2DM1A

Solution structure of the second sh3 domain of human protein vav-2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
GSSGSSGGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein vav-2
publication title Solution structure of the second SH3 domain of human protein vav-2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dm1A00
2RPNA 2FRWA 1CSKA 2ENMA 4JJDA 1SEMA 2EYZA 3KFVA 2LMJA 3H0HA 4Z88A 2EW3A 1T0HA 1UDLA 1PKTA 1QWEA 1QKXA 2KNBB 2RQVA 2YUNA 2JW4A 4HVUA 2K6DA 2ESWA 1H3HA 1AWWA 4D8KA 2AKKA 4JJBA 1X69A 2LX7A 3PVLA 4OMMA 2NWMA 1B07A 2LQWA 3M0PA 2HBWA 1MV3A 2W10A 2FG0A 1KFZA 4DEYA 4RTZA 2ABLA 2CSQA 2JM9A 2LJ3A 1GCPA 1W70A 2EBPA 2O88A 4AG1C 2HDAA 3VS0A 4LE9A 5L23A 4LUEA 1JU5C 1AOJA 1ABQA 1WI7A 2OAWA 2J05A 4J9BA 1GL5A 2H8HA 1OEBA 4RTXA 1XOVA 2CUBA 1H8KA 2FEIA 4R0KA 2GTOA 3VS6A 2OI3A 3M0RA 2FO0A 2JS2A 3M0UA 1G2BA 2KR3A 3NMZC 4AFSC 3VS5A 1AZGB 2DE0X 1QWFA 1YNZA 2YUOA 5I11A 1PRLC 2KXCA 1U5SA 1NLOC 4CC4B 1AWJA 1UJ0A 1BB9A 3QWXX 1UGVA 1QLYA 2EVRA 2K3BA 2J06A 2EYWA 2B86A 2A36A 2L3QA 1UHFA 1T3SA 2KXDA 4HXJA 5IXBA 2MIOA 1K9AA 3THKA 3RNJA 2A28A 2D8HA 1GBQA 2V1RA 1WDXA 2ROTA 1BU1A 4X1VA 2X3XD 2DBKA 1YWPA 2DILA 3C0CA 1RLQC 3TSWA 1X2QA 4K11A 1SHFA 2EGAA 3VS4A 2M51A 4JZ4A 2ROLA 1UE9A 1EFNA 1ZUYA 1SSHA 3VRYA 1E6HA 2DRMA 1Z9QA 1NEGA 2RNAA 4LUDA 2K9GA 2GNCA 1U3OA 2KT8A 1PKSA 1X2KA 1M3AA 2DJQA 1PRMC 3VS1A 2F2WA 4AG2C 2DX1A 3H41A 2A08A 3PE0A 4ZNXA 1YP5A 4AFUC 1Y57A 4AFZC 3UA6A 2CT4A 2KBTA 4LNPA 2HSPA 2RF0A 1TUDA 2J6FA 1WIEA 2AK5A 2EYXA 1GFDA 1KSWA 4IIMA 3EG0A 2RQUA 5ECAA 3EHQA 2SEMA 1NLPC 2JMCA 4OMPA 3LH5A 4D8DA 3NHNA 2L3SA 2JMAA 2O31A 1RLPC 1U06A 2K2MA 1PWTA 1UJYA 1G83A 2DLPA 4OMQA 4Y92A 3I35A 2I0NA 3I5SA 1M3CA 1VYUA 2KRMA 2OJ2A 2EGEA 2KROA 1Z9ZA 3UATA 3VRZA 2C0OA 1K0SA 2CSIA 2CT3A 4J9IA 4JZ3A 1W1FA 2RQTA 4CC3A 2RQWA 2YSQA 1TUCA 2DNUA 1X27A 2VWFA 2JS0A 2DA9A 3M0TA 2DL4A 1OPLA 1AEYA 3JV3A 3H0FA 2EGCA 1HSQA 1M3BA 1X6BA 2CREA 4HVWA 2V1QA 4J9FA 1UHCA 1WA7A 2CUDA 3M0SA 1KIKA 2HEQA 1ZUKA 1S1NA 1VYTA 3NGPA 2GTJA 4KRTA 3M0QA 3GBQA 2FPDA 2M0YA 2JXBA 4J9CA 3ZL7C 2YDLA 2A37A 2JM8A 1X43A 1AZEA 1FMKA 1I1JA 4F16A 2FPFA 2LJ1A 4F14A 3IQLA 5FW9A 2D8JA 3EGUA 2J6OA 3VS7A 2DF6A 1ZSGA 2K7AA 1WLPB 1OPKA 1GBRA 2DBMA 4A63B 2X3WD 4IIOA 1NEBA 1SRLA 2VVKA 1QKWA 1WXTA 2GBQA 1A0NB 1E7OA 1KJWA 1CKAA 1K1ZA 2JTEA 1T3LA 2PNIA 4GLMA 1UECA 3H0IA 2LCSA 1NYGA 4WCIA 2GQIA 1YN8A 2F2VA 1AD5A 2DMOA 1M30A 3UA7A 1GCQA 2J7IA 2LP5A 4CC2A 1T0JA 1UTIA 2AKLA 2KRSA 5GJVB 2FRYA 2FPEA 1X6GA 2O9SA 1JQQA 3SEMA 2DL7A 1AVZC 1I07A 1LCKA 3EG2A 1JEGA 2DRKA 2L2PA 1AWXA 2P4RA 4E6RA 1N5ZA 4F17A 1WFWA 1CKBA 4QT7A 1ZX6A 2BZYA 4J9DA 2RN8A 1RUWA 2RMOA 4Z89A 2KGTA 3QWYA 1ABOA 1B3QA 3TVTA 2C0TA 4RTWA 2QDLA 4DEXA 2BTTA 5IXFA 2MCNA 1JXMA 2XMFA 5GJWB 3ULRB 4ESRA 4Z8AA 2C0IA 1E6GA 4ORZA 3SHWA 2JT4A 1SPKA 5IHKA 5FWCA 1YCSB 1Y0MA 1J3TA 1M8MA 2E5KA 1MV0B 3I5RA 1GRIA 2KYBA 3VS2A 4LN2A 4J9GA 2EPDA 2EQIA 1NM7A 2O2OA 4RTTA 3A98A 5FWBA 1RI9A 1VA7A 1WYXA 2CH4A 2G6FX 1PNJA 2GGRA 3VS3A 3UF4A 3PVQA 2CH4W 2DYBA 2LQNA 3EG1A 1ZLMA 1OOTA 2BZXA 2SRCA 2D0NA 3R6NA 3O5ZA 2ED0A 2EKHA 2W0ZA 1MUZA 1SHGA 2HCKA 4HCKA 3EHRA 1AWOA 2K79A 2L3PA 1IO6A 2PZ1A 3RBBB 1V1CA 2L0AA 4RUGA 2KEAA 1SRMA 3CQTA 2KT1A 1HD3A 1VYVA 2CDTA 1ZBJA 1PHTA 4M4ZA 1HJDA 3REAB 4RTVA 1UG1A 1ARKA 5I22A 1I0CA 3TSZA 5IHIA 2VKNA 2AZVA 2LJ0A 2BZ8A 3NPFA 5IHNA 3REBB 1TG0A 1WXBA 1QCFA 4J9HA 2DL3A 2MOXA 4FSSA 1W6XA 5EC7A 4RTUA 5HCKA 1WX6A 4EIKA 1FYNA 2LNHB 2EYYA 2F2XA 1OV3A 5IH2A 1GCQC 1WXUA 2LZ6B 4J9EA 2ED1A 2RQRA 2O9VA 1K4US 1M27C 1K76A 2YT6A 2IIMA 1BBZA 2ECZA 1JXOA 3FJ5A 2YUPA 2AZSA 1UUEA 2PTKA 1NYFA 1ZUUA 2YUQA 3I9QA 4GBQA 2KYMA 4CC7A 4HVVA 1NG2A 2KRNA 2D1XA 2J6KA 2DL8A 4RTYA 1JO8A 2DL5A 3U23A 2KE9A 3EG3A 4AFQC 1K0XA 1YWOA 2DM1A 1BK2A 1H92A 4OMOA 1GFCA 1UFFA 4OMNA 2DVJA 2NUZA 4OMLA 4JPBW 4JJCA
chains in the Genus database with same CATH superfamily
4JJDA 4KUDK 2GFAA 1RABB 2HL5C 2LMJA 4Z88A 2Y4YA 4C92C 1QWEA 2E70A 1PD0A 1Q86R 3PMIA 3S3MA 3RR6A 2JW4A 2K6DA 1H3HA 3MEAA 1M1KC 3I56A 3FJPA 2NWMA 4J8OA 4PFPA 1TS9A 1WHKA 4PNOA 4ZTFA 2LQWA 3M0PA 2DZ9A 2W10A 4DEYA 4E7LA 4FYWB 1RI0A 2P0PA 4OB0B 2CS7A 3CBOA 5I21A 3CMAA 2RA2A 2HDAA 3LX7A 4M75C 3RESA 2OAWA 1WI7A 3M58A 1VQ6Q 1N6AA 1PSFA 2H8HA 4M78D 1I4K1 3VS6A 2DO3A 2OAUA 2K5FA 3M0RA 2JS2A 5GAOp 2JN0A 4M77D 6AT1B 1XQHA 1AZGB 4HCBA 3CMEA 3RERA 2MMPA 4RCCA 2H3JA 4FL6A 1QQJA 3AHUA 1U5SA 1NLOC 4M7AG 1QVFS 1BB9A 1UGVA 4MZPA 5GANg 4OB1B 2E6NA 5KYWA 2DK3A 2RI2A 1T3SA 4HXJA 2RH2A 5IXBA 1K9AA 3HL8A 1WZOA 3JSCA 1WDXA 2Y90A 3QPHA 2X3XD 3O8VA 4C0GA 1YWPA 1M9SA 2DILA 3H6ZA 1RLQC 3G7ZA 2V26A 2EGAA 4JZ4A 1M1FA 1UE9A 2YLCA 1ZUYA 4M7AC 1SSHA 1NEGA 2MWOA 2GNCA 1U3OA 1VOMA 2KT8A 2ZAEA 1PKSA 1LJOA 3BW1A 5LJ3h 1VQPT 1M3AA 4XTZA 1G8XA 5DLOA 3VS1A 3DLLA 4AG2C 2HKQB 4ZNXA 4AFUC 1YP5A 1HXDA 2E5QA 5AYFA 1M1KR 1WHGA 2RF0A 3Q1JA 3CCJA 4F7UA 2V8JA 5I2SA 2LDMA 3EG0A 3S6WA 1YJNQ 2LTOA 1W2BS 3G4SQ 1N27A 4JRQA 4PJMA 4C92F 2JMAA 2O31A 4F7UE 3SD4A 1VQ9A 2DD5A 2K2MA 3EGXA 1UJYA 1G3TA 3OW2A 3QUIA 1ZA2B 4OMQA 2EGEA 2KY9A 2C0OA 1K0SA 3BDLA 1D1CA 3PTAA 3CXCA 2CT3A 4J9IA 4JZ3A 3ZEHA 2A0FB 2YSQA 3M56A 2DNUA 2VWFA 1U8RA 4RCBA 2DA9A 5GMKi 2DL4A 1OPLA 1OZ3A 1VQ6T 1AEYA 1HSQA 2CREA 1MNEA 2E1HA 2DD4A 4HVWA 3JB9H 4J9FA 4M75F 4ZGDB 1N8RC 1WA7A 2CUDA 2F1LA 2OTJA 3M0SA 2HEQA 4PJOA 2R5AA 3CMAQ 3NGPA 5LJ5j 3M0QA 5IT9E 4J9CA 3CBPA 3ZL7C 2YDLA 2YRDA 1HK9A 2EQJA 4IUPA 2QGFB 2D8JA 4GLKA 1IGUA 2LQ8A 4Y28E 3CCEA 5CQYA 3OYYA 4J7FA 1VQKA 2RO0A 3CCUT 4J83A 2C06A 4IIOA 2VVKA 3CMEQ 1QKWA 1WJQA 3MHXA 1CKAA 4FT4A 1MGQA 2VUBA 3QJYA 1R77A 3VV0A 8ATCB 4ATOA 5KYUA 4Y91A 1YHQT 1YN8A 4JJNK 2PVGB 1AD5A 3JAME 2J7IA 1PD1A 2FRYA 2FPEA 2XIDA 1PG5B 1Q81R 3SEMA 3GIBA 1WPYA 1D0XA 1RAEB 1LCKA 3EG2A 4E6RA 1V76A 1SF9A 3CCSA 2CP0A 4F7UF 1ZSZA 1ZX6A 5CK9A 4M7AB 4Z89A 1D0YA 3QWYA 1AT1B 1RL2A 4A4KA 1Y96B 3OBYA 2QDLA 3JCMe 1S72A 3OS2A 4B6MA 2QYZA 1YI2T 2RI3A 4WTOB 2MCNA 2K5IA 1YFNA 3ER0A 2RJDA 2JZ2A 3ULRB 1K73U 5LJ5e 1E6GA 4ORZA 3CCJQ 2HQHA 3OMGA 1YCSB 4C5IA 1QCOA 3OYHA 4BUGA 5KYXA 3V7RA 2CP6A 3OA6A 4J9GA 3RKYA 4C8QG 2EQIA 1NM7A 3I56T 2YRVA 5FWBA 2CP5A 2G6FX 1PNJA 3VS3A 