2ED0A

Solution structure of the sh3 domain of abl interactor 2 (abelson interactor 2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
78
structure length
78
Chain Sequence
GSSGSSGDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Abl interactor 2
total genus 6
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ed0A00
2KNBB 2HSPA 1AVZC 2KBTA 4J9BA 3IQLA 1OOTA 1A0NB 2V1RA 1WXUA 1ZX6A 1YP5A 2LJ0A 2KYBA 2JM9A 4CC3A 1E6HA 3NGPA 1AZGB 4ORZA 2L0AA 3EG2A 2LQWA 2J6OA 2A28A 2ROTA 2EYWA 4LUEA 1VA7A 1PWTA 2C0TA 4CC2A 1U06A 1KSWA 1VYVA 2AKKA 4F16A 2KRMA 2DX1A 2HDAA 2VWFA 1QKWA 1UE9A 2OI3A 2EGEA 3ZL7C 5FWCA 1X43A 2YDLA 2KRSA 1PNJA 2CSQA 2K2MA 2MCNA 2LZ6B 2EYYA 2B86A 2CUDA 1RLQC 2A08A 1QLYA 1WFWA 2ROLA 2KRNA 3VS1A 2LNHB 3H0FA 4JJCA 1CSKA 2X3XD 4J9IA 1GCQA 1PKTA 4AFSC 2NWMA 1UJ0A 1X27A 2GBQA 2JMCA 3RBBB 4WCIA 1LCKA 2CH4A 2XMFA 4IIOA 1PKSA 1HSQA 1M30A 1K0SA 1PHTA 3I5RA 2RF0A 2L3SA 1GBRA 1SSHA 3REAB 2ED0A 2YUNA 1ZSGA 1Y0MA 1AWXA 2RQUA 2EQIA 2W10A 3VS4A 1HD3A 2KYMA 3VS0A 1RI9A 4QT7A 1UTIA 3RNJA 1SRMA 1B07A 1WYXA 2ED1A 1QCFA 5I22A 1TUCA 2KROA 1QWFA 1WI7A 1T0JA 3KFVA 4LN2A 4Z88A 1WX6A 2RMOA 2F2VA 1M3BA 1S1NA 3UA7A 1AWOA 2EVRA 1K9AA 1YWOA 2PZ1A 1UGVA 2J7IA 1T3LA 1V1CA 1WXBA 4M4ZA 1VYUA 2K9GA 4X1VA 1X6BA 3NPFA 3VS7A 1ZUUA 1NYFA 2PTKA 1GBQA 1YNZA 2O31A 2E5KA 2J06A 1JU5C 2DVJA 3UA6A 2O2OA 1WLPB 5IHNA 1TG0A 1E7OA 2YSQA 2MIOA 2MOXA 4A63B 2ESWA 2RQWA 4OMPA 5FW9A 2O9VA 2D8HA 1G2BA 1NYGA 2KGTA 3LH5A 2YUQA 1SHFA 4HVWA 2CT4A 2JW4A 2KXCA 1WXTA 2P4RA 1NLOC 2GTJA 4LUDA 2D1XA 2DRKA 2SRCA 2FPFA 1K1ZA 4OMOA 1E6GA 1Y57A 2FRYA 4CC4B 2I0NA 2RQRA 2RN8A 2AK5A 1JQQA 2GTOA 4JJBA 4AG2C 2DL8A 2OAWA 2L2PA 3I9QA 1KFZA 4J9GA 2C0IA 4RTZA 1BB9A 2EBPA 4K11A 2YUPA 2EPDA 1ABOA 1AEYA 1HJDA 1AWWA 2ENMA 2VVKA 3VS5A 2LCSA 2JXBA 2FRWA 4KRTA 2LX7A 2CT3A 3A98A 1KJWA 1X2QA 2KXDA 1X2KA 1ABQA 4RTTA 1ZLMA 4JZ4A 2C0OA 4D8KA 1Z9ZA 2KR3A 3EHRA 4RTVA 1JXOA 2AZVA 1FYNA 2HBWA 2DM1A 1PRMC 1N5ZA 1ZUKA 2PNIA 1M8MA 3REBB 2CREA 4J9FA 1GCPA 4RUGA 2NUZA 3SEMA 1H92A 3I35A 2FG0A 4OMLA 2DYBA 2HEQA 2DL3A 3H0HA 4GLMA 4AG1C 1U3OA 3CQTA 2K6DA 1ZUYA 1UECA 4HXJA 2HCKA 1AZEA 4OMQA 1I1JA 2CDTA 1CKBA 2DBKA 3PVQA 4Z89A 2DL5A 1T3SA 2JTEA 1NEGA 2K3BA 2ECZA 2FPDA 2CUBA 4JZ3A 4F14A 1ZBJA 2AKLA 1IO6A 1QKXA 2M51A 2DA9A 3I5SA 2EGCA 3U23A 1M3CA 2DL7A 2JMAA 1H3HA 1KIKA 4JJDA 3VS6A 1FMKA 2JT4A 5IHKA 2EYZA 5HCKA 2LJ3A 1J3TA 4EIKA 1H8KA 4LNPA 2SEMA 4Y92A 3JV3A 3FJ5A 2EGAA 4J9EA 1SEMA 4J9DA 3VS3A 2DE0X 2YUOA 4J9HA 2JS0A 2J05A 4RTYA 1UUEA 1OPKA 2KEAA 1NM7A 3EHQA 4R0KA 1QWEA 5I11A 2IIMA 4HVUA 2JM8A 5IXFA 2X3WD 5FWBA 1MUZA 1VYTA 2W0ZA 3TVTA 1X6GA 3M0PA 4HVVA 3EG3A 2DL4A 1M27C 1SRLA 2DNUA 4FSSA 2CSIA 2D8JA 2FO0A 2H8HA 2DRMA 2QDLA 4RTWA 2EKHA 4D8DA 1RUWA 1AWJA 3QWYA 4ESRA 1W70A 3M0TA 1WDXA 1YWPA 2DBMA 2GGRA 1SHGA 1I07A 4GBQA 1K4US 2L3QA 2JS2A 3GBQA 1UHCA 2LJ1A 2M0YA 3M0SA 2KE9A 4E6RA 1AOJA 2DMOA 3SHWA 1NLPC 1GRIA 1EFNA 1UJYA 1PRLC 1SPKA 2BZ8A 2GQIA 2V1QA 1NEBA 2O88A 3NMZC 1ARKA 4ZNXA 1NG2A 2AZSA 5IH2A 1OPLA 2DJQA 3VRZA 2F2WA 3VS2A 2EW3A 4J9CA 5GJVB 3VRYA 4HCKA 4OMNA 1M3AA 1XOVA 1GL5A 1TUDA 2FPEA 2YT6A 1BBZA 2O9SA 1JXMA 3PVLA 1CKAA 3UATA 1YN8A 3M0RA 2CH4W 1K0XA 1OV3A 3UF4A 3PE0A 2EYXA 4AFQC 2RQTA 1OEBA 1W1FA 2GNCA 2RNAA 5L23A 3EG1A 2F2XA 4RTUA 1GFDA 3NHNA 1T0HA 2DLPA 2J6KA 2RPNA 2LMJA 3THKA 2K79A 4OMMA 4CC7A 4RTXA 4AFZC 5ECAA 2DILA 4JPBW 1X69A 2BTTA 2FEIA 1BU1A 3TSZA 1Z9QA 1YCSB 2J6FA 3M0QA 1G83A 3H41A 1BK2A 5EC7A 2LP5A 1MV0B 5IHIA 2DF6A 2G6FX 2RQVA 2A36A 2A37A 4IIMA 1MV3A 1UFFA 1B3QA 2D0NA 2VKNA 4Z8AA 1UDLA 1I0CA 1GCQC 1JO8A 1W6XA 4DEYA 2BZYA 1UG1A 1AD5A 2KT1A 1GFCA 4DEXA 3H0IA 3ULRB 2BZXA 3QWXX 5IXBA 3C0CA 2LQNA 1RLPC 3M0UA 3R6NA 1WA7A 1JEGA 3EGUA 3O5ZA 5GJWB 1WIEA 1U5SA 3EG0A 3TSWA 4LE9A 2L3PA 1UHFA 2OJ2A 4AFUC 2K7AA 2KT8A 1K76A 2ABLA 4F17A
chains in the Genus database with same CATH superfamily
4BUGA 5CQXA 1QMCA 1OOTA 2ZPGB 2OX7A 2EFIA 3CCRA 1WJSA 2KYBA 4PFPA 3OYHA 2L0AA 4LD9K 1VQKT 3CCVT 3CD6Q 4M78D 4CC2A 3LLRA 1U06A 4PJOG 5LL6S 3G4SQ 2KRMA 2R5MA 1QVPA 3J7AF 4ZN1A 2ZAEA 1UE9A 4MMLA 5GMKj 4JRPA 3G6ET 3PTAA 3OBYA 3HFNA 4DOVA 1OZ2A 5KYYA 2CP0A 4Q5WA 1QCNA 4M7AD 3KBGA 2LZ6B 3V7CA 2X4XA 2CUDA 3OB9A 5J39A 1VQLA 1QLYA 5CKEA 2KRNA 5LJ5f 2XKOC 3H0FA 4JJCA 2RO0A 1N6AA 1CSKA 1XJWB 2X3XD 3CBPA 3L1AA 3X24B 4PJLA 5C6SA 5CO7A 2FZGB 1K8AU 1JBMA 2RK2A 4EMKA 2QA4A 2CGHA 1LVKA 3QZ9B 2XMFA 5GMKl 2K5LA 1HSQA 1PHTA 4M78E 2M9UA 4JRKA 4FW1A 1G3TA 1EX4A 1IZ6A 2P0PA 2H3JA 5KYXA 2X4YA 2P0KA 4M78F 3OYBA 3PGGA 1AWXA 4C92A 3VS4A 1ZHIA 1SRMA 4AMCA 1WYXA 2ED1A 2VGMA 1QCFA 3H6ZA 4C92E 2KROA 3MJXA 2IVWA 1QWFA 4M77F 3BW1A 4UC4A 4FYVB 1S1NA 1YWOA 4FYXB 1WNLA 1V1CA 4ZGEB 1I81A 4M4ZA 4M7DF 2K9GA 2PTKA 1MNEA 4A53A 2FZKB 3PMIA 2DVJA 3UA6A 4M75E 1HYOA 1WLPB 1YIJA 8ATCB 1M1GA 4N0AC 3HPWA 1OI1A 2YSQA 2MOXA 3A8OB 5FW9A 1P92A 2D8HA 2Y90A 1IHWA 1M8VA 3S3OA 3LH5A 2YUQA 1JRIA 4DBQA 1RAIB 2JNGA 2VYTA 2KXCA 1WXTA 3PMTA 2P4RA 3OSSC 5J26A 4LUDA 1C6VX 2EQKA 2QEXA 2D6FA 1SF9A 3PIOA 5KE2A 1K1ZA 2NYSA 4OMOA 4PK4A 1Y57A 4P5NA 1OX8A 2CP6A 2A0FB 2I0NA 2RN8A 1JQQA 4AG2C 4FYWB 5GAOl 3EGDA 3I9QA 4KH0B 1D3BB 2C0IA 4RTZA 1BKBA 4XU0A 2EBPA 2LRQA 2EPDA 1ABOA 1WQ7A 2COYA 4M77G 4C0GA 4M7AE 1I4K1 2KAFA 2XG8D 2ENMA 3WVEB 5CKFA 3DB3A 4C0DB 4KRTA 3TREA 1KJWA 4RKUE 3CC2Q 2HSEB 4RTTA 4QVDA 3NTIA 3TU4K 2BE7D 1YBYA 2DM1A 2NUTB 2OTJA 3REBB 4QW2A 3VU3C 2DZCA 1BI0A 3E9GA 1NBEB 1MHNA 1D1BA 1RL2A 3QDFA 2QXFA 2PVDB 5FU7B 2FG0A 2DYBA 4DBRA 1KD1C 5IT9E 4M75C 4AG1C 5KYYB 4ZTFA 3G1JA 1UECA 3MP6A 4DBFA 2WACA 2DBKA 3NFCA 3PVQA 1T3SA 5FRNA 1WZOA 2NLUA 2ECZA 2DZ9A 4N0AA 4M77B 1W2BA 3JCMf 3OMGA 5KCHA 1SSFA 4C8QC 4PNOA 2M0OA 1O9SA 1KIKA 1FMKA 3CCUQ 3G4ST 1YJNA 5IHKA 2RB6A 2LJ3A 1I5OB 1X6OA 1OU8A 4JS4A 1XTDA 3CXCA 2E1HA 2R58A 4J9DA 1PSFA 2DE0X 5KYXB 3JCMQ 4A4GA 1GXIE 2KEAA 3M55A 3EHQA 4M7AA 3SDZA 1QWEA 4HVUA 5IXFA 2X3WD 5FWBA 1MUZA 2DO3A 3TVTA 1V76A 3EG3A 2DL4A 3RUXA 3JB9F 1VQ6T 2DD4A 2DNUA 4XTYA 2FO0A 2H8HA 2NUTA 2JZ2A 5KE3A 3QXEB 2DVEA 2EKHA 5I21A 4BY6B 5GAOq 1AWJA 1TS9A 2RH2A 2DBMA 2GGRA 1K4US 2LJ1A 2NUPA 3C12A 1K8AR 4V2SA 1KC8U 1FX7A 3RDVA 1ZQ1A 5GAOm 4C92F 5GANj 