4KUIA

Crystal structure of n-terminal acetylated yeast sir3 bah domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
201
Chain Sequence
KTLKDLDGWQVIITDDQGRVIDENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Regulatory protein SIR3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 53
structure length 201
sequence length 213
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kuiA00
4FT4A 1ZBXA 4BB7A 4JJNK 3PTAA 4DOVA 4FT2A 4FSXA 4KUDK 1W4SA 4DOWA 4LD9K 2FL7A 2FVUA 3PT9A 3TU4K 1M4ZA 4DA4A 4KULA 4KUIA 1ZHIA
chains in the Genus database with same CATH superfamily
1WHGA 2ATCB 3VUBA 4D8DA 5DM7R 1D1CA 5DLOA 3X20B 3PMTA 1YJNQ 3V7CA 1GCQA 1UTIA 3JB9I 4M77F 2BKDN 2DZCA 1OULA 1OOTA 3CCLT 1UDLA 3X24B 4E7HA 2HQHA 3OBWA 2PU9B 1T0HA 3TSWA 5DY9A 2QDYB 1U1TA 2JS0A 2MMPA 2H3JA 5KCOA 1GBQA 4M7AE 2QQ9A 4ZGJB 1H641 2V1QA 3CCLA 4C8QC 2JJ9A 1RAFB 4C5HA 1T0JA 3JB9J 4XU3A 2HZYA 2P0KA 1S1NA 3JCMP 2RHXA 1M30A 4BY6C 1VYUA 3H0IA 3CD6Q 1B07A 4CC4B 5GAOm 2DL3A 3JB9H 3CMAQ 3L2ZA 4QW2A 1QVGA 2EVRA 4QQ6A 2DRMA 3VKIA 1AT1B 4R55A 1I81A 1KHCA 2JTEA 2QQAA 1NYFA 1M1KU 2HKNA 4XU0A 4M7DA 2EGCA 3G4ST 2EYXA 2FZGB 3TREA 1Q86C 1V29B 3G71T 1TUCA 1MNDA 2RHIA 2X3WD 3OY9A 3OYLA 4CC3A 4FYVB 3HL8A 3OYMA 1MGQA 1SSFA 1LOJA 3I55T 4L6V5 2X4WA 4LDUA 2RM4A 3DB4A 4J9IA 4DA4A 1YI2A 1JXMA 2ZPIB 4NOYA 1WXUA 4OB0B 1ZLMA 3H0FA 4CI0C 2HEQA 2ED1A 1PHTA 2YDLA 1FWZA 5GMKm 3GP8A 3G71A 3CC7Q 1GCPA 1Q82R 2YT6A 5D7UA 4FU6A 4LNPA 3QG1A 3PT9A 2ZAEA 1QCOA 2M0OA 1KQSS 1H92A 5HCKA 3HRSA 5LL6S 4FM4B 3U23A 1PC0A 1X6OA 5FWBA 2EWNA 1I4K1 4PK4A 2RJCA 4F7UG 3L2WA 1G3TA 2MAMA 1N9RA 2QA4T 4M78G 2EFIA 4O5VA 2EJ9A 2EKOA 1A0NB 4BACA 2CZ1B 4DEXA 1VA7A 5M9OA 1VQ8A 1B34A 1M1GA 3OYYA 5D6YA 1BI1A 4N4IA 2DXCA 2QA4A 4KRTA 4J7FA 2J6FA 3M0QA 2I0NA 1AWJA 2GNCA 1NJIC 3CPWA 3HTRA 1Q86U 2JN0A 4OMLA 3RDVA 2MCNA 1NZ9A 4KBMB 4JPBW 1SG5A 3SFMA 2KRSA 1QP3A 5CCAA 3META 2DL8A 5FRNA 4L59A 1WPYA 5GAN7 1KC8R 1OU8A 3JB9F 1IZ6A 1WDXA 5GAMg 4C5IA 4M7DB 1NE8A 2GQIA 3EG2A 4PJJA 1KG1A 1MMDA 4C8QE 3OYEA 4JJNK 2AKLA 3MEAA 3E2UA 2HL5C 2RNAA 4TVRA 1Y71A 1W2BA 1JQQA 4BI8B 4A54A 5GMKl 5GAN3 2DIQA 1RAAB 2YXYA 2HBPA 4J6WA 3EHRA 3E19A 4XTVA 1PSFA 2E6ZA 1U8RA 4IUQA 5CQXA 3TVTA 2DLPA 3TEEA 1YHQQ 1P92A 2DERA 1MMAA 1SHGA 3CPWP 2K2MA 1I07A 1S72T 1FMVA 4X9DA 4QQGA 4QVDA 1Q81R 4M75A 3OW2S 1AEYA 2MF2A 1JRIA 2X4JA 1TTHB 4HVWA 4A4EA 4GY5A 1I0CA 3A5ZB 4XTWA 3MPUB 2QI2A 2RH2A 2DIGA 2VYTA 3OS0A 4C92D 2RI2A 1VQLA 3E9GA 3L2VA 1S72A 4IUPA 4M75D 2DNUA 1BCOA 1UGVA 1YFNA 2ZPBB 4PJOG 1FMWA 1NJIU 4X1VA 1RLPC 2NUPA 3CC2Q 2A08A 3EGXA 2ZPGB 3CCJT 1W2BP 3LWHA 1VQNT 4XTUA 3CCRA 3S3NA 1YCYA 1B34B 2DPPB 3S3MA 1ZHIA 8ATCB 2JOYA 4WCIA 2CP7A 5IXFA 1IHWA 3SWNA 1RABB 1G83A 4F17A 1Y7XA 3V8KA 1VQPT 5CAIA 3X25B 1N6AA 2ENMA 3THKA 1QVFA 2CT3A 1G5VA 4A4HA 1ZUKA 3EFOA 4EMKC 1QW1A 3INZA 1VQNA 4CRIA 3V8JA 3EG0A 5L8RE 5GAN4 3SB2A 4JS4A 4KGVB 3VS5A 3C95A 1ZBXA 3M53A 1YNZA 5J26A 1H3HA 2CP5A 2P0PA 1U5SA 2J05A 1TXQA 1VQPA 3MCAB 1KD1U 3VRYA 2KY9A 1ZSZA 5HY6A 4HCBA 2K5FA 2XICA 4VUBA 1JJ2S 1LJOA 2L89A 3EGDA 4GBQA 1Q7YR 3VRZA 1UECA 1UE9A 2VUBA 2ZPHB 4ATOA 2KEAA 2HL3A 1M3BA 4J6XA 1VQOT 2J6KA 4M77D 4R0KA 2D0NA 4C92G 2W10A 4E2FB 1R0BG 2RQTA 4HT8A 2COWA 3CC4Q 2XU8A 2LNVA 3VS0A 2K5IA 2RHUA 2VB6A 2EYWA 2CH4A 4K11A 1NM7A 3GPLA 3JSCA 1KHIA 4M75B 3QUIA 4JRQA 2EQIA 2LTOA 3WVEB 1C0MA 4M7DC 3X28B 2P4TA 4LD6A 3FRNA 5CKEA 1WXBA 3DLLA 3CCMT 4OMMA 2NLUA 2FG0A 1M2OA 3FJPA 3JAME 4M7AF 3JCMW 2VC8A 1YJWT 4KUIA 1WHHA 3CXCS 5A0DA 3GIBA 2CREA 2RHYA 2F5KA 1X6GA 3LGLA 5LJ5g 2NUPB 1VQ7T 1IO6A 3EGXB 4WTOB 1BK2A 4DBRA 3JCMd 5CIUA 4J9CA 3OS1A 1XNIA 1K9MR 3CCMA 4HCCA 4Z88A 2KNBB 3BE3A 3JCMe 2X35A 3SWNB 5CK9A 3RMSA 1YN8A 2F1LA 1YWPA 3H8ZA 3EG9A 4Y91A 2BE7D 3EFOB 3EFRA 1QP2A 3QYGB 4FSXA 2ZCFB 2K3BA 1QMCA 2ROTA 3EAEA 1G3YA 3SDZA 2LNHB 2A37A 3UT1A 3CMET 4M77G 1W1FA 1MMGA 2GQVA 1HXDA 1ZSZB 4JZ4A 2E12A 2RMOA 1G3SA 1KQSP 1U06A 2EKHA 4OMOA 2DXUA 4EMHA 3ULRB 2M02A 5HKCA 2DX1A 4KGXB 3A8GB 1WA7A 2YLCA 4R56A 2DTIA 1EIFA 2QQRA 1YI2Q 9ATCB 3CMEA 1OI1A 2FPDA 5I2MA 2LQNA 2MPXC 1RLQC 4A63B 3OYFA 3PMIA 1D1BA 1ZBJA 4QT7A 3QO3A 2BE9B 1RACB 1QKXA 3CBPA 2GCXA 4JRKA 2BIVA 2DVEA 3EGUA 1IREB 1TUGB 3JCMg 2YHTA 2WSEE 4J9BA 1F1BB 1OZ2A 5CVIA 2LCCA 4NL2A 3KBGA 3I56A 1MV0B 2FHDA 3NHNA 4P5NA 3UA7A 2L0AA 3LYIA 5IAYA 3G1JA 4RCCA 1VQKQ 3C94A 3RBBB 1RL2A 1AD5A 2C0OA 2FEIA 3EH2A 3E9FA 5FU7C 5LJ3h 2LZ6B 1PWTA 1QVPA 3ASKA 4ESRA 1WGSA 1RI9A 1VQ8Q 5J39A 2KXDA 3NTKA 5IT9E 3P8BB 5IHNA 1KFZA 1YBYA 2DILA 4XU2A 1WZOA 2KI7A 4E47A 4M75C 4C0GA 3JB9D 1GXIE 4ZGDB 2E4HA 2LRQA 1YP5A 2JMCA 4M7DE 2VXEA 3EG9B 2HDAA 3VS1A 2F69A 2WACA 1NBEB 2DTOA 3M54A 2P84A 3M9QA 1WQWA 3A8MB 2M1HA 5GMKi 5I22A 4HCZA 1VYVA 2YLBA 1QCFA 3OSSC 1JBMA 3NFCA 4C8QF 4EMKA 1PNJA 3OW2P 3MEWA 5KCHA 2AIRB 1NLPC 1W70A 3FB9A 4LDXA 1BYMA 2OTJQ 2DM1A 4LUDA 1MNEA 2LMJA 5KYXA 4JLGA 2JM8A 3REBB 1M9SA 3DKMA 3M57A 4F7UA 1ZA1B 2FZCB 3SWNC 3L2UA 2SRCA 2LP5A 4M78A 1OU9A 4XTYA 3JRZA 1Z9QA 2A7YA 2JUFA 3HPWA 2X3XD 1X75C 1X2KA 4BE1A 2E3IA 4AFQC 2YRDA 4EIKA 2C06A 3FC3A 2E3HA 4BDZA 4KH0B 4M78D 1VIFA 2HSEB 4DBHA 1KSWA 2KDSA 3TCJA 1BI0A 4EDUA 1ZSZC 1Q82C 2L5QA 2MIOA 1IHVA 3VUZA 1VQLQ 2IPOB 2K57A 1S72Q 2RI3A 1WYXA 4PLLA 1WQ7A 1PD1A 2HMAA 3JB9G 1CKBA 3BFMA 2E70A 2I2LA 3RUXA 1NPPA 2RJFA 4AFUC 4QVCA 4J7IA 1D0XA 3SHWA 2RD1A 4LE9A 1BCMA 1RI0A 1XQHA 2KT8A 5C0MA 1BIBA 3CCRQ 1SRMA 4E7JA 3NGPA 2L3PA 3SD4A 4OB3B 1MMNA 4MMKA 1JJ2P 4PLIA 2DE0X 3GF5A 3UDCA 3VV0A 3J7AF 2YUPA 1EFNA 5IH2A 2O31A 4LDWA 3MP6A 3QBYA 4ME7A 3ZL7C 4OMQA 1M27C 2M0YA 3G4SA 4HXJA 2DO3A 1VQNQ 5A2QE 5GAMd 3PE0A 2PUOB 2IG0A 3CCUT 5GANg 1H3ZA 3I55A 5GMKh 5GAMe 3QHSA 4B9WA 3KFVA 4DBFA 4EMKB 5EG2A 2WSCE 2EGEA 1B7TA 2DRKA 1M8VA 1O9SA 4EPCA 4KUDK 2QK0A 5J3BA 2CZ6B 4J6YA 2ED0A 5KYXB 1JEGA 2RJDA 3NTHA 2RF0A 4AT1B 4F7UB 5GAOq 3H41A 1Y57A 3RKXA 4OGCA 4M78B 4X34A 1G2BA 4PJOA 2FRWA 1Q82U 3CXCP 2L8DA 4PL6A 3M5AA 1EZZB 4DQ2A 1WJSA 1M3AA 5GAOl 3MEVA 2D9TA 1GFCA 4M7AD 1SPKA 1ZUYA 1RUWA 3G7ZA 2M51A 4PJOD 3M0RA 3J80E 3M58A 3S3OA 1KJWA 1G8XA 3VU3C 6AT1B 1N27A 1O75A 2L3RA 3OYIA 2PVOB 3HKSA 4JJDA 4C5EA 3C0CA 1N5ZA 2RK1A 2FPEA 1FXXA 1ZUUA 4RTUA 3X26B 4D6WA 2OAWA 1N8RC 2F2WA 3UA6A 1QQJA 1I1JA 