4PL6A

Structure of the chromodomain of mrg2 in complex with h3k4me3
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords At1g02740
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pl6A00
5M9OA 2GF7A 3P8DA 3OYFA 1SSFA 3Q1JA 3MEAA 5KE2A 1OI1A 3FEOA 3LX7A 2LDMA 3DLMA 3OMGA 3H8ZA 2O4XA 2G3RA 2EQJA 4IUUA 3QJ6A 4QQGA 2EKOA 4C5HA 3P8HA 1OZ2A 3OYLA 2L8DA 3ME9A 3META 2RJCA 2VYTA 3CEYA 4L59A 3OMCA 3OYCA 3L2WA 4B9XA 2HQXA 2LVMA 4N4HA 4QQDA 2HQEA 3UWNA 4IUTA 2DIGA 3OYHA 4FL6A 3L2UA 2E6NA 3OYBA 2JTFA 3L2VA 4BACA 2LCCA 2R5AA 3LLRA 4BE2A 4B9WA 3C4SA 4ZTFA 3OS2A 3LGLA 2GFUA 2BUDA 4C5GA 3FLGA 4E7KA 4N4IA 4PLLA 3OS1A 3SD4A 2JZ2A 5CIUA 2O4XB 2B8AA 3NTIA 1OYXA 2X35A 3MP1A 4BDZA 4BD3A 3LH0A 3M9QA 3OB9A 2RI3A 2R57A 3BDLA 5C6SA 4PLIA 3PMTA 2RJDA 2E5QA 3DB4A 2QQRA 3OQ5A 3L2QA 3LGFA 2EQKA 2RHYA 3ZEHA 1N27A 4UC4A 3OYJA 3NTHA 2R58A 3FDRA 5FRMA 4RG2A 2XDPA 4II1A 3OS0A 2BKDN 4HCZA 1WJQA 1RI0A 2XK0A 4E7JA 2F5KA 3ASKA 1WJSA 2L89A 4IKFA 4FU6A 2RO0A 3OYMA 2EQUA 1WJRA 5FRNA 3PFSA 2PQWA 4A4GA 4E7LA 2GFAA 2MWPA 3MEUA 4IUPA 2D9TA 3LYIA 4LD6A 2CKKA 3E9GA 3OYIA 1OZ3A 3OA6A 3O8VA 1WGSA 2FHDA 4OVAA 2RI5A 3PNWC 5C0MA 3GOXA 3OYGA 4E7IA 2DAQA 5J26A 2MWOA 4QVZA 4QW2A 4EDUA 3S3OA 2RJFA 4N4GA 4C5EA 5FROA 3FC3A 2LTOA 3MEVA 1KHCA 5D6WA 3DB3A 4IUQA 5KCHA 3QBYA 3MP8A 5KCOA 3S3NA 2M16A 4GY5A 4A4FA 4C5IA 4E7HA 2NLUA 3EAEA 3OYNA 4ZTJA 2DIQA 2R5MA 1H3ZA 4IURA 3OY9A 3MP6A 3MEWA 4A4HA 4NS5A 5D6XA 3UT1A 3OYAA 2EFIA 4Q5WA 2EQMA 4IUVA 2QQSA 2M0OA 3OYKA 1MHNA 2YRVA 3QIIA 2X4YA 3S3MA 3OYEA 4BE1A 4BE0A 2RHUA 3KUFA 4Z02A 4PL6A 2RHZA 5IAYA 2RHIA 3L2RA 2M1HA 2K3XA 4A4EA 2X4XA 3S6WA 5KH6A 2P0KA 3OYDA 1G5VA 5KE3A 2K3YA 2BIVA 5D6YA 1XNIA 3NTKA 2WACA 2RJEA 2LRQA 2RI2A 2X4WA 3QKJA 4X34A 3E9FA 3H6ZA 5IN1A 4QQ6A 2RHXA 3MO8A 4CRIA 2IG0A 2L3RA 3PMIA 3F70A 5J39A 3L42A 4BDYA
chains in the Genus database with same CATH superfamily
2M9UA 1Q86U 2F69A 5D7UA 3FEOA 3VS7A 1M3AA 2K2VA 3M0TA 1NPPA 1TUDA 3I56T 3VJPA 2RJCA 2XHCA 4MDWA 3VV0A 2BZ8A 4LNPA 4M75D 1VQKQ 4FL6A 2JUFA 3CCMQ 2J6KA 2A37A 3E19A 1QMCA 3FLGA 5DM7R 1W2BA 1JJ2A 3R6NA 5CIUA 3CCQT 2RK2A 3MP1A 4BDZA 2CP0A 1YHQT 2DKGA 4JLGA 2PU9B 3V8JA 2YUPA 4RTVA 5IXBA 1IHWA 5I2SA 1KK7A 3CCEA 5FRMA 2CH4A 5GAN4 3N5BB 4IKFA 2C0OA 3HRSA 2EQUA 4OGEA 3VUBA 4O5VA 5FU6B 2K3BA 3V8KA 1E6GA 5GANf 4EMKA 3E9GA 5C0MA 1A0NB 2YUOA 3CCJQ 2JMCA 2KE9A 3CC2T 2KRSA 3UATA 5IXFA 1W2BS 1JJ2S 3CPWA 2V26A 3QUIA 3G71Q 1LJOA 2AK5A 3RESA 5KYYA 3MEWA 2EQIA 2H3JA 5D6XA 3M59A 3OYAA 2ZPHB 1V1CA 1F1BB 2EYZA 5IH2A 3QWXX 3G7ZA 4L5GA 4VUBA 1ZA1B 3EGXA 4XTYA 4PL6A 3DLLA 2D0QB 6AT1B 1NM7A 2C06A 3JCMb 5CKHA 2GNCA 5CCAA 3I55A 1QW1A 2GF7A 1G3YA 1OI1A 3DLMA 1HXDA 3H8ZA 3HP9A 4RTUA 4KGXB 3ME9A 1BI2A 2CZ7B 2QEXA 1Q7YC 3L2UA 3PE0A 1YWPA 1OX9A 4JS4A 1VQ8A 2JN0A 4PNOA 1G83A 2CUBA 3LGLA 4QVCA 4BI4A 2NUPB 3UA7A 4C0ZA 3OS5A 4HKEA 2NYSA 3M9QA 2GQVA 1WHJA 4RTXA 4DBQA 3CMET 1FWZA 2FPEA 3RNJA 2LZ6B 5HKCA 4M7AD 1D3BA 3L2ZA 3THKA 4ELZC 2QQBA 4NOYA 4CC7A 3WVDB 2P4TA 2YUQA 3JCMd 1X69A 4DEXA 1ZUKA 2DXTA 3CXCA 3G4SA 3QJYA 2X4JA 1G3TA 2KAFA 1VQPT 1BI3A 3M0PA 2KNBB 1MMNA 4ZGDB 2JJ9A 1N6AA 3PNWC 1CSKA 4M7DB 1ZHIA 2RPNA 3NMZC 2ATCB 3RKWA 1N8RR 1E6HA 3MEVA 5LJ5g 2IVWA 1NBEB 1WFWA 2H8HA 1WI7A 2QASA 4E7HA 4MDXA 3RMSA 1AWWA 2R5MA 3ZBDA 3CCST 4D8DA 4X9DA 1K0SA 3G6ET 1O9SA 2YUNA 4LDWA 3HFNA 1WQ7A 2KDSA 1SHGA 4KBMB 1TS9A 3CCEQ 3LWIA 4C0DB 2JT4A 4OB2B 1PD0A 1D1CA 2EBPA 4PJOC 1Q82R 1NYFA 1VQ7A 3P8DA 1M27C 5CKEA 1BB9A 4FIBA 4PJOF 2NUZA 2LX7A 2DO3A 2RB6A 5LJ3h 3P8HA 3X26B 1M90R 3CEYA 2AKKA 4FW2A 3MPUB 4M7AA 2DMOA 2B86A 2DYIA 3SWNB 2XIDA 1C6VX 1VQ6A 2R5AA 4B9WA 3OS2A 2KBTA 2L3QA 3LWHA 5J3BA 4V2SA 4MZTA 4JZ4A 3CPFA 2JZ2A 3V8LA 3TU4K 1N9RA 3BDLA 1XJWB 1TG0A 5GAN3 3VS6A 2CREA 2Y4YA 1M5Q1 3QZ9B 3FDRA 5EG2A 5IHKA 1AVZC 2K4YA 2JTEA 2ZPFB 5KYUB 3CCUT 1OULA 3RKXA 2ZPEB 2DD4A 2L89A 2RO0A 1ARKA 5GANd 1RI9A 3OYMA 1RAFB 2F5TX 1W70A 5GMKi 2QEXQ 1WYXA 4BI3A 1VQ8Q 5KYWB 2KROA 4EMKC 1SRLA 1YIJQ 4OF1A 3VYGA 1I4K1 2EPDA 1KHIA 3JAME 4R0KA 1X2KA 4A4FA 4R56A 2VXFA 3E1SA 4KGVB 2VUBA 4FYWB 2A0FB 3MJXA 4FT2A 2E64A 3DKMA 1VQ5A 2EYYA 2A08A 2C0IA 3KUFA 1Q7YU 1D0XA 2WSEE 2GGRA 3I35A 4D6WA 4JRPA 2XMFA 5KH6A 1M30A 2P84A 1G5VA 3QO3A 2K3YA 3HPWA 1U3OA 4FSXA 1UHFA 2W10A 3QKJA 2HAXA 5KYUA 3PMIA 2EAYA 1Y96B 4M75F 5IHIA 3HRUA 2D0NA 4R55A 3M4YA 3QXEB 2YRDA 1EX4A 3VU3C 3CBPA 5KYWA 3CC4A 4B6MA 1IXDA 2FO0A 2NUTB 2L0AA 3SHWA 3EFSA 2J6FA 2A7YA 2HZYA 1UHCA 4M77D 4E7ZA 1KC8C 4JRKA 2ECZA 3CCRT 1NLPC 3QPHA 3JRZA 1PKTA 4LDXA 1KD1R 2GTOA 4QVDA 7AT1B 3CCLT 2QGFB 2F2WA 1TWBA 1SF9A 5A0GA 3KBGA 1YWOA 3I56Q 5GAMj 2LQ8A 4HCKA 1VQ7Q 4HCZA 4C92E 1K73C 2XK0A 4J6XA 1OPLA 3CQTA 1T3SA 4KGZB 2MWPA 3J80E 1QKWA 3LYIA 2E3HA 1X43A 1EZZB 3VKIA 3OYIA 4M78B 2RI5A 5J26A 4J7IA 2CYZB 1ZSZB 4RG8A 4M75E 4ORZA 1VQ6Q 2CGHA 2CZ6B 5CR2A 3FC3A 2LTOA 1KHCA 5AT1B 1YHQQ 5KCOA 4ZNXA 1Q81R 1NZ9A 1MNEA 1TUGB 3JCMh 2O88A 5GAOl 2LJ1A 1NJIC 1TXQA 2X51A 1I5OB 1UECA 2HL3A 3JCMc 2KGTA 1UGVA 4NL2A 1HYOA 5GAN7 1WQWA 4HVUA 1BCOA 5KE3A 2F2VA 3I5SA 4KUDK 1KQSP 4M77A 3E9FA 1M2VB 3MO8A 2IG0A 3CC2Q 1GCPA 4KUIA 2FZKB 2G6FX 3CBOA 1X2QA 2H3EB 4IUUA 4PJJA 4M78A 3JB9I 2LCLA 2MIOA 2K6DA 3OYCA 3M5AA 4CI0C 1ZBXA 4M7DC 4M7AC 1WIEA 2RQTA 1WX6A 4PJNA 2FL7A 2XDDA 1VQMA 3EFOB 4FYVB 4C5GA 1MMDA 3M57A 1WXTA 1SPKA 2AZSA 2YRCA 1VQ5Q 4M7AF 2GCXA 4PFPA 5HK3A 4P5NA 1FX7A 1VQ4T 3OB9A 3DB4A 2QQRA 2QGGA 5CQXA 1YJ9T 3HFOA 2QAZA 3VS5A 1UB4A 4XU0A 2YSQA 3M53A 1RADB 2CDTA 3H0FA 2JM8A 4XK8E 4HXJA 2RNAA 1WZOA 4E47A 4JJNK 1ACMB 1YI2A 3VRZA 1K8AC 1PWTA 4DOVA 5LJ3g 4QT7A 4JUVA 3VS3A 4M75G 4AG1C 3CC4Q 3UPUA 1VYVA 4RCBA 2KMTA 4N4GA 3KXTA 4JJCA 2VGNA 4XTZA 3RR6A 3MP8A 3M58A 2ZPGB 4E6RA 3SWNC 2EIFA 5GAOq 4BY6B 5FWCA 1IREB 4HT8A 1OPKA 3BDUA 5GANh 4IUVA 1YNZA 2RN8A 4Y28E 1YJWT 2YRVA 4F7UE 3SDZA 1M3CA 3V7SA 4JDSA 2CSQA 1JB0E 2PUKB 2JXBA 1VQPQ 1MNDA 3NHNA 1LPLA 3CCVT 4BI8B 2K79A 1XNIA 2F2XA 2NWMA 2DL8A 2WACA 3NTKA 2V8IA 4C8QA 3C12A 1YJNT 2DJQA 1KSWA 2M51A 1FMWA 2KYMA 3M0QA 4RMOA 1KC8U 2RHXA 1JBMA 3P8BB 1PM3A 1M1KR 3M0SA 1ZSGA 2G3RA 2KQWA 1GFDA 2DNUA 1UGPB 3VS2A 3SEMA 2CZ0B 2LVMA 4N4HA 1YFNA 4IUTA 1UGSB 1IGQA 3OYBA 2DL7A 2EGCA 4FM4B 1K73U 4BE2A 1T0JA 1Y71A 2KRNA 1KIKA 3OBYA 4WCIA 4FYXB 2B8AA 3JCMP 2RA2A 1OYXA 1GFCA 2ZGWA 1GBQA 3M56A 2XG8D 1H3HA 2J6OA 1YBYA 2P4RA 3LGFA 4FT4A 4UC4A 3OS0A 2BKDN 2DZCA 2YWWA 2F5KA 3NGPA 2ESWA 2DILA 1NJIU 4PFOA 1GBRA 1WHKA 4A4GA 1VIEA 1TSFA 4LD6A 4E7IA 1QVGA 1WXBA 5GAN8 4QVZA 4QW2A 4EDUA 4M4ZA 1ZX6A 4ANJA 4C92B 5D6WA 3DB3A 1VQMQ 1Y07A 3BY7A 5GMKj 1HD3A 3C94A 2NLUA 1VQNA 1WPYA 4MMKA 1PKSA 4E2FB 3RKYA 1VQLA 4PK4A 4F7UG 3M4GA 2QQSA 2CSIA 4RTZA 3OYKA 1QVFA 1M8VA 