4C92C

Crystal structure of the yeast lsm1-7 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
b'METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92C00
5I21A 5GAN7 2DTHA 4M77F 1I81A 4PJOF 4M78G 2E65A 3V8KA 4WF2A 5GMKh 2DJZA 4MMKA 4M7AD 4M7DD 5GMKe 5GAOp 3JCMP 2DEQA 1TH7A 4C8QD 5GAMg 3BDUA 4M7AG 2EJ9A 4M7DF 4XTXA 2YLBA 5LJ5d 4C8QG 4M75E 3JCMJ 4M75C 2ZGWA 2FB7A 1YCYA 4M77E 4XTZA 4M7AF 4PJOE 3JCMX 4PJOC 3JCMQ 5GANf 1N9SA 4C8QF 4EMKC 1JRIA 4A54A 3QO3A 3EFRA 4N0AA 4M77G 5LJ3h 4EMHA 5GAN6 1BIAA 1HK9A 1WPYA 5LJ3e 2K57A 4XTVA 4M78C 2YLCA 3JCMg 5GAOl 4M78B 4C92B 2YHTA 4M7DE 5GAMf 3JCMV 5GMKi 1U1SA 4JUVA 4QVCA 4M7AE 3RKYA 3SWNC 2RA2A 4M7DG 4HA8A 4RCBA 4RCCA 3V8LA 2VXEA 4C8QE 2RD1A 4C8QC 4C92A 3HSBA 4OP0A 4XTWA 3EFSA 5GAN5 5GANj 5GAN4 4J6XA 1Y96B 1I4K1 1D3BB 2E64A 3AHUA 3PGGA 1WQ7A 4EMGA 1M8VA 1LOJA 4NL3A 3QHSA 3JCMb 4XQ3A 4HT9A 4M75B 3RKXA 1N9RA 3VU3C 4F7UB 3M4GA 1MGQA 4M77C 1Y96A 3JCMf 1D3BA 3BFMA 5GAMj 2RM4A 2VXFA 3FB9A 4PJOB 1BIBA 1LJOA 2DKGA 4EMKB 4M75A 3JCMd 5LJ5h 4F7UA 1LNXA 4C92D 5GMKm 5LJ5e 5GANd 4M7DC 3INZA 5GAOr 4M7DB 4PJOA 1JBMA 5GAOq 1HXDA 4EMKA 2EAYA 4J6WA 4HT8A 4M7AC 2VC8A 4XU3A 3SWNB 4M7AB 1I5LA 4M78A 5GAMd 4JLIA 4C92F 5GANe 3RESA 1H641 4Y91A 5DY9A 4C8QB 2DZ9A 5GAN3 2CGHA 3GIBA 5LJ5g 3RIRA 3SWNA 2DXUA 5LJ3g 3FIFA 1KQ2A 4C8QA 2Y90A 2DTIA 3QSUA 1B34B 1KQ1A 2E41A 4XU2A 4A53A 3RERA 2DVEA 4M77B 3RUXA 4JRIA 4C92E 1WNLA 4DQ2A 4J6YA 1M5Q1 3JB9D 3QUIA 4XU0A 2EWNA 1B34A 3L2ZA 4M78D 4F7UF 4NL2A 3SB2A 5GAN8 2EJGA 2I2LA 3HFNA 4M77A 3JB9G 5GAOn 3JB9I 4C92G 3JCMW 5GMKl 2DTOA 3L1AA 4PNOA 2EJFA 5LJ5f 3V7SA 5CAIA 5LJ3f 5GMKj 3JCMh 3BW1A 5GAN2 2RB6A 3JB9F 4M7DA 3JCMe 5GANh 2JN0A 2DZCA 4M78F 3JB9J 1X01A 5LJ3d 4X9DA 4F7UE 2E10A 4N0AC 2FYKA 4JRKA 3V7CA 1I8FA 4NOYA 4M75D 4M7AA 1U1TA 4M77D 5GAOm 2HNIA 3BY7A 4M75G 4XTYA 3RKWA 4X9CA 3FJPA 4F7UG 5GAMh 5GAMe 4PJOD 3V7RA 4XU1A 4MMLA 4M78E 4PJOG 4QVDA 4C92C 5LJ5j 1WQWA 3V8JA 4V2SA 3JCMc 5GANg 3HFOA 4XTUA 4J5YA 5LJ3j 4M75F 2DXTA 2E1HA 2QTXA 3JB9H
chains in the Genus database with same CATH superfamily
3EGDB 1Q86U 1U06A 2LTOA 1OPKA 3UDCA 1VQ4A 1OPLA 1FX7A 2EQMA 2KBTA 1M9SA 2FB7A 3OYLA 1A0NB 4KGVB 1NZ9A 1ACMB 2QQ9A 2CT3A 4KT0E 2VV5A 2JJ9A 1QQJA 1KQSA 4XTVA 1GFCA 1M30A 2K9GA 4PJMA 4OB1B 2YHTA 3MP1A 1W2BS 1CSKA 1UFFA 2RPNA 1OX8A 3AHUA 3PIOA 3VV0A 1Q82U 4Z88A 1H3HA 2QG9B 3CCMA 3VKIA 1D0XA 2LQKA 1VQ6A 3CEYA 1B3QA 2XHCA 3MEVA 1UJ0A 2HQEA 3JAME 2IPOB 2BTTA 5KH6A 3H0FA 2D8HA 4BE1A 1FMKA 1WZOA 4J7FA 2ZPFB 2ZZDA 2RHUA 5A0LA 1VQLA 1WGSA 3M55A 2E41A 2PVOB 2EIFA 3M54A 1G5VA 4C0DC 1TTHB 4C92E 3TU4K 1VA7A 2EWNA 4PJLA 4NL2A 4C5EA 1QVGA 3PE0A 2EGEA 4KUIA 4HXJA 2RF0A 5LJ5f 4O5VA 1BCOA 5GANh 2BZYA 4X9DA 3KBGA 4IIOA 4N4HA 3SDZA 1OU8A 4FU6A 3LWHA 2HD0A 4DA4A 5GAMh 2HQHA 3CD6A 1I5OB 2KI7A 3MPUB 3V8JA 1VQ7T 3DB3A 4C0GA 1UGVA 1XTDA 2E65A 5GMKh 1K76A 2CZ0B 3FC3A 3MKDA 2PZ1A 2M0YA 2EJ9A 4B9XA 3QBYA 2ZGWA 2L3SA 1YITT 1VQPT 4QQ6A 1UJYA 2X4YA 4EMHA 2DD5A 2M16A 1BIAA 2O9SA 4C8QE 1KC8R 1VQ5A 4ME7A 5GAN5 5GAN4 1VQKQ 1I0CA 3ER0A 2E6ZA 3FEOA 4F7UB 1MGQA 1V76A 1XOVA 1M2OA 4C0ZA 1VQ9A 3RMQA 1Z9QA 2YUQA 1YJWT 4M75A 4II1A 5CKHA 4BE0A 4DEXA 1YI2Q 1FYNA 5KYWA 3OSSC 1AEYA 4IUPA 2GBQA 4E7SA 2KROA 1M90R 3CBPA 1IGQA 1ZSZC 1M3AA 2O01E 1N5ZA 2OTJQ 3SWNB 4ATOA 5LL6S 4AFZC 4FT4A 5GAN3 2QA4A 2J6KA 5I2SA 3F70A 2QDYB 1D1BA 2RK1A 2CUBA 4J7IA 1B34A 2GQIA 1QLYA 3OYBA 2YUNA 1SRLA 2RQUA 3WVEB 1AZGB 2JMCA 5ECAA 4M7DA 1SEMA 3CCQA 4ZGEB 2P4RA 2PTKA 1O9SA 1M1FA 4R55A 2FYKA 2KY9A 5IXBA 3M0RA 3P8HA 1GFDA 1YIJT 2COZA 3WVDB 2BE9B 2XU8A 3CBMA 5GAMe 2NUPB 1M3CA 3PFSA 4PLLA 2F2VA 1B7TA 2O4XB 3I56T 3WXMB 1I81A 5GMKe 3CMEA 4J9EA 4PJNA 4M7DF 4OMNA 3CBOA 4M77E 5IHKA 2QI2A 2MK5A 4L59A 4LNPA 3HRTA 1WHHA 2H8HA 1VQ4T 4B6MA 3OYEA 3NMZC 4D6WA 1HSQA 4C92B 4KBMB 1GCQA 3VJPA 1Q86R 3CCSA 4OMMA 3H0IA 3FLGA 2KNBB 1R77A 2E64A 1WHGA 4ZN1A 2CP5A 2ECZA 3NTHA 1Y96A 2YUOA 2L3PA 1VQ7Q 2QQBA 1SHFA 3INZA 4M7DB 2DL5A 4OB0B 1HXDA 5DM7R 2BUDA 4C5HA 4M7AC 3EG9B 5DLQE 1PHTA 4JDSA 2CP2A 2Y4XA 2K2MA 2RN8A 2K3YA 1Q82R 2ZAEA 1S72A 1YITQ 2DTIA 3SFMA 4XU2A 5D6WA 3I55T 4JRIA 1JU5C 2W10A 1MV3A 3MP6A 5KYUB 1FMVA 3A8MB 2A0FB 1SSFA 1C6VX 1SHGA 2E70A 3BW1A 3M0SA 1AVZC 1SPKA 3MEUA 2DIGA 3OBYA 4M75G 3RKWA 4AMCA 4JS4A 4KUDK 1PKSA 3V7RA 2VGMA 1ZA2B 5I22A 5LJ5j 1WQWA 2W0ZA 3TSWA 2X4JA 3LGLA 5GAN7 4RKUE 3EG3A 1QP2A 3CD6T 2HSEB 1RI9A 4J9BA 2DVJA 2A08A 2DL4A 4DBRA 1KD1C 2JMAA 3PVQA 4JRQA 2EGCA 4PLIA 3GF5A 2RJCA 3OW2A 5CIUA 4E7LA 5D7UA 1NJIC 3JCMV 3SWNC 2RA2A 4LDWA 4M7DG 2EQKA 4RCCA 2EQIA 1D1CA 3TSZA 4BI4A 1C1AA 3TREA 1WA7A 1TXQA 5CO7A 1VQ5T 5HK0A 4E7HA 4KGXB 2RM4A 2VXFA 1HYOA 4RUGA 5IT9E 4ZGJB 4EMKB 1IREB 4HCBA 4A4EA 4HCCA 5FU7B 1KD1U 4A4GA 3PT9A 1AOJA 3I56Q 3UPUA 1W2BA 1JBMA 3C0CA 2NUTA 3GP8A 2EKHA 2O31A 3VS2A 1VQ9T 2ZPEB 2DZ9A 4N4IA 1K9MC 2C06A 4JRPA 2P0KA 3URGA 1NJIU 3QG1A 3QSUA 3EH1A 4RG2A 4M77B 1ZX6A 3IQLA 1VQ4Q 2D9TA 3TVTA 2QA4T 1YHQT 3OYJA 4DBFA 3JB9I 2HZYA 1OEBA 5CAIA 3JCMh 4AFSC 4BI3A 2QDLA 2K7AA 2KRNA 3QIIA 1FWZA 5J39A 1AWXA 4XTYA 3CCQT 2DIQA 3ZBDA 4C92C 3QDFA 3CCMQ 4XTUA 4M7DD 2DEUA 1WI7A 2L3QA 3OS0A 3E9GA 1N27A 1YCSB 3JCMP 4JJDA 1AWWA 2RI2A 1BI1A 1IHWA 1KK7A 1QW1A 3SD4A 5LJ5d 2EQJA 2RHYA 2XKOC 1IGUA 2DL7A 2AK5A 3T9NA 2YWWA 1UUEA 1K73U 3JCMX 2J6OA 2JT4A 3JCMQ 2RQRA 3I55Q 2NUTB 3QO3A 3N5BB 2WACA 4N0AA 3MP8A 2R5AA 2GTJA 1VQLQ 3CCEA 1QVGP 2J7IA 1X43A 4C5GA 3G6EA 2ZPHB 3QPHA 1YJ9A 2K79A 3U23A 4BY6B 2AIRB 2KRSA 2LDMA 3CCST 4J9FA 3M4GA 4AFQC 2MAMA 3OYFA 2VB6A 4FCYA 3S3OA 2LP5A 3O8VA 4JS5A 3CD6Q 2LT1A 2P0PA 2LC4A 1TSFA 2OJ2A 3M9QA 2VYTA 1UGPB 2VWFA 1JJ2A 1K4US 3UWNA 2ESWA 4CRIA 1YN8A 1S72T 4MZTA 4IUTA 4AFUC 3BE3A 2LCSA 1E6GA 5CK9A 2RI5A 3A1PA 3A8OB 2LX7A 2XK0A 1DJ7B 2C0OA 2M02A 2GNCA 4MZPA 5CR2A 3JCMe 4ELZC 2QK0A 4FW1A 4LE9A 4F04B 1VQ5Q 1PRMC 1Q81C 2XMFA 2J05A 3JSCA 5GANg 3M58A 5CVIA 3X24B 1VQ9Q 1QCOA 5GAMg 3LWIA 3UA7A 1VQKT 3RBBB 3SHWA 2JTMA 1SKUB 2BZ8A 2FVUA 3VS7A 2F2XA 2KSSA 4EMKC 2FHDA 5FU7C 4ZNXA 3VRZA 1MMGA 2L89A 2P4TA 1WPYA 2EYZA 4PL6A 2QA4Q 4FSSA 3ULRB 2DILA 2KT1A 2Y4YA 3M56A 1NPRA 2SEMA 3V8LA 2RQVA 4F14A 2FL7A 2QASA 2OTJT 1Q81U 2PVGB 3E1SA 2K3XA 1LPLA 4J6XA 1RLPC 3CC4A 4EMGA 2RJDA 1BKBA 1TUGB 2X9HA 3QWXX 1RUWA 3X28B 1D0YA 4M77C 1Q7YU 3R6OA 1GXIE 1WJSA 3CCQQ 1LJOA 1RADB 4IKFA 1LNXA 1VQMA 2DL8A 2HCKA 4NS5A 4PJOA 1BI3A 3CPWS 4HT8A 4GBQA 4Y91A 3CCUA 2WSCE 4CC4B 4KH0B 1UECA 2M9UA 2ZPGB 1JEGA 2FPFA 1IXDA 2Y90A 3OYAA 5KCHA 1KQ1A 3CMEQ 3PTAA 1WNLA 3DLLA 1AT1B 3MJXA 4RTZA 2CZ7B 1KD1R 1WYXA 1TS9A 4KRTA 5GMKl 4TVRA 2L5QA 2YT6A 4PNOA 2EJFA 3EGXA 3ASKA 2E3IA 4L6V5 2QEXA 3OS5A 4LUEA 1NJIR 2KYBA 3CCSQ 2XDDA 5IN1A 1U1TA 2K3BA 2CKKA 1PNJA 1EX4A 3EHRA 4LXCA 4QVDA 4RTWA 5FWCA 2DXTA 1UEBA 8ATCB 