4J9DA

Crystal structure of the n114a mutant of the abl-sh3 domain complexed with the high affinity peptide p0
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high affinity peptide P0
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9dA00
2RQVA 2LX7A 2RQTA 1ZBJA 2F2VA 1AZGB 1SRLA 1S1NA 4OMNA 4OMQA 3REBB 1MUZA 1WDXA 3RNJA 2RPNA 1UECA 1AEYA 2CH4A 4J9GA 2O31A 2C0TA 3U23A 1GL5A 2GBQA 1X27A 1NEGA 4F16A 1QKWA 5I22A 1GBQA 2GTOA 2DL7A 1BB9A 2ROTA 1IO6A 4AFUC 2LZ6B 2OAWA 2ESWA 4RTXA 4AG2C 1VYVA 2VWFA 5HCKA 4R0KA 2MCNA 3UA6A 4X1VA 2VKNA 4GLMA 2SEMA 2X3WD 2D0NA 5IHKA 1WXTA 1T3LA 1ABOA 2YUPA 1G2BA 4J9BA 1MV0B 1UUEA 3H0FA 2KBTA 3VS7A 2ENMA 3UF4A 1YWOA 1GFDA 1NYGA 1E7OA 3EHQA 2KRNA 1SHFA 2ED0A 3TSZA 2F2WA 2DBMA 2B86A 1PKTA 1W6XA 3A98A 2A08A 1I1JA 1KJWA 3EG0A 1YCSB 1QCFA 3THKA 1CSKA 2YUOA 1UDLA 2JM8A 2AZVA 2PZ1A 4RTVA 1QWEA 1PRMC 2H8HA 1WI7A 1AWXA 2QDLA 2DL3A 4DEXA 4RTZA 2DLPA 1LCKA 2IIMA 4M4ZA 1U3OA 1TUDA 4RUGA 2FPDA 4LUDA 4J9CA 3VS1A 1FYNA 2KRMA 4JPBW 3TSWA 2HBWA 4EIKA 5IHNA 2FO0A 1HD3A 3VS6A 1SSHA 3FJ5A 2GNCA 2GGRA 1WFWA 2DBKA 2J06A 1U06A 4F14A 3H41A 5FW9A 2LCSA 1I0CA 4GBQA 1AD5A 4A63B 2KT8A 2I0NA 1JO8A 2OJ2A 4DEYA 2K9GA 1T0HA 3PE0A 1NYFA 2BTTA 4LNPA 1WX6A 1JXMA 1ABQA 1UE9A 2L3SA 3CQTA 4CC4B 1PRLC 2K7AA 3KFVA 4JZ3A 1K0SA 2KE9A 2D1XA 1OPLA 2DMOA 1GCQA 3M0PA 2J7IA 1SPKA 4CC7A 2DA9A 5L23A 1M3BA 2PNIA 2DL8A 1K1ZA 3RBBB 4J9HA 2G6FX 4E6RA 1PHTA 2EPDA 2KT1A 2F2XA 1NLPC 2ROLA 1XOVA 2LJ1A 2M0YA 1N5ZA 3VRYA 5IXBA 2YSQA 1B07A 5ECAA 2LP5A 1MV3A 2RQRA 2YUNA 4Y92A 1Z9QA 2JS2A 1TUCA 2RN8A 4J9EA 3TVTA 2KNBB 2C0OA 1UFFA 1X6GA 3I5RA 2DL5A 4JZ4A 1QKXA 2PTKA 3PVQA 2A28A 1HSQA 4JJDA 5GJWB 2YT6A 2E5KA 2EVRA 3EHRA 2BZXA 1KFZA 1X2QA 1H3HA 1K76A 2D8JA 2O2OA 2KGTA 2V1QA 1AOJA 1PNJA 2O9SA 4KRTA 2EW3A 1UTIA 2K79A 2KXDA 2EBPA 1T0JA 3M0UA 3UATA 2CH4W 2ABLA 2LQWA 1E6HA 1RLQC 3EG1A 2O9VA 4RTWA 2DX1A 1JXOA 4IIOA 1ZUYA 1WIEA 2GQIA 2KRSA 4J9DA 1E6GA 1W70A 4RTUA 1GFCA 4F17A 2JMAA 1UGVA 4LE9A 2EYYA 1WYXA 2AKKA 1X6BA 2DNUA 4ESRA 2XMFA 2P4RA 1Y57A 2ECZA 1K4US 2RQWA 1OOTA 1YNZA 5IHIA 3SHWA 3EG3A 1T3SA 2JXBA 2YUQA 2BZYA 4HXJA 2CT4A 2CT3A 1Y0MA 1UHCA 2J05A 2BZ8A 1UG1A 2JMCA 2AZSA 2L2PA 2SRCA 2A37A 2LQNA 4ZNXA 1AWWA 1JQQA 2L3PA 4J9IA 1ZUUA 4AFQC 1VYUA 2CDTA 1NM7A 2C0IA 1X69A 3UA7A 2ED1A 1GBRA 3VRZA 1ARKA 3EGUA 1U5SA 3M0TA 4Z88A 2EKHA 2DYBA 1M8MA 2KXCA 2W0ZA 2EYWA 3M0SA 2AK5A 1BU1A 1AWJA 2FPFA 3VS5A 1M27C 1HJDA 2EYXA 3VS4A 4FSSA 1BK2A 3REAB 1UJYA 4RTTA 1H8KA 2EGCA 1Z9ZA 1JU5C 2O88A 1ZLMA 2L0AA 2DRKA 1YP5A 3M0RA 1SRMA 4Z8AA 1RLPC 5IXFA 1M3CA 4AFZC 1H92A 5IH2A 4CC3A 1WLPB 1WXBA 2V1RA 2JM9A 2YDLA 1UHFA 1QWFA 1SHGA 1ZX6A 2AKLA 2LMJA 1UJ0A 4CC2A 5GJVB 2EGAA 2EYZA 2KEAA 3PVLA 3VS0A 1WXUA 4D8KA 2K3BA 4J9FA 2HDAA 1CKBA 2K6DA 2OI3A 2VVKA 4HCKA 4JJBA 4Z89A 4AFSC 1X43A 1YWPA 2KYMA 4HVWA 2CSIA 1VA7A 2HEQA 1NEBA 3GBQA 1KSWA 2J6KA 2CREA 2MIOA 2M51A 3LH5A 1TG0A 4WCIA 4IIMA 1M3AA 2JW4A 1I07A 2EQIA 4RTYA 5FWBA 2DILA 1JEGA 2DL4A 4OMPA 1NG2A 4HVUA 3O5ZA 4ORZA 1YN8A 4D8DA 2RMOA 1GRIA 2NUZA 5FWCA 1VYTA 4QT7A 2CUBA 2CSQA 3VS3A 1GCPA 1GCQC 2LJ3A 3QWXX 3H0IA 3SEMA 1V1CA 3R6NA 3VS2A 1OV3A 2GTJA 2LJ0A 3C0CA 2DM1A 2FRYA 2KYBA 3NPFA 1K0XA 3I5SA 1M30A 1SEMA 2JT4A 1B3QA 2LNHB 4AG1C 2DRMA 3QWYA 2JTEA 2FRWA 2HSPA 2DJQA 5EC7A 2JS0A 3JV3A 1NLOC 4OMLA 2X3XD 2K2MA 1X2KA 2J6FA 3H0HA 3ULRB 2DF6A 2HCKA 4LUEA 1EFNA 5I11A 4LN2A 1KIKA 2DVJA 2MOXA 4JJCA 2DE0X 1OEBA 1FMKA 1W1FA 2A36A 1A0NB 3ZL7C 1PKSA 1QLYA 1ZSGA 4OMOA 3I35A 2NWMA 4OMMA 1ZUKA 2RNAA 2J6OA 4HVVA 2EGEA 2KROA 2RQUA 2FPEA 1WA7A 2D8HA 1RI9A 3IQLA 3I9QA 1AWOA 3EG2A 1OPKA 1CKAA 1K9AA 3M0QA 2KR3A 2L3QA 1BBZA 3NMZC 1G83A 3NGPA 1J3TA 1PWTA 1AZEA 3NHNA 1AVZC 2FG0A 1RUWA 2CUDA 2W10A 2FEIA 4K11A 2RF0A
chains in the Genus database with same CATH superfamily
1VQ9T 3G4ST 2F1LA 1ZBJA 2O01E 4Y91A 2DAQA 4C92F 3PT9A 1WNLA 3X25B 2YHTA 4OP0A 3L42A 1UECA 2MYSA 3RR6A 1TWBA 2GBQA 4J5YA 5CKDA 2HL5C 1WJRA 2DL7A 3T9NA 3UWNA 3I56T 4AFUC 2ESWA 4AG2C 1VYVA 2VWFA 5HCKA 3I55Q 3A8MB 4QKUA 3CCUA 3TEEA 5LJ3e 2MCNA 3UA6A 4X1VA 1W2BP 1G3YA 2K3YA 5J26A 1WXTA 3CCMA 4J9BA 2VGMA 1OZ2A 3VYHB 3VS7A 4A54A 1EIFA 1B34A 3UF4A 4C8QG 2RI2A 3EH2A 4KT0E 1K9MC 1SHFA 3A8OB 3NTHA 2B86A 3ASKA 4RCCA 1RAHB 3A98A 1Q86C 4OB2B 2CP5A 2A08A 3JCMJ 1I1JA 3OYEA 1O75A 5GANe 2AZVA 1JJ2A 1VQ5T 4E7ZA 4JLIA 4M77D 2QDLA 2XU8A 4RTZA 2DLPA 2Y90A 1NE8A 2IIMA 2YLCA 5KYXA 4LUDA 4J9CA 3EFOA 2ZPEB 3TSWA 4C92A 3CCUQ 4N4IA 2FO0A 1HD3A 3M4YA 2K5IA 2KI7A 3V7CA 2GGRA 2M16A 2V8KA 1U06A 1UEBA 3E9FA 3CCMQ 2IVWA 4EMKC 4A63B 1K8AR 2I0NA 1JO8A 1PM3A 4M7DC 2K9GA 1T0HA 3OW2S 3ZBDA 1O9SA 1D1CA 2L3SA 2WSEE 3KFVA 2K7AA 2CZ1B 3BDUA 1D1AA 1XJWB 5GAMg 2J7IA 1PD1A 5GAOp 4CC7A 2R57A 5L23A 1YJNT 3VYGA 3RBBB 1VQ8A 3CC7A 1TXQA 1NJIU 3QZ5B 2D6FA 1NLPC 3HFNA 1XOVA 2DEQA 3MP1A 2QQRA 2M0YA 4DBHA 3VRYA 5IXBA 1KG1A 2LP5A 3OYLA 1MV3A 4LDWA 2YUNA 4Y92A 4C5EA 2PVDB 3CPWP 2RN8A 4A4EA 1VQPA 1MMGA 1LNXA 1UFFA 4JZ4A 2DL5A 1QKXA 3CXCS 1H641 1HSQA 1XQHA 4M78D 1I5LA 5GJWB 1B34B 2M0OA 2XICA 1X2QA 2HZYA 2EKOA 1BI1A 4RG8A 1LPLA 1AOJA 1VQ8Q 2K2VA 1YI2T 1HXDA 4NS5A 2K79A 3CC7Q 5CIUA 2EBPA 1T0JA 2ABLA 4FL6A 4M7DE 4WF2A 5KYXB 1ZUYA 3TREA 2GQIA 3EFOB 2JMAA 3N5BB 4C92B 3CMAA 4PJOG 1VQPQ 2AIRB 4M7AG 4M75D 1WYXA 2QQSA 1X6BA 3DLLA 1SSFA 1BYMA 2P4RA 2ECZA 1PG5B 5I2SA 1DJ7B 4JS5A 4HCZA 3M58A 2L3RA 2JXBA 2BZYA 1Y7XA 3GOXA 2DETA 1M1FA 1WZOA 2J05A 1QCNA 1UG1A 2BZ8A 2A0FB 2AZSA 3GLXA 2VXFA 3JSCA 2HKNA 2LQNA 1JQQA 1YIJT 1RAAB 1KQ2A 1UGRB 5LJ5j 1ZUUA 1VQNA 2ED1A 1BCMA 3VRZA 3EGUA 1OQKA 3CMAQ 3FB9A 2DYBA 3D7SB 5LJ3g 4UC4A 5GMKj 2DERA 3M0SA 2FB7A 2DTIA 5I21A 4ZGDB 1UGPB 3FJPA 4IUTA 2GQVA 1WJSA 2Y4YA 1ZLMA 1KQSP 1F1BB 4WTOB 1VUBA 1OI1A 1RL2A 1SRMA 4Z8AA 4AFZC 1NJIC 1KC8R 3OA6A 1QVFP 5GANg 2DEUA 3E9GA 3CC2T 2XDBA 1WXBA 4OB0B 4R55A 2V1RA 1VQNQ 1WQWA 3OSSC 4JRKA 4A53A 3CCVA 2P0PA 2PUKB 4J83A 3C12A 3CBMA 4MDWA 3FC3A 1FWZA 2CSIA 2BIVA 4F7UF 1TUGB 3EGDA 3GBQA 4O5VA 4C92C 3G6ET 1AHJB 3CCST 5GAOl 1BCOA 4DQ2A 2JW4A 1I07A 4QVZA 3QYHB 4OMPA 2I2LA 2HKQB 4HVUA 3O5ZA 4EPCA 1KD1R 1XNIA 3MJXA 3QUIA 3KBGA 1TH7A 3CCJA 3PMTA 2R5MA 4CRIA 4E7JA 4QT7A 2CSQA 