3LW5E

Improved model of plant photosystem i
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
64
structure length
64
Chain Sequence
IGPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 1
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lw5E00
4L6V5 2PU9B 2WSEE 4RKUE 2CZ0B 3WVDB 2ZPFB 2DXBA 2PUOB 3QYHB 2CZ1B 3WVEB 5L8RE 2DD4A 2D0QB 2AHJB 1IREB 2ZPBB 1UGSB 1UGRB 2CZ7B 3X28B 2WSFE 3LW5E 2DD5A 3QXEB 1V29B 2ZCFB 2PVGB 1AHJB 4OB0B 4ZGDB 3VYGA 3A8HB 3X24B 3HHTB 2ZPIB 3X25B 1UGPB 2CYZB 1GXIE 2CZ6B 2ZPEB 3A8GB 4FM4B 3QZ5B 1PSEA 3QYGB 1QP2A 2DPPB 4KT0E 4OB2B 4XK8E 4Y28E 4ZGEB 1DJ7B 3A8MB 4OB1B 2DXCA 3A8OB 1UGQB 2PVOB 1PSFA 3A8LB 3X20B 4ZGJB 2WSCE 4OB3B 3VYHB 2ZPHB 3X26B 2O01E 1JB0E 1QP3A 2PVDB 2QDYB 2ZZDA 3QZ9B 2ZPGB 2PUKB
chains in the Genus database with same CATH superfamily
2KAFA 8AT1B 2JMCA 3QIIA 3GBQA 3OW2S 2IG0A 5L8RE 2YT6A 3CCRT 1OYXA 1OV3A 5CAIA 3QWXX 3UF4A 2RHUA 4DQ2A 3E9FA 3BFMA 4M77B 1HD3A 3X25B 4D8KA 4OVAA 3LGFA 3CCUQ 4WF2A 1YITT 3CMEQ 3SWNA 3S3NA 3HPWA 1BKBA 1E6GA 2RHXA 5CQXA 4DBFA 1KJWA 3VS6A 5GAN4 1EIFA 2DL8A 3VUZA 5GANj 3CC4T 3NTHA 5FWCA 2O4XB 1VQKA 3LH0A 3OBWA 5AT1B 1K8AU 4BE1A 1OEBA 1N5ZA 1T0HA 2L3QA 2QA4T 2DPPB 2EKHA 2QQSA 3CCST 1KC8C 4OB1B 4ZGJB 4BE0A 2DBKA 3VYGA 1M4ZA 4MMLA 2AHJB 1O75A 1WHLA 4KGVB 1VQ9T 3C0CA 4X9CA 1PCXA 2JN0A 4JLIA 4A4FA 1HJDA 3H0IA 4M7AF 3CMET 3LWIA 1AVZC 1Y0MA 3A5ZB 5AYFA 3X20B 2QYZA 3OW2A 5DLQE 2PVDB 4ESRA 1BIAA 3UATA 4XQ3A 4C92B 1W6XA 1GFDA 5KYXA 4AFQC 2DYIA 1VQPQ 5A2QE 2OJ2A 2H3EB 4E7HA 1LCKA 2K3XA 2B86A 4J83A 4JPBW 2CZ6B 4J6YA 2NUTA 4PL6A 4IKFA 5GMKl 2K5FA 3EH1A 1X6GA 4LDVA 3VRZA 3A8LB 2F2XA 4E7KA 1K9AA 2DA9A 2A28A 4AFUC 3BY7A 2DJQA 1W2BS 1UE9A 2G3RA 2MK5A 1TUGB 3EG3A 2QEXQ 4FW2A 2CZ7B 1BK2A 1PKSA 5FROA 1OULA 5GMKj 2JM8A 3EHQA 4C0ZA 1M9SA 1B34A 3A8GB 3L42A 4YTLA 1EZZB 2JUFA 1QQJA 3EFOA 3OS2A 1VUBA 3CPFA 5C6SA 2EYXA 4Y92A 1TSFA 5LJ3j 1KD1U 2FZKB 3TVTA 5LJ5j 3MJXA 1LPLA 3CCSA 3E1SA 3GF5A 4VUBA 3P8DA 2Y4YA 2DIQA 1LNXA 2CSIA 2YRVA 4E7JA 2K4YA 2DL4A 2K7AA 3V7RA 1PSFA 2ATCB 2RNAA 2LC4A 2RF0A 1YFNA 4J8OA 5GMKm 2A3LA 3PE0A 4FW1A 1M90R 1NPPA 3M0TA 1RADB 2IPOB 3CD6T 3TCJA 1Z9ZA 1G3YA 3OYJA 1R0CB 4DBHA 1YJNA 1K0SA 5J26A 2F2WA 1ZUYA 2VKNA 5CKDA 1TXQA 4X9DA 5I22A 1TTHB 1Y96A 4L59A 4M75D 1V1CA 8ATCB 4FT2A 4KGXB 4M7AE 4HXJA 2HDAA 3H9NA 2L8DA 3OYGA 4F17A 1KD1C 3CD6Q 3I56T 2QGFB 4V2SA 3TSWA 2VYTA 2EGCA 3QJYA 2LQNA 1RAGB 3VRYA 4C92G 2RJFA 3DB4A 1EX4A 2V8KA 3NGPA 2E5KA 2K2VA 3M58A 3EGDA 1JXMA 3WVEB 4WTOB 2CSQA 2LVMA 1H3ZA 1X6BA 4DA4A 4P5NA 4O6JA 1BI0A 2D0QB 2CUBA 1WGSA 3H0HA 5KYWA 2HQHA 5GAN2 5CKHA 2DL7A 3CC7A 4DOWA 1B3QA 3ZEHA 1UGQB 2FO0A 2CKKA 4B6MA 5CCAA 2E12A 4M77A 4X34A 2P0KA 3SEMA 5A0GA 3CC2T 3M4GA 3PGGA 3FB9A 1UGSB 4QVZA 3JCMb 2MAMA 5GAOp 1ABQA 3A8HB 1AWOA 1GXIE 5J39A 3GP8A 4AMCA 1B34B 3E9GA 4QVDA 4M78A 3JCMc 1AZEA 5IHKA 4XTXA 1E6HA 1MNDA 3EGDB 5A0LA 1T3LA 3V8JA 3OYFA 3HRTA 3CMAT 2EJ9A 3EAEA 2ZPBB 2KRNA 1YJ9T 2DD5A 1R0BG 4QQ6A 2C0TA 1T0JA 3CPWS 3CCVQ 3G6ET 1XQHA 2CP5A 4HKEA 3GNGA 2BZ8A 3HRUA 3CCQQ 3FJ5A 1PHTA 2BE9B 5GANe 5IT9E 3OSVA 4C0GA 2E6NA 4N4IA 3FEOA 4E7SA 1RABB 1HXDA 2RHYA 3KXTA 1QCFA 3CCJT 4EMGA 4M7AD 1SG5A 2XD0A 2M9UA 1UUEA 4CC7A 1PSEA 3SHWA 1WJQA 2RQVA 5IH2A 2MWPA 1M90C 4J6WA 4PFPA 3CC2Q 4M78D 1NLOC 3OYYA 2DE0X 2GF7A 1I4K1 3VS2A 2O2OA 1JBMA 3FJPA 4IURA 1WQ7A 3H41A 1OZ2A 3I55A 2OTJQ 1FXXA 1ZSZC 2WACA 1JJ2P 2KRMA 3MCAB 1RI9A 4LDUA 2LRQA 1JB0E 2AT1B 3RIRA 4RG8A 2OTLA 5KE3A 2EGAA 1Q7YU 2JNGA 3I56Q 5FWBA 2L3PA 1AHJB 5GAOn 4M78G 1UG1A 5GAN8 1KQSA 1MV0B 1QP2A 3OYCA 2HQEA 1M1KC 3TU4K 2RJEA 4BD3A 1X6OA 1QVGP 2DZCA 3EG2A 3CCLQ 5FU7C 5CR2A 4C8QA 3RR6A 3UWNA 1VQ4Q 4M7DD 2X35A 4D8DA 2EQJA 4C0FA 3OS0A 3OA6A 1VQOQ 3M53A 3ULRB 1FMKA 1MUZA 3KUFA 5KYXB 2EIFA 3VV0A 5FW9A 1NJIU 4RG2A 1ZBXA 3V7CA 4IIOA 1QLYA 2CDTA 2K79A 1WHMA 3C94A 2VC8A 5L23A 2HAXA 3NMZC 3G4ST 4JJNK 3LGLA 4R56A 3RKYA 4EMKB 1N9SA 2F5TX 2KSSA 1WIEA 4M78E 1I07A 2EPDA 1VIEA 3HKSA 4FYXB 1JQQA 4J9FA 3M54A 1U1SA 3BE3A 2MWOA 2K5IA 4C8QD 3VS7A 1SHFA 1PM3A 5KCHA 2K9GA 2DTOA 2A36A 5KYNA 4L5GA 3G6EA 4PJNA 2HZYA 1YI2A 4BI3A 4KBMB 2SEMA 1Y7XA 4DBQA 4BACA 3CPWP 4PJJA 3H6ZA 3S3MA 1YJ9A 4PFOA 2E64A 2LCCA 2JVVA 2X51A 1UEBA 4BI8B 2I0NA 1X43A 3S3OA 2XDBA 4HVWA 3ER0A 1VQ4A 4M7DB 3QJ6A 5LJ5h 3MHXA 2DXCA 3CCVT 1U06A 3CCLA 1NG2A 4XTYA 1MNEA 2E3IA 3EFRA 1WPYA 2AKKA 1WFWA 2DEUA 2DM1A 2I2LA 1IO6A 3MP8A 2AZSA 2WSFE 2VGNA 4A53A 2CGHA 3EG9A 1H641 2DRKA 1UB4A 1KSWA 2JT4A 3I56A 4OB2B 1PC0A 2OTLQ 1R8OB 2MYSA 1N6AA 2QQAA 4XU2A 5HCKA 1YJWQ 1I8FA 2WSCE 1N8RU 4C8QB 2KY9A 1VIFA 5CKFA 4BB7A 4E2FB 4CC4B 1OOTA 4M75A 2RM4A 1WXTA 1VQ8A 3X28B 2LZ6B 5LJ3d 2HD0A 2KXCA 2SRCA 1X75C 3OYHA 3JCMf 2K3YA 1UFFA 1ZSZB 2KYBA 2DVJA 2QA4Q 4ZNXA 1HSQA 1PD1A 2XI9A 3CC2A 1BBZA 3PVQA 1KQ2A 2MOXA 4D6WA 3CC4Q 1UJYA 2B8AA 1M3BA 3OS5A 3CCRQ 4IUUA 4F14A 1N9RA 3UA7A 1VQ7A 1PD0A 2VV5A 4FSSA 3FRNA 1K9MC 4PJMA 3EG1A 4RKUE 2DTIA 3JCMV 4LUEA 4A4GA 3L2VA 4PJOD 4RMOA 1I5OB 5KE2A 1UGPB 2ZPEB 2LX7A 3JCMe 3MEAA 2HSEB 2XK0A 4HT8A 4M77F 1YI2T 3RMQA 1GFCA 3SD4A 2CZ1B 2W0ZA 2DD4A 3GIBA 1K8AC 2CT3A 3NTIA 1FX7A 5GAMh 2HQXA 4HVVA 1XNIA 1VYVA 2KMTA 4NL2A 2DETA 2G6FX 2COZA 3QSUA 3LH5A 1IHWA 1WHKA 5GAOr 3RKWA 2O88A 2D8HA 2LT1A 1XOVA 4JZ3A 1KIKA 5GANd 4F7UF 5GAN3 1X2KA 3QKJA 2YUPA 3PFSA 1NEBA 1GBRA 2HNIA 2EQMA 3J7AF 4BDYA 2E4HA 1OX9A 1RAIB 1YBYA 4KGZB 2FPEA 2P4TA 4XU3A 4C8QE 4M7AA 3VJPA 3I55T 2O31A 2MIOA 2XIDA 4KH1B 2DTHA 2KE9A 1U1TA 4HCBA 1WXBA 3LWHA 1ZQ1A 4MDXA 2ZPFB 1Q95G 1G3TA 1MHNA 4ME7A 2KEAA 1AWWA 2O9VA 4RCBA 5KYYA 3JCMP 1EFNA 3OYKA 4C92F 4K11A 2QTXA 4XAXB 4BI4A 5GANg 2MCNA 2FB7A 2EJFA 4PFZA 3NFCA 2CT4A 1KD1R 3GLXA 2OTJA 2RQRA 1S1NA 1WQWA 2DIGA 1ACMB 1UHFA 1CSKA 3I5SA 4LE9A 2K6DA 1VQ5T 1QMCA 3QDFA 1Q81U 2FVUA 2D8JA 2EQUA 3A1PA 3VS5A 2YRCA 3FC3A 2Y4XA 1H3HA 1GCPA 1GCQC 3GOXA 3M0RA 2F69A 3JCMg 2ZCFB 3P8HA 2P0QA 2DO3A 4KH0B 3JSCA 2EKOA 2CS7A 2L5QA 4Y91A 4J9DA 4E47A 3CCSQ 1DJ7B 4M77C 5IAYA 1U8RA 4OGCA 4N0AA 1TH7A 4C5GA 1VQPT 5GMKe 4PLIA 4OMFB 4FYVB 1VQ7Q 2YUOA 4M77D 3ZBDA 9ATCB 3CCRA 2RHZA 4RTWA 1M3AA 2CYZB 4ZN3A 3MO8A 1N8RR 1G83A 3L2RA 2PZ1A 3CC4A 1AEYA 2C0IA 3O5ZA 1W2BA 4Z88A 3LX7A 2X4YA 4C8QF 3BW1A 1VQLT 1Q81C 1OPLA 2HBPA 1UHCA 3EFOB 1IGQA 1AWXA 2DLPA 2GNCA 3OYAA 3M9QA 1NM7A 2JTFA 4N4HA 2HKQB 1MMAA 2DBMA 3I5RA 2RK1A 