2M1HA

Solution structure of a pwwp domain from trypanosoma brucei
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
110
structure length
110
Chain Sequence
MLQERVFHINDRVWLKTGANTWWPAKVTSVTGVEGVDGRSSETGTSTVTVLTYPGTQNKATYKNVDSHSSAITFFEPSSEKAVTANEDLLQAIRNAEEDKESNALRFEPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor S-II
publication title Solution structure of TbTFIIS2-1 PWWP domain from Trypanosoma brucei.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transcription
total genus 9
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2m1hA00
2GFUA 2EQUA 2RJEA 3S3OA 5KE2A 1OZ3A 4IUQA 2LTOA 4N4GA 4QVZA 2G3RA 5IAYA 2QQRA 2R58A 3PMIA 4IURA 3CEYA 3FEOA 4E7HA 4PL6A 2E5QA 2EFIA 3C4SA 2L89A 5CIUA 5KE3A 4QQDA 3LLRA 5KH6A 3LGLA 2O4XB 3OYLA 1N27A 2RHXA 4BACA 1RI0A 2LCCA 3NTKA 2RHUA 3PFSA 2YRVA 4A4GA 2B8AA 3LYIA 4E7LA 3OS2A 2JZ2A 2K3YA 2RHZA 4Z02A 4B9WA 2M16A 4FL6A 1G5VA 1KHCA 3GOXA 2PQWA 2BKDN 2RI2A 3O8VA 4E7IA 1WJRA 2DAQA 2GF7A 2BUDA 3MP1A 4NS5A 3ZEHA 2IG0A 2EQMA 5KCHA 3LX7A 3P8HA 2DIQA 2L8DA 1XNIA 3META 3OS0A 2X4WA 2RJDA 4BD3A 4BE0A 4C5HA 3OYJA 4ZTFA 1OI1A 2EQKA 4PLIA 4QQ6A 4L59A 3UWNA 4BE2A 3MEUA 3Q1JA 3ASKA 4PLLA 1OZ2A 2QQSA 4EDUA 2XK0A 3FLGA 4N4HA 3OYHA 3SD4A 4ZTJA 3DB3A 4E7JA 3OYNA 3OYCA 5J39A 1WJSA 2DIGA 4LD6A 2K3XA 3L2UA 3MEVA 5KCOA 2RHIA 2JTFA 3OYEA 2E6NA 2M0OA 2HQXA 3OMGA 3NTHA 2VYTA 4FU6A 3QBYA 4HCZA 2F5KA 3QJ6A 3OYKA 3OA6A 5C6SA 3L2WA 2X35A 3L2VA 2L3RA 2P0KA 2RHYA 2BIVA 4GY5A 3OMCA 5IN1A 3L2QA 3BDLA 3S3MA 5FROA 3OY9A 2WACA 2X4XA 3E9GA 4QQGA 3MP6A 4CRIA 3OYAA 2O4XA 4C5GA 4BE1A 3DB4A 3QIIA 2EQJA 2FHDA 1SSFA 3L42A 3NTIA 3PMTA 3OYBA 4A4HA 4IUPA 4QW2A 5D6WA 4C5EA 1MHNA 2RJCA 3H8ZA 3MO8A 3OYIA 2LDMA 4E7KA 5FRMA 2D9TA 2MWOA 1OYXA 2M1HA 3UT1A 3OQ5A 4Q5WA 3EAEA 2LRQA 4A4EA 2RI5A 3L2RA 3OYDA 1WJQA 2NLUA 3S3NA 2EKOA 2MWPA 3PNWC 2LVMA 3MP8A 2R57A 3H6ZA 4UC4A 3OYFA 3E9FA 2RO0A 3OB9A 4IUUA 4N4IA 1WGSA 3DLMA 5J26A 3ME9A 4C5IA 5M9OA 4A4FA 5FRNA 2HQEA 2R5MA 4BDYA 3OYMA 3MEAA 2RI3A 5D6XA 4BDZA 5C0MA 2X4YA 2RJFA 3P8DA 2R5AA 4II1A 3FC3A 4X34A 3OS1A 3LGFA 4IUTA 3M9QA 4OVAA 1H3ZA 3S6WA 2CKKA 3F70A 2GFAA 4IUVA 3KUFA 4RG2A 3QKJA 5D6YA 3OYGA 3MEWA 3FDRA 4IKFA 2XDPA 3LH0A 4B9XA
chains in the Genus database with same CATH superfamily
1YJWA 3VS0A 4CC3A 2LJ0A 5GANg 4XU0A 1H8KA 4EMKC 3VRYA 1BBZA 1ZSZB 1G83A 4OP0A 4PJOC 2DNUA 1M2VB 5GAN6 3M0UA 3LWIA 5J3BA 2GF7A 2RQWA 4NS5A 1FWZA 2LT1A 1K73C 3HSBA 1V76A 3I5SA 2F69A 1OPLA 2KMTA 1QVPA 4J6XA 4J6WA 4MZTA 4M78C 2SEMA 3Q1JA 3VS1A 3CPWP 3JCMW 2X3WD 2P4RA 1GRIA 4LDVA 2OAUA 2JJ9A 3NTHA 4J6YA 4BI8B 1RAIB 2BZXA 3VYGA 4DOVA 1YITQ 3JCMf 5LJ5j 4A53A 1LCKA 3OYAA 4JDSA 3SFMA 3M59A 3NTIA 3EG1A 2HKNA 3RERA 2HDAA 3OYIA 1WPYA 5CQXA 4M7DC 2HSEB 2DD4A 3PNWC 5GAMe 1G3TA 2L0AA 1QKWA 3CD6Q 3CQTA 4Y28E 3OYMA 1BI1A 1RAFB 4II1A 1KG1A 4OVAA 2DRMA 3RR6A 2G6FX 1WIEA 3LH0A 2HAXA 4KGZB 1K76A 3M57A 2JVVA 3JCMJ 2CT4A 2FPEA 2O4XB 1RI0A 1KC8R 4C8QA 1VQ8T 3OS2A 3FJPA 2E3HA 3QXEB 1E6GA 4O6JA 4C92G 4F17A 2RI2A 1Q81U 1M1GA 3EG9B 2EGCA 2MYSA 1XNIA 2NUTB 4ELYC 3G71A 1KJWA 2PUKB 3TEEA 1VQ6A 3PTAA 2CS7A 2M0YA 4M75B 1MNEA 1T3SA 3M4GA 3HL8A 1WJSA 1ACMB 5GANj 2E6NA 2HQXA 2XI9A 2CZ0B 3G1JA 4FYVB 2DVJA 2RK1A 4HCZA 1WXUA 5LJ5h 5CO7A 1GL5A 2E4HA 4KUIA 3L2VA 2RHYA 1WXTA 2OTJQ 3M0TA 4MZPA 3CXCP 4CRIA 3DLLA 1ZLMA 1W1FA 3CPFA 1UE9A 1GCQC 3MO8A 4FW1A 3JCMP 2ZPGB 3UT1A 4ATOA 1SKUB 1VQ7T 4OGCA 5LJ3d 4R56A 2DK3A 2DZ9A 2EGAA 2X4JA 4LUEA 1J3TA 1Y71A 4JUVA 4X9CA 4C5IA 1U8RA 3PT9A 4BDYA 1AVZC 1UGQB 3U23A 2GTOA 2KYBA 3V7SA 1S72A 3TSWA 3C0CA 4EMHA 2D0QB 1VQ4A 4RG2A 3CCRA 1QVFA 1VQ9A 2JUFA 3JB9D 1OZ3A 3HRSA 2QQRA 2R58A 3FEOA 4L6V5 1WHLA 4QQDA 3CCVA 1ZSGA 1RAHB 2K5IA 1VQKA 3PFSA 1K9MU 2CSQA 4DBHA 2IVWA 2CP7A 1KQSP 2KYMA 2I0NA 1OULA 1H92A 1X6OA 1NG2A 4E7IA 1G8XA 2JW4A 1Y96B 2J6KA 3HFOA 1QVGA 1D3BB 3OS0A 2LNVA 1M3CA 3BDUA 4BD3A 1I0CA 1X75C 3QG1A 1N9SA 3HPWA 9ATCB 4XAXB 3M4YA 1HYOA 4FIBA 5GANh 4LDXA 1GXIE 1KQ1A 4C92D 4F16A 2RHIA 2V8KA 4E7ZA 1M27C 4A54A 4KGXB 3CBMA 4C92F 1JRIA 4JJNK 3QJ6A 3CCQA 1MV0B 2X35A 2K5FA 2CUBA 1FMKA 2X4XA 2WSCE 1NBEB 4JJCA 1QCFA 1YJ9Q 2RD1A 4A4HA 2NYSA 2HNIA 1DJ7B 2DL4A 5CKEA 1FX7A 2I2LA 4M75F 4FT2A 2QQBA 4KBMB 2OI3A 1B3QA 1UFFA 3G4SQ 2E6ZA 1OOTA 2BE9B 4OMQA 3H6ZA 1BIAA 3OSSC 1BU1A 3TQ7P 4F7UB 4IIOA 1YJNT 3CMAA 4CC2A 1VQMQ 2FVUA 2FZCB 5A0LA 1YHQA 3OS1A 1OU8A 1ZA1B 1KFZA 2AZVA 3CCLT 4IIMA 3CCMT 5KYYB 3R6OA 2LP5A 2AKLA 2K57A 3HP9A 4Z89A 2NUPA 5HK0A 3JCMQ 3S3OA 1NJIU 1OPKA 3SHWA 1D3BA 2YUPA 1U1TA 2CZ1B 3OYLA 5CQYA 3CC7Q 1Q81R 3SDZA 3NTKA 2YRVA 2LCLA 2AKKA 2JZ2A 4Z02A 1Q86U 2X3XD 5GAN8 3GOXA 1NEBA 4C92C 1AT1B 2DAQA 2DXCA 1MMAA 2IG0A 3LX7A 4M4ZA 3JB9I 2MIOA 1W2BP 3META 2COYA 2KXDA 1IGQA 1VQNA 5EG2A 3URGA 3I55A 2QQSA 4LN2A 3JCMX 5KYUA 4M7AB 2AZSA 5LJ3g 3G6EA 4C0FA 4J9IA 3BY7A 3PGGA 1K4US 4QT7A 1WNLA 1MMGA 1WHMA 1ZBXA 4J7IA 2M0OA 3OMGA 4OMMA 2EKHA 4GLMA 2D0NA 3H0FA 1UDLA 2HCKA 1GCPA 1QMCA 1HK9A 5CR2A 1I5OB 3ZL7C 1K73U 3MP6A 1VQ5T 2P84A 2KRNA 1EZZB 2FHDA 4JZ3A 2DKGA 4F7UA 1VQPT 1V29B 2XG8D 2QEXA 1MMDA 3H9NA 4E7SA 2RA2A 3OQ5A 1R8OB 1Y0MA 4J5YA 1D0XA 1K0SA 2EKOA 3CCSA 4OF1A 4D6WA 2RK2A 2JT4A 1OX8A 3RKYA 4RTWA 1JO8A 2KRSA 2F1LA 3LH5A 3VS4A 5GAN2 3MEAA 1WHJA 3TVTA 5C0MA 3BW1A 2L3PA 3GIBA 5AYFA 3E2UA 1QW1A 2GFAA 1PCXA 5IXFA 3MEWA 1UGPB 2XICA 4PJNA 2HSPA 1BCMA 1R0CB 1M8VA 2GNCA 2A7YA 1K9MR 4N4GA 1QKXA 2RH2A 1CKAA 1PNJA 3VS5A 3CCJA 1YJWT 5GAMd 2JNGA 3LLRA 3H0HA 5HY6A 1KK7A 1VA7A 5GAN4 1YBYA 2YDLA 3ZFJA 1M9SA 4K11A 2EYWA 3RUXA 1I81A 2FL7A 3M5AA 4M77B 2FZKB 1D0ZA 4AT1B 4F7UF 2BKDN 2DXBA 2PQWA 4WCIA 4EMKA 3VS6A 4LDUA 1TUGB 2FEIA 4ZGJB 1TU0B 4PJOA 2HKQB 1QLYA 4ZTFA 1Q82C 1VUBA 2PUOB 2HMAA 5HK3A 1VQ8Q 4RTUA 5GAOn 1LJOA 3TCJA 4RCBA 1Y57A 4HKEA 2FRYA 4OMLA 5FWCA 4J9FA 5LJ5g 3NHNA 2NUZA 1QVFS 4M78A 2DTIA 2V8JA 2VUBA 2GGRA 4AG2C 2QI2A 2LT4A 1R77A 4AFQC 3S3MA 2JMCA 2JTEA 3M0RA 3EH2A 4C5GA 3PMTA 3VJPA 4QW2A 3RKWA 3CC2A 3X26B 1MHNA 4LDYA 3LWHA 1T0JA 5FRMA 1TH7A 1RI9A 3QJYA 4AG1C 2VC8A 2O31A 2V26A 3OYDA 1WJQA 4M7AF 1QVGS 5LJ3j 2R57A 1G3YA 2ED1A 2J06A 2DE0X 2LCSA 1N5ZA 2J7IA 2K6DA 2OAWA 3I9QA 1BB9A 1NJIR 1VQ7Q 3D7SB 3JCMe 3ER0A 4M77A 1UHCA 3SWNC 2XDPA 4MMKA 2LTOA 1PM3A 1ZHIA 2YUQA 1Q86R 3UATA 2HBPA 1PG5B 5FU7B 2RHUA 1ABOA 3CPWA 1KQ2A 4QVCA 4B9WA 2M16A 3HKSA 4OB1B 2IPOB 2DXUA 1AWWA 1O75A 2YSQA 1HSQA 2RQTA 3EG2A 4NL2A 4Y92A 4RTZA 4ZNXA 3VUBA 4PLLA 2E10A 3G71T 4JLGA 1UEBA 2ESWA 3REAB 1SRLA 1VQ6T 1B7TA 2XMFA 4M75E 4ME7A 2JTFA 5A0DA 1FMVA 1WYXA 1K73R 2KEAA 2VYTA 2B86A 4LNPA 3CC4A 2F5KA 4C0DC 1XOVA 3C12A 2GBQA 4M77F 4B6MA 4GY5A 3PIOA 2VGMA 4JLIA 3OY9A 1K1ZA 4QQGA 2WSEE 5DY9A 4XTXA 2EYXA 1YCYA 3L42A 4C8QB 1ZA2B 2C06A 5GAOm 3UA6A 2W0ZA 3PE0A 