2ABLA 4V2SA 1YWOA 1SKUB 5FROA 3GNGA 3QDFA 2PNIA 1VQMT 1VQ6T 3VYHB 3OYDA 3CCQT 2F2XA 1VQ4T 2IIMA 5KYYA 1KD1C 3M0TA 2XKOC 3OS5A 1OPLA 2DD4A 2QTXA 4C92A 2E6NA 2HNIA 2LJ0A 1VQ5Q 1GBRA 1VQ6A 4HVUA 1VQMA 1KC8U 1K76A 1W6XA 4C0ZA 1PD0A 3CCQA 2LQWA 1VQ4A 2P0QA 1NJIR 5GAN5 2EYZA 2DZ9A 1M4ZA 4J9EA 1UHCA 3MJXA 4FL6A 4F04B 4M7AG 4MDXA 2GF7A 2CSQA 3RKYA 1HSQA 2HQXA 3CMEQ 1NEBA 2OI3A 2RPNA 2XDPA 1OYXA 1OX8A 4PJOB 4OP0A 1N9SA 4X9CA 3CBMA 1NEGA 4ELZC 2DMOA 2MWPA 2LQKA 5CKBA 3PVLA 1I5LA 3MO8A 3QJYA 2QQBA 1HYOA 3I56Q 1VQ9Q 3CCJA 2BZXA 1N8RU 3CC7T 1QWFA 2X51A 2RQUA 1JB0E 2FO0A 5LJ5d 2K2VA 3VS4A 3P8DA 1BKBA 1OX9A 2BUDA 3QWYA 2EYQA 2LX7A 5LJ5e 3BDUA 3EHQA 3MEUA 3OS2A 3CCVT 4XU1A 2VGNA 1ZSGA 4M77A 2QEXT 2Z0WA 3CC7A 2KVQG 3EFSA 4M78C 5CKDA 3LH0A 4BUGA 2BZYA 4Z89A 2RK2A 2CP0A 1UFFA 3C4SA 5KYNA 3L1AA 5KYUA 3IQLA 4KT0E 4M7DF 5FU7B 1R0CB 1NLOC 2DD5A 2G6FX 4C8QD 3JCMb 3CCVA 2LX9A 4E7LA 1YIJT 3S6WA 5KYYB 1K8AR 2QEXA 4AG2C 3JCMQ 1B3QA 4QKUA 5FW9A 4PFOA 3OYGA 2AK5A 2P4RA 2K79A 2EPDA 4C92B 4Y28E 4ZN3A 4JJBA 3PVQA 5GAOr 1VUBA 2X9HA 3LWIA 4UC4A 5ECAA 1FYNA 1VQOA 2BZ8A 2RJEA 1YIJA 2CP6A 2M9UA 1M90C 1QLYA 1JU5C 5GJVB 2MI6A 4BI3A 1QVGS 3O8VA 3JCMf 1ZX6A 3OQ5A 2RQVA 1ABQA 1KQSA 2EW3A 2G3RA 2JXBA 2COYA 2YRVA 3OYAA 3FLGA 3FEOA 2KE9A 2CKKA 3D7SB 5FWCA 3Q1JA 3CCLQ 2LVMA 2KT1A 2DKGA 1NPRA 4RTTA 1UGSB 4JRIA 2D6FA 2YUQA 4ZNXA 4RTVA 2F2VA 1OPKA 2LCLA 1D09B 1YJWA 4HVVA 3HHTB 3QWXX 5GAMj 2LC4A 4MZTA 1UGRB 4AG1C 3H9NA 2RQWA 3NTIA 1VQ7A 1YHQT 2SEMA 1AZEA 4FSSA 2CZ7B 2D1XA 4CC7A 2CUDA 1DJ7B 2FL7A 2DBKA 1OZ3A 4ZN1A 4AFZC 1Y07A 3VS2A 3HRTA 4C8QG 4KH1B 5CR2A 4B6MA 2LQ8A 2DTHA 2VGMA 2CYZB 3O5ZA 3QZ5B 4M77B 1JXOA 4PJOC 3CPFA 2EAYA 2DJZA 3HP9A 4PJLA 2CZ0B 3NPFA 3R6NA 5KYUB 2EQJA 4PNOA 2K4YA 4II1A 2NYSA 2R5AA 1WI7A 4N4HA 4KULA 3RESA 3JCMX 3H6ZA 1BI3A 4E7ZA 3G4SQ 1M90U 1IXDA 2QG9B 1UGPB 1K9AA 3C12A 3G71Q 2KSSA 3LX7A 2GTOA 3R6OA 4DOVA 3V7SA 3HSBA 3N5BB 5C6SA 3I55Q 4MZPA 2LCSA 1BBZA 2V1RA 2AHJB 1QCNA 2JS2A 3OYKA 2DYIA 2K7AA 4GLKA 4F7UE 4LDVA 4MZMA 2R5MA 2DL4A 3QIIA 1K73R 1HK9A 4RTWA 4XTXA 1G3WA 1K0SA 2GGRA 4M75F 1I5OB 4FT2A 2NWMA 2GFUA 3OW2A 2A28A 2XMFA 1YJ9T 1LVKA 2XG8D 1PSEA 1C1AA 1RAEB 2YUNA 4O6JA 5DLQE 3HRUA 5HK0A 3J81E 2KK4A 2CGHA 4FW2A 4N0AC 2WSFE 4JJCA 2O88A 3ER0A 4J9DA 1E6GA 4C92C 2QA4Q 1YJ9A 2DYBA 2CDTA 2QGGA 1I8FA 4C0DC 1WHMA 4BE0A 3CC4T 4IKFA 2KYBA 3VS7A 4ZGEB 1PM3A 5LJ3d 5GAN8 2DXBA 2E64A 4RG8A 1TUDA 2EQKA 1WHLA 5IHKA 2LT4A 2JZ2A 3QYHB 2Y90A 5LJ3e 5KYWA 2FVUA 3M0SA 2BTTA 3OMCA 1VOMA 4FYXB 3CC4A 3TSZA 2FYKA 4JRPA 2PUKB 2VKNA 2NUTA 5CO7A 4ELYC 1M1FA 4QVZA 3WVDB 2RO0A 2E10A 5GANd 3RNJA 4EMGA 1AHJB 1SF9A 1UEBA 2E5KA 3QSUA 3QPHA 4J9GA 3F70A 1JJ2A 1RAHB 4D8KA 5EC7A 5I21A 2EQUA 2JT4A 3DB3A 4JLIA 1QWEA 5GANe 3HFNA 1X43A 2C0TA 1C6VX 2FRYA 2H3EB 1FX7A 4ZTFA 3KXTA 2MWOA 2QTVA 3UATA 5GAOn 3OYHA 1VQMQ 1VQ6Q 2LJ3A 4CC2A 2COZA 3L2RA 4OMFB 4M4ZA 3CCQQ 1M1KR 1RAIB 5LJ5j 1VQ4Q 2ZGWA 1QVFS 4DOWA 3FJ5A 3UPUA 2HBWA 3NMZC 1X69A 4A4GA 4M77C 1IRXA 4QQDA 4PJOE 3CCET 2HAXA 2JNGA 1IB8A 4MDWA 2CUBA 2X4YA 3RMQA 3AHUA 3LGFA 2EGAA 5CKHA 3A98A 5LJ3g 2DAQA 8AT1B 3LW5E 5GAN6 1YITT 3LLRA 2DL5A 2V8KA 4J9FA 2PVGB 1UB4A 2VXFA 3CCEA 2RI5A 1K4US 1RAGB 4J83A 2J7IA 2OAUA 3JCMJ 1YI2T 5GAMf 5GAMh 3CXCA 2E41A 1MHNA 3OYCA 2EYYA 3CCJQ 2QXFA 3CQTA 5IXBA 1YITA 1KQ1A 2R58A 4LDYA 3OMGA 2VV5A 4F16A 2VVKA 3VYGA 3OA6A 4M7DD 4RUGA 1M2VB 1VQPQ 2CS7A 5KYWB 2AZSA 1NG2A 4N4GA 3CCST 1LCKA 1WHJA 2DETA 1VQKT 4HKEA 3CCUA 2NUTB 1T3LA 1U3OA 3REAB 3RR6A 2KRMA 4C92E 2RQRA 1SSHA 1WHKA 4M7AA 1QVGP 1KC8C 1VYTA 2MYSA 2O2OA 1VIEA 1WNLA 4M75E 1WLPB 4IUVA 5KH6A 3CCVQ 1WX6A 3KUFA 3MKDA 2O01E 4JDSA 2B86A 1VQ8T 3CCSA 1SEMA 1WFWA 2CP3A 2QEXQ 1Q86R 5CKFA 1BB9A 5GAOp 1VQKA 1MV3A 4PFPA 4OVAA 2A3LA 2DVJA 2EJGA 4FYYB 1AWWA 4Z8AA 3A8OB 1TG0A 5GMKe 1FMKA 4AFSC 3RKWA 5KE2A 4A4KA 2DL7A 1K1ZA 1VQOQ 2DEUA 2NUZA 4BE2A 3MP1A 1YIJQ 4BB7A 1ABOA 3OYJA 2KRNA 2EQMA 4PFZA 2R57A 4ORZA 3ZFJA 3G6ET 2OTLT 2JVVA 3BDLA 1M3CA 1WIEA 1Z9ZA 2E65A 1ACMB 4J5YA 1Q81C 3V8LA 3M4GA 1YJNT 2FPFA 2RA2A 3OYNA 2O4XA 2JM9A 3G6EA 2OTJT 2A36A 2MOXA 2OTLA 1OV3A 2YRCA 3CCMQ 4IUTA 3PNWC 3PGGA 4KGZB 4M7DG 4IIMA 1YJNA 1CSKA 2F5TX 1YJWQ 2CH4W 2RN8A 4N0AA 3RIRA 2YUOA 1VQ7Q 1V1CA 3WXMB 2DA9A 3CEYA 1TWBA 3GOXA 2GTJA 1ZA2B 2ZZDA 4M77E 5CQYA 2OTJA 4RCBA 3ZEHA 4FW1A 1UJ0A 2XHCA 2KROA 5HK3A 2FZKB 2K6DA 5GJWB 2D8HA 3M0UA 2XDBA 2XD0A 3AT1B 4AMCA 3CD6T 3QDRB 2RB6A 1X2QA 4PJNA 3PIPA 3CMAT 2XDDA 4A4FA 5FU6B 3SEMA 1IGQA 1VQLT 3I35A 3HFOA 4B9XA 5KE3A 3L42A 1CKAA 1E6HA 3M59A 4OB1B 3A1PA 3UF4A 4M7AB 2EJFA 2ZPEB 2LT1A 1D3BA 4LD9K 2VWFA 1PRLC 1EX4A 2X4XA 3CD6A 4RMOA 2RHZA 1HJDA 3DLMA 4PKCC 4E7SA 3CCRT 1SHFA 4RTYA 3TU4K 1N8RR 3CMAA 4XTZA 2PZ1A 2KMTA 4DEYA 1Q7YC 1BI2A 1LNXA 1UJYA 3FIFA 1Q81U 4F7UF 3JV3A 4DBQA 1AWOA 5LJ5f 5LJ5h 2PTKA 1KIKA 4RTXA 4E6RA 4M78F 1PKTA 3BW1A 4Z02A 1W4SA 1D0YA 2AKKA 1KD1R 5LJ3j 1YCSB 2OX7A 1K8AC 3A8LB 1SRLA 4Y92A 1PG5B 2H8HA 2EBPA 2K9GA 1Y0MA 4FCYA 1TH7A 2DEQA 3GLXA 4FYWB 5FLXE 3RERA 4HT9A 4LXCA 2KYMA 4BDYA 2HKQB 1GCQC 1UHFA 2J6OA 4Q5WA 2QDLA 4MMLA 4C8QA 2HSPA 2ZPFB 2O4XB 4J8OA 1PRMC 2O9SA 5GANj 4OGEA 1WXTA 2QASA 2E5QA 5I2SA 1WJQA 2FB7A 2JW4A 2LDMA 1KK7A 1YJ9Q 1Y96A 1R8OB 1M5Q1 3PTAA 1HD3A 1K9MC 2DXTA 3MHXA 4OMPA 2JTMA 2AZVA 2YWWA 1Q95G 2W0ZA 1IGUA 1V76A 1XOVA 3OYBA 5GAN2 4C0DB 1J3TA 3PIOA 3QJ6A 4J9HA 4A53A 2DFUA 2V8IA 3URGA 4M75G 1TU0B 1Q7YU 2OJ2A 2O9VA 1QVFP 3M55A 2HQEA 2XIDA 2ECZA 2J06A 3VJPA 4F14A 3GBQA 3JCMh 2V26A 3MP8A 2JMAA 1UUEA 3A8HB 4E7KA 1M8MA 2LJ1A 1GRIA 2KBTA 3ME9A 1D3BB 2K3XA 3PFSA 4JUVA 2IVWA 1K8AU 1GFDA 1GL5A 1KQ2A 5L23A 2DF6A 4HCKA 4OF1A 1PKSA 2GBQA 2B8AA 3LH5A 2Y4XA 1K0XA 1TSFA 2XK0A 2JTFA 3H0HA 2L3SA 2YSQA 1TOVA 1U1SA 4XQ3A 2CT4A 4FT4A 4PJOF 2KAFA 1OQKA 1AWXA 4FIBA 4BD3A 4NL3A 3T9NA 5IHIA 3EH1A 1X01A 5FU6C 5AYFA 5AT1B 1VQ5T 4BI4A 4JZ3A 4XAXB 4OB2B 2L2PA 1TS9A 4HA8A 1D0ZA 4PJMA 1X6BA 3TQ7P 4M7AC 4IURA 4NS5A 1JO8A 4C8QB 3I5SA 1M90R 5D6XA 1K73C 1K9MU 1YHQA 1PCXA 2QAZA 1AZGB 4IUUA 3CCEQ 2KGTA 1VQ5A 1OEBA 1QKWA 4BY6B 2KR3A 4RG2A 2DK3A 1UG1A 2A0FB 5GMKj 1BIAA 4LN2A 2D0QB 4C0FA 1Y96B 2K5LA 3CC2T 2PVDB 4C5GA 4L5GA 3V7RA 3EG1A 3M0PA 4OMNA 4ANJA 4JS5A 3L2QA 4ZTJA 1ARKA 2PQWA 4YTLA 1YITQ 1RADB 3EGDB 4WF2A 2KQWA 2DJQA 2QQSA 5IN1A 1H8KA 1NYGA 1E7OA 2D8JA 3FDRA 1BU1A 5A0LA 5A0GA 3GNFB 1XTDA 3I56T 1VQ9T 3CC2A 2CP2A 2CSIA 1ZQ1A 4RTZA 7AT1B 3CPWS 3EG3A 4C92F 4M78E 3I5RA 2EIFA 3CCUQ 2C0IA 2HD0A 3OBYA 4IIOA 4E7IA 1UGQB 3OB9A 1VQ9A 1AVZC 3VS3A 3CCSQ 4RKUE 2KXCA 3JCMV 2XI9A 2AT1B 2ROLA 2K3YA 2Y4YA 1R77A 2QGFB 2QYZA 1W2BS 2VASA 1AOJA 2HCKA 3I9QA 3VS6A 5LJ3f 1MUZA 3JCMc 5I11A 3CBOA 3P8HA 1D1AA 5D6WA 3QZ9B 1K73U 2DBMA 1X27A 2M16A 2MK5A 4XK8E 1WJRA 2E1HA 4GLMA 3ZBDA 3QKJA 2L3QA 3UWNA 1M2VA 1M1KC 2ESWA 2V8JA 3M56A 3QXEB 1T3SA 2GFAA 1LPLA 1XJWB 5GANf 4LUEA 5GANh 3BY7A 3M4YA 5FRMA 3E1SA 3G6EQ 2OTLQ 3OSVA