5GAOm 1RLPC 2EW3A 1SEMA 3META 2MMPA 1X2QA 1K4US 1AD5A 2CP7A 3L1AA 4KUDK 1C6VX 5LJ3f 5DM7R 2LCSA 3ZL7C 4OB0B 1ARKA 4OF1A 2VXEA 2JJ9A 1TOVA 1YN8A 1ZX6A 3A98A 2JMAA 5KYUA 1Z9QA 2RB6A 2XU8A 4FCYA 2BE7D 2IIMA 5FRNA 2ZAEA 3EGUA 2DILA 2J6KA 3HTRA 3LLRA 1OX8A 1VQKQ 5FU6B 2V1QA 1YJ9Q 1JJ2A 1ZUKA 2CH4A 1BI3A 3D7SB 3RESA 2PTKA 3G7ZA 5GAMg 2HEQA 2BKDN 3C95A 1KC8R 3KBGA 2LP5A 1YI2Q 2F2VA 4C0DC 2KT1A 3WVDB 2RK2A 2VUBA 3CCUA 3JB9F 4OMLA 2E1HA 1A0NB 2HMAA 5IHNA 4J7IA 1MGQA 3ZFJA 5FRMA 4QVCA 1F1BB 2E10A 4HVUA 2IVWA 3CBPA 4KUIA 1WI7A 3OY9A 1WDXA 4ZN1A 5CKEA 4IIMA 2R57A 1GL5A 3OB9A 1G8XA 1Y57A 1BU1A 3EG0A 2KT8A 1K73C 4CC2A 2XKOC 5LJ5f 1YJNT 4MZMA 1QVFP 5D6WA 2EAYA 2RQTA 2MI6A 1K0XA 3R6OA 2XDPA 3V8LA 1M1FA 2EBPA 1KHIA 2LJ0A 4RCCA 2KXDA 1KK7A 3BDUA 4Z89A 2FPFA 1QWFA 1RL2A 4BDZA 4E7IA 3I35A 3SWNC 2KYMA 3M0PA 4J9EA 2L0AA 2YHTA 1Q86R 5GAN6 4OP0A 1HK9A 1QW1A 5GAMe 2FHDA 1BB9A 5LL6S 3INZA 2E70A 3GPLA 4PJOA 4RTTA 3RUXA 2J05A 3QBYA 2E6ZA 5IHIA 2LCLA 2FZGB 3M56A 2LX9A 2HSPA 2RA2A 2DNUA 4OB3B 2RH2A 2ROLA 3JCMh 2OI3A 2QA4A 1M8VA 2QDLA 4RUGA 2OAWA 2ENMA 4C8QC 2JS2A 4QT7A 2LNVA 5IXFA 2CH4W 1K1ZA 5KYWB 1VQKT 1ZLMA 1WZOA 1VQ8Q 3JB9G 3VS3A 2JZ2A 1SKUB 2RI5A 4AFSC 3N5BB 3EFSA 2ZPHB 1MMDA 4JJDA 4PLLA 3NPFA 4DBRA 1YJWA 1KFZA 5I2MA 2LT4A 2DAQA 5A0DA 4FIBA 3JCMQ 4M77G 1NE8A 1OQKA 3OMCA 5CO7A 1ZUUA 3MEWA 3PMTA 3QUIA 1K73R 4QQDA 4FL6A 1Q82C 1NEGA 1PNJA 1M30A 2DKGA 2NLUA 1NJIC 3QYGB 4NS5A 1WYXA 3URGA 3I9QA 3CCMQ 2KVQG 4M75B 3MKDA 4EMKC 1SPKA 4AT1B 2K57A 2EVRA 1TG0A 1OU8A 1S72A 2LTOA 4LN2A 2JTEA 1QVGS 2RJDA 1WNLA 5HK0A 3TSZA 3M59A 4XTUA 3CXCA 3CCJQ 2YRDA 1D3BA 3ASKA 2OTLT 3TQ7P 1WHGA 1OZ3A 4GBQA 2A0FB 4ZTJA 1KQSS 4KULA 1JO8A 3RNJA 3G6EQ 1UECA 5CVIA 3CCUT 4M7DA 1FMWA 4UC4A 1VQ8T 2P4RA 2YLCA 4QQGA 4C8QG 3CCEA 3G1JA 2XMFA 5DY9A 3E19A 4M7DE 2VXFA 4GLKA 1VQ6T 2D9TA 3JCMW 1PKTA 4RTVA 1Q82U 2GTJA 5GMKh 3X26B 2CP3A 1GCQA 2W10A 2ZPGB 3OQ5A 2MF2A 4LDWA 1Y07A 3CBOA 4JS4A 2CP0A 3RBBB 1OI1A 2QQBA 1NLPC 4RTYA 1D1CA 2LQKA 3JV3A 2LMJA 1D0XA 5LJ3g 4AG1C 2AIRB 1KC8U 1UTIA 2DF6A 1VQ9Q 3M4YA 3QZ5B 2ESWA 1W1FA 2XHCA 4BUGA 1UJ0A 1VQMT 1QP3A 2VB6A 1WJSA 4M7DF 1BCOA 2CZ0B 2R5MA 1ZSZA 2AK5A 3PIOA 1VQOA 2HL3A 2CREA 4B9XA 1M5Q1 6AT1B 3OW2P 3P8BB 3SDZA 1M1KR 1WX6A 3UA6A 1IGUA 4JLGA 2EJGA 1RLQC 4J6XA 4Y28E 2EYYA 1JJ2S 2E3HA 2COYA 1N8RC 1YP5A 1NZ9A 2O01E 5GAMf 2LQWA 4RTZA 3S6WA 1VQLA 4M7AB 2OX7A 3VUBA 2JXBA 2HBWA 1NYGA 1IB8A 3F70A 3CD6A 4HCZA 4C5HA 2RMOA 4C5EA 1MMNA 2ED0A 3M55A 2M0YA 1G2BA 2DXUA 2OAUA 4AFZC 3AT1B 2DX1A 2J6OA 2CP6A 3EGXA 2FRWA 1YHQA 1QVFS 1D0ZA 2DMOA 2X9HA 3CBMA 1CKAA 3I55Q 4IUTA 1KQSP 2RI3A 3QXEB 3CCET 1H92A 4ELZC 4KRTA 1PG5B 2ZPIB 1JU5C 1WXUA 1J3TA 5CKBA 2NUTB 2V8JA 1UDLA 3SFMA 2FRYA 5I2SA 1K9MU 1BCMA 3U23A 3WXMB 1RACB 2ZGWA 2KGTA 3QHSA 2DJZA 5GAN5 1QKXA 4L6V5 4DEXA 2LDMA 3M57A 4M7AC 4M78C 5EC7A 1TWBA 3IQLA 1N27A 1LVKA 2H3JA 1M2VB 1XJWB 4EDUA 2QQ9A 2DXTA 1WHJA 2X3WD 3CCQA 2DYBA 5I11A 3RKXA 3DLLA 1I5LA 2NUZA 3JB9J 5GANh 4E6RA 1D09B 2EWNA 4JRQA 3CCVA 3RERA 4EIKA 3Q1JA 2M0OA 4JDSA 2NYSA 4MZTA 2QEXA 4OMQA 2DZ9A 2LNHB 2ED1A 1VA7A 2RHIA 2BTTA 1QWEA 3MEUA 3EGXB 2EYWA 3QO3A 4JUVA 1XTDA 1Y96B 3L2QA 2PUOB 1RI0A 2GFAA 3SWNB 3OYMA 1M2OA 5KCOA 4J9CA 4RTUA 1RAFB 1YNZA 4IUVA 1VQPA 4J9HA 2FL7A 5CQYA 2JS0A 1QKWA 1BI2A 3M0UA 3CPWA 2AZVA 5GAOq 1B7TA 4F16A 1Q86U 4BY6B 3JB9D 3CC7Q 1G5VA 2DL5A 5KYUB 1S72T 1K8AR 3OS1A 2L89A 2RJCA 3HFNA 3EG9B 2YWWA 3HHTB 1YWPA 5GJVB 4MZPA 2OTJT 2KQWA 2L3SA 2YUQA 1FWZA 4PJOG 1YIJQ 1W2BP 1M1GA 2RN8A 2XDDA 1VOMA 1AT1B 1VQ5Q 2V8IA 2CP2A 4FYWB 3GNFB 4HCKA 4M75F 2EQIA 3OYEA 3PTAA 4CC3A 3CCMT 1Q7YR 2K2MA 1X69A 2EYZA 3PVLA 3JAME 3THKA 1Q82R 3OYBA 2YDLA 2BIVA 5D7UA 4M78B 3CXCS 2D6FA 1SSHA 3L2WA 5LJ3h 3BDLA 2FPDA 2BZXA 2C06A 2KI7A 3CMEA 1MMGA 4ATOA 3CCQT 1YJNQ 5LJ5d 1V76A 5D6XA 3G71A 1CKBA 1M2VA 2GGRA 2DRMA 4LDYA 4ZGDB 1X27A 1H8KA 4F7UG 4RTXA 3V7SA 4JRKA 1NPRA 2MPXC 1WLPB 4LXCA 3QPHA 2PVOB 5I21A 5KYYB 3AHUA 1M8MA 1JRIA 3M0QA 2GCXA 4C92C 4HCCA 1O9SA 1WA7A 3UDCA 1VQNT 3M0SA 3TREA 1U3OA 3OYDA 4JRPA 4OGEA 4LNPA 4FM4B 1M90U 4KT0E 3MEVA 3T9NA 4DEYA 5IN1A 3DKMA 5C0MA 1QCNA 2PQWA 1KQ1A 1D3BB 2EFIA 3C4SA 2EGEA 4IUPA 4M4ZA 2K5LA 3NHNA 2QXFA 3CMAA 2VGMA 2AKLA 2VWFA 1YCYA 2YSQA 1ZBJA 1I1JA 5M9OA 1T3SA 4F7UB 5LJ5e 2F5KA 4IUQA 4PJOB 2DERA 1Q7YC 1M3CA 2X4JA 2NUPA 2QASA 1UGRB 3PT9A 3CCLT 4Q5WA 1D0YA 3JCMd 3OYIA 1D1AA 1FMVA 3A8MB 1ZA1B 3FIFA 4M75E 2RI2A 1SRMA 1MV3A 3DLMA 1YIJT 3OSSC 2YUNA 3V8KA 1UGVA 2FG0A 4M75G 4CRIA 4C0DB 2KBTA 4QW2A 1IREB 2R5AA 4BY6C 2JOYA 1VQNA 2M02A 1K76A 1SF9A 2Z0WA 5D6YA 2KR3A 1WJRA 4C92A 3J81E 4XU0A 1GRIA 3A8OB 2FZCB 1M27C 1LJOA 2KNBB 3JB9H 4PJOC 2PUKB 3KFVA 4C92E 2KDSA 3HFOA 3CQTA 4R0KA 2P0PA 4M78F 1PWTA 2QAZA 2LJ1A 5ECAA 2QI2A 1VQ6A 3VS0A 2X4WA 1ABOA 2E65A 3OBYA 1RAHB 4LD9K 7AT1B 4JJCA 2QK0A 2DFUA 5GANf 2J7IA 5HK3A 2DL3A 1C0MA 3HSBA 2RQUA 2Y90A 1SHGA 3PNWC 3SB2A 2X4XA 4WCIA 4OMMA 5HY6A 4DOVA 4LDXA 1FYNA 2GQIA 2PNIA 2XICA 1VYUA 2DEQA 3DB3A 2DXBA 3O8VA 4X1VA 1U5SA 2QGGA 1VQ4T 2P84A 4OMNA 3JB9I 2A37A 2PVGB 2XG8D 4F04B 2QQRA 4F7UE 3EHRA 4OMPA 4MDWA 1JEGA 2RD1A 2X3XD 1ZHIA 1Q81R 3QWYA 3PIPA 1VQMA 5CK9A 2CUDA 1SRLA 2KROA 1NBEB 3CXCP 2E5QA 5LJ5g 1R77A 1ZSGA 4O5VA 2FEIA 3G71Q 4J9BA 1HYOA 3JRZA 4FSXA 3H8ZA 4N0AC 1E7OA 4PJLA 5GAMd 2JTMA 2VVKA 4ZTFA 1W70A 2J06A 3G4SA 4M77E 2YXYA 4M7AG 1KHCA 1OU9A 4JRIA 4F7UA 1VQ5A 1WHHA 2EQKA 3FDRA 3H0FA 4C5IA 2R58A 5J3BA 1B07A 5FLXE 5GAMj 3M5AA 3MP6A 4II1A 3VYHB 4HT9A 2ZZDA 1YIJA 4OMOA 4FYYB 2DK3A 3UPUA 2V26A 3G4SQ 1IXDA 1G3WA 2J6FA 1I0CA 1M1KU 4PJOF 4QKUA 2QDYB 2BUDA 4XU1A 2RO0A 2YLBA 2GFUA 4PK4A 4E7ZA 4E7LA 1AOJA 3LYIA 3UT1A 4M7DG 1TUCA 1VQ9A 1C1AA 1LOJA 1RAEB 2HL5C 3VS1A 2GBQA 4GY5A 1YITQ 4HA8A 2LQ8A 4J5YA 4BE2A 4NOYA 1IRXA 3L2ZA 4J9GA 4ZGEB 4A63B 1BI1A 2ECZA 3OYLA 1VQMQ 4A4KA 5FU7B 3RMSA 5CIUA 1ZA2B 1BIBA 3RDVA 1TS9A 1TUDA 2A08A 2D0NA 4NL3A 2KK4A 2GQVA 3OYNA 1YJWT 1VQOT 2PU9B 1G3SA 1KG1A 1VQ7T 2BZYA 1Y71A 5GJWB 1PRLC 4EMHA 5DLOA 4ORZA 1I81A 3VU3C 4XTWA 1IZ6A 2M51A 1V29B 3CCEQ 1IHVA 1AZGB 2RPNA 1OPKA 2H8HA 3JCMX 1D1BA 2O9SA 4PKCC 1YHQT 4J7FA 1VYTA 1PRMC 5EG2A 3VKIA 5IXBA 3REBB 3MP1A 4MMKA 3NTKA 4R55A 3CC7T 3CEYA 4ELYC 1K73U 1RAAB 3G71T 4JS5A 4AG2C 3CCJA 5HKCA 1P92A 1VQ6Q 4B9WA 2E41A 5GMKi 5GAOl 3J80E 1S72Q 4XTZA 4LD6A 3QG1A 2GTOA 1QVGA 4JJBA 1QVFA 2M1HA 2JW4A 2QEXT 1QCOA 3CCMA 2WSEE 3QDRB 4A4HA 1YITA 3C12A 1VQNQ 4A54A 4PNOA 4GLMA 2HCKA 3MPUB 3PMIA 4A4EA 1YHQQ 4TVRA 4CI0C 4JZ4A 2L3RA 3EH2A 2JM9A 1NJIR 3QYHB 2LJ3A 1K9MR 1SSFA 2M16A 2NWMA 5KH6A 4PJOE 2RQWA 4EPCA 3X24B 4N4GA 5LJ3e 1AWJA 1QVPA 1BYMA 4LUDA 4XK8E 2K3BA 1VQLQ 2ROTA 1JXOA 2EYQA 3FLGA 1NYFA 4J9IA 2KRSA 4XTVA 1GBQA 3L2UA 3HRSA 1W4SA 1TU0B 2D1XA 3VS4A 2C0OA 3ME9A 2V1RA 1YWOA 3LW5E 2O4XA 3REAB 3CMAQ 3OMGA 4M75C 4M7DC 2NUPB 4FT4A 5FU6C 2FYKA 2L2PA 2QG9B 2F1LA 2ABLA 1YCSB 3QZ9B 2HKNA 4Z02A 4FU6A 5GAN7 2QTVA 4ANJA 1Q86C 3JCMJ 3HP9A 1RUWA 2DVEA 3E2UA 3HL8A 2A7YA 2COWA 4C92D 3TEEA 3R6NA 4Z8AA 2VASA 1X01A 4EMKA