4JRIA 3E2UA 2OAUA 2V1QA 4JRQA 2COZA 3JCMc 2DJQA 1BCMA 2QTVA 1V29B 4KUIA 1QQJA 4HCKA 1GL5A 1TUDA 3URGA 2RK1A 2YT6A 2O9SA 1YIJQ 2F1LA 1VQPT 2MPXC 4QQ6A 5HKCA 2DEUA 4PLIA 1Q82U 3M0RA 3EFSA 2FHDA 4F7UB 1PCXA 5HK0A 5GAOn 3PE0A 4E7IA 3M5AA 4AFQC 1WGSA 1B34A 1VUBA 5KYUB 5L23A 3M53A 2F69A 3AHUA 4DBHA 2ZPBB 2DLPA 2LMJA 2EJ9A 4PJNA 4AFZC 5ECAA 3G6EA 1R0CB 3RKYA 4ZGDB 2FEIA 3TSZA 5LJ5e 7AT1B 1YJNQ 2Y4YA 3H41A 3GF5A 1QVGS 3DB4A 1YI2T 3VYHB 4EMKB 1IHVA 2LP5A 5FU6C 1MV0B 5IHIA 2MMPA 3I55Q 3MEAA 2DF6A 2ZZDA 1YJ9Q 3VV0A 4JS5A 1OX9A 1MV3A 1VQ7T 3CCET 3PNWC 1UDLA 2JUFA 1I0CA 1OQKA 1VQ8Q 2BZYA 2EQMA 3OQ5A 1N8RU 1D1AA 1GFCA 3H0IA 2P0QA 2HKNA 2O01E 3CBOA 3OYYA 3EH2A 2LQNA 1Q7YR 5A0GA 4NL2A 1G3SA 1VQMT 3R6NA 4FSXA 2QEXT 2RM4A 2FZCB 3O5ZA 4E7KA 4JJNK 4C5GA 2JOYA 3TSWA 3G71Q 3D7SB 3FJPA 2CS7A 4OF1A 2KT8A 3GOXA 2HSPA 5GAMg 2LVMA 4J9BA 3IQLA 1WXUA 5GAN8 3CCVQ 1ZX6A 1VQLT 1E6HA 2PVGB 3NGPA 2XU8A 1BIAA 1EZZB 2A28A 2QQSA 1F1BB 2EYWA 4LUEA 1VA7A 1K9MU 4PJOC 1OZ3A 3Q1JA 1YJ9T 1VYVA 1RAEB 1MNDA 2DX1A 2HDAA 4FW2A 1TTHB 2DFUA 1QKWA 4LXCA 4OGEA 2LQKA 2OI3A 4M77E 1Q86U 2HQEA 2VC8A 2VASA 2QEXQ 1VQ4T 2GF7A 2MCNA 5GAN2 2EYYA 3ME9A 1RLQC 2FB7A 2ROLA 3VS1A 1M2OA 1LNXA 5CQYA 3CCJT 1GCQA 1PKTA 4JLGA 2NWMA 1X27A 3TEEA 3RMSA 4KT0E 3RBBB 3JCMd 2RD1A 2VXFA 1LCKA 3CCEQ 2CH4A 3S3NA 1M30A 1K0SA 5GANf 1Y96A 1S72T 1K73R 1QVGA 5LJ3g 3CC4T 3OYJA 1ZSGA 2X4JA 8AT1B 3BY7A 1YI2A 3CPWS 1VQMQ 2A3LA 3L2ZA 2LX9A 1HD3A 5A2QE 3UT1A 4KBMB 2ZPFB 3INZA 3QHSA 1OYXA 2EQJA 3LYIA 1TUCA 4M7AC 1WI7A 2QGGA 3KFVA 1WX6A 4BACA 3EFOA 2CP2A 3OYAA 1YCYA 3VJPA 2PZ1A 2PVOB 2QTXA 4J7FA 3CMEQ 4JLIA 3EH1A 2KY9A 2VUBA 4M77A 4X1VA 2K5IA 4M75A 1I8FA 1X6BA 3VS7A 4F7UA 1NYFA 1GBQA 2DAQA 4PJMA 2BKDN 1BI3A 5KYWA 3CCQT 2R57A 1E7OA 1SKUB 1MMGA 2CKKA 2HL3A 2LT1A 3CD6T 1RAGB 4PJOB 4A63B 4IUUA 2RQWA 4C5IA 2O9VA 4E7JA 2LNVA 1TXQA 2YXYA 3QYHB 1VIFA 5GAMe 2RI5A 1G2BA 1NYGA 1VQLQ 2JN0A 2OTLA 4HVWA 2YLCA 2CT4A 1VQNT 2JW4A 3JSCA 2ZPHB 5GMKi 3S3MA 5GAOp 4LDUA 3M4GA 2D1XA 3PIPA 4HCBA 2SRCA 4DA4A 3X26B 2YRDA 2AK5A 3E19A 3H9NA 2DL8A 1QCOA 2I2LA 2OAWA 3V8KA 1YJWT 4ZGJB 2EIFA 1AEYA 1AWWA 2VVKA 3VS5A 2LCSA 4LDXA 5DLOA 5IN1A 3M57A 1ABQA 4ELZC 2DD5A 4PJOE 1C0MA 2KR3A 3JB9J 4RTVA 3JCMg 1FYNA 2XICA 4QVZA 1N5ZA 1ZUKA 3LGFA 2CREA 2E10A 1RACB 4RUGA 2A7YA 1N8RR 3I35A 4HCCA 3A8MB 1WHHA 2DL3A 1ZSZC 5LJ3d 3M59A 2K6DA 4BB7A 4ELYC 4HXJA 3I56T 4ZTJA 1D0ZA 3SB2A 1AZEA 2GQVA 2YWWA 4E7HA 1NJIU 4OMQA 3CPWP 1VQNA 4FM4B 4RG2A 3CCLA 1JJ2P 1NEGA 3HKSA 2FPDA 2RJDA 1VQ7Q 4FT2A 4IUPA 2Z0WA 3RR6A 4F14A 4PLLA 1TWBA 1PD0A 1YFNA 1ZBJA 2L5QA 2DA9A 2EGCA 4XU2A 3MEWA 2JMAA 5A0DA 3VS6A 2JT4A 3FEOA 3OS5A 4J83A 3CMET 2EYQA 1Q7YC 1J3TA 2SEMA 1B7TA 1LJOA 2XDDA 1KHCA 3ZFJA 2P4TA 3CMAA 1VQ9Q 3VS3A 2JS0A 1Q82R 2RJFA 5EG2A 1UUEA 3CMAT 1OPKA 5AYFA 3SWNA 3L2RA 2LDMA 1Q86R 1U1TA 2ATCB 5I11A 2IIMA 4OB3B 1YJWQ 3I56Q 2CZ1B 2HAXA 2W0ZA 5D6XA 2XK0A 3QKJA 1M27C 1SRLA 5CKHA 4FSSA 2D8JA 3S6WA 3V7RA 3CCUT 2DRMA 2BE9B 1FMVA 2QDLA 5FLXE 4LDVA 4RTWA 2E4HA 3JB9G 5FROA 1I5LA 1RUWA 3L42A 3N5BB 4F04B 4E7LA 1SHGA 3JCMX 2LQ8A 3V8LA 1G8XA 1UHCA 4Z02A 4ZN3A 4E6RA 2QDYB 1AOJA 4JDSA 3CCRT 1NLPC 3P8DA 4E7ZA 2GQIA 2O88A 1ARKA 2V26A 2MAMA 5FRMA 2DEQA 2EW3A 2E41A 2DXCA 2QQRA 5GJVB 4B9XA 4PL6A 4KGZB 2FPEA 1UGPB 2RI2A 1BBZA 4BI8B 5GANd 3ZEHA 3PVLA 2MF2A 1S72Q 1VQ5A 1VQPQ 1VQOA 4PFZA 3CC7T 3GPLA 3CC4Q 2D9TA 1K0XA 4HT9A 1Q82C 5IAYA 1VQOT 1ZA2B 1W1FA 2XIDA 1KHIA 4LDWA 2RNAA 4OB1B 2DTOA 2DXUA 3F70A 4RTUA 2MYSA 3NHNA 3L2VA 2QQ9A 1Q81U 1XQHA 1M90C 2DILA 4JPBW 2BTTA 3SWNC 1BU1A 3CCSQ 1YCSB 3HFOA 3M0QA 1G83A 3DKMA 3HP9A 3E1SA 1BK2A 4RG8A 2OTLT 1KQ1A 4M78B 4EDUA 1TH7A 4HCZA 3JB9D 1YJNT 2K57A 3MP8A 1MMAA 4A54A 1B3QA 3CCQA 5D6YA 4IUVA 1GCQC 1H641 2EWNA 4D6WA 1ZSZB 5CKDA 1VIEA 2KT1A 4J5YA 3ULRB 3BE3A 2KI7A 2BZXA 2ZPEB 3QWXX 4C8QE 5AT1B 3CCQQ 5IXBA 3C0CA 3VUBA 4FCYA 3P8BB 2VV5A 3OYKA 3UPUA 1SG5A 4C0FA 1WA7A 1UGSB 1JEGA 4QQGA 2K2VA 1M1FA 1WHJA 3OYFA 4FL6A 1M9SA 1UHFA 3MHXA 4C92C 2DIQA 4XU1A 2K7AA 1K76A 1UGRB 3CCSA 2F5KA 4HKEA 1AVZC 2HZYA 4MMKA 2KBTA 1K73U 4C0DC 5HK3A 3RIRA 1M4ZA 1AZGB 4ORZA 3EG2A 5DY9A 4J8OA 2E3IA 2ROTA 4FU6A 3LWIA 2MK5A 3J80E 3OA6A 2E6ZA 3H8ZA 1AT1B 2QGFB 4C8QF 2AKKA 4MZTA 2VWFA 4M7AF 1YITQ 2DETA 4KGXB 3QYGB 1RI0A 2EGEA 4F7UE 3ZL7C 1RABB 4X34A 1EIFA 3V7SA 3HL8A 1PNJA 2K2MA 2B86A 3OW2A 1WFWA 2HQXA 2ZCFB 2DTIA 1YHQA 5GMKe 4J9IA 4AFSC 2LT4A 3SD4A 1UJ0A 2GBQA 5D6WA 1AHJB 4WCIA 3NTKA 4II1A 2YRVA 4IIOA 2BIVA 5GANh 3I5RA 3OS0A 1GBRA 2MWOA 1N9SA 3REAB 2XHCA 2ED0A 4M75F 1KC8C 1WPYA 2YUNA 4OB2B 1Q81R 2RQUA 1Y96B 4M7DE 1YJWA 2W10A 4BDYA 2KYMA 1D1CA 2EJGA 1K73C 4QT7A 4QVCA 3DLLA 1KQSS 5I22A 3T9NA 3L2QA 2XDPA 1T0JA 4LN2A 3QJYA 1M1KR 2F2VA 1IGQA 3JCMW 2J7IA 1HXDA 1WXBA 4MDXA 1G5VA 4CI0C 2IG0A 1VYUA 4HT8A 1G3YA 3BFMA 3EGDB 4CRIA 1N8RC 5CR2A 1ACMB 1YNZA 2O31A 2E5KA 2J06A 2HNIA 1B34B 5GMKm 2O4XB 1FWZA 4NL3A 5I2SA 2ESWA 5LJ3h 2C06A 6AT1B 4N4HA 3OS2A 4C8QG 2KGTA 1PM3A 4X9DA 3FC3A 1ZSZA 1PG5B 1SHFA 3EGXB 1KQSP 3A8GB 1NLOC 3LH0A 4R55A 4PJJA 2V8KA 3TCJA 2E70A 3QPHA 2FRYA 3CCST 4EMKC 2AIRB 4IUQA 5KYUA 2RQRA 1WHKA 2GTOA 4JJBA 2L2PA 4C92B 1KFZA 3LW5E 2RHIA 2JJ9A 3CCJQ 1ZA1B 4K11A 1VQ8T 2YUPA 1W2BP 2LTOA 1HJDA 1BIBA 2FRWA 4OGCA 3OYDA 2JVVA 3CC4A 2CT3A 1RADB 2AT1B 1VQKA 3A98A 3GNGA 3A8HB 4DQ2A 1VQOQ 3E9FA 1X2KA 1VQPA 1S72A 1VQ5Q 1ZLMA 2C0OA 4NOYA 2V8IA 4QKUA 5I2MA 3L2WA 1PRMC 2AZVA 2PNIA 5C0MA 4Y28E 2V8JA 5DLQE 4J9FA 1VQ4A 3CEYA 3SEMA 1K9MC 1H92A 5CCAA 3JCMe 5LJ5j 3H0HA 2E5QA 3M4YA 1VQ6Q 2NUPB 3CQTA 4QQDA 2COWA 1ZUYA 1I1JA 2L89A 4RCBA 5CAIA 4A4HA 4PJOF 2DL5A 3KXTA 1KD1R 2JTEA 4PJOD 2DIGA 3OY9A 2M16A 4GLKA 4XU3A 1R8OB 1UGQB 2AKLA 1QVFS 2M51A 4C5HA 3HRUA 1YIJT 3GP8A 3U23A 1VQ6A 1H3HA 2RHUA 1R0BG 4JJDA 1O75A 4L5GA 4FYYB 2EYZA 5HCKA 3CMEA 1WHMA 3BDUA 4EIKA 1H8KA 1LOJA 4LNPA 3CC7A 3CPWA 2MI6A 3M9QA 4Y92A 3VUZA 2EAYA 1M5Q1 4E2FB 3UDCA 1SEMA 3WXMB 3JCMJ 1VQ9A 3CMAQ 5GMKh 2JTMA 4M75B 1X75C 9ATCB 2GFUA 3V8JA 5KYNA 1VQKQ 4GY5A 2JM8A 1BI2A 5GANe 5LJ5g 3CCLT 1VYTA 3SFMA 3OS1A 4HVVA 2CP7A 3HTRA 3R6OA 3SWNB 5GAN5 1WQWA 3RERA 3CBMA 1DJ7B 3X28B 2DERA 1VQ7A 4ESRA 2M1HA 3FLGA 3M0TA 1WDXA 1YWPA 2KMTA 1I07A 