2DTHA 1KFZA 2QXFA 2QYZA 4HVVA 3GLXA 4LN2A 2DPPB 1BI2A 1PWTA 2DRMA 2A3LA 4M4ZA 2G6FX 1N9SA 3H6ZA 2A37A 3CXCS 1Y0MA 2MIOA 2M51A 2DL3A 1D1AA 4M7DE 2FPDA 1S72Q 2XD0A 2FEIA 5CKFA 3A5ZB 3JV3A 1QWEA 2A7YA 3EHQA 2X51A 3G4SA 3CCET 3RKXA 4KGZB 1K73R 3G6ET 2CH4A 1N6AA 3S6WA 1YJ9T 1M3BA 2E4HA 5HY6A 3EGXB 2CS7A 5IHIA 2OAWA 1BK2A 3EAEA 4JPBW 1RI0A 1K8AC 2LQ8A 4M78A 3MEAA 5CQYA 4E7JA 1RAIB 2CP7A 2F69A 2CSIA 1KQ2A 3E19A 1U3OA 3M5AA 4DEYA 1NBEB 4JZ3A 3OW2P 1G3WA 4ORZA 1X6OA 4PFPA 1R0CB 3QZ9B 2CP3A 3QUIA 1X75C 1BI0A 3L2ZA 4PJJA 4RTXA 3NFCA 4B9WA 4A4HA 2JS2A 4FM4B 3L1AA 2RJEA 5KYYA 3LW5E 3E2UA 4M78F 1YNZA 3S3NA 1AHJB 5EC7A 2KEAA 4A63B 4E6RA 3EG2A 1K8AU 3BY7A 2MCNA 2KYMA 1SRMA 2ED1A 4PJOG 2KT8A 5J26A 3CCRA 2DD4A 4M75F 3META 1W2BP 2KE9A 1HJDA 2DAQA 3CCVA 4M7AG 2Z0WA 4XTXA 3R6NA 3GBQA 1WDXA 2RHXA 3JCMJ 5GANf 4UC4A 1KG1A 2COYA 2CP6A 2RHIA 5CKBA 1NYFA 1ABQA 1UHCA 3CCLA 2CP0A 4M78B 3A8GB 4AG2C 3HRSA 2L0AA 5GAMf 5GMKi 1QKWA 4HA8A 3L2RA 2YSQA 4LDYA 2EBPA 3OY9A 1N8RC 2IVWA 1LOJA 3QHSA 4M75B 4K11A 1D3BA 1CKAA 1ZHIA 5KYWB 4JJNK 2VVKA 3RR6A 4KULA 1T0JA 2FRWA 3CC4T 4JJBA 1Y57A 1LCKA 2V26A 3EH2A 1M4ZA 1WHKA 1Q81R 2OTLA 2ED0A 2GFAA 4PK4A 2R57A 1ZQ1A 3QWYA 5LJ3g 4FYVB 2LJ1A 4C8QA 4A4FA 1I07A 1B34B 1Q7YR 1NEBA 3CCUT 3RUXA 1KJWA 2K5FA 3FJ5A 4YTLA 4E7IA 2X35A 3JB9G 1N8RU 3CCMT 5EG2A 1RACB 1VQ6T 2DLPA 5GAN2 2RQTA 1M1KC 2DZCA 2JNGA 2CDTA 5LJ3d 1AWOA 3CCEQ 2HAXA 3S3MA 4OF1A 4Y28E 1RAGB 3G6EQ 1YWPA 2PUOB 1WIEA 4Z8AA 1YJ9Q 3PMTA 4DBQA 2QEXT 5IH2A 2MF2A 4JLGA 2HEQA 4HVUA 1X27A 2HBPA 1VQLT 4M78G 2KK4A 1WXUA 3MCAB 1UB4A 3LGFA 1WHLA 1VOMA 3CCJA 3QYGB 3NHNA 3KXTA 1PC0A 2OX7A 4QQDA 2K6DA 2QGFB 1JJ2P 5I2MA 1W6XA 1R0BG 2GGRA 2X3WD 1YWOA 2K2VA 3OS1A 4DBHA 2NYSA 2X3XD 3HSBA 4IUQA 5KE2A 4LD6A 4JZ4A 1Y96B 1ZLMA 1VQNA 2L8DA 3SEMA 1B07A 2H3EB 2HL5C 3FB9A 3G4ST 2F2WA 1PD1A 4A4KA 5GMKm 1TUCA 1QMCA 4OB3B 2RI3A 2DJQA 2VC8A 1NE8A 3OYIA 4OB2B 2F5KA 4EIKA 3OA6A 2RHZA 2CGHA 1YP5A 2CZ1B 3I9QA 2GCXA 4QQGA 2QQSA 3NGPA 1OX9A 4J6YA 3JRZA 2AKLA 4M78D 3CPWA 1Y7XA 3JCMW 5L23A 3I5RA 3CC7A 1IB8A 1FXXA 1ARKA 4JRKA 4E47A 4NOYA 3KFVA 4M75D 2HKNA 1EIFA 2HNIA 1QVPA 4XU1A 2PU9B 1ZUYA 3CC4Q 2CREA 2LMJA 4QW2A 4EDUA 1KQSP 5FROA 1HD3A 3JB9H 1F1BB 4PFZA 3OYYA 1IHVA 5C6SA 2DJZA 3GPLA 4BACA 1QVFS 1JB0E 3CCRT 3BDUA 1VQMQ 4L5GA 5FLXE 4BB7A 4C8QG 4M75C 1H8KA 1O75A 2DF6A 2KVQG 4QVZA 1G3YA 1K8AR 3CCVT 4OGEA 3VYHB 3CCUQ 1JRIA 3EFRA 2RH2A 1AZEA 1R8OB 1TWBA 5KYXA 1K9MU 1BBZA 2K5IA 3LH5A 1U1SA 2XG8D 3PIPA 2QGGA 1VQ6Q 3VS5A 2RO0A 1H92A 1MMAA 2LRQA 2PNIA 4OP0A 1G3SA 3CCLT 5GANj 1WQ7A 3H9NA 2CH4W 2YXYA 4XQ3A 1KC8C 1PSFA 3CXCA 5GAMj 3CMET 2QEXQ 4J83A 3DB4A 4M7DC 2LNHB 2DX1A 1UE9A 1I5LA 1S1NA 4JLIA 3L2UA 3OBWA 3VS0A 4IIMA 4FSXA 2LT4A 2DXUA 3C12A 3MEWA 5GJWB 2LJ0A 2NLUA 2LVMA 2DM1A 2VASA 4C0DB 1PD0A 3OMCA 4AT1B 4EPCA 2OTLT 5KYNA 3HFNA 3G1JA 1VQPA 3VUZA 2MPXC 2ATCB 4F17A 3V7SA 5LJ3f 1QWFA 1MV0B 3BDLA 4QT7A 1X01A 1UHFA 2DK3A 1ZSZA 2XIDA 4Q5WA 1SSHA 2DFUA 1ZUUA 3M53A 3G4SQ 1GCQC 3REAB 4CC7A 1WHMA 4LD9K 3M0TA 1N8RR 1UG1A 4MZMA 2LQNA 4MMKA 4LDUA 2KRMA 1YJWA 2YRDA 3EGDA 3MO8A 4CC3A 1KIKA 1YCYA 4ANJA 1IO6A 4O6JA 3CC2A 1RL2A 3CCJT 3M0UA 2ZCFB 4OMPA 2NUZA 2F5TX 2K57A 2YLCA 1OU9A 1G83A 4HVWA 2FZKB 4RCBA 2VXEA 2O9VA 3ME9A 3H8ZA 1W4SA 3PGGA 1KSWA 1UGSB 4HT9A 4R56A 4BD3A 1VQ8A 5KE3A 2XDPA 3OYCA 1YI2T 1P92A 5LJ5h 4KH1B 5GANd 4OMLA 4GY5A 4FL6A 1VQNT 2LQWA 1PCXA 2EFIA 1YIJA 3L2WA 2ROLA 3A8HB 5GAMd 1NLOC 3CCRQ 5FRNA 1OOTA 3RDVA 3VUBA 2DERA 1JO8A 2YDLA 2BKDN 2V8JA 4E7ZA 3OB9A 4E7KA 3J7AF 2QAZA 3CCVQ 1X2KA 3TEEA 2J06A 4C5IA 4Z89A 5AYFA 3RNJA 1ZA1B 2V1QA 2ROTA 2YRCA 1K9AA 4OGCA 3CCLQ 4R0KA 2E5QA 3V7CA 5GJVB 4M7AA 2QQRA 2EVRA 5CKEA 3CC7T 3OS2A 1T3LA 1D0ZA 5A0GA 2HQXA 4X9CA 3UF4A 4M78E 2JS0A 3NPFA 1WJRA 4J5YA 3OYMA 5I21A 1RLQC 1CKBA 3LLRA 4PJOF 3V8KA 5GAOp 3X20B 1TH7A 9ATCB 1I1JA 3RMSA 2HDAA 4M75E 4DOVA 3H0HA 4OMQA 3VS1A 4M7AF 2HSPA 2DETA 4A54A 3L2VA 2OTLQ 1W1FA 1T3SA 3OMGA 1BB9A 2K4YA 2O88A 4QVCA 3RKYA 2HMAA 2A28A 2HL3A 2RD1A 2I0NA 3I55A 2LCLA 3OYNA 4BY6C 3OYKA 1X6BA 2C0IA 3FRNA 1QKXA 2KGTA 2M0OA 2XDBA 4PJOB 4F7UA 4LDXA 2LCCA 5LJ5e 2JTEA 3LYIA 3HL8A 2RJFA 4Y92A 1K9MR 3H41A 4PFOA 2EKOA 3VRYA 2KDSA 1KHCA 4M7AB 2DNUA 1OYXA 1M2VA 1OV3A 2KAFA 3I5SA 1WXTA 5DLOA 3SWNA 1QCFA 3FDRA 2JOYA 2XICA 2HKQB 2AZSA 3CCJQ 2EYQA 1H3ZA 1ZUKA 1UDLA 4F7UF 2VGNA 2EJGA 5HCKA 3OQ5A 1YFNA 2FRYA 2QTVA 5CCAA 3JB9F 2RB6A 1ZBJA 4RTVA 3C95A 4BDYA 1K0SA 1NPPA 1WXBA 4N0AC 2KQWA 1AD5A 1I8FA 3PVLA 2RNAA 2ENMA 3FJPA 1LVKA 2BIVA 2P84A 2FZCB 4OMFB 1WFWA 1K1ZA 5LJ3j 1VQNQ 3Q1JA 2NUPA 3NTIA 1GBQA 2O4XA 4WF2A 1U8RA 1OZ2A 2EW3A 1XJWB 2GQVA 3HKSA 2LZ6B 4XK8E 2DRKA 3UATA 3HHTB 1T0HA 4GLKA 3UT1A 3G71A 5M9OA 2RQWA 3VS4A 3CMAA 1G8XA 1JJ2S 4FIBA 3G7ZA 2IG0A 2JVVA 3CPWP 1M2VB 1X6GA 2JTFA 4HCKA 1QVFA 1RABB 4C92A 3CC2T 2FG0A 1NG2A 1YJNA 1I4K1 3PMIA 4WCIA 1YHQA 2PUKB 5A2QE 4E2FB 3JCMb 1VQOA 3CC7Q 2D0NA 1RAAB 2DKGA 1XQHA 4AG1C 1MUZA 1VIFA 4F16A 3A8LB 4P5NA 2OI3A 3DLMA 1VQ8T 3X26B 3CQTA 2L3RA 2XI9A 3KUFA 2MWOA 3LH0A 4JJCA 4C92F 5GANe 2DYIA 3J80E 3EG9A 3GIBA 1ZSGA 2BZXA 1C0MA 2VKNA 5FU6B 1NEGA 4X34A 1ZBXA 4DQ2A 4VUBA 1YBYA 5KYYB 2I2LA 1VYUA 2KXCA 2DYBA 2DTOA 4IUUA 4HKEA 5KYUA 3HPWA 1TUDA 3EG1A 3JB9J 1VQMT 4RG8A 2E10A 3M0QA 3CXCP 3QDRB 3GNFB 1MMDA 4F7UG 3M0PA 4PJOD 4LUDA 3OYGA 2JXBA 3TCJA 4V2SA 3JCMc 1TG0A 3HFOA 2E1HA 1KQSS 2D1XA 2E3HA 5J3BA 3DKMA 4CC2A 4M7AD 1PG5B 2DEQA 1BU1A 2V1RA 2EYWA 2MYSA 4D8DA 2WSEE 1MNEA 1IZ6A 4PJOC 4C8QF 1OI1A 5GAOl 3JCMg 2CZ6B 4BDZA 3O5ZA 2H3JA 3THKA 4Z02A 1SF9A 2AT1B 3D7SB 2MI6A 3VS3A 2NWMA 1M1GA 3EFSA 1VYVA 4FYYB 2LNVA 1D3BB 2JUFA 1VQPQ 3VS6A 3C4SA 1OZ3A 3VU3C 2E5KA 1D09B 1JXMA 3JCMd 5FRMA 1M1KU 4ELYC 5GAOq 3ZFJA 1RAHB 4EMKA 1VYTA 2EAYA 4J6WA 3QXEB 4BE2A 1QVGS 2EQUA 2EYXA 4XAXB 5FWBA 1H641 4C8QB 3OYDA 4J9DA 3RIRA 4ZN3A 3QJ6A 1YJWQ 1W70A 2OAUA 3AT1B 2DVEA 1MMNA 1M5Q1 3JB9D 2VUBA 2IIMA 3P8DA 4LDVA 5GAN8 2KXDA 4M77A 1VQKA 1J3TA 2AKKA 2DBMA 5GAOn 4C92G 3GNGA 3UA6A 3CC2Q 2COWA 1G2BA 1PRLC 2CUDA 2DXBA 2D8JA 2CT4A 2V8IA 1TU0B 5KCOA 4FW2A 4BUGA 1YI2A 1WHJA 4GLMA 3L2QA 3A98A 4ZGDB 4IUVA 2DE0X 2OTJA 4MMLA 1VIEA 5HKCA 4J9GA 1NYGA 3X25B 2KMTA 2MOXA 5AT1B 2QTXA 3NTKA 3J81E 2QQAA 4M77F 1VQ8Q 2FPEA 1UGRB 2YLBA 3I35A 1NLPC 5FW9A 5C0MA 1YIJQ 1X69A 4XTZA 2GTOA 3EFOA 3VYGA 2DBKA 2R5MA 2KR3A 2O2OA 2ABLA 1KHIA 1PKTA 5LJ3h 5GAN6 1HK9A 4M78C 4J9IA 2YRVA 3G71T 4JUVA 1E6HA 2C0TA 3CMAT 1MHNA 4XTWA 5D6XA 4WTOB 4NL3A 5FU6C 4MDXA 1N9RA 1XNIA 1AWJA 5HK3A 5L8RE 2EPDA 1V1CA 1YJNT 1UGQB 4C92D 2JM9A 5GAOr 1RAFB 1EZZB 1VQOT 1K73C 2CSQA 2MMPA 1E7OA 3LX7A 2E6NA 1GBRA 4XU3A 2PVDB 3M57A 3OYHA 3L42A 2CYZB 5DY9A 3EGUA 5CKDA 4CI0C 5LJ5g 4ZTFA 5I11A 1Y07A 1TOVA 1JXOA 2AHJB 1GL5A 2E12A 4DOWA 1BCMA 