2OX7A

Crystal structure of protein ef1440 from enterococcus faecalis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
SLIPKFRAWDTYEKEMLENVTPLFDDSNSMIAIITDFQIKGSPGTSEIEIGSYDTTFNWDEFPYVIMQSTGLKDKNGVEIFEGDILVYDAPKKYAHRRSMHEIAYADGRFFWEFLDLVFCQSNILYRDGYLVIGNIHENPELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
total genus 23
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2ox7A02
2.30.30.310 Mainly Beta Roll SH3 type barrels. YopX-like domains 2ox7A01
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH superfamily
2FB7A 3CCRT 3JB9I 1SEMA 1VYTA 3PE0A 1K0SA 4LDUA 5CKFA 4FW1A 4RG2A 1K9MR 1G3TA 5GAOr 1NG2A 2NYSA 4N0AA 4L59A 1SF9A 2DEUA 1UHFA 4PFOA 9ATCB 2GFUA 1NE8A 2XDDA 3CC2T 4M77E 1BCOA 2DL7A 2NLUA 1UUEA 2RM4A 1O9SA 5LJ5e 2NUTB 3P8DA 3NMZC 4OMPA 1WZOA 3SWNC 2QGFB 2L5QA 2JM9A 2CZ1B 3A8LB 1GBRA 4FM4B 2YSQA 5J39A 2C0OA 3MPUB 2FZKB 1X6BA 3OQ5A 3CXCA 1T0HA 4RCBA 2IG0A 4E2FB 2NUPB 4KH0B 2DX1A 4ZGEB 2OTJQ 1YWOA 1XTDA 5GMKl 3H9NA 2ZGWA 4OMOA 5I22A 1NJIC 1K0XA 3JCMJ 2K57A 4J9IA 1K73U 3THKA 2LRQA 1I5OB 4BE1A 1M27C 3L2RA 3CC7T 1MMAA 3LWHA 2E4HA 3M4YA 1BI2A 2HKNA 3EGXB 3EFOB 5GMKi 1BB9A 1LVKA 4MDWA 4M75D 4K11A 1TSFA 2XDPA 4LNPA 2ZAEA 2HQEA 3VS2A 2EJFA 3CD6A 4C0FA 1Q82C 1JQQA 2K5IA 2R57A 4LXCA 1Q81U 4FL6A 3BDLA 3ME9A 1HJDA 3BY7A 2FZGB 2KGTA 2W10A 2RJEA 4FSXA 2RJDA 3JB9H 2RI5A 2RHZA 2KEAA 1JJ2P 1G5VA 4PK4A 4QQGA 1G8XA 1VQPQ 3TQ7P 3NTKA 3OS5A 4EPCA 3M56A 4A54A 2VGMA 4VUBA 2LX7A 4PJOD 2OTLT 1Q82U 2R5MA 3M0UA 2DJZA 2RK2A 1OULA 1ZSZC 1K8AU 4PJOE 2YLCA 2RH2A 3QHSA 1ABOA 2EJGA 2QQRA 4QVCA 5M9OA 3OYMA 3M5AA 4PJLA 1YITT 1WHHA 5IAYA 1VQOA 1LNXA 4IUTA 2RO0A 2CP5A 2E1HA 2J7IA 2VKNA 3GPLA 4BE0A 3TCJA 1U1SA 4DOVA 2X4XA 1WDXA 1Q7YC 3MP1A 1WNLA 2QTXA 2EYZA 3SHWA 1VQNT 2LC4A 2KVQG 1VQ7Q 4M75G 3CCVT 1KQ2A 4FCYA 1S72A 2BE9B 2LTOA 2K9GA 2LCSA 3V7SA 1E6HA 2VC8A 2QEXA 1Y7XA 4JPBW 3QYGB 2ATCB 1IHVA 4BB7A 4KH1B 4WF2A 4GBQA 1M4ZA 3VRZA 3OYEA 2XI9A 4X9CA 2VUBA 1BBZA 2VYTA 1WYXA 3HRTA 3HTRA 1RAHB 4M78G 2X9HA 5L8RE 4F16A 2CUBA 4C0DB 2EAYA 3EFSA 1ARKA 4M77B 2YUOA 2HZYA 2KR3A 4X34A 1AT1B 2FHDA 2RJFA 3VKIA 2EKOA 3QZ5B 4J9FA 5DM7R 4OB3B 3JCMc 4AFUC 4M4ZA 2LDMA 1PCXA 3CMEQ 3RUXA 1RACB 3QYHB 1GL5A 1NLOC 2O4XA 4B6MA 2LJ1A 2K79A 4DBQA 4BUGA 2QDLA 3WVEB 2QEXT 2DXBA 3S3NA 1OU9A 2X4JA 1YCYA 3QSUA 3C4SA 5IT9E 1YJWA 5KCHA 2YDLA 4NS5A 3QWXX 3ZL7C 1NPRA 3LW5E 3VS5A 2A36A 2K5FA 1Q95G 2DZCA 3CMAT 2LMJA 1HD3A 2JNGA 2LP5A 5GAOn 4OB2B 5FU6C 4ELZC 4CC4B 3OBYA 1CSKA 3HL8A 1UDLA 2QA4A 1WIEA 2FPFA 4F14A 2EYWA 3PT9A 2CKKA 3E1SA 1WXUA 5HCKA 3OMGA 2MCNA 1SKUB 4E7LA 2K3YA 1YHQA 2DERA 1RABB 4FYWB 4PJOG 2COYA 1MGQA 2YHTA 4JRPA 4FYYB 2NUZA 1TH7A 2FVUA 1QQJA 3KUFA 4C5GA 2DTHA 1VQ6Q 1XQHA 3CCMQ 4XTUA 1YI2A 4O5VA 4C8QA 4QQ6A 5KYXA 4BD3A 2CH4A 3RBBB 4C8QB 1B34B 1N8RC 1Y96B 5LJ3g 5GMKh 2HQHA 2DK3A 3ZFJA 1QVFP 1A0NB 1UGSB 2DKGA 1D1CA 3E9FA 3URGA 2B86A 3CD6T 3HP9A 2KSSA 2JJ9A 3UA7A 5FRMA 3CPWP 4BI3A 5KYWB 2DRKA 1M2VA 1SSFA 3U23A 5GAN7 3LH0A 2GQIA 1G3WA 2PUOB 3RESA 1VQLA 1BI0A 4CRIA 4ZN3A 2EFIA 1N9RA 1UHCA 1GCPA 4A4KA 3CCSA 3V7RA 2LJ0A 3X26B 1S72T 2JUFA 2HSPA 1KJWA 1VUBA 1BIAA 5A0GA 3CPFA 2F5TX 2I0NA 5A0LA 4J9CA 1M9SA 3QIIA 2XMFA 2F2XA 2L3RA 4J5YA 3VJPA 2KDSA 2EQUA 2CP6A 4OMMA 4PJOF 2CZ0B 4EIKA 4XU2A 5GAN4 1VQKA 2EGAA 2YRDA 1Y0MA 4OMLA 3RMQA 5GAMg 2LQNA 3CCJA 4IIOA 3NTIA 1PSFA 4IUQA 1Y96A 3LX7A 2JVVA 4DBHA 3M0TA 1U3OA 2D9TA 2RJCA 5GAMe 1D1BA 2RQTA 3G6ET 4GLMA 3M58A 1ABQA 1C1AA 2COZA 3JCMQ 5I11A 1HK9A 3P8HA 4BACA 3QWYA 2J06A 4ATOA 2LNHB 1VQ5A 2NWMA 3CPWS 1OZ3A 5IXFA 3L2UA 1LCKA 3CCET 4PJNA 2NUPA 1U8RA 1ZA1B 1X2KA 7AT1B 5KYNA 1WHGA 1QP2A 1QVPA 1AHJB 3A1PA 2KMTA 5IN1A 2AKKA 3DLLA 1KC8U 2DXCA 3KFVA 4IUVA 4JRIA 4M7DB 3HKSA 4XU0A 5GAMh 4M77D 1R77A 3RNJA 3DLMA 5HK0A 1GCQA 4BY6C 2DBKA 3NPFA 4DA4A 3G4SA 3GIBA 4KBMB 3JCMf 2X51A 5FWCA 2FRYA 5GAOq 4M7DC 1E7OA 4ANJA 2DFUA 2DM1A 3HSBA 2BIVA 5LL6S 4BY6B 2ESWA 1QVGP 6AT1B 4CC7A 5FWBA 2DL5A 4A63B 2L3SA 1JEGA 3VYGA 5J3BA 5CKDA 3CCSQ 