4GBQA 4EMGA 3CCLQ 2HD0A 2JS2A 1KQ2A 2EQUA 3M0SA 3M56A 2RHZA 4C0ZA 1VQNQ 4EPCA 4XTZA 1WJQA 2DMOA 5GAMf 3OW2S 1UJYA 1PRLC 1SPKA 4E47A 3NMZC 4ZNXA 3MKDA 2AZSA 1OPLA 1W4SA 1U8RA 3VRZA 3OYIA 1JJ2A 3VS2A 1RAHB 2QAZA 3EFOB 2L3RA 2P84A 2E3HA 1WJRA 1YN8A 1K9MR 3QUIA 1JB0E 4M7DD 3UF4A 4N4IA 4BY6C 2YHTA 2XD0A 1OEBA 2GNCA 3PT9A 3HSBA 5KYWB 3EG1A 3P8HA 1PC0A 2F2XA 2DKGA 2B8AA 3FB9A 3C95A 5FU6B 3THKA 3CCVA 1IXDA 2K79A 4OMMA 1UEBA 3EGXA 3DLMA 2HKQB 1QVGP 3M58A 1IRXA 5HY6A 5LJ3f 3OYMA 3CC7Q 2X51A 4M7AG 2RHYA 1Z9QA 2J6FA 2GFAA 2OTLQ 1UB4A 2K3XA 2G6FX 2A36A 2KQWA 2A37A 4IIMA 2WSEE 4J7IA 3VYGA 3CXCS 2D0NA 2VKNA 2X35A 4Z8AA 4XTVA 3ZBDA 2YLBA 4YTLA 5GANg 3BDLA 4BD3A 2F5TX 3MPUB 1PSEA 4DEXA 4A4FA 2M02A 2L8DA 3HRTA 1HK9A 2DTHA 1YHQQ 4C8QA 4ATOA 3OYGA 3I55A 5KH6A 1VQ4Q 1M2VB 1WIEA 1U5SA 3EG0A 4LE9A 5A0LA 3JCMV 3CCMT 2KNBB 4PKCC 4IKFA 1A0NB 2V1RA 2JTFA 1YP5A 4M78G 4XAXB 2LJ0A 5LJ3e 4C8QD 2JM9A 5CKBA 4CC3A 1VQMA 3VKIA 2LQWA 5CVIA 2J6OA 1JJ2S 1PWTA 2C0TA 3CCJA 2HL5C 4OMFB 1KSWA 3J81E 4F16A 1VQ9T 5DM7R 2QA4T 4MDWA 3CCEA 2HBPA 1K8AC 2X4WA 1Q81C 2CP3A 4L59A 1G3WA 4MZPA 1QP3A 5FWCA 1YITT 1X43A 1N27A 2YDLA 1X01A 2KRSA 5GAMh 1U1SA 2CSQA 3AT1B 4BE0A 4NS5A 1BYMA 4FT4A 2A08A 1Q7YU 1QW1A 3RKWA 2LNHB 3OSVA 4Y91A 3OYEA 3RKXA 2QYZA 3A1PA 1TSFA 3RESA 1ZBXA 2QG9B 2KDSA 3UWNA 2DYIA 4C92D 2JMCA 2X9HA 4M78A 1W2BS 4RMOA 5CIUA 1PKSA 1QVFP 4WTOB 1QVFA 2RF0A 2L3SA 5GAMj 4O5VA 1SSHA 4XQ3A 2DK3A 4E7SA 1Y0MA 4M77D 2EQIA 3VS0A 1MMNA 1RI9A 1UTIA 3RNJA 1B07A 5D7UA 1KK7A 4F7UF 2DXTA 2DPPB 3M54A 4Z88A 2RMOA 1M3BA 5GAN3 3G71A 4BI3A 3OYLA 3UA7A 1AWOA 2EVRA 2CZ7B 1K9AA 1NJIR 1UGVA 3JCMb 2ZPIB 1T3LA 2KK4A 3CCUA 1BCOA 3QSUA 4M7AB 2CYZB 3NPFA 2WSCE 3OMCA 4IUTA 1ZUUA 1N9RA 4IURA 1JU5C 2RJCA 4BE1A 5KCOA 2O2OA 1VQ8A 5IHNA 5GAMd 1Q86C 1TG0A 3LX7A 3TQ7P 2K5FA 1FXXA 2MIOA 1NPPA 3C94A 2HMAA 4KH1B 4OMPA 1YJ9A 3QO3A 5M9OA 1KG1A 4F7UG 4HA8A 5LJ3j 2QI2A 2O4XA 5GAN6 1KC8R 2RJEA 2E12A 2GTJA 1QP2A 1D0YA 1XNIA 4LDYA 2DRKA 2FPFA 3G6EQ 2XDBA 2DXBA 2QQAA 1E6GA 2RI3A 4CC4B 1YITA 4M78C 1IREB 4X9CA 4DOWA 1RAAB 1M2VA 3EAEA 4J9GA 1BB9A 2K3YA 4M7DA 3EFRA 1M90R 2LCLA 4C92G 5CK9A 2K4YA 4PFOA 2JXBA 4PJOA 4EMHA 2LX7A 2AHJB 3QG1A 1X2QA 2KXDA 4XTXA 4R56A 4B6MA 1MGQA 3CPFA 4JZ4A 4D8KA 4M7DG 1Z9ZA 3EHRA 3KUFA 1JXOA 2HBWA 2E64A 3OYCA 1M8MA 1FMWA 2RA2A 1GCPA 2EJFA 2NUZA 3X20B 2HQHA 3MP1A 2R5AA 4ME7A 4OMLA 3QZ5B 2HEQA 2YRCA 1TOVA 4GLMA 1Y71A 2Y4XA 1NJIC 1M1KU 1U3OA 2CZ6B 3X25B 2EKOA 3FRNA 2HCKA 2CDTA 1CKBA 4Z89A 1D0XA 5GAN7 4VUBA 3L2UA 4KGVB 3O8VA 2K3BA 2CUBA 2KVQG 3EG9B 4JZ3A 4AT1B 3HHTB 1IGUA 3QJ6A 1R77A 1IO6A 1QKXA 3I5SA 2FL7A 3OBWA 1M3CA 2DL7A 4J6WA 4N4GA 1OU9A 3A5ZB 5GAOr 2LC4A 3JAME 1YHQT 3LGLA 3FJ5A 2EGAA 1WHGA 5GAN4 2XI9A 4J9EA 1NZ9A 2VGNA 4C8QB 1C1AA 2YUOA 3QBYA 4J9HA 2J05A 4RTYA 4RCCA 2VXEA 3MCAB 3RMQA 4XTUA 1KQSA 1NM7A 3MEUA 4WF2A 4R0KA 3NTHA 4M7DC 1OULA 2ZGWA 1H3ZA 1M1KC 1X6GA 3M0PA 1Y07A 2E65A 2CZ0B 2CSIA 4FIBA 4L6V5 4C5EA 3CXCP 2BUDA 3WVDB 3EG9A 2E6NA 4TVRA 4D8DA 5LJ5d 4M75D 4M77C 3QWYA 1W70A 2DJZA 3QDRB 5FU7C 2QA4Q 2L3QA 3GBQA 2M0YA 2KE9A 3MEVA 1BI1A 3SHWA 3JCMh 1TUGB 1GRIA 1EFNA 4A4KA 2BZ8A 1NEBA 3JCMP 1RAFB 3PFSA 5L8RE 3FIFA 1NG2A 2PUOB 5IH2A 2QK0A 1NPRA 1VOMA 2F2WA 4MZMA 4J9CA 1D09B 4KULA 3LWHA 3VRYA 3OYNA 4OMNA 1M3AA 1XOVA 4LD6A 2H3EB 3A8LB 3C4SA 2OTJQ 4B9WA 1JXMA 4XK8E 1CKAA 3UATA 3CC2A 3ASKA 4BE2A 3META 2PUKB 2QASA 2RHXA 2CH4W 4OVAA 1OV3A 3G4SA 1LPLA 2EYXA 3CC2T 1Y7XA 2RQTA 3CD6A 3I56A 3QIIA 1GFDA 1T0HA 1MMDA 2J6KA 2RPNA 3CCRQ 4M7DB 3ER0A 4CC7A 4OB0B 4RTXA 2LCCA 3JB9H 1X69A 3OW2P 1M90U 1TU0B 3I55T 2CP5A 4JUVA 3JB9I 2VB6A 1Q95G 1YI2Q 4XTWA 5EC7A 2QQBA 2D0QB 5LJ5h 1KD1U 2RQVA 3CCMA 3MO8A 4M75G 1PD1A 4OP0A 2FYKA 4J6XA 1VQ5T 2KSSA 2MWPA 1UFFA 2GCXA 2OTJT 4BDZA 2FVUA 3GNFB 4A4EA 1JO8A 2WSFE 3GIBA 1W6XA 4DEYA 1UG1A 1AD5A 1IB8A 3GLXA 2PQWA 2G3RA 3G7ZA 1RLPC 3HRSA 4J6YA 3M0UA 3JRZA 3CCMQ 5J3BA 3EGUA 4KUDK 5GJWB 3FDRA 2PU9B 2IPOB 3G71T 1WHLA 4O6JA 4ANJA 4BI4A 2L3PA 1NE8A 2OJ2A 4AFUC 1D3BA 3JV3A 2ABLA 4F17A
chains in the Genus database with same CATH topology
2KNBB 2HSPA 1AVZC 2KBTA 4J9BA 3IQLA 1OOTA 1A0NB 2V1RA 1WXUA 1ZX6A 1YP5A 2LJ0A 2KYBA 2JM9A 4CC3A 1E6HA 3NGPA 1AZGB 4ORZA 2L0AA 3EG2A 2LQWA 2J6OA 2A28A 2ROTA 2EYWA 4LUEA 1VA7A 1PWTA 2C0TA 4CC2A 1U06A 1KSWA 1VYVA 2AKKA 4F16A 2KRMA 2DX1A 2HDAA 2VWFA 1QKWA 1UE9A 2OI3A 2EGEA 3ZL7C 5FWCA 1X43A 2YDLA 2KRSA 1PNJA 2CSQA 2K2MA 2MCNA 2LZ6B 2EYYA 2B86A 2CUDA 1RLQC 2A08A 1QLYA 1WFWA 2ROLA 2KRNA 3VS1A 2LNHB 3H0FA 4JJCA 1CSKA 2X3XD 4J9IA 1GCQA 1PKTA 4AFSC 2NWMA 1UJ0A 1X27A 2GBQA 2JMCA 3RBBB 4WCIA 1LCKA 2CH4A 2XMFA 4IIOA 1PKSA 1HSQA 1M30A 1K0SA 1PHTA 3I5RA 2RF0A 2L3SA 1GBRA 1SSHA 3REAB 2ED0A 2YUNA 1ZSGA 1Y0MA 1AWXA 2RQUA 2EQIA 2W10A 3VS4A 1HD3A 2KYMA 3VS0A 1RI9A 4QT7A 1UTIA 3RNJA 1SRMA 1B07A 1WYXA 2ED1A 1QCFA 5I22A 1TUCA 2KROA 1QWFA 1WI7A 1T0JA 3KFVA 4LN2A 4Z88A 1WX6A 2RMOA 2F2VA 1M3BA 1S1NA 3UA7A 1AWOA 2EVRA 1K9AA 1YWOA 2PZ1A 1UGVA 2J7IA 1T3LA 1V1CA 1WXBA 4M4ZA 1VYUA 2K9GA 4X1VA 1X6BA 3NPFA 3VS7A 1ZUUA 1NYFA 2PTKA 1GBQA 1YNZA 2O31A 2E5KA 2J06A 1JU5C 2DVJA 3UA6A 2O2OA 1WLPB 5IHNA 1TG0A 1E7OA 2YSQA 2MIOA 2MOXA 4A63B 2ESWA 2RQWA 4OMPA 5FW9A 2O9VA 2D8HA 1G2BA 1NYGA 2KGTA 3LH5A 2YUQA 1SHFA 4HVWA 2CT4A 2JW4A 2KXCA 1WXTA 2P4RA 1NLOC 2GTJA 4LUDA 2D1XA 2DRKA 2SRCA 2FPFA 1K1ZA 4OMOA 1E6GA 1Y57A 2FRYA 4CC4B 2I0NA 2RQRA 2RN8A 2AK5A 1JQQA 2GTOA 4JJBA 4AG2C 2DL8A 2OAWA 2L2PA 3I9QA 1KFZA 4J9GA 2C0IA 4RTZA 1BB9A 2EBPA 4K11A 2YUPA 2EPDA 1ABOA 1AEYA 1HJDA 1AWWA 2ENMA 2VVKA 3VS5A 2LCSA 2JXBA 2FRWA 4KRTA 2LX7A 2CT3A 3A98A 1KJWA 1X2QA 2KXDA 1X2KA 1ABQA 4RTTA 1ZLMA 4JZ4A 2C0OA 4D8KA 1Z9ZA 2KR3A 3EHRA 4RTVA 1JXOA 2AZVA 1FYNA 2HBWA 2DM1A 1PRMC 1N5ZA 1ZUKA 2PNIA 1M8MA 3REBB 2CREA 4J9FA 1GCPA 4RUGA 2NUZA 3SEMA 1H92A 3I35A 2FG0A 4OMLA 2DYBA 2HEQA 2DL3A 3H0HA 4GLMA 4AG1C 1U3OA 3CQTA 2K6DA 1ZUYA 1UECA 4HXJA 2HCKA 1AZEA 4OMQA 1I1JA 2CDTA 1CKBA 2DBKA 3PVQA 4Z89A 2DL5A 1T3SA 2JTEA 1NEGA 2K3BA 2ECZA 2FPDA 2CUBA 4JZ3A 4F14A 1ZBJA 2AKLA 1IO6A 1QKXA 2M51A 2DA9A 3I5SA 2EGCA 3U23A 1M3CA 2DL7A 2JMAA 1H3HA 1KIKA 4JJDA 3VS6A 1FMKA 2JT4A 5IHKA 2EYZA 5HCKA 2LJ3A 1J3TA 