5LJ3h 3MCAB 4J9EA 2KE9A 5GAMg 3PVLA 5GAOr 4RKUE 5KYNA 2C0OA 2AHJB 3S3NA 2CP2A 3CMEA 2D6FA 3QZ9B 2D1XA 1ZX6A 4D8KA 1PKSA 2IIMA 5GAOp 5LJ5f 4XTUA 5FU6B 2CT3A 3CBPA 3A5ZB 4JZ4A 3EH1A 1UHFA 3N5BB 3CCUA 3OYGA 4R0KA 3HFNA 3TSZA 1JJ2P 3CCRT 3ULRB 1IRXA 1VQ9T 4CC7A 1YJNQ 2EFIA 3SEMA 4P5NA 1M1KC 1YWOA 2DTOA 1PSEA 1YJ9A 5CKBA 4XTYA 2HL3A 4LDWA 3CCLQ 2V1RA 3CCMQ 3CCVT 2EBPA 1YI2T 4LD9K 1SRMA 1X2QA 1VQKT 1V1CA 4ANJA 1YCSB 1D1AA 3VS2A 2DRKA 3V8LA 2EWNA 2GQIA 4CC4B 5KCHA 2DZCA 1NPRA 2DIQA 2QA4A 5GMKj 2PZ1A 4OB2B 5GAN3 3VYHB 2L3SA 7AT1B 1WZOA 2EJFA 3OYNA 2FG0A 1F1BB 3NMZC 5IHNA 2RQUA 1Q95G 4RCCA 2RNAA 3HHTB 3QBYA 3OYKA 3L2WA 5CVIA 1SPKA 1EX4A 3BFMA 3CCQT 3JCMb 2KROA 2MOXA 2MCNA 3QIIA 2OTLA 2QTVA 1IZ6A 4BY6C 2K2MA 4ESRA 4BUGA 2FPFA 2DL3A 4JJDA 3VS3A 2M1HA 4M75G 3EGXA 5IXBA 5GANf 2E65A 2RM4A 1MNDA 4PFPA 1U3OA 1VQ5Q 2ZPIB 1UB4A 4KH0B 3SB2A 2MMPA 3FB9A 2CZ6B 1M90C 1YN8A 1VQPQ 1IHVA 1UTIA 4BDZA 1WHHA 2QGGA 4F7UE 1VQLA 3QDRB 3TREA 3CMAT 4IUVA 1P92A 4N0AC 1YHQT 1ZQ1A 1KQSA 1VYUA 3V7CA 2FPDA 4IUQA 2KQWA 4C8QF 3OBYA 5I21A 3C4SA 2XDDA 3LGLA 2QDYB 1KD1C 5GAMj 2MAMA 8ATCB 1WI7A 2ECZA 2DERA 5HKCA 2CREA 4J9CA 3I56A 2ZAEA 3QWXX 4PJLA 4XU3A 2FO0A 1KSWA 3V8KA 1T3LA 5GMKh 3NPFA 4E2FB 1YJWQ 4E6RA 2AIRB 4XU1A 1JXOA 2VXEA 5IHKA 2X4WA 4MZMA 4LUDA 1IO6A 2KSSA 1NLOC 2QTXA 3MPUB 1VQNT 3CCEA 2XHCA 4E7JA 2DBMA 3I55T 4HXJA 1YWPA 4M7AE 3G6ET 5IHIA 5HCKA 1ZSZC 2NUPB 2BE7D 5FLXE 1LPLA 2BTTA 5GMKm 4A4KA 2CGHA 3OW2P 1H641 3GP8A 1VQOA 2COWA 1UGSB 1Q82U 5KYWB 1C1AA 1YFNA 1Q7YC 3WVDB 4NL3A 3CPWS 5D6WA 4E47A 2RQRA 2DF6A 4L5GA 4O5VA 2VASA 2QEXT 4JRPA 2RQVA 1TSFA 2GTJA 1YIJA 2F2WA 1W6XA 4J8OA 3MKDA 3OYFA 1WGSA 1UG1A 3ME9A 3CCST 2CP3A 4WF2A 5KYUB 4V2SA 2MK5A 2ZGWA 3MJXA 4MMLA 1BI3A 3P8DA 4M75D 2LZ6B 3M9QA 1H3ZA 4BI3A 3F70A 1AD5A 1RLPC 4J83A 3GBQA 3VKIA 5KE2A 2E5KA 3QPHA 4Z88A 5GAMh 3FRNA 1W2BA 3UF4A 3KXTA 2A0FB 3A8GB 3CCJT 3RKXA 5A0GA 5CKFA 1TWBA 1JBMA 1VIFA 4DEYA 2QDLA 4F7UG 3JCMd 4M77E 4PFOA 1WJRA 2K9GA 2L5QA 2XD0A 5I2MA 4JS4A 4BE0A 1QQJA 4X9DA 2EQKA 1TXQA 3ASKA 2XK0A 3M0PA 2M9UA 3SD4A 2O2OA 5J39A 2LMJA 5KYWA 3MEVA 1IREB 2FZGB 2LQWA 3C95A 1UGRB 2KRMA 1PD1A 2ZZDA 2ENMA 2VGNA 1GBRA 1ZUKA 3BE3A 2XDBA 4FM4B 4BI4A 2DEUA 3G71Q 4A63B 2CYZB 4OMFB 3J81E 1VQ6Q 1BK2A 2E64A 1G3WA 2LX7A 4ORZA 2EYZA 3EGUA 5D7UA 2RJCA 1CKBA 4M75C 3J7AF 2E70A 4EMKB 1MUZA 6AT1B 4M7AG 2A37A 4PNOA 1XTDA 2O9VA 1UUEA 4PJOB 2J6FA 4RTYA 2HQHA 3IQLA 4HCBA 1RACB 1RLQC 4HCCA 2KVQG 3J80E 3CXCS 2EIFA 3A98A 1LNXA 2RJFA 2KAFA 2R5AA 4OMPA 1VYVA 1OQKA 3WVEB 3OYYA 2LQNA 2EPDA 4M78B 1RADB 1X6GA 1G3SA 2CP5A 1WHGA 2EGEA 2XKOC 1A0NB 2QQ9A 1NYGA 2CDTA 2D8JA 4OGEA 4RG8A 3OBWA 4A4GA 2DEQA 1AZEA 4KRTA 2F2VA 5I22A 1VQ4Q 3L1AA 3A8OB 2PVGB 1KHCA 3CCRQ 1VQ9Q 1PKTA 4QVDA 1YITA 2O01E 4RUGA 1IGUA 3GF5A 1X6BA 3RIRA 3CCVQ 3UWNA 1YI2Q 4M7DB 3OYHA 1VQKQ 1NEGA 1UGVA 4N4HA 4ZTJA 1M1KU 2JS0A 1WXBA 4HVUA 4DBRA 1X27A 3JCMc 2Y4XA 1BCOA 4ZGDB 4BB7A 1KQSS 2DA9A 4FYXB 1Q82R 4LXCA 2D8HA 2K4YA 3RNJA 2F2XA 4M77G 2K7AA 3CC4T 2ROTA 3CD6A 1B34A 3DB4A 3OYBA 1EIFA 1N9RA 4C5EA 4EIKA 4DBQA 2H3EB 4VUBA 4C8QE 1QCNA 4QKUA 4DOWA 3CCQQ 2EJ9A 2DL7A 3EHRA 2HZYA 1HXDA 3O5ZA 3JSCA 1TUCA 3CMET 3JCMg 5CK9A 2ED0A 4XU2A 5GMKi 2EW3A 1WHKA 4M7AD 1PRMC 2CKKA 2QG9B 1S1NA 2DXTA 3GNFB 3H0IA 4B9XA 2EQUA 2RJEA 2DM1A 1M5Q1 5FW9A 5LJ3f 3H41A 4AMCA 4PL6A 5KH6A 3EFOB 4HA8A 3CMAQ 2VKNA 4M7DA 4AFUC 2LCCA 2C0TA 1M90U 1YHQQ 5CCAA 2M02A 4PJOF 1PSFA 3KFVA 3GNGA 1G5VA 1K8AC 5LJ5e 3QSUA 3MP1A 5DLQE 2DILA 1GFDA 3P8HA 2ROLA 4PJJA 1U1SA 2OTJA 1M2OA 1AEYA 4C0ZA 4RTXA 1NYFA 2JMAA 2QA4T 4M78F 1R0BG 1PD0A 1KD1U 2ZPFB 3RMQA 1WX6A 2DX1A 3VRZA 4J9HA 3M53A 3RDVA 4AFZC 5C6SA 2Z0WA 2EYQA 1VQNQ 1W2BS 2V1QA 1AZGB 3I55Q 2E1HA 5KYXA 3G6EQ 1OU9A 4IUPA 2AT1B 2PTKA 2OTLT 3VV0A 1NPPA 1OYXA 4M77D 2E41A 1JU5C 4M7AC 5AT1B 2DMOA 2KNBB 3E19A 3E9FA 4ZN1A 1JJ2A 5GAOl 5J26A 2KT8A 3EFOA 3GPLA 1QP2A 2QGFB 3FIFA 3QHSA 4XK8E 4DA4A 4XTZA 3QYHB 3EGDB 4ZGEB 4X34A 2QEXQ 1M1FA 1PHTA 1Q7YU 4HT9A 2CH4A 1VQLT 3NGPA 2YXYA 4C8QG 2KGTA 3DKMA 3CCSQ 3X28B 4IURA 3PMIA 3CEYA 3L2ZA 2CZ7B 2E5QA 4MDXA 3T9NA 1GCQA 2GCXA 4N0AA 1N27A 5GANe 2RHXA 2ZPHB 3JAME 3V7RA 4KGVB 4GLKA 2EAYA 4FL6A 3I56T 3EGXB 1WA7A 1S72T 1SG5A 1ZUYA 1ZUUA 2BUDA 2BZYA 3ZEHA 1E6HA 2EQMA 1VQ4T 1M1KR 3CCJQ 1BI2A 4C5HA 4JRQA 3UA7A 4EDUA 4NOYA 3FLGA 3DB3A 3OYCA 4KUDK 4LD6A 2DYIA 5GJVB 3CCET 2LJ3A 4EPCA 1OX9A 3HTRA 2CSIA 3TU4K 3X20B 4M77C 2L3RA 3G4SA 2FYKA 3JB9G 1NM7A 1OEBA 4XTWA 2WACA 2LNHB 3OS5A 1JQQA 2KI7A 1VQMA 1ZSZA 4RMOA 1EFNA 3P8BB 3CXCA 4PFZA 2JOYA 1I5LA 2K5LA 1VQOT 3EGDA 2XIDA 1MMNA 2LDMA 4E7KA 1M2VA 2ATCB 2PVOB 4J9DA 1N8RU 3QWYA 3L2RA 2NLUA 1GFCA 1ARKA 1I07A 3JV3A 1HJDA 4UC4A 1K9AA 1RABB 2P0QA 2V8IA 3M0QA 1YIJT 5GJWB 5M9OA 1W4SA 1BI0A 4RTVA 2R5MA 4C92B 3CC7A 3FC3A 3KBGA 2KY9A 2NWMA 3CC2Q 1U06A 1KC8C 4J9GA 3MEUA 3E1SA 2GFUA 1M90R 2A3LA 2G3RA 2DL5A 4E7HA 5KE3A 2L89A 5L23A 4C0GA 2VWFA 4JS5A 3X24B 1D09B 1NE8A 1SF9A 1X01A 3QZ5B 3V8JA 1FYNA 3JCMh 4C8QD 1U5SA 2ABLA 2YT6A 4MDWA 3MHXA 3O8VA 2ZPEB 2PVDB 8AT1B 3FJ5A 1HD3A 1ABQA 1KD1R 1IXDA 3JB9J 1M4ZA 5LL6S 1OI1A 4QQ6A 4GBQA 4BE2A 5GAN7 3HRTA 3OW2A 5GAMf 2RPNA 2VXFA 1TS9A 4KH1B 1AWXA 3M0SA 5ECAA 5FU7C 4OMNA 1AWOA 3OA6A 1B07A 4FSSA 5FROA 3PVQA 2KR3A 2O4XA 3QO3A 2VVKA 2BZ8A 3VS7A 4C92A 2Y90A 3R6NA 2A36A 4DEXA 1SHFA 2DJQA 1BKBA 5GMKl 2O88A 3CC4Q 3EG9A 2GQVA 2MWPA 1E7OA 2RMOA 2NUTA 2E12A 4JRKA 3EFSA 3OB9A 2RO0A 3A8HB 4N4IA 1Q7YR 1K0XA 3JB9F 1YI2A 1FMWA 4PJOE 1BYMA 2DD5A 5D6XA 4M75A 1KIKA 4RTTA 4F04B 1M30A 3VUZA 1VIEA 3QKJA 1ZBJA 5EC7A 2P4TA 1QP3A 2WSFE 2JS2A 4C8QC 3CMEQ 4M78E 3I35A 3X25B 1UECA 4FYYB 1OV3A 2QAZA 3G7ZA 1N6AA 1NZ9A 4XQ3A 1VQ8A 4JRIA 1KHIA 4LE9A 2A08A 4PJMA 1PWTA 4E7LA 3EG3A 1D1BA 1QVFP 1QWEA 4R55A 2RHZA 2YRDA 4XTVA 3CCUQ 5FU6C 2X9HA 2DL8A 2DVEA 1UJ0A 2RJDA 3OYJA 2LJ1A 1JJ2S 1YITT 2EVRA 1OZ2A 1RAGB 2QQAA 2CUDA 5L8RE 4ELZC 1PC0A 2K3XA 4M7DE 3L2UA 5KCOA 3AHUA 2KK4A 2LC4A 1QVGP 3M56A 2YWWA 2EQIA 4FYWB 4YTLA 5GAN5 5LJ5d 5FWBA 2QA4Q 2BIVA 1IHWA 1K8AU 2W10A 1JXMA 3ZBDA 5A2QE 3E9GA 1N8RR 1Z9QA 3SWNB 1SSFA 3REBB 3CD6T 5IT9E 2RN8A 1VQ7A 1N8RC 3H8ZA 2QYZA 1X43A 2D9TA 1TTHB 1IB8A 1M3AA 2YLBA 2LRQA 2RI5A 2PNIA 2XU8A 2YLCA 1Y96A 1RAEB 2CP0A 1YNZA 3RMSA 5CKHA 3LW5E 4IUUA 1T0HA 4A4FA 2VV5A 5FRNA 2OTLQ 1UJYA 1SSHA 2ZPBB 2K3BA 1M3BA 2KT1A 3EHQA 4PK4A 1Q81C 2H8HA 2P0PA 3KUFA 5D6YA 1QWFA 2DPPB 2Y4YA 3CC2T 3C94A 2EYYA 1LVKA 4QVZA 3I5RA 1NLPC 1TUDA 1Y7XA 5CIUA 1B34B 2COZA 2HEQA 3THKA 4BACA 4PJOG 4C0DB 1RUWA 1VQLQ 1WDXA 3INZA 2LQKA 4AFSC 4OB3B 2DJZA 5I2SA 1SEMA 2DTHA 2JTMA 5DM7R 4KT0E 1XJWB 1AHJB 4PLIA 4M78G 2ZCFB 2OTJT 1WFWA 1AWJA 3SWNA 3I56Q 2DIGA 2JN0A 5GANd 1S72Q 4X1VA 5LJ3e 3OYEA 2C0IA 5KYYA 5DLOA 2HBWA 