2ED0A

Solution structure of the sh3 domain of abl interactor 2 (abelson interactor 2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
GSSGSSGDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abl interactor 2
publication title Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ed0A00
1NLOC 4Z88A 1ZSGA 1AD5A 3REAB 1JXMA 3TSWA 4CC4B 4RTWA 3VRZA 1M27C 2O31A 2YUPA 2QDLA 2PNIA 2AKLA 2HDAA 1U06A 4RTVA 2DBMA 3VS3A 2C0IA 4KRTA 3C0CA 1H92A 2RNAA 1BK2A 1SHFA 2O9VA 2DM1A 2D0NA 1JEGA 3M0RA 3VS6A 2P4RA 1RLQC 1UDLA 2BZ8A 4J9CA 2RMOA 2LNHB 2JMAA 1WXUA 4J9HA 1SSHA 3PVLA 4JJBA 2EQIA 4LN2A 1KIKA 3EG3A 1CKAA 1JXOA 3QWXX 2EGAA 2DX1A 1M8MA 2CT4A 1Y0MA 4OMMA 3UATA 1WYXA 4RTXA 1FMKA 5I22A 1GFDA 2CT3A 4J9EA 3H0IA 2B86A 4RTZA 2AZVA 1GCPA 2EGEA 1PRLC 1K1ZA 2DL3A 2DILA 1ZUYA 2J05A 1VYUA 2DL8A 1WXBA 3KFVA 2LQWA 2SEMA 2FPFA 4FSSA 2LJ1A 3VS0A 1VYTA 4DEYA 2CSIA 4HVVA 3EG2A 4AFZC 4LUEA 1SPKA 5IHKA 1M30A 4OMNA 3QWYA 2DJQA 3H41A 2EYYA 1RLPC 4AFSC 1NYFA 2JT4A 3I35A 3TVTA 2RF0A 1NEBA 1ZX6A 4AG1C 3LH5A 1PKTA 1AVZC 4ESRA 3GBQA 2PZ1A 2LP5A 2SRCA 2DVJA 2CUBA 4RTYA 1NLPC 1PNJA 2GGRA 2EW3A 5L23A 4GLMA 3PE0A 3A98A 1ABOA 1M3BA 3NHNA 2ED0A 1YWOA 1BB9A 2HSPA 4OMQA 3REBB 2ED1A 1KJWA 2EBPA 1TUDA 1OPLA 5I11A 4K11A 5IHNA 3TSZA 2FPDA 2EYWA 3O5ZA 4HVWA 4CC2A 1V1CA 2MOXA 2O9SA 2DRMA 3M0QA 1U3OA 2ESWA 2YSQA 1YNZA 4IIMA 2BTTA 1N5ZA 1I0CA 1QWEA 1X43A 4Y92A 2KE9A 2GTJA 2W0ZA 1X6GA 2DYBA 2ROLA 1HJDA 1J3TA 2IIMA 1CSKA 3I5RA 2CUDA 1UHCA 4AFQC 3EGUA 4A63B 3UA7A 2BZYA 2F2XA 5FW9A 2DL4A 1GFCA 2FEIA 2HEQA 5IH2A 1UFFA 2DBKA 4E6RA 1AEYA 2DL5A 5FWBA 2RQUA 3M0UA 1UGVA 2G6FX 1K76A 2M51A 4JZ3A 2EVRA 1K4US 2ENMA 2J6KA 2X3XD 2AKKA 3ULRB 2AK5A 1WI7A 1XOVA 1SEMA 4Z8AA 2DA9A 1SRLA 1AZEA 2FPEA 2YDLA 2L0AA 3NMZC 1W1FA 1EFNA 1UE9A 1UG1A 1B3QA 1NG2A 2FG0A 2HCKA 1WXTA 4ORZA 2LCSA 2DRKA 1AWXA 1ABQA 1BU1A 2KR3A 2KT8A 1HSQA 1KSWA 1A0NB 1X27A 1AOJA 2KNBB 2JW4A 1FYNA 1WLPB 2JS0A 2DE0X 1UHFA 2M0YA 1TG0A 1X69A 1AWWA 1QCFA 1UUEA 3VRYA 4LE9A 4OMPA 4J9BA 2YT6A 1PHTA 4AG2C 4M4ZA 2ROTA 5GJVB 2LJ3A 1PWTA 4D8KA 2OJ2A 1CKBA 1GL5A 1SHGA 2DL7A 1QKWA 2F2WA 4HCKA 1H8KA 1WX6A 3VS7A 2EYZA 1W6XA 2J06A 2RQRA 1KFZA 1T0HA 4RTTA 5IXBA 5IXFA 1K9AA 1T3SA 1MV3A 3UF4A 1QWFA 2J7IA 2FO0A 3CQTA 1MV0B 4J9FA 2KBTA 1M3CA 4EIKA 1E6GA 4F17A 1T0JA 2H8HA 1VYVA 1PKSA 2GTOA 2V1RA 4J9IA 2CREA 4LUDA 2L2PA 2PTKA 1ZUUA 2CSQA 2GQIA 3UA6A 4X1VA 1E6HA 3EG0A 1UJ0A 1AWJA 1ARKA 5HCKA 2YUOA 4DEXA 2NWMA 4QT7A 2YUNA 2OI3A 1GBQA 2K2MA 1YN8A 2K9GA 4JJDA 4CC3A 3THKA 3VS4A 4AFUC 1H3HA 4RUGA 1K0SA 2ABLA 1WA7A 4OMLA 1GRIA 2A36A 1SRMA 2RN8A 3NGPA 4RTUA 3FJ5A 2C0TA 4JJCA 2LQNA 3IQLA 1NM7A 1GBRA 1Y57A 1TUCA 1ZBJA 2I0NA 2JM9A 1IO6A 5FWCA 1Z9QA 2A37A 2JMCA 1WDXA 2ECZA 2K79A 3M0PA 2LX7A 1OPKA 1I1JA 4HVUA 2JS2A 2RQVA 2NUZA 2VWFA 2D1XA 2DF6A 2RPNA 2LMJA 2GBQA 1JO8A 1MUZA 1YCSB 2A08A 1OEBA 2KXDA 1G2BA 1GCQA 2DLPA 2MIOA 2E5KA 3M0TA 3H0HA 2KYMA 1Z9ZA 3NPFA 1BBZA 5IHIA 1B07A 2MCNA 1YP5A 2K3BA 3RBBB 1T3LA 1QKXA 4JZ4A 2C0OA 3EHRA 3ZL7C 2L3QA 4J9GA 3VS1A 1U5SA 2EYXA 3U23A 4J9DA 4IIOA 5GJWB 2O2OA 1E7OA 4D8DA 1VA7A 2KEAA 1AZGB 1X2KA 1X2QA 5EC7A 2D8JA 4HXJA 1WIEA 1UTIA 1QLYA 2VKNA 2KYBA 3EHQA 4F14A 2KT1A 5ECAA 4CC7A 1RUWA 2J6OA 4ZNXA 1ZUKA 2KROA 2O88A 4R0KA 2KRNA 2L3SA 4OMOA 4WCIA 1I07A 1RI9A 3JV3A 3VS2A 2LJ0A 1X6BA 2JXBA 4GBQA 1WFWA 3M0SA 2X3WD 2EGCA 2AZSA 4LNPA 1OV3A 2FRWA 2FRYA 1G83A 2L3PA 1HD3A 2OAWA 4JPBW 1PRMC 1W70A 1GCQC 2W10A 2K7AA 2D8HA 1LCKA 3I9QA 3RNJA 4F16A 2K6DA 1YWPA 1UECA 1UJYA 3VS5A 2GNCA 2J6FA 3SHWA 1M3AA 2CH4W 1JQQA 2BZXA 2HBWA 1NYGA 2KGTA 1NEGA 2V1QA 3R6NA 4Z89A 1K0XA 2JTEA 2RQTA 2EPDA 2KXCA 2KRMA 3SEMA 2RQWA 2VVKA 2A28A 2KRSA 1ZLMA 1S1NA 2JM8A 2XMFA 3H0FA 3PVQA 2EKHA 3EG1A 2F2VA 1JU5C 2CH4A 2YUQA 1AWOA 2DNUA 3I5SA 1OOTA 2DMOA 2LZ6B 2CDTA
chains in the Genus database with same CATH superfamily
3CCUQ 1AD5A 1K9MC 1JXMA 2EQJA 1M27C 5HK3A 1QVGA 2PVGB 1RADB 1X6OA 1U06A 2F5TX 4KGZB 3VS3A 4KRTA 3CMAT 1Y71A 2OTJT 3OMGA 1PSFA 2GFAA 3M0RA 4C92C 2P4RA 3MEUA 1UDLA 1N27A 3OYYA 4PL6A 3JCMc 5CIUA 1WXUA 4DBRA 1M8VA 4RMOA 3H6ZA 1KIKA 3EG3A 4JLGA 1CKAA 2EGAA 2ATCB 2RHYA 3CCQA 3UATA 3GNFB 2FZCB 5AT1B 4IUPA 2RB6A 3CC7T 1FMKA 5I22A 2QDYB 1GFDA 2LDMA 4PJOB 4J9EA 2DL3A 2DILA 3EG9A 2CP6A 2J05A 3KFVA 5J39A 2QASA 2CSIA 4AFZC 1KC8R 4LUEA 2A7YA 1SPKA 2IPOB 5IHKA 2NUTA 1B34B 1M30A 2BE7D 3CEYA 3I35A 3CXCA 1TS9A 3LH5A 1N8RU 1PKTA 2LP5A 5FU7C 2KDSA 2GGRA 2EW3A 3CC4T 1N6AA 4OB3B 4BDYA 5CKEA 5GMKi 3JCMV 3MO8A 2YWWA 1K73R 2DYIA 4PJMA 4FSXA 4XK8E 4C8QE 1V76A 3OMCA 3ZBDA 1C6VX 5LJ3f 4F04B 1IREB 5I11A 5A0GA 8ATCB 2FPDA 3OB9A 1DJ7B 4M7AB 4XQ3A 2O9SA 2DRMA 4LDUA 4R55A 1WHJA 2VGMA 1N5ZA 5GMKl 2GTJA 2DYBA 2YXYA 5GMKh 4M7DA 1J3TA 2IIMA 4II1A 4ME7A 2R5MA 3OYGA 1MGQA 3HHTB 3EGUA 3A5ZB 4A63B 3UA7A 3X20B 1IHVA 2CP5A 4Z02A 5IH2A 2KSSA 4FM4B 1VQ8T 3JCMd 5C6SA 1TUGB 3VKIA 4DOVA 2J6KA 5KH6A 2AKKA 2QA4A 4JRPA 4C92E 2L3RA 6AT1B 4Y91A 1HXDA 2ZPBB 1QVFA 5LJ5d 2JTFA 2FPEA 1XQHA 2L0AA 4C0DB 1UE9A 3LH0A 1VIEA 1HYOA 3JB9D 1WXTA 2FZGB 4C5IA 2DRKA 5C0MA 1LOJA 2FZKB 2K57A 4BY6B 2BUDA 3UWNA 3SWNC 3CMAQ 3SDZA 2OTJQ 3EG9B 2YLBA 1SSFA 1FYNA 3EH2A 4JLIA 1AWWA 1UUEA 2CP2A 1D1AA 2NUTB 1KHIA 3DKMA 4PJNA 2QGFB 2GCXA 3V7SA 2RHIA 2E3HA 1WHMA 4XTUA 4AG2C 2K5FA 4L59A 4PNOA 2LJ3A 3MJXA 1PWTA 5LJ3h 2RK2A 4D8KA 4AMCA 1Q82R 1QKWA 3I56T 2NUPA 3E1SA 1KC8U 2Z0WA 3QSUA 4RKUE 4EMKA 1X75C 3GOXA 2QEXT 2MWPA 4XTXA 1K9AA 2YRCA 1NZ9A 2FO0A 1M3CA 4VUBA 4M78D 4EIKA 4B9XA 3CCLA 5KYUA 3M56A 1BCOA 2E12A 2CKKA 1RAHB 3ME9A 2FHDA 2KK4A 4C8QF 2M1HA 5IT9E 1WQWA 2CSQA 3UA6A 1K73U 2RA2A 3TU4K 1UGPB 1AWJA 2RHZA 5HCKA 3CC4Q 2QXFA 5GAOm 2NWMA 4QT7A 1NJIR 5L8RE 4AT1B 2V8KA 4O5VA 3VS4A 4AFUC 4RUGA 4CI0C 2ABLA 2F69A 3S6WA 2C0TA 2DD4A 1YHQA 3CBOA 1RL2A 1AT1B 3TEEA 5CO7A 1GBRA 5LJ5j 2JM9A 3E9FA 5FWCA 3URGA 4PJOD 1GXIE 3CCJA 2JMCA 2ECZA 2K79A 1KD1R 1I1JA 4N0AC 2JN0A 3P8DA 4ATOA 3CMAA 2LMJA 2GBQA 4NL2A 3VUZA 1OEBA 4C92F 3CCQT 1ACMB 2E5KA 4XTYA 2L89A 4C8QA 2VASA 1VQ8Q 4M7AE 4E47A 3H0HA 2HMAA 1Y96A 4C0GA 1JB0E 3QO3A 4A53A 3RBBB 3M59A 1U1SA 2OTLA 3JCMP 4J6WA 5EG2A 4M7DC 2L3QA 3VS1A 2JOYA 1U5SA 1ZSZB 4J9DA 4GLKA 5GJWB 