4J9DA

Crystal structure of the n114a mutant of the abl-sh3 domain complexed with the high affinity peptide p0
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high affinity peptide P0
rcsb
source organism Homo sapiens
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9dA00
2LJ1A 1FYNA 1M3AA 2O9VA 4AFQC 2JW4A 2PNIA 2LJ0A 1OPKA 2BZXA 1GL5A 2DE0X 2K79A 4Z8AA 2JTEA 2GNCA 2EGEA 1WIEA 4HVUA 4Z89A 4RTVA 3TSZA 1ZSGA 1H3HA 4HVWA 1IO6A 2LQNA 1GBRA 1CKBA 1UECA 1RLQC 2C0TA 3NPFA 2RN8A 5I11A 2ROTA 4RTZA 2YUNA 1QWFA 1M3CA 3EGUA 4JJCA 2J7IA 4D8DA 2ECZA 2EVRA 2CSQA 2O9SA 3VS5A 2DILA 1ZUKA 2SEMA 1AZGB 4Z88A 1RUWA 2OAWA 1OV3A 1WX6A 2L3QA 1N5ZA 1UG1A 4RTXA 4CC4B 3UATA 4DEYA 2IIMA 2YSQA 2W0ZA 3I5SA 2J6OA 1QKWA 2KT1A 4J9EA 1AOJA 1UHFA 4HVVA 2FRWA 2B86A 3KFVA 3NGPA 2BZYA 1T3SA 1X69A 1M8MA 2F2WA 1JQQA 4M4ZA 1GFCA 1K1ZA 2K9GA 3EHQA 4JPBW 4JZ3A 1KIKA 2L3SA 2DJQA 5EC7A 2JMCA 4RTWA 1K0XA 1K9AA 1Z9QA 2KE9A 2O31A 1GCQC 1GCPA 2A36A 3TSWA 2EYXA 4J9BA 1G2BA 2RQTA 2DL4A 4LE9A 4LUEA 2CDTA 1JXOA 2BZ8A 2VWFA 2DL8A 1VYTA 1BBZA 1T0JA 2K6DA 4EIKA 1RI9A 1Z9ZA 1G83A 3EG2A 3VRZA 4HXJA 5IHIA 4LN2A 2FO0A 5IHNA 2KRMA 2V1QA 1KFZA 2D8JA 1Y0MA 2C0OA 4AFZC 5IXBA 1AWWA 1I0CA 1PHTA 2ABLA 3JV3A 2L0AA 3ULRB 4JJBA 2A28A 2KROA 2D8HA 2JM8A 1UTIA 2NWMA 1UHCA 2KBTA 3U23A 2DLPA 2CT3A 4K11A 4RTTA 1HSQA 3H0HA 2MCNA 2KRSA 2O88A 1UJYA 1YWPA 1SEMA 2LJ3A 2AKKA 2CT4A 2JS0A 5I22A 4E6RA 1BB9A 3M0PA 3I5RA 2CREA 2SRCA 4AG2C 4AG1C 3IQLA 3H0IA 4RTYA 2HDAA 1EFNA 2F2XA 1PKTA 2YUQA 4J9CA 1AEYA 1NYGA 5L23A 1X27A 1ZLMA 2J05A 4AFSC 4IIMA 2DRKA 3VRYA 3QWYA 2DL7A 2GBQA 2W10A 4F16A 4LUDA 2RF0A 1M30A 4X1VA 1I1JA 1GBQA 3SHWA 4CC7A 1B07A 1M27C 2YUPA 2FRYA 1UUEA 2L3PA 4F17A 1BU1A 1UDLA 1B3QA 2XMFA 1PRLC 1NEGA 3M0UA 2DBKA 1S1NA 2KGTA 1GCQA 1T0HA 2CH4A 2D0NA 2DVJA 5IXFA 2K2MA 2CSIA 2ED0A 1WA7A 1GFDA 1QLYA 3VS7A 1ZUYA 2JXBA 4OMPA 2KRNA 1VYUA 1U06A 2EBPA 1GRIA 1CKAA 4J9GA 2LMJA 3FJ5A 1H92A 1UFFA 2GTOA 1H8KA 1K0SA 5IHKA 1AWJA 2K7AA 3EG0A 1NYFA 1XOVA 1SHGA 1X43A 2L2PA 2OJ2A 4GBQA 1UGVA 2FG0A 2F2VA 1AWXA 1JXMA 1X2QA 1ZX6A 2DMOA 4OMQA 2V1RA 2GQIA 4OMLA 2CH4W 1I07A 2BTTA 2KXDA 2EKHA 1WXTA 1SPKA 2KYMA 2A37A 2DYBA 2VVKA 2LNHB 4HCKA 4J9FA 2LZ6B 1YCSB 2D1XA 1X6BA 2CUDA 1OPLA 4J9HA 4OMNA 4QT7A 2LCSA 3REBB 2JM9A 2X3WD 2DL5A 1NLPC 4ORZA 2FPFA 1W1FA 1NG2A 1BK2A 2KR3A 4OMMA 2RNAA 2YT6A 5ECAA 2KNBB 1W6XA 1OOTA 1U3OA 4KRTA 4DEXA 1SRLA 2I0NA 2EYYA 2MOXA 3QWXX 2JS2A 3SEMA 1HD3A 2E5KA 3GBQA 2C0IA 2EW3A 2HSPA 1TUCA 1SRMA 2AK5A 1E6GA 3M0RA 1WDXA 3VS1A 3M0TA 5GJVB 3RNJA 1K4US 1TG0A 1NM7A 4IIOA 2DNUA 1KJWA 1K76A 3EG3A 1TUDA 2RQVA 2LP5A 1OEBA 2M0YA 4Y92A 1J3TA 2KEAA 2ED1A 2HBWA 3NHNA 3R6NA 2DM1A 3PVLA 5FWCA 5HCKA 3VS2A 1QCFA 1NLOC 2NUZA 3O5ZA 2A08A 4RUGA 1QWEA 3THKA 1AVZC 1ZUUA 1WFWA 3EG1A 4A63B 1SHFA 3CQTA 2ROLA 2EYWA 1LCKA 3EHRA 1MV0B 1CSKA 3VS4A 1HJDA 2DL3A 2J6KA 3VS3A 2KXCA 3M0QA 2K3BA 2AZVA 1MUZA 1JU5C 3VS6A 1JO8A 3I9QA 2FPDA 1WXBA 2GGRA 4ZNXA 4F14A 1UJ0A 5GJWB 3UA7A 3A98A 2DBMA 4J9DA 1PRMC 5IH2A 3REAB 2DRMA 1KSWA 3NMZC 1ABQA 4FSSA 5FW9A 4WCIA 2YDLA 2CUBA 4CC3A 2DF6A 1ARKA 1FMKA 3ZL7C 2VKNA 2J06A 1PNJA 3H0FA 2AKLA 2X3XD 1YN8A 2JT4A 2RMOA 2EQIA 1WXUA 2YUOA 1E7OA 2HEQA 3H41A 3PE0A 1E6HA 3RBBB 1V1CA 2RQUA 2RPNA 4OMOA 1NEBA 2EPDA 2PTKA 1SSHA 1WYXA 1X6GA 1X2KA 1U5SA 2QDLA 2DA9A 4CC2A 1ZBJA 2EGAA 3UF4A 1QKXA 2G6FX 1WLPB 1WI7A 1YP5A 2LX7A 2GTJA 1AD5A 1PWTA 2ENMA 1UE9A 4D8KA 1YWOA 1AZEA 2AZSA 2MIOA 2EGCA 3TVTA 2OI3A 2RQWA 2O2OA 2ESWA 1T3LA 4GLMA 2P4RA 3VS0A 2FEIA 1RLPC 1VA7A 2RQRA 4LNPA 1YNZA 2HCKA 2PZ1A 3LH5A 1AWOA 4JZ4A 4R0KA 2J6FA 2DX1A 1A0NB 3UA6A 2LQWA 1Y57A 2KT8A 2EYZA 3I35A 4JJDA 5FWBA 4J9IA 3PVQA 4AFUC 1W70A 1MV3A 4RTUA 2H8HA 1JEGA 4ESRA 1VYVA 2KYBA 3C0CA 1ABOA 2JMAA 2FPEA 2M51A 1M3BA 1PKSA 3M0SA
chains in the Genus database with same CATH superfamily
2PQWA 2JW4A 3RMQA 1OPKA 2FZKB 1YIJQ 1GL5A 2X51A 5M9OA 3A5ZB 2AIRB 2KK4A 3CCUT 4Z8AA 2LX9A 1BI1A 1QVFS 1KG1A 1WIEA 3TSZA 1AHJB 3GIBA 1KK7A 5GAOr 2EQKA 2CGHA 2QYZA 2RN8A 1KQ1A 3M9QA 2VYTA 4C92G 1UB4A 8ATCB 3PFSA 1QWFA 3OYCA 3EGUA 2H3EB 5GAMj 5LJ3e 3M4GA 3VS5A 1QVGS 2YHTA 2COZA 1W4SA 4N0AC 2QGGA 3JCMX 4Z88A 1WX6A 2DXCA 1ZSZB 1QW1A 3I55T 1V76A 1M9SA 2MPXC 2YSQA 2W0ZA 2J6OA 1QKWA 2KT1A 4M75G 2QXFA 4XTVA 1QMCA 2X9HA 3P8BB 5GAOn 2FRWA 3RKXA 5GANg 4C92C 2M1HA 4L5GA 1T3SA 2F2WA 2NUTA 2YLCA 4A4KA 2OTJQ 4M4ZA 3A8MB 1RAEB 4LDXA 2X35A 4RTWA 2KE9A 2O31A 4IKFA 2V8JA 4OGEA 2QQBA 1SF9A 3CCRA 1WHLA 1G2BA 2RK2A 4M75C 2RQTA 4LE9A 4LUEA 2CDTA 2VWFA 2DL8A 4C8QF 1W2BA 4ZTJA 1M90C 2OTLT 1Q81U 4EMKA 4C0DC 1G83A 1RAFB 3EG2A 3VRZA 3QKJA 5IHIA 3CC7Q 3G4SQ 5IHNA 2KRMA 4PK4A 2V1QA 1RAHB 4AFZC 4AT1B 1AWWA 1I0CA 5LJ3h 2ABLA 2ZPFB 3ULRB 2D8HA 2JM8A 5LJ5d 3SFMA 5D6YA 1R8OB 2HZYA 3M4YA 4CRIA 2IG0A 4PLIA 2CZ1B 4OF1A 1NJIU 5GANf 3V8JA 3V7SA 1YJWQ 3I5RA 2CREA 1VQ7A 1K9MC 8AT1B 4C0FA 1TOVA 2DK3A 3QYGB 1UGQB 2CZ0B 3QIIA 3S6WA 1JJ2S 2RA2A 2XDBA 4OB2B 1EFNA 2F2XA 1PKTA 1IREB 1YIJA 1NYGA 4BE0A 3RIRA 4IIMA 2X4WA 2DRKA 5DM7R 2DO3A 4F7UB 2W10A 3EG9A 1OYXA 2RF0A 4KGXB 4C8QE 1IXDA 1M30A 2KI7A 5KCHA 3SHWA 1OU8A 3MP6A 4M77A 1VIFA 2FRYA 2F5TX 1SKUB 5KYWB 1B3QA 4QKUA 1UGSB 2XMFA 4V2SA 1RAIB 4O6JA 4C8QA 1S1NA 4BACA 1X6OA 2DVJA 4LDUA 1IGQA 4A4FA 1KC8U 3CCEQ 2CSIA 2KRNA 1VYUA 3GOXA 1GRIA 1XNIA 3EH2A 2JUFA 3FJ5A 5LJ5f 2VV5A 3CCRT 3DB4A 2K7AA 3HRSA 1RL2A 2MWPA 4PJOB 4PJOD 2L2PA 1WHKA 1WJRA 2IPOB 3EH1A 2OTJA 2HQXA 4R55A 3HFNA 2EFIA 3KBGA 1JXMA 4Z02A 5GAN3 4E47A 1RABB 3EFSA 2RJCA 4KH1B 2BTTA 2KXDA 3SWNA 3CD6Q 2DYBA 3MEVA 2LNHB 3FEOA 4PFZA 4EDUA 4HCKA 3JCMW 4BI4A 3PT9A 4J9FA 1YCSB 2K5IA 5CKBA 2CUDA 1OPLA 2AHJB 4J9HA 2LCSA 1NPRA 3V7RA 2JM9A 2DKGA 1KQSP 4M7DG 5CKFA 2ZPGB 3CC7A 3G4SA 1VQ7T 1D0ZA 1VQ9Q 2LCCA 1D1AA 3QUIA 2DJZA 1WJSA 2EYYA 1M2VA 5KH6A 2L89A 1H3ZA 2F1LA 3QWXX 3SEMA 2D6FA 1YCYA 2E5KA 4EPCA 2EQJA 5GAN2 5LJ3d 5GAMe 2RHYA 2XD0A 1TUCA 1SRMA 2RD1A 3CMET 2D0QB 1E6GA 1WDXA 3CC2Q 1Q82U 4IUQA 1KQSA 1KJWA 1K76A 3EG3A 5GAN4 1RACB 4M7DC 2VC8A 2M0YA 1VQLQ 3ER0A 2FB7A 4X34A 4XTUA 4Y92A 3L2VA 1YJWA 1J3TA 3QYHB 3R6NA 2HBWA 2DM1A 3PVLA 5FWCA 2OAUA 2JNGA 3I56Q 4OB1B 2LC4A 2ZZDA 3THKA 3RKWA 3N5BB 