4PL6A

Structure of the chromodomain of mrg2 in complex with h3k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At1g02740
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pl6A00
3PFSA 4II1A 2YRVA 2F5KA 3MEWA 3LYIA 5D6WA 1SSFA 4C5EA 2RJDA 4E7KA 2DIQA 2RHYA 3META 2EQUA 3DB4A 2XK0A 2L8DA 4BD3A 2GFAA 3S3NA 2MWPA 2RJFA 3L42A 3NTHA 4IURA 3OYIA 3L2WA 2L89A 2RI5A 2IG0A 2LDMA 2QQRA 1N27A 4N4GA 4C5HA 5C0MA 2M1HA 5KH6A 3OYJA 4QQ6A 4IUVA 3L2UA 4BDYA 2K3XA 3OMCA 2XDPA 5IN1A 5KCOA 3L2QA 3ZEHA 4IUPA 2L3RA 2B8AA 2BIVA 3OA6A 3H6ZA 2M16A 3QKJA 5FROA 3NTKA 4FU6A 2EQMA 2R57A 4BDZA 3QBYA 2NLUA 3ASKA 4B9XA 2DIGA 3E9GA 4A4FA 3PNWC 3LGLA 2WACA 3ME9A 3MEUA 3Q1JA 2LVMA 2RI3A 2LRQA 3C4SA 5C6SA 3OYBA 3FLGA 4UC4A 4QVZA 2BUDA 3E9FA 4L59A 3PMTA 5J26A 4IUTA 4N4HA 2X35A 3M9QA 4QQGA 2R58A 2QQSA 2M0OA 3UT1A 4B9WA 4PLLA 3QIIA 3OY9A 2MWOA 5CIUA 4IKFA 2DAQA 3OYMA 4OVAA 3S3MA 3MEVA 3L2VA 1OZ2A 2BKDN 2K3YA 1H3ZA 3BDLA 3LLRA 3OYLA 2HQXA 4BACA 5M9OA 1XNIA 3CEYA 2RHUA 2X4WA 3OYHA 4Z02A 2GF7A 4LD6A 3FDRA 2JTFA 3F70A 4A4HA 3OS2A 3SD4A 2HQEA 3O8VA 3QJ6A 3OYDA 3EAEA 2RI2A 3FEOA 3OQ5A 4CRIA 2R5MA 4E7IA 3OB9A 2G3RA 2LCCA 5IAYA 4IUUA 4N4IA 3MEAA 2GFUA 3GOXA 4E7LA 4BE1A 5D6YA 4BE0A 4QW2A 3L2RA 4GY5A 4PLIA 3OS0A 5FRNA 2EKOA 2EQKA 1KHCA 2RHXA 1WJRA 1RI0A 2RO0A 2LTOA 3KUFA 5D6XA 4BE2A 4PL6A 2X4YA 3H8ZA 3OYGA 1WJSA 4A4EA 2EQJA 3MO8A 3MP8A 3FC3A 2E6NA 2E5QA 3LH0A 4C5IA 5KCHA 4A4GA 5FRMA 3OMGA 3UWNA 1G5VA 4IUQA 1OYXA 2R5AA 3DLMA 3MP6A 3NTIA 4RG2A 4NS5A 4Q5WA 2EFIA 5J39A 4ZTFA 4FL6A 3OYFA 3MP1A 2D9TA 3OS1A 3DB3A 3OYNA 2JZ2A 4ZTJA 1WGSA 2VYTA 2CKKA 1MHNA 2FHDA 4C5GA 3OYCA 2O4XB 2X4XA 3LX7A 4QQDA 4X34A 2RJCA 3OYAA 5KE2A 4HCZA 2O4XA 4EDUA 4E7JA 1OZ3A 1OI1A 2RHZA 3P8HA 1WJQA 4E7HA 3LGFA 3PMIA 3OYEA 3P8DA 2PQWA 2RJEA 3S6WA 3S3OA 3OYKA 2RHIA 5KE3A 2P0KA
chains in the Genus database with same CATH superfamily
2E1HA 2CP5A 1M3BA 1GCPA 4C0DC 2FEIA 1OV3A 3META 2EQUA 3CBOA 5EC7A 1D3BB 2V8IA 1NPRA 1D3BA 4FSXA 1VQ6Q 1T0HA 4N4GA 2E4HA 1W4SA 4PJNA 4M75E 3CCST 3TQ7P 1RAAB 3CCQT 2ZPEB 1PD0A 2B8AA 4J5YA 4JJDA 3RERA 5KYUB 2PUKB 1I81A 3CXCA 5KYUA 2O88A 3LWIA 4M78D 4D8DA 2FVUA 2VUBA 5C6SA 1KQ2A 2OTJA 2EAYA 3V8LA 1Q82R 2DLPA 1VQ6A 1AWXA 2YUOA 2CDTA 2R58A 2K2VA 2DAQA 2PZ1A 2K7AA 3QDRB 2ZPIB 4BACA 1EX4A 3OYHA 2E6ZA 2ZGWA 2LT4A 1M8VA 3V7SA 4RTYA 3M4YA 3M0PA 2HQEA 5LJ3j 2A3LA 2RI2A 4PFZA 4ANJA 1BYMA 1ZLMA 4J9DA 2CZ6B 1SKUB 5FRNA 1G3TA 5D6XA 2QTVA 2VB6A 8AT1B 4MDXA 4TVRA 1YJWQ 1K4US 2DBMA 2J06A 5DLOA 5FU7B 3WVEB 4M78C 4M78E 1V29B 4FYYB 1I07A 1K9MU 2LX7A 5A2QE 1PWTA 1Q86R 4LUDA 4M77F 1LCKA 5GANh 2HSPA 4J9CA 1OQKA 2LMJA 4KT0E 4XQ3A 1YJWA 4KGVB 4Y92A 5DLQE 3A5ZB 4PJOF 2HZYA 4C8QG 3KXTA 1SHGA 4FW2A 5KE3A 1KHIA 3EGXB 1K73U 4DBFA 2DERA 1QMCA 3EGXA 2RHYA 3QUIA 1M1FA 3A8LB 3S3NA 2CGHA 3SHWA 5GAOp 4OB1B 2DRKA 4AG1C 3OYJA 1U5SA 1ZQ1A 1N8RC 2HDAA 4LDWA 3NTKA 3CMAT 3HP9A 4LD9K 1VQKQ 2GCXA 3PIPA 2VWFA 1K9AA 3ME9A 3JCMV 3ZBDA 3RNJA 1JJ2A 4PFPA 3V8KA 1YNZA 1B3QA 5AYFA 4L59A 1M30A 3RDVA 3UPUA 4OGEA 5J26A 4E47A 1GBQA 4HT8A 3LWHA 2MPXC 1YITT 3OYMA 3GLXA 4RKUE 2L3QA 1TG0A 1ACMB 2Y4YA 3MPUB 1VQKA 3HHTB 2QA4T 2DZ9A 4LDVA 3OS2A 5GAMe 2BZXA 3EH1A 1ABOA 3FEOA 3M0SA 4P5NA 4XTXA 3VRYA 2DYBA 3CMET 2O01E 4C92F 4FM4B 3M0RA 1QP2A 1MNEA 2ED1A 2MIOA 2K5IA 3A8HB 4RCBA 5CO7A 3PT9A 1ZSGA 2CT3A 5I2MA 4ATOA 2JMAA 5KYYB 1VQPT 3OW2P 4K11A 3OW2S 5L23A 2GQVA 1UGSB 3CCET 2VV5A 1Y0MA 4OMQA 3ZL7C 3VUBA 1KJWA 3ULRB 1ABQA 4MZMA 3C94A 3QJYA 1B34B 4E7JA 1KC8C 3CC2Q 3CCJQ 1B34A 1IGUA 3LGFA 3P8DA 3VJPA 2RJEA 3JCMf 1VQ7Q 2YRVA 1I8FA 2EW3A 3G71T 2RJDA 3M5AA 1AOJA 1YWPA 2KSSA 2NYSA 1WI7A 2GNCA 3E2UA 4IURA 1M90C 2JUFA 2RI5A 2IG0A 4WCIA 5GANf 3QHSA 3CC2A 3CCJA 2P4TA 3UA6A 3VS5A 4GBQA 3JCMQ 1VQ7A 3QKJA 2PU9B 4DEXA 4J7FA 5GAN4 1F1BB 1Q82U 2V8JA 1LPLA 3C95A 2CSQA 4NL2A 4M7DF 1RADB 3HRUA 4FYXB 1QCOA 1VQMA 3SFMA 4A53A 1Q95G 2EYYA 2KT1A 2L5QA 4LN2A 3PMTA 3VV0A 3HFOA 4IUTA 4PJOD 5CCAA 2LQWA 1KD1C 1UGQB 3RKWA 2MWOA 2LX9A 2X51A 4DOVA 1OZ2A 4J6YA 3JB9F 2DZCA 2FL7A 2HQXA 2FZKB 2RHUA 2YDLA 4ME7A 5GAMj 2HNIA 1LVKA 2KYMA 5HK0A 2HL3A 2F1LA 2R5MA 3JB9H 2MAMA 4OMOA 3URGA 1UECA 4E7LA 3J80E 2DXBA 1EZZB 1VQ8Q 2OTLQ 5FU7C 4L6V5 2M9UA 1WJSA 4M77E 3J81E 3H0HA 2NUTB 5GAN8 3UWNA 1VA7A 2NUTA 1Q86U 3CPFA 3REAB 4J9BA 3OYFA 4BY6B 5GAMh 4PJOC 2YXYA 3VKIA 4ZTJA 1JB0E 3OYKA 4AFQC 3LX7A 1Q81R 1YJ9T 4RG8A 1VQ8A 4JPBW 1JJ2S 2OTLA 2OTJT 3QWYA 1QVGA 1VIFA 4F17A 2F5KA 3RR6A 1X2KA 1PNJA 4C5EA 2LC4A 1HK9A 4KGZB 3I55A 1M8MA 3CBMA 5HKCA 3I9QA 3MHXA 4OB0B 1XQHA 2AZSA 2CP0A 1AVZC 4IUPA 2FZGB 1ZBXA 2GTOA 2V8KA 2YUNA 3O5ZA 2K9GA 2RI3A 1HSQA 1QP3A 1YJNA 4F7UF 4M7AF 1D0XA 4LDYA 3OYYA 2QQBA 1S72A 2EGAA 1JRIA 5D7UA 4M75B 4C92E 4M75A 3JB9J 3CC4T 2GF7A 3O8VA 3UA7A 4HKEA 3M59A 5GMKl 2DXTA 3CCLQ 3TEEA 4GY5A 4PLIA 2ZZDA 1AWWA 3VS3A 2YLBA 3HPWA 4C0ZA 2QI2A 4J7IA 5GAN2 4Z88A 5GJWB 3OMGA 3EFOB 4IIMA 2RD1A 3EFOA 1FWZA 4ORZA 4WTOB 2D9TA 3CCLA 3CPWA 2DE0X 2X3WD 4C5GA 3V7CA 1Z9QA 2ZPFB 5CKDA 2E3IA 2LNHB 5LJ5g 3MKDA 3G4SQ 2PNIA 3PMIA 2HD0A 3S3OA 4JJNK 4XTZA 1KQ1A 3PFSA 3RMSA 4M78B 3MEWA 4M78A 1AWOA 2KR3A 3M0UA 4OP0A 3DB4A 4DEYA 4KUDK 1G3YA 2LQNA 1K9MR 5LJ5f 5KYXB 5KYXA 2GQIA 4M7DE 5HY6A 3G4SA 1C1AA 3EFSA 3M57A 3L2QA 2HKNA 2EIFA 3RIRA 1BIBA 3OA6A 4YTLA 1T3SA 3ASKA 2FG0A 4O5VA 5GMKm 2XI9A 3OYBA 5L8RE 2KT8A 1NBEB 4J9EA 1G3SA 1QQJA 4EMKC 5IXFA 1IZ6A 3EFRA 2EPDA 1RAHB 2EBPA 1WNLA 2XICA 1WXTA 1KK7A 1FYNA 4A4HA 2Y4XA 1LJOA 1P92A 1TOVA 4E7IA 3M4GA 1YWOA 4C8QF 3QZ9B 1OEBA 1VQNA 3JCMe 2CH4A 2HEQA 1CKAA 2FPEA 1KG1A 4CC7A 3DLLA 1YCYA 4M7AD 1BI2A 4J9HA 3HRSA 1HD3A 4OMNA 1BI1A 3CCVQ 2RM4A 2E10A 1ZBJA 2D6FA 3CCMQ 3NHNA 5GANe 1Q81U 4OMMA 2D8JA 1QLYA 4L5GA 2NUZA 4HCZA 4HCCA 2O31A 5IHIA 2CT4A 3M56A 2SEMA 1Q7YC 1NYGA 1VQMT 4M75D 2H3EB 5D6WA 1WDXA 1IREB 1E7OA 1UFFA 3CCMA 4MMKA 2MF2A 3L42A 1WQ7A 3FJPA 4J9GA 1QCFA 4C5HA 1YI2T 5KH6A 4NOYA 3KFVA 2M51A 3OMCA 4M7AC 4F7UE 4JJBA 1QW1A 1AWJA 1D1AA 1VQ4Q 2DIGA 2EWNA 4RMOA 4KRTA 2YWWA 2JT4A 1D0YA 3E19A 1BI0A 1WXBA 1XJWB 4XTUA 3CBPA 1TUCA 2CUBA 2M0OA 4B9WA 1QVPA 4PLLA 2DL3A 4M75C 2JS2A 2EVRA 2BE7D 5CK9A 3PVLA 4XU3A 2B86A 4XTVA 1YIJQ 8ATCB 2X4WA 1PM3A 2DYIA 3HL8A 4D6WA 4JZ3A 3WVDB 5D6YA 4XTYA 1PHTA 2LZ6B 2LJ0A 3OS0A 1KHCA 4OMPA 1EFNA 3VYGA 2HAXA 3OYGA 1KQSP 4CC2A 2E5QA 1YIJA 3LH0A 2QEXQ 1KQSS 1TSFA 5GAN5 1YBYA 2QAZA 3DLMA 4MZTA 1W2BA 2K6DA 4KH1B 5GANj 1FMWA 2DVJA 2F2VA 3G6ET 5GAN3 3HKSA 3V7RA 2XDBA 4PJLA 5CKHA 1Y7XA 2GBQA 1QCNA 1WHHA 1BBZA 1WPYA 4JS5A 2W10A 3JCMh 1D1BA 3CCRQ 1YJNT 1DJ7B 4M78G 4GLKA 2QEXA 4FT2A 5AT1B 4II1A 3M53A 1IXDA 1VQLQ 1VQ5Q 4PFOA 1UJ0A 2RJFA 3NTHA 3OYIA 2K3BA 4PJOB 3QXEB 2QQRA 2ESWA 1RUWA 3R6NA 