4C0DB 3OYHA 2GTJA 2CZ0B 1N27A 1W2BA 3CCEA 3CCVQ 3RMSA 2KYBA 1AT1B 3P8BB 5DY9A 1SF9A 5D6XA 2HSEB 3I5SA 1OU8A 3QJ6A 2LNHB 2DRMA 2JTEA 1N6AA 2HSPA 3E19A 1YJWA 2LQKA 2F5TX 5KYUB 1NLOC 2RJFA 2DIGA 3OS2A 3CCRT 2K2MA 2GCXA 2LRQA 3CCJQ 4XU3A 1TS9A 5GAN7 5KYYA 4J6WA 3CCLT 5I11A 4LN2A 4PKCC 1D0YA 3LX7A 1A0NB 4F7UA 1VQKT 3ZL7C 2F69A 1PKSA 1QLYA 3G4SA 4M78G 2DXUA 3RUXA 4OMMA 3CCEQ 4OF1A 2RQUA 2V26A 2CZ6B 4Q5WA 4C92E 5I2MA 2D8HA 4PLLA 1K9MR 3IQLA 4OGEA 1AWOA 2P4TA 1CKAA 2BUDA 3HP9A 2E5QA 1Q86R 3GNGA 1YJWQ 1PWTA 1AVZC 2FZGB 1IZ6A 2RHIA 2EWNA 2LCCA 3I56A 2ZPHB 2E70A 2X4YA 2KY9A 3META 5GMKm 5LJ5h 2F2VA 3OYFA 2ZPFB 2LQ8A 3LH0A 3PGGA 3CCQA 3REBB 3JB9F 4D6WA 2P84A 2CH4A 2QTVA 3G4SQ 3LLRA 1X27A 4F16A 5KYWA 5GMKh 5GAOn 4FT4A 2YLBA 3CPWA 8ATCB 5GAMe 3MEVA 3ZFJA 2VKNA 5FU6B 4BI4A 3LYIA 4XTYA 3RKXA 1G2BA 3I56Q 3OBYA 1UUEA 3URGA 5GAN2 2E10A 1GFDA 3S6WA 1E7OA 3TSZA 2F2WA 3CCQQ 1M1GA 3BE3A 2NUTA 2GF7A 1C6VX 3MEAA 1EZZB 4KUIA 3EG0A 1IB8A 4A4GA 1CSKA 5GAMf 4F7UB 2A3LA 1V76A 2PZ1A 4IUPA 1QWEA 3J81E 1WHHA 1WI7A 1Y96A 1AWXA 4DEXA 2COYA 4C5IA 3AT1B 4B9WA 5D6WA 1LCKA 2R5AA 4CI0C 5HKCA 2COWA 4N0AA 2E6NA 5DLQE 3OYKA 5CCAA 2HBWA 3MO8A 4EIKA 3VS6A 3M59A 3WXMB 5LJ3d 2DBKA 2J06A 4XAXB 5CKHA 5GMKi 3H41A 5FW9A 2LCSA 5J39A 4PJOD 2OJ2A 4E2FB 5A2QE 4M7AD 1NYFA 2JVVA 4QW2A 1W2BS 1WX6A 1JXMA 2FZKB 3LGLA 5GAN8 1ABQA 1QW1A 3KUFA 1UE9A 4XU1A 1OPLA 2XIDA 1GCQA 3JCMc 4HCBA 2PNIA 2DL8A 5GANd 1K1ZA 2QGGA 2QXFA 4FCYA 2RHXA 3G71T 4F04B 1PHTA 2EPDA 2O4XA 3RKWA 5GAN5 2QASA 4BD3A 1M90U 2DK3A 4BACA 3X28B 1LJOA 2CGHA 2ROLA 1WHGA 2YSQA 5ECAA 3A8GB 2G3RA 1K73U 1YI2A 4PJMA 4HCCA 4E7IA 2WACA 1JBMA 3S3MA 4KBMB 1TUCA 4J9EA 2C0OA 3I5RA 1KQSA 3PVQA 4C92D 3RKYA 4RKUE 2A28A 2YT6A 1QVFA 2EVRA 5FU6C 1IREB 2RJEA 4BB7A 3EHRA 2BZXA 1KFZA 2D8JA 1NBEB 2O2OA 2XK0A 5GAOq 4Z02A 2NUTB 2L89A 4M7DG 1PNJA 3L1AA 3CD6T 2RB6A 1SG5A 3P8HA 4FW2A 1IGUA 2NLUA 3CC4T 3M0UA 2F5KA 2JTMA 2CH4W 1Y96B 1D09B 3GF5A 4JRPA 1R77A 2O9VA 4RTWA 2DXCA 4NL3A 1ZA1B 2RJDA 1OU9A 1RABB 1VQ6T 4DOWA 1YI2Q 1WIEA 2YRVA 1E6GA 1VQ7T 2YRCA 1GFCA 2VV5A 2MMPA 5CKEA 3UPUA 1R0BG 2DXTA 1NJIR 4QVCA 4OB3B 5C6SA 3CPWS 5LJ3f 1YNZA 5IHIA 3SHWA 4A4HA 1UGQB 1D0XA 4RMOA 2DJZA 2EQUA 5CAIA 1QVGP 1ACMB 4M77F 1SKUB 3NTKA 2JMCA 2L2PA 5GANj 3S3NA 1EX4A 3MHXA 2H3JA 1AWWA 2XKOC 2O4XB 1M2OA 5GANf 1NM7A 1MMDA 1ARKA 1R0CB 3M0TA 4XU2A 3PFSA 1GXIE 2M9UA 2JTFA 2W0ZA 3MPUB 2OTLT 1QP3A 3M5AA 3QSUA 1M27C 1HJDA 2EYXA 2CP0A 3VS4A 4FSSA 3BY7A 1UJYA 4RTTA 1ZSZA 4QVDA 1JU5C 4ZTJA 5CKFA 1YP5A 3M0RA 3FIFA 1VQ4T 1N8RC 4FSXA 1RLPC 2QA4T 4F7UE 1M90C 4PL6A 3V8KA 3G6EA 3QBYA 3CCSA 4CC3A 2XHCA 2E1HA 1K73C 2VGNA 2VXEA 2AKLA 2BE7D 2RO0A 2LMJA 4CC2A 3VJPA 3M53A 4IKFA 2EGAA 2XDDA 2E41A 3SD4A 2E65A 3VS0A 4M77A 2HDAA 2VVKA 4HCKA 4JJBA 2VC8A 4Z89A 4AFSC 1X43A 2CP2A 4E7LA 2KYMA 4X9DA 1WGSA 4DOVA 4LD9K 4KGZB 4N4GA 4N0AC 4B9XA 3A5ZB 1FXXA 3OMCA 3J80E 2MIOA 3LH5A 2RK1A 2COZA 4WCIA 5FWBA 2DILA 2HBPA 2DL4A 3QHSA 1JEGA 5CQYA 4ORZA 3GP8A 3OW2P 2RMOA 5HY6A 3G6EQ 1BIBA 3CCSQ 1M1KU 4J7FA 2E12A 5FWCA 3JCMW 3CCRA 2CUBA 2AHJB 2MWOA 1YHQA 4XTXA 1GCQC 3QWXX 5KE2A 2XI9A 3C0CA 2EJ9A 2MI6A 4AMCA 4M75F 1OX9A 1VQOA 5HK0A 4QQ6A 4BE0A 2ZPIB 1VQKA 1M30A 3DKMA 3C95A 2X51A 3EGXA 4AG1C 2ZAEA 3CCUT 3LWHA 4FW1A 1B7TA 5FU7B 5LJ5e 3H8ZA 3JV3A 4E7HA 1S72T 3MCAB 1VQLT 1ZSZB 1FX7A 1X2KA 2HQXA 3OS1A 4XU0A 4DBRA 1G5VA 4JJCA 1X01A 5C0MA 3CCRQ 1OEBA 1JJ2S 3NFCA 1YHQQ 2K5LA 4C92G 3L2QA 5KYNA 4OMOA 3I35A 5FROA 1HK9A 1RADB 5DLOA 2RNAA 4HT9A 1VQOQ 2BKDN 2EGEA 2KROA 2FPEA 3SWNB 1VQKQ 4ELZC 4A4KA 4M77B 5IAYA 1WHJA 2L3QA 1BBZA 4PJLA 1QVPA 2C06A 2CS7A 5GAOm 3NHNA 2MF2A 1Q95G 4XTVA 2FG0A 5GANh 3JCMP 3QPHA 2W10A 2FEIA 1I5OB 1WQ7A 2RF0A 4M75A 1Q7YU 4HKEA 2RQVA 2ZGWA 1MGQA 4MZMA 1AZGB 4MDXA 1S1NA 1BI3A 3MEUA 2RJCA 1WDXA 3RNJA 2RPNA 4IURA 4PLIA 2NUPA 2O31A 2C0TA 2OX7A 1LOJA 3U23A 1GL5A 3R6OA 1NEGA 2EQJA 4ZGJB 3JCMX 1QKWA 3Q1JA 5I22A 1MHNA 2GTOA 3QG1A 1BB9A 4XTZA 2E64A 3FEOA 2LZ6B 2OAWA 3M56A 3ZEHA 4RTXA 2HD0A 3KXTA 1VIEA 3OYIA 4GLMA 2D0NA 3EGXB 2L8DA 1ABOA 4ZN3A 2EQKA 1LVKA 2KBTA 2ENMA 1VQPT 3EHQA 2K5FA 2KRNA 1M1KC 2ED0A 4PFZA 2DBMA 1PKTA 4L59A 1W6XA 2FZCB 5FRMA 4OGCA 3OYYA 3LGFA 3JCMe 1KJWA 4XK8E 1WHLA 1QCFA 5KCHA 3THKA 2YUOA 1UDLA 1IXDA 2JM8A 4M7DD 3A1PA 4RTVA 1PRMC 2H8HA 4JS4A 2QEXT 2DL3A 2LT4A 1BI2A 1Q81U 3PTAA 3S3OA 4M4ZA 1U3OA 1TUDA 4VUBA 1ZHIA 3VS1A 2KRMA 5GAMd 2QQBA 5IHNA 1SSHA 3FJ5A 1WFWA 3ER0A 3MEWA 2DD4A 1VQMT 4PFOA 2EJFA 4C8QF 3CMAT 4DEYA 1QVGA 4LNPA 1VQ9A 4M77C 4NL2A 3VUZA 4C0GA 4L5GA 2VB6A 1PRLC 5L8RE 5GAN3 1K0SA 2D1XA 4M75B 2RA2A 5CQXA 2DMOA 4FM4B 1SPKA 2Z0WA 2DA9A 3VV0A 3M57A 3VKIA 3L2WA 1M3BA 3CEYA 4FU6A 2NUPB 3VU3C 2RM4A 1PCXA 2KT1A 3PIOA 1QQJA 1VQNT 2H3EB 1B07A 3X20B 1P92A 4FT2A 3CC4A 2JS2A 1Q7YC 3TVTA 1VQ9Q 2KNBB 2RHZA 2QI2A 2PTKA 2HQHA 4IUUA 3M54A 4PFPA 5LJ5g 3JB9D 4JUVA 2E5KA 1QP2A 3PMIA 2QG9B 4QQGA 4C0DC 5A0LA 3EAEA 1VQ5A 1YCYA 2O9SA 1U1SA 4C8QA 1NZ9A 2KXDA 4ANJA 2MAMA 5J3BA 2FVUA 1E6HA 1QMCA 1RLQC 3EG1A 1Q82U 2OTJT 4M77E 1KK7A 5GAMj 2QYZA 4RTUA 1W4SA 1UGVA 3CC4Q 3HPWA 2CP7A 1PD0A 4LE9A 2X4XA 1N8RR 2K4YA 2VASA 3X24B 1M90R 3QO3A 2FYKA 2AKKA 2DNUA 3HTRA 3C4SA 3OW2A 2RQWA 1OOTA 1KHIA 3EG3A 1K73R 3HKSA 1T3SA 2K3XA 1YFNA 3OYNA 5CR2A 3BW1A 4HXJA 1YJNA 3CBOA 1VQ5Q 1Y0MA 3HRSA 1Q81C 1M2VB 4XTUA 4M75C 3H9NA 3CCJT 3OYBA 2DVEA 4TVRA 4J9IA 3UT1A 2CDTA 1VQ4A 2C0IA 1X69A 3UA7A 1GBRA 4L6V5 1PC0A 4PJOF 3TCJA 4Z88A 4M7AF 1Y71A 4PK4A 2KXCA 2DTHA 2L5QA 5GAN4 2EYWA 2AK5A 1BU1A 3OB9A 1AWJA 2FPFA 1MNDA 5DM7R 3HRUA 4F7UG 1Z9ZA 1YJNQ 1YJWT 3EH1A 4BDYA 2JNGA 1RAIB 2V8IA 3OYGA 4IUQA 3J7AF 3JB9J 3JCMg 5IXFA 1M3CA 3RMQA 5IH2A 2LC4A 2CKKA 4C8QB 4E7KA 1WLPB 2KMTA 1VQ4Q 5FLXE 1M8VA 2YDLA 1UHFA 5IT9E 1SHGA 3M4GA 2EYZA 3E1SA 1I4K1 3PVLA 1WXUA 2K3BA 4J9FA 2DKGA 2K6DA 1FMWA 2E3HA 4FIBA 2Y4XA 4DBQA 4YTLA 3G1JA 3PIPA 1NPRA 4ZN1A 4XQ3A 1ZBXA 4HVWA 4BE1A 1VA7A 1NEBA 2YRDA 1KSWA 4ZGEB 1PSEA 2DXBA 2M51A 4M75E 1D1BA 2P0QA 4C5HA 1NPPA 4IIMA 1M3AA 4PJOA 2EQIA 4M7AA 1YN8A 2MK5A 4JLGA 4KGXB 2YXYA 2LT1A 5CO7A 3CMET 1YJ9T 2E6ZA 3LWIA 2CYZB 4NOYA 5LJ3j 3CCQT 3HSBA 1YIJA 1Q82C 2LCLA 1VYTA 1S72A 1VQLA 2D9TA 4JRQA 3OYDA 