4KUIA

Crystal structure of n-terminal acetylated yeast sir3 bah domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
201
Chain Sequence
b'KTLKDLDGWQVIITDDQGRVIDENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein SIR3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 53
structure length 201
sequence length 213
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kuiA00
3TU4K 4BB7A 4KUDK 4KUIA 2FVUA 4DA4A 1ZBXA 4JJNK 4FSXA 2FL7A 4KULA 3PTAA 1M4ZA 4DOVA 4FT4A 4LD9K 1W4SA 1ZHIA 4FT2A 3PT9A 4DOWA
chains in the Genus database with same CATH superfamily
1HSQA 3A8OB 1BIAA 3QIIA 4PFPA 3CCLT 2RJDA 5IH2A 2L8DA 2Y4YA 4C92G 1OPKA 4KGXB 2HQHA 2X51A 3M0SA 2MAMA 2MOXA 4M78E 2PUKB 1OV3A 5LJ5g 5FU6C 1JXMA 1ZUUA 4M7DD 4PJOG 1QVGS 3I35A 1VQOQ 3S6WA 1ZX6A 2X9HA 3MEWA 2EJGA 2FB7A 2LCLA 4HVUA 1QP3A 2L3SA 5DLOA 2EGAA 3VKIA 2OAWA 2CT4A 4KUIA 4BY6B 4C8QA 2JTFA 3VS6A 3MEAA 1KQSS 1IB8A 1F1BB 2XG8D 4TVRA 1OI1A 1PKTA 1EIFA 1WXTA 1H641 3CXCS 1M90U 2E4HA 2KR3A 2VWFA 1TWBA 4OB2B 2EQMA 1IREB 3EG1A 1M8VA 2GFUA 1VOMA 1YITT 2RK1A 4IUVA 5M9OA 4RTTA 4MZTA 1K73R 3A8HB 4VUBA 2R5MA 3HTRA 1Z9ZA 2YXYA 1M30A 1TTHB 2BUDA 2LNHB 2PU9B 5KYYA 1UB4A 2EVRA 2NYSA 2NUTB 1KIKA 4M75E 1MMNA 3CD6A 3NGPA 2PQWA 2ZPEB 4Z02A 2YUQA 4ZN1A 4PJLA 3N5BB 4CC7A 2ENMA 3EHQA 2CYZB 1JQQA 2NUPA 3JCMJ 2YRCA 4NS5A 1WA7A 2EW3A 2EWNA 5LJ3h 1XTDA 1XNIA 2LT4A 2ABLA 3S3OA 2RQVA 1P92A 2FO0A 2MCNA 3V7SA 3OYAA 2YHTA 1WHGA 4ESRA 4KRTA 4D8KA 1BKBA 5HY6A 1N8RR 1FWZA 1QCNA 2MWPA 1K8AR 2JMAA 3EFRA 4C5GA 5IHKA 3X25B 3VYHB 1E6GA 2YUNA 4AG2C 1D3BB 2QA4Q 3RBBB 3VJPA 2QASA 2FZKB 4FCYA 5LJ3g 1VQPT 1OYXA 1X6BA 1BI2A 4M77G 4LUEA 1VQ7A 1X2QA 4JRPA 1WPYA 2J05A 3JCMc 4J83A 4EMHA 2HQXA 1YHQT 4OVAA 1K9AA 2DTHA 1YN8A 2F2XA 3LGLA 1IGQA 2E3IA 1YWPA 3REBB 2LQ8A 1YBYA 4P5NA 1IXDA 4IUQA 2FZGB 1QVPA 4OMFB 2G3RA 3JSCA 3ZFJA 3UPUA 3INZA 3H0HA 3L2ZA 2CZ7B 2SEMA 1SHFA 3MP1A 2FRWA 1RAFB 2RI5A 4QKUA 3QHSA 1PC0A 2YRDA 4Z89A 4M78D 3FIFA 5GAMd 2KSSA 3OY9A 2DL3A 3LYIA 4BDYA 4J6XA 1UUEA 3L2WA 4M7AG 4XU2A 4WF2A 3S3NA 2E1HA 3CD6Q 1VQ6A 4RTXA 2JW4A 3X26B 1WI7A 4HT8A 3I55A 4OB0B 4MZPA 3OYKA 2RQTA 4JRKA 1U3OA 3JB9G 5CKHA 2GQIA 2CT3A 4FL6A 3OMGA 2RHXA 1NPPA 4FYVB 1X75C 2J6OA 1FMWA 2D8HA 2DXTA 1VQ6T 3J7AF 3KUFA 3I55T 1U1SA 3A8MB 2QEXQ 1RLPC 5A0DA 2K5IA 1MUZA 2IPOB 3JCMd 2MMPA 1PD1A 4C8QG 2ZCFB 1MNEA 4E7IA 2LJ0A 1D1AA 5KYXB 5I22A 4M75D 4AFQC 3DKMA 1VQ7Q 3DB4A 3QYHB 1UFFA 2CP6A 2XU8A 3PNWC 2NUZA 4M7AB 4R55A 3L2VA 4A4EA 3TQ7P 2YRVA 2FRYA 5D7UA 5GAN3 3OBYA 3JB9H 3QDRB 1C6VX 1BK2A 2KYMA 4F7UA 4E7LA 4N4GA 1ACMB 2DF6A 3JV3A 3C94A 2ED1A 1ARKA 2RQRA 3PVLA 2JM9A 3C95A 1WIEA 5C0MA 5FWCA 1WGSA 2AT1B 1KFZA 4C8QB 4JJBA 2V26A 4DBHA 4D6WA 4FYWB 4QVDA 1JJ2S 2VXEA 3I5SA 1MMAA 4XTVA 1PSFA 2L2PA 1JEGA 4OMPA 3MCAB 5IT9E 4BI3A 3V8LA 2YUPA 1BI3A 1GCPA 5IXFA 1YI2A 5A0GA 3BDUA 2CP7A 1QQJA 4BE2A 3CEYA 1X6OA 2CH4A 1RUWA 3CCJT 1MMDA 2P84A 5KYNA 4C0FA 3SDZA 3Q1JA 1B7TA 4F16A 3QKJA 4RCBA 4AMCA 1XQHA 1AD5A 3OB9A 2DAQA 4BDZA 3CCUA 2KRSA 2IG0A 3HRTA 1Q86U 2AZVA 1R0BG 4LNPA 2DL4A 3A8GB 4EMKC 1N27A 5LJ5f 3FRNA 5GAOp 2K79A 4PLIA 1C0MA 3EG9B 2EYXA 1QWEA 1Y7XA 2JT4A 2LQKA 3AT1B 1VQ8A 3GBQA 5GAN5 5LJ3d 2JVVA 4EMGA 3CCUT 2COWA 2RB6A 1UGPB 3ZEHA 3RMQA 1RADB 3BFMA 5J26A 2W0ZA 4HXJA 2YWWA 3I56A 1WZOA 1OZ2A 3M5AA 3JB9J 2EGEA 5L23A 3CCRQ 2JZ2A 2RO0A 4J9EA 2DZCA 1BIBA 1Q81U 2CZ1B 1YJNA 1RAEB 2K7AA 3SD4A 3ER0A 4B9WA 1GBRA 5CVIA 1X6GA 1VQLA 2HCKA 3MKDA 2A37A 1PKSA 4DBFA 2FEIA 1OU9A 5GAN7 1WXUA 2EAYA 3CCSA 2EYZA 4B9XA 2MI6A 4BY6C 5GAMj 5HK3A 4IIOA 3QZ5B 2HAXA 4JS4A 2DPPB 5J3BA 5GMKl 2MWOA 1WQ7A 1KHIA 1YI2Q 3CMAA 4AT1B 1AWXA 2DM1A 2KXCA 2LC4A 2JN0A 1G3WA 1OPLA 1YJWA 1Q7YU 1D3BA 3LLRA 2RI2A 1BBZA 3CMEA 1X69A 2JUFA 6AT1B 5FROA 1PG5B 2EJ9A 2KEAA 4M7DG 1G83A 4JLGA 3CMAT 4F7UG 4C5HA 1NYGA 2C0TA 4C0GA 3OS0A 2QQAA 1YJWT 4KGZB 5GAMe 1N9SA 4BI8B 4MMKA 4KH0B 1I5OB 2XI9A 1WHJA 3M53A 3U23A 2K5LA 1KQ2A 3MP8A 1BB9A 5KH6A 3EG0A 1VQOA 3OYIA 4ZGEB 1VQ8Q 5GAMh 2W10A 2EBPA 1UEBA 4Z8AA 5ECAA 2V8IA 1WNLA 1PRMC 4PLLA 1GCQA 1KK7A 3I56Q 1M1FA 3ASKA 4C92F 1VQOT 3SFMA 2PVDB 1PHTA 2K2MA 3EG3A 4B6MA 4DA4A 2H3EB 4PJOF 2KVQG 3NTIA 1NBEB 4J9BA 3JCMe 2HKNA 4JJCA 1YJNQ 1UGVA 5GAMg 1KC8R 3E2UA 5FRMA 1M9SA 2ATCB 4IKFA 2HBWA 2JMCA 4AFZC 4M7DB 1VQLQ 3JCMh 3EFOB 1AZEA 1YIJA 2LRQA 4RCCA 4XAXB 2KYBA 2L3QA 3CCSQ 1K0XA 5KCOA 3A5ZB 5LL6S 3JCMV 2M0YA 2OTJQ 2FYKA 4HCCA 4LDXA 4OMLA 1KD1U 2DVEA 4E7ZA 4XQ3A 1GCQC 3CPWA 1VYTA 1Q82U 3J81E 2GNCA 3META 1AEYA 3OYLA 1ZSZB 4BI4A 2QI2A 2DLPA 1M1KC 2V8KA 3CMEQ 2DA9A 2XICA 4F04B 4PJJA 3VUZA 1JB0E 3GLXA 1HK9A 3QPHA 4FT2A 3RIRA 4C92E 2P0PA 2P4TA 2E10A 2X35A 2XK0A 2MIOA 2QA4A 4II1A 3NPFA 3HRUA 3HSBA 2DIQA 1Y96B 2VUBA 4PJOE 1TH7A 4OB3B 1JRIA 3CPWP 2KT1A 4L5GA 4OF1A 1CKBA 3M4GA 3NMZC 2QA4T 2D9TA 5GMKh 3OYDA 5HCKA 2HD0A 3LW5E 2VB6A 5LJ3j 3H0IA 3OW2S 1E7OA 5KCHA 5FU7B 2RH2A 1BI0A 3EGDB 4OMOA 4DQ2A 1PSEA 4V2SA 3GP8A 1MV0B 5CQYA 4M77F 1U8RA 1QW1A 3QJYA 1AT1B 2EYQA 3BY7A 2E5QA 2HQEA 4J6YA 4OGEA 4M4ZA 1LJOA 1GRIA 3TEEA 1WXBA 4M7AC 2P0QA 3LGFA 3VS4A 1EX4A 1PM3A 3LH5A 2M16A 2YT6A 4ZGJB 2VASA 2QGGA 2ZPHB 1AOJA 1NLPC 3H41A 5CAIA 1NPRA 1YIJQ 2I2LA 4IUPA 1AWWA 2HSEB 2HDAA 1ZUKA 2XIDA 3QWXX 4Y92A 2DEQA 5LJ3e 2EQKA 1M4ZA 2D1XA 1TS9A 3E19A 2PUOB 3MP6A 2DRMA 4DBRA 4ATOA 4LDYA 2DJQA 3V7CA 4NL2A 4ZNXA 1IO6A 2K3YA 3RDVA 1JU5C 2DXBA 1RACB 5DLQE 2ZPFB 4C8QC 3CD6T 1ABOA 1EFNA 1NEGA 4M7AF 3ZL7C 4IIMA 1R77A 2J7IA 2QEXA 3EG9A 2L0AA 4XTYA 4M78B 2LCCA 1FX7A 3UA7A 2JS0A 1M1KR 2FZCB 3PGGA 3RMSA 1I8FA 4J8OA 2VGNA 1K9MC 2K4YA 3HP9A 2HL3A 2FVUA 2CREA 1DJ7B 1YFNA 3JB9I 3EFSA 2WSFE 3MO8A 4M77E 2QEXT 1NG2A 2COYA 4MDWA 2AHJB 2LX9A 5GJVB 5GAN2 5CKDA 4X1VA 3EAEA 2DERA 2E5KA 2R58A 1M3AA 2EQIA 2ZPBB 3CC4Q 4C8QF 1ZBJA 2EFIA 3MEVA 2J6FA 3HKSA 2DMOA 4J9IA 3H9NA 3CCVQ 4J5YA 1QVFA 1VQ7T 1KQ1A 3DB3A 2FG0A 3G4SA 1D0ZA 4ZTJA 1TUCA 1D0XA 1Q81C 2RF0A 2P4RA 2GF7A 3M56A 4C92D 1TUGB 2O4XB 4M75B 2LX7A 5GAOl 4BB7A 2PZ1A 3KFVA 2O9SA 4PJOD 2DILA 5GANh 2M51A 2ZZDA 2E12A 3OYCA 1HXDA 3VS7A 2RI3A 2ZAEA 1TU0B 2DVJA 3HFNA 2F1LA 1TOVA 3OYMA 3C4SA 4AFUC 2DTIA 2KY9A 1K73U 3E1SA 1QVFP 2BKDN 3OS5A 2LT1A 3TVTA 1ZA1B 3G7ZA 2E41A 5HK0A 3SB2A 2D6FA 1Q7YC 1K76A 2J06A 5GAOr 