4RTZA

Crystal structure of the c-src-sh3 domain in complex with the high affinity peptide vsl12
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the c-Src-SH3 domain in complex with the high affinity peptide VSL12
rcsb
source organism Gallus gallus
total genus 16
structure length 61
sequence length 61
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtzA00
1WIEA 2YSQA 1NG2A 1WA7A 1SPKA 4AFQC 3EGUA 1PWTA 1OPKA 5GJVB 2CT3A 2EYZA 2ROLA 4AG1C 4Z89A 5IXBA 2KE9A 2FO0A 4LUEA 1K0XA 2GBQA 1OV3A 2ESWA 2DJQA 2EYXA 1VA7A 2GTJA 3M0SA 4HCKA 3KFVA 2ENMA 1T3SA 2A08A 2ROTA 1CKAA 4F14A 3VRYA 4CC3A 2V1RA 2VVKA 4DEXA 2K7AA 4RTXA 2D1XA 2DLPA 1GCQA 1WYXA 3NHNA 1AD5A 1OOTA 1T3LA 2DA9A 2KT8A 2GGRA 1TUDA 3TSWA 1KSWA 1MV0B 1E7OA 2DX1A 1NYGA 3EHQA 4JPBW 3EG3A 2J6OA 4FSSA 3R6NA 2LX7A 5I22A 2RQVA 2DMOA 2KRSA 2LMJA 1AVZC 4J9IA 2GQIA 2BZYA 2DILA 1GRIA 4LE9A 5GJWB 1NLOC 1SHFA 1VYVA 1RLPC 2L3QA 4OMNA 1OPLA 1N5ZA 1PHTA 1PKTA 2CREA 2HBWA 2W0ZA 2AK5A 2KEAA 2PZ1A 2K79A 4AFSC 2YUNA 1FYNA 5IHKA 1X2KA 1PRLC 1G2BA 2CSIA 4RTYA 3VS5A 1KJWA 2VKNA 1JXMA 2JM8A 2BZ8A 3M0QA 5IH2A 1M3AA 4D8KA 1BK2A 3UA6A 1YP5A 2LZ6B 1QKXA 3VS6A 2RPNA 4AG2C 1UJ0A 2JMCA 2SRCA 2C0IA 1UHCA 1H8KA 2QDLA 1UUEA 2DF6A 2PNIA 1QWEA 1YWPA 2LCSA 4K11A 2FEIA 3UF4A 4OMLA 1ABQA 1JQQA 4Z88A 2CH4A 1I0CA 2XMFA 2DM1A 4JJDA 4EIKA 2FG0A 2EPDA 2L2PA 1I07A 1X69A 3VS4A 3VS3A 2BZXA 5IXFA 1ZUKA 1QKWA 4RTVA 3JV3A 4F17A 2HDAA 2D8HA 1VYTA 1U3OA 4IIMA 1UG1A 1MV3A 2OAWA 1H3HA 1WFWA 2LP5A 1U06A 2A37A 1B07A 4HVVA 3LH5A 1PKSA 2LJ3A 2CUDA 2O2OA 4J9FA 3H0HA 3A98A 2F2XA 1UGVA 3REAB 1RLQC 1X2QA 1W1FA 2RQTA 3NPFA 2O88A 2LJ0A 2EW3A 5I11A 1K76A 3PE0A 4DEYA 2DE0X 4J9CA 1BBZA 3H41A 3M0TA 2DBMA 2AKKA 2J05A 2CSQA 4D8DA 1M8MA 1X6GA 2CUBA 1UJYA 1OEBA 2M51A 5FWCA 4HXJA 2KYMA 3VS7A 5EC7A 2LQNA 3I5SA 2ED0A 1SHGA 2LJ1A 4AFUC 3ZL7C 4RTZA 4JJBA 1G83A 5FW9A 2RQRA 2J06A 4JZ3A 1H92A 2D8JA 1KIKA 3QWYA 1SSHA 1HD3A 1WX6A 3IQLA 4CC7A 5IHIA 1ZLMA 2GNCA 3I9QA 3THKA 1Z9ZA 4J9BA 2K9GA 2P4RA 1UHFA 3REBB 2ABLA 2MCNA 3TVTA 2EGCA 2EQIA 1K1ZA 1GL5A 4LNPA 2RQUA 1ARKA 4HVUA 4OMPA 3EG0A 1K4US 2D0NA 5FWBA 2I0NA 3UATA 2GTOA 4KRTA 1B3QA 2JXBA 2FPDA 3EG2A 1NLPC 1W70A 2YUPA 1T0HA 1BU1A 1QLYA 3M0RA 4J9HA 1M30A 4CC2A 2KXDA 1WI7A 2DL3A 2O9VA 2OI3A 1Y57A 2HCKA 2YDLA 3UA7A 2YUOA 2JMAA 1WXBA 1BB9A 2EYYA 2RMOA 1JXOA 2FPFA 1YWOA 2KGTA 1AWJA 2JT4A 2MIOA 2K3BA 2K6DA 1ABOA 3H0FA 5HCKA 2F2WA 2L3PA 1RUWA 1ZSGA 2DVJA 1U5SA 1W6XA 2E5KA 4OMOA 2PTKA 1TUCA 3PVLA 1GFDA 3VS0A 3CQTA 2DYBA 1M3CA 1UDLA 2CH4W 1M27C 1J3TA 2KNBB 2V1QA 3VS1A 3ULRB 2G6FX 3I35A 1HJDA 2NUZA 1UTIA 1Z9QA 2X3WD 1GBRA 1NEGA 3FJ5A 2KR3A 2YUQA 2H8HA 1IO6A 4X1VA 1RI9A 3VS2A 2AKLA 1VYUA 2RNAA 1NEBA 2LNHB 1NYFA 4CC4B 4QT7A 3PVQA 4LN2A 1QCFA 3GBQA 4E6RA 1V1CA 1GCPA 4HVWA 2A36A 1SRMA 2AZSA 2EYWA 2EKHA 4RTTA 1FMKA 2EVRA 2KRMA 3SHWA 1A0NB 1T0JA 1UECA 2DNUA 2M0YA 2SEMA 2EGEA 2J6KA 3NMZC 1GBQA 3SEMA 2KT1A 1XOVA 3M0PA 1AZEA 2A28A 1ZX6A 4RTWA 2J7IA 1HSQA 2KYBA 1I1JA 4A63B 5L23A 2F2VA 1AEYA 1TG0A 4ORZA 1AWWA 2LQWA 2DL7A 4LUDA 1M3BA 1ZUUA 4JJCA 2HSPA 1WXUA 2BTTA 3I5RA 1GFCA 4AFZC 2DRKA 3C0CA 4J9GA 1NM7A 2X3XD 2DL8A 2NWMA 1WDXA 1SRLA 2KROA 2DRMA 2JS2A 2JM9A 2EGAA 3NGPA 3EHRA 4RTUA 2YT6A 2HEQA 1MUZA 2ED1A 4OMQA 2DL5A 4R0KA 4ZNXA 1LCKA 4M4ZA 2DBKA 1YNZA 1UE9A 4GBQA 1AWXA 1Y0MA 1AWOA 1CKBA 1GCQC 2O31A 5IHNA 1AZGB 1X6BA 1X27A 1AOJA 5ECAA 2FPEA 3M0UA 1YCSB 1JU5C 1PNJA 2B86A 3H0IA 2OJ2A 2L0AA 1K0SA 2CT4A 4GLMA 1YN8A 2RN8A 2JTEA 2IIMA 3VRZA 1S1NA 2MOXA 1X43A 1SEMA 2DL4A 2L3SA 2RQWA 1QWFA 4OMMA 2W10A 3QWXX 3EG1A 4Y92A 1E6HA 1EFNA 3RNJA 2KXCA 2O9SA 2K2MA 2VWFA 2EBPA 1CSKA 3RBBB 2JW4A 2RF0A 4IIOA 2CDTA 4ESRA 2FRWA 1JEGA 4WCIA 4F16A 1WXTA 2ECZA 3O5ZA 2KRNA 1K9AA 1ZBJA 2JS0A 1JO8A 4Z8AA 1WLPB 4J9EA 2C0OA 2AZVA 2FRYA 2J6FA 2KBTA 1PRMC 1ZUYA 1UFFA 4RUGA 3U23A 1E6GA 2C0TA 4JZ4A 4J9DA 3TSZA 1KFZA
chains in the Genus database with same CATH superfamily
1WIEA 3VV0A 5A0GA 1NG2A 1WA7A 4ZGDB 5KYYA 1W2BA 4C8QA 1OPKA 3CCUA 5I2MA 2EYZA 2V8KA 3PIPA 5KYNA 5IXBA 4JLIA 1OZ2A 2FO0A 4MDXA 3G71T 1VQPT 4HCKA 1VQNQ 4ANJA 5GANf 3JB9I 2A08A 3VRYA 4CC3A 1MMGA 4BI3A 4DEXA 1M90C 2K7AA 1W4SA 3OA6A 4PKCC 3EG9A 2E1HA 5D7UA 1AD5A 3ZFJA 2KT8A 1KSWA 5CKHA 3FC3A 4PFZA 4FU6A 1B7TA 4J6XA 1NJIR 5A2QE 3EG3A 4GLKA 4FSSA 3V8KA 3H9NA 4IUPA 5LJ3e 2DMOA 4M75A 4A4GA 3I55T 4PJJA 1OULA 5IAYA 2DILA 1WQWA 1VQ7A 2FZKB 1RLPC 4OMNA 1VQ5T 4BD3A 1PHTA 2CREA 2OAUA 4IUVA 1QCNA 3CCVA 3NTHA 2KEAA 3HKSA 2D0QB 2K79A 3CMET 2YUNA 5A0LA 2MF2A 5IHKA 1XQHA 3RKXA 1X2KA 2CSIA 1OU8A 3OS1A 4J6YA 3VS5A 1VQ6Q 2VKNA 1JXMA 2BZ8A 4A54A 4F7UE 3CC2T 3TQ7P 4D8KA 1B34A 5FU6B 5GMKe 2HL3A 2QXFA 1QKXA 4ZN3A 2RPNA 4AG2C 4OB0B 3QG1A 4PJOG 3VU3C 4J7IA 2LT4A 2X35A 1VQNT 2LCSA 1QMCA 4K11A 2LNVA 4RG2A 3TU4K 4OMLA 2VUBA 3X24B 5D6YA 1I0CA 2FG0A 1Q81C 4MZTA 3OYDA 3CCRA 2L2PA 4AT1B 2X4YA 5KE2A 1QKWA 1Q82U 3BE3A 3A8LB 2HDAA 1VYTA 2QA4A 4M7DC 4JS4A 4PJMA 2CS7A 4FT4A 1YJNQ 1MV3A 4WTOB 2A37A 2E65A 2R57A 3MEAA 3ZEHA 1HXDA 3A98A 2WSEE 3H8ZA 3MP6A 1M1FA 3JCMb 2CZ1B 2O88A 1IB8A 2CZ0B 5I11A 2DXCA 3PE0A 5KCOA 2FB7A 1VQKA 4FYVB 2DE0X 1M1KC 3H41A 4HCZA 2AKKA 2J05A 1M8MA 1X6GA 4OF1A 4BI8B 2KYMA 3VS7A 1M90R 4A4EA 5EC7A 2LQNA 3C94A 3SWNC 1K73U 1PM3A 4Q5WA 4LDVA 2KY9A 2NUPB 1G83A 4QQDA 1WX6A 3QHSA 3H6ZA 3QZ9B 5IHIA 3GNGA 1ZSZC 3G1JA 4J9BA 1TS9A 4M7DF 3EGXA 1RADB 2HKNA 2P4RA 4M7AD 4XU2A 2WSCE 2ZGWA 2M9UA 3OYIA 4E7KA 2HMAA 5LJ5f 3OYAA 3RKYA 2EQIA 2QEXA 1K1ZA 2RQUA 1ARKA 1MMDA 2DFUA 3QJYA 4BDYA 4OMPA 3E2UA 1VQ4Q 2BE9B 1K4US 4O6JA 1DJ7B 3CCMQ 5CCAA 2ZPHB 2KAFA 1NLPC 1WHKA 1YJNT 2DXBA 4M7DA 1JRIA 1KQSS 1QLYA 4J9HA 1M30A 2DZ9A 4M7AB 1X75C 4XTUA 2OI3A 2DTHA 2QASA 1K9MU 2QG9B 3G71A 3EFSA 1VQPA 2XG8D 3NTIA 3META 1WJRA 4C5IA 1YWOA 1JJ2S 1AWJA 1MNDA 2K6DA 1ABOA 1OQKA 4C92F 2COWA 2DVJA 1W6XA 1KHIA 3PVLA 3G4ST 5CK9A 1UDLA 2CH4W 1M9SA 5GMKl 4RG8A 1Q81R 2CZ6B 3ULRB 5EG2A 2MMPA 1XJWB 2XDPA 1HJDA 1UTIA 2X3WD 1U1TA 1NEGA 1Y7XA 3F70A 4B9WA 4ELYC 2YUQA 4QVZA 2H8HA 3SWNA 3HL8A 5HKCA 3VS2A 1ZBXA 1M2VB 2RNAA 1PG5B 2LNHB 3NTKA 4OB2B 2QGFB 3ME9A 1BYMA 3RMQA 4KH0B 1VQ5A 1WHMA 1ZSZA 4FSXA 4E6RA 2RD1A 4HVWA 5D6WA 3CMEA 2EKHA 3KXTA 