2ED0A

Solution structure of the sh3 domain of abl interactor 2 (abelson interactor 2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
GSSGSSGDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Abl interactor 2
publication title Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)
rcsb
source organism Homo sapiens
total genus 6
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ed0A00
1UUEA 3ULRB 3C0CA 1ZLMA 2KGTA 1I07A 4OMMA 2KRMA 1ZSGA 1K9AA 3SEMA 4CC7A 2CT3A 3FJ5A 3PE0A 1SHGA 2JMCA 3NGPA 4ORZA 1YNZA 1SHFA 1H92A 1AZGB 3VS2A 1CSKA 1Z9ZA 2J6FA 2V1QA 3THKA 2V1RA 4D8DA 4CC3A 1NYGA 2M0YA 2QDLA 4OMOA 2K79A 2KYBA 3QWXX 3VS0A 2YUOA 1GCPA 2CREA 1JQQA 3I5SA 3I5RA 1M3CA 1N5ZA 3M0SA 3EG2A 2PTKA 2RPNA 3IQLA 1TG0A 4K11A 1G2BA 1YCSB 2L2PA 2KR3A 1M8MA 2LJ3A 2DMOA 2DL5A 2ENMA 4RTVA 2BZ8A 1PHTA 2C0IA 2A28A 2L0AA 1VA7A 4RTUA 5IXFA 1LCKA 1NYFA 2JM9A 1ARKA 3U23A 2X3XD 1WYXA 2F2VA 1T0JA 1OV3A 2LP5A 5IHKA 3A98A 2RQTA 3EG1A 1G83A 1PRMC 2EYWA 1ZUKA 1WXUA 1ABQA 1AWWA 1PNJA 1KFZA 1GL5A 1GFCA 2NWMA 1NM7A 1E7OA 3M0QA 3O5ZA 2KROA 1HSQA 1X2QA 4KRTA 4LN2A 2FO0A 2DVJA 3PVLA 2YSQA 2O31A 3NPFA 2LMJA 2XMFA 2F2WA 2DL7A 1JXMA 4AFZC 3M0RA 4RUGA 1RLPC 1PKSA 2CH4A 2D1XA 2O88A 1JO8A 4LNPA 1WX6A 2DF6A 3EHRA 1A0NB 2B86A 1WDXA 1AVZC 1X69A 5ECAA 3NMZC 1B07A 2LNHB 4LE9A 1AWJA 4RTTA 1AOJA 3VS4A 2RF0A 2KT1A 2L3SA 1QWEA 2A08A 1WI7A 2KT8A 4J9EA 4Z88A 4HVUA 1K0XA 4F14A 2EYXA 4DEXA 4RTWA 1U3OA 1J3TA 3GBQA 2O9SA 2A36A 1T3LA 3H0FA 3H41A 1VYTA 1K0SA 1UJ0A 4JJCA 2CUBA 3CQTA 2DRMA 4Y92A 1GBRA 4AG2C 2PNIA 5FWCA 2EGCA 3UA6A 1I0CA 1AZEA 2D8JA 2RQRA 1OOTA 2J06A 3UF4A 1OPKA 1SPKA 2EGEA 1NEBA 2EGAA 2IIMA 2VVKA 3VS5A 4JZ3A 4ESRA 4OMLA 3TVTA 2GQIA 2JS2A 2DE0X 1IO6A 1UHCA 3NHNA 2W0ZA 2EVRA 2L3QA 2EYYA 2BTTA 4HXJA 2AZSA 2J6KA 4LUDA 2YDLA 5GJWB 2LJ1A 4E6RA 1YP5A 1EFNA 1E6GA 2DJQA 2ESWA 2M51A 1UJYA 4ZNXA 2SRCA 1U06A 1U5SA 2LQWA 1AWXA 1GRIA 1K1ZA 4A63B 1UGVA 2A37A 2GGRA 4AFUC 1Y57A 1NEGA 1BB9A 2NUZA 1ABOA 2KRSA 2K7AA 1XOVA 2GNCA 1B3QA 2OJ2A 1WXBA 1CKAA 5IHIA 2DILA 1JU5C 2KBTA 2K2MA 1UFFA 2JM8A 1V1CA 1SEMA 2GTOA 1ZUYA 1YWPA 2OAWA 5FW9A 2FEIA 2FG0A 3QWYA 2DL4A 1UTIA 4J9GA 2X3WD 3JV3A 2D8HA 1BK2A 2DYBA 4JPBW 1E6HA 2C0OA 1SRLA 3RBBB 2DL8A 1TUCA 5HCKA 1OEBA 2O9VA 2E5KA 2HDAA 5IHNA 1WXTA 3I9QA 5IH2A 4J9FA 2EKHA 1RI9A 1TUDA 4AFQC 2C0TA 2DBMA 2K3BA 1HD3A 4CC2A 1UG1A 5I22A 2JT4A 1KSWA 2LZ6B 3EG0A 1W70A 2FRWA 1PWTA 4OMNA 2RN8A 4M4ZA 4R0KA 3EGUA 2L3PA 4J9BA 2JW4A 5I11A 4HVVA 2P4RA 2RNAA 1QLYA 2FRYA 1YWOA 2AKLA 1BBZA 4LUEA 3M0UA 2CT4A 1KIKA 1NLOC 2KRNA 2KXCA 4IIOA 1HJDA 2CSIA 2G6FX 4OMPA 2J7IA 4JJBA 3VRYA 1UECA 2O2OA 3RNJA 4EIKA 3SHWA 1QKWA 4OMQA 1SRMA 5EC7A 1WFWA 2K6DA 2W10A 4HVWA 2KE9A 2MIOA 4WCIA 2DRKA 1AEYA 3VS3A 3VRZA 2ABLA 3TSZA 3EG3A 3I35A 2HBWA 1PRLC 1MUZA 2I0NA 2LCSA 1RLQC 1GCQC 2AZVA 1K76A 1BU1A 2DA9A 1MV3A 4X1VA 2F2XA 3REAB 2J05A 1VYUA 1GBQA 4QT7A 2RQUA 1YN8A 1X27A 4AG1C 2FPEA 3VS6A 1ZX6A 2HCKA 3KFVA 1WIEA 2FPFA 2CH4W 2GBQA 1CKBA 1FMKA 1T3SA 1ZUUA 3UA7A 4GBQA 4CC4B 3PVQA 2YUQA 1QKXA 1QWFA 1X43A 2EBPA 2PZ1A 4J9DA 3H0HA 1T0HA 4RTZA 4JJDA 2CUDA 2GTJA 1QCFA 2AK5A 2DX1A 2HSPA 4Z89A 1NLPC 2ED0A 2J6OA 5IXBA 1UE9A 2KNBB 2CSQA 1H8KA 2FPDA 2MOXA 4AFSC 4F16A 2DNUA 2RMOA 1OPLA 1ZBJA 1AWOA 2ROTA 1W6XA 1I1JA 2CDTA 2LX7A 1S1NA 5GJVB 2YUNA 3EHQA 1GCQA 2EQIA 2JXBA 1KJWA 2BZYA 2ROLA 2H8HA 4J9HA 4RTXA 1FYNA 1MV0B 2K9GA 1X6GA 1UDLA 3TSWA 2VKNA 4DEYA 2SEMA 1M3AA 4HCKA 1M30A 1K4US 4GLMA 2RQWA 1PKTA 4JZ4A 2ED1A 3REBB 2JTEA 1X2KA 1SSHA 4J9CA 2VWFA 2EYZA 2D0NA 2HEQA 4RTYA 2DLPA 2MCNA 2YT6A 2EW3A 2RQVA 4Z8AA 1VYVA 2JMAA 1H3HA 2LJ0A 1WLPB 2LQNA 2DM1A 4F17A 1NG2A 1W1FA 1M27C 3UATA 3M0TA 5FWBA 2YUPA 1WA7A 1Z9QA 3H0IA 3M0PA 4IIMA 5L23A 3LH5A 1JXOA 2JS0A 1UHFA 4FSSA 2EPDA 3R6NA 3VS7A 4D8KA 3ZL7C 2DBKA 2KXDA 1RUWA 2DL3A 2ECZA 2AKKA 1JEGA 1M3BA 2BZXA 1Y0MA 1GFDA 3VS1A 2KYMA 2KEAA 2OI3A 4J9IA 1X6BA 1AD5A
chains in the Genus database with same CATH superfamily
1ZLMA 1I07A 2WACA 3GNFB 3M57A 4ZGDB 3JSCA 3H9NA 3WVDB 1SHGA 1C1AA 2JMCA 3NGPA 3A1PA 3M4GA 5CKBA 1D1BA 1D0YA 1CSKA 2JOYA 2V1QA 4M75G 3THKA 1EZZB 4CC3A 1Q86R 1NYGA 1Q7YU 4JRPA 2RHZA 2QDLA 5FRNA 2K79A 3VS0A 1VQ7T 4OGEA 3V8LA 2VGMA 1G3WA 3LLRA 4C0ZA 3OS0A 2COWA 2OTJT 3M0SA 4M78D 2KAFA 1H641 1G2BA 4ANJA 1LPLA 2L2PA 4C8QD 1RABB 2E1HA 3OYBA 3E19A 2CP7A 2VGNA 3RDVA 5DY9A 2LC4A 4JRKA 4PJOB 2COZA 2KR3A 3CCUQ 2VB6A 3FB9A 2WSFE 2DMOA 2DL5A 2ENMA 4C5IA 2C0IA 2L0AA 1X01A 5CIUA 5CKDA 3V8JA 1NYFA 4X9DA 1OU8A 3SFMA 2EJ9A 2X3XD 4M75F 3TREA 5LL6S 5IHKA 2NLUA 4OGCA 2RQTA 1PRMC 4JS4A 4N0AC 2V8KA 2FHDA 3O8VA 4B9XA 1GL5A 1GFCA 1PSEA 1OZ3A 1NM7A 4QKUA 1Y07A 4F7UG 3HP9A 4Y28E 2M02A 3O5ZA 3M54A 4N4GA 5J3BA 1QMCA 2MWPA 2QEXT 4KRTA 3J81E 1K73C 2O31A 4M75E 4C92B 2F2WA 3FIFA 2YXYA 3G6EQ 2CKKA 2DYIA 2LTOA 1WHJA 3CCMQ 5GAN6 3SWNB 2CH4A 3OYHA 5GMKl 3CPWA 1VQLA 5AT1B 2AIRB 5LJ3g 5A0LA 3JB9D 3M9QA 3CC7Q 1R0CB 3MEAA 1BIAA 1G3SA 1ZA2B 3OYYA 4RG2A 4LE9A 3FJPA 4RTTA 2E10A 2L3SA 1QWEA 3RERA 1UB4A 3RMSA 4EMHA 2KT8A 4J9EA 4Z88A 3G4SQ 1TH7A 4HVUA 4F7UF 4F14A 4RTWA 2RI3A 1VQ7Q 1LJOA 2E41A 3GBQA 3H0FA 1T3LA 4FT4A 3M4YA 1S72A 3PTAA 1K0SA 1UJ0A 1RAIB 4Y92A 3CQTA 2DRMA 2HBPA 4M7DA 4MMKA 1TXQA 2LCCA 2OTJQ 1I0CA 3CCEQ 1RAGB 4M7DD 2D8JA 4XTYA 1OOTA 2RA2A 2F69A 3OY9A 2VVKA 4F7UE 4PJOC 4ESRA 3SB2A 5FU6B 2DE0X 1YIJT 3NHNA 2W0ZA 3J7AF 2EVRA 2HKQB 4LUDA 4Z02A 2IPOB 3CBMA 2P0KA 2CP6A 2YDLA 3S6WA 2OTLT 3OQ5A 1RL2A 3CMAA 2VYTA 4ZTJA 1QW1A 1VQ8T 2DJQA 1O75A 4BE1A 1UJYA 2SRCA 1U06A 2FVUA 1AWXA 2JNGA 2LQWA 1GRIA 3EGDB 2A37A 1Q7YC 4C8QF 2NUZA 1ZBXA 1QP2A 1ABOA 1OULA 2HD0A 1XOVA 3E1SA 5CKFA 2JZ2A 1K73R 4PFPA 2XDPA 5I2SA 1K8AU 1QCNA 1YWPA 4XAXB 3FRNA 2ZPEB 4P5NA 4C92C 3JCMb 3V8KA 1MMGA 2P0QA 3PNWC 5EG2A 1YI2A 2DL4A 2QDYB 4J9GA 4M78E 3JB9G 4J83A 3SWNC 1YITA 1R0BG 2C0OA 1BI2A 1TWBA 1KQSS 2DL8A 1WJSA 1OEBA 4C8QE 4OP0A 2FL7A 3R6OA 2HDAA 2LQ8A 4L6V5 4J9FA 5CR2A 1PC0A 4N4HA 3D7SB 4AFQC 2XD0A 4ELYC 5GMKj 2ZGWA 1JJ2A 4CRIA 1UG1A 2LZ6B 3EG0A 5CQYA 1IXDA 3OYLA 1B7TA 4OMNA 4BI8B 4M4ZA 2P4RA 2RNAA 1X6OA 4HKEA 3ZBDA 2AKLA 4FYVB 3JCMc 4M7DG 3LX7A 4KGVB 1EX4A 2MK5A 5KYNA 2CT4A 2CS7A 2G3RA 2KRNA 3P8BB 1HJDA 