2ED0A

Solution structure of the sh3 domain of abl interactor 2 (abelson interactor 2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abl interactor 2
publication title Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ed0A00
2JMCA 3KFVA 4F16A 2GQIA 2RF0A 5IHNA 4Y92A 1AOJA 4LE9A 2KRNA 3VS7A 4HVUA 4J9FA 1YN8A 2KRMA 3M0SA 4Z88A 4J9HA 2DL5A 1Y57A 2LMJA 1K76A 1NG2A 2J05A 2LJ1A 2AK5A 1GBRA 1ZUKA 1TUCA 1X27A 1OEBA 1PWTA 4RTYA 2A36A 1QLYA 2B86A 1M27C 3I5SA 4CC4B 1GBQA 1GFCA 1NEGA 1PRMC 2VVKA 1TG0A 1X69A 1QWFA 2JTEA 3EG0A 3I5RA 1T0JA 3VRYA 1W70A 2KNBB 4QT7A 2KXCA 5GJVB 5HCKA 2DNUA 5I11A 1Y0MA 4LUEA 1UTIA 1AVZC 2HSPA 1ZUYA 3RNJA 3NMZC 4HXJA 1X6BA 5IHKA 3UATA 5I22A 2AKKA 4OMOA 2ENMA 3SEMA 1AZGB 4R0KA 3UF4A 2J06A 3A98A 2JW4A 5FWBA 2G6FX 1UE9A 2RQUA 2YDLA 2EBPA 2DL4A 2ROLA 1ZUUA 2W0ZA 3GBQA 2DBKA 1H8KA 1NM7A 2L2PA 1BU1A 2LCSA 2W10A 2ESWA 1RI9A 3CQTA 2AZVA 1AWWA 5FW9A 2FG0A 4J9CA 2O31A 4HVWA 3VS1A 1WXBA 4D8KA 2DRMA 4E6RA 1GCQC 3QWXX 4AFZC 5IXFA 3VRZA 2RNAA 1M3BA 2MCNA 1E7OA 1KJWA 1T3LA 2DILA 2FO0A 3ULRB 2L3SA 2K79A 1JXOA 2OJ2A 2YUNA 1KSWA 1RLPC 1WXTA 1YWPA 2DRKA 1XOVA 4WCIA 1SPKA 4RTVA 2CDTA 2KXDA 4OMPA 1SEMA 2ED1A 2KYBA 2KGTA 5ECAA 5IXBA 3H41A 4J9IA 4OMMA 2M51A 3VS2A 2OI3A 2BTTA 1YNZA 2RQWA 4GBQA 3VS6A 2DM1A 4RTTA 4OMNA 1MUZA 1WXUA 5GJWB 4X1VA 1KIKA 1PKSA 1UG1A 2GNCA 1B07A 4A63B 2DYBA 2EYXA 4JPBW 3VS3A 3VS5A 1VA7A 1M3AA 2D1XA 3FJ5A 1GFDA 1LCKA 2VKNA 1PRLC 2KBTA 1MV0B 2DLPA 1I07A 4FSSA 1AWOA 3I9QA 1N5ZA 4IIMA 1M30A 1ZSGA 2D0NA 2J6FA 1M3CA 3H0HA 4JZ3A 2ECZA 3REBB 1QWEA 1UGVA 2P4RA 3M0TA 1H92A 1GCPA 1IO6A 4RTZA 1PHTA 1AZEA 1JQQA 1X6GA 3TSZA 2BZ8A 2F2VA 3C0CA 4LN2A 1Z9ZA 1G83A 1SHFA 2EVRA 4IIOA 1OV3A 4F17A 2M0YA 1S1NA 2AKLA 1QKWA 1WA7A 4J9GA 2AZSA 3EG3A 1ZBJA 2LNHB 4AG1C 4J9EA 2KRSA 2JT4A 2GBQA 2LX7A 2L0AA 1BK2A 4CC3A 3U23A 2RPNA 2J6KA 2LP5A 2JS0A 1T0HA 1QKXA 1OOTA 1U5SA 1WLPB 2JS2A 1GCQA 2JXBA 4CC2A 2DA9A 1CKAA 2J6OA 2GTOA 4Z8AA 4JJCA 2CSIA 2GGRA 1SRMA 2K2MA 2L3PA 3PVLA 2EGAA 1K9AA 1W1FA 2PNIA 2EGCA 1AEYA 2X3XD 1JO8A 5IHIA 4GLMA 1ABQA 2D8JA 3LH5A 3RBBB 2CT3A 2XMFA 2DL8A 2K3BA 1WYXA 4LNPA 2DJQA 1EFNA 2GTJA 2V1QA 2VWFA 3H0IA 2J7IA 2ABLA 2CT4A 1VYTA 2MOXA 1GRIA 2A28A 1RUWA 4AG2C 1UJYA 1BBZA 1CSKA 3H0FA 1NLPC 2LQWA 5IH2A 3SHWA 4CC7A 1JU5C 1SSHA 2DE0X 2CH4W 2RQTA 2FRYA 3EG1A 1AWXA 2FPEA 1M8MA 1WIEA 1OPLA 1NEBA 2DBMA 1K1ZA 1NYFA 3EHRA 2MIOA 4RUGA 2HBWA 2CSQA 2LZ6B 4J9DA 2K9GA 2KT1A 2LQNA 2RN8A 2EW3A 2A08A 2C0IA 1WFWA 2YUQA 2RQVA 1ARKA 1BB9A 2FPFA 3I35A 1U3OA 1AWJA 2V1RA 1E6GA 4DEYA 2BZXA 1NYGA 1UHFA 2KE9A 3EGUA 4AFUC 2K6DA 3QWYA 4M4ZA 4OMQA 1UJ0A 2RQRA 3EHQA 1H3HA 2BZYA 1GL5A 1ZLMA 2RMOA 3NHNA 2OAWA 2FPDA 5L23A 1J3TA 1E6HA 1K0XA 1HD3A 3M0RA 4OMLA 1CKBA 1PNJA 1WX6A 2YUOA 1FYNA 2I0NA 1TUDA 2DL7A 1X2QA 1V1CA 1Z9QA 2KROA 4JZ4A 4RTWA 3M0PA 1JXMA 2EQIA 2HDAA 2O2OA 2NUZA 3EG2A 1VYVA 2JMAA 4KRTA 1YP5A 2DL3A 4ESRA 2DX1A 4JJDA 4HCKA 2O9VA 2KEAA 1NLOC 1KFZA 2CH4A 4F14A 2JM8A 1WI7A 3VS0A 2CREA 2FRWA 2E5KA 1AD5A 2HEQA 3M0QA 4AFSC 5EC7A 2HCKA 2LJ0A 1PKTA 5FWCA 1FMKA 4EIKA 2KT8A 1RLQC 1HJDA 2SEMA 1MV3A 2KR3A 2ED0A 1T3SA 1YCSB 2KYMA 3TVTA 3NPFA 2F2WA 1JEGA 3REAB 3NGPA 2QDLA 4D8DA 2EYYA 2F2XA 4K11A 3UA7A 1X2KA 1UUEA 2A37A 1B3QA 1UHCA 2ROTA 2O88A 3PE0A 1K4US 3UA6A 1OPKA 4RTXA 2YUPA 1U06A 3VS4A 2D8HA 2JM9A 2EPDA 1HSQA 3ZL7C 1K0SA 4J9BA 4JJBA 1SHGA 2DVJA 3IQLA 2O9SA 4RTUA 2EYZA 3O5ZA 2IIMA 3JV3A 4HVVA 4ZNXA 2EKHA 3PVQA 2DF6A 1ZX6A 3M0UA 3TSWA 1I1JA 2CUDA 1SRLA 1A0NB 2C0TA 3THKA 2H8HA 2SRCA 4LUDA 1X43A 2YT6A 2YSQA 1UECA 4Z89A 1UDLA 1G2BA 2FEIA 1VYUA 2EYWA 2L3QA 1I0CA 1WDXA 2C0OA 1UFFA 1ABOA 1YWOA 3R6NA 4AFQC 4ORZA 2LJ3A 2NWMA 1W6XA 2DMOA 2EGEA 2PTKA 2CUBA 4DEXA 2K7AA 2PZ1A 2X3WD 1QCFA
chains in the Genus database with same CATH superfamily
1RAIB 2PU9B 5KE3A 1VQPQ 2RF0A 1P92A 1PM3A 1AOJA 2KRNA 4HVUA 5DM7R 4J9FA 5A2QE 1TU0B 2KRMA 1M1KU 3OW2A 1Y57A 2D9TA 2RO0A 4FW1A 2LMJA 3HRSA 3JB9H 4MZPA 4PJJA 3PIPA 4J7FA 5FU7B 2AK5A 1ZSZC 1RI0A 1D1BA 4R55A 3SD4A 1ZA2B 3GPLA 1PWTA 1M27C 3I5SA 3CCRA 1JJ2P 1I81A 1NEGA 1PRMC 1B34A 1TH7A 3PIOA 3M59A 1X69A 1VQMT 3M4YA 3RMQA 4V2SA 2DTOA 2KNBB 2KXCA 1V29B 2DNUA 1AT1B 2PVOB 2HSPA 3BFMA 5IHKA 3UATA 1M8VA 4OB1B 3CD6Q 3Q1JA 3SEMA 2ENMA 4EMKC 1Q82R 4RKUE 3RKYA 4ZN3A 2BE7D 4MMLA 5FWBA 1UE9A 3INZA 3GNGA 3E19A 2RQUA 3TCJA 2YDLA 5LJ5d 2EBPA 3WVDB 2DBKA 2XK0A 3TQ7P 1BU1A 5D6XA 3MJXA 3E2UA 1RL2A 1Y71A 4M78G 3CQTA 2AZVA 3CCRT 3VKIA 3L2UA 4XTZA 1Y07A 2QASA 2FG0A 9ATCB 3VS1A 4M77C 3VUBA 3OYDA 4E6RA 1OI1A 3QWXX 4XTWA 3VRZA 1HYOA 1M3BA 2QTXA 1E7OA 1K73C 3OBYA 3JCMd 2OAUA 4PLLA 1WPYA 1RAAB 8ATCB 1BCMA 1RLPC 1WXTA 1XOVA 4WCIA 4FM4B 4ZTJA 4RTVA 4HA8A 3LW5E 3OYLA 4AMCA 2ED1A 4QVCA 4F7UE 3S3OA 2NUPB 4GBQA 1JBMA 2DM1A 4OMNA 3QXEB 1WXUA 4M75G 1ZSZA 4FYWB 1PD0A 3JB9J 3G1JA 2QK0A 3ZBDA 1VA7A 1KQ1A 2D1XA 3G7ZA 3OYYA 2MF2A 1M1KR 5CKDA 4KUIA 4X34A 4LDXA 1XNIA 1AWOA 3HP9A 4BI3A 1N5ZA 1QVGS 4Y28E 2E64A 2E3IA 3I56Q 1M3CA 2QXFA 3GIBA 1WZOA 4O6JA 4XTYA 1VQ9Q 2P4RA 3NFCA 3JCMX 4M77F 3JCMP 4EMKA 1QMCA 2DEUA 1BIAA 3J7AF 1JQQA 4C8QG 2BZ8A 5GAMe 4M7DD 1SHFA 5GAN8 4C0FA 3KUFA 3EFOA 2VGMA 2LRQA 3OS0A 3CMAA 1S1NA 2AKLA 1KHIA 5I2SA 2AZSA 2CP0A 4E2FB 1ZBJA 2EQKA 2R5AA 4DBQA 1XQHA 4E7LA 3M56A 2JT4A 1Y96B 2DXCA 2GBQA 2MYSA 1VQ5T 1KK7A 1Y7XA 2HKQB 2RPNA 3MP1A 2J6KA 4M7AB 3GP8A 1IXDA 4M77A 2Y4YA 4C0ZA 2JXBA 3EFRA 1JJ2A 2J6OA 4PLIA 4JJCA 5KYWB 2VB6A 2DYIA 2CSIA 2L3PA 3PVLA 4D6WA 1W1FA 2H3EB 1AEYA 3RUXA 2K4YA 2A3LA 3OYNA 1Q82C 1WJSA 2XMFA 1MHNA 4HCBA 3CMAT 3SWNA 2XIDA 1EFNA 2V1QA 3H0IA 1EZZB 3VYHB 2ABLA 2CT4A 3L2WA 3M55A 1GRIA 2EYQA 3R6OA 3HHTB 1ZHIA 1BBZA 1CSKA 4PL6A 1RADB 1WHHA 3H0FA 1NLPC 1RABB 3EGXB 1JU5C 5EG2A 1SSHA 5CKEA 2CH4W 2K5FA 2RQTA 3EG1A 1H641 1MNDA 1NEBA 1R0BG 2JNGA 4RUGA 2CSQA 3CC7A 1YI2A 5L8RE 4PFOA 2EW3A 2X9HA 5J39A 4VUBA 2OX7A 2GFUA 1BI1A 2FPFA 4OGCA 4M78E 2QI2A 1U3OA 5HY6A 2EJ9A 5LJ3h 1Q81C 3MCAB 1E6GA 3CCLQ 5FU6C 4ZN1A 1QQJA 2M02A 2JTFA 2K6DA 4EMGA 1C0MA 1UJ0A 1H3HA 5GAOp 1YBYA 1GL5A 1SF9A 4R56A 5KYXA 4C92F 1J3TA 1DJ7B 1D0XA 3M0RA 5IN1A 5LJ5e 4M78C 4OMLA 2FB7A 5FLXE 3CCMQ 2I0NA 3OYMA 1TUDA 2EJGA 2DL7A 1X2QA 