4J9DA

Crystal structure of the n114a mutant of the abl-sh3 domain complexed with the high affinity peptide p0
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high affinity peptide P0
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9dA00
1I1JA 2FRYA 2DX1A 4RTUA 1KIKA 4HVUA 1YNZA 1WFWA 2LJ0A 1HSQA 3QWXX 4GBQA 2EBPA 4J9GA 1NYFA 1ZLMA 2LZ6B 2ROLA 4OMMA 2JTEA 2JW4A 2RF0A 4LN2A 4JJCA 2YUOA 2JMAA 2YDLA 1IO6A 2FG0A 1RLPC 3H0FA 2DJQA 1JXMA 1BU1A 3LH5A 1AVZC 1X43A 1OOTA 2F2XA 1AWXA 3REBB 1UGVA 1ZBJA 1PWTA 4AFZC 2YUNA 1AEYA 1UDLA 1GCQA 2A37A 1VA7A 2BZXA 5L23A 1X6GA 3U23A 2KRSA 2VVKA 3UA7A 1M8MA 2H8HA 3H41A 2BTTA 1SPKA 1NG2A 2DILA 3I9QA 2CSQA 1WI7A 1SSHA 1GFCA 4F16A 4D8DA 2MOXA 4Z88A 1AOJA 1V1CA 1JU5C 3A98A 2NUZA 2KRMA 2RNAA 4AG1C 1MUZA 2KEAA 2KXDA 1HD3A 1Y57A 1M3BA 4J9BA 1NYGA 4J9HA 3I5SA 1YWOA 1GBRA 3M0UA 4LE9A 4RTYA 5IXFA 1Z9QA 4RTWA 5HCKA 3EG2A 1I0CA 1WIEA 1NM7A 4OMNA 1ZUUA 2SRCA 1N5ZA 1RI9A 1UECA 1OV3A 3VS1A 3ZL7C 2MIOA 1UHCA 1UE9A 5FW9A 2GNCA 4HXJA 1T0HA 1G2BA 3PVQA 2LX7A 1UUEA 1Y0MA 1FYNA 2C0TA 2DM1A 1TUDA 2KYBA 2GTOA 2KGTA 3VRZA 4AFSC 1CKAA 2EYXA 1CKBA 1GRIA 2K6DA 2JM8A 4RTXA 1YP5A 4OMPA 2J6FA 2HBWA 4AFQC 3EG1A 1NLPC 2LMJA 1MV0B 4JZ4A 2DL8A 2GQIA 1GFDA 2KYMA 3M0SA 1WXTA 1NEBA 1PNJA 1X2KA 2L0AA 2YSQA 2D0NA 2K2MA 2LNHB 4JZ3A 1S1NA 1YN8A 4Z8AA 5GJWB 3RNJA 1H3HA 1YWPA 2KE9A 2CT4A 2OAWA 2EKHA 1PHTA 2O9VA 2GBQA 4A63B 1I07A 5FWCA 3UF4A 2FEIA 1WXBA 1PKTA 1K1ZA 1OEBA 4WCIA 1AWOA 3I5RA 2D8JA 4LUEA 3C0CA 3TSZA 2NWMA 4AFUC 2OI3A 3ULRB 2LP5A 2KBTA 3NMZC 2G6FX 3VRYA 2DE0X 2O9SA 1GCPA 4K11A 1AWWA 3EG0A 2EPDA 2LJ1A 4IIOA 3REAB 1H92A 2JS0A 3VS3A 2FO0A 2CUBA 3NHNA 3PE0A 4JPBW 2W0ZA 2JXBA 3TSWA 1H8KA 2ECZA 2RMOA 1WA7A 3NPFA 2J06A 2JS2A 2EW3A 2RQRA 2VWFA 3GBQA 3O5ZA 4JJDA 4CC4B 1LCKA 2EYZA 3EGUA 1E6GA 4FSSA 4Z89A 3PVLA 4OMOA 4CC2A 4KRTA 2L3SA 2IIMA 1QWEA 1G83A 1SHGA 2DVJA 1K0SA 1JQQA 2YUQA 2DL4A 1UJYA 3I35A 2FPEA 1M3AA 1SRLA 2DBMA 1M3CA 1ZSGA 1MV3A 1JO8A 4ORZA 2LJ3A 2J6KA 2KRNA 1T0JA 2ED1A 2V1QA 4HVWA 3M0QA 1J3TA 1ABOA 4QT7A 4M4ZA 4EIKA 2A36A 4HCKA 1BK2A 2OJ2A 4LUDA 1K76A 2J05A 1GCQC 3VS5A 2D1XA 2X3WD 2FPDA 1QKWA 1WYXA 1X6BA 1UJ0A 2DL7A 4IIMA 1WLPB 2PTKA 2BZYA 1AD5A 4CC7A 1ZX6A 3EHRA 1X2QA 3UATA 1VYTA 2GTJA 1WXUA 1GBQA 1BB9A 4RTVA 2E5KA 2K7AA 1GL5A 1W6XA 2CDTA 2CUDA 3CQTA 4OMQA 5IHIA 1A0NB 2RPNA 2DA9A 4ESRA 1PRLC 2K79A 2PZ1A 5FWBA 2DRKA 2XMFA 4R0KA 1AWJA 3M0RA 3VS7A 2HCKA 2ENMA 1TUCA 1QCFA 2CSIA 3FJ5A 1B3QA 2BZ8A 5IHNA 2KXCA 2O2OA 2ESWA 4ZNXA 4Y92A 3UA6A 2EQIA 1RUWA 1W70A 1W1FA 1K9AA 1JEGA 4J9DA 1NLOC 3EG3A 3R6NA 2AK5A 4HVVA 2YUPA 1UG1A 4JJBA 4RTZA 3SEMA 3SHWA 2K9GA 1E7OA 2DNUA 5GJVB 3NGPA 1SHFA 2CH4A 2YT6A 2JM9A 3JV3A 1WX6A 3M0PA 1E6HA 2B86A 1YCSB 4RTTA 1WDXA 1KSWA 2A28A 1PRMC 4OMLA 2EGEA 1TG0A 2J7IA 2F2VA 3QWYA 2MCNA 2I0NA 5IHKA 1M27C 1ZUKA 2DL5A 2L2PA 4F14A 1FMKA 2EYYA 1X69A 1HJDA 3M0TA 1XOVA 2KR3A 3VS2A 5IXBA 3KFVA 2C0IA 2LQNA 4DEXA 1NEGA 1T3LA 2V1RA 2JMCA 1UFFA 1PKSA 5IH2A 2KNBB 4J9CA 1ABQA 2EGAA 1VYUA 1VYVA 2AKKA 2W10A 2O31A 1X27A 4GLMA 1U3OA 2LQWA 1BBZA 1ZUYA 2CT3A 1QLYA 2AZSA 1OPKA 3H0HA 1T3SA 2J6OA 4RUGA 1B07A 2DL3A 3TVTA 1CSKA 5I22A 2VKNA 2JT4A 2RN8A 2F2WA 2LCSA 2DBKA 2EGCA 2M0YA 2EVRA 2O88A 1AZEA 1K4US 1UTIA 2ROTA 3IQLA 3THKA 2QDLA 2FRWA 2ED0A 2GGRA 2RQVA 2HSPA 1SRMA 2DF6A 1QWFA 1QKXA 1SEMA 5ECAA 1KFZA 4J9IA 2C0OA 3VS6A 2A08A 1AZGB 4J9FA 3RBBB 2DLPA 2HDAA 2L3PA 2M51A 2D8HA 2HEQA 3H0IA 2EYWA 2SEMA 4CC3A 1U06A 4LNPA 5I11A 2RQWA 3VS0A 2DRMA 4J9EA 1KJWA 5EC7A 2FPFA 2P4RA 2KT1A 2L3QA 2CH4W 1UHFA 2AZVA 2KROA 2RQTA 2RQUA 1RLQC 2CREA 2K3BA 4E6RA 1EFNA 2KT8A 4AG2C 4DEYA 4X1VA 2PNIA 2DMOA 1ARKA 1M30A 2X3XD 1K0XA 2AKLA 1Z9ZA 3VS4A 1OPLA 3EHQA 2DYBA 2ABLA 1JXOA 4F17A 4D8KA 1U5SA
chains in the Genus database with same CATH superfamily
2DTIA 1VQ9Q 2DX1A 1VQKT 4HVUA 5GANd 3QWXX 2M02A 4BE0A 1NYFA 1MNDA 1ZLMA 3L2ZA 2OTJA 1VQ8Q 3QXEB 1VQ6A 1VQ4T 4MDWA 2RI5A 2JW4A 2OAUA 3CCJA 2YDLA 1JXMA 1QP3A 3LH5A 2VV5A 5GAN3 4C8QF 1AWXA 3REBB 2R5MA 1TUGB 5KYXB 4HCCA 3RUXA 1GCQA 4M7AC 2KRSA 1WHGA 3F70A 3A5ZB 5KE3A 3CCVA 3P8HA 3FRNA 3UA7A 3G1JA 4KT0E 4JS4A 2H8HA 3H41A 1SPKA 1NG2A 3OYCA 2JN0A 1QVGP 5GAN6 2CSQA 1TS9A 1QVGS 1FMWA 2RJDA 1V1CA 2NUZA 2KRMA 4PK4A 2KEAA 2KQWA 4F7UG 1HD3A 1KHCA 2DD4A 1GBRA 4LE9A 4E7HA 4RTWA 4ATOA 4M75B 4J6YA 2EJ9A 2X4XA 1U1TA 1ZUUA 4XAXB 2D9TA 2MI6A 1OV3A 4LXCA 3VS1A 2YHTA 4FT4A 2QEXQ 4A54A 2ZPGB 2E5QA 2YLCA 4OB0B 4M78C 3I55A 2KYBA 5GAOl 2GTOA 5KYYA 2M0OA 1M1KU 4XTXA 4LDWA 1CKAA 5EG2A 2K6DA 2JM8A 4BI3A 4OMPA 4IUPA 2J6FA 2AT1B 2NUTB 1YITA 5LJ3f 2LMJA 2XDBA 2AHJB 4OB2B 1OULA 2QTXA 3MEWA 2V8JA 5GAMg 2K57A 2KYMA 1WXTA 1NEBA 3OYYA 1VQNA 4V2SA 2K2MA 3HHTB 3QO3A 4XU3A 3VUZA 3DB4A 1M8VA 2JZ2A 3G71A 1H3ZA 2OAWA 4OB1B 4HT9A 3M58A 4A63B 3UF4A 2FEIA 4XK8E 3OYDA 3CMET 3QJYA 4WCIA 3GPLA 3I5RA 2EWNA 3C0CA 1M2VA 3OY9A 4AFUC 3JCMV 3L42A 2QGFB 2CP5A 3CPWP 2O9SA 5CQXA 3EG0A 3CPWS 4IIOA 5GAOn 3TQ7P 3I56A 5CKDA 1YI2A 3JCMX 1MNEA 2E1HA 4JRQA 2FO0A 5KYWB 2QG9B 1H8KA 3FJPA 1WA7A 3NPFA 2EW3A 3GBQA 4CC4B 4KGXB 1LCKA 1C6VX 2DIGA 4UC4A 3CCQA 4OMOA 2RJEA 4J5YA 4KRTA 4LDVA 4M75C 4JRKA 1BI2A 1S72T 4M77G 1UJYA 3I35A 4EMKB 2FPEA 4QW2A 3JSCA 2ZPBB 1OX8A 2RA2A 3C94A 2BIVA 3J80E 4C0FA 1JO8A 2LJ3A 4FCYA 1SSFA 1T0JA 2ED1A 4HVWA 3RERA 1TSFA 3M0QA 1J3TA 5CO7A 3TEEA 1NJIU 2QA4T 4LDYA 2GFAA 5GAMd 1LVKA 2D1XA 1QKWA 1X6BA 4IIMA 4Z02A 4XU1A 1WLPB 4M7AD 2FB7A 2VASA 1K9MC 3EHRA 3JCMe 5DM7R 4JLIA 1EZZB 6AT1B 2GTJA 1GBQA 2K7AA 3VJPA 1GL5A 4CRIA 3Q1JA 2FYKA 1A0NB 1B7TA 4IUQA 5KCHA 4C0DC 3CCST 2WSFE 1WQ7A 2PZ1A 2DRKA 2XMFA 1AHJB 3JCMf 1AWJA 3VS7A 2GQVA 2ENMA 3OYHA 4P5NA 1QCFA 4M7AF 2BZ8A 5IHNA 3G6ET 1YJWA 2KXCA 2O2OA 3OS0A 4PFPA 3JB9H 1Q86C 5LJ3g 1IHVA 1W70A 4BB7A 4J9DA 3G7ZA 1K73C 2FHDA 4QQGA 3M9QA 2IG0A 2YUPA 3NTHA 4M7AA 3CMEQ 2K9GA 1E7OA 2DNUA 4E7JA 1SHFA 2CH4A 4M78D 4E7SA 2YT6A 4ZN3A 4RMOA 1NZ9A 1WX6A 3TCJA 3ASKA 4EPCA 2LCCA 8ATCB 4XTWA 4WTOB 1WDXA 2GCXA 1KSWA 5KYYB 3CC4A 3M54A 1VQ7T 1G5VA 1TG0A 2EKOA 1HXDA 2HBPA 1VIEA 2DL5A 1IRXA 4YTLA 1FMKA 5LL6S 3VKIA 2KDSA 4M78F 5GAN7 4OMFB 2OX7A 2MF2A 4RKUE 3HRUA 1D0YA 1S72Q 3OA6A 3CC7T 4O6JA 