chains in the Genus database with same CATH topology
4X9CA 3KUFA 3VUBA 2O01E 3CBMA 4JDSA 4Y91A 1VQ8T 3CCSA 4ELZC 5DM7R 2MWPA 2LQKA 5DLOA 3EFRA 3X20B 3PMTA 1QP2A 5CKFA 3V7CA 5CKBA 3QYGB 1I5LA 3MO8A 4FSXA 5GAOp 2ZCFB 1VQKA 3JB9I 4M77F 4OVAA 2BKDN 3QJYA 4C8QE 2QQBA 2A3LA 2EJGA 3EAEA 1G3YA 2DZCA 3A8OB 3CCJA 5GMKe 3SDZA 1N8RU 3CCLT 3CC7T 3UT1A 3CMET 3RKWA 4M77G 5KE2A 3X24B 1JB0E 4A4KA 5LJ5d 4E7HA 2K2VA 2GQVA 1HXDA 3P8DA 3OBWA 1BKBA 4BE2A 2E12A 3MP1A 2PU9B 2BUDA 4BB7A 3OYJA 1G3SA 2EYQA 2EQMA 2R57A 5DY9A 3ZFJA 3G6ET 2OTLT 2DXUA 5LJ5e 2QDYB 2JVVA 1U1TA 3BDUA 4EMHA 3MEUA 3BDLA 2MMPA 2H3JA 2E65A 3OS2A 5KCOA 3CCVT 4M7AE 5HKCA 4XU1A 2QQ9A 2VGNA 3A8GB 1H641 2YLCA 4J5YA 4M77A 4ZGJB 2QEXT 1Q81C 3V8LA 3M4GA 4R56A 3CC7A 3CCLA 1YJNT 2DTIA 1EIFA 2KVQG 2QQRA 3EFSA 4M78C 4C8QC 5CKDA 3CMEA 3LH0A 4BUGA 1OI1A 2RK2A 4C5HA 5I2MA 3JB9J 3C4SA 3L1AA 2RA2A 4XU3A 3OYNA 2O4XA 2P0KA 3OYFA 3PMIA 2RHXA 3JCMP 4KT0E 4M7DF 5FU7B 4BY6C 3G6EA 2OTJT 2OTLA 2DD5A 3QO3A 3CBPA 4C8QD 3JCMb 3CCVA 2GCXA 4JRKA 2LX9A 4IUTA 3PNWC 4E7LA 1YIJT 3PGGA 3S6WA 5GAOm 3JB9H 4M7DG 2BIVA 2DVEA 2QEXA 3JCMQ 1YJNA 1IREB 3L2ZA 4QW2A 2F5TX 3OYGA 4QQ6A 3JCMg 2YHTA 1QVGA 2WSEE 3VKIA 1OZ2A 5CVIA 2LCCA 4C92B 4NL2A 3KBGA 4Y28E 4N0AA 3RIRA 2FHDA 4ZN3A 3I56A 3WXMB 4P5NA 4R55A 1I81A 3LYIA 1KHCA 1VUBA 3CEYA 5GAOr 2QQAA 3GOXA 5IAYA 2ZZDA 4RCCA 4UC4A 3LWIA 4M77E 1M1KU 5CQYA 2OTJA 4XU0A 4M7DA 1VQOA 3C94A 4RCBA 3ZEHA 1RL2A 3G4ST 2RJEA 2XHCA 3TREA 1YIJA 5HK3A 1Q86C 1V29B 2M9UA 4IUVA 3G71T 2RHIA 1M90C 3OY9A 3OYLA 2MI6A 2XDBA 3E9FA 5FU7C 4BI3A 2XD0A 1QVGS 5LJ3h 3HL8A 3O8VA 3OYMA 1MGQA 1QVPA 3QDRB 1SSFA 2RB6A 3JCMf 1LOJA 3I55T 3CD6T 4L6V5 2X4WA 3ASKA 4LDUA 2RM4A 3OQ5A 3DB4A 1WGSA 3PIPA 4DA4A 1YI2A 1KQSA 3CMAT 2XDDA 5J39A 4A4FA 5FU6B 2G3RA 3NTKA 2ZPIB 2YRVA 4NOYA 4OB0B 3OYAA 3FLGA 5IT9E 3FEOA 1VQLT 3HFOA 3P8BB 4B9XA 5KE3A 3L42A 2CKKA 3M59A 4CI0C 4OB1B 1FWZA 1YBYA 5GMKm 3GP8A 3G71A 3Q1JA 2LVMA 4XU2A 4M7AB 2DKGA 2EJFA 1NPRA 2ZPEB 2LT1A 4M75C 4E47A 4C0GA 1D3BA 1UGSB 4JRIA 4FU6A 3JB9D 4ZGDB 3QG1A 1S72A 4LD9K 2D6FA 2X4XA 3CD6A 4RMOA 2RHZA 2LRQA 3DLMA 3PT9A 2VXEA 4PKCC 3CCRT 2LCLA 3TU4K 4M7DE 3CMAA 2F69A 4XTZA 2M0OA 2KMTA 3HHTB 5GAMj 1YJWA 2WACA 1KQSS 2DTOA 2LC4A 4MZTA 1UGRB 3HRSA 1Q7YC 5LL6S 3M54A 1BI2A 3NTIA 1LNXA 4FM4B 3FIFA 1VQ7A 1Q81U 4F7UF 3M9QA 1WQWA 3A8MB 2M1HA 1YHQT 1X6OA 5GMKi 5LJ5f 4HCZA 5LJ5h 2YLBA 2EWNA 2CZ7B 1I4K1 4M78F 3OSSC 1JBMA 3NFCA 2RJCA 3BW1A 4C8QF 4EMKA 4Z02A 4F7UG 1W4SA 3L2WA 1DJ7B 1G3TA 2FL7A 2MAMA 5LJ3j 1K8AC 1OZ3A 3MEWA 4ZN1A 5KCHA 1Y07A 1N9RA 3A8LB 3HRTA 4M78G 2QA4T 4C8QG 2EFIA 4O5VA 3FB9A 2EJ9A 2EKOA 5CR2A 4LDXA 1BYMA 4BACA 2LQ8A 2DTHA 2CZ1B 2VGMA 2CYZB 1TH7A 4JLGA 2DEQA 3GLXA 3QZ5B 5FLXE 4M77B 1M9SA 3DKMA 5M9OA 3M57A 1VQ8A 3RERA 4HT9A 1B34A 4F7UA 1M1GA 3OYYA 4BDYA 4PJOC 3CPFA 3SWNC 3L2UA 2EAYA 2DJZA 5D6YA 4Q5WA 3HP9A 4M78A 1BI1A 4MMLA 2CZ0B 4C8QA 4XTYA 3JRZA 2A7YA 4N4IA 2ZPFB 2JUFA 2DXCA 2O4XB 3HPWA 4J8OA 2QA4A 2EQJA 4PNOA 2K4YA 4II1A 4J7FA 1X75C 2R5AA 5GANj 1NJIC 4OGEA 3CPWA 4N4HA 4KULA 4BE1A 2E5QA 3RESA 5I2SA 3JCMX 3H6ZA 1BI3A 1WJQA 2FB7A 2JN0A 1Q86U 1M90U 2C06A 2LDMA 3FC3A 4BDZA 1UGPB 3C12A 2KSSA 1NZ9A 4KBMB 1Y96A 1R8OB 3LX7A 1M5Q1 3PTAA 4DOVA 3R6OA 3V7SA 4M78D 3SFMA 1QP3A 1VIFA 3TCJA 2KDSA 3HSBA 3N5BB 5C6SA 4MZPA 1BI0A 4EDUA 5CCAA 3META 1Q82C 5FRNA 2L5QA 4L59A 1WPYA 2AHJB 5GAN7 1K9MC 2DXTA 1IZ6A 3MHXA 3JB9F 2JTMA 3VUZA 5GAMg 4C5IA 3OYKA 4M7DB 2K57A 4GLKA 4F7UE 4LDVA 2RI3A 4MZMA 1NE8A 2R5MA 4PLLA 1WQ7A 3JB9G 1KG1A 3BFMA 3QIIA 1HK9A 2E70A 2I2LA 1G3WA 1NPPA 1XOVA 2RJFA 4XTXA 3RUXA 4J7IA 4QVCA 3OYBA 3OYEA 4JJNK 5GAN2 4C0DB 3MEAA 4M75F 4FT2A 1W2BA 4TVRA 1Y71A 2GFUA 2RD1A 3OW2A 3PIOA 3QJ6A 4BI8B 1RI0A 1XQHA 4A54A 4A53A 5C0MA 5GMKl 1BIBA 1YJ9T 5GAN3 2XG8D 2V8IA 3URGA 2DIQA 4M75G 1Q7YU 1PSEA 4E7JA 3M55A 2HQEA 2HBPA 2XIDA 4J6WA 3SD4A 3VJPA 3E19A 4O6JA 4OB3B 5DLQE 3JCMh 3HRUA 4MMKA 1PSFA 4PLIA 2E6ZA 2KK4A 3MP8A 2CGHA 4XTVA 5HK0A 3J81E 3GF5A 3UDCA 4IUQA 3A8HB 4N0AC 2WSFE 5CQXA 3VV0A 4E7KA 1U8RA 3J7AF 3TEEA 1VQPT 1P92A 3MP6A 4LDWA 3ME9A 3QBYA 4ME7A 1S72T 1D3BB 2K3XA 3ER0A 3PFSA 2IVWA 4JUVA 1K8AU 1GXIE 3G4SA 1KQ2A 4X9DA 4QQGA 4C92C 2DO3A 4QVDA 4M75A 3OW2S 5A2QE 5GAMd 4OF1A 1YJ9A 2PUOB 2MF2A 2B8AA 2IG0A 1JRIA 2X4JA 3CCUT 4A4EA 2Y4XA 1I8FA 4GY5A 5GANg 4C0DC 3A5ZB 1H3ZA 4XTWA 3I55A 4BE0A 5GMKh 2XK0A 2JTFA 3CC4T 2QI2A 2RH2A 5GAMe 4IKFA 2DIGA 2VYTA 3QHSA 1U1SA 4B9WA 3OS0A 4C92D 2RI2A 4ZGEB 1VQLA 4XQ3A 3E9GA 4FT4A 5LJ3d 4EMKB 4PJOF 2KAFA 5GAN8 5EG2A 2DXBA 2WSCE 2E64A 4FIBA 4RG8A 3L2VA 2EQKA 4IUPA 4M75D 4BD3A 4NL3A 1M8VA 1O9SA 3T9NA 2ZPBB 4EPCA 4PJOG 4KUDK 1NJIU 2LT4A 1X01A 5FU6C 5J3BA 2JZ2A 3QYHB 5AYFA 2Y90A 5LJ3e 2CZ6B 4J6YA 2FVUA 2ZPGB 3CCJT 1VQ5T 3OMCA 3LWHA 4BI4A 1VQNT 2RJDA 4XAXB 3NTHA 4OB2B 4XTUA 3CCRA 3CC4A 3S3NA 2FYKA 4HA8A 4JRPA 1YCYA 2PUKB 1B34B 4F7UB 2DPPB 5GAOq 5CO7A 4M7AC 3RKXA 4IURA 4ELYC 4NS5A 1ZHIA 3S3MA 2JOYA 4OGCA 1M1FA 4M78B 4C8QB 4X34A 4PJOA 3SWNA 1Q82U 5D6XA 4QVZA 3WVDB 2L8DA 1K73C 2RO0A 4PL6A 1K9MU 3M5AA 1YHQA 2E10A 5GANd 1Y7XA 3V8KA 4EMGA 4DQ2A 1AHJB 5CAIA 3X25B 1N6AA 4IUUA 1UEBA 1WJSA 1QVFA 3QSUA 1G5VA 3QPHA 4A4HA 1VQ5A 3F70A 4EMKC 1QW1A 5GAOl 1JJ2A 3MEVA 3INZA 2D9TA 1VQNA 4BY6B 4CRIA 5I21A 4M7AD 2EQUA 2DK3A 4RG2A 3V8JA 3DB3A 4JLIA 5GMKj 5GANe 1BIAA 3HFNA 2D0QB 4C0FA 1Y96B 2K5LA 3G7ZA 5L8RE 5GAN4 3CC2T 3SB2A 4JS4A 2PVDB 1FX7A 4ZTFA 3KXTA 4PJOD 4C5GA 4L5GA 3C95A 3J80E 1ZBXA 2MWOA 3M53A 3V7RA 3M58A 5GAOn 5J26A 3OYHA 4JS5A 3S3OA 2P0PA 3L2QA 3L2RA 4ZTJA 2PQWA 4YTLA 4OMFB 3VU3C 4WF2A 1VQPA 3MCAB 5LJ5j 