  5LJ3 g;  4NOY A;  4IUP A;  5LJ3 j;  5FWB A;  3HHT B;  4PJJ A;  2KBT A;  1PC0 A;  2CT4 A;  2EQU A;  1YIT A;  1X6O A;  4PLI A;  3CCE T;  1TUD A;  2PZ1 A;  1JXO A;  3JCM V;  1T3L A;  4C92 B;  1U5S A;  4PNO A;  3G1J A;  3L2Q A;  1UJY A;  3HPW A;  2JJ9 A;  2LQN A;  3M0T A;  1KC8 R;  2O2O A;  2EW3 A;  5HK3 A;  1X2K A;  4QT7 A;  3E1S A;  4M78 G;  2QTX A;  1M1F A;  2O31 A;  2X4X A;  3L2W A;  1QKX A;  3GIB A;  1HXD A;  2WAC A;  1YJW Q;  1AWJ A;  2DIL A;  1M30 A;  1QVP A;  3OS5 A;  3ZL7 C;  2ZPG B;  1I07 A;  1Q82 R;  1E7O A;  3M55 A;  4RG8 A;  4FW2 A;  2F1L A;  1VQL T;  2ATC B;  4EIK A;  3VV0 A;  2VUB A;  1GCQ C;  1VQ6 A;  3C95 A;  4OB2 B;  1MV0 B;  1PKT A;  1G3S A;  2IVW A;  1X43 A;  1QKW A;  5CR2 A;  1C1A A;  5ECA A;  5GAN g;  1JJ2 S;  5KYX B;  4XTW A;  4F7U B;  2M9U A;  5J39 A;  2KT1 A;  1MGQ A;  2BUD A;  5FU6 B;  3A8M B;  4DOW A;  2PU9 B;  2HBW A;  2HKQ B;  2E3I A;  4PK4 A;  4ANJ A;  4BE2 A;  5DM7 R;  4XAX B;  2COY A;  4M7D C;  4F7U A;  1K0X A;  4KUI A;  2KDS A;  4M77 E;  1OQK A;  2QEX T;  5KE3 A;  5CAI A;  3CCV A;  2BE7 D;  3T9N A;  3PMT A;  2GGR A;  1IB8 A;  4J9D A;  3VU3 C;  4OGC A;  4LDV A;  2XDB A;  2LCL A;  4BY6 C;  4C0Z A;  3HL8 A;  4IIM A;  4Z88 A;  2B86 A;  2C0T A;  2KEA A;  4E47 A;  2XU8 A;  5IT9 E;  2DPP B;  1I1J A;  2EIF A;  3N5B B;  5GAN 2;  2QQB A;  2E5Q A;  2QTV A;  2ROL A;  5GAN 8;  3M4Y A;  5C6S A;  4XTU A;  1HYO A;  2DJZ A;  3QJY A;  1PCX A;  4PJO E;  1Y96 B;  1AOJ A;  2QK0 A;  3PFS A;  2A08 A;  2YRV A;  2L3R A;  3UWN A;  4PJM A;  2OTL Q;  2NUT B;  2EKH A;  1SKU B;  1VYV A;  4M75 F;  3H0I A;  2H8H A;  2D9T A;  4M75 D;  1QP2 A;  3I35 A;  5KCO A;  1QCN A;  5GMK l;  2CZ7 B;  2RHZ A;  4DEY A;  2QDL A;  3OW2 S;  4MZT A;  2NUT A;  3JB9 J;  1M90 R;  4JUV A;  1Q7Y R;  3WVD B;  5CKD A;  5AYF A;  3PE0 A;  2KAF A;  1KC8 C;  3CQT A;  3GBQ A;  2QEX A;  1ZHI A;  2EGE A;  3PIO A;  3CCR T;  4RTU A;  4DBQ A;  1BBZ A;  4GLK A;  1JEG A;  5FRO A;  2NUP A;  1OZ2 A;  4VUB A;  3OSV A;  3SWN B;  2L3P A;  4OMF B;  3NPF