4KUIA

Crystal structure of n-terminal acetylated yeast sir3 bah domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
201
Chain Sequence
KTLKDLDGWQVIITDDQGRVIDENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Regulatory protein SIR3
total genus 53
structure length 201
sequence length 213
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kuiA00
1W4SA 2FL7A 4LD9K 1M4ZA 4DA4A 2FVUA 4DOVA 4KULA 1ZBXA 3TU4K 4KUDK 1ZHIA 4FSXA 4DOWA 4FT4A 3PT9A 4BB7A 4FT2A 4JJNK 4KUIA 3PTAA
chains in the Genus database with same CATH superfamily
1B07A 2DXTA 5LJ3j 3NTHA 4BUGA 3HSBA 3VV0A 2ZCFB 2FZCB 1A0NB 2EGEA 3H6ZA 3RNJA 4PK4A 1BI1A 2HQXA 2KRNA 2E70A 4MZMA 4FYVB 2JT4A 1PSEA 2QQRA 1BCOA 2H8HA 1RUWA 1V76A 1WGSA 4KUIA 1HK9A 3E1SA 2RHUA 1YJ9A 2EWNA 3EG3A 4B9XA 4X1VA 1JB0E 3PNWC 1U1TA 2KI7A 1NEBA 1BK2A 2HQHA 3JCMX 2A3LA 1YIJQ 3GPLA 3L1AA 1OOTA 7AT1B 3EG0A 5CKEA 2VGNA 2ZZDA 1WJQA 3CCUA 3VUZA 1C6VX 5GANd 2DL3A 4BD3A 2BE7D 3OYNA 1YJ9Q 1WNLA 2M1HA 2PU9B 2JMCA 3E19A 4OB3B 1NJIC 1O9SA 3GNGA 2OTJT 3LYIA 2J6FA 2O9VA 3REAB 5A0GA 2DTHA 1F1BB 2F2VA 4WCIA 5KYXB 2YUQA 3CCET 2PVGB 2YHTA 2QQAA 2J06A 1ARKA 2RQRA 2VV5A 3OMGA 2JTFA 1NPRA 4PLLA 2D8JA 1BCMA 5CCAA 2RI2A 1IREB 2QK0A 5IXBA 4E7JA 2QEXA 1W2BA 4X34A 4F04B 2L2PA 1PM3A 5L8RE 1YJNT 2C0OA 4M75G 1W2BP 1WJRA 4TVRA 2IIMA 4A4HA 1MNDA 3H0FA 3JCMV 2RH2A 1OU9A 4IUTA 1YFNA 2KR3A 1NZ9A 4OB1B 1OX9A 1TG0A 4AG1C 2DM1A 2VASA 2FO0A 2MIOA 1K9MR 1WYXA 1R77A 1Q95G 1PD1A 1VQ7A 2LZ6B 4C5GA 3QO3A 3OA6A 4C8QD 1UHFA 2RI3A 3EFRA 4QQ6A 2CP3A 3TREA 4AG2C 3CCUQ 1QWEA 4DEXA 1X6GA 2J6OA 2NUPA 1YBYA 2M0YA 5FLXE 4F7UE 3KFVA 4RTTA 3SD4A 5LJ5f 2CP5A 1KFZA 4J7IA 1M9SA 4QQDA 1AD5A 1D0ZA 3VU3C 2FB7A 3TSWA 4RTWA 3MCAB 4ZN1A 2ZGWA 4PJJA 4EPCA 1LCKA 1Y7XA 1GFDA 5CQYA 4EMKC 3CCQT 2L89A 2SRCA 3URGA 1YI2Q 2DLPA 4C92D 3TQ7P 3RKYA 1X69A 1NE8A 1Q7YU 1B7TA 1PC0A 1KQ2A 5I11A 3JCMe 1M90U 1K0XA 2LC4A 1OZ2A 2MMPA 1ZUKA 2K7AA 3G4SA 1NPPA 4J7FA 2FL7A 1XJWB 2D1XA 3F70A 2QA4T 2YWWA 8ATCB 4JPBW 4M75C 5LJ5d 2G6FX 4EDUA 1UFFA 3QKJA 4XTWA 1UUEA 3TU4K 3GBQA 1XTDA 1GRIA 4LDUA 2A28A 4M7AD 1LOJA 3JCMW 4AFSC 2P0QA 1RAGB 4OGEA 1M1GA 4DEYA 1VQ6T 3QSUA 2AKLA 3UPUA 4O5VA 3HFNA 5GAMj 1W6XA 3JCMP 2AK5A 3E9GA 1YCYA 3GLXA 2QASA 1WI7A 2DJQA 3CBOA 1Q81U 1AZEA 1WJSA 1IO6A 2K5IA 2E5KA 3A8HB 4NL3A 1GCQA 5L23A 2DERA 1ZQ1A 1K8AC 3PIOA 4M78E 3PMIA 2K57A 1RAEB 4M7AB 1PNJA 3FC3A 3CCJT 1I1JA 2E41A 1ZX6A 4JS4A 1VQPA 4II1A 3I5SA 1Q82C 1VQ4T 1PRLC 1QVGS 2OI3A 1JJ2A 5AT1B 4FM4B 1M1FA 3HHTB 1BI3A 5GAOr 3HTRA 3QIIA 4BDZA 4J9FA 4HKEA 5HCKA 1SRLA 1G83A 4WTOB 3LGFA 3UA7A 1WX6A 1VQLA 3CC7T 3OS1A 2DVJA 2MK5A 3EG2A 2KMTA 1BB9A 2BZXA 2XDPA 4HVVA 2E12A 4E7HA 2IVWA 3CCSA 2HKQB 2JJ9A 1CKBA 3CPWP 5FU6B 2HDAA 4M77E 2LTOA 2A36A 2LCLA 2V8KA 1OYXA 1EIFA 3CPWA 2P4RA 2GGRA 4P5NA 1SF9A 5FU6C 3M0PA 2NUTB 3JCMc 2XHCA 2ROLA 3N5BB 1K73R 3LH5A 4J9IA 2X3XD 3G71T 3CCLQ 5KYWA 3QYGB 4GY5A 1JEGA 5CKDA 1AWJA 2V1QA 2YUPA 1FXXA 4OMLA 5LJ3e 1GXIE 4AT1B 2CZ6B 5AYFA 3CD6Q 4A54A 1VYTA 1WLPB 3ER0A 2GNCA 4PLIA 1M2VB 3P8DA 2CT4A 2GTOA 4IUPA 1YP5A 2EKHA 2I2LA 1IHWA 1I81A 2H3EB 2L3PA 3G4ST 4C0DB 2CREA 3ME9A 1FWZA 3M56A 4E7SA 1RI9A 3OYHA 3CCRT 1U1SA 3C94A 1PKSA 3CCUT 2CYZB 4M75B 1MV3A 3JCMJ 3OQ5A 1T0HA 3FB9A 3CXCA 2PVOB 1NJIR 1YITQ 2KVQG 2VGMA 4M75D 2CP7A 2DL8A 4J5YA 2FG0A 3DB4A 2K3BA 2LCCA 4DOWA 4V2SA 4ELZC 1K8AR 2DD4A 1KK7A 3J81E 3CMEA 4E47A 2P0PA 1ZSZB 1V1CA 1W1FA 3VKIA 1R0CB 1HJDA 5J39A 3QZ9B 2DZCA 2EFIA 3REBB 3PIPA 3VS3A 1Q82U 1ZLMA 3S3NA 1BIBA 4M75A 3JB9D 4C92A 3GP8A 1H3ZA 1X2QA 4C5IA 3EFSA 3WXMB 3VS4A 3JRZA 4FT2A 3UDCA 4FL6A 4JJCA 4PJOG 3G6ET 1VQMQ 1YITT 2L3QA 3RMQA 1BU1A 4M77D 2ZPFB 3CC2T 2JMAA 3L42A 4M77C 1UECA 1M1KU 1NBEB 1QLYA 2ED0A 1G3TA 4RKUE 1QKXA 1KD1U 2YLBA 2A37A 3EHRA 4MZPA 4RG2A 1KQSS 1QKWA 5LL6S 3CCMQ 4JRQA 2KT8A 1AWOA 3EG1A 2GFUA 1N8RU 1X01A 2LNVA 1RLQC 1MHNA 1OU8A 5A0LA 5I2MA 1WQ7A 4Y28E 2ZPIB 3R6NA 3J7AF 2XG8D 4M7DD 5IHIA 2DMOA 4M78B 2E65A 2HMAA 4FSSA 4HA8A 2FPFA 3SWNA 4DBHA 4JJNK 2DBMA 2L0AA 2BKDN 3QXEB 4OMMA 3X26B 2LX7A 3M53A 1I5LA 3QZ5B 3EG9A 4YTLA 3FIFA 3CMET 3QPHA 3CMAT 4J6YA 2LQKA 1YN8A 2RF0A 3CBMA 3ZEHA 4XU0A 3CCRQ 3S3OA 2RA2A 3M59A 4C5HA 3KBGA 2RQVA 4N0AA 5CKFA 2HL5C 3UF4A 4M7DF 4M78G 2V26A 3M4GA 3MEAA 3TVTA 4OMQA 4Q5WA 2DVEA 2XICA 1WFWA 1QCFA 2F69A 3JB9H 4JLGA 3CCRA 2V8IA 4J9HA 4PJOC 4ZTJA 3I56T 2FRWA 1ZSZC 3CC2A 3MKDA 1CSKA 2K5FA 1VQNA 1X43A 2XK0A 2DIQA 1QVFP 3NPFA 5HK3A 4JS5A 2CP0A 1M30A 1C0MA 2LJ3A 5KYWB 4IIMA 4KH1B 5IHKA 3O8VA 3OBWA 2RHZA 3I56Q 3C12A 3V7SA 1QW1A 5D6XA 1Y96A 1M1KC 3CC4A 3TSZA 2E6NA 4IIOA 3G71A 5GAOn 1RI0A 2B86A 2YLCA 3OBYA 3CCMT 4LUEA 2L5QA 1MMAA 5GAN7 1G5VA 4LNPA 3VRYA 5C0MA 2RK2A 4OP0A 2X4YA 2OTJA 2CP2A 2LNHB 5GAN5 4L5GA 2QTVA 1PSFA 2HD0A 2OAUA 3M0QA 3CCVQ 2EW3A 1QVFS 4DBRA 3MHXA 4CRIA 3LLRA 4M4ZA 2BZYA 1VQ9Q 1YNZA 4M77B 3OYBA 2RHYA 1VQPQ 3M0RA 2X9HA 2GQVA 1I5OB 1Z9ZA 3CC7A 4J9EA 5M9OA 2EVRA 4EMKB 1VA7A 2DTOA 4XAXB 2YXYA 1UE9A 5DLQE 1VQ9A 1QMCA 4IUQA 2EKOA 3TCJA 3NMZC 4M7AE 3PT9A 1GCQC 5GANe 3EH2A 5FRNA 2DRKA 4J9CA 2L8DA 1X6BA 2OTLA 2C0IA 1W4SA 3CC2Q 4CI0C 1M4ZA 4XTXA 4A4KA 2PNIA 4OMNA 1N27A 1IRXA 4XQ3A 1KQ1A 2JM8A 2VVKA 2DILA 3CQTA 1Y07A 2EYXA 3OYKA 4M7DG 3I5RA 5CVIA 1WHKA 3H9NA 1Q81R 3CC4Q 4M77F 3JB9G 3CCEQ 4FIBA 2DA9A 3G6EQ 1K9MC 1NJIU 2LVMA 2YUNA 2EYYA 5CO7A 2PZ1A 3OS0A 3EGDA 2AHJB 4C92E 3QWYA 4J9BA 4M75E 2HSEB 2LJ0A 3FEOA 3VS5A 4X9DA 2KYBA 1Y71A 3FJPA 2DJZA 3OSSC 4OVAA 4OMOA 4R0KA 3X28B 2FRYA 3JAME 3I55Q 3HPWA 3I9QA 2EIFA 3SWNC 2AT1B 2DK3A 2ED1A 1SHFA 2XMFA 3V8JA 4F14A 4F7UB 4ANJA 2E3HA 1E6GA 3SB2A 4C8QC 5GMKh 2LT1A 1QVPA 1YWOA 2D6FA 3ASKA 1WDXA 4LE9A 3OW2A 1OZ3A 1KIKA 1OEBA 2DF6A 2M9UA 3H41A 4Z89A 1M2VA 1PKTA 2GFAA 3WVEB 1N5ZA 3CPWS 2ZPBB 3D7SB 3PE0A 3MPUB 2C0TA 3BFMA 4PKCC 4DOVA 2DZ9A 2LMJA 4C92F 5GMKl 1NYGA 4JDSA 2COYA 1HD3A 1VUBA 2EYZA 4C92B 1JXMA 4JUVA 3NFCA 1J3TA 2P0KA 2RB6A 4PFPA 4M7AA 2PTKA 3PVQA 3INZA 3MP8A 4M7DC 2RNAA 2LQNA 1SSHA 2D0NA 3DB3A 3M0SA 3BDUA 2K9GA 3CPFA 4E2FB 1GL5A 4RTXA 4QVDA 3BY7A 1N6AA 2E4HA 1BIAA 3A8OB 3M4YA 4B6MA 1YCSB 2EQJA 4J9GA 1I0CA 2JNGA 1PG5B 5LJ5j 1RL2A 1K76A 1TUDA 1UTIA 3L2RA 4KULA 2KBTA 2QGFB 4OB2B 5FWBA 3EH1A 1YJNA 2EQMA 3CBPA 5GMKm 4C0ZA 