2LJ3A 5IN1A 2PQWA 1TU0B 2QDYB 3R6NA 1OV3A 2VUBA 2DPPB 4ZTFA 2DM1A 4EDUA 1H3ZA 3JCMQ 3SFMA 1I81A 1U1TA 3CBPA 3QIIA 2VYTA 3NPFA 4DBFA 2ZPGB 2QTXA 1SEMA 3RDVA 1B3QA 2E4HA 3QXEB 4LDUA 3QWYA 1VOMA 2DJQA 4BUGA 4LXCA 2JS0A 3RESA 1RACB 2X3XD 2DYIA 2EIFA 1IGQA 2X4JA 2J6FA 3ULRB 3FRNA 2DF6A 3QZ9B 2HCKA 3OQ5A 4X9CA 4QQDA 1KIKA 1YIJQ 5A0GA 2DE0X 5GAMh 1S72Q 3CC2A 1VQLQ 4HT8A 3JB9G 4KULA 1ZSGA 4BI8B 2NWMA 3LW5E 1KQ1A 2DZ9A 2RHYA 1YITT 2HMAA 4C8QC 3JB9I 1M1KR 2LNVA 4KGVB 4AT1B 4ME7A 3I9QA 1OPKA 3M0QA 3FLGA 1WHKA 2KR3A 4MMKA 1G83A 3NGPA 2RI3A 1J3TA 5LJ5d 2V8JA 1YBYA 3SB2A 3H6ZA 4MZPA 3SWNA 3JCMb 2LX7A 2RQTA 1RAGB 1C0MA 4PJOB 4A4FA 1JRIA 2XG8D 4M7AB 1SRLA 3CC2Q 4OMNA 4OMQA 4KH1B 1MUZA 4M78F 1AEYA 3P8DA 4J9GA 1M4ZA 2LVMA 4DA4A 1ZA2B 2ATCB 1OULA 4OMFB 3I55T 1FMVA 1GBQA 5CVIA 1K8AU 2CP6A 4Y28E 3EFSA 2ROTA 4B6MA 1MMNA 3WVDB 1IO6A 1OX8A 2RK2A 1HYOA 4JRIA 2DTOA 4JJNK 4GY5A 2EQMA 2PVOB 4R0KA 1C1AA 2CZ7B 2QEXA 1KQSS 4PJJA 2SEMA 2X3WD 4JDSA 5IHKA 3M55A 3L2RA 3L2UA 1T3LA 2YUPA 3NTIA 1MV0B 3H0FA 1U8RA 3A8LB 4LDYA 4LDVA 1QVFS 3OY9A 1YWOA 1NYGA 3JRZA 2JOYA 3OYAA 3CCLA 1IRXA 1XTDA 4V2SA 1G3WA 3GIBA 1VQMA 1TOVA 4MZTA 4C8QE 1YCSB 3OYMA 3RIRA 3OSVA 3BDLA 3DB3A 3QYGB 2X9HA 3UDCA 1JB0E 2PU9B 3M9QA 1Q7YR 2KQWA 1N9SA 3CCMT 4HA8A 2EJGA 4RG2A 3CPFA 4RUGA 2FPDA 4PNOA 4RCBA 1FYNA 2R58A 4JPBW 2M02A 2GNCA 4E47A 2QEXQ 2A7YA 4F14A 4M78A 3CXCP 2P0KA 5GMKe 3V8LA 1I0CA 4GBQA 1AD5A 2KT8A 3DB4A 2HNIA 3PE0A 5LJ3h 4J6XA 2BTTA 3OS0A 3JB9H 3ME9A 2JZ2A 7AT1B 2PVGB 3CQTA 3CCLQ 1MMAA 4CC4B 1RAFB 2QK0A 4JZ3A 2KE9A 2RI5A 1VQMQ 5FRNA 3M0PA 4KUDK 5LJ5f 4J6YA 2BE9B 4O6JA 3JCMd 2GFAA 3X26B 5A0DA 1QCOA 4C0FA 4N4HA 4J9HA 4FYWB 2G6FX 4E6RA 3HFOA 4PJOC 1UB4A 2KDSA 2RHUA 4M7AC 2F2XA 3AHUA 3OMGA 2LJ1A 3QJYA 2FL7A 5EG2A 4FYVB 3MKDA 1N5ZA 2YWWA 2B8AA 2RQRA 3F70A 2EAYA 4KH0B 1Z9QA 5CKBA 1Q81R 1X6GA 4BDZA 2OTJA 2KAFA 2X35A 2QQ9A 4JJDA 1VQ8T 1RI0A 4R56A 3SDZA 4J7IA 2KSSA 1KHCA 2E3IA 2JUFA 1K76A 3CC7T 1H3HA 2NYSA 2KGTA 1BKBA 1WJQA 2JJ9A 2V1QA 1K8AC 4KRTA 4M77G 4LDXA 2EW3A 1UTIA 3OS5A 2DFUA 2PUOB 3UATA 2LQWA 3EFRA 2DD5A 1VIFA 5AT1B 4BE2A 2DX1A 1JXOA 4IIOA 1JJ2P 4FYYB 2KRSA 4J9DA 4F17A 1W70A 5FU7C 3HL8A 3QKJA 1OYXA 3RERA 3C94A 2EYYA 4M78B 3MP6A 4BY6B 1ZSZC 1WHMA 3QDRB 2OTJQ 5GAN6 2JN0A 8AT1B 3V7RA 2XDPA 4ESRA 2XMFA 1R8OB 4PJNA 1KC8U 1RAEB 1K4US 4EMGA 4PJOE 4M7AE 2YUQA 4M7DF 4II1A 2CT4A 2CT3A 2IPOB 3G7ZA 1IHWA 3G71A 1UHCA 3JCMV 3WVEB 3SWNC 2SRCA 2A37A 4ZNXA 3V7SA 3JCMf 2L3PA 3QDFA 1G8XA 4C5GA 2MWPA 4AFQC 1VYUA 1YHQT 1BI0A 4MMLA 3A8HB 2DO3A 1UGSB 4C8QD 1X6OA 1U5SA 3VUBA 1I8FA 2EKHA 4X34A 1M8MA 3EG9A 2HL3A 1VQOT 4E7SA 1D3BA 1BIAA 4IUVA 1M2VA 2QAZA 1KD1U 5M9OA 3O8VA 4GLKA 3FDRA 3VS5A 4XTWA 1Q82R 1ZQ1A 2GFUA 2LX9A 1BK2A 3REAB 2EFIA 1Y07A 1H8KA 4EMHA 2EGCA 1M5Q1 1TTHB 2O88A 2L0AA 2DRKA 4FYXB 3G71Q 3CD6A 3DLMA 2M1HA 1IHVA 2ZPBB 4ELYC 1H92A 3HRTA 3EGDB 4BI3A 2RH2A 2AT1B 2JM9A 1VQ6A 9ATCB 4EMKA 1QWFA 1ZX6A 1VQ7A 1UJ0A 3CMEA 5GJVB 1YJ9A 4M7DA 1OZ3A 2KEAA 2EYQA 4D8KA 3E2UA 3GNFB 2CP3A 2KK4A 1CKBA 2OI3A 1N9RA 4M75G 1YWPA 2LDMA 2HEQA 2MPXC 3JAME 1PSFA 6AT1B 2HAXA 2XD0A 3OYCA 2FHDA 3MP8A 1MNEA 5LL6S 2J6KA 2CREA 5KYUA 1TG0A 4M78C 4BY6C 2QQAA 4OVAA 4RTYA 3CD6Q 1NG2A 2IG0A 2QGFB 3OBWA 4D8DA 1GRIA 5GMKl 3CCVT 1K9MU 2NUZA 2DIQA 3VS3A 1Q86U 1G3SA 1VQ6Q 1GCPA 3H0IA 3SEMA 1VQ7Q 2ZZDA 1V1CA 3CMEQ 3VS2A 2LJ0A 3L2ZA 3L2VA 1YJ9Q 5D7UA 2OAUA 2FRYA 2WSCE 4J8OA 1K0XA 1KC8C 5KYYB 1D0ZA 3EG9B 2OTLA 2JT4A 1D3BB 2X4WA 2DZCA 2FRWA 1TSFA 5EC7A 3TQ7P 5HK3A 4OB1B 1YITA 4OMLA 4LD6A 3PNWC 2HQEA 2QA4A 3H0HA 1V29B 4LUEA 3CCET 1EFNA 5D6YA 2DVJA 2MOXA 3HHTB 5KE3A 3TU4K 1W1FA 1FMKA 2A36A 5CK9A 2RD1A 2K57A 1G3TA 3V8JA 5KCOA 2LTOA 4P5NA 1ZUKA 5GAOr 2J6OA 4HVVA 3BFMA 3CXCA 5KH6A 1KD1C 4EMKB 1WA7A 3OYJA 1RI9A 4M7DB 2OTLQ 1X75C 4M78E 3EG2A 1M9SA 1WPYA 1K9AA 2WSFE 3GPLA 3NMZC 2ZCFB 2D0QB 3I55A 1QVGS 3JCMh 1AZEA 1YITQ 1N8RU 1RUWA 5AYFA 4C0ZA 3INZA 5KYWB 4ATOA 2CUDA 2KVQG 1Y57A 4K11A 2QA4Q
chains in the Genus database with same CATH topology
2RQVA 2LX7A 2RQTA 1ZBJA 2F2VA 1AZGB 1SRLA 1S1NA 4OMNA 4OMQA 3REBB 1MUZA 1WDXA 3RNJA 2RPNA 1UECA 1AEYA 2CH4A 4J9GA 2O31A 2C0TA 3U23A 1GL5A 2GBQA 1X27A 1NEGA 4F16A 1QKWA 5I22A 1GBQA 2GTOA 2DL7A 1BB9A 2ROTA 1IO6A 4AFUC 2LZ6B 2OAWA 2ESWA 4RTXA 4AG2C 1VYVA 2VWFA 5HCKA 4R0KA 2MCNA 3UA6A 4X1VA 2VKNA 4GLMA 2SEMA 2X3WD 2D0NA 5IHKA 1WXTA 1T3LA 1ABOA 2YUPA 1G2BA 4J9BA 1MV0B 1UUEA 3H0FA 2KBTA 3VS7A 2ENMA 3UF4A 1YWOA 1GFDA 1NYGA 1E7OA 3EHQA 2KRNA 1SHFA 2ED0A 3TSZA 2F2WA 2DBMA 2B86A 1PKTA 1W6XA 3A98A 2A08A 1I1JA 1KJWA 3EG0A 1YCSB 1QCFA 3THKA 1CSKA 2YUOA 1UDLA 2JM8A 2AZVA 2PZ1A 4RTVA 1QWEA 1PRMC 2H8HA 1WI7A 1AWXA 2QDLA 2DL3A 4DEXA 4RTZA 2DLPA 1LCKA 2IIMA 4M4ZA 1U3OA 1TUDA 4RUGA 2FPDA 4LUDA 4J9CA 3VS1A 1FYNA 2KRMA 4JPBW 3TSWA 2HBWA 4EIKA 5IHNA 2FO0A 1HD3A 3VS6A 1SSHA 3FJ5A 2GNCA 2GGRA 1WFWA 2DBKA 2J06A 1U06A 4F14A 3H41A 5FW9A 2LCSA 1I0CA 4GBQA 1AD5A 4A63B 2KT8A 2I0NA 1JO8A 2OJ2A 4DEYA 2K9GA 1T0HA 3PE0A 1NYFA 2BTTA 4LNPA 1WX6A 1JXMA 1ABQA 1UE9A 2L3SA 3CQTA 4CC4B 1PRLC 2K7AA 3KFVA 4JZ3A 1K0SA 2KE9A 2D1XA 1OPLA 2DMOA 1GCQA 3M0PA 2J7IA 1SPKA 4CC7A 2DA9A 5L23A 1M3BA 2PNIA 2DL8A 1K1ZA 3RBBB 4J9HA 2G6FX 4E6RA 1PHTA 2EPDA 2KT1A 2F2XA 1NLPC 2ROLA 1XOVA 2LJ1A 2M0YA 1N5ZA 3VRYA 5IXBA 2YSQA 1B07A 5ECAA 2LP5A 1MV3A 2RQRA 2YUNA 4Y92A 1Z9QA 2JS2A 1TUCA 2RN8A 4J9EA 3TVTA 2KNBB 2C0OA 1UFFA 1X6GA 3I5RA 2DL5A 4JZ4A 1QKXA 2PTKA 3PVQA 2A28A 1HSQA 4JJDA 5GJWB 2YT6A 2E5KA 2EVRA 3EHRA 2BZXA 1KFZA 1X2QA 1H3HA 1K76A 2D8JA 2O2OA 2KGTA 2V1QA 1AOJA 1PNJA 2O9SA 4KRTA 2EW3A 1UTIA 2K79A 2KXDA 2EBPA 1T0JA 3M0UA 3UATA 2CH4W 2ABLA 2LQWA 1E6HA 1RLQC 3EG1A 2O9VA 4RTWA 2DX1A 1JXOA 4IIOA 1ZUYA 1WIEA 2GQIA 2KRSA 4J9DA 1E6GA 1W70A 4RTUA 1GFCA 4F17A 2JMAA 1UGVA 4LE9A 2EYYA 1WYXA 2AKKA 1X6BA 2DNUA 4ESRA 2XMFA 2P4RA 1Y57A 2ECZA 1K4US 2RQWA 1OOTA 1YNZA 5IHIA 3SHWA 3EG3A 1T3SA 2JXBA 2YUQA 2BZYA 4HXJA 2CT4A 2CT3A 1Y0MA 1UHCA 2J05A 2BZ8A 1UG1A 2JMCA 2AZSA 2L2PA 2SRCA 2A37A 2LQNA 4ZNXA 1AWWA 1JQQA 2L3PA 4J9IA 1ZUUA 4AFQC 1VYUA 2CDTA 1NM7A 2C0IA 1X69A 3UA7A 2ED1A 1GBRA 3VRZA 1ARKA 3EGUA 1U5SA 3M0TA 4Z88A 2EKHA 2DYBA 1M8MA 