4RTZA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide vsl12
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide VSL12
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 16
structure length 61
sequence length 61
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtzA00
2ROTA 2X3XD 2KYMA 4IIMA 3R6NA 2KT1A 4ESRA 3M0PA 2M51A 1XOVA 3TVTA 4JJCA 2JTEA 2VVKA 4J9DA 4LUDA 3M0TA 5ECAA 4Z8AA 2KT8A 2LNHB 1YWOA 5GJVB 1Y0MA 4HVVA 1M30A 1UJ0A 1V1CA 1M3BA 3EGUA 1NYFA 1HJDA 1ZX6A 1I0CA 2DYBA 4J9FA 2CDTA 2A36A 1ZBJA 2W0ZA 2DL4A 3A98A 1S1NA 1WFWA 2FPEA 4WCIA 3H0FA 2LJ1A 1K1ZA 4RTYA 4CC7A 2ROLA 1VA7A 1UECA 2O9VA 2RQTA 2KRNA 4ORZA 3EHQA 2JW4A 1SHFA 1QCFA 2FPFA 2DM1A 3VS7A 4FSSA 1MV0B 2RNAA 2OI3A 4KRTA 3I5SA 4HVWA 2AKKA 2DE0X 2JT4A 2CUDA 2K6DA 1G2BA 1UE9A 1GCPA 3EG3A 2RQRA 1TG0A 2GGRA 2J6FA 1E6GA 1M27C 2O2OA 2YUOA 1K76A 1SRMA 2KRMA 1Y57A 2FRWA 1EFNA 1TUDA 2D0NA 2E5KA 3SHWA 3UATA 4AFSC 4D8KA 1T0JA 1GFDA 4CC4B 1RI9A 4AFZC 3JV3A 2AK5A 2JM8A 2EVRA 3ULRB 1JQQA 2NWMA 2DBMA 2HSPA 3H41A 4OMMA 2IIMA 3SEMA 1SEMA 2HBWA 2L0AA 3CQTA 1N5ZA 2EGAA 1H92A 2CH4A 2KEAA 4RTXA 2D1XA 3VS6A 1UDLA 2C0OA 2KRSA 2LX7A 2A37A 2KYBA 1UFFA 2LQWA 4OMQA 1WLPB 4HXJA 1ABOA 2KE9A 2RQVA 2CH4W 2RN8A 1H3HA 4DEXA 2DLPA 1BK2A 3VRYA 3VS3A 3NMZC 1AD5A 1OPLA 1SRLA 1T3SA 2EYZA 2GBQA 5IH2A 2BZYA 4CC3A 5FWBA 2J6OA 4LE9A 3NPFA 1GBRA 1YNZA 1UHCA 5I22A 2JM9A 2ABLA 2J7IA 3EG1A 3UA6A 1VYVA 2RPNA 4ZNXA 1Z9QA 1X2QA 2QDLA 2DMOA 1PHTA 4RTZA 3ZL7C 1ZUUA 3RNJA 1OEBA 4Z88A 2V1QA 1AZGB 1WI7A 1K9AA 1M3AA 2KNBB 1BU1A 1I1JA 3M0UA 4E6RA 4GLMA 4OMPA 4RTVA 1X69A 3REBB 3UF4A 3H0IA 5EC7A 2F2WA 5I11A 2EGEA 1GL5A 1GFCA 1K0SA 2DJQA 1AWJA 1NLPC 1UTIA 2DRMA 4D8DA 3M0RA 2K2MA 1AOJA 3VRZA 1BBZA 2G6FX 3TSWA 1PRLC 1UGVA 2F2VA 3O5ZA 1PKTA 4RTTA 2LP5A 1QKXA 1X27A 2DL5A 1KIKA 1SSHA 2YUQA 1NM7A 1K0XA 2GTJA 4F17A 2LMJA 2VKNA 2K7AA 2RF0A 2L2PA 2OJ2A 2JS2A 5FWCA 2DNUA 4J9HA 2CT3A 2YDLA 1U5SA 2JXBA 3THKA 4JJBA 1U06A 2EBPA 1AWWA 2FPDA 4EIKA 2H8HA 2CSQA 1WDXA 1X2KA 2X3WD 1OPKA 4JZ3A 1K4US 2FRYA 3NHNA 1GCQA 1WXTA 2LZ6B 2BZ8A 3QWYA 3REAB 1JXOA 1WIEA 2AKLA 2DX1A 1OOTA 1AWOA 1VYUA 2V1RA 2NUZA 1SPKA 3EG2A 1RLQC 5IHNA 1FYNA 1PNJA 2RMOA 4AFUC 2M0YA 4J9BA 2B86A 2J6KA 1QLYA 3FJ5A 2HDAA 3GBQA 5IXFA 2A08A 4OMLA 2PZ1A 4QT7A 2DL3A 2MIOA 2KGTA 1AEYA 4RTWA 2VWFA 2GQIA 3EHRA 1UHFA 1X6GA 1QKWA 2FO0A 4F16A 2PTKA 1WYXA 2LJ0A 2LJ3A 1MV3A 1YWPA 2KBTA 2GTOA 1ZLMA 2BZXA 1ZUKA 1SHGA 1RLPC 1AVZC 2GNCA 1T3LA 2HEQA 4AG2C 1ZUYA 3TSZA 1U3OA 1QWFA 2EYWA 2JMAA 1YP5A 3I9QA 4AFQC 1W1FA 3VS5A 2JS0A 2YUNA 1RUWA 2CSIA 2KROA 2LQNA 4J9GA 4JZ4A 2KR3A 2ENMA 1JXMA 2J05A 2SEMA 4RTUA 1AWXA 1ABQA 2EGCA 2DF6A 4HVUA 2DBKA 3I5RA 3VS4A 1CKAA 2YSQA 2YT6A 4RUGA 1CKBA 1FMKA 1QWEA 1YN8A 4JJDA 2D8HA 1PWTA 2O9SA 3PE0A 1WA7A 4DEYA 2KXCA 3PVLA 1NYGA 2J06A 1X6BA 1GRIA 2RQUA 2EKHA 2L3PA 4J9CA 2F2XA 2XMFA 4IIOA 4J9EA 1TUCA 4F14A 2ED0A 4LN2A 2FEIA 2P4RA 5L23A 1ZSGA 2DA9A 5GJWB 1WX6A 1BB9A 3KFVA 2OAWA 4CC2A 2DVJA 1A0NB 2O88A 2EW3A 2DILA 5IHIA 1UJYA 1X43A 1I07A 4AG1C 2LCSA 1HSQA 2I0NA 2MOXA 2ED1A 5IXBA 1KSWA 2K3BA 4J9IA 4GBQA 1M8MA 1PKSA 2SRCA 3H0HA 1JO8A 3EG0A 2C0IA 2PNIA 5IHKA 1WXUA 4LNPA 1T0HA 1LCKA 3NGPA 4X1VA 4HCKA 2AZVA 5FW9A 4Y92A 1JU5C 1GBQA 4A63B 1WXBA 4M4ZA 1IO6A 2BTTA 2L3QA 2MCNA 1G83A 4OMOA 1KJWA 3QWXX 4LUEA 2O31A 1OV3A 2DL8A 3M0QA 2AZSA 2C0TA 2DL7A 3UA7A 2CT4A 3PVQA 1E6HA 2A28A 2KXDA 1JEGA 1J3TA 1E7OA 2EYYA 3U23A 1CSKA 3VS0A 3M0SA 2CREA 2D8JA 1B3QA 1KFZA 1NEBA 3I35A 1VYTA 2HCKA 2L3SA 3LH5A 1B07A 3VS1A 2ESWA 2JMCA 2RQWA 3VS2A 2K79A 2K9GA 1NEGA 1H8KA 1GCQC 1YCSB 4R0KA 2W10A 4K11A 1AZEA 2EYXA 4JPBW 1W70A 2YUPA 4OMNA 1MUZA 2CUBA 2EQIA 4Z89A 1M3CA 2EPDA 1HD3A 2FG0A 1UUEA 1UG1A 2DRKA 1NLOC 1Z9ZA 3IQLA 1NG2A 5HCKA 3C0CA 1W6XA 2ECZA 3RBBB 1ARKA 1PRMC
chains in the Genus database with same CATH superfamily
3R6NA 3MPUB 4A4EA 2DTOA 4M77G 1TWBA 1PG5B 1JJ2A 3P8DA 2JTEA 2VVKA 4J9DA 1VQ5A 3CBMA 3M59A 5ECAA 3OBYA 2LNHB 2XDDA 1K73C 5CQYA 3HRTA 4HVVA 4M7DB 3JCMd 2LCCA 3OYAA 5M9OA 3A5ZB 3VJPA 1HJDA 1QVGS 4ELYC 4XTXA 4PFOA 1PC0A 2CDTA 2E64A 2DL4A 2FPEA 5HK0A 2FHDA 3TU4K 1Y96A 1G3WA 1ZQ1A 2LJ1A 3CCVT 3BFMA 2OTLQ 4CC7A 2ROLA 1UECA 3E1SA 3CMET 3OYNA 4IUTA 1ZSZB 2HL5C 5GAOp 2DM1A 5A2QE 4M77E 1VQMA 3LWHA 3A8MB 2EIFA 1IZ6A 2X9HA 4B9WA 3G71Q 4PJOE 3V7RA 2JT4A 2CUDA 1GCPA 3EFOB 1FWZA 4M7AD 4BE2A 1O9SA 1M1GA 2J6FA 1VQPA 2QA4T 1U8RA 3CMAQ 4EMGA 2RD1A 1EFNA 2D0NA 2P4TA 2E5KA 4M77B 4D8KA 3CCLA 2IPOB 4OF1A 4PLIA 2PUKB 3CCMT 3QDFA 3LWIA 4PJOB 3X28B 2F69A 4C8QG 1I81A 2M9UA 2IIMA 3SEMA 2E6NA 2HBWA 3CQTA 4C92D 2JJ9A 2EGAA 2KEAA 1ARKA 1JJ2S 3E9FA 2KY9A 1BI3A 2C0OA 1N27A 2CS7A 4AMCA 5GAOn 5GAMj 2DXBA 3CMEA 3PTAA 2RQVA 2CH4W 6AT1B 1YI2A 3MHXA 1TXQA 3CXCA 4BE0A 3S3OA 5KE2A 3PNWC 5A0DA 3URGA 1OX8A 3SB2A 4C8QE 4E7ZA 4A53A 4ZN1A 3TQ7P 2VASA 5D7UA 3DKMA 3EG1A 3N5BB 3UA6A 2RPNA 2R5AA 4ZNXA 3G6EA 1I8FA 2EJFA 2DMOA 1PHTA 1N8RU 1R77A 2A0FB 4R56A 4XTYA 3EGXA 2V1QA 1K9AA 1BU1A 4C8QB 4OMPA 1BIBA 1X69A 1IHVA 2OAUA 1N9RA 1AWJA 2DTIA 2DRMA 1RABB 3GF5A 3OYYA 4PK4A 1VQ6T 1WNLA 1UGVA 4RTTA 1PKTA 2DL5A 1KIKA 2YXYA 8ATCB 3GNGA 1WHMA 3T9NA 1HYOA 4ME7A 1MHNA 4JLIA 3SWNA 4C92C 4Y28E 3SDZA 3CCJQ 1O75A 5FROA 2RJFA 4MZTA 3CXCS 3JB9F 2DEQA 1X2KA 4JZ3A 3G7ZA 1K73U 1IXDA 1WXTA 4M7AG 1VQLA 3I56A 1RAGB 3OBWA 5GANe 2JVVA 1M90R 1AWOA 1ZA2B 4M7DF 1FYNA 2RMOA 3C12A 2M0YA 1QLYA 4MZPA 1UGPB 3GBQA 5IXFA 4OMLA 4F7UG 1YJWQ 1C6VX 4M78A 2KGTA 2VWFA 2F5TX 1VUBA 5KYXB 1X6GA 1QKWA 2MMPA 4C92G 4BD3A 1VQ8T 2KBTA 1YITA 4N4IA 5DLOA 4P5NA 2GTOA 4A4FA 1MMDA 1QVFP 3D7SB 1BCMA 1PD1A 3CBOA 1AVZC 1YFNA 1T3LA 4LDVA 1ZUYA 4QVZA 4KT0E 3TSZA 1R0BG 3OB9A 7AT1B 1M1FA 4BI4A 1C1AA 3INZA 2CP5A 4AFQC 2JS0A 4OGEA 2IG0A 1VQ9T 1Y07A 4JUVA 1WQWA 1AHJB 2SEMA 4KUDK 4LDUA 1AWXA 3TEEA 3RERA 2PUOB 2DBKA 3A8HB 4M7AB 2YSQA 2E12A 1CKBA 4PJOF 3CCST 5GMKl 1YN8A 2CZ1B 4JJDA 1PWTA 1MMGA 2O9SA 1HK9A 3M4GA 1AT1B 2K2VA 4OB1B 4DOWA 2AIRB 4J9CA 3QJYA 3JAME 1M2VA 5GANd 4F7UB 2QGFB 5GANg 5D6WA 1M90C 1VQ7T 4X9CA 4F14A 1RAEB 2P4RA 5L23A 1ZSGA 2KK4A 4BY6C 1YIJT 5FU6C 1JB0E 2ZPGB 3QYHB 3OMCA 2ZPHB 4QW2A 2O88A 4PFZA 4PFPA 2DILA 5IHIA 4F04B 1I07A 