3I56A 5CK9A 4EMKA 4EIKA 5I22A 3TEEA 2ZPGB 3T9NA 4E6RA 5HY6A 2O88A 4HCCA 3L2UA 2KXDA 5KCOA 3OYIA 4LDVA 4PJOD 1G2BA 4OGCA 4RG8A 5GAN4 2ENMA 1WIEA 4OB0B 1UDLA 2MF2A 2VKNA 1FMKA 3PFSA 5C6SA 8AT1B 1H641 2CSIA 4LXCA 2JN0A 4K11A 2RN8A 1RACB 2GTJA 2RMOA 4J6XA 1MNEA 2O4XB 2DTIA 5GAMh 5GAOp 4BE1A 4LDWA 2QTXA 5GANh 3LWIA 2FVUA 3JCMh 5I21A 1KHIA 1YJWT 2CT3A 1HYOA 2CZ7B 4R55A 4AMCA 9ATCB 1KC8C 4M7AG 4IUVA 2GF7A 5GAMf 3QDRB 1V29B 3RKWA 3EGDB 1EZZB 2MI6A 5FWCA 3WVDB 3UATA 2RHIA 3EFOB 3A98A 4D8KA 3M0UA 1M3BA 5LJ5e 2QEXQ 1VOMA 5GAN6 1OV3A 3VS7A 1FMWA 2W10A 3EHQA 1VQKQ 1OPKA 2R5MA 2RJFA 3H0IA 2HQEA 4M75F 2EGAA 4N0AC 4ZNXA 2RHXA 4DA4A 2AZVA 2LRQA 2DBKA 2EGCA 1FX7A 1AWWA 4QVCA 1M2OA 2KE9A 2O31A 3G6EA 3CCQQ 3SHWA 5CAIA 1YHQT 1WXUA 4XTZA 4F17A 1H8KA 2LX9A 1N9RA 3ZFJA 1ZSZA 4C0DC 3E9FA 5CR2A 2RQUA 4XU1A 2KROA 4BI4A 4BACA 4OMFB 4Z02A 1VIFA 3A8LB 3OSVA 2SEMA 3HP9A 5GMKj 2OAWA 4F7UG 1BBZA 4CC2A 1JXOA 1VQOA 4M78F 3L2QA 1X6OA 5GAN3 2J6KA 2OTJQ 4EMGA 4MMKA 2CSQA 5LJ3h 5CKBA 2AZSA 2KXCA 1SKUB 1VQOT 3PGGA 4OF1A 4KRTA 3CCJA 1N8RR 4M7AC 5DM7R 2K2MA 2K3YA 4A4EA 4FSXA 2YSQA 1D0YA 1VQLQ 1YJWA 1D1AA 3UT1A 4RTYA 3E2UA 2VYTA 1GCPA 3MO8A 2ZAEA 2O2OA 3MEWA 5KYYB 1UB4A 1WZOA 3OS5A 1YHQA 1OI1A 1TUCA 3OYGA 1VQPT 3CCVT 1UEBA 2FZKB 2DIGA 1VQ7T 2R58A 5J3BA 2FPEA 2QYZA 2HZYA 1UGQB 2K5LA 5KYXA 2OTLQ 4A4FA 4F16A 5LJ5h 4NS5A 5KYUB 3KUFA 2BUDA 5EG2A 4F7UF 2W0ZA 2CZ1B 2QI2A 5D6WA 3VYHB 3NTIA 1WQWA 2IG0A 1G3YA 1NLOC 1XOVA 4Y92A 2DPPB 3SFMA 5GMKi 1Y96B 5LJ3d 4FU6A 3RESA 1G8XA 2E1HA 2FEIA 1YHQQ 1ZSGA 2FPDA 4HCKA 4QVZA 4DQ2A 4NOYA 1UG1A 3HKSA 5GAN2 5KYYA 3CCEA 3CCVA 1TSFA 4M7DB 2CDTA 2H3JA 1QCOA 3DKMA 4XTYA 2D9TA 1SG5A 2MWPA 2OX7A 4JJBA 4JJDA 4LD9K 2HKNA 4M77A 4HXJA 2R57A 2B8AA 2QXFA 3M54A 3L2VA 1D0XA 3QJYA 1E7OA 2XIDA 3M57A 2A7YA 2EQUA 2HSPA 1QQJA 4BB7A 4D8DA 3PVLA 4RTZA 2QDYB 1PHTA 3J80E 1AZGB 4L6V5 3JB9J 3MP1A 5GAMd 3OYDA 3GF5A 2KSSA 4ZGDB 1OULA 3RUXA 5KE2A 1KD1C 1RAAB 4AFUC 4KGZB 1BI2A 3G1JA 3DLMA 3NTKA 1O75A 1ABQA 3HFOA 1ZA2B 2KNBB 2QEXT 4Z88A 3EG9B 4M78A 3P8BB 2K4YA 4FW1A 4N4IA 1NEGA 3H0HA 2RJDA 3META 2EYWA 2PQWA 3M0TA 5IH2A 2G3RA 1JU5C 2YUOA 2E64A 1IB8A 2QG9B 2EYQA 1U06A 1K73C 2DX1A 2A0FB 1D1CA 1HXDA 1I07A 1Q86U 2DL7A 4X9CA 3CMAQ 2L3SA 1BI0A 1KSWA 3CCQA 2WSEE 1KG1A 3CEYA 2D8HA 1UJ0A 1R0BG 1BYMA 1KC8R 2QDLA 2VWFA 3EAEA 1DJ7B 3FRNA 3L2WA 5GJVB 3LX7A 5GAOq 1N8RC 4DBQA 4HVUA 1YJ9T 2X4JA 1H92A 4BDYA 2DXCA 5HK0A 2IPOB 3V7CA 3O5ZA 3JV3A 2F5KA 1QCNA 2DETA 1OQKA 1WHMA 1WHHA 3M55A 4AFZC 2MPXC 3GNFB 6AT1B 1MGQA 1ZA1B 2HNIA 2XDDA 3BDLA 3VRZA 1WHLA 4LD6A 4UC4A 1TS9A 3PTAA 1AOJA 3S3MA 3ZBDA 1K8AU 1TUGB 2GQIA 2KY9A 4FYWB 5FW9A 1GFCA 1WXTA 2CKKA 1MMDA 2LT4A 4ZGEB 2LQ8A 2LDMA 4F7UA 5GAMg 1NG2A 4ZGJB 1P92A 4RCCA 2DXUA 1M90R 2FYKA 1TWBA 4KGXB 3GIBA 2K6DA 5FU7B 5GANf 4VUBA 5DY9A 2WSFE 5GAOl 3SWNB 1TXQA 2MOXA 2K79A 4RTVA 2FZGB 3RDVA 2EJGA 1SRMA 5KYUA 3IQLA 3CCMA 1JJ2P 2KDSA 1ZBXA 3G71Q 3CCLT 3I55T 3VS2A 1RAFB 2RO0A 1T3SA 5GJWB 5KH6A 2BIVA 2CZ0B 1UGRB 5FROA 3NHNA 2RK1A 2EAYA 1D1BA 1XNIA 2JUFA 1N9SA 3CCST 2DRMA 3R6OA 1CKAA 2O9SA 1VQKA 1OPLA 3OYEA 2JOYA 1NLPC 4ZN3A 1RADB 3ZL7C 4FT4A 3S6WA 1S72A 1KQSA 4PFZA 1SPKA 4ME7A 1IZ6A 2EPDA 2F1LA 1YWPA 3JCMd 4BI8B 4JZ4A 1K9MU 4EMHA 3DLLA 1KQSP 2Y4YA 1RAIB 2YDLA 1VQ4A 4HT8A 1TTHB 3C95A 3CD6T 1D3BA 1UHCA 1C1AA 1AWXA 2J05A 1AHJB 1Y57A 4J9DA 1NM7A 1JRIA 2E5QA 3QJ6A 2NLUA 3HL8A 4D6WA 4CC7A 3X25B 3MEVA 4M7AF 3Q1JA 5D7UA 1VQ4Q 3OYCA 3OYAA 2JS0A 3OYMA 4M78C 4A53A 4A4GA 2O4XA 1T3LA 1LVKA 3HRSA 3OY9A 2ZPEB 5LJ3f 1VQ5A 1VQ8Q 5GAOm 2RM4A 1UJYA 1D3BB 2E3IA 2JW4A 4HCBA 4IURA 2NUZA 4ESRA 4BY6C 4N4HA 2I0NA 4QQGA 3RR6A 2RJCA 3OW2S 4XTVA 1KHCA 2RQWA 2EJ9A 5EC7A 3EGXA 2LP5A 2X51A 4LDYA 2PUOB 2MAMA 4QW2A 2CH4W 3CCSQ 2FHDA 1Q7YR 4MZTA 3QUIA 3MEUA 1LNXA 3BE3A 2QQBA 1JJ2S 2VXEA 2LJ1A 2M16A 2HL3A 4IUUA 4QKUA 2LQWA 1VQ5Q 3OYFA 1VQ8A 3LH0A 4IKFA 1EX4A 2JVVA 2MCNA 4C8QB 3JCMg 1M90C 3C4SA 5IHNA 3CMAA 2NUTA 1Z9QA 4C8QF 3G7ZA 4CC4B 1QVGA 4HVWA 2XU8A 4JRIA 3ULRB 3JCMf 3QHSA 3VUBA 4R56A 4PJMA 4C0FA 2DYIA 4KBMB 3CXCS 3RIRA 4FCYA 1AEYA 4LN2A 4GLMA 1M5Q1 4ELYC 2WSCE 4E7IA 4C0GA 4KT0E 4KGVB 1KJWA 5FRMA 1K0SA 1ZUUA 3X24B 3CMEQ 4KUDK 3FDRA 3X20B 1ZHIA 4B9WA 4C92C 2QAZA 1VQMA 2CS7A 3VS1A 4PL6A 2ZPHB 4PJOE 2HBPA 4C8QE 4M77G 1TH7A 2KRSA 2KK4A 5KCHA 4XU3A 2HBWA 2X4WA 1EFNA 1K4US 1JQQA 1M27C 1M8MA 1VQ5T 1MMNA 1YJNQ 3QWXX 3FJ5A 2RQTA 3THKA 4RTUA 4ZTFA 1RAHB 2EQKA 1YIJA 3QDFA 4HCZA 4PJLA 5CKHA 2F2WA 1B34A 5I2SA 2YRDA 1GBQA 1D09B 4E7LA 2L3RA 3I35A 2AKKA 4O6JA 5FU7C 5IXFA 5HKCA 2OTLT 3V7RA 3JCMb 1WXBA 2GBQA 2RJEA 2P4TA 1VQ7Q 3P8HA 2ABLA 2QQSA 2DE0X 2D0QB 3EFOA 4LDXA 2O01E 2NUPB 2KEAA 4MDWA 2KYMA 3OYYA 2CUBA 2X4XA 5CIUA 2DNUA 4BY6B 2XDBA 3RMSA 2JS2A 3EGUA 2ATCB 1NYFA 2ECZA 3RERA 2V1RA 3M5AA 4JRKA 2Y90A 1VQLT 4FYYB 1QP2A 2KQWA 1B34B 3C0CA 4DBFA 1MV0B 2Y4XA 2XKOC 3AT1B 1YI2T 1MUZA 5DLOA 1I4K1 2F5TX 2MYSA 4OMPA 2OJ2A 1VQ9T 4M7DA 2BTTA 3RBBB 4ORZA 3SEMA 3L2ZA 4C92G 1PCXA 2PUKB 5GMKe 1VYUA 3A8MB 1FYNA 3JSCA 2P84A 2PVDB 2KT1A 3A5ZB 3LWHA 1VQ8T 1WPYA 1E6HA 4XTUA 2KRMA 2VC8A 1WA7A 2QA4Q 5LJ3g 5GAMe 1T0JA 1Q86C 1RABB 1VQNT 1JO8A 2BZ8A 2J7IA 1QP3A 3VJPA 1Q7YC 2VB6A 3V8KA 2DAQA 1VIEA 3VYGA 2ROTA 1RLPC 1K1ZA 1UGVA 1M8VA 2GCXA 1U3OA 4QT7A 5KE3A 1LPLA 2DXBA 1ZUYA 3RKXA 3OYJA 1LJOA 2V8JA 4KH0B 2JTMA 2QA4A 1S1NA 1WHGA 4RUGA 3HRTA 2KGTA 4GBQA 1PRMC 5CQXA 2RD1A 4XU2A 4M78D 3KXTA 2MWOA 5IN1A 2RPNA 4HT9A 2HEQA 3VS6A 4JRPA 1S72Q 1SSFA 2CUDA 5IT9E 2NYSA 1YI2A 2AIRB 4PFOA 2DEQA 1MMGA 2JM9A 2DL4A 4AFQC 4BE0A 2A08A 5GANg 3G4SQ 3OS2A 3M9QA 3H8ZA 1SEMA 3FLGA 5J26A 4M7DE 3AHUA 3CC7Q 4RCBA 4J83A 1ABOA 4E7KA 3QYHB 2RI5A 4GLKA 2VXFA 4L59A 2R5AA 1QVGP 1UGSB 1W70A 3VS0A 4A63B 1VQ6A 2VUBA 2Z0WA 3OYLA 2NWMA 5LJ5g 3BW1A 2DFUA 1VQKT 3QG1A 1GBRA 1YIJT 1UGPB 3A1PA 2DYBA 3NGPA 3JB9F 4XK8E 5A0DA 1BKBA 5IAYA 3CC4T 1VQNQ 1Y0MA 1PD0A 2EBPA 2BE9B 3CXCP 4J8OA 4N4GA 2YT6A 2JZ2A 2COZA 4E7ZA 2CGHA 4PNOA 3U23A 1I8FA 2DKGA 2E10A 2M02A 2M51A 1KC8U 2F2XA 3JCMQ 1G3SA 1XQHA 3V8LA 1H3HA 1KD1R 2DO3A 1U8RA 1AT1B 1VQMT 1PWTA 3EGXB 5ECAA 4WF2A 1M1KR 1ZBJA 1VQ6Q 5A2QE 1SHGA 2X3WD 4C8QG 1B3QA 1YJWQ 2ESWA 1Q86R 1FMVA 1WHJA 2QGGA 4MMLA 3LGLA 5D6YA 5GANj 1VYVA 1IHVA 4FYXB 3QBYA 2C06A 2EJFA 3CCJQ 4C8QA 4PJOA 3CD6A 1M3CA 4PJOF 2E6ZA 1AVZC 4BI3A 2HCKA 3OW2P 1VQOQ 1Q82R 1X27A 4FW2A 3OMCA 4J6WA 4C5EA 4NL2A 2HAXA 1IGUA 2YRVA 4JLIA 4Z8AA 2CP6A 2CH4A 4ATOA 1QVFA 2YRCA 1TOVA 2DD5A 3A8GB 4CC3A 2EQIA 1IXDA 2KAFA 1QWFA 2DEUA 4RMOA 2LCSA 2DL5A 3JB9I 3HRUA 1G3WA 1JBMA 2JXBA 1W2BS 1HSQA 2X35A 5KYNA 3PMTA 2XI9A 3GOXA 3MP6A 5GAN8 3CCLA 2QQ9A 1IGQA 1S72T 1X75C 4LUDA 3M58A 3UWNA 1OX8A 4PJOB 3LW5E 2JTEA 4JZ3A 4MDXA 3MJXA 1M3AA 1TU0B 2K2VA 2WACA 2COWA 3UA6A 4Y91A 1Q81C 2M0OA 1ACMB 1YITA 4PJNA 2XD0A 2K3XA 3SDZA 3OB9A 1K9AA 1X2KA 1U5SA 1R8OB 3I55A 1K73U 4BE2A