1LCKA 1MV0B 1CSKA 4E7JA 1KD1U 4HCCA 2HAXA 2K3BA 2EAYA 2ZPIB 2XG8D 4LXCA 3I9QA 1PSEA 4A4EA 4PFPA 1UJ0A 1FWZA 3FJPA 1PRMC 4HT9A 3REAB 3NMZC 2HNIA 2OTJT 4EMKB 4WTOB 1MMDA 2YDLA 1HYOA 2CUBA 4CC3A 3CCEA 2JT4A 1G8XA 2RMOA 2EQIA 2YUOA 2CP3A 2HSEB 2M0OA 1V1CA 1YHQQ 3BW1A 5GAMh 3JAME 4RG8A 1H641 2DXUA 1TS9A 5LJ3f 3A8LB 2BUDA 3R6OA 1YBYA 1ZBXA 2CYZB 2EPDA 1UGPB 3AT1B 3EGXB 2DEQA 1YJNQ 3OYGA 5GMKm 4CC2A 2EGAA 3UF4A 1QKXA 1QQJA 1KHIA 3M56A 2LX7A 1AD5A 3CC7T 2HL5C 4D8KA 1AZEA 1BCOA 1S72Q 2MIOA 2YWWA 5FROA 1ACMB 3OYEA 2O2OA 3CD6A 2ESWA 4KGZB 4CI0C 5L8RE 4O5VA 1IB8A 2PZ1A 2QQAA 2P4TA 2DX1A 1VQKT 1Y57A 2EYZA 4JJDA 3CPWS 1IGUA 3TREA 5FWBA 2GFUA 4M77B 4M77D 4RTUA 1MV3A 4ESRA 3NTIA 2LNVA 1VQ9A 3C0CA 2R57A 1ABOA 2JMAA 2DIQA 1M3BA 4C8QB 4A4HA 1OU9A 4C8QD 2LJ1A 1FYNA 2O9VA 3VUBA 3URGA 2LJ0A 2DTHA 2BZXA 3JB9G 2XDDA 4ME7A 1D1BA 3OB9A 2JTMA 5KYYA 2R5MA 1MMAA 3QXEB 3TCJA 4JRKA 1R0BG 1K9MR 3EGDA 2EGEA 3CC2A 3MO8A 4Z89A 4RTVA 3PIOA 1M1KU 4HVWA 1IO6A 4BE1A 1VQLA 1CKBA 1UECA 2C0TA 5FU7C 4J7IA 4N4IA 3I56A 5FU6B 4JJCA 2I2LA 3JB9I 3GNGA 3X20B 3L2WA 3CCET 3CCQT 4M7AG 3A8OB 2WSFE 1ZUKA 2SEMA 4M78G 1N8RR 2COWA 2L3QA 2X4YA 4NL3A 2QGFB 3SWNB 3UATA 1QVFP 4XU2A 3HRTA 1WGSA 4J9EA 2DAQA 1IHVA 2QASA 4HVVA 1WHJA 2FHDA 3HFOA 3NGPA 1M1GA 4PNOA 2QI2A 4MZPA 3L42A 1K1ZA 2V8KA 2E64A 4JPBW 3KXTA 1KIKA 1Q7YR 4M7AC 4M78C 1QVGP 1Z9QA 1OX9A 3CD6T 1M2VB 3L1AA 3TSWA 2EYXA 1YHQA 1QVFA 2VGNA 1JXOA 2RK1A 2BZ8A 1K8AR 1VYTA 5GAMd 4PLLA 1YJNA 2H3JA 2PVDB 2C06A 2AT1B 2QA4T 4LN2A 5CQXA 2DD4A 5DLOA 1S72A 3OS5A 2HKNA 1QVGA 2D8JA 5C0MA 1Q86C 3JV3A 2L0AA 3TU4K 3UPUA 3BDUA 4MDXA 2KBTA 2NUPA 2CT3A 1VQPA 1PM3A 3H0HA 3RMSA 1ZSZC 2MCNA 1QP3A 1YWPA 2F5KA 2QQRA 4TVRA 4ZN1A 5I22A 3X26B 4E6RA 1VQLT 3HRUA 4AG1C 1PD1A 1WPYA 3JCMe 1K73U 5CAIA 3A8HB 3I56T 1VQNT 2HDAA 2PUKB 1TSFA 2YUQA 2E70A 1ZLMA 4AFSC 3GP8A 3BFMA 2GBQA 4B9WA 4JLGA 3HPWA 1I1JA 4CC7A 1TWBA 4FYYB 4MZMA 1M8VA 5HY6A 3C94A 1N9RA 1YFNA 2L3PA 1BYMA 2ZCFB 1UDLA 5GAMf 3OYDA 2VGMA 1X75C 2KGTA 1GCQA 1T0HA 2YRDA 5IXFA 2GFAA 1JJ2P 5CCAA 2ED0A 2K2MA 3LGFA 1WA7A 3CBPA 4MDWA 4WF2A 2X4XA 4OMPA 1IZ6A 1R0CB 2EBPA 1W2BP 2MF2A 4J9GA 2LMJA 4IUVA 4XTYA 1H8KA 2X4JA 5IHKA 3MEAA 4C0GA 3H9NA 4F7UG 3DLLA 4JRIA 3UDCA 5CK9A 1X43A 2OJ2A 3UWNA 1UGVA 4IUTA 1YJNT 2KSSA 2HQEA 1JJ2A 1AWXA 1X2QA 2K57A 2LT4A 4N4GA 3JCMh 1S72T 5CO7A 2FVUA 2QAZA 3QJ6A 5GMKl 2CH4W 1WXTA 3OBYA 3J80E 3LYIA 1VIEA 3VKIA 1VQPT 2O4XA 3OQ5A 4OVAA 1F1BB 2D1XA 2VB6A 3X24B 3QDRB 3LWIA 1X6BA 5KYYB 4OMNA 4QT7A 3VYHB 3EGDB 2X3WD 4BUGA 3CCSQ 2DL5A 3TQ7P 3RUXA 2JOYA 4PJOG 3PNWC 5LJ5g 3T9NA 2R5AA 1NJIR 2KNBB 1LVKA 4A53A 4FT4A 1OOTA 4E7ZA 4DEXA 2I0NA 3C4SA 4DBRA 2MOXA 4DBFA 2F69A 2RJFA 3JCMc 4AMCA 2M16A 4J6YA 3G6EA 4BI3A 4KUDK 2EW3A 2HSPA 2E65A 2HMAA 2AK5A 2MWOA 4J8OA 2PU9B 5GAN5 5GANj 1WHGA 3FB9A 3M0RA 3M0TA 1NM7A 1WQWA 2CKKA 5GAN7 4PJOC 4XU1A 2HQHA 3QPHA 1OEBA 1VQ8Q 2XI9A 1B34A 1ZA2B 2E4HA 2ZPHB 3OY9A 2ED1A 4NS5A 5A0GA 1QCFA 2DD5A 2NUZA 3PMTA 3DLMA 3L2QA 1AVZC 1Y07A 1N8RC 3CQTA 2EYWA 5GMKi 4VUBA 1KC8R 3VYGA 4FCYA 3VS4A 1DJ7B 3RDVA 1HJDA 2J6KA 2CP5A 2KXCA 3QJYA 1JU5C 5C6SA 1JO8A 1RAGB 2GGRA 3CBOA 3L2ZA 2MYSA 3A98A 4RKUE 1U1SA 4J9DA 5IT9E 1Q7YC 1C0MA 1BI0A 4A4GA 1ARKA 2KAFA 4BY6C 1FMKA 2YLBA 2VXEA 3JB9F 1BKBA 1BIAA 1SG5A 2KVQG 4DQ2A 4RCCA 1NZ9A 2HEQA 3H41A 1E6HA 5CKEA 1K8AC 1Y71A 2K5FA 4OMOA 2NUPB 2A3LA 3AHUA 4E7LA 3EFRA 1VUBA 2PTKA 4XQ3A 3JB9J 4QVZA 3E2UA 2QDLA 3OYLA 1WQ7A 3VUZA 1G3SA 2QEXQ 1ZBJA 2G6FX 1WI7A 4Q5WA 3P8HA 5J39A 3OYAA 3A1PA 1FXXA 2KMTA 4DBQA 1UE9A 1YWOA 2LTOA 5D7UA 3OYFA 2E3HA 1I5LA 2D9TA 3OYNA 2EGCA 1UGRB 3V8LA 2RQWA 4QQ6A 1VQOQ 3V8KA 1WZOA 4DA4A 1PCXA 3JCMd 3G6ET 3VS0A 3CC4Q 2FEIA 1RLPC 1VA7A 2RHZA 3RKYA 1AWOA 1FMWA 4BY6B 5HK0A 2QTVA 4QW2A 3CXCS 2KT8A 3JCMb 3CCSA 4KT0E 1Q86R 3CCVQ 5CR2A 4A54A 3MEWA 3OYMA 1YIJT 4OGCA 3ASKA 2H8HA 5LJ3g 2MAMA 5IN1A 4EMKC 1EX4A 3M0SA 2EJGA 4E7HA 1YITQ 1M3AA 4AFQC 2RJDA 3PMIA 3FLGA 4E7KA 2DE0X 2R58A 3M53A 3MP8A 2A7YA 2JTEA 4F04B 1TU0B 2QK0A 2NUTB 2YRCA 1KD1R 5GAOp 4C5IA 3HKSA 1H3HA 1M1FA 1OI1A 3H8ZA 1VQ8A 3CPWP 3NPFA 1D0YA 1O9SA 4JS4A 5I11A 2DZ9A 2YUNA 1TXQA 4M77G 2J7IA 2P0PA 5HKCA 4FL6A 2O9SA 5KYXA 2DILA 5FRNA 5GAN8 2B8AA 4C8QG 3JCMQ 4EMHA 1N5ZA 4RTXA 3JCMf 5KYUA 4PJMA 4JLIA 2DXBA 3A8GB 3I5SA 2P84A 5D6WA 3CPWA 1AOJA 4NL2A 2RB6A 2DETA 3KFVA 5GMKj 3NTKA 4M77C 4PJJA 1JQQA 1GFCA 1I4K1 3I55Q 4JZ3A 4C8QC 1OX8A 2JMCA 1K0XA 4C92F 4FYXB 3ZFJA 2JN0A 3MPUB 1GCPA 5CKDA 3HP9A 5J26A 1OZ2A 4KBMB 3G4ST 3MJXA 3OS1A 1NJIC 2E10A 2QEXA 4EIKA 5GANe 4HXJA 2EJFA 1D3BA 4M75F 3L2UA 2FO0A 2RJEA 3NFCA 3QG1A 1G3TA 2QDYB 4LDYA 5FU6C 2RM4A 3M59A 2OTLQ 3EG9B 2OX7A 3E9GA 1VQOA 4JJBA 2A28A 4RCBA 2RI2A 2NWMA 3CC4A 1YJWT 4ELYC 1HSQA 1V29B 3RESA 4F7UF 3JCMJ 2KRSA 3OBWA 3SWNC 1M90U 3RR6A 3FDRA 3LW5E 4RMOA 2AKKA 3CCVA 2CT4A 2EYQA 2ZPBB 2JS0A 2FYKA 1BB9A 1VQ8T 1M1KR 2EIFA 3CCJQ 4J5YA 4RTYA 1WNLA 5A0DA 4N0AA 1BI3A 2KQWA 4L59A 1YITA 4E7SA 1RADB 4C92E 1KC8C 2EQUA 3PGGA 5L23A 2J05A 1LOJA 2BKDN 5KE2A 5AT1B 2CZ7B 5HK3A 3JCMP 3QWYA 2DL7A 4E7IA 1YI2Q 3OW2S 1WHHA 4F16A 3FRNA 4LUDA 4C92A 4DOWA 2PVGB 1HXDA 1MNEA 2CP2A 2VXFA 1GBQA 1WJQA 1M27C 5CIUA 1M2OA 1UUEA 1K9MU 2BE7D 4M75E 2LCLA 1D1CA 4J83A 3X28B 1PRLC 1UEBA 3QDFA 5KCOA 5GANh 3CCMQ 3JB9H 2DERA 3M0UA 1LPLA 1FMVA 1PG5B 2XKOC 2CP7A 1QLYA 3VS7A 2JXBA 4YTLA 4M75A 1U06A 3LX7A 5DLQE 3JCMV 2ZGWA 1IRXA 2O01E 1BIBA 1UFFA 3E9FA 2IVWA 3KUFA 4D6WA 2L3RA 1XOVA 1FX7A 3BDLA 1SHGA 3P8DA 3OYYA 4C5GA 2F2VA 3V7CA 2QEXT 3I55A 3FIFA 2DMOA 1X01A 4B9XA 5CQYA 4OMQA 1KHCA 3MP1A 9ATCB 5GAMg 2EKHA 1VQOT 1QCOA 1LNXA 1QP2A 2KYMA 5I21A 3DKMA 4FSXA 2LZ6B 2YXYA 1N27A 2RH2A 3LGLA 1VQ9T 5I2MA 3REBB 1I5OB 4QQGA 3LH0A 3LLRA 3CCVT 4BDZA 2FPFA 1NG2A 2KR3A 4OMMA 5ECAA 4X9DA 2QG9B 1U3OA 4KRTA 3CC2T 1VQMQ 2VUBA 2DEUA 2FL7A 1K73R 3META 4NOYA 3GBQA 5KYXB 3TEEA 1VQ5Q 4KUIA 3FC3A 3CBMA 1KD1C 2CS7A 3VS1A 1TTHB 3RNJA 1TG0A 4IIOA 2DNUA 1TUDA 2LP5A 2KEAA 3NHNA 3CCJA 1U8RA 4MMLA 2VASA 2XIDA 4OP0A 1NLOC 3CMEQ 4HT8A 2A08A 2COYA 1QWEA 3O8VA 1WFWA 3HSBA 2GF7A 5GMKe 4M7DF 4N4HA 2JVVA 1Y96A 3X25B 3CEYA 4FU6A 2K5LA 5GAOq 4C5EA 1YI2A 2L8DA 2ATCB 2DL3A 3M0QA 2AZVA 3RERA 