3DB3A

Crystal structure of the tandem tudor domains of the e3 ubiquitin-protein ligase uhrf1 in complex with trimethylated histone h3-k9 peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
157
structure length
140
Chain Sequence
WDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Recognition of multivalent histone states associated with heterochromatin by UHRF1 protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 140
sequence length 157
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12148 TTD Tandem tudor domain within UHRF1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3db3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3db3A01
3DLMA 3CMAT 3MO8A 3LGFA 5IN1A 2RI3A 4N4GA 5IT9E 1JJ2A 1YITT 1W2BS 3KUFA 4BDYA 2E5QA 3M9QA 1YJWT 2GF7A 2LQ8A 3CCQT 1VQLT 3NTIA 3QBYA 3CCVA 4X34A 2HQXA 5CIUA 2K3XA 1VQNT 2QEXT 3LYIA 4N4IA 3G4ST 1NJIU 3OYCA 2RHYA 4QQDA 2R5AA 1NPRA 3CMAA 2M1HA 1Q86C 3CC4A 3LX7A 3PNWC 4BE1A 3OS2A 4IUVA 4C5GA 2MWPA 3CCQA 1VQLA 3CC2T 4C5EA 3FLGA 3MEVA 3OYLA 2DAQA 1YHQA 3NTKA 4IUPA 4A4EA 5J39A 3A5ZB 1WJQA 2E6NA 2QA4T 1NJIC 2DIQA 5KCOA 1JJ2S 3Q1JA 3CCSA 4FU6A 1VQPT 3UWNA 3I55T 3OS1A 1OI1A 2MWOA 3ZEHA 1VQ9T 1Q81C 2EFIA 3LGLA 3L2QA 2JOYA 3NTHA 3OYYA 3J7AF 1VQ7T 3F70A 3I56T 3CCUT 2XK0A 3ASKA 4IUUA 3G71T 4IUTA 1VQKT 1VQ6A 3C4SA 2OTLT 3OYNA 2EQJA 4QQ6A 1M90U 2LCLA 2RO0A 3EAEA 1YJ9T 5M9OA 1VQPA 1K9MU 3CPFA 5D6XA 4CRIA 1K8AC 3CD6T 1VQ4T 3S3NA 3META 3CCRA 1YIJT 3P8BB 1OZ3A 3S3OA 1X6OA 3TREA 1H3ZA 3OS0A 5KE3A 2RHIA 3CCEA 2RHXA 1NZ9A 1XNIA 3PMIA 2OTLA 2OTJA 4Z02A 1VQOA 1VQ8T 5D6WA 4BACA 1YJNT 1QVGA 3CCLT 3QJ6A 3CPWS 4PLIA 3OW2A 3OYHA 2LVMA 1N8RC 2F5KA 5KH6A 4PL6A 4QW2A 3MP8A 4FL6A 3MEUA 3OQ5A 5FLXE 4E7JA 4BD3A 2L89A 1QVFS 3MP6A 1Q86U 3G6EA 3L2WA 2EQMA 5J3BA 3CC7T 2BUDA 4N4HA 2RHZA 1S72A 1Q82C 1K73U 4C5IA 3HKSA 5DM7R 4NS5A 2R5MA 1M1GA 2O4XA 2XHCA 2KVQG 3OMGA 3DB3A 3J81E 1YITA 2G3RA 3L42A 2E6ZA 2KDSA 1QVGS 3FDRA 1YJWA 1Q81U 3S6WA 1VQNA 2QEXA 5KCHA 1K73C 3CCJT 1M1KU 3ER0A 2O4XB 3G4SA 2XDPA 3QKJA 1KQSA 2JTFA 2RI5A 3E9GA 1MHNA 1K8AU 4ZTFA 5FRMA 2IG0A 3CC2A 4IURA 1M1KC 3CCJA 1NPPA 2D9TA 2QA4A 1XTDA 2DIGA 1IZ6A 2LDMA 1KC8U 3MP1A 4E7KA 3I55A 1VQ9A 2B8AA 4Q5WA 1VQ7A 3I56A 3CCUA 2EQKA 5IAYA 3CEYA 1N8RU 5FROA 3G71A 1VQKA 3L2VA 2JVVA 3OYIA 3MEAA 4RG2A 3CXCA 1KC8C 4BE2A 3JAME 1YJ9A 3LLRA 4EDUA 1SSFA 2WACA 2JNGA 3OYEA 3CD6A 1OZ2A 1VQ4A 3L2UA 1VQMT 1YIJA 1OYXA 3ME9A 4QVZA 2EIFA 3OYDA 2GFUA 2X4WA 1Q82U 4QQGA 4L59A 1KHCA 4IKFA 2DO3A 4A4HA 4C5HA 5A2QE 2RJFA 4PLLA 5LL6S 3H6ZA 1Q7YC 3PIOA 3KBGA 1KHIA 4HCZA 2QQRA 1VQ8A 2R58A 4ZN3A 3CCVT 2EQUA 1YJNA 3CCLA 2EKOA 2JZ2A 4UC4A 3OA6A 3DLLA 3P8DA 2X4XA 4B9WA 3CC4T 3CXCS 2RI2A 2CKKA 3DB4A 3OY9A 2LRQA 4OVAA 3OYAA 2MI6A 3CC7A 3OYMA 1YHQT 3OW2S 5FRNA 3SD4A 5DLQE 2K3YA 2FHDA 4BE0A 4ZTJA 5C0MA 3PFSA 3CCST 4YTLA 4A4GA 2L8DA 1N27A 4TVRA 3O8VA 3GOXA 2NLUA 5D6YA 3FC3A 3OMCA 4ZN1A 4GY5A 3OYJA 1VQ6T 4E7IA 1WJRA 2E70A 3MEWA 1WJSA 3E9FA 3BDLA 4B9XA 2RJCA 2VYTA 3OYBA 1G5VA 3H8ZA 3CCRT 1WGSA 3CMET 3UT1A 3CPWA 3S3MA 4LD6A 3CCET 5J26A 3OYFA 4E7HA 1KD1U 2LCCA 1UEBA 2OTJT 1VQ5T 1YI2T 1VQOT 3PMTA 2GFAA 1QVFA 1KQSS 2QQSA 3QIIA 1W2BA 2RJEA 5KE2A 2M0OA 1Q7YU 2PQWA 3L2RA 3CCMT 2M16A 4II1A 3LH0A 3OYKA 3CMEA 4IUQA 5C6SA 3FEOA 3J80E 1YBYA 3PIPA 4A4FA 1BKBA 1KD1C 5HY6A 2YRVA 2P0KA 2HQEA 4BDZA 2JUFA 3OYGA 1M90C 1VQ5A 1YI2A 2X4YA 2R57A 3G6ET 2RJDA 2LTOA 2BKDN 1K9MC 1RI0A 2RHUA 4E7LA 3CCMA 3P8HA 2BIVA 3OB9A 1EIFA 1S72T 1VQMA 1RL2A 2L3RA 2X35A
chains in the Genus database with same CATH superfamily
1VQMQ 1WHLA 1Z9ZA 5IT9E 1E6GA 3HHTB 1WA7A 3MCAB 2ZPBB 4E7SA 2K57A 3HRSA 1T3SA 4AG1C 1AZEA 2QQAA 4M7DD 2HQXA 1BCOA 3LYIA 2HEQA 3GF5A 2O88A 1PKSA 1RAHB 4M77F 2RQRA 4BUGA 4PJMA 2CZ0B 3RKXA 1GCQA 3CMAQ 3PNWC 4BE1A 3OS2A 3RIRA 2KI7A 2YXYA 3CC4Q 2FL7A 4C5EA 2P0PA 3HL8A 2YUNA 2DAQA 4C8QG 1YHQA 3NTKA 2P84A 1JQQA 2J7IA 1N9RA 1ZUYA 4RKUE 2YWWA 4XU2A 2E64A 3OBYA 2KEAA 4XQ3A 1B7TA 1Y57A 1WIEA 1VQPT 4AFSC 3I55T 4DBFA 4JLIA 1OI1A 2MWOA 1VIEA 1VOMA 4LDUA 4WTOB 2BZXA 2DBMA 4C8QE 1JU5C 3RMQA 3ASKA 3EGXA 2ZCFB 2MF2A 3G71T 1D1BA 4DA4A 2C0OA 4MMLA 2D8JA 2H8HA 3T9NA 2KYMA 4HCBA 4QQ6A 1IHVA 2PVDB 3G1JA 1D09B 2E1HA 4PFZA 4M7AB 5M9OA 4JRKA 1Y07A 3CD6T 1TH7A 3P8BB 2YLBA 3REAB 1OZ3A 4XU1A 4MDWA 5KYWA 4GLMA 4JZ4A 4M7AC 1H3ZA 5KE3A 2KRSA 4M75A 4C8QF 2DPPB 3E1SA 5GJVB 4MDXA 1JEGA 5KYYB 1NZ9A 2OTLA 1V76A 3THKA 4LDXA 1T0JA 5EC7A 4O6JA 2SEMA 1ZA2B 1MV0B 1QVGA 1IB8A 5CKFA 4BI4A 5CKEA 1DJ7B 1WQWA 3EGDB 2EGCA 1ZSZB 1EX4A 4M7AG 4RTTA 4PJLA 3GIBA 3MP8A 3OQ5A 4E7JA 2L89A 1Q86U 3G6EA 2H3EB 2XICA 4JJDA 3CBOA 3C94A 2BUDA 2RPNA 2RHZA 2J06A 2JM9A 3EHRA 1M90R 3QG1A 3JB9I 1X6BA 1SF9A 2O4XA 2FRWA 2XHCA 2KY9A 1U3OA 2FO0A 2LJ3A 4PKCC 2Y4YA 1Q81U 1YITQ 4ELZC 1YJWQ 2MOXA 2QEXA 5I22A 1K73C 4R0KA 3ER0A 3G4SA 4Z89A 5GAOl 3EG1A 1VQNQ 2PZ1A 4A4KA 1OOTA 2K6DA 1BI0A 1GCPA 2V8IA 2KYBA 2KNBB 4LXCA 4QVDA 5LJ5j 1FMWA 3X28B 1M2VA 3VKIA 2GCXA 5GANj 1K8AU 2HL5C 5FRMA 4OGEA 4JDSA 2KQWA 1HYOA 5KYUA 3VYHB 2Z0WA 1BB9A 3CC2Q 2QA4A 4AG2C 4V2SA 1SHGA 2MK5A 1M4ZA 1KC8U 2DL5A 1K76A 5GMKj 2FPDA 2F1LA 2FPEA 3AHUA 1OPKA 2RK1A 5FWBA 3EGXB 1XJWB 2XKOC 1RAIB 4Q5WA 1LOJA 4FYVB 2X3XD 2V1QA 1RADB 3OSVA 1VQ9Q 3L2VA 3I56Q 3CCUQ 3URGA 3JCMh 2CZ7B 2C06A 2AK5A 4PJJA 1G2BA 3CXCA 1ZUUA 2BZYA 2YUOA 4BE2A 1JO8A 2RF0A 3LLRA 1YJ9A 4EDUA 4X9CA 4BY6B 3SWNA 3QDRB 2LQKA 1KQ1A 3JCMJ 1IRXA 3V8LA 1VQ4Q 1D1CA 1Q82U 3NGPA 2DO3A 4BY6C 4C5HA 2LMJA 1LJOA 2RJFA 3BW1A 3QWYA 4M7DB 4PLLA 4J7IA 4HCKA 3KBGA 1KHIA 3RUXA 9ATCB 4HCZA 1VQ8A 2WSCE 4JPBW 1YJNA 4M7DC 2EKOA 2AZVA 2JZ2A 4RTYA 5GAN4 1H3HA 4HT8A 3OA6A 2DBKA 2CT4A 3DLLA 2DJZA 1O9SA 2ZPFB 1MNDA 1I4K1 2COYA 2CKKA 1KG1A 2DNUA 3RNJA 1BI2A 3REBB 2QTVA 1BI3A 4C8QD 2MI6A 4OF1A 1YHQT 1E6HA 4LNPA 3SD4A 1ARKA 4NL3A 2CH4A 5LJ5e 2PVOB 1I07A 5GANe 4LUDA 2L8DA 5GMKm 1UGQB 2HL3A 3M55A 4FYYB 2V1RA 2NLUA 1QKWA 3FC3A 1KJWA 2GQIA 3MJXA 3VS4A 5LJ5f 2Y4XA 4E7IA 2AIRB 2E70A 5GMKe 4E7ZA 5GANf 5LJ3j 3BDLA 3FRNA 4EPCA 4X1VA 4E6RA 3JB9H 1TUCA 2DL4A 2H3JA 1G5VA 3H8ZA 5CQXA 4MZPA 3UT1A 3CMET 3NFCA 1K73R 5HKCA 1C0MA 4JZ3A 4ME7A 2EYXA 2E65A 3JRZA 2LQNA 4AMCA 1CSKA 4IIOA 2BE7D 1VQ6Q 1VQ5T 2V8JA 2GFAA 1QVFA 1KQSS 2RJEA 2VVKA 3DKMA 3GNGA 1Q7YU 1BCMA 1W6XA 3HFNA 3L2RA 2M16A 4PFOA 1RABB 2YSQA 4II1A 4PJOG 2K5FA 1G3YA 2EPDA 1R77A 1UE9A 2CP5A 1KQSP 2M0YA 4LDVA 2FZGB 1BKBA 1KD1C 5HY6A 2HQEA 4BDZA 1YI2A 2X4YA 2R57A 3G6ET 2RJDA 3M0PA 2BKDN 1RI0A 4DBHA 2L3SA 2XG8D 5FWCA 2KGTA 1EIFA 4M4ZA 3CCMQ 1VQMA 3NMZC 1RI9A 4JUVA 2FZKB 3VUBA 1QKXA 1HK9A 7AT1B 3DLMA 4MZTA 3QSUA 2JJ9A 5IN1A 3WXMB 2YT6A 1JJ2A 1W2BS 1B3QA 2DTOA 2E5QA 4HCCA 1NEGA 2CSIA 2VC8A 1LVKA 4DEXA 2GF7A 4XU3A 2K3BA 2ROTA 3CCQT 2DVJA 1VQLT 1EFNA 2EWNA 4R55A 2M02A 3L2ZA 2HQHA 2VGNA 2DXBA 1JB0E 3M0SA 4PJOF 4KH0B 2QEXT 5FU7B 4C0DB 1W2BP 3G4ST 1NBEB 1NJIU 2KXCA 2RHYA 2K2VA 4QQDA 2R5AA 3CMAA 1Q86C 5FU7C 4C0DC 3CC4A 1SEMA 1X43A 3VS7A 4F7UG 4IUVA 5DLOA 2QASA 5I11A 1LPLA 1T0HA 3FLGA 3OBWA 3JCMb 5LJ3e 5L8RE 1GXIE 1SG5A 4IUPA 4A4EA 5J39A 2QA4T 5KCOA 1GBQA 3Q1JA 3X20B 1ACMB 2ESWA 3V7SA 2HKNA 