3HP9A 3PVQA 4M7DG 4OP0A 2DYBA 1MMNA 3EG1A 4PJOF 2GQVA 2VYTA 1VQOA 2BE7D 5D6YA 1BCOA 5GAN4 3J80E 4L59A 3CMAT 1MUZA 1AWOA 2QTVA 1RACB 1V1CA 2XU8A 1D0ZA 4RUGA 2X4XA 2KEAA 3OYKA 3L2WA 3WVEB 3ZFJA 3DLMA 1HJDA 3REAB 5KYNA 1VQNT 2L5QA 5KCHA 2R5MA 1UG1A 3ZBDA 5GAMj 4O6JA 1NJIC 3E19A 3TSZA 3CMET 2QA4Q 2VKNA 1M8VA 2ZCFB 1G3WA 1VQ5A 1X6OA 2LJ0A 1QVGS 3LLRA 1WXBA 5CKFA 1D09B 1NZ9A 4M77A 4J6YA 2RM4A 3C94A 3PIOA 1JJ2S 1D1BA 2X9HA 3CCEQ 2XICA 4QQGA 4BY6C 5GAN3 2F2XA 4M7AD 2HQEA 3QYHB 3CC4A 1GCQC 2XHCA 3JCMX 1WXUA 2ZGWA 4IUQA 5LJ3d 1K4US 2KQWA 3G71A 2KMTA 1JXOA 3FJ5A 2BIVA 1UUEA 3FC3A 5CKEA 2CYZB 3LW5E 2KRNA 2D1XA 2HQXA 4RTYA 3QYGB 1JO8A 1QVFA 3U23A 2QXFA 3HFNA 3EG3A 2RK1A 2NUPB 1QP3A 3OYLA 3SWNA 1UGPB 1ZHIA 4OMOA 1GFCA 2FB7A 4OMNA 1BIBA 4FYVB 2RHXA 3CCSQ 2RPNA 2FRWA 2EYZA 3H0HA 3JCMh 3CCLT 5FLXE 1T0HA 1UDLA 3X24B 2EAYA 3R6OA 2KNBB 4HT8A 2QQRA 2RQVA 4KULA 4PFOA 5FU6C 5LJ3j 3JCMb 1MMAA 1VQ9T 3PVLA 1RAGB 5GAMe 4A53A 1B07A 3OYGA 1IRXA 4XK8E 1KFZA 2QEXA 4KGVB 1OULA 4A4EA 5FU7C 4RTZA 2A7YA 2CSQA 2JM9A 2LJ3A 3RMSA 3OYBA 1DJ7B 3LWIA 2EBPA 2DTOA 1TOVA 3X26B 4RKUE 1GL5A 1NJIR 1XOVA 3QJ6A 3VUZA 2FEIA 2GTOA 1FXXA 2XD0A 2OI3A 4IUVA 2FO0A 2OTJT 4M78F 1G2BA 3NMZC 3QKJA 4AFSC 3JCMf 3MP1A 1QWFA 4FW1A 4O5VA 1YJWA 2YUOA 4M77F 1YITA 2QQBA 1VQ4T 5LJ5f 2RK2A 4EPCA 2RB6A 1N9SA 1AWJA 2F5TX 1UJ0A 1D3BB 1BI1A 3QG1A 5IN1A 4ZGEB 5DY9A 5A0DA 3CCET 2EVRA 1YHQA 2K3BA 3M59A 4M7DB 2J06A 1K8AU 2EYWA 3JB9G 1VQKT 2B86A 1UHFA 1WJSA 2KXDA 1MMDA 2YHTA 2D8HA 3AT1B 2DPPB 1GBQA 5GAN6 2LVMA 4X1VA 1M5Q1 2QI2A 5CVIA 3C0CA 2EJGA 5KE2A 2EQMA 4K11A 2M51A 3HKSA 2EQUA 3VRYA 3JCMc 4BI4A 1Z9QA 2RNAA 4QW2A 5CKDA 4J6XA 5HK3A 2PUOB 1X2KA 2DJQA 4KH1B 1PRMC 3QXEB 3LYIA 4RG8A 2F2WA 3H41A 3OYCA 3CCST 2A08A 2R58A 2OTLA 4BB7A 3CC2A 4LNPA 4LD9K 2P0QA 4E7IA 4UC4A 3JRZA 1KHCA 4AMCA 2RQUA 5ECAA 5GAOm 1S72T 2M0OA 1P92A 2DXCA 3HSBA 2VB6A 1U06A 4EMHA 1PWTA 2NLUA 1PCXA 4C92A 3C4SA 1VYUA 2BUDA 2KRMA 2KROA 4HKEA 2YLBA 5GAMh 2CSIA 2DETA 4C92E 1W1FA 2PUKB 2RQTA 1PM3A 4CC3A 4C0DB 3OW2P 2ZPGB 1W4SA 4N4HA 5FU6B 3OYAA 2B8AA 3M0TA 4X34A 1K9MU 2EGCA 3HHTB 4C8QD 5FRMA 4FSXA 3CXCP 4ELYC 4BDYA 3CC7A 1VQOT 2RI5A 2RHUA 2XI9A 1MNDA 4M7DD 2X4JA 1S1NA 1VQNA 1VYTA 5FU7B 4M75A 2GTJA 1VQMA 3UPUA 3GBQA 2K2VA 2O01E 4TVRA 1NPPA 4OB3B 2JXBA 2CZ0B 4AT1B 4DBFA 2JM8A 2QASA 3M53A 4M75E 1I1JA 2LJ1A 4F14A 3IQLA 2VGMA 3ME9A 1K73R 3A8HB 1KC8U 3EGDA 2DF6A 2K7AA 1TU0B 7AT1B 2D9TA 1KD1U 1GBRA 2DBMA 4A63B 3CCUQ 2GBQA 1VQ5T 5L8RE 1K1ZA 2HMAA 4MZTA 2JTEA 2PNIA 5GAOq 1WQ7A 3J7AF 1NYGA 3WXMB 1YIJA 1YHQQ 1FWZA 4BE2A 2DMOA 3UA7A 4F7UG 3CC4T 3META 4XU1A 1UTIA 4CC2A 1M2VB 5GJVB 4D6WA 2O9SA 3G71T 2COYA 1JQQA 1AVZC 2DRKA 2L2PA 1X01A 4II1A 2V8IA 1QVGA 2EQKA 4C5EA 3V8KA 3A8LB 1M90U 3SDZA 3JCMd 3G6ET 1Q81C 1C1AA 1Y96A 3CCLA 1JJ2A 2RMOA 5LJ5d 5GANh 2KK4A 1B3QA 2JUFA 3TVTA 1ZA1B 1G3SA 4CRIA 4DEXA 3EG9B 3BDUA 4OVAA 1YI2Q 1JXMA 5GJWB 2A3LA 3A8GB 4IUUA 4Z8AA 2C0IA 2RHIA 3SHWA 2JT4A 1SPKA 5IHKA 1TWBA 5DM7R 1Y0MA 4LDYA 3WVDB 3RUXA 1GRIA 2AHJB 3VS2A 4LN2A 3CCMA 4XTVA 4L6V5 2O2OA 3GNFB 5C6SA 3I56Q 5CIUA 1WYXA 2CH4A 2GGRA 2CZ1B 2JJ9A 5LJ3f 2GFUA 2QEXT 2NYSA 2SRCA 2D0NA 2XDBA 1SHGA 2GCXA 1XJWB 3EHRA 1R0CB 2L3PA 4LDUA 1R8OB 3N5BB 3JCMV 2VXFA 1VQ4A 4PJOE 2L0AA 2YWWA 4A4FA 3BE3A 3BY7A 1F1BB 1VQ8A 1SRMA 1KQ2A 2KT1A 2CDTA 1PHTA 5GMKm 2FHDA 1C0MA 5CKBA 1VQNQ 4FT2A 1VQMQ 3CPWS 2QGGA 2LRQA 4EDUA 1YJWT 1YITT 2FVUA 1JRIA 1TG0A 1QCFA 3FDRA 2DL3A 4FSSA 2E12A 3JB9J 4EIKA 1KQSA 4N4GA 3CCVT 2CP3A 2LNHB 3I55A 2DEUA 3G1JA 1HYOA 1YJ9A 2LZ6B 2KSSA 4J9EA 2RQRA 1H3ZA 2LX9A 2O9VA 5A0LA 3FEOA 4OMFB 4M7AF 3KBGA 1BBZA 2ECZA 1BYMA 3JB9D 4E7HA 2PTKA 1IGQA 1NYFA 2YUQA 2DIQA 3RDVA 2NUPA 2FZKB 3VUBA 1MMGA 5CCAA 2KE9A 5AT1B 1K0XA 1K9MC 1OU8A 1BK2A 1H92A 1EIFA 2BE9B 1OU9A 1UFFA 2RJCA 4OMLA 2HBPA 3V8LA 1QVFP 2CP2A 2OTLT 3CC2T 2L89A 3M9QA 3EAEA 1SEMA 3KFVA 3RKWA 2EWNA 1WNLA 2EW3A 3CCLQ 1UGRB 4OGCA 1PKTA 2MYSA 1G3YA 5GAMd 4R55A 2YUNA 2ZPFB 1Y07A 4N4IA 2DJZA 2ESWA 2RJEA 2QG9B 1AWWA 2AKKA 4JJBA 3OYNA 4HA8A 1X69A 1VQ9Q 2LX7A 4OMMA 1QCNA 2E6ZA 4EMKA 3CEYA 1MV3A 3OYMA 1I5OB 2FG0A 3EGXB 2VV5A 4MMKA 2ABLA 1VIEA 2RJFA 2HNIA 2MAMA 3OYFA 4AG1C 1KK7A 3VU3C 3VS0A 5L23A 1JU5C 3QHSA 1ABQA 4C8QC 2J05A 4RTXA 3CC7T 4KH0B 4R0KA 3PFSA 4M7DC 2OTJQ 1LNXA 2KR3A 1BKBA 2E3IA 1OX9A 5KCOA 1VQMT 1W2BP 2CP7A 2LNVA 1YNZA 4M78A 2HSEB 2LC4A 4BE0A 3JCMQ 3L2ZA 1WHLA 1PRLC 2EIFA 4E47A 1OYXA 2KXCA 1VQ4Q 4DOVA 4F04B 2GF7A 1M1KU 3QWXX 1QLYA 4M78E 2HZYA 4RMOA 2KAFA 3P8HA 5KYYA 2JNGA 1VQKQ 1TSFA 2A36A 4JUVA 2L3QA 2XK0A 4M77E 3E9FA 1B7TA 1ZQ1A 2COWA 2YXYA 2HD0A 3NFCA 3THKA 2KDSA 3RNJA 2MWPA 3EFOA 5GAN2 1FMVA 2V1RA 1BU1A 2DBKA 5LJ5g 3TSWA 1K9MR 1X2QA 2KVQG 3HRSA 3VS4A 2Y4XA 1YIJT 1EZZB 4BACA 3KUFA 1EFNA 1E6HA 2DRMA 2FYKA 3OYEA 5GAN5 1QMCA 4R56A 3G6EA 1AHJB 4PL6A 4XTUA 4N0AC 5IAYA 3QZ5B 1KQ1A 4JLIA 3P8BB 4PJJA 3CPFA 2DX1A 2ZPEB 3M54A 3PE0A 1Q7YU 1Y57A 1IB8A 3URGA 4C0ZA 3CBMA 2HSPA 1KC8R 1TUDA 2J6FA 1WIEA 2EYXA 2XDPA 1GFDA 3X20B 2CZ6B 1KD1R 2CZ7B 4FYXB 2NUTB 4C0DC 4MDWA 3EHQA 2QQAA 3VYGA 2BKDN 1XTDA 2SEMA 2DERA 2IG0A 3FLGA 5FROA 1JBMA 1S72Q 4D8DA 1M2OA 3NHNA 2I2LA 2K5LA 3OS1A 2DLPA 4Y92A 3I35A 1M3CA 5D6WA 4IUTA 1N9RA 3OS5A 1FMWA 1LVKA 1Z9ZA 3UATA 3VRZA 3CCMT 4PKCC 3OBWA 4PJNA 2RQWA 3OYDA 5GANj 2QTXA 2MPXC 3JV3A 3H0FA 4DA4A 5GAOr 1M3BA 1KQSS 1VQOQ 3LGLA 1M90R 1FX7A 2FL7A 1KIKA 4LDWA 2X4YA 2FPDA 4M7DF 2M0YA 3A8MB 1AZEA 1VQ8T 2WACA 4C8QB 1FMKA 4F16A 3SFMA 2EJFA 5FW9A 4FM4B 2VXEA 4FIBA 4KGZB 3L2QA 4FCYA 3EGUA 1B34B 3A1PA 3VS7A 4E7ZA 3CCVA 1WLPB 1OPKA 2P4TA 2X3WD 2MK5A 1RAFB 3INZA 1WXTA 1VQ5Q 1A0NB 1E7OA 1KJWA 3VKIA 3KXTA 2M9UA 2DYIA 1K73C 4E7KA 2DXTA 1UECA 2YRCA 5HY6A 3H0IA 1R0BG 4WCIA 2ZPBB 1M2VA 4OB2B 3EFRA 3GLXA 1M30A 3I55T 3LH0A 1MHNA 1RAAB 4LD6A 3CC4Q 2LP5A 1WHHA 1T0JA 2AKLA 2KRSA 1YJ9T 4X9CA 1VUBA 4JRIA 1N8RU 1X6GA 3G71Q 2DL7A 4XTXA 3QIIA 8AT1B 3FB9A 4FU6A 3CPWA 3BFMA 2HKNA 2P4RA 4C92G 1WFWA 3UT1A 3G6EQ 5GANe 4GY5A 4J9DA 3NTIA 5A2QE 4PFZA 5D7UA 2KGTA 5HK0A 1YJNA 1QVGP 3G4SA 2C0TA 1D1AA 5IXFA 3MKDA 4KBMB 1JJ2P 2X35A 1KHIA 3L2RA 2EYQA 1YBYA 5GMKe 1BCMA 2RHYA 1PSEA 4KUIA 4M75G 2VASA 2EPDA 4RTTA 3CCRT 3A98A 