2EVRA 5LJ5j 1UECA 1M5Q1 2EGEA 2J6KA 1ACMB 5GAOl 4R56A 3CCMT 3CC2A 1RAHB 4BY6C 1TSFA 2K2VA 1I1JA 5LJ5d 4A63B 5L23A 2F2VA 2M1HA 3M5AA 1M1KR 4ORZA 2O4XA 2DL7A 4Y28E 1M3BA 5GAN3 1VQNA 1YI2Q 2E12A 2CP0A 1TXQA 2DRMA 5CKFA 2JOYA 1D1BA 2JM9A 4C8QG 4JRPA 4DBHA 2DTIA 2EJFA 1AT1B 1Y71A 1RAFB 4OMQA 2DEQA 1R0CB 5I21A 1YHQQ 3HFNA 3OQ5A 4M4ZA 1YNZA 4E7IA 4X34A 3L2QA 3J7AF 1Q7YC 1PC0A 2RI5A 2Y4XA 5CO7A 1KQSA 1X27A 1RI0A 5AT1B 4HT8A 1WHGA 1AOJA 2M02A 5ECAA 2FPEA 4IUUA 1YCSB 1PNJA 4EMHA 4QVCA 2EAYA 4GLMA 1JJ2A 2MPXC 3VRZA 1S1NA 8AT1B 2DXUA 2IG0A 1SKUB 2MOXA 1X43A 2YXYA 1SEMA 4M75G 3CCSQ 3TEEA 2JZ2A 2ZPIB 5LJ3h 1EFNA 5LJ3g 2KXCA 1VQ6A 2QGGA 1VQ7T 5GAN8 2K2MA 1QVGS 2JW4A 3P8HA 3QYHB 4ZTFA 2CDTA 4KUIA 1KC8C 2DZCA 3E9FA 8ATCB 3T9NA 2FRWA 2LCLA 3V8LA 3LWHA 3GPLA 3O5ZA 3PGGA 2KRNA 1ZBJA 3LH0A 3CC4T 1Q86R 1WLPB 3OMCA 1TUGB 1V76A 2KBTA 3JCMf 2RHYA 4NL3A 4IKFA 1YI2T 3WVDB 4XTXA 1IHVA 2QTVA 2OTLQ 2C0TA 4DA4A 5LJ3j 3JB9H 2LQKA 2YSQA 4UC4A 5GMKh 4C8QD 2RA2A 5HK3A 5GJVB 1MMNA 2ROLA 4Z89A 1YHQT 1M8VA 3MCAB 2A0FB 3OW2P 1PD0A 4LUEA 2DEUA 2ESWA 1NE8A 2EYXA 1N9RA 1VA7A 2GTJA 3KFVA 2ENMA 1T3SA 4N4HA 3OYYA 4J7FA 3G6EQ 2V1RA 4M77D 2VVKA 1U1SA 4RTXA 2D1XA 1YJNA 1NJIC 1ZA1B 4J5YA 3INZA 4RCCA 2VXEA 2KVQG 1OOTA 1OX8A 4C8QB 4A53A 2B8AA 3ER0A 1TUDA 5GMKj 4C0DC 4C92E 2MAMA 3A8GB 3CC7Q 2M0OA 1E7OA 2DX1A 3R6NA 4M77B 3CXCP 4M75D 3VYHB 1WJQA 2R58A 1GRIA 5LJ5e 2LTOA 4XU1A 1HYOA 2E64A 1VYVA 1N5ZA 1R0BG 1PKTA 4N4GA 4AFSC 1VQKT 1RL2A 3MP1A 5GAMj 4KGZB 4KGXB 4II1A 2DTOA 2D6FA 3EFOA 1PRLC 4RTYA 4BACA 4M75B 1M2OA 3M0QA 3QYGB 1RAEB 2ZPFB 4XAXB 2OTLT 2DO3A 2F1LA 3O8VA 2V8JA 5GAMd 3CXCA 2EIFA 2NYSA 2HL5C 1M1GA 3HRSA 1KQ1A 1M4ZA 1UJ0A 2RJEA 4FT2A 3JCMd 2C0IA 1H8KA 2QDLA 1WHHA 2X51A 2PNIA 3OYGA 1QWEA 1QVGA 4FIBA 2JNGA 2MI6A 2FL7A 3UF4A 3CCMA 3MO8A 1ABQA 3JCMX 3OS2A 2XMFA 2DM1A 2P0PA 4JJDA 4EIKA 5CAIA 3CPWS 2EPDA 1VIEA 1I07A 3RR6A 3VS4A 4OMFB 1IGUA 4M7AE 5KE3A 1QVPA 4LD9K 3JV3A 3CC7T 4F17A 1KC8R 2D8HA 4M7DG 1U3OA 3OYFA 3GF5A 4XQ3A 5GAN7 4OP0A 3VYGA 1WFWA 1B07A 3LH5A 3LYIA 3S3MA 2CUDA 3PFSA 2JTMA 1UGVA 1LPLA 1W1FA 2LC4A 1YCYA 1KD1U 3KUFA 1FXXA 2RQTA 3NPFA 2RJCA 2RH2A 3BFMA 2LJ0A 1C1AA 3HPWA 4DEYA 2LVMA 1UEBA 2E6ZA 1O75A 4J9CA 2A7YA 2DBMA 3J80E 1WJSA 4D8DA 2GQVA 5AYFA 4FCYA 2CUBA 2JJ9A 2M51A 2VB6A 2CP2A 2EQJA 3I5SA 2DK3A 1Y96B 2MK5A 4AFUC 4RTZA 3EGDB 1Q82R 5FW9A 2RQRA 1S72Q 3QSUA 2D8JA 1HD3A 3IQLA 4CC7A 5C0MA 4PLLA 3LWIA 1MGQA 3JB9D 2K9GA 4EMKC 2H3JA 3REBB 5KH6A 2MCNA 3QDFA 2HSEB 3LGFA 3RIRA 3TVTA 2F5KA 3CC4A 4LNPA 4M78D 3EG0A 4KULA 4JJNK 1IXDA 3UATA 1YI2A 1B3QA 2RK2A 3OSVA 4F04B 3WVEB 4DBRA 1W70A 3EGXB 4NL2A 2JUFA 1IHWA 3OYKA 3M0RA 3QBYA 2KXDA 2K3XA 2RHIA 1YHQA 2X4JA 1Y57A 4XTWA 4HCBA 4E7JA 2QQBA 3HFOA 3UPUA 2JMAA 4M78B 2LDMA 3V7RA 2OTJQ 1K73R 2EYYA 1R77A 1JXOA 5GANj 2FPFA 2KGTA 2JT4A 2K3BA 2MWPA 2WSFE 1QW1A 3CCEQ 1ZSGA 3EFRA 2VASA 5FU7B 3CBOA 2QQRA 1U5SA 2E5KA 5GAMe 5GANd 2DIQA 3CQTA 2DYBA 3DKMA 2CP6A 2KNBB 4YTLA 1MMAA 1VQ8Q 2G6FX 3OY9A 1FMVA 3CCSA 1YJ9Q 2NUTB 3CCJQ 2ZAEA 1XNIA 1S72T 4X1VA 1RI9A 2VYTA 5DLQE 2PVOB 2COZA 4A4FA 1H3ZA 1VQMQ 1NYFA 1G3SA 4BE1A 3M4GA 5CIUA 1D0XA 1WPYA 2VXFA 2E6NA 5I2SA 1K8AU 3PVQA 1QCFA 4EMKA 1BCMA 5DLOA 4FL6A 4A4KA 2AZSA 1C6VX 2EYWA 3OMGA 4IUQA 1K9MR 4RTTA 3I56Q 3OYNA 1T0JA 1VQ6T 2L5QA 2DNUA 2M0YA 3SWNB 4QVDA 3QKJA 2DJZA 2QI2A 3OYCA 3M0PA 2QTXA 2HD0A 2OTLA 1HSQA 2KYBA 1ZHIA 4C92C 5GAOq 1AEYA 4PLIA 4LUDA 1TTHB 2HSPA 2KMTA 1TH7A 4PJOD 1WXUA 2X3XD 2OTJT 3DB4A 1WDXA 4TVRA 3G6EA 3URGA 4A4HA 3CCET 4QKUA 3C95A 4ATOA 3QJ6A 4PNOA 2O4XB 2DPPB 2DL5A 3OSSC 4R0KA 2F5TX 1N6AA 1LCKA 3LW5E 4E7LA 3S3NA 1N8RU 2YRDA 1AWXA 4PJOB 3CC7A 4F7UG 2C06A 1GCQC 2O31A 5CKEA 5IHNA 5KYUB 3CCJT 1X6BA 1VQOQ 4C5HA 2A3LA 4KUDK 1JU5C 2CP5A 2B86A 3H0IA 4RKUE 1H641 2OJ2A 2EFIA 4M77E 2RHUA 2K5IA 4GY5A 2L89A 2ZPGB 2DD5A 2CT4A 1YITQ 4DBQA 3S6WA 1N27A 3V7SA 2L3RA 3M58A 3FRNA 2Y90A 2RQWA 2W10A 3EG1A 5CKDA 3VJPA 2BIVA 3OB9A 2WACA 3CBMA 1Q86C 1BI3A 2QQ9A 3JSCA 2VWFA 1BCOA 2EBPA 1QQJA 3RBBB 5LJ5h 4M7AC 3L2ZA 5LJ5g 3AHUA 2DIGA 3CD6Q 3AT1B 2P4TA 4WCIA 1WXTA 1M90U 4C5EA 1JO8A 3VUZA 4C92A 2FRYA 3GLXA 5IT9E 1VQLQ 4LDWA 4RUGA 4Z02A 3U23A 1WHJA 2VC8A 1MNEA 4J9DA 3TSZA 3CCLQ 1HK9A 5GANe 4BY6B 2QK0A 3JCMQ 5J26A 3EAEA 2IPOB 1PSFA 1D3BB 5KCHA 1PWTA 1G3YA 2CT3A 4CRIA 2EQUA 2ATCB 5IN1A 5GAN2 1VQ4T 2KE9A 1NZ9A 1K0XA 2EWNA 2GBQA 2DJQA 1NBEB 4O5VA 2ROTA 1CKAA 2HQXA 3MEUA 1RAAB 3RUXA 1VQOT 2DLPA 2NUPA 3CBPA 1GCQA 4PK4A 1WYXA 2PUKB 2QAZA 1PSEA 1T3LA 1KQSP 3UWNA 1YJWQ 2DA9A 3BY7A 3BDLA 3TSWA 1YITT 3GOXA 4M7AF 3A8MB 2ZZDA 4X9CA 2PUOB 4JPBW 2J6OA 1VUBA 2LX7A 5KYXB 1JJ2P 4F7UB 5KYWB 1IZ6A 2KRSA 2LMJA 1AVZC 4PJLA 2GQIA 2OX7A 2BZYA 5FRMA 5GJWB 1OI1A 1OU9A 1SHFA 1WZOA 3BDUA 3G7ZA 3CEYA 1FX7A 1OPLA 2HBWA 2W0ZA 3CD6T 4JRQA 3OS0A 4M7AA 7AT1B 2PZ1A 4EDUA 2YWWA 4LXCA 1Q81U 1S72A 1G2BA 1VQLT 3FIFA 2KQWA 3M54A 2ZPEB 3UA6A 5M9OA 2LZ6B 3PMTA 3SFMA 1UGSB 1X6OA 3M53A 5FROA 3HRTA 2V26A 2IVWA 3EFOB 2DF6A 2R5AA 2GCXA 2XHCA 2QA4Q 4Z88A 3A8OB 2CH4A 4JLGA 5CKBA 3ASKA 2HBPA 1YIJQ 1RABB 4LDUA 2RK1A 1X69A 5GAOn 1M2VA 3VS3A 5GAN4 2BZXA 1YJWT 1M1KU 2X4WA 1ZUKA 2BKDN 2OTJA 4BB7A 1LJOA 5HY6A 3V8JA 4IIMA 2COYA 4V2SA 4M78E 3CCEA 3HHTB 1H3HA 1PKSA 4L59A 4BI4A 3PNWC 2F2XA 3REAB 1X2QA 2EJGA 2QQAA 2EQKA 3E19A 4KH1B 5GAN6 1VQ8A 3LX7A 3LGLA 1YJ9A 2EW3A 4C0DB 3CCJA 1VOMA 4HA8A 3OS5A 2EJ9A 1W2BS 2CZ7B 5KYYB 4MMLA 3M0TA 1Q82C 4PJNA 4CI0C 5GAMh 3CCQQ 1QVFS 4HXJA 3M4YA 5GAMg 2P0QA 3QIIA 4DBFA 3CCST 4LDXA 2ED0A 1SHGA 2LJ1A 3JCMh 4QQGA 3JCMW 3C12A 4E7HA 2K5FA 4J8OA 1F1BB 4JJBA 3PIOA 4XTZA 2AHJB 1G5VA 2J06A 4IUTA 4JZ3A 1H92A 3DLLA 2DERA 3EG9B 1KIKA 5L8RE 1ZLMA 2XD0A 2GNCA 4DOWA 1N9SA 1YIJT 2RHZA 3EH2A 1QVGP 1KG1A 2ABLA 1TOVA 3QDRB 4LD6A 1KD1R 4HVUA 3MP8A 2FHDA 2D0NA 3MHXA 4FW1A 4KRTA 1BI0A 2JXBA 4M77C 3OYEA 1K73C 3M59A 3L2UA 1UB4A 3JCMc 1T0HA 1BU1A 4C0GA 2YRCA 1WI7A 4KBMB 1VQ4A 2YDLA 1C0MA 2F69A 2YUOA 1WXBA 3DB3A 3G6ET 5HCKA 2MIOA 3H0FA 3CMAQ 3N5BB 2CYZB 4PJOE 1D1AA 2F2WA 1B34B 2L3PA 1VQOA 4N0AC 3S3OA 1RUWA 3QO3A 3I55Q 2PTKA 3Q1JA 4P5NA 3P8BB 1GFDA 2QQSA 5DY9A 3QZ5B 1YITA 4RMOA 1M27C 1J3TA 2V1QA 3C4SA 2GFAA 2XK0A 3ZBDA 1ZA2B 3FDRA 