3SWNC 4FSXA 1M90R 4F04B 1PSEA 1U3OA 5A2QE 3S3NA 2VB6A 3D7SB 1QLYA 2AZSA 5FU7C 5A0GA 1M2VB 1B07A 4II1A 3TVTA 4QQ6A 5I22A 3UWNA 2QA4Q 2K5FA 4N4HA 2EGCA 2M0YA 1RAGB 3IQLA 4DOVA 1IZ6A 1VUBA 3L1AA 1WJSA 1KHIA 4N4IA 5AT1B 2RQVA 1RAHB 5LJ3d 1D3BA 2DXTA 3DB3A 2MAMA 2QASA 2QQAA 1AT1B 4M75D 2O4XA 3A8HB 3HRTA 3CCSQ 1OZ2A 2LTOA 2EYWA 3OMGA 4CC3A 1U06A 1KC8R 2JUFA 2RQWA 2P0KA 1HK9A 1YJNQ 4JUVA 1XTDA 1NE8A 5CAIA 5D6XA 5EC7A 2P4RA 2KT1A 3CBMA 3OYLA 3G6EQ 3CCMT 2CH4W 1UHFA 1C1AA 2AZVA 4C8QG 1KQSP 1IXDA 3OW2P 3OYFA 1KQSS 2K3BA 3OW2S 2RB6A 3V7CA 4DEYA 4X1VA 3JCMg 2PNIA 1JJ2A 1M30A 4M75F 1K0XA 3MO8A 4Y28E 1D0XA 4M77A 2DYBA 1VOMA 3RMSA 5CQYA 4D8KA 2RI2A 1U5SA 1ZSZC 3ER0A 4BY6B 2V8KA 1NBEB 2I2LA 1KIKA 3FEOA 2DEQA 4B9WA 1VQOT 3OYBA 2EBPA 2MMPA 4BDZA 2ROLA 5J26A 4C92C 2RF0A 1VQ7Q 5A0LA 4LN2A 3CCLA 1QVPA 3CD6A 3QBYA 2FG0A 4VUBA 1RLPC 3VUBA 1G3YA 3MPUB 1C0MA 3CCUQ 2CZ1B 1AVZC 1X43A 2CS7A 2QXFA 3PMTA 1UGVA 2JTFA 4AFZC 4C92G 4M7AE 2YUNA 2NYSA 2E6NA 1N8RR 1X6GA 2NLUA 4HA8A 2E10A 1IB8A 4PL6A 1FMVA 2DXCA 4M7DG 3CC7Q 4PLLA 2RHIA 3MEUA 1BKBA 3V7RA 2EJGA 3CCRA 3E9FA 1ZA2B 1WI7A 4PFZA 3PNWC 1GFCA 2MWOA 2MOXA 1AOJA 1M5Q1 2RNAA 1ZHIA 2VUBA 2KXDA 2V8IA 3CEYA 4J9BA 1YWOA 3PFSA 2LQKA 2Y4XA 4RTYA 1Z9QA 3TREA 1VQPA 1WIEA 3EGXA 1YFNA 1M1KC 1N5ZA 2XHCA 1RI9A 1UECA 2QQRA 4XTVA 3ZBDA 4J8OA 2HAXA 3CBPA 1UHCA 1UE9A 3HRSA 4RG2A 3PMIA 4R55A 2GNCA 5KCOA 4M78E 3V8KA 2RI3A 3JCMd 1YJ9T 3PVQA 3M56A 3RKWA 1FYNA 4KH1B 3QZ5B 4ZN1A 4XU0A 2EYXA 1TTHB 1N9SA 3R6OA 1Q82R 3AHUA 2KI7A 3A1PA 1MHNA 3GP8A 3JCMW 1Y96A 1H641 2COZA 4FW1A 1VQ9A 2DL8A 2GQIA 1UEBA 1WHJA 2YRCA 3CPFA 5LJ5e 1VQMT 2LNHB 1VQ8A 2EIFA 1I8FA 1KK7A 4XTUA 4PJJA 1VQOQ 7AT1B 3M4GA 1I07A 2COWA 2KK4A 1OEBA 3OYMA 5LJ5f 1AWOA 4CI0C 2IVWA 5GANh 3SWNA 1D3BB 4PJOG 1VQLT 4X9DA 2KBTA 3VRYA 2E64A 5GMKm 1QVFP 2O4XB 3OYIA 1AWWA 4B6MA 2EPDA 3REAB 1QVFS 2A3LA 1GXIE 1M90U 2QI2A 1RAFB 4M77E 1G3SA 2LCLA 4L5GA 1IHWA 1WHMA 2ECZA 2RMOA 2J06A 2RQRA 3O5ZA 4JJDA 1E6GA 4J83A 4M75E 2L3SA 2FZKB 3CCEQ 2IIMA 1QWEA 1G83A 4A4EA 5GANj 2QYZA 2D6FA 1NJIC 2FZGB 3CCJQ 1K0SA 5I21A 2DL4A 4M77B 2XG8D 1M3AA 1SRLA 2QEXA 2ZCFB 2DAQA 4ME7A 4Q5WA 4ORZA 2JJ9A 2J6KA 4GY5A 4JRIA 1ABOA 2HSEB 2HKQB 4EIKA 4HCKA 1BK2A 4LUDA 2DIQA 2HQXA 2QGGA 3PIOA 2DERA 4OVAA 2LT1A 3VS5A 8AT1B 1KC8U 1WYXA 2CP2A 1EX4A 3LGLA 1YJ9Q 4JDSA 3HKSA 1QQJA 2R57A 2PTKA 2DETA 2BZYA 1WXUA 2A0FB 1Y07A 1ZSZA 3OSVA 5GAN8 1W6XA 2CDTA 3CQTA 4OMQA 2LC4A 2F69A 5CVIA 4ESRA 1PRLC 5HK3A 2EJFA 1VQKA 2ZAEA 5FWBA 4R0KA 4C92A 1RAAB 2QQBA 2R58A 2CSIA 1VQMQ 3BDLA 1Y7XA 1VQ4A 1B34B 2ZPEB 3JRZA 4C5IA 2ESWA 2CKKA 1KD1R 4Y92A 4M7DA 3UA6A 4C0DB 3I55Q 1JEGA 2QQSA 3OB9A 3EG3A 3EGXB 4HVVA 2FZCB 1UG1A 4JJBA 3SEMA 4FYVB 4X9CA 1UGQB 3CMAT 5GJVB 1WJRA 2X9HA 1N27A 4RCCA 4A4KA 1VQLQ 2JM9A 2MK5A 1MGQA 1E6HA 4NL3A 1KG1A 1N8RU 1I4K1 3DLMA 4RTTA 1VQNQ 4RG8A 2A28A 5LJ5g 4OMLA 2J7IA 2F2VA 5IHKA 1ZUKA 2MPXC 4XQ3A 4M77C 4WF2A 1Y96B 3CXCP 1QVGA 3RIRA 2KR3A 3CXCS 5IXBA 1N9RA 2ZZDA 1Y71A 3KFVA 2L8DA 4IUVA 2LRQA 3RR6A 1NEGA 2EYQA 3OBYA 4OP0A 2V1RA 1K8AR 2JMCA 5GMKi 1MMAA 1TXQA 1PKSA 1WHHA 5IH2A 4J9CA 3X20B 1ABQA 2EGAA 2XDDA 1VYVA 2AKKA 1W2BP 3LGFA 3VU3C 1W2BS 1YI2Q 2L5QA 1JB0E 4FIBA 2LQWA 3FLGA 3NFCA 1ZUYA 2HD0A 3LLRA 3EH2A 4EDUA 1MMDA 3JCMb 3QUIA 4PKCC 1YHQT 2OTLT 2XDPA 4NL2A 3SWNB 1BIBA 3KXTA 2JT4A 3P8BB 2LVMA 5GAN5 4MZPA 2LCSA 2DBKA 3KBGA 2EVRA 2WACA 3HFNA 4IUTA 1Q82U 3C12A 3H6ZA 3L2VA 3PIPA 2FRWA 2ED0A 2KSSA 3EH1A 5FU7B 3S3OA 2K4YA 4BUGA 3MEVA 2K5IA 5GAMh 2DF6A 5ECAA 1M2OA 4J9IA 2C0OA 2JVVA 3VS6A 2DK3A 1AZGB 4PJOA 2DLPA 4C5HA 2M9UA 2C06A 2DVEA 3UPUA 3VV0A 2SEMA 3H8ZA 4N4GA 1YJNT 3HPWA 3BW1A 3JB9G 3VS0A 3CMEA 2PVOB 1KJWA 4JRPA 5LJ5d 2NUPA 3SDZA 1EFNA 5GAMj 2HQEA 1ARKA 3WVEB 2MWPA 5CKFA 4HCBA 3VS4A 3EAEA 2ABLA 1JXOA 3OYKA 2E6ZA 3CPWA 3CMAQ 4F7UA 2FRYA 5IT9E 5HKCA 2LJ0A 1HSQA 4FU6A 2Z0WA 4GBQA 3M59A 4DA4A 4C92E 1ZA1B 4OMMA 3QHSA 5GANe 4A4HA 9ATCB 2RD1A 4HCZA 4JJCA 1YIJT 1ZSZB 3SB2A 2R5AA 1O9SA 2EQKA 3E19A 4M7DE 3H0FA 1BI3A 2DJQA 3CCUT 1BU1A 3P8DA 1S72A 2VYTA 1OOTA 1D09B 1KQ2A 2AIRB 1ZBJA 2F5TX 5J3BA 4C92B 1AEYA 1PCXA 1VA7A 2YWWA 2VVKA 3NTKA 2HKNA 4GLKA 2M1HA 4A4FA 3OYNA 3M55A 2RM4A 5D6YA 4M7DB 1M8MA 2QA4A 3X25B 1LPLA 2DKGA 3OYEA 3I9QA 4R56A 1UB4A 1SSHA 2VC8A 2ZPFB 4Z88A 1G3WA 2O01E 1JU5C 3OS1A 1YHQQ 2OTLQ 3GNFB 1Y57A 2FL7A 1NYGA 2CZ6B 4J9HA 3I5SA 2V26A 3QPHA 1R77A 3M0UA 3LYIA 4J6XA 5IXFA 1Q7YR 2DD5A 4IUUA 1TOVA 3BY7A 4OMNA 3CCSA 2IPOB 4M77D 4BE2A 3ZL7C 1YJNA 1G8XA 3RKXA 4DBHA 3G4ST 3FC3A 4HXJA 3G6EA 1T0HA 2A7YA 1TH7A 4C8QC 2LX7A 1UUEA 1Y0MA 2C0TA 5LJ3h 5GAOp 1O75A 1KD1U 3VRZA 4KGVB 3HTRA 1VQ5T 4RTXA 4C5GA 4FL6A 4JS5A 5CIUA 4ZGDB 4M77F 4JZ4A 1JRIA 5KE2A 1PD0A 1WQWA 1PNJA 5GAN2 2YSQA 2D0NA 1SKUB 1XQHA 4JZ3A 2YLBA 3OS2A 3JAME 4DOWA 1VQ7A 4PJOE 5GJWB 3CC2T 3RNJA 1H3HA 1YWPA 3V8LA 2KE9A 2CT4A 3FIFA 4BE1A 1PHTA 2O9VA 5LJ3j 1NPPA 2GBQA 5CKBA 3CCUA 2QTVA 1WXBA 3M57A 2XD0A 5D7UA 1M90C 2XU8A 2D8JA 3OMCA 1Q81R 4BD3A 3NTIA 1YIJQ 4PJOB 2G6FX 4L59A 2DE0X 4M7DC 1GCPA 4K11A 4FYYB 3CC7A 1K8AU 1RACB 1FXXA 2RHZA 4KGZB 2CUBA 3NHNA 1TWBA 3PE0A 2W0ZA 2E41A 2LDMA 3S6WA 4F7UE 3TSWA 1RI0A 4AMCA 3QYGB 4QKUA 2P0PA 2EYZA 3EGUA 4Z89A 2NUPB 2OTJT 2DPPB 1WPYA 1D1CA 2H3JA 1VQ6T 3CCET 4RCBA 1D1BA 3PT9A 1BI1A 1X01A 2JNGA 3MEAA 3CCJT 3CD6Q 2RH2A 2CZ0B 2EQJA 3QDFA 2RJCA 1B34A 4KUDK 4F7UB 1KC8C 2DBMA 2ZPIB 1ZSGA 4FM4B 2DXBA 4C0GA 2XI9A 3RESA 1MV3A 2PU9B 3A8MB 3LX7A 2KRNA 3LW5E 4QT7A 2EAYA 3DLLA 2A36A 4NS5A 2EFIA 2DXUA 3RMQA 3G4SQ 1SF9A 2FPDA 2B8AA 1ZBXA 4O5VA 3CCMA 5GAMe 1AD5A 4CC7A 1ZX6A 1X2QA 2DO3A 3JB9I 3KUFA 3J7AF 1BB9A 4RTVA 1VQ5Q 2HL5C 3MCAB 3JCMh 1HYOA 3GLXA 2CUDA 1KQSA 3OW2A 5IHIA 1JBMA 3QSUA 5FRNA 2D0QB 1SG5A 3E2UA 1VQOA 3L2UA 1MMGA 2RK2A 3FJ5A 1B3QA 3T9NA 2GF7A 4ZNXA 3JCMc 4PJOC 3CC2Q 1I81A 1OZ3A 3I55T 3JB9J 1N8RC 3BE3A 1RUWA 1W1FA 4PJNA 4E47A 5AYFA 4RTZA 2HL3A 4MDXA 4MMLA 4C8QD 2L3RA 4Y91A 1YITT 4LD6A 1OQKA 3QKJA 5A0DA 3JV3A 3M0PA 2B86A 1YCSB 1VQNT 5M9OA 1WJQA 3OYJA 1OI1A 4LDUA 4KBMB 3M5AA 3CCEA 1WHKA 3A8OB 3BDUA 2MCNA 3E9GA 2PQWA 3G71T 4EMGA 3OQ5A 1TU0B 3X28B 2EYYA 4IKFA 1Q95G 3A8LB 1W4SA 1XOVA 2OTJQ 2XK0A 3VS2A 2VXFA 