5GAMe 5IAYA 2RHZA 1I0CA 4XTWA 2BTTA 4LN2A 2YLCA 3EGDB 4MMLA 3GF5A 2RQVA 1R77A 1YI2Q 1UGRB 5J39A 1JRIA 4J9BA 4M77C 5LJ5j 3CC7A 1QVGS 2D6FA 2RQUA 4J5YA 1UUEA 1QCNA 1VQOT 3CMAT 4HCBA 4RUGA 4OMLA 3I5RA 3MHXA 1RAIB 4M77F 4M78C 2ED1A 4DA4A 3SFMA 4OB3B 1R0BG 1ZSZC 3JCMg 3C4SA 2CP2A 2KK4A 3TCJA 1QVFS 1Y0MA 4LDYA 1K8AU 3TREA 3QSUA 2CT4A 1DJ7B 3REAB 1KG1A 4WTOB 2KT1A 3SD4A 2D8JA 2E6ZA 2RQRA 2OJ2A 1M3BA 1W1FA 3NFCA 4JLIA 2EYWA 5A2QE 3CPWS 1OU9A 2AZVA 1TH7A 1VQ9A 2CP5A 1YIJA 2QA4T 1RI0A 3ASKA 4ELYC 3L1AA 4JPBW 1MV0B 1M9SA 3RIRA 2GFAA 3MEUA 2LT4A 1OZ3A 1M1FA 3O8VA 5IHNA 2FEIA 4A54A 3CD6A 3QDRB 2DM1A 1SG5A 1AWOA 4M7DD 2WSFE 4KULA 3QYHB 2PTKA 4BB7A 2OX7A 2XD0A 3OY9A 1U8RA 3H9NA 3JB9H 2DYBA 1YITA 1OEBA 1PG5B 4PFZA 4A4EA 2OTJA 4AFQC 3OW2A 3H41A 1RABB 4PJLA 3A8MB 1S1NA 2AIRB 1U1SA 3OSSC 2DETA 4C8QC 2YLBA 4F7UB 2NUPA 2LDMA 2K57A 4CC3A 3A1PA 3META 2E4HA 3EG0A 1WNLA 1VQNQ 3CXCS 1VQLQ 1XTDA 3I56A 1RL2A 1RAHB 5GANg 4KT0E 5AYFA 3X24B 4BD3A 2JMAA 3O5ZA 4ZGEB 3OW2S 2OTLT 5GAOp 4M7DA 5IT9E 1K9MR 1QVPA 2VB6A 1CKAA 3OYJA 2VWFA 1JQQA 1EIFA 3CCQA 1VYTA 3CC7Q 3GNGA 2CUDA 5FLXE 3MKDA 1YHQA 3LH5A 2VC8A 1UE9A 2LNHB 4FCYA 4ESRA 1VQKT 4J7FA 2E41A 3PFSA 4IUPA 2A36A 1OOTA 2CKKA 1MMAA 3C0CA 3CCMT 5CKDA 2MCNA 4ZN3A 2MWOA 1RUWA 4C5EA 5HK0A 1G8XA 1FMKA 4J9DA 1BK2A 1ABOA 5FU7C 2E1HA 3AHUA 2LP5A 3RMQA 1JEGA 3C95A 3CC2A 1XOVA 1QKXA 1WLPB 1AZGB 4OB0B 5KYXB 3EG2A 1VQ9Q 2MF2A 5L23A 4DBRA 1P92A 1YP5A 4PJOE 3SWNA 2HBWA 2KY9A 2HCKA 4X34A 1Q86R 4ATOA 5IN1A 1N8RC 2JOYA 3CMAA 3V7RA 3M55A 3G1JA 2DJZA 3CCJT 2V8JA 2Y4XA 3CD6Q 1M8MA 2X3XD 2EKOA 4C5HA 3JCMV 1G2BA 2EJGA 3G71T 3OMCA 2JVVA 3L2WA 5GMKe 2LQKA 2CP7A 5CVIA 3WVEB 3OYHA 5I22A 2DVEA 2DRKA 3TEEA 1RLQC 4PJMA 3LLRA 4ZTFA 4C92C 1UGQB 2BUDA 1NE8A 3QDFA 1D0YA 2EGAA 1M1GA 2VGMA 4KH1B 4PLLA 2LT1A 1YITQ 1Q82C 3NTIA 2X35A 1ABQA 2J7IA 1NLOC 4DBFA 4JRIA 2OTJQ 2HNIA 2XKOC 5FU6C 3EG9B 2FPDA 1FYNA 2LMJA 2P0QA 5GAMf 2EQKA 2EYXA 4Y91A 1WA7A 2FPFA 1M90C 2RK1A 5CKBA 3ZFJA 5LJ5e 2XDPA 2FZGB 1CKBA 3CMEA 3A8HB 1QQJA 1W4SA 1S72T 2ROLA 2DL3A 3GOXA 5CQYA 2YDLA 2QG9B 4M78D 1N9SA 2J05A 2KT8A 1WXUA 1VQPA 2COZA 4LE9A 2PZ1A 4EMHA 2ZAEA 4A4HA 2EQMA 1Y96A 3HTRA 2L5QA 4EPCA 5CKFA 1BIBA 3UF4A 2E3IA 2EGEA 5HY6A 3PIPA 4PJOG 5LJ3j 4ZGJB 1J3TA 2KXCA 4TVRA 3CCQQ 3CCSA 2DPPB 3G6EA 2NUTA 2K5LA 2O9SA 4HT9A 2L2PA 2W0ZA 1Q86C 3GP8A 3BFMA 1UFFA 1IB8A 3TSZA 3ZL7C 2L8DA 3M54A 2PVDB 4JS5A 1PC0A 3GPLA 2JTFA 2DRMA 1K0XA 2IPOB 3EHQA 3JB9J 4N4IA 3CCET 3OS1A 2ZPIB 2O4XB 4O6JA 2GBQA 3REBB 9ATCB 1Z9ZA 2RI3A 2R57A 2DF6A 2RJDA 3RUXA 1ZSZA 1AEYA 4XU3A 3CMAQ 1IO6A 4RG2A 2I2LA 2LJ0A 4Z89A 4C8QD 1U5SA 4AT1B 2MAMA 3GBQA 1GRIA 4M7DF 4E7LA 1AHJB 1KQ1A 3R6OA 2E65A 2FHDA 1D0ZA 5GAN6 3JB9D 3CCUA 3FJPA 1KD1C 2CS7A 4GLKA 1FXXA 2K9GA 4C0DC 1N8RU 1JXMA 1M2VA 1NPRA 4DEYA 2A28A 2D8HA 3X20B 3JCMQ 3I55T 1MHNA 4LD9K 2LJ3A 2ENMA 4Z02A 1QLYA 3L2RA 2KRMA 2P0KA 1ZUYA 4C0GA 1BKBA 2RM4A 1Y7XA 3T9NA 2X4WA 2MPXC 3CMEQ 2QEXT 1QWEA 4QQ6A 3M0RA 3EFOA 1VQ8T 2DLPA 4DBHA 1VA7A 3MEAA 1Q82U 3LX7A 1Q81C 2QQAA 4QQGA 1LVKA 3OYLA 4HCCA 4MZMA 3FIFA 1GXIE 4D8KA 5GAN2 2HL5C 1YCYA 2J06A 4PJOB 1M90U 2DIGA 4M7DE 3V7CA 4M7AE 1D09B 2HEQA 4Z8AA 2E12A 1OV3A 3QG1A 1XQHA 4NL3A 1I1JA 4N0AA 1IZ6A 4X1VA 5GMKl 4J6WA 3A98A 1UJYA 5CK9A 1N5ZA 2MOXA 4XU2A 5GAMd 1HJDA 3G4ST 3CCSQ 1JU5C 2E5QA 3G6EQ 1PRLC 3URGA 5I21A 3CCRA 3EH1A 1S72A 2DEQA 4J6YA 2LQNA 2EKHA 2LCSA 1WJQA 1OQKA 3PIOA 4L6V5 1AWJA 3A8GB 2DBKA 3CCLA 4GBQA 1AD5A 1B34B 4AFZC 1WGSA 2ZZDA 4F14A 2HKQB 3GNFB 1NEGA 5GAN5 4C92D 3J7AF 2FB7A 4ZTJA 2F1LA 4AMCA 4LDUA 1AOJA 2YT6A 1WHLA 2ZPBB 1Q7YR 1B07A 2DX1A 4EMKB 2E70A 3QIIA 2X4YA 2QXFA 4GLMA 2DZ9A 4X9CA 4BE0A 3S3MA 1VQ7T 2X3WD 2HD0A 2RHIA 1T0HA 2M1HA 5I2MA 4JJBA 2LNVA 3JV3A 2XDBA 4J9CA 3H6ZA 2DA9A 2XICA 5KYYB 5LJ5f 1ZBJA 5A0DA 3OYFA 2BE9B 1GL5A 2AHJB 1VQ6T 3QJ6A 4F16A 1B34A 4J9GA 3EGXB 4OB1B 3CCUQ 1MMGA 4M75B 1BYMA 4M7DG 4B9XA 4M7AG 1VUBA 4HA8A 2JS0A 3OYYA 3L2VA 5HCKA 3OBWA 3GLXA 2EJ9A 1R8OB 2HQHA 1G3WA 2X9HA 3HL8A 4FSSA 4LUEA 2K7AA 4OMNA 4OMQA 1NG2A 2VXEA 4OGCA 5LJ3e 1B7TA 1RLPC 2LQWA 2DL4A 4PLIA 3PMTA 2DTIA 1KD1U 1M1KC 2AT1B 3VS0A 2CP6A 2RF0A 3ZEHA 2KSSA 4RCCA 3NTHA 4C92A 1M2OA 2BE7D 2HBPA 2CZ1B 3UA6A 3EGUA 1I07A 1EFNA 4E7JA 1LCKA 1VQ4A 3VYHB 4M78F 4OP0A 2DERA 2JS2A 5FRNA 5DLQE 2JW4A 1YJ9A 2DFUA 1WHMA 2DE0X 5KYNA 1MUZA 4M75A 3HRTA 5GANj 1K76A 3UDCA 1D3BB 3X28B 1HK9A 1VQ5T 3EGDA 4IUQA 1K1ZA 4J9HA 2DIQA 3FJ5A 2DTHA 1Q81U 2V8KA 2PVGB 1NYGA 2MMPA 1ZA2B 3TVTA 2L3SA 2M0OA 2PUOB 1X6OA 2DL5A 1SSHA 4XTVA 3PVLA 3CCRQ 1S72Q 3TSWA 1GCQA 1WHHA 3OYDA 4KRTA 2BIVA 2VVKA 4Y92A 2ABLA 3RDVA 2ED0A 4LUDA 1YJWA 2HDAA 3CC4T 3CCLQ 2L3PA 4M77E 3E2UA 4EIKA 1Q95G 1BIAA 1RAGB 5GAOr 3CCVA 3JSCA 1YJNA 4A4KA 1I8FA 1VOMA 4M78E 1X6BA 3UWNA 3FRNA 2K5IA 4Z88A 3VS1A 2GFUA 1UEBA 4E7KA 3JCMW 4IIOA 1KQSA 4FW1A 5CO7A 4KH0B 2O9VA 1BU1A 4N0AC 4RTYA 3LH0A 3QWYA 2RD1A 1QWFA 5C6SA 4M7AB 4ME7A 4C8QF 2MYSA 2R58A 4OMFB 4II1A 2ROTA 2VV5A 4LDVA 1U1TA 1D1AA 2MI6A 1H8KA 1WJSA 4OMMA 4CC2A 4J83A 3EFRA 4XQ3A 3JB9F 3JCMJ 4A63B 1O75A 2PQWA 4BY6C 2OI3A 3QYGB 1WHGA 2FRWA 3OA6A 3WXMB 5GAMh 2BZXA 4F04B 4JJDA 5LL6S 2FG0A 1PHTA 3QBYA 1KQSS 2M0YA 1BI0A 1W6XA 3CBMA 4C5IA 4GY5A 3QHSA 1LOJA 1SKUB 4NS5A 1Z9QA 1BI1A 1UDLA 2EFIA 2VASA 4F7UA 3HKSA 1VYUA 2XU8A 2KR3A 5GJWB 1JXOA 1VIFA 2RHUA 5GJVB 1PD1A 3U23A 2K3XA 2D1XA 2FRYA 1KC8R 5LJ5d 1MGQA 1VQ4Q 4HVVA 4BUGA 4M77G 3JCMe 3A8LB 2L3RA 4JZ3A 4C8QE 3L42A 1YJ9Q 2GQIA 5KE2A 1H641 3X25B 3OMGA 1QCFA 2EQJA 5CAIA 3VUZA 1VQMT 4OMOA 2JM9A 3VS4A 4M78G 1M1KU 2VYTA 3EH2A 4RKUE 2GTJA 2HQXA 1K73R 3I55Q 3A5ZB 1MV3A 3EG3A 1W2BP 1JJ2P 2V1RA 2Y90A 5FWBA 1IRXA 4PKCC 1M4ZA 1VQOA 1RACB 2IIMA 5GAOm 1U06A 1QVGP 4J9IA 3EG1A 1G3SA 3NPFA 1TOVA 1YI2T 3OQ5A 1ZLMA 1V29B 2RHYA 1N27A 1YJWQ 3FB9A 1NJIR 1PSEA 2RH2A 2DXCA 1QVFP 4AFUC 3CCVQ 1YJNQ 1AWXA 1R0CB 4C92F 3S3OA 1PSFA 5KYXA 2RJFA 2QA4A 2JNGA 3CPWP 2O31A 4M75C 1IHVA 4C0FA 4E7SA 3INZA 3G4SQ 2M16A 1K9MC 3M0UA 2DEUA 5L8RE 2A3LA 2LC4A 5I11A 3ULRB 2JTMA 1H92A 3UT1A 4IIMA 2K5FA 4FYYB 3KFVA 5LJ3f 1JO8A 4J8OA 2QTVA 2X4XA 4AG2C 1ZUUA 5A0LA 5D6YA 1Y57A 4C8QG 2KEAA 2LRQA 3PGGA 1GCQC 2QDLA 4EMGA 2YXYA 1I81A 2O01E 2COYA 2SEMA 3F70A 5M9OA 1RAAB 1AZEA 1SSFA 3Q1JA 5GAOn 2HMAA 5GANe 2OAUA 3JCMX 2E5KA 2P0PA 4XU1A 1OZ2A 3JB9G 4L59A 2DK3A 4HVWA 3PT9A 3EG9A 2RMOA 3TQ7P 2HQEA 2EJFA 2E6NA 4DQ2A 1C1AA 4J9FA 2AKLA 3A8OB 1K8AR 4M77B 2K2MA 1V76A 1NEBA 4A53A 1B3QA 2DXBA 3MCAB 3ER0A 2ZCFB 1I5LA 1UJ0A 1AT1B 2DBMA 4CC4B 1T3LA 3L2QA 1QCOA 1KQ2A 3CXCP 3H0HA 4XTXA 2EW3A 2HKNA 2DXUA 2O2OA 4LXCA 1IGUA 8AT1B 2OTLA 5EC7A 5GMKm 3AT1B 2D9TA 1VQNT 2COWA 1BCMA 4BE1A 3H0IA 1VQLT 4OVAA 3OW2P 3OYGA 3GIBA 