4PJOA 1S1NA 2M1HA 1K8AU 3QPHA 1YN8A 1NM7A 1SPKA 2E64A 2XDPA 3CCRA 2QASA 2L3RA 2AIRB 4Z89A 4FU6A 2EQMA 5A0DA 1FMKA 4OB2B 1CSKA 3EG2A 1HYOA 2VGNA 1VQLA 3LGLA 2QGGA 1K0SA 2LRQA 3OBWA 3UDCA 2DL5A 3R6OA 5HK3A 2RQUA 2CP6A 2O2OA 2D0NA 1H3HA 4FCYA 1JBMA 1VIEA 4IKFA 1ZHIA 4OMLA 2QDLA 2W0ZA 1UEBA 4AFSC 2K3YA 4C8QC 4C8QE 3LLRA 5M9OA 1MGQA 1XOVA 2ZAEA 2NUPB 2RQTA 1SRMA 2BE9B 4KBMB 2NUPA 1JEGA 1ZUUA 5IAYA 3I35A 4X9CA 1K1ZA 1TWBA 2X4JA 3RMQA 3L2RA 3QG1A 1H3ZA 1WJRA 1AZGB 3KUFA 4DOWA 2VGMA 2G6FX 7AT1B 4M4ZA 2QYZA 2MYSA 2EFIA 5LJ5e 2DF6A 1VYVA 3OYNA 2EYXA 3JB9I 1MHNA 3X24B 4JLIA 5LJ3d 4ZGDB 1N8RR 2PVDB 1I0CA 1NJIU 4PNOA 2IPOB 4IIOA 3INZA 5KYYA 3GP8A 4CC3A 1AT1B 3RKYA 4FYVB 5CQXA 1YHQQ 2X9HA 1Y07A 3U23A 3L2WA 4F14A 3CXCP 1C6VX 4R0KA 4JRKA 4JRIA 1VQ9Q 3CXCS 3M0TA 2CYZB 2FYKA 4IUVA 3L2UA 2DEQA 1NE8A 1NEBA 2JW4A 2LT1A 2R57A 2M0YA 1WFWA 2NLUA 3PIOA 1VQNT 1BCMA 3CD6Q 3Q1JA 4GLMA 1YHQA 2AKLA 1U1SA 4Y28E 5GAOq 1R0BG 1X27A 1Q7YU 1MV0B 4HT9A 1H8KA 1JO8A 1VQOT 2QGFB 2KRNA 2F2WA 2YRCA 3OY9A 1NZ9A 1LNXA 3C12A 4OB3B 1M2OA 3CCUQ 2ROLA 1TS9A 5LJ3g 2H8HA 4MDWA 3CEYA 2JMCA 4M77D 1IHVA 3FDRA 3CD6A 2F5TX 3M54A 3EAEA 2YLCA 2HL5C 1H641 3I56Q 3X20B 1RI0A 1QKXA 2JS0A 4DA4A 3CC7Q 2L3PA 2KNBB 1M27C 2K4YA 2D0QB 5CR2A 2KQWA 4EMKB 4XU1A 2E6NA 3SWNB 4EMKA 2XHCA 3SWNA 4IUQA 1RAGB 5LJ5j 3TCJA 2Y90A 1M90R 4FL6A 4HVVA 4RTUA 2JVVA 4C0FA 2A0FB 2VYTA 1ZSZC 2O4XB 3I56A 2O4XA 1OI1A 1ZUKA 3FRNA 2I2LA 3P8HA 5A0LA 1SEMA 1ZUYA 4A4KA 1WHJA 2A36A 4M77C 1RLPC 2RQVA 2O9VA 3SEMA 3CCSQ 2DEUA 3CCQQ 4PJOG 4BD3A 1GXIE 5LJ5h 1G3WA 2LP5A 3M55A 1IGQA 2DJZA 1KD1R 3A8MB 4R55A 2D8HA 3CQTA 3EHRA 2L2PA 4QVCA 1JJ2P 4C0GA 4QQ6A 1TU0B 2DVEA 4XTWA 2ZPGB 5FWCA 1OU9A 1IRXA 2QDYB 1VYUA 3H6ZA 4BDZA 2KBTA 2V1RA 3QBYA 1I1JA 1VQ6T 1MV3A 3JRZA 4C92D 3GIBA 2WACA 2DD4A 3CCQA 2HSEB 2ZCFB 3WXMB 1OULA 2QG9B 3BE3A 2ECZA 2KI7A 3T9NA 2P84A 4DBHA 3MEVA 3NGPA 4R56A 4VUBA 3IQLA 4M7AB 4F7UB 5I2SA 3G1JA 3OYLA 1LOJA 3H0IA 4M7AA 2E5KA 3L1AA 1UG1A 2JTFA 1IHWA 2XKOC 1M5Q1 2PTKA 4D8KA 1OPKA 3OB9A 2LCCA 2LJ3A 2COZA 5GJVB 4BI8B 3GOXA 1QVFA 3HTRA 2OAWA 1WIEA 2RO0A 2PUOB 3VS6A 2LCSA 4FIBA 4C92C 3GNGA 4DBQA 1UGRB 5DM7R 5CQYA 3NTIA 2AK5A 2IVWA 1YJWT 3MP1A 1SSHA 5GAMd 1WGSA 2RPNA 1HXDA 1N8RU 4BI3A 1Y57A 3GPLA 2RB6A 2CH4W 4PJMA 2RJCA 5I22A 4XAXB 1RAFB 3JCMc 4JRQA 3QDFA 4Z8AA 2JM9A 4XU2A 1SF9A 4KUIA 4M7DD 1JXMA 1AEYA 4MMLA 2E65A 2C0OA 3OSVA 1SSFA 2DIQA 2DRMA 1UUEA 3LH5A 2J6KA 2Z0WA 1UDLA 2EJGA 1AD5A 3CMAQ 2DFUA 1K9MC 5CAIA 3JB9D 3G7ZA 2DL4A 1UTIA 4N0AC 3HSBA 4BDYA 3ZEHA 2A7YA 3VS7A 1PKTA 2DJQA 3QYHB 2ROTA 3PE0A 3QSUA 1YITQ 3PNWC 4AT1B 1X75C 2PVGB 3FLGA 3CMAA 1I4K1 2VASA 2MCNA 6AT1B 1K73C 3M9QA 2RMOA 2QA4Q 4FT4A 1VQKT 4M7DC 5I21A 1D09B 3CMEQ 4JDSA 1K8AR 1T3LA 1YITA 1V76A 3M58A 2EJ9A 3F70A 4BI4A 1GCQC 3BDUA 3JCMb 1KC8U 4QKUA 3X28B 3OS5A 1VQPQ 1NG2A 3MCAB 2QA4A 3CCEQ 4FYWB 1AZEA 4EIKA 1NEGA 1RAEB 1AHJB 4LE9A 3A8OB 3X26B 1WYXA 4ELZC 3CMEA 3SWNC 4C5IA 1M90U 5FRMA 4C8QB 5J39A 3MP6A 4C8QA 4NS5A 2HCKA 5GAN6 1M1KC 1QVGP 3VS0A 1N9RA 3DB3A 1QVGS 1JQQA 2JM8A 1VYTA 2DK3A 2FHDA 2KE9A 3G71Q 2RQWA 3CCEA 4QT7A 2P4RA 3UATA 4F16A 4EPCA 2RHIA 4XU0A 4E7ZA 4RTXA 2KAFA 1PKSA 2JTEA 2ATCB 3CC2T 3CCJT 1KD1U 1X6GA 2ABLA 1B7TA 1BKBA 1PD1A 3G71A 3MJXA 1VQ7T 1RLQC 4JLGA 5A0GA 2K3XA 1FMVA 3P8BB 2KVQG 4JJCA 2FZCB 1KFZA 2E3HA 2CS7A 1NJIR 3GBQA 2X3XD 3QZ5B 4EMHA 1RABB 2CP7A 3CCVA 3JSCA 4Y91A 2KEAA 2RN8A 1GL5A 1R0CB 2P0QA 3VUZA 3E9FA 2WSEE 4ZNXA 4HCKA 1BU1A 1UGVA 2J05A 4RTVA 3ZFJA 1MMNA 1TUDA 4M7AG 4ZN1A 2KYBA 4DQ2A 1I5OB 1D0ZA 1UHCA 2K5LA 1XNIA 2K57A 2EGEA 1PRLC 3SD4A 2OJ2A 1UJYA 2F2XA 4XK8E 1BIAA 4IUUA 2XU8A 4QW2A 1Q82C 2EQKA 2FPFA 4X1VA 2E12A 2LTOA 1Q7YR 4PL6A 4M75G 2DXCA 2EQJA 3MO8A 3CPWP 4E7SA 4A4GA 1YJ9Q 3CPWS 2AKKA 1G5VA 1VQ4A 3H41A 4RG2A 4ZTFA 4HVUA 1VQ8T 1PG5B 4J8OA 2OTJQ 1B07A 2OTLT 2VKNA 1O9SA 1PCXA 3OS1A 3OW2A 1MMGA 2X4XA 4EMGA 2RNAA 2COWA 1VUBA 1A0NB 3I55T 4UC4A 1YJ9A 1BK2A 2V1QA 2XD0A 1U1TA 2ZPHB 4LXCA 2CZ1B 1ARKA 1ZX6A 5CKBA 2QQAA 2L89A 3HFNA 1Q86C 3NPFA 1N27A 1ZSZB 1PSFA 5C0MA 4NL3A 1G83A 3J7AF 1ZSZA 1UHFA 2A37A 1WXUA 2VVKA 3A98A 1G2BA 4A63B 4M77B 1TTHB 4M77A 1S72T 3EH2A 4A4FA 4C8QD 5FW9A 1NLOC 2IIMA 9ATCB 2VXFA 1UE9A 3CC4Q 1FXXA 4N4HA 2X35A 2VC8A 5GAOl 3TU4K 1SHFA 3TSZA 3RKXA 2BKDN 1OPLA 4LD6A 1PRMC 5FWBA 2K79A 1Y96B 1VQ5A 5FU6C 1Y96A 2WSFE 2FO0A 5LJ3h 4BE1A 2KXDA 3CC4A 2BZ8A 4V2SA 4RTTA 3KBGA 1J3TA 1SRLA 2RH2A 2X4YA 2DO3A 3EG3A 4FSSA 5KYWB 1U06A 1WX6A 5KYWA 3C0CA 3CCLT 2J7IA 2R5AA 3RUXA 2F69A 1GFDA 1ZA2B 1QWFA 4J9IA 4JS4A 5KYNA 2DMOA 5IT9E 2DILA 5IXBA 2EYZA 2RF0A 4OMFB 5J3BA 1OZ3A 1IB8A 3V8JA 3JCMW 1M3CA 4E7HA 5CKFA 2EYWA 3JCMd 1M1GA 4J6XA 3L2ZA 4C92B 3EGDB 2LCLA 4C92A 1JXOA 3EGDA 4E7KA 2XMFA 2JXBA 1X6BA 2WSCE 1MMAA 3G4ST 5GMKe 1E6GA 2RA2A 5GAOm 2LDMA 4J6WA 5GANd 1U3OA 1YCSB 2YUQA 5IN1A 1M1KU 4HVWA 2DXUA 4DBRA 2DA9A 1XTDA 2RK2A 2YUPA 3OBYA 2YT6A 4B9XA 4LNPA 2CUDA 1M2VB 2GTJA 3M0QA 2J6OA 1GBRA 1M2VA 2E41A 3GNFB 5GMKi 2LQ8A 1GFCA 2EQIA 4O6JA 4AFZC 3QIIA 1X69A 1HJDA 2QQ9A 1Z9ZA 2A28A 4PKCC 4N0AA 1WHMA 1OX8A 5ECAA 1X2QA 1WZOA 3JCMg 2LJ1A 2ZPBB 3OQ5A 4CRIA 1M4ZA 1EIFA 2CP2A 1MMDA 4AFUC 2CSIA 4BE0A 4AG2C 2HBWA 1VQ9A 1W2BP 1WHLA 2OX7A 1H92A 1W2BS 5GANg 4M7DB 1OU8A 4M7DA 5I11A 3A1PA 2KDSA 2EYQA 3VU3C 1CKBA 2BZYA 2KROA 1VQMQ 1VOMA 1GCQA 4ZGEB 4HCBA 3OYCA 1KC8R 3FIFA 1YFNA 5LJ3f 3BY7A 1N6AA 3JAME 2KMTA 1PC0A 3CCVT 3OYEA 2PQWA 3ER0A 3CCUA 2NWMA 3S6WA 3CCMT 2DBKA 4BB7A 3RBBB 1MNDA 1YI2Q 2H3JA 4JRPA 3N5BB 3TSWA 2GGRA 2MI6A 3EGUA 4ZGJB 5GMKj 2XK0A 1T0JA 4JUVA 3PVQA 3CC7A 1Q81C 2J6FA 4M77G 4CC4B 2D1XA 2BIVA 4PJJA 1YI2A 5IHNA 3EG1A 4BUGA 3E9GA 3E1SA 2LVMA 3NFCA 1W6XA 2HBPA 2JTMA 4QVZA 4KGXB 2MK5A 4RUGA 1MUZA 5GMKh 1WLPB 4WF2A 4QQGA 2DKGA 1NYFA 1VQ4T 3UT1A 1E6HA 5CIUA 3BFMA 2XG8D 2HQHA 2CZ7B 3LW5E 2LNVA 3PTAA 2KGTA 3CCSA 3QJ6A 3OYDA 4LDXA 4PJOE 2YRDA 3I55Q 1FX7A 3I5SA 4N4IA 1R8OB 1WHKA 4LUEA 3OSSC 5IH2A 2K5FA 1YIJT 1M3AA 2LQKA 2QK0A 2I0NA 5FLXE 3UF4A 3HRTA 3G6EQ 3TVTA 3H8ZA 1BCOA 2JN0A 1BI3A 1I5LA 4A4EA 3REBB 3FC3A 1N5ZA 1K0XA 2QXFA 4F7UA 2FPDA 5CVIA 2KXCA 1YJNQ 2CKKA 1S72Q 2DD5A 2QEXT 2EGCA 3QYGB 4X9DA 2COYA 3G6EA 1WJQA 3FJ5A 4RTWA 4ELYC 1TXQA 2FRYA 3THKA 4C92G 2L3SA 3H9NA 4OGCA 1JU5C 3LYIA 2KRSA 1C0MA 4C0DB 4KH0B 3AHUA 5HCKA 2DX1A 1QWEA 2L0AA 5LJ5d 3CCRT 1UB4A 2DTHA 2EJFA 2E70A 1G8XA 1VQLT 4QVDA 5KCOA 1VQ5T 4OF1A 4MZPA 2DETA 2M16A 2KRMA 4FW1A 3EHQA 4LDUA 1BB9A 3JCMJ 1WA7A 2DM1A 4M75F 2BUDA 3VYHB 2MOXA 2QQSA 4J9FA 3FB9A 2YSQA 2KY9A 3SDZA 2BTTA 2YHTA 1RAIB 3VS1A 3BDLA 2ENMA 4Z02A 1K8AC 1WQWA 4B6MA 2RK1A 3H0FA 2V26A 5IHKA 3GF5A 4ESRA 3JCMP 1OOTA 3MEAA 1RACB 1TH7A 2OAUA 1O75A 1RL2A 2EKOA 2RHXA 