3CCJQ 2Y4XA 5FU6B 2GQVA 4J9DA 4C8QG 3OW2A 3JCMW 5KYYA 1MMDA 2QG9B 3X28B 4MMKA 5KYYB 1UB4A 1YWPA 2A37A 1WA7A 4J8OA 1M90C 3CCVA 3C12A 3M0SA 3G6EQ 1AWXA 4IURA 3LH5A 4OP0A 4AFZC 4JZ3A 1I07A 5LJ5f 3WXMB 5GAN2 1QCOA 3EAEA 3OB9A 3S6WA 2E41A 1M5Q1 2ECZA 2I2LA 1KD1R 5HKCA 4FW2A 1Q7YU 1Y71A 1RL2A 2AK5A 4R56A 1AZEA 2DO3A 4PKCC 1LPLA 2EYQA 3G1JA 3I55A 1UJ0A 4AG2C 1AVZC 5AT1B 1KC8R 4PJOC 4RTUA 2QQBA 4E7JA 4JJBA 2QAZA 1XOVA 4HCKA 5D6WA 1D09B 2GF7A 1M1GA 2JTMA 3ZEHA 4RKUE 4RUGA 3LGFA 4AFSC 1C0MA 1VIEA 2BZYA 4C0DC 3A8HB 4F7UG 1AWWA 3JCMh 3JCMV 3CCUT 1RAGB 2DA9A 3A8GB 3PTAA 1G2BA 2GTOA 2CP0A 1WQ7A 4IUPA 5LJ3h 1SPKA 3X20B 2XICA 5FROA 4DBRA 4ELYC 3MEUA 5KH6A 1PG5B 4OGCA 4EMHA 1JJ2S 4KGVB 1D0ZA 2EYXA 3M9QA 2A0FB 1KFZA 4Z02A 2LX9A 2RI3A 4MDXA 2E10A 3R6OA 3RKWA 2DXUA 3H8ZA 2PU9B 3CC7Q 2RMOA 2F5KA 1YHQQ 1AD5A 1BI1A 4TVRA 3LWIA 2JZ2A 1YJWQ 2CZ6B 3EFOA 1K73C 5GANg 4LD9K 1I1JA 4M77G 1VQ4T 4KT0E 1OX8A 4CI0C 4M7AA 1ZSZB 4D8DA 2H3JA 3KBGA 2OTJT 1PRLC 1VQ8T 2DL8A 3HHTB 2MPXC 5HY6A 1PD0A 3CXCS 1TU0B 2SEMA 4M77C 4JJNK 2DTOA 4HKEA 2CDTA 3EG9B 2EQJA 1QVGA 3NGPA 4RCCA 5D6YA 4NL3A 2MMPA 2OTLQ 1NEGA 3X24B 2LQKA 1CKAA 1WJRA 1LJOA 4M7AF 2J05A 2IPOB 1GBQA 1M8VA 3G4ST 2VWFA 3OY9A 4LDXA 1M3CA 2F69A 3G71T 3RIRA 4HCCA 3EG3A 2EWNA 3CCEQ 2E5KA 1PM3A 1AEYA 1Q86U 3RR6A 3G71A 3C95A 4HVWA 1UGVA 1EX4A 2RF0A 3GNFB 4B9XA 2X3WD 1WLPB 3RKXA 1KD1U 2QEXQ 2YUPA 2ZCFB 1OI1A 2J6FA 4OVAA 2RK1A 1M90R 4M78E 1NPPA 3OYNA 3WVDB 1UJYA 4ZGJB 2HDAA 3MEVA 3DKMA 1SHGA 1VQNA 1OQKA 2KT8A 3M53A 4N4HA 4EMGA 1NLPC 4A4EA 5GJWB 3VS7A 2P4RA 1WHKA 3V8JA 1D3BB 1KHIA 1VQPT 1ZUKA 2Z0WA 2HSEB 2R58A 3OYYA 2X3XD 1VQ9Q 2E3HA 2DD5A 3M0QA 4E47A 3BDUA 4JRKA 5LJ5h 1PNJA 4FU6A 1IHWA 2KNBB 3FB9A 3QKJA 2HKQB 3VUBA 3TU4K 4M7DD 1YJNA 4AT1B 2ZPGB 1WX6A 1X75C 2XK0A 4KUIA 4AMCA 1Q81R 2SRCA 4LUEA 2VGNA 2IIMA 2EQMA 1ZSGA 3FJ5A 5GMKj 3GF5A 1ZBXA 1RAIB 2JTEA 1M30A 3LYIA 2PNIA 4E7KA 1M2VB 4J9BA 3OYLA 4FSSA 2KROA 4A4HA 1SG5A 2A7YA 1VQLT 1FXXA 2CT3A 2DL4A 3OYGA 2EPDA 1VQ7T 1R0CB 3QZ9B 5J26A 3PVQA 3L2QA 1H3HA 1ZA2B 3EH1A 2HD0A 1WHLA 4E6RA 4N4IA 4YTLA 2RA2A 1KD1C 2CP3A 3CCLQ 4Z88A 1G83A 1W2BP 1VQLQ 4DEXA 4CC2A 1AOJA 5FLXE 3QJYA 1VQ9A 3J80E 1TOVA 1W2BA 2EW3A 3CBOA 3PMTA 4M75C 3VU3C 4MZPA 1VQ6T 2DMOA 2RD1A 5KYXB 1BYMA 1NZ9A 1YHQT 4J6YA 2E70A 2CREA 1WJSA 4HT8A 1X43A 4F7UE 2PVGB 4QVZA 2GBQA 3VYHB 1M3AA 2C06A 5KCOA 3MO8A 1RAEB 3T9NA 2CZ7B 4HXJA 1MHNA 1KHCA 5CK9A 2RQVA 3I5SA 1N9SA 2ZPFB 2V1RA 1GFDA 1O75A 4OB0B 1QKXA 2IVWA 1OX9A 3PMIA 3L1AA 3INZA 4PLLA 5KYWA 3CC4Q 3VS6A 2DNUA 4RMOA 1TUDA 1TWBA 4KUDK 4HT9A 2EYYA 1TUGB 2GGRA 2RHUA 4N0AC 2RI2A 3CMAQ 1QVGS 4C5IA 4DQ2A 1QWFA 4R55A 1JRIA 1Q7YR 2Y4YA 4OMNA 2V26A 2P84A 2XG8D 3OW2P 1NBEB 2KXCA 3C94A 2C0IA 1YCSB 1MNEA 2L89A 3X25B 1UE9A 3I5RA 2K3XA 4LE9A 3SWNA 3M57A 1K8AR 2DLPA 1JB0E 2L3PA 4IUUA 5I21A 1Q82R 1W70A 4XTXA 1B3QA 4PJOB 3CQTA 4C92F 4PJMA 3M4GA 1BK2A 2PTKA 3MEAA 2KAFA 2FRWA 3REAB 1AWJA 3QPHA 4OB1B 4QKUA 2P4TA 3OSSC 1MMGA 1RI9A 5GAMj 2PZ1A 1UGQB 2WSEE 3REBB 3OYDA 3FLGA 1M1FA 4FYVB 5GAN3 1KQSP 2A08A 4JS5A 1VQ4A 3MEWA 2DYIA 1YI2T 4RTVA 1W6XA 3IQLA 4DOWA 4JUVA 2VVKA 1I0CA 2EQKA 8AT1B 3JCMb 2E5QA 3L42A 1XNIA 2DD4A 3H0FA 4Y92A 4XU3A 5CQXA 4XTYA 2DBMA 3LGLA 1W4SA 3RDVA 1IB8A 4ORZA 4JLIA 1TTHB 5CR2A 3FC3A 2DETA 2HL3A 3JCMP 1WXBA 3C0CA 4XTZA 1FX7A 1MUZA 4F17A 5GANh 3EGUA 5GAMd 1VOMA 2EGCA 1M3BA 4FIBA 1M90U 3PIPA 1EIFA 4C8QC 4M78D 3EGDA 3JSCA 1NJIU 1V1CA 2JS2A 3FJPA 4C8QF 5CCAA 2VASA 1PKTA 3CMET 1PRMC 2D8JA 1FYNA 3ER0A 1KK7A 1Q86R 2X4WA 3EHQA 1TS9A 1MV0B 2HNIA 3I55T 2KXDA 5C6SA 1JXMA 3J81E 4RTXA 2YT6A 2OAUA 5KYUA 4ESRA 2DF6A 2FPDA 3JB9J 1VQ6A 1H3ZA 1UTIA 1H641 4PNOA 2RQUA 1QW1A 4E7ZA 1PWTA 3AT1B 1VQ9T 2QXFA 2ENMA 4WCIA 2E6NA 1KG1A 2LVMA 3HFOA 2EGEA 2KYMA 4B9WA 1MV3A 1Q81C 2M9UA 5DY9A 3E9GA 3DB4A 4KGZB 2RHYA 2ZPEB 2M16A 5CAIA 3NFCA 1K4US 3CCRA 4AFQC 3PVLA 3CPWA 4GY5A 3FDRA 3OS2A 3EG2A 4PFPA 1K9AA 4XTVA 2MWPA 2O2OA 3CCMA 3OMCA 4OMFB 1WPYA 4L6V5 1PSEA 4M7AE 1ZUYA 4C5HA 