4HVVA 2KDSA 3M54A 4HCKA 5I11A 4TVRA 2SRCA 2CP6A 3OMCA 5IN1A 4ZN3A 2FB7A 1I8FA 3HRUA 1JEGA 2YRCA 3UPUA 3A8LB 2PU9B 2L2PA 4BE1A 1WQ7A 1XQHA 4FW2A 3CCEQ 3RESA 1O9SA 4JJBA 1Z9ZA 4M7DG 5GAOq 3EAEA 1YP5A 1WQWA 4HVWA 2K79A 4Y91A 4D8DA 2LVMA 2H3JA 4DQ2A 4OB0B 1YJNA 1MGQA 2JM8A 3DLMA 2HL5C 1K9MC 5CAIA 2FRWA 2HQEA 1VQOQ 3OW2S 2RI3A 2KBTA 4FCYA 1D1CA 3CCLA 4M7AA 3M55A 2A28A 3CCMA 4IUTA 1X69A 3A1PA 3GLXA 3NFCA 2K2VA 3FDRA 4IKFA 3QUIA 2QASA 1WLPB 1YIJQ 2E3IA 2HD0A 5IAYA 1FXXA 2KXCA 2DYBA 2QK0A 4FSXA 1C0MA 1JB0E 2MPXC 2EJGA 5KYXB 2JM9A 1RL2A 2YUOA 4HT8A 2B8AA 3LYIA 2QXFA 1G2BA 2K3YA 1VOMA 3JRZA 3RBBB 2DFUA 1W70A 1KC8U 2L8DA 3CCUT 1BIBA 2OJ2A 4BY6B 4KULA 2YUNA 4PJOD 2DLPA 4L59A 1M8MA 2RF0A 1LOJA 2MF2A 2J05A 4EMGA 2M51A 1VYTA 3CBOA 2L3QA 4FT4A 2F5TX 3JB9H 3VU3C 1K8AR 1CSKA 3EFRA 1PRLC 1Y07A 1YJ9T 2LQ8A 1QCOA 5CKDA 2VB6A 4F14A 4FU6A 3WXMB 1C6VX 1SHGA 1I1JA 1TG0A 4M78D 2RB6A 2P0KA 3UDCA 1VQ5A 2DO3A 2DETA 4PKCC 3L2QA 3EG0A 3BDLA 3G4ST 1MV3A 3OSVA 1VQPA 3AT1B 3QYGB 2CH4W 2EQJA 2MI6A 2OX7A 1RAAB 1VQMT 1AOJA 4Z8AA 3PIPA 4OMOA 2MWOA 2JXBA 1X2KA 1NJIC 4JPBW 2DBKA 4Q5WA 5IH2A 2LX9A 4A4EA 4J9BA 1D0YA 3JCMV 2AK5A 3QDFA 3MP8A 4WTOB 2X51A 1GBQA 2YHTA 1I4K1 1TOVA 4M7DD 2X4YA 2J6OA 1Q86C 3A8MB 3LGFA 4DBFA 4J7FA 4C92E 3S6WA 3CC7T 4CI0C 3M58A 2O9SA 5GMKe 1H3HA 4M7DF
chains in the Genus database with same CATH topology
2GFUA 1YJWA 1M8VA 3VKIA 5KE2A 2A7YA 4N4GA 2RH2A 2A3LA 3QPHA 2G3RA 5GAMh 3CCJA 3FRNA 1YJWT 4E7HA 1W2BA 5GAMd 5GANg 5KE3A 2L89A 2JNGA 4XU0A 4C0GA 3KXTA 3LLRA 3A8GB 4JS5A 5HY6A 3X24B 4EMKC 5GAN4 3CCJT 1YBYA 3ZFJA 3RKXA 1NE8A 1M9SA 5A0GA 1X01A 3QZ5B 3V8JA 4OP0A 4PJOC 5CKFA 3RUXA 1I81A 2FL7A 3M5AA 4M77B 1JBMA 1VIFA 3JCMh 4C8QD 5GAN6 4F7UG 3JCMd 4MDWA 4M77E 4F7UF 2BKDN 2DXBA 2PQWA 3MHXA 3O8VA 5J3BA 1WJRA 2ZPEB 2GF7A 3LWIA 4EMKA 2PVDB 4NS5A 4LDUA 1FWZA 2L5QA 2LT1A 2XD0A 5I2MA 1K73C 4ZGJB 3HSBA 3JB9J 4JS4A 4BE0A 1M4ZA 4PJOA 2F69A 4X9DA 5LL6S 4ZTFA 1Q82C 1OI1A 1QVPA 1VUBA 2EQKA 2KMTA 4J6XA 4J6WA 2PUOB 4M78C 4MZTA 4QQ6A 5GAN7 5HK3A 4BE2A 3Q1JA 3ASKA 3HRTA 5GAOn 1LJOA 2XK0A 3OW2A 2M9UA 5GAMf 3SD4A 3TCJA 3JCMW 4RCBA 5J39A 2VXFA 4HKEA 4LDVA 2OAUA 3MEVA 1IREB 5LJ5g 3C95A 3NTHA 4J6YA 1UGRB 1QVFS 5FU7C 4BI8B 2ZZDA 4M78A 2VGNA 2DTIA 3VYGA 4DOVA 3OA6A 2XDBA 4FM4B 2V8JA 2VUBA 3JCMf 4BI4A 2QI2A 5LJ5j 2LT4A 3S3MA 5FROA 2CYZB 4OMFB 4A53A 3J81E 3OYAA 2O4XA 4JDSA 4C5GA 3QO3A 3SFMA 2E64A 1G3WA 3M59A 3NTIA 3PMTA 4C92A 2Y90A 3VJPA 3RERA 4QW2A 3RKWA 3CC2A 3X26B 1MHNA 2RJCA 4LDYA 3OYIA 3LWHA 5FRMA 1WPYA 5CQXA 4M7DC 1TH7A 1BKBA 5GMKl 4M75C 3J7AF 2E70A 3QJYA 2VC8A 4EMKB 4M7AG 3OYDA 1WJQA 4M7AF 4PNOA 1XTDA 1QVGS 2GQVA 2DD4A 2MWPA 3PNWC 5GAMe 5LJ3j 1G3TA 2E12A 2R57A 4PJOB 4JRKA 1G3YA 3EFSA 3OB9A 2RO0A 3A8HB 4N4IA 4HCBA 3JB9F 1YI2A 4HCCA 4PJOE 2KVQG 4Y28E 3J80E 1BYMA 3OYMA 2DD5A 5D6XA 1BI1A 3CXCS 4M75A 2EIFA 1LNXA 2RJFA 4II1A 2KAFA 2R5AA 1KG1A 4OVAA 3JCMe 3ER0A 4M77A 3WVEB 3OYYA 3VUZA 1VIEA 3QKJA 2P4TA 4M7AA 3SWNC 2XDPA 4M78B 3LH0A 2HAXA 1G3SA 1QP3A 2WSFE 4C8QC 4MMKA 2LTOA 1ZHIA 3M57A 2JVVA 2XKOC 4M78E 3X25B 3JCMJ 2QQ9A 3G7ZA 1N6AA 1NZ9A 4XQ3A 2O4XB 2HBPA 1VQ8A 4OGEA 4RG8A 5FU7B 4JRIA 3OBWA 1KHIA 1RI0A 4A4GA 2RHUA 2DEQA 4C8QA 3CPWA 4E7LA 1VQ8T 3OS2A 3FJPA 1KQ2A 4QVCA 4R55A 2RHZA 4XTVA 3QXEB 3L1AA 2M16A 4B9WA 4O6JA 3A8OB 2PVGB 1KHCA 5FU6C 4C92G 2RI2A 3HKSA 4OB1B 1Q81U 1M1GA 4QVDA 1YITA 2DXUA 2DVEA 2O01E 1XNIA 1O75A 2RJDA 3GF5A 3OYJA 4ELYC 3G71A 1JJ2S 2PUKB 4NL2A 1YITT 3RIRA 3TEEA 1VQ6A 3UWNA 3PTAA 2CS7A 4M7DB 3VUBA 4PLLA 1OZ2A 3OYHA 2E10A 2QQAA 4N4HA 4M75B 5L8RE 3G71T 4JLGA 4ZTJA 4ELZC 3M4GA 1UEBA 3HL8A 1VQ6T 1M1KU 1WJSA 2K3XA 4M7DE 3L2UA 5KCOA 3AHUA 2KK4A 4M75E 4ME7A 2JTFA 5GANj 5A0DA 2E6NA 3JCMc 2HQXA 2Y4XA 2XI9A 2VYTA 2LC4A 4ZGDB 4BB7A 2CZ0B 1KQSS 3M56A 2RK1A 4HCZA 5LJ5h 3CC4A 2F5KA 5CO7A 2K4YA 4YTLA 5GAN5 4C0DC 1XOVA 3C12A 4M77G 4KUIA 3L2VA 2RHYA 5LJ5d 4M77F 2BIVA 1K8AU 4GY5A 3PIOA 3CC4T 3CD6A 3ZBDA 2VGMA 4JLIA 5A2QE 3OY9A 3E9GA 4MZPA 1B34A 4QQGA 4CRIA 3DLLA 2WSEE 5DY9A 4XTXA 3DB4A 3SWNB 1SSFA 1YCYA 3CPFA 3L42A 3CD6T 3OYBA 5IT9E 4C8QB 1EIFA 2C06A 1N9RA 5GAOm 1VQ7A 4C5EA 1N8RC 3H8ZA 3MO8A 3JCMP 2ZPGB 4VUBA 2D9TA 3MCAB 5LJ3h 4C8QE 5GAMg 3UT1A 5GAOr 4ATOA 4RKUE 2YLBA 1VQ7T 2LRQA 4OGCA 5LJ3d 2RI5A 4R56A 2XU8A 2YLCA 1Y96A 2DK3A 4DOWA 2AHJB 2DZ9A 3S3NA 2EJ9A 3RMSA 3CMEA 2D6FA 5CKHA 2X4JA 3QZ9B 3LW5E 1HXDA 1Y71A 4IUUA 3JSCA 4JUVA 4X9CA 3CMET 4C5IA 5GAOp 1U8RA 4A4FA 5LJ5f 3PT9A 2VV5A 4XTUA 5FU6B 5FRNA 4BDYA 3CBPA 3A5ZB 3JCMg 2ZPBB 1UGQB 5CK9A 4XU2A 3V7SA 5GMKi 1S72A 3N5BB 4M7AD 2CKKA 4EMHA 2D0QB 1Q81C 1VQ4A 2P0PA 3KUFA 4RG2A 3CCUA 5D6YA 3OYGA 2DXTA 2DPPB 3CCRA 1QVFA 1VQ9A 3GNFB 4B9XA 2EQUA 2JUFA 2RJEA 2Y4YA 1OZ3A 3JB9D 3HFNA 3C94A 3HRSA 3CC2T 4QVZA 1M5Q1 3CCRT 2QQRA 2R58A 1VQ9T 1Y7XA 3FEOA 4L6V5 5LJ3f 4PL6A 2EFIA 5CIUA 4QQDA 4P5NA 1B34B 5KH6A 3CCVA 1M1KC 4HA8A 2K5IA 2DTOA 1VQKA 1PSEA 1YJ9A 4M7DA 5CKBA 4BACA 2LCCA 3PFSA 4LDWA 4XTYA 1K9MU 1M90U 4PJOG 3CCVT 4C0DB 5CCAA 4PJOF 1YI2T 1PSFA 4LD9K 1VQKT 3INZA 2IVWA 3GNGA 1G5VA 3V8LA 1X6OA 2LQKA 4E7IA 1K8AC 5LJ5e 2EWNA 3QSUA 4OB3B 1Y96B 3MP1A 3HFOA 2DJZA 5I2SA 2DZCA 5DLQE 5KCHA 1D3BB 1QVGA 1NPRA 2DIQA 3P8HA 2DTHA 2LNVA 3BDUA 3OS0A 1U1SA 2QA4A 2JTMA 5DM7R 2OTJA 4BD3A 4KT0E 5GMKj 4OB2B 1AHJB 5GAN3 1X75C 3QG1A 4PLIA 1N9SA 3HPWA 4C0ZA 4M78G 2QA4T 3VYHB 2ZCFB 4M78F 3M4YA 4XAXB 2OTJT 4FIBA 5GANh 4LDXA 1GXIE 3SWNA 1KQ1A 2EJFA 3OYNA 1H3ZA 2DIGA 4C92D 1KD1U 2JN0A 2ZPFB 3RMQA 5GANd 2RHIA 2V8KA 5LJ3e 3OYEA 5DLOA 3M53A 4RCCA 4A54A 3HHTB 3QBYA 3CBMA 4C92F 1JRIA 2KDSA 3M54A 4JJNK 3QJ6A 3OYKA 3CCQA 5C6SA 3L2WA 2X35A 5CVIA 2K5FA 4TVRA 3OMCA 2EYQA 5IN1A 4ZN3A 1W2BS 2FB7A 1I8FA 3BFMA 3CCQT 3HRUA 3JCMb 2X4XA 3UPUA 2WSCE 3A8LB 2PU9B 4BE1A 1WQ7A 3QIIA 1XQHA 2E1HA 2OTLA 3RESA 1IZ6A 2RD1A 4A4HA 4IUPA 1O9SA 4BY6C 2HNIA 4BUGA 2OTLT 3VV0A 1DJ7B 1NPPA 1OYXA 4M77D 4M7DG 5CKEA 2M1HA 1FX7A 2E41A 2I2LA 4M75G 3EAEA 5GANf 5GAOq 4M75F 4FT2A 4M7AC 2QQBA 1WQWA 4KBMB 4Y91A 2E65A 2RM4A 2LVMA 2H3JA 4DQ2A 2E6ZA 4OB0B 2ZPIB 1UB4A 3H6ZA 1BIAA 3E19A 3OSSC 1MGQA 3E9FA 2MMPA 3SB2A 4ZN1A 1YJNA 1JJ2A 3DLMA 3FB9A 5GAOl 5J26A 2CZ6B 1K9MC 1M90C 5CAIA 2HQEA 4F7UB 3GPLA 1QP2A 3OW2S 3CMAA 1YJNT 2RI3A 4BDZA 3FIFA 2FVUA 3QHSA 5A0LA 4XK8E 3CCLA 4DA4A 4XTZA 3M55A 3QYHB 4ZGEB 3CCMA 4X34A 3OS1A 1YHQA 4F7UE 4IUTA 3QDRB 3TREA 1VQLA 1M1FA 3CMAT 4IUVA 3GLXA 1P92A 2K2VA 3NFCA 3CCLT 1Q7YU 4N0AC 3CCMT 4HT9A 1YHQT 1ZQ1A 3FDRA 1KQSA 1VQLT 3R6OA 4IKFA 3QUIA 3JCMQ 2K57A 3HP9A 3V7CA 3S3OA 5HK0A 4C8QG 4IUQA 1NJIU 2KQWA 4C8QF 3DKMA 3OBYA 2HD0A 3X28B 5IAYA 1FXXA 1D3BA 3PMIA 4IURA 3CEYA 5I21A 3L2ZA 1U1TA 2CZ7B 2E5QA 3C4SA 4FSXA 4MDXA 3T9NA 1JB0E 2XDDA 3LGLA 2GCXA 2QDYB 2EJGA 2MAMA 