A;  5CKB A;  1Q82 C;  5FWC A;  2EYY A;  1TWB A;  2DTI A;  5LJ5 j;  2XKO C;  1WHK A;  2VGN A;  1ZUY A;  1E6G A;  2XK0 A;  3CCM T;  4C92 G;  4LXC A;  3H8Z A;  3UA6 A;  5CKF A;  2LCC A;  2RK1 A;  4J9C A;  2ZCF B;  2HAX A;  2M0Y A;  2DBK A;  2K5I A;  2RH2 A;  1YHQ T;  2H3J A;  2EYZ A;  3UPU A;  3C4S A;  1UHF A;  4ZN1 A;  2RJC A;  1VQ5 T;  1QVG A;  1GFC A;  3QYH B;  3R6N A;  3ULR B;  2FL7 A;  2LVM A;  4J9F A;  2JXB A;  2KE9 A;  1OX9 A;  1AWX A;  3M56 A;  2QA4 Q;  1C6V X;  1H8K A;  3CCL Q;  1WHH A;  2O9V A;  4ZGE B;  3JCM W;  5GAN f;  3EG9 A;  2DYB A;  3CCQ Q;  1JXM A;  3JB9 F;  2ENM A;  4O5V A;  4F7U G;  2ZPH B;  2FEI A;  1IHW A;  1KC8 U;  1TG0 A;  1EIF A;  3VS1 A;  4QVC A;  3OA6 A;  2JUF A;  1BIB A;  4M77 C;  1NPP A;  2VWF A;  3I55 Q;  4LDX A;  3CCR A;  4Z02 A;  1PRL C;  3CCS T;  2DNU A;  1Q82 U;  4WTO B;  1IGU A;  2CP2 A;  2JMC A;  2QQS A;  4Z89 A;  4UC4 A;  4OML A;  3KUF A;  3E9F A;  1VQ4 Q;  2MAM A;  5FW9 A;  4OMO A;  2LQK A;  1RAH B;  1X75 C;  3NTK A;  3FLG A;  1WA7 A;  4N4H A;  2PVO B;  3REA B;  4X9C A;  3P8B B;  5DY9 A;  1N8R R;  1T0H A;  3FJ5 A;  1P92 A;  1RAF B;  3GOX A;  4GY5 A;  5LL6 S;  1MMD A;  4C0D B;  4ORZ A;  2VXE A;  2KVQ G;  3OS0 A;  2SRC A;  3EFO A;  2C0I A;  2RJD A;  1KD1 R;  2NWM A;  2DD5 A;  2P0Q A;  3A1P A;  1YHQ A;  4NS5 A;  2RI5 A;  3M0Q A;  1BI2 A;  3JCM J;  3M0P A;  1QW1 A;  4PJO C;  4E7S A;  2BIV A;  2C0O A;  1VQ5 A;  1M90 C;  3CC7 T;  2BKD N;  1MMN A;  4M75 E;  2DTH A;  4BE0 A;  4DBH A;  4KBM B;  3BDU A;  4ZTF A;  2KRO A;  1R0C B;  4L59 A;  4X9D A;  1VQM Q;  2VVK A;  3HRU A;  1K9M R;  2CZ1 B;  4J9I A;  4IUT A;  4KGZ B;  2XDD A;  1AHJ B;  2EGA A;  1HK9 A;  2DO3 A;  2WSF E;  4HXJ A;  3JCM d;  1UGR B;  1KIK A;  1M8V A;  2HQX A;  4IKF A;  2NLU A;  1ZX6 A;  1OI1 A;  3M59 A;  3P8D A;  5HY6 A;  3SWN C;  3RR6 A;  5KYY B;  1RAA B;  3CD6 Q;  2EFI A;  4M75 B;  4JJD A;  2CZ0 B;  2WSC E;  1Q95 G;  2YT6 A;  1U8R A;  3SFM A;  3L1A A;  1W2B S;  5GMK i;  3QDF A;  4RMO A;  3OY9 A;  4JS4 A;  5A2Q E;  