chains in the Genus database with same CATH topology
2GCXA 3M54A 1K73C 2KAFA 2XKOC 3QIIA 5LJ5f 1U1SA 4C92C 3OW2S 1O9SA 2IG0A 5L8RE 4MZMA 1OYXA 2MWOA 3UDCA 5CAIA 3CCRT 5D6WA 2K5IA 2EAYA 4C8QD 1VQNT 3TREA 2RHUA 4DQ2A 2MI6A 3OYDA 3S3MA 3E9FA 3BFMA 4M77B 3X25B 3R6OA 2XDPA 5KCHA 4JRPA 4OGEA 4OVAA 1M1FA 3V8LA 4FM4B 1M90U 1KHIA 2DTOA 3MEVA 3LGFA 4KT0E 4RCCA 4WF2A 3T9NA 1YITT 3SWNA 3S3NA 3BDUA 4L5GA 5IN1A 3DKMA 3HPWA 3G6EA 1YI2A 4BI3A 1RL2A 4BDZA 4E7IA 1BKBA 5C0MA 2RHXA 5CQXA 3SWNC 2PQWA 4KBMB 1KQ1A 1Y7XA 1D3BB 4BACA 2YHTA 5GAN4 1EIFA 5GAN6 3H6ZA 4OP0A 2EFIA 3VUZA 3C4SA 3CC4T 2E64A 1HK9A 1QW1A 2LCCA 2FHDA 2K5LA 3NTHA 4IUPA 2QXFA 5GAMe 2O4XB 3CMAA 1VQKA 3LH0A 3OBWA 5LL6S 2JVVA 2E70A 2VGMA 1UEBA 3INZA 3GPLA 3RUXA 4BI8B 4BE1A 1K8AU 4PJOA 1YCYA 3S3OA 2XDBA 3QBYA 2E6ZA 3ER0A 5M9OA 1VQ4A 2LCLA 4M7DB 3QJ6A 2QA4T 2DPPB 2QQSA 3M56A 2LX9A 4F7UB 5LJ5e 3CCST 5LJ5h 1KC8C 4OB1B 3MHXA 2DXCA 3CCVT 2RA2A 4ZGJB 4BE0A 3CCLA 4OB3B 2F5KA 4IUQA 4XTYA 2RH2A 4PJOB 3EFRA 3JCMh 3VYGA 1WPYA 1Q7YC 2I2LA 2QA4A 1M8VA 3MP8A 1M4ZA 2X4JA 4MMLA 4C8QC 2AHJB 1O75A 1UGRB 2LNVA 2WSFE 3PT9A 1VQ9T 2VGNA 3CCLT 4A53A 4Q5WA 1VQKT 2CGHA 1H641 4X9CA 3JB9G 1UB4A 2JN0A 4JLIA 2JZ2A 3I56A 4A4FA 3JCMd 3OYIA 4OB2B 4M7AF 3CMET 3A8MB 1R8OB 3LWIA 3FIFA 1N6AA 2RI5A 2QQAA 3A5ZB 4M75E 4XU2A 5AYFA 3N5BB 3X20B 2RI2A 1I8FA 2WSCE 3EFSA 3OW2A 2ZPHB 1YJWA 4PLLA 3DLMA 2PVDB 5DLQE 5I2MA 4C8QB 2LT4A 2DAQA 3OSSC 2KY9A 5A0DA 1YIJT 4FIBA 1BIAA 3JCMQ 1VIFA 3V8KA 4M77G 4XQ3A 5CKFA 1NE8A 4M75G 4BB7A 4C92B 4CRIA 5CO7A 3OMCA 4M75A 4C0DB 5A2QE 4QW2A 2RM4A 1IREB 2R5AA 4M7DC 1VQ8A 3MEWA 3PMTA 3X28B 5LJ3d 3QUIA 4BY6C 4E7HA 2HD0A 2JOYA 4QQDA 4FL6A 2K3XA 1Q82C 1X75C 1VQNA 4J83A 3OYHA 5D6YA 2CZ6B 3JCMf 2K3YA 4J6YA 1WJRA 2DKGA 2NLUA 1NJIC 3QYGB 4C92A 4NS5A 4PL6A 3J81E 3URGA 4XU0A 2KVQG 2XI9A 4M75B 3CC2A 3A8OB 4EMKC 1KQ2A 4IKFA 5GMKl 2K5FA 1LJOA 3JB9H 4LDVA 2K57A 4PJOC 3A8LB 4D6WA 2PUKB 4C92E 2KDSA 3HFOA 4E7KA 1S72A 2P0PA 2LTOA 4M78F 3BY7A 1W2BS 1QVGS 2G3RA 2QI2A 2RJDA 1VQ6A 1WNLA 2X4WA 5HK0A 2B8AA 2CZ7B 3M59A 3OS5A 4XTUA 3CXCA 2E65A 3OBYA 5FROA 4IUUA 5GMKj 1N9RA 4C0ZA 4LD9K 1M9SA 1D3BA 1B34A 3A8GB 3L42A 4YTLA 5GANf 3ASKA 1VQ7A 2OTLT 2VV5A 1OZ3A 5HK3A 2JUFA 3OS2A 1VUBA 3HSBA 3FRNA 3CPFA 4ZTJA 4KULA 1KQSS 1K9MC 2Y90A 5C6SA 3PNWC 3SB2A 2X4XA 5LJ3j 1KD1U 5HY6A 4DOVA 4LDXA 5CVIA 4RKUE 5LJ5j 2DTIA 2DEQA 2XICA 3DB3A 2DXBA 3O8VA 3JCMV 3CCSA 3CCUT 4A4GA 4M7DA 1VQ4T 4UC4A 3L2VA 3E1SA 3GF5A 4VUBA 4PJOD 1N8RU 1VQ8T 3P8DA 2Y4YA 3JB9I 2YLCA 4QQGA 4C8QG 2PVGB 4RMOA 2DIQA 3CCEA 1LNXA 2XG8D 5DY9A 5KE2A 1UGPB 3E19A 2YRVA 4E7JA 4M7DE 2ZPEB 2QQRA 4F7UE 2K4YA 2VXFA 3JCMe 4GLKA 3MEAA 1VQ6T 2D9TA 3V7RA 3JCMW 4MDWA 1PSFA 2RD1A 2XK0A 4HT8A 1Q82U 1ZHIA 5GMKh 3X26B 4M77F 1YI2T 2LC4A 3RMQA 2ZPGB 3OQ5A 3PIPA 1VQMA 5CK9A 4J8OA 5GMKm 2MF2A 4LDWA 3SD4A 2CZ1B 1Y07A 2A3LA 3CBOA 4JS4A 2DD4A 3GIBA 1NPPA 1OI1A 2E5QA 1K8AC 2QQBA 3NTIA 1FX7A 5LJ5g 2LQKA 5GAMh 3CD6T 2HQXA 3TCJA 1XNIA 5LJ3g 2KMTA 4NL2A 1G3YA 4O5VA 3OYJA 1KC8U 3M4YA 1YJNA 3QZ5B 3JRZA 3QSUA 4FSXA 5J26A 2XHCA 3H8ZA 4BUGA 4N0AC 5GAOr 3RKWA 5CKDA 1VQMT 4X9DA 1QP3A 2LT1A 1WJSA 1XOVA 5GAMd 2JTMA 1Y96A 4L59A 4M75D 5GANd 4M7DF 2CZ0B 2R5MA 4F7UF 5GAN3 4FT2A 3PIOA 3QKJA 3PFSA 4ZTFA 1VQOA 4M7AE 4B9XA 1M5Q1 3P8BB 2HNIA 2EQMA 3J7AF 4BDYA 2L8DA 3SDZA 3OYGA 1KD1C 3G4SA 4M77E 3I56T 4JLGA 4V2SA 1YBYA 2VYTA 2EJGA 2P4TA 4M7AG 4XU3A 4C8QE 1KHCA 4JRIA 4M7AA 3QJYA 4J6XA 4Y28E 3VJPA 4F7UA 3I55T 1VQ5A 3FDRA 2EQKA 2XIDA 4C92G 1JJ2S 4C5IA 5FLXE 2R58A 2RJFA 5J3BA 3DB4A 2V8KA 5GAMj 1N8RC 2DTHA 3M5AA 3MP6A 2K2VA 4II1A 1U1TA 1NZ9A 3M58A 2O01E 3VYHB 5GAMf 3LWHA 4HCBA 4HT9A 2ZZDA 3WVEB 2LVMA 1ZQ1A 1H3ZA 1YIJA 3S6WA 4MDXA 1VQLA 4M7AB 2ZPFB 4DA4A 1G3TA 4P5NA 3VUBA 1MHNA 4O6JA 4ME7A 1BI0A 2D0QB 2DK3A 3UPUA 4RCBA 3F70A 1WGSA 3CD6A 4HCZA 4C5HA 3JCMP 5GAN2 4C5EA 3OYKA 4C92F 1YJ9A 5CKHA 1G3WA 3M55A 3CC7A 4DOWA 2DXUA 2OAUA 2QTXA 3ZEHA 1UGQB 1M1KU 4XAXB 4PJOF 4BI4A 5GANg 2CKKA 2QDYB 5CCAA 2BUDA 2E12A 2FB7A 2RO0A 4M77A 4X34A 4XU1A 2EJFA 2YLBA 1YHQA 1QVFS 3NFCA 2GFUA 4E7LA 2P0KA 3CBMA 3LYIA 3UT1A 5A0GA 3GLXA 2OTJA 4M7DG 3CC2T 3M4GA 1VQ9A 3PGGA 3FB9A 4IUTA 1UGSB 1LOJA 2RI3A 3QXEB 3CCET 4QVZA 1WQWA 3JCMb 2MAMA 4ELZC 2DIGA 5GAOp 3A8HB 4GY5A 2ZPIB 4HA8A 2LQ8A 1GXIE 4J5YA 4BE2A 5CKBA 5J39A 3GP8A 2V8JA 4NOYA 3L2ZA 1B34B 3E9GA 3SFMA 4ZGEB 5I2SA 1VQ5T 1BI1A 4QVDA 4M78A 3OYLA 1K9MU 1Q81U 3JCMc 4A4KA 5FU7B 3RMSA 3WXMB 5CIUA 1BIBA 2FVUA 2ZGWA 4XTXA 3QHSA 2DJZA 2EQUA 5A0LA 2KK4A 2GQVA 5GAN5 4NL3A 3OYNA 4L6V5 1YJWT 1VQOT 2PU9B 1G3SA 2LDMA 3V8JA 1KG1A 3M57A 3FC3A 3OYFA 4M78C 2Y4XA 1Y71A 1VQ7T 4M7AC 3HRTA 4EMHA 1N27A 5DLOA 3CMAT 2EJ9A 3GOXA 1I81A 2H3JA 2ZPBB 3EAEA 4XTWA 3VU3C 1IZ6A 1YJ9T 2F69A 2DD5A 1V29B 2ZCFB 4QQ6A 3JCMg 3P8HA 4EDUA 2QQ9A 2P0QA 2DO3A 3CPWS 3JSCA 2DXTA 3JCMX 2EKOA 2CS7A 2L5QA 4Y91A 4E47A 4PKCC 1DJ7B 4J7FA 1YHQT 3G6ET 3CCQA 1XQHA 4HKEA 4M77C 3GNGA 5EG2A 3VKIA 5IAYA 1U8RA 3MP1A 4OGCA 4N0AA 3RKXA 4MMKA 1TH7A 4C5GA 3DLLA 1VQPT 3HRUA 5GMKe 4PLIA 4OMFB 1I5LA 3JB9J 3NTKA 5GANh 4R55A 5GANe 5IT9E 3CC7T 2EWNA 4M77D 3CEYA 3ZBDA 4ELYC 4JRQA 3OSVA 4C0GA 2E6NA 4N4IA 3CCVA 3FEOA 3G71T 1K73U 3RERA 1HXDA 2RHYA 3KXTA 3CCRA 4JS5A 3CCJT 2RHZA 3Q1JA 4EMGA 3CCJA 4M7AD 5HKCA 2M0OA 4JDSA 1P92A 2CYZB 4MZTA 4B9WA 4ZN3A 2E41A 2QEXA 2XD0A 5GMKi 2M9UA 5GAOl 1PSEA 3J80E 2DZ9A 3MO8A 1WJQA 4XTZA 3L2RA 3CC4A 2MWPA 1M90C 4LD6A 3QG1A 4J6WA 2RHIA 3MEUA 1W2BA 1QVGA 1QVFA 2M1HA 3QO3A 2QEXT 3LX7A 4JUVA 2X4YA 4M78D 4C8QF 1XTDA 1Y96B 2WSEE 3OYYA 3BW1A 3QDRB 3CCMA 3L2QA 2PUOB 4A4HA 1Q81C 1RI0A 1VQLT 2HBPA 2GFAA 3SWNB 3OYMA 1YITA 3C12A 2GF7A 1I4K1 5KCOA 