1RI9A 3UF4A 2P0KA 2EJ9A 1ZLMA 2R57A 3D7SB 2RHZA 2QEXQ 1XNIA 1OOTA 3M5AA 3R6NA 3O5ZA 5EG2A 2DTHA 1RADB 5GAN7 2JOYA 2ZZDA 5CQXA 1WHJA 2K79A 2JTMA 1IO6A 4E7JA 2PZ1A 3LGFA 4QKUA 3EH1A 3OYJA 1OZ2A 3CQTA 1HD3A 5LJ3g 1I81A 2O4XB 1ZBJA 2DAQA 5J39A 3A5ZB 4DQ2A 4RTVA 3PGGA 3J81E 3JCMP 1ARKA 5I22A 5IHIA 1YJWQ 1Q7YC 1YITQ 3UDCA 5IHNA 2ZPHB 2DVEA 3NPFA 5GAMf 3OSVA 2PVDB 4J9HA 2MOXA 5C0MA 1W6XA 5EC7A 3H9NA 3DB4A 1WX6A 2IPOB 1FYNA 3CCVQ 2EYYA 4EMGA 5IH2A 4VUBA 4PLIA 1WHMA 4B9XA 3ASKA 1M27C 3PT9A 1VIFA 2IIMA 1YCYA 3X28B 2XDDA 1KQSP 2YUPA 1ZUUA 1Y7XA 2COZA 1BI3A 3I9QA 4GBQA 4LXCA 4M7AA 2M02A 4CC7A 3MP6A 1NG2A 4BI3A 3JB9F 1NPRA 2D6FA 2DL8A 1RAIB 4E7SA 1BIAA 1TH7A 3VYHB 2K3YA 4AFQC 4M7AE 2DM1A 3SB2A 4NS5A 2PVOB 2QQ9A 4JS4A 1VQ7A 4XAXB 5CR2A 4NOYA 1NJIU 2DVJA 4JPBW 4XTWA 1QVPA 4JJCA 4ZGJB 1I5LA 2OTLQ 4MMLA 1CSKA 1BI2A 2ENMA 2LCLA 1LPLA 3CC2Q 3F70A 1UB4A 4HT9A 3M4GA 5D6XA 2WSFE 4YTLA 2F69A 3CCQA 3OQ5A 4PJOG 1QKXA 2AT1B 4HCCA 2P84A 4JRKA 4HVUA 5GMKh 3HRUA 2E4HA 1KG1A 1QW1A 1IZ6A 4D8KA 5GAOl 4ELZC 1K8AC 3OMCA 5J3BA 2OX7A 2HBWA 4OGEA 4C92B 2DTIA 4J5YA 2WSCE 1GCPA 4PJOC 1NBEB 1W70A 2O88A 4IKFA 4LE9A 4LUEA 2HAXA 4NL3A 1AOJA 4J9BA 9ATCB 2K57A 1OEBA 5GANf 3CC7Q 2CUBA 1H8KA 4DBQA 1Q7YR 1WJRA 2E10A 1LOJA 3A8OB 2EFIA 4DBRA 4DOWA 3DKMA 1Q82U 2IVWA 3M0UA 4A4GA 3VS5A 3CD6A 2DE0X 2PQWA 3HPWA 2QA4A 1UEBA 3L2UA 5I11A 4M75B 1TUGB 3TCJA 4CC4B 2FZCB 3RMQA 2M16A 4QVCA 3TEEA 2FZGB 1WQWA 2DKGA 1Q86U 1M1GA 4FW2A 3OSSC 3EGDB 2MIOA 5KYWB 2A28A 5DLQE 3OS0A 2ROTA 1OI1A 1SHFA 1SG5A 1YIJQ 2ROLA 4QQDA 1NE8A 3TU4K 3QSUA 4KT0E 2DXBA 4LUDA 2H3EB 2K9GA 2PU9B 3OYIA 3QO3A 1ZSZC 1UGSB 1VQLA 3MCAB 1ZBXA 1RAHB 3RIRA 3E1SA 4RG2A 4JS5A 3DB3A 2DEQA 2X4WA 4AFZC 3UA6A 2CT4A 2KBTA 2NUTA 3MEVA 4LDXA 5I2MA 3OB9A 4P5NA 2AK5A 1KSWA 4IIMA 1K8AR 5GAN8 1OQKA 4C92D 1YJNT 3GPLA 1VQ7Q 3G4ST 2LT1A 1NLPC 1OX8A 2E64A 2JMCA 3M55A 4F7UB 4BDZA 4OMPA 3LH5A 2L3SA 4JRPA 3CCRA 1KC8C 3GF5A 1RLPC 3PIPA 3EH2A 1G83A 1KD1C 3I5SA 2I0NA 2QDYB 2ZPIB 4E2FB 3M57A 2ATCB 3CCQQ 3QBYA 4EMKC 2OJ2A 3CCMQ 4IURA 3V7SA 1Y71A 1GXIE 4M78G 1SSFA 3NTHA 2LCCA 1TUCA 3L1AA 1X27A 1N8RR 2JS0A 3E2UA 5CO7A 3MEWA 2MF2A 2DZCA 4M75D 4M77G 1X6BA 2DXUA 3TQ7P 1PC0A 4XU3A 2V1QA 3FIFA 2M1HA 4J7IA 1UHCA 2JVVA 4KGXB 1ZUKA 4A54A 4QVDA 1M4ZA 2E3HA 5LL6S 3E9GA 4Z02A 4KRTA 4C8QA 3EFSA 4PJOB 4M78C 1D3BA 1M90C 2A37A 1X43A 3VJPA 3GP8A 1VQ8Q 1B34A 2JTFA 4M7DA 2XG8D 4BE1A 2VGNA 1IHWA 2FPFA 3TREA 4C8QE 4M77C 1C6VX 3UWNA 2K3XA 2J6OA 1ZSGA 5GMKl 1O75A 5KH6A 3CD6Q 1QP2A 4M7DE 2XKOC 1NEBA 1SRLA 3JCMg 4C5HA 1T3LA 4GLMA 2RD1A 4ME7A 3OY9A 5J26A 4PK4A 2LCSA 4BD3A 2CKKA 4XU0A 2QK0A 2GQIA 1IHVA 3MPUB 2F2VA 1I8FA 1UGQB 5GAOn 2EKOA 1GCQA 3I55Q 3C12A 3GNGA 5KYUB 1WGSA 4WF2A 1YJ9Q 4X9DA 3PMTA 3FRNA 3SWNC 1VQPA 3OW2S 5GANd 3P8DA 1IREB 1I07A 3T9NA 1JEGA 2L8DA 1AWXA 1SKUB 1N5ZA 4F17A 3S3OA 3CXCS 1CKBA 4QT7A 3LWHA 2BZYA 1TTHB 4XU2A 2RN8A 1RUWA 3CPWP 1EX4A 1VQLQ 4DBHA 1ZSZB 4N0AA 1ABOA 3V8JA 2K4YA 1VQ7T 4RTWA 2CGHA 2BTTA 1U1TA 2DIGA 2AIRB 2XMFA 1Q82C 4ZN3A 4A4HA 4XTYA 2HL3A 4OF1A 4ESRA 3M4YA 4J6WA 4V2SA 3CCJT 1IXDA 3CCQT 5FWCA 3QZ9B 1J3TA 1M8MA 2E5KA 1MV0B 3I5RA 5M9OA 5LJ5h 2KYBA 4HCZA 3QDFA 3JCMJ 5CKHA 4ANJA 3HTRA 4PLLA 5KYXB 3CCRQ 1VA7A 5KE3A 4JDSA 3NTKA 4BI8B 4PJOD 1ACMB 3L42A 2LQKA 2CH4W 1Q86C 1VQ6A 2LQNA 1JB0E 2QQSA 4QVZA 2KI7A 3C95A 2BZXA 1BI0A 4EMKB 4C8QF 1H641 2ED0A 2EKHA 4MZMA 4C5GA 2W0ZA 5HKCA 2Z0WA 1Q81U 2HCKA 4HCKA 3L2VA 2D0QB 4C0FA 4JLGA 2E65A 3RBBB 2DFUA 5GMKj 3S3NA 2O4XA 3PNWC 1W2BA 3JCMW 3X25B 1O9SA 4L5GA 2V8KA 1VYVA 4ZTJA 4M4ZA 2QAZA 4Q5WA 3MO8A 1V29B 3CD6T 3JB9I 3GOXA 1I0CA 3CCUA 2QA4T 2AZVA 4QQ6A 3REBB 2BZ8A 3RKXA 3V7CA 4M78B 4RTUA 5HCKA 2LT4A 3HRTA 2MI6A 5CAIA 4M77B 2WSEE 4CI0C 1OV3A 2G3RA 2E41A 1U1SA 4MDXA 5KYYB 2L3RA 2ED1A 4LDVA 3H8ZA 1K76A 2F5KA 2YT6A 3MP8A 2VC8A 5GAMg 2AZSA 3EFOB 3HFOA 4ZN1A 3QDRB 1X75C 2KYMA 1TXQA 4HVVA 3MJXA 2J6KA 5FRNA 1Q95G 4B9WA 5LJ3e 2DL5A 4XQ3A 4BY6B 4FYYB 1Q82R 1VQLT 1YWOA 4NL2A 4PJLA 1VQPQ 3EG9A 2X51A 5A0GA 3SWNB 2NUZA 3MEUA 1G5VA 1YI2A
chains in the Genus database with same CATH topology
2RPNA 2FRWA 1CSKA 2ENMA 4JJDA 1SEMA 2EYZA 3KFVA 2LMJA 3H0HA 4Z88A 2EW3A 1T0HA 1UDLA 1PKTA 1QWEA 1QKXA 2KNBB 2RQVA 2YUNA 2JW4A 4HVUA 2K6DA 2ESWA 1H3HA 1AWWA 4D8KA 2AKKA 4JJBA 1X69A 2LX7A 3PVLA 4OMMA 2NWMA 1B07A 2LQWA 3M0PA 2HBWA 1MV3A 2W10A 2FG0A 1KFZA 4DEYA 4RTZA 2ABLA 2CSQA 2JM9A 2LJ3A 1GCPA 1W70A 2EBPA 2O88A 4AG1C 2HDAA 3VS0A 4LE9A 5L23A 4LUEA 1JU5C 1AOJA 1ABQA 1WI7A 2OAWA 2J05A 4J9BA 1GL5A 2H8HA 1OEBA 4RTXA 1XOVA 2CUBA 1H8KA 2FEIA 4R0KA 2GTOA 3VS6A 2OI3A 3M0RA 2FO0A 2JS2A 3M0UA 1G2BA 2KR3A 3NMZC 4AFSC 3VS5A 1AZGB 2DE0X 1QWFA 1YNZA 2YUOA 5I11A 1PRLC 2KXCA 1U5SA 1NLOC 4CC4B 1AWJA 1UJ0A 1BB9A 3QWXX 1UGVA 1QLYA 2EVRA 2K3BA 2J06A 2EYWA 2B86A 2A36A 2L3QA 1UHFA 1T3SA 2KXDA 4HXJA 5IXBA 2MIOA 1K9AA 3THKA 3RNJA 2A28A 2D8HA 1GBQA 2V1RA 1WDXA 2ROTA 1BU1A 4X1VA 2X3XD 2DBKA 1YWPA 2DILA 3C0CA 1RLQC 3TSWA 1X2QA 4K11A 1SHFA 2EGAA 3VS4A 2M51A 4JZ4A 2ROLA 1UE9A 1EFNA 1ZUYA 1SSHA 3VRYA 1E6HA 2DRMA 1Z9QA 1NEGA 2RNAA 4LUDA 2K9GA 2GNCA 1U3OA 2KT8A 1PKSA 1X2KA 1M3AA 2DJQA 1PRMC 3VS1A 2F2WA 4AG2C 2DX1A 3H41A 2A08A 3PE0A 4ZNXA 1YP5A 4AFUC 1Y57A 4AFZC 3UA6A 2CT4A 2KBTA 4LNPA 2HSPA 2RF0A 1TUDA 2J6FA 1WIEA 2AK5A 2EYXA 1GFDA 1KSWA 4IIMA 3EG0A 2RQUA 5ECAA 3EHQA 2SEMA 1NLPC 2JMCA 4OMPA 3LH5A 4D8DA 3NHNA 2L3SA 2JMAA 2O31A 1RLPC 1U06A 2K2MA 1PWTA 1UJYA 1G83A 2DLPA 4OMQA 4Y92A 3I35A 2I0NA 3I5SA 1M3CA 1VYUA 2KRMA 2OJ2A 2EGEA 2KROA 1Z9ZA 3UATA 3VRZA 2C0OA 1K0SA 2CSIA 2CT3A 4J9IA 4JZ3A 1W1FA 2RQTA 4CC3A 2RQWA 2YSQA 1TUCA 2DNUA 1X27A 2VWFA 2JS0A 2DA9A 3M0TA 2DL4A 1OPLA 1AEYA 3JV3A 3H0FA 2EGCA 1HSQA 1M3BA 1X6BA 2CREA 4HVWA 2V1QA 4J9FA 1UHCA 1WA7A 2CUDA 3M0SA 1KIKA 2HEQA 1ZUKA 1S1NA 1VYTA 3NGPA 2GTJA 4KRTA 3M0QA 3GBQA 2FPDA 2M0YA 2JXBA 4J9CA 3ZL7C 2YDLA 2A37A 2JM8A 1X43A 1AZEA 1FMKA 1I1JA 4F16A 2FPFA 2LJ1A 4F14A 3IQLA 5FW9A 2D8JA 3EGUA 2J6OA 3VS7A 2DF6A 1ZSGA 2K7AA 1WLPB 1OPKA 1GBRA 2DBMA 4A63B 2X3WD 4IIOA 1NEBA 1SRLA 2VVKA 1QKWA 1WXTA 2GBQA 1A0NB 1E7OA 1KJWA 1CKAA 1K1ZA 2JTEA 1T3LA 2PNIA 4GLMA 1UECA 3H0IA 2LCSA 1NYGA 4WCIA 2GQIA 1YN8A 2F2VA 