1PD1A 3UATA 1UB4A 1Q81C 3LGLA 5LJ3f 2LQWA 3OYYA 4HVVA 2J6FA 2E41A 4M7AA 1H8KA 3VYGA 2DM1A 3D7SB 2EQIA 4WCIA 3QPHA 4M77C 2D0NA 1M3BA 4MMKA 3OYNA 3GLXA 4F16A 5GJWB 5GAN7 5KYYA 2RNAA 2RO0A 4KUIA 1YJ9T 2XDBA 4QKUA 1K9MU 1OULA 2DXUA 2CREA 4CRIA 1K8AC 3S3NA 1VQPQ 3S3OA 3MHXA 1X6OA 3CCRQ 3OS0A 3V8JA 1M5Q1 2RHIA 4M77G 3RKYA 1WFWA 5LJ5d 2RHXA 1OX8A 2DE0X 4Z02A 5GANd 5IHIA 1UGSB 1VQ8T 4ZNXA 5D6WA 1M3AA 2J6OA 1AEYA 2OTJQ 1YJNT 1U8RA 2RQVA 4EMKB 2CT3A 4J9BA 2K9GA 2JTMA 3CPWS 3OYHA 2LVMA 2F5KA 2O9VA 5KH6A 2JMCA 3LWIA 3A8HB 4EMKC 1M2OA 3A8MB 2QDLA 1FX7A 5AT1B 3MP6A 4C8QB 3CPWP 4PK4A 5HK3A 2COZA 5J3BA 3ZL7C 3JCMQ 2ABLA 3UDCA 2P4RA 2EJFA 1KD1R 4M78E 4IIMA 4C8QC 1Q82C 3M0RA 3TU4K 1UFFA 4C5IA 2HSEB 1S72Q 1AWXA 1WI7A 2NUTB 2R5MA 4OMOA 1RLQC 3OMGA 3DB3A 1D0YA 3J81E 1YITA 2EYWA 3L42A 5GAN8 2E6ZA 1JXMA 2FZCB 1QVGS 2QI2A 3QHSA 1YJWA 4CI0C 5GAN6 2RK2A 2DMOA 2CZ1B 2BE9B 2L5QA 3H41A 1BIAA 1QP2A 1IO6A 1VQNA 5KCHA 3CCJT 1M1KU 3V7RA 4M78F 1G3WA 1WHGA 3UF4A 1QVGP 4QT7A 2PTKA 4C92E 1YN8A 2PUOB 2RI5A 3E9GA 4JRQA 4XAXB 5CQYA 2KE9A 3CC2A 4FIBA 1GL5A 4RCBA 1QLYA 1MNEA 4OMPA 4EMGA 1R8OB 1NPPA 1Q86R 3VS3A 2D9TA 1RACB 5GAMg 4KULA 1IZ6A 1BIBA 2CP3A 3EG9B 3VUZA 2F2VA 5GAOr 3MP1A 4JJNK 4C92F 4PJOD 4KH1B 1RLPC 5LJ5g 1VQ9A 2ZPIB 2IVWA 5L23A 2K4YA 4N0AC 1VQ7A 3I56A 3CCUA 4VUBA 5IAYA 1XQHA 2KAFA 3CEYA 4OMLA 2QGFB 2JVVA 1VQKQ 4FSXA 2HMAA 1T3LA 2HBPA 2EBPA 3FJ5A 4M7DA 2KROA 1SSFA 1RAGB 2X4JA 3OYEA 2GGRA 1M1FA 2QGGA 1VQ4A 3A8GB 2DD4A 1VQMT 3PT9A 5LJ3d 3ME9A 3EFOB 2EIFA 1OQKA 1JXOA 1YIJQ 4L59A 4LN2A 1VA7A 4E47A 5A2QE 3JSCA 1K8AR 4PFPA 3H6ZA 3SHWA 1Q7YC 1X69A 4D8KA 2R58A 2E10A 4CC4B 1K4US 1S1NA 3M56A 4AT1B 1PD0A 2YHTA 3WVEB 4J9EA 1WHKA 4J83A 2LZ6B 4J8OA 1HJDA 1WYXA 4FW2A 1QWEA 3CCLQ 2HAXA 2ZPHB 2CP0A 3JB9F 2OAUA 1IGQA 2I0NA 3VS0A 4B9WA 3CC4T 3CXCS 3ULRB 1UDLA 1X2QA 3JCMe 1NYGA 4KBMB 3QYHB 4XK8E 4KT0E 1UGRB 3OW2S 5FRNA 2XDDA 3CXCP 2DA9A 3CC7Q 2FHDA 3M58A 3JCMc 2GTJA 2A36A 2LJ0A 4ZTJA 1FYNA 1F1BB 4Z8AA 3RR6A 3JCMf 4PJOA 3JCMV 3OW2P 3O8VA 1D0XA 1FMVA 1Y7XA 4FT4A 4KGZB 2DXCA 3SEMA 1Q82R 3OMCA 4ZN1A 1U1SA 4J9CA 1OPLA 2DL8A 5GAOq 3C12A 1WXBA 3A8LB 2M51A 1PKTA 3UA7A 2RJCA 3OSSC 5GMKl 4FSSA 3M4YA 1TOVA 2RA2A 2YLCA 2DILA 2CDTA 4RTXA 2XIDA 4M77D 4LD6A 2BZ8A 5D7UA 1UJYA 3OYFA 1HXDA 3VU3C 1MMGA 2LCCA 1UEBA 2LNHB 3PMTA 4RCCA 1RAFB 2CP2A 4DBQA 3VRZA 2JTEA 4RTWA 1WXTA 4DOWA 1WNLA 3LH0A 2AKKA 2KBTA 1M9SA 2IIMA 3FEOA 3TSZA 2RH2A 3J80E 4A63B 1K1ZA 1BBZA 3CMEQ 2YRVA 2DTHA 1K9AA 4F7UA 2LTOA 1JRIA 1K9MC 1OU8A 1KFZA 1VQ5Q 2FB7A 4E7LA 3X24B 4J9HA 3CCMA 1IREB 3P8HA 4EMHA 1K0XA 2W10A 4HT9A 2A0FB 1NM7A 1RL2A 2VASA 1X75C 1I81A 2LCSA 1Y96B 1PC0A 3LWHA 1X6GA 2LT1A 1SKUB 2RI3A 4HA8A 1YITT 2DRMA 3PE0A 4CC2A 1WLPB 3M9QA 2CS7A 1YJWT 4A53A 1MMDA 3QBYA 3NTIA 4C0GA 1NG2A 3CCVA 4X34A 1I5OB 1UECA 2CP6A 2K3XA 1VQNT 4N4IA 3QZ9B 3OYCA 1Q7YR 2M1HA 1UJ0A 4MZMA 2DF6A 1QVPA 3LX7A 3PGGA 4C5GA 4Y91A 2DD5A 2DRKA 3X26B 2CUDA 3CC2T 4LD9K 4M77A 2EYYA 3OYLA 3CCQQ 1VQLQ 3A5ZB 3I35A 2E6NA 4M75E 4PJOB 2DZ9A 2L2PA 2VKNA 2QYZA 1JJ2S 2KRNA 1AWJA 5ECAA 1NLPC 2CGHA 3UWNA 4FW1A 3ZEHA 1VQ9T 4A54A 1FXXA 2EFIA 3CCSQ 2JOYA 1YWOA 1LCKA 3A1PA 4PJOC 2GBQA 3J7AF 1VQ7T 3I56T 3CCUT 5CAIA 2QG9B 2XK0A 4IUUA 1M8VA 1JJ2P 4ZGJB 3HFOA 5EG2A 3VS2A 3C4SA 1OV3A 2OTLT 2DX1A 1R0BG 1ZLMA 2GQVA 4L5GA 4OP0A 1RAEB 4M75F 2AT1B 4OB1B 1C1AA 1VQPA 4F04B 5CKHA 2CH4W 1GFCA 1N5ZA 5CVIA 3JCMd 4R56A 2KXDA 1VQ4T 1UUEA 3CCRA 3GP8A 3M0TA 1QCFA 1TU0B 3TREA 3KFVA 4EMKA 4LDWA 3PMIA 3N5BB 3A8OB 1I5LA 1R0CB 4ZGDB 5GAMh 3CCEQ 2OTJA 4KUDK 2QTXA 4FT2A 1B07A 1GBRA 1C6VX 3RKWA 1QCNA 4AFQC 1J3TA 1VQOQ 1SPKA 1PRLC 4C8QA 3TSWA 4FCYA 2A3LA 4JS5A 1CKBA 1M8MA 1Y71A 2MAMA 4F7UB 4Z88A 4FL6A 1HSQA 5FLXE 3BY7A 4BD3A 3R6NA 1QWFA 1G8XA 2NUTA 5A0DA 3L2WA 2F69A 2EQMA 4OGCA 1U5SA 4N4HA 1G3SA 1M3CA 1S72A 2K79A 1TTHB 2ZGWA 1I0CA 1K73U 3MPUB 1TUDA 2V26A 1OX9A 5DM7R 2C0IA 1K9MR 1QCOA 1WDXA 3VV0A 2CUBA 2QQBA 1M1GA 2KVQG 3H0IA 2YUQA 2DETA 2HCKA 5GAN2 5DY9A 2KDSA 3FDRA 3BE3A 4OB2B 4QVCA 1NLOC 3TCJA 4BI3A 2O9SA 2MPXC 4J6XA 1KQ2A 1M27C 4J6YA 3EG0A 1PCXA 2X3WD 4CC3A 2XDPA 2C0TA 5I2SA 1KQSA 2M9UA 2RQTA 3M59A 4ANJA 4XTXA 3M57A 4M77B 4J9DA 3BFMA 5KYNA 4N0AA 4C0FA 3EG9A 3M0UA 2D0QB 3QUIA 2LP5A 2EAYA 1X01A 3H9NA 3CCJQ 2DIGA 2LDMA 2VUBA 1M30A 3LH5A 4E7KA 2AHJB 1YWPA 2ZZDA 4PJNA 1D3BB 4OMMA 3I55Q 1MUZA 1BK2A 3BDUA 1N8RU 1VQKA 3NPFA 1AT1B 2A28A 2LJ1A 3OYIA 2ZAEA 3EFOA 2DFUA 4J5YA 2XU8A 3G71Q 5IXBA 2RB6A 1KC8C 1RUWA 2FPFA 2A08A 2DEUA 2ED0A 2LT4A 2JNGA 1OZ2A 4J9FA 1YIJA 1OYXA 2PUKB 1SHFA 3NHNA 3OYDA 3CD6Q 2GFUA 2X4WA 4M78G 4QQGA 3V7CA 3GPLA 2E3IA 1BYMA 2EGEA 4O5VA 2EJGA 1ZA1B 3EG3A 1VIFA 3TVTA 1A0NB 3TEEA 2QQRA 4ESRA 3CCVT 4C0ZA 2HD0A 5GAOp 2EQUA 1WZOA 1G3TA 2DLPA 3CCLA 5FW9A 5A0LA 8AT1B 4M75D 4UC4A 1XOVA 1V1CA 3H0FA 3JCMX 2QQ9A 5CR2A 2K7AA 2ED1A 2NUPB 2HZYA 2RI2A 2EJ9A 1WPYA 4C92G 5FU6B 5GAOn 3DB4A 4OVAA 4PNOA 1PWTA 4RG8A 5GAN5 4F17A 3OYMA 3CC7A 1UGPB 2RMOA 2BTTA 1CKAA 5DLQE 5FU6C 4DQ2A 2K3YA 4BE0A 4Y92A 4F14A 3PFSA 1FMKA 1D0ZA 4YTLA 2DKGA 2E3HA 3M53A 4A4GA 1H92A 2AKLA 1SSHA 5CO7A 1ZQ1A 2EVRA 4JJCA 3U23A 3GOXA 2OAWA 5D6YA 2COWA 3GBQA 4GY5A 2K5LA 2B86A 3OYJA 4BI8B 3QXEB 3SB2A 4AFZC 1WJRA 3EH2A 4XTYA 3M0QA 1WJSA 3E9FA 2O2OA 2QK0A 3GNFB 4X9DA 4P5NA 1SRLA 2VYTA 3OYBA 3CCRT 4JRPA 1WGSA 3CPWA 4L6V5 1QQJA 2CP7A 3S3MA 5GANg 1UHFA 1RAAB 3JB9G 1PM3A 4E7HA 1KD1U 2OJ2A 2OTJT 2PU9B 1YI2T 5IHKA 1I8FA 2QQSA 3QIIA 2G6FX 1Q81R 5KE2A 1AZGB 1PNJA 2VGMA 2M0OA 6AT1B 4J9IA 2QAZA 2XMFA 1VYUA 3V8KA 4IUQA 3CMEA 2L3PA 5C6SA 1VYVA 2VV5A 4HVUA 4JJBA 2OX7A 1YBYA 3PIPA 4FM4B 4A4FA 4NL2A 4ORZA 2JUFA 2Y90A 3OYGA 1VQ5A 2ECZA 2W0ZA 1Y96A 2HBWA 4ZGEB 3VS1A 3EFSA 2RHUA 3M4GA 5GMKi 1X2KA 4XTZA 3RESA 3OB9A 4DBRA 2XD0A 1S72T 2DYIA 2HSPA 5CKDA 2L3RA 2EYZA 1ABQA 3G7ZA 1YNZA 4Y28E 3MO8A 1KC8R 3CMAT 3LGFA 3UPUA 2LNVA 4N4GA 2A37A 1YP5A 4BDYA 3KUFA 1WHMA 1UGVA 2CZ6B 1ZSZC 1V29B 3UA6A 1BI1A 3A98A 2LQ8A 2EGAA 3C0CA 1WQ7A 2O01E 5CIUA 4RMOA 4M7AE 1OEBA 3FIFA 3EG2A 1Z9QA 1NPRA 1YFNA 3R6OA 4LE9A 4RTZA 1JBMA 1P92A 1WX6A 1ZBJA 1TUGB 2E12A 2MWPA 2RQUA 3CCQA 2HDAA 1VQLA 3MEVA 1IHWA 4BB7A 2ROLA 2DZCA 2EW3A 3PTAA 4ELYC 5GAMj 1VYTA 1WJQA 4M7AF 1NJIC 4DOVA 1TG0A 2DIQA 1MV3A 1YHQQ 1HD3A 4HKEA 2YRDA 3SDZA 2KR3A 4ATOA 3CCSA 4FU6A 3OS1A 1GCQC 3L2QA 3NTHA 2F5TX 3F70A 3RMSA 2DERA 2JW4A 4IUTA 1VQKT 1KSWA 2PNIA 1LNXA 1VQ6A 3PVLA 1ZUKA 2WSEE 4WF2A 2EQJA 1M90U 3QWXX 1KK7A 2LCLA 5LJ3g 3EAEA 3M54A 5IH2A 1MGQA 3CPFA 5D6XA 2JT4A 1OU9A 5AYFA 3META 1YIJT 4OMQA 1WHJA 1U1TA 1EZZB 4M78D 3SFMA 1NE8A 2KK4A 1VQ7Q 2KMTA 3CCEA 4HXJA 1FWZA 1UHCA 3RDVA 1XNIA 4OB0B 4KGXB 3HRTA 3ZBDA 1VQOA 2OTLQ 1WHHA 5KYWB 1AVZC 2K5IA 1G83A 4J9GA 4BACA 2NYSA 3CCLT 3FB9A 4M75B 4AFUC 4DEYA 2D1XA 3QJ6A 3QJYA 1PHTA 3HSBA 2ZPEB 2D8HA 4PLIA 1H641 3OW2A 1N8RC 1PSFA 2KSSA 4JRIA 4PL6A 4CC7A 4E2FB 5I2MA 2SRCA 3WVDB 4QW2A 5HK0A 4M75C 3MEUA 3JB9J 4C92D 1QVFS 3ZFJA 2EYQA 2AZSA 2DVEA 2X9HA 3IQLA 3E2UA 2PVGB 4RTUA 3G6EQ 3CC7T 2A7YA 3KXTA 1NYFA 1AOJA 1YCYA 1QVFP 4EIKA 2O31A 3HKSA 2JS0A 4HVWA 1GRIA 4OB3B 5GAOm 4NS5A 3AT1B 4M75G 8ATCB 1SRMA 4OMNA 