2GF7A 2D6FA 3CC7T 1X6OA 1PSFA 3QDRB 1OU9A 3M0PA 3J81E 1JXMA 1NJIU 1UGSB 2EQIA 4M75E 3NTIA 3CCEQ 2O2OA 1TXQA 1VYVA 3G71A 4C5IA 3GOXA 3S6WA 3CBOA 4J8OA 4CI0C 3JCMe 1YP5A 4PNOA 1UGQB 4ESRA 3OY9A 3CPWS 2D0QB 4BE1A 4II1A 4FSXA 5CIUA 2QEXA 2CH4A 4AFSC 1Q7YR 5FWCA 4FT2A 1OULA 4PJLA 4QQGA 4XTUA 3FEOA 2RHZA 3TVTA 3NPFA 1SG5A 3NGPA 2QDLA 2EYYA 4C8QE 3G4SA 2DXBA 2YRVA 4C0DB 2QG9B 3MEWA 4WF2A 2E3HA 4UC4A 4JRQA 5A0GA 2XDPA 3OMGA 1MMAA 3H9NA 1OPKA 4M75B 3G71T 1FMWA 4KH0B 6AT1B 1FXXA 3QPHA 2E6ZA 2JM9A 3CCVA 3CXCS 2MPXC 3T9NA 4JJBA 5CKBA 2QEXT 2EYZA 3JB9D 2K5LA 3JV3A 5GANj 4HVVA 5KE2A 1ZX6A 3M0UA 1I1JA 3OA6A 1BIBA 4DA4A 2KVQG 2YSQA 3I55A 1G2BA 2EYWA 2L3QA 1I0CA 2C0OA 3G4ST 1U1SA 5GMKm 1ABOA 1QVFS 4C8QB 4ZGJB 3C94A 4X9DA 2COWA 2H3JA 5LJ3f 1N8RR 5GAN4 3PMTA 2I2LA 2PZ1A 3HPWA 2JVVA 4L59A 3OW2S 3KFVA 4F16A 2GQIA 2HMAA 1IHVA 1QP3A 5GMKl 1VQ6Q 4M77G 3EH2A 1QCOA 3PNWC 2DL5A 2OTJA 4PK4A 1TUGB 2COYA 1YJ9Q 2QAZA 3URGA 3CMET 2J05A 3MP8A 1VQKA 3H6ZA 2K57A 2DIQA 3I55T 3M57A 1ZUKA 1IHWA 3MEVA 1ZA1B 4RTYA 4ELYC 2FZGB 2A36A 3X26B 4PJOB 3MP6A 3OYEA 1GFCA 1D1CA 3L2ZA 4X9CA 4E7ZA 3HFOA 3EG0A 4C92D 1VQOQ 2HBPA 3V7SA 4NL2A 3VRYA 1W70A 5GJVB 1KC8U 5HCKA 3MEAA 2HAXA 1ZUYA 1O75A 3TREA 3RNJA 1X6BA 3MPUB 2VXEA 5LJ3d 4JS4A 4OF1A 4DOVA 4LDVA 3UF4A 2RK1A 2OTJT 1JRIA 2G6FX 1VQKT 4EPCA 2W0ZA 1ZUUA 1OQKA 3GBQA 2XG8D 3FJPA 1NM7A 2L2PA 4ATOA 2YRCA 4DBRA 1Q7YC 2W10A 3OYFA 2KK4A 2P84A 3ASKA 1AWWA 3QKJA 5LJ5g 3LWHA 3J80E 2DFUA 2AT1B 2CP5A 1Q86U 2M0OA 2VXFA 2CZ1B 5CR2A 2DRMA 1MGQA 2EQUA 2WSFE 4BD3A 1N27A 3RERA 3V8JA 1TWBA 4IUVA 2FYKA 2BIVA 3ULRB 1WHGA 1NBEB 1JXOA 2DRKA 1OYXA 2RJDA 3ZEHA 1OZ2A 2ZPBB 3CCJQ 3S3NA 1SPKA 2CDTA 2KXDA 1SEMA 2LX9A 2KYBA 2KGTA 2RHIA 5IXBA 3H41A 4OMMA 4XU0A 2M51A 1SSFA 3E1SA 4QVZA 2EFIA 2KI7A 1VQMA 4OB3B 4M7DF 3CBPA 5GJWB 2EKOA 4FYYB 2GNCA 1C6VX 2KY9A 1VQPT 3A8GB 4A63B 4JPBW 3VS5A 2DERA 3CD6A 4A4GA 1BKBA 1M3AA 1R8OB 2JTMA 2LC4A 4BY6B 5J3BA 4C92G 1GFDA 3HKSA 5GMKh 1OZ3A 1MMGA 1MV0B 2MAMA 2DLPA 1VQ8Q 3PMIA 4FSSA 3UDCA 4L6V5 1M30A 2D0NA 2J6FA 1N8RC 3H0HA 4DBFA 3REBB 1QWEA 2VUBA 8AT1B 3M0TA 1MMDA 3QYGB 4M7DA 1H92A 1IO6A 4NL3A 1AZEA 3BE3A 2DTHA 2EVRA 2L89A 1OV3A 3DB4A 1KC8R 2E4HA 4J9GA 2DVEA 3EG3A 2LNHB 3CD6T 4B9XA 3OS1A 1ZSZB 5FRNA 3FC3A 2LQKA 3RIRA 3A1PA 2O4XA 5GANf 1WNLA 2LX7A 2CP6A 1BK2A 1JJ2S 4ME7A 4CC3A 2CP7A 2BE9B 4QQDA 1T0HA 1QKXA 1OOTA 1WLPB 4M77E 2JS2A 3OSVA 4CC2A 4JDSA 4Y91A 1C1AA 2KQWA 2NYSA 5KYYA 4N4GA 2CYZB 1YIJQ 2CS7A 1VQ4A 2ATCB 1PG5B 5IHIA 2CZ7B 4PFZA 3D7SB 4EMKB 1Q86R 2DJQA 3C12A 2FVUA 3EG9A 2VWFA 1RAGB 3EFOB 2EQMA 5CKHA 3I56A 2A28A 2R57A 3FIFA 3JAME 4ZGEB 1VQ9A 4KULA 3M58A 1RACB 2LQWA 5IH2A 4CC7A 5IT9E 1QP2A 2DD5A 3CCRQ 2LQ8A 7AT1B 2FRYA 2ZGWA 2FPEA 3META 5GANd 1OPLA 4IURA 4M77B 3SWNC 1NYFA 2DK3A 2HBWA 2LZ6B 1VQ4T 1BI3A 4KH1B 1W2BP 1VQNQ 5DLQE 1BCOA 3V7CA 3A5ZB 4ZTFA 2EJFA 2YUQA 2RQVA 2XD0A 2CZ0B 1ARKA 1AWJA 4PJOD 2RH2A 1I4K1 2V1RA 2RI2A 1VQ5A 5GAOr 5KCOA 3SB2A 3I56T 1UHFA 5LJ3e 3QWYA 2QQBA 3EHQA 1VQ9T 1ZLMA 2RMOA 2VV5A 1K0XA 5CVIA 5GAN7 3QO3A 4ANJA 4F7UB 3EAEA 4B9WA 2EAYA 1Z9QA 1RAEB 4A4FA 1G8XA 4RTWA 5KYNA 2DO3A 3G6EA 1K8AU 4GY5A 5I21A 1G3TA 4LDYA 4C92E 5HK0A 3AT1B 1KFZA 2MMPA 4F14A 2JM8A 1SKUB 3VS0A 2CREA 2V8JA 2RD1A 2E5KA 1AD5A 2HEQA 2M9UA 3M0QA 2JN0A 2HCKA 2JUFA 1FMKA 3JB9F 5I2MA 1KD1U 1MV3A 2KR3A 2IVWA 2ED0A 5KYXB 3CCSA 2CP2A 2XICA 1K9MU 5CK9A 1YCSB 1BYMA 3M5AA 1FMVA 2LCCA 2AIRB 1IRXA 1JEGA 3OYCA 4C92C 3OQ5A 2YRDA 2LDMA 2KDSA 2ZPGB 3UA7A 4PJMA 1UUEA 2A37A 4EMHA 3O8VA 5GAMj 2XDDA 3G6ET 1U06A 3JCMW 4A4HA 1NZ9A 1HSQA 3ZL7C 3CCMA 2QDYB 3IQLA 1NPRA 1Q86C 2IIMA 4JLIA 3AHUA 3CMAQ 1VIFA 1N6AA 3NTKA 1VOMA 5KYUA 4M7AF 3X28B 2CUDA 3LLRA 1SRLA 3RESA 2C0TA 3CCST 4M7DG 3CCEA 4LUDA 1UB4A 4J6YA 4QKUA 1M90U 4C5HA 1VQ7A 1G5VA 1UECA 2LCLA 4Z89A 4DBHA 3C4SA 1WDXA 3BW1A 3PFSA 2QA4A 4FL6A 2HQXA 1YWOA 3R6NA 2NWMA 4E7JA 4TVRA 3L2VA 3MHXA 1Y96A 2X3WD 4JRPA 4PJNA 1W2BA 4BE2A 3CCMT 2DPPB 4N4HA 1LJOA 4Y92A 4LE9A 3VS7A 4RG2A 3CCUQ 1YN8A 5KCHA 1YFNA 1M1KC 2RB6A 5KYWA 5FU6B 1K76A 2LJ1A 1YHQQ 3CCET 1VQ7T 1TUCA 1X27A 2E1HA 2DAQA 1OEBA 2QA4T 1KG1A 3ER0A 4M78B 3ZFJA 2VVKA 4C92A 1WHLA 2JJ9A 2HZYA 2E6NA 1FWZA 5D6YA 3VJPA 3CPWP 2PQWA 1KQSP 4BI4A 3I5RA 5GAN2 1T0JA 5GAOq 4QT7A 3CC7Q 4FYVB 1YI2Q 3DLLA 3QYHB 2FHDA 5FRMA 1Y0MA 4LUEA 1UTIA 4A4EA 1K9MR 3OYIA 2AHJB 2AKKA 2Y90A 2J06A 2VASA 1YJNA 2DL4A 2ROLA 5LJ5j 3X24B 2LCSA 2ESWA 1RI9A 5J26A 4Q5WA 4QVDA 1G3YA 2DKGA 1VQ6A 5FW9A 2GCXA 4J9CA 3QBYA 4HVWA 3PT9A 2HL3A 2DXTA 2P4TA 1WXBA 1OU8A 5GAMg 1YJ9A 4HCCA 4AFZC 2RNAA 2A0FB 4KGXB 2A7YA 3UWNA 1K73U 1KJWA 4XK8E 1M90R 4JRIA 2FO0A 2OTLA 3CMEA 5CKFA 2OJ2A 1KSWA 3GNFB 2PVDB 3G71Q 1U8RA 2MK5A 3A8MB 4OMPA 1YITA 3JCMQ 3L42A 5ECAA 1YJNT 4J9IA 3VS2A 2QEXQ 3A8OB 2OI3A 1G3WA 3FDRA 1WHJA 1YNZA 5CQXA 1VQOA 1PSEA 4HT8A 2BUDA 2RJCA 1KIKA 1X01A 1YJWA 3CC4A 3QZ9B 2DTIA 2DYBA 3OBWA 3VS3A 1VQ6T 2VGNA 3OW2P 4MDXA 3OYBA 4MDWA 3CC2Q 1YJ9T 2DJZA 2FZCB 4M7AD 1I07A 3G4SQ 3CCQQ 4M75F 4FU6A 4MZTA 1QVPA 5GMKe 1ZSGA 4KT0E 5DLOA 2OTLT 1NJIR 1BI2A 4JZ3A 1TOVA 1LVKA 3RDVA 1GXIE 5GAN6 3N5BB 2QYZA 1GCPA 3CCVQ 1YITT 4RTZA 4M7DE 1PHTA 5A0LA 1X75C 1X6GA 3TSZA 2F2VA 3C0CA 4LN2A 3BY7A 4NS5A 1Z9ZA 1G83A 2L8DA 2LNVA 1XJWB 5GAMf 1M1GA 1VQOT 2K5IA 4IIOA 3WXMB 4BB7A 2M0YA 1QKWA 5GANh 2R5MA 1WA7A 3CC4T 1YJWT 4AG1C 3RKXA 4J9EA 2NUTB 2KRSA 2L5QA 5DY9A 2MWPA 3BDUA 1KHCA 3JB9G 3I55Q 2K2VA 4M7DC 1VQLA 3L2RA 4PFPA 1IZ6A 2LP5A 2JS0A 3JRZA 3A8LB 2MWOA 2DA9A 1HXDA 1UGRB 5GAOm 2FZKB 2K2MA 2LVMA 4HCZA 2EGAA 1S72Q 1QW1A 2PNIA 1KQSA 2X3XD 3TU4K 4GLMA 1ABQA 2D8JA 4AT1B 1VQPA 3LH5A 3RBBB 3FRNA 2DL8A 4LNPA 2ZPEB 2DD4A 3QUIA 2E41A 4OGEA 3M4GA 1B34B 1ACMB 2GTJA 3GF5A 1VYTA 3EGDA 4N4IA 4PJOF 2MOXA 5LL6S 2EQJA 2B8AA 1VQKQ 4JUVA 2F69A 4AG2C 2P0PA 4FW2A 4M7AG 1AHJB 4KGZB 1VQLT 4XU1A 4XQ3A 2QQAA 3H8ZA 4WTOB 1WQWA 4YTLA 1M8MA 3JCMg 2DBMA 1K1ZA 3EHRA 4J9DA 2X4WA 3OB9A 5KYYB 2LQNA 3EFSA 2A08A 2C0IA 4FCYA 1WFWA 1M90C 4PJOA 2RI5A 2RJEA 1BB9A 5HK3A 3PGGA 1I5LA 3I35A 3M53A 3CPFA 2VC8A 5CCAA 1Q81U 3QG1A 4DEYA 2KMTA 3V8LA 3F70A 3EG9B 3EGUA 2KE9A 4AFUC 4M4ZA 2G3RA 2RQRA 5FU7C 4LDUA 3NHNA 1D3BA 1EX4A 2OAWA 