1RAHB 3JCMb 5EG2A 5FRNA 3UT1A 5GANg 3REAB 1M3CA 1RI0A 5CKFA 3H8ZA 1MNDA 3VS5A 1RABB 3CC2A 3QXEB 2KRNA 4FSSA 3HHTB 3OYEA 1E6HA 3CC7A 3VU3C 1VA7A 5IAYA 4C0DB 1R0CB 3M57A 1LCKA 3CBMA 1U06A 4KBMB 1M5Q1 1UTIA 1TG0A 4FSXA 2RPNA 1HJDA 1VIEA 1ZQ1A 2X4YA 1NYFA 2KQWA 1N8RU 1EZZB 3M0UA 4OP0A 3OS2A 1K9MR 1K8AU 3OYHA 2QDYB 4AG1C 3JRZA 3PIPA 2SRCA 2DKGA 3BE3A 2GTOA 3FB9A 2D0NA 2RA2A 1VQ9Q 3GOXA 1IGUA 3VS1A 2EQJA 3VUBA 2R5AA 4NL3A 2BZYA 4M7DA 4Y91A 3G4SQ 1PWTA 1SKUB 1G8XA 4DOVA 3EFOA 3CCRA 3O5ZA 1H3ZA 1V76A 4ZN3A 5GAOn 5GAMf 5DM7R 1MV3A 5HKCA 2DL7A 1M2VB 2RHIA 2DYIA 2QG9B 3RKXA 1H92A 2CUBA 4M77D 2DBMA 1RI9A 5I2MA 3BDLA 4FU6A 4J6WA 3CCRT 3L42A 3G1JA 4J9GA 2AIRB 1G3TA 1WLPB 1X43A 2C06A 1ZSZA 3F70A 3C12A 2FPEA 4J7IA 2F2WA 4OGCA 2K2VA 1A0NB 3CCQA 2BE9B 1Q82C 4RUGA 1W2BA 1H3HA 4PJMA 1AWJA 1NEBA 2QAZA 3OYJA 3JCMf 2C0IA 4M7DC 2DYBA 2H3JA 2ROTA 2NWMA 2DEUA 2EPDA 3M55A 1ZSGA 4KH1B 3NFCA 2X4WA 3VYGA 4DEYA 1Y96A 3CC2Q 4HVWA 1OULA 2CP3A 3O8VA 3CC7Q 4RTWA 2JXBA 1YJ9Q 4BE0A 4MMLA 1YI2T 1VQMQ 4RMOA 1W70A 2A36A 2PTKA 3UA6A 3FDRA 4QVZA 3KBGA 2FPDA 2GQVA 1VYUA 4IURA 3LX7A 5C6SA 3NTHA 4LD6A 3M0TA 3QWYA 3EHRA 3I5RA 1M1GA 5D6WA 1ZSZC 3EGDA 3RESA 4GLMA 2RNAA 1W2BP 1CKAA 4E7SA 4ZTFA 3EH1A 2DJZA 4F7UF 1QCOA 2DL8A 2F2VA 1WDXA 3M0PA 4QW2A 3PMIA 3VRYA 2KROA 2F5TX 4MZMA 1Y0MA 3SEMA 1VQ8T 1RL2A 1RLQC 1M90C 2XKOC 3C0CA 4CI0C 2KBTA 2M9UA 2K3BA 4RTVA 1T0HA 3P8BB 3QUIA 3JCMW 1FMKA 4Z88A 3I56T 4A4KA 4QQDA 1I81A 1W4SA 3GNGA 9ATCB 1VQ5Q 1GBQA 1GL5A 5FU7C 1YJNT 2JOYA 2EJFA 1UJ0A 3PVQA 3CCMA 3JCMQ 3TCJA 3GPLA 2OTJA 1WJRA 1VQLT 3CCQQ 4M78A 4PFOA 1PD0A 2RJCA 5GJWB 2MF2A 4JS5A 1VQNA 3CCST 4J9DA 1GFCA 3GF5A 4N0AA 3A1PA 2KI7A 1IHVA 1R8OB 2GCXA 1Q82R 1LNXA 2OTJT 2D8JA 4F7UE 2A08A 4JDSA 5GANd 1JBMA 2OTLQ 3E9FA 1S1NA 4FT4A 2HNIA 2NLUA 1YCYA 5CO7A 4E7JA 4FIBA 4X34A 5LJ3f 1I0CA 2AZSA 2ZPGB 4BUGA 1FYNA 3CMET 2RMOA 1I07A 4PJNA 2IVWA 2BTTA 1ZA2B 3M4YA 2WACA 1TUDA 1JO8A 5GAN8 4RG2A 2QQBA 4M78C 1AVZC 1MGQA 1YCSB 4LE9A 3RR6A 2MK5A 2LNVA 4CRIA 2O4XA 4M75A 3CCEA 1OX8A 1X2KA 3EGXA 4XTXA 4F14A 4CC4B 3PT9A 4J7FA 4N0AC 2KK4A 3L1AA 5CK9A 2RJEA 4N4IA 3HRSA 2J6KA 5AT1B 1QVGA 1Z9QA 4HCBA 2DXCA 3V7RA 4DBQA 3M59A 3G6EQ 1WJSA 2A7YA 1KG1A 3RKYA 1M90R 2L89A 4JRQA 2K57A 5KE3A 2LJ3A 4E6RA 3RUXA 1HD3A 2PVGB 3ME9A 4HCKA 4X9DA 1NM7A 1VQ4A 2ROLA 2Z0WA 4JLIA 1G3SA 4GBQA 2O01E 3CCMQ 1KQSA 2LQNA 3OYFA 4PK4A 4FW2A 4R56A 1YP5A 2DL5A 5GMKm 2O88A 4HKEA 1NZ9A 2FPFA 5GMKj 1YIJT 4M75C 2OI3A 2V1QA 1M2OA 4DOWA 3CXCA 1VQNQ 4PNOA 2B8AA 4PKCC 3CBOA 4J9FA 3TSWA 2RQWA 3FJ5A 2CP2A 5KYUB 3LWHA 1B07A 1LVKA 1N9RA 4FM4B 3PTAA 1U1TA 3G71A 2DNUA 5KE2A 1NJIU 2DX1A 2QYZA 3EGUA 3SWNB 1AZGB 3P8HA 3T9NA 1BCMA 2K3XA 2KE9A 1BU1A 2QQ9A 2RHZA 3GIBA 3CCLA 3SHWA 4KT0E 2X3XD 5A0LA 2GTJA 3JAME 1WQWA 4BD3A 5GMKe 3OA6A 5D6XA 2CP0A 2OX7A 3KXTA 3CXCP 1AHJB 3CC4A 5KYWB 4WTOB 4C0DC 2VV5A 2C0OA 1D0YA 2RHYA 1M2VA 2XMFA 3CCEQ 3VS3A 2ZPIB 1NLOC 3CCVA 2RD1A 2I0NA 1IZ6A 1YNZA 2LQWA 1S72Q 5CQXA 4C5IA 2X4JA 1I5LA 4M78G 1KSWA 5I21A 3CC4T 5A2QE 2E6NA 1K0SA 4LD9K 3CCVT 2GFAA 2IIMA 3NHNA 4HT9A 2V1RA 1YITA 3OQ5A 4E2FB 3A98A 1ZBXA 4J9HA 4K11A 1VQ4Q 1WHKA 1KC8U 1JXOA 2DBKA 4A53A 4KULA 4O5VA 2DXUA 1U5SA 1V1CA 4NOYA 3CPWS 2QQRA 2HSPA 1I4K1 1FXXA 2ESWA 4AFSC 1XOVA 2VYTA 3RNJA 2YDLA 5IXBA 5I2SA 1UHFA 3AHUA 4JJDA 2G6FX 2RQUA 2HZYA 3E9GA 1B3QA 4C92B 1Y07A 4ME7A 1Q95G 1VIFA 2QQSA 2QDLA 2O9VA 3H0FA 4M75G 1T0JA 1UG1A 3OBWA 3VS2A 3FC3A 4PJOB 4LN2A 3L2QA 1K1ZA 3JB9F 1Q86C 4C0ZA 3G71Q 3URGA 3QJ6A 3IQLA 3X24B 4KUDK 3CBPA 5GANj 4XU0A 3OSVA 1VQKQ 2QXFA 4RTZA 4HVVA 3CCLQ 1N6AA 2FHDA 1VQPA 3OSSC 1QKXA 1RAAB 4BE1A 2KGTA 2DIGA 2E3HA 2YLBA 4A63B 3V8JA 1VQ9A 1B34B 4XTWA 5GAN4 1YHQA 2M0OA 1D09B 4Q5WA 1QLYA 3QG1A 2DETA 3V8KA 4ORZA 5I11A 4RG8A 7AT1B 3ULRB 4R0KA 5GMKi 3M0QA 1C1AA 5GANe 1QP2A 1VQ9T 1SEMA 4IUTA 2Y4XA 4QQ6A 3EGXB 5AYFA 3G4ST 2JS2A 4JUVA 1LOJA 2B86A 2EYWA 1YITQ 4LDWA 1X01A 1ZLMA 2RM4A 1VYVA 3OS1A 4M7AE 1NE8A 2KAFA 2F69A 5CR2A 3J80E 3RERA 1OOTA 2CP5A 2CS7A 2H8HA 1PCXA 2WSCE 4ELYC 1QKWA 2DD4A 2XDDA 2X4XA 4OMMA 3A8LB 1OEBA 2JTMA 4CC3A 1ABQA 2RK2A 3NTKA 5IHNA 2RJFA 3TREA 3THKA 2CSQA 3HPWA 2VGMA 1WYXA 4HA8A 4YTLA 5CCAA 2HKQB 3EG2A 3EH2A 4M77B 1JJ2A 4F17A 3UF4A 1PRLC 3PFSA 4C8QE 1YJ9A 1VQMA 2JM8A 4CC2A 1BI1A 1CSKA 1SSFA 2VC8A 3OYNA 2ECZA 3GNFB 3M54A 3LWIA 4LUDA 3RKWA 5FU6B 4IUUA 3CC2T 4FYXB 1AWOA 1Q86R 3CC7T 1VQPQ 1M1KU 1YJ9T 4XU1A 3VV0A 1VQMT 2LP5A 1UJYA 1QVFS 1D1CA 2K9GA 2QTXA 3CPFA 1ZUYA 2Y90A 3HL8A 1UGQB 2PNIA 1TSFA 1YHQQ 2HBPA 4QQGA 3WVDB 3MHXA 2E6ZA 2YLCA 1JJ2P 4ELZC 2E64A 3H6ZA 1M8MA 2EKHA 1IHWA 4QVCA 4Y28E 3VRZA 2ED0A 5LJ5d 2BZXA 2KMTA 1Q81R 5GAOm 4E7HA 2EIFA 4A54A 1VQ5A 4JRIA 3PE0A 2EQUA 2XHCA 4JZ3A 1YWOA 2MYSA 3MJXA 4OB1B 3OYYA 1RAGB 2DD5A 1W1FA 1KD1C 2KT8A 5KYUA 4WCIA 1O9SA 2BZ8A 2AK5A 2D0QB 3QZ9B 4OMNA 4RTUA 3R6OA 1VQ5T 1UDLA 4EMKA 5CKBA 2HMAA 2DK3A 1QCFA 1UGSB 3SWNA 1M3BA 3OYBA 2AKKA 3FJPA 4L6V5 2O2OA 1VQ6Q 2AKLA 5FLXE 5GAOq 3I55Q 1Q7YR 3MEUA 2OJ2A 3CCQT 3CCJA 1OU8A 1QWFA 1NJIC 3PMTA 2EGCA 2OTLA 1IRXA 4ZGDB 2CZ0B 2K5FA 4O6JA 1OQKA 2A3LA 5KYWA 4M7AD 2V8JA 3I9QA 2DRKA 5KYYB 8AT1B 1J3TA 3TSZA 2CDTA 3QYGB 4EIKA 2CSIA 2XDPA 3JCMP 3JB9D 1RAIB 4X9CA 2LZ6B 3PIOA 2A0FB 2JJ9A 2OTLT 1T3LA 3OYGA 2NUPB 3OMCA 3UWNA 4M7DF 2XD0A 5L8RE 1FMVA 1PNJA 1SRLA 4XU3A 4GY5A 3R6NA 2ZGWA 1KJWA 2GGRA 1OX9A 1MMGA 4BACA 1K9MU 4EDUA 3SWNC 3L2UA 4XK8E 1N5ZA 2FL7A 2M1HA 4PL6A 3TU4K 4C8QD 2VVKA 4MDXA 1KHCA 1UHCA 2CGHA 2VKNA 1UGRB 1SHGA 4J9CA 4JZ4A 3UDCA 2QTVA 1BCOA 4A4GA 3BW1A 3G6EA 1O75A 2EYYA 2PVOB 4HCZA 1QMCA 2DO3A 2LJ1A 1SG5A 3LH0A 1KC8C 3JCMX 4RTYA 3UATA 3P8DA 4N4HA 1W6XA 1H8KA 1W2BS 4GLKA 2NUTA 3G6ET 4C92A 2RN8A 1HYOA 1OZ3A 1Y57A 4UC4A 1WX6A 4EPCA 4JPBW 4LDVA 1MHNA 4PJOA 1GXIE 3FLGA 2LCSA 2LTOA 4D8DA 1KD1R 2CKKA 1UECA 5FWBA 1GFDA 2MPXC 2CH4W 3QO3A 3CCMT 2KNBB 3CCJQ 4M7DE 4JJNK 3L2RA 1SSHA 1VQNT 3HFOA 5DY9A 2CUDA 2LVMA 2RHUA 1K4US 3D7SB 3X20B 2DTOA 1I1JA 1B34A 3QDFA 1WHMA 1NJIR 1X27A 4ANJA 2CZ6B 1UE9A 2L3RA 4C5EA 4C92C 2K6DA 5EC7A 4XTUA 3CQTA 2KRMA 4PFZA 4PJOC 5GAN6 3WXMB 3CCUQ 2O31A 2XDBA 1G5VA 5CIUA 5CKEA 4RKUE 2JTEA 2DE0X 3WVEB 8ATCB 1T3SA 1S72A 1BYMA 2YSQA 4FW1A 4E7KA 2YUOA 1SPKA 2BE7D 4LXCA 3M58A 2EKOA 3CCET 3QSUA 4L59A 1Y71A 3FEOA 1WHHA 3ZBDA 4FYYB 2QGFB 2M02A 2F5KA 2HL5C 5LJ5j 1S72T 3VS0A 2OAUA 2L5QA 4M78F 4KGVB 1VUBA 2LMJA 3OW2A 2R57A 1K73C 2E70A 2QK0A 4LDUA 4M77A 4QT7A 3DLMA 3X28B 2L3PA 4E47A 5J39A 1ZHIA 2LDMA 3DLLA 2X3WD 3M0RA 4F7UB 5IHIA 1LPLA 1VQ4T 2VXFA 5GANf 1QVGP 1WJQA 3M9QA 4OMQA 1V29B 5IN1A 1WHLA 2A28A 5LJ5e 1D1BA 1SF9A 2DZ9A 4XTZA 5FW9A 1G2BA 3CMAQ 2COZA 2E65A 4EMKB 1G3YA 2KXDA 4A4HA 3OW2P 1YJWQ 1N8RC 2BIVA 5LJ5h 3JCMg 2HEQA 2JNGA 5KYXA 1VQKA 1K8AC 1KQSP 1M27C 3MPUB 2WSEE 4A4FA 3S3MA 4M75F 2P0KA 3G71T 1SRMA 2KDSA 4M77C 3QBYA 5D6YA 4M7AA 1TXQA 1WFWA 1XJWB 2GBQA 2DFUA 1VQKT 4DEXA