4EIKA 1H8KA 4LNPA 2SEMA 4Y92A 3JV3A 3FJ5A 2EGAA 4J9EA 1SEMA 4J9DA 3VS3A 2DE0X 2YUOA 4J9HA 2JS0A 2J05A 4RTYA 1UUEA 1OPKA 2KEAA 1NM7A 3EHQA 4R0KA 1QWEA 5I11A 2IIMA 4HVUA 2JM8A 5IXFA 2X3WD 5FWBA 1MUZA 1VYTA 2W0ZA 3TVTA 1X6GA 3M0PA 4HVVA 3EG3A 2DL4A 1M27C 1SRLA 2DNUA 4FSSA 2CSIA 2D8JA 2FO0A 2H8HA 2DRMA 2QDLA 4RTWA 2EKHA 4D8DA 1RUWA 1AWJA 3QWYA 4ESRA 1W70A 3M0TA 1WDXA 1YWPA 2DBMA 2GGRA 1SHGA 1I07A 4GBQA 1K4US 2L3QA 2JS2A 3GBQA 1UHCA 2LJ1A 2M0YA 3M0SA 2KE9A 4E6RA 1AOJA 2DMOA 3SHWA 1NLPC 1GRIA 1EFNA 1UJYA 1PRLC 1SPKA 2BZ8A 2GQIA 2V1QA 1NEBA 2O88A 3NMZC 1ARKA 4ZNXA 1NG2A 2AZSA 5IH2A 1OPLA 2DJQA 3VRZA 2F2WA 3VS2A 2EW3A 4J9CA 5GJVB 3VRYA 4HCKA 4OMNA 1M3AA 1XOVA 1GL5A 1TUDA 2FPEA 2YT6A 1BBZA 2O9SA 1JXMA 3PVLA 1CKAA 3UATA 1YN8A 3M0RA 2CH4W 1K0XA 1OV3A 3UF4A 3PE0A 2EYXA 4AFQC 2RQTA 1OEBA 1W1FA 2GNCA 2RNAA 5L23A 3EG1A 2F2XA 4RTUA 1GFDA 3NHNA 1T0HA 2DLPA 2J6KA 2RPNA 2LMJA 3THKA 2K79A 4OMMA 4CC7A 4RTXA 4AFZC 5ECAA 2DILA 4JPBW 1X69A 2BTTA 2FEIA 1BU1A 3TSZA 1Z9QA 1YCSB 2J6FA 3M0QA 1G83A 3H41A 1BK2A 5EC7A 2LP5A 1MV0B 5IHIA 2DF6A 2G6FX 2RQVA 2A36A 2A37A 4IIMA 1MV3A 1UFFA 1B3QA 2D0NA 2VKNA 4Z8AA 1UDLA 1I0CA 1GCQC 1JO8A 1W6XA 4DEYA 2BZYA 1UG1A 1AD5A 2KT1A 1GFCA 4DEXA 3H0IA 3ULRB 2BZXA 3QWXX 5IXBA 3C0CA 2LQNA 1RLPC 3M0UA 3R6NA 1WA7A 1JEGA 3EGUA 3O5ZA 5GJWB 1WIEA 1U5SA 3EG0A 3TSWA 4LE9A 2L3PA 1UHFA 2OJ2A 4AFUC 2K7AA 2KT8A 1K76A 2ABLA 4F17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNB B;  2HSP A;  1AVZ C;  2KBT A;  4J9B A;  3IQL A;  1OOT A;  1A0N B;  2V1R A;  1WXU A;  1ZX6 A;  1YP5 A;  2LJ0 A;  2KYB A;  2JM9 A;  4CC3 A;  1E6H A;  3NGP A;  1AZG B;  4ORZ A;  2L0A A;  3EG2 A;  2LQW A;  2J6O A;  2A28 A;  2ROT A;  2EYW A;  4LUE A;  1VA7 A;  1PWT A;  2C0T A;  4CC2 A;  1U06 A;  1KSW A;  1VYV A;  2AKK A;  4F16 A;  2KRM A;  2DX1 A;  2HDA A;  2VWF A;  1QKW A;  1UE9 A;  2OI3 A;  2EGE A;  3ZL7 C;  5FWC A;  1X43 A;  2YDL A;  2KRS A;  1PNJ A;  2CSQ A;  2K2M A;  2MCN A;  2LZ6 B;  2EYY A;  2B86 A;  2CUD A;  1RLQ C;  2A08 A;  1QLY A;  1WFW A;  2ROL A;  2KRN A;  3VS1 A;  2LNH B;  3H0F A;  4JJC A;  1CSK A;  2X3X D;  4J9I A;  1GCQ A;  1PKT A;  4AFS C;  2NWM A;  1UJ0 A;  1X27 A;  2GBQ A;  2JMC A;  3RBB B;  4WCI A;  1LCK A;  2CH4 A;  2XMF A;  4IIO A;  1PKS A;  1HSQ A;  1M30 A;  1K0S A;  1PHT A;  3I5R A;  2RF0 A;  2L3S A;  1GBR A;  1SSH A;  3REA B;  2ED0 A;  2YUN A;  1ZSG A;  1Y0M A;  1AWX A;  2RQU A;  2EQI A;  2W10 A;  3VS4 A;  1HD3 A;  2KYM A;  3VS0 A;  1RI9 A;  4QT7 A;  1UTI A;  3RNJ A;  1SRM A;  1B07 A;  1WYX A;  2ED1 A;  1QCF A;  5I22 A;  1TUC A;  2KRO A;  1QWF A;  1WI7 A;  1T0J A;  3KFV A;  4LN2 A;  4Z88 A;  1WX6 A;  2RMO A;  2F2V A;  1M3B A;  1S1N A;  3UA7 A;  1AWO A;  2EVR A;  1K9A A;  1YWO A;  2PZ1 A;  1UGV A;  2J7I A;  1T3L A;  1V1C A;  1WXB A;  4M4Z A;  1VYU A;  2K9G A;  4X1V A;  1X6B A;  3NPF A;  3VS7 A;  1ZUU A;  1NYF A;  2PTK A;  1GBQ A;  1YNZ A;  2O31 A;  2E5K A;  2J06 A;  1JU5 C;  2DVJ A;  3UA6 A;  2O2O A;  1WLP B;  5IHN A;  1TG0 A;  1E7O A;  2YSQ A;  2MIO A;  2MOX A;  4A63 B;  2ESW A;  2RQW A;  4OMP A;  5FW9 A;  2O9V A;  2D8H A;  1G2B A;  1NYG A;  2KGT A;  3LH5 A;  2YUQ A;  1SHF A;  4HVW A;  2CT4 A;  2JW4 A;  2KXC A;  1WXT A;  2P4R A;  1NLO C;  2GTJ A;  4LUD A;  2D1X A;  2DRK A;  2SRC A;  2FPF A;  1K1Z A;  4OMO A;  1E6G A;  1Y57 A;  2FRY A;  4CC4 B;  2I0N A;  2RQR A;  2RN8 A;  2AK5 A;  1JQQ A;  2GTO A;  4JJB A;  4AG2 C;  2DL8 A;  2OAW A;  2L2P A;  3I9Q A;  1KFZ A;  4J9G A;  2C0I A;  4RTZ A;  1BB9 A;  2EBP A;  4K11 A;  2YUP A;  2EPD A;  1ABO A;  1AEY A;  1HJD A;  1AWW A;  2ENM A;  2VVK A;  3VS5 A;  2LCS A;  2JXB A;  2FRW A;  4KRT A;  2LX7 A;  2CT3 A;  3A98 A;  1KJW A;  1X2Q A;  2KXD A;  1X2K A;  1ABQ A;  4RTT A;  1ZLM A;  4JZ4 A;  2C0O A;  4D8K A;  1Z9Z A;  2KR3 A;  3EHR A;  4RTV A;  1JXO A;  2AZV A;  1FYN A;  2HBW A;  2DM1 A;  1PRM C;  1N5Z A;  1ZUK A;  2PNI A;  1M8M A;  3REB B;  2CRE A;  4J9F A;  1GCP A;  4RUG A;  2NUZ A;  3SEM A;  1H92 A;  3I35 A;  2FG0 A;  4OML A;  2DYB A;  2HEQ A;  2DL3 A;  3H0H A;  4GLM A;  4AG1 C;  1U3O A;  3CQT A;  2K6D A;  1ZUY A;  1UEC A;  4HXJ A;  2HCK A;  1AZE A;  4OMQ A;  1I1J A;  2CDT A;  1CKB A;  2DBK A;  3PVQ A;  4Z89 A;  2DL5 A;  1T3S A;  2JTE A;  1NEG A;  2K3B A;  2ECZ A;  2FPD A;  2CUB A;  4JZ3 A;  4F14 A;  1ZBJ A;  2AKL A;  1IO6 A;  1QKX A;  2M51 A;  2DA9 A;  3I5S A;  2EGC A;  3U23 A;  1M3C A;  2DL7 A;  2JMA A;  1H3H A;  1KIK A;  4JJD A;  3VS6 A;  1FMK A;  2JT4 A;  5IHK A;  2EYZ A;  5HCK A;  2LJ3 A;  1J3T A;  4EIK A;  1H8K A;  4LNP A;  2SEM A;  4Y92 A;  3JV3 A;  3FJ5 A;  2EGA A;  4J9E A;  1SEM A;  4J9D A;  3VS3 A;  2DE0 X;  2YUO A;  4J9H A;  2JS0 A;  2J05 A;  4RTY A;  1UUE A;  1OPK A;  2KEA A;  1NM7 A;  3EHQ A;  4R0K A;  1QWE A;  5I11 A;  2IIM A;  4HVU A;  2JM8 A;  5IXF A;  2X3W D;  5FWB A;  1MUZ A;  1VYT A;  2W0Z A;  3TVT A;  1X6G A;  3M0P A;  4HVV A;  3EG3 A;  2DL4 A;  1M27 C;  1SRL A;  2DNU A;  4FSS A;  2CSI A;  2D8J A;  2FO0 A;  2H8H A;  2DRM A;  2QDL A;  4RTW A;  2EKH A;  4D8D A;  1RUW A;  1AWJ A;  3QWY A;  4ESR A;  1W70 A;  3M0T A;  1WDX A;  1YWP A;  2DBM A;  2GGR A;  1SHG A;  1I07 A;  4GBQ A;  1K4U S;  2L3Q A;  2JS2 A;  3GBQ A;  1UHC A;  2LJ1 A;  2M0Y A;  3M0S A;  2KE9 A;  4E6R A;  1AOJ A;  2DMO A;  3SHW A;  1NLP C;  1GRI A;  1EFN A;  1UJY A;  1PRL C;  1SPK A;  2BZ8 A;  2GQI A;  2V1Q A;  1NEB A;  2O88 A;  3NMZ C;  1ARK A;  4ZNX A;  1NG2 A;  2AZS A;  5IH2 A;  1OPL A;  2DJQ A;  3VRZ A;  2F2W A;  3VS2 A;  2EW3 A;  4J9C A;  5GJV B;  3VRY A;  4HCK A;  4OMN A;  1M3A A;  1XOV A;  1GL5 A;  1TUD A;  2FPE A;  2YT6 A;  1BBZ A;  2O9S A;  1JXM A;  3PVL A;  1CKA A;  3UAT A;  1YN8 A;  3M0R A;  2CH4 W;  1K0X A;  1OV3 A;  3UF4 A;  3PE0 A;  2EYX A;  4AFQ C;  2RQT A;  1OEB A;  1W1F A;  2GNC A;  2RNA A;  5L23 A;  3EG1 A;  2F2X A;  4RTU A;  1GFD A;  3NHN A;  1T0H A;  2DLP A;  2J6K A;  2RPN A;  2LMJ A;  3THK A;  2K79 A;  4OMM A;  4CC7 A;  4RTX A;  4AFZ C;  5ECA A;  2DIL A;  4JPB W;  1X69 A;  2BTT A;  2FEI A;  1BU1 A;  3TSZ A;  1Z9Q A;  1YCS B;  2J6F A;  3M0Q A;  1G83 A;  3H41 A;  1BK2 A;  5EC7 A;  2LP5 A;  1MV0 B;  5IHI A;  2DF6 A;  2G6F X;  2RQV A;  2A36 A;  2A37 A;  4IIM A;  1MV3 A;  1UFF A;  1B3Q A;  2D0N A;  2VKN A;  4Z8A A;  1UDL A;  1I0C A;  1GCQ C;  1JO8 A;  1W6X A;  4DEY A;  2BZY A;  1UG1 A;  1AD5 A;  2KT1 A;  1GFC A;  4DEX A;  3H0I A;  3ULR B;  2BZX A;  3QWX X;  5IXB A;  3C0C A;  2LQN A;  1RLP C;  3M0U A;  3R6N A;  1WA7 A;  1JEG A;  3EGU A;  3O5Z A;  5GJW B;  1WIE A;  1U5S A;  3EG0 A;  3TSW A;  4LE9 A;  2L3P A;  1UHF A;  2OJ2 A;  4AFU C;  2K7A A;  2KT8 A;  1K76 A;  2ABL A;  4F17 A; 
