3LW5E

Improved model of plant photosystem i
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
64
structure length
64
Chain Sequence
IGPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIVEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
total genus 1
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lw5E00
2CZ7B 2PUOB 1UGSB 3A8GB 3X26B 2CZ0B 3A8LB 4OB2B 2ZCFB 1V29B 5L8RE 2D0QB 2ZPFB 3X20B 1QP2A 2QDYB 3A8OB 3QZ5B 1AHJB 1IREB 2ZPEB 4FM4B 1UGQB 2DXBA 2DXCA 2CZ6B 3LW5E 1PSEA 1GXIE 3WVDB 4L6V5 3X28B 2CZ1B 2AHJB 2ZPGB 2PVDB 2WSCE 3QXEB 3QZ9B 2DD5A 1UGRB 2CYZB 2PVOB 3X24B 4OB1B 4XK8E 2ZPIB 1DJ7B 2ZPHB 2ZZDA 3VYHB 2ZPBB 4OB0B 2PVGB 1JB0E 3VYGA 3A8MB 1PSFA 2PU9B 4ZGEB 2WSEE 3QYGB 4ZGDB 1UGPB 3HHTB 4KT0E 2O01E 4RKUE 4Y28E 1QP3A 2WSFE 2PUKB 3QYHB 4ZGJB 4OB3B 2DPPB 3WVEB 3X25B 3A8HB 2DD4A
chains in the Genus database with same CATH superfamily
5GAOn 5KYYA 4P5NA 4J9FA 1TSFA 3CCVT 3MPUB 3HFNA 3I55A 3JB9G 2KT8A 4C5EA 2P0PA 4E7IA 2O9SA 1RAFB 1BKBA 2KBTA 1V29B 2YUOA 4HCCA 1YHQA 3CC2A 2FHDA 1WHJA 1ZUKA 1B07A 3QWXX 1BIBA 1PWTA 3CPWS 3RBBB 5J3BA 1KK7A 1VQ7A 4EMKA 4J9GA 3OS0A 1YJ9A 3L42A 2C0OA 2RJCA 2LC4A 1VQ4T 1AEYA 2DYIA 5CAIA 1VQNQ 1YJWA 1SSFA 4E7ZA 4FW1A 1VYTA 4DEYA 4J8OA 1JU5C 1QVGA 1M1GA 1SHGA 1MUZA 3M54A 1X69A 1WXBA 1IGQA 1QLYA 1D0XA 2AKKA 3TVTA 4AT1B 2GCXA 1TG0A 3RMSA 4XU1A 3FB9A 3I56Q 4QT7A 1KQSS 4C92E 4RTZA 3HRUA 1M90U 2CP7A 5DLOA 2X4YA 1KC8U 1X75C 2QEXT 2EFIA 2FVUA 2OTJQ 3H9NA 1WLPB 5GMKh 4PKCC 4M7AB 1EIFA 2E4HA 2FZCB 2OAUA 2DFUA 2M0OA 5GANf 1VQ8A 5CKFA 2DPPB 2XU8A 3HRSA 1ZUUA 4JLGA 4JPBW 4QVCA 1YJNA 2RHIA 2JM9A 3UATA 4XTUA 2A3LA 2LZ6B 2GQVA 4PJOG 5C0MA 3ZEHA 3CCRQ 2ED1A 2HBPA 2Y4YA 2YLBA 3HL8A 1K73C 3OYGA 2PNIA 1WHGA 5KE2A 5HCKA 2LJ0A 4DOWA 2NLUA 5CKHA 1YP5A 1Q86R 3QUIA 1Q7YR 2K4YA 3M4GA 1UDLA 2OI3A 3QZ5B 2K9GA 2EKOA 2F1LA 1ARKA 1BCMA 1UEBA 4AFQC 1RAHB 5LJ3j 1WIEA 3DB3A 2LQNA 1UG1A 4ZN3A 2BZYA 5I2MA 2DXBA 5LJ5j 1ZHIA 5LJ3f 2V8JA 1M3CA 3UPUA 1VOMA 3OYMA 1NJIC 1ZA2B 2X4WA 4J9HA 1PSEA 3VU3C 5I21A 4QQGA 3EHRA 3UWNA 5FRNA 3MP1A 1T0JA 2KMTA 1X6GA 4N4HA 5FU6C 1ZBXA 1NYGA 1BI0A 4ZTJA 1K9MC 2CYZB 1K8AR 5KYYB 4JS5A 1HXDA 3SDZA 3PNWC 3OYDA 1UFFA 2ZPHB 4EMGA 2KDSA 1GCQC 3VYHB 1QWFA 4JJBA 4KULA 3EG9A 2P4RA 3QO3A 2DO3A 5D6WA 4BI4A 1W2BS 2J6OA 1MMAA 1IHWA 5FU7C 4EMKB 1PM3A 4MZMA 3CCMA 3PE0A 2J7IA 3VJPA 1RLPC 3CCVQ 1B34A 2L3PA 2LCLA 2VWFA 2WSFE 2LQKA 4J6WA 2GTJA 1WX6A 4BACA 1QCOA 3M5AA 2NYSA 1C6VX 1JRIA 2HEQA 3JB9J 5KH6A 2EYYA 2MI6A 3CCUT 2PUOB 1KIKA 4GLKA 4PFZA 1QCFA 3A1PA 4XU2A 2DILA 2IIMA 3HTRA 4MDWA 3M56A 4DA4A 1ZUYA 2JJ9A 3UA6A 1V1CA 4J83A 1VQLA 2KE9A 2KRSA 3X20B 3AT1B 2E70A 1VQ4Q 2EQUA 4OMPA 2EQIA 1OPKA 4M77G 2FZGB 4FM4B 1NPPA 3L2QA 2VGNA 1XQHA 1MV0B 2F5KA 3MP6A 1CKAA 4M78G 2JTFA 4J9EA 5GAOq 1G83A 3CC7A 3WVDB 1Y7XA 4ZN1A 5GJVB 1WNLA 3KXTA 2ENMA 1MMNA 5GAN8 4C8QA 2QQSA 3JCMe 2CP3A 4ZTFA 1K0SA 5LJ5e 3CPFA 2HQHA 2PZ1A 3KBGA 3QJYA 1BK2A 3CPWA 2QYZA 5IHKA 1H92A 1PRLC 1R0CB 4LUEA 4TVRA 3EFRA 2COWA 2SEMA 2K79A 1TTHB 3CCEA 2DVEA 3CD6T 4PJJA 2YUQA 3MHXA 3ZFJA 2XDDA 1K76A 1IZ6A 3A8MB 1IXDA 2A7YA 1T3SA 3PFSA 3JCMb 1TWBA 2RQVA 1SSHA 3JB9I 2RJDA 4RTWA 4MZPA 5GAN7 4C0GA 1NG2A 1PNJA 2RI5A 1WXUA 2P84A 3G6ET 3VS0A 4M75C 3AHUA 3FJ5A 1AT1B 4HXJA 5GANd 1NM7A 5IHNA 4CI0C 3LWIA 4F17A 2K57A 4BDZA 1EFNA 3CMEQ 1KQSA 3O8VA 4HVUA 1PRMC 5AT1B 3G71Q 2DJZA 3P8BB 1X01A 2M1HA 3GF5A 2MIOA 5J39A 4PK4A 1M3AA 1VQ9Q 2LP5A 3JCMV 1HYOA 4A4EA 1NE8A 1WDXA 2YRVA 3E2UA 4J7FA 3M55A 4PL6A 1FYNA 1QP2A 3U23A 2DTHA 4RG8A 4DBQA 1Q81R 1M1KR 1SRMA 2RA2A 2DKGA 1MV3A 1V76A 3EG9B 4M75F 5HK0A 1Q82C 1N9RA 2COZA 2QQRA 4ATOA 1VA7A 3H0HA 5GAOr 1RAAB 4JRPA 2OX7A 3QWYA 5A0DA 2VUBA 2DAQA 3V7RA 1MMDA 3L2VA 1UJYA 1TUGB 4M75A 3JCMc 2WACA 2LQ8A 2MMPA 3EFSA 2CZ1B 1TU0B 2VVKA 2CP5A 5CCAA 2DBMA 1KG1A 2K3XA 5J26A 4PJOE 1K73U 2PVOB 5GMKj 3S3MA 1Y96B 5KCOA 2LCCA 5FU6B 4PLIA 3PMTA 3RKWA 4Y92A 4J7IA 3FLGA 2CDTA 2JN0A 3CCSQ 4RCCA 1O75A 2QG9B 2MF2A 1D3BB 5IXBA 1PSFA 2HBWA 2EQKA 3CCJA 2BKDN 2EVRA 1VQNT 5GAMe 2V1RA 1PKSA 1NJIU 2OAWA 1OU9A 2NUTA 2JT4A 2QGGA 3G4SA 5KYUA 3TU4K 3CCUQ 3QYHB 4M7DG 3ULRB 4JRQA 2V8KA 3OW2S 3MO8A 2DD4A 1D1BA 3V7SA 5CKEA 4C8QB 3BFMA 2EPDA 1K9MU 4E7HA 1HD3A 3OYYA 4FYWB 3I56T 1YCYA 1G8XA 1SF9A 1I5LA 2YSQA 4DQ2A 1VIFA 1W2BA 4OB2B 3RUXA 2RI2A 2A28A 1JXOA 5CO7A 2OJ2A 4E7LA 3M0PA 1JBMA 4IUQA 1FX7A 1OZ2A 4KBMB 2RQRA 1WA7A 2F2WA 2A08A 4OGCA 4CC7A 2R57A 3PVQA 2LJ3A 2QA4A 2RHYA 4A4FA 4QVZA 3URGA 2L2PA 1OEBA 5DM7R 1K9AA 1TXQA 4F7UG 1M2OA 2AHJB 1VQ6A 3CCRT 1W1FA 3SB2A 3CD6Q 2LRQA 2E3HA 4M7DB 3OBYA 1RL2A 3P8DA 1U8RA 4J6XA 1PC0A 1UGVA 1UHFA 4J9CA 3DB4A 2HZYA 1SPKA 1YI2A 1JQQA 1N8RR 1S1NA 3CCLA 1T0HA 2FYKA 1WHMA 2XIDA 1YN8A 4IUVA 4LDUA 3G6EQ 1UE9A 1RLQC 4M77E 3QYGB 2DETA 1UGPB 4LXCA 2KXDA 3HHTB 3VS7A 3JCMW 2E41A 4E2FB 1I5OB 1VQMA 3VRZA 4M78E 2W10A 2F2VA 3CCVA 1RUWA 2M9UA 1BBZA 1NPRA 2DRMA 4OF1A 4M75B 3EG3A 5CQXA 3MCAB 4D8DA 4HVVA 2J06A 1KD1C 1UGSB 3OYCA 1XJWB 3A8LB 3BW1A 2ZCFB 2B8AA 4C0ZA 4DBRA 4RTYA 3CXCS 2M51A 2NUPA 1KHCA 2XKOC 1FMWA 2EJ9A 2F69A 4B9WA 3A8OB 3GNFB 1OZ3A 5A0LA 4M75D 5GMKm 3PIOA 1XTDA 2BZ8A 1ZBJA 2Z0WA 3EFOA 4RTVA 2K5LA 2XD0A 4MMKA 3MEUA 3BE3A 1VQKQ 2CUBA 2D9TA 1W70A 2NUTB 5KYUB 2B86A 4R56A 1Y07A 4PJOF 3VV0A 1ZSZC 2L3SA 5KE3A 2AKLA 4M7AG 1M1FA 1RAEB 2R58A 3BY7A 4NL2A 4PJLA 2RO0A 3GPLA 2DJQA 8ATCB 4AFUC 2QEXA 4HCBA 1LJOA 2M02A 2DRKA 4OMMA 1S72Q 1XOVA 3RDVA 2E10A 2DA9A 2JTEA 5GAOp 4MZTA 1Q82U 2COYA 1WQWA 1WPYA 2QQBA 2FRYA 4HCZA 2QTVA 2KT1A 1WZOA 2I0NA 1G2BA 3M58A 3THKA 5FWBA 2BTTA 4B9XA 3UDCA 2CH4A 2CP2A 1JJ2S 4EPCA 3UT1A 2DXTA 1H8KA 4C8QE 2EJFA 1AOJA 2PUKB 4ZGJB 1VQ5Q 2DERA 2KNBB 2X3WD 4XTVA 1HSQA 2EW3A 1K9MR 2YRCA 1Y0MA 3I5RA 4C5IA 3J81E 1B3QA 3EG1A 1C0MA 5GANj 1PD0A 1E7OA 1YITQ 3OQ5A 4LD6A 3REAB 3EG0A 4FCYA 3DLMA 2JOYA 2DZCA 2D0NA 2QDYB 4OGEA 4FIBA 1QVFP 2ESWA 2PQWA 1I0CA 4PFOA 2MCNA 3OW2A 3SD4A 3KFVA 1IHVA 2W0ZA 2QAZA 2FL7A 1M9SA 4M78C 1RABB 3CMET 3DKMA 4E7SA 1AD5A 4BI3A 3LLRA 5FRMA 1PHTA 3G71T 4M7DE 1SEMA 3CMAA 2EGAA 2YUPA 3OB9A 4JLIA 3QZ9B 1VQ9T 1OOTA 1B7TA 4X9DA 2VKNA 2KRMA 4J6YA 1EX4A 2L0AA 3MEWA 4XK8E 1FWZA 2L5QA 2ZPIB 1BU1A 4EDUA 5CKDA 4WF2A 4M77F 2HMAA 1BI1A 3QDRB 2NUPB 1YIJQ 1M2VA 2LNHB 1VQ8T 4M78F 1NEBA 3VS3A 2JMCA 1D1AA 3H41A 1SRLA 4E47A 3EFOB 3CCUA 3WXMB 3E1SA 4F7UE 3NFCA 1BI3A 