2OX7A

Crystal structure of protein ef1440 from enterococcus faecalis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
SLIPKFRAWDTYEKEMLENVTPLFDDSNSMIAIITDFQIKGSPGTSEIEIGSYDTTFNWDEFPYVIMQSTGLKDKNGVEIFEGDILVYDAPKKYAHRRSMHEIAYADGRFFWEFLDLVFCQSNILYRDGYLVIGNIHENPELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
publication title Crystal structure of the hypothetical protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 23
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2ox7A02
2.30.30.310 Mainly Beta Roll SH3 type barrels. YopX-like domains 2ox7A01
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH superfamily
3CXCS 4M77F 5EC7A 2LZ6B 1TH7A 3L2ZA 1UGSB 1YP5A 2F2VA 2RHYA 2FPDA 4F16A 5I2MA 4JJBA 1TUCA 5GAMf 3CCRQ 3OSSC 4JRPA 1BI0A 5GAOm 2CT4A 2KRSA 1G8XA 2JOYA 3OS5A 2HQEA 4J7FA 4M75B 3RESA 2QG9B 2X9HA 1SHFA 3G1JA 3ZL7C 3G71Q 2VXFA 3KBGA 3OS2A 1GCPA 4HKEA 2O4XA 3HRUA 2LC4A 1NJIR 2RA2A 3QIIA 1M1KR 1ZBJA 4A4FA 1GFDA 4EMKB 2FRYA 1ZHIA 3EG2A 4QW2A 4II1A 1KSWA 5C0MA 2CKKA 2L2PA 4FYVB 1M2VA 1RAGB 2KNBB 2LQNA 3FLGA 3OQ5A 1DJ7B 3X20B 1OYXA 1VQ5A 1RAFB 2CYZB 4QQ6A 1PD1A 1ZSZB 4J9FA 4X34A 4J8OA 3MO8A 1I5OB 4PLIA 2D9TA 3AT1B 5GANj 4OF1A 2EQUA 4AFUC 4IUTA 3CCEA 2E5QA 3JCMd 3LGLA 3VV0A 4C0DC 3OYDA 1OULA 1OZ2A 1VQ4T 2D6FA 1M8VA 3GLXA 3P8HA 3THKA 5HK3A 4AFZC 1OU9A 2V8KA 1IGQA 1KQ2A 1BYMA 4O6JA 1WXBA 2XIDA 3BFMA 3FDRA 2FPFA 1NLPC 2L3PA 2KI7A 1MGQA 3C4SA 3MJXA 3X28B 3CPWA 1D1AA 2KT1A 4J9CA 1WHGA 1PM3A 1NBEB 3ER0A 1YIJT 2O9SA 3TSZA 2RHXA 3A8LB 5GANg 2EYQA 5CCAA 2XDDA 5GAN7 4DBRA 2O2OA 5KYNA 2RO0A 2NUZA 2M9UA 3CC2A 1I1JA 3OYMA 2COYA 4DEXA 4M75D 1B34A 2JTEA 1QVGP 1QKXA 3LGFA 1Y71A 3G71A 3G6EA 3NPFA 1M9SA 1WHMA 3JB9F 2NUPB 2QQBA 4HCCA 1R8OB 3M5AA 4C8QA 1KD1R 4KULA 2LP5A 2DTIA 2EQIA 1JJ2S 2G6FX 1WHLA 3TVTA 5IHNA 3CPWP 5DM7R 1D09B 2K5LA 4BDYA 1QWEA 1H3HA 3TQ7P 3A1PA 3HRSA 4RG8A 2OTJQ 2VUBA 2QK0A 1UDLA 1C0MA 3VU3C 4HVWA 4M7DF 1FMWA 1MMGA 1UGQB 1N6AA 1UGRB 2EQJA 5AYFA 1HYOA 2HBWA 2CP7A 2DXTA 4M77G 2JS2A 4A4KA 2P4RA 4D8KA 3L2RA 3M0PA 3MEWA 2VVKA 2CP3A 1WIEA 3OB9A 4JS4A 4RG2A 2R57A 3ZFJA 2LMJA 2MOXA 4JJDA 2FYKA 1VQ4Q 1FWZA 1X27A 4C8QC 2DJQA 3HTRA 1M4ZA 2BIVA 5FU6C 2NLUA 3OYIA 2J6FA 2D8HA 4JRKA 1T3SA 3VKIA 1WHKA 1ABOA 1VQ8Q 4J9GA 5I22A 3RKYA 2ROLA 3JB9I 1B3QA 2QGGA 5CR2A 1H641 2BE7D 4XU0A 3JRZA 4J9EA 2KXDA 3LWHA 3T9NA 1QP2A 2MYSA 1BCMA 5KYXB 4EMGA 1YJNT 2XK0A 2KBTA 3QXEB 3EFRA 1AZEA 2ZCFB 3VRYA 3CCST 1IXDA 1ZUUA 1N8RU 1YCYA 3CCVT 4L59A 4MZPA 1EX4A 2A08A 1W1FA 2DBMA 3P8BB 2VYTA 2DE0X 1UEBA 2KYMA 4GLKA 1SPKA 1PRMC 2IPOB 4RTYA 4JUVA 3ZBDA 2KROA 2DXUA 4D8DA 4PJMA 2AZSA 4HCBA 1D3BA 3UDCA 4CI0C 5CKBA 3HFOA 2KR3A 4NOYA 2VKNA 2HSEB 1OX9A 5FU7C 2QA4A 1E7OA 4FW1A 1YN8A 5LJ3e 1AWOA 2KMTA 2KE9A 2KSSA 1W6XA 5LJ3h 5FLXE 2IVWA 3JCMe 1N9RA 2NYSA 3LH0A 3PFSA 4HA8A 1Y0MA 3JB9G 3JCMh 4NL2A 1FXXA 3JCMb 5GAN2 1NJIU 7AT1B 1PSFA 5GMKm 1M1KU 2DNUA 2X3XD 2HBPA 3I5SA 2RI3A 3OYJA 3HL8A 1YIJA 1RLQC 2DETA 5LJ3f 3D7SB 3EGDA 2DD5A 1ZLMA 2DLPA 4M77E 4C5IA 2M51A 1Y7XA 3LX7A 4AFSC 2DL7A 3E19A 3SWNB 5CQXA 1ZUKA 1XTDA 1BK2A 5I21A 5LJ5j 2C06A 2JVVA 4J9HA 2COWA 3M4YA 4QVZA 4DBFA 5KYYB 1V29B 3V7RA 2CP2A 1NPPA 5GAOn 1Y96A 2R5MA 2EAYA 3PNWC 1YJNQ 2FZGB 1M1GA 2E6NA 2ZAEA 1AD5A 1OPLA 4LDXA 1IO6A 3CCSQ 1IRXA 3E1SA 3M0RA 4OMFB 2WACA 4PJJA 2O9VA 5LJ5g 3CCVQ 3OYYA 3BY7A 3X25B 2DXCA 1YJ9T 3VS0A 3A8OB 3UA7A 3H9NA 4M75A 4PFPA 3BDUA 2DKGA 2PUKB 1YHQT 1M90R 5HCKA 3PMTA 2DMOA 1MMNA 4JS5A 5C6SA 1RI9A 3J81E 1UE9A 2YWWA 4DEYA 5GAN8 1AZGB 2P0QA 2L8DA 2EGCA 5HY6A 3META 4RTZA 1KD1U 2PVOB 2KT8A 1IB8A 5LJ5f 3QG1A 2X51A 2K6DA 3H0IA 5D6WA 2KXCA 3VS5A 1ZSZA 4FCYA 2O01E 2ZPBB 4JRIA 5GAN3 2RI5A 3M0UA 4FL6A 4M75G 3FJ5A 3M9QA 2SEMA 2DVEA 4M75C 1WI7A 3M58A 1NJIC 4XQ3A 3NGPA 2OTLT 1K9AA 2ESWA 2HKNA 1YJNA 4M7AB 3NMZC 2ECZA 2QDLA 1PKTA 2YRCA 4J6WA 3WVDB 5IXFA 2LDMA 5GAOl 3CCSA 2JMAA 1WZOA 1YITQ 1TG0A 3CCVA 1N5ZA 2G3RA 5CAIA 4RCBA 3G4SQ 3EG0A 1UFFA 5IN1A 3JCMQ 1KC8C 4XU1A 1NLOC 5J39A 3EGUA 4OMOA 