1Z9QA 3FJ5A 1RACB 3CMEQ 2KR3A 3TREA 1IO6A 1K9MC 2AKLA 4MMKA 2RO0A 1NEBA 4N4IA 5HK0A 3CC2Q 4M77F 2LQ8A 4FM4B 2DETA 3CD6A 1V1CA 1D0ZA 1EZZB 2HQHA 2JTFA 3QUIA 5FRNA 1YBYA 1Y07A 2HZYA 2KRMA 1A0NB 1VQLA 1GBQA 3SEMA 1FMWA 1QVFA 2D9TA 1AZEA 1G8XA 1ZX6A 4RTWA 3MEVA 2J7IA 4QW2A 3HRUA 3CCLA 4M77A 3L42A 1R8OB 4M75F 4C92G 1Q7YU 3OBWA 4QQ6A 2LQWA 4EMKB 1AWWA 1ZUUA 2EKOA 4JJCA 2BTTA 3I5RA 1GFCA 1LNXA 4AFZC 2DRKA 4J9GA 4EPCA 4LDYA 2DL8A 1SRLA 2KROA 3CMAT 1V29B 2FZGB 3J81E 3UT1A 4RTUA 3FEOA 1P92A 2HEQA 1MUZA 2ED1A 4L5GA 1MHNA 5GANh 4N0AA 3CPWP 1QP2A 2NLUA 5GANg 1K8AR 2X9HA 1YJWA 2XU8A 4FW2A 3TCJA 2GF7A 2EYQA 2RI3A 3RKWA 4AMCA 4XTYA 4M7DD 1KC8U 4E7ZA 3M0UA 1BIBA 4XTVA 1WNLA 3MJXA 4OB3B 3UDCA 4ZN1A 2L0AA 2RM4A 1YN8A 2ZCFB 3M56A 4J83A 2IIMA 3A8HB 2DD4A 3CPWA 4ME7A 5C6SA 2DL4A 2YLBA 2L3SA 3X26B 4OMMA 3QWXX 1E6HA 4M7DB 3D7SB 3RNJA 3RESA 2RJFA 5FU6C 4B9XA 2PU9B 3BW1A 2O9SA 2PQWA 2KI7A 1NPPA 2RF0A 4C5GA 4ZGEB 4M7AG 4IIOA 2CP3A 3JCMe 4PFOA 4ESRA 1JEGA 1KHCA 1K9AA 1IRXA 4C92D 1OZ3A 2JS0A 4Z8AA 1BI2A 4J9EA 1N8RR 1NJIU 4M78C 2J6FA 2DVEA 1BKBA 1PRMC 3A1PA 1ZUYA 1UFFA 1D09B 3SB2A 4BDZA 5FU7C 1YIJA 1SPKA 4AFQC 3GNFB 3MPUB 3JRZA 3EGUA 1UGPB 1VQ9Q 4AG1C 5D6XA 4C92B 3JCMJ 2LRQA 1KQ2A 1OV3A 3PTAA 3X20B 3M0SA 3FJPA 4F14A 1X01A 1Y96A 1SSFA 1ZSZB 3EGDA 2MYSA 5CQYA 3NHNA 3L2RA 2XICA 3E1SA 3OYMA 1I5OB 3JB9F 2GGRA 3OBYA 2RHXA 3G4SQ 1MV0B 3V7CA 2E3IA 4B6MA 1NYGA 4BUGA 3EHQA 2PVDB 3KBGA 5I22A 2RI2A 1SF9A 2RQVA 4M78F 1TWBA 2HAXA 4J9IA 2GFUA 4LE9A 3CCQA 1NLOC 2L3QA 3OYHA 4C8QE 3SDZA 1VQ8T 3VUBA 2AK5A 1YJ9T 2LT1A 4JDSA 1TU0B 2KDSA 1RAGB 3QPHA 5FLXE 2K5LA 1FYNA 1KJWA 2E41A 1VQMT 4KT0E 4M78A 2JM8A 5IH2A 1UGRB 3QXEB 1M3AA 4J6WA 1BK2A 2FZCB 4BE0A 1YP5A 1I81A 2RJDA 1PCXA 3VS6A 3I56T 3RDVA 2JMCA 1VQ9T 2SRCA 4PJOC 2V8IA 1UHCA 3MEWA 3A5ZB 2K3YA 1UUEA 5J39A 1YWPA 2XI9A 4JRIA 2FEIA 1JQQA 4M75E 3GIBA 2NUTA 4ZGJB 4HCCA 3CCUQ 2XDDA 2YHTA 5IXFA 4R55A 4RCBA 4RTVA 1RAIB 1VIFA 3CMAA 2XKOC 1UG1A 1OYXA 4XK8E 2OAWA 2LP5A 1U06A 2VV5A 4HVVA 2LJ3A 3HP9A 3I55A 2E10A 2O2OA 4J9FA 3H0HA 1RLQC 2E70A 1D1CA 1WGSA 4HKEA 1I8FA 4L6V5 3CPFA 3EH1A 5GMKi 5CQXA 1K76A 1QCOA 2E5QA 4PJOF 4FYYB 1BBZA 2CSQA 2YLCA 1UJYA 3JAME 1G3TA 1VQ7Q 1OEBA 5FWCA 1QP3A 2K4YA 3CCVQ 4JRKA 3M57A 4XU0A 2P0KA 3ZL7C 3JB9J 1ZQ1A 3WXMB 3X25B 3CC4Q 4BE2A 1KK7A 3QWYA 4PJOA 1SSHA 1KD1C 5LJ3f 3I9QA 3THKA 5KYUA 1Z9ZA 2ZPBB 1UHFA 2MWOA 4C0FA 2EGCA 3CCUT 3OW2S 2G3RA 3FB9A 1GL5A 1SG5A 2AT1B 3LLRA 3GP8A 5FWBA 2I0NA 2GTOA 3MKDA 2E3HA 4M77G 2FPDA 2HQEA 3EG2A 2P84A 3CCLT 2YUPA 4MZPA 1IGQA 5CVIA 3E9GA 2XIDA 3CCRQ 1LOJA 4CC2A 4OGCA 2EQMA 2DL3A 2O9VA 2R5MA 2VGNA 4PL6A 4D6WA 2HCKA 3UA7A 3L1AA 1GXIE 5DM7R 4OB1B 1BB9A 2RMOA 2BE7D 2CGHA 3RMSA 3CXCS 5GAOr 3P8DA 1YFNA 2FVUA 1D0YA 4KGVB 2LCCA 4HT9A 4OMOA 3DLMA 1LVKA 1TUCA 3VS0A 4OGEA 4OVAA 1M3CA 9ATCB 3L2WA 2KK4A 3VS1A 4E7SA 3CCVT 2AIRB 2X4XA 3I35A 2NUZA 1D3BA 5GAMf 4ZTJA 1GBRA 1I5LA 1VQKQ 2DYIA 2O01E 1PD1A 4WF2A 4JS5A 1VYUA 1NPRA 1OX9A 4M7DE 4CC4B 4F7UF 3OYJA 4QT7A 4LN2A 2JN0A 3GBQA 5J3BA 5GMKm 1GCPA 3PMIA 2A36A 1SRMA 3HSBA 3L2VA 1FMKA 4MDWA 3SHWA 1BI1A 2SEMA 3NMZC 5LJ3d 4Y91A 1VQMA 2KT1A 1XOVA 1JB0E 4NS5A 2A28A 1O9SA 2HNIA 1IREB 3PT9A 1EIFA 5KYXA 4F7UA 3CCRT 5KYWA 1Q95G 3SD4A 1TG0A 2QYZA 3JCMg 3I56A 2QEXQ 4DQ2A 1VQ9A 4VUBA 4EMGA 4JUVA 4MZMA 3C0CA 4FYWB 1NM7A 1K8AC 3OYLA 2QA4T 2NWMA 1WQ7A 2BUDA 5GAOm 1WHLA 2JS2A 3VKIA 4NOYA 4C8QC 1AHJB 2EGAA 3NGPA 3OW2A 3EHRA 1JBMA 2KSSA 2YT6A 2YRVA 1XTDA 4ELZC 6AT1B 4ZNXA 2DBKA 1Q86U 1UE9A 4GBQA 3G71Q 1VQPQ 1Y0MA 2Y4YA 1AWOA 3G4SA 2HKQB 1CKBA 4E47A 5CR2A 1I4K1 2L8DA 1AZGB 2E4HA 5GAOp 2CKKA 1UGQB 2RB6A 4FYXB 2XDBA 4IURA 3M9QA 3JCMV 5A0DA 1K0SA 1Q7YR 2RN8A 2JTEA 2M16A 2PVGB 3NFCA 3M55A 1BIAA 3R6OA 4M75C 2JVVA 1QWFA 2DAQA 3FLGA 4DOVA 4Y92A 2QDYB 1EX4A 2CP7A 1N8RC 4C0ZA 3CCQT 1W2BP 2K57A 1G3WA 4E2FB 3JB9G 2FYKA 2I2LA 2VGMA 4XU3A 1CSKA 1U8RA 5GAN5 2DXTA 3X28B 1VQ5Q 3RERA 4PFPA 4C8QF 1QVFP 2H3EB 1FWZA 4F16A 2ECZA 2QEXT 4M78G 4X9DA 2C0OA 2AZVA 2LX9A 3JCMP 3OYBA 3HTRA 2Z0WA 1E6GA 4JZ4A 2DKGA 5LL6S 1KFZA
chains in the Genus database with same CATH topology
1WIEA 2YSQA 1NG2A 1WA7A 1SPKA 4AFQC 3EGUA 1PWTA 1OPKA 5GJVB 2CT3A 2EYZA 2ROLA 4AG1C 4Z89A 5IXBA 2KE9A 2FO0A 4LUEA 1K0XA 2GBQA 1OV3A 2ESWA 2DJQA 2EYXA 1VA7A 2GTJA 3M0SA 4HCKA 3KFVA 2ENMA 1T3SA 2A08A 2ROTA 1CKAA 4F14A 3VRYA 4CC3A 2V1RA 2VVKA 4DEXA 2K7AA 4RTXA 2D1XA 2DLPA 1GCQA 1WYXA 3NHNA 1AD5A 1OOTA 1T3LA 2DA9A 2KT8A 2GGRA 1TUDA 3TSWA 1KSWA 1MV0B 1E7OA 2DX1A 1NYGA 3EHQA 4JPBW 3EG3A 2J6OA 4FSSA 3R6NA 2LX7A 5I22A 2RQVA 2DMOA 2KRSA 2LMJA 1AVZC 4J9IA 2GQIA 2BZYA 2DILA 1GRIA 4LE9A 5GJWB 1NLOC 1SHFA 1VYVA 1RLPC 2L3QA 4OMNA 1OPLA 1N5ZA 1PHTA 1PKTA 2CREA 2HBWA 2W0ZA 2AK5A 2KEAA 2PZ1A 2K79A 4AFSC 2YUNA 1FYNA 5IHKA 1X2KA 1PRLC 1G2BA 2CSIA 4RTYA 3VS5A 1KJWA 2VKNA 1JXMA 2JM8A 2BZ8A 3M0QA 5IH2A 1M3AA 4D8KA 1BK2A 3UA6A 1YP5A 2LZ6B 1QKXA 3VS6A 2RPNA 4AG2C 1UJ0A 2JMCA 2SRCA 2C0IA 1UHCA 1H8KA 2QDLA 1UUEA 2DF6A 2PNIA 1QWEA 1YWPA 2LCSA 4K11A 2FEIA 3UF4A 4OMLA 1ABQA 1JQQA 4Z88A 2CH4A 1I0CA 2XMFA 2DM1A 4JJDA 4EIKA 2FG0A 2EPDA 2L2PA 1I07A 1X69A 3VS4A 3VS3A 2BZXA 5IXFA 1ZUKA 1QKWA 4RTVA 3JV3A 4F17A 2HDAA 2D8HA 1VYTA 1U3OA 4IIMA 1UG1A 1MV3A 2OAWA 1H3HA 1WFWA 2LP5A 1U06A 2A37A 1B07A 4HVVA 3LH5A 1PKSA 2LJ3A 2CUDA 2O2OA 4J9FA 3H0HA 3A98A 2F2XA 1UGVA 3REAB 1RLQC 1X2QA 1W1FA 2RQTA 3NPFA 2O88A 2LJ0A 2EW3A 5I11A 1K76A 3PE0A 4DEYA 2DE0X 4J9CA 1BBZA 3H41A 3M0TA 2DBMA 2AKKA 2J05A 2CSQA 4D8DA 1M8MA 1X6GA 2CUBA 1UJYA 1OEBA 2M51A 5FWCA 4HXJA 2KYMA 3VS7A 5EC7A 2LQNA 3I5SA 2ED0A 1SHGA 2LJ1A 4AFUC 3ZL7C 4RTZA 4JJBA 1G83A 5FW9A 2RQRA 2J06A 4JZ3A 1H92A 2D8JA 1KIKA 3QWYA 1SSHA 1HD3A 1WX6A 3IQLA 4CC7A 5IHIA 1ZLMA 2GNCA 3I9QA 3THKA 1Z9ZA 4J9BA 2K9GA 2P4RA 1UHFA 3REBB 2ABLA 2MCNA 3TVTA 2EGCA 2EQIA 1K1ZA 1GL5A 4LNPA 2RQUA 1ARKA 4HVUA 4OMPA 3EG0A 1K4US 2D0NA 5FWBA 2I0NA 3UATA 2GTOA 4KRTA 1B3QA 2JXBA 2FPDA 3EG2A 1NLPC 1W70A 2YUPA 1T0HA 1BU1A 1QLYA 3M0RA 4J9HA 1M30A 4CC2A 2KXDA 1WI7A 2DL3A 2O9VA 2OI3A 1Y57A 2HCKA 2YDLA 3UA7A 2YUOA 2JMAA 1WXBA 1BB9A 2EYYA 2RMOA 1JXOA 2FPFA 1YWOA 2KGTA 1AWJA 2JT4A 2MIOA 2K3BA 2K6DA 1ABOA 3H0FA 5HCKA 2F2WA 