chains in the Genus database with same CATH topology
3E9FA 2DXTA 5LJ3j 2QQBA 5CR2A 2GFUA 1JJ2S 2VXEA 1N8RU 1X01A 2LNVA 2M16A 4XU1A 3NTHA 4IUUA 4BUGA 3HSBA 4BI4A 1VQ8A 3OYFA 3VV0A 4BACA 3LH0A 4IKFA 1MHNA 4OMFB 2ZCFB 4Z02A 5A0LA 5I2MA 1WQ7A 1VIFA 2JVVA 3H6ZA 2ZPIB 4Y28E 3A8LB 3OSVA 3J7AF 1BI1A 2HQXA 2XG8D 4C8QB 4M7DD 3JCMg 2E70A 4MZMA 3HP9A 2E65A 4M78B 1M90C 4HA8A 5GMKj 3C4SA 3CMAA 3SWNA 1PSEA 2QQRA 4F7UG 1WGSA 4C8QF 3G7ZA 4JJNK 4KUIA 1HK9A 4M78F 3E1SA 1VQOA 3L2QA 1QVGA 1X6OA 2RHUA 2BKDN 2XU8A 3QXEB 5GAN3 1YJ9A 2EWNA 4JRIA 4MMKA 5LJ3h 3X26B 4B9XA 4EMGA 5CKBA 3JCMf 3M53A 1JB0E 3QHSA 3VUBA 1I5LA 3QZ5B 4R56A 4YTLA 1VQOT 3PGGA 4OF1A 3CCJA 3FIFA 3PNWC 3CMET 4C0FA 1U1TA 4M7AC 3QPHA 3CMAT 4J6YA 2LQKA 4KBMB 3JCMX 2A3LA 3CXCS 3GPLA 3L1AA 3RIRA 5DM7R 3CBMA 3ZEHA 2K3YA 4XU0A 5CKEA 4A4EA 2VGNA 2ZZDA 1WJQA 4FSXA 3CCUA 3VUZA 3S3OA 1YJWA 2RA2A 3M59A 5GANd 3UT1A 1M5Q1 4C5HA 3KBGA 4BD3A 4ELYC 3OYNA 2WSCE 2VYTA 4N0AA 3MO8A 5CKFA 1WNLA 2M1HA 2PU9B 4M78G 4E7IA 4C0GA 3MEWA 4KT0E 4M7DF 3M4GA 3MEAA 3E19A 4OB3B 4Q5WA 1NJIC 2DVEA 1O9SA 3GNGA 5FRMA 1UB4A 2XICA 2OTJT 3OS5A 2F69A 3JB9H 4JLGA 3LYIA 3X24B 1YHQA 1OI1A 3CCRA 2V8IA 3OYGA 4KUDK 5A0GA 2DTHA 4PJOC 3FDRA 4ZTJA 1VQPT 3X20B 1ZHIA 3CCVT 3CCET 3I56T 2PVGB 1UEBA 2QQAA 2YHTA 2DIGA 1VQ7T 2VV5A 2R58A 5J3BA 3OMGA 4B9WA 4C92C 2JTFA 3CC2A 1NPRA 1VQMA 4PLLA 1UGQB 2K5LA 5M9OA 2CS7A 4A4FA 5CCAA 2RI2A 1IREB 2K5FA 2XK0A 5LJ5h 1VQNA 4NS5A 4PL6A 2ZPHB 4PJOE 2HBPA 2BUDA 2DIQA 3KUFA 4C8QE 4E7JA 4M77G 2QEXA 4JS5A 5HK3A 5EG2A 1W2BA 1TH7A 4F7UF 2KK4A 3O8VA 3OBWA 4X34A 2RHZA 4XU3A 2CZ1B 5KCHA 2X4WA 2QI2A 3C12A 5D6WA 1QW1A 3V7SA 5D6XA 3VYHB 3NTIA 1VQ5T 1Y96A 1M1KC 3CC4A 1WQWA 5L8RE 1YJNT 2E6NA 2IG0A 4M75G 3G71A 5GAOn 1G3YA 1RI0A 2YLCA 1WJRA 4ZTFA 3OBYA 4TVRA 3CCMT 1XOVA 2EQKA 4A4HA 1YIJA 2DPPB 4HCZA 3JCMV 5CKHA 3SFMA 5GMKi 1B34A 2L5QA 5I2SA 1Y96B 2RH2A 5LJ3d 4FU6A 3RESA 5GAN7 1G5VA 4IUTA 2E1HA 5C0MA 4E7LA 2RK2A 1NZ9A 2L3RA 4OB1B 4O6JA 5FU7C 2OTLT 5HKCA 4OP0A 2X4YA 3V7RA 2OTJA 3JCMb 4QVZA 2RJEA 4DQ2A 4NOYA 2P4TA 5GAN5 4L5GA 3HKSA 1PSFA 5GAN2 2HD0A 3P8HA 2OAUA 2QQSA 1QVFS 1VQ7A 3MHXA 4CRIA 3CCEA 3LLRA 3CCVA 4C5GA 2D0QB 3QO3A 4LDXA 2O01E 3OA6A 4M77B 4C8QD 3OYBA 4M7DB 2RI3A 3EFRA 4QQ6A 4MDWA 2H3JA 2RHYA 3TREA 3OYYA 3DKMA 4XTYA 2D9TA 2X4XA 5CIUA 4BY6B 2XDBA 2MWPA 3RMSA 2GQVA 4LD9K 4M77A 1YBYA 3RERA 3CC7A 3M5AA 2R57A 2B8AA 4JRKA 5FLXE 2Y90A 4EMKB 3SD4A 2QXFA 1QP2A 4F7UE 5LJ5f 2KQWA 1VQLT 3M54A 3L2VA 1B34B 3QJYA 2DTOA 4XAXB 4J7IA 1M9SA 2XIDA 5DLQE 1VQ9A 3M57A 4QQDA 2A7YA 2EQUA 2EKOA 2Y4XA 4IUQA 3TCJA 4M7AE 3VU3C 2FB7A 2XKOC 3PT9A 1YI2T 5DLOA 3MCAB 4BB7A 5GANe 1I4K1 4ZN1A 2ZGWA 2F5TX 5FRNA 2L8DA 2QDYB 1VQ9T 2OTLA 4M7DA 1W4SA 4EPCA 3J80E 4CI0C 1Y7XA 1M4ZA 5CQYA 4EMKC 4XTXA 4L6V5 4A4KA 3CCQT 3JB9J 3MP1A 3L2ZA 5GAMd 2L89A 4C92G 3OYDA 2PUKB 5GMKe 1N27A 3URGA 3A8MB 1KQ1A 4XQ3A 4C92D 3GF5A 2KSSA 4ZGDB 3JSCA 3RKYA 2PVDB 1Y07A 3RUXA 5KE2A 3OYKA 1NE8A 1Q7YU 1KD1C 1BI2A 1KQ2A 5CVIA 4M7DG 3A5ZB 3DLMA 3NTKA 3JCMe 3LWHA 1VQ8T 1O75A 1WPYA 1M90U 2LC4A 4M77F 1OZ2A 2MMPA 4XTUA 3JB9G 4FIBA 3G4SA 1K9MC 3HFOA 2VC8A 1NJIU 2LVMA 1NPPA 2QEXT 4J7FA 2FL7A 5LJ3g 4M78A 3P8BB 3F70A 2K4YA 5GAMe 2QA4T 1Q86C 5CO7A 4M75C 1VQNT 5LJ5d 3OS0A 4EDUA 2AHJB 4N4IA 1QP3A 3QKJA 4XTWA 3VJPA 2RJDA 4C92E 4M75E 3TU4K 3META 1Q7YC 3V8KA 2PQWA 2DAQA 1VIEA 3FEOA 1XTDA 3VYGA 4LDUA 2G3RA 4X9DA 4M7AD 1M8VA 1LOJA 2GCXA 1Y71A 3JCMW 2E64A 2DJZA 2P0QA 3FJPA 3OSSC 4OVAA 4OGEA 3X28B 1M1GA 5KE3A 2EYQA 2DXBA 3RKXA 1VQ6T 3OYJA 3JAME 3QSUA 1LJOA 3UPUA 4O5VA 2V8JA 3HPWA 3HFNA 1K73C 2JTMA 2QA4A 5GAMj 3JCMP 1HXDA 2EIFA 3SWNC 1Q86U 3E9GA 1YCYA 3GLXA 4X9CA 3HRTA 2DK3A 1BI0A 3CBOA 5CQXA 2RD1A 4XU2A 3CCQA 1Q81U 1WJSA 4M78D 3V8JA 3KXTA 2K5IA 4F7UB 2MWOA 2WSEE 5IN1A 4HT9A 1KG1A 3A8HB 3SB2A 4NL3A 3CEYA 4C8QC 5GMKh 2LT1A 4JRPA 1BYMA 1ZQ1A 1QVPA 3PIOA 4M78E 3PMIA 1K8AC 1SSFA 2K57A 2D6FA 3ASKA 3EAEA 1DJ7B 5IT9E 4M7AB 3OW2A 3FRNA 1OZ3A 3FC3A 1YI2A 3L2WA 3CCJT 2E41A 2M9UA 3LX7A 5GAOq 4JS4A 1VQPA 1N8RC 2DEQA 2GFAA 4II1A 3WVEB 1YJ9T 4BE0A 2X4JA 3CPWS 1Q82C 2ZPBB 1VQ4T 4BDYA 2DXCA 5HK0A 3BFMA 3V7CA 1QVGS 2F5KA 5GANg 1JJ2A 3QUIA 4PKCC 4DOVA 3OS2A 2DZ9A 4FM4B 1M1FA 3M9QA 3HHTB 1BI3A 3M55A 3H8ZA 5GAOr 3GNFB 3FLGA 4C92F 5GMKl 3QIIA 4BDZA 1MGQA 4HKEA 4JDSA 5J26A 4M7DE 2HNIA 2XDDA 3BDLA 3AHUA 1VUBA 3LGFA 1VQLA 4LD6A 4UC4A 4C92B 4RCBA 3CC7T 3PTAA 3OS1A 4J83A 4JUVA 2KMTA 3NFCA 3S3MA 4E7KA 3ZBDA 1K8AU 2KY9A 2P0KA 2RB6A 2XDPA 4M7AA 2CKKA 2RI5A 2E12A 3QYHB 2VXFA 3INZA 2R5AA 4GLKA 2IVWA 4L59A 3CCSA 4E7HA 3MP8A 2LT4A 4M7DC 1UGSB 4ZGEB 2LQ8A 2LDMA 3DB3A 2VUBA 4F7UA 1VQ6A 5FU6B 5GAMg 4ZGJB 3BDUA 3OYLA 1P92A 3CPFA 4M77E 2DXUA 3BW1A 2LTOA 4RCCA 5LJ5g 2LCLA 2V8KA 1VQKT 3QG1A 1YIJT 1UGPB 3BY7A 2FYKA 1N6AA 1OYXA 4QVDA 3JB9F 4XK8E 5A0DA 1EIFA 1BIAA 1BKBA 3A8OB 3M4YA 3CPWA 5IAYA 3GIBA 5GANf 5FU7B 2EQJA 4VUBA 5DY9A 2WSFE 5GAOl 4P5NA 3CC4T 3SWNB 5FU6C 2JNGA 3JCMc 5LJ5j 4J8OA 4N4GA 2XHCA 1RL2A 2EJGA 3N5BB 2JZ2A 3CCMA 2CGHA 3L2RA 4PNOA 4KULA 2KDSA 1I8FA 1ZBXA 3CCLT 2DKGA 2E10A 4OB2B 3I55T 1KC8U 3G71T 3JCMQ 1G3SA 1XQHA 1YJNA 3V8LA 2EQMA 3QYGB 4GY5A 2DO3A 1U8RA 5CKDA 1VQMT 2RO0A 3CBPA 5GMKm 4WF2A 5KH6A 4C0ZA 3I56A 1FXXA 5CK9A 4EMKA 2BIVA 2CZ0B 1UGRB 5FROA 2RK1A 5LJ3e 5A2QE 1GXIE 2EAYA 3TEEA 4C8QG 2ZPGB 2CZ6B 5AYFA 1XNIA 3T9NA 5HY6A 2JUFA 4A54A 3ER0A 1N9SA 4HCCA 4MMLA 3L2UA 3CCST 3LGLA 4PLIA 5KCOA 3R6OA 5D6YA 5GANj 3P8DA 4IUPA 4LDVA 3OYIA 4PJOD 4OGCA 2I2LA 4RG8A 1VQKA 3OYEA 1I81A 5GAN4 3QBYA 3G4ST 2JOYA 4OB0B 4C0DB 4ZN3A 2C06A 2MF2A 2EJFA 3ME9A 1FWZA 4FT4A 3M56A 3S6WA 4C8QA 3OYHA 