2DJQA 2G3RA 2VB6A 1QW1A 4LUEA 2VWFA 2OI3A 2DK3A 5GAMe 2F2WA 3S6WA 5KYXA 4M7DG 2CSQA 2FG0A 5CCAA 1U06A 2O4XB 1IXDA 4GLKA 3HTRA 2QEXQ 2JXBA 3QKJA 2FEIA 3G4SQ 2JTFA 5GAMf 1MHNA 3EHQA 3HRUA 4M7DE 4ZTFA 4M78A 2IG0A 4IURA 3JB9D 2DXTA 1Q95G 4JS4A 4J6WA 3JCMP 1M1KC 2D6FA 3O5ZA 1D3BA 3CCJA 4LDYA 2KRMA 4B6MA 2K2MA 1M2VB 1AHJB 1XTDA 4FYWB 2MCNA 2FYKA 2L3QA 2QA4Q 3VS6A 2WSFE 2NWMA 3I55A 3INZA 1W4SA 4FYXB 5KYUB 2B8AA 1B34A 1NJIR 2EQKA 4J7FA 4M7DF 1Y0MA 1ABOA 5FROA 3G71A 3TQ7P 2LX7A 3MEAA 4C92A 2QXFA 2VXFA 1VUBA 4RG2A 2JMAA 4JLGA 3EGUA 3JAME 1ZBXA 2E4HA 2DYBA 1GFDA 5LJ5h 2WACA 3CD6A 3L2UA 1YJ9Q 2HNIA 3I5SA 4RTVA 5IHNA 1PRMC 4M7AD 2GTOA 4QVZA 3CBMA 5GANh 5HCKA 4XTUA 2I2LA 3EH1A 1W70A 2MYSA 1KHCA 4IKFA 4A4HA 5I21A 1PSEA 4KGVB 5LL6S 3OS5A 3SWNB 4XU0A 3VRYA 3PIOA 2E5KA 3QO3A 4PJOE 4ZN3A 2NUPA 5GMKh 3EFRA 1VQ8Q 1UTIA 1ZHIA 3JV3A 1QP3A 3SWNC 1YJNQ 1WXUA 2YDLA 1N9SA 1BU1A 1IGUA 2QDYB 1W1FA 3VS5A 2GNCA 2ZPGB 3E19A 3LW5E 4XTWA 2FVUA 2RN8A 2JM8A 3HP9A 3VJPA 3P8DA 2YRCA 2X4XA 2J6KA 4K11A 3RBBB 1TXQA 1I1JA 2DL3A 3OY9A 2RM4A 2LRQA 3I9QA 1N8RR 2J05A 5GAN3 4D6WA 3OYAA 3CCVQ 2ATCB 1TWBA 2DEQA 3H0HA 2LX9A 1MMNA 2KT8A 2MMPA 1X27A 4RUGA 5C0MA 2F2XA 5CKBA 3CCST 1K0SA 4XTVA 5KYXB 1N27A 2ENMA 4TVRA 1UG1A 3L1AA 1YCSB 2P0QA 3X25B 3FJPA 3JCMW 5CK9A 1VQ6T 2HKQB 1AD5A 3MEWA 3JCMg 2DTIA 1QMCA 2RQWA 4B9XA 3M5AA 4F7UE 1AWWA 1O75A 4M78B 1AWOA 2DL7A 1D1AA 1ZSGA 2NUZA 2L0AA 2XI9A 3CBPA 2EKHA 3CCET 3CQTA 4M78C 5J26A 2MIOA 1NEBA 3QDFA 1TS9A 1VQOT 1W2BA 3PVQA 2VXEA 2P4TA 2PQWA 3MKDA 1B34B 4F7UF 3CCMT 1KIKA 3HPWA 5GAMd 3OYKA 1M1KR 2JS2A 3QYGB 4D8DA 2CYZB 4KRTA 4C92B 5IXFA 2IPOB 2X51A 3RERA 2P0KA 1E7OA 2JN0A 2V8KA 3EGDA 1ZSZA 1M90C 2KT1A 4GBQA 5LJ3h 4C92C 1ZX6A 1PG5B 1YI2Q 1MMAA 3I5RA 1N6AA 1TSFA 4NOYA 2BIVA 4OMFB 2YUPA 3C95A 4M77E 2LC4A 2X35A 2RD1A 5A0GA 3QZ5B 2FRYA
chains in the Genus database with same CATH topology
1Y96B 3DLMA 4MZTA 4Y28E 3MO8A 3CMAT 3LWHA 3LGFA 3QSUA 3UPUA 2LT1A 5IN1A 2LNVA 2RI3A 3WXMB 4HA8A 4N4GA 5IT9E 1JJ2A 3HHTB 4BDYA 3KUFA 1YITT 1W2BS 4HCCA 2DTOA 2E5QA 2CZ6B 3M9QA 3MCAB 2CS7A 2ZPBB 2K57A 1V29B 2VC8A 3HRSA 1BI1A 1YJWT 2GF7A 2LQ8A 4A53A 4XU3A 1WQ7A 3CCQT 3QBYA 3NTIA 4C0GA 2EWNA 4R55A 2QQAA 3CCVA 2O01E 1VQLT 4M7DD 4X34A 2HQXA 5CIUA 4RMOA 3L2ZA 2VGNA 2DXBA 2K3XA 1JB0E 4PJOF 1VQNT 4M7AE 3LYIA 2QEXT 5FU7B 4N4IA 4C0DB 3GF5A 3G4ST 3FIFA 3QZ9B 1NJIU 3OYCA 4M77F 2RHYA 2K2VA 4QQDA 2R5AA 1NPRA 3CMAA 2M1HA 3R6OA 4BUGA 2CZ0B 4MZMA 1JBMA 1Q86C 1P92A 3RKXA 1QVPA 5FU7C 4C0DC 3CC4A 3LX7A 3PNWC 4BE1A 4F7UG 3PGGA 3OS2A 3RIRA 4IUVA 4C5GA 5DLOA 2E12A 2MWPA 4Y91A 2DD5A 3CCQA 1VQLA 3X26B 3CC2T 2FL7A 4C5EA 2P0PA 3FLGA 3HL8A 3MEVA 3OBWA 4M77A 5LJ3e 4BB7A 3JCMb 4LD9K 5L8RE 2DAQA 3OYLA 1GXIE 4C8QG 2DZCA 1YHQA 3NTKA 4IUPA 3PTAA 4ELYC 4A4EA 5GAMj 5J39A 1N9RA 1WJQA 3A5ZB 2E6NA 4RKUE 4M75E 4XU2A 4DOVA 2QA4T 1NJIC 4M7AF 2DIQA 4PJOB 2DZ9A 2E64A 3OBYA 4HKEA 5KCOA 3SDZA 1JJ2S 3Q1JA 3X20B 4ATOA 4XQ3A 3CCSA 4FU6A 1VQPT 3V7SA 2CGHA 3UWNA 3I55T 3OS1A 4JLIA 1OI1A 2MWOA 3ZEHA 1UB4A 1VQ9T 4A54A 1VIEA 1Q81C 1FXXA 2EFIA 4LDUA 3LGLA 5LJ3f 2JOYA 3NTHA 3L2QA 4PJOC 3OYYA 2F5TX 3J7AF 1VQ7T 3F70A 3I56T 3CCUT 4C8QE 2E41A 4M7AA 5CAIA 3VYGA 3RMQA 3RMSA 2XK0A 3ASKA 4IUUA 1M8VA 2ZCFB 2MF2A 4IUTA 4ZGJB 3G71T 3HFOA 5EG2A 1VQKT 3QPHA 4M77C 4DA4A 1LNXA 1VQ6A 3C4SA 4MMLA 4MMKA 2OTLT 3OYNA 3T9NA 2GQVA 2WSEE 3GLXA 4L5GA 4WF2A 2EQJA 4OP0A 4QQ6A 4HCBA 1M90U 4M75F 2PVDB 5GAN7 4OB1B 2LCLA 5LJ3g 2RO0A 2E1HA 3EAEA 3M54A 4KUIA 4M7AB 5M9OA 1VQPA 1YJ9T 5CKHA 1K9MU 2XDBA 1MGQA 2DXUA 3CPFA 5CVIA 4JRKA 1Y07A 5D6XA 4CRIA 3JCMd 1K8AC 4R56A 3CD6T 1VQ4T 1TH7A 3S3NA 5AYFA 3META 3CCRA 3GP8A 1YIJT 3P8BB 2YLBA 1OZ3A 4XU1A 4MDWA 3S3OA 1U1TA 3MHXA 4C8QF 4M78D 1X6OA 3TREA 4M7AC 4EMKA 5KE3A 3OS0A 3SFMA 1NE8A 2KK4A 4LDWA 2KMTA 4M75A 3V8JA 2DPPB 2RHIA 1M5Q1 3E1SA 4M77G 3RKYA 3CCEA 4MDXA 1FWZA 5LJ5d 2RHXA 1NZ9A 1XNIA 3PMIA 3N5BB 3A8OB 4OB0B 2OTLA 1I5LA 4ZGDB 5GAMh 3HRTA 4LDXA 2OTJA 4Z02A 4KUDK 5GANd 3ZBDA 1VQOA 2QTXA 4FT2A 1UGSB 1VQ8T 4O6JA 5D6WA 3RKWA 2K5IA 4BACA 1YJNT 1U8RA 1QVGA 4EMKB 5CKFA 4C8QA 3FB9A 4M75B 3CCLT 2A3LA 3QJ6A 4BI4A 3QJYA 3CPWS 5CKEA 2JTMA 1DJ7B 4JS5A 2ZPEB 3HSBA 4PLIA 1H641 3OW2A 3OYHA 1WQWA 2LVMA 2F5KA 1PSFA 1N8RC 2KSSA 5KH6A 4JRIA 4PL6A 1Y71A 2MAMA 4F7UB 4M7AG 5I2MA 3LWIA 3WVDB 3A8HB 4QW2A 3MP8A 4EMKC 5HK0A 3GIBA 4M75C 3A8MB 4FL6A 1FX7A 3MEUA 3OQ5A 5FLXE 3BY7A 4E7JA 4BD3A 3JB9J 2L89A 4C92D 1QVFS 3MP6A 4C8QB 1Q86U 3ZFJA 2EYQA 3G6EA 2DVEA 5HK3A 2XICA 5A0DA 3L2WA 2F69A 2PVGB 1H3ZA 2EQMA 5J3BA 3JCMQ 3CBOA 4OGCA 3UDCA 3C94A 3CC7T 2A7YA 2BUDA 4N4HA 2EJFA 3KXTA 1G3SA 2RHZA 4M78E 4C8QC 1S72A 1YCYA 2ZGWA 1Q82C 1K73U 3TU4K 4C5IA 3HKSA 3QG1A 3JB9I 5DM7R 4OB3B 5GAOm 4NS5A 2R5MA 3VV0A 4M75G 2QQBA 1M1GA 2O4XA 2XHCA 2KVQG 3OMGA 3DB3A 3J81E 1YITA 2KY9A 2G3RA 3L42A 1QW1A 5GAN8 5GAN2 2E6ZA 5DY9A 2KDSA 3FDRA 2QI2A 3QHSA 2DK3A 2Y4YA 4PKCC 4CI0C 5GAN6 5GAMe 2RK2A 4OB2B 3S6WA 4ELZC 1YJWA 4QVCA 1Q81U 1X75C 2CZ1B 2L5QA 4M7DG 1BIAA 1QP2A 5CCAA 3TCJA 4BI3A 1VQNA 5KCHA 2QEXA 1K73C 2O4XB 3CCJT 3ER0A 4J6XA 1M1KU 4GLKA 3G4SA 3V7RA 5GAOl 4M78F 1KQ2A 4J6YA 1G3WA 2XDPA 4A4KA 3QKJA 2V8IA 1BI0A 5I2SA 1KQSA 2JTFA 4C92E 2M9UA 3M59A 2PUOB 2RI5A 4XTXA 4QVDA 5LJ5j 3E9GA 3M57A 3X28B 4JRQA 5GAMf 4M77B 4XAXB 3VKIA 1MHNA 2GCXA 5CQYA 3BFMA 3HRUA 4N0AA 5GANj 4C0FA 1K8AU 4M7DE 4ZTFA 2D0QB 3QUIA 4M78A 4OGEA 5FRMA 2IG0A 3CC2A 4FIBA 4JDSA 1BYMA 2EAYA 4IURA 4RCBA 3JB9D 2DXTA 4EMGA 2KQWA 4JS4A 3VYHB 4J6WA 3JCMP 1M1KC 2D6FA 1D3BA 1R8OB 1NPPA 4LDYA 3CCJA 2D9TA 1X01A 2QA4A 4V2SA 1AHJB 1XTDA 5GAMg 4KULA 2DIGA 2FYKA 1IZ6A 2LDMA 1BIBA 1M4ZA 2VUBA 3VUZA 1KC8U 5GAOr 3MP1A 5GMKj 4JJNK 4E7KA 2WSFE 2AHJB 4C92F 3AHUA 4PJOD 2ZZDA 2RK1A 3I55A 3INZA 5LJ5g 1W4SA 1VQ9A 2B8AA 2XKOC 2ZPIB 2IVWA 1D3BB 2K4YA 4Q5WA 1LOJA 4N0AC 1B34A 1VQ7A 2EQKA 3I56A 3CCUA 4VUBA 5IAYA 1XQHA 3BDUA 3OSVA 2KAFA 4J7FA 4M7DF 3CEYA 1N8RU 5FROA 3G71A 3L2VA 1VQKA 2JVVA 3URGA 3JCMh 3OYIA 3MEAA 4J5YA 4C92A 2XU8A 2QXFA 2CZ7B 2VXFA 2C06A 1VUBA 4RG2A 4FSXA 4JLGA 2RB6A 3CXCA 4BE2A 1KC8C 2HBPA 3JAME 1ZBXA 3LLRA 1YJ9A 4EDUA 4M7DA 1SSFA 5LJ5h 2WACA 4X9CA 4BY6B 2LT4A 2JNGA 2X4JA 3SWNA 3OYEA 1OZ2A 3CD6A 1M1FA 3QDRB 1VQ4A 3A8GB 2DD4A 3L2UA 2HNIA 2LQKA 3PT9A 1VQMT 1YIJA 5LJ3d 1OYXA 3ME9A 4M7AD 4QVZA 3CBMA 2PUKB 5GANh 1KQ1A 2EIFA 3JCMJ 3V8LA 3OYDA 4XTUA 2GFUA 2I2LA 2X4WA 4M78G 1Q82U 4QQGA 4L59A 3V7CA 3GPLA 1KHCA 4IKFA 2DO3A 4A4HA 4BY6C 4C5HA 4E47A 5I21A 4O5VA 1LJOA 5A2QE 2EJGA 2RJFA 3BW1A 1PSEA 4M7DB 4PLLA 1VIFA 4J7IA 3JSCA 5LL6S 3OS5A 3SWNB 4XU0A 3H6ZA 1Q7YC 3PIOA 3KBGA 1KHIA 3RUXA 3TEEA 3QO3A 4HCZA 2QQRA 2R58A 1VQ8A 4PJOE 2E10A 4ZN3A 3CCVT 4C0ZA 2HD0A 3M56A 2WSCE 5GAOp 2EQUA 1YJNA 1G3TA 2YHTA 3WVEB 5GMKh 3EFRA 3CCLA 4M7DC 1ZHIA 4J83A 4J8OA 2EKOA 1QP3A 5A0LA 3SWNC 5GAN4 2JZ2A 1N9SA 2QDYB 2HAXA 2ZPGB 2ZPHB 4HT8A 4M75D 3JB9F 3E19A 4UC4A 3OA6A 1XOVA 3LW5E 4XTWA 2FVUA 3HP9A 2OAUA 3VJPA 3JCMX 3DLLA 3P8DA 2QQ9A 5CR2A 2X4XA 2DJZA 4B9WA 3CC4T 3CXCS 2RI2A 1O9SA 2ZPFB 1QVGS 1I4K1 2EJ9A 1WPYA 4C92G 2CKKA 5FU6B 5GAOn 3DB4A 1KG1A 3JCMe 4KBMB 2RM4A 3QYHB 