3EG9B 4BE2A 4M7DG 2DPPB 4E2FB 2DTIA 1QKWA 5GAMg 3EG9A 3VS2A 3QWXX 1N9SA 4E6RA 2AZVA 3MP8A 2XDDA 4HXJA 1NPPA 1OYXA 2EKHA 1IO6A 4Q5WA 2A08A 1KIKA 3I5RA 5LL6S 3JB9G 3X25B 1UGPB 3D7SB 1KQSA 2JZ2A 5GAMf 5FU6B 1YP5A 1M9SA 4M78F 3OYAA 1Y71A 4J83A 2ED0A 4ZN3A 1U8RA 1V1CA 3A8GB 1R77A 2QTXA 1D1CA 3S3MA 3L2VA 1W70A 5GAOr 2DNUA 1SG5A 2CP3A 4A54A 2CREA 2HMAA 2L8DA 2GFAA 2MWPA 1VQPA 1K73R 2JOYA 1VQNQ 2C0TA 2PVOB 3EG0A 1YHQT 2OI3A 3AT1B 5FROA 5EG2A 1VQOQ 2DL8A 1NJIC 1VQ9T 3PGGA 3MEUA 2JJ9A 3C4SA 2FRWA 3VRZA 2XIDA 4CI0C 1WHGA 2C0IA 2FB7A 4KULA 1K76A 2AHJB 2DL7A 2SRCA 2C06A 3CD6T 4OVAA 2O9SA 3RESA 3JCMX 2HKQB 3SB2A 1KSWA 1QVFP 1VQOA 1M1KR 1QVFS 3JV3A 3QO3A 4AMCA 4BY6C 1X43A 1X01A 2RQRA 4RCCA 2G3RA 5GAOn 3CCUT 5LJ3e 2GFUA 2M02A 5DY9A 1NLPC 2DTOA 2CZ0B 2VXEA 3BW1A 2P0PA 3DKMA 1PSEA 1TUGB 4F7UG 1X6OA 4JZ4A 3TREA 2K2MA 1GRIA 3VS4A 1ZA1B 5KCHA 4PK4A 2MMPA 3I56T 4RTZA 4HA8A 3CC7T 2AT1B 1W1FA 1RI9A 4F04B 4QQDA 4X34A 2JNGA 5KE2A 4EDUA 1OX9A 2RHZA 5GAN7 4M7AE 3NMZC 5CKEA 2KK4A 2P0KA
chains in the Genus database with same CATH topology
1KQ1A 3PFSA 3RMSA 3L2ZA 2E1HA 4M78B 4C92B 3MEWA 2LCLA 4C0DC 4M78A 4C92A 4E7KA 3META 2WSCE 2EQUA 4OP0A 3DB4A 3CBOA 4PJOG 1D3BB 4BD3A 3G4ST 4KUDK 1G3YA 2RA2A 2V8IA 5GMKe 5LJ5h 1GXIE 1G3WA 1NPRA 5GAOm 1D3BA 4FSXA 3M55A 5LJ5f 2LDMA 2DJZA 3A8MB 4R55A 4J6WA 5GANd 4QVCA 4N4GA 4M7DE 1W4SA 4QQ6A 5HY6A 4C0GA 2DVEA 4M75E 3G4SA 3CCST 4XTWA 3EFSA 3M57A 5IN1A 3L2QA 1M1KU 2DXUA 2ZPGB 2ZPEB 3CCQT 2EIFA 3RIRA 2QDYB 2B8AA 4J5YA 1BIBA 1XTDA 3OA6A 3H6ZA 4YTLA 3RERA 2PUKB 1I81A 2RK2A 3OBYA 3QBYA 3CXCA 3ASKA 4BDZA 4B9XA 1VQ6T 3LWIA 4M78D 3JRZA 4O5VA 4C92D 3GIBA 5GMKm 2FVUA 2VUBA 2DD4A 2WACA 2XI9A 5C6SA 1KQ2A 3CCQA 2E41A 3OYBA 2OTJA 2EAYA 2ZCFB 3V8LA 3GNFB 3WXMB 5GMKi 5L8RE 1VQ6A 2LQ8A 2R58A 2K2VA 1G3SA 4O6JA 3QIIA 3T9NA 4EMKC 2DAQA 2QQ9A 3MEVA 1IZ6A 3EFRA 4R56A 4PKCC 4VUBA 4F7UB 4N0AA 4M7AB 5I2SA 3QDRB 2ZPIB 3OYLA 4BACA 1LOJA 3OYHA 4M7AA 1WNLA 2XICA 2E6ZA 2ZGWA 2LT4A 1M8VA 3L1AA 2JTFA 3V7SA 4A4HA 3JCMg 2XKOC 1M5Q1 3M4YA 2HQEA 2Y4XA 2ZPBB 5LJ3j 2A3LA 2RI2A 1LJOA 1P92A 3OQ5A 1M4ZA 4CRIA 3OB9A 4E7IA 1EIFA 2LCCA 1BYMA 3M4GA 4BI8B 3GOXA 1QVFA 4C8QF 4BE0A 2CZ6B 3QZ9B 1VQNA 5FRNA 1G3TA 1VQ9A 2RO0A 5D6XA 2PUOB 4MDXA 4TVRA 3JCMe 1W2BS 5GANg 5DLOA 5FU7B 3WVEB 4M7DB 1KG1A 4FIBA 3DLLA 4M78C 4C92C 3GNGA 4M78E 1UGRB 1V29B 1BI2A 1YCYA 5DM7R 2QA4T 4M7DA 4M7AD 3HRSA 5CQYA 1K9MU 3NTIA 2KDSA 1BI1A 2EYQA 3VU3C 2RM4A 5A2QE 2E10A 2IVWA 1YJWT 3MP1A 2D6FA 5GANe 1Q81U 5GAMd 4M77F 5GANh 1WGSA 1HXDA 1N8RU 4BI3A 4L5GA 4ZGEB 3OYCA 3GPLA 4HCBA 2RB6A 3FIFA 2RJCA 4XAXB 3JCMc 4HCZA 4KT0E 5LJ3f 3BY7A 1N6AA 4XQ3A 4JRQA 1YJWA 3JAME 2KMTA 4HCCA 3CCVT 3OYEA 2PQWA 3ER0A 4XU2A 3CCUA 3M56A 3S6WA 3CCMT 5DLQE 1Q7YC 4KUIA 4M7DD 3A5ZB 4PJOF 4C8QG 4M75D 4BB7A 3KXTA 1VQMT 4MMLA 5KE3A 1KHIA 2E65A 2H3JA 5D6WA 3OSVA 4JRPA 1K73U 1SSFA 3N5BB 1IREB 2MI6A 2DIQA 2RHYA 3QUIA 1M1FA 4ZGJB 5GMKj 3CCMA 4MMKA 2MF2A 2XK0A 3A8LB 3S3NA 2CGHA 3L42A 2EJGA 1WQ7A 3FJPA 5GAOp 1K9MC 5CAIA 4JUVA 3G7ZA 3JB9D 4C5HA 4OB1B 1YI2T 5KH6A 3OYJA 4NOYA 4N0AC 3HSBA 3CC7A 4BDYA 3OMCA 1Q81C 4M7AC 4F7UE 4M77G 1ZQ1A 3ZEHA 1QW1A 1N8RC 2A7YA 4LDWA 2BIVA 3QYHB 3NTKA 3CMAT 1YI2A 2DIGA 4BUGA 3HP9A 3QSUA 2EWNA 3E9GA 4LD9K 2GCXA 3PNWC 3PIPA 3E1SA 1X75C 3ME9A 3JCMV 3ZBDA 4RMOA 2PVGB 2LVMA 1JJ2A 3V8KA 3NFCA 2HBPA 2JTMA 3FLGA 3E19A 1BI0A 4QVZA 4XTUA 5AYFA 3CMAA 4L59A 1I4K1 3CBPA 5GMKh 3UPUA 4OGEA 4WF2A 5J26A 4E47A 1K73C 3M9QA 4QQGA 2DKGA 4HT8A 3LWHA 1VQ4T 2M0OA 3UT1A 4B9WA 1QVPA 4FT4A 4PLLA 1YITT 1VQKT 4M7DC 5CIUA 5I21A 4M75C 3OYMA 3BFMA 2XG8D 5CK9A 3GLXA 4RKUE 4JDSA 4XU3A 4XTVA 2CZ7B 3LW5E 2Y4YA 2X4WA 2LNVA 3PTAA 1YITA 1VQKA 3M58A 2EJ9A 3F70A 2DZ9A 3HHTB 3HL8A 4LDVA 4BI4A 3BDUA 4D6WA 5GAMe 3JCMb 3OS2A 3QJ6A 3CCSA 1KC8U 3OYDA 4LDXA 3X28B 3OS5A 3FEOA 4PJOE 4P5NA 1FX7A 4XTXA 3WVDB 4N4IA 3CMET 2O01E 1R8OB 4C92F 3OSSC 5D6YA 3MCAB 4FM4B 4XTYA 1QP2A 2K5FA 1YIJT 2QA4A 3A8HB 3OS0A 2K5IA 4RCBA 2LQKA 5CO7A 1KHCA 3PT9A 3VYGA 5FLXE 1AHJB 3HRTA 2HAXA 3A8OB 3H8ZA 3X26B 3OYGA 5I2MA 4ATOA 2JN0A 4ELZC 3CMEA 1BI3A 1I5LA 3SWNC 4A4EA 1VQPT 3FC3A 2E5QA 1YIJA 3LH0A 4C5IA 1M90U 1KQSS 2QXFA 5FRMA 5GAN5 4C8QB 1YBYA 3OW2S 4F7UA 2GQVA 1UGSB 3DLMA 3MP6A 4MZTA 5CVIA 4C8QA 4NS5A 5J39A 1W2BA 3CCET 2VV5A 5GANj 5GAN6 1M1KC 3G6ET 5GAN3 3HKSA 1N9RA 3V7RA 2XDBA 3DB3A 1QVGS 3VUBA 5CKHA 2CKKA 1Y7XA 2DD5A 2DK3A 2FHDA 4MZMA 2QEXT 3C94A 3CCEA 3QJYA 3QYGB 4X9DA 1B34B 1WPYA 4JS5A 4E7JA 1KC8C 3G6EA 1B34A 1WJQA 4ELYC 3LGFA 3P8DA 3JCMh 3VJPA 2RJEA 1YJNT 4EPCA 1DJ7B 2RHIA 4M78G 4GLKA 4XU0A 3JCMf 4C92G 2QEXA 4FT2A 4II1A 2YRVA 3M53A 1I8FA 4OGCA 2KAFA 3LYIA 3G71T 2RJDA 3M5AA 3CC2T 4C0DB 3CCJT 3AHUA 1KD1U 2KSSA 2RJFA 3NTHA 1M90C 4IURA 3OYIA 1BKBA 5LJ5d 2JUFA 3CCRT 2RI5A 1UB4A 2DTHA 2IG0A 4PJOB 3QXEB 3G71A 1VQ7T 2QQRA 5GANf 4PJOA 3QHSA 2EJFA 3CC2A 2E70A 2M1HA 3CCJA 3QPHA 2P4TA 1K8AU 4JLGA 5A0GA 2E64A 2K3XA 1VQLT 3P8BB 2XDPA 2KVQG 4QVDA 5KCOA 1VQ5T 3JCMQ 3CCRA 4OF1A 4MZPA 2L3RA 1VQ7A 3QKJA 2M16A 2CS7A 2PU9B 4FU6A 2EQMA 5A0DA 4OB2B 4J7FA 3QZ5B 4LDUA 4EMHA 5GAN4 1Q82U 2VGNA 2V8JA 3LGLA 1VQLA 3C95A 3CCVA 4NL2A 3JSCA 2LRQA 4Y91A 3JCMJ 3OBWA 3UDCA 4M75F 4M7DF 5HK3A 3R6OA 3HRUA 2P0QA 3VUZA 2BUDA 3E9FA 1VQMA 3VYHB 3SFMA 4A53A 2WSEE 2L5QA 3PMTA 3VV0A 3HFOA 4IUTA 4PJOD 5CCAA 2QQSA 1JBMA 1KD1C 3FB9A 3ZFJA 1UGQB 1VIEA 2MWOA 3RKWA 4IKFA 2KY9A 4M7AG 1ZHIA 3SDZA 4ZN1A 2LX9A 2YHTA 4DOVA 4DQ2A 1OZ2A 4J6YA 1UEBA 2K3YA 2K5LA 4C8QC 3JB9F 2DZCA 2FL7A 3BDLA 4C8QE 3LLRA 2HQXA 5M9OA 1MGQA 1XNIA 2K57A 2RHUA 4Z02A 1K8AC 1XOVA 4ME7A 5GAMj 2HNIA 1WQWA 2RK1A 4KBMB 5HK0A 3SD4A 3GF5A 2R5MA 3JCMP 3JB9H 2MAMA 4XK8E 5IAYA 1BIAA 4IUUA 3MEAA 3URGA 4E7LA 4X9CA 1TH7A 2DXBA 2XU8A 4QW2A 2X4JA 3RMQA 2OAUA 3J80E 1O75A 3L2RA 1Q82C 1RL2A 3QG1A 2EKOA 2EQKA 2RHXA 1H3ZA 1WJRA 2E12A 3KUFA 2LTOA 4BE2A 4M7DG 4DOWA 2DPPB 4PL6A 4M75G 2DTIA 5GAMg 2VGMA 2DXCA 5FU7C 1N9SA 4L6V5 2M9UA 1WJSA 4M77E 3J81E 2EQJA 3MO8A 3MP8A 2XDDA 5GAN8 4A4GA 3UWNA 3CPWS 1Q86U 1G5VA 1VQ4A 1NPPA 1OYXA 4RG2A 3CPFA 4ZTFA 4Q5WA 2EFIA 1VQ8T 5LJ5e 4J8OA 3OYFA 4BY6B 2OTLT 5LL6S 5GAMh 3JB9G 1O9SA 3VKIA 3X25B 3OS1A 1UGPB 1KQSA 4PJOC 3OYNA 2JZ2A 5GAMf 4ZTJA 5FU6B 3JB9I 3OW2A 1M9SA 1JB0E 1MHNA 3OYKA 3X24B 3LX7A 2X4XA 4M78F 4EMGA 3OYAA 4JLIA 1Y71A 4RG8A 5LJ3d 4ZGDB 1YJ9T 4J83A 1VQ8A 2PVDB 1NJIU 4ZN3A 1U8RA 1JJ2S 2OTLA 2OTJT 3A8GB 4PNOA 1QVGA 3INZA 1VUBA 1VIFA 2QTXA 3I55T 3S3MA 4UC4A 3L2VA 3GP8A 1YJ9A 2XD0A 1U1TA 2ZPHB 2F5KA 5GAOr 3RKYA 4C5EA 2CZ1B 5CQXA 4A54A 5CKBA 1Y07A 2L8DA 2LC4A 2GFAA 2QQAA 1HK9A 2MWPA 3I55A 3L2WA 1VQPA 2L89A 3HFNA 1Q86C 2JOYA 4JRKA 4JRIA 1N27A 3CXCS 1PSFA 5C0MA 4NL3A 2PVOB 