3PFSA 3CCRT 1U1SA 5C6SA 1S72A 1KQSA 3CD6A 4PJOA 1H641 4PJOF 3C94A 4ME7A 2E6ZA 3CCUT 2CYZB 1IZ6A 4M75B 3JCMJ 2JN0A 3OQ5A 4BI3A 3JCMd 3FB9A 3CXCA 2PVOB 4BI8B 1K9MU 4EMHA 3DLLA 4J6XA 5GAMh 2O4XB 2DTIA 5GAOp 2KVQG 3OMCA 2Y4YA 4J6WA 2VGMA 4BE1A 1VQ4A 4LDWA 4HT8A 2QTXA 4M75D 4C5EA 3C95A 5GANh 4NL2A 2FVUA 3LWIA 4J5YA 3JCMh 5I21A 2HAXA 3CD6T 1D3BA 1KHIA 1YJWT 1AHJB 3DB4A 2YRVA 4JLIA 2CZ7B 4R55A 2LCCA 4DOWA 1JRIA 2E5QA 3QJ6A 4V2SA 1KC8C 2NLUA 4ELZC 3HL8A 4ATOA 4M7AG 4IUVA 4D6WA 2GF7A 5GAMf 2DD4A 3J81E 3CMEA 1QVFA 3A8GB 2DD5A 3X25B 3QDRB 2P0PA 1V29B 3MEVA 4E47A 4M7AF 3RKWA 3Q1JA 2MI6A 3VKIA 2KAFA 3WVDB 2RHIA 5J39A 4RMOA 3OYCA 3QZ9B 3JB9I 3OYAA 3HRUA 1G3WA 2DZCA 2EFIA 1JBMA 3PIPA 1Q82U 3OYMA 3S3NA 4M78C 5LJ5e 1W2BS 4A53A 1BIBA 2X35A 4M75A 3JB9D 3PMTA 4C92A 5GAN6 3GP8A 1H3ZA 4A4GA 2O4XA 2XI9A 4C5IA 3GOXA 3HRSA 3MP6A 3EFSA 3OY9A 2ZPEB 5GAN8 5LJ3f 3CCLA 3WXMB 2QQ9A 1VQ5A 3JRZA 5GAOm 4FT2A 3UDCA 4FL6A 1S72T 2R5MA 2RJFA 4PJOG 1X75C 2RM4A 3G6ET 3M58A 1D3BB 1YITT 3RMQA 3UWNA 4PJOB 2HQEA 3LW5E 4HCBA 4MDXA 4M75F 4IURA 4N0AC 4BY6C 2K2VA 4N4HA 2WACA 2RHXA 1K73U 4M77D 4DA4A 2ZPFB 3CC2T 4Y91A 2LRQA 3L42A 4M77C 4QQGA 1Q81C 2RJCA 2M0OA 4XTVA 1FX7A 3OW2S 1KHCA 1M1KU 4QVCA 1YITA 2EJ9A 3G6EA 2K3XA 3SDZA 2XD0A 1G3TA 4RKUE 5CAIA 3OB9A 4LDYA 2PUOB 2MAMA 1YHQT 2YLBA 1KD1U 4XTZA 4QW2A 4MZPA 2LX9A 4RG2A 1KQSS 2FHDA 5LL6S 1R8OB 1N9RA 4MZTA 3ZFJA 3I55A 4JRQA 3MEUA 4C0DC 1LNXA 4BE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4S A;  2FL7 A;  4LD9 K;  1M4Z A;  4DA4 A;  2FVU A;  4DOV A;  4KUL A;  1ZBX A;  3TU4 K;  4KUD K;  1ZHI A;  4FSX A;  4DOW A;  4FT4 A;  3PT9 A;  4BB7 A;  4FT2 A;  4JJN K;  4KUI A;  3PTA A; 
#chains in the Genus database with same CATH topology
 1B07 A;  2DXT A;  5LJ3 j;  3NTH A;  4BUG A;  3HSB A;  3VV0 A;  2ZCF B;  2FZC B;  1A0N B;  2EGE A;  3H6Z A;  3RNJ A;  4PK4 A;  1BI1 A;  2HQX A;  2KRN A;  2E70 A;  4MZM A;  4FYV B;  2JT4 A;  1PSE A;  2QQR A;  1BCO A;  2H8H A;  1RUW A;  1V76 A;  1WGS A;  4KUI A;  1HK9 A;  3E1S A;  2RHU A;  1YJ9 A;  2EWN A;  3EG3 A;  4B9X A;  4X1V A;  1JB0 E;  3PNW C;  1U1T A;  2KI7 A;  1NEB A;  1BK2 A;  2HQH A;  3JCM X;  2A3L A;  1YIJ Q;  3GPL A;  3L1A A;  1OOT A;  7AT1 B;  3EG0 A;  5CKE A;  2VGN A;  2ZZD A;  1WJQ A;  3CCU A;  3VUZ A;  1C6V X;  5GAN d;  2DL3 A;  4BD3 A;  2BE7 D;  3OYN A;  1YJ9 Q;  1WNL A;  2M1H A;  2PU9 B;  2JMC A;  3E19 A;  4OB3 B;  1NJI C;  1O9S A;  3GNG A;  2OTJ T;  3LYI A;  2J6F A;  2O9V A;  3REA B;  5A0G A;  2DTH A;  1F1B B;  2F2V A;  4WCI A;  5KYX B;  2YUQ A;  3CCE T;  2PVG B;  2YHT A;  2QQA A;  2J06 A;  1ARK A;  2RQR A;  2VV5 A;  3OMG A;  2JTF A;  1NPR A;  4PLL A;  2D8J A;  1BCM A;  5CCA A;  2RI2 A;  1IRE B;  2QK0 A;  5IXB A;  4E7J A;  2QEX A;  1W2B A;  4X34 A;  4F04 B;  2L2P A;  1PM3 A;  5L8R E;  1YJN T;  2C0O A;  4M75 G;  1W2B P;  1WJR A;  4TVR A;  2IIM A;  4A4H A;  1MND A;  3H0F A;  3JCM V;  2RH2 A;  1OU9 A;  4IUT A;  1YFN A;  2KR3 A;  1NZ9 A;  4OB1 B;  1OX9 A;  1TG0 A;  4AG1 C;  2DM1 A;  2VAS A;  2FO0 A;  2MIO A;  1K9M R;  1WYX A;  1R77 A;  1Q95 G;  1PD1 A;  1VQ7 A;  2LZ6 B;  4C5G A;  3QO3 A;  3OA6 A;  4C8Q D;  1UHF A;  2RI3 A;  3EFR A;  4QQ6 A;  2CP3 A;  3TRE A;  4AG2 C;  3CCU Q;  1QWE A;  4DEX A;  1X6G A;  2J6O A;  2NUP A;  1YBY A;  2M0Y A;  5FLX E;  4F7U E;  3KFV A;  4RTT A;  3SD4 A;  5LJ5 f;  2CP5 A;  1KFZ A;  4J7I A;  1M9S A;  4QQD A;  1AD5 A;  1D0Z A;  3VU3 C;  2FB7 A;  3TSW A;  4RTW A;  3MCA B;  4ZN1 A;  2ZGW A;  4PJJ A;  4EPC A;  1LCK A;  1Y7X A;  1GFD A;  5CQY A;  4EMK C;  3CCQ T;  2L89 A;  2SRC A;  3URG A;  1YI2 Q;  2DLP A;  4C92 D;  3TQ7 P;  3RKY A;  1X69 A;  1NE8 A;  1Q7Y U;  1B7T A;  1PC0 A;  1KQ2 A;  5I11 A;  3JCM e;  1M90 U;  1K0X A;  2LC4 A;  1OZ2 A;  2MMP A;  1ZUK A;  2K7A A;  3G4S A;  1NPP A;  4J7F A;  2FL7 A;  1XJW B;  2D1X A;  3F70 A;  2QA4 T;  2YWW A;  8ATC B;  4JPB W;  4M75 C;  5LJ5 d;  2G6F X;  4EDU A;  1UFF A;  3QKJ A;  4XTW A;  1UUE A;  3TU4 K;  3GBQ A;  1XTD A;  1GRI A;  4LDU A;  2A28 A;  4M7A D;  1LOJ A;  3JCM W;  4AFS C;  2P0Q A;  1RAG B;  4OGE A;  1M1G A;  4DEY A;  1VQ6 T;  3QSU A;  2AKL A;  3UPU A;  4O5V A;  3HFN A;  5GAM j;  1W6X A;  3JCM P;  2AK5 A;  3E9G A;  1YCY A;  3GLX A;  2QAS A;  1WI7 A;  2DJQ A;  3CBO A;  1Q81 U;  1AZE A;  1WJS A;  1IO6 A;  2K5I A;  2E5K A;  3A8H B;  4NL3 A;  1GCQ A;  5L23 A;  2DER A;  1ZQ1 A;  1K8A C;  3PIO A;  4M78 E;  3PMI A;  2K57 A;  1RAE B;  4M7A B;  1PNJ A;  3FC3 A;  3CCJ T;  1I1J A;  2E41 A;  1ZX6 A;  4JS4 A;  1VQP A;  4II1 A;  3I5S A;  1Q82 C;  1VQ4 T;  1PRL C;  1QVG S;  2OI3 A;  1JJ2 A;  5AT1 B;  4FM4 B;  1M1F A;  3HHT B;  1BI3 A;  5GAO r;  3HTR A;  3QII A;  4BDZ A;  4J9F A;  4HKE A;  5HCK A;  1SRL A;  1G83 A;  4WTO B;  3LGF A;  3UA7 A;  1WX6 A;  1VQL A;  3CC7 T;  3OS1 A;  2DVJ A;  2MK5 A;  3EG2 A;  2KMT A;  1BB9 A;  2BZX A;  2XDP A;  4HVV A;  2E12 A;  4E7H A;  2IVW A;  3CCS A;  2HKQ B;  2JJ9 A;  1CKB A;  3CPW P;  5FU6 B;  2HDA A;  4M77 E;  2LTO A;  2A36 A;  2LCL A;  2V8K A;  1OYX A;  1EIF A;  3CPW A;  2P4R A;  2GGR A;  4P5N A;  1SF9 A;  5FU6 C;  3M0P A;  2NUT B;  3JCM c;  2XHC A;  2ROL A;  3N5B B;  1K73 R;  3LH5 A;  4J9I A;  2X3X D;  3G71 T;  3CCL Q;  5KYW A;  3QYG B;  4GY5 A;  1JEG A;  5CKD A;  1AWJ A;  2V1Q A;  2YUP A;  1FXX A;  4OML A;  5LJ3 e;  1GXI E;  4AT1 B;  2CZ6 B;  5AYF A;  3CD6 Q;  4A54 A;  1VYT A;  1WLP B;  3ER0 A;  2GNC A;  4PLI A;  1M2V B;  3P8D A;  2CT4 A;  2GTO A;  4IUP A;  1YP5 A;  2EKH A;  2I2L A;  1IHW A;  1I81 A;  2H3E B;  2L3P A;  3G4S T;  4C0D B;  2CRE A;  3ME9 A;  1FWZ A;  3M56 A;  4E7S A;  1RI9 A;  3OYH A;  3CCR T;  1U1S A;  3C94 A;  1PKS A;  3CCU T;  2CYZ B;  4M75 B;  1MV3 A;  3JCM J;  3OQ5 A;  1T0H A;  3FB9 A;  3CXC A;  2PVO B;  1NJI R;  1YIT Q;  2KVQ G;  2VGM A;  4M75 D;  2CP7 A;  2DL8 A;  4J5Y A;  2FG0 A;  3DB4 A;  2K3B A;  2LCC A;  4DOW A;  4V2S A;  4ELZ C;  1K8A R;  2DD4 A;  1KK7 A;  3J81 E;  3CME A;  4E47 A;  2P0P A;  1ZSZ B;  1V1C A;  1W1F A;  3VKI A;  1R0C B;  1HJD A;  5J39 A;  3QZ9 B;  2DZC A;  2EFI A;  3REB B;  3PIP A;  3VS3 A;  1Q82 U;  1ZLM A;  3S3N A;  1BIB A;  4M75 A;  3JB9 D;  4C92 A;  3GP8 A;  