1UG1A 1PCXA 2DAQA 1KJWA 3PVQA 1ZQ1A 4J9EA 1OX8A 2LX9A 1WDXA 2QI2A 4QKUA 1K4US 1VQKA 1VQOQ 1TTHB 3S3NA 3EAEA 3OYNA 1H3ZA 3SB2A 3CCMA 1TUCA 4Q5WA 2SRCA 2CP3A 3I9QA 2C0TA 2KYBA 1FMVA 3CC7T 4JRQA 2I0NA 2EVRA 3QZ5B 5GMKh 4RTWA 3S6WA 1QP2A 1RAEB 2E10A 2RJEA 4F7UF 1UTIA 4K11A 3EHRA 2KVQG 3HSBA 2PNIA 2FVUA 2O4XA 2CH4W 2QA4Q 1QP3A 2YHTA 3D7SB 5GAMg 1BBZA 2DVJA 4RTTA 4WF2A 3BW1A 2QK0A 4QQDA 2EWNA 4C92G 4MZPA 4PJOD 3CCJA 4YTLA 4C8QB 1X6GA 4BACA 2LCCA 5LJ5h 1SEMA 2FZCB 3BE3A 2VKNA 4ZN1A 2M02A 3G71A 3VRYA 1OU8A 1X27A 1VQ9T 1YN8A 2V1QA 1YIJT 3LW5E 2EYQA 4AFSC 3RBBB 2BZYA 3RERA 4DOWA 4XAXB 1K9MU 2FYKA 3CD6T 1TU0B 1PNJA 2XI9A 5ECAA 1HSQA 4FU6A 2RQWA 3JCMf 1WJRA 2QQ9A 2QDYB 1YCSB 2OAWA 2KXDA 3J81E 2QYZA 3PTAA 1SRMA 2KI7A 5FW9A 2DTOA 1E7OA 5FROA 1SHFA 2HSPA 5DY9A 1KFZA 1YITT 1D1BA 2CT3A 5KCHA 2WSCE 8ATCB 2OTJT 3IQLA 3HHTB 4F17A 2QTXA 4IURA 4XTUA 3MP6A 1K9AA 2MK5A 1LNXA 5LJ3d 3OYEA 2HSEB 2PVOB 1X01A 4OMPA 5FU7B 4PJOA 2Z0WA 2DD5A 1C0MA 5DLOA 1X75C 2RI2A 3OSVA 4CRIA 2OTLQ 4BDYA 1PRMC
chains in the Genus database with same CATH topology
2M9UA 1Q86U 2F69A 4M77E 3FEOA 4KUIA 2K2VA 2V8JA 2Y4XA 3CBOA 4IUUA 1NPPA 1BIAA 2EKOA 4C5HA 5GAOr 3JCMV 3I56T 3CCVA 2EJGA 3JSCA 4M78A 3VJPA 2RJCA 3JB9I 2LCLA 2XHCA 4MDWA 3OMCA 3OYCA 3VV0A 2JVVA 1I8FA 4A4KA 5GMKe 3L2WA 2LQKA 3M5AA 4M75D 4M78E 5CVIA 3WVEB 3UWNA 3OYHA 4FL6A 4CI0C 1ZBXA 4M7DC 2DVEA 3FRNA 4M7AC 2K5IA 3TEEA 3G71T 2JUFA 3LLRA 4ZTFA 4C92C 2FL7A 2XDDA 2GFUA 1UGQB 1UEBA 2BUDA 1VQMA 1NE8A 3FLGA 3E19A 4C5GA 5DM7R 4E7KA 3JCMW 3M57A 1M1GA 2VGMA 4PLLA 1W2BA 1JJ2A 1KQSA 2LT1A 1K8AC 5CIUA 3CCQT 2RK2A 4M7AF 2GCXA 3NTIA 5CO7A 1Q82C 2X35A 3MP1A 4N0AC 5HK3A 4BDZA 3LH0A 4P5NA 1FX7A 1VQ4T 4JRIA 3OB9A 2HNIA 1YHQT 2DKGA 2RD1A 5C6SA 2XKOC 5FU6C 4JLGA 2PU9B 4ME7A 4M7AB 3V8JA 4C8QF 3DB4A 2QQRA 5CQXA 2P0QA 1YJ9T 3HFOA 5GAMf 5I2SA 2EQKA 4Y91A 1UB4A 3CCEA 4XU0A 1M90C 2R58A 2RK1A 5CKBA 3M53A 3ZFJA 5FRMA 5LJ5e 2XDPA 4OMFB 4II1A 2VV5A 3N5BB 4XK8E 4LDVA 5GAN4 1U1TA 2MI6A 1WJSA 4IKFA 3CMEA 3A8HB 4J83A 3EFRA 4XQ3A 3HRSA 4E47A 1W4SA 4JJNK 2EQUA 4OGEA 1O75A 3VUBA 3JCMJ 2PQWA 4O5VA 1YI2A 4DOVA 5FU6B 5LJ3g 3V8KA 1S72T 4BY6C 4JUVA 5GANf 3QYGB 4EMKA 3E9GA 3OA6A 3GOXA 4M75G 5C0MA 3UPUA 5CQYA 3WXMB 4RCBA 5GAMh 4M78D 2KMTA 4N4GA 3KXTA 3CC2T 5LL6S 2VGNA 1N9SA 4XTZA 1W2BS 1JJ2S 3QBYA 3MP8A 3CPWA 3M58A 1KQSS 1BI0A 2ZPGB 3QUIA 3CBMA 4C5IA 4GY5A 1VQPA 3QHSA 1LJOA 3RESA 3SWNC 1LOJA 2EIFA 4EMHA 5GAOq 4BY6B 4A4HA 3MEWA 4NS5A 1IREB 2H3JA 5D6XA 1BI1A 3M59A 3OYAA 2EFIA 2ZPHB 4HT8A 2EQMA 4F7UA 1Y96A 3BDUA 3HKSA 4IUVA 5GANh 2L5QA 4EPCA 4Y28E 2XU8A 3G7ZA 4L5GA 1BIBA 5CKFA 4VUBA 2YRVA 1YJWT 4F7UE 3SDZA 1VIFA 3V7SA 2RHUA 4XTYA 5HY6A 4JDSA 4PL6A 1JB0E 3PIPA 2K3XA 2PUKB 4PJOG 3DLLA 5LJ3j 4ZGJB 4TVRA 2D0QB 3CCSA 3CCVT 4BI8B 2DPPB 5LJ5d 1MGQA 3G6EA 1XNIA 3NTKA 1YJNT 2K5LA 2WACA 4C8QA 2V8IA 3JCMb 3C12A 4BUGA 4M77G 4RMOA 5CKHA 1KC8U 3JCMe 2RHXA 3A8LB 5CCAA 1JBMA 1QW1A 2L3RA 4C8QE 3L42A 3I55A 4HT9A 3P8BB 2GF7A 1G3YA 5KE2A 1H641 1OI1A 3X25B 1Q86C 3DLMA 3OMGA 1HXDA 3GP8A 3BFMA 3H8ZA 2G3RA 2EQJA 2KQWA 3HP9A 5CAIA 3VUZA 1VQMT 1UGPB 4M78G 2L8DA 3ME9A 3M54A 1BI2A 2CZ7B 2VYTA 1M1KU 4RKUE 2PVDB 2QEXA 4JS5A 2CZ0B 1Q7YC 2HQXA 2LVMA 4N4HA 3L2UA 4IUTA 1UGSB 4JS4A 1VQ8A 3GPLA 3A5ZB 3OYBA 2JTFA 2JN0A 4FM4B 4PNOA 1K73U 4BE2A 1Y71A 3LGLA 3OBYA 2Y90A 4PKCC 4QVCA 1M4ZA 1VQOA 4BI4A 3JB9J 4N4IA 3CCET 3OS1A 5GAOm 2ZPIB 3OS5A 4C0ZA 2O4XB 2D6FA 2B8AA 4HKEA 2RA2A 1OYXA 4O6JA 3JCMP 1G3SA 2ZGWA 3M9QA 3M56A 2GQVA 2RI3A 2XG8D 2R57A 3CMET 1FWZA 1YI2T 5HKCA 2RJDA 1YBYA 3OQ5A 3LGFA 3RUXA 4FT4A 4M7AD 1D3BA 1V29B 4XU3A 2RHYA 3L2ZA 1N27A 4UC4A 4ELZC 2QQBA 3FB9A 4NOYA 3WVDB 4RG2A 2P4TA 3OS0A 3JCMd 2I2LA 2BKDN 2DZCA 1PSEA 2RH2A 4C8QD 2DXCA 2F5KA 2DXTA 3CXCA 2MAMA 1NJIU 3G4SA 3QJYA 2X4JA 1G3TA 2KAFA 4A4GA 1BI3A 1VIEA 4E7LA 1VQPT 4M7DF 1AHJB 1KQ1A 3R6OA 4LD6A 2E65A 4ZGDB 2FHDA 4C92F 1N6AA 4E7IA 3PNWC 1QVGA 4M7DB 5GAN8 3S3OA 1PSFA 1ZHIA 4QVZA 4QW2A 2RJFA 4EDUA 5GAN6 2QA4A 3CCUA 2JNGA 3JB9D 3RKWA 4M75C 3FJPA 1KD1C 4C0FA 2CS7A 4C92B 3INZA 3MEVA 5LJ5g 5D6WA 3DB3A 2IVWA 1Y07A 3BY7A 5GMKj 4GLKA 1FXXA 1N8RU 4C0DC 3C94A 2M16A 4E7HA 1K9MC 4MDXA 3RMSA 2NLUA 1VQNA 1WPYA 2A3LA 2R5MA 2LC4A 5L8RE 4MMKA 2JTMA 1NPRA 3ZBDA 3CCST 3RKYA 1VQLA 4X9DA 3UT1A 3G6ET 4F7UG 1QVGS 3M4GA 1O9SA 2QQSA 3X20B 4LDWA 3JCMQ 3OYKA 1QVFA 2K5FA 1MHNA 3I55T 1M8VA 3HFNA 4LD9K 4Z02A 5GAMe 5LJ3f 2RHZA 5IAYA 1WQ7A 2KDSA 4KBMB 3L2RA 4J8OA 3LWIA 4XTWA 4C0DB 2X4XA 2P0KA 2YLCA 4OB2B 4C0GA 5A0LA 1BKBA 5D6YA 2RM4A 1Y7XA 4PJOC 3T9NA 4C8QG 2LRQA 2X4WA 3PGGA 4MMLA 4EMGA 2QEXT 3GF5A 1I81A 2O01E 4QQ6A 3JB9F 3F70A 1UGRB 5J39A 1VQ8T 5M9OA 1VQ7A 3P8DA 1JRIA 1SSFA 3Q1JA 3MEAA 4M77C 5CKEA 5GANe 2OAUA 3LX7A 5LJ5j 3JCMX 4FIBA 5GAOn 3CC7A 1Q81C 2QQAA 4PJOF 4J5YA 4QQGA 2DO3A 2RB6A 2P0PA 3P8HA 1OZ2A 4XU1A 5LJ3h 3X26B 3OYLA 3JB9G 4MZMA 1VQOT 3CEYA 4L59A 3FIFA 3CMAT 4HCCA 2DK3A 5GAN2 1GXIE 3PT9A 1YCYA 3MHXA 4M7AA 4PJOB 4M77F 4M78C 2HQEA 1M90U 2DIGA 2EJFA 4M7DE 3V7CA 2E6NA 4DA4A 3SFMA 4OB3B 3SWNB 4DQ2A 4M7AE 2XIDA 1VQ6A 3A8OB 2R5AA 4M77B 3JCMg 2E12A 3C4SA 4B9WA 3OS2A 2KK4A 3QG1A 1XQHA 3TCJA 1QVFS 4A53A 4LDYA 3LWHA 5J3BA 2DXBA 4NL3A 1K8AU 4MZTA 3TREA 4V2SA 3QSUA 4N0AA 3MCAB 1DJ7B 1IZ6A 5GMKl 3CPFA 1KG1A 3SD4A 2JZ2A 3ER0A 4J6WA 3V8LA 2E6ZA 2ZCFB 5CK9A 1I5LA 3TU4K 1N9RA 4XU2A 5GAMd 3BDLA 3NFCA 3G4ST 4JLIA 5A2QE 5GAN3 2E5QA 3L2QA 3CPWS 1KQ2A 3URGA 2Y4YA 5I21A 1M5Q1 3CCRA 3QZ9B 1TH7A 3FDRA 2DEQA 4J6YA 5EG2A 1S72A 1VQ9A 2K4YA 2ZPFB 1YIJA 2QA4T 3CCUT 1WJQA 1RI0A 3RKXA 2ZPEB 4XTXA 2DD4A 3ASKA 3PIOA 2L89A 2DXUA 2RO0A 4ELYC 3L1AA 5GANd 4L6V5 3OYMA 2OTLA 1M9SA 3A8GB 5GMKm 2F5TX 2GFAA 3MEUA 3RIRA 3CCLA 2D9TA 2LT4A 5GMKi 1VQNT 1B34B 4BE1A 1OZ3A 1M1FA 1WGSA 3O8VA 4OVAA 1VQLT 4A54A 3CD6A 3OYGA 3QDRB 4BI3A 2DAQA 3GIBA 2ZZDA 4EMKC 4M7DD 1ZQ1A 2WSFE 4OF1A 3GNFB 2LX9A 2QI2A 3VYGA 1I4K1 4KULA 1VQKA 5GAN5 4C92D 3J7AF 1KHIA 3JAME 3S3NA 4A4FA 2FB7A 3QYHB 4R56A 3EAEA 2VXFA 3OYNA 3E1SA 4BB7A 4ZTJA 2VUBA 2XD0A 1H3ZA 3SB2A 3OY9A 4LDUA 1U8RA 3CCMA 4Q5WA 4FT2A 2E64A 2ZPBB 3JB9H 4EMKB 2E70A 3DKMA 2X4YA 2QXFA 3QIIA 2DZ9A 4X9CA 4BE0A 3S3MA 1VQ5A 1YITA 1VQ7T 3KUFA 1Q7YU 2WSEE 4JRQA 3CC7T 2HD0A 2RHIA 3QZ5B 2M1HA 4D6WA 5GMKh 4A4EA 2OTJA 4JRPA 3S6WA 5KH6A 1G5VA 1QP2A 3QO3A 2K3YA 5I2MA 3HPWA 3OW2A 2LNVA 2E10A 4FSXA 2RJEA 3QKJA 4F7UF 2HAXA 2XDBA 3A8MB 3H6ZA 1U1SA 2XICA 3OSSC 3PMIA 5LJ5f 2EAYA 4C8QC 2YLBA 3OYFA 5A0DA 4F7UB 1Y96B 2KVQG 4M75F 3HSBA 2AHJB 2LDMA 3HRUA 1VQ6T 2K57A 4R55A 2FVUA 2O4XA 3M4YA 3QXEB 3QJ6A 1B34A 3VU3C 1QP3A 2YHTA 4OB1B 5GAMg 3META 4M75B 1BYMA 3CBPA 4WF2A 4M7DG 4B9XA 3BW1A 4M7AG 1VUBA 4HA8A 4QQDA 3CC4A 1WNLA 