3CBMA 3J7AF 2CYZB 2FYKA 4IUVA 5HKCA 3L2UA 2DEQA 3MHXA 4OB0B 1XQHA 1YHQT 1NE8A 4IUPA 2LT1A 1ZBXA 5FROA 4M77B 2R57A 5EG2A 2NLUA 2V8KA 3PIOA 1VQNT 4M77A 1S72T 1NJIC 4A4FA 4C8QD 1VQ9T 3PGGA 3MEUA 3Q1JA 3C4SA 2RI3A 1YHQA 1U1SA 4Y28E 2XIDA 4CI0C 1QP3A 5GAOq 1YJNA 4F7UF 4M7AF 4LDYA 2VXFA 3OYYA 1Q7YU 2QQBA 4HT9A 2FB7A 1S72A 1FXXA 4KULA 4N4HA 2X35A 2VC8A 5GAOl 3TU4K 1VQOT 2AHJB 3OY9A 1JRIA 1NZ9A 2C06A 1LNXA 3C12A 3RKXA 3CD6T 4OVAA 4OB3B 4M75B 3RESA 3JCMX 2BKDN 5LJ3g 3SB2A 4C92E 4M75A 3JB9J 4MDWA 3CEYA 1VQOA 4M77D 3CC4T 2GF7A 4LD6A 1QVFS 3FDRA 3QO3A 4BY6C 3CD6A 2F5TX 3M54A 1X01A 1Y96B 3O8VA 4HKEA 3EAEA 1VQ5A 2YLCA 4RCCA 5FU6C 3M59A 1Y96A 2G3RA 5GAOn 3CCUT 5GMKl 5LJ3e 2DXTA 2GFUA 2WSFE 5DY9A 5LJ3h 4BE1A 3CC4A 3TEEA 1H641 4GY5A 4PLIA 4V2SA 3KBGA 3X20B 2ZZDA 1RI0A 2CZ0B 2DTOA 2VXEA 3BW1A 2P0PA 4DA4A 2YLBA 2RH2A 1PSEA 2X4YA 3DKMA 3HPWA 4C0ZA 2DO3A 4F7UG 2QI2A 1X6OA 2K4YA 4J7IA 3TREA 2D0QB 5GAN2 5CR2A 2KQWA 4EMKB 4XU1A 2E6NA 3SWNB 5KCHA 3CCLT 2MMPA 3OMGA 4EMKA 2XHCA 3SWNA 2RD1A 4IUQA 5LJ5j 3TCJA 2R5AA 1FWZA 2Y90A 3RUXA 3I56T 2F69A 4FL6A 4HA8A 3CC7T 4JS4A 2D9TA 5IT9E 2JVVA 4C0FA 3CCLA 2VYTA 3CPWA 4C5GA 2O4XB 4QQDA 2JNGA 4X34A 3V7CA 3I56A 5KE2A 4EDUA 2O4XA 2ZPFB 4OMFB 5J3BA 1OZ3A 1OI1A 5CKDA 3V8JA 3JCMW 2RHZA 3FRNA 3P8HA 2I2LA 5A0LA 5GAN7 4E7HA 5CKFA 5LJ5g 4M7AE 3PMIA 2KK4A 5CKEA 2HD0A 3S3OA 4A4KA 4M77C 3JCMd 1M1GA 4J6XA 4JJNK 4XTZA 2P0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFS A;  4II1 A;  2YRV A;  2F5K A;  3MEW A;  3LYI A;  5D6W A;  1SSF A;  4C5E A;  2RJD A;  4E7K A;  2DIQ A;  2RHY A;  3MET A;  2EQU A;  3DB4 A;  2XK0 A;  2L8D A;  4BD3 A;  2GFA A;  3S3N A;  2MWP A;  2RJF A;  3L42 A;  3NTH A;  4IUR A;  3OYI A;  3L2W A;  2L89 A;  2RI5 A;  2IG0 A;  2LDM A;  2QQR A;  1N27 A;  4N4G A;  4C5H A;  5C0M A;  2M1H A;  5KH6 A;  3OYJ A;  4QQ6 A;  4IUV A;  3L2U A;  4BDY A;  2K3X A;  3OMC A;  2XDP A;  5IN1 A;  5KCO A;  3L2Q A;  3ZEH A;  4IUP A;  2L3R A;  2B8A A;  2BIV A;  3OA6 A;  3H6Z A;  2M16 A;  3QKJ A;  5FRO A;  3NTK A;  4FU6 A;  2EQM A;  2R57 A;  4BDZ A;  3QBY A;  2NLU A;  3ASK A;  4B9X A;  2DIG A;  3E9G A;  4A4F A;  3PNW C;  3LGL A;  2WAC A;  3ME9 A;  3MEU A;  3Q1J A;  2LVM A;  2RI3 A;  2LRQ A;  3C4S A;  5C6S A;  3OYB A;  3FLG A;  4UC4 A;  4QVZ A;  2BUD A;  3E9F A;  4L59 A;  3PMT A;  5J26 A;  4IUT A;  4N4H A;  2X35 A;  3M9Q A;  4QQG A;  2R58 A;  2QQS A;  2M0O A;  3UT1 A;  4B9W A;  4PLL A;  3QII A;  3OY9 A;  2MWO A;  5CIU A;  4IKF A;  2DAQ A;  3OYM A;  4OVA A;  3S3M A;  3MEV A;  3L2V A;  1OZ2 A;  2BKD N;  2K3Y A;  1H3Z A;  3BDL A;  3LLR A;  3OYL A;  2HQX A;  4BAC A;  5M9O A;  1XNI A;  3CEY A;  2RHU A;  2X4W A;  3OYH A;  4Z02 A;  2GF7 A;  4LD6 A;  3FDR A;  2JTF A;  3F70 A;  4A4H A;  3OS2 A;  3SD4 A;  2HQE A;  3O8V A;  3QJ6 A;  3OYD A;  3EAE A;  2RI2 A;  3FEO A;  3OQ5 A;  4CRI A;  2R5M A;  4E7I A;  3OB9 A;  2G3R A;  2LCC A;  5IAY A;  4IUU A;  4N4I A;  3MEA A;  2GFU A;  3GOX A;  4E7L A;  4BE1 A;  5D6Y A;  4BE0 A;  4QW2 A;  3L2R A;  4GY5 A;  4PLI A;  3OS0 A;  5FRN A;  2EKO A;  2EQK A;  1KHC A;  2RHX A;  1WJR A;  1RI0 A;  2RO0 A;  2LTO A;  3KUF A;  5D6X A;  4BE2 A;  4PL6 A;  2X4Y A;  3H8Z A;  3OYG A;  1WJS A;  4A4E A;  2EQJ A;  3MO8 A;  3MP8 A;  3FC3 A;  2E6N A;  2E5Q A;  3LH0 A;  4C5I A;  5KCH A;  4A4G A;  5FRM A;  3OMG A;  3UWN A;  1G5V A;  4IUQ A;  1OYX A;  2R5A A;  3DLM A;  3MP6 A;  3NTI A;  4RG2 A;  4NS5 A;  4Q5W A;  2EFI A;  5J39 A;  4ZTF A;  4FL6 A;  3OYF A;  3MP1 A;  2D9T A;  3OS1 A;  3DB3 A;  3OYN A;  2JZ2 A;  4ZTJ A;  1WGS A;  2VYT A;  2CKK A;  1MHN A;  2FHD A;  4C5G A;  3OYC A;  2O4X B;  2X4X A;  3LX7 A;  4QQD A;  4X34 A;  2RJC A;  3OYA A;  5KE2 A;  4HCZ A;  2O4X A;  4EDU A;  4E7J A;  1OZ3 A;  1OI1 A;  2RHZ A;  3P8H A;  1WJQ A;  4E7H A;  3LGF A;  3PMI A;  3OYE A;  3P8D A;  2PQW A;  2RJE A;  3S6W A;  3S3O A;  3OYK A;  2RHI A;  5KE3 A;  2P0K A; 
#chains in the Genus database with same CATH topology
 2E1H A;  2CP5 A;  1M3B A;  1GCP A;  4C0D C;  2FEI A;  1OV3 A;  3MET A;  2EQU A;  3CBO A;  5EC7 A;  1D3B B;  2V8I A;  1NPR A;  1D3B A;  4FSX A;  1VQ6 Q;  1T0H A;  4N4G A;  2E4H A;  1W4S A;  4PJN A;  4M75 E;  3CCS T;  3TQ7 P;  1RAA B;  3CCQ T;  2ZPE B;  1PD0 A;  2B8A A;  4J5Y A;  4JJD A;  3RER A;  5KYU B;  2PUK B;  1I81 A;  3CXC A;  5KYU A;  2O88 A;  3LWI A;  4M78 D;  4D8D A;  2FVU A;  2VUB A;  5C6S A;  1KQ2 A;  2OTJ A;  2EAY A;  3V8L A;  1Q82 R;  2DLP A;  1VQ6 A;  1AWX A;  2YUO A;  2CDT A;  2R58 A;  2K2V A;  2DAQ A;  2PZ1 A;  2K7A A;  3QDR B;  2ZPI B;  4BAC A;  1EX4 A;  3OYH A;  2E6Z A;  2ZGW A;  2LT4 A;  1M8V A;  3V7S A;  4RTY A;  3M4Y A;  3M0P A;  2HQE A;  5LJ3 j;  2A3L A;  2RI2 A;  4PFZ A;  4ANJ A;  1BYM A;  1ZLM A;  4J9D A;  2CZ6 B;  1SKU B;  5FRN A;  1G3T A;  5D6X A;  2QTV A;  2VB6 A;  8AT1 B;  4MDX A;  4TVR A;  1YJW Q;  1K4U S;  2DBM A;  2J06 A;  5DLO A;  5FU7 B;  3WVE B;  4M78 C;  4M78 E;  1V29 B;  4FYY B;  1I07 A;  1K9M U;  2LX7 A;  5A2Q E;  1PWT A;  1Q86 R;  4LUD A;  4M77 F;  1LCK A;  5GAN h;  2HSP A;  4J9C A;  1OQK A;  2LMJ A;  4KT0 E;  4XQ3 A;  1YJW A;  4KGV B;  4Y92 A;  5DLQ E;  3A5Z B;  4PJO F;  2HZY A;  4C8Q G;  3KXT A;  1SHG A;  4FW2 A;  5KE3 A;  1KHI A;  3EGX B;  1K73 U;  4DBF A;  2DER A;  1QMC A;  3EGX A;  2RHY A;  3QUI A;  1M1F A;  3A8L B;  3S3N A;  2CGH A;  3SHW A;  5GAO p;  4OB1 B;  2DRK A;  4AG1 C;  3OYJ A;  1U5S A;  1ZQ1 A;  1N8R C;  2HDA A;  4LDW A;  3NTK A;  3CMA T;  3HP9 A;  4LD9 K;  1VQK Q;  2GCX A;  3PIP A;  2VWF A;  1K9A A;  3ME9 A;  3JCM V;  3ZBD A;  3RNJ A;  1JJ2 A;  4PFP A;  3V8K A;  1YNZ A;  1B3Q A;  5AYF A;  4L59 A;  1M30 A;  3RDV A;  3UPU A;  4OGE A;  5J26 A;  4E47 A;  1GBQ A;  4HT8 A;  3LWH A;  2MPX C;  1YIT T;  3OYM A;  3GLX A;  4RKU E;  2L3Q A;  1TG0 A;  1ACM B;  2Y4Y A;  3MPU B;  1VQK A;  3HHT B;  2QA4 T;  2DZ9 A;  4LDV A;  3OS2 A;  5GAM e;  2BZX A;  3EH1 A;  1ABO A;  3FEO A;  3M0S A;  4P5N A;  4XTX A;  3VRY A;  2DYB A;  3CME T;  2O01 E;  4C92 F;  4FM4 B;  3M0R A;  1QP2 A;  1MNE A;  2ED1 A;  2MIO A;  2K5I A;  3A8H B;  4RCB A;  5CO7 A;  3PT9 A;  1ZSG A;  2CT3 A;  5I2M A;  4ATO A;  2JMA A;  5KYY B;  1VQP T;  3OW2 P;  4K11 A;  3OW2 S;  5L23 A;  2GQV A;  1UGS B;  3CCE T;  2VV5 A;  1Y0M A;  4OMQ A;  3ZL7 C;  3VUB A;  1KJW A;  3ULR B;  1ABQ A;  4MZM A;  3C94 A;  3QJY A;  1B34 B;  4E7J A;  1KC8 C;  3CC2 Q;  3CCJ Q;  1B34 A;  1IGU A;  3LGF A;  3P8D A;  3VJP A;  2RJE A;  3JCM f;  1VQ7 Q;  2YRV A;  1I8F A;  2EW3 A;  3G71 T;  2RJD A;  3M5A A;  1AOJ A;  1YWP A;  2KSS A;  2NYS A;  1WI7 A;  2GNC A;  3E2U A;  4IUR A;  1M90 C;  2JUF