3HKSA 3OYCA 4OMPA 4JJBA 3JB9F 4M77D 1N8RU 2QAZA 2X4WA 2QK0A 2DK3A 1SF9A 4FM4B 4QQDA 3GPLA 2EWNA 5EC7A 1WFWA 2W10A 1YIJQ 1VQ6A 3M5AA 4WCIA 5FLXE 3OW2A 3VRZA 2ABLA 5D6WA 3RESA 5LJ5f 2OTLQ 2F5TX 4GY5A 1YJ9A 5I2MA 2EQUA 3OA6A 2R5MA 1K76A 1MV3A 5LJ3j 4PLLA 4RCCA 2RM4A 4QT7A 2RQUA 1VIFA 1X27A 2FPEA 2HMAA 4M7DF 4XTUA 1ZX6A 1AT1B 2HNIA 2CH4W 1HXDA 5KYXA 1M1KU 4C5GA 4AMCA 3PVQA 1RAAB 4OF1A 2EBPA 3A5ZB 4J9DA 1HYOA 2L89A 4RTZA 3OS5A 1VQOT 4J6XA 2XHCA 3L2RA 2X51A 4LDXA 3OMCA 1VQ4A 4Z89A 2CYZB 5IXBA 2J6OA 2LX9A 1LNXA 2KNBB 2CSQA 5CAIA 3CCJA 3MP6A 2NUPA 3QKJA 2HZYA 4J7IA 1W6XA 2LX7A 5GAOq 3LYIA 1B34A 3EHQA 3TQ7P 2ROLA 2H8HA 3OSSC 5GAMh 1O9SA 1UDLA 3TSWA 1VQMA 4DEYA 1U8RA 1VQPA 2XU8A 3Q1JA 1M30A 3EGXB 4FW1A 4JZ4A 2ED1A 3REBB 3VKIA 2RI2A 4M7AC 1SG5A 2GFAA 1BCMA 2VWFA 2X4YA 5GAN4 5KE2A 1K8AC 3MO8A 4OMFB 2RQVA 4Z8AA 3VU3C 1H3HA 1KQSP 2LJ0A 1WPYA 1MNDA 1WLPB 1FMWA 2LQNA 2E64A 2Y4XA 4F17A 4E7LA 1W1FA 5GMKe 1WHLA 3M0TA 4LDWA 2L5QA 4LXCA 3AT1B 1WA7A 1G3YA 1Z9QA 2JN0A 4O5VA 2QI2A 1M90U 3LH5A 1JXOA 2JS0A 2EPDA 4OB3B 3R6NA 3VS7A 3ZFJA 5GAN3 2QG9B 4IUVA 1NZ9A 4IUPA 2IVWA 2AKKA 3FEOA 1JEGA 4BE0A 5KYYB 1M3BA 1Y0MA 3VS1A 2KYMA 2EJGA 4IURA 1AD5A 2EQMA 3T9NA 2V8JA 4L59A 2DO3A 4OMMA 2KRMA 4X9CA 3OW2S 3SEMA 2BKDN 1IHWA 4ORZA 1G3TA 2DKGA 1KG1A 5FRMA 1BKBA 2VV5A 3VS2A 1MMNA 1N8RC 2CZ6B 2DXUA 2KYBA 2QYZA 2YUOA 2RO0A 4M77E 3NTIA 1JQQA 3I5SA 1N27A 3I5RA 2DEUA 1M3CA 4EMKA 1VQ9T 5LJ3e 2PTKA 2RPNA 1N9RA 5KYWA 3KBGA 3J80E 5GAOm 1D1AA 4FL6A 1PM3A 2C06A 3RKYA 1BIBA 5D6YA 1TU0B 2GFUA 1QVGA 2HAXA 2GF7A 2XDDA 1M8MA 3HSBA 1VQ5A 2BZ8A 2R57A 3QJYA 4LDUA 3CCQA 5IXFA 1IHVA 1LCKA 2PUKB 4IKFA 3BDUA 2RHYA 3OB9A 1ARKA 2LCLA 3UWNA 1M1KC 5FU7C 1FXXA 4FCYA 2RJCA 3EG1A 4ELZC 1G83A 3C12A 1YJNA 5LJ5g 3CCST 1W2BP 1ZUKA 1WGSA 1MGQA 3QUIA 1PNJA 2VXEA 2NWMA 3I56A 4MDWA 4UC4A 4BB7A 4JUVA 3CMAQ 4LN2A 2DTOA 3PVLA 4PJOD 2E4HA 2KI7A 1ZSZC 2NUTA 4RUGA 2MYSA 4KGXB 1PKSA 4TVRA 2D1XA 2O88A 4LNPA 5GAOp 4PFOA 2DF6A 3MEUA 3EHRA 2RHUA 2B86A 1WDXA 1X69A 5ECAA 4BI4A 1YI2Q 3INZA 1IREB 3CCMT 2PVGB 3VS4A 2H3EB 3MPUB 2MPXC 2LVMA 3OYIA 2KT1A 4JLGA 3TEEA 2K4YA 2XKOC 1WI7A 2F1LA 2L8DA 3CC7T 1ACMB 4ZGEB 2B8AA 2ZPBB 3CXCP 1VQKA 3PFSA 4JLIA 3MEVA 4RG8A 2O9SA 4KUIA 4C92D 2XK0A 3SWNA 4DOVA 1VYTA 2BE9B 1I8FA 2RD1A 1VQ9Q 4MDXA 4AG2C 2PNIA 5FWCA 2EGCA 1AZEA 1IZ6A 3G4ST 3I55T 1M90C 3LH0A 1OPKA 2F5KA 2K5LA 4KUDK 2EGEA 1NEBA 4AT1B 4D6WA 1KC8U 2X4JA 4M78A 4QW2A 4OMLA 2EQJA 2GQIA 2JS2A 1IO6A 1C0MA 4C8QA 1VUBA 1I81A 3CCET 1K9MC 4HXJA 4NL3A 2J6KA 1Y96B 5GAMd 5GJWB 3G71A 2LJ1A 3ZEHA 1D3BB 1UGPB 1E6GA 5AYFA 2K5FA 1PCXA 4ZNXA 5GAOl 3CCSQ 4XTVA 4A63B 5IT9E 1VQNA 1FMVA 3C94A 1UGVA 2RB6A 2GGRA 4KT0E 1Y57A 3V7CA 2K7AA 2OJ2A 1WXBA 1CKAA 2DILA 2K2MA 1V1CA 2JM8A 2HKNA 3PGGA 1BK2A 2RJEA 1E6HA 2LT4A 1SRLA 3GLXA 3RBBB 1M2OA 1TUCA 1M2VB 1UEBA 3HHTB 4E47A 2FYKA 3CD6T 3EGDA 2HL5C 3CBPA 5IH2A 2EKHA 1TUDA 3DLMA 3CCLA 2C0TA 2DBMA 2KQWA 1OI1A 4LDVA 3JCMd 3OYDA 1QVFA 2IG0A 4FIBA 2DJZA 3RMQA 2JT4A 5I22A 1Q81U 3JCMQ 3OYMA 2HQEA 3HFOA 2FRWA 1PWTA 3EH2A 1WHMA 1AHJB 1M9SA 3EGUA 4R0KA 3CCJQ 3CC4A 5I11A 1QLYA 4JS5A 5GAN5 3MEWA 5KYUB 5LJ5j 1D0ZA 2KXCA 1YJWT 4IIOA 2G6FX 2J7IA 3I55Q 1UECA 2O2OA 2QQRA 3X20B 3RNJA 2RJDA 3E2UA 4KBMB 4M78G 2VUBA 1VQMQ 4PJOE 1XNIA 1WQWA 3QZ5B 1I5OB 4IUTA 2XG8D 4C8QG 4HVWA 5GAOr 2KE9A 1TSFA 5DLQE 2MIOA 2RK2A 3CC2T 1K9MR 2DRKA 3GIBA 3VS3A 3EG3A 1MUZA 2CZ1B 1RLQC 2AZVA 3P8HA 1BU1A 3OMGA 4X1VA 2F2XA 1VYUA 1GBQA 1YN8A 3QZ9B 2ZPIB 4AG1C 4BDZA 2PUOB 5KH6A 1NPPA 1WIEA 3JRZA 3BY7A 4GLKA 1P92A 3CCVA 1QCOA 1FMKA 1T3SA 3UA7A 4GBQA 3E9GA 2DIQA 1MMDA 1H3ZA 2PZ1A 3H0HA 1NE8A 4C92E 4JJDA 4M78F 3PIPA 2CUDA 8ATCB 4FYXB 2AK5A 2MF2A 1YHQT 3CCRT 2ED0A 2LQKA 1KQ1A 1Q95G 2O4XB 4AFSC 4F16A 4DOWA 4KH0B 1ZBJA 4JRIA 3CD6Q 1AWOA 2ROTA 2QA4A 3VUZA 2FZKB 2EAYA 4WTOB 4J6YA 5GJVB 2E3HA 2ZCFB 2YWWA 1GCQA 2Y4YA 1KJWA 3UPUA 1UGQB 1WJRA 2HSEB 5CQXA 3L2VA 3A8HB 5I21A 5GANd 1WQ7A 3CEYA 2QXFA 3ASKA 4GLMA 1PKTA 3RKXA 2NYSA 3H8ZA 2JTEA 1X2KA 2JJ9A 1KD1U 3PT9A 1YJWQ 3A8OB 1LVKA 1OQKA 4J5YA 1MHNA 2D0NA 2CGHA 1QVFS 2MCNA 3WXMB 2DD5A 3CPWS 1Y7XA 2EW3A 1VYVA 2EIFA 2JMAA 4CI0C 3CCQQ 4A4HA 1Q82U 4M7AB 4M77A 2KY9A 1NJIU 2DETA 4JRQA 2KDSA 3CC2Q 3HTRA 3H0IA 3M0PA 4PKCC 3JB9J 4PJNA 3JB9I 4D8KA 3ZL7C 2DBKA 3L2ZA 4MMLA 4C0FA 5HKCA 5L8RE 3QBYA 2BZXA 1Q81C 3MKDA 3L42A 2KSSA 5LJ5e 3C0CA 2KGTA 4FW2A 1TTHB 3OS1A 1ZSGA 1PSFA 5C6SA 4DBRA 2X4XA 4JJNK 3FJ5A 3PE0A 3CCUA 1M4ZA 1YNZA 1SHFA 3WVEB 1H92A 1AZGB 2ZAEA 1Q7YR 3EFRA 1Z9ZA 2V1RA 4D8DA 1YHQQ 1IB8A 2X9HA 3CCRQ 1ZQ1A 1PD1A 4OMOA 2M0OA 2OX7A 1Q86U 1GCPA 2BUDA 2A3LA 4PNOA 5KYYA 2DVEA 1N5ZA 2VXFA 2ZPHB 1SKUB 4C5EA 3IQLA 1VQLT 1R77A 1TG0A 4K11A 1M1FA 3CPFA 3CC4T 1VQKQ 3M58A 5DLOA 2LJ3A 3EG9B 2V8IA 1BI1A 4RTVA 4E2FB 2LDMA 2A28A 3G6EA 2EKOA 4XU2A 3U23A 2DXBA 3EFOB 1OV3A 3GOXA 4Q5WA 2LP5A 2XIDA 1BI0A 1S72T 3AHUA 2P84A 2EYWA 1TOVA 3N5BB 2DZCA 4DBHA 1WXUA 1ABQA 5A0DA 1AWWA 1KFZA 3VV0A 3L2UA 4MZPA 4M77G 4WF2A 1E7OA 3BFMA 1MMAA 4M7DC 5FU7B 3G71Q 4F04B 2DTHA 1JJ2S 1HSQA 2QGFB 3OBWA 5GAMe 1BYMA 4PJLA 2DTIA 3LWIA 3NPFA 2A0FB 2XMFA 2R58A 5GAMf 1VQ7A 1JXMA 3M0RA 1VQNQ 1QP3A 1RADB 5CKEA 2Y90A 2OTJA 1XJWB 4NS5A 5GMKh 1V29B 1OZ2A 1WX6A 2DD4A 3CMAT 1A0NB 4XK8E 4BE2A 1AVZC 5CK9A 1ZSZB 2CZ7B 1GXIE 2QQBA 2LNVA 1KK7A 2QQSA 5IN1A 3QSUA 1KD1C 4ZTFA 2BE7D 1AWJA 4FYYB 4YTLA 1BCOA 2K3YA 2RF0A 3CPWP 3QXEB 2A08A 3DKMA 3JCMh 2Z0WA 4M77F 2KMTA 3QIIA 4N0AA 2ZZDA 1K0XA 1RAFB 3QPHA 5M9OA 5CKHA 2QA4T 2A36A 1YI2T 4B6MA 4DBQA 5IAYA 1Q82C 2CUBA 2CZ0B 3CCLQ 3QO3A 1YITT 1NJIC 4B9WA 5C0MA 5KCHA 1JB0E 1RACB 1VQLQ 3TCJA 3UA6A 1V76A 3EFSA 2RQRA 2J06A 1SPKA 3CC4Q 2QEXA 3VS5A 4JZ3A 3M59A 2K57A 1PD0A 3TVTA 4A4EA 3DB4A 1F1BB 3G7ZA 3OYEA 2CP3A 2L3QA 2EYYA 4LD9K 3DLLA 2AHJB 4HT9A 2M1HA 1PG5B 2MWOA 4E6RA 1KHCA 2ZPFB 1EFNA 5GMKi 1S72Q 2ESWA 2DXTA 1RI0A 1JRIA 4V2SA 3X25B 3QHSA 1NEGA 1BB9A 1Q86C 1I4K1 2KRSA 7AT1B 1B3QA 1K8AR 3META 2KBTA 1JU5C 1UFFA 3JCMJ 1ZUYA 2OAWA 1I5LA 1K73U 2FEIA 2FB7A 1VQ6T 3QWYA 5GAN8 3E9FA 4HA8A 4J8OA 1Y96A 2DYBA 4JPBW 1RAEB 2RH2A 4PJOA 3CCVQ 2O9VA 1YJ9T 1OYXA 4NL2A 2QQ9A 2E65A 2KK4A 3M55A 3GNGA 1HD3A 1YIJA 1U1SA 1KSWA 2EFIA 1W70A 3SD4A 