1H3Z A;  1X2Q A;  4C5I A;  3EFS A;  3WXM B;  3VS4 A;  3JRZ A;  4FT2 A;  3UDC A;  4FL6 A;  4JJC A;  4PJO G;  3G6E T;  1VQM Q;  1YIT T;  2L3Q A;  3RMQ A;  1BU1 A;  4M77 D;  2ZPF B;  3CC2 T;  2JMA A;  3L42 A;  4M77 C;  1UEC A;  1M1K U;  1NBE B;  1QLY A;  2ED0 A;  1G3T A;  4RKU E;  1QKX A;  1KD1 U;  2YLB A;  2A37 A;  3EHR A;  4MZP A;  4RG2 A;  1KQS S;  1QKW A;  5LL6 S;  3CCM Q;  4JRQ A;  2KT8 A;  1AWO A;  3EG1 A;  2GFU A;  1N8R U;  1X01 A;  2LNV A;  1RLQ C;  1MHN A;  1OU8 A;  5A0L A;  5I2M A;  1WQ7 A;  4Y28 E;  2ZPI B;  3R6N A;  3J7A F;  2XG8 D;  4M7D D;  5IHI A;  2DMO A;  4M78 B;  2E65 A;  2HMA A;  4FSS A;  4HA8 A;  2FPF A;  3SWN A;  4DBH A;  4JJN K;  2DBM A;  2L0A A;  2BKD N;  3QXE B;  4OMM A;  3X26 B;  2LX7 A;  3M53 A;  1I5L A;  3QZ5 B;  3EG9 A;  4YTL A;  3FIF A;  3CME T;  3QPH A;  3CMA T;  4J6Y A;  2LQK A;  1YN8 A;  2RF0 A;  3CBM A;  3ZEH A;  4XU0 A;  3CCR Q;  3S3O A;  2RA2 A;  3M59 A;  4C5H A;  3KBG A;  2RQV A;  4N0A A;  5CKF A;  2HL5 C;  3UF4 A;  4M7D F;  4M78 G;  2V26 A;  3M4G A;  3MEA A;  3TVT A;  4OMQ A;  4Q5W A;  2DVE A;  2XIC A;  1WFW A;  1QCF A;  2F69 A;  3JB9 H;  4JLG A;  3CCR A;  2V8I A;  4J9H A;  4PJO C;  4ZTJ A;  3I56 T;  2FRW A;  1ZSZ C;  3CC2 A;  3MKD A;  1CSK A;  2K5F A;  1VQN A;  1X43 A;  2XK0 A;  2DIQ A;  1QVF P;  3NPF A;  5HK3 A;  4JS5 A;  2CP0 A;  1M30 A;  1C0M A;  2LJ3 A;  5KYW B;  4IIM A;  4KH1 B;  5IHK A;  3O8V A;  3OBW A;  2RHZ A;  3I56 Q;  3C12 A;  3V7S A;  1QW1 A;  5D6X A;  1Y96 A;  1M1K C;  3CC4 A;  3TSZ A;  2E6N A;  4IIO A;  3G71 A;  5GAO n;  1RI0 A;  2B86 A;  2YLC A;  3OBY A;  3CCM T;  4LUE A;  2L5Q A;  1MMA A;  5GAN 7;  1G5V A;  4LNP A;  3VRY A;  5C0M A;  2RK2 A;  4OP0 A;  2X4Y A;  2OTJ A;  2CP2 A;  2LNH B;  5GAN 5;  4L5G A;  2QTV A;  1PSF A;  2HD0 A;  2OAU A;  3M0Q A;  3CCV Q;  2EW3 A;  1QVF S;  4DBR A;  3MHX A;  4CRI A;  3LLR A;  4M4Z A;  2BZY A;  1VQ9 Q;  1YNZ A;  4M77 B;  3OYB A;  2RHY A;  1VQP Q;  3M0R A;  2X9H A;  2GQV A;  1I5O B;  1Z9Z A;  3CC7 A;  4J9E A;  5M9O A;  2EVR A;  4EMK B;  1VA7 A;  2DTO A;  4XAX B;  2YXY A;  1UE9 A;  5DLQ E;  1VQ9 A;  1QMC A;  4IUQ A;  2EKO A;  3TCJ A;  3NMZ C;  4M7A E;  3PT9 A;  1GCQ C;  5GAN e;  3EH2 A;  5FRN A;  2DRK A;  4J9C A;  2L8D A;  1X6B A;  2OTL A;  2C0I A;  1W4S A;  3CC2 Q;  4CI0 C;  1M4Z A;  4XTX A;  4A4K A;  2PNI A;  4OMN A;  1N27 A;  1IRX A;  4XQ3 A;  1KQ1 A;  2JM8 A;  2VVK A;  2DIL A;  3CQT A;  1Y07 A;  2EYX A;  3OYK A;  4M7D G;  3I5R A;  5CVI A;  1WHK A;  3H9N A;  1Q81 R;  3CC4 Q;  4M77 F;  3JB9 G;  3CCE Q;  4FIB A;  2DA9 A;  3G6E Q;  1K9M C;  1NJI U;  2LVM A;  2YUN A;  2EYY A;  5CO7 A;  2PZ1 A;  3OS0 A;  3EGD A;  2AHJ B;  4C92 E;  3QWY A;  4J9B A;  4M75 E;  2HSE B;  2LJ0 A;  3FEO A;  3VS5 A;  4X9D A;  2KYB A;  1Y71 A;  3FJP A;  2DJZ A;  3OSS C;  4OVA A;  4OMO A;  4R0K A;  3X28 B;  2FRY A;  3JAM E;  3I55 Q;  3HPW A;  3I9Q A;  2EIF A;  3SWN C;  2AT1 B;  2DK3 A;  2ED1 A;  1SHF A;  2XMF A;  3V8J A;  4F14 A;  4F7U B;  4ANJ A;  2E3H A;  1E6G A;  3SB2 A;  4C8Q C;  5GMK h;  2LT1 A;  1QVP A;  1YWO A;  2D6F A;  3ASK A;  1WDX A;  4LE9 A;  3OW2 A;  1OZ3 A;  1KIK A;  1OEB A;  2DF6 A;  2M9U A;  3H41 A;  4Z89 A;  1M2V A;  1PKT A;  2GFA A;  3WVE B;  1N5Z A;  3CPW S;  2ZPB B;  3D7S B;  3PE0 A;  3MPU B;  2C0T A;  3BFM A;  4PKC C;  4DOV A;  2DZ9 A;  2LMJ A;  4C92 F;  5GMK l;  1NYG A;  4JDS A;  2COY A;  1HD3 A;  1VUB A;  2EYZ A;  4C92 B;  1JXM A;  4JUV A;  3NFC A;  1J3T A;  2P0K A;  2RB6 A;  4PFP A;  4M7A A;  2PTK A;  3PVQ A;  3INZ A;  3MP8 A;  4M7D C;  2RNA A;  2LQN A;  1SSH A;  2D0N A;  3DB3 A;  3M0S A;  3BDU A;  2K9G A;  3CPF A;  4E2F B;  1GL5 A;  4RTX A;  4QVD A;  3BY7 A;  1N6A A;  2E4H A;  1BIA A;  3A8O B;  3M4Y A;  4B6M A;  1YCS B;  2EQJ A;  4J9G A;  1I0C A;  2JNG A;  1PG5 B;  5LJ5 j;  1RL2 A;  1K76 A;  1TUD A;  1UTI A;  3L2R A;  4KUL A;  2KBT A;  2QGF B;  4OB2 B;  5FWB A;  3EH1 A;  1YJN A;  2EQM A;  3CBP A;  5GMK m;  4C0Z A;  3I56 A;  5CK9 A;  4EMK A;  4EIK A;  5I22 A;  3TEE A;  2ZPG B;  3T9N A;  4E6R A;  5HY6 A;  2O88 A;  4HCC A;  3L2U A;  2KXD A;  5KCO A;  3OYI A;  4LDV A;  4PJO D;  1G2B A;  4OGC A;  4RG8 A;  5GAN 4;  2ENM A;  1WIE A;  4OB0 B;  1UDL A;  2MF2 A;  2VKN A;  1FMK A;  3PFS A;  5C6S A;  8AT1 B;  1H64 1;  2CSI A;  4LXC A;  2JN0 A;  4K11 A;  2RN8 A;  1RAC B;  2GTJ A;  2RMO A;  4J6X A;  1MNE A;  2O4X B;  2DTI A;  5GAM h;  5GAO p;  4BE1 A;  4LDW A;  2QTX A;  5GAN h;  3LWI A;  2FVU A;  3JCM h;  5I21 A;  1KHI A;  1YJW T;  2CT3 A;  1HYO A;  2CZ7 B;  4R55 A;  4AMC A;  9ATC B;  1KC8 C;  4M7A G;  4IUV A;  2GF7 A;  5GAM f;  3QDR B;  1V29 B;  3RKW A;  3EGD B;  1EZZ B;  2MI6 A;  5FWC A;  3WVD B;  3UAT A;  2RHI A;  3EFO B;  3A98 A;  4D8K A;  3M0U A;  1M3B A;  5LJ5 e;  2QEX Q;  1VOM A;  5GAN 6;  1OV3 A;  3VS7 A;  1FMW A;  2W10 A;  3EHQ A;  1VQK Q;  1OPK A;  2R5M A;  2RJF A;  3H0I A;  2HQE A;  4M75 F;  2EGA A;  4N0A C;  4ZNX A;  2RHX A;  4DA4 A;  2AZV A;  2LRQ A;  2DBK A;  2EGC A;  1FX7 A;  1AWW A;  4QVC A;  1M2O A;  2KE9 A;  2O31 A;  3G6E A;  3CCQ Q;  3SHW A;  5CAI A;  1YHQ T;  1WXU A;  4XTZ A;  4F17 A;  1H8K A;  2LX9 A;  1N9R A;  3ZFJ A;  1ZSZ A;  4C0D C;  3E9F A;  5CR2 A;  2RQU A;  4XU1 A;  2KRO A;  4BI4 A;  4BAC A;  4OMF B;  4Z02 A;  1VIF A;  3A8L B;  3OSV A;  2SEM A;  3HP9 A;  5GMK j;  2OAW A;  4F7U G;  1BBZ A;  4CC2 A;  1JXO A;  1VQO A;  4M78 F;  3L2Q A;  1X6O A;  5GAN 3;  2J6K A;  2OTJ Q;  4EMG A;  4MMK A;  2CSQ A;  5LJ3 h;  5CKB A;  2AZS A;  2KXC A;  1SKU B;  1VQO T;  3PGG A;  4OF1 A;  4KRT A;  3CCJ A;  1N8R R;  4M7A C;  5DM7 R;  2K2M A;  2K3Y A;  4A4E A;  4FSX A;  2YSQ A;  1D0Y A;  1VQL Q;  1YJW A;  1D1A A;  3UT1 A;  4RTY A;  3E2U A;  2VYT A;  1GCP A;  3MO8 A;  2ZAE A;  2O2O A;  3MEW A;  5KYY B;  1UB4 A;  1WZO A;  3OS5 A;  1YHQ A;  1OI1 A;  1TUC A;  3OYG A;  1VQP T;  3CCV T;  1UEB A;  2FZK B;  2DIG A;  1VQ7 T;  2R58 A;  5J3B A;  2FPE A;  2QYZ A;  2HZY A;  1UGQ B;  2K5L A;  5KYX A;  2OTL Q;  4A4F A;  4F16 A;  5LJ5 h;  4NS5 A;  5KYU B;  3KUF A;  2BUD A;  5EG2 A;  4F7U F;  2W0Z A;  2CZ1 B;  2QI2 A;  5D6W A;  3VYH B;  3NTI A;  1WQW A;  2IG0 A;  1G3Y A;  1NLO C;  