1S72 A;  2OAW A;  3KFV A;  1KJW A;  4L5G A;  3SDZ A;  1I5L A;  1VQO Q;  3CCS A;  4M75 A;  4OVA A;  2QGF B;  5IXB A;  3PIP A;  2CH4 A;  3URG A;  3GLX A;  1I0C A;  2RHI A;  2ED0 A;  1SSH A;  2KRN A;  3EG0 A;  3M54 A;  2HKN A;  1YFN A;  1IZ6 A;  1WPY A;  2RMO A;  2HSE B;  2YUP A;  2YDL A;  1KHI A;  2CSI A;  2CGH A;  5L23 A;  5A0G A;  1YWO A;  5GJW B;  1M90 U;  1M1K R;  2DET A;  4D8D A;  3CCJ Q;  2RQU A;  1KSW A;  3AHU A;  3MP6 A;  2Z0W A;  5DLO A;  3DKM A;  2YLB A;  2ZAE A;  1BU1 A;  1V29 B;  2EKO A;  3JCM e;  1UFF A;  1RAI B;  1UEC A;  3BE3 A;  4A4E A;  2YLC A;  4MML A;  4JZ3 A;  4RTT A;  3MP1 A;  1KK7 A;  2LNV A;  4II1 A;  3GNF B;  4CC2 A;  4HT8 A;  4GBQ A;  3PNW C;  2EYQ A;  4DBR A;  2DTO A;  3L2Z A;  2L89 A;  2P84 A;  4PFP A;  1X27 A;  4J7I A;  1VQN Q;  2C06 A;  4EMH A;  3QBY A;  3UDC A;  2AZV A;  1TXQ A;  2FG0 A;  1VQP T;  5CKH A;  2BZX A;  2X4W A;  2GQV A;  3E19 A;  3VYH B;  3OSS C;  3EHQ A;  1XOV A;  4ELY C;  3I56 Q;  1WHJ A;  2EVR A;  1FMK A;  2EQM A;  3LX7 A;  2OJ2 A;  2D8J A;  1SG5 A;  4C0D C;  1B34 B;  4XTY A;  4Y92 A;  5CIU A;  3C94 A;  3QJ6 A;  2OX7 A;  1YIT T;  5D7U A;  2VKN A;  2J06 A;  3TSW A;  3G7Z A;  5IAY A;  1CKA A;  1G3Y A;  4M7A C;  2X4J A;  1YIJ Q;  2QXF A;  3EAE A;  4J9E A;  4FL6 A;  1O9S A;  1WQW A;  2K2V A;  1B34 A;  2KY9 A;  1W1F A;  5LJ3 d;  1GCQ A;  3CME T;  1QP3 A;  5GMK j;  1WHM A;  2HNI A;  1RLP C;  2J05 A;  3LYI A;  2PVG B;  4Z8A A;  3H0H A;  1QVG P;  1UGS B;  8AT1 B;  3TSZ A;  3MCA B;  9ATC B;  2DIQ A;  3OB9 A;  4DOV A;  4HCK A;  5IHI A;  2XI9 A;  1G5V A;  3MO8 A;  4E7H A;  3TQ7 P;  3EH2 A;  5GAO p;  4RCC A;  3HTR A;  3WXM B;  3MEV A;  3MEA A;  1JBM A;  4AT1 B;  4LDY A;  1FYN A;  2IG0 A;  4DEX A;  2HZY A;  4KUL A;  3OYD A;  4MMK A;  3G4S Q;  2LQ8 A;  2MMP A;  4XU1 A;  4XK8 E;  1U06 A;  1OYX A;  2HBP A;  3RKY A;  4IIO A;  1VQP A;  4ZTJ A;  3NTH A;  1QQJ A;  4M78 C;  2KQW A;  1ABQ A;  1G3T A;  4KGV B;  2AHJ B;  4E7I A;  1GBR A;  3V8K A;  4M75 G;  1JJ2 A;  2W0Z A;  2JW4 A;  3HP9 