4D6WA 1SRLA 1WGSA 2KRNA 5FU7C 3M59A 2KRSA 4XU1A 2QQSA 2RQWA 1IGUA 3N5BB 3UATA 2KBTA 1QLYA 5I2SA 3OS1A 3G4SQ 2OAWA 3NTHA 4M78B 2OI3A 2M0OA 4KULA 2LT1A 3UPUA 4Z8AA 3JV3A 4ZNXA 5LJ3e 2JMCA 1K9MC 2DRMA 1U1TA 3BE3A 1VA7A 4J9HA 3A5ZB 4LDVA 3BW1A 1BI3A 3HRSA 3CCVQ 4FT2A 3JRZA 3VV0A 3TEEA 4XTWA 5GAMf 2DE0X 4J83A 3G71Q 4JDSA 2GTJA 4J6WA 3P8BB 4C0GA 4M75B 1KC8C 4C5EA 4M7AG 1LOJA 1WJQA 2F2WA 2MF2A 1QVFA 2V1QA 5AYFA 4RTWA 1I8FA 3SDZA 1OU8A 2F2VA 2JM8A 3GBQA 2OTLA 2JT4A 3OS0A 3CC2Q 2ROTA 1T0JA 3PNWC 1NEBA 2ABLA 3HFNA 2DVJA 1VQKQ 3H0IA 1BCMA 4PL6A 5GANe 2AIRB 4EMKB 3H41A 3CMEA 5IH2A 2DVEA 2MIOA 3CC2A 4X9DA 1ZBJA 3M55A 1D3BA 2RB6A 2CUDA 3VS3A 2MOXA 3PGGA 1BKBA 3QXEB 3ULRB 3G7ZA 3I56T 3MCAB 1OPLA 2X35A 1J3TA 3VRYA 1OZ2A 4II1A 1YIJT 4C92C 3CCLT 3V7CA 1HSQA 2K7AA 3UT1A 1I81A 5A0DA 2WSFE 3Q1JA 4J6XA 1VIFA 4OGEA 4O6JA 2XIDA 1HYOA 4IIMA 1IGQA 4RG8A 1D0XA 3EH2A 1OV3A 4X1VA 4RTYA 4V2SA 3OYJA 1V76A 1RAFB 3F70A 3CBPA 2BZ8A 3CCLA 3GP8A 3CC7A 3D7SB 5LJ5j 2XD0A 5GMKm 1OYXA 3L2VA 2L3QA 1UGRB 2DIQA 2HQXA 3SWNB 3SD4A 2YLBA 3QO3A 3A8MB 3ASKA 1OEBA 1PD1A 2ED0A 2LT4A 5GAN5 5A2QE 1UGPB 3GLXA 4J7IA 4PJOA 4NL2A 2HL5C 1VQOT 4MZTA 4C92D 1N5ZA 3UF4A 1YITA 4F7UA 2CP2A 1T3SA 3CXCP 5CKBA 1VQMQ 1TUCA 1M1KU 1G3SA 1ZLMA 4L5GA 2AZSA 3JCMe 1TXQA 4M75E 2E3IA 1R8OB 1B34A 1VQ8Q 2D0QB 3QJ6A 1DJ7B 1U5SA 2E64A 2BE7D 2LNVA 4QW2A 1VQMT 3OYAA 3S3MA 4ZGDB 1KQSS 3G6EA 1X01A 3E19A 5LJ5d 2DPPB 2RN8A 4HCZA 2CS7A 5LJ3d 4JJDA 2DZ9A 1KQ1A 2HEQA 4E7SA 3QG1A 5IXBA 2DEQA 1VYUA 2MAMA 4C92A 4RTZA 5DLOA 3CCJT 2QYZA 3VS0A 5IHNA 2BZXA 5I2MA 3V8KA 4N4GA 4C92B 2KY9A 2BUDA 5DLQE 2J6KA 2YUNA 2RNAA 1YFNA 5LJ3f 2BTTA 3MP8A 4KRTA 4QT7A 1QP3A 4IKFA 1HXDA 3RKYA 5L23A 2M0YA 4A4GA 4BI4A 4M7AC 1S1NA 5IHKA 2RHXA 2V8JA 2C0TA 3O8VA 3FEOA 1H92A 4F7UB 1IRXA 2X4YA 1YP5A 4PJJA 3OSVA 3QUIA 1IREB 4M77F 3EGDB 4C8QE 1YJ9T 2JXBA 1TG0A 2E12A 1H8KA 1WFWA 2EKHA 3CCMT 3UA6A 1QKWA 3I9QA 3JCMg 3TSZA 4LN2A 1N8RR 1NYGA 2QQAA 1FMWA 1B07A 2KI7A 2GNCA 2V8KA 5KYUB 3J7AF 2QK0A 4OF1A 5CKEA 1UG1A 2KK4A 2YRVA 3QDFA 2K5LA 3TSWA 1VQ5Q 1VQ4Q 1UFFA 4M7DA 2FL7A 4A53A 2AKLA 2CSQA 1I5LA 2HMAA 1M8MA 2JMAA 1K73R 1B7TA 2EBPA 3JCMX 5CKHA 4F7UF 5CIUA 3TVTA 1NYFA 3EGXA 2FEIA 1P92A 4HA8A 3FRNA 3CCEA 1JJ2A 5KE2A 3CC4T 2PUKB 1GXIE 3BFMA 2VB6A 4GLKA 5FRNA 2HBWA 4M7DF 3GNGA 2P0KA 4D8KA 3OYFA 3L2WA 2K4YA 4JJCA 4M78A 2RQRA 3NHNA 4P5NA 1GCQC 2DL3A 3EG0A 3CCRQ 1RLQC 2V8IA 4C8QD 3L2ZA 2FYKA 2XKOC 2VXEA 2KT1A 4DEYA 2K3BA 4C92E 4PFZA 4CC3A 1Y57A 2COWA 2ROLA 2J6OA 3JB9D 1M1KR 2LZ6B 1ZQ1A 3FIFA 3CCUQ 3VS1A 2EJ9A 1KSWA 3CC4A 1YJWT 2G6FX 2KRMA 1X6OA 5GANj 2JS0A 4AG1C 2QASA 1IO6A 2ED1A 1RUWA 3ZBDA 2QDYB 1KQSA 3H6ZA 4WTOB 2A3LA 2CT4A 1C6VX 4JZ4A 1S72Q 1X6GA 2LQ8A 2DTIA 2FO0A 4EMKC 1VQ7A 4Z89A 2WSCE 1D0YA 1FMKA 3CCQA 4ZTJA 1F1BB 1YNZA 2JW4A 3VUZA 1Z9ZA 2L0AA 1VQOQ 2MK5A 2ZPBB 3META 1M2OA 2XDBA 1WQWA 5FW9A 4A4FA 2YRCA 3AHUA 2CGHA 4Y28E 3M0PA 3CBMA 1KIKA 2YUQA 2JTFA 4E7IA 3OA6A 2NUTA 1YJNT 2EQIA 2FPEA 2JN0A 1N8RU 1UECA 3UDCA 5GANf 1WXTA 5LJ3j 1VQ5T 5GAOm 1JXOA 2L2PA 4LDYA 4M7DE 2A28A 2XHCA 3JAME 3CCQT 2MYSA 3OYHA 1YITQ 3OYKA 1RLPC 2G3RA 2M1HA 4XK8E 1VQPA 5HK3A 4M78C 3A8OB 3MJXA 1EZZB 4QVDA 3SFMA 2YWWA 2BKDN 3OBWA 3S3OA 2CSIA 1ZUUA 2K2MA 2O9VA 1ACMB 3MHXA 2OJ2A 2QI2A 2GFAA 1E6GA 3PFSA 1W1FA 1JU5C 1IXDA 4M77A 4LUDA 4OMQA 3I56A 2DJQA 2E65A 1RADB 1YN8A 4RTTA 4F04B 3O5ZA 3I35A 4XQ3A 4M7AB 3RERA 1K9MU 3CD6Q 3R6NA 2O31A 2HBPA 4J7FA 1QCFA 2KYBA 2O9SA 1N6AA 2JOYA 3SB2A 3GOXA 1QCNA 4MZMA 2ZPIB 2DILA 3CCST 4EDUA 5CVIA 3CCUA 1WHMA 2Y90A 1ZSZA 2CH4W 2VXFA 3EG1A 5GJVB 2K6DA 4EMKA 2YXYA 1RAAB 4Q5WA 3PIOA 1GRIA 4FT4A 4LDWA 5GAN6 4QQDA 5CO7A 5GAN8 3EG9A 2EVRA 4DBFA 2LCCA 3SEMA 1WHJA 1VYVA 2KQWA 3VS4A 1ZX6A 1W2BS 2HCKA 3QBYA 2K2VA 1FMVA 2LJ3A 3M0RA 2QGGA 3M54A 2OTJA 1SHFA 3JB9F 4M75F 2DAQA 2P0PA 2F1LA 4KGXB 4NOYA 3LLRA 2PVDB 5EG2A 1SRMA 3I56Q 1QVFS 3E2UA 3RMSA 1K1ZA 2LQWA 1PHTA 1MMNA 4ZTFA 2GCXA 1K8AC 1NM7A 2LCLA 4JS4A 4M7AD 1G3YA 4M78F 3TREA 2W0ZA 2D1XA 2ZPHB 