2QQRA 4PKCC 2V8IA 2LCSA 1HSQA 4L5GA 2I0NA 2MOXA 3V7SA 3CC7Q 4PNOA 4MDWA 5LJ3h 1KSWA 3EGDA 3GNFB 2CP2A 2DFUA 4C5IA 3FB9A 1OU9A 4J6WA 3AHUA 2PU9B 2RO0A 4KGZB 5GAN5 1NZ9A 4Q5WA 2RI3A 3LW5E 1JU5C 1GBQA 2QEXA 1WXBA 3CCET 2GFUA 1OI1A 4QVDA 5CKHA 1H3ZA 3PT9A 2WSCE 2HL3A 2BUDA 4L6V5 2XK0A 1VQKA 1MNDA 3M0QA 2C0TA 4A4KA 1WGSA 4KUIA 3UA7A 2CT4A 2P0PA 1E6HA 2KXDA 1NPRA 1SG5A 1VQOQ 2YLCA 3U23A 4IUUA 2HZYA 3OYDA 2CREA 2V26A 3I35A 2HCKA 2L3SA 4KGXB 4N4HA 5CR2A 2X4WA 5GAOl 3BDUA 1QVPA 4FT4A 3NTKA 2DVEA 1WQ7A 5GAOq 3I55A 2CKKA 5CKDA 3JCMV 1BI2A 2EYXA 1W70A 2CUBA 3JCMQ 2EPDA 1HD3A 3JCMb 1UG1A 2OTLT 2DRKA 1VQNQ 3IQLA 1IREB 5HCKA 3C0CA 3QSUA 4J83A 2OTJA 1KK7A 2ECZA 2K3XA 4FYWB 4C0DC 2X3XD 1XNIA 2LCLA 2RM4A 1KHIA 2M51A 3TVTA 4M7DA 3FRNA 3DLMA 4JJCA 2QXFA 3M0TA 3OYEA 4HA8A 2JUFA 2LX9A 2YHTA 4O5VA 5DLQE 1Q82R 4LDWA 3VV0A 3EGUA 2E1HA 5GAN7 1ZX6A 1I0CA 4J9FA 1ZBJA 2W0ZA 5LJ5h 1ZA1B 4JRIA 2XIDA 2YRDA 4M75E 4RTYA 5FU7C 2RI2A 3CCQA 4II1A 3MP6A 2DXUA 2O9VA 2JNGA 1Q81R 4HCZA 1SKUB 2K3YA 3MCAB 5GAMe 1PSEA 3VS7A 3EFOA 2HQEA 1RAFB 2E70A 2OI3A 3I5SA 4BACA 2K5IA 4FT2A 4NS5A 3LGLA 2AKKA 2DEUA 4M77A 2DE0X 4M75B 1G2BA 1UE9A 5J3BA 1Q86R 2X4JA 1PSFA 5CQXA 1TG0A 1BCOA 3JCMe 3OW2P 2YUOA 4BE1A 1PCXA 2F1LA 2FZCB 2VXFA 1X6OA 2DIGA 5A0GA 1T0JA 4DOVA 2DYIA 1OYXA 2AK5A 2FZKB 3MKDA 3QG1A 5KH6A 3JB9J 1V76A 3G71A 1M90U 4E7JA 3C95A 3I55Q 1KQSP 2CZ6B 1OULA 1N6AA 1OZ2A 2DBMA 2HSPA 5J39A 4TVRA 1FXXA 2ZAEA 4EMKB 1H92A 3QDRB 3CMAA 2D1XA 2OTJQ 2EJGA 1Q82C 3MO8A 3UDCA 4RMOA 2KYBA 2RK2A 3EFRA 5GAN2 2FVUA 4OMQA 1VQMT 3A8LB 3UWNA 3OSVA 3A1PA 3CC2A 4N0AA 1IGUA 2ZPEB 2DLPA 2XI9A 2BE7D 1SRLA 2X35A 4PJOC 3J7AF 2BZYA 5GMKh 1VQPT 1Q81C 3OY9A 5GAMd 2H3EB 5GAMg 3QZ5B 4LE9A 4A54A 1OZ3A 3CCLT 1GBRA 1TH7A 5I22A 4YTLA 2JM9A 2ABLA 2J7IA 4ANJA 3CCQQ 1VYVA 4C8QA 5LJ3f 4PLLA 1ZUUA 1Q86C 3NFCA 3JCMg 4JRQA 1AZGB 1M3AA 2KNBB 3M56A 3QIIA 1TU0B 2QQ9A 3OYIA 4RTVA 5EC7A 2F2WA 2EGEA 3MEWA 4M78F 2RA2A 1UTIA 1RL2A 2E41A 2K57A 1RAAB 2K2MA 1WHJA 2F5KA 1YI2T 2FZGB 4ZGDB 2F2VA 4ATOA 3CCRA 2LP5A 1SSHA 2L5QA 4OB3B 1K0XA 1YJWT 2HNIA 2LMJA 3JCMc 1JJ2P 5CK9A 1YJ9Q 2OJ2A 3OA6A 5KYUB 1VIFA 3SD4A 3GPLA 1MMNA 5FWCA 3OYCA 2D0QB 2K5LA 4IUQA 3G1JA 3V8LA 5AYFA 4FW1A 3THKA 4XTVA 1AWWA 1XJWB 2FPDA 3G6ET 2L3RA 2H8HA 1OQKA 2X3WD 3M53A 2AT1B 2NUTB 1JXOA 1WJQA 2HQXA 4ZN3A 4IUPA 1IB8A 4FSXA 1BI1A 1OOTA 3CC2Q 1VYUA 2V1RA 2NUZA 5KYXA 1RLQC 4O6JA 1QQJA 3CCUA 3CCJA 2B86A 2DO3A 5FRNA 3RMSA 2A08A 4HCCA 2PZ1A 2DTHA 2JN0A 2NLUA 1LJOA 3EHRA 1KQ2A 2FO0A 1DJ7B 1WYXA 3TCJA 5CCAA 2HMAA 2RJCA 1SHGA 1RLPC 4RCCA 1EZZB 1WPYA 1YJWA 2HEQA 2BE9B 3JCMh 4AG2C 5LL6S 2QQSA 5LJ5f 4E2FB 4R55A 4XU2A 4NOYA 1X75C 1M1KR 5KYNA 4WF2A 4PJMA 2XDBA 2L89A 3I9QA 2DIQA 1K8AR 3VS5A 2YUNA 3OYFA 4M7AA 1RUWA 3OS2A 2KROA 2LQNA 5GMKi 4J9GA 1VQLT 3I56T 1JXMA 2J05A 4EMHA 4HT8A 2EGCA 4HVUA 2NUPA 3VS4A 1M9SA 3G4SQ 3CCRQ 2YT6A 4F7UA 4RUGA 3EH2A 4C5GA 2QAZA 3S3MA 4DEYA 1UEBA 1Q82U 3VYHB 4QQGA 2J06A 1GRIA 2RQUA 2EKHA 1HXDA 5KCOA 3Q1JA 1YITT 3OQ5A 2HBPA 2ED0A 3LGFA 4M78D 1G3TA 2LT1A 4CC2A 2M1HA 2EW3A 1UJYA 4FIBA 1Q81U 5D6XA 1X43A 4XU1A 2RI5A 4AG1C 1ACMB 2WSEE 1Q95G 4DA4A 3CCUQ 5IXBA 4IURA 3CD6Q 1Q7YR 3E19A 1M8MA 2PNIA 2QQBA 1PD0A 4LNPA 3PIOA 1Q86U 1QP3A 2LVMA 4OB0B 3V8JA 1M1KC 5C0MA 2AZVA 3JCMX 5KYWB 2E6ZA 1QP2A 1FMVA 1W2BA 3CC7A 1K8AC 2ATCB 1IO6A 2BTTA 2L3QA 2E65A 3P8BB 2LRQA 2XU8A 1KJWA 4JRPA 4OVAA 3MJXA 4XTZA 2A3LA 4LUEA 1OV3A 3CCVQ 2XKOC 2AZSA 5IT9E 3CEYA 4MDXA 4BDZA 3PVQA 3LLRA 2XDPA 3J81E 1JBMA 3OYJA 2DD5A 2ZGWA 1CSKA 2COWA 2D8JA 2NYSA 3SWNC 1KFZA 1NEBA 2X4YA 2AHJB 1LNXA 3M9QA 1ZBXA 1M5Q1 2ESWA 2ZPIB 4M7AE 3CPWP 3VS2A 3ZFJA 2EQMA 1NPPA 1MGQA 4CRIA 1H8KA 4R0KA 2W10A 2X4XA 2XG8D 1VQOA 1UGRB 2QA4Q 4Z89A 1M3CA 4MMLA 4F7UE 2COZA 1NLOC 2CP0A 1NG2A 2P0QA 1W6XA 4M77F 3CCMQ 1PRMC 2QEXT 3CC4A 2JOYA 3NTIA 4C92E 2G3RA 4M78C 4J7FA 5I2MA 1Q7YC 1VQKT 4FCYA 2DK3A 4LUDA 2VV5A 3L2RA 4BUGA 5IN1A 4ZTFA 2NUPB 3PMTA 4Z8AA 2KT8A 3JB9I 2FB7A 1VQNA 1B34B 4KULA 1JRIA 4RCBA 3QO3A 5GJVB 1UJ0A 5CVIA 1V1CA 1LVKA 3M4YA 3UPUA 2QDYB 3M5AA 4C92B 2A36A 1BI0A 2LDMA 3VU3C 1W2BS 3A98A 1S1NA 4QKUA 4Z02A 1K1ZA 3DB4A 2GF7A 3I55T 3X20B 5GAN4 4ORZA 3EHQA 2JW4A 1SHFA 2LQKA 4M75A 3VUBA 3OS5A 1B7TA 4HVWA 2OTJT 1TSFA 1D0XA 2E5QA 3EG3A 2MI6A 4B9XA 2R58A 2GGRA 1E6GA 3JB9D 2O2OA 3JCMf 1V29B 1K76A 1SRMA 5LJ3j 4BI3A 2FRWA 3SHWA 2E4HA 2Y4YA 4AFSC 5LJ5d 4CC4B 4C8QF 4DBRA 4EMKA 3QYGB 3KXTA 1RADB 2JM8A 2EVRA 3ME9A 4L59A 4QVCA 4M7DD 4E7KA 3ULRB 1VQ6Q 1UGSB 1N5ZA 3AT1B 4RTXA 3CCQT 3VS6A 4OGCA 3CC4Q 2A37A 2E3IA 1WLPB 2RHXA 4HXJA 1ABOA 1D1CA 2X51A 5FRMA 2RN8A 3GLXA 5CAIA 4DEXA 2RH2A 3VRYA 2DPPB 3EH1A 1T3SA 3S6WA 2EYZA 5GANh 4X34A 1M1KU 5I21A 5EG2A 3X25B 1K8AU 5FWBA 2J6OA 1UB4A 2LNVA 4XAXB 1YNZA 2CP3A 1UHCA 4JRKA 4X9DA 3KBGA 2YWWA 3OSSC 4BY6B 3G71T 2Y4XA 5FU6B 1Z9QA 1X2QA 3OMGA 3GIBA 2PVOB 3X24B 2VUBA 4ZTJA 1KG1A 3ZL7C 4PJOD 3QUIA 1U1SA 2GQVA 1VQ8Q 4FYXB 1I1JA 3CMAT 4E6RA 4GLMA 1BIAA 3UF4A 3H0IA 1WHLA 5I11A 1K0SA 1GL5A 1GXIE 2DJQA 1LOJA 1FMWA 1NLPC 2YLBA 3HP9A 3MP1A 4FYVB 4AT1B 1AOJA 2A7YA 3CC2T 2VYTA 3SFMA 5KYUA 4WTOB 1MMAA 4BB7A 1QKXA 4ELZC 1TS9A 3VUZA 1VQ9Q 4F17A 5LJ5j 2KMTA 3OYGA 2K7AA 2PVDB 2DETA 4M7DC 1WJRA 2L2PA 2QGGA 2DNUA 2EQUA 3GP8A 1Q7YU 2NUTA 2MF2A 1VQ4Q 2JXBA 4B6MA 4JJBA 1TTHB 1U06A 3CCSQ 2EBPA 4M7AF 4EIKA 4E7IA 1K4US 1OPKA 4BDYA 4KH0B 2KAFA 2RHUA 1GCQA 2LZ6B 2BZ8A 3QHSA 3QWYA 4DBFA 2M16A 1ZSZC 1G8XA 2AKLA 1YJ9A 3JB9G 2VGMA 5C6SA 4GY5A 4F7UF 1VQ7Q 1SPKA 4BI8B 5IHNA 5D6YA 4C8QD 1KC8R 8AT1B 4J9BA 3H6ZA 1YIJQ 2J6KA 3V7CA 4Y91A 4C92F 4M7DG 1I5LA 4RTWA 1SSFA 4OP0A 3L2WA 2DD4A 1UHFA 3CCRT 4E7SA 3OYKA 2PTKA 2I2LA 1MV3A 1YWPA 2JTMA 1QVGP 4C0DB 4PJJA 4EDUA 4M77C 3HRUA 1IRXA 1ZUKA 4KBMB 4OB2B 1D3BB 2B8AA 3JB9H 4PL6A 3RKYA 2H3JA 3MP8A 1EX4A 1IGQA 4LD9K 2EYWA 2JMAA 2EQJA 1YP5A 1M4ZA 4V2SA 2CSIA 2Y90A 2O4XB 2MK5A 1KD1R 1S72A 2R5MA 1KQ1A 4JZ4A 2E3HA 2KR3A 5CIUA 3CBPA 5KCHA 1ABQA 3O8VA 5FU7B 2DF6A 1K9MR 4NL3A 4QQDA 4C0ZA 4GLKA 2EFIA 5GMKj 3CCUT 3CCJT 3CD6T 1QWEA 2MYSA 1RI0A 3MEVA 3C4SA 1KHCA 3PE0A 1N9SA 1WA7A 3M57A 1NYGA 1X6BA 4PJOG 3A8OB 2L3PA 1YJNQ 4N0AC 4RG2A 4LXCA 2XMFA 4IIOA 2CP7A 4J9EA 2EAYA 