1KQ1A 1VQPQ 4KGZB 3OA6A 4IKFA 4CRIA 3CCST 3OYEA 1BI2A 2CZ0B 2R5AA 2K2VA 3CBMA 3L1AA 2ZPFB 2X3XD 3RERA 2LDMA 1OU8A 2R5MA 3OMCA 1UB4A 4A4HA 1IREB 3RKYA 2HQXA 1QVPA 2HDAA 3A5ZB 3GP8A 3EH2A 5GANe 1QVGP 3JSCA 2K5FA 2RB6A 1VQOQ 3M0TA 1VUBA 2DYBA 3OYLA 4DEXA 3QHSA 3R6NA 4A63B 4C92C 3EGDA 3CCQQ 2QGFB 1Q86C 4PJOD 2LNVA 1Q7YC 1K4US 2EKHA 6AT1B 1X2QA 2PVDB 1GCQA 3CXCA 3LGFA 4RG2A 1KD1U 2OTLT 2KY9A 5HY6A 3CD6A 3X24B 1K1ZA 1NLPC 3TSZA 2VV5A 2ZZDA 4XQ3A 1I81A 4BUGA 4R55A 1VYUA 1KQ2A 3L2ZA 5LJ3e 4X9CA 2KRNA 3I55Q 4GLMA 2F5TX 4Z8AA 1AZGB 4C92F 1K8AC 5KYXA 3V8LA 2DL7A 1YFNA 1YHQQ 2CT4A 4RKUE 1X6OA 2LX7A 2IG0A 3G7ZA 1E6GA 5IHIA 4M4ZA 5D7UA 3A98A 4JDSA 2VGMA 3LH0A 4C92A 2I2LA 1G5VA 4XTZA 3OYFA 1RAGB 1M90R 1VQ7Q 4ANJA 4RTXA 3JCMP 5I2SA 2RNAA 1VQLT 4M7AE 3M0SA 2HSPA 5CKBA 3KUFA 1KC8R 1PKTA 2LQWA 4UC4A 1BB9A 4XTXA 2AT1B 1FMVA 2ABLA 2F2XA 3RMQA 1D1CA 1YBYA 1HK9A 1OYXA 1M4ZA 2NUZA 1P92A 2XMFA 4O5VA 1JJ2A 2RHXA 5AYFA 3V8JA 2JXBA 4PJNA 2V26A 2ECZA 1NBEB 7AT1B 1SHFA 2CUDA 1XNIA 3OYHA 2ZAEA 1M2VB 1R77A 2G6FX 3OS5A 4JJDA 3OYKA 4OMQA 2FZKB 1MNEA 1T3LA 4KUIA 1GXIE 2V8IA 1Y71A 4BE1A 2WSCE 2KSSA 3OYBA 1N9SA 4HT8A 3LX7A 1VQ8Q 2H8HA 4M77D 4C8QG 4LDYA 2EQMA 3L2UA 3F70A 1VQNA 4J9DA 2DEUA 1YJNQ 1B34B 5DLQE 4M78D 2YHTA 1H3ZA 3JCMd 4LN2A 3V7CA 3JRZA 2EQJA 1VQKT 2BZXA 3JCMQ 2DLPA 2JS0A 2GQIA 3TREA 1NEGA 3I56A 3TEEA 3EGDB 2M16A 4GY5A 2GNCA 4IUPA 2KK4A 2LJ1A 3EH1A 3JV3A 3VRYA 4DBFA 3REBB 2OTJA 1S72T 3V8KA 2VC8A 3MEVA 4RTTA 4BE2A 1PG5B 3JCMX 3T9NA 3M9QA 3OYIA 3OYAA 4RUGA 3OBWA 1N5ZA 1IB8A 5FU7B 3H6ZA 1OX9A 1M30A 1M8VA 2FO0A 2ZPEB 4E7KA 1G3WA 3JCMJ 3JCMh 5C6SA 3M4YA 1ZSGA 5GAN2 1U06A 2DE0X 2MAMA 3OS1A 3CCRA 4QW2A 3QSUA 4FU6A 3E19A 1VQ5T 5KYXB 2OTLQ 2QASA 1X6BA 2CZ6B 5FROA 3CPWP 5LL6S 2AZVA 2ROTA 2ZPGB 2E3IA 4MMLA 4JUVA 1UJ0A 1Q81C 1M1KC 4ELZC 3OYJA 3ZL7C 4C92B 3DLLA 1AVZC 2FG0A 2GBQA 3NMZC 3RESA 4IIOA 1KD1R 2LT4A 3S3NA 2JW4A 3CCMQ 1I1JA 2JS2A 1GRIA 4ZNXA 3H0FA 1YITT 4II1A 3VS5A 4M75G 1DJ7B 1WFWA 2QK0A 3SHWA 1ZLMA 5IAYA 1ZA1B 1KFZA 2ZPBB 3QIIA 4GBQA 2XDPA 2DL4A 2RHZA 3G4ST 4K11A 4PFPA 3ME9A 2CSIA 3JB9F 2PU9B 1RI9A 2RMOA 2YWWA 4C92D 1FMKA 1KQSP 1RAIB 3G1JA 1WHLA 2GFUA 1VQLQ 1Q86U 3NTHA 4M7AF 2AIRB 5CVIA 2KROA 2RD1A 1WQ7A 3PT9A 3X25B 3WVEB 1E6HA 2VB6A 2SRCA 2CZ7B 2EGCA 2V1QA 4RMOA 5ECAA 5GMKe 2X9HA 4FYVB 3META 4IUUA 3H0IA 3LH5A 2QDLA 3H8ZA 3M57A 3M53A 2AZSA 4X1VA 5GAMd 2EYWA 3O5ZA 4BD3A 1YIJT 2FB7A 4FT2A 4V2SA 3JCMg 2Y4XA 2E6ZA 4Y91A 1K8AU 4PJOC 5FW9A 1VQ6T 3M0UA 3CCEQ 1ZQ1A 3LW5E 4C5GA 1VQPT 1U5SA 1OQKA 3QG1A 2XDBA 2FRWA 1C1AA 2LT1A 2DX1A 4OMLA 3QXEB 1VQ4A 2L3QA 4KUDK 2DD5A 1MGQA 2HCKA 3QJ6A 3IQLA 4C0FA 2JMAA 4OP0A 4ORZA 3PVLA 5GAMh 2DF6A 2FPDA 4YTLA 2GFAA 4B6MA 2L89A 2RM4A 4FT4A 3RIRA 4E7JA 3VYGA 2KAFA 1VQMT 2BIVA 2YRDA 3PIPA 3NTKA 3RNJA 5GAOm 1VQOT 2D6FA 2O2OA 2CP0A 4F04B 3CCQT 3EGXA 3NGPA 4QVDA 3CC4T 1K73R 4PJOA 1NYFA 2O01E 1X27A 5IT9E 2DL5A 4DBHA 4Y28E 1N8RC 3D7SB 2EWNA 3S6WA 2BUDA 1CKBA 2DM1A 1QKXA 1W2BP 3OSVA 3SFMA 3FC3A 5KYWA 3OMGA 2EIFA 3C95A 1VYVA 3X26B 1QMCA 2O31A 2KEAA 1NJIR 3EHQA 2QQ9A 5CR2A 2JVVA 2O4XA 3I55T 4IIMA 2EBPA 4A54A 4JRKA 2LCSA 4JZ3A 3CMEA 1TUCA 2C0IA 2GTOA 1WI7A 1YHQT 4FSXA 4OMNA 3CC2T 1ZSZA 3FRNA 1R0BG 3G71A 5GMKi 1U1SA 2XG8D 1YWPA 2RN8A 4NL3A 1OX8A 4KH0B 3M0QA 2GGRA 1VQ9A 1VQ7T 2RPNA 1QW1A 1YJ9T 4HA8A 4Q5WA 3X28B 5KYNA 3Q1JA 3CCJQ 3R6OA 1I4K1 2O9VA 1YJWT 1BCOA 2DXUA 5GAMg 4M77C 3NHNA 5D6YA 1H3HA 3VS4A 2YT6A 3QPHA 1MNDA 4FYXB 3G4SQ 2IVWA 1NZ9A 2KQWA 1WJRA 2C06A 4XTWA 2HQEA 2CP6A 4OB0B 1LNXA 5CIUA 2A0FB 3JB9D 1OULA 1BIAA 3EGUA 4OVAA 3GIBA 2DVJA 1OV3A 2WSEE 2DZ9A 5GAN6 3HP9A 2Y90A 4ZGDB 3OS2A 3MEAA 4MDXA 5D6XA 2EJGA 4M7AD 1WJSA 4N4GA 2X51A 3GNGA 1PD1A 1Q81U 1M1KU 2XHCA 1UUEA 2P0QA 1GL5A 2GF7A 3CCSA 3A8HB 1N6AA 1NLOC 3C94A 4N0AC 2MWOA 3MKDA 2QA4Q 4A4GA 2E65A 5L23A 2EYQA 4M77A 4OMOA 4LE9A 3JCMf 2QI2A 3INZA 1YJNT 4M75E 2HSEB 1N27A 5LJ5f 5L8RE 3SEMA 1VQ6Q 2D0QB 1IO6A 4X34A 4HCKA 4M78A 1KJWA 2L3RA 1AHJB 3BDLA 1GFCA 4Z89A 2A37A 3L2WA 2KVQG 1X2KA 4XU0A 3CMAT 1UGQB 4AFZC 1YI2Q 4QQDA 3CCLQ 2PTKA 3PMIA 3EGXB 2VXFA 4PJOB 4BY6C 2OTLA 2IPOB 2QQAA 1R8OB 3LYIA 2CT3A 2KYBA 1M3BA 4F14A 5GAN4 1UGRB 3MP8A 5IH2A 4NOYA 5KYWB 2MOXA 4L59A 3SWNC 2CKKA 1VQMQ 4N0AA 4O6JA 3J7AF 2HKQB 2YDLA 2CS7A 4C8QC 2JUFA 2L8DA 4FW2A 2CREA 1H641 4AG2C 3CC4Q 1JB0E 2O4XB 3MJXA 3HSBA 5HK3A 4BB7A 1Y96A 2HL3A 3C4SA 4ZGEB 4HVWA 1ZSZB 2YXYA 2XK0A 1VIEA 4KH1B 4PNOA 1D3BA 4LUDA 2FPFA 1TH7A 1IGUA 1AZEA 3CCMT 3VS1A 2DNUA 4N4IA 3G6EA 1I07A 1Q82R 3M59A 3JAME 4C8QF 3A8GB 4FL6A 1QVFS 1RADB 1TUDA 4D8KA 2E1HA 3OW2P 3CC2Q 5GAN5 3C0CA 4DOVA 3SWNA 3TCJA 4C0DC 2KI7A 2K7AA 3TSWA 2EYZA 1QCNA 4M7DC 2RJFA 2O88A 1OPLA 5GAN3 4HKEA 3E9GA 4PLLA 4JJNK 4BI8B 1YJ9Q 4JRIA 4NS5A 1MMGA 1LPLA 2HD0A 4ELYC 2M0YA 3M0RA 2DIQA 2DXCA 3HRTA 2QEXQ 1AWXA 1ABQA 1YJWQ 4QKUA 2HNIA 5GAMj 1N8RU 2CGHA 4BE0A 2KR3A 2RK2A 3HFOA 2X35A 4KRTA 3QKJA 4AFSC 5GAMf 4D6WA 3FEOA 3CBOA 5KCHA 4J5YA 2ED0A 2DTOA 1WYXA 2HL5C 4E6RA 1U3OA 3CC7T 2VXEA 1ACMB 2RQUA 2HAXA 1AWJA 1PCXA 8AT1B 4XU3A 2VYTA 2XI9A 3P8HA 1F1BB 5EC7A 4M7DF 2DIGA 3VS2A 1A0NB 1QQJA 4M77B 4F16A 3HPWA 3GOXA 2ROLA 2E5QA 1X43A 1VQKA 1TS9A 3TQ7P 5GJWB 3NTIA 3JB9H 4M7DA 4M78B 1ZX6A 3CCET 1MHNA 4WTOB 4VUBA 4KT0E 3UF4A 2D8HA 2MPXC 2RH2A 4Z88A 1HJDA 3OY9A 3C12A 1QP3A 1UHCA 5CQYA 4EIKA 2RF0A 3RR6A 4OB3B 3N5BB 3VKIA 1WHKA 3FDRA 3GBQA 2QTXA 3CEYA 3I5SA 1S72A 2LMJA 1WJQA 3I9QA 2H3JA 4R0KA 2P0KA 4PJMA 5LJ3d 4WCIA 1AWWA 1BYMA 4RTUA 5LJ5d 4F7UF 2JM8A 9ATCB 4BDYA 1SKUB 5GANh 2AK5A 4C92G 1QVGS 1AWOA 3CMAQ 1GCPA 4HT9A 1M90C 4ESRA 4F7UA 1VQ5A 3QBYA 4AG1C 2E5KA 1WXTA 3ZBDA 1O9SA 1KC8C 2BE7D 1RACB 2JZ2A 3J80E 2EYXA 1Y57A 3CXCP 1M27C 1EZZB 4C5HA 4JZ4A 1D0ZA 2VASA 4LDXA 2JNGA 4L6V5 3VUZA 5GMKl 2D1XA 2K3BA 1YITA 1LVKA 1QKWA 4BY6B 5A0GA 2KXCA 3UA7A 5LJ3h 3CBPA 4JS4A 2ZGWA 4QQ6A 2HKNA 5LJ5h 1D0YA 5HKCA 1YNZA 5FWCA 3BDUA 4ME7A 4L5GA 3SWNB 5GAOl 2A36A 4FYYB 4LD9K 1M5Q1 5I22A 4LDWA 2PVGB 2MK5A 1JO8A 5A2QE 3LGLA 4M7AC 4CC3A 2G3RA 1UTIA 2EGEA 1ABOA 2KYMA 2CH4W 2K5IA 4OMFB 3CCJT 1Z9QA 1GBRA 3VUBA 2LX9A 1G3YA 1UECA 3FIFA 2OTJT 1G3SA 3PTAA 1SG5A 1OI1A 5M9OA 2MYSA 4AMCA 2P4TA 4C8QD 5GANg 1YIJA 1JJ2P 2DK3A 2RJEA 3PGGA 3QDFA 1U1TA 1W4SA 2YUNA 5EG2A 4FSSA 2QXFA 2DMOA 2LTOA 2CSQA 2DBKA 4Z02A 4LNPA 1Q7YU 2K3YA 2FPEA 3EG2A 2DEQA 5CK9A 1GFDA 1WHHA 4EMHA 3FJPA 3NPFA 1K0XA 4KGXB 2RHUA 4C0DB 5I11A 2J6KA 2ATCB 1YCSB 1RI0A 1JXMA 3CQTA 3EAEA 1VQPA 2D8JA 1LCKA 1FXXA 4M7AA 2J05A 1W6XA 1M8MA 3E9FA 3VS6A 4IURA 3RKXA 3ASKA 3CC7Q 3OYNA 1G3TA 1QVFA 2K2MA 1LOJA 2NWMA 3OSSC 3I35A 2MWPA 5LJ3g 2X4JA 4CC4B 2QA4T 2DTIA 2K6DA 1JEGA 5LJ5g 1WGSA 4IUTA 2LVMA 4A4KA 2RQWA 4M7DD 4KGVB 2H3EB 4LDVA 1QWEA 4J9BA 2XICA 5IN1A 1D09B 2RK1A 4OB1B 2EAYA 4XAXB 2E12A 3S3OA 1CSKA 4RCBA 2J6FA 1J3TA 1VQOA 2BE9B 1Q95G 4JJCA 4J9IA 2DL3A 2X4XA 3CCQA 2E64A 5DY9A 1KHIA 2YLCA 3CC4A 4EMKC 3GLXA 4A53A 4CC2A 1YI2T 1YWOA 2C0TA 5IXFA 2RI3A 3CCLT 4F7UB 1IRXA 2JTMA 3ER0A 2FEIA 1I8FA 1Z9ZA 3LWHA 1TOVA 3HKSA 2E6NA 2DL8A 3L2RA 5FLXE 2RQTA 1GBQA 4XTYA 1KSWA 2KGTA