2LRQA 3OY9A 4XK8E 1BI2A 4OVAA 4PNOA 4KT0E 4RG8A 5GAN3 1BI3A 4C8QD 4D6WA 3OYAA 2MI6A 1UGRB 4OF1A 5GAN5 3OYMA 3CC7A 1YHQT 1UGPB 3OW2S 5FRNA 3SD4A 2DEQA 2XDDA 5DLQE 5FU6C 4NL3A 4DQ2A 2LX9A 5LJ5e 2PVOB 2K3YA 2FHDA 3M58A 2MMPA 3JCMc 4BE0A 4ZTJA 5C0MA 5CKBA 3PFSA 5GANe 3CCST 4YTLA 2DKGA 2L8DA 3M53A 4XTVA 3JCMf 4A4GA 4PJOA 1N27A 1ZQ1A 5CO7A 4TVRA 3JCMV 3O8VA 5GMKm 1UGQB 3M55A 3L1AA 3GOXA 2NLUA 1Y7XA 4FT4A 2DXCA 5D6YA 3FC3A 3OMCA 4ZN1A 2P0QA 3X25B 3FJPA 4GY5A 3JCMW 1U1SA 5CK9A 2K5LA 3OYJA 5LJ5f 4BI8B 1VQ6T 2Y4XA 3QXEB 3SB2A 4E7IA 1WJRA 2E70A 3MEWA 5GMKe 5GAOq 4XTYA 3C12A 3JCMg 5LJ3j 5GANf 2DTIA 1WJSA 3E9FA 3A8LB 3BDLA 3FRNA 4B9XA 4EPCA 3M5AA 4F7UE 3GNFB 4X9DA 2RJCA 3OSSC 1O75A 4P5NA 5GMKl 3JB9H 4M78B 2H3JA 2VYTA 3OYBA 1G5VA 3H8ZA 3M4YA 3CCRT 5CQXA 2RA2A 4MZPA 2YLCA 4JRPA 1WGSA 3UT1A 3CMET 3NFCA 3CPWA 2XIDA 5HKCA 4L6V5 2XI9A 3CBPA 4ME7A 3S3MA 5GANg 2E65A 3JRZA 4LD6A 4M77D 3CCET 4M78C 5J26A 3JB9G 3OYFA 4E7HA 1KD1U 1HXDA 3VU3C 2LCCA 1UEBA 2PU9B 2OTJT 1VQ5T 1YI2T 3PMTA 1VQOT 1I8FA 2V8JA 2GFAA 4RCCA 1QVFA 2QQSA 3QIIA 1KQSS 1W2BA 2RJEA 5KE2A 3DKMA 3GNGA 2VXEA 2VGMA 2M0OA 2P4TA 1Q7YU 2PQWA 3HFNA 1B34B 3L2RA 4F7UF 2M16A 3CCMT 4DOWA 1WNLA 4II1A 4PJOG 3HPWA 2K5FA 3LH0A 5GAMd 3V8KA 3OYKA 4IUQA 3CMEA 3QYGB 1G3YA 1M9SA 5C6SA 2CYZB 2VV5A 3FEOA 2RH2A 3J80E 4C92B 4LDVA 1YBYA 3PIPA 4FM4B 4A4FA 3RERA 1BKBA 4NL2A 1KD1C 2YRVA 5HY6A 2DTHA 2P0KA 2HQEA 2JN0A 2V8KA 4BDZA 2JUFA 2Y90A 3OYGA 1M90C 4F7UA 1VQ5A 1YI2A 2X4YA 2R57A 3G6ET 2RJDA 2LTOA 5LJ3h 1JRIA 1Y96A 2BKDN 1RI0A 4C92C 4ZGEB 3EFSA 1K9MC 2RHUA 2FB7A 3M4GA 5GMKi 4E7LA 3X24B 3CCMA 1IREB 1N6AA 3P8HA 4XTZA 4EMHA 4NOYA 2BIVA 2XG8D 4OMFB 3RESA 3OB9A 4HT9A 1EIFA 2XD0A 1S72T 3C95A 3QZ5B 4M77E 1VQMA 2LC4A 1RL2A 2L3RA 4JUVA 5CKDA 3VUBA 2X35A 2RD1A 5A0GA 1I81A 1HK9A 3G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLM A;  3CMA T;  3MO8 A;  3LGF A;  5IN1 A;  2RI3 A;  4N4G A;  5IT9 E;  1JJ2 A;  1YIT T;  1W2B S;  3KUF A;  4BDY A;  2E5Q A;  3M9Q A;  1YJW T;  2GF7 A;  2LQ8 A;  3CCQ T;  1VQL T;  3NTI A;  3QBY A;  3CCV A;  4X34 A;  2HQX A;  5CIU A;  2K3X A;  1VQN T;  2QEX T;  3LYI A;  4N4I A;  3G4S T;  1NJI U;  3OYC A;  2RHY A;  4QQD A;  2R5A A;  1NPR A;  3CMA A;  2M1H A;  1Q86 C;  3CC4 A;  3LX7 A;  3PNW C;  4BE1 A;  3OS2 A;  4IUV A;  4C5G A;  2MWP A;  3CCQ A;  1VQL A;  3CC2 T;  4C5E A;  3FLG A;  3MEV A;  3OYL A;  2DAQ A;  1YHQ A;  3NTK A;  4IUP A;  4A4E A;  5J39 A;  3A5Z B;  1WJQ A;  2E6N A;  2QA4 T;  1NJI C;  2DIQ A;  5KCO A;  1JJ2 S;  3Q1J A;  3CCS A;  4FU6 A;  1VQP T;  3UWN A;  3I55 T;  3OS1 A;  1OI1 A;  2MWO A;  3ZEH A;  1VQ9 T;  1Q81 C;  2EFI A;  3LGL A;  3L2Q A;  2JOY A;  3NTH A;  3OYY A;  3J7A F;  1VQ7 T;  3F70 A;  3I56 T;  3CCU T;  2XK0 A;  3ASK A;  4IUU A;  3G71 T;  4IUT A;  1VQK T;  1VQ6 A;  3C4S A;  2OTL T;  3OYN A;  2EQJ A;  4QQ6 A;  1M90 U;  2LCL A;  2RO0 A;  3EAE A;  1YJ9 T;  5M9O A;  1VQP A;  1K9M U;  3CPF A;  5D6X A;  4CRI A;  1K8A C;  3CD6 T;  1VQ4 T;  3S3N A;  3MET A;  3CCR A;  1YIJ T;  3P8B B;  1OZ3 A;  3S3O A;  1X6O A;  3TRE A;  1H3Z A;  3OS0 A;  5KE3 A;  2RHI A;  3CCE A;  2RHX A;  1NZ9 A;  1XNI A;  3PMI A;  2OTL A;  2OTJ A;  4Z02 A;  1VQO A;  1VQ8 T;  5D6W A;  4BAC A;  1YJN T;  1QVG A;  3CCL T;  3QJ6 A;  3CPW S;  4PLI A;  3OW2 A;  3OYH A;  2LVM A;  1N8R C;  2F5K A;  5KH6 A;  4PL6 A;  4QW2 A;  3MP8 A;  4FL6 A;  3MEU A;  3OQ5 A;  5FLX E;  4E7J A;  4BD3 A;  2L89 A;  1QVF S;  3MP6 A;  1Q86 U;  3G6E A;  3L2W A;  2EQM A;  5J3B A;  3CC7 T;  2BUD A;  4N4H A;  2RHZ A;  1S72 A;  1Q82 C;  1K73 U;  4C5I A;  3HKS A;  5DM7 R;  4NS5 A;  2R5M A;  1M1G A;  2O4X A;  2XHC A;  2KVQ G;  3OMG A;  3DB3 A;  3J81 E;  1YIT A;  2G3R A;  3L42 A;  2E6Z A;  2KDS A;  1QVG S;  3FDR A;  1YJW A;  1Q81 U;  3S6W A;  1VQN A;  2QEX A;  5KCH A;  1K73 C;  3CCJ T;  1M1K U;  3ER0 A;  2O4X B;  3G4S A;  2XDP A;  3QKJ A;  1KQS A;  2JTF A;  2RI5 A;  3E9G A;  1MHN A;  1K8A U;  4ZTF A;  5FRM A;  2IG0 A;  3CC2 A;  4IUR A;  1M1K C;  3CCJ A;  1NPP A;  2D9T A;  2QA4 A;  1XTD A;  2DIG A;  1IZ6 A;  2LDM A;  1KC8 U;  3MP1 A;  4E7K A;  3I55 A;  1VQ9 A;  2B8A A;  4Q5W A;  1VQ7 A;  3I56 A;  3CCU A;  2EQK A;  5IAY A;  3CEY A;  1N8R U;  5FRO A;  3G71 A;  1VQK A;  3L2V A;  2JVV A;  3OYI A;  3MEA A;  4RG2 A;  3CXC A;  1KC8 C;  4BE2 A;  3JAM E;  1YJ9 A;  3LLR A;  4EDU A;  1SSF A;  2WAC A;  2JNG A;  3OYE A;  3CD6 A;  1OZ2 A;  1VQ4 A;  3L2U A;  1VQM T;  1YIJ A;  1OYX A;  3ME9 A;  4QVZ A;  2EIF A;  3OYD A;  2GFU A;  2X4W A;  1Q82 U;  4QQG A;  4L59 A;  1KHC A;  4IKF A;  2DO3 A;  4A4H A;  4C5H A;  5A2Q E;  2RJF A;  4PLL A;  5LL6 S;  3H6Z A;  1Q7Y C;  3PIO A;  3KBG A;  1KHI A;  4HCZ A;  2QQR A;  1VQ8 A;  2R58 A;  4ZN3 A;  3CCV T;  2EQU A;  1YJN A;  3CCL A;  2EKO A;  2JZ2 A;  4UC4 A;  3OA6 A;  3DLL A;  3P8D A;  2X4X A;  4B9W A;  3CC4 T;  3CXC S;  2RI2 A;  2CKK A;  3DB4 A;  3OY9 A;  2LRQ A;  4OVA A;  3OYA A;  2MI6 A;  3CC7 A;  3OYM A;  1YHQ T;  3OW2 S;  5FRN A;  3SD4 A;  5DLQ E;  2K3Y A;  2FHD A;  4BE0 A;  4ZTJ A;  5C0M A;  3PFS A;  3CCS T;  4YTL A;  4A4G A;  2L8D A;  1N27 A;  4TVR A;  3O8V A;  3GOX A;  2NLU A;  5D6Y A;  3FC3 A;  3OMC A;  4ZN1 A;  4GY5 A;  3OYJ A;  1VQ6 T;  4E7I A;  1WJR A;  2E70 A;  3MEW A;  1WJS A;  3E9F A;  3BDL A;  4B9X A;  2RJC A;  2VYT A;  3OYB A;  1G5V A;  3H8Z A;  3CCR T;  1WGS A;  3CME T;  3UT1 A;  3CPW A;  3S3M A;  4LD6 A;  3CCE T;  5J26 A;  3OYF A;  4E7H A;  1KD1 U;  2LCC A;  1UEB A;  2OTJ T;  1VQ5 T;  1YI2 T;  1VQO T;  3PMT A;  2GFA A;  1QVF A;  1KQS S;  2QQS A;  3QII A;  1W2B A;  2RJE A;  5KE2 A;  2M0O A;  1Q7Y U;  2PQW A;  3L2R A;  3CCM T;  2M16 A;  4II1 A;  3LH0 A;  3OYK A;  3CME A;  4IUQ A;  5C6S A;  3FEO A;  3J80 E;  1YBY A;  3PIP A;  4A4F A;  1BKB A;  1KD1 C;  5HY6 A;  2YRV A;  2P0K A;  2HQE A;  4BDZ A;  2JUF A;  3OYG A;  1M90 C;  1VQ5 A;  1YI2 A;  2X4Y A;  2R57 A;  3G6E T;  2RJD A;  2LTO A;  2BKD N;  1K9M C;  1RI0 A;  2RHU A;  4E7L A;  3CCM A;  3P8H A;  2BIV A;  3OB9 A;  1EIF A;  1S72 T;  1VQM A;  1RL2 A;  2L3R A;  2X35 A; 
#chains in the Genus database with same CATH topology
