2OX7A

Crystal structure of protein ef1440 from enterococcus faecalis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
144
structure length
144
Chain Sequence
b'SLIPKFRAWDTYEKEMLENVTPLFDDSNSMIAIITDFQIKGSPGTSEIEIGSYDTTFNWDEFPYVIMQSTGLKDKNGVEIFEGDILVYDAPKKYAHRRSMHEIAYADGRFFWEFLDLVFCQSNILYRDGYLVIGNIHENPELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of the hypothetical protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 23
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.290 Mainly Beta Roll SH3 type barrels. YopX-like domains 2ox7A02
2.30.30.310 Mainly Beta Roll SH3 type barrels. YopX-like domains 2ox7A01
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH superfamily
1BIAA 5DY9A 3CCRT 3TSWA 2D0QB 4M75C 5CR2A 3TVTA 5GAOn 5CKDA 4LNPA 1VQ9Q 2BKDN 3CCMA 4YTLA 3M0UA 1OV3A 4RCBA 1M8VA 1IZ6A 2HQXA 2RQWA 3SWNB 1TSFA 4AFSC 3L1AA 3PVLA 4C5IA 2NUTB 3G71A 2YLBA 2A08A 3L2WA 1BKBA 1GCQC 2AIRB 2KRMA 5GAN2 3GIBA 2VXEA 4LE9A 2DXUA 3I5RA 4OMOA 2A3LA 3R6NA 5D7UA 1VQ6Q 1G2BA 1RAGB 5CVIA 2KI7A 2NYSA 1B34A 2LJ3A 2ECZA 1M90R 3WVDB 2AT1B 1I8FA 2X4WA 1OQKA 1D1CA 3RKWA 3ZBDA 2DKGA 1R8OB 2CUBA 3SD4A 3CCVT 5I2SA 1Y0MA 3HRTA 2LJ1A 1I07A 4MZMA 1Q81U 3OMCA 1EZZB 2FB7A 2DTHA 5IHKA 5GAMg 4M75G 4PJOA 3V8KA 5GJWB 1XTDA 2DVEA 4XTWA 4OB1B 4M77F 4JDSA 3PIOA 2YUOA 1ARKA 3EFOA 2Y90A 1UDLA 3M0PA 1KG1A 3FEOA 4B6MA 3CC2T 2DXBA 1PSFA 2RQUA 1QVGP 4JS4A 4OF1A 2ROTA 3PMIA 4LDYA 1F1BB 2RD1A 2XD0A 3OMGA 2DL3A 4OMQA 3CCLT 1VQOQ 3CC4T 4J6XA 1VQLQ 2EKHA 3CPFA 3G4SQ 5GMKh 4FSXA 2BZXA 2ED0A 1ZSZA 5EC7A 3C12A 3CCSQ 5KCHA 2J05A 1HXDA 2C0IA 1RABB 2X4JA 3PNWC 5LJ3h 4LD9K 2KE9A 1ZQ1A 4M7DA 1QVFP 3NGPA 4RTYA 2F5KA 1IHWA 3FRNA 1M9SA 4PFPA 4N4GA 3L2ZA 5DLOA 2M1HA 2JZ2A 3L2RA 1MMGA 2F1LA 1I81A 1FYNA 3MP6A 2K3XA 2CREA 2V1QA 4ZN1A 4BDYA 4DQ2A 4BD3A 3SWNA 2JNGA 4EMKB 1X01A 1VQMA 1UHCA 1GRIA 3C4SA 2NUTA 1WJRA 2NUPB 1XOVA 3QJ6A 2CZ1B 2VYTA 2L3RA 3ASKA 2FPDA 5HK0A 3MJXA 2JW4A 2MPXC 4C5GA 2KYMA 2K3BA 2KAFA 1K1ZA 2DBKA 2K4YA 5I2MA 3JAME 2XDPA 1VA7A 3I56Q 1S72A 2EWNA 2CDTA 1X6GA 3PT9A 5KE2A 3JB9H 3O8VA 4ZGJB 1BI1A 2LJ0A 4F7UF 2OTJQ 3GPLA 2YUQA 4R55A 4J9CA 4A4GA 1W2BS 2XU8A 3TEEA 8AT1B 4QT7A 1PKSA 1M2VB 1C0MA 5FU7C 1YJWQ 1RACB 2RJFA 4A63B 2RJDA 2VV5A 5FRMA 1WHMA 4BY6C 1WFWA 4MMKA 2P0QA 4M7AF 1YIJQ 2IPOB 4KGXB 4KH0B 2ROLA 2ZPHB 4B9WA 3VS3A 3OYNA 1X6BA 2MCNA 4E7LA 3A8LB 2GFAA 2AHJB 1OX9A 2LVMA 3CD6Q 5GMKm 1XJWB 1HD3A 4PLLA 2WACA 4LN2A 1EX4A 1JBMA 4PL6A 1KC8U 3N5BB 2V26A 4FYXB 3JB9F 3E19A 3M53A 1NEBA 1R0BG 2K5FA 2OX7A 3MEVA 4M75D 2O9SA 1UJYA 1TG0A 1RLPC 3MP1A 2CT4A 3X20B 3KFVA 5GJVB 1IREB 4BDZA 3GBQA 3MPUB 1G3SA 2QQRA 4HCBA 3JCMh 1WNLA 4AMCA 3JCMc 3EHRA 1ZUKA 5M9OA 1G5VA 4HVUA 1VQ5Q 1M8MA 1TUGB 2QEXT 1VQNQ 2EIFA 3TQ7P 1N5ZA 2V1RA 1KSWA 2O88A 2BZ8A 4F7UB 3QO3A 4EMKA 1MMAA 1YJ9T 2GTJA 1PRMC 1VQ4T 1FMVA 4LDUA 4Y28E 1IRXA 4N0AA 5LJ3f 2DAQA 1FMKA 2CP6A 2NUPA 3A8MB 2DIQA 2K7AA 2YRVA 3PTAA 4DBRA 2D6FA 2CT3A 4C5HA 1W6XA 3ZEHA 5I22A 1QWFA 1WQ7A 3LLRA 1KHIA 1M2OA 3MO8A 4C92F 1CKAA 1TH7A 1QVFA 4ZTFA 4BE0A 2LCSA 2KQWA 3I5SA 2QASA 4FYVB 4M7AB 3CCUT 1PWTA 3M0QA 2X4XA 1LJOA 4F14A 2MF2A 2RH2A 5LJ5h 4R0KA 1UGPB 3RBBB 4F17A 1YITT 1U5SA 5FU6B 1Q82U 5J3BA 2RJCA 2AZSA 4O6JA 1K0SA 4C0DC 1M2VA 1NZ9A 1RUWA 4FM4B 1JQQA 3GP8A 2AKLA 3LGFA 2GQIA 2DLPA 1U1TA 2FRWA 1NEGA 2EYZA 2EVRA 2CGHA 2HCKA 1Y71A 2DM1A 2GTOA 2LTOA 3CCET 1VQ9A 1KK7A 3Q1JA 4QVDA 4A4HA 2EJFA 3RERA 2DL8A 4CC2A 1BK2A 3FDRA 3HKSA 2E64A 2L0AA 3HHTB 3CCMT 1YP5A 4GY5A 1QCNA 3CXCS 2KBTA 3MHXA 2OAUA 2BZYA 3CD6T 3G71T 1Q81R 1VQ6A 1AWWA 3OA6A 1Q7YC 3P8BB 4EPCA 4E47A 1PD1A 1YWPA 1RAHB 1SEMA 5FLXE 3EGXB 1QVGS 2CP5A 2CZ6B 2HL5C 4RCCA 5KE3A 2P4TA 1CSKA 2COWA 3META 1AWJA 4HVVA 2EQMA 2XICA 4C92B 5LJ3g 3VS6A 5GANd 2RI5A 4Z02A 3TREA 3VS5A 2DETA 1HSQA 1KC8C 2X35A 3OYMA 1LOJA 4JZ4A 3OYYA 3QSUA 3E9GA 4F7UA 2PUKB 1Z9QA 4JRPA 2QXFA 2EGCA 2J7IA 2H3JA 5GAOr 1RAAB 5GANf 2EYYA 5LL6S 2FG0A 2LQ8A 1G3WA 4HCZA 4EMHA 2YUNA 1ACMB 1M4ZA 1VQOA 3CC7Q 4A4KA 2K6DA 3JCMX 