A;  2X35 A;  5FLX E;  4JS5 A;  1D0X A;  2RJF A;  4OB0 B;  3I9Q A;  1YCY A;  1IHV A;  2HDA A;  4AG1 C;  3HRT A;  1YJ9 T;  4FU6 A;  2K3Y A;  5LJ3 e;  2EJ9 A;  1K73 C;  4FT4 A;  1PNJ A;  4C5E A;  4N4G A;  2FRY A;  3LGF A;  1WDX A;  2M51 A;  4JRI A;  2DER A;  1K9M U;  3VUZ A;  1XJW B;  1K8A R;  4FT2 A;  3CME A;  2MK5 A;  2V8J A;  1TS9 A;  2AK5 A;  2YHT A;  1VQ6 Q;  1XTD A;  4F7U E;  3G71 T;  1YJN T;  1H64 1;  2CP0 A;  4F04 B;  1N5Z A;  2YUQ A;  3RER A;  4D8K A;  1ZSZ B;  1VOM A;  2J6K A;  2KSS A;  3VUB A;  4LD6 A;  2EJG A;  2LT1 A;  1PSF A;  5CO7 A;  2MI6 A;  2EYW A;  3CBO A;  1PSE A;  4PKC C;  5CQY A;  2YRD A;  1KFZ A;  1IRX A;  1D1C A;  5GAN j;  2MCN A;  2FYK A;  3V8L A;  1ZSZ A;  1VYT A;  4J7F A;  1H3H A;  2DXB A;  2JS2 A;  2LJ0 A;  5L8R E;  3CCV Q;  3LGL A;  3EG1 A;  3CC4 T;  3JCM f;  2QQA A;  1ZA1 B;  4MZP A;  2A0F B;  5KH6 A;  3LWI A;  2EQK A;  4RG2 A;  1UB4 A;  4EPC A;  3HRS A;  3CCE Q;  3UA7 A;  1T0J A;  3C0C A;  3M9Q A;  4ME7 A;  1X2Q A;  4EMG A;  1K73 U;  3JB9 I;  1YJ9 A;  2K4Y A;  3OW2 A;  1SPK A;  4OMP A;  4EMK B;  4QQD A;  2QQ9 A;  3LH5 A;  1KQ1 A;  2ZPB B;  2EPD A;  4HCZ A;  3VKI A;  4CC7 A;  4WCI A;  1X6B A;  4R0K A;  1S1N A;  1VYU A;  2RM4 A;  3JCM h;  1VQ9 T;  2D1X A;  3QSU A;  3FC3 A;  1G3W A;  2LX7 A;  4EMK A;  4BI3 A;  1VQL Q;  2VAS A;  2CT3 A;  3CPW S;  3G71 A;  5LJ5 d;  2Y90 A;  2IPO B;  2KGT A;  1YJN A;  2D0N A;  1WHG A;  4M7A F;  3MJX A;  1A0N B;  4ZGJ B;  2CKK A;  1SRL A;  2E12 A;  1JO8 A;  4OB3 B;  2MPX C;  4F17 A;  5GAO n;  1YI2 T;  5FRN A;  1PG5 B;  4MZM A;  1M1G A;  3RIR A;  4N4I A;  3VS6 A;  4OGE A;  4OMQ A;  2M0O A;  2X4Y A;  3V8J A;  1BI0 A;  7AT1 B;  3OYE A;  2RJE A;  2QI2 A;  2F5T X;  1NYG A;  2I0N A;  4C8Q F;  5GAN 6;  4KH0 B;  2HSP A;  5J26 A;  2QEX Q;  3I5R A;  2K3X A;  4IUR A;  2NUP B;  3CC4 A;  1Q81 R;  2KRM A;  4J6W A;  2DKG A;  3GNG A;  1WXT A;  2EYX A;  4C92 C;  2LJ1 A;  4BDY A;  4DA4 A;  3VS2 A;  2DIG A;  3EG2 A;  1AD5 A;  3A5Z B;  1K8A C;  2ECZ A;  2CSQ A;  3H41 A;  