3RKWA 1QCNA 3MEVA 1K8AR 3EGXA 4QVZA 2KEAA 1X2KA 1X2QA 2ZZDA 1VQKA 3CCMA 1TU0B 2XDDA 4EMKB 5GMKe 3EHQA 2KT1A 3EFRA 5GANd 2YLCA 2KROA 3MEWA 3HPWA 3PIOA 4OMOA 3JV3A 1RI9A 2E1HA 2DAQA 1Q82U 2QQSA 4GBQA 2FL7A 4XU1A 2CGHA 4C92A 2OX7A 2RH2A 2FRYA 3OYAA 2VGNA 1G83A 2DTIA 1HD3A 2W10A 1LCKA 3EFOA 3RNJA 3I56Q 3CXCS 3OW2P 4KUIA 4F16A 4FU6A 2QEXQ 1UECA 2DETA 2GNCA 2M0OA 2J6FA 3SHWA 3T9NA 2ZCFB 2RQTA 5HY6A 2E70A 3SEMA 2KRMA 3OYDA 4KH1B 1RAIB 1NJIU 1S1NA 2JM8A 3H0FA 1EIFA 3EG1A 3LGLA 1G3YA 4XU0A 2CDTA 2QA4T 1BI0A 2X35A 4QQDA 1OI1A 3TSWA 1BCMA 5I2SA 2Y4XA 1IGQA 2O31A 5FU6B 2QDLA 1KC8C 2PNIA 4RTVA 2DXTA 3M53A 3EGDA 3M57A 5D6WA 1H92A 1ZA1B 2D0NA 4C8QB 4QQ6A 3LWIA 5DY9A 3QBYA 2BZ8A 4J9CA 5KCHA 1KD1U 2RD1A 1Y96B 3X26B 2WSFE 3PVLA 3QYGB 4J7FA 5GAN5 2EQIA 1WHKA 4TVRA 2DX1A 3I55T 3OBYA 1M8MA 1K73C 4M7AF 4M7DE 1WYXA 4RTXA 3VJPA 5HK0A 2EYQA 3JB9G 3M55A 3EGXB 2B86A 3TCJA 3CCQQ 1YJWA 2SEMA 2FPFA 3OYBA 1VYTA 2MF2A 5GANj 1YCYA 1G3TA 1KHCA 3EG2A 3CBMA 1KK7A 4OMNA 3QWYA 2DJQA 3OY9A 2EYYA 2RO0A 3FB9A 1K8AU 2HBPA 3HFNA 1NYFA 2GFUA 2P84A 1NEBA 1AHJB 1ZX6A 2RI5A 5CR2A 3CCSA 3MKDA 2PZ1A 1LNXA 2WSCE 4C92B 3HFOA 2DVJA 3CCLT 4JDSA 1TOVA 2QEXA 3NTIA 1M1KR 3A98A 3EFOB 1ABOA 1M3BA 3MCAB 1G5VA 4XTWA 4OMQA 4MZTA 5CK9A 3C4SA 3OS1A 1TUDA 1OPLA 4K11A 4ZGEB 5CQYA 3BW1A 5IHNA 4Q5WA 2EYWA 3SWNA 3HSBA 1OQKA 1OULA 1V1CA 2MMPA 2ESWA 2YSQA 1YNZA 1X01A 5GMKm 1M4ZA 2JNGA 3E19A 4Y92A 1D0ZA 1PG5B 3RMSA 2X4YA 1YHQT 1BYMA 3G4SA 2CUDA 3QKJA 4XTVA 1I81A 4WTOB 2CP0A 4M75G 5FW9A 3CCJT 1GFCA 1VQ5T 1BI3A 1PD1A 2DBKA 1QP3A 4E6RA 3JCMb 5FU7B 1RAFB 5FWBA 3LWHA 1UGVA 3EGDB 8AT1B 1K76A 1K4US 4JRKA 2JTMA 3OQ5A 4BUGA 5M9OA 1WI7A 1XOVA 3JCMW 1SEMA 3WVDB 3G6EA 1SRLA 1Q82C 1AZEA 3OYNA 3QYHB 3ZFJA 3LGFA 3CBPA 2DFUA 5GAN3 1W1FA 1EFNA 1NG2A 2DIGA 3V7CA 2QA4Q 4P5NA 4C5GA 1YIJA 4PJOG 2OTLT 2EQUA 1AWXA 3QIIA 3CMEQ 1BU1A 1VQ4A 2KT8A 1KSWA 2VV5A 2PUOB 1WHHA 1Q7YU 4IKFA 2JS0A 2LCCA 1R77A 1VQKT 1X69A 4M7DF 3CCMT 3CCEA 2CYZB 2COYA 4OMPA 4N4HA 2EJGA 2YT6A 3JSCA 2LQ8A 1YFNA 4OGCA 1VQOA 4XU2A 3OYKA 3I55Q 2DTOA 3OYMA 2OJ2A 1CKBA 2DL7A 1G3WA 4ANJA 5GAOn 4ELZC 1WX6A 1VUBA 3A8LB 4LDYA 4N0AA 1T0HA 1RAEB 5IXFA 1T3SA 3UF4A 3CPWP 4BI3A 5FROA 2V26A 1MV0B 2DKGA 4PJJA 2DXBA 4F17A 1VYVA 2EIFA 2F5KA 3CCRA 1S72A 4M75C 2GTOA 2V1RA 2K5IA 1KD1C 2E65A 2GQIA 2DEQA 4X1VA 2O4XB 1E6HA 2QYZA 2EJ9A 3CCLQ 3P8HA 4E7IA 2YUNA 1W2BP 2K2MA 3MEAA 1IXDA 3QDRB 4JJDA 1G8XA 3QUIA 2LQKA 1WJRA 4C8QD 3FC3A 1Q86U 4A4KA 3PNWC 1FWZA 1QQJA 2MAMA 4LDWA 2ZGWA 2RJDA 5KYXA 2A36A 3AHUA 1ZA2B 9ATCB 2RJCA 5GAMd 2GF7A 3OA6A 4JJCA 3IQLA 1MMDA 2LT4A 2E5QA 1W2BS 1RABB 3RMQA 5D6YA 1MHNA 1Z9QA 5KE3A 2A37A 4M77G 3M0PA 4ZN3A 1YHQQ 3QJYA 4A4EA 3CMEA 4HVUA 1WZOA 1JO8A 2DJZA 3CCJQ 2CZ7B 1G2BA 2DLPA 1VQ5Q 3M0TA 1WJSA 2KYMA 3JRZA 5J3BA 1YJWT 2R58A 3BDUA 3I55A 2NYSA 5CCAA 2K3YA 4C92D 1OYXA 4MDWA 5HKCA 2DEUA 4D6WA 2QQBA 3ZL7C 4ZGJB 1TTHB 4J9GA 3U23A 3JB9I 3MP6A 4IIOA 3L42A 4OMFB 2OTLQ 3OS2A 4HXJA 1WIEA 3CCST 2BE9B 1FMVA 3JAME 3KUFA 2KYBA 4E7HA 2LC4A 2MPXC 4F14A 3S3NA 1M90R 2X9HA 4CC7A 2L5QA 1KQSP 3LYIA 1ZUKA 4E7LA 1VQKQ 4R0KA 3CCMQ 1IRXA 3META 4J7IA 2LJ0A 2COWA 3L2RA 4LD6A 3UT1A 1WFWA 2AIRB 1IB8A 4IUTA 2EGCA 2FRWA 2L3PA 1KQ2A 2K2VA 1PRMC 1W70A 2RI2A 1RAAB 1M2OA 1VQMT 1WGSA 1YJNA 3E9GA 1MMAA 2K6DA 4J8OA 1EZZB 3UPUA 3P8BB 4M7DB 1VOMA 1WPYA 3N5BB 3G4ST 4M77C 4BACA 2DZ9A 4DBFA 1JQQA 1UGSB 3CPFA 2BZXA 2HBWA 3HKSA 1Q7YC 1NEGA 2V1QA 3R6NA 5GAMj 4LDXA 2K4YA 4XAXB 5KYXB 4B6MA 2H3JA 2A28A 2DVEA 3G1JA 2JJ9A 4B9WA 2E6NA 3PVQA 3KBGA 3HRTA 1TH7A 2F2VA 1JU5C 5CKBA 5KYWA 3G71A 3I5SA 3BE3A 3FDRA 3KXTA 2LZ6B 3M4YA 2MK5A 1NLOC 4Z88A 1VQ5A 4CC4B 5KE2A 1N8RC 3G6ET 3VRZA 1UGQB 3MP1A 2YUPA 3RIRA 3QXEB 2C0IA 2HSEB 1YBYA 2RNAA 2AT1B 1YIJT 1BK2A 1SHFA 5FRNA 1MMNA 1IHWA 1VQ4T 2M16A 4Y28E 2JMAA 1RI0A 2CZ0B 3JCMf 3QWXX 1U8RA 2CT4A 4YTLA 1BI2A 3CCET 3CCVA 4HT9A 3VYHB 2ZPEB 4IUVA 1YI2A 3INZA 1R8OB 1Q95G 5LJ5f 3H0IA 3MHXA 1VQOT 1VQ6A 4O6JA 2JUFA 4MZMA 2DL8A 1WXBA 3GPLA 2LQWA 3EAEA 2LJ1A 2NUPB 1Q86C 4DEYA 2RJEA 4HVVA 4M7AD 1VQ7Q 1YJWQ 3QG1A 1PCXA 1D3BA 5CQXA 3H41A 1OZ2A 1RLPC 2JT4A 3TVTA 1F1BB 2H3EB 1AVZC 5KYUB 4ESRA 2I2LA 2SRCA 4DOWA 2CUBA 1NLPC 1NPPA 1PNJA 4FW1A 3CCRT 1S72T 3M9QA 5L23A 1M90U 4GLMA 2XHCA 2DXUA 4E7KA 3JB9H 2ED0A 2QQRA 3CCSQ 5GAOq 2HAXA 2QQ9A 1BB9A 2HSPA 3BDLA 3E2UA 4OP0A 3REBB 3UDCA 2DD5A 1KJWA 2EBPA 4FYYB 4M75F 3JCMJ 1YJ9A 3TSZA 1UB4A 4PLLA 5IN1A 5GAOp 1YITA 4HVWA 4M77E 3A1PA 4ZGDB 3OYFA 1W2BA 1FXXA 2DERA 5D7UA 4IIMA 3BFMA 4JS5A 1I0CA 1QWEA 1X43A 3ZEHA 1BIBA 2P0PA 3FJPA 2KE9A 2W0ZA 3OW2S 1OX8A 3X24B 2D9TA 1VQMQ 1QP2A 2HQXA 3HL8A 2ZAEA 4OB0B 3L2VA 3S3OA 2HL5C 3CD6A 4AFQC 3QHSA 2EKOA 2BZYA 2Y4YA 1M2VA 1M9SA 2DL4A 3G4SQ 3EFSA 2K5LA 3CMET 2R5AA 3V7RA 2LVMA 2M51A 2EVRA 2VC8A 2ENMA 2P4TA 4BE1A 3PTAA 5GAOr 5CAIA 2DA9A 2L8DA 2YDLA 1G3SA 1UG1A 1KQ1A 2HCKA 3QJ6A 4M75A 3RUXA 4ORZA 2LCSA 4LDVA 3PIPA 1LPLA 3VV0A 3G6EQ 1ZQ1A 4DBQA 2KR3A 1HSQA 1X27A 2E6ZA 2KNBB 4L5GA 2PU9B 2JW4A 1VQ7A 1YIJQ 3QPHA 4JRQA 1VQLA 1UHFA 2M0YA 3PFSA 4PKCC 1VQ4Q 3JCMQ 1VQPA 4QKUA 2IG0A 2ZPIB 1VQNA 1D3BB 1UEBA 4R56A 4PJOA 2O01E 4M4ZA 2ROTA 2LT1A 1OU8A 2DZCA 3CCEQ 5LJ3d 2X4XA 2YRDA 1GL5A 4A4GA 3OS5A 4F7UG 2VXFA 2F2WA 2A0FB 4M7DD 4HCKA 4MMKA 2XDBA 1H8KA 1VQOQ 1W6XA 1PD0A 2HD0A 2RHUA 1OU9A 2J06A 1B34A 2VB6A 3WXMB 2RQRA 1KFZA 5IXBA 1KG1A 3RDVA 4KUDK 1QWFA 1YJNT 3CQTA 4JS4A 4J9FA 2KBTA 4PFOA 2PUKB 1JRIA 3HTRA 5DLOA 1E6GA 2KQWA 2H8HA 1PKSA 2M02A 3O8VA 4J9IA 5GANf 2L2PA 3C12A 1VQMA 3M58A 4M78G 3EG0A 5GMKj 1WNLA 3CCRQ 1S72Q 3TQ7P 4ZTFA 4IUUA 4DEXA 4M77F 2OI3A 1GBQA 2RJFA 2BKDN 3G71T 2COZA 1LJOA 5GAMg 3JCMg 3THKA 1M2VB 4HCBA 4PLIA 1C1AA 1WA7A 3HRSA 3OSVA 1VQ9T 1JBMA 4IURA 2VUBA 1GRIA 4RTUA 5A2QE 2VYTA 3G7ZA 5LJ5g 4ELYC 5LL6S 2X4WA 1TSFA 1Y57A 1ZBJA 2I0NA 3H8ZA 4WF2A 4EMGA 1IO6A 2YHTA 2EWNA 1WDXA 3OSSC 5IAYA 4JUVA 2V8IA 1QCOA 2WACA 3F70A 4OVAA 2RQVA 4KT0E 3DB4A 4M75B 2DF6A 2RPNA 1M90C 4FIBA 4V2SA 1YCSB 1BI1A 1MUZA 4JJNK 1M5Q1 4NL3A 3CCVT 4PJLA 4QW2A 2GQVA 4L6V5 2FB7A 1YI2T 3PT9A 4X34A 1R0BG 1Z9ZA 1BBZA 5IHIA 2MCNA 1YP5A 2K3BA 1VQ6T 1ZHIA 2LX9A 1T3LA 1NBEB 4M77A 4JZ4A 3A8OB 3OS0A 1Q81R 4FT2A 2E3IA 