3OYAA 1JBMA 3FJPA 3M9QA 4IURA 1WQ7A 4IUVA 2JTFA 4A54A 4N4HA 4PNOA 1OZ2A 3I55A 1VQPA 2FL7A 5CQYA 1FXXA 3PMIA 4A4EA 2WACA 1BI2A 4TVRA 3MCAB 4CI0C 3CPWA 2RK1A 2L3RA 5GAOm 4LDUA 5GAOq 2LRQA 1JB0E 3RIRA 1Q86U 4BY6B 3META 2MMPA 3JB9D 4RG8A 2OTLA 3L1AA 5KE3A 3QYHB 4KUDK 1G5VA 1SSFA 1Q7YU 1S72T 2M16A 2JNGA 5LJ3f 5KH6A 3OS1A 5DM7R 4PJOE 2L89A 2RJCA 3HFNA 1AHJB 4OB0B 5GAOn 4OF1A 4EPCA 3X24B 3HHTB 4M78G 2VXEA 4N4GA 4MZPA 5LJ3e 2OTJT 1QVPA 2KQWA 5GAN8 1KQSA 1BYMA 1QP2A 4XK8E 3OYCA 2HQEA 1M1KC 3TU4K 1FWZA 4PJOG 2RJEA 4BD3A 1X6OA 2DZCA 2EYQA 3FLGA 2RB6A 1M1GA 2XDDA 4XTVA 5FU7C 5CR2A 3L2UA 4C8QA 2XU8A 5GANj 3HRSA 5FRNA 1W4SA 2V8IA 3UWNA 3ME9A 3GNFB 4M75F 4M7DD 3OYEA 4HCCA 3PTAA 3LLRA 2O4XA 3LW5E 2X35A 3OMGA 5FU6B 3CCMT 2EQJA 4M75C 4C0FA 3OS0A 3JAME 1JJ2A 1BI3A 3OA6A 3M53A 3OYBA 3KUFA 2BIVA 2EIFA 3RESA 3G7ZA 4M78B 3VV0A 3CXCS 5GAMg 1NJIU 4FT4A 2D6FA 5FU6C 2BKDN 3L2WA 5LJ3h 3C95A 4RG2A 3BDLA 2FYKA 3KBGA 2C06A 1ZBXA 3V7CA 3QZ9B 4C0DC 3CMEA 3WVDB 2RK2A 2VUBA 3CCUA 4ATOA 4Z02A 3JB9F 4FU6A 2E1HA 3CCQT 5LJ5d 5D6XA 5GAN7 4J7IA 1MGQA 3ZFJA 3G71A 3C94A 2VC8A 5FRMA 2HAXA 1Q86C 3G4ST 3JCMJ 4QVCA 4LDYA 4JJNK 3HP9A 3LGLA 4ZGDB 4F7UG 4R56A 3RKYA 4EMKB 1N9SA 2E10A 2F5TX 2KSSA 3V7SA 4JRKA 2DVEA 2IVWA 1NPRA 3CBPA 4KUIA 4M78E 3OY9A 4ZN1A 5CKEA 2R57A 3HL8A 2A7YA 3QPHA 1VIEA 2PVOB 3OB9A 3TEEA 4C92D 1YJNT 5I21A 3HKSA 3AHUA 1JRIA 1X01A 4EMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6V 5;  2PU9 B;  2WSE E;  4RKU E;  2CZ0 B;  3WVD B;  2ZPF B;  2DXB A;  2PUO B;  3QYH B;  2CZ1 B;  3WVE B;  5L8R E;  2DD4 A;  2D0Q B;  2AHJ B;  1IRE B;  2ZPB B;  1UGS B;  1UGR B;  2CZ7 B;  3X28 B;  2WSF E;  3LW5 E;  2DD5 A;  3QXE B;  1V29 B;  2ZCF B;  2PVG B;  1AHJ B;  4OB0 B;  4ZGD B;  3VYG A;  3A8H B;  3X24 B;  3HHT B;  2ZPI B;  3X25 B;  1UGP B;  2CYZ B;  1GXI E;  2CZ6 B;  2ZPE B;  3A8G B;  4FM4 B;  3QZ5 B;  1PSE A;  3QYG B;  1QP2 A;  2DPP B;  4KT0 E;  4OB2 B;  4XK8 E;  4Y28 E;  4ZGE B;  1DJ7 B;  3A8M B;  4OB1 B;  2DXC A;  3A8O B;  1UGQ B;  2PVO B;  1PSF A;  3A8L B;  3X20 B;  4ZGJ B;  2WSC E;  4OB3 B;  3VYH B;  2ZPH B;  3X26 B;  2O01 E;  1JB0 E;  1QP3 A;  2PVD B;  2QDY B;  2ZZD A;  3QZ9 B;  2ZPG B;  2PUK B; 
#chains in the Genus database with same CATH topology
 2KAF A;  8AT1 B;  2JMC A;  3QII A;  3GBQ A;  3OW2 S;  2IG0 A;  5L8R E;  2YT6 A;  3CCR T;  1OYX A;  1OV3 A;  5CAI A;  3QWX X;  3UF4 A;  2RHU A;  4DQ2 A;  3E9F A;  3BFM A;  4M77 B;  1HD3 A;  3X25 B;  4D8K A;  4OVA A;  3LGF A;  3CCU Q;  4WF2 A;  1YIT T;  3CME Q;  3SWN A;  3S3N A;  3HPW A;  1BKB A;  1E6G A;  2RHX A;  5CQX A;  4DBF A;  1KJW A;  3VS6 A;  5GAN 4;  1EIF A;  2DL8 A;  3VUZ A;  5GAN j;  3CC4 T;  3NTH A;  5FWC A;  2O4X B;  1VQK A;  3LH0 A;  3OBW A;  5AT1 B;  1K8A U;  4BE1 A;  1OEB A;  1N5Z A;  1T0H A;  2L3Q A;  2QA4 T;  2DPP B;  2EKH A;  2QQS A;  3CCS T;  1KC8 C;  4OB1 B;  4ZGJ B;  4BE0 A;  2DBK A;  3VYG A;  1M4Z A;  4MML A;  2AHJ B;  1O75 A;  1WHL A;  4KGV B;  1VQ9 T;  3C0C A;  4X9C A;  1PCX A;  2JN0 A;  4JLI A;  4A4F A;  1HJD A;  3H0I A;  4M7A F;  3CME T;  3LWI A;  1AVZ C;  1Y0M A;  3A5Z B;  5AYF A;  3X20 B;  2QYZ A;  3OW2 A;  5DLQ E;  2PVD B;  4ESR A;  1BIA A;  3UAT A;  4XQ3 A;  4C92 B;  1W6X A;  1GFD A;  5KYX A;  4AFQ C;  2DYI A;  1VQP Q;  5A2Q E;  2OJ2 A;  2H3E B;  4E7H A;  1LCK A;  2K3X A;  2B86 A;  4J83 A;  4JPB W;  2CZ6 B;  4J6Y A;  2NUT A;  4PL6 A;  4IKF A;  5GMK l;  2K5F A;  3EH1 A;  1X6G A;  4LDV A;  3VRZ A;  3A8L B;  2F2X A;  4E7K A;  1K9A A;  2DA9 A;  2A28 A;  4AFU C;  3BY7 A;  2DJQ A;  1W2B S;  1UE9 A;  2G3R A;  2MK5 A;  1TUG B;  3EG3 A;  2QEX Q;  4FW2 A;  2CZ7 B;  1BK2 A;  1PKS A;  5FRO A;  1OUL A;  5GMK j;  2JM8 A;  3EHQ A;  4C0Z A;  1M9S A;  1B34 A;  3A8G B;  3L42 A;  4YTL A;  1EZZ B;  2JUF A;  1QQJ A;  3EFO A;  3OS2 A;  1VUB A;  3CPF A;  5C6S A;  2EYX A;  4Y92 A;  1TSF A;  5LJ3 j;  1KD1 U;  2FZK B;  3TVT A;  5LJ5 j;  3MJX A;  1LPL A;  3CCS A;  3E1S A;  3GF5 A;  4VUB A;  3P8D A;  2Y4Y A;  2DIQ A;  1LNX A;  2CSI A;  2YRV A;  4E7J A;  2K4Y A;  2DL4 A;  2K7A A;  3V7R A;  1PSF A;  2ATC B;  2RNA A;  2LC4 A;  2RF0 A;  1YFN A;  4J8O A;  5GMK m;  2A3L A;  3PE0 A;  4FW1 A;  1M90 R;  1NPP A;  3M0T A;  1RAD B;  2IPO B;  3CD6 T;  3TCJ A;  1Z9Z A;  1G3Y A;  3OYJ A;  1R0C B;  4DBH A;  1YJN A;  1K0S A;  5J26 A;  2F2W A;  1ZUY A;  2VKN A;  5CKD A;  1TXQ A;  4X9D A;  5I22 A;  1TTH B;  1Y96 A;  4L59 A;  4M75 D;  1V1C A;  8ATC B;  4FT2 A;  4KGX B;  4M7A E;  4HXJ A;  2HDA A;  3H9N A;  2L8D A;  3OYG A;  4F17 A;  1KD1 C;  3CD6 Q;  3I56 T;  2QGF B;  4V2S A;  3TSW A;  2VYT A;  2EGC A;  3QJY A;  2LQN A;  1RAG B;  3VRY A;  4C92 G;  2RJF A;  3DB4 A;  1EX4 A;  2V8K A;  3NGP A;  2E5K A;  2K2V A;  3M58 A;  3EGD A;  1JXM A;  3WVE B;  4WTO B;  2CSQ A;  2LVM A;  1H3Z A;  1X6B A;  4DA4 A;  4P5N A;  4O6J A;  1BI0 A;  2D0Q B;  2CUB A;  1WGS A;  3H0H A;  5KYW A;  2HQH A;  5GAN 2;  5CKH A;  2DL7 A;  3CC7 A;  4DOW A;  1B3Q A;  3ZEH A;  1UGQ B;  2FO0 A;  2CKK A;  4B6M A;  5CCA A;  2E12 A;  4M77 A;  4X34 A;  2P0K A;  3SEM A;  5A0G A;  3CC2 T;  3M4G A;  3PGG A;  3FB9 A;  1UGS B;  4QVZ A;  3JCM b;  2MAM A;  5GAO p;  1ABQ A;  3A8H B;  1AWO A;  1GXI E;  5J39 A;  3GP8 A;  4AMC A;  1B34 B;  3E9G A;  4QVD A;  4M78 A;  3JCM c;  1AZE A;  5IHK A;  4XTX A;  1E6H A;  1MND A;  3EGD B;  5A0L A;  1T3L A;  3V8J A;  3OYF A;  3HRT A;  3CMA T;  2EJ9 A;  3EAE A;  2ZPB B;  2KRN A;  1YJ9 T;  2DD5 A;  1R0B G;  4QQ6 A;  2C0T A;  1T0J A;  3CPW S;  3CCV Q;  3G6E T;  1XQH A;  2CP5 A;  4HKE A;  3GNG A;  2BZ8 A;  3HRU A;  3CCQ Q;  3FJ5 A;  1PHT A;  2BE9 B;  5GAN e;  5IT9 E;  3OSV A;  4C0G A;  2E6N A;  4N4I A;  3FEO A;  4E7S A;  1RAB B;  1HXD A;  2RHY A;  3KXT A;  1QCF A;  3CCJ T;  4EMG A;  4M7A D;  1SG5 A;  2XD0 A;  2M9U A;  1UUE A;  4CC7 A;  1PSE A;  3SHW A;  1WJQ A;  2RQV A;  5IH2 A;  2MWP A;  1M90 C;  4J6W A;  4PFP A;  3CC2 Q;  4M78 D;  1NLO C;  3OYY A;  2DE0 X;  2GF7 A;  1I4K 1;  3VS2 A;  2O2O A;  1JBM A;  3FJP A;  4IUR A;  1WQ7 A;  3H41 A;  1OZ2 A;  3I55 A;  2OTJ Q;  1FXX A;  1ZSZ C;  2WAC A;  1JJ2 P;  2KRM A;  3MCA B;  1RI9 A;  4LDU A;  2LRQ A;  1JB0 E;  2AT1 B;  3RIR A;  4RG8 A;  2OTL A;  5KE3 A;  2EGA A;  1Q7Y U;  2JNG A;  3I56 Q;  5FWB A;  2L3P A;  1AHJ B;  5GAO