2KXCA 2W0ZA 2EYWA 3M0SA 2AK5A 1BU1A 1AWJA 2FPFA 3VS5A 1M27C 1HJDA 2EYXA 3VS4A 4FSSA 1BK2A 3REAB 1UJYA 4RTTA 1H8KA 2EGCA 1Z9ZA 1JU5C 2O88A 1ZLMA 2L0AA 2DRKA 1YP5A 3M0RA 1SRMA 4Z8AA 1RLPC 5IXFA 1M3CA 4AFZC 1H92A 5IH2A 4CC3A 1WLPB 1WXBA 2V1RA 2JM9A 2YDLA 1UHFA 1QWFA 1SHGA 1ZX6A 2AKLA 2LMJA 1UJ0A 4CC2A 5GJVB 2EGAA 2EYZA 2KEAA 3PVLA 3VS0A 1WXUA 4D8KA 2K3BA 4J9FA 2HDAA 1CKBA 2K6DA 2OI3A 2VVKA 4HCKA 4JJBA 4Z89A 4AFSC 1X43A 1YWPA 2KYMA 4HVWA 2CSIA 1VA7A 2HEQA 1NEBA 3GBQA 1KSWA 2J6KA 2CREA 2MIOA 2M51A 3LH5A 1TG0A 4WCIA 4IIMA 1M3AA 2JW4A 1I07A 2EQIA 4RTYA 5FWBA 2DILA 1JEGA 2DL4A 4OMPA 1NG2A 4HVUA 3O5ZA 4ORZA 1YN8A 4D8DA 2RMOA 1GRIA 2NUZA 5FWCA 1VYTA 4QT7A 2CUBA 2CSQA 3VS3A 1GCPA 1GCQC 2LJ3A 3QWXX 3H0IA 3SEMA 1V1CA 3R6NA 3VS2A 1OV3A 2GTJA 2LJ0A 3C0CA 2DM1A 2FRYA 2KYBA 3NPFA 1K0XA 3I5SA 1M30A 1SEMA 2JT4A 1B3QA 2LNHB 4AG1C 2DRMA 3QWYA 2JTEA 2FRWA 2HSPA 2DJQA 5EC7A 2JS0A 3JV3A 1NLOC 4OMLA 2X3XD 2K2MA 1X2KA 2J6FA 3H0HA 3ULRB 2DF6A 2HCKA 4LUEA 1EFNA 5I11A 4LN2A 1KIKA 2DVJA 2MOXA 4JJCA 2DE0X 1OEBA 1FMKA 1W1FA 2A36A 1A0NB 3ZL7C 1PKSA 1QLYA 1ZSGA 4OMOA 3I35A 2NWMA 4OMMA 1ZUKA 2RNAA 2J6OA 4HVVA 2EGEA 2KROA 2RQUA 2FPEA 1WA7A 2D8HA 1RI9A 3IQLA 3I9QA 1AWOA 3EG2A 1OPKA 1CKAA 1K9AA 3M0QA 2KR3A 2L3QA 1BBZA 3NMZC 1G83A 3NGPA 1J3TA 1PWTA 1AZEA 3NHNA 1AVZC 2FG0A 1RUWA 2CUDA 2W10A 2FEIA 4K11A 2RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQV A;  2LX7 A;  2RQT A;  1ZBJ A;  2F2V A;  1AZG B;  1SRL A;  1S1N A;  4OMN A;  4OMQ A;  3REB B;  1MUZ A;  1WDX A;  3RNJ A;  2RPN A;  1UEC A;  1AEY A;  2CH4 A;  4J9G A;  2O31 A;  2C0T A;  3U23 A;  1GL5 A;  2GBQ A;  1X27 A;  1NEG A;  4F16 A;  1QKW A;  5I22 A;  1GBQ A;  2GTO A;  2DL7 A;  1BB9 A;  2ROT A;  1IO6 A;  4AFU C;  2LZ6 B;  2OAW A;  2ESW A;  4RTX A;  4AG2 C;  1VYV A;  2VWF A;  5HCK A;  4R0K A;  2MCN A;  3UA6 A;  4X1V A;  2VKN A;  4GLM A;  2SEM A;  2X3W D;  2D0N A;  5IHK A;  1WXT A;  1T3L A;  1ABO A;  2YUP A;  1G2B A;  4J9B A;  1MV0 B;  1UUE A;  3H0F A;  2KBT A;  3VS7 A;  2ENM A;  3UF4 A;  1YWO A;  1GFD A;  1NYG A;  1E7O A;  3EHQ A;  2KRN A;  1SHF A;  2ED0 A;  3TSZ A;  2F2W A;  2DBM A;  2B86 A;  1PKT A;  1W6X A;  3A98 A;  2A08 A;  1I1J A;  1KJW A;  3EG0 A;  1YCS B;  1QCF A;  3THK A;  1CSK A;  2YUO A;  1UDL A;  2JM8 A;  2AZV A;  2PZ1 A;  4RTV A;  1QWE A;  1PRM C;  2H8H A;  1WI7 A;  1AWX A;  2QDL A;  2DL3 A;  4DEX A;  4RTZ A;  2DLP A;  1LCK A;  2IIM A;  4M4Z A;  1U3O A;  1TUD A;  4RUG A;  2FPD A;  4LUD A;  4J9C A;  3VS1 A;  1FYN A;  2KRM A;  4JPB W;  3TSW A;  2HBW A;  4EIK A;  5IHN A;  2FO0 A;  1HD3 A;  3VS6 A;  1SSH A;  3FJ5 A;  2GNC A;  2GGR A;  1WFW A;  2DBK A;  2J06 A;  1U06 A;  4F14 A;  3H41 A;  5FW9 A;  2LCS A;  1I0C A;  4GBQ A;  1AD5 A;  4A63 B;  2KT8 A;  2I0N A;  1JO8 A;  2OJ2 A;  4DEY A;  2K9G A;  1T0H A;  3PE0 A;  1NYF A;  2BTT A;  4LNP A;  1WX6 A;  1JXM A;  1ABQ A;  1UE9 A;  2L3S A;  3CQT A;  4CC4 B;  1PRL C;  2K7A A;  3KFV A;  4JZ3 A;  1K0S A;  2KE9 A;  2D1X A;  1OPL A;  2DMO A;  1GCQ A;  3M0P A;  2J7I A;  1SPK A;  4CC7 A;  2DA9 A;  5L23 A;  1M3B A;  2PNI A;  2DL8 A;  1K1Z A;  3RBB B;  4J9H A;  2G6F X;  4E6R A;  1PHT A;  2EPD A;  2KT1 A;  2F2X A;  1NLP C;  2ROL A;  1XOV A;  2LJ1 A;  2M0Y A;  1N5Z A;  3VRY A;  5IXB A;  2YSQ A;  1B07 A;  5ECA A;  2LP5 A;  1MV3 A;  2RQR A;  2YUN A;  4Y92 A;  1Z9Q A;  2JS2 A;  1TUC A;  2RN8 A;  4J9E A;  3TVT A;  2KNB B;  2C0O A;  1UFF A;  1X6G A;  3I5R A;  2DL5 A;  4JZ4 A;  1QKX A;  2PTK A;  3PVQ A;  2A28 A;  1HSQ A;  4JJD A;  5GJW B;  2YT6 A;  2E5K A;  2EVR A;  3EHR A;  2BZX A;  1KFZ A;  1X2Q A;  1H3H A;  1K76 A;  2D8J A;  2O2O A;  2KGT A;  2V1Q A;  1AOJ A;  1PNJ A;  2O9S A;  4KRT A;  2EW3 A;  1UTI A;  2K79 A;  2KXD A;  2EBP A;  1T0J A;  3M0U A;  3UAT A;  2CH4 W;  2ABL A;  2LQW A;  1E6H A;  1RLQ C;  3EG1 A;  2O9V A;  4RTW A;  2DX1 A;  1JXO A;  4IIO A;  1ZUY A;  1WIE A;  2GQI A;  2KRS A;  4J9D A;  1E6G A;  1W70 A;  4RTU A;  1GFC A;  4F17 A;  2JMA A;  1UGV A;  4LE9 A;  2EYY A;  1WYX A;  2AKK A;  1X6B A;  2DNU A;  4ESR A;  2XMF A;  2P4R A;  1Y57 A;  2ECZ A;  1K4U S;  2RQW A;  1OOT A;  1YNZ A;  5IHI A;  3SHW A;  3EG3 A;  1T3S A;  2JXB A;  2YUQ A;  2BZY A;  4HXJ A;  2CT4 A;  2CT3 A;  1Y0M A;  1UHC A;  2J05 A;  2BZ8 A;  1UG1 A;  2JMC A;  2AZS A;  2L2P A;  2SRC A;  2A37 A;  2LQN A;  4ZNX A;  1AWW A;  1JQQ A;  2L3P A;  4J9I A;  1ZUU A;  4AFQ C;  1VYU A;  2CDT A;  1NM7 A;  2C0I A;  1X69 A;  3UA7 A;  2ED1 A;  1GBR A;  3VRZ A;  1ARK A;  3EGU A;  1U5S A;  3M0T A;  4Z88 A;  2EKH A;  2DYB A;  1M8M A;  2KXC A;  2W0Z A;  2EYW A;  3M0S A;  2AK5 A;  1BU1 A;  1AWJ A;  2FPF A;  3VS5 A;  1M27 C;  1HJD A;  2EYX A;  3VS4 A;  4FSS A;  1BK2 A;  3REA B;  1UJY A;  4RTT A;  1H8K A;  2EGC A;  1Z9Z A;  1JU5 C;  2O88 A;  1ZLM A;  2L0A A;  2DRK A;  1YP5 A;  3M0R A;  1SRM A;  4Z8A A;  1RLP C;  5IXF A;  1M3C A;  4AFZ C;  1H92 A;  5IH2 A;  4CC3 A;  1WLP B;  1WXB A;  2V1R A;  2JM9 A;  2YDL A;  1UHF A;  1QWF A;  1SHG A;  1ZX6 A;  2AKL A;  2LMJ A;  1UJ0 A;  4CC2 A;  5GJV B;  2EGA A;  2EYZ A;  2KEA A;  3PVL A;  3VS0 A;  1WXU A;  4D8K A;  2K3B A;  4J9F A;  2HDA A;  1CKB A;  2K6D A;  2OI3 A;  2VVK A;  4HCK A;  4JJB A;  4Z89 A;  4AFS C;  1X43 A;  1YWP A;  2KYM A;  4HVW A;  2CSI A;  1VA7 A;  2HEQ A;  1NEB A;  3GBQ A;  1KSW A;  2J6K A;  2CRE A;  2MIO A;  2M51 A;  3LH5 A;  1TG0 A;  4WCI A;  4IIM A;  1M3A A;  2JW4 A;  1I07 A;  2EQI A;  4RTY A;  5FWB A;  2DIL A;  1JEG A;  2DL4 A;  4OMP A;  1NG2 A;  4HVU A;  3O5Z A;  4ORZ A;  1YN8 A;  4D8D A;  2RMO A;  1GRI A;  2NUZ A;  5FWC A;  1VYT A;  4QT7 A;  2CUB A;  2CSQ A;  3VS3 A;  1GCP A;  1GCQ C;  2LJ3 A;  3QWX X;  3H0I A;  3SEM A;  1V1C A;  3R6N A;  3VS2 A;  1OV3 A;  2GTJ A;  2LJ0 A;  3C0C A;  2DM1 A;  2FRY A;  2KYB A;  3NPF A;  1K0X A;  3I5S A;  1M30 A;  1SEM A;  2JT4 A;  1B3Q A;  2LNH B;  4AG1 C;  2DRM A;  3QWY A;  2JTE A;  2FRW A;  2HSP A;  2DJQ A;  5EC7 A;  2JS0 A;  3JV3 A;  1NLO C;  4OML A;  2X3X D;  2K2M A;  1X2K A;  2J6F A;  3H0H A;  3ULR B;  2DF6 A;  2HCK A;  4LUE A;  1EFN A;  5I11 A;  4LN2 A;  1KIK A;  2DVJ A;  2MOX A;  4JJC A;  2DE0 X;  1OEB A;  1FMK A;  1W1F A;  2A36 A;  1A0N B;  3ZL7 C;  1PKS A;  1QLY A;  1ZSG A;  4OMO A;  3I35 A;  2NWM A;  4OMM A;  1ZUK A;  2RNA A;  2J6O A;  4HVV A;  2EGE A;  2KRO A;  2RQU A;  2FPE A;  1WA7 A;  2D8H A;  1RI9 A;  3IQL A;  3I9Q A;  1AWO A;  3EG2 A;  1OPK A;  1CKA A;  1K9A A;  3M0Q A;  2KR3 A;  2L3Q A;  1BBZ A;  3NMZ C;  1G83 A;  3NGP A;  1J3T A;  1PWT A;  1AZE A;  3NHN A;  1AVZ C;  2FG0 A;  1RUW A;  2CUD A;  2W10 A;  2FEI A;  4K11 A;  2RF0 A; 