2GF7A 3TQ7P 1ABOA 3SB2A 1WLPB 1OQKA 4BI8B 5IAYA 4PKCC 4HCZA 1WX6A 3EG0A 4J9HA 3HTRA 5GMKj 1UTIA 1GCPA 3EFOB 2DXCA 3ZEHA 1Y71A 1VQ7A 1QCNA 1M90C 3HRUA 1Z9ZA 1QP3A 2FZGB 1X2QA 2JW4A 2LJ3A 3M4YA 1V29B 4OMOA 2M1HA 2B8AA 4MDWA 1YITA 4X1VA 1KC8U 2A36A 4IURA 4C8QD 3QYHB 1EFNA 2R58A 3HP9A 2EYYA 1M8MA 1K0XA 4PJOE 2ZPBB 2GFUA 5D6YA 5KYXB 4RMOA 4ZTJA 1FMWA 3REBB 2D6FA 2DO3A 4M77G 2RK2A 4OVAA 1M27C 3PNWC 5LJ3e 2BE7D 1RAEB 4FYXB 3QJYA 1M90U 3MHXA 2L2PA 4M7AE 1PSEA 1Q95G 3M59A 3GOXA 2K5LA 2F1LA 4C8QC 3P8BB 1IRXA 2DA9A 8AT1B 3ZL7C 4RTUA 1JQQA 2G3RA 1M8VA 1U5SA 1WJQA 2LX9A 2RMOA 3JCMf 5CQXA 3BFMA 4RTTA 2D0QB 2P0QA 5A0DA 4J9CA 1SG5A 2HBWA 2FO0A 3QZ5B 2X4WA 3RESA 4RTYA 1MNDA 3CPFA 3FIFA 2DMOA 1Q86C 2AZVA 1BYMA 4A53A 7AT1B 3RERA 5IXFA 2ZPIB 4XU0A 1OULA 2X4XA 1M1KR 4FT2A 2YUPA 1G3TA 3G71Q 3OSVA 1Q7YC 4QKUA 2J6FA 2JZ2A 1QVFP 3E9FA 1ZSZB 2EGAA 3CMAQ 2SRCA 1VUBA 2WSFE 4ESRA 2JN0A 4D8KA 4F7UE 4C0FA 6AT1B 3I56A 3C94A 1GRIA 2B86A 4J8OA 2JM8A 3QKJA 4M77D 5GAOm 4N4GA 3OW2S 2MWPA 2V8KA 1YJNQ 2PQWA 5IHNA 1PM3A 1YHQQ 1NM7A 1Q82C 4FYWB 1BIBA 1VQOQ
chains in the Genus database with same CATH topology
3NTIA 2HBPA 3OS0A 1Q86U 1VQLT 3E9GA 4M78G 2O4XA 4WF2A 2KK4A 1N27A 2LTOA 1U8RA 1OZ2A 3JCMP 3MCAB 1UB4A 2GQVA 2RI2A 3LGFA 1BI1A 3HKSA 1QW1A 4XK8E 3CCJA 3SD4A 3UDCA 2EQJA 5LJ5d 1FX7A 2EQMA 2RHYA 2XKOC 3HHTB 1VQ4A 3QYGB 1M9SA 2FB7A 3OYLA 4GLKA 3T9NA 3UT1A 1NZ9A 1K73U 3KXTA 3G71A 3JCMX 3JCMQ 5M9OA 2QQ9A 4QQDA 4KT0E 2VV5A 3N5BB 3QO3A 5I2MA 2WACA 4N0AA 3CMAA 3MP8A 4FIBA 1JJ2S 1KQSA 3G7ZA 2R5AA 4XTVA 2IG0A 2K2VA 2JVVA 4OB1B 2YHTA 3OS1A 3MP1A 3CCEA 2JTFA 1W2BS 1QVFA 3CC2T 4C92A 3HSBA 4IUQA 4C5GA 3G6EA 2ZPHB 5KE2A 4LD6A 3QPHA 1YJ9A 1YJNA 3AHUA 1Y96B 1I4K1 4BY6B 3PMIA 3VV0A 3PIOA 1YHQA 2PUKB 5A2QE 1Q82U 2LDMA 3CCMA 3VKIA 3JCMb 2L8DA 1VQNA 3CCST 1VQOA 2LQKA 1VQ6A 3M4GA 3CEYA 2XHCA 3FB9A 3MEVA 3G4ST 2DKGA 1XQHA 4A4KA 5GMKm 4OB3B 2HQEA 3JAME 2MAMA 2RI3A 1VIFA 3OYFA 3S3OA 3A8LB 4P5NA 3DLMA 1VQ8T 3O8VA 4JS5A 5KH6A 2LT1A 2P0PA 2LC4A 2VC8A 3X26B 1NE8A 3OYIA 4OB2B 4BE1A 2L3RA 2XI9A 3KUFA 2F5KA 2MWOA 3LH0A 3M9QA 4C92F 5GANe 3OA6A 4J7FA 2RHZA 3J80E 2CGHA 2ZPFB 3GIBA 2VYTA 2ZZDA 2RHUA 5A0LA 1UGPB 1VQLA 2CZ1B 1WGSA 3M55A 2E41A 2PVOB 5FU6B 2GCXA 2EIFA 3M54A 4X34A 1JJ2A 4QQGA 2QQSA 3UWNA 4C0DC 4C92E 1G5VA 1ZBXA 4DQ2A 3TU4K 4J6YA 3JRZA 2EWNA 4VUBA 4CRIA 1YBYA 4M78D 1S72T 4MZTA 4NL2A 2I2LA 4IUTA 4C5EA 1Y7XA 3CPWA 1QVGA 3JCMW 4KUIA 5CK9A 2DTOA 4IUUA 4HKEA 3CC7A 2RI5A 5LJ5f 3A8OB 3HPWA 2XK0A 4O5VA 1DJ7B 1FXXA 5CR2A 4MZPA 3JCMe 5GANh 4ELZC 3JB9J 1VQMT 4X9DA 3KBGA 4RG8A 2E10A 4N4HA 4JRKA 3SDZA 4E47A 4NOYA 4M75D 1EIFA 4FU6A 2HD0A 3LWHA 2HNIA 3QDRB 4DA4A 1QVPA 3GNFB 4F7UG 5GAMh 4PJOD 1Q81C 3CD6A 4XU1A 2PU9B 3JSCA 3OYGA 1KD1U 3TCJA 3V8JA 4V2SA 3JCMc 4QW2A 3HFOA 5GANg 4EDUA 3DB3A 5FROA 1VQ7T 2E1HA 4C0GA 3JB9H 3M58A 1KQSS 5J3BA 1XTDA 3OYYA 5C6SA 5CVIA 3DKMA 3X24B 2E65A 5GMKh 2DJZA 2CZ0B 3FC3A 4M7AD 3GPLA 4BACA 2DEQA 1QVFS 5GAMg 1JB0E 3CCRT 3BDUA 2EJ9A 4L5GA 5FLXE 2WSEE 4B9XA 4BB7A 3LWIA 4C8QG 3QBYA 4M75C 2ZGWA 1O75A 1VQKT 2JTMA 2KVQG 1YITT 1VQPT 4QQ6A 4QVZA 1IZ6A 1G3YA 2FVUA 5FRNA 4PJOC 2X4YA 3CCVT 4C8QF 4EMKC 2KSSA 4OGEA 3VYHB 1JRIA 1OI1A 2FHDA 5FU7C 3EFRA 4EMHA 2RH2A 2DD5A 2L89A 1BIAA 1WPYA 2M16A 2P4TA 4PL6A 5GAOl 3JCMg 1R8OB 2CZ6B 4BDZA 2H3JA 1K9MU 4Z02A 2K5IA 2Y4YA 1U1SA 2XG8D 3PIPA 3M56A 1NPRA 2MI6A 2RO0A 3V8LA 4C8QE 1VQ5A 2FL7A 2LRQA 4OP0A 2OTJT 1Q81U 1G3SA 1M1GA 2PVGB 3E1SA 3EFSA 2K3XA 4ME7A 5GAN5 3CCLT 2LNVA 4J6XA 5GAN4 5GANj 1D3BB 2JUFA 1WQ7A 3ER0A 4EMGA 3CC4A 2RJDA 1BKBA 2E6ZA 4XQ3A 3C4SA 1OZ3A 3FEOA 3X28B 3VU3C 1PSFA 4F7UB 1MGQA 4M77C 1KC8C 3CXCA 1XOVA 3R6OA 1Q7YU 1GXIE 1WJSA 4C0ZA 5GAMj 3RMQA 1VQ9A 1YJWT 3CMET 1LJOA 4M75A 3JCMd 4II1A 4IKFA 4J83A 1LNXA 3DB4A 5CKHA 4ELYC 4BE0A 1VQMA 1M1KU 5FRMA 4M7DC 3OSSC 4IUPA 4NS5A 4PJOA 5GAOq 1BI3A 3ZFJA 4EMKA 3CBPA 2EAYA 2O01E 3QXEB 4J6WA 3CPWS 4BE2A 1QVGS 4HT8A 2EQUA 3SWNB 1I5LA 4ATOA 4JLIA 4XAXB 5LL6S 3L2UA 3OBWA 1H641 4FT4A 4Y91A 4C8QB 2WSCE 5GAN3 3OYDA 3CCUA 2M9UA 2ZPGB 4FSXA 3RIRA 2QA4A 2LT4A 2DXUA 3C12A 3MEWA 5I2SA 3F70A 2QDYB 4ZN3A 2Y90A 3OYAA 5KCHA 2NLUA 3QJ6A 1KQ1A 2LVMA 2OAUA 3PTAA 2DVEA 2RK1A 1WNLA 4C0DB 3DLLA 4EPCA 1M5Q1 3OMCA 4J7IA 3JB9D 2OTLT 2VUBA 2CZ7B 1B34A 3OYBA 3P8DA 4LDVA 5GAN8 3HFNA 4M77A 1VQKA 5GAOn 4C92G 3GNGA 1VQPA 3VUZA 3WVEB 5GMKl 4TVRA 2L5QA 4PNOA 2EJFA 3V7SA 5LJ3f 3ASKA 4M7DA 4L6V5 2DXBA 3CCQA 3BDLA 4ZGEB 2V8IA 1X01A 5KCOA 2QEXA 2DK3A 3OS5A 1O9SA 1M1FA 4R55A 2XIDA 2FYKA 2KY9A 4BUGA 1YI2A 2XDDA 4Q5WA 5IN1A 1U1TA 3P8HA 3L2QA 1YIJT 3M53A 3WVDB 4ZGDB 5GAMe 2CKKA 2XU8A 3CBMA 4IUVA 2OTJA 4MMLA 1VIEA 3PFSA 5HKCA 4QVDA 4PLLA 3X25B 2KMTA 4LD9K 2O4XB 2DXTA 1UEBA 3I56T 2QTXA 3NTKA 3J81E 2QQAA 2DTHA 4M77F 3WXMB 1I81A 2QXFA 4MZMA 4MMKA 3GLXA 4LDUA 5GMKe 1UGRB 1YJWA 3CMEA 3MO8A 4M7DF 2DPPB 2YLBA 1BI2A 3CBOA 5C0MA 2A3LA 1YCYA 4M77E 2QI2A 4XTZA 4L59A 3VYGA 1N9SA 4O6JA 3H6ZA 3HRTA 2R5MA 3CC2A 1RL2A 3CXCS 1KHIA 3CCJT 2ZCFB 5LJ3h 5GAN6 1HK9A 1VQ4T 3OYEA 2F5TX 2K57A 4D6WA 4M78C 2YLCA 2XD0A 4C92B 5CKFA 2YRVA 3A5ZB 4KBMB 3G71T 4JUVA 3VJPA 3CCSA 2A7YA 4RCBA 2VXEA 3FLGA 3CMAT 1MHNA 4XTWA 5D6XA 3G4SA 3ME9A 2E64A 3H8ZA 1W4SA 3PGGA 4ZN1A 3CCET 4NL3A 1UGSB 4HT9A 5FU6C 3RKXA 4MDXA 1N9RA 1XNIA 4R56A 4BD3A 3NTHA 1Y96A 1VQ8A 3G6ET 5KE3A 5L8RE 5HK3A 1N6AA 3S6WA 2XDPA 3OYCA 1YI2T 1YJ9T 1YJNT 1P92A 5LJ5h 1UGQB 5HY6A 4C92D 4GY5A 2CS7A 2QQBA 5GANd 3INZA 4FL6A 5GAOr 1VQNT 4M7DB 4OB0B 1VQOT 1K73C 3EAEA 1HXDA 2MMPA 1RI0A 5DM7R 3LX7A 2EFIA 2BUDA 2E6NA 1K8AC 2LQ8A 1YIJA 4C5HA 4M7AC 4XU3A 5DLQE 2PVDB 3L2WA 3M57A 3A8HB 4JDSA 3MEAA 4M78A 5CQYA 5GAMd 4E7JA 3VUBA 3OYHA 2Y4XA 2CYZB 3L42A 5DY9A 5CKDA 4CI0C 2F69A 5LJ5g 2BKDN 2K3YA 2V8JA 4ZTFA 4E7KA 3OB9A 1S72A 1KQ2A 3J7AF 3E19A 1Y07A 3M5AA 2DTIA 1G3WA 3SFMA 4XU2A 1X6OA 5D6WA 2AHJB 3I55T 2E12A 3QZ9B 4JRIA 4DOWA 2GF7A 3TEEA 3QUIA 1X75C 1BI0A 3L2ZA 3SB2A 3MP6A 3NFCA 4C5IA 4B9WA 5AYFA 4A4HA 4BI8B 5IAYA 3A8MB 4PKCC 1SSFA 4HCZA 4FM4B 3L1AA 2RJEA 3LW5E 2E70A 3BW1A 5GMKj 4OGCA 3MEUA 4M78F 2DXCA 2DIGA 3ZEHA 1Y71A 3S3NA 2E5QA 1VQ7A 1M90C 1AHJB 3V7CA 4M7AA 2QQRA 5CKEA 3CC7T 3OBYA 3OS2A 3HRUA 1K8AU 3BY7A 4M75G 2HQXA 3RKWA 4X9CA 5A0GA 4JS4A 4KUDK 3V7RA 1QP3A 2VGMA 4M78E 4PJOG 5J26A 5LJ5j 1WQWA 3CCRA 2DD4A 1WJRA 3M4YA 4J5YA 4M75F 3OYMA 3META 2X4JA 3LGLA 1V29B 5I21A 5GAN7 3LLRA 2M1HA 4RKUE 2B8AA 4PJOF 4MDWA 3V8KA 1YITA 1QP2A 2DAQA 1KC8U 3CD6T 5GAOp 3CCVA 4IURA 3X20B 1TH7A 4C8QD 3QYHB 4M7AG 3HP9A 2R58A 1KD1C 4XTXA 3RMSA 4JRQA 4M75E 4PLIA 2RHXA 4DOVA 3GF5A 3JCMJ 2RJCA 3OW2A 4M7AF 4PJOE 2ZPBB 5GANf 5CIUA 4UC4A 1KG1A 2GFUA 5D6YA 4RMOA 2RHIA 4A54A 4ZTJA 3L2VA 2D6FA 2DO3A 5CKBA 4E7LA 4M77G 2RK2A 4OVAA 3OMGA 3PNWC 5LJ3e 