#chains in the Genus database with same CATH topology
 4BUG A;  5CQX A;  1QMC A;  1OOT A;  2ZPG B;  2OX7 A;  2EFI A;  3CCR A;  1WJS A;  2KYB A;  4PFP A;  3OYH A;  2L0A A;  4LD9 K;  1VQK T;  3CCV T;  3CD6 Q;  4M78 D;  4CC2 A;  3LLR A;  1U06 A;  4PJO G;  5LL6 S;  3G4S Q;  2KRM A;  2R5M A;  1QVP A;  3J7A F;  4ZN1 A;  2ZAE A;  1UE9 A;  4MML A;  5GMK j;  4JRP A;  3G6E T;  3PTA A;  3OBY A;  3HFN A;  4DOV A;  1OZ2 A;  5KYY A;  2CP0 A;  4Q5W A;  1QCN A;  4M7A D;  3KBG A;  2LZ6 B;  3V7C A;  2X4X A;  2CUD A;  3OB9 A;  5J39 A;  1VQL A;  1QLY A;  5CKE A;  2KRN A;  5LJ5 f;  2XKO C;  3H0F A;  4JJC A;  2RO0 A;  1N6A A;  1CSK A;  1XJW B;  2X3X D;  3CBP A;  3L1A A;  3X24 B;  4PJL A;  5C6S A;  5CO7 A;  2FZG B;  1K8A U;  1JBM A;  2RK2 A;  4EMK A;  2QA4 A;  2CGH A;  1LVK A;  3QZ9 B;  2XMF A;  5GMK l;  2K5L A;  1HSQ A;  1PHT A;  4M78 E;  2M9U A;  4JRK A;  4FW1 A;  1G3T A;  1EX4 A;  1IZ6 A;  2P0P A;  2H3J A;  5KYX A;  2X4Y A;  2P0K A;  4M78 F;  3OYB A;  3PGG A;  1AWX A;  4C92 A;  3VS4 A;  1ZHI A;  1SRM A;  4AMC A;  1WYX A;  2ED1 A;  2VGM A;  1QCF A;  3H6Z A;  4C92 E;  2KRO A;  3MJX A;  2IVW A;  1QWF A;  4M77 F;  3BW1 A;  4UC4 A;  4FYV B;  1S1N A;  1YWO A;  4FYX B;  1WNL A;  1V1C A;  4ZGE B;  1I81 A;  4M4Z A;  4M7D F;  2K9G A;  2PTK A;  1MNE A;  4A53 A;  2FZK B;  3PMI A;  2DVJ A;  3UA6 A;  4M75 E;  1HYO A;  1WLP B;  1YIJ A;  8ATC B;  1M1G A;  4N0A C;  3HPW A;  1OI1 A;  2YSQ A;  2MOX A;  3A8O B;  5FW9 A;  1P92 A;  2D8H A;  2Y90 A;  1IHW A;  1M8V A;  3S3O A;  3LH5 A;  2YUQ A;  1JRI A;  4DBQ A;  1RAI B;  2JNG A;  2VYT A;  2KXC A;  1WXT A;  3PMT A;  2P4R A;  3OSS C;  5J26 A;  4LUD A;  1C6V X;  2EQK A;  2QEX A;  2D6F A;  1SF9 A;  3PIO A;  5KE2 A;  1K1Z A;  2NYS A;  4OMO A;  4PK4 A;  1Y57 A;  4P5N A;  1OX8 A;  2CP6 A;  2A0F B;  2I0N A;  2RN8 A;  1JQQ A;  4AG2 C;  4FYW B;  5GAO l;  3EGD A;  3I9Q A;  4KH0 B;  1D3B B;  2C0I A;  4RTZ A;  1BKB A;  4XU0 A;  2EBP A;  2LRQ A;  2EPD A;  1ABO A;  1WQ7 A;  2COY A;  4M77 G;  4C0G A;  4M7A E;  1I4K 1;  2KAF A;  2XG8 D;  2ENM A;  3WVE B;  5CKF A;  3DB3 A;  4C0D B;  4KRT A;  3TRE A;  1KJW A;  4RKU E;  3CC2 Q;  2HSE B;  4RTT A;  4QVD A;  3NTI A;  3TU4 K;  2BE7 D;  1YBY A;  2DM1 A;  2NUT B;  2OTJ A;  3REB B;  4QW2 A;  3VU3 C;  2DZC A;  1BI0 A;  3E9G A;  1NBE B;  1MHN A;  1D1B A;  1RL2 A;  3QDF A;  2QXF A;  2PVD B;  5FU7 B;  2FG0 A;  2DYB A;  4DBR A;  1KD1 C;  5IT9 E;  4M75 C;  4AG1 C;  5KYY B;  4ZTF A;  3G1J A;  1UEC A;  3MP6 A;  4DBF A;  2WAC A;  2DBK A;  3NFC A;  3PVQ A;  1T3S A;  5FRN A;  1WZO A;  2NLU A;  2ECZ A;  2DZ9 A;  4N0A A;  4M77 B;  1W2B A;  3JCM f;  3OMG A;  5KCH A;  1SSF A;  4C8Q C;  4PNO A;  2M0O A;  1O9S A;  1KIK A;  1FMK A;  3CCU Q;  3G4S T;  1YJN A;  5IHK A;  2RB6 A;  2LJ3 A;  1I5O B;  1X6O A;  1OU8 A;  4JS4 A;  1XTD A;  3CXC A;  2E1H A;  2R58 A;  4J9D A;  1PSF A;  2DE0 X;  5KYX B;  3JCM Q;  4A4G A;  1GXI E;  2KEA A;  3M55 A;  3EHQ A;  4M7A A;  3SDZ A;  1QWE A;  4HVU A;  5IXF A;  2X3W D;  5FWB A;  1MUZ A;  2DO3 A;  3TVT A;  1V76 A;  3EG3 A;  2DL4 A;  3RUX A;  3JB9 F;  1VQ6 T;  2DD4 A;  2DNU A;  4XTY A;  2FO0 A;  2H8H A;  2NUT A;  2JZ2 A;  5KE3 A;  3QXE B;  2DVE A;  2EKH A;  5I21 A;  4BY6 B;  5GAO q;  1AWJ A;  1TS9 A;  2RH2 A;  2DBM A;  2GGR A;  1K4U S;  2LJ1 A;  2NUP A;  3C12 A;  1K8A R;  4V2S A;  1KC8 U;  1FX7 A;  3RDV A;  1ZQ1 A;  5GAO m;  4C92 F;  5GAN j;  4JRI A;  3E2U A;  2OAU A;  2V1Q A;  4JRQ A;  2COZ A;  3JCM c;  2DJQ A;  1BCM A;  2QTV A;  1V29 B;  4KUI A;  1QQJ A;  4HCK A;  1GL5 A;  1TUD A;  3URG A;  2RK1 A;  2YT6 A;  2O9S A;  1YIJ Q;  2F1L A;  1VQP T;  2MPX C;  4QQ6 A;  5HKC A;  2DEU A;  4PLI A;  1Q82 U;  3M0R A;  3EFS A;  2FHD A;  4F7U B;  1PCX A;  5HK0 A;  5GAO n;  3PE0 A;  4E7I A;  3M5A A;  4AFQ C;  1WGS A;  1B34 A;  1VUB A;  5KYU B;  5L23 A;  3M53 A;  2F69 A;  3AHU A;  4DBH A;  2ZPB B;  2DLP A;  2LMJ A;  2EJ9 A;  4PJN A;  4AFZ C;  5ECA A;  3G6E A;  1R0C B;  3RKY A;  4ZGD B;  2FEI A;  3TSZ A;  5LJ5 e;  7AT1 B;  1YJN Q;  2Y4Y A;  3H41 A;  3GF5 A;  1QVG S;  3DB4 A;  1YI2 T;  3VYH B;  4EMK B;  1IHV A;  2LP5 A;  5FU6 C;  1MV0 B;  5IHI A;  2MMP A;  3I55 Q;  3MEA A;  2DF6 A;  2ZZD A;  1YJ9 Q;  3VV0 A;  4JS5 A;  1OX9 A;  1MV3 A;  1VQ7 T;  3CCE T;  3PNW C;  1UDL A;  2JUF A;  1I0C A;  1OQK A;  1VQ8 Q;  2BZY A;  2EQM A;  3OQ5 A;  1N8R U;  1D1A A;  1GFC A;  3H0I A;  2P0Q A;  2HKN A;  2O01 E;  3CBO A;  3OYY A;  3EH2 A;  2LQN A;  1Q7Y R;  5A0G A;  4NL2 A;  1G3S A;  1VQM T;  3R6N A;  4FSX A;  2QEX T;  2RM4 A;  2FZC B;  3O5Z A;  4E7K A;  4JJN K;  4C5G A;  2JOY A;  3TSW A;  3G71 Q;  3D7S B;  3FJP A;  2CS7 A;  4OF1 A;  2KT8 A;  3GOX A;  2HSP A;  5GAM g;  2LVM A;  4J9B A;  3IQL A;  1WXU A;  5GAN 8;  3CCV Q;  1ZX6 A;  1VQL T;  1E6H A;  2PVG B;  3NGP A;  2XU8 A;  1BIA A;  1EZZ B;  2A28 A;  2QQS A;  1F1B B;  2EYW A;  4LUE A;  1VA7 A;  1K9M U;  4PJO C;  1OZ3 A;  3Q1J A;  1YJ9 T;  1VYV A;  1RAE B;  1MND A;  2DX1 A;  2HDA A;  4FW2 A;  1TTH B;  2DFU A;  1QKW A;  4LXC A;  4OGE A;  2LQK A;  2OI3 A;  4M77 E;  1Q86 U;  2HQE A;  2VC8 A;  2VAS A;  2QEX Q;  1VQ4 T;  2GF7 A;  2MCN A;  5GAN 2;  2EYY A;  3ME9 A;  1RLQ C;  2FB7 A;  2ROL A;  3VS1 A;  1M2O A;  1LNX A;  5CQY A;  3CCJ T;  1GCQ A;  1PKT A;  4JLG A;  2NWM A;  1X27 A;  3TEE A;  3RMS A;  4KT0 E;  3RBB B;  3JCM d;  2RD1 A;  2VXF A;  1LCK A;  3CCE Q;  2CH4 A;  3S3N A;  1M30 A;  1K0S A;  5GAN f;  1Y96 A;  1S72 T;  1K73 R;  1QVG A;  5LJ3 g;  3CC4 T;  3OYJ A;  1ZSG A;  2X4J A;  8AT1 B;  3BY7 A;  1YI2 A;  3CPW S;  1VQM Q;  