1D1CA 3OYEA 3R6OA 3EHRA 7AT1B 2EJFA 5GAN4 3VYGA 2LRQA 5LJ3j 3X28B 1RAGB 2O2OA 1E7OA 4FYWB 1NJIC 5DM7R 4J6XA 1BIAA 3EH1A 1N9RA 2QI2A 1UTIA 4RCCA 5KCOA 2VKNA 4M78C 3GIBA 1B7TA 2HQHA 1RUWA 5ECAA 2J6OA 5GANh 4ZNXA 2B8AA 4DBHA 4X9CA 4J5YA 1Y07A 4KGVB 2KRNA 4DQ2A 4WCIA 3J80E 4M7AG 2JXBA 1WHGA 3V8KA 3OW2A 3C95A 2QK0A 2X3WD 5GAMe 1YJ9T 3SWNB 3JCMe 1YITT 2C06A 2AZSA 2HZYA 1OV3A 2OAWA 4JPBW 1MNEA 4LXCA 1M1KU 1GCQC 2P0KA 3OYIA 4DA4A 4E7JA 1O75A 2QAZA 5LJ5e 3CPWS 3ER0A 2KMTA 4J83A 5CKFA 1UJYA 3VS5A 3DB3A 2PVDB 2DK3A 5CKHA 2QTVA 1M3AA 2CH4W 2YRVA 1YJNQ 3CD6T 1NYGA 2KGTA 2EQKA 1K0XA 3FEOA 2JTEA 2KXCA 4PJOC 1I5OB 2M9UA 2XDPA 3CCUA 2XKOC 1FX7A 2XMFA 2EKHA 5KYYA 2VXEA 3FRNA 3L2ZA 2CH4A 2YUQA 4E2FB 1H3ZA 1K8AC 1OOTA 2DMOA 4C0FA 3VUBA 2IVWA 2DXCA 2CZ1B 3JB9J 4E7ZA 1ZSGA 3REAB 2XU8A 4RTWA 3G71Q 2AKLA 2HDAA 4RG2A 4BD3A 5GAN2 2DBMA 3AT1B 3C0CA 1VQ9Q 2O9VA 2DM1A 1JEGA 3VS6A 3OYLA 4OB1B 1RLQC 2R57A 2RMOA 2MWOA 1H641 2LNHB 1SG5A 1IZ6A 4F7UE 4J9HA 1SSHA 4JJBA 1VQ7T 3PMIA 3RESA 4LN2A 4M77B 1VQLT 1JXOA 4J6YA 1Y0MA 4OMMA 3NTHA 2DTHA 1VQPT 2DIQA 1JJ2P 3FLGA 3GP8A 1VQNT 3CC2T 2MYSA 4M7AC 2CT3A 4RTZA 3OYCA 2AZVA 1GCPA 2EGEA 4QVDA 1PRLC 1K1ZA 1ZUYA 1TWBA 1VYUA 3HRUA 3CCVQ 4FSSA 5GANg 1QW1A 1K9MR 3RERA 4NOYA 3VS0A 1YI2Q 5GAN7 1I4K1 1Q81U 5D6XA 4M78E 4IUQA 1XJWB 1VQ6Q 4NS5A 1ZSZA 1SF9A 1JJ2S 4AFSC 3OYHA 4HT8A 2RF0A 2HKNA 4FL6A 2D6FA 4AG1C 3CC7Q 1Y7XA 3A8GB 3GBQA 2QG9B 4UC4A 4C5HA 1XTDA 4RTYA 2LTOA 2ZPHB 4M75E 4KGXB 4C0ZA 4FT4A 3PE0A 3NHNA 4BI4A 2P0QA 1SKUB 4M7DG 2A3LA 5J26A 4EDUA 3NFCA 1YWOA 4JRIA 1KQSS 5A0DA 2RK1A 2ED1A 1WJQA 2FVUA 3HP9A 4C0DC 3O5ZA 3L2UA 4FCYA 4CC2A 2MOXA 1NE8A 2KY9A 3M0QA 1U3OA 2BTTA 4BY6C 4BE2A 2RI3A 5GAN8 1YJ9Q 2E41A 1BKBA 1YITQ 4PJOE 4KBMB 1X6GA 2X51A 1LVKA 4M75D 2ROLA 5KYYB 4HKEA 1HJDA 1CSKA 2E64A 1WHLA 3I5RA 3OBWA 1FMWA 1UHCA 2QQAA 4HCZA 3RKXA 1ZBXA 5FLXE 3J81E 2F2XA 2XICA 2XG8D 3LX7A 1VQ9A 2FEIA 2HEQA 4CRIA 2RM4A 1UFFA 1AEYA 2DL5A 2KVQG 2RQUA 2KI7A 3M0UA 3CD6Q 3JB9F 2G6FX 2CP3A 4JZ3A 2FYKA 2X3XD 1TXQA 3ULRB 2AK5A 2XD0A 1QVGP 1D09B 4Z8AA 2DO3A 4A54A 5GANe 5A0LA 4QQGA 3NMZC 3L2QA 5GAMf 4MZPA 1B3QA 2FG0A 3L2WA 2E4HA 2E10A 2OTJA 1M1KC 1I8FA 2HKQB 1P92A 1RACB 1ABQA 1MNDA 3DLMA 4PFPA 4F7UF 1NPRA 3S3MA 1A0NB 3QZ5B 1D0YA 3LLRA 1AOJA 4FW2A 1QVGS 1O9SA 2V8JA 4BE0A 1WLPB 4N4GA 2BIVA 2DE0X 1TG0A 3GF5A 1QCFA 3VRYA 4LE9A 4J9BA 5LJ3g 3CC7A 5I2MA 5AYFA 4OGEA 1PHTA 1D0XA 1VQLQ 3QDFA 4PK4A 5GJVB 2EFIA 1VQPQ 4KULA 3RR6A 1SHGA 3JCMX 1K9MU 4M78F 3CPWA 3CC2Q 1MMGA 1VQNQ 2AHJB 1M1FA 4ZN1A 2K3XA 3VS7A 2EYZA 5FRMA 2LCLA 3CXCP 3M5AA 3VU3C 4EPCA 1PC0A 4RTTA 1MV3A 2J7IA 3MPUB 5KYNA 4HCCA 1EX4A 1T0JA 3CC4A 4N4IA 2CREA 4LUDA 2XIDA 4F7UA 2PTKA 1ZUUA 4XU3A 1PSEA 3SD4A 3OYJA 1UJ0A 4RCBA 1ARKA 2XI9A 3PGGA 2YUOA 4X9DA 3CCUT 1QVPA 5GAOl 3J7AF 5KYWB 1YN8A 2RHXA 2K9GA 4QVCA 4CC3A 4E7SA 4BB7A 2XK0A 2EQMA 1H3HA 4PJOF 1K0SA 2ZPGB 4HA8A 1ZSZC 5GAN6 3Q1JA 1C0MA 4LD9K 1W4SA 4OMLA 1Q81C 1SRMA 2RN8A 3NGPA 2HQEA 3FJ5A 5GAMh 4M77D 3JCMh 4C8QG 4M78A 2KAFA 5CKDA 1IGUA 2LQNA 1UGRB 1NM7A 4BDZA 3BY7A 1TUCA 3V8LA 2NLUA 2LNVA 3SB2A 4EMKC 3X25B 2JZ2A 5LJ5h 2LX7A 4FYVB 1OPKA 2HL3A 2JS2A 1VQ8A 3QZ9B 2NUZA 2VWFA 4RG8A 2D1XA 4KH0B 2HNIA 5LJ3e 2PVOB 2A08A 2KXDA 3M54A 1QVFP 1GCQA 1OZ3A 1R0CB 2G3RA 2MIOA 2D0QB 1VIFA 4C5EA 5I21A 3NPFA 2Y90A 1B07A 1JJ2A 1Q7YR 2X4JA 4BI8B 1QKXA 2C0OA 3LW5E 1N9SA 5DLQE 4GY5A 2CZ6B 5CVIA 4ZTJA 3GLXA 2EYXA 3CC2A 2CS7A 1QVFS 2QGGA 4D8DA 2WSEE 4C92G 4A4HA 1VA7A 1AZGB 2F1LA 1KQSA 5EC7A 3V8JA 2D8JA 3A8HB 1N8RR 3M4GA 3PMTA 1QLYA 4PFZA 2JVVA 3C94A 1U1TA 2MI6A 3ASKA 4XTZA 2O88A 2L3SA 3D7SB 3L1AA 1QMCA 1I07A 4OB2B 3VS2A 1M1GA 1OX9A 1X6BA 3WVEB 4MMLA 3RKYA 3I56A 5FU6C 1V29B 3M0SA 3A8MB 3DLLA 2OAUA 4LNPA 4OF1A 4F7UB 2DPPB 2K7AA 2D8HA 3I9QA 4C8QC 3H9NA 4MDXA 2EAYA 1YWPA 4FYXB 4A4FA 1PM3A 2PQWA 4M7AA 3FIFA 4EMHA 1XNIA 1Q86R 3GNGA 1I5LA 3SFMA 4Z89A 1D1BA 2O4XA 2EPDA 2RQWA 2VVKA 2KRSA 1ZLMA 1HK9A 2CP7A 4M78B 2ZPFB 2QTXA 3NTKA 1WQ7A 1AWOA 2DNUA 3MP8A 3TREA
chains in the Genus database with same CATH topology
1NLOC 4Z88A 1ZSGA 1AD5A 3REAB 1JXMA 3TSWA 4CC4B 4RTWA 3VRZA 1M27C 2O31A 2YUPA 2QDLA 2PNIA 2AKLA 2HDAA 1U06A 4RTVA 2DBMA 3VS3A 2C0IA 4KRTA 3C0CA 1H92A 2RNAA 1BK2A 1SHFA 2O9VA 2DM1A 2D0NA 1JEGA 3M0RA 3VS6A 2P4RA 1RLQC 1UDLA 2BZ8A 4J9CA 2RMOA 2LNHB 2JMAA 1WXUA 4J9HA 1SSHA 3PVLA 4JJBA 2EQIA 4LN2A 1KIKA 3EG3A 1CKAA 1JXOA 3QWXX 2EGAA 2DX1A 1M8MA 2CT4A 1Y0MA 4OMMA 3UATA 1WYXA 4RTXA 1FMKA 5I22A 1GFDA 2CT3A 4J9EA 3H0IA 2B86A 4RTZA 2AZVA 1GCPA 2EGEA 1PRLC 1K1ZA 2DL3A 2DILA 1ZUYA 2J05A 1VYUA 2DL8A 1WXBA 3KFVA 2LQWA 2SEMA 2FPFA 4FSSA 2LJ1A 3VS0A 1VYTA 4DEYA 2CSIA 4HVVA 3EG2A 4AFZC 4LUEA 1SPKA 5IHKA 1M30A 4OMNA 3QWYA 2DJQA 3H41A 2EYYA 1RLPC 4AFSC 1NYFA 2JT4A 3I35A 3TVTA 2RF0A 1NEBA 1ZX6A 4AG1C 3LH5A 1PKTA 1AVZC 4ESRA 3GBQA 2PZ1A 2LP5A 2SRCA 2DVJA 2CUBA 4RTYA 1NLPC 1PNJA 2GGRA 2EW3A 5L23A 4GLMA 3PE0A 3A98A 1ABOA 1M3BA 3NHNA 2ED0A 1YWOA 1BB9A 2HSPA 4OMQA 3REBB 2ED1A 1KJWA 2EBPA 1TUDA 1OPLA 5I11A 4K11A 5IHNA 3TSZA 2FPDA 2EYWA 3O5ZA 4HVWA 4CC2A 1V1CA 2MOXA 2O9SA 2DRMA 3M0QA 1U3OA 2ESWA 2YSQA 1YNZA 4IIMA 2BTTA 1N5ZA 1I0CA 1QWEA 1X43A 4Y92A 2KE9A 2GTJA 2W0ZA 1X6GA 2DYBA 2ROLA 1HJDA 1J3TA 2IIMA 1CSKA 3I5RA 2CUDA 1UHCA 4AFQC 3EGUA 4A63B 3UA7A 2BZYA 2F2XA 5FW9A 2DL4A 1GFCA 2FEIA 2HEQA 5IH2A 1UFFA 2DBKA 4E6RA 1AEYA 2DL5A 5FWBA 2RQUA 3M0UA 1UGVA 2G6FX 1K76A 2M51A 4JZ3A 2EVRA 1K4US 2ENMA 2J6KA 2X3XD 2AKKA 3ULRB 2AK5A 1WI7A 1XOVA 1SEMA 4Z8AA 2DA9A 1SRLA 1AZEA 2FPEA 2YDLA 2L0AA 3NMZC 1W1FA 1EFNA 1UE9A 1UG1A 1B3QA 1NG2A 2FG0A 2HCKA 1WXTA 4ORZA 2LCSA 2DRKA 1AWXA 1ABQA 1BU1A 2KR3A 2KT8A 1HSQA 1KSWA 1A0NB 1X27A 1AOJA 2KNBB 2JW4A 1FYNA 1WLPB 2JS0A 2DE0X 1UHFA 2M0YA 1TG0A 1X69A 1AWWA 1QCFA 1UUEA 3VRYA 4LE9A 4OMPA 4J9BA 2YT6A 1PHTA 4AG2C 4M4ZA 2ROTA 5GJVB 2LJ3A 1PWTA 4D8KA 2OJ2A 1CKBA 1GL5A 1SHGA 2DL7A 1QKWA 2F2WA 4HCKA 1H8KA 1WX6A 3VS7A 2EYZA 1W6XA 2J06A 2RQRA 1KFZA 1T0HA 4RTTA 5IXBA 5IXFA 1K9AA 1T3SA 1MV3A 3UF4A 1QWFA 2J7IA 2FO0A 3CQTA 1MV0B 4J9FA 2KBTA 1M3CA 4EIKA 1E6GA 4F17A 1T0JA 2H8HA 1VYVA 1PKSA 2GTOA 2V1RA 4J9IA 2CREA 4LUDA 2L2PA 2PTKA 1ZUUA 2CSQA 2GQIA 3UA6A 