1N27A 2KQWA 1KD1U 2KY9A 2ZGWA 1O75A 5HY6A 4HCBA 2L3RA 2QQSA 5IN1A 1QVFS 3OYIA 2K5FA 2PVOB 2XICA 3HKSA 4VUBA 4DOWA 3UPUA 1JJ2S 3FDRA 1LJOA 4A4GA 4M77C 4C5EA 5A0LA 2L89A 4QQDA 5A0GA 4PJOE 2RK1A 3GNFB 1XTDA 3I56T 1VQ9T 3CC2A 3CCET 1ZQ1A 1FXXA 2VUBA 3CPWS 2HAXA 2ZPHB 3X26B 4D6WA 4ATOA 2JNGA 1N8RC 4MDWA 4C92F 4M78E 4J6XA 4V2SA 1VQOT 2X4YA 2EIFA 3RMQA 3AHUA 3LGFA 4M77D 3GNGA 5FROA 2HD0A 3OBYA 5CKHA 4C92G 5LJ3g 1VQ6T 2DAQA 1VQMT 3LW5E 5GAN6 3VYHB 1YITT 3LLRA 4HT8A 3OYDA 4E7IA 2V8KA 2XU8A 3CCQT 2LNVA 2PVGB 2K5IA 1VQ4T 1UB4A 1UGQB 2RHUA 2VXFA 3OB9A 3CCEA 2RI5A 1VQ9A 1KD1C 4J83A 2XKOC 3OS5A 2OAUA 3JCMJ 1YI2T 5GAMf 3GPLA 5GAMh 4RKUE 3JSCA 1KHIA 4M75B 3CXCA 3QUIA 4JRQA 3JCMV 2E41A 1MHNA 2DD4A 2LTOA 2QTXA 2XI9A 3WVEB 4C92A 3OYCA 2K3YA 2Y4YA 2E6NA 2HNIA 4M7DC 2QXFA 3X28B 2P4TA 1W2BS 1VQ6A 4LD6A 1VQMA 1KC8U 3FRNA 4C0ZA 1YITA 1KQ1A 2R58A 4LDYA 5LJ3f 3JCMc 5CKEA 3DLLA 3CCQA 2P0QA 1VQ4A 3CCMT 3CBOA 3P8HA 5GAN5 3OMGA 2NLUA 2DZ9A 3FJPA 3JAME 5D6WA 4M7AF 1M4ZA 3QZ9B 3JCMW 2VV5A 2VC8A 1K73U 3VYGA 1YJWT 3OA6A 4KUIA 4M7DD 3CXCS 5A0DA 3GIBA 4FL6A 2M16A 2RHYA 2F5KA 4XK8E 4M7AG 4MDXA 2CS7A 3LGLA 2GF7A 5LJ5g 1VQ7T 1WJRA 2E1HA 4N4GA 3JCMd 3CCST 5CIUA 3OS1A 3RKYA 3ZBDA 3QKJA 1XNIA 2HQXA 3UWNA 1VQKT 1M1KC 2V8JA 3M56A 3QXEB 4HKEA 3CCUA 3CCMA 2XDPA 4HCCA 1OYXA 3JCMe 2GFAA 4C92E 2X35A 5GANf 4OP0A 4PJOB 3SWNB 5GANh 5CK9A 4M7AA 3BY7A 1KC8C 3M4YA 1VIEA 3RMSA 3E1SA 5FRMA 1WNLA 4M75E 1N9SA 3OSVA 5KH6A 3H8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FT4 A;  1ZBX A;  4BB7 A;  4JJN K;  3PTA A;  4DOV A;  4FT2 A;  4FSX A;  4KUD K;  1W4S A;  4DOW A;  4LD9 K;  2FL7 A;  2FVU A;  3PT9 A;  3TU4 K;  1M4Z A;  4DA4 A;  4KUL A;  4KUI A;  1ZHI A; 
#chains in the Genus database with same CATH topology
 1WHG A;  2ATC B;  3VUB A;  4D8D A;  5DM7 R;  1D1C A;  5DLO A;  3X20 B;  3PMT A;  1YJN Q;  3V7C A;  1GCQ A;  1UTI A;  3JB9 I;  4M77 F;  2BKD N;  2DZC A;  1OUL A;  1OOT A;  3CCL T;  1UDL A;  3X24 B;  4E7H A;  2HQH A;  3OBW A;  2PU9 B;  1T0H A;  3TSW A;  5DY9 A;  2QDY B;  1U1T A;  2JS0 A;  2MMP A;  2H3J A;  5KCO A;  1GBQ A;  4M7A E;  2QQ9 A;  4ZGJ B;  1H64 1;  2V1Q A;  3CCL A;  4C8Q C;  2JJ9 A;  1RAF B;  4C5H A;  1T0J A;  3JB9 J;  4XU3 A;  2HZY A;  2P0K A;  1S1N A;  3JCM P;  2RHX A;  1M30 A;  4BY6 C;  1VYU A;  3H0I A;  3CD6 Q;  1B07 A;  4CC4 B;  5GAO m;  2DL3 A;  3JB9 H;  3CMA Q;  3L2Z A;  4QW2 A;  1QVG A;  2EVR A;  4QQ6 A;  2DRM A;  3VKI A;  1AT1 B;  4R55 A;  1I81 A;  1KHC A;  2JTE A;  2QQA A;  1NYF A;  1M1K U;  2HKN A;  4XU0 A;  4M7D A;  2EGC A;  3G4S T;  2EYX A;  2FZG B;  3TRE A;  1Q86 C;  1V29 B;  3G71 T;  1TUC A;  1MND A;  2RHI A;  2X3W D;  3OY9 A;  3OYL A;  4CC3 A;  4FYV B;  3HL8 A;  3OYM A;  1MGQ A;  1SSF A;  1LOJ A;  3I55 T;  4L6V 5;  2X4W A;  4LDU A;  2RM4 A;  3DB4 A;  4J9I A;  4DA4 A;  1YI2 A;  1JXM A;  2ZPI B;  4NOY A;  1WXU A;  4OB0 B;  1ZLM A;  3H0F A;  4CI0 C;  2HEQ A;  2ED1 A;  1PHT A;  2YDL A;  1FWZ A;  5GMK m;  3GP8 A;  3G71 A;  3CC7 Q;  1GCP A;  1Q82 R;  2YT6 A;  5D7U A;  4FU6 A;  4LNP A;  3QG1 A;  3PT9 A;  2ZAE A;  1QCO A;  2M0O A;  1KQS S;  1H92 A;  5HCK A;  3HRS A;  5LL6 S;  4FM4 B;  3U23 A;  1PC0 A;  1X6O A;  5FWB A;  2EWN A;  1I4K 1;  4PK4 A;  2RJC A;  4F7U G;  3L2W A;  1G3T A;  2MAM A;  1N9R A;  2QA4 T;  4M78 G;  2EFI A;  4O5V A;  2EJ9 A;  2EKO A;  1A0N B;  4BAC A;  2CZ1 B;  4DEX A;  1VA7 A;  5M9O A;  1VQ8 A;  1B34 A;  1M1G A;  3OYY A;  5D6Y A;  1BI1 A;  4N4I A;  2DXC A;  2QA4 A;  4KRT A;  4J7F A;  2J6F A;  3M0Q A;  2I0N A;  1AWJ A;  2GNC A;  1NJI C;  3CPW A;  3HTR A;  1Q86 U;  2JN0 A;  4OML A;  3RDV A;  2MCN A;  1NZ9 A;  4KBM B;  4JPB W;  1SG5 A;  3SFM A;  2KRS A;  1QP3 A;  5CCA A;  3MET A;  2DL8 A;  5FRN A;  4L59 A;  1WPY A;  5GAN 7;  1KC8 R;  1OU8 A;  3JB9 F;  1IZ6 A;  1WDX A;  5GAM g;  4C5I A;  4M7D B;  1NE8 A;  2GQI A;  3EG2 A;  4PJJ A;  1KG1 A;  1MMD A;  4C8Q E;  3OYE A;  4JJN K;  2AKL A;  3MEA A;  3E2U A;  2HL5 C;  2RNA A;  4TVR A;  1Y71 A;  1W2B A;  1JQQ A;  4BI8 B;  4A54 A;  5GMK l;  5GAN 3;  2DIQ A;  1RAA B;  2YXY A;  2HBP A;  4J6W A;  3EHR A;  3E19 A;  4XTV A;  1PSF A;  2E6Z A;  1U8R A;  4IUQ A;  5CQX A;  3TVT A;  2DLP A;  3TEE A;  1YHQ Q;  1P92 A;  2DER A;  1MMA A;  1SHG A;  3CPW P;  2K2M A;  1I07 A;  1S72 T;  1FMV A;  4X9D A;  4QQG A;  4QVD A;  1Q81 R;  4M75 A;  3OW2 S;  1AEY A;  2MF2 A;  1JRI A;  2X4J A;  1TTH B;  4HVW A;  4A4E A;  4GY5 A;  1I0C A;  3A5Z B;  4XTW A;  3MPU B;  2QI2 A;  2RH2 A;  2DIG A;  2VYT A;  3OS0 A;  4C92 D;  2RI2 A;  1VQL A;  3E9G A;  3L2V A;  1S72 A;  4IUP A;  4M75 D;  2DNU A;  1BCO A;  1UGV A;  1YFN A;  2ZPB B;  4PJO G;  1FMW A;  1NJI U;  4X1V A;  1RLP C;  2NUP A;  3CC2 Q;  2A08 A;  3EGX A;  2ZPG B;  3CCJ T;  1W2B P;  3LWH A;  1VQN T;  4XTU A;  3CCR A;  3S3N A;  1YCY A;  1B34 B;  2DPP B;  3S3M A;  1ZHI A;  8ATC B;  2JOY A;  4WCI A;  2CP7 A;  5IXF A;  1IHW A;  3SWN A;  1RAB B;  1G83 A;  4F17 A;  1Y7X A;  3V8K A;  1VQP T;  5CAI A;  3X25 B;  1N6A A;  2ENM A;  3THK A;  1QVF A;  2CT3 A;  1G5V A;  4A4H A;  1ZUK A;  3EFO A;  4EMK C;  1QW1 A;  3INZ A;  1VQN A;  4CRI A;  3V8J A;  3EG0 A;  5L8R E;  5GAN 4;  3SB2 A;  4JS4 A;  4KGV B;  3VS5 A;  3C95 A;  1ZBX A;  3M53 A;  1YNZ A;  5J26 A;  1H3H A;  2CP5 A;  2P0P A;  1U5S A;  2J05 A;  1TXQ A;  1VQP A;  3MCA B;  1KD1 U;  3VRY A;  2KY9 A;  1ZSZ A;  5HY6 A;  4HCB A;  2K5F A;  2XIC A;  4VUB A;  1JJ2 S;  1LJO A;  2L89 A;  3EGD A;  4GBQ A;  1Q7Y R;  3VRZ A;  1UEC A;  1UE9 A;  2VUB A;  2ZPH B;  4ATO A;  2KEA A;  2HL3 A;  1M3B A;  4J6X A;  1VQO T;  2J6K A;  4M77 D;  4R0K A;  2D0N A;  4C92 G;  2W10 A;  4E2F B;  1R0B G;  2RQT A;  4HT8 A;  2COW A;  3CC4 Q;  2XU8 A;  2LNV A;  3VS0 A;  2K5I A;  2RHU A;  2VB6 A;  2EYW A;  2CH4 A;  4K11 A;  1NM7 A;  3GPL A;  3JSC A;  1KHI A;  4M75 B;  3QUI A;  4JRQ A;  2EQI A;  2LTO A;  3WVE B;  1C0M A;  4M7D C;  3X28 B;  2P4T A;  4LD6 A;  3FRN A;  5CKE A;  1WXB A;  3DLL A;  3CCM T;  4OMM A;  2NLU A;  2FG0 A;  1M2O A;  3FJP A;  3JAM E;  4M7A F;  3JCM W;  2VC8 A;  1YJW T;  4KUI A;  1WHH A;  3CXC S;  5A0D A;  3GIB A;  2CRE A;  2RHY A;  2F5K A;  1X6G A;  3LGL A;  5LJ5 g;  2NUP