1ZSZC 4ZGEB 3EH1A 4M78B 5GMKe 1I4K1 1BU1A 3OMGA 2L0AA 5GMKh 1YJ9Q 1ACMB 3U23A 2NUPA 1N9SA 4MZTA 1VQKQ 2K3BA 1AWJA 2I0NA 3OW2P 1HXDA 4RTWA 4HT9A 2GQVA 2A36A 1KK7A 1TSFA 1YHQQ 3FRNA 4C92B 1QVFA 4JPBW 4GY5A 2F1LA 1VQPT 2P84A 3QKJA 2E70A 2XICA 3VS6A 2DJZA 2EYZA 4WF2A 5D6XA 1M8MA 1Y07A 4WCIA 2ATCB 1Q82R 1EIFA 3MPUB 3JAME 1MV0B 1QWFA 2CGHA 2YRVA 5GANd 3QYGB 2GFUA 2VGMA 4FYYB 1T3LA 2AK5A 2BE9B 3DLMA 2JM8A 1OU8A 4M7AD 2ZPEB 2RPNA 2ED1A 1VQ7T 2E3HA 2JZ2A 2PNIA 2XHCA 3ME9A 1O75A 2RQRA 1VQ6A 4DBHA 1PNJA 1X6GA 4HT8A 2B86A 4CRIA 3GBQA 2RK1A 1UUEA 4BI8B 3JCMJ 4QQDA 3EGDB 2K3XA 2C0TA 4M75E 2DILA 4F7UA 3OYAA 1VIFA 2BZ8A 1M3BA 2MF2A 1YJ9A 1WJSA 2XI9A 1Q81C 1N27A 3V8LA 2RJFA 2VV5A 5KYXA 5KYUB 3M4GA 3CD6A 5KYWB 4FYWB 1YHQA 3CC4Q 3I56T 4C92D 2RQUA 3RR6A 2SRCA 1GL5A 2KAFA 3RUXA 1SHGA 3RNJA 2RJDA 5KE2A 2E64A 1Q86C 2EKHA 2DVJA 5FWBA 1TOVA 4ZN3A 3PMIA 2MMPA 2RHIA 1VQPQ 2DPPB 3UATA 2I2LA 3SB2A 3ASKA 1H8KA 2YLBA 4C8QF 4XU2A 5KCHA 3L42A 4X9CA 4XTWA 2K3YA 4E7ZA 3CCMT 5CKFA 4MZMA 3VS4A 2GBQA 5CK9A 3EHQA 1D0YA 1VQMA 2AKKA 2EYXA 4AG1C 3QWYA 4P5NA 1UB4A 2OTJT 4OMMA 2XG8D 1S1NA 2OTLA 3CCQT 2OAWA 2DTOA 1UHFA 3WXMB 4J9BA 1M90U 3PE0A 1K0XA 3E2UA 1OPKA 4JZ3A 1VQ7Q 4LUDA 1NYFA 2OX7A 1TU0B 3BE3A 1JJ2A 2FEIA 4OMLA 1OX8A 4XTUA 5CIUA 1BB9A 4F04B 4MDWA 5CO7A 3SWNA 2FHDA 3TCJA 2YUPA 2QDYB 2MK5A 3NTHA 5KYYA 1PRLC 1VQLQ 4PJOB 3RMQA 2H8HA 2Y4YA 4MMLA 4RKUE 4KBMB 3EHRA 1VIEA 1VQ8T 1YBYA 2ZPHB 4PNOA 1K76A 3M0SA 1B07A 2FZCB 3MEUA 5GAOq 1NE8A 2GTOA 3I56Q 3I5RA 1IGUA 4BI3A 1VQPA 3CCRA 3FB9A 2HMAA 4OGCA 3CCJT 2JM9A 3QZ9B 1JJ2P 4FW2A 1G3TA 2RH2A 1C1AA 2NUTB 2FRWA 3VYGA 3SWNC 4Y28E 3RBBB 2AHJB 1WDXA 1M3AA 2F5KA 4NL3A 3EFSA 4KRTA 1ABQA 3GP8A 5GMKl 1AHJB 4E7JA 2K79A 3CCMQ 3EGXB 2BKDN 1VQ7A 3R6OA 2RN8A 2W0ZA 2FB7A 3GIBA 2DAQA 2ENMA 2F69A 2LCLA 4KGZB 3CCQQ 2MIOA 1HD3A 4OVAA 2LQWA 1I07A 3GOXA 4R55A 2PQWA 4AG2C 1QVGS 1CKBA 2LT1A 4KUDK 1RAEB 5DLOA 4PJOD 5IXBA 3DLLA 2CSIA 5EG2A 1Q82U 2DEQA 1OV3A 1VQNT 4C8QG 2VB6A 1H92A 3CCLT 2AZVA 1V76A 2C0IA 4M7AA 1Z9QA 2DL3A 3SD4A 1K9MR 5A2QE 3M53A 5L23A 1W2BS 3CEYA 2HL5C 3ULRB 1UECA 1WJQA 1D0XA 3SEMA 2LX7A 4F7UB 2DYBA 2QI2A 2MCNA 4FT4A 2D1XA 3QJYA 3TEEA 4M78A 2X4YA 5LJ3j 2X35A 2QQAA 1M30A 1PG5B 3S6WA 4E7LA 3CCJQ 5DLQE 2DZCA 4PKCC 4E7SA 1SRLA 4J5YA 3C0CA 1G2BA 3RMSA 1Q95G 2EVRA 4FSXA 4M7AG 1JEGA 1U8RA 4RUGA 2OAUA 2OTJA 2J7IA 2HEQA 4Z02A 4C92A 1RABB 4M7AC 2M1HA 8ATCB 2C0OA 4LDVA 1G3YA 1ZUYA 1XJWB 2M02A 2Y90A 3CCQA 2XD0A 3L2VA 1ZSGA 4M75F 1K73R 1Q7YR 5LJ3g 3VYHB 5IAYA 1D1BA 4NS5A 1WQ7A 3CMET 1M5Q1 2CUDA 3S3MA 3JCMg 4XTVA 3M54A 1M27C 1NPRA 2PZ1A 2GF7A 2FO0A 4M78C 4LDYA 3JB9J 1VQ4A 2E41A 3LLRA 2EPDA 4PFZA 4JLIA 2JS0A 4A4EA 4BACA 5J3BA 1VQ8A 4C92G 3REBB 1WXUA 1VQNQ 1M3CA 3UF4A 4C92C 2MAMA 2LVMA 3CCLQ 2GCXA 3QPHA 5FW9A 1IREB 2L3QA 4BB7A 1G3WA 2GNCA 1ZA2B 1MMDA 1A0NB 2JNGA 4YTLA 4PJOF 3JCMf 1J3TA 1Q82C 3DB4A 3CBOA 1X2KA 2DL5A 3S3NA 2K2VA 4OMQA 2YUNA 1JRIA 1RI0A 5FWCA 3JCMV 3REAB 2K5IA 4KT0E 2X4WA 2XDPA 2KK4A 1RAHB 4C8QE 1JU5C 4HCZA 1FYNA 5KYUA 2ZPFB 5KYWA 1RUWA 1R0CB 1YITT 3QBYA 3RDVA 3G4ST 2E1HA 2HQHA 1VQ9Q 2CDTA 4JJCA 3X26B 3SFMA 4FU6A 3V8JA 4GBQA 2EJ9A 2BUDA 3OYNA 1YI2T 1YFNA 3URGA 1EFNA 1K0SA 2A7YA 2DA9A 4DOVA 1S72T 3CBMA 1LCKA 2PVGB 3MP1A 2MWOA 1UG1A 1D1CA 5GAOp 4EDUA 1VQKT 4PFOA 4EPCA 1FMKA 1N8RC 3JV3A 4QT7A 1JXMA 4F14A 3CMEQ 4L6V5 5FRNA 3M0QA 3JB9H 1H3ZA 1MUZA 4XAXB 2HD0A 2YRDA 1SG5A 4M7AE 3PT9A 2CT3A 3KFVA 2XU8A 3GNGA 3L2QA 1F1BB 1QCNA 3CCLA 5FRMA 5GAMd 1VQOT 4C0ZA 4MDXA 2QEXQ 4BUGA 2EQMA 2VC8A 3R6NA 3EFOA 2DXBA 4RTUA 1X43A 3EAEA 3INZA 5GMKj 3FJPA 2RM4A 2GTJA 3GNFB 2AKLA 2JW4A 4A54A 4DQ2A 2DRKA 4EIKA 1VUBA 3OS0A 3OBYA 3EG9B 1W70A 1I8FA 5KCOA 4FSSA 2X3WD 1SSHA 2QASA 4PJOA 3UWNA 1BI1A 2KDSA 2FG0A 2ZGWA 3OY9A 1M1KC 1TUGB 4J9IA 1LPLA 2LNVA 4C92E 2YXYA 4E7HA 2L3SA 2EQKA 1NEBA 5CKEA 4F7UF 1YJWT 1AOJA 4M4ZA 3VS3A 3A8GB 2CZ0B 4QKUA 2FVUA 1KG1A 5GAOr 1K9MU 1GBQA 1RLPC 1YI2Q 3CQTA 1NG2A 3JCMW 2NUTA 1I0CA 1GBRA 4OP0A 4KGXB 1S72Q 4Z8AA 2W10A 3CC4T 