3CCLA 2K4YA 1NJIC 4M78B 3A8GB 4M7DE 3QJYA 5GAMf 3HRSA 3JCMV 5GMKi 3MHXA 1M90U 4QVCA 4M7AE 3RKYA 1PSEA 2RA2A 4LDWA 3M59A 4HA8A 2EQKA 4RCCA 3SWNC 3L2RA 2K5LA 3GOXA 4M7DG 2RD1A 4C8QC 3I55A 3P8BB 2LCLA 4LDYA 3OYNA 4BI4A 4BY6C 3OYKA 3OY9A 1N8RC 2IVWA 2G3RA 1M8VA 1LOJA 3QHSA 3TREA 1WJQA 3FRNA 2LX9A 2M0OA 4M75B 5CO7A 1VQ5T 3JCMf 1D3BA 5CQXA 1ZHIA 3BFMA 5HK0A 4JJNK 4E7HA 2RM4A 2VXFA 2XDBA 4PJOB 5IT9E 4ZGJB 4EMKB 1IREB 4KULA 4HCBA 4A4EA 4F7UA 4HCCA 5FU7B 4LDXA 2LCCA 5LJ5e 3CC4T 3LYIA 3PT9A 4A4GA 2D0QB 2RJFA 3HL8A 3UPUA 2P0QA 5A0DA 1W2BA 1JBMA 3GP8A 2EKOA 3QZ5B 2KDSA 1VQ9T 2X4WA 1KHCA 1M4ZA 4M7AB 1OYXA 2ZPEB 3RESA 2DZ9A 4N4IA 2KAFA 1K9MC 2C06A 2OTLA 2GFAA 5DLOA 4JRPA 3SWNA 2R57A 1ZQ1A 2P0KA 3URGA 5LJ3g 1NJIU 3CPFA 3FDRA 3FIFA 3QG1A 1Q86C 4C8QA 2JOYA 2XICA 4A4FA 3QSUA 1BYMA 1B34B 4A53A 4RG2A 3RERA 4M77B 3CCUT 3RUXA 2ZPIB 2EYQA 1H3ZA 4XU0A 2D9TA 2X4XA 2K5FA 4YTLA 2QA4T 4FT2A 4F7UF 4E7IA 2X35A 1YHQT 2VGNA 2EJGA 3JB9G 1N8RU 3CCMT 5EG2A 1G3TA 3OYJA 3OQ5A 3JB9I 3OSVA 1Q7YC 1VQ6T 2JZ2A 3E9FA 5CAIA 5CCAA 3JCMh 5GAN2 1VUBA 2RB6A 3JB9F 4BI3A 2WSFE 1M1KC 3C95A 2JN0A 2DZCA 4BDYA 2JNGA 3QIIA 1NPPA 5LJ3d 4F7UE 4C0FA 4N0AC 1FWZA 3S3MA 2HAXA 2KQWA 3I56A 1I8FA 3C94A 4OF1A 4Y28E 5J39A 4J8OA 3QKJA 4M77D 5GAOm 4N4GA 4XTYA 3OW2S 3FJPA 2PUOB 2BIVA 3CCQT 2MWPA 2V8KA 3PMTA 2PQWA 2DIQA 4OMFB 2QEXT 3ZBDA 4C92C 2MF2A 4XTUA 5LJ3j 1Q82C 4M7DD 1BIBA 3Q1JA 4JLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I21 A;  5GAN 7;  2DTH A;  4M77 F;  1I81 A;  4PJO F;  4M78 G;  2E65 A;  3V8K A;  4WF2 A;  5GMK h;  2DJZ A;  4MMK A;  4M7A D;  4M7D D;  5GMK e;  5GAO p;  3JCM P;  2DEQ A;  1TH7 A;  4C8Q D;  5GAM g;  3BDU A;  4M7A G;  2EJ9 A;  4M7D F;  4XTX A;  2YLB A;  5LJ5 d;  4C8Q G;  4M75 E;  3JCM J;  4M75 C;  2ZGW A;  2FB7 A;  1YCY A;  4M77 E;  4XTZ A;  4M7A F;  4PJO E;  3JCM X;  4PJO C;  3JCM Q;  5GAN f;  1N9S A;  4C8Q F;  4EMK C;  1JRI A;  4A54 A;  3QO3 A;  3EFR A;  4N0A A;  4M77 G;  5LJ3 h;  4EMH A;  5GAN 6;  1BIA A;  1HK9 A;  1WPY A;  5LJ3 e;  2K57 A;  4XTV A;  4M78 C;  2YLC A;  3JCM g;  5GAO l;  4M78 B;  4C92 B;  2YHT A;  4M7D E;  5GAM f;  3JCM V;  5GMK i;  1U1S A;  4JUV A;  4QVC A;  4M7A E;  3RKY A;  3SWN C;  2RA2 A;  4M7D G;  4HA8 A;  4RCB A;  4RCC A;  3V8L A;  2VXE A;  4C8Q E;  2RD1 A;  4C8Q C;  4C92 A;  3HSB A;  4OP0 A;  4XTW A;  3EFS A;  5GAN 5;  5GAN j;  5GAN 4;  4J6X A;  1Y96 B;  1I4K 1;  1D3B B;  2E64 A;  3AHU A;  3PGG A;  1WQ7 A;  4EMG A;  1M8V A;  1LOJ A;  4NL3 A;  3QHS A;  3JCM b;  4XQ3 A;  4HT9 A;  4M75 B;  3RKX A;  1N9R A;  3VU3 C;  4F7U B;  3M4G A;  1MGQ A;  4M77 C;  1Y96 A;  3JCM f;  1D3B A;  3BFM A;  5GAM j;  2RM4 A;  2VXF A;  3FB9 A;  4PJO B;  1BIB A;  1LJO A;  2DKG A;  4EMK B;  4M75 A;  3JCM d;  5LJ5 h;  4F7U A;  1LNX A;  4C92 D;  5GMK m;  5LJ5 e;  5GAN d;  4M7D C;  3INZ A;  5GAO r;  4M7D B;  4PJO A;  1JBM A;  5GAO q;  1HXD A;  4EMK A;  2EAY A;  4J6W A;  4HT8 A;  4M7A C;  2VC8 A;  4XU3 A;  3SWN B;  4M7A B;  1I5L A;  4M78 A;  5GAM d;  4JLI A;  4C92 F;  5GAN e;  3RES A;  1H64 1;  4Y91 A;  5DY9 A;  4C8Q B;  2DZ9 A;  5GAN 3;  2CGH A;  3GIB A;  5LJ5 g;  3RIR A;  3SWN A;  2DXU A;  5LJ3 g;  3FIF A;  1KQ2 A;  4C8Q A;  2Y90 A;  2DTI A;  3QSU A;  1B34 B;  1KQ1 A;  2E41 A;  4XU2 A;  4A53 A;  3RER A;  2DVE A;  4M77 B;  3RUX A;  4JRI A;  4C92 E;  1WNL A;  4DQ2 A;  4J6Y A;  1M5Q 1;  3JB9 D;  3QUI A;  4XU0 A;  2EWN A;  1B34 A;  3L2Z A;  4M78 D;  4F7U F;  4NL2 A;  3SB2 A;  5GAN 8;  2EJG A;  2I2L A;  3HFN A;  4M77 A;  3JB9 G;  5GAO n;  3JB9 I;  4C92 G;  3JCM W;  5GMK l;  2DTO A;  3L1A A;  4PNO A;  2EJF A;  5LJ5 f;  3V7S A;  5CAI A;  5LJ3 f;  5GMK j;  3JCM h;  3BW1 A;  5GAN 2;  2RB6 A;  3JB9 F;  4M7D A;  3JCM e;  5GAN h;  2JN0 A;  2DZC A;  4M78 F;  3JB9 J;  1X01 A;  5LJ3 d;  4X9D A;  4F7U E;  2E10 A;  4N0A C;  2FYK A;  4JRK A;  3V7C A;  1I8F A;  4NOY A;  4M75 D;  4M7A A;  1U1T A;  4M77 D;  5GAO m;  2HNI A;  3BY7 A;  4M75 G;  4XTY A;  3RKW A;  4X9C A;  3FJP A;  4F7U G;  5GAM h;  5GAM e;  4PJO D;  3V7R A;  4XU1 A;  4MML A;  4M78 E;  4PJO G;  4QVD A;  4C92 C;  5LJ5 j;  1WQW A;  3V8J A;  4V2S A;  3JCM c;  5GAN g;  3HFO A;  4XTU A;  4J5Y A;  5LJ3 j;  4M75 F;  2DXT A;  2E1H A;  2QTX A;  3JB9 H; 
#chains in the Genus database with same CATH topology
 3EGD B;  1Q86 U;  1U06 A;  2LTO A;  1OPK A;  3UDC A;  1VQ4 A;  1OPL A;  1FX7 A;  2EQM A;  2KBT A;  1M9S A;  2FB7 A;  3OYL A;  1A0N B;  4KGV B;  1NZ9 A;  1ACM B;  2QQ9 A;  2CT3 A;  4KT0 E;  2VV5 A;  2JJ9 A;  1QQJ A;  1KQS A;  4XTV A;  1GFC A;  1M30 A;  2K9G A;  4PJM A;  4OB1 B;  2YHT A;  3MP1 A;  1W2B S;  1CSK A;  1UFF A;  2RPN A;  1OX8 A;  3AHU A;  3PIO A;  3VV0 A;  1Q82 U;  4Z88 A;  1H3H A;  2QG9 B;  3CCM A;  3VKI A;  1D0X A;  2LQK A;  1VQ6 A;  3CEY A;  1B3Q A;  2XHC A;  3MEV A;  1UJ0 A;  2HQE A;  3JAM E;  2IPO B;  2BTT A;  5KH6 A;  3H0F A;  2D8H A;  4BE1 A;  1FMK A;  1WZO A;  4J7F A;  2ZPF B;  2ZZD A;  2RHU A;  5A0L A;  1VQL A;  1WGS A;  3M55 A;  2E41 A;  2PVO B;  2EIF A;  3M54 A;  1G5V A;  4C0D C;  1TTH B;  4C92 E;  3TU4 K;  1VA7 A;  2EWN A;  4PJL A;  4NL2 A;  4C5E A;  1QVG A;  3PE0 A;  2EGE A;  4KUI A;  4HXJ A;  2RF0 A;  5LJ5 f;  4O5V A;  1BCO A;  5GAN h;  2BZY A;  4X9D A;  3KBG A;  4IIO A;  4N4H A;  3SDZ A;  1OU8 A;  4FU6 A;  3LWH A;  2HD0 A;  4DA4 A;  5GAM h;  2HQH A;  3CD6 A;  1I5O B;  2KI7 A;  3MPU B;  3V8J A;  1VQ7 T;  3DB3 A;  4C0G A;  1UGV A;  1XTD A;  2E65 A;  5GMK h;  1K76 A;  2CZ0 B;  3FC3 A;  3MKD A;  2PZ1 A;  2M0Y A;  2EJ9 A;  4B9X A;  3QBY A;  2ZGW A;  2L3S A;  1YIT T;  1VQP T;  4QQ6 A;  1UJY A;  2X4Y A;  4EMH A;  2DD5 A;  2M16 A;  1BIA A;  2O9S A;  4C8Q E;  1KC8 R;  1VQ5 A;  4ME7 A;  5GAN 5;  5GAN 4;  1VQK Q;  1I0C A;  3ER0 A;  2E6Z A;  3FEO A;  4F7U B;  1MGQ A;  1V76 A;  1XOV A;  1M2O A;  4C0Z A;  1VQ9 A;  3RMQ A;  1Z9Q A;  2YUQ A;  1YJW T;  4M75 A;  4II1 A;  5CKH A;  4BE0 A;  4DEX A;  1YI2 Q;  1FYN A;  5KYW A;  3OSS C;  1AEY A;  4IUP A;  2GBQ A;  4E7S A;  2KRO A;  1M90 R;  3CBP A;  1IGQ A;  1ZSZ C;  1M3A A;  2O01 E;  1N5Z A;  2OTJ Q;  3SWN B;  4ATO A;  5LL6 S;  4AFZ C;  4FT4 A;  5GAN 3;  2QA4 A;  2J6K A;  5I2S A;  3F70 A;  2QDY B;  1D1B A;  2RK1 A;  2CUB A;  4J7I A;  1B34 A;  2GQI A;  1QLY A;  3OYB A;  2YUN A;  1SRL A;  2RQU A;  3WVE B;  1AZG B;  2JMC A;  5ECA A;  4M7D A;  1SEM A;  3CCQ A;  4ZGE B;  2P4R A;  2PTK A;  1O9S A;  1M1F A;  4R55 A;  2FYK A;  2KY9 A;  5IXB A;  3M0R A;  3P8H A;  1GFD A;  1YIJ T;  2COZ A;  3WVD B;  2BE9 B;  2XU8 A;  3CBM A;  5GAM e;  2NUP B;  1M3C A;  3PFS A;  4PLL A;  2F2V A;  1B7T A;  2O4X B;  3I56 T;  3WXM B;  1I81 A;  5GMK e;  3CME A;  4J9E A;  4PJN A;  4M7D