2FPDA 5L23A 4C5GA 4HKEA 1HD3A 3QDFA 5LJ5f 1CKBA 4PKCC 2HQEA 1PNJA 1WX6A 1FYNA 5GMKi 1M2VA 1KQ2A 1V1CA 2RHYA 2GFAA 1M1FA 4OP0A 2KROA 1NJIC 1O9SA 3MO8A 2HDAA 2E10A 2NUZA 3RMSA 4RCBA 4M75D 2PVGB 4KRTA 3DLMA 2HD0A 2E5QA 4F04B 2YWWA 2DL3A 3JCMf 2DX1A 5D6WA 2O9VA 2KEAA 2DETA 1YIJT 2CP3A 4IUPA 3MKDA 1VQMQ 1VQNA 2X4JA 5EC7A 2LJ0A 2X35A 3OYJA 1RLQC 1T3SA 4IUUA 1WQ7A 4P5NA 4D8DA 1LNXA 1WHMA 1X2KA 4C8QD 5GAOn 4J5YA 3JCMV 1UHCA 2ROTA 5AT1B 2O88A 1W4SA 4RTXA 2YUPA 3P8HA 2NLUA 3VS4A 3S3MA 2D8HA 2YLBA 3RR6A 3LH0A 3QZ5B 2HKNA 3ME9A 3QIIA 1SHGA 2DVJA 2O9SA 4RTUA 4KUDK 2RA2A 3KBGA 1BI0A 1VQNT 4RCCA 4ZNXA 3PTAA 3V7RA 4JS5A 3TSWA 4J6XA 4C0GA 2C06A 3THKA 4KGVB 4OMFB 4FYXB 2YT6A 2IPOB 1UDLA 4J6WA 1Q81R 2IG0A 1UFFA 4A4KA 1N9SA 3HSBA 4ORZA 1FX7A 2QTVA 3RKWA 3SWNB 1W2BS 2DMOA 2QQRA 1QVGP 2V8KA 3HTRA 3QJ6A 4QW2A 4DEXA 1VQ4Q 2K7AA 1M9SA 2JMCA 4CRIA 1F1BB 5IHNA 5D7UA 4M7AE 1LPLA 1XTDA 2K3YA 3M0SA 4J9HA 4Z88A 1NG2A 4LXCA 5KYUB 1GBRA 2HNIA 2XDBA 3A8HB 2DZ9A 3X20B 3HRUA 3JB9I 1IB8A 1QLYA 2B86A 4CC4B 4M7AC 1GBQA 2V26A 2DXUA 1NPPA 1TG0A 1QWFA 2JTEA 2F5TX 2E65A 5HKCA 2WSCE 3FLGA 1KC8C 5I11A 2RHUA 2Y4XA 1AVZC 3NMZC 4HXJA 5I22A 1UEBA 3OYGA 4OMOA 5LJ3j 4E7SA 1AZGB 4R0KA 3A98A 2JW4A 2NUPA 3CCLA 1VQ5Q 2HL5C 3DB3A 2LT1A 2XU8A 1H8KA 1PD1A 1WJQA 2CZ6B 4ZGDB 4PJOG 1Q95G 1Q7YU 1VIEA 4MMKA 4F7UF 3JCMJ 3CCUA 1B7TA 2X4XA 3OS2A 2O31A 2WSEE 1D0YA 2ZPHB 4C92B 3MEUA 4D8KA 3QHSA 1GCQC 5IXFA 3P8DA 1YHQA 3EH1A 5C0MA 2MCNA 3VV0A 3WVEB 1WHKA 1T3LA 2DILA 2L3SA 4NOYA 2K79A 2CKKA 2YUNA 2DEQA 2RK2A 4QQ6A 3UPUA 1YWPA 3G6EQ 5IAYA 2XHCA 4MZMA 3VU3C 3CCLT 1QCNA 3JCMc 4F7UA 2COZA 2BTTA 2RQWA 3VS6A 4RTTA 3M54A 4FIBA 3OMCA 1MUZA 1I5OB 2LT4A 2KSSA 4X1VA 5CQYA 1PKSA 1UG1A 1B07A 1IREB 2EYXA 3CCUT 1HK9A 1IGUA 2F5KA 3FJ5A 3CCSQ 4M7AA 5GAN3 1LCKA 3L1AA 2VKNA 1U1TA 1PRLC 2KBTA 1LOJA 2XKOC 4J83A 3I9QA 1YHQT 4IIMA 3OSSC 4KBMB 2QGFB 1N8RU 2ECZA 1UGVA 2YHTA 5GAMh 1QVGA 2QQ9A 1K8AR 4XTVA 1M5Q1 4HT9A 4DOWA 2YLCA 2VYTA 4N0AC 4XTXA 4JJNK 1IGQA 4F17A 1YI2T 2V8IA 1N9RA 1RAHB 3JSCA 1PC0A 2K3XA 4IUQA 1KD1R 2M1HA 2ZZDA 5GANe 3EGXA 1VQ7Q 2L0AA 2L3RA 2PUKB 3E9FA 4LD6A 1M2OA 3BDLA 3U23A 2QA4Q 1MMNA 3LGLA 1OX8A 2QGGA 3NTHA 1NE8A 1U5SA 1KQSS 1GCQA 1CKAA 4C0DC 2GTOA 4Z8AA 4XU3A 5CAIA 4M77D 1RAFB 2GGRA 1SRMA 3FB9A 5LJ3g 1K9AA 4BUGA 2EGCA 4IKFA 2Z0WA 4L5GA 2P0KA 4M75C 1JO8A 1TTHB 3HFNA 1WGSA 2E70A 4Z02A 2CT3A 3CXCP 3CC2A 2K3BA 1WYXA 3CCQA 2J7IA 3E9GA 2ZAEA 4M78F 5AYFA 4GLKA 1RUWA 1UJYA 1D0ZA 4J7IA 1MNEA 1M4ZA 2M16A 3SHWA 3LWIA 2DE0X 2JZ2A 5CO7A 1VUBA 1AWXA 4C8QC 1WIEA 2EWNA 1QVFP 2MIOA 2K9GA 2KT1A 2E12A 2CGHA 2RN8A 2ZCFB 2R58A 4M78A 4PJOE 3CC2T 1D1AA 3CCQT 4N0AA 1JB0E 2BZXA 3KXTA 1ZBXA 3LGFA 1NYGA 1OX9A 1YJNQ 4OMQA 4JLGA 3EGDB 2RHXA 5LJ5h 2BZYA 1S72A 3HRTA 3CCVT 4RG8A 2PUOB 1TSFA 3SDZA 1E6HA 4BE0A 1TS9A 4PJOC 2YUOA 1V76A 4E47A 3OYHA 5M9OA 2X4YA 2DIGA 4C5EA 4BACA 3P8BB 3OYKA 2XI9A 3JCMb 3CBMA 3M9QA 4JZ4A 4M75A 1EIFA 2OTLQ 3CMEQ 3VYGA 2O01E 3JCMh 4C8QF 3EG2A 2JMAA 1ZQ1A 4EDUA 1K8AC 3OS5A 4E7HA 3QSUA 3CCJA 1H3ZA 1YITQ 4A53A 4JJDA 4HCKA 1NLOC 4IUTA 1D09B 4B6MA 1WI7A 2HSEB 2FRWA 4LDWA 1S72T 2RM4A 2FL7A 2RJFA 1I8FA 1PKTA 1YJWQ 3CC4Q 4EIKA 3CPWA 2KT8A 3LX7A 1KD1C 1HJDA 2SEMA 4O5VA 4OVAA 1D3BB 1PCXA 3GLXA 1K9MC 5GMKj 2KYMA 4F7UG 4M7DB 2F2WA 3QJYA 3REAB 3SFMA 4C8QA 3OYAA 1Q82U 2RI3A 1VQ8A 4LD9K 2ZPFB 2F2XA 1M2VB 5GAN5 4K11A 2OTJQ 1WJRA 5FROA 2JOYA 1R0CB 5GAOl 1B3QA 3L2QA 4FT4A 1K73R 2DZCA 3C95A 4BDZA 5GAMd 2MI6A 4ELZC 3PE0A 4XAXB 1K4US 3UA6A 3LYIA 4RMOA 3CCJT 2GQVA 3HL8A 2EPDA 2HQHA 2O4XB 5KH6A 2F1LA 1K0SA 4J9BA 3TEEA 2EIFA 3O5ZA 2P0QA 4JRKA 3CXCA 1G3SA 5C6SA 2EKHA 3PVQA 4OB0B 2QQSA 2DF6A 2X51A 4E7KA 1A0NB 2BKDN 4BDYA 1R77A 4OB2B 2H8HA 2SRCA 1X43A 4E7IA 4BY6C 5GANg 2FEIA 1YCYA 1VYUA 4XU2A 3X25B 5A0DA 2KAFA 1VQLQ 4BI8B 1VQ8T 3DKMA 1UGPB 4A54A 3VUZA 4M78D 3CEYA 4AFQC 2LJ3A 1W6XA 2NUTA 2EGEA 3V8KA 2PTKA 2CUBA 2WACA 1YIJA 2LTOA 1QVFA 3UT1A 2ZPIB 2YXYA 1QCFA 4DQ2A
chains in the Genus database with same CATH topology
2JMCA 3KFVA 4F16A 2GQIA 2RF0A 5IHNA 4Y92A 1AOJA 4LE9A 2KRNA 3VS7A 4HVUA 4J9FA 1YN8A 2KRMA 3M0SA 4Z88A 4J9HA 2DL5A 1Y57A 2LMJA 1K76A 1NG2A 2J05A 2LJ1A 2AK5A 1GBRA 1ZUKA 1TUCA 1X27A 1OEBA 1PWTA 4RTYA 2A36A 1QLYA 2B86A 1M27C 3I5SA 4CC4B 1GBQA 1GFCA 1NEGA 1PRMC 2VVKA 1TG0A 1X69A 1QWFA 2JTEA 3EG0A 3I5RA 1T0JA 3VRYA 1W70A 2KNBB 4QT7A 2KXCA 5GJVB 5HCKA 2DNUA 5I11A 1Y0MA 4LUEA 1UTIA 1AVZC 2HSPA 1ZUYA 3RNJA 3NMZC 4HXJA 1X6BA 5IHKA 3UATA 5I22A 2AKKA 4OMOA 2ENMA 3SEMA 1AZGB 4R0KA 3UF4A 2J06A 3A98A 2JW4A 5FWBA 2G6FX 1UE9A 2RQUA 2YDLA 2EBPA 2DL4A 2ROLA 1ZUUA 2W0ZA 3GBQA 2DBKA 1H8KA 1NM7A 2L2PA 1BU1A 2LCSA 2W10A 2ESWA 1RI9A 3CQTA 2AZVA 1AWWA 5FW9A 2FG0A 4J9CA 2O31A 4HVWA 3VS1A 1WXBA 4D8KA 2DRMA 4E6RA 1GCQC 3QWXX 4AFZC 5IXFA 3VRZA 2RNAA 1M3BA 2MCNA 1E7OA 1KJWA 1T3LA 2DILA 2FO0A 3ULRB 2L3SA 2K79A 1JXOA 2OJ2A 2YUNA 1KSWA 1RLPC 1WXTA 1YWPA 2DRKA 1XOVA 4WCIA 1SPKA 4RTVA 2CDTA 2KXDA 4OMPA 1SEMA 2ED1A 2KYBA 2KGTA 5ECAA 5IXBA 3H41A 4J9IA 4OMMA 2M51A 3VS2A 2OI3A 2BTTA 1YNZA 2RQWA 4GBQA 3VS6A 2DM1A 4RTTA 4OMNA 1MUZA 1WXUA 5GJWB 4X1VA 1KIKA 1PKSA 1UG1A 2GNCA 1B07A 4A63B 2DYBA 2EYXA 4JPBW 3VS3A 3VS5A 1VA7A 1M3AA 2D1XA 3FJ5A 1GFDA 1LCKA 2VKNA 1PRLC 2KBTA 1MV0B 2DLPA 1I07A 4FSSA 1AWOA 3I9QA 1N5ZA 4IIMA 1M30A 1ZSGA 2D0NA 2J6FA 1M3CA 3H0HA 4JZ3A 2ECZA 3REBB 1QWEA 1UGVA 2P4RA 3M0TA 1H92A 1GCPA 1IO6A 4RTZA 1PHTA 1AZEA 1JQQA 1X6GA 3TSZA 2BZ8A 2F2VA 3C0CA 4LN2A 1Z9ZA 1G83A 1SHFA 2EVRA 4IIOA 1OV3A 4F17A 2M0YA 1S1NA 2AKLA 1QKWA 1WA7A 4J9GA 2AZSA 3EG3A 1ZBJA 2LNHB 4AG1C 4J9EA 2KRSA 2JT4A 2GBQA 2LX7A 2L0AA 1BK2A 4CC3A 3U23A 2RPNA 2J6KA 2LP5A 2JS0A 1T0HA 1QKXA 1OOTA 1U5SA 1WLPB 2JS2A 1GCQA 2JXBA 4CC2A 2DA9A 1CKAA 2J6OA 2GTOA 4Z8AA 4JJCA 2CSIA 2GGRA 1SRMA 2K2MA 2L3PA 3PVLA 2EGAA 1K9AA 1W1FA 2PNIA 2EGCA 1AEYA 2X3XD 1JO8A 5IHIA 4GLMA 1ABQA 2D8JA 3LH5A 3RBBB 2CT3A 2XMFA 2DL8A 2K3BA 1WYXA 4LNPA 2DJQA 1EFNA 2GTJA 2V1QA 2VWFA 3H0IA 2J7IA 2ABLA 2CT4A 1VYTA 2MOXA 1GRIA 2A28A 1RUWA 4AG2C 1UJYA 1BBZA 1CSKA 3H0FA 1NLPC 2LQWA 5IH2A 3SHWA 4CC7A 1JU5C 1SSHA 2DE0X 2CH4W 2RQTA 2FRYA 3EG1A 1AWXA 2FPEA 1M8MA 1WIEA 1OPLA 