2L3PA 1RUWA 1ZSGA 2DVJA 1U5SA 1W6XA 2E5KA 4OMOA 2PTKA 1TUCA 3PVLA 1GFDA 3VS0A 3CQTA 2DYBA 1M3CA 1UDLA 2CH4W 1M27C 1J3TA 2KNBB 2V1QA 3VS1A 3ULRB 2G6FX 3I35A 1HJDA 2NUZA 1UTIA 1Z9QA 2X3WD 1GBRA 1NEGA 3FJ5A 2KR3A 2YUQA 2H8HA 1IO6A 4X1VA 1RI9A 3VS2A 2AKLA 1VYUA 2RNAA 1NEBA 2LNHB 1NYFA 4CC4B 4QT7A 3PVQA 4LN2A 1QCFA 3GBQA 4E6RA 1V1CA 1GCPA 4HVWA 2A36A 1SRMA 2AZSA 2EYWA 2EKHA 4RTTA 1FMKA 2EVRA 2KRMA 3SHWA 1A0NB 1T0JA 1UECA 2DNUA 2M0YA 2SEMA 2EGEA 2J6KA 3NMZC 1GBQA 3SEMA 2KT1A 1XOVA 3M0PA 1AZEA 2A28A 1ZX6A 4RTWA 2J7IA 1HSQA 2KYBA 1I1JA 4A63B 5L23A 2F2VA 1AEYA 1TG0A 4ORZA 1AWWA 2LQWA 2DL7A 4LUDA 1M3BA 1ZUUA 4JJCA 2HSPA 1WXUA 2BTTA 3I5RA 1GFCA 4AFZC 2DRKA 3C0CA 4J9GA 1NM7A 2X3XD 2DL8A 2NWMA 1WDXA 1SRLA 2KROA 2DRMA 2JS2A 2JM9A 2EGAA 3NGPA 3EHRA 4RTUA 2YT6A 2HEQA 1MUZA 2ED1A 4OMQA 2DL5A 4R0KA 4ZNXA 1LCKA 4M4ZA 2DBKA 1YNZA 1UE9A 4GBQA 1AWXA 1Y0MA 1AWOA 1CKBA 1GCQC 2O31A 5IHNA 1AZGB 1X6BA 1X27A 1AOJA 5ECAA 2FPEA 3M0UA 1YCSB 1JU5C 1PNJA 2B86A 3H0IA 2OJ2A 2L0AA 1K0SA 2CT4A 4GLMA 1YN8A 2RN8A 2JTEA 2IIMA 3VRZA 1S1NA 2MOXA 1X43A 1SEMA 2DL4A 2L3SA 2RQWA 1QWFA 4OMMA 2W10A 3QWXX 3EG1A 4Y92A 1E6HA 1EFNA 3RNJA 2KXCA 2O9SA 2K2MA 2VWFA 2EBPA 1CSKA 3RBBB 2JW4A 2RF0A 4IIOA 2CDTA 4ESRA 2FRWA 1JEGA 4WCIA 4F16A 1WXTA 2ECZA 3O5ZA 2KRNA 1K9AA 1ZBJA 2JS0A 1JO8A 4Z8AA 1WLPB 4J9EA 2C0OA 2AZVA 2FRYA 2J6FA 2KBTA 1PRMC 1ZUYA 1UFFA 4RUGA 3U23A 1E6GA 2C0TA 4JZ4A 4J9DA 3TSZA 1KFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIE A;  2YSQ A;  1NG2 A;  1WA7 A;  1SPK A;  4AFQ C;  3EGU A;  1PWT A;  1OPK A;  5GJV B;  2CT3 A;  2EYZ A;  2ROL A;  4AG1 C;  4Z89 A;  5IXB A;  2KE9 A;  2FO0 A;  4LUE A;  1K0X A;  2GBQ A;  1OV3 A;  2ESW A;  2DJQ A;  2EYX A;  1VA7 A;  2GTJ A;  3M0S A;  4HCK A;  3KFV A;  2ENM A;  1T3S A;  2A08 A;  2ROT A;  1CKA A;  4F14 A;  3VRY A;  4CC3 A;  2V1R A;  2VVK A;  4DEX A;  2K7A A;  4RTX A;  2D1X A;  2DLP A;  1GCQ A;  1WYX A;  3NHN A;  1AD5 A;  1OOT A;  1T3L A;  2DA9 A;  2KT8 A;  2GGR A;  1TUD A;  3TSW A;  1KSW A;  1MV0 B;  1E7O A;  2DX1 A;  1NYG A;  3EHQ A;  4JPB W;  3EG3 A;  2J6O A;  4FSS A;  3R6N A;  2LX7 A;  5I22 A;  2RQV A;  2DMO A;  2KRS A;  2LMJ A;  1AVZ C;  4J9I A;  2GQI A;  2BZY A;  2DIL A;  1GRI A;  4LE9 A;  5GJW B;  1NLO C;  1SHF A;  1VYV A;  1RLP C;  2L3Q A;  4OMN A;  1OPL A;  1N5Z A;  1PHT A;  1PKT A;  2CRE A;  2HBW A;  2W0Z A;  2AK5 A;  2KEA A;  2PZ1 A;  2K79 A;  4AFS C;  2YUN A;  1FYN A;  5IHK A;  1X2K A;  1PRL C;  1G2B A;  2CSI A;  4RTY A;  3VS5 A;  1KJW A;  2VKN A;  1JXM A;  2JM8 A;  2BZ8 A;  3M0Q A;  5IH2 A;  1M3A A;  4D8K A;  1BK2 A;  3UA6 A;  1YP5 A;  2LZ6 B;  1QKX A;  3VS6 A;  2RPN A;  4AG2 C;  1UJ0 A;  2JMC A;  2SRC A;  2C0I A;  1UHC A;  1H8K A;  2QDL A;  1UUE A;  2DF6 A;  2PNI A;  1QWE A;  1YWP A;  2LCS A;  4K11 A;  2FEI A;  3UF4 A;  4OML A;  1ABQ A;  1JQQ A;  4Z88 A;  2CH4 A;  1I0C A;  2XMF A;  2DM1 A;  4JJD A;  4EIK A;  2FG0 A;  2EPD A;  2L2P A;  1I07 A;  1X69 A;  3VS4 A;  3VS3 A;  2BZX A;  5IXF A;  1ZUK A;  1QKW A;  4RTV A;  3JV3 A;  4F17 A;  2HDA A;  2D8H A;  1VYT A;  1U3O A;  4IIM A;  1UG1 A;  1MV3 A;  2OAW A;  1H3H A;  1WFW A;  2LP5 A;  1U06 A;  2A37 A;  1B07 A;  4HVV A;  3LH5 A;  1PKS A;  2LJ3 A;  2CUD A;  2O2O A;  4J9F A;  3H0H A;  3A98 A;  2F2X A;  1UGV A;  3REA B;  1RLQ C;  1X2Q A;  1W1F A;  2RQT A;  3NPF A;  2O88 A;  2LJ0 A;  2EW3 A;  5I11 A;  1K76 A;  3PE0 A;  4DEY A;  2DE0 X;  4J9C A;  1BBZ A;  3H41 A;  3M0T A;  2DBM A;  2AKK A;  2J05 A;  2CSQ A;  4D8D A;  1M8M A;  1X6G A;  2CUB A;  1UJY A;  1OEB A;  2M51 A;  5FWC A;  4HXJ A;  2KYM A;  3VS7 A;  5EC7 A;  2LQN A;  3I5S A;  2ED0 A;  1SHG A;  2LJ1 A;  4AFU C;  3ZL7 C;  4RTZ A;  4JJB A;  1G83 A;  5FW9 A;  2RQR A;  2J06 A;  4JZ3 A;  1H92 A;  2D8J A;  1KIK A;  3QWY A;  1SSH A;  1HD3 A;  1WX6 A;  3IQL A;  4CC7 A;  5IHI A;  1ZLM A;  2GNC A;  3I9Q A;  3THK A;  1Z9Z A;  4J9B A;  2K9G A;  2P4R A;  1UHF A;  3REB B;  2ABL A;  2MCN A;  3TVT A;  2EGC A;  2EQI A;  1K1Z A;  1GL5 A;  4LNP A;  2RQU A;  1ARK A;  4HVU A;  4OMP A;  3EG0 A;  1K4U S;  2D0N A;  5FWB A;  2I0N A;  3UAT A;  2GTO A;  4KRT A;  1B3Q A;  2JXB A;  2FPD A;  3EG2 A;  1NLP C;  1W70 A;  2YUP A;  1T0H A;  1BU1 A;  1QLY A;  3M0R A;  4J9H A;  1M30 A;  4CC2 A;  2KXD A;  1WI7 A;  2DL3 A;  2O9V A;  2OI3 A;  1Y57 A;  2HCK A;  2YDL A;  3UA7 A;  2YUO A;  2JMA A;  1WXB A;  1BB9 A;  2EYY A;  2RMO A;  1JXO A;  2FPF A;  1YWO A;  2KGT A;  1AWJ A;  2JT4 A;  2MIO A;  2K3B A;  2K6D A;  1ABO A;  3H0F A;  5HCK A;  2F2W A;  2L3P A;  1RUW A;  1ZSG A;  2DVJ A;  1U5S A;  1W6X A;  2E5K A;  4OMO A;  2PTK A;  1TUC A;  3PVL A;  1GFD A;  3VS0 A;  3CQT A;  2DYB A;  1M3C A;  1UDL A;  2CH4 W;  1M27 C;  1J3T A;  2KNB B;  2V1Q A;  3VS1 A;  3ULR B;  2G6F X;  3I35 A;  1HJD A;  2NUZ A;  1UTI A;  1Z9Q A;  2X3W D;  1GBR A;  1NEG A;  3FJ5 A;  2KR3 A;  2YUQ A;  2H8H A;  1IO6 A;  4X1V A;  1RI9 A;  3VS2 A;  2AKL A;  1VYU A;  2RNA A;  1NEB A;  2LNH B;  1NYF A;  4CC4 B;  4QT7 A;  3PVQ A;  4LN2 A;  1QCF A;  3GBQ A;  4E6R A;  1V1C A;  1GCP A;  4HVW A;  2A36 A;  1SRM A;  2AZS A;  2EYW A;  2EKH A;  4RTT A;  1FMK A;  2EVR A;  2KRM A;  3SHW A;  1A0N B;  1T0J A;  1UEC A;  2DNU A;  2M0Y A;  2SEM A;  2EGE A;  2J6K A;  3NMZ C;  1GBQ A;  3SEM A;  2KT1 A;  1XOV A;  3M0P A;  1AZE A;  2A28 A;  1ZX6 A;  4RTW A;  2J7I A;  1HSQ A;  2KYB A;  1I1J A;  4A63 B;  5L23 A;  2F2V A;  1AEY A;  1TG0 A;  4ORZ A;  1AWW A;  2LQW A;  2DL7 A;  4LUD A;  1M3B A;  1ZUU A;  4JJC A;  2HSP A;  1WXU A;  2BTT A;  3I5R A;  1GFC A;  4AFZ C;  2DRK A;  3C0C A;  4J9G A;  1NM7 A;  2X3X D;  2DL8 A;  2NWM A;  1WDX A;  1SRL A;  2KRO A;  2DRM A;  2JS2 A;  2JM9 A;  2EGA A;  3NGP A;  3EHR A;  4RTU A;  2YT6 A;  2HEQ A;  1MUZ A;  2ED1 A;  4OMQ A;  2DL5 A;  4R0K A;  4ZNX A;  1LCK A;  4M4Z A;  2DBK A;  1YNZ A;  1UE9 A;  4GBQ A;  1AWX A;  1Y0M A;  1AWO A;  1CKB A;  1GCQ C;  2O31 A;  5IHN A;  1AZG B;  1X6B A;  1X27 A;  1AOJ A;  5ECA A;  2FPE A;  3M0U A;  1YCS B;  1JU5 C;  1PNJ A;  2B86 A;  3H0I A;  2OJ2 A;  2L0A A;  1K0S A;  2CT4 A;  4GLM A;  1YN8 A;  2RN8 A;  2JTE A;  2IIM A;  3VRZ A;  1S1N A;  2MOX A;  1X43 A;  1SEM A;  2DL4 A;  2L3S A;  2RQW A;  1QWF A;  4OMM A;  2W10 A;  3QWX X;  3EG1 A;  4Y92 A;  1E6H A;  1EFN A;  3RNJ A;  2KXC A;  2O9S A;  2K2M A;  2VWF A;  2EBP A;  1CSK A;  3RBB B;  2JW4 A;  2RF0 A;  4IIO A;  2CDT A;  4ESR A;  2FRW A;  1JEG A;  4WCI A;  4F16 A;  1WXT A;  2ECZ A;  3O5Z A;  2KRN A;  1K9A A;  1ZBJ A;  2JS0 A;  1JO8 A;  4Z8A A;  1WLP B;  4J9E A;  2C0O A;  2AZV A;  2FRY A;  2J6F A;  2KBT A;  1PRM C;  1ZUY A;  1UFF A;  4RUG A;  3U23 A;  1E6G A;  2C0T A;  4JZ4 A;  4J9D A;  3TSZ A;  1KFZ A; 