chains in the Genus database with same CATH topology
4IUTA 1D3BA 2Y4XA 3A8OB 3QIIA 1BIAA 4J7IA 3LLRA 2RI2A 2RJDA 4QQ6A 2L8DA 2Y4YA 4C92G 3CMEA 2JUFA 5AYFA 3G4ST 5FROA 4E7JA 4OGCA 4JUVA 2EJ9A 1LOJA 2K2VA 2MAMA 3CCQA 4M78E 2PUKB 4LDWA 5LJ5g 1X01A 2RM4A 5FU6C 4M7DD 4PJOG 1Q82C 1QVGS 1W2BA 3S6WA 4M7DG 4JLGA 3CMAT 4F7UG 3OS1A 3MEWA 4C5HA 4M7AE 2EJGA 2FB7A 1NE8A 2LCLA 3JCMf 3OYJA 4M7DC 4C0GA 1QP3A 2KAFA 2QQAA 3OS0A 1YJWT 2H3JA 2F69A 5DLOA 5GAMe 5CR2A 3M55A 3J80E 3VKIA 3NFCA 1N9SA 2X4WA 4BI8B 3RERA 4MMKA 3VYGA 2CS7A 2WSCE 1Y96A 4ELYC 2XI9A 3M53A 3O8VA 2DD4A 2K5LA 2XDDA 1KQ2A 3MP8A 2X4XA 4KUIA 3A8LB 5KH6A 4BY6B 4C8QA 2JTMA 2JTFA 4MMLA 4BE0A 3MEAA 2RK2A 1VQOA 1YI2T 3OYIA 1KQSS 4ZGEB 5GAMh 2XG8D 3NTKA 2RJFA 4TVRA 3TREA 4RMOA 3HPWA 1OI1A 1UEBA 2VGMA 3FDRA 1EIFA 2V8IA 4QVZA 4HA8A 1H641 3KBGA 1WNLA 2GQVA 3CXCS 1M90U 4IURA 4PLLA 4YTLA 3LX7A 5CCAA 5C6SA 3NTHA 4LD6A 4M77B 4OB2B 2EQMA 1IREB 1M1GA 2GFUA 1M8VA 1YITT 1M1FA 5D6WA 3ASKA 1JJ2A 4C92F 2RK1A 3RESA 4IUVA 5M9OA 1VQOT 3SFMA 2PVDB 3PFSA 4MZTA 4C8QE 3A8HB 1YJ9A 1VQMA 4VUBA 1BI1A 4DA4A 4PJOF 2R5MA 2KVQG 1SSFA 2VC8A 3OYNA 4ZTFA 2DJZA 3NTIA 4F7UF 3JCMe 2BUDA 3GNFB 3M54A 2PU9B 3LWIA 1UB4A 3RKWA 5FU6B 4M75E 4QW2A 3CD6A 4IUUA 3PMIA 5GAMg 3CC2T 2PQWA 2ZPEB 5FRMA 4Z02A 1M9SA 4ZN1A 4IKFA 3N5BB 3CC7T 1M1KU 4M7DB 2F5TX 1YJ9T 4XU1A 4MZMA 2CYZB 3VV0A 1VQMT 3JCMh 1VQ8T 1RL2A 1YIJA 3JCMJ 1QVFS 4NS5A 1M90C 2LRQA 5LJ3h 2EWNA 2QTXA 4RCCA 2XKOC 4XAXB 1XTDA 1XNIA 3CPFA 4CI0C 2Y90A 2LT4A 1UGQB 2M9UA 3HL8A 5KCOA 3S3OA 3A5ZB 5LL6S 1P92A 3P8BB 3QUIA 3JCMV 3JCMW 3V7SA 3OYAA 2YHTA 2HBPA 4QQGA 3I56T 2FYKA 3WVDB 4A4KA 3MHXA 2E6ZA 4QQDA 2YLCA 4HCCA 1BKBA 4LDXA 1KD1U 4ELZC 1I81A 1W4SA 2E64A 3GNGA 2DVEA 3H6ZA 5HY6A 1FWZA 4XQ3A 2MWPA 3CPWA 3EFRA 4C5GA 4QVCA 4Y28E 1Q82U 5FU7C 3J81E 1YJNT 2JOYA 3META 3OYLA 5LJ5d 4BI4A 3X25B 3VYHB 2QI2A 1M1KC 2EJFA 2KMTA 2V8KA 1D3BB 3CCMA 3VJPA 5LJ3g 3JCMQ 1VQPT 1OYXA 3TCJA 3GPLA 3CCLT 1WJRA 2OTJA 5GAOm 1BI2A 4M77G 4E7HA 1VQLT 2XICA 1VQ7A 4M78A 2EIFA 2RJCA 3VUZA 2MF2A 4A54A 1VQ5A 4JS5A 1JB0E 3GLXA 4JRIA 4JRPA 1VQNA 1HK9A 1WPYA 2EQUA 2XHCA 3CCST 3QPHA 4FT2A 3JCMc 3GF5A 4J83A 4N0AA 3RIRA 4EMHA 2HQXA 4C92E 2P0PA 2P4TA 3OYYA 1R8OB 2E10A 2GCXA 2X35A 2XK0A 4OB1B 2DD5A 1KD1C 2QA4A 1LNXA 4II1A 2OTJT 1O9SA 3HRUA 3HSBA 2DIQA 1Y96B 2VUBA 2DTHA 4OVAA 2D0QB 4PJOE 3LGLA 3QZ9B 3R6OA 4F7UE 1VQ5T 4JDSA 2LQ8A 5GANd 1YHQT 1YBYA 4P5NA 1JBMA 1TH7A 4OB3B 1JRIA 4EMKA 5CKBA 3E9FA 4IUQA 2DK3A 1QVPA 4FT4A 2HNIA 2NLUA 1UGSB 4L5GA 2G3RA 3JSCA 1YCYA 4OMFB 5CO7A 3SWNA 4OF1A 3ZFJA 4FIBA 4X34A 5LJ3f 3OYBA 3UPUA 3FJPA 3INZA 3L2ZA 3M4GA 2CZ7B 2ZPGB 4L6V5 4BUGA 3CMET 2D9TA 5GMKh 2QA4T 5FLXE 3OYDA 2HD0A 3LW5E 5LJ3j 5GAOq 3MP1A 3MEUA 3OW2S 3CCQT 3CCJA 2RI5A 5KCHA 2IVWA 5FU7B 3QHSA 2RH2A 1BI0A 1NJIC 4DQ2A 4V2SA 1PSEA 3PMTA 3GP8A 4M78D 5CQYA 4M77F 1U8RA 3M4YA 4PJOB 2WACA 1QW1A 3FIFA 2OTLA 5GAMd 4ZGDB 2CZ0B 2K5FA 2KSSA 3OY9A 3QJYA 4O6JA 3LYIA 5GAN8 2EYQA 4BDYA 4RG2A 2A3LA 4M7AD 4J6XA 2V8JA 2E5QA 2QQBA 2HQEA 3BY7A 4M78C 4XU2A 1MGQA 3L2WA 4J6YA 4M7AG 4WF2A 4OGEA 2LNVA 3S3NA 2E1HA 4CRIA 1LJOA 2O4XA 4M75A 3QYGB 3CCEA 1VQ6A 4XTXA 3TEEA 3X26B 4HT8A 2XDPA 3I55A 4OB0B 2P0QA 3LGFA 3PT9A 3JCMP 3JB9D 4M7AC 4X9CA 4MZPA 2M16A 4JRKA 3OYKA 4ZGJB 3JB9G 4J7FA 2ZPHB 4N0AC 3PIOA 5CKHA 2KK4A 3L1AA 5CAIA 5CK9A 2OTLT 4FL6A 1NPRA 3OYGA 3OMGA 2I2LA 4IUPA 3OMCA 2RHXA 3UWNA 2RJEA 4N4IA 4M7DF 3HRSA 2XD0A 5L8RE 1QVGA 1NPPA 1X75C 4HCBA 2DXCA 2XIDA 3V7RA 4XU3A 4GY5A 3M59A 2DXTA 1VQ6T 2ZGWA 3J7AF 1WJSA 2DEQA 3KUFA 3I55T 5LJ3e 4BACA 1U1SA 2A7YA 2EQKA 3A8MB 1M4ZA 1K9MU 1VQKT 1KG1A 3RKYA 4EDUA 2L89A 3SWNC 3L2UA 4XK8E 3E19A 2FL7A 2PUOB 2M1HA 3MP6A 4ATOA 5A0DA 2K5IA 3JCMd 4JRQA 2MMPA 4LDYA 4PL6A 3TU4K 4C8QD 4MDXA 1KHCA 2CGHA 2K57A 4NL2A 3V7CA 1UGRB 2ZCFB 3RUXA 4C8QG 5KE3A 1Q7YU 2PVGB 3ME9A 4X9DA 2K3YA 1VQ4A 2DXBA 4JLIA 5DLQE 1G3SA 2ZPFB 3UDCA 4C8QC 3CD6T 4A4GA 4E7IA 3BW1A 2O01E 3G6EA 1O75A 4M7AF 2PVOB 4M75D 1KQSA 3OYFA 4HCZA 2QEXA 4R56A 3DKMA 2DO3A 5GMKm 4HKEA 1NZ9A 3DB4A 3QYHB 4M78B 3LH0A 2LCCA 1FX7A 4XTYA 5GMKj 3JCMX 1YIJT 1KC8C 4M75C 3PGGA 4DOWA 3CXCA 3RMSA 4PNOA 2XU8A 1I8FA 3P8DA 2B8AA 4J8OA 3PNWC 2VGNA 4N4HA 4M7AB 2K4YA 4PKCC 3CBOA 1K9MC 1W2BS 3HP9A 4GLKA 4R55A 3G6ET 2FVUA 3L2VA 1DJ7B 4A4EA 4C92A 3JB9I 1OZ3A 2YRVA 3EFSA 2WSFE 3MO8A 4UC4A 4M77E 4EPCA 5GAN3 3JB9H 3OBYA 2QEXT 3QDRB 3LWHA 4LDVA 1MHNA 4MDWA 4PJOA 1GXIE 3FLGA 2AHJB 1N9RA 2LX9A 4F7UA 4FM4B 2LTOA 4N4GA 5GAN2 3PTAA 4E7LA 5CKDA 3EAEA 1U1TA 3G71A 3C94A 2R58A 5KE2A 1NJIU 2CKKA 2ZPBB 4C8QF 2EFIA 3MEVA 3SWNB 3P8HA 3QO3A 3T9NA 3CCMT 2K3XA 3HKSA 3C95A 2QQ9A 2RHZA 3GIBA 3CCLA 5C0MA 4J5YA 4KT0E 5A0LA 1VQ7T 1QVFA 1KQ1A 4M7DE 3DB3A 1WGSA 3G4SA 4JJNK 3JAME 4ZTJA 3L2RA 1WQWA 4BD3A 5GMKe 3OA6A 5D6XA 4C8QB 3KXTA 1Q81C 1VQNT 3HFOA 4D6WA 5DY9A 4QVDA 1JJ2S 1AHJB 2LVMA 2RHUA 2VXEA 3CC4A 3X20B 2DTOA 4C0DC 2VV5A 1B34A 2RHYA 4XTVA 2GF7A 1PSFA 3M56A 4C92D 2O4XB 4M75B 2ZPIB 2CZ6B 3CCVA 2RD1A 5GAOl 4BB7A 1IZ6A 2L3RA 4C5EA 3MCAB 4PJOD 5IT9E 4BI3A 4C92C 5CQXA 3V8LA 4C5IA 5GANh 2X4JA 1I5LA 1BI3A 4XTUA 4M78G 2ZZDA 1YI2A 2E12A 5A0GA 3OYCA 1HXDA 5I21A 3CC4T 2RI3A 3BDUA 4PJOC 5GAN6 5A2QE 3WXMB 2XDBA 1G5VA 3HFNA 2E6NA 4BE2A 3CEYA 5CIUA 4LD9K 1X6OA 5CKEA 3OYMA 3C4SA 3CCVT 2DTIA 3CCJT 2KY9A 2GFAA 4RKUE 3E1SA 1K73U 3WVEB 2BKDN 3OS5A 4HT9A 2LT1A 1YITA 3OQ5A 4C0FA 3SDZA 1S72A 1G3WA 3G7ZA 3Q1JA 1BYMA 2E41A 5HK0A 3SB2A 1ZBXA 2D6FA 1Q7YC 5GAOr 3QKJA 4RCBA 4E7KA 1XQHA 3JCMb 3OB9A 5EG2A 1KC8U 2DAQA 4BDZA 4A53A 4KULA 3CCUA 5FRNA 3HRTA 2IG0A 2EKOA 3M58A 4O5VA 2DXUA 3UT1A 5GANg 