1NEBA 2DBMA 1K1ZA 1NYFA 3EHRA 2MIOA 4RUGA 2HBWA 2CSQA 2LZ6B 4J9DA 2K9GA 2KT1A 2LQNA 2RN8A 2EW3A 2A08A 2C0IA 1WFWA 2YUQA 2RQVA 1ARKA 1BB9A 2FPFA 3I35A 1U3OA 1AWJA 2V1RA 1E6GA 4DEYA 2BZXA 1NYGA 1UHFA 2KE9A 3EGUA 4AFUC 2K6DA 3QWYA 4M4ZA 4OMQA 1UJ0A 2RQRA 3EHQA 1H3HA 2BZYA 1GL5A 1ZLMA 2RMOA 3NHNA 2OAWA 2FPDA 5L23A 1J3TA 1E6HA 1K0XA 1HD3A 3M0RA 4OMLA 1CKBA 1PNJA 1WX6A 2YUOA 1FYNA 2I0NA 1TUDA 2DL7A 1X2QA 1V1CA 1Z9QA 2KROA 4JZ4A 4RTWA 3M0PA 1JXMA 2EQIA 2HDAA 2O2OA 2NUZA 3EG2A 1VYVA 2JMAA 4KRTA 1YP5A 2DL3A 4ESRA 2DX1A 4JJDA 4HCKA 2O9VA 2KEAA 1NLOC 1KFZA 2CH4A 4F14A 2JM8A 1WI7A 3VS0A 2CREA 2FRWA 2E5KA 1AD5A 2HEQA 3M0QA 4AFSC 5EC7A 2HCKA 2LJ0A 1PKTA 5FWCA 1FMKA 4EIKA 2KT8A 1RLQC 1HJDA 2SEMA 1MV3A 2KR3A 2ED0A 1T3SA 1YCSB 2KYMA 3TVTA 3NPFA 2F2WA 1JEGA 3REAB 3NGPA 2QDLA 4D8DA 2EYYA 2F2XA 4K11A 3UA7A 1X2KA 1UUEA 2A37A 1B3QA 1UHCA 2ROTA 2O88A 3PE0A 1K4US 3UA6A 1OPKA 4RTXA 2YUPA 1U06A 3VS4A 2D8HA 2JM9A 2EPDA 1HSQA 3ZL7C 1K0SA 4J9BA 4JJBA 1SHGA 2DVJA 3IQLA 2O9SA 4RTUA 2EYZA 3O5ZA 2IIMA 3JV3A 4HVVA 4ZNXA 2EKHA 3PVQA 2DF6A 1ZX6A 3M0UA 3TSWA 1I1JA 2CUDA 1SRLA 1A0NB 2C0TA 3THKA 2H8HA 2SRCA 4LUDA 1X43A 2YT6A 2YSQA 1UECA 4Z89A 1UDLA 1G2BA 2FEIA 1VYUA 2EYWA 2L3QA 1I0CA 1WDXA 2C0OA 1UFFA 1ABOA 1YWOA 3R6NA 4AFQC 4ORZA 2LJ3A 2NWMA 1W6XA 2DMOA 2EGEA 2PTKA 2CUBA 4DEXA 2K7AA 2PZ1A 2X3WD 1QCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMC A;  3KFV A;  4F16 A;  2GQI A;  2RF0 A;  5IHN A;  4Y92 A;  1AOJ A;  4LE9 A;  2KRN A;  3VS7 A;  4HVU A;  4J9F A;  1YN8 A;  2KRM A;  3M0S A;  4Z88 A;  4J9H A;  2DL5 A;  1Y57 A;  2LMJ A;  1K76 A;  1NG2 A;  2J05 A;  2LJ1 A;  2AK5 A;  1GBR A;  1ZUK A;  1TUC A;  1X27 A;  1OEB A;  1PWT A;  4RTY A;  2A36 A;  1QLY A;  2B86 A;  1M27 C;  3I5S A;  4CC4 B;  1GBQ A;  1GFC A;  1NEG A;  1PRM C;  2VVK A;  1TG0 A;  1X69 A;  1QWF A;  2JTE A;  3EG0 A;  3I5R A;  1T0J A;  3VRY A;  1W70 A;  2KNB B;  4QT7 A;  2KXC A;  5GJV B;  5HCK A;  2DNU A;  5I11 A;  1Y0M A;  4LUE A;  1UTI A;  1AVZ C;  2HSP A;  1ZUY A;  3RNJ A;  3NMZ C;  4HXJ A;  1X6B A;  5IHK A;  3UAT A;  5I22 A;  2AKK A;  4OMO A;  2ENM A;  3SEM A;  1AZG B;  4R0K A;  3UF4 A;  2J06 A;  3A98 A;  2JW4 A;  5FWB A;  2G6F X;  1UE9 A;  2RQU A;  2YDL A;  2EBP A;  2DL4 A;  2ROL A;  1ZUU A;  2W0Z A;  3GBQ A;  2DBK A;  1H8K A;  1NM7 A;  2L2P A;  1BU1 A;  2LCS A;  2W10 A;  2ESW A;  1RI9 A;  3CQT A;  2AZV A;  1AWW A;  5FW9 A;  2FG0 A;  4J9C A;  2O31 A;  4HVW A;  3VS1 A;  1WXB A;  4D8K A;  2DRM A;  4E6R A;  1GCQ C;  3QWX X;  4AFZ C;  5IXF A;  3VRZ A;  2RNA A;  1M3B A;  2MCN A;  1E7O A;  1KJW A;  1T3L A;  2DIL A;  2FO0 A;  3ULR B;  2L3S A;  2K79 A;  1JXO A;  2OJ2 A;  2YUN A;  1KSW A;  1RLP C;  1WXT A;  1YWP A;  2DRK A;  1XOV A;  4WCI A;  1SPK A;  4RTV A;  2CDT A;  2KXD A;  4OMP A;  1SEM A;  2ED1 A;  2KYB A;  2KGT A;  5ECA A;  5IXB A;  3H41 A;  4J9I A;  4OMM A;  2M51 A;  3VS2 A;  2OI3 A;  2BTT A;  1YNZ A;  2RQW A;  4GBQ A;  3VS6 A;  2DM1 A;  4RTT A;  4OMN A;  1MUZ A;  1WXU A;  5GJW B;  4X1V A;  1KIK A;  1PKS A;  1UG1 A;  2GNC A;  1B07 A;  4A63 B;  2DYB A;  2EYX A;  4JPB W;  3VS3 A;  3VS5 A;  1VA7 A;  1M3A A;  2D1X A;  3FJ5 A;  1GFD A;  1LCK A;  2VKN A;  1PRL C;  2KBT A;  1MV0 B;  2DLP A;  1I07 A;  4FSS A;  1AWO A;  3I9Q A;  1N5Z A;  4IIM A;  1M30 A;  1ZSG A;  2D0N A;  2J6F A;  1M3C A;  3H0H A;  4JZ3 A;  2ECZ A;  3REB B;  1QWE A;  1UGV A;  2P4R A;  3M0T A;  1H92 A;  1GCP A;  1IO6 A;  4RTZ A;  1PHT A;  1AZE A;  1JQQ A;  1X6G A;  3TSZ A;  2BZ8 A;  2F2V A;  3C0C A;  4LN2 A;  1Z9Z A;  1G83 A;  1SHF A;  2EVR A;  4IIO A;  1OV3 A;  4F17 A;  2M0Y A;  1S1N A;  2AKL A;  1QKW A;  1WA7 A;  4J9G A;  2AZS A;  3EG3 A;  1ZBJ A;  2LNH B;  4AG1 C;  4J9E A;  2KRS A;  2JT4 A;  2GBQ A;  2LX7 A;  2L0A A;  1BK2 A;  4CC3 A;  3U23 A;  2RPN A;  2J6K A;  2LP5 A;  2JS0 A;  1T0H A;  1QKX A;  1OOT A;  1U5S A;  1WLP B;  2JS2 A;  1GCQ A;  2JXB A;  4CC2 A;  2DA9 A;  1CKA A;  2J6O A;  2GTO A;  4Z8A A;  4JJC A;  2CSI A;  2GGR A;  1SRM A;  2K2M A;  2L3P A;  3PVL A;  2EGA A;  1K9A A;  1W1F A;  2PNI A;  2EGC A;  1AEY A;  2X3X D;  1JO8 A;  5IHI A;  4GLM A;  1ABQ A;  2D8J A;  3LH5 A;  3RBB B;  2CT3 A;  2XMF A;  2DL8 A;  2K3B A;  1WYX A;  4LNP A;  2DJQ A;  1EFN A;  2GTJ A;  2V1Q A;  2VWF A;  3H0I A;  2J7I A;  2ABL A;  2CT4 A;  1VYT A;  2MOX A;  1GRI A;  2A28 A;  1RUW A;  4AG2 C;  1UJY A;  1BBZ A;  1CSK A;  3H0F A;  1NLP C;  2LQW A;  5IH2 A;  3SHW A;  4CC7 A;  1JU5 C;  1SSH A;  2DE0 X;  2CH4 W;  2RQT A;  2FRY A;  3EG1 A;  1AWX A;  2FPE A;  1M8M A;  1WIE A;  1OPL A;  1NEB A;  2DBM A;  1K1Z A;  1NYF A;  3EHR A;  2MIO A;  4RUG A;  2HBW A;  2CSQ A;  2LZ6 B;  4J9D A;  2K9G A;  2KT1 A;  2LQN A;  2RN8 A;  2EW3 A;  2A08 A;  2C0I A;  1WFW A;  2YUQ A;  2RQV A;  1ARK A;  1BB9 A;  2FPF A;  3I35 A;  1U3O A;  1AWJ A;  2V1R A;  1E6G A;  4DEY A;  2BZX A;  1NYG A;  1UHF A;  2KE9 A;  3EGU A;  4AFU C;  2K6D A;  3QWY A;  4M4Z A;  4OMQ A;  1UJ0 A;  2RQR A;  3EHQ A;  1H3H A;  2BZY A;  1GL5 A;  1ZLM A;  2RMO A;  3NHN A;  2OAW A;  2FPD A;  5L23 A;  1J3T A;  1E6H A;  1K0X A;  1HD3 A;  3M0R A;  4OML A;  1CKB A;  1PNJ A;  1WX6 A;  2YUO A;  1FYN A;  2I0N A;  1TUD A;  2DL7 A;  1X2Q A;  1V1C A;  1Z9Q A;  2KRO A;  4JZ4 A;  4RTW A;  3M0P A;  1JXM A;  2EQI A;  2HDA A;  2O2O A;  2NUZ A;  3EG2 A;  1VYV A;  2JMA A;  4KRT A;  1YP5 A;  2DL3 A;  4ESR A;  2DX1 A;  4JJD A;  4HCK A;  2O9V A;  2KEA A;  1NLO C;  1KFZ A;  2CH4 A;  4F14 A;  2JM8 A;  1WI7 A;  3VS0 A;  2CRE A;  2FRW A;  2E5K A;  1AD5 A;  2HEQ A;  3M0Q A;  4AFS C;  5EC7 A;  2HCK A;  2LJ0 A;  1PKT A;  5FWC A;  1FMK A;  4EIK A;  2KT8 A;  1RLQ C;  1HJD A;  2SEM A;  1MV3 A;  2KR3 A;  2ED0 A;  1T3S A;  1YCS B;  2KYM A;  3TVT A;  3NPF A;  2F2W A;  1JEG A;  3REA B;  3NGP A;  2QDL A;  4D8D A;  2EYY A;  2F2X A;  4K11 A;  3UA7 A;  1X2K A;  1UUE A;  2A37 A;  1B3Q A;  1UHC A;  2ROT A;  2O88 A;  3PE0 A;  1K4U S;  3UA6 A;  1OPK A;  4RTX A;  2YUP A;  1U06 A;  3VS4 A;  2D8H A;  2JM9 A;  2EPD A;  1HSQ A;  3ZL7 C;  1K0S A;  4J9B A;  4JJB A;  1SHG A;  2DVJ A;  3IQL A;  2O9S A;  4RTU A;  2EYZ A;  3O5Z A;  2IIM A;  3JV3 A;  4HVV A;  4ZNX A;  2EKH A;  3PVQ A;  2DF6 A;  1ZX6 A;  3M0U A;  3TSW A;  1I1J A;  2CUD A;  1SRL A;  1A0N B;  2C0T A;  3THK A;  2H8H A;  2SRC A;  4LUD A;  1X43 A;  2YT6 A;  2YSQ A;  1UEC A;  4Z89 A;  1UDL A;  1G2B A;  2FEI A;  1VYU A;  2EYW A;  2L3Q A;  1I0C A;  1WDX A;  2C0O A;  1UFF A;  1ABO A;  1YWO A;  3R6N A;  4AFQ C;  4ORZ A;  2LJ3 A;  2NWM A;  1W6X A;  2DMO A;  2EGE A;  2PTK A;  2CUB A;  4DEX A;  2K7A A;  2PZ1 A;  2X3W D;  1QCF A; 