2CS7A 4M7AA 3G4SA 2NUZA 7AT1B 2FZGB 3P8DA 4QVCA 2SRCA 1TWBA 2YHTA 5IHIA 3S3NA 2MOXA 4M78D 4IUUA 3BW1A 2PTKA 3CCSA 3G6EQ 2EQIA 2AZVA 1QKWA 2OI3A 3VUZA 2DRMA 5DM7R 1DJ7B 1M27C 3G7ZA 2K9GA 2RQVA 2K5LA 3PE0A 3EHQA 2CSQA 3P8HA 3PVQA 5ECAA 2F2XA 4JLIA 4CC4B 1KIKA 3CMEQ 4XTUA 2ESWA 4L5GA 3TCJA 5LJ5f 4WF2A 2D8JA 3NHNA 3EG1A 2XDDA 1Q82C 4J9HA 1AZGB 2EW3A 1QP2A 4AG2C 2YLCA 1ZSZC 4IIMA 1VQMT 1PNJA 2QDLA 2KT8A 3AT1B 5GAMd 4OB0B 3VV0A 4M75F 4XTZA 3RKYA 4X9CA 5KYNA 4QW2A 2P0KA 3EFSA 4M7DC 1QCFA 1UEBA 5FROA 5IHNA 4JLGA 9ATCB 4AT1B 1Q7YR 1ZUUA 2EYXA 3EGXA 1H3HA 3C0CA 1UGVA 2DF6A 4J6WA 4PJMA 4DA4A 2OTJA 4XTXA 3V7RA 3QDFA 3A1PA 4XQ3A 4BE1A 1RI0A 1BYMA 3M57A 2A7YA 2I0NA 5EG2A 4C92A 5CKEA 2O2OA 1OU9A 3JCMg 2CUDA 3OBWA 1VYUA 2LX9A 1UECA 2DJZA 1KC8R 1TOVA 4X9DA 1YIJA 1I1JA 1VYTA 1OPKA 2XMFA 3OW2S 3GLXA 2FHDA 2K5IA 5GAMj 3VS0A 2VUBA 2YSQA 2DYIA 2IVWA 3H0HA 3BY7A 1KQSP 3CD6A 1SKUB 1SRLA 3REAB 1PM3A 2D8HA 3BFMA 2V8IA 3M59A 1IHVA 3OSVA 5GMKe 2A36A 5A0DA 2XKOC 3CC7T 2LNVA 3HFOA 4C0FA 1KFZA 2KXCA 4UC4A 4NL2A 2DTOA 3D7SB 3M54A 2R5MA 3QIIA 2EQKA 5LJ3e 1H3ZA 5LJ5g 2F69A 1SSHA 2E12A 2VC8A 4FSSA 1YI2Q 3NTIA 2DYBA 1BIBA 4IIOA 1QCOA 1WYXA 3CCJQ 3URGA 4M75B 1R77A 5D6YA 1YHQQ 2C0OA 4E7KA 2RHYA 1NJIU 2CP3A 3KXTA 1WHKA 3HRUA 5KYWB 1VQ5A 3CMET 3QPHA 2XG8D 4DOWA 1VQNA 2L2PA 1X27A 2JOYA 2V8KA 3QWYA 3OYCA 3E1SA 4KGVB 1MNEA 4QVZA 2P84A 3OY9A 3BDLA 2PZ1A 1Q82R 1VQPQ 4ZN3A 2E6ZA 2QQSA 1Q86U 3QXEB 3VUBA 1X2KA 5CAIA 2LQWA 2G6FX 2DJQA 3OSSC 4HKEA 4J9GA 4BI3A 1NPRA 3CPWP 1K8AU 2KYBA 2EKOA 3OBYA 2YRDA 5D6WA 4EDUA 1UFFA 3FB9A 4XTYA 2YDLA 1OU8A 4RTVA 1JXMA 1LNXA 2C0TA 3S6WA 2C06A 2DNUA 4EMKC 2G3RA 3KUFA 2PVOB 4JRKA 2KROA 2DPPB 1JJ2P 4HXJA 4IUQA 1BCMA 1MHNA 2RA2A 1KD1U 2E5KA 1K76A 1ZX6A 2PQWA 2A0FB 1KHCA 5DLQE 2LQKA 4FW2A 2QTVA 2LMJA 1VQ9T 4QQDA 1EFNA 3NTKA 2YWWA 2MMPA 2JTMA 1VQ8Q 1D09B 4F16A 2VGNA 2X4YA 2VXFA 1K73U 4M78E 1TS9A 1RAIB 1E6HA 3EH1A 4JJDA 4PKCC 1VQ6T 3HP9A 4KH1B 4CI0C 2AK5A 3JB9J 3RNJA 3PFSA 3IQLA 4M77B 5IN1A 1SSFA 3JCMe 3H9NA 4JRQA 5IAYA 4J5YA 1HYOA 3REBB 2B86A 1YI2T 2E10A 2CH4W 1WPYA 2M16A 2LCCA 3MEUA 4M75A 3UF4A 5CIUA 4LDXA 3H0FA 3OYJA 3CCJT 1KQSA 1KQ2A 3M4GA 3MP8A 4OGEA 5KYWA 1N6AA 4OB2B 2X3XD 4JUVA 3MEAA 4M78C 2DTIA 3FIFA 2R58A 1GCQA 2EPDA 3V7SA 2ZPGB 5I11A 4M7DD 1ABQA 3H6ZA 1VQ7Q 4OGCA 2OJ2A 4J8OA 4FL6A 3NPFA 1ZUYA 8ATCB 2MIOA 3QDRB 2HSEB 1D0XA 2K79A 3OYAA 1GL5A 3A8OB 3OS2A 2DD5A 1Q81C 1VIEA 3CC7A 1NJIC 5LJ5e 3M0SA 2NLUA 4CC7A 1WJSA 3VS4A 2QI2A 2RQTA 2ED1A 3LX7A 5GMKi 1VQOT 4NOYA 1VQLT 4VUBA 4OMMA 3G4ST 3LH5A 3G6EA 4J9DA 1YCYA 1NM7A 3EFRA 2CZ0B 2I2LA 1QKXA 1T3SA 3OYBA 3FJ5A 4C8QE 1M3BA 3CCST 5FRNA 1Q86C 1I5OB 5GANh 2MWPA 2LRQA 1VYVA 1KJWA 4JJCA 3CMEA 2D0NA 3OYIA 1UTIA 5CKFA 4M78G 4C5EA 4JS5A 2JS2A 3CPWA 1BI0A 4HT9A 2JMCA 2M9UA 3UWNA 3QWXX 2KT1A 3I55Q 2RJEA 4DBQA 4QKUA 4AFUC 4A4EA 4FYWB 2K57A 3QBYA 5FU6C 4IUPA 4X1VA 4C8QC 5FWCA 2FL7A 3PGGA 5GAOq 1KD1C 1JJ2A 1FMWA 3VS7A 4DBHA 2RQRA 4RKUE 2QQBA 2KNBB 2HDAA 4ELYC 2VASA 3RR6A 1G3YA 3A5ZB 1M1KU 3I9QA 4N4IA 4M77A 1WLPB 4OMLA 3I56T 4HCCA 1Q95G 1WXBA 1MV3A 1PHTA 1G83A 1OI1A 3VYGA 2OTJT 3ER0A 1X43A 1FXXA 3JV3A 3ME9A 2ABLA 3OYKA 2COZA 1K9AA 3JCMV 3QYHB 1YJWT 5LJ3j 4FU6A 4Z8AA 5CO7A 3NMZC 1YJNQ 3ZFJA 2DA9A 4JJBA 1N8RU 3SEMA 3QG1A 1YIJT 2ZPBB 3M0RA 2P4RA 2Y4XA 1VQKQ 4ATOA 1TUDA 2AKKA 4C8QG 4J7IA 4KBMB 5GAMh 2HL3A 1WA7A 1Y7XA 2LX7A 1I5LA 2FZKB 4TVRA 2QK0A 2CSIA 3LYIA 3FLGA 2QG9B 2RI3A 3VJPA 3CCQQ 4C92C 2JTEA 1NJIR 4XU3A 2JTFA 3WXMB 5J26A 4AFZC 3WVEB 4C0DB 5FW9A 3RDVA 2OTLQ 2XI9A 1YWOA 2ZCFB 1N9RA 1J3TA 2YRCA 1YI2A 3BE3A 2JJ9A 2LCLA 2HD0A 4XU0A 1RAEB 2LT1A 2RN8A 4NS5A 3CCJA 1U3OA 2LZ6B 1VOMA 1WQWA 2RI2A 1Q86R 2GBQA 2EQUA 1YHQA 1GBQA 3CBOA 4J9BA 5CCAA 2ZPEB 1M1GA 2JMAA 3CBPA 1OULA 1IXDA 2EQJA 4ESRA 3M0TA 2MI6A 1UGQB 2EFIA 1SHGA 4IURA 1VQ5T 4E2FB 3CMAQ 1VQNT 4QQ6A 2ZZDA 4PJOE 1A0NB 1OYXA 2DXTA 1QVFS 2JT4A 2DK3A 2QA4Q 1VQPA 3X28B 2DEUA 4OP0A 4RUGA 3VS1A 3CCRQ 4ZGEB 4HCKA 4RTXA 2DL7A 1C1AA 3EG9B 2BE9B 4KGZB 4OB3B 1S1NA 