A;  2RI5 A;  2IG0 A;  4WCI A;  5GAN f;  3QHS A;  3CC2 A;  3CCJ A;  2P4T A;  3UA6 A;  3VS5 A;  4GBQ A;  3JCM Q;  1VQ7 A;  3QKJ A;  2PU9 B;  4DEX A;  4J7F A;  5GAN 4;  1F1B B;  1Q82 U;  2V8J A;  1LPL A;  3C95 A;  2CSQ A;  4NL2 A;  4M7D F;  1RAD B;  3HRU A;  4FYX B;  1QCO A;  1VQM A;  3SFM A;  4A53 A;  1Q95 G;  2EYY A;  2KT1 A;  2L5Q A;  4LN2 A;  3PMT A;  3VV0 A;  3HFO A;  4IUT A;  4PJO D;  5CCA A;  2LQW A;  1KD1 C;  1UGQ B;  3RKW A;  2MWO A;  2LX9 A;  2X51 A;  4DOV A;  1OZ2 A;  4J6Y A;  3JB9 F;  2DZC A;  2FL7 A;  2HQX A;  2FZK B;  2RHU A;  2YDL A;  4ME7 A;  5GAM j;  2HNI A;  1LVK A;  2KYM A;  5HK0 A;  2HL3 A;  2F1L A;  2R5M A;  3JB9 H;  2MAM A;  4OMO A;  3URG A;  1UEC A;  4E7L A;  3J80 E;  2DXB A;  1EZZ B;  1VQ8 Q;  2OTL Q;  5FU7 C;  4L6V 5;  2M9U A;  1WJS A;  4M77 E;  3J81 E;  3H0H A;  2NUT B;  5GAN 8;  3UWN A;  1VA7 A;  2NUT A;  1Q86 U;  3CPF A;  3REA B;  4J9B A;  3OYF A;  4BY6 B;  5GAM h;  4PJO C;  2YXY A;  3VKI A;  4ZTJ A;  1JB0 E;  3OYK A;  4AFQ C;  3LX7 A;  1Q81 R;  1YJ9 T;  4RG8 A;  1VQ8 A;  4JPB W;  1JJ2 S;  2OTL A;  2OTJ T;  3QWY A;  1QVG A;  1VIF A;  4F17 A;  2F5K A;  3RR6 A;  1X2K A;  1PNJ A;  4C5E A;  2LC4 A;  1HK9 A;  4KGZ B;  3I55 A;  1M8M A;  3CBM A;  5HKC A;  3I9Q A;  3MHX A;  4OB0 B;  1XQH A;  2AZS A;  2CP0 A;  1AVZ C;  4IUP A;  2FZG B;  1ZBX A;  2GTO A;  2V8K A;  2YUN A;  3O5Z A;  2K9G A;  2RI3 A;  1HSQ A;  1QP3 A;  1YJN A;  4F7U F;  4M7A F;  1D0X A;  4LDY A;  3OYY A;  2QQB A;  1S72 A;  2EGA A;  1JRI A;  5D7U A;  4M75 B;  4C92 E;  4M75 A;  3JB9 J;  3CC4 T;  2GF7 A;  3O8V A;  3UA7 A;  4HKE A;  3M59 A;  5GMK l;  2DXT A;  3CCL Q;  3TEE A;  4GY5 A;  4PLI A;  2ZZD A;  1AWW A;  3VS3 A;  2YLB A;  3HPW A;  4C0Z A;  2QI2 A;  4J7I A;  5GAN 2;  4Z88 A;  5GJW B;  3OMG A;  3EFO B;  4IIM A;  2RD1 A;  3EFO A;  1FWZ A;  4ORZ A;  4WTO B;  2D9T A;  3CCL A;  3CPW A;  2DE0 X;  2X3W D;  4C5G A;  3V7C A;  1Z9Q A;  2ZPF B;  5CKD A;  2E3I A;  2LNH B;  5LJ5 g;  3MKD A;  3G4S Q;  2PNI A;  3PMI A;  2HD0 A;  3S3O A;  4JJN K;  4XTZ A;  1KQ1 A;  3PFS A;  3RMS A;  4M78 B;  3MEW A;  4M78 A;  1AWO A;  2KR3 A;  3M0U A;  4OP0 A;  3DB4 A;  4DEY A;  4KUD K;  1G3Y A;  2LQN A;  1K9M R;  5LJ5 f;  5KYX B;  5KYX A;  2GQI A;  4M7D E;  5HY6 A;  3G4S A;  1C1A A;  3EFS A;  3M57 A;  3L2Q A;  2HKN A;  2EIF A;  3RIR A;  1BIB A;  3OA6 A;  4YTL A;  1T3S A;  3ASK A;  2FG0 A;  4O5V A;  5GMK m;  2XI9 A;  3OYB A;  5L8R E;  2KT8 A;  1NBE B;  4J9E A;  1G3S A;  1QQJ A;  4EMK C;  5IXF A;  1IZ6 A;  3EFR A;  2EPD A;  1RAH B;  2EBP A;  1WNL A;  2XIC A;  1WXT A;  1KK7 A;  1FYN A;  4A4H A;  2Y4X A;  1LJO A;  1P92 A;  1TOV A;  4E7I A;  3M4G A;  1YWO A;  4C8Q F;  3QZ9 B;  1OEB A;  1VQN A;  3JCM e;  2CH4 A;  2HEQ A;  1CKA A;  2FPE A;  1KG1 A;  4CC7 A;  3DLL A;  1YCY A;  4M7A D;  1BI2 A;  4J9H A;  3HRS A;  1HD3 A;  4OMN A;  1BI1 A;  3CCV Q;  2RM4 A;  2E10 A;  1ZBJ A;  2D6F A;  3CCM Q;  3NHN A;  5GAN e;  1Q81 U;  4OMM A;  2D8J A;  1QLY A;  4L5G A;  2NUZ A;  4HCZ A;  4HCC A;  2O31 A;  5IHI A;  2CT4 A;  3M56 A;  2SEM A;  1Q7Y C;  1NYG A;  1VQM T;  4M75 D;  2H3E B;  5D6W A;  1WDX A;  1IRE B;  1E7O A;  1UFF A;  3CCM A;  4MMK A;  2MF2 A;  3L42 A;  1WQ7 A;  3FJP A;  4J9G A;  1QCF A;  4C5H A;  1YI2 T;  5KH6 A;  4NOY A;  3KFV A;  2M51 A;  3OMC A;  4M7A C;  4F7U E;  4JJB A;  1QW1 A;  1AWJ A;  1D1A A;  1VQ4 Q;  2DIG A;  2EWN A;  4RMO A;  4KRT A;  2YWW A;  2JT4 A;  1D0Y A;  3E19 A;  1BI0 A;  1WXB A;  1XJW B;  4XTU A;  3CBP A;  1TUC A;  2CUB A;  2M0O A;  4B9W A;  1QVP A;  4PLL A;  2DL3 A;  4M75 C;  2JS2 A;  2EVR A;  2BE7 D;  5CK9 A;  3PVL A;  4XU3 A;  2B86 A;  4XTV A;  1YIJ Q;  8ATC B;  2X4W A;  1PM3 A;  2DYI A;  3HL8 A;  4D6W A;  4JZ3 A;  3WVD B;  5D6Y A;  4XTY A;  1PHT A;  2LZ6 B;  2LJ0 A;  3OS0 A;  1KHC A;  4OMP A;  1EFN A;  3VYG A;  2HAX A;  3OYG A;  1KQS P;  4CC2 A;  2E5Q A;  1YIJ A;  3LH0 A;  2QEX Q;  1KQS S;  1TSF A;  5GAN 5;  1YBY A;  2QAZ A;  3DLM A;  4MZT A;  1W2B A;  2K6D A;  4KH1 B;  5GAN j;  1FMW A;  2DVJ A;  2F2V A;  3G6E T;  5GAN 3;  3HKS A;  3V7R A;  2XDB A;  4PJL A;  5CKH A;  1Y7X A;  2GBQ A;  1QCN A;  1WHH A;  1BBZ A;  1WPY A;  4JS5 A;  2W10 A;  3JCM h;  1D1B A;  3CCR Q;  1YJN T;  1DJ7 B;  4M78 G;  4GLK A;  2QEX A;  4FT2 A;  5AT1 B;  4II1 A;  3M53 A;  1IXD A;  1VQL Q;  1VQ5 Q;  4PFO A;  1UJ0 A;  2RJF A;  3NTH A;  3OYI A;  2K3B A;  4PJO B;  3QXE B;  2QQR A;  2ESW A;  1RUW A;  3R6N A;  4PJO A;  1S1N A;  2M1H A;  1K8A U;  3QPH A;  1YN8 A;  1NM7 A;  1SPK A;  2E64 A;  2XDP A;  3CCR A;  2QAS A;  2L3R A;  2AIR B;  4Z89 A;  4FU6 A;  2EQM A;  5A0D A;  1FMK A;  4OB2 B;  1CSK A;  3EG2 A;  1HYO A;  2VGN A;  1VQL A;  3LGL A;  2QGG A;  1K0S A;  2LRQ A;  3OBW A;  3UDC A;  2DL5 A;  3R6O A;  5HK3 A;  2RQU A;  2CP6 A;  2O2O A;  2D0N A;  1H3H A;  4FCY A;  1JBM A;  1VIE A;  4IKF A;  1ZHI A;  4OML A;  2QDL A;  2W0Z A;  1UEB A;  4AFS C;  2K3Y A;  4C8Q C;  4C8Q E;  3LLR A;  5M9O A;  1MGQ A;  1XOV A;  2ZAE A;  2NUP B;  2RQT A;  1SRM A;  2BE9 B;  4KBM B;  2NUP A;  1JEG A;  1ZUU A;  5IAY A;  3I35 A;  4X9C A;  1K1Z A;  1TWB A;  2X4J A;  3RMQ A;  3L2R A;  3QG1 A;  1H3Z A;  1WJR A;  1AZG B;  3KUF A;  4DOW A;  2VGM A;  2G6F X;  7AT1 B;  4M4Z A;  2QYZ A;  2MYS A;  2EFI A;  5LJ5 e;  2DF6 A;  1VYV A;  3OYN A;  2EYX A;  3JB9 I;  1MHN A;  3X24 B;  4JLI A;  5LJ3 d;  4ZGD B;  1N8R R;  2PVD B;  1I0C A;  1NJI U;  4PNO A;  2IPO B;  4IIO A;  3INZ A;  5KYY A;  3GP8 A;  4CC3 A;  1AT1 B;  3RKY A;  4FYV B;  5CQX A;  1YHQ Q;  2X9H A;  1Y07 A;  3U23 A;  3L2W A;  4F14 A;  3CXC P;  1C6V X;  4R0K A;  4JRK A;  4JRI A;  1VQ9 Q;  3CXC S;  3M0T A;  2CYZ B;  2FYK A;  4IUV A;  3L2U A;  2DEQ A;  1NE8 A;  1NEB A;  2JW4 A;  2LT1 A;  2R57 A;  2M0Y A;  1WFW A;  2NLU A;  3PIO A;  1VQN T;  1BCM A;  3CD6 Q;  3Q1J A;  4GLM A;  1YHQ A;  2AKL A;  1U1S A;  4Y28 E;  5GAO q;  1R0B G;  1X27 A;  1Q7Y U;  1MV0 B;  4HT9 A;  1H8K A;  1JO8 A;  1VQO T;  2QGF B;  2KRN A;  2F2W A;  2YRC A;  3OY9 A;  1NZ9 A;  1LNX A;  3C12 A;  4OB3 B;  1M2O A;  3CCU Q;  2ROL A;  1TS9 A;  5LJ3 g;  2H8H A;  4MDW A;  3CEY A;  2JMC A;  4M77 D;  1IHV A;  3FDR A;  3CD6 A;  2F5T X;  3M54 A;  3EAE A;  2YLC A;  2HL5 C;  1H64 1;  3I56 Q;  3X20 B;  1RI0 A;  1QKX A;  2JS0 A;  4DA4 A;  3CC7 Q;  2L3P A;  2KNB B;  1M27 C;  2K4Y A;  2D0Q B;  5CR2 A;  2KQW A;  4EMK B;  4XU1 A;  2E6N A;  3SWN B;  4EMK A;  2XHC A;  3SWN A;  4IUQ A;  1RAG B;  5LJ5 j;  3TCJ A;  2Y90 A;  1M90 R;  4FL6 A;  4HVV A;  4RTU A;  2JVV A;  4C0F A;  2A0F B;  2VYT A;  1ZSZ C;  2O4X B;  3I56 A;  2O4X A;  1OI1 A;  1ZUK A;  3FRN A;  2I2L