F;  4OMN A;  3CBO A;  4M77 E;  5IHK A;  2QI2 A;  2MK5 A;  4L59 A;  4LNP A;  3HRT A;  1WHH A;  2H8H A;  1VQ4 T;  4B6M A;  3OYE A;  3NMZ C;  4D6W A;  1HSQ A;  4C92 B;  4KBM B;  1GCQ A;  3VJP A;  1Q86 R;  3CCS A;  4OMM A;  3H0I A;  3FLG A;  2KNB B;  1R77 A;  2E64 A;  1WHG A;  4ZN1 A;  2CP5 A;  2ECZ A;  3NTH A;  1Y96 A;  2YUO A;  2L3P A;  1VQ7 Q;  2QQB A;  1SHF A;  3INZ A;  4M7D B;  2DL5 A;  4OB0 B;  1HXD A;  5DM7 R;  2BUD A;  4C5H A;  4M7A C;  3EG9 B;  5DLQ E;  1PHT A;  4JDS A;  2CP2 A;  2Y4X A;  2K2M A;  2RN8 A;  2K3Y A;  1Q82 R;  2ZAE A;  1S72 A;  1YIT Q;  2DTI A;  3SFM A;  4XU2 A;  5D6W A;  3I55 T;  4JRI A;  1JU5 C;  2W10 A;  1MV3 A;  3MP6 A;  5KYU B;  1FMV A;  3A8M B;  2A0F B;  1SSF A;  1C6V X;  1SHG A;  2E70 A;  3BW1 A;  3M0S A;  1AVZ C;  1SPK A;  3MEU A;  2DIG A;  3OBY A;  4M75 G;  3RKW A;  4AMC A;  4JS4 A;  4KUD K;  1PKS A;  3V7R A;  2VGM A;  1ZA2 B;  5I22 A;  5LJ5 j;  1WQW A;  2W0Z A;  3TSW A;  2X4J A;  3LGL A;  5GAN 7;  4RKU E;  3EG3 A;  1QP2 A;  3CD6 T;  2HSE B;  1RI9 A;  4J9B A;  2DVJ A;  2A08 A;  2DL4 A;  4DBR A;  1KD1 C;  2JMA A;  3PVQ A;  4JRQ A;  2EGC A;  4PLI A;  3GF5 A;  2RJC A;  3OW2 A;  5CIU A;  4E7L A;  5D7U A;  1NJI C;  3JCM V;  3SWN C;  2RA2 A;  4LDW A;  4M7D G;  2EQK A;  4RCC A;  2EQI A;  1D1C A;  3TSZ A;  4BI4 A;  1C1A A;  3TRE A;  1WA7 A;  1TXQ A;  5CO7 A;  1VQ5 T;  5HK0 A;  4E7H A;  4KGX B;  2RM4 A;  2VXF A;  1HYO A;  4RUG A;  5IT9 E;  4ZGJ B;  4EMK B;  1IRE B;  4HCB A;  4A4E A;  4HCC A;  5FU7 B;  1KD1 U;  4A4G A;  3PT9 A;  1AOJ A;  3I56 Q;  3UPU A;  1W2B A;  1JBM A;  3C0C A;  2NUT A;  3GP8 A;  2EKH A;  2O31 A;  3VS2 A;  1VQ9 T;  2ZPE B;  2DZ9 A;  4N4I A;  1K9M C;  2C06 A;  4JRP A;  2P0K A;  3URG A;  1NJI U;  3QG1 A;  3QSU A;  3EH1 A;  4RG2 A;  4M77 B;  1ZX6 A;  3IQL A;  1VQ4 Q;  2D9T A;  3TVT A;  2QA4 T;  1YHQ T;  3OYJ A;  4DBF A;  3JB9 I;  2HZY A;  1OEB A;  5CAI A;  3JCM h;  4AFS C;  4BI3 A;  2QDL A;  2K7A A;  2KRN A;  3QII A;  1FWZ A;  5J39 A;  1AWX A;  4XTY A;  3CCQ T;  2DIQ A;  3ZBD A;  4C92 C;  3QDF A;  3CCM Q;  4XTU A;  4M7D D;  2DEU A;  1WI7 A;  2L3Q A;  3OS0 A;  3E9G A;  1N27 A;  1YCS B;  3JCM P;  4JJD A;  1AWW A;  2RI2 A;  1BI1 A;  1IHW A;  1KK7 A;  1QW1 A;  3SD4 A;  5LJ5 d;  2EQJ A;  2RHY A;  2XKO C;  1IGU A;  2DL7 A;  2AK5 A;  3T9N A;  2YWW A;  1UUE A;  1K73 U;  3JCM X;  2J6O A;  2JT4 A;  3JCM Q;  2RQR A;  3I55 Q;  2NUT B;  3QO3 A;  3N5B B;  2WAC A;  4N0A A;  3MP8 A;  2R5A A;  2GTJ A;  1VQL Q;  3CCE A;  1QVG P;  2J7I A;  1X43 A;  4C5G A;  3G6E A;  2ZPH B;  3QPH A;  1YJ9 A;  2K79 A;  3U23 A;  4BY6 B;  2AIR B;  2KRS A;  2LDM A;  3CCS T;  4J9F A;  3M4G A;  4AFQ C;  2MAM A;  3OYF A;  2VB6 A;  4FCY A;  3S3O A;  2LP5 A;  3O8V A;  4JS5 A;  3CD6 Q;  2LT1 A;  2P0P A;  2LC4 A;  1TSF A;  2OJ2 A;  3M9Q A;  2VYT A;  1UGP B;  2VWF A;  1JJ2 A;  1K4U S;  3UWN A;  2ESW A;  4CRI A;  1YN8 A;  1S72 T;  4MZT A;  4IUT A;  4AFU C;  3BE3 A;  2LCS A;  1E6G A;  5CK9 A;  2RI5 A;  3A1P A;  3A8O B;  2LX7 A;  2XK0 A;  1DJ7 B;  2C0O A;  2M02 A;  2GNC A;  4MZP A;  5CR2 A;  3JCM e;  4ELZ C;  2QK0 A;  4FW1 A;  4LE9 A;  4F04 B;  1VQ5 Q;  1PRM C;  1Q81 C;  2XMF A;  2J05 A;  3JSC A;  5GAN g;  3M58 A;  5CVI A;  3X24 B;  1VQ9 Q;  1QCO A;  5GAM g;  3LWI A;  3UA7 A;  1VQK T;  3RBB B;  3SHW A;  2JTM A;  1SKU B;  2BZ8 A;  2FVU A;  3VS7 A;  2F2X A;  2KSS A;  4EMK C;  2FHD A;  5FU7 C;  4ZNX A;  3VRZ A;  1MMG A;  2L89 A;  2P4T A;  1WPY A;  2EYZ A;  4PL6 A;  2QA4 Q;  4FSS A;  3ULR B;  2DIL A;  2KT1 A;  2Y4Y A;  3M56 A;  1NPR A;  2SEM A;  3V8L A;  2RQV A;  4F14 A;  2FL7 A;  2QAS A;  2OTJ T;  1Q81 U;  2PVG B;  3E1S A;  2K3X A;  1LPL A;  4J6X A;  1RLP C;  3CC4 A;  4EMG A;  2RJD A;  1BKB A;  1TUG B;  2X9H A;  3QWX X;  1RUW A;  3X28 B;  1D0Y A;  4M77 C;  1Q7Y U;  3R6O A;  1GXI E;  1WJS A;  3CCQ Q;  1LJO A;  1RAD B;  4IKF A;  1LNX A;  1VQM A;  2DL8 A;  2HCK A;  4NS5 A;  4PJO A;  1BI3 A;  3CPW S;  4HT8 A;  4GBQ A;  4Y91 A;  3CCU A;  2WSC E;  4CC4 B;  4KH0 B;  1UEC A;  2M9U A;  2ZPG B;  1JEG A;  2FPF A;  1IXD A;  2Y90 A;  3OYA A;  5KCH A;  1KQ1 A;  3CME Q;  3PTA A;  1WNL A;  3DLL A;  1AT1 B;  3MJX A;  4RTZ A;  2CZ7 B;  1KD1 R;  1WYX A;  1TS9 A;  4KRT A;  5GMK l;  4TVR A;  2L5Q A;  2YT6 A;  4PNO A;  2EJF A;  3EGX A;  3ASK A;  2E3I A;  4L6V 5;  2QEX A;  3OS5 A;  4LUE A;  1NJI R;  2KYB A;  3CCS Q;  2XDD A;  5IN1 A;  1U1T A;  2K3B A;  2CKK A;  1PNJ A;  1EX4 A;  3EHR A;  4LXC A;  4QVD A;  4RTW A;  5FWC A;  2DXT A;  1UEB A;  8ATC B;  2DTH A;  1KFZ A;  2QXF A;  2QYZ A;  4HVV A;  3GLX A;  4LN2 A;  2DPP B;  1BI2 A;  1PWT A;  2DRM A;  2A3L A;  4M4Z A;  2G6F X;  1N9S A;  3H6Z A;  2A37 A;  3CXC S;  1Y0M A;  2MIO A;  2M51 A;  2DL3 A;  1D1A A;  4M7D E;  2FPD A;  1S72 Q;  2XD0 A;  2FEI A;  5CKF A;  3A5Z B;  3JV3 A;  1QWE A;  2A7Y A;  3EHQ A;  2X51 A;  3G4S A;  3CCE T;  3RKX A;  4KGZ B;  1K73 R;  3G6E T;  2CH4 A;  1N6A A;  3S6W A;  1YJ9 T;  1M3B A;  2E4H A;  5HY6 A;  3EGX B;  2CS7 A;  5IHI A;  2OAW A;  1BK2 A;  3EAE A;  4JPB W;  1RI0 A;  1K8A C;  2LQ8 A;  4M78 A;  3MEA A;  5CQY A;  4E7J A;  1RAI B;  2CP7 A;  2F69 A;  2CSI A;  1KQ2 A;  3E19 A;  1U3O A;  3M5A A;  4DEY A;  1NBE B;  4JZ3 A;  3OW2 P;  1G3W A;  4ORZ A;  1X6O A;  4PFP A;  1R0C B;  3QZ9 B;  2CP3 A;  3QUI A;  1X75 C;  1BI0 A;  3L2Z A;  4PJJ A;  4RTX A;  3NFC A;  4B9W A;  4A4H A;  2JS2 A;  4FM4 B;  3L1A A;  2RJE A;  5KYY A;  3LW5 E;  3E2U A;  4M78 F;  1YNZ A;  3S3N A;  1AHJ B;  5EC7 A;  2KEA A;  4A63 B;  4E6R A;  3EG2 A;  1K8A U;  3BY7 A;  2MCN A;  2KYM A;  1SRM A;  2ED1 A;  4PJO G;  2KT8 A;  5J26 A;  3CCR A;  2DD4 A;  4M75 F;  3MET A;  1W2B P;  2KE9 A;  1HJD A;  2DAQ A;  3CCV A;  4M7A G;  2Z0W A;  4XTX A;  3R6N A;  3GBQ A;  1WDX A;  2RHX A;  3JCM J;  5GAN f;  4UC4 A;  1KG1 A;  2COY A;  2CP6 A;  2RHI A;  5CKB A;  1NYF A;  1ABQ A;  1UHC A;  3CCL A;  2CP0 A;  4M78 B;  3A8G B;  4AG2 C;  3HRS A;  2L0A A;  5GAM f;  5GMK i;  1QKW A;  4HA8 A;  3L2R A;  2YSQ A;  4LDY A;  2EBP A;  3OY9 A;  1N8R C;  2IVW A;  1LOJ A;  3QHS A;  4M75 B;  4K11 A;  1D3B A;  1CKA A;  1ZHI A;  5KYW B;  4JJN K;  2VVK A;  3RR6 A;  4KUL A;  1T0J A;  2FRW A;  3CC4 T;  4JJB A;  1Y57 A;  1LCK A;  2V26 A;  3EH2 A;  1M4Z A;  1WHK A;  1Q81 R;  2OTL A;  2ED0 A;  2GFA A;  4PK4 A;  2R57 A;  1ZQ1 A;  3QWY A;  5LJ3 g;  4FYV B;  2LJ1 A;  4C8Q A;  4A4F A;  1I07 A;  1B34 B;  1Q7Y R;  1NEB A;  3CCU T;  3RUX A;  1KJW A;  2K5F A;  3FJ5 A;  4YTL A;  4E7I A;  2X35 A;  3JB9 G;  1N8R U;  3CCM T;  5EG2 A;  1RAC B;  1VQ6 T;  2DLP A;  5GAN 2;  2RQT A;  1M1K C;  2DZC A;  2JNG A;  2CDT A;  5LJ3 d;  1AWO A;  3CCE Q;  2HAX A;  3S3M A;  4OF1 A;  4Y28 