 1VQM Q;  1WHL A;  1Z9Z A;  5IT9 E;  1E6G A;  3HHT B;  1WA7 A;  3MCA B;  2ZPB B;  4E7S A;  2K57 A;  3HRS A;  1T3S A;  4AG1 C;  1AZE A;  2QQA A;  4M7D D;  2HQX A;  1BCO A;  3LYI A;  2HEQ A;  3GF5 A;  2O88 A;  1PKS A;  1RAH B;  4M77 F;  2RQR A;  4BUG A;  4PJM A;  2CZ0 B;  3RKX A;  1GCQ A;  3CMA Q;  3PNW C;  4BE1 A;  3OS2 A;  3RIR A;  2KI7 A;  2YXY A;  3CC4 Q;  2FL7 A;  4C5E A;  2P0P A;  3HL8 A;  2YUN A;  2DAQ A;  4C8Q G;  1YHQ A;  3NTK A;  2P84 A;  1JQQ A;  2J7I A;  1N9R A;  1ZUY A;  4RKU E;  2YWW A;  4XU2 A;  2E64 A;  3OBY A;  2KEA A;  4XQ3 A;  1B7T A;  1Y57 A;  1WIE A;  1VQP T;  4AFS C;  3I55 T;  4DBF A;  4JLI A;  1OI1 A;  2MWO A;  1VIE A;  1VOM A;  4LDU A;  4WTO B;  2BZX A;  2DBM A;  4C8Q E;  1JU5 C;  3RMQ A;  3ASK A;  3EGX A;  2ZCF B;  2MF2 A;  3G71 T;  1D1B A;  4DA4 A;  2C0O A;  4MML A;  2D8J A;  2H8H A;  3T9N A;  2KYM A;  4HCB A;  4QQ6 A;  1IHV A;  2PVD B;  3G1J A;  1D09 B;  2E1H A;  4PFZ A;  4M7A B;  5M9O A;  4JRK A;  1Y07 A;  3CD6 T;  1TH7 A;  3P8B B;  2YLB A;  3REA B;  1OZ3 A;  4XU1 A;  4MDW A;  5KYW A;  4GLM A;  4JZ4 A;  4M7A C;  1H3Z A;  5KE3 A;  2KRS A;  4M75 A;  4C8Q F;  2DPP B;  3E1S A;  5GJV B;  4MDX A;  1JEG A;  5KYY B;  1NZ9 A;  2OTL A;  1V76 A;  3THK A;  4LDX A;  1T0J A;  5EC7 A;  4O6J A;  2SEM A;  1ZA2 B;  1MV0 B;  1QVG A;  1IB8 A;  5CKF A;  4BI4 A;  5CKE A;  1DJ7 B;  1WQW A;  3EGD B;  2EGC A;  1ZSZ B;  1EX4 A;  4M7A G;  4RTT A;  4PJL A;  3GIB A;  3MP8 A;  3OQ5 A;  4E7J A;  2L89 A;  1Q86 U;  3G6E A;  2H3E B;  2XIC A;  4JJD A;  3CBO A;  3C94 A;  2BUD A;  2RPN A;  2RHZ A;  2J06 A;  2JM9 A;  3EHR A;  1M90 R;  3QG1 A;  3JB9 I;  1X6B A;  1SF9 A;  2O4X A;  2FRW A;  2XHC A;  2KY9 A;  1U3O A;  2FO0 A;  2LJ3 A;  4PKC C;  2Y4Y A;  1Q81 U;  1YIT Q;  4ELZ C;  1YJW Q;  2MOX A;  2QEX A;  5I22 A;  1K73 C;  4R0K A;  3ER0 A;  3G4S A;  4Z89 A;  5GAO l;  3EG1 A;  1VQN Q;  2PZ1 A;  4A4K A;  1OOT A;  2K6D A;  1BI0 A;  1GCP A;  2V8I A;  2KYB A;  2KNB B;  4LXC A;  4QVD A;  5LJ5 j;  1FMW A;  3X28 B;  1M2V A;  3VKI A;  2GCX A;  5GAN j;  1K8A U;  2HL5 C;  5FRM A;  4OGE A;  4JDS A;  2KQW A;  1HYO A;  5KYU A;  3VYH B;  2Z0W A;  1BB9 A;  3CC2 Q;  2QA4 A;  4AG2 C;  4V2S A;  1SHG A;  2MK5 A;  1M4Z A;  1KC8 U;  2DL5 A;  1K76 A;  5GMK j;  2FPD A;  2F1L A;  2FPE A;  3AHU A;  1OPK A;  2RK1 A;  5FWB A;  3EGX B;  1XJW B;  2XKO C;  1RAI B;  4Q5W A;  1LOJ A;  4FYV B;  2X3X D;  2V1Q A;  1RAD B;  3OSV A;  1VQ9 Q;  3L2V A;  3I56 Q;  3CCU Q;  3URG A;  3JCM h;  2CZ7 B;  2C06 A;  2AK5 A;  4PJJ A;  1G2B A;  3CXC A;  1ZUU A;  2BZY A;  2YUO A;  4BE2 A;  1JO8 A;  2RF0 A;  3LLR A;  1YJ9 A;  4EDU A;  4X9C A;  4BY6 B;  3SWN A;  3QDR B;  2LQK A;  1KQ1 A;  3JCM J;  1IRX A;  3V8L A;  1VQ4 Q;  1D1C A;  1Q82 U;  3NGP A;  2DO3 A;  4BY6 C;  4C5H A;  2LMJ A;  1LJO A;  2RJF A;  3BW1 A;  3QWY A;  4M7D B;  4PLL A;  4J7I A;  4HCK A;  3KBG A;  1KHI A;  3RUX A;  9ATC B;  4HCZ A;  1VQ8 A;  2WSC E;  4JPB W;  1YJN A;  4M7D C;  2EKO A;  2AZV A;  2JZ2 A;  4RTY A;  5GAN 4;  1H3H A;  4HT8 A;  3OA6 A;  2DBK A;  2CT4 A;  3DLL A;  2DJZ A;  1O9S A;  2ZPF B;  1MND A;  1I4K 1;  2COY A;  2CKK A;  1KG1 A;  2DNU A;  3RNJ A;  1BI2 A;  3REB B;  2QTV A;  1BI3 A;  4C8Q D;  2MI6 A;  4OF1 A;  1YHQ T;  1E6H A;  4LNP A;  3SD4 A;  1ARK A;  4NL3 A;  2CH4 A;  5LJ5 e;  2PVO B;  1I07 A;  5GAN e;  4LUD A;  2L8D A;  5GMK m;  1UGQ B;  2HL3 A;  3M55 A;  4FYY B;  2V1R A;  2NLU A;  1QKW A;  3FC3 A;  1KJW A;  2GQI A;  3MJX A;  3VS4 A;  5LJ5 f;  2Y4X A;  4E7I A;  2AIR B;  2E70 A;  5GMK e;  4E7Z A;  5GAN f;  5LJ3 j;  3BDL A;  3FRN A;  4EPC A;  4X1V A;  4E6R A;  3JB9 H;  1TUC A;  2DL4 A;  2H3J A;  1G5V A;  3H8Z A;  5CQX A;  4MZP A;  3UT1 A;  3CME T;  3NFC A;  1K73 R;  5HKC A;  1C0M A;  4JZ3 A;  4ME7 A;  2EYX A;  2E65 A;  3JRZ A;  2LQN A;  4AMC A;  1CSK A;  4IIO A;  2BE7 D;  1VQ6 Q;  1VQ5 T;  2V8J A;  2GFA A;  1QVF A;  1KQS S;  2RJE A;  2VVK A;  3DKM A;  3GNG A;  1Q7Y U;  1BCM A;  1W6X A;  3HFN A;  3L2R A;  2M16 A;  4PFO A;  1RAB B;  2YSQ A;  4II1 A;  4PJO G;  2K5F A;  1G3Y A;  2EPD A;  1R77 A;  1UE9 A;  2CP5 A;  1KQS P;  2M0Y A;  4LDV A;  2FZG B;  1BKB A;  1KD1 C;  5HY6 A;  2HQE A;  4BDZ A;  1YI2 A;  2X4Y A;  2R57 A;  3G6E T;  2RJD A;  3M0P A;  2BKD N;  1RI0 A;  4DBH A;  2L3S A;  2XG8 D;  5FWC A;  2KGT A;  1EIF A;  4M4Z A;  3CCM Q;  1VQM A;  3NMZ C;  1RI9 A;  4JUV A;  2FZK B;  3VUB A;  1QKX A;  1HK9 A;  7AT1 B;  3DLM A;  4MZT A;  3QSU A;  2JJ9 A;  5IN1 A;  3WXM B;  2YT6 A;  1JJ2 A;  1W2B S;  1B3Q A;  2DTO A;  2E5Q A;  4HCC A;  1NEG A;  2CSI A;  2VC8 A;  1LVK A;  4DEX A;  2GF7 A;  4XU3 A;  2K3B A;  2ROT A;  3CCQ T;  2DVJ A;  1VQL T;  1EFN A;  2EWN A;  4R55 A;  2M02 A;  3L2Z A;  2HQH A;  2VGN A;  2DXB A;  1JB0 E;  3M0S A;  4PJO F;  4KH0 B;  2QEX T;  5FU7 B;  4C0D B;  1W2B P;  3G4S T;  1NBE B;  1NJI U;  2KXC A;  2RHY A;  2K2V A;  4QQD A;  2R5A A;  3CMA A;  1Q86 C;  5FU7 C;  4C0D C;  3CC4 A;  1SEM A;  1X43 A;  3VS7 A;  4F7U G;  4IUV A;  5DLO A;  2QAS A;  5I11 A;  1LPL A;  1T0H A;  3FLG A;  3OBW A;  3JCM b;  5LJ3 e;  5L8R E;  1GXI E;  1SG5 A;  4IUP A;  4A4E A;  5J39 A;  2QA4 T;  5KCO A;  1GBQ A;  3Q1J A;  3X20 B;  1ACM B;  2ESW A;  3V7S A;  2HKN A;  1PD1 A;  3UAT A;  1UB4 A;  1Q81 C;  3LGL A;  5LJ3 f;  2LQW A;  3OYY A;  4HVV A;  2J6F A;  2E41 A;  4M7A A;  1H8K A;  3VYG A;  2DM1 A;  3D7S B;  2EQI A;  4WCI A;  3QPH A;  4M77 C;  2D0N A;  1M3B A;  4MMK A;  3OYN A;  3GLX A;  4F16 A;  5GJW B;  5GAN 7;  5KYY A;  2RNA A;  2RO0 A;  4KUI A;  1YJ9 T;  2XDB A;  4QKU A;  1K9M U;  1OUL A;  2DXU A;  2CRE A;  4CRI A;  1K8A C;  3S3N A;  1VQP Q;  3S3O A;  3MHX A;  1X6O A;  3CCR Q;  3OS0 A;  3V8J A;  1M5Q 1;  2RHI A;  4M77 G;  3RKY A;  1WFW A;  5LJ5 d;  2RHX A;  1OX8 A;  2DE0 X;  4Z02 A;  5GAN d;  5IHI A;  1UGS B;  1VQ8 T;  4ZNX A;  5D6W A;  1M3A A;  2J6O A;  1AEY A;  2OTJ Q;  1YJN T;  1U8R A;  2RQV A;  4EMK B;  2CT3 A;  4J9B A;  2K9G A;  2JTM A;  3CPW S;  3OYH A;  2LVM A;  2F5K A;  2O9V A;  5KH6 A;  2JMC A;  3LWI A;  3A8H B;  4EMK C;  1M2O A;  3A8M B;  2QDL A;  1FX7 A;  5AT1 B;  3MP6 A;  4C8Q B;  3CPW P;  4PK4 A;  5HK3 A;  2COZ A;  5J3B A;  3ZL7 C;  3JCM Q;  2ABL A;  3UDC A;  2P4R A;  2EJF A;  1KD1 R;  4M78 E;  4IIM A;  4C8Q C;  1Q82 C;  3M0R A;  3TU4 K;  1UFF A;  4C5I A;  2HSE B;  1S72 Q;  1AWX A;  1WI7 A;  2NUT B;  2R5M A;  4OMO A;  1RLQ C;  3OMG A;  3DB3 A;  1D0Y A;  3J81 E;  1YIT A;  2EYW A;  3L42 A;  5GAN 8;  2E6Z A;  1JXM A;  2FZC B;  1QVG S;  2QI2 A;  3QHS A;  1YJW A;  4CI0 C;  5GAN 6;  2RK2 A;  2DMO A;  2CZ1 B;  2BE9 B;  2L5Q A;  3H41 A;  1BIA A;  1QP2 A;  1IO6 A;  1VQN A;  5KCH A;  3CCJ T;  1M1K U;  3V7R A;  4M78 F;  1G3W A;  1WHG A;  3UF4 A;  1QVG P;  4QT7 A;  2PTK A;  4C92 E;  1YN8 A;  2PUO B;  2RI5 A;  3E9G A;  4JRQ A;  4XAX B;  5CQY A;  2KE9 A;  3CC2 A;  4FIB A;  1GL5 A;  4RCB A;  1QLY A;  1MNE A;  4OMP A;  4EMG A;  1R8O B;  1NPP A;  1Q86 R;  3VS3 A;  2D9T A;  1RAC B;  5GAM g;  4KUL A;  1IZ6 A;  1BIB A;  2CP3 A;  3EG9 B;  3VUZ A;  2F2V A;  5GAO r;  3MP1 A;  4JJN K;  4C92 F;  4PJO D;  4KH1 B;  1RLP C;  5LJ5 g;  1VQ9 A;  2ZPI B;  2IVW A;  5L23 A;  2K4Y A;  4N0A C;  1VQ7 A;  3I56 A;  3CCU A;  4VUB A;  5IAY A;  1XQH A;  2KAF A;  3CEY A;  4OML A;  2QGF B;  2JVV A;  1VQK Q;  4FSX A;  2HMA A;  1T3L A;  2HBP A;  2EBP A;  3FJ5 A;  4M7D A;  2KRO A;  1SSF A;  1RAG B;  2X4J A;  3OYE A;  2GGR A;  1M1F A;  2QGG A;  1VQ4 A;  3A8G B;  2DD4 A;  1VQM T;  3PT9 A;  5LJ3 d;  3ME9 A;  3EFO B;  2EIF A;  1OQK A;  1JXO A;  1YIJ Q;  4L59 A;  4LN2 A;  1VA7 A;  4E47 A;  5A2Q E;  3JSC A;  1K8A R;  4PFP A;  3H6Z A;  3SHW A;  1Q7Y C;  1X69 A;  4D8K A;  2R58 A;  2E10 A;  4CC4 B;  1K4U S;  1S1N A;  3M56 A;  4AT1 B;  1PD0 A;  2YHT A;  3WVE B;  4J9E A;  1WHK A;  4J83 A;  2LZ6 B;  4J8O A;  1HJD A;  1WYX A;  4FW2 A;  1QWE A;  3CCL Q;  2HAX A;  2ZPH B;  2CP0 A;  3JB9 F;  2OAU A;  1IGQ A;  2I0N A;  3VS0 A;  4B9W A;  3CC4 T;  3CXC S;  3ULR