4C92C

Crystal structure of the yeast lsm1-7 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92C00
1BIAA 4N0AC 2RD1A 3JCMX 3VU3C 5LJ5j 3JCMb 3JCMc 4XTVA 4PJOD 5GAOm 4M75A 3RESA 4EMHA 4A54A 4HT8A 4M7DF 4J6WA 2EJFA 4C8QE 5LJ3g 4Y91A 4M78F 5LJ5d 4A53A 2RB6A 4C92C 3JCMd 4M7DG 3BW1A 5GAOn 4M7AF 2YLBA 4M7DE 1I8FA 4QVDA 5GAN7 4M78G 3RKYA 5LJ5e 3JCMe 1BIBA 1LOJA 4M7AG 4XTZA 4M7AE 4C8QB 4V2SA 2K57A 4M77F 1N9RA 4M75C 4RCCA 5GMKh 4HT9A 1MGQA 4EMKA 4PJOF 4NOYA 2DTHA 3JB9H 1M5Q1 5GANh 4F7UF 4M77G 3V8KA 4M7DB 3PGGA 4RCBA 3V7RA 5GMKj 4PJOG 4DQ2A 1U1TA 4M78B 4C8QF 4F7UG 4PJOE 1WQ7A 2QTXA 5GANj 1B34B 4C92D 2DJZA 4M7AB 4F7UE 3BDUA 5LJ3f 3JCMQ 1LNXA 2RA2A 4C8QG 3V7CA 1I4K1 1H641 4JUVA 4M7DA 3HFNA 5GAMh 4EMKC 4M78A 1N9SA 5GAN3 5GAN2 2EJGA 3QHSA 4M77B 4PNOA 4XTUA 2E64A 5GANd 2VXEA 3SWNB 2DKGA 4PJOB 5GAMj 4WF2A 5GMKe 4JRKA 3EFRA 4F7UB 4XU0A 4XU1A 5LJ5f 5GAN8 3RUXA 5GANe 3JB9J 3JCMf 3FB9A 4M77A 3INZA 2DXUA 1I81A 4M7DC 3SWNA 5LJ5g 4PJOA 3JCMg 4X9CA 3BY7A 4M78C 4XTXA 2DZ9A 1Y96B 4F7UA 5GAMd 1WNLA 4C92E 3JB9D 3HSBA 2E10A 2DTOA 4NL2A 4C8QA 5GAMe 1JBMA 3QSUA 2VC8A 1KQ2A 4X9DA 3FIFA 4XTWA 5GAN6 2E41A 5GMKl 5GAN4 4XQ3A 3RKWA 1Y96A 2EWNA 5LJ3h 4M77C 1YCYA 4J6YA 4J6XA 3SWNC 4NL3A 1D3BB 1I5LA 4PJOC 3V7SA 5GAOp 2Y90A 2CGHA 3M4GA 4JRIA 5LJ3j 1B34A 4MMLA 4M75D 2DXTA 4XTYA 3JCMJ 4M7AA 3JCMW 4EMGA 2YLCA 4C8QC 1JRIA 2DVEA 3JB9F 1D3BA 1M8VA 1WQWA 5GANf 5GAOr 2EAYA 1U1SA 5LJ3d 4C92F 3GIBA 2YHTA 3SB2A 5GANg 2E65A 3RKXA 2I2LA 2VXFA 4XU2A 4C92G 5GMKm 1TH7A 4M77D 3V8JA 5LJ3e 1KQ1A 4HA8A 4XU3A 1LJOA 4MMKA 3JB9I 4M7AC 3EFSA 1X01A 1WPYA 5DY9A 4M75F 5GAMf 2FB7A 4JLIA 3JCMP 3JCMV 5I21A 5GAN5 2EJ9A 1HXDA 4M75G 5CAIA 4C8QD 5GAMg 5GAOl 4N0AA 4M75E 4EMKB 2DTIA 4J5YA 2HNIA 3L1AA 3QUIA 3RIRA 3AHUA 4C92B 4M78E 1HK9A 3QO3A 3BFMA 4M7DD 2DEQA 5GAOq 5GMKi 2RM4A 4M78D 3V8LA 2E1HA 3HFOA 2DZCA 2ZGWA 3L2ZA 2FYKA 4OP0A 2JN0A 5LJ5h 4M7AD 3JCMh 3RERA 4C92A 3FJPA 4M75B 4QVCA 3JB9G 4M77E
chains in the Genus database with same CATH superfamily
5I2MA 2RD1A 4DA4A 3JCMX 1RI0A 2E5QA 1G3WA 3LWHA 1ZBXA 4AFZC 2X3WD 1FMVA 4BY6B 2OAWA 4QQ6A 5GAOn 4ZGEB 5DM7R 1EFNA 4LNPA 4FW2A 2EIFA 4M7AG 2QQSA 3R6OA 3GNFB 4M77F 2OTLT 1WHGA 1R8OB 4OB1B 1WXTA 3CMAA 5CKBA 3QZ9B 2P0QA 1VQLT 1PG5B 1RUWA 3V7RA 2DO3A 4LXCA 1IXDA 3OYAA 4F7UG 3TSWA 4C92D 2ECZA 4M7DA 2KRMA 2MIOA 4X1VA 2IVWA 4FYVB 2PU9B 3EHRA 3CD6T 3MP6A 4C0FA 2YUPA 2XD0A 5HK3A 4WF2A 3WVEB 1YJWA 4EIKA 3H9NA 2D0QB 2CT4A 2VV5A 3CC7T 4JRQA 4HCCA 4C0DB 1XTDA 4AMCA 5ECAA 3NPFA 2E41A 3S3NA 2QQRA 1Y96A 5D6WA 2KVQG 1VQ8T 1MMDA 3OY9A 3V7SA 4PKCC 2XICA 2AKKA 2CGHA 3CC4T 4C5GA 1Q81R 3VS7A 2R58A 4K11A 3CCEA 1VQKT 1PRLC 3HTRA 3A5ZB 2RQTA 3EG9A 5CKEA 1Z9QA 3EH2A 1NG2A 3R6NA 3CD6Q 1H3ZA 2EJ9A 1IO6A 5KYYA 1OULA 2BE9B 3EG2A 1HK9A 2A0FB 1NEGA 4D8DA 3CC7Q 5GMKi 2FZGB 3TVTA 3I56Q 4QQDA 2ZAEA 1NYGA 2E6ZA 2L0AA 1QVGP 1K0SA 2BE7D 3VS1A 4JS5A 5LJ5d 1NLPC 3SFMA 4KGXB 3OYMA 1VOMA 5FU7C 1Q7YR 4C8QB 4V2SA 4M75C 1OZ3A 2LNVA 4EMKA 1OV3A 2KGTA 1T3LA 4J9DA 3UF4A 1YWOA 4PJOG 4GBQA 2ZPEB 3CPWA 2P0KA 3UA6A 2L3RA 2X51A 2OX7A 3ASKA 3TQ7P 3LLRA 4OGCA 4M77B 3CMAQ 1YBYA 4JRKA 3CCET 2GGRA 3C12A 3E9GA 4LDXA 2DD5A 2JTEA 1SHGA 4M78C 3UPUA 3JAME 3MP8A 1YJWQ 2CDTA 4ZN1A 2DYIA 4IUTA 4BE2A 2J6KA 4J6YA 2FRWA 4JJCA 1D3BB 1I5LA 1Z9ZA 2QA4T 2VWFA 2DVEA 1ZQ1A 1H92A 1QCNA 3OBYA 1U1SA 3GBQA 3GIBA 2ZZDA 4C92G 4ORZA 3A98A 3MCAB 2LX7A 4RTUA 2RJDA 2PNIA 3DB3A 2JMAA 4M75E 2K3BA 4J5YA 3CCSA 3CCEQ 3EH1A 2M02A 2KAFA 3ME9A 2DL7A 3QJYA 4M7DD 1PD1A 2Y4XA 1SHFA 1O9SA 2L3SA 4N0AC 5LJ5j 2DBMA 4HXJA 2QDYB 1I0CA 5HK0A 4GLMA 3OYGA 2Z0WA 2O88A 2DAQA 4KRTA 2KMTA 1T0JA 1IHVA 4FU6A 3REBB 5GAN7 4CRIA 1OU8A 1VIEA 4PK4A 1ZSZC 3HRUA 2HBWA 4XTZA 1QVFP 3PTAA 3OMGA 1KD1U 1MGQA 3CCLT 1WHHA 2DJQA 2G3RA 2AIRB 2RHXA 1WQ7A 3BDUA 3JCMQ 4FM4B 5IXFA 2NUTB 5GAMh 3MEUA 3E9FA 1N9SA 4DBFA 1IHWA 3DKMA 4PFOA 3SWNB 2JVVA 1SSFA 2XDPA 1FX7A 2RHZA 3NTHA 4XU0A 4XU1A 3TSZA 3I55A 2ZPIB 3UATA 2FPEA 2M16A 4F7UA 1TXQA 3M0RA 3J7AF 5KYUB 2PVOB 3JB9D 4OB0B 3HKSA 2DTOA 5GAN6 1AWJA 2LX9A 3L2WA 1BCMA 2EBPA 4J6XA 3HL8A 4JRIA 1AVZC 2NUZA 3JCMW 1OOTA 3A8HB 5FU7B 3JV3A 2D8HA 4C0GA 4HVVA 2ED1A 2SEMA 5GANg 2K7AA 4XU2A 1AT1B 2MK5A 4M77D 4HA8A 3VS2A 1X01A 2RPNA 1WDXA 4D6WA 3CCJT 4R56A 5I11A 4QQGA 2ENMA 2HNIA 3QUIA 3PFSA 3CC2A 1W2BP 3QO3A 1RI9A 1UE9A 2ROTA 1QWFA 1WHMA 2DD4A 3JCMh 2JS2A 4BDZA 2BZXA 3JCMc 4L6V5 1M3BA 3CCSQ 4JLGA 1Q81C 1OQKA 3EFOB 3M9QA 3N5BB 5LJ3g 1Y0MA 2EKHA 3MJXA 3VUBA 3I55T 2VASA 2K79A 2FHDA 1GCQC 1BIBA 4OMMA 3A8GB 2GNCA 4RTYA 4PFZA 4FYXB 3VRZA 2CUBA 1Q95G 1UG1A 2QGFB 3CCJQ 2O2OA 3CBPA 1H641 1AWWA 4RG2A 3S6WA 1W4SA 5KYNA 3G7ZA 5AYFA 1BCOA 5GAN3 3QWYA 3QDFA 2VXEA 2X4XA 4LDWA 4PJOA 