2M1HA

Solution structure of a pwwp domain from trypanosoma brucei
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
110
structure length
110
Chain Sequence
MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDKESNALRFEPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription elongation factor S-II
publication title Solution structure of TbTFIIS2-1 PWWP domain from Trypanosoma brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 9
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2m1hA00
3OS1A 3SD4A 3S6WA 3QBYA 1MHNA 4IURA 2L3RA 1RI0A 3PMIA 3DB4A 2RJEA 2RHYA 3S3NA 4EDUA 4N4GA 3O8VA 4C5HA 2P0KA 2RHUA 4E7LA 2PQWA 2EQJA 3MP1A 1OZ2A 4IUTA 1WJRA 2HQXA 4IUUA 4ZTJA 2CKKA 3S3MA 3L2QA 4BDYA 3MEWA 1G5VA 3OYEA 3OA6A 3DB3A 3OYLA 4QQ6A 2K3YA 3LGLA 1WJQA 2RJFA 3FEOA 5D6WA 3OYAA 2X4XA 3L2RA 1KHCA 4BACA 2L8DA 2RHIA 3MEVA 2MWOA 5M9OA 2JZ2A 5IN1A 3S3OA 2M0OA 3E9GA 3MP6A 2FHDA 3QJ6A 3KUFA 3META 3MEUA 3CEYA 4FL6A 4QQDA 5J39A 3LYIA 3OYBA 3OYDA 2EQKA 2GFAA 5KH6A 4C5EA 3PFSA 2HQEA 4N4HA 1WJSA 2O4XB 2R5AA 3BDLA 1N27A 3E9FA 3LLRA 4QVZA 3OYNA 4BE2A 2GF7A 3OYIA 2RJCA 4NS5A 3OY9A 3P8DA 2R57A 3LH0A 3PMTA 1OZ3A 2YRVA 3MO8A 4II1A 2D9TA 3Q1JA 4X34A 2EQMA 2IG0A 2K3XA 2RHZA 2M16A 3FDRA 3MEAA 4HCZA 3FLGA 4C5GA 2DIGA 4L59A 3NTHA 5FRMA 1OI1A 3OYHA 4OVAA 3ME9A 3OMCA 2RI5A 5KE2A 3L2UA 4LD6A 5C0MA 2RO0A 4A4GA 2JTFA 2O4XA 3ASKA 3OS2A 4QW2A 2R5MA 1SSFA 2EKOA 2QQSA 2RI3A 4IKFA 4QQGA 3OYMA 1OYXA 2E6NA 5KCHA 2DIQA 4RG2A 3OYKA 2E5QA 2R58A 5KCOA 2XDPA 4CRIA 3L2VA 2LRQA 1XNIA 3H6ZA 3H8ZA 3OB9A 5CIUA 2BIVA 4A4EA 4ZTFA 2LCCA 4GY5A 3QKJA 4Z02A 3OS0A 2QQRA 3M9QA 2MWPA 5KE3A 2RHXA 3DLMA 5FRNA 4C5IA 2DAQA 3L42A 4B9WA 3OQ5A 2LDMA 2WACA 2GFUA 4BD3A 2B8AA 3OYGA 4B9XA 3FC3A 4E7JA 2X4YA 2G3RA 3UT1A 4BE0A 2F5KA 3MP8A 2RJDA 2BUDA 4IUVA 5C6SA 2RI2A 4A4FA 4FU6A 4Q5WA 5J26A 5IAYA 4E7HA 2X4WA 4BE1A 4PL6A 3NTKA 3LGFA 4PLIA 4UC4A 3EAEA 2EQUA 1WGSA 5FROA 3OMGA 2X35A 2BKDN 3C4SA 5D6YA 3ZEHA 5D6XA 4E7KA 4A4HA 2XK0A 3GOXA 3F70A 3P8HA 3PNWC 3UWNA 2L89A 2LTOA 3LX7A 3NTIA 4PLLA 3QIIA 4IUPA 3OYFA 3OYCA 3OYJA 3L2WA 4BDZA 1H3ZA 2LVMA 4E7IA 2EFIA 2VYTA 4IUQA 2NLUA 2M1HA 4N4IA
chains in the Genus database with same CATH superfamily
2CT4A 2HNIA 5LJ3d 1TUDA 3CXCS 3A8OB 2EQJA 2RA2A 3CCMA 2HQXA 5FW9A 3X26B 2VASA 2W0ZA 3DB3A 2KE9A 2QGGA 1QP3A 1T3LA 1W2BP 4XTZA 1Y71A 2BZYA 1AWXA 3A5ZB 4M77B 2YLBA 3CEYA 2YRCA 2NUPA 4JPBW 4X9CA 1YBYA 1YWPA 2E3HA 1K9AA 2DZ9A 3BW1A 3I35A 4JDSA 3M0TA 3PIOA 2DIGA 2OI3A 4DEXA 2A28A 3OMCA 4KGXB 2QXFA 1G3WA 4NOYA 1Q82U 1SRMA 1W70A 4E7ZA 2MYSA 4C92A 4M7DC 4JS5A 4PJOB 1YP5A 2FRWA 5KYYA 4FSSA 5GANj 3CCSQ 2KRSA 4E2FB 2WSEE 4MZTA 4D8KA 5IH2A 5KYUA 5FRNA 3M58A 5CK9A 4VUBA 4E7JA 2XD0A 3G71T 5IAYA 4IIMA 2LMJA 4PL6A 1D1AA 1VQ8A 2JXBA 2V26A 2DEQA 2HAXA 1KIKA 1IO6A 1SEMA 3ZFJA 4RTZA 1JXOA 1OU8A 1YIJA 1K8AC 1I81A 2NUPB 4C8QA 1AD5A 1N5ZA 1A0NB 2C0OA 1O75A 1UJYA 2FO0A 4OP0A 1RAFB 1X69A 3I56Q 3I55T 3CMEA 1JO8A 1D3BA 2RH2A 4RTTA 4XK8E 2QGFB 1KC8U 4A53A 2L8DA 1K4US 2M0OA 4F17A 3HL8A 3ZL7C 2AKKA 3JB9I 5HCKA 4D8DA 1G3YA 1Z9ZA 3HSBA 2FPFA 1I07A 4C92B 3GNGA 5KYYB 3R6OA 1GFCA 5FU6B 2RNAA 4YTLA 3RESA 2KXCA 2NUZA 4N0AA 5C0MA 3ASKA 5KYUB 1M8VA 3N5BB 5D7UA 2R5MA 1Y0MA 2VXEA 3P8BB 4J6YA 3QO3A 2SEMA 2DX1A 3OYKA 3A8LB 2ROLA 2KYMA 3JRZA 3L2VA 1KK7A 3QZ5B 4XTVA 4J9FA 1R8OB 2QQRA 3VYHB 1PM3A 2RHXA 3QXEB 1SSHA 3H0IA 2JTMA 3CCQQ 1K73U 2DEUA 3J81E 1P92A 4BE0A 3JCMV 1PRLC 2YWWA 5C6SA 2JW4A 2KMTA 2YHTA 3VU3C 5GAN5 4PLIA 4BE2A 4OGCA 1ZX6A 3VRYA 4F7UG 1NG2A 4Z89A 3CMEQ 3CXCP 3GOXA 1OPKA 2CP5A 2QDYB 4PLLA 2XKOC 4M75A 1VQPT 1BI2A 3HKSA 3S6WA 4RUGA 2DMOA 2OTLQ 1PSFA 3JCMW 3SB2A 1M90U 2ZPEB 2KXDA 2ATCB 1DJ7B 2O9SA 1JBMA 5I2MA 2DXTA 4Z88A 3QDFA 1PKTA 5GANd 1RAIB 4KGZB 2LQKA 4FYYB 2RPNA 4WCIA 4QQ6A 2I2LA 3FEOA 1IGQA 2O88A 3MKDA 3MEVA 4LXCA 2HKNA 2J7IA 1RAAB 3KBGA 4ANJA 1AWOA 2EQKA 1M1KU 2EYWA 2LCLA 4CC3A 2QEXQ 5LJ5j 2QI2A 3TSZA 3AHUA 5GJVB 1NLOC 4R56A 3EG0A 1UHCA 3Q1JA 2WSCE 4TVRA 1WYXA 2E4HA 1BU1A 5FU7C 1D0XA 1ZUUA 3RKWA 2JUFA 2IVWA 1Y96A 3SDZA 2DNUA 2HD0A 2RQWA 2JM9A 2OTJQ 2MPXC 4J8OA 3VYGA 3PVLA 2M9UA 2R58A 1XNIA 3H8ZA 3C0CA 2YUNA 1PSEA 4RCCA 4GY5A 3TREA 3L1AA 2C0IA 1YITT 1ABQA 2JS0A 4C5IA 2ROTA 2EAYA 2AKLA 2BUDA 3TVTA 2J6OA 1Q7YU 5CVIA 4BUGA 1YI2A 2KEAA 3GBQA 3DLLA 3NTIA 2F5TX 3OYCA 2H3EB 4HCBA 4JJDA 4O6JA 1OX9A 4PFZA 3SD4A 4DEYA 3INZA 3PMIA 4A4KA 2DZCA 2CSQA 1S72A 2RQRA 1ZA2B 4BI8B 4EMGA 3TCJA 4M7DE 3MEWA 1C0MA 2E10A 1PCXA 1RL2A 1WDXA 4IIOA 1GXIE 2C0TA 4J7FA 4X9DA 4OMQA 2VWFA 1G83A 1SPKA 5EC7A 3SEMA 2GNCA 3CD6Q 3JCMJ 1K1ZA 5LJ3h 3CCRA 4XU1A 2KGTA 2GQIA 2COZA 3JCMQ 3BDLA 2KR3A 4GLKA 4KBMB 2RJCA 2JM8A 1N8RR 3CCUQ 3CC4Q 4ATOA 2KBTA 4F7UE 5GMKj 5GAMf 3FLGA 2L5QA 1MNEA 1VOMA 3HRUA 5KE2A 3L2UA 1Q86C 5CAIA 2J06A 2ZPIB 5ECAA 1SSFA 4AFUC 2D1XA 1ARKA 1VYUA 2VUBA 1Y07A 1W2BS 1R77A 3JCMg 3A8HB 1VQ5T 2RK2A 5DM7R 1YJ9A 4X1VA 5IT9E 2K5FA 2LZ6B 3M9QA 2EBPA 1ZSZA 1AWJA 4OMPA 4C0ZA 1ACMB 1KQ2A 1QMCA 3FC3A 2CH4W 2X4YA 4M78C 5IXBA 4HXJA 3RBBB 2RI2A 4RTWA 2HCKA 5LJ5d 2GQVA 5I2SA 3RKXA 2JJ9A 2W10A 3MJXA 2P0QA 4E7KA 2XDBA 3P8HA 3FRNA 2LC4A 3L2WA 2YUQA 5CKDA 4RTXA 1QLYA 2NLUA 3FJPA 1NZ9A 2CZ6B 4OMOA 3DB4A 3M5AA 3FB9A 1G3SA 2DBKA 2CP3A 1VQ7T 1OQKA 1U3OA 2ESWA 2PQWA 2AHJB 2LJ3A 5GAOm 1K73R 5LJ5f 3OSSC 4DBRA 3EFRA 2VVKA 1R0CB 5L23A 2LQ8A 1Q82C 2VGMA 5GAN4 3RUXA 4FL6A 2IPOB 3VS0A 4NL2A 2YSQA 4GLMA 4OMFB 2HQEA 1WX6A 2J05A 3VS4A 2VKNA 1M4ZA 1OOTA 2CH4A 1VQ6Q 2D0QB 2CP2A 2QA4Q 3OY9A 1JJ2S 1HYOA 1VQNA 3CC7Q 2YRVA 4HCZA 2M16A 2MOXA 1M5Q1 2AT1B 1YJNA 1UB4A 4L59A 2CP7A 3ME9A 1KQ1A 3M54A 4R55A 3OW2S 2OX7A 2YRDA 4LDVA 3M57A 3A8MB 4AFZC 4Y92A 5CQYA 3CCVT 3CC2Q 1PWTA 5KCHA 5GAN2 2RF0A 2XI9A 1BBZA 3EGXB 1W1FA 1KG1A 3OB9A 1H8KA 1E7OA 3OYYA 1RLPC 1VIFA 1WHJA 4M77C 1BYMA 2YXYA 1M1KR 3R6NA 1WHKA 1WA7A 2EPDA 3L42A 2KAFA 3OQ5A 1VQKT 4HCCA 2B8AA 1AZGB 1PC0A 4J83A 3OSVA 1VQMT 4E7HA 1E6HA 3EAEA 5D6YA 4AMCA 5FWCA 2L3QA 1KC8C 2K6DA 3ZBDA 2ED1A 3G6EA 4IUPA 3JCMf 2VYTA 1UHFA 4XU0A 4IURA 2L3RA 1SKUB 1GBRA 4PJOC 2PUKB 4J9EA 3O8VA 4C5HA 1BIBA 2PUOB 5HK3A 1RLQC 1YCSB 4ZNXA 3L2QA 4M7AD 1QCOA 2YLCA 1IREB 3CCSA 2OAUA 1KQSP 1X43A 1K8AR 4J5YA 1M1GA 2MWOA 1FYNA 1WHMA 1Q7YR 2YUPA 3I5SA 3OYDA 3UA7A 3CPWS 3PE0A 1TH7A 2M02A 3UATA 2GF7A 2KSSA 5GANh 1ZA1B 2F2WA 3FDRA 2DD4A 1NPPA 5FLXE 3WVEB 5CCAA 2FYKA 3VJPA 3QZ9B 5LL6S 4CC4B 2Y4XA 1HSQA 1Y57A 2JN0A 3URGA 5HK0A 2KQWA 3LWIA 1TG0A 1JEGA 4C0DB 3FIFA 2KDSA 1QVGA 3GPLA 1M1FA 4PKCC 4E6RA 4RG8A 2KT1A 2XIDA 3G6EQ 2MIOA 4RTYA 5GJWB 3I56A 4Z02A 1Q81C 1FMKA 2CDTA 5EG2A 5GMKe 1QVFP 3NHNA 3OYGA 4B9XA 3UT1A 4E7SA 4C92C 2V8IA 4M7DD 4ZGJB 3CCMT 5FROA 2DXCA 1H3HA 2DYBA 3UF4A 4A4HA 4EPCA 2XK0A 1AWWA 