3ME9A 3UDCA 2RN8A 2A7YA 2DAQA 2X35A 3FC3A 2OTLA 4J6WA 4HVVA 2QA4Q 2FRYA 3JB9H 2D9TA 1VQ8A 2MI6A 5GANh 1VQ4T 1JJ2P 4LUEA 4E7KA 1G8XA 3M0UA 3OYKA 1YITQ 1KIKA 1M2VA 2RK1A 1N6AA 2CSIA 1N8RR 5KE3A 5CO7A 1KQ2A 4C92A 3OYJA 2HL3A 4EIKA 4OVAA 1BI3A 3CCJT 3QJ6A 4OMQA 4BUGA 1SRMA 3BE3A 2RI5A 2K6DA 2DPPB 3X28B 4A4KA 5GANf 2VC8A 3QDRB 4LD6A 4EMKB 2LT1A 1AEYA 4EMGA 3MJXA 4XU0A 3X24B 3TSZA 5KYWB 4M75B 2LCSA 1VQMT 1VQPT 1YBYA 3OSVA 4L5GA 5KYUA 3REAB 2J05A 5A0GA 5GAMg 3X26B 3OW2P 3KFVA 4O6JA 1M1KR 3RUXA 1UGSB 2FPFA 1VOMA 2GBQA 2YLCA 1ZUUA 2YUQA 1QKXA 5HK3A 1QWFA 1X43A 1OX9A 3UT1A 1T0HA 1N9SA 4PK4A 1ZHIA 2WSCE 1QVGS 3FLGA 1VQ6Q 3HRSA 2HSPA 3M53A 4LDYA 4PJOG 1NLPC 1UE9A 3EH1A 4BY6C 2HQXA 1H8KA 1HK9A 2FPDA 1YJ9Q 4HCZA 1TUGB 2E6NA 2GQVA 2E70A 1M8VA 3QYGB 2NUTB 4FYWB 2CDTA 1S1NA 2P4TA 2YUNA 4X34A 3JCMP 4J9HA 4RTXA 4F7UB 4II1A 3JCMg 4R56A 1X6GA 2SEMA 4HCKA 1K4US 1KQSA 4IUUA 3JCMV 3KUFA 1VQ4Q 2CP0A 3JAME 3C95A 3NTHA 1W4SA 2O4XA 4E7JA 4C92G 2HEQA 4PJOF 4RTYA 8AT1B 3MP8A 2RJFA 4XU1A 4HT8A 2DM1A 2VASA 1VQOA 3UATA 1M27C 4EMKC 1M90R 2YLBA 2DIGA 4FSSA 1UHFA 4M75C 3MCAB 1RUWA 1VQ5T 1VQPQ 2DL3A 3CCQT 2ECZA 5LJ3d 4R55A 3HRTA 2QGGA 4M78B 1GFDA 4KGZB 1ZA1B 2KEAA 2DXCA 1X6BA 3V7RA 4C8QB 1UUEA 3ULRB 2JUFA 2QTXA 2M9UA 4ATOA 3CMEA 3BW1A 1YJNT 1K9AA 2QQAA 4CC7A 4C92F 2CT3A 1VIEA 4E7ZA 3M56A 4OB2B 4M7AA 4QVDA 3I56T 3VUBA 2J6FA 4M7AD 2M0YA 3QWXX 2CREA 2JTMA 2DZ9A 2D6FA 3EG2A 2EYQA 4KULA 1JBMA 4PJJA 3V7SA 1IGUA 1YCSB 1KC8C 2LRQA 3VJPA 1QVPA 2DERA 2JVVA 4ME7A 2RHXA 4Y91A 5D6XA 1W2BA 3HRUA 4PLIA 1PHTA 1VA7A 4RTUA 2GCXA 2JM9A 5GANg 1WHGA 1YFNA 5GAMj 3OS2A 1VQKT 1WYXA 1QVGP 2F2VA 2QEXQ 1T0JA 3A98A 1XQHA 4QQ6A 4C0GA 3MHXA 3S3MA 3OYAA 3M0QA 3BDLA 4RCBA 2KROA 1SSFA 5D7UA 1X2QA 3S3NA 3EG9A 3KXTA 2FO0A 2DVJA 2E5QA 2YSQA 5J39A 4E7IA 2LMJA 2DL7A 4AFZC 4DQ2A 1VQ5Q 1RLPC 1MNEA 2COYA 3G1JA 4M78C 1VQ9A 3SDZA 3EFOA 1D1CA 4M7DB 1JO8A 2OAUA 1C6VX 3G71T 5FROA 4C8QC 6AT1B 3HL8A 3CXCA 1YJNQ 3EGXA 1EIFA 3NMZC 5DM7R 1B07A 4M7AG 1VQNT 3FDRA 2LNHB 2YHTA 1WNLA 1AOJA 3I56Q 4A53A 2I2LA 5LJ5h 2K3XA 4XTZA 1RAHB 2EYXA 4DEXA 1U3OA 4ZN3A 1J3TA 2YRCA 2QASA 3H41A 1M5Q1 5FU6C 3CCSA 4JJCA 3S3OA 1GBRA 3QDFA 3LW5E 3EAEA 1KC8R 1ZSZA 2FZCB 3UF4A 2E12A 2EGAA 2AT1B 2IIMA 2K2VA 2E3IA 1VQ8Q 3CCLT 4KH1B 1UHCA 4M7AF 3HPWA 2ATCB 3A8MB 2PQWA 4XTXA 5GAOn 4MZTA 3L1AA 2BTTA 3A8LB 2AZSA 1YP5A 2PU9B 4MZMA 2M51A 1U5SA 1K1ZA 1WHKA 2L3RA 3MP1A 3CCMA 4AFUC 1W2BS 4M7AE 4M7DE 1OU9A 2GNCA 5CCAA 5IHIA 2PVOB 3CC7A 3OYNA 4EPCA 1SEMA 2GTOA 2MAMA 2R5AA 5FW9A 2BIVA 2FG0A 1M1GA 1UTIA 2X3WD 3JV3A 2D8HA 5CVIA 4PJMA 3NTKA 5HCKA 4M77B 4BD3A 3CMET 3G4SA 3I55A 2E5KA 3A8GB 4ZN1A 3TU4K 5IHNA 2XDBA 1WXTA 3L2QA 3OYGA 3I9QA 3DB3A 3QG1A 4C0DB 1RI9A 4FSXA 4RKUE 2EQKA 2FZGB 2K3BA 4CC2A 1Q81R 4RMOA 4XU3A 4DBFA 3F70A 3CCVT 3CCEA 4XTWA 1LOJA 2YRVA 2L3PA 4J9BA 2JW4A 1IGQA 2CP5A 5GANj 4ZGJB 5J26A 4E7HA 1YWOA 4QQGA 1BBZA 3RIRA 3CXCS 3P8DA 1QVFP 1NLOC 3QYHB 9ATCB 3VRYA 4IUQA 1UGRB 3SHWA 1QKWA 4A4FA 5KYXB 2DEQA 4XQ3A 5A2QE 4A4GA 2WSEE 5KCOA 3LGLA 2ZPGB 4EDUA 3JCMe 3JCMf 4VUBA 3I35A 1K9MU 2HBWA 1PRLC 2O01E 3HFNA 2I0NA 2MMPA 4FT2A 1GCQC 2H3JA 2DA9A 3CD6A 1VQOQ 5LJ3h 2E6ZA 2NUPB 1IRXA 3VS6A 1FX7A 2HCKA 3RKWA 4BACA 1YCYA 1CKBA 1FWZA 3OBYA 1B34B 2EJFA 3RR6A 1WZOA 4CC4B 1U1TA 1D09B 2D0QB 1G5VA 1NBEB 3LWHA 3H6ZA 2YRDA 2GTJA 3OYFA 3PIOA 1QCFA 4PFZA 2DX1A 5LJ3f 4A54A 3LGFA 4PL6A 4M75A 2JTFA 1OX8A 1YJWA 1WJQA 1D0XA 4FU6A 3CMEQ 2KVQG 3C4SA 4M77C 2MOXA 4QVZA 4M75D 2DNUA 2RMOA 2V26A 2XI9A 1R8OB 3URGA 1OPLA 3VYHB 4HCBA 2DFUA 3PMIA 4C0DC 1I1JA 3VYGA 1NPRA 1XTDA 4BY6B 2EQIA 1D3BA 1TS9A 2BZYA 2JXBA 3CC2A 2P0PA 3GP8A 1FYNA 4J7FA 3CCUT 1MV0B 2K9GA 4BDYA 2RHIA 2VKNA 2K5IA 4N4IA 2M16A 1M3AA 1DJ7B 3PMTA 1KD1R 2RQWA 3CBOA 4OB0B 4BI3A 2QTVA 4C5HA 2HQHA 1KHIA 1Y71A 5LJ5d 1SSHA 4J9CA 1QQJA 2EYZA 4QVCA 4NOYA 5GAN7 2DLPA 4OB1B 2YT6A 5GMKm 1WHHA 3GF5A 1Q82R 5GAN2 3ER0A 1NJIR 1X75C 3L2WA 1NG2A 4F7UA 5FWBA 3JCMX 2YUPA 1YHQA 3CCRA 2XICA 5HK0A 4IIMA 5L23A 2PVDB 3JCMW 2KXDA 5HY6A 3G6ET 5GANe 4HCCA 4DA4A 4E7SA 3NFCA 2CP2A 4JDSA 2OI3A 4J9IA
chains in the Genus database with same CATH topology
1UUEA 3ULRB 3C0CA 1ZLMA 2KGTA 1I07A 4OMMA 2KRMA 1ZSGA 1K9AA 3SEMA 4CC7A 2CT3A 3FJ5A 3PE0A 1SHGA 2JMCA 3NGPA 4ORZA 1YNZA 1SHFA 1H92A 1AZGB 3VS2A 1CSKA 1Z9ZA 2J6FA 2V1QA 3THKA 2V1RA 4D8DA 4CC3A 1NYGA 2M0YA 2QDLA 4OMOA 2K79A 2KYBA 3QWXX 3VS0A 2YUOA 1GCPA 2CREA 1JQQA 3I5SA 3I5RA 1M3CA 1N5ZA 3M0SA 3EG2A 2PTKA 2RPNA 3IQLA 1TG0A 4K11A 1G2BA 1YCSB 2L2PA 2KR3A 1M8MA 2LJ3A 2DMOA 2DL5A 2ENMA 4RTVA 2BZ8A 1PHTA 2C0IA 2A28A 2L0AA 1VA7A 4RTUA 5IXFA 1LCKA 1NYFA 2JM9A 1ARKA 3U23A 2X3XD 1WYXA 2F2VA 1T0JA 1OV3A 2LP5A 5IHKA 3A98A 2RQTA 3EG1A 1G83A 1PRMC 2EYWA 1ZUKA 1WXUA 1ABQA 1AWWA 1PNJA 1KFZA 1GL5A 1GFCA 2NWMA 1NM7A 1E7OA 3M0QA 3O5ZA 2KROA 1HSQA 1X2QA 4KRTA 4LN2A 2FO0A 2DVJA 3PVLA 2YSQA 2O31A 3NPFA 2LMJA 2XMFA 2F2WA 2DL7A 1JXMA 4AFZC 3M0RA 4RUGA 1RLPC 1PKSA 2CH4A 2D1XA 2O88A 1JO8A 4LNPA 1WX6A 2DF6A 3EHRA 1A0NB 2B86A 1WDXA 1AVZC 1X69A 5ECAA 3NMZC 1B07A 2LNHB 4LE9A 1AWJA 4RTTA 1AOJA 3VS4A 2RF0A 2KT1A 2L3SA 1QWEA 2A08A 1WI7A 2KT8A 4J9EA 4Z88A 4HVUA 1K0XA 4F14A 2EYXA 4DEXA 4RTWA 1U3OA 1J3TA 3GBQA 2O9SA 2A36A 1T3LA 3H0FA 3H41A 1VYTA 1K0SA 1UJ0A 4JJCA 2CUBA 3CQTA 2DRMA 4Y92A 1GBRA 4AG2C 2PNIA 5FWCA 2EGCA 3UA6A 1I0CA 1AZEA 2D8JA 2RQRA 1OOTA 2J06A 3UF4A 1OPKA 1SPKA 2EGEA 1NEBA 2EGAA 2IIMA 2VVKA 3VS5A 4JZ3A 4ESRA 4OMLA 3TVTA 2GQIA 2JS2A 2DE0X 1IO6A 1UHCA 3NHNA 2W0ZA 2EVRA 2L3QA 2EYYA 2BTTA 4HXJA 2AZSA 2J6KA 4LUDA 2YDLA 5GJWB 2LJ1A 4E6RA 1YP5A 1EFNA 1E6GA 2DJQA 2ESWA 2M51A 1UJYA 4ZNXA 2SRCA 1U06A 1U5SA 2LQWA 1AWXA 1GRIA 1K1ZA 4A63B 1UGVA 2A37A 2GGRA 4AFUC 1Y57A 1NEGA 1BB9A 2NUZA 1ABOA 2KRSA 2K7AA 1XOVA 2GNCA 1B3QA 2OJ2A 1WXBA 1CKAA 5IHIA 2DILA 1JU5C 2KBTA 2K2MA 1UFFA 2JM8A 1V1CA 1SEMA 2GTOA 1ZUYA 1YWPA 2OAWA 5FW9A 2FEIA 2FG0A 3QWYA 2DL4A 1UTIA 4J9GA 2X3WD 3JV3A 2D8HA 1BK2A 2DYBA 4JPBW 1E6HA 2C0OA 1SRLA 3RBBB 2DL8A 1TUCA 5HCKA 1OEBA 2O9VA 2E5KA 2HDAA 5IHNA 1WXTA 3I9QA 5IH2A 4J9FA 2EKHA 1RI9A 1TUDA 4AFQC 2C0TA 2DBMA 2K3BA 1HD3A 4CC2A 1UG1A 5I22A 2JT4A 1KSWA 2LZ6B 3EG0A 1W70A 2FRWA 1PWTA 4OMNA 2RN8A 