2RHZA 1YBYA 3JB9I 2Z0WA 2COYA 2WSFE 4E7ZA 1KD1R 3NTHA 3QKJA 1W4SA 2H3EB 2K2VA 2D9TA 5I21A 3FJPA 1VQLA 4ELZC 2KVQG 1H8KA 1MGQA 2DE0X 2RHUA 2PNIA 1N27A 1AWOA 3HL8A 1RLQC 4OVAA 3BDUA 4PJJA 4PJOC 1MUZA 1K0XA 3HFNA 1JB0E 1ZA2B 1W2BP 5HY6A 1ZBXA 3OS5A 2QTXA 4RTZA 1I4K1 3DKMA 3FC3A 3G1JA 3E2UA 3DLMA 4M7DE 4E7SA 4XU2A 1Z9ZA 5GAN3 1K73R 3SB2A 3CCVQ 3GNGA 3M4YA 3LGLA 3INZA 2BTTA 5KCOA 1T0JA 3QYGB 2ZPFB 1SRMA 1SHFA 3EGUA 1B7TA 1M1FA 2ZAEA 2GF7A 3R6OA 2QQAA 1BCOA 3J80E 3OS1A 2JXBA 4KULA 2K3YA 2WSCE 1UGRB 3QUIA 2XHCA 1N9SA 3OYGA 5KYUB 2E65A 2XDBA 2HQHA 3E9FA 3I56A 3CC2Q 1IGQA 2OTLT 1N8RC 4PJOG 1FX7A 3OYEA 1WXTA 4PFZA 5GAMf 1XNIA 5AT1B 4D8KA 3CCLQ 5LJ5j 2QGGA 4M7AD 2M02A 3SWNC 3CC4Q 1U8RA 2KRSA 1YJWA 2IG0A 2V8JA 4LDVA 1VUBA 1QW1A 5GANg 2DZCA 4C8QD 1M3AA 2M0OA 3F70A 4FT2A 2CZ7B 4XU1A 2EJ9A 1VQ7A 1JU5C 2GGRA 4DEYA 1M5Q1 2EJGA 3VU3C 2HSPA 5GAOp 1D0YA 4IUVA 3J7AF 5CK9A 2NWMA 3EG9A 2PVGB 2CH4A 1U06A 3X26B 1BBZA 2DBMA 5KH6A 3EGDB 4M7DG 2QYZA 2HKNA 4X34A 3EG0A 1AOJA 4B9XA 4R56A 5L8RE 2RHIA 2BE7D 4XTVA 4RTUA 4ZGDB 2KY9A 4HVWA 2EYWA 1UE9A 1NLOC 3OYHA 1GFCA 1T0HA 4WCIA 5A0LA 2ATCB 1BI2A 2O01E 1PG5B 2RHXA 3G6ET 1K9MU 2EGAA 2YXYA 4LDWA 1MNDA 1RI9A 3AHUA 2XIDA 4C0GA 1ZHIA 5GAOl 5HKCA 5IXFA 2CYZB 2E4HA 2HAXA 4PJNA 4L59A 3I55A 1M1KR 5CKBA 4C92D 3QJYA 1UJ0A 1NG2A 1IGUA 1SG5A 1HJDA 5A0GA 1AT1B 3CXCP 4D6WA 3UA7A 5HCKA 4JRIA 4BACA 3EG2A 3M58A 3C95A 2CP0A 2W0ZA 2HQEA 1BI3A 1W2BA 4J9EA 5KYUA 1O75A 2KR3A 3LWHA 1WHLA 4LD6A 2CP2A 1AD5A 2O4XB 1JXOA 1N8RR 3U23A 2HKQB 3SFMA 4E6RA 3EH2A 2VB6A 4ORZA 4M77E 2JS0A 1WHJA 5GAN5 2RO0A 3NFCA 3DB3A 2KRNA 3OQ5A 3KBGA 4N4HA 3ZL7C 2KXDA 2CP7A 2HEQA 1JO8A 4RMOA 3EG3A 5KYYB 4N0AC 2CKKA 4LUDA 4Z88A 5L23A 5CQXA 4K11A 2M51A 1YJNA 2HBWA 1SF9A 2M0YA 1PSEA 1CKBA 3HSBA 2J6FA 3S3OA 1LCKA 3RUXA 4KUIA 1SPKA 2EYQA 5KYXB 1VQKA 2DERA 4M77C 2OAWA 2EGEA 1YNZA 2IIMA 4V2SA 1NLPC 4M78F 1TTHB 1UGSB 4PJOD 3LW5E 3MEWA 4P5NA 1B3QA 3VRYA 2QEXQ 3EAEA 3CCQA 4ZTJA 3EGDA 3HTRA 1P92A 2RB6A 4F04B 1TUCA 1YJ9Q 2MYSA 4Y91A 1VQ4Q 2FEIA 2R57A 2OTLA 5J39A 3L2QA 3A8HB 2L5QA 1NYFA 3OS0A 1I0CA 1Y96B 4RG2A 5GANe 2KEAA 1Y57A 2FO0A 3A98A 2KSSA 2JVVA 3RMQA 2RNAA 3TU4K 1GCPA 1RL2A 2GFUA 1W70A 3CCUQ 1UUEA 2FPEA 1MMDA 1OOTA 3X25B 2L3SA 3CBMA 4BE2A 1YHQT 3M55A 2ENMA 4EMGA 1YITQ 2MWOA 2DL5A 3VYHB 4JPBW 3CMAA 2RPNA 2LP5A 2J6KA 2F5TX 3UATA 3VRZA 1OZ2A 2QA4A 1ZBJA 4AFQC 4M77G 3M56A 3L2UA 4F7UE 1FWZA 2DL4A 1WJQA 3CCRA 2BIVA 5GAN7 1K9MC 1Y07A 1VQPT 3CCEQ 2H8HA 3MKDA 1Q7YU 2RK2A 1ABOA 3HRSA 1W1FA 2LNHB 1AHJB 4CC3A 3CCMQ 1D3BB 1YCSB 4J9FA 1WGSA 5CKHA 2O4XA 2LC4A 4Q5WA 2GCXA 1LPLA 4E7JA 2RF0A 4M7AE 1OZ3A 4C8QF 2K2MA 5FU7B 4Y92A 1O9SA 4Z89A 3G71Q 2E5QA 1MMNA 5C6SA 3UT1A 4M78B 3GOXA 3JCMW 5KYYA 2GNCA 4FYYB 4BY6B 3CXCA 1WIEA 2DD4A 2J6OA 4MMLA 1D1AA 5FWBA 1K8AC 4BI8B 1KQ1A 1G3TA 3CCVA 2LDMA 4BUGA 1QVPA 2KMTA 1YFNA 3J81E 2ZPIB 3JCMb 2X9HA 3OW2P 4J6YA 5KYXA 2DIGA 4HA8A 3RESA 3V8LA 5GAMe 4M7AC 2DMOA 1QVGA 5LJ3d 3QZ9B 2L8DA 3GF5A 1X69A 1WHGA 3H0IA 2LQNA 1TXQA 3SDZA 3JCMQ 1VQ8T 3I35A 1M90U 1B07A 3PMTA 2E6NA 2Y4YA 2JM8A 2RM4A 2JN0A 1QWEA 1OPLA 3CC2A 4XK8E 3ULRB 2F2WA 3L42A 1Y96A 1KQSS 2E3IA 2DX1A 1X2QA 1LVKA 1E7OA 1WX6A 3CCLA 4F7UG 3VS2A 3MCAB 1WI7A 1XQHA 3T9NA 5GMKj 1AZEA 3CC4A 2A37A 1MV0B 2FRYA 2DZ9A 3QHSA 2E1HA 3H8ZA 2RK1A 1GXIE 2D1XA 1D1BA 1WZOA 4LUEA 4C92E 3OB9A 5HK3A 4KUDK 4II1A 1NBEB 4ANJA 1K73C 3JCMJ 2B8AA 4PLIA 3L2VA 2PU9B 4RTWA 2FVUA 2MK5A 4C8QB 4M7AG 2HMAA 2VVKA 3JRZA 3OYFA 1E6GA 1WDXA 4C0ZA 4GLMA 1VQ7T 5D6XA 1T3LA 4JZ3A 2HNIA 2YT6A 1K9MR 4KT0E 4DBFA 3DLLA 3VKIA 1BU1A 4BI4A 4J83A 2JM9A 2KGTA 4GLKA 6AT1B 5A2QE 1ZLMA 2A28A 1D3BA 3A8GB 4RG8A 2L3QA 1AVZC 2E41A 2FYKA 3JB9G 2BUDA 1GBRA 3THKA 4A53A 3UPUA 1VQMQ 3X24B 5IH2A 2KDSA 4A4FA 4JJNK 2FPFA 1QMCA 4M78A 5GAN6 3CPWS 2VKNA 3UDCA 4OMPA 2GQVA 5GMKl 3CEYA 2DFUA 3HPWA 3RIRA 4M77D 2O31A 4D8DA 1K8AR 1QP3A 4PJOF 3RMSA 1S72Q 2WSEE 4XAXB 3S3MA 3V7CA 3O5ZA 4GBQA 3DB4A 4OMNA 1OEBA 5IXBA 4FCYA 1JJ2S 4MDXA 2P0PA 3I55T 2L89A 1UHFA 3JCMd 4IKFA 3C94A 