chains in the Genus database with same CATH topology
3JCMP 5I2SA 3V7SA 5CKEA 4C8QB 3BFMA 5GAOn 1K9MU 1VQLT 4E7HA 4M7AE 5CKBA 3OYYA 1N6AA 3C94A 4P5NA 3KUFA 4N0AC 3CCVT 2MWOA 1YCYA 3I56T 1I5LA 4UC4A 3HFNA 4A4GA 2E65A 3I55A 3JB9G 4XTXA 2EYQA 4M77A 2P0PA 4C5EA 4DQ2A 1VIFA 4E7IA 1W2BA 3JCMf 2QI2A 3INZA 4OB2B 1YJNT 4M75E 1BKBA 3RMQA 3RUXA 1V29B 5LJ5f 1N27A 2RI2A 5L8RE 1YBYA 4HCCA 1YHQA 3CC2A 2D0QB 1HK9A 5CO7A 4E7LA 1OYXA 1M4ZA 2FHDA 1P92A 4O5VA 4X34A 1JJ2A 1JBMA 2RHXA 4M78A 5AYFA 2L3RA 3V8JA 4IUQA 1BIBA 3CPWS 1FX7A 1OZ2A 1AHJB 4KBMB 3BDLA 5J3BA 4OGCA 2R57A 1VQ7A 3L2WA 1XNIA 4EMKA 3OS0A 2KVQG 1YJ9A 4XU0A 3OYHA 3CMAT 1UGQB 3L42A 2RJCA 2LC4A 3OS5A 1VQ4T 2QA4A 4QQDA 2RHYA 4A4FA 3OYKA 5CAIA 4QVZA 3URGA 3PMIA 1YJWA 1SSFA 2VXFA 4PJOB 4BY6C 2OTLA 4KUIA 1GXIE 2QQAA 1R8OB 4F7UG 2V8IA 5DM7R 3LYIA 1Y71A 2AHJB 1VQ6A 4J8OA 4BE1A 1QVGA 3CCRT 2WSCE 3SB2A 1M1GA 2KSSA 5GAN4 1UGRB 3MP8A 3M54A 2LRQA 3OYBA 4M7DB 3OBYA 1RL2A 4NOYA 4L59A 3P8DA 1U8RA 3SWNC 2CKKA 4J6XA 1N9SA 4N0AA 4O6JA 3J7AF 2GCXA 4HT8A 3RMSA 3LX7A 3FB9A 4XU1A 3DB4A 1YI2A 2CS7A 4C8QC 4M77D 1KQSS 2JUFA 2L8DA 4C8QG 4LDYA 4C92E 2EQMA 3CCLA 3L2UA 1H641 3HRUA 2FYKA 3F70A 1M90U 1VQNA 2XIDA 4IUVA 1B34B 4LDUA 1JB0E 2O4XB 5DLQE 5DLOA 3HSBA 2X4YA 5HK3A 4M78D 4BB7A 1KC8U 1X75C 2QEXT 1Y96A 3C4SA 4ZGEB 2YHTA 4M77E 1H3ZA 3JCMd 3QYGB 2EFIA 1UGPB 2FVUA 3JRZA 3V7CA 2EQJA 1VQKT 3HHTB 5GMKh 4PKCC 3JCMW 2E41A 2XK0A 3JCMQ 1VIEA 4M7AB 1EIFA 3TREA 4PNOA 1VQMA 4M78E 1D3BA 2OAUA 3CCVA 2M0OA 2M9UA 3I56A 5GANf 1VQ8A 4OF1A 1NPRA 3TEEA 5CKFA 2DPPB 2XU8A 1TH7A 2M16A 4GY5A 4M75B 3CCMT 4IUPA 2KK4A 3HRSA 4JLGA 4QVCA 1YJNA 2RHIA 4N4IA 5CQXA 3MCAB 3G6EA 4XTUA 2A3LA 2GQVA 3M59A 3JAME 4PJOG 5C0MA 3ZEHA 1KD1C 4C8QF 1UGSB 3A8GB 4FL6A 1QVFS 2HBPA 2Y4YA 2YLBA 3OYCA 3A8LB 3BW1A 3HL8A 1K73C 2E1HA 3OYGA 1S72T 2OTJA 3V8KA 2VC8A 3MEVA 5KE2A 5GAN5 2ZCFB 2B8AA 4C0ZA 4DOVA 3SWNA 3TCJA 4C0DC 4BE2A 4DOWA 3CXCS 3JCMX 3T9NA 3M9QA 3OYIA 2NLUA 5CKHA 3OYAA 1KHCA 2XKOC 3OBWA 2RJFA 3QUIA 4M7DC 5GAN3 5FU7B 2EJ9A 2K4YA 2F69A 3H6ZA 3M4GA 4HKEA 4B9WA 3A8OB 3GNFB 3E9GA 3QZ5B 1OZ3A 4PLLA 5A0LA 1M8VA 2EKOA 4M75D 5GMKm 4JJNK 2ZPEB 1UEBA 4BI8B 4E7KA 4JRIA 1G3WA 5LJ3j 3JCMJ 4NS5A 3DB3A 3PIOA 2HD0A 1XTDA 3JCMh 4ELYC 4ZN3A 3M4YA 5I2MA 5C6SA 2DXBA 5GAN2 5LJ5j 2DIQA 2DXCA 1ZHIA 3HRTA 5LJ3f 2MAMA 3OS1A 2V8JA 4QW2A 2HNIA 5GAMj 4FU6A 2CGHA 2K5LA 3E19A 3CCRA 4BE0A 4MMKA 3OYMA 2RK2A 3UPUA 1NJIC 2CZ6B 5FROA 2XD0A 3MEUA 3HFOA 2X4WA 1PSEA 2X35A 5LL6S 2D9TA 3VU3C 5I21A 3QKJA 4QQGA 5GAMf 4D6WA 3FEOA 3UWNA 3CBOA 4R56A 1Y07A 2ZPGB 4J5YA 4PJOF 5KCHA 5FRNA 4MMLA 4JUVA 3VV0A 1Q81C 1M1KC 4ELZC 3MP1A 2DTOA 3OYJA 2KMTA 4N4HA 5KE3A 5FU6C 4C92B 4M7AG 3DLLA 1M1FA 1ZBXA 3CC7T 3RESA 2R58A 2VXEA 1BI0A 3BY7A 4NL2A 2HAXA 2LT4A 3S3NA 4ZTJA 1K9MC 2CYZB 4XU3A 2VYTA 2XI9A 1YITT 2RO0A 3P8HA 4II1A 3GPLA 4JS5A 1HXDA 4M7DF 2DIGA 3SDZA 3PNWC 4M75G 1DJ7B 3OYDA 2ZPHB 4EMGA 4M77B 2KDSA 5IAYA 3HPWA 3OYFA 3GOXA 2QEXA 3VYHB 2ZPBB 4HCBA 1LJOA 2E5QA 3QIIA 1VQKA 1XOVA 4KULA 2XDPA 2RHZA 2E10A 3NTIA 3G4ST 3ME9A 5GAOp 3JB9H 4M7DA 4MZTA 4M78B 3QO3A 2DO3A 1Q82U 2PU9B 1WQWA 5D6WA 3JB9F 4BI4A 3CCET 1WPYA 2QQBA 1MHNA 4C92D 1W2BS 4HCZA 4VUBA 1N8RU 3M58A 5FU7C 4KT0E 4EMKB 4MZMA 2GFUA 4B9XA 3CCMA 2RH2A 3UDCA 1JJ2S 3VJPA 4EPCA 1Q86U 3UT1A 2DXTA 1B34A 4C8QE 2EJFA 2LCLA 3NTHA 3OY9A 3C12A 1QP3A 4M7AF 5CVIA 2WSFE 2LQKA 2PUKB 4J6WA 5CQYA 2RD1A 4ZGJB 1WQ7A 3PT9A 4BACA 4OB3B 3N5BB 3VKIA 3WVEB 3X25B 3FDRA 3M5AA 2CZ7B 1JRIA 2QTXA 3CEYA 1S72A 4XTVA 3JB9J 4RMOA 5GMKe 1WJQA 2H3JA 2P0KA 5LJ3d 5KH6A 2MI6A 3CCUT 2PUOB 3META 4GLKA 1BYMA 4C5IA 4IUUA 4XU2A 5LJ5d 3H8ZA 4F7UF 3M57A 3J81E 3M53A 4MDWA 3M56A 5GAMd 4BDYA 4DA4A 5GANh 4BD3A 5GANj 4C92G 1QVGS 1YIJT 4J83A 1VQLA 3OQ5A 2FB7A 4FT2A 4LD6A 3X20B 4HT9A 3DLMA 2JOYA 2DZCA 4V2SA 2E70A 2EQUA 3JCMg 2Y4XA 2QDYB 4OGEA 1M90C 4FIBA 4F7UA 2E6ZA 2PQWA 1VQ5A 3QBYA 4Y91A 4M77G 3OW2A 1K8AU 3ZBDA 1O9SA 4FM4B 1KC8C 3SD4A 2JZ2A 3J80E 1NPPA 4PJOC 1VQ6T 3L2QA 2VGNA 1XQHA 4C5HA 2F5KA 3MP6A 4LDXA 2JNGA 2FL7A 1M9SA 4M78C 1ZQ1A 3CMET 3DKMA 4M78G 5GAOq 2JTFA 3LW5E 4C5GA 1VQPT 3CC7A 4BI3A 3QG1A 2XDBA 3WVDB 1Y7XA 3LLRA 4L6V5 3VUZA 4ZN1A 5GMKl 3G71T 1WNLA 3KXTA 5FRMA 4M7DE 3CMAA 5GAN8 1YITA 2LT1A 4C8QA 2QQSA 3JCMe 3QXEB 4ZTFA 1VQ4A 3OB9A 4JLIA 3QZ9B 5A0GA 2DD5A 3CPFA 4BY6B 1MGQA 5LJ5e 1VQ9T 4KUDK 4X9DA 3KBGA 3QJ6A 5LJ3h 3QJYA 3CBPA 3CPWA 4JS4A 4C0FA 4J6YA 2ZGWA 4QQ6A 3MEWA 4OP0A 5HKCA 4XK8E 4TVRA 1FWZA 2L5QA 3BDUA 2ZPIB 3EFRA 5LJ5h 3QSUA 5GAMh 4EDUA 5CKDA 4WF2A 3CCEA 2DVEA 4ME7A 4YTLA 3CD6T 2GFAA 4L5GA 4M77F 2L89A 3SWNB 5GAOl 2RM4A 4LD9K 3MHXA 1M5Q1 1BI1A 3QDRB 4FT4A 4LDWA 3RIRA 3ZFJA 2PVGB 2XDDA 1VQ5T 1IZ6A 4E7JA 3VYGA 2KAFA 3A8MB 2A7YA 3PFSA 3JCMb 5A2QE 1VQMT 3LGLA 2BIVA 3PIPA 4M7AC 3NTKA 5GAOm 1VQOT 2G3RA 3JB9I 2RJDA 1VQ8T 4M78F 2D6FA 4MZPA 5GAN7 4C0GA 3CCQT 2K5IA 2RI5A 4QVDA 4OMFB 3CC4T 4PJOA 2O01E 3G6ET 3CCJT 4M75C 4E47A 3AHUA 5GANd 5IT9E 3VUBA 4Y28E 1N8RC 4CI0C 2LX9A 1G3YA 2EWNA 3LWIA 3S6WA 2BUDA 3CCUA 3WXMB 2K57A 3E1SA 4F7UE 4BDZA 3NFCA 3OSVA 1BI3A 3FIFA 3SFMA 2OTJT 1KQSA 3O8VA 1KQ1A 1G3SA 3PTAA 3FC3A 1OI1A 3OA6A 4IKFA 3OMGA 2EIFA 5M9OA 2DJZA 2P4TA 3C95A 1X01A 3P8BB 4C8QD 5GANg 1YIJA 2DK3A 2M1HA 2RJEA 3PGGA 4CRIA 1U1TA 3GF5A 3X26B 5J39A 1W4SA 3CCST 3OYEA 1BI2A 5EG2A 2CZ0B 2R5AA 2QXFA 3JCMV 2K2VA 2LTOA 4A4EA 1NE8A 2QQ9A 3CBMA 4Z02A 3L1AA 1Q7YU 2K3YA 5CR2A 2YRVA 4J7FA 2DEQA 2JVVA 2ZPFB 1QP2A 2O4XA 3M55A 2LDMA 4PL6A 2R5MA 5CK9A 3I55T 3RERA 2DTHA 3OMCA 4RG8A 4EMHA 1UB4A 4A54A 3FJPA 4JRKA 4A4HA 2RHUA 1IREB 4C0DB 3RKYA 2RA2A 1QVPA 2DKGA 2HQXA 3CMEA 