4IIOA 4R0KA 4PJOG 1KIKA 6AT1B 3RIRA 1VYTA 2PVDB 1QCFA 5GAN4 2A37A 3CCET 4PJOC 1K8AR 4XTYA 3HSBA 2CZ7B 2YUOA 3A8MB 1XQHA 1ARKA 1SEMA 1NM7A 2CZ6B 2V26A 3EGXA 2QGFB 4TVRA 5GJVB 3M57A 4OMNA 2KEAA 4CC3A 2QQSA 3RKXA 1JO8A 2PUOB 4ZGDB 1LNXA 3NFCA 1RAIB 1X6BA 1VQOQ 1EZZB 1YWOA 1ZQ1A 3BW1A 4RTVA 2H3EB 4PK4A 2FL7A 2WSFE 2M16A 4JZ4A 3CXCA 1U5SA 4BDZA 1K73U 5IHKA 4JLGA 4BY6B 1Q7YU 2JTMA 1QMCA 1KD1C 2HKQB 3E9FA 2CZ1B 3BDLA 3EG3A 3OW2S 1JB0E 3G6ET 2DF6A 3J7AF 4E47A 1YITA 3G4SA 4LNPA 2LX9A 4M7DB 1QLYA 1PHTA 3MCAB 1RAAB 1QVFP 4CC4B 2WSCE 1YI2A 3OMCA 3NHNA 4C5EA 1AEYA 1PC0A 4LXCA 3UA6A 1CKAA 1YJWQ 4RMOA 1VQLT 2NWMA 4M78D 2E5KA 1KHCA 4F17A 1S72A 2F5TX 2V8JA 1WYXA 2D8JA 1MV3A 3CXCP 2HAXA 2RK2A 4DOWA 4BE1A 2IG0A 1VQKA 4IIMA 2LTOA 3MEVA 4UC4A 2WSEE 3OYKA 1VA7A 4E7KA 1VQ5Q 4C0FA 4EMHA 1K9MC 3L2UA 3LWIA 2RJEA 4C5GA 2AT1B 2EFIA 3CCEQ 2YLCA 4WTOB 4JJNK 1VQOA 2DBKA 2P0KA 4J7IA 2LNHB 1BIBA 3JCMP 4OB0B 4DA4A 3CMAT 1IHVA 5GAN5 1WPYA 5A0LA 2YT6A 2DIGA 4AFQC 2ROTA 1RL2A 4F7UG 3VS7A 4OMPA 1G5VA 4ZTFA 1I81A 2HSPA 2ED0A 3C95A 5GAMh 4PJOE 1KQSS 2LJ3A 1RADB 4BD3A 1WA7A 1WNLA 4HVUA 1XNIA 2MWPA 3VUZA 1K4US 2RJCA 5M9OA 2RF0A 2L89A 4QVCA 5CQYA 2D0NA 2EW3A 2RD1A 4A53A 2EKOA 3PIPA 1NZ9A 5IH2A 3MKDA 2CP6A 3VS2A 4M7DD 1X69A 3CC2Q 1WQWA 1M2OA 4XTZA 1B7TA 3V8KA 4KUIA 1PD0A 3PIOA 2LJ1A 3G6EQ 3EFOB 1BBZA 4A63B 1YJWA 1K73C 2F2XA 1TUDA 1XOVA 3LW5E 4KH1B 4XU3A 1Q7YC 2QQRA 1QW1A 3HRTA 1LJOA 4C5HA 1U3OA 2DERA 1OEBA 3O8VA 3VJPA 2K4YA 2RNAA 4M7AF 1ZBXA 2DK3A 4X9DA 3CC4A 3FIFA 5LJ3d 1QVGA 1KC8R 4D6WA 3GPLA 4IUQA 3O5ZA 1Y57A 4ATOA 3A5ZB 2QA4T 2V1QA 2EIFA 4Z88A 4K11A 4M78F 4Z89A 2ZPIB 1TXQA 2F2WA 4O5VA 4IKFA 2GFAA 4OB3B 2LT4A 3M55A 2EGAA 4JDSA 1X01A 2RQVA 3QO3A 2AIRB 2EBPA 1WHHA 1TS9A 3QYHB 2XKOC 1W2BA 4V2SA 3CMAQ 3UT1A 2EWNA 3QUIA 4RTXA 1OOTA 2KY9A 4C92F 2RHUA 2YUQA 4IUUA 4IUVA 2XDBA 1K1ZA 2DEUA 3C94A 1UTIA 4M77A 1R77A 2EJGA 2YSQA 1K8AU 5GANe 3OYHA 3I55T 3HFNA 5D6YA 4LUEA 4XK8E 3PVQA 3IQLA 2P4TA 5GANh 2BTTA 4E7IA 3V7SA 4F7UE 3HHTB 2K2MA 2L5QA 1TTHB 4N4IA 1I5LA 2J05A 2BZYA 1UJ0A 3H41A 3EG9A 2M0OA 3I35A 1VQLA 1BI3A 3RKWA 2K57A 5GANf 4FT2A 1W2BP 4J83A 2QYZA 1JBMA 2LJ0A 3HP9A 1M90C 3H6ZA 2X4JA 3EG1A 3LH5A 2DM1A 5LJ5d 2ZZDA 2A28A 9ATCB 3CPWS 2QQ9A 3H8ZA 1LVKA 1NEGA 3OYBA 4ME7A 3I56A 1E6HA 1UGPB 2JJ9A 4M77C 2DL8A 2CP5A 3A98A 1Q81R 2QXFA 1AWWA 1MHNA 1MNEA 1QQJA 3MHXA 4ZTJA 3LYIA 2KRNA 2LQKA 2QA4Q 3M0TA 2HCKA 3CMAA 3OYFA 2L3RA 3DKMA 1FMVA 1BCOA 3EH2A 3QWXX 4B9XA 4PLLA 4CC7A 5HKCA 5IT9E 2EYWA 2VXEA 1VQ9T 1Q86R 1W4SA 5IHIA 2X4XA 3CCMA 2KYBA 1TWBA 1VYUA 1YIJQ 2DZ9A 2E65A 2DO3A 3C12A 4ZGJB 4HCKA 5GJWB 2KQWA 1UGVA 1GRIA 3OYGA 1O9SA 3QJ6A 3PVLA 4KH0B 1X75C 3H0HA 2CH4W 1HSQA 4GLMA 1U06A 4MMKA 1PKSA 4L5GA 8AT1B 5KH6A 2HZYA 3CCUT 3OYEA 3OS1A 1IZ6A 3I55Q 2XMFA 4M78G 3M59A 1OI1A 1SKUB 3X24B 5DY9A 3OBWA 1LOJA 4N4GA 2RI2A 1QVPA 1P92A 2PU9B 5CKDA 3SDZA 3QZ5B 1K8AC 4N4HA 4Y92A 3MP6A 2QEXT 4XTXA 3TU4K 4C0DB 3JCMX 1OZ3A 1E6GA 4M7DA 4HVVA 3G7ZA 1T0HA 1GCQA 1WJRA 3JSCA 5CKHA 4ANJA 2RHZA 1QKWA 5D7UA 2O4XB 2MPXC 3L1AA 3UPUA 4FYXB 3VS1A 1SRMA 1D0ZA 1M2VB 3CCJA 4BI4A 2LCSA 1SSFA 2J6OA 4BY6C 5GAN6 1UHCA 2RQWA 1PSEA 3V7CA 1YNZA 3HKSA 5HK0A 2YDLA 2O31A 3GF5A 2JN0A 2HQXA 1BIAA 2CH4A 1VYVA 4M7DG 3DB3A 3OSVA 4LD6A 2CUBA 3FC3A 1UJYA 2V8IA 2E12A 2B8AA 3QDFA 4M7DC 1KC8U 1GCQC 1WXTA 2RB6A 3WVEB 3I55A 5CVIA 1WX6A 3MEAA 4E6RA 2CP0A 1VQ6T 2CSQA 3S3OA 1ZA1B 4LE9A 4ZN1A 3I9QA 1RACB 3N5BB 4PJNA 3CCUQ 2JTFA 5GMKi 2VGNA 2HL3A 5J26A 2CS7A 4QVDA 1IHWA 1JXOA 4PJLA 1AT1B 3KXTA 3CC7T 1GXIE 2Y4XA 2RMOA 2JT4A 1VQNA 1B34B 4M77B 2EJFA 2DFUA 3P8DA 1VOMA 1GFCA 1KFZA 2J06A 4JRQA 1BKBA 1KQ1A 4RCCA 2DYIA 3SHWA 3QSUA 1PCXA 3VUBA 2QTVA 3CD6T 3E9GA 2GQIA 4BE0A 5ECAA 5LJ5e 5AT1B 4C8QB 1JQQA 4LN2A 5I11A 4HXJA 4M78E 2RQTA 4EMKA 5LJ5h 5FU6B 1G3SA 2E10A 4ZNXA 5FROA 1WLPB 1M1FA 2ZPGB 1OQKA 2KVQG 1X2QA 4IURA 4QQGA 4CC2A 1NYGA 3RERA 2K7AA 2OJ2A 4A4GA 1VQ9A 1G83A 2K5FA 1WFWA 2KRMA 3TSWA 3HPWA 5LL6S 4ELZC 3OYLA 2A0FB 3CPFA 3ZEHA 1VQMT 2V1RA 