4M4ZA 4R0KA 3EGUA 2L3PA 4J9BA 2JW4A 5I11A 4HVVA 2P4RA 2RNAA 1QLYA 2FRYA 1YWOA 2AKLA 1BBZA 4LUEA 3M0UA 2CT4A 1KIKA 1NLOC 2KRNA 2KXCA 4IIOA 1HJDA 2CSIA 2G6FX 4OMPA 2J7IA 4JJBA 3VRYA 1UECA 2O2OA 3RNJA 4EIKA 3SHWA 1QKWA 4OMQA 1SRMA 5EC7A 1WFWA 2K6DA 2W10A 4HVWA 2KE9A 2MIOA 4WCIA 2DRKA 1AEYA 3VS3A 3VRZA 2ABLA 3TSZA 3EG3A 3I35A 2HBWA 1PRLC 1MUZA 2I0NA 2LCSA 1RLQC 1GCQC 2AZVA 1K76A 1BU1A 2DA9A 1MV3A 4X1VA 2F2XA 3REAB 2J05A 1VYUA 1GBQA 4QT7A 2RQUA 1YN8A 1X27A 4AG1C 2FPEA 3VS6A 1ZX6A 2HCKA 3KFVA 1WIEA 2FPFA 2CH4W 2GBQA 1CKBA 1FMKA 1T3SA 1ZUUA 3UA7A 4GBQA 4CC4B 3PVQA 2YUQA 1QKXA 1QWFA 1X43A 2EBPA 2PZ1A 4J9DA 3H0HA 1T0HA 4RTZA 4JJDA 2CUDA 2GTJA 1QCFA 2AK5A 2DX1A 2HSPA 4Z89A 1NLPC 2ED0A 2J6OA 5IXBA 1UE9A 2KNBB 2CSQA 1H8KA 2FPDA 2MOXA 4AFSC 4F16A 2DNUA 2RMOA 1OPLA 1ZBJA 1AWOA 2ROTA 1W6XA 1I1JA 2CDTA 2LX7A 1S1NA 5GJVB 2YUNA 3EHQA 1GCQA 2EQIA 2JXBA 1KJWA 2BZYA 2ROLA 2H8HA 4J9HA 4RTXA 1FYNA 1MV0B 2K9GA 1X6GA 1UDLA 3TSWA 2VKNA 4DEYA 2SEMA 1M3AA 4HCKA 1M30A 1K4US 4GLMA 2RQWA 1PKTA 4JZ4A 2ED1A 3REBB 2JTEA 1X2KA 1SSHA 4J9CA 2VWFA 2EYZA 2D0NA 2HEQA 4RTYA 2DLPA 2MCNA 2YT6A 2EW3A 2RQVA 4Z8AA 1VYVA 2JMAA 1H3HA 2LJ0A 1WLPB 2LQNA 2DM1A 4F17A 1NG2A 1W1FA 1M27C 3UATA 3M0TA 5FWBA 2YUPA 1WA7A 1Z9QA 3H0IA 3M0PA 4IIMA 5L23A 3LH5A 1JXOA 2JS0A 1UHFA 4FSSA 2EPDA 3R6NA 3VS7A 4D8KA 3ZL7C 2DBKA 2KXDA 1RUWA 2DL3A 2ECZA 2AKKA 1JEGA 1M3BA 2BZXA 1Y0MA 1GFDA 3VS1A 2KYMA 2KEAA 2OI3A 4J9IA 1X6BA 1AD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUE A;  3ULR B;  3C0C A;  1ZLM A;  2KGT A;  1I07 A;  4OMM A;  2KRM A;  1ZSG A;  1K9A A;  3SEM A;  4CC7 A;  2CT3 A;  3FJ5 A;  3PE0 A;  1SHG A;  2JMC A;  3NGP A;  4ORZ A;  1YNZ A;  1SHF A;  1H92 A;  1AZG B;  3VS2 A;  1CSK A;  1Z9Z A;  2J6F A;  2V1Q A;  3THK A;  2V1R A;  4D8D A;  4CC3 A;  1NYG A;  2M0Y A;  2QDL A;  4OMO A;  2K79 A;  2KYB A;  3QWX X;  3VS0 A;  2YUO A;  1GCP A;  2CRE A;  1JQQ A;  3I5S A;  3I5R A;  1M3C A;  1N5Z A;  3M0S A;  3EG2 A;  2PTK A;  2RPN A;  3IQL A;  1TG0 A;  4K11 A;  1G2B A;  1YCS B;  2L2P A;  2KR3 A;  1M8M A;  2LJ3 A;  2DMO A;  2DL5 A;  2ENM A;  4RTV A;  2BZ8 A;  1PHT A;  2C0I A;  2A28 A;  2L0A A;  1VA7 A;  4RTU A;  5IXF A;  1LCK A;  1NYF A;  2JM9 A;  1ARK A;  3U23 A;  2X3X D;  1WYX A;  2F2V A;  1T0J A;  1OV3 A;  2LP5 A;  5IHK A;  3A98 A;  2RQT A;  3EG1 A;  1G83 A;  1PRM C;  2EYW A;  1ZUK A;  1WXU A;  1ABQ A;  1AWW A;  1PNJ A;  1KFZ A;  1GL5 A;  1GFC A;  2NWM A;  1NM7 A;  1E7O A;  3M0Q A;  3O5Z A;  2KRO A;  1HSQ A;  1X2Q A;  4KRT A;  4LN2 A;  2FO0 A;  2DVJ A;  3PVL A;  2YSQ A;  2O31 A;  3NPF A;  2LMJ A;  2XMF A;  2F2W A;  2DL7 A;  1JXM A;  4AFZ C;  3M0R A;  4RUG A;  1RLP C;  1PKS A;  2CH4 A;  2D1X A;  2O88 A;  1JO8 A;  4LNP A;  1WX6 A;  2DF6 A;  3EHR A;  1A0N B;  2B86 A;  1WDX A;  1AVZ C;  1X69 A;  5ECA A;  3NMZ C;  1B07 A;  2LNH B;  4LE9 A;  1AWJ A;  4RTT A;  1AOJ A;  3VS4 A;  2RF0 A;  2KT1 A;  2L3S A;  1QWE A;  2A08 A;  1WI7 A;  2KT8 A;  4J9E A;  4Z88 A;  4HVU A;  1K0X A;  4F14 A;  2EYX A;  4DEX A;  4RTW A;  1U3O A;  1J3T A;  3GBQ A;  2O9S A;  2A36 A;  1T3L A;  3H0F A;  3H41 A;  1VYT A;  1K0S A;  1UJ0 A;  4JJC A;  2CUB A;  3CQT A;  2DRM A;  4Y92 A;  1GBR A;  4AG2 C;  2PNI A;  5FWC A;  2EGC A;  3UA6 A;  1I0C A;  1AZE A;  2D8J A;  2RQR A;  1OOT A;  2J06 A;  3UF4 A;  1OPK A;  1SPK A;  2EGE A;  1NEB A;  2EGA A;  2IIM A;  2VVK A;  3VS5 A;  4JZ3 A;  4ESR A;  4OML A;  3TVT A;  2GQI A;  2JS2 A;  2DE0 X;  1IO6 A;  1UHC A;  3NHN A;  2W0Z A;  2EVR A;  2L3Q A;  2EYY A;  2BTT A;  4HXJ A;  2AZS A;  2J6K A;  4LUD A;  2YDL A;  5GJW B;  2LJ1 A;  4E6R A;  1YP5 A;  1EFN A;  1E6G A;  2DJQ A;  2ESW A;  2M51 A;  1UJY A;  4ZNX A;  2SRC A;  1U06 A;  1U5S A;  2LQW A;  1AWX A;  1GRI A;  1K1Z A;  4A63 B;  1UGV A;  2A37 A;  2GGR A;  4AFU C;  1Y57 A;  1NEG A;  1BB9 A;  2NUZ A;  1ABO A;  2KRS A;  2K7A A;  1XOV A;  2GNC A;  1B3Q A;  2OJ2 A;  1WXB A;  1CKA A;  5IHI A;  2DIL A;  1JU5 C;  2KBT A;  2K2M A;  1UFF A;  2JM8 A;  1V1C A;  1SEM A;  2GTO A;  1ZUY A;  1YWP A;  2OAW A;  5FW9 A;  2FEI A;  2FG0 A;  3QWY A;  2DL4 A;  1UTI A;  4J9G A;  2X3W D;  3JV3 A;  2D8H A;  1BK2 A;  2DYB A;  4JPB W;  1E6H A;  2C0O A;  1SRL A;  3RBB B;  2DL8 A;  1TUC A;  5HCK A;  1OEB A;  2O9V A;  2E5K A;  2HDA A;  5IHN A;  1WXT A;  3I9Q A;  5IH2 A;  4J9F A;  2EKH A;  1RI9 A;  1TUD A;  4AFQ C;  2C0T A;  2DBM A;  2K3B A;  1HD3 A;  4CC2 A;  1UG1 A;  5I22 A;  2JT4 A;  1KSW A;  2LZ6 B;  3EG0 A;  1W70 A;  2FRW A;  1PWT A;  4OMN A;  2RN8 A;  4M4Z A;  4R0K A;  3EGU A;  2L3P A;  4J9B A;  2JW4 A;  5I11 A;  4HVV A;  2P4R A;  2RNA A;  1QLY A;  2FRY A;  1YWO A;  2AKL A;  1BBZ A;  4LUE A;  3M0U A;  2CT4 A;  1KIK A;  1NLO C;  2KRN A;  2KXC A;  4IIO A;  1HJD A;  2CSI A;  2G6F X;  4OMP A;  2J7I A;  4JJB A;  3VRY A;  1UEC A;  2O2O A;  3RNJ A;  4EIK A;  3SHW A;  1QKW A;  4OMQ A;  1SRM A;  5EC7 A;  1WFW A;  2K6D A;  2W10 A;  4HVW A;  2KE9 A;  2MIO A;  4WCI A;  2DRK A;  1AEY A;  3VS3 A;  3VRZ A;  2ABL A;  3TSZ A;  3EG3 A;  3I35 A;  2HBW A;  1PRL C;  1MUZ A;  2I0N A;  2LCS A;  1RLQ C;  1GCQ C;  2AZV A;  1K76 A;  1BU1 A;  2DA9 A;  1MV3 A;  4X1V A;  2F2X A;  3REA B;  2J05 A;  1VYU A;  1GBQ A;  4QT7 A;  2RQU A;  1YN8 A;  1X27 A;  4AG1 C;  2FPE A;  3VS6 A;  1ZX6 A;  2HCK A;  3KFV A;  1WIE A;  2FPF A;  2CH4 W;  2GBQ A;  1CKB A;  1FMK A;  1T3S A;  1ZUU A;  3UA7 A;  4GBQ A;  4CC4 B;  3PVQ A;  2YUQ A;  1QKX A;  1QWF A;  1X43 A;  2EBP A;  2PZ1 A;  4J9D A;  3H0H A;  1T0H A;  4RTZ A;  4JJD A;  2CUD A;  2GTJ A;  1QCF A;  2AK5 A;  2DX1 A;  2HSP A;  4Z89 A;  1NLP C;  2ED0 A;  2J6O A;  5IXB A;  1UE9 A;  2KNB B;  2CSQ A;  1H8K A;  2FPD A;  2MOX A;  4AFS C;  4F16 A;  2DNU A;  2RMO A;  1OPL A;  1ZBJ A;  1AWO A;  2ROT A;  1W6X A;  1I1J A;  2CDT A;  2LX7 A;  1S1N A;  5GJV B;  2YUN A;  3EHQ A;  1GCQ A;  2EQI A;  2JXB A;  1KJW A;  2BZY A;  2ROL A;  2H8H A;  4J9H A;  4RTX A;  1FYN A;  1MV0 B;  2K9G A;  1X6G A;  1UDL A;  3TSW A;  2VKN A;  4DEY A;  2SEM A;  1M3A A;  4HCK A;  1M30 A;  1K4U S;  4GLM A;  2RQW A;  1PKT A;  4JZ4 A;  2ED1 A;  3REB B;  2JTE A;  1X2K A;  1SSH A;  4J9C A;  2VWF A;  2EYZ A;  2D0N A;  2HEQ A;  4RTY A;  2DLP A;  2MCN A;  2YT6 A;  2EW3 A;  2RQV A;  4Z8A A;  1VYV A;  2JMA A;  1H3H A;  2LJ0 A;  1WLP B;  2LQN A;  2DM1 A;  4F17 A;  1NG2 A;  1W1F A;  1M27 C;  3UAT A;  3M0T A;  5FWB A;  2YUP A;  1WA7 A;  1Z9Q A;  3H0I A;  3M0P A;  4IIM A;  5L23 A;  3LH5 A;  1JXO A;  2JS0 A;  1UHF A;  4FSS A;  2EPD A;  3R6N A;  3VS7 A;  4D8K A;  3ZL7 C;  2DBK A;  2KXD A;  1RUW A;  2DL3 A;  2ECZ A;  2AKK A;  1JEG A;  1M3B A;  2BZX A;  1Y0M A;  1GFD A;  3VS1 A;  2KYM A;  2KEA A;  2OI3 A;  4J9I A;  1X6B A;  1AD5 A; 