1Q86U 3CCET 3QSUA 1RI0A 5CKFA 4NOYA 3CPWS 3A8GB 1Y71A 2QQRA 3FEOA 3H8ZA 4L59A 4EMKC 1N27A 3ZBDA 1I4K1 1FXXA 5LJ5f 3CC2A 3FRNA 3QXEB 5GAOp 1XOVA 2F5KA 5LJ5j 4PLIA 1S72T 3HHTB 3OYEA 3CC7A 2VYTA 3VU3C 5IAYA 4C0DB 1Y7XA 2OAUA 2LQKA 1VQ8A 2L5QA 3M57A 5GAN5 5LJ3d 2JVVA 5I2SA 3CBMA 4EMGA 4M78F 3CCUT 4KBMB 3AHUA 1VUBA 2RB6A 1UGPB 1M5Q1 3OW2A 2R57A 1K73C 3E9GA 4FSXA 3ZEHA 1VIEA 3RMQA 2E70A 1ZQ1A 4C92B 1Y07A 3BFMA 2X4YA 4LDUA 4ME7A 5J26A 4M77A 1VIFA 2QQSA 3DLMA 2KQWA 4M75G 3X28B 1N8RU 4E47A 3OBWA 4OP0A 5J39A 3I56A 3FC3A 3L2QA 3OS2A 1ZHIA 2LDMA 3OYHA 3DLLA 3M5AA 1OZ2A 1K8AU 2QDYB 3JB9J 3JB9F 4F7UB 3JRZA 3PIPA 1Q86C 4C0ZA 2JZ2A 2RO0A 2DKGA 1VQ4T 2VXFA 5GANf 3URGA 2DZCA 3FB9A 3QJ6A 1BIBA 3X24B 4KUDK 1WJQA 3CBPA 3M9QA 5GANj 1Q81U 2CZ1B 2RA2A 4XU0A 3OSVA 3GOXA 1YJNA 2QXFA 1V29B 2EQJA 3VUBA 3SD4A 3ER0A 5IN1A 1N6AA 2FHDA 2R5AA 4NL3A 4B9WA 5LJ5e 4Y91A 1VQPA 4M7DA 5CVIA 3OSSC 1VQLA 4DOVA 3CCRA 2DZ9A 4XTZA 1H3ZA 4BE1A 2DIGA 2E65A 5GAN7 4EMKB 2EAYA 1G3YA 2YLBA 4ZN3A 5GAMf 5DM7R 5GAOn 4A4HA 3CCSA 4BY6C 4B9XA 2MI6A 1N8RC 3V8JA 2BIVA 5HKCA 3JCMg 5LJ5h 1VQ9A 1B34B 2JNGA 5GAMj 4XTWA 2RHIA 5HK3A 5GAN4 1K8AC 1VQKA 3QZ5B 1YHQA 2M0OA 3RKXA 2HAXA 4Q5WA 2WSEE 4M77D 4JS4A 2DPPB 3QG1A 5J3BA 5GMKl 5I2MA 2MWOA 3BDLA 1WQ7A 4FU6A 3V8KA 4M75F 4A4FA 4J6WA 3CCRT 3S3MA 3L42A 2P0KA 4RG8A 1KHIA 3G71T 2KDSA 4M77C 3CMAA 3QBYA 5D6YA 4M7AA 1G3TA 5GMKi 5GANe 1QP2A 2LC4A 1VQ9T 2C06A 3F70A 2JN0A 1YJWA 3C12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 K;  4BB7 A;  4KUD K;  4KUI A;  2FVU A;  4DA4 A;  1ZBX A;  4JJN K;  4FSX A;  2FL7 A;  4KUL A;  3PTA A;  1M4Z A;  4DOV A;  4FT4 A;  4LD9 K;  1W4S A;  1ZHI A;  4FT2 A;  3PT9 A;  4DOW A; 
#chains in the Genus database with same CATH topology
 1HSQ A;  3A8O B;  1BIA A;  3QII A;  4PFP A;  3CCL T;  2RJD A;  5IH2 A;  2L8D A;  2Y4Y A;  4C92 G;  1OPK A;  4KGX B;  2HQH A;  2X51 A;  3M0S A;  2MAM A;  2MOX A;  4M78 E;  2PUK B;  1OV3 A;  5LJ5 g;  5FU6 C;  1JXM A;  1ZUU A;  4M7D D;  4PJO G;  1QVG S;  3I35 A;  1VQO Q;  3S6W A;  1ZX6 A;  2X9H A;  3MEW A;  2EJG A;  2FB7 A;  2LCL A;  4HVU A;  1QP3 A;  2L3S A;  5DLO A;  2EGA A;  3VKI A;  2OAW A;  2CT4 A;  4KUI A;  4BY6 B;  4C8Q A;  2JTF A;  3VS6 A;  3MEA A;  1KQS S;  1IB8 A;  1F1B B;  2XG8 D;  4TVR A;  1OI1 A;  1PKT A;  1EIF A;  1WXT A;  1H64 1;  3CXC S;  1M90 U;  2E4H A;  2KR3 A;  2VWF A;  1TWB A;  4OB2 B;  2EQM A;  1IRE B;  3EG1 A;  1M8V A;  2GFU A;  1VOM A;  1YIT T;  2RK1 A;  4IUV A;  5M9O A;  4RTT A;  4MZT A;  1K73 R;  3A8H B;  4VUB A;  2R5M A;  3HTR A;  1Z9Z A;  2YXY A;  1M30 A;  1TTH B;  2BUD A;  2LNH B;  2PU9 B;  5KYY A;  1UB4 A;  2EVR A;  2NYS A;  2NUT B;  1KIK A;  4M75 E;  1MMN A;  3CD6 A;  3NGP A;  2PQW A;  2ZPE B;  4Z02 A;  2YUQ A;  4ZN1 A;  4PJL A;  3N5B B;  4CC7 A;  2ENM A;  3EHQ A;  2CYZ B;  1JQQ A;  2NUP A;  3JCM J;  2YRC A;  4NS5 A;  1WA7 A;  2EW3 A;  2EWN A;  5LJ3 h;  1XTD A;  1XNI A;  2LT4 A;  2ABL A;  3S3O A;  2RQV A;  1P92 A;  2FO0 A;  2MCN A;  3V7S A;  3OYA A;  2YHT A;  1WHG A;  4ESR A;  4KRT A;  4D8K A;  1BKB A;  5HY6 A;  1N8R R;  1FWZ A;  1QCN A;  2MWP A;  1K8A R;  2JMA A;  3EFR A;  4C5G A;  5IHK A;  3X25 B;  3VYH B;  1E6G A;  2YUN A;  4AG2 C;  1D3B B;  2QA4 Q;  3RBB B;  3VJP A;  2QAS A;  2FZK B;  4FCY A;  5LJ3 g;  1VQP T;  1OYX A;  1X6B A;  1BI2 A;  4M77 G;  4LUE A;  1VQ7 A;  1X2Q A;  4JRP A;  1WPY A;  2J05 A;  3JCM c;  4J83 A;  4EMH A;  2HQX A;  1YHQ T;  4OVA A;  1K9A A;  2DTH A;  1YN8 A;  2F2X A;  3LGL A;  1IGQ A;  2E3I A;  1YWP A;  3REB B;  2LQ8 A;  1YBY A;  4P5N A;  1IXD A;  4IUQ A;  2FZG B;  1QVP A;  4OMF B;  2G3R A;  3JSC A;  3ZFJ A;  3UPU A;  3INZ A;  3H0H A;  3L2Z A;  2CZ7 B;  2SEM A;  1SHF A;  3MP1 A;  2FRW A;  1RAF B;  2RI5 A;  4QKU A;  3QHS A;  1PC0 A;  2YRD A;  4Z89 A;  4M78 D;  3FIF A;  5GAM d;  2KSS A;  3OY9 A;  2DL3 A;  3LYI A;  4BDY A;  4J6X A;  1UUE A;  3L2W A;  4M7A G;  4XU2 A;  4WF2 A;  3S3N A;  2E1H A;  3CD6 Q;  1VQ6 A;  4RTX A;  2JW4 A;  3X26 B;  1WI7 A;  4HT8 A;  3I55 A;  4OB0 B;  4MZP A;  3OYK A;  2RQT A;  4JRK A;  1U3O A;  3JB9 G;  5CKH A;  2GQI A;  2CT3 A;  4FL6 A;  3OMG A;  2RHX A;  1NPP A;  4FYV B;  1X75 C;  2J6O A;  1FMW A;  2D8H A;  2DXT A;  1VQ6 T;  3J7A F;  3KUF A;  3I55 T;  1U1S A;  3A8M B;  2QEX Q;  1RLP C;  5A0D A;  2K5I A;  1MUZ A;  2IPO B;  3JCM d;  2MMP A;  1PD1 A;  4C8Q G;  2ZCF B;  1MNE A;  4E7I A;  2LJ0 A;  1D1A A;  5KYX B;  5I22 A;  4M75 D;  4AFQ C;  3DKM A;  1VQ7 Q;  3DB4 A;  3QYH B;  1UFF A;  2CP6 A;  2XU8 A;  3PNW C;  2NUZ A;  4M7A B;  4R55 A;  3L2V A;  4A4E A;  3TQ7 P;  2YRV A;  2FRY A;  5D7U A;  5GAN 3;  3OBY A;  3JB9 H;  3QDR B;  1C6V X;  1BK2 A;  2KYM A;  4F7U A;  4E7L A;  4N4G A;  1ACM B;  2DF6 A;  3JV3 A;  3C94 A;  2ED1 A;  1ARK A;  2RQR A;  3PVL A;  2JM9 A;  3C95 A;  1WIE A;  5C0M A;  5FWC A;  1WGS A;  2AT1 B;  1KFZ A;  4C8Q B;  4JJB A;  2V26 A;  4DBH A;  4D6W A;  4FYW B;  4QVD A;  1JJ2 S;  2VXE A;  3I5S A;  1MMA A;  4XTV A;  1PSF A;  2L2P A;  1JEG A;  4OMP A;  3MCA B;  5IT9 E;  4BI3 A;  3V8L A;  2YUP A;  1BI3 A;  1GCP A;  5IXF A;  1YI2 A;  5A0G A;  3BDU A;  2CP7 A;  1QQJ A;  4BE2 A;  3CEY A;  1X6O A;  2CH4 A;  1RUW A;  3CCJ T;  1MMD A;  2P84 A;  5KYN A;  4C0F A;  3SDZ A;  3Q1J A;  1B7T A;  4F16 A;  3QKJ A;  4RCB A;  4AMC A;  1XQH A;  1AD5 A;  3OB9 A;  2DAQ A;  4BDZ A;  3CCU A;  2KRS A;  2IG0 A;  3HRT A;  1Q86 U;  2AZV A;  1R0B G;  4LNP A;  2DL4 A;  3A8G B;  4EMK C;  1N27 A;  5LJ5 f;  3FRN A;  5GAO p;  2K79 A;  4PLI A;  1C0M A;  3EG9 B;  2EYX A;  1QWE A;  1Y7X A;  2JT4 A;  2LQK A;  3AT1 B;  1VQ8 A;  3GBQ A;  5GAN 5;  5LJ3 d;  2JVV A;  4EMG A;  3CCU T;  2COW A;  2RB6 A;  1UGP B;  3ZEH A;  3RMQ A;  1RAD B;  3BFM A;  5J26 A;  2W0Z A;  4HXJ A;  2YWW A;  3I56 A;  1WZO A;  1OZ2 A;  3M5A A;  3JB9 J;  2EGE A;  5L23 A;  3CCR Q;  2JZ2 A;  2RO0 A;  4J9E A;  2DZC A;  1BIB A;  1Q81 U;  2CZ1 B;  1YJN A;  1RAE B;  2K7A A;  3SD4 A;  3ER0 A;  4B9W A;  1GBR A;  5CVI A;  1X6G A;  1VQL A;  2HCK A;  3MKD A;  2A37 A;  1PKS A;  4DBF A;  2FEI A;  1OU9 A;  5GAN 7;  1WXU A;  2EAY A;  3CCS A;  2EYZ A;  4B9X A;  2MI6 A;  4BY6 C;  5GAM j;  5HK3 A;  4IIO