2LT4A 1D1AA 3PIPA 2QTVA 2FL7A 3G4SA 3UT1A 2FEIA 1KC8C 2RHZA 3PMIA 2DA9A 3L1AA 4J5YA 3FDRA 2RK1A 2V8JA 3KFVA 3V8KA 1A0NB 2JTFA 4HT9A 2WSFE 5L8RE 2FYKA 4C8QC 4FL6A 2RJEA 2ED1A 3OYHA 5KYWA 2OX7A 2SRCA 3H0HA 1JO8A 2C0IA 3ZBDA 5IHKA 1WXUA 3HRSA 2KVQG 1TUGB 1M8VA 1LCKA 2QG9B 4VUBA 3WXMB 3EG9A 2CP6A 5FW9A 1YHQQ 4N4GA 3F70A 2RB6A 3RKWA 5GANf 4UC4A 3DLLA 4A63B 3M55A 4M4ZA 3S3NA 3HFNA 1G83A 1KD1C 2GCXA 3CD6A 1ZHIA 3LH0A 2O31A 2DL8A 2DL7A 1Y7XA 5GAN6 2JZ2A 1RAIB 1K9MC 2LQ8A 5GAMh 5GAN3 1JEGA 3L42A 2EYYA 3HL8A 3QBYA 5J26A 3LYIA 4QQ6A 3M0SA 2ZPFB 1S72Q 1XTDA 4JS5A 2LTOA 1X01A 1WHKA 3LH5A 3RDVA 4XTWA 5CKBA 3VS1A 2JMCA 3L2UA 3CCVA 1OU8A 2DERA 2VGNA 4IKFA 4K11A 1AZEA 4JPBW 4M75F 1VQ5Q 1PM3A 2DXCA 1MNEA 2FG0A 1UUEA 3L2QA 4E47A 2QYZA 1P92A 3TREA 1EIFA 3RBBB 5CKFA 3CC7T 2ROTA 2KYMA 1B34A 2MPXC 2KT1A 4IIMA 4ESRA 2R57A 3M0PA 4XTUA 1XOVA 4J7IA 3PFSA 5DM7R 2EKOA 4JDSA 5KYYB 2QA4A 5LJ3e 3CXCP 4C92A 4ZGJB 2EWNA 4XU0A 1YWOA 2DJZA 1Y0MA 3JSCA 1M30A 1M3BA 3QPHA 4D6WA 3CCMA 4C0GA 1NYFA 3FJPA 1VQMQ 2DYBA 3E9GA 5CO7A 2WACA 3JCMW 1WFWA 4FM4B 4WCIA 2ZPBB 3H0FA 3META 3HSBA 4ZGEB 1VA7A 3RESA 4M7AC 3FLGA 1QCNA 2RQTA 3RMQA 2KRNA 1VQPQ 3L2VA 1VQOT 1QCFA 3EAEA 2FPFA 1Y96B 5A0LA 2E10A 4FSSA 1MV0B 3CCLQ 5IAYA 1D0YA 2P0KA 2RNAA 3HTRA 4KRTA 2YRCA 3M58A 2HKQB 2DXTA 3OYBA 4C5EA 3CC4T 2K6DA 4HCBA 2RQRA 1QVFA 1M27C 3L2ZA 2KRMA 1NJIR 1Y57A 2ZZDA 1GFDA 1TUDA 3UATA 3ZEHA 1VQNT 1WZOA 3E2UA 4DQ2A 3CPWA 4LD6A 1RI9A 2K4YA 4AFZC 3EG9B 3JV3A 2VB6A 3J80E 4FW2A 3CMEQ 2VXEA 1JQQA 1YI2Q 2NWMA 3H41A 4OMMA 1KC8U 2QI2A 4PJNA 1SEMA 4MZMA 2CGHA 2L0AA 2DAQA 1R8OB 3C94A 4XK8E 5LJ3d 2CH4A 5LJ3g 3BW1A 1YBYA 3QXEB 3PGGA 1UDLA 4OMFB 1M2OA 2KRSA 5HKCA 2LX7A 3JRZA 3QZ9B 1D09B 1UFFA 2LQWA 2KE9A 2P84A 1BKBA 1U1TA 1XQHA 1VQ6A 1H3HA 2HD0A 3KUFA 1W2BP 3G6EQ 1BK2A 4KH1B 1WHHA 3VS3A 3NMZC 1AD5A 1OPLA 2XD0A 4EPCA 2GBQA 1IHWA 5IH2A 5LJ5e 4CC3A 2VC8A 2XICA 4M75D 3RUXA 4J8OA 3OYLA 2YRVA 5GAN8 1KD1U 3NPFA 2C06A 2KSSA 4FYYB 1FX7A 3H8ZA 4RG8A 3WVEB 4KGVB 1K9MU 1OX9A 1VIEA 2QDLA 4RTZA 1I5OB 3RNJA 1OEBA 1VQ4T 4Z88A 4C5HA 1WI7A 4A4GA 1RACB 2EYQA 3M0UA 1NJIC 1QVFS 2MWPA 3REBB 2DZ9A 1GFCA 5GAOr 2GFAA 3EGXB 3CPWS 4D8DA 3M0RA 2QTXA 2DKGA 3VRZA 1BBZA 2PQWA 2G6FX 4M78G 3TSWA 4CI0C 1PRLC 5AT1B 3O5ZA 2HKNA 1X27A 5GAMf 2YUQA 1VQ8A 2HAXA 1NM7A 2GTJA 1D1BA 2VKNA 1VQLQ 2RF0A 3I56Q 5KE3A 3JCMP 2JS2A 4XU3A 3RR6A 2O01E 3R6OA 4IUVA 2HSEB 1WJSA 4DBQA 3NTHA 4J9HA 3BY7A 2CT3A 2YDLA 1U5SA 4A4HA 3OS1A 4DBHA 2CSQA 1WDXA 1I4K1 2K5FA 2FRYA 3NHNA 5LJ5g 1VQ9A 3SWNB 3REAB 1G3YA 1WIEA 2DX1A 1YITQ 1C0MA 4JJNK 2D9TA 4M78E 4JLGA 2KI7A 5GMKe 5DY9A 3EG2A 1VQ4A 4LDXA 1PNJA 4AFUC 4LDYA 3FJ5A 2HDAA 3CCSA 1QCOA 4QT7A 4M75C 2DL3A 2KQWA 2MIOA 3A8GB 1AEYA 3QJ6A 3CPFA 3JCMJ 2GQIA 1G3SA 2COYA 1D3BA 4F16A 2LJ0A 2LJ3A 1ZLMA 2BZXA 4M78B 2MWOA 1VQ7A 2M0OA 1H641 1YIJA 1YJNT 1BYMA 1QMCA 2O4XA 2GNCA 4RKUE 1R0CB 1U3OA 4JS4A 4EMKC 1QWFA 1W1FA 3WVDB 2ZCFB 3FIFA 1F1BB 3ER0A 4J6YA 4M77D 2ENMA 4HKEA 4M75G 1YJ9T 4RTUA 5GMKm 5GANj 3X26B 3I5RA 1CKAA 3RKXA 5HY6A 1LPLA 1N8RR 9ATCB 2KDSA 2QK0A 3HFOA 1FMKA 2RHYA 2D8HA 5I2SA 2D6FA 3CCEA 2KXCA 3PVLA 3HPWA 2F2XA 3OS0A 3OW2A 1YHQT 2MAMA 2QASA 3FEOA 1TUCA 5CKEA 3DB3A 4LN2A 1YCYA 3OYMA 1UGQB 1VOMA 5GJWB 1ZSZA 3BDLA 4J6XA 1WX6A 1BB9A 1M2VB 2OAWA 4XQ3A 2DVJA 1W4SA 3ASKA 3FC3A 4E7HA 2V8KA 1KQSA 1TOVA 1WHGA 1YJNA 3HKSA 2QEXQ 4E7LA 5FLXE 1RAHB 1S72T 3QKJA 2K3BA 1SF9A 4J9IA 4GBQA 3MEUA 1VQKQ 2M02A 2PVGB 1PKSA 2L8DA 3EG0A 4PJLA 2BKDN 2Z0WA 1Y71A 3VKIA 1T0HA 3NGPA 4X1VA 1K73R 2OTLA 4HCKA 4MMKA 3EGDB 1QVGA 1NJIU 4Y92A 2HQHA 1VQ5T 2IVWA 2EJ9A 2QQAA 4PJOA 2RHIA 2MCNA 4OMOA 3QWXX 2CYZB 2EQKA 1NE8A 3M54A 2A28A 2RJDA 3G4ST 3RIRA 1J3TA 1E7OA 3H9NA 1N8RC 3MEAA 4NL2A 1YHQA 3VS0A 5GAOm 2LC4A 1B3QA 5HK3A 1VYTA 1D0ZA 1B07A 2RQWA 2K79A 1NBEB 2K9GA 1NEGA 2DZCA 3EFSA 3OW2S 1GCQC 1YCSB 1G5VA 3LX7A 2YUPA 3HHTB 4OMNA 3CCEQ 1MUZA 2BIVA 2EQIA 3VYGA 2CZ0B 4FU6A 3BE3A 1Z9ZA 4M7DE 2XHCA 3GOXA 5KYYA 2CZ7B 1KQSS 1QW1A 4C0FA 3P8HA
chains in the Genus database with same CATH topology
2ROTA 2X3XD 2KYMA 4IIMA 3R6NA 2KT1A 4ESRA 3M0PA 2M51A 1XOVA 3TVTA 4JJCA 2JTEA 2VVKA 4J9DA 4LUDA 3M0TA 5ECAA 4Z8AA 2KT8A 2LNHB 1YWOA 5GJVB 1Y0MA 4HVVA 1M30A 1UJ0A 1V1CA 1M3BA 3EGUA 1NYFA 1HJDA 1ZX6A 1I0CA 2DYBA 4J9FA 2CDTA 2A36A 1ZBJA 2W0ZA 2DL4A 3A98A 1S1NA 1WFWA 2FPEA 4WCIA 3H0FA 2LJ1A 1K1ZA 4RTYA 4CC7A 2ROLA 1VA7A 1UECA 2O9VA 2RQTA 2KRNA 4ORZA 3EHQA 2JW4A 1SHFA 1QCFA 2FPFA 2DM1A 3VS7A 4FSSA 1MV0B 2RNAA 2OI3A 4KRTA 3I5SA 4HVWA 2AKKA 2DE0X 2JT4A 2CUDA 2K6DA 1G2BA 1UE9A 1GCPA 3EG3A 2RQRA 1TG0A 2GGRA 2J6FA 1E6GA 1M27C 2O2OA 2YUOA 1K76A 1SRMA 2KRMA 1Y57A 2FRWA 1EFNA 1TUDA 2D0NA 2E5KA 3SHWA 3UATA 4AFSC 4D8KA 1T0JA 1GFDA 4CC4B 1RI9A 4AFZC 3JV3A 2AK5A 2JM8A 2EVRA 3ULRB 1JQQA 2NWMA 2DBMA 2HSPA 3H41A 4OMMA 2IIMA 3SEMA 1SEMA 2HBWA 2L0AA 3CQTA 1N5ZA 2EGAA 1H92A 2CH4A 2KEAA 4RTXA 2D1XA 3VS6A 1UDLA 2C0OA 2KRSA 2LX7A 2A37A 2KYBA 1UFFA 2LQWA 4OMQA 1WLPB 4HXJA 1ABOA 2KE9A 2RQVA 2CH4W 2RN8A 1H3HA 4DEXA 2DLPA 1BK2A 3VRYA 3VS3A 3NMZC 1AD5A 1OPLA 1SRLA 1T3SA 2EYZA 2GBQA 5IH2A 2BZYA 4CC3A 5FWBA 2J6OA 4LE9A 3NPFA 1GBRA 1YNZA 1UHCA 5I22A 2JM9A 2ABLA 2J7IA 3EG1A 3UA6A 1VYVA 2RPNA 4ZNXA 1Z9QA 1X2QA 2QDLA 2DMOA 1PHTA 4RTZA 3ZL7C 1ZUUA 3RNJA 1OEBA 4Z88A 2V1QA 1AZGB 1WI7A 1K9AA 1M3AA 2KNBB 1BU1A 1I1JA 3M0UA 4E6RA 4GLMA 4OMPA 4RTVA 1X69A 3REBB 3UF4A 3H0IA 5EC7A 2F2WA 5I11A 2EGEA 1GL5A 1GFCA 1K0SA 2DJQA 1AWJA 1NLPC 1UTIA 2DRMA 4D8DA 3M0RA 2K2MA 1AOJA 3VRZA 1BBZA 2G6FX 3TSWA 1PRLC 1UGVA 2F2VA 3O5ZA 1PKTA 4RTTA 2LP5A 1QKXA 1X27A 2DL5A 1KIKA 1SSHA 2YUQA 1NM7A 1K0XA 2GTJA 4F17A 2LMJA 2VKNA 2K7AA 2RF0A 2L2PA 2OJ2A 2JS2A 5FWCA 2DNUA 4J9HA 2CT3A 2YDLA 1U5SA 2JXBA 3THKA 4JJBA 1U06A 2EBPA 1AWWA 2FPDA 4EIKA 2H8HA 2CSQA 1WDXA 1X2KA 2X3WD 1OPKA 4JZ3A 1K4US 2FRYA 3NHNA 1GCQA 1WXTA 2LZ6B 2BZ8A 3QWYA 3REAB 1JXOA 1WIEA 2AKLA 2DX1A 1OOTA 1AWOA 1VYUA 2V1RA 2NUZA 1SPKA 3EG2A 1RLQC 5IHNA 1FYNA 1PNJA 2RMOA 4AFUC 2M0YA 4J9BA 2B86A 2J6KA 1QLYA 3FJ5A 2HDAA 3GBQA 5IXFA 2A08A 4OMLA 2PZ1A 4QT7A 2DL3A 2MIOA 2KGTA 1AEYA 4RTWA 2VWFA 2GQIA 3EHRA 1UHFA 1X6GA 1QKWA 2FO0A 4F16A 2PTKA 1WYXA 2LJ0A 2LJ3A 