2EWNA 4MZPA 3OYYA 4C92G 3CCJA 4PJOD 4YTLA 3L2VA 4C8QB 3OBWA 3CXCS 3GLXA 2EJ9A 1R8OB 2LCCA 1G3WA 3HL8A 5LJ5h 3EFSA 4BACA 1XTDA 2A7YA 4M77D 3I56A 1RL2A 4ZN1A 1KC8C 4JRKA 3G71A 5GANg 4KT0E 3CCRT 1VQ9T 5AYFA 3QPHA 3JRZA 3X24B 1YIJT 2VXEA 4OGCA 4LDXA 5LJ3e 4BD3A 4QVDA 3LW5E 4ZGEB 3OW2S 4PLIA 3PMTA 2OTLT 2EYQA 2DTIA 5GAOp 1KD1U 1M1KC 4M7DA 5IT9E 1QVPA 3CCLT 3RERA 1Q82U 3ZEHA 4DOWA 2KSSA 4RCCA 5A0GA 3KBGA 3NTHA 4XAXB 4C92A 3OYJA 5GAMj 2FYKA 1K9MU 3CD6T 2HBPA 1EIFA 2LQ8A 3CCQA 2CZ1B 4HCZA 2XI9A 4C92E 3GNGA 1K73C 2XK0A 4J6XA 5FLXE 4E7JA 1VQ4A 1YHQA 4FU6A 2VC8A 3JCMf 4M78F 4OP0A 3VYHB 1VQKT 4J7FA 1WJRA 2QQ9A 2E41A 2QDYB 3PFSA 5FRNA 5DLQE 2MWPA 3J80E 4IUPA 1YJ9A 3LYIA 2CKKA 3VKIA 3J81E 3OYIA 3PTAA 3CCMT 4M78B 2RI5A 4M75A 3HRTA 5CKDA 5GANj 4ZN3A 4HCBA 5J26A 2MWOA 4J7IA 2CYZB 3UDCA 4RG8A 1D3BB 2DTOA 4M75E 4C5EA 2CGHA 3X28B 5FROA 2CZ6B 5HK0A 5DY9A 5CR2A 3FC3A 1HK9A 1VQ5T 2LTOA 2C06A 1KHCA 1YITT 4IUQA 2WSCE 5KCHA 5KCOA 5FU7C 1NZ9A 2E1HA 2OTJT 3AHUA 2DIQA 3HHTB 3JCMh 2QTXA 4IURA 4XTUA 3MP6A 5GAOl 2DTHA 3RMQA 1Q81U 2V8KA 2PVGB 3C95A 1LNXA 2MMPA 1NJIC 5LJ3d 3CC2A 2M0OA 2PUOB 1X6OA 1XOVA 3JCMc 3OYEA 4OB0B 4XTVA 2PVOB 4NL2A 1YJNA 5GAN7 1X01A 4PJOA 1WQWA 5FU7B 2MF2A 2DD5A 3OYDA 5KE3A 1P92A 2BIVA 4KUDK 4PJOE 3SWNA 1X75C 5DLOA 2KY9A 2RI2A 3OSVA 4X34A 4ATOA 4M77A 3E9FA 5IN1A 4CRIA 1YJWA 3MO8A 1N8RC 2IG0A 2JOYA 4BDYA 3CMAA 3V7RA 3CC4T 3M55A 2DJZA 3CCJT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M9O A;  2GF7 A;  3P8D A;  3OYF A;  1SSF A;  3Q1J A;  3MEA A;  5KE2 A;  1OI1 A;  3FEO A;  3LX7 A;  2LDM A;  3DLM A;  3OMG A;  3H8Z A;  2O4X A;  2G3R A;  2EQJ A;  4IUU A;  3QJ6 A;  4QQG A;  2EKO A;  4C5H A;  3P8H A;  1OZ2 A;  3OYL A;  2L8D A;  3ME9 A;  3MET A;  2RJC A;  2VYT A;  3CEY A;  4L59 A;  3OMC A;  3OYC A;  3L2W A;  4B9X A;  2HQX A;  2LVM A;  4N4H A;  4QQD A;  2HQE A;  3UWN A;  4IUT A;  2DIG A;  3OYH A;  4FL6 A;  3L2U A;  2E6N A;  3OYB A;  2JTF A;  3L2V A;  4BAC A;  2LCC A;  2R5A A;  3LLR A;  4BE2 A;  4B9W A;  3C4S A;  4ZTF A;  3OS2 A;  3LGL A;  2GFU A;  2BUD A;  4C5G A;  3FLG A;  4E7K A;  4N4I A;  4PLL A;  3OS1 A;  3SD4 A;  2JZ2 A;  5CIU A;  2O4X B;  2B8A A;  3NTI A;  1OYX A;  2X35 A;  3MP1 A;  4BDZ A;  4BD3 A;  3LH0 A;  3M9Q A;  3OB9 A;  2RI3 A;  2R57 A;  3BDL A;  5C6S A;  4PLI A;  3PMT A;  2RJD A;  2E5Q A;  3DB4 A;  2QQR A;  3OQ5 A;  3L2Q A;  3LGF A;  2EQK A;  2RHY A;  3ZEH A;  1N27 A;  4UC4 A;  3OYJ A;  3NTH A;  2R58 A;  3FDR A;  5FRM A;  4RG2 A;  2XDP A;  4II1 A;  3OS0 A;  2BKD N;  4HCZ A;  1WJQ A;  1RI0 A;  2XK0 A;  4E7J A;  2F5K A;  3ASK A;  1WJS A;  2L89 A;  4IKF A;  4FU6 A;  2RO0 A;  3OYM A;  2EQU A;  1WJR A;  5FRN A;  3PFS A;  2PQW A;  4A4G A;  4E7L A;  2GFA A;  2MWP A;  3MEU A;  4IUP A;  2D9T A;  3LYI A;  4LD6 A;  2CKK A;  3E9G A;  3OYI A;  1OZ3 A;  3OA6 A;  3O8V A;  1WGS A;  2FHD A;  4OVA A;  2RI5 A;  3PNW C;  5C0M A;  3GOX A;  3OYG A;  4E7I A;  2DAQ A;  5J26 A;  2MWO A;  4QVZ A;  4QW2 A;  4EDU A;  3S3O A;  2RJF A;  4N4G A;  4C5E A;  5FRO A;  3FC3 A;  2LTO A;  3MEV A;  1KHC A;  5D6W A;  3DB3 A;  4IUQ A;  5KCH A;  3QBY A;  3MP8 A;  5KCO A;  3S3N A;  2M16 A;  4GY5 A;  4A4F A;  4C5I A;  4E7H A;  2NLU A;  3EAE A;  3OYN A;  4ZTJ A;  2DIQ A;  2R5M A;  1H3Z A;  4IUR A;  3OY9 A;  3MP6 A;  3MEW A;  4A4H A;  4NS5 A;  5D6X A;  3UT1 A;  3OYA A;  2EFI A;  4Q5W A;  2EQM A;  4IUV A;  2QQS A;  2M0O A;  3OYK A;  1MHN A;  2YRV A;  3QII A;  2X4Y A;  3S3M A;  3OYE A;  4BE1 A;  4BE0 A;  2RHU A;  3KUF A;  4Z02 A;  4PL6 A;  2RHZ A;  5IAY A;  2RHI A;  3L2R A;  2M1H A;  2K3X A;  4A4E A;  2X4X A;  3S6W A;  5KH6 A;  2P0K A;  3OYD A;  1G5V A;  5KE3 A;  2K3Y A;  2BIV A;  5D6Y A;  1XNI A;  3NTK A;  2WAC A;  2RJE A;  2LRQ A;  2RI2 A;  2X4W A;  3QKJ A;  4X34 A;  3E9F A;  3H6Z A;  5IN1 A;  4QQ6 A;  2RHX A;  3MO8 A;  4CRI A;  2IG0 A;  2L3R A;  3PMI A;  3F70 A;  5J39 A;  3L42 A;  4BDY A; 
#chains in the Genus database with same CATH topology
 2M9U A;  1Q86 U;  2F69 A;  5D7U A;  3FEO A;  3VS7 A;  1M3A A;  2K2V A;  3M0T A;  1NPP A;  1TUD A;  3I56 T;  3VJP A;  2RJC A;  2XHC A;  4MDW A;  3VV0 A;  2BZ8 A;  4LNP A;  4M75 D;  1VQK Q;  4FL6 A;  2JUF A;  3CCM Q;  2J6K A;  2A37 A;  3E19 A;  1QMC A;  3FLG A;  5DM7 R;  1W2B A;  1JJ2 A;  3R6N A;  5CIU A;  3CCQ T;  2RK2 A;  3MP1 A;  4BDZ A;  2CP0 A;  1YHQ T;  2DKG A;  4JLG A;  2PU9 B;  3V8J A;  2YUP A;  4RTV A;  5IXB A;  1IHW A;  5I2S A;  1KK7 A;  3CCE A;  5FRM A;  2CH4 A;  5GAN 4;  3N5B B;  4IKF A;  2C0O A;  3HRS A;  2EQU A;  4OGE A;  3VUB A;  4O5V A;  5FU6 B;  2K3B A;  3V8K A;  1E6G A;  5GAN f;  4EMK A;  3E9G A;  5C0M A;  1A0N B;  2YUO A;  3CCJ Q;  2JMC A;  2KE9 A;  3CC2 T;  2KRS A;  3UAT A;  5IXF A;  1W2B S;  1JJ2 S;  3CPW A;  2V26 A;  3QUI A;  3G71 Q;  1LJO A;  2AK5 A;  3RES A;  5KYY A;  3MEW A;  2EQI A;  2H3J A;  5D6X A;  3M59 A;  3OYA A;  2ZPH B;  1V1C A;  1F1B B;  2EYZ A;  5IH2 A;  3QWX X;  3G7Z A;  4L5G A;  4VUB A;  1ZA1 B;  3EGX A;  4XTY A;  4PL6 A;  3DLL A;  2D0Q B;  6AT1 B;  1NM7 A;  2C06 A;  3JCM b;  5CKH A;  2GNC A;  5CCA A;  3I55 A;  1QW1 A;  2GF7 A;  1G3Y A;  1OI1 A;  3DLM A;  1HXD A;  3H8Z A;  3HP9 A;  4RTU A;  4KGX B;  3ME9 A;  1BI2 A;  2CZ7 B;  2QEX A;  1Q7Y C;  3L2U A;  3PE0 A;  1YWP A;  1OX9 A;  4JS4 A;  1VQ8 A;  2JN0 A;  4PNO A;  1G83 A;  2CUB A;  3LGL A;  4QVC A;  4BI4 A;  2NUP B;  3UA7 A;  4C0Z A;  3OS5 A;  4HKE A;  2NYS A;  3M9Q A;  2GQV A;  1WHJ A;  4RTX A;  4DBQ A;  3CME T;  1FWZ A;  2FPE A;  3RNJ A;  2LZ6 B;  5HKC A;  4M7A D;  1D3B A;  3L2Z A;  3THK A;  4ELZ C;  2QQB A;  4NOY A;  4CC7 A;  3WVD B;  2P4T A;  2YUQ A;  3JCM d;  1X69 A;  4DEX A;  1ZUK A;  2DXT A;  3CXC A;  3G4S A;  3QJY A;  2X4J A;  1G3T A;  2KAF A;  1VQP T;  1BI3 A;  3M0P A;  2KNB B;  1MMN A;  4ZGD B;  2JJ9 A;  1N6A A;  3PNW C;  1CSK A;  4M7D B;  1ZHI A;  2RPN A;  3NMZ C;  2ATC B;  3RKW A;  1N8R R;  1E6H A;  3MEV A;  5LJ5 g;  2IVW A;  1NBE B;  1WFW A;  2H8H A;  1WI7 A;  2QAS A;  4E7H A;  4MDX A;  3RMS A;  1AWW A;  2R5M A;  3ZBD A;  3CCS T;  4D8D A;  4X9D A;  1K0S A;  3G6E T;  1O9S A;  2YUN A;  4LDW A;  3HFN A;  1WQ7 A;  2KDS A;  1SHG A;  4KBM B;  1TS9 A;  3CCE Q;  3LWI A;  4C0D B;  2JT4 A;  4OB2 B;  1PD0 A;  1D1C A;  2EBP A;  4PJO C;  1Q82 R;  1NYF A;  1VQ7 A;  3P8D A;  1M27 C;  5CKE A;  1BB9 A;  4FIB A;  4PJO F;  2NUZ A;  2LX7 A;  2DO3 A;  2RB6 A;  5LJ3 h;  3P8H A;  3X26 B;  1M90 R;  3CEY A;  2AKK A;  4FW2 A;  3MPU B;  4M7A A;  2DMO A;  2B86 A;  2DYI A;  3SWN B;  2XID A;  1C6V X;  1VQ6 A;  2R5A A;  4B9W A;  3OS2 A;  2KBT A;  2L3Q A;  3LWH A;  5J3B A;  4V2S A;  