4PJLA 2R5AA 3TSZA 1WXUA 1V29B 2PVDB 2HBPA 2DILA 4C92G 2QDYB 2EAYA 1TU0B 2RMOA 3LWIA 1OX8A 4ME7A 1V1CA 3UA6A 1AEYA 1GFDA 4AG1C 2ZGWA 4MZTA 4J7FA 1NPPA 2L3PA 4FIBA 4QQGA 4MZPA 4BB7A 1D0ZA 1PD0A 4PFOA 1UG1A 4OMFB 1VIFA 2LT4A 3JCMf 1ZSGA 4LXCA 3M9QA 1QQJA 2HZYA 2YUPA 2W10A 3OW2A 1YN8A 4FW1A 3JCMP 3JSCA 1M3CA 4M7DF 3OYDA 4RTTA 4E7HA 5GAOm 1U1SA 4ZNXA 1WHHA 3SHWA 5GAN8 1M90C 3M5AA 3PIPA 2DEQA 1B34B 1JRIA 5GANj 4O5VA 1NE8A 1G8XA 5AYFA 4DEXA 4C8QA 5LJ5d 4MDWA 2VGMA 1M1KC 1HK9A 1YJNT 4E7IA 1PC0A 1UB4A 2FZCB 1X75C 1IB8A 4IUTA 4A54A 2J06A 4DOVA 1BB9A 1VQ8A 1VQKT 3GNFB 2QEXA 1JEGA 3OYLA 4PNOA 1PKTA 2SEMA 4CRIA 1RADB 1R0CB 1YJ9A 2EBPA 1X6OA 2DXCA 2X3WD 4PJOB 4WTOB 1VQ4A 3RKXA 3CCQT 2VWFA 1IO6A 3QZ5B 4NL3A 3CQTA 1ZA1B 2KK4A 3EFOB 4M4ZA 2DVJA 1V76A 2QGFB 5CQYA 2F2VA 4KRTA 1C6VX 4FT4A 3V8JA 4L6V5 1EIFA 2PUOB 3CCUA 5C0MA 4EIKA 2QAZA 3H41A 1NYGA 1M30A 4M75E 1H641 2MAMA 2QQ9A 2E3HA 2E70A 4HT8A 5GAN4 1YITA 2DO3A 1QLYA 2DRKA 1H92A 1S72T 2JUFA 1RAFB 1K4US 1ZSZB 1PRLC 5IT9E 3LH0A 3CMAT 1PCXA 1AWXA 2X51A 4PK4A 3JB9D 2QA4T 4M7DB 2O9VA 3CCEA 2XK0A 4J9IA
chains in the Genus database with same CATH topology
2QYZA 2P84A 2OX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYZ A;  2P84 A;  2OX7 A; 
#chains in the Genus database with same CATH topology
 1BIA A;  5DY9 A;  3CCR T;  3TSW A;  2D0Q B;  4M75 C;  5CR2 A;  3TVT A;  5GAO n;  5CKD A;  4LNP A;  1VQ9 Q;  2BKD N;  3CCM A;  4YTL A;  3M0U A;  1OV3 A;  4RCB A;  1M8V A;  1IZ6 A;  2HQX A;  2RQW A;  3SWN B;  1TSF A;  4AFS C;  3L1A A;  3PVL A;  4C5I A;  2NUT B;  3G71 A;  2YLB A;  2A08 A;  3L2W A;  1BKB A;  1GCQ C;  2AIR B;  2KRM A;  5GAN 2;  3GIB A;  2VXE A;  4LE9 A;  2DXU A;  3I5R A;  4OMO A;  2A3L A;  3R6N A;  5D7U A;  1VQ6 Q;  1G2B A;  1RAG B;  5CVI A;  2KI7 A;  2NYS A;  1B34 A;  2LJ3 A;  2ECZ A;  1M90 R;  3WVD B;  2AT1 B;  1I8F A;  2X4W A;  1OQK A;  1D1C A;  3RKW A;  3ZBD A;  2DKG A;  1R8O B;  2CUB A;  3SD4 A;  3CCV T;  5I2S A;  1Y0M A;  3HRT A;  2LJ1 A;  1I07 A;  4MZM A;  1Q81 U;  3OMC A;  1EZZ B;  2FB7 A;  2DTH A;  5IHK A;  5GAM g;  4M75 G;  4PJO A;  3V8K A;  5GJW B;  1XTD A;  2DVE A;  4XTW A;  4OB1 B;  4M77 F;  4JDS A;  3PIO A;  2YUO A;  1ARK A;  3EFO A;  2Y90 A;  1UDL A;  3M0P A;  1KG1 A;  3FEO A;  4B6M A;  3CC2 T;  2DXB A;  1PSF A;  2RQU A;  1QVG P;  4JS4 A;  4OF1 A;  2ROT A;  3PMI A;  4LDY A;  1F1B B;  2RD1 A;  2XD0 A;  3OMG A;  2DL3 A;  4OMQ A;  3CCL T;  1VQO Q;  3CC4 T;  4J6X A;  1VQL Q;  2EKH A;  3CPF A;  3G4S Q;  5GMK h;  4FSX A;  2BZX A;  2ED0 A;  1ZSZ A;  5EC7 A;  3C12 A;  3CCS Q;  5KCH A;  2J05 A;  1HXD A;  2C0I A;  1RAB B;  2X4J A;  3PNW C;  5LJ3 h;  4LD9 K;  2KE9 A;  1ZQ1 A;  4M7D A;  1QVF P;  3NGP A;  4RTY A;  2F5K A;  1IHW A;  3FRN A;  1M9S A;  4PFP A;  4N4G A;  3L2Z A;  5DLO A;  2M1H A;  2JZ2 A;  3L2R A;  1MMG A;  2F1L A;  1I81 A;  1FYN A;  3MP6 A;  2K3X A;  2CRE A;  2V1Q A;  4ZN1 A;  4BDY A;  4DQ2 A;  4BD3 A;  3SWN A;  2JNG A;  4EMK B;  1X01 A;  1VQM A;  1UHC A;  1GRI A;  3C4S A;  2NUT A;  1WJR A;  2NUP B;  1XOV A;  3QJ6 A;  2CZ1 B;  2VYT A;  2L3R A;  3ASK A;  2FPD A;  5HK0 A;  3MJX A;  2JW4 A;  2MPX C;  4C5G A;  2KYM A;  2K3B A;  2KAF A;  1K1Z A;  2DBK A;  2K4Y A;  5I2M A;  3JAM E;  2XDP A;  1VA7 A;  3I56 Q;  1S72 A;  2EWN A;  2CDT A;  1X6G A;  3PT9 A;  5KE2 A;  3JB9 H;  3O8V A;  4ZGJ B;  1BI1 A;  2LJ0 A;  4F7U F;  2OTJ Q;  3GPL A;  2YUQ A;  4R55 A;  4J9C A;  4A4G A;  1W2B S;  2XU8 A;  3TEE A;  8AT1 B;  4QT7 A;  1PKS A;  1M2V B;  1C0M A;  5FU7 C;  1YJW Q;  1RAC B;  2RJF A;  4A63 B;  2RJD A;  2VV5 A;  5FRM A;  1WHM A;  4BY6 C;  1WFW A;  4MMK A;  2P0Q A;  4M7A F;  1YIJ Q;  2IPO B;  4KGX B;  4KH0 B;  2ROL A;  2ZPH B;  4B9W A;  3VS3 A;  3OYN A;  1X6B A;  2MCN A;  4E7L A;  3A8L B;  2GFA A;  2AHJ B;  1OX9 A;  2LVM A;  3CD6 Q;  5GMK m;  1XJW B;  1HD3 A;  4PLL A;  2WAC A;  4LN2 A;  1EX4 A;  1JBM A;  4PL6 A;  1KC8 U;  3N5B B;  2V26 A;  4FYX B;  3JB9 F;  3E19 A;  3M53 A;  1NEB A;  1R0B