2WACA 2O4XB 2B8AA 1IZ6A 4J9GA 2RPNA 1X27A 1AZGB 2MI6A 1XJWB 3H0HA 3UWNA 2O88A 1U06A 4PLIA 3MKDA 1V29B 3OYIA 1N27A 3HPWA 5ECAA 3KXTA 4R0KA 2QA4T 1YIJA 2AZVA 4JLGA 3V8LA 5LJ5g 5GANd 5C0MA 2D6FA 5D6XA 3OYCA 2O01E 3CMAA 1NJIR 1JBMA 2M51A 1VQMA 2PVOB 1Y07A 4BDYA 2D8HA 4Y91A 1QMCA 4BE2A 4E7HA 1YI2Q 2H8HA 2D0NA 8ATCB 4J9EA 2XU8A 3EFRA 2DXTA 5GAOl 2AT1B 1I4K1 2OX7A 3OYBA 2KE9A 4M75A 2MWOA 2DIGA 2R5AA 1AWOA 3CCQQ 2AHJB 2FZCB 2RHIA 3I55Q 4ZN1A 1M1KC 1YJ9Q 2H3EB 1PKSA 2L8DA 4HVVA 1OPKA 3JB9G 1RI0A 5D7UA 2QTVA 5CQYA 4MMLA 5EC7A 4LD6A 1YIJQ 4HVUA 1Z9QA 1Q86C 1SSHA 3JCMd 1UEBA 1K76A 4FYXB 5FU7B 2QA4Q 2CYZB 2QQ9A 4BI8B 1D1AA 1ZHIA 3OW2S 4M7DG 2CP7A 2PQWA 1BIBA 2M02A 1BU1A 1PC0A 1MNDA 2ZZDA 1OOTA 1VQNQ 1YBYA 4C0ZA 1VQ8A 1VQKT 1JO8A 1FWZA 4BDZA 3QDRB 3DB3A 4XAXB 3CEYA 4C92G 1X69A 5IHIA 5GMKe 1EFNA 1YJ9A 2FG0A 5GAOp 2EIFA 3EHRA 2P0QA 2DYBA 1CKBA 4ME7A 5KE3A 2HAXA 1WI7A 1GFCA 4UC4A 3MP6A 2VV5A 3HRUA 1X2QA 1T3LA 1R0BG 3A98A 4JRQA 2E6ZA 1QWEA 1YJNQ 4HCBA
chains in the Genus database with same CATH topology
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYZ A;  2P84 A;  2OX7 A; 
#chains in the Genus database with same CATH topology
 2FB7 A;  3CCR T;  3JB9 I;  1SEM A;  1VYT A;  3PE0 A;  1K0S A;  4LDU A;  5CKF A;  4FW1 A;  4RG2 A;  1K9M R;  1G3T A;  5GAO r;  1NG2 A;  2NYS A;  4N0A A;  4L59 A;  1SF9 A;  2DEU A;  1UHF A;  4PFO A;  9ATC B;  2GFU A;  1NE8 A;  2XDD A;  3CC2 T;  4M77 E;  1BCO A;  2DL7 A;  2NLU A;  1UUE A;  2RM4 A;  1O9S A;  5LJ5 e;  2NUT B;  3P8D A;  3NMZ C;  4OMP A;  1WZO A;  3SWN C;  2QGF B;  2L5Q A;  2JM9 A;  2CZ1 B;  3A8L B;  1GBR A;  4FM4 B;  2YSQ A;  5J39 A;  2C0O A;  3MPU B;  2FZK B;  1X6B A;  3OQ5 A;  3CXC A;  1T0H A;  4RCB A;  2IG0 A;  4E2F B;  2NUP B;  4KH0 B;  2DX1 A;  4ZGE B;  2OTJ Q;  1YWO A;  1XTD A;  5GMK l;  3H9N A;  2ZGW A;  4OMO A;  5I22 A;  1NJI C;  1K0X A;  3JCM J;  2K57 A;  4J9I A;  1K73 U;  3THK A;  2LRQ A;  1I5O B;  4BE1 A;  1M27 C;  3L2R A;  3CC7 T;  1MMA A;  3LWH A;  2E4H A;  3M4Y A;  1BI2 A;  2HKN A;  3EGX B;  3EFO B;  5GMK i;  1BB9 A;  1LVK A;  4MDW A;  4M75 D;  4K11 A;  1TSF A;  2XDP A;  4LNP A;  2ZAE A;  2HQE A;  3VS2 A;  2EJF A;  3CD6 A;  4C0F A;  1Q82 C;  1JQQ A;  2K5I A;  2R57 A;  4LXC A;  1Q81 U;  4FL6 A;  3BDL A;  3ME9 A;  1HJD A;  3BY7 A;  2FZG B;  2KGT A;  2W10 A;  2RJE A;  4FSX A;  2RJD A;  3JB9 H;  2RI5 A;  2RHZ A;  2KEA A;  1JJ2 P;  1G5V A;  4PK4 A;  4QQG A;  1G8X A;  1VQP Q;  3TQ7 P;  3NTK A;  3OS5 A;  4EPC A;  3M56 A;  4A54 A;  2VGM A;  4VUB A;  2LX7 A;  4PJO D;  2OTL T;  1Q82 U;  2R5M A;  3M0U A;  2DJZ A;  2RK2 A;  1OUL A;  1ZSZ C;  1K8A U;  4PJO E;  2YLC A;  2RH2 A;  3QHS A;  1ABO A;  2EJG A;  2QQR A;  4QVC A;  5M9O A;  3OYM A;  3M5A A;  4PJL A;  1YIT T;  1WHH A;  5IAY A;  1VQO A;  1LNX A;  4IUT A;  2RO0 A;  2CP5 A;  2E1H A;  2J7I A;  2VKN A;  3GPL A;  4BE0 A;  3TCJ A;  1U1S A;  4DOV A;  2X4X A;  1WDX A;  1Q7Y C;  3MP1 A;  1WNL A;  2QTX A;  2EYZ A;  3SHW A;  1VQN T;  2LC4 A;  2KVQ G;  1VQ7 Q;  4M75 G;  3CCV T;  1KQ2 A;  4FCY A;  1S72 A;  2BE9 B;  2LTO A;  2K9G A;  2LCS A;  3V7S A;  1E6H A;  2VC8 A;  2QEX A;  1Y7X A;  4JPB W;  3QYG B;  2ATC B;  1IHV A;  4BB7 A;  4KH1 B;  4WF2 A;  4GBQ A;  1M4Z A;  3VRZ A;  3OYE A;  2XI9 A;  4X9C A;  2VUB A;  1BBZ A;  2VYT A;  1WYX A;  3HRT A;  3HTR A;  1RAH B;  4M78 G;  2X9H A;  5L8R E;  4F16 A;  2CUB A;  4C0D B;  2EAY A;  3EFS A;  1ARK A;  4M77 B;  2YUO A;  2HZY A;  2KR3 A;  4X34 A;  1AT1 B;  2FHD A;  2RJF A;  3VKI A;  2EKO A;  3QZ5 B;  4J9F A;  5DM7 R;  4OB3 B;  3JCM c;  4AFU C;  4M4Z A;  2LDM A;  1PCX A;  3CME Q;  3RUX A;  1RAC B;  3QYH B;  1GL5 A;  1NLO C;  2O4X A;  4B6M A;  2LJ1 A;  2K79 A;  4DBQ A;  4BUG A;  2QDL A;  3WVE B;  2QEX T;  2DXB A;  3S3N A;  1OU9 A;  2X4J A;  1YCY A;  3QSU A;  3C4S A;  5IT9 E;  1YJW A;  5KCH A;  2YDL A;  4NS5 A;  3QWX X;  3ZL7 C;  1NPR A;  3LW5 E;  3VS5 A;  2A36 A;  2K5F A;  1Q95 G;  2DZC A;  3CMA