#chains in the Genus database with same CATH topology
 1RAI B;  2PU9 B;  5KE3 A;  1VQP Q;  2RF0 A;  1P92 A;  1PM3 A;  1AOJ A;  2KRN A;  4HVU A;  5DM7 R;  4J9F A;  5A2Q E;  1TU0 B;  2KRM A;  1M1K U;  3OW2 A;  1Y57 A;  2D9T A;  2RO0 A;  4FW1 A;  2LMJ A;  3HRS A;  3JB9 H;  4MZP A;  4PJJ A;  3PIP A;  4J7F A;  5FU7 B;  2AK5 A;  1ZSZ C;  1RI0 A;  1D1B A;  4R55 A;  3SD4 A;  1ZA2 B;  3GPL A;  1PWT A;  1M27 C;  3I5S A;  3CCR A;  1JJ2 P;  1I81 A;  1NEG A;  1PRM C;  1B34 A;  1TH7 A;  3PIO A;  3M59 A;  1X69 A;  1VQM T;  3M4Y A;  3RMQ A;  4V2S A;  2DTO A;  2KNB B;  2KXC A;  1V29 B;  2DNU A;  1AT1 B;  2PVO B;  2HSP A;  3BFM A;  5IHK A;  3UAT A;  1M8V A;  4OB1 B;  3CD6 Q;  3Q1J A;  3SEM A;  2ENM A;  4EMK C;  1Q82 R;  4RKU E;  3RKY A;  4ZN3 A;  2BE7 D;  4MML A;  5FWB A;  1UE9 A;  3INZ A;  3GNG A;  3E19 A;  2RQU A;  3TCJ A;  2YDL A;  5LJ5 d;  2EBP A;  3WVD B;  2DBK A;  2XK0 A;  3TQ7 P;  1BU1 A;  5D6X A;  3MJX A;  3E2U A;  1RL2 A;  1Y71 A;  4M78 G;  3CQT A;  2AZV A;  3CCR T;  3VKI A;  3L2U A;  4XTZ A;  1Y07 A;  2QAS A;  2FG0 A;  9ATC B;  3VS1 A;  4M77 C;  3VUB A;  3OYD A;  4E6R A;  1OI1 A;  3QWX X;  4XTW A;  3VRZ A;  1HYO A;  1M3B A;  2QTX A;  1E7O A;  1K73 C;  3OBY A;  3JCM d;  2OAU A;  4PLL A;  1WPY A;  1RAA B;  8ATC B;  1BCM A;  1RLP C;  1WXT A;  1XOV A;  4WCI A;  4FM4 B;  4ZTJ A;  4RTV A;  4HA8 A;  3LW5 E;  3OYL A;  4AMC A;  2ED1 A;  4QVC A;  4F7U E;  3S3O A;  2NUP B;  4GBQ A;  1JBM A;  2DM1 A;  4OMN A;  3QXE B;  1WXU A;  4M75 G;  1ZSZ A;  4FYW B;  1PD0 A;  3JB9 J;  3G1J A;  2QK0 A;  3ZBD A;  1VA7 A;  1KQ1 A;  2D1X A;  3G7Z A;  3OYY A;  2MF2 A;  1M1K R;  5CKD A;  4KUI A;  4X34 A;  4LDX A;  1XNI A;  1AWO A;  3HP9 A;  4BI3 A;  1N5Z A;  1QVG S;  4Y28 E;  2E64 A;  2E3I A;  3I56 Q;  1M3C A;  2QXF A;  3GIB A;  1WZO A;  4O6J A;  4XTY A;  1VQ9 Q;  2P4R A;  3NFC A;  3JCM X;  4M77 F;  3JCM P;  4EMK A;  1QMC A;  2DEU A;  1BIA A;  3J7A F;  1JQQ A;  4C8Q G;  2BZ8 A;  5GAM e;  4M7D D;  1SHF A;  5GAN 8;  4C0F A;  3KUF A;  3EFO A;  2VGM A;  2LRQ A;  3OS0 A;  3CMA A;  1S1N A;  2AKL A;  1KHI A;  5I2S A;  2AZS A;  2CP0 A;  4E2F B;  1ZBJ A;  2EQK A;  2R5A A;  4DBQ A;  1XQH A;  4E7L A;  3M56 A;  2JT4 A;  1Y96 B;  2DXC A;  2GBQ A;  2MYS A;  1VQ5 T;  1KK7 A;  1Y7X A;  2HKQ B;  2RPN A;  3MP1 A;  2J6K A;  4M7A B;  3GP8 A;  1IXD A;  4M77 A;  2Y4Y A;  4C0Z A;  2JXB A;  3EFR A;  1JJ2 A;  2J6O A;  4PLI A;  4JJC A;  5KYW B;  2VB6 A;  2DYI A;  2CSI A;  2L3P A;  3PVL A;  4D6W A;  1W1F A;  2H3E B;  1AEY A;  3RUX A;  2K4Y A;  2A3L A;  3OYN A;  1Q82 C;  1WJS A;  2XMF A;  1MHN A;  4HCB A;  3CMA T;  3SWN A;  2XID A;  1EFN A;  2V1Q A;  3H0I A;  1EZZ B;  3VYH B;  2ABL A;  2CT4 A;  3L2W A;  3M55 A;  1GRI A;  2EYQ A;  3R6O A;  3HHT B;  1ZHI A;  1BBZ A;  1CSK A;  4PL6 A;  1RAD B;  1WHH A;  3H0F A;  1NLP C;  1RAB B;  3EGX B;  1JU5 C;  5EG2 A;  1SSH A;  5CKE A;  2CH4 W;  2K5F A;  2RQT A;  3EG1 A;  1H64 1;  1MND A;  1NEB A;  1R0B G;  2JNG A;  4RUG A;  2CSQ A;  3CC7 A;  1YI2 A;  5L8R E;  4PFO A;  2EW3 A;  2X9H A;  5J39 A;  4VUB A;  2OX7 A;  2GFU A;  1BI1 A;  2FPF A;  4OGC A;  4M78 E;  2QI2 A;  1U3O A;  5HY6 A;  2EJ9 A;  5LJ3 h;  1Q81 C;  3MCA B;  1E6G A;  3CCL Q;  5FU6 C;  4ZN1 A;  1QQJ A;  2M02 A;  2JTF A;  2K6D A;  4EMG A;  1C0M A;  1UJ0 A;  1H3H A;  5GAO p;  1YBY A;  1GL5 A;  1SF9 A;  4R56 A;  5KYX A;  4C92 F;  1J3T A;  1DJ7 B;  1D0X A;  3M0R A;  5IN1 A;  5LJ5 e;  4M78 C;  4OML A;  2FB7 A;  5FLX E;  3CCM Q;  2I0N A;  3OYM A;  1TUD A;  2EJG A;  2DL7 A;  1X2Q A;  2GF7 A;  2D6F A;  3CC7 T;  1X6O A;  1PSF A;  3QDR B;  1OU9 A;  3M0P A;  3J81 E;  1JXM A;  1NJI U;  1UGS B;  2EQI A;  4M75 E;  3NTI A;  3CCE Q;  2O2O A;  1TXQ A;  1VYV A;  3G71 A;  4C5I A;  3GOX A;  3S6W A;  3CBO A;  4J8O A;  4CI0 C;  3JCM e;  1YP5 A;  4PNO A;  1UGQ B;  4ESR A;  3OY9 A;  3CPW S;  2D0Q B;  4BE1 A;  4II1 A;  4FSX A;  5CIU A;  2QEX A;  2CH4 A;  4AFS C;  1Q7Y R;  5FWC A;  4FT2 A;  1OUL A;  4PJL A;  4QQG A;  4XTU A;  3FEO A;  2RHZ A;  3TVT A;  3NPF A;  1SG5 A;  3NGP A;  2QDL A;  2EYY A;  4C8Q E;  3G4S A;  2DXB A;  2YRV A;  4C0D B;  2QG9 B;  3MEW A;  4WF2 A;  2E3H A;  4UC4 A;  4JRQ A;  5A0G A;  2XDP A;  3OMG A;  1MMA A;  3H9N A;  1OPK A;  4M75 B;  3G71 T;  1FMW A;  4KH0 B;  6AT1 B;  1FXX A;  3QPH A;  2E6Z A;  2JM9 A;  3CCV A;  3CXC S;  2MPX C;  3T9N A;  4JJB A;  5CKB A;  2QEX T;  2EYZ A;  3JB9 D;  2K5L A;  3JV3 A;  5GAN j;  4HVV A;  5KE2 A;  1ZX6 A;  3M0U A;  1I1J A;  3OA6 A;  1BIB A;  4DA4 A;  2KVQ G;  2YSQ A;  3I55 A;  1G2B A;  2EYW A;  2L3Q A;  1I0C A;  2C0O A;  3G4S T;  1U1S A;  5GMK m;  1ABO A;  1QVF S;  4C8Q B;  4ZGJ B;  3C94 A;  4X9D A;  2COW A;  2H3J A;  5LJ3 f;  1N8R R;  5GAN 4;  3PMT A;  2I2L A;  2PZ1 A;  3HPW A;  2JVV A;  4L59 A;  3OW2 S;  3KFV A;  4F16 A;  2GQI A;  2HMA A;  1IHV A;  1QP3 A;  5GMK l;  1VQ6 Q;  4M77 G;  3EH2 A;  1QCO A;  3PNW C;  2DL5 A;  2OTJ A;  4PK4 A;  1TUG B;  2COY A;  1YJ9 Q;  2QAZ A;  3URG A;  3CME T;  2J05 A;  3MP8 A;  1VQK A;  3H6Z A;  2K57 A;  2DIQ A;  3I55 T;  3M57 A;  1ZUK A;  1IHW A;  3MEV A;  1ZA1 B;  4RTY A;  4ELY C;  2FZG B;  2A36 A;  3X26 B;  4PJO B;  3MP6 A;  3OYE A;  1GFC A;  1D1C A;  3L2Z A;  4X9C A;  4E7Z A;  3HFO A;  3EG0 A;  4C92 D;  1VQO Q;  2HBP A;  3V7S A;  4NL2 A;  3VRY A;  1W70 A;  5GJV B;  1KC8 U;  5HCK A;  3MEA A;  2HAX A;  1ZUY A;  1O75 A;  3TRE A;  3RNJ A;  1X6B A;  3MPU B;  2VXE A;  5LJ3 d;  4JS4 A;  4OF1 A;  4DOV A;  4LDV A;  3UF4 A;  2RK1 A;  2OTJ T;  1JRI A;  2G6F X;  1VQK T;  4EPC A;  2W0Z A;  1ZUU A;  1OQK A;  3GBQ A;  2XG8 D;  