4X1VA 1E6HA 3EG0A 1UJ0A 1AWJA 1ARKA 5HCKA 2YUOA 4DEXA 2NWMA 4QT7A 2YUNA 2OI3A 1GBQA 2K2MA 1YN8A 2K9GA 4JJDA 4CC3A 3THKA 3VS4A 4AFUC 1H3HA 4RUGA 1K0SA 2ABLA 1WA7A 4OMLA 1GRIA 2A36A 1SRMA 2RN8A 3NGPA 4RTUA 3FJ5A 2C0TA 4JJCA 2LQNA 3IQLA 1NM7A 1GBRA 1Y57A 1TUCA 1ZBJA 2I0NA 2JM9A 1IO6A 5FWCA 1Z9QA 2A37A 2JMCA 1WDXA 2ECZA 2K79A 3M0PA 2LX7A 1OPKA 1I1JA 4HVUA 2JS2A 2RQVA 2NUZA 2VWFA 2D1XA 2DF6A 2RPNA 2LMJA 2GBQA 1JO8A 1MUZA 1YCSB 2A08A 1OEBA 2KXDA 1G2BA 1GCQA 2DLPA 2MIOA 2E5KA 3M0TA 3H0HA 2KYMA 1Z9ZA 3NPFA 1BBZA 5IHIA 1B07A 2MCNA 1YP5A 2K3BA 3RBBB 1T3LA 1QKXA 4JZ4A 2C0OA 3EHRA 3ZL7C 2L3QA 4J9GA 3VS1A 1U5SA 2EYXA 3U23A 4J9DA 4IIOA 5GJWB 2O2OA 1E7OA 4D8DA 1VA7A 2KEAA 1AZGB 1X2KA 1X2QA 5EC7A 2D8JA 4HXJA 1WIEA 1UTIA 1QLYA 2VKNA 2KYBA 3EHQA 4F14A 2KT1A 5ECAA 4CC7A 1RUWA 2J6OA 4ZNXA 1ZUKA 2KROA 2O88A 4R0KA 2KRNA 2L3SA 4OMOA 4WCIA 1I07A 1RI9A 3JV3A 3VS2A 2LJ0A 1X6BA 2JXBA 4GBQA 1WFWA 3M0SA 2X3WD 2EGCA 2AZSA 4LNPA 1OV3A 2FRWA 2FRYA 1G83A 2L3PA 1HD3A 2OAWA 4JPBW 1PRMC 1W70A 1GCQC 2W10A 2K7AA 2D8HA 1LCKA 3I9QA 3RNJA 4F16A 2K6DA 1YWPA 1UECA 1UJYA 3VS5A 2GNCA 2J6FA 3SHWA 1M3AA 2CH4W 1JQQA 2BZXA 2HBWA 1NYGA 2KGTA 1NEGA 2V1QA 3R6NA 4Z89A 1K0XA 2JTEA 2RQTA 2EPDA 2KXCA 2KRMA 3SEMA 2RQWA 2VVKA 2A28A 2KRSA 1ZLMA 1S1NA 2JM8A 2XMFA 3H0FA 3PVQA 2EKHA 3EG1A 2F2VA 1JU5C 2CH4A 2YUQA 1AWOA 2DNUA 3I5SA 1OOTA 2DMOA 2LZ6B 2CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLO C;  4Z88 A;  1ZSG A;  1AD5 A;  3REA B;  1JXM A;  3TSW A;  4CC4 B;  4RTW A;  3VRZ A;  1M27 C;  2O31 A;  2YUP A;  2QDL A;  2PNI A;  2AKL A;  2HDA A;  1U06 A;  4RTV A;  2DBM A;  3VS3 A;  2C0I A;  4KRT A;  3C0C A;  1H92 A;  2RNA A;  1BK2 A;  1SHF A;  2O9V A;  2DM1 A;  2D0N A;  1JEG A;  3M0R A;  3VS6 A;  2P4R A;  1RLQ C;  1UDL A;  2BZ8 A;  4J9C A;  2RMO A;  2LNH B;  2JMA A;  1WXU A;  4J9H A;  1SSH A;  3PVL A;  4JJB A;  2EQI A;  4LN2 A;  1KIK A;  3EG3 A;  1CKA A;  1JXO A;  3QWX X;  2EGA A;  2DX1 A;  1M8M A;  2CT4 A;  1Y0M A;  4OMM A;  3UAT A;  1WYX A;  4RTX A;  1FMK A;  5I22 A;  1GFD A;  2CT3 A;  4J9E A;  3H0I A;  2B86 A;  4RTZ A;  2AZV A;  1GCP A;  2EGE A;  1PRL C;  1K1Z A;  2DL3 A;  2DIL A;  1ZUY A;  2J05 A;  1VYU A;  2DL8 A;  1WXB A;  3KFV A;  2LQW A;  2SEM A;  2FPF A;  4FSS A;  2LJ1 A;  3VS0 A;  1VYT A;  4DEY A;  2CSI A;  4HVV A;  3EG2 A;  4AFZ C;  4LUE A;  1SPK A;  5IHK A;  1M30 A;  4OMN A;  3QWY A;  2DJQ A;  3H41 A;  2EYY A;  1RLP C;  4AFS C;  1NYF A;  2JT4 A;  3I35 A;  3TVT A;  2RF0 A;  1NEB A;  1ZX6 A;  4AG1 C;  3LH5 A;  1PKT A;  1AVZ C;  4ESR A;  3GBQ A;  2PZ1 A;  2LP5 A;  2SRC A;  2DVJ A;  2CUB A;  4RTY A;  1NLP C;  1PNJ A;  2GGR A;  2EW3 A;  5L23 A;  4GLM A;  3PE0 A;  3A98 A;  1ABO A;  1M3B A;  3NHN A;  2ED0 A;  1YWO A;  1BB9 A;  2HSP A;  4OMQ A;  3REB B;  2ED1 A;  1KJW A;  2EBP A;  1TUD A;  1OPL A;  5I11 A;  4K11 A;  5IHN A;  3TSZ A;  2FPD A;  2EYW A;  3O5Z A;  4HVW A;  4CC2 A;  1V1C A;  2MOX A;  2O9S A;  2DRM A;  3M0Q A;  1U3O A;  2ESW A;  2YSQ A;  1YNZ A;  4IIM A;  2BTT A;  1N5Z A;  1I0C A;  1QWE A;  1X43 A;  4Y92 A;  2KE9 A;  2GTJ A;  2W0Z A;  1X6G A;  2DYB A;  2ROL A;  1HJD A;  1J3T A;  2IIM A;  1CSK A;  3I5R A;  2CUD A;  1UHC A;  4AFQ C;  3EGU A;  4A63 B;  3UA7 A;  2BZY A;  2F2X A;  5FW9 A;  2DL4 A;  1GFC A;  2FEI A;  2HEQ A;  5IH2 A;  1UFF A;  2DBK A;  4E6R A;  1AEY A;  2DL5 A;  5FWB A;  2RQU A;  3M0U A;  1UGV A;  2G6F X;  1K76 A;  2M51 A;  4JZ3 A;  2EVR A;  1K4U S;  2ENM A;  2J6K A;  2X3X D;  2AKK A;  3ULR B;  2AK5 A;  1WI7 A;  1XOV A;  1SEM A;  4Z8A A;  2DA9 A;  1SRL A;  1AZE A;  2FPE A;  2YDL A;  2L0A A;  3NMZ C;  1W1F A;  1EFN A;  1UE9 A;  1UG1 A;  1B3Q A;  1NG2 A;  2FG0 A;  2HCK A;  1WXT A;  4ORZ A;  2LCS A;  2DRK A;  1AWX A;  1ABQ A;  1BU1 A;  2KR3 A;  2KT8 A;  1HSQ A;  1KSW A;  1A0N B;  1X27 A;  1AOJ A;  2KNB B;  2JW4 A;  1FYN A;  1WLP B;  2JS0 A;  2DE0 X;  1UHF A;  2M0Y A;  1TG0 A;  1X69 A;  1AWW A;  1QCF A;  1UUE A;  3VRY A;  4LE9 A;  4OMP A;  4J9B A;  2YT6 A;  1PHT A;  4AG2 C;  4M4Z A;  2ROT A;  5GJV B;  2LJ3 A;  1PWT A;  4D8K A;  2OJ2 A;  1CKB A;  1GL5 A;  1SHG A;  2DL7 A;  1QKW A;  2F2W A;  4HCK A;  1H8K A;  1WX6 A;  3VS7 A;  2EYZ A;  1W6X A;  2J06 A;  2RQR A;  1KFZ A;  1T0H A;  4RTT A;  5IXB A;  5IXF A;  1K9A A;  1T3S A;  1MV3 A;  3UF4 A;  1QWF A;  2J7I A;  2FO0 A;  3CQT A;  1MV0 B;  4J9F A;  2KBT A;  1M3C A;  4EIK A;  1E6G A;  4F17 A;  1T0J A;  2H8H A;  1VYV A;  1PKS A;  2GTO A;  2V1R A;  4J9I A;  2CRE A;  4LUD A;  2L2P A;  2PTK A;  1ZUU A;  2CSQ A;  2GQI A;  3UA6 A;  4X1V A;  1E6H A;  3EG0 A;  1UJ0 A;  1AWJ A;  1ARK A;  5HCK A;  2YUO A;  4DEX A;  2NWM A;  4QT7 A;  2YUN A;  2OI3 A;  1GBQ A;  2K2M A;  1YN8 A;  2K9G A;  4JJD A;  4CC3 A;  3THK A;  3VS4 A;  4AFU C;  1H3H A;  4RUG A;  1K0S A;  2ABL A;  1WA7 A;  4OML A;  1GRI A;  2A36 A;  1SRM A;  2RN8 A;  3NGP A;  4RTU A;  3FJ5 A;  2C0T A;  4JJC A;  2LQN A;  3IQL A;  1NM7 A;  1GBR A;  1Y57 A;  1TUC A;  1ZBJ A;  2I0N A;  2JM9 A;  1IO6 A;  5FWC A;  1Z9Q A;  2A37 A;  2JMC A;  1WDX A;  2ECZ A;  2K79 A;  3M0P A;  2LX7 A;  1OPK A;  1I1J A;  4HVU A;  2JS2 A;  2RQV A;  2NUZ A;  2VWF A;  2D1X A;  2DF6 A;  2RPN A;  2LMJ A;  2GBQ A;  1JO8 A;  1MUZ A;  1YCS B;  2A08 A;  1OEB A;  2KXD A;  1G2B A;  1GCQ A;  2DLP A;  2MIO A;  2E5K A;  3M0T A;  3H0H A;  2KYM A;  1Z9Z A;  3NPF A;  1BBZ A;  5IHI A;  1B07 A;  2MCN A;  1YP5 A;  2K3B A;  3RBB B;  1T3L A;  1QKX A;  4JZ4 A;  2C0O A;  3EHR A;  3ZL7 C;  2L3Q A;  4J9G A;  3VS1 A;  1U5S A;  2EYX A;  3U23 A;  4J9D A;  4IIO A;  5GJW B;  2O2O A;  1E7O A;  4D8D A;  1VA7 A;  2KEA A;  1AZG B;  1X2K A;  1X2Q A;  5EC7 A;  2D8J A;  4HXJ A;  1WIE A;  1UTI A;  1QLY A;  2VKN A;  2KYB A;  3EHQ A;  4F14 A;  2KT1 A;  5ECA A;  4CC7 A;  1RUW A;  2J6O A;  4ZNX A;  1ZUK A;  2KRO A;  2O88 A;  4R0K A;  2KRN A;  2L3S A;  4OMO A;  4WCI A;  1I07 A;  1RI9 A;  3JV3 A;  3VS2 A;  2LJ0 A;  1X6B A;  2JXB A;  4GBQ A;  1WFW A;  3M0S A;  2X3W D;  2EGC A;  2AZS A;  4LNP A;  1OV3 A;  2FRW A;  2FRY A;  1G83 A;  2L3P A;  1HD3 A;  2OAW A;  4JPB W;  1PRM C;  1W70 A;  1GCQ C;  2W10 A;  2K7A A;  2D8H A;  1LCK A;  3I9Q A;  3RNJ A;  4F16 A;  2K6D A;  1YWP A;  1UEC A;  1UJY A;  3VS5 A;  2GNC A;  2J6F A;  3SHW A;  1M3A A;  2CH4 W;  1JQQ A;  2BZX A;  2HBW A;  1NYG A;  2KGT A;  1NEG A;  2V1Q A;  3R6N A;  4Z89 A;  1K0X A;  2JTE A;  2RQT A;  2EPD A;  2KXC A;  2KRM A;  3SEM A;  2RQW A;  2VVK A;  2A28 A;  2KRS A;  1ZLM A;  1S1N A;  2JM8 A;  2XMF A;  3H0F A;  3PVQ A;  2EKH A;  3EG1 A;  2F2V A;  1JU5 C;  2CH4 A;  2YUQ A;  1AWO A;  2DNU A;  3I5S A;  1OOT A;  2DMO A;  2LZ6 B;  2CDT A; 