B;  1UDL A;  1X2Q A;  3JCM e;  1NYG A;  4KBM B;  3QYH B;  4XK8 E;  4KT0 E;  1UGR B;  3OW2 S;  5FRN A;  2XDD A;  3CXC P;  2DA9 A;  3CC7 Q;  2FHD A;  3M58 A;  3JCM c;  2GTJ A;  2A36 A;  2LJ0 A;  4ZTJ A;  1FYN A;  1F1B B;  4Z8A A;  3RR6 A;  3JCM f;  4PJO A;  3JCM V;  3OW2 P;  3O8V A;  1D0X A;  1FMV A;  1Y7X A;  4FT4 A;  4KGZ B;  2DXC A;  3SEM A;  1Q82 R;  3OMC A;  4ZN1 A;  1U1S A;  4J9C A;  1OPL A;  2DL8 A;  5GAO q;  3C12 A;  1WXB A;  3A8L B;  2M51 A;  1PKT A;  3UA7 A;  2RJC A;  3OSS C;  5GMK l;  4FSS A;  3M4Y A;  1TOV A;  2RA2 A;  2YLC A;  2DIL A;  2CDT A;  4RTX A;  2XID A;  4M77 D;  4LD6 A;  2BZ8 A;  5D7U A;  1UJY A;  3OYF A;  1HXD A;  3VU3 C;  1MMG A;  2LCC A;  1UEB A;  2LNH B;  3PMT A;  4RCC A;  1RAF B;  2CP2 A;  4DBQ A;  3VRZ A;  2JTE A;  4RTW A;  1WXT A;  4DOW A;  1WNL A;  3LH0 A;  2AKK A;  2KBT A;  1M9S A;  2IIM A;  3FEO A;  3TSZ A;  2RH2 A;  3J80 E;  4A63 B;  1K1Z A;  1BBZ A;  3CME Q;  2YRV A;  2DTH A;  1K9A A;  4F7U A;  2LTO A;  1JRI A;  1K9M C;  1OU8 A;  1KFZ A;  1VQ5 Q;  2FB7 A;  4E7L A;  3X24 B;  4J9H A;  3CCM A;  1IRE B;  3P8H A;  4EMH A;  1K0X A;  2W10 A;  4HT9 A;  2A0F B;  1NM7 A;  1RL2 A;  2VAS A;  1X75 C;  1I81 A;  2LCS A;  1Y96 B;  1PC0 A;  3LWH A;  1X6G A;  2LT1 A;  1SKU B;  2RI3 A;  4HA8 A;  1YIT T;  2DRM A;  3PE0 A;  4CC2 A;  1WLP B;  3M9Q A;  2CS7 A;  1YJW T;  4A53 A;  1MMD A;  3QBY A;  3NTI A;  4C0G A;  1NG2 A;  3CCV A;  4X34 A;  1I5O B;  1UEC A;  2CP6 A;  2K3X A;  1VQN T;  4N4I A;  3QZ9 B;  3OYC A;  1Q7Y R;  2M1H A;  1UJ0 A;  4MZM A;  2DF6 A;  1QVP A;  3LX7 A;  3PGG A;  4C5G A;  4Y91 A;  2DD5 A;  2DRK A;  3X26 B;  2CUD A;  3CC2 T;  4LD9 K;  4M77 A;  2EYY A;  3OYL A;  3CCQ Q;  1VQL Q;  3A5Z B;  3I35 A;  2E6N A;  4M75 E;  4PJO B;  2DZ9 A;  2L2P A;  2VKN A;  2QYZ A;  1JJ2 S;  2KRN A;  1AWJ A;  5ECA A;  1NLP C;  2CGH A;  3UWN A;  4FW1 A;  3ZEH A;  1VQ9 T;  4A54 A;  1FXX A;  2EFI A;  3CCS Q;  2JOY A;  1YWO A;  1LCK A;  3A1P A;  4PJO C;  2GBQ A;  3J7A F;  1VQ7 T;  3I56 T;  3CCU T;  5CAI A;  2QG9 B;  2XK0 A;  4IUU A;  1M8V A;  1JJ2 P;  4ZGJ B;  3HFO A;  5EG2 A;  3VS2 A;  3C4S A;  1OV3 A;  2OTL T;  2DX1 A;  1R0B G;  1ZLM A;  2GQV A;  4L5G A;  4OP0 A;  1RAE B;  4M75 F;  2AT1 B;  4OB1 B;  1C1A A;  1VQP A;  4F04 B;  5CKH A;  2CH4 W;  1GFC A;  1N5Z A;  5CVI A;  3JCM d;  4R56 A;  2KXD A;  1VQ4 T;  1UUE A;  3CCR A;  3GP8 A;  3M0T A;  1QCF A;  1TU0 B;  3TRE A;  3KFV A;  4EMK A;  4LDW A;  3PMI A;  3N5B B;  3A8O B;  1I5L A;  1R0C B;  4ZGD B;  5GAM h;  3CCE Q;  2OTJ A;  4KUD K;  2QTX A;  4FT2 A;  1B07 A;  1GBR A;  1C6V X;  3RKW A;  1QCN A;  4AFQ C;  1J3T A;  1VQO Q;  1SPK A;  1PRL C;  4C8Q A;  3TSW A;  4FCY A;  2A3L A;  4JS5 A;  1CKB A;  1M8M A;  1Y71 A;  2MAM A;  4F7U B;  4Z88 A;  4FL6 A;  1HSQ A;  5FLX E;  3BY7 A;  4BD3 A;  3R6N A;  1QWF A;  1G8X A;  2NUT A;  5A0D A;  3L2W A;  2F69 A;  2EQM A;  4OGC A;  1U5S A;  4N4H A;  1G3S A;  1M3C A;  1S72 A;  2K79 A;  1TTH B;  2ZGW A;  1I0C A;  1K73 U;  3MPU B;  1TUD A;  2V26 A;  1OX9 A;  5DM7 R;  2C0I A;  1K9M R;  1QCO A;  1WDX A;  3VV0 A;  2CUB A;  2QQB A;  1M1G A;  2KVQ G;  3H0I A;  2YUQ A;  2DET A;  2HCK A;  5GAN 2;  5DY9 A;  2KDS A;  3FDR A;  3BE3 A;  4OB2 B;  4QVC A;  1NLO C;  3TCJ A;  4BI3 A;  2O9S A;  2MPX C;  4J6X A;  1KQ2 A;  1M27 C;  4J6Y A;  3EG0 A;  1PCX A;  2X3W D;  4CC3 A;  2XDP A;  2C0T A;  5I2S A;  1KQS A;  2M9U A;  2RQT A;  3M59 A;  4ANJ A;  4XTX A;  3M57 A;  4M77 B;  4J9D A;  3BFM A;  5KYN A;  4N0A A;  4C0F A;  3EG9 A;  3M0U A;  2D0Q B;  3QUI A;  2LP5 A;  2EAY A;  1X01 A;  3H9N A;  3CCJ Q;  2DIG A;  2LDM A;  2VUB A;  1M30 A;  3LH5 A;  4E7K A;  2AHJ B;  1YWP A;  2ZZD A;  4PJN A;  1D3B B;  4OMM A;  3I55 Q;  1MUZ A;  1BK2 A;  3BDU A;  1N8R U;  1VQK A;  3NPF A;  1AT1 B;  2A28 A;  2LJ1 A;  3OYI A;  2ZAE A;  3EFO A;  2DFU A;  4J5Y A;  2XU8 A;  3G71 Q;  5IXB A;  2RB6 A;  1KC8 C;  1RUW A;  2FPF A;  2A08 A;  2DEU A;  2ED0 A;  2LT4 A;  2JNG A;  1OZ2 A;  4J9F A;  1YIJ A;  1OYX A;  2PUK B;  1SHF A;  3NHN A;  3OYD A;  3CD6 Q;  2GFU A;  2X4W A;  4M78 G;  4QQG A;  3V7C A;  3GPL A;  2E3I A;  1BYM A;  2EGE A;  4O5V A;  2EJG A;  1ZA1 B;  3EG3 A;  1VIF A;  3TVT A;  1A0N B;  3TEE A;  2QQR A;  4ESR A;  3CCV T;  4C0Z A;  2HD0 A;  5GAO p;  2EQU A;  1WZO A;  1G3T A;  2DLP A;  3CCL A;  5FW9 A;  5A0L A;  8AT1 B;  4M75 D;  4UC4 A;  1XOV A;  1V1C A;  3H0F A;  3JCM X;  2QQ9 A;  5CR2 A;  2K7A A;  2ED1 A;  2NUP B;  2HZY A;  2RI2 A;  2EJ9 A;  1WPY A;  4C92 G;  5FU6 B;  5GAO n;  3DB4 A;  4OVA A;  4PNO A;  1PWT A;  4RG8 A;  5GAN 5;  4F17 A;  3OYM A;  3CC7 A;  1UGP B;  2RMO A;  2BTT A;  1CKA A;  5DLQ E;  5FU6 C;  4DQ2 A;  2K3Y A;  4BE0 A;  4Y92 A;  4F14 A;  3PFS A;  1FMK A;  1D0Z A;  4YTL A;  2DKG A;  2E3H A;  3M53 A;  4A4G A;  1H92 A;  2AKL A;  1SSH A;  5CO7 A;  1ZQ1 A;  2EVR A;  4JJC A;  3U23 A;  3GOX A;  2OAW A;  5D6Y A;  2COW A;  3GBQ A;  4GY5 A;  2K5L A;  2B86 A;  3OYJ A;  4BI8 B;  3QXE B;  3SB2 A;  4AFZ C;  1WJR A;  3EH2 A;  4XTY A;  3M0Q A;  1WJS A;  3E9F A;  2O2O A;  2QK0 A;  3GNF B;  4X9D A;  4P5N A;  1SRL A;  2VYT A;  3OYB A;  3CCR T;  4JRP A;  1WGS A;  3CPW A;  4L6V 5;  1QQJ A;  2CP7 A;  3S3M A;  5GAN g;  1UHF A;  1RAA B;  3JB9 G;  1PM3 A;  4E7H A;  1KD1 U;  2OJ2 A;  2OTJ T;  2PU9 B;  1YI2 T;  5IHK A;  1I8F A;  2QQS A;  3QII A;  2G6F X;  1Q81 R;  5KE2 A;  1AZG B;  1PNJ A;  2VGM A;  2M0O A;  6AT1 B;  4J9I A;  2QAZ A;  2XMF A;  1VYU A;  3V8K A;  4IUQ A;  3CME A;  2L3P A;  5C6S A;  1VYV A;  2VV5 A;  4HVU A;  4JJB A;  2OX7 A;  1YBY A;  3PIP A;  4FM4 B;  4A4F A;  4NL2 A;  4ORZ A;  2JUF A;  2Y90 A;  3OYG A;  1VQ5 A;  2ECZ A;  2W0Z A;  1Y96 A;  2HBW A;  4ZGE B;  3VS1 A;  3EFS A;  2RHU A;  3M4G A;  5GMK i;  1X2K A;  4XTZ A;  3RES A;  3OB9 A;  4DBR A;  2XD0 A;  1S72 T;  2DYI A;  2HSP A;  5CKD A;  2L3R A;  2EYZ A;  1ABQ A;  3G7Z A;  1YNZ A;  4Y28 E;  3MO8 A;  1KC8 R;  3CMA T;  3LGF A;  3UPU A;  2LNV A;  4N4G A;  2A37 A;  1YP5 A;  4BDY A;  3KUF A;  1WHM A;  1UGV A;  2CZ6 B;  1ZSZ C;  1V29 B;  3UA6 A;  1BI1 A;  3A98 A;  2LQ8 A;  2EGA A;  3C0C A;  1WQ7 A;  2O01 E;  5CIU A;  4RMO A;  4M7A E;  1OEB A;  3FIF A;  3EG2 A;  1Z9Q A;  1NPR A;  1YFN A;  3R6O A;  4LE9 A;  4RTZ A;  1JBM A;  1P92 A;  1WX6 A;  1ZBJ A;  1TUG B;  2E12 A;  2MWP A;  2RQU A;  3CCQ A;  2HDA A;  1VQL A;  3MEV A;  1IHW A;  4BB7 A;  2ROL A;  2DZC A;  2EW3 A;  3PTA A;  4ELY C;  5GAM j;  1VYT A;  1WJQ A;  4M7A F;  1NJI C;  4DOV A;  1TG0 A;  2DIQ A;  1MV3 A;  1YHQ Q;  1HD3 A;  4HKE A;  2YRD A;  3SDZ A;  2KR3 A;  4ATO A;  3CCS A;  4FU6 A;  3OS1 A;  1GCQ C;  3L2Q A;  3NTH A;  2F5T X;  3F70 A;  3RMS A;  2DER A;  2JW4 A;  4IUT A;  1VQK T;  1KSW A;  2PNI A;  1LNX A;  1VQ6 A;  3PVL A;  1ZUK A;  2WSE E;  4WF2 A;  2EQJ A;  1M90 U;  3QWX X;  1KK7 A;  2LCL A;  5LJ3 g;  3EAE A;  3M54 A;  5IH2 A;  1MGQ A;  3CPF A;  5D6X A;  2JT4 A;  1OU9 A;  5AYF A;  3MET A;  1YIJ T;  4OMQ A;  1WHJ A;  1U1T A;  1EZZ B;  4M78 D;  3SFM A;  1NE8 A;  2KK4 A;  1VQ7 Q;  2KMT A;  3CCE A;  