1VQ6Q 5KH6A 4DBQA 2P84A 3S3MA 3HFOA 3HSBA 1Q7YU 2P4TA 2BKDN 3L2QA 1WGSA 4C8QA 3I56T 1VYUA 2O31A 1YI2T 4C92D 2E12A 1Q82C 3RDVA 1YJ9A 4ZTJA 1BBZA 3LH0A 2CT3A 4M7AG 3CCVQ 4M7DD 3H0HA 3OSSC 1T3SA 2E3HA 2J6OA 4RUGA 5I2SA 3MHXA 1CSKA 1M1GA 1R8OB 2VKNA 4B9XA 1PC0A 3CCQT 2DTOA 3FDRA 5IN1A 4N0AC 2O88A 1AZEA 1F1BB 4J7FA 2P0QA 2L89A 3THKA 5DLOA 3OYAA 1RADB 2QDLA 1QW1A 1X75C 2RO0A 2BE7D 2GGRA 2HSPA 4C92F 1SRMA 1QKXA 2MYSA 2HMAA 1VQMA 5GMKh 1M9SA 5LJ3e 2HDAA 2RJFA 3BFMA 2L3PA 4M7DF 2M51A 2D8HA 1BI0A 3MKDA 2RHXA 4X34A 3PTAA 2RHYA 2HEQA 3H0IA 5CK9A 2QAZA 3PGGA 4LNPA 2LT4A 2K3XA 1MMNA 4HT8A 2DRMA 2LX9A 3EG9B 1P92A 2FPFA 4PNOA 5IAYA 2PVGB 2RQTA 2RQUA 1RLQC 2GFUA 3X26B 4M78G 1VQLA 2CREA 1Q81U 3HP9A 3MP6A 2BUDA 3CBOA 5GAOm 1EIFA 5GMKj 2AKLA 1KQ1A 3EHQA 2VGNA 3LWIA 4F17A 1YITQ 1QVFA 1I1JA 1K9MR 5CR2A 3AT1B 4RTUA 3VYGA 1YNZA 5GAOr 1WFWA 1VQKQ 4DQ2A 4ZGEB 4J9GA 2HNIA 2LZ6B 1X6OA 2JTEA 1YJWT 3QG1A 1VQ4Q 3WVDB 2YUOA 2EQMA 2JMAA 1IO6A 3G71Q 4C5EA 3GOXA 1QP2A 2F2XA 1R0BG 4XTYA 2CYZB 1PWTA 3X24B 1Q86R 1UDLA 2KMTA 2KVQG 2A37A 4PJOD 2BZXA 2YXYA 5L23A 3U23A 1NPRA 1V29B 1K73R 2CP7A 2BTTA 2EQUA 3I56Q 4HKEA 1PM3A 3CC4T 4KUIA 2DILA 1RAEB 1UGSB 2CP0A 3ME9A 3SD4A 4F16A 4D8DA 3QYHB 3A98A 4AG1C 1MUZA 3QIIA 2XKOC 3MP8A 5HK0A 1M3BA 2X35A 5C6SA 1V76A 4PJOF 3CCQQ 3QZ9B 5C0MA 5HCKA 3EG2A 1I0CA 1NM7A 4M75G 1KD1C 2QK0A 2WSCE 2SRCA 2XIDA 2X4WA 3VYHB 2MIOA 1BYMA 5FW9A 4ZTFA 1IREB 4C8QE 1BCOA 1DJ7B 1G2BA 3GNGA 2DM1A 1TUDA 2YRVA 2KGTA 1QCNA 4AFSC 1CKBA 1IGUA 1GRIA 1I5OB 5DY9A 4PJLA 1YP5A 3EFOA 5J39A 2HBWA 5KYNA 4AFQC 3EG1A 1WHLA 1NLPC 4TVRA 2K5LA 4C8QB 3DKMA 3CMAA 4BDYA 4F7UF 1MV0B 1OYXA 2RHUA 4QQDA 1GFDA 5FRMA 3HL8A 3M0SA 3FB9A 1X2KA 2L0AA 4MZTA 4PJMA 2CGHA 4A53A 3EGDA 1S1NA 1OU9A 4QVZA 1YN8A 4Z8AA 5LJ5h 2Y4YA 2DZ9A 2QDYB 4ZGJB 4A4GA 4BI4A 2EKHA 2VGMA 1K8AC 4ANJA 5FWCA 3L2RA 1YBYA 1RAIB 3LWHA 1PKTA 1K1ZA 1JJ2P 3MJXA 4LUEA 1YJWQ 3TSZA 2M16A 2NWMA 2OI3A 3ULRB 1JJ2S 2HQHA 2LP5A 2K2VA 3NMZC 3CXCA 3JCMP 2XICA 4FYXB 2LJ1A 3GIBA 1H92A 2E70A 2JS0A 3VS3A 2X4JA 3GF5A 4EMHA 5GANf 1RL2A 2DTHA 5LJ5j 1I5LA 4JPBW 2JXBA 4EMKC 3OBWA 1W2BA 4KULA 2COYA 1YHQA 2OTLA 2JS2A 4MZMA 4N0AA 2VWFA 4KH0B 4FSSA 5D6WA 3PVLA 4XU2A 4CC2A 3CC4Q 4PFOA 4D6WA 2ZPHB 3CCLT 2DJZA 3CD6T 1SHGA 2ZGWA 2DVJA 1JQQA 2E4HA 4XTZA 2YUQA 3TU4K 2LQ8A 5FU6B 3URGA 1M3CA 3M53A 5CKEA 4M78A 4FYWB 4L6V5 3O8VA 4J7IA 2V1QA 1M1FA 4M4ZA 3ZFJA 4DBFA 2OJ2A 1K76A 2J05A 1GCQC 1R0CB 3RKYA 1G3TA 5KYUA 3CCRT 2DZCA 3OYGA 2X3WD 1ZQ1A 1UJ0A 2DL7A 2ATCB 3EFSA 3INZA 2FVUA 3MP1A 3UATA 4ELYC 5GMKe 1VYTA 1UGPB 1FX7A 2E5KA 5I2MA 3UDCA 3J81E 4AT1B 2RPNA 1VQPT 2DA9A 2YRDA 4PLIA 4FT2A 3E1SA 2K79A 5KYXA 1K9MU 4QVDA 2PUKB 1D0ZA 3M0RA 1M4ZA 2HCKA 3OS5A 5FROA 2DEUA 1TUCA 3L2WA 2CP6A 4E7IA 2F5KA 3WXMB 2WSEE 1M1KR 3V7SA 4C0ZA 1YIJA 2EQIA 1XNIA 1K9AA 5DLQE 1IGQA 1NLOC 2JTMA 3JB9D 3R6NA 1OU8A 2AK5A 1PSFA 3SHWA 3NGPA 1VQ9T 2G3RA 4BI8B 2X51A 1Q86U 4E2FB 2Y90A 4M75A 1K73U 2JOYA 1VQ8T 4LD9K 4FW2A 1PRMC 2EGEA 3QWYA 3UT1A 1U1SA 3JCMQ 2I0NA 1Q7YC 1M27C 5GAOq 3EFOB 3JB9F 3N5BB 5CKHA 2L2PA 4F14A 4BACA 5FU6C 3QJ6A 1X69A 1HJDA 2H3EB 3M0TA 4E7LA 4IURA 4E7ZA 3A8GB 1RABB 4DBRA 4E7KA 1QCOA 2E65A 5GANg 2C0IA 2LQNA 3CCLQ 1XJWB 4JJNK 4DEXA 1T3LA 3EGDB 2CZ7B 1LOJA 3QDRB 4OGEA 3EG9A 1UFFA 1U8RA 1ACMB 2KNBB 2NUTA 3META 2W10A 5GAN4 3G4SA 1X27A 4GLMA 1LJOA 2DYIA 4M7AB 3CCVT 1OPKA 2BE9B 2F1LA 5FLXE 4OGCA 2CP3A 3C95A 1VQ5A 2DL3A 2RN8A 3CCRQ 2F2WA 2HZYA 4ELZC 1UGRB 1K4US 3V8JA 1UTIA 1QMCA 2ROTA 1D1AA 3JCMJ 2VXEA 3C4SA 2KAFA 2K3YA 2QEXT 2PUOB 1QWFA 1SEMA 3M4YA 2X4YA 1KFZA 1VIFA 1N6AA 2A08A 4J9FA 3RBBB 2E3IA 4QVCA 2PVDB 1YCYA 3ZEHA 5CCAA 1NJIR 3CC2A 1WZOA 1VQPQ 1Q81C 1FWZA 5HY6A 1PG5B 5GAMf 2QQ9A 4J6WA 4MMKA 4OF1A 5I11A 4JLGA 2RK1A 5KYWA 1PD1A 2DFUA 1WNLA 3H9NA 4NOYA 4J9EA 1LNXA 3EFRA 4OB3B 5GMKl 2L3QA 4BY6C 3CCMQ 2KROA 4M78B 4E6RA 2KT8A 4AG2C 3SFMA 2KY9A 2LNVA 2DMOA 2X3XD 4LDXA 5L8RE 1Z9ZA 1BIAA 1OX9A 1OPLA 1BCMA 4EMKA 5KYUB
chains in the Genus database with same CATH topology
1I1JA 2FRYA 2DX1A 4RTUA 1KIKA 4HVUA 1YNZA 1WFWA 2LJ0A 1HSQA 3QWXX 4GBQA 2EBPA 4J9GA 1NYFA 1ZLMA 2LZ6B 2ROLA 4OMMA 2JTEA 2JW4A 2RF0A 4LN2A 4JJCA 2YUOA 2JMAA 2YDLA 1IO6A 2FG0A 1RLPC 3H0FA 2DJQA 1JXMA 1BU1A 3LH5A 1AVZC 1X43A 1OOTA 2F2XA 1AWXA 3REBB 1UGVA 1ZBJA 1PWTA 4AFZC 2YUNA 1AEYA 1UDLA 1GCQA 2A37A 1VA7A 2BZXA 5L23A 1X6GA 3U23A 2KRSA 2VVKA 3UA7A 1M8MA 2H8HA 3H41A 2BTTA 1SPKA 1NG2A 2DILA 3I9QA 2CSQA 1WI7A 1SSHA 1GFCA 4F16A 4D8DA 2MOXA 4Z88A 1AOJA 1V1CA 1JU5C 3A98A 2NUZA 2KRMA 2RNAA 4AG1C 1MUZA 2KEAA 2KXDA 1HD3A 1Y57A 1M3BA 4J9BA 1NYGA 4J9HA 3I5SA 1YWOA 1GBRA 3M0UA 4LE9A 4RTYA 5IXFA 1Z9QA 4RTWA 5HCKA 3EG2A 1I0CA 1WIEA 1NM7A 4OMNA 1ZUUA 2SRCA 1N5ZA 1RI9A 1UECA 1OV3A 3VS1A 3ZL7C 2MIOA 1UHCA 1UE9A 5FW9A 2GNCA 4HXJA 1T0HA 1G2BA 3PVQA 2LX7A 1UUEA 1Y0MA 1FYNA 2C0TA 2DM1A 1TUDA 2KYBA 2GTOA 2KGTA 3VRZA 4AFSC 1CKAA 2EYXA 1CKBA 1GRIA 2K6DA 2JM8A 4RTXA 1YP5A 4OMPA 2J6FA 2HBWA 4AFQC 3EG1A 1NLPC 2LMJA 1MV0B 4JZ4A 2DL8A 2GQIA 1GFDA 2KYMA 3M0SA 1WXTA 1NEBA 1PNJA 1X2KA 2L0AA 2YSQA 2D0NA 2K2MA 2LNHB 4JZ3A 1S1NA 1YN8A 4Z8AA 5GJWB 3RNJA 1H3HA 1YWPA 2KE9A 2CT4A 2OAWA 2EKHA 1PHTA 2O9VA 2GBQA 4A63B 1I07A 5FWCA 3UF4A 2FEIA 1WXBA 1PKTA 1K1ZA 1OEBA 4WCIA 1AWOA 3I5RA 2D8JA 4LUEA 3C0CA 3TSZA 2NWMA 4AFUC 2OI3A 3ULRB 2LP5A 2KBTA 3NMZC 2G6FX 3VRYA 2DE0X 2O9SA 1GCPA 4K11A 1AWWA 3EG0A 2EPDA 2LJ1A 4IIOA 3REAB 1H92A 2JS0A 3VS3A 2FO0A 2CUBA 3NHNA 3PE0A 4JPBW 2W0ZA 2JXBA 3TSWA 1H8KA 2ECZA 2RMOA 1WA7A 3NPFA 2J06A 2JS2A 2EW3A 2RQRA 2VWFA 3GBQA 3O5ZA 4JJDA 4CC4B 1LCKA 2EYZA 3EGUA 1E6GA 4FSSA 4Z89A 3PVLA 4OMOA 4CC2A 4KRTA 2L3SA 2IIMA 1QWEA 1G83A 1SHGA 2DVJA 1K0SA 1JQQA 2YUQA 2DL4A 1UJYA 3I35A 2FPEA 1M3AA 1SRLA 2DBMA 1M3CA 1ZSGA 1MV3A 1JO8A 4ORZA 2LJ3A 2J6KA 2KRNA 1T0JA 2ED1A 2V1QA 4HVWA 3M0QA 1J3TA 1ABOA 4QT7A 4M4ZA 4EIKA 2A36A 4HCKA 1BK2A 2OJ2A 4LUDA 1K76A 2J05A 1GCQC 3VS5A 2D1XA 2X3WD 2FPDA 1QKWA 1WYXA 1X6BA 1UJ0A 2DL7A 4IIMA 1WLPB 2PTKA 2BZYA 1AD5A 4CC7A 1ZX6A 3EHRA 1X2QA 3UATA 1VYTA 2GTJA 1WXUA 1GBQA 1BB9A 4RTVA 2E5KA 2K7AA 1GL5A 1W6XA 2CDTA 2CUDA 3CQTA 4OMQA 5IHIA 1A0NB 2RPNA 2DA9A 4ESRA 1PRLC 