T;  2LMJ A;  1HD3 A;  2JNG A;  2LP5 A;  5GAO n;  4OB2 B;  5FU6 C;  4ELZ C;  4CC4 B;  3OBY A;  1CSK A;  3HL8 A;  1UDL A;  2QA4 A;  1WIE A;  2FPF A;  4F14 A;  2EYW A;  3PT9 A;  2CKK A;  3E1S A;  1WXU A;  5HCK A;  3OMG A;  2MCN A;  1SKU B;  4E7L A;  2K3Y A;  1YHQ A;  2DER A;  1RAB B;  4FYW B;  4PJO G;  2COY A;  1MGQ A;  2YHT A;  4JRP A;  4FYY B;  2NUZ A;  1TH7 A;  2FVU A;  1QQJ A;  3KUF A;  4C5G A;  2DTH A;  1VQ6 Q;  1XQH A;  3CCM Q;  4XTU A;  1YI2 A;  4O5V A;  4C8Q A;  4QQ6 A;  5KYX A;  4BD3 A;  2CH4 A;  3RBB B;  4C8Q B;  1B34 B;  1N8R C;  1Y96 B;  5LJ3 g;  5GMK h;  2HQH A;  2DK3 A;  3ZFJ A;  1QVF P;  1A0N B;  1UGS B;  2DKG A;  1D1C A;  3E9F A;  3URG A;  2B86 A;  3CD6 T;  3HP9 A;  2KSS A;  2JJ9 A;  3UA7 A;  5FRM A;  3CPW P;  4BI3 A;  5KYW B;  2DRK A;  1M2V A;  1SSF A;  3U23 A;  5GAN 7;  3LH0 A;  2GQI A;  1G3W A;  2PUO B;  3RES A;  1VQL A;  1BI0 A;  4CRI A;  4ZN3 A;  2EFI A;  1N9R A;  1UHC A;  1GCP A;  4A4K A;  3CCS A;  3V7R A;  2LJ0 A;  3X26 B;  1S72 T;  2JUF A;  2HSP A;  1KJW A;  1VUB A;  1BIA A;  5A0G A;  3CPF A;  2F5T X;  2I0N A;  5A0L A;  4J9C A;  1M9S A;  3QII A;  2XMF A;  2F2X A;  2L3R A;  4J5Y A;  3VJP A;  2KDS A;  2EQU A;  2CP6 A;  4OMM A;  4PJO F;  2CZ0 B;  4EIK A;  4XU2 A;  5GAN 4;  1VQK A;  2EGA A;  2YRD A;  1Y0M A;  4OML A;  3RMQ A;  5GAM g;  2LQN A;  3CCJ A;  4IIO A;  3NTI A;  1PSF A;  4IUQ A;  1Y96 A;  3LX7 A;  2JVV A;  4DBH A;  3M0T A;  1U3O A;  2D9T A;  2RJC A;  5GAM e;  1D1B A;  2RQT A;  3G6E T;  4GLM A;  3M58 A;  1ABQ A;  1C1A A;  2COZ A;  3JCM Q;  5I11 A;  1HK9 A;  3P8H A;  4BAC A;  3QWY A;  2J06 A;  4ATO A;  2LNH B;  1VQ5 A;  2NWM A;  3CPW S;  1OZ3 A;  5IXF A;  3L2U A;  1LCK A;  3CCE T;  4PJN A;  2NUP A;  1U8R A;  1ZA1 B;  1X2K A;  7AT1 B;  5KYN A;  1WHG A;  1QP2 A;  1QVP A;  1AHJ B;  3A1P A;  2KMT A;  5IN1 A;  2AKK A;  3DLL A;  1KC8 U;  2DXC A;  3KFV A;  4IUV A;  4JRI A;  4M7D B;  3HKS A;  4XU0 A;  5GAM h;  4M77 D;  1R77 A;  3RNJ A;  3DLM A;  5HK0 A;  1GCQ A;  4BY6 C;  2DBK A;  3NPF A;  4DA4 A;  3G4S A;  3GIB A;  4KBM B;  3JCM f;  2X51 A;  5FWC A;  2FRY A;  5GAO q;  4M7D C;  1E7O A;  4ANJ A;  2DFU A;  2DM1 A;  3HSB A;  2BIV A;  5LL6 S;  4BY6 B;  2ESW A;  1QVG P;  6AT1 B;  4CC7 A;  5FWB A;  2DL5 A;  4A63 B;  2L3S A;  1JEG A;  3VYG A;  5J3B A;  5CKD A;  3CCS Q;  3CCJ Q;  2Y4X A;  5FU6 B;  2GQV A;  4J9D A;  4C8Q G;  3OW2 A;  3JCM W;  5KYY A;  1MMD A;  2QG9 B;  3X28 B;  4MMK A;  5KYY B;  1UB4 A;  1YWP A;  2A37 A;  1WA7 A;  4J8O A;  1M90 C;  3CCV A;  3C12 A;  3M0S A;  3G6E Q;  1AWX A;  4IUR A;  3LH5 A;  4OP0 A;  4AFZ C;  4JZ3 A;  1I07 A;  5LJ5 f;  3WXM B;  5GAN 2;  1QCO A;  3EAE A;  3OB9 A;  3S6W A;  2E41 A;  1M5Q 1;  2ECZ A;  2I2L A;  1KD1 R;  5HKC A;  4FW2 A;  1Q7Y U;  1Y71 A;  1RL2 A;  2AK5 A;  4R56 A;  1AZE A;  2DO3 A;  4PKC C;  1LPL A;  2EYQ A;  3G1J A;  3I55 A;  1UJ0 A;  4AG2 C;  1AVZ C;  5AT1 B;  1KC8 R;  4PJO C;  4RTU A;  2QQB A;  4E7J A;  4JJB A;  2QAZ A;  1XOV A;  4HCK A;  5D6W A;  1D09 B;  2GF7 A;  1M1G A;  2JTM A;  3ZEH A;  4RKU E;  4RUG A;  3LGF A;  4AFS C;  1C0M A;  1VIE A;  2BZY A;  4C0D C;  3A8H B;  4F7U G;  1AWW A;  3JCM h;  3JCM V;  3CCU T;  1RAG B;  2DA9 A;  3A8G B;  3PTA A;  1G2B A;  2GTO A;  2CP0 A;  1WQ7 A;  4IUP A;  5LJ3 h;  1SPK A;  3X20 B;  2XIC A;  5FRO A;  4DBR A;  4ELY C;  3MEU A;  5KH6 A;  1PG5 B;  4OGC A;  4EMH A;  1JJ2 S;  4KGV B;  1D0Z A;  2EYX A;  3M9Q A;  2A0F B;  1KFZ A;  4Z02 A;  2LX9 A;  2RI3 A;  4MDX A;  2E10 A;  3R6O A;  3RKW A;  2DXU A;  3H8Z A;  2PU9 B;  3CC7 Q;  2RMO A;  2F5K A;  1YHQ Q;  1AD5 A;  1BI1 A;  4TVR A;  3LWI A;  2JZ2 A;  1YJW Q;  2CZ6 B;  3EFO A;  1K73 C;  5GAN g;  4LD9 K;  1I1J A;  4M77 G;  1VQ4 T;  4KT0 E;  1OX8 A;  4CI0 C;  4M7A A;  1ZSZ B;  4D8D A;  2H3J A;  3KBG A;  2OTJ T;  1PRL C;  1VQ8 T;  2DL8 A;  3HHT B;  2MPX C;  5HY6 A;  1PD0 A;  3CXC S;  1TU0 B;  2SEM A;  4M77 C;  4JJN K;  2DTO A;  4HKE A;  2CDT A;  3EG9 B;  2EQJ A;  