1XOV A;  4Y92 A;  2DPP B;  3SFM A;  5GMK i;  1Y96 B;  5LJ3 d;  4FU6 A;  3RES A;  1G8X A;  2E1H A;  2FEI A;  1YHQ Q;  1ZSG A;  2FPD A;  4HCK A;  4QVZ A;  4DQ2 A;  4NOY A;  1UG1 A;  3HKS A;  5GAN 2;  5KYY A;  3CCE A;  3CCV A;  1TSF A;  4M7D B;  2CDT A;  2H3J A;  1QCO A;  3DKM A;  4XTY A;  2D9T A;  1SG5 A;  2MWP A;  2OX7 A;  4JJB A;  4JJD A;  4LD9 K;  2HKN A;  4M77 A;  4HXJ A;  2R57 A;  2B8A A;  2QXF A;  3M54 A;  3L2V A;  1D0X A;  3QJY A;  1E7O A;  2XID A;  3M57 A;  2A7Y A;  2EQU A;  2HSP A;  1QQJ A;  4BB7 A;  4D8D A;  3PVL A;  4RTZ A;  2QDY B;  1PHT A;  3J80 E;  1AZG B;  4L6V 5;  3JB9 J;  3MP1 A;  5GAM d;  3OYD A;  3GF5 A;  2KSS A;  4ZGD B;  1OUL A;  3RUX A;  5KE2 A;  1KD1 C;  1RAA B;  4AFU C;  4KGZ B;  1BI2 A;  3G1J A;  3DLM A;  3NTK A;  1O75 A;  1ABQ A;  3HFO A;  1ZA2 B;  2KNB B;  2QEX T;  4Z88 A;  3EG9 B;  4M78 A;  3P8B B;  2K4Y A;  4FW1 A;  4N4I A;  1NEG A;  3H0H A;  2RJD A;  3MET A;  2EYW A;  2PQW A;  3M0T A;  5IH2 A;  2G3R A;  1JU5 C;  2YUO A;  2E64 A;  1IB8 A;  2QG9 B;  2EYQ A;  1U06 A;  1K73 C;  2DX1 A;  2A0F B;  1D1C A;  1HXD A;  1I07 A;  1Q86 U;  2DL7 A;  4X9C A;  3CMA Q;  2L3S A;  1BI0 A;  1KSW A;  3CCQ A;  2WSE E;  1KG1 A;  3CEY A;  2D8H A;  1UJ0 A;  1R0B G;  1BYM A;  1KC8 R;  2QDL A;  2VWF A;  3EAE A;  1DJ7 B;  3FRN A;  3L2W A;  5GJV B;  3LX7 A;  5GAO q;  1N8R C;  4DBQ A;  4HVU A;  1YJ9 T;  2X4J A;  1H92 A;  4BDY A;  2DXC A;  5HK0 A;  2IPO B;  3V7C A;  3O5Z A;  3JV3 A;  2F5K A;  1QCN A;  2DET A;  1OQK A;  1WHM A;  1WHH A;  3M55 A;  4AFZ C;  2MPX C;  3GNF B;  6AT1 B;  1MGQ A;  1ZA1 B;  2HNI A;  2XDD A;  3BDL A;  3VRZ A;  1WHL A;  4LD6 A;  4UC4 A;  1TS9 A;  3PTA A;  1AOJ A;  3S3M A;  3ZBD A;  1K8A U;  1TUG B;  2GQI A;  2KY9 A;  4FYW B;  5FW9 A;  1GFC A;  1WXT A;  2CKK A;  1MMD A;  2LT4 A;  4ZGE B;  2LQ8 A;  2LDM A;  4F7U A;  5GAM g;  1NG2 A;  4ZGJ B;  1P92 A;  4RCC A;  2DXU A;  1M90 R;  2FYK A;  1TWB A;  4KGX B;  3GIB A;  2K6D A;  5FU7 B;  5GAN f;  4VUB A;  5DY9 A;  2WSF E;  5GAO l;  3SWN B;  1TXQ A;  2MOX A;  2K79 A;  4RTV A;  2FZG B;  3RDV A;  2EJG A;  1SRM A;  5KYU A;  3IQL A;  3CCM A;  1JJ2 P;  2KDS A;  1ZBX A;  3G71 Q;  3CCL T;  3I55 T;  3VS2 A;  1RAF B;  2RO0 A;  1T3S A;  5GJW B;  5KH6 A;  2BIV A;  2CZ0 B;  1UGR B;  5FRO A;  3NHN A;  2RK1 A;  2EAY A;  1D1B A;  1XNI A;  2JUF A;  1N9S A;  3CCS T;  2DRM A;  3R6O A;  1CKA A;  2O9S A;  1VQK A;  1OPL A;  3OYE A;  2JOY A;  1NLP C;  4ZN3 A;  1RAD B;  3ZL7 C;  4FT4 A;  3S6W A;  1S72 A;  1KQS A;  4PFZ A;  1SPK A;  4ME7 A;  1IZ6 A;  2EPD A;  2F1L A;  1YWP A;  3JCM d;  4BI8 B;  4JZ4 A;  1K9M U;  4EMH A;  3DLL A;  1KQS P;  2Y4Y A;  1RAI B;  2YDL A;  1VQ4 A;  4HT8 A;  1TTH B;  3C95 A;  3CD6 T;  1D3B A;  1UHC A;  1C1A A;  1AWX A;  2J05 A;  1AHJ B;  1Y57 A;  4J9D A;  1NM7 A;  1JRI A;  2E5Q A;  3QJ6 A;  2NLU A;  3HL8 A;  4D6W A;  4CC7 A;  3X25 B;  3MEV A;  4M7A F;  3Q1J A;  5D7U A;  1VQ4 Q;  3OYC A;  3OYA A;  2JS0 A;  3OYM A;  4M78 C;  4A53 A;  4A4G A;  2O4X A;  1T3L A;  1LVK A;  3HRS A;  3OY9 A;  2ZPE B;  5LJ3 f;  1VQ5 A;  1VQ8 Q;  5GAO m;  2RM4 A;  1UJY A;  1D3B B;  2E3I A;  2JW4 A;  4HCB A;  4IUR A;  2NUZ A;  4ESR A;  4BY6 C;  4N4H A;  2I0N A;  4QQG A;  3RR6 A;  2RJC A;  3OW2 S;  4XTV A;  1KHC A;  2RQW A;  2EJ9 A;  5EC7 A;  3EGX A;  2LP5 A;  2X51 A;  4LDY A;  2PUO B;  2MAM A;  4QW2 A;  2CH4 W;  3CCS Q;  2FHD A;  1Q7Y R;  4MZT A;  3QUI A;  3MEU A;  1LNX A;  3BE3 A;  2QQB A;  1JJ2 S;  2VXE A;  2LJ1 A;  2M16 A;  2HL3 A;  4IUU A;  4QKU A;  2LQW A;  1VQ5 Q;  3OYF A;  1VQ8 A;  3LH0 A;  4IKF A;  1EX4 A;  2JVV A;  2MCN A;  4C8Q B;  3JCM g;  1M90 C;  3C4S A;  5IHN A;  3CMA A;  2NUT A;  1Z9Q A;  4C8Q F;  3G7Z A;  4CC4 B;  1QVG A;  4HVW A;  2XU8 A;  4JRI A;  3ULR B;  3JCM f;  3QHS A;  3VUB A;  4R56 A;  4PJM A;  4C0F A;  2DYI A;  4KBM B;  3CXC S;  3RIR A;  4FCY A;  1AEY A;  4LN2 A;  4GLM A;  1M5Q 1;  4ELY C;  2WSC E;  4E7I A;  4C0G A;  4KT0 E;  4KGV B;  1KJW A;  5FRM A;  1K0S A;  1ZUU A;  3X24 B;  3CME Q;  4KUD K;  3FDR A;  3X20 B;  1ZHI A;  4B9W A;  4C92 C;  2QAZ A;  1VQM A;  2CS7 A;  3VS1 A;  4PL6 A;  2ZPH B;  4PJO E;  2HBP A;  4C8Q E;  4M77 G;  1TH7 A;  2KRS A;  2KK4 A;  5KCH A;  4XU3 A;  2HBW A;  2X4W A;  1EFN A;  1K4U S;  1JQQ A;  1M27 C;  1M8M A;  1VQ5 T;  1MMN A;  1YJN Q;  3QWX X;  3FJ5 A;  2RQT A;  3THK A;  4RTU A;  4ZTF A;  1RAH B;  2EQK A;  1YIJ A;  3QDF A;  4HCZ A;  4PJL A;  5CKH A;  2F2W A;  1B34 A;  5I2S A;  2YRD A;  1GBQ A;  1D09 B;  4E7L A;  2L3R A;  3I35 A;  2AKK A;  4O6J A;  5FU7 C;  5IXF A;  5HKC A;  2OTL T;  3V7R A;  3JCM b;  1WXB A;  2GBQ A;  2RJE A;  2P4T A;  1VQ7 Q;  3P8H A;  2ABL A;  2QQS A;  2DE0 X;  2D0Q B;  3EFO A;  4LDX A;  2O01 E;  2NUP B;  2KEA A;  4MDW A;  2KYM A;  3OYY A;  2CUB A;  2X4X A;  5CIU A;  2DNU A;  4BY6 B;  2XDB A;  3RMS A;  2JS2 A;  3EGU A;  2ATC B;  1NYF A;  2ECZ A;  3RER A;  2V1R A;  3M5A A;  4JRK A;  2Y90 A;  1VQL T;  4FYY B;  1QP2 A;  2KQW A;  1B34 B;  3C0C A;  4DBF A;  1MV0 B;  2Y4X A;  2XKO C;  3AT1 B;  1YI2 T;  1MUZ A;  5DLO A;  1I4K 1;  2F5T X;  2MYS A;  4OMP A;  2OJ2 A;  1VQ9 T;  4M7D A;  2BTT A;  3RBB B;  4ORZ A;  3SEM A;  3L2Z A;  4C92 G;  1PCX A;  2PUK B;  5GMK e;  1VYU A;  3A8M B;  1FYN A;  3JSC A;  2P84 A;  2PVD B;  2KT1 A;  3A5Z B;  3LWH A;  1VQ8 T;  1WPY A;  1E6H A;  4XTU A;  2KRM A;  2VC8 A;  1WA7 A;  2QA4 Q;  5LJ3 g;  5GAM e;  1T0J A;  1Q86 C;  1RAB B;  1VQN T;  1JO8 A;  2BZ8 A;  2J7I A;  1QP3 A;  3VJP A;  1Q7Y C;  2VB6 A;  3V8K A;  2DAQ A;  1VIE A;  3VYG A;  2ROT A;  1RLP C;  1K1Z A;  1UGV A;  1M8V A;  2GCX A;  1U3O A;  4QT7 A;  5KE3 A;  1LPL A;  2DXB A;  1ZUY A;  3RKX A;  3OYJ A;  1LJO A;  2V8J A;  4KH0 B;  2JTM A;  2QA4 A;  1S1N A;  1WHG A;  4RUG A;  3HRT A;  2KGT A;  4GBQ A;  1PRM C;  5CQX A;  2RD1 A;  4XU2 A;  4M78 D;  3KXT A;  2MWO A;  5IN1 A;  2RPN A;  4HT9 A;  2HEQ A;  3VS6 A;  4JRP A;  1S72 Q;  1SSF A;  2CUD A;  5IT9 E;  2NYS A;  1YI2 A;  2AIR B;  4PFO A;  2DEQ A;  1MMG A;  2JM9 A;  2DL4 A;  4AFQ C;  4BE0 A;  2A08 A;  5GAN g;  3G4S Q;  3OS2 A;  3M9Q A;  3H8Z A;  1SEM A;  3FLG A;  5J26 A;  4M7D E;  3AHU A;  3CC7 Q;  4RCB