4MZT A;  4JZ4 A;  3CPF A;  2JZ2 A;  3V8L A;  3TU4 K;  1N9R A;  3BDL A;  1XJW B;  1TG0 A;  5GAN 3;  3VS6 A;  2CRE A;  2Y4Y A;  1M5Q 1;  3QZ9 B;  3FDR A;  5EG2 A;  5IHK A;  1AVZ C;  2K4Y A;  2JTE A;  2ZPF B;  5KYU B;  3CCU T;  1OUL A;  3RKX A;  2ZPE B;  2DD4 A;  2L89 A;  2RO0 A;  1ARK A;  5GAN d;  1RI9 A;  3OYM A;  1RAF B;  2F5T X;  1W70 A;  5GMK i;  2QEX Q;  1WYX A;  4BI3 A;  1VQ8 Q;  5KYW B;  2KRO A;  4EMK C;  1SRL A;  1YIJ Q;  4OF1 A;  3VYG A;  1I4K 1;  2EPD A;  1KHI A;  3JAM E;  4R0K A;  1X2K A;  4A4F A;  4R56 A;  2VXF A;  3E1S A;  4KGV B;  2VUB A;  4FYW B;  2A0F B;  3MJX A;  4FT2 A;  2E64 A;  3DKM A;  1VQ5 A;  2EYY A;  2A08 A;  2C0I A;  3KUF A;  1Q7Y U;  1D0X A;  2WSE E;  2GGR A;  3I35 A;  4D6W A;  4JRP A;  2XMF A;  5KH6 A;  1M30 A;  2P84 A;  1G5V A;  3QO3 A;  2K3Y A;  3HPW A;  1U3O A;  4FSX A;  1UHF A;  2W10 A;  3QKJ A;  2HAX A;  5KYU A;  3PMI A;  2EAY A;  1Y96 B;  4M75 F;  5IHI A;  3HRU A;  2D0N A;  4R55 A;  3M4Y A;  3QXE B;  2YRD A;  1EX4 A;  3VU3 C;  3CBP A;  5KYW A;  3CC4 A;  4B6M A;  1IXD A;  2FO0 A;  2NUT B;  2L0A A;  3SHW A;  3EFS A;  2J6F A;  2A7Y A;  2HZY A;  1UHC A;  4M77 D;  4E7Z A;  1KC8 C;  4JRK A;  2ECZ A;  3CCR T;  1NLP C;  3QPH A;  3JRZ A;  1PKT A;  4LDX A;  1KD1 R;  2GTO A;  4QVD A;  7AT1 B;  3CCL T;  2QGF B;  2F2W A;  1TWB A;  1SF9 A;  5A0G A;  3KBG A;  1YWO A;  3I56 Q;  5GAM j;  2LQ8 A;  4HCK A;  1VQ7 Q;  4HCZ A;  4C92 E;  1K73 C;  2XK0 A;  4J6X A;  1OPL A;  3CQT A;  1T3S A;  4KGZ B;  2MWP A;  3J80 E;  1QKW A;  3LYI A;  2E3H A;  1X43 A;  1EZZ B;  3VKI A;  3OYI A;  4M78 B;  2RI5 A;  5J26 A;  4J7I A;  2CYZ B;  1ZSZ B;  4RG8 A;  4M75 E;  4ORZ A;  1VQ6 Q;  2CGH A;  2CZ6 B;  5CR2 A;  3FC3 A;  2LTO A;  1KHC A;  5AT1 B;  1YHQ Q;  5KCO A;  4ZNX A;  1Q81 R;  1NZ9 A;  1MNE A;  1TUG B;  3JCM h;  2O88 A;  5GAO l;  2LJ1 A;  1NJI C;  1TXQ A;  2X51 A;  1I5O B;  1UEC A;  2HL3 A;  3JCM c;  2KGT A;  1UGV A;  4NL2 A;  1HYO A;  5GAN 7;  1WQW A;  4HVU A;  1BCO A;  5KE3 A;  2F2V A;  3I5S A;  4KUD K;  1KQS P;  4M77 A;  3E9F A;  1M2V B;  3MO8 A;  2IG0 A;  3CC2 Q;  1GCP A;  4KUI A;  2FZK B;  2G6F X;  3CBO A;  1X2Q A;  2H3E B;  4IUU A;  4PJJ A;  4M78 A;  3JB9 I;  2LCL A;  2MIO A;  2K6D A;  3OYC A;  3M5A A;  4CI0 C;  1ZBX A;  4M7D C;  4M7A C;  1WIE A;  2RQT A;  1WX6 A;  4PJN A;  2FL7 A;  2XDD A;  1VQM A;  3EFO B;  4FYV B;  4C5G A;  1MMD A;  3M57 A;  1WXT A;  1SPK A;  2AZS A;  2YRC A;  1VQ5 Q;  4M7A F;  2GCX A;  4PFP A;  5HK3 A;  4P5N A;  1FX7 A;  1VQ4 T;  3OB9 A;  3DB4 A;  2QQR A;  2QGG A;  5CQX A;  1YJ9 T;  3HFO A;  2QAZ A;  3VS5 A;  1UB4 A;  4XU0 A;  2YSQ A;  3M53 A;  1RAD B;  2CDT A;  3H0F A;  2JM8 A;  4XK8 E;  4HXJ A;  2RNA A;  1WZO A;  4E47 A;  4JJN K;  1ACM B;  1YI2 A;  3VRZ A;  1K8A C;  1PWT A;  4DOV A;  5LJ3 g;  4QT7 A;  4JUV A;  3VS3 A;  4M75 G;  4AG1 C;  3CC4 Q;  3UPU A;  1VYV A;  4RCB A;  2KMT A;  4N4G A;  3KXT A;  4JJC A;  2VGN A;  4XTZ A;  3RR6 A;  3MP8 A;  3M58 A;  2ZPG B;  4E6R A;  3SWN C;  2EIF A;  5GAO q;  4BY6 B;  5FWC A;  1IRE B;  4HT8 A;  1OPK A;  3BDU A;  5GAN h;  4IUV A;  1YNZ A;  2RN8 A;  4Y28 E;  1YJW T;  2YRV A;  4F7U E;  3SDZ A;  1M3C A;  3V7S A;  4JDS A;  2CSQ A;  1JB0 E;  2PUK B;  2JXB A;  1VQP Q;  1MND A;  3NHN A;  1LPL A;  3CCV T;  4BI8 B;  2K79 A;  1XNI A;  2F2X A;  2NWM A;  2DL8 A;  2WAC A;  3NTK A;  2V8I A;  4C8Q A;  3C12 A;  1YJN T;  2DJQ A;  1KSW A;  2M51 A;  1FMW A;  2KYM A;  3M0Q A;  4RMO A;  1KC8 U;  2RHX A;  1JBM A;  3P8B B;  1PM3 A;  1M1K R;  3M0S A;  1ZSG A;  2G3R A;  2KQW A;  1GFD A;  2DNU A;  1UGP B;  3VS2 A;  3SEM A;  2CZ0 B;  2LVM A;  4N4H A;  1YFN A;  4IUT A;  1UGS B;  1IGQ A;  3OYB A;  2DL7 A;  2EGC A;  4FM4 B;  1K73 U;  4BE2 A;  1T0J A;  1Y71 A;  2KRN A;  1KIK A;  3OBY A;  4WCI A;  4FYX B;  2B8A A;  3JCM P;  2RA2 A;  1OYX A;  1GFC A;  2ZGW A;  1GBQ A;  3M56 A;  2XG8 D;  1H3H A;  2J6O A;  1YBY A;  2P4R A;  3LGF A;  4FT4 A;  4UC4 A;  3OS0 A;  2BKD N;  2DZC A;  2YWW A;  2F5K A;  3NGP A;  2ESW A;  2DIL A;  1NJI U;  4PFO A;  1GBR A;  1WHK A;  4A4G A;  1VIE A;  1TSF A;  4LD6 A;  4E7I A;  1QVG A;  1WXB A;  5GAN 8;  4QVZ A;  4QW2 A;  4EDU A;  4M4Z A;  1ZX6 A;  4ANJ A;  4C92 B;  5D6W A;  3DB3 A;  1VQM Q;  1Y07 A;  3BY7 A;  5GMK j;  1HD3 A;  3C94 A;  2NLU A;  1VQN A;  1WPY A;  4MMK A;  1PKS A;  4E2F B;  3RKY A;  1VQL A;  4PK4 A;  4F7U G;  3M4G A;  2QQS A;  2CSI A;  4RTZ A;  3OYK A;  1QVF A;  1M8V A;  5GAM e;  5IAY A;  2RHZ A;  1I0C A;  4XTW A;  2BTT A;  4LN2 A;  2YLC A;  3EGD B;  4MML A;  3GF5 A;  2RQV A;  1R77 A;  1YI2 Q;  1UGR B;  5J39 A;  1JRI A;  4J9B A;  4M77 C;  5LJ5 j;  3CC7 A;  1QVG S;  2D6F A;  2RQU A;  4J5Y A;  1UUE A;  1QCN A;  1VQO T;  3CMA T;  4HCB A;  4RUG A;  4OML A;  3I5R A;  3MHX A;  1RAI B;  4M77 F;  4M78 C;  2ED1 A;  4DA4 A;  3SFM A;  4OB3 B;  1R0B G;  1ZSZ C;  3JCM g;  3C4S A;  2CP2 A;  2KK4 A;  3TCJ A;  1QVF S;  1Y0M A;  4LDY A;  1K8A U;  3TRE A;  3QSU A;  2CT4 A;  1DJ7 B;  3REA B;  1KG1 A;  4WTO B;  2KT1 A;  3SD4 A;  2D8J A;  2E6Z A;  2RQR A;  2OJ2 A;  1M3B A;  1W1F A;  3NFC A;  4JLI A;  2EYW A;  5A2Q E;  3CPW S;  1OU9 A;  2AZV A;  1TH7 A;  1VQ9 A;  2CP5 A;  1YIJ A;  2QA4 T;  1RI0 A;  3ASK A;  4ELY C;  3L1A A;  4JPB W;  1MV0 B;  1M9S A;  3RIR A;  2GFA A;  3MEU A;  2LT4 A;  1OZ3 A;  1M1F A;  3O8V A;  5IHN A;  2FEI A;  4A54 A;  3CD6 A;  3QDR B;  2DM1 A;  1SG5 A;  1AWO A;  4M7D D;  2WSF E;  4KUL A;  3QYH B;  2PTK A;  4BB7 A;  2OX7 A;  2XD0 A;  3OY9 A;  1U8R A;  3H9N A;  3JB9 H;  2DYB A;  1YIT A;  1OEB A;  1PG5 B;  4PFZ A;  4A4E A;  2OTJ A;  4AFQ C;  3OW2 A;  3H41 A;  1RAB B;  4PJL A;  3A8M B;  1S1N A;  2AIR B;  1U1S A;  3OSS C;  2DET A;  4C8Q C;  2YLB A;  4F7U B;  2NUP A;  2LDM A;  2K57 A;  4CC3 A;  3A1P A;  3MET A;  2E4H A;  3EG0 A;  1WNL A;  1VQN Q;  3CXC S;  1VQL Q;  1XTD A;  3I56 A;  1RL2 A;  1RAH B;  5GAN g;  4KT0 E;  5AYF A;  3X24 B;  4BD3 A;  2JMA A;  3O5Z A;  4ZGE B;  3OW2 S;  2OTL T;  5GAO p;  4M7D A;  5IT9 E;  1K9M R;  1QVP A;  2VB6 A;  1CKA A;  3OYJ A;  2VWF A;  1JQQ A;  1EIF A;  3CCQ A;  1VYT A;  3CC7 Q;  3GNG A;  2CUD A;  5FLX E;  3MKD A;  1YHQ A;  3LH5 A;  2VC8 A;  1UE9 A;  2LNH B;  4FCY A;  4ESR A;  1VQK T;  4J7F A;  2E41 A;  3PFS A;  4IUP A;  2A36 A;  1OOT A;  2CKK A;  1MMA A;  3C0C A;  3CCM T;  5CKD A;  2MCN A;  4ZN3 A;  2MWO A;  1RUW A;  4C5E A;  5HK0 A;  1G8X A;  1FMK A;  4J9D A;  1BK2 A;  1ABO A;  5FU7 C;  2E1H A;  3AHU A;  2LP5 A;  3RMQ A;  1JEG A;  3C95 A;  3CC2 A;  1XOV A;  1QKX A;  1WLP B;  1AZG B;  4OB0 B;  5KYX B;  3EG2 A;  1VQ9 Q;  2MF2 A;  5L23 A;  4DBR A;  1P92 A;  