2K79A 2PZ1A 5FWBA 2DRKA 2XMFA 4R0KA 1AWJA 3M0RA 3VS7A 2HCKA 2ENMA 1TUCA 1QCFA 2CSIA 3FJ5A 1B3QA 2BZ8A 5IHNA 2KXCA 2O2OA 2ESWA 4ZNXA 4Y92A 3UA6A 2EQIA 1RUWA 1W70A 1W1FA 1K9AA 1JEGA 4J9DA 1NLOC 3EG3A 3R6NA 2AK5A 4HVVA 2YUPA 1UG1A 4JJBA 4RTZA 3SEMA 3SHWA 2K9GA 1E7OA 2DNUA 5GJVB 3NGPA 1SHFA 2CH4A 2YT6A 2JM9A 3JV3A 1WX6A 3M0PA 1E6HA 2B86A 1YCSB 4RTTA 1WDXA 1KSWA 2A28A 1PRMC 4OMLA 2EGEA 1TG0A 2J7IA 2F2VA 3QWYA 2MCNA 2I0NA 5IHKA 1M27C 1ZUKA 2DL5A 2L2PA 4F14A 1FMKA 2EYYA 1X69A 1HJDA 3M0TA 1XOVA 2KR3A 3VS2A 5IXBA 3KFVA 2C0IA 2LQNA 4DEXA 1NEGA 1T3LA 2V1RA 2JMCA 1UFFA 1PKSA 5IH2A 2KNBB 4J9CA 1ABQA 2EGAA 1VYUA 1VYVA 2AKKA 2W10A 2O31A 1X27A 4GLMA 1U3OA 2LQWA 1BBZA 1ZUYA 2CT3A 1QLYA 2AZSA 1OPKA 3H0HA 1T3SA 2J6OA 4RUGA 1B07A 2DL3A 3TVTA 1CSKA 5I22A 2VKNA 2JT4A 2RN8A 2F2WA 2LCSA 2DBKA 2EGCA 2M0YA 2EVRA 2O88A 1AZEA 1K4US 1UTIA 2ROTA 3IQLA 3THKA 2QDLA 2FRWA 2ED0A 2GGRA 2RQVA 2HSPA 1SRMA 2DF6A 1QWFA 1QKXA 1SEMA 5ECAA 1KFZA 4J9IA 2C0OA 3VS6A 2A08A 1AZGB 4J9FA 3RBBB 2DLPA 2HDAA 2L3PA 2M51A 2D8HA 2HEQA 3H0IA 2EYWA 2SEMA 4CC3A 1U06A 4LNPA 5I11A 2RQWA 3VS0A 2DRMA 4J9EA 1KJWA 5EC7A 2FPFA 2P4RA 2KT1A 2L3QA 2CH4W 1UHFA 2AZVA 2KROA 2RQTA 2RQUA 1RLQC 2CREA 2K3BA 4E6RA 1EFNA 2KT8A 4AG2C 4DEYA 4X1VA 2PNIA 2DMOA 1ARKA 1M30A 2X3XD 1K0XA 2AKLA 1Z9ZA 3VS4A 1OPLA 3EHQA 2DYBA 2ABLA 1JXOA 4F17A 4D8KA 1U5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1J A;  2FRY A;  2DX1 A;  4RTU A;  1KIK A;  4HVU A;  1YNZ A;  1WFW A;  2LJ0 A;  1HSQ A;  3QWX X;  4GBQ A;  2EBP A;  4J9G A;  1NYF A;  1ZLM A;  2LZ6 B;  2ROL A;  4OMM A;  2JTE A;  2JW4 A;  2RF0 A;  4LN2 A;  4JJC A;  2YUO A;  2JMA A;  2YDL A;  1IO6 A;  2FG0 A;  1RLP C;  3H0F A;  2DJQ A;  1JXM A;  1BU1 A;  3LH5 A;  1AVZ C;  1X43 A;  1OOT A;  2F2X A;  1AWX A;  3REB B;  1UGV A;  1ZBJ A;  1PWT A;  4AFZ C;  2YUN A;  1AEY A;  1UDL A;  1GCQ A;  2A37 A;  1VA7 A;  2BZX A;  5L23 A;  1X6G A;  3U23 A;  2KRS A;  2VVK A;  3UA7 A;  1M8M A;  2H8H A;  3H41 A;  2BTT A;  1SPK A;  1NG2 A;  2DIL A;  3I9Q A;  2CSQ A;  1WI7 A;  1SSH A;  1GFC A;  4F16 A;  4D8D A;  2MOX A;  4Z88 A;  1AOJ A;  1V1C A;  1JU5 C;  3A98 A;  2NUZ A;  2KRM A;  2RNA A;  4AG1 C;  1MUZ A;  2KEA A;  2KXD A;  1HD3 A;  1Y57 A;  1M3B A;  4J9B A;  1NYG A;  4J9H A;  3I5S A;  1YWO A;  1GBR A;  3M0U A;  4LE9 A;  4RTY A;  5IXF A;  1Z9Q A;  4RTW A;  5HCK A;  3EG2 A;  1I0C A;  1WIE A;  1NM7 A;  4OMN A;  1ZUU A;  2SRC A;  1N5Z A;  1RI9 A;  1UEC A;  1OV3 A;  3VS1 A;  3ZL7 C;  2MIO A;  1UHC A;  1UE9 A;  5FW9 A;  2GNC A;  4HXJ A;  1T0H A;  1G2B A;  3PVQ A;  2LX7 A;  1UUE A;  1Y0M A;  1FYN A;  2C0T A;  2DM1 A;  1TUD A;  2KYB A;  2GTO A;  2KGT A;  3VRZ A;  4AFS C;  1CKA A;  2EYX A;  1CKB A;  1GRI A;  2K6D A;  2JM8 A;  4RTX A;  1YP5 A;  4OMP A;  2J6F A;  2HBW A;  4AFQ C;  3EG1 A;  1NLP C;  2LMJ A;  1MV0 B;  4JZ4 A;  2DL8 A;  2GQI A;  1GFD A;  2KYM A;  3M0S A;  1WXT A;  1NEB A;  1PNJ A;  1X2K A;  2L0A A;  2YSQ A;  2D0N A;  2K2M A;  2LNH B;  4JZ3 A;  1S1N A;  1YN8 A;  4Z8A A;  5GJW B;  3RNJ A;  1H3H A;  1YWP A;  2KE9 A;  2CT4 A;  2OAW A;  2EKH A;  1PHT A;  2O9V A;  2GBQ A;  4A63 B;  1I07 A;  5FWC A;  3UF4 A;  2FEI A;  1WXB A;  1PKT A;  1K1Z A;  1OEB A;  4WCI A;  1AWO A;  3I5R A;  2D8J A;  4LUE A;  3C0C A;  3TSZ A;  2NWM A;  4AFU C;  2OI3 A;  3ULR B;  2LP5 A;  2KBT A;  3NMZ C;  2G6F X;  3VRY A;  2DE0 X;  2O9S A;  1GCP A;  4K11 A;  1AWW A;  3EG0 A;  2EPD A;  2LJ1 A;  4IIO A;  3REA B;  1H92 A;  2JS0 A;  3VS3 A;  2FO0 A;  2CUB A;  3NHN A;  3PE0 A;  4JPB W;  2W0Z A;  2JXB A;  3TSW A;  1H8K A;  2ECZ A;  2RMO A;  1WA7 A;  3NPF A;  2J06 A;  2JS2 A;  2EW3 A;  2RQR A;  2VWF A;  3GBQ A;  3O5Z A;  4JJD A;  4CC4 B;  1LCK A;  2EYZ A;  3EGU A;  1E6G A;  4FSS A;  4Z89 A;  3PVL A;  4OMO A;  4CC2 A;  4KRT A;  2L3S A;  2IIM A;  1QWE A;  1G83 A;  1SHG A;  2DVJ A;  1K0S A;  1JQQ A;  2YUQ A;  2DL4 A;  1UJY A;  3I35 A;  2FPE A;  1M3A A;  1SRL A;  2DBM A;  1M3C A;  1ZSG A;  1MV3 A;  1JO8 A;  4ORZ A;  2LJ3 A;  2J6K A;  2KRN A;  1T0J A;  2ED1 A;  2V1Q A;  4HVW A;  3M0Q A;  1J3T A;  1ABO A;  4QT7 A;  4M4Z A;  4EIK A;  2A36 A;  4HCK A;  1BK2 A;  2OJ2 A;  4LUD A;  1K76 A;  2J05 A;  1GCQ C;  3VS5 A;  2D1X A;  2X3W D;  2FPD A;  1QKW A;  1WYX A;  1X6B A;  1UJ0 A;  2DL7 A;  4IIM A;  1WLP B;  2PTK A;  2BZY A;  1AD5 A;  4CC7 A;  1ZX6 A;  3EHR A;  1X2Q A;  3UAT A;  1VYT A;  2GTJ A;  1WXU A;  1GBQ A;  1BB9 A;  4RTV A;  2E5K A;  2K7A A;  1GL5 A;  1W6X A;  2CDT A;  2CUD A;  3CQT A;  4OMQ A;  5IHI A;  1A0N B;  2RPN A;  2DA9 A;  4ESR A;  1PRL C;  2K79 A;  2PZ1 A;  5FWB A;  2DRK A;  2XMF A;  4R0K A;  1AWJ A;  3M0R A;  3VS7 A;  2HCK A;  2ENM A;  1TUC A;  1QCF A;  2CSI A;  3FJ5 A;  1B3Q A;  2BZ8 A;  5IHN A;  2KXC A;  2O2O A;  2ESW A;  4ZNX A;  4Y92 A;  3UA6 A;  2EQI A;  1RUW A;  1W70 A;  1W1F A;  1K9A A;  1JEG A;  4J9D A;  1NLO C;  3EG3 A;  3R6N A;  2AK5 A;  4HVV A;  2YUP A;  1UG1 A;  4JJB A;  4RTZ A;  3SEM A;  3SHW A;  2K9G A;  1E7O A;  2DNU A;  5GJV B;  3NGP A;  1SHF A;  2CH4 A;  2YT6 A;  2JM9 A;  3JV3 A;  1WX6 A;  3M0P A;  1E6H A;  2B86 A;  1YCS B;  4RTT A;  1WDX A;  1KSW A;  2A28 A;  1PRM C;  4OML A;  2EGE A;  1TG0 A;  2J7I A;  2F2V A;  3QWY A;  2MCN A;  2I0N A;  5IHK A;  1M27 C;  1ZUK A;  2DL5 A;  2L2P A;  4F14 A;  1FMK A;  2EYY A;  1X69 A;  1HJD A;  3M0T A;  1XOV A;  2KR3 A;  3VS2 A;  5IXB A;  3KFV A;  2C0I A;  2LQN A;  4DEX A;  1NEG A;  1T3L A;  2V1R A;  2JMC A;  1UFF A;  1PKS A;  5IH2 A;  2KNB B;  4J9C A;  1ABQ A;  2EGA A;  1VYU A;  1VYV A;  2AKK A;  2W10 A;  2O31 A;  1X27 A;  4GLM A;  1U3O A;  2LQW A;  1BBZ A;  1ZUY A;  2CT3 A;  1QLY A;  2AZS A;  1OPK A;  3H0H A;  1T3S A;  2J6O A;  4RUG A;  1B07 A;  2DL3 A;  3TVT A;  1CSK A;  5I22 A;  2VKN A;  2JT4 A;  2RN8 A;  2F2W A;  2LCS A;  2DBK A;  2EGC A;  2M0Y A;  2EVR A;  2O88 A;  1AZE A;  1K4U S;  1UTI A;  2ROT A;  3IQL A;  3THK A;  2QDL A;  2FRW A;  2ED0 A;  2GGR A;  2RQV A;  2HSP A;  1SRM A;  2DF6 A;  1QWF A;  1QKX A;  1SEM A;  5ECA A;  1KFZ A;  4J9I A;  2C0O A;  3VS6 A;  2A08 A;  1AZG B;  4J9F A;  3RBB B;  2DLP A;  2HDA A;  2L3P A;  2M51 A;  2D8H A;  2HEQ A;  3H0I A;  2EYW A;  2SEM A;  4CC3 A;  1U06 A;  4LNP A;  5I11 A;  2RQW A;  3VS0 A;  2DRM A;  4J9E A;  1KJW A;  5EC7 A;  2FPF A;  2P4R A;  2KT1 A;  2L3Q A;  2CH4 W;  1UHF A;  2AZV A;  2KRO A;  2RQT A;  2RQU A;  1RLQ C;  2CRE A;  2K3B A;  4E6R A;  1EFN A;  2KT8 A;  4AG2 C;  4DEY A;  4X1V A;  2PNI A;  2DMO A;  1ARK A;  1M30 A;  2X3X D;  1K0X A;  2AKL A;  1Z9Z A;  3VS4 A;  1OPL A;  3EHQ A;  2DYB A;  2ABL A;  1JXO A;  4F17 A;  4D8K A;  1U5S A; 