1MUZA 2JTFA 3CMAQ 4HKEA 2MK5A 4OB3B 3VS6A 1RAAB 1WXBA 4F14A 3UA7A 2DXTA 5IH2A 3CCMA 2XU8A 4LD9K 1YHQT 1ABQA 4FSSA 5FW9A 4LD6A 2E3IA 4WCIA 2DF6A 1D3BB 3ZL7C 2J06A 5GANd 3H0FA 2EWNA 2AKLA 5AYFA 1WXUA 4J7FA 1E7OA 2JJ9A 3PE0A 3C12A 3RBBB 1Q81R 1B7TA 1OULA 1PD0A 1NEBA 1MMGA 4BB7A 2M9UA 1KQ2A 1WYXA 1C1AA 4FW1A 4FYVB 2DA9A 4BI8B 1WLPB 2GCXA 4M77F 2DTOA 2LQKA 2GTJA 1PWTA 2AZSA 3OS2A 3L2RA 3MEUA 4GLKA 2DFUA 4IURA 4M7DE 3TVTA 2OI3A 3EFOA 2E6NA 5GMKh 1PSFA 5DY9A 3QSUA 4EMGA 5CVIA 1D09B 2V26A 3OMCA 4KULA 2P4RA 4M7DA 2DPPB 3LH5A 3OYKA 2J6FA 1A0NB 1OQKA 7AT1B 2LQWA 1ZA1B 2V8IA 4C92B 1MMNA 3I35A 2ZAEA 4MZTA 4C92D 1M1KC 2K3YA 4J9IA 3PVQA 1QVPA 4AFUC 3CCJT 2E12A 3EGXA 4ELZC 2FPEA 2M51A 1VQMA 1NBEB 1GXIE 4QVDA 4J9BA 4XU0A 1VQKQ 2HD0A 2RO0A 2PNIA 4Y91A 1VOMA 2E6ZA 5GAOm 1VQ5A 2K79A 4M75B 2Y4XA 3CCLQ 3EAEA 4M75D 1M4ZA 3S3NA 1YI2T 2GNCA 3OYBA 4HVUA 1ZSGA 2LVMA 2Y90A 1RI0A 2LQNA 3CXCP 3G71Q 5FRMA 3J7AF 4JUVA 1GBRA 1W2BS 4C0DB 1RLQC 4M77E 4ZN3A 2K2VA 2ROTA 2RHUA 3CCMT 3CMEA 4RTZA 1JRIA 1M3CA 4D8DA 2ECZA 3QHSA 2EVRA 2CSQA 2EQMA 3OYJA 2KY9A 1EIFA 1AZGB 1RUWA 2OAWA 1OV3A 2RHXA 1XTDA 1BCMA 3VJPA 4DOVA 1UG1A 3BE3A 3CMAA 4CC4B 1VQ4Q 4DEYA 4ANJA 3CXCA 2IIMA 2P0KA 1UHFA 3CCQQ 2B86A 5LJ5j 3QZ9B 2BZYA 2CP6A 2LRQA 1X69A 1N9SA 1M8MA 2XHCA 4OMFB 2RI5A 2E1HA 4JJNK 2K9GA 3EHQA 2L3SA 2DJQA 2QQ9A 3PTAA 3WVDB 5EC7A 2A0FB 1K9AA 4XU3A 1GCQC 2A36A 4DBHA 4XTWA 3OA6A 1G5VA 5A0LA 2Z0WA 1NE8A 3ZEHA 2DL4A 1EZZB 2MMPA 3S3OA 2WSCE 1YJ9Q 4M7AF 4M78F 1BBZA 1T0JA 3HHTB 3MKDA 4LDWA 2K6DA 3WXMB 4C0ZA 1RI9A 1N6AA 1Z9ZA 4RG2A 3OYHA 1IHWA 3JCMg 4BDYA 4PJLA 1KFZA 1Y0MA 2C0OA 5IXBA 1PHTA 1VQMT 1K73C 1SSFA 2EKOA 2KROA 1Q82R 1UTIA 3OS0A 1UHCA 2LT1A 3U23A 2DLPA 2NLUA 4K11A 2QA4Q 4RTTA 1VQ5T 3GNFB 1Y96B 2RHIA 2PVOB 3S3MA 1UJYA 2O88A 1SEMA 4GY5A 2K4YA 2LJ3A 1VQ6Q 4ZGDB 4XK8E 4BE2A 4MMKA 2EJ9A 3M0PA 2SRCA 4AG2C 4KH0B 3IQLA 3C95A 3H0IA 2YRVA 1Q86U 2K3XA 2PUOB 3SB2A 4ATOA 3F70A 1VQKA 1AEYA 4J9CA 2G3RA 4JDSA 1X27A 4L6V5 3CCUQ 3CCLA 3VRYA 2E41A 1O75A 1TH7A 4M7AE 4E2FB 4M78E 3CMAT 4X1VA 1VQNQ 1B07A 2YUPA 3G71A 1M5Q1 4F17A 1BU1A 2L5QA 4M7AA 1NEGA 3SD4A 2WACA 4M78A 4IUUA 2DBKA 2CH4A 2D0NA 3CPFA 2O4XB 2XICA 1GFDA 1ZUYA 1PC0A 3QO3A 3E1SA 1Q81C 1CKAA 3D7SB 3EFOB 1I8FA 1H92A 1Q95G 2GTOA 1VQ4A 3OW2P 1K0SA 1AWJA 4PFOA 2DZCA 3EG0A 2LDMA 3CCQA 2HL3A 2MI6A 4M7DB 1JB0E 1NYFA 2DVEA 4JRPA 4M7DD 4GBQA 2DYIA 2FG0A 5LJ3j 1KQSS 1TUGB 3G7ZA 2JZ2A 4XTZA 1ZX6A 4FW2A 2QTXA 1NPPA 2HBPA 4QQDA 4C5HA 2V1RA 2GQIA 3LWHA 4OMLA 1ZSZA 1I07A 3OSVA 3CCST 1SPKA 2QQSA 3BY7A 3OW2A 2A37A 1HK9A 2VVKA 3DB3A 1G3WA 1B34B 4B6MA 1YJ9A 3GLXA 3VV0A 3M55A 1M90R 1G3YA 2E5QA 4PJNA 4JS5A 1NLPC 4ORZA 2CP0A 4QVCA 1W1FA 1BK2A 2RNAA 1VQPQ 2YT6A 4HCZA 4PKCC 3OSSC 4HCBA 2P0QA 2NYSA 1W6XA 3M57A 1SRLA 1ZHIA 4BD3A 2JS2A 1HD3A 1LJOA 2Y4YA 2QA4A 2GQVA 2C0IA 3CCLT 5FLXE 4Y28E 1ZQ1A 3J81E 3M58A 5GJVB 1K4US 1VQ6A 2KDSA 4FIBA 5EG2A 2FZCB 4UC4A 5GAOl 2RQVA 3G71T 3M5AA 4P5NA 2M02A 3HTRA 4HA8A 4XAXB 5J3BA 2HKQB 5HCKA 3VS2A 5LJ5e 5GAN6 3O5ZA 4RUGA 4ZGEB 1ZUUA 4R56A 3EG1A 4A63B 3G1JA 1SHFA 4PJOF 2ROLA 3EHRA 1R77A 3CCUA 5LL6S 3UT1A 2XK0A 6AT1B 1MHNA 3VS3A 3Q1JA 4IUPA 1XJWB 1VQ4T 1BI2A 1VQNA 1OZ3A 4ZGJB 4ZTFA 2FPDA 4ZNXA 5KYNA 5I2SA 3GPLA 5GJWB 1JBMA 5IAYA 2CZ6B 2DBMA 3INZA 4F7UE 2DRMA 4FM4B 1I81A 1KSWA 2XDPA 3QBYA 4PL6A 5A2QE 1U1TA 2FZGB 1N8RU 3SDZA 5CKHA 2VKNA 1PNJA 2DTIA 2X3XD 1YN8A 1P92A 4F7UA 2LQ8A 5KE3A 4JRQA 2RI3A 3ME9A 3CCRQ 2RQUA 2RPNA 5D6XA 4X9CA 2BIVA 3OMGA 5KYWA 3JRZA 1MGQA 1YJ9T 3H6ZA 4J6XA 1XQHA 1SSHA 4FYWB 2ZPEB 1X6GA 1X2KA 1U5SA 5FU7B 3MCAB 1QCNA 2WSEE 1Q7YU 1YP5A 3CC4T 2ENMA 4KGVB 5LJ5h 3M54A 3MHXA 3E19A 4XTXA 4PJOE 1AT1B 1Q82C 3JB9D 4OB0B 1WHMA 3PIPA 3ZBDA 1T3LA 1K8AU 4GLMA 4LNPA 2RQRA 3GF5A 3OYIA 1YNZA 2HCKA 4PJOA 3QZ5B 4JZ4A 4FT2A 2OTLA 4R0KA 4J6WA 3UA6A 1YITT 1VQ6T 2BE9B 3NTHA 2DIGA 4II1A 3WVEB 3JSCA 1D0XA 1MNDA 4LDVA 3VU3C 3G6EQ 1C6VX 1W70A 1VQ7Q 1JEGA 3HL8A 1Y7XA 1VYVA 2KYBA 4M7AB 4M78B 1PKSA 4M7AD 5KYUB 4M78D
chains in the Genus database with same CATH topology
2LJ1A 1FYNA 1M3AA 2O9VA 4AFQC 2JW4A 2PNIA 2LJ0A 1OPKA 2BZXA 1GL5A 2DE0X 2K79A 4Z8AA 2JTEA 2GNCA 2EGEA 1WIEA 4HVUA 4Z89A 4RTVA 3TSZA 1ZSGA 1H3HA 4HVWA 1IO6A 2LQNA 1GBRA 1CKBA 1UECA 1RLQC 2C0TA 3NPFA 2RN8A 5I11A 2ROTA 4RTZA 2YUNA 1QWFA 1M3CA 3EGUA 4JJCA 2J7IA 4D8DA 2ECZA 2EVRA 2CSQA 2O9SA 3VS5A 2DILA 1ZUKA 2SEMA 1AZGB 4Z88A 1RUWA 2OAWA 1OV3A 1WX6A 2L3QA 1N5ZA 1UG1A 4RTXA 4CC4B 3UATA 4DEYA 2IIMA 2YSQA 2W0ZA 3I5SA 2J6OA 1QKWA 2KT1A 4J9EA 1AOJA 1UHFA 4HVVA 2FRWA 2B86A 3KFVA 3NGPA 2BZYA 1T3SA 1X69A 1M8MA 2F2WA 1JQQA 4M4ZA 1GFCA 1K1ZA 2K9GA 3EHQA 4JPBW 4JZ3A 1KIKA 2L3SA 2DJQA 5EC7A 2JMCA 4RTWA 1K0XA 1K9AA 1Z9QA 2KE9A 2O31A 1GCQC 1GCPA 2A36A 3TSWA 2EYXA 4J9BA 1G2BA 2RQTA 2DL4A 4LE9A 4LUEA 2CDTA 1JXOA 2BZ8A 2VWFA 2DL8A 1VYTA 1BBZA 1T0JA 2K6DA 4EIKA 1RI9A 1Z9ZA 1G83A 3EG2A 3VRZA 4HXJA 5IHIA 4LN2A 2FO0A 5IHNA 2KRMA 2V1QA 1KFZA 2D8JA 1Y0MA 2C0OA 4AFZC 5IXBA 1AWWA 1I0CA 1PHTA 2ABLA 3JV3A 2L0AA 3ULRB 4JJBA 2A28A 2KROA 2D8HA 2JM8A 1UTIA 2NWMA 1UHCA 2KBTA 3U23A 2DLPA 2CT3A 4K11A 4RTTA 1HSQA 3H0HA 2MCNA 2KRSA 2O88A 1UJYA 1YWPA 1SEMA 2LJ3A 2AKKA 2CT4A 2JS0A 5I22A 4E6RA 1BB9A 3M0PA 3I5RA 2CREA 2SRCA 4AG2C 4AG1C 3IQLA 3H0IA 4RTYA 2HDAA 1EFNA 2F2XA 1PKTA 2YUQA 4J9CA 1AEYA 1NYGA 5L23A 1X27A 1ZLMA 2J05A 4AFSC 4IIMA 2DRKA 3VRYA 3QWYA 2DL7A 2GBQA 2W10A 4F16A 4LUDA 2RF0A 1M30A 4X1VA 1I1JA 1GBQA 3SHWA 4CC7A 1B07A 1M27C 2YUPA 2FRYA 1UUEA 2L3PA 4F17A 1BU1A 1UDLA 1B3QA 2XMFA 1PRLC 1NEGA 3M0UA 2DBKA 1S1NA 2KGTA 1GCQA 1T0HA 2CH4A 2D0NA 2DVJA 5IXFA 2K2MA 2CSIA 2ED0A 1WA7A 1GFDA 1QLYA 3VS7A 1ZUYA 2JXBA 4OMPA 2KRNA 1VYUA 1U06A 2EBPA 1GRIA 1CKAA 4J9GA 2LMJA 3FJ5A 1H92A 1UFFA 2GTOA 1H8KA 1K0SA 5IHKA 1AWJA 2K7AA 3EG0A 1NYFA 1XOVA 1SHGA 1X43A 2L2PA 2OJ2A 4GBQA 1UGVA 2FG0A 2F2VA 1AWXA 1JXMA 1X2QA 1ZX6A 2DMOA 4OMQA 2V1RA 2GQIA 4OMLA 2CH4W 1I07A 2BTTA 2KXDA 2EKHA 1WXTA 1SPKA 2KYMA 2A37A 2DYBA 2VVKA 2LNHB 4HCKA 4J9FA 2LZ6B 1YCSB 2D1XA 1X6BA 2CUDA 1OPLA 4J9HA 4OMNA 4QT7A 2LCSA 3REBB 2JM9A 2X3WD 2DL5A 1NLPC 4ORZA 2FPFA 1W1FA 1NG2A 1BK2A 2KR3A 4OMMA 2RNAA 2YT6A 5ECAA 2KNBB 1W6XA 1OOTA 