2CZ1B 5GAMj 1KD1C 4N0AA 3OYLA 5CQYA 1N27A 5GANe 5HKCA 2RHXA 3SDZA 2ZPHB 3NTKA 3JAME 1RL2A 2YRVA 3I56A 3V7RA 4HT8A 2B8AA 3LYIA 2QXFA 2LCLA 2JZ2A 2K3YA 4GLKA 2EAYA 4Z02A 1Q86U 4XU3A 4FL6A 3I56T 5GAN8 3JRZA 3V8KA 3GOXA 4C92C 5GMKh 1S72T 2DAQA 2BUDA 2DXCA 3ZEHA 2IG0A 2EQMA 1VQ4T 3LX7A 3JB9I 1KC8U 2L8DA 4XU1A 3META 1BIBA 3CCUT 2VXEA 1BI2A 2X4WA 4BY6B 4KULA 4MZMA 4C5HA 1VQNA 5EG2A 4JRQA 4PJOD 2KSSA 4L59A 3URGA 1LOJA 2MF2A 2QTXA 2QQSA 4EDUA 3CBOA 3FLGA 4NOYA 4EMGA 3I55A 4FT4A 3CCEA 1VQNT 2XHCA 2F5TX 4M7AB 5LJ3g 3DB3A 3JCMX 3G6EA 3VU3C 3OYCA 4E7JA 4KUDK 3JB9H 4LD6A 4C0FA 3BY7A 3PGGA 3I55T 3EFRA 3CCET 1WNLA 1YJ9T 1Y07A 1ZBXA 4J7IA 3G6ET 2M0OA 2LQ8A 3OMGA 4M7AE 5CKDA 4EPCA 4FU6A 3WXMB 3TU4K 5FLXE 4M78D 2RB6A 2L3RA 2P0KA 4M77C 3UDCA 3X20B 3G4SA 1VQ5A 2FYKA 2DO3A 5GMKm 4PKCC 3L2QA 4A4KA 3BDLA 3JB9G 5CR2A 1HK9A 2CGHA 4XTWA 2WACA 1K73U 3G4ST 3MP6A 3OSVA 1H641 1VQ5T 1VQPA 3GP8A 3OS5A 1VQOA 3QYGB 1UGSB 2EQJA 2FHDA 2DKGA 1VQMA 4F7UA 4RMOA 3P8BB 1Q82U 3CXCA 2JOYA 2MI6A 1Q7YC 3WVDB 1I5LA 4NL3A 1VQPT 2K5LA 3CPWS 1V29B 5D6WA 2XG8D 4E47A 2QEXA 1VQOT 1VQMT 2XIDA 4E7KA 2LDMA 4L5GA 3PIPA 2MWOA 1NJIC 2PVOB 2RA2A 4O5VA 3OQ5A 4Q5WA 1N8RU 1R8OB 2LX9A 4A4EA 3L2RA 2QEXT 4JRPA 4J5YA 2NLUA 3JCMV 2EKOA 1YIJA 3CCSA 4J8OA 4OF1A 3MP8A 4D6WA 4UC4A 3OYFA 2RK2A 1WGSA 2P0QA 2V8IA 3RKYA 3ME9A 2YHTA 1YIJT 5M9OA 1W4SA 1BI0A 1I4K1 3CCST 2R5MA 4C92B 3CC7A 5GAN2 3MEAA 4WF2A 4V2SA 2ZGWA 5C0MA 3BW1A 4M7DD 2X4YA 4MMLA 1BI3A 3A8MB 3P8DA 1Q86C 3FC3A 4M75D 3GIBA 3LGFA 3KBGA 2KY9A 3M9QA 4J7FA 5AYFA 3F70A 3S6WA 4BI3A 4C92E 4CI0C 1QW1A 2GFAA 3M58A 3CC7T 3MEWA 1UGPB 2XICA 1KC8C 5GMKe 4M7DF 4J83A 3MEUA 3E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFU A;  2EQU A;  2RJE A;  3S3O A;  5KE2 A;  1OZ3 A;  4IUQ A;  2LTO A;  4N4G A;  4QVZ A;  2G3R A;  5IAY A;  2QQR A;  2R58 A;  3PMI A;  4IUR A;  3CEY A;  3FEO A;  4E7H A;  4PL6 A;  2E5Q A;  2EFI A;  3C4S A;  2L89 A;  5CIU A;  5KE3 A;  4QQD A;  3LLR A;  5KH6 A;  3LGL A;  2O4X B;  3OYL A;  1N27 A;  2RHX A;  4BAC A;  1RI0 A;  2LCC A;  3NTK A;  2RHU A;  3PFS A;  2YRV A;  4A4G A;  2B8A A;  3LYI A;  4E7L A;  3OS2 A;  2JZ2 A;  2K3Y A;  2RHZ A;  4Z02 A;  4B9W A;  2M16 A;  4FL6 A;  1G5V A;  1KHC A;  3GOX A;  2PQW A;  2BKD N;  2RI2 A;  3O8V A;  4E7I A;  1WJR A;  2DAQ A;  2GF7 A;  2BUD A;  3MP1 A;  4NS5 A;  3ZEH A;  2IG0 A;  2EQM A;  5KCH A;  3LX7 A;  3P8H A;  2DIQ A;  2L8D A;  1XNI A;  3MET A;  3OS0 A;  2X4W A;  2RJD A;  4BD3 A;  4BE0 A;  4C5H A;  3OYJ A;  4ZTF A;  1OI1 A;  2EQK A;  4PLI A;  4QQ6 A;  4L59 A;  3UWN A;  4BE2 A;  3MEU A;  3Q1J A;  3ASK A;  4PLL A;  1OZ2 A;  2QQS A;  4EDU A;  2XK0 A;  3FLG A;  4N4H A;  3OYH A;  3SD4 A;  4ZTJ A;  3DB3 A;  4E7J A;  3OYN A;  3OYC A;  5J39 A;  1WJS A;  2DIG A;  4LD6 A;  2K3X A;  3L2U A;  3MEV A;  5KCO A;  2RHI A;  2JTF A;  3OYE A;  2E6N A;  2M0O A;  2HQX A;  3OMG A;  3NTH A;  2VYT A;  4FU6 A;  3QBY A;  4HCZ A;  2F5K A;  3QJ6 A;  3OYK A;  3OA6 A;  5C6S A;  3L2W A;  2X35 A;  3L2V A;  2L3R A;  2P0K A;  2RHY A;  2BIV A;  4GY5 A;  3OMC A;  5IN1 A;  3L2Q A;  3BDL A;  3S3M A;  5FRO A;  3OY9 A;  2WAC A;  2X4X A;  3E9G A;  4QQG A;  3MP6 A;  4CRI A;  3OYA A;  2O4X A;  4C5G A;  4BE1 A;  3DB4 A;  3QII A;  2EQJ A;  2FHD A;  1SSF A;  3L42 A;  3NTI A;  3PMT A;  3OYB A;  4A4H A;  4IUP A;  4QW2 A;  5D6W A;  4C5E A;  1MHN A;  2RJC A;  3H8Z A;  3MO8 A;  3OYI A;  2LDM A;  4E7K A;  5FRM A;  2D9T A;  2MWO A;  1OYX A;  2M1H A;  3UT1 A;  3OQ5 A;  4Q5W A;  3EAE A;  2LRQ A;  4A4E A;  2RI5 A;  3L2R A;  3OYD A;  1WJQ A;  2NLU A;  3S3N A;  2EKO A;  2MWP A;  3PNW C;  2LVM A;  3MP8 A;  2R57 A;  3H6Z A;  4UC4 A;  3OYF A;  3E9F A;  2RO0 A;  3OB9 A;  4IUU A;  4N4I A;  1WGS A;  3DLM A;  5J26 A;  3ME9 A;  4C5I A;  5M9O A;  4A4F A;  5FRN A;  2HQE A;  2R5M A;  4BDY A;  3OYM A;  3MEA A;  2RI3 A;  5D6X A;  4BDZ A;  5C0M A;  2X4Y A;  2RJF A;  3P8D A;  2R5A A;  4II1 A;  3FC3 A;  4X34 A;  3OS1 A;  3LGF A;  4IUT A;  3M9Q A;  4OVA A;  1H3Z A;  3S6W A;  2CKK A;  3F70 A;  2GFA A;  4IUV A;  3KUF A;  4RG2 A;  3QKJ A;  5D6Y A;  3OYG A;  3MEW A;  3FDR A;  4IKF A;  2XDP A;  3LH0 A;  4B9X A; 
#chains in the Genus database with same CATH topology
 1YJW A;  3VS0 A;  4CC3 A;  2LJ0 A;  5GAN g;  4XU0 A;  1H8K A;  4EMK C;  3VRY A;  1BBZ A;  1ZSZ B;  1G83 A;  4OP0 A;  4PJO C;  2DNU A;  1M2V B;  5GAN 6;  3M0U A;  3LWI A;  5J3B A;  2GF7 A;  2RQW A;  4NS5 A;  1FWZ A;  2LT1 A;  1K73 C;  3HSB A;  1V76 A;  3I5S A;  2F69 A;  1OPL A;  2KMT A;  1QVP A;  4J6X A;  4J6W A;  4MZT A;  4M78 C;  2SEM A;  3Q1J A;  3VS1 A;  3CPW P;  3JCM W;  2X3W D;  2P4R A;  1GRI A;  4LDV A;  2OAU A;  2JJ9 A;  3NTH A;  4J6Y A;  4BI8 B;  1RAI B;  2BZX A;  3VYG A;  4DOV A;  1YIT Q;  3JCM f;  5LJ5 j;  4A53 A;  1LCK A;  3OYA A;  4JDS A;  3SFM A;  3M59 A;  3NTI A;  3EG1 A;  2HKN A;  3RER A;  2HDA A;  3OYI A;  1WPY A;  5CQX A;  4M7D C;  2HSE B;  2DD4 A;  3PNW C;  5GAM e;  1G3T A;  2L0A A;  1QKW A;  3CD6 Q;  3CQT A;  4Y28 E;  3OYM A;  1BI1 A;  1RAF B;  4II1 A;  1KG1 A;  4OVA A;  2DRM A;  3RR6 A;  2G6F X;  1WIE A;  3LH0 A;  2HAX A;  4KGZ B;  1K76 A;  3M57 A;  2JVV A;  3JCM J;  2CT4 A;  2FPE A;  2O4X B;  1RI0 A;  1KC8 R;  4C8Q A;  1VQ8 T;  3OS2 A;  3FJP A;  2E3H A;  3QXE B;  1E6G A;  4O6J A;  4C92 G;  4F17 A;  2RI2 A;  1Q81 U;  1M1G A;  3EG9 B;  2EGC A;  2MYS A;  1XNI A;  2NUT B;  4ELY C;  3G71 A;  1KJW A;  2PUK B;  3TEE A;  1VQ6 A;  3PTA A;  2CS7 A;  2M0Y A;  4M75 B;  1MNE A;  1T3S A;  3M4G A;  3HL8 A;  1WJS A;  1ACM B;  5GAN j;  2E6N A;  2HQX A;  2XI9 A;  2CZ0 B;  3G1J A;  4FYV B;  2DVJ A;  2RK1 A;  4HCZ A;  1WXU A;  5LJ5 h;  5CO7 A;  1GL5 A;  2E4H A;  4KUI A;  3L2V A;  2RHY A;  1WXT A;  2OTJ Q;  3M0T A;  4MZP A;  3CXC P;  4CRI A;  3DLL A;  1ZLM A;  1W1F A;  3CPF A;  1UE9 A;  1GCQ C;  3MO8 A;  4FW1 A;  3JCM P;  2ZPG B;  3UT1 A;  4ATO A;  1SKU B;  1VQ7 T;  4OGC A;  5LJ3 d;  4R56 A;  2DK3 A;  2DZ9 A;  2EGA A;  2X4J A;  4LUE A;  1J3T A;  1Y71 A;  4JUV A;  4X9C A;  4C5I A;  1U8R A;  3PT9 A;  4BDY A;  1AVZ C;  1UGQ B;  3U23 A;  2GTO A;  2KYB A;  3V7S A;  1S72 A;  3TSW A;  3C0C A;  4EMH A;  2D0Q B;  1VQ4 A;  4RG2 A;  3CCR A;  1QVF A;  1VQ9 A;  2JUF A;  3JB9 D;  1OZ3 A;  3HRS A;  2QQR A;  2R58 A;  3FEO A;  4L6V 5;  1WHL A;  4QQD A;  3CCV A;  1ZSG A;  1RAH B;  2K5I A;  1VQK A;  3PFS A;  1K9M U;  2CSQ A;  4DBH A;  2IVW A;  2CP7 A;  1KQS P;  2KYM A;  2I0N A;  1OUL A;  1H92 A;  1X6O A;  1NG2 A;  4E7I A;  1G8X A;  2JW4 A;  1Y96 B;  2J6K A;  3HFO A;  1QVG A;  1D3B B;  3OS0 A;  2LNV A;  1M3C A;  3BDU A;  4BD3 A;  1I0C A;  1X75 C;  3QG1 A;  1N9S A;  3HPW A;  9ATC B;  4XAX B;  