A;  3P8H A;  5A0L A;  1SEM A;  1ZUY A;  4A4K A;  1WHJ A;  2A36 A;  4M77 C;  1RLP C;  2RQV A;  2O9V A;  3SEM A;  3CCS Q;  2DEU A;  3CCQ Q;  4PJO G;  4BD3 A;  1GXI E;  5LJ5 h;  1G3W A;  2LP5 A;  3M55 A;  1IGQ A;  2DJZ A;  1KD1 R;  3A8M B;  4R55 A;  2D8H A;  3CQT A;  3EHR A;  2L2P A;  4QVC A;  1JJ2 P;  4C0G A;  4QQ6 A;  1TU0 B;  2DVE A;  4XTW A;  2ZPG B;  5FWC A;  1OU9 A;  1IRX A;  2QDY B;  1VYU A;  3H6Z A;  4BDZ A;  2KBT A;  2V1R A;  3QBY A;  1I1J A;  1VQ6 T;  1MV3 A;  3JRZ A;  4C92 D;  3GIB A;  2WAC A;  2DD4 A;  3CCQ A;  2HSE B;  2ZCF B;  3WXM B;  1OUL A;  2QG9 B;  3BE3 A;  2ECZ A;  2KI7 A;  3T9N A;  2P84 A;  4DBH A;  3MEV A;  3NGP A;  4R56 A;  4VUB A;  3IQL A;  4M7A B;  4F7U B;  5I2S A;  3G1J A;  3OYL A;  1LOJ A;  3H0I A;  4M7A A;  2E5K A;  3L1A A;  1UG1 A;  2JTF A;  1IHW A;  2XKO C;  1M5Q 1;  2PTK A;  4D8K A;  1OPK A;  3OB9 A;  2LCC A;  2LJ3 A;  2COZ A;  5GJV B;  4BI8 B;  3GOX A;  1QVF A;  3HTR A;  2OAW A;  1WIE A;  2RO0 A;  2PUO B;  3VS6 A;  2LCS A;  4FIB A;  4C92 C;  3GNG A;  4DBQ A;  1UGR B;  5DM7 R;  5CQY A;  3NTI A;  2AK5 A;  2IVW A;  1YJW T;  3MP1 A;  1SSH A;  5GAM d;  1WGS A;  2RPN A;  1HXD A;  1N8R U;  4BI3 A;  1Y57 A;  3GPL A;  2RB6 A;  2CH4 W;  4PJM A;  2RJC A;  5I22 A;  4XAX B;  1RAF B;  3JCM c;  4JRQ A;  3QDF A;  4Z8A A;  2JM9 A;  4XU2 A;  1SF9 A;  4KUI A;  4M7D D;  1JXM A;  1AEY A;  4MML A;  2E65 A;  2C0O A;  3OSV A;  1SSF A;  2DIQ A;  2DRM A;  1UUE A;  3LH5 A;  2J6K A;  2Z0W A;  1UDL A;  2EJG A;  1AD5 A;  3CMA Q;  2DFU A;  1K9M C;  5CAI A;  3JB9 D;  3G7Z A;  2DL4 A;  1UTI A;  4N0A C;  3HSB A;  4BDY A;  3ZEH A;  2A7Y A;  3VS7 A;  1PKT A;  2DJQ A;  3QYH B;  2ROT A;  3PE0 A;  3QSU A;  1YIT Q;  3PNW C;  4AT1 B;  1X75 C;  2PVG B;  3FLG A;  3CMA A;  1I4K 1;  2VAS A;  2MCN A;  6AT1 B;  1K73 C;  3M9Q A;  2RMO A;  2QA4 Q;  4FT4 A;  1VQK T;  4M7D C;  5I21 A;  1D09 B;  3CME Q;  4JDS A;  1K8A R;  1T3L A;  1YIT A;  1V76 A;  3M58 A;  2EJ9 A;  3F70 A;  4BI4 A;  1GCQ C;  3BDU A;  3JCM b;  1KC8 U;  4QKU A;  3X28 B;  3OS5 A;  1VQP Q;  1NG2 A;  3MCA B;  2QA4 A;  3CCE Q;  4FYW B;  1AZE A;  4EIK A;  1NEG A;  1RAE B;  1AHJ B;  4LE9 A;  3A8O B;  3X26 B;  1WYX A;  4ELZ C;  3CME A;  3SWN C;  4C5I A;  1M90 U;  5FRM A;  4C8Q B;  5J39 A;  3MP6 A;  4C8Q A;  4NS5 A;  2HCK A;  5GAN 6;  1M1K C;  1QVG P;  3VS0 A;  1N9R A;  3DB3 A;  1QVG S;  1JQQ A;  2JM8 A;  1VYT A;  2DK3 A;  2FHD A;  2KE9 A;  3G71 Q;  2RQW A;  3CCE A;  4QT7 A;  2P4R A;  3UAT A;  4F16 A;  4EPC A;  2RHI A;  4XU0 A;  4E7Z A;  4RTX A;  2KAF A;  1PKS A;  2JTE A;  2ATC B;  3CC2 T;  3CCJ T;  1KD1 U;  1X6G A;  2ABL A;  1B7T A;  1BKB A;  1PD1 A;  3G71 A;  3MJX A;  1VQ7 T;  1RLQ C;  4JLG A;  5A0G A;  2K3X A;  1FMV A;  3P8B B;  2KVQ G;  4JJC A;  2FZC B;  1KFZ A;  2E3H A;  2CS7 A;  1NJI R;  3GBQ A;  2X3X D;  3QZ5 B;  4EMH A;  1RAB B;  2CP7 A;  3CCV A;  3JSC A;  4Y91 A;  2KEA A;  2RN8 A;  1GL5 A;  1R0C B;  2P0Q A;  3VUZ A;  3E9F A;  2WSE E;  4ZNX A;  4HCK A;  1BU1 A;  1UGV A;  2J05 A;  4RTV A;  3ZFJ A;  1MMN A;  1TUD A;  4M7A G;  4ZN1 A;  2KYB A;  4DQ2 A;  1I5O B;  1D0Z A;  1UHC A;  2K5L A;  1XNI A;  2K57 A;  2EGE A;  1PRL C;  3SD4 A;  2OJ2 A;  1UJY A;  2F2X A;  4XK8 E;  1BIA A;  4IUU A;  2XU8 A;  4QW2 A;  1Q82 C;  2EQK A;  2FPF A;  4X1V A;  2E12 A;  2LTO A;  1Q7Y R;  4PL6 A;  4M75 G;  2DXC A;  2EQJ A;  3MO8 A;  3CPW P;  4E7S A;  4A4G A;  1YJ9 Q;  3CPW S;  2AKK A;  1G5V A;  1VQ4 A;  3H41 A;  4RG2 A;  4ZTF A;  4HVU A;  1VQ8 T;  1PG5 B;  4J8O A;  2OTJ Q;  1B07 A;  2OTL T;  2VKN A;  1O9S A;  1PCX A;  3OS1 A;  3OW2 A;  1MMG A;  2X4X A;  4EMG A;  2RNA A;  2COW A;  1VUB A;  1A0N B;  3I55 T;  4UC4 A;  1YJ9 A;  1BK2 A;  2V1Q A;  2XD0 A;  1U1T A;  2ZPH B;  4LXC A;  2CZ1 B;  1ARK A;  1ZX6 A;  5CKB A;  2QQA A;  2L89 A;  3HFN A;  1Q86 C;  3NPF A;  1N27 A;  1ZSZ B;  1PSF A;  5C0M A;  4NL3 A;  1G83 A;  3J7A F;  1ZSZ A;  1UHF A;  2A37 A;  1WXU A;  2VVK A;  3A98 A;  1G2B A;  4A63 B;  4M77 B;  1TTH B;  4M77 A;  1S72 T;  3EH2 A;  4A4F A;  4C8Q D;  5FW9 A;  1NLO C;  2IIM A;  9ATC B;  2VXF A;  1UE9 A;  3CC4 Q;  1FXX A;  4N4H A;  2X35 A;  2VC8 A;  5GAO l;  3TU4 K;  1SHF A;  3TSZ A;  3RKX A;  2BKD N;  1OPL A;  4LD6 A;  1PRM C;  5FWB A;  2K79 A;  1Y96 B;  1VQ5 A;  5FU6 C;  1Y96 A;  2WSF E;  2FO0 A;  5LJ3 h;  4BE1 A;  2KXD A;  3CC4 A;  2BZ8 A;  4V2S A;  4RTT A;  3KBG A;  1J3T A;  1SRL A;  2RH2 A;  2X4Y A;  2DO3 A;  3EG3 A;  4FSS A;  5KYW B;  1U06 A;  1WX6 A;  5KYW A;  3C0C A;  3CCL T;  2J7I A;  2R5A A;  3RUX A;  2F69 A;  1GFD A;  1ZA2 B;  1QWF A;  4J9I A;  4JS4 A;  5KYN A;  2DMO A;  5IT9 E;  2DIL A;  5IXB A;  2EYZ A;  2RF0 A;  4OMF B;  5J3B A;  1OZ3 A;  1IB8 A;  3V8J A;  3JCM W;  1M3C A;  4E7H A;  5CKF A;  2EYW A;  3JCM d;  1M1G A;  4J6X A;  3L2Z A;  4C92 B;  3EGD B;  2LCL A;  4C92 A;  1JXO A;  3EGD A;  4E7K A;  2XMF A;  2JXB A;  1X6B A;  2WSC E;  1MMA A;  3G4S T;  5GMK e;  1E6G A;  2RA2 A;  5GAO m;  2LDM A;  4J6W A;  5GAN d;  1U3O A;  1YCS B;  2YUQ A;  5IN1 A;  1M1K U;  4HVW A;  2DXU A;  4DBR A;  2DA9 A;  1XTD A;  2RK2 A;  2YUP A;  3OBY A;  2YT6 A;  4B9X A;  4LNP A;  2CUD A;  1M2V B;  2GTJ A;  3M0Q A;  2J6O A;  1GBR A;  1M2V A;  2E41 A;  3GNF B;  5GMK i;  2LQ8 A;  1GFC A;  2EQI A;  4O6J A;  4AFZ C;  3QII A;  1X69 A;  1HJD A;  2QQ9 A;  1Z9Z A;  2A28 A;  4PKC C;  4N0A A;  1WHM A;  1OX8 A;  5ECA A;  1X2Q A;  1WZO A;  3JCM g;  2LJ1 A;  2ZPB B;  3OQ5 A;  4CRI A;  1M4Z A;  1EIF A;  2CP2 A;  1MMD A;  4AFU C;  2CSI A;  4BE0 A;  4AG2 C;  2HBW A;  1VQ9 A;  1W2B P;  1WHL A;  2OX7 A;  1H92 A;  1W2B S;  5GAN g;  4M7D B;  1OU8 A;  4M7D A;  5I11 A;  3A1P A;  2KDS A;  2EYQ A;  3VU3 C;  1CKB A;  2BZY A;  2KRO A;  1VQM Q;  1VOM A;  1GCQ A;  4ZGE B;  4HCB A;  3OYC A;  1KC8 R;  3FIF A;  1YFN A;  5LJ3 f;  3BY7 A;  1N6A A;  3JAM E;  2KMT A;  1PC0 A;  3CCV T;  3OYE A;  2PQW A;  3ER0 A;  3CCU A;  2NWM A;  3S6W A;  3CCM T;  2DBK A;  4BB7 A;  3RBB B;  1MND A;  1YI2 Q;  2H3J A;  4JRP A;  3N5B B;  3TSW A;  2GGR A;  2MI6 A;  3EGU A;  4ZGJ B;  5GMK j;  2XK0 A;  1T0J A;  4JUV A;  3PVQ A;  3CC7 A;  1Q81 C;  2J6F A;  4M77 G;  4CC4 B;  2D1X A;  2BIV A;  4PJJ A;  1YI2 A;  5IHN A;  3EG1 A;  4BUG A;  3E9G A;  3E1S A;  2LVM A;  3NFC A;  1W6X A;  2HBP A;  2JTM A;  4QVZ A;  4KGX B;  2MK5 A;  4RUG A;  1MUZ A;  5GMK h;  1WLP B;  4WF2 A;  4QQG A;  2DKG A;  1NYF A;  1VQ4 T;  3UT1 A;  1E6H A;  5CIU A;  3BFM A;  2XG8 D;  2HQH A;  2CZ7 B;  3LW5 E;  2LNV A;  3PTA A;  2KGT A;  3CCS A;  3QJ6 A;  3OYD A;  4LDX A;  4PJO E;  2YRD A;  3I55 Q;  1FX7 A;  3I5S A;  4N4I A;  1R8O B;  