1TOVA 2HMAA 5DLOA 3CBPA 3OS1A 1VUBA 3JB9G 4WF2A 1NYFA 1GRIA 4PJOG 2X4JA 2A3LA 8ATCB 3RIRA 4EDUA 5LJ3e 2L0AA 4JRIA 5IHIA 4V2SA 1JQQA 2HBWA 1V76A 3GF5A 4M7AG 4OB2B 3EGUA 3ER0A 1PD1A 3RR6A 3OA6A 3I56T 3CCEA 2DF6A 5D6WA 1WZOA 2X4XA 2FVUA 1XQHA 3CCQA 1JJ2P 1LJOA 1N8RU 3LYIA 3WVDB 1FXXA 4R0KA 4J9IA 1ZHIA 4N4HA 4C8QC 1M3BA 4HVWA 2VGNA 3OW2P 2C06A 4OMNA 1BCOA 1V1CA 2DL5A 2EKHA 1MNDA 2OTLA 1E6GA 2DTOA 2YT6A 3C95A 5I21A 2HSEB 2G6FX 2AK5A 1VQ8T 1OULA 4CRIA 4FYWB 5CIUA 1TTHB 2LT1A 1WXBA 1LVKA 3CMAA 3CCQT 3JB9H 2M0YA 4N0AC 2MF2A 2GFUA 4BD3A 1D0ZA 1YIJT 1OU9A 2K79A 2MK5A 2FZGB 4M7DG 2QEXA 2DA9A 2WSFE 3O5ZA 2KK4A 5AYFA 5GAMj 3I55Q 3CCEQ 3CMET 4M7AF 3OYFA 2XICA 1C1AA 4PJJA 5A0LA 2I0NA 2QTXA 1UE9A 3QBYA 2OTLT 2COWA 5CQXA 3GIBA 3QHSA 1RI0A 2PNIA 5LJ5h 2NUTA 3MP1A 3X25B 2OTJA 1UGQB 1VQOQ 4LUEA 1KSWA 1N6AA 2QASA 2EGAA 1B07A 3HHTB 3CPWP 1KD1C 2DFUA 4M75C 4F7UB 2EJ9A 5IN1A 1YJWA 4DQ2A 3OS5A 4ELYC 1RAHB 3PFSA 2ZAEA 4C8QG 1ZUKA 1OEBA 1K9MC 1NJIR 3M53A 3VV0A 3REBB 4X34A 2EQMA 1QKWA 2E6ZA 3V7SA 1VQ4A 2KT8A 4QVDA 3CMAQ 4WTOB 2A37A 2JMCA 3H0HA 5HY6A 4LD6A 4Y28E 1WHGA 4QW2A 3QJYA 4CC7A 2HDAA 4DBHA 4J6XA 4PJOE 1JXMA 3OYMA 2DD5A 1OYXA 4FW2A 4F16A 3LW5E 1HJDA 4J9CA 4M7DF 1U06A 3D7SB 1X6BA 2PTKA 4A4EA 3M0QA 4ZTFA 1BIAA 3QG1A 1WLPB 1ABOA 4M7AE 1VQPQ 3NMZC 4LNPA 1H92A 3CD6A 4OGEA 1Q95G 3HTRA 2RJDA 4JUVA 3CCJQ 1VA7A 1VIEA 2FZCB 1RAGB 2BKDN 4OB0B 2NUTB 4FM4B 2EW3A 4OB1B 3TEEA 2CSIA 3BE3A 1YFNA 1UDLA 3CCUA 3CC4A 3VS3A 4F7UF 2E70A 1GBQA 1D1BA 1WJQA 1YJWQ 3M55A 3EH2A 2Y90A 1K8AU 3RMSA 2QG9B 1PKSA 2DERA 3M0UA 5GMKm 2D8JA 1I5OB 3HRSA 1M9SA 2EJFA 2FRYA 5GAOq 3OYEA 1ZQ1A 5GANe 4MMKA 1D09B 2CS7A 5GMKh 1VQ4Q 9ATCB 2RJFA 3EG2A 4M75G 2RHIA 5GMKl 3J7AF 2XHCA 3META 4PJLA 2X9HA 1GCPA 2MMPA 4C5EA 3VS6A 4PNOA 1D1CA 3WXMB 4QVZA 3CCLA 3OYIA 4CI0C 4NS5A 2R57A 3BFMA 1OZ3A 5GAMd 1SF9A 3MO8A 3M4GA 3MEAA 2E64A 1YITQ 4C5GA 1GL5A 1OI1A 3OYHA 2O4XA 2PVDB 1VQ9Q 1B3QA 2AZVA 3H41A 2QQSA 1KQSS 2V8JA 1YI2T 1M2VB 2D6FA 2LRQA 2HZYA 2BTTA 3MCAB 4K11A 1NLPC 1XTDA 3AT1B 2F1LA 4BI3A 1MUZA 3CXCA 4E47A 4XTXA 2V1RA 1RAEB 1VQLA 2DL8A 1S72T 4F14A 3VUZA 3E19A 1B7TA 2OJ2A 4LDXA 3LGFA 3HFOA 1VQ6A 2F69A 2X35A 2MCNA 4C8QE 2QA4A 3QUIA 1QQJA 1H641 3X28B 2LX9A 4LDUA 1WHHA 2V8KA 3CC7A 2DETA 3RERA 3RMQA 4XU3A 1YCYA 1ZSZC 2CZ1B 4E7IA 4IUQA 4EIKA 3VS7A 1MHNA 1NBEB 1SHFA 4M78D 3CCRT 1UGVA 2P4RA 1N9SA 5GAN6 3CCLQ 3EGXA 3RDVA 4IUTA 1CSKA 1WJRA 2H3JA 4PFOA 3CC2A 1QVFS 2EIFA 2CKKA 2GTOA 1BCMA 2JOYA 4KGVB 2DRKA 4J6WA 1AHJB 3L2RA 1ZBXA 2AIRB 4JJCA 3MP6A 3A8GB 1PRMC 2EGEA 3MEUA 1NEGA 2F2VA 1WPYA 3M0PA 4DA4A 2O4XB 3OYNA 4MDWA 1BI0A 2QA4T 1VQ5Q 1SG5A 1YJ9T 3G4SA 2DLPA 1EFNA 4J7IA 1MMAA 3NTHA 4KT0E 2KRNA 4PJNA 4PJMA 4DBFA 2E12A 2CUBA 4O5VA 1VQLQ 4LE9A 4A4GA 2JTFA 1QVGP 4ZGEB 1LPLA 2E65A 1BKBA 1WNLA 2JTEA 2EYZA 2K7AA 3X20B 2E6NA 3EHQA 5GMKi 4JRQA 2J6KA 5GAN8 2PVOB 1FWZA 1XOVA 2EGCA 4XTUA 1GFDA 2A36A 1YHQA 2RQTA 2MWPA 2DAQA 2DXUA 4M75E 3TQ7P 5I11A 4ELZC 5LJ3g 4LN2A 1X27A 4RCBA 1VQ7Q 5GAOp 3H0FA 1OV3A 4IUVA 3X24B 4A4FA 3JSCA 4BI4A 3QWYA 3M59A 5LJ5e 2KNBB 1Q81R 4HT8A 1BB9A 3JCMd 1FX7A 3C12A 3G7ZA 3T9NA 4M77D 2LP5A 2E3IA 2L89A 2LTOA 3LX7A 2E1HA 3UWNA 4BDZA 1M27C 1UTIA 1N8RC 3JCMb 2GGRA 4C0DC 2ZPGB 4EMKA 2E41A 4M78G 2DTIA 1MMDA 4ZN1A 1PHTA 4J9HA 4NL3A 2QQAA 3C94A 4BDYA 1VQNT 4EMHA 3G4SQ 3TSWA 3LH5A 2K3YA 3OYAA 2GTJA 4MMLA 1YJNT 4BACA 2GCXA 2NWMA 3PGGA 2VV5A 1NJIU 1TXQA 3UA6A 2ED0A 3JB9D 2DTHA 4XAXB 4PJOD 2EYQA 1TU0B 4PFPA 1X6OA 2BE7D 4OMLA 3H9NA 1G8XA 5A0DA 3PMTA 2M51A 3REAB 4II1A 1UGPB 3QPHA 3VS1A 1YHQQ 4XTYA 3M56A 4HVUA 1X2QA 1VQKQ 3IQLA 5HKCA 2JMAA 1VQMQ 3EGDA 2XDDA 2DM1A 3V8LA 3FJ5A 4FSXA 4HKEA 2YDLA 4JRPA 4QVCA 3H6ZA 4M7AA 3G6ET 1HXDA 3SWNB 1TS9A 1K73C 1TUGB 4C0FA 4F04B 2Z0WA 2DPPB 3GP8A 2BZ8A 4QT7A 2KRMA 2LJ1A 4ZGDB 2FPEA 3QDRB 3JV3A 2RMOA 1X75C 2E5KA 4M78F 5CKEA 4OB3B 4Q5WA 2DXBA 4EMKB 2EQUA 2YUOA 3C4SA 3G1JA 2LNVA 4FYXB 2EWNA 3CCST 3PNWC 4FT2A 4M77G 2A7YA 4ORZA 3OYJA 2RQVA 1JB0E 5DY9A 1H3ZA 2CUDA 2CGHA 2EFIA 4N4IA 3LWHA 4LDYA 1M90C 3V7RA 1MV0B 2RK1A 3S3NA 4JLIA 4C92D 3G71A 2XU8A 5LJ3f 1UG1A 3J80E 4ZTJA 4IUUA 2O31A 2JNGA 4PK4A 1AOJA 5FU6C 4FIBA 6AT1B 3E1SA 4XU2A 2K9GA 3A1PA 3JB9J 4QKUA 3THKA 3S3OA 3I5RA 1EZZB 1M8MA 1MGQA 3V8KA 4QQDA 1C6VX 1M1KC 2HBPA 3CBOA 2F2XA 1UJ0A 3BDUA 2DL7A 2K4YA 5GAN3 5L8RE 2HQHA 2KI7A 3VRZA 3NFCA 1UECA 4ZN3A 3LLRA 2R5AA 1N27A 1KD1R 1MMNA 4M7DA 1KJWA 7AT1B 4C0GA 3EGDB 3P8DA 3LH0A 2RB6A 5J3BA 2D9TA 3EG3A 2K3XA 2SRCA 3I55A 3HPWA 4DOWA 4M7AB 2J6FA 1B34B 5FRMA 2BZXA 3EFSA 2P4TA 4OVAA 4BY6B 1JRIA 4HVVA 1K9MR 1AT1B 3QWXX 2B86A 2EKOA 1QP2A 4M78E 3CCMQ 4C8QD 1QCNA 2DIQA 1WXUA 1K0XA 1WFWA 5GAMh 4RTVA 1VQOA 5CO7A 5KYWA 4F7UA 3E2UA 1RI9A 2X3WD 3OS0A 3HFNA 2RD1A 4M77F 3DLMA 2DJQA 1CKAA 3MHXA 4JJBA 4AFSC 1I0CA 3JCMP 2VXFA 2G3RA 3DKMA 2F5KA 3MP8A 5KYXA 2CREA 1Q7YC 3G71Q 1NE8A 4BE1A 3NTKA 2DVEA 3OMGA 5GANg 3SHWA 3V8JA 4DOVA 1NPRA 5D6XA 1G3TA 1G2BA 2CZ7B 3CCET 2EYYA 1PD0A 2DBMA 3F70A 2LJ0A 4LUDA 1IB8A 1M2OA 3A98A 1KQSA 2LQNA 1IZ6A 2L3PA 1TWBA 4AG2C 2LCSA 2EYXA 4MDXA 3VKIA 4KUDK 3JB9F 1I1JA 1UFFA 3KFVA 4N4GA 4PJOF 4C92G 2DRMA 5KYNA 2HKQB 1VQOT 1QKXA 4M7DB 3LGLA 1EX4A 2L3SA 2HL3A 1VQPA 4J9BA 1EIFA 2CP6A 3M4YA 3PT9A 5KH6A 1W2BA 1O9SA 2V1QA 2QQBA 3QSUA 3CCJA 2K3BA 5CKHA 4LD9K 2RN8A 2A0FB 1VQ8Q 3GNFB 3JCMc 4JLGA 4KRTA 2LX7A 2IG0A 2LT4A 4M75D 4JZ4A 1U1SA 3CMAT 3PVQA 5KYWB 4MZMA 1X2KA 4M77E 1YIJQ 2K2VA 5FWBA 2FB7A 2RO0A 2K5LA 4RMOA 1QVFA 3EG1A 4RKUE 4A54A 2RI3A 2P84A 2QEXT 2ZGWA 5KYXB 3PIPA 2XDPA 4BB7A 1HD3A 4C8QB 2VB6A 1Y7XA 1OX8A 2LCCA 4KUIA 4XTWA 2PZ1A 3RNJA 3JCMX 1D3BB 1AEYA 1Q81U 4RTUA 3MPUB 2WACA 2DYIA 1R0BG 3CCJT 1AZEA 2X4WA 2OTJT 4C92F 4UC4A 5GAMg 3L2ZA 1QVGS 5A2QE 1GCQC 1VYTA 1RADB 4KULA 5A0GA 1GCQA 3I9QA 1Q86R 2COYA 1YITA 5CR2A 2KY9A 1W6XA 1YJWT 3EG9A 1ZSGA 1FMVA 1JU5C 1KHIA 1JJ2A 2EQIA 3OBYA 1VQ9A 1M2VA 2MAMA 2FZKB 5AT1B 1OZ2A 1NEBA 2O9VA 1WQ7A 3JCMh 1G5VA 2O01E 2RQUA 3OW2A 1VQ4T 1KFZA 1TUCA 2KVQG 4P5NA 5GANf 1U8RA 1KHCA 1I4K1 2JZ2A 1NYGA 2FHDA 3QJ6A 1XJWB 4HA8A 1TSFA 1SHGA 2GFAA 3QYGB 1RUWA 2DJZA 3CBMA 3BY7A 1WJSA 2DL3A 1UUEA 4HCKA 2DL4A 2JT4A 1MV3A 4C8QF 2CT3A 1HK9A 3V7CA 4XQ3A 3TU4K 3EFOA 4KH0B 2RI5A 2RM4A 4M75B 3CD6T 1VQ9T 2AZSA 4FT4A 5LJ5g 1QCFA 3SFMA 4AT1B 2Y4YA 4C92E 5KCOA 1WIEA 3GLXA 2HSPA 2K2MA 2QTVA 1UGRB 1Q82R 4D6WA 1UGSB 2CZ0B 1X01A 3CCUT 2DO3A 2NYSA 3CC4T 4FYVB 2OAWA 2ZPBB 1RABB 5KE3A 1S1NA 1U1TA 1WQWA 4KH1B 1YWOA 1W4SA 2LQWA 3EG9B 2K5IA 1LNXA 4FU6A 4AFQC 2GBQA 3ZEHA 2HEQA 2BE9B 1VQ5A 4MZPA 3ULRB 1I8FA 1D0YA 4JJNK 5CKBA 2JS2A 1NJIC 3CPWA 2HL5C 2P0PA 2DE0X 2RJEA 1Y96B 5FU7B 4B6MA 3EHRA 4JRKA 2ZPFB 5GAN7 2P0KA 3CCLT 4OMMA 1NM7A 1M3CA 1LCKA 4Z8AA 1IRXA 1LOJA 4ME7A 