1MV3A 1YWPA 2KBTA 2GTOA 1ZLMA 2BZXA 1ZUKA 1SHGA 1RLPC 1AVZC 2GNCA 1T3LA 2HEQA 4AG2C 1ZUYA 3TSZA 1U3OA 1QWFA 2EYWA 2JMAA 1YP5A 3I9QA 4AFQC 1W1FA 3VS5A 2JS0A 2YUNA 1RUWA 2CSIA 2KROA 2LQNA 4J9GA 4JZ4A 2KR3A 2ENMA 1JXMA 2J05A 2SEMA 4RTUA 1AWXA 1ABQA 2EGCA 2DF6A 4HVUA 2DBKA 3I5RA 3VS4A 1CKAA 2YSQA 2YT6A 4RUGA 1CKBA 1FMKA 1QWEA 1YN8A 4JJDA 2D8HA 1PWTA 2O9SA 3PE0A 1WA7A 4DEYA 2KXCA 3PVLA 1NYGA 2J06A 1X6BA 1GRIA 2RQUA 2EKHA 2L3PA 4J9CA 2F2XA 2XMFA 4IIOA 4J9EA 1TUCA 4F14A 2ED0A 4LN2A 2FEIA 2P4RA 5L23A 1ZSGA 2DA9A 5GJWB 1WX6A 1BB9A 3KFVA 2OAWA 4CC2A 2DVJA 1A0NB 2O88A 2EW3A 2DILA 5IHIA 1UJYA 1X43A 1I07A 4AG1C 2LCSA 1HSQA 2I0NA 2MOXA 2ED1A 5IXBA 1KSWA 2K3BA 4J9IA 4GBQA 1M8MA 1PKSA 2SRCA 3H0HA 1JO8A 3EG0A 2C0IA 2PNIA 5IHKA 1WXUA 4LNPA 1T0HA 1LCKA 3NGPA 4X1VA 4HCKA 2AZVA 5FW9A 4Y92A 1JU5C 1GBQA 4A63B 1WXBA 4M4ZA 1IO6A 2BTTA 2L3QA 2MCNA 1G83A 4OMOA 1KJWA 3QWXX 4LUEA 2O31A 1OV3A 2DL8A 3M0QA 2AZSA 2C0TA 2DL7A 3UA7A 2CT4A 3PVQA 1E6HA 2A28A 2KXDA 1JEGA 1J3TA 1E7OA 2EYYA 3U23A 1CSKA 3VS0A 3M0SA 2CREA 2D8JA 1B3QA 1KFZA 1NEBA 3I35A 1VYTA 2HCKA 2L3SA 3LH5A 1B07A 3VS1A 2ESWA 2JMCA 2RQWA 3VS2A 2K79A 2K9GA 1NEGA 1H8KA 1GCQC 1YCSB 4R0KA 2W10A 4K11A 1AZEA 2EYXA 4JPBW 1W70A 2YUPA 4OMNA 1MUZA 2CUBA 2EQIA 4Z89A 1M3CA 2EPDA 1HD3A 2FG0A 1UUEA 1UG1A 2DRKA 1NLOC 1Z9ZA 3IQLA 1NG2A 5HCKA 3C0CA 1W6XA 2ECZA 3RBBB 1ARKA 1PRMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROT A;  2X3X D;  2KYM A;  4IIM A;  3R6N A;  2KT1 A;  4ESR A;  3M0P A;  2M51 A;  1XOV A;  3TVT A;  4JJC A;  2JTE A;  2VVK A;  4J9D A;  4LUD A;  3M0T A;  5ECA A;  4Z8A A;  2KT8 A;  2LNH B;  1YWO A;  5GJV B;  1Y0M A;  4HVV A;  1M30 A;  1UJ0 A;  1V1C A;  1M3B A;  3EGU A;  1NYF A;  1HJD A;  1ZX6 A;  1I0C A;  2DYB A;  4J9F A;  2CDT A;  2A36 A;  1ZBJ A;  2W0Z A;  2DL4 A;  3A98 A;  1S1N A;  1WFW A;  2FPE A;  4WCI A;  3H0F A;  2LJ1 A;  1K1Z A;  4RTY A;  4CC7 A;  2ROL A;  1VA7 A;  1UEC A;  2O9V A;  2RQT A;  2KRN A;  4ORZ A;  3EHQ A;  2JW4 A;  1SHF A;  1QCF A;  2FPF A;  2DM1 A;  3VS7 A;  4FSS A;  1MV0 B;  2RNA A;  2OI3 A;  4KRT A;  3I5S A;  4HVW A;  2AKK A;  2DE0 X;  2JT4 A;  2CUD A;  2K6D A;  1G2B A;  1UE9 A;  1GCP A;  3EG3 A;  2RQR A;  1TG0 A;  2GGR A;  2J6F A;  1E6G A;  1M27 C;  2O2O A;  2YUO A;  1K76 A;  1SRM A;  2KRM A;  1Y57 A;  2FRW A;  1EFN A;  1TUD A;  2D0N A;  2E5K A;  3SHW A;  3UAT A;  4AFS C;  4D8K A;  1T0J A;  1GFD A;  4CC4 B;  1RI9 A;  4AFZ C;  3JV3 A;  2AK5 A;  2JM8 A;  2EVR A;  3ULR B;  1JQQ A;  2NWM A;  2DBM A;  2HSP A;  3H41 A;  4OMM A;  2IIM A;  3SEM A;  1SEM A;  2HBW A;  2L0A A;  3CQT A;  1N5Z A;  2EGA A;  1H92 A;  2CH4 A;  2KEA A;  4RTX A;  2D1X A;  3VS6 A;  1UDL A;  2C0O A;  2KRS A;  2LX7 A;  2A37 A;  2KYB A;  1UFF A;  2LQW A;  4OMQ A;  1WLP B;  4HXJ A;  1ABO A;  2KE9 A;  2RQV A;  2CH4 W;  2RN8 A;  1H3H A;  4DEX A;  2DLP A;  1BK2 A;  3VRY A;  3VS3 A;  3NMZ C;  1AD5 A;  1OPL A;  1SRL A;  1T3S A;  2EYZ A;  2GBQ A;  5IH2 A;  2BZY A;  4CC3 A;  5FWB A;  2J6O A;  4LE9 A;  3NPF A;  1GBR A;  1YNZ A;  1UHC A;  5I22 A;  2JM9 A;  2ABL A;  2J7I A;  3EG1 A;  3UA6 A;  1VYV A;  2RPN A;  4ZNX A;  1Z9Q A;  1X2Q A;  2QDL A;  2DMO A;  1PHT A;  4RTZ A;  3ZL7 C;  1ZUU A;  3RNJ A;  1OEB A;  4Z88 A;  2V1Q A;  1AZG B;  1WI7 A;  1K9A A;  1M3A A;  2KNB B;  1BU1 A;  1I1J A;  3M0U A;  4E6R A;  4GLM A;  4OMP A;  4RTV A;  1X69 A;  3REB B;  3UF4 A;  3H0I A;  5EC7 A;  2F2W A;  5I11 A;  2EGE A;  1GL5 A;  1GFC A;  1K0S A;  2DJQ A;  1AWJ A;  1NLP C;  1UTI A;  2DRM A;  4D8D A;  3M0R A;  2K2M A;  1AOJ A;  3VRZ A;  1BBZ A;  2G6F X;  3TSW A;  1PRL C;  1UGV A;  2F2V A;  3O5Z A;  1PKT A;  4RTT A;  2LP5 A;  1QKX A;  1X27 A;  2DL5 A;  1KIK A;  1SSH A;  2YUQ A;  1NM7 A;  1K0X A;  2GTJ A;  4F17 A;  2LMJ A;  2VKN A;  2K7A A;  2RF0 A;  2L2P A;  2OJ2 A;  2JS2 A;  5FWC A;  2DNU A;  4J9H A;  2CT3 A;  2YDL A;  1U5S A;  2JXB A;  3THK A;  4JJB A;  1U06 A;  2EBP A;  1AWW A;  2FPD A;  4EIK A;  2H8H A;  2CSQ A;  1WDX A;  1X2K A;  2X3W D;  1OPK A;  4JZ3 A;  1K4U S;  2FRY A;  3NHN A;  1GCQ A;  1WXT A;  2LZ6 B;  2BZ8 A;  3QWY A;  3REA B;  1JXO A;  1WIE A;  2AKL A;  2DX1 A;  1OOT A;  1AWO A;  1VYU A;  2V1R A;  2NUZ A;  1SPK A;  3EG2 A;  1RLQ C;  5IHN A;  1FYN A;  1PNJ A;  2RMO A;  4AFU C;  2M0Y A;  4J9B A;  2B86 A;  2J6K A;  1QLY A;  3FJ5 A;  2HDA A;  3GBQ A;  5IXF A;  2A08 A;  4OML A;  2PZ1 A;  4QT7 A;  2DL3 A;  2MIO A;  2KGT A;  1AEY A;  4RTW A;  2VWF A;  2GQI A;  3EHR A;  1UHF A;  1X6G A;  1QKW A;  2FO0 A;  4F16 A;  2PTK A;  1WYX A;  2LJ0 A;  2LJ3 A;  1MV3 A;  1YWP A;  2KBT A;  2GTO A;  1ZLM A;  2BZX A;  1ZUK A;  1SHG A;  1RLP C;  1AVZ C;  2GNC A;  1T3L A;  2HEQ A;  4AG2 C;  1ZUY A;  3TSZ A;  1U3O A;  1QWF A;  2EYW A;  2JMA A;  1YP5 A;  3I9Q A;  4AFQ C;  1W1F A;  3VS5 A;  2JS0 A;  2YUN A;  1RUW A;  2CSI A;  2KRO A;  2LQN A;  4J9G A;  4JZ4 A;  2KR3 A;  2ENM A;  1JXM A;  2J05 A;  2SEM A;  4RTU A;  1AWX A;  1ABQ A;  2EGC A;  2DF6 A;  4HVU A;  2DBK A;  3I5R A;  3VS4 A;  1CKA A;  2YSQ A;  2YT6 A;  4RUG A;  1CKB A;  1FMK A;  1QWE A;  1YN8 A;  4JJD A;  2D8H A;  1PWT A;  2O9S A;  3PE0 A;  1WA7 A;  4DEY A;  2KXC A;  3PVL A;  1NYG A;  2J06 A;  1X6B A;  1GRI A;  2RQU A;  2EKH A;  2L3P A;  4J9C A;  2F2X A;  2XMF A;  4IIO A;  4J9E A;  1TUC A;  4F14 A;  2ED0 A;  4LN2 A;  2FEI A;  2P4R A;  5L23 A;  1ZSG A;  2DA9 A;  5GJW B;  1WX6 A;  1BB9 A;  3KFV A;  2OAW A;  4CC2 A;  2DVJ A;  1A0N B;  2O88 A;  2EW3 A;  2DIL A;  5IHI A;  1UJY A;  1X43 A;  1I07 A;  4AG1 C;  2LCS A;  1HSQ A;  2I0N A;  2MOX A;  2ED1 A;  5IXB A;  1KSW A;  2K3B A;  4J9I A;  4GBQ A;  1M8M A;  1PKS A;  2SRC A;  3H0H A;  1JO8 A;  3EG0 A;  2C0I A;  2PNI A;  5IHK A;  1WXU A;  4LNP A;  1T0H A;  1LCK A;  3NGP A;  4X1V A;  4HCK A;  2AZV A;  5FW9 A;  4Y92 A;  1JU5 C;  1GBQ A;  4A63 B;  1WXB A;  4M4Z A;  1IO6 A;  2BTT A;  2L3Q A;  2MCN A;  1G83 A;  4OMO A;  1KJW A;  3QWX X;  4LUE A;  2O31 A;  1OV3 A;  2DL8 A;  3M0Q A;  2AZS A;  2C0T A;  2DL7 A;  3UA7 A;  2CT4 A;  3PVQ A;  1E6H A;  2A28 A;  2KXD A;  1JEG A;  1J3T A;  1E7O A;  2EYY A;  3U23 A;  1CSK A;  3VS0 A;  3M0S A;  2CRE A;  2D8J A;  1B3Q A;  1KFZ A;  1NEB A;  3I35 A;  1VYT A;  2HCK A;  2L3S A;  3LH5 A;  1B07 A;  3VS1 A;  2ESW A;  2JMC A;  2RQW A;  3VS2 A;  2K79 A;  2K9G A;  1NEG A;  1H8K A;  1GCQ C;  1YCS B;  4R0K A;  2W10 A;  4K11 A;  1AZE A;  2EYX A;  4JPB W;  1W70 A;  2YUP A;  4OMN A;  1MUZ A;  2CUB A;  2EQI A;  4Z89 A;  1M3C A;  2EPD A;  1HD3 A;  2FG0 A;  1UUE A;  1UG1 A;  2DRK A;  1NLO C;  1Z9Z A;  3IQL A;  1NG2 A;  5HCK A;  3C0C A;  1W6X A;  2ECZ A;  3RBB B;  1ARK A;  1PRM C; 