4HXJ A;  1FWZ A;  1UHC A;  3RDV A;  1XNI A;  4OB0 B;  4KGX B;  3HRT A;  3ZBD A;  1VQO A;  2OTL Q;  1WHH A;  5KYW B;  1AVZ C;  2K5I A;  1G83 A;  4J9G A;  4BAC A;  2NYS A;  3CCL T;  3FB9 A;  4M75 B;  4AFU C;  4DEY A;  2D1X A;  3QJ6 A;  3QJY A;  1PHT A;  3HSB A;  2ZPE B;  2D8H A;  4PLI A;  1H64 1;  3OW2 A;  1N8R C;  1PSF A;  2KSS A;  4JRI A;  4PL6 A;  4CC7 A;  4E2F B;  5I2M A;  2SRC A;  3WVD B;  4QW2 A;  5HK0 A;  4M75 C;  3MEU A;  3JB9 J;  4C92 D;  1QVF S;  3ZFJ A;  2EYQ A;  2AZS A;  2DVE A;  2X9H A;  3IQL A;  3E2U A;  2PVG B;  4RTU A;  3G6E Q;  3CC7 T;  2A7Y A;  3KXT A;  1NYF A;  1AOJ A;  1YCY A;  1QVF P;  4EIK A;  2O31 A;  3HKS A;  2JS0 A;  4HVW A;  1GRI A;  4OB3 B;  5GAO m;  4NS5 A;  3AT1 B;  4M75 G;  8ATC B;  1SRM A;  4OMN A;  2DJQ A;  2G3R A;  2VB6 A;  1QW1 A;  4LUE A;  2VWF A;  2OI3 A;  2DK3 A;  5GAM e;  2F2W A;  3S6W A;  5KYX A;  4M7D G;  2CSQ A;  2FG0 A;  5CCA A;  1U06 A;  2O4X B;  1IXD A;  4GLK A;  3HTR A;  2QEX Q;  2JXB A;  3QKJ A;  2FEI A;  3G4S Q;  2JTF A;  5GAM f;  1MHN A;  3EHQ A;  3HRU A;  4M7D E;  4ZTF A;  4M78 A;  2IG0 A;  4IUR A;  3JB9 D;  2DXT A;  1Q95 G;  4JS4 A;  4J6W A;  3JCM P;  1M1K C;  2D6F A;  3O5Z A;  1D3B A;  3CCJ A;  4LDY A;  2KRM A;  4B6M A;  2K2M A;  1M2V B;  1AHJ B;  1XTD A;  4FYW B;  2MCN A;  2FYK A;  2L3Q A;  2QA4 Q;  3VS6 A;  2WSF E;  2NWM A;  3I55 A;  3INZ A;  1W4S A;  4FYX B;  5KYU B;  2B8A A;  1B34 A;  1NJI R;  2EQK A;  4J7F A;  4M7D F;  1Y0M A;  1ABO A;  5FRO A;  3G71 A;  3TQ7 P;  2LX7 A;  3MEA A;  4C92 A;  2QXF A;  2VXF A;  1VUB A;  4RG2 A;  2JMA A;  4JLG A;  3EGU A;  3JAM E;  1ZBX A;  2E4H A;  2DYB A;  1GFD A;  5LJ5 h;  2WAC A;  3CD6 A;  3L2U A;  1YJ9 Q;  2HNI A;  3I5S A;  4RTV A;  5IHN A;  1PRM C;  4M7A D;  2GTO A;  4QVZ A;  3CBM A;  5GAN h;  5HCK A;  4XTU A;  2I2L A;  3EH1 A;  1W70 A;  2MYS A;  1KHC A;  4IKF A;  4A4H A;  5I21 A;  1PSE A;  4KGV B;  5LL6 S;  3OS5 A;  3SWN B;  4XU0 A;  3VRY A;  3PIO A;  2E5K A;  3QO3 A;  4PJO E;  4ZN3 A;  2NUP A;  5GMK h;  3EFR A;  1VQ8 Q;  1UTI A;  1ZHI A;  3JV3 A;  1QP3 A;  3SWN C;  1YJN Q;  1WXU A;  2YDL A;  1N9S A;  1BU1 A;  1IGU A;  2QDY B;  1W1F A;  3VS5 A;  2GNC A;  2ZPG B;  3E19 A;  3LW5 E;  4XTW A;  2FVU A;  2RN8 A;  2JM8 A;  3HP9 A;  3VJP A;  3P8D A;  2YRC A;  2X4X A;  2J6K A;  4K11 A;  3RBB B;  1TXQ A;  1I1J A;  2DL3 A;  3OY9 A;  2RM4 A;  2LRQ A;  3I9Q A;  1N8R R;  2J05 A;  5GAN 3;  4D6W A;  3OYA A;  3CCV Q;  2ATC B;  1TWB A;  2DEQ A;  3H0H A;  2LX9 A;  1MMN A;  2KT8 A;  2MMP A;  1X27 A;  4RUG A;  5C0M A;  2F2X A;  5CKB A;  3CCS T;  1K0S A;  4XTV A;  5KYX B;  1N27 A;  2ENM A;  4TVR A;  1UG1 A;  3L1A A;  1YCS B;  2P0Q A;  3X25 B;  3FJP A;  3JCM W;  5CK9 A;  1VQ6 T;  2HKQ B;  1AD5 A;  3MEW A;  3JCM g;  2DTI A;  1QMC A;  2RQW A;  4B9X A;  3M5A A;  4F7U E;  1AWW A;  1O75 A;  4M78 B;  1AWO A;  2DL7 A;  1D1A A;  1ZSG A;  2NUZ A;  2L0A A;  2XI9 A;  3CBP A;  2EKH A;  3CCE T;  3CQT A;  4M78 C;  5J26 A;  2MIO A;  1NEB A;  3QDF A;  1TS9 A;  1VQO T;  1W2B A;  3PVQ A;  2VXE A;  2P4T A;  2PQW A;  3MKD A;  1B34 B;  4F7U F;  3CCM T;  1KIK A;  3HPW A;  5GAM d;  3OYK A;  1M1K R;  2JS2 A;  3QYG B;  4D8D A;  2CYZ B;  4KRT A;  4C92 B;  5IXF A;  2IPO B;  2X51 A;  3RER A;  2P0K A;  1E7O A;  2JN0 A;  2V8K A;  3EGD A;  1ZSZ A;  1M90 C;  2KT1 A;  4GBQ A;  5LJ3 h;  4C92 C;  1ZX6 A;  1PG5 B;  1YI2 Q;  1MMA A;  3I5R A;  1N6A A;  1TSF A;  4NOY A;  2BIV A;  4OMF B;  2YUP A;  3C95 A;  4M77 E;  2LC4 A;  2X35 A;  2RD1 A;  5A0G A;  3QZ5 B;  2FRY A; 
#chains in the Genus database with same CATH homology
 1Y96 B;  3DLM A;  4MZT A;  4Y28 E;  3MO8 A;  3CMA T;  3LWH A;  3LGF A;  3QSU A;  3UPU A;  2LT1 A;  5IN1 A;  2LNV A;  2RI3 A;  3WXM B;  4HA8 A;  4N4G A;  5IT9 E;  1JJ2 A;  3HHT B;  4BDY A;  3KUF A;  1YIT T;  1W2B S;  4HCC A;  2DTO A;  2E5Q A;  2CZ6 B;  3M9Q A;  3MCA B;  2CS7 A;  2ZPB B;  2K57 A;  1V29 B;  2VC8 A;  3HRS A;  1BI1 A;  1YJW T;  2GF7 A;  2LQ8 A;  4A53 A;  4XU3 A;  1WQ7 A;  3CCQ T;  3QBY A;  3NTI A;  4C0G A;  2EWN A;  4R55 A;  2QQA A;  3CCV A;  2O01 E;  1VQL T;  4M7D D;  4X34 A;  2HQX A;  5CIU A;  4RMO A;  3L2Z A;  2VGN A;  2DXB A;  2K3X A;  1JB0 E;  4PJO F;  1VQN T;  4M7A E;  3LYI A;  2QEX T;  5FU7 B;  4N4I A;  4C0D B;  3GF5 A;  3G4S T;  3FIF A;  3QZ9 B;  1NJI U;  3OYC A;  4M77 F;  2RHY A;  2K2V A;  4QQD A;  2R5A A;  1NPR A;  3CMA A;  2M1H A;  3R6O A;  4BUG A;  2CZ0 B;  4MZM A;  1JBM A;  1Q86 C;  1P92 A;  3RKX A;  1QVP A;  5FU7 C;  4C0D C;  3CC4 A;  3LX7 A;  3PNW C;  4BE1 A;  4F7U G;  3PGG A;  3OS2 A;  3RIR A;  4IUV A;  4C5G A;  5DLO A;  2E12 A;  2MWP A;  4Y91 A;  2DD5 A;  3CCQ A;  1VQL A;  3X26 B;  3CC2 T;  2FL7 A;  4C5E A;  2P0P A;  3FLG A;  3HL8 A;  3MEV A;  3OBW A;  4M77 A;  5LJ3 e;  4BB7 A;  3JCM b;  4LD9 K;  5L8R E;  2DAQ A;  3OYL A;  1GXI E;  4C8Q G;  2DZC A;  1YHQ A;  3NTK A;  4IUP A;  3PTA A;  4ELY C;  4A4E A;  5GAM j;  5J39 A;  1N9R A;  1WJQ A;  3A5Z B;  2E6N A;  4RKU E;  4M75 E;  4XU2 A;  4DOV A;  2QA4 T;  1NJI C;  4M7A F;  2DIQ A;  4PJO B;  2DZ9 A;  2E64 A;  3OBY A;  4HKE A;  5KCO A;  3SDZ A;  1JJ2 S;  3Q1J A;  3X20 B;  4ATO A;  4XQ3 A;  3CCS A;  4FU6 A;  1VQP T;  3V7S A;  2CGH A;  3UWN A;  3I55 T;  3OS1 A;  4JLI A;  1OI1 A;  2MWO A;  3ZEH A;  1UB4 A;  1VQ9 T;  4A54 A;  1VIE A;  1Q81 C;  1FXX A;  2EFI A;  4LDU A;  3LGL A;  5LJ3 f;  2JOY A;  3NTH A;  3L2Q A;  4PJO C;  3OYY A;  2F5T X;  3J7A F;  1VQ7 T;  3F70 A;  3I56 T;  3CCU T;  4C8Q E;  2E41 A;  4M7A A;  5CAI A;  3VYG A;  3RMQ A;  3RMS A;  2XK0 A;  3ASK A;  4IUU A;  1M8V A;  2ZCF B;  2MF2 A;  4IUT A;  4ZGJ B;  3G71 T;  3HFO A;  5EG2 A;  1VQK T;  3QPH A;  4M77 C;  4DA4 A;  1LNX A;  1VQ6 A;  3C4S A;  4MML A;  4MMK A;  2OTL T;  3OYN A;  3T9N A;  2GQV A;  2WSE E;  3GLX A;  4L5G A;  4WF2 A;  2EQJ A;  4OP0 A;  4QQ6 A;  4HCB A;  1M90 U;  4M75 F;  2PVD B;  5GAN 7;  4OB1 B;  2LCL A;  5LJ3 g;  2RO0 A;  2E1H A;  3EAE A;  3M54 A;  4KUI A;  4M7A B;  5M9O A;  1VQP A;  1YJ9 T;  5CKH A;  1K9M U;  2XDB A;  1MGQ A;  2DXU A;  3CPF A;  5CVI A;  4JRK A;  1Y07 A;  5D6X A;  4CRI A;  3JCM d;  1K8A C;  4R56 A;  3CD6 T;  1VQ4 T;  1TH7 A;  3S3N A;  5AYF A;  3MET A;  3CCR A;  3GP8 A;  1YIJ T;  3P8B B;  2YLB A;  1OZ3 A;  4XU1 A;  4MDW A;  3S3O A;  1U1T A;  3MHX A;  4C8Q F;  4M78 D;  1X6O A;  3TRE A;  4M7A C;  4EMK A;  5KE3 A;  3OS0 A;  3SFM A;  1NE8 A;  2KK4 A;  4LDW A;  2KMT A;  4M75 A;  3V8J A;  2DPP B;  2RHI A;  1M5Q 1;  3E1S A;  4M77 G;  3RKY A;  3CCE A;  4MDX A;  1FWZ A;  5LJ5 d;  2RHX A;  1NZ9 A;  1XNI A;  3PMI A;  3N5B B;  3A8O B;  4OB0 B;  2OTL A;  1I5L A;  4ZGD B;  5GAM h;  3HRT A;  4LDX A;  2OTJ A;  4Z02 A;  4KUD K;  5GAN d;  3ZBD A;  1VQO A;  2QTX A;  4FT2 A;  1UGS B;  1VQ8 T;  4O6J A;  5D6W A;  3RKW A;  2K5I A;  4BAC A;  1YJN T;  1U8R A;  1QVG A;  4EMK B;  5CKF A;  4C8Q A;  3FB9 A;  4M75 B;  3CCL T;  2A3L A;  3QJ6 A;  4BI4 A;  3QJY A;  3CPW S;  5CKE A;  2JTM A;  1DJ7 B;  4JS5 A;  2ZPE B;  3HSB A;  4PLI A;  1H64 1;  3OW2 A;  3OYH A;  1WQW