1WXTA 3OYLA 1OPLA 1KD1U 1IGUA 3EFOB 2FG0A 4M75F 1FMWA 3E9GA 5GAOn 3OYBA 1Z9QA 1VQ7A 2CYZB 2CP0A 2DVJA 3E9FA 1YI2Q 1KC8R 2D8HA 1M3AA 1K9MU 2A08A 5GAMe 3VS5A 1U5SA 1T0JA 2VC8A 1VQLT 4M78A 1S72Q 5LJ3j 4QQGA 2QYZA 3QYHB 1I5LA 1N9RA 1VQ6T 3PTAA 4RG2A 1IXDA 4ESRA 3M0SA 3CC7T 3QKJA 3NGPA 3CPFA 2MI6A 1RACB 2LDMA 3CQTA 2DK3A 3CCRQ 1X6GA 1YNZA 5J26A 2ECZA 2QK0A 3VUBA 3KXTA 3CCVA 1YN8A 2DKGA 1M30A 3CC2T 2DILA 2FL7A 4FCYA 3HRTA 3RKYA 3U23A 5GAOl 1PNJA 2LVMA 8AT1B 2EVRA 1VYVA 1VQKA 5CKFA 2FEIA 2RHYA 4OF1A 2H8HA 5IXFA 2X3XD 2RHUA 4E7LA 1VQMA 4FW1A 3S3MA 1YJ9Q 3SWNC 3G4ST 3SWNA 2FPDA 1M90R 4GBQA 4J9GA 2IIMA 1SRLA 2KROA 3VS2A 5M9OA 1QVPA 3KUFA 1ZSZB 4EMKC 5J39A 1IHWA 1ZUYA 2XMFA 1WI7A 2QQ9A 1MMGA 2O2OA 2L2PA 2D0NA 4M78B 4AG1C 1BI1A 2LNHB 3OBWA 2RHZA 2ZZDA 1YHQT 4CC2A 1J3TA 2ABLA 4M77A 4M4ZA 3NPFA 3UPUA 4L5GA 5I22A 2XG8D 4J9DA 3UDCA 1T3SA 4L6V5 1ZLMA 2PU9B 3OS2A 2JVVA 3HP9A 2K57A 2ZPHB 4IKFA 4DBQA 2QDLA 3CCVQ 1F1BB 1IHVA 3M0RA 1UEBA 2ZCFB 2E5QA 1K0SA 2KYBA 1QWFA 1AVZC 1BI3A 2ENMA 5GAOr 1QWEA 1WHLA 2BIVA 4LDWA 1T0HA 4A63B 2QAZA 1CKBA 1QW1A 2EJGA 2X51A 1K76A 4JS4A 4B9WA 4JZ3A 5IHNA 4PJOA 1Q86U 1ZBJA 1WGSA 4HT9A 1BK2A 1PG5B 5DLQE 5IHKA 1VQNQ 3EH1A 4M7AC 1B34A 3JCMe 4Y91A 4BY6C 1YJNQ 3JAME 3QIIA 2PVGB 2M1HA 1V29B
chains in the Genus database with same CATH topology
2HNIA 3M55A 1NZ9A 4MDXA 2CZ6B 2Y90A 3DB4A 3VKIA 5LJ3d 3M5AA 3CXCS 4KUDK 3JB9F 3FB9A 1G3SA 3A8OB 1K8AU 1VQ7T 4PJOF 4N4GA 3RMSA 4C92G 2PQWA 2EQJA 2RA2A 3CCMA 2AHJB 5GMKm 2HQXA 1VQOT 3HRSA 5GAOm 3X26B 1M9SA 2EJFA 5GAOq 3OYEA 1ZQ1A 5LJ5f 3OSSC 5GANe 3DB3A 4MMKA 4M7DB 3EFRA 2CS7A 5GMKh 3LGLA 1WJQA 2RJFA 4M75G 1QP3A 2RHIA 4XTZA 1Y71A 5GMKl 1VQPA 2LQ8A 3J7AF 1Q82C 2VGMA 3A5ZB 5GAN4 4M77B 2XHCA 2YLBA 1EIFA 3META 4FL6A 3CEYA 3RUXA 3M4YA 4NL2A 3PT9A 2MMPA 5KH6A 1W2BA 4C5EA 1O9SA 4OMFB 4PNOA 2QQBA 1YBYA 2HQEA 4X9CA 3QSUA 3CCJA 3WXMB 1M4ZA 4QVZA 3CCLA 5CKHA 4LD9K 2D0QB 3OYIA 4CI0C 4NS5A 3OY9A 3GNFB 1JJ2S 2R57A 3JCMc 2DZ9A 3BFMA 4JLGA 1OZ3A 5GAMd 1VQNA 2YRVA 3BW1A 3MO8A 3M4GA 4JDSA 4HCZA 2IG0A 2M16A 3MEAA 2E64A 2LT4A 1M5Q1 4M75D 3PIOA 1U1SA 3CMAT 4C5GA 1YJNA 1UB4A 2DIGA 4L59A 4MZMA 1OI1A 4M77E 3OYHA 3ME9A 3OMCA 2QXFA 1KQ1A 3M54A 2K2VA 4R55A 1G3WA 3OW2S 2FB7A 2RO0A 2K5LA 2O4XA 4LDVA 2PVDB 4NOYA 3M57A 3A8MB 4RMOA 1Q82U 4RKUE 1QVFA 4A54A 2QQSA 2RI3A 3FJPA 5CQYA 1KQSS 3CCVT 4C92A 2QEXT 4JS5A 4M7DC 2ZGWA 5KCHA 2V8JA 5GAN2 2XI9A 1YI2T 4PJOB 2D6FA 3PIPA 2XDPA 2LRQA 4BB7A 4C8QB 1KG1A 3OB9A 5GANj 3OYYA 1Y7XA 3MCAB 2OTJT 2LCCA 1VIFA 4KUIA 4M77C 2WSEE 4MZTA 4XTWA 1BYMA 1XTDA 4BI3A 3JCMX 1D3BB 3CXCA 1Q81U 5FRNA 3M58A 4E47A 5LJ5g 4XTXA 4HCCA 3L42A 2KAFA 3OQ5A 1VQKT 2WACA 5CK9A 4VUBA 2B8AA 1VQLA 4E7JA 2XD0A 4J83A 3CCJT 1S72T 1KQSA 3G71T 3OSVA 3VUZA 5IAYA 3E19A 1VQMT 4E7HA 2X4WA 4LDXA 4PL6A 3LGFA 3HFOA 4UC4A 3EAEA 4C92F 5GAMg 2F69A 3L2ZA 2X35A 5D6YA 1VQ6A 1VQ8A 4C8QE 2QA4A 3QUIA 1H641 3X28B 2LX9A 4LDUA 1KC8C 2V8KA 2DEQA 3ZBDA 3CC7A 5A2QE 3G6EA 1QVGS 2HAXA 4KULA 3RERA 5A0GA 4IUPA 3RMQA 4XU3A 1YCYA 3JCMf 3ZFJA 2CZ1B 1YITA 5CR2A 2VYTA 4IUQA 4E7IA 2KY9A 1YJWT 1MHNA 4XU0A 4IURA 1YIJA 2L3RA 4M78D 3CCRT 1KHIA 1K8AC 4PJOC 1JJ2A 1N9SA 3OBYA 2PUKB 1VQ9A 1I81A 3O8VA 4C5HA 5GAN6 2MAMA 1BIBA 1OZ2A 4IUTA 4C8QA 2PUOB 1WJRA 2H3JA 5HK3A 3CC2A 1QVFS 2EIFA 2CKKA 1WQ7A 1O75A 2JOYA 3JCMh 3L2QA 4M7AD 4OP0A 1G5VA 2YLCA 1IREB 2O01E 3I55T 4J6WA 2OAUA 3CMEA 1AHJB 1D3BA 2RH2A 3CCSA 3OW2A 4XK8E 1VQ4T 3L2RA 1ZBXA 2KVQG 4P5NA 4A53A 1KHCA 5GANf 4J5YA 2L8DA 1U8RA 1KC8U 1M1GA 2MWOA 1I4K1 2JZ2A 2M0OA 3A8GB 3MP6A 2FHDA 3QJ6A 4HA8A 3HL8A 3MEUA 3JB9I 3OYDA 2GFAA 1WPYA 3QYGB 2DJZA 3CBMA 3CPWS 3BY7A 1WJSA 1G3YA 1TH7A 4DA4A 2O4XB 3OYNA 4MDWA 2GF7A 3HSBA 1BI0A 2QA4T 4C8QF 2KSSA 5GANh 4C92B 1HK9A 3V7CA 1YJ9T 4XQ3A 3G4SA 3TU4K 3FDRA 2DD4A 1NPPA 3GNGA 4J7IA 3WVEB 5FLXE 2FYKA 3R6OA 3VJPA 5CCAA 5FU6B 3NTHA 3QZ9B 4KT0E 5LL6S 4YTLA 3RESA 4N0AA 2RI5A 2E12A 2RM4A 2Y4XA 4M75B 4O5VA 3CD6T 5C0MA 4A4GA 2JTFA 3ASKA 1M8VA 4ZGEB 3N5BB 1VQ9T 2JN0A 3URGA 2R5MA 4FT4A 5HK0A 2KQWA 2E65A 2VXEA 3P8BB 1BKBA 1WNLA 4J6YA 3QO3A 3LWIA 4C0DB 3SFMA 3FIFA 3X20B 2E6NA 2KDSA 5GMKi 3GPLA 4JRQA 1QVGA 3OYKA 3A8LB 1M1FA 2Y4YA 5GAN8 4C92E 5KCOA 3JRZA 2PVOB 4PKCC 3L2VA 3GLXA 4RG8A 1FWZA 1XOVA 3QZ5B 2XIDA 1UGRB 4XTVA 4XTUA 1UGSB 2CZ0B 4D6WA 1YHQA 1X01A 3I56A 3CCUT 2DO3A 4Z02A 1R8OB 3CC4T 1Q81C 5GMKe 5EG2A 2QQRA 3VYHB 2ZPBB 2MWPA 5KE3A 2RHXA 3QXEB 2JTMA 2DAQA 1K73U 2DXUA 4M75E 1U1TA 3J81E 1WQWA 3OYGA 4ELZC 4B9XA 5LJ3g 1P92A 3UT1A 4BE0A 3JCMV 4RCBA 1W4SA 5GAOp 4IUVA 5C6SA 2K5IA 3X24B 4A4FA 1LNXA 4FU6A 4C92C 2V8IA 2KMTA 3JSCA 2YHTA 4BI4A 4M7DD 4ZGJB 3VU3C 3CCMT 5GAN5 4PLIA 3M59A 5LJ5e 4BE2A 5FROA 3ZEHA 2DXCA 4HT8A 4OGCA 1VQ5A 3JCMd 1FX7A 4F7UG 4MZPA 3C12A 4A4HA 4EPCA 2XK0A 3GOXA 1I8FA 3G7ZA 3T9NA 4M77D 4JJNK 2QDYB 2L89A 2LTOA 3LX7A 2E1HA 4PLLA 5CKBA 3UWNA 4BDZA 1NJIC 2XKOC 4M75A 1VQPT 5DLOA 1N8RC 3JCMb 1BI2A 3CPWA 3CBPA 3HKSA 3OS1A 3S6WA 1VUBA 2P0PA 1PSFA 4WF2A 2ZPGB 4C0DC 4EMKA 4PJOG 3JCMW 3JB9G 2E41A 4M78G 2RJEA 5FU7B 1Y96B 2DTIA 2X4JA 3SB2A 2A3LA 1M90U 2ZPEB 3RIRA 4JRKA 4EDUA 5LJ3e 1DJ7B 2ZPFB 4JRIA 2P0KA 1JBMA 5I2MA 2DXTA 4ZN1A 5GAN7 3CCLT 4V2SA 4NL3A 2QQAA 3C94A 1LOJA 3GF5A 4ME7A 5GANd 4BDYA 1VQNT 4OB2B 4EMHA 4M7AG 2LQKA 3ER0A 3I56T 3OA6A 3CCEA 3OYLA 4QQ6A 2K3YA 2I2LA 3FEOA 5D6WA 3OYAA 2X4XA 4MMLA 1YJNT 1KD1U 4BACA 3MEVA 2FVUA 2GCXA 3PGGA 2VV5A 4M75F 1NJIU 1XQHA 3E9GA 3CCQA 1LJOA 5GAOn 3OYBA 1N8RU 3LYIA 3KBGA 3JB9D 2DTHA 4XAXB 2EQKA 4PJOD 3WVDB 2EYQA 1FXXA 1M1KU 2LCLA 1ZHIA 4N4HA 1X6OA 1VQ7A 2CYZB 3E9FA 5LJ5j 4C8QC 2QI2A 2VGNA 5A0DA 3AHUA 3PMTA 4R56A 1K9MU 4II1A 1UGPB 3Q1JA 2WSCE 4TVRA 3QPHA 5GAMe 4XTYA 2C06A 2VC8A 5FU7C 3M56A 3RKWA 2JUFA 2IVWA 1Y96A 3SDZA 1VQLT 5HKCA 2OTLA 2HD0A 4M78A 2DTOA 3C95A 5LJ3j 4QQGA 5I21A 3QYHB 2XDDA 1I5LA 1N9RA 4J8OA 1VQ6T 3VYGA 4RG2A 3PTAA 3V8LA 1VQ8T 2M9UA 2R58A 4FSXA 4HKEA 4CRIA 4JRPA 1XNIA 4QVCA 3H6ZA 3H8ZA 5CIUA 4M7AA 3CC7T 3G6ET 2LT1A 1PSEA 4RCCA 4GY5A 3QKJA 3TREA 1HXDA 3L1AA 3CPFA 3SWNB 1K73C 3CMAA 1YITT 3CCQT 3JB9H 4C0FA 2MI6A 4N0AC 4C5IA 2MF2A 2LDMA 2DPPB 2DK3A 2EAYA 2GFUA 4BD3A 3GP8A 1YIJT 4ZGDB 3QDRB 2BUDA 1X75C 5CKEA 4M78F 4OB3B 4Q5WA 5J26A 3VUBA 2DXBA 4EMKB 3KXTA 3CCVA 1Q7YU 2DKGA 4M7DG 5CVIA 2QEXA 4BUGA 3CC2T 2EQUA 2WSFE 1YI2A 3C4SA 2FL7A 2LNVA 2EWNA 2KK4A 5AYFA 5GAMj 3HRTA 3RKYA 3CMET 3CCST 4M7AF 3PNWC 4FT2A 4M77G 3OYFA 3DLLA 2A7YA 2XICA 3NTIA 5A0LA 2F5TX 3OYCA 3OYJA 1JB0E 5DY9A 1H3ZA 5GAOl 2LVMA 2EFIA 2CGHA 4HCBA 4O6JA 2QTXA 4N4IA 3LWHA 3SD4A 3QBYA 4LDYA 1VQKA 2OTLT 5CQXA 3INZA 1M90C 3GIBA 3QHSA 1RI0A 3PMIA 4A4KA 5CKFA 2DZCA 2RHYA 3V7RA 2RK1A 3S3NA 4JLIA 4OF1A 4C92D 5LJ5h 3G71A 1S72A 1VQMA 2RHUA 2XU8A 