1U3OA 4KRTA 4DEXA 1SRLA 2I0NA 2EYYA 2MOXA 3QWXX 2JS2A 3SEMA 1HD3A 2E5KA 3GBQA 2C0IA 2EW3A 2HSPA 1TUCA 1SRMA 2AK5A 1E6GA 3M0RA 1WDXA 3VS1A 3M0TA 5GJVB 3RNJA 1K4US 1TG0A 1NM7A 4IIOA 2DNUA 1KJWA 1K76A 3EG3A 1TUDA 2RQVA 2LP5A 1OEBA 2M0YA 4Y92A 1J3TA 2KEAA 2ED1A 2HBWA 3NHNA 3R6NA 2DM1A 3PVLA 5FWCA 5HCKA 3VS2A 1QCFA 1NLOC 2NUZA 3O5ZA 2A08A 4RUGA 1QWEA 3THKA 1AVZC 1ZUUA 1WFWA 3EG1A 4A63B 1SHFA 3CQTA 2ROLA 2EYWA 1LCKA 3EHRA 1MV0B 1CSKA 3VS4A 1HJDA 2DL3A 2J6KA 3VS3A 2KXCA 3M0QA 2K3BA 2AZVA 1MUZA 1JU5C 3VS6A 1JO8A 3I9QA 2FPDA 1WXBA 2GGRA 4ZNXA 4F14A 1UJ0A 5GJWB 3UA7A 3A98A 2DBMA 4J9DA 1PRMC 5IH2A 3REAB 2DRMA 1KSWA 3NMZC 1ABQA 4FSSA 5FW9A 4WCIA 2YDLA 2CUBA 4CC3A 2DF6A 1ARKA 1FMKA 3ZL7C 2VKNA 2J06A 1PNJA 3H0FA 2AKLA 2X3XD 1YN8A 2JT4A 2RMOA 2EQIA 1WXUA 2YUOA 1E7OA 2HEQA 3H41A 3PE0A 1E6HA 3RBBB 1V1CA 2RQUA 2RPNA 4OMOA 1NEBA 2EPDA 2PTKA 1SSHA 1WYXA 1X6GA 1X2KA 1U5SA 2QDLA 2DA9A 4CC2A 1ZBJA 2EGAA 3UF4A 1QKXA 2G6FX 1WLPB 1WI7A 1YP5A 2LX7A 2GTJA 1AD5A 1PWTA 2ENMA 1UE9A 4D8KA 1YWOA 1AZEA 2AZSA 2MIOA 2EGCA 3TVTA 2OI3A 2RQWA 2O2OA 2ESWA 1T3LA 4GLMA 2P4RA 3VS0A 2FEIA 1RLPC 1VA7A 2RQRA 4LNPA 1YNZA 2HCKA 2PZ1A 3LH5A 1AWOA 4JZ4A 4R0KA 2J6FA 2DX1A 1A0NB 3UA6A 2LQWA 1Y57A 2KT8A 2EYZA 3I35A 4JJDA 5FWBA 4J9IA 3PVQA 4AFUC 1W70A 1MV3A 4RTUA 2H8HA 1JEGA 4ESRA 1VYVA 2KYBA 3C0CA 1ABOA 2JMAA 2FPEA 2M51A 1M3BA 1PKSA 3M0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ1 A;  1FYN A;  1M3A A;  2O9V A;  4AFQ C;  2JW4 A;  2PNI A;  2LJ0 A;  1OPK A;  2BZX A;  1GL5 A;  2DE0 X;  2K79 A;  4Z8A A;  2JTE A;  2GNC A;  2EGE A;  1WIE A;  4HVU A;  4Z89 A;  4RTV A;  3TSZ A;  1ZSG A;  1H3H A;  4HVW A;  1IO6 A;  2LQN A;  1GBR A;  1CKB A;  1UEC A;  1RLQ C;  2C0T A;  3NPF A;  2RN8 A;  5I11 A;  2ROT A;  4RTZ A;  2YUN A;  1QWF A;  1M3C A;  3EGU A;  4JJC A;  2J7I A;  4D8D A;  2ECZ A;  2EVR A;  2CSQ A;  2O9S A;  3VS5 A;  2DIL A;  1ZUK A;  2SEM A;  1AZG B;  4Z88 A;  1RUW A;  2OAW A;  1OV3 A;  1WX6 A;  2L3Q A;  1N5Z A;  1UG1 A;  4RTX A;  4CC4 B;  3UAT A;  4DEY A;  2IIM A;  2YSQ A;  2W0Z A;  3I5S A;  2J6O A;  1QKW A;  2KT1 A;  4J9E A;  1AOJ A;  1UHF A;  4HVV A;  2FRW A;  2B86 A;  3KFV A;  3NGP A;  2BZY A;  1T3S A;  1X69 A;  1M8M A;  2F2W A;  1JQQ A;  4M4Z A;  1GFC A;  1K1Z A;  2K9G A;  3EHQ A;  4JPB W;  4JZ3 A;  1KIK A;  2L3S A;  2DJQ A;  5EC7 A;  2JMC A;  4RTW A;  1K0X A;  1K9A A;  1Z9Q A;  2KE9 A;  2O31 A;  1GCQ C;  1GCP A;  2A36 A;  3TSW A;  2EYX A;  4J9B A;  1G2B A;  2RQT A;  2DL4 A;  4LE9 A;  4LUE A;  2CDT A;  1JXO A;  2BZ8 A;  2VWF A;  2DL8 A;  1VYT A;  1BBZ A;  1T0J A;  2K6D A;  4EIK A;  1RI9 A;  1Z9Z A;  1G83 A;  3EG2 A;  3VRZ A;  4HXJ A;  5IHI A;  4LN2 A;  2FO0 A;  5IHN A;  2KRM A;  2V1Q A;  1KFZ A;  2D8J A;  1Y0M A;  2C0O A;  4AFZ C;  5IXB A;  1AWW A;  1I0C A;  1PHT A;  2ABL A;  3JV3 A;  2L0A A;  3ULR B;  4JJB A;  2A28 A;  2KRO A;  2D8H A;  2JM8 A;  1UTI A;  2NWM A;  1UHC A;  2KBT A;  3U23 A;  2DLP A;  2CT3 A;  4K11 A;  4RTT A;  1HSQ A;  3H0H A;  2MCN A;  2KRS A;  2O88 A;  1UJY A;  1YWP A;  1SEM A;  2LJ3 A;  2AKK A;  2CT4 A;  2JS0 A;  5I22 A;  4E6R A;  1BB9 A;  3M0P A;  3I5R A;  2CRE A;  2SRC A;  4AG2 C;  4AG1 C;  3IQL A;  3H0I A;  4RTY A;  2HDA A;  1EFN A;  2F2X A;  1PKT A;  2YUQ A;  4J9C A;  1AEY A;  1NYG A;  5L23 A;  1X27 A;  1ZLM A;  2J05 A;  4AFS C;  4IIM A;  2DRK A;  3VRY A;  3QWY A;  2DL7 A;  2GBQ A;  2W10 A;  4F16 A;  4LUD A;  2RF0 A;  1M30 A;  4X1V A;  1I1J A;  1GBQ A;  3SHW A;  4CC7 A;  1B07 A;  1M27 C;  2YUP A;  2FRY A;  1UUE A;  2L3P A;  4F17 A;  1BU1 A;  1UDL A;  1B3Q A;  2XMF A;  1PRL C;  1NEG A;  3M0U A;  2DBK A;  1S1N A;  2KGT A;  1GCQ A;  1T0H A;  2CH4 A;  2D0N A;  2DVJ A;  5IXF A;  2K2M A;  2CSI A;  2ED0 A;  1WA7 A;  1GFD A;  1QLY A;  3VS7 A;  1ZUY A;  2JXB A;  4OMP A;  2KRN A;  1VYU A;  1U06 A;  2EBP A;  1GRI A;  1CKA A;  4J9G A;  2LMJ A;  3FJ5 A;  1H92 A;  1UFF A;  2GTO A;  1H8K A;  1K0S A;  5IHK A;  1AWJ A;  2K7A A;  3EG0 A;  1NYF A;  1XOV A;  1SHG A;  1X43 A;  2L2P A;  2OJ2 A;  4GBQ A;  1UGV A;  2FG0 A;  2F2V A;  1AWX A;  1JXM A;  1X2Q A;  1ZX6 A;  2DMO A;  4OMQ A;  2V1R A;  2GQI A;  4OML A;  2CH4 W;  1I07 A;  2BTT A;  2KXD A;  2EKH A;  1WXT A;  1SPK A;  2KYM A;  2A37 A;  2DYB A;  2VVK A;  2LNH B;  4HCK A;  4J9F A;  2LZ6 B;  1YCS B;  2D1X A;  1X6B A;  2CUD A;  1OPL A;  4J9H A;  4OMN A;  4QT7 A;  2LCS A;  3REB B;  2JM9 A;  2X3W D;  2DL5 A;  1NLP C;  4ORZ A;  2FPF A;  1W1F A;  1NG2 A;  1BK2 A;  2KR3 A;  4OMM A;  2RNA A;  2YT6 A;  5ECA A;  2KNB B;  1W6X A;  1OOT A;  1U3O A;  4KRT A;  4DEX A;  1SRL A;  2I0N A;  2EYY A;  2MOX A;  3QWX X;  2JS2 A;  3SEM A;  1HD3 A;  2E5K A;  3GBQ A;  2C0I A;  2EW3 A;  2HSP A;  1TUC A;  1SRM A;  2AK5 A;  1E6G A;  3M0R A;  1WDX A;  3VS1 A;  3M0T A;  5GJV B;  3RNJ A;  1K4U S;  1TG0 A;  1NM7 A;  4IIO A;  2DNU A;  1KJW A;  1K76 A;  3EG3 A;  1TUD A;  2RQV A;  2LP5 A;  1OEB A;  2M0Y A;  4Y92 A;  1J3T A;  2KEA A;  2ED1 A;  2HBW A;  3NHN A;  3R6N A;  2DM1 A;  3PVL A;  5FWC A;  5HCK A;  3VS2 A;  1QCF A;  1NLO C;  2NUZ A;  3O5Z A;  2A08 A;  4RUG A;  1QWE A;  3THK A;  1AVZ C;  1ZUU A;  1WFW A;  3EG1 A;  4A63 B;  1SHF A;  3CQT A;  2ROL A;  2EYW A;  1LCK A;  3EHR A;  1MV0 B;  1CSK A;  3VS4 A;  1HJD A;  2DL3 A;  2J6K A;  3VS3 A;  2KXC A;  3M0Q A;  2K3B A;  2AZV A;  1MUZ A;  1JU5 C;  3VS6 A;  1JO8 A;  3I9Q A;  2FPD A;  1WXB A;  2GGR A;  4ZNX A;  4F14 A;  1UJ0 A;  5GJW B;  3UA7 A;  3A98 A;  2DBM A;  4J9D A;  1PRM C;  5IH2 A;  3REA B;  2DRM A;  1KSW A;  3NMZ C;  1ABQ A;  4FSS A;  5FW9 A;  4WCI A;  2YDL A;  2CUB A;  4CC3 A;  2DF6 A;  1ARK A;  1FMK A;  3ZL7 C;  2VKN A;  2J06 A;  1PNJ A;  3H0F A;  2AKL A;  2X3X D;  1YN8 A;  2JT4 A;  2RMO A;  2EQI A;  1WXU A;  2YUO A;  1E7O A;  2HEQ A;  3H41 A;  3PE0 A;  1E6H A;  3RBB B;  1V1C A;  2RQU A;  2RPN A;  4OMO A;  1NEB A;  2EPD A;  2PTK A;  1SSH A;  1WYX A;  1X6G A;  1X2K A;  1U5S A;  2QDL A;  2DA9 A;  4CC2 A;  1ZBJ A;  2EGA A;  3UF4 A;  1QKX A;  2G6F X;  1WLP B;  1WI7 A;  1YP5 A;  2LX7 A;  2GTJ A;  1AD5 A;  1PWT A;  2ENM A;  1UE9 A;  4D8K A;  1YWO A;  1AZE A;  2AZS A;  2MIO A;  2EGC A;  3TVT A;  2OI3 A;  2RQW A;  2O2O A;  2ESW A;  1T3L A;  4GLM A;  2P4R A;  3VS0 A;  2FEI A;  1RLP C;  1VA7 A;  2RQR A;  4LNP A;  1YNZ A;  2HCK A;  2PZ1 A;  3LH5 A;  1AWO A;  4JZ4 A;  4R0K A;  2J6F A;  2DX1 A;  1A0N B;  3UA6 A;  2LQW A;  1Y57 A;  2KT8 A;  2EYZ A;  3I35 A;  4JJD A;  5FWB A;  4J9I A;  3PVQ A;  4AFU C;  1W70 A;  1MV3 A;  4RTU A;  2H8H A;  1JEG A;  4ESR A;  1VYV A;  2KYB A;  3C0C A;  1ABO A;  2JMA A;  2FPE A;  2M51 A;  1M3B A;  1PKS A;  3M0S A; 