#chains in the Genus database with same CATH topology
 3R6N A;  3MPU B;  4A4E A;  2DTO A;  4M77 G;  1TWB A;  1PG5 B;  1JJ2 A;  3P8D A;  2JTE A;  2VVK A;  4J9D A;  1VQ5 A;  3CBM A;  3M59 A;  5ECA A;  3OBY A;  2LNH B;  2XDD A;  1K73 C;  5CQY A;  3HRT A;  4HVV A;  4M7D B;  3JCM d;  2LCC A;  3OYA A;  5M9O A;  3A5Z B;  3VJP A;  1HJD A;  1QVG S;  4ELY C;  4XTX A;  4PFO A;  1PC0 A;  2CDT A;  2E64 A;  2DL4 A;  2FPE A;  5HK0 A;  2FHD A;  3TU4 K;  1Y96 A;  1G3W A;  1ZQ1 A;  2LJ1 A;  3CCV T;  3BFM A;  2OTL Q;  4CC7 A;  2ROL A;  1UEC A;  3E1S A;  3CME T;  3OYN A;  4IUT A;  1ZSZ B;  2HL5 C;  5GAO p;  2DM1 A;  5A2Q E;  4M77 E;  1VQM A;  3LWH A;  3A8M B;  2EIF A;  1IZ6 A;  2X9H A;  4B9W A;  3G71 Q;  4PJO E;  3V7R A;  2JT4 A;  2CUD A;  1GCP A;  3EFO B;  1FWZ A;  4M7A D;  4BE2 A;  1O9S A;  1M1G A;  2J6F A;  1VQP A;  2QA4 T;  1U8R A;  3CMA Q;  4EMG A;  2RD1 A;  1EFN A;  2D0N A;  2P4T A;  2E5K A;  4M77 B;  4D8K A;  3CCL A;  2IPO B;  4OF1 A;  4PLI A;  2PUK B;  3CCM T;  3QDF A;  3LWI A;  4PJO B;  3X28 B;  2F69 A;  4C8Q G;  1I81 A;  2M9U A;  2IIM A;  3SEM A;  2E6N A;  2HBW A;  3CQT A;  4C92 D;  2JJ9 A;  2EGA A;  2KEA A;  1ARK A;  1JJ2 S;  3E9F A;  2KY9 A;  1BI3 A;  2C0O A;  1N27 A;  2CS7 A;  4AMC A;  5GAO n;  5GAM j;  2DXB A;  3CME A;  3PTA A;  2RQV A;  2CH4 W;  6AT1 B;  1YI2 A;  3MHX A;  1TXQ A;  3CXC A;  4BE0 A;  3S3O A;  5KE2 A;  3PNW C;  5A0D A;  3URG A;  1OX8 A;  3SB2 A;  4C8Q E;  4E7Z A;  4A53 A;  4ZN1 A;  3TQ7 P;  2VAS A;  5D7U A;  3DKM A;  3EG1 A;  3N5B B;  3UA6 A;  2RPN A;  2R5A A;  4ZNX A;  3G6E A;  1I8F A;  2EJF A;  2DMO A;  1PHT A;  1N8R U;  1R77 A;  2A0F B;  4R56 A;  4XTY A;  3EGX A;  2V1Q A;  1K9A A;  1BU1 A;  4C8Q B;  4OMP A;  1BIB A;  1X69 A;  1IHV A;  2OAU A;  1N9R A;  1AWJ A;  2DTI A;  2DRM A;  1RAB B;  3GF5 A;  3OYY A;  4PK4 A;  1VQ6 T;  1WNL A;  1UGV A;  4RTT A;  1PKT A;  2DL5 A;  1KIK A;  2YXY A;  8ATC B;  3GNG A;  1WHM A;  3T9N A;  1HYO A;  4ME7 A;  1MHN A;  4JLI A;  3SWN A;  4C92 C;  4Y28 E;  3SDZ A;  3CCJ Q;  1O75 A;  5FRO A;  2RJF A;  4MZT A;  3CXC S;  3JB9 F;  2DEQ A;  1X2K A;  4JZ3 A;  3G7Z A;  1K73 U;  1IXD A;  1WXT A;  4M7A G;  1VQL A;  3I56 A;  1RAG B;  3OBW A;  5GAN e;  2JVV A;  1M90 R;  1AWO A;  1ZA2 B;  4M7D F;  1FYN A;  2RMO A;  3C12 A;  2M0Y A;  1QLY A;  4MZP A;  1UGP B;  3GBQ A;  5IXF A;  4OML A;  4F7U G;  1YJW Q;  1C6V X;  4M78 A;  2KGT A;  2VWF A;  2F5T X;  1VUB A;  5KYX B;  1X6G A;  1QKW A;  2MMP A;  4C92 G;  4BD3 A;  1VQ8 T;  2KBT A;  1YIT A;  4N4I A;  5DLO A;  4P5N A;  2GTO A;  4A4F A;  1MMD A;  1QVF P;  3D7S B;  1BCM A;  1PD1 A;  3CBO A;  1AVZ C;  1YFN A;  1T3L A;  4LDV A;  1ZUY A;  4QVZ A;  4KT0 E;  3TSZ A;  1R0B G;  3OB9 A;  7AT1 B;  1M1F A;  4BI4 A;  1C1A A;  3INZ A;  2CP5 A;  4AFQ C;  2JS0 A;  4OGE A;  2IG0 A;  1VQ9 T;  1Y07 A;  4JUV A;  1WQW A;  1AHJ B;  2SEM A;  4KUD K;  4LDU A;  1AWX A;  3TEE A;  3RER A;  2PUO B;  2DBK A;  3A8H B;  4M7A B;  2YSQ A;  2E12 A;  1CKB A;  4PJO F;  3CCS T;  5GMK l;  1YN8 A;  2CZ1 B;  4JJD A;  1PWT A;  1MMG A;  2O9S A;  1HK9 A;  3M4G A;  1AT1 B;  2K2V A;  4OB1 B;  4DOW A;  2AIR B;  4J9C A;  3QJY A;  3JAM E;  1M2V A;  5GAN d;  4F7U B;  2QGF B;  5GAN g;  5D6W A;  1M90 C;  1VQ7 T;  4X9C A;  4F14 A;  1RAE B;  2P4R A;  5L23 A;  1ZSG A;  2KK4 A;  4BY6 C;  1YIJ T;  5FU6 C;  1JB0 E;  2ZPG B;  3QYH B;  3OMC A;  2ZPH B;  4QW2 A;  2O88 A;  4PFZ A;  4PFP A;  2DIL A;  5IHI A;  4F04 B;  1I07 A;  2QQR A;  4PKC C;  2V8I A;  2LCS A;  1HSQ A;  4L5G A;  2I0N A;  2MOX A;  3V7S A;  3CC7 Q;  4PNO A;  4MDW A;  5LJ3 h;  1KSW A;  3EGD A;  3GNF B;  2CP2 A;  2DFU A;  4C5I A;  3FB9 A;  1OU9 A;  4J6W A;  3AHU A;  2PU9 B;  2RO0 A;  4KGZ B;  5GAN 5;  1NZ9 A;  4Q5W A;  2RI3 A;  3LW5 E;  1JU5 C;  1GBQ A;  2QEX A;  1WXB A;  3CCE T;  2GFU A;  1OI1 A;  4QVD A;  5CKH A;  1H3Z A;  3PT9 A;  2WSC E;  2HL3 A;  2BUD A;  4L6V 5;  2XK0 A;  1VQK A;  1MND A;  3M0Q A;  2C0T A;  4A4K A;  1WGS A;  4KUI A;  3UA7 A;  2CT4 A;  2P0P A;  1E6H A;  2KXD A;  1NPR A;  1SG5 A;  1VQO Q;  2YLC A;  3U23 A;  4IUU A;  2HZY A;  3OYD A;  2CRE A;  2V26 A;  3I35 A;  2HCK A;  2L3S A;  4KGX B;  4N4H A;  5CR2 A;  2X4W A;  5GAO l;  3BDU A;  1QVP A;  4FT4 A;  3NTK A;  2DVE A;  1WQ7 A;  5GAO q;  3I55 A;  2CKK A;  5CKD A;  3JCM V;  1BI2 A;  2EYX A;  1W70 A;  2CUB A;  3JCM Q;  2EPD A;  1HD3 A;  3JCM b;  1UG1 A;  2OTL T;  2DRK A;  1VQN Q;  3IQL A;  1IRE B;  5HCK A;  3C0C A;  3QSU A;  4J83 A;  2OTJ A;  1KK7 A;  2ECZ A;  2K3X A;  4FYW B;  4C0D C;  2X3X D;  1XNI A;  2LCL A;  2RM4 A;  1KHI A;  2M51 A;  3TVT A;  4M7D A;  3FRN A;  3DLM A;  4JJC A;  2QXF A;  3M0T A;  3OYE A;  4HA8 A;  2JUF A;  2LX9 A;  2YHT A;  4O5V A;  5DLQ E;  1Q82 R;  4LDW A;  3VV0 A;  3EGU A;  2E1H A;  5GAN 7;  1ZX6 A;  1I0C A;  4J9F A;  1ZBJ A;  2W0Z A;  5LJ5 h;  1ZA1 B;  4JRI A;  2XID A;  2YRD A;  4M75 E;  4RTY A;  5FU7 C;  2RI2 A;  3CCQ A;  4II1 A;  3MP6 A;  2DXU A;  2O9V A;  2JNG A;  1Q81 R;  4HCZ A;  1SKU B;  2K3Y A;  3MCA B;  5GAM e;  1PSE A;  3VS7 A;  3EFO A;  2HQE A;  1RAF B;  2E70 A;  2OI3 A;  3I5S A;  4BAC A;  2K5I A;  4FT2 A;  4NS5 A;  3LGL A;  2AKK A;  2DEU A;  4M77 A;  2DE0 X;  4M75 B;  1G2B A;  1UE9 A;  5J3B A;  1Q86 R;  2X4J A;  1PSF A;  5CQX A;  1TG0 A;  1BCO A;  3JCM e;  3OW2 P;  2YUO A;  4BE1 A;  1PCX A;  2F1L A;  2FZC B;  2VXF A;  1X6O A;  2DIG A;  5A0G A;  1T0J A;  4DOV A;  2DYI A;  1OYX A;  2AK5 A;  2FZK B;  3MKD A;  3QG1 A;  5KH6 A;  3JB9 J;  1V76 A;  3G71 A;  1M90 U;  4E7J A;  3C95 A;  3I55 Q;  1KQS P;  2CZ6 B;  1OUL A;  1N6A