#chains in the Genus database with same CATH topology
 1VQ9 T;  3G4S T;  2F1L A;  1ZBJ A;  2O01 E;  4Y91 A;  2DAQ A;  4C92 F;  3PT9 A;  1WNL A;  3X25 B;  2YHT A;  4OP0 A;  3L42 A;  1UEC A;  2MYS A;  3RR6 A;  1TWB A;  2GBQ A;  4J5Y A;  5CKD A;  2HL5 C;  1WJR A;  2DL7 A;  3T9N A;  3UWN A;  3I56 T;  4AFU C;  2ESW A;  4AG2 C;  1VYV A;  2VWF A;  5HCK A;  3I55 Q;  3A8M B;  4QKU A;  3CCU A;  3TEE A;  5LJ3 e;  2MCN A;  3UA6 A;  4X1V A;  1W2B P;  1G3Y A;  2K3Y A;  5J26 A;  1WXT A;  3CCM A;  4J9B A;  2VGM A;  1OZ2 A;  3VYH B;  3VS7 A;  4A54 A;  1EIF A;  1B34 A;  3UF4 A;  4C8Q G;  2RI2 A;  3EH2 A;  4KT0 E;  1K9M C;  1SHF A;  3A8O B;  3NTH A;  2B86 A;  3ASK A;  4RCC A;  1RAH B;  3A98 A;  1Q86 C;  4OB2 B;  2CP5 A;  2A08 A;  3JCM J;  1I1J A;  3OYE A;  1O75 A;  5GAN e;  2AZV A;  1JJ2 A;  1VQ5 T;  4E7Z A;  4JLI A;  4M77 D;  2QDL A;  2XU8 A;  4RTZ A;  2DLP A;  2Y90 A;  1NE8 A;  2IIM A;  2YLC A;  5KYX A;  4LUD A;  4J9C A;  3EFO A;  2ZPE B;  3TSW A;  4C92 A;  3CCU Q;  4N4I A;  2FO0 A;  1HD3 A;  3M4Y A;  2K5I A;  2KI7 A;  3V7C A;  2GGR A;  2M16 A;  2V8K A;  1U06 A;  1UEB A;  3E9F A;  3CCM Q;  2IVW A;  4EMK C;  4A63 B;  1K8A R;  2I0N A;  1JO8 A;  1PM3 A;  4M7D C;  2K9G A;  1T0H A;  3OW2 S;  3ZBD A;  1O9S A;  1D1C A;  2L3S A;  2WSE E;  3KFV A;  2K7A A;  2CZ1 B;  3BDU A;  1D1A A;  1XJW B;  5GAM g;  2J7I A;  1PD1 A;  5GAO p;  4CC7 A;  2R57 A;  5L23 A;  1YJN T;  3VYG A;  3RBB B;  1VQ8 A;  3CC7 A;  1TXQ A;  1NJI U;  3QZ5 B;  2D6F A;  1NLP C;  3HFN A;  1XOV A;  2DEQ A;  3MP1 A;  2QQR A;  2M0Y A;  4DBH A;  3VRY A;  5IXB A;  1KG1 A;  2LP5 A;  3OYL A;  1MV3 A;  4LDW A;  2YUN A;  4Y92 A;  4C5E A;  2PVD B;  3CPW P;  2RN8 A;  4A4E A;  1VQP A;  1MMG A;  1LNX A;  1UFF A;  4JZ4 A;  2DL5 A;  1QKX A;  3CXC S;  1H64 1;  1HSQ A;  1XQH A;  4M78 D;  1I5L A;  5GJW B;  1B34 B;  2M0O A;  2XIC A;  1X2Q A;  2HZY A;  2EKO A;  1BI1 A;  4RG8 A;  1LPL A;  1AOJ A;  1VQ8 Q;  2K2V A;  1YI2 T;  1HXD A;  4NS5 A;  2K79 A;  3CC7 Q;  5CIU A;  2EBP A;  1T0J A;  2ABL A;  4FL6 A;  4M7D E;  4WF2 A;  5KYX B;  1ZUY A;  3TRE A;  2GQI A;  3EFO B;  2JMA A;  3N5B B;  4C92 B;  3CMA A;  4PJO G;  1VQP Q;  2AIR B;  4M7A G;  4M75 D;  1WYX A;  2QQS A;  1X6B A;  3DLL A;  1SSF A;  1BYM A;  2P4R A;  2ECZ A;  1PG5 B;  5I2S A;  1DJ7 B;  4JS5 A;  4HCZ A;  3M58 A;  2L3R A;  2JXB A;  2BZY A;  1Y7X A;  3GOX A;  2DET A;  1M1F A;  1WZO A;  2J05 A;  1QCN A;  1UG1 A;  2BZ8 A;  2A0F B;  2AZS A;  3GLX A;  2VXF A;  3JSC A;  2HKN A;  2LQN A;  1JQQ A;  1YIJ T;  1RAA B;  1KQ2 A;  1UGR B;  5LJ5 j;  1ZUU A;  1VQN A;  2ED1 A;  1BCM A;  3VRZ A;  3EGU A;  1OQK A;  3CMA Q;  3FB9 A;  2DYB A;  3D7S B;  5LJ3 g;  4UC4 A;  5GMK j;  2DER A;  3M0S A;  2FB7 A;  2DTI A;  5I21 A;  4ZGD B;  1UGP B;  3FJP A;  4IUT A;  2GQV A;  1WJS A;  2Y4Y A;  1ZLM A;  1KQS P;  1F1B B;  4WTO B;  1VUB A;  1OI1 A;  1RL2 A;  1SRM A;  4Z8A A;  4AFZ C;  1NJI C;  1KC8 R;  3OA6 A;  1QVF P;  5GAN g;  2DEU A;  3E9G A;  3CC2 T;  2XDB A;  1WXB A;  4OB0 B;  4R55 A;  2V1R A;  1VQN Q;  1WQW A;  3OSS C;  4JRK A;  4A53 A;  3CCV A;  2P0P A;  2PUK B;  4J83 A;  3C12 A;  3CBM A;  4MDW A;  3FC3 A;  1FWZ A;  2CSI A;  2BIV A;  4F7U F;  1TUG B;  3EGD A;  3GBQ A;  4O5V A;  4C92 C;  3G6E T;  1AHJ B;  3CCS T;  5GAO l;  1BCO A;  4DQ2 A;  2JW4 A;  1I07 A;  4QVZ A;  3QYH B;  4OMP A;  2I2L A;  2HKQ B;  4HVU A;  3O5Z A;  4EPC A;  1KD1 R;  1XNI A;  3MJX A;  3QUI A;  3KBG A;  1TH7 A;  3CCJ A;  3PMT A;  2R5M A;  4CRI A;  4E7J A;  4QT7 A;  2CSQ A;  4C0D B;  3OYH A;  2GTJ A;  2CZ0 B;  1N27 A;  1W2B A;  3CCE A;  3CCV Q;  3RMS A;  2KYB A;  1AT1 B;  3P8B B;  5DY9 A;  1SF9 A;  5D6X A;  2HSE B;  3I5S A;  1OU8 A;  3QJ6 A;  2LNH B;  2DRM A;  2JTE A;  1N6A A;  2HSP A;  3E19 A;  1YJW A;  2LQK A;  2F5T X;  5KYU B;  1NLO C;  2RJF A;  2DIG A;  3OS2 A;  3CCR T;  2K2M A;  2GCX A;  2LRQ A;  3CCJ Q;  4XU3 A;  1TS9 A;  5GAN 7;  5KYY A;  4J6W A;  3CCL T;  5I11 A;  4LN2 A;  4PKC C;  1D0Y A;  3LX7 A;  1A0N B;  4F7U A;  1VQK T;  3ZL7 C;  2F69 A;  1PKS A;  1QLY A;  3G4S A;  4M78 G;  2DXU A;  3RUX A;  4OMM A;  3CCE Q;  4OF1 A;  2RQU A;  2V26 A;  2CZ6 B;  4Q5W A;  4C92 E;  5I2M A;  2D8H A;  4PLL A;  1K9M R;  3IQL A;  4OGE A;  1AWO A;  2P4T A;  1CKA A;  2BUD A;  3HP9 A;  2E5Q A;  1Q86 R;  3GNG A;  1YJW Q;  1PWT A;  1AVZ C;  2FZG B;  1IZ6 A;  2RHI A;  2EWN A;  2LCC A;  3I56 A;  2ZPH B;  2E70 A;  2X4Y A;  2KY9 A;  3MET A;  5GMK m;  5LJ5 h;  2F2V A;  3OYF A;  2ZPF B;  2LQ8 A;  3LH0 A;  3PGG A;  3CCQ A;  3REB B;  3JB9 F;  4D6W A;  2P84 A;  2CH4 A;  2QTV A;  3G4S Q;  3LLR A;  1X27 A;  4F16 A;  5KYW A;  5GMK h;  5GAO n;  4FT4 A;  2YLB A;  3CPW A;  8ATC B;  5GAM e;  3MEV A;  3ZFJ A;  2VKN A;  5FU6 B;  4BI4 A;  3LYI A;  4XTY A;  3RKX A;  1G2B A;  3I56 Q;  3OBY A;  1UUE A;  3URG A;  5GAN 2;  2E10 A;  1GFD A;  3S6W A;  1E7O A;  3TSZ A;  2F2W A;  3CCQ Q;  1M1G A;  3BE3 A;  2NUT A;  2GF7 A;  1C6V X;  3MEA A;  1EZZ B;  4KUI A;  3EG0 A;  1IB8 A;  4A4G A;  1CSK A;  5GAM f;  4F7U B;  2A3L A;  1V76 A;  2PZ1 A;  4IUP A;  1QWE A;  3J81 E;  1WHH A;  1WI7 A;  1Y96 A;  1AWX A;  4DEX A;  2COY A;  4C5I A;  3AT1 B;  4B9W A;  5D6W A;  1LCK A;  2R5A A;  4CI0 C;  5HKC A;  2COW A;  4N0A A;  2E6N A;  5DLQ E;  3OYK A;  5CCA A;  2HBW A;  3MO8 A;  4EIK A;  3VS6 A;  3M59 A;  3WXM B;  5LJ3 d;  2DBK A;  2J06 A;  4XAX B;  5CKH A;  5GMK i;  3H41 A;  5FW9 A;  2LCS A;  5J39 A;  4PJO D;  2OJ2 A;  4E2F B;  5A2Q E;  4M7A D;  1NYF A;  2JVV A;  4QW2 A;  1W2B S;  1WX6 A;  1JXM A;  2FZK B;  3LGL A;  5GAN 8;  1ABQ A;  1QW1 A;  3KUF A;  1UE9 