A;  3QZ5 B;  2HAX A;  4JS4 A;  2DPP B;  5J3B A;  5GMK l;  2MWO A;  1WQ7 A;  1KHI A;  1YI2 Q;  3CMA A;  4AT1 B;  1AWX A;  2DM1 A;  2KXC A;  2LC4 A;  2JN0 A;  1G3W A;  1OPL A;  1YJW A;  1Q7Y U;  1D3B A;  3LLR A;  2RI2 A;  1BBZ A;  3CME A;  1X69 A;  2JUF A;  6AT1 B;  5FRO A;  1PG5 B;  2EJ9 A;  2KEA A;  4M7D G;  1G83 A;  4JLG A;  3CMA T;  4F7U G;  4C5H A;  1NYG A;  2C0T A;  4C0G A;  3OS0 A;  2QQA A;  1YJW T;  4KGZ B;  5GAM e;  1N9S A;  4BI8 B;  4MMK A;  4KH0 B;  1I5O B;  2XI9 A;  1WHJ A;  3M53 A;  3U23 A;  2K5L A;  1KQ2 A;  3MP8 A;  1BB9 A;  5KH6 A;  3EG0 A;  1VQO A;  3OYI A;  4ZGE B;  1VQ8 Q;  5GAM h;  2W10 A;  2EBP A;  1UEB A;  4Z8A A;  5ECA A;  2V8I A;  1WNL A;  1PRM C;  4PLL A;  1GCQ A;  1KK7 A;  3I56 Q;  1M1F A;  3ASK A;  4C92 F;  1VQO T;  3SFM A;  2PVD B;  1PHT A;  2K2M A;  3EG3 A;  4B6M A;  4DA4 A;  2H3E B;  4PJO F;  2KVQ G;  3NTI A;  1NBE B;  4J9B A;  3JCM e;  2HKN A;  4JJC A;  1YJN Q;  1UGV A;  5GAM g;  1KC8 R;  3E2U A;  5FRM A;  1M9S A;  2ATC B;  4IKF A;  2HBW A;  2JMC A;  4AFZ C;  4M7D B;  1VQL Q;  3JCM h;  3EFO B;  1AZE A;  1YIJ A;  2LRQ A;  4RCC A;  4XAX B;  2KYB A;  2L3Q A;  3CCS Q;  1K0X A;  5KCO A;  3A5Z B;  5LL6 S;  3JCM V;  2M0Y A;  2OTJ Q;  2FYK A;  4HCC A;  4LDX A;  4OML A;  1KD1 U;  2DVE A;  4E7Z A;  4XQ3 A;  1GCQ C;  3CPW A;  1VYT A;  1Q82 U;  3J81 E;  2GNC A;  3MET A;  1AEY A;  3OYL A;  1ZSZ B;  4BI4 A;  2QI2 A;  2DLP A;  1M1K C;  2V8K A;  3CME Q;  2DA9 A;  2XIC A;  4F04 B;  4PJJ A;  3VUZ A;  1JB0 E;  3GLX A;  1HK9 A;  3QPH A;  4FT2 A;  3RIR A;  4C92 E;  2P0P A;  2P4T A;  2E10 A;  2X35 A;  2XK0 A;  2MIO A;  2QA4 A;  4II1 A;  3NPF A;  3HRU A;  3HSB A;  2DIQ A;  1Y96 B;  2VUB A;  4PJO E;  1TH7 A;  4OB3 B;  1JRI A;  3CPW P;  2KT1 A;  4L5G A;  4OF1 A;  1CKB A;  3M4G A;  3NMZ C;  2QA4 T;  2D9T A;  5GMK h;  3OYD A;  5HCK A;  2HD0 A;  3LW5 E;  2VB6 A;  5LJ3 j;  3H0I A;  3OW2 S;  1E7O A;  5KCH A;  5FU7 B;  2RH2 A;  1BI0 A;  3EGD B;  4OMO A;  4DQ2 A;  1PSE A;  4V2S A;  3GP8 A;  1MV0 B;  5CQY A;  4M77 F;  1U8R A;  1QW1 A;  3QJY A;  1AT1 B;  2EYQ A;  3BY7 A;  2E5Q A;  2HQE A;  4J6Y A;  4OGE A;  4M4Z A;  1LJO A;  1GRI A;  3TEE A;  1WXB A;  4M7A C;  2P0Q A;  3LGF A;  3VS4 A;  1EX4 A;  1PM3 A;  3LH5 A;  2M16 A;  2YT6 A;  4ZGJ B;  2VAS A;  2QGG A;  2ZPH B;  1AOJ A;  1NLP C;  3H41 A;  5CAI A;  1NPR A;  1YIJ Q;  2I2L A;  4IUP A;  1AWW A;  2HSE B;  2HDA A;  1ZUK A;  2XID A;  3QWX X;  4Y92 A;  2DEQ A;  5LJ3 e;  2EQK A;  1M4Z A;  2D1X A;  1TS9 A;  3E19 A;  2PUO B;  3MP6 A;  2DRM A;  4DBR A;  4ATO A;  4LDY A;  2DJQ A;  3V7C A;  4NL2 A;  4ZNX A;  1IO6 A;  2K3Y A;  3RDV A;  1JU5 C;  2DXB A;  1RAC B;  5DLQ E;  2ZPF B;  4C8Q C;  3CD6 T;  1ABO A;  1EFN A;  1NEG A;  4M7A F;  3ZL7 C;  4IIM A;  1R77 A;  2J7I A;  2QEX A;  3EG9 A;  2L0A A;  4XTY A;  4M78 B;  2LCC A;  1FX7 A;  3UA7 A;  2JS0 A;  1M1K R;  2FZC B;  3PGG A;  3RMS A;  1I8F A;  4J8O A;  2VGN A;  1K9M C;  2K4Y A;  3HP9 A;  2HL3 A;  2FVU A;  2CRE A;  1DJ7 B;  1YFN A;  3JB9 I;  3EFS A;  2WSF E;  3MO8 A;  4M77 E;  2QEX T;  1NG2 A;  2COY A;  4MDW A;  2AHJ B;  2LX9 A;  5GJV B;  5GAN 2;  5CKD A;  4X1V A;  3EAE A;  2DER A;  2E5K A;  2R58 A;  1M3A A;  2EQI A;  2ZPB B;  3CC4 Q;  4C8Q F;  1ZBJ A;  2EFI A;  3MEV A;  2J6F A;  3HKS A;  2DMO A;  4J9I A;  3H9N A;  3CCV Q;  4J5Y A;  1QVF A;  1VQ7 T;  1KQ1 A;  3DB3 A;  2FG0 A;  3G4S A;  1D0Z A;  4ZTJ A;  1TUC A;  1D0X A;  1Q81 C;  2RF0 A;  2P4R A;  2GF7 A;  3M56 A;  4C92 D;  1TUG B;  2O4X B;  4M75 B;  2LX7 A;  5GAO l;  4BB7 A;  2PZ1 A;  3KFV A;  2O9S A;  4PJO D;  2DIL A;  5GAN h;  2M51 A;  2ZZD A;  2E12 A;  3OYC A;  1HXD A;  3VS7 A;  2RI3 A;  2ZAE A;  1TU0 B;  2DVJ A;  3HFN A;  2F1L A;  1TOV A;  3OYM A;  3C4S A;  4AFU C;  2DTI A;  2KY9 A;  1K73 U;  3E1S A;  1QVF P;  2BKD N;  3OS5 A;  2LT1 A;  3TVT A;  1ZA1 B;  3G7Z A;  2E41 A;  5HK0 A;  3SB2 A;  2D6F A;  1Q7Y C;  1K76 A;  2J06 A;  5GAO r;  1RAH B;  3JCM b;  5EG2 A;  5FRN A;  3UT1 A;  5GAN g;  3REA B;  1M3C A;  1RI0 A;  5CKF A;  3H8Z A;  1MND A;  3VS5 A;  1RAB B;  3CC2 A;  3QXE B;  2KRN A;  4FSS A;  3HHT B;  3OYE A;  1E6H A;  3CC7 A;  3VU3 C;  1VA7 A;  5IAY A;  4C0D B;  1R0C B;  3M57 A;  1LCK A;  3CBM A;  1U06 A;  4KBM B;  1M5Q 1;  1UTI A;  1TG0 A;  4FSX A;  2RPN A;  1HJD A;  1VIE A;  1ZQ1 A;  2X4Y A;  1NYF A;  2KQW A;  1N8R U;  1EZZ B;  3M0U A;  4OP0 A;  3OS2 A;  1K9M R;  1K8A U;  3OYH A;  2QDY B;  4AG1 C;  3JRZ A;  3PIP A;  2SRC A;  2DKG A;  3BE3 A;  2GTO A;  3FB9 A;  2D0N A;  2RA2 A;  1VQ9 Q;  3GOX A;  1IGU A;  3VS1 A;  2EQJ A;  3VUB A;  2R5A A;  4NL3 A;  2BZY A;  4M7D A;  4Y91 A;  3G4S Q;  1PWT A;  1SKU B;  1G8X A;  4DOV A;  3EFO A;  3CCR A;  3O5Z A;  1H3Z A;  1V76 A;  4ZN3 A;  5GAO n;  5GAM f;  5DM7 R;  1MV3 A;  5HKC A;  2DL7 A;  1M2V B;  2RHI A;  2DYI A;  2QG9 B;  3RKX A;  1H92 A;  2CUB A;  4M77 D;  2DBM A;  1RI9 A;  5I2M A;  3BDL A;  4FU6 A;  4J6W A;  3CCR T;  3L42 A;  3G1J A;  4J9G A;  2AIR B;  1G3T A;  1WLP B;  1X43 A;  2C06 A;  1ZSZ A;  3F70 A;  3C12 A;  2FPE A;  4J7I A;  2F2W A;  4OGC A;  2K2V A;  1A0N B;  3CCQ A;  2BE9 B;  1Q82 C;  4RUG A;  1W2B A;  1H3H A;  4PJM A;  1AWJ A;  1NEB A;  2QAZ A;  3OYJ A;  3JCM f;  2C0I A;  4M7D C;  2DYB A;  2H3J A;  2ROT A;  2NWM A;  2DEU A;  2EPD A;  3M55 A;  1ZSG A;  4KH1 B;  3NFC A;  2X4W A;  3VYG A;  4DEY A;  1Y96 A;  3CC2 Q;  4HVW A;  1OUL A;  2CP3 A;  3O8V A;  3CC7 Q;  4RTW A;  2JXB A;  1YJ9 Q;  4BE0 A;  4MML A;  1YI2 T;  1VQM Q;  4RMO A;  1W70 A;  2A36 A;  2PTK A;  3UA6 A;  3FDR A;  4QVZ A;  3KBG A;  2FPD A;  2GQV A;  1VYU A;  4IUR A;  3LX7 A;  5C6S A;  3NTH A;  4LD6 A;  3M0T A;  3QWY A;  3EHR A;  3I5R A;  1M1G A;  5D6W A;  1ZSZ C;  3EGD A;  3RES A;  4GLM A;  2RNA A;  1W2B P;  1CKA A;  4E7S A;  4ZTF A;  3EH1 A;  2DJZ A;  4F7U F;  1QCO A;  2DL8 A;  2F2V A;  1WDX A;  3M0P A;  4QW2 A;  3PMI A;  3VRY A;  2KRO A;  2F5T X;  4MZM A;  1Y0M A;  3SEM A;  1VQ8 T;  1RL2 A;  1RLQ C;  1M90 C;  2XKO C;  3C0C A;  4CI0 C;  2KBT A;  2M9U A;  2K3B A;  4RTV A;  1T0H A;  3P8B B;  3QUI A;  3JCM W;  1FMK A;  4Z88 A;  3I56 T;  4A4K A;  4QQD A;  1I81 A;  1W4S A;  3GNG A;  9ATC