3FJP A;  1NM7 A;  2L2P A;  4ATO A;  2YRC A;  4DBR A;  1Q7Y C;  2W10 A;  3OYF A;  2KK4 A;  2P84 A;  3ASK A;  1AWW A;  3QKJ A;  5LJ5 g;  3LWH A;  3J80 E;  2DFU A;  2AT1 B;  2CP5 A;  1Q86 U;  2M0O A;  2VXF A;  2CZ1 B;  5CR2 A;  2DRM A;  1MGQ A;  2EQU A;  2WSF E;  4BD3 A;  1N27 A;  3RER A;  3V8J A;  1TWB A;  4IUV A;  2FYK A;  2BIV A;  3ULR B;  1WHG A;  1NBE B;  1JXO A;  2DRK A;  1OYX A;  2RJD A;  3ZEH A;  1OZ2 A;  2ZPB B;  3CCJ Q;  3S3N A;  1SPK A;  2CDT A;  2KXD A;  1SEM A;  2LX9 A;  2KYB A;  2KGT A;  2RHI A;  5IXB A;  3H41 A;  4OMM A;  4XU0 A;  2M51 A;  1SSF A;  3E1S A;  4QVZ A;  2EFI A;  2KI7 A;  1VQM A;  4OB3 B;  4M7D F;  3CBP A;  5GJW B;  2EKO A;  4FYY B;  2GNC A;  1C6V X;  2KY9 A;  1VQP T;  3A8G B;  4A63 B;  4JPB W;  3VS5 A;  2DER A;  3CD6 A;  4A4G A;  1BKB A;  1M3A A;  1R8O B;  2JTM A;  2LC4 A;  4BY6 B;  5J3B A;  4C92 G;  1GFD A;  3HKS A;  5GMK h;  1OZ3 A;  1MMG A;  1MV0 B;  2MAM A;  2DLP A;  1VQ8 Q;  3PMI A;  4FSS A;  3UDC A;  4L6V 5;  1M30 A;  2D0N A;  2J6F A;  1N8R C;  3H0H A;  4DBF A;  3REB B;  1QWE A;  2VUB A;  8AT1 B;  3M0T A;  1MMD A;  3QYG B;  4M7D A;  1H92 A;  1IO6 A;  4NL3 A;  1AZE A;  3BE3 A;  2DTH A;  2EVR A;  2L89 A;  1OV3 A;  3DB4 A;  1KC8 R;  2E4H A;  4J9G A;  2DVE A;  3EG3 A;  2LNH B;  3CD6 T;  4B9X A;  3OS1 A;  1ZSZ B;  5FRN A;  3FC3 A;  2LQK A;  3RIR A;  3A1P A;  2O4X A;  5GAN f;  1WNL A;  2LX7 A;  2CP6 A;  1BK2 A;  1JJ2 S;  4ME7 A;  4CC3 A;  2CP7 A;  2BE9 B;  4QQD A;  1T0H A;  1QKX A;  1OOT A;  1WLP B;  4M77 E;  2JS2 A;  3OSV A;  4CC2 A;  4JDS A;  4Y91 A;  1C1A A;  2KQW A;  2NYS A;  5KYY A;  4N4G A;  2CYZ B;  1YIJ Q;  2CS7 A;  1VQ4 A;  2ATC B;  1PG5 B;  5IHI A;  2CZ7 B;  4PFZ A;  3D7S B;  4EMK B;  1Q86 R;  2DJQ A;  3C12 A;  2FVU A;  3EG9 A;  2VWF A;  1RAG B;  3EFO B;  2EQM A;  5CKH A;  3I56 A;  2A28 A;  2R57 A;  3FIF A;  3JAM E;  4ZGE B;  1VQ9 A;  4KUL A;  3M58 A;  1RAC B;  2LQW A;  5IH2 A;  4CC7 A;  5IT9 E;  1QP2 A;  2DD5 A;  3CCR Q;  2LQ8 A;  7AT1 B;  2FRY A;  2ZGW A;  2FPE A;  3MET A;  5GAN d;  1OPL A;  4IUR A;  4M77 B;  3SWN C;  1NYF A;  2DK3 A;  2HBW A;  2LZ6 B;  1VQ4 T;  1BI3 A;  4KH1 B;  1W2B P;  1VQN Q;  5DLQ E;  1BCO A;  3V7C A;  3A5Z B;  4ZTF A;  2EJF A;  2YUQ A;  2RQV A;  2XD0 A;  2CZ0 B;  1ARK A;  1AWJ A;  4PJO D;  2RH2 A;  1I4K 1;  2V1R A;  2RI2 A;  1VQ5 A;  5GAO r;  5KCO A;  3SB2 A;  3I56 T;  1UHF A;  5LJ3 e;  3QWY A;  2QQB A;  3EHQ A;  1VQ9 T;  1ZLM A;  2RMO A;  2VV5 A;  1K0X A;  5CVI A;  5GAN 7;  3QO3 A;  4ANJ A;  4F7U B;  3EAE A;  4B9W A;  2EAY A;  1Z9Q A;  1RAE B;  4A4F A;  1G8X A;  4RTW A;  5KYN A;  2DO3 A;  3G6E A;  1K8A U;  4GY5 A;  5I21 A;  1G3T A;  4LDY A;  4C92 E;  5HK0 A;  3AT1 B;  1KFZ A;  2MMP A;  4F14 A;  2JM8 A;  1SKU B;  3VS0 A;  2CRE A;  2V8J A;  2RD1 A;  2E5K A;  1AD5 A;  2HEQ A;  2M9U A;  3M0Q A;  2JN0 A;  2HCK A;  2JUF A;  1FMK A;  3JB9 F;  5I2M A;  1KD1 U;  1MV3 A;  2KR3 A;  2IVW A;  2ED0 A;  5KYX B;  3CCS A;  2CP2 A;  2XIC A;  1K9M U;  5CK9 A;  1YCS B;  1BYM A;  3M5A A;  1FMV A;  2LCC A;  2AIR B;  1IRX A;  1JEG A;  3OYC A;  4C92 C;  3OQ5 A;  2YRD A;  2LDM A;  2KDS A;  2ZPG B;  3UA7 A;  4PJM A;  1UUE A;  2A37 A;  4EMH A;  3O8V A;  5GAM j;  2XDD A;  3G6E T;  1U06 A;  3JCM W;  4A4H A;  1NZ9 A;  1HSQ A;  3ZL7 C;  3CCM A;  2QDY B;  3IQL A;  1NPR A;  1Q86 C;  2IIM A;  4JLI A;  3AHU A;  3CMA Q;  1VIF A;  1N6A A;  3NTK A;  1VOM A;  5KYU A;  4M7A F;  3X28 B;  2CUD A;  3LLR A;  1SRL A;  3RES A;  2C0T A;  3CCS T;  4M7D G;  3CCE A;  4LUD A;  1UB4 A;  4J6Y A;  4QKU A;  1M90 U;  4C5H A;  1VQ7 A;  1G5V A;  1UEC A;  2LCL A;  4Z89 A;  4DBH A;  3C4S A;  1WDX A;  3BW1 A;  3PFS A;  2QA4 A;  4FL6 A;  2HQX A;  1YWO A;  3R6N A;  2NWM A;  4E7J A;  4TVR A;  3L2V A;  3MHX A;  1Y96 A;  2X3W D;  4JRP A;  4PJN A;  1W2B A;  4BE2 A;  3CCM T;  2DPP B;  4N4H A;  1LJO A;  4Y92 A;  4LE9 A;  3VS7 A;  4RG2 A;  3CCU Q;  1YN8 A;  5KCH A;  1YFN A;  1M1K C;  2RB6 A;  5KYW A;  5FU6 B;  1K76 A;  2LJ1 A;  1YHQ Q;  3CCE T;  1VQ7 T;  1TUC A;  1X27 A;  2E1H A;  2DAQ A;  1OEB A;  2QA4 T;  1KG1 A;  3ER0 A;  4M78 B;  3ZFJ A;  2VVK A;  4C92 A;  1WHL A;  2JJ9 A;  2HZY A;  2E6N A;  1FWZ A;  5D6Y A;  3VJP A;  3CPW P;  2PQW A;  1KQS P;  4BI4 A;  3I5R A;  5GAN 2;  1T0J A;  5GAO q;  4QT7 A;  3CC7 Q;  4FYV B;  1YI2 Q;  3DLL A;  3QYH B;  2FHD A;  5FRM A;  1Y0M A;  4LUE A;  1UTI A;  4A4E A;  1K9M R;  3OYI A;  2AHJ B;  2AKK A;  2Y90 A;  2J06 A;  2VAS A;  1YJN A;  2DL4 A;  2ROL A;  5LJ5 j;  3X24 B;  2LCS A;  2ESW A;  1RI9 A;  5J26 A;  4Q5W A;  4QVD A;  1G3Y A;  2DKG A;  1VQ6 A;  5FW9 A;  2GCX A;  4J9C A;  3QBY A;  4HVW A;  3PT9 A;  2HL3 A;  2DXT A;  2P4T A;  1WXB A;  1OU8 A;  5GAM g;  1YJ9 A;  4HCC A;  4AFZ C;  2RNA A;  2A0F B;  4KGX B;  2A7Y A;  3UWN A;  1K73 U;  1KJW A;  4XK8 E;  1M90 R;  4JRI A;  2FO0 A;  2OTL A;  3CME A;  5CKF A;  2OJ2 A;  1KSW A;  3GNF B;  2PVD B;  3G71 Q;  1U8R A;  2MK5 A;  3A8M B;  4OMP A;  1YIT A;  3JCM Q;  3L42 A;  5ECA A;  1YJN T;  4J9I A;  3VS2 A;  2QEX Q;  3A8O B;  2OI3 A;  1G3W A;  3FDR A;  1WHJ A;  1YNZ A;  5CQX A;  1VQO A;  1PSE A;  4HT8 A;  2BUD A;  2RJC A;  1KIK A;  1X01 A;  1YJW A;  3CC4 A;  3QZ9 B;  2DTI A;  2DYB A;  3OBW A;  3VS3 A;  1VQ6 T;  2VGN A;  3OW2 P;  4MDX A;  3OYB A;  4MDW A;  3CC2 Q;  1YJ9 T;  2DJZ A;  2FZC B;  4M7A D;  1I07 A;  3G4S Q;  3CCQ Q;  4M75 F;  4FU6 A;  4MZT A;  1QVP A;  5GMK e;  1ZSG A;  4KT0 E;  5DLO A;  2OTL T;  1NJI R;  1BI2 A;  4JZ3 A;  1TOV A;  1LVK A;  3RDV A;  1GXI E;  5GAN 6;  3N5B B;  2QYZ A;  1GCP A;  3CCV Q;  1YIT T;  4RTZ A;  4M7D E;  1PHT A;  5A0L A;  1X75 C;  1X6G A;  3TSZ A;  2F2V A;  3C0C A;  4LN2 A;  3BY7 A;  4NS5 A;  1Z9Z A;  1G83 A;  2L8D A;  2LNV A;  1XJW B;  5GAM f;  1M1G A;  1VQO T;  2K5I A;  4IIO A;  3WXM B;  4BB7 A;  2M0Y A;  1QKW A;  5GAN h;  2R5M A;  1WA7 A;  3CC4 T;  1YJW T;  4AG1 C;  3RKX A;  4J9E A;  2NUT B;  2KRS A;  2L5Q A;  5DY9 A;  2MWP A;  3BDU A;  1KHC A;  3JB9 G;  3I55 Q;  2K2V A;  4M7D C;  1VQL A;  3L2R A;  4PFP A;  1IZ6 A;  2LP5 A;  2JS0 A;  3JRZ A;  3A8L B;  2MWO A;  2DA9 A;  