2DZ9A 2KYBA 4C92E 2F2VA 1X6BA 5GAMe 1JBMA 1M90U 2KQWA 4XTWA 4QT7A 4RUGA 2CP0A 3I55Q 1QQJA 2IG0A 3OMCA 3CCQA 2LTOA 1VQPT 2FRYA 4RTZA 1JRIA 3H0FA 1QWEA 1ZSZB 2MOXA 3HRSA 2EAYA 5IN1A 3CXCP 2YHTA 3LYIA 1VQ4A 4BE0A 2KE9A 4XU3A 1LJOA 4JZ4A 4PJNA 1M9SA 1CSKA 5C6SA 3SHWA 2KYMA 3PMTA 5CAIA 2A7YA 2XI9A 5FROA 1TS9A 3OYBA 2A28A 1UHCA 1AWOA 2D1XA 5GAOq 2GBQA 2EGCA 4KUDK 2ED0A 3OYDA 3GF5A 3CCUT 2JN0A 4M7AD 4C92A 3G1JA 5FRMA 3JB9G 4R55A 1VQ7T 5FU6B 2HSEB 3CC2Q 1KQSA 4E47A 1KSWA 3NTKA 3TCJA 2OI3A 1VQPQ 2VGMA 4AFSC 2DEUA 2YLBA 2MWPA 1KC8U 4WTOB 2EQIA 3CPWS 2CZ0B 3JCMe 1I1JA 1BYMA 2KROA 1R77A 2K57A 3M0UA 4J9EA 3JB9H 3OSVA 3EGUA 1WJSA 3ZEHA 4M77G 3V8KA 3VRYA 2FVUA 2AZSA 3LGFA 4LDVA 5GMKj 1NPPA 1N27A 3OS0A 4IIMA 1PKTA 3CCMA 3CCQT 1PWTA 3H0HA 3PMIA 1PRMC 2DKGA 3G4SA 2YRDA 3M54A 3OS5A 1G2BA 2JM9A 2LCSA 1VQ4T 1VQ7Q 1I81A 3PIPA 4M7DC 2PVGB 1QKXA 1YI2A 3LWIA 5KYWA 2XK0A 2CT3A 1WHKA 4NL2A 1M1FA 4HCKA 2VC8A 1SG5A 3TREA 4DEXA 1VQMT 1K73C 2BIVA 1VIFA 1YJ9T 5GAOp 1WFWA 1D09B 3M4GA 2DXBA 4Y92A 2PVDB 3U23A 1GRIA 5M9OA 2OTLA 1KQ1A 3EFSA 3CCQQ 1VQLA 2JTMA 1YIJA 2HD0A 3AT1B 4OMPA 3NGPA 4E2FB 1VQ4Q 2YDLA 3IQLA 3X28B 5LJ5h 1CKBA 2C0OA 2M51A 1HYOA 3G6ET 4RKUE 2ATCB 4A54A 2HQHA 1K9MR 3CCMT 1VQMQ 3OYNA 3CC7A 4PJMA 1M2VA 3GPLA 4PJOD 4PLLA 4C5IA 2EJFA 3HPWA 3G4ST 4PJLA 1G3YA 2EFIA 2EGEA 4M7DE 4DOVA 1GFDA 3O5ZA 1VQ8A 2F5KA 4WCIA 4FSSA 4CC2A 2KXDA 3CC4A 1WZOA 3M0TA 4NOYA 2KK4A 4MZTA 2X35A 3RDVA 5GJWB 2DRKA 3C94A 4C8QF 1M1KC 2QI2A 4E6RA 1B34B 3ZBDA 1O75A 1VQKA 3HRTA 4FL6A 1I4K1 4IKFA 1MV0B 4EMKC 2K2VA 3MO8A 4MDXA 4OMFB 4PNOA 4JJBA 1Q86U 3LGLA 2OJ2A 4ZTFA 2LRQA 2Y4YA 3G6EQ 3RUXA 3QIIA 1KD1C 2MPXC 2CP5A 2COZA 3CCMQ 4R0KA 2VUBA 4X9CA 1RAAB 3QPHA 1YIJT 2QEXA 2WSCE 3G4SQ 1EIFA 1AZGB 2V8KA 1X75C 2DILA 2K5IA 2EWNA 2RHIA 2RQWA 3VS0A 4E7KA 1YCYA 5D6XA 1K8AC 5KH6A 4MZPA 2HQEA 2L8DA 1YI2Q 3EG1A 2K2MA 2DXTA 1BI2A 2HDAA 1YNZA 2EYXA 4KGZB 3UDCA 2AZVA 2DYBA 3OA6A 2CSQA 4J8OA 4E7IA 2V1RA 1Q7YU 3OYHA 3JCMV 1GFCA 4N4IA 2NWMA 4XK8E 5GAOl 2VVKA 3HP9A 4AG1C 2OTLQ 1XJWB 2X4YA 1KJWA 2ZGWA 3X25B 1XOVA 1VQLQ 1M8MA 3DLMA 4E7ZA 2HCKA 1YIJQ 4J7IA 4M77E 5EC7A 4BD3A 3PE0A 2EGAA 2F2WA 6AT1B 2JXBA 1U06A 3UA7A 3EGDB 4A53A 2LCCA 4JPBW 4HCBA 1NM7A 2CP7A 3RKYA 5LJ5e 1E6GA 1JJ2A 2RJFA 1WXBA 1RLPC 1SKUB 4RCCA 1T0HA 3CBMA 1NBEB 2QEXT 1M5Q1 2EYQA 2QA4A 5CK9A 2K3YA 3UT1A 3QDRB 4Z8AA 2J6OA 5J39A 1M4ZA 2DJZA 2M1HA 1VQ8Q 1RL2A 3HFNA 1IRXA 2CZ7B 3CC4Q 3L2QA 2KNBB 1N8RC 5KCHA 4PLIA 1EX4A 2COWA 5GAN8 3FB9A 4M77A 1VQKQ 2EVRA 2KT8A 1ZBJA 2CP3A 2QQ9A 5FW9A 1TG0A 3KBGA 4X34A 4N4HA 5GAN4 4J7FA 1BK2A 4PJJA 3BE3A 2RI2A 2A3LA 4HVWA 4MMLA 5IHIA 2O4XB 4HKEA 2QEXQ 3GNGA 1D3BA 5CIUA 1X2QA 1S72A 1X6OA 2DA9A 3MEWA 3V8JA 3E2UA 3JB9I 1M90C 3CCLA 4ZTJA 4M75F 4JDSA 2LQWA 2DRMA 2LC4A 2M0YA 3NTIA 3MHXA 4BI4A 3OYLA 4OB2B 4EMKB 1SF9A 3VYGA 3OYEA 3J81E 2DEQA 2RM4A 2W0ZA 1RABB 1KQSS 3EG0A 4A4EA 1M27C 2LNHB 5D6YA 4BACA 4Z88A 2DK3A 3RESA 4EMHA 9ATCB 4DBHA 5GAOm 1UECA 4M78F 1X6GA 2KBTA 4ATOA 2R5MA 3WVDB 4M7AE 1D1CA 1WA7A 4KH0B 1PHTA 5GMKh 2H3EB 2DL5A 4RG8A 4DQ2A 4F7UE 1GCPA 1YITT 3OW2A 1HD3A 1VQOT 1ZA2B 2V26A 2QA4Q 1K9MC 2MWOA 3CCJA 1V76A 4UC4A 5A0DA 2NUTA 1S72T 1K73R 3VKIA 3SWNA 2EYZA 3QXEB 4J9GA 2KRSA 1NZ9A 1U8RA 2CZ1B 3FIFA 1Q82C 2KY9A 2XDBA 2V8IA 4OGEA 1RLQC 5KYUA 4PJOC 3ER0A 2XU8A 4M7AA 3EGXA 2MCNA 3EHQA 2X4JA 2H8HA 2XKOC 5GANf 5CVIA 1MHNA 3QBYA 2WSEE 1R0BG 3NFCA 2QK0A 3SB2A 2HBPA 1VYVA 1UEBA 1TH7A 1QKWA 5DY9A 2L3PA 1NJIC 3BDLA 2F5TX 3PVLA 4C8QD 5GAMg 5KE3A 3QZ5B 4YTLA 3ZL7C 1S72Q 5CKDA 3I35A 3CCLQ 3L2ZA 2PTKA 1YHQT 3C0CA 4B9WA 2W10A 4M75B 1BIAA 3DLLA 3JCMb 1G5VA 2A36A 1X2KA 2BKDN 2RI5A 1KHIA 1W1FA 4XTVA 3KFVA 5KCOA 2RO0A 2A37A 4RTXA 4C92C 3EFOA 3RNJA 1IGUA 1M1KR 4C5HA 2DTHA 1VQPA 4F17A 2K5LA 4QVZA 4M78B 4PJOE 3QG1A 4A4KA 3LH5A 3KXTA 2X4WA 2LJ0A 3KUFA 2LP5A 4FSXA 1MMGA 1KD1R 5I2SA 1JXOA 3SEMA 2COYA 2EJGA 1BKBA 5GMKe 1YHQQ 2CREA 4Z02A 2RQUA 4RTVA 2E4HA 2JJ9A 3JCMg 1K8AR 1U3OA 2J6FA 4BUGA 3CCUA 3P8HA 3OB9A 3CBOA 3VYHB 4A4HA 1VQ7A 1FMKA 1WYXA 1Y71A 2JNGA 5IXBA 1UJYA 1IB8A 2RQVA 4FCYA 1Q86C 2F69A 3VS6A 1QVGA 1U5SA 3PNWC 4HCZA 4CI0C 5CKHA 1PKSA 4DBQA 2YXYA 4CC7A 1OZ2A 2QXFA 1TTHB 4JJNK 2O31A 1Y57A 1C0MA 3L2VA 3RBBB 4IUQA 4N4GA 2DTIA 1SEMA 3L1AA 5CKFA 4OP0A 1AEYA 2XMFA 3CCRA 1AWXA 1VYTA 3RERA 4LN2A 4ME7A 1MMNA 4QKUA 1TSFA 3OYKA 1JJ2S 3THKA 2E5KA 2GQIA 5CQXA 3NMZC 2LQKA 1VQMA 2C06A 1RAEB 2FPDA 3QKJA 1OPLA 1YJ9A 3VS5A 4RMOA 3QYGB 1RAIB 1KHCA 1G83A 1JQQA 4GY5A 1VQNT 1N8RR 2L89A 5A2QE 1X69A 4AT1B 4C8QG 4JUVA 4BY6C 4DOWA 4LD6A 3FJ5A 4FW1A 1HSQA 3X24B 1ZUUA 1OI1A 4Y28E 5GANd 4KGVB 2C0IA 3H0IA 3VS4A 4Z89A 3FDRA 3H6ZA 1QCOA 2MI6A 1VQ5T 2DXUA 1NE8A 1M1GA 3BY7A 1YFNA 4XTXA 2KSSA 