#chains in the Genus database with same CATH topology
 2DTI A;  1VQ9 Q;  2DX1 A;  1VQK T;  4HVU A;  5GAN d;  3QWX X;  2M02 A;  4BE0 A;  1NYF A;  1MND A;  1ZLM A;  3L2Z A;  2OTJ A;  1VQ8 Q;  3QXE B;  1VQ6 A;  1VQ4 T;  4MDW A;  2RI5 A;  2JW4 A;  2OAU A;  3CCJ A;  2YDL A;  1JXM A;  1QP3 A;  3LH5 A;  2VV5 A;  5GAN 3;  4C8Q F;  1AWX A;  3REB B;  2R5M A;  1TUG B;  5KYX B;  4HCC A;  3RUX A;  1GCQ A;  4M7A C;  2KRS A;  1WHG A;  3F70 A;  3A5Z B;  5KE3 A;  3CCV A;  3P8H A;  3FRN A;  3UA7 A;  3G1J A;  4KT0 E;  4JS4 A;  2H8H A;  3H41 A;  1SPK A;  1NG2 A;  3OYC A;  2JN0 A;  1QVG P;  5GAN 6;  2CSQ A;  1TS9 A;  1QVG S;  1FMW A;  2RJD A;  1V1C A;  2NUZ A;  2KRM A;  4PK4 A;  2KEA A;  2KQW A;  4F7U G;  1HD3 A;  1KHC A;  2DD4 A;  1GBR A;  4LE9 A;  4E7H A;  4RTW A;  4ATO A;  4M75 B;  4J6Y A;  2EJ9 A;  2X4X A;  1U1T A;  1ZUU A;  4XAX B;  2D9T A;  2MI6 A;  1OV3 A;  4LXC A;  3VS1 A;  2YHT A;  4FT4 A;  2QEX Q;  4A54 A;  2ZPG B;  2E5Q A;  2YLC A;  4OB0 B;  4M78 C;  3I55 A;  2KYB A;  5GAO l;  2GTO A;  5KYY A;  2M0O A;  1M1K U;  4XTX A;  4LDW A;  1CKA A;  5EG2 A;  2K6D A;  2JM8 A;  4BI3 A;  4OMP A;  4IUP A;  2J6F A;  2AT1 B;  2NUT B;  1YIT A;  5LJ3 f;  2LMJ A;  2XDB A;  2AHJ B;  4OB2 B;  1OUL A;  2QTX A;  3MEW A;  2V8J A;  5GAM g;  2K57 A;  2KYM A;  1WXT A;  1NEB A;  3OYY A;  1VQN A;  4V2S A;  2K2M A;  3HHT B;  3QO3 A;  4XU3 A;  3VUZ A;  3DB4 A;  1M8V A;  2JZ2 A;  3G71 A;  1H3Z A;  2OAW A;  4OB1 B;  4HT9 A;  3M58 A;  4A63 B;  3UF4 A;  2FEI A;  4XK8 E;  3OYD A;  3CME T;  3QJY A;  4WCI A;  3GPL A;  3I5R A;  2EWN A;  3C0C A;  1M2V A;  3OY9 A;  4AFU C;  3JCM V;  3L42 A;  2QGF B;  2CP5 A;  3CPW P;  2O9S A;  5CQX A;  3EG0 A;  3CPW S;  4IIO A;  5GAO n;  3TQ7 P;  3I56 A;  5CKD A;  1YI2 A;  3JCM X;  1MNE A;  2E1H A;  4JRQ A;  2FO0 A;  5KYW B;  2QG9 B;  1H8K A;  3FJP A;  1WA7 A;  3NPF A;  2EW3 A;  3GBQ A;  4CC4 B;  4KGX B;  1LCK A;  1C6V X;  2DIG A;  4UC4 A;  3CCQ A;  4OMO A;  2RJE A;  4J5Y A;  4KRT A;  4LDV A;  4M75 C;  4JRK A;  1BI2 A;  1S72 T;  4M77 G;  1UJY A;  3I35 A;  4EMK B;  2FPE A;  4QW2 A;  3JSC A;  2ZPB B;  1OX8 A;  2RA2 A;  3C94 A;  2BIV A;  3J80 E;  4C0F A;  1JO8 A;  2LJ3 A;  4FCY A;  1SSF A;  1T0J A;  2ED1 A;  4HVW A;  3RER A;  1TSF A;  3M0Q A;  1J3T A;  5CO7 A;  3TEE A;  1NJI U;  2QA4 T;  4LDY A;  2GFA A;  5GAM d;  1LVK A;  2D1X A;  1QKW A;  1X6B A;  4IIM A;  4Z02 A;  4XU1 A;  1WLP B;  4M7A D;  2FB7 A;  2VAS A;  1K9M C;  3EHR A;  3JCM e;  5DM7 R;  4JLI A;  1EZZ B;  6AT1 B;  2GTJ A;  1GBQ A;  2K7A A;  3VJP A;  1GL5 A;  4CRI A;  3Q1J A;  2FYK A;  1A0N B;  1B7T A;  4IUQ A;  5KCH A;  4C0D C;  3CCS T;  2WSF E;  1WQ7 A;  2PZ1 A;  2DRK A;  2XMF A;  1AHJ B;  3JCM f;  1AWJ A;  3VS7 A;  2GQV A;  2ENM A;  3OYH A;  4P5N A;  1QCF A;  4M7A F;  2BZ8 A;  5IHN A;  3G6E T;  1YJW A;  2KXC A;  2O2O A;  3OS0 A;  4PFP A;  3JB9 H;  1Q86 C;  5LJ3 g;  1IHV A;  1W70 A;  4BB7 A;  4J9D A;  3G7Z A;  1K73 C;  2FHD A;  4QQG A;  3M9Q A;  2IG0 A;  2YUP A;  3NTH A;  4M7A A;  3CME Q;  2K9G A;  1E7O A;  2DNU A;  4E7J A;  1SHF A;  2CH4 A;  4M78 D;  4E7S A;  2YT6 A;  4ZN3 A;  4RMO A;  1NZ9 A;  1WX6 A;  3TCJ A;  3ASK A;  4EPC A;  2LCC A;  8ATC B;  4XTW A;  4WTO B;  1WDX A;  2GCX A;  1KSW A;  5KYY B;  3CC4 A;  3M54 A;  1VQ7 T;  1G5V A;  1TG0 A;  2EKO A;  1HXD A;  2HBP A;  1VIE A;  2DL5 A;  1IRX A;  4YTL A;  1FMK A;  5LL6 S;  3VKI A;  2KDS A;  4M78 F;  5GAN 7;  4OMF B;  2OX7 A;  2MF2 A;  4RKU E;  3HRU A;  1D0Y A;  1S72 Q;  3OA6 A;  3CC7 T;  4O6J A;  3SWN C;  4FSX A;  1M90 R;  4F04 B;  1PSE A;  1U3O A;  5A2Q E;  3S3N A;  2VB6 A;  3D7S B;  1QLY A;  2AZS A;  5FU7 C;  5A0G A;  1M2V B;  1B07 A;  4II1 A;  3TVT A;  4QQ6 A;  5I22 A;  3UWN A;  2QA4 Q;  2K5F A;  4N4H A;  2EGC A;  2M0Y A;  1RAG B;  3IQL A;  4DOV A;  1IZ6 A;  1VUB A;  3L1A A;  1WJS A;  1KHI A;  4N4I A;  5AT1 B;  2RQV A;  1RAH B;  5LJ3 d;  1D3B A;  2DXT A;  3DB3 A;  2MAM A;  2QAS A;  2QQA A;  1AT1 B;  4M75 D;  2O4X A;  3A8H B;  3HRT A;  3CCS Q;  1OZ2 A;  2LTO A;  2EYW A;  3OMG A;  4CC3 A;  1U06 A;  1KC8 R;  2JUF A;  2RQW A;  2P0K A;  1HK9 A;  1YJN Q;  4JUV A;  1XTD A;  1NE8 A;  5CAI A;  5D6X A;  5EC7 A;  2P4R A;  2KT1 A;  3CBM A;  3OYL A;  3G6E Q;  3CCM T;  2CH4 W;  1UHF A;  1C1A A;  2AZV A;  4C8Q G;  1KQS P;  1IXD A;  3OW2 P;  3OYF A;  1KQS S;  2K3B A;  3OW2 S;  2RB6 A;  3V7C A;  4DEY A;  4X1V A;  3JCM g;  2PNI A;  1JJ2 A;  1M30 A;  4M75 F;  1K0X A;  3MO8 A;  4Y28 E;  1D0X A;  4M77 A;  2DYB A;  1VOM A;  3RMS A;  5CQY A;  4D8K A;  2RI2 A;  1U5S A;  1ZSZ C;  3ER0 A;  4BY6 B;  2V8K A;  1NBE B;  2I2L A;  1KIK A;  3FEO A;  2DEQ A;  4B9W A;  1VQO T;  3OYB A;  2EBP A;  2MMP A;  4BDZ A;  2ROL A;  5J26 A;  4C92 C;  2RF0 A;  1VQ7 Q;  5A0L A;  4LN2 A;  3CCL A;  1QVP A;  3CD6 A;  3QBY A;  2FG0 A;  4VUB A;  1RLP C;  3VUB A;  1G3Y A;  3MPU B;  1C0M A;  3CCU Q;  2CZ1 B;  1AVZ C;  1X43 A;  2CS7 A;  2QXF A;  3PMT A;  1UGV A;  2JTF A;  4AFZ C;  4C92 G;  4M7A E;  2YUN A;  2NYS A;  2E6N A;  1N8R R;  1X6G A;  2NLU A;  4HA8 A;  2E10 A;  1IB8 A;  4PL6 A;  1FMV A;  2DXC A;  4M7D G;  3CC7 Q;  4PLL A;  2RHI A;  3MEU A;  1BKB A;  3V7R A;  2EJG A;  3CCR A;  3E9F A;  1ZA2 B;  1WI7 A;  4PFZ A;  3PNW C;  1GFC A;  2MWO A;  2MOX A;  1AOJ A;  1M5Q 1;  2RNA A;  1ZHI A;  2VUB A;  2KXD A;  2V8I A;  3CEY A;  4J9B A;  1YWO A;  3PFS A;  2LQK A;  2Y4X A;  4RTY A;  1Z9Q A;  3TRE A;  1VQP A;  1WIE A;  3EGX A;  1YFN A;  1M1K C;  1N5Z A;  2XHC A;  1RI9 A;  1UEC A;  2QQR A;  4XTV A;  3ZBD A;  4J8O A;  2HAX A;  3CBP A;  1UHC A;  1UE9 A;  3HRS A;  4RG2 A;  3PMI