4RTZA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide vsl12
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
b'GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide VSL12
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 16
structure length 61
sequence length 61
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtzA00
2OAWA 2JMAA 3ULRB 4HCKA 2DM1A 2ROLA 2J6OA 2J6KA 1A0NB 2J7IA 3GBQA 2KGTA 2K9GA 1JO8A 3C0CA 1H92A 1V1CA 2C0TA 3VS3A 2D1XA 1X27A 2VVKA 4JJCA 4AFUC 1OEBA 4OMMA 1T3LA 1VYUA 3VRZA 2AK5A 1AD5A 1GRIA 2L3SA 2RQVA 3PVQA 3THKA 1T0HA 3EHRA 1JEGA 1HSQA 2LQNA 1NLOC 2AKKA 3EGUA 4CC4B 1MUZA 1QKXA 2ABLA 4RTWA 2BZXA 2OJ2A 3VS4A 2FG0A 3PE0A 1UJYA 1GL5A 2DF6A 2DRKA 2FEIA 1GCQA 1KIKA 4F16A 4M4ZA 2AZSA 1HD3A 4OMOA 1EFNA 4J9EA 2KT8A 2DJQA 1H3HA 2A37A 1MV3A 1WYXA 3NHNA 3REBB 1TUCA 2CREA 1VA7A 2JM9A 2X3WD 3EG1A 2GQIA 1SEMA 2D8HA 4R0KA 3O5ZA 2D0NA 3TSZA 2ED0A 5IHNA 2XMFA 1AWOA 1ZUKA 3UA6A 1FMKA 1QWFA 1UE9A 2LZ6B 1M3CA 4OMPA 1RLQC 2KXCA 2C0OA 1YNZA 2DBKA 2ENMA 3NPFA 3M0UA 3I9QA 2GNCA 2SRCA 1OPKA 3UA7A 3M0TA 4Z8AA 2DVJA 4DEYA 1K0XA 2H8HA 3QWYA 2PNIA 1NM7A 3H0HA 2F2WA 1XOVA 1I07A 2DNUA 3VRYA 1X2QA 1UHFA 4JJBA 1WA7A 2JXBA 2BZ8A 1RUWA 1AVZC 1NG2A 1Z9QA 5L23A 2YUOA 2LJ0A 3CQTA 1PRLC 2YSQA 2NWMA 1K1ZA 4X1VA 2ESWA 2KROA 2KT1A 1SHGA 1S1NA 5IHIA 2RPNA 2O31A 1K4US 1I0CA 1M30A 2RQUA 5HCKA 2DL4A 1W70A 1N5ZA 2I0NA 4J9CA 2FPFA 4ESRA 5IHKA 2DL3A 1NEBA 1OPLA 2KXDA 2CSIA 2HEQA 4GBQA 1GBRA 3M0QA 4OMQA 1SSHA 4WCIA 1ABQA 5IXFA 1U06A 3M0SA 2FPDA 2YUQA 1WXTA 2JT4A 1IO6A 4K11A 4LUEA 1QKWA 4J9BA 4RUGA 1UFFA 1QCFA 1UTIA 1YCSB 1E7OA 2L3PA 3LH5A 3UF4A 1AZEA 3I5SA 4LE9A 2G6FX 2LJ1A 2PZ1A 4E6RA 1SHFA 1KSWA 2LNHB 1AWJA 3NMZC 1JXOA 4OMLA 1WXBA 1U5SA 2GBQA 1TG0A 2EYWA 3U23A 2EYYA 1YN8A 2YDLA 2J6FA 3FJ5A 2EKHA 1U3OA 4IIOA 1BB9A 1BBZA 4F17A 1KFZA 3TSWA 3UATA 1PHTA 2KRSA 1MV0B 2AKLA 1GCPA 1Y0MA 2CDTA 1ZX6A 2DL5A 1TUDA 1K0SA 3VS2A 1W1FA 4OMNA 2EQIA 4RTVA 2MIOA 3EG2A 2CUBA 3REAB 1G83A 1NLPC 1WX6A 3VS6A 1YP5A 4AG1C 1AWWA 2DE0X 2O9VA 2A36A 1RLPC 4LUDA 1X43A 4F14A 1ZLMA 2DRMA 2CSQA 2KE9A 4JPBW 2KRNA 2VWFA 2EYZA 2CH4A 2RQTA 1AWXA 1GBQA 1M3BA 3PVLA 2OI3A 1UG1A 1QWEA 2RQRA 2EPDA 4HXJA 2MCNA 1SPKA 4RTTA 2LQWA 2ROTA 3JV3A 2DILA 4J9FA 2AZVA 4Y92A 2FRYA 2FPEA 1BU1A 2LCSA 1QLYA 1M27C 4AG2C 1JQQA 2VKNA 2EGEA 2DL7A 3IQLA 1E6GA 1WFWA 1K9AA 1VYVA 1UGVA 1WDXA 3VS0A 2SEMA 1FYNA 3H41A 1CKBA 4J9IA 2CH4W 2L2PA 2BZYA 1X2KA 1PNJA 2HCKA 4J9DA 2JW4A 2BTTA 4HVUA 2QDLA 2F2XA 2EGAA 2KYBA 1SRLA 4ORZA 1PWTA 1AOJA 1PKSA 2K7AA 2X3XD 1KJWA 2J06A 4JJDA 1ARKA 1B3QA 2DLPA 4CC2A 1B07A 1J3TA 2D8JA 1JU5C 1M8MA 5I22A 2L0AA 3EG3A 1NEGA 1LCKA 5GJVB 1NYFA 4D8DA 3I35A 1HJDA 2MOXA 5I11A 2GTJA 1E6HA 4J9GA 2CT3A 3TVTA 4RTZA 2DBMA 3VS5A 1UDLA 2EVRA 2KEAA 4Z89A 1CKAA 5GJWB 2FO0A 2W10A 1NYGA 2V1RA 3M0PA 4RTXA 2DL8A 2YUNA 4EIKA 2K3BA 2LP5A 3ZL7C 4GLMA 4J9HA 3R6NA 4LN2A 1AEYA 1WI7A 2JMCA 2PTKA 4AFZC 4DEXA 1VYTA 3VS7A 1UJ0A 1Y57A 3SHWA 2ECZA 2F2VA 2CUDA 4KRTA 5ECAA 2KRMA 2KR3A 1T3SA 5FWBA 5FWCA 4AFSC 1UHCA 1T0JA 2KYMA 3RBBB 2DYBA 1ABOA 2B86A 2GTOA 4AFQC 1CSKA 2J05A 4D8KA 5FW9A 3QWXX 5EC7A 1UECA 1BK2A 2L3QA 3H0FA 2YUPA 2RNAA 2O9SA 3EG0A 1I1JA 2ED1A 2EW3A 2V1QA 1PRMC 1X6BA 3M0RA 2RMOA 2CT4A 4RTUA 4HVVA 4Z88A 4CC3A 1RI9A 1YWPA 2O88A 1X69A 2K79A 2O2OA 2KBTA 2E5KA 2W0ZA 1ZBJA 1ZUYA 4IIMA 1JXMA 2DA9A 2DMOA 4QT7A 2A28A 3NGPA 4HVWA 3I5RA 1ZSGA 3RNJA 2YT6A 3H0IA 4JZ3A 2M51A 2KNBB 3KFVA 1ZUUA 5IXBA 2EYXA 1WXUA 1UUEA 2HDAA 2K2MA 2DX1A 1WLPB 4CC7A 1WIEA 2FRWA 2EGCA 4LNPA 2EBPA 4FSSA 2C0IA 1OV3A 1GFCA 2HSPA 2RF0A 2LMJA 1SRMA 3SEMA 4JZ4A 1GCQC 2RQWA 1YWOA 2IIMA 1GFDA 2JTEA 2HBWA 3A98A 1AZGB 4RTYA 3VS1A 2JM8A 1OOTA 5IH2A 2GGRA 2JS2A 2P4RA 1W6XA 2A08A 1G2BA 2JS0A 2K6DA 1X6GA 1H8KA 1PKTA 4A63B 1Z9ZA 2LX7A 4ZNXA 3EHQA 2NUZA 2M0YA 2RN8A 1K76A 2LJ3A 1M3AA
chains in the Genus database with same CATH superfamily
3HP9A 2KK4A 5LJ5j 1W2BA 1X01A 3VU3C 2J6OA 4FU6A 2AHJB 2P0PA 1BI3A 2MAMA 1K8AR 3QO3A 3JSCA 3QDFA 4XTWA 2KGTA 1JO8A 3C0CA 2C0TA 3M5AA 1PD0A 1T3LA 3VRZA 3JCMV 1AD5A 2LQ8A 1GRIA 5CCAA 2O4XB 2RQVA 1QCNA 2E3HA 1JEGA 2FVUA 4J8OA 2AKKA 5IN1A 4CC4B 2EJ9A 1VQ6A 1MUZA 3G6EQ 2BZXA 3RKXA 1OQKA 1GXIE 2R5MA 3SD4A 3PE0A 3MHXA 1UJYA 1JJ2A 2FEIA 2M02A 1QVGP 3EGXA 4M78G 2QQAA 4M4ZA 3HFOA 4OMOA 2QA4T 2XDPA 1TXQA 4FYVB 1YJNQ 2A37A 1MV3A 3NHNA 1FX7A 1TUCA 2CREA 3LGLA 4QKUA 1YI2Q 4BY6B 2D8HA 2CS7A 1M5Q1 4C92E 1ZQ1A 1YJWA 2QGFB 1G3TA 1VQKQ 3EFSA 5LJ3e 4E7LA 2RH2A 1QP3A 1SF9A 2AIRB 3CBPA 4PL6A 4O6JA 4OMPA 5GMKl 2F69A 4J5YA 1YNZA 3NPFA 3M59A 4OF1A 4BE2A 1Y07A 3UA7A 1S72T 5GAN2 4C5HA 2H8HA 3BY7A 5HK0A 3QWYA 3CC2T 3MPUB 4NS5A 1XOVA 3DB4A 1M90C 5KYWB 3G4SA 1QP2A 4DBRA 3SFMA 2QI2A 2JXBA 4JJBA 2HKNA 4QQDA 2ZPGB 1NG2A 5L23A 2LJ0A 4FSXA 4JDSA 4A4GA 4F7UE 3OYNA 3LX7A 4A54A 2EAYA 5IAYA 2PU9B 2KT1A 1SHGA 1G3SA 3HRSA 4GY5A 3OYJA 1O75A 1K4US 1I0CA 2RQUA 2QK0A 5HCKA 3M57A 2K5IA 1M1KU 5IHKA 1NEBA 3NTIA 3OSSC 2KXDA 2YWWA 3M0QA 5GANg 2LRQA 4ME7A 3M0SA 2YUQA 4M75E 1IO6A 4K11A 4LUEA 3JCMb 1IGUA 4J9BA 3M56A 1QVFP 4C5GA 3UPUA 4RUGA 5LJ5d 1UTIA 1YCSB 1YCYA 3DB3A 1E7OA 1H3ZA 3UF4A 3LLRA 4C0GA 1WQ7A 2WSFE 2JTFA 5KYUA 1SHFA 2LNHB 3QG1A 4F04B 3NMZC 4OMLA 3CC4Q 3MJXA 4LDWA 1K9MU 4RCBA 5I2SA 4M7DD 2EYYA 2CYZB 2OTLT 3FJ5A 2EKHA 2NUPA 2DK3A 1WHMA 5DY9A 4FL6A 1Q82C 3QJ6A 3TSWA 1Q86U 1KFZA 4BY6C 4L5GA 1PHTA 4BE0A 2KRSA 1VQLT 2DL5A 2YRVA 1K0SA 4RKUE 3GPLA 3CCUQ 4OMNA 3CCRT 4E47A 3RKYA 2MIOA 3EG2A 2CUBA 1W2BS 5C6SA 1S72A 3OBWA 1ZA1B 4IURA 5GANj 3CPFA 1YP5A 3CD6T 1JBMA 2O9VA 3EH1A 3CC2A 1IRXA 1WHLA 4JPBW 2KRNA 2O4XA 1K73U 2CH4A 3QPHA 1YIJA 1R8OB 3GF5A 4XU1A 2OI3A 2QG9B 2RJFA 5CKEA 2JVVA 3X25B 4RTTA 4BI3A 3EFOB 2L89A 4J9FA 2AZVA 5CKDA 1BU1A 2LCSA 3H8ZA 2EJGA 1JQQA 2WACA 2EGEA 3IQLA 1WFWA 3CMAA 1K9AA 1VQMT 3G1JA 3CC7T 2X4YA 3C94A 4C92G 4O5VA 1X2KA 1OX8A 2HBPA 2HCKA 4J9DA 4HVUA 2V8KA 2EGAA 3QHSA 3J7AF 1VUBA 3MEWA 3S6WA 1KQSS 1B07A 1M8MA 5I22A 2RI5A 4OB2B 3HHTB 2XHCA 4C5IA 1E6HA 3JCMc 2DAQA 4RTZA 2COZA 4A53A 4MMLA 3VS5A 3L2ZA 1Y96A 2CP2A 2FO0A 4XU0A 3VYGA 1X75C 1EIFA 4E7SA 2V1RA 3MP1A 4RTXA 2OTLA 2VXEA 3ZEHA 3CXCP 4F7UG 4JRIA 4D6WA 2EQMA 