1RI0A 1YHQT 3CC2T 3EAEA 4FSXA 1VQPA 4M75F 5HK0A 3A5ZB 3GP8A 1Q82C 1N9RA 3FRNA 2QQRA 1FXXA 5GANe 4M7AA 3JSCA 2K5FA 3G71A 4ATOA 2RB6A 5GMKi 1U1SA 5GAOr 3E9FA 4JRPA 4IURA 1VUBA 2XG8D 5A0DA 3RKXA 3ASKA 2VUBA 4NL3A 2DAQA 3QHSA 3OYLA 3V7RA 3OYNA 1G3TA 3L2VA 1QVFA 4C92C 1VQ9A 1LOJA 1VQ7T 3OSSC 1QW1A 1YJ9T 4HA8A 1Q86C 2LNVA 4M75A 4Q5WA 2WACA 3JCMc 3X28B 4PJOD 1Q7YC 2LQ8A 2MMPA 2MWPA 2CZ1B 3EFSA 2X4JA 3Q1JA 5LJ3g 3R6OA 2PVDB 2QA4T 3CXCA 2DTIA 1I4K1 3LGFA 5LJ5g 4RG2A 1YJWT 1WGSA 1KD1U 4IUTA 2DXUA 5CCAA 5GAMg 4M77C 5D6YA 2LVMA 2OTLT 1KG1A 2KY9A 5HY6A 2K3XA 5J26A 3CD6A 4A4KA 4PJOE 4M7DD 3QPHA 1K73U 2PVOB 4LDVA 5GMKj 1Y96B 2IVWA 3X24B 3S3MA 2XICA 5IN1A 5KCOA 1NZ9A 2RK1A 2KQWA 4OB1B 1WJRA 2LCCA 5FU6B 2C06A 2EAYA 4PLIA 2E12A 2VV5A 3PMTA 4XAXB 4XTWA 2ZZDA 3RKWA 3S3OA 4J7IA 3FLGA 4RCBA 4XQ3A 2JN0A 1I81A 4BUGA 4R55A 1VQOA 2HQEA 1KQ2A 4RCCA 4OB0B 1O75A 3L2ZA 1LNXA 5CIUA 2X4XA 3CCQA 2E64A 2MF2A 5DY9A 1KHIA 3JB9D 1D3BB 5LJ3e 2YLCA 1BIAA 4OVAA 4EMKC 3GLXA 3CC4A 1PSFA 4X9CA 4A53A 2EQKA 3CCJA 1YI2T 3GIBA 2BKDN 2RI3A 2WSEE 3CCLT 2F5TX 4F7UB 2DZ9A 1VQNT 5GAMe 3HP9A 2Y90A 5GAN6 4ZGDB 4C92F 1K8AC 2JTMA 3ER0A 3OS2A 1NJIU 1I8FA 3MEAA 3V8LA 3LWHA 4MDXA 3HKSA 2E6NA 5D6XA 2EJGA 4RKUE 3G4SA 1X6OA 4M7AD 3TU4K 1WJSA 2IG0A 3G7ZA 4N4GA 3L2RA 5FLXE 3GNGA 3QYHB 1Q81U 1M1KU 2XHCA 4M7DG 4JDSA 4JRQA 2P0QA 4XTYA 2V8KA 2GF7A 2VGMA 3LH0A 4C92A 2I2LA 3CCSA 3A8HB 4XTZA 3OW2S 1G5VA 3MO8A 2DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ7 B;  2PUO B;  1UGS B;  3A8G B;  3X26 B;  2CZ0 B;  3A8L B;  4OB2 B;  2ZCF B;  1V29 B;  5L8R E;  2D0Q B;  2ZPF B;  3X20 B;  1QP2 A;  2QDY B;  3A8O B;  3QZ5 B;  1AHJ B;  1IRE B;  2ZPE B;  4FM4 B;  1UGQ B;  2DXB A;  2DXC A;  2CZ6 B;  3LW5 E;  1PSE A;  1GXI E;  3WVD B;  4L6V 5;  3X28 B;  2CZ1 B;  2AHJ B;  2ZPG B;  2PVD B;  2WSC E;  3QXE B;  3QZ9 B;  2DD5 A;  1UGR B;  2CYZ B;  2PVO B;  3X24 B;  4OB1 B;  4XK8 E;  2ZPI B;  1DJ7 B;  2ZPH B;  2ZZD A;  3VYH B;  2ZPB B;  4OB0 B;  2PVG B;  1JB0 E;  3VYG A;  3A8M B;  1PSF A;  2PU9 B;  4ZGE B;  2WSE E;  3QYG B;  4ZGD B;  1UGP B;  3HHT B;  4KT0 E;  2O01 E;  4RKU E;  4Y28 E;  1QP3 A;  2WSF E;  2PUK B;  3QYH B;  4ZGJ B;  4OB3 B;  2DPP B;  3WVE B;  3X25 B;  3A8H B;  2DD4 A; 
#chains in the Genus database with same CATH topology
 5GAO n;  5KYY A;  4P5N A;  4J9F A;  1TSF A;  3CCV T;  3MPU B;  3HFN A;  3I55 A;  3JB9 G;  2KT8 A;  4C5E A;  2P0P A;  4E7I A;  2O9S A;  1RAF B;  1BKB A;  2KBT A;  1V29 B;  2YUO A;  4HCC A;  1YHQ A;  3CC2 A;  2FHD A;  1WHJ A;  1ZUK A;  1B07 A;  3QWX X;  1BIB A;  1PWT A;  3CPW S;  3RBB B;  5J3B A;  1KK7 A;  1VQ7 A;  4EMK A;  4J9G A;  3OS0 A;  1YJ9 A;  3L42 A;  2C0O A;  2RJC A;  2LC4 A;  1VQ4 T;  1AEY A;  2DYI A;  5CAI A;  1VQN Q;  1YJW A;  1SSF A;  4E7Z A;  4FW1 A;  1VYT A;  4DEY A;  4J8O A;  1JU5 C;  1QVG A;  1M1G A;  1SHG A;  1MUZ A;  3M54 A;  1X69 A;  1WXB A;  1IGQ A;  1QLY A;  1D0X A;  2AKK A;  3TVT A;  4AT1 B;  2GCX A;  1TG0 A;  3RMS A;  4XU1 A;  3FB9 A;  3I56 Q;  4QT7 A;  1KQS S;  4C92 E;  4RTZ A;  3HRU A;  1M90 U;  2CP7 A;  5DLO A;  2X4Y A;  1KC8 U;  1X75 C;  2QEX T;  2EFI A;  2FVU A;  2OTJ Q;  3H9N A;  1WLP B;  5GMK h;  4PKC C;  4M7A B;  1EIF A;  2E4H A;  2FZC B;  2OAU A;  2DFU A;  2M0O A;  5GAN f;  1VQ8 A;  5CKF A;  2DPP B;  2XU8 A;  3HRS A;  1ZUU A;  4JLG A;  4JPB W;  4QVC A;  1YJN A;  2RHI A;  2JM9 A;  3UAT A;  4XTU A;  2A3L A;  2LZ6 B;  2GQV A;  4PJO G;  5C0M A;  3ZEH A;  3CCR Q;  2ED1 A;  2HBP A;  2Y4Y A;  2YLB A;  3HL8 A;  1K73 C;  3OYG A;  2PNI A;  1WHG A;  5KE2 A;  5HCK A;  2LJ0 A;  4DOW A;  2NLU A;  5CKH A;  1YP5 A;  1Q86 R;  3QUI A;  1Q7Y R;  2K4Y A;  3M4G A;  1UDL A;  2OI3 A;  3QZ5 B;  2K9G A;  2EKO A;  2F1L A;  1ARK A;  1BCM A;  1UEB A;  4AFQ C;  1RAH B;  5LJ3 j;  1WIE A;  3DB3 A;  2LQN A;  1UG1 A;  4ZN3 A;  2BZY A;  5I2M A;  2DXB A;  5LJ5 j;  1ZHI A;  5LJ3 f;  2V8J A;  1M3C A;  3UPU A;  1VOM A;  3OYM A;  1NJI C;  1ZA2 B;  2X4W A;  4J9H A;  1PSE A;  3VU3 C;  5I21 A;  4QQG A;  3EHR A;  3UWN A;  5FRN A;  3MP1 A;  1T0J A;  2KMT A;  1X6G A;  4N4H A;  5FU6 C;  1ZBX A;  1NYG A;  1BI0 A;  4ZTJ A;  1K9M C;  2CYZ B;  1K8A R;  5KYY B;  4JS5 A;  1HXD A;  3SDZ A;  3PNW C;  3OYD A;  1UFF A;  2ZPH B;  4EMG A;  2KDS A;  1GCQ C;  3VYH B;  1QWF A;  4JJB A;  4KUL A;  3EG9 A;  2P4R A;  3QO3 A;  2DO3 A;  5D6W A;  4BI4 A;  1W2B S;  2J6O A;  1MMA A;  1IHW A;  5FU7 C;  4EMK B;  1PM3 A;  4MZM A;  3CCM A;  3PE0 A;  2J7I A;  3VJP A;  1RLP C;  3CCV Q;  1B34 A;  2L3P A;  2LCL A;  2VWF A;  2WSF E;  2LQK A;  4J6W A;  2GTJ A;  1WX6 A;  4BAC A;  1QCO A;  3M5A A;  2NYS A;  1C6V X;  1JRI A;  2HEQ A;  3JB9 J;  5KH6 A;  2EYY A;  2MI6 A;  3CCU T;  2PUO B;  1KIK A;  4GLK A;  4PFZ A;  1QCF A;  3A1P A;  4XU2 A;  2DIL A;  2IIM A;  3HTR A;  4MDW A;  3M56 A;  4DA4 A;  1ZUY A;  2JJ9 A;  3UA6 A;  1V1C A;  4J83 A;  1VQL A;  2KE9 A;  2KRS A;  3X20 B;  3AT1 B;  2E70 A;  1VQ4 Q;  2EQU A;  4OMP A;  2EQI A;  1OPK A;  4M77 G;  2FZG B;  4FM4 B;  1NPP A;  3L2Q A;  2VGN A;  1XQH A;  1MV0 B;  2F5K A;  3MP6 A;  1CKA A;  4M78 G;  2JTF A;  4J9E A;  5GAO q;  1G83 A;  3CC7 A;  3WVD B;  1Y7X A;  4ZN1 A;  5GJV B;  1WNL A;  3KXT A;  2ENM A;  1MMN A;  5GAN 8;  4C8Q A;  2QQS A;  3JCM e;  2CP3 A;  4ZTF A;  1K0S A;  5LJ5 e;  3CPF A;  2HQH A;  2PZ1 A;  3KBG A;  3QJY A;  1BK2 A;  3CPW A;  2QYZ A;  5IHK A;  1H92 A;  1PRL C;  1R0C B;  4LUE A;  4TVR A;  3EFR A;  2COW A;  2SEM A;  2K79 A;  1TTH B;  3CCE A;  2DVE A;  3CD6 T;  4PJJ A;  2YUQ A;  3MHX A;  3ZFJ A;  2XDD A;  1K76 A;  1IZ6 A;  3A8M B;  1IXD A;  2A7Y A;  1T3S A;  3PFS A;  3JCM b;  1TWB A;  2RQV A;  1SSH A;  3JB9 I;  2RJD A;  4RTW A;  4MZP A;  5GAN 7;  4C0G A;  1NG2 A;  1PNJ A;  2RI5 A;  1WXU A;  2P84 A;  3G6E T;  3VS0 A;  4M75 C;  3AHU A;  3FJ5 A;  1AT1 B;  4HXJ A;  5GAN d;  1NM7 A;  5IHN A;  4CI0 C;  3LWI A;  4F17 A;  2K57 A;  4BDZ A;  1EFN A;  3CME Q;  1KQS A;  3O8V A;  4HVU A;  1PRM C;  5AT1 B;  3G71 Q;  2DJZ A;  3P8B B;  1X01 A;  2M1H A;  3GF5 A;  2MIO A;  5J39 A;  4PK4 A;  1M3A A;  1VQ9 Q;  2LP5 A;  3JCM V;  1HYO A;  4A4E A;  1NE8 A;  1WDX A;  2YRV A;  3E2U A;  4J7F A;  3M55 A;  4PL6 A;  1FYN A;  1QP2 A;  3U23 A;  2DTH A;  4RG8 A;  4DBQ A;  1Q81 R;  1M1K R;  1SRM A;  2RA2 A;  2DKG A;  1MV3 A;  1V76 A;  3EG9 B;  4M75 F;  5HK0 A;  1Q82 C;  1N9R A;  2COZ A;  2QQR A;  4ATO A;  1VA7 A;  3H0H A;  5GAO r;  1RAA B;  4JRP A;  2OX7 A;  3QWY A;  5A0D A;  2VUB A;  2DAQ A;  3V7R A;  1MMD A;  3L2V A;  1UJY A;  1TUG B;  4M75 A;  3JCM c;  2WAC A;  2LQ8 A;  2MMP A;  3EFS A;  2CZ1 B;  1TU0 B;  2VVK A;  2CP5 A;  5CCA A;  2DBM A;  1KG1 A;  2K3X A;  5J26 A;  4PJO E;  1K73 U;  2PVO B;  5GMK j;  3S3M A;  1Y96 B;  5KCO A;  2LCC A;  5FU6 B;  4PLI A;  3PMT A;  3RKW A;  4Y92 A;  4J7I A;  3FLG A;  2CDT A;  2JN0 A;  3CCS Q;  4RCC A;  1O75 A;  2QG9 B;  2MF2 A;  1D3B B;  5IXB A;  1PSF A;  2HBW A;  2EQK A;  3CCJ A;  2BKD N;  2EVR A;  1VQN T;  5GAM e;  2V1R A;  1PKS A;  1NJI U;  2OAW A;  1OU9 A;  2NUT A;  2JT4 A;  2QGG A;  3G4S A;  5KYU A;  3TU4 K;  3CCU Q;  3QYH B;  4M7D G;  3ULR B;  4JRQ A;  2V8K A;  3OW2 S;  3MO8 A;  2DD4 A;  1D1B A;  3V7S A;  5CKE A;  4C8Q B;  3BFM A;  2EPD A;  1K9M U;  4E7H A;  1HD3 A;  3OYY A;  4FYW B;  3I56 T;  1YCY A;  1G8X A;  1SF9 A;  1I5L A;  2YSQ A;  4DQ2 A;  1VIF A;  1W2B A;  4OB2 B;  3RUX A;  2RI2 A;  2A28 A;  1JXO A;  5CO7 A;  2OJ2 A;  4E7L A;  3M0P A;  1JBM A;  4IUQ A;  1FX7 A;  1OZ2 A;  4KBM B;  2RQR A;  1WA7 A;  2F2W A;  2A08 A;  4OGC A;  4CC7 A;  2R57 A;  3PVQ A;  2LJ3 A;  2QA4 A;  2RHY A;  4A4F A;  4QVZ A;  3URG A;  2L2P A;  1OEB A;  5DM7 R;  1K9A A;  1TXQ A;  4F7U G;  1M2O A;  2AHJ B;  1VQ6 A;  3CCR T;  1W1F A;  3SB2 A;  3CD6 Q;  2LRQ A;  2E3H A;  4M7D B;  3OBY A;  1RL2 A;  3P8D A;  1U8R A;  4J6X A;  1PC0 A;  1UGV A;  1UHF A;  4J9C A;  3DB4 A;  2HZY A;  1SPK A;  1YI2 A;  1JQQ A;  1N8R R;  1S1N A;  3CCL A;  1T0H A;  2FYK A;  1WHM A;  2XID A;  1YN8 A;  4IUV A;  4LDU A;  3G6E Q;  1UE9 A;  1RLQ C;  4M77 E;  3QYG B;  2DET A;  1UGP B;  4LXC A;  2KXD A;  3HHT B;  3VS7 A;  3JCM W;  2E41 A;  4E2F B;  1I5O B;  1VQM A;  3VRZ A;  4M78 E;  2W10 A;  2F2V A;  3CCV A;  1RUW A;  2M9U A;  1BBZ A;  1NPR A;  2DRM A;  4OF1 A;  4M75 B;  3EG3 A;  5CQX A;  3MCA B;  4D8D A;  4HVV A;  2J06 A;  1KD1 C;  1UGS B;  3OYC A;  1XJW B;  3A8L B;  3BW1 A;  2ZCF B;  2B8A A;  4C0Z A;  4DBR A;  4RTY A;  3CXC S;  2M51 A;  2NUP A;  1KHC A;  2XKO C;  1FMW A;  2EJ9 A;  2F69 A;  4B9W A;  3A8O B;  3GNF B;  1OZ3 A;  5A0L A;  4M75 D;  5GMK m;  3PIO A;  1XTD A;  2BZ8 A;  1ZBJ A;  2Z0W A;  3EFO A;  4RTV A;  2K5L A;  2XD0 A;  4MMK A;  3MEU A;  3BE3 A;  1VQK Q;  2CUB A;  2D9T A;  1W70 A;  2NUT B;  5KYU B;  2B86 A;  4R56 A;  1Y07 A;  4PJO F;  3VV0 A;  1ZSZ C;  2L3S A;  5KE3 A;  2AKL A;  4M7A G;  1M1F A;  1RAE B;  2R58 A;  3BY7 A;  4NL2 A;  4PJL A;  2RO0 A;  3GPL A;  2DJQ A;  8ATC B;  4AFU C;  2QEX A;  4HCB A;  1LJO A;  2M02 A;  2DRK A;  4OMM A;  1S72 Q;  1XOV A;  3RDV A;  2E10 A;  2DA9 A;  2JTE A;  5GAO p;  4MZT A;  1Q82 U;  2COY A;  1WQW A;  1WPY A;  2QQB A;  2FRY A;  4HCZ A;  2QTV A;  2KT1 A;  1WZO A;  2I0N A;  1G2B A;  3M58 A;  3THK A;  5FWB A;  2BTT A;  4B9X A;  3UDC A;  2CH4 A;  2CP2 A;  1JJ2 S;  4EPC A;  3UT1 A;  2DXT A;  1H8K A;  4C8Q E;  2EJF A;  1AOJ A;  2PUK B;  4ZGJ B;  1VQ5 Q;  2DER A;  2KNB B;  2X3W D;  4XTV A;  1HSQ A;  2EW3 A;  1K9M R;  2YRC A;  1Y0M A;  3I5R A;  4C5I A;  3J81 E;  1B3Q A;  3EG1 A;  1C0M A;  5GAN j;  1PD0 A;  1E7O A;  1YIT Q;  3OQ5 A;  4LD6 A;  3REA B;  3EG0 A;  4FCY A;  3DLM A;  2JOY A;  2DZC A;  2D0N A;  2QDY B;  4OGE A;  4FIB A;  1QVF P;  2ESW A;  2PQW A;  1I0C A;  4PFO A;  2MCN A;  3OW2 A;  3SD4 A;  3KFV A;  1IHV A;  2W0Z A;  2QAZ A;  2FL7 A;  1M9S A;  4M78 C;  1RAB B;  3CME T;  3DKM A;  4E7S A;  1AD5 A;  4BI3 A;  3LLR A;  5FRM A;  1PHT A;  3G71 T;  4M7D E;  1SEM A;  3CMA A;  2EGA A;  2YUP A;  3OB9 A;  4JLI A;  3QZ9 B;  1VQ9 T;  1OOT A;  1B7T A;  4X9D A;  2VKN A;  2KRM A;  4J6Y A;  1EX4 A;  2L0A A;  3MEW A;  4XK8 E;  1FWZ A;  2L5Q A;  2ZPI B;  1BU1 A;  4EDU A;  5CKD A;  4WF2 A;  4M77 F;  2HMA A;  1BI1 A;  3QDR B;  2NUP B;  1YIJ Q;  1M2V A;  2LNH B;  1VQ8 T;  4M78 F;  1NEB A;  3VS3 A;  2JMC A;  1D1A A;  3H41 A;  1SRL A;  4E47 A;  3EFO B;  3CCU A;  3WXM B;  3E1S A;  4F7U E;  3NFC A;  1BI3 A;  1KQ1 A;  1VQP Q;  4KGZ B;  3OA6 A;  4IKF A;  4CRI A;  3CCS T;  3OYE A;  1BI2 A;  2CZ0 B;  2R5A A;  2K2V A;  3CBM A;  3L1A A;  2ZPF B;  2X3X D;  3RER A;  2LDM A;  1OU8 A;  2R5M A;  3OMC A;  1UB4 A;  4A4H A;  1IRE B;  3RKY A;  2HQX A;  1QVP A;  2HDA A;  3A5Z B;  3GP8 A;  3EH2 A;  5GAN e;  1QVG P;  3JSC A;  2K5F A;  2RB6 A;  1VQO Q;  3M0T A;  1VUB A;  2DYB A;  3OYL A;  4DEX A;  3QHS A;  3R6N A;  4A63 B;  4C92 C;  3EGD A;  3CCQ Q;  2QGF B;  1Q86 C;  4PJO D;  2LNV A;  1Q7Y C;  1K4U S;  2EKH A;  6AT1 B;  1X2Q A;  2PVD B;  1GCQ A;  3CXC A;  3LGF A;  4RG2 A;  1KD1 U;  2OTL T;  2KY9 A;  5HY6 A;  3CD6 A;  3X24 B;  1K1Z A;  1NLP C;  3TSZ A;  2VV5 A;  2ZZD A;  4XQ3 A;  1I81 A;  4BUG A;  4R55 A;  1VYU A;  1KQ2 A;  3L2Z A;  5LJ3 e;  4X9C A;  2KRN A;  3I55 Q;  4GLM A;  2F5T X;  4Z8A A;  1AZG B;  4C92 F;  1K8A C;  5KYX A;  3V8L A;  2DL7 A;  1YFN A;  1YHQ Q;  2CT4 A;  4RKU E;  1X6O A;  2LX7 A;  2IG0 A;  3G7Z A;  1E6G A;  5IHI A;  4M4Z A;  5D7U A;  3A98 A;  4JDS A;  2VGM A;  3LH0 A;  4C92 A;  2I2L A;  1G5V A;  4XTZ A;  3OYF A;  1RAG B;  1M90 R;  1VQ7 Q;  4ANJ A;  4RTX A;  3JCM P;  5I2S A;  2RNA A;  1VQL T;  4M7A E;  3M0S A;  2HSP A;  5CKB A;  3KUF A;  1KC8 R;  1PKT A;  2LQW A;  4UC4 A;  1BB9 A;  4XTX A;  2AT1 B;  1FMV A;  2ABL A;  2F2X A;  3RMQ A;  1D1C A;  1YBY A;  1HK9 A;  1OYX A;  1M4Z A;  2NUZ A;  1P92 A;  2XMF A;  4O5V A;  1JJ2 A;  2RHX A;  5AYF A;  3V8J A;  2JXB A;  4PJN A;  2V26 A;  2ECZ A;  1NBE B;  7AT1 B;  1SHF A;  2CUD A;  1XNI A;  3OYH A;  2ZAE A;  1M2V B;  1R77 A;  2G6F X;  3OS5 A;  4JJD A;  3OYK A;  4OMQ A;  2FZK B;  1MNE A;  1T3L A;  4KUI A;  1GXI E;  2V8I A;  1Y71 A;  4BE1 A;  2WSC E;  2KSS A;  3OYB A;  1N9S A;  4HT8 A;  3LX7 A;  1VQ8 Q;  2H8H A;  4M77 D;  4C8Q G;  4LDY A;  2EQM A;  3L2U A;  3F70 A;  1VQN A;  4J9D A;  2DEU A;  1YJN Q;  1B34 B;  5DLQ E;  4M78 D;  2YHT A;  1H3Z A;  3JCM d;  4LN2 A;  3V7C A;  3JRZ A;  2EQJ A;  1VQK T;  2BZX A;  3JCM Q;  2DLP A;  2JS0 A;  2GQI A;  3TRE A;  1NEG A;  3I56 A;  3TEE A;  3EGD B;  2M16 A;  4GY5 A;  2GNC A;  4IUP A;  2KK4 A;  2LJ1 A;  3EH1 A;  3JV3 A;  3VRY A;  4DBF A;  3REB B;  2OTJ A;  1S72 T;  3V8K