4E7LA 3MP1A 3X25B 4BI8B 5LJ3f 1UGQB 3J80E 2OTJA 4ZTJA 4IUUA 4EMGA 3TCJA 4M7DE 3S3MA 2JNGA 3SWNC 3MEWA 1N6AA 3G4ST 3SWNA 5FU6C 4FIBA 3E1SA 2E10A 4XU2A 1RL2A 3HHTB 1KD1C 1GXIE 4M75C 3JB9J 4J7FA 4X9DA 4F7UB 2EJ9A 5IN1A 5M9OA 1QVPA 3S3OA 1YJWA 3KUFA 3OS5A 1MGQA 3V8KA 4DQ2A 4QQDA 4EMKC 5J39A 4ELYC 1M1KC 3JCMJ 2HBPA 3CBOA 5LJ3h 3BDUA 3CCRA 2K4YA 5GAN3 4XU1A 2QQ9A 5L8RE 3PFSA 3NFCA 4ZN3A 3JCMQ 3BDLA 2R5AA 3LLRA 1N27A 4C8QG 4GLKA 4M78B 4M7DA 4KBMB 2RJCA 1K9MC 1BI1A 4C0GA 3P8DA 3LH0A 3M53A 3VV0A 2RB6A 3OBWA 5J3BA 2D9TA 4X34A 2EQMA 2K3XA 2RHZA 2ZZDA 3I55A 3HPWA 1YHQT 2E6ZA 4ATOA 3V7SA 4M77A 4DOWA 1VQ4A 4QVDA 4F7UE 5GMKj 4M7AB 5GAMf 1B34B 2L5QA 3FLGA 5FRMA 3UPUA 4L5GA 2XG8D 3EFSA 2P4TA 4OVAA 3HRUA 4BY6B 5KE2A 1JRIA 3UDCA 3L2UA 5HY6A 4L6V5 4LD6A 2PU9B 3OS2A 1Q86C 2JVVA 5CAIA 3HP9A 4Y28E 2K57A 4QW2A 3QJYA 2ZPHB 2ZPIB 1SSFA 2EKOA 4IKFA 4J6XA 4PJOE 1QP2A 4M78E 3OYMA 2DD5A 1OYXA 2VUBA 4C8QD 1Y07A 1UEBA 2DIQA 2ZCFB 3LW5E 1W2BS 2E5QA 4M7DF 3JCMg 3A8HB 5GAMh 1BI3A 1VQ5T 2RK2A 1VQOA 5CO7A 5DM7R 5GAOr 5IT9E 1YJ9A 2BIVA 4LDWA 2K5FA 4A4EA 4ZTFA 1BIAA 4F7UA 3QG1A 4M7AE 3OS0A 3HFNA 2RD1A 3M9QA 4M77F 1QW1A 2EJGA 3DLMA 4C0ZA 1KQ2A 4JS4A 4B9WA 3MHXA 3FC3A 3CD6A 3JCMP 2VXFA 2G3RA 2X4YA 3DKMA 2F5KA 4M78C 4OGEA 4PJOA 3MP8A 2RJDA 4JUVA 1Q7YC 2RI2A 1Q86U 1VIEA 5LJ5d 1NE8A 2GQVA 4BE1A 5I2SA 3NTKA 1WGSA 3RKXA 2DVEA 3OMGA 2BKDN 4OB0B 5DLQE 5GANg 4HT9A 4FM4B 3V8JA 4DOVA 1NPRA 5D6XA 2P0QA 4M7AC 1G3TA 2CZ7B 4E7KA 3CCET 2XDBA 4OB1B 3TEEA 1B34A 3JCMe 3F70A 3P8HA 3FRNA 4Y91A 2LC4A 4BY6C 3L2WA 3CCUA 3JAME 3QIIA 4F7UF 2E70A 5CKDA 3CC4A 2PVGB 2NLUA 2M1HA 1IZ6A 1V29B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS1 A;  3SD4 A;  3S6W A;  3QBY A;  1MHN A;  4IUR A;  2L3R A;  1RI0 A;  3PMI A;  3DB4 A;  2RJE A;  2RHY A;  3S3N A;  4EDU A;  4N4G A;  3O8V A;  4C5H A;  2P0K A;  2RHU A;  4E7L A;  2PQW A;  2EQJ A;  3MP1 A;  1OZ2 A;  4IUT A;  1WJR A;  2HQX A;  4IUU A;  4ZTJ A;  2CKK A;  3S3M A;  3L2Q A;  4BDY A;  3MEW A;  1G5V A;  3OYE A;  3OA6 A;  3DB3 A;  3OYL A;  4QQ6 A;  2K3Y A;  3LGL A;  1WJQ A;  2RJF A;  3FEO A;  5D6W A;  3OYA A;  2X4X A;  3L2R A;  1KHC A;  4BAC A;  2L8D A;  2RHI A;  3MEV A;  2MWO A;  5M9O A;  2JZ2 A;  5IN1 A;  3S3O A;  2M0O A;  3E9G A;  3MP6 A;  2FHD A;  3QJ6 A;  3KUF A;  3MET A;  3MEU A;  3CEY A;  4FL6 A;  4QQD A;  5J39 A;  3LYI A;  3OYB A;  3OYD A;  2EQK A;  2GFA A;  5KH6 A;  4C5E A;  3PFS A;  2HQE A;  4N4H A;  1WJS A;  2O4X B;  2R5A A;  3BDL A;  1N27 A;  3E9F A;  3LLR A;  4QVZ A;  3OYN A;  4BE2 A;  2GF7 A;  3OYI A;  2RJC A;  4NS5 A;  3OY9 A;  3P8D A;  2R57 A;  3LH0 A;  3PMT A;  1OZ3 A;  2YRV A;  3MO8 A;  4II1 A;  2D9T A;  3Q1J A;  4X34 A;  2EQM A;  2IG0 A;  2K3X A;  2RHZ A;  2M16 A;  3FDR A;  3MEA A;  4HCZ A;  3FLG A;  4C5G A;  2DIG A;  4L59 A;  3NTH A;  5FRM A;  1OI1 A;  3OYH A;  4OVA A;  3ME9 A;  3OMC A;  2RI5 A;  5KE2 A;  3L2U A;  4LD6 A;  5C0M A;  2RO0 A;  4A4G A;  2JTF A;  2O4X A;  3ASK A;  3OS2 A;  4QW2 A;  2R5M A;  1SSF A;  2EKO A;  2QQS A;  2RI3 A;  4IKF A;  4QQG A;  3OYM A;  1OYX A;  2E6N A;  5KCH A;  2DIQ A;  4RG2 A;  3OYK A;  2E5Q A;  2R58 A;  5KCO A;  2XDP A;  4CRI A;  3L2V A;  2LRQ A;  1XNI A;  3H6Z A;  3H8Z A;  3OB9 A;  5CIU A;  2BIV A;  4A4E A;  4ZTF A;  2LCC A;  4GY5 A;  3QKJ A;  4Z02 A;  3OS0 A;  2QQR A;  3M9Q A;  2MWP A;  5KE3 A;  2RHX A;  3DLM A;  5FRN A;  4C5I A;  2DAQ A;  3L42 A;  4B9W A;  3OQ5 A;  2LDM A;  2WAC A;  2GFU A;  4BD3 A;  2B8A A;  3OYG A;  4B9X A;  3FC3 A;  4E7J A;  2X4Y A;  2G3R A;  3UT1 A;  4BE0 A;  2F5K A;  3MP8 A;  2RJD A;  2BUD A;  4IUV A;  5C6S A;  2RI2 A;  4A4F A;  4FU6 A;  4Q5W A;  5J26 A;  5IAY A;  4E7H A;  2X4W A;  4BE1 A;  4PL6 A;  3NTK A;  3LGF A;  4PLI A;  4UC4 A;  3EAE A;  2EQU A;  1WGS A;  5FRO A;  3OMG A;  2X35 A;  2BKD N;  3C4S A;  5D6Y A;  3ZEH A;  5D6X A;  4E7K A;  4A4H A;  2XK0 A;  3GOX A;  3F70 A;  3P8H A;  3PNW C;  3UWN A;  2L89 A;  2LTO A;  3LX7 A;  3NTI A;  4PLL A;  3QII A;  4IUP A;  3OYF A;  3OYC A;  3OYJ A;  3L2W A;  4BDZ A;  1H3Z A;  2LVM A;  4E7I A;  2EFI A;  2VYT A;  4IUQ A;  2NLU A;  2M1H A;  4N4I A; 
#chains in the Genus database with same CATH topology
 2CT4 A;  2HNI A;  5LJ3 d;  1TUD A;  3CXC S;  3A8O B;  2EQJ A;  2RA2 A;  3CCM A;  2HQX A;  5FW9 A;  3X26 B;  2VAS A;  2W0Z A;  3DB3 A;  2KE9 A;  2QGG A;  1QP3 A;  1T3L A;  1W2B P;  4XTZ A;  1Y71 A;  2BZY A;  1AWX A;  3A5Z B;  4M77 B;  2YLB A;  3CEY A;  2YRC A;  2NUP A;  4JPB W;  4X9C A;  1YBY A;  1YWP A;  2E3H A;  1K9A A;  2DZ9 A;  3BW1 A;  3I35 A;  4JDS A;  3M0T A;  3PIO A;  2DIG A;  2OI3 A;  4DEX A;  2A28 A;  3OMC A;  4KGX B;  2QXF A;  1G3W A;  4NOY A;  1Q82 U;  1SRM A;  1W70 A;  4E7Z A;  2MYS A;  4C92 A;  4M7D C;  4JS5 A;  4PJO B;  1YP5 A;  2FRW A;  5KYY A;  4FSS A;  5GAN j;  3CCS Q;  2KRS A;  4E2F B;  2WSE E;  4MZT A;  4D8K A;  5IH2 A;  5KYU A;  5FRN A;  3M58 A;  5CK9 A;  4VUB A;  4E7J A;  2XD0 A;  3G71 T;  5IAY A;  4IIM A;  2LMJ A;  4PL6 A;  1D1A A;  1VQ8 A;  2JXB A;  2V26 A;  2DEQ A;  2HAX A;  1KIK A;  1IO6 A;  1SEM A;  3ZFJ A;  4RTZ A;  1JXO A;  1OU8 A;  1YIJ A;  1K8A C;  1I81 A;  2NUP B;  4C8Q A;  1AD5 A;  1N5Z A;  1A0N B;  2C0O A;  1O75 A;  1UJY A;  2FO0 A;  4OP0 A;  1RAF B;  1X69 A;  3I56 Q;  3I55 T;  3CME A;  1JO8 A;  1D3B A;  2RH2 A;  4RTT A;  4XK8 E;  2QGF B;  1KC8 U;  4A53 A;  2L8D A;  1K4U S;  2M0O A;  4F17 A;  3HL8 A;  3ZL7 C;  2AKK A;  3JB9 I;  5HCK A;  4D8D A;  1G3Y A;  1Z9Z A;  3HSB A;  2FPF A;  1I07 A;  4C92 B;  3GNG A;  5KYY B;  3R6O A;  1GFC A;  5FU6 B;  2RNA A;  4YTL A;  3RES A;  2KXC A;  2NUZ A;  4N0A A;  5C0M A;  3ASK A;  5KYU B;  1M8V A;  3N5B B;  5D7U A;  2R5M A;  1Y0M A;  2VXE A;  3P8B B;  4J6Y A;  3QO3 A;  2SEM A;  2DX1 A;  3OYK A;  3A8L B;  2ROL A;  2KYM A;  3JRZ A;  3L2V A;  1KK7 A;  3QZ5 B;  4XTV A;  4J9F A;  1R8O B;  2QQR A;  3VYH B;  1PM3 A;  2RHX A;  3QXE B;  1SSH A;  3H0I A;  2JTM A;  3CCQ Q;  1K73 U;  2DEU A;  3J81 E;  1P92 A;  4BE0 A;  3JCM V;  1PRL C;  2YWW A;  5C6S A;  2JW4 A;  2KMT A;  2YHT A;  3VU3 C;  5GAN 5;  4PLI A;  4BE2 A;  4OGC A;  1ZX6 A;  3VRY A;  4F7U G;  1NG2 A;  4Z89 A;  3CME Q;  3CXC P;  3GOX A;  1OPK A;  2CP5 A;  2QDY B;  4PLL A;  2XKO C;  4M75 A;  1VQP T;  1BI2 A;  3HKS A;  3S6W A;  4RUG A;  2DMO A;  2OTL Q;  1PSF A;  3JCM W;  3SB2 A;  1M90 U;  2ZPE B;  2KXD A;  2ATC B;  1DJ7 B;  2O9S A;  1JBM A;  5I2M A;  2DXT A;  4Z88 A;  3QDF A;  1PKT A;  5GAN d;  1RAI B;  4KGZ B;  2LQK A;  4FYY B;  2RPN A;  4WCI A;  4QQ6 A;  2I2L A;  3FEO A;  1IGQ A;  2O88 A;  3MKD A;  3MEV A;  4LXC A;  2HKN A;  2J7I A;  1RAA B;  3KBG A;  4ANJ A;  1AWO A;  2EQK A;  1M1K