#chains in the Genus database with same CATH topology
 1WIE A;  3VV0 A;  5A0G A;  1NG2 A;  1WA7 A;  4ZGD B;  5KYY A;  1W2B A;  4C8Q A;  1OPK A;  3CCU A;  5I2M A;  2EYZ A;  2V8K A;  3PIP A;  5KYN A;  5IXB A;  4JLI A;  1OZ2 A;  2FO0 A;  4MDX A;  3G71 T;  1VQP T;  4HCK A;  1VQN Q;  4ANJ A;  5GAN f;  3JB9 I;  2A08 A;  3VRY A;  4CC3 A;  1MMG A;  4BI3 A;  4DEX A;  1M90 C;  2K7A A;  1W4S A;  3OA6 A;  4PKC C;  3EG9 A;  2E1H A;  5D7U A;  1AD5 A;  3ZFJ A;  2KT8 A;  1KSW A;  5CKH A;  3FC3 A;  4PFZ A;  4FU6 A;  1B7T A;  4J6X A;  1NJI R;  5A2Q E;  3EG3 A;  4GLK A;  4FSS A;  3V8K A;  3H9N A;  4IUP A;  5LJ3 e;  2DMO A;  4M75 A;  4A4G A;  3I55 T;  4PJJ A;  1OUL A;  5IAY A;  2DIL A;  1WQW A;  1VQ7 A;  2FZK B;  1RLP C;  4OMN A;  1VQ5 T;  4BD3 A;  1PHT A;  2CRE A;  2OAU A;  4IUV A;  1QCN A;  3CCV A;  3NTH A;  2KEA A;  3HKS A;  2D0Q B;  2K79 A;  3CME T;  2YUN A;  5A0L A;  2MF2 A;  5IHK A;  1XQH A;  3RKX A;  1X2K A;  2CSI A;  1OU8 A;  3OS1 A;  4J6Y A;  3VS5 A;  1VQ6 Q;  2VKN A;  1JXM A;  2BZ8 A;  4A54 A;  4F7U E;  3CC2 T;  3TQ7 P;  4D8K A;  1B34 A;  5FU6 B;  5GMK e;  2HL3 A;  2QXF A;  1QKX A;  4ZN3 A;  2RPN A;  4AG2 C;  4OB0 B;  3QG1 A;  4PJO G;  3VU3 C;  4J7I A;  2LT4 A;  2X35 A;  1VQN T;  2LCS A;  1QMC A;  4K11 A;  2LNV A;  4RG2 A;  3TU4 K;  4OML A;  2VUB A;  3X24 B;  5D6Y A;  1I0C A;  2FG0 A;  1Q81 C;  4MZT A;  3OYD A;  3CCR A;  2L2P A;  4AT1 B;  2X4Y A;  5KE2 A;  1QKW A;  1Q82 U;  3BE3 A;  3A8L B;  2HDA A;  1VYT A;  2QA4 A;  4M7D C;  4JS4 A;  4PJM A;  2CS7 A;  4FT4 A;  1YJN Q;  1MV3 A;  4WTO B;  2A37 A;  2E65 A;  2R57 A;  3MEA A;  3ZEH A;  1HXD A;  3A98 A;  2WSE E;  3H8Z A;  3MP6 A;  1M1F A;  3JCM b;  2CZ1 B;  2O88 A;  1IB8 A;  2CZ0 B;  5I11 A;  2DXC A;  3PE0 A;  5KCO A;  2FB7 A;  1VQK A;  4FYV B;  2DE0 X;  1M1K C;  3H41 A;  4HCZ A;  2AKK A;  2J05 A;  1M8M A;  1X6G A;  4OF1 A;  4BI8 B;  2KYM A;  3VS7 A;  1M90 R;  4A4E A;  5EC7 A;  2LQN A;  3C94 A;  3SWN C;  1K73 U;  1PM3 A;  4Q5W A;  4LDV A;  2KY9 A;  2NUP B;  1G83 A;  4QQD A;  1WX6 A;  3QHS A;  3H6Z A;  3QZ9 B;  5IHI A;  3GNG A;  1ZSZ C;  3G1J A;  4J9B A;  1TS9 A;  4M7D F;  3EGX A;  1RAD B;  2HKN A;  2P4R A;  4M7A D;  4XU2 A;  2WSC E;  2ZGW A;  2M9U A;  3OYI A;  4E7K A;  2HMA A;  5LJ5 f;  3OYA A;  3RKY A;  2EQI A;  2QEX A;  1K1Z A;  2RQU A;  1ARK A;  1MMD A;  2DFU A;  3QJY A;  4BDY A;  4OMP A;  3E2U A;  1VQ4 Q;  2BE9 B;  1K4U S;  4O6J A;  1DJ7 B;  3CCM Q;  5CCA A;  2ZPH B;  2KAF A;  1NLP C;  1WHK A;  1YJN T;  2DXB A;  4M7D A;  1JRI A;  1KQS S;  1QLY A;  4J9H A;  1M30 A;  2DZ9 A;  4M7A B;  1X75 C;  4XTU A;  2OI3 A;  2DTH A;  2QAS A;  1K9M U;  2QG9 B;  3G71 A;  3EFS A;  1VQP A;  2XG8 D;  3NTI A;  3MET A;  1WJR A;  4C5I A;  1YWO A;  1JJ2 S;  1AWJ A;  1MND A;  2K6D A;  1ABO A;  1OQK A;  4C92 F;  2COW A;  2DVJ A;  1W6X A;  1KHI A;  3PVL A;  3G4S T;  5CK9 A;  1UDL A;  2CH4 W;  1M9S A;  5GMK l;  4RG8 A;  1Q81 R;  2CZ6 B;  3ULR B;  5EG2 A;  2MMP A;  1XJW B;  2XDP A;  1HJD A;  1UTI A;  2X3W D;  1U1T A;  1NEG A;  1Y7X A;  3F70 A;  4B9W A;  4ELY C;  2YUQ A;  4QVZ A;  2H8H A;  3SWN A;  3HL8 A;  5HKC A;  3VS2 A;  1ZBX A;  1M2V B;  2RNA A;  1PG5 B;  2LNH B;  3NTK A;  4OB2 B;  2QGF B;  3ME9 A;  1BYM A;  3RMQ A;  4KH0 B;  1VQ5 A;  1WHM A;  1ZSZ A;  4FSX A;  4E6R A;  2RD1 A;  4HVW A;  5D6W A;  3CME A;  2EKH A;  3KXT A;  2EVR A;  5LJ5 j;  1UEC A;  1M5Q 1;  2EGE A;  2J6K A;  1ACM B;  5GAO l;  4R56 A;  3CCM T;  3CC2 A;  1RAH B;  4BY6 C;  1TSF A;  2K2V A;  1I1J A;  5LJ5 d;  4A63 B;  5L23 A;  2F2V A;  2M1H A;  3M5A A;  1M1K R;  4ORZ A;  2O4X A;  2DL7 A;  4Y28 E;  1M3B A;  5GAN 3;  1VQN A;  1YI2 Q;  2E12 A;  2CP0 A;  1TXQ A;  2DRM A;  5CKF A;  2JOY A;  1D1B A;  2JM9 A;  4C8Q G;  4JRP A;  4DBH A;  2DTI A;  2EJF A;  1AT1 B;  1Y71 A;  1RAF B;  4OMQ A;  2DEQ A;  1R0C B;  5I21 A;  1YHQ Q;  3HFN A;  3OQ5 A;  4M4Z A;  1YNZ A;  4E7I A;  4X34 A;  3L2Q A;  3J7A F;  1Q7Y C;  1PC0 A;  2RI5 A;  2Y4X A;  5CO7 A;  1KQS A;  1X27 A;  1RI0 A;  5AT1 B;  4HT8 A;  1WHG A;  1AOJ A;  2M02 A;  5ECA A;  2FPE A;  4IUU A;  1YCS B;  1PNJ A;  4EMH A;  4QVC A;  2EAY A;  4GLM A;  1JJ2 A;  2MPX C;  3VRZ A;  1S1N A;  8AT1 B;  2DXU A;  2IG0 A;  1SKU B;  2MOX A;  1X43 A;  2YXY A;  1SEM A;  4M75 G;  3CCS Q;  3TEE A;  2JZ2 A;  2ZPI B;  5LJ3 h;  1EFN A;  5LJ3 g;  2KXC A;  1VQ6 A;  2QGG A;  1VQ7 T;  5GAN 8;  2K2M A;  1QVG S;  2JW4 A;  3P8H A;  3QYH B;  4ZTF A;  2CDT A;  4KUI A;  1KC8 C;  2DZC A;  3E9F A;  8ATC B;  3T9N A;  2FRW A;  2LCL A;  3V8L A;  3LWH A;  3GPL A;  3O5Z A;  3PGG A;  2KRN A;  1ZBJ A;  3LH0 A;  3CC4 T;  1Q86 R;  1WLP B;  3OMC A;  1TUG B;  1V76 A;  2KBT A;  3JCM f;  2RHY A;  4NL3 A;  4IKF A;  1YI2 T;  3WVD B;  4XTX A;  1IHV A;  2QTV A;  2OTL Q;  2C0T A;  4DA4 A;  5LJ3 j;  3JB9 H;  2LQK A;  2YSQ A;  4UC4 A;  5GMK h;  4C8Q D;  2RA2 A;  5HK3 A;  5GJV B;  1MMN A;  2ROL A;  4Z89 A;  1YHQ T;  1M8V A;  3MCA B;  2A0F B;  3OW2 P;  1PD0 A;  4LUE A;  2DEU A;  2ESW A;  1NE8 A;  2EYX A;  1N9R A;  1VA7 A;  2GTJ A;  3KFV A;  2ENM A;  1T3S A;  4N4H A;  3OYY A;  4J7F A;  3G6E Q;  2V1R A;  4M77 D;  2VVK A;  1U1S A;  4RTX A;  2D1X A;  1YJN A;  1NJI C;  1ZA1 B;  4J5Y A;  3INZ A;  4RCC A;  2VXE A;  2KVQ G;  1OOT A;  1OX8 A;  4C8Q B;  4A53 A;  2B8A A;  3ER0 A;  1TUD A;  5GMK j;  4C0D C;  4C92 E;  2MAM A;  3A8G B;  3CC7 Q;  2M0O A;  1E7O A;  2DX1 A;  3R6N A;  4M77 B;  3CXC P;  4M75 D;  3VYH B;  1WJQ A;  2R58 A;  1GRI A;  5LJ5 e;  2LTO A;  4XU1 A;  1HYO A;  2E64 A;  1VYV A;  1N5Z A;  1R0B G;  1PKT