n;  4M78 G;  1UG1 A;  5GAN 8;  1KQS A;  1MV0 B;  1QP2 A;  3OYC A;  2HQE A;  1M1K C;  3TU4 K;  2RJE A;  4BD3 A;  1X6O A;  1QVG P;  2DZC A;  3EG2 A;  3CCL Q;  5FU7 C;  5CR2 A;  4C8Q A;  3RR6 A;  3UWN A;  1VQ4 Q;  4M7D D;  2X35 A;  4D8D A;  2EQJ A;  4C0F A;  3OS0 A;  3OA6 A;  1VQO Q;  3M53 A;  3ULR B;  1FMK A;  1MUZ A;  3KUF A;  5KYX B;  2EIF A;  3VV0 A;  5FW9 A;  1NJI U;  4RG2 A;  1ZBX A;  3V7C A;  4IIO A;  1QLY A;  2CDT A;  2K79 A;  1WHM A;  3C94 A;  2VC8 A;  5L23 A;  2HAX A;  3NMZ C;  3G4S T;  4JJN K;  3LGL A;  4R56 A;  3RKY A;  4EMK B;  1N9S A;  2F5T X;  2KSS A;  1WIE A;  4M78 E;  1I07 A;  2EPD A;  1VIE A;  3HKS A;  4FYX B;  1JQQ A;  4J9F A;  3M54 A;  1U1S A;  3BE3 A;  2MWO A;  2K5I A;  4C8Q D;  3VS7 A;  1SHF A;  1PM3 A;  5KCH A;  2K9G A;  2DTO A;  2A36 A;  5KYN A;  4L5G A;  3G6E A;  4PJN A;  2HZY A;  1YI2 A;  4BI3 A;  4KBM B;  2SEM A;  1Y7X A;  4DBQ A;  4BAC A;  3CPW P;  4PJJ A;  3H6Z A;  3S3M A;  1YJ9 A;  4PFO A;  2E64 A;  2LCC A;  2JVV A;  2X51 A;  1UEB A;  4BI8 B;  2I0N A;  1X43 A;  3S3O A;  2XDB A;  4HVW A;  3ER0 A;  1VQ4 A;  4M7D B;  3QJ6 A;  5LJ5 h;  3MHX A;  2DXC A;  3CCV T;  1U06 A;  3CCL A;  1NG2 A;  4XTY A;  1MNE A;  2E3I A;  3EFR A;  1WPY A;  2AKK A;  1WFW A;  2DEU A;  2DM1 A;  2I2L A;  1IO6 A;  3MP8 A;  2AZS A;  2WSF E;  2VGN A;  4A53 A;  2CGH A;  3EG9 A;  1H64 1;  2DRK A;  1UB4 A;  1KSW A;  2JT4 A;  3I56 A;  4OB2 B;  1PC0 A;  2OTL Q;  1R8O B;  2MYS A;  1N6A A;  2QQA A;  4XU2 A;  5HCK A;  1YJW Q;  1I8F A;  2WSC E;  1N8R U;  4C8Q B;  2KY9 A;  1VIF A;  5CKF A;  4BB7 A;  4E2F B;  4CC4 B;  1OOT A;  4M75 A;  2RM4 A;  1WXT A;  1VQ8 A;  3X28 B;  2LZ6 B;  5LJ3 d;  2HD0 A;  2KXC A;  2SRC A;  1X75 C;  3OYH A;  3JCM f;  2K3Y A;  1UFF A;  1ZSZ B;  2KYB A;  2DVJ A;  2QA4 Q;  4ZNX A;  1HSQ A;  1PD1 A;  2XI9 A;  3CC2 A;  1BBZ A;  3PVQ A;  1KQ2 A;  2MOX A;  4D6W A;  3CC4 Q;  1UJY A;  2B8A A;  1M3B A;  3OS5 A;  3CCR Q;  4IUU A;  4F14 A;  1N9R A;  3UA7 A;  1VQ7 A;  1PD0 A;  2VV5 A;  4FSS A;  3FRN A;  1K9M C;  4PJM A;  3EG1 A;  4RKU E;  2DTI A;  3JCM V;  4LUE A;  4A4G A;  3L2V A;  4PJO D;  4RMO A;  1I5O B;  5KE2 A;  1UGP B;  2ZPE B;  2LX7 A;  3JCM e;  3MEA A;  2HSE B;  2XK0 A;  4HT8 A;  4M77 F;  1YI2 T;  3RMQ A;  1GFC A;  3SD4 A;  2CZ1 B;  2W0Z A;  2DD4 A;  3GIB A;  1K8A C;  2CT3 A;  3NTI A;  1FX7 A;  5GAM h;  2HQX A;  4HVV A;  1XNI A;  1VYV A;  2KMT A;  4NL2 A;  2DET A;  2G6F X;  2COZ A;  3QSU A;  3LH5 A;  1IHW A;  1WHK A;  5GAO r;  3RKW A;  2O88 A;  2D8H A;  2LT1 A;  1XOV A;  4JZ3 A;  1KIK A;  5GAN d;  4F7U F;  5GAN 3;  1X2K A;  3QKJ A;  2YUP A;  3PFS A;  1NEB A;  1GBR A;  2HNI A;  2EQM A;  3J7A F;  4BDY A;  2E4H A;  1OX9 A;  1RAI B;  1YBY A;  4KGZ B;  2FPE A;  2P4T A;  4XU3 A;  4C8Q E;  4M7A A;  3VJP A;  3I55 T;  2O31 A;  2MIO A;  2XID A;  4KH1 B;  2DTH A;  2KE9 A;  1U1T A;  4HCB A;  1WXB A;  3LWH A;  1ZQ1 A;  4MDX A;  2ZPF B;  1Q95 G;  1G3T A;  1MHN A;  4ME7 A;  2KEA A;  1AWW A;  2O9V A;  4RCB A;  5KYY A;  3JCM P;  1EFN A;  3OYK A;  4C92 F;  4K11 A;  2QTX A;  4XAX B;  4BI4 A;  5GAN g;  2MCN A;  2FB7 A;  2EJF A;  4PFZ A;  3NFC A;  2CT4 A;  1KD1 R;  3GLX A;  2OTJ A;  2RQR A;  1S1N A;  1WQW A;  2DIG A;  1ACM B;  1UHF A;  1CSK A;  3I5S A;  4LE9 A;  2K6D A;  1VQ5 T;  1QMC A;  3QDF A;  1Q81 U;  2FVU A;  2D8J A;  2EQU A;  3A1P A;  3VS5 A;  2YRC A;  3FC3 A;  2Y4X A;  1H3H A;  1GCP A;  1GCQ C;  3GOX A;  3M0R A;  2F69 A;  3JCM g;  2ZCF B;  3P8H A;  2P0Q A;  2DO3 A;  4KH0 B;  3JSC A;  2EKO A;  2CS7 A;  2L5Q A;  4Y91 A;  4J9D A;  4E47 A;  3CCS Q;  1DJ7 B;  4M77 C;  5IAY A;  1U8R A;  4OGC A;  4N0A A;  1TH7 A;  4C5G A;  1VQP T;  5GMK e;  4PLI A;  4OMF B;  4FYV B;  1VQ7 Q;  2YUO A;  4M77 D;  3ZBD A;  9ATC B;  3CCR A;  2RHZ A;  4RTW A;  1M3A A;  2CYZ B;  4ZN3 A;  3MO8 A;  1N8R R;  1G83 A;  3L2R A;  2PZ1 A;  3CC4 A;  1AEY A;  2C0I A;  3O5Z A;  1W2B A;  4Z88 A;  3LX7 A;  2X4Y A;  4C8Q F;  3BW1 A;  1VQL T;  1Q81 C;  1OPL A;  2HBP A;  1UHC A;  3EFO B;  1IGQ A;  1AWX A;  2DLP A;  2GNC A;  3OYA A;  3M9Q A;  1NM7 A;  2JTF A;  4N4H A;  2HKQ B;  1MMA A;  2DBM A;  3I5R A;  2RK1 A;  5GAO m;  1RLP C;  2EW3 A;  1SEM A;  3MET A;  2MMP A;  1X2Q A;  1K4U S;  1AD5 A;  2CP7 A;  3L1A A;  4KUD K;  1C6V X;  5LJ3 f;  5DM7 R;  2LCS A;  3ZL7 C;  4OB0 B;  1ARK A;  4OF1 A;  2VXE A;  2JJ9 A;  1TOV A;  1YN8 A;  1ZX6 A;  3A98 A;  2JMA A;  5KYU A;  1Z9Q A;  2RB6 A;  2XU8 A;  4FCY A;  2BE7 D;  2IIM A;  5FRN A;  2ZAE A;  3EGU A;  2DIL A;  2J6K A;  3HTR A;  3LLR A;  1OX8 A;  1VQK Q;  5FU6 B;  2V1Q A;  1YJ9 Q;  1JJ2 A;  1ZUK A;  2CH4 A;  1BI3 A;  3D7S B;  3RES A;  2PTK A;  3G7Z A;  5GAM g;  2HEQ A;  2BKD N;  3C95 A;  1KC8 R;  3KBG A;  2LP5 A;  1YI2 Q;  2F2V A;  4C0D C;  2KT1 A;  3WVD B;  2RK2 A;  2VUB A;  3CCU A;  3JB9 F;  4OML A;  2E1H A;  1A0N B;  2HMA A;  5IHN A;  4J7I A;  1MGQ A;  3ZFJ A;  5FRM A;  4QVC A;  1F1B B;  2E10 A;  4HVU A;  2IVW A;  3CBP A;  4KUI A;  1WI7 A;  3OY9 A;  1WDX A;  4ZN1 A;  5CKE A;  4IIM A;  2R57 A;  1GL5 A;  3OB9 A;  1G8X A;  1Y57 A;  1BU1 A;  3EG0 A;  2KT8 A;  1K73 C;  4CC2 A;  2XKO C;  5LJ5 f;  1YJN T;  4MZM A;  1QVF P;  5D6W A;  2EAY A;  2RQT A;  2MI6 A;  1K0X A;  3R6O A;  2XDP A;  3V8L A;  1M1F A;  2EBP A;  1KHI A;  2LJ0 A;  4RCC A;  2KXD A;  1KK7 A;  3BDU A;  4Z89 A;  2FPF A;  1QWF A;  1RL2 A;  4BDZ A;  4E7I A;  3I35 A;  3SWN C;  2KYM A;  3M0P A;  4J9E A;  2L0A A;  2YHT A;  1Q86 R;  5GAN 6;  4OP0 A;  1HK9 A;  1QW1 A;  5GAM e;  2FHD A;  1BB9 A;  5LL6 S;  3INZ A;  2E70 A;  3GPL A;  4PJO A;  4RTT A;  3RUX A;  2J05 A;  3QBY A;  2E6Z A;  5IHI A;  2LCL A;  2FZG B;  3M56 A;  2LX9 A;  2HSP A;  2RA2 A;  2DNU A;  4OB3 B;  2RH2 A;  2ROL A;  3JCM h;  2OI3 A;  2QA4 A;  1M8V A;  2QDL A;  4RUG A;  2OAW A;  2ENM A;  4C8Q C;  2JS2 A;  4QT7 A;  2LNV A;  5IXF A;  2CH4 W;  1K1Z A;  5KYW B;  1VQK T;  1ZLM A;  1WZO A;  1VQ8 Q;  3JB9 G;  3VS3 A;  2JZ2 A;  1SKU B;  2RI5 A;  4AFS C;  3N5B B;  3EFS A;  2ZPH B;  1MMD A;  4JJD A;  4PLL A;  3NPF A;  4DBR A;  1YJW A;  1KFZ A;  5I2M A;  2LT4 A;  2DAQ A;  5A0D A;  4FIB A;  3JCM Q;  4M77 G;  1NE8 A;  1OQK A;  3OMC A;  5CO7 A;  1ZUU A;  3MEW A;  3PMT A;  3QUI A;  1K73 R;  4QQD A;  4FL6 A;  1Q82 C;  1NEG A;  1PNJ A;  1M30 A;  