1HXD A;  1UGR B;  5GAO m;  2FZK B;  2K2M A;  2LVM A;  4HCZ A;  2EGA A;  1S72 Q;  1QW1 A;  2PNI A;  1KQS A;  2X3X D;  3TU4 K;  4GLM A;  1ABQ A;  2D8J A;  4AT1 B;  1VQP A;  3LH5 A;  3RBB B;  3FRN A;  2DL8 A;  4LNP A;  2ZPE B;  2DD4 A;  3QUI A;  2E41 A;  4OGE A;  3M4G A;  1B34 B;  1ACM B;  2GTJ A;  3GF5 A;  1VYT A;  3EGD A;  4N4I A;  4PJO F;  2MOX A;  5LL6 S;  2EQJ A;  2B8A A;  1VQK Q;  4JUV A;  2F69 A;  4AG2 C;  2P0P A;  4FW2 A;  4M7A G;  1AHJ B;  4KGZ B;  1VQL T;  4XU1 A;  4XQ3 A;  2QQA A;  3H8Z A;  4WTO B;  1WQW A;  4YTL A;  1M8M A;  3JCM g;  2DBM A;  1K1Z A;  3EHR A;  4J9D A;  2X4W A;  3OB9 A;  5KYY B;  2LQN A;  3EFS A;  2A08 A;  2C0I A;  4FCY A;  1WFW A;  1M90 C;  4PJO A;  2RI5 A;  2RJE A;  1BB9 A;  5HK3 A;  3PGG A;  1I5L A;  3I35 A;  3M53 A;  3CPF A;  2VC8 A;  5CCA A;  1Q81 U;  3QG1 A;  4DEY A;  2KMT A;  3V8L A;  3F70 A;  3EG9 B;  3EGU A;  2KE9 A;  4AFU C;  4M4Z A;  2G3R A;  2RQR A;  5FU7 C;  4LDU A;  3NHN A;  1D3B A;  1EX4 A;  2OAW A;  2FPD A;  5L23 A;  4C5G A;  4HKE A;  1HD3 A;  3QDF A;  5LJ5 f;  1CKB A;  4PKC C;  2HQE A;  1PNJ A;  1WX6 A;  1FYN A;  5GMK i;  1M2V A;  1KQ2 A;  1V1C A;  2RHY A;  2GFA A;  1M1F A;  4OP0 A;  2KRO A;  1NJI C;  1O9S A;  3MO8 A;  2HDA A;  2E10 A;  2NUZ A;  3RMS A;  4RCB A;  4M75 D;  2PVG B;  4KRT A;  3DLM A;  2HD0 A;  2E5Q A;  4F04 B;  2YWW A;  2DL3 A;  3JCM f;  2DX1 A;  5D6W A;  2O9V A;  2KEA A;  2DET A;  1YIJ T;  2CP3 A;  4IUP A;  3MKD A;  1VQM Q;  1VQN A;  2X4J A;  5EC7 A;  2LJ0 A;  2X35 A;  3OYJ A;  1RLQ C;  1T3S A;  4IUU A;  1WQ7 A;  4P5N A;  4D8D A;  1LNX A;  1WHM A;  1X2K A;  4C8Q D;  5GAO n;  4J5Y A;  3JCM V;  1UHC A;  2ROT A;  5AT1 B;  2O88 A;  1W4S A;  4RTX A;  2YUP A;  3P8H A;  2NLU A;  3VS4 A;  3S3M A;  2D8H A;  2YLB A;  3RR6 A;  3LH0 A;  3QZ5 B;  2HKN A;  3ME9 A;  3QII A;  1SHG A;  2DVJ A;  2O9S A;  4RTU A;  4KUD K;  2RA2 A;  3KBG A;  1BI0 A;  1VQN T;  4RCC A;  4ZNX A;  3PTA A;  3V7R A;  4JS5 A;  3TSW A;  4J6X A;  4C0G A;  2C06 A;  3THK A;  4KGV B;  4OMF B;  4FYX B;  2YT6 A;  2IPO B;  1UDL A;  4J6W A;  1Q81 R;  2IG0 A;  1UFF A;  4A4K A;  1N9S A;  3HSB A;  4ORZ A;  1FX7 A;  2QTV A;  3RKW A;  3SWN B;  1W2B S;  2DMO A;  2QQR A;  1QVG P;  2V8K A;  3HTR A;  3QJ6 A;  4QW2 A;  4DEX A;  1VQ4 Q;  2K7A A;  1M9S A;  2JMC A;  4CRI A;  1F1B B;  5IHN A;  5D7U A;  4M7A E;  1LPL A;  1XTD A;  2K3Y A;  3M0S A;  4J9H A;  4Z88 A;  1NG2 A;  4LXC A;  5KYU B;  1GBR A;  2HNI A;  2XDB A;  3A8H B;  2DZ9 A;  3X20 B;  3HRU A;  3JB9 I;  1IB8 A;  1QLY A;  2B86 A;  4CC4 B;  4M7A C;  1GBQ A;  2V26 A;  2DXU A;  1NPP A;  1TG0 A;  1QWF A;  2JTE A;  2F5T X;  2E65 A;  5HKC A;  2WSC E;  3FLG A;  1KC8 C;  5I11 A;  2RHU A;  2Y4X A;  1AVZ C;  3NMZ C;  4HXJ A;  5I22 A;  1UEB A;  3OYG A;  4OMO A;  5LJ3 j;  4E7S A;  1AZG B;  4R0K A;  3A98 A;  2JW4 A;  2NUP A;  3CCL A;  1VQ5 Q;  2HL5 C;  3DB3 A;  2LT1 A;  2XU8 A;  1H8K A;  1PD1 A;  1WJQ A;  2CZ6 B;  4ZGD B;  4PJO G;  1Q95 G;  1Q7Y U;  1VIE A;  4MMK A;  4F7U F;  3JCM J;  3CCU A;  1B7T A;  2X4X A;  3OS2 A;  2O31 A;  2WSE E;  1D0Y A;  2ZPH B;  4C92 B;  3MEU A;  4D8K A;  3QHS A;  1GCQ C;  5IXF A;  3P8D A;  1YHQ A;  3EH1 A;  5C0M A;  2MCN A;  3VV0 A;  3WVE B;  1WHK A;  1T3L A;  2DIL A;  2L3S A;  4NOY A;  2K79 A;  2CKK A;  2YUN A;  2DEQ A;  2RK2 A;  4QQ6 A;  3UPU A;  1YWP A;  3G6E Q;  5IAY A;  2XHC A;  4MZM A;  3VU3 C;  3CCL T;  1QCN A;  3JCM c;  4F7U A;  2COZ A;  2BTT A;  2RQW A;  3VS6 A;  4RTT A;  3M54 A;  4FIB A;  3OMC A;  1MUZ A;  1I5O B;  2LT4 A;  2KSS A;  4X1V A;  5CQY A;  1PKS A;  1UG1 A;  1B07 A;  1IRE B;  2EYX A;  3CCU T;  1HK9 A;  1IGU A;  2F5K A;  3FJ5 A;  3CCS Q;  4M7A A;  5GAN 3;  1LCK A;  3L1A A;  2VKN A;  1U1T A;  1PRL C;  2KBT A;  1LOJ A;  2XKO C;  4J83 A;  3I9Q A;  1YHQ T;  4IIM A;  3OSS C;  4KBM B;  2QGF B;  1N8R U;  2ECZ A;  1UGV A;  2YHT A;  5GAM h;  1QVG A;  2QQ9 A;  1K8A R;  4XTV A;  1M5Q 1;  4HT9 A;  4DOW A;  2YLC A;  2VYT A;  4N0A C;  4XTX A;  4JJN K;  1IGQ A;  4F17 A;  1YI2 T;  2V8I A;  1N9R A;  1RAH B;  3JSC A;  1PC0 A;  2K3X A;  4IUQ A;  1KD1 R;  2M1H A;  2ZZD A;  5GAN e;  3EGX A;  1VQ7 Q;  2L0A A;  2L3R A;  2PUK B;  3E9F A;  4LD6 A;  1M2O A;  3BDL A;  3U23 A;  2QA4 Q;  1MMN A;  3LGL A;  1OX8 A;  2QGG A;  3NTH A;  1NE8 A;  1U5S A;  1KQS S;  1GCQ A;  1CKA A;  4C0D C;  2GTO A;  4Z8A A;  4XU3 A;  5CAI A;  4M77 D;  1RAF B;  2GGR A;  1SRM A;  3FB9 A;  5LJ3 g;  1K9A A;  4BUG A;  2EGC A;  4IKF A;  2Z0W A;  4L5G A;  2P0K A;  4M75 C;  1JO8 A;  1TTH B;  3HFN A;  1WGS A;  2E70 A;  4Z02 A;  2CT3 A;  3CXC P;  3CC2 A;  2K3B A;  1WYX A;  3CCQ A;  2J7I A;  3E9G A;  2ZAE A;  4M78 F;  5AYF A;  4GLK A;  1RUW A;  1UJY A;  1D0Z A;  4J7I A;  1MNE A;  1M4Z A;  2M16 A;  3SHW A;  3LWI A;  2DE0 X;  2JZ2 A;  5CO7 A;  1VUB A;  1AWX A;  4C8Q C;  1WIE A;  2EWN A;  1QVF P;  2MIO A;  2K9G A;  2KT1 A;  2E12 A;  2CGH A;  2RN8 A;  2ZCF B;  2R58 A;  4M78 A;  4PJO E;  3CC2 T;  1D1A A;  3CCQ T;  4N0A A;  1JB0 E;  2BZX A;  3KXT A;  1ZBX A;  3LGF A;  1NYG A;  1OX9 A;  1YJN Q;  4OMQ A;  4JLG A;  3EGD B;  2RHX A;  5LJ5 h;  2BZY A;  1S72 A;  3HRT A;  3CCV T;  4RG8 A;  2PUO B;  1TSF A;  3SDZ A;  1E6H A;  4BE0 A;  1TS9 A;  4PJO C;  2YUO A;  1V76 A;  4E47 A;  3OYH A;  5M9O A;  2X4Y A;  2DIG A;  4C5E A;  4BAC A;  3P8B B;  3OYK A;  2XI9 A;  3JCM b;  3CBM A;  3M9Q A;  4JZ4 A;  4M75 A;  1EIF A;  2OTL Q;  3CME Q;  3VYG A;  2O01 E;  3JCM h;  4C8Q F;  3EG2 A;  2JMA A;  1ZQ1 A;  4EDU A;  1K8A C;  3OS5 A;  4E7H A;  3QSU A;  3CCJ A;  1H3Z A;  1YIT Q;  4A53 A;  4JJD A;  4HCK A;  1NLO C;  4IUT A;  1D09 B;  4B6M A;  1WI7 A;  2HSE B;  2FRW A;  4LDW A;  1S72 T;  2RM4 A;  2FL7 A;  2RJF A;  1I8F A;  1PKT A;  1YJW Q;  3CC4 Q;  4EIK A;  3CPW A;  2KT8 A;  3LX7 A;  1KD1 C;  1HJD A;  2SEM A;  4O5V A;  4OVA A;  1D3B B;  1PCX A;  3GLX A;  1K9M C;  5GMK j;  2KYM A;  4F7U G;  4M7D B;  2F2W A;  3QJY A;  3REA B;  3SFM A;  4C8Q A;  3OYA A;  1Q82 U;  2RI3 A;  1VQ8 A;  4LD9 K;  2ZPF B;  2F2X A;  1M2V B;  5GAN 5;  4K11 A;  2OTJ Q;  1WJR A;  5FRO A;  2JOY A;  1R0C B;  5GAO l;  1B3Q