A;  4N4G A;  4AFS C;  1VQK T;  1RL2 A;  3MP1 A;  5GAM j;  4KGZ B;  4KGX B;  4II1 A;  2DTO A;  2D6F A;  3EFO A;  1PRL C;  4RTY A;  4BAC A;  4M75 B;  1M2O A;  3M0Q A;  3QYG B;  1RAE B;  2ZPF B;  4XAX B;  2OTL T;  2DO3 A;  2F1L A;  3O8V A;  2V8J A;  5GAM d;  3CXC A;  2EIF A;  2NYS A;  2HL5 C;  1M1G A;  3HRS A;  1KQ1 A;  1M4Z A;  1UJ0 A;  2RJE A;  4FT2 A;  3JCM d;  2C0I A;  1H8K A;  2QDL A;  1WHH A;  2X51 A;  2PNI A;  3OYG A;  1QWE A;  1QVG A;  4FIB A;  2JNG A;  2MI6 A;  2FL7 A;  3UF4 A;  3CCM A;  3MO8 A;  1ABQ A;  3JCM X;  3OS2 A;  2XMF A;  2DM1 A;  2P0P A;  4JJD A;  4EIK A;  5CAI A;  3CPW S;  2EPD A;  1VIE A;  1I07 A;  3RR6 A;  3VS4 A;  4OMF B;  1IGU A;  4M7A E;  5KE3 A;  1QVP A;  4LD9 K;  3JV3 A;  3CC7 T;  4F17 A;  1KC8 R;  2D8H A;  4M7D G;  1U3O A;  3OYF A;  3GF5 A;  4XQ3 A;  5GAN 7;  4OP0 A;  3VYG A;  1WFW A;  1B07 A;  3LH5 A;  3LYI A;  3S3M A;  2CUD A;  3PFS A;  2JTM A;  1UGV A;  1LPL A;  1W1F A;  2LC4 A;  1YCY A;  1KD1 U;  3KUF A;  1FXX A;  2RQT A;  3NPF A;  2RJC A;  2RH2 A;  3BFM A;  2LJ0 A;  1C1A A;  3HPW A;  4DEY A;  2LVM A;  1UEB A;  2E6Z A;  1O75 A;  4J9C A;  2A7Y A;  2DBM A;  3J80 E;  1WJS A;  4D8D A;  2GQV A;  5AYF A;  4FCY A;  2CUB A;  2JJ9 A;  2M51 A;  2VB6 A;  2CP2 A;  2EQJ A;  3I5S A;  2DK3 A;  1Y96 B;  2MK5 A;  4AFU C;  4RTZ A;  3EGD B;  1Q82 R;  5FW9 A;  2RQR A;  1S72 Q;  3QSU A;  2D8J A;  1HD3 A;  3IQL A;  4CC7 A;  5C0M A;  4PLL A;  3LWI A;  1MGQ A;  3JB9 D;  2K9G A;  4EMK C;  2H3J A;  3REB B;  5KH6 A;  2MCN A;  3QDF A;  2HSE B;  3LGF A;  3RIR A;  3TVT A;  2F5K A;  3CC4 A;  4LNP A;  4M78 D;  3EG0 A;  4KUL A;  4JJN K;  1IXD A;  3UAT A;  1YI2 A;  1B3Q A;  2RK2 A;  3OSV A;  4F04 B;  3WVE B;  4DBR A;  1W70 A;  3EGX B;  4NL2 A;  2JUF A;  1IHW A;  3OYK A;  3M0R A;  3QBY A;  2KXD A;  2K3X A;  2RHI A;  1YHQ A;  2X4J A;  1Y57 A;  4XTW A;  4HCB A;  4E7J A;  2QQB A;  3HFO A;  3UPU A;  2JMA A;  4M78 B;  2LDM A;  3V7R A;  2OTJ Q;  1K73 R;  2EYY A;  1R77 A;  1JXO A;  5GAN j;  2FPF A;  2KGT A;  2JT4 A;  2K3B A;  2MWP A;  2WSF E;  1QW1 A;  3CCE Q;  1ZSG A;  3EFR A;  2VAS A;  5FU7 B;  3CBO A;  2QQR A;  1U5S A;  2E5K A;  5GAM e;  5GAN d;  2DIQ A;  3CQT A;  2DYB A;  3DKM A;  2CP6 A;  2KNB B;  4YTL A;  1MMA A;  1VQ8 Q;  2G6F X;  3OY9 A;  1FMV A;  3CCS A;  1YJ9 Q;  2NUT B;  3CCJ Q;  2ZAE A;  1XNI A;  1S72 T;  4X1V A;  1RI9 A;  2VYT A;  5DLQ E;  2PVO B;  2COZ A;  4A4F A;  1H3Z A;  1VQM Q;  1NYF A;  1G3S A;  4BE1 A;  3M4G A;  5CIU A;  1D0X A;  1WPY A;  2VXF A;  2E6N A;  5I2S A;  1K8A U;  3PVQ A;  1QCF A;  4EMK A;  1BCM A;  5DLO A;  4FL6 A;  4A4K A;  2AZS A;  1C6V X;  2EYW A;  3OMG A;  4IUQ A;  1K9M R;  4RTT A;  3I56 Q;  3OYN A;  1T0J A;  1VQ6 T;  2L5Q A;  2DNU A;  2M0Y A;  3SWN B;  4QVD A;  3QKJ A;  2DJZ A;  2QI2 A;  3OYC A;  3M0P A;  2QTX A;  2HD0 A;  2OTL A;  1HSQ A;  2KYB A;  1ZHI A;  4C92 C;  5GAO q;  1AEY A;  4PLI A;  4LUD A;  1TTH B;  2HSP A;  2KMT A;  1TH7 A;  4PJO D;  1WXU A;  2X3X D;  2OTJ T;  3DB4 A;  1WDX A;  4TVR A;  3G6E A;  3URG A;  4A4H A;  3CCE T;  4QKU A;  3C95 A;  4ATO A;  3QJ6 A;  4PNO A;  2O4X B;  2DPP B;  2DL5 A;  3OSS C;  4R0K A;  2F5T X;  1N6A A;  1LCK A;  3LW5 E;  4E7L A;  3S3N A;  1N8R U;  2YRD A;  1AWX A;  4PJO B;  3CC7 A;  4F7U G;  2C06 A;  1GCQ C;  2O31 A;  5CKE A;  5IHN A;  5KYU B;  3CCJ T;  1X6B A;  1VQO Q;  4C5H A;  2A3L A;  4KUD K;  1JU5 C;  2CP5 A;  2B86 A;  3H0I A;  4RKU E;  1H64 1;  2OJ2 A;  2EFI A;  4M77 E;  2RHU A;  2K5I A;  4GY5 A;  2L89 A;  2ZPG B;  2DD5 A;  2CT4 A;  1YIT Q;  4DBQ A;  3S6W A;  1N27 A;  3V7S A;  2L3R A;  3M58 A;  3FRN A;  2Y90 A;  2RQW A;  2W10 A;  3EG1 A;  5CKD A;  3VJP A;  2BIV A;  3OB9 A;  2WAC A;  3CBM A;  1Q86 C;  1BI3 A;  2QQ9 A;  3JSC A;  2VWF A;  1BCO A;  2EBP A;  1QQJ A;  3RBB B;  5LJ5 h;  4M7A C;  3L2Z A;  5LJ5 g;  3AHU A;  2DIG A;  3CD6 Q;  3AT1 B;  2P4T A;  4WCI A;  1WXT A;  1M90 U;  4C5E A;  1JO8 A;  3VUZ A;  4C92 A;  2FRY A;  3GLX A;  5IT9 E;  1VQL Q;  4LDW A;  4RUG A;  4Z02 A;  3U23 A;  1WHJ A;  2VC8 A;  1MNE A;  4J9D A;  3TSZ A;  3CCL Q;  1HK9 A;  5GAN e;  4BY6 B;  2QK0 A;  3JCM Q;  5J26 A;  3EAE A;  2IPO B;  1PSF A;  1D3B B;  5KCH A;  1PWT A;  1G3Y A;  2CT3 A;  4CRI A;  2EQU A;  2ATC B;  5IN1 A;  5GAN 2;  1VQ4 T;  2KE9 A;  1NZ9 A;  1K0X A;  2EWN A;  2GBQ A;  2DJQ A;  1NBE B;  4O5V A;  2ROT A;  1CKA A;  2HQX A;  3MEU A;  1RAA B;  3RUX A;  1VQO T;  2DLP A;  2NUP A;  3CBP A;  1GCQ A;  4PK4 A;  1WYX A;  2PUK B;  2QAZ A;  1PSE A;  1T3L A;  1KQS P;  3UWN A;  1YJW Q;  2DA9 A;  3BY7 A;  3BDL A;  3TSW A;  1YIT T;  3GOX A;  4M7A F;  3A8M B;  2ZZD A;  4X9C A;  2PUO B;  4JPB W;  2J6O A;  1VUB A;  2LX7 A;  5KYX B;  1JJ2 P;  4F7U B;  5KYW B;  1IZ6 A;  2KRS A;  2LMJ A;  1AVZ C;  4PJL A;  2GQI A;  2OX7 A;  2BZY A;  5FRM A;  5GJW B;  1OI1 A;  1OU9 A;  1SHF A;  1WZO A;  3BDU A;  3G7Z A;  3CEY A;  1FX7 A;  1OPL A;  2HBW A;  2W0Z A;  3CD6 T;  4JRQ A;  3OS0 A;  4M7A A;  7AT1 B;  2PZ1 A;  4EDU A;  2YWW A;  4LXC A;  1Q81 U;  1S72 A;  1G2B A;  1VQL T;  3FIF A;  2KQW A;  3M54 A;  2ZPE B;  3UA6 A;  5M9O A;  2LZ6 B;  3PMT A;  3SFM A;  1UGS B;  1X6O A;  3M53 A;  5FRO A;  3HRT A;  2V26 A;  2IVW A;  3EFO B;  2DF6 A;  2R5A A;  2GCX A;  2XHC A;  2QA4 Q;  4Z88 A;  3A8O B;  2CH4 A;  4JLG A;  5CKB A;  3ASK A;  2HBP A;  1YIJ Q;  1RAB B;  4LDU A;  2RK1 A;  1X69 A;  5GAO n;  1M2V A;  3VS3 A;  5GAN 4;  2BZX A;  1YJW T;  1M1K U;  2X4W A;  1ZUK A;  2BKD N;  2OTJ A;  4BB7 A;  1LJO A;  5HY6 A;  3V8J A;  4IIM A;  2COY A;  4V2S A;  4M78 E;  3CCE A;  3HHT B;  1H3H A;  1PKS A;  4L59 A;  4BI4 A;  3PNW C;  2F2X A;  3REA B;  1X2Q A;  2EJG A;  2QQA A;  2EQK A;  3E19 A;  4KH1 B;  5GAN 6;  1VQ8 A;  3LX7 A;  3LGL A;  1YJ9 A;  2EW3 A;  4C0D B;  3CCJ A;  1VOM A;  4HA8 A;  3OS5 A;  2EJ9 A;  1W2B S;  2CZ7 B;  5KYY B;  4MML A;  3M0T A;  1Q82 C;  4PJN A;  4CI0 C;  5GAM h;  3CCQ Q;  1QVF S;  4HXJ A;  3M4Y A;  5GAM g;  2P0Q A;  3QII A;  4DBF A;  3CCS T;  4LDX A;  2ED0 A;  1SHG A;  2LJ1 A;  3JCM h;  4QQG A;  3JCM W;  3C12 A;  4E7H A;  2K5F A;  4J8O A;  1F1B B;  4JJB A;  3PIO A;  4XTZ A;  2AHJ B;  1G5V A;  2J06 A;  4IUT A;  4JZ3 A;  1H92 A;  3DLL A;  2DER A;  3EG9 B;  1KIK A;  5L8R E;  1ZLM A;  2XD0 A;  2GNC A;  4DOW A;  1N9S A;  1YIJ T;  2RHZ A;  3EH2 A;  1QVG P;  1KG1 A;  2ABL A;  1TOV A;  3QDR B;  4LD6 A;  1KD1 R;  4HVU A;  3MP8 A;  2FHD A;  2D0N A;  3MHX A;  4FW1 A;  4KRT A;  1BI0 A;  2JXB A;  4M77 C;  3OYE A;  1K73 C;  3M59 A;  3L2U A;  1UB4 A;  3JCM c;  1T0H A;  1BU1 A;  4C0G A;  2YRC A;  1WI7 A;  4KBM B;  1VQ4 A;  2YDL A;  1C0M A;  2F69 A;  2YUO A;  1WXB A;  3DB3 A;  3G6E T;  5HCK A;  2MIO A;  3H0F A;  3CMA Q;  3N5B B;  2CYZ B;  4PJO E;  1D1A A;  2F2W A;  1B34 B;  2L3P A;  1VQO A;  4N0A C;  3S3O A;  1RUW A;  3QO3 A;  3I55 Q;  2PTK A;  3Q1J A;  4P5N A;  3P8B B;  1GFD A;  2QQS A;  5DY9 A;  3QZ5 B;  1YIT A;  4RMO A;  1M27 C;  1J3T A;  2V1Q A;  3C4S A;  2GFA A;  2XK0 A;  3ZBD A;  1ZA2 B;  3FDR A;  1Z9Q A;  3FJ5 A;  1RAC B;  3CME Q;  2KR3 A;  3TRE A;  1IO6 A;  1K9M C;  2AKL A;  4MMK A;  2RO0 A;  1NEB A;  4N4I A;  5HK0 A;  3CC2 Q;  4M77 F;  2LQ8 A;  4FM4 B;  2DET A;  3CD6 A;  1V1C A;  1D0Z A;  1EZZ B;  2HQH A;  2JTF A;  3QUI A;  5FRN A;  1YBY A;  1Y07 A;  2HZY A;  2KRM A;  1A0N B;  1VQL A;  1GBQ A;  3SEM A;  1FMW A;  1QVF A;  2D9T A;  1AZE A;  1G8X A;  1ZX6 A;  4RTW A;  3MEV A;  2J7I A;  4QW2 A;  3HRU A;  3CCL A;  4M77 A;  3L42 A;  1R8O B;  4M75 F;  4C92 G;  1Q7Y U;  3OBW A;  4QQ6 A;  2LQW A;  4EMK B;  1AWW A;  1ZUU A;  2EKO A;  4JJC A;  2BTT A;  3I5R A;  1GFC A;  1LNX A;  4AFZ C;  2DRK A;  4J9G A;  4EPC A;  4LDY A;  2DL8 A;  1SRL A;  2KRO A;  3CMA T;  1V29 B;  2FZG B;  3J81 E;  3UT1 A;  4RTU A;  3FEO A;  1P92 A;  2HEQ A;  1MUZ A;  2ED1 A;  4L5G A;  1MHN A;  5GAN h;  4N0A A;  3CPW P;  1QP2 A;  2NLU A;  5GAN g;  1K8A R;  2X9H A;  1YJW A;  2XU8 A;  4FW2 A;  3TCJ A;  2GF7 A;  2EYQ A;  2RI3 A;  3RKW A;  4AMC A;  4XTY A;  4M7D D;  1KC8 U;  4E7Z A;  3M0U A;  1BIB A;  4XTV A;  1WNL A;  3MJX A;  4OB3 B;  3UDC A;  4ZN1 A;  2L0A A;  2RM4 A;  1YN8 A;  2ZCF B;  3M56 A;  4J83 A;  2IIM A;  3A8H B;  2DD4 A;  3CPW A;  4ME7 A;  5C6S A;  2DL4 A;  2YLB A;  2L3S A;  3X26 B;  4OMM A;  3QWX X;  1E6H A;  4M7D B;  3D7S B;  3RNJ A;  3RES A;  2RJF A;  5FU6 C;  4B9X A;  2PU9 B;  3BW1 A;  2O9S A;  2PQW A;  2KI7 A;  1NPP A;  2RF0 A;  4C5G A;  4ZGE B;  4M7A G;  4IIO A;  2CP3 A;  3JCM e;  4PFO A;  4ESR A;  1JEG A;  1KHC A;  1K9A A;  1IRX A;  4C92 D;  1OZ3 A;  2JS0 A;  4Z8A A;  1BI2 A;  4J9E A;  1N8R R;  1NJI U;  4M78 C;  2J6F A;  2DVE A;  1BKB A;  1PRM C;  3A1P A;  1ZUY A;  1UFF A;  1D09 B;  3SB2 A;  4BDZ A;  5FU7 C;  1YIJ A;  1SPK A;  4AFQ C;  3GNF B;  3MPU B;  3JRZ A;  3EGU A;  1UGP B;  1VQ9 Q;  4AG1 C;  5D6X A;  4C92 B;  3JCM J;  2LRQ A;  1KQ2 A;  1OV3 A;  3PTA A;  3X20 B;  3M0S A;  3FJP A;  4F14 A;  1X01 A;  1Y96 A;  1SSF A;  1ZSZ B;  3EGD A;  2MYS A;  5CQY A;  3NHN A;  3L2R A;  2XIC A;  3E1S A;  3OYM A;  1I5O B;  3JB9 F;  2GGR A;  3OBY A;  2RHX A;  3G4S Q;  1MV0 B;  3V7C A;  2E3I A;  4B6M A;  1NYG A;  4BUG A;  3EHQ A;  2PVD B;  3KBG A;  5I22 A;  2RI2 A;  1SF9 A;  2RQV A;  4M78 F;  1TWB A;  2HAX A;  4J9I A;  2GFU A;  4LE9 A;  3CCQ A;  1NLO C;  2L3Q A;  3OYH A;  4C8Q E;  3SDZ A;  1VQ8 T;  3VUB A;  2AK5 A;  1YJ9 T;  2LT1 A;  4JDS A;  1TU0 B;  2KDS A;  1RAG B;  3QPH A;  5FLX E;  2K5L A;  1FYN A;  1KJW A;  2E41 A;  1VQM T;  4KT0 E;  4M78 A;  2JM8 A;  5IH2 A;  1UGR B;  3QXE B;  1M3A A;  4J6W A;  1BK2 A;  2FZC B;  4BE0 A;  1YP5 A;  1I81 A;  2RJD A;  1PCX A;  3VS6 A;  3I56 T;  3RDV A;  2JMC A;  1VQ9 T;  2SRC A;  4PJO C;  2V8I A;  1UHC A;  3MEW A;  3A5Z B;  2K3Y A;  1UUE A;  5J39 A;  1YWP A;  2XI9 A;  4JRI A;  2FEI A;  1JQQ A;  4M75 E;  3GIB A;  2NUT A;  4ZGJ B;  4HCC A;  3CCU Q;  2XDD A;  2YHT A;  5IXF A;  4R55 A;  4RCB A;  4RTV A;  1RAI B;  1VIF A;  3CMA A;  2XKO C;  1UG1 A;  1OYX A;  4XK8 E;  2OAW A;  2LP5 A;  1U06 A;  2VV5 A;  4HVV A;  2LJ3 A;  3HP9 A;  3I55 A;  2E10 A;  2O2O A;  4J9F A;  3H0H A;  1RLQ C;  2E70 A;  1D1C A;  1WGS A;  4HKE A;  1I8F A;  4L6V 5;  3CPF A;  3EH1 A;  5GMK i;  5CQX A;  1K76 A;  1QCO A;  2E5Q A;  4PJO F;  4FYY B;  1BBZ A;  2CSQ A;  2YLC A;  1UJY A;  3JAM E;  1G3T A;  1VQ7 Q;  1OEB A;  5FWC A;  1QP3 A;  2K4Y A;  3CCV Q;  4JRK A;  3M57 A;  4XU0 A;  2P0K A;  3ZL7 C;  3JB9 J;  1ZQ1 A;  3WXM B;  3X25 B;  3CC4 Q;  4BE2 A;  1KK7 A;  3QWY A;  4PJO A;  1SSH A;  1KD1 C;  5LJ3 f;  3I9Q A;  3THK A;  5KYU A;  1Z9Z A;  2ZPB B;  1UHF A;  2MWO A;  4C0F A;  2EGC A;  3CCU T;  3OW2 S;  2G3R A;  3FB9 A;  1GL5 A;  1SG5 A;  2AT1 B;  3LLR A;  3GP8 A;  5FWB A;  2I0N A;  2GTO A;  3MKD A;  2E3H A;  4M77 G;  2FPD A;  2HQE A;  3EG2 A;  2P84 A;  3CCL T;  2YUP A;  4MZP A;  1IGQ A;  5CVI A;  3E9G A;  2XID A;  3CCR Q;  1LOJ A;  4CC2 A;  4OGC A;  2EQM A;  2DL3 A;  2O9V A;  2R5M A;  2VGN A;  4PL6 A;  4D6W A;  2HCK A;  3UA7 A;  3L1A A;  1GXI E;  5DM7 R;  4OB1 B;  1BB9 A;  2RMO A;  2BE7 D;  2CGH A;  3RMS A;  3CXC S;  5GAO r;  3P8D A;  1YFN A;  2FVU A;  1D0Y A;  4KGV B;  2LCC A;  4HT9 A;  4OMO A;  3DLM A;  1LVK A;  1TUC A;  3VS0 A;  4OGE A;  4OVA A;  1M3C A;  9ATC B;  3L2W A;  2KK4 A;  3VS1 A;  4E7S A;  3CCV T;  2AIR B;  2X4X A;  3I35 A;  2NUZ A;  1D3B A;  5GAM f;  4ZTJ A;  1GBR A;  1I5L A;  1VQK Q;  2DYI A;  2O01 E;  1PD1 A;  4WF2 A;  4JS5 A;  1VYU A;  1NPR A;  1OX9 A;  4M7D E;  4CC4 B;  4F7U F;  3OYJ A;  4QT7 A;  4LN2 A;  2JN0 A;  3GBQ A;  5J3B A;  5GMK m;  1GCP A;  3PMI A;  2A36 A;  1SRM A;  3HSB A;  3L2V A;  1FMK A;  4MDW A;  3SHW A;  1BI1 A;  2SEM A;  3NMZ C;  5LJ3 d;  4Y91 A;  1VQM A;  2KT1 A;  1XOV A;  1JB0 E;  4NS5 A;  2A28 A;  1O9S A;  2HNI A;  1IRE B;  3PT9 A;  1EIF A;  5KYX A;  4F7U A;  3CCR T;  5KYW A;  1Q95 G;  3SD4 A;  1TG0 A;  2QYZ A;  3JCM g;  3I56 A;  2QEX Q;  4DQ2 A;  1VQ9 A;  4VUB A;  4EMG A;  4JUV A;  4MZM A;  3C0C A;  4FYW B;  1NM7 A;  1K8A C;  3OYL A;  2QA4 T;  2NWM A;  1WQ7 A;  2BUD A;  5GAO m;  1WHL A;  2JS2 A;  3VKI A;  4NOY A;  4C8Q C;  1AHJ B;  2EGA A;  3NGP A;  3OW2 A;  3EHR A;  1JBM A;  2KSS A;  2YT6 A;  2YRV A;  1XTD A;  4ELZ C;  6AT1 B;  4ZNX A;  2DBK A;  1Q86 U;  1UE9 A;  4GBQ A;  3G71 Q;  1VQP Q;  1Y0M A;  2Y4Y A;  1AWO A;  3G4S A;  2HKQ B;  1CKB A;  4E47 A;  5CR2 A;  1I4K 1;  2L8D A;  1AZG B;  2E4H A;  5GAO p;  2CKK A;  1UGQ B;  2RB6 A;  4FYX B;  2XDB A;  4IUR A;  3M9Q A;  3JCM V;  5A0D A;  1K0S A;  1Q7Y R;  2RN8 A;  2JTE A;  2M16 A;  2PVG B;  3NFC A;  3M55 A;  1BIA A;  3R6O A;  4M75 C;  2JVV A;  1QWF A;  2DAQ A;  3FLG A;  4DOV A;  4Y92 A;  2QDY B;  1EX4 A;  2CP7 A;  1N8R C;  4C0Z A;  3CCQ T;  1W2B P;  2K57 A;  1G3W A;  4E2F B;  3JB9 G;  2FYK A;  2I2L A;  2VGM A;  4XU3 A;  1CSK A;  1U8R A;  5GAN 5;  2DXT A;  3X28 B;  1VQ5 Q;  3RER A;  4PFP A;  4C8Q F;  1QVF P;  2H3E B;  1FWZ A;  4F16 A;  2ECZ A;  2QEX T;  4M78 G;  4X9D A;  2C0O A;  2AZV A;  2LX9 A;  3JCM P;  3OYB A;  3HTR A;  2Z0W A;  1E6G A;  4JZ4 A;  2DKG A;  5LL6 S;  1KFZ A; 