A;  4J83 A;  1ABO A;  4E7K A;  3QYH B;  2RI5 A;  4GLK A;  2VXF A;  4L59 A;  2R5A A;  1QVG P;  1UGS B;  1W70 A;  3VS0 A;  4A63 B;  1VQ6 A;  2VUB A;  2Z0W A;  3OYL A;  2NWM A;  5LJ5 g;  3BW1 A;  2DFU A;  1VQK T;  3QG1 A;  1GBR A;  1YIJ T;  1UGP B;  3A1P A;  2DYB A;  3NGP A;  3JB9 F;  4XK8 E;  5A0D A;  1BKB A;  5IAY A;  3CC4 T;  1VQN Q;  1Y0M A;  1PD0 A;  2EBP A;  2BE9 B;  3CXC P;  4J8O A;  4N4G A;  2YT6 A;  2JZ2 A;  2COZ A;  4E7Z A;  2CGH A;  4PNO A;  3U23 A;  1I8F A;  2DKG A;  2E10 A;  2M02 A;  2M51 A;  1KC8 U;  2F2X A;  3JCM Q;  1G3S A;  1XQH A;  3V8L A;  1H3H A;  1KD1 R;  2DO3 A;  1U8R A;  1AT1 B;  1VQM T;  1PWT A;  3EGX B;  5ECA A;  4WF2 A;  1M1K R;  1ZBJ A;  1VQ6 Q;  5A2Q E;  1SHG A;  2X3W D;  4C8Q G;  1B3Q A;  1YJW Q;  2ESW A;  1Q86 R;  1FMV A;  1WHJ A;  2QGG A;  4MML A;  3LGL A;  5D6Y A;  5GAN j;  1VYV A;  1IHV A;  4FYX B;  3QBY A;  2C06 A;  2EJF A;  3CCJ Q;  4C8Q A;  4PJO A;  3CD6 A;  1M3C A;  4PJO F;  2E6Z A;  1AVZ C;  4BI3 A;  2HCK A;  3OW2 P;  1VQO Q;  1Q82 R;  1X27 A;  4FW2 A;  3OMC A;  4J6W A;  4C5E A;  4NL2 A;  2HAX A;  1IGU A;  2YRV A;  4JLI A;  4Z8A A;  2CP6 A;  2CH4 A;  4ATO A;  1QVF A;  2YRC A;  1TOV A;  2DD5 A;  3A8G B;  4CC3 A;  2EQI A;  1IXD A;  2KAF A;  1QWF A;  2DEU A;  4RMO A;  2LCS A;  2DL5 A;  3JB9 I;  3HRU A;  1G3W A;  1JBM A;  2JXB A;  1W2B S;  1HSQ A;  2X35 A;  5KYN A;  3PMT A;  2XI9 A;  3GOX A;  3MP6 A;  5GAN 8;  3CCL A;  2QQ9 A;  1IGQ A;  1S72 T;  1X75 C;  4LUD A;  3M58 A;  3UWN A;  1OX8 A;  4PJO B;  3LW5 E;  2JTE A;  4JZ3 A;  4MDX A;  3MJX A;  1M3A A;  1TU0 B;  2K2V A;  2WAC A;  2COW A;  3UA6 A;  4Y91 A;  1Q81 C;  2M0O A;  1ACM B;  1YIT A;  4PJN A;  2XD0 A;  2K3X A;  3SDZ A;  3OB9 A;  1K9A A;  1X2K A;  1U5S A;  1R8O B;  3I55 A;  1K73 U;  4BE2 A; 
#chains in the Genus database with same CATH homology
 3E9F A;  2DXT A;  5LJ3 j;  2QQB A;  5CR2 A;  2GFU A;  1JJ2 S;  2VXE A;  1N8R U;  1X01 A;  2LNV A;  2M16 A;  4XU1 A;  3NTH A;  4IUU A;  4BUG A;  3HSB A;  4BI4 A;  1VQ8 A;  3OYF A;  3VV0 A;  4BAC A;  3LH0 A;  4IKF A;  1MHN A;  4OMF B;  2ZCF B;  4Z02 A;  5A0L A;  5I2M A;  1WQ7 A;  1VIF A;  2JVV A;  3H6Z A;  2ZPI B;  4Y28 E;  3A8L B;  3OSV A;  3J7A F;  1BI1 A;  2HQX A;  2XG8 D;  4C8Q B;  4M7D D;  3JCM g;  2E70 A;  4MZM A;  3HP9 A;  2E65 A;  4M78 B;  1M90 C;  4HA8 A;  5GMK j;  3C4S A;  3CMA A;  3SWN A;  1PSE A;  2QQR A;  4F7U G;  1WGS A;  4C8Q F;  3G7Z A;  4JJN K;  4KUI A;  1HK9 A;  4M78 F;  3E1S A;  1VQO A;  3L2Q A;  1QVG A;  1X6O A;  2RHU A;  2BKD N;  2XU8 A;  3QXE B;  5GAN 3;  1YJ9 A;  2EWN A;  4JRI A;  4MMK A;  5LJ3 h;  3X26 B;  4B9X A;  4EMG A;  5CKB A;  3JCM f;  3M53 A;  1JB0 E;  3QHS A;  3VUB A;  1I5L A;  3QZ5 B;  4R56 A;  4YTL A;  1VQO T;  3PGG A;  4OF1 A;  3CCJ A;  3FIF A;  3PNW C;  3CME T;  4C0F A;  1U1T A;  4M7A C;  3QPH A;  3CMA T;  4J6Y A;  2LQK A;  4KBM B;  3JCM X;  2A3L A;  3CXC S;  3GPL A;  3L1A A;  3RIR A;  5DM7 R;  3CBM A;  3ZEH A;  2K3Y A;  4XU0 A;  5CKE A;  4A4E A;  2VGN A;  2ZZD A;  1WJQ A;  4FSX A;  3CCU A;  3VUZ A;  3S3O A;  1YJW A;  2RA2 A;  3M59 A;  5GAN d;  3UT1 A;  1M5Q 1;  4C5H A;  3KBG A;  4BD3 A;  4ELY C;  3OYN A;  2WSC E;  2VYT A;  4N0A A;  3MO8 A;  5CKF A;  1WNL A;  2M1H A;  2PU9 B;  4M78 G;  4E7I A;  4C0G A;  3MEW A;  4KT0 E;  4M7D F;  3M4G A;  3MEA A;  3E19 A;  4OB3 B;  4Q5W A;  1NJI C;  2DVE A;  1O9S A;  3GNG A;  5FRM A;  1UB4 A;  2XIC A;  2OTJ T;  3OS5 A;  2F69 A;  3JB9 H;  4JLG A;  3LYI A;  3X24 B;  1YHQ A;  1OI1 A;  3CCR A;  2V8I A;  3OYG A;  4KUD K;  5A0G A;  2DTH A;  4PJO C;  3FDR A;  4ZTJ A;  1VQP T;  3X20 B;  1ZHI A;  3CCV T;  3CCE T;  3I56 T;  2PVG B;  1UEB A;  2QQA A;  2YHT A;  2DIG A;  1VQ7 T;  2VV5 A;  2R58 A;  5J3B A;  3OMG A;  4B9W A;  4C92 C;  2JTF A;  3CC2 A;  1NPR A;  1VQM A;  4PLL A;  1UGQ B;  2K5L A;  5M9O A;  2CS7 A;  4A4F A;  5CCA A;  2RI2 A;  1IRE B;  2K5F A;  2XK0 A;  5LJ5 h;  1VQN A;  4NS5 A;  4PL6 A;  2ZPH B;  4PJO E;  2HBP A;  2BUD A;  2DIQ A;  3KUF A;  4C8Q E;  4E7J A;  4M77 G;  2QEX A;  4JS5 A;  5HK3 A;  5EG2 A;  1W2B A;  1TH7 A;  4F7U F;  2KK4 A;  3O8V A;  3OBW A;  4X34 A;  2RHZ A;  4XU3 A;  2CZ1 B;  5KCH A;  2X4W A;  2QI2 A;  3C12 A;  5D6W A;  1QW1 A;  3V7S A;  5D6X A;  3VYH B;  3NTI A;  1VQ5 T;  1Y96 A;  1M1K C;  3CC4 A;  1WQW A;  5L8R E;  1YJN T;  2E6N A;  2IG0 A;  4M75 G;  3G71 A;  5GAO n;  1G3Y A;  1RI0 A;  2YLC A;  1WJR A;  4ZTF A;  3OBY A;  4TVR A;  3CCM T;  1XOV A;  2EQK A;  4A4H A;  1YIJ A;  2DPP B;  4HCZ A;  3JCM V;  5CKH A;  3SFM A;  5GMK i;  1B34 A;  2L5Q A;  5I2S A;  1Y96 B;  2RH2 A;  5LJ3 d;  4FU6 A;  3RES A;  5GAN 7;  1G5V A;  4IUT A;  2E1H A;  5C0M A;  4E7L A;  2RK2 A;  1NZ9 A;  2L3R A;  4OB1 B;  4O6J A;  5FU7 C;  2OTL T;  5HKC A;  4OP0 A;  2X4Y A;  3V7R A;  2OTJ A;  3JCM b;  4QVZ A;  2RJE A;  4DQ2 A;  4NOY A;  2P4T A;  5GAN 5;  4L5G A;  3HKS A;  1PSF A;  5GAN 2;  2HD0 A;  3P8H A;  2OAU A;  2QQS A;  1QVF S;  1VQ7 A;  3MHX A;  4CRI A;  3CCE A;  3LLR A;  3CCV A;  4C5G A;  2D0Q B;  3QO3 A;  4LDX A;  2O01 E;  3OA6 A;  4M77 B;  4C8Q D;  3OYB A;  4M7D B;  2RI3 A;  3EFR A;  4QQ6 A;  4MDW A;  2H3J A;  2RHY A;  3TRE A;  3OYY A;  3DKM A;  4XTY A;  2D9T A;  2X4X A;  5CIU A;  4BY6 B;  2XDB A;  2MWP A;  3RMS A;  2GQV A;  4LD9 K;  4M77 A;  1YBY A;  3RER A;  3CC7 A;  3M5A A;  2R57 A;  2B8A A;  4JRK A;  5FLX E;  2Y90 A;  4EMK B;  3SD4 A;  2QXF A;  1QP2 A;  4F7U E;  5LJ5 f;  2KQW A;  1VQL T;  3M54 A;  3L2V A;  1B34 B;  3QJY A;  2DTO A;  4XAX B;  4J7I A;  1M9S A;  2XID A;  5DLQ E;  1VQ9 A;  3M57 A;  4QQD A;  2A7Y A;  2EQU A;  2EKO A;  2Y4X A;  4IUQ A;  3TCJ A;  4M7A E;  3VU3 C;  2FB7 A;  2XKO C;  3PT9 A;  1YI2 T;  5DLO A;  3MCA B;  4BB7 A;  5GAN e;  1I4K 1;  4ZN1 A;  2ZGW A;  2F5T X;  5FRN A;  2L8D A;  2QDY B;  1VQ9 T;  2OTL A;  4M7D A;  1W4S A;  4EPC A;  3J80 E;  4CI0 C;  1Y7X A;  1M4Z A;  5CQY A;  4EMK C;  4XTX A;  4L6V 5;  4A4K A;  3CCQ T;  3JB9 J;  3MP1 A;  3L2Z A;  5GAM d;  2L89 A;  4C92 G;  3OYD A;  2PUK B;  5GMK e;  1N27 A;  3URG A;  3A8M B;  1KQ1 A;  4XQ3 A;  4C92 D;  3GF5 A;  2KSS A;  4ZGD B;  3JSC A;  3RKY A;  2PVD B;  1Y07 A;  3RUX A;  5KE2 