3M4Y A;  1HYO A;  4FIB A;  5GAN h;  4LDX A;  1GXI E;  1KQ1 A;  4C92 D;  4F16 A;  2RHI A;  2V8K A;  4E7Z A;  1M27 C;  4A54 A;  4KGX B;  3CBM A;  4C92 F;  1JRI A;  4JJN K;  3QJ6 A;  3CCQ A;  1MV0 B;  2X35 A;  2K5F A;  2CUB A;  1FMK A;  2X4X A;  2WSC E;  1NBE B;  4JJC A;  1QCF A;  1YJ9 Q;  2RD1 A;  4A4H A;  2NYS A;  2HNI A;  1DJ7 B;  2DL4 A;  5CKE A;  1FX7 A;  2I2L A;  4M75 F;  4FT2 A;  2QQB A;  4KBM B;  2OI3 A;  1B3Q A;  1UFF A;  3G4S Q;  2E6Z A;  1OOT A;  2BE9 B;  4OMQ A;  3H6Z A;  1BIA A;  3OSS C;  1BU1 A;  3TQ7 P;  4F7U B;  4IIO A;  1YJN T;  3CMA A;  4CC2 A;  1VQM Q;  2FVU A;  2FZC B;  5A0L A;  1YHQ A;  3OS1 A;  1OU8 A;  1ZA1 B;  1KFZ A;  2AZV A;  3CCL T;  4IIM A;  3CCM T;  5KYY B;  3R6O A;  2LP5 A;  2AKL A;  2K57 A;  3HP9 A;  4Z89 A;  2NUP A;  5HK0 A;  3JCM Q;  3S3O A;  1NJI U;  1OPK A;  3SHW A;  1D3B A;  2YUP A;  1U1T A;  2CZ1 B;  3OYL A;  5CQY A;  3CC7 Q;  1Q81 R;  3SDZ A;  3NTK A;  2YRV A;  2LCL A;  2AKK A;  2JZ2 A;  4Z02 A;  1Q86 U;  2X3X D;  5GAN 8;  3GOX A;  1NEB A;  4C92 C;  1AT1 B;  2DAQ A;  2DXC A;  1MMA A;  2IG0 A;  3LX7 A;  4M4Z A;  3JB9 I;  2MIO A;  1W2B P;  3MET A;  2COY A;  2KXD A;  1IGQ A;  1VQN A;  5EG2 A;  3URG A;  3I55 A;  2QQS A;  4LN2 A;  3JCM X;  5KYU A;  4M7A B;  2AZS A;  5LJ3 g;  3G6E A;  4C0F A;  4J9I A;  3BY7 A;  3PGG A;  1K4U S;  4QT7 A;  1WNL A;  1MMG A;  1WHM A;  1ZBX A;  4J7I A;  2M0O A;  3OMG A;  4OMM A;  2EKH A;  4GLM A;  2D0N A;  3H0F A;  1UDL A;  2HCK A;  1GCP A;  1QMC A;  1HK9 A;  5CR2 A;  1I5O B;  3ZL7 C;  1K73 U;  3MP6 A;  1VQ5 T;  2P84 A;  2KRN A;  1EZZ B;  2FHD A;  4JZ3 A;  2DKG A;  4F7U A;  1VQP T;  1V29 B;  2XG8 D;  2QEX A;  1MMD A;  3H9N A;  4E7S A;  2RA2 A;  3OQ5 A;  1R8O B;  1Y0M A;  4J5Y A;  1D0X A;  1K0S A;  2EKO A;  3CCS A;  4OF1 A;  4D6W A;  2RK2 A;  2JT4 A;  1OX8 A;  3RKY A;  4RTW A;  1JO8 A;  2KRS A;  2F1L A;  3LH5 A;  3VS4 A;  5GAN 2;  3MEA A;  1WHJ A;  3TVT A;  5C0M A;  3BW1 A;  2L3P A;  3GIB A;  5AYF A;  3E2U A;  1QW1 A;  2GFA A;  1PCX A;  5IXF A;  3MEW A;  1UGP B;  2XIC A;  4PJN A;  2HSP A;  1BCM A;  1R0C B;  1M8V A;  2GNC A;  2A7Y A;  1K9M R;  4N4G A;  1QKX A;  2RH2 A;  1CKA A;  1PNJ A;  3VS5 A;  3CCJ A;  1YJW T;  5GAM d;  2JNG A;  3LLR A;  3H0H A;  5HY6 A;  1KK7 A;  1VA7 A;  5GAN 4;  1YBY A;  2YDL A;  3ZFJ A;  1M9S A;  4K11 A;  2EYW A;  3RUX A;  1I81 A;  2FL7 A;  3M5A A;  4M77 B;  2FZK B;  1D0Z A;  4AT1 B;  4F7U F;  2BKD N;  2DXB A;  2PQW A;  4WCI A;  4EMK A;  3VS6 A;  4LDU A;  1TUG B;  2FEI A;  4ZGJ B;  1TU0 B;  4PJO A;  2HKQ B;  1QLY A;  4ZTF A;  1Q82 C;  1VUB A;  2PUO B;  2HMA A;  5HK3 A;  1VQ8 Q;  4RTU A;  5GAO n;  1LJO A;  3TCJ A;  4RCB A;  1Y57 A;  4HKE A;  2FRY A;  4OML A;  5FWC A;  4J9F A;  5LJ5 g;  3NHN A;  2NUZ A;  1QVF S;  4M78 A;  2DTI A;  2V8J A;  2VUB A;  2GGR A;  4AG2 C;  2QI2 A;  2LT4 A;  1R77 A;  4AFQ C;  3S3M A;  2JMC A;  2JTE A;  3M0R A;  3EH2 A;  4C5G A;  3PMT A;  3VJP A;  4QW2 A;  3RKW A;  3CC2 A;  3X26 B;  1MHN A;  4LDY A;  3LWH A;  1T0J A;  5FRM A;  1TH7 A;  1RI9 A;  3QJY A;  4AG1 C;  2VC8 A;  2O31 A;  2V26 A;  3OYD A;  1WJQ A;  4M7A F;  1QVG S;  5LJ3 j;  2R57 A;  1G3Y A;  2ED1 A;  2J06 A;  2DE0 X;  2LCS A;  1N5Z A;  2J7I A;  2K6D A;  2OAW A;  3I9Q A;  1BB9 A;  1NJI R;  1VQ7 Q;  3D7S B;  3JCM e;  3ER0 A;  4M77 A;  1UHC A;  3SWN C;  2XDP A;  4MMK A;  2LTO A;  1PM3 A;  1ZHI A;  2YUQ A;  1Q86 R;  3UAT A;  2HBP A;  1PG5 B;  5FU7 B;  2RHU A;  1ABO A;  3CPW A;  1KQ2 A;  4QVC A;  4B9W A;  2M16 A;  3HKS A;  4OB1 B;  2IPO B;  2DXU A;  1AWW A;  1O75 A;  2YSQ A;  1HSQ A;  2RQT A;  3EG2 A;  4NL2 A;  4Y92 A;  4RTZ A;  4ZNX A;  3VUB A;  4PLL A;  2E10 A;  3G71 T;  4JLG A;  1UEB A;  2ESW A;  3REA B;  1SRL A;  1VQ6 T;  1B7T A;  2XMF A;  4M75 E;  4ME7 A;  2JTF A;  5A0D A;  1FMV A;  1WYX A;  1K73 R;  2KEA A;  2VYT A;  2B86 A;  4LNP A;  3CC4 A;  2F5K A;  4C0D C;  1XOV A;  3C12 A;  2GBQ A;  4M77 F;  4B6M A;  4GY5 A;  3PIO A;  2VGM A;  4JLI A;  3OY9 A;  1K1Z A;  4QQG A;  2WSE E;  5DY9 A;  4XTX A;  2EYX A;  1YCY A;  3L42 A;  4C8Q B;  1ZA2 B;  2C06 A;  5GAO m;  3UA6 A;  2W0Z A;  3PE0 A;  5LJ3 h;  3MCA B;  4J9E A;  2KE9 A;  5GAM g;  3PVL A;  5GAO r;  4RKU E;  5KYN A;  2C0O A;  2AHJ B;  3S3N A;  2CP2 A;  3CME A;  2D6F A;  3QZ9 B;  2D1X A;  1ZX6 A;  4D8K A;  1PKS A;  2IIM A;  5GAO p;  5LJ5 f;  4XTU A;  5FU6 B;  2CT3 A;  3CBP A;  3A5Z B;  4JZ4 A;  3EH1 A;  1UHF A;  3N5B B;  3CCU A;  3OYG A;  4R0K A;  3HFN A;  3TSZ A;  1JJ2 P;  3CCR T;  3ULR B;  1IRX A;  1VQ9 T;  4CC7 A;  1YJN Q;  2EFI A;  3SEM A;  4P5N A;  1M1K C;  1YWO A;  2DTO A;  1PSE A;  1YJ9 A;  5CKB A;  4XTY A;  2HL3 A;  4LDW A;  3CCL Q;  2V1R A;  3CCM Q;  3CCV T;  2EBP A;  1YI2 T;  4LD9 K;  1SRM A;  1X2Q A;  1VQK T;  1V1C A;  4ANJ A;  1YCS B;  1D1A A;  3VS2 A;  2DRK A;  3V8L A;  2EWN A;  2GQI A;  4CC4 B;  5KCH A;  2DZC A;  1NPR A;  2DIQ A;  2QA4 A;  5GMK j;  2PZ1 A;  4OB2 B;  5GAN 3;  3VYH B;  2L3S A;  7AT1 B;  1WZO A;  2EJF A;  3OYN A;  2FG0 A;  1F1B B;  3NMZ C;  5IHN A;  2RQU A;  1Q95 G;  4RCC A;  2RNA A;  3HHT B;  3QBY A;  3OYK A;  3L2W A;  5CVI A;  1SPK A;  1EX4 A;  3BFM A;  3CCQ T;  3JCM b;  2KRO A;  2MOX A;  2MCN A;  3QII A;  2OTL A;  2QTV A;  1IZ6 A;  4BY6 C;  2K2M A;  4ESR A;  4BUG A;  2FPF A;  2DL3 A;  4JJD A;  3VS3 A;  2M1H A;  4M75 G;  3EGX A;  5IXB A;  5GAN f;  2E65 A;  2RM4 A;  1MND A;  4PFP A;  1U3O A;  1VQ5 Q;  2ZPI B;  1UB4 A;  4KH0 B;  3SB2 A;  2MMP A;  3FB9 A;  2CZ6 B;  1M90 C;  1YN8 A;  1VQP Q;  1IHV A;  1UTI A;  4BDZ A;  1WHH A;  2QGG A;  4F7U E;  1VQL A;  3QDR B;  3TRE A;  3CMA T;  4IUV A;  1P92 A;  4N0A C;  1YHQ T;  1ZQ1 A;  1KQS A;  1VYU A;  3V7C A;  2FPD A;  4IUQ A;  2KQW A;  4C8Q F;  3OBY A;  5I21 A;  3C4S A;  2XDD A;  3LGL A;  2QDY B;  1KD1 C;  5GAM j;  2MAM A;  8ATC B;  1WI7 A;  2ECZ A;  2DER A;  5HKC A;  2CRE A;  4J9C A;  3I56 A;  2ZAE A;  3QWX X;  4PJL A;  4XU3 A;  2FO0 A;  1KSW A;  3V8K A;  1T3L A;  5GMK h;  3NPF A;  4E2F B;  1YJW Q;  4E6R A;  2AIR B;  4XU1 A;  1JXO A;  2VXE A;  5IHK A;  2X4W A;  4MZM A;  4LUD A;  1IO6 A;  2KSS A;  1NLO C;  2QTX A;  3MPU B;  1VQN T;  3CCE A;  2XHC A;  4E7J A;  2DBM A;  3I55 T;  4HXJ A;  1YWP A;  4M7A E;  3G6E T;  5IHI A;  5HCK A;  1ZSZ C;  2NUP B;  2BE7 D;  5FLX E;  1LPL A;  2BTT A;  5GMK m;  4A4K A;  2CGH A;  3OW2 P;  1H64 1;  3GP8 A;  1VQO A;  2COW A;  1UGS B;  1Q82 U;  5KYW B;  1C1A A;  1YFN A;  1Q7Y C;  3WVD B;  4NL3 A;  3CPW S;  5D6W A;  4E47 A;  2RQR A;  2DF6 A;  4L5G A;  4O5V A;  2VAS A;  2QEX T;  4JRP A;  2RQV A;  1TSF A;  2GTJ A;  1YIJ A;  2F2W A;  1W6X A;  4J8O A;  3MKD A;  3OYF A;  1WGS A;  1UG1 A;  3ME9 A;  