1AD5A 2DMOA 1M30A 3UA7A 1GCQA 2J7IA 2LP5A 4CC2A 1T0JA 1UTIA 2AKLA 2KRSA 5GJVB 2FRYA 2FPEA 1X6GA 2O9SA 1JQQA 3SEMA 2DL7A 1AVZC 1I07A 1LCKA 3EG2A 1JEGA 2DRKA 2L2PA 1AWXA 2P4RA 4E6RA 1N5ZA 4F17A 1WFWA 1CKBA 4QT7A 1ZX6A 2BZYA 4J9DA 2RN8A 1RUWA 2RMOA 4Z89A 2KGTA 3QWYA 1ABOA 1B3QA 3TVTA 2C0TA 4RTWA 2QDLA 4DEXA 2BTTA 5IXFA 2MCNA 1JXMA 2XMFA 5GJWB 3ULRB 4ESRA 4Z8AA 2C0IA 1E6GA 4ORZA 3SHWA 2JT4A 1SPKA 5IHKA 5FWCA 1YCSB 1Y0MA 1J3TA 1M8MA 2E5KA 1MV0B 3I5RA 1GRIA 2KYBA 3VS2A 4LN2A 4J9GA 2EPDA 2EQIA 1NM7A 2O2OA 4RTTA 3A98A 5FWBA 1RI9A 1VA7A 1WYXA 2CH4A 2G6FX 1PNJA 2GGRA 3VS3A 3UF4A 3PVQA 2CH4W 2DYBA 2LQNA 3EG1A 1ZLMA 1OOTA 2BZXA 2SRCA 2D0NA 3R6NA 3O5ZA 2ED0A 2EKHA 2W0ZA 1MUZA 1SHGA 2HCKA 4HCKA 3EHRA 1AWOA 2K79A 2L3PA 1IO6A 2PZ1A 3RBBB 1V1CA 2L0AA 4RUGA 2KEAA 1SRMA 3CQTA 2KT1A 1HD3A 1VYVA 2CDTA 1ZBJA 1PHTA 4M4ZA 1HJDA 3REAB 4RTVA 1UG1A 1ARKA 5I22A 1I0CA 3TSZA 5IHIA 2VKNA 2AZVA 2LJ0A 2BZ8A 3NPFA 5IHNA 3REBB 1TG0A 1WXBA 1QCFA 4J9HA 2DL3A 2MOXA 4FSSA 1W6XA 5EC7A 4RTUA 5HCKA 1WX6A 4EIKA 1FYNA 2LNHB 2EYYA 2F2XA 1OV3A 5IH2A 1GCQC 1WXUA 2LZ6B 4J9EA 2ED1A 2RQRA 2O9VA 1K4US 1M27C 1K76A 2YT6A 2IIMA 1BBZA 2ECZA 1JXOA 3FJ5A 2YUPA 2AZSA 1UUEA 2PTKA 1NYFA 1ZUUA 2YUQA 3I9QA 4GBQA 2KYMA 4CC7A 4HVVA 1NG2A 2KRNA 2D1XA 2J6KA 2DL8A 4RTYA 1JO8A 2DL5A 3U23A 2KE9A 3EG3A 4AFQC 1K0XA 1YWOA 2DM1A 1BK2A 1H92A 4OMOA 1GFCA 1UFFA 4OMNA 2DVJA 2NUZA 4OMLA 4JPBW 4JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPN A;  2FRW A;  1CSK A;  2ENM A;  4JJD A;  1SEM A;  2EYZ A;  3KFV A;  2LMJ A;  3H0H A;  4Z88 A;  2EW3 A;  1T0H A;  1UDL A;  1PKT A;  1QWE A;  1QKX A;  2KNB B;  2RQV A;  2YUN A;  2JW4 A;  4HVU A;  2K6D A;  2ESW A;  1H3H A;  1AWW A;  4D8K A;  2AKK A;  4JJB A;  1X69 A;  2LX7 A;  3PVL A;  4OMM A;  2NWM A;  1B07 A;  2LQW A;  3M0P A;  2HBW A;  1MV3 A;  2W10 A;  2FG0 A;  1KFZ A;  4DEY A;  4RTZ A;  2ABL A;  2CSQ A;  2JM9 A;  2LJ3 A;  1GCP A;  1W70 A;  2EBP A;  2O88 A;  4AG1 C;  2HDA A;  3VS0 A;  4LE9 A;  5L23 A;  4LUE A;  1JU5 C;  1AOJ A;  1ABQ A;  1WI7 A;  2OAW A;  2J05 A;  4J9B A;  1GL5 A;  2H8H A;  1OEB A;  4RTX A;  1XOV A;  2CUB A;  1H8K A;  2FEI A;  4R0K A;  2GTO A;  3VS6 A;  2OI3 A;  3M0R A;  2FO0 A;  2JS2 A;  3M0U A;  1G2B A;  2KR3 A;  3NMZ C;  4AFS C;  3VS5 A;  1AZG B;  2DE0 X;  1QWF A;  1YNZ A;  2YUO A;  5I11 A;  1PRL C;  2KXC A;  1U5S A;  1NLO C;  4CC4 B;  1AWJ A;  1UJ0 A;  1BB9 A;  3QWX X;  1UGV A;  1QLY A;  2EVR A;  2K3B A;  2J06 A;  2EYW A;  2B86 A;  2A36 A;  2L3Q A;  1UHF A;  1T3S A;  2KXD A;  4HXJ A;  5IXB A;  2MIO A;  1K9A A;  3THK A;  3RNJ A;  2A28 A;  2D8H A;  1GBQ A;  2V1R A;  1WDX A;  2ROT A;  1BU1 A;  4X1V A;  2X3X D;  2DBK A;  1YWP A;  2DIL A;  3C0C A;  1RLQ C;  3TSW A;  1X2Q A;  4K11 A;  1SHF A;  2EGA A;  3VS4 A;  2M51 A;  4JZ4 A;  2ROL A;  1UE9 A;  1EFN A;  1ZUY A;  1SSH A;  3VRY A;  1E6H A;  2DRM A;  1Z9Q A;  1NEG A;  2RNA A;  4LUD A;  2K9G A;  2GNC A;  1U3O A;  2KT8 A;  1PKS A;  1X2K A;  1M3A A;  2DJQ A;  1PRM C;  3VS1 A;  2F2W A;  4AG2 C;  2DX1 A;  3H41 A;  2A08 A;  3PE0 A;  4ZNX A;  1YP5 A;  4AFU C;  1Y57 A;  4AFZ C;  3UA6 A;  2CT4 A;  2KBT A;  4LNP A;  2HSP A;  2RF0 A;  1TUD A;  2J6F A;  1WIE A;  2AK5 A;  2EYX A;  1GFD A;  1KSW A;  4IIM A;  3EG0 A;  2RQU A;  5ECA A;  3EHQ A;  2SEM A;  1NLP C;  2JMC A;  4OMP A;  3LH5 A;  4D8D A;  3NHN A;  2L3S A;  2JMA A;  2O31 A;  1RLP C;  1U06 A;  2K2M A;  1PWT A;  1UJY A;  1G83 A;  2DLP A;  4OMQ A;  4Y92 A;  3I35 A;  2I0N A;  3I5S A;  1M3C A;  1VYU A;  2KRM A;  2OJ2 A;  2EGE A;  2KRO A;  1Z9Z A;  3UAT A;  3VRZ A;  2C0O A;  1K0S A;  2CSI A;  2CT3 A;  4J9I A;  4JZ3 A;  1W1F A;  2RQT A;  4CC3 A;  2RQW A;  2YSQ A;  1TUC A;  2DNU A;  1X27 A;  2VWF A;  2JS0 A;  2DA9 A;  3M0T A;  2DL4 A;  1OPL A;  1AEY A;  3JV3 A;  3H0F A;  2EGC A;  1HSQ A;  1M3B A;  1X6B A;  2CRE A;  4HVW A;  2V1Q A;  4J9F A;  1UHC A;  1WA7 A;  2CUD A;  3M0S A;  1KIK A;  2HEQ A;  1ZUK A;  1S1N A;  1VYT A;  3NGP A;  2GTJ A;  4KRT A;  3M0Q A;  3GBQ A;  2FPD A;  2M0Y A;  2JXB A;  4J9C A;  3ZL7 C;  2YDL A;  2A37 A;  2JM8 A;  1X43 A;  1AZE A;  1FMK A;  1I1J A;  4F16 A;  2FPF A;  2LJ1 A;  4F14 A;  3IQL A;  5FW9 A;  2D8J A;  3EGU A;  2J6O A;  3VS7 A;  2DF6 A;  1ZSG A;  2K7A A;  1WLP B;  1OPK A;  1GBR A;  2DBM A;  4A63 B;  2X3W D;  4IIO A;  1NEB A;  1SRL A;  2VVK A;  1QKW A;  1WXT A;  2GBQ A;  1A0N B;  1E7O A;  1KJW A;  1CKA A;  1K1Z A;  2JTE A;  1T3L A;  2PNI A;  4GLM A;  1UEC A;  3H0I A;  2LCS A;  1NYG A;  4WCI A;  2GQI A;  1YN8 A;  2F2V A;  1AD5 A;  2DMO A;  1M30 A;  3UA7 A;  1GCQ A;  2J7I A;  2LP5 A;  4CC2 A;  1T0J A;  1UTI A;  2AKL A;  2KRS A;  5GJV B;  2FRY A;  2FPE A;  1X6G A;  2O9S A;  1JQQ A;  3SEM A;  2DL7 A;  1AVZ C;  1I07 A;  1LCK A;  3EG2 A;  1JEG A;  2DRK A;  2L2P A;  1AWX A;  2P4R A;  4E6R A;  1N5Z A;  4F17 A;  1WFW A;  1CKB A;  4QT7 A;  1ZX6 A;  2BZY A;  4J9D A;  2RN8 A;  1RUW A;  2RMO A;  4Z89 A;  2KGT A;  3QWY A;  1ABO A;  1B3Q A;  3TVT A;  2C0T A;  4RTW A;  2QDL A;  4DEX A;  2BTT A;  5IXF A;  2MCN A;  1JXM A;  2XMF A;  5GJW B;  3ULR B;  4ESR A;  4Z8A A;  2C0I A;  1E6G A;  4ORZ A;  3SHW A;  2JT4 A;  1SPK A;  5IHK A;  5FWC A;  1YCS B;  1Y0M A;  1J3T A;  1M8M A;  2E5K A;  1MV0 B;  3I5R A;  1GRI A;  2KYB A;  3VS2 A;  4LN2 A;  4J9G A;  2EPD A;  2EQI A;  1NM7 A;  2O2O A;  4RTT A;  3A98 A;  5FWB A;  1RI9 A;  1VA7 A;  1WYX A;  2CH4 A;  2G6F X;  1PNJ A;  2GGR A;  3VS3 A;  3UF4 A;  3PVQ A;  2CH4 W;  2DYB A;  2LQN A;  3EG1 A;  1ZLM A;  1OOT A;  2BZX A;  2SRC A;  2D0N A;  3R6N A;  3O5Z A;  2ED0 A;  2EKH A;  2W0Z A;  1MUZ A;  1SHG A;  2HCK A;  4HCK A;  3EHR A;  1AWO A;  2K79 A;  2L3P A;  1IO6 A;  2PZ1 A;  3RBB B;  1V1C A;  2L0A A;  4RUG A;  2KEA A;  1SRM A;  3CQT A;  2KT1 A;  1HD3 A;  1VYV A;  2CDT A;  1ZBJ A;  1PHT A;  4M4Z A;  1HJD A;  3REA B;  4RTV A;  1UG1 A;  1ARK A;  5I22 A;  1I0C A;  3TSZ A;  5IHI A;  2VKN A;  2AZV A;  2LJ0 A;  2BZ8 A;  3NPF A;  5IHN A;  3REB B;  1TG0 A;  1WXB A;  1QCF A;  4J9H A;  2DL3 A;  2MOX A;  4FSS A;  1W6X A;  5EC7 A;  4RTU A;  5HCK A;  1WX6 A;  4EIK A;  1FYN A;  2LNH B;  2EYY A;  2F2X A;  1OV3 A;  5IH2 A;  1GCQ C;  1WXU A;  2LZ6 B;  4J9E A;  2ED1 A;  2RQR A;  2O9V A;  1K4U S;  1M27 C;  1K76 A;  2YT6 A;  2IIM A;  1BBZ A;  2ECZ A;  1JXO A;  3FJ5 A;  2YUP A;  2AZS A;  1UUE A;  2PTK A;  1NYF A;  1ZUU A;  2YUQ A;  3I9Q A;  4GBQ A;  2KYM A;  4CC7 A;  4HVV A;  1NG2 A;  2KRN A;  2D1X A;  2J6K A;  2DL8 A;  4RTY A;  1JO8 A;  2DL5 A;  3U23 A;  2KE9 A;  3EG3 A;  4AFQ C;  1K0X A;  1YWO A;  2DM1 A;  1BK2 A;  1H92 A;  4OMO A;  1GFC A;  1UFF A;  4OMN A;  2DVJ A;  2NUZ A;  4OML A;  4JPB W;  4JJC A; 