B;  1VQ7 T;  1IO6 A;  3EGX B;  4WTO B;  1BK2 A;  4DBR A;  3JCM d;  5CIU A;  4J9C A;  3OS1 A;  1XNI A;  1K9M R;  3CCM A;  4HCC A;  4Z88 A;  2KNB B;  3BE3 A;  3JCM e;  2X35 A;  3SWN B;  5CK9 A;  3RMS A;  1YN8 A;  2F1L A;  1YWP A;  3H8Z A;  3EG9 A;  4Y91 A;  2BE7 D;  3EFO B;  3EFR A;  1QP2 A;  3QYG B;  4FSX A;  2ZCF B;  2K3B A;  1QMC A;  2ROT A;  3EAE A;  1G3Y A;  3SDZ A;  2LNH B;  2A37 A;  3UT1 A;  3CME T;  4M77 G;  1W1F A;  1MMG A;  2GQV A;  1HXD A;  1ZSZ B;  4JZ4 A;  2E12 A;  2RMO A;  1G3S A;  1KQS P;  1U06 A;  2EKH A;  4OMO A;  2DXU A;  4EMH A;  3ULR B;  2M02 A;  5HKC A;  2DX1 A;  4KGX B;  3A8G B;  1WA7 A;  2YLC A;  4R56 A;  2DTI A;  1EIF A;  2QQR A;  1YI2 Q;  9ATC B;  3CME A;  1OI1 A;  2FPD A;  5I2M A;  2LQN A;  2MPX C;  1RLQ C;  4A63 B;  3OYF A;  3PMI A;  1D1B A;  1ZBJ A;  4QT7 A;  3QO3 A;  2BE9 B;  1RAC B;  1QKX A;  3CBP A;  2GCX A;  4JRK A;  2BIV A;  2DVE A;  3EGU A;  1IRE B;  1TUG B;  3JCM g;  2YHT A;  2WSE E;  4J9B A;  1F1B B;  1OZ2 A;  5CVI A;  2LCC A;  4NL2 A;  3KBG A;  3I56 A;  1MV0 B;  2FHD A;  3NHN A;  4P5N A;  3UA7 A;  2L0A A;  3LYI A;  5IAY A;  3G1J A;  4RCC A;  1VQK Q;  3C94 A;  3RBB B;  1RL2 A;  1AD5 A;  2C0O A;  2FEI A;  3EH2 A;  3E9F A;  5FU7 C;  5LJ3 h;  2LZ6 B;  1PWT A;  1QVP A;  3ASK A;  4ESR A;  1WGS A;  1RI9 A;  1VQ8 Q;  5J39 A;  2KXD A;  3NTK A;  5IT9 E;  3P8B B;  5IHN A;  1KFZ A;  1YBY A;  2DIL A;  4XU2 A;  1WZO A;  2KI7 A;  4E47 A;  4M75 C;  4C0G A;  3JB9 D;  1GXI E;  4ZGD B;  2E4H A;  2LRQ A;  1YP5 A;  2JMC A;  4M7D E;  2VXE A;  3EG9 B;  2HDA A;  3VS1 A;  2F69 A;  2WAC A;  1NBE B;  2DTO A;  3M54 A;  2P84 A;  3M9Q A;  1WQW A;  3A8M B;  2M1H A;  5GMK i;  5I22 A;  4HCZ A;  1VYV A;  2YLB A;  1QCF A;  3OSS C;  1JBM A;  3NFC A;  4C8Q F;  4EMK A;  1PNJ A;  3OW2 P;  3MEW A;  5KCH A;  2AIR B;  1NLP C;  1W70 A;  3FB9 A;  4LDX A;  1BYM A;  2OTJ Q;  2DM1 A;  4LUD A;  1MNE A;  2LMJ A;  5KYX A;  4JLG A;  2JM8 A;  3REB B;  1M9S A;  3DKM A;  3M57 A;  4F7U A;  1ZA1 B;  2FZC B;  3SWN C;  3L2U A;  2SRC A;  2LP5 A;  4M78 A;  1OU9 A;  4XTY A;  3JRZ A;  1Z9Q A;  2A7Y A;  2JUF A;  3HPW A;  2X3X D;  1X75 C;  1X2K A;  4BE1 A;  2E3I A;  4AFQ C;  2YRD A;  4EIK A;  2C06 A;  3FC3 A;  2E3H A;  4BDZ A;  4KH0 B;  4M78 D;  1VIF A;  2HSE B;  4DBH A;  1KSW A;  2KDS A;  3TCJ A;  1BI0 A;  4EDU A;  1ZSZ C;  1Q82 C;  2L5Q A;  2MIO A;  1IHV A;  3VUZ A;  1VQL Q;  2IPO B;  2K57 A;  1S72 Q;  2RI3 A;  1WYX A;  4PLL A;  1WQ7 A;  1PD1 A;  2HMA A;  3JB9 G;  1CKB A;  3BFM A;  2E70 A;  2I2L A;  3RUX A;  1NPP A;  2RJF A;  4AFU C;  4QVC A;  4J7I A;  1D0X A;  3SHW A;  2RD1 A;  4LE9 A;  1BCM A;  1RI0 A;  1XQH A;  2KT8 A;  5C0M A;  1BIB A;  3CCR Q;  1SRM A;  4E7J A;  3NGP A;  2L3P A;  3SD4 A;  4OB3 B;  1MMN A;  4MMK A;  1JJ2 P;  4PLI A;  2DE0 X;  3GF5 A;  3UDC A;  3VV0 A;  3J7A F;  2YUP A;  1EFN A;  5IH2 A;  2O31 A;  4LDW A;  3MP6 A;  3QBY A;  4ME7 A;  3ZL7 C;  4OMQ A;  1M27 C;  2M0Y A;  3G4S A;  4HXJ A;  2DO3 A;  1VQN Q;  5A2Q E;  5GAM d;  3PE0 A;  2PUO B;  2IG0 A;  3CCU T;  5GAN g;  1H3Z A;  3I55 A;  5GMK h;  5GAM e;  3QHS A;  4B9W A;  3KFV A;  4DBF A;  4EMK B;  5EG2 A;  2WSC E;  2EGE A;  1B7T A;  2DRK A;  1M8V A;  1O9S A;  4EPC A;  4KUD K;  2QK0 A;  5J3B A;  2CZ6 B;  4J6Y A;  2ED0 A;  5KYX B;  1JEG A;  2RJD A;  3NTH A;  2RF0 A;  4AT1 B;  4F7U B;  5GAO q;  3H41 A;  1Y57 A;  3RKX A;  4OGC A;  4M78 B;  4X34 A;  1G2B A;  4PJO A;  2FRW A;  1Q82 U;  3CXC P;  2L8D A;  4PL6 A;  3M5A A;  1EZZ B;  4DQ2 A;  1WJS A;  1M3A A;  5GAO l;  3MEV A;  2D9T A;  1GFC A;  4M7A D;  1SPK A;  1ZUY A;  1RUW A;  3G7Z A;  2M51 A;  4PJO D;  3M0R A;  3J80 E;  3M58 A;  3S3O A;  1KJW A;  1G8X A;  3VU3 C;  6AT1 B;  1N27 A;  1O75 A;  2L3R A;  3OYI A;  2PVO B;  3HKS A;  4JJD A;  4C5E A;  3C0C A;  1N5Z A;  2RK1 A;  2FPE A;  1FXX A;  1ZUU A;  4RTU A;  3X26 B;  4D6W A;  2OAW A;  1N8R C;  2F2W A;  3UA6 A;  1QQJ A;  1I1J A;  2ABL A;  4V2S A;  1YWO A;  1SKU B;  5FRO A;  3GNG A;  3QDF A;  2PNI A;  1VQM T;  1VQ6 T;  3VYH B;  3OYD A;  3CCQ T;  2F2X A;  1VQ4 T;  2IIM A;  5KYY A;  1KD1 C;  3M0T A;  2XKO C;  3OS5 A;  1OPL A;  2DD4 A;  2QTX A;  4C92 A;  2E6N A;  2HNI A;  2LJ0 A;  1VQ5 Q;  1GBR A;  1VQ6 A;  4HVU A;  1VQM A;  1KC8 U;  1K76 A;  1W6X A;  4C0Z A;  1PD0 A;  3CCQ A;  2LQW A;  1VQ4 A;  2P0Q A;  1NJI R;  5GAN 5;  2EYZ A;  2DZ9 A;  1M4Z A;  4J9E A;  1UHC A;  3MJX A;  4FL6 A;  4F04 B;  4M7A G;  4MDX A;  2GF7 A;  2CSQ A;  3RKY A;  1HSQ A;  2HQX A;  3CME Q;  1NEB A;  2OI3 A;  2RPN A;  2XDP A;  1OYX A;  1OX8 A;  4PJO B;  4OP0 A;  1N9S A;  4X9C A;  3CBM A;  1NEG A;  4ELZ C;  2DMO A;  2MWP A;  2LQK A;  5CKB A;  3PVL A;  1I5L A;  3MO8 A;  3QJY A;  2QQB A;  1HYO A;  3I56 Q;  1VQ9 Q;  3CCJ A;  2BZX A;  1N8R U;  3CC7 T;  1QWF A;  2X51 A;  2RQU A;  1JB0 E;  2FO0 A;  5LJ5 d;  2K2V A;  3VS4 A;  3P8D A;  1BKB A;  1OX9 A;  2BUD A;  3QWY A;  2EYQ A;  2LX7 A;  5LJ5 e;  3BDU A;  3EHQ A;  3MEU A;  3OS2 A;  3CCV T;  4XU1 A;  2VGN A;  1ZSG A;  4M77 A;  2QEX T;  2Z0W A;  3CC7 A;  2KVQ G;  3EFS A;  4M78 C;  5CKD A;  3LH0 A;  4BUG A;  2BZY A;  4Z89 A;  2RK2 A;  2CP0 A;  1UFF A;  3C4S A;  5KYN A;  3L1A A;  5KYU A;  3IQL A;  4KT0 E;  4M7D F;  5FU7 B;  1R0C B;  1NLO C;  2DD5 A;  2G6F X;  4C8Q D;  3JCM b;  3CCV A;  2LX9 A;  4E7L A;  1YIJ T;  3S6W A;  5KYY B;  1K8A R;  2QEX A;  4AG2 C;  3JCM Q;  1B3Q A;  4QKU A;  5FW9 A;  4PFO A;  3OYG A;  2AK5 A;  2P4R A;  2K79 A;  2EPD A;  4C92 B;  4Y28 E;  4ZN3 A;  4JJB A;  3PVQ A;  5GAO r;  1VUB A;  2X9H A;  3LWI A;  4UC4 A;  5ECA A;  1FYN A;  1VQO A;  2BZ8 A;  2RJE A;  1YIJ A;  2CP6 A;  2M9U A;  1M90 C;  1QLY A;  1JU5 C;  5GJV B;  2MI6 A;  4BI3 A;  1QVG S;  3O8V A;  3JCM f;  1ZX6 A;  3OQ5 A;  2RQV A;  1ABQ A;  1KQS A;  2EW3 A;  2G3R A;  2JXB A;  2COY A;  2YRV A;  3OYA A;  3FLG A;  3FEO A;  2KE9 A;  2CKK A;  3D7S B;  5FWC A;  3Q1J A;  3CCL Q;  2LVM A;  2KT1 A;  2DKG A;  1NPR A;  4RTT A;  1UGS B;  4JRI A;  2D6F A;  2YUQ A;  4ZNX A;  4RTV A;  2F2V A;  1OPK A;  2LCL A;  1D09 B;  1YJW A;  4HVV A;  3HHT B;  3QWX X;  5GAM j;  2LC4 A;  4MZT A;  1UGR B;  4AG1 C;  3H9N A;  2RQW A;  3NTI A;  1VQ7 A;  