B;  1VQ5 Q;  1GBQ A;  1GL5 A;  5FU7 C;  1YJN T;  2JOY A;  2EJF A;  1UJ0 A;  3PVQ A;  3CCM A;  3JCM Q;  3TCJ A;  3GPL A;  2OTJ A;  1WJR A;  1VQL T;  3CCQ Q;  4M78 A;  4PFO A;  1PD0 A;  2RJC A;  5GJW B;  2MF2 A;  4JS5 A;  1VQN A;  3CCS T;  4J9D A;  1GFC A;  3GF5 A;  4N0A A;  3A1P A;  2KI7 A;  1IHV A;  1R8O B;  2GCX A;  1Q82 R;  1LNX A;  2OTJ T;  2D8J A;  4F7U E;  2A08 A;  4JDS A;  5GAN d;  1JBM A;  2OTL Q;  3E9F A;  1S1N A;  4FT4 A;  2HNI A;  2NLU A;  1YCY A;  5CO7 A;  4E7J A;  4FIB A;  4X34 A;  5LJ3 f;  1I0C A;  2AZS A;  2ZPG B;  4BUG A;  1FYN A;  3CME T;  2RMO A;  1I07 A;  4PJN A;  2IVW A;  2BTT A;  1ZA2 B;  3M4Y A;  2WAC A;  1TUD A;  1JO8 A;  5GAN 8;  4RG2 A;  2QQB A;  4M78 C;  1AVZ C;  1MGQ A;  1YCS B;  4LE9 A;  3RR6 A;  2MK5 A;  2LNV A;  4CRI A;  2O4X A;  4M75 A;  3CCE A;  1OX8 A;  1X2K A;  3EGX A;  4XTX A;  4F14 A;  4CC4 B;  3PT9 A;  4J7F A;  4N0A C;  2KK4 A;  3L1A A;  5CK9 A;  2RJE A;  4N4I A;  3HRS A;  2J6K A;  5AT1 B;  1QVG A;  1Z9Q A;  4HCB A;  2DXC A;  3V7R A;  4DBQ A;  3M59 A;  3G6E Q;  1WJS A;  2A7Y A;  1KG1 A;  3RKY A;  1M90 R;  2L89 A;  4JRQ A;  2K57 A;  5KE3 A;  2LJ3 A;  4E6R A;  3RUX A;  1HD3 A;  2PVG B;  3ME9 A;  4HCK A;  4X9D A;  1NM7 A;  1VQ4 A;  2ROL A;  2Z0W A;  4JLI A;  1G3S A;  4GBQ A;  2O01 E;  3CCM Q;  1KQS A;  2LQN A;  3OYF A;  4PK4 A;  4FW2 A;  4R56 A;  1YP5 A;  2DL5 A;  5GMK m;  2O88 A;  4HKE A;  1NZ9 A;  2FPF A;  5GMK j;  1YIJ T;  4M75 C;  2OI3 A;  2V1Q A;  1M2O A;  4DOW A;  3CXC A;  1VQN Q;  4PNO A;  2B8A A;  4PKC C;  3CBO A;  4J9F A;  3TSW A;  2RQW A;  3FJ5 A;  2CP2 A;  5KYU B;  3LWH A;  1B07 A;  1LVK A;  1N9R A;  4FM4 B;  3PTA A;  1U1T A;  3G71 A;  2DNU A;  5KE2 A;  1NJI U;  2DX1 A;  2QYZ A;  3EGU A;  3SWN B;  1AZG B;  3P8H A;  3T9N A;  1BCM A;  2K3X A;  2KE9 A;  1BU1 A;  2QQ9 A;  2RHZ A;  3GIB A;  3CCL A;  3SHW A;  4KT0 E;  2X3X D;  5A0L A;  2GTJ A;  3JAM E;  1WQW A;  4BD3 A;  5GMK e;  3OA6 A;  5D6X A;  2CP0 A;  2OX7 A;  3KXT A;  3CXC P;  1AHJ B;  3CC4 A;  5KYW B;  4WTO B;  4C0D C;  2VV5 A;  2C0O A;  1D0Y A;  2RHY A;  1M2V A;  2XMF A;  3CCE Q;  3VS3 A;  2ZPI B;  1NLO C;  3CCV A;  2RD1 A;  2I0N A;  1IZ6 A;  1YNZ A;  2LQW A;  1S72 Q;  5CQX A;  4C5I A;  2X4J A;  1I5L A;  4M78 G;  1KSW A;  5I21 A;  3CC4 T;  5A2Q E;  2E6N A;  1K0S A;  4LD9 K;  3CCV T;  2GFA A;  2IIM A;  3NHN A;  4HT9 A;  2V1R A;  1YIT A;  3OQ5 A;  4E2F B;  3A98 A;  1ZBX A;  4J9H A;  4K11 A;  1VQ4 Q;  1WHK A;  1KC8 U;  1JXO A;  2DBK A;  4A53 A;  4KUL A;  4O5V A;  2DXU A;  1U5S A;  1V1C A;  4NOY A;  3CPW S;  2QQR A;  2HSP A;  1I4K 1;  1FXX A;  2ESW A;  4AFS C;  1XOV A;  2VYT A;  3RNJ A;  2YDL A;  5IXB A;  5I2S A;  1UHF A;  3AHU A;  4JJD A;  2G6F X;  2RQU A;  2HZY A;  3E9G A;  1B3Q A;  4C92 B;  1Y07 A;  4ME7 A;  1Q95 G;  1VIF A;  2QQS A;  2QDL A;  2O9V A;  3H0F A;  4M75 G;  1T0J A;  1UG1 A;  3OBW A;  3VS2 A;  3FC3 A;  4PJO B;  4LN2 A;  3L2Q A;  1K1Z A;  3JB9 F;  1Q86 C;  4C0Z A;  3G71 Q;  3URG A;  3QJ6 A;  3IQL A;  3X24 B;  4KUD K;  3CBP A;  5GAN j;  4XU0 A;  3OSV A;  1VQK Q;  2QXF A;  4RTZ A;  4HVV A;  3CCL Q;  1N6A A;  2FHD A;  1VQP A;  3OSS C;  1QKX A;  1RAA B;  4BE1 A;  2KGT A;  2DIG A;  2E3H A;  2YLB A;  4A63 B;  3V8J A;  1VQ9 A;  1B34 B;  4XTW A;  5GAN 4;  1YHQ A;  2M0O A;  1D09 B;  4Q5W A;  1QLY A;  3QG1 A;  2DET A;  3V8K A;  4ORZ A;  5I11 A;  4RG8 A;  7AT1 B;  3ULR B;  4R0K A;  5GMK i;  3M0Q A;  1C1A A;  5GAN e;  1QP2 A;  1VQ9 T;  1SEM A;  4IUT A;  2Y4X A;  4QQ6 A;  3EGX B;  5AYF A;  3G4S T;  2JS2 A;  4JUV A;  1LOJ A;  2B86 A;  2EYW A;  1YIT Q;  4LDW A;  1X01 A;  1ZLM A;  2RM4 A;  1VYV A;  3OS1 A;  4M7A E;  1NE8 A;  2KAF A;  2F69 A;  5CR2 A;  3J80 E;  3RER A;  1OOT A;  2CP5 A;  2CS7 A;  2H8H A;  1PCX A;  2WSC E;  4ELY C;  1QKW A;  2DD4 A;  2XDD A;  2X4X A;  4OMM A;  3A8L B;  1OEB A;  2JTM A;  4CC3 A;  1ABQ A;  2RK2 A;  3NTK A;  5IHN A;  2RJF A;  3TRE A;  3THK A;  2CSQ A;  3HPW A;  2VGM A;  1WYX A;  4HA8 A;  4YTL A;  5CCA A;  2HKQ B;  3EG2 A;  3EH2 A;  4M77 B;  1JJ2 A;  4F17 A;  3UF4 A;  1PRL C;  3PFS A;  4C8Q E;  1YJ9 A;  1VQM A;  2JM8 A;  4CC2 A;  1BI1 A;  1CSK A;  1SSF A;  2VC8 A;  3OYN A;  2ECZ A;  3GNF B;  3M54 A;  3LWI A;  4LUD A;  3RKW A;  5FU6 B;  4IUU A;  3CC2 T;  4FYX B;  1AWO A;  1Q86 R;  3CC7 T;  1VQP Q;  1M1K U;  1YJ9 T;  4XU1 A;  3VV0 A;  1VQM T;  2LP5 A;  1UJY A;  1QVF S;  1D1C A;  2K9G A;  2QTX A;  3CPF A;  1ZUY A;  2Y90 A;  3HL8 A;  1UGQ B;  2PNI A;  1TSF A;  1YHQ Q;  2HBP A;  4QQG A;  3WVD B;  3MHX A;  2E6Z A;  2YLC A;  1JJ2 P;  4ELZ C;  2E64 A;  3H6Z A;  1M8M A;  2EKH A;  1IHW A;  4QVC A;  4Y28 E;  3VRZ A;  2ED0 A;  5LJ5 d;  2BZX A;  2KMT A;  1Q81 R;  5GAO m;  4E7H A;  2EIF A;  4A54 A;  1VQ5 A;  4JRI A;  3PE0 A;  2EQU A;  2XHC A;  4JZ3 A;  1YWO A;  2MYS A;  3MJX A;  4OB1 B;  3OYY A;  1RAG B;  2DD5 A;  1W1F A;  1KD1 C;  2KT8 A;  5KYU A;  4WCI A;  1O9S A;  2BZ8 A;  2AK5 A;  2D0Q B;  3QZ9 B;  4OMN A;  4RTU A;  3R6O A;  1VQ5 T;  1UDL A;  4EMK A;  5CKB A;  2HMA A;  2DK3 A;  1QCF A;  1UGS B;  3SWN A;  1M3B A;  3OYB A;  2AKK A;  3FJP A;  4L6V 5;  2O2O A;  1VQ6 Q;  2AKL A;  5FLX E;  5GAO q;  3I55 Q;  1Q7Y R;  3MEU A;  2OJ2 A;  3CCQ T;  3CCJ A;  1OU8 A;  1QWF A;  1NJI C;  3PMT A;  2EGC A;  2OTL A;  1IRX A;  4ZGD B;  2CZ0 B;  2K5F A;  4O6J A;  1OQK A;  2A3L A;  5KYW A;  4M7A D;  2V8J A;  3I9Q A;  2DRK A;  5KYY B;  8AT1 B;  1J3T A;  3TSZ A;  2CDT A;  3QYG B;  4EIK A;  2CSI A;  2XDP A;  3JCM P;  3JB9 D;  1RAI B;  4X9C A;  2LZ6 B;  3PIO A;  2A0F B;  2JJ9 A;  2OTL T;  1T3L A;  3OYG A;  2NUP B;  3OMC A;  3UWN A;  4M7D F;  2XD0 A;  5L8R E;  1FMV A;  1PNJ A;  1SRL A;  4XU3 A;  4GY5 A;  3R6N A;  2ZGW A;  1KJW A;  2GGR A;  1OX9 A;  1MMG A;  4BAC A;  1K9M U;  4EDU A;  3SWN C;  3L2U A;  4XK8 E;  1N5Z A;  2FL7 A;  2M1H A;  4PL6 A;  3TU4 K;  4C8Q D;  2VVK A;  4MDX A;  1KHC A;  1UHC A;  2CGH A;  2VKN A;  1UGR B;  1SHG A;  4J9C A;  4JZ4 A;  3UDC A;  2QTV A;  1BCO A;  4A4G A;  3BW1 A;  3G6E A;  1O75 A;  2EYY A;  2PVO B;  4HCZ A;  1QMC A;  2DO3 A;  2LJ1 A;  1SG5 A;  3LH0 A;  1KC8 C;  3JCM X;  4RTY A;  3UAT A;  3P8D A;  4N4H A;  1W6X A;  1H8K A;  