1QVG A;  3NGP A;  4RCC A;  5D6Y A;  4NL3 A;  2MMP A;  2OTL Q;  1NEG A;  3X24 B;  2LQK A;  1CKA A;  1WJR A;  1LJO A;  4M7A F;  2J05 A;  2IPO B;  1GBQ A;  1M8V A;  3G4S T;  2VWF A;  3OY9 A;  4LDX A;  1M3C A;  2F69 A;  3G71 T;  3RIR A;  4HCC A;  3EG3 A;  2EWN A;  3CCE Q;  2E5K A;  1PM3 A;  1AEY A;  1Q86 U;  3RR6 A;  3G71 A;  3C95 A;  4HVW A;  1UGV A;  1EX4 A;  2RF0 A;  3GNF B;  4B9X A;  2X3W D;  1WLP B;  3RKX A;  1KD1 U;  2QEX Q;  2YUP A;  2ZCF B;  1OI1 A;  2J6F A;  4OVA A;  2RK1 A;  1M90 R;  4M78 E;  1NPP A;  3OYN A;  3WVD B;  1UJY A;  4ZGJ B;  2HDA A;  3MEV A;  3DKM A;  1SHG A;  1VQN A;  1OQK A;  2KT8 A;  3M53 A;  4N4H A;  4EMG A;  1NLP C;  4A4E A;  5GJW B;  3VS7 A;  2P4R A;  1WHK A;  3V8J A;  1D3B B;  1KHI A;  1VQP T;  1ZUK A;  2Z0W A;  2HSE B;  2R58 A;  3OYY A;  2X3X D;  1VQ9 Q;  2E3H A;  2DD5 A;  3M0Q A;  4E47 A;  3BDU A;  4JRK A;  5LJ5 h;  1PNJ A;  4FU6 A;  1IHW A;  2KNB B;  3FB9 A;  3QKJ A;  2HKQ B;  3VUB A;  3TU4 K;  4M7D D;  1YJN A;  4AT1 B;  2ZPG B;  1WX6 A;  1X75 C;  2XK0 A;  4KUI A;  4AMC A;  1Q81 R;  2SRC A;  4LUE A;  2VGN A;  2IIM A;  2EQM A;  1ZSG A;  3FJ5 A;  5GMK j;  3GF5 A;  1ZBX A;  1RAI B;  2JTE A;  1M30 A;  3LYI A;  2PNI A;  4E7K A;  1M2V B;  4J9B A;  3OYL A;  4FSS A;  2KRO A;  4A4H A;  1SG5 A;  2A7Y A;  1VQL T;  1FXX A;  2CT3 A;  2DL4 A;  3OYG A;  2EPD A;  1VQ7 T;  1R0C B;  3QZ9 B;  5J26 A;  3PVQ A;  3L2Q A;  1H3H A;  1ZA2 B;  3EH1 A;  2HD0 A;  1WHL A;  4E6R A;  4N4I A;  4YTL A;  2RA2 A;  1KD1 C;  2CP3 A;  3CCL Q;  4Z88 A;  1G83 A;  1W2B P;  1VQL Q;  4DEX A;  4CC2 A;  1AOJ A;  5FLX E;  3QJY A;  1VQ9 A;  3J80 E;  1TOV A;  1W2B A;  2EW3 A;  3CBO A;  3PMT A;  4M75 C;  3VU3 C;  4MZP A;  1VQ6 T;  2DMO A;  2RD1 A;  5KYX B;  1BYM A;  1NZ9 A;  1YHQ T;  4J6Y A;  2E70 A;  2CRE A;  1WJS A;  4HT8 A;  1X43 A;  4F7U E;  2PVG B;  4QVZ A;  2GBQ A;  3VYH B;  1M3A A;  2C06 A;  5KCO A;  3MO8 A;  1RAE B;  3T9N A;  2CZ7 B;  4HXJ A;  1MHN A;  1KHC A;  5CK9 A;  2RQV A;  3I5S A;  1N9S A;  2ZPF B;  2V1R A;  1GFD A;  1O75 A;  4OB0 B;  1QKX A;  2IVW A;  1OX9 A;  3PMI A;  3L1A A;  3INZ A;  4PLL A;  5KYW A;  3CC4 Q;  3VS6 A;  2DNU A;  4RMO A;  1TUD A;  1TWB A;  4KUD K;  4HT9 A;  2EYY A;  1TUG B;  2GGR A;  2RHU A;  4N0A C;  2RI2 A;  3CMA Q;  1QVG S;  4C5I A;  4DQ2 A;  1QWF A;  4R55 A;  1JRI A;  1Q7Y R;  2Y4Y A;  4OMN A;  2V26 A;  2P84 A;  2XG8 D;  3OW2 P;  1NBE B;  2KXC A;  3C94 A;  2C0I A;  1YCS B;  1MNE A;  2L89 A;  3X25 B;  1UE9 A;  3I5R A;  2K3X A;  4LE9 A;  3SWN A;  3M57 A;  1K8A R;  2DLP A;  1JB0 E;  2L3P A;  4IUU A;  5I21 A;  1Q82 R;  1W70 A;  4XTX A;  1B3Q A;  4PJO B;  3CQT A;  4C92 F;  4PJM A;  3M4G A;  1BK2 A;  2PTK A;  3MEA A;  2KAF A;  2FRW A;  3REA B;  1AWJ A;  3QPH A;  4OB1 B;  4QKU A;  2P4T A;  3OSS C;  1MMG A;  1RI9 A;  5GAM j;  2PZ1 A;  1UGQ B;  2WSE E;  3REB B;  3OYD A;  3FLG A;  1M1F A;  4FYV B;  5GAN 3;  1KQS P;  2A08 A;  4JS5 A;  1VQ4 A;  3MEW A;  2DYI A;  1YI2 T;  4RTV A;  1W6X A;  3IQL A;  4DOW A;  4JUV A;  2VVK A;  1I0C A;  2EQK A;  8AT1 B;  3JCM b;  2E5Q A;  3L42 A;  1XNI A;  2DD4 A;  3H0F A;  4Y92 A;  4XU3 A;  5CQX A;  4XTY A;  2DBM A;  3LGL A;  1W4S A;  3RDV A;  1IB8 A;  4ORZ A;  4JLI A;  1TTH B;  5CR2 A;  3FC3 A;  2DET A;  2HL3 A;  3JCM P;  1WXB A;  3C0C A;  4XTZ A;  1FX7 A;  1MUZ A;  4F17 A;  5GAN h;  3EGU A;  5GAM d;  1VOM A;  2EGC A;  1M3B A;  4FIB A;  1M90 U;  3PIP A;  1EIF A;  4C8Q C;  4M78 D;  3EGD A;  3JSC A;  1NJI U;  1V1C A;  2JS2 A;  3FJP A;  4C8Q F;  5CCA A;  2VAS A;  1PKT A;  3CME T;  1PRM C;  2D8J A;  1FYN A;  3ER0 A;  1KK7 A;  1Q86 R;  2X4W A;  3EHQ A;  1TS9 A;  1MV0 B;  2HNI A;  3I55 T;  2KXD A;  5C6S A;  1JXM A;  3J81 E;  4RTX A;  2YT6 A;  2OAU A;  5KYU A;  4ESR A;  2DF6 A;  2FPD A;  3JB9 J;  1VQ6 A;  1H3Z A;  1UTI A;  1H64 1;  4PNO A;  2RQU A;  1QW1 A;  4E7Z A;  1PWT A;  3AT1 B;  1VQ9 T;  2QXF A;  2ENM A;  4WCI A;  2E6N A;  1KG1 A;  2LVM A;  3HFO A;  2EGE A;  2KYM