2A3L A;  3L2Z A;  2LX9 A;  1HD3 A;  5A2Q E;  3UT1 A;  4KBM B;  2ZPF B;  3INZ A;  3QHS A;  1OYX A;  2EQJ A;  3LYI A;  1TUC A;  4M7A C;  1WI7 A;  2QGG A;  3KFV A;  1WX6 A;  4BAC A;  3EFO A;  2CP2 A;  3OYA A;  1YCY A;  3VJP A;  2PZ1 A;  2PVO B;  2QTX A;  4J7F A;  3CME Q;  4JLI A;  3EH1 A;  2KY9 A;  2VUB A;  4M77 A;  4X1V A;  2K5I A;  4M75 A;  1I8F A;  1X6B A;  3VS7 A;  4F7U A;  1NYF A;  1GBQ A;  2DAQ A;  4PJM A;  2BKD N;  1BI3 A;  5KYW A;  3CCQ T;  2R57 A;  1E7O A;  1SKU B;  1MMG A;  2CKK A;  2HL3 A;  2LT1 A;  3CD6 T;  1RAG B;  4PJO B;  4A63 B;  4IUU A;  2RQW A;  4C5I A;  2O9V A;  4E7J A;  2LNV A;  1TXQ A;  2YXY A;  3QYH B;  1VIF A;  5GAM e;  2RI5 A;  1G2B A;  1NYG A;  1VQL Q;  2JN0 A;  2OTL A;  4HVW A;  2YLC A;  2CT4 A;  1VQN T;  2JW4 A;  3JSC A;  2ZPH B;  5GMK i;  3S3M A;  5GAO p;  4LDU A;  3M4G A;  2D1X A;  3PIP A;  4HCB A;  2SRC A;  4DA4 A;  3X26 B;  2YRD A;  2AK5 A;  3E19 A;  3H9N A;  2DL8 A;  1QCO A;  2I2L A;  2OAW A;  3V8K A;  1YJW T;  4ZGJ B;  2EIF A;  1AEY A;  1AWW A;  2VVK A;  3VS5 A;  2LCS A;  4LDX A;  5DLO A;  5IN1 A;  3M57 A;  1ABQ A;  4ELZ C;  2DD5 A;  4PJO E;  1C0M A;  2KR3 A;  3JB9 J;  4RTV A;  3JCM g;  1FYN A;  2XIC A;  4QVZ A;  1N5Z A;  1ZUK A;  3LGF A;  2CRE A;  2E10 A;  1RAC B;  4RUG A;  2A7Y A;  1N8R R;  3I35 A;  4HCC A;  3A8M B;  1WHH A;  2DL3 A;  1ZSZ C;  5LJ3 d;  3M59 A;  2K6D A;  4BB7 A;  4ELY C;  4HXJ A;  3I56 T;  4ZTJ A;  1D0Z A;  3SB2 A;  1AZE A;  2GQV A;  2YWW A;  4E7H A;  1NJI U;  4OMQ A;  3CPW P;  1VQN A;  4FM4 B;  4RG2 A;  3CCL A;  1JJ2 P;  1NEG A;  3HKS A;  2FPD A;  2RJD A;  1VQ7 Q;  4FT2 A;  4IUP A;  2Z0W A;  3RR6 A;  4F14 A;  4PLL A;  1TWB A;  1PD0 A;  1YFN A;  1ZBJ A;  2L5Q A;  2DA9 A;  2EGC A;  4XU2 A;  3MEW A;  2JMA A;  5A0D A;  3VS6 A;  2JT4 A;  3FEO A;  3OS5 A;  4J83 A;  3CME T;  2EYQ A;  1Q7Y C;  1J3T A;  2SEM A;  1B7T A;  1LJO A;  2XDD A;  1KHC A;  3ZFJ A;  2P4T A;  3CMA A;  1VQ9 Q;  3VS3 A;  2JS0 A;  1Q82 R;  2RJF A;  5EG2 A;  1UUE A;  3CMA T;  1OPK A;  5AYF A;  3SWN A;  3L2R A;  2LDM A;  1Q86 R;  1U1T A;  2ATC B;  5I11 A;  2IIM A;  4OB3 B;  1YJW Q;  3I56 Q;  2CZ1 B;  2HAX A;  2W0Z A;  5D6X A;  2XK0 A;  3QKJ A;  1M27 C;  1SRL A;  5CKH A;  4FSS A;  2D8J A;  3S6W A;  3V7R A;  3CCU T;  2DRM A;  2BE9 B;  1FMV A;  2QDL A;  5FLX E;  4LDV A;  4RTW A;  2E4H A;  3JB9 G;  5FRO A;  1I5L A;  1RUW A;  3L42 A;  3N5B B;  4F04 B;  4E7L A;  1SHG A;  3JCM X;  2LQ8 A;  3V8L A;  1G8X A;  1UHC A;  4Z02 A;  4ZN3 A;  4E6R A;  2QDY B;  1AOJ A;  4JDS A;  3CCR T;  1NLP C;  3P8D A;  4E7Z A;  2GQI A;  2O88 A;  1ARK A;  2V26 A;  2MAM A;  5FRM A;  2DEQ A;  2EW3 A;  2E41 A;  2DXC A;  2QQR A;  5GJV B;  4B9X A;  4PL6 A;  4KGZ B;  2FPE A;  1UGP B;  2RI2 A;  1BBZ A;  4BI8 B;  5GAN d;  3ZEH A;  3PVL A;  2MF2 A;  1S72 Q;  1VQ5 A;  1VQP Q;  1VQO A;  4PFZ A;  3CC7 T;  3GPL A;  3CC4 Q;  2D9T A;  1K0X A;  4HT9 A;  1Q82 C;  5IAY A;  1VQO T;  1ZA2 B;  1W1F A;  2XID A;  1KHI A;  4LDW A;  2RNA A;  4OB1 B;  2DTO A;  2DXU A;  3F70 A;  4RTU A;  2MYS A;  3NHN A;  3L2V A;  2QQ9 A;  1Q81 U;  1XQH A;  1M90 C;  2DIL A;  4JPB W;  2BTT A;  3SWN C;  1BU1 A;  3CCS Q;  1YCS B;  3HFO A;  3M0Q A;  1G83 A;  3DKM A;  3HP9 A;  3E1S A;  1BK2 A;  4RG8 A;  2OTL T;  1KQ1 A;  4M78 B;  4EDU A;  1TH7 A;  4HCZ A;  3JB9 D;  1YJN T;  2K57 A;  3MP8 A;  1MMA A;  4A54 A;  1B3Q A;  3CCQ A;  5D6Y A;  4IUV A;  1GCQ C;  1H64 1;  2EWN A;  4D6W A;  1ZSZ B;  5CKD A;  1VIE A;  2KT1 A;  4J5Y A;  3ULR B;  3BE3 A;  2KI7 A;  2BZX A;  2ZPE B;  3QWX X;  4C8Q E;  5AT1 B;  3CCQ Q;  5IXB A;  3C0C A;  3VUB A;  4FCY A;  3P8B B;  2VV5 A;  3OYK A;  3UPU A;  1SG5 A;  4C0F A;  1WA7 A;  1UGS B;  1JEG A;  4QQG A;  2K2V A;  1M1F A;  1WHJ A;  3OYF A;  4FL6 A;  1M9S A;  1UHF A;  3MHX A;  4C92 C;  2DIQ A;  4XU1 A;  2K7A A;  1K76 A;  1UGR B;  3CCS A;  2F5K A;  4HKE A;  1AVZ C;  2HZY A;  4MMK A;  2KBT A;  1K73 U;  4C0D C;  5HK3 A;  3RIR A;  1M4Z A;  1AZG B;  4ORZ A;  3EG2 A;  5DY9 A;  4J8O A;  2E3I A;  2ROT A;  4FU6 A;  3LWI A;  2MK5 A;  3J80 E;  3OA6 A;  2E6Z A;  3H8Z A;  1AT1 B;  2QGF B;  4C8Q F;  2AKK A;  4MZT A;  2VWF A;  4M7A F;  1YIT Q;  2DET A;  4KGX B;  3QYG B;  1RI0 A;  2EGE A;  4F7U E;  3ZL7 C;  1RAB B;  4X34 A;  1EIF A;  3V7S A;  3HL8 A;  1PNJ A;  2K2M A;  2B86 A;  3OW2 A;  1WFW A;  2HQX A;  2ZCF B;  2DTI A;  1YHQ A;  5GMK e;  4J9I A;  4AFS C;  2LT4 A;  3SD4 A;  1UJ0 A;  2GBQ A;  5D6W A;  1AHJ B;  4WCI A;  3NTK A;  4II1 A;  2YRV A;  4IIO A;  2BIV A;  5GAN h;  3I5R A;  3OS0 A;  1GBR A;  2MWO A;  1N9S A;  3REA B;  2XHC A;  2ED0 A;  4M75 F;  1KC8 C;  1WPY A;  2YUN A;  4OB2 B;  1Q81 R;  2RQU A;  1Y96 B;  4M7D E;  1YJW A;  2W10 A;  4BDY A;  2KYM A;  1D1C A;  2EJG A;  1K73 C;  4QT7 A;  4QVC A;  3DLL A;  1KQS S;  5I22 A;  3T9N A;  3L2Q A;  2XDP A;  1T0J A;  4LN2 A;  3QJY A;  1M1K R;  2F2V A;  1IGQ A;  3JCM W;  2J7I A;  1HXD A;  1WXB A;  4MDX A;  1G5V A;  4CI0 C;  2IG0 A;  1VYU A;  4HT8 A;  1G3Y A;  3BFM A;  3EGD B;  4CRI A;  1N8R C;  5CR2 A;  1ACM B;  1YNZ A;  2O31 A;  2E5K A;  2J06 A;  2HNI A;  1B34 B;  5GMK m;  2O4X B;  1FWZ A;  4NL3 A;  5I2S A;  2ESW A;  5LJ3 h;  2C06 A;  6AT1 B;  4N4H A;  3OS2 A;  4C8Q G;  2KGT A;  1PM3 A;  4X9D A;  3FC3 A;  1ZSZ A;  1PG5 B;  1SHF A;  3EGX B;  1KQS P;  3A8G B;  1NLO C;  3LH0 A;  4R55 A;  4PJJ A;  2V8K A;  3TCJ A;  2E70 A;  3QPH A;  2FRY A;  3CCS T;  4EMK C;  2AIR B;  4IUQ A;  5KYU A;  2RQR A;  1WHK A;  2GTO A;  4JJB A;  2L2P A;  4C92 B;  1KFZ A;  3LW5 E;  2RHI A;  2JJ9 A;  3CCJ Q;  1ZA1 B;  4K11 A;  1VQ8 T;  2YUP A;  1W2B P;  2LTO A;  1HJD A;  1BIB A;  2FRW A;  4OGC A;  3OYD A;  2JVV A;  3CC4 A;  2CT3 A;  1RAD B;  2AT1 B;  1VQK A;  3A98 A;  3GNG A;  3A8H B;  4DQ2 A;  1VQO Q;  3E9F A;  1X2K A;  1VQP A;  1S72 A;  1VQ5 Q;  1ZLM A;  2C0O A;  4NOY A;  2V8I A;  4QKU A;  5I2M A;  3L2W A;  1PRM C;  2AZV A;  2PNI A;  5C0M A;  4Y28 E;  2V8J A;  5DLQ E;  4J9F A;  1VQ4 A;  3CEY A;  3SEM A;  1K9M C;  1H92 A;  5CCA A;  3JCM e;  5LJ5 j;  3H0H A;  2E5Q A;  3M4Y A;  1VQ6 Q;  2NUP B;  3CQT A;  4QQD A;  2COW A;  1ZUY A;  1I1J