U;  2EYW A;  2LCL A;  4CC3 A;  2QEX Q;  5LJ5 j;  2QI2 A;  3TSZ A;  3AHU A;  5GJV B;  1NLO C;  4R56 A;  3EG0 A;  1UHC A;  3Q1J A;  2WSC E;  4TVR A;  1WYX A;  2E4H A;  1BU1 A;  5FU7 C;  1D0X A;  1ZUU A;  3RKW A;  2JUF A;  2IVW A;  1Y96 A;  3SDZ A;  2DNU A;  2HD0 A;  2RQW A;  2JM9 A;  2OTJ Q;  2MPX C;  4J8O A;  3VYG A;  3PVL A;  2M9U A;  2R58 A;  1XNI A;  3H8Z A;  3C0C A;  2YUN A;  1PSE A;  4RCC A;  4GY5 A;  3TRE A;  3L1A A;  2C0I A;  1YIT T;  1ABQ A;  2JS0 A;  4C5I A;  2ROT A;  2EAY A;  2AKL A;  2BUD A;  3TVT A;  2J6O A;  1Q7Y U;  5CVI A;  4BUG A;  1YI2 A;  2KEA A;  3GBQ A;  3DLL A;  3NTI A;  2F5T X;  3OYC A;  2H3E B;  4HCB A;  4JJD A;  4O6J A;  1OX9 A;  4PFZ A;  3SD4 A;  4DEY A;  3INZ A;  3PMI A;  4A4K A;  2DZC A;  2CSQ A;  1S72 A;  2RQR A;  1ZA2 B;  4BI8 B;  4EMG A;  3TCJ A;  4M7D E;  3MEW A;  1C0M A;  2E10 A;  1PCX A;  1RL2 A;  1WDX A;  4IIO A;  1GXI E;  2C0T A;  4J7F A;  4X9D A;  4OMQ A;  2VWF A;  1G83 A;  1SPK A;  5EC7 A;  3SEM A;  2GNC A;  3CD6 Q;  3JCM J;  1K1Z A;  5LJ3 h;  3CCR A;  4XU1 A;  2KGT A;  2GQI A;  2COZ A;  3JCM Q;  3BDL A;  2KR3 A;  4GLK A;  4KBM B;  2RJC A;  2JM8 A;  1N8R R;  3CCU Q;  3CC4 Q;  4ATO A;  2KBT A;  4F7U E;  5GMK j;  5GAM f;  3FLG A;  2L5Q A;  1MNE A;  1VOM A;  3HRU A;  5KE2 A;  3L2U A;  1Q86 C;  5CAI A;  2J06 A;  2ZPI B;  5ECA A;  1SSF A;  4AFU C;  2D1X A;  1ARK A;  1VYU A;  2VUB A;  1Y07 A;  1W2B S;  1R77 A;  3JCM g;  3A8H B;  1VQ5 T;  2RK2 A;  5DM7 R;  1YJ9 A;  4X1V A;  5IT9 E;  2K5F A;  2LZ6 B;  3M9Q A;  2EBP A;  1ZSZ A;  1AWJ A;  4OMP A;  4C0Z A;  1ACM B;  1KQ2 A;  1QMC A;  3FC3 A;  2CH4 W;  2X4Y A;  4M78 C;  5IXB A;  4HXJ A;  3RBB B;  2RI2 A;  4RTW A;  2HCK A;  5LJ5 d;  2GQV A;  5I2S A;  3RKX A;  2JJ9 A;  2W10 A;  3MJX A;  2P0Q A;  4E7K A;  2XDB A;  3P8H A;  3FRN A;  2LC4 A;  3L2W A;  2YUQ A;  5CKD A;  4RTX A;  1QLY A;  2NLU A;  3FJP A;  1NZ9 A;  2CZ6 B;  4OMO A;  3DB4 A;  3M5A A;  3FB9 A;  1G3S A;  2DBK A;  2CP3 A;  1VQ7 T;  1OQK A;  1U3O A;  2ESW A;  2PQW A;  2AHJ B;  2LJ3 A;  5GAO m;  1K73 R;  5LJ5 f;  3OSS C;  4DBR A;  3EFR A;  2VVK A;  1R0C B;  5L23 A;  2LQ8 A;  1Q82 C;  2VGM A;  5GAN 4;  3RUX A;  4FL6 A;  2IPO B;  3VS0 A;  4NL2 A;  2YSQ A;  4GLM A;  4OMF B;  2HQE A;  1WX6 A;  2J05 A;  3VS4 A;  2VKN A;  1M4Z A;  1OOT A;  2CH4 A;  1VQ6 Q;  2D0Q B;  2CP2 A;  2QA4 Q;  3OY9 A;  1JJ2 S;  1HYO A;  1VQN A;  3CC7 Q;  2YRV A;  4HCZ A;  2M16 A;  2MOX A;  1M5Q 1;  2AT1 B;  1YJN A;  1UB4 A;  4L59 A;  2CP7 A;  3ME9 A;  1KQ1 A;  3M54 A;  4R55 A;  3OW2 S;  2OX7 A;  2YRD A;  4LDV A;  3M57 A;  3A8M B;  4AFZ C;  4Y92 A;  5CQY A;  3CCV T;  3CC2 Q;  1PWT A;  5KCH A;  5GAN 2;  2RF0 A;  2XI9 A;  1BBZ A;  3EGX B;  1W1F A;  1KG1 A;  3OB9 A;  1H8K A;  1E7O A;  3OYY A;  1RLP C;  1VIF A;  1WHJ A;  4M77 C;  1BYM A;  2YXY A;  1M1K R;  3R6N A;  1WHK A;  1WA7 A;  2EPD A;  3L42 A;  2KAF A;  3OQ5 A;  1VQK T;  4HCC A;  2B8A A;  1AZG B;  1PC0 A;  4J83 A;  3OSV A;  1VQM T;  4E7H A;  1E6H A;  3EAE A;  5D6Y A;  4AMC A;  5FWC A;  2L3Q A;  1KC8 C;  2K6D A;  3ZBD A;  2ED1 A;  3G6E A;  4IUP A;  3JCM f;  2VYT A;  1UHF A;  4XU0 A;  4IUR A;  2L3R A;  1SKU B;  1GBR A;  4PJO C;  2PUK B;  4J9E A;  3O8V A;  4C5H A;  1BIB A;  2PUO B;  5HK3 A;  1RLQ C;  1YCS B;  4ZNX A;  3L2Q A;  4M7A D;  1QCO A;  2YLC A;  1IRE B;  3CCS A;  2OAU A;  1KQS P;  1X43 A;  1K8A R;  4J5Y A;  1M1G A;  2MWO A;  1FYN A;  1WHM A;  1Q7Y R;  2YUP A;  3I5S A;  3OYD A;  3UA7 A;  3CPW S;  3PE0 A;  1TH7 A;  2M02 A;  3UAT A;  2GF7 A;  2KSS A;  5GAN h;  1ZA1 B;  2F2W A;  3FDR A;  2DD4 A;  1NPP A;  5FLX E;  3WVE B;  5CCA A;  2FYK A;  3VJP A;  3QZ9 B;  5LL6 S;  4CC4 B;  2Y4X A;  1HSQ A;  1Y57 A;  2JN0 A;  3URG A;  5HK0 A;  2KQW A;  3LWI A;  1TG0 A;  1JEG A;  4C0D B;  3FIF A;  2KDS A;  1QVG A;  3GPL A;  1M1F A;  4PKC C;  4E6R A;  4RG8 A;  2KT1 A;  2XID A;  3G6E Q;  2MIO A;  4RTY A;  5GJW B;  3I56 A;  4Z02 A;  1Q81 C;  1FMK A;  2CDT A;  5EG2 A;  5GMK e;  1QVF P;  3NHN A;  3OYG A;  4B9X A;  3UT1 A;  4E7S A;  4C92 C;  2V8I A;  4M7D D;  4ZGJ B;  3CCM T;  5FRO A;  2DXC A;  1H3H A;  2DYB A;  3UF4 A;  4A4H A;  4EPC A;  2XK0 A;  1AWW A;  1TOV A;  2HMA A;  5DLO A;  3CBP A;  3OS1 A;  1VUB A;  3JB9 G;  4WF2 A;  1NYF A;  1GRI A;  4PJO G;  2X4J A;  2A3L A;  8ATC B;  3RIR A;  4EDU A;  5LJ3 e;  2L0A A;  4JRI A;  5IHI A;  4V2S A;  1JQQ A;  2HBW A;  1V76 A;  3GF5 A;  4M7A G;  4OB2 B;  3EGU A;  3ER0 A;  1PD1 A;  3RR6 A;  3OA6 A;  3I56 T;  3CCE A;  2DF6 A;  5D6W A;  1WZO A;  2X4X A;  2FVU A;  1XQH A;  3CCQ A;  1JJ2 P;  1LJO A;  1N8R U;  3LYI A;  3WVD B;  1FXX A;  4R0K A;  4J9I A;  1ZHI A;  4N4H A;  4C8Q C;  1M3B A;  4HVW A;  2VGN A;  3OW2 P;  2C06 A;  4OMN A;  1BCO A;  1V1C A;  2DL5 A;  2EKH A;  1MND A;  2OTL A;  1E6G A;  2DTO A;  2YT6 A;  3C95 A;  5I21 A;  2HSE B;  2G6F X;  2AK5 A;  1VQ8 T;  1OUL A;  4CRI A;  4FYW B;  5CIU A;  1TTH B;  2LT1 A;  1WXB A;  1LVK A;  3CMA A;  3CCQ T;  3JB9 H;  2M0Y A;  4N0A C;  2MF2 A;  2GFU A;  4BD3 A;  1D0Z A;  1YIJ T;  1OU9 A;  2K79 A;  2MK5 A;  2FZG B;  4M7D G;  2QEX A;  2DA9 A;  2WSF E;  3O5Z A;  2KK4 A;  5AYF A;  5GAM j;  3I55 Q;  3CCE Q;  3CME T;  4M7A F;  3OYF A;  2XIC A;  1C1A A;  4PJJ A;  5A0L A;  2I0N A;  2QTX A;  1UE9 A;  3QBY A;  2OTL T;  2COW A;  5CQX A;  3GIB A;  3QHS A;  1RI0 A;  2PNI A;  5LJ5 h;  2NUT A;  3MP1 A;  3X25 B;  2OTJ A;  1UGQ B;  1VQO Q;  4LUE A;  1KSW A;  1N6A A;  2QAS A;  2EGA A;  1B07 A;  3HHT B;  3CPW P;  1KD1 C;  2DFU A;  4M75 C;  4F7U B;  2EJ9 A;  5IN1 A;  1YJW A;  4DQ2 A;  3OS5 A;  4ELY C;  1RAH B;  3PFS A;  2ZAE A;  4C8Q G;  1ZUK A;  1OEB A;  1K9M C;  1NJI R;  3M53 A;  3VV0 A;  3REB B;  4X34 A;  2EQM A;  1QKW A;  2E6Z A;  3V7S A;  1VQ4 A;  2KT8 A;  4QVD A;  3CMA Q;  4WTO B;  2A37 A;  2JMC A;  3H0H A;  5HY6 A;  4LD6 A;  4Y28 E;  1WHG A;  4QW2 A;  3QJY A;  4CC7 A;  2HDA A;  4DBH A;  4J6X A;  4PJO E;  1JXM A;  3OYM A;  2DD5 A;  1OYX A;  4FW2 A;  4F16 A;  3LW5 E;  1HJD A;  4J9C A;  4M7D F;  1U06 A;  3D7S B;  1X6B A;  2PTK A;  4A4E A;  3M0Q A;  4ZTF A;  1BIA A;  3QG1 A;  1WLP B;  1ABO A;  4M7A E;  1VQP Q;  3NMZ C;  4LNP A;  1H92 A;  3CD6 A;  4OGE A;  1Q95 G;  3HTR A;  2RJD A;  4JUV A;  3CCJ Q;  1VA7 A;  1VIE A;  2FZC B;  1RAG B;  2BKD N;  4OB0 B;  2NUT B;  4FM4 B;  2EW3 A;  4OB1 B;  3TEE A;  2CSI A;  3BE3 A;  1YFN A;  1UDL A;  3CCU A;  3CC4 A;  3VS3 A;  4F7U F;  2E70 A;  1GBQ A;  1D1B A;  1WJQ A;  1YJW Q;  3M55 A;  3EH2 A;  2Y90 A;  1K8A U;  3RMS A;  2QG9 B;  1PKS A;  2DER A;  3M0U A;  5GMK m;  2D8J A;  1I5O B;  3HRS A;  1M9S A;  2EJF A;  2FRY A;  5GAO q;  3OYE A;  1ZQ1 A;  5GAN e;  4MMK A;  