2OI3A 2EGEA 2PTKA 1WHJA 5L8RE 2P0PA 4KGVB 2BZXA 2DTHA 3OW2A 3PTAA 3CCUA 1Q81U 1T0JA 4EMKC 4ESRA 4J6YA 3CMEA 1U1SA 1MMAA 2QAZA 1VQ5T 1VQ6Q 3AHUA 4LDUA 1HJDA 3NTKA 4PL6A 2J6KA 4J6XA 4M77D 2DRMA 3TREA 3QDRB 1YWPA 4LD9K 4M7DE 4AT1B 1R0BG 2QEXA 1Q86U 4B6MA 2O88A 3CC7Q 5FU7B 4C8QD 2JXBA 2R5AA 1Z9ZA 1AVZC 4C0GA 3FEOA 2VWFA 3H0FA 3NTIA 1X6OA 3QHSA 2IIMA 4ELYC 3KUFA 4VUBA 3CD6Q 2MI6A 2CREA 2E4HA 1PWTA 2E3IA 5KE3A 3CCRT 2DX1A 2A3LA 3CC2T 4AMCA 2Z0WA 1C6VX 3JCMc 4N0AA 1MNDA 1SF9A 4DBQA 2JUFA 3F70A 1ZX6A 2ABLA 3L2WA 2FZKB 3G71T 2DIQA 1WGSA 3M56A 1D3BB 3CBPA 2COZA 1KQSA 2K9GA 1KHIA 1AWXA 1HK9A 1CSKA 4FIBA 2HNIA 1FX7A 2H3JA 5GAMj 4OB1B 4RTTA 1BI2A 2FPEA 2HDAA 1QCOA 4R56A 1QP3A 1VQMQ 2JMCA 3PGGA 2DD4A 2QTXA 4BE2A 4IUPA 2OTLQ 4B9WA 5A0DA 1U1TA 2YHTA 4Q5WA 4J9DA 4E2FB 1V1CA 2LQ8A 2M0YA 3Q1JA 4N0AC 2GGRA 2D0QB 4FM4B 3CC7A 2E6ZA 4A4HA 4Y91A 5GAMg 1KJWA 4ORZA 1KQSP 1QVFS 3OYCA 2VASA 1N8RR 5I2SA 3MP8A 1Y96B 2KGTA 2LCCA 2EYYA 4X1VA 2R58A 2LRQA 1YCSB 5A0GA 3A8HB 3VRZA 3J80E 4OGEA 3JB9D 4OB2B 5GAMe 3OA6A 4LDWA 2DL4A
chains in the Genus database with same CATH topology
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYZ A;  2P84 A;  2OX7 A; 
#chains in the Genus database with same CATH topology
 3CXC S;  4M77 F;  5EC7 A;  2LZ6 B;  1TH7 A;  3L2Z A;  1UGS B;  1YP5 A;  2F2V A;  2RHY A;  2FPD A;  4F16 A;  5I2M A;  4JJB A;  1TUC A;  5GAM f;  3CCR Q;  3OSS C;  4JRP A;  1BI0 A;  5GAO m;  2CT4 A;  2KRS A;  1G8X A;  2JOY A;  3OS5 A;  2HQE A;  4J7F A;  4M75 B;  3RES A;  2QG9 B;  2X9H A;  1SHF A;  3G1J A;  3ZL7 C;  3G71 Q;  2VXF A;  3KBG A;  3OS2 A;  1GCP A;  4HKE A;  2O4X A;  3HRU A;  2LC4 A;  1NJI R;  2RA2 A;  3QII A;  1M1K R;  1ZBJ A;  4A4F A;  1GFD A;  4EMK B;  2FRY A;  1ZHI A;  3EG2 A;  4QW2 A;  4II1 A;  1KSW A;  5C0M A;  2CKK A;  2L2P A;  4FYV B;  1M2V A;  1RAG B;  2KNB B;  2LQN A;  3FLG A;  3OQ5 A;  1DJ7 B;  3X20 B;  1OYX A;  1VQ5 A;  1RAF B;  2CYZ B;  4QQ6 A;  1PD1 A;  1ZSZ B;  4J9F A;  4X34 A;  4J8O A;  3MO8 A;  1I5O B;  4PLI A;  2D9T A;  3AT1 B;  5GAN j;  4OF1 A;  2EQU A;  4AFU C;  4IUT A;  3CCE A;  2E5Q A;  3JCM d;  3LGL A;  3VV0 A;  4C0D C;  3OYD A;  1OUL A;  1OZ2 A;  1VQ4 T;  2D6F A;  1M8V A;  3GLX A;  3P8H A;  3THK A;  5HK3 A;  4AFZ C;  1OU9 A;  2V8K A;  1IGQ A;  1KQ2 A;  1BYM A;  4O6J A;  1WXB A;  2XID A;  3BFM A;  3FDR A;  2FPF A;  1NLP C;  2L3P A;  2KI7 A;  1MGQ A;  3C4S A;  3MJX A;  3X28 B;  3CPW A;  1D1A A;  2KT1 A;  4J9C A;  1WHG A;  1PM3 A;  1NBE B;  3ER0 A;  1YIJ T;  2O9S A;  3TSZ A;  2RHX A;  3A8L B;  5GAN g;  2EYQ A;  5CCA A;  2XDD A;  5GAN 7;  4DBR A;  2O2O A;  5KYN A;  2RO0 A;  2NUZ A;  2M9U A;  3CC2 A;  1I1J A;  3OYM A;  2COY A;  4DEX A;  4M75 D;  1B34 A;  2JTE A;  1QVG P;  1QKX A;  3LGF A;  1Y71 A;  3G71 A;  3G6E A;  3NPF A;  1M9S A;  1WHM A;  3JB9 F;  2NUP B;  2QQB A;  4HCC A;  1R8O B;  3M5A A;  4C8Q A;  1KD1 R;  4KUL A;  2LP5 A;  2DTI A;  2EQI A;  1JJ2 S;  2G6F X;  1WHL A;  3TVT A;  5IHN A;  3CPW P;  5DM7 R;  1D09 B;  2K5L A;  4BDY A;  1QWE A;  1H3H A;  3TQ7 P;  3A1P A;  3HRS A;  4RG8 A;  2OTJ Q;  2VUB A;  2QK0 A;  1UDL A;  1C0M A;  3VU3 C;  4HVW A;  4M7D F;  1FMW A;  1MMG A;  1UGQ B;  1N6A A;  1UGR B;  2EQJ A;  5AYF A;  1HYO A;  2HBW A;  2CP7 A;  2DXT A;  4M77 G;  2JS2 A;  4A4K A;  2P4R A;  4D8K A;  3L2R A;  3M0P A;  3MEW A;  2VVK A;  2CP3 A;  1WIE A;  3OB9 A;  4JS4 A;  4RG2 A;  2R57 A;  3ZFJ A;  2LMJ A;  2MOX A;  4JJD A;  2FYK A;  1VQ4 Q;  1FWZ A;  1X27 A;  4C8Q C;  2DJQ A;  3HTR A;  1M4Z A;  2BIV A;  5FU6 C;  2NLU A;  3OYI A;  2J6F A;  2D8H A;  4JRK A;  1T3S A;  3VKI A;  1WHK A;  1ABO A;  1VQ8 Q;  4J9G A;  5I22 A;  3RKY A;  2ROL A;  3JB9 I;  1B3Q A;  2QGG A;  5CR2 A;  1H64 1;  2BE7 D;  4XU0 A;  3JRZ A;  4J9E A;  2KXD A;  3LWH A;  3T9N A;  1QP2 A;  2MYS A;  1BCM A;  5KYX B;  4EMG A;  1YJN T;  2XK0 A;  2KBT A;  3QXE B;  3EFR A;  1AZE A;  2ZCF B;  3VRY A;  3CCS T;  1IXD A;  1ZUU A;  1N8R U;  1YCY A;  3CCV T;  