#chains in the Genus database with same CATH topology
 1ZLM A;  1I07 A;  2WAC A;  3GNF B;  3M57 A;  4ZGD B;  3JSC A;  3H9N A;  3WVD B;  1SHG A;  1C1A A;  2JMC A;  3NGP A;  3A1P A;  3M4G A;  5CKB A;  1D1B A;  1D0Y A;  1CSK A;  2JOY A;  2V1Q A;  4M75 G;  3THK A;  1EZZ B;  4CC3 A;  1Q86 R;  1NYG A;  1Q7Y U;  4JRP A;  2RHZ A;  2QDL A;  5FRN A;  2K79 A;  3VS0 A;  1VQ7 T;  4OGE A;  3V8L A;  2VGM A;  1G3W A;  3LLR A;  4C0Z A;  3OS0 A;  2COW A;  2OTJ T;  3M0S A;  4M78 D;  2KAF A;  1H64 1;  1G2B A;  4ANJ A;  1LPL A;  2L2P A;  4C8Q D;  1RAB B;  2E1H A;  3OYB A;  3E19 A;  2CP7 A;  2VGN A;  3RDV A;  5DY9 A;  2LC4 A;  4JRK A;  4PJO B;  2COZ A;  2KR3 A;  3CCU Q;  2VB6 A;  3FB9 A;  2WSF E;  2DMO A;  2DL5 A;  2ENM A;  4C5I A;  2C0I A;  2L0A A;  1X01 A;  5CIU A;  5CKD A;  3V8J A;  1NYF A;  4X9D A;  1OU8 A;  3SFM A;  2EJ9 A;  2X3X D;  4M75 F;  3TRE A;  5LL6 S;  5IHK A;  2NLU A;  4OGC A;  2RQT A;  1PRM C;  4JS4 A;  4N0A C;  2V8K A;  2FHD A;  3O8V A;  4B9X A;  1GL5 A;  1GFC A;  1PSE A;  1OZ3 A;  1NM7 A;  4QKU A;  1Y07 A;  4F7U G;  3HP9 A;  4Y28 E;  2M02 A;  3O5Z A;  3M54 A;  4N4G A;  5J3B A;  1QMC A;  2MWP A;  2QEX T;  4KRT A;  3J81 E;  1K73 C;  2O31 A;  4M75 E;  4C92 B;  2F2W A;  3FIF A;  2YXY A;  3G6E Q;  2CKK A;  2DYI A;  2LTO A;  1WHJ A;  3CCM Q;  5GAN 6;  3SWN B;  2CH4 A;  3OYH A;  5GMK l;  3CPW A;  1VQL A;  5AT1 B;  2AIR B;  5LJ3 g;  5A0L A;  3JB9 D;  3M9Q A;  3CC7 Q;  1R0C B;  3MEA A;  1BIA A;  1G3S A;  1ZA2 B;  3OYY A;  4RG2 A;  4LE9 A;  3FJP A;  4RTT A;  2E10 A;  2L3S A;  1QWE A;  3RER A;  1UB4 A;  3RMS A;  4EMH A;  2KT8 A;  4J9E A;  4Z88 A;  3G4S Q;  1TH7 A;  4HVU A;  4F7U F;  4F14 A;  4RTW A;  2RI3 A;  1VQ7 Q;  1LJO A;  2E41 A;  3GBQ A;  3H0F A;  1T3L A;  4FT4 A;  3M4Y A;  1S72 A;  3PTA A;  1K0S A;  1UJ0 A;  1RAI B;  4Y92 A;  3CQT A;  2DRM A;  2HBP A;  4M7D A;  4MMK A;  1TXQ A;  2LCC A;  2OTJ Q;  1I0C A;  3CCE Q;  1RAG B;  4M7D D;  2D8J A;  4XTY A;  1OOT A;  2RA2 A;  2F69 A;  3OY9 A;  2VVK A;  4F7U E;  4PJO C;  4ESR A;  3SB2 A;  5FU6 B;  2DE0 X;  1YIJ T;  3NHN A;  2W0Z A;  3J7A F;  2EVR A;  2HKQ B;  4LUD A;  4Z02 A;  2IPO B;  3CBM A;  2P0K A;  2CP6 A;  2YDL A;  3S6W A;  2OTL T;  3OQ5 A;  1RL2 A;  3CMA A;  2VYT A;  4ZTJ A;  1QW1 A;  1VQ8 T;  2DJQ A;  1O75 A;  4BE1 A;  1UJY A;  2SRC A;  1U06 A;  2FVU A;  1AWX A;  2JNG A;  2LQW A;  1GRI A;  3EGD B;  2A37 A;  1Q7Y C;  4C8Q F;  2NUZ A;  1ZBX A;  1QP2 A;  1ABO A;  1OUL A;  2HD0 A;  1XOV A;  3E1S A;  5CKF A;  2JZ2 A;  1K73 R;  4PFP A;  2XDP A;  5I2S A;  1K8A U;  1QCN A;  1YWP A;  4XAX B;  3FRN A;  2ZPE B;  4P5N A;  4C92 C;  3JCM b;  3V8K A;  1MMG A;  2P0Q A;  3PNW C;  5EG2 A;  1YI2 A;  2DL4 A;  2QDY B;  4J9G A;  4M78 E;  3JB9 G;  4J83 A;  3SWN C;  1YIT A;  1R0B G;  2C0O A;  1BI2 A;  1TWB A;  1KQS S;  2DL8 A;  1WJS A;  1OEB A;  4C8Q E;  4OP0 A;  2FL7 A;  3R6O A;  2HDA A;  2LQ8 A;  4L6V 5;  4J9F A;  5CR2 A;  1PC0 A;  4N4H A;  3D7S B;  4AFQ C;  2XD0 A;  4ELY C;  5GMK j;  2ZGW A;  1JJ2 A;  4CRI A;  1UG1 A;  2LZ6 B;  3EG0 A;  5CQY A;  1IXD A;  3OYL A;  1B7T A;  4OMN A;  4BI8 B;  4M4Z A;  2P4R A;  2RNA A;  1X6O A;  4HKE A;  3ZBD A;  2AKL A;  4FYV B;  3JCM c;  4M7D G;  3LX7 A;  4KGV B;  1EX4 A;  2MK5 A;  5KYN A;  2CT4 A;  2CS7 A;  2G3R A;  2KRN A;  3P8B B;  1HJD A;  3HKS A;  3OYC A;  4OMP A;  4JJB A;  3JB9 F;  4M77 D;  1N8R U;  2QAZ A;  2X4W A;  2QK0 A;  2DK3 A;  1SF9 A;  4FM4 B;  4QQD A;  3GPL A;  2EWN A;  5EC7 A;  1WFW A;  2W10 A;  1YIJ Q;  1VQ6 A;  3M5A A;  4WCI A;  5FLX E;  3OW2 A;  3VRZ A;  2ABL A;  5D6W A;  3RES A;  5LJ5 f;  2OTL Q;  2F5T X;  4GY5 A;  1YJ9 A;  5I2M A;  2EQU A;  3OA6 A;  2R5M A;  1K76 A;  1MV3 A;  5LJ3 j;  4PLL A;  4RCC A;  2RM4 A;  4QT7 A;  2RQU A;  1VIF A;  1X27 A;  2FPE A;  2HMA A;  4M7D F;  4XTU A;  1ZX6 A;  1AT1 B;  2HNI A;  2CH4 W;  1HXD A;  5KYX A;  1M1K U;  4C5G A;  4AMC A;  3PVQ A;  1RAA B;  4OF1 A;  2EBP A;  3A5Z B;  4J9D A;  1HYO A;  2L89 A;  4RTZ A;  3OS5 A;  1VQO T;  4J6X A;  2XHC A;  3L2R A;  2X51 A;  4LDX A;  3OMC A;  1VQ4 A;  4Z89 A;  2CYZ B;  5IXB A;  2J6O A;  2LX9 A;  1LNX A;  2KNB B;  2CSQ A;  5CAI A;  3CCJ A;  3MP6 A;  2NUP A;  3QKJ A;  2HZY A;  4J7I A;  1W6X A;  2LX7 A;  5GAO q;  3LYI A;  1B34 A;  3EHQ A;  3TQ7 P;  2ROL A;  2H8H A;  3OSS C;  5GAM h;  1O9S A;  1UDL A;  3TSW A;  1VQM A;  4DEY A;  1U8R A;  1VQP A;  2XU8 A;  3Q1J A;  1M30 A;  3EGX B;  4FW1 A;  4JZ4 A;  2ED1 A;  3REB B;  3VKI A;  2RI2 A;  4M7A C;  1SG5 A;  2GFA A;  1BCM A;  2VWF A;  2X4Y A;  5GAN 4;  5KE2 A;  1K8A C;  3MO8 A;  4OMF B;  2RQV A;  4Z8A A;  3VU3 C;  1H3H A;  1KQS P;  2LJ0 A;  1WPY A;  1MND A;  1WLP B;  1FMW A;  2LQN A;  2E64 A;  2Y4X A;  4F17 A;  4E7L A;  1W1F A;  5GMK e;  1WHL A;  3M0T A;  4LDW A;  2L5Q A;  4LXC A;  3AT1 B;  1WA7 A;  1G3Y A;  1Z9Q A;  2JN0 A;  4O5V A;  2QI2 A;  1M90 U;  3LH5 A;  1JXO A;  2JS0 A;  2EPD A;  4OB3 B;  3R6N A;  3VS7 A;  3ZFJ A;  5GAN 3;  2QG9 B;  4IUV A;  1NZ9 A;  4IUP A;  2IVW A;  2AKK A;  3FEO A;  1JEG A;  4BE0 A;  5KYY B;  1M3B A;  1Y0M A;  3VS1 A;  2KYM A;  2EJG A;  4IUR A;  1AD5 A;  2EQM A;  3T9N A;  2V8J A;  4L59 A;  2DO3 A;  4OMM A;  2KRM A;  4X9C A;  3OW2 S;  3SEM A;  2BKD N;  1IHW A;  4ORZ A;  1G3T A;  2DKG A;  1KG1 A;  5FRM A;  1BKB A;  2VV5 A;  3VS2 A;  1MMN A;  1N8R C;  2CZ6 B;  2DXU A;  2KYB A;  2QYZ A;  2YUO A;  2RO0 A;  4M77 E;  3NTI A;  1JQQ A;  3I5S A;  1N27 A;  3I5R A;  2DEU A;  1M3C A;  4EMK A;  1VQ9 T;  5LJ3 e;  2PTK A;  2RPN A;  1N9R A;  5KYW A;  3KBG A;  