1YP5 A;  4PJO E;  3SWN A;  2HBW A;  2KY9 A;  2HCK A;  4X34 A;  1Q86 R;  4ATO A;  5IN1 A;  1N8R C;  2JOY A;  3CMA A;  3V7R A;  3M55 A;  3G1J A;  2DJZ A;  3CCJ T;  2V8J A;  2Y4X A;  3CD6 Q;  1M8M A;  2X3X D;  2EKO A;  4C5H A;  3JCM V;  1G2B A;  2EJG A;  3G71 T;  3OMC A;  2JVV A;  3L2W A;  5GMK e;  2LQK A;  2CP7 A;  5CVI A;  3WVE B;  3OYH A;  5I22 A;  2DVE A;  2DRK A;  3TEE A;  1RLQ C;  4PJM A;  3LLR A;  4ZTF A;  4C92 C;  1UGQ B;  2BUD A;  1NE8 A;  3QDF A;  1D0Y A;  2EGA A;  1M1G A;  2VGM A;  4KH1 B;  4PLL A;  2LT1 A;  1YIT Q;  1Q82 C;  3NTI A;  2X35 A;  1ABQ A;  2J7I A;  1NLO C;  4DBF A;  4JRI A;  2OTJ Q;  2HNI A;  2XKO C;  5FU6 C;  3EG9 B;  2FPD A;  1FYN A;  2LMJ A;  2P0Q A;  5GAM f;  2EQK A;  2EYX A;  4Y91 A;  1WA7 A;  2FPF A;  1M90 C;  2RK1 A;  5CKB A;  3ZFJ A;  5LJ5 e;  2XDP A;  2FZG B;  1CKB A;  3CME A;  3A8H B;  1QQJ A;  1W4S A;  1S72 T;  2ROL A;  2DL3 A;  3GOX A;  5CQY A;  2YDL A;  2QG9 B;  4M78 D;  1N9S A;  2J05 A;  2KT8 A;  1WXU A;  1VQP A;  2COZ A;  4LE9 A;  2PZ1 A;  4EMH A;  2ZAE A;  4A4H A;  2EQM A;  1Y96 A;  3HTR A;  2L5Q A;  4EPC A;  5CKF A;  1BIB A;  3UF4 A;  2E3I A;  2EGE A;  5HY6 A;  3PIP A;  4PJO G;  5LJ3 j;  4ZGJ B;  1J3T A;  2KXC A;  4TVR A;  3CCQ Q;  3CCS A;  2DPP B;  3G6E A;  2NUT A;  2K5L A;  2O9S A;  4HT9 A;  2L2P A;  2W0Z A;  1Q86 C;  3GP8 A;  3BFM A;  1UFF A;  1IB8 A;  3TSZ A;  3ZL7 C;  2L8D A;  3M54 A;  2PVD B;  4JS5 A;  1PC0 A;  3GPL A;  2JTF A;  2DRM A;  1K0X A;  2IPO B;  3EHQ A;  3JB9 J;  4N4I A;  3CCE T;  3OS1 A;  2ZPI B;  2O4X B;  4O6J A;  2GBQ A;  3REB B;  9ATC B;  1Z9Z A;  2RI3 A;  2R57 A;  2DF6 A;  2RJD A;  3RUX A;  1ZSZ A;  1AEY A;  4XU3 A;  3CMA Q;  1IO6 A;  4RG2 A;  2I2L A;  2LJ0 A;  4Z89 A;  4C8Q D;  1U5S A;  4AT1 B;  2MAM A;  3GBQ A;  1GRI A;  4M7D F;  4E7L A;  1AHJ B;  1KQ1 A;  3R6O A;  2E65 A;  2FHD A;  1D0Z A;  5GAN 6;  3JB9 D;  3CCU A;  3FJP A;  1KD1 C;  2CS7 A;  4GLK A;  1FXX A;  2K9G A;  4C0D C;  1N8R U;  1JXM A;  1M2V A;  1NPR A;  4DEY A;  2A28 A;  2D8H A;  3X20 B;  3JCM Q;  3I55 T;  1MHN A;  4LD9 K;  2LJ3 A;  2ENM A;  4Z02 A;  1QLY A;  3L2R A;  2KRM A;  2P0K A;  1ZUY A;  4C0G A;  1BKB A;  2RM4 A;  1Y7X A;  3T9N A;  2X4W A;  2MPX C;  3CME Q;  2QEX T;  1QWE A;  4QQ6 A;  3M0R A;  3EFO A;  1VQ8 T;  2DLP A;  4DBH A;  1VA7 A;  3MEA A;  1Q82 U;  3LX7 A;  1Q81 C;  2QQA A;  4QQG A;  1LVK A;  3OYL A;  4HCC A;  4MZM A;  3FIF A;  1GXI E;  4D8K A;  5GAN 2;  2HL5 C;  1YCY A;  2J06 A;  4PJO B;  1M90 U;  2DIG A;  4M7D E;  3V7C A;  4M7A E;  1D09 B;  2HEQ A;  4Z8A A;  2E12 A;  1OV3 A;  3QG1 A;  1XQH A;  4NL3 A;  1I1J A;  4N0A A;  1IZ6 A;  4X1V A;  5GMK l;  4J6W A;  3A98 A;  1UJY A;  5CK9 A;  1N5Z A;  2MOX A;  4XU2 A;  5GAM d;  1HJD A;  3G4S T;  3CCS Q;  1JU5 C;  2E5Q A;  3G6E Q;  1PRL C;  3URG A;  5I21 A;  3CCR A;  3EH1 A;  1S72 A;  2DEQ A;  4J6Y A;  2LQN A;  2EKH A;  2LCS A;  1WJQ A;  1OQK A;  3PIO A;  4L6V 5;  1AWJ A;  3A8G B;  2DBK A;  3CCL A;  4GBQ A;  1AD5 A;  1B34 B;  4AFZ C;  1WGS A;  2ZZD A;  4F14 A;  2HKQ B;  3GNF B;  1NEG A;  5GAN 5;  4C92 D;  3J7A F;  2FB7 A;  4ZTJ A;  2F1L A;  4AMC A;  4LDU A;  1AOJ A;  2YT6 A;  1WHL A;  2ZPB B;  1Q7Y R;  1B07 A;  2DX1 A;  4EMK B;  2E70 A;  3QII A;  2X4Y A;  2QXF A;  4GLM A;  2DZ9 A;  4X9C A;  4BE0 A;  3S3M A;  1VQ7 T;  2X3W D;  2HD0 A;  2RHI A;  1T0H A;  2M1H A;  5I2M A;  4JJB A;  2LNV A;  3JV3 A;  2XDB A;  4J9C A;  3H6Z A;  2DA9 A;  2XIC A;  5KYY B;  5LJ5 f;  1ZBJ A;  5A0D A;  3OYF A;  2BE9 B;  1GL5 A;  2AHJ B;  1VQ6 T;  3QJ6 A;  4F16 A;  1B34 A;  4J9G A;  3EGX B;  4OB1 B;  3CCU Q;  1MMG A;  4M75 B;  1BYM A;  4M7D G;  4B9X A;  4M7A G;  1VUB A;  4HA8 A;  2JS0 A;  3OYY A;  3L2V A;  5HCK A;  3OBW A;  3GLX A;  2EJ9 A;  1R8O B;  2HQH A;  1G3W A;  2X9H A;  3HL8 A;  4FSS A;  4LUE A;  2K7A A;  4OMN A;  4OMQ A;  1NG2 A;  2VXE A;  4OGC A;  5LJ3 e;  1B7T A;  1RLP C;  2LQW A;  2DL4 A;  4PLI A;  3PMT A;  2DTI A;  1KD1 U;  1M1K C;  2AT1 B;  3VS0 A;  2CP6 A;  2RF0 A;  3ZEH A;  2KSS A;  4RCC A;  3NTH A;  4C92 A;  1M2O A;  2BE7 D;  2HBP A;  2CZ1 B;  3UA6 A;  3EGU A;  1I07 A;  1EFN A;  4E7J A;  1LCK A;  1VQ4 A;  3VYH B;  4M78 F;  4OP0 A;  2DER A;  2JS2 A;  5FRN A;  5DLQ E;  2JW4 A;  1YJ9 A;  2DFU A;  1WHM A;  2DE0 X;  5KYN A;  1MUZ A;  4M75 A;  3HRT A;  5GAN j;  1K76 A;  3UDC A;  1D3B B;  3X28 B;  1HK9 A;  1VQ5 T;  3EGD A;  4IUQ A;  1K1Z A;  4J9H A;  2DIQ A;  3FJ5 A;  2DTH A;  1Q81 U;  2V8K A;  2PVG B;  1NYG A;  2MMP A;  1ZA2 B;  3TVT A;  2L3S A;  2M0O A;  2PUO B;  1X6O A;  2DL5 A;  1SSH A;  4XTV A;  3PVL A;  3CCR Q;  1S72 Q;  3TSW A;  1GCQ A;  1WHH A;  3OYD A;  4KRT A;  2BIV A;  2VVK A;  4Y92 A;  2ABL A;  3RDV A;  2ED0 A;  4LUD A;  1YJW A;  2HDA A;  3CC4 T;  3CCL Q;  2L3P A;  4M77 E;  3E2U A;  4EIK A;  1Q95 G;  1BIA A;  1RAG B;  5GAO r;  3CCV A;  3JSC A;  1YJN A;  4A4K A;  1I8F A;  1VOM A;  4M78 E;  1X6B A;  3UWN A;  3FRN A;  2K5I A;  4Z88 A;  3VS1 A;  2GFU A;  1UEB A;  4E7K A;  3JCM W;  4IIO A;  1KQS A;  4FW1 A;  5CO7 A;  4KH0 B;  2O9V A;  1BU1 A;  4N0A C;  4RTY A;  3LH0 A;  3QWY A;  2RD1 A;  1QWF A;  5C6S A;  4M7A B;  4ME7 A;  4C8Q F;  2MYS A;  2R58 A;  4OMF B;  4II1 A;  2ROT A;  2VV5 A;  4LDV A;  1U1T A;  1D1A A;  2MI6 A;  1H8K A;  1WJS A;  4OMM A;  4CC2 A;  4J83 A;  3EFR A;  4XQ3 A;  3JB9 F;  3JCM J;  4A63 B;  1O75 A;  2PQW A;  4BY6 C;  2OI3 A;  3QYG B;  1WHG A;  2FRW A;  3OA6 A;  3WXM B;  5GAM h;  2BZX A;  4F04 B;  4JJD A;  5LL6 S;  2FG0 A;  1PHT A;  3QBY A;  1KQS S;  2M0Y A;  1BI0 A;  1W6X A;  3CBM A;  4C5I A;  4GY5 A;  3QHS A;  1LOJ A;  1SKU B;  4NS5 A;  1Z9Q A;  1BI1 A;  1UDL A;  2EFI A;  2VAS A;  4F7U A;  3HKS A;  1VYU A;  2XU8 A;  2KR3 A;  5GJW B;  1JXO A;  1VIF A;  2RHU A;  5GJV B;  1PD1 A;  3U23 A;  2K3X A;  2D1X A;  2FRY A;  1KC8 R;  5LJ5 d;  1MGQ A;  1VQ4 Q;  4HVV A;  4BUG A;  4M77 G;  3JCM e;  3A8L B;  2L3R A;  4JZ3 A;  4C8Q E;  3L42 A;  1YJ9 Q;  2GQI A;  5KE2 A;  1H64 1;  3X25 B;  3OMG A;  1QCF A;  2EQJ A;  5CAI A;  3VUZ A;  1VQM T;  4OMO A;  2JM9 A;  3VS4 A;  4M78 G;  1M1K U;  2VYT A;  3EH2 A;  4RKU E;  2GTJ A;  2HQX A;  1K73 R;  3I55 Q;  3A5Z B;  1MV3 A;  3EG3 A;  1W2B P;  1JJ2 P;  2V1R A;  2Y90 A;  5FWB A;  1IRX A;  4PKC C;  1M4Z A;  1VQO A;  1RAC B;  2IIM A;  5GAO m;  1U06 A;  1QVG P;  4J9I A;  3EG1 A;  1G3S A;  3NPF A;  1TOV A;  1YI2 T;  3OQ5 A;  1ZLM A;  1V29 B;  2RHY A;  1N27 A;  1YJW Q;  3FB9 A;  1NJI R;  1PSE A;  2RH2 A;  2DXC A;  1QVF P;  4AFU C;  3CCV Q;  1YJN Q;  1AWX A;  1R0C B;  4C92 F;  3S3O A;  1PSF A;  5KYX A;  2RJF A;  2QA4 A;  2JNG A;  3CPW P;  2O31 A;  