3TU4K 1MV3A 3GP8A 3HSBA 2JOYA 3G6EA 2LCLA 5GMKl 1UB4A 5FRNA 1TUCA 2K3XA 1TWBA 3CPWP 4EMGA 3CCRT 3GOXA 1M90R 3CCUQ 4E7SA 1JO8A 1PNJA 4A4FA 5DLOA 2MAMA 2AKLA 2B86A 5LJ3d 1N5ZA 3QWXX 2VXFA 3OS1A 1QVFA 3G71T 2DNUA 1JXMA 1ZUKA 2BUDA 2CYZB 4M4ZA 2GCXA 3PIOA 1VQ5Q 2FZKB 4PFPA 5CO7A 5I22A 1RAHB 2D0NA 2E1HA 2LVMA 2DERA 2FYKA 4MZMA 4JJDA 3FJPA 1QW1A 1VYUA 2K5FA 3RMQA 2RI3A 2J06A 3I5RA 1XNIA 2KRNA 1NYFA 1NLOC 2QG9B 2E3IA 2DE0X 4HT8A 4M7DF 3Q1JA 2BTTA 2I0NA 4Y91A 2BZYA 2ZPBB 2DLPA 1E7OA 2RB6A 3I5SA 2R57A 3CCRQ 4J9IA 5KYXB 3J80E 2M9UA 3MKDA 1C1AA 3OW2S 1WHLA 3M4YA 5D7UA 1UFFA 1M30A 4RCBA 8AT1B 1KIKA 2NUPB 3DB4A 3G71Q 2O01E 1XQHA 1QP3A 2YUQA 3A1PA 5GANj 2HSPA 1YJ9Q 3T9NA 2ABLA 3HHTB 3WXMB 2G6FX 3O8VA 2LQNA 2YRVA 1AHJB 2NYSA 3QHSA 2E64A 4OMNA 2LJ3A 2VYTA 1FWZA 2QQBA 3JB9J 1WLPB 2A08A 2ZPFB 1Q82R 3VJPA 2EQKA 5LJ5g 4EPCA 2WSFE 1T3SA 2R5AA 1W2BA 1G8XA 2X3XD 1Q81U 3MEVA 2L5QA 1A0NB 4XQ3A 2EPDA 4M77C 2CP2A 2MF2A 3X20B 5LJ3j 1TUDA 3JCMJ 1PSFA 2CH4W 3JB9F 1NJIR 1GBQA 1M2VB 2EQMA 5HCKA 2LT4A 2E65A 1FXXA 5GMKm 1BI1A 2EQUA 5J26A 3H41A 1KFZA 4M75G 4EDUA 3FLGA 3RIRA 1H3HA 3ULRB 3AHUA 1F1BB 3BFMA 1AD5A 2P4RA 4J83A 2DZCA 3OYJA 2KI7A 1I07A 5IHNA 2RJCA 5FLXE 1YJNA 2P4TA 4DEYA 4NS5A 3SDZA 4C8QE 2EQJA 2DX1A 4LUEA 2J05A 2J7IA 3BW1A 1RADB 2H3JA 2YSQA 4M78G 4LE9A 1UGQB 2D9TA 3EGDA 1M3CA 4J9BA 1SRMA 2HKNA 1MUZA 4HT9A 1D0XA 3QJ6A 4LDYA 3OSSC 3I56T 3L42A 2F1LA 4M7DB 3PGGA 1RAGB 2EW3A 2KT1A 1TUGB 3H8ZA 3URGA 3CXCA 2DETA 1PM3A 4KT0E 2IPOB 1VQ6A 1MNDA 2E6NA 2GFAA 4ELYC 1JU5C 2RJEA 4BE1A 1ZUYA 4RTTA 3M0SA 1PD0A 1ZX6A 1N6AA 1Y96B 4E7HA 1Q86R 2SRCA 2DM1A 4C8QA 2CZ6B 1KQ2A 2GF7A 1QVGS 2FG0A 4F04B 2GQVA 3SWNC 5GJVB 2F2XA 4OVAA 2C0TA 3CMAT 4L59A 2DL3A 2KEAA 4AFUC 3EG9B 1M8VA 1RAFB 1YJNT 5CR2A 1UJ0A 2BZ8A 2OTJA 2RK1A 2CKKA 4MDWA 1QVPA 2O4XA 1VUBA 1GXIE 2K4YA 1Y7XA 4BI3A 4M7AC 1AZEA 1X43A 5KYYB 1D0YA 1RACB 5I21A 1YJWT 1QLYA 3VS3A 2LQ8A 1YITA 4O5VA 2JUFA 1VQOA 4OB3B 1B3QA 4II1A 3V8LA 3FEOA 2CUDA 2RHUA 1QMCA 1YWPA 1UTIA 1X27A 5HY6A 1GBRA 4ZGDB 1VQ6T 1OX8A 1K73U 1K1ZA 4M7AF 3LH0A 1GL5A 2QTVA 1B7TA 1YJNQ 1UGRB 1V29B 1WX6A 2YUNA 3M0PA 4F7UF 4OF1A 1JB0E 4PL6A 2QTXA 1BB9A 2DMOA 4F14A 2RA2A 1SPKA 2AK5A 3M58A 2DL8A 1LVKA 1S1NA 5GAN2 4DBRA 3MPUB 2OTJT 5DLQE 2DXCA 1KQSP 4C5EA 4RTWA 1YCSB 2VB6A 1WXUA 1VQ6Q 2ZPGB 1YHQA 3QSUA 2HAXA 1AOJA 3OS2A 3C4SA 2ROLA 3OYYA 2YUOA 4NL3A 2PZ1A 2Y90A 1KC8C 1J3TA 3SD4A 2YLCA 3MEAA 1VA7A 3S3OA 1QVFS 1ABOA 3PT9A 2JZ2A 3RMSA 2CP6A 3PVQA 4F16A 2HL3A 2PQWA 1VQ9A 1M1KU 1D1BA 2CS7A 5GAMf 2FB7A 4FYYB 4FYWB 2YT6A 1HXDA 1ZHIA 3D7SB 2JT4A 3M5AA 2OTJQ 4M78E 2LJ1A 4Q5WA 3JRZA 3HFOA 3A8LB 3CPFA 4B9XA 4CC4B 3OYCA 4E7JA 3L2RA 4QVCA 3JSCA 4E7LA 2QYZA 2FO0A 2ZPHB 1YITQ 2AT1B 3LW5E 4M75A 2JTFA 4CC3A 4J6WA 1VQOQ 3UWNA 1W70A 3M56A 1K8AU 3CEYA 1WIEA 2JW4A 4QVDA 1TU0B 2KXCA 4KULA 4J9HA 4A4GA 4QW2A 2EYYA 2P0PA 8ATCB 1N9RA 1K0XA 2M0OA 3F70A 4PJOF 5FU6C 1C6VX 5GANh 2ESWA 2JM8A 1CKAA 4M7AB 5FWBA 5LJ3f 1OU9A 3CCST 3EGXB 2PUOB 3P8BB 2K9GA 2QDLA 3S3MA 2L3QA 4JZ3A 4M78A 4L5GA 4O6JA 1K4US 4XTUA 1BI0A 2XIDA 1ZSGA 5IAYA 1W2BS 4F7UB 5CCAA 4IIOA 2GTJA 3M57A 4IURA 3JCMf 3CMEA 2IIMA 3INZA 4TVRA 1VQ9T 1WHJA 2RQRA 1YP5A 3L2UA 2LT1A 2ZCFB 2X9HA 4BI8B 2PUKB 3RKWA 5LJ3h 5C0MA 2RHYA 4ZGJB 5IHKA 2HZYA 2QQAA 2HMAA 4XTYA 1TOVA 7AT1B 5CQYA 2XHCA 3NHNA 2LDMA 2E3HA 4C92F 1M3AA 4BDYA 2QASA 1PSEA 2P84A 3A8OB 2RK2A 4C0ZA 2KDSA 1FYNA 1WPYA 2WACA 1VQNA 3FRNA 4GLKA 2FZCB 3RR6A 2DBKA 5GAN5 3M59A 4OMQA 4J9FA 4N0AA 1N8RU 2VKNA 1IREB 1K76A 3OBWA 1E6HA 1W6XA 4KUIA 1VQ9Q 2QAZA 2RMOA 1NPRA 1FMWA 1OX9A 3VU3C 1VQ5A 1ZSZA 2YRCA 1G3SA 3TEEA 2FL7A 2QGGA 4M7DG 4J9CA 3VV0A 2XG8D 1I8FA 3CMET 1JEGA 1R0CB 4P5NA 1LOJA 2RF0A 1D0ZA 1ARKA 1EZZB 3CXCS 2KR3A 4D8KA 3CCVA 1U1TA 2XDDA 4HVUA 4XAXB 2HKQB 2D6FA 3VUZA 1Q7YC 1B07A 1WGSA 1LNXA 4LUDA 3CC2T 2DVJA 1I5OB 2GFUA 1K9AA 2RNAA 3G71A 1LCKA 5KE2A 2DF6A 1QP2A 4PJOB 4ELZC 5IH2A 5GANe 5FWCA 2CH4A 2DL4A 5GAMd 2B8AA 2L2PA 2D8JA 3X26B 4X9DA 1JJ2P 1OEBA 4LD9K 1UDLA 5L23A 5IT9E 1M2OA 3CMEQ 5AT1B 4M75D 2LMJA 2FPFA 1UGSB 3QYHB 5L8RE 1WI7A 1UUEA 3M53A 3RKXA 5LJ3e 3E1SA 4A63B 2NLUA 3MP1A 3JCMP 2GTOA 4IUPA 1NEBA 3EAEA 5LL6S 1MNEA 4C92B 1K9MU 1HJDA 3I9QA 3EG3A 4M78D 3ZFJA 3CCVT 1VQNQ 4C0DC 3FC3A 2HL5C 2JS0A 1GCQA 1P92A 2DIQA 2OAUA 5A0LA 2AHJB 1Q82U 4IUVA 5A0GA 1KK7A 3JCMd 1UGVA 1WJRA 2DFUA 1WJQA 1LPLA 2DPPB 4KH1B 3E19A 2FEIA 2V8JA 3CQTA 3REAB 3OQ5A 4FT4A 1H8KA 2K6DA 4IUUA 1PC0A 5KYXA 3LX7A 1UHFA 1DJ7B 2CSIA 1ACMB 2EKOA 1NJIU 3V7CA 2NUPA 1V1CA 1D1AA 1SRLA 3OYIA 2HEQA 4ZNXA 5GAMj 1ZLMA 3EFRA 2O9SA 3CCVQ 5KYWB 1Y07A 4LDUA 5LJ5f 1QCFA 2RH2A 1SSHA 1PCXA 2JMCA 1BU1A 2HQXA 1WNLA 1KC8R 2E10A 2V1QA 4BB7A 2EYWA 4JS4A 3GLXA 4ZN3A 1MMAA 1OYXA 4JRPA 3C95A 4FT2A 1UGPB 4OMOA 1B34A 1YN8A 4KBMB 4C8QC 3CD6A 3OYFA 2LZ6B 1WQWA 5GAOr 3OW2P 2VGNA 1IZ6A 4FIBA 2MMPA 1ZA1B 2YWWA 1BI3A 2I2LA 3META 1KG1A 1G3TA 5J3BA 4MMKA 3P8DA 3I56A 3A8MB 2O9VA 4JLIA 1OPKA 3M55A 4ANJA 4ESRA 2RN8A 3M0QA 2MYSA 4B6MA 2DIGA 4OMLA 4VUBA 4AFQC 1IGQA 4AG2C 5EG2A 1YI2T 2E70A 2E12A 5HKCA 1BBZA 1ABQA