3J80 E;  5GAO m;  1D1A A;  4FL6 A;  1PM3 A;  2C06 A;  3RKY A;  1BIB A;  5D6Y A;  1TU0 B;  2GFU A;  1QVG A;  2HAX A;  2GF7 A;  2XDD A;  1M8M A;  3HSB A;  1VQ5 A;  2BZ8 A;  2R57 A;  3QJY A;  4LDU A;  3CCQ A;  5IXF A;  1IHV A;  1LCK A;  2PUK B;  4IKF A;  3BDU A;  2RHY A;  3OB9 A;  1ARK A;  2LCL A;  3UWN A;  1M1K C;  5FU7 C;  1FXX A;  4FCY A;  2RJC A;  3EG1 A;  4ELZ C;  1G83 A;  3C12 A;  1YJN A;  5LJ5 g;  3CCS T;  1W2B P;  1ZUK A;  1WGS A;  1MGQ A;  3QUI A;  1PNJ A;  2VXE A;  2NWM A;  3I56 A;  4MDW A;  4UC4 A;  4BB7 A;  4JUV A;  3CMA Q;  4LN2 A;  2DTO A;  3PVL A;  4PJO D;  2E4H A;  2KI7 A;  1ZSZ C;  2NUT A;  4RUG A;  2MYS A;  4KGX B;  1PKS A;  4TVR A;  2D1X A;  2O88 A;  4LNP A;  5GAO p;  4PFO A;  2DF6 A;  3MEU A;  3EHR A;  2RHU A;  2B86 A;  1WDX A;  1X69 A;  5ECA A;  4BI4 A;  1YI2 Q;  3INZ A;  1IRE B;  3CCM T;  2PVG B;  3VS4 A;  2H3E B;  3MPU B;  2MPX C;  2LVM A;  3OYI A;  2KT1 A;  4JLG A;  3TEE A;  2K4Y A;  2XKO C;  1WI7 A;  2F1L A;  2L8D A;  3CC7 T;  1ACM B;  4ZGE B;  2B8A A;  2ZPB B;  3CXC P;  1VQK A;  3PFS A;  4JLI A;  3MEV A;  4RG8 A;  2O9S A;  4KUI A;  4C92 D;  2XK0 A;  3SWN A;  4DOV A;  1VYT A;  2BE9 B;  1I8F A;  2RD1 A;  1VQ9 Q;  4MDX A;  4AG2 C;  2PNI A;  5FWC A;  2EGC A;  1AZE A;  1IZ6 A;  3G4S T;  3I55 T;  1M90 C;  3LH0 A;  1OPK A;  2F5K A;  2K5L A;  4KUD K;  2EGE A;  1NEB A;  4AT1 B;  4D6W A;  1KC8 U;  2X4J A;  4M78 A;  4QW2 A;  4OML A;  2EQJ A;  2GQI A;  2JS2 A;  1IO6 A;  1C0M A;  4C8Q A;  1VUB A;  1I81 A;  3CCE T;  1K9M C;  4HXJ A;  4NL3 A;  2J6K A;  1Y96 B;  5GAM d;  5GJW B;  3G71 A;  2LJ1 A;  3ZEH A;  1D3B B;  1UGP B;  1E6G A;  5AYF A;  2K5F A;  1PCX A;  4ZNX A;  5GAO l;  3CCS Q;  4XTV A;  4A63 B;  5IT9 E;  1VQN A;  1FMV A;  3C94 A;  1UGV A;  2RB6 A;  2GGR A;  4KT0 E;  1Y57 A;  3V7C A;  2K7A A;  2OJ2 A;  1WXB A;  1CKA A;  2DIL A;  2K2M A;  1V1C A;  2JM8 A;  2HKN A;  3PGG A;  1BK2 A;  2RJE A;  1E6H A;  2LT4 A;  1SRL A;  3GLX A;  3RBB B;  1M2O A;  1TUC A;  1M2V B;  1UEB A;  3HHT B;  4E47 A;  2FYK A;  3CD6 T;  3EGD A;  2HL5 C;  3CBP A;  5IH2 A;  2EKH A;  1TUD A;  3DLM A;  3CCL A;  2C0T A;  2DBM A;  2KQW A;  1OI1 A;  4LDV A;  3JCM d;  3OYD A;  1QVF A;  2IG0 A;  4FIB A;  2DJZ A;  3RMQ A;  2JT4 A;  5I22 A;  1Q81 U;  3JCM Q;  3OYM A;  2HQE A;  3HFO A;  2FRW A;  1PWT A;  3EH2 A;  1WHM A;  1AHJ B;  1M9S A;  3EGU A;  4R0K A;  3CCJ Q;  3CC4 A;  5I11 A;  1QLY A;  4JS5 A;  5GAN 5;  3MEW A;  5KYU B;  5LJ5 j;  1D0Z A;  2KXC A;  1YJW T;  4IIO A;  2G6F X;  2J7I A;  3I55 Q;  1UEC A;  2O2O A;  2QQR A;  3X20 B;  3RNJ A;  2RJD A;  3E2U A;  4KBM B;  4M78 G;  2VUB A;  1VQM Q;  4PJO E;  1XNI A;  1WQW A;  3QZ5 B;  1I5O B;  4IUT A;  2XG8 D;  4C8Q G;  4HVW A;  5GAO r;  2KE9 A;  1TSF A;  5DLQ E;  2MIO A;  2RK2 A;  3CC2 T;  1K9M R;  2DRK A;  3GIB A;  3VS3 A;  3EG3 A;  1MUZ A;  2CZ1 B;  1RLQ C;  2AZV A;  3P8H A;  1BU1 A;  3OMG A;  4X1V A;  2F2X A;  1VYU A;  1GBQ A;  1YN8 A;  3QZ9 B;  2ZPI B;  4AG1 C;  4BDZ A;  2PUO B;  5KH6 A;  1NPP A;  1WIE A;  3JRZ A;  3BY7 A;  4GLK A;  1P92 A;  3CCV A;  1QCO A;  1FMK A;  1T3S A;  3UA7 A;  4GBQ A;  3E9G A;  2DIQ A;  1MMD A;  1H3Z A;  2PZ1 A;  3H0H A;  1NE8 A;  4C92 E;  4JJD A;  4M78 F;  3PIP A;  2CUD A;  8ATC B;  4FYX B;  2AK5 A;  2MF2 A;  1YHQ T;  3CCR T;  2ED0 A;  2LQK A;  1KQ1 A;  1Q95 G;  2O4X B;  4AFS C;  4F16 A;  4DOW A;  4KH0 B;  1ZBJ A;  4JRI A;  3CD6 Q;  1AWO A;  2ROT A;  2QA4 A;  3VUZ A;  2FZK B;  2EAY A;  4WTO B;  4J6Y A;  5GJV B;  2E3H A;  2ZCF B;  2YWW A;  1GCQ A;  2Y4Y A;  1KJW A;  3UPU A;  1UGQ B;  1WJR A;  2HSE B;  5CQX A;  3L2V A;  3A8H B;  5I21 A;  5GAN d;  1WQ7 A;  3CEY A;  2QXF A;  3ASK A;  4GLM A;  1PKT A;  3RKX A;  2NYS A;  3H8Z A;  2JTE A;  1X2K A;  2JJ9 A;  1KD1 U;  3PT9 A;  1YJW Q;  3A8O B;  1LVK A;  1OQK A;  4J5Y A;  1MHN A;  2D0N A;  2CGH A;  1QVF S;  2MCN A;  3WXM B;  2DD5 A;  3CPW S;  1Y7X A;  2EW3 A;  1VYV A;  2EIF A;  2JMA A;  4CI0 C;  3CCQ Q;  4A4H A;  1Q82 U;  4M7A B;  4M77 A;  2KY9 A;  1NJI U;  2DET A;  4JRQ A;  2KDS A;  3CC2 Q;  3HTR A;  3H0I A;  3M0P A;  4PKC C;  3JB9 J;  4PJN A;  3JB9 I;  4D8K A;  3ZL7 C;  2DBK A;  3L2Z A;  4MML A;  4C0F A;  5HKC A;  5L8R E;  3QBY A;  2BZX A;  1Q81 C;  3MKD A;  3L42 A;  2KSS A;  5LJ5 e;  3C0C A;  2KGT A;  4FW2 A;  1TTH B;  3OS1 A;  1ZSG A;  1PSF A;  5C6S A;  4DBR A;  2X4X A;  4JJN K;  3FJ5 A;  3PE0 A;  3CCU A;  1M4Z A;  1YNZ A;  1SHF A;  3WVE B;  1H92 A;  1AZG B;  2ZAE A;  1Q7Y R;  3EFR A;  1Z9Z A;  2V1R A;  4D8D A;  1YHQ Q;  1IB8 A;  2X9H A;  3CCR Q;  1ZQ1 A;  1PD1 A;  4OMO A;  2M0O A;  2OX7 A;  1Q86 U;  1GCP A;  2BUD A;  2A3L A;  4PNO A;  5KYY A;  2DVE A;  1N5Z A;  2VXF A;  2ZPH B;  1SKU B;  4C5E A;  3IQL A;  1VQL T;  1R77 A;  1TG0 A;  4K11 A;  1M1F A;  3CPF A;  3CC4 T;  1VQK Q;  3M58 A;  5DLO A;  2LJ3 A;  3EG9 B;  2V8I A;  1BI1 A;  4RTV A;  4E2F B;  2LDM A;  2A28 A;  3G6E A;  2EKO A;  4XU2 A;  3U23 A;  2DXB A;  3EFO B;  1OV3 A;  3GOX A;  4Q5W A;  2LP5 A;  2XID A;  1BI0 A;  1S72 T;  3AHU A;  2P84 A;  2EYW A;  1TOV A;  3N5B B;  2DZC A;  4DBH A;  1WXU A;  1ABQ A;  5A0D A;  1AWW A;  1KFZ A;  3VV0 A;  3L2U A;  4MZP A;  4M77 G;  4WF2 A;  1E7O A;  3BFM A;  1MMA A;  4M7D C;  5FU7 B;  3G71 Q;  4F04 B;  2DTH A;  1JJ2 S;  1HSQ A;  2QGF B;  3OBW A;  5GAM e;  1BYM A;  4PJL A;  2DTI A;  3LWI A;  3NPF A;  2A0F B;  2XMF A;  2R58 A;  5GAM f;  1VQ7 A;  1JXM A;  3M0R A;  1VQN Q;  1QP3 A;  1RAD B;  5CKE A;  2Y90 A;  2OTJ A;  1XJW B;  4NS5 A;  5GMK h;  1V29 B;  1OZ2 A;  1WX6 A;  2DD4 A;  3CMA T;  1A0N B;  4XK8 E;  4BE2 A;  1AVZ C;  5CK9 A;  1ZSZ B;  2CZ7 B;  1GXI E;  2QQB A;  2LNV A;  1KK7 A;  2QQS A;  5IN1 A;  3QSU A;  1KD1 C;  4ZTF A;  2BE7 D;  1AWJ A;  4FYY B;  4YTL A;  1BCO A;  2K3Y A;  2RF0 A;  3CPW P;  3QXE B;  2A08 A;  3DKM A;  3JCM h;  2Z0W A;  4M77 F;  2KMT A;  3QII A;  4N0A A;  2ZZD A;  1K0X A;  1RAF B;  3QPH A;  5M9O A;  5CKH A;  2QA4 T;  2A36 A;  1YI2 T;  4B6M A;  4DBQ A;  5IAY A;  1Q82 C;  2CUB A;  2CZ0 B;  3CCL Q;  3QO3 A;  1YIT T;  1NJI C;  4B9W A;  5C0M A;  5KCH A;  1JB0 E;  1RAC B;  1VQL Q;  3TCJ A;  3UA6 