A;  1OZ2 A;  2DBM A;  2HSP A;  5J39 A;  4TVR A;  1FXX A;  2ZAE A;  4EMK B;  1H92 A;  3QDR B;  3CMA A;  2D1X A;  2OTJ Q;  2EJG A;  1Q82 C;  3MO8 A;  3UDC A;  4RMO A;  2KYB A;  2RK2 A;  3EFR A;  5GAN 2;  2FVU A;  4OMQ A;  1VQM T;  3A8L B;  3UWN A;  3OSV A;  3A1P A;  3CC2 A;  4N0A A;  1IGU A;  2ZPE B;  2DLP A;  2XI9 A;  2BE7 D;  1SRL A;  2X35 A;  4PJO C;  3J7A F;  2BZY A;  5GMK h;  1VQP T;  1Q81 C;  3OY9 A;  5GAM d;  2H3E B;  5GAM g;  3QZ5 B;  4LE9 A;  4A54 A;  1OZ3 A;  3CCL T;  1GBR A;  1TH7 A;  5I22 A;  4YTL A;  2JM9 A;  2ABL A;  2J7I A;  4ANJ A;  3CCQ Q;  1VYV A;  4C8Q A;  5LJ3 f;  4PLL A;  1ZUU A;  1Q86 C;  3NFC A;  3JCM g;  4JRQ A;  1AZG B;  1M3A A;  2KNB B;  3M56 A;  3QII A;  1TU0 B;  2QQ9 A;  3OYI A;  4RTV A;  5EC7 A;  2F2W A;  2EGE A;  3MEW A;  4M78 F;  2RA2 A;  1UTI A;  1RL2 A;  2E41 A;  2K57 A;  1RAA B;  2K2M A;  1WHJ A;  2F5K A;  1YI2 T;  2FZG B;  4ZGD B;  2F2V A;  4ATO A;  3CCR A;  2LP5 A;  1SSH A;  2L5Q A;  4OB3 B;  1K0X A;  1YJW T;  2HNI A;  2LMJ A;  3JCM c;  1JJ2 P;  5CK9 A;  1YJ9 Q;  2OJ2 A;  3OA6 A;  5KYU B;  1VIF A;  3SD4 A;  3GPL A;  1MMN A;  5FWC A;  3OYC A;  2D0Q B;  2K5L A;  4IUQ A;  3G1J A;  3V8L A;  5AYF A;  4FW1 A;  3THK A;  4XTV A;  1AWW A;  1XJW B;  2FPD A;  3G6E T;  2L3R A;  2H8H A;  1OQK A;  2X3W D;  3M53 A;  2AT1 B;  2NUT B;  1JXO A;  1WJQ A;  2HQX A;  4ZN3 A;  4IUP A;  1IB8 A;  4FSX A;  1BI1 A;  1OOT A;  3CC2 Q;  1VYU A;  2V1R A;  2NUZ A;  5KYX A;  1RLQ C;  4O6J A;  1QQJ A;  3CCU A;  3CCJ A;  2B86 A;  2DO3 A;  5FRN A;  3RMS A;  2A08 A;  4HCC A;  2PZ1 A;  2DTH A;  2JN0 A;  2NLU A;  1LJO A;  3EHR A;  1KQ2 A;  2FO0 A;  1DJ7 B;  1WYX A;  3TCJ A;  5CCA A;  2HMA A;  2RJC A;  1SHG A;  1RLP C;  4RCC A;  1EZZ B;  1WPY A;  1YJW A;  2HEQ A;  2BE9 B;  3JCM h;  4AG2 C;  5LL6 S;  2QQS A;  5LJ5 f;  4E2F B;  4R55 A;  4XU2 A;  4NOY A;  1X75 C;  1M1K R;  5KYN A;  4WF2 A;  4PJM A;  2XDB A;  2L89 A;  3I9Q A;  2DIQ A;  1K8A R;  3VS5 A;  2YUN A;  3OYF A;  4M7A A;  1RUW A;  3OS2 A;  2KRO A;  2LQN A;  5GMK i;  4J9G A;  1VQL T;  3I56 T;  1JXM A;  2J05 A;  4EMH A;  4HT8 A;  2EGC A;  4HVU A;  2NUP A;  3VS4 A;  1M9S A;  3G4S Q;  3CCR Q;  2YT6 A;  4F7U A;  4RUG A;  3EH2 A;  4C5G A;  2QAZ A;  3S3M A;  4DEY A;  1UEB A;  1Q82 U;  3VYH B;  4QQG A;  2J06 A;  1GRI A;  2RQU A;  2EKH A;  1HXD A;  5KCO A;  3Q1J A;  1YIT T;  3OQ5 A;  2HBP A;  2ED0 A;  3LGF A;  4M78 D;  1G3T A;  2LT1 A;  4CC2 A;  2M1H A;  2EW3 A;  1UJY A;  4FIB A;  1Q81 U;  5D6X A;  1X43 A;  4XU1 A;  2RI5 A;  4AG1 C;  1ACM B;  2WSE E;  1Q95 G;  4DA4 A;  3CCU Q;  5IXB A;  4IUR A;  3CD6 Q;  1Q7Y R;  3E19 A;  1M8M A;  2PNI A;  2QQB A;  1PD0 A;  4LNP A;  3PIO A;  1Q86 U;  1QP3 A;  2LVM A;  4OB0 B;  3V8J A;  1M1K C;  5C0M A;  2AZV A;  3JCM X;  5KYW B;  2E6Z A;  1QP2 A;  1FMV A;  1W2B A;  3CC7 A;  1K8A C;  2ATC B;  1IO6 A;  2BTT A;  2L3Q A;  2E65 A;  3P8B B;  2LRQ A;  2XU8 A;  1KJW A;  4JRP A;  4OVA A;  3MJX A;  4XTZ A;  2A3L A;  4LUE A;  1OV3 A;  3CCV Q;  2XKO C;  2AZS A;  5IT9 E;  3CEY A;  4MDX A;  4BDZ A;  3PVQ A;  3LLR A;  2XDP A;  3J81 E;  1JBM A;  3OYJ A;  2DD5 A;  2ZGW A;  1CSK A;  2COW A;  2D8J A;  2NYS A;  3SWN C;  1KFZ A;  1NEB A;  2X4Y A;  2AHJ B;  1LNX A;  3M9Q A;  1ZBX A;  1M5Q 1;  2ESW A;  2ZPI B;  4M7A E;  3CPW P;  3VS2 A;  3ZFJ A;  2EQM A;  1NPP A;  1MGQ A;  4CRI A;  1H8K A;  4R0K A;  2W10 A;  2X4X A;  2XG8 D;  1VQO A;  1UGR B;  2QA4 Q;  4Z89 A;  1M3C A;  4MML A;  4F7U E;  2COZ A;  1NLO C;  2CP0 A;  1NG2 A;  2P0Q A;  1W6X A;  4M77 F;  3CCM Q;  1PRM C;  2QEX T;  3CC4 A;  2JOY A;  3NTI A;  4C92 E;  2G3R A;  4M78 C;  4J7F A;  5I2M A;  1Q7Y C;  1VQK T;  4FCY A;  2DK3 A;  4LUD A;  2VV5 A;  3L2R A;  4BUG A;  5IN1 A;  4ZTF A;  2NUP B;  3PMT A;  4Z8A A;  2KT8 A;  3JB9 I;  2FB7 A;  1VQN A;  1B34 B;  4KUL A;  1JRI A;  4RCB A;  3QO3 A;  5GJV B;  1UJ0 A;  5CVI A;  1V1C A;  1LVK A;  3M4Y A;  3UPU A;  2QDY B;  3M5A A;  4C92 B;  2A36 A;  1BI0 A;  2LDM A;  3VU3 C;  1W2B S;  3A98 A;  1S1N A;  4QKU A;  4Z02 A;  1K1Z A;  3DB4 A;  2GF7 A;  3I55 T;  3X20 B;  5GAN 4;  4ORZ A;  3EHQ A;  2JW4 A;  1SHF A;  2LQK A;  4M75 A;  3VUB A;  3OS5 A;  1B7T A;  4HVW A;  2OTJ T;  1TSF A;  1D0X A;  2E5Q A;  3EG3 A;  2MI6 A;  4B9X A;  2R58 A;  2GGR A;  1E6G A;  3JB9 D;  2O2O A;  3JCM f;  1V29 B;  1K76 A;  1SRM A;  5LJ3 j;  4BI3 A;  2FRW A;  3SHW A;  2E4H A;  2Y4Y A;  4AFS C;  5LJ5 d;  4CC4 B;  4C8Q F;  4DBR A;  4EMK A;  3QYG B;  3KXT A;  1RAD B;  2JM8 A;  2EVR A;  3ME9 A;  4L59 A;  4QVC A;  4M7D D;  4E7K A;  3ULR B;  1VQ6 Q;  1UGS B;  1N5Z A;  3AT1 B;  4RTX A;  3CCQ T;  3VS6 A;  4OGC A;  3CC4 Q;  2A37 A;  2E3I A;  1WLP B;  2RHX A;  4HXJ A;  1ABO A;  1D1C A;  2X51 A;  5FRM A;  2RN8 A;  3GLX A;  5CAI A;  4DEX A;  2RH2 A;  3VRY A;  2DPP B;  3EH1 A;  1T3S A;  3S6W A;  2EYZ A;  5GAN h;  4X34 A;  1M1K U;  5I21 A;  5EG2 A;  3X25 B;  1K8A U;  5FWB A;  2J6O A;  1UB4 A;  2LNV A;  4XAX B;  1YNZ A;  2CP3 A;  1UHC A;  4JRK A;  4X9D A;  3KBG A;  2YWW A;  3OSS C;  4BY6 B;  3G71 T;  2Y4X A;  5FU6 B;  1Z9Q A;  1X2Q A;  3OMG A;  3GIB A;  2PVO B;  3X24 B;  2VUB A;  4ZTJ A;  1KG1 A;  3ZL7 C;  4PJO D;  3QUI A;  1U1S A;  2GQV A;  1VQ8 Q;  4FYX B;  1I1J A;  3CMA T;  4E6R A;  4GLM A;  1BIA A;  3UF4 A;  3H0I A;  1WHL A;  5I11 A;  1K0S A;  1GL5 A;  1GXI E;  2DJQ A;  1LOJ A;  1FMW A;  1NLP C;  2YLB A;  3HP9 A;  3MP1 A;  4FYV B;  4AT1 B;  1AOJ A;  2A7Y A;  3CC2 T;  2VYT A;  3SFM A;  5KYU A;  4WTO B;  1MMA A;  4BB7 A;  1QKX A;  4ELZ C;  1TS9 A;  3VUZ A;  1VQ9 Q;  4F17 A;  5LJ5 j;  2KMT A;  3OYG A;  2K7A A;  2PVD B;  2DET A;  4M7D C;  1WJR A;  2L2P A;  2QGG A;  2DNU A;  2EQU A;  3GP8 A;  1Q7Y U;  2NUT A;  2MF2 A;  1VQ4 Q;  2JXB A;  4B6M A;  4JJB A;  1TTH B;  1U06 A;  3CCS Q;  2EBP A;  4M7A F;  4EIK A;  4E7I A;  1K4U S;  1OPK A;  4BDY A;  4KH0 B;  2KAF A;  2RHU A;  1GCQ A;  2LZ6 B;  2BZ8 A;  3QHS A;  3QWY A;  4DBF A;  2M16 A;  1ZSZ C;  1G8X A;  2AKL A;  1YJ9 A;  3JB9 G;  2VGM A;  5C6S A;  4GY5 A;  4F7U F;  1VQ7 Q;  1SPK A;  4BI8 B;  5IHN A;  5D6Y A;  4C8Q D;  1KC8 R;  8AT1 B;  4J9B