chains in the Genus database with same CATH topology
1BIAA 5I2MA 3DLLA 2RD1A 4DA4A 3JCMX 1RI0A 5FU6B 3JCMb 5HY6A 1G5VA 2E5QA 1G3WA 4ZGDB 2BKDN 2RI5A 1KHIA 4XTVA 4E47A 3LWHA 1ZBXA 1KQSA 4F7UF 1VQ6T 1K73U 3NTKA 5KCOA 3TCJA 2RO0A 4C92C 2VGMA 4BY6B 4QQ6A 5GAOn 4M7AF 2YLBA 4ZGEB 3LH0A 2MWPA 5DM7R 1KC8U 2EIFA 3CPWS 2CZ0B 2QQSA 3JCMe 1UGRB 4M7AG 1BYMA 1V29B 3R6OA 2K57A 3GNFB 4M77F 2OTLT 1R8OB 4OB1B 2DTHA 3OSVA 4C5HA 1WJSA 3CMAA 5CKBA 3QZ9B 2P0QA 3ZEHA 4M77G 2K5LA 4OF1A 3V7RA 2FVUA 3LGFA 4LDVA 3V8KA 4QVZA 2DO3A 5GMKj 1JB0E 1NPPA 4M78B 3OYAA 4F7UG 4PJOE 3QG1A 4PL6A 2QTXA 4A4KA 4C92D 3KXTA 1N27A 3OS0A 2X4WA 2RA2A 3KUFA 4M7DA 4FSXA 3M58A 3CCMA 5I2SA 3CCQT 2IVWA 2PU9B 5GAN2 2EJGA 3CD6T 3PMIA 3MP6A 1BKBA 4C0FA 2XD0A 2DKGA 5HK3A 3G4SA 4WF2A 3WVEB 5GMKe 1YJWA 3M54A 3OS5A 4Z02A 2OTJT 5DLQE 2DXCA 2D0QB 4C5EA 1VQ4T 2VV5A 1I81A 3PIPA 3CC7T 2PVGB 4JRQA 4M7DC 3JCMg 4HCCA 1YI2A 3LWIA 1K73C 4C0DB 2XK0A 1XTDA 3CCUA 2ZPGB 4BUGA 1YHQA 4NL2A 1M1FA 3QSUA 3P8HA 2VC8A 3OB9A 3CBOA 3TREA 3VYHB 4A4HA 2HAXA 2E41A 3S3NA 1VQ7A 2QQRA 2JNGA 2BIVA 1Y71A 1Y96A 1VIFA 3OS2A 1VQMT 1YJ9T 5D6WA 2KVQG 3C4SA 1VQ8T 3OY9A 3OYYA 4NL3A 3V7SA 5GAOp 1Q86C 4PKCC 2XICA 2Y90A 2CGHA 3M4GA 2F69A 3CC4T 1KC8C 2DXBA 4C5GA 3SD4A 2YLCA 2PVDB 3MEAA 1QVGA 3S3OA 3PNWC 4HCZA 4CI0C 2R58A 5CKHA 1QVFS 3PT9A 2JZ2A 3RMSA 3CCEA 1VQKT 5M9OA 3A5ZB 2OTLA 1OZ2A 2QXFA 2PQWA 4JJNK 1VQ9A 1KQ1A 5CKEA 1M1KU 3EFSA 2CS7A 5GAMf 1VQLA 2FB7A 3L2VA 1H3ZA 2JTMA 1YIJA 2EJ9A 1HXDA 4IUQA 1ZHIA 2HD0A 4N4GA 2DTIA 3L1AA 3M5AA 5CKFA 4M78E 1HK9A 5CR2A 3X28B 4Q5WA 5GMKi 3JRZA 3HFOA 3A8LB 3CPFA 4B9XA 3OYCA 4E7JA 4OP0A 5LJ5h 3CCRA 3G6ET 4QQDA 3RERA 4RKUE 4A54A 3L2RA 4QVCA 4ME7A 3JSCA 2E6ZA 4E7LA 3CCMT 2ZPHB 3OYNA 3CC7A 3GPLA 4PJOD 3LW5E 4M75A 4PLLA 3OYKA 2JTFA 1JJ2S 4J6WA 2EJFA 4C5IA 3HPWA 3G4ST 4JS5A 5LJ5d 3UWNA 3SFMA 3M56A 1G3YA 1K8AU 2EFIA 3CEYA 5CQXA 3OYMA 4M7DE 4QVDA 2LQKA 1VQMA 4KULA 4DOVA 2C06A 1YJ9A 3QKJA 5FU7C 2F5KA 4A4GA 1VQ8A 4QW2A 2P0PA 4RMOA 3QYGB 4C8QB 4V2SA 1KHCA 1N9RA 4M75C 1OZ3A 2M0OA 2LNVA 3F70A 3CC4A 4EMKA 4PJOF 4NOYA 2KK4A 4MZTA 2X35A 5FU6C 4GY5A 5GANh 1VQNT 3C94A 4PJOG 2ZPEB 3CPWA 4C8QF 2P0KA 1M1KC 2L89A 2QI2A 5A2QE 1B34B 4M7AB 3ZBDA 2L3RA 1O75A 5LJ3f 3HRTA 3CCST 4C8QG 4FL6A 1VQKA 1I4K1 2PUOB 3P8BB 4JUVA 4BY6C 4DOWA 4IKFA 3S3MA 4EMKC 2K2VA 3ASKA 4LD6A 4M78A 3MO8A 4MDXA 4OMFB 4L5GA 3LLRA 4O6JA 4OGCA 4M77B 4PNOA 4XTUA 1BI0A 1OI1A 2XIDA 3LGLA 4Y28E 3X24B 5GANd 1Q86U 1YBYA 5IAYA 4ZTFA 4JRKA 2LRQA 1W2BS 4F7UB 2Y4YA 5CCAA 3M57A 3CCET 3RUXA 3QIIA 4IURA 3JCMf 3FDRA 3C12A 3CMEA 3E9GA 3H6ZA 1KD1C 2MI6A 3INZA 2DXUA 1VQ5T 1NE8A 4LDXA 4TVRA 1M1GA 1VQ9T 2DD5A 4X9CA 2VUBA 3BY7A 4M78C 4XTXA 2KSSA 3TU4K 3UPUA 3QPHA 3JAME 3GP8A 3L2UA 1YIJT 2QEXA 2LT1A 2JOYA 2WSCE 2ZCFB 3MP8A 3HSBA 3G6EA 1EIFA 2V8KA 4BI8B 2PUKB 2LCLA 4ZN1A 5GMKl 1X75C 2RHIA 1UB4A 2EWNA 2K5IA 4IUTA 3RKWA 2RHYA 5LJ3h 5C0MA 4BE2A 4E7KA 1YCYA 4J6YA 4ZGJB 5D6XA 1K8AC 1D3BB 1I5LA 5KH6A 5FRNA 4MZPA 2HQEA 2K3XA 2L8DA 2QQAA 4XTYA 2DXTA 4EMGA 3CCRT 2QA4T 3GOXA 5CQYA 1BI2A 2XHCA 2DVEA 1ZQ1A 4A4FA 5DLOA 2MAMA 3UDCA 2LDMA 3OBYA 1U1SA 5LJ3d 4C92F 4BDYA 3GIBA 3JB9H 2ZZDA 3OA6A 1PSEA 4J8OA 3A8OB 2VXFA 4C92G 3OS1A 2RK2A 4C0ZA 2KDSA 1QVFA 3MCAB 3G71T 4E7IA 1Q7YU 1WPYA 3OYHA 2WACA 1VQNA 3FRNA 3JCMV 4GLKA 4N4IA 5GAN5 2BUDA 3M59A 4XK8E 2RJDA 5GAOl 3DB3A 4N0AA 4M75E 1N8RU 4J5YA 1IREB 2CYZB 3HP9A 2GCXA 3OBWA 3CCSA 3PIOA 4KUIA 3QJYA 2KAFA 3ME9A 4M7DD 2X4YA 2Y4XA 5CO7A 2E1HA 2LVMA 2ZGWA 2FYKA 1XOVA 3X25B 3DLMA 1O9SA 4MZMA 3FJPA 1QW1A 1NPRA 4J7IA 4M77E 2K5FA 3RMQA 2RI3A 4N0AC 3VU3C 5LJ5j 1XNIA 1VQ5A 4BD3A 2QDYB 5HK0A 3OYGA 1G3SA 2DAQA 4HT8A 4M7DF 3TEEA 3Q1JA 2FL7A 2KMTA 4Y91A 2ZPBB 4A53A 2LCCA 2RB6A 4HCBA 4M7DG 2R57A 4FU6A 3VV0A 2XG8D 1I8FA 5GAN7 3CMET 4CRIA 3RKYA 3J80E 5LJ5e 4P5NA 1VIEA 1LOJA 1JJ2A 2M9UA 2RJFA 3HRUA 4XTZA 3PTAA 3OMGA 4RCCA 3CBMA 1KD1U 1MGQA 3CCLT 3OW2S 3M4YA 2QEXT 1M5Q1 2G3RA 2EYQA 5CK9A 3CXCS 2K3YA 2QA4A 3UT1A 4RCBA 3QDRB 3DB4A 2O01E 1XQHA 3CCVA 1QP3A 1U1TA 2XDDA 2D6FA 4XAXB 2RHXA 1WQ7A 5J39A 5GANj 1M4ZA 3VUZA 1Q7YC 2DJZA 1WGSA 2M1HA 3BDUA 3JCMQ 1LNXA 3T9NA 3HHTB 4FM4B 3WXMB 3CC2T 3O8VA 1RL2A 3HFNA 5GAMh 3MEUA 3E9FA 1N9SA 2CZ7B 1AHJB 2GFUA 2YRVA 3DKMA 3QHSA 3L2QA 3G71A 1N8RC 5KE2A 2E64A 3SWNB 1QP2A 5KCHA 4PJOB 2JVVA 4ELZC 1SSFA 2VYTA 2XDPA 4PLIA 1FX7A 