#chains in the Genus database with same CATH topology
 2PQW A;  2JW4 A;  3RMQ A;  1OPK A;  2FZK B;  1YIJ Q;  1GL5 A;  2X51 A;  5M9O A;  3A5Z B;  2AIR B;  2KK4 A;  3CCU T;  4Z8A A;  2LX9 A;  1BI1 A;  1QVF S;  1KG1 A;  1WIE A;  3TSZ A;  1AHJ B;  3GIB A;  1KK7 A;  5GAO r;  2EQK A;  2CGH A;  2QYZ A;  2RN8 A;  1KQ1 A;  3M9Q A;  2VYT A;  4C92 G;  1UB4 A;  8ATC B;  3PFS A;  1QWF A;  3OYC A;  3EGU A;  2H3E B;  5GAM j;  5LJ3 e;  3M4G A;  3VS5 A;  1QVG S;  2YHT A;  2COZ A;  1W4S A;  4N0A C;  2QGG A;  3JCM X;  4Z88 A;  1WX6 A;  2DXC A;  1ZSZ B;  1QW1 A;  3I55 T;  1V76 A;  1M9S A;  2MPX C;  2YSQ A;  2W0Z A;  2J6O A;  1QKW A;  2KT1 A;  4M75 G;  2QXF A;  4XTV A;  1QMC A;  2X9H A;  3P8B B;  5GAO n;  2FRW A;  3RKX A;  5GAN g;  4C92 C;  2M1H A;  4L5G A;  1T3S A;  2F2W A;  2NUT A;  2YLC A;  4A4K A;  2OTJ Q;  4M4Z A;  3A8M B;  1RAE B;  4LDX A;  2X35 A;  4RTW A;  2KE9 A;  2O31 A;  4IKF A;  2V8J A;  4OGE A;  2QQB A;  1SF9 A;  3CCR A;  1WHL A;  1G2B A;  2RK2 A;  4M75 C;  2RQT A;  4LE9 A;  4LUE A;  2CDT A;  2VWF A;  2DL8 A;  4C8Q F;  1W2B A;  4ZTJ A;  1M90 C;  2OTL T;  1Q81 U;  4EMK A;  4C0D C;  1G83 A;  1RAF B;  3EG2 A;  3VRZ A;  3QKJ A;  5IHI A;  3CC7 Q;  3G4S Q;  5IHN A;  2KRM A;  4PK4 A;  2V1Q A;  1RAH B;  4AFZ C;  4AT1 B;  1AWW A;  1I0C A;  5LJ3 h;  2ABL A;  2ZPF B;  3ULR B;  2D8H A;  2JM8 A;  5LJ5 d;  3SFM A;  5D6Y A;  1R8O B;  2HZY A;  3M4Y A;  4CRI A;  2IG0 A;  4PLI A;  2CZ1 B;  4OF1 A;  1NJI U;  5GAN f;  3V8J A;  3V7S A;  1YJW Q;  3I5R A;  2CRE A;  1VQ7 A;  1K9M C;  8AT1 B;  4C0F A;  1TOV A;  2DK3 A;  3QYG B;  1UGQ B;  2CZ0 B;  3QII A;  3S6W A;  1JJ2 S;  2RA2 A;  2XDB A;  4OB2 B;  1EFN A;  2F2X A;  1PKT A;  1IRE B;  1YIJ A;  1NYG A;  4BE0 A;  3RIR A;  4IIM A;  2X4W A;  2DRK A;  5DM7 R;  2DO3 A;  4F7U B;  2W10 A;  3EG9 A;  1OYX A;  2RF0 A;  4KGX B;  4C8Q E;  1IXD A;  1M30 A;  2KI7 A;  5KCH A;  3SHW A;  1OU8 A;  3MP6 A;  4M77 A;  1VIF A;  2FRY A;  2F5T X;  1SKU B;  5KYW B;  1B3Q A;  4QKU A;  1UGS B;  2XMF A;  4V2S A;  1RAI B;  4O6J A;  4C8Q A;  1S1N A;  4BAC A;  1X6O A;  2DVJ A;  4LDU A;  1IGQ A;  4A4F A;  1KC8 U;  3CCE Q;  2CSI A;  2KRN A;  1VYU A;  3GOX A;  1GRI A;  1XNI A;  3EH2 A;  2JUF A;  3FJ5 A;  5LJ5 f;  2VV5 A;  3CCR T;  3DB4 A;  2K7A A;  3HRS A;  1RL2 A;  2MWP A;  4PJO B;  4PJO D;  2L2P A;  1WHK A;  1WJR A;  2IPO B;  3EH1 A;  2OTJ A;  2HQX A;  4R55 A;  3HFN A;  2EFI A;  3KBG A;  1JXM A;  4Z02 A;  5GAN 3;  4E47 A;  1RAB B;  3EFS A;  2RJC A;  4KH1 B;  2BTT A;  2KXD A;  3SWN A;  3CD6 Q;  2DYB A;  3MEV A;  2LNH B;  3FEO A;  4PFZ A;  4EDU A;  4HCK A;  3JCM W;  4BI4 A;  3PT9 A;  4J9F A;  1YCS B;  2K5I A;  5CKB A;  2CUD A;  1OPL A;  2AHJ B;  4J9H A;  2LCS A;  1NPR A;  3V7R A;  2JM9 A;  2DKG A;  1KQS P;  4M7D G;  5CKF A;  2ZPG B;  3CC7 A;  3G4S A;  1VQ7 T;  1D0Z A;  1VQ9 Q;  2LCC A;  1D1A A;  3QUI A;  2DJZ A;  1WJS A;  2EYY A;  1M2V A;  5KH6 A;  2L89 A;  1H3Z A;  2F1L A;  3QWX X;  3SEM A;  2D6F A;  1YCY A;  2E5K A;  4EPC A;  2EQJ A;  5GAN 2;  5LJ3 d;  5GAM e;  2RHY A;  2XD0 A;  1TUC A;  1SRM A;  2RD1 A;  3CME T;  2D0Q B;  1E6G A;  1WDX A;  3CC2 Q;  1Q82 U;  4IUQ A;  1KQS A;  1KJW A;  1K76 A;  3EG3 A;  5GAN 4;  1RAC B;  4M7D C;  2VC8 A;  2M0Y A;  1VQL Q;  3ER0 A;  2FB7 A;  4X34 A;  4XTU A;  4Y92 A;  3L2V A;  1YJW A;  1J3T A;  3QYH B;  3R6N A;  2HBW A;  2DM1 A;  3PVL A;  5FWC A;  2OAU A;  2JNG A;  3I56 Q;  4OB1 B;  2LC4 A;  2ZZD A;  3THK A;  3RKW A;  3N5B B;  1LCK A;  1MV0 B;  1CSK A;  4E7J A;  1KD1 U;  4HCC A;  2HAX A;  2K3B A;  2EAY A;  2ZPI B;  2XG8 D;  4LXC A;  3I9Q A;  1PSE A;  4A4E A;  4PFP A;  1UJ0 A;  1FWZ A;  3FJP A;  1PRM C;  4HT9 A;  3REA B;  3NMZ C;  2HNI A;  2OTJ T;  4EMK B;  4WTO B;  1MMD A;  2YDL A;  1HYO A;  2CUB A;  4CC3 A;  3CCE A;  2JT4 A;  1G8X A;  2RMO A;  2EQI A;  2YUO A;  2CP3 A;  2HSE B;  2M0O A;  1V1C A;  1YHQ Q;  3BW1 A;  5GAM h;  3JAM E;  4RG8 A;  1H64 1;  2DXU A;  1TS9 A;  5LJ3 f;  3A8L B;  2BUD A;  3R6O A;  1YBY A;  1ZBX A;  2CYZ B;  2EPD A;  1UGP B;  3AT1 B;  3EGX B;  2DEQ A;  1YJN Q;  3OYG A;  5GMK m;  4CC2 A;  2EGA A;  3UF4 A;  1QKX A;  1QQJ A;  1KHI A;  3M56 A;  2LX7 A;  1AD5 A;  3CC7 T;  2HL5 C;  4D8K A;  1AZE A;  1BCO A;  1S72 Q;  2MIO A;  2YWW A;  5FRO A;  1ACM B;  3OYE A;  2O2O A;  3CD6 A;  2ESW A;  4KGZ B;  4CI0 C;  5L8R E;  4O5V A;  1IB8 A;  2PZ1 A;  2QQA A;  2P4T A;  2DX1 A;  1VQK T;  1Y57 A;  2EYZ A;  4JJD A;  3CPW S;  1IGU A;  3TRE A;  5FWB A;  2GFU A;  4M77 B;  4M77 D;  4RTU A;  1MV3 A;  4ESR A;  3NTI A;  2LNV A;  1VQ9 A;  3C0C A;  2R57 A;  1ABO A;  2JMA A;  2DIQ A;  1M3B A;  4C8Q B;  4A4H A;  1OU9 A;  4C8Q D;  2LJ1 A;  1FYN A;  2O9V A;  3VUB A;  3URG A;  2LJ0 A;  2DTH A;  2BZX A;  3JB9 G;  2XDD A;  4ME7 A;  1D1B A;  3OB9 A;  2JTM A;  5KYY A;  2R5M A;  1MMA A;  3QXE B;  3TCJ A;  4JRK A;  1R0B G;  1K9M R;  3EGD A;  2EGE A;  3CC2 A;  3MO8 A;  4Z89 A;  4RTV A;  3PIO A;  1M1K U;  4HVW A;  1IO6 A;  4BE1 A;  1VQL A;  1CKB A;  1UEC A;  2C0T A;  5FU7 C;  4J7I A;  4N4I A;  3I56 A;  5FU6 B;  4JJC A;  2I2L A;  3JB9 I;  3GNG A;  3X20 B;  3L2W A;  3CCE T;  3CCQ T;  4M7A G;  3A8O B;  2WSF E;  1ZUK A;  2SEM A;  4M78 G;  1N8R R;  2COW A;  2L3Q A;  2X4Y A;  4NL3 A;  2QGF B;  3SWN B;  3UAT A;  1QVF P;  4XU2 A;  3HRT A;  1WGS A;  4J9E A;  2DAQ A;  1IHV A;  2QAS A;  4HVV A;  1WHJ A;  2FHD A;  3HFO A;  3NGP A;  1M1G A;  4PNO A;  2QI2 A;  4MZP A;  3L42 A;  1K1Z A;  2V8K A;  2E64 A;  4JPB W;  3KXT A;  1KIK A;  1Q7Y R;  4M7A C;  4M78 C;  1QVG P;  1Z9Q A;  1OX9 A;  3CD6 T;  1M2V B;  3L1A A;  