3CCS T;  2CP3 A;  4WF2 A;  5KYU B;  4V2S A;  2MK5 A;  2ZGW A;  3MJX A;  4MML A;  1BI3 A;  3P8D A;  4M75 D;  2LZ6 B;  3M9Q A;  1H3Z A;  4BI3 A;  3F70 A;  1AD5 A;  1RLP C;  4J83 A;  3GBQ A;  3VKI A;  5KE2 A;  2E5K A;  3QPH A;  4Z88 A;  5GAM h;  3FRN A;  1W2B A;  3UF4 A;  3KXT A;  2A0F B;  3A8G B;  3CCJ T;  3RKX A;  5A0G A;  5CKF A;  1TWB A;  1JBM A;  1VIF A;  4DEY A;  2QDL A;  4F7U G;  3JCM d;  4M77 E;  4PFO A;  1WJR A;  2K9G A;  2L5Q A;  2XD0 A;  5I2M A;  4JS4 A;  4BE0 A;  1QQJ A;  4X9D A;  2EQK A;  1TXQ A;  3ASK A;  2XK0 A;  3M0P A;  2M9U A;  3SD4 A;  2O2O A;  5J39 A;  2LMJ A;  5KYW A;  3MEV A;  1IRE B;  2FZG B;  2LQW A;  3C95 A;  1UGR B;  2KRM A;  1PD1 A;  2ZZD A;  2ENM A;  2VGN A;  1GBR A;  1ZUK A;  3BE3 A;  2XDB A;  4FM4 B;  4BI4 A;  2DEU A;  3G71 Q;  4A63 B;  2CYZ B;  4OMF B;  3J81 E;  1VQ6 Q;  1BK2 A;  2E64 A;  1G3W A;  2LX7 A;  4ORZ A;  2EYZ A;  3EGU A;  5D7U A;  2RJC A;  1CKB A;  4M75 C;  3J7A F;  2E70 A;  4EMK B;  1MUZ A;  6AT1 B;  4M7A G;  2A37 A;  4PNO A;  1XTD A;  2O9V A;  1UUE A;  4PJO B;  2J6F A;  4RTY A;  2HQH A;  3IQL A;  4HCB A;  1RAC B;  1RLQ C;  4HCC A;  2KVQ G;  3J80 E;  3CXC S;  2EIF A;  3A98 A;  1LNX A;  2RJF A;  2KAF A;  2R5A A;  4OMP A;  1VYV A;  1OQK A;  3WVE B;  3OYY A;  2LQN A;  2EPD A;  4M78 B;  1RAD B;  1X6G A;  1G3S A;  2CP5 A;  1WHG A;  2EGE A;  2XKO C;  1A0N B;  2QQ9 A;  1NYG A;  2CDT A;  2D8J A;  4OGE A;  4RG8 A;  3OBW A;  4A4G A;  2DEQ A;  1AZE A;  4KRT A;  2F2V A;  5I22 A;  1VQ4 Q;  3L1A A;  3A8O B;  2PVG B;  1KHC A;  3CCR Q;  1VQ9 Q;  1PKT A;  4QVD A;  1YIT A;  2O01 E;  4RUG A;  1IGU A;  3GF5 A;  1X6B A;  3RIR A;  3CCV Q;  3UWN A;  1YI2 Q;  4M7D B;  3OYH A;  1VQK Q;  1NEG A;  1UGV A;  4N4H A;  4ZTJ A;  1M1K U;  2JS0 A;  1WXB A;  4HVU A;  4DBR A;  1X27 A;  3JCM c;  2Y4X A;  1BCO A;  4ZGD B;  4BB7 A;  1KQS S;  2DA9 A;  4FYX B;  1Q82 R;  4LXC A;  2D8H A;  2K4Y A;  3RNJ A;  2F2X A;  4M77 G;  2K7A A;  3CC4 T;  2ROT A;  3CD6 A;  1B34 A;  3DB4 A;  3OYB A;  1EIF A;  1N9R A;  4C5E A;  4EIK A;  4DBQ A;  2H3E B;  4VUB A;  4C8Q E;  1QCN A;  4QKU A;  4DOW A;  3CCQ Q;  2EJ9 A;  2DL7 A;  3EHR A;  2HZY A;  1HXD A;  3O5Z A;  3JSC A;  1TUC A;  3CME T;  3JCM g;  5CK9 A;  2ED0 A;  4XU2 A;  5GMK i;  2EW3 A;  1WHK A;  4M7A D;  1PRM C;  2CKK A;  2QG9 B;  1S1N A;  2DXT A;  3GNF B;  3H0I A;  4B9X A;  2EQU A;  2RJE A;  2DM1 A;  1M5Q 1;  5FW9 A;  5LJ3 f;  3H41 A;  4AMC A;  4PL6 A;  5KH6 A;  3EFO B;  4HA8 A;  3CMA Q;  2VKN A;  4M7D A;  4AFU C;  2LCC A;  2C0T A;  1M90 U;  1YHQ Q;  5CCA A;  2M02 A;  4PJO F;  1PSF A;  3KFV A;  3GNG A;  1G5V A;  1K8A C;  5LJ5 e;  3QSU A;  3MP1 A;  5DLQ E;  2DIL A;  1GFD A;  3P8H A;  2ROL A;  4PJJ A;  1U1S A;  2OTJ A;  1M2O A;  1AEY A;  4C0Z A;  4RTX A;  1NYF A;  2JMA A;  2QA4 T;  4M78 F;  1R0B G;  1PD0 A;  1KD1 U;  2ZPF B;  3RMQ A;  1WX6 A;  2DX1 A;  3VRZ A;  4J9H A;  3M53 A;  3RDV A;  4AFZ C;  5C6S A;  2Z0W A;  2EYQ A;  1VQN Q;  1W2B S;  2V1Q A;  1AZG B;  3I55 Q;  2E1H A;  5KYX A;  3G6E Q;  1OU9 A;  4IUP A;  2AT1 B;  2PTK A;  2OTL T;  3VV0 A;  1NPP A;  1OYX A;  4M77 D;  2E41 A;  1JU5 C;  4M7A C;  5AT1 B;  2DMO A;  2KNB B;  3E19 A;  3E9F A;  4ZN1 A;  1JJ2 A;  5GAO l;  5J26 A;  2KT8 A;  3EFO A;  3GPL A;  1QP2 A;  2QGF B;  3FIF A;  3QHS A;  4XK8 E;  4DA4 A;  4XTZ A;  3QYH B;  3EGD B;  4ZGE B;  4X34 A;  2QEX Q;  1M1F A;  1PHT A;  1Q7Y U;  4HT9 A;  2CH4 A;  1VQL T;  3NGP A;  2YXY A;  4C8Q G;  2KGT A;  3DKM A;  3CCS Q;  3X28 B;  4IUR A;  3PMI A;  3CEY A;  3L2Z A;  2CZ7 B;  2E5Q A;  4MDX A;  3T9N A;  1GCQ A;  2GCX A;  4N0A A;  1N27 A;  5GAN e;  2RHX A;  2ZPH B;  3JAM E;  3V7R A;  4KGV B;  4GLK A;  2EAY A;  4FL6 A;  3I56 T;  3EGX B;  1WA7 A;  1S72 T;  1SG5 A;  1ZUY A;  1ZUU A;  2BUD A;  2BZY A;  3ZEH A;  1E6H A;  2EQM A;  1VQ4 T;  1M1K R;  3CCJ Q;  1BI2 A;  4C5H A;  4JRQ A;  3UA7 A;  4EDU A;  4NOY A;  3FLG A;  3DB3 A;  3OYC A;  4KUD K;  4LD6 A;  2DYI A;  5GJV B;  3CCE T;  2LJ3 A;  4EPC A;  1OX9 A;  3HTR A;  2CSI A;  3TU4 K;  3X20 B;  4M77 C;  2L3R A;  3G4S A;  2FYK A;  3JB9 G;  1NM7 A;  1OEB A;  4XTW A;  2WAC A;  2LNH B;  3OS5 A;  1JQQ A;  2KI7 A;  1VQM A;  1ZSZ A;  4RMO A;  1EFN A;  3P8B B;  3CXC A;  4PFZ A;  2JOY A;  1I5L A;  2K5L A;  1VQO T;  3EGD A;  2XID A;  1MMN A;  2LDM A;  4E7K A;  1M2V A;  2ATC B;  2PVO B;  4J9D A;  1N8R U;  3QWY A;  3L2R A;  2NLU A;  1GFC A;  1ARK A;  1I07 A;  3JV3 A;  1HJD A;  4UC4 A;  1K9A A;  1RAB B;  2P0Q A;  2V8I A;  3M0Q A;  1YIJ T;  5GJW B;  5M9O A;  1W4S A;  1BI0 A;  4RTV A;  2R5M A;  4C92 B;  3CC7 A;  3FC3 A;  3KBG A;  2KY9 A;  2NWM A;  3CC2 Q;  1U06 A;  1KC8 C;  4J9G A;  3MEU A;  3E1S A;  2GFU A;  1M90 R;  2A3L A;  2G3R A;  2DL5 A;  4E7H A;  5KE3 A;  2L89 A;  5L23 A;  4C0G A;  2VWF A;  4JS5 A;  3X24 B;  1D09 B;  1NE8 A;  1SF9 A;  1X01 A;  3QZ5 B;  3V8J A;  1FYN A;  3JCM h;  4C8Q D;  1U5S A;  2ABL A;  2YT6 A;  4MDW A;  3MHX A;  3O8V A;  2ZPE B;  2PVD B;  8AT1 B;  3FJ5 A;  1HD3 A;  1ABQ A;  1KD1 R;  1IXD A;  3JB9 J;  1M4Z A;  5LL6 S;  1OI1 A;  4QQ6 A;  4GBQ A;  4BE2 A;  5GAN 7;  3HRT A;  3OW2 A;  5GAM f;  2RPN A;  2VXF A;  1TS9 A;  4KH1 B;  1AWX A;  3M0S A;  5ECA A;  5FU7 C;  4OMN A;  1AWO A;  3OA6 A;  1B07 A;  4FSS A;  5FRO A;  3PVQ A;  2KR3 A;  2O4X A;  3QO3 A;  2VVK A;  2BZ8 A;  3VS7 A;  4C92 A;  2Y90 A;  3R6N A;  2A36 A;  4DEX A;  1SHF A;  2DJQ A;  1BKB A;  5GMK l;  2O88 A;  3CC4 Q;  3EG9 A;  2GQV A;  2MWP A;  1E7O A;  2RMO A;  2NUT A;  2E12 A;  4JRK A;  3EFS A;  3OB9 A;  2RO0 A;  3A8H B;  4N4I A;  1Q7Y R;  1K0X A;  3JB9 F;  1YI2 A;  1FMW A;  4PJO E;  1BYM A;  2DD5 A;  5D6X A;  4M75 A;  1KIK A;  4RTT A;  4F04 B;  1M30 A;  3VUZ A;  1VIE A;  3QKJ A;  1ZBJ A;  5EC7 A;  2P4T A;  1QP3 A;  2WSF E;  2JS2 A;  4C8Q C;  3CME Q;  4M78 E;  3I35 A;  3X25 B;  1UEC A;  4FYY B;  1OV3 A;  2QAZ A;  3G7Z A;  1N6A A;  1NZ9 A;  4XQ3 A;  1VQ8 A;  4JRI A;  1KHI A;  4LE9 A;  2A08 A;  4PJM A;  1PWT A;  4E7L A;  3EG3 A;  1D1B A;  1QVF P;  1QWE A;  4R55 A;  2RHZ A;  2YRD A;  4XTV A;  3CCU Q;  5FU6 C;  2X9H A;  2DL8 A;  2DVE A;  1UJ0 A;  2RJD A;  3OYJ A;  2LJ1 A;  1JJ2 S;  1YIT T;  2EVR A;  1OZ2 A;  1RAG B;  2QQA A;  2CUD A;  5L8R E;  4ELZ C;  1PC0 A;  2K3X A;  4M7D E;  3L2U A;  5KCO A;  3AHU A;  2KK4 A;  2LC4 A;  1QVG P;  3M56 A;  2YWW A;  2EQI A;  4FYW B;  4YTL A;  5GAN 5;  5LJ5 d;  5FWB A;  2QA4 Q;  2BIV A;  1IHW A;  1K8A U;  2W10 A;  1JXM A;  3ZBD A;  5A2Q E;  3E9G A;  1N8R R;  1Z9Q A;  3SWN B;  1SSF A;  3REB B;  3CD6 T;  5IT9 E;  2RN8 A;  1VQ7 A;  1N8R C;  3H8Z A;  2QYZ A;  1X43 A;  2D9T A;  1TTH B;  1IB8 A;  1M3A A;  2YLB A;  2LRQ A;  2RI5 