1D09 B;  2CS7 A;  5GMK h;  1VQ4 Q;  9ATC B;  2RJF A;  3EG2 A;  4M75 G;  2RHI A;  5GMK l;  3J7A F;  2XHC A;  3MET A;  4PJL A;  2X9H A;  1GCP A;  2MMP A;  4C5E A;  3VS6 A;  4PNO A;  1D1C A;  3WXM B;  4QVZ A;  3CCL A;  3OYI A;  4CI0 C;  4NS5 A;  2R57 A;  3BFM A;  1OZ3 A;  5GAM d;  1SF9 A;  3MO8 A;  3M4G A;  3MEA A;  2E64 A;  1YIT Q;  4C5G A;  1GL5 A;  1OI1 A;  3OYH A;  2O4X A;  2PVD B;  1VQ9 Q;  1B3Q A;  2AZV A;  3H41 A;  2QQS A;  1KQS S;  2V8J A;  1YI2 T;  1M2V B;  2D6F A;  2LRQ A;  2HZY A;  2BTT A;  3MCA B;  4K11 A;  1NLP C;  1XTD A;  3AT1 B;  2F1L A;  4BI3 A;  1MUZ A;  3CXC A;  4E47 A;  4XTX A;  2V1R A;  1RAE B;  1VQL A;  2DL8 A;  1S72 T;  4F14 A;  3VUZ A;  3E19 A;  1B7T A;  2OJ2 A;  4LDX A;  3LGF A;  3HFO A;  1VQ6 A;  2F69 A;  2X35 A;  2MCN A;  4C8Q E;  2QA4 A;  3QUI A;  1QQJ A;  1H64 1;  3X28 B;  2LX9 A;  4LDU A;  1WHH A;  2V8K A;  3CC7 A;  2DET A;  3RER A;  3RMQ A;  4XU3 A;  1YCY A;  1ZSZ C;  2CZ1 B;  4E7I A;  4IUQ A;  4EIK A;  3VS7 A;  1MHN A;  1NBE B;  1SHF A;  4M78 D;  3CCR T;  1UGV A;  2P4R A;  1N9S A;  5GAN 6;  3CCL Q;  3EGX A;  3RDV A;  4IUT A;  1CSK A;  1WJR A;  2H3J A;  4PFO A;  3CC2 A;  1QVF S;  2EIF A;  2CKK A;  2GTO A;  1BCM A;  2JOY A;  4KGV B;  2DRK A;  4J6W A;  1AHJ B;  3L2R A;  1ZBX A;  2AIR B;  4JJC A;  3MP6 A;  3A8G B;  1PRM C;  2EGE A;  3MEU A;  1NEG A;  2F2V A;  1WPY A;  3M0P A;  4DA4 A;  2O4X B;  3OYN A;  4MDW A;  1BI0 A;  2QA4 T;  1VQ5 Q;  1SG5 A;  1YJ9 T;  3G4S A;  2DLP A;  1EFN A;  4J7I A;  1MMA A;  3NTH A;  4KT0 E;  2KRN A;  4PJN A;  4PJM A;  4DBF A;  2E12 A;  2CUB A;  4O5V A;  1VQL Q;  4LE9 A;  4A4G A;  2JTF A;  1QVG P;  4ZGE B;  1LPL A;  2E65 A;  1BKB A;  1WNL A;  2JTE A;  2EYZ A;  2K7A A;  3X20 B;  2E6N A;  3EHQ A;  5GMK i;  4JRQ A;  2J6K A;  5GAN 8;  2PVO B;  1FWZ A;  1XOV A;  2EGC A;  4XTU A;  1GFD A;  2A36 A;  1YHQ A;  2RQT A;  2MWP A;  2DAQ A;  2DXU A;  4M75 E;  3TQ7 P;  5I11 A;  4ELZ C;  5LJ3 g;  4LN2 A;  1X27 A;  4RCB A;  1VQ7 Q;  5GAO p;  3H0F A;  1OV3 A;  4IUV A;  3X24 B;  4A4F A;  3JSC A;  4BI4 A;  3QWY A;  3M59 A;  5LJ5 e;  2KNB B;  1Q81 R;  4HT8 A;  1BB9 A;  3JCM d;  1FX7 A;  3C12 A;  3G7Z A;  3T9N A;  4M77 D;  2LP5 A;  2E3I A;  2L89 A;  2LTO A;  3LX7 A;  2E1H A;  3UWN A;  4BDZ A;  1M27 C;  1UTI A;  1N8R C;  3JCM b;  2GGR A;  4C0D C;  2ZPG B;  4EMK A;  2E41 A;  4M78 G;  2DTI A;  1MMD A;  4ZN1 A;  1PHT A;  4J9H A;  4NL3 A;  2QQA A;  3C94 A;  4BDY A;  1VQN T;  4EMH A;  3G4S Q;  3TSW A;  3LH5 A;  2K3Y A;  3OYA A;  2GTJ A;  4MML A;  1YJN T;  4BAC A;  2GCX A;  2NWM A;  3PGG A;  2VV5 A;  1NJI U;  1TXQ A;  3UA6 A;  2ED0 A;  3JB9 D;  2DTH A;  4XAX B;  4PJO D;  2EYQ A;  1TU0 B;  4PFP A;  1X6O A;  2BE7 D;  4OML A;  3H9N A;  1G8X A;  5A0D A;  3PMT A;  2M51 A;  3REA B;  4II1 A;  1UGP B;  3QPH A;  3VS1 A;  1YHQ Q;  4XTY A;  3M56 A;  4HVU A;  1X2Q A;  1VQK Q;  3IQL A;  5HKC A;  2JMA A;  1VQM Q;  3EGD A;  2XDD A;  2DM1 A;  3V8L A;  3FJ5 A;  4FSX A;  4HKE A;  2YDL A;  4JRP A;  4QVC A;  3H6Z A;  4M7A A;  3G6E T;  1HXD A;  3SWN B;  1TS9 A;  1K73 C;  1TUG B;  4C0F A;  4F04 B;  2Z0W A;  2DPP B;  3GP8 A;  2BZ8 A;  4QT7 A;  2KRM A;  2LJ1 A;  4ZGD B;  2FPE A;  3QDR B;  3JV3 A;  2RMO A;  1X75 C;  2E5K A;  4M78 F;  5CKE A;  4OB3 B;  4Q5W A;  2DXB A;  4EMK B;  2EQU A;  2YUO A;  3C4S A;  3G1J A;  2LNV A;  4FYX B;  2EWN A;  3CCS T;  3PNW C;  4FT2 A;  4M77 G;  2A7Y A;  4ORZ A;  3OYJ A;  2RQV A;  1JB0 E;  5DY9 A;  1H3Z A;  2CUD A;  2CGH A;  2EFI A;  4N4I A;  3LWH A;  4LDY A;  1M90 C;  3V7R A;  1MV0 B;  2RK1 A;  3S3N A;  4JLI A;  4C92 D;  3G71 A;  2XU8 A;  5LJ3 f;  1UG1 A;  3J80 E;  4ZTJ A;  4IUU A;  2O31 A;  2JNG A;  4PK4 A;  1AOJ A;  5FU6 C;  4FIB A;  6AT1 B;  3E1S A;  4XU2 A;  2K9G A;  3A1P A;  3JB9 J;  4QKU A;  3THK A;  3S3O A;  3I5R A;  1EZZ B;  1M8M A;  1MGQ A;  3V8K A;  4QQD A;  1C6V X;  1M1K C;  2HBP A;  3CBO A;  2F2X A;  1UJ0 A;  3BDU A;  2DL7 A;  2K4Y A;  5GAN 3;  5L8R E;  2HQH A;  2KI7 A;  3VRZ A;  3NFC A;  1UEC A;  4ZN3 A;  3LLR A;  2R5A A;  1N27 A;  1KD1 R;  1MMN A;  4M7D A;  1KJW A;  7AT1 B;  4C0G A;  3EGD B;  3P8D A;  3LH0 A;  2RB6 A;  5J3B A;  2D9T A;  3EG3 A;  2K3X A;  2SRC A;  3I55 A;  3HPW A;  4DOW A;  4M7A B;  2J6F A;  1B34 B;  5FRM A;  2BZX A;  3EFS A;  2P4T A;  4OVA A;  4BY6 B;  1JRI A;  4HVV A;  1K9M R;  1AT1 B;  3QWX X;  2B86 A;  2EKO A;  1QP2 A;  4M78 E;  3CCM Q;  4C8Q D;  1QCN A;  2DIQ A;  1WXU A;  1K0X A;  1WFW A;  5GAM h;  4RTV A;  1VQO A;  5CO7 A;  5KYW A;  4F7U A;  3E2U A;  1RI9 A;  2X3W D;  3OS0 A;  3HFN A;  2RD1 A;  4M77 F;  3DLM A;  2DJQ A;  1CKA A;  3MHX A;  4JJB A;  4AFS C;  1I0C A;  3JCM P;  2VXF A;  2G3R A;  3DKM A;  2F5K A;  3MP8 A;  5KYX A;  2CRE A;  1Q7Y C;  3G71 Q;  1NE8 A;  4BE1 A;  3NTK A;  2DVE A;  3OMG A;  5GAN g;  3SHW A;  3V8J A;  4DOV A;  1NPR A;  5D6X A;  1G3T A;  1G2B A;  2CZ7 B;  3CCE T;  2EYY A;  1PD0 A;  2DBM A;  3F70 A;  2LJ0 A;  4LUD A;  1IB8 A;  1M2O A;  3A98 A;  1KQS A;  2LQN A;  1IZ6 A;  2L3P A;  1TWB A;  4AG2 C;  2LCS A;  2EYX A;  4MDX A;  3VKI A;  4KUD K;  3JB9 F;  1I1J A;  1UFF A;  3KFV A;  4N4G A;  4PJO F;  4C92 G;  2DRM A;  5KYN A;  2HKQ B;  1VQO T;  1QKX A;  4M7D B;  3LGL A;  1EX4 A;  2L3S A;  2HL3 A;  1VQP A;  4J9B A;  1EIF A;  2CP6 A;  3M4Y A;  3PT9 A;  5KH6 A;  1W2B A;  1O9S A;  2V1Q A;  2QQB A;  3QSU A;  3CCJ A;  2K3B A;  5CKH A;  4LD9 K;  2RN8 A;  2A0F B;  1VQ8 Q;  3GNF B;  3JCM c;  4JLG A;  4KRT A;  2LX7 A;  2IG0 A;  2LT4 A;  4M75 D;  4JZ4 A;  1U1S A;  3CMA T;  3PVQ A;  5KYW B;  4MZM A;  1X2K A;  4M77 E;  1YIJ Q;  2K2V A;  5FWB A;  2FB7 A;  2RO0 A;  2K5L A;  4RMO A;  1QVF A;  3EG1 A;  4RKU E;  4A54 A;  2RI3 A;  2P84 A;  2QEX T;  2ZGW A;  5KYX B;  3PIP A;  2XDP A;  4BB7 A;  1HD3 A;  4C8Q B;  2VB6 A;  1Y7X A;  1OX8 A;  2LCC A;  4KUI A;  4XTW A;  2PZ1 A;  3RNJ A;  3JCM X;  1D3B B;  1AEY A;  1Q81 U;  4RTU A;  3MPU B;  2WAC A;  2DYI A;  1R0B G;  3CCJ T;  1AZE A;  2X4W A;  2OTJ T;  4C92 F;  4UC4 A;  5GAM g;  3L2Z A;  1QVG S;  5A2Q E;  1GCQ C;  1VYT A;  1RAD B;  4KUL A;  5A0G A;  1GCQ A;  3I9Q A;  1Q86 R;  2COY A;  1YIT A;  5CR2 A;  2KY9 A;  1W6X A;  1YJW T;  3EG9 A;  1ZSG A;  1FMV A;  1JU5 C;  1KHI A;  1JJ2 A;  2EQI A;  3OBY A;  1VQ9 A;  1M2V A;  2MAM A;  2FZK B;  5AT1 B;  1OZ2 A;  1NEB A;  2O9V A;  1WQ7 A;  3JCM h;  1G5V A;  2O01 E;  2RQU A;  3OW2 A;  1VQ4 T;  1KFZ A;  1TUC A;  2KVQ G;  4P5N A;  5GAN f;  1U8R A;  1KHC A;  1I4K 1;  2JZ2 A;  1NYG A;  2FHD A;  3QJ6 A;  1XJW B;  4HA8 A;  1TSF A;  1SHG A;  2GFA A;  3QYG B;  1RUW A;  2DJZ A;  3CBM A;  3BY7 A;  1WJS A;  2DL3 A;  1UUE A;  4HCK A;  2DL4 A;  2JT4 A;  1MV3 