A;  3H6Z A;  1YIJ Q;  2J6K A;  3V7C A;  4Y91 A;  4C92 F;  4M7D G;  1I5L A;  4RTW A;  1SSF A;  4OP0 A;  3L2W A;  2DD4 A;  1UHF A;  3CCR T;  4E7S A;  3OYK A;  2PTK A;  2I2L A;  1MV3 A;  1YWP A;  2JTM A;  1QVG P;  4C0D B;  4PJJ A;  4EDU A;  4M77 C;  3HRU A;  1IRX A;  1ZUK A;  4KBM B;  4OB2 B;  1D3B B;  2B8A A;  3JB9 H;  4PL6 A;  3RKY A;  2H3J A;  3MP8 A;  1EX4 A;  1IGQ A;  4LD9 K;  2EYW A;  2JMA A;  2EQJ A;  1YP5 A;  1M4Z A;  4V2S A;  2CSI A;  2Y90 A;  2O4X B;  2MK5 A;  1KD1 R;  1S72 A;  2R5M A;  1KQ1 A;  4JZ4 A;  2E3H A;  2KR3 A;  5CIU A;  3CBP A;  5KCH A;  1ABQ A;  3O8V A;  5FU7 B;  2DF6 A;  1K9M R;  4NL3 A;  4QQD A;  4C0Z A;  4GLK A;  2EFI A;  5GMK j;  3CCU T;  3CCJ T;  3CD6 T;  1QWE A;  2MYS A;  1RI0 A;  3MEV A;  3C4S A;  1KHC A;  3PE0 A;  1N9S A;  1WA7 A;  3M57 A;  1NYG A;  1X6B A;  4PJO G;  3A8O B;  2L3P A;  1YJN Q;  4N0A C;  4RG2 A;  4LXC A;  2XMF A;  4IIO A;  2CP7 A;  4J9E A;  2EAY A;  2LT4 A;  1D1A A;  3PIP A;  2QTV A;  2FL7 A;  3G4S A;  3UT1 A;  2FEI A;  1KC8 C;  2RHZ A;  3PMI A;  2DA9 A;  3L1A A;  4J5Y A;  3FDR A;  2RK1 A;  2V8J A;  3KFV A;  3V8K A;  1A0N B;  2JTF A;  4HT9 A;  2WSF E;  5L8R E;  2FYK A;  4C8Q C;  4FL6 A;  2RJE A;  2ED1 A;  3OYH A;  5KYW A;  2OX7 A;  2SRC A;  3H0H A;  1JO8 A;  2C0I A;  3ZBD A;  5IHK A;  1WXU A;  3HRS A;  2KVQ G;  1TUG B;  1M8V A;  1LCK A;  2QG9 B;  4VUB A;  3WXM B;  3EG9 A;  2CP6 A;  5FW9 A;  1YHQ Q;  4N4G A;  3F70 A;  2RB6 A;  3RKW A;  5GAN f;  4UC4 A;  3DLL A;  4A63 B;  3M55 A;  4M4Z A;  3S3N A;  3HFN A;  1G83 A;  1KD1 C;  2GCX A;  3CD6 A;  1ZHI A;  3LH0 A;  2O31 A;  2DL8 A;  2DL7 A;  1Y7X A;  5GAN 6;  2JZ2 A;  1RAI B;  1K9M C;  2LQ8 A;  5GAM h;  5GAN 3;  1JEG A;  3L42 A;  2EYY A;  3HL8 A;  3QBY A;  5J26 A;  3LYI A;  4QQ6 A;  3M0S A;  2ZPF B;  1S72 Q;  1XTD A;  4JS5 A;  2LTO A;  1X01 A;  1WHK A;  3LH5 A;  3RDV A;  4XTW A;  5CKB A;  3VS1 A;  2JMC A;  3L2U A;  3CCV A;  1OU8 A;  2DER A;  2VGN A;  4IKF A;  4K11 A;  1AZE A;  4JPB W;  4M75 F;  1VQ5 Q;  1PM3 A;  2DXC A;  1MNE A;  2FG0 A;  1UUE A;  3L2Q A;  4E47 A;  2QYZ A;  1P92 A;  3TRE A;  1EIF A;  3RBB B;  5CKF A;  3CC7 T;  2ROT A;  2KYM A;  1B34 A;  2MPX C;  2KT1 A;  4IIM A;  4ESR A;  2R57 A;  3M0P A;  4XTU A;  1XOV A;  4J7I A;  3PFS A;  5DM7 R;  2EKO A;  4JDS A;  5KYY B;  2QA4 A;  5LJ3 e;  3CXC P;  4C92 A;  4ZGJ B;  2EWN A;  4XU0 A;  1YWO A;  2DJZ A;  1Y0M A;  3JSC A;  1M30 A;  1M3B A;  3QPH A;  4D6W A;  3CCM A;  4C0G A;  1NYF A;  3FJP A;  1VQM Q;  2DYB A;  3E9G A;  5CO7 A;  2WAC A;  3JCM W;  1WFW A;  4FM4 B;  4WCI A;  2ZPB B;  3H0F A;  3MET A;  3HSB A;  4ZGE B;  1VA7 A;  3RES A;  4M7A C;  3FLG A;  1QCN A;  2RQT A;  3RMQ A;  2KRN A;  1VQP Q;  3L2V A;  1VQO T;  1QCF A;  3EAE A;  2FPF A;  1Y96 B;  5A0L A;  2E10 A;  4FSS A;  1MV0 B;  3CCL Q;  5IAY A;  1D0Y A;  2P0K A;  2RNA A;  3HTR A;  4KRT A;  2YRC A;  3M58 A;  2HKQ B;  2DXT A;  3OYB A;  4C5E A;  3CC4 T;  2K6D A;  4HCB A;  2RQR A;  1QVF A;  1M27 C;  3L2Z A;  2KRM A;  1NJI R;  1Y57 A;  2ZZD A;  1GFD A;  1TUD A;  3UAT A;  3ZEH A;  1VQN T;  1WZO A;  3E2U A;  4DQ2 A;  3CPW A;  4LD6 A;  1RI9 A;  2K4Y A;  4AFZ C;  3EG9 B;  3JV3 A;  2VB6 A;  3J80 E;  4FW2 A;  3CME Q;  2VXE A;  1JQQ A;  1YI2 Q;  2NWM A;  3H41 A;  4OMM A;  1KC8 U;  2QI2 A;  4PJN A;  1SEM A;  4MZM A;  2CGH A;  2L0A A;  2DAQ A;  1R8O B;  3C94 A;  4XK8 E;  5LJ3 d;  2CH4 A;  5LJ3 g;  3BW1 A;  1YBY A;  3QXE B;  3PGG A;  1UDL A;  4OMF B;  1M2O A;  2KRS A;  5HKC A;  2LX7 A;  3JRZ A;  3QZ9 B;  1D09 B;  1UFF A;  2LQW A;  2KE9 A;  2P84 A;  1BKB A;  1U1T A;  1XQH A;  1VQ6 A;  1H3H A;  2HD0 A;  3KUF A;  1W2B P;  3G6E Q;  1BK2 A;  4KH1 B;  1WHH A;  3VS3 A;  3NMZ C;  1AD5 A;  1OPL A;  2XD0 A;  4EPC A;  2GBQ A;  1IHW A;  5IH2 A;  5LJ5 e;  4CC3 A;  2VC8 A;  2XIC A;  4M75 D;  3RUX A;  4J8O A;  3OYL A;  2YRV A;  5GAN 8;  1KD1 U;  3NPF A;  2C06 A;  2KSS A;  4FYY B;  1FX7 A;  3H8Z A;  4RG8 A;  3WVE B;  4KGV B;  1K9M U;  1OX9 A;  1VIE A;  2QDL A;  4RTZ A;  1I5O B;  3RNJ A;  1OEB A;  1VQ4 T;  4Z88 A;  4C5H A;  1WI7 A;  4A4G A;  1RAC B;  2EYQ A;  3M0U A;  1NJI C;  1QVF S;  2MWP A;  3REB B;  2DZ9 A;  1GFC A;  5GAO r;  2GFA A;  3EGX B;  3CPW S;  4D8D A;  3M0R A;  2QTX A;  2DKG A;  3VRZ A;  1BBZ A;  2PQW A;  2G6F X;  4M78 G;  3TSW A;  4CI0 C;  1PRL C;  5AT1 B;  3O5Z A;  2HKN A;  1X27 A;  5GAM f;  2YUQ A;  1VQ8 A;  2HAX A;  1NM7 A;  2GTJ A;  1D1B A;  2VKN A;  1VQL Q;  2RF0 A;  3I56 Q;  5KE3 A;  3JCM P;  2JS2 A;  4XU3 A;  3RR6 A;  2O01 E;  3R6O A;  4IUV A;  2HSE B;  1WJS A;  4DBQ A;  3NTH A;  4J9H A;  3BY7 A;  2CT3 A;  2YDL A;  1U5S A;  4A4H A;  3OS1 A;  4DBH A;  2CSQ A;  1WDX A;  1I4K 1;  2K5F A;  2FRY A;  3NHN A;  5LJ5 g;  1VQ9 A;  3SWN B;  3REA B;  1G3Y A;  1WIE A;  2DX1 A;  1YIT Q;  1C0M A;  4JJN K;  2D9T A;  4M78 E;  4JLG A;  2KI7 A;  5GMK e;  5DY9 A;  3EG2 A;  1VQ4 A;  4LDX A;  1PNJ A;  4AFU C;  4LDY A;  3FJ5 A;  2HDA A;  3CCS A;  1QCO A;  4QT7 A;  4M75 C;  2DL3 A;  2KQW A;  2MIO A;  3A8G B;  1AEY A;  3QJ6 A;  3CPF A;  3JCM J;  2GQI A;  1G3S A;  2COY A;  1D3B A;  4F16 A;  2LJ0 A;  2LJ3 A;  1ZLM A;  2BZX A;  4M78 B;  2MWO A;  1VQ7 A;  2M0O A;  1H64 1;  1YIJ A;  1YJN T;  1BYM A;  1QMC A;  2O4X A;  2GNC A;  4RKU E;  1R0C B;  1U3O A;  4JS4 A;  4EMK C;  1QWF A;  1W1F A;  3WVD B;  2ZCF B;  3FIF A;  1F1B B;  3ER0 A;  4J6Y A;  4M77 D;  2ENM A;  4HKE A;  4M75 G;  1YJ9 T;  4RTU A;  5GMK m;  5GAN j;  3X26 B;  3I5R A;  1CKA A;  3RKX A;  5HY6 A;  1LPL A;  1N8R R;  9ATC B;  2KDS A;  2QK0 A;  3HFO A;  1FMK A;  2RHY A;  2D8H A;  5I2S A;  2D6F A;  3CCE A;  2KXC A;  3PVL A;  3HPW A;  2F2X A;  3OS0 A;  3OW2 A;  1YHQ T;  2MAM A;  2QAS A;  3FEO A;  1TUC A;  5CKE A;  3DB3 A;  4LN2 A;  1YCY A;  3OYM A;  1UGQ B;  1VOM A;  5GJW B;  1ZSZ A;  3BDL A;  4J6X A;  1WX6 A;  1BB9 A;  1M2V B;  2OAW A;  4XQ3 A;  2DVJ A;  1W4S A;  3ASK A;  3FC3 A;  4E7H A;  2V8K A;  1KQS A;  1TOV A;  1WHG A;  1YJN A;  3HKS A;  2QEX Q;  4E7L A;  5FLX E;  1RAH B;  1S72 T;  3QKJ A;  2K3B A;  1SF9 A;  4J9I A;  4GBQ A;  3MEU A;  1VQK Q;  2M02 A;  2PVG B;  1PKS A;  2L8D A;  3EG0 A;  4PJL A;  2BKD N;  2Z0W A;  1Y71 A;  3VKI A;  1T0H A;  3NGP A;  4X1V A;  1K73 R;  2OTL A;  4HCK A;  4MMK A;  3EGD B;  1QVG A;  1NJI U;  4Y92 A;  2HQH A;  1VQ5 T;  2IVW A;  2EJ9 A;  2QQA A;  4PJO A;  2RHI A;  2MCN A;  4OMO A;  3QWX X;  2CYZ B;  2EQK A;  1NE8 A;  3M54 A;  2A28 A;  2RJD A;  3G4S T;  3RIR A;  1J3T A;  1E7O A;  3H9N A;  1N8R C;  3MEA A;  4NL2 A;  1YHQ A;  3VS0 A;  5GAO m;  2LC4 A;  1B3Q A;  5HK3 A;  1VYT A;  1D0Z A;  1B07 A;  2RQW A;  2K79 A;  1NBE B;  2K9G A;  1NEG A;  2DZC A;  3EFS A;  3OW2 S;  1GCQ C;  1YCS B;  1G5V A;  3LX7 A;  2YUP A;  3HHT B;  4OMN A;  3CCE Q;  1MUZ A;  2BIV A;  2EQI A;  3VYG A;  2CZ0 B;  4FU6 A;  3BE3 A;  1Z9Z A;  4M7D E;  2XHC A;  3GOX A;  5KYY A;  2CZ7 B;  1KQS S;  1QW1 A;  4C0F A;  3P8H A; 