2NUTA 2L5QA 4M7DB 3I55A 1AEYA 3RUXA 1WI7A 2JMCA 3CCMA 2PTKA 3FRNA 4N0AA 3VS7A 5KYXA 1WHJA 4KRTA 2COYA 4EMHA 1D0YA 1Q7YR 1TOVA 2FB7A 4A4FA 4M7AD 4C8QG 3G6ET 1RACB 1UHCA 4PJJA 4MZMA 1U1TA 2QA4Q 5KYYB 2DYBA 2HL3A 2GTOA 2DIGA 3TEEA 4AFQC 3BDUA 4D8KA 5FW9A 2CP3A 2QQSA 4ANJA 1I4K1 2O9SA 1I1JA 4M75G 3QJYA 1RL2A 5HKCA 3RMSA 1X6BA 4M77E 2RMOA 4CC3A 1YI2T 1YWPA 2LC4A 1X69A 4PK4A 4ELYC 1KC8C 5D7UA 3SWNB 2DKGA 4MDXA 3KBGA 3OYBA 4E7KA 1ZUYA 3JB9G 4DBFA 3GP8A 4M78B 1BI1A 2R58A 2QXFA 1YFNA 5GANd 1QQJA 4QQ6A 3CMEA 2BIVA 2KNBB 3M58A 4LDVA 1BI0A 3E9FA 2EWNA 5DLOA 2DJZA 2RD1A 3QUIA 4OGEA 2DEUA 3OS5A 3M9QA 3PMIA 4CC7A 1M2OA 1WIEA 3I56A 2DEQA 3DKMA 2ZPHB 2C0IA 3OYCA 4JZ4A 1SG5A 3A8OB 1YWOA 2RM4A 1TUGB 2F5TX 2HBWA 3OMCA 2RK1A 3OSVA 3JCMe 2E12A 4HT8A 2C06A 2MPXC 4R56A 2X4XA 3CCST 2JS0A 3Q1JA 4LXCA 3CCEQ 1HK9A 2RN8A 1VQNQ 1D1BA 3A1PA 1K76A 1NPPA 3H6ZA 2ZPFB 4RMOA 2JMAA 3LW5E 2BUDA 2Z0WA 2XDDA 1K73R 4M7DC 1VQ5A 2ROLA 1OZ2A 1VQ4T 1VIEA 4XU3A 2J7IA 5D6WA 1M2VA 1O9SA 4E7JA 2D1XA 3P8HA 1B7TA 2VVKA 2F1LA 3UDCA 3FLGA 3ASKA 4JS4A 4OVAA 4M7AB 2WSCE 2L3SA 3THKA 1NBEB 1T0HA 5CQYA 4IUTA 1IHVA 1YJNA 2RK2A 3CC4T 2OJ2A 1QVGS 2FG0A 5J39A 1VQLQ 3UWNA 4PJOB 1N9RA 3CCRQ 1VQKA 1EFNA 1D1CA 3PFSA 3JCMQ 3SWNC 4KGXB 4PLLA 2QYZA 2RHIA 3L2VA 2HNIA 1OZ3A 3REBB 5GMKe 3CD6Q 5CK9A 2B8AA 4M78C 4BACA 1BIAA 2K3YA 3CCJT 1SEMA 4R0KA 2K4YA 3O5ZA 2VGNA 4QW2A 3D7SB 3E19A 5FU6B 4AT1B 5IHNA 5KH6A 1N8RR 5A0DA 3DLMA 4PKCC 1QWFA 5GAN5 2HZYA 1M3CA 2KXCA 3KXTA 4JLIA 1YITT 5GAN7 1M1KC 3X20B 1VQ9Q 3OYAA 2RHZA 1R0BG 2M9UA 2VC8A 5KCHA 1VQMQ 3CC7Q 4XAXB 5GAOp 2DNUA 4PJNA 1X2QA 1UHFA 4M77G 3OYMA 2BZ8A 1AVZC 2YUOA 2YSQA 2R5AA 1NE8A 3OS0A 4OB3B 4X1VA 2ESWA 6AT1B 4UC4A 3RESA 2CZ0B 1BYMA 5GAOm 1K9MC 3C4SA 2RPNA 3SWNA 1UB4A 3S3MA 4M7DF 1MMAA 1N5ZA 1Q86C 4J9CA 5GAMe 4ESRA 2GFUA 5IT9E 5LJ3g 2HEQA 3FIFA 2XIDA 4GBQA 4M7AC 2E6NA 3CC4A 2RJEA 5IXFA 4C92B 1IB8A 4JRPA 1QVFS 4XTVA 4FYXB 2KY9A 1UFFA 3A5ZB 2X35A 5CR2A 3LH5A 1PSFA 3I5SA 1YJ9T 2G6FX 3GLXA 2H3JA 4PJOC 1KSWA 1TH7A 1JXOA 2EYWA 3GOXA 3U23A 3CCUA 2K5FA 5KE2A 3CBMA 2J6FA 1U3OA 4NL2A 3TU4K 1BB9A 3P8DA 2KSSA 1OULA 3A8GB 3S3OA 1KQSA 2AKLA 3PT9A 4X9DA 5FU6C 4M78F 4B9WA 1Y0MA 2CDTA 4FCYA 3VS2A 5FROA 3MO8A 4KULA 5LJ3j 3L42A 3CCVT 4OB1B 5LL6S 1WX6A 4C0ZA 5J26A 1AWWA 1G3YA 1NJIR 1MMNA 2A36A 3X24B 1ZLMA 2KE9A 1OYXA 4VUBA 1R77A 4EMKB 2EYZA 4ZN3A 1GBQA 1M3BA 3OYGA 1U8RA 3X26B 1SPKA 1H641 5CKHA 1VQOT 2LQWA 1XTDA 3JV3A 4M75B 4Y92A 2FPEA 4XTUA 1VQ8Q 3JCMP 1M27C 4KH0B 1Q7YU 2DTIA 3G71A 3TCJA 1YHQQ 2YLCA 1E6GA 3FDRA 3HRTA 2RHUA 1WDXA 1RAHB 2RB6A 3J81E 1FYNA 3H41A 1CKBA 4J9IA 3VKIA 2QEXT 2L2PA 2BZYA 2DD5A 4DBQA 2JW4A 2KYBA 4JJDA 3CCSQ 2QASA 1B3QA 3META 2IPOB 4CC2A 3EFRA 4C8QE 2V8IA 3EG3A 1NEGA 5GJVB 2FHDA 1IGQA 2KQWA 2DZCA 3I35A 1HJDA 2MOXA 1UGRB 4C92C 3CCET 4A4HA 4M7AF 3FC3A 1Q81R 4J9GA 3OYEA 1LJOA 2DBMA 2HMAA 1VQNT 2O01E 1W4SA 2DETA 1VQ4Q 2EVRA 4Z89A 4C0DB 5GAOn 2MI6A 3CCLT 1TS9A 1ZHIA 2XG8D 3E2UA 2QGGA 1NYGA 1ZA2B 2M16A 2LDMA 2GCXA 3QBYA 2QA4A 3UT1A 2K3BA 2LP5A 4PJOF 3ZL7C 4J9HA 1MGQA 3JB9I 4YTLA 2KMTA 4FW1A 5CIUA 1P92A 5GAOr 1UGSB 1VYTA 2ECZA 1K8AC 2KRMA 2FZKB 1ZSZB 2COWA 4ZTFA 2ZPBB 4AFSC 2GQVA 5C0MA 1TWBA 4X34A 3RBBB 1WHKA 4J6YA 1WHGA 5KYNA 2B86A 5GAN6 2JJ9A 3OW2A 3QWXX 2DPPB 1WHHA 2L3QA 4XTXA 3CCJQ 4DOVA 2HD0A 1MNEA 2YRDA 2EW3A 3MEUA 2A3LA 4EMKC 2V1QA 1M8VA 3OYHA 2K5LA 2CT4A 4RTUA 4LD9K 2XI9A 2P0QA 1RI9A 2K79A 3OBYA 2GFAA 4FYWB 1G8XA 2HKQB 2KBTA 2HQEA 2E5KA 2W0ZA 1YITQ 4M75C 1IXDA 1JB0E 4IIMA 5LJ3d 4QT7A 2D9TA 4Y91A 4P5NA 1ZSGA 2ZGWA 4PFPA 4M78D 4X9CA 3KFVA 4FYYB 5IXBA 1VQ9T 4JLGA 1WJSA 2KDSA 1BKBA 1WLPB 2X51A 3MKDA 5A0LA 2PVDB 2RJCA 1OV3A 1QVGA 3HSBA 1GFCA 1HYOA 2RF0A 4N4HA 2LMJA 3SEMA 4LDUA 1GCQC 2RQWA 3RKWA 1GFDA 2JTEA 2JM8A 2NLUA 2ZZDA 1IZ6A 3BDLA 1OOTA 4C92F 5IH2A 2JS2A 2VASA 1W6XA 2VYTA 4IUPA 4C0DC 1EZZB 1X6GA 5HK3A 1RAGB 3FEOA 1PKTA 1R0CB 4A63B 1Z9ZA 3EHQA 3HFNA 2NUZA 2M0YA 3V7RA 2DXUA 2OAWA 3ULRB 4M77B 2LCCA 3L1AA 1N8RU 2DM1A 3V8JA 1M1FA 2J6KA 1A0NB 9ATCB 5KYWA 3SB2A 2MYSA 1V1CA 3VS3A 1YJ9Q 1X27A 4AFUC 1OEBA 1ZSZC 1LOJA 2L8DA 1M90U 1VYUA 4BDYA 2AK5A 1VQLA 2D6FA 4ZTJA 3CCRA 5LJ5f 2LQNA 1NLOC 5GMKm 3EGUA 3HTRA 4TVRA 5HY6A 1QKXA 2LTOA 4QVZA 2G3RA 1RAEB 2A0FB 3CD6A 4JRQA 3VS4A 2KVQG 4MMKA 2DF6A 2DRKA 2E41A 2LNVA 3JCMg 3WVDB 4J83A 2XK0A 3NTHA 4N4IA 1GCQA 4BUGA 1RAFB 3PGGA 1V29B 1C6VX 2AZSA 2BE7D 4J9EA 4PJOD 1JRIA 3V7CA 2YHTA 2HQHA 3CCVQ 2KT8A 1VQPQ 1N6AA 1H3HA 1SSFA 1PD1A 4LDYA 1KD1R 1PCXA 1VA7A 2JM9A 2E5QA 2BE9B 3C95A 3SDZA 2D0QB 2DD4A 2LT4A 3JRZA 4M75F 5AYFA 3TSZA 2K2VA 2ED0A 1VQMA 3CC7A 3VUBA 2XMFA 1AWOA 4PNOA 1VQ7T 1VQOQ 1BCOA 1FMKA 2VGMA 2LZ6B 1QVFA 1RLQC 2RI2A 2C0OA 2DBKA 2DZ9A 2ENMA 4Z02A 3M0UA 5M9OA 3I9QA 3DLLA 3JCMJ 5FLXE 2CZ1B 2SRCA 1OPKA 2R57A 4Z8AA 3QDRB 2DVJA 4DEYA 2FYKA 1K0XA 3T9NA 5CO7A 5LJ3f 3AHUA 1NM7A 3H0HA 2F5KA 2QEXQ 1I07A 3VRYA 3OS1A 1VQ8T 2CGHA 3EG9B 2HQXA 1YHQT 4L6V5 1WA7A 2Y4YA 5D6YA 3QZ5B 1Z9QA 2HAXA 2EYQA 3CQTA 1PRLC 4C5EA 2JUFA 3OW2S 3L2RA 3OYKA 2M1HA 2NWMA 1K1ZA 4BB7A 4ZN1A 1OX9A 2JNGA 3CEYA 3HRUA 1JJ2P 1QW1A 3ER0A 2V26A 4PJLA 3TREA 4M77C 2HL5C 2FZCB 4II1A 8ATCB 3PIPA 3QYGB 2DL4A 4DBHA 1PSEA 3JAME 4HCBA 3A8HB 3PMTA 3M54A 3CCLQ 2I0NA 2ZAEA 2FPFA 3E1SA 3EGXB 2E65A 2DL3A 3RDVA 1OPLA 1NJIU 3EFOA 4A4EA 3R6OA 2E4HA 3OMGA 3G6EA 2IG0A 1KG1A 1GBRA 1SSHA 2LX9A 4FIBA 2LQKA 4WTOB 2FPDA 4C92D 2VB6A 2Y4XA 4CI0C 4RCCA 3WVEB 1QCFA 3MEAA 4OP0A 2IVWA 2LJ1A 4KUDK 2PZ1A 4E6RA 1UGQB 1U5SA 1TG0A 1ZBXA 4DA4A 1BI2A 2K57A 1YI2A 4E7ZA 4FT2A 3LWIA 5FRNA 4IIOA 1BBZA 1XQHA 3LYIA 5GMKj 4RG2A 1BIBA 3QYHB 1Q7YC 1I81A 3I55Q 2OAUA 3N5BB 3CCMQ 1GCPA 3JCMW 4MDWA 4HA8A 5GAMg 1Q81U 3PNWC 4RTVA 2ZPIB 1RABB 5FU7B 1G83A 1NLPC 2QAZA 4M7DA 1D1AA 8AT1B 4AG1C 2DE0X 2PVOB 3PTAA 1RLPC 4LUDA 3VUZA 4F14A 1VQ8A 2CSQA 1YHQA 2VWFA 4C8QD 2RQTA 1AWXA 3CXCA 4HCZA 4OMFB 3PVLA 5GAN4 1M90R 2X4WA 1QWEA 2RQRA 2MCNA 5CVIA 5KYYA 3RR6A 2ROTA 3QXEB 3CCSA 2DO3A 1OU9A 2OTJQ 5GANf 2EQJA 1Y7XA 2DILA 5L8RE 2FRYA 3M53A 3O8VA 3OYYA 4M75D 2VKNA 2DL7A 3CPWP 1VYVA 1UGVA 3VS0A 2XICA 4MZPA 2QDYB 3L2UA 2RHXA 1OU8A 4PFZA 1PNJA 1EX4A 2QDLA 2F2XA 4M77F 1VQ4A 1PWTA 1PKSA 2X3XD 