#chains in the Genus database with same CATH topology
 3CCU Q;  1AD5 A;  1K9M C;  1JXM A;  2EQJ A;  1M27 C;  5HK3 A;  1QVG A;  2PVG B;  1RAD B;  1X6O A;  1U06 A;  2F5T X;  4KGZ B;  3VS3 A;  4KRT A;  3CMA T;  1Y71 A;  2OTJ T;  3OMG A;  1PSF A;  2GFA A;  3M0R A;  4C92 C;  2P4R A;  3MEU A;  1UDL A;  1N27 A;  3OYY A;  4PL6 A;  3JCM c;  5CIU A;  1WXU A;  4DBR A;  1M8V A;  4RMO A;  3H6Z A;  1KIK A;  3EG3 A;  4JLG A;  1CKA A;  2EGA A;  2ATC B;  2RHY A;  3CCQ A;  3UAT A;  3GNF B;  2FZC B;  5AT1 B;  4IUP A;  2RB6 A;  3CC7 T;  1FMK A;  5I22 A;  2QDY B;  1GFD A;  2LDM A;  4PJO B;  4J9E A;  2DL3 A;  2DIL A;  3EG9 A;  2CP6 A;  2J05 A;  3KFV A;  5J39 A;  2QAS A;  2CSI A;  4AFZ C;  1KC8 R;  4LUE A;  2A7Y A;  1SPK A;  2IPO B;  5IHK A;  2NUT A;  1B34 B;  1M30 A;  2BE7 D;  3CEY A;  3I35 A;  3CXC A;  1TS9 A;  3LH5 A;  1N8R U;  1PKT A;  2LP5 A;  5FU7 C;  2KDS A;  2GGR A;  2EW3 A;  3CC4 T;  1N6A A;  4OB3 B;  4BDY A;  5CKE A;  5GMK i;  3JCM V;  3MO8 A;  2YWW A;  1K73 R;  2DYI A;  4PJM A;  4FSX A;  4XK8 E;  4C8Q E;  1V76 A;  3OMC A;  3ZBD A;  1C6V X;  5LJ3 f;  4F04 B;  1IRE B;  5I11 A;  5A0G A;  8ATC B;  2FPD A;  3OB9 A;  1DJ7 B;  4M7A B;  4XQ3 A;  2O9S A;  2DRM A;  4LDU A;  4R55 A;  1WHJ A;  2VGM A;  1N5Z A;  5GMK l;  2GTJ A;  2DYB A;  2YXY A;  5GMK h;  4M7D A;  1J3T A;  2IIM A;  4II1 A;  4ME7 A;  2R5M A;  3OYG A;  1MGQ A;  3HHT B;  3EGU A;  3A5Z B;  4A63 B;  3UA7 A;  3X20 B;  1IHV A;  2CP5 A;  4Z02 A;  5IH2 A;  2KSS A;  4FM4 B;  1VQ8 T;  3JCM d;  5C6S A;  1TUG B;  3VKI A;  4DOV A;  2J6K A;  5KH6 A;  2AKK A;  2QA4 A;  4JRP A;  4C92 E;  2L3R A;  6AT1 B;  4Y91 A;  1HXD A;  2ZPB B;  1QVF A;  5LJ5 d;  2JTF A;  2FPE A;  1XQH A;  2L0A A;  4C0D B;  1UE9 A;  3LH0 A;  1VIE A;  1HYO A;  3JB9 D;  1WXT A;  2FZG B;  4C5I A;  2DRK A;  5C0M A;  1LOJ A;  2FZK B;  2K57 A;  4BY6 B;  2BUD A;  3UWN A;  3SWN C;  3CMA Q;  3SDZ A;  2OTJ Q;  3EG9 B;  2YLB A;  1SSF A;  1FYN A;  3EH2 A;  4JLI A;  1AWW A;  1UUE A;  2CP2 A;  1D1A A;  2NUT B;  1KHI A;  3DKM A;  4PJN A;  2QGF B;  2GCX A;  3V7S A;  2RHI A;  2E3H A;  1WHM A;  4XTU A;  4AG2 C;  2K5F A;  4L59 A;  4PNO A;  2LJ3 A;  3MJX A;  1PWT A;  5LJ3 h;  2RK2 A;  4D8K A;  4AMC A;  1Q82 R;  1QKW A;  3I56 T;  2NUP A;  3E1S A;  1KC8 U;  2Z0W A;  3QSU A;  4RKU E;  4EMK A;  1X75 C;  3GOX A;  2QEX T;  2MWP A;  4XTX A;  1K9A A;  2YRC A;  1NZ9 A;  2FO0 A;  1M3C A;  4VUB A;  4M78 D;  4EIK A;  4B9X A;  3CCL A;  5KYU A;  3M56 A;  1BCO A;  2E12 A;  2CKK A;  1RAH B;  3ME9 A;  2FHD A;  2KK4 A;  4C8Q F;  2M1H A;  5IT9 E;  1WQW A;  2CSQ A;  3UA6 A;  1K73 U;  2RA2 A;  3TU4 K;  1UGP B;  1AWJ A;  2RHZ A;  5HCK A;  3CC4 Q;  2QXF A;  5GAO m;  2NWM A;  4QT7 A;  1NJI R;  5L8R E;  4AT1 B;  2V8K A;  4O5V A;  3VS4 A;  4AFU C;  4RUG A;  4CI0 C;  2ABL A;  2F69 A;  3S6W A;  2C0T A;  2DD4 A;  1YHQ A;  3CBO A;  1RL2 A;  1AT1 B;  3TEE A;  5CO7 A;  1GBR A;  5LJ5 j;  2JM9 A;  3E9F A;  5FWC A;  3URG A;  4PJO D;  1GXI E;  3CCJ A;  2JMC A;  2ECZ A;  2K79 A;  1KD1 R;  1I1J A;  4N0A C;  2JN0 A;  3P8D A;  4ATO A;  3CMA A;  2LMJ A;  2GBQ A;  4NL2 A;  3VUZ A;  1OEB A;  4C92 F;  3CCQ T;  1ACM B;  2E5K A;  4XTY A;  2L89 A;  4C8Q A;  2VAS A;  1VQ8 Q;  4M7A E;  4E47 A;  3H0H A;  2HMA A;  1Y96 A;  4C0G A;  1JB0 E;  3QO3 A;  4A53 A;  3RBB B;  3M59 A;  1U1S A;  2OTL A;  3JCM P;  4J6W A;  5EG2 A;  4M7D C;  2L3Q A;  3VS1 A;  2JOY A;  1U5S A;  1ZSZ B;  4J9D A;  4GLK A;  5GJW B;  3RKW A;  1QCN A;  3MEV A;  1K8A R;  3EGX A;  4QVZ A;  2KEA A;  1X2K A;  1X2Q A;  2ZZD A;  1VQK A;  3CCM A;  1TU0 B;  2XDD A;  4EMK B;  5GMK e;  3EHQ A;  2KT1 A;  3EFR A;  5GAN d;  2YLC A;  2KRO A;  3MEW A;  3HPW A;  3PIO A;  4OMO A;  3JV3 A;  1RI9 A;  2E1H A;  2DAQ A;  1Q82 U;  2QQS A;  4GBQ A;  2FL7 A;  4XU1 A;  2CGH A;  4C92 A;  2OX7 A;  2RH2 A;  2FRY A;  3OYA A;  2VGN A;  1G83 A;  2DTI A;  1HD3 A;  2W10 A;  1LCK A;  3EFO A;  3RNJ A;  3I56 Q;  3CXC S;  3OW2 P;  4KUI A;  4F16 A;  4FU6 A;  2QEX Q;  1UEC A;  2DET A;  2GNC A;  2M0O A;  2J6F A;  3SHW A;  3T9N A;  2ZCF B;  2RQT A;  5HY6 A;  2E70 A;  3SEM A;  2KRM A;  3OYD A;  4KH1 B;  1RAI B;  1NJI U;  1S1N A;  2JM8 A;  3H0F A;  1EIF A;  3EG1 A;  3LGL A;  1G3Y A;  4XU0 A;  2CDT A;  2QA4 T;  1BI0 A;  2X35 A;  4QQD A;  1OI1 A;  3TSW A;  1BCM A;  5I2S A;  2Y4X A;  1IGQ A;  2O31 A;  5FU6 B;  2QDL A;  1KC8 C;  2PNI A;  4RTV A;  2DXT A;  3M53 A;  3EGD A;  3M57 A;  5D6W A;  1H92 A;  1ZA1 B;  2D0N A;  4C8Q B;  4QQ6 A;  3LWI A;  5DY9 A;  3QBY A;  2BZ8 A;  4J9C A;  5KCH A;  1KD1 U;  2RD1 A;  1Y96 B;  3X26 B;  2WSF E;  3PVL A;  3QYG B;  4J7F A;  5GAN 5;  2EQI A;  1WHK A;  4TVR A;  2DX1 A;  3I55 T;  3OBY A;  1M8M A;  1K73 C;  4M7A F;  4M7D E;  1WYX A;  4RTX A;  3VJP A;  5HK0 A;  2EYQ A;  3JB9 G;  3M55 A;  3EGX B;  2B86 A;  3TCJ A;  3CCQ Q;  1YJW A;  2SEM A;  2FPF A;  3OYB A;  1VYT A;  2MF2 A;  5GAN j;  1YCY A;  1G3T A;  1KHC A;  3EG2 A;  3CBM A;  1KK7 A;  4OMN A;  3QWY A;  2DJQ A;  3OY9 A;  2EYY A;  2RO0 A;  3FB9 A;  1K8A U;  2HBP A;  3HFN A;  1NYF A;  2GFU A;  2P84 A;  1NEB A;  1AHJ B;  1ZX6 A;  2RI5 A;  5CR2 A;  3CCS A;  3MKD A;  2PZ1 A;  1LNX A;  2WSC E;  4C92 B;  3HFO A;  2DVJ A;  3CCL T;  4JDS A;  1TOV A;  2QEX A;  3NTI A;  1M1K R;  3A98 A;  3EFO B;  1ABO A;  1M3B A;  3MCA B;  1G5V A;  4XTW A;  4OMQ A;  4MZT A;  5CK9 A;  3C4S A;  3OS1 A;  1TUD A;  1OPL A;  4K11 A;  4ZGE B;  5CQY A;  3BW1 A;  5IHN A;  4Q5W A;  2EYW A;  3SWN A;  3HSB A;  1OQK A;  1OUL A;  1V1C A;  2MMP A;  2ESW A;  2YSQ A;  1YNZ A;  1X01 A;  5GMK m;  1M4Z A;  2JNG