1W2B S;  4GLK A;  2NUT A;  3G6E T;  4C92 A;  2RN8 A;  1HYO A;  1OZ3 A;  1Y57 A;  4UC4 A;  1WX6 A;  4EPC A;  4JPB W;  4LDV A;  1MHN A;  4PJO A;  1GXI E;  3FLG A;  2LCS A;  2LTO A;  4D8D A;  1KD1 R;  2CKK A;  1UEC A;  5FWB A;  1GFD A;  2MPX C;  2CH4 W;  3QO3 A;  3CCM T;  2KNB B;  3CCJ Q;  4M7D E;  4JJN K;  3L2R A;  1SSH A;  1VQN T;  3HFO A;  5DY9 A;  2CUD A;  2LVM A;  2RHU A;  1K4U S;  3D7S B;  3X20 B;  2DTO A;  1I1J A;  1B34 A;  3QDF A;  1WHM A;  1NJI R;  1X27 A;  4ANJ A;  2CZ6 B;  1UE9 A;  2L3R A;  4C5E A;  4C92 C;  2K6D A;  5EC7 A;  4XTU A;  3CQT A;  2KRM A;  4PFZ A;  4PJO C;  5GAN 6;  3WXM B;  3CCU Q;  2O31 A;  2XDB A;  1G5V A;  5CIU A;  5CKE A;  4RKU E;  2JTE A;  2DE0 X;  3WVE B;  8ATC B;  1T3S A;  1S72 A;  1BYM A;  2YSQ A;  4FW1 A;  4E7K A;  2YUO A;  1SPK A;  2BE7 D;  4LXC A;  3M58 A;  2EKO A;  3CCE T;  3QSU A;  4L59 A;  1Y71 A;  3FEO A;  1WHH A;  3ZBD A;  4FYY B;  2QGF B;  2M02 A;  2F5K A;  2HL5 C;  5LJ5 j;  1S72 T;  3VS0 A;  2OAU A;  2L5Q A;  4M78 F;  4KGV B;  1VUB A;  2LMJ A;  3OW2 A;  2R57 A;  1K73 C;  2E70 A;  2QK0 A;  4LDU A;  4M77 A;  4QT7 A;  3DLM A;  3X28 B;  2L3P A;  4E47 A;  5J39 A;  1ZHI A;  2LDM A;  3DLL A;  2X3W D;  3M0R A;  4F7U B;  5IHI A;  1LPL A;  1VQ4 T;  2VXF A;  5GAN f;  1QVG P;  1WJQ A;  3M9Q A;  4OMQ A;  1V29 B;  5IN1 A;  1WHL A;  2A28 A;  5LJ5 e;  1D1B A;  1SF9 A;  2DZ9 A;  4XTZ A;  5FW9 A;  1G2B A;  3CMA Q;  2COZ A;  2E65 A;  4EMK B;  1G3Y A;  2KXD A;  4A4H A;  3OW2 P;  1YJW Q;  1N8R C;  2BIV A;  5LJ5 h;  3JCM g;  2HEQ A;  2JNG A;  5KYX A;  1VQK A;  1K8A C;  1KQS P;  1M27 C;  3MPU B;  2WSE E;  4A4F A;  3S3M A;  4M75 F;  2P0K A;  3G71 T;  1SRM A;  2KDS A;  4M77 C;  3QBY A;  5D6Y A;  4M7A A;  1TXQ A;  1WFW A;  1XJW B;  2GBQ A;  2DFU A;  1VQK T;  4DEX A; 
#chains in the Genus database with same CATH homology
 4IUT A;  1D3B A;  2Y4X A;  3A8O B;  3QII A;  1BIA A;  4J7I A;  3LLR A;  2RI2 A;  2RJD A;  4QQ6 A;  2L8D A;  2Y4Y A;  4C92 G;  3CME A;  2JUF A;  5AYF A;  3G4S T;  5FRO A;  4E7J A;  4OGC A;  4JUV A;  2EJ9 A;  1LOJ A;  2K2V A;  2MAM A;  3CCQ A;  4M78 E;  2PUK B;  4LDW A;  5LJ5 g;  1X01 A;  2RM4 A;  5FU6 C;  4M7D D;  4PJO G;  1Q82 C;  1QVG S;  1W2B A;  3S6W A;  4M7D G;  4JLG A;  3CMA T;  4F7U G;  3OS1 A;  3MEW A;  4C5H A;  4M7A E;  2EJG A;  2FB7 A;  1NE8 A;  2LCL A;  3JCM f;  3OYJ A;  4M7D C;  4C0G A;  1QP3 A;  2KAF A;  2QQA A;  3OS0 A;  1YJW T;  2H3J A;  2F69 A;  5DLO A;  5GAM e;  5CR2 A;  3M55 A;  3J80 E;  3VKI A;  3NFC A;  1N9S A;  2X4W A;  4BI8 B;  3RER A;  4MMK A;  3VYG A;  2CS7 A;  2WSC E;  1Y96 A;  4ELY C;  2XI9 A;  3M53 A;  3O8V A;  2DD4 A;  2K5L A;  2XDD A;  1KQ2 A;  3MP8 A;  2X4X A;  4KUI A;  3A8L B;  5KH6 A;  4BY6 B;  4C8Q A;  2JTM A;  2JTF A;  4MML A;  4BE0 A;  3MEA A;  2RK2 A;  1VQO A;  1YI2 T;  3OYI A;  1KQS S;  4ZGE B;  5GAM h;  2XG8 D;  3NTK A;  2RJF A;  4TVR A;  3TRE A;  4RMO A;  3HPW A;  1OI1 A;  1UEB A;  2VGM A;  3FDR A;  1EIF A;  2V8I A;  4QVZ A;  4HA8 A;  1H64 1;  3KBG A;  1WNL A;  2GQV A;  3CXC S;  1M90 U;  4IUR A;  4PLL A;  4YTL A;  3LX7 A;  5CCA A;  5C6S A;  3NTH A;  4LD6 A;  4M77 B;  4OB2 B;  2EQM A;  1IRE B;  1M1G A;  2GFU A;  1M8V A;  1YIT T;  1M1F A;  5D6W A;  3ASK A;  1JJ2 A;  4C92 F;  2RK1 A;  3RES A;  4IUV A;  5M9O A;  1VQO T;  3SFM A;  2PVD B;  3PFS A;  4MZT A;  4C8Q E;  3A8H B;  1YJ9 A;  1VQM A;  4VUB A;  1BI1 A;  4DA4 A;  4PJO F;  2R5M A;  2KVQ G;  1SSF A;  2VC8 A;  3OYN A;  4ZTF A;  2DJZ A;  3NTI A;  4F7U F;  3JCM e;  2BUD A;  3GNF B;  3M54 A;  2PU9 B;  3LWI A;  1UB4 A;  3RKW A;  5FU6 B;  4M75 E;  4QW2 A;  3CD6 A;  4IUU A;  3PMI A;  5GAM g;  3CC2 T;  2PQW A;  2ZPE B;  5FRM A;  4Z02 A;  1M9S A;  4ZN1 A;  4IKF A;  3N5B B;  3CC7 T;  1M1K U;  4M7D B;  2F5T X;  1YJ9 T;  4XU1 A;  4MZM A;  2CYZ B;  3VV0 A;  1VQM T;  3JCM h;  1VQ8 T;  1RL2 A;  1YIJ A;  3JCM J;  1QVF S;  4NS5 A;  1M90 C;  2LRQ A;  5LJ3 h;  2EWN A;  2QTX A;  4RCC A;  2XKO C;  4XAX B;  1XTD A;  1XNI A;  3CPF A;  4CI0 C;  2Y90 A;  2LT4 A;  1UGQ B;  2M9U A;  3HL8 A;  5KCO A;  3S3O A;  3A5Z B;  5LL6 S;  1P92 A;  3P8B B;  3QUI A;  3JCM V;  3JCM W;  3V7S A;  3OYA A;  2YHT A;  2HBP A;  4QQG A;  3I56 T;  2FYK A;  3WVD B;  4A4K A;  3MHX A;  2E6Z A;  4QQD A;  2YLC A;  4HCC A;  1BKB A;  4LDX A;  1KD1 U;  4ELZ C;  1I81 A;  1W4S A;  2E64 A;  3GNG A;  2DVE A;  3H6Z A;  5HY6 A;  1FWZ A;  4XQ3 A;  2MWP A;  3CPW A;  3EFR A;  4C5G A;  4QVC A;  4Y28 E;  1Q82 U;  5FU7 C;  3J81 E;  1YJN T;  2JOY A;  3MET A;  3OYL A;  5LJ5 d;  4BI4 A;  3X25 B;  3VYH B;  2QI2 A;  1M1K C;  2EJF A;  2KMT A;  2V8K A;  1D3B B;  3CCM A;  3VJP A;  5LJ3 g;  3JCM Q;  1VQP T;  1OYX A;  3TCJ A;  3GPL A;  3CCL T;  1WJR A;  2OTJ A;  5GAO m;  1BI2 A;  4M77 G;  4E7H A;  1VQL T;  2XIC A;  1VQ7 A;  4M78 A;  2EIF A;  2RJC A;  3VUZ A;  2MF2 A;  4A54 A;  1VQ5 A;  4JS5 A;  1JB0 E;  3GLX A;  4JRI A;  4JRP A;  1VQN A;  1HK9 A;  1WPY A;  2EQU A;  2XHC A;  3CCS T;  3QPH A;  4FT2 A;  3JCM c;  3GF5 A;  4J83 A;  4N0A A;  3RIR A;  4EMH A;  2HQX A;  4C92 E;  2P0P A;  2P4T A;  3OYY A;  1R8O B;  2E10 A;  2GCX A;  2X35 A;  2XK0 A;  4OB1 B;  2DD5 A;  1KD1 C;  2QA4 A;  1LNX A;  4II1 A;  2OTJ T;  1O9S A;  3HRU A;  3HSB A;  2DIQ A;  1Y96 B;  2VUB A;  2DTH A;  4OVA A;  2D0Q B;  4PJO E;  3LGL A;  3QZ9 B;  3R6O A;  4F7U E;  1VQ5 T;  4JDS A;  2LQ8 A;  5GAN d;  1YHQ T;  1YBY A;  4P5N A;  1JBM A;  1TH7 A;  4OB3 B;  1JRI A;  4EMK A;  5CKB A;  3E9F A;  4IUQ A;  2DK3 A;  1QVP A;  4FT4 A;  2HNI A;  2NLU A;  1UGS B;  4L5G A;  2G3R A;  3JSC A;  1YCY A;  4OMF B;  5CO7 A;  3SWN A;  4OF1 A;  3ZFJ A;  4FIB A;  4X34 A;  5LJ3 f;  3OYB A;  3UPU A;  3FJP A;  3INZ A;  3L2Z A;  3M4G A;  2CZ7 B;  2ZPG B;  4L6V 5;  4BUG A;  3CME T;  2D9T A;  5GMK h;  2QA4 T;  5FLX E;  3OYD A;  2HD0 A;  3LW5 E;  5LJ3 j;  5GAO q;  3MP1 A;  3MEU A;  3OW2 S;  3CCQ T;  3CCJ A;  2RI5 A;  5KCH A;  2IVW A;  5FU7 B;  3QHS A;  2RH2 A;  1BI0 A;  1NJI C;  4DQ2 A;  4V2S A;  1PSE A;  3PMT A;  3GP8 A;  4M78 D;  5CQY A;  4M77 F;  1U8R A;  3M4Y A;  4PJO B;  2WAC A;  1QW1 A;  3FIF A;  2OTL A;  5GAM d;  4ZGD B;  2CZ0 B;  2K5F A;  2KSS A;  3OY9 A;  3QJY