2J06A 2DLPA 3JCMd 1QVPA 5FRMA 2D8JA 2E1HA 4A4KA 3JB9D 1JU5C 5GAMj 3ZBDA 2L0AA 3OQ5A 3HL8A 2EQUA 3ZFJA 2EJFA 1WJRA 4M78A 4FW2A 4M7DG 5I11A 2GTJA 5KE3A 5LJ5h 3J80E 2ZPEB 3G4ST 1AT1B 2E3IA 3EH2A 2VXFA 1UDLA 2KEAA 1WZOA 1CKAA 2RO0A 3F70A 3V8LA 1FXXA 3JB9H 1D3BB 1VOMA 2DTOA 2W10A 1I5LA 2JTMA 1MNDA 3MEVA 5LJ5e 2DL8A 1XNIA 2YUNA 4EIKA 2QTVA 3EG9A 4GLMA 3R6NA 1K73C 4AFZC 4DEXA 1RAIB 4IUVA 3S3NA 1Q82R 1PG5B 2CUDA 5ECAA 2KR3A 3MP6A 3CCJA 1T3SA 5FWBA 1VQ5Q 3CCQQ 2DFUA 2QQ9A 1CSKA 2WSEE 4KGVB 4F7UB 3OYDA 5FU7C 1Y71A 2JN0A 4ELZC 1UECA 4E7HA 1BK2A 5CKBA 1M1GA 1YITA 2H3EB 2RNAA 1QMCA 1VQPT 3M0RA 5LJ3h 4N4GA 3GNFB 4C8QB 4HVVA 2CKKA 4XTYA 1VQ7Q 4M7AA 2MWPA 4IUUA 2O2OA 2YLBA 3RIRA 1ZBJA 1JXMA 2FL7A 2DMOA 1TTHB 3I5RA 3RNJA 2DERA 1RAAB 3H0IA 5EG2A 4NOYA 3GIBA 1OI1A 2M51A 4FT4A 1B34B 4PJOA 2EYXA 1WXUA 1N8RC 1Y96B 2HDAA 2I2LA 2X9HA 2MMPA 1UGPB 5GAN3 4HT9A 2DXCA 3EGDB 2FRWA 2EGCA 2HSPA 1SRMA 2NUTB 3BE3A 1YIJT 3A98A 1AZGB 4RTYA 3VS1A 2CP0A 5KYXB 5CKFA 1D09B 2DXTA 2P4RA 2CP5A 2A08A 1KD1U 1H8KA 3PIOA 4C0FA 2ZCFB 4M7AG 1YJ9A 4DQ2A 2EKOA 2LJ3A 3JCMf 3CMAT 5GAMd 4HCKA 3CXCS 2A7YA 2VV5A 4M77D 3GBQA 5CQXA 1H92A 2K9GA 3VV0A 2EFIA 5GAN8 4PJOG 4JJCA 1PM3A 4OMMA 4KBMB 2XDBA 4JJNK 2CP6A 1X6OA 3PVQA 1NZ9A 2EIFA 2OX7A 3EHRA 1HSQA 3V8KA 4V2SA 4IUQA 2XD0A 3CCVA 4RTWA 2ABLA 1VQPA 4XTZA 1N9SA 3CPWA 3FB9A 1XJWB 1WPYA 1PC0A 1GL5A 3ME9A 2X4JA 2E6ZA 2QTXA 4E7IA 1KIKA 5A0GA 4F16A 1LNXA 4C8QC 1HD3A 3OYLA 1KC8R 1IREB 3I55T 2PUKB 3CCMT 1VQOA 1VQ6Q 4C92A 2DJQA 3MCAB 1WYXA 5GANh 1D3BA 3M4GA 4PLIA 2X3WD 3EG1A 3URGA 2GQIA 4XK8E 2D0NA 4L59A 5GMKi 2E70A 3NFCA 4ZGEB 1ZUKA 3UA6A 2QEXA 3OS2A 2V8JA 1UE9A 3L2QA 5GANe 1NPRA 4EMGA 2GNCA 1NJIC 3M0TA 1C1AA 3INZA 1YJWQ 2OTJT 2PNIA 2F2WA 3CCEA 4N0AC 4F7UA 2P4TA 4LDXA 1HXDA 1VQNA 1M2VB 4BI8B 1RUWA 1JJ2S 4HCCA 3CCLA 1FMVA 4J7IA 3QKJA 2DYIA 4IKFA 2KROA 4C8QA 3CMET 1KK7A 1FMWA 2CZ7B 3OYFA 3RMQA 4EMKA 2XU8A 1S1NA 3G4SQ 4RG8A 5IHIA 2O31A 3JCMX 1M30A 3G71Q 3BW1A 1W70A 2KI7A 2MF2A 1D0XA 3M4YA 3I56T 1DJ7B 2CSIA 4M75A 4OMQA 4WCIA 1ABQA 1B34A 4FM4B 2Y90A 1UEBA 3OA6A 3E9GA 1U06A 1KHIA 1Q81C 4PFOA 1WXTA 2JT4A 4KGZB 1QKWA 5GAMf 3FJPA 4F7UF 3EGDA 2JZ2A 5GAOq 3NTKA 4EDUA 2L3PA 5J3BA 1AZEA 4GLKA 2MK5A 3GNGA 4LE9A 2EQKA 3LGFA 4B6MA 3WXMB 1AWJA 2AT1B 1WXBA 4B9XA 2GBQA 4DOWA 3HPWA 2NYSA 3VJPA 1YN8A 5GAOl 2YDLA 4J7FA 2QQBA 1M4ZA 4C8QF 1VQ5T 3CCQT 3CBOA 1MMDA 2DIQA 4R55A 4F17A 3UATA 1KQ1A 1QCOA 1MV0B 1KQ2A 3L2WA 1ZX6A 1TUDA 1W1FA 1VQ9A 1AHJB 2EQIA 4J6XA 4HKEA 1IHWA 4KUIA 1YJNT 4PJMA 2DVEA 5DLQE 3REAB 2E64A 2DTHA 2P84A 2RA2A 2VUBA 1SKUB 3VS6A 4Q5WA 4ZGJB 1WQWA 5CAIA 1M1KR 2P0KA 1W2BP 2OTJA 2YXYA 2CP7A 1X43A 2DRMA 4JRKA 3QSUA 4M7DE 3JB9J 3JB9F 1ZSZA 1ACMB 1VQKT 2RJDA 1UG1A 1LVKA 1K8AU 2EPDA 3G7ZA 4HXJA 1S72Q 3EAEA 3TQ7P 1Q82U 3CC2Q 4OGCA 3CPWS 1QLYA 4AG2C 4NL3A 3JCMh 1YIJQ 1K9MR 2SEMA 4LD6A 3LH0A 2CH4W 1G3WA 1C0MA 3AT1B 2BTTA 2KAFA 1SRLA 4ATOA 4ORZA 1AOJA 1ARKA 2K7AA 1KJWA 1Q86R 5DM7R 2PUOB 1J3TA 1V76A 4EPCA 1LCKA 1KQSP 3CMAQ 1G5VA 1NYFA 4D8DA 3QZ9B 1MHNA 2XKOC 3H9NA 3X28B 1BCMA 4QVCA 3TVTA 2CT3A 2DXBA 3A8MB 4M78E 1I8FA 1LPLA 5KCOA 2PQWA 4KT0E 5GJWB 2LCLA 3OYIA 2M0OA 2ATCB 3M0PA 2QQRA 2HSEB 3CCQA 1RADB 3OY9A 1TU0B 2K3XA 4LN2A 1F1BB 1UJ0A 1Y57A 3SHWA 4JS5A 2F2VA 5D6XA 3C12A 2GF7A 4QVDA 3A8LB 2FZGB 1WJQA 2OTLQ 5FWCA 2LT1A 1T0JA 3VYHB 2KYMA 4J6WA 4XU2A 1N27A 1ABOA 1VQ7A 2J05A 1WGSA 5GMKh 1U1SA 3LWHA 4M77A 5EC7A 7AT1B 1D0ZA 3H0FA 2YUPA 3HKSA 3EG0A 5AT1B 1VQ6T 2ED1A 1YBYA 4ZGDB 1PRMC 4MZTA 3BFMA 4BDZA 2L3RA 4Z88A 3CCUT 2RHYA 2O88A 2RI3A 3P8BB 2E10A 4JUVA 3MP8A 4E2FB 3KUFA 1KD1C 5A2QE 4M7AE 5LJ5g 2DA9A 3OB9A 3RERA 2A28A 3NGPA 4HVWA 3V7SA 2YT6A 4XQ3A 4JZ3A 4WF2A 2PVGB 1KHCA 1ZUUA 1MMGA 2JOYA 1RI0A 1Q95G 4AMCA 1UUEA 4BE1A 1YJWT 3M55A 2CZ6B 2K2MA 4CRIA 5I21A 2DX1A 2BKDN 4KH1B 4PJOE 4LNPA 2EBPA 3QIIA 1FWZA 4FSSA 4OB0B 3CMEQ 1M9SA 2IIMA 5KYUB 1VIFA 4Y28E 4BD3A 4QQGA 2LVMA 2YRCA 1KC8U 2MWOA 5GAMh 2GGRA 3OW2P 2NUPB 1WNLA 4BI4A 1G2BA 3I56Q 2K6DA 5I2MA 2LX7A 4ZNXA 1I5OB 3G71T 1TSFA 1M3AA
chains in the Genus database with same CATH topology
2OAWA 2JMAA 3ULRB 4HCKA 2DM1A 2ROLA 2J6OA 2J6KA 1A0NB 2J7IA 3GBQA 2KGTA 2K9GA 1JO8A 3C0CA 1H92A 1V1CA 2C0TA 3VS3A 2D1XA 1X27A 2VVKA 4JJCA 4AFUC 1OEBA 4OMMA 1T3LA 1VYUA 3VRZA 2AK5A 1AD5A 1GRIA 2L3SA 2RQVA 3PVQA 3THKA 1T0HA 3EHRA 1JEGA 1HSQA 2LQNA 1NLOC 2AKKA 3EGUA 4CC4B 1MUZA 1QKXA 2ABLA 4RTWA 2BZXA 2OJ2A 3VS4A 2FG0A 3PE0A 1UJYA 1GL5A 2DF6A 2DRKA 2FEIA 1GCQA 1KIKA 4F16A 4M4ZA 2AZSA 1HD3A 4OMOA 1EFNA 4J9EA 2KT8A 2DJQA 1H3HA 2A37A 1MV3A 1WYXA 3NHNA 3REBB 1TUCA 2CREA 1VA7A 2JM9A 2X3WD 3EG1A 2GQIA 1SEMA 2D8HA 4R0KA 3O5ZA 2D0NA 3TSZA 2ED0A 5IHNA 2XMFA 1AWOA 1ZUKA 3UA6A 1FMKA 1QWFA 1UE9A 2LZ6B 1M3CA 4OMPA 1RLQC 2KXCA 2C0OA 1YNZA 2DBKA 2ENMA 3NPFA 3M0UA 3I9QA 2GNCA 2SRCA 1OPKA 3UA7A 3M0TA 4Z8AA 2DVJA 4DEYA 1K0XA 2H8HA 3QWYA 2PNIA 1NM7A 3H0HA 2F2WA 1XOVA 1I07A 2DNUA 3VRYA 1X2QA 1UHFA 4JJBA 1WA7A 2JXBA 2BZ8A 1RUWA 1AVZC 1NG2A 1Z9QA 5L23A 2YUOA 2LJ0A 3CQTA 1PRLC 2YSQA 2NWMA 1K1ZA 4X1VA 2ESWA 2KROA 2KT1A 1SHGA 1S1NA 5IHIA 2RPNA 2O31A 1K4US 1I0CA 1M30A 2RQUA 5HCKA 2DL4A 1W70A 1N5ZA 2I0NA 4J9CA 2FPFA 4ESRA 5IHKA 2DL3A 1NEBA 1OPLA 2KXDA 2CSIA 2HEQA 4GBQA 1GBRA 3M0QA 4OMQA 1SSHA 4WCIA 1ABQA 5IXFA 1U06A 3M0SA 2FPDA 2YUQA 1WXTA 2JT4A 1IO6A 4K11A 4LUEA 1QKWA 4J9BA 4RUGA 1UFFA 1QCFA 1UTIA 1YCSB 1E7OA 2L3PA 3LH5A 3UF4A 1AZEA 3I5SA 4LE9A 2G6FX 2LJ1A 2PZ1A 4E6RA 1SHFA 1KSWA 2LNHB 1AWJA 3NMZC 1JXOA 4OMLA 1WXBA 1U5SA 2GBQA 1TG0A 2EYWA 3U23A 2EYYA 1YN8A 2YDLA 2J6FA 3FJ5A 2EKHA 1U3OA 4IIOA 1BB9A 1BBZA 4F17A 1KFZA 3TSWA 3UATA 1PHTA 2KRSA 1MV0B 2AKLA 1GCPA 1Y0MA 2CDTA 1ZX6A 2DL5A 1TUDA 1K0SA 3VS2A 1W1FA 4OMNA 2EQIA 4RTVA 2MIOA 3EG2A 2CUBA 3REAB 1G83A 1NLPC 1WX6A 3VS6A 1YP5A 4AG1C 1AWWA 2DE0X 2O9VA 2A36A 1RLPC 4LUDA 1X43A 4F14A 1ZLMA 2DRMA 2CSQA 2KE9A 4JPBW 2KRNA 2VWFA 2EYZA 2CH4A 2RQTA 1AWXA 1GBQA 1M3BA 3PVLA 2OI3A 1UG1A 1QWEA 2RQRA 2EPDA 4HXJA 2MCNA 1SPKA 4RTTA 2LQWA 2ROTA 3JV3A 2DILA 4J9FA 2AZVA 4Y92A 2FRYA 2FPEA 1BU1A 2LCSA 1QLYA 1M27C 4AG2C 1JQQA 2VKNA 2EGEA 2DL7A 3IQLA 1E6GA 1WFWA 1K9AA 1VYVA 1UGVA 1WDXA 3VS0A 2SEMA 1FYNA 3H41A 