A;  3L2Q A;  4FT4 A;  1K73 R;  2DZC A;  3C95 A;  4BDZ A;  5GAM d;  2MI6 A;  4ELZ C;  3PE0 A;  4XAX B;  1K4U S;  3UA6 A;  3LYI A;  4RMO A;  3CCJ T;  2GQV A;  3HL8 A;  2EPD A;  2HQH A;  2O4X B;  5KH6 A;  2F1L A;  1K0S A;  4J9B A;  3TEE A;  2EIF A;  3O5Z A;  2P0Q A;  4JRK A;  3CXC A;  1G3S A;  5C6S A;  2EKH A;  3PVQ A;  4OB0 B;  2QQS A;  2DF6 A;  2X51 A;  4E7K A;  1A0N B;  2BKD N;  4BDY A;  1R77 A;  4OB2 B;  2H8H A;  2SRC A;  1X43 A;  4E7I A;  4BY6 C;  5GAN g;  2FEI A;  1YCY A;  1VYU A;  4XU2 A;  3X25 B;  5A0D A;  2KAF A;  1VQL Q;  4BI8 B;  1VQ8 T;  3DKM A;  1UGP B;  4A54 A;  3VUZ A;  4M78 D;  3CEY A;  4AFQ C;  2LJ3 A;  1W6X A;  2NUT A;  2EGE A;  3V8K A;  2PTK A;  2CUB A;  2WAC A;  1YIJ A;  2LTO A;  1QVF A;  3UT1 A;  2ZPI B;  2YXY A;  1QCF A;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 2JMC A;  3KFV A;  4F16 A;  2GQI A;  2RF0 A;  5IHN A;  4Y92 A;  1AOJ A;  4LE9 A;  2KRN A;  3VS7 A;  4HVU A;  4J9F A;  1YN8 A;  2KRM A;  3M0S A;  4Z88 A;  4J9H A;  2DL5 A;  1Y57 A;  2LMJ A;  1K76 A;  1NG2 A;  2J05 A;  2LJ1 A;  2AK5 A;  1GBR A;  1ZUK A;  1TUC A;  1X27 A;  1OEB A;  1PWT A;  4RTY A;  2A36 A;  1QLY A;  2B86 A;  1M27 C;  3I5S A;  4CC4 B;  1GBQ A;  1GFC A;  1NEG A;  1PRM C;  2VVK A;  1TG0 A;  1X69 A;  1QWF A;  2JTE A;  3EG0 A;  3I5R A;  1T0J A;  3VRY A;  1W70 A;  2KNB B;  4QT7 A;  2KXC A;  5GJV B;  5HCK A;  2DNU A;  5I11 A;  1Y0M A;  4LUE A;  1UTI A;  1AVZ C;  2HSP A;  1ZUY A;  3RNJ A;  3NMZ C;  4HXJ A;  1X6B A;  5IHK A;  3UAT A;  5I22 A;  2AKK A;  4OMO A;  2ENM A;  3SEM A;  1AZG B;  4R0K A;  3UF4 A;  2J06 A;  3A98 A;  2JW4 A;  5FWB A;  2G6F X;  1UE9 A;  2RQU A;  2YDL A;  2EBP A;  2DL4 A;  2ROL A;  1ZUU A;  2W0Z A;  3GBQ A;  2DBK A;  1H8K A;  1NM7 A;  2L2P A;  1BU1 A;  2LCS A;  2W10 A;  2ESW A;  1RI9 A;  3CQT A;  2AZV A;  1AWW A;  5FW9 A;  2FG0 A;  4J9C A;  2O31 A;  4HVW A;  3VS1 A;  1WXB A;  4D8K A;  2DRM A;  4E6R A;  1GCQ C;  3QWX X;  4AFZ C;  5IXF A;  3VRZ A;  2RNA A;  1M3B A;  2MCN A;  1E7O A;  1KJW A;  1T3L A;  2DIL A;  2FO0 A;  3ULR B;  2L3S A;  2K79 A;  1JXO A;  2OJ2 A;  2YUN A;  1KSW A;  1RLP C;  1WXT A;  1YWP A;  2DRK A;  1XOV A;  4WCI A;  1SPK A;  4RTV A;  2CDT A;  2KXD A;  4OMP A;  1SEM A;  2ED1 A;  2KYB A;  2KGT A;  5ECA A;  5IXB A;  3H41 A;  4J9I A;  4OMM A;  2M51 A;  3VS2 A;  2OI3 A;  2BTT A;  1YNZ A;  2RQW A;  4GBQ A;  3VS6 A;  2DM1 A;  4RTT A;  4OMN A;  1MUZ A;  1WXU A;  5GJW B;  4X1V A;  1KIK A;  1PKS A;  1UG1 A;  2GNC A;  1B07 A;  4A63 B;  2DYB A;  2EYX A;  4JPB W;  3VS3 A;  3VS5 A;  1VA7 A;  1M3A A;  2D1X A;  3FJ5 A;  1GFD A;  1LCK A;  2VKN A;  1PRL C;  2KBT A;  1MV0 B;  2DLP A;  1I07 A;  4FSS A;  1AWO A;  3I9Q A;  1N5Z A;  4IIM A;  1M30 A;  1ZSG A;  2D0N A;  2J6F A;  1M3C A;  3H0H A;  4JZ3 A;  2ECZ A;  3REB B;  1QWE A;  1UGV A;  2P4R A;  3M0T A;  1H92 A;  1GCP A;  1IO6 A;  4RTZ A;  1PHT A;  1AZE A;  1JQQ A;  1X6G A;  3TSZ A;  2BZ8 A;  2F2V A;  3C0C A;  4LN2 A;  1Z9Z A;  1G83 A;  1SHF A;  2EVR A;  4IIO A;  1OV3 A;  4F17 A;  2M0Y A;  1S1N A;  2AKL A;  1QKW A;  1WA7 A;  4J9G A;  2AZS A;  3EG3 A;  1ZBJ A;  2LNH B;  4AG1 C;  4J9E A;  2KRS A;  2JT4 A;  2GBQ A;  2LX7 A;  2L0A A;  1BK2 A;  4CC3 A;  3U23 A;  2RPN A;  2J6K A;  2LP5 A;  2JS0 A;  1T0H A;  1QKX A;  1OOT A;  1U5S A;  1WLP B;  2JS2 A;  1GCQ A;  2JXB A;  4CC2 A;  2DA9 A;  1CKA A;  2J6O A;  2GTO A;  4Z8A A;  4JJC A;  2CSI A;  2GGR A;  1SRM A;  2K2M A;  2L3P A;  3PVL A;  2EGA A;  1K9A A;  1W1F A;  2PNI A;  2EGC A;  1AEY A;  2X3X D;  1JO8 A;  5IHI A;  4GLM A;  1ABQ A;  2D8J A;  3LH5 A;  3RBB B;  2CT3 A;  2XMF A;  2DL8 A;  2K3B A;  1WYX A;  4LNP A;  2DJQ A;  1EFN A;  2GTJ A;  2V1Q A;  2VWF A;  3H0I A;  2J7I A;  2ABL A;  2CT4 A;  1VYT A;  2MOX A;  1GRI A;  2A28 A;  1RUW A;  4AG2 C;  1UJY A;  1BBZ A;  1CSK A;  3H0F A;  1NLP C;  2LQW A;  5IH2 A;  3SHW A;  4CC7 A;  1JU5 C;  1SSH A;  2DE0 X;  2CH4 W;  2RQT A;  2FRY A;  3EG1 A;  1AWX A;  2FPE A;  1M8M A;  1WIE A;  1OPL A;  1NEB A;  2DBM A;  1K1Z A;  1NYF A;  3EHR A;  2MIO A;  4RUG A;  2HBW A;  2CSQ A;  2LZ6 B;  4J9D A;  2K9G A;  2KT1 A;  2LQN A;  2RN8 A;  2EW3 A;  2A08 A;  2C0I A;  1WFW A;  2YUQ A;  2RQV A;  1ARK A;  1BB9 A;  2FPF A;  3I35 A;  1U3O A;  1AWJ A;  2V1R A;  1E6G A;  4DEY A;  2BZX A;  1NYG A;  1UHF A;  2KE9 A;  3EGU A;  4AFU C;  2K6D A;  3QWY A;  4M4Z A;  4OMQ A;  1UJ0 A;  2RQR A;  3EHQ A;  1H3H A;  2BZY A;  1GL5 A;  1ZLM A;  2RMO A;  3NHN A;  2OAW A;  2FPD A;  5L23 A;  1J3T A;  1E6H A;  1K0X A;  1HD3 A;  3M0R A;  4OML A;  1CKB A;  1PNJ A;  1WX6 A;  2YUO A;  1FYN A;  2I0N A;  1TUD A;  2DL7 A;  1X2Q A;  1V1C A;  1Z9Q A;  2KRO A;  4JZ4 A;  4RTW A;  3M0P A;  1JXM A;  2EQI A;  2HDA A;  2O2O A;  2NUZ A;  3EG2 A;  1VYV A;  2JMA A;  4KRT A;  1YP5 A;  2DL3 A;  4ESR A;  2DX1 A;  4JJD A;  4HCK A;  2O9V A;  2KEA A;  1NLO C;  1KFZ A;  2CH4 A;  4F14 A;  2JM8 A;  1WI7 A;  3VS0 A;  2CRE A;  2FRW A;  2E5K A;  1AD5 A;  2HEQ A;  3M0Q A;  4AFS C;  5EC7 A;  2HCK A;  2LJ0 A;  1PKT A;  5FWC A;  1FMK A;  4EIK A;  2KT8 A;  1RLQ C;  1HJD A;  2SEM A;  1MV3 A;  2KR3 A;  2ED0 A;  1T3S A;  1YCS B;  2KYM A;  3TVT A;  3NPF A;  2F2W A;  1JEG A;  3REA B;  3NGP A;  2QDL A;  4D8D A;  2EYY A;  2F2X A;  4K11 A;  3UA7 A;  1X2K A;  1UUE A;  2A37 A;  1B3Q A;  1UHC A;  2ROT A;  2O88 A;  3PE0 A;  1K4U S;  3UA6 A;  1OPK A;  4RTX A;  2YUP A;  1U06 A;  3VS4 A;  2D8H A;  2JM9 A;  2EPD A;  1HSQ A;  3ZL7 C;  1K0S A;  4J9B A;  4JJB A;  1SHG A;  2DVJ A;  3IQL A;  2O9S A;  4RTU A;  2EYZ A;  3O5Z A;  2IIM A;  3JV3 A;  4HVV A;  4ZNX A;  2EKH A;  3PVQ A;  2DF6 A;  1ZX6 A;  3M0U A;  3TSW A;  1I1J A;  2CUD A;  1SRL A;  1A0N B;  2C0T A;  3THK A;  2H8H A;  2SRC A;  4LUD A;  1X43 A;  2YT6 A;  2YSQ A;  1UEC A;  4Z89 A;  1UDL A;  1G2B A;  2FEI A;  1VYU A;  2EYW A;  2L3Q A;  1I0C A;  1WDX A;  2C0O A;  1UFF A;  1ABO A;  1YWO A;  3R6N A;  4AFQ C;  4ORZ A;  2LJ3 A;  2NWM A;  1W6X A;  2DMO A;  2EGE A;  2PTK A;  2CUB A;  4DEX A;  2K7A A;  2PZ1 A;  2X3W D;  1QCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...