A;  2PNI A;  2XU8 A;  2YLC A;  1Y96 A;  1RAE B;  2CP0 A;  1YNZ A;  3RMS A;  5CKH A;  3LW5 E;  4IUU A;  1T0H A;  4A4F A;  2VV5 A;  5FRN A;  2OTL Q;  1UJY A;  1SSH A;  2ZPB B;  2K3B A;  1M3B A;  2KT1 A;  3EHQ A;  4PK4 A;  1Q81 C;  2H8H A;  2P0P A;  3KUF A;  5D6Y A;  1QWF A;  2DPP B;  2Y4Y A;  3CC2 T;  3C94 A;  2EYY A;  1LVK A;  4QVZ A;  3I5R A;  1NLP C;  1TUD A;  1Y7X A;  5CIU A;  1B34 B;  2COZ A;  2HEQ A;  3THK A;  4BAC A;  4PJO G;  4C0D B;  1RUW A;  1VQL Q;  1WDX A;  3INZ A;  2LQK A;  4AFS C;  4OB3 B;  2DJZ A;  5I2S A;  1SEM A;  2DTH A;  2JTM A;  5DM7 R;  4KT0 E;  1XJW B;  1AHJ B;  4PLI A;  4M78 G;  2ZCF B;  2OTJ T;  1WFW A;  1AWJ A;  3SWN A;  3I56 Q;  2DIG A;  2JN0 A;  5GAN d;  1S72 Q;  4X1V A;  5LJ3 e;  3OYE A;  2C0I A;  5KYY A;  5DLO A;  2HBW A;  4HVV A;  2KDS A;  3M54 A;  4HCK A;  5I11 A;  4TVR A;  2SRC A;  2CP6 A;  3OMC A;  5IN1 A;  4ZN3 A;  2FB7 A;  1I8F A;  3HRU A;  1JEG A;  2YRC A;  3UPU A;  3A8L B;  2PU9 B;  2L2P A;  4BE1 A;  1WQ7 A;  1XQH A;  4FW2 A;  3CCE Q;  3RES A;  1O9S A;  4JJB A;  1Z9Z A;  4M7D G;  5GAO q;  3EAE A;  1YP5 A;  1WQW A;  4HVW A;  2K79 A;  4Y91 A;  4D8D A;  2LVM A;  2H3J A;  4DQ2 A;  4OB0 B;  1YJN A;  1MGQ A;  2JM8 A;  3DLM A;  2HL5 C;  1K9M C;  5CAI A;  2FRW A;  2HQE A;  1VQO Q;  3OW2 S;  2RI3 A;  2KBT A;  4FCY A;  1D1C A;  3CCL A;  4M7A A;  3M55 A;  2A28 A;  3CCM A;  4IUT A;  1X69 A;  3A1P A;  3GLX A;  3NFC A;  2K2V A;  3FDR A;  4IKF A;  3QUI A;  2QAS A;  1WLP B;  1YIJ Q;  2E3I A;  2HD0 A;  5IAY A;  1FXX A;  2KXC A;  2DYB A;  2QK0 A;  4FSX A;  1C0M A;  1JB0 E;  2MPX C;  2EJG A;  5KYX B;  2JM9 A;  1RL2 A;  2YUO A;  4HT8 A;  2B8A A;  3LYI A;  2QXF A;  1G2B A;  2K3Y A;  1VOM A;  3JRZ A;  3RBB B;  2DFU A;  1W70 A;  1KC8 U;  2L8D A;  3CCU T;  1BIB A;  2OJ2 A;  4BY6 B;  4KUL A;  2YUN A;  4PJO D;  2DLP A;  4L59 A;  1M8M A;  2RF0 A;  1LOJ A;  2MF2 A;  2J05 A;  4EMG A;  2M51 A;  1VYT A;  3CBO A;  2L3Q A;  4FT4 A;  2F5T X;  3JB9 H;  3VU3 C;  1K8A R;  1CSK A;  3EFR A;  1PRL C;  1Y07 A;  1YJ9 T;  2LQ8 A;  1QCO A;  5CKD A;  2VB6 A;  4F14 A;  4FU6 A;  3WXM B;  1C6V X;  1SHG A;  1I1J A;  1TG0 A;  4M78 D;  2RB6 A;  2P0K A;  3UDC A;  1VQ5 A;  2DO3 A;  2DET A;  4PKC C;  3L2Q A;  3EG0 A;  3BDL A;  3G4S T;  1MV3 A;  3OSV A;  1VQP A;  3AT1 B;  3QYG B;  2CH4 W;  2EQJ A;  2MI6 A;  2OX7 A;  1RAA B;  1VQM T;  1AOJ A;  4Z8A A;  3PIP A;  4OMO A;  2MWO A;  2JXB A;  1X2K A;  1NJI C;  4JPB W;  2DBK A;  4Q5W A;  5IH2 A;  2LX9 A;  4A4E A;  4J9B A;  1D0Y A;  3JCM V;  2AK5 A;  3QDF A;  3MP8 A;  4WTO B;  2X51 A;  1GBQ A;  2YHT A;  1I4K 1;  1TOV A;  4M7D D;  2X4Y A;  2J6O A;  1Q86 C;  3A8M B;  3LGF A;  4DBF A;  4J7F A;  4C92 E;  3S6W A;  3CC7 T;  4CI0 C;  3M58 A;  2O9S A;  5GMK e;  1H3H A;  4M7D F; 
#chains in the Genus database with same CATH homology
 2GFU A;  1YJW A;  1M8V A;  3VKI A;  5KE2 A;  2A7Y A;  4N4G A;  2RH2 A;  2A3L A;  3QPH A;  2G3R A;  5GAM h;  3CCJ A;  3FRN A;  1YJW T;  4E7H A;  1W2B A;  5GAM d;  5GAN g;  5KE3 A;  2L89 A;  2JNG A;  4XU0 A;  4C0G A;  3KXT A;  3LLR A;  3A8G B;  4JS5 A;  5HY6 A;  3X24 B;  4EMK C;  5GAN 4;  3CCJ T;  1YBY A;  3ZFJ A;  3RKX A;  1NE8 A;  1M9S A;  5A0G A;  1X01 A;  3QZ5 B;  3V8J A;  4OP0 A;  4PJO C;  5CKF A;  3RUX A;  1I81 A;  2FL7 A;  3M5A A;  4M77 B;  1JBM A;  1VIF A;  3JCM h;  4C8Q D;  5GAN 6;  4F7U G;  3JCM d;  4MDW A;  4M77 E;  4F7U F;  2BKD N;  2DXB A;  2PQW A;  3MHX A;  3O8V A;  5J3B A;  1WJR A;  2ZPE B;  2GF7 A;  3LWI A;  4EMK A;  2PVD B;  4NS5 A;  4LDU A;  1FWZ A;  2L5Q A;  2LT1 A;  2XD0 A;  5I2M A;  1K73 C;  4ZGJ B;  3HSB A;  3JB9 J;  4JS4 A;  4BE0 A;  1M4Z A;  4PJO A;  2F69 A;  4X9D A;  5LL6 S;  4ZTF A;  1Q82 C;  1OI1 A;  1QVP A;  1VUB A;  2EQK A;  2KMT A;  4J6X A;  4J6W A;  2PUO B;  4M78 C;  4MZT A;  4QQ6 A;  5GAN 7;  5HK3 A;  4BE2 A;  3Q1J A;  3ASK A;  3HRT A;  5GAO n;  1LJO A;  2XK0 A;  3OW2 A;  2M9U A;  5GAM f;  3SD4 A;  3TCJ A;  3JCM W;  4RCB A;  5J39 A;  2VXF A;  4HKE A;  4LDV A;  2OAU A;  3MEV A;  1IRE B;  5LJ5 g;  3C95 A;  3NTH A;  4J6Y A;  1UGR B;  1QVF S;  5FU7 C;  4BI8 B;  2ZZD A;  4M78 A;  2VGN A;  2DTI A;  3VYG A;  4DOV A;  3OA6 A;  2XDB A;  4FM4 B;  2V8J A;  2VUB A;  3JCM f;  4BI4 A;  2QI2 A;  5LJ5 j;  2LT4 A;  3S3M A;  5FRO A;  2CYZ B;  4OMF B;  4A53 A;  3J81 E;  3OYA A;  2O4X A;  4JDS A;  4C5G A;  3QO3 A;  3SFM A;  2E64 A;  1G3W A;  3M59 A;  3NTI A;  3PMT A;  4C92 A;  2Y90 A;  3VJP A;  3RER A;  4QW2 A;  3RKW A;  3CC2 A;  3X26 B;  1MHN A;  2RJC A;  4LDY A;  3OYI A;  3LWH A;  5FRM A;  1WPY A;  5CQX A;  4M7D C;  1TH7 A;  1BKB A;  5GMK l;  4M75 C;  3J7A F;  2E70 A;  3QJY A;  2VC8 A;  4EMK B;  4M7A G;  3OYD A;  1WJQ A;  4M7A F;  4PNO A;  1XTD A;  1QVG S;  2GQV A;  2DD4 A;  2MWP A;  3PNW C;  5GAM e;  5LJ3 j;  1G3T A;  2E12 A;  2R57 A;  4PJO B;  4JRK A;  1G3Y A;  3EFS A;  3OB9 A;  2RO0 A;  3A8H B;  4N4I A;  4HCB A;  3JB9 F;  1YI2 A;  4HCC A;  4PJO E;  2KVQ G;  4Y28 E;  3J80 E;  1BYM A;  3OYM A;  2DD5 A;  5D6X A;  1BI1 A;  3CXC S;  4M75 A;  2EIF A;  1LNX A;  2RJF A;  4II1 A;  2KAF A;  2R5A A;  1KG1 A;  4OVA A;  3JCM e;  3ER0 A;  4M77 A;  3WVE B;  3OYY A;  3VUZ A;  1VIE A;  3QKJ A;  2P4T A;  4M7A A;  3SWN C;  2XDP A;  4M78 B;  3LH0 A;  2HAX A;  1G3S A;  1QP3 A;  2WSF E;  4C8Q C;  4MMK A;  2LTO A;  1ZHI A;  3M57 A;  2JVV A;  2XKO C;  4M78 E;  3X25 B;  3JCM J;  2QQ9 A;  3G7Z A;  1N6A A;  1NZ9 A;  4XQ3 A;  2O4X B;  2HBP A;  1VQ8 A;  4OGE A;  4RG8 A;  5FU7 B;  4JRI A;  3OBW A;  1KHI A;  1RI0 A;  4A4G A;  2RHU A;  2DEQ A;  4C8Q A;  3CPW A;  4E7L A;  1VQ8 T;  3OS2 A;  3FJP A;  1KQ2 A;  4QVC A;  4R55 A;  2RHZ A;  4XTV A;  3QXE B;  3L1A A;  2M16 A;  4B9W A;  4O6J A;  3A8O B;  2PVG B;  1KHC A;  5FU6 C;  4C92 G;  2RI2 A;  3HKS A;  4OB1 B;  1Q81 U;  1M1G A;  4QVD A;  1YIT A;  2DXU A;  2DVE A;  2O01 E;  1XNI A;  1O75 A;  2RJD A;  3GF5 A;  3OYJ A;  4ELY C;  3G71 A;  1JJ2 S;  2PUK B;  4NL2 A;  1YIT T;  3RIR A;  3TEE A;  1VQ6 A;  3UWN A;  3PTA A;  2CS7 A;  4M7D B;  3VUB A;  4PLL A;  1OZ2 A;  3OYH A;  2E10 A;  2QQA A;  4N4H A;  4M75 B;  5L8R E;  3G71 T;  4JLG A;  4ZTJ A;  4ELZ C;  3M4G A;  1UEB A;  3HL8 A;  1VQ6 T;  1M1K U;  1WJS A;  2K3X A;  4M7D E;  3L2U A;  5KCO A;  3AHU A;  2KK4 A;  4M75 E;  4ME7 A;  2JTF A;  5GAN j;  5A0D A;  2E6N A;  3JCM c;  2HQX A;  2Y4X A;  2XI9 A;  2VYT A;  2LC4 A;  4ZGD B;  4BB7 A;  2CZ0 B;  1KQS S;  3M56 A;  2RK1 A;  4HCZ A;  5LJ5 h;  3CC4 A;  2F5K A;  5CO7 A;  2K4Y A;  4YTL A;  5GAN 5;  4C0D C;  1XOV A;  3C12 A;  4M77 G;  4KUI A;  3L2V A;  2RHY A;  5LJ5 d;  4M77 F;  2BIV A;  1K8A U;  4GY5 A;  3PIO A;  3CC4 T;  3CD6 A;  3ZBD