A;  4B9W A;  1MV3 A;  1Q81 C;  2M9U A;  5DY9 A;  3E9G A;  3DB4 A;  4KGZ B;  2RHY A;  2ZPE B;  2M16 A;  5CAI A;  3NFC A;  1K4U S;  3CCR A;  4AFQ C;  3PVL A;  3CPW A;  4GY5 A;  3FDR A;  3OS2 A;  3EG2 A;  4PFP A;  1K9A A;  4XTV A;  2MWP A;  2O2O A;  3CCM A;  3OMC A;  4OMF B;  1WPY A;  4L6V 5;  1PSE A;  4M7A E;  1ZUY A;  4C5H A;  4D6W A;  1SRL A;  1WGS A;  2KRN A;  5FU7 C;  3M59 A;  2KRS A;  4XU1 A;  2QQS A;  2RQW A;  1IGU A;  3N5B B;  3UAT A;  2KBT A;  1QLY A;  5I2S A;  3OS1 A;  3G4S Q;  2OAW A;  3NTH A;  4M78 B;  2OI3 A;  2M0O A;  4KUL A;  2LT1 A;  3UPU A;  4Z8A A;  3JV3 A;  4ZNX A;  5LJ3 e;  2JMC A;  1K9M C;  2DRM A;  1U1T A;  3BE3 A;  1VA7 A;  4J9H A;  3A5Z B;  4LDV A;  3BW1 A;  1BI3 A;  3HRS A;  3CCV Q;  4FT2 A;  3JRZ A;  3VV0 A;  3TEE A;  4XTW A;  5GAM f;  2DE0 X;  4J83 A;  3G71 Q;  4JDS A;  2GTJ A;  4J6W A;  3P8B B;  4C0G A;  4M75 B;  1KC8 C;  4C5E A;  4M7A G;  1LOJ A;  1WJQ A;  2F2W A;  2MF2 A;  1QVF A;  2V1Q A;  5AYF A;  4RTW A;  1I8F A;  3SDZ A;  1OU8 A;  2F2V A;  2JM8 A;  3GBQ A;  2OTL A;  2JT4 A;  3OS0 A;  3CC2 Q;  2ROT A;  1T0J A;  3PNW C;  1NEB A;  2ABL A;  3HFN A;  2DVJ A;  1VQK Q;  3H0I A;  1BCM A;  4PL6 A;  5GAN e;  2AIR B;  4EMK B;  3H41 A;  3CME A;  5IH2 A;  2DVE A;  2MIO A;  3CC2 A;  4X9D A;  1ZBJ A;  3M55 A;  1D3B A;  2RB6 A;  2CUD A;  3VS3 A;  2MOX A;  3PGG A;  1BKB A;  3QXE B;  3ULR B;  3G7Z A;  3I56 T;  3MCA B;  1OPL A;  2X35 A;  1J3T A;  3VRY A;  1OZ2 A;  4II1 A;  1YIJ T;  4C92 C;  3CCL T;  3V7C A;  1HSQ A;  2K7A A;  3UT1 A;  1I81 A;  5A0D A;  2WSF E;  3Q1J A;  4J6X A;  1VIF A;  4OGE A;  4O6J A;  2XID A;  1HYO A;  4IIM A;  1IGQ A;  4RG8 A;  1D0X A;  3EH2 A;  1OV3 A;  4X1V A;  4RTY A;  4V2S A;  3OYJ A;  1V76 A;  1RAF B;  3F70 A;  3CBP A;  2BZ8 A;  3CCL A;  3GP8 A;  3CC7 A;  3D7S B;  5LJ5 j;  2XD0 A;  5GMK m;  1OYX A;  3L2V A;  2L3Q A;  1UGR B;  2DIQ A;  2HQX A;  3SWN B;  3SD4 A;  2YLB A;  3QO3 A;  3A8M B;  3ASK A;  1OEB A;  1PD1 A;  2ED0 A;  2LT4 A;  5GAN 5;  5A2Q E;  1UGP B;  3GLX A;  4J7I A;  4PJO A;  4NL2 A;  2HL5 C;  1VQO T;  4MZT A;  4C92 D;  1N5Z A;  3UF4 A;  1YIT A;  4F7U A;  2CP2 A;  1T3S A;  3CXC P;  5CKB A;  1VQM Q;  1TUC A;  1M1K U;  1G3S A;  1ZLM A;  4L5G A;  2AZS A;  3JCM e;  1TXQ A;  4M75 E;  2E3I A;  1R8O B;  1B34 A;  1VQ8 Q;  2D0Q B;  3QJ6 A;  1DJ7 B;  1U5S A;  2E64 A;  2BE7 D;  2LNV A;  4QW2 A;  1VQM T;  3OYA A;  3S3M A;  4ZGD B;  1KQS S;  3G6E A;  1X01 A;  3E19 A;  5LJ5 d;  2DPP B;  2RN8 A;  4HCZ A;  2CS7 A;  5LJ3 d;  4JJD A;  2DZ9 A;  1KQ1 A;  2HEQ A;  4E7S A;  3QG1 A;  5IXB A;  2DEQ A;  1VYU A;  2MAM A;  4C92 A;  4RTZ A;  5DLO A;  3CCJ T;  2QYZ A;  3VS0 A;  5IHN A;  2BZX A;  5I2M A;  3V8K A;  4N4G A;  4C92 B;  2KY9 A;  2BUD A;  5DLQ E;  2J6K A;  2YUN A;  2RNA A;  1YFN A;  5LJ3 f;  2BTT A;  3MP8 A;  4KRT A;  4QT7 A;  1QP3 A;  4IKF A;  1HXD A;  3RKY A;  5L23 A;  2M0Y A;  4A4G A;  4BI4 A;  4M7A C;  1S1N A;  5IHK A;  2RHX A;  2V8J A;  2C0T A;  3O8V A;  3FEO A;  1H92 A;  4F7U B;  1IRX A;  2X4Y A;  1YP5 A;  4PJJ A;  3OSV A;  3QUI A;  1IRE B;  4M77 F;  3EGD B;  4C8Q E;  1YJ9 T;  2JXB A;  1TG0 A;  2E12 A;  1H8K A;  1WFW A;  2EKH A;  3CCM T;  3UA6 A;  1QKW A;  3I9Q A;  3JCM g;  3TSZ A;  4LN2 A;  1N8R R;  1NYG A;  2QQA A;  1FMW A;  1B07 A;  2KI7 A;  2GNC A;  2V8K A;  5KYU B;  3J7A F;  2QK0 A;  4OF1 A;  5CKE A;  1UG1 A;  2KK4 A;  2YRV A;  3QDF A;  2K5L A;  3TSW A;  1VQ5 Q;  1VQ4 Q;  1UFF A;  4M7D A;  2FL7 A;  4A53 A;  2AKL A;  2CSQ A;  1I5L A;  2HMA A;  1M8M A;  2JMA A;  1K73 R;  1B7T A;  2EBP A;  3JCM X;  5CKH A;  4F7U F;  5CIU A;  3TVT A;  1NYF A;  3EGX A;  2FEI A;  1P92 A;  4HA8 A;  3FRN A;  3CCE A;  1JJ2 A;  5KE2 A;  3CC4 T;  2PUK B;  1GXI E;  3BFM A;  2VB6 A;  4GLK A;  5FRN A;  2HBW A;  4M7D F;  3GNG A;  2P0K A;  4D8K A;  3OYF A;  3L2W A;  2K4Y A;  4JJC A;  4M78 A;  2RQR A;  3NHN A;  4P5N A;  1GCQ C;  2DL3 A;  3EG0 A;  3CCR Q;  1RLQ C;  2V8I A;  4C8Q D;  3L2Z A;  