2DKG A;  2NLU A;  1NJI C;  3QYG B;  4NS5 A;  1WYX A;  3URG A;  3I9Q A;  3CCM Q;  2KVQ G;  4M75 B;  3MKD A;  4EMK C;  1SPK A;  4AT1 B;  2K57 A;  2EVR A;  1TG0 A;  1OU8 A;  1S72 A;  2LTO A;  4LN2 A;  2JTE A;  1QVG S;  2RJD A;  1WNL A;  5HK0 A;  3TSZ A;  3M59 A;  4XTU A;  3CXC A;  3CCJ Q;  2YRD A;  1D3B A;  3ASK A;  2OTL T;  3TQ7 P;  1WHG A;  1OZ3 A;  4GBQ A;  2A0F B;  4ZTJ A;  1KQS S;  4KUL A;  1JO8 A;  3RNJ A;  3G6E Q;  1UEC A;  5CVI A;  3CCU T;  4M7D A;  1FMW A;  4UC4 A;  1VQ8 T;  2P4R A;  2YLC A;  4QQG A;  4C8Q G;  3CCE A;  3G1J A;  2XMF A;  5DY9 A;  3E19 A;  4M7D E;  2VXF A;  4GLK A;  1VQ6 T;  2D9T A;  3JCM W;  1PKT A;  4RTV A;  1Q82 U;  2GTJ A;  5GMK h;  3X26 B;  2CP3 A;  1GCQ A;  2W10 A;  2ZPG B;  3OQ5 A;  2MF2 A;  4LDW A;  1Y07 A;  3CBO A;  4JS4 A;  2CP0 A;  3RBB B;  1OI1 A;  2QQB A;  1NLP C;  4RTY A;  1D1C A;  2LQK A;  3JV3 A;  2LMJ A;  1D0X A;  5LJ3 g;  4AG1 C;  2AIR B;  1KC8 U;  1UTI A;  2DF6 A;  1VQ9 Q;  3M4Y A;  3QZ5 B;  2ESW A;  1W1F A;  2XHC A;  4BUG A;  1UJ0 A;  1VQM T;  1QP3 A;  2VB6 A;  1WJS A;  4M7D F;  1BCO A;  2CZ0 B;  2R5M A;  1ZSZ A;  2AK5 A;  3PIO A;  1VQO A;  2HL3 A;  2CRE A;  4B9X A;  1M5Q 1;  6AT1 B;  3OW2 P;  3P8B B;  3SDZ A;  1M1K R;  1WX6 A;  3UA6 A;  1IGU A;  4JLG A;  2EJG A;  1RLQ C;  4J6X A;  4Y28 E;  2EYY A;  1JJ2 S;  2E3H A;  2COY A;  1N8R C;  1YP5 A;  1NZ9 A;  2O01 E;  5GAM f;  2LQW A;  4RTZ A;  3S6W A;  1VQL A;  4M7A B;  2OX7 A;  3VUB A;  2JXB A;  2HBW A;  1NYG A;  1IB8 A;  3F70 A;  3CD6 A;  4HCZ A;  4C5H A;  2RMO A;  4C5E A;  1MMN A;  2ED0 A;  3M55 A;  2M0Y A;  1G2B A;  2DXU A;  2OAU A;  4AFZ C;  3AT1 B;  2DX1 A;  2J6O A;  2CP6 A;  3EGX A;  2FRW A;  1YHQ A;  1QVF S;  1D0Z A;  2DMO A;  2X9H A;  3CBM A;  1CKA A;  3I55 Q;  4IUT A;  1KQS P;  2RI3 A;  3QXE B;  3CCE T;  1H92 A;  4ELZ C;  4KRT A;  1PG5 B;  2ZPI B;  1JU5 C;  1WXU A;  1J3T A;  5CKB A;  2NUT B;  2V8J A;  1UDL A;  3SFM A;  2FRY A;  5I2S A;  1K9M U;  1BCM A;  3U23 A;  3WXM B;  1RAC B;  2ZGW A;  2KGT A;  3QHS A;  2DJZ A;  5GAN 5;  1QKX A;  4L6V 5;  4DEX A;  2LDM A;  3M57 A;  4M7A C;  4M78 C;  5EC7 A;  1TWB A;  3IQL A;  1N27 A;  1LVK A;  2H3J A;  1M2V B;  1XJW B;  4EDU A;  2QQ9 A;  2DXT A;  1WHJ A;  2X3W D;  3CCQ A;  2DYB A;  5I11 A;  3RKX A;  3DLL A;  1I5L A;  2NUZ A;  3JB9 J;  5GAN h;  4E6R A;  1D09 B;  2EWN A;  4JRQ A;  3CCV A;  3RER A;  4EIK A;  3Q1J A;  2M0O A;  4JDS A;  2NYS A;  4MZT A;  2QEX A;  4OMQ A;  2DZ9 A;  2LNH B;  2ED1 A;  1VA7 A;  2RHI A;  2BTT A;  1QWE A;  3MEU A;  3EGX B;  2EYW A;  3QO3 A;  4JUV A;  1XTD A;  1Y96 B;  3L2Q A;  2PUO B;  1RI0 A;  2GFA A;  3SWN B;  3OYM A;  1M2O A;  5KCO A;  4J9C A;  4RTU A;  1RAF B;  1YNZ A;  4IUV A;  1VQP A;  4J9H A;  2FL7 A;  5CQY A;  2JS0 A;  1QKW A;  1BI2 A;  3M0U A;  3CPW A;  2AZV A;  5GAO q;  1B7T A;  4F16 A;  1Q86 U;  4BY6 B;  3JB9 D;  3CC7 Q;  1G5V A;  2DL5 A;  5KYU B;  1S72 T;  1K8A R;  3OS1 A;  2L89 A;  2RJC A;  3HFN A;  3EG9 B;  2YWW A;  3HHT B;  1YWP A;  5GJV B;  4MZP A;  2OTJ T;  2KQW A;  2L3S A;  2YUQ A;  1FWZ A;  4PJO G;  1YIJ Q;  1W2B P;  1M1G A;  2RN8 A;  2XDD A;  1VOM A;  1AT1 B;  1VQ5 Q;  2V8I A;  2CP2 A;  4FYW B;  3GNF B;  4HCK A;  4M75 F;  2EQI A;  3OYE A;  3PTA A;  4CC3 A;  3CCM T;  1Q7Y R;  2K2M A;  1X69 A;  2EYZ A;  3PVL A;  3JAM E;  3THK A;  1Q82 R;  3OYB A;  2YDL A;  2BIV A;  5D7U A;  4M78 B;  3CXC S;  2D6F A;  1SSH A;  3L2W A;  5LJ3 h;  3BDL A;  2FPD A;  2BZX A;  2C06 A;  2KI7 A;  3CME A;  1MMG A;  4ATO A;  3CCQ T;  1YJN Q;  5LJ5 d;  1V76 A;  5D6X A;  3G71 A;  1CKB A;  1M2V A;  2GGR A;  2DRM A;  4LDY A;  4ZGD B;  1X27 A;  1H8K A;  4F7U G;  4RTX A;  3V7S A;  4JRK A;  1NPR A;  2MPX C;  1WLP B;  4LXC A;  3QPH A;  2PVO B;  5I21 A;  5KYY B;  3AHU A;  1M8M A;  1JRI A;  3M0Q A;  2GCX A;  4C92 C;  4HCC A;  1O9S A;  1WA7 A;  3UDC A;  1VQN T;  3M0S A;  3TRE A;  1U3O A;  3OYD A;  4JRP A;  4OGE A;  4LNP A;  4FM4 B;  1M90 U;  4KT0 E;  3MEV A;  3T9N A;  4DEY A;  5IN1 A;  3DKM A;  5C0M A;  1QCN A;  2PQW A;  1KQ1 A;  1D3B B;  2EFI A;  3C4S A;  2EGE A;  4IUP A;  4M4Z A;  2K5L A;  3NHN A;  2QXF A;  3CMA A;  2VGM A;  2AKL A;  2VWF A;  1YCY A;  2YSQ A;  1ZBJ A;  1I1J A;  5M9O A;  1T3S A;  4F7U B;  5LJ5 e;  2F5K A;  4IUQ A;  4PJO B;  2DER A;  1Q7Y C;  1M3C A;  2X4J A;  2NUP A;  2QAS A;  1UGR B;  3PT9 A;  3CCL T;  4Q5W A;  1D0Y A;  3JCM d;  3OYI A;  1D1A A;  1FMV A;  3A8M B;  1ZA1 B;  3FIF A;  4M75 E;  2RI2 A;  1SRM A;  1MV3 A;  3DLM A;  1YIJ T;  3OSS C;  2YUN A;  3V8K A;  1UGV A;  2FG0 A;  4M75 G;  4CRI A;  4C0D B;  2KBT A;  4QW2 A;  1IRE B;  2R5A A;  4BY6 C;  2JOY A;  1VQN A;  2M02 A;  1K76 A;  1SF9 A;  2Z0W A;  5D6Y A;  2KR3 A;  1WJR A;  4C92 A;  3J81 E;  4XU0 A;  1GRI A;  3A8O B;  2FZC B;  1M27 C;  1LJO A;  2KNB B;  3JB9 H;  4PJO C;  2PUK B;  3KFV A;  4C92 E;  2KDS A;  3HFO A;  3CQT A;  4R0K A;  2P0P A;  4M78 F;  1PWT A;  2QAZ A;  2LJ1 A;  5ECA A;  2QI2 A;  1VQ6 A;  3VS0 A;  2X4W A;  1ABO A;  2E65 A;  3OBY A;  1RAH B;  4LD9 K;  7AT1 B;  4JJC A;  2QK0 A;  2DFU A;  5GAN f;  2J7I A;  5HK3 A;  2DL3 A;  1C0M A;  3HSB A;  2RQU A;  2Y90 A;  1SHG A;  3PNW C;  3SB2 A;  2X4X A;  4WCI A;  4OMM A;  5HY6 A;  4DOV A;  4LDX A;  1FYN A;  2GQI A;  2PNI A;  2XIC A;  1VYU A;  2DEQ A;  3DB3 A;  2DXB A;  3O8V A;  4X1V A;  1U5S A;  2QGG A;  1VQ4 T;  2P84 A;  4OMN A;  3JB9 I;  2A37 A;  2PVG B;  2XG8 D;  4F04 B;  2QQR A;  4F7U E;  3EHR A;  4OMP A;  4MDW A;  1JEG A;  2RD1 A;  2X3X D;  1ZHI A;  1Q81 R;  3QWY A;  3PIP A;  1VQM A;  5CK9 A;  2CUD A;  1SRL A;  2KRO A;  1NBE B;  3CXC P;  2E5Q A;  5LJ5 g;  1R77 A;  1ZSG A;  4O5V A;  2FEI A;  3G71 Q;  4J9B A;  1HYO A;  3JRZ A;  4FSX A;  3H8Z A;  4N0A C;  1E7O A;  4PJL A;  5GAM d;  2JTM A;  2VVK A;  4ZTF A;  1W70 A;  2J06 A;  3G4S A;  4M77 E;  2YXY A;  4M7A G;  1KHC A;  1OU9 A;  4JRI A;  4F7U A;  1VQ5 A;  1WHH A;  2EQK A;  3FDR A;  3H0F A;  4C5I A;  2R58 A;  5J3B A;  1B07 A;  5FLX E;  5GAM j;  3M5A A;  3MP6 A;  4II1 A;  3VYH B;  4HT9 A;  2ZZD A;  1YIJ A;  4OMO A;  4FYY B;  2DK3 A;  3UPU A;  2V26 A;  3G4S Q;  1IXD A;  1G3W A;  2J6F A;  1I0C A;  1M1K U;  4PJO F;  4QKU A;  2QDY B;  2BUD A;  4XU1 A;  2RO0 A;  2YLB A;  2GFU A;  4PK4 A;  4E7Z A;  4E7L A;  1AOJ A;  3LYI A;  