A;  1V76 A;  3EFS A;  2RQR A;  2J06 A;  1SPK A;  3CC4 Q;  2QEX A;  3VS5 A;  4JZ3 A;  3M59 A;  2K57 A;  1PD0 A;  3TVT A;  4A4E A;  3DB4 A;  1F1B B;  3G7Z A;  3OYE A;  2CP3 A;  2L3Q A;  2EYY A;  4LD9 K;  3DLL A;  2AHJ B;  4HT9 A;  2M1H A;  1PG5 B;  2MWO A;  4E6R A;  1KHC A;  2ZPF B;  1EFN A;  5GMK i;  1S72 Q;  2ESW A;  2DXT A;  1RI0 A;  1JRI A;  4V2S A;  3X25 B;  3QHS A;  1NEG A;  1BB9 A;  1Q86 C;  1I4K 1;  2KRS A;  7AT1 B;  1B3Q A;  1K8A R;  3MET A;  2KBT A;  1JU5 C;  1UFF A;  3JCM J;  1ZUY A;  2OAW A;  1I5L A;  1K73 U;  2FEI A;  2FB7 A;  1VQ6 T;  3QWY A;  5GAN 8;  3E9F A;  4HA8 A;  4J8O A;  1Y96 A;  2DYB A;  4JPB W;  1RAE B;  2RH2 A;  4PJO A;  3CCV Q;  2O9V A;  1YJ9 T;  1OYX A;  4NL2 A;  2QQ9 A;  2E65 A;  2KK4 A;  3M55 A;  3GNG A;  1HD3 A;  1YIJ A;  1U1S A;  1KSW A;  2EFI A;  1W70 A;  3SD4 A;  3ME9 A;  3UDC A;  2RN8 A;  2A7Y A;  2DAQ A;  2X35 A;  3FC3 A;  2OTL A;  4J6W A;  4HVV A;  2QA4 Q;  2FRY A;  3JB9 H;  2D9T A;  1VQ8 A;  2MI6 A;  5GAN h;  1VQ4 T;  1JJ2 P;  4LUE A;  4E7K A;  1G8X A;  3M0U A;  3OYK A;  1YIT Q;  1KIK A;  1M2V A;  2RK1 A;  1N6A A;  2CSI A;  1N8R R;  5KE3 A;  5CO7 A;  1KQ2 A;  4C92 A;  3OYJ A;  2HL3 A;  4EIK A;  4OVA A;  1BI3 A;  3CCJ T;  3QJ6 A;  4OMQ A;  4BUG A;  1SRM A;  3BE3 A;  2RI5 A;  2K6D A;  2DPP B;  3X28 B;  4A4K A;  5GAN f;  2VC8 A;  3QDR B;  4LD6 A;  4EMK B;  2LT1 A;  1AEY A;  4EMG A;  3MJX A;  4XU0 A;  3X24 B;  3TSZ A;  5KYW B;  4M75 B;  2LCS A;  1VQM T;  1VQP T;  1YBY A;  3OSV A;  4L5G A;  5KYU A;  3REA B;  2J05 A;  5A0G A;  5GAM g;  3X26 B;  3OW2 P;  3KFV A;  4O6J A;  1M1K R;  3RUX A;  1UGS B;  2FPF A;  1VOM A;  2GBQ A;  2YLC A;  1ZUU A;  2YUQ A;  1QKX A;  5HK3 A;  1QWF A;  1X43 A;  1OX9 A;  3UT1 A;  1T0H A;  1N9S A;  4PK4 A;  1ZHI A;  2WSC E;  1QVG S;  3FLG A;  1VQ6 Q;  3HRS A;  2HSP A;  3M53 A;  4LDY A;  4PJO G;  1NLP C;  1UE9 A;  3EH1 A;  4BY6 C;  2HQX A;  1H8K A;  1HK9 A;  2FPD A;  1YJ9 Q;  4HCZ A;  1TUG B;  2E6N A;  2GQV A;  2E70 A;  1M8V A;  3QYG B;  2NUT B;  4FYW B;  2CDT A;  1S1N A;  2P4T A;  2YUN A;  4X34 A;  3JCM P;  4J9H A;  4RTX A;  4F7U B;  4II1 A;  3JCM g;  4R56 A;  1X6G A;  2SEM A;  4HCK A;  1K4U S;  1KQS A;  4IUU A;  3JCM V;  3KUF A;  1VQ4 Q;  2CP0 A;  3JAM E;  3C95 A;  3NTH A;  1W4S A;  2O4X A;  4E7J A;  4C92 G;  2HEQ A;  4PJO F;  4RTY A;  8AT1 B;  3MP8 A;  2RJF A;  4XU1 A;  4HT8 A;  2DM1 A;  2VAS A;  1VQO A;  3UAT A;  1M27 C;  4EMK C;  1M90 R;  2YLB A;  2DIG A;  4FSS A;  1UHF A;  4M75 C;  3MCA B;  1RUW A;  1VQ5 T;  1VQP Q;  2DL3 A;  3CCQ T;  2ECZ A;  5LJ3 d;  4R55 A;  3HRT A;  2QGG A;  4M78 B;  1GFD A;  4KGZ B;  1ZA1 B;  2KEA A;  2DXC A;  1X6B A;  3V7R A;  4C8Q B;  1UUE A;  3ULR B;  2JUF A;  2QTX A;  2M9U A;  4ATO A;  3CME A;  3BW1 A;  1YJN T;  1K9A A;  2QQA A;  4CC7 A;  4C92 F;  2CT3 A;  1VIE A;  4E7Z A;  3M56 A;  4OB2 B;  4M7A A;  4QVD A;  3I56 T;  3VUB A;  2J6F A;  4M7A D;  2M0Y A;  3QWX X;  2CRE A;  2JTM A;  2DZ9 A;  2D6F A;  3EG2 A;  2EYQ A;  4KUL A;  1JBM A;  4PJJ A;  3V7S A;  1IGU A;  1YCS B;  1KC8 C;  2LRQ A;  3VJP A;  1QVP A;  2DER A;  2JVV A;  4ME7 A;  2RHX A;  4Y91 A;  5D6X A;  1W2B A;  3HRU A;  4PLI A;  1PHT A;  1VA7 A;  4RTU A;  2GCX A;  2JM9 A;  5GAN g;  1WHG A;  1YFN A;  5GAM j;  3OS2 A;  1VQK T;  1WYX A;  1QVG P;  2F2V A;  2QEX Q;  1T0J A;  3A98 A;  1XQH A;  4QQ6 A;  4C0G A;  3MHX A;  3S3M A;  3OYA A;  3M0Q A;  3BDL A;  4RCB A;  2KRO A;  1SSF A;  5D7U A;  1X2Q A;  3S3N A;  3EG9 A;  3KXT A;  2FO0 A;  2DVJ A;  2E5Q A;  2YSQ A;  5J39 A;  4E7I A;  2LMJ A;  2DL7 A;  4AFZ C;  4DQ2 A;  1VQ5 Q;  1RLP C;  1MNE A;  2COY A;  3G1J A;  4M78 C;  1VQ9 A;  3SDZ A;  3EFO A;  1D1C A;  4M7D B;  1JO8 A;  2OAU A;  1C6V X;  3G71 T;  5FRO A;  4C8Q C;  6AT1 B;  3HL8 A;  3CXC A;  1YJN Q;  3EGX A;  1EIF A;  3NMZ C;  5DM7 R;  1B07 A;  4M7A G;  1VQN T;  3FDR A;  2LNH B;  2YHT A;  1WNL A;  1AOJ A;  3I56 Q;  4A53 A;  2I2L A;  5LJ5 h;  2K3X A;  4XTZ A;  1RAH B;  2EYX A;  4DEX A;  1U3O A;  4ZN3 A;  1J3T A;  2YRC A;  2QAS A;  3H41 A;  1M5Q 1;  5FU6 C;  3CCS A;  4JJC A;  3S3O A;  1GBR A;  3QDF A;  3LW5 E;  3EAE A;  1KC8 R;  1ZSZ A;  2FZC B;  3UF4 A;  2E12 A;  2EGA A;  2AT1 B;  2IIM A;  2K2V A;  2E3I A;  1VQ8 Q;  3CCL T;  4KH1 B;  1UHC A;  4M7A F;  3HPW A;  2ATC B;  3A8M B;  2PQW A;  4XTX A;  5GAO n;  4MZT A;  3L1A A;  2BTT A;  3A8L B;  2AZS A;  1YP5 A;  2PU9 B;  4MZM A;  2M51 A;  1U5S A;  1K1Z A;  1WHK A;  2L3R A;  3MP1 A;  3CCM A;  4AFU C;  1W2B S;  4M7A E;  4M7D E;  1OU9 A;  2GNC A;  5CCA A;  5IHI A;  2PVO B;  3CC7 A;  3OYN A;  4EPC A;  1SEM A;  2GTO A;  2MAM A;  2R5A A;  5FW9 A;  2BIV A;  2FG0 A;  1M1G A;  1UTI A;  2X3W D;  3JV3 A;  2D8H A;  5CVI A;  4PJM A;  3NTK A;  5HCK A;  4M77 B;  4BD3 A;  3CME T;  3G4S A;  3I55 A;  2E5K A;  3A8G B;  4ZN1 A;  3TU4 K;  5IHN A;  2XDB A;  1WXT A;  3L2Q A;  3OYG A;  3I9Q A;  3DB3 A;  3QG1 A;  4C0D B;  1RI9 A;  4FSX A;  4RKU E;  2EQK A;  2FZG B;  2K3B A;  4CC2 A;  1Q81 R;  4RMO A;  4XU3 A;  4DBF A;  3F70 A;  3CCV T;  3CCE A;  4XTW A;  1LOJ A;  2YRV A;  2L3P A;  4J9B A;  2JW4 A;  1IGQ A;  2CP5 A;  5GAN j;  4ZGJ B;  5J26 A;  4E7H A;  1YWO A;  4QQG A;  1BBZ A;  3RIR A;  3CXC S;  3P8D A;  1QVF P;  1NLO C;  3QYH B;  9ATC B;  3VRY A;  4IUQ A;  1UGR B;  3SHW A;  1QKW A;  4A4F A;  5KYX B;  2DEQ A;  4XQ3 A;  5A2Q E;  4A4G A;  2WSE E;  5KCO A;  3LGL A;  2ZPG B;  4EDU A;  3JCM e;  3JCM f;  4VUB A;  3I35 A;  1K9M U;  2HBW A;  1PRL C;  2O01 E;  3HFN A;  2I0N A;  2MMP A;  4FT2 A;  1GCQ C;  2H3J A;  2DA9 A;  3CD6 A;  1VQO Q;  5LJ3 h;  2E6Z A;  2NUP B;  1IRX A;  3VS6 A;  1FX7 A;  2HCK A;  3RKW A;  4BAC A;  1YCY A;  1CKB A;  1FWZ A;  3OBY A;  1B34 B;  2EJF A;  3RR6 A;  1WZO A;  4CC4 B;  1U1T A;  1D09 B;  2D0Q B;  1G5V A;  1NBE B;  3LWH A;  3H6Z A;  2YRD A;  2GTJ A;  3OYF A;  3PIO A;  1QCF A;  4PFZ A;  2DX1 A;  5LJ3 f;  4A54 A;  3LGF A;  4PL6 A;  4M75 A;  2JTF A;  1OX8 A;  1YJW A;  1WJQ A;  1D0X A;  4FU6 A;  3CME Q;  2KVQ G;  3C4S A;  4M77 C;  2MOX A;  4QVZ A;  4M75 D;  2DNU A;  2RMO A;  2V26 A;  2XI9 A;  1R8O B;  3URG A;  1OPL A;  3VYH B;  4HCB A;  2DFU A;  3PMI A;  4C0D C;  1I1J A;  3VYG A;  1NPR A;  1XTD A;  4BY6 B;  2EQI A;  1D3B A;  1TS9 A;  2BZY A;  2JXB A;  3CC2 A;  2P0P A;  3GP8 A;  1FYN A;  4J7F A;  3CCU T;  1MV0 B;  2K9G A;  4BDY A;  2RHI A;  2VKN A;  2K5I A;  4N4I A;  2M16 A;  1M3A A;  1DJ7 B;  3PMT A;  1KD1 R;  2RQW A;  3CBO A;  4OB0 B;  4BI3 A;  2QTV A;  4C5H A;  2HQH A;  1KHI A;  1Y71 A;  5LJ5 d;  1SSH A;  4J9C A;  1QQJ A;  2EYZ A;  4QVC A;  4NOY A;  5GAN 7;  2DLP A;  4OB1 B;  2YT6 A;  5GMK m;  1WHH A;  3GF5 A;  1Q82 R;  5GAN 2;  3ER0 A;  1NJI R;  1X75 C;  3L2W A;  1NG2 A;  4F7U A;  5FWB A;  3JCM X;  2YUP A;  1YHQ A;  3CCR A;  2XIC A;  5HK0 A;  4IIM A;  5L23 A;  2PVD B;  3JCM W;  2KXD A;  5HY6 A;  3G6E T;  5GAN e;  4HCC A;  4DA4 A;  4E7S A;  3NFC A;  2CP2 A;  4JDS A;  2OI3 A;  4J9I A; 