A;  2L89 A;  4RCB A;  5CAI A;  4A4H A;  4PJO F;  2DL5 A;  3KXT A;  1KD1 R;  2JTE A;  4PJO D;  2DIG A;  3OY9 A;  2M16 A;  4GLK A;  4XU3 A;  1R8O B;  1UGQ B;  2AKL A;  1QVF S;  2M51 A;  4C5H A;  3HRU A;  1YIJ T;  3GP8 A;  3U23 A;  1VQ6 A;  1H3H A;  2RHU A;  1R0B G;  4JJD A;  1O75 A;  4L5G A;  4FYY B;  2EYZ A;  5HCK A;  3CME A;  1WHM A;  3BDU A;  4EIK A;  1H8K A;  1LOJ A;  4LNP A;  3CC7 A;  3CPW A;  2MI6 A;  3M9Q A;  4Y92 A;  3VUZ A;  2EAY A;  1M5Q 1;  4E2F B;  3UDC A;  1SEM A;  3WXM B;  3JCM J;  1VQ9 A;  3CMA Q;  5GMK h;  2JTM A;  4M75 B;  1X75 C;  9ATC B;  2GFU A;  3V8J A;  5KYN A;  1VQK Q;  4GY5 A;  2JM8 A;  1BI2 A;  5GAN e;  5LJ5 g;  3CCL T;  1VYT A;  3SFM A;  3OS1 A;  4HVV A;  2CP7 A;  3HTR A;  3R6O A;  3SWN B;  5GAN 5;  1WQW A;  3RER A;  3CBM A;  1DJ7 B;  3X28 B;  2DER A;  1VQ7 A;  4ESR A;  2M1H A;  3FLG A;  3M0T A;  1WDX A;  1YWP A;  2KMT A;  1I07 A;  4GBQ A;  4EMG A;  3CCL Q;  2HD0 A;  2JS2 A;  1KQ2 A;  2EQU A;  3M0S A;  3M56 A;  2RHZ A;  4C0Z A;  1VQN Q;  4EPC A;  4XTZ A;  1WJQ A;  2DMO A;  5GAM f;  3OW2 S;  1UJY A;  1PRL C;  1SPK A;  4E47 A;  3NMZ C;  4ZNX A;  3MKD A;  2AZS A;  1OPL A;  1W4S A;  1U8R A;  3VRZ A;  3OYI A;  1JJ2 A;  3VS2 A;  1RAH B;  2QAZ A;  3EFO B;  2L3R A;  2P84 A;  2E3H A;  1WJR A;  1YN8 A;  1K9M R;  3QUI A;  1JB0 E;  4M7D D;  3UF4 A;  4N4I A;  4BY6 C;  2YHT A;  2XD0 A;  1OEB A;  2GNC A;  3PT9 A;  3HSB A;  5KYW B;  3EG1 A;  3P8H A;  1PC0 A;  2F2X A;  2DKG A;  2B8A A;  3FB9 A;  3C95 A;  5FU6 B;  3THK A;  3CCV A;  1IXD A;  2K79 A;  4OMM A;  1UEB A;  3EGX A;  3DLM A;  2HKQ B;  1QVG P;  3M58 A;  1IRX A;  5HY6 A;  5LJ3 f;  3OYM A;  3CC7 Q;  2X51 A;  4M7A G;  2RHY A;  1Z9Q A;  2J6F A;  2GFA A;  2OTL Q;  1UB4 A;  2K3X A;  2G6F X;  2A36 A;  2KQW A;  2A37 A;  4IIM A;  2WSE E;  4J7I A;  3VYG A;  3CXC S;  2D0N A;  2VKN A;  2X35 A;  4Z8A A;  4XTV A;  3ZBD A;  2YLB A;  4YTL A;  5GAN g;  3BDL A;  4BD3 A;  2F5T X;  3MPU B;  1PSE A;  4DEX A;  4A4F A;  2M02 A;  2L8D A;  3HRT A;  1HK9 A;  2DTH A;  1YHQ Q;  4C8Q A;  4ATO A;  3OYG A;  3I55 A;  5KH6 A;  1VQ4 Q;  1M2V B;  1WIE A;  1U5S A;  3EG0 A;  4LE9 A;  5A0L A;  3JCM V;  3CCM T;  2KNB B;  4PKC C;  4IKF A;  1A0N B;  2V1R A;  2JTF A;  1YP5 A;  4M78 G;  4XAX B;  2LJ0 A;  5LJ3 e;  4C8Q D;  2JM9 A;  5CKB A;  4CC3 A;  1VQM A;  3VKI A;  2LQW A;  5CVI A;  2J6O A;  1JJ2 S;  1PWT A;  2C0T A;  3CCJ A;  2HL5 C;  4OMF B;  1KSW A;  3J81 E;  4F16 A;  1VQ9 T;  5DM7 R;  2QA4 T;  4MDW A;  3CCE A;  2HBP A;  1K8A C;  2X4W A;  1Q81 C;  2CP3 A;  4L59 A;  1G3W A;  4MZP A;  1QP3 A;  5FWC A;  1YIT T;  1X43 A;  1N27 A;  2YDL A;  1X01 A;  2KRS A;  5GAM h;  1U1S A;  2CSQ A;  3AT1 B;  4BE0 A;  4NS5 A;  1BYM A;  4FT4 A;  2A08 A;  1Q7Y U;  1QW1 A;  3RKW A;  2LNH B;  3OSV A;  4Y91 A;  3OYE A;  3RKX A;  2QYZ A;  3A1P A;  1TSF A;  3RES A;  1ZBX A;  2QG9 B;  2KDS A;  3UWN A;  2DYI A;  4C92 D;  2JMC A;  2X9H A;  4M78 A;  1W2B S;  4RMO A;  5CIU A;  1PKS A;  1QVF P;  4WTO B;  1QVF A;  2RF0 A;  2L3S A;  5GAM j;  4O5V A;  1SSH A;  4XQ3 A;  2DK3 A;  4E7S A;  1Y0M A;  4M77 D;  2EQI A;  3VS0 A;  1MMN A;  1RI9 A;  1UTI A;  3RNJ A;  1B07 A;  5D7U A;  1KK7 A;  4F7U F;  2DXT A;  2DPP B;  3M54 A;  4Z88 A;  2RMO A;  1M3B A;  5GAN 3;  3G71 A;  4BI3 A;  3OYL A;  3UA7 A;  1AWO A;  2EVR A;  2CZ7 B;  1K9A A;  1NJI R;  1UGV A;  3JCM b;  2ZPI B;  1T3L A;  2KK4 A;  3CCU A;  1BCO A;  3QSU A;  4M7A B;  2CYZ B;  3NPF A;  2WSC E;  3OMC A;  4IUT A;  1ZUU A;  1N9R A;  4IUR A;  1JU5 C;  2RJC A;  4BE1 A;  5KCO A;  2O2O A;  1VQ8 A;  5IHN A;  5GAM d;  1Q86 C;  1TG0 A;  3LX7 A;  3TQ7 P;  2K5F A;  1FXX A;  2MIO A;  1NPP A;  3C94 A;  2HMA A;  4KH1 B;  4OMP A;  1YJ9 A;  3QO3 A;  5M9O A;  1KG1 A;  4F7U G;  4HA8 A;  5LJ3 j;  2QI2 A;  2O4X A;  5GAN 6;  1KC8 R;  2RJE A;  2E12 A;  2GTJ A;  1QP2 A;  1D0Y A;  1XNI A;  4LDY A;  2DRK A;  2FPF A;  3G6E Q;  2XDB A;  2DXB A;  2QQA A;  1E6G A;  2RI3 A;  4CC4 B;  1YIT A;  4M78 C;  1IRE B;  4X9C A;  4DOW A;  1RAA B;  1M2V A;  3EAE A;  4J9G A;  1BB9 A;  2K3Y A;  4M7D A;  3EFR A;  1M90 R;  2LCL A;  4C92 G;  5CK9 A;  2K4Y A;  4PFO A;  2JXB A;  4PJO A;  4EMH A;  2LX7 A;  2AHJ B;  3QG1 A;  1X2Q A;  2KXD A;  4XTX A;  4R56 A;  4B6M A;  1MGQ A;  3CPF A;  4JZ4 A;  4D8K A;  4M7D G;  1Z9Z A;  3EHR A;  3KUF A;  1JXO A;  2HBW A;  2E64 A;  3OYC A;  1M8M A;  1FMW A;  2RA2 A;  1GCP A;  2EJF A;  2NUZ A;  3X20 B;  2HQH A;  3MP1 A;  2R5A A;  4ME7 A;  4OML A;  3QZ5 B;  2HEQ A;  2YRC A;  1TOV A;  4GLM A;  1Y71 A;  2Y4X A;  1NJI C;  1M1K U;  1U3O A;  2CZ6 B;  3X25 B;  2EKO A;  3FRN A;  2HCK A;  2CDT A;  1CKB A;  4Z89 A;  1D0X A;  5GAN 7;  4VUB A;  3L2U A;  4KGV B;  3O8V A;  2K3B A;  2CUB A;  2KVQ G;  3EG9 B;  4JZ3 A;  4AT1 B;  3HHT B;  1IGU A;  3QJ6 A;  1R77 A;  1IO6 A;  1QKX A;  3I5S A;  2FL7 A;  3OBW A;  1M3C A;  2DL7 A;  4J6W A;  4N4G A;  1OU9 A;  3A5Z B;  5GAO r;  2LC4 A;  3JAM E;  1YHQ T;  3LGL A;  3FJ5 A;  2EGA A;  1WHG A;  5GAN 4;  2XI9 A;  4J9E A;  1NZ9 A;  2VGN A;  4C8Q B;  1C1A A;  2YUO A;  3QBY A;  4J9H A;  2J05 A;  4RTY A;  4RCC A;  2VXE A;  3MCA B;  3RMQ A;  4XTU A;  1KQS A;  1NM7 A;  3MEU A;  4WF2 A;  4R0K A;  3NTH A;  4M7D C;  1OUL A;  2ZGW A;  1H3Z A;  1M1K C;  1X6G A;  3M0P A;  1Y07 A;  2E65 A;  2CZ0 B;  2CSI A;  4FIB A;  4L6V 5;  4C5E A;  3CXC P;  2BUD A;  3WVD B;  3EG9 A;  2E6N A;  4TVR A;  4D8D A;  5LJ5 d;  4M75 D;  4M77 C;  3QWY A;  1W70 A;  2DJZ A;  3QDR B;  5FU7 C;  2QA4 Q;  2L3Q A;  3GBQ A;  2M0Y A;  2KE9 A;  3MEV A;  1BI1 A;  3SHW A;  3JCM h;  1TUG B;  1GRI A;  1EFN A;  4A4K A;  2BZ8 A;  1NEB A;  3JCM P;  1RAF B;  3PFS A;  5L8R E;  3FIF A;  1NG2 A;  2PUO B;  5IH2 A;  2QK0 A;  1NPR A;  1VOM A;  2F2W A;  4MZM A;  4J9C A;  1D09 B;  4KUL A;  3LWH A;  3VRY A;  3OYN A;  4OMN A;  1M3A A;  1XOV A;  4LD6 A;  2H3E B;  3A8L B;  3C4S A;  2OTJ Q;  4B9W A;  1JXM A;  4XK8 E;  1CKA A;  3UAT A;  3CC2 A;  3ASK A;  4BE2 A;  3MET A;  2PUK B;  2QAS A;  2RHX A;  2CH4 W;  4OVA A;  1OV3 A;  3G4S A;  1LPL A;  2EYX A;  3CC2 T;  1Y7X A;  2RQT A;  3CD6 A;  3I56 A;  3QII A;  1GFD A;  1T0H A;  1MMD A;  2J6K A;  2RPN A;  3CCR Q;  4M7D B;  3ER0 A;  4CC7 A;  4OB0 B;  4RTX A;  2LCC A;  3JB9 H;  1X69 A;  3OW2 P;  1M90 U;  1TU0 B;  3I55 T;  2CP5 A;  4JUV A;  3JB9 I;  2VB6 A;  1Q95 G;  1YI2 Q;  4XTW A;  5EC7 A;  2QQB A;  2D0Q B;  5LJ5 h;  1KD1 U;  2RQV A;  3CCM A;  3MO8 A;  4M75 G;  1PD1 A;  4OP0 A;  2FYK A;  4J6X A;  1VQ5 T;  2KSS A;  2MWP A;  1UFF A;  2GCX A;  2OTJ T;  4BDZ A;  2FVU A;  3GNF B;  4A4E A;  1JO8 A;  2WSF E;  3GIB A;  1W6X A;  4DEY A;  1UG1 A;  1AD5 A;  1IB8 A;  3GLX A;  2PQW A;  2G3R A;  3G7Z A;  1RLP C;  3HRS A;  4J6Y A;  3M0U A;  3JRZ A;  3CCM Q;  5J3B A;  3EGU A;  4KUD K;  5GJW B;  3FDR A;  2PU9 B;  2IPO B;  3G71 T;  1WHL A;  4O6J A;  4ANJ A;  4BI4 A;  2L3P A;  1NE8 A;  2OJ2 A;  4AFU C;  1D3B A;  3JV3 A;  2ABL A;  4F17 A; 