E;  1RAG B;  3G6E Q;  1YWP A;  2PUO B;  1WIE A;  4Z8A A;  1YJ9 Q;  3PMT A;  4DBQ A;  2QEX T;  5IH2 A;  2MF2 A;  4JLG A;  2HEQ A;  4HVU A;  1X27 A;  2HBP A;  1VQL T;  4M78 G;  2KK4 A;  1WXU A;  3MCA B;  1UB4 A;  3LGF A;  1WHL A;  1VOM A;  3CCJ A;  3QYG B;  3NHN A;  3KXT A;  1PC0 A;  2OX7 A;  4QQD A;  2K6D A;  2QGF B;  1JJ2 P;  5I2M A;  1W6X A;  1R0B G;  2GGR A;  2X3W D;  1YWO A;  2K2V A;  3OS1 A;  4DBH A;  2NYS A;  2X3X D;  3HSB A;  4IUQ A;  5KE2 A;  4LD6 A;  4JZ4 A;  1Y96 B;  1ZLM A;  1VQN A;  2L8D A;  3SEM A;  1B07 A;  2H3E B;  2HL5 C;  3FB9 A;  3G4S T;  2F2W A;  1PD1 A;  4A4K A;  5GMK m;  1TUC A;  1QMC A;  4OB3 B;  2RI3 A;  2DJQ A;  2VC8 A;  1NE8 A;  3OYI A;  4OB2 B;  2F5K A;  4EIK A;  3OA6 A;  2RHZ A;  2CGH A;  1YP5 A;  2CZ1 B;  3I9Q A;  2GCX A;  4QQG A;  2QQS A;  3NGP A;  1OX9 A;  4J6Y A;  3JRZ A;  2AKL A;  4M78 D;  3CPW A;  1Y7X A;  3JCM W;  5L23 A;  3I5R A;  3CC7 A;  1IB8 A;  1FXX A;  1ARK A;  4JRK A;  4E47 A;  4NOY A;  3KFV A;  4M75 D;  2HKN A;  1EIF A;  2HNI A;  1QVP A;  4XU1 A;  2PU9 B;  1ZUY A;  3CC4 Q;  2CRE A;  2LMJ A;  4QW2 A;  4EDU A;  1KQS P;  5FRO A;  1HD3 A;  3JB9 H;  1F1B B;  4PFZ A;  3OYY A;  1IHV A;  5C6S A;  2DJZ A;  3GPL A;  4BAC A;  1QVF S;  1JB0 E;  3CCR T;  3BDU A;  1VQM Q;  4L5G A;  5FLX E;  4BB7 A;  4C8Q G;  4M75 C;  1H8K A;  1O75 A;  2DF6 A;  2KVQ G;  4QVZ A;  1G3Y A;  1K8A R;  3CCV T;  4OGE A;  3VYH B;  3CCU Q;  1JRI A;  3EFR A;  2RH2 A;  1AZE A;  1R8O B;  1TWB A;  5KYX A;  1K9M U;  1BBZ A;  2K5I A;  3LH5 A;  1U1S A;  2XG8 D;  3PIP A;  2QGG A;  1VQ6 Q;  3VS5 A;  2RO0 A;  1H92 A;  1MMA A;  2LRQ A;  2PNI A;  4OP0 A;  1G3S A;  3CCL T;  5GAN j;  1WQ7 A;  3H9N A;  2CH4 W;  2YXY A;  4XQ3 A;  1KC8 C;  1PSF A;  3CXC A;  5GAM j;  3CME T;  2QEX Q;  4J83 A;  3DB4 A;  4M7D C;  2LNH B;  2DX1 A;  1UE9 A;  1I5L A;  1S1N A;  4JLI A;  3L2U A;  3OBW A;  3VS0 A;  4IIM A;  4FSX A;  2LT4 A;  2DXU A;  3C12 A;  3MEW A;  5GJW B;  2LJ0 A;  2NLU A;  2LVM A;  2DM1 A;  2VAS A;  4C0D B;  1PD0 A;  3OMC A;  4AT1 B;  4EPC A;  2OTL T;  5KYN A;  3HFN A;  3G1J A;  1VQP A;  3VUZ A;  2MPX C;  2ATC B;  4F17 A;  3V7S A;  5LJ3 f;  1QWF A;  1MV0 B;  3BDL A;  4QT7 A;  1X01 A;  1UHF A;  2DK3 A;  1ZSZ A;  2XID A;  4Q5W A;  1SSH A;  2DFU A;  1ZUU A;  3M53 A;  3G4S Q;  1GCQ C;  3REA B;  4CC7 A;  1WHM A;  4LD9 K;  3M0T A;  1N8R R;  1UG1 A;  4MZM A;  2LQN A;  4MMK A;  4LDU A;  2KRM A;  1YJW A;  2YRD A;  3EGD A;  3MO8 A;  4CC3 A;  1KIK A;  1YCY A;  4ANJ A;  1IO6 A;  4O6J A;  3CC2 A;  1RL2 A;  3CCJ T;  3M0U A;  2ZCF B;  4OMP A;  2NUZ A;  2F5T X;  2K57 A;  2YLC A;  1OU9 A;  1G83 A;  4HVW A;  2FZK B;  4RCB A;  2VXE A;  2O9V A;  3ME9 A;  3H8Z A;  1W4S A;  3PGG A;  1KSW A;  1UGS B;  4HT9 A;  4R56 A;  4BD3 A;  1VQ8 A;  5KE3 A;  2XDP A;  3OYC A;  1YI2 T;  1P92 A;  5LJ5 h;  4KH1 B;  5GAN d;  4OML A;  4GY5 A;  4FL6 A;  1VQN T;  2LQW A;  1PCX A;  2EFI A;  1YIJ A;  3L2W A;  2ROL A;  3A8H B;  5GAM d;  1NLO C;  3CCR Q;  5FRN A;  1OOT A;  3RDV A;  3VUB A;  2DER A;  1JO8 A;  2YDL A;  2BKD N;  2V8J A;  4E7Z A;  3OB9 A;  4E7K A;  3J7A F;  2QAZ A;  3CCV Q;  1X2K A;  3TEE A;  2J06 A;  4C5I A;  4Z89 A;  5AYF A;  3RNJ A;  1ZA1 B;  2V1Q A;  2ROT A;  2YRC A;  1K9A A;  4OGC A;  3CCL Q;  4R0K A;  2E5Q A;  3V7C A;  5GJV B;  4M7A A;  2QQR A;  2EVR A;  5CKE A;  3CC7 T;  3OS2 A;  1T3L A;  1D0Z A;  5A0G A;  2HQX A;  4X9C A;  3UF4 A;  4M78 E;  2JS0 A;  3NPF A;  1WJR A;  4J5Y A;  3OYM A;  5I21 A;  1RLQ C;  1CKB A;  3LLR A;  4PJO F;  3V8K A;  5GAO p;  3X20 B;  1TH7 A;  9ATC B;  1I1J A;  3RMS A;  2HDA A;  4M75 E;  4DOV A;  3H0H A;  4OMQ A;  3VS1 A;  4M7A F;  2HSP A;  2DET A;  4A54 A;  3L2V A;  2OTL Q;  1W1F A;  1T3S A;  3OMG A;  1BB9 A;  2K4Y A;  2O88 A;  4QVC A;  3RKY A;  2HMA A;  2A28 A;  2HL3 A;  2RD1 A;  2I0N A;  3I55 A;  2LCL A;  3OYN A;  4BY6 C;  3OYK A;  1X6B A;  2C0I A;  3FRN A;  1QKX A;  2KGT A;  2M0O A;  2XDB A;  4PJO B;  4F7U A;  4LDX A;  2LCC A;  5LJ5 e;  2JTE A;  3LYI A;  3HL8 A;  2RJF A;  4Y92 A;  1K9M R;  3H41 A;  4PFO A;  2EKO A;  3VRY A;  2KDS A;  1KHC A;  4M7A B;  2DNU A;  1OYX A;  1M2V A;  1OV3 A;  2KAF A;  3I5S A;  1WXT A;  5DLO A;  3SWN A;  1QCF A;  3FDR A;  2JOY A;  2XIC A;  2HKQ B;  2AZS A;  3CCJ Q;  2EYQ A;  1H3Z A;  1ZUK A;  1UDL A;  4F7U F;  2VGN A;  2EJG A;  5HCK A;  3OQ5 A;  1YFN A;  2FRY A;  2QTV A;  5CCA A;  3JB9 F;  2RB6 A;  1ZBJ A;  4RTV A;  3C95 A;  4BDY A;  1K0S A;  1NPP A;  1WXB A;  4N0A C;  2KQW A;  1AD5 A;  1I8F A;  3PVL A;  2RNA A;  2ENM A;  3FJP A;  1LVK A;  2BIV A;  2P84 A;  2FZC B;  4OMF B;  1WFW A;  1K1Z A;  5LJ3 j;  1VQN Q;  3Q1J A;  2NUP A;  3NTI A;  1GBQ A;  2O4X A;  4WF2 A;  1U8R A;  1OZ2 A;  2EW3 A;  1XJW B;  2GQV A;  3HKS A;  2LZ6 B;  4XK8 E;  2DRK A;  3UAT A;  3HHT B;  1T0H A;  4GLK A;  3UT1 A;  3G71 A;  5M9O A;  2RQW A;  3VS4 A;  3CMA A;  1G8X A;  1JJ2 S;  4FIB A;  3G7Z A;  2IG0 A;  2JVV A;  3CPW P;  1M2V B;  1X6G A;  2JTF A;  4HCK A;  1QVF A;  1RAB B;  4C92 A;  3CC2 T;  2FG0 A;  1NG2 A;  1YJN A;  1I4K 1;  3PMI A;  4WCI A;  1YHQ A;  2PUK B;  5A2Q E;  4E2F B;  3JCM b;  1VQO A;  3CC7 Q;  2D0N A;  1RAA B;  2DKG A;  1XQH A;  4AG1 C;  1MUZ A;  1VIF A;  4F16 A;  3A8L B;  4P5N A;  2OI3 A;  3DLM A;  1VQ8 T;  3X26 B;  3CQT A;  2L3R A;  2XI9 A;  3KUF A;  2MWO A;  3LH0 A;  4JJC A;  4C92 F;  5GAN e;  2DYI A;  3J80 E;  3EG9 A;  3GIB A;  1ZSG A;  2BZX A;  1C0M A;  2VKN A;  5FU6 B;  1NEG A;  4X34 A;  1ZBX A;  4DQ2 A;  4VUB A;  1YBY A;  5KYY B;  2I2L A;  1VYU A;  2KXC A;  2DYB A;  2DTO A;  4IUU A;  4HKE A;  5KYU A;  3HPW A;  1TUD A;  3EG1 A;  3JB9 J;  1VQM T;  4RG8 A;  2E10 A;  3M0Q A;  3CXC P;  3QDR B;  3GNF B;  1MMD A;  4F7U G;  3M0P A;  4PJO D;  4LUD A;  3OYG A;  2JXB A;  3TCJ A;  4V2S A;  3JCM c;  1TG0 A;  3HFO A;  2E1H A;  1KQS S;  2D1X A;  2E3H A;  5J3B A;  3DKM A;  4CC2 A;  4M7A D;  1PG5 B;  2DEQ A;  1BU1 A;  2V1R A;  2EYW A;  2MYS A;  4D8D A;  2WSE E;  1MNE A;  1IZ6 A;  4PJO C;  4C8Q F;  1OI1 A;  5GAO l;  3JCM g;  2CZ6 B;  4BDZ A;  3O5Z A;  2H3J A;  3THK A;  4Z02 A;  1SF9 A;  2AT1 B;  3D7S B;  2MI6 A;  3VS3 A;  2NWM A;  1M1G A;  3EFS A;  1VYV A;  4FYY B;  2LNV A;  1D3B B;  2JUF A;  1VQP Q;  3VS6 A;  3C4S A;  1OZ3 A;  3VU3 C;  2E5K A;  1D09 B;  1JXM A;  3JCM d;  5FRM A;  1M1K U;  4ELY C;  5GAO q;  3ZFJ A;  1RAH B;  4EMK A;  1VYT A;  2EAY A;  4J6W A;  3QXE B;  4BE2 A;  1QVG S;  2EQU A;  2EYX A;  4XAX B;  5FWB A;  1H64 1;  4C8Q B;  3OYD A;  4J9D A;  3RIR A;  4ZN3 A;  3QJ6 A;  1YJW Q;  1W70 A;  2OAU A;  3AT1 B;  2DVE A;  1MMN A;  1M5Q 1;  3JB9 D;  2VUB A;  2IIM A;  3P8D A;  4LDV A;  5GAN 8;  2KXD A;  4M77 A;  1VQK A;  