#chains in the Genus database with same CATH homology
 1UUE A;  3ULR B;  3C0C A;  1ZLM A;  2KGT A;  1I07 A;  4OMM A;  2KRM A;  1ZSG A;  1K9A A;  3SEM A;  4CC7 A;  2CT3 A;  3FJ5 A;  3PE0 A;  1SHG A;  2JMC A;  3NGP A;  4ORZ A;  1YNZ A;  1SHF A;  1H92 A;  1AZG B;  3VS2 A;  1CSK A;  1Z9Z A;  2J6F A;  2V1Q A;  3THK A;  2V1R A;  4D8D A;  4CC3 A;  1NYG A;  2M0Y A;  2QDL A;  4OMO A;  2K79 A;  2KYB A;  3QWX X;  3VS0 A;  2YUO A;  1GCP A;  2CRE A;  1JQQ A;  3I5S A;  3I5R A;  1M3C A;  1N5Z A;  3M0S A;  3EG2 A;  2PTK A;  2RPN A;  3IQL A;  1TG0 A;  4K11 A;  1G2B A;  1YCS B;  2L2P A;  2KR3 A;  1M8M A;  2LJ3 A;  2DMO A;  2DL5 A;  2ENM A;  4RTV A;  2BZ8 A;  1PHT A;  2C0I A;  2A28 A;  2L0A A;  1VA7 A;  4RTU A;  5IXF A;  1LCK A;  1NYF A;  2JM9 A;  1ARK A;  3U23 A;  2X3X D;  1WYX A;  2F2V A;  1T0J A;  1OV3 A;  2LP5 A;  5IHK A;  3A98 A;  2RQT A;  3EG1 A;  1G83 A;  1PRM C;  2EYW A;  1ZUK A;  1WXU A;  1ABQ A;  1AWW A;  1PNJ A;  1KFZ A;  1GL5 A;  1GFC A;  2NWM A;  1NM7 A;  1E7O A;  3M0Q A;  3O5Z A;  2KRO A;  1HSQ A;  1X2Q A;  4KRT A;  4LN2 A;  2FO0 A;  2DVJ A;  3PVL A;  2YSQ A;  2O31 A;  3NPF A;  2LMJ A;  2XMF A;  2F2W A;  2DL7 A;  1JXM A;  4AFZ C;  3M0R A;  4RUG A;  1RLP C;  1PKS A;  2CH4 A;  2D1X A;  2O88 A;  1JO8 A;  4LNP A;  1WX6 A;  2DF6 A;  3EHR A;  1A0N B;  2B86 A;  1WDX A;  1AVZ C;  1X69 A;  5ECA A;  3NMZ C;  1B07 A;  2LNH B;  4LE9 A;  1AWJ A;  4RTT A;  1AOJ A;  3VS4 A;  2RF0 A;  2KT1 A;  2L3S A;  1QWE A;  2A08 A;  1WI7 A;  2KT8 A;  4J9E A;  4Z88 A;  4HVU A;  1K0X A;  4F14 A;  2EYX A;  4DEX A;  4RTW A;  1U3O A;  1J3T A;  3GBQ A;  2O9S A;  2A36 A;  1T3L A;  3H0F A;  3H41 A;  1VYT A;  1K0S A;  1UJ0 A;  4JJC A;  2CUB A;  3CQT A;  2DRM A;  4Y92 A;  1GBR A;  4AG2 C;  2PNI A;  5FWC A;  2EGC A;  3UA6 A;  1I0C A;  1AZE A;  2D8J A;  2RQR A;  1OOT A;  2J06 A;  3UF4 A;  1OPK A;  1SPK A;  2EGE A;  1NEB A;  2EGA A;  2IIM A;  2VVK A;  3VS5 A;  4JZ3 A;  4ESR A;  4OML A;  3TVT A;  2GQI A;  2JS2 A;  2DE0 X;  1IO6 A;  1UHC A;  3NHN A;  2W0Z A;  2EVR A;  2L3Q A;  2EYY A;  2BTT A;  4HXJ A;  2AZS A;  2J6K A;  4LUD A;  2YDL A;  5GJW B;  2LJ1 A;  4E6R A;  1YP5 A;  1EFN A;  1E6G A;  2DJQ A;  2ESW A;  2M51 A;  1UJY A;  4ZNX A;  2SRC A;  1U06 A;  1U5S A;  2LQW A;  1AWX A;  1GRI A;  1K1Z A;  4A63 B;  1UGV A;  2A37 A;  2GGR A;  4AFU C;  1Y57 A;  1NEG A;  1BB9 A;  2NUZ A;  1ABO A;  2KRS A;  2K7A A;  1XOV A;  2GNC A;  1B3Q A;  2OJ2 A;  1WXB A;  1CKA A;  5IHI A;  2DIL A;  1JU5 C;  2KBT A;  2K2M A;  1UFF A;  2JM8 A;  1V1C A;  1SEM A;  2GTO A;  1ZUY A;  1YWP A;  2OAW A;  5FW9 A;  2FEI A;  2FG0 A;  3QWY A;  2DL4 A;  1UTI A;  4J9G A;  2X3W D;  3JV3 A;  2D8H A;  1BK2 A;  2DYB A;  4JPB W;  1E6H A;  2C0O A;  1SRL A;  3RBB B;  2DL8 A;  1TUC A;  5HCK A;  1OEB A;  2O9V A;  2E5K A;  2HDA A;  5IHN A;  1WXT A;  3I9Q A;  5IH2 A;  4J9F A;  2EKH A;  1RI9 A;  1TUD A;  4AFQ C;  2C0T A;  2DBM A;  2K3B A;  1HD3 A;  4CC2 A;  1UG1 A;  5I22 A;  2JT4 A;  1KSW A;  2LZ6 B;  3EG0 A;  1W70 A;  2FRW A;  1PWT A;  4OMN A;  2RN8 A;  4M4Z A;  4R0K A;  3EGU A;  2L3P A;  4J9B A;  2JW4 A;  5I11 A;  4HVV A;  2P4R A;  2RNA A;  1QLY A;  2FRY A;  1YWO A;  2AKL A;  1BBZ A;  4LUE A;  3M0U A;  2CT4 A;  1KIK A;  1NLO C;  2KRN A;  2KXC A;  4IIO A;  1HJD A;  2CSI A;  2G6F X;  4OMP A;  2J7I A;  4JJB A;  3VRY A;  1UEC A;  2O2O A;  3RNJ A;  4EIK A;  3SHW A;  1QKW A;  4OMQ A;  1SRM A;  5EC7 A;  1WFW A;  2K6D A;  2W10 A;  4HVW A;  2KE9 A;  2MIO A;  4WCI A;  2DRK A;  1AEY A;  3VS3 A;  3VRZ A;  2ABL A;  3TSZ A;  3EG3 A;  3I35 A;  2HBW A;  1PRL C;  1MUZ A;  2I0N A;  2LCS A;  1RLQ C;  1GCQ C;  2AZV A;  1K76 A;  1BU1 A;  2DA9 A;  1MV3 A;  4X1V A;  2F2X A;  3REA B;  2J05 A;  1VYU A;  1GBQ A;  4QT7 A;  2RQU A;  1YN8 A;  1X27 A;  4AG1 C;  2FPE A;  3VS6 A;  1ZX6 A;  2HCK A;  3KFV A;  1WIE A;  2FPF A;  2CH4 W;  2GBQ A;  1CKB A;  1FMK A;  1T3S A;  1ZUU A;  3UA7 A;  4GBQ A;  4CC4 B;  3PVQ A;  2YUQ A;  1QKX A;  1QWF A;  1X43 A;  2EBP A;  2PZ1 A;  4J9D A;  3H0H A;  1T0H A;  4RTZ A;  4JJD A;  2CUD A;  2GTJ A;  1QCF A;  2AK5 A;  2DX1 A;  2HSP A;  4Z89 A;  1NLP C;  2ED0 A;  2J6O A;  5IXB A;  1UE9 A;  2KNB B;  2CSQ A;  1H8K A;  2FPD A;  2MOX A;  4AFS C;  4F16 A;  2DNU A;  2RMO A;  1OPL A;  1ZBJ A;  1AWO A;  2ROT A;  1W6X A;  1I1J A;  2CDT A;  2LX7 A;  1S1N A;  5GJV B;  2YUN A;  3EHQ A;  1GCQ A;  2EQI A;  2JXB A;  1KJW A;  2BZY A;  2ROL A;  2H8H A;  4J9H A;  4RTX A;  1FYN A;  1MV0 B;  2K9G A;  1X6G A;  1UDL A;  3TSW A;  2VKN A;  4DEY A;  2SEM A;  1M3A A;  4HCK A;  1M30 A;  1K4U S;  4GLM A;  2RQW A;  1PKT A;  4JZ4 A;  2ED1 A;  3REB B;  2JTE A;  1X2K A;  1SSH A;  4J9C A;  2VWF A;  2EYZ A;  2D0N A;  2HEQ A;  4RTY A;  2DLP A;  2MCN A;  2YT6 A;  2EW3 A;  2RQV A;  4Z8A A;  1VYV A;  2JMA A;  1H3H A;  2LJ0 A;  1WLP B;  2LQN A;  2DM1 A;  4F17 A;  1NG2 A;  1W1F A;  1M27 C;  3UAT A;  3M0T A;  5FWB A;  2YUP A;  1WA7 A;  1Z9Q A;  3H0I A;  3M0P A;  4IIM A;  5L23 A;  3LH5 A;  1JXO A;  2JS0 A;  1UHF A;  4FSS A;  2EPD A;  3R6N A;  3VS7 A;  4D8K A;  3ZL7 C;  2DBK A;  2KXD A;  1RUW A;  2DL3 A;  2ECZ A;  2AKK A;  1JEG A;  1M3B A;  2BZX A;  1Y0M A;  1GFD A;  3VS1 A;  2KYM A;  2KEA A;  2OI3 A;  4J9I A;  1X6B A;  1AD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...