A;  4R55 A;  2GNC A;  5KCO A;  4M78 E;  3V8K A;  2RI3 A;  3JCM d;  1YJ9 T;  3PVQ A;  3M56 A;  3RKW A;  1FYN A;  4KH1 B;  3QZ5 B;  4ZN1 A;  4XU0 A;  2EYX A;  1TTH B;  1N9S A;  3R6O A;  1Q82 R;  3AHU A;  2KI7 A;  3A1P A;  1MHN A;  3GP8 A;  3JCM W;  1Y96 A;  1H64 1;  2COZ A;  4FW1 A;  1VQ9 A;  2DL8 A;  2GQI A;  1UEB A;  1WHJ A;  2YRC A;  3CPF A;  5LJ5 e;  1VQM T;  2LNH B;  1VQ8 A;  2EIF A;  1I8F A;  1KK7 A;  4XTU A;  4PJJ A;  1VQO Q;  7AT1 B;  3M4G A;  1I07 A;  2COW A;  2KK4 A;  1OEB A;  3OYM A;  5LJ5 f;  1AWO A;  4CI0 C;  2IVW A;  5GAN h;  3SWN A;  1D3B B;  4PJO G;  1VQL T;  4X9D A;  2KBT A;  3VRY A;  2E64 A;  5GMK m;  1QVF P;  2O4X B;  3OYI A;  1AWW A;  4B6M A;  2EPD A;  3REA B;  1QVF S;  2A3L A;  1GXI E;  1M90 U;  2QI2 A;  1RAF B;  4M77 E;  1G3S A;  2LCL A;  4L5G A;  1IHW A;  1WHM A;  2ECZ A;  2RMO A;  2J06 A;  2RQR A;  3O5Z A;  4JJD A;  1E6G A;  4J83 A;  4M75 E;  2L3S A;  2FZK B;  3CCE Q;  2IIM A;  1QWE A;  1G83 A;  4A4E A;  5GAN j;  2QYZ A;  2D6F A;  1NJI C;  2FZG B;  3CCJ Q;  1K0S A;  5I21 A;  2DL4 A;  4M77 B;  2XG8 D;  1M3A A;  1SRL A;  2QEX A;  2ZCF B;  2DAQ A;  4ME7 A;  4Q5W A;  4ORZ A;  2JJ9 A;  2J6K A;  4GY5 A;  4JRI A;  1ABO A;  2HSE B;  2HKQ B;  4EIK A;  4HCK A;  1BK2 A;  4LUD A;  2DIQ A;  2HQX A;  2QGG A;  3PIO A;  2DER A;  4OVA A;  2LT1 A;  3VS5 A;  8AT1 B;  1KC8 U;  1WYX A;  2CP2 A;  1EX4 A;  3LGL A;  1YJ9 Q;  4JDS A;  3HKS A;  1QQJ A;  2R57 A;  2PTK A;  2DET A;  2BZY A;  1WXU A;  2A0F B;  1Y07 A;  1ZSZ A;  3OSV A;  5GAN 8;  1W6X A;  2CDT A;  3CQT A;  4OMQ A;  2LC4 A;  2F69 A;  5CVI A;  4ESR A;  1PRL C;  5HK3 A;  2EJF A;  1VQK A;  2ZAE A;  5FWB A;  4R0K A;  4C92 A;  1RAA B;  2QQB A;  2R58 A;  2CSI A;  1VQM Q;  3BDL A;  1Y7X A;  1VQ4 A;  1B34 B;  2ZPE B;  3JRZ A;  4C5I A;  2ESW A;  2CKK A;  1KD1 R;  4Y92 A;  4M7D A;  3UA6 A;  4C0D B;  3I55 Q;  1JEG A;  2QQS A;  3OB9 A;  3EG3 A;  3EGX B;  4HVV A;  2FZC B;  1UG1 A;  4JJB A;  3SEM A;  4FYV B;  4X9C A;  1UGQ B;  3CMA T;  5GJV B;  1WJR A;  2X9H A;  1N27 A;  4RCC A;  4A4K A;  1VQL Q;  2JM9 A;  2MK5 A;  1MGQ A;  1E6H A;  4NL3 A;  1KG1 A;  1N8R U;  1I4K 1;  3DLM A;  4RTT A;  1VQN Q;  4RG8 A;  2A28 A;  5LJ5 g;  4OML A;  2J7I A;  2F2V A;  5IHK A;  1ZUK A;  2MPX C;  4XQ3 A;  4M77 C;  4WF2 A;  1Y96 B;  3CXC P;  1QVG A;  3RIR A;  2KR3 A;  3CXC S;  5IXB A;  1N9R A;  2ZZD A;  1Y71 A;  3KFV A;  2L8D A;  4IUV A;  2LRQ A;  3RR6 A;  1NEG A;  2EYQ A;  3OBY A;  4OP0 A;  2V1R A;  1K8A R;  2JMC A;  5GMK i;  1MMA A;  1TXQ A;  1PKS A;  1WHH A;  5IH2 A;  4J9C A;  3X20 B;  1ABQ A;  2EGA A;  2XDD A;  1VYV A;  2AKK A;  1W2B P;  3LGF A;  3VU3 C;  1W2B S;  1YI2 Q;  2L5Q A;  1JB0 E;  4FIB A;  2LQW A;  3FLG A;  3NFC A;  1ZUY A;  2HD0 A;  3LLR A;  3EH2 A;  4EDU A;  1MMD A;  3JCM b;  3QUI A;  4PKC C;  1YHQ T;  2OTL T;  2XDP A;  4NL2 A;  3SWN B;  1BIB A;  3KXT A;  2JT4 A;  3P8B B;  2LVM A;  5GAN 5;  4MZP A;  2LCS A;  2DBK A;  3KBG A;  2EVR A;  2WAC A;  3HFN A;  4IUT A;  1Q82 U;  3C12 A;  3H6Z A;  3L2V A;  3PIP A;  2FRW A;  2ED0 A;  2KSS A;  3EH1 A;  5FU7 B;  3S3O A;  2K4Y A;  4BUG A;  3MEV A;  2K5I A;  5GAM h;  2DF6 A;  5ECA A;  1M2O A;  4J9I A;  2C0O A;  2JVV A;  3VS6 A;  2DK3 A;  1AZG B;  4PJO A;  2DLP A;  4C5H A;  2M9U A;  2C06 A;  2DVE A;  3UPU A;  3VV0 A;  2SEM A;  3H8Z A;  4N4G A;  1YJN T;  3HPW A;  3BW1 A;  3JB9 G;  3VS0 A;  3CME A;  2PVO B;  1KJW A;  4JRP A;  5LJ5 d;  2NUP A;  3SDZ A;  1EFN A;  5GAM j;  2HQE A;  1ARK A;  3WVE B;  2MWP A;  5CKF A;  4HCB A;  3VS4 A;  3EAE A;  2ABL A;  1JXO A;  3OYK A;  2E6Z A;  3CPW A;  3CMA Q;  4F7U A;  2FRY A;  5IT9 E;  5HKC A;  2LJ0 A;  1HSQ A;  4FU6 A;  2Z0W A;  4GBQ A;  3M59 A;  4DA4 A;  4C92 E;  1ZA1 B;  4OMM A;  3QHS A;  5GAN e;  4A4H A;  9ATC B;  2RD1 A;  4HCZ A;  4JJC A;  1YIJ T;  1ZSZ B;  3SB2 A;  2R5A A;  1O9S A;  2EQK A;  3E19 A;  4M7D E;  3H0F A;  1BI3 A;  2DJQ A;  3CCU T;  1BU1 A;  3P8D A;  1S72 A;  2VYT A;  1OOT A;  1D09 B;  1KQ2 A;  2AIR B;  1ZBJ A;  2F5T X;  5J3B A;  4C92 B;  1AEY A;  1PCX A;  1VA7 A;  2YWW A;  2VVK A;  3NTK A;  2HKN A;  4GLK A;  2M1H A;  4A4F A;  3OYN A;  3M55 A;  2RM4 A;  5D6Y A;  4M7D B;  1M8M A;  2QA4 A;  3X25 B;  1LPL A;  2DKG A;  3OYE A;  3I9Q A;  4R56 A;  1UB4 A;  1SSH A;  2VC8 A;  2ZPF B;  4Z88 A;  1G3W A;  2O01 E;  1JU5 C;  3OS1 A;  1YHQ Q;  2OTL Q;  3GNF B;  1Y57 A;  2FL7 A;  1NYG A;  2CZ6 B;  4J9H A;  3I5S A;  2V26 A;  3QPH A;  1R77 A;  3M0U A;  3LYI A;  4J6X A;  5IXF A;  1Q7Y R;  2DD5 A;  4IUU A;  1TOV A;  3BY7 A;  4OMN A;  3CCS A;  2IPO B;  4M77 D;  4BE2 A;  3ZL7 C;  1YJN A;  1G8X A;  3RKX A;  4DBH A;  3G4S T;  3FC3 A;  4HXJ A;  3G6E A;  1T0H A;  2A7Y A;  1TH7 A;  4C8Q C;  2LX7 A;  1UUE A;  1Y0M A;  2C0T A;  5LJ3 h;  5GAO p;  1O75 A;  1KD1 U;  3VRZ A;  4KGV B;  3HTR A;  1VQ5 T;  4RTX A;  4C5G A;  4FL6 A;  4JS5 A;  5CIU A;  4ZGD B;  4M77 F;  4JZ4 A;  1JRI A;  5KE2 A;  1PD0 A;  1WQW A;  1PNJ A;  5GAN 2;  2YSQ A;  2D0N A;  1SKU B;  1XQH A;  4JZ3 A;  2YLB A;  3OS2 A;  3JAM E;  4DOW A;  1VQ7 A;  4PJO E;  5GJW B;  3CC2 T;  3RNJ A;  1H3H A;  1YWP A;  3V8L A;  2KE9 A;  2CT4 A;  3FIF A;  4BE1 A;  1PHT A;  2O9V A;  5LJ3 j;  1NPP A;  2GBQ A;  5CKB A;  3CCU A;  2QTV A;  1WXB A;  3M57 A;  2XD0 A;  5D7U A;  1M90 C;  2XU8 A;  2D8J A;  3OMC A;  1Q81 R;  4BD3 A;  3NTI A;  1YIJ Q;  4PJO B;  2G6F X;  4L59 A;  2DE0 X;  4M7D C;  1GCP A;  4K11 A;  4FYY B;  3CC7 A;  1K8A U;  1RAC B;  1FXX A;  2RHZ A;  4KGZ B;  2CUB A;  3NHN A;  1TWB A;  3PE0 A;  2W0Z A;  2E41 A;  2LDM A;  3S6W A;  4F7U E;  3TSW A;  1RI0 A;  4AMC A;  3QYG B;  4QKU A;  2P0P A;  2EYZ A;  3EGU A;  4Z89 A;  2NUP B;  2OTJ T;  2DPP B;  1WPY A;  1D1C A;  2H3J A;  1VQ6 T;  3CCE T;  4RCB A;  1D1B A;  3PT9 A;  1BI1 A;  1X01 A;  2JNG A;  3MEA A;  3CCJ T;  3CD6 Q;  2RH2 A;  2CZ0 B;  2EQJ A;  3QDF A;  2RJC A;  1B34 A;  4KUD K;  4F7U B;  1KC8 C;  2DBM A;  2ZPI B;  1ZSG A;  4FM4 B;  2DXB A;  4C0G A;  2XI9 A;  3RES A;  1MV3 A;  2PU9 B;  3A8M B;  3LX7 A;  2KRN A;  3LW5 E;  4QT7 A;  2EAY A;  3DLL A;  2A36 A;  4NS5 A;  2EFI A;  2DXU A;  