2VGM A;  3D7S B;  3G6E T;  4QW2 A;  1Q86 R;  3L2V A;  2MWP A;  5KCH A;  3REB B;  1TOV A;  3EFR A;  2DL4 A;  4HKE A;  3NFC A;  3OYK A;  1KQ2 A;  1BCO A;  3DLM A;  4NL3 A;  5LJ5 e;  1R8O B;  2RF0 A;  1UJ0 A;  2L3S A;  1VQ9 A;  3JCM c;  2RB6 A;  3RMS A;  1Y07 A;  3UF4 A;  2CUB A;  1AZE A;  1GCP A;  3OS2 A;  1FX7 A;  5FU6 C;  1Z9Q A;  2YXY A;  1HD3 A;  4JRQ A;  5EG2 A;  2BZ8 A;  2CUD A;  3EG9 B;  1UGQ B;  3FDR A;  3J81 E;  4AMC A;  1YI2 A;  1ZQ1 A;  1VA7 A;  4R56 A;  2K7A A;  3CXC S;  2LJ3 A;  1EFN A;  3AT1 B;  4C5I A;  1QVF S;  1TUG B;  4KH1 B;  2RQT A;  5FU7 B;  2CP3 A;  1TUC A;  1SHG A;  2K79 A;  3DB3 A;  2KRS A;  2A7Y A;  4C5G A;  4J9H A;  3JB9 D;  4RCB A;  5LJ3 h;  1JJ2 P;  3CCU T;  3CCR Q;  2VV5 A;  2HQE A;  1B7T A;  2A3L A;  4MDX A;  2CRE A;  1K8A U;  1WFW A;  3VJP A;  1O75 A; 
#chains in the Genus database with same CATH homology
 2PTK A;  4J9B A;  1WXU A;  2CSI A;  4LN2 A;  1ARK A;  4HVU A;  4CC4 B;  5L23 A;  2NUZ A;  2YUN A;  1YWO A;  2KR3 A;  5GJW B;  1H92 A;  4FSS A;  4D8D A;  2RQU A;  1KSW A;  3UAT A;  1HJD A;  1BK2 A;  1BU1 A;  1YP5 A;  1ZSG A;  2MIO A;  3IQL A;  2A28 A;  2DJQ A;  2CH4 W;  3VS5 A;  1UFF A;  1UEC A;  4J9G A;  3U23 A;  3EG3 A;  4RTY A;  4JZ3 A;  4RTT A;  5FWB A;  4CC2 A;  2KBT A;  4GBQ A;  2CT4 A;  2W10 A;  1GL5 A;  3PVL A;  1TUD A;  2PZ1 A;  1WIE A;  1JXO A;  1T3L A;  1U5S A;  1Y0M A;  1UJY A;  1W6X A;  1X27 A;  1GRI A;  1MUZ A;  2LQN A;  3M0T A;  2O2O A;  2EW3 A;  2A36 A;  2AZV A;  1X2K A;  2FG0 A;  2DA9 A;  2BZX A;  2X3X D;  4QT7 A;  2O31 A;  3EHQ A;  1QKX A;  1XOV A;  3SHW A;  2LQW A;  1PWT A;  5IH2 A;  1YNZ A;  2BZY A;  1AWJ A;  1UTI A;  2DIL A;  1M30 A;  3ZL7 C;  2EVR A;  1I07 A;  2F2V A;  1FMK A;  2D8H A;  2GNC A;  1E7O A;  2OJ2 A;  2D8J A;  1UE9 A;  4Y92 A;  4OMM A;  2L3Q A;  4EIK A;  2DL7 A;  1B07 A;  1GCQ C;  3NGP A;  2KXC A;  4KRT A;  1MV0 B;  1WI7 A;  2VKN A;  1PKT A;  2J06 A;  1OPK A;  3TSW A;  1CKA A;  1X43 A;  1QKW A;  4LNP A;  2DRK A;  2RPN A;  4F14 A;  5ECA A;  1B3Q