A;  4XU1 A;  1OPL A;  2XID A;  1GCQ A;  3JCM c;  4HCB A;  2PNI A;  2DL8 A;  5GAN d;  1K1Z A;  2QGG A;  2QXF A;  4FCY A;  2RHX A;  3G71 T;  4F04 B;  1PHT A;  2EPD A;  2O4X A;  3RKW A;  5GAN 5;  2QAS A;  4BD3 A;  1M90 U;  2DK3 A;  4BAC A;  3X28 B;  1LJO A;  2CGH A;  2ROL A;  1WHG A;  2YSQ A;  5ECA A;  3A8G B;  2G3R A;  1K73 U;  1YI2 A;  4PJM A;  4HCC A;  4E7I A;  2WAC A;  1JBM A;  3S3M A;  4KBM B;  1TUC A;  4J9E A;  2C0O A;  3I5R A;  1KQS A;  3PVQ A;  4C92 D;  3RKY A;  4RKU E;  2A28 A;  2YT6 A;  1QVF A;  2EVR A;  5FU6 C;  1IRE B;  2RJE A;  4BB7 A;  3EHR A;  2BZX A;  1KFZ A;  2D8J A;  1NBE B;  2O2O A;  2XK0 A;  5GAO q;  4Z02 A;  2NUT B;  2L89 A;  4M7D G;  1PNJ A;  3L1A A;  3CD6 T;  2RB6 A;  1SG5 A;  3P8H A;  4FW2 A;  1IGU A;  2NLU A;  3CC4 T;  3M0U A;  2F5K A;  2JTM A;  2CH4 W;  1Y96 B;  1D09 B;  3GF5 A;  4JRP A;  1R77 A;  2O9V A;  4RTW A;  2DXC A;  4NL3 A;  1ZA1 B;  2RJD A;  1OU9 A;  1RAB B;  1VQ6 T;  4DOW A;  1YI2 Q;  1WIE A;  2YRV A;  1E6G A;  1VQ7 T;  2YRC A;  1GFC A;  2VV5 A;  2MMP A;  5CKE A;  3UPU A;  1R0B G;  2DXT A;  1NJI R;  4QVC A;  4OB3 B;  5C6S A;  3CPW S;  5LJ3 f;  1YNZ A;  5IHI A;  3SHW A;  4A4H A;  1UGQ B;  1D0X A;  4RMO A;  2DJZ A;  2EQU A;  5CAI A;  1QVG P;  1ACM B;  4M77 F;  1SKU B;  3NTK A;  2JMC A;  2L2P A;  5GAN j;  3S3N A;  1EX4 A;  3MHX A;  2H3J A;  1AWW A;  2XKO C;  2O4X B;  1M2O A;  5GAN f;  1NM7 A;  1MMD A;  1ARK A;  1R0C B;  3M0T A;  4XU2 A;  3PFS A;  1GXI E;  2M9U A;  2JTF A;  2W0Z A;  3MPU B;  2OTL T;  1QP3 A;  3M5A A;  3QSU A;  1M27 C;  1HJD A;  2EYX A;  2CP0 A;  3VS4 A;  4FSS A;  3BY7 A;  1UJY A;  4RTT A;  1ZSZ A;  4QVD A;  1JU5 C;  4ZTJ A;  5CKF A;  1YP5 A;  3M0R A;  3FIF A;  1VQ4 T;  1N8R C;  4FSX A;  1RLP C;  2QA4 T;  4F7U E;  1M90 C;  4PL6 A;  3V8K A;  3G6E A;  3QBY A;  3CCS A;  4CC3 A;  2XHC A;  2E1H A;  1K73 C;  2VGN A;  2VXE A;  2AKL A;  2BE7 D;  2RO0 A;  2LMJ A;  4CC2 A;  3VJP A;  3M53 A;  4IKF A;  2EGA A;  2XDD A;  2E41 A;  3SD4 A;  2E65 A;  3VS0 A;  4M77 A;  2HDA A;  2VVK A;  4HCK A;  4JJB A;  2VC8 A;  4Z89 A;  4AFS C;  1X43 A;  2CP2 A;  4E7L A;  2KYM A;  4X9D A;  1WGS A;  4DOV A;  4LD9 K;  4KGZ B;  4N4G A;  4N0A C;  4B9X A;  3A5Z B;  1FXX A;  3OMC A;  3J80 E;  2MIO A;  3LH5 A;  2RK1 A;  2COZ A;  4WCI A;  5FWB A;  2DIL A;  2HBP A;  2DL4 A;  3QHS A;  1JEG A;  5CQY A;  4ORZ A;  3GP8 A;  3OW2 P;  2RMO A;  5HY6 A;  3G6E Q;  1BIB A;  3CCS Q;  1M1K U;  4J7F A;  2E12 A;  5FWC A;  3JCM W;  3CCR A;  2CUB A;  2AHJ B;  2MWO A;  1YHQ A;  4XTX A;  1GCQ C;  3QWX X;  5KE2 A;  2XI9 A;  3C0C A;  2EJ9 A;  2MI6 A;  4AMC A;  4M75 F;  1OX9 A;  1VQO A;  5HK0 A;  4QQ6 A;  4BE0 A;  2ZPI B;  1VQK A;  1M30 A;  3DKM A;  3C95 A;  2X51 A;  3EGX A;  4AG1 C;  2ZAE A;  3CCU T;  3LWH A;  4FW1 A;  1B7T A;  5FU7 B;  5LJ5 e;  3H8Z A;  3JV3 A;  4E7H A;  1S72 T;  3MCA B;  1VQL T;  1ZSZ B;  1FX7 A;  1X2K A;  2HQX A;  3OS1 A;  4XU0 A;  4DBR A;  1G5V A;  4JJC A;  1X01 A;  5C0M A;  3CCR Q;  1OEB A;  1JJ2 S;  3NFC A;  1YHQ Q;  2K5L A;  4C92 G;  3L2Q A;  5KYN A;  4OMO A;  3I35 A;  5FRO A;  1HK9 A;  1RAD B;  5DLO A;  2RNA A;  4HT9 A;  1VQO Q;  2BKD N;  2EGE A;  2KRO A;  2FPE A;  3SWN B;  1VQK Q;  4ELZ C;  4A4K A;  4M77 B;  5IAY A;  1WHJ A;  2L3Q A;  1BBZ A;  4PJL A;  1QVP A;  2C06 A;  2CS7 A;  5GAO m;  3NHN A;  2MF2 A;  1Q95 G;  4XTV A;  2FG0 A;  5GAN h;  3JCM P;  3QPH A;  2W10 A;  2FEI A;  1I5O B;  1WQ7 A;  2RF0 A;  4M75 A;  1Q7Y U;  4HKE A;  2RQV A;  2ZGW A;  1MGQ A;  4MZM A;  1AZG B;  4MDX A;  1S1N A;  1BI3 A;  3MEU A;  2RJC A;  1WDX A;  3RNJ A;  2RPN A;  4IUR A;  4PLI A;  2NUP A;  2O31 A;  2C0T A;  2OX7 A;  1LOJ A;  3U23 A;  1GL5 A;  3R6O A;  1NEG A;  2EQJ A;  4ZGJ B;  3JCM X;  1QKW A;  3Q1J A;  5I22 A;  1MHN A;  2GTO A;  3QG1 A;  1BB9 A;  4XTZ A;  2E64 A;  3FEO A;  2LZ6 B;  2OAW A;  3M56 A;  3ZEH A;  4RTX A;  2HD0 A;  3KXT A;  1VIE A;  3OYI A;  4GLM A;  2D0N A;  3EGX B;  2L8D A;  1ABO A;  4ZN3 A;  2EQK A;  1LVK A;  2KBT A;  2ENM A;  1VQP T;  3EHQ A;  2K5F A;  2KRN A;  1M1K C;  2ED0 A;  4PFZ A;  2DBM A;  1PKT A;  4L59 A;  1W6X A;  2FZC B;  5FRM A;  4OGC A;  3OYY A;  3LGF A;  3JCM e;  1KJW A;  4XK8 E;  1WHL A;  1QCF A;  5KCH A;  3THK A;  2YUO A;  1UDL A;  1IXD A;  2JM8 A;  4M7D D;  3A1P A;  4RTV A;  1PRM C;  2H8H A;  4JS4 A;  2QEX T;  2DL3 A;  2LT4 A;  1BI2 A;  1Q81 U;  3PTA A;  3S3O A;  4M4Z A;  1U3O A;  1TUD A;  4VUB A;  1ZHI A;  3VS1 A;  2KRM A;  5GAM d;  2QQB A;  5IHN A;  1SSH A;  3FJ5 A;  1WFW A;  3ER0 A;  3MEW A;  2DD4 A;  1VQM T;  4PFO A;  2EJF A;  4C8Q F;  3CMA T;  4DEY A;  1QVG A;  4LNP A;  1VQ9 A;  4M77 C;  4NL2 A;  3VUZ A;  4C0G A;  4L5G A;  2VB6 A;  1PRL C;  5L8R E;  5GAN 3;  1K0S A;  2D1X A;  4M75 B;  2RA2 A;  5CQX A;  2DMO A;  4FM4 B;  1SPK A;  2Z0W A;  2DA9 A;  3VV0 A;  3M57 A;  3VKI A;  3L2W A;  1M3B A;  3CEY A;  4FU6 A;  2NUP B;  3VU3 C;  2RM4 A;  1PCX A;  2KT1 A;  3PIO A;  1QQJ A;  1VQN T;  2H3E B;  1B07 A;  3X20 B;  1P92 A;  4FT2 A;  3CC4 A;  2JS2 A;  1Q7Y C;  3TVT A;  1VQ9 Q;  2KNB B;  2RHZ A;  2QI2 A;  2PTK A;  2HQH A;  4IUU A;  3M54 A;  4PFP A;  5LJ5 g;  3JB9 D;  4JUV A;  2E5K A;  1QP2 A;  3PMI A;  2QG9 B;  4QQG A;  4C0D C;  5A0L A;  3EAE A;  1VQ5 A;  1YCY A;  2O9S A;  1U1S A;  4C8Q A;  1NZ9 A;  2KXD A;  4ANJ A;  2MAM A;  5J3B A;  2FVU A;  1E6H A;  1QMC A;  1RLQ C;  3EG1 A;  1Q82 U;  2OTJ T;  4M77 E;  1KK7 A;  5GAM j;  2QYZ A;  4RTU A;  1W4S A;  1UGV A;  3CC4 Q;  3HPW A;  2CP7 A;  1PD0 A;  4LE9 A;  2X4X A;  1N8R R;  2K4Y A;  2VAS A;  3X24 B;  1M90 R;  3QO3 A;  2FYK A;  2AKK A;  2DNU A;  3HTR A;  3C4S A;  3OW2 A;  2RQW A;  1OOT A;  1KHI A;  3EG3 A;  1K73 R;  3HKS A;  1T3S A;  2K3X A;  1YFN A;  3OYN A;  5CR2 A;  3BW1 A;  4HXJ A;  1YJN A;  3CBO A;  1VQ5 Q;  1Y0M A;  3HRS A;  1Q81 C;  1M2V B;  4XTU A;  4M75 C;  3H9N A;  3CCJ T;  3OYB A;  2DVE A;  4TVR A;  4J9I A;  3UT1 A;  2CDT A;  1VQ4 A;  2C0I A;  1X69 A;  3UA7 A;  1GBR A;  4L6V 5;  1PC0 A;  4PJO F;  3TCJ A;  4Z88 A;  4M7A F;  1Y71 A;  4PK4 A;  2KXC A;  2DTH A;  2L5Q A;  5GAN 4;  2EYW A;  2AK5 A;  1BU1 