#chains in the Genus database with same CATH topology
 4JJD A;  4KUD K;  2GFA A;  1RAB B;  2HL5 C;  2LMJ A;  4Z88 A;  2Y4Y A;  4C92 C;  1QWE A;  2E70 A;  1PD0 A;  1Q86 R;  3PMI A;  3S3M A;  3RR6 A;  2JW4 A;  2K6D A;  1H3H A;  3MEA A;  1M1K C;  3I56 A;  3FJP A;  2NWM A;  4J8O A;  4PFP A;  1TS9 A;  1WHK A;  4PNO A;  4ZTF A;  2LQW A;  3M0P A;  2DZ9 A;  2W10 A;  4DEY A;  4E7L A;  4FYW B;  1RI0 A;  2P0P A;  4OB0 B;  2CS7 A;  3CBO A;  5I21 A;  3CMA A;  2RA2 A;  2HDA A;  3LX7 A;  4M75 C;  3RES A;  2OAW A;  1WI7 A;  3M58 A;  1VQ6 Q;  1N6A A;  1PSF A;  2H8H A;  4M78 D;  1I4K 1;  3VS6 A;  2DO3 A;  2OAU A;  2K5F A;  3M0R A;  2JS2 A;  5GAO p;  2JN0 A;  4M77 D;  6AT1 B;  1XQH A;  1AZG B;  4HCB A;  3CME A;  3RER A;  2MMP A;  4RCC A;  2H3J A;  4FL6 A;  1QQJ A;  3AHU A;  1U5S A;  1NLO C;  4M7A G;  1QVF S;  1BB9 A;  1UGV A;  4MZP A;  5GAN g;  4OB1 B;  2E6N A;  5KYW A;  2DK3 A;  2RI2 A;  1T3S A;  4HXJ A;  2RH2 A;  5IXB A;  1K9A A;  3HL8 A;  1WZO A;  3JSC A;  1WDX A;  2Y90 A;  3QPH A;  2X3X D;  3O8V A;  4C0G A;  1YWP A;  1M9S A;  2DIL A;  3H6Z A;  1RLQ C;  3G7Z A;  2V26 A;  2EGA A;  4JZ4 A;  1M1F A;  1UE9 A;  2YLC A;  1ZUY A;  4M7A C;  1SSH A;  1NEG A;  2MWO A;  2GNC A;  1U3O A;  1VOM A;  2KT8 A;  2ZAE A;  1PKS A;  1LJO A;  3BW1 A;  5LJ3 h;  1VQP T;  1M3A A;  4XTZ A;  1G8X A;  5DLO A;  3VS1 A;  3DLL A;  4AG2 C;  2HKQ B;  4ZNX A;  4AFU C;  1YP5 A;  1HXD A;  2E5Q A;  5AYF A;  1M1K R;  1WHG A;  2RF0 A;  3Q1J A;  3CCJ A;  4F7U A;  2V8J A;  5I2S A;  2LDM A;  3EG0 A;  3S6W A;  1YJN Q;  2LTO A;  1W2B S;  3G4S Q;  1N27 A;  4JRQ A;  4PJM A;  4C92 F;  2JMA A;  2O31 A;  4F7U E;  3SD4 A;  1VQ9 A;  2DD5 A;  2K2M A;  3EGX A;  1UJY A;  1G3T A;  3OW2 A;  3QUI A;  1ZA2 B;  4OMQ A;  2EGE A;  2KY9 A;  2C0O A;  1K0S A;  3BDL A;  1D1C A;  3PTA A;  3CXC A;  2CT3 A;  4J9I A;  4JZ3 A;  3ZEH A;  2A0F B;  2YSQ A;  3M56 A;  2DNU A;  2VWF A;  1U8R A;  4RCB A;  2DA9 A;  5GMK i;  2DL4 A;  1OPL A;  1OZ3 A;  1VQ6 T;  1AEY A;  1HSQ A;  2CRE A;  1MNE A;  2E1H A;  2DD4 A;  4HVW A;  3JB9 H;  4J9F A;  4M75 F;  4ZGD B;  1N8R C;  1WA7 A;  2CUD A;  2F1L A;  2OTJ A;  3M0S A;  2HEQ A;  4PJO A;  2R5A A;  3CMA Q;  3NGP A;  5LJ5 j;  3M0Q A;  5IT9 E;  4J9C A;  3CBP A;  3ZL7 C;  2YDL A;  2YRD A;  1HK9 A;  2EQJ A;  4IUP A;  2QGF B;  2D8J A;  4GLK A;  1IGU A;  2LQ8 A;  4Y28 E;  3CCE A;  5CQY A;  3OYY A;  4J7F A;  1VQK A;  2RO0 A;  3CCU T;  4J83 A;  2C06 A;  4IIO A;  2VVK A;  3CME Q;  1QKW A;  1WJQ A;  3MHX A;  1CKA A;  4FT4 A;  1MGQ A;  2VUB A;  3QJY A;  1R77 A;  3VV0 A;  8ATC B;  4ATO A;  5KYU A;  4Y91 A;  1YHQ T;  1YN8 A;  4JJN K;  2PVG B;  1AD5 A;  3JAM E;  2J7I A;  1PD1 A;  2FRY A;  2FPE A;  2XID A;  1PG5 B;  1Q81 R;  3SEM A;  3GIB A;  1WPY A;  1D0X A;  1RAE B;  1LCK A;  3EG2 A;  4E6R A;  1V76 A;  1SF9 A;  3CCS A;  2CP0 A;  4F7U F;  1ZSZ A;  1ZX6 A;  5CK9 A;  4M7A B;  4Z89 A;  1D0Y A;  3QWY A;  1AT1 B;  1RL2 A;  4A4K A;  1Y96 B;  3OBY A;  2QDL A;  3JCM e;  1S72 A;  3OS2 A;  4B6M A;  2QYZ A;  1YI2 T;  2RI3 A;  4WTO B;  2MCN A;  2K5I A;  1YFN A;  3ER0 A;  2RJD A;  2JZ2 A;  3ULR B;  1K73 U;  5LJ5 e;  1E6G A;  4ORZ A;  3CCJ Q;  2HQH A;  3OMG A;  1YCS B;  4C5I A;  1QCO A;  3OYH A;  4BUG A;  5KYX A;  3V7R A;  2CP6 A;  3OA6 A;  4J9G A;  3RKY A;  4C8Q G;  2EQI A;  1NM7 A;  3I56 T;  2YRV A;  5FWB A;  2CP5 A;  2G6F X;  1PNJ A;  3VS3 A;  3HP9 A;  3PVQ A;  4M7D G;  4OP0 A;  2DYB A;  1MMN A;  3EG1 A;  4PJO F;  2GQV A;  2VYT A;  1VQO A;  2BE7 D;  5D6Y A;  1BCO A;  5GAN 4;  3J80 E;  4L59 A;  3CMA T;  1MUZ A;  1AWO A;  2QTV A;  1RAC B;  1V1C A;  2XU8 A;  1D0Z A;  4RUG A;  2X4X A;  2KEA A;  3OYK A;  3L2W A;  3WVE B;  3ZFJ A;  3DLM A;  1HJD A;  3REA B;  5KYN A;  1VQN T;  2L5Q A;  5KCH A;  2R5M A;  1UG1 A;  3ZBD A;  5GAM j;  4O6J A;  1NJI C;  3E19 A;  3TSZ A;  3CME T;  2QA4 Q;  2VKN A;  1M8V A;  2ZCF B;  1G3W A;  1VQ5 A;  1X6O A;  2LJ0 A;  1QVG S;  3LLR A;  1WXB A;  5CKF A;  1D09 B;  1NZ9 A;  4M77 A;  4J6Y A;  2RM4 A;  3C94 A;  3PIO A;  1JJ2 S;  1D1B A;  2X9H A;  3CCE Q;  2XIC A;  4QQG A;  4BY6 C;  5GAN 3;  2F2X A;  4M7A D;  2HQE A;  3QYH B;  3CC4 A;  1GCQ C;  2XHC A;  3JCM X;  1WXU A;  2ZGW A;  4IUQ A;  5LJ3 d;  1K4U S;  2KQW A;  3G71 A;  2KMT A;  1JXO A;  3FJ5 A;  2BIV A;  1UUE A;  3FC3 A;  5CKE A;  2CYZ B;  3LW5 E;  2KRN A;  2D1X A;  2HQX A;  4RTY A;  3QYG B;  1JO8 A;  1QVF A;  3U23 A;  2QXF A;  3HFN A;  3EG3 A;  2RK1 A;  2NUP B;  1QP3 A;  3OYL A;  3SWN A;  1UGP B;  1ZHI A;  4OMO A;  1GFC A;  2FB7 A;  4OMN A;  1BIB A;  4FYV B;  2RHX A;  3CCS Q;  2RPN A;  2FRW A;  2EYZ A;  3H0H A;  3JCM h;  3CCL T;  5FLX E;  1T0H A;  1UDL A;  3X24 B;  2EAY A;  3R6O A;  2KNB B;  4HT8 A;  2QQR A;  2RQV A;  4KUL A;  4PFO A;  5FU6 C;  5LJ3 j;  3JCM b;  1MMA A;  1VQ9 T;  3PVL A;  1RAG B;  5GAM e;  4A53 A;  1B07 A;  3OYG A;  1IRX A;  4XK8 E;  1KFZ A;  2QEX A;  4KGV B;  1OUL A;  4A4E A;  5FU7 C;  4RTZ A;  2A7Y A;  2CSQ A;  2JM9 A;  2LJ3 A;  3RMS A;  3OYB A;  1DJ7 B;  3LWI A;  2EBP A;  2DTO A;  1TOV A;  3X26 B;  4RKU E;  1GL5 A;  1NJI R;  1XOV A;  3QJ6 A;  3VUZ A;  2FEI A;  2GTO A;  1FXX A;  2XD0 A;  2OI3 A;  4IUV A;  2FO0 A;  2OTJ T;  4M78 F;  1G2B A;  3NMZ C;  3QKJ A;  4AFS C;  3JCM f;  3MP1 A;  1QWF A;  4FW1 A;  4O5V A;  1YJW A;  2YUO A;  4M77 F;  1YIT A;  2QQB A;  1VQ4 T;  5LJ5 f;  2RK2 A;  4EPC A;  2RB6 A;  1N9S A;  1AWJ A;  2F5T X;  1UJ0 A;  1D3B B;  1BI1 A;  3QG1 A;  5IN1 A;  4ZGE B;  5DY9 A;  5A0D A;  3CCE T;  2EVR A;  1YHQ A;  2K3B A;  3M59 A;  4M7D B;  2J06 A;  1K8A