#chains in the Genus database with same CATH homology
 2KNB B;  2HSP A;  1AVZ C;  2KBT A;  4J9B A;  3IQL A;  1OOT A;  1A0N B;  2V1R A;  1WXU A;  1ZX6 A;  1YP5 A;  2LJ0 A;  2KYB A;  2JM9 A;  4CC3 A;  1E6H A;  3NGP A;  1AZG B;  4ORZ A;  2L0A A;  3EG2 A;  2LQW A;  2J6O A;  2A28 A;  2ROT A;  2EYW A;  4LUE A;  1VA7 A;  1PWT A;  2C0T A;  4CC2 A;  1U06 A;  1KSW A;  1VYV A;  2AKK A;  4F16 A;  2KRM A;  2DX1 A;  2HDA A;  2VWF A;  1QKW A;  1UE9 A;  2OI3 A;  2EGE A;  3ZL7 C;  5FWC A;  1X43 A;  2YDL A;  2KRS A;  1PNJ A;  2CSQ A;  2K2M A;  2MCN A;  2LZ6 B;  2EYY A;  2B86 A;  2CUD A;  1RLQ C;  2A08 A;  1QLY A;  1WFW A;  2ROL A;  2KRN A;  3VS1 A;  2LNH B;  3H0F A;  4JJC A;  1CSK A;  2X3X D;  4J9I A;  1GCQ A;  1PKT A;  4AFS C;  2NWM A;  1UJ0 A;  1X27 A;  2GBQ A;  2JMC A;  3RBB B;  4WCI A;  1LCK A;  2CH4 A;  2XMF A;  4IIO A;  1PKS A;  1HSQ A;  1M30 A;  1K0S A;  1PHT A;  3I5R A;  2RF0 A;  2L3S A;  1GBR A;  1SSH A;  3REA B;  2ED0 A;  2YUN A;  1ZSG A;  1Y0M A;  1AWX A;  2RQU A;  2EQI A;  2W10 A;  3VS4 A;  1HD3 A;  2KYM A;  3VS0 A;  1RI9 A;  4QT7 A;  1UTI A;  3RNJ A;  1SRM A;  1B07 A;  1WYX A;  2ED1 A;  1QCF A;  5I22 A;  1TUC A;  2KRO A;  1QWF A;  1WI7 A;  1T0J A;  3KFV A;  4LN2 A;  4Z88 A;  1WX6 A;  2RMO A;  2F2V A;  1M3B A;  1S1N A;  3UA7 A;  1AWO A;  2EVR A;  1K9A A;  1YWO A;  2PZ1 A;  1UGV A;  2J7I A;  1T3L A;  1V1C A;  1WXB A;  4M4Z A;  1VYU A;  2K9G A;  4X1V A;  1X6B A;  3NPF A;  3VS7 A;  1ZUU A;  1NYF A;  2PTK A;  1GBQ A;  1YNZ A;  2O31 A;  2E5K A;  2J06 A;  1JU5 C;  2DVJ A;  3UA6 A;  2O2O A;  1WLP B;  5IHN A;  1TG0 A;  1E7O A;  2YSQ A;  2MIO A;  2MOX A;  4A63 B;  2ESW A;  2RQW A;  4OMP A;  5FW9 A;  2O9V A;  2D8H A;  1G2B A;  1NYG A;  2KGT A;  3LH5 A;  2YUQ A;  1SHF A;  4HVW A;  2CT4 A;  2JW4 A;  2KXC A;  1WXT A;  2P4R A;  1NLO C;  2GTJ A;  4LUD A;  2D1X A;  2DRK A;  2SRC A;  2FPF A;  1K1Z A;  4OMO A;  1E6G A;  1Y57 A;  2FRY A;  4CC4 B;  2I0N A;  2RQR A;  2RN8 A;  2AK5 A;  1JQQ A;  2GTO A;  4JJB A;  4AG2 C;  2DL8 A;  2OAW A;  2L2P A;  3I9Q A;  1KFZ A;  4J9G A;  2C0I A;  4RTZ A;  1BB9 A;  2EBP A;  4K11 A;  2YUP A;  2EPD A;  1ABO A;  1AEY A;  1HJD A;  1AWW A;  2ENM A;  2VVK A;  3VS5 A;  2LCS A;  2JXB A;  2FRW A;  4KRT A;  2LX7 A;  2CT3 A;  3A98 A;  1KJW A;  1X2Q A;  2KXD A;  1X2K A;  1ABQ A;  4RTT A;  1ZLM A;  4JZ4 A;  2C0O A;  4D8K A;  1Z9Z A;  2KR3 A;  3EHR A;  4RTV A;  1JXO A;  2AZV A;  1FYN A;  2HBW A;  2DM1 A;  1PRM C;  1N5Z A;  1ZUK A;  2PNI A;  1M8M A;  3REB B;  2CRE A;  4J9F A;  1GCP A;  4RUG A;  2NUZ A;  3SEM A;  1H92 A;  3I35 A;  2FG0 A;  4OML A;  2DYB A;  2HEQ A;  2DL3 A;  3H0H A;  4GLM A;  4AG1 C;  1U3O A;  3CQT A;  2K6D A;  1ZUY A;  1UEC A;  4HXJ A;  2HCK A;  1AZE A;  4OMQ A;  1I1J A;  2CDT A;  1CKB A;  2DBK A;  3PVQ A;  4Z89 A;  2DL5 A;  1T3S A;  2JTE A;  1NEG A;  2K3B A;  2ECZ A;  2FPD A;  2CUB A;  4JZ3 A;  4F14 A;  1ZBJ A;  2AKL A;  1IO6 A;  1QKX A;  2M51 A;  2DA9 A;  3I5S A;  2EGC A;  3U23 A;  1M3C A;  2DL7 A;  2JMA A;  1H3H A;  1KIK A;  4JJD A;  3VS6 A;  1FMK A;  2JT4 A;  5IHK A;  2EYZ A;  5HCK A;  2LJ3 A;  1J3T A;  4EIK A;  1H8K A;  4LNP A;  2SEM A;  4Y92 A;  3JV3 A;  3FJ5 A;  2EGA A;  4J9E A;  1SEM A;  4J9D A;  3VS3 A;  2DE0 X;  2YUO A;  4J9H A;  2JS0 A;  2J05 A;  4RTY A;  1UUE A;  1OPK A;  2KEA A;  1NM7 A;  3EHQ A;  4R0K A;  1QWE A;  5I11 A;  2IIM A;  4HVU A;  2JM8 A;  5IXF A;  2X3W D;  5FWB A;  1MUZ A;  1VYT A;  2W0Z A;  3TVT A;  1X6G A;  3M0P A;  4HVV A;  3EG3 A;  2DL4 A;  1M27 C;  1SRL A;  2DNU A;  4FSS A;  2CSI A;  2D8J A;  2FO0 A;  2H8H A;  2DRM A;  2QDL A;  4RTW A;  2EKH A;  4D8D A;  1RUW A;  1AWJ A;  3QWY A;  4ESR A;  1W70 A;  3M0T A;  1WDX A;  1YWP A;  2DBM A;  2GGR A;  1SHG A;  1I07 A;  4GBQ A;  1K4U S;  2L3Q A;  2JS2 A;  3GBQ A;  1UHC A;  2LJ1 A;  2M0Y A;  3M0S A;  2KE9 A;  4E6R A;  1AOJ A;  2DMO A;  3SHW A;  1NLP C;  1GRI A;  1EFN A;  1UJY A;  1PRL C;  1SPK A;  2BZ8 A;  2GQI A;  2V1Q A;  1NEB A;  2O88 A;  3NMZ C;  1ARK A;  4ZNX A;  1NG2 A;  2AZS A;  5IH2 A;  1OPL A;  2DJQ A;  3VRZ A;  2F2W A;  3VS2 A;  2EW3 A;  4J9C A;  5GJV B;  3VRY A;  4HCK A;  4OMN A;  1M3A A;  1XOV A;  1GL5 A;  1TUD A;  2FPE A;  2YT6 A;  1BBZ A;  2O9S A;  1JXM A;  3PVL A;  1CKA A;  3UAT A;  1YN8 A;  3M0R A;  2CH4 W;  1K0X A;  1OV3 A;  3UF4 A;  3PE0 A;  2EYX A;  4AFQ C;  2RQT A;  1OEB A;  1W1F A;  2GNC A;  2RNA A;  5L23 A;  3EG1 A;  2F2X A;  4RTU A;  1GFD A;  3NHN A;  1T0H A;  2DLP A;  2J6K A;  2RPN A;  2LMJ A;  3THK A;  2K79 A;  4OMM A;  4CC7 A;  4RTX A;  4AFZ C;  5ECA A;  2DIL A;  4JPB W;  1X69 A;  2BTT A;  2FEI A;  1BU1 A;  3TSZ A;  1Z9Q A;  1YCS B;  2J6F A;  3M0Q A;  1G83 A;  3H41 A;  1BK2 A;  5EC7 A;  2LP5 A;  1MV0 B;  5IHI A;  2DF6 A;  2G6F X;  2RQV A;  2A36 A;  2A37 A;  4IIM A;  1MV3 A;  1UFF A;  1B3Q A;  2D0N A;  2VKN A;  4Z8A A;  1UDL A;  1I0C A;  1GCQ C;  1JO8 A;  1W6X A;  4DEY A;  2BZY A;  1UG1 A;  1AD5 A;  2KT1 A;  1GFC A;  4DEX A;  3H0I A;  3ULR B;  2BZX A;  3QWX X;  5IXB A;  3C0C A;  2LQN A;  1RLP C;  3M0U A;  3R6N A;  1WA7 A;  1JEG A;  3EGU A;  3O5Z A;  5GJW B;  1WIE A;  1U5S A;  3EG0 A;  3TSW A;  4LE9 A;  2L3P A;  1UHF A;  2OJ2 A;  4AFU C;  2K7A A;  2KT8 A;  1K76 A;  2ABL A;  4F17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...