A;  3OB9 A;  1AWJ A;  2FPF A;  1MND A;  5DM7 R;  3HRU A;  4F7U G;  1Z9Z A;  1YJN Q;  1YJW T;  3EH1 A;  4BDY A;  2JNG A;  1RAI B;  2V8I A;  3OYG A;  4IUQ A;  3J7A F;  3JB9 J;  3JCM g;  5IXF A;  1M3C A;  3RMQ A;  5IH2 A;  2LC4 A;  2CKK A;  4C8Q B;  4E7K A;  1WLP B;  2KMT A;  1VQ4 Q;  5FLX E;  1M8V A;  2YDL A;  1UHF A;  5IT9 E;  1SHG A;  3M4G A;  2EYZ A;  3E1S A;  1I4K 1;  3PVL A;  1WXU A;  2K3B A;  4J9F A;  2DKG A;  2K6D A;  1FMW A;  2E3H A;  4FIB A;  2Y4X A;  4DBQ A;  4YTL A;  3G1J A;  3PIP A;  1NPR A;  4ZN1 A;  4XQ3 A;  1ZBX A;  4HVW A;  4BE1 A;  1VA7 A;  1NEB A;  2YRD A;  1KSW A;  4ZGE B;  1PSE A;  2DXB A;  2M51 A;  4M75 E;  1D1B A;  2P0Q A;  4C5H A;  1NPP A;  4IIM A;  1M3A A;  4PJO A;  2EQI A;  4M7A A;  1YN8 A;  2MK5 A;  4JLG A;  4KGX B;  2YXY A;  2LT1 A;  5CO7 A;  3CME T;  1YJ9 T;  2E6Z A;  3LWI A;  2CYZ B;  4NOY A;  5LJ3 j;  3CCQ T;  3HSB A;  1YIJ A;  1Q82 C;  2LCL A;  1VYT A;  1S72 A;  1VQL A;  2D9T A;  4JRQ A;  3OYD A;  2LJ3 A;  5IN1 A;  2PQW A;  1TU0 B;  2QDY B;  3R6N A;  1OV3 A;  2VUB A;  2DPP B;  4ZTF A;  2DM1 A;  4EDU A;  1H3Z A;  3JCM Q;  3SFM A;  1I81 A;  1U1T A;  3CBP A;  3QII A;  2VYT A;  3NPF A;  4DBF A;  2ZPG B;  2QTX A;  1SEM A;  3RDV A;  1B3Q A;  2E4H A;  3QXE B;  4LDU A;  3QWY A;  1VOM A;  2DJQ A;  4BUG A;  4LXC A;  2JS0 A;  3RES A;  1RAC B;  2X3X D;  2DYI A;  2EIF A;  1IGQ A;  2X4J A;  2J6F A;  3ULR B;  3FRN A;  2DF6 A;  3QZ9 B;  2HCK A;  3OQ5 A;  4X9C A;  4QQD A;  1KIK A;  1YIJ Q;  5A0G A;  2DE0 X;  5GAM h;  1S72 Q;  3CC2 A;  1VQL Q;  4HT8 A;  3JB9 G;  4KUL A;  1ZSG A;  4BI8 B;  2NWM A;  3LW5 E;  1KQ1 A;  2DZ9 A;  2RHY A;  1YIT T;  2HMA A;  4C8Q C;  3JB9 I;  1M1K R;  2LNV A;  4KGV B;  4AT1 B;  4ME7 A;  3I9Q A;  1OPK A;  3M0Q A;  3FLG A;  1WHK A;  2KR3 A;  4MMK A;  1G83 A;  3NGP A;  2RI3 A;  1J3T A;  5LJ5 d;  2V8J A;  1YBY A;  3SB2 A;  3H6Z A;  4MZP A;  3SWN A;  3JCM b;  2LX7 A;  2RQT A;  1RAG B;  1C0M A;  4PJO B;  4A4F A;  1JRI A;  2XG8 D;  4M7A B;  1SRL A;  3CC2 Q;  4OMN A;  4OMQ A;  4KH1 B;  1MUZ A;  4M78 F;  1AEY A;  3P8D A;  4J9G A;  1M4Z A;  2LVM A;  4DA4 A;  1ZA2 B;  2ATC B;  1OUL A;  4OMF B;  3I55 T;  1FMV A;  1GBQ A;  5CVI A;  1K8A U;  2CP6 A;  4Y28 E;  3EFS A;  2ROT A;  4B6M A;  1MMN A;  3WVD B;  1IO6 A;  1OX8 A;  2RK2 A;  1HYO A;  4JRI A;  2DTO A;  4JJN K;  4GY5 A;  2EQM A;  2PVO B;  4R0K A;  1C1A A;  2CZ7 B;  2QEX A;  1KQS S;  4PJJ A;  2SEM A;  2X3W D;  4JDS A;  5IHK A;  3M55 A;  3L2R A;  3L2U A;  1T3L A;  2YUP A;  3NTI A;  1MV0 B;  3H0F A;  1U8R A;  3A8L B;  4LDY A;  4LDV A;  1QVF S;  3OY9 A;  1YWO A;  1NYG A;  3JRZ A;  2JOY A;  3OYA A;  3CCL A;  1IRX A;  1XTD A;  4V2S A;  1G3W A;  3GIB A;  1VQM A;  1TOV A;  4MZT A;  4C8Q E;  1YCS B;  3OYM A;  3RIR A;  3OSV A;  3BDL A;  3DB3 A;  3QYG B;  2X9H A;  3UDC A;  1JB0 E;  2PU9 B;  3M9Q A;  1Q7Y R;  2KQW A;  1N9S A;  3CCM T;  4HA8 A;  2EJG A;  4RG2 A;  3CPF A;  4RUG A;  2FPD A;  4PNO A;  4RCB A;  1FYN A;  2R58 A;  4JPB W;  2M02 A;  2GNC A;  4E47 A;  2QEX Q;  2A7Y A;  4F14 A;  4M78 A;  3CXC P;  2P0K A;  5GMK e;  3V8L A;  1I0C A;  4GBQ A;  1AD5 A;  2KT8 A;  3DB4 A;  2HNI A;  3PE0 A;  5LJ3 h;  4J6X A;  2BTT A;  3OS0 A;  3JB9 H;  3ME9 A;  2JZ2 A;  7AT1 B;  2PVG B;  3CQT A;  3CCL Q;  1MMA A;  4CC4 B;  1RAF B;  2QK0 A;  4JZ3 A;  2KE9 A;  2RI5 A;  1VQM Q;  5FRN A;  3M0P A;  4KUD K;  5LJ5 f;  4J6Y A;  2BE9 B;  4O6J A;  3JCM d;  2GFA A;  3X26 B;  5A0D A;  1QCO A;  4C0F A;  4N4H A;  4J9H A;  4FYW B;  2G6F X;  4E6R A;  3HFO A;  4PJO C;  1UB4 A;  2KDS A;  2RHU A;  4M7A C;  2F2X A;  3AHU A;  3OMG A;  2LJ1 A;  3QJY A;  2FL7 A;  5EG2 A;  4FYV B;  3MKD A;  1N5Z A;  2YWW A;  2B8A A;  2RQR A;  3F70 A;  2EAY A;  4KH0 B;  1Z9Q A;  5CKB A;  1Q81 R;  1X6G A;  4BDZ A;  2OTJ A;  2KAF A;  2X35 A;  2QQ9 A;  4JJD A;  1VQ8 T;  1RI0 A;  4R56 A;  3SDZ A;  4J7I A;  2KSS A;  1KHC A;  2E3I A;  2JUF A;  1K76 A;  3CC7 T;  1H3H A;  2NYS A;  2KGT A;  1BKB A;  1WJQ A;  2JJ9 A;  2V1Q A;  1K8A C;  4KRT A;  4M77 G;  4LDX A;  2EW3 A;  1UTI A;  3OS5 A;  2DFU A;  2PUO B;  3UAT A;  2LQW A;  3EFR A;  2DD5 A;  1VIF A;  5AT1 B;  4BE2 A;  2DX1 A;  1JXO A;  4IIO A;  1JJ2 P;  4FYY B;  2KRS A;  4J9D A;  4F17 A;  1W70 A;  5FU7 C;  3HL8 A;  3QKJ A;  1OYX A;  3RER A;  3C94 A;  2EYY A;  4M78 B;  3MP6 A;  4BY6 B;  1ZSZ C;  1WHM A;  3QDR B;  2OTJ Q;  5GAN 6;  2JN0 A;  8AT1 B;  3V7R A;  2XDP A;  4ESR A;  2XMF A;  1R8O B;  4PJN A;  1KC8 U;  1RAE B;  1K4U S;  4EMG A;  4PJO E;  4M7A E;  2YUQ A;  4M7D F;  4II1 A;  2CT4 A;  2CT3 A;  2IPO B;  3G7Z A;  1IHW A;  3G71 A;  1UHC A;  3JCM V;  3WVE B;  3SWN C;  2SRC A;  2A37 A;  4ZNX A;  3V7S A;  3JCM f;  2L3P A;  3QDF A;  1G8X A;  4C5G A;  2MWP A;  4AFQ C;  1VYU A;  1YHQ T;  1BI0 A;  4MML A;  3A8H B;  2DO3 A;  1UGS B;  4C8Q D;  1X6O A;  1U5S A;  3VUB A;  1I8F A;  2EKH A;  4X34 A;  1M8M A;  3EG9 A;  2HL3 A;  1VQO T;  4E7S A;  1D3B A;  1BIA A;  4IUV A;  1M2V A;  2QAZ A;  1KD1 U;  5M9O A;  3O8V A;  4GLK A;  3FDR A;  3VS5 A;  4XTW A;  1Q82 R;  1ZQ1 A;  2GFU A;  2LX9 A;  1BK2 A;  3REA B;  2EFI A;  1Y07 A;  1H8K A;  4EMH A;  2EGC A;  1M5Q 1;  1TTH B;  2O88 A;  2L0A A;  2DRK A;  4FYX B;  3G71 Q;  3CD6 A;  3DLM A;  2M1H A;  1IHV A;  2ZPB B;  4ELY C;  1H92 A;  3HRT A;  3EGD B;  4BI3 A;  2RH2 A;  2AT1 B;  2JM9 A;  1VQ6 A;  9ATC B;  4EMK A;  1QWF A;  1ZX6 A;  1VQ7 A;  1UJ0 A;  3CME A;  5GJV B;  1YJ9 A;  4M7D A;  1OZ3 A;  2KEA A;  2EYQ A;  4D8K A;  3E2U A;  3GNF B;  2CP3 A;  2KK4 A;  1CKB A;  2OI3 A;  1N9R A;  4M75 G;  1YWP A;  2LDM A;  2HEQ A;  2MPX C;  3JAM E;  1PSF A;  6AT1 B;  2HAX A;  2XD0 A;  3OYC A;  2FHD A;  3MP8 A;  1MNE A;  5LL6 S;  2J6K A;  2CRE A;  5KYU A;  1TG0 A;  4M78 C;  4BY6 C;  2QQA A;  4OVA A;  4RTY A;  3CD6 Q;  1NG2 A;  2IG0 A;  2QGF B;  3OBW A;  4D8D A;  1GRI A;  5GMK l;  3CCV T;  1K9M U;  2NUZ A;  2DIQ A;  3VS3 A;  1Q86 U;  1G3S A;  1VQ6 Q;  1GCP A;  3H0I A;  3SEM A;  1VQ7 Q;  2ZZD A;  1V1C A;  3CME Q;  3VS2 A;  2LJ0 A;  3L2Z A;  3L2V A;  1YJ9 Q;  5D7U A;  2OAU A;  2FRY A;  2WSC E;  4J8O A;  1K0X A;  1KC8 C;  5KYY B;  1D0Z A;  3EG9 B;  2OTL A;  2JT4 A;  1D3B B;  2X4W A;  2DZC A;  2FRW A;  1TSF A;  5EC7 A;  3TQ7 P;  5HK3 A;  4OB1 B;  1YIT A;  4OML A;  4LD6 A;  3PNW C;  2HQE A;  2QA4 A;  3H0H A;  1V29 B;  4LUE A;  3CCE T;  1EFN A;  5D6Y A;  2DVJ A;  2MOX A;  3HHT B;  5KE3 A;  3TU4 K;  1W1F A;  1FMK A;  2A36 A;  5CK9 A;  2RD1 A;  2K57 A;  1G3T A;  3V8J A;  5KCO A;  2LTO A;  4P5N A;  1ZUK A;  5GAO r;  2J6O A;  4HVV A;  3BFM A;  3CXC A;  5KH6 A;  1KD1 C;  4EMK B;  1WA7 A;  3OYJ A;  1RI9 A;  4M7D B;  2OTL Q;  1X75 C;  4M78 E;  3EG2 A;  1M9S A;  1WPY A;  1K9A A;  2WSF E;  3GPL A;  3NMZ C;  2ZCF B;  2D0Q B;  3I55 A;  1QVG S;  3JCM h;  1AZE A;  1YIT Q;  1N8R U;  1RUW A;  5AYF A;  4C0Z A;  3INZ A;  5KYW B;  4ATO A;  2CUD A;  2KVQ G;  1Y57 A;  4K11 A;  2QA4 Q; 