#chains in the Genus database with same CATH homology
 1WIE A;  2YSQ A;  1NG2 A;  1WA7 A;  1SPK A;  4AFQ C;  3EGU A;  1PWT A;  1OPK A;  5GJV B;  2CT3 A;  2EYZ A;  2ROL A;  4AG1 C;  4Z89 A;  5IXB A;  2KE9 A;  2FO0 A;  4LUE A;  1K0X A;  2GBQ A;  1OV3 A;  2ESW A;  2DJQ A;  2EYX A;  1VA7 A;  2GTJ A;  3M0S A;  4HCK A;  3KFV A;  2ENM A;  1T3S A;  2A08 A;  2ROT A;  1CKA A;  4F14 A;  3VRY A;  4CC3 A;  2V1R A;  2VVK A;  4DEX A;  2K7A A;  4RTX A;  2D1X A;  2DLP A;  1GCQ A;  1WYX A;  3NHN A;  1AD5 A;  1OOT A;  1T3L A;  2DA9 A;  2KT8 A;  2GGR A;  1TUD A;  3TSW A;  1KSW A;  1MV0 B;  1E7O A;  2DX1 A;  1NYG A;  3EHQ A;  4JPB W;  3EG3 A;  2J6O A;  4FSS A;  3R6N A;  2LX7 A;  5I22 A;  2RQV A;  2DMO A;  2KRS A;  2LMJ A;  1AVZ C;  4J9I A;  2GQI A;  2BZY A;  2DIL A;  1GRI A;  4LE9 A;  5GJW B;  1NLO C;  1SHF A;  1VYV A;  1RLP C;  2L3Q A;  4OMN A;  1OPL A;  1N5Z A;  1PHT A;  1PKT A;  2CRE A;  2HBW A;  2W0Z A;  2AK5 A;  2KEA A;  2PZ1 A;  2K79 A;  4AFS C;  2YUN A;  1FYN A;  5IHK A;  1X2K A;  1PRL C;  1G2B A;  2CSI A;  4RTY A;  3VS5 A;  1KJW A;  2VKN A;  1JXM A;  2JM8 A;  2BZ8 A;  3M0Q A;  5IH2 A;  1M3A A;  4D8K A;  1BK2 A;  3UA6 A;  1YP5 A;  2LZ6 B;  1QKX A;  3VS6 A;  2RPN A;  4AG2 C;  1UJ0 A;  2JMC A;  2SRC A;  2C0I A;  1UHC A;  1H8K A;  2QDL A;  1UUE A;  2DF6 A;  2PNI A;  1QWE A;  1YWP A;  2LCS A;  4K11 A;  2FEI A;  3UF4 A;  4OML A;  1ABQ A;  1JQQ A;  4Z88 A;  2CH4 A;  1I0C A;  2XMF A;  2DM1 A;  4JJD A;  4EIK A;  2FG0 A;  2EPD A;  2L2P A;  1I07 A;  1X69 A;  3VS4 A;  3VS3 A;  2BZX A;  5IXF A;  1ZUK A;  1QKW A;  4RTV A;  3JV3 A;  4F17 A;  2HDA A;  2D8H A;  1VYT A;  1U3O A;  4IIM A;  1UG1 A;  1MV3 A;  2OAW A;  1H3H A;  1WFW A;  2LP5 A;  1U06 A;  2A37 A;  1B07 A;  4HVV A;  3LH5 A;  1PKS A;  2LJ3 A;  2CUD A;  2O2O A;  4J9F A;  3H0H A;  3A98 A;  2F2X A;  1UGV A;  3REA B;  1RLQ C;  1X2Q A;  1W1F A;  2RQT A;  3NPF A;  2O88 A;  2LJ0 A;  2EW3 A;  5I11 A;  1K76 A;  3PE0 A;  4DEY A;  2DE0 X;  4J9C A;  1BBZ A;  3H41 A;  3M0T A;  2DBM A;  2AKK A;  2J05 A;  2CSQ A;  4D8D A;  1M8M A;  1X6G A;  2CUB A;  1UJY A;  1OEB A;  2M51 A;  5FWC A;  4HXJ A;  2KYM A;  3VS7 A;  5EC7 A;  2LQN A;  3I5S A;  2ED0 A;  1SHG A;  2LJ1 A;  4AFU C;  3ZL7 C;  4RTZ A;  4JJB A;  1G83 A;  5FW9 A;  2RQR A;  2J06 A;  4JZ3 A;  1H92 A;  2D8J A;  1KIK A;  3QWY A;  1SSH A;  1HD3 A;  1WX6 A;  3IQL A;  4CC7 A;  5IHI A;  1ZLM A;  2GNC A;  3I9Q A;  3THK A;  1Z9Z A;  4J9B A;  2K9G A;  2P4R A;  1UHF A;  3REB B;  2ABL A;  2MCN A;  3TVT A;  2EGC A;  2EQI A;  1K1Z A;  1GL5 A;  4LNP A;  2RQU A;  1ARK A;  4HVU A;  4OMP A;  3EG0 A;  1K4U S;  2D0N A;  5FWB A;  2I0N A;  3UAT A;  2GTO A;  4KRT A;  1B3Q A;  2JXB A;  2FPD A;  3EG2 A;  1NLP C;  1W70 A;  2YUP A;  1T0H A;  1BU1 A;  1QLY A;  3M0R A;  4J9H A;  1M30 A;  4CC2 A;  2KXD A;  1WI7 A;  2DL3 A;  2O9V A;  2OI3 A;  1Y57 A;  2HCK A;  2YDL A;  3UA7 A;  2YUO A;  2JMA A;  1WXB A;  1BB9 A;  2EYY A;  2RMO A;  1JXO A;  2FPF A;  1YWO A;  2KGT A;  1AWJ A;  2JT4 A;  2MIO A;  2K3B A;  2K6D A;  1ABO A;  3H0F A;  5HCK A;  2F2W A;  2L3P A;  1RUW A;  1ZSG A;  2DVJ A;  1U5S A;  1W6X A;  2E5K A;  4OMO A;  2PTK A;  1TUC A;  3PVL A;  1GFD A;  3VS0 A;  3CQT A;  2DYB A;  1M3C A;  1UDL A;  2CH4 W;  1M27 C;  1J3T A;  2KNB B;  2V1Q A;  3VS1 A;  3ULR B;  2G6F X;  3I35 A;  1HJD A;  2NUZ A;  1UTI A;  1Z9Q A;  2X3W D;  1GBR A;  1NEG A;  3FJ5 A;  2KR3 A;  2YUQ A;  2H8H A;  1IO6 A;  4X1V A;  1RI9 A;  3VS2 A;  2AKL A;  1VYU A;  2RNA A;  1NEB A;  2LNH B;  1NYF A;  4CC4 B;  4QT7 A;  3PVQ A;  4LN2 A;  1QCF A;  3GBQ A;  4E6R A;  1V1C A;  1GCP A;  4HVW A;  2A36 A;  1SRM A;  2AZS A;  2EYW A;  2EKH A;  4RTT A;  1FMK A;  2EVR A;  2KRM A;  3SHW A;  1A0N B;  1T0J A;  1UEC A;  2DNU A;  2M0Y A;  2SEM A;  2EGE A;  2J6K A;  3NMZ C;  1GBQ A;  3SEM A;  2KT1 A;  1XOV A;  3M0P A;  1AZE A;  2A28 A;  1ZX6 A;  4RTW A;  2J7I A;  1HSQ A;  2KYB A;  1I1J A;  4A63 B;  5L23 A;  2F2V A;  1AEY A;  1TG0 A;  4ORZ A;  1AWW A;  2LQW A;  2DL7 A;  4LUD A;  1M3B A;  1ZUU A;  4JJC A;  2HSP A;  1WXU A;  2BTT A;  3I5R A;  1GFC A;  4AFZ C;  2DRK A;  3C0C A;  4J9G A;  1NM7 A;  2X3X D;  2DL8 A;  2NWM A;  1WDX A;  1SRL A;  2KRO A;  2DRM A;  2JS2 A;  2JM9 A;  2EGA A;  3NGP A;  3EHR A;  4RTU A;  2YT6 A;  2HEQ A;  1MUZ A;  2ED1 A;  4OMQ A;  2DL5 A;  4R0K A;  4ZNX A;  1LCK A;  4M4Z A;  2DBK A;  1YNZ A;  1UE9 A;  4GBQ A;  1AWX A;  1Y0M A;  1AWO A;  1CKB A;  1GCQ C;  2O31 A;  5IHN A;  1AZG B;  1X6B A;  1X27 A;  1AOJ A;  5ECA A;  2FPE A;  3M0U A;  1YCS B;  1JU5 C;  1PNJ A;  2B86 A;  3H0I A;  2OJ2 A;  2L0A A;  1K0S A;  2CT4 A;  4GLM A;  1YN8 A;  2RN8 A;  2JTE A;  2IIM A;  3VRZ A;  1S1N A;  2MOX A;  1X43 A;  1SEM A;  2DL4 A;  2L3S A;  2RQW A;  1QWF A;  4OMM A;  2W10 A;  3QWX X;  3EG1 A;  4Y92 A;  1E6H A;  1EFN A;  3RNJ A;  2KXC A;  2O9S A;  2K2M A;  2VWF A;  2EBP A;  1CSK A;  3RBB B;  2JW4 A;  2RF0 A;  4IIO A;  2CDT A;  4ESR A;  2FRW A;  1JEG A;  4WCI A;  4F16 A;  1WXT A;  2ECZ A;  3O5Z A;  2KRN A;  1K9A A;  1ZBJ A;  2JS0 A;  1JO8 A;  4Z8A A;  1WLP B;  4J9E A;  2C0O A;  2AZV A;  2FRY A;  2J6F A;  2KBT A;  1PRM C;  1ZUY A;  1UFF A;  4RUG A;  3U23 A;  1E6G A;  2C0T A;  4JZ4 A;  4J9D A;  3TSZ A;  1KFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...