4L59 A;  4MZP A;  1EX4 A;  2A08 A;  1W1F A;  2DBM A;  3P8B B;  2VYT A;  2DE0 X;  1UEB A;  2KYM A;  4GLK A;  1SPK A;  1PRM C;  2IPO B;  4RTY A;  4JUV A;  3ZBD A;  2KRO A;  2DXU A;  4D8D A;  4PJM A;  2AZS A;  4HCB A;  1D3B A;  3UDC A;  4CI0 C;  5CKB A;  3HFO A;  2KR3 A;  4NOY A;  2VKN A;  2HSE B;  1OX9 A;  5FU7 C;  2QA4 A;  1E7O A;  4FW1 A;  1YN8 A;  5LJ3 e;  1AWO A;  2KMT A;  2KE9 A;  2KSS A;  1W6X A;  5LJ3 h;  5FLX E;  2IVW A;  3JCM e;  1N9R A;  2NYS A;  3LH0 A;  3PFS A;  4HA8 A;  1Y0M A;  3JB9 G;  3JCM h;  4NL2 A;  1FXX A;  3JCM b;  5GAN 2;  1NJI U;  7AT1 B;  1PSF A;  5GMK m;  1M1K U;  2DNU A;  2X3X D;  2HBP A;  3I5S A;  2RI3 A;  3OYJ A;  3HL8 A;  1YIJ A;  1RLQ C;  2DET A;  5LJ3 f;  3D7S B;  3EGD A;  2DD5 A;  1ZLM A;  2DLP A;  4M77 E;  4C5I A;  2M51 A;  1Y7X A;  3LX7 A;  4AFS C;  2DL7 A;  3E19 A;  3SWN B;  5CQX A;  1ZUK A;  1XTD A;  1BK2 A;  5I21 A;  5LJ5 j;  2C06 A;  2JVV A;  4J9H A;  2COW A;  3M4Y A;  4QVZ A;  4DBF A;  5KYY B;  1V29 B;  3V7R A;  2CP2 A;  1NPP A;  5GAO n;  1Y96 A;  2R5M A;  2EAY A;  3PNW C;  1YJN Q;  2FZG B;  1M1G A;  2E6N A;  2ZAE A;  1AD5 A;  1OPL A;  4LDX A;  1IO6 A;  3CCS Q;  1IRX A;  3E1S A;  3M0R A;  4OMF B;  2WAC A;  4PJJ A;  2O9V A;  5LJ5 g;  3CCV Q;  3OYY A;  3BY7 A;  3X25 B;  2DXC A;  1YJ9 T;  3VS0 A;  3A8O B;  3UA7 A;  3H9N A;  4M75 A;  4PFP A;  3BDU A;  2DKG A;  2PUK B;  1YHQ T;  1M90 R;  5HCK A;  3PMT A;  2DMO A;  1MMN A;  4JS5 A;  5C6S A;  1RI9 A;  3J81 E;  1UE9 A;  2YWW A;  4DEY A;  5GAN 8;  1AZG B;  2P0Q A;  2L8D A;  2EGC A;  5HY6 A;  3MET A;  4RTZ A;  1KD1 U;  2PVO B;  2KT8 A;  1IB8 A;  5LJ5 f;  3QG1 A;  2X51 A;  2K6D A;  3H0I A;  5D6W A;  2KXC A;  3VS5 A;  1ZSZ A;  4FCY A;  2O01 E;  2ZPB B;  4JRI A;  5GAN 3;  2RI5 A;  3M0U A;  4FL6 A;  4M75 G;  3FJ5 A;  3M9Q A;  2SEM A;  2DVE A;  4M75 C;  1WI7 A;  3M58 A;  1NJI C;  4XQ3 A;  3NGP A;  2OTL T;  1K9A A;  2ESW A;  2HKN A;  1YJN A;  4M7A B;  3NMZ C;  2ECZ A;  2QDL A;  1PKT A;  2YRC A;  4J6W A;  3WVD B;  5IXF A;  2LDM A;  5GAO l;  3CCS A;  2JMA A;  1WZO A;  1YIT Q;  1TG0 A;  3CCV A;  1N5Z A;  2G3R A;  5CAI A;  4RCB A;  3G4S Q;  3EG0 A;  1UFF A;  5IN1 A;  3JCM Q;  1KC8 C;  4XU1 A;  1NLO C;  5J39 A;  3EGU A;  4OMO A;  1ZSZ C;  4ZGE B;  3EH1 A;  4M78 B;  5GMK e;  1I4K 1;  1BU1 A;  3OMG A;  2L0A A;  5GMK h;  1YJ9 Q;  1ACM B;  3U23 A;  2NUP A;  1N9S A;  4MZT A;  1VQK Q;  2K3B A;  1AWJ A;  2I0N A;  3OW2 P;  1HXD A;  4RTW A;  4HT9 A;  2GQV A;  2A36 A;  1KK7 A;  1TSF A;  1YHQ Q;  3FRN A;  4C92 B;  1QVF A;  4JPB W;  4GY5 A;  2F1L A;  1VQP T;  2P84 A;  3QKJ A;  2E70 A;  2XIC A;  3VS6 A;  2DJZ A;  2EYZ A;  4WF2 A;  5D6X A;  1M8M A;  1Y07 A;  4WCI A;  2ATC B;  1Q82 R;  1EIF A;  3MPU B;  3JAM E;  1MV0 B;  1QWF A;  2CGH A;  2YRV A;  5GAN d;  3QYG B;  2GFU A;  2VGM A;  4FYY B;  1T3L A;  2AK5 A;  2BE9 B;  3DLM A;  2JM8 A;  1OU8 A;  4M7A D;  2ZPE B;  2RPN A;  2ED1 A;  1VQ7 T;  2E3H A;  2JZ2 A;  2PNI A;  2XHC A;  3ME9 A;  1O75 A;  2RQR A;  1VQ6 A;  4DBH A;  1PNJ A;  1X6G A;  4HT8 A;  2B86 A;  4CRI A;  3GBQ A;  2RK1 A;  1UUE A;  4BI8 B;  3JCM J;  4QQD A;  3EGD B;  2K3X A;  2C0T A;  4M75 E;  2DIL A;  4F7U A;  3OYA A;  1VIF A;  2BZ8 A;  1M3B A;  2MF2 A;  1YJ9 A;  1WJS A;  2XI9 A;  1Q81 C;  1N27 A;  3V8L A;  2RJF A;  2VV5 A;  5KYX A;  5KYU B;  3M4G A;  3CD6 A;  5KYW B;  4FYW B;  1YHQ A;  3CC4 Q;  3I56 T;  4C92 D;  2RQU A;  3RR6 A;  2SRC A;  1GL5 A;  2KAF A;  3RUX A;  1SHG A;  3RNJ A;  2RJD A;  5KE2 A;  2E64 A;  1Q86 C;  2EKH A;  2DVJ A;  5FWB A;  1TOV A;  4ZN3 A;  3PMI A;  2MMP A;  2RHI A;  1VQP Q;  2DPP B;  3UAT A;  2I2L A;  3SB2 A;  3ASK A;  1H8K A;  2YLB A;  4C8Q F;  4XU2 A;  5KCH A;  3L42 A;  4X9C A;  4XTW A;  2K3Y A;  4E7Z A;  3CCM T;  5CKF A;  4MZM A;  3VS4 A;  2GBQ A;  5CK9 A;  3EHQ A;  1D0Y A;  1VQM A;  2AKK A;  2EYX A;  4AG1 C;  3QWY A;  4P5N A;  1UB4 A;  2OTJ T;  4OMM A;  2XG8 D;  1S1N A;  2OTL A;  3CCQ T;  2OAW A;  2DTO A;  1UHF A;  3WXM B;  