A;  4C8Q F;  2CT3 A;  1HK9 A;  3V7C A;  4XQ3 A;  3TU4 K;  3EFO A;  4KH0 B;  2RI5 A;  2RM4 A;  4M75 B;  3CD6 T;  1VQ9 T;  2AZS A;  4FT4 A;  5LJ5 g;  1QCF A;  3SFM A;  4AT1 B;  2Y4Y A;  4C92 E;  5KCO A;  1WIE A;  3GLX A;  2HSP A;  2K2M A;  2QTV A;  1UGR B;  1Q82 R;  4D6W A;  1UGS B;  2CZ0 B;  1X01 A;  3CCU T;  2DO3 A;  2NYS A;  3CC4 T;  4FYV B;  2OAW A;  2ZPB B;  1RAB B;  5KE3 A;  1S1N A;  1U1T A;  1WQW A;  4KH1 B;  1YWO A;  1W4S A;  2LQW A;  3EG9 B;  2K5I A;  1LNX A;  4FU6 A;  4AFQ C;  2GBQ A;  3ZEH A;  2HEQ A;  2BE9 B;  1VQ5 A;  4MZP A;  3ULR B;  1I8F A;  1D0Y A;  4JJN K;  5CKB A;  2JS2 A;  1NJI C;  3CPW A;  2HL5 C;  2P0P A;  2DE0 X;  2RJE A;  1Y96 B;  5FU7 B;  4B6M A;  3EHR A;  4JRK A;  2ZPF B;  5GAN 7;  2P0K A;  3CCL T;  4OMM A;  1NM7 A;  1M3C A;  1LCK A;  4Z8A A;  1IRX A;  1LOJ A;  4ME7 A;  1WXT A;  3OYL A;  1OPL A;  1KD1 U;  1IGU A;  3EFO B;  2FG0 A;  4M75 F;  1FMW A;  3E9G A;  5GAO n;  3OYB A;  1Z9Q A;  1VQ7 A;  2CYZ B;  2CP0 A;  2DVJ A;  3E9F A;  1YI2 Q;  1KC8 R;  2D8H A;  1M3A A;  1K9M U;  2A08 A;  5GAM e;  3VS5 A;  1U5S A;  1T0J A;  2VC8 A;  1VQL T;  4M78 A;  1S72 Q;  5LJ3 j;  4QQG A;  2QYZ A;  3QYH B;  1I5L A;  1N9R A;  1VQ6 T;  3PTA A;  4RG2 A;  1IXD A;  4ESR A;  3M0S A;  3CC7 T;  3QKJ A;  3NGP A;  3CPF A;  2MI6 A;  1RAC B;  2LDM A;  3CQT A;  2DK3 A;  3CCR Q;  1X6G A;  1YNZ A;  5J26 A;  2ECZ A;  2QK0 A;  3VUB A;  3KXT A;  3CCV A;  1YN8 A;  2DKG A;  1M30 A;  3CC2 T;  2DIL A;  2FL7 A;  4FCY A;  3HRT A;  3RKY A;  3U23 A;  5GAO l;  1PNJ A;  2LVM A;  8AT1 B;  2EVR A;  1VYV A;  1VQK A;  5CKF A;  2FEI A;  2RHY A;  4OF1 A;  2H8H A;  5IXF A;  2X3X D;  2RHU A;  4E7L A;  1VQM A;  4FW1 A;  3S3M A;  1YJ9 Q;  3SWN C;  3G4S T;  3SWN A;  2FPD A;  1M90 R;  4GBQ A;  4J9G A;  2IIM A;  1SRL A;  2KRO A;  3VS2 A;  5M9O A;  1QVP A;  3KUF A;  1ZSZ B;  4EMK C;  5J39 A;  1IHW A;  1ZUY A;  2XMF A;  1WI7 A;  2QQ9 A;  1MMG A;  2O2O A;  2L2P A;  2D0N A;  4M78 B;  4AG1 C;  1BI1 A;  2LNH B;  3OBW A;  2RHZ A;  2ZZD A;  1YHQ T;  4CC2 A;  1J3T A;  2ABL A;  4M77 A;  4M4Z A;  3NPF A;  3UPU A;  4L5G A;  5I22 A;  2XG8 D;  4J9D A;  3UDC A;  1T3S A;  4L6V 5;  1ZLM A;  2PU9 B;  3OS2 A;  2JVV A;  3HP9 A;  2K57 A;  2ZPH B;  4IKF A;  4DBQ A;  2QDL A;  3CCV Q;  1F1B B;  1IHV A;  3M0R A;  1UEB A;  2ZCF B;  2E5Q A;  1K0S A;  2KYB A;  1QWF A;  1AVZ C;  1BI3 A;  2ENM A;  5GAO r;  1QWE A;  1WHL A;  2BIV A;  4LDW A;  1T0H A;  4A63 B;  2QAZ A;  1CKB A;  1QW1 A;  2EJG A;  2X51 A;  1K76 A;  4JS4 A;  4B9W A;  4JZ3 A;  5IHN A;  4PJO A;  1Q86 U;  1ZBJ A;  1WGS A;  4HT9 A;  1BK2 A;  1PG5 B;  5DLQ E;  5IHK A;  1VQN Q;  3EH1 A;  4M7A C;  1B34 A;  3JCM e;  4Y91 A;  4BY6 C;  1YJN Q;  3JAM E;  3QII A;  2PVG B;  2M1H A;  1V29 B; 
#chains in the Genus database with same CATH homology
 2HNI A;  3M55 A;  1NZ9 A;  4MDX A;  2CZ6 B;  2Y90 A;  3DB4 A;  3VKI A;  5LJ3 d;  3M5A A;  3CXC S;  4KUD K;  3JB9 F;  3FB9 A;  1G3S A;  3A8O B;  1K8A U;  1VQ7 T;  4PJO F;  4N4G A;  3RMS A;  4C92 G;  2PQW A;  2EQJ A;  2RA2 A;  3CCM A;  2AHJ B;  5GMK m;  2HQX A;  1VQO T;  3HRS A;  5GAO m;  3X26 B;  1M9S A;  2EJF A;  5GAO q;  3OYE A;  1ZQ1 A;  5LJ5 f;  3OSS C;  5GAN e;  3DB3 A;  4MMK A;  4M7D B;  3EFR A;  2CS7 A;  5GMK h;  3LGL A;  1WJQ A;  2RJF A;  4M75 G;  1QP3 A;  2RHI A;  4XTZ A;  1Y71 A;  5GMK l;  1VQP A;  2LQ8 A;  3J7A F;  1Q82 C;  2VGM A;  3A5Z B;  5GAN 4;  4M77 B;  2XHC A;  2YLB A;  1EIF A;  3MET A;  4FL6 A;  3CEY A;  3RUX A;  3M4Y A;  4NL2 A;  3PT9 A;  2MMP A;  5KH6 A;  1W2B A;  4C5E A;  1O9S A;  4OMF B;  4PNO A;  2QQB A;  1YBY A;  2HQE A;  4X9C A;  3QSU A;  3CCJ A;  3WXM B;  1M4Z A;  4QVZ A;  3CCL A;  5CKH A;  4LD9 K;  2D0Q B;  3OYI A;  4CI0 C;  4NS5 A;  3OY9 A;  3GNF B;  1JJ2 S;  2R57 A;  3JCM c;  2DZ9 A;  3BFM A;  4JLG A;  1OZ3 A;  5GAM d;  1VQN A;  2YRV A;  3BW1 A;  3MO8 A;  3M4G A;  4JDS A;  4HCZ A;  2IG0 A;  2M16 A;  3MEA A;  2E64 A;  2LT4 A;  1M5Q 1;  4M75 D;  3PIO A;  1U1S A;  3CMA T;  4C5G A;  1YJN A;  1UB4 A;  2DIG A;  4L59 A;  4MZM A;  1OI1 A;  4M77 E;  3OYH A;  3ME9 A;  3OMC A;  2QXF A;  1KQ1 A;  3M54 A;  2K2V A;  4R55 A;  1G3W A;  3OW2 S;  2FB7 A;  2RO0 A;  2K5L A;  2O4X A;  4LDV A;  2PVD B;  4NOY A;  3M57 A;  3A8M B;  4RMO A;  1Q82 U;  4RKU E;  1QVF A;  4A54 A;  2QQS A;  2RI3 A;  3FJP A;  5CQY A;  1KQS S;  3CCV T;  4C92 A;  2QEX T;  4JS5 A;  4M7D C;  2ZGW A;  5KCH A;  2V8J A;  5GAN 2;  2XI9 A;  1YI2 T;  4PJO B;  2D6F A;  3PIP A;  2XDP A;  2LRQ A;  4BB7 A;  4C8Q B;  1KG1 A;  3OB9 A;  5GAN j;  3OYY A;  1Y7X A;  3MCA B;  2OTJ T;  2LCC A;  1VIF A;  4KUI A;  4M77 C;  2WSE E;  4MZT A;  4XTW A;  1BYM A;  1XTD A;  4BI3 A;  3JCM X;  1D3B B;  3CXC A;  1Q81 U;  5FRN A;  3M58 A;  4E47 A;  5LJ5 g;  4XTX A;  4HCC A;  3L42 A;  2KAF A;  3OQ5 A;  1VQK T;  2WAC A;  5CK9 A;  4VUB A;  2B8A A;  1VQL A;  4E7J A;  2XD0 A;  4J83 A;  3CCJ T;  1S72 T;  1KQS A;  3G71 T;  3OSV A;  3VUZ A;  5IAY A;  3E19 A;  1VQM T;  4E7H A;  2X4W A;  4LDX A;  4PL6 A;  3LGF A;  3HFO A;  4UC4 A;  3EAE A;  4C92 F;  5GAM g;  2F69 A;  3L2Z A;  2X35 A;  5D6Y A;  1VQ6 A;  1VQ8 A;  4C8Q E;  2QA4 A;  3QUI A;  1H64 1;  3X28 B;  2LX9 A;  4LDU A;  1KC8 C;  2V8K A;  2DEQ A;  3ZBD A;  3CC7 A;  5A2Q E;  3G6E A;  1QVG S;  2HAX A;  4KUL A;  3RER A;  5A0G A;  4IUP A;  3RMQ A;  4XU3 A;  1YCY A;  3JCM f;  3ZFJ A;  2CZ1 B;  1YIT A;  5CR2 A;  2VYT A;  4IUQ A;  4E7I A;  2KY9 A;  1YJW T;  1MHN A;  4XU0 A;  4IUR A;  1YIJ A;  2L3R A;  4M78 D;  3CCR T;  1KHI A;  1K8A C;  4PJO C;  1JJ2 A;  1N9S A;  3OBY A;  2PUK B;  1VQ9 A;  1I81 A;  3O8V A;  4C5H A;  5GAN 6;  2MAM A;  1BIB A;  1OZ2 A;  4IUT A;  4C8Q A;  2PUO B;  1WJR A;  2H3J A;  5HK3 A;  3CC2 A;  1QVF S;  2EIF A;  2CKK A;  1WQ7 A;  1O75 A;  2JOY A;  3JCM h;  3L2Q A;  4M7A D;  4OP0 A;  1G5V A;  2YLC A;  1IRE B;  2O01 E;  3I55 T;  4J6W A;  2OAU A;  3CME A;  1AHJ B;  1D3B A;  2RH2 A;  3CCS A;  3OW2 A;  4XK8 E;  1VQ4 T;  3L2R A;  1ZBX A;  2KVQ G;  4P5N A;  4A53 A;  1KHC A;  5GAN f;  4J5Y A;  2L8D A;  1U8R A;  1KC8 U;  1M1G A;  2MWO A;  1I4K 1;  2JZ2 A;  2M0O A;  3A8G B;  3MP6 A;  2FHD A;  3QJ6 A;  4HA8 A;  3HL8 A;  3MEU A;  3JB9 I;  3OYD A;  2GFA A;  1WPY A;  3QYG B;  2DJZ A;  3CBM A;  3CPW S;  3BY7 A;  1WJS A;  1G3Y A;  1TH7 A;  4DA4 A;  2O4X B;  3OYN A;  4MDW A;  2GF7 A;  3HSB A;  1BI0 A;  2QA4 T;  4C8Q F;  2KSS A;  5GAN h;  4C92 B;  1HK9 A;  3V7C A;  1YJ9 T;  4XQ3 A;  3G4S A;  3TU4 K;  3FDR A;  2DD4 A;  1NPP A;  3GNG A;  4J7I A;  3WVE B;  5FLX E;  2FYK A;  3R6O A;  3VJP A;  5CCA A;  5FU6 B;  3NTH A;  3QZ9 B;  4KT0 E;  5LL6 S;  4YTL A;  3RES A;  4N0A A;  2RI5 