1J3T A;  2AKK A;  2DBM A;  5GAO n;  4C92 G;  3GNG A;  3UA6 A;  3CC2 Q;  2COW A;  1G2B A;  1PRL C;  2CUD A;  2DXB A;  2D8J A;  2CT4 A;  2V8I A;  1TU0 B;  5KCO A;  4FW2 A;  4BUG A;  1YI2 A;  1WHJ A;  4GLM A;  3L2Q A;  3A98 A;  4ZGD B;  4IUV A;  2DE0 X;  2OTJ A;  4MML A;  1VIE A;  5HKC A;  4J9G A;  1NYG A;  3X25 B;  2KMT A;  2MOX A;  5AT1 B;  2QTX A;  3NTK A;  3J81 E;  2QQA A;  4M77 F;  1VQ8 Q;  2FPE A;  1UGR B;  2YLB A;  3I35 A;  1NLP C;  5FW9 A;  5C0M A;  1YIJ Q;  1X69 A;  4XTZ A;  2GTO A;  3EFO A;  3VYG A;  2DBK A;  2R5M A;  2KR3 A;  2O2O A;  2ABL A;  1KHI A;  1PKT A;  5LJ3 h;  5GAN 6;  1HK9 A;  4M78 C;  4J9I A;  2YRV A;  3G71 T;  4JUV A;  1E6H A;  2C0T A;  3CMA T;  1MHN A;  4XTW A;  5D6X A;  4WTO B;  4NL3 A;  5FU6 C;  4MDX A;  1N9R A;  1XNI A;  1AWJ A;  5HK3 A;  5L8R E;  2EPD A;  1V1C A;  1YJN T;  1UGQ B;  4C92 D;  2JM9 A;  5GAO r;  1RAF B;  1EZZ B;  1VQO T;  1K73 C;  2CSQ A;  2MMP A;  1E7O A;  3LX7 A;  2E6N A;  1GBR A;  4XU3 A;  2PVD B;  3M57 A;  3OYH A;  3L42 A;  2CYZ B;  5DY9 A;  3EGU A;  5CKD A;  4CI0 C;  5LJ5 g;  4ZTF A;  5I11 A;  1Y07 A;  1TOV A;  1JXO A;  2AHJ B;  1GL5 A;  2E12 A;  4DOW A;  1BCM A;  2GF7 A;  3TQ7 P;  1ABO A;  3SB2 A;  1WLP B;  1OQK A;  4BI8 B;  5IAY A;  4PKC C;  4HCZ A;  1WX6 A;  3EG0 A;  4J9H A;  3HTR A;  5GMK j;  1UTI A;  1GCP A;  3EFO B;  2DXC A;  3ZEH A;  1Y71 A;  1VQ7 A;  1QCN A;  1M90 C;  3HRU A;  1Z9Z A;  1QP3 A;  2FZG B;  1X2Q A;  2JW4 A;  2LJ3 A;  3M4Y A;  1V29 B;  4OMO A;  2M1H A;  2B8A A;  4MDW A;  1YIT A;  4X1V A;  1KC8 U;  2A36 A;  4IUR A;  4C8Q D;  3QYH B;  1EFN A;  2R58 A;  3HP9 A;  2EYY A;  1M8M A;  1K0X A;  4PJO E;  2ZPB B;  2GFU A;  5D6Y A;  5KYX B;  4RMO A;  4ZTJ A;  1FMW A;  3REB B;  2D6F A;  2DO3 A;  4M77 G;  2RK2 A;  4OVA A;  1M27 C;  3PNW C;  5LJ3 e;  2BE7 D;  1RAE B;  4FYX B;  3QJY A;  1M90 U;  3MHX A;  2L2P A;  4M7A E;  1PSE A;  1Q95 G;  3M59 A;  3GOX A;  2K5L A;  2F1L A;  4C8Q C;  3P8B B;  1IRX A;  2DA9 A;  8AT1 B;  3ZL7 C;  4RTU A;  1JQQ A;  2G3R A;  1M8V A;  1U5S A;  1WJQ A;  2LX9 A;  2RMO A;  3JCM f;  5CQX A;  3BFM A;  4RTT A;  2D0Q B;  2P0Q A;  5A0D A;  4J9C A;  1SG5 A;  2HBW A;  2FO0 A;  3QZ5 B;  2X4W A;  3RES A;  4RTY A;  1MND A;  3CPF A;  3FIF A;  2DMO A;  1Q86 C;  2AZV A;  1BYM A;  4A53 A;  7AT1 B;  3RER A;  5IXF A;  2ZPI B;  4XU0 A;  1OUL A;  2X4X A;  1M1K R;  4FT2 A;  2YUP A;  1G3T A;  3G71 Q;  3OSV A;  1Q7Y C;  4QKU A;  2J6F A;  2JZ2 A;  1QVF P;  3E9F A;  1ZSZ B;  2EGA A;  3CMA Q;  2SRC A;  1VUB A;  2WSF E;  4ESR A;  2JN0 A;  4D8K A;  4F7U E;  4C0F A;  6AT1 B;  3I56 A;  3C94 A;  1GRI A;  2B86 A;  4J8O A;  2JM8 A;  3QKJ A;  4M77 D;  5GAO m;  4N4G A;  3OW2 S;  2MWP A;  2V8K A;  1YJN Q;  2PQW A;  5IHN A;  1PM3 A;  1YHQ Q;  1NM7 A;  1Q82 C;  4FYW B;  1BIB A;  1VQO Q; 
#chains in the Genus database with same CATH homology
 3NTI A;  2HBP A;  3OS0 A;  1Q86 U;  1VQL T;  3E9G A;  4M78 G;  2O4X A;  4WF2 A;  2KK4 A;  1N27 A;  2LTO A;  1U8R A;  1OZ2 A;  3JCM P;  3MCA B;  1UB4 A;  2GQV A;  2RI2 A;  3LGF A;  1BI1 A;  3HKS A;  1QW1 A;  4XK8 E;  3CCJ A;  3SD4 A;  3UDC A;  2EQJ A;  5LJ5 d;  1FX7 A;  2EQM A;  2RHY A;  2XKO C;  3HHT B;  1VQ4 A;  3QYG B;  1M9S A;  2FB7 A;  3OYL A;  4GLK A;  3T9N A;  3UT1 A;  1NZ9 A;  1K73 U;  3KXT A;  3G71 A;  3JCM X;  3JCM Q;  5M9O A;  2QQ9 A;  4QQD A;  4KT0 E;  2VV5 A;  3N5B B;  3QO3 A;  5I2M A;  2WAC A;  4N0A A;  3CMA A;  3MP8 A;  4FIB A;  1JJ2 S;  1KQS A;  3G7Z A;  2R5A A;  4XTV A;  2IG0 A;  2K2V A;  2JVV A;  4OB1 B;  2YHT A;  3OS1 A;  3MP1 A;  3CCE A;  2JTF A;  1W2B S;  1QVF A;  3CC2 T;  4C92 A;  3HSB A;  4IUQ A;  4C5G A;  3G6E A;  2ZPH B;  5KE2 A;  4LD6 A;  3QPH A;  1YJ9 A;  1YJN A;  3AHU A;  1Y96 B;  1I4K 1;  4BY6 B;  3PMI A;  3VV0 A;  3PIO A;  1YHQ A;  2PUK B;  5A2Q E;  1Q82 U;  2LDM A;  3CCM A;  3VKI A;  3JCM b;  2L8D A;  1VQN A;  3CCS T;  1VQO A;  2LQK A;  1VQ6 A;  3M4G A;  3CEY A;  2XHC A;  3FB9 A;  3MEV A;  3G4S T;  2DKG A;  1XQH A;  4A4K A;  5GMK m;  4OB3 B;  2HQE A;  3JAM E;  2MAM A;  2RI3 A;  1VIF A;  3OYF A;  3S3O A;  3A8L B;  4P5N A;  3DLM A;  1VQ8 T;  3O8V A;  4JS5 A;  5KH6 A;  2LT1 A;  2P0P A;  2LC4 A;  2VC8 A;  3X26 B;  1NE8 A;  3OYI A;  4OB2 B;  4BE1 A;  2L3R A;  2XI9 A;  3KUF A;  2F5K A;  2MWO A;  3LH0 A;  3M9Q A;  4C92 F;  5GAN e;  3OA6 A;  4J7F A;  2RHZ A;  3J80 E;  2CGH A;  2ZPF B;  3GIB A;  2VYT A;  2ZZD A;  2RHU A;  5A0L A;  1UGP B;  1VQL A;  2CZ1 B;  1WGS A;  3M55 A;  2E41 A;  2PVO B;  5FU6 B;  2GCX A;  2EIF A;  3M54 A;  4X34 A;  1JJ2 A;  4QQG A;  2QQS A;  3UWN A;  4C0D C;  4C92 E;  1G5V A;  1ZBX A;  4DQ2 A;  3TU4 K;  4J6Y A;  3JRZ A;  2EWN A;  4VUB A;  4CRI A;  1YBY A;  4M78 D;  1S72 T;  4MZT A;  4NL2 A;  2I2L A;  4IUT A;  4C5E A;  1Y7X A;  3CPW A;  1QVG A;  3JCM W;  4KUI A;  5CK9 A;  2DTO A;  4IUU A;  4HKE A;  3CC7 A;  2RI5 A;  5LJ5 f;  3A8O B;  3HPW A;  2XK0 A;  4O5V A;  1DJ7 B;  1FXX A;  5CR2 A;  4MZP A;  3JCM e;  5GAN h;  4ELZ C;  3JB9 J;  1VQM T;  4X9D A;  3KBG A;  4RG8 A;  2E10 A;  4N4H A;  4JRK A;  3SDZ A;  4E47 A;  4NOY A;  4M75 D;  1EIF A;  4FU6 A;  2HD0 A;  3LWH A;  2HNI A;  3QDR B;  4DA4 A;  1QVP A;  3GNF B;  4F7U G;  5GAM h;  4PJO D;  1Q81 C;  3CD6 A;  4XU1 A;  2PU9 B;  3JSC A;  3OYG A;  1KD1 U;  3TCJ A;  3V8J A;  4V2S A;  3JCM c;  4QW2 A;  3HFO A;  5GAN g;  4EDU A;  3DB3 A;  5FRO A;  1VQ7 T;  2E1H A;  4C0G A;  3JB9 H;  3M58 A;  1KQS S;  5J3B A;  1XTD A;  3OYY A;  5C6S A;  5CVI A;  3DKM A;  3X24 B;  2E65 A;  5GMK h;  2DJZ A;  2CZ0 B;  3FC3 A;  4M7A D;  3GPL A;  4BAC A;  2DEQ A;  1QVF S;  5GAM g;  1JB0 E;  3CCR T;  3BDU A;  2EJ9 A;  4L5G A;  5FLX E;  2WSE E;  4B9X A;  4BB7 A;  3LWI A;  4C8Q G;  3QBY A;  4M75 C;  2ZGW A;  1O75 A;  1VQK T;  2JTM A;  2KVQ G;  1YIT T;  1VQP T;  4QQ6 A;  4QVZ A;  1IZ6 A;  1G3Y A;  2FVU A;  5FRN A;  4PJO C;  2X4Y A;  3CCV T;  4C8Q F;  4EMK C;  2KSS A;  4OGE A;  3VYH B;  1JRI A;  1OI1 A;  2FHD A;  5FU7 C;  3EFR A;  4EMH A;  2RH2 A;  2DD5 A;  2L89 A;  1BIA A;  1WPY A;  2M16 A;  2P4T A;  4PL6 A;  5GAO l;  3JCM g;  1R8O B;  2CZ6 B;  4BDZ A;  2H3J A;  1K9M U;  4Z02 A;  2K5I A;  2Y4Y A;  1U1S A;  2XG8 D;  3PIP A;  3M56 A;  1NPR A;  2MI6 A;  2RO0 A;  3V8L A;  4C8Q E;  1VQ5 A;  2FL7 A;  2LRQ A;  4OP0 A;  2OTJ T;  1Q81 U;  1G3S A;  1M1G A;  2PVG B;  3E1S A;  3EFS A;  2K3X A;  4ME7 A;  5GAN 5;  3CCL T;  2LNV A;  4J6X A;  5GAN 4;  5GAN j;  1D3B B;  2JUF A;  1WQ7 A;  3ER0 A;  4EMG A;  3CC4 A;  2RJD A;  1BKB A;  2E6Z A;  4XQ3 A;  3C4S A;  1OZ3 A;  3FEO A;  3X28 B;  3VU3 C;  1PSF A;  4F7U B;  1MGQ A;  4M77 C;  1KC8 C;  3CXC A;  1XOV A;  3R6O A;  1Q7Y U;  1GXI E;  1WJS A;  4C0Z A;  