A;  1RUW A;  4J9E A;  2GQI A;  1W1F A;  2L2P A;  2KT1 A;  1GCQ A;  2SEM A;  2FPF A;  1GFD A;  2HBW A;  1NG2 A;  1RLP C;  2J05 A;  4Z8A A;  1K1Z A;  3H0H A;  4HVV A;  3TSZ A;  1AEY A;  1Y57 A;  4HCK A;  2JS0 A;  5IHI A;  1K0X A;  2KT8 A;  1PRM C;  4RUG A;  1ABO A;  2LMJ A;  1OV3 A;  1YN8 A;  2GGR A;  1E6H A;  4ESR A;  4J9D A;  4AG2 C;  2EGC A;  1FYN A;  1M3A A;  2K9G A;  4DEX A;  4IIM A;  2YUO A;  4Z88 A;  1U06 A;  1NEG A;  1K76 A;  1M27 C;  2B86 A;  2C0T A;  3M0U A;  4IIO A;  2KEA A;  1UUE A;  3A98 A;  2YSQ A;  1I1J A;  5I11 A;  3I5S A;  2ROL A;  3VS3 A;  1ABQ A;  2FPE A;  1GBR A;  2L0A A;  2W0Z A;  2JW4 A;  2P4R A;  3TVT A;  2HEQ A;  2K2M A;  1AOJ A;  3I9Q A;  2A08 A;  2K6D A;  2HDA A;  4A63 B;  4AG1 C;  1NEB A;  1CKB A;  1WX6 A;  2EKH A;  1PNJ A;  1VYV A;  1K9A A;  1X6G A;  5IHN A;  2FRY A;  2J7I A;  3H0I A;  1WDX A;  2H8H A;  2M51 A;  2EBP A;  3I35 A;  5IHK A;  4LUD A;  2DVJ A;  1QLY A;  3EHR A;  1HSQ A;  4DEY A;  5IXF A;  2QDL A;  2AK5 A;  2FO0 A;  2JT4 A;  2O88 A;  4RTX A;  2LNH B;  4AFQ C;  1N5Z A;  2YUQ A;  4JJC A;  4D8K A;  3O5Z A;  4GLM A;  4AFS C;  3PE0 A;  4CC3 A;  3CQT A;  1NM7 A;  1AZG B;  3GBQ A;  4HVW A;  3VRZ A;  2J6K A;  1M3C A;  2DBM A;  2EGE A;  2J6O A;  2KNB B;  2X3W D;  2JMA A;  4RTU A;  2LP5 A;  1U3O A;  2EYW A;  4X1V A;  1BBZ A;  1JEG A;  2IIM A;  2GTO A;  1KFZ A;  2DL3 A;  2DLP A;  2DL5 A;  2DMO A;  1UDL A;  2L3P A;  3NPF A;  2MCN A;  1G2B A;  3M0R A;  1ZLM A;  2FRW A;  4LE9 A;  4RTV A;  1WXB A;  1VYT A;  5FWC A;  1H3H A;  2EYY A;  2JM8 A;  3VS0 A;  2JS2 A;  2LJ0 A;  1SEM A;  1RI9 A;  1YCS B;  1K4U S;  1OPL A;  3NMZ C;  1ZUY A;  1E6G A;  3EG1 A;  2DX1 A;  3UA6 A;  1X69 A;  2AKL A;  4J9C A;  2FPD A;  2RN8 A;  2GTJ A;  1SRM A;  4K11 A;  2V1R A;  2M0Y A;  2HCK A;  2DBK A;  3UA7 A;  2DE0 X;  2GBQ A;  1T0J A;  3C0C A;  2EYZ A;  5EC7 A;  1UHF A;  2F2X A;  1WLP B;  1X2Q A;  1M3B A;  1PKS A;  2KYB A;  1SPK A;  1GFC A;  3RBB B;  4OMP A;  1UHC A;  3R6N A;  3ULR B;  1ZUU A;  3LH5 A;  1NLP C;  