A;  2VC8 A;  3MEV A;  4RTT A;  4BE2 A;  1PG5 B;  3JCM X;  3T9N A;  3M9Q A;  3OYI A;  3OYA A;  4RUG A;  3OBW A;  1N5Z A;  1IB8 A;  5FU7 B;  3H6Z A;  1OX9 A;  1M30 A;  1M8V A;  2FO0 A;  2ZPE B;  4E7K A;  1G3W A;  3JCM J;  3JCM h;  5C6S A;  3M4Y A;  1ZSG A;  5GAN 2;  1U06 A;  2DE0 X;  2MAM A;  3OS1 A;  3CCR A;  4QW2 A;  3QSU A;  4FU6 A;  3E19 A;  1VQ5 T;  5KYX B;  2OTL Q;  2QAS A;  1X6B A;  2CZ6 B;  5FRO A;  3CPW P;  5LL6 S;  2AZV A;  2ROT A;  2ZPG B;  2E3I A;  4MML A;  4JUV A;  1UJ0 A;  1Q81 C;  1M1K C;  4ELZ C;  3OYJ A;  3ZL7 C;  4C92 B;  3DLL A;  1AVZ C;  2FG0 A;  2GBQ A;  3NMZ C;  3RES A;  4IIO A;  1KD1 R;  2LT4 A;  3S3N A;  2JW4 A;  3CCM Q;  1I1J A;  2JS2 A;  1GRI A;  4ZNX A;  3H0F A;  1YIT T;  4II1 A;  3VS5 A;  4M75 G;  1DJ7 B;  1WFW A;  2QK0 A;  3SHW A;  1ZLM A;  5IAY A;  1ZA1 B;  1KFZ A;  2ZPB B;  3QII A;  4GBQ A;  2XDP A;  2DL4 A;  2RHZ A;  3G4S T;  4K11 A;  4PFP A;  3ME9 A;  2CSI A;  3JB9 F;  2PU9 B;  1RI9 A;  2RMO A;  2YWW A;  4C92 D;  1FMK A;  1KQS P;  1RAI B;  3G1J A;  1WHL A;  2GFU A;  1VQL Q;  1Q86 U;  3NTH A;  4M7A F;  2AIR B;  5CVI A;  2KRO A;  2RD1 A;  1WQ7 A;  3PT9 A;  3X25 B;  3WVE B;  1E6H A;  2VB6 A;  2SRC A;  2CZ7 B;  2EGC A;  2V1Q A;  4RMO A;  5ECA A;  5GMK e;  2X9H A;  4FYV B;  3MET A;  4IUU A;  3H0I A;  3LH5 A;  2QDL A;  3H8Z A;  3M57 A;  3M53 A;  2AZS A;  4X1V A;  5GAM d;  2EYW A;  3O5Z A;  4BD3 A;  1YIJ T;  2FB7 A;  4FT2 A;  4V2S A;  3JCM g;  2Y4X A;  2E6Z A;  4Y91 A;  1K8A U;  4PJO C;  5FW9 A;  1VQ6 T;  3M0U A;  3CCE Q;  1ZQ1 A;  3LW5 E;  4C5G A;  1VQP T;  1U5S A;  1OQK A;  3QG1 A;  2XDB A;  2FRW A;  1C1A A;  2LT1 A;  2DX1 A;  4OML A;  3QXE B;  1VQ4 A;  2L3Q A;  4KUD K;  2DD5 A;  1MGQ A;  2HCK A;  3QJ6 A;  3IQL A;  4C0F A;  2JMA A;  4OP0 A;  4ORZ A;  3PVL A;  5GAM h;  2DF6 A;  2FPD A;  4YTL A;  2GFA A;  4B6M A;  2L89 A;  2RM4 A;  4FT4 A;  3RIR A;  4E7J A;  3VYG A;  2KAF A;  1VQM T;  2BIV A;  2YRD A;  3PIP A;  3NTK A;  3RNJ A;  5GAO m;  1VQO T;  2D6F A;  2O2O A;  2CP0 A;  4F04 B;  3CCQ T;  3EGX A;  3NGP A;  4QVD A;  3CC4 T;  1K73 R;  4PJO A;  1NYF A;  2O01 E;  1X27 A;  5IT9 E;  2DL5 A;  4DBH A;  4Y28 E;  1N8R C;  3D7S B;  2EWN A;  3S6W A;  2BUD A;  1CKB A;  2DM1 A;  1QKX A;  1W2B P;  3OSV A;  3SFM A;  3FC3 A;  5KYW A;  3OMG A;  2EIF A;  3C95 A;  1VYV A;  3X26 B;  1QMC A;  2O31 A;  2KEA A;  1NJI R;  3EHQ A;  2QQ9 A;  5CR2 A;  2JVV A;  2O4X A;  3I55 T;  4IIM A;  2EBP A;  4A54 A;  4JRK A;  2LCS A;  4JZ3 A;  3CME A;  1TUC A;  2C0I A;  2GTO A;  1WI7 A;  1YHQ T;  4FSX A;  4OMN A;  3CC2 T;  1ZSZ A;  3FRN A;  1R0B G;  3G71 A;  5GMK i;  1U1S A;  2XG8 D;  1YWP A;  2RN8 A;  4NL3 A;  1OX8 A;  4KH0 B;  3M0Q A;  2GGR A;  1VQ9 A;  1VQ7 T;  2RPN A;  1QW1 A;  1YJ9 T;  4HA8 A;  4Q5W A;  3X28 B;  5KYN A;  3Q1J A;  3CCJ Q;  3R6O A;  1I4K 1;  2O9V A;  1YJW T;  1BCO A;  2DXU A;  5GAM g;  4M77 C;  3NHN A;  5D6Y A;  1H3H A;  3VS4 A;  2YT6 A;  3QPH A;  1MND A;  4FYX B;  3G4S Q;  2IVW A;  1NZ9 A;  2KQW A;  1WJR A;  2C06 A;  4XTW A;  2HQE A;  2CP6 A;  4OB0 B;  1LNX A;  5CIU A;  2A0F B;  3JB9 D;  1OUL A;  1BIA A;  3EGU A;  4OVA A;  3GIB A;  2DVJ A;  1OV3 A;  2WSE E;  2DZ9 A;  5GAN 6;  3HP9 A;  2Y90 A;  4ZGD B;  3OS2 A;  3MEA A;  4MDX A;  5D6X A;  2EJG A;  4M7A D;  1WJS A;  4N4G A;  2X51 A;  3GNG A;  1PD1 A;  1Q81 U;  1M1K U;  2XHC A;  1UUE A;  2P0Q A;  1GL5 A;  2GF7 A;  3CCS A;  3A8H B;  1N6A A;  1NLO C;  3C94 A;  4N0A C;  2MWO A;  3MKD A;  2QA4 Q;  4A4G A;  2E65 A;  5L23 A;  2EYQ A;  4M77 A;  4OMO A;  4LE9 A;  3JCM f;  2QI2 A;  3INZ A;  1YJN T;  4M75 E;  2HSE B;  1N27 A;  5LJ5 f;  5L8R E;  3SEM A;  1VQ6 Q;  2D0Q B;  1IO6 A;  4X34 A;  4HCK A;  4M78 A;  1KJW A;  2L3R A;  1AHJ B;  3BDL A;  1GFC A;  4Z89 A;  2A37 A;  3L2W A;  2KVQ G;  1X2K A;  4XU0 A;  3CMA T;  1UGQ B;  4AFZ C;  1YI2 Q;  4QQD A;  3CCL Q;  2PTK A;  3PMI A;  3EGX B;  2VXF A;  4PJO B;  4BY6 C;  2OTL A;  2IPO B;  2QQA A;  1R8O B;  3LYI A;  2CT3 A;  2KYB A;  1M3B A;  4F14 A;  5GAN 4;  1UGR B;  3MP8 A;  5IH2 A;  4NOY A;  5KYW B;  2MOX A;  4L59 A;  3SWN C;  2CKK A;  1VQM Q;  4N0A A;  4O6J A;  3J7A F;  2HKQ B;  2YDL A;  2CS7 A;  4C8Q C;  2JUF A;  2L8D A;  4FW2 A;  2CRE A;  1H64 1;  4AG2 C;  3CC4 Q;  1JB0 E;  2O4X B;  3MJX A;  3HSB A;  5HK3 A;  4BB7 A;  1Y96 A;  2HL3 A;  3C4S A;  4ZGE B;  4HVW A;  1ZSZ B;  2YXY A;  2XK0 A;  1VIE A;  4KH1 B;  4PNO A;  1D3B A;  4LUD A;  2FPF A;  1TH7 A;  1IGU A;  1AZE A;  3CCM T;  3VS1 A;  2DNU A;  4N4I A;  3G6E A;  1I07 A;  1Q82 R;  3M59 A;  3JAM E;  4C8Q F;  3A8G B;  4FL6 A;  1QVF S;  1RAD B;  1TUD A;  4D8K A;  2E1H A;  3OW2 P;  3CC2 Q;  5GAN 5;  3C0C A;  4DOV A;  3SWN A;  3TCJ A;  4C0D C;  2KI7 A;  2K7A A;  3TSW A;  2EYZ A;  1QCN A;  4M7D C;  2RJF A;  2O88 A;  1OPL A;  5GAN 3;  4HKE A;  3E9G A;  4PLL A;  4JJN K;  4BI8 B;  1YJ9 Q;  4JRI A;  4NS5 A;  1MMG A;  1LPL A;  2HD0 A;  4ELY C;  2M0Y A;  3M0R A;  2DIQ A;  2DXC A;  3HRT A;  2QEX Q;  1AWX A;  1ABQ A;  1YJW Q;  4QKU A;  2HNI A;  5GAM j;  1N8R U;  2CGH A;  4BE0 A;  2KR3 A;  2RK2 A;  3HFO A;  2X35 A;  4KRT A;  3QKJ A;  4AFS C;  5GAM f;  4D6W A;  3FEO A;  3CBO A;  5KCH A;  4J5Y A;  2ED0 A;  2DTO A;  1WYX A;  2HL5 C;  4E6R A;  1U3O A;  3CC7 T;  2VXE A;  1ACM B;  2RQU A;  2HAX A;  1AWJ A;  1PCX A;  8AT1 B;  4XU3 A;  2VYT A;  2XI9 A;  3P8H A;  1F1B B;  5EC7 A;  4M7D F;  2DIG A;  3VS2 A;  1A0N B;  1QQJ A;  4M77 B;  4F16 A;  3HPW A;  3GOX A;  2ROL A;  2E5Q A;  1X43 A;  1VQK A;  1TS9 A;  3TQ7 P;  5GJW B;  3NTI A;  3JB9 H;  4M7D A;  4M78 B;  1ZX6 A;  3CCE T;  1MHN A;  4WTO B;  4VUB A;  4KT0 E;  3UF4 A;  2D8H A;  2MPX C;  2RH2 A;  4Z88 A;  1HJD A;  3OY9 A;  3C12 A;  1QP3 A;  1UHC A;  5CQY A;  4EIK A;  2RF0 A;  3RR6 A;  4OB3 B;  3N5B B;  3VKI A;  1WHK A;  3FDR A;  3GBQ A;  2QTX A;  3CEY A;  3I5S A;  1S72 A;  2LMJ A;  1WJQ A;  3I9Q A;  2H3J A;  4R0K A;  2P0K A;  4PJM A;  5LJ3 d;  4WCI A;  1AWW A;  1BYM A;  4RTU A;  5LJ5 d;  4F7U F;  2JM8 A;  9ATC B;  4BDY A;  1SKU B;  5GAN h;  2AK5 A;  4C92 G;  1QVG S;  1AWO A;  3CMA Q;  1GCP A;  4HT9 A;  1M90 C;  4ESR A;  4F7U A;  1VQ5 A;  3QBY A;  4AG1 C;  2E5K A;  1WXT A;  3ZBD A;  1O9S A;  1KC8 C;  2BE7 D;  1RAC B;  2JZ2 A;  3J80 E;  2EYX A;  1Y57 A;  3CXC P;  1M27 C;  