A;  3E19 A;  4Y92 A;  1D0Z A;  1PG5 B;  3RMS A;  2X4Y A;  1YHQ T;  1BYM A;  3G4S A;  2CUD A;  3QKJ A;  4XTV A;  1I81 A;  4WTO B;  2CP0 A;  4M75 G;  5FW9 A;  3CCJ T;  1GFC A;  1VQ5 T;  1BI3 A;  1PD1 A;  2DBK A;  1QP3 A;  4E6R A;  3JCM b;  5FU7 B;  1RAF B;  5FWB A;  3LWH A;  1UGV A;  3EGD B;  8AT1 B;  1K76 A;  1K4U S;  4JRK A;  2JTM A;  3OQ5 A;  4BUG A;  5M9O A;  1WI7 A;  1XOV A;  3JCM W;  1SEM A;  3WVD B;  3G6E A;  1SRL A;  1Q82 C;  1AZE A;  3OYN A;  3QYH B;  3ZFJ A;  3LGF A;  3CBP A;  2DFU A;  5GAN 3;  1W1F A;  1EFN A;  1NG2 A;  2DIG A;  3V7C A;  2QA4 Q;  4P5N A;  4C5G A;  1YIJ A;  4PJO G;  2OTL T;  2EQU A;  1AWX A;  3QII A;  3CME Q;  1BU1 A;  1VQ4 A;  2KT8 A;  1KSW A;  2VV5 A;  2PUO B;  1WHH A;  1Q7Y U;  4IKF A;  2JS0 A;  2LCC A;  1R77 A;  1VQK T;  1X69 A;  4M7D F;  3CCM T;  3CCE A;  2CYZ B;  2COY A;  4OMP A;  4N4H A;  2EJG A;  2YT6 A;  3JSC A;  2LQ8 A;  1YFN A;  4OGC A;  1VQO A;  4XU2 A;  3OYK A;  3I55 Q;  2DTO A;  3OYM A;  2OJ2 A;  1CKB A;  2DL7 A;  1G3W A;  4ANJ A;  5GAO n;  4ELZ C;  1WX6 A;  1VUB A;  3A8L B;  4LDY A;  4N0A A;  1T0H A;  1RAE B;  5IXF A;  1T3S A;  3UF4 A;  3CPW P;  4BI3 A;  5FRO A;  2V26 A;  1MV0 B;  2DKG A;  4PJJ A;  2DXB A;  4F17 A;  1VYV A;  2EIF A;  2F5K A;  3CCR A;  1S72 A;  4M75 C;  2GTO A;  2V1R A;  2K5I A;  1KD1 C;  2E65 A;  2GQI A;  2DEQ A;  4X1V A;  2O4X B;  1E6H A;  2QYZ A;  2EJ9 A;  3CCL Q;  3P8H A;  4E7I A;  2YUN A;  1W2B P;  2K2M A;  3MEA A;  1IXD A;  3QDR B;  4JJD A;  1G8X A;  3QUI A;  2LQK A;  1WJR A;  4C8Q D;  3FC3 A;  1Q86 U;  4A4K A;  3PNW C;  1FWZ A;  1QQJ A;  2MAM A;  4LDW A;  2ZGW A;  2RJD A;  5KYX A;  2A36 A;  3AHU A;  1ZA2 B;  9ATC B;  2RJC A;  5GAM d;  2GF7 A;  3OA6 A;  4JJC A;  3IQL A;  1MMD A;  2LT4 A;  2E5Q A;  1W2B S;  1RAB B;  3RMQ A;  5D6Y A;  1MHN A;  1Z9Q A;  5KE3 A;  2A37 A;  4M77 G;  3M0P A;  4ZN3 A;  1YHQ Q;  3QJY A;  4A4E A;  3CME A;  4HVU A;  1WZO A;  1JO8 A;  2DJZ A;  3CCJ Q;  2CZ7 B;  1G2B A;  2DLP A;  1VQ5 Q;  3M0T A;  1WJS A;  2KYM A;  3JRZ A;  5J3B A;  1YJW T;  2R58 A;  3BDU A;  3I55 A;  2NYS A;  5CCA A;  2K3Y A;  4C92 D;  1OYX A;  4MDW A;  5HKC A;  2DEU A;  4D6W A;  2QQB A;  3ZL7 C;  4ZGJ B;  1TTH B;  4J9G A;  3U23 A;  3JB9 I;  3MP6 A;  4IIO A;  3L42 A;  4OMF B;  2OTL Q;  3OS2 A;  4HXJ A;  1WIE A;  3CCS T;  2BE9 B;  1FMV A;  3JAM E;  3KUF A;  2KYB A;  4E7H A;  2LC4 A;  2MPX C;  4F14 A;  3S3N A;  1M90 R;  2X9H A;  4CC7 A;  2L5Q A;  1KQS P;  3LYI A;  1ZUK A;  4E7L A;  1VQK Q;  4R0K A;  3CCM Q;  1IRX A;  3MET A;  4J7I A;  2LJ0 A;  2COW A;  3L2R A;  4LD6 A;  3UT1 A;  1WFW A;  2AIR B;  1IB8 A;  4IUT A;  2EGC A;  2FRW A;  2L3P A;  1KQ2 A;  2K2V A;  1PRM C;  1W70 A;  2RI2 A;  1RAA B;  1M2O A;  1VQM T;  1WGS A;  1YJN A;  3E9G A;  1MMA A;  2K6D A;  4J8O A;  1EZZ B;  3UPU A;  3P8B B;  4M7D B;  1VOM A;  1WPY A;  3N5B B;  3G4S T;  4M77 C;  4BAC A;  2DZ9 A;  4DBF A;  1JQQ A;  1UGS B;  3CPF A;  2BZX A;  2HBW A;  3HKS A;  1Q7Y C;  1NEG A;  2V1Q A;  3R6N A;  5GAM j;  4LDX A;  2K4Y A;  4XAX B;  5KYX B;  4B6M A;  2H3J A;  2A28 A;  2DVE A;  3G1J A;  2JJ9 A;  4B9W A;  2E6N A;  3PVQ A;  3KBG A;  3HRT A;  1TH7 A;  2F2V A;  1JU5 C;  5CKB A;  5KYW A;  3G71 A;  3I5S A;  3BE3 A;  3FDR A;  3KXT A;  2LZ6 B;  3M4Y A;  2MK5 A;  1NLO C;  4Z88 A;  1VQ5 A;  4CC4 B;  5KE2 A;  1N8R C;  3G6E T;  3VRZ A;  1UGQ B;  3MP1 A;  2YUP A;  3RIR A;  3QXE B;  2C0I A;  2HSE B;  1YBY A;  2RNA A;  2AT1 B;  1YIJ T;  1BK2 A;  1SHF A;  5FRN A;  1MMN A;  1IHW A;  1VQ4 T;  2M16 A;  4Y28 E;  2JMA A;  1RI0 A;  2CZ0 B;  3JCM f;  3QWX X;  1U8R A;  2CT4 A;  4YTL A;  1BI2 A;  3CCE T;  3CCV A;  4HT9 A;  3VYH B;  2ZPE B;  4IUV A;  1YI2 A;  3INZ A;  1R8O B;  1Q95 G;  5LJ5 f;  3H0I A;  3MHX A;  1VQO T;  1VQ6 A;  4O6J A;  2JUF A;  4MZM A;  2DL8 A;  1WXB A;  3GPL A;  2LQW A;  3EAE A;  2LJ1 A;  2NUP B;  1Q86 C;  4DEY A;  2RJE A;  4HVV A;  4M7A D;  1VQ7 Q;  1YJW Q;  3QG1 A;  1PCX A;  1D3B A;  5CQX A;  3H41 A;  1OZ2 A;  1RLP C;  2JT4 A;  3TVT A;  1F1B B;  2H3E B;  1AVZ C;  5KYU B;  4ESR A;  2I2L A;  2SRC A;  4DOW A;  2CUB A;  1NLP C;  1NPP A;  1PNJ A;  4FW1 A;  3CCR T;  1S72 T;  3M9Q A;  5L23 A;  1M90 U;  4GLM A;  2XHC A;  2DXU A;  4E7K A;  3JB9 H;  2ED0 A;  2QQR A;  3CCS Q;  5GAO q;  2HAX A;  2QQ9 A;  1BB9 A;  2HSP A;  3BDL A;  3E2U A;  4OP0 A;  3REB B;  3UDC A;  2DD5 A;  1KJW A;  2EBP A;  4FYY B;  4M75 F;  3JCM J;  1YJ9 A;  3TSZ A;  1UB4 A;  4PLL A;  5IN1 A;  5GAO p;  1YIT A;  4HVW A;  4M77 E;  3A1P A;  4ZGD B;  3OYF A;  1W2B A;  1FXX A;  2DER A;  5D7U A;  4IIM A;  3BFM A;  4JS5 A;  1I0C A;  1QWE A;  1X43 A;  3ZEH A;  1BIB A;  2P0P A;  3FJP A;  2KE9 A;  2W0Z A;  3OW2 S;  1OX8 A;  3X24 B;  2D9T A;  1VQM Q;  1QP2 A;  2HQX A;  3HL8 A;  2ZAE A;  4OB0 B;  3L2V A;  3S3O A;  2HL5 C;  3CD6 A;  4AFQ C;  3QHS A;  2EKO A;  2BZY A;  2Y4Y A;  1M2V A;  1M9S A;  2DL4 A;  3G4S Q;  3EFS A;  2K5L A;  3CME T;  2R5A A;  3V7R A;  2LVM A;  2M51 A;  2EVR A;  2VC8 A;  2ENM A;  2P4T A;  4BE1 A;  3PTA A;  5GAO r;  5CAI A;  2DA9 A;  2L8D A;  2YDL A;  1G3S A;  1UG1 A;  1KQ1 A;  2HCK A;  3QJ6 A;  4M75 A;  3RUX A;  4ORZ A;  2LCS A;  4LDV A;  3PIP A;  1LPL A;  3VV0 A;  3G6E Q;  1ZQ1 A;  4DBQ A;  2KR3 A;  1HSQ A;  1X27 A;  2E6Z A;  2KNB B;  4L5G A;  2PU9 B;  2JW4 A;  1VQ7 A;  1YIJ Q;  3QPH A;  4JRQ A;  1VQL A;  1UHF A;  2M0Y A;  3PFS A;  4PKC C;  1VQ4 Q;  3JCM Q;  1VQP A;  4QKU A;  2IG0 A;  2ZPI B;  1VQN A;  1D3B B;  1UEB A;  4R56 A;  4PJO A;  2O01 E;  4M4Z A;  2ROT A;  2LT1 A;  1OU8 A;  2DZC A;  3CCE Q;  5LJ3 d;  2X4X A;  2YRD A;  1GL5 A;  4A4G A;  3OS5 A;  4F7U G;  2VXF A;  2F2W A;  2A0F B;  4M7D D;  4HCK A;  4MMK A;  2XDB A;  1H8K A;  1VQO Q;  1W6X A;  1PD0 A;  2HD0 A;  2RHU A;  1OU9 A;  2J06 A;  1B34 A;  2VB6 A;  3WXM B;  2RQR A;  1KFZ A;  5IXB A;  1KG1 A;  3RDV A;  4KUD K;  1QWF A;  1YJN T;  3CQT A;  4JS4 A;  4J9F A;  2KBT A;  4PFO A;  2PUK B;  1JRI A;  3HTR A;  5DLO A;  1E6G A;  2KQW A;  2H8H A;  1PKS A;  2M02 A;  3O8V A;  4J9I A;  5GAN f;  2L2P A;  3C12 A;  1VQM A;  3M58 A;  4M78 G;  3EG0 A;  5GMK j;  1WNL