2RHZA 3NTHA 1FWZA 4XU0A 2QQBA 4XU1A 5GAN8 2ZPIB 5GANe 3I55A 3JB9J 2ZPFB 3FB9A 4M77A 2M16A 3VJPA 2EQKA 5LJ5g 5GAMd 4EPCA 2WSFE 2R5AA 2QQ9A 4F7UA 1W2BA 2B8AA 3J7AF 2PVOB 3JB9D 4OB0B 3HKSA 2DTOA 3KBGA 3X26B 1Q81U 4X9DA 3MEVA 4X34A 2L5QA 4N4HA 5GAN6 5GAN4 4J7FA 4LD9K 2LX9A 4XQ3A 3L2WA 5IT9E 4M77C 4J6XA 2RI2A 2MF2A 3HL8A 2A3LA 4MDWA 3X20B 4JRIA 5LJ3j 4MMLA 4M75D 3JCMJ 3JCMW 1PSFA 2O4XB 4HKEA 3A8HB 5FU7B 3JB9F 3GNGA 1D3BA 1UGSB 3QYHB 5CIUA 5L8RE 4C0GA 2EQMA 3M53A 2LT4A 5GANg 2E65A 3RKXA 4XU2A 1X6OA 1S72A 1FXXA 3MEWA 5GMKm 4M77D 3V8JA 3E1SA 4HA8A 5LJ3e 1BI1A 3JB9I 1M90C 3CCLA 4ZTJA 2NLUA 1X01A 2EQUA 3MP1A 4M75F 4JDSA 5J26A 3JCMP 2LC4A 3NTIA 4IUPA 4D6WA 3CCJT 4R56A 3EAEA 3MHXA 4M75G 5LL6S 4EDUA 4QQGA 4BI4A 4OB2B 3FLGA 4EMKB 3OYLA 3RIRA 2HNIA 3QUIA 3PFSA 3AHUA 4C92B 1K9MU 3CC2A 3QO3A 3BFMA 3VYGA 3OYEA 3J81E 2DEQA 2RM4A 4M78D 3ZFJA 4J83A 2DZCA 3CCVT 3OYJA 2DD4A 1KQSS 4A4EA 3JCMh 4C0DC 3FC3A 2RJCA 5FLXE 4BDZA 1YJNA 2P4TA 5D6YA 3JCMc 4L6V5 1P92A 2DIQA 4NS5A 2OAUA 3SDZA 5A0LA 4JLGA 4BACA 1Q81C 2DK3A 3RESA 2AHJB 3M9QA 4EMHA 5GAOm 1Q82U 4IUVA 4C8QE 3N5BB 2EQJA 5LJ3g 5A0GA 4M78F 3JCMd 3VUBA 1WJRA 3BW1A 3I55T 1WJQA 2H3JA 2DPPB 4M78G 1UGQB 2D9TA 2FHDA 2R5MA 3E19A 4ATOA 2V8JA 1BIBA 3OQ5A 3WVDB 4FT4A 4M7AE 3A8GB 5GMKh 4IUUA 3QJ6A 4HT9A 4LDYA 3OSSC 3I56T 3L42A 3LX7A 4M7DB 3PGGA 4RG8A 1DJ7B 4DQ2A 2EKOA 4F7UE 1YITT 3H8ZA 1NJIU 3OW2A 3CBPA 3V7CA 3URGA 1H641 3CXCA 4RG2A 3S6WA 1W4SA 1VQOT 3G7ZA 4KT0E 5AYFA 5GAN3 3OYIA 1VQ6A 2E6NA 2GFAA 2VXEA 4ELYC 1VQPA 1VQ4A 1K9MC 5GAMj 2MWOA 3CCJA 3EFRA 4UC4A 5A0DA 2RJEA 1Y07A 4LDUA 5LJ5f 4BE1A 1S72T 2RH2A 2X4XA 3VKIA 4LDWA 3SWNA 4PJOA 3QXEB 1N6AA 2DZ9A 1Y96B 4E7HA 1NZ9A 1U8RA 2HQXA 1WNLA 4C92E 2CZ1B 2E10A 4C8QA 5GAMe 2CZ6B 1JBMA 1M90U 1KQ2A 2GF7A 4BB7A 3FIFA 2KQWA 4XTWA 4JS4A 1QVGS 3GLXA 4ZN3A 1Q82C 2KY9A 2XDBA 2V8IA 1OYXA 1VQ7T 2IG0A 4JRPA 2GQVA 4OGEA 3C95A 3SWNC 4PJOC 3ER0A 4FT2A 1GXIE 4OVAA 2XU8A 3OMCA 1UGPB 1B34A 4M7AA 3CCQA 2LTOA 1VQPT 4L59A 3CMAT 4KBMB 4C8QC 3CD6A 1JRIA 1VQLT 3OYFA 2X4JA 2XKOC 3HRSA 1M8VA 1WQWA 5GANf 5GAOr 1YJNT 2EAYA 2VGNA 5CVIA 1MHNA 3QBYA 2WSEE 3NFCA 5IN1A 1IZ6A 2YHTA 3SB2A 2OTJA 2MMPA 2RK1A 4FIBA 2O4XA 2CKKA 1QVPA 2HBPA 1VUBA 1BI3A 2I2LA 2K4YA 1UEBA 3LYIA 3META 4BE0A 1G3TA 1TH7A 1Y7XA 5J3BA 4BI3A 4XU3A 4M7AC 1LJOA 4MMKA 1M9SA 3P8DA 5C6SA 5DY9A 3I56A 1NJIC 3A8MB 4JLIA 5I21A 3BDLA 1YJWT 3M55A 2F5TX 3PMTA 1KG1A 5CAIA 4C8QD 5GAMg 2A7YA 5KE3A 3QZ5B 2XI9A 4YTLA 5FROA 2LQ8A 3OYBA 1YITA 4O5VA 2JUFA 2DIGA 4VUBA 5EG2A 1YI2T 5GAOq 1VQOA 4OB3B 4KUDK 2E70A 3V8LA 4II1A 5CKDA 3FEOA 2E12A 3OYDA 5HKCA 3L2ZA 3GF5A 3CCUT 1YHQT 2JN0A 4B9WA 4M7AD 4C92A 2RHUA 4M75B 5FRMA 3JB9G 4R55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  4N0A C;  2RD1 A;  3JCM X;  3VU3 C;  5LJ5 j;  3JCM b;  3JCM c;  4XTV A;  4PJO D;  5GAO m;  4M75 A;  3RES A;  4EMH A;  4A54 A;  4HT8 A;  4M7D F;  4J6W A;  2EJF A;  4C8Q E;  5LJ3 g;  4Y91 A;  4M78 F;  5LJ5 d;  4A53 A;  2RB6 A;  4C92 C;  3JCM d;  4M7D G;  3BW1 A;  5GAO n;  4M7A F;  2YLB A;  4M7D E;  1I8F A;  4QVD A;  5GAN 7;  4M78 G;  3RKY A;  5LJ5 e;  3JCM e;  1BIB A;  1LOJ A;  4M7A G;  4XTZ A;  4M7A E;  4C8Q B;  4V2S A;  2K57 A;  4M77 F;  1N9R A;  4M75 C;  4RCC A;  5GMK h;  4HT9 A;  1MGQ A;  4EMK A;  4PJO F;  4NOY A;  2DTH A;  3JB9 H;  1M5Q 1;  5GAN h;  4F7U F;  4M77 G;  3V8K A;  4M7D B;  3PGG A;  4RCB A;  3V7R A;  5GMK j;  4PJO G;  4DQ2 A;  1U1T A;  4M78 B;  4C8Q F;  4F7U G;  4PJO E;  1WQ7 A;  2QTX A;  5GAN j;  1B34 B;  4C92 D;  2DJZ A;  4M7A B;  4F7U E;  3BDU A;  5LJ3 f;  3JCM Q;  1LNX A;  2RA2 A;  4C8Q G;  3V7C A;  1I4K 1;  1H64 1;  4JUV A;  4M7D A;  3HFN A;  5GAM h;  4EMK C;  4M78 A;  1N9S A;  5GAN 3;  5GAN 2;  2EJG A;  3QHS A;  4M77 B;  4PNO A;  4XTU A;  2E64 A;  5GAN d;  2VXE A;  3SWN B;  2DKG A;  4PJO B;  5GAM j;  4WF2 A;  5GMK e;  4JRK A;  3EFR A;  4F7U B;  4XU0 A;  4XU1 A;  5LJ5 f;  5GAN 8;  3RUX A;  5GAN e;  3JB9 J;  3JCM f;  3FB9 A;  4M77 A;  3INZ A;  2DXU A;  1I81 A;  4M7D C;  3SWN A;  5LJ5 g;  4PJO A;  3JCM g;  4X9C A;  3BY7 A;  4M78 C;  4XTX A;  2DZ9 A;  1Y96 B;  4F7U A;  5GAM d;  1WNL A;  4C92 E;  3JB9 D;  3HSB A;  2E10 A;  2DTO A;  4NL2 A;  4C8Q A;  5GAM e;  1JBM A;  3QSU A;  2VC8 A;  1KQ2 A;  4X9D A;  3FIF A;  4XTW A;  5GAN 6;  2E41 A;  5GMK l;  5GAN 4;  4XQ3 A;  3RKW A;  1Y96 A;  2EWN A;  5LJ3 h;  4M77 C;  1YCY A;  4J6Y A;  4J6X A;  3SWN C;  4NL3 A;  1D3B B;  1I5L A;  4PJO C;  3V7S A;  5GAO p;  2Y90 A;  2CGH A;  3M4G A;  4JRI A;  5LJ3 j;  1B34 A;  4MML A;  4M75 D;  2DXT A;  4XTY A;  3JCM J;  4M7A A;  3JCM W;  4EMG A;  2YLC A;  4C8Q C;  1JRI A;  2DVE A;  3JB9 F;  1D3B A;  1M8V A;  1WQW