1EZZ B;  4C5H A;  4JZ4 A;  1D0Z A;  2VAS A;  4LDX A;  2JNG A;  4L6V 5;  3VUZ A;  5GMK l;  2D1X A;  2K3B A;  1YIT A;  1LVK A;  1QKW A;  4BY6 B;  5A0G A;  2KXC A;  3UA7 A;  5LJ3 h;  3CBP A;  4JS4 A;  2ZGW A;  4QQ6 A;  2HKN A;  5LJ5 h;  1D0Y A;  5HKC A;  1YNZ A;  5FWC A;  3BDU A;  4ME7 A;  4L5G A;  3SWN B;  5GAO l;  2A36 A;  4FYY B;  4LD9 K;  1M5Q 1;  5I22 A;  4LDW A;  2PVG B;  2MK5 A;  1JO8 A;  5A2Q E;  3LGL A;  4M7A C;  4CC3 A;  2G3R A;  1UTI A;  2EGE A;  1ABO A;  2KYM A;  2CH4 W;  2K5I A;  4OMF B;  3CCJ T;  1Z9Q A;  1GBR A;  3VUB A;  2LX9 A;  1G3Y A;  1UEC A;  3FIF A;  2OTJ T;  1G3S A;  3PTA A;  1SG5 A;  1OI1 A;  5M9O A;  2MYS A;  4AMC A;  2P4T A;  4C8Q D;  5GAN g;  1YIJ A;  1JJ2 P;  2DK3 A;  2RJE A;  3PGG A;  3QDF A;  1U1T A;  1W4S A;  2YUN A;  5EG2 A;  4FSS A;  2QXF A;  2DMO A;  2LTO A;  2CSQ A;  2DBK A;  4Z02 A;  4LNP A;  1Q7Y U;  2K3Y A;  2FPE A;  3EG2 A;  2DEQ A;  5CK9 A;  1GFD A;  1WHH A;  4EMH A;  3FJP A;  3NPF A;  1K0X A;  4KGX B;  2RHU A;  4C0D B;  5I11 A;  2J6K A;  2ATC B;  1YCS B;  1RI0 A;  1JXM A;  3CQT A;  3EAE A;  1VQP A;  2D8J A;  1LCK A;  1FXX A;  4M7A A;  2J05 A;  1W6X A;  1M8M A;  3E9F A;  3VS6 A;  4IUR A;  3RKX A;  3ASK A;  3CC7 Q;  3OYN A;  1G3T A;  1QVF A;  2K2M A;  1LOJ A;  2NWM A;  3OSS C;  3I35 A;  2MWP A;  5LJ3 g;  2X4J A;  4CC4 B;  2QA4 T;  2DTI A;  2K6D A;  1JEG A;  5LJ5 g;  1WGS A;  4IUT A;  2LVM A;  4A4K A;  2RQW A;  4M7D D;  4KGV B;  2H3E B;  4LDV A;  1QWE A;  4J9B A;  2XIC A;  5IN1 A;  1D09 B;  2RK1 A;  4OB1 B;  2EAY A;  4XAX B;  2E12 A;  3S3O A;  1CSK A;  4RCB A;  2J6F A;  1J3T A;  1VQO A;  2BE9 B;  1Q95 G;  4JJC A;  4J9I A;  2DL3 A;  2X4X A;  3CCQ A;  2E64 A;  5DY9 A;  1KHI A;  2YLC A;  3CC4 A;  4EMK C;  3GLX A;  4A53 A;  4CC2 A;  1YI2 T;  1YWO A;  2C0T A;  5IXF A;  2RI3 A;  3CCL T;  4F7U B;  1IRX A;  2JTM A;  3ER0 A;  2FEI A;  1I8F A;  1Z9Z A;  3LWH A;  1TOV A;  3HKS A;  2E6N A;  2DL8 A;  3L2R A;  5FLX E;  2RQT A;  1GBQ A;  4XTY A;  1KSW A;  2KGT A; 
#chains in the Genus database with same CATH homology
 3JCM P;  5I2S A;  3V7S A;  5CKE A;  4C8Q B;  3BFM A;  5GAO n;  1K9M U;  1VQL T;  4E7H A;  4M7A E;  5CKB A;  3OYY A;  1N6A A;  3C94 A;  4P5N A;  3KUF A;  4N0A C;  3CCV T;  2MWO A;  1YCY A;  3I56 T;  1I5L A;  4UC4 A;  3HFN A;  4A4G A;  2E65 A;  3I55 A;  3JB9 G;  4XTX A;  2EYQ A;  4M77 A;  2P0P A;  4C5E A;  4DQ2 A;  1VIF A;  4E7I A;  1W2B A;  3JCM f;  2QI2 A;  3INZ A;  4OB2 B;  1YJN T;  4M75 E;  1BKB A;  3RMQ A;  3RUX A;  1V29 B;  5LJ5 f;  1N27 A;  2RI2 A;  5L8R E;  1YBY A;  4HCC A;  1YHQ A;  3CC2 A;  2D0Q B;  1HK9 A;  5CO7 A;  4E7L A;  1OYX A;  1M4Z A;  2FHD A;  1P92 A;  4O5V A;  4X34 A;  1JJ2 A;  1JBM A;  2RHX A;  4M78 A;  5AYF A;  2L3R A;  3V8J A;  4IUQ A;  1BIB A;  3CPW S;  1FX7 A;  1OZ2 A;  1AHJ B;  4KBM B;  3BDL A;  5J3B A;  4OGC A;  2R57 A;  1VQ7 A;  3L2W A;  1XNI A;  4EMK A;  3OS0 A;  2KVQ G;  1YJ9 A;  4XU0 A;  3OYH A;  3CMA T;  1UGQ B;  3L42 A;  2RJC A;  2LC4 A;  3OS5 A;  1VQ4 T;  2QA4 A;  4QQD A;  2RHY A;  4A4F A;  3OYK A;  5CAI A;  4QVZ A;  3URG A;  3PMI A;  1YJW A;  1SSF A;  2VXF A;  4PJO B;  4BY6 C;  2OTL A;  4KUI A;  1GXI E;  2QQA A;  1R8O B;  4F7U G;  2V8I A;  5DM7 R;  3LYI A;  1Y71 A;  2AHJ B;  1VQ6 A;  4J8O A;  4BE1 A;  1QVG A;  3CCR T;  2WSC E;  3SB2 A;  1M1G A;  2KSS A;  5GAN 4;  1UGR B;  3MP8 A;  3M54 A;  2LRQ A;  3OYB A;  4M7D B;  3OBY A;  1RL2 A;  4NOY A;  4L59 A;  3P8D A;  1U8R A;  3SWN C;  2CKK A;  4J6X A;  1N9S A;  4N0A A;  4O6J A;  3J7A F;  2GCX A;  4HT8 A;  3RMS A;  3LX7 A;  3FB9 A;  4XU1 A;  3DB4 A;  1YI2 A;  2CS7 A;  4C8Q C;  4M77 D;  1KQS S;  2JUF A;  2L8D A;  4C8Q G;  4LDY A;  4C92 E;  2EQM A;  3CCL A;  3L2U A;  1H64 1;  3HRU A;  2FYK A;  3F70 A;  1M90 U;  1VQN A;  2XID A;  4IUV A;  1B34 B;  4LDU A;  1JB0 E;  2O4X B;  5DLQ E;  5DLO A;  3HSB A;  2X4Y A;  5HK3 A;  4M78 D;  4BB7 A;  1KC8 U;  1X75 C;  2QEX T;  1Y96 A;  3C4S A;  4ZGE B;  2YHT A;  4M77 E;  1H3Z A;  3JCM d;  3QYG B;  2EFI A;  1UGP B;  2FVU A;  3JRZ A;  3V7C A;  2EQJ A;  1VQK T;  3HHT B;  5GMK h;  4PKC C;  3JCM W;  2E41 A;  2XK0 A;  3JCM Q;  1VIE A;  4M7A B;  1EIF A;  3TRE A;  4PNO A;  1VQM A;  4M78 E;  1D3B A;  2OAU A;  3CCV A;  2M0O A;  2M9U A;  3I56 A;  5GAN f;  1VQ8 A;  4OF1 A;  1NPR A;  3TEE A;  5CKF A;  2DPP B;  2XU8 A;  1TH7 A;  2M16 A;  4GY5 A;  4M75 B;  3CCM T;  4IUP A;  2KK4 A;  3HRS A;  4JLG A;  4QVC A;  1YJN A;  2RHI A;  4N4I A;  5CQX A;  3MCA B;  3G6E A;  4XTU A;  2A3L A;  2GQV A;  3M59 A;  3JAM E;  4PJO G;  5C0M A;  3ZEH A;  1KD1 C;  4C8Q F;  1UGS B;  3A8G B;  4FL6 A;  1QVF S;  2HBP A;  2Y4Y A;  2YLB A;  3OYC A;  3A8L B;  3BW1 A;  3HL8 A;  1K73 C;  2E1H A;  3OYG A;  1S72 T;  2OTJ A;  3V8K A;  2VC8 A;  3MEV A;  5KE2 A;  5GAN 5;  2ZCF B;  2B8A A;  4C0Z A;  4DOV A;  3SWN A;  3TCJ A;  4C0D C;  4BE2 A;  4DOW A;  3CXC S;  3JCM X;  3T9N A;  3M9Q A;  3OYI A;  2NLU A;  5CKH A;  3OYA A;  1KHC A;  2XKO C;  3OBW A;  2RJF A;  3QUI A;  4M7D C;  5GAN 3;  5FU7 B;  2EJ9 A;  2K4Y A;  2F69 A;  3H6Z A;  3M4G A;  4HKE A;  4B9W A;  3A8O B;  3GNF B;  3E9G A;  3QZ5 B;  1OZ3 A;  4PLL A;  5A0L A;  1M8V A;  2EKO A;  4M75 D;  5GMK m;  4JJN K;  2ZPE B;  1UEB A;  4BI8 B;  4E7K A;  4JRI A;  1G3W A;  5LJ3 j;  3JCM J;  4NS5 A;  3DB3 A;  3PIO A;  2HD0 A;  1XTD A;  3JCM h;  4ELY C;  4ZN3 A;  3M4Y A;  5I2M A;  5C6S A;  2DXB A;  5GAN 2;  5LJ5 j;  2DIQ A;  2DXC A;  1ZHI A;  3HRT A;  5LJ3 f;  2MAM A;  3OS1 A;  2V8J A;  4QW2 A;  2HNI A;  5GAM j;  4FU6 A;  2CGH A;  2K5L A;  3E19 A;  3CCR A;  4BE0 A;  4MMK A;  3OYM A;  2RK2 A;  3UPU A;  1NJI C;  2CZ6 B;  5FRO A;  2XD0 A;  3MEU A;  3HFO A;  2X4W A;  1PSE A;  2X35 A;  5LL6 S;  2D9T A;  3VU3 C;  5I21 A;  3QKJ A;  4QQG A;  5GAM f;  4D6W A;  3FEO A;  3UWN A;  3CBO A;  4R56 A;  1Y07 A;  2ZPG B;  4J5Y A;  4PJO F;  5KCH A;  5FRN A;  4MML A;  4JUV A;  3VV0 A;  1Q81 C;  1M1K C;  4ELZ C;  3MP1 A;  2DTO A;  3OYJ A;  2KMT A;  4N4H A;  5KE3 A;  5FU6 C;  4C92 B;  4M7A G;  3DLL A;  1M1F A;  1ZBX A;  3CC7 T;  3RES A;  2R58 A;  2VXE A;  1BI0 A;  3BY7 A;  4NL2 A;  2HAX A;  2LT4 A;  3S3N A;  4ZTJ A;  1K9M C;  2CYZ B;  4XU3 A;  2VYT A;  2XI9 A;  1YIT T;  2RO0 A;  3P8H A;  4II1 A;  3GPL A;  4JS5 A;  1HXD A;  4M7D