3TSW A;  2EYX A;  1YHQ A;  1QVF A;  2VGN A;  1JXO A;  2RK1 A;  2BZ8 A;  1K8A R;  1VYT A;  5GAM d;  4PLL A;  1YJN A;  2H3J A;  2PVD B;  2C06 A;  2AT1 B;  2QA4 T;  4LN2 A;  5CQX A;  2DD4 A;  5DLO A;  1S72 A;  3OS5 A;  2HKN A;  1QVG A;  2D8J A;  5C0M A;  1Q86 C;  3JV3 A;  2L0A A;  3TU4 K;  3UPU A;  3BDU A;  4MDX A;  2KBT A;  2NUP A;  2CT3 A;  1VQP A;  1PM3 A;  3H0H A;  3RMS A;  1ZSZ C;  2MCN A;  1QP3 A;  1YWP A;  2F5K A;  2QQR A;  4TVR A;  4ZN1 A;  5I22 A;  3X26 B;  4E6R A;  1VQL T;  3HRU A;  4AG1 C;  1PD1 A;  1WPY A;  3JCM e;  1K73 U;  5CAI A;  3A8H B;  3I56 T;  1VQN T;  2HDA A;  2PUK B;  1TSF A;  2YUQ A;  2E70 A;  1ZLM A;  4AFS C;  3GP8 A;  3BFM A;  2GBQ A;  4B9W A;  4JLG A;  3HPW A;  1I1J A;  4CC7 A;  1TWB A;  4FYY B;  4MZM A;  1M8V A;  5HY6 A;  3C94 A;  1N9R A;  1YFN A;  2L3P A;  1BYM A;  2ZCF B;  1UDL A;  5GAM f;  3OYD A;  2VGM A;  1X75 C;  2KGT A;  1GCQ A;  1T0H A;  2YRD A;  5IXF A;  2GFA A;  1JJ2 P;  5CCA A;  2ED0 A;  2K2M A;  3LGF A;  1WA7 A;  3CBP A;  4MDW A;  4WF2 A;  2X4X A;  4OMP A;  1IZ6 A;  1R0C B;  2EBP A;  1W2B P;  2MF2 A;  4J9G A;  2LMJ A;  4IUV A;  4XTY A;  1H8K A;  2X4J A;  5IHK A;  3MEA A;  4C0G A;  3H9N A;  4F7U G;  3DLL A;  4JRI A;  3UDC A;  5CK9 A;  1X43 A;  2OJ2 A;  3UWN A;  1UGV A;  4IUT A;  1YJN T;  2KSS A;  2HQE A;  1JJ2 A;  1AWX A;  1X2Q A;  2K57 A;  2LT4 A;  4N4G A;  3JCM h;  1S72 T;  5CO7 A;  2FVU A;  2QAZ A;  3QJ6 A;  5GMK l;  2CH4 W;  1WXT A;  3OBY A;  3J80 E;  3LYI A;  1VIE A;  3VKI A;  1VQP T;  2O4X A;  3OQ5 A;  4OVA A;  1F1B B;  2D1X A;  2VB6 A;  3X24 B;  3QDR B;  3LWI A;  1X6B A;  5KYY B;  4OMN A;  4QT7 A;  3VYH B;  3EGD B;  2X3W D;  4BUG A;  3CCS Q;  2DL5 A;  3TQ7 P;  3RUX A;  2JOY A;  4PJO G;  3PNW C;  5LJ5 g;  3T9N A;  2R5A A;  1NJI R;  2KNB B;  1LVK A;  4A53 A;  4FT4 A;  1OOT A;  4E7Z A;  4DEX A;  2I0N A;  3C4S A;  4DBR A;  2MOX A;  4DBF A;  2F69 A;  2RJF A;  3JCM c;  4AMC A;  2M16 A;  4J6Y A;  3G6E A;  4BI3 A;  4KUD K;  2EW3 A;  2HSP A;  2E65 A;  2HMA A;  2AK5 A;  2MWO A;  4J8O A;  2PU9 B;  5GAN 5;  5GAN j;  1WHG A;  3FB9 A;  3M0R A;  3M0T A;  1NM7 A;  1WQW A;  2CKK A;  5GAN 7;  4PJO C;  4XU1 A;  2HQH A;  3QPH A;  1OEB A;  1VQ8 Q;  2XI9 A;  1B34 A;  1ZA2 B;  2E4H A;  2ZPH B;  3OY9 A;  2ED1 A;  4NS5 A;  5A0G A;  1QCF A;  2DD5 A;  2NUZ A;  3PMT A;  3DLM A;  3L2Q A;  1AVZ C;  1Y07 A;  1N8R C;  3CQT A;  2EYW A;  5GMK i;  4VUB A;  1KC8 R;  3VYG A;  4FCY A;  3VS4 A;  1DJ7 B;  3RDV A;  1HJD A;  2J6K A;  2CP5 A;  2KXC A;  3QJY A;  1JU5 C;  5C6S A;  1JO8 A;  1RAG B;  2GGR A;  3CBO A;  3L2Z A;  2MYS A;  3A98 A;  4RKU E;  1U1S A;  4J9D A;  5IT9 E;  1Q7Y C;  1C0M A;  1BI0 A;  4A4G A;  1ARK A;  2KAF A;  4BY6 C;  1FMK A;  2YLB A;  2VXE A;  3JB9 F;  1BKB A;  1BIA A;  1SG5 A;  2KVQ G;  4DQ2 A;  4RCC A;  1NZ9 A;  2HEQ A;  3H41 A;  1E6H A;  5CKE A;  1K8A C;  1Y71 A;  2K5F A;  4OMO A;  2NUP B;  2A3L A;  3AHU A;  4E7L A;  3EFR A;  1VUB A;  2PTK A;  4XQ3 A;  3JB9 J;  4QVZ A;  3E2U A;  2QDL A;  3OYL A;  1WQ7 A;  3VUZ A;  1G3S A;  2QEX Q;  1ZBJ A;  2G6F X;  1WI7 A;  4Q5W A;  3P8H A;  5J39 A;  3OYA A;  3A1P A;  1FXX A;  2KMT A;  4DBQ A;  1UE9 A;  1YWO A;  2LTO A;  5D7U A;  3OYF A;  2E3H A;  1I5L A;  2D9T A;  3OYN A;  2EGC A;  1UGR B;  3V8L A;  2RQW A;  4QQ6 A;  1VQO Q;  3V8K A;  1WZO A;  4DA4 A;  1PCX A;  3JCM d;  3G6E T;  3VS0 A;  3CC4 Q;  2FEI A;  1RLP C;  1VA7 A;  2RHZ A;  3RKY A;  1AWO A;  1FMW A;  4BY6 B;  5HK0 A;  2QTV A;  4QW2 A;  3CXC S;  2KT8 A;  3JCM b;  3CCS A;  4KT0 E;  1Q86 R;  3CCV Q;  5CR2 A;  4A54 A;  3MEW A;  3OYM A;  1YIJ T;  4OGC A;  3ASK A;  2H8H A;  5LJ3 g;  2MAM A;  5IN1 A;  4EMK C;  1EX4 A;  3M0S A;  2EJG A;  4E7H A;  1YIT Q;  1M3A A;  4AFQ C;  2RJD A;  3PMI A;  3FLG A;  4E7K A;  2DE0 X;  2R58 A;  3M53 A;  3MP8 A;  2A7Y A;  2JTE A;  4F04 B;  1TU0 B;  2QK0 A;  2NUT B;  2YRC A;  1KD1 R;  5GAO p;  4C5I A;  3HKS A;  1H3H A;  1M1F A;  1OI1 A;  3H8Z A;  1VQ8 A;  3CPW P;  3NPF A;  1D0Y A;  1O9S A;  4JS4 A;  5I11 A;  2DZ9 A;  2YUN A;  1TXQ A;  4M77 G;  2J7I A;  2P0P A;  5HKC A;  4FL6 A;  2O9S A;  5KYX A;  2DIL A;  5FRN A;  5GAN 8;  2B8A A;  4C8Q G;  3JCM Q;  4EMH A;  1N5Z A;  4RTX A;  3JCM f;  5KYU A;  4PJM A;  4JLI A;  2DXB A;  3A8G B;  3I5S A;  2P84 A;  5D6W A;  3CPW A;  1AOJ A;  4NL2 A;  2RB6 A;  2DET A;  3KFV A;  5GMK j;  3NTK A;  4M77 C;  4PJJ A;  1JQQ A;  1GFC A;  1I4K 1;  3I55 Q;  4JZ3 A;  4C8Q C;  1OX8 A;  2JMC A;  1K0X A;  4C92 F;  4FYX B;  3ZFJ A;  2JN0 A;  3MPU B;  1GCP A;  5CKD A;  3HP9 A;  5J26 A;  1OZ2 A;  4KBM B;  3G4S T;  3MJX A;  3OS1 A;  1NJI C;  2E10 A;  2QEX A;  4EIK A;  5GAN e;  4HXJ A;  2EJF A;  1D3B A;  4M75 F;  3L2U A;  2FO0 A;  2RJE A;  3NFC A;  3QG1 A;  1G3T A;  2QDY B;  4LDY A;  5FU6 C;  2RM4 A;  3M59 A;  2OTL Q;  3EG9 B;  2OX7 A;  3E9G A;  1VQO A;  4JJB A;  2A28 A;  4RCB A;  2RI2 A;  2NWM A;  3CC4 A;  1YJW T;  4ELY C;  1HSQ A;  1V29 B;  3RES A;  4F7U F;  3JCM J;  2KRS A;  3OBW A;  3SWN C;  1M90 U;  3RR6 A;  3FDR A;  3LW5 E;  4RMO A;  2AKK A;  3CCV A;  2CT4 A;  2EYQ A;  2ZPB B;  2JS0 A;  2FYK A;  1BB9 A;  1VQ8 T;  1M1K R;  2EIF A;  3CCJ Q;  4J5Y A;  4RTY A;  1WNL A;  5A0D A;  4N0A A;  1BI3 A;  2KQW A;  4L59 A;  1YIT A;  4E7S A;  1RAD B;  4C92 E;  1KC8 C;  2EQU A;  3PGG A;  5L23 A;  2J05 A;  1LOJ A;  2BKD N;  5KE2 A;  5AT1 B;  2CZ7 B;  5HK3 A;  3JCM P;  3QWY A;  2DL7 A;  4E7I A;  1YI2 Q;  3OW2 S;  1WHH A;  4F16 A;  3FRN A;  4LUD A;  4C92 A;  4DOW A;  2PVG B;  1HXD A;  1MNE A;  2CP2 A;  2VXF A;  1GBQ A;  1WJQ A;  1M27 C;  5CIU A;  1M2O A;  1UUE A;  1K9M U;  2BE7 D;  4M75 E;  2LCL A;  1D1C A;  4J83 A;  3X28 B;  1PRL C;  1UEB A;  3QDF A;  5KCO A;  5GAN h;  3CCM Q;  3JB9 H;  2DER A;  3M0U A;  1LPL A;  1FMV A;  1PG5 B;  2XKO C;  2CP7 A;  1QLY A;  3VS7 A;  2JXB A;  4YTL A;  4M75 A;  1U06 A;  3LX7 A;  5DLQ E;  3JCM V;  2ZGW A;  1IRX A;  2O01 E;  1BIB A;  1UFF A;  3E9F A;  2IVW A;  3KUF A;  4D6W A;  2L3R A;  1XOV A;  1FX7 A;  3BDL A;  1SHG A;  3P8D A;  3OYY A;  4C5G A;  2F2V A;  3V7C A;  2QEX T;  3I55 A;  3FIF A;  2DMO A;  1X01 A;  