4M75 C;  1IHV A;  4C0F A;  4E7S A;  3INZ A;  3G4S Q;  2M16 A;  1K9M C;  3M0U A;  2DEU A;  5L8R E;  2A3L A;  2LC4 A;  5I11 A;  3ULR B;  2JTM A;  1H92 A;  3UT1 A;  4IIM A;  2K5F A;  4FYY B;  3KFV A;  5LJ3 f;  1JO8 A;  4J8O A;  2QTV A;  2X4X A;  4AG2 C;  1ZUU A;  5A0L A;  5D6Y A;  1Y57 A;  4C8Q G;  2KEA A;  2LRQ A;  3PGG A;  1GCQ C;  2QDL A;  4EMG A;  2YXY A;  1I81 A;  2O01 E;  2COY A;  2SEM A;  3F70 A;  5M9O A;  1RAA B;  1AZE A;  1SSF A;  3Q1J A;  5GAO n;  2HMA A;  5GAN e;  2OAU A;  3JCM X;  2E5K A;  2P0P A;  4XU1 A;  1OZ2 A;  3JB9 G;  4L59 A;  2DK3 A;  4HVW A;  3PT9 A;  3EG9 A;  2RMO A;  3TQ7 P;  2HQE A;  2EJF A;  2E6N A;  4DQ2 A;  1C1A A;  4J9F A;  2AKL A;  3A8O B;  1K8A R;  4M77 B;  2K2M A;  1V76 A;  1NEB A;  4A53 A;  1B3Q A;  2DXB A;  3MCA B;  3ER0 A;  2ZCF B;  1I5L A;  1UJ0 A;  1AT1 B;  2DBM A;  4CC4 B;  1T3L A;  3L2Q A;  1QCO A;  1KQ2 A;  3CXC P;  3H0H A;  4XTX A;  2EW3 A;  2HKN A;  2DXU A;  2O2O A;  4LXC A;  1IGU A;  8AT1 B;  2OTL A;  5EC7 A;  5GMK m;  3AT1 B;  2D9T A;  1VQN T;  2COW A;  1BCM A;  4BE1 A;  3H0I A;  1VQL T;  4OVA A;  3OW2 P;  3OYG A;  3GIB A;  1UG1 A;  1PCX A;  2DAQ A;  1KJW A;  3PVQ A;  1ZQ1 A;  4J9E A;  1OX8 A;  2LX9 A;  1WDX A;  2QI2 A;  4QKU A;  1K4U S;  1VQK A;  1VQO Q;  1TTH B;  3S3N A;  3EAE A;  3OYN A;  1H3Z A;  3SB2 A;  3CCM A;  1TUC A;  4Q5W A;  2SRC A;  2CP3 A;  3I9Q A;  2C0T A;  2KYB A;  1FMV A;  3CC7 T;  4JRQ A;  2I0N A;  2EVR A;  3QZ5 B;  5GMK h;  4RTW A;  3S6W A;  1QP2 A;  1RAE B;  2E10 A;  2RJE A;  4F7U F;  1UTI A;  4K11 A;  3EHR A;  2KVQ G;  3HSB A;  2PNI A;  2FVU A;  2O4X A;  2CH4 W;  2QA4 Q;  1QP3 A;  2YHT A;  3D7S B;  5GAM g;  1BBZ A;  2DVJ A;  4RTT A;  4WF2 A;  3BW1 A;  2QK0 A;  4QQD A;  2EWN A;  4C92 G;  4MZP A;  4PJO D;  3CCJ A;  4YTL A;  4C8Q B;  1X6G A;  4BAC A;  2LCC A;  5LJ5 h;  1SEM A;  2FZC B;  3BE3 A;  2VKN A;  4ZN1 A;  2M02 A;  3G71 A;  3VRY A;  1OU8 A;  1X27 A;  1VQ9 T;  1YN8 A;  2V1Q A;  1YIJ T;  3LW5 E;  2EYQ A;  4AFS C;  3RBB B;  2BZY A;  3RER A;  4DOW A;  4XAX B;  1K9M U;  2FYK A;  3CD6 T;  1TU0 B;  1PNJ A;  2XI9 A;  5ECA A;  1HSQ A;  4FU6 A;  2RQW A;  3JCM f;  1WJR A;  2QQ9 A;  2QDY B;  1YCS B;  2OAW A;  2KXD A;  3J81 E;  2QYZ A;  3PTA A;  1SRM A;  2KI7 A;  5FW9 A;  2DTO A;  1E7O A;  5FRO A;  1SHF A;  2HSP A;  5DY9 A;  1KFZ A;  1YIT T;  1D1B A;  2CT3 A;  5KCH A;  2WSC E;  8ATC B;  2OTJ T;  3IQL A;  3HHT B;  4F17 A;  2QTX A;  4IUR A;  4XTU A;  3MP6 A;  1K9A A;  2MK5 A;  1LNX A;  5LJ3 d;  3OYE A;  2HSE B;  2PVO B;  1X01 A;  4OMP A;  5FU7 B;  4PJO A;  2Z0W A;  2DD5 A;  1C0M A;  5DLO A;  1X75 C;  2RI2 A;  3OSV A;  4CRI A;  2OTL Q;  4BDY A;  1PRM C; 
#chains in the Genus database with same CATH homology
 2M9U A;  1Q86 U;  2F69 A;  4M77 E;  3FEO A;  4KUI A;  2K2V A;  2V8J A;  2Y4X A;  3CBO A;  4IUU A;  1NPP A;  1BIA A;  2EKO A;  4C5H A;  5GAO r;  3JCM V;  3I56 T;  3CCV A;  2EJG A;  3JSC A;  4M78 A;  3VJP A;  2RJC A;  3JB9 I;  2LCL A;  2XHC A;  4MDW A;  3OMC A;  3OYC A;  3VV0 A;  2JVV A;  1I8F A;  4A4K A;  5GMK e;  3L2W A;  2LQK A;  3M5A A;  4M75 D;  4M78 E;  5CVI A;  3WVE B;  3UWN A;  3OYH A;  4FL6 A;  4CI0 C;  1ZBX A;  4M7D C;  2DVE A;  3FRN A;  4M7A C;  2K5I A;  3TEE A;  3G71 T;  2JUF A;  3LLR A;  4ZTF A;  4C92 C;  2FL7 A;  2XDD A;  2GFU A;  1UGQ B;  1UEB A;  2BUD A;  1VQM A;  1NE8 A;  3FLG A;  3E19 A;  4C5G A;  5DM7 R;  4E7K A;  3JCM W;  3M57 A;  1M1G A;  2VGM A;  4PLL A;  1W2B A;  1JJ2 A;  1KQS A;  2LT1 A;  1K8A C;  5CIU A;  3CCQ T;  2RK2 A;  4M7A F;  2GCX A;  3NTI A;  5CO7 A;  1Q82 C;  2X35 A;  3MP1 A;  4N0A C;  5HK3 A;  4BDZ A;  3LH0 A;  4P5N A;  1FX7 A;  1VQ4 T;  4JRI A;  3OB9 A;  2HNI A;  1YHQ T;  2DKG A;  2RD1 A;  5C6S A;  2XKO C;  5FU6 C;  4JLG A;  2PU9 B;  4ME7 A;  4M7A B;  3V8J A;  4C8Q F;  3DB4 A;  2QQR A;  5CQX A;  2P0Q A;  1YJ9 T;  3HFO A;  5GAM f;  5I2S A;  2EQK A;  4Y91 A;  1UB4 A;  3CCE A;  4XU0 A;  1M90 C;  2R58 A;  2RK1 A;  5CKB A;  3M53 A;  3ZFJ A;  5FRM A;  5LJ5 e;  2XDP A;  4OMF B;  4II1 A;  2VV5 A;  3N5B B;  4XK8 E;  4LDV A;  5GAN 4;  1U1T A;  2MI6 A;  1WJS A;  4IKF A;  3CME A;  3A8H B;  4J83 A;  3EFR A;  4XQ3 A;  3HRS A;  4E47 A;  1W4S A;  4JJN K;  2EQU A;  4OGE A;  1O75 A;  3VUB A;  3JCM J;  2PQW A;  4O5V A;  1YI2 A;  4DOV A;  5FU6 B;  5LJ3 g;  3V8K A;  1S72 T;  4BY6 C;  4JUV A;  5GAN f;  3QYG B;  4EMK A;  3E9G A;  3OA6 A;  3GOX A;  4M75 G;  5C0M A;  3UPU A;  5CQY A;  3WXM B;  4RCB A;  5GAM h;  4M78 D;  2KMT A;  4N4G A;  3KXT A;  3CC2 T;  5LL6 S;  2VGN A;  1N9S A;  4XTZ A;  1W2B S;  1JJ2 S;  3QBY A;  3MP8 A;  3CPW A;  3M58 A;  1KQS S;  1BI0 A;  2ZPG B;  3QUI A;  3CBM A;  4C5I A;  4GY5 A;  1VQP A;  3QHS A;  1LJO A;  3RES A;  3SWN C;  1LOJ A;  2EIF A;  4EMH A;  5GAO q;  4BY6 B;  4A4H A;  3MEW A;  4NS5 A;  1IRE B;  2H3J A;  5D6X A;  1BI1 A;  3M59 A;  3OYA A;  2EFI A;  2ZPH B;  4HT8 A;  2EQM A;  4F7U A;  1Y96 A;  3BDU A;  3HKS A;  4IUV A;  5GAN h;  2L5Q A;  4EPC A;  4Y28 E;  2XU8 A;  3G7Z A;  4L5G A;  1BIB A;  5CKF A;  4VUB A;  2YRV A;  1YJW T;  4F7U E;  3SDZ A;  1VIF A;  3V7S A;  2RHU A;  4XTY A;  5HY6 A;  4JDS A;  4PL6 A;  1JB0 E;  3PIP A;  2K3X A;  2PUK B;  4PJO G;  3DLL A;  5LJ3 j;  4ZGJ B;  4TVR A;  2D0Q B;  3CCS A;  3CCV T;  4BI8 B;  2DPP B;  5LJ5 d;  1MGQ A;  3G6E A;  1XNI A;  3NTK A;  1YJN T;  2K5L A;  2WAC A;  4C8Q A;  2V8I A;  3JCM b;  3C12 A;  4BUG A;  4M77 G;  4RMO A;  5CKH A;  1KC8 U;  3JCM e;  2RHX A;  3A8L B;  5CCA A;  1JBM A;  1QW1 A;  2L3R A;  4C8Q E;  3L42 A;  3I55 A;  4HT9 A;  3P8B B;  2GF7 A;  1G3Y A;  5KE2 A;  1H64 1;  1OI1 A;  3X25 B;  1Q86 C;  3DLM A;  3OMG A;  1HXD A;  3GP8 A;  3BFM A;  3H8Z A;  2G3R A;  2EQJ A;  2KQW A;  3HP9 A;  5CAI A;  3VUZ A;  1VQM T;  1UGP B;  4M78 G;  2L8D A;  3ME9 A;  3M54 A;  1BI2 A;  2CZ7 B;  2VYT A;  1M1K U;  4RKU E;  2PVD B;  2QEX A;  4JS5 A;  2CZ0 B;  1Q7Y C;  2HQX A;  2LVM A;  4N4H A;  3L2U A;  4IUT A;  1UGS B;  4JS4 A;  1VQ8 A;  3GPL A;  3A5Z B;  3OYB A;  2JTF A;  2JN0 A;  4FM4 B;  4PNO A;  1K73 U;  4BE2 A;  1Y71 A;  3LGL A;  3OBY A;  2Y90 A;  4PKC C;  4QVC A;  1M4Z A;  1VQO A;  4BI4 A;  3JB9 J;  4N4I A;  3CCE T;  3OS1 A;  5GAO m;  2ZPI B;  3OS5 A;  4C0Z A;  2O4X B;  2D6F A;  2B8A A;  4HKE A;  2RA2 A;  1OYX A;  4O6J A;  3JCM P;  1G3S A;  2ZGW A;  3M9Q A;  3M56 A;  2GQV A;  2RI3 A;  2XG8 D;  2R57 A;  3CME T;  1FWZ A;  1YI2 T;  5HKC A;  2RJD A;  1YBY A;  3OQ5 A;  3LGF A;  3RUX A;  4FT4 A;  4M7A D;  1D3B A;  1V29 B;  4XU3 A;  2RHY A;  3L2Z A;  1N27 A;  4UC4 A;  4ELZ C;  2QQB A;  3FB9 A;  4NOY A;  3WVD B;  4RG2 A;  2P4T