1YHQ T;  2SEM A;  1AZE A;  4FSS A;  2CZ7 B;  2D1X A;  4CC7 A;  2CUD A;  1DJ7 B;  2FL7 A;  2DBK A;  1OZ3 A;  4ZN1 A;  4AFZ C;  1Y07 A;  3VS2 A;  3HRT A;  4C8Q G;  4KH1 B;  5CR2 A;  4B6M A;  2LQ8 A;  2DTH A;  2VGM A;  2CYZ B;  3O5Z A;  3QZ5 B;  4M77 B;  1JXO A;  4PJO C;  3CPF A;  2EAY A;  2DJZ A;  3HP9 A;  4PJL A;  2CZ0 B;  3NPF A;  3R6N A;  5KYU B;  2EQJ A;  4PNO A;  2K4Y A;  4II1 A;  2NYS A;  2R5A A;  1WI7 A;  4N4H A;  4KUL A;  3RES A;  3JCM X;  3H6Z A;  1BI3 A;  4E7Z A;  3G4S Q;  1M90 U;  1IXD A;  2QG9 B;  1UGP B;  1K9A A;  3C12 A;  3G71 Q;  2KSS A;  3LX7 A;  2GTO A;  3R6O A;  4DOV A;  3V7S A;  3HSB A;  3N5B B;  5C6S A;  3I55 Q;  4MZP A;  2LCS A;  1BBZ A;  2V1R A;  2AHJ B;  1QCN A;  2JS2 A;  3OYK A;  2DYI A;  2K7A A;  4GLK A;  4F7U E;  4LDV A;  4MZM A;  2R5M A;  2DL4 A;  3QII A;  1K73 R;  1HK9 A;  4RTW A;  4XTX A;  1G3W A;  1K0S A;  2GGR A;  4M75 F;  1I5O B;  4FT2 A;  2NWM A;  2GFU A;  3OW2 A;  2A28 A;  2XMF A;  1YJ9 T;  1LVK A;  2XG8 D;  1PSE A;  1C1A A;  1RAE B;  2YUN A;  4O6J A;  5DLQ E;  3HRU A;  5HK0 A;  3J81 E;  2KK4 A;  2CGH A;  4FW2 A;  4N0A C;  2WSF E;  4JJC A;  2O88 A;  3ER0 A;  4J9D A;  1E6G A;  4C92 C;  2QA4 Q;  1YJ9 A;  2DYB A;  2CDT A;  2QGG A;  1I8F A;  4C0D C;  1WHM A;  4BE0 A;  3CC4 T;  4IKF A;  2KYB A;  3VS7 A;  4ZGE B;  1PM3 A;  5LJ3 d;  5GAN 8;  2DXB A;  2E64 A;  4RG8 A;  1TUD A;  2EQK A;  1WHL A;  5IHK A;  2LT4 A;  2JZ2 A;  3QYH B;  2Y90 A;  5LJ3 e;  5KYW A;  2FVU A;  3M0S A;  2BTT A;  3OMC A;  1VOM A;  4FYX B;  3CC4 A;  3TSZ A;  2FYK A;  4JRP A;  2PUK B;  2VKN A;  2NUT A;  5CO7 A;  4ELY C;  1M1F A;  4QVZ A;  3WVD B;  2RO0 A;  2E10 A;  5GAN d;  3RNJ A;  4EMG A;  1AHJ B;  1SF9 A;  1UEB A;  2E5K A;  3QSU A;  3QPH A;  4J9G A;  3F70 A;  1JJ2 A;  1RAH B;  4D8K A;  5EC7 A;  5I21 A;  2EQU A;  2JT4 A;  3DB3 A;  4JLI A;  1QWE A;  5GAN e;  3HFN A;  1X43 A;  2C0T A;  1C6V X;  2FRY A;  2H3E B;  1FX7 A;  4ZTF A;  3KXT A;  2MWO A;  2QTV A;  3UAT A;  5GAO n;  3OYH A;  1VQM Q;  1VQ6 Q;  2LJ3 A;  4CC2 A;  2COZ A;  3L2R A;  4OMF B;  4M4Z A;  3CCQ Q;  1M1K R;  1RAI B;  5LJ5 j;  1VQ4 Q;  2ZGW A;  1QVF S;  4DOW A;  3FJ5 A;  3UPU A;  2HBW A;  3NMZ C;  1X69 A;  4A4G A;  4M77 C;  1IRX A;  4QQD A;  4PJO E;  3CCE T;  2HAX A;  2JNG A;  1IB8 A;  4MDW A;  2CUB A;  2X4Y A;  3RMQ A;  3AHU A;  3LGF A;  2EGA A;  5CKH A;  3A98 A;  5LJ3 g;  2DAQ A;  8AT1 B;  3LW5 E;  5GAN 6;  1YIT T;  3LLR A;  2DL5 A;  2V8K A;  4J9F A;  2PVG B;  1UB4 A;  2VXF A;  3CCE A;  2RI5 A;  1K4U S;  1RAG B;  4J83 A;  2J7I A;  2OAU A;  3JCM J;  1YI2 T;  5GAM f;  5GAM h;  3CXC A;  2E41 A;  1MHN A;  3OYC A;  2EYY A;  3CCJ Q;  2QXF A;  3CQT A;  5IXB A;  1YIT A;  1KQ1 A;  2R58 A;  4LDY A;  3OMG A;  2VV5 A;  4F16 A;  2VVK A;  3VYG A;  3OA6 A;  4M7D D;  4RUG A;  1M2V B;  1VQP Q;  2CS7 A;  5KYW B;  2AZS A;  1NG2 A;  4N4G A;  3CCS T;  1LCK A;  1WHJ A;  2DET A;  1VQK T;  4HKE A;  3CCU A;  2NUT B;  1T3L A;  1U3O A;  3REA B;  3RR6 A;  2KRM A;  4C92 E;  2RQR A;  1SSH A;  1WHK A;  4M7A A;  1QVG P;  1KC8 C;  1VYT A;  2MYS A;  2O2O A;  1VIE A;  1WNL A;  4M75 E;  1WLP B;  4IUV A;  5KH6 A;  3CCV Q;  1WX6 A;  3KUF A;  3MKD A;  2O01 E;  4JDS A;  2B86 A;  1VQ8 T;  3CCS A;  1SEM A;  1WFW A;  2CP3 A;  2QEX Q;  1Q86 R;  5CKF A;  1BB9 A;  5GAO p;  1VQK A;  1MV3 A;  4PFP A;  4OVA A;  2A3L A;  2DVJ A;  2EJG A;  4FYY B;  1AWW A;  4Z8A A;  3A8O B;  1TG0 A;  5GMK e;  1FMK A;  4AFS C;  3RKW A;  5KE2 A;  4A4K A;  2DL7 A;  1K1Z A;  1VQO Q;  2DEU A;  2NUZ A;  4BE2 A;  3MP1 A;  1YIJ Q;  4BB7 A;  1ABO A;  3OYJ A;  2KRN A;  2EQM A;  4PFZ A;  2R57 A;  4ORZ A;  3ZFJ A;  3G6E T;  2OTL T;  2JVV A;  3BDL A;  1M3C A;  1WIE A;  1Z9Z A;  2E65 A;  1ACM B;  4J5Y A;  1Q81 C;  3V8L A;  3M4G A;  1YJN T;  2FPF A;  2RA2 A;  3OYN A;  2O4X A;  2JM9 A;  3G6E A;  2OTJ T;  2A36 A;  2MOX A;  2OTL A;  1OV3 A;  2YRC A;  3CCM Q;  4IUT A;  3PNW C;  3PGG A;  4KGZ B;  4M7D G;  4IIM A;  1YJN A;  1CSK A;  2F5T X;  1YJW Q;  2CH4 W;  2RN8 A;  4N0A A;  3RIR A;  2YUO A;  1VQ7 Q;  1V1C A;  3WXM B;  2DA9 A;  3CEY A;  1TWB A;  3GOX A;  2GTJ A;  1ZA2 B;  2ZZD A;  4M77 E;  5CQY A;  2OTJ A;  4RCB A;  3ZEH A;  4FW1 A;  1UJ0 A;  2XHC A;  2KRO A;  5HK3 A;  2FZK B;  2K6D A;  5GJW B;  2D8H A;  3M0U A;  2XDB A;  2XD0 A;  3AT1 B;  4AMC A;  3CD6 T;  3QDR B;  2RB6 A;  1X2Q A;  4PJN A;  3PIP A;  3CMA T;  2XDD A;  4A4F A;  5FU6 B;  3SEM A;  1IGQ A;  1VQL T;  3I35 A;  3HFO A;  4B9X A;  5KE3 A;  3L42 A;  1CKA A;  1E6H A;  3M59 A;  4OB1 B;  3A1P A;  3UF4 A;  4M7A B;  2EJF A;  2ZPE B;  2LT1 A;  1D3B A;  4LD9 K;  2VWF A;  1PRL C;  1EX4 A;  2X4X A;  3CD6 A;  4RMO A;  2RHZ A;  1HJD A;  3DLM A;  4PKC C;  4E7S A;  3CCR T;  1SHF A;  4RTY A;  3TU4 K;  1N8R R;  3CMA A;  4XTZ A;  2PZ1 A;  2KMT A;  4DEY A;  1Q7Y C;  1BI2 A;  1LNX A;  1UJY A;  3FIF A;  1Q81 U;  4F7U F;  3JV3 A;  4DBQ A;  1AWO A;  5LJ5 f;  5LJ5 h;  2PTK A;  1KIK A;  4RTX A;  4E6R A;  4M78 F;  1PKT A;  3BW1 A;  4Z02 A;  1W4S A;  1D0Y A;  2AKK A;  1KD1 R;  5LJ3 j;  1YCS B;  2OX7 A;  1K8A C;  3A8L B;  1SRL A;  4Y92 A;  1PG5 B;  2H8H A;  2EBP A;  2K9G A;  1Y0M A;  4FCY A;  1TH7 A;  2DEQ A;  3GLX A;  4FYW B;  5FLX E;  3RER A;  4HT9 A;  4LXC A;  2KYM A;  4BDY A;  2HKQ B;  1GCQ C;  1UHF A;  2J6O A;  4Q5W A;  2QDL A;  4MML A;  4C8Q A;  2HSP A;  2ZPF B;  2O4X B;  4J8O A;  1PRM C;  2O9S A;  5GAN j;  4OGE A;  1WXT A;  2QAS A;  2E5Q A;  5I2S A;  1WJQ A;  2FB7 A;  2JW4 A;  2LDM A;  1KK7 A;  1YJ9 Q;  1Y96 A;  1R8O B;  1M5Q 1;  3PTA A;  1HD3 A;  1K9M C;  2DXT A;  3MHX A;  4OMP A;  2JTM A;  2AZV A;  2YWW A;  1Q95 G;  2W0Z A;  1IGU A;  1V76 A;  1XOV A;  3OYB A;  5GAN 2;  4C0D B;  1J3T A;  3PIO A;  3QJ6 A;  4J9H A;  4A53 A;  2DFU A;  2V8I A;  3URG A;  4M75 G;  1TU0 B;  1Q7Y U;  2OJ2 A;  2O9V A;  1QVF P;  3M55 A;  2HQE A;  2XID A;  2ECZ A;  2J06 A;  3VJP A;  4F14 A;  3GBQ A;  3JCM h;  2V26 A;  3MP8 A;  2JMA A;  1UUE A;  3A8H B;  4E7K A;  1M8M A;  2LJ1 A;  1GRI A;  2KBT A;  3ME9 A;  1D3B B;  2K3X A;  3PFS A;  4JUV A;  2IVW A;  1K8A U;  1GFD A;  1GL5 A;  1KQ2 A;  5L23 A;  2DF6 A;  4HCK A;  4OF1 A;  1PKS A;  2GBQ A;  2B8A A;  3LH5 