U;  2EYW A;  3JB9 G;  1VQK T;  2B86 A;  1UHF A;  1WJS A;  2KXD A;  1MMD A;  2YHT A;  2D8H A;  3AT1 B;  2DPP B;  1GBQ A;  5GAN 6;  2LVM A;  4X1V A;  1M5Q 1;  2QI2 A;  5CVI A;  3C0C A;  2EJG A;  5KE2 A;  2EQM A;  4K11 A;  2M51 A;  3HKS A;  2EQU A;  3VRY A;  3JCM c;  4BI4 A;  1Z9Q A;  2RNA A;  4QW2 A;  5CKD A;  4J6X A;  5HK3 A;  2PUO B;  1X2K A;  2DJQ A;  4KH1 B;  1PRM C;  3QXE B;  3LYI A;  4RG8 A;  2F2W A;  3H41 A;  3OYC A;  3CCS T;  2A08 A;  2R58 A;  2OTL A;  4BB7 A;  3CC2 A;  4LNP A;  4LD9 K;  2P0Q A;  4E7I A;  4UC4 A;  3JRZ A;  1KHC A;  4AMC A;  2RQU A;  5ECA A;  5GAO m;  1S72 T;  2M0O A;  1P92 A;  2DXC A;  3HSB A;  2VB6 A;  1U06 A;  4EMH A;  1PWT A;  2NLU A;  1PCX A;  4C92 A;  3C4S A;  1VYU A;  2BUD A;  2KRM A;  2KRO A;  4HKE A;  2YLB A;  5GAM h;  2CSI A;  2DET A;  4C92 E;  1W1F A;  2PUK B;  2RQT A;  1PM3 A;  4CC3 A;  4C0D B;  3OW2 P;  2ZPG B;  1W4S A;  4N4H A;  5FU6 B;  3OYA A;  2B8A A;  3M0T A;  4X34 A;  1K9M U;  2EGC A;  3HHT B;  4C8Q D;  5FRM A;  4FSX A;  3CXC P;  4ELY C;  4BDY A;  3CC7 A;  1VQO T;  2RI5 A;  2RHU A;  2XI9 A;  1MND A;  4M7D D;  2X4J A;  1S1N A;  1VQN A;  1VYT A;  5FU7 B;  4M75 A;  2GTJ A;  1VQM A;  3UPU A;  3GBQ A;  2K2V A;  2O01 E;  4TVR A;  1NPP A;  4OB3 B;  2JXB A;  2CZ0 B;  4AT1 B;  4DBF A;  2JM8 A;  2QAS A;  3M53 A;  4M75 E;  1I1J A;  2LJ1 A;  4F14 A;  3IQL A;  2VGM A;  3ME9 A;  1K73 R;  3A8H B;  1KC8 U;  3EGD A;  2DF6 A;  2K7A A;  1TU0 B;  7AT1 B;  2D9T A;  1KD1 U;  1GBR A;  2DBM A;  4A63 B;  3CCU Q;  2GBQ A;  1VQ5 T;  5L8R E;  1K1Z A;  2HMA A;  4MZT A;  2JTE A;  2PNI A;  5GAO q;  1WQ7 A;  3J7A F;  1NYG A;  3WXM B;  1YIJ A;  1YHQ Q;  1FWZ A;  4BE2 A;  2DMO A;  3UA7 A;  4F7U G;  3CC4 T;  3MET A;  4XU1 A;  1UTI A;  4CC2 A;  1M2V B;  5GJV B;  4D6W A;  2O9S A;  3G71 T;  2COY A;  1JQQ A;  1AVZ C;  2DRK A;  2L2P A;  1X01 A;  4II1 A;  2V8I A;  1QVG A;  2EQK A;  4C5E A;  3V8K A;  3A8L B;  1M90 U;  3SDZ A;  3JCM d;  3G6E T;  1Q81 C;  1C1A A;  1Y96 A;  3CCL A;  1JJ2 A;  2RMO A;  5LJ5 d;  5GAN h;  2KK4 A;  1B3Q A;  2JUF A;  3TVT A;  1ZA1 B;  1G3S A;  4CRI A;  4DEX A;  3EG9 B;  3BDU A;  4OVA A;  1YI2 Q;  1JXM A;  5GJW B;  2A3L A;  3A8G B;  4IUU A;  4Z8A A;  2C0I A;  2RHI A;  3SHW A;  2JT4 A;  1SPK A;  5IHK A;  1TWB A;  5DM7 R;  1Y0M A;  4LDY A;  3WVD B;  3RUX A;  1GRI A;  2AHJ B;  3VS2 A;  4LN2 A;  3CCM A;  4XTV A;  4L6V 5;  2O2O A;  3GNF B;  5C6S A;  3I56 Q;  5CIU A;  1WYX A;  2CH4 A;  2GGR A;  2CZ1 B;  2JJ9 A;  5LJ3 f;  2GFU A;  2QEX T;  2NYS A;  2SRC A;  2D0N A;  2XDB A;  1SHG A;  2GCX A;  1XJW B;  3EHR A;  1R0C B;  2L3P A;  4LDU A;  1R8O B;  3N5B B;  3JCM V;  2VXF A;  1VQ4 A;  4PJO E;  2L0A A;  2YWW A;  4A4F A;  3BE3 A;  3BY7 A;  1F1B B;  1VQ8 A;  1SRM A;  1KQ2 A;  2KT1 A;  2CDT A;  1PHT A;  5GMK m;  2FHD A;  1C0M A;  5CKB A;  1VQN Q;  4FT2 A;  1VQM Q;  3CPW S;  2QGG A;  2LRQ A;  4EDU A;  1YJW T;  1YIT T;  2FVU A;  1JRI A;  1TG0 A;  1QCF A;  3FDR A;  2DL3 A;  4FSS A;  2E12 A;  3JB9 J;  4EIK A;  1KQS A;  4N4G A;  3CCV T;  2CP3 A;  2LNH B;  3I55 A;  2DEU A;  3G1J A;  1HYO A;  1YJ9 A;  2LZ6 B;  2KSS A;  4J9E A;  2RQR A;  1H3Z A;  2LX9 A;  2O9V A;  5A0L A;  3FEO A;  4OMF B;  4M7A F;  3KBG A;  1BBZ A;  2ECZ A;  1BYM A;  3JB9 D;  4E7H A;  2PTK A;  1IGQ A;  1NYF A;  2YUQ A;  2DIQ A;  3RDV A;  2NUP A;  2FZK B;  3VUB A;  1MMG A;  5CCA A;  2KE9 A;  5AT1 B;  1K0X A;  1K9M C;  1OU8 A;  1BK2 A;  1H92 A;  1EIF A;  2BE9 B;  1OU9 A;  1UFF A;  2RJC A;  4OML A;  2HBP A;  3V8L A;  1QVF P;  2CP2 A;  2OTL T;  3CC2 T;  2L89 A;  3M9Q A;  3EAE A;  1SEM A;  3KFV A;  3RKW A;  2EWN A;  1WNL A;  2EW3 A;  3CCL Q;  1UGR B;  4OGC A;  1PKT A;  2MYS A;  1G3Y A;  5GAM d;  4R55 A;  2YUN A;  2ZPF B;  1Y07 A;  4N4I A;  2DJZ A;  2ESW A;  2RJE A;  2QG9 B;  1AWW A;  2AKK A;  4JJB A;  3OYN A;  4HA8 A;  1X69 A;  1VQ9 Q;  2LX7 A;  4OMM A;  1QCN A;  2E6Z A;  4EMK A;  3CEY A;  1MV3 A;  3OYM A;  1I5O B;  2FG0 A;  3EGX B;  2VV5 A;  4MMK A;  2ABL A;  1VIE A;  2RJF A;  2HNI A;  2MAM A;  3OYF A;  4AG1 C;  1KK7 A;  3VU3 C;  3VS0 A;  5L23 A;  1JU5 C;  3QHS A;  1ABQ A;  4C8Q C;  2J05 A;  4RTX A;  3CC7 T;  4KH0 B;  4R0K A;  3PFS A;  4M7D C;  2OTJ Q;  1LNX A;  2KR3 A;  1BKB A;  2E3I A;  1OX9 A;  5KCO A;  1VQM T;  1W2B P;  2CP7 A;  2LNV A;  1YNZ A;  4M78 A;  2HSE B;  2LC4 A;  4BE0 A;  3JCM Q;  3L2Z A;  1WHL A;  1PRL C;  2EIF A;  4E47 A;  1OYX A;  2KXC A;  1VQ4 Q;  4DOV A;  4F04 B;  2GF7 A;  1M1K U;  3QWX X;  1QLY A;  4M78 E;  2HZY A;  4RMO A;  2KAF A;  3P8H A;  5KYY A;  2JNG A;  1VQK Q;  1TSF A;  2A36 A;  4JUV A;  2L3Q A;  2XK0 A;  4M77 E;  3E9F A;  1B7T A;  1ZQ1 A;  2COW A;  2YXY A;  2HD0 A;  3NFC A;  3THK A;  2KDS A;  3RNJ A;  2MWP A;  3EFO A;  5GAN 2;  1FMV A;  2V1R A;  1BU1 A;  2DBK A;  5LJ5 g;  3TSW A;  1K9M R;  1X2Q A;  2KVQ G;  3HRS A;  3VS4 A;  2Y4X A;  1YIJ T;  1EZZ B;  4BAC A;  3KUF A;  1EFN A;  1E6H A;  2DRM A;  2FYK A;  3OYE A;  5GAN 5;  1QMC A;  4R56 A;  3G6E A;  1AHJ B;  4PL6 A;  4XTU A;  4N0A C;  5IAY A;  3QZ5 B;  1KQ1 A;  4JLI A;  3P8B B;  4PJJ A;  3CPF A;  2DX1 A;  2ZPE B;  3M54 A;  3PE0 A;  1Q7Y U;  1Y57 A;  1IB8 A;  3URG A;  4C0Z A;  3CBM A;  2HSP A;  1KC8 R;  1TUD A;  2J6F A;  1WIE A;  2EYX A;  2XDP A;  1GFD A;  3X20 B;  2CZ6 B;  1KD1 R;  2CZ7 B;  4FYX B;  2NUT B;  4C0D C;  4MDW A;  3EHQ A;  2QQA A;  3VYG A;  2BKD N;  1XTD A;  2SEM A;  2DER A;  2IG0 A;  3FLG A;  5FRO A;  1JBM A;  1S72 Q;  4D8D A;  1M2O A;  3NHN A;  2I2L A;  2K5L A;  3OS1 A;  2DLP A;  4Y92 A;  3I35 A;  1M3C A;  5D6W A;  4IUT A;  1N9R A;  3OS5 A;  1FMW A;  1LVK A;  1Z9Z A;  3UAT A;  3VRZ A;  3CCM T;  4PKC C;  3OBW A;  4PJN A;  2RQW A;  3OYD A;  5GAN j;  2QTX A;  2MPX C;  3JV3 A;  3H0F A;  4DA4 A;  5GAO r;  1M3B A;  1KQS S;  1VQO Q;  3LGL A;  1M90 R;  1FX7 A;  2FL7 A;  1KIK A;  4LDW A;  2X4Y A;  2FPD A;  4M7D F;  2M0Y A;  3A8M B;  1AZE A;  1VQ8 T;  2WAC A;  4C8Q B;  1FMK A;  4F16 A;  3SFM A;  2EJF A;  5FW9 A;  4FM4 B;  2VXE A;  4FIB A;  4KGZ B;  3L2Q A;  4FCY A;  3EGU A;  1B34 B;  3A1P A;  3VS7 A;  4E7Z A;  3CCV A;  1WLP B;  1OPK A;  