3UT1 A;  4M7D G;  1TUC A;  1VQ9 A;  1C1A A;  1LOJ A;  1RAE B;  2HL5 C;  3VS1 A;  2GBQ A;  4GY5 A;  1YIT Q;  4HA8 A;  2LQ8 A;  4J5Y A;  4BE2 A;  4NOY A;  1IRX A;  3L2Z A;  4J9G A;  4ZGE B;  4A63 B;  1BI1 A;  2ECZ A;  3OYL A;  1VQM Q;  4A4K A;  5FU7 B;  3RMS A;  5CIU A;  1ZA2 B;  1BIB A;  3RDV A;  1TS9 A;  1TUD A;  2A08 A;  2D0N A;  4NL3 A;  2KK4 A;  2GQV A;  3OYN A;  1YJW T;  1VQO T;  2PU9 B;  1G3S A;  1KG1 A;  1VQ7 T;  2BZY A;  1Y71 A;  5GJW B;  1PRL C;  4EMH A;  5DLO A;  4ORZ A;  1I81 A;  3VU3 C;  4XTW A;  1IZ6 A;  2M51 A;  1V29 B;  3CCE Q;  1IHV A;  1AZG B;  2RPN A;  1OPK A;  2H8H A;  3JCM X;  1D1B A;  2O9S A;  4PKC C;  1YHQ T;  4J7F A;  1VYT A;  1PRM C;  5EG2 A;  3VKI A;  5IXB A;  3REB B;  3MP1 A;  4MMK A;  3NTK A;  4R55 A;  3CC7 T;  3CEY A;  4ELY C;  1K73 U;  1RAA B;  3G71 T;  4JS5 A;  4AG2 C;  3CCJ A;  5HKC A;  1P92 A;  1VQ6 Q;  4B9W A;  2E41 A;  5GMK i;  5GAO l;  3J80 E;  1S72 Q;  4XTZ A;  4LD6 A;  3QG1 A;  2GTO A;  1QVG A;  4JJB A;  1QVF A;  2M1H A;  2JW4 A;  2QEX T;  1QCO A;  3CCM A;  2WSE E;  3QDR B;  4A4H A;  1YIT A;  3C12 A;  1VQN Q;  4A54 A;  4PNO A;  4GLM A;  2HCK A;  3MPU B;  3PMI A;  4A4E A;  1YHQ Q;  4TVR A;  4CI0 C;  4JZ4 A;  2L3R A;  3EH2 A;  2JM9 A;  1NJI R;  3QYH B;  2LJ3 A;  1K9M R;  1SSF A;  2M16 A;  2NWM A;  5KH6 A;  4PJO E;  2RQW A;  4EPC A;  3X24 B;  4N4G A;  5LJ3 e;  1AWJ A;  1QVP A;  1BYM A;  4LUD A;  4XK8 E;  2K3B A;  1VQL Q;  2ROT A;  1JXO A;  2EYQ A;  3FLG A;  1NYF A;  4J9I A;  2KRS A;  4XTV A;  1GBQ A;  3L2U A;  3HRS A;  1W4S A;  1TU0 B;  2D1X A;  3VS4 A;  2C0O A;  3ME9 A;  2V1R A;  1YWO A;  3LW5 E;  2O4X A;  3REA B;  3CMA Q;  3OMG A;  4M75 C;  4M7D C;  2NUP B;  4FT4 A;  5FU6 C;  2FYK A;  2L2P A;  2QG9 B;  2F1L A;  2ABL A;  1YCS B;  3QZ9 B;  2HKN A;  4Z02 A;  4FU6 A;  5GAN 7;  2QTV A;  4ANJ A;  1Q86 C;  3JCM J;  3HP9 A;  1RUW A;  2DVE A;  3E2U A;  3HL8 A;  2A7Y A;  2COW A;  4C92 D;  3TEE A;  3R6N A;  4Z8A A;  2VAS A;  1X01 A;  4EMK A; 
#chains in the Genus database with same CATH homology
 2GCX A;  3M54 A;  1K73 C;  2KAF A;  2XKO C;  3QII A;  5LJ5 f;  1U1S A;  4C92 C;  3OW2 S;  1O9S A;  2IG0 A;  5L8R E;  4MZM A;  1OYX A;  2MWO A;  3UDC A;  5CAI A;  3CCR T;  5D6W A;  2K5I A;  2EAY A;  4C8Q D;  1VQN T;  3TRE A;  2RHU A;  4DQ2 A;  2MI6 A;  3OYD A;  3S3M A;  3E9F A;  3BFM A;  4M77 B;  3X25 B;  3R6O A;  2XDP A;  5KCH A;  4JRP A;  4OGE A;  4OVA A;  1M1F A;  3V8L A;  4FM4 B;  1M90 U;  1KHI A;  2DTO A;  3MEV A;  3LGF A;  4KT0 E;  4RCC A;  4WF2 A;  3T9N A;  1YIT T;  3SWN A;  3S3N A;  3BDU A;  4L5G A;  5IN1 A;  3DKM A;  3HPW A;  3G6E A;  1YI2 A;  4BI3 A;  1RL2 A;  4BDZ A;  4E7I A;  1BKB A;  5C0M A;  2RHX A;  5CQX A;  3SWN C;  2PQW A;  4KBM B;  1KQ1 A;  1Y7X A;  1D3B B;  4BAC A;  2YHT A;  5GAN 4;  1EIF A;  5GAN 6;  3H6Z A;  4OP0 A;  2EFI A;  3VUZ A;  3C4S A;  3CC4 T;  2E64 A;  1HK9 A;  1QW1 A;  2LCC A;  2FHD A;  2K5L A;  3NTH A;  4IUP A;  2QXF A;  5GAM e;  2O4X B;  3CMA A;  1VQK A;  3LH0 A;  3OBW A;  5LL6 S;  2JVV A;  2E70 A;  2VGM A;  1UEB A;  3INZ A;  3GPL A;  3RUX A;  4BI8 B;  4BE1 A;  1K8A U;  4PJO A;  1YCY A;  3S3O A;  2XDB A;  3QBY A;  2E6Z A;  3ER0 A;  5M9O A;  1VQ4 A;  2LCL A;  4M7D B;  3QJ6 A;  2QA4 T;  2DPP B;  2QQS A;  3M56 A;  2LX9 A;  4F7U B;  5LJ5 e;  3CCS T;  5LJ5 h;  1KC8 C;  4OB1 B;  3MHX A;  2DXC A;  3CCV T;  2RA2 A;  4ZGJ B;  4BE0 A;  3CCL A;  4OB3 B;  2F5K A;  4IUQ A;  4XTY A;  2RH2 A;  4PJO B;  3EFR A;  3JCM h;  3VYG A;  1WPY A;  1Q7Y C;  2I2L A;  2QA4 A;  1M8V A;  3MP8 A;  1M4Z A;  2X4J A;  4MML A;  4C8Q C;  2AHJ B;  1O75 A;  1UGR B;  2LNV A;  2WSF E;  3PT9 A;  1VQ9 T;  2VGN A;  3CCL T;  4A53 A;  4Q5W A;  1VQK T;  2CGH A;  1H64 1;  4X9C A;  3JB9 G;  1UB4 A;  2JN0 A;  4JLI A;  2JZ2 A;  3I56 A;  4A4F A;  3JCM d;  3OYI A;  4OB2 B;  4M7A F;  3CME T;  3A8M B;  1R8O B;  3LWI A;  3FIF A;  1N6A A;  2RI5 A;  2QQA A;  3A5Z B;  4M75 E;  4XU2 A;  5AYF A;  3N5B B;  3X20 B;  2RI2 A;  1I8F A;  2WSC E;  3EFS A;  3OW2 A;  2ZPH B;  1YJW A;  4PLL A;  3DLM A;  2PVD B;  5DLQ E;  5I2M A;  4C8Q B;  2LT4 A;  2DAQ A;  3OSS C;  2KY9 A;  5A0D A;  1YIJ T;  4FIB A;  1BIA A;  3JCM Q;  1VIF A;  3V8K A;  4M77 G;  4XQ3 A;  5CKF A;  1NE8 A;  4M75 G;  4BB7 A;  4C92 B;  4CRI A;  5CO7 A;  3OMC A;  4M75 A;  4C0D B;  5A2Q E;  4QW2 A;  2RM4 A;  1IRE B;  2R5A A;  4M7D C;  1VQ8 A;  3MEW A;  3PMT A;  3X28 B;  5LJ3 d;  3QUI A;  4BY6 C;  4E7H A;  2HD0 A;  2JOY A;  4QQD A;  4FL6 A;  2K3X A;  1Q82 C;  1X75 C;  1VQN A;  4J83 A;  3OYH A;  5D6Y A;  2CZ6 B;  3JCM f;  2K3Y A;  4J6Y A;  1WJR A;  2DKG A;  2NLU A;  1NJI C;  3QYG B;  4C92 A;  4NS5 A;  4PL6 A;  3J81 E;  3URG A;  4XU0 A;  2KVQ G;  2XI9 A;  4M75 B;  3CC2 A;  3A8O B;  4EMK C;  1KQ2 A;  4IKF A;  5GMK l;  2K5F A;  1LJO A;  3JB9 H;  4LDV A;  2K57 A;  4PJO C;  3A8L B;  4D6W A;  2PUK B;  4C92 E;  2KDS A;  3HFO A;  4E7K A;  1S72 A;  2P0P A;  2LTO A;  4M78 F;  3BY7 A;  1W2B S;  1QVG S;  2G3R A;  2QI2 A;  2RJD A;  1VQ6 A;  1WNL A;  2X4W A;  5HK0 A;  2B8A A;  2CZ7 B;  3M59 A;  3OS5 A;  4XTU A;  3CXC A;  2E65 A;  3OBY A;  5FRO A;  4IUU A;  5GMK j;  1N9R A;  4C0Z A;  4LD9 K;  1M9S A;  1D3B A;  1B34 A;  3A8G B;  3L42 A;  4YTL A;  5GAN f;  3ASK A;  1VQ7 A;  2OTL T;  2VV5 A;  1OZ3 A;  5HK3 A;  2JUF A;  3OS2 A;  1VUB A;  3HSB A;  3FRN A;  3CPF A;  4ZTJ A;  4KUL A;  1KQS S;  1K9M C;  2Y90 A;  5C6S A;  3PNW C;  3SB2 A;  2X4X A;  5LJ3 j;  1KD1 U;  5HY6 A;  4DOV A;  4LDX A;  5CVI A;  4RKU E;  5LJ5 j;  2DTI A;  2DEQ A;  2XIC A;  3DB3 A;  2DXB A;  3O8V A;  3JCM V;  3CCS A;  3CCU T;  4A4G A;  4M7D A;  1VQ4 T;  4UC4 A;  3L2V A;  3E1S A;  3GF5 A;  4VUB A;  4PJO D;  1N8R U;  1VQ8 T;  3P8D A;  2Y4Y A;  3JB9 I;  2YLC A;  4QQG A;  4C8Q G;  2PVG B;  4RMO A;  2DIQ A;  3CCE A;  1LNX A;  2XG8 D;  5DY9 A;  5KE2 A;  1UGP B;  3E19 A;  2YRV A;  4E7J A;  4M7D E;  2ZPE B;  2QQR A;  4F7U E;  2K4Y A;  2VXF A;  3JCM e;  4GLK A;  3MEA A;  1VQ6 T;  2D9T A;  3V7R A;  3JCM W;  4MDW A;  1PSF A;  2RD1 A;  2XK0 A;  4HT8 A;  1Q82 U;  1ZHI A;  5GMK h;  3X26 B;  4M77 F;  1YI2 T;  2LC4 A;  3RMQ A;  2ZPG B;  3OQ5 A;  3PIP A;  1VQM A;  5CK9 A;  4J8O A;  5GMK m;  2MF2 A;  4LDW A;  3SD4 A;  2CZ1 B;  1Y07 A;  2A3L A;  3CBO A;  4JS4 