4J9B A;  1M90 U;  3PE0 A;  1K0X A;  3E2U A;  1OPK A;  4JZ3 A;  1VQ7 Q;  4LUD A;  1NYF A;  2OX7 A;  1TU0 B;  3BE3 A;  1JJ2 A;  2FEI A;  4OML A;  1OX8 A;  4XTU A;  5CIU A;  1BB9 A;  4F04 B;  4MDW A;  5CO7 A;  3SWN A;  2FHD A;  3TCJ A;  2YUP A;  2QDY B;  2MK5 A;  3NTH A;  5KYY A;  1PRL C;  1VQL Q;  4PJO B;  3RMQ A;  2H8H A;  2Y4Y A;  4MML A;  4RKU E;  4KBM B;  3EHR A;  1VIE A;  1VQ8 T;  1YBY A;  2ZPH B;  4PNO A;  1K76 A;  3M0S A;  1B07 A;  2FZC B;  3MEU A;  5GAO q;  1NE8 A;  2GTO A;  3I56 Q;  3I5R A;  1IGU A;  4BI3 A;  1VQP A;  3CCR A;  3FB9 A;  2HMA A;  4OGC A;  3CCJ T;  2JM9 A;  3QZ9 B;  1JJ2 P;  4FW2 A;  1G3T A;  2RH2 A;  1C1A A;  2NUT B;  2FRW A;  3VYG A;  3SWN C;  4Y28 E;  3RBB B;  2AHJ B;  1WDX A;  1M3A A;  2F5K A;  4NL3 A;  3EFS A;  4KRT A;  1ABQ A;  3GP8 A;  5GMK l;  1AHJ B;  4E7J A;  2K79 A;  3CCM Q;  3EGX B;  2BKD N;  1VQ7 A;  3R6O A;  2RN8 A;  2W0Z A;  2FB7 A;  3GIB A;  2DAQ A;  2ENM A;  2F69 A;  2LCL A;  4KGZ B;  3CCQ Q;  2MIO A;  1HD3 A;  4OVA A;  2LQW A;  1I07 A;  3GOX A;  4R55 A;  2PQW A;  4AG2 C;  1QVG S;  1CKB A;  2LT1 A;  4KUD K;  1RAE B;  5DLO A;  4PJO D;  5IXB A;  3DLL A;  2CSI A;  5EG2 A;  1Q82 U;  2DEQ A;  1OV3 A;  1VQN T;  4C8Q G;  2VB6 A;  1H92 A;  3CCL T;  2AZV A;  1V76 A;  2C0I A;  4M7A A;  1Z9Q A;  2DL3 A;  3SD4 A;  1K9M R;  5A2Q E;  3M53 A;  5L23 A;  1W2B S;  3CEY A;  2HL5 C;  3ULR B;  1UEC A;  1WJQ A;  1D0X A;  3SEM A;  2LX7 A;  4F7U B;  2DYB A;  2QI2 A;  2MCN A;  4FT4 A;  2D1X A;  3QJY A;  3TEE A;  4M78 A;  2X4Y A;  5LJ3 j;  2X35 A;  2QQA A;  1M30 A;  1PG5 B;  3S6W A;  4E7L A;  3CCJ Q;  5DLQ E;  2DZC A;  4PKC C;  4E7S A;  1SRL A;  4J5Y A;  3C0C A;  1G2B A;  3RMS A;  1Q95 G;  2EVR A;  4FSX A;  4M7A G;  1JEG A;  1U8R A;  4RUG A;  2OAU A;  2OTJ A;  2J7I A;  2HEQ A;  4Z02 A;  4C92 A;  1RAB B;  4M7A C;  2M1H A;  8ATC B;  2C0O A;  4LDV A;  1G3Y A;  1ZUY A;  1XJW B;  2M02 A;  2Y90 A;  3CCQ A;  2XD0 A;  3L2V A;  1ZSG A;  4M75 F;  1K73 R;  1Q7Y R;  5LJ3 g;  3VYH B;  5IAY A;  1D1B A;  4NS5 A;  1WQ7 A;  3CME T;  1M5Q 1;  2CUD A;  3S3M A;  3JCM g;  4XTV A;  3M54 A;  1M27 C;  1NPR A;  2PZ1 A;  2GF7 A;  2FO0 A;  4M78 C;  4LDY A;  3JB9 J;  1VQ4 A;  2E41 A;  3LLR A;  2EPD A;  4PFZ A;  4JLI A;  2JS0 A;  4A4E A;  4BAC A;  5J3B A;  1VQ8 A;  4C92 G;  3REB B;  1WXU A;  1VQN Q;  1M3C A;  3UF4 A;  4C92 C;  2MAM A;  2LVM A;  3CCL Q;  2GCX A;  3QPH A;  5FW9 A;  1IRE B;  2L3Q A;  4BB7 A;  1G3W A;  2GNC A;  1ZA2 B;  1MMD A;  1A0N B;  2JNG A;  4YTL A;  4PJO F;  3JCM f;  1J3T A;  1Q82 C;  3DB4 A;  3CBO A;  1X2K A;  2DL5 A;  3S3N A;  2K2V A;  4OMQ A;  2YUN A;  1JRI A;  1RI0 A;  5FWC A;  3JCM V;  3REA B;  2K5I A;  4KT0 E;  2X4W A;  2XDP A;  2KK4 A;  1RAH B;  4C8Q E;  1JU5 C;  4HCZ A;  1FYN A;  5KYU A;  2ZPF B;  5KYW A;  1RUW A;  1R0C B;  1YIT T;  3QBY A;  3RDV A;  3G4S T;  2E1H A;  2HQH A;  1VQ9 Q;  2CDT A;  4JJC A;  3X26 B;  3SFM A;  4FU6 A;  3V8J A;  4GBQ A;  2EJ9 A;  2BUD A;  3OYN A;  1YI2 T;  1YFN A;  3URG A;  1EFN A;  1K0S A;  2A7Y A;  2DA9 A;  4DOV A;  1S72 T;  3CBM A;  1LCK A;  2PVG B;  3MP1 A;  2MWO A;  1UG1 A;  1D1C A;  5GAO p;  4EDU A;  1VQK T;  4PFO A;  4EPC A;  1FMK A;  1N8R C;  3JV3 A;  4QT7 A;  1JXM A;  4F14 A;  3CME Q;  4L6V 5;  5FRN A;  3M0Q A;  3JB9 H;  1H3Z A;  1MUZ A;  4XAX B;  2HD0 A;  2YRD A;  1SG5 A;  4M7A E;  3PT9 A;  2CT3 A;  3KFV A;  2XU8 A;  3GNG A;  3L2Q A;  1F1B B;  1QCN A;  3CCL A;  5FRM A;  5GAM d;  1VQO T;  4C0Z A;  4MDX A;  2QEX Q;  4BUG A;  2EQM A;  2VC8 A;  3R6N A;  3EFO A;  2DXB A;  4RTU A;  1X43 A;  3EAE A;  3INZ A;  5GMK j;  3FJP A;  2RM4 A;  2GTJ A;  3GNF B;  2AKL A;  2JW4 A;  4A54 A;  4DQ2 A;  2DRK A;  4EIK A;  1VUB A;  3OS0 A;  3OBY A;  3EG9 B;  1W70 A;  1I8F A;  5KCO A;  4FSS A;  2X3W D;  1SSH A;  2QAS A;  4PJO A;  3UWN A;  1BI1 A;  2KDS A;  2FG0 A;  2ZGW A;  3OY9 A;  1M1K C;  1TUG B;  4J9I A;  1LPL A;  2LNV A;  4C92 E;  2YXY A;  4E7H A;  2L3S A;  2EQK A;  1NEB A;  5CKE A;  