2P4T A;  2X3W D;  2MK5 A;  1RAF B;  3INZ A;  1WXT A;  1VQ5 Q;  1A0N B;  1E7O A;  1KJW A;  3VKI A;  3KXT A;  2M9U A;  2DYI A;  1K73 C;  4E7K A;  2DXT A;  1UEC A;  2YRC A;  5HY6 A;  3H0I A;  1R0B G;  4WCI A;  2ZPB B;  1M2V A;  4OB2 B;  3EFR A;  3GLX A;  1M30 A;  3I55 T;  3LH0 A;  1MHN A;  1RAA B;  4LD6 A;  3CC4 Q;  2LP5 A;  1WHH A;  1T0J A;  2AKL A;  2KRS A;  1YJ9 T;  4X9C A;  1VUB A;  4JRI A;  1N8R U;  1X6G A;  3G71 Q;  2DL7 A;  4XTX A;  3QII A;  8AT1 B;  3FB9 A;  4FU6 A;  3CPW A;  3BFM A;  2HKN A;  2P4R A;  4C92 G;  1WFW A;  3UT1 A;  3G6E Q;  5GAN e;  4GY5 A;  4J9D A;  3NTI A;  5A2Q E;  4PFZ A;  5D7U A;  2KGT A;  5HK0 A;  1YJN A;  1QVG P;  3G4S A;  2C0T A;  1D1A A;  5IXF A;  3MKD A;  4KBM B;  1JJ2 P;  2X35 A;  1KHI A;  3L2R A;  2EYQ A;  1YBY A;  5GMK e;  1BCM A;  2RHY A;  1PSE A;  4KUI A;  4M75 G;  2VAS A;  2EPD A;  4RTT A;  3CCR T;  3A98 A;  1RI9 A;  3UF4 A;  2P0K A;  2EJ9 A;  1ZLM A;  2R57 A;  3D7S B;  2RHZ A;  2QEX Q;  1XNI A;  1OOT A;  3M5A A;  3R6N A;  3O5Z A;  5EG2 A;  2DTH A;  1RAD B;  5GAN 7;  2JOY A;  2ZZD A;  5CQX A;  1WHJ A;  2K79 A;  2JTM A;  1IO6 A;  4E7J A;  2PZ1 A;  3LGF A;  4QKU A;  3EH1 A;  3OYJ A;  1OZ2 A;  3CQT A;  1HD3 A;  5LJ3 g;  1I81 A;  2O4X B;  1ZBJ A;  2DAQ A;  5J39 A;  3A5Z B;  4DQ2 A;  4RTV A;  3PGG A;  3J81 E;  3JCM P;  1ARK A;  5I22 A;  5IHI A;  1YJW Q;  1Q7Y C;  1YIT Q;  3UDC A;  5IHN A;  2ZPH B;  2DVE A;  3NPF A;  5GAM f;  3OSV A;  2PVD B;  4J9H A;  2MOX A;  5C0M A;  1W6X A;  5EC7 A;  3H9N A;  3DB4 A;  1WX6 A;  2IPO B;  1FYN A;  3CCV Q;  2EYY A;  4EMG A;  5IH2 A;  4VUB A;  4PLI A;  1WHM A;  4B9X A;  3ASK A;  1M27 C;  3PT9 A;  1VIF A;  2IIM A;  1YCY A;  3X28 B;  2XDD A;  1KQS P;  2YUP A;  1ZUU A;  1Y7X A;  2COZ A;  1BI3 A;  3I9Q A;  4GBQ A;  4LXC A;  4M7A A;  2M02 A;  4CC7 A;  3MP6 A;  1NG2 A;  4BI3 A;  3JB9 F;  1NPR A;  2D6F A;  2DL8 A;  1RAI B;  4E7S A;  1BIA A;  1TH7 A;  3VYH B;  2K3Y A;  4AFQ C;  4M7A E;  2DM1 A;  3SB2 A;  4NS5 A;  2PVO B;  2QQ9 A;  4JS4 A;  1VQ7 A;  4XAX B;  5CR2 A;  4NOY A;  1NJI U;  2DVJ A;  4JPB W;  4XTW A;  1QVP A;  4JJC A;  4ZGJ B;  1I5L A;  2OTL Q;  4MML A;  1CSK A;  1BI2 A;  2ENM A;  2LCL A;  1LPL A;  3CC2 Q;  3F70 A;  1UB4 A;  4HT9 A;  3M4G A;  5D6X A;  2WSF E;  4YTL A;  2F69 A;  3CCQ A;  3OQ5 A;  4PJO G;  1QKX A;  2AT1 B;  4HCC A;  2P84 A;  4JRK A;  4HVU A;  5GMK h;  3HRU A;  2E4H A;  1KG1 A;  1QW1 A;  1IZ6 A;  4D8K A;  5GAO l;  4ELZ C;  1K8A C;  3OMC A;  5J3B A;  2OX7 A;  2HBW A;  4OGE A;  4C92 B;  2DTI A;  4J5Y A;  2WSC E;  1GCP A;  4PJO C;  1NBE B;  1W70 A;  2O88 A;  4IKF A;  4LE9 A;  4LUE A;  2HAX A;  4NL3 A;  1AOJ A;  4J9B A;  9ATC B;  2K57 A;  1OEB A;  5GAN f;  3CC7 Q;  2CUB A;  1H8K A;  4DBQ A;  1Q7Y R;  1WJR A;  2E10 A;  1LOJ A;  3A8O B;  2EFI A;  4DBR A;  4DOW A;  3DKM A;  1Q82 U;  2IVW A;  3M0U A;  4A4G A;  3VS5 A;  3CD6 A;  2DE0 X;  2PQW A;  3HPW A;  2QA4 A;  1UEB A;  3L2U A;  5I11 A;  4M75 B;  1TUG B;  3TCJ A;  4CC4 B;  2FZC B;  3RMQ A;  2M16 A;  4QVC A;  3TEE A;  2FZG B;  1WQW A;  2DKG A;  1Q86 U;  1M1G A;  4FW2 A;  3OSS C;  3EGD B;  2MIO A;  5KYW B;  2A28 A;  5DLQ E;  3OS0 A;  2ROT A;  1OI1 A;  1SHF A;  1SG5 A;  1YIJ Q;  2ROL A;  4QQD A;  1NE8 A;  3TU4 K;  3QSU A;  4KT0 E;  2DXB A;  4LUD A;  2H3E B;  2K9G A;  2PU9 B;  3OYI A;  3QO3 A;  1ZSZ C;  1UGS B;  1VQL A;  3MCA B;  1ZBX A;  1RAH B;  3RIR A;  3E1S A;  4RG2 A;  4JS5 A;  3DB3 A;  2DEQ A;  2X4W A;  4AFZ C;  3UA6 A;  2CT4 A;  2KBT A;  2NUT A;  3MEV A;  4LDX A;  5I2M A;  3OB9 A;  4P5N A;  2AK5 A;  1KSW A;  4IIM A;  1K8A R;  5GAN 8;  1OQK A;  4C92 D;  1YJN T;  3GPL A;  1VQ7 Q;  3G4S T;  2LT1 A;  1NLP C;  1OX8 A;  2E64 A;  2JMC A;  3M55 A;  4F7U B;  4BDZ A;  4OMP A;  3LH5 A;  2L3S A;  4JRP A;  3CCR A;  1KC8 C;  3GF5 A;  1RLP C;  3PIP A;  3EH2 A;  1G83 A;  1KD1 C;  3I5S A;  2I0N A;  2QDY B;  2ZPI B;  4E2F B;  3M57 A;  2ATC B;  3CCQ Q;  3QBY A;  4EMK C;  2OJ2 A;  3CCM Q;  4IUR A;  3V7S A;  1Y71 A;  1GXI E;  4M78 G;  1SSF A;  3NTH A;  2LCC A;  1TUC A;  3L1A A;  1X27 A;  1N8R R;  2JS0 A;  3E2U A;  5CO7 A;  3MEW A;  2MF2 A;  2DZC A;  4M75 D;  4M77 G;  1X6B A;  2DXU A;  3TQ7 P;  1PC0 A;  4XU3 A;  2V1Q A;  3FIF A;  2M1H A;  4J7I A;  1UHC A;  2JVV A;  4KGX B;  1ZUK A;  4A54 A;  4QVD A;  1M4Z A;  2E3H A;  5LL6 S;  3E9G A;  4Z02 A;  4KRT A;  4C8Q A;  3EFS A;  4PJO B;  4M78 C;  1D3B A;  1M90 C;  2A37 A;  1X43 A;  3VJP A;  3GP8 A;  1VQ8 Q;  1B34 A;  2JTF A;  4M7D A;  2XG8 D;  4BE1 A;  2VGN A;  1IHW A;  2FPF A;  3TRE A;  4C8Q E;  4M77 C;  1C6V X;  3UWN A;  2K3X A;  2J6O A;  1ZSG A;  5GMK l;  1O75 A;  5KH6 A;  3CD6 Q;  1QP2 A;  4M7D E;  2XKO C;  1NEB A;  1SRL A;  3JCM g;  4C5H A;  1T3L A;  4GLM A;  2RD1 A;  4ME7 A;  3OY9 A;  5J26 A;  4PK4 A;  2LCS A;  4BD3 A;  2CKK A;  4XU0 A;  2QK0 A;  2GQI A;  1IHV A;  3MPU B;  2F2V A;  1I8F A;  1UGQ B;  5GAO n;  2EKO A;  1GCQ A;  3I55 Q;  3C12 A;  3GNG A;  5KYU B;  1WGS A;  4WF2 A;  1YJ9 Q;  4X9D A;  3PMT A;  3FRN A;  3SWN C;  1VQP A;  3OW2 S;  5GAN d;  3P8D A;  1IRE B;  1I07 A;  3T9N A;  1JEG A;  2L8D A;  1AWX A;  1SKU B;  1N5Z A;  4F17 A;  3S3O A;  3CXC S;  1CKB A;  4QT7 A;  3LWH A;  2BZY A;  1TTH B;  4XU2 A;  2RN8 A;  1RUW A;  3CPW P;  1EX4 A;  1VQL Q;  4DBH A;  1ZSZ B;  4N0A A;  1ABO A;  3V8J A;  2K4Y A;  1VQ7 T;  4RTW A;  2CGH A;  2BTT A;  1U1T A;  2DIG A;  2AIR B;  2XMF A;  1Q82 C;  4ZN3 A;  4A4H A;  4XTY A;  2HL3 A;  4OF1 A;  4ESR A;  3M4Y A;  4J6W A;  4V2S A;  3CCJ T;  1IXD A;  3CCQ T;  5FWC A;  3QZ9 B;  1J3T A;  1M8M A;  2E5K A;  1MV0 B;  3I5R A;  5M9O A;  5LJ5 h;  2KYB A;  4HCZ A;  3QDF A;  3JCM J;  5CKH A;  4ANJ A;  3HTR A;  4PLL A;  5KYX B;  3CCR Q;  1VA7 A;  5KE3 A;  4JDS A;  3NTK A;  4BI8 B;  4PJO D;  1ACM B;  3L42 A;  2LQK A;  2CH4 W;  1Q86 C;  1VQ6 A;  2LQN A;  1JB0 E;  2QQS A;  4QVZ A;  2KI7 A;  3C95 A;  2BZX A;  1BI0 A;  4EMK B;  4C8Q F;  1H64 1;  2ED0 A;  2EKH A;  4MZM A;  4C5G A;  2W0Z A;  5HKC A;  2Z0W A;  1Q81 U;  2HCK A;  4HCK A;  3L2V A;  2D0Q B;  4C0F A;  4JLG A;  2E65 A;  3RBB B;  2DFU A;  5GMK j;  3S3N A;  2O4X A;  3PNW C;  1W2B A;  3JCM W;  3X25 B;  1O9S A;  4L5G A;  2V8K A;  1VYV A;  4ZTJ A;  4M4Z A;  2QAZ A;  4Q5W A;  3MO8 A;  1V29 B;  3CD6 T;  3JB9 I;  3GOX A;  1I0C A;  3CCU A;  2QA4 T;  2AZV A;  4QQ6 A;  3REB B;  2BZ8 A;  3RKX A;  3V7C A;  4M78 B;  4RTU A;  5HCK A;  2LT4 A;  3HRT A;  2MI6 A;  5CAI A;  4M77 B;  2WSE E;  4CI0 C;  1OV3 A;  2G3R A;  2E41 A;  1U1S A;  4MDX A;  5KYY B;  2L3R A;  2ED1 A;  4LDV A;  3H8Z A;  1K76 A;  2F5K A;  2YT6 A;  3MP8 A;  2VC8 A;  5GAM g;  2AZS A;  3EFO B;  3HFO A;  4ZN1 A;  3QDR B;  1X75 C;  2KYM A;  1TXQ A;  4HVV A;  3MJX A;  2J6K A;  5FRN A;  1Q95 G;  4B9W A;  5LJ3 e;  2DL5 A;  4XQ3 A;  4BY6 B;  4FYY B;  1Q82 R;  1VQL T;  1YWO A;  4NL2 A;  4PJL A;  1VQP Q;  3EG9 A;  2X51 A;  5A0G A;  3SWN B;  2NUZ A;  3MEU A;  1G5V A;  1YI2 A; 