4B9X A;  5CQY A;  4OMQ A;  1KHC A;  3MP1 A;  9ATC B;  5GAM g;  2EKH A;  1VQO T;  1QCO A;  1LNX A;  1QP2 A;  2KYM A;  5I21 A;  3DKM A;  4FSX A;  2LZ6 B;  2YXY A;  1N27 A;  2RH2 A;  3LGL A;  1VQ9 T;  5I2M A;  3REB B;  1I5O B;  4QQG A;  3LH0 A;  3LLR A;  3CCV T;  4BDZ A;  2FPF A;  1NG2 A;  2KR3 A;  4OMM A;  5ECA A;  4X9D A;  2QG9 B;  1U3O A;  4KRT A;  3CC2 T;  1VQM Q;  2VUB A;  2DEU A;  2FL7 A;  1K73 R;  3MET A;  4NOY A;  3GBQ A;  5KYX B;  3TEE A;  1VQ5 Q;  4KUI A;  3FC3 A;  3CBM A;  1KD1 C;  2CS7 A;  3VS1 A;  1TTH B;  3RNJ A;  1TG0 A;  4IIO A;  2DNU A;  1TUD A;  2LP5 A;  2KEA A;  3NHN A;  3CCJ A;  1U8R A;  4MML A;  2VAS A;  2XID A;  4OP0 A;  1NLO C;  3CME Q;  4HT8 A;  2A08 A;  2COY A;  1QWE A;  3O8V A;  1WFW A;  3HSB A;  2GF7 A;  5GMK e;  4M7D F;  4N4H A;  2JVV A;  1Y96 A;  3X25 B;  3CEY A;  4FU6 A;  2K5L A;  5GAO q;  4C5E A;  1YI2 A;  2L8D A;  2ATC B;  2DL3 A;  3M0Q A;  2AZV A;  3RER A;  1MUZ A;  2JTF A;  3CMA Q;  4HKE A;  2MK5 A;  4OB3 B;  3VS6 A;  1RAA B;  1WXB A;  4F14 A;  3UA7 A;  2DXT A;  5IH2 A;  3CCM A;  2XU8 A;  4LD9 K;  1YHQ T;  1ABQ A;  4FSS A;  5FW9 A;  4LD6 A;  2E3I A;  4WCI A;  2DF6 A;  1D3B B;  3ZL7 C;  2J06 A;  5GAN d;  3H0F A;  2EWN A;  2AKL A;  5AYF A;  1WXU A;  4J7F A;  1E7O A;  2JJ9 A;  3PE0 A;  3C12 A;  3RBB B;  1Q81 R;  1B7T A;  1OUL A;  1PD0 A;  1NEB A;  1MMG A;  4BB7 A;  2M9U A;  1KQ2 A;  1WYX A;  1C1A A;  4FW1 A;  4FYV B;  2DA9 A;  4BI8 B;  1WLP B;  2GCX A;  4M77 F;  2DTO A;  2LQK A;  2GTJ A;  1PWT A;  2AZS A;  3OS2 A;  3L2R A;  3MEU A;  4GLK A;  2DFU A;  4IUR A;  4M7D E;  3TVT A;  2OI3 A;  3EFO A;  2E6N A;  5GMK h;  1PSF A;  5DY9 A;  3QSU A;  4EMG A;  5CVI A;  1D09 B;  2V26 A;  3OMC A;  4KUL A;  2P4R A;  4M7D A;  2DPP B;  3LH5 A;  3OYK A;  2J6F A;  1A0N B;  1OQK A;  7AT1 B;  2LQW A;  1ZA1 B;  2V8I A;  4C92 B;  1MMN A;  3I35 A;  2ZAE A;  4MZT A;  4C92 D;  1M1K C;  2K3Y A;  4J9I A;  3PVQ A;  1QVP A;  4AFU C;  3CCJ T;  2E12 A;  3EGX A;  4ELZ C;  2FPE A;  2M51 A;  1VQM A;  1NBE B;  1GXI E;  4QVD A;  4J9B A;  4XU0 A;  1VQK Q;  2HD0 A;  2RO0 A;  2PNI A;  4Y91 A;  1VOM A;  2E6Z A;  5GAO m;  1VQ5 A;  2K79 A;  4M75 B;  2Y4X A;  3CCL Q;  3EAE A;  4M75 D;  1M4Z A;  3S3N A;  1YI2 T;  2GNC A;  3OYB A;  4HVU A;  1ZSG A;  2LVM A;  2Y90 A;  1RI0 A;  2LQN A;  3CXC P;  3G71 Q;  5FRM A;  3J7A F;  4JUV A;  1GBR A;  1W2B S;  4C0D B;  1RLQ C;  4M77 E;  4ZN3 A;  2K2V A;  2ROT A;  2RHU A;  3CCM T;  3CME A;  4RTZ A;  1JRI A;  1M3C A;  4D8D A;  2ECZ A;  3QHS A;  2EVR A;  2CSQ A;  2EQM A;  3OYJ A;  2KY9 A;  1EIF A;  1AZG B;  1RUW A;  2OAW A;  1OV3 A;  2RHX A;  1XTD A;  1BCM A;  3VJP A;  4DOV A;  1UG1 A;  3BE3 A;  3CMA A;  4CC4 B;  1VQ4 Q;  4DEY A;  4ANJ A;  3CXC A;  2IIM A;  2P0K A;  1UHF A;  3CCQ Q;  2B86 A;  5LJ5 j;  3QZ9 B;  2BZY A;  2CP6 A;  2LRQ A;  1X69 A;  1N9S A;  1M8M A;  2XHC A;  4OMF B;  2RI5 A;  2E1H A;  4JJN K;  2K9G A;  3EHQ A;  2L3S A;  2DJQ A;  2QQ9 A;  3PTA A;  3WVD B;  5EC7 A;  2A0F B;  1K9A A;  4XU3 A;  1GCQ C;  2A36 A;  4DBH A;  4XTW A;  3OA6 A;  1G5V A;  5A0L A;  2Z0W A;  1NE8 A;  3ZEH A;  2DL4 A;  1EZZ B;  2MMP A;  3S3O A;  2WSC E;  1YJ9 Q;  4M7A F;  4M78 F;  1BBZ A;  1T0J A;  3HHT B;  3MKD A;  4LDW A;  2K6D A;  3WXM B;  4C0Z A;  1RI9 A;  1N6A A;  1Z9Z A;  4RG2 A;  3OYH A;  1IHW A;  3JCM g;  4BDY A;  4PJL A;  1KFZ A;  1Y0M A;  2C0O A;  5IXB A;  1PHT A;  1VQM T;  1K73 C;  1SSF A;  2EKO A;  2KRO A;  1Q82 R;  1UTI A;  3OS0 A;  1UHC A;  2LT1 A;  3U23 A;  2DLP A;  2NLU A;  4K11 A;  2QA4 Q;  4RTT A;  1VQ5 T;  3GNF B;  1Y96 B;  2RHI A;  2PVO B;  3S3M A;  1UJY A;  2O88 A;  1SEM A;  4GY5 A;  2K4Y A;  2LJ3 A;  1VQ6 Q;  4ZGD B;  4XK8 E;  4BE2 A;  4MMK A;  2EJ9 A;  3M0P A;  2SRC A;  4AG2 C;  4KH0 B;  3IQL A;  3C95 A;  3H0I A;  2YRV A;  1Q86 U;  2K3X A;  2PUO B;  3SB2 A;  4ATO A;  3F70 A;  1VQK A;  1AEY A;  4J9C A;  2G3R A;  4JDS A;  1X27 A;  4L6V 5;  3CCU Q;  3CCL A;  3VRY A;  2E41 A;  1O75 A;  1TH7 A;  4M7A E;  4E2F B;  4M78 E;  3CMA T;  4X1V A;  1VQN Q;  1B07 A;  2YUP A;  3G71 A;  1M5Q 1;  4F17 A;  1BU1 A;  2L5Q A;  4M7A A;  1NEG A;  3SD4 A;  2WAC A;  4M78 A;  4IUU A;  2DBK A;  2CH4 A;  2D0N A;  3CPF A;  2O4X B;  2XIC A;  1GFD A;  1ZUY A;  1PC0 A;  3QO3 A;  3E1S A;  1Q81 C;  1CKA A;  3D7S B;  3EFO B;  1I8F A;  1H92 A;  1Q95 G;  2GTO A;  1VQ4 A;  3OW2 P;  1K0S A;  1AWJ A;  4PFO A;  2DZC A;  3EG0 A;  2LDM A;  3CCQ A;  2HL3 A;  2MI6 A;  4M7D B;  1JB0 E;  1NYF A;  2DVE A;  4JRP A;  4M7D D;  4GBQ A;  2DYI A;  2FG0 A;  5LJ3 j;  1KQS S;  1TUG B;  3G7Z A;  2JZ2 A;  4XTZ A;  1ZX6 A;  4FW2 A;  2QTX A;  1NPP A;  2HBP A;  4QQD A;  4C5H A;  2V1R A;  2GQI A;  3LWH A;  4OML A;  1ZSZ A;  1I07 A;  3OSV A;  3CCS T;  1SPK A;  2QQS A;  3BY7 A;  3OW2 A;  2A37 A;  1HK9 A;  2VVK A;  3DB3 A;  1G3W A;  1B34 B;  4B6M A;  1YJ9 A;  3GLX A;  3VV0 A;  3M55 A;  1M90 R;  1G3Y A;  2E5Q A;  4PJN A;  4JS5 A;  1NLP C;  4ORZ A;  2CP0 A;  4QVC A;  1W1F A;  1BK2 A;  2RNA A;  1VQP Q;  2YT6 A;  4HCZ A;  4PKC C;  3OSS C;  4HCB A;  2P0Q A;  2NYS A;  1W6X A;  3M57 A;  1SRL A;  1ZHI A;  4BD3 A;  2JS2 A;  1HD3 A;  1LJO A;  2Y4Y A;  2QA4 A;  2GQV A;  2C0I A;  3CCL T;  5FLX E;  4Y28 E;  1ZQ1 A;  3J81 E;  3M58 A;  5GJV B;  1K4U S;  1VQ6 A;  2KDS A;  4FIB A;  5EG2 A;  2FZC B;  4UC4 A;  5GAO l;  2RQV A;  3G71 T;  3M5A A;  4P5N A;  2M02 A;  3HTR A;  4HA8 A;  4XAX B;  5J3B A;  2HKQ B;  5HCK A;  3VS2 A;  5LJ5 e;  5GAN 6;  3O5Z A;  4RUG A;  4ZGE B;  1ZUU A;  4R56 A;  3EG1 A;  4A63 B;  3G1J A;  1SHF A;  4PJO F;  2ROL A;  3EHR A;  1R77 A;  3CCU A;  5LL6 S;  3UT1 A;  2XK0 A;  6AT1 B;  1MHN A;  3VS3 A;  3Q1J A;  4IUP A;  1XJW B;  1VQ4 T;  1BI2 A;  1VQN A;  1OZ3 A;  4ZGJ B;  4ZTF A;  2FPD A;  4ZNX A;  5KYN A;  5I2S A;  3GPL A;  5GJW B;  1JBM A;  5IAY A;  2CZ6 B;  2DBM A;  3INZ A;  4F7U E;  2DRM A;  4FM4 B;  1I81 A;  1KSW A;  2XDP A;  3QBY A;  4PL6 A;  5A2Q E;  1U1T A;  2FZG B;  1N8R U;  3SDZ A;  5CKH A;  2VKN A;  1PNJ A;  2DTI A;  2X3X D;  1YN8 A;  1P92 A;  4F7U A;  2LQ8 A;  5KE3 A;  4JRQ A;  2RI3 A;  3ME9 A;  3CCR Q;  2RQU A;  2RPN A;  5D6X A;  4X9C A;  2BIV A;  3OMG A;  5KYW A;  3JRZ A;  1MGQ A;  1YJ9 T;  3H6Z A;  4J6X A;  1XQH A;  1SSH A;  4FYW B;  2ZPE B;  1X6G A;  1X2K A;  1U5S A;  5FU7 B;  3MCA B;  1QCN A;  2WSE E;  1Q7Y U;  1YP5 A;  3CC4 T;  2ENM A;  4KGV B;  5LJ5 h;  3M54 A;  3MHX A;  3E19 A;  4XTX A;  4PJO E;  1AT1 B;  1Q82 C;  3JB9 D;  4OB0 B;  1WHM A;  3PIP A;  3ZBD A;  1T3L A;  1K8A U;  4GLM A;  4LNP A;  2RQR A;  3GF5 A;  3OYI A;  1YNZ A;  2HCK A;  4PJO A;  3QZ5 B;  4JZ4 A;  4FT2 A;  2OTL A;  4R0K A;  4J6W A;  3UA6 A;  1YIT T;  1VQ6 T;  2BE9 B;  3NTH A;  2DIG A;  4II1 A;  3WVE B;  3JSC A;  1D0X A;  1MND A;  4LDV A;  3VU3 C;  3G6E Q;  1C6V X;  1W70 A;  1VQ7 Q;  1JEG A;  3HL8 A;  1Y7X A;  1VYV A;  2KYB A;  4M7A B;  4M78 B;  1PKS A;  4M7A D;  5KYU B;  4M78 D; 