G;  2K5F A;  2OX7 A;  3MEV A;  4M75 D;  2O9S A;  1UJY A;  1TG0 A;  1RLP C;  3MP1 A;  2CT4 A;  3X20 B;  3KFV A;  5GJV B;  1IRE B;  4BDZ A;  3GBQ A;  3MPU B;  1G3S A;  2QQR A;  4HCB A;  3JCM h;  1WNL A;  4AMC A;  3JCM c;  3EHR A;  1ZUK A;  5M9O A;  1G5V A;  4HVU A;  1VQ5 Q;  1M8M A;  1TUG B;  2QEX T;  1VQN Q;  2EIF A;  3TQ7 P;  1N5Z A;  2V1R A;  1KSW A;  2O88 A;  2BZ8 A;  4F7U B;  3QO3 A;  4EMK A;  1MMA A;  1YJ9 T;  2GTJ A;  1PRM C;  1VQ4 T;  1FMV A;  4LDU A;  4Y28 E;  1IRX A;  4N0A A;  5LJ3 f;  2DAQ A;  1FMK A;  2CP6 A;  2NUP A;  3A8M B;  2DIQ A;  2K7A A;  2YRV A;  3PTA A;  4DBR A;  2D6F A;  2CT3 A;  4C5H A;  1W6X A;  3ZEH A;  5I22 A;  1QWF A;  1WQ7 A;  3LLR A;  1KHI A;  1M2O A;  3MO8 A;  4C92 F;  1CKA A;  1TH7 A;  1QVF A;  4ZTF A;  4BE0 A;  2LCS A;  2KQW A;  3I5S A;  2QAS A;  4FYV B;  4M7A B;  3CCU T;  1PWT A;  3M0Q A;  2X4X A;  1LJO A;  4F14 A;  2MF2 A;  2RH2 A;  5LJ5 h;  4R0K A;  1UGP B;  3RBB B;  4F17 A;  1YIT T;  1U5S A;  5FU6 B;  1Q82 U;  5J3B A;  2RJC A;  2AZS A;  4O6J A;  1K0S A;  4C0D C;  1M2V A;  1NZ9 A;  1RUW A;  4FM4 B;  1JQQ A;  3GP8 A;  2AKL A;  3LGF A;  2GQI A;  2DLP A;  1U1T A;  2FRW A;  1NEG A;  2EYZ A;  2EVR A;  2CGH A;  2HCK A;  1Y71 A;  2DM1 A;  2GTO A;  2LTO A;  3CCE T;  1VQ9 A;  1KK7 A;  3Q1J A;  4QVD A;  4A4H A;  2EJF A;  3RER A;  2DL8 A;  4CC2 A;  1BK2 A;  3FDR A;  3HKS A;  2E64 A;  2L0A A;  3HHT B;  3CCM T;  1YP5 A;  4GY5 A;  1QCN A;  3CXC S;  2KBT A;  3MHX A;  2OAU A;  2BZY A;  3CD6 T;  3G71 T;  1Q81 R;  1VQ6 A;  1AWW A;  3OA6 A;  1Q7Y C;  3P8B B;  4EPC A;  4E47 A;  1PD1 A;  1YWP A;  1RAH B;  1SEM A;  5FLX E;  3EGX B;  1QVG S;  2CP5 A;  2CZ6 B;  2HL5 C;  4RCC A;  5KE3 A;  2P4T A;  1CSK A;  2COW A;  3MET A;  1AWJ A;  4HVV A;  2EQM A;  2XIC A;  4C92 B;  5LJ3 g;  3VS6 A;  5GAN d;  2RI5 A;  4Z02 A;  3TRE A;  3VS5 A;  2DET A;  1HSQ A;  1KC8 C;  2X35 A;  3OYM A;  1LOJ A;  4JZ4 A;  3OYY A;  3QSU A;  3E9G A;  4F7U A;  2PUK B;  1Z9Q A;  4JRP A;  2QXF A;  2EGC A;  2J7I A;  2H3J A;  5GAO r;  1RAA B;  5GAN f;  2EYY A;  5LL6 S;  2FG0 A;  2LQ8 A;  1G3W A;  4HCZ A;  4EMH A;  2YUN A;  1ACM B;  1M4Z A;  1VQO A;  3CC7 Q;  4A4K A;  2K6D A;  3JCM X;  2CS7 A;  4M7A A;  3G4S A;  2NUZ A;  7AT1 B;  2FZG B;  3P8D A;  4QVC A;  2SRC A;  1TWB A;  2YHT A;  5IHI A;  3S3N A;  2MOX A;  4M78 D;  4IUU A;  3BW1 A;  2PTK A;  3CCS A;  3G6E Q;  2EQI A;  2AZV A;  1QKW A;  2OI3 A;  3VUZ A;  2DRM A;  5DM7 R;  1DJ7 B;  1M27 C;  3G7Z A;  2K9G A;  2RQV A;  2K5L A;  3PE0 A;  3EHQ A;  2CSQ A;  3P8H A;  3PVQ A;  5ECA A;  2F2X A;  4JLI A;  4CC4 B;  1KIK A;  3CME Q;  4XTU A;  2ESW A;  4L5G A;  3TCJ A;  5LJ5 f;  4WF2 A;  2D8J A;  3NHN A;  3EG1 A;  2XDD A;  1Q82 C;  4J9H A;  1AZG B;  2EW3 A;  1QP2 A;  4AG2 C;  2YLC A;  1ZSZ C;  4IIM A;  1VQM T;  1PNJ A;  2QDL A;  2KT8 A;  3AT1 B;  5GAM d;  4OB0 B;  3VV0 A;  4M75 F;  4XTZ A;  3RKY A;  4X9C A;  5KYN A;  4QW2 A;  2P0K A;  3EFS A;  4M7D C;  1QCF A;  1UEB A;  5FRO A;  5IHN A;  4JLG A;  9ATC B;  4AT1 B;  1Q7Y R;  1ZUU A;  2EYX A;  3EGX A;  1H3H A;  3C0C A;  1UGV A;  2DF6 A;  4J6W A;  4PJM A;  4DA4 A;  2OTJ A;  4XTX A;  3V7R A;  3QDF A;  3A1P A;  4XQ3 A;  4BE1 A;  1RI0 A;  1BYM A;  3M57 A;  2A7Y A;  2I0N A;  5EG2 A;  4C92 A;  5CKE A;  2O2O A;  1OU9 A;  3JCM g;  2CUD A;  3OBW A;  1VYU A;  2LX9 A;  1UEC A;  2DJZ A;  1KC8 R;  1TOV A;  4X9D A;  1YIJ A;  1I1J A;  1VYT A;  1OPK A;  2XMF A;  3OW2 S;  3GLX A;  2FHD A;  2K5I A;  5GAM j;  3VS0 A;  2VUB A;  2YSQ A;  2DYI A;  2IVW A;  3H0H A;  3BY7 A;  1KQS P;  3CD6 A;  1SKU B;  1SRL A;  3REA B;  1PM3 A;  2D8H A;  3BFM A;  2V8I A;  3M59 A;  1IHV A;  3OSV A;  5GMK e;  2A36 A;  5A0D A;  2XKO C;  3CC7 T;  2LNV A;  3HFO A;  4C0F A;  1KFZ A;  2KXC A;  4UC4 A;  4NL2 A;  2DTO A;  3D7S B;  3M54 A;  2R5M A;  3QII A;  2EQK A;  5LJ3 e;  1H3Z A;  5LJ5 g;  2F69 A;  1SSH A;  2E12 A;  2VC8 A;  4FSS A;  1YI2 Q;  3NTI A;  2DYB A;  1BIB A;  4IIO A;  1QCO A;  1WYX A;  3CCJ Q;  3URG