2FYK A;  2XKO C;  2VXE A;  2KT1 A;  4DEY A;  2K3B A;  4C92 E;  4PFZ A;  4CC3 A;  1Y57 A;  2COW A;  2ROL A;  2J6O A;  3JB9 D;  1M1K R;  2LZ6 B;  1ZQ1 A;  3FIF A;  3CCU Q;  3VS1 A;  2EJ9 A;  1KSW A;  3CC4 A;  1YJW T;  2G6F X;  2KRM A;  1X6O A;  5GAN j;  2JS0 A;  4AG1 C;  2QAS A;  1IO6 A;  2ED1 A;  1RUW A;  3ZBD A;  2QDY B;  1KQS A;  3H6Z A;  4WTO B;  2A3L A;  2CT4 A;  1C6V X;  4JZ4 A;  1S72 Q;  1X6G A;  2LQ8 A;  2DTI A;  2FO0 A;  4EMK C;  1VQ7 A;  4Z89 A;  2WSC E;  1D0Y A;  1FMK A;  3CCQ A;  4ZTJ A;  1F1B B;  1YNZ A;  2JW4 A;  3VUZ A;  1Z9Z A;  2L0A A;  1VQO Q;  2MK5 A;  2ZPB B;  3MET A;  1M2O A;  2XDB A;  1WQW A;  5FW9 A;  4A4F A;  2YRC A;  3AHU A;  2CGH A;  4Y28 E;  3M0P A;  3CBM A;  1KIK A;  2YUQ A;  2JTF A;  4E7I A;  3OA6 A;  2NUT A;  1YJN T;  2EQI A;  2FPE A;  2JN0 A;  1N8R U;  1UEC A;  3UDC A;  5GAN f;  1WXT A;  5LJ3 j;  1VQ5 T;  5GAO m;  1JXO A;  2L2P A;  4LDY A;  4M7D E;  2A28 A;  2XHC A;  3JAM E;  3CCQ T;  2MYS A;  3OYH A;  1YIT Q;  3OYK A;  1RLP C;  2G3R A;  2M1H A;  4XK8 E;  1VQP A;  5HK3 A;  4M78 C;  3A8O B;  3MJX A;  1EZZ B;  4QVD A;  3SFM A;  2YWW A;  2BKD N;  3OBW A;  3S3O A;  2CSI A;  1ZUU A;  2K2M A;  2O9V A;  1ACM B;  3MHX A;  2OJ2 A;  2QI2 A;  2GFA A;  1E6G A;  3PFS A;  1W1F A;  1JU5 C;  1IXD A;  4M77 A;  4LUD A;  4OMQ A;  3I56 A;  2DJQ A;  2E65 A;  1RAD B;  1YN8 A;  4RTT A;  4F04 B;  3O5Z A;  3I35 A;  4XQ3 A;  4M7A B;  3RER A;  1K9M U;  3CD6 Q;  3R6N A;  2O31 A;  2HBP A;  4J7F A;  1QCF A;  2KYB A;  2O9S A;  1N6A A;  2JOY A;  3SB2 A;  3GOX A;  1QCN A;  4MZM A;  2ZPI B;  2DIL A;  3CCS T;  4EDU A;  5CVI A;  3CCU A;  1WHM A;  2Y90 A;  1ZSZ A;  2CH4 W;  2VXF A;  3EG1 A;  5GJV B;  2K6D A;  4EMK A;  2YXY A;  1RAA B;  4Q5W A;  3PIO A;  1GRI A;  4FT4 A;  4LDW A;  5GAN 6;  4QQD A;  5CO7 A;  5GAN 8;  3EG9 A;  2EVR A;  4DBF A;  2LCC A;  3SEM A;  1WHJ A;  1VYV A;  2KQW A;  3VS4 A;  1ZX6 A;  1W2B S;  2HCK A;  3QBY A;  2K2V A;  1FMV A;  2LJ3 A;  3M0R A;  2QGG A;  3M54 A;  2OTJ A;  1SHF A;  3JB9 F;  4M75 F;  2DAQ A;  2P0P A;  2F1L A;  4KGX B;  4NOY A;  3LLR A;  2PVD B;  5EG2 A;  1SRM A;  3I56 Q;  1QVF S;  3E2U A;  3RMS A;  1K1Z A;  2LQW A;  1PHT A;  1MMN A;  4ZTF A;  2GCX A;  1K8A C;  1NM7 A;  2LCL A;  4JS4 A;  4M7A D;  1G3Y A;  4M78 F;  3TRE A;  2W0Z A;  2D1X A;  2ZPH B;  2WAC A;  2O4X B;  2B8A A;  1IZ6 A;  4J9G A;  2RPN A;  1X27 A;  1AZG B;  2MI6 A;  1XJW B;  3H0H A;  3UWN A;  2O88 A;  1U06 A;  4PLI A;  3MKD A;  1V29 B;  3OYI A;  1N27 A;  3HPW A;  5ECA A;  3KXT A;  4R0K A;  2QA4 T;  1YIJ A;  2AZV A;  4JLG A;  3V8L A;  5LJ5 g;  5GAN d;  5C0M A;  2D6F A;  5D6X A;  3OYC A;  2O01 E;  3CMA A;  1NJI R;  1JBM A;  2M51 A;  1VQM A;  2PVO B;  1Y07 A;  4BDY A;  2D8H A;  4Y91 A;  1QMC A;  4BE2 A;  4E7H A;  1YI2 Q;  2H8H A;  2D0N A;  8ATC B;  4J9E A;  2XU8 A;  3EFR A;  2DXT A;  5GAO l;  2AT1 B;  1I4K 1;  2OX7 A;  3OYB A;  2KE9 A;  4M75 A;  2MWO A;  2DIG A;  2R5A A;  1AWO A;  3CCQ Q;  2AHJ B;  2FZC B;  2RHI A;  3I55 Q;  4ZN1 A;  1M1K C;  1YJ9 Q;  2H3E B;  1PKS A;  2L8D A;  4HVV A;  1OPK A;  3JB9 G;  1RI0 A;  5D7U A;  2QTV A;  5CQY A;  4MML A;  5EC7 A;  4LD6 A;  1YIJ Q;  4HVU A;  1Z9Q A;  1Q86 C;  1SSH A;  3JCM d;  1UEB A;  1K76 A;  4FYX B;  5FU7 B;  2QA4 Q;  2CYZ B;  2QQ9 A;  4BI8 B;  1D1A A;  1ZHI A;  3OW2 S;  4M7D G;  2CP7 A;  2PQW A;  1BIB A;  2M02 A;  1BU1 A;  1PC0 A;  1MND A;  2ZZD A;  1OOT A;  1VQN Q;  1YBY A;  4C0Z A;  1VQ8 A;  1VQK T;  1JO8 A;  1FWZ A;  4BDZ A;  3QDR B;  3DB3 A;  4XAX B;  3CEY A;  4C92 G;  1X69 A;  5IHI A;  5GMK e;  1EFN A;  1YJ9 A;  2FG0 A;  5GAO p;  2EIF A;  3EHR A;  2P0Q A;  2DYB A;  1CKB A;  4ME7 A;  5KE3 A;  2HAX A;  1WI7 A;  1GFC A;  4UC4 A;  3MP6 A;  2VV5 A;  3HRU A;  1X2Q A;  1T3L A;  1R0B G;  3A98 A;  4JRQ A;  2E6Z A;  1QWE A;  1YJN Q;  4HCB A; 
#chains in the Genus database with same CATH homology
 2QYZ A;  2P84 A;  2OX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...