A;  3OS0 A;  3JCM d;  2I2L A;  2BKD N;  2DZC A;  1PSE A;  2RH2 A;  4C8Q D;  2DXC A;  2F5K A;  2DXT A;  3CXC A;  2MAM A;  1NJI U;  3G4S A;  3QJY A;  2X4J A;  1G3T A;  2KAF A;  4A4G A;  1BI3 A;  1VIE A;  4E7L A;  1VQP T;  4M7D F;  1AHJ B;  1KQ1 A;  3R6O A;  4LD6 A;  2E65 A;  4ZGD B;  2FHD A;  4C92 F;  1N6A A;  4E7I A;  3PNW C;  1QVG A;  4M7D B;  5GAN 8;  3S3O A;  1PSF A;  1ZHI A;  4QVZ A;  4QW2 A;  2RJF A;  4EDU A;  5GAN 6;  2QA4 A;  3CCU A;  2JNG A;  3JB9 D;  3RKW A;  4M75 C;  3FJP A;  1KD1 C;  4C0F A;  2CS7 A;  4C92 B;  3INZ A;  3MEV A;  5LJ5 g;  5D6W A;  3DB3 A;  2IVW A;  1Y07 A;  3BY7 A;  5GMK j;  4GLK A;  1FXX A;  1N8R U;  4C0D C;  3C94 A;  2M16 A;  4E7H A;  1K9M C;  4MDX A;  3RMS A;  2NLU A;  1VQN A;  1WPY A;  2A3L A;  2R5M A;  2LC4 A;  5L8R E;  4MMK A;  2JTM A;  1NPR A;  3ZBD A;  3CCS T;  3RKY A;  1VQL A;  4X9D A;  3UT1 A;  3G6E T;  4F7U G;  1QVG S;  3M4G A;  1O9S A;  2QQS A;  3X20 B;  4LDW A;  3JCM Q;  3OYK A;  1QVF A;  2K5F A;  1MHN A;  3I55 T;  1M8V A;  3HFN A;  4LD9 K;  4Z02 A;  5GAM e;  5LJ3 f;  2RHZ A;  5IAY A;  1WQ7 A;  2KDS A;  4KBM B;  3L2R A;  4J8O A;  3LWI A;  4XTW A;  4C0D B;  2X4X A;  2P0K A;  2YLC A;  4OB2 B;  4C0G A;  5A0L A;  1BKB A;  5D6Y A;  2RM4 A;  1Y7X A;  4PJO C;  3T9N A;  4C8Q G;  2LRQ A;  2X4W A;  3PGG A;  4MML A;  4EMG A;  2QEX T;  3GF5 A;  1I81 A;  2O01 E;  4QQ6 A;  3JB9 F;  3F70 A;  1UGR B;  5J39 A;  1VQ8 T;  5M9O A;  1VQ7 A;  3P8D A;  1JRI A;  1SSF A;  3Q1J A;  3MEA A;  4M77 C;  5CKE A;  5GAN e;  2OAU A;  3LX7 A;  5LJ5 j;  3JCM X;  4FIB A;  5GAO n;  3CC7 A;  1Q81 C;  2QQA A;  4PJO F;  4J5Y A;  4QQG A;  2DO3 A;  2RB6 A;  2P0P A;  3P8H A;  1OZ2 A;  4XU1 A;  5LJ3 h;  3X26 B;  3OYL A;  3JB9 G;  4MZM A;  1VQO T;  3CEY A;  4L59 A;  3FIF A;  3CMA T;  4HCC A;  2DK3 A;  5GAN 2;  1GXI E;  3PT9 A;  1YCY A;  3MHX A;  4M7A A;  4PJO B;  4M77 F;  4M78 C;  2HQE A;  1M90 U;  2DIG A;  2EJF A;  4M7D E;  3V7C A;  2E6N A;  4DA4 A;  3SFM A;  4OB3 B;  3SWN B;  4DQ2 A;  4M7A E;  2XID A;  1VQ6 A;  3A8O B;  2R5A A;  4M77 B;  3JCM g;  2E12 A;  3C4S A;  4B9W A;  3OS2 A;  2KK4 A;  3QG1 A;  1XQH A;  3TCJ A;  1QVF S;  4A53 A;  4LDY A;  3LWH A;  5J3B A;  2DXB A;  4NL3 A;  1K8A U;  4MZT A;  3TRE A;  4V2S A;  3QSU A;  4N0A A;  3MCA B;  1DJ7 B;  1IZ6 A;  5GMK l;  3CPF A;  1KG1 A;  3SD4 A;  2JZ2 A;  3ER0 A;  4J6W A;  3V8L A;  2E6Z A;  2ZCF B;  5CK9 A;  1I5L A;  3TU4 K;  1N9R A;  4XU2 A;  5GAM d;  3BDL A;  3NFC A;  3G4S T;  4JLI A;  5A2Q E;  5GAN 3;  2E5Q A;  3L2Q A;  3CPW S;  1KQ2 A;  3URG A;  2Y4Y A;  5I21 A;  1M5Q 1;  3CCR A;  3QZ9 B;  1TH7 A;  3FDR A;  2DEQ A;  4J6Y A;  5EG2 A;  1S72 A;  1VQ9 A;  2K4Y A;  2ZPF B;  1YIJ A;  2QA4 T;  3CCU T;  1WJQ A;  1RI0 A;  3RKX A;  2ZPE B;  4XTX A;  2DD4 A;  3ASK A;  3PIO A;  2L89 A;  2DXU A;  2RO0 A;  4ELY C;  3L1A A;  5GAN d;  4L6V 5;  3OYM A;  2OTL A;  1M9S A;  3A8G B;  5GMK m;  2F5T X;  2GFA A;  3MEU A;  3RIR A;  3CCL A;  2D9T A;  2LT4 A;  5GMK i;  1VQN T;  1B34 B;  4BE1 A;  1OZ3 A;  1M1F A;  1WGS A;  3O8V A;  4OVA A;  1VQL T;  4A54 A;  3CD6 A;  3OYG A;  3QDR B;  4BI3 A;  2DAQ A;  3GIB A;  2ZZD A;  4EMK C;  4M7D D;  1ZQ1 A;  2WSF E;  4OF1 A;  3GNF B;  2LX9 A;  2QI2 A;  3VYG A;  1I4K 1;  4KUL A;  1VQK A;  5GAN 5;  4C92 D;  3J7A F;  1KHI A;  3JAM E;  3S3N A;  4A4F A;  2FB7 A;  3QYH B;  4R56 A;  3EAE A;  2VXF A;  3OYN A;  3E1S A;  4BB7 A;  4ZTJ A;  2VUB A;  2XD0 A;  1H3Z A;  3SB2 A;  3OY9 A;  4LDU A;  1U8R A;  3CCM A;  4Q5W A;  4FT2 A;  2E64 A;  2ZPB B;  3JB9 H;  4EMK B;  2E70 A;  3DKM A;  2X4Y A;  2QXF A;  3QII A;  2DZ9 A;  4X9C A;  4BE0 A;  3S3M A;  1VQ5 A;  1YIT A;  1VQ7 T;  3KUF A;  1Q7Y U;  2WSE E;  4JRQ A;  3CC7 T;  2HD0 A;  2RHI A;  3QZ5 B;  2M1H A;  4D6W A;  5GMK h;  4A4E A;  2OTJ A;  4JRP A;  3S6W A;  5KH6 A;  1G5V A;  1QP2 A;  3QO3 A;  2K3Y A;  5I2M A;  3HPW A;  3OW2 A;  2LNV A;  2E10 A;  4FSX A;  2RJE A;  3QKJ A;  4F7U F;  2HAX A;  2XDB A;  3A8M B;  3H6Z A;  1U1S A;  2XIC A;  3OSS C;  3PMI A;  5LJ5 f;  2EAY A;  4C8Q C;  2YLB A;  3OYF A;  5A0D A;  4F7U B;  1Y96 B;  2KVQ G;  4M75 F;  3HSB A;  2AHJ B;  2LDM A;  3HRU A;  1VQ6 T;  2K57 A;  4R55 A;  2FVU A;  2O4X A;  3M4Y A;  3QXE B;  3QJ6 A;  1B34 A;  3VU3 C;  1QP3 A;  2YHT A;  4OB1 B;  5GAM g;  3MET A;  4M75 B;  1BYM A;  3CBP A;  4WF2 A;  4M7D G;  4B9X A;  3BW1 A;  4M7A G;  1VUB A;  4HA8 A;  4QQD A;  3CC4 A;  1WNL A;  2EWN A;  4MZP A;  3OYY A;  4C92 G;  3CCJ A;  4PJO D;  4YTL A;  3L2V A;  4C8Q B;  3OBW A;  3CXC S;  3GLX A;  2EJ9 A;  1R8O B;  2LCC A;  1G3W A;  3HL8 A;  5LJ5 h;  3EFS A;  4BAC A;  1XTD A;  2A7Y A;  4M77 D;  3I56 A;  1RL2 A;  4ZN1 A;  1KC8 C;  4JRK A;  3G71 A;  5GAN g;  4KT0 E;  3CCR T;  1VQ9 T;  5AYF A;  3QPH A;  3JRZ A;  3X24 B;  1YIJ T;  2VXE A;  4OGC A;  4LDX A;  5LJ3 e;  4BD3 A;  4QVD A;  3LW5 E;  4ZGE B;  3OW2 S;  4PLI A;  3PMT A;  2OTL T;  2EYQ A;  2DTI A;  5GAO p;  1KD1 U;  1M1K C;  4M7D A;  5IT9 E;  1QVP A;  3CCL T;  3RER A;  1Q82 U;  3ZEH A;  4DOW A;  2KSS A;  4RCC A;  5A0G A;  3KBG A;  3NTH A;  4XAX B;  4C92 A;  3OYJ A;  5GAM j;  2FYK A;  1K9M U;  3CD6 T;  2HBP A;  1EIF A;  2LQ8 A;  3CCQ A;  2CZ1 B;  4HCZ A;  2XI9 A;  4C92 E;  3GNG A;  1K73 C;  2XK0 A;  4J6X A;  5FLX E;  4E7J A;  1VQ4 A;  1YHQ A;  4FU6 A;  2VC8 A;  3JCM f;  4M78 F;  4OP0 A;  3VYH B;  1VQK T;  4J7F A;  1WJR A;  2QQ9 A;  2E41 A;  2QDY B;  3PFS A;  5FRN A;  5DLQ E;  2MWP A;  3J80 E;  4IUP A;  1YJ9 A;  3LYI A;  2CKK A;  3VKI A;  3J81 E;  3OYI A;  3PTA A;  3CCM T;  4M78 B;  2RI5 A;  4M75 A;  3HRT A;  5CKD A;  5GAN j;  4ZN3 A;  4HCB A;  5J26 A;  2MWO A;  4J7I A;  2CYZ B;  3UDC A;  4RG8 A;  1D3B B;  2DTO A;  4M75 E;  4C5E A;  2CGH A;  3X28 B;  5FRO A;  2CZ6 B;  5HK0 A;  5DY9 A;  5CR2 A;  3FC3 A;  1HK9 A;  1VQ5 T;  2LTO A;  2C06 A;  1KHC A;  1YIT T;  4IUQ A;  2WSC E;  5KCH A;  5KCO A;  5FU7 C;  1NZ9 A;  2E1H A;  2OTJ T;  3AHU A;  2DIQ A;  3HHT B;  3JCM h;  2QTX A;  4IUR A;  4XTU A;  3MP6 A;  5GAO l;  2DTH A;  3RMQ A;  1Q81 U;  2V8K A;  2PVG B;  3C95 A;  1LNX A;  2MMP A;  1NJI C;  5LJ3 d;  3CC2 A;  2M0O A;  2PUO B;  1X6O A;  1XOV A;  3JCM c;  3OYE A;  4OB0 B;  4XTV A;  2PVO B;  4NL2 A;  1YJN A;  5GAN 7;  1X01 A;  4PJO A;  1WQW A;  5FU7 B;  2MF2 A;  2DD5 A;  3OYD A;  5KE3 A;  1P92 A;  2BIV A;  4KUD K;  4PJO E;  3SWN A;  1X75 C;  5DLO A;  2KY9 A;  2RI2 A;  3OSV A;  4X34 A;  4ATO A;  4M77 A;  3E9F A;  5IN1 A;  4CRI A;  1YJW A;  3MO8 A;  1N8R C;  2IG0 A;  2JOY A;  4BDY A;  3CMA A;  3V7R A;  3CC4 T;  3M55 A;  2DJZ A;  3CCJ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...