1CKBA 4J9IA 2CH4W 2L2PA 2BZYA 1X2KA 1PNJA 2HCKA 4J9DA 2JW4A 2BTTA 4HVUA 2QDLA 2F2XA 2EGAA 2KYBA 1SRLA 4ORZA 1PWTA 1AOJA 1PKSA 2K7AA 2X3XD 1KJWA 2J06A 4JJDA 1ARKA 1B3QA 2DLPA 4CC2A 1B07A 1J3TA 2D8JA 1JU5C 1M8MA 5I22A 2L0AA 3EG3A 1NEGA 1LCKA 5GJVB 1NYFA 4D8DA 3I35A 1HJDA 2MOXA 5I11A 2GTJA 1E6HA 4J9GA 2CT3A 3TVTA 4RTZA 2DBMA 3VS5A 1UDLA 2EVRA 2KEAA 4Z89A 1CKAA 5GJWB 2FO0A 2W10A 1NYGA 2V1RA 3M0PA 4RTXA 2DL8A 2YUNA 4EIKA 2K3BA 2LP5A 3ZL7C 4GLMA 4J9HA 3R6NA 4LN2A 1AEYA 1WI7A 2JMCA 2PTKA 4AFZC 4DEXA 1VYTA 3VS7A 1UJ0A 1Y57A 3SHWA 2ECZA 2F2VA 2CUDA 4KRTA 5ECAA 2KRMA 2KR3A 1T3SA 5FWBA 5FWCA 4AFSC 1UHCA 1T0JA 2KYMA 3RBBB 2DYBA 1ABOA 2B86A 2GTOA 4AFQC 1CSKA 2J05A 4D8KA 5FW9A 3QWXX 5EC7A 1UECA 1BK2A 2L3QA 3H0FA 2YUPA 2RNAA 2O9SA 3EG0A 1I1JA 2ED1A 2EW3A 2V1QA 1PRMC 1X6BA 3M0RA 2RMOA 2CT4A 4RTUA 4HVVA 4Z88A 4CC3A 1RI9A 1YWPA 2O88A 1X69A 2K79A 2O2OA 2KBTA 2E5KA 2W0ZA 1ZBJA 1ZUYA 4IIMA 1JXMA 2DA9A 2DMOA 4QT7A 2A28A 3NGPA 4HVWA 3I5RA 1ZSGA 3RNJA 2YT6A 3H0IA 4JZ3A 2M51A 2KNBB 3KFVA 1ZUUA 5IXBA 2EYXA 1WXUA 1UUEA 2HDAA 2K2MA 2DX1A 1WLPB 4CC7A 1WIEA 2FRWA 2EGCA 4LNPA 2EBPA 4FSSA 2C0IA 1OV3A 1GFCA 2HSPA 2RF0A 2LMJA 1SRMA 3SEMA 4JZ4A 1GCQC 2RQWA 1YWOA 2IIMA 1GFDA 2JTEA 2HBWA 3A98A 1AZGB 4RTYA 3VS1A 2JM8A 1OOTA 5IH2A 2GGRA 2JS2A 2P4RA 1W6XA 2A08A 1G2BA 2JS0A 2K6DA 1X6GA 1H8KA 1PKTA 4A63B 1Z9ZA 2LX7A 4ZNXA 3EHQA 2NUZA 2M0YA 2RN8A 1K76A 2LJ3A 1M3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAW A;  2JMA A;  3ULR B;  4HCK A;  2DM1 A;  2ROL A;  2J6O A;  2J6K A;  1A0N B;  2J7I A;  3GBQ A;  2KGT A;  2K9G A;  1JO8 A;  3C0C A;  1H92 A;  1V1C A;  2C0T A;  3VS3 A;  2D1X A;  1X27 A;  2VVK A;  4JJC A;  4AFU C;  1OEB A;  4OMM A;  1T3L A;  1VYU A;  3VRZ A;  2AK5 A;  1AD5 A;  1GRI A;  2L3S A;  2RQV A;  3PVQ A;  3THK A;  1T0H A;  3EHR A;  1JEG A;  1HSQ A;  2LQN A;  1NLO C;  2AKK A;  3EGU A;  4CC4 B;  1MUZ A;  1QKX A;  2ABL A;  4RTW A;  2BZX A;  2OJ2 A;  3VS4 A;  2FG0 A;  3PE0 A;  1UJY A;  1GL5 A;  2DF6 A;  2DRK A;  2FEI A;  1GCQ A;  1KIK A;  4F16 A;  4M4Z A;  2AZS A;  1HD3 A;  4OMO A;  1EFN A;  4J9E A;  2KT8 A;  2DJQ A;  1H3H A;  2A37 A;  1MV3 A;  1WYX A;  3NHN A;  3REB B;  1TUC A;  2CRE A;  1VA7 A;  2JM9 A;  2X3W D;  3EG1 A;  2GQI A;  1SEM A;  2D8H A;  4R0K A;  3O5Z A;  2D0N A;  3TSZ A;  2ED0 A;  5IHN A;  2XMF A;  1AWO A;  1ZUK A;  3UA6 A;  1FMK A;  1QWF A;  1UE9 A;  2LZ6 B;  1M3C A;  4OMP A;  1RLQ C;  2KXC A;  2C0O A;  1YNZ A;  2DBK A;  2ENM A;  3NPF A;  3M0U A;  3I9Q A;  2GNC A;  2SRC A;  1OPK A;  3UA7 A;  3M0T A;  4Z8A A;  2DVJ A;  4DEY A;  1K0X A;  2H8H A;  3QWY A;  2PNI A;  1NM7 A;  3H0H A;  2F2W A;  1XOV A;  1I07 A;  2DNU A;  3VRY A;  1X2Q A;  1UHF A;  4JJB A;  1WA7 A;  2JXB A;  2BZ8 A;  1RUW A;  1AVZ C;  1NG2 A;  1Z9Q A;  5L23 A;  2YUO A;  2LJ0 A;  3CQT A;  1PRL C;  2YSQ A;  2NWM A;  1K1Z A;  4X1V A;  2ESW A;  2KRO A;  2KT1 A;  1SHG A;  1S1N A;  5IHI A;  2RPN A;  2O31 A;  1K4U S;  1I0C A;  1M30 A;  2RQU A;  5HCK A;  2DL4 A;  1W70 A;  1N5Z A;  2I0N A;  4J9C A;  2FPF A;  4ESR A;  5IHK A;  2DL3 A;  1NEB A;  1OPL A;  2KXD A;  2CSI A;  2HEQ A;  4GBQ A;  1GBR A;  3M0Q A;  4OMQ A;  1SSH A;  4WCI A;  1ABQ A;  5IXF A;  1U06 A;  3M0S A;  2FPD A;  2YUQ A;  1WXT A;  2JT4 A;  1IO6 A;  4K11 A;  4LUE A;  1QKW A;  4J9B A;  4RUG A;  1UFF A;  1QCF A;  1UTI A;  1YCS B;  1E7O A;  2L3P A;  3LH5 A;  3UF4 A;  1AZE A;  3I5S A;  4LE9 A;  2G6F X;  2LJ1 A;  2PZ1 A;  4E6R A;  1SHF A;  1KSW A;  2LNH B;  1AWJ A;  3NMZ C;  1JXO A;  4OML A;  1WXB A;  1U5S A;  2GBQ A;  1TG0 A;  2EYW A;  3U23 A;  2EYY A;  1YN8 A;  2YDL A;  2J6F A;  3FJ5 A;  2EKH A;  1U3O A;  4IIO A;  1BB9 A;  1BBZ A;  4F17 A;  1KFZ A;  3TSW A;  3UAT A;  1PHT A;  2KRS A;  1MV0 B;  2AKL A;  1GCP A;  1Y0M A;  2CDT A;  1ZX6 A;  2DL5 A;  1TUD A;  1K0S A;  3VS2 A;  1W1F A;  4OMN A;  2EQI A;  4RTV A;  2MIO A;  3EG2 A;  2CUB A;  3REA B;  1G83 A;  1NLP C;  1WX6 A;  3VS6 A;  1YP5 A;  4AG1 C;  1AWW A;  2DE0 X;  2O9V A;  2A36 A;  1RLP C;  4LUD A;  1X43 A;  4F14 A;  1ZLM A;  2DRM A;  2CSQ A;  2KE9 A;  4JPB W;  2KRN A;  2VWF A;  2EYZ A;  2CH4 A;  2RQT A;  1AWX A;  1GBQ A;  1M3B A;  3PVL A;  2OI3 A;  1UG1 A;  1QWE A;  2RQR A;  2EPD A;  4HXJ A;  2MCN A;  1SPK A;  4RTT A;  2LQW A;  2ROT A;  3JV3 A;  2DIL A;  4J9F A;  2AZV A;  4Y92 A;  2FRY A;  2FPE A;  1BU1 A;  2LCS A;  1QLY A;  1M27 C;  4AG2 C;  1JQQ A;  2VKN A;  2EGE A;  2DL7 A;  3IQL A;  1E6G A;  1WFW A;  1K9A A;  1VYV A;  1UGV A;  1WDX A;  3VS0 A;  2SEM A;  1FYN A;  3H41 A;  1CKB A;  4J9I A;  2CH4 W;  2L2P A;  2BZY A;  1X2K A;  1PNJ A;  2HCK A;  4J9D A;  2JW4 A;  2BTT A;  4HVU A;  2QDL A;  2F2X A;  2EGA A;  2KYB A;  1SRL A;  4ORZ A;  1PWT A;  1AOJ A;  1PKS A;  2K7A A;  2X3X D;  1KJW A;  2J06 A;  4JJD A;  1ARK A;  1B3Q A;  2DLP A;  4CC2 A;  1B07 A;  1J3T A;  2D8J A;  1JU5 C;  1M8M A;  5I22 A;  2L0A A;  3EG3 A;  1NEG A;  1LCK A;  5GJV B;  1NYF A;  4D8D A;  3I35 A;  1HJD A;  2MOX A;  5I11 A;  2GTJ A;  1E6H A;  4J9G A;  2CT3 A;  3TVT A;  4RTZ A;  2DBM A;  3VS5 A;  1UDL A;  2EVR A;  2KEA A;  4Z89 A;  1CKA A;  5GJW B;  2FO0 A;  2W10 A;  1NYG A;  2V1R A;  3M0P A;  4RTX A;  2DL8 A;  2YUN A;  4EIK A;  2K3B A;  2LP5 A;  3ZL7 C;  4GLM A;  4J9H A;  3R6N A;  4LN2 A;  1AEY A;  1WI7 A;  2JMC A;  2PTK A;  4AFZ C;  4DEX A;  1VYT A;  3VS7 A;  1UJ0 A;  1Y57 A;  3SHW A;  2ECZ A;  2F2V A;  2CUD A;  4KRT A;  5ECA A;  2KRM A;  2KR3 A;  1T3S A;  5FWB A;  5FWC A;  4AFS C;  1UHC A;  1T0J A;  2KYM A;  3RBB B;  2DYB A;  1ABO A;  2B86 A;  2GTO A;  4AFQ C;  1CSK A;  2J05 A;  4D8K A;  5FW9 A;  3QWX X;  5EC7 A;  1UEC A;  1BK2 A;  2L3Q A;  3H0F A;  2YUP A;  2RNA A;  2O9S A;  3EG0 A;  1I1J A;  2ED1 A;  2EW3 A;  2V1Q A;  1PRM C;  1X6B A;  3M0R A;  2RMO A;  2CT4 A;  4RTU A;  4HVV A;  4Z88 A;  4CC3 A;  1RI9 A;  1YWP A;  2O88 A;  1X69 A;  2K79 A;  2O2O A;  2KBT A;  2E5K A;  2W0Z A;  1ZBJ A;  1ZUY A;  4IIM A;  1JXM A;  2DA9 A;  2DMO A;  4QT7 A;  2A28 A;  3NGP A;  4HVW A;  3I5R A;  1ZSG A;  3RNJ A;  2YT6 A;  3H0I A;  4JZ3 A;  2M51 A;  2KNB B;  3KFV A;  1ZUU A;  5IXB A;  2EYX A;  1WXU A;  1UUE A;  2HDA A;  2K2M A;  2DX1 A;  1WLP B;  4CC7 A;  1WIE A;  2FRW A;  2EGC A;  4LNP A;  2EBP A;  4FSS A;  2C0I A;  1OV3 A;  1GFC A;  2HSP A;  2RF0 A;  2LMJ A;  1SRM A;  3SEM A;  4JZ4 A;  1GCQ C;  2RQW A;  1YWO A;  2IIM A;  1GFD A;  2JTE A;  2HBW A;  3A98 A;  1AZG B;  4RTY A;  3VS1 A;  2JM8 A;  1OOT A;  5IH2 A;  2GGR A;  2JS2 A;  2P4R A;  1W6X A;  2A08 A;  1G2B A;  2JS0 A;  2K6D A;  1X6G A;  1H8K A;  1PKT A;  4A63 B;  1Z9Z A;  2LX7 A;  4ZNX A;  3EHQ A;  2NUZ A;  2M0Y A;  2RN8 A;  1K76 A;  2LJ3 A;  1M3A A; 