A;  2DD4 A;  3GIB A;  1NPP A;  1OI1 A;  2E5Q A;  1K8A C;  2QQB A;  3NTI A;  1FX7 A;  5LJ5 g;  2LQK A;  5GAM h;  3CD6 T;  2HQX A;  3TCJ A;  1XNI A;  5LJ3 g;  2KMT A;  4NL2 A;  1G3Y A;  4O5V A;  3OYJ A;  1KC8 U;  3M4Y A;  1YJN A;  3QZ5 B;  3JRZ A;  3QSU A;  4FSX A;  5J26 A;  2XHC A;  3H8Z A;  4BUG A;  4N0A C;  5GAO r;  3RKW A;  5CKD A;  1VQM T;  4X9D A;  1QP3 A;  2LT1 A;  1WJS A;  1XOV A;  5GAM d;  2JTM A;  1Y96 A;  4L59 A;  4M75 D;  5GAN d;  4M7D F;  2CZ0 B;  2R5M A;  4F7U F;  5GAN 3;  4FT2 A;  3PIO A;  3QKJ A;  3PFS A;  4ZTF A;  1VQO A;  4M7A E;  4B9X A;  1M5Q 1;  3P8B B;  2HNI A;  2EQM A;  3J7A F;  4BDY A;  2L8D A;  3SDZ A;  3OYG A;  1KD1 C;  3G4S A;  4M77 E;  3I56 T;  4JLG A;  4V2S A;  1YBY A;  2VYT A;  2EJG A;  2P4T A;  4M7A G;  4XU3 A;  4C8Q E;  1KHC A;  4JRI A;  4M7A A;  3QJY A;  4J6X A;  4Y28 E;  3VJP A;  4F7U A;  3I55 T;  1VQ5 A;  3FDR A;  2EQK A;  2XID A;  4C92 G;  1JJ2 S;  4C5I A;  5FLX E;  2R58 A;  2RJF A;  5J3B A;  3DB4 A;  2V8K A;  5GAM j;  1N8R C;  2DTH A;  3M5A A;  3MP6 A;  2K2V A;  4II1 A;  1U1T A;  1NZ9 A;  3M58 A;  2O01 E;  3VYH B;  5GAM f;  3LWH A;  4HCB A;  4HT9 A;  2ZZD A;  3WVE B;  2LVM A;  1ZQ1 A;  1H3Z A;  1YIJ A;  3S6W A;  4MDX A;  1VQL A;  4M7A B;  2ZPF B;  4DA4 A;  1G3T A;  4P5N A;  3VUB A;  1MHN A;  4O6J A;  4ME7 A;  1BI0 A;  2D0Q B;  2DK3 A;  3UPU A;  4RCB A;  3F70 A;  1WGS A;  3CD6 A;  4HCZ A;  4C5H A;  3JCM P;  5GAN 2;  4C5E A;  3OYK A;  4C92 F;  1YJ9 A;  5CKH A;  1G3W A;  3M55 A;  3CC7 A;  4DOW A;  2DXU A;  2OAU A;  2QTX A;  3ZEH A;  1UGQ B;  1M1K U;  4XAX B;  4PJO F;  4BI4 A;  5GAN g;  2CKK A;  2QDY B;  5CCA A;  2BUD A;  2E12 A;  2FB7 A;  2RO0 A;  4M77 A;  4X34 A;  4XU1 A;  2EJF A;  2YLB A;  1YHQ A;  1QVF S;  3NFC A;  2GFU A;  4E7L A;  2P0K A;  3CBM A;  3LYI A;  3UT1 A;  5A0G A;  3GLX A;  2OTJ A;  4M7D G;  3CC2 T;  3M4G A;  1VQ9 A;  3PGG A;  3FB9 A;  4IUT A;  1UGS B;  1LOJ A;  2RI3 A;  3QXE B;  3CCE T;  4QVZ A;  1WQW A;  3JCM b;  2MAM A;  4ELZ C;  2DIG A;  5GAO p;  3A8H B;  4GY5 A;  2ZPI B;  4HA8 A;  2LQ8 A;  1GXI E;  4J5Y A;  4BE2 A;  5CKB A;  5J39 A;  3GP8 A;  2V8J A;  4NOY A;  3L2Z A;  1B34 B;  3E9G A;  3SFM A;  4ZGE B;  5I2S A;  1VQ5 T;  1BI1 A;  4QVD A;  4M78 A;  3OYL A;  1K9M U;  1Q81 U;  3JCM c;  4A4K A;  5FU7 B;  3RMS A;  3WXM B;  5CIU A;  1BIB A;  2FVU A;  2ZGW A;  4XTX A;  3QHS A;  2DJZ A;  2EQU A;  5A0L A;  2KK4 A;  2GQV A;  5GAN 5;  4NL3 A;  3OYN A;  4L6V 5;  1YJW T;  1VQO T;  2PU9 B;  1G3S A;  2LDM A;  3V8J A;  1KG1 A;  3M57 A;  3FC3 A;  3OYF A;  4M78 C;  2Y4X A;  1Y71 A;  1VQ7 T;  4M7A C;  3HRT A;  4EMH A;  1N27 A;  5DLO A;  3CMA T;  2EJ9 A;  3GOX A;  1I81 A;  2H3J A;  2ZPB B;  3EAE A;  4XTW A;  3VU3 C;  1IZ6 A;  1YJ9 T;  2F69 A;  2DD5 A;  1V29 B;  2ZCF B;  4QQ6 A;  3JCM g;  3P8H A;  4EDU A;  2QQ9 A;  2P0Q A;  2DO3 A;  3CPW S;  3JSC A;  2DXT A;  3JCM X;  2EKO A;  2CS7 A;  2L5Q A;  4Y91 A;  4E47 A;  4PKC C;  1DJ7 B;  4J7F A;  1YHQ T;  3G6E T;  3CCQ A;  1XQH A;  4HKE A;  4M77 C;  3GNG A;  5EG2 A;  3VKI A;  5IAY A;  1U8R A;  3MP1 A;  4OGC A;  4N0A A;  3RKX A;  4MMK A;  1TH7 A;  4C5G A;  3DLL A;  1VQP T;  3HRU A;  5GMK e;  4PLI A;  4OMF B;  1I5L A;  3JB9 J;  3NTK A;  5GAN h;  4R55 A;  5GAN e;  5IT9 E;  3CC7 T;  2EWN A;  4M77 D;  3CEY A;  3ZBD A;  4ELY C;  4JRQ A;  3OSV A;  4C0G A;  2E6N A;  4N4I A;  3CCV A;  3FEO A;  3G71 T;  1K73 U;  3RER A;  1HXD A;  2RHY A;  3KXT A;  3CCR A;  4JS5 A;  3CCJ T;  2RHZ A;  3Q1J A;  4EMG A;  3CCJ A;  4M7A D;  5HKC A;  2M0O A;  4JDS A;  1P92 A;  2CYZ B;  4MZT A;  4B9W A;  4ZN3 A;  2E41 A;  2QEX A;  2XD0 A;  5GMK i;  2M9U A;  5GAO l;  1PSE A;  3J80 E;  2DZ9 A;  3MO8 A;  1WJQ A;  4XTZ A;  3L2R A;  3CC4 A;  2MWP A;  1M90 C;  4LD6 A;  3QG1 A;  4J6W A;  2RHI A;  3MEU A;  1W2B A;  1QVG A;  1QVF A;  2M1H A;  3QO3 A;  2QEX T;  3LX7 A;  4JUV A;  2X4Y A;  4M78 D;  4C8Q F;  1XTD A;  1Y96 B;  2WSE E;  3OYY A;  3BW1 A;  3QDR B;  3CCM A;  3L2Q A;  2PUO B;  4A4H A;  1Q81 C;  1RI0 A;  1VQL T;  2HBP A;  2GFA A;  3SWN B;  3OYM A;  1YIT A;  3C12 A;  2GF7 A;  1I4K 1;  5KCO A;  3OYA A;  1JBM A;  3FJP A;  3M9Q A;  4IUR A;  1WQ7 A;  4IUV A;  2JTF A;  4A54 A;  4N4H A;  4PNO A;  1OZ2 A;  3I55 A;  1VQP A;  2FL7 A;  5CQY A;  1FXX A;  3PMI A;  4A4E A;  2WAC A;  1BI2 A;  4TVR A;  3MCA B;  4CI0 C;  3CPW A;  2RK1 A;  2L3R A;  5GAO m;  4LDU A;  5GAO q;  2LRQ A;  1JB0 E;  3RIR A;  1Q86 U;  4BY6 B;  3MET A;  2MMP A;  3JB9 D;  4RG8 A;  2OTL A;  3L1A A;  5KE3 A;  3QYH B;  4KUD K;  1G5V A;  1SSF A;  1Q7Y U;  1S72 T;  2M16 A;  2JNG A;  5LJ3 f;  5KH6 A;  3OS1 A;  5DM7 R;  4PJO E;  2L89 A;  2RJC A;  3HFN A;  1AHJ B;  4OB0 B;  5GAO n;  4OF1 A;  4EPC A;  3X24 B;  3HHT B;  4M78 G;  2VXE A;  4N4G A;  4MZP A;  5LJ3 e;  2OTJ T;  1QVP A;  2KQW A;  5GAN 8;  1KQS A;  1BYM A;  1QP2 A;  4XK8 E;  3OYC A;  2HQE A;  1M1K C;  3TU4 K;  1FWZ A;  4PJO G;  2RJE A;  4BD3 A;  1X6O A;  2DZC A;  2EYQ A;  3FLG A;  2RB6 A;  1M1G A;  2XDD A;  4XTV A;  5FU7 C;  5CR2 A;  3L2U A;  4C8Q A;  2XU8 A;  5GAN j;  3HRS A;  5FRN A;  1W4S A;  2V8I A;  3UWN A;  3ME9 A;  3GNF B;  4M75 F;  4M7D D;  3OYE A;  4HCC A;  3PTA A;  3LLR A;  2O4X A;  3LW5 E;  2X35 A;  3OMG A;  5FU6 B;  3CCM T;  2EQJ A;  4M75 C;  4C0F A;  3OS0 A;  3JAM E;  1JJ2 A;  1BI3 A;  3OA6 A;  3M53 A;  3OYB A;  3KUF A;  2BIV A;  2EIF A;  3RES A;  3G7Z A;  4M78 B;  3VV0 A;  3CXC S;  5GAM g;  1NJI U;  4FT4 A;  2D6F A;  5FU6 C;  2BKD N;  3L2W A;  5LJ3 h;  3C95 A;  4RG2 A;  3BDL A;  2FYK A;  3KBG A;  2C06 A;  1ZBX A;  3V7C A;  3QZ9 B;  4C0D C;  3CME A;  3WVD B;  2RK2 A;  2VUB A;  3CCU A;  4ATO A;  4Z02 A;  3JB9 F;  4FU6 A;  2E1H A;  3CCQ T;  5LJ5 d;  5D6X A;  5GAN 7;  4J7I A;  1MGQ A;  3ZFJ A;  3G71 A;  3C94 A;  2VC8 A;  5FRM A;  2HAX A;  1Q86 C;  3G4S T;  3JCM J;  4QVC A;  4LDY A;  4JJN K;  3HP9 A;  3LGL A;  4ZGD B;  4F7U G;  4R56 A;  3RKY A;  4EMK B;  1N9S A;  2E10 A;  2F5T X;  2KSS A;  3V7S A;  4JRK A;  2DVE A;  2IVW A;  1NPR A;  3CBP A;  4KUI A;  4M78 E;  3OY9 A;  4ZN1 A;  5CKE A;  2R57 A;  3HL8 A;  2A7Y A;  3QPH A;  1VIE A;  2PVO B;  3OB9 A;  3TEE A;  4C92 D;  1YJN T;  5I21 A;  3HKS A;  3AHU A;  1JRI A;  1X01 A;  4EMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...