3RMQ A;  3G4S Q;  1SF9 A;  2FPD A;  2B8A A;  1ZBX A;  4O5V A;  3CCM A;  5GAM e;  1AD5 A;  4CC7 A;  1ZX6 A;  1X2Q A;  2DO3 A;  3JB9 I;  3KUF A;  3J7A F;  1BB9 A;  4RTV A;  1VQ5 Q;  2HL5 C;  3MCA B;  3JCM h;  1HYO A;  3GLX A;  2CUD A;  1KQS A;  3OW2 A;  5IHI A;  1JBM A;  3QSU A;  5FRN A;  2D0Q B;  1SG5 A;  3E2U A;  1VQO A;  3L2U A;  1MMG A;  2RK2 A;  3FJ5 A;  1B3Q A;  3T9N A;  2GF7 A;  4ZNX A;  3JCM c;  4PJO C;  3CC2 Q;  1I81 A;  1OZ3 A;  3I55 T;  3JB9 J;  1N8R C;  3BE3 A;  1RUW A;  1W1F A;  4PJN A;  4E47 A;  5AYF A;  4RTZ A;  2HL3 A;  4MDX A;  4MML A;  4C8Q D;  2L3R A;  4Y91 A;  1YIT T;  4LD6 A;  1OQK A;  3QKJ A;  5A0D A;  3JV3 A;  3M0P A;  2B86 A;  1YCS B;  1VQN T;  5M9O A;  1WJQ A;  3OYJ A;  1OI1 A;  4LDU A;  4KBM B;  3M5A A;  3CCE A;  1WHK A;  3A8O B;  3BDU A;  2MCN A;  3E9G A;  2PQW A;  3G71 T;  4EMG A;  3OQ5 A;  1TU0 B;  3X28 B;  2EYY A;  4IKF A;  1Q95 G;  3A8L B;  1W4S A;  1XOV A;  2OTJ Q;  2XK0 A;  3VS2 A;  2VXF A;  1VQ6 Q;  5KH6 A;  4DBQ A;  2P84 A;  3S3M A;  3HFO A;  3HSB A;  1Q7Y U;  2P4T A;  2BKD N;  3L2Q A;  1WGS A;  4C8Q A;  3I56 T;  1VYU A;  2O31 A;  1YI2 T;  4C92 D;  2E12 A;  1Q82 C;  3RDV A;  1YJ9 A;  4ZTJ A;  1BBZ A;  3LH0 A;  2CT3 A;  4M7A G;  3CCV Q;  4M7D D;  3H0H A;  3OSS C;  1T3S A;  2E3H A;  2J6O A;  4RUG A;  5I2S A;  3MHX A;  1CSK A;  1M1G A;  1R8O B;  2VKN A;  4B9X A;  1PC0 A;  3CCQ T;  2DTO A;  3FDR A;  5IN1 A;  4N0A C;  2O88 A;  1AZE A;  1F1B B;  4J7F A;  2P0Q A;  2L89 A;  3THK A;  5DLO A;  3OYA A;  1RAD B;  2QDL A;  1QW1 A;  1X75 C;  2RO0 A;  2BE7 D;  2GGR A;  2HSP A;  4C92 F;  1SRM A;  1QKX A;  2MYS A;  2HMA A;  1VQM A;  5GMK h;  1M9S A;  5LJ3 e;  2HDA A;  2RJF A;  3BFM A;  2L3P A;  4M7D F;  2M51 A;  2D8H A;  1BI0 A;  3MKD A;  2RHX A;  4X34 A;  3PTA A;  2RHY A;  2HEQ A;  3H0I A;  5CK9 A;  2QAZ A;  3PGG A;  4LNP A;  2LT4 A;  2K3X A;  1MMN A;  4HT8 A;  2DRM A;  2LX9 A;  3EG9 B;  1P92 A;  2FPF A;  4PNO A;  5IAY A;  2PVG B;  2RQT A;  2RQU A;  1RLQ C;  2GFU A;  3X26 B;  4M78 G;  1VQL A;  2CRE A;  1Q81 U;  3HP9 A;  3MP6 A;  2BUD A;  3CBO A;  5GAO m;  1EIF A;  5GMK j;  2AKL A;  1KQ1 A;  3EHQ A;  2VGN A;  3LWI A;  4F17 A;  1YIT Q;  1QVF A;  1I1J A;  1K9M R;  5CR2 A;  3AT1 B;  4RTU A;  3VYG A;  1YNZ A;  5GAO r;  1WFW A;  1VQK Q;  4DQ2 A;  4ZGE B;  4J9G A;  2HNI A;  2LZ6 B;  1X6O A;  2JTE A;  1YJW T;  3QG1 A;  1VQ4 Q;  3WVD B;  2YUO A;  2EQM A;  2JMA A;  1IO6 A;  3G71 Q;  4C5E A;  3GOX A;  1QP2 A;  2F2X A;  1R0B G;  4XTY A;  2CYZ B;  1PWT A;  3X24 B;  1Q86 R;  1UDL A;  2KMT A;  2KVQ G;  2A37 A;  4PJO D;  2BZX A;  2YXY A;  5L23 A;  3U23 A;  1NPR A;  1V29 B;  1K73 R;  2CP7 A;  2BTT A;  2EQU A;  3I56 Q;  4HKE A;  1PM3 A;  3CC4 T;  4KUI A;  2DIL A;  1RAE B;  1UGS B;  2CP0 A;  3ME9 A;  3SD4 A;  4F16 A;  4D8D A;  3QYH B;  3A98 A;  4AG1 C;  1MUZ A;  3QII A;  2XKO C;  3MP8 A;  5HK0 A;  1M3B A;  2X35 A;  5C6S A;  1V76 A;  4PJO F;  3CCQ Q;  3QZ9 B;  5C0M A;  5HCK A;  3EG2 A;  1I0C A;  1NM7 A;  4M75 G;  1KD1 C;  2QK0 A;  2WSC E;  2SRC A;  2XID A;  2X4W A;  3VYH B;  2MIO A;  1BYM A;  5FW9 A;  4ZTF A;  1IRE B;  4C8Q E;  1BCO A;  1DJ7 B;  1G2B A;  3GNG A;  2DM1 A;  1TUD A;  2YRV A;  2KGT A;  1QCN A;  4AFS C;  1CKB A;  1IGU A;  1GRI A;  1I5O B;  5DY9 A;  4PJL A;  1YP5 A;  3EFO A;  5J39 A;  2HBW A;  5KYN A;  4AFQ C;  3EG1 A;  1WHL A;  1NLP C;  4TVR A;  2K5L A;  4C8Q B;  3DKM A;  3CMA A;  4BDY A;  4F7U F;  1MV0 B;  1OYX A;  2RHU A;  4QQD A;  1GFD A;  5FRM A;  3HL8 A;  3M0S A;  3FB9 A;  1X2K A;  2L0A A;  4MZT A;  4PJM A;  2CGH A;  4A53 A;  3EGD A;  1S1N A;  1OU9 A;  4QVZ A;  1YN8 A;  4Z8A A;  5LJ5 h;  2Y4Y A;  2DZ9 A;  2QDY B;  4ZGJ B;  4A4G A;  4BI4 A;  2EKH A;  2VGM A;  1K8A C;  4ANJ A;  5FWC A;  3L2R A;  1YBY A;  1RAI B;  3LWH A;  1PKT A;  1K1Z A;  1JJ2 P;  3MJX A;  4LUE A;  1YJW Q;  3TSZ A;  2M16 A;  2NWM A;  2OI3 A;  3ULR B;  1JJ2 S;  2HQH A;  2LP5 A;  2K2V A;  3NMZ C;  3CXC A;  3JCM P;  2XIC A;  4FYX B;  2LJ1 A;  3GIB A;  1H92 A;  2E70 A;  2JS0 A;  3VS3 A;  2X4J A;  3GF5 A;  4EMH A;  5GAN f;  1RL2 A;  2DTH A;  5LJ5 j;  1I5L A;  4JPB W;  2JXB A;  4EMK C;  3OBW A;  1W2B A;  4KUL A;  2COY A;  1YHQ A;  2OTL A;  2JS2 A;  4MZM A;  4N0A A;  2VWF A;  4KH0 B;  4FSS A;  5D6W A;  3PVL A;  4XU2 A;  4CC2 A;  3CC4 Q;  4PFO A;  4D6W A;  2ZPH B;  3CCL T;  2DJZ A;  3CD6 T;  1SHG A;  2ZGW A;  2DVJ A;  1JQQ A;  2E4H A;  4XTZ A;  2YUQ A;  3TU4 K;  2LQ8 A;  5FU6 B;  3URG A;  1M3C A;  3M53 A;  5CKE A;  4M78 A;  4FYW B;  4L6V 5;  3O8V A;  4J7I A;  2V1Q A;  1M1F A;  4M4Z A;  3ZFJ A;  4DBF A;  2OJ2 A;  1K76 A;  2J05 A;  1GCQ C;  1R0C B;  3RKY A;  1G3T A;  5KYU A;  3CCR T;  2DZC A;  3OYG A;  2X3W D;  1ZQ1 A;  1UJ0 A;  2DL7 A;  2ATC B;  3EFS A;  3INZ A;  2FVU A;  3MP1 A;  3UAT A;  4ELY C;  5GMK e;  1VYT A;  1UGP B;  1FX7 A;  2E5K A;  5I2M A;  3UDC A;  3J81 E;  4AT1 B;  2RPN A;  1VQP T;  2DA9 A;  2YRD A;  4PLI A;  4FT2 A;  3E1S A;  2K79 A;  5KYX A;  1K9M U;  4QVD A;  2PUK B;  1D0Z A;  3M0R A;  1M4Z A;  2HCK A;  3OS5 A;  5FRO A;  2DEU A;  1TUC A;  3L2W A;  2CP6 A;  4E7I A;  2F5K A;  3WXM B;  2WSE E;  1M1K R;  3V7S A;  4C0Z A;  1YIJ A;  2EQI A;  1XNI A;  1K9A A;  5DLQ E;  1IGQ A;  1NLO C;  2JTM A;  3JB9 D;  3R6N A;  1OU8 A;  2AK5 A;  1PSF A;  3SHW A;  3NGP A;  1VQ9 T;  2G3R A;  4BI8 B;  2X51 A;  1Q86 U;  4E2F B;  2Y90 A;  4M75 A;  1K73 U;  2JOY A;  1VQ8 T;  4LD9 K;  4FW2 A;  1PRM C;  2EGE A;  3QWY A;  3UT1 A;  1U1S A;  3JCM Q;  2I0N A;  1Q7Y C;  1M27 C;  5GAO q;  3EFO B;  3JB9 F;  3N5B B;  5CKH A;  2L2P A;  4F14 A;  4BAC A;  5FU6 C;  3QJ6 A;  1X69 A;  1HJD A;  2H3E B;  3M0T A;  4E7L A;  4IUR A;  4E7Z A;  3A8G B;  1RAB B;  4DBR A;  4E7K A;  1QCO A;  2E65 A;  5GAN g;  2C0I A;  2LQN A;  3CCL Q;  1XJW B;  4JJN K;  4DEX A;  1T3L A;  3EGD B;  2CZ7 B;  1LOJ A;  3QDR B;  4OGE A;  3EG9 A;  1UFF A;  1U8R A;  1ACM B;  2KNB B;  2NUT A;  3MET A;  2W10 A;  5GAN 4;  3G4S A;  1X27 A;  4GLM A;  1LJO A;  2DYI A;  4M7A B;  3CCV T;  1OPK A;  2BE9 B;  2F1L A;  5FLX E;  4OGC A;  2CP3 A;  3C95 A;  1VQ5 A;  2DL3 A;  2RN8 A;  3CCR Q;  2F2W A;  2HZY A;  4ELZ C;  1UGR B;  1K4U S;  3V8J A;  1UTI A;  1QMC A;  2ROT A;  1D1A A;  3JCM J;  2VXE A;  3C4S A;  2KAF A;  2K3Y A;  2QEX T;  2PUO B;  1QWF A;  1SEM A;  3M4Y A;  2X4Y A;  1KFZ A;  1VIF A;  1N6A A;  2A08 A;  4J9F A;  3RBB B;  2E3I A;  4QVC A;  2PVD B;  1YCY A;  3ZEH A;  5CCA A;  1NJI R;  3CC2 A;  1WZO A;  1VQP Q;  1Q81 C;  1FWZ A;  5HY6 A;  1PG5 B;  5GAM f;  2QQ9 A;  4J6W A;  4MMK A;  4OF1 A;  5I11 A;  4JLG A;  2RK1 A;  5KYW A;  1PD1 A;  2DFU A;  1WNL A;  3H9N A;  4NOY A;  4J9E A;  1LNX A;  3EFR A;  4OB3 B;  5GMK l;  2L3Q A;  4BY6 C;  3CCM Q;  2KRO A;  4M78 B;  4E6R A;  2KT8 A;  4AG2 C;  3SFM A;  2KY9 A;  2LNV A;  2DMO A;  2X3X D;  4LDX A;  5L8R E;  1Z9Z A;  1BIA A;  1OX9 A;  1OPL A;  1BCM A;  4EMK A;  5KYU B; 