A;  3CCR Q;  1S72 Q;  3TQ7 P;  4ZTF A;  4IUU A;  4DEX A;  4M77 F;  2OI3 A;  1GBQ A;  2RJF A;  2BKD N;  3G71 T;  2COZ A;  1LJO A;  5GAM g;  3JCM g;  3THK A;  1M2V B;  4HCB A;  4PLI A;  1C1A A;  1WA7 A;  3HRS A;  3OSV A;  1VQ9 T;  1JBM A;  4IUR A;  2VUB A;  1GRI A;  4RTU A;  5A2Q E;  2VYT A;  3G7Z A;  5LJ5 g;  4ELY C;  5LL6 S;  2X4W A;  1TSF A;  1Y57 A;  1ZBJ A;  2I0N A;  3H8Z A;  4WF2 A;  4EMG A;  1IO6 A;  2YHT A;  2EWN A;  1WDX A;  3OSS C;  5IAY A;  4JUV A;  2V8I A;  1QCO A;  2WAC A;  3F70 A;  4OVA A;  2RQV A;  4KT0 E;  3DB4 A;  4M75 B;  2DF6 A;  2RPN A;  1M90 C;  4FIB A;  4V2S A;  1YCS B;  1BI1 A;  1MUZ A;  4JJN K;  1M5Q 1;  4NL3 A;  3CCV T;  4PJL A;  4QW2 A;  2GQV A;  4L6V 5;  2FB7 A;  1YI2 T;  3PT9 A;  4X34 A;  1R0B G;  1Z9Z A;  1BBZ A;  5IHI A;  2MCN A;  1YP5 A;  2K3B A;  1VQ6 T;  1ZHI A;  2LX9 A;  1T3L A;  1NBE B;  4M77 A;  4JZ4 A;  3A8O B;  3OS0 A;  1Q81 R;  4FT2 A;  2E3I A;  1D1C A;  3OYE A;  3R6O A;  3EHR A;  7AT1 B;  2EJF A;  5GAN 4;  3VYG A;  2LRQ A;  5LJ3 j;  3X28 B;  1RAG B;  2O2O A;  1E7O A;  4FYW B;  1NJI C;  5DM7 R;  4J6X A;  1BIA A;  3EH1 A;  1N9R A;  2QI2 A;  1UTI A;  4RCC A;  5KCO A;  2VKN A;  4M78 C;  3GIB A;  1B7T A;  2HQH A;  1RUW A;  5ECA A;  2J6O A;  5GAN h;  4ZNX A;  2B8A A;  4DBH A;  4X9C A;  4J5Y A;  1Y07 A;  4KGV B;  2KRN A;  4DQ2 A;  4WCI A;  3J80 E;  4M7A G;  2JXB A;  1WHG A;  3V8K A;  3OW2 A;  3C95 A;  2QK0 A;  2X3W D;  5GAM e;  1YJ9 T;  3SWN B;  3JCM e;  1YIT T;  2C06 A;  2AZS A;  2HZY A;  1OV3 A;  2OAW A;  4JPB W;  1MNE A;  4LXC A;  1M1K U;  1GCQ C;  2P0K A;  3OYI A;  4DA4 A;  4E7J A;  1O75 A;  2QAZ A;  5LJ5 e;  3CPW S;  3ER0 A;  2KMT A;  4J83 A;  5CKF A;  1UJY A;  3VS5 A;  3DB3 A;  2PVD B;  2DK3 A;  5CKH A;  2QTV A;  1M3A A;  2CH4 W;  2YRV A;  1YJN Q;  3CD6 T;  1NYG A;  2KGT A;  2EQK A;  1K0X A;  3FEO A;  2JTE A;  2KXC A;  4PJO C;  1I5O B;  2M9U A;  2XDP A;  3CCU A;  2XKO C;  1FX7 A;  2XMF A;  2EKH A;  5KYY A;  2VXE A;  3FRN A;  3L2Z A;  2CH4 A;  2YUQ A;  4E2F B;  1H3Z A;  1K8A C;  1OOT A;  2DMO A;  4C0F A;  3VUB A;  2IVW A;  2DXC A;  2CZ1 B;  3JB9 J;  4E7Z A;  1ZSG A;  3REA B;  2XU8 A;  4RTW A;  3G71 Q;  2AKL A;  2HDA A;  4RG2 A;  4BD3 A;  5GAN 2;  2DBM A;  3AT1 B;  3C0C A;  1VQ9 Q;  2O9V A;  2DM1 A;  1JEG A;  3VS6 A;  3OYL A;  4OB1 B;  1RLQ C;  2R57 A;  2RMO A;  2MWO A;  1H64 1;  2LNH B;  1SG5 A;  1IZ6 A;  4F7U E;  4J9H A;  1SSH A;  4JJB A;  1VQ7 T;  3PMI A;  3RES A;  4LN2 A;  4M77 B;  1VQL T;  1JXO A;  4J6Y A;  1Y0M A;  4OMM A;  3NTH A;  2DTH A;  1VQP T;  2DIQ A;  1JJ2 P;  3FLG A;  3GP8 A;  1VQN T;  3CC2 T;  2MYS A;  4M7A C;  2CT3 A;  4RTZ A;  3OYC A;  2AZV A;  1GCP A;  2EGE A;  4QVD A;  1PRL C;  1K1Z A;  1ZUY A;  1TWB A;  1VYU A;  3HRU A;  3CCV Q;  4FSS A;  5GAN g;  1QW1 A;  1K9M R;  3RER A;  4NOY A;  3VS0 A;  1YI2 Q;  5GAN 7;  1I4K 1;  1Q81 U;  5D6X A;  4M78 E;  4IUQ A;  1XJW B;  1VQ6 Q;  4NS5 A;  1ZSZ A;  1SF9 A;  1JJ2 S;  4AFS C;  3OYH A;  4HT8 A;  2RF0 A;  2HKN A;  4FL6 A;  2D6F A;  4AG1 C;  3CC7 Q;  1Y7X A;  3A8G B;  3GBQ A;  2QG9 B;  4UC4 A;  4C5H A;  1XTD A;  4RTY A;  2LTO A;  2ZPH B;  4M75 E;  4KGX B;  4C0Z A;  4FT4 A;  3PE0 A;  3NHN A;  4BI4 A;  2P0Q A;  1SKU B;  4M7D G;  2A3L A;  5J26 A;  4EDU A;  3NFC A;  1YWO A;  4JRI A;  1KQS S;  5A0D A;  2RK1 A;  2ED1 A;  1WJQ A;  2FVU A;  3HP9 A;  4C0D C;  3O5Z A;  3L2U A;  4FCY A;  4CC2 A;  2MOX A;  1NE8 A;  2KY9 A;  3M0Q A;  1U3O A;  2BTT A;  4BY6 C;  4BE2 A;  2RI3 A;  5GAN 8;  1YJ9 Q;  2E41 A;  1BKB A;  1YIT Q;  4PJO E;  4KBM B;  1X6G A;  2X51 A;  1LVK A;  4M75 D;  2ROL A;  5KYY B;  4HKE A;  1HJD A;  1CSK A;  2E64 A;  1WHL A;  3I5R A;  3OBW A;  1FMW A;  1UHC A;  2QQA A;  4HCZ A;  3RKX A;  1ZBX A;  5FLX E;  3J81 E;  2F2X A;  2XIC A;  2XG8 D;  3LX7 A;  1VQ9 A;  2FEI A;  2HEQ A;  4CRI A;  2RM4 A;  1UFF A;  1AEY A;  2DL5 A;  2KVQ G;  2RQU A;  2KI7 A;  3M0U A;  3CD6 Q;  3JB9 F;  2G6F X;  2CP3 A;  4JZ3 A;  2FYK A;  2X3X D;  1TXQ A;  3ULR B;  2AK5 A;  2XD0 A;  1QVG P;  1D09 B;  4Z8A A;  2DO3 A;  4A54 A;  5GAN e;  5A0L A;  4QQG A;  3NMZ C;  3L2Q A;  5GAM f;  4MZP A;  1B3Q A;  2FG0 A;  3L2W A;  2E4H A;  2E10 A;  2OTJ A;  1M1K C;  1I8F A;  2HKQ B;  1P92 A;  1RAC B;  1ABQ A;  1MND A;  3DLM A;  4PFP A;  4F7U F;  1NPR A;  3S3M A;  1A0N B;  3QZ5 B;  1D0Y A;  3LLR A;  1AOJ A;  4FW2 A;  1QVG S;  1O9S A;  2V8J A;  4BE0 A;  1WLP B;  4N4G A;  2BIV A;  2DE0 X;  1TG0 A;  3GF5 A;  1QCF A;  3VRY A;  4LE9 A;  4J9B A;  5LJ3 g;  3CC7 A;  5I2M A;  5AYF A;  4OGE A;  1PHT A;  1D0X A;  1VQL Q;  3QDF A;  4PK4 A;  5GJV B;  2EFI A;  1VQP Q;  4KUL A;  3RR6 A;  1SHG A;  3JCM X;  1K9M U;  4M78 F;  3CPW A;  3CC2 Q;  1MMG A;  1VQN Q;  2AHJ B;  1M1F A;  4ZN1 A;  2K3X A;  3VS7 A;  2EYZ A;  5FRM A;  2LCL A;  3CXC P;  3M5A A;  3VU3 C;  4EPC A;  1PC0 A;  4RTT A;  1MV3 A;  2J7I A;  3MPU B;  5KYN A;  4HCC A;  1EX4 A;  1T0J A;  3CC4 A;  4N4I A;  2CRE A;  4LUD A;  2XID A;  4F7U A;  2PTK A;  1ZUU A;  4XU3 A;  1PSE A;  3SD4 A;  3OYJ A;  1UJ0 A;  4RCB A;  1ARK A;  2XI9 A;  3PGG A;  2YUO A;  4X9D A;  3CCU T;  1QVP A;  5GAO l;  3J7A F;  5KYW B;  1YN8 A;  2RHX A;  2K9G A;  4QVC A;  4CC3 A;  4E7S A;  4BB7 A;  2XK0 A;  2EQM A;  1H3H A;  4PJO F;  1K0S A;  2ZPG B;  4HA8 A;  1ZSZ C;  5GAN 6;  3Q1J A;  1C0M A;  4LD9 K;  1W4S A;  4OML A;  1Q81 C;  1SRM A;  2RN8 A;  3NGP A;  2HQE A;  3FJ5 A;  5GAM h;  4M77 D;  3JCM h;  4C8Q G;  4M78 A;  2KAF A;  5CKD A;  1IGU A;  2LQN A;  1UGR B;  1NM7 A;  4BDZ A;  3BY7 A;  1TUC A;  3V8L A;  2NLU A;  2LNV A;  3SB2 A;  4EMK C;  3X25 B;  2JZ2 A;  5LJ5 h;  2LX7 A;  4FYV B;  1OPK A;  2HL3 A;  2JS2 A;  1VQ8 A;  3QZ9 B;  2NUZ A;  2VWF A;  4RG8 A;  2D1X A;  4KH0 B;  2HNI A;  5LJ3 e;  2PVO B;  2A08 A;  2KXD A;  3M54 A;  1QVF P;  1GCQ A;  1OZ3 A;  1R0C B;  2G3R A;  2MIO A;  2D0Q B;  1VIF A;  4C5E A;  5I21 A;  3NPF A;  2Y90 A;  1B07 A;  1JJ2 A;  1Q7Y R;  2X4J A;  4BI8 B;  1QKX A;  2C0O A;  3LW5 E;  1N9S A;  5DLQ E;  4GY5 A;  2CZ6 B;  5CVI A;  4ZTJ A;  3GLX A;  2EYX A;  3CC2 A;  2CS7 A;  1QVF S;  2QGG A;  4D8D A;  2WSE E;  4C92 G;  4A4H A;  1VA7 A;  1AZG B;  2F1L A;  1KQS A;  5EC7 A;  3V8J A;  2D8J A;  3A8H B;  1N8R R;  3M4G A;  3PMT A;  1QLY A;  4PFZ A;  2JVV A;  3C94 A;  1U1T A;  2MI6 A;  3ASK A;  4XTZ A;  2O88 A;  2L3S A;  3D7S B;  3L1A A;  1QMC A;  1I07 A;  4OB2 B;  3VS2 A;  1M1G A;  1OX9 A;  1X6B A;  3WVE B;  4MML A;  3RKY A;  3I56 A;  5FU6 C;  1V29 B;  3M0S A;  3A8M B;  3DLL A;  2OAU A;  4LNP A;  4OF1 A;  4F7U B;  2DPP B;  2K7A A;  2D8H A;  3I9Q A;  4C8Q C;  3H9N A;  4MDX A;  2EAY A;  1YWP A;  4FYX B;  4A4F A;  1PM3 A;  2PQW A;  4M7A A;  3FIF A;  4EMH A;  1XNI A;  1Q86 R;  3GNG A;  1I5L A;  3SFM A;  4Z89 A;  1D1B A;  2O4X A;  2EPD A;  2RQW A;  2VVK A;  2KRS A;  1ZLM A;  1HK9 A;  2CP7 A;  4M78 B;  2ZPF B;  2QTX A;  3NTK A;  1WQ7 A;  1AWO A;  2DNU A;  3MP8 A;  3TRE A; 