1WHK A;  4LUE A;  3OSS C;  5IH2 A;  2K5F A;  1YIJ T;  1M3A A;  2LQK A;  2QK0 A;  2I0N A;  5FLX E;  3UF4 A;  3HRT A;  3G6E Q;  3TVT A;  3H8Z A;  1BCO A;  2JN0 A;  1BI3 A;  1I5L A;  4A4E A;  3REB B;  3FC3 A;  1N5Z A;  1K0X A;  2QXF A;  4F7U A;  2FPD A;  5CVI A;  2KXC A;  1YJN Q;  2CKK A;  1S72 Q;  2DD5 A;  2QEX T;  2EGC A;  3QYG B;  4X9D A;  2COY A;  3G6E A;  1WJQ A;  3FJ5 A;  4RTW A;  4ELY C;  1TXQ A;  2FRY A;  3THK A;  4C92 G;  2L3S A;  3H9N A;  4OGC A;  1JU5 C;  3LYI A;  2KRS A;  1C0M A;  4C0D B;  4KH0 B;  3AHU A;  5HCK A;  2DX1 A;  1QWE A;  2L0A A;  5LJ5 d;  3CCR T;  1UB4 A;  2DTH A;  2EJF A;  2E70 A;  1G8X A;  1VQL T;  4QVD A;  5KCO A;  1VQ5 T;  4OF1 A;  4MZP A;  2DET A;  2M16 A;  2KRM A;  4FW1 A;  3EHQ A;  4LDU A;  1BB9 A;  3JCM J;  1WA7 A;  2DM1 A;  4M75 F;  2BUD A;  3VYH B;  2MOX A;  2QQS A;  4J9F A;  3FB9 A;  2YSQ A;  2KY9 A;  3SDZ A;  2BTT A;  2YHT A;  1RAI B;  3VS1 A;  3BDL A;  2ENM A;  4Z02 A;  1K8A C;  1WQW A;  4B6M A;  2RK1 A;  3H0F A;  2V26 A;  5IHK A;  3GF5 A;  4ESR A;  3JCM P;  1OOT A;  3MEA A;  1RAC B;  1TH7 A;  2OAU A;  1O75 A;  1RL2 A;  2EKO A;  2RHX A;  3EG9 B;  4BE2 A;  4M7D G;  2DPP B;  4E2F B;  2DTI A;  1QKW A;  5GAM g;  3EG9 A;  3VS2 A;  3QWX X;  1N9S A;  4E6R A;  2AZV A;  3MP8 A;  2XDD A;  4HXJ A;  1NPP A;  1OYX A;  2EKH A;  1IO6 A;  4Q5W A;  2A08 A;  1KIK A;  3I5R A;  5LL6 S;  3JB9 G;  3X25 B;  1UGP B;  3D7S B;  1KQS A;  2JZ2 A;  5GAM f;  5FU6 B;  1YP5 A;  1M9S A;  4M78 F;  3OYA A;  1Y71 A;  4J83 A;  2ED0 A;  4ZN3 A;  1U8R A;  1V1C A;  3A8G B;  1R77 A;  2QTX A;  1D1C A;  3S3M A;  3L2V A;  1W70 A;  5GAO r;  2DNU A;  1SG5 A;  2CP3 A;  4A54 A;  2CRE A;  2HMA A;  2L8D A;  2GFA A;  2MWP A;  1VQP A;  1K73 R;  2JOY A;  1VQN Q;  2C0T A;  2PVO B;  3EG0 A;  1YHQ T;  2OI3 A;  3AT1 B;  5FRO A;  5EG2 A;  1VQO Q;  2DL8 A;  1NJI C;  1VQ9 T;  3PGG A;  3MEU A;  2JJ9 A;  3C4S A;  2FRW A;  3VRZ A;  2XID A;  4CI0 C;  1WHG A;  2C0I A;  2FB7 A;  4KUL A;  1K76 A;  2AHJ B;  2DL7 A;  2SRC A;  2C06 A;  3CD6 T;  4OVA A;  2O9S A;  3RES A;  3JCM X;  2HKQ B;  3SB2 A;  1KSW A;  1QVF P;  1VQO A;  1M1K R;  1QVF S;  3JV3 A;  3QO3 A;  4AMC A;  4BY6 C;  1X43 A;  1X01 A;  2RQR A;  4RCC A;  2G3R A;  5GAO n;  3CCU T;  5LJ3 e;  2GFU A;  2M02 A;  5DY9 A;  1NLP C;  2DTO A;  2CZ0 B;  2VXE A;  3BW1 A;  2P0P A;  3DKM A;  1PSE A;  1TUG B;  4F7U G;  1X6O A;  4JZ4 A;  3TRE A;  2K2M A;  1GRI A;  3VS4 A;  1ZA1 B;  5KCH A;  4PK4 A;  2MMP A;  3I56 T;  4RTZ A;  4HA8 A;  3CC7 T;  2AT1 B;  1W1F A;  1RI9 A;  4F04 B;  4QQD A;  4X34 A;  2JNG A;  5KE2 A;  4EDU A;  1OX9 A;  2RHZ A;  5GAN 7;  4M7A E;  3NMZ C;  5CKE A;  2KK4 A;  2P0K A; 
#chains in the Genus database with same CATH homology
 1KQ1 A;  3PFS A;  3RMS A;  3L2Z A;  2E1H A;  4M78 B;  4C92 B;  3MEW A;  2LCL A;  4C0D C;  4M78 A;  4C92 A;  4E7K A;  3MET A;  2WSC E;  2EQU A;  4OP0 A;  3DB4 A;  3CBO A;  4PJO G;  1D3B B;  4BD3 A;  3G4S T;  4KUD K;  1G3Y A;  2RA2 A;  2V8I A;  5GMK e;  5LJ5 h;  1GXI E;  1G3W A;  1NPR A;  5GAO m;  1D3B A;  4FSX A;  3M55 A;  5LJ5 f;  2LDM A;  2DJZ A;  3A8M B;  4R55 A;  4J6W A;  5GAN d;  4QVC A;  4N4G A;  4M7D E;  1W4S A;  4QQ6 A;  5HY6 A;  4C0G A;  2DVE A;  4M75 E;  3G4S A;  3CCS T;  4XTW A;  3EFS A;  3M57 A;  5IN1 A;  3L2Q A;  1M1K U;  2DXU A;  2ZPG B;  2ZPE B;  3CCQ T;  2EIF A;  3RIR A;  2QDY B;  2B8A A;  4J5Y A;  1BIB A;  1XTD A;  3OA6 A;  3H6Z A;  4YTL A;  3RER A;  2PUK B;  1I81 A;  2RK2 A;  3OBY A;  3QBY A;  3CXC A;  3ASK A;  4BDZ A;  4B9X A;  1VQ6 T;  3LWI A;  4M78 D;  3JRZ A;  4O5V A;  4C92 D;  3GIB A;  5GMK m;  2FVU A;  2VUB A;  2DD4 A;  2WAC A;  2XI9 A;  5C6S A;  1KQ2 A;  3CCQ A;  2E41 A;  3OYB A;  2OTJ A;  2EAY A;  2ZCF B;  3V8L A;  3GNF B;  3WXM B;  5GMK i;  5L8R E;  1VQ6 A;  2LQ8 A;  2R58 A;  2K2V A;  1G3S A;  4O6J A;  3QII A;  3T9N A;  4EMK C;  2DAQ A;  2QQ9 A;  3MEV A;  1IZ6 A;  3EFR A;  4R56 A;  4PKC C;  4VUB A;  4F7U B;  4N0A A;  4M7A B;  5I2S A;  3QDR B;  2ZPI B;  3OYL A;  4BAC A;  1LOJ A;  3OYH A;  4M7A A;  1WNL A;  2XIC A;  2E6Z A;  2ZGW A;  2LT4 A;  1M8V A;  3L1A A;  2JTF A;  3V7S A;  4A4H A;  3JCM g;  2XKO C;  1M5Q 1;  3M4Y A;  2HQE A;  2Y4X A;  2ZPB B;  5LJ3 j;  2A3L A;  2RI2 A;  1LJO A;  1P92 A;  3OQ5 A;  1M4Z A;  4CRI A;  3OB9 A;  4E7I A;  1EIF A;  2LCC A;  1BYM A;  3M4G A;  4BI8 B;  3GOX A;  1QVF A;  4C8Q F;  4BE0 A;  2CZ6 B;  3QZ9 B;  1VQN A;  5FRN A;  1G3T A;  1VQ9 A;  2RO0 A;  5D6X A;  2PUO B;  4MDX A;  4TVR A;  3JCM e;  1W2B S;  5GAN g;  5DLO A;  5FU7 B;  3WVE B;  4M7D B;  1KG1 A;  4FIB A;  3DLL A;  4M78 C;  4C92 C;  3GNG A;  4M78 E;  1UGR B;  1V29 B;  1BI2 A;  1YCY A;  5DM7 R;  2QA4 T;  4M7D A;  4M7A D;  3HRS A;  5CQY A;  1K9M U;  3NTI A;  2KDS A;  1BI1 A;  2EYQ A;  3VU3 C;  2RM4 A;  5A2Q E;  2E10 A;  2IVW A;  1YJW T;  3MP1 A;  2D6F A;  5GAN e;  1Q81 U;  5GAM d;  4M77 F;  5GAN h;  1WGS A;  1HXD A;  1N8R U;  4BI3 A;  4L5G A;  4ZGE B;  3OYC A;  3GPL A;  4HCB A;  2RB6 A;  3FIF A;  2RJC A;  4XAX B;  3JCM c;  4HCZ A;  4KT0 E;  5LJ3 f;  3BY7 A;  1N6A A;  4XQ3 A;  4JRQ A;  1YJW A;  3JAM E;  2KMT A;  4HCC A;  3CCV T;  3OYE A;  2PQW A;  3ER0 A;  4XU2 A;  3CCU A;  3M56 A;  3S6W A;  3CCM T;  5DLQ E;  1Q7Y C;  4KUI A;  4M7D D;  3A5Z B;  4PJO F;  4C8Q G;  4M75 D;  4BB7 A;  3KXT A;  1VQM T;  4MML A;  5KE3 A;  1KHI A;  2E65 A;  2H3J A;  5D6W A;  3OSV A;  4JRP A;  1K73 U;  1SSF A;  3N5B B;  1IRE B;  2MI6 A;  2DIQ A;  2RHY A;  3QUI A;  1M1F A;  4ZGJ B;  5GMK j;  3CCM A;  4MMK A;  2MF2 A;  2XK0 A;  3A8L B;  3S3N A;  2CGH A;  3L42 A;  2EJG A;  1WQ7 A;  3FJP A;  5GAO p;  1K9M C;  5CAI A;  4JUV A;  3G7Z A;  3JB9 D;  4C5H A;  4OB1 B;  1YI2 T;  5KH6 A;  3OYJ A;  4NOY A;  4N0A C;  3HSB A;  3CC7 A;  4BDY A;  3OMC A;  1Q81 C;  4M7A C;  4F7U E;  4M77 G;  1ZQ1 A;  3ZEH A;  1QW1 A;  1N8R C;  2A7Y A;  4LDW A;  2BIV A;  3QYH B;  3NTK A;  3CMA T;  1YI2 A;  2DIG A;  4BUG A;  3HP9 A;  3QSU A;  2EWN A;  3E9G A;  4LD9 K;  2GCX A;  3PNW C;  3PIP A;  3E1S A;  1X75 C;  3ME9 A;  3JCM V;  3ZBD A;  4RMO A;  2PVG B;  2LVM A;  1JJ2 A;  3V8K A;  3NFC A;  2HBP A;  2JTM A;  3FLG A;  3E19 A;  1BI0 A;  4QVZ A;  4XTU A;  5AYF A;  3CMA A;  4L59 A;  1I4K 1;  3CBP A;  5GMK h;  3UPU A;  4OGE A;  4WF2 A;  5J26 A;  4E47 A;  1K73 C;  3M9Q A;  4QQG A;  2DKG A;  4HT8 A;  3LWH A;  1VQ4 T;  2M0O A;  3UT1 A;  4B9W A;  1QVP A;  4FT4 A;  4PLL A;  1YIT T;  1VQK T;  4M7D C;  5CIU A;  5I21 A;  4M75 C;  3OYM A;  3BFM A;  2XG8 D;  5CK9 A;  3GLX A;  4RKU E;  4JDS A;  4XU3 A;  4XTV A;  2CZ7 B;  3LW5 E;  2Y4Y A;  2X4W A;  2LNV A;  3PTA A;  