A;  2Y4X A;  1K0X A;  1TSF A;  2XK0 A;  2JTF A;  3H0H A;  2L3S A;  2YSQ A;  1TOV A;  1U1S A;  4XQ3 A;  2CT4 A;  4FT4 A;  4PJO F;  2KAF A;  1OQK A;  1AWX A;  4FIB A;  4BD3 A;  4NL3 A;  3T9N A;  5IHI A;  3EH1 A;  1X01 A;  5FU6 C;  5AYF A;  5AT1 B;  1VQ5 T;  4BI4 A;  4JZ3 A;  4XAX B;  4OB2 B;  2L2P A;  1TS9 A;  4HA8 A;  1D0Z A;  4PJM A;  1X6B A;  3TQ7 P;  4M7A C;  4IUR A;  4NS5 A;  1JO8 A;  4C8Q B;  3I5S A;  1M90 R;  5D6X A;  1K73 C;  1K9M U;  1YHQ A;  1PCX A;  2QAZ A;  1AZG B;  4IUU A;  3CCE Q;  2KGT A;  1VQ5 A;  1OEB A;  1QKW A;  4BY6 B;  2KR3 A;  4RG2 A;  2DK3 A;  1UG1 A;  2A0F B;  5GMK j;  1BIA A;  4LN2 A;  2D0Q B;  4C0F A;  1Y96 B;  2K5L A;  3CC2 T;  2PVD B;  4C5G A;  4L5G A;  3V7R A;  3EG1 A;  3M0P A;  4OMN A;  4ANJ A;  4JS5 A;  3L2Q A;  4ZTJ A;  1ARK A;  2PQW A;  4YTL A;  1YIT Q;  1RAD B;  3EGD B;  4WF2 A;  2KQW A;  2DJQ A;  2QQS A;  5IN1 A;  1H8K A;  1NYG A;  1E7O A;  2D8J A;  3FDR A;  1BU1 A;  5A0L A;  5A0G A;  3GNF B;  1XTD A;  3I56 T;  1VQ9 T;  3CC2 A;  2CP2 A;  2CSI A;  1ZQ1 A;  4RTZ A;  7AT1 B;  3CPW S;  3EG3 A;  4C92 F;  4M78 E;  3I5R A;  2EIF A;  3CCU Q;  2C0I A;  2HD0 A;  3OBY A;  4IIO A;  4E7I A;  1UGQ B;  3OB9 A;  1VQ9 A;  1AVZ C;  3VS3 A;  3CCS Q;  4RKU E;  2KXC A;  3JCM V;  2XI9 A;  2AT1 B;  2ROL A;  2K3Y A;  2Y4Y A;  1R77 A;  2QGF B;  2QYZ A;  1W2B S;  2VAS A;  1AOJ A;  2HCK A;  3I9Q A;  3VS6 A;  5LJ3 f;  1MUZ A;  3JCM c;  5I11 A;  3CBO A;  3P8H A;  1D1A A;  5D6W A;  3QZ9 B;  1K73 U;  2DBM A;  1X27 A;  2M16 A;  2MK5 A;  4XK8 E;  1WJR A;  2E1H A;  4GLM A;  3ZBD A;  3QKJ A;  2L3Q A;  3UWN A;  1M2V A;  1M1K C;  2ESW A;  2V8J A;  3M56 A;  3QXE B;  1T3S A;  2GFA A;  1LPL A;  1XJW B;  5GAN f;  4LUE A;  5GAN h;  3BY7 A;  3M4Y A;  5FRM A;  3E1S A;  3G6E Q;  2OTL Q;  3OSV A; 
#chains in the Genus database with same CATH homology
 4X9C A;  3KUF A;  3VUB A;  2O01 E;  3CBM A;  4JDS A;  4Y91 A;  1VQ8 T;  3CCS A;  4ELZ C;  5DM7 R;  2MWP A;  2LQK A;  5DLO A;  3EFR A;  3X20 B;  3PMT A;  1QP2 A;  5CKF A;  3V7C A;  5CKB A;  3QYG B;  1I5L A;  3MO8 A;  4FSX A;  5GAO p;  2ZCF B;  1VQK A;  3JB9 I;  4M77 F;  4OVA A;  2BKD N;  3QJY A;  4C8Q E;  2QQB A;  2A3L A;  2EJG A;  3EAE A;  1G3Y A;  2DZC A;  3A8O B;  3CCJ A;  5GMK e;  3SDZ A;  1N8R U;  3CCL T;  3CC7 T;  3UT1 A;  3CME T;  3RKW A;  4M77 G;  5KE2 A;  3X24 B;  1JB0 E;  4A4K A;  5LJ5 d;  4E7H A;  2K2V A;  2GQV A;  1HXD A;  3P8D A;  3OBW A;  1BKB A;  4BE2 A;  2E12 A;  3MP1 A;  2PU9 B;  2BUD A;  4BB7 A;  3OYJ A;  1G3S A;  2EYQ A;  2EQM A;  2R57 A;  5DY9 A;  3ZFJ A;  3G6E T;  2OTL T;  2DXU A;  5LJ5 e;  2QDY B;  2JVV A;  1U1T A;  3BDU A;  4EMH A;  3MEU A;  3BDL A;  2MMP A;  2H3J A;  2E65 A;  3OS2 A;  5KCO A;  3CCV T;  4M7A E;  5HKC A;  4XU1 A;  2QQ9 A;  2VGN A;  3A8G B;  1H64 1;  2YLC A;  4J5Y A;  4M77 A;  4ZGJ B;  2QEX T;  1Q81 C;  3V8L A;  3M4G A;  4R56 A;  3CC7 A;  3CCL A;  1YJN T;  2DTI A;  1EIF A;  2KVQ G;  2QQR A;  3EFS A;  4M78 C;  4C8Q C;  5CKD A;  3CME A;  3LH0 A;  4BUG A;  1OI1 A;  2RK2 A;  4C5H A;  5I2M A;  3JB9 J;  3C4S A;  3L1A A;  2RA2 A;  4XU3 A;  3OYN A;  2O4X A;  2P0K A;  3OYF A;  3PMI A;  2RHX A;  3JCM P;  4KT0 E;  4M7D F;  5FU7 B;  4BY6 C;  3G6E A;  2OTJ T;  2OTL A;  2DD5 A;  3QO3 A;  3CBP A;  4C8Q D;  3JCM b;  3CCV A;  2GCX A;  4JRK A;  2LX9 A;  4IUT A;  3PNW C;  4E7L A;  1YIJ T;  3PGG A;  3S6W A;  5GAO m;  3JB9 H;  4M7D G;  2BIV A;  2DVE A;  2QEX A;  3JCM Q;  1YJN A;  1IRE B;  3L2Z A;  4QW2 A;  2F5T X;  3OYG A;  4QQ6 A;  3JCM g;  2YHT A;  1QVG A;  2WSE E;  3VKI A;  1OZ2 A;  5CVI A;  2LCC A;  4C92 B;  4NL2 A;  3KBG A;  4Y28 E;  4N0A A;  3RIR A;  2FHD A;  4ZN3 A;  3I56 A;  3WXM B;  4P5N A;  4R55 A;  1I81 A;  3LYI A;  1KHC A;  1VUB A;  3CEY A;  5GAO r;  2QQA A;  3GOX A;  5IAY A;  2ZZD A;  4RCC A;  4UC4 A;  3LWI A;  4M77 E;  1M1K U;  5CQY A;  2OTJ A;  4XU0 A;  4M7D A;  1VQO A;  3C94 A;  4RCB A;  3ZEH A;  1RL2 A;  3G4S T;  2RJE A;  2XHC A;  3TRE A;  1YIJ A;  5HK3 A;  1Q86 C;  1V29 B;  2M9U A;  4IUV A;  3G71 T;  2RHI A;  1M90 C;  3OY9 A;  3OYL A;  2MI6 A;  2XDB A;  3E9F A;  5FU7 C;  4BI3 A;  2XD0 A;  1QVG S;  5LJ3 h;  3HL8 A;  3O8V A;  3OYM A;  1MGQ A;  1QVP A;  3QDR B;  1SSF A;  2RB6 A;  3JCM f;  1LOJ A;  3I55 T;  3CD6 T;  4L6V 5;  2X4W A;  3ASK A;  4LDU A;  2RM4 A;  3OQ5 A;  3DB4 A;  1WGS A;  3PIP A;  4DA4 A;  1YI2 A;  1KQS A;  3CMA T;  2XDD A;  5J39 A;  4A4F A;  5FU6 B;  2G3R A;  3NTK A;  2ZPI B;  2YRV A;  4NOY A;  4OB0 B;  3OYA A;  3FLG A;  5IT9 E;  3FEO A;  1VQL T;  3HFO A;  3P8B B;  4B9X A;  5KE3 A;  3L42 A;  2CKK A;  3M59 A;  4CI0 C;  4OB1 B;  1FWZ A;  1YBY A;  5GMK m;  3GP8 A;  3G71 A;  3Q1J A;  2LVM A;  4XU2 A;  4M7A B;  2DKG A;  2EJF A;  1NPR A;  2ZPE B;  2LT1 A;  4M75 C;  4E47 A;  4C0G A;  1D3B A;  1UGS B;  4JRI A;  4FU6 A;  3JB9 D;  4ZGD B;  3QG1 A;  1S72 A;  4LD9 K;  2D6F A;  2X4X A;  3CD6 A;  4RMO A;  2RHZ A;  2LRQ A;  3DLM A;  3PT9 A;  2VXE A;  4PKC C;  3CCR T;  2LCL A;  3TU4 K;  4M7D E;  3CMA A;  2F69 A;  4XTZ A;  2M0O A;  2KMT A;  3HHT B;  5GAM j;  1YJW A;  2WAC A;  1KQS S;  2DTO A;  2LC4 A;  4MZT A;  1UGR B;  3HRS A;  1Q7Y C;  5LL6 S;  3M54 A;  1BI2 A;  3NTI A;  1LNX A;  4FM4 B;  3FIF A;  1VQ7 A;  1Q81 U;  4F7U F;  3M9Q A;  1WQW A;  3A8M B;  2M1H A;  1YHQ T;  1X6O A;  5GMK i;  5LJ5 f;  4HCZ A;  5LJ5 h;  2YLB A;  2EWN A;  2CZ7 B;  1I4K 1;  4M78 F;  3OSS C;  1JBM A;  3NFC A;  2RJC A;  3BW1 A;  4C8Q F;  4EMK A;  4Z02 A;  4F7U G;  1W4S A;  3L2W A;  1DJ7 B;  1G3T A;  2FL7 A;  2MAM A;  5LJ3 j;  1K8A C;  1OZ3 A;  3MEW A;  4ZN1 A;  5KCH A;  1Y07 A;  1N9R A;  3A8L B;  3HRT A;  4M78 G;  2QA4 T;  4C8Q G;  2EFI A;  4O5V A;  3FB9 A;  2EJ9 A;  2EKO A;  5CR2 A;  4LDX A;  1BYM A;  4BAC A;  2LQ8 A;  2DTH A;  2CZ1 B;  2VGM A;  2CYZ B;  1TH7 A;  4JLG A;  2DEQ A;  3GLX A;  3QZ5 B;  5FLX E;  4M77 B;  1M9S A;  3DKM A;  5M9O A;  3M57 A;  1VQ8 A;  3RER A;  4HT9 A;  1B34 A;  4F7U A;  1M1G A;  3OYY A;  4BDY A;  4PJO C;  3CPF A;  3SWN C;  3L2U A;  2EAY A;  2DJZ A;  5D6Y A;  4Q5W A;  3HP9 A;  4M78 A;  1BI1 A;  4MML A;  2CZ0 B;  4C8Q A;  4XTY A;  3JRZ A;  2A7Y A;  4N4I A;  2ZPF B;  2JUF A;  