A;  2LVM A;  2F5K A;  1PSF A;  1N8R C;  2KSS A;  5KH6 A;  4JRI A;  4PL6 A;  1Y71 A;  2MAM A;  4F7U B;  4M7A G;  5I2M A;  3LWI A;  3WVD B;  3A8H B;  4QW2 A;  3MP8 A;  4EMK C;  5HK0 A;  3GIB A;  4M75 C;  3A8M B;  4FL6 A;  1FX7 A;  3MEU A;  3OQ5 A;  5FLX E;  3BY7 A;  4E7J A;  4BD3 A;  3JB9 J;  2L89 A;  4C92 D;  1QVF S;  3MP6 A;  4C8Q B;  1Q86 U;  3ZFJ A;  2EYQ A;  3G6E A;  2DVE A;  5HK3 A;  2XIC A;  5A0D A;  3L2W A;  2F69 A;  2PVG B;  1H3Z A;  2EQM A;  5J3B A;  3JCM Q;  3CBO A;  4OGC A;  3UDC A;  3C94 A;  3CC7 T;  2A7Y A;  2BUD A;  4N4H A;  2EJF A;  3KXT A;  1G3S A;  2RHZ A;  4M78 E;  4C8Q C;  1S72 A;  1YCY A;  2ZGW A;  1Q82 C;  1K73 U;  3TU4 K;  4C5I A;  3HKS A;  3QG1 A;  3JB9 I;  5DM7 R;  4OB3 B;  5GAO m;  4NS5 A;  2R5M A;  3VV0 A;  4M75 G;  2QQB A;  1M1G A;  2O4X A;  2XHC A;  2KVQ G;  3OMG A;  3DB3 A;  3J81 E;  1YIT A;  2KY9 A;  2G3R A;  3L42 A;  1QW1 A;  5GAN 8;  5GAN 2;  2E6Z A;  5DY9 A;  2KDS A;  3FDR A;  2QI2 A;  3QHS A;  2DK3 A;  2Y4Y A;  4PKC C;  4CI0 C;  5GAN 6;  5GAM e;  2RK2 A;  4OB2 B;  3S6W A;  4ELZ C;  1YJW A;  4QVC A;  1Q81 U;  1X75 C;  2CZ1 B;  2L5Q A;  4M7D G;  1BIA A;  1QP2 A;  5CCA A;  3TCJ A;  4BI3 A;  1VQN A;  5KCH A;  2QEX A;  1K73 C;  2O4X B;  3CCJ T;  3ER0 A;  4J6X A;  1M1K U;  4GLK A;  3G4S A;  3V7R A;  5GAO l;  4M78 F;  1KQ2 A;  4J6Y A;  1G3W A;  2XDP A;  4A4K A;  3QKJ A;  2V8I A;  1BI0 A;  5I2S A;  1KQS A;  2JTF A;  4C92 E;  2M9U A;  3M59 A;  2PUO B;  2RI5 A;  4XTX A;  4QVD A;  5LJ5 j;  3E9G A;  3M57 A;  3X28 B;  4JRQ A;  5GAM f;  4M77 B;  4XAX B;  3VKI A;  1MHN A;  2GCX A;  5CQY A;  3BFM A;  3HRU A;  4N0A A;  5GAN j;  4C0F A;  1K8A U;  4M7D E;  4ZTF A;  2D0Q B;  3QUI A;  4M78 A;  4OGE A;  5FRM A;  2IG0 A;  3CC2 A;  4FIB A;  4JDS A;  1BYM A;  2EAY A;  4IUR A;  4RCB A;  3JB9 D;  2DXT A;  4EMG A;  2KQW A;  4JS4 A;  3VYH B;  4J6W A;  3JCM P;  1M1K C;  2D6F A;  1D3B A;  1R8O B;  1NPP A;  4LDY A;  3CCJ A;  2D9T A;  1X01 A;  2QA4 A;  4V2S A;  1AHJ B;  1XTD A;  5GAM g;  4KUL A;  2DIG A;  2FYK A;  1IZ6 A;  2LDM A;  1BIB A;  1M4Z A;  2VUB A;  3VUZ A;  1KC8 U;  5GAO r;  3MP1 A;  5GMK j;  4JJN K;  4E7K A;  2WSF E;  2AHJ B;  4C92 F;  3AHU A;  4PJO D;  2ZZD A;  2RK1 A;  3I55 A;  3INZ A;  5LJ5 g;  1W4S A;  1VQ9 A;  2B8A A;  2XKO C;  2ZPI B;  2IVW A;  1D3B B;  2K4Y A;  4Q5W A;  1LOJ A;  4N0A C;  1B34 A;  1VQ7 A;  2EQK A;  3I56 A;  3CCU A;  4VUB A;  5IAY A;  1XQH A;  3BDU A;  3OSV A;  2KAF A;  4J7F A;  4M7D F;  3CEY A;  1N8R U;  5FRO A;  3G71 A;  3L2V A;  1VQK A;  2JVV A;  3URG A;  3JCM h;  3OYI A;  3MEA A;  4J5Y A;  4C92 A;  2XU8 A;  2QXF A;  2CZ7 B;  2VXF A;  2C06 A;  1VUB A;  4RG2 A;  4FSX A;  4JLG A;  2RB6 A;  3CXC A;  4BE2 A;  1KC8 C;  2HBP A;  3JAM E;  1ZBX A;  3LLR A;  1YJ9 A;  4EDU A;  4M7D A;  1SSF A;  5LJ5 h;  2WAC A;  4X9C A;  4BY6 B;  2LT4 A;  2JNG A;  2X4J A;  3SWN A;  3OYE A;  1OZ2 A;  3CD6 A;  1M1F A;  3QDR B;  1VQ4 A;  3A8G B;  2DD4 A;  3L2U A;  2HNI A;  2LQK A;  3PT9 A;  1VQM T;  1YIJ A;  5LJ3 d;  1OYX A;  3ME9 A;  4M7A D;  4QVZ A;  3CBM A;  2PUK B;  5GAN h;  1KQ1 A;  2EIF A;  3JCM J;  3V8L A;  3OYD A;  4XTU A;  2GFU A;  2I2L A;  2X4W A;  4M78 G;  1Q82 U;  4QQG A;  4L59 A;  3V7C A;  3GPL A;  1KHC A;  4IKF A;  2DO3 A;  4A4H A;  4BY6 C;  4C5H A;  4E47 A;  5I21 A;  4O5V A;  1LJO A;  5A2Q E;  2EJG A;  2RJF A;  3BW1 A;  1PSE A;  4M7D B;  4PLL A;  1VIF A;  4J7I A;  3JSC A;  5LL6 S;  3OS5 A;  3SWN B;  4XU0 A;  3H6Z A;  1Q7Y C;  3PIO A;  3KBG A;  1KHI A;  3RUX A;  3TEE A;  3QO3 A;  4HCZ A;  2QQR A;  2R58 A;  1VQ8 A;  4PJO E;  2E10 A;  4ZN3 A;  3CCV T;  4C0Z A;  2HD0 A;  3M56 A;  2WSC E;  5GAO p;  2EQU A;  1YJN A;  1G3T A;  2YHT A;  3WVE B;  5GMK h;  3EFR A;  3CCL A;  4M7D C;  1ZHI A;  4J83 A;  4J8O A;  2EKO A;  1QP3 A;  5A0L A;  3SWN C;  5GAN 4;  2JZ2 A;  1N9S A;  2QDY B;  2HAX A;  2ZPG B;  2ZPH B;  4HT8 A;  4M75 D;  3JB9 F;  3E19 A;  4UC4 A;  3OA6 A;  1XOV A;  3LW5 E;  4XTW A;  2FVU A;  3HP9 A;  2OAU A;  3VJP A;  3JCM X;  3DLL A;  3P8D A;  2QQ9 A;  5CR2 A;  2X4X A;  2DJZ A;  4B9W A;  3CC4 T;  3CXC S;  2RI2 A;  1O9S A;  2ZPF B;  1QVG S;  1I4K 1;  2EJ9 A;  1WPY A;  4C92 G;  2CKK A;  5FU6 B;  5GAO n;  3DB4 A;  1KG1 A;  3JCM e;  4KBM B;  2RM4 A;  3QYH B;  2LRQ A;  3OY9 A;  4XK8 E;  1BI2 A;  4OVA A;  4PNO A;  4KT0 E;  4RG8 A;  5GAN 3;  1BI3 A;  4C8Q D;  4D6W A;  3OYA A;  2MI6 A;  1UGR B;  4OF1 A;  5GAN 5;  3OYM A;  3CC7 A;  1YHQ T;  1UGP B;  3OW2 S;  5FRN A;  3SD4 A;  2DEQ A;  2XDD A;  5DLQ E;  5FU6 C;  4NL3 A;  4DQ2 A;  2LX9 A;  5LJ5 e;  2PVO B;  2K3Y A;  2FHD A;  3M58 A;  2MMP A;  3JCM c;  4BE0 A;  4ZTJ A;  5C0M A;  5CKB A;  3PFS A;  5GAN e;  3CCS T;  4YTL A;  2DKG A;  2L8D A;  3M53 A;  4XTV A;  3JCM f;  4A4G A;  4PJO A;  1N27 A;  1ZQ1 A;  5CO7 A;  4TVR A;  3JCM V;  3O8V A;  5GMK m;  1UGQ B;  3M55 A;  3L1A A;  3GOX A;  2NLU A;  1Y7X A;  4FT4 A;  2DXC A;  5D6Y A;  3FC3 A;  3OMC A;  4ZN1 A;  2P0Q A;  3X25 B;  3FJP A;  4GY5 A;  3JCM W;  1U1S A;  5CK9 A;  2K5L A;  3OYJ A;  5LJ5 f;  4BI8 B;  1VQ6 T;  2Y4X A;  3QXE B;  3SB2 A;  4E7I A;  1WJR A;  2E70 A;  3MEW A;  5GMK e;  5GAO q;  4XTY A;  3C12 A;  3JCM g;  5LJ3 j;  5GAN f;  2DTI A;  1WJS A;  3E9F A;  3A8L B;  3BDL A;  3FRN A;  4B9X A;  4EPC A;  3M5A A;  4F7U E;  3GNF B;  4X9D A;  2RJC A;  3OSS C;  1O75 A;  4P5N A;  5GMK l;  3JB9 H;  4M78 B;  2H3J A;  2VYT A;  3OYB A;  1G5V A;  3H8Z A;  3M4Y A;  3CCR T;  5CQX A;  2RA2 A;  4MZP A;  2YLC A;  4JRP A;  1WGS A;  3UT1 A;  3CME T;  3NFC A;  3CPW A;  2XID A;  5HKC A;  4L6V 5;  2XI9 A;  3CBP A;  4ME7 A;  3S3M A;  5GAN g;  2E65 A;  3JRZ A;  4LD6 A;  4M77 D;  3CCE T;  4M78 C;  5J26 A;  3JB9 G;  3OYF A;  4E7H A;  1KD1 U;  1HXD A;  3VU3 C;  2LCC A;  1UEB A;  2PU9 B;  2OTJ T;  1VQ5 T;  1YI2 T;  3PMT A;  1VQO T;  1I8F A;  2V8J A;  2GFA A;  4RCC A;  1QVF A;  2QQS A;  3QII A;  1KQS S;  1W2B A;  2RJE A;  5KE2 A;  3DKM A;  3GNG A;  2VXE A;  2VGM A;  2M0O A;  2P4T A;  1Q7Y U;  2PQW A;  3HFN A;  1B34 B;  3L2R A;  4F7U F;  2M16 A;  3CCM T;  4DOW A;  1WNL A;  4II1 A;  4PJO G;  3HPW A;  2K5F A;  3LH0 A;  5GAM d;  3V8K A;  3OYK A;  4IUQ A;  3CME A;  3QYG B;  1G3Y A;  1M9S A;  5C6S A;  2CYZ B;  2VV5 A;  3FEO A;  2RH2 A;  3J80 E;  4C92 B;  4LDV A;  1YBY A;  3PIP A;  4FM4 B;  4A4F A;  3RER A;  1BKB A;  4NL2 A;  1KD1 C;  2YRV A;  5HY6 A;  2DTH A;  2P0K A;  2HQE A;  2JN0 A;  2V8K A;  4BDZ A;  2JUF A;  2Y90 A;  3OYG A;  1M90 C;  4F7U A;  1VQ5 A;  1YI2 A;  2X4Y A;  2R57 A;  3G6E T;  2RJD A;  2LTO A;  5LJ3 h;  1JRI A;  1Y96 A;  2BKD N;  1RI0 A;  4C92 C;  4ZGE B;  3EFS A;  1K9M C;  2RHU A;  2FB7 A;  3M4G A;  5GMK i;  4E7L A;  3X24 B;  3CCM A;  1IRE B;  1N6A A;  3P8H A;  4XTZ A;  4EMH A;  4NOY A;  2BIV A;  2XG8 D;  4OMF B;  3RES A;  3OB9 A;  4HT9 A;  1EIF A;  2XD0 A;  1S72 T;  3C95 A;  3QZ5 B;  4M77 E;  1VQM A;  2LC4 A;  1RL2 A;  2L3R A;  4JUV A;  5CKD A;  3VUB A;  2X35 A;  2RD1 A;  5A0G A;  1I81 A;  1HK9 A;  3G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...