A;  3OYK A;  1NE8 A;  1Q7Y U;  1KD1 C;  1BI2 A;  1KQ2 A;  5CVI A;  4M7D G;  3A5Z B;  3DLM A;  3NTK A;  3JCM e;  3LWH A;  1VQ8 T;  1O75 A;  1WPY A;  1M90 U;  2LC4 A;  4M77 F;  1OZ2 A;  2MMP A;  4XTU A;  3JB9 G;  4FIB A;  3G4S A;  1K9M C;  3HFO A;  2VC8 A;  1NJI U;  2LVM A;  1NPP A;  2QEX T;  4J7F A;  2FL7 A;  5LJ3 g;  4M78 A;  3P8B B;  3F70 A;  2K4Y A;  5GAM e;  2QA4 T;  1Q86 C;  5CO7 A;  4M75 C;  1VQN T;  5LJ5 d;  3OS0 A;  4EDU A;  2AHJ B;  4N4I A;  1QP3 A;  3QKJ A;  4XTW A;  3VJP A;  2RJD A;  4C92 E;  4M75 E;  3TU4 K;  3MET A;  1Q7Y C;  3V8K A;  2PQW A;  2DAQ A;  1VIE A;  3FEO A;  1XTD A;  3VYG A;  4LDU A;  2G3R A;  4X9D A;  4M7A D;  1M8V A;  1LOJ A;  2GCX A;  1Y71 A;  3JCM W;  2E64 A;  2DJZ A;  2P0Q A;  3FJP A;  3OSS C;  4OVA A;  4OGE A;  3X28 B;  1M1G A;  5KE3 A;  2EYQ A;  2DXB A;  3RKX A;  1VQ6 T;  3OYJ A;  3JAM E;  3QSU A;  1LJO A;  3UPU A;  4O5V A;  2V8J A;  3HPW A;  3HFN A;  1K73 C;  2JTM A;  2QA4 A;  5GAM j;  3JCM P;  1HXD A;  2EIF A;  3SWN C;  1Q86 U;  3E9G A;  1YCY A;  3GLX A;  4X9C A;  3HRT A;  2DK3 A;  1BI0 A;  3CBO A;  5CQX A;  2RD1 A;  4XU2 A;  3CCQ A;  1Q81 U;  1WJS A;  4M78 D;  3V8J A;  3KXT A;  2K5I A;  4F7U B;  2MWO A;  2WSE E;  5IN1 A;  4HT9 A;  1KG1 A;  3A8H B;  3SB2 A;  4NL3 A;  3CEY A;  4C8Q C;  5GMK h;  2LT1 A;  4JRP A;  1BYM A;  1ZQ1 A;  1QVP A;  3PIO A;  4M78 E;  3PMI A;  1K8A C;  1SSF A;  2K57 A;  2D6F A;  3ASK A;  3EAE A;  1DJ7 B;  5IT9 E;  4M7A B;  3OW2 A;  3FRN A;  1OZ3 A;  3FC3 A;  1YI2 A;  3L2W A;  3CCJ T;  2E41 A;  2M9U A;  3LX7 A;  5GAO q;  4JS4 A;  1VQP A;  1N8R C;  2DEQ A;  2GFA A;  4II1 A;  3WVE B;  1YJ9 T;  4BE0 A;  2X4J A;  3CPW S;  1Q82 C;  2ZPB B;  1VQ4 T;  4BDY A;  2DXC A;  5HK0 A;  3BFM A;  3V7C A;  1QVG S;  2F5K A;  5GAN g;  1JJ2 A;  3QUI A;  4PKC C;  4DOV A;  3OS2 A;  2DZ9 A;  4FM4 B;  1M1F A;  3M9Q A;  3HHT B;  1BI3 A;  3M55 A;  3H8Z A;  5GAO r;  3GNF B;  3FLG A;  4C92 F;  5GMK l;  3QII A;  4BDZ A;  1MGQ A;  4HKE A;  4JDS A;  5J26 A;  4M7D E;  2HNI A;  2XDD A;  3BDL A;  3AHU A;  1VUB A;  3LGF A;  1VQL A;  4LD6 A;  4UC4 A;  4C92 B;  4RCB A;  3CC7 T;  3PTA A;  3OS1 A;  4J83 A;  4JUV A;  2KMT A;  3NFC A;  3S3M A;  4E7K A;  3ZBD A;  1K8A U;  2KY9 A;  2P0K A;  2RB6 A;  2XDP A;  4M7A A;  2CKK A;  2RI5 A;  2E12 A;  3QYH B;  2VXF A;  3INZ A;  2R5A A;  4GLK A;  2IVW A;  4L59 A;  3CCS A;  4E7H A;  3MP8 A;  2LT4 A;  4M7D C;  1UGS B;  4ZGE B;  2LQ8 A;  2LDM A;  3DB3 A;  2VUB A;  4F7U A;  1VQ6 A;  5FU6 B;  5GAM g;  4ZGJ B;  3BDU A;  3OYL A;  1P92 A;  3CPF A;  4M77 E;  2DXU A;  3BW1 A;  2LTO A;  4RCC A;  5LJ5 g;  2LCL A;  2V8K A;  1VQK T;  3QG1 A;  1YIJ T;  1UGP B;  3BY7 A;  2FYK A;  1N6A A;  1OYX A;  4QVD A;  3JB9 F;  4XK8 E;  5A0D A;  1EIF A;  1BIA A;  1BKB A;  3A8O B;  3M4Y A;  3CPW A;  5IAY A;  3GIB A;  5GAN f;  5FU7 B;  2EQJ A;  4VUB A;  5DY9 A;  2WSF E;  5GAO l;  4P5N A;  3CC4 T;  3SWN B;  5FU6 C;  2JNG A;  3JCM c;  5LJ5 j;  4J8O A;  4N4G A;  2XHC A;  1RL2 A;  2EJG A;  3N5B B;  2JZ2 A;  3CCM A;  2CGH A;  3L2R A;  4PNO A;  4KUL A;  2KDS A;  1I8F A;  1ZBX A;  3CCL T;  2DKG A;  2E10 A;  4OB2 B;  3I55 T;  1KC8 U;  3G71 T;  3JCM Q;  1G3S A;  1XQH A;  1YJN A;  3V8L A;  2EQM A;  3QYG B;  4GY5 A;  2DO3 A;  1U8R A;  5CKD A;  1VQM T;  2RO0 A;  3CBP A;  5GMK m;  4WF2 A;  5KH6 A;  4C0Z A;  3I56 A;  1FXX A;  5CK9 A;  4EMK A;  2BIV A;  2CZ0 B;  1UGR B;  5FRO A;  2RK1 A;  5LJ3 e;  5A2Q E;  1GXI E;  2EAY A;  3TEE A;  4C8Q G;  2ZPG B;  2CZ6 B;  5AYF A;  1XNI A;  3T9N A;  5HY6 A;  2JUF A;  4A54 A;  3ER0 A;  1N9S A;  4HCC A;  4MML A;  3L2U A;  3CCS T;  3LGL A;  4PLI A;  5KCO A;  3R6O A;  5D6Y A;  5GAN j;  3P8D A;  4IUP A;  4LDV A;  3OYI A;  4PJO D;  4OGC A;  2I2L A;  4RG8 A;  1VQK A;  3OYE A;  1I81 A;  5GAN 4;  3QBY A;  3G4S T;  2JOY A;  4OB0 B;  4C0D B;  4ZN3 A;  2C06 A;  2MF2 A;  2EJF A;  3ME9 A;  1FWZ A;  4FT4 A;  3M56 A;  3S6W A;  4C8Q A;  3OYH A;  3PFS A;  3CCR T;  1U1S A;  5C6S A;  1S72 A;  1KQS A;  3CD6 A;  4PJO A;  1H64 1;  4PJO F;  3C94 A;  4ME7 A;  2E6Z A;  3CCU T;  2CYZ B;  1IZ6 A;  4M75 B;  3JCM J;  2JN0 A;  3OQ5 A;  4BI3 A;  3JCM d;  3FB9 A;  3CXC A;  2PVO B;  4BI8 B;  1K9M U;  4EMH A;  3DLL A;  4J6X A;  5GAM h;  2O4X B;  2DTI A;  5GAO p;  2KVQ G;  3OMC A;  2Y4Y A;  4J6W A;  2VGM A;  4BE1 A;  1VQ4 A;  4LDW A;  4HT8 A;  2QTX A;  4M75 D;  4C5E A;  3C95 A;  5GAN h;  4NL2 A;  2FVU A;  3LWI A;  4J5Y A;  3JCM h;  5I21 A;  2HAX A;  3CD6 T;  1D3B A;  1KHI A;  1YJW T;  1AHJ B;  3DB4 A;  2YRV A;  4JLI A;  2CZ7 B;  4R55 A;  2LCC A;  4DOW A;  1JRI A;  2E5Q A;  3QJ6 A;  4V2S A;  1KC8 C;  2NLU A;  4ELZ C;  3HL8 A;  4ATO A;  4M7A G;  4IUV A;  4D6W A;  2GF7 A;  5GAM f;  2DD4 A;  3J81 E;  3CME A;  1QVF A;  3A8G B;  2DD5 A;  3X25 B;  3QDR B;  2P0P A;  1V29 B;  3MEV A;  4E47 A;  4M7A F;  3RKW A;  3Q1J A;  2MI6 A;  3VKI A;  2KAF A;  3WVD B;  2RHI A;  5J39 A;  4RMO A;  3OYC A;  3QZ9 B;  3JB9 I;  3OYA A;  3HRU A;  1G3W A;  2DZC A;  2EFI A;  1JBM A;  3PIP A;  1Q82 U;  3OYM A;  3S3N A;  4M78 C;  5LJ5 e;  1W2B S;  4A53 A;  1BIB A;  2X35 A;  4M75 A;  3JB9 D;  3PMT A;  4C92 A;  5GAN 6;  3GP8 A;  1H3Z A;  4A4G A;  2O4X A;  2XI9 A;  4C5I A;  3GOX A;  3HRS A;  3MP6 A;  3EFS A;  3OY9 A;  2ZPE B;  5GAN 8;  5LJ3 f;  3CCL A;  3WXM B;  2QQ9 A;  1VQ5 A;  3JRZ A;  5GAO m;  4FT2 A;  3UDC A;  4FL6 A;  1S72 T;  2R5M A;  2RJF A;  4PJO G;  1X75 C;  2RM4 A;  3G6E T;  3M58 A;  1D3B B;  1YIT T;  3RMQ A;  3UWN A;  4PJO B;  2HQE A;  3LW5 E;  4HCB A;  4MDX A;  4M75 F;  4IUR A;  4N0A C;  4BY6 C;  2K2V A;  4N4H A;  2WAC A;  2RHX A;  1K73 U;  4M77 D;  4DA4 A;  2ZPF B;  3CC2 T;  4Y91 A;  2LRQ A;  3L42 A;  4M77 C;  4QQG A;  1Q81 C;  2RJC A;  2M0O A;  4XTV A;  1FX7 A;  3OW2 S;  1KHC A;  1M1K U;  4QVC A;  1YIT A;  2EJ9 A;  3G6E A;  2K3X A;  3SDZ A;  2XD0 A;  1G3T A;  4RKU E;  5CAI A;  3OB9 A;  4LDY A;  2PUO B;  2MAM A;  1YHQ T;  2YLB A;  1KD1 U;  4XTZ A;  4QW2 A;  4MZP A;  2LX9 A;  4RG2 A;  1KQS S;  2FHD A;  5LL6 S;  1R8O B;  1N9R A;  4MZT A;  3ZFJ A;  3I55 A;  4JRQ A;  3MEU A;  4C0D C;  1LNX A;  4BE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...