2DXC A;  2O4X B;  3HPW A;  4J8O A;  2QA4 A;  2EQJ A;  4PNO A;  2K4Y A;  4II1 A;  4J7F A;  1X75 C;  2R5A A;  5GAN j;  1NJI C;  4OGE A;  3CPW A;  4N4H A;  4KUL A;  4BE1 A;  2E5Q A;  3RES A;  5I2S A;  3JCM X;  3H6Z A;  1BI3 A;  1WJQ A;  2FB7 A;  2JN0 A;  1Q86 U;  1M90 U;  2C06 A;  2LDM A;  3FC3 A;  4BDZ A;  1UGP B;  3C12 A;  2KSS A;  1NZ9 A;  4KBM B;  1Y96 A;  1R8O B;  3LX7 A;  1M5Q 1;  3PTA A;  4DOV A;  3R6O A;  3V7S A;  4M78 D;  3SFM A;  1QP3 A;  1VIF A;  3TCJ A;  2KDS A;  3HSB A;  3N5B B;  5C6S A;  4MZP A;  1BI0 A;  4EDU A;  5CCA A;  3MET A;  1Q82 C;  5FRN A;  2L5Q A;  4L59 A;  1WPY A;  2AHJ B;  5GAN 7;  1K9M C;  2DXT A;  1IZ6 A;  3MHX A;  3JB9 F;  2JTM A;  3VUZ A;  5GAM g;  4C5I A;  3OYK A;  4M7D B;  2K57 A;  4GLK A;  4F7U E;  4LDV A;  2RI3 A;  4MZM A;  1NE8 A;  2R5M A;  4PLL A;  1WQ7 A;  3JB9 G;  1KG1 A;  3BFM A;  3QII A;  1HK9 A;  2E70 A;  2I2L A;  1G3W A;  1NPP A;  1XOV A;  2RJF A;  4XTX A;  3RUX A;  4J7I A;  4QVC A;  3OYB A;  3OYE A;  4JJN K;  5GAN 2;  4C0D B;  3MEA A;  4M75 F;  4FT2 A;  1W2B A;  4TVR A;  1Y71 A;  2GFU A;  2RD1 A;  3OW2 A;  3PIO A;  3QJ6 A;  4BI8 B;  1RI0 A;  1XQH A;  4A54 A;  4A53 A;  5C0M A;  5GMK l;  1BIB A;  1YJ9 T;  5GAN 3;  2XG8 D;  2V8I A;  3URG A;  2DIQ A;  4M75 G;  1Q7Y U;  1PSE A;  4E7J A;  3M55 A;  2HQE A;  2HBP A;  2XID A;  4J6W A;  3SD4 A;  3VJP A;  3E19 A;  4O6J A;  4OB3 B;  5DLQ E;  3JCM h;  3HRU A;  4MMK A;  1PSF A;  4PLI A;  2E6Z A;  2KK4 A;  3MP8 A;  2CGH A;  4XTV A;  5HK0 A;  3J81 E;  3GF5 A;  3UDC A;  4IUQ A;  3A8H B;  4N0A C;  2WSF E;  5CQX A;  3VV0 A;  4E7K A;  1U8R A;  3J7A F;  3TEE A;  1VQP T;  1P92 A;  3MP6 A;  4LDW A;  3ME9 A;  3QBY A;  4ME7 A;  1S72 T;  1D3B B;  2K3X A;  3ER0 A;  3PFS A;  2IVW A;  4JUV A;  1K8A U;  1GXI E;  3G4S A;  1KQ2 A;  4X9D A;  4QQG A;  4C92 C;  2DO3 A;  4QVD A;  4M75 A;  3OW2 S;  5A2Q E;  5GAM d;  4OF1 A;  1YJ9 A;  2PUO B;  2MF2 A;  2B8A A;  2IG0 A;  1JRI A;  2X4J A;  3CCU T;  4A4E A;  2Y4X A;  1I8F A;  4GY5 A;  5GAN g;  4C0D C;  3A5Z B;  1H3Z A;  4XTW A;  3I55 A;  4BE0 A;  5GMK h;  2XK0 A;  2JTF A;  3CC4 T;  2QI2 A;  2RH2 A;  5GAM e;  4IKF A;  2DIG A;  2VYT A;  3QHS A;  1U1S A;  4B9W A;  3OS0 A;  4C92 D;  2RI2 A;  4ZGE B;  1VQL A;  4XQ3 A;  3E9G A;  4FT4 A;  5LJ3 d;  4EMK B;  4PJO F;  2KAF A;  5GAN 8;  5EG2 A;  2DXB A;  2WSC E;  2E64 A;  4FIB A;  4RG8 A;  3L2V A;  2EQK A;  4IUP A;  4M75 D;  4BD3 A;  4NL3 A;  1M8V A;  1O9S A;  3T9N A;  2ZPB B;  4EPC A;  4PJO G;  4KUD K;  1NJI U;  2LT4 A;  1X01 A;  5FU6 C;  5J3B A;  2JZ2 A;  3QYH B;  5AYF A;  2Y90 A;  5LJ3 e;  2CZ6 B;  4J6Y A;  2FVU A;  2ZPG B;  3CCJ T;  1VQ5 T;  3OMC A;  3LWH A;  4BI4 A;  1VQN T;  2RJD A;  4XAX B;  3NTH A;  4OB2 B;  4XTU A;  3CCR A;  3CC4 A;  3S3N A;  2FYK A;  4HA8 A;  4JRP A;  1YCY A;  2PUK B;  1B34 B;  4F7U B;  2DPP B;  5GAO q;  5CO7 A;  4M7A C;  3RKX A;  4IUR A;  4ELY C;  4NS5 A;  1ZHI A;  3S3M A;  2JOY A;  4OGC A;  1M1F A;  4M78 B;  4C8Q B;  4X34 A;  4PJO A;  3SWN A;  1Q82 U;  5D6X A;  4QVZ A;  3WVD B;  2L8D A;  1K73 C;  2RO0 A;  4PL6 A;  1K9M U;  3M5A A;  1YHQ A;  2E10 A;  5GAN d;  1Y7X A;  3V8K A;  4EMG A;  4DQ2 A;  1AHJ B;  5CAI A;  3X25 B;  1N6A A;  4IUU A;  1UEB A;  1WJS A;  1QVF A;  3QSU A;  1G5V A;  3QPH A;  4A4H A;  1VQ5 A;  3F70 A;  4EMK C;  1QW1 A;  5GAO l;  1JJ2 A;  3MEV A;  3INZ A;  2D9T A;  1VQN A;  4BY6 B;  4CRI A;  5I21 A;  4M7A D;  2EQU A;  2DK3 A;  4RG2 A;  3V8J A;  3DB3 A;  4JLI A;  5GMK j;  5GAN e;  1BIA A;  3HFN A;  2D0Q B;  4C0F A;  1Y96 B;  2K5L A;  3G7Z A;  5L8R E;  5GAN 4;  3CC2 T;  3SB2 A;  4JS4 A;  2PVD B;  1FX7 A;  4ZTF A;  3KXT A;  4PJO D;  4C5G A;  4L5G A;  3C95 A;  3J80 E;  1ZBX A;  2MWO A;  3M53 A;  3V7R A;  3M58 A;  5GAO n;  5J26 A;  3OYH A;  4JS5 A;  3S3O A;  2P0P A;  3L2Q A;  3L2R A;  4ZTJ A;  2PQW A;  4YTL A;  4OMF B;  3VU3 C;  4WF2 A;  1VQP A;  3MCA B;  5LJ5 j;  1N27 A;  2KQW A;  1KD1 U;  2KY9 A;  2ZGW A;  1O75 A;  5HY6 A;  4HCB A;  2L3R A;  2QQS A;  5IN1 A;  1QVF S;  3OYI A;  2K5F A;  2PVO B;  2XIC A;  3HKS A;  4VUB A;  4DOW A;  3UPU A;  1JJ2 S;  3FDR A;  1LJO A;  4A4G A;  4M77 C;  4C5E A;  5A0L A;  2L89 A;  4QQD A;  5A0G A;  4PJO E;  2RK1 A;  3GNF B;  1XTD A;  3I56 T;  1VQ9 T;  3CC2 A;  3CCE T;  1ZQ1 A;  1FXX A;  2VUB A;  3CPW S;  2HAX A;  2ZPH B;  3X26 B;  4D6W A;  4ATO A;  2JNG A;  1N8R C;  4MDW A;  4C92 F;  4M78 E;  4J6X A;  4V2S A;  1VQO T;  2X4Y A;  2EIF A;  3RMQ A;  3AHU A;  3LGF A;  4M77 D;  3GNG A;  5FRO A;  2HD0 A;  3OBY A;  5CKH A;  4C92 G;  5LJ3 g;  1VQ6 T;  2DAQ A;  1VQM T;  3LW5 E;  5GAN 6;  3VYH B;  1YIT T;  3LLR A;  4HT8 A;  3OYD A;  4E7I A;  2V8K A;  2XU8 A;  3CCQ T;  2LNV A;  2PVG B;  2K5I A;  1VQ4 T;  1UB4 A;  1UGQ B;  2RHU A;  2VXF A;  3OB9 A;  3CCE A;  2RI5 A;  1VQ9 A;  1KD1 C;  4J83 A;  2XKO C;  3OS5 A;  2OAU A;  3JCM J;  1YI2 T;  5GAM f;  3GPL A;  5GAM h;  4RKU E;  3JSC A;  1KHI A;  4M75 B;  3CXC A;  3QUI A;  4JRQ A;  3JCM V;  2E41 A;  1MHN A;  2DD4 A;  2LTO A;  2QTX A;  2XI9 A;  3WVE B;  4C92 A;  3OYC A;  2K3Y A;  2Y4Y A;  2E6N A;  2HNI A;  4M7D C;  2QXF A;  3X28 B;  2P4T A;  1W2B S;  1VQ6 A;  4LD6 A;  1VQM A;  1KC8 U;  3FRN A;  4C0Z A;  1YIT A;  1KQ1 A;  2R58 A;  4LDY A;  5LJ3 f;  3JCM c;  5CKE A;  3DLL A;  3CCQ A;  2P0Q A;  1VQ4 A;  3CCM T;  3CBO A;  3P8H A;  5GAN 5;  3OMG A;  2NLU A;  2DZ9 A;  3FJP A;  3JAM E;  5D6W A;  4M7A F;  1M4Z A;  3QZ9 B;  3JCM W;  2VV5 A;  2VC8 A;  1K73 U;  3VYG A;  1YJW T;  3OA6 A;  4KUI A;  4M7D D;  3CXC S;  5A0D A;  3GIB A;  4FL6 A;  2M16 A;  2RHY A;  2F5K A;  4XK8 E;  4M7A G;  4MDX A;  2CS7 A;  3LGL A;  2GF7 A;  5LJ5 g;  1VQ7 T;  1WJR A;  2E1H A;  4N4G A;  3JCM d;  3CCS T;  5CIU A;  3OS1 A;  3RKY A;  3ZBD A;  3QKJ A;  1XNI A;  2HQX A;  3UWN A;  1VQK T;  1M1K C;  2V8J A;  3M56 A;  3QXE B;  4HKE A;  3CCU A;  3CCM A;  2XDP A;  4HCC A;  1OYX A;  3JCM e;  2GFA A;  4C92 E;  2X35 A;  5GAN f;  4OP0 A;  4PJO B;  3SWN B;  5GAN h;  5CK9 A;  4M7A A;  3BY7 A;  1KC8 C;  3M4Y A;  1VIE A;  3RMS A;  3E1S A;  5FRM A;  1WNL A;  4M75 E;  1N9S A;  3OSV A;  5KH6 A;  3H8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...