#chains in the Genus database with same CATH homology
 1NLO C;  4Z88 A;  1ZSG A;  1AD5 A;  3REA B;  1JXM A;  3TSW A;  4CC4 B;  4RTW A;  3VRZ A;  1M27 C;  2O31 A;  2YUP A;  2QDL A;  2PNI A;  2AKL A;  2HDA A;  1U06 A;  4RTV A;  2DBM A;  3VS3 A;  2C0I A;  4KRT A;  3C0C A;  1H92 A;  2RNA A;  1BK2 A;  1SHF A;  2O9V A;  2DM1 A;  2D0N A;  1JEG A;  3M0R A;  3VS6 A;  2P4R A;  1RLQ C;  1UDL A;  2BZ8 A;  4J9C A;  2RMO A;  2LNH B;  2JMA A;  1WXU A;  4J9H A;  1SSH A;  3PVL A;  4JJB A;  2EQI A;  4LN2 A;  1KIK A;  3EG3 A;  1CKA A;  1JXO A;  3QWX X;  2EGA A;  2DX1 A;  1M8M A;  2CT4 A;  1Y0M A;  4OMM A;  3UAT A;  1WYX A;  4RTX A;  1FMK A;  5I22 A;  1GFD A;  2CT3 A;  4J9E A;  3H0I A;  2B86 A;  4RTZ A;  2AZV A;  1GCP A;  2EGE A;  1PRL C;  1K1Z A;  2DL3 A;  2DIL A;  1ZUY A;  2J05 A;  1VYU A;  2DL8 A;  1WXB A;  3KFV A;  2LQW A;  2SEM A;  2FPF A;  4FSS A;  2LJ1 A;  3VS0 A;  1VYT A;  4DEY A;  2CSI A;  4HVV A;  3EG2 A;  4AFZ C;  4LUE A;  1SPK A;  5IHK A;  1M30 A;  4OMN A;  3QWY A;  2DJQ A;  3H41 A;  2EYY A;  1RLP C;  4AFS C;  1NYF A;  2JT4 A;  3I35 A;  3TVT A;  2RF0 A;  1NEB A;  1ZX6 A;  4AG1 C;  3LH5 A;  1PKT A;  1AVZ C;  4ESR A;  3GBQ A;  2PZ1 A;  2LP5 A;  2SRC A;  2DVJ A;  2CUB A;  4RTY A;  1NLP C;  1PNJ A;  2GGR A;  2EW3 A;  5L23 A;  4GLM A;  3PE0 A;  3A98 A;  1ABO A;  1M3B A;  3NHN A;  2ED0 A;  1YWO A;  1BB9 A;  2HSP A;  4OMQ A;  3REB B;  2ED1 A;  1KJW A;  2EBP A;  1TUD A;  1OPL A;  5I11 A;  4K11 A;  5IHN A;  3TSZ A;  2FPD A;  2EYW A;  3O5Z A;  4HVW A;  4CC2 A;  1V1C A;  2MOX A;  2O9S A;  2DRM A;  3M0Q A;  1U3O A;  2ESW A;  2YSQ A;  1YNZ A;  4IIM A;  2BTT A;  1N5Z A;  1I0C A;  1QWE A;  1X43 A;  4Y92 A;  2KE9 A;  2GTJ A;  2W0Z A;  1X6G A;  2DYB A;  2ROL A;  1HJD A;  1J3T A;  2IIM A;  1CSK A;  3I5R A;  2CUD A;  1UHC A;  4AFQ C;  3EGU A;  4A63 B;  3UA7 A;  2BZY A;  2F2X A;  5FW9 A;  2DL4 A;  1GFC A;  2FEI A;  2HEQ A;  5IH2 A;  1UFF A;  2DBK A;  4E6R A;  1AEY A;  2DL5 A;  5FWB A;  2RQU A;  3M0U A;  1UGV A;  2G6F X;  1K76 A;  2M51 A;  4JZ3 A;  2EVR A;  1K4U S;  2ENM A;  2J6K A;  2X3X D;  2AKK A;  3ULR B;  2AK5 A;  1WI7 A;  1XOV A;  1SEM A;  4Z8A A;  2DA9 A;  1SRL A;  1AZE A;  2FPE A;  2YDL A;  2L0A A;  3NMZ C;  1W1F A;  1EFN A;  1UE9 A;  1UG1 A;  1B3Q A;  1NG2 A;  2FG0 A;  2HCK A;  1WXT A;  4ORZ A;  2LCS A;  2DRK A;  1AWX A;  1ABQ A;  1BU1 A;  2KR3 A;  2KT8 A;  1HSQ A;  1KSW A;  1A0N B;  1X27 A;  1AOJ A;  2KNB B;  2JW4 A;  1FYN A;  1WLP B;  2JS0 A;  2DE0 X;  1UHF A;  2M0Y A;  1TG0 A;  1X69 A;  1AWW A;  1QCF A;  1UUE A;  3VRY A;  4LE9 A;  4OMP A;  4J9B A;  2YT6 A;  1PHT A;  4AG2 C;  4M4Z A;  2ROT A;  5GJV B;  2LJ3 A;  1PWT A;  4D8K A;  2OJ2 A;  1CKB A;  1GL5 A;  1SHG A;  2DL7 A;  1QKW A;  2F2W A;  4HCK A;  1H8K A;  1WX6 A;  3VS7 A;  2EYZ A;  1W6X A;  2J06 A;  2RQR A;  1KFZ A;  1T0H A;  4RTT A;  5IXB A;  5IXF A;  1K9A A;  1T3S A;  1MV3 A;  3UF4 A;  1QWF A;  2J7I A;  2FO0 A;  3CQT A;  1MV0 B;  4J9F A;  2KBT A;  1M3C A;  4EIK A;  1E6G A;  4F17 A;  1T0J A;  2H8H A;  1VYV A;  1PKS A;  2GTO A;  2V1R A;  4J9I A;  2CRE A;  4LUD A;  2L2P A;  2PTK A;  1ZUU A;  2CSQ A;  2GQI A;  3UA6 A;  4X1V A;  1E6H A;  3EG0 A;  1UJ0 A;  1AWJ A;  1ARK A;  5HCK A;  2YUO A;  4DEX A;  2NWM A;  4QT7 A;  2YUN A;  2OI3 A;  1GBQ A;  2K2M A;  1YN8 A;  2K9G A;  4JJD A;  4CC3 A;  3THK A;  3VS4 A;  4AFU C;  1H3H A;  4RUG A;  1K0S A;  2ABL A;  1WA7 A;  4OML A;  1GRI A;  2A36 A;  1SRM A;  2RN8 A;  3NGP A;  4RTU A;  3FJ5 A;  2C0T A;  4JJC A;  2LQN A;  3IQL A;  1NM7 A;  1GBR A;  1Y57 A;  1TUC A;  1ZBJ A;  2I0N A;  2JM9 A;  1IO6 A;  5FWC A;  1Z9Q A;  2A37 A;  2JMC A;  1WDX A;  2ECZ A;  2K79 A;  3M0P A;  2LX7 A;  1OPK A;  1I1J A;  4HVU A;  2JS2 A;  2RQV A;  2NUZ A;  2VWF A;  2D1X A;  2DF6 A;  2RPN A;  2LMJ A;  2GBQ A;  1JO8 A;  1MUZ A;  1YCS B;  2A08 A;  1OEB A;  2KXD A;  1G2B A;  1GCQ A;  2DLP A;  2MIO A;  2E5K A;  3M0T A;  3H0H A;  2KYM A;  1Z9Z A;  3NPF A;  1BBZ A;  5IHI A;  1B07 A;  2MCN A;  1YP5 A;  2K3B A;  3RBB B;  1T3L A;  1QKX A;  4JZ4 A;  2C0O A;  3EHR A;  3ZL7 C;  2L3Q A;  4J9G A;  3VS1 A;  1U5S A;  2EYX A;  3U23 A;  4J9D A;  4IIO A;  5GJW B;  2O2O A;  1E7O A;  4D8D A;  1VA7 A;  2KEA A;  1AZG B;  1X2K A;  1X2Q A;  5EC7 A;  2D8J A;  4HXJ A;  1WIE A;  1UTI A;  1QLY A;  2VKN A;  2KYB A;  3EHQ A;  4F14 A;  2KT1 A;  5ECA A;  4CC7 A;  1RUW A;  2J6O A;  4ZNX A;  1ZUK A;  2KRO A;  2O88 A;  4R0K A;  2KRN A;  2L3S A;  4OMO A;  4WCI A;  1I07 A;  1RI9 A;  3JV3 A;  3VS2 A;  2LJ0 A;  1X6B A;  2JXB A;  4GBQ A;  1WFW A;  3M0S A;  2X3W D;  2EGC A;  2AZS A;  4LNP A;  1OV3 A;  2FRW A;  2FRY A;  1G83 A;  2L3P A;  1HD3 A;  2OAW A;  4JPB W;  1PRM C;  1W70 A;  1GCQ C;  2W10 A;  2K7A A;  2D8H A;  1LCK A;  3I9Q A;  3RNJ A;  4F16 A;  2K6D A;  1YWP A;  1UEC A;  1UJY A;  3VS5 A;  2GNC A;  2J6F A;  3SHW A;  1M3A A;  2CH4 W;  1JQQ A;  2BZX A;  2HBW A;  1NYG A;  2KGT A;  1NEG A;  2V1Q A;  3R6N A;  4Z89 A;  1K0X A;  2JTE A;  2RQT A;  2EPD A;  2KXC A;  2KRM A;  3SEM A;  2RQW A;  2VVK A;  2A28 A;  2KRS A;  1ZLM A;  1S1N A;  2JM8 A;  2XMF A;  3H0F A;  3PVQ A;  2EKH A;  3EG1 A;  2F2V A;  1JU5 C;  2CH4 A;  2YUQ A;  1AWO A;  2DNU A;  3I5S A;  1OOT A;  2DMO A;  2LZ6 B;  2CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...