A;  5GAN f;  5GAO r;  2EAY A;  1U1S A;  5LJ3 d;  4C92 F;  3GIB A;  2YHT A;  3SB2 A;  5GAN g;  2E65 A;  3RKX A;  2I2L A;  2VXF A;  4XU2 A;  4C92 G;  5GMK m;  1TH7 A;  4M77 D;  3V8J A;  5LJ3 e;  1KQ1 A;  4HA8 A;  4XU3 A;  1LJO A;  4MMK A;  3JB9 I;  4M7A C;  3EFS A;  1X01 A;  1WPY A;  5DY9 A;  4M75 F;  5GAM f;  2FB7 A;  4JLI A;  3JCM P;  3JCM V;  5I21 A;  5GAN 5;  2EJ9 A;  1HXD A;  4M75 G;  5CAI A;  4C8Q D;  5GAM g;  5GAO l;  4N0A A;  4M75 E;  4EMK B;  2DTI A;  4J5Y A;  2HNI A;  3L1A A;  3QUI A;  3RIR A;  3AHU A;  4C92 B;  4M78 E;  1HK9 A;  3QO3 A;  3BFM A;  4M7D D;  2DEQ A;  5GAO q;  5GMK i;  2RM4 A;  4M78 D;  3V8L A;  2E1H A;  3HFO A;  2DZC A;  2ZGW A;  3L2Z A;  2FYK A;  4OP0 A;  2JN0 A;  5LJ5 h;  4M7A D;  3JCM h;  3RER A;  4C92 A;  3FJP A;  4M75 B;  4QVC A;  3JB9 G;  4M77 E; 
#chains in the Genus database with same CATH topology
 5I2M A;  2RD1 A;  4DA4 A;  3JCM X;  1RI0 A;  2E5Q A;  1G3W A;  3LWH A;  1ZBX A;  4AFZ C;  2X3W D;  1FMV A;  4BY6 B;  2OAW A;  4QQ6 A;  5GAO n;  4ZGE B;  5DM7 R;  1EFN A;  4LNP A;  4FW2 A;  2EIF A;  4M7A G;  2QQS A;  3R6O A;  3GNF B;  4M77 F;  2OTL T;  1WHG A;  1R8O B;  4OB1 B;  1WXT A;  3CMA A;  5CKB A;  3QZ9 B;  2P0Q A;  1VQL T;  1PG5 B;  1RUW A;  3V7R A;  2DO3 A;  4LXC A;  1IXD A;  3OYA A;  4F7U G;  3TSW A;  4C92 D;  2ECZ A;  4M7D A;  2KRM A;  2MIO A;  4X1V A;  2IVW A;  4FYV B;  2PU9 B;  3EHR A;  3CD6 T;  3MP6 A;  4C0F A;  2YUP A;  2XD0 A;  5HK3 A;  4WF2 A;  3WVE B;  1YJW A;  4EIK A;  3H9N A;  2D0Q B;  2CT4 A;  2VV5 A;  3CC7 T;  4JRQ A;  4HCC A;  4C0D B;  1XTD A;  4AMC A;  5ECA A;  3NPF A;  2E41 A;  3S3N A;  2QQR A;  1Y96 A;  5D6W A;  2KVQ G;  1VQ8 T;  1MMD A;  3OY9 A;  3V7S A;  4PKC C;  2XIC A;  2AKK A;  2CGH A;  3CC4 T;  4C5G A;  1Q81 R;  3VS7 A;  2R58 A;  4K11 A;  3CCE A;  1VQK T;  1PRL C;  3HTR A;  3A5Z B;  2RQT A;  3EG9 A;  5CKE A;  1Z9Q A;  3EH2 A;  1NG2 A;  3R6N A;  3CD6 Q;  1H3Z A;  2EJ9 A;  1IO6 A;  5KYY A;  1OUL A;  2BE9 B;  3EG2 A;  1HK9 A;  2A0F B;  1NEG A;  4D8D A;  3CC7 Q;  5GMK i;  2FZG B;  3TVT A;  3I56 Q;  4QQD A;  2ZAE A;  1NYG A;  2E6Z A;  2L0A A;  1QVG P;  1K0S A;  2BE7 D;  3VS1 A;  4JS5 A;  5LJ5 d;  1NLP C;  3SFM A;  4KGX B;  3OYM A;  1VOM A;  5FU7 C;  1Q7Y R;  4C8Q B;  4V2S A;  4M75 C;  1OZ3 A;  2LNV A;  4EMK A;  1OV3 A;  2KGT A;  1T3L A;  4J9D A;  3UF4 A;  1YWO A;  4PJO G;  4GBQ A;  2ZPE B;  3CPW A;  2P0K A;  3UA6 A;  2L3R A;  2X51 A;  2OX7 A;  3ASK A;  3TQ7 P;  3LLR A;  4OGC A;  4M77 B;  3CMA Q;  1YBY A;  4JRK A;  3CCE T;  2GGR A;  3C12 A;  3E9G A;  4LDX A;  2DD5 A;  2JTE A;  1SHG A;  4M78 C;  3UPU A;  3JAM E;  3MP8 A;  1YJW Q;  2CDT A;  4ZN1 A;  2DYI A;  4IUT A;  4BE2 A;  2J6K A;  4J6Y A;  2FRW A;  4JJC A;  1D3B B;  1I5L A;  1Z9Z A;  2QA4 T;  2VWF A;  2DVE A;  1ZQ1 A;  1H92 A;  1QCN A;  3OBY A;  1U1S A;  3GBQ A;  3GIB A;  2ZZD A;  4C92 G;  4ORZ A;  3A98 A;  3MCA B;  2LX7 A;  4RTU A;  2RJD A;  2PNI A;  3DB3 A;  2JMA A;  4M75 E;  2K3B A;  4J5Y A;  3CCS A;  3CCE Q;  3EH1 A;  2M02 A;  2KAF A;  3ME9 A;  2DL7 A;  3QJY A;  4M7D D;  1PD1 A;  2Y4X A;  1SHF A;  1O9S A;  2L3S A;  4N0A C;  5LJ5 j;  2DBM A;  4HXJ A;  2QDY B;  1I0C A;  5HK0 A;  4GLM A;  3OYG A;  2Z0W A;  2O88 A;  2DAQ A;  4KRT A;  2KMT A;  1T0J A;  1IHV A;  4FU6 A;  3REB B;  5GAN 7;  4CRI A;  1OU8 A;  1VIE A;  4PK4 A;  1ZSZ C;  3HRU A;  2HBW A;  4XTZ A;  1QVF P;  3PTA A;  3OMG A;  1KD1 U;  1MGQ A;  3CCL T;  1WHH A;  2DJQ A;  2G3R A;  2AIR B;  2RHX A;  1WQ7 A;  3BDU A;  3JCM Q;  4FM4 B;  5IXF A;  2NUT B;  5GAM h;  3MEU A;  3E9F A;  1N9S A;  4DBF A;  1IHW A;  3DKM A;  4PFO A;  3SWN B;  2JVV A;  1SSF A;  2XDP A;  1FX7 A;  2RHZ A;  3NTH A;  4XU0 A;  4XU1 A;  3TSZ A;  3I55 A;  2ZPI B;  3UAT A;  2FPE A;  2M16 A;  4F7U A;  1TXQ A;  3M0R A;  3J7A F;  5KYU B;  2PVO B;  3JB9 D;  4OB0 B;  3HKS A;  2DTO A;  5GAN 6;  1AWJ A;  2LX9 A;  3L2W A;  1BCM A;  2EBP A;  4J6X A;  3HL8 A;  4JRI A;  1AVZ C;  2NUZ A;  3JCM W;  1OOT A;  3A8H B;  5FU7 B;  3JV3 A;  2D8H A;  4C0G A;  4HVV A;  2ED1 A;  2SEM A;  5GAN g;  2K7A A;  4XU2 A;  1AT1 B;  2MK5 A;  4M77 D;  4HA8 A;  3VS2 A;  1X01 A;  2RPN A;  1WDX A;  4D6W A;  3CCJ T;  4R56 A;  5I11 A;  4QQG A;  2ENM A;  2HNI A;  3QUI A;  3PFS A;  3CC2 A;  1W2B P;  3QO3 A;  1RI9 A;  1UE9 A;  2ROT A;  1QWF A;  1WHM A;  2DD4 A;  3JCM h;  2JS2 A;  4BDZ A;  2BZX A;  3JCM c;  4L6V 5;  1M3B A;  3CCS Q;  4JLG A;  1Q81 C;  1OQK A;  3EFO B;  3M9Q A;  3N5B B;  5LJ3 g;  1Y0M A;  2EKH A;  3MJX A;  3VUB A;  3I55 T;  2VAS A;  2K79 A;  2FHD A;  1GCQ C;  1BIB A;  4OMM A;  3A8G B;  2GNC A;  4RTY A;  4PFZ A;  4FYX B;  3VRZ A;  2CUB A;  1Q95 G;  1UG1 