#chains in the Genus database with same CATH homology
 2ROT A;  2X3X D;  2KYM A;  4IIM A;  3R6N A;  2KT1 A;  4ESR A;  3M0P A;  2M51 A;  1XOV A;  3TVT A;  4JJC A;  2JTE A;  2VVK A;  4J9D A;  4LUD A;  3M0T A;  5ECA A;  4Z8A A;  2KT8 A;  2LNH B;  1YWO A;  5GJV B;  1Y0M A;  4HVV A;  1M30 A;  1UJ0 A;  1V1C A;  1M3B A;  3EGU A;  1NYF A;  1HJD A;  1ZX6 A;  1I0C A;  2DYB A;  4J9F A;  2CDT A;  2A36 A;  1ZBJ A;  2W0Z A;  2DL4 A;  3A98 A;  1S1N A;  1WFW A;  2FPE A;  4WCI A;  3H0F A;  2LJ1 A;  1K1Z A;  4RTY A;  4CC7 A;  2ROL A;  1VA7 A;  1UEC A;  2O9V A;  2RQT A;  2KRN A;  4ORZ A;  3EHQ A;  2JW4 A;  1SHF A;  1QCF A;  2FPF A;  2DM1 A;  3VS7 A;  4FSS A;  1MV0 B;  2RNA A;  2OI3 A;  4KRT A;  3I5S A;  4HVW A;  2AKK A;  2DE0 X;  2JT4 A;  2CUD A;  2K6D A;  1G2B A;  1UE9 A;  1GCP A;  3EG3 A;  2RQR A;  1TG0 A;  2GGR A;  2J6F A;  1E6G A;  1M27 C;  2O2O A;  2YUO A;  1K76 A;  1SRM A;  2KRM A;  1Y57 A;  2FRW A;  1EFN A;  1TUD A;  2D0N A;  2E5K A;  3SHW A;  3UAT A;  4AFS C;  4D8K A;  1T0J A;  1GFD A;  4CC4 B;  1RI9 A;  4AFZ C;  3JV3 A;  2AK5 A;  2JM8 A;  2EVR A;  3ULR B;  1JQQ A;  2NWM A;  2DBM A;  2HSP A;  3H41 A;  4OMM A;  2IIM A;  3SEM A;  1SEM A;  2HBW A;  2L0A A;  3CQT A;  1N5Z A;  2EGA A;  1H92 A;  2CH4 A;  2KEA A;  4RTX A;  2D1X A;  3VS6 A;  1UDL A;  2C0O A;  2KRS A;  2LX7 A;  2A37 A;  2KYB A;  1UFF A;  2LQW A;  4OMQ A;  1WLP B;  4HXJ A;  1ABO A;  2KE9 A;  2RQV A;  2CH4 W;  2RN8 A;  1H3H A;  4DEX A;  2DLP A;  1BK2 A;  3VRY A;  3VS3 A;  3NMZ C;  1AD5 A;  1OPL A;  1SRL A;  1T3S A;  2EYZ A;  2GBQ A;  5IH2 A;  2BZY A;  4CC3 A;  5FWB A;  2J6O A;  4LE9 A;  3NPF A;  1GBR A;  1YNZ A;  1UHC A;  5I22 A;  2JM9 A;  2ABL A;  2J7I A;  3EG1 A;  3UA6 A;  1VYV A;  2RPN A;  4ZNX A;  1Z9Q A;  1X2Q A;  2QDL A;  2DMO A;  1PHT A;  4RTZ A;  3ZL7 C;  1ZUU A;  3RNJ A;  1OEB A;  4Z88 A;  2V1Q A;  1AZG B;  1WI7 A;  1K9A A;  1M3A A;  2KNB B;  1BU1 A;  1I1J A;  3M0U A;  4E6R A;  4GLM A;  4OMP A;  4RTV A;  1X69 A;  3REB B;  3UF4 A;  3H0I A;  5EC7 A;  2F2W A;  5I11 A;  2EGE A;  1GL5 A;  1GFC A;  1K0S A;  2DJQ A;  1AWJ A;  1NLP C;  1UTI A;  2DRM A;  4D8D A;  3M0R A;  2K2M A;  1AOJ A;  3VRZ A;  1BBZ A;  2G6F X;  3TSW A;  1PRL C;  1UGV A;  2F2V A;  3O5Z A;  1PKT A;  4RTT A;  2LP5 A;  1QKX A;  1X27 A;  2DL5 A;  1KIK A;  1SSH A;  2YUQ A;  1NM7 A;  1K0X A;  2GTJ A;  4F17 A;  2LMJ A;  2VKN A;  2K7A A;  2RF0 A;  2L2P A;  2OJ2 A;  2JS2 A;  5FWC A;  2DNU A;  4J9H A;  2CT3 A;  2YDL A;  1U5S A;  2JXB A;  3THK A;  4JJB A;  1U06 A;  2EBP A;  1AWW A;  2FPD A;  4EIK A;  2H8H A;  2CSQ A;  1WDX A;  1X2K A;  2X3W D;  1OPK A;  4JZ3 A;  1K4U S;  2FRY A;  3NHN A;  1GCQ A;  1WXT A;  2LZ6 B;  2BZ8 A;  3QWY A;  3REA B;  1JXO A;  1WIE A;  2AKL A;  2DX1 A;  1OOT A;  1AWO A;  1VYU A;  2V1R A;  2NUZ A;  1SPK A;  3EG2 A;  1RLQ C;  5IHN A;  1FYN A;  1PNJ A;  2RMO A;  4AFU C;  2M0Y A;  4J9B A;  2B86 A;  2J6K A;  1QLY A;  3FJ5 A;  2HDA A;  3GBQ A;  5IXF A;  2A08 A;  4OML A;  2PZ1 A;  4QT7 A;  2DL3 A;  2MIO A;  2KGT A;  1AEY A;  4RTW A;  2VWF A;  2GQI A;  3EHR A;  1UHF A;  1X6G A;  1QKW A;  2FO0 A;  4F16 A;  2PTK A;  1WYX A;  2LJ0 A;  2LJ3 A;  1MV3 A;  1YWP A;  2KBT A;  2GTO A;  1ZLM A;  2BZX A;  1ZUK A;  1SHG A;  1RLP C;  1AVZ C;  2GNC A;  1T3L A;  2HEQ A;  4AG2 C;  1ZUY A;  3TSZ A;  1U3O A;  1QWF A;  2EYW A;  2JMA A;  1YP5 A;  3I9Q A;  4AFQ C;  1W1F A;  3VS5 A;  2JS0 A;  2YUN A;  1RUW A;  2CSI A;  2KRO A;  2LQN A;  4J9G A;  4JZ4 A;  2KR3 A;  2ENM A;  1JXM A;  2J05 A;  2SEM A;  4RTU A;  1AWX A;  1ABQ A;  2EGC A;  2DF6 A;  4HVU A;  2DBK A;  3I5R A;  3VS4 A;  1CKA A;  2YSQ A;  2YT6 A;  4RUG A;  1CKB A;  1FMK A;  1QWE A;  1YN8 A;  4JJD A;  2D8H A;  1PWT A;  2O9S A;  3PE0 A;  1WA7 A;  4DEY A;  2KXC A;  3PVL A;  1NYG A;  2J06 A;  1X6B A;  1GRI A;  2RQU A;  2EKH A;  2L3P A;  4J9C A;  2F2X A;  2XMF A;  4IIO A;  4J9E A;  1TUC A;  4F14 A;  2ED0 A;  4LN2 A;  2FEI A;  2P4R A;  5L23 A;  1ZSG A;  2DA9 A;  5GJW B;  1WX6 A;  1BB9 A;  3KFV A;  2OAW A;  4CC2 A;  2DVJ A;  1A0N B;  2O88 A;  2EW3 A;  2DIL A;  5IHI A;  1UJY A;  1X43 A;  1I07 A;  4AG1 C;  2LCS A;  1HSQ A;  2I0N A;  2MOX A;  2ED1 A;  5IXB A;  1KSW A;  2K3B A;  4J9I A;  4GBQ A;  1M8M A;  1PKS A;  2SRC A;  3H0H A;  1JO8 A;  3EG0 A;  2C0I A;  2PNI A;  5IHK A;  1WXU A;  4LNP A;  1T0H A;  1LCK A;  3NGP A;  4X1V A;  4HCK A;  2AZV A;  5FW9 A;  4Y92 A;  1JU5 C;  1GBQ A;  4A63 B;  1WXB A;  4M4Z A;  1IO6 A;  2BTT A;  2L3Q A;  2MCN A;  1G83 A;  4OMO A;  1KJW A;  3QWX X;  4LUE A;  2O31 A;  1OV3 A;  2DL8 A;  3M0Q A;  2AZS A;  2C0T A;  2DL7 A;  3UA7 A;  2CT4 A;  3PVQ A;  1E6H A;  2A28 A;  2KXD A;  1JEG A;  1J3T A;  1E7O A;  2EYY A;  3U23 A;  1CSK A;  3VS0 A;  3M0S A;  2CRE A;  2D8J A;  1B3Q A;  1KFZ A;  1NEB A;  3I35 A;  1VYT A;  2HCK A;  2L3S A;  3LH5 A;  1B07 A;  3VS1 A;  2ESW A;  2JMC A;  2RQW A;  3VS2 A;  2K79 A;  2K9G A;  1NEG A;  1H8K A;  1GCQ C;  1YCS B;  4R0K A;  2W10 A;  4K11 A;  1AZE A;  2EYX A;  4JPB W;  1W70 A;  2YUP A;  4OMN A;  1MUZ A;  2CUB A;  2EQI A;  4Z89 A;  1M3C A;  2EPD A;  1HD3 A;  2FG0 A;  1UUE A;  1UG1 A;  2DRK A;  1NLO C;  1Z9Z A;  3IQL A;  1NG2 A;  5HCK A;  3C0C A;  1W6X A;  2ECZ A;  3RBB B;  1ARK A;  1PRM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...