F;  2DIG A;  3SDZ A;  3PNW C;  4M75 G;  1DJ7 B;  3OYD A;  2ZPH B;  4EMG A;  4M77 B;  2KDS A;  5IAY A;  3HPW A;  3OYF A;  3GOX A;  2QEX A;  3VYH B;  2ZPB B;  4HCB A;  1LJO A;  2E5Q A;  3QII A;  1VQK A;  1XOV A;  4KUL A;  2XDP A;  2RHZ A;  2E10 A;  3NTI A;  3G4S T;  3ME9 A;  5GAO p;  3JB9 H;  4M7D A;  4MZT A;  4M78 B;  3QO3 A;  2DO3 A;  1Q82 U;  2PU9 B;  1WQW A;  5D6W A;  3JB9 F;  4BI4 A;  3CCE T;  1WPY A;  2QQB A;  1MHN A;  4C92 D;  1W2B S;  4HCZ A;  4VUB A;  1N8R U;  3M58 A;  5FU7 C;  4KT0 E;  4EMK B;  4MZM A;  2GFU A;  4B9X A;  3CCM A;  2RH2 A;  3UDC A;  1JJ2 S;  3VJP A;  4EPC A;  1Q86 U;  3UT1 A;  2DXT A;  1B34 A;  4C8Q E;  2EJF A;  2LCL A;  3NTH A;  3OY9 A;  3C12 A;  1QP3 A;  4M7A F;  5CVI A;  2WSF E;  2LQK A;  2PUK B;  4J6W A;  5CQY A;  2RD1 A;  4ZGJ B;  1WQ7 A;  3PT9 A;  4BAC A;  4OB3 B;  3N5B B;  3VKI A;  3WVE B;  3X25 B;  3FDR A;  3M5A A;  2CZ7 B;  1JRI A;  2QTX A;  3CEY A;  1S72 A;  4XTV A;  3JB9 J;  4RMO A;  5GMK e;  1WJQ A;  2H3J A;  2P0K A;  5LJ3 d;  5KH6 A;  2MI6 A;  3CCU T;  2PUO B;  3MET A;  4GLK A;  1BYM A;  4C5I A;  4IUU A;  4XU2 A;  5LJ5 d;  3H8Z A;  4F7U F;  3M57 A;  3J81 E;  3M53 A;  4MDW A;  3M56 A;  5GAM d;  4BDY A;  4DA4 A;  5GAN h;  4BD3 A;  5GAN j;  4C92 G;  1QVG S;  1YIJ T;  4J83 A;  1VQL A;  3OQ5 A;  2FB7 A;  4FT2 A;  4LD6 A;  3X20 B;  4HT9 A;  3DLM A;  2JOY A;  2DZC A;  4V2S A;  2E70 A;  2EQU A;  3JCM g;  2Y4X A;  2QDY B;  4OGE A;  1M90 C;  4FIB A;  4F7U A;  2E6Z A;  2PQW A;  1VQ5 A;  3QBY A;  4Y91 A;  4M77 G;  3OW2 A;  1K8A U;  3ZBD A;  1O9S A;  4FM4 B;  1KC8 C;  3SD4 A;  2JZ2 A;  3J80 E;  1NPP A;  4PJO C;  1VQ6 T;  3L2Q A;  2VGN A;  1XQH A;  4C5H A;  2F5K A;  3MP6 A;  4LDX A;  2JNG A;  2FL7 A;  1M9S A;  4M78 C;  1ZQ1 A;  3CME T;  3DKM A;  4M78 G;  5GAO q;  2JTF A;  3LW5 E;  4C5G A;  1VQP T;  3CC7 A;  4BI3 A;  3QG1 A;  2XDB A;  3WVD B;  1Y7X A;  3LLR A;  4L6V 5;  3VUZ A;  4ZN1 A;  5GMK l;  3G71 T;  1WNL A;  3KXT A;  5FRM A;  4M7D E;  3CMA A;  5GAN 8;  1YIT A;  2LT1 A;  4C8Q A;  2QQS A;  3JCM e;  3QXE B;  4ZTF A;  1VQ4 A;  3OB9 A;  4JLI A;  3QZ9 B;  5A0G A;  2DD5 A;  3CPF A;  4BY6 B;  1MGQ A;  5LJ5 e;  1VQ9 T;  4KUD K;  4X9D A;  3KBG A;  3QJ6 A;  5LJ3 h;  3QJY A;  3CBP A;  3CPW A;  4JS4 A;  4C0F A;  4J6Y A;  2ZGW A;  4QQ6 A;  3MEW A;  4OP0 A;  5HKC A;  4XK8 E;  4TVR A;  1FWZ A;  2L5Q A;  3BDU A;  2ZPI B;  3EFR A;  5LJ5 h;  3QSU A;  5GAM h;  4EDU A;  5CKD A;  4WF2 A;  3CCE A;  2DVE A;  4ME7 A;  4YTL A;  3CD6 T;  2GFA A;  4L5G A;  4M77 F;  2L89 A;  3SWN B;  5GAO l;  2RM4 A;  4LD9 K;  3MHX A;  1M5Q 1;  1BI1 A;  3QDR B;  4FT4 A;  4LDW A;  3RIR A;  3ZFJ A;  2PVG B;  2XDD A;  1VQ5 T;  1IZ6 A;  4E7J A;  3VYG A;  2KAF A;  3A8M B;  2A7Y A;  3PFS A;  3JCM b;  5A2Q E;  1VQM T;  3LGL A;  2BIV A;  3PIP A;  4M7A C;  3NTK A;  5GAO m;  1VQO T;  2G3R A;  3JB9 I;  2RJD A;  1VQ8 T;  4M78 F;  2D6F A;  4MZP A;  5GAN 7;  4C0G A;  3CCQ T;  2K5I A;  2RI5 A;  4QVD A;  4OMF B;  3CC4 T;  4PJO A;  2O01 E;  3G6E T;  3CCJ T;  4M75 C;  4E47 A;  3AHU A;  5GAN d;  5IT9 E;  3VUB A;  4Y28 E;  1N8R C;  4CI0 C;  2LX9 A;  1G3Y A;  2EWN A;  3LWI A;  3S6W A;  2BUD A;  3CCU A;  3WXM B;  2K57 A;  3E1S A;  4F7U E;  4BDZ A;  3NFC A;  3OSV A;  1BI3 A;  3FIF A;  3SFM A;  2OTJ T;  1KQS A;  3O8V A;  1KQ1 A;  1G3S A;  3PTA A;  3FC3 A;  1OI1 A;  3OA6 A;  4IKF A;  3OMG A;  2EIF A;  5M9O A;  2DJZ A;  2P4T A;  3C95 A;  1X01 A;  3P8B B;  4C8Q D;  5GAN g;  1YIJ A;  2DK3 A;  2M1H A;  2RJE A;  3PGG A;  4CRI A;  1U1T A;  3GF5 A;  3X26 B;  5J39 A;  1W4S A;  3CCS T;  3OYE A;  1BI2 A;  5EG2 A;  2CZ0 B;  2R5A A;  2QXF A;  3JCM V;  2K2V A;  2LTO A;  4A4E A;  1NE8 A;  2QQ9 A;  3CBM A;  4Z02 A;  3L1A A;  1Q7Y U;  2K3Y A;  5CR2 A;  2YRV A;  4J7F A;  2DEQ A;  2JVV A;  2ZPF B;  1QP2 A;  2O4X A;  3M55 A;  2LDM A;  4PL6 A;  2R5M A;  5CK9 A;  3I55 T;  3RER A;  2DTH A;  3OMC A;  4RG8 A;  4EMH A;  1UB4 A;  4A54 A;  3FJP A;  4JRK A;  4A4H A;  2RHU A;  1IRE B;  4C0D B;  3RKY A;  2RA2 A;  1QVP A;  2DKG A;  2HQX A;  3CME A;  1RI0 A;  1YHQ T;  3CC2 T;  3EAE A;  4FSX A;  1VQP A;  4M75 F;  5HK0 A;  3A5Z B;  3GP8 A;  1Q82 C;  1N9R A;  3FRN A;  2QQR A;  1FXX A;  5GAN e;  4M7A A;  3JSC A;  2K5F A;  3G71 A;  4ATO A;  2RB6 A;  5GMK i;  1U1S A;  5GAO r;  3E9F A;  4JRP A;  4IUR A;  1VUB A;  2XG8 D;  5A0D A;  3RKX A;  3ASK A;  2VUB A;  4NL3 A;  2DAQ A;  3QHS A;  3OYL A;  3V7R A;  3OYN A;  1G3T A;  3L2V A;  1QVF A;  4C92 C;  1VQ9 A;  1LOJ A;  1VQ7 T;  3OSS C;  1QW1 A;  1YJ9 T;  4HA8 A;  1Q86 C;  2LNV A;  4M75 A;  4Q5W A;  2WAC A;  3JCM c;  3X28 B;  4PJO D;  1Q7Y C;  2LQ8 A;  2MMP A;  2MWP A;  2CZ1 B;  3EFS A;  2X4J A;  3Q1J A;  5LJ3 g;  3R6O A;  2PVD B;  2QA4 T;  3CXC A;  2DTI A;  1I4K 1;  3LGF A;  5LJ5 g;  4RG2 A;  1YJW T;  1WGS A;  1KD1 U;  4IUT A;  2DXU A;  5CCA A;  5GAM g;  4M77 C;  5D6Y A;  2LVM A;  2OTL T;  1KG1 A;  2KY9 A;  5HY6 A;  2K3X A;  5J26 A;  3CD6 A;  4A4K A;  4PJO E;  4M7D D;  3QPH A;  1K73 U;  2PVO B;  4LDV A;  5GMK j;  1Y96 B;  2IVW A;  3X24 B;  3S3M A;  2XIC A;  5IN1 A;  5KCO A;  1NZ9 A;  2RK1 A;  2KQW A;  4OB1 B;  1WJR A;  2LCC A;  5FU6 B;  2C06 A;  2EAY A;  4PLI A;  2E12 A;  2VV5 A;  3PMT A;  4XAX B;  4XTW A;  2ZZD A;  3RKW A;  3S3O A;  4J7I A;  3FLG A;  4RCB A;  4XQ3 A;  2JN0 A;  1I81 A;  4BUG A;  4R55 A;  1VQO A;  2HQE A;  1KQ2 A;  4RCC A;  4OB0 B;  1O75 A;  3L2Z A;  1LNX A;  5CIU A;  2X4X A;  3CCQ A;  2E64 A;  2MF2 A;  5DY9 A;  1KHI A;  3JB9 D;  1D3B B;  5LJ3 e;  2YLC A;  1BIA A;  4OVA A;  4EMK C;  3GLX A;  3CC4 A;  1PSF A;  4X9C A;  4A53 A;  2EQK A;  3CCJ A;  1YI2 T;  3GIB A;  2BKD N;  2RI3 A;  2WSE E;  3CCL T;  2F5T X;  4F7U B;  2DZ9 A;  1VQN T;  5GAM e;  3HP9 A;  2Y90 A;  5GAN 6;  4ZGD B;  4C92 F;  1K8A C;  2JTM A;  3ER0 A;  3OS2 A;  1NJI U;  1I8F A;  3MEA A;  3V8L A;  3LWH A;  4MDX A;  3HKS A;  2E6N A;  5D6X A;  2EJG A;  4RKU E;  3G4S A;  1X6O A;  4M7A D;  3TU4 K;  1WJS A;  2IG0 A;  3G7Z A;  4N4G A;  3L2R A;  5FLX E;  3GNG A;  3QYH B;  1Q81 U;  1M1K U;  2XHC A;  4M7D G;  4JDS A;  4JRQ A;  2P0Q A;  4XTY A;  2V8K A;  2GF7 A;  2VGM A;  3LH0 A;  4C92 A;  2I2L A;  3CCS A;  3A8H B;  4XTZ A;  3OW2 S;  1G5V A;  3MO8 A;  2DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...