#chains in the Genus database with same CATH homology
 2RQV A;  2LX7 A;  2RQT A;  1ZBJ A;  2F2V A;  1AZG B;  1SRL A;  1S1N A;  4OMN A;  4OMQ A;  3REB B;  1MUZ A;  1WDX A;  3RNJ A;  2RPN A;  1UEC A;  1AEY A;  2CH4 A;  4J9G A;  2O31 A;  2C0T A;  3U23 A;  1GL5 A;  2GBQ A;  1X27 A;  1NEG A;  4F16 A;  1QKW A;  5I22 A;  1GBQ A;  2GTO A;  2DL7 A;  1BB9 A;  2ROT A;  1IO6 A;  4AFU C;  2LZ6 B;  2OAW A;  2ESW A;  4RTX A;  4AG2 C;  1VYV A;  2VWF A;  5HCK A;  4R0K A;  2MCN A;  3UA6 A;  4X1V A;  2VKN A;  4GLM A;  2SEM A;  2X3W D;  2D0N A;  5IHK A;  1WXT A;  1T3L A;  1ABO A;  2YUP A;  1G2B A;  4J9B A;  1MV0 B;  1UUE A;  3H0F A;  2KBT A;  3VS7 A;  2ENM A;  3UF4 A;  1YWO A;  1GFD A;  1NYG A;  1E7O A;  3EHQ A;  2KRN A;  1SHF A;  2ED0 A;  3TSZ A;  2F2W A;  2DBM A;  2B86 A;  1PKT A;  1W6X A;  3A98 A;  2A08 A;  1I1J A;  1KJW A;  3EG0 A;  1YCS B;  1QCF A;  3THK A;  1CSK A;  2YUO A;  1UDL A;  2JM8 A;  2AZV A;  2PZ1 A;  4RTV A;  1QWE A;  1PRM C;  2H8H A;  1WI7 A;  1AWX A;  2QDL A;  2DL3 A;  4DEX A;  4RTZ A;  2DLP A;  1LCK A;  2IIM A;  4M4Z A;  1U3O A;  1TUD A;  4RUG A;  2FPD A;  4LUD A;  4J9C A;  3VS1 A;  1FYN A;  2KRM A;  4JPB W;  3TSW A;  2HBW A;  4EIK A;  5IHN A;  2FO0 A;  1HD3 A;  3VS6 A;  1SSH A;  3FJ5 A;  2GNC A;  2GGR A;  1WFW A;  2DBK A;  2J06 A;  1U06 A;  4F14 A;  3H41 A;  5FW9 A;  2LCS A;  1I0C A;  4GBQ A;  1AD5 A;  4A63 B;  2KT8 A;  2I0N A;  1JO8 A;  2OJ2 A;  4DEY A;  2K9G A;  1T0H A;  3PE0 A;  1NYF A;  2BTT A;  4LNP A;  1WX6 A;  1JXM A;  1ABQ A;  1UE9 A;  2L3S A;  3CQT A;  4CC4 B;  1PRL C;  2K7A A;  3KFV A;  4JZ3 A;  1K0S A;  2KE9 A;  2D1X A;  1OPL A;  2DMO A;  1GCQ A;  3M0P A;  2J7I A;  1SPK A;  4CC7 A;  2DA9 A;  5L23 A;  1M3B A;  2PNI A;  2DL8 A;  1K1Z A;  3RBB B;  4J9H A;  2G6F X;  4E6R A;  1PHT A;  2EPD A;  2KT1 A;  2F2X A;  1NLP C;  2ROL A;  1XOV A;  2LJ1 A;  2M0Y A;  1N5Z A;  3VRY A;  5IXB A;  2YSQ A;  1B07 A;  5ECA A;  2LP5 A;  1MV3 A;  2RQR A;  2YUN A;  4Y92 A;  1Z9Q A;  2JS2 A;  1TUC A;  2RN8 A;  4J9E A;  3TVT A;  2KNB B;  2C0O A;  1UFF A;  1X6G A;  3I5R A;  2DL5 A;  4JZ4 A;  1QKX A;  2PTK A;  3PVQ A;  2A28 A;  1HSQ A;  4JJD A;  5GJW B;  2YT6 A;  2E5K A;  2EVR A;  3EHR A;  2BZX A;  1KFZ A;  1X2Q A;  1H3H A;  1K76 A;  2D8J A;  2O2O A;  2KGT A;  2V1Q A;  1AOJ A;  1PNJ A;  2O9S A;  4KRT A;  2EW3 A;  1UTI A;  2K79 A;  2KXD A;  2EBP A;  1T0J A;  3M0U A;  3UAT A;  2CH4 W;  2ABL A;  2LQW A;  1E6H A;  1RLQ C;  3EG1 A;  2O9V A;  4RTW A;  2DX1 A;  1JXO A;  4IIO A;  1ZUY A;  1WIE A;  2GQI A;  2KRS A;  4J9D A;  1E6G A;  1W70 A;  4RTU A;  1GFC A;  4F17 A;  2JMA A;  1UGV A;  4LE9 A;  2EYY A;  1WYX A;  2AKK A;  1X6B A;  2DNU A;  4ESR A;  2XMF A;  2P4R A;  1Y57 A;  2ECZ A;  1K4U S;  2RQW A;  1OOT A;  1YNZ A;  5IHI A;  3SHW A;  3EG3 A;  1T3S A;  2JXB A;  2YUQ A;  2BZY A;  4HXJ A;  2CT4 A;  2CT3 A;  1Y0M A;  1UHC A;  2J05 A;  2BZ8 A;  1UG1 A;  2JMC A;  2AZS A;  2L2P A;  2SRC A;  2A37 A;  2LQN A;  4ZNX A;  1AWW A;  1JQQ A;  2L3P A;  4J9I A;  1ZUU A;  4AFQ C;  1VYU A;  2CDT A;  1NM7 A;  2C0I A;  1X69 A;  3UA7 A;  2ED1 A;  1GBR A;  3VRZ A;  1ARK A;  3EGU A;  1U5S A;  3M0T A;  4Z88 A;  2EKH A;  2DYB A;  1M8M A;  2KXC A;  2W0Z A;  2EYW A;  3M0S A;  2AK5 A;  1BU1 A;  1AWJ A;  2FPF A;  3VS5 A;  1M27 C;  1HJD A;  2EYX A;  3VS4 A;  4FSS A;  1BK2 A;  3REA B;  1UJY A;  4RTT A;  1H8K A;  2EGC A;  1Z9Z A;  1JU5 C;  2O88 A;  1ZLM A;  2L0A A;  2DRK A;  1YP5 A;  3M0R A;  1SRM A;  4Z8A A;  1RLP C;  5IXF A;  1M3C A;  4AFZ C;  1H92 A;  5IH2 A;  4CC3 A;  1WLP B;  1WXB A;  2V1R A;  2JM9 A;  2YDL A;  1UHF A;  1QWF A;  1SHG A;  1ZX6 A;  2AKL A;  2LMJ A;  1UJ0 A;  4CC2 A;  5GJV B;  2EGA A;  2EYZ A;  2KEA A;  3PVL A;  3VS0 A;  1WXU A;  4D8K A;  2K3B A;  4J9F A;  2HDA A;  1CKB A;  2K6D A;  2OI3 A;  2VVK A;  4HCK A;  4JJB A;  4Z89 A;  4AFS C;  1X43 A;  1YWP A;  2KYM A;  4HVW A;  2CSI A;  1VA7 A;  2HEQ A;  1NEB A;  3GBQ A;  1KSW A;  2J6K A;  2CRE A;  2MIO A;  2M51 A;  3LH5 A;  1TG0 A;  4WCI A;  4IIM A;  1M3A A;  2JW4 A;  1I07 A;  2EQI A;  4RTY A;  5FWB A;  2DIL A;  1JEG A;  2DL4 A;  4OMP A;  1NG2 A;  4HVU A;  3O5Z A;  4ORZ A;  1YN8 A;  4D8D A;  2RMO A;  1GRI A;  2NUZ A;  5FWC A;  1VYT A;  4QT7 A;  2CUB A;  2CSQ A;  3VS3 A;  1GCP A;  1GCQ C;  2LJ3 A;  3QWX X;  3H0I A;  3SEM A;  1V1C A;  3R6N A;  3VS2 A;  1OV3 A;  2GTJ A;  2LJ0 A;  3C0C A;  2DM1 A;  2FRY A;  2KYB A;  3NPF A;  1K0X A;  3I5S A;  1M30 A;  1SEM A;  2JT4 A;  1B3Q A;  2LNH B;  4AG1 C;  2DRM A;  3QWY A;  2JTE A;  2FRW A;  2HSP A;  2DJQ A;  5EC7 A;  2JS0 A;  3JV3 A;  1NLO C;  4OML A;  2X3X D;  2K2M A;  1X2K A;  2J6F A;  3H0H A;  3ULR B;  2DF6 A;  2HCK A;  4LUE A;  1EFN A;  5I11 A;  4LN2 A;  1KIK A;  2DVJ A;  2MOX A;  4JJC A;  2DE0 X;  1OEB A;  1FMK A;  1W1F A;  2A36 A;  1A0N B;  3ZL7 C;  1PKS A;  1QLY A;  1ZSG A;  4OMO A;  3I35 A;  2NWM A;  4OMM A;  1ZUK A;  2RNA A;  2J6O A;  4HVV A;  2EGE A;  2KRO A;  2RQU A;  2FPE A;  1WA7 A;  2D8H A;  1RI9 A;  3IQL A;  3I9Q A;  1AWO A;  3EG2 A;  1OPK A;  1CKA A;  1K9A A;  3M0Q A;  2KR3 A;  2L3Q A;  1BBZ A;  3NMZ C;  1G83 A;  3NGP A;  1J3T A;  1PWT A;  1AZE A;  3NHN A;  1AVZ C;  2FG0 A;  1RUW A;  2CUD A;  2W10 A;  2FEI A;  4K11 A;  2RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...