A;  2QGF B;  3CCJ Q;  2O2O A;  3CBP A;  1H64 1;  1AWW A;  4RG2 A;  3S6W A;  1W4S A;  5KYN A;  3G7Z A;  5AYF A;  1BCO A;  5GAN 3;  3QWY A;  3QDF A;  2VXE A;  2X4X A;  4LDW A;  4PJO A;  2DZ9 A;  2KYB A;  4C92 E;  2F2V A;  1X6B A;  5GAM e;  1JBM A;  1M90 U;  2KQW A;  4XTW A;  4QT7 A;  4RUG A;  2CP0 A;  3I55 Q;  1QQJ A;  2IG0 A;  3OMC A;  3CCQ A;  2LTO A;  1VQP T;  2FRY A;  4RTZ A;  1JRI A;  3H0F A;  1QWE A;  1ZSZ B;  2MOX A;  3HRS A;  2EAY A;  5IN1 A;  3CXC P;  2YHT A;  3LYI A;  1VQ4 A;  4BE0 A;  2KE9 A;  4XU3 A;  1LJO A;  4JZ4 A;  4PJN A;  1M9S A;  1CSK A;  5C6S A;  3SHW A;  2KYM A;  3PMT A;  5CAI A;  2A7Y A;  2XI9 A;  5FRO A;  1TS9 A;  3OYB A;  2A28 A;  1UHC A;  1AWO A;  2D1X A;  5GAO q;  2GBQ A;  2EGC A;  4KUD K;  2ED0 A;  3OYD A;  3GF5 A;  3CCU T;  2JN0 A;  4M7A D;  4C92 A;  3G1J A;  5FRM A;  3JB9 G;  4R55 A;  1VQ7 T;  5FU6 B;  2HSE B;  3CC2 Q;  1KQS A;  4E47 A;  1KSW A;  3NTK A;  3TCJ A;  2OI3 A;  1VQP Q;  2VGM A;  4AFS C;  2DEU A;  2YLB A;  2MWP A;  1KC8 U;  4WTO B;  2EQI A;  3CPW S;  2CZ0 B;  3JCM e;  1I1J A;  1BYM A;  2KRO A;  1R77 A;  2K57 A;  3M0U A;  4J9E A;  3JB9 H;  3OSV A;  3EGU A;  1WJS A;  3ZEH A;  4M77 G;  3V8K A;  3VRY A;  2FVU A;  2AZS A;  3LGF A;  4LDV A;  5GMK j;  1NPP A;  1N27 A;  3OS0 A;  4IIM A;  1PKT A;  3CCM A;  3CCQ T;  1PWT A;  3H0H A;  3PMI A;  1PRM C;  2DKG A;  3G4S A;  2YRD A;  3M54 A;  3OS5 A;  1G2B A;  2JM9 A;  2LCS A;  1VQ4 T;  1VQ7 Q;  1I81 A;  3PIP A;  4M7D C;  2PVG B;  1QKX A;  1YI2 A;  3LWI A;  5KYW A;  2XK0 A;  2CT3 A;  1WHK A;  4NL2 A;  1M1F A;  4HCK A;  2VC8 A;  1SG5 A;  3TRE A;  4DEX A;  1VQM T;  1K73 C;  2BIV A;  1VIF A;  1YJ9 T;  5GAO p;  1WFW A;  1D09 B;  3M4G A;  2DXB A;  4Y92 A;  2PVD B;  3U23 A;  1GRI A;  5M9O A;  2OTL A;  1KQ1 A;  3EFS A;  3CCQ Q;  1VQL A;  2JTM A;  1YIJ A;  2HD0 A;  3AT1 B;  4OMP A;  3NGP A;  4E2F B;  1VQ4 Q;  2YDL A;  3IQL A;  3X28 B;  5LJ5 h;  1CKB A;  2C0O A;  2M51 A;  1HYO A;  3G6E T;  4RKU E;  2ATC B;  4A54 A;  2HQH A;  1K9M R;  3CCM T;  1VQM Q;  3OYN A;  3CC7 A;  4PJM A;  1M2V A;  3GPL A;  4PJO D;  4PLL A;  4C5I A;  2EJF A;  3HPW A;  3G4S T;  4PJL A;  1G3Y A;  2EFI A;  2EGE A;  4M7D E;  4DOV A;  1GFD A;  3O5Z A;  1VQ8 A;  2F5K A;  4WCI A;  4FSS A;  4CC2 A;  2KXD A;  3CC4 A;  1WZO A;  3M0T A;  4NOY A;  2KK4 A;  4MZT A;  2X35 A;  3RDV A;  5GJW B;  2DRK A;  3C94 A;  4C8Q F;  1M1K C;  2QI2 A;  4E6R A;  1B34 B;  3ZBD A;  1O75 A;  1VQK A;  3HRT A;  4FL6 A;  1I4K 1;  4IKF A;  1MV0 B;  4EMK C;  2K2V A;  3MO8 A;  4MDX A;  4OMF B;  4PNO A;  4JJB A;  1Q86 U;  3LGL A;  2OJ2 A;  4ZTF A;  2LRQ A;  2Y4Y A;  3G6E Q;  3RUX A;  3QII A;  1KD1 C;  2MPX C;  2CP5 A;  2COZ A;  3CCM Q;  4R0K A;  2VUB A;  4X9C A;  1RAA B;  3QPH A;  1YIJ T;  2QEX A;  2WSC E;  3G4S Q;  1EIF A;  1AZG B;  2V8K A;  1X75 C;  2DIL A;  2K5I A;  2EWN A;  2RHI A;  2RQW A;  3VS0 A;  4E7K A;  1YCY A;  5D6X A;  1K8A C;  5KH6 A;  4MZP A;  2HQE A;  2L8D A;  1YI2 Q;  3EG1 A;  2K2M A;  2DXT A;  1BI2 A;  2HDA A;  1YNZ A;  2EYX A;  4KGZ B;  3UDC A;  2AZV A;  2DYB A;  3OA6 A;  2CSQ A;  4J8O A;  4E7I A;  2V1R A;  1Q7Y U;  3OYH A;  3JCM V;  1GFC A;  4N4I A;  2NWM A;  4XK8 E;  5GAO l;  2VVK A;  3HP9 A;  4AG1 C;  2OTL Q;  1XJW B;  2X4Y A;  1KJW A;  2ZGW A;  3X25 B;  1XOV A;  1VQL Q;  1M8M A;  3DLM A;  4E7Z A;  2HCK A;  1YIJ Q;  4J7I A;  4M77 E;  5EC7 A;  4BD3 A;  3PE0 A;  2EGA A;  2F2W A;  6AT1 B;  2JXB A;  1U06 A;  3UA7 A;  3EGD B;  4A53 A;  2LCC A;  4JPB W;  4HCB A;  1NM7 A;  2CP7 A;  3RKY A;  5LJ5 e;  1E6G A;  1JJ2 A;  2RJF A;  1WXB A;  1RLP C;  1SKU B;  4RCC A;  1T0H A;  3CBM A;  1NBE B;  2QEX T;  1M5Q 1;  2EYQ A;  2QA4 A;  5CK9 A;  2K3Y A;  3UT1 A;  3QDR B;  4Z8A A;  2J6O A;  5J39 A;  1M4Z A;  2DJZ A;  2M1H A;  1VQ8 Q;  1RL2 A;  3HFN A;  1IRX A;  2CZ7 B;  3CC4 Q;  3L2Q A;  2KNB B;  1N8R C;  5KCH A;  4PLI A;  1EX4 A;  2COW A;  5GAN 8;  3FB9 A;  4M77 A;  1VQK Q;  2EVR A;  2KT8 A;  1ZBJ A;  2CP3 A;  2QQ9 A;  5FW9 A;  1TG0 A;  3KBG A;  4X34 A;  4N4H A;  5GAN 4;  4J7F A;  1BK2 A;  4PJJ A;  3BE3 A;  2RI2 A;  2A3L A;  4HVW A;  4MML A;  5IHI A;  2O4X B;  4HKE A;  2QEX Q;  3GNG A;  1D3B A;  5CIU A;  1X2Q A;  1S72 A;  1X6O A;  2DA9 A;  3MEW A;  3V8J A;  3E2U A;  3JB9 I;  1M90 C;  3CCL A;  4ZTJ A;  4M75 F;  4JDS A;  2LQW A;  2DRM A;  2LC4 A;  2M0Y A;  3NTI A;  3MHX A;  4BI4 A;  3OYL A;  4OB2 B;  4EMK B;  1SF9 A;  3VYG A;  3OYE A;  3J81 E;  2DEQ A;  2RM4 A;  2W0Z A;  1RAB B;  1KQS S;  3EG0 A;  4A4E A;  1M27 C;  2LNH B;  5D6Y A;  4BAC A;  4Z88 A;  2DK3 A;  3RES A;  4EMH A;  9ATC B;  4DBH A;  5GAO m;  1UEC A;  4M78 F;  1X6G A;  2KBT A;  4ATO A;  2R5M