#chains in the Genus database with same CATH topology
 3HP9 A;  2KK4 A;  5LJ5 j;  1W2B A;  1X01 A;  3VU3 C;  2J6O A;  4FU6 A;  2AHJ B;  2P0P A;  1BI3 A;  2MAM A;  1K8A R;  3QO3 A;  3JSC A;  3QDF A;  4XTW A;  2KGT A;  1JO8 A;  3C0C A;  2C0T A;  3M5A A;  1PD0 A;  1T3L A;  3VRZ A;  3JCM V;  1AD5 A;  2LQ8 A;  1GRI A;  5CCA A;  2O4X B;  2RQV A;  1QCN A;  2E3H A;  1JEG A;  2FVU A;  4J8O A;  2AKK A;  5IN1 A;  4CC4 B;  2EJ9 A;  1VQ6 A;  1MUZ A;  3G6E Q;  2BZX A;  3RKX A;  1OQK A;  1GXI E;  2R5M A;  3SD4 A;  3PE0 A;  3MHX A;  1UJY A;  1JJ2 A;  2FEI A;  2M02 A;  1QVG P;  3EGX A;  4M78 G;  2QQA A;  4M4Z A;  3HFO A;  4OMO A;  2QA4 T;  2XDP A;  1TXQ A;  4FYV B;  1YJN Q;  2A37 A;  1MV3 A;  3NHN A;  1FX7 A;  1TUC A;  2CRE A;  3LGL A;  4QKU A;  1YI2 Q;  4BY6 B;  2D8H A;  2CS7 A;  1M5Q 1;  4C92 E;  1ZQ1 A;  1YJW A;  2QGF B;  1G3T A;  1VQK Q;  3EFS A;  5LJ3 e;  4E7L A;  2RH2 A;  1QP3 A;  1SF9 A;  2AIR B;  3CBP A;  4PL6 A;  4O6J A;  4OMP A;  5GMK l;  2F69 A;  4J5Y A;  1YNZ A;  3NPF A;  3M59 A;  4OF1 A;  4BE2 A;  1Y07 A;  3UA7 A;  1S72 T;  5GAN 2;  4C5H A;  2H8H A;  3BY7 A;  5HK0 A;  3QWY A;  3CC2 T;  3MPU B;  4NS5 A;  1XOV A;  3DB4 A;  1M90 C;  5KYW B;  3G4S A;  1QP2 A;  4DBR A;  3SFM A;  2QI2 A;  2JXB A;  4JJB A;  2HKN A;  4QQD A;  2ZPG B;  1NG2 A;  5L23 A;  2LJ0 A;  4FSX A;  4JDS A;  4A4G A;  4F7U E;  3OYN A;  3LX7 A;  4A54 A;  2EAY A;  5IAY A;  2PU9 B;  2KT1 A;  1SHG A;  1G3S A;  3HRS A;  4GY5 A;  3OYJ A;  1O75 A;  1K4U S;  1I0C A;  2RQU A;  2QK0 A;  5HCK A;  3M57 A;  2K5I A;  1M1K U;  5IHK A;  1NEB A;  3NTI A;  3OSS C;  2KXD A;  2YWW A;  3M0Q A;  5GAN g;  2LRQ A;  4ME7 A;  3M0S A;  2YUQ A;  4M75 E;  1IO6 A;  4K11 A;  4LUE A;  3JCM b;  1IGU A;  4J9B A;  3M56 A;  1QVF P;  4C5G A;  3UPU A;  4RUG A;  5LJ5 d;  1UTI A;  1YCS B;  1YCY A;  3DB3 A;  1E7O A;  1H3Z A;  3UF4 A;  3LLR A;  4C0G A;  1WQ7 A;  2WSF E;  2JTF A;  5KYU A;  1SHF A;  2LNH B;  3QG1 A;  4F04 B;  3NMZ C;  4OML A;  3CC4 Q;  3MJX A;  4LDW A;  1K9M U;  4RCB A;  5I2S A;  4M7D D;  2EYY A;  2CYZ B;  2OTL T;  3FJ5 A;  2EKH A;  2NUP A;  2DK3 A;  1WHM A;  5DY9 A;  4FL6 A;  1Q82 C;  3QJ6 A;  3TSW A;  1Q86 U;  1KFZ A;  4BY6 C;  4L5G A;  1PHT A;  4BE0 A;  2KRS A;  1VQL T;  2DL5 A;  2YRV A;  1K0S A;  4RKU E;  3GPL A;  3CCU Q;  4OMN A;  3CCR T;  4E47 A;  3RKY A;  2MIO A;  3EG2 A;  2CUB A;  1W2B S;  5C6S A;  1S72 A;  3OBW A;  1ZA1 B;  4IUR A;  5GAN j;  3CPF A;  1YP5 A;  3CD6 T;  1JBM A;  2O9V A;  3EH1 A;  3CC2 A;  1IRX A;  1WHL A;  4JPB W;  2KRN A;  2O4X A;  1K73 U;  2CH4 A;  3QPH A;  1YIJ A;  1R8O B;  3GF5 A;  4XU1 A;  2OI3 A;  2QG9 B;  2RJF A;  5CKE A;  2JVV A;  3X25 B;  4RTT A;  4BI3 A;  3EFO B;  2L89 A;  4J9F A;  2AZV A;  5CKD A;  1BU1 A;  2LCS A;  3H8Z A;  2EJG A;  1JQQ A;  2WAC A;  2EGE A;  3IQL A;  1WFW A;  3CMA A;  1K9A A;  1VQM T;  3G1J A;  3CC7 T;  2X4Y A;  3C94 A;  4C92 G;  4O5V A;  1X2K A;  1OX8 A;  2HBP A;  2HCK A;  4J9D A;  4HVU A;  2V8K A;  2EGA A;  3QHS A;  3J7A F;  1VUB A;  3MEW A;  3S6W A;  1KQS S;  1B07 A;  1M8M A;  5I22 A;  2RI5 A;  4OB2 B;  3HHT B;  2XHC A;  4C5I A;  1E6H A;  3JCM c;  2DAQ A;  4RTZ A;  2COZ A;  4A53 A;  4MML A;  3VS5 A;  3L2Z A;  1Y96 A;  2CP2 A;  2FO0 A;  4XU0 A;  3VYG A;  1X75 C;  1EIF A;  4E7S A;  2V1R A;  3MP1 A;  4RTX A;  2OTL A;  2VXE A;  3ZEH A;  3CXC P;  4F7U G;  4JRI A;  4D6W A;  2EQM A;  2NUT A;  2L5Q A;  4M7D B;  3I55 A;  1AEY A;  3RUX A;  1WI7 A;  2JMC A;  3CCM A;  2PTK A;  3FRN A;  4N0A A;  3VS7 A;  5KYX A;  1WHJ A;  4KRT A;  2COY A;  4EMH A;  1D0Y A;  1Q7Y R;  1TOV A;  2FB7 A;  4A4F A;  4M7A D;  4C8Q G;  3G6E T;  1RAC B;  1UHC A;  4PJJ A;  4MZM A;  1U1T A;  2QA4 Q;  5KYY B;  2DYB A;  2HL3 A;  2GTO A;  2DIG A;  3TEE A;  4AFQ C;  3BDU A;  4D8K A;  5FW9 A;  2CP3 A;  2QQS A;  4ANJ A;  1I4K 1;  2O9S A;  1I1J A;  4M75 G;  3QJY A;  1RL2 A;  5HKC A;  3RMS A;  1X6B A;  4M77 E;  2RMO A;  4CC3 A;  1YI2 T;  1YWP A;  2LC4 A;  1X69 A;  4PK4 A;  4ELY C;  1KC8 C;  5D7U A;  3SWN B;  2DKG A;  4MDX A;  3KBG A;  3OYB A;  4E7K A;  1ZUY A;  3JB9 G;  4DBF A;  3GP8 A;  4M78 B;  1BI1 A;  2R58 A;  2QXF A;  1YFN A;  5GAN d;  1QQJ A;  4QQ6 A;  3CME A;  2BIV A;  2KNB B;  3M58 A;  4LDV A;  1BI0 A;  3E9F A;  2EWN A;  5DLO A;  2DJZ A;  2RD1 A;  3QUI A;  4OGE A;  2DEU A;  3OS5 A;  3M9Q A;  3PMI A;  4CC7 A;  1M2O A;  1WIE A;  3I56 A;  2DEQ A;  3DKM A;  2ZPH B;  2C0I A;  3OYC A;  4JZ4 A;  1SG5 A;  3A8O B;  1YWO A;  2RM4 A;  1TUG B;  2F5T X;  2HBW A;  3OMC A;  2RK1 A;  3OSV A;  3JCM e;  2E12 A;  4HT8 A;  2C06 A;  2MPX C;  4R56 A;  2X4X A;  3CCS T;  2JS0 A;  3Q1J A;  4LXC A;  3CCE Q;  1HK9 A;  2RN8 A;  1VQN Q;  1D1B A;  3A1P A;  1K76 A;  1NPP A;  3H6Z A;  2ZPF B;  4RMO A;  2JMA A;  3LW5 E;  2BUD A;  2Z0W A;  2XDD A;  1K73 R;  4M7D C;  1VQ5 A;  2ROL A;  1OZ2 A;  1VQ4 T;  1VIE A;  4XU3 A;  2J7I A;  5D6W A;  1M2V A;  1O9S A;  4E7J A;  2D1X A;  3P8H A;  1B7T A;  2VVK A;  2F1L A;  3UDC A;  3FLG A;  3ASK A;  4JS4 A;  4OVA A;  4M7A B;  2WSC E;  2L3S A;  3THK A;  1NBE B;  1T0H A;  5CQY A;  4IUT A;  1IHV A;  1YJN A;  2RK2 A;  3CC4 T;  2OJ2 A;  1QVG S;  2FG0 A;  5J39 A;  1VQL Q;  3UWN A;  4PJO B;  1N9R A;  3CCR Q;  1VQK A;  1EFN A;  1D1C A;  3PFS A;  3JCM Q;  3SWN C;  4KGX B;  4PLL A;  2QYZ A;  2RHI A;  3L2V A;  2HNI A;  1OZ3 A;  3REB B;  5GMK e;  3CD6 Q;  5CK9 A;  2B8A A;  4M78 C;  4BAC A;  1BIA A;  2K3Y A;  3CCJ T;  1SEM A;  4R0K A;  2K4Y A;  3O5Z A;  2VGN A;  4QW2 A;  3D7S B;  3E19 A;  5FU6 B;  4AT1 B;  5IHN A;  5KH6 A;  1N8R R;  5A0D