#chains in the Genus database with same CATH homology
 2RPN A;  2FRW A;  1CSK A;  2ENM A;  4JJD A;  1SEM A;  2EYZ A;  3KFV A;  2LMJ A;  3H0H A;  4Z88 A;  2EW3 A;  1T0H A;  1UDL A;  1PKT A;  1QWE A;  1QKX A;  2KNB B;  2RQV A;  2YUN A;  2JW4 A;  4HVU A;  2K6D A;  2ESW A;  1H3H A;  1AWW A;  4D8K A;  2AKK A;  4JJB A;  1X69 A;  2LX7 A;  3PVL A;  4OMM A;  2NWM A;  1B07 A;  2LQW A;  3M0P A;  2HBW A;  1MV3 A;  2W10 A;  2FG0 A;  1KFZ A;  4DEY A;  4RTZ A;  2ABL A;  2CSQ A;  2JM9 A;  2LJ3 A;  1GCP A;  1W70 A;  2EBP A;  2O88 A;  4AG1 C;  2HDA A;  3VS0 A;  4LE9 A;  5L23 A;  4LUE A;  1JU5 C;  1AOJ A;  1ABQ A;  1WI7 A;  2OAW A;  2J05 A;  4J9B A;  1GL5 A;  2H8H A;  1OEB A;  4RTX A;  1XOV A;  2CUB A;  1H8K A;  2FEI A;  4R0K A;  2GTO A;  3VS6 A;  2OI3 A;  3M0R A;  2FO0 A;  2JS2 A;  3M0U A;  1G2B A;  2KR3 A;  3NMZ C;  4AFS C;  3VS5 A;  1AZG B;  2DE0 X;  1QWF A;  1YNZ A;  2YUO A;  5I11 A;  1PRL C;  2KXC A;  1U5S A;  1NLO C;  4CC4 B;  1AWJ A;  1UJ0 A;  1BB9 A;  3QWX X;  1UGV A;  1QLY A;  2EVR A;  2K3B A;  2J06 A;  2EYW A;  2B86 A;  2A36 A;  2L3Q A;  1UHF A;  1T3S A;  2KXD A;  4HXJ A;  5IXB A;  2MIO A;  1K9A A;  3THK A;  3RNJ A;  2A28 A;  2D8H A;  1GBQ A;  2V1R A;  1WDX A;  2ROT A;  1BU1 A;  4X1V A;  2X3X D;  2DBK A;  1YWP A;  2DIL A;  3C0C A;  1RLQ C;  3TSW A;  1X2Q A;  4K11 A;  1SHF A;  2EGA A;  3VS4 A;  2M51 A;  4JZ4 A;  2ROL A;  1UE9 A;  1EFN A;  1ZUY A;  1SSH A;  3VRY A;  1E6H A;  2DRM A;  1Z9Q A;  1NEG A;  2RNA A;  4LUD A;  2K9G A;  2GNC A;  1U3O A;  2KT8 A;  1PKS A;  1X2K A;  1M3A A;  2DJQ A;  1PRM C;  3VS1 A;  2F2W A;  4AG2 C;  2DX1 A;  3H41 A;  2A08 A;  3PE0 A;  4ZNX A;  1YP5 A;  4AFU C;  1Y57 A;  4AFZ C;  3UA6 A;  2CT4 A;  2KBT A;  4LNP A;  2HSP A;  2RF0 A;  1TUD A;  2J6F A;  1WIE A;  2AK5 A;  2EYX A;  1GFD A;  1KSW A;  4IIM A;  3EG0 A;  2RQU A;  5ECA A;  3EHQ A;  2SEM A;  1NLP C;  2JMC A;  4OMP A;  3LH5 A;  4D8D A;  3NHN A;  2L3S A;  2JMA A;  2O31 A;  1RLP C;  1U06 A;  2K2M A;  1PWT A;  1UJY A;  1G83 A;  2DLP A;  4OMQ A;  4Y92 A;  3I35 A;  2I0N A;  3I5S A;  1M3C A;  1VYU A;  2KRM A;  2OJ2 A;  2EGE A;  2KRO A;  1Z9Z A;  3UAT A;  3VRZ A;  2C0O A;  1K0S A;  2CSI A;  2CT3 A;  4J9I A;  4JZ3 A;  1W1F A;  2RQT A;  4CC3 A;  2RQW A;  2YSQ A;  1TUC A;  2DNU A;  1X27 A;  2VWF A;  2JS0 A;  2DA9 A;  3M0T A;  2DL4 A;  1OPL A;  1AEY A;  3JV3 A;  3H0F A;  2EGC A;  1HSQ A;  1M3B A;  1X6B A;  2CRE A;  4HVW A;  2V1Q A;  4J9F A;  1UHC A;  1WA7 A;  2CUD A;  3M0S A;  1KIK A;  2HEQ A;  1ZUK A;  1S1N A;  1VYT A;  3NGP A;  2GTJ A;  4KRT A;  3M0Q A;  3GBQ A;  2FPD A;  2M0Y A;  2JXB A;  4J9C A;  3ZL7 C;  2YDL A;  2A37 A;  2JM8 A;  1X43 A;  1AZE A;  1FMK A;  1I1J A;  4F16 A;  2FPF A;  2LJ1 A;  4F14 A;  3IQL A;  5FW9 A;  2D8J A;  3EGU A;  2J6O A;  3VS7 A;  2DF6 A;  1ZSG A;  2K7A A;  1WLP B;  1OPK A;  1GBR A;  2DBM A;  4A63 B;  2X3W D;  4IIO A;  1NEB A;  1SRL A;  2VVK A;  1QKW A;  1WXT A;  2GBQ A;  1A0N B;  1E7O A;  1KJW A;  1CKA A;  1K1Z A;  2JTE A;  1T3L A;  2PNI A;  4GLM A;  1UEC A;  3H0I A;  2LCS A;  1NYG A;  4WCI A;  2GQI A;  1YN8 A;  2F2V A;  1AD5 A;  2DMO A;  1M30 A;  3UA7 A;  1GCQ A;  2J7I A;  2LP5 A;  4CC2 A;  1T0J A;  1UTI A;  2AKL A;  2KRS A;  5GJV B;  2FRY A;  2FPE A;  1X6G A;  2O9S A;  1JQQ A;  3SEM A;  2DL7 A;  1AVZ C;  1I07 A;  1LCK A;  3EG2 A;  1JEG A;  2DRK A;  2L2P A;  1AWX A;  2P4R A;  4E6R A;  1N5Z A;  4F17 A;  1WFW A;  1CKB A;  4QT7 A;  1ZX6 A;  2BZY A;  4J9D A;  2RN8 A;  1RUW A;  2RMO A;  4Z89 A;  2KGT A;  3QWY A;  1ABO A;  1B3Q A;  3TVT A;  2C0T A;  4RTW A;  2QDL A;  4DEX A;  2BTT A;  5IXF A;  2MCN A;  1JXM A;  2XMF A;  5GJW B;  3ULR B;  4ESR A;  4Z8A A;  2C0I A;  1E6G A;  4ORZ A;  3SHW A;  2JT4 A;  1SPK A;  5IHK A;  5FWC A;  1YCS B;  1Y0M A;  1J3T A;  1M8M A;  2E5K A;  1MV0 B;  3I5R A;  1GRI A;  2KYB A;  3VS2 A;  4LN2 A;  4J9G A;  2EPD A;  2EQI A;  1NM7 A;  2O2O A;  4RTT A;  3A98 A;  5FWB A;  1RI9 A;  1VA7 A;  1WYX A;  2CH4 A;  2G6F X;  1PNJ A;  2GGR A;  3VS3 A;  3UF4 A;  3PVQ A;  2CH4 W;  2DYB A;  2LQN A;  3EG1 A;  1ZLM A;  1OOT A;  2BZX A;  2SRC A;  2D0N A;  3R6N A;  3O5Z A;  2ED0 A;  2EKH A;  2W0Z A;  1MUZ A;  1SHG A;  2HCK A;  4HCK A;  3EHR A;  1AWO A;  2K79 A;  2L3P A;  1IO6 A;  2PZ1 A;  3RBB B;  1V1C A;  2L0A A;  4RUG A;  2KEA A;  1SRM A;  3CQT A;  2KT1 A;  1HD3 A;  1VYV A;  2CDT A;  1ZBJ A;  1PHT A;  4M4Z A;  1HJD A;  3REA B;  4RTV A;  1UG1 A;  1ARK A;  5I22 A;  1I0C A;  3TSZ A;  5IHI A;  2VKN A;  2AZV A;  2LJ0 A;  2BZ8 A;  3NPF A;  5IHN A;  3REB B;  1TG0 A;  1WXB A;  1QCF A;  4J9H A;  2DL3 A;  2MOX A;  4FSS A;  1W6X A;  5EC7 A;  4RTU A;  5HCK A;  1WX6 A;  4EIK A;  1FYN A;  2LNH B;  2EYY A;  2F2X A;  1OV3 A;  5IH2 A;  1GCQ C;  1WXU A;  2LZ6 B;  4J9E A;  2ED1 A;  2RQR A;  2O9V A;  1K4U S;  1M27 C;  1K76 A;  2YT6 A;  2IIM A;  1BBZ A;  2ECZ A;  1JXO A;  3FJ5 A;  2YUP A;  2AZS A;  1UUE A;  2PTK A;  1NYF A;  1ZUU A;  2YUQ A;  3I9Q A;  4GBQ A;  2KYM A;  4CC7 A;  4HVV A;  1NG2 A;  2KRN A;  2D1X A;  2J6K A;  2DL8 A;  4RTY A;  1JO8 A;  2DL5 A;  3U23 A;  2KE9 A;  3EG3 A;  4AFQ C;  1K0X A;  1YWO A;  2DM1 A;  1BK2 A;  1H92 A;  4OMO A;  1GFC A;  1UFF A;  4OMN A;  2DVJ A;  2NUZ A;  4OML A;  4JPB W;  4JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...