4J9F A;  2JXB A;  2KE9 A;  1AWX A;  2AKK A;  4JZ4 A;  2EPD A;  1H8K A;  3JV3 A;  4CC7 A;  4WCI A;  2O9V A;  3VS7 A;  1X6B A;  4ZNX A;  4R0K A;  1S1N A;  1VYU A;  2DM1 A;  1M8M A;  1OEB A;  2DYB A;  2D1X A;  2MOX A;  2LX7 A;  1JXM A;  5GJV B;  1G83 A;  2ENM A;  2CT3 A;  1CSK A;  1OOT A;  3RNJ A;  2EQI A;  2FEI A;  2KGT A;  3SEM A;  1TG0 A;  2D0N A;  3VS1 A;  4M4Z A;  1A0N B;  1SRL A;  3VRY A;  2BTT A;  1JO8 A;  1JU5 C;  2VWF A;  4F17 A;  1PRL C;  2ED1 A;  2A37 A;  2DNU A;  2XMF A;  4JJB A;  3VS6 A;  4OMQ A;  2JMC A;  4Z89 A;  2DF6 A;  4OML A;  4F16 A;  5FW9 A;  4OMO A;  3PVQ A;  2KXD A;  1QWE A;  2RQW A;  1NYG A;  2CDT A;  2I0N A;  1WA7 A;  3REA B;  2HSP A;  2RNA A;  3EGU A;  1T0H A;  3FJ5 A;  3I5R A;  1PHT A;  2ABL A;  2PNI A;  2KRM A;  2LCS A;  1SHF A;  1WXT A;  2AZS A;  2EYX A;  2E5K A;  2LJ1 A;  4ORZ A;  3VS2 A;  1V1C A;  2SRC A;  2C0I A;  3EG2 A;  3VS4 A;  2NWM A;  1AD5 A;  2ECZ A;  1AVZ C;  2CSQ A;  3H41 A;  3M0Q A;  4OMN A;  3M0P A;  1NLO C;  2ROT A;  1YWP A;  2ESW A;  2C0O A;  3REB B;  3NHN A;  2RQR A;  1UG1 A;  2DL4 A;  2KRO A;  2JTE A;  2VVK A;  4J9I A;  2EGA A;  1AWO A;  2RF0 A;  1UJ0 A;  4HXJ A;  2J6F A;  1QWF A;  1KIK A;  2L3S A;  1ZX6 A;  3H0F A;  5HCK A;  1LCK A;  1WYX A;  3UF4 A;  2CUB A;  1RLQ C;  1GCP A;  1AZE A;  2G6F X;  4AFU C;  1ZBJ A;  1UGV A;  1GBQ A;  4JJD A;  1Z9Q A;  4AFZ C;  2YT6 A;  1HD3 A;  2BZ8 A;  2CUD A;  1Z9Z A;  1QCF A;  1AWW A;  3M0S A;  2OAW A;  1VA7 A;  3KFV A;  1KJW A;  1K0S A;  2K7A A;  2LJ3 A;  1EFN A;  1J3T A;  4JPB W;  4LUE A;  2RQV A;  5IXB A;  2K3B A;  1T3S A;  2DL8 A;  2RQT A;  4E6R A;  2CH4 A;  2LZ6 B;  1TUC A;  3QWY A;  1SHG A;  2K79 A;  1I0C A;  3QWX X;  4RTZ A;  5I22 A;  2ED0 A;  1SSH A;  2KRN A;  2KRS A;  3EG0 A;  1JQQ A;  2O9S A;  2JM9 A;  4J9H A;  4RTW A;  3THK A;  1ZUK A;  2RMO A;  1BB9 A;  2DRM A;  1NYF A;  1MV3 A;  2F2W A;  2OI3 A;  2V1Q A;  2KYM A;  2YUP A;  2YDL A;  2CRE A;  1IO6 A;  1WFW A;  1W70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...