A;  3DLM A;  4PKC C;  1QWF A;  5GAN 5;  2HZY A;  1M3C A;  2KXC A;  3KXT A;  4JLI A;  1YIT T;  5GAN 7;  1M1K C;  3X20 B;  1VQ9 Q;  3OYA A;  2RHZ A;  1R0B G;  2M9U A;  2VC8 A;  5KCH A;  1VQM Q;  3CC7 Q;  4XAX B;  5GAO p;  2DNU A;  4PJN A;  1X2Q A;  1UHF A;  4M77 G;  3OYM A;  2BZ8 A;  1AVZ C;  2YUO A;  2YSQ A;  2R5A A;  1NE8 A;  3OS0 A;  4OB3 B;  4X1V A;  2ESW A;  6AT1 B;  4UC4 A;  3RES A;  2CZ0 B;  1BYM A;  5GAO m;  1K9M C;  3C4S A;  2RPN A;  3SWN A;  1UB4 A;  3S3M A;  4M7D F;  1MMA A;  1N5Z A;  1Q86 C;  4J9C A;  5GAM e;  4ESR A;  2GFU A;  5IT9 E;  5LJ3 g;  2HEQ A;  3FIF A;  2XID A;  4GBQ A;  4M7A C;  2E6N A;  3CC4 A;  2RJE A;  5IXF A;  4C92 B;  1IB8 A;  4JRP A;  1QVF S;  4XTV A;  4FYX B;  2KY9 A;  1UFF A;  3A5Z B;  2X35 A;  5CR2 A;  3LH5 A;  1PSF A;  3I5S A;  1YJ9 T;  2G6F X;  3GLX A;  2H3J A;  4PJO C;  1KSW A;  1TH7 A;  1JXO A;  2EYW A;  3GOX A;  3U23 A;  3CCU A;  2K5F A;  5KE2 A;  3CBM A;  2J6F A;  1U3O A;  4NL2 A;  3TU4 K;  1BB9 A;  3P8D A;  2KSS A;  1OUL A;  3A8G B;  3S3O A;  1KQS A;  2AKL A;  3PT9 A;  4X9D A;  5FU6 C;  4M78 F;  4B9W A;  1Y0M A;  2CDT A;  4FCY A;  3VS2 A;  5FRO A;  3MO8 A;  4KUL A;  5LJ3 j;  3L42 A;  3CCV T;  4OB1 B;  5LL6 S;  1WX6 A;  4C0Z A;  5J26 A;  1AWW A;  1G3Y A;  1NJI R;  1MMN A;  2A36 A;  3X24 B;  1ZLM A;  2KE9 A;  1OYX A;  4VUB A;  1R77 A;  4EMK B;  2EYZ A;  4ZN3 A;  1GBQ A;  1M3B A;  3OYG A;  1U8R A;  3X26 B;  1SPK A;  1H64 1;  5CKH A;  1VQO T;  2LQW A;  1XTD A;  3JV3 A;  4M75 B;  4Y92 A;  2FPE A;  4XTU A;  1VQ8 Q;  3JCM P;  1M27 C;  4KH0 B;  1Q7Y U;  2DTI A;  3G71 A;  3TCJ A;  1YHQ Q;  2YLC A;  1E6G A;  3FDR A;  3HRT A;  2RHU A;  1WDX A;  1RAH B;  2RB6 A;  3J81 E;  1FYN A;  3H41 A;  1CKB A;  4J9I A;  3VKI A;  2QEX T;  2L2P A;  2BZY A;  2DD5 A;  4DBQ A;  2JW4 A;  2KYB A;  4JJD A;  3CCS Q;  2QAS A;  1B3Q A;  3MET A;  2IPO B;  4CC2 A;  3EFR A;  4C8Q E;  2V8I A;  3EG3 A;  1NEG A;  5GJV B;  2FHD A;  1IGQ A;  2KQW A;  2DZC A;  3I35 A;  1HJD A;  2MOX A;  1UGR B;  4C92 C;  3CCE T;  4A4H A;  4M7A F;  3FC3 A;  1Q81 R;  4J9G A;  3OYE A;  1LJO A;  2DBM A;  2HMA A;  1VQN T;  2O01 E;  1W4S A;  2DET A;  1VQ4 Q;  2EVR A;  4Z89 A;  4C0D B;  5GAO n;  2MI6 A;  3CCL T;  1TS9 A;  1ZHI A;  2XG8 D;  3E2U A;  2QGG A;  1NYG A;  1ZA2 B;  2M16 A;  2LDM A;  2GCX A;  3QBY A;  2QA4 A;  3UT1 A;  2K3B A;  2LP5 A;  4PJO F;  3ZL7 C;  4J9H A;  1MGQ A;  3JB9 I;  4YTL A;  2KMT A;  4FW1 A;  5CIU A;  1P92 A;  5GAO r;  1UGS B;  1VYT A;  2ECZ A;  1K8A C;  2KRM A;  2FZK B;  1ZSZ B;  2COW A;  4ZTF A;  2ZPB B;  4AFS C;  2GQV A;  5C0M A;  1TWB A;  4X34 A;  3RBB B;  1WHK A;  4J6Y A;  1WHG A;  5KYN A;  2B86 A;  5GAN 6;  2JJ9 A;  3OW2 A;  3QWX X;  2DPP B;  1WHH A;  2L3Q A;  4XTX A;  3CCJ Q;  4DOV A;  2HD0 A;  1MNE A;  2YRD A;  2EW3 A;  3MEU A;  2A3L A;  4EMK C;  2V1Q A;  1M8V A;  3OYH A;  2K5L A;  2CT4 A;  4RTU A;  4LD9 K;  2XI9 A;  2P0Q A;  1RI9 A;  2K79 A;  3OBY A;  2GFA A;  4FYW B;  1G8X A;  2HKQ B;  2KBT A;  2HQE A;  2E5K A;  2W0Z A;  1YIT Q;  4M75 C;  1IXD A;  1JB0 E;  4IIM A;  5LJ3 d;  4QT7 A;  2D9T A;  4Y91 A;  4P5N A;  1ZSG A;  2ZGW A;  4PFP A;  4M78 D;  4X9C A;  3KFV A;  4FYY B;  5IXB A;  1VQ9 T;  4JLG A;  1WJS A;  2KDS A;  1BKB A;  1WLP B;  2X51 A;  3MKD A;  5A0L A;  2PVD B;  2RJC A;  1OV3 A;  1QVG A;  3HSB A;  1GFC A;  1HYO A;  2RF0 A;  4N4H A;  2LMJ A;  3SEM A;  4LDU A;  1GCQ C;  2RQW A;  3RKW A;  1GFD A;  2JTE A;  2JM8 A;  2NLU A;  2ZZD A;  1IZ6 A;  3BDL A;  1OOT A;  4C92 F;  5IH2 A;  2JS2 A;  2VAS A;  1W6X A;  2VYT A;  4IUP A;  4C0D C;  1EZZ B;  1X6G A;  5HK3 A;  1RAG B;  3FEO A;  1PKT A;  1R0C B;  4A63 B;  1Z9Z A;  3EHQ A;  3HFN A;  2NUZ A;  2M0Y A;  3V7R A;  2DXU A;  2OAW A;  3ULR B;  4M77 B;  2LCC A;  3L1A A;  1N8R U;  2DM1 A;  3V8J A;  1M1F A;  2J6K A;  1A0N B;  9ATC B;  5KYW A;  3SB2 A;  2MYS A;  1V1C A;  3VS3 A;  1YJ9 Q;  1X27 A;  4AFU C;  1OEB A;  1ZSZ C;  1LOJ A;  2L8D A;  1M90 U;  1VYU A;  4BDY A;  2AK5 A;  1VQL A;  2D6F A;  4ZTJ A;  3CCR A;  5LJ5 f;  2LQN A;  1NLO C;  5GMK m;  3EGU A;  3HTR A;  4TVR A;  5HY6 A;  1QKX A;  2LTO A;  4QVZ A;  2G3R A;  1RAE B;  2A0F B;  3CD6 A;  4JRQ A;  3VS4 A;  2KVQ G;  4MMK A;  2DF6 A;  2DRK A;  2E41 A;  2LNV A;  3JCM g;  3WVD B;  4J83 A;  2XK0 A;  3NTH A;  4N4I A;  1GCQ A;  4BUG A;  1RAF B;  3PGG A;  1V29 B;  1C6V X;  2AZS A;  2BE7 D;  4J9E A;  4PJO D;  1JRI A;  3V7C A;  2YHT A;  2HQH A;  3CCV Q;  2KT8 A;  1VQP Q;  1N6A A;  1H3H A;  1SSF A;  1PD1 A;  4LDY A;  1KD1 R;  1PCX A;  1VA7 A;  2JM9 A;  2E5Q A;  2BE9 B;  3C95 A;  3SDZ A;  2D0Q B;  2DD4 A;  2LT4 A;  3JRZ A;  4M75 F;  5AYF A;  3TSZ A;  2K2V A;  2ED0 A;  1VQM A;  3CC7 A;  3VUB A;  2XMF A;  1AWO A;  4PNO A;  1VQ7 T;  1VQO Q;  1BCO A;  1FMK A;  2VGM A;  2LZ6 B;  1QVF A;  1RLQ C;  2RI2 A;  2C0O A;  2DBK A;  2DZ9 A;  2ENM A;  4Z02 A;  3M0U A;  5M9O A;  3I9Q A;  3DLL A;  3JCM J;  5FLX E;  2CZ1 B;  2SRC A;  1OPK A;  2R57 A;  4Z8A A;  3QDR B;  2DVJ A;  4DEY A;  2FYK A;  1K0X A;  3T9N A;  5CO7 A;  5LJ3 f;  3AHU A;  1NM7 A;  3H0H A;  2F5K A;  2QEX Q;  1I07 A;  3VRY A;  3OS1 A;  1VQ8 T;  2CGH A;  3EG9 B;  2HQX A;  1YHQ T;  4L6V 5;  1WA7 A;  2Y4Y A;  5D6Y A;  3QZ5 B;  1Z9Q A;  2HAX A;  2EYQ A;  3CQT A;  1PRL C;  4C5E A;  2JUF A;  3OW2 S;  3L2R A;  3OYK A;  2M1H A;  2NWM A;  1K1Z A;  4BB7 A;  4ZN1 A;  1OX9 A;  2JNG A;  3CEY A;  3HRU A;  1JJ2 P;  1QW1 A;  3ER0 A;  2V26 A;  4PJL A;  3TRE A;  4M77 C;  2HL5 C;  2FZC B;  4II1 A;  8ATC B;  3PIP A;  3QYG B;  2DL4 A;  4DBH A;  1PSE A;  3JAM E;  4HCB A;  3A8H B;  3PMT A;  3M54 A;  3CCL Q;  2I0N A;  2ZAE A;  2FPF A;  3E1S A;  3EGX B;  2E65 A;  2DL3 A;  3RDV A;  1OPL A;  1NJI U;  3EFO A;  4A4E A;  3R6O A;  2E4H A;  3OMG A;  3G6E A;  2IG0 A;  1KG1 A;  1GBR A;  1SSH A;  2LX9 A;  4FIB A;  2LQK A;  4WTO B;  2FPD A;  4C92 D;  2VB6 A;  2Y4X A;  4CI0 C;  4RCC A;  3WVE B;  1QCF A;  3MEA A;  4OP0 A;  2IVW A;  2LJ1 A;  4KUD K;  2PZ1 A;  4E6R A;  1UGQ B;  1U5S A;  1TG0 A;  1ZBX A;  4DA4 A;  1BI2 A;  2K57 A;  1YI2 A;  4E7Z A;  4FT2 A;  3LWI A;  5FRN A;  4IIO A;  1BBZ A;  