5GAM j;  3RMQ A;  1VQ9 A;  1YJW T;  3CME T;  1LJO A;  4M75 A;  3JCM d;  4II1 A;  4IKF A;  4J83 A;  1LNX A;  3DB4 A;  5CKH A;  4ELY C;  4BE0 A;  1VQM A;  1M1K U;  5FRM A;  4M7D C;  3OSS C;  4IUP A;  4NS5 A;  4PJO A;  5GAO q;  1BI3 A;  3ZFJ A;  4EMK A;  3CBP A;  2EAY A;  2O01 E;  3QXE B;  4J6W A;  3CPW S;  4BE2 A;  1QVG S;  4HT8 A;  2EQU A;  3SWN B;  1I5L A;  4ATO A;  4JLI A;  4XAX B;  5LL6 S;  3L2U A;  3OBW A;  1H64 1;  4FT4 A;  4Y91 A;  4C8Q B;  2WSC E;  5GAN 3;  3OYD A;  3CCU A;  2M9U A;  2ZPG B;  4FSX A;  3RIR A;  2QA4 A;  2LT4 A;  2DXU A;  3C12 A;  3MEW A;  5I2S A;  3F70 A;  2QDY B;  4ZN3 A;  2Y90 A;  3OYA A;  5KCH A;  2NLU A;  3QJ6 A;  1KQ1 A;  2LVM A;  2OAU A;  3PTA A;  2DVE A;  2RK1 A;  1WNL A;  4C0D B;  3DLL A;  4EPC A;  1M5Q 1;  3OMC A;  4J7I A;  3JB9 D;  2OTL T;  2VUB A;  2CZ7 B;  1B34 A;  3OYB A;  3P8D A;  4LDV A;  5GAN 8;  3HFN A;  4M77 A;  1VQK A;  5GAO n;  4C92 G;  3GNG A;  1VQP A;  3VUZ A;  3WVE B;  5GMK l;  4TVR A;  2L5Q A;  4PNO A;  2EJF A;  3V7S A;  5LJ3 f;  3ASK A;  4M7D A;  4L6V 5;  2DXB A;  3CCQ A;  3BDL A;  4ZGE B;  2V8I A;  1X01 A;  5KCO A;  2QEX A;  2DK3 A;  3OS5 A;  1O9S A;  1M1F A;  4R55 A;  2XID A;  2FYK A;  2KY9 A;  4BUG A;  1YI2 A;  2XDD A;  4Q5W A;  5IN1 A;  1U1T A;  3P8H A;  3L2Q A;  1YIJ T;  3M53 A;  3WVD B;  4ZGD B;  5GAM e;  2CKK A;  2XU8 A;  3CBM A;  4IUV A;  2OTJ A;  4MML A;  1VIE A;  3PFS A;  5HKC A;  4QVD A;  4PLL A;  3X25 B;  2KMT A;  4LD9 K;  2O4X B;  2DXT A;  1UEB A;  3I56 T;  2QTX A;  3NTK A;  3J81 E;  2QQA A;  2DTH A;  4M77 F;  3WXM B;  1I81 A;  2QXF A;  4MZM A;  4MMK A;  3GLX A;  4LDU A;  5GMK e;  1UGR B;  1YJW A;  3CME A;  3MO8 A;  4M7D F;  2DPP B;  2YLB A;  1BI2 A;  3CBO A;  5C0M A;  2A3L A;  1YCY A;  4M77 E;  2QI2 A;  4XTZ A;  4L59 A;  3VYG A;  1N9S A;  4O6J A;  3H6Z A;  3HRT A;  2R5M A;  3CC2 A;  1RL2 A;  3CXC S;  1KHI A;  3CCJ T;  2ZCF B;  5LJ3 h;  5GAN 6;  1HK9 A;  1VQ4 T;  3OYE A;  2F5T X;  2K57 A;  4D6W A;  4M78 C;  2YLC A;  2XD0 A;  4C92 B;  5CKF A;  2YRV A;  3A5Z B;  4KBM B;  3G71 T;  4JUV A;  3VJP A;  3CCS A;  2A7Y A;  4RCB A;  2VXE A;  3FLG A;  3CMA T;  1MHN A;  4XTW A;  5D6X A;  3G4S A;  3ME9 A;  2E64 A;  3H8Z A;  1W4S A;  3PGG A;  4ZN1 A;  3CCE T;  4NL3 A;  1UGS B;  4HT9 A;  5FU6 C;  3RKX A;  4MDX A;  1N9R A;  1XNI A;  4R56 A;  4BD3 A;  3NTH A;  1Y96 A;  1VQ8 A;  3G6E T;  5KE3 A;  5L8R E;  5HK3 A;  1N6A A;  3S6W A;  2XDP A;  3OYC A;  1YI2 T;  1YJ9 T;  1YJN T;  1P92 A;  5LJ5 h;  1UGQ B;  5HY6 A;  4C92 D;  4GY5 A;  2CS7 A;  2QQB A;  5GAN d;  3INZ A;  4FL6 A;  5GAO r;  1VQN T;  4M7D B;  4OB0 B;  1VQO T;  1K73 C;  3EAE A;  1HXD A;  2MMP A;  1RI0 A;  5DM7 R;  3LX7 A;  2EFI A;  2BUD A;  2E6N A;  1K8A C;  2LQ8 A;  1YIJ A;  4C5H A;  4M7A C;  4XU3 A;  5DLQ E;  2PVD B;  3L2W A;  3M57 A;  3A8H B;  4JDS A;  3MEA A;  4M78 A;  5CQY A;  5GAM d;  4E7J A;  3VUB A;  3OYH A;  2Y4X A;  2CYZ B;  3L42 A;  5DY9 A;  5CKD A;  4CI0 C;  2F69 A;  5LJ5 g;  2BKD N;  2K3Y A;  2V8J A;  4ZTF A;  4E7K A;  3OB9 A;  1S72 A;  1KQ2 A;  3J7A F;  3E19 A;  1Y07 A;  3M5A A;  2DTI A;  1G3W A;  3SFM A;  4XU2 A;  1X6O A;  5D6W A;  2AHJ B;  3I55 T;  2E12 A;  3QZ9 B;  4JRI A;  4DOW A;  2GF7 A;  3TEE A;  3QUI A;  1X75 C;  1BI0 A;  3L2Z A;  3SB2 A;  3MP6 A;  3NFC A;  4C5I A;  4B9W A;  5AYF A;  4A4H A;  4BI8 B;  5IAY A;  3A8M B;  4PKC C;  1SSF A;  4HCZ A;  4FM4 B;  3L1A A;  2RJE A;  3LW5 E;  2E70 A;  3BW1 A;  5GMK j;  4OGC A;  3MEU A;  4M78 F;  2DXC A;  2DIG A;  3ZEH A;  1Y71 A;  3S3N A;  2E5Q A;  1VQ7 A;  1M90 C;  1AHJ B;  3V7C A;  4M7A A;  2QQR A;  5CKE A;  3CC7 T;  3OBY A;  3OS2 A;  3HRU A;  1K8A U;  3BY7 A;  4M75 G;  2HQX A;  3RKW A;  4X9C A;  5A0G A;  4JS4 A;  4KUD K;  3V7R A;  1QP3 A;  2VGM A;  4M78 E;  4PJO G;  5J26 A;  5LJ5 j;  1WQW A;  3CCR A;  2DD4 A;  1WJR A;  3M4Y A;  4J5Y A;  4M75 F;  3OYM A;  3MET A;  2X4J A;  3LGL A;  1V29 B;  5I21 A;  5GAN 7;  3LLR A;  2M1H A;  4RKU E;  2B8A A;  4PJO F;  4MDW A;  3V8K A;  1YIT A;  1QP2 A;  2DAQ A;  1KC8 U;  3CD6 T;  5GAO p;  3CCV A;  4IUR A;  3X20 B;  1TH7 A;  4C8Q D;  3QYH B;  4M7A G;  3HP9 A;  2R58 A;  1KD1 C;  4XTX A;  3RMS A;  4JRQ A;  4M75 E;  4PLI A;  2RHX A;  4DOV A;  3GF5 A;  3JCM J;  2RJC A;  3OW2 A;  4M7A F;  4PJO E;  2ZPB B;  5GAN f;  5CIU A;  4UC4 A;  1KG1 A;  2GFU A;  5D6Y A;  4RMO A;  2RHI A;  4A54 A;  4ZTJ A;  3L2V A;  2D6F A;  2DO3 A;  5CKB A;  4E7L A;  4M77 G;  2RK2 A;  4OVA A;  3OMG A;  3PNW C;  5LJ3 e;  3CCL A;  2K4Y A;  1NJI C;  4M78 B;  3A8G B;  4M7D E;  3QJY A;  5GAM f;  3HRS A;  3JCM V;  5GMK i;  3MHX A;  1M90 U;  4QVC A;  4M7A E;  3RKY A;  1PSE A;  2RA2 A;  4LDW A;  3M59 A;  4HA8 A;  2EQK A;  4RCC A;  3SWN C;  3L2R A;  2K5L A;  3GOX A;  4M7D G;  2RD1 A;  4C8Q C;  3I55 A;  3P8B B;  2LCL A;  4LDY A;  3OYN A;  4BI4 A;  4BY6 C;  3OYK A;  3OY9 A;  1N8R C;  2IVW A;  2G3R A;  1M8V A;  1LOJ A;  3QHS A;  3TRE A;  1WJQ A;  3FRN A;  2LX9 A;  2M0O A;  4M75 B;  5CO7 A;  1VQ5 T;  3JCM f;  1D3B A;  5CQX A;  1ZHI A;  3BFM A;  5HK0 A;  4JJN K;  4E7H A;  2RM4 A;  2VXF A;  2XDB A;  4PJO B;  5IT9 E;  4ZGJ B;  4EMK B;  1IRE B;  4KUL A;  4HCB A;  4A4E A;  4F7U A;  4HCC A;  5FU7 B;  4LDX A;  2LCC A;  5LJ5 e;  3CC4 T;  3LYI A;  3PT9 A;  4A4G A;  2D0Q B;  2RJF A;  3HL8 A;  3UPU A;  2P0Q A;  5A0D A;  1W2B A;  1JBM A;  3GP8 A;  2EKO A;  3QZ5 B;  2KDS A;  1VQ9 T;  2X4W A;  1KHC A;  1M4Z A;  4M7A B;  1OYX A;  2ZPE B;  3RES A;  2DZ9 A;  4N4I A;  2KAF A;  1K9M C;  2C06 A;  2OTL A;  2GFA A;  5DLO A;  4JRP A;  3SWN A;  2R57 A;  1ZQ1 A;  2P0K A;  3URG A;  5LJ3 g;  1NJI U;  3CPF A;  3FDR A;  3FIF A;  3QG1 A;  1Q86 C;  4C8Q A;  2JOY A;  2XIC A;  4A4F A;  3QSU A;  1BYM A;  1B34 B;  4A53 A;  4RG2 A;  3RER A;  4M77 B;  3CCU T;  3RUX A;  2ZPI B;  2EYQ A;  1H3Z A;  4XU0 A;  2D9T A;  2X4X A;  2K5F A;  4YTL A;  2QA4 T;  4FT2 A;  4F7U F;  4E7I A;  2X35 A;  1YHQ T;  2VGN A;  2EJG A;  3JB9 G;  1N8R U;  3CCM T;  5EG2 A;  1G3T A;  3OYJ A;  3OQ5 A;  3JB9 I;  3OSV A;  1Q7Y C;  1VQ6 T;  2JZ2 A;  3E9F A;  5CAI A;  5CCA A;  3JCM h;  5GAN 2;  1VUB A;  2RB6 A;  3JB9 F;  4BI3 A;  2WSF E;  1M1K C;  3C95 A;  2JN0 A;  2DZC A;  4BDY A;  2JNG A;  3QII A;  1NPP A;  5LJ3 d;  4F7U E;  4C0F A;  4N0A C;  1FWZ A;  3S3M A;  2HAX A;  2KQW A;  3I56 A;  1I8F A;  3C94 A;  4OF1 A;  4Y28 E;  5J39 A;  4J8O A;  3QKJ A;  4M77 D;  5GAO m;  4N4G A;  4XTY A;  3OW2 S;  3FJP A;  2PUO B;  2BIV A;  3CCQ T;  2MWP A;  2V8K A;  3PMT A;  2PQW A;  2DIQ A;  4OMF B;  2QEX T;  3ZBD A;  4C92 C;  2MF2 A;  4XTU A;  5LJ3 j;  1Q82 C;  4M7D D;  1BIB A;  3Q1J A;  4JLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...