#chains in the Genus database with same CATH homology
 2LJ1 A;  1FYN A;  1M3A A;  2O9V A;  4AFQ C;  2JW4 A;  2PNI A;  2LJ0 A;  1OPK A;  2BZX A;  1GL5 A;  2DE0 X;  2K79 A;  4Z8A A;  2JTE A;  2GNC A;  2EGE A;  1WIE A;  4HVU A;  4Z89 A;  4RTV A;  3TSZ A;  1ZSG A;  1H3H A;  4HVW A;  1IO6 A;  2LQN A;  1GBR A;  1CKB A;  1UEC A;  1RLQ C;  2C0T A;  3NPF A;  2RN8 A;  5I11 A;  2ROT A;  4RTZ A;  2YUN A;  1QWF A;  1M3C A;  3EGU A;  4JJC A;  2J7I A;  4D8D A;  2ECZ A;  2EVR A;  2CSQ A;  2O9S A;  3VS5 A;  2DIL A;  1ZUK A;  2SEM A;  1AZG B;  4Z88 A;  1RUW A;  2OAW A;  1OV3 A;  1WX6 A;  2L3Q A;  1N5Z A;  1UG1 A;  4RTX A;  4CC4 B;  3UAT A;  4DEY A;  2IIM A;  2YSQ A;  2W0Z A;  3I5S A;  2J6O A;  1QKW A;  2KT1 A;  4J9E A;  1AOJ A;  1UHF A;  4HVV A;  2FRW A;  2B86 A;  3KFV A;  3NGP A;  2BZY A;  1T3S A;  1X69 A;  1M8M A;  2F2W A;  1JQQ A;  4M4Z A;  1GFC A;  1K1Z A;  2K9G A;  3EHQ A;  4JPB W;  4JZ3 A;  1KIK A;  2L3S A;  2DJQ A;  5EC7 A;  2JMC A;  4RTW A;  1K0X A;  1K9A A;  1Z9Q A;  2KE9 A;  2O31 A;  1GCQ C;  1GCP A;  2A36 A;  3TSW A;  2EYX A;  4J9B A;  1G2B A;  2RQT A;  2DL4 A;  4LE9 A;  4LUE A;  2CDT A;  1JXO A;  2BZ8 A;  2VWF A;  2DL8 A;  1VYT A;  1BBZ A;  1T0J A;  2K6D A;  4EIK A;  1RI9 A;  1Z9Z A;  1G83 A;  3EG2 A;  3VRZ A;  4HXJ A;  5IHI A;  4LN2 A;  2FO0 A;  5IHN A;  2KRM A;  2V1Q A;  1KFZ A;  2D8J A;  1Y0M A;  2C0O A;  4AFZ C;  5IXB A;  1AWW A;  1I0C A;  1PHT A;  2ABL A;  3JV3 A;  2L0A A;  3ULR B;  4JJB A;  2A28 A;  2KRO A;  2D8H A;  2JM8 A;  1UTI A;  2NWM A;  1UHC A;  2KBT A;  3U23 A;  2DLP A;  2CT3 A;  4K11 A;  4RTT A;  1HSQ A;  3H0H A;  2MCN A;  2KRS A;  2O88 A;  1UJY A;  1YWP A;  1SEM A;  2LJ3 A;  2AKK A;  2CT4 A;  2JS0 A;  5I22 A;  4E6R A;  1BB9 A;  3M0P A;  3I5R A;  2CRE A;  2SRC A;  4AG2 C;  4AG1 C;  3IQL A;  3H0I A;  4RTY A;  2HDA A;  1EFN A;  2F2X A;  1PKT A;  2YUQ A;  4J9C A;  1AEY A;  1NYG A;  5L23 A;  1X27 A;  1ZLM A;  2J05 A;  4AFS C;  4IIM A;  2DRK A;  3VRY A;  3QWY A;  2DL7 A;  2GBQ A;  2W10 A;  4F16 A;  4LUD A;  2RF0 A;  1M30 A;  4X1V A;  1I1J A;  1GBQ A;  3SHW A;  4CC7 A;  1B07 A;  1M27 C;  2YUP A;  2FRY A;  1UUE A;  2L3P A;  4F17 A;  1BU1 A;  1UDL A;  1B3Q A;  2XMF A;  1PRL C;  1NEG A;  3M0U A;  2DBK A;  1S1N A;  2KGT A;  1GCQ A;  1T0H A;  2CH4 A;  2D0N A;  2DVJ A;  5IXF A;  2K2M A;  2CSI A;  2ED0 A;  1WA7 A;  1GFD A;  1QLY A;  3VS7 A;  1ZUY A;  2JXB A;  4OMP A;  2KRN A;  1VYU A;  1U06 A;  2EBP A;  1GRI A;  1CKA A;  4J9G A;  2LMJ A;  3FJ5 A;  1H92 A;  1UFF A;  2GTO A;  1H8K A;  1K0S A;  5IHK A;  1AWJ A;  2K7A A;  3EG0 A;  1NYF A;  1XOV A;  1SHG A;  1X43 A;  2L2P A;  2OJ2 A;  4GBQ A;  1UGV A;  2FG0 A;  2F2V A;  1AWX A;  1JXM A;  1X2Q A;  1ZX6 A;  2DMO A;  4OMQ A;  2V1R A;  2GQI A;  4OML A;  2CH4 W;  1I07 A;  2BTT A;  2KXD A;  2EKH A;  1WXT A;  1SPK A;  2KYM A;  2A37 A;  2DYB A;  2VVK A;  2LNH B;  4HCK A;  4J9F A;  2LZ6 B;  1YCS B;  2D1X A;  1X6B A;  2CUD A;  1OPL A;  4J9H A;  4OMN A;  4QT7 A;  2LCS A;  3REB B;  2JM9 A;  2X3W D;  2DL5 A;  1NLP C;  4ORZ A;  2FPF A;  1W1F A;  1NG2 A;  1BK2 A;  2KR3 A;  4OMM A;  2RNA A;  2YT6 A;  5ECA A;  2KNB B;  1W6X A;  1OOT A;  1U3O A;  4KRT A;  4DEX A;  1SRL A;  2I0N A;  2EYY A;  2MOX A;  3QWX X;  2JS2 A;  3SEM A;  1HD3 A;  2E5K A;  3GBQ A;  2C0I A;  2EW3 A;  2HSP A;  1TUC A;  1SRM A;  2AK5 A;  1E6G A;  3M0R A;  1WDX A;  3VS1 A;  3M0T A;  5GJV B;  3RNJ A;  1K4U S;  1TG0 A;  1NM7 A;  4IIO A;  2DNU A;  1KJW A;  1K76 A;  3EG3 A;  1TUD A;  2RQV A;  2LP5 A;  1OEB A;  2M0Y A;  4Y92 A;  1J3T A;  2KEA A;  2ED1 A;  2HBW A;  3NHN A;  3R6N A;  2DM1 A;  3PVL A;  5FWC A;  5HCK A;  3VS2 A;  1QCF A;  1NLO C;  2NUZ A;  3O5Z A;  2A08 A;  4RUG A;  1QWE A;  3THK A;  1AVZ C;  1ZUU A;  1WFW A;  3EG1 A;  4A63 B;  1SHF A;  3CQT A;  2ROL A;  2EYW A;  1LCK A;  3EHR A;  1MV0 B;  1CSK A;  3VS4 A;  1HJD A;  2DL3 A;  2J6K A;  3VS3 A;  2KXC A;  3M0Q A;  2K3B A;  2AZV A;  1MUZ A;  1JU5 C;  3VS6 A;  1JO8 A;  3I9Q A;  2FPD A;  1WXB A;  2GGR A;  4ZNX A;  4F14 A;  1UJ0 A;  5GJW B;  3UA7 A;  3A98 A;  2DBM A;  4J9D A;  1PRM C;  5IH2 A;  3REA B;  2DRM A;  1KSW A;  3NMZ C;  1ABQ A;  4FSS A;  5FW9 A;  4WCI A;  2YDL A;  2CUB A;  4CC3 A;  2DF6 A;  1ARK A;  1FMK A;  3ZL7 C;  2VKN A;  2J06 A;  1PNJ A;  3H0F A;  2AKL A;  2X3X D;  1YN8 A;  2JT4 A;  2RMO A;  2EQI A;  1WXU A;  2YUO A;  1E7O A;  2HEQ A;  3H41 A;  3PE0 A;  1E6H A;  3RBB B;  1V1C A;  2RQU A;  2RPN A;  4OMO A;  1NEB A;  2EPD A;  2PTK A;  1SSH A;  1WYX A;  1X6G A;  1X2K A;  1U5S A;  2QDL A;  2DA9 A;  4CC2 A;  1ZBJ A;  2EGA A;  3UF4 A;  1QKX A;  2G6F X;  1WLP B;  1WI7 A;  1YP5 A;  2LX7 A;  2GTJ A;  1AD5 A;  1PWT A;  2ENM A;  1UE9 A;  4D8K A;  1YWO A;  1AZE A;  2AZS A;  2MIO A;  2EGC A;  3TVT A;  2OI3 A;  2RQW A;  2O2O A;  2ESW A;  1T3L A;  4GLM A;  2P4R A;  3VS0 A;  2FEI A;  1RLP C;  1VA7 A;  2RQR A;  4LNP A;  1YNZ A;  2HCK A;  2PZ1 A;  3LH5 A;  1AWO A;  4JZ4 A;  4R0K A;  2J6F A;  2DX1 A;  1A0N B;  3UA6 A;  2LQW A;  1Y57 A;  2KT8 A;  2EYZ A;  3I35 A;  4JJD A;  5FWB A;  4J9I A;  3PVQ A;  4AFU C;  1W70 A;  1MV3 A;  4RTU A;  2H8H A;  1JEG A;  4ESR A;  1VYV A;  2KYB A;  3C0C A;  1ABO A;  2JMA A;  2FPE A;  2M51 A;  1M3B A;  1PKS A;  3M0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...