1XQH A;  3LYI A;  5GMK j;  4RG2 A;  1BIB A;  3QYH B;  1Q7Y C;  1I81 A;  3I55 Q;  2OAU A;  3N5B B;  3CCM Q;  1GCP A;  3JCM W;  4MDW A;  4HA8 A;  5GAM g;  1Q81 U;  3PNW C;  4RTV A;  2ZPI B;  1RAB B;  5FU7 B;  1G83 A;  1NLP C;  2QAZ A;  4M7D A;  1D1A A;  8AT1 B;  4AG1 C;  2DE0 X;  2PVO B;  3PTA A;  1RLP C;  4LUD A;  3VUZ A;  4F14 A;  1VQ8 A;  2CSQ A;  1YHQ A;  2VWF A;  4C8Q D;  2RQT A;  1AWX A;  3CXC A;  4HCZ A;  4OMF B;  3PVL A;  5GAN 4;  1M90 R;  2X4W A;  1QWE A;  2RQR A;  2MCN A;  5CVI A;  5KYY A;  3RR6 A;  2ROT A;  3QXE B;  3CCS A;  2DO3 A;  1OU9 A;  2OTJ Q;  5GAN f;  2EQJ A;  1Y7X A;  2DIL A;  5L8R E;  2FRY A;  3M53 A;  3O8V A;  3OYY A;  4M75 D;  2VKN A;  2DL7 A;  3CPW P;  1VYV A;  1UGV A;  3VS0 A;  2XIC A;  4MZP A;  2QDY B;  3L2U A;  2RHX A;  1OU8 A;  4PFZ A;  1PNJ A;  1EX4 A;  2QDL A;  2F2X A;  4M77 F;  1VQ4 A;  1PWT A;  1PKS A;  2X3X D;  2J06 A;  2DLP A;  3JCM d;  1QVP A;  5FRM A;  2D8J A;  2E1H A;  4A4K A;  3JB9 D;  1JU5 C;  5GAM j;  3ZBD A;  2L0A A;  3OQ5 A;  3HL8 A;  2EQU A;  3ZFJ A;  2EJF A;  1WJR A;  4M78 A;  4FW2 A;  4M7D G;  5I11 A;  2GTJ A;  5KE3 A;  5LJ5 h;  3J80 E;  2ZPE B;  3G4S T;  1AT1 B;  2E3I A;  3EH2 A;  2VXF A;  1UDL A;  2KEA A;  1WZO A;  1CKA A;  2RO0 A;  3F70 A;  3V8L A;  1FXX A;  3JB9 H;  1D3B B;  1VOM A;  2DTO A;  2W10 A;  1I5L A;  2JTM A;  1MND A;  3MEV A;  5LJ5 e;  2DL8 A;  1XNI A;  2YUN A;  4EIK A;  2QTV A;  3EG9 A;  4GLM A;  3R6N A;  1K73 C;  4AFZ C;  4DEX A;  1RAI B;  4IUV A;  3S3N A;  1Q82 R;  1PG5 B;  2CUD A;  5ECA A;  2KR3 A;  3MP6 A;  3CCJ A;  1T3S A;  5FWB A;  1VQ5 Q;  3CCQ Q;  2DFU A;  2QQ9 A;  1CSK A;  2WSE E;  4KGV B;  4F7U B;  3OYD A;  5FU7 C;  1Y71 A;  2JN0 A;  4ELZ C;  1UEC A;  4E7H A;  1BK2 A;  5CKB A;  1M1G A;  1YIT A;  2H3E B;  2RNA A;  1QMC A;  1VQP T;  3M0R A;  5LJ3 h;  4N4G A;  3GNF B;  4C8Q B;  4HVV A;  2CKK A;  4XTY A;  1VQ7 Q;  4M7A A;  2MWP A;  4IUU A;  2O2O A;  2YLB A;  3RIR A;  1ZBJ A;  1JXM A;  2FL7 A;  2DMO A;  1TTH B;  3I5R A;  3RNJ A;  2DER A;  1RAA B;  3H0I A;  5EG2 A;  4NOY A;  3GIB A;  1OI1 A;  2M51 A;  4FT4 A;  1B34 B;  4PJO A;  2EYX A;  1WXU A;  1N8R C;  1Y96 B;  2HDA A;  2I2L A;  2X9H A;  2MMP A;  1UGP B;  5GAN 3;  4HT9 A;  2DXC A;  3EGD B;  2FRW A;  2EGC A;  2HSP A;  1SRM A;  2NUT B;  3BE3 A;  1YIJ T;  3A98 A;  1AZG B;  4RTY A;  3VS1 A;  2CP0 A;  5KYX B;  5CKF A;  1D09 B;  2DXT A;  2P4R A;  2CP5 A;  2A08 A;  1KD1 U;  1H8K A;  3PIO A;  4C0F A;  2ZCF B;  4M7A G;  1YJ9 A;  4DQ2 A;  2EKO A;  2LJ3 A;  3JCM f;  3CMA T;  5GAM d;  4HCK A;  3CXC S;  2A7Y A;  2VV5 A;  4M77 D;  3GBQ A;  5CQX A;  1H92 A;  2K9G A;  3VV0 A;  2EFI A;  5GAN 8;  4PJO G;  4JJC A;  1PM3 A;  4OMM A;  4KBM B;  2XDB A;  4JJN K;  2CP6 A;  1X6O A;  3PVQ A;  1NZ9 A;  2EIF A;  2OX7 A;  3EHR A;  1HSQ A;  3V8K A;  4V2S A;  4IUQ A;  2XD0 A;  3CCV A;  4RTW A;  2ABL A;  1VQP A;  4XTZ A;  1N9S A;  3CPW A;  3FB9 A;  1XJW B;  1WPY A;  1PC0 A;  1GL5 A;  3ME9 A;  2X4J A;  2E6Z A;  2QTX A;  4E7I A;  1KIK A;  5A0G A;  4F16 A;  1LNX A;  4C8Q C;  1HD3 A;  3OYL A;  1KC8 R;  1IRE B;  3I55 T;  2PUK B;  3CCM T;  1VQO A;  1VQ6 Q;  4C92 A;  2DJQ A;  3MCA B;  1WYX A;  5GAN h;  1D3B A;  3M4G A;  4PLI A;  2X3W D;  3EG1 A;  3URG A;  2GQI A;  4XK8 E;  2D0N A;  4L59 A;  5GMK i;  2E70 A;  3NFC A;  4ZGE B;  1ZUK A;  3UA6 A;  2QEX A;  3OS2 A;  2V8J A;  1UE9 A;  3L2Q A;  5GAN e;  1NPR A;  4EMG A;  2GNC A;  1NJI C;  3M0T A;  1C1A A;  3INZ A;  1YJW Q;  2OTJ T;  2PNI A;  2F2W A;  3CCE A;  4N0A C;  4F7U A;  2P4T A;  4LDX A;  1HXD A;  1VQN A;  1M2V B;  4BI8 B;  1RUW A;  1JJ2 S;  4HCC A;  3CCL A;  1FMV A;  4J7I A;  3QKJ A;  2DYI A;  4IKF A;  2KRO A;  4C8Q A;  3CME T;  1KK7 A;  1FMW A;  2CZ7 B;  3OYF A;  3RMQ A;  4EMK A;  2XU8 A;  1S1N A;  3G4S Q;  4RG8 A;  5IHI A;  2O31 A;  3JCM X;  1M30 A;  3G71 Q;  3BW1 A;  1W70 A;  2KI7 A;  2MF2 A;  1D0X A;  3M4Y A;  3I56 T;  1DJ7 B;  2CSI A;  4M75 A;  4OMQ A;  4WCI A;  1ABQ A;  1B34 A;  4FM4 B;  2Y90 A;  1UEB A;  3OA6 A;  3E9G A;  1U06 A;  1KHI A;  1Q81 C;  4PFO A;  1WXT A;  2JT4 A;  4KGZ B;  1QKW A;  5GAM f;  3FJP A;  4F7U F;  3EGD A;  2JZ2 A;  5GAO q;  3NTK A;  4EDU A;  2L3P A;  5J3B A;  1AZE A;  4GLK A;  2MK5 A;  3GNG A;  4LE9 A;  2EQK A;  3LGF A;  4B6M A;  3WXM B;  1AWJ A;  2AT1 B;  1WXB A;  4B9X A;  2GBQ A;  4DOW A;  3HPW A;  2NYS A;  3VJP A;  1YN8 A;  5GAO l;  2YDL A;  4J7F A;  2QQB A;  1M4Z A;  4C8Q F;  1VQ5 T;  3CCQ T;  3CBO A;  1MMD A;  2DIQ A;  4R55 A;  4F17 A;  3UAT A;  1KQ1 A;  1QCO A;  1MV0 B;  1KQ2 A;  3L2W A;  1ZX6 A;  1TUD A;  1W1F A;  1VQ9 A;  1AHJ B;  2EQI A;  4J6X A;  4HKE A;  1IHW A;  4KUI A;  1YJN T;  4PJM A;  2DVE A;  5DLQ E;  3REA B;  2E64 A;  2DTH A;  2P84 A;  2RA2 A;  2VUB A;  1SKU B;  3VS6 A;  4Q5W A;  4ZGJ B;  1WQW A;  5CAI A;  1M1K R;  2P0K A;  1W2B P;  2OTJ A;  2YXY A;  2CP7 A;  1X43 A;  2DRM A;  4JRK A;  3QSU A;  4M7D E;  3JB9 J;  3JB9 F;  1ZSZ A;  1ACM B;  1VQK T;  2RJD A;  1UG1 A;  1LVK A;  1K8A U;  2EPD A;  3G7Z A;  4HXJ A;  1S72 Q;  3EAE A;  3TQ7 P;  1Q82 U;  3CC2 Q;  4OGC A;  3CPW S;  1QLY A;  4AG2 C;  4NL3 A;  3JCM h;  1YIJ Q;  1K9M R;  2SEM A;  4LD6 A;  3LH0 A;  2CH4 W;  1G3W A;  1C0M A;  3AT1 B;  2BTT A;  2KAF A;  1SRL A;  4ATO A;  4ORZ A;  1AOJ A;  1ARK A;  2K7A A;  1KJW A;  1Q86 R;  5DM7 R;  2PUO B;  1J3T A;  1V76 A;  4EPC A;  1LCK A;  1KQS P;  3CMA Q;  1G5V A;  1NYF A;  4D8D A;  3QZ9 B;  1MHN A;  2XKO C;  3H9N A;  3X28 B;  1BCM A;  4QVC A;  3TVT A;  2CT3 A;  2DXB A;  3A8M B;  4M78 E;  1I8F A;  1LPL A;  5KCO A;  2PQW A;  4KT0 E;  5GJW B;  2LCL A;  3OYI A;  2M0O A;  2ATC B;  3M0P A;  2QQR A;  2HSE B;  3CCQ A;  1RAD B;  3OY9 A;  1TU0 B;  2K3X A;  4LN2 A;  1F1B B;  1UJ0 A;  1Y57 A;  3SHW A;  4JS5 A;  2F2V A;  5D6X A;  3C12 A;  2GF7 A;  4QVD A;  3A8L B;  2FZG B;  1WJQ A;  2OTL Q;  5FWC A;  2LT1 A;  1T0J A;  3VYH B;  2KYM A;  4J6W A;  4XU2 A;  1N27 A;  1ABO A;  1VQ7 A;  2J05 A;  1WGS A;  5GMK h;  1U1S A;  3LWH A;  4M77 A;  5EC7 A;  7AT1 B;  1D0Z A;  3H0F A;  2YUP A;  3HKS A;  3EG0 A;  5AT1 B;  1VQ6 T;  2ED1 A;  1YBY A;  4ZGD B;  1PRM C;  4MZT A;  3BFM A;  4BDZ A;  2L3R A;  4Z88 A;  3CCU T;  2RHY A;  2O88 A;  2RI3 A;  3P8B B;  2E10 A;  4JUV A;  3MP8 A;  4E2F B;  3KUF A;  1KD1 C;  5A2Q E;  4M7A E;  5LJ5 g;  2DA9 A;  3OB9 A;  3RER A;  2A28 A;  3NGP A;  4HVW A;  3V7S A;  2YT6 A;  4XQ3 A;  4JZ3 A;  4WF2 A;  2PVG B;  1KHC A;  1ZUU A;  1MMG A;  2JOY A;  1RI0 A;  1Q95 G;  4AMC A;  1UUE A;  4BE1 A;  1YJW T;  3M55 A;  2CZ6 B;  2K2M A;  4CRI A;  5I21 A;  2DX1 A;  2BKD N;  4KH1 B;  4PJO E;  4LNP A;  2EBP A;  3QII A;  1FWZ A;  4FSS A;  4OB0 B;  3CME Q;  1M9S A;  2IIM A;  5KYU B;  1VIF A;  4Y28 E;  4BD3 A;  4QQG A;  2LVM A;  2YRC A;  1KC8 U;  2MWO A;  5GAM h;  2GGR A;  3OW2 P;  2NUP B;  1WNL A;  4BI4 A;  1G2B A;  3I56 Q;  2K6D A;  5I2M A;  2LX7 A;  4ZNX A;  1I5O B;  3G71 T;  1TSF A;  1M3A A; 