A;  4M75 B;  1R77 A;  5D6Y A;  1YHQ Q;  2C0O A;  4E7K A;  2RHY A;  1NJI U;  2CP3 A;  3KXT A;  1WHK A;  3HRU A;  5KYW B;  1VQ5 A;  3CME T;  3QPH A;  2XG8 D;  4DOW A;  1VQN A;  2L2P A;  1X27 A;  2JOY A;  2V8K A;  3QWY A;  3OYC A;  3E1S A;  4KGV B;  1MNE A;  4QVZ A;  2P84 A;  3OY9 A;  3BDL A;  2PZ1 A;  1Q82 R;  1VQP Q;  4ZN3 A;  2E6Z A;  2QQS A;  1Q86 U;  3QXE B;  3VUB A;  1X2K A;  5CAI A;  2LQW A;  2G6F X;  2DJQ A;  3OSS C;  4HKE A;  4J9G A;  4BI3 A;  1NPR A;  3CPW P;  1K8A U;  2KYB A;  2EKO A;  3OBY A;  2YRD A;  5D6W A;  4EDU A;  1UFF A;  3FB9 A;  4XTY A;  2YDL A;  1OU8 A;  4RTV A;  1JXM A;  1LNX A;  2C0T A;  3S6W A;  2C06 A;  2DNU A;  4EMK C;  2G3R A;  3KUF A;  2PVO B;  4JRK A;  2KRO A;  2DPP B;  1JJ2 P;  4HXJ A;  4IUQ A;  1BCM A;  1MHN A;  2RA2 A;  1KD1 U;  2E5K A;  1K76 A;  1ZX6 A;  2PQW A;  2A0F B;  1KHC A;  5DLQ E;  2LQK A;  4FW2 A;  2QTV A;  2LMJ A;  1VQ9 T;  4QQD A;  1EFN A;  3NTK A;  2YWW A;  2MMP A;  2JTM A;  1VQ8 Q;  1D09 B;  4F16 A;  2VGN A;  2X4Y A;  2VXF A;  1K73 U;  4M78 E;  1TS9 A;  1RAI B;  1E6H A;  3EH1 A;  4JJD A;  4PKC C;  1VQ6 T;  3HP9 A;  4KH1 B;  4CI0 C;  2AK5 A;  3JB9 J;  3RNJ A;  3PFS A;  3IQL A;  4M77 B;  5IN1 A;  1SSF A;  3JCM e;  3H9N A;  4JRQ A;  5IAY A;  4J5Y A;  1HYO A;  3REB B;  2B86 A;  1YI2 T;  2E10 A;  2CH4 W;  1WPY A;  2M16 A;  2LCC A;  3MEU A;  4M75 A;  3UF4 A;  5CIU A;  4LDX A;  3H0F A;  3OYJ A;  3CCJ T;  1KQS A;  1KQ2 A;  3M4G A;  3MP8 A;  4OGE A;  5KYW A;  1N6A A;  4OB2 B;  2X3X D;  4JUV A;  3MEA A;  4M78 C;  2DTI A;  3FIF A;  2R58 A;  1GCQ A;  2EPD A;  3V7S A;  2ZPG B;  5I11 A;  4M7D D;  1ABQ A;  3H6Z A;  1VQ7 Q;  4OGC A;  2OJ2 A;  4J8O A;  4FL6 A;  3NPF A;  1ZUY A;  8ATC B;  2MIO A;  3QDR B;  2HSE B;  1D0X A;  2K79 A;  3OYA A;  1GL5 A;  3A8O B;  3OS2 A;  2DD5 A;  1Q81 C;  1VIE A;  3CC7 A;  1NJI C;  5LJ5 e;  3M0S A;  2NLU A;  4CC7 A;  1WJS A;  3VS4 A;  2QI2 A;  2RQT A;  2ED1 A;  3LX7 A;  5GMK i;  1VQO T;  4NOY A;  1VQL T;  4VUB A;  4OMM A;  3G4S T;  3LH5 A;  3G6E A;  4J9D A;  1YCY A;  1NM7 A;  3EFR A;  2CZ0 B;  2I2L A;  1QKX A;  1T3S A;  3OYB A;  3FJ5 A;  4C8Q E;  1M3B A;  3CCS T;  5FRN A;  1Q86 C;  1I5O B;  5GAN h;  2MWP A;  2LRQ A;  1VYV A;  1KJW A;  4JJC A;  3CME A;  2D0N A;  3OYI A;  1UTI A;  5CKF A;  4M78 G;  4C5E A;  4JS5 A;  2JS2 A;  3CPW A;  1BI0 A;  4HT9 A;  2JMC A;  2M9U A;  3UWN A;  3QWX X;  2KT1 A;  3I55 Q;  2RJE A;  4DBQ A;  4QKU A;  4AFU C;  4A4E A;  4FYW B;  2K57 A;  3QBY A;  5FU6 C;  4IUP A;  4X1V A;  4C8Q C;  5FWC A;  2FL7 A;  3PGG A;  5GAO q;  1KD1 C;  1JJ2 A;  1FMW A;  3VS7 A;  4DBH A;  2RQR A;  4RKU E;  2QQB A;  2KNB B;  2HDA A;  4ELY C;  2VAS A;  3RR6 A;  1G3Y A;  3A5Z B;  1M1K U;  3I9Q A;  4N4I A;  4M77 A;  1WLP B;  4OML A;  3I56 T;  4HCC A;  1Q95 G;  1WXB A;  1MV3 A;  1PHT A;  1G83 A;  1OI1 A;  3VYG A;  2OTJ T;  3ER0 A;  1X43 A;  1FXX A;  3JV3 A;  3ME9 A;  2ABL A;  3OYK A;  2COZ A;  1K9A A;  3JCM V;  3QYH B;  1YJW T;  5LJ3 j;  4FU6 A;  4Z8A A;  5CO7 A;  3NMZ C;  1YJN Q;  3ZFJ A;  2DA9 A;  4JJB A;  1N8R U;  3SEM A;  3QG1 A;  1YIJ T;  2ZPB B;  3M0R A;  2P4R A;  2Y4X A;  1VQK Q;  4ATO A;  1TUD A;  2AKK A;  4C8Q G;  4J7I A;  4KBM B;  5GAM h;  2HL3 A;  1WA7 A;  1Y7X A;  2LX7 A;  1I5L A;  2FZK B;  4TVR A;  2QK0 A;  2CSI A;  3LYI A;  3FLG A;  2QG9 B;  2RI3 A;  3VJP A;  3CCQ Q;  4C92 C;  2JTE A;  1NJI R;  4XU3 A;  2JTF A;  3WXM B;  5J26 A;  4AFZ C;  3WVE B;  4C0D B;  5FW9 A;  3RDV A;  2OTL Q;  2XI9 A;  1YWO A;  2ZCF B;  1N9R A;  1J3T A;  2YRC A;  1YI2 A;  3BE3 A;  2JJ9 A;  2LCL A;  2HD0 A;  4XU0 A;  1RAE B;  2LT1 A;  2RN8 A;  4NS5 A;  3CCJ A;  1U3O A;  2LZ6 B;  1VOM A;  1WQW A;  2RI2 A;  1Q86 R;  2GBQ A;  2EQU A;  1YHQ A;  1GBQ A;  3CBO A;  4J9B A;  5CCA A;  2ZPE B;  1M1G A;  2JMA A;  3CBP A;  1OUL A;  1IXD A;  2EQJ A;  4ESR A;  3M0T A;  2MI6 A;  1UGQ B;  2EFI A;  1SHG A;  4IUR A;  1VQ5 T;  4E2F B;  3CMA Q;  1VQN T;  4QQ6 A;  2ZZD A;  4PJO E;  1A0N B;  1OYX A;  2DXT