4F7U F;  1YJW T;  1AOJ A;  4M4Z A;  3VS3 A;  3A8G B;  2CZ0 B;  4QKU A;  2FVU A;  1KG1 A;  5GAO r;  1K9M U;  1GBQ A;  1RLP C;  1YI2 Q;  3CQT A;  1NG2 A;  3JCM W;  2NUT A;  1I0C A;  1GBR A;  4OP0 A;  4KGX B;  1S72 Q;  4Z8A A;  2W10 A;  3CC4 T;  4IIO A;  4R0K A;  4PJO G;  1KIK A;  6AT1 B;  3RIR A;  1VYT A;  2PVD B;  1QCF A;  5GAN 4;  2A37 A;  3CCE T;  4PJO C;  1K8A R;  4XTY A;  3HSB A;  2CZ7 B;  2YUO A;  3A8M B;  1XQH A;  1ARK A;  1SEM A;  1NM7 A;  2CZ6 B;  2V26 A;  3EGX A;  2QGF B;  4TVR A;  5GJV B;  3M57 A;  4OMN A;  2KEA A;  4CC3 A;  2QQS A;  3RKX A;  1JO8 A;  2PUO B;  4ZGD B;  1LNX A;  3NFC A;  1RAI B;  1X6B A;  1VQO Q;  1EZZ B;  1YWO A;  1ZQ1 A;  3BW1 A;  4RTV A;  2H3E B;  4PK4 A;  2FL7 A;  2WSF E;  2M16 A;  4JZ4 A;  3CXC A;  1U5S A;  4BDZ A;  1K73 U;  5IHK A;  4JLG A;  4BY6 B;  1Q7Y U;  2JTM A;  1QMC A;  1KD1 C;  2HKQ B;  3E9F A;  2CZ1 B;  3BDL A;  3EG3 A;  3OW2 S;  1JB0 E;  3G6E T;  2DF6 A;  3J7A F;  4E47 A;  1YIT A;  3G4S A;  4LNP A;  2LX9 A;  4M7D B;  1QLY A;  1PHT A;  3MCA B;  1RAA B;  1QVF P;  4CC4 B;  2WSC E;  1YI2 A;  3OMC A;  3NHN A;  4C5E A;  1AEY A;  1PC0 A;  4LXC A;  3UA6 A;  1CKA A;  1YJW Q;  4RMO A;  1VQL T;  2NWM A;  4M78 D;  2E5K A;  1KHC A;  4F17 A;  1S72 A;  2F5T X;  2V8J A;  1WYX A;  2D8J A;  1MV3 A;  3CXC P;  2HAX A;  2RK2 A;  4DOW A;  4BE1 A;  2IG0 A;  1VQK A;  4IIM A;  2LTO A;  3MEV A;  4UC4 A;  2WSE E;  3OYK A;  1VA7 A;  4E7K A;  1VQ5 Q;  4C0F A;  4EMH A;  1K9M C;  3L2U A;  3LWI A;  2RJE A;  4C5G A;  2AT1 B;  2EFI A;  3CCE Q;  2YLC A;  4WTO B;  4JJN K;  1VQO A;  2DBK A;  2P0K A;  4J7I A;  2LNH B;  1BIB A;  3JCM P;  4OB0 B;  4DA4 A;  3CMA T;  1IHV A;  5GAN 5;  1WPY A;  5A0L A;  2YT6 A;  2DIG A;  4AFQ C;  2ROT A;  1RL2 A;  4F7U G;  3VS7 A;  4OMP A;  1G5V A;  4ZTF A;  1I81 A;  2HSP A;  2ED0 A;  3C95 A;  5GAM h;  4PJO E;  1KQS S;  2LJ3 A;  1RAD B;  4BD3 A;  1WA7 A;  1WNL A;  4HVU A;  1XNI A;  2MWP A;  3VUZ A;  1K4U S;  2RJC A;  5M9O A;  2RF0 A;  2L89 A;  4QVC A;  5CQY A;  2D0N A;  2EW3 A;  2RD1 A;  4A53 A;  2EKO A;  3PIP A;  1NZ9 A;  5IH2 A;  3MKD A;  2CP6 A;  3VS2 A;  4M7D D;  1X69 A;  3CC2 Q;  1WQW A;  1M2O A;  4XTZ A;  1B7T A;  3V8K A;  4KUI A;  1PD0 A;  3PIO A;  2LJ1 A;  3G6E Q;  3EFO B;  1BBZ A;  4A63 B;  1YJW A;  1K73 C;  2F2X A;  1TUD A;  1XOV A;  3LW5 E;  4KH1 B;  4XU3 A;  1Q7Y C;  2QQR A;  1QW1 A;  3HRT A;  1LJO A;  4C5H A;  1U3O A;  2DER A;  1OEB A;  3O8V A;  3VJP A;  2K4Y A;  2RNA A;  4M7A F;  1ZBX A;  2DK3 A;  4X9D A;  3CC4 A;  3FIF A;  5LJ3 d;  1QVG A;  1KC8 R;  4D6W A;  3GPL A;  4IUQ A;  3O5Z A;  1Y57 A;  4ATO A;  3A5Z B;  2QA4 T;  2V1Q A;  2EIF A;  4Z88 A;  4K11 A;  4M78 F;  4Z89 A;  2ZPI B;  1TXQ A;  2F2W A;  4O5V A;  4IKF A;  2GFA A;  4OB3 B;  2LT4 A;  3M55 A;  2EGA A;  4JDS A;  1X01 A;  2RQV A;  3QO3 A;  2AIR B;  2EBP A;  1WHH A;  1TS9 A;  3QYH B;  2XKO C;  1W2B A;  4V2S A;  3CMA Q;  3UT1 A;  2EWN A;  3QUI A;  4RTX A;  1OOT A;  2KY9 A;  4C92 F;  2RHU A;  2YUQ A;  4IUU A;  4IUV A;  2XDB A;  1K1Z A;  2DEU A;  3C94 A;  1UTI A;  4M77 A;  1R77 A;  2EJG A;  2YSQ A;  1K8A U;  5GAN e;  3OYH A;  3I55 T;  3HFN A;  5D6Y A;  4LUE A;  4XK8 E;  3PVQ A;  3IQL A;  2P4T A;  5GAN h;  2BTT A;  4E7I A;  3V7S A;  4F7U E;  3HHT B;  2K2M A;  2L5Q A;  1TTH B;  4N4I A;  1I5L A;  2J05 A;  2BZY A;  1UJ0 A;  3H41 A;  3EG9 A;  2M0O A;  3I35 A;  1VQL A;  1BI3 A;  3RKW A;  2K57 A;  5GAN f;  4FT2 A;  1W2B P;  4J83 A;  2QYZ A;  1JBM A;  2LJ0 A;  3HP9 A;  1M90 C;  3H6Z A;  2X4J A;  3EG1 A;  3LH5 A;  2DM1 A;  5LJ5 d;  2ZZD A;  2A28 A;  9ATC B;  3CPW S;  2QQ9 A;  3H8Z A;  1LVK A;  1NEG A;  3OYB A;  4ME7 A;  3I56 A;  1E6H A;  1UGP B;  2JJ9 A;  4M77 C;  2DL8 A;  2CP5 A;  3A98 A;  1Q81 R;  2QXF A;  1AWW A;  1MHN A;  1MNE A;  1QQJ A;  3MHX A;  4ZTJ A;  3LYI A;  2KRN A;  2LQK A;  2QA4 Q;  3M0T A;  2HCK A;  3CMA A;  3OYF A;  2L3R A;  3DKM A;  1FMV A;  1BCO A;  3EH2 A;  3QWX X;  4B9X A;  4PLL A;  4CC7 A;  5HKC