#chains in the Genus database with same CATH homology
 2OAW A;  2JMA A;  3ULR B;  4HCK A;  2DM1 A;  2ROL A;  2J6O A;  2J6K A;  1A0N B;  2J7I A;  3GBQ A;  2KGT A;  2K9G A;  1JO8 A;  3C0C A;  1H92 A;  1V1C A;  2C0T A;  3VS3 A;  2D1X A;  1X27 A;  2VVK A;  4JJC A;  4AFU C;  1OEB A;  4OMM A;  1T3L A;  1VYU A;  3VRZ A;  2AK5 A;  1AD5 A;  1GRI A;  2L3S A;  2RQV A;  3PVQ A;  3THK A;  1T0H A;  3EHR A;  1JEG A;  1HSQ A;  2LQN A;  1NLO C;  2AKK A;  3EGU A;  4CC4 B;  1MUZ A;  1QKX A;  2ABL A;  4RTW A;  2BZX A;  2OJ2 A;  3VS4 A;  2FG0 A;  3PE0 A;  1UJY A;  1GL5 A;  2DF6 A;  2DRK A;  2FEI A;  1GCQ A;  1KIK A;  4F16 A;  4M4Z A;  2AZS A;  1HD3 A;  4OMO A;  1EFN A;  4J9E A;  2KT8 A;  2DJQ A;  1H3H A;  2A37 A;  1MV3 A;  1WYX A;  3NHN A;  3REB B;  1TUC A;  2CRE A;  1VA7 A;  2JM9 A;  2X3W D;  3EG1 A;  2GQI A;  1SEM A;  2D8H A;  4R0K A;  3O5Z A;  2D0N A;  3TSZ A;  2ED0 A;  5IHN A;  2XMF A;  1AWO A;  1ZUK A;  3UA6 A;  1FMK A;  1QWF A;  1UE9 A;  2LZ6 B;  1M3C A;  4OMP A;  1RLQ C;  2KXC A;  2C0O A;  1YNZ A;  2DBK A;  2ENM A;  3NPF A;  3M0U A;  3I9Q A;  2GNC A;  2SRC A;  1OPK A;  3UA7 A;  3M0T A;  4Z8A A;  2DVJ A;  4DEY A;  1K0X A;  2H8H A;  3QWY A;  2PNI A;  1NM7 A;  3H0H A;  2F2W A;  1XOV A;  1I07 A;  2DNU A;  3VRY A;  1X2Q A;  1UHF A;  4JJB A;  1WA7 A;  2JXB A;  2BZ8 A;  1RUW A;  1AVZ C;  1NG2 A;  1Z9Q A;  5L23 A;  2YUO A;  2LJ0 A;  3CQT A;  1PRL C;  2YSQ A;  2NWM A;  1K1Z A;  4X1V A;  2ESW A;  2KRO A;  2KT1 A;  1SHG A;  1S1N A;  5IHI A;  2RPN A;  2O31 A;  1K4U S;  1I0C A;  1M30 A;  2RQU A;  5HCK A;  2DL4 A;  1W70 A;  1N5Z A;  2I0N A;  4J9C A;  2FPF A;  4ESR A;  5IHK A;  2DL3 A;  1NEB A;  1OPL A;  2KXD A;  2CSI A;  2HEQ A;  4GBQ A;  1GBR A;  3M0Q A;  4OMQ A;  1SSH A;  4WCI A;  1ABQ A;  5IXF A;  1U06 A;  3M0S A;  2FPD A;  2YUQ A;  1WXT A;  2JT4 A;  1IO6 A;  4K11 A;  4LUE A;  1QKW A;  4J9B A;  4RUG A;  1UFF A;  1QCF A;  1UTI A;  1YCS B;  1E7O A;  2L3P A;  3LH5 A;  3UF4 A;  1AZE A;  3I5S A;  4LE9 A;  2G6F X;  2LJ1 A;  2PZ1 A;  4E6R A;  1SHF A;  1KSW A;  2LNH B;  1AWJ A;  3NMZ C;  1JXO A;  4OML A;  1WXB A;  1U5S A;  2GBQ A;  1TG0 A;  2EYW A;  3U23 A;  2EYY A;  1YN8 A;  2YDL A;  2J6F A;  3FJ5 A;  2EKH A;  1U3O A;  4IIO A;  1BB9 A;  1BBZ A;  4F17 A;  1KFZ A;  3TSW A;  3UAT A;  1PHT A;  2KRS A;  1MV0 B;  2AKL A;  1GCP A;  1Y0M A;  2CDT A;  1ZX6 A;  2DL5 A;  1TUD A;  1K0S A;  3VS2 A;  1W1F A;  4OMN A;  2EQI A;  4RTV A;  2MIO A;  3EG2 A;  2CUB A;  3REA B;  1G83 A;  1NLP C;  1WX6 A;  3VS6 A;  1YP5 A;  4AG1 C;  1AWW A;  2DE0 X;  2O9V A;  2A36 A;  1RLP C;  4LUD A;  1X43 A;  4F14 A;  1ZLM A;  2DRM A;  2CSQ A;  2KE9 A;  4JPB W;  2KRN A;  2VWF A;  2EYZ A;  2CH4 A;  2RQT A;  1AWX A;  1GBQ A;  1M3B A;  3PVL A;  2OI3 A;  1UG1 A;  1QWE A;  2RQR A;  2EPD A;  4HXJ A;  2MCN A;  1SPK A;  4RTT A;  2LQW A;  2ROT A;  3JV3 A;  2DIL A;  4J9F A;  2AZV A;  4Y92 A;  2FRY A;  2FPE A;  1BU1 A;  2LCS A;  1QLY A;  1M27 C;  4AG2 C;  1JQQ A;  2VKN A;  2EGE A;  2DL7 A;  3IQL A;  1E6G A;  1WFW A;  1K9A A;  1VYV A;  1UGV A;  1WDX A;  3VS0 A;  2SEM A;  1FYN A;  3H41 A;  1CKB A;  4J9I A;  2CH4 W;  2L2P A;  2BZY A;  1X2K A;  1PNJ A;  2HCK A;  4J9D A;  2JW4 A;  2BTT A;  4HVU A;  2QDL A;  2F2X A;  2EGA A;  2KYB A;  1SRL A;  4ORZ A;  1PWT A;  1AOJ A;  1PKS A;  2K7A A;  2X3X D;  1KJW A;  2J06 A;  4JJD A;  1ARK A;  1B3Q A;  2DLP A;  4CC2 A;  1B07 A;  1J3T A;  2D8J A;  1JU5 C;  1M8M A;  5I22 A;  2L0A A;  3EG3 A;  1NEG A;  1LCK A;  5GJV B;  1NYF A;  4D8D A;  3I35 A;  1HJD A;  2MOX A;  5I11 A;  2GTJ A;  1E6H A;  4J9G A;  2CT3 A;  3TVT A;  4RTZ A;  2DBM A;  3VS5 A;  1UDL A;  2EVR A;  2KEA A;  4Z89 A;  1CKA A;  5GJW B;  2FO0 A;  2W10 A;  1NYG A;  2V1R A;  3M0P A;  4RTX A;  2DL8 A;  2YUN A;  4EIK A;  2K3B A;  2LP5 A;  3ZL7 C;  4GLM A;  4J9H A;  3R6N A;  4LN2 A;  1AEY A;  1WI7 A;  2JMC A;  2PTK A;  4AFZ C;  4DEX A;  1VYT A;  3VS7 A;  1UJ0 A;  1Y57 A;  3SHW A;  2ECZ A;  2F2V A;  2CUD A;  4KRT A;  5ECA A;  2KRM A;  2KR3 A;  1T3S A;  5FWB A;  5FWC A;  4AFS C;  1UHC A;  1T0J A;  2KYM A;  3RBB B;  2DYB A;  1ABO A;  2B86 A;  2GTO A;  4AFQ C;  1CSK A;  2J05 A;  4D8K A;  5FW9 A;  3QWX X;  5EC7 A;  1UEC A;  1BK2 A;  2L3Q A;  3H0F A;  2YUP A;  2RNA A;  2O9S A;  3EG0 A;  1I1J A;  2ED1 A;  2EW3 A;  2V1Q A;  1PRM C;  1X6B A;  3M0R A;  2RMO A;  2CT4 A;  4RTU A;  4HVV A;  4Z88 A;  4CC3 A;  1RI9 A;  1YWP A;  2O88 A;  1X69 A;  2K79 A;  2O2O A;  2KBT A;  2E5K A;  2W0Z A;  1ZBJ A;  1ZUY A;  4IIM A;  1JXM A;  2DA9 A;  2DMO A;  4QT7 A;  2A28 A;  3NGP A;  4HVW A;  3I5R A;  1ZSG A;  3RNJ A;  2YT6 A;  3H0I A;  4JZ3 A;  2M51 A;  2KNB B;  3KFV A;  1ZUU A;  5IXB A;  2EYX A;  1WXU A;  1UUE A;  2HDA A;  2K2M A;  2DX1 A;  1WLP B;  4CC7 A;  1WIE A;  2FRW A;  2EGC A;  4LNP A;  2EBP A;  4FSS A;  2C0I A;  1OV3 A;  1GFC A;  2HSP A;  2RF0 A;  2LMJ A;  1SRM A;  3SEM A;  4JZ4 A;  1GCQ C;  2RQW A;  1YWO A;  2IIM A;  1GFD A;  2JTE A;  2HBW A;  3A98 A;  1AZG B;  4RTY A;  3VS1 A;  2JM8 A;  1OOT A;  5IH2 A;  2GGR A;  2JS2 A;  2P4R A;  1W6X A;  2A08 A;  1G2B A;  2JS0 A;  2K6D A;  1X6G A;  1H8K A;  1PKT A;  4A63 B;  1Z9Z A;  2LX7 A;  4ZNX A;  3EHQ A;  2NUZ A;  2M0Y A;  2RN8 A;  1K76 A;  2LJ3 A;  1M3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...