A;  1QVF S;  2JT4 A;  2DK3 A;  2QA4 Q;  1VQP A;  3X28 B;  2DEU A;  4OP0 A;  4RUG A;  3VS1 A;  3CCR Q;  4ZGE B;  4HCK A;  4RTX A;  2DL7 A;  1C1A A;  3EG9 B;  2BE9 B;  4KGZ B;  4OB3 B;  1S1N A;  2RHZ A;  1YBY A;  3JB9 I;  2Z0W A;  2COY A;  2WSF E;  4E7Z A;  1KD1 R;  3NTH A;  3QKJ A;  1W4S A;  2H3E B;  2K2V A;  2D9T A;  5I21 A;  3FJP A;  1VQL A;  4ELZ C;  2KVQ G;  1H8K A;  1MGQ A;  2DE0 X;  2RHU A;  2PNI A;  1N27 A;  1AWO A;  3HL8 A;  1RLQ C;  4OVA A;  3BDU A;  4PJJ A;  4PJO C;  1MUZ A;  1K0X A;  3HFN A;  1JB0 E;  1ZA2 B;  1W2B P;  5HY6 A;  1ZBX A;  3OS5 A;  2QTX A;  4RTZ A;  1I4K 1;  3DKM A;  3FC3 A;  3G1J A;  3E2U A;  3DLM A;  4M7D E;  4E7S A;  4XU2 A;  1Z9Z A;  5GAN 3;  1K73 R;  3SB2 A;  3CCV Q;  3GNG A;  3M4Y A;  3LGL A;  3INZ A;  2BTT A;  5KCO A;  1T0J A;  3QYG B;  2ZPF B;  1SRM A;  1SHF A;  3EGU A;  1B7T A;  1M1F A;  2ZAE A;  2GF7 A;  3R6O A;  2QQA A;  1BCO A;  3J80 E;  3OS1 A;  2JXB A;  4KUL A;  2K3Y A;  2WSC E;  1UGR B;  3QUI A;  2XHC A;  1N9S A;  3OYG A;  5KYU B;  2E65 A;  2XDB A;  2HQH A;  3E9F A;  3I56 A;  3CC2 Q;  1IGQ A;  2OTL T;  1N8R C;  4PJO G;  1FX7 A;  3OYE A;  1WXT A;  4PFZ A;  5GAM f;  1XNI A;  5AT1 B;  4D8K A;  3CCL Q;  5LJ5 j;  2QGG A;  4M7A D;  2M02 A;  3SWN C;  3CC4 Q;  1U8R A;  2KRS A;  1YJW A;  2IG0 A;  2V8J A;  4LDV A;  1VUB A;  1QW1 A;  5GAN g;  2DZC A;  4C8Q D;  1M3A A;  2M0O A;  3F70 A;  4FT2 A;  2CZ7 B;  4XU1 A;  2EJ9 A;  1VQ7 A;  1JU5 C;  2GGR A;  4DEY A;  1M5Q 1;  2EJG A;  3VU3 C;  2HSP A;  5GAO p;  1D0Y A;  4IUV A;  3J7A F;  5CK9 A;  2NWM A;  3EG9 A;  2PVG B;  2CH4 A;  1U06 A;  3X26 B;  1BBZ A;  2DBM A;  5KH6 A;  3EGD B;  4M7D G;  2QYZ A;  2HKN A;  4X34 A;  3EG0 A;  1AOJ A;  4B9X A;  4R56 A;  5L8R E;  2RHI A;  2BE7 D;  4XTV A;  4RTU A;  4ZGD B;  2KY9 A;  4HVW A;  2EYW A;  1UE9 A;  1NLO C;  3OYH A;  1GFC A;  1T0H A;  4WCI A;  5A0L A;  2ATC B;  1BI2 A;  2O01 E;  1PG5 B;  2RHX A;  3G6E T;  1K9M U;  2EGA A;  2YXY A;  4LDW A;  1MND A;  1RI9 A;  3AHU A;  2XID A;  4C0G A;  1ZHI A;  5GAO l;  5HKC A;  5IXF A;  2CYZ B;  2E4H A;  2HAX A;  4PJN A;  4L59 A;  3I55 A;  1M1K R;  5CKB A;  4C92 D;  3QJY A;  1UJ0 A;  1NG2 A;  1IGU A;  1SG5 A;  1HJD A;  5A0G A;  1AT1 B;  3CXC P;  4D6W A;  3UA7 A;  5HCK A;  4JRI A;  4BAC A;  3EG2 A;  3M58 A;  3C95 A;  2CP0 A;  2W0Z A;  2HQE A;  1BI3 A;  1W2B A;  4J9E A;  5KYU A;  1O75 A;  2KR3 A;  3LWH A;  1WHL A;  4LD6 A;  2CP2 A;  1AD5 A;  2O4X B;  1JXO A;  1N8R R;  3U23 A;  2HKQ B;  3SFM A;  4E6R A;  3EH2 A;  2VB6 A;  4ORZ A;  4M77 E;  2JS0 A;  1WHJ A;  5GAN 5;  2RO0 A;  3NFC A;  3DB3 A;  2KRN A;  3OQ5 A;  3KBG A;  4N4H A;  3ZL7 C;  2KXD A;  2CP7 A;  2HEQ A;  1JO8 A;  4RMO A;  3EG3 A;  5KYY B;  4N0A C;  2CKK A;  4LUD A;  4Z88 A;  5L23 A;  5CQX A;  4K11 A;  2M51 A;  1YJN A;  2HBW A;  1SF9 A;  2M0Y A;  1PSE A;  1CKB A;  3HSB A;  2J6F A;  3S3O A;  1LCK A;  3RUX A;  4KUI A;  1SPK A;  2EYQ A;  5KYX B;  1VQK A;  2DER A;  4M77 C;  2OAW A;  2EGE A;  1YNZ A;  2IIM A;  4V2S A;  1NLP C;  4M78 F;  1TTH B;  1UGS B;  4PJO D;  3LW5 E;  3MEW A;  4P5N A;  1B3Q A;  3VRY A;  2QEX Q;  3EAE A;  3CCQ A;  4ZTJ A;  3EGD A;  3HTR A;  1P92 A;  2RB6 A;  4F04 B;  1TUC A;  1YJ9 Q;  2MYS A;  4Y91 A;  1VQ4 Q;  2FEI A;  2R57 A;  2OTL A;  5J39 A;  3L2Q A;  3A8H B;  2L5Q A;  1NYF A;  3OS0 A;  1I0C A;  1Y96 B;  4RG2 A;  5GAN e;  2KEA A;  1Y57 A;  2FO0 A;  3A98 A;  2KSS A;  2JVV A;  3RMQ A;  2RNA A;  3TU4 K;  1GCP A;  1RL2 A;  2GFU A;  1W70 A;  3CCU Q;  1UUE A;  2FPE A;  1MMD A;  1OOT A;  3X25 B;  2L3S A;  3CBM A;  4BE2 A;  1YHQ T;  3M55 A;  2ENM A;  4EMG A;  1YIT Q;  2MWO A;  2DL5 A;  3VYH B;  4JPB W;  3CMA A;  2RPN A;  2LP5 A;  2J6K A;  2F5T X;  3UAT A;  3VRZ A;  1OZ2 A;  2QA4 A;  1ZBJ A;  4AFQ C;  4M77 G;  3M56 A;  3L2U A;  4F7U E;  1FWZ A;  2DL4 A;  1WJQ A;  3CCR A;  2BIV A;  5GAN 7;  1K9M C;  1Y07 A;  1VQP T;  3CCE Q;  2H8H A;  3MKD A;  1Q7Y U;  2RK2 A;  1ABO A;  3HRS A;  1W1F A;  2LNH B;  1AHJ B;  4CC3 