A;  5IT9 E;  2EYW A;  2VXE A;  1VQ9 T;  1Q86 R;  1W4S A;  5IHI A;  2X4X A;  3CCM A;  2KYB A;  1TWB A;  1VYU A;  1YIJ Q;  2DZ9 A;  2E65 A;  2DO3 A;  3C12 A;  4ZGJ B;  4HCK A;  5GJW B;  2KQW A;  1UGV A;  1GRI A;  3OYG A;  1O9S A;  3QJ6 A;  3PVL A;  4KH0 B;  1X75 C;  3H0H A;  2CH4 W;  1HSQ A;  4GLM A;  1U06 A;  4MMK A;  1PKS A;  4L5G A;  8AT1 B;  5KH6 A;  2HZY A;  3CCU T;  3OYE A;  3OS1 A;  1IZ6 A;  3I55 Q;  2XMF A;  4M78 G;  3M59 A;  1OI1 A;  1SKU B;  3X24 B;  5DY9 A;  3OBW A;  1LOJ A;  4N4G A;  2RI2 A;  1QVP A;  1P92 A;  2PU9 B;  5CKD A;  3SDZ A;  3QZ5 B;  1K8A C;  4N4H A;  4Y92 A;  3MP6 A;  2QEX T;  4XTX A;  3TU4 K;  4C0D B;  3JCM X;  1OZ3 A;  1E6G A;  4M7D A;  4HVV A;  3G7Z A;  1T0H A;  1GCQ A;  1WJR A;  3JSC A;  5CKH A;  4ANJ A;  2RHZ A;  1QKW A;  5D7U A;  2O4X B;  2MPX C;  3L1A A;  3UPU A;  4FYX B;  3VS1 A;  1SRM A;  1D0Z A;  1M2V B;  3CCJ A;  4BI4 A;  2LCS A;  1SSF A;  2J6O A;  4BY6 C;  5GAN 6;  1UHC A;  2RQW A;  1PSE A;  3V7C A;  1YNZ A;  3HKS A;  5HK0 A;  2YDL A;  2O31 A;  3GF5 A;  2JN0 A;  2HQX A;  1BIA A;  2CH4 A;  1VYV A;  4M7D G;  3DB3 A;  3OSV A;  4LD6 A;  2CUB A;  3FC3 A;  1UJY A;  2V8I A;  2E12 A;  2B8A A;  3QDF A;  4M7D C;  1KC8 U;  1GCQ C;  1WXT A;  2RB6 A;  3WVE B;  3I55 A;  5CVI A;  1WX6 A;  3MEA A;  4E6R A;  2CP0 A;  1VQ6 T;  2CSQ A;  3S3O A;  1ZA1 B;  4LE9 A;  4ZN1 A;  3I9Q A;  1RAC B;  3N5B B;  4PJN A;  3CCU Q;  2JTF A;  5GMK i;  2VGN A;  2HL3 A;  5J26 A;  2CS7 A;  4QVD A;  1IHW A;  1JXO A;  4PJL A;  1AT1 B;  3KXT A;  3CC7 T;  1GXI E;  2Y4X A;  2RMO A;  2JT4 A;  1VQN A;  1B34 B;  4M77 B;  2EJF A;  2DFU A;  3P8D A;  1VOM A;  1GFC A;  1KFZ A;  2J06 A;  4JRQ A;  1BKB A;  1KQ1 A;  4RCC A;  2DYI A;  3SHW A;  3QSU A;  1PCX A;  3VUB A;  2QTV A;  3CD6 T;  3E9G A;  2GQI A;  4BE0 A;  5ECA A;  5LJ5 e;  5AT1 B;  4C8Q B;  1JQQ A;  4LN2 A;  5I11 A;  4HXJ A;  4M78 E;  2RQT A;  4EMK A;  5LJ5 h;  5FU6 B;  1G3S A;  2E10 A;  4ZNX A;  5FRO A;  1WLP B;  1M1F A;  2ZPG B;  1OQK A;  2KVQ G;  1X2Q A;  4IUR A;  4QQG A;  4CC2 A;  1NYG A;  3RER A;  2K7A A;  2OJ2 A;  4A4G A;  1VQ9 A;  1G83 A;  2K5F A;  1WFW A;  2KRM A;  3TSW A;  3HPW A;  5LL6 S;  4ELZ C;  3OYL A;  2A0F B;  3CPF A;  3ZEH A;  1VQM T;  2V1R A;  2OI3 A;  2EGE A;  2PTK A;  1WHJ A;  5L8R E;  2P0P A;  4KGV B;  2BZX A;  2DTH A;  3OW2 A;  3PTA A;  3CCU A;  1Q81 U;  1T0J A;  4EMK C;  4ESR A;  4J6Y A;  3CME A;  1U1S A;  1MMA A;  2QAZ A;  1VQ5 T;  1VQ6 Q;  3AHU A;  4LDU A;  1HJD A;  3NTK A;  4PL6 A;  2J6K A;  4J6X A;  4M77 D;  2DRM A;  3TRE A;  3QDR B;  1YWP A;  4LD9 K;  4M7D E;  4AT1 B;  1R0B G;  2QEX A;  1Q86 U;  4B6M A;  2O88 A;  3CC7 Q;  5FU7 B;  4C8Q D;  2JXB A;  2R5A A;  1Z9Z A;  1AVZ C;  4C0G A;  3FEO A;  2VWF A;  3H0F A;  3NTI A;  1X6O A;  3QHS A;  2IIM A;  4ELY C;  3KUF A;  4VUB A;  3CD6 Q;  2MI6 A;  2CRE A;  2E4H A;  1PWT A;  2E3I A;  5KE3 A;  3CCR T;  2DX1 A;  2A3L A;  3CC2 T;  4AMC A;  2Z0W A;  1C6V X;  3JCM c;  4N0A A;  1MND A;  1SF9 A;  4DBQ A;  2JUF A;  3F70 A;  1ZX6 A;  2ABL A;  3L2W A;  2FZK B;  3G71 T;  2DIQ A;  1WGS A;  3M56 A;  1D3B B;  3CBP A;  2COZ A;  1KQS A;  2K9G A;  1KHI A;  1AWX A;  1HK9 A;  1CSK A;  4FIB A;  2HNI A;  1FX7 A;  2H3J A;  5GAM j;  4OB1 B;  4RTT A;  1BI2 A;  2FPE A;  2HDA A;  1QCO A;  4R56 A;  1QP3 A;  1VQM Q;  2JMC A;  3PGG A;  2DD4 A;  2QTX A;  4BE2 A;  4IUP A;  2OTL Q;  4B9W A;  5A0D A;  1U1T A;  2YHT A;  4Q5W A;  4J9D A;  4E2F B;  1V1C A;  2LQ8 A;  2M0Y A;  3Q1J A;  4N0A C;  2GGR A;  2D0Q B;  4FM4 B;  3CC7 A;  2E6Z A;  4A4H A;  4Y91 A;  5GAM g;  1KJW A;  4ORZ A;  1KQS P;  1QVF S;  3OYC A;  2VAS A;  1N8R R;  5I2S A;  3MP8 A;  1Y96 B;  2KGT A;  2LCC A;  2EYY A;  4X1V A;  2R58 A;  2LRQ A;  1YCS B;  5A0G A;  3A8H B;  3VRZ A;  3J80 E;  4OGE A;  3JB9 D;  4OB2 B;  5GAM e;  3OA6 A;  4LDW A;  2DL4 A; 
#chains in the Genus database with same CATH homology
 2QYZ A;  2P84 A;  2OX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...