A;  4O6J A;  3LYI A;  5GAN 8;  2EYQ A;  4BDY A;  4RG2 A;  2A3L A;  4M7A D;  4J6X A;  2V8J A;  2E5Q A;  2QQB A;  2HQE A;  3BY7 A;  4M78 C;  4XU2 A;  1MGQ A;  3L2W A;  4J6Y A;  4M7A G;  4WF2 A;  4OGE A;  2LNV A;  3S3N A;  2E1H A;  4CRI A;  1LJO A;  2O4X A;  4M75 A;  3QYG B;  3CCE A;  1VQ6 A;  4XTX A;  3TEE A;  3X26 B;  4HT8 A;  2XDP A;  3I55 A;  4OB0 B;  2P0Q A;  3LGF A;  3PT9 A;  3JCM P;  3JB9 D;  4M7A C;  4X9C A;  4MZP A;  2M16 A;  4JRK A;  3OYK A;  4ZGJ B;  3JB9 G;  4J7F A;  2ZPH B;  4N0A C;  3PIO A;  5CKH A;  2KK4 A;  3L1A A;  5CAI A;  5CK9 A;  2OTL T;  4FL6 A;  1NPR A;  3OYG A;  3OMG A;  2I2L A;  4IUP A;  3OMC A;  2RHX A;  3UWN A;  2RJE A;  4N4I A;  4M7D F;  3HRS A;  2XD0 A;  5L8R E;  1QVG A;  1NPP A;  1X75 C;  4HCB A;  2DXC A;  2XID A;  3V7R A;  4XU3 A;  4GY5 A;  3M59 A;  2DXT A;  1VQ6 T;  2ZGW A;  3J7A F;  1WJS A;  2DEQ A;  3KUF A;  3I55 T;  5LJ3 e;  4BAC A;  1U1S A;  2A7Y A;  2EQK A;  3A8M B;  1M4Z A;  1K9M U;  1VQK T;  1KG1 A;  3RKY A;  4EDU A;  2L89 A;  3SWN C;  3L2U A;  4XK8 E;  3E19 A;  2FL7 A;  2PUO B;  2M1H A;  3MP6 A;  4ATO A;  5A0D A;  2K5I A;  3JCM d;  4JRQ A;  2MMP A;  4LDY A;  4PL6 A;  3TU4 K;  4C8Q D;  4MDX A;  1KHC A;  2CGH A;  2K57 A;  4NL2 A;  3V7C A;  1UGR B;  2ZCF B;  3RUX A;  4C8Q G;  5KE3 A;  1Q7Y U;  2PVG B;  3ME9 A;  4X9D A;  2K3Y A;  1VQ4 A;  2DXB A;  4JLI A;  5DLQ E;  1G3S A;  2ZPF B;  3UDC A;  4C8Q C;  3CD6 T;  4A4G A;  4E7I A;  3BW1 A;  2O01 E;  3G6E A;  1O75 A;  4M7A F;  2PVO B;  4M75 D;  1KQS A;  3OYF A;  4HCZ A;  2QEX A;  4R56 A;  3DKM A;  2DO3 A;  5GMK m;  4HKE A;  1NZ9 A;  3DB4 A;  3QYH B;  4M78 B;  3LH0 A;  2LCC A;  1FX7 A;  4XTY A;  5GMK j;  3JCM X;  1YIJ T;  1KC8 C;  4M75 C;  3PGG A;  4DOW A;  3CXC A;  3RMS A;  4PNO A;  2XU8 A;  1I8F A;  3P8D A;  2B8A A;  4J8O A;  3PNW C;  2VGN A;  4N4H A;  4M7A B;  2K4Y A;  4PKC C;  3CBO A;  1K9M C;  1W2B S;  3HP9 A;  4GLK A;  4R55 A;  3G6E T;  2FVU A;  3L2V A;  1DJ7 B;  4A4E A;  4C92 A;  3JB9 I;  1OZ3 A;  2YRV A;  3EFS A;  2WSF E;  3MO8 A;  4UC4 A;  4M77 E;  4EPC A;  5GAN 3;  3JB9 H;  3OBY A;  2QEX T;  3QDR B;  3LWH A;  4LDV A;  1MHN A;  4MDW A;  4PJO A;  1GXI E;  3FLG A;  2AHJ B;  1N9R A;  2LX9 A;  4F7U A;  4FM4 B;  2LTO A;  4N4G A;  5GAN 2;  3PTA A;  4E7L A;  5CKD A;  3EAE A;  1U1T A;  3G71 A;  3C94 A;  2R58 A;  5KE2 A;  1NJI U;  2CKK A;  2ZPB B;  4C8Q F;  2EFI A;  3MEV A;  3SWN B;  3P8H A;  3QO3 A;  3T9N A;  3CCM T;  2K3X A;  3HKS A;  3C95 A;  2QQ9 A;  2RHZ A;  3GIB A;  3CCL A;  5C0M A;  4J5Y A;  4KT0 E;  5A0L A;  1VQ7 T;  1QVF A;  1KQ1 A;  4M7D E;  3DB3 A;  1WGS A;  3G4S A;  4JJN K;  3JAM E;  4ZTJ A;  3L2R A;  1WQW A;  4BD3 A;  5GMK e;  3OA6 A;  5D6X A;  4C8Q B;  3KXT A;  1Q81 C;  1VQN T;  3HFO A;  4D6W A;  5DY9 A;  4QVD A;  1JJ2 S;  1AHJ B;  2LVM A;  2RHU A;  2VXE A;  3CC4 A;  3X20 B;  2DTO A;  4C0D C;  2VV5 A;  1B34 A;  2RHY A;  4XTV A;  2GF7 A;  1PSF A;  3M56 A;  4C92 D;  2O4X B;  4M75 B;  2ZPI B;  2CZ6 B;  3CCV A;  2RD1 A;  5GAO l;  4BB7 A;  1IZ6 A;  2L3R A;  4C5E A;  3MCA B;  4PJO D;  5IT9 E;  4BI3 A;  4C92 C;  5CQX A;  3V8L A;  4C5I A;  5GAN h;  2X4J A;  1I5L A;  1BI3 A;  4XTU A;  4M78 G;  2ZZD A;  1YI2 A;  2E12 A;  5A0G A;  3OYC A;  1HXD A;  5I21 A;  3CC4 T;  2RI3 A;  3BDU A;  4PJO C;  5GAN 6;  5A2Q E;  3WXM B;  2XDB A;  1G5V A;  3HFN A;  2E6N A;  4BE2 A;  3CEY A;  5CIU A;  4LD9 K;  1X6O A;  5CKE A;  3OYM A;  3C4S A;  3CCV T;  2DTI A;  3CCJ T;  2KY9 A;  2GFA A;  4RKU E;  3E1S A;  1K73 U;  3WVE B;  2BKD N;  3OS5 A;  4HT9 A;  2LT1 A;  1YIT A;  3OQ5 A;  4C0F A;  3SDZ A;  1S72 A;  1G3W A;  3G7Z A;  3Q1J A;  1BYM A;  2E41 A;  5HK0 A;  3SB2 A;  1ZBX A;  2D6F A;  1Q7Y C;  5GAO r;  3QKJ A;  4RCB A;  4E7K A;  1XQH A;  3JCM b;  3OB9 A;  5EG2 A;  1KC8 U;  2DAQ A;  4BDZ A;  4A53 A;  4KUL A;  3CCU A;  5FRN A;  3HRT A;  2IG0 A;  2EKO A;  3M58 A;  4O5V A;  2DXU A;  3UT1 A;  5GAN g;  1Q86 U;  3CCE T;  3QSU A;  1RI0 A;  5CKF A;  4NOY A;  3CPW S;  3A8G B;  1Y71 A;  2QQR A;  3FEO A;  3H8Z A;  4L59 A;  4EMK C;  1N27 A;  3ZBD A;  1I4K 1;  1FXX A;  5LJ5 f;  3CC2 A;  3FRN A;  3QXE B;  5GAO p;  1XOV A;  2F5K A;  5LJ5 j;  4PLI A;  1S72 T;  3HHT B;  3OYE A;  3CC7 A;  2VYT A;  3VU3 C;  5IAY A;  4C0D B;  1Y7X A;  2OAU A;  2LQK A;  1VQ8 A;  2L5Q A;  3M57 A;  5GAN 5;  5LJ3 d;  2JVV A;  5I2S A;  3CBM A;  4EMG A;  4M78 F;  3CCU T;  4KBM B;  3AHU A;  1VUB A;  2RB6 A;  1UGP B;  1M5Q 1;  3OW2 A;  2R57 A;  1K73 C;  3E9G A;  4FSX A;  3ZEH A;  1VIE A;  3RMQ A;  2E70 A;  1ZQ1 A;  4C92 B;  1Y07 A;  3BFM A;  2X4Y A;  4LDU A;  4ME7 A;  5J26 A;  4M77 A;  1VIF A;  2QQS A;  3DLM A;  2KQW A;  4M75 G;  3X28 B;  1N8R U;  4E47 A;  3OBW A;  4OP0 A;  5J39 A;  3I56 A;  3FC3 A;  3L2Q A;  3OS2 A;  1ZHI A;  2LDM A;  3OYH A;  3DLL A;  3M5A A;  1OZ2 A;  1K8A U;  2QDY B;  3JB9 J;  3JB9 F;  4F7U B;  3JRZ A;  3PIP A;  1Q86 C;  4C0Z A;  2JZ2 A;  2RO0 A;  2DKG A;  1VQ4 T;  2VXF A;  5GAN f;  3URG A;  2DZC A;  3FB9 A;  3QJ6 A;  1BIB A;  3X24 B;  4KUD K;  1WJQ A;  3CBP A;  3M9Q A;  5GAN j;  1Q81 U;  2CZ1 B;  2RA2 A;  4XU0 A;  3OSV A;  3GOX A;  1YJN A;  2QXF A;  1V29 B;  2EQJ A;  3VUB A;  3SD4 A;  3ER0 A;  5IN1 A;  1N6A A;  2FHD A;  2R5A A;  4NL3 A;  4B9W A;  5LJ5 e;  4Y91 A;  1VQP A;  4M7D A;  5CVI A;  3OSS C;  1VQL A;  4DOV A;  3CCR A;  2DZ9 A;  4XTZ A;  1H3Z A;  4BE1 A;  2DIG A;  2E65 A;  5GAN 7;  4EMK B;  2EAY A;  1G3Y A;  2YLB A;  4ZN3 A;  5GAM f;  5DM7 R;  5GAO n;  4A4H A;  3CCS A;  4BY6 C;  4B9X A;  2MI6 A;  1N8R C;  3V8J A;  2BIV A;  5HKC A;  3JCM g;  5LJ5 h;  1VQ9 A;  1B34 B;  2JNG A;  5GAM j;  4XTW A;  2RHI A;  5HK3 A;  5GAN 4;  1K8A C;  1VQK A;  3QZ5 B;  1YHQ A;  2M0O A;  3RKX A;  2HAX A;  4Q5W A;  2WSE E;  4M77 D;  4JS4 A;  2DPP B;  3QG1 A;  5J3B A;  5GMK l;  5I2M A;  2MWO A;  3BDL A;  1WQ7 A;  4FU6 A;  3V8K A;  4M75 F;  4A4F A;  4J6W A;  3CCR T;  3S3M A;  3L42 A;  2P0K A;  4RG8 A;  1KHI A;  3G71 T;  2KDS A;  4M77 C;  3CMA A;  3QBY A;  5D6Y A;  4M7A A;  1G3T A;  5GMK i;  5GAN e;  1QP2 A;  2LC4 A;  1VQ9 T;  2C06 A;  3F70 A;  2JN0 A;  1YJW A;  3C12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...