A;  3CCM Q;  1D3B B;  1YCS B;  4J9F A;  1WGS A;  5CKH A;  2O4X A;  2LC4 A;  4Q5W A;  2GCX A;  1LPL A;  4E7J A;  2RF0 A;  4M7A E;  1OZ3 A;  4C8Q F;  2K2M A;  5FU7 B;  4Y92 A;  1O9S A;  4Z89 A;  3G71 Q;  2E5Q A;  1MMN A;  5C6S A;  3UT1 A;  4M78 B;  3GOX A;  3JCM W;  5KYY A;  2GNC A;  4FYY B;  4BY6 B;  3CXC A;  1WIE A;  2DD4 A;  2J6O A;  4MML A;  1D1A A;  5FWB A;  1K8A C;  4BI8 B;  1KQ1 A;  1G3T A;  3CCV A;  2LDM A;  4BUG A;  1QVP A;  2KMT A;  1YFN A;  3J81 E;  2ZPI B;  3JCM b;  2X9H A;  3OW2 P;  4J6Y A;  5KYX A;  2DIG A;  4HA8 A;  3RES A;  3V8L A;  5GAM e;  4M7A C;  2DMO A;  1QVG A;  5LJ3 d;  3QZ9 B;  2L8D A;  3GF5 A;  1X69 A;  1WHG A;  3H0I A;  2LQN A;  1TXQ A;  3SDZ A;  3JCM Q;  1VQ8 T;  3I35 A;  1M90 U;  1B07 A;  3PMT A;  2E6N A;  2Y4Y A;  2JM8 A;  2RM4 A;  2JN0 A;  1QWE A;  1OPL A;  3CC2 A;  4XK8 E;  3ULR B;  2F2W A;  3L42 A;  1Y96 A;  1KQS S;  2E3I A;  2DX1 A;  1X2Q A;  1LVK A;  1E7O A;  1WX6 A;  3CCL A;  4F7U G;  3VS2 A;  3MCA B;  1WI7 A;  1XQH A;  3T9N A;  5GMK j;  1AZE A;  3CC4 A;  2A37 A;  1MV0 B;  2FRY A;  2DZ9 A;  3QHS A;  2E1H A;  3H8Z A;  2RK1 A;  1GXI E;  2D1X A;  1D1B A;  1WZO A;  4LUE A;  4C92 E;  3OB9 A;  5HK3 A;  4KUD K;  4II1 A;  1NBE B;  4ANJ A;  1K73 C;  3JCM J;  2B8A A;  4PLI A;  3L2V A;  2PU9 B;  4RTW A;  2FVU A;  2MK5 A;  4C8Q B;  4M7A G;  2HMA A;  2VVK A;  3JRZ A;  3OYF A;  1E6G A;  1WDX A;  4C0Z A;  4GLM A;  1VQ7 T;  5D6X A;  1T3L A;  4JZ3 A;  2HNI A;  2YT6 A;  1K9M R;  4KT0 E;  4DBF A;  3DLL A;  3VKI A;  1BU1 A;  4BI4 A;  4J83 A;  2JM9 A;  2KGT A;  4GLK A;  6AT1 B;  5A2Q E;  1ZLM A;  2A28 A;  1D3B A;  3A8G B;  4RG8 A;  2L3Q A;  1AVZ C;  2E41 A;  2FYK A;  3JB9 G;  2BUD A;  1GBR A;  3THK A;  4A53 A;  3UPU A;  1VQM Q;  3X24 B;  5IH2 A;  2KDS A;  4A4F A;  4JJN K;  2FPF A;  1QMC A;  4M78 A;  5GAN 6;  3CPW S;  2VKN A;  3UDC A;  4OMP A;  2GQV A;  5GMK l;  3CEY A;  2DFU A;  3HPW A;  3RIR A;  4M77 D;  2O31 A;  4D8D A;  1K8A R;  1QP3 A;  4PJO F;  3RMS A;  1S72 Q;  2WSE E;  4XAX B;  3S3M A;  3V7C A;  3O5Z A;  4GBQ A;  3DB4 A;  4OMN A;  1OEB A;  5IXB A;  4FCY A;  1JJ2 S;  4MDX A;  2P0P A;  3I55 T;  2L89 A;  1UHF A;  3JCM d;  4IKF A;  3C94 A;  4PJL A;  2R5A A;  3TSZ A;  1WXU A;  1V29 B;  2PVD B;  2HBP A;  2DIL A;  4C92 G;  2QDY B;  2EAY A;  1TU0 B;  2RMO A;  3LWI A;  1OX8 A;  4ME7 A;  1V1C A;  3UA6 A;  1AEY A;  1GFD A;  4AG1 C;  2ZGW A;  4MZT A;  4J7F A;  1NPP A;  2L3P A;  4FIB A;  4QQG A;  4MZP A;  4BB7 A;  1D0Z A;  1PD0 A;  4PFO A;  1UG1 A;  4OMF B;  1VIF A;  2LT4 A;  3JCM f;  1ZSG A;  4LXC A;  3M9Q A;  1QQJ A;  2HZY A;  2YUP A;  2W10 A;  3OW2 A;  1YN8 A;  4FW1 A;  3JCM P;  3JSC A;  1M3C A;  4M7D F;  3OYD A;  4RTT A;  4E7H A;  5GAO m;  1U1S A;  4ZNX A;  1WHH A;  3SHW A;  5GAN 8;  1M90 C;  3M5A A;  3PIP A;  2DEQ A;  1B34 B;  1JRI A;  5GAN j;  4O5V A;  1NE8 A;  1G8X A;  5AYF A;  4DEX A;  4C8Q A;  5LJ5 d;  4MDW A;  2VGM A;  1M1K C;  1HK9 A;  1YJN T;  4E7I A;  1PC0 A;  1UB4 A;  2FZC B;  1X75 C;  1IB8 A;  4IUT A;  4A54 A;  2J06 A;  4DOV A;  1BB9 A;  1VQ8 A;  1VQK T;  3GNF B;  2QEX A;  1JEG A;  3OYL A;  4PNO A;  1PKT A;  2SEM A;  4CRI A;  1RAD B;  1R0C B;  1YJ9 A;  2EBP A;  1X6O A;  2DXC A;  2X3W D;  4PJO B;  4WTO B;  1VQ4 A;  3RKX A;  3CCQ T;  2VWF A;  1IO6 A;  3QZ5 B;  4NL3 A;  3CQT A;  1ZA1 B;  2KK4 A;  3EFO B;  4M4Z A;  2DVJ A;  1V76 A;  2QGF B;  5CQY A;  2F2V A;  4KRT A;  1C6V X;  4FT4 A;  3V8J A;  4L6V 5;  1EIF A;  2PUO B;  3CCU A;  5C0M A;  4EIK A;  2QAZ A;  3H41 A;  1NYG A;  1M30 A;  4M75 E;  1H64 1;  2MAM A;  2QQ9 A;  2E3H A;  2E70 A;  4HT8 A;  5GAN 4;  1YIT A;  2DO3 A;  1QLY A;  2DRK A;  1H92 A;  1S72 T;  2JUF A;  1RAF B;  1K4U S;  1ZSZ B;  1PRL C;  5IT9 E;  3LH0 A;  3CMA T;  1PCX A;  1AWX A;  2X51 A;  4PK4 A;  3JB9 D;  2QA4 T;  4M7D B;  2O9V A;  3CCE A;  2XK0 A;  4J9I A; 
#chains in the Genus database with same CATH homology
 2QYZ A;  2P84 A;  2OX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...