A;  2VGM A;  4JLI A;  5A2Q E;  3OY9 A;  3E9G A;  4MZP A;  1B34 A;  4QQG A;  4CRI A;  3DLL A;  2WSE E;  5DY9 A;  4XTX A;  3DB4 A;  3SWN B;  1SSF A;  1YCY A;  3CPF A;  3L42 A;  3CD6 T;  3OYB A;  5IT9 E;  4C8Q B;  1EIF A;  2C06 A;  1N9R A;  5GAO m;  1VQ7 A;  4C5E A;  1N8R C;  3H8Z A;  3MO8 A;  3JCM P;  2ZPG B;  4VUB A;  2D9T A;  3MCA B;  5LJ3 h;  4C8Q E;  5GAM g;  3UT1 A;  5GAO r;  4ATO A;  4RKU E;  2YLB A;  1VQ7 T;  2LRQ A;  4OGC A;  5LJ3 d;  2RI5 A;  4R56 A;  2XU8 A;  2YLC A;  1Y96 A;  2DK3 A;  4DOW A;  2AHJ B;  2DZ9 A;  3S3N A;  2EJ9 A;  3RMS A;  3CME A;  2D6F A;  5CKH A;  2X4J A;  3QZ9 B;  3LW5 E;  1HXD A;  1Y71 A;  4IUU A;  3JSC A;  4JUV A;  4X9C A;  3CME T;  4C5I A;  5GAO p;  1U8R A;  4A4F A;  5LJ5 f;  3PT9 A;  2VV5 A;  4XTU A;  5FU6 B;  5FRN A;  4BDY A;  3CBP A;  3A5Z B;  3JCM g;  2ZPB B;  1UGQ B;  5CK9 A;  4XU2 A;  3V7S A;  5GMK i;  1S72 A;  3N5B B;  4M7A D;  2CKK A;  4EMH A;  2D0Q B;  1Q81 C;  1VQ4 A;  2P0P A;  3KUF A;  4RG2 A;  3CCU A;  5D6Y A;  3OYG A;  2DXT A;  2DPP B;  3CCR A;  1QVF A;  1VQ9 A;  3GNF B;  4B9X A;  2EQU A;  2JUF A;  2RJE A;  2Y4Y A;  1OZ3 A;  3JB9 D;  3HFN A;  3C94 A;  3HRS A;  3CC2 T;  4QVZ A;  1M5Q 1;  3CCR T;  2QQR A;  2R58 A;  1VQ9 T;  1Y7X A;  3FEO A;  4L6V 5;  5LJ3 f;  4PL6 A;  2EFI A;  5CIU A;  4QQD A;  4P5N A;  1B34 B;  5KH6 A;  3CCV A;  1M1K C;  4HA8 A;  2K5I A;  2DTO A;  1VQK A;  1PSE A;  1YJ9 A;  4M7D A;  5CKB A;  4BAC A;  2LCC A;  3PFS A;  4LDW A;  4XTY A;  1K9M U;  1M90 U;  4PJO G;  3CCV T;  4C0D B;  5CCA A;  4PJO F;  1YI2 T;  1PSF A;  4LD9 K;  1VQK T;  3INZ A;  2IVW A;  3GNG A;  1G5V A;  3V8L A;  1X6O A;  2LQK A;  4E7I A;  1K8A C;  5LJ5 e;  2EWN A;  3QSU A;  4OB3 B;  1Y96 B;  3MP1 A;  3HFO A;  2DJZ A;  5I2S A;  2DZC A;  5DLQ E;  5KCH A;  1D3B B;  1QVG A;  1NPR A;  2DIQ A;  3P8H A;  2DTH A;  2LNV A;  3BDU A;  3OS0 A;  1U1S A;  2QA4 A;  2JTM A;  5DM7 R;  2OTJ A;  4BD3 A;  4KT0 E;  5GMK j;  4OB2 B;  1AHJ B;  5GAN 3;  1X75 C;  3QG1 A;  4PLI A;  1N9S A;  3HPW A;  4C0Z A;  4M78 G;  2QA4 T;  3VYH B;  2ZCF B;  4M78 F;  3M4Y A;  4XAX B;  2OTJ T;  4FIB A;  5GAN h;  4LDX A;  1GXI E;  3SWN A;  1KQ1 A;  2EJF A;  3OYN A;  1H3Z A;  2DIG A;  4C92 D;  1KD1 U;  2JN0 A;  2ZPF B;  3RMQ A;  5GAN d;  2RHI A;  2V8K A;  5LJ3 e;  3OYE A;  5DLO A;  3M53 A;  4RCC A;  4A54 A;  3HHT B;  3QBY A;  3CBM A;  4C92 F;  1JRI A;  2KDS A;  3M54 A;  4JJN K;  3QJ6 A;  3OYK A;  3CCQ A;  5C6S A;  3L2W A;  2X35 A;  5CVI A;  2K5F A;  4TVR A;  3OMC A;  2EYQ A;  5IN1 A;  4ZN3 A;  1W2B S;  2FB7 A;  1I8F A;  3BFM A;  3CCQ T;  3HRU A;  3JCM b;  2X4X A;  3UPU A;  2WSC E;  3A8L B;  2PU9 B;  4BE1 A;  1WQ7 A;  3QII A;  1XQH A;  2E1H A;  2OTL A;  3RES A;  1IZ6 A;  2RD1 A;  4A4H A;  4IUP A;  1O9S A;  4BY6 C;  2HNI A;  4BUG A;  2OTL T;  3VV0 A;  1DJ7 B;  1NPP A;  1OYX A;  4M77 D;  4M7D G;  5CKE A;  2M1H A;  1FX7 A;  2E41 A;  2I2L A;  4M75 G;  3EAE A;  5GAN f;  5GAO q;  4M75 F;  4FT2 A;  4M7A C;  2QQB A;  1WQW A;  4KBM B;  4Y91 A;  2E65 A;  2RM4 A;  2LVM A;  2H3J A;  4DQ2 A;  2E6Z A;  4OB0 B;  2ZPI B;  1UB4 A;  3H6Z A;  1BIA A;  3E19 A;  3OSS C;  1MGQ A;  3E9F A;  2MMP A;  3SB2 A;  4ZN1 A;  1YJN A;  1JJ2 A;  3DLM A;  3FB9 A;  5GAO l;  5J26 A;  2CZ6 B;  1K9M C;  1M90 C;  5CAI A;  2HQE A;  4F7U B;  3GPL A;  1QP2 A;  3OW2 S;  3CMA A;  1YJN T;  2RI3 A;  4BDZ A;  3FIF A;  2FVU A;  3QHS A;  5A0L A;  4XK8 E;  3CCL A;  4DA4 A;  4XTZ A;  3M55 A;  3QYH B;  4ZGE B;  3CCM A;  4X34 A;  3OS1 A;  1YHQ A;  4F7U E;  4IUT A;  3QDR B;  3TRE A;  1VQL A;  1M1F A;  3CMA T;  4IUV A;  3GLX A;  1P92 A;  2K2V A;  3NFC A;  3CCL T;  1Q7Y U;  4N0A C;  3CCM T;  4HT9 A;  1YHQ T;  1ZQ1 A;  3FDR A;  1KQS A;  1VQL T;  3R6O A;  4IKF A;  3QUI A;  3JCM Q;  2K57 A;  3HP9 A;  3V7C A;  3S3O A;  5HK0 A;  4C8Q G;  4IUQ A;  1NJI U;  2KQW A;  4C8Q F;  3DKM A;  3OBY A;  2HD0 A;  3X28 B;  5IAY A;  1FXX A;  1D3B A;  3PMI A;  4IUR A;  3CEY A;  5I21 A;  3L2Z A;  1U1T A;  2CZ7 B;  2E5Q A;  3C4S A;  4FSX A;  4MDX A;  3T9N A;  1JB0 E;  2XDD A;  3LGL A;  2GCX A;  2QDY B;  2EJG A;  2MAM A;  2CZ1 B;  5GAM j;  1KD1 C;  4N0A A;  3OYL A;  5CQY A;  1N27 A;  5GAN e;  5HKC A;  2RHX A;  3SDZ A;  2ZPH B;  3NTK A;  3JAM E;  1RL2 A;  2YRV A;  3I56 A;  3V7R A;  4HT8 A;  2B8A A;  3LYI A;  2QXF A;  2LCL A;  2JZ2 A;  2K3Y A;  4GLK A;  2EAY A;  4Z02 A;  1Q86 U;  4XU3 A;  4FL6 A;  3I56 T;  5GAN 8;  3JRZ A;  3V8K A;  3GOX A;  4C92 C;  5GMK h;  1S72 T;  2DAQ A;  2BUD A;  2DXC A;  3ZEH A;  2IG0 A;  2EQM A;  1VQ4 T;  3LX7 A;  3JB9 I;  1KC8 U;  2L8D A;  4XU1 A;  3MET A;  1BIB A;  3CCU T;  2VXE A;  1BI2 A;  2X4W A;  4BY6 B;  4KUL A;  4MZM A;  4C5H A;  1VQN A;  5EG2 A;  4JRQ A;  4PJO D;  2KSS A;  4L59 A;  3URG A;  1LOJ A;  2MF2 A;  2QTX A;  2QQS A;  4EDU A;  3CBO A;  3FLG A;  4NOY A;  4EMG A;  3I55 A;  4FT4 A;  3CCE A;  1VQN T;  2XHC A;  2F5T X;  4M7A B;  5LJ3 g;  3DB3 A;  3JCM X;  3G6E A;  3VU3 C;  3OYC A;  4E7J A;  4KUD K;  3JB9 H;  4LD6 A;  4C0F A;  3BY7 A;  3PGG A;  3I55 T;  3EFR A;  3CCE T;  1WNL A;  1YJ9 T;  1Y07 A;  1ZBX A;  4J7I A;  3G6E T;  2M0O A;  2LQ8 A;  3OMG A;  4M7A E;  5CKD A;  4EPC A;  4FU6 A;  3WXM B;  3TU4 K;  5FLX E;  4M78 D;  2RB6 A;  2L3R A;  2P0K A;  4M77 C;  3UDC A;  3X20 B;  3G4S A;  1VQ5 A;  2FYK A;  2DO3 A;  5GMK m;  4PKC C;  3L2Q A;  4A4K A;  3BDL A;  3JB9 G;  5CR2 A;  1HK9 A;  2CGH A;  4XTW A;  2WAC A;  1K73 U;  3G4S T;  3MP6 A;  3OSV A;  1H64 1;  1VQ5 T;  1VQP A;  3GP8 A;  3OS5 A;  1VQO A;  3QYG B;  1UGS B;  2EQJ A;  2FHD A;  2DKG A;  1VQM A;  4F7U A;  4RMO A;  3P8B B;  1Q82 U;  3CXC A;  2JOY A;  2MI6 A;  1Q7Y C;  3WVD B;  1I5L A;  4NL3 A;  1VQP T;  2K5L A;  3CPW S;  1V29 B;  5D6W A;  2XG8 D;  4E47 A;  2QEX A;  1VQO T;  1VQM T;  2XID A;  4E7K A;  2LDM A;  4L5G A;  3PIP A;  2MWO A;  1NJI C;  2PVO B;  2RA2 A;  4O5V A;  3OQ5 A;  4Q5W A;  1N8R U;  1R8O B;  2LX9 A;  4A4E A;  3L2R A;  2QEX T;  4JRP A;  4J5Y A;  2NLU A;  3JCM V;  2EKO A;  1YIJ A;  3CCS A;  4J8O A;  4OF1 A;  3MP8 A;  4D6W A;  4UC4 A;  3OYF A;  2RK2 A;  1WGS A;  2P0Q A;  2V8I A;  3RKY A;  3ME9 A;  2YHT A;  1YIJ T;  5M9O A;  1W4S A;  1BI0 A;  1I4K 1;  3CCS T;  2R5M A;  4C92 B;  3CC7 A;  5GAN 2;  3MEA A;  4WF2 A;  4V2S A;  2ZGW A;  5C0M A;  3BW1 A;  4M7D D;  2X4Y A;  4MML A;  1BI3 A;  3A8M B;  3P8D A;  1Q86 C;  3FC3 A;  4M75 D;  3GIB A;  3LGF A;  3KBG A;  2KY9 A;  3M9Q A;  4J7F A;  5AYF A;  3F70 A;  3S6W A;  4BI3 A;  4C92 E;  4CI0 C;  1QW1 A;  2GFA A;  3M58 A;  3CC7 T;  3MEW A;  1UGP B;  2XIC A;  1KC8 C;  5GMK e;  4M7D F;  4J83 A;  3MEU A;  3E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...