#chains in the Genus database with same CATH homology
 1I1J A;  2FRY A;  2DX1 A;  4RTU A;  1KIK A;  4HVU A;  1YNZ A;  1WFW A;  2LJ0 A;  1HSQ A;  3QWX X;  4GBQ A;  2EBP A;  4J9G A;  1NYF A;  1ZLM A;  2LZ6 B;  2ROL A;  4OMM A;  2JTE A;  2JW4 A;  2RF0 A;  4LN2 A;  4JJC A;  2YUO A;  2JMA A;  2YDL A;  1IO6 A;  2FG0 A;  1RLP C;  3H0F A;  2DJQ A;  1JXM A;  1BU1 A;  3LH5 A;  1AVZ C;  1X43 A;  1OOT A;  2F2X A;  1AWX A;  3REB B;  1UGV A;  1ZBJ A;  1PWT A;  4AFZ C;  2YUN A;  1AEY A;  1UDL A;  1GCQ A;  2A37 A;  1VA7 A;  2BZX A;  5L23 A;  1X6G A;  3U23 A;  2KRS A;  2VVK A;  3UA7 A;  1M8M A;  2H8H A;  3H41 A;  2BTT A;  1SPK A;  1NG2 A;  2DIL A;  3I9Q A;  2CSQ A;  1WI7 A;  1SSH A;  1GFC A;  4F16 A;  4D8D A;  2MOX A;  4Z88 A;  1AOJ A;  1V1C A;  1JU5 C;  3A98 A;  2NUZ A;  2KRM A;  2RNA A;  4AG1 C;  1MUZ A;  2KEA A;  2KXD A;  1HD3 A;  1Y57 A;  1M3B A;  4J9B A;  1NYG A;  4J9H A;  3I5S A;  1YWO A;  1GBR A;  3M0U A;  4LE9 A;  4RTY A;  5IXF A;  1Z9Q A;  4RTW A;  5HCK A;  3EG2 A;  1I0C A;  1WIE A;  1NM7 A;  4OMN A;  1ZUU A;  2SRC A;  1N5Z A;  1RI9 A;  1UEC A;  1OV3 A;  3VS1 A;  3ZL7 C;  2MIO A;  1UHC A;  1UE9 A;  5FW9 A;  2GNC A;  4HXJ A;  1T0H A;  1G2B A;  3PVQ A;  2LX7 A;  1UUE A;  1Y0M A;  1FYN A;  2C0T A;  2DM1 A;  1TUD A;  2KYB A;  2GTO A;  2KGT A;  3VRZ A;  4AFS C;  1CKA A;  2EYX A;  1CKB A;  1GRI A;  2K6D A;  2JM8 A;  4RTX A;  1YP5 A;  4OMP A;  2J6F A;  2HBW A;  4AFQ C;  3EG1 A;  1NLP C;  2LMJ A;  1MV0 B;  4JZ4 A;  2DL8 A;  2GQI A;  1GFD A;  2KYM A;  3M0S A;  1WXT A;  1NEB A;  1PNJ A;  1X2K A;  2L0A A;  2YSQ A;  2D0N A;  2K2M A;  2LNH B;  4JZ3 A;  1S1N A;  1YN8 A;  4Z8A A;  5GJW B;  3RNJ A;  1H3H A;  1YWP A;  2KE9 A;  2CT4 A;  2OAW A;  2EKH A;  1PHT A;  2O9V A;  2GBQ A;  4A63 B;  1I07 A;  5FWC A;  3UF4 A;  2FEI A;  1WXB A;  1PKT A;  1K1Z A;  1OEB A;  4WCI A;  1AWO A;  3I5R A;  2D8J A;  4LUE A;  3C0C A;  3TSZ A;  2NWM A;  4AFU C;  2OI3 A;  3ULR B;  2LP5 A;  2KBT A;  3NMZ C;  2G6F X;  3VRY A;  2DE0 X;  2O9S A;  1GCP A;  4K11 A;  1AWW A;  3EG0 A;  2EPD A;  2LJ1 A;  4IIO A;  3REA B;  1H92 A;  2JS0 A;  3VS3 A;  2FO0 A;  2CUB A;  3NHN A;  3PE0 A;  4JPB W;  2W0Z A;  2JXB A;  3TSW A;  1H8K A;  2ECZ A;  2RMO A;  1WA7 A;  3NPF A;  2J06 A;  2JS2 A;  2EW3 A;  2RQR A;  2VWF A;  3GBQ A;  3O5Z A;  4JJD A;  4CC4 B;  1LCK A;  2EYZ A;  3EGU A;  1E6G A;  4FSS A;  4Z89 A;  3PVL A;  4OMO A;  4CC2 A;  4KRT A;  2L3S A;  2IIM A;  1QWE A;  1G83 A;  1SHG A;  2DVJ A;  1K0S A;  1JQQ A;  2YUQ A;  2DL4 A;  1UJY A;  3I35 A;  2FPE A;  1M3A A;  1SRL A;  2DBM A;  1M3C A;  1ZSG A;  1MV3 A;  1JO8 A;  4ORZ A;  2LJ3 A;  2J6K A;  2KRN A;  1T0J A;  2ED1 A;  2V1Q A;  4HVW A;  3M0Q A;  1J3T A;  1ABO A;  4QT7 A;  4M4Z A;  4EIK A;  2A36 A;  4HCK A;  1BK2 A;  2OJ2 A;  4LUD A;  1K76 A;  2J05 A;  1GCQ C;  3VS5 A;  2D1X A;  2X3W D;  2FPD A;  1QKW A;  1WYX A;  1X6B A;  1UJ0 A;  2DL7 A;  4IIM A;  1WLP B;  2PTK A;  2BZY A;  1AD5 A;  4CC7 A;  1ZX6 A;  3EHR A;  1X2Q A;  3UAT A;  1VYT A;  2GTJ A;  1WXU A;  1GBQ A;  1BB9 A;  4RTV A;  2E5K A;  2K7A A;  1GL5 A;  1W6X A;  2CDT A;  2CUD A;  3CQT A;  4OMQ A;  5IHI A;  1A0N B;  2RPN A;  2DA9 A;  4ESR A;  1PRL C;  2K79 A;  2PZ1 A;  5FWB A;  2DRK A;  2XMF A;  4R0K A;  1AWJ A;  3M0R A;  3VS7 A;  2HCK A;  2ENM A;  1TUC A;  1QCF A;  2CSI A;  3FJ5 A;  1B3Q A;  2BZ8 A;  5IHN A;  2KXC A;  2O2O A;  2ESW A;  4ZNX A;  4Y92 A;  3UA6 A;  2EQI A;  1RUW A;  1W70 A;  1W1F A;  1K9A A;  1JEG A;  4J9D A;  1NLO C;  3EG3 A;  3R6N A;  2AK5 A;  4HVV A;  2YUP A;  1UG1 A;  4JJB A;  4RTZ A;  3SEM A;  3SHW A;  2K9G A;  1E7O A;  2DNU A;  5GJV B;  3NGP A;  1SHF A;  2CH4 A;  2YT6 A;  2JM9 A;  3JV3 A;  1WX6 A;  3M0P A;  1E6H A;  2B86 A;  1YCS B;  4RTT A;  1WDX A;  1KSW A;  2A28 A;  1PRM C;  4OML A;  2EGE A;  1TG0 A;  2J7I A;  2F2V A;  3QWY A;  2MCN A;  2I0N A;  5IHK A;  1M27 C;  1ZUK A;  2DL5 A;  2L2P A;  4F14 A;  1FMK A;  2EYY A;  1X69 A;  1HJD A;  3M0T A;  1XOV A;  2KR3 A;  3VS2 A;  5IXB A;  3KFV A;  2C0I A;  2LQN A;  4DEX A;  1NEG A;  1T3L A;  2V1R A;  2JMC A;  1UFF A;  1PKS A;  5IH2 A;  2KNB B;  4J9C A;  1ABQ A;  2EGA A;  1VYU A;  1VYV A;  2AKK A;  2W10 A;  2O31 A;  1X27 A;  4GLM A;  1U3O A;  2LQW A;  1BBZ A;  1ZUY A;  2CT3 A;  1QLY A;  2AZS A;  1OPK A;  3H0H A;  1T3S A;  2J6O A;  4RUG A;  1B07 A;  2DL3 A;  3TVT A;  1CSK A;  5I22 A;  2VKN A;  2JT4 A;  2RN8 A;  2F2W A;  2LCS A;  2DBK A;  2EGC A;  2M0Y A;  2EVR A;  2O88 A;  1AZE A;  1K4U S;  1UTI A;  2ROT A;  3IQL A;  3THK A;  2QDL A;  2FRW A;  2ED0 A;  2GGR A;  2RQV A;  2HSP A;  1SRM A;  2DF6 A;  1QWF A;  1QKX A;  1SEM A;  5ECA A;  1KFZ A;  4J9I A;  2C0O A;  3VS6 A;  2A08 A;  1AZG B;  4J9F A;  3RBB B;  2DLP A;  2HDA A;  2L3P A;  2M51 A;  2D8H A;  2HEQ A;  3H0I A;  2EYW A;  2SEM A;  4CC3 A;  1U06 A;  4LNP A;  5I11 A;  2RQW A;  3VS0 A;  2DRM A;  4J9E A;  1KJW A;  5EC7 A;  2FPF A;  2P4R A;  2KT1 A;  2L3Q A;  2CH4 W;  1UHF A;  2AZV A;  2KRO A;  2RQT A;  2RQU A;  1RLQ C;  2CRE A;  2K3B A;  4E6R A;  1EFN A;  2KT8 A;  4AG2 C;  4DEY A;  4X1V A;  2PNI A;  2DMO A;  1ARK A;  1M30 A;  2X3X D;  1K0X A;  2AKL A;  1Z9Z A;  3VS4 A;  1OPL A;  3EHQ A;  2DYB A;  2ABL A;  1JXO A;  4F17 A;  4D8K A;  1U5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...