A;  2E12 A;  2RM4 A;  2Y4X A;  4M75 B;  4O5V A;  3CD6 T;  5C0M A;  4A4G A;  2JTF A;  3ASK A;  1M8V A;  4ZGE B;  3N5B B;  1VQ9 T;  2JN0 A;  3URG A;  2R5M A;  4FT4 A;  5HK0 A;  2KQW A;  2E65 A;  2VXE A;  3P8B B;  1BKB A;  1WNL A;  4J6Y A;  3QO3 A;  3LWI A;  4C0D B;  3SFM A;  3FIF A;  3X20 B;  2E6N A;  2KDS A;  5GMK i;  3GPL A;  4JRQ A;  1QVG A;  3OYK A;  3A8L B;  1M1F A;  2Y4Y A;  5GAN 8;  4C92 E;  5KCO A;  3JRZ A;  2PVO B;  4PKC C;  3L2V A;  3GLX A;  4RG8 A;  1FWZ A;  1XOV A;  3QZ5 B;  2XID A;  1UGR B;  4XTV A;  4XTU A;  1UGS B;  2CZ0 B;  4D6W A;  1YHQ A;  1X01 A;  3I56 A;  3CCU T;  2DO3 A;  4Z02 A;  1R8O B;  3CC4 T;  1Q81 C;  5GMK e;  5EG2 A;  2QQR A;  3VYH B;  2ZPB B;  2MWP A;  5KE3 A;  2RHX A;  3QXE B;  2JTM A;  2DAQ A;  1K73 U;  2DXU A;  4M75 E;  1U1T A;  3J81 E;  1WQW A;  3OYG A;  4ELZ C;  4B9X A;  5LJ3 g;  1P92 A;  3UT1 A;  4BE0 A;  3JCM V;  4RCB A;  1W4S A;  5GAO p;  4IUV A;  5C6S A;  2K5I A;  3X24 B;  4A4F A;  1LNX A;  4FU6 A;  4C92 C;  2V8I A;  2KMT A;  3JSC A;  2YHT A;  4BI4 A;  4M7D D;  4ZGJ B;  3VU3 C;  3CCM T;  5GAN 5;  4PLI A;  3M59 A;  5LJ5 e;  4BE2 A;  5FRO A;  3ZEH A;  2DXC A;  4HT8 A;  4OGC A;  1VQ5 A;  3JCM d;  1FX7 A;  4F7U G;  4MZP A;  3C12 A;  4A4H A;  4EPC A;  2XK0 A;  3GOX A;  1I8F A;  3G7Z A;  3T9N A;  4M77 D;  4JJN K;  2QDY B;  2L89 A;  2LTO A;  3LX7 A;  2E1H A;  4PLL A;  5CKB A;  3UWN A;  4BDZ A;  1NJI C;  2XKO C;  4M75 A;  1VQP T;  5DLO A;  1N8R C;  3JCM b;  1BI2 A;  3CPW A;  3CBP A;  3HKS A;  3OS1 A;  3S6W A;  1VUB A;  2P0P A;  1PSF A;  4WF2 A;  2ZPG B;  4C0D C;  4EMK A;  4PJO G;  3JCM W;  3JB9 G;  2E41 A;  4M78 G;  2RJE A;  5FU7 B;  1Y96 B;  2DTI A;  2X4J A;  3SB2 A;  2A3L A;  1M90 U;  2ZPE B;  3RIR A;  4JRK A;  4EDU A;  5LJ3 e;  1DJ7 B;  2ZPF B;  4JRI A;  2P0K A;  1JBM A;  5I2M A;  2DXT A;  4ZN1 A;  5GAN 7;  3CCL T;  4V2S A;  4NL3 A;  2QQA A;  3C94 A;  1LOJ A;  3GF5 A;  4ME7 A;  5GAN d;  4BDY A;  1VQN T;  4OB2 B;  4EMH A;  4M7A G;  2LQK A;  3ER0 A;  3I56 T;  3OA6 A;  3CCE A;  3OYL A;  4QQ6 A;  2K3Y A;  2I2L A;  3FEO A;  5D6W A;  3OYA A;  2X4X A;  4MML A;  1YJN T;  1KD1 U;  4BAC A;  3MEV A;  2FVU A;  2GCX A;  3PGG A;  2VV5 A;  4M75 F;  1NJI U;  1XQH A;  3E9G A;  3CCQ A;  1LJO A;  5GAO n;  3OYB A;  1N8R U;  3LYI A;  3KBG A;  3JB9 D;  2DTH A;  4XAX B;  2EQK A;  4PJO D;  3WVD B;  2EYQ A;  1FXX A;  1M1K U;  2LCL A;  1ZHI A;  4N4H A;  1X6O A;  1VQ7 A;  2CYZ B;  3E9F A;  5LJ5 j;  4C8Q C;  2QI2 A;  2VGN A;  5A0D A;  3AHU A;  3PMT A;  4R56 A;  1K9M U;  4II1 A;  1UGP B;  3Q1J A;  2WSC E;  4TVR A;  3QPH A;  5GAM e;  4XTY A;  2C06 A;  2VC8 A;  5FU7 C;  3M56 A;  3RKW A;  2JUF A;  2IVW A;  1Y96 A;  3SDZ A;  1VQL T;  5HKC A;  2OTL A;  2HD0 A;  4M78 A;  2DTO A;  3C95 A;  5LJ3 j;  4QQG A;  5I21 A;  3QYH B;  2XDD A;  1I5L A;  1N9R A;  4J8O A;  1VQ6 T;  3VYG A;  4RG2 A;  3PTA A;  3V8L A;  1VQ8 T;  2M9U A;  2R58 A;  4FSX A;  4HKE A;  4CRI A;  4JRP A;  1XNI A;  4QVC A;  3H6Z A;  3H8Z A;  5CIU A;  4M7A A;  3CC7 T;  3G6E T;  2LT1 A;  1PSE A;  4RCC A;  4GY5 A;  3QKJ A;  3TRE A;  1HXD A;  3L1A A;  3CPF A;  3SWN B;  1K73 C;  3CMA A;  1YIT T;  3CCQ T;  3JB9 H;  4C0F A;  2MI6 A;  4N0A C;  4C5I A;  2MF2 A;  2LDM A;  2DPP B;  2DK3 A;  2EAY A;  2GFU A;  4BD3 A;  3GP8 A;  1YIJ T;  4ZGD B;  3QDR B;  2BUD A;  1X75 C;  5CKE A;  4M78 F;  4OB3 B;  4Q5W A;  5J26 A;  3VUB A;  2DXB A;  4EMK B;  3KXT A;  3CCV A;  1Q7Y U;  2DKG A;  4M7D G;  5CVI A;  2QEX A;  4BUG A;  3CC2 T;  2EQU A;  2WSF E;  1YI2 A;  3C4S A;  2FL7 A;  2LNV A;  2EWN A;  2KK4 A;  5AYF A;  5GAM j;  3HRT A;  3RKY A;  3CME T;  3CCS T;  4M7A F;  3PNW C;  4FT2 A;  4M77 G;  3OYF A;  3DLL A;  2A7Y A;  2XIC A;  3NTI A;  5A0L A;  2F5T X;  3OYC A;  3OYJ A;  1JB0 E;  5DY9 A;  1H3Z A;  5GAO l;  2LVM A;  2EFI A;  2CGH A;  4HCB A;  4O6J A;  2QTX A;  4N4I A;  3LWH A;  3SD4 A;  3QBY A;  4LDY A;  1VQK A;  2OTL T;  5CQX A;  3INZ A;  1M90 C;  3GIB A;  3QHS A;  1RI0 A;  3PMI A;  4A4K A;  5CKF A;  2DZC A;  2RHY A;  3V7R A;  2RK1 A;  3S3N A;  4JLI A;  4OF1 A;  4C92 D;  5LJ5 h;  3G71 A;  1S72 A;  1VQM A;  2RHU A;  2XU8 A;  4E7L A;  3MP1 A;  3X25 B;  4BI8 B;  5LJ3 f;  1UGQ B;  3J80 E;  2OTJ A;  4ZTJ A;  4IUU A;  4EMG A;  3TCJ A;  4M7D E;  3S3M A;  2JNG A;  3SWN C;  3MEW A;  1N6A A;  3G4S T;  3SWN A;  5FU6 C;  4FIB A;  3E1S A;  2E10 A;  4XU2 A;  1RL2 A;  3HHT B;  1KD1 C;  1GXI E;  4M75 C;  3JB9 J;  4J7F A;  4X9D A;  4F7U B;  2EJ9 A;  5IN1 A;  5M9O A;  1QVP A;  3S3O A;  1YJW A;  3KUF A;  3OS5 A;  1MGQ A;  3V8K A;  4DQ2 A;  4QQD A;  4EMK C;  5J39 A;  4ELY C;  1M1K C;  3JCM J;  2HBP A;  3CBO A;  5LJ3 h;  3BDU A;  3CCR A;  2K4Y A;  5GAN 3;  4XU1 A;  2QQ9 A;  5L8R E;  3PFS A;  3NFC A;  4ZN3 A;  3JCM Q;  3BDL A;  2R5A A;  3LLR A;  1N27 A;  4C8Q G;  4GLK A;  4M78 B;  4M7D A;  4KBM B;  2RJC A;  1K9M C;  1BI1 A;  4C0G A;  3P8D A;  3LH0 A;  3M53 A;  3VV0 A;  2RB6 A;  3OBW A;  5J3B A;  2D9T A;  4X34 A;  2EQM A;  2K3X A;  2RHZ A;  2ZZD A;  3I55 A;  3HPW A;  1YHQ T;  2E6Z A;  4ATO A;  3V7S A;  4M77 A;  4DOW A;  1VQ4 A;  4QVD A;  4F7U E;  5GMK j;  4M7A B;  5GAM f;  1B34 B;  2L5Q A;  3FLG A;  5FRM A;  3UPU A;  4L5G A;  2XG8 D;  3EFS A;  2P4T A;  4OVA A;  3HRU A;  4BY6 B;  5KE2 A;  1JRI A;  3UDC A;  3L2U A;  5HY6 A;  4L6V 5;  4LD6 A;  2PU9 B;  3OS2 A;  1Q86 C;  2JVV A;  5CAI A;  3HP9 A;  4Y28 E;  2K57 A;  4QW2 A;  3QJY A;  2ZPH B;  2ZPI B;  1SSF A;  2EKO A;  4IKF A;  4J6X A;  4PJO E;  1QP2 A;  4M78 E;  3OYM A;  2DD5 A;  1OYX A;  2VUB A;  4C8Q D;  1Y07 A;  1UEB A;  2DIQ A;  2ZCF B;  3LW5 E;  1W2B S;  2E5Q A;  4M7D F;  3JCM g;  3A8H B;  5GAM h;  1BI3 A;  1VQ5 T;  2RK2 A;  1VQO A;  5CO7 A;  5DM7 R;  5GAO r;  5IT9 E;  1YJ9 A;  2BIV A;  4LDW A;  2K5F A;  4A4E A;  4ZTF A;  1BIA A;  4F7U A;  3QG1 A;  4M7A E;  3OS0 A;  3HFN A;  2RD1 A;  3M9Q A;  4M77 F;  1QW1 A;  2EJG A;  3DLM A;  4C0Z A;  1KQ2 A;  4JS4 A;  4B9W A;  3MHX A;  3FC3 A;  3CD6 A;  3JCM P;  2VXF A;  2G3R A;  2X4Y A;  3DKM A;  2F5K A;  4M78 C;  4OGE A;  4PJO A;  3MP8 A;  2RJD A;  4JUV A;  1Q7Y C;  2RI2 A;  1Q86 U;  1VIE A;  5LJ5 d;  1NE8 A;  2GQV A;  4BE1 A;  5I2S A;  3NTK A;  1WGS A;  3RKX A;  2DVE A;  3OMG A;  2BKD N;  4OB0 B;  5DLQ E;  5GAN g;  4HT9 A;  4FM4 B;  3V8J A;  4DOV A;  1NPR A;  5D6X A;  2P0Q A;  4M7A C;  1G3T A;  2CZ7 B;  4E7K A;  3CCE T;  2XDB A;  4OB1 B;  3TEE A;  1B34 A;  3JCM e;  3F70 A;  3P8H A;  3FRN A;  4Y91 A;  2LC4 A;  4BY6 C;  3L2W A;  3CCU A;  3JAM E;  3QII A;  4F7U F;  2E70 A;  5CKD A;  3CC4 A;  2PVG B;  2NLU A;  2M1H A;  1IZ6 A;  1V29 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...