1YIT A;  1VQK A;  3M58 A;  2EJ9 A;  3F70 A;  2DZ9 A;  3HHT B;  3HL8 A;  4LDV A;  4BI4 A;  3BDU A;  4D6W A;  5GAM e;  3JCM b;  3OS2 A;  3QJ6 A;  3CCS A;  1KC8 U;  3OYD A;  4LDX A;  3X28 B;  3OS5 A;  3FEO A;  4PJO E;  4P5N A;  1FX7 A;  4XTX A;  3WVD B;  4N4I A;  3CME T;  2O01 E;  1R8O B;  4C92 F;  3OSS C;  5D6Y A;  3MCA B;  4FM4 B;  4XTY A;  1QP2 A;  2K5F A;  1YIJ T;  2QA4 A;  3A8H B;  3OS0 A;  2K5I A;  4RCB A;  2LQK A;  5CO7 A;  1KHC A;  3PT9 A;  3VYG A;  5FLX E;  1AHJ B;  3HRT A;  2HAX A;  3A8O B;  3H8Z A;  3X26 B;  3OYG A;  5I2M A;  4ATO A;  2JN0 A;  4ELZ C;  3CME A;  1BI3 A;  1I5L A;  3SWN C;  4A4E A;  1VQP T;  3FC3 A;  2E5Q A;  1YIJ A;  3LH0 A;  4C5I A;  1M90 U;  1KQS S;  2QXF A;  5FRM A;  5GAN 5;  4C8Q B;  1YBY A;  3OW2 S;  4F7U A;  2GQV A;  1UGS B;  3DLM A;  3MP6 A;  4MZT A;  5CVI A;  4C8Q A;  4NS5 A;  5J39 A;  1W2B A;  3CCE T;  2VV5 A;  5GAN j;  5GAN 6;  1M1K C;  3G6E T;  5GAN 3;  3HKS A;  1N9R A;  3V7R A;  2XDB A;  3DB3 A;  1QVG S;  3VUB A;  5CKH A;  2CKK A;  1Y7X A;  2DD5 A;  2DK3 A;  2FHD A;  4MZM A;  2QEX T;  3C94 A;  3CCE A;  3QJY A;  3QYG B;  4X9D A;  1B34 B;  1WPY A;  4JS5 A;  4E7J A;  1KC8 C;  3G6E A;  1B34 A;  1WJQ A;  4ELY C;  3LGF A;  3P8D A;  3JCM h;  3VJP A;  2RJE A;  1YJN T;  4EPC A;  1DJ7 B;  2RHI A;  4M78 G;  4GLK A;  4XU0 A;  3JCM f;  4C92 G;  2QEX A;  4FT2 A;  4II1 A;  2YRV A;  3M53 A;  1I8F A;  4OGC A;  2KAF A;  3LYI A;  3G71 T;  2RJD A;  3M5A A;  3CC2 T;  4C0D B;  3CCJ T;  3AHU A;  1KD1 U;  2KSS A;  2RJF A;  3NTH A;  1M90 C;  4IUR A;  3OYI A;  1BKB A;  5LJ5 d;  2JUF A;  3CCR T;  2RI5 A;  1UB4 A;  2DTH A;  2IG0 A;  4PJO B;  3QXE B;  3G71 A;  1VQ7 T;  2QQR A;  5GAN f;  4PJO A;  3QHS A;  2EJF A;  3CC2 A;  2E70 A;  2M1H A;  3CCJ A;  3QPH A;  2P4T A;  1K8A U;  4JLG A;  5A0G A;  2E64 A;  2K3X A;  1VQL T;  3P8B B;  2XDP A;  2KVQ G;  4QVD A;  5KCO A;  1VQ5 T;  3JCM Q;  3CCR A;  4OF1 A;  4MZP A;  2L3R A;  1VQ7 A;  3QKJ A;  2M16 A;  2CS7 A;  2PU9 B;  4FU6 A;  2EQM A;  5A0D A;  4OB2 B;  4J7F A;  3QZ5 B;  4LDU A;  4EMH A;  5GAN 4;  1Q82 U;  2VGN A;  2V8J A;  3LGL A;  1VQL A;  3C95 A;  3CCV A;  4NL2 A;  3JSC A;  2LRQ A;  4Y91 A;  3JCM J;  3OBW A;  3UDC A;  4M75 F;  4M7D F;  5HK3 A;  3R6O A;  3HRU A;  2P0Q A;  3VUZ A;  2BUD A;  3E9F A;  1VQM A;  3VYH B;  3SFM A;  4A53 A;  2WSE E;  2L5Q A;  3PMT A;  3VV0 A;  3HFO A;  4IUT A;  4PJO D;  5CCA A;  2QQS A;  1JBM A;  1KD1 C;  3FB9 A;  3ZFJ A;  1UGQ B;  1VIE A;  2MWO A;  3RKW A;  4IKF A;  2KY9 A;  4M7A G;  1ZHI A;  3SDZ A;  4ZN1 A;  2LX9 A;  2YHT A;  4DOV A;  4DQ2 A;  1OZ2 A;  4J6Y A;  1UEB A;  2K3Y A;  2K5L A;  4C8Q C;  3JB9 F;  2DZC A;  2FL7 A;  3BDL A;  4C8Q E;  3LLR A;  2HQX A;  5M9O A;  1MGQ A;  1XNI A;  2K57 A;  2RHU A;  4Z02 A;  1K8A C;  1XOV A;  4ME7 A;  5GAM j;  2HNI A;  1WQW A;  2RK1 A;  4KBM B;  5HK0 A;  3SD4 A;  3GF5 A;  2R5M A;  3JCM P;  3JB9 H;  2MAM A;  4XK8 E;  5IAY A;  1BIA A;  4IUU A;  3MEA A;  3URG A;  4E7L A;  4X9C A;  1TH7 A;  2DXB A;  2XU8 A;  4QW2 A;  2X4J A;  3RMQ A;  2OAU A;  3J80 E;  1O75 A;  3L2R A;  1Q82 C;  1RL2 A;  3QG1 A;  2EKO A;  2EQK A;  2RHX A;  1H3Z A;  1WJR A;  2E12 A;  3KUF A;  2LTO A;  4BE2 A;  4M7D G;  4DOW A;  2DPP B;  4PL6 A;  4M75 G;  2DTI A;  5GAM g;  2VGM A;  2DXC A;  5FU7 C;  1N9S A;  4L6V 5;  2M9U A;  1WJS A;  4M77 E;  3J81 E;  2EQJ A;  3MO8 A;  3MP8 A;  2XDD A;  5GAN 8;  4A4G A;  3UWN A;  3CPW S;  1Q86 U;  1G5V A;  1VQ4 A;  1NPP A;  1OYX A;  4RG2 A;  3CPF A;  4ZTF A;  4Q5W A;  2EFI A;  1VQ8 T;  5LJ5 e;  4J8O A;  3OYF A;  4BY6 B;  2OTL T;  5LL6 S;  5GAM h;  3JB9 G;  1O9S A;  3VKI A;  3X25 B;  3OS1 A;  1UGP B;  1KQS A;  4PJO C;  3OYN A;  2JZ2 A;  5GAM f;  4ZTJ A;  5FU6 B;  3JB9 I;  3OW2 A;  1M9S A;  1JB0 E;  1MHN A;  3OYK A;  3X24 B;  3LX7 A;  2X4X A;  4M78 F;  4EMG A;  3OYA A;  4JLI A;  1Y71 A;  4RG8 A;  5LJ3 d;  4ZGD B;  1YJ9 T;  4J83 A;  1VQ8 A;  2PVD B;  1NJI U;  4ZN3 A;  1U8R A;  1JJ2 S;  2OTL A;  2OTJ T;  3A8G B;  4PNO A;  1QVG A;  3INZ A;  1VUB A;  1VIF A;  2QTX A;  3I55 T;  3S3M A;  4UC4 A;  3L2V A;  3GP8 A;  1YJ9 A;  2XD0 A;  1U1T A;  2ZPH B;  2F5K A;  5GAO r;  3RKY A;  4C5E A;  2CZ1 B;  5CQX A;  4A54 A;  5CKB A;  1Y07 A;  2L8D A;  2LC4 A;  2GFA A;  2QQA A;  1HK9 A;  2MWP A;  3I55 A;  3L2W A;  1VQP A;  2L89 A;  3HFN A;  1Q86 C;  2JOY A;  4JRK A;  4JRI A;  1N27 A;  3CXC S;  1PSF A;  5C0M A;  4NL3 A;  2PVO B;  3CBM A;  3J7A F;  2CYZ B;  2FYK A;  4IUV A;  5HKC A;  3L2U A;  2DEQ A;  3MHX A;  4OB0 B;  1XQH A;  1YHQ T;  1NE8 A;  4IUP A;  2LT1 A;  1ZBX A;  5FRO A;  4M77 B;  2R57 A;  5EG2 A;  2NLU A;  2V8K A;  3PIO A;  1VQN T;  4M77 A;  1S72 T;  1NJI C;  4A4F A;  4C8Q D;  1VQ9 T;  3PGG A;  3MEU A;  3Q1J A;  3C4S A;  2RI3 A;  1YHQ A;  1U1S A;  4Y28 E;  2XID A;  4CI0 C;  1QP3 A;  5GAO q;  1YJN A;  4F7U F;  4M7A F;  4LDY A;  2VXF A;  3OYY A;  1Q7Y U;  2QQB A;  4HT9 A;  2FB7 A;  1S72 A;  1FXX A;  4KUL A;  4N4H A;  2X35 A;  2VC8 A;  5GAO l;  3TU4 K;  1VQO T;  2AHJ B;  3OY9 A;  1JRI A;  1NZ9 A;  2C06 A;  1LNX A;  3C12 A;  3RKX A;  3CD6 T;  4OVA A;  4OB3 B;  4M75 B;  3RES A;  3JCM X;  2BKD N;  5LJ3 g;  3SB2 A;  4C92 E;  4M75 A;  3JB9 J;  4MDW A;  3CEY A;  1VQO A;  4M77 D;  3CC4 T;  2GF7 A;  4LD6 A;  1QVF S;  3FDR A;  3QO3 A;  4BY6 C;  3CD6 A;  2F5T X;  3M54 A;  1X01 A;  1Y96 B;  3O8V A;  4HKE A;  3EAE A;  1VQ5 A;  2YLC A;  4RCC A;  5FU6 C;  3M59 A;  1Y96 A;  2G3R A;  5GAO n;  3CCU T;  5GMK l;  5LJ3 e;  2DXT A;  2GFU A;  2WSF E;  5DY9 A;  5LJ3 h;  4BE1 A;  3CC4 A;  3TEE A;  1H64 1;  4GY5 A;  4PLI A;  4V2S A;  3KBG A;  3X20 B;  2ZZD A;  1RI0 A;  2CZ0 B;  2DTO A;  2VXE A;  3BW1 A;  2P0P A;  4DA4 A;  2YLB A;  2RH2 A;  1PSE A;  2X4Y A;  3DKM A;  3HPW A;  4C0Z A;  2DO3 A;  4F7U G;  2QI2 A;  1X6O A;  2K4Y A;  4J7I A;  3TRE A;  2D0Q B;  5GAN 2;  5CR2 A;  2KQW A;  4EMK B;  4XU1 A;  2E6N A;  3SWN B;  5KCH A;  3CCL T;  2MMP A;  3OMG A;  4EMK A;  2XHC A;  3SWN A;  2RD1 A;  4IUQ A;  5LJ5 j;  3TCJ A;  2R5A A;  1FWZ A;  2Y90 A;  3RUX A;  3I56 T;  2F69 A;  4FL6 A;  4HA8 A;  3CC7 T;  4JS4 A;  2D9T A;  5IT9 E;  2JVV A;  4C0F A;  3CCL A;  2VYT A;  3CPW A;  4C5G A;  2O4X B;  4QQD A;  2JNG A;  4X34 A;  3V7C A;  3I56 A;  5KE2 A;  4EDU A;  2O4X A;  2ZPF B;  4OMF B;  5J3B A;  1OZ3 A;  1OI1 A;  5CKD A;  3V8J A;  3JCM W;  2RHZ A;  3FRN A;  3P8H A;  2I2L A;  5A0L A;  5GAN 7;  4E7H A;  5CKF A;  5LJ5 g;  4M7A E;  3PMI A;  2KK4 A;  5CKE A;  2HD0 A;  3S3O A;  4A4K A;  4M77 C;  3JCM d;  1M1G A;  4J6X A;  4JJN K;  4XTZ A;  2P0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...