A;  3WVD B;  4M7A E;  1D1C A;  1WA7 A;  4KH0 B;  1PHT A;  5GMK h;  2H3E B;  2DL5 A;  4RG8 A;  4DQ2 A;  4F7U E;  1GCP A;  1YIT T;  3OW2 A;  1HD3 A;  1VQO T;  1ZA2 B;  2V26 A;  2QA4 Q;  1K9M C;  2MWO A;  3CCJ A;  1V76 A;  4UC4 A;  5A0D A;  2NUT A;  1S72 T;  1K73 R;  3VKI A;  3SWN A;  2EYZ A;  3QXE B;  4J9G A;  2KRS A;  1NZ9 A;  1U8R A;  2CZ1 B;  3FIF A;  1Q82 C;  2KY9 A;  2XDB A;  2V8I A;  4OGE A;  1RLQ C;  5KYU A;  4PJO C;  3ER0 A;  2XU8 A;  4M7A A;  3EGX A;  2MCN A;  3EHQ A;  2X4J A;  2H8H A;  2XKO C;  5GAN f;  5CVI A;  1MHN A;  3QBY A;  2WSE E;  1R0B G;  3NFC A;  2QK0 A;  3SB2 A;  2HBP A;  1VYV A;  1UEB A;  1TH7 A;  1QKW A;  5DY9 A;  2L3P A;  1NJI C;  3BDL A;  2F5T X;  3PVL A;  4C8Q D;  5GAM g;  5KE3 A;  3QZ5 B;  4YTL A;  3ZL7 C;  1S72 Q;  5CKD A;  3I35 A;  3CCL Q;  3L2Z A;  2PTK A;  1YHQ T;  3C0C A;  4B9W A;  2W10 A;  4M75 B;  1BIA A;  3DLL A;  3JCM b;  1G5V A;  2A36 A;  1X2K A;  2BKD N;  2RI5 A;  1KHI A;  1W1F A;  4XTV A;  3KFV A;  5KCO A;  2RO0 A;  2A37 A;  4RTX A;  4C92 C;  3EFO A;  3RNJ A;  1IGU A;  1M1K R;  4C5H A;  2DTH A;  1VQP A;  4F17 A;  2K5L A;  4QVZ A;  4M78 B;  4PJO E;  3QG1 A;  4A4K A;  3LH5 A;  3KXT A;  2X4W A;  2LJ0 A;  3KUF A;  2LP5 A;  4FSX A;  1MMG A;  1KD1 R;  5I2S A;  1JXO A;  3SEM A;  2COY A;  2EJG A;  1BKB A;  5GMK e;  1YHQ Q;  2CRE A;  4Z02 A;  2RQU A;  4RTV A;  2E4H A;  2JJ9 A;  3JCM g;  1K8A R;  1U3O A;  2J6F A;  4BUG A;  3CCU A;  3P8H A;  3OB9 A;  3CBO A;  3VYH B;  4A4H A;  1VQ7 A;  1FMK A;  1WYX A;  1Y71 A;  2JNG A;  5IXB A;  1UJY A;  1IB8 A;  2RQV A;  4FCY A;  1Q86 C;  2F69 A;  3VS6 A;  1QVG A;  1U5S A;  3PNW C;  4HCZ A;  4CI0 C;  5CKH A;  1PKS A;  4DBQ A;  2YXY A;  4CC7 A;  1OZ2 A;  2QXF A;  1TTH B;  4JJN K;  2O31 A;  1Y57 A;  1C0M A;  3L2V A;  3RBB B;  4IUQ A;  4N4G A;  2DTI A;  1SEM A;  3L1A A;  5CKF A;  4OP0 A;  1AEY A;  2XMF A;  3CCR A;  1AWX A;  1VYT A;  3RER A;  4LN2 A;  4ME7 A;  1MMN A;  4QKU A;  1TSF A;  3OYK A;  1JJ2 S;  3THK A;  2E5K A;  2GQI A;  5CQX A;  3NMZ C;  2LQK A;  1VQM A;  2C06 A;  1RAE B;  2FPD A;  3QKJ A;  1OPL A;  1YJ9 A;  3VS5 A;  4RMO A;  3QYG B;  1RAI B;  1KHC A;  1G83 A;  1JQQ A;  4GY5 A;  1VQN T;  1N8R R;  2L89 A;  5A2Q E;  1X69 A;  4AT1 B;  4C8Q G;  4JUV A;  4BY6 C;  4DOW A;  4LD6 A;  3FJ5 A;  4FW1 A;  1HSQ A;  3X24 B;  1ZUU A;  1OI1 A;  4Y28 E;  5GAN d;  4KGV B;  2C0I A;  3H0I A;  3VS4 A;  4Z89 A;  3FDR A;  3H6Z A;  1QCO A;  2MI6 A;  1VQ5 T;  2DXU A;  1NE8 A;  1M1G A;  3BY7 A;  1YFN A;  4XTX A;  2KSS A;  3TU4 K;  1MV3 A;  3GP8 A;  3HSB A;  2JOY A;  3G6E A;  2LCL A;  5GMK l;  1UB4 A;  5FRN A;  1TUC A;  2K3X A;  1TWB A;  3CPW P;  4EMG A;  3CCR T;  3GOX A;  1M90 R;  3CCU Q;  4E7S A;  1JO8 A;  1PNJ A;  4A4F A;  5DLO A;  2MAM A;  2AKL A;  2B86 A;  5LJ3 d;  1N5Z A;  3QWX X;  2VXF A;  3OS1 A;  1QVF A;  3G71 T;  2DNU A;  1JXM A;  1ZUK A;  2BUD A;  2CYZ B;  4M4Z A;  2GCX A;  3PIO A;  1VQ5 Q;  2FZK B;  4PFP A;  5CO7 A;  5I22 A;  1RAH B;  2D0N A;  2E1H A;  2LVM A;  2DER A;  2FYK A;  4MZM A;  4JJD A;  3FJP A;  1QW1 A;  1VYU A;  2K5F A;  3RMQ A;  2RI3 A;  2J06 A;  3I5R A;  1XNI A;  2KRN A;  1NYF A;  1NLO C;  2QG9 B;  2E3I A;  2DE0 X;  4HT8 A;  4M7D F;  3Q1J A;  2BTT A;  2I0N A;  4Y91 A;  2BZY A;  2ZPB B;  2DLP A;  1E7O A;  2RB6 A;  3I5S A;  2R57 A;  3CCR Q;  4J9I A;  5KYX B;  3J80 E;  2M9U A;  3MKD A;  1C1A A;  3OW2 S;  1WHL A;  3M4Y A;  5D7U A;  1UFF A;  1M30 A;  4RCB A;  8AT1 B;  1KIK A;  2NUP B;  3DB4 A;  3G71 Q;  2O01 E;  1XQH A;  1QP3 A;  2YUQ A;  3A1P A;  5GAN j;  2HSP A;  1YJ9 Q;  3T9N A;  2ABL A;  3HHT B;  3WXM B;  2G6F X;  3O8V A;  2LQN A;  2YRV A;  1AHJ B;  2NYS A;  3QHS A;  2E64 A;  4OMN A;  2LJ3 A;  2VYT A;  1FWZ A;  2QQB A;  3JB9 J;  1WLP B;  2A08 A;  2ZPF B;  1Q82 R;  3VJP A;  2EQK A;  5LJ5 g;  4EPC A;  2WSF E;  1T3S A;  2R5A A;  1W2B A;  1G8X A;  2X3X D;  1Q81 U;  3MEV A;  2L5Q A;  1A0N B;  4XQ3 A;  2EPD A;  4M77 C;  2CP2 A;  2MF2 A;  3X20 B;  5LJ3 j;  1TUD A;  3JCM J;  1PSF A;  2CH4 W;  3JB9 F;  1NJI R;  1GBQ A;  1M2V B;  2EQM A;  5HCK A;  2LT4 A;  2E65 A;  1FXX A;  5GMK m;  1BI1 A;  2EQU A;  5J26 A;  3H41 A;  1KFZ A;  4M75 G;  4EDU A;  3FLG A;  3RIR A;  1H3H A;  3ULR B;  3AHU A;  1F1B B;  3BFM A;  1AD5 A;  2P4R A;  4J83 A;  2DZC A;  3OYJ A;  2KI7 A;  1I07 A;  5IHN A;  2RJC A;  5FLX E;  1YJN A;  2P4T A;  4DEY A;  4NS5 A;  3SDZ A;  4C8Q E;  2EQJ A;  2DX1 A;  4LUE A;  2J05 A;  2J7I A;  3BW1 A;  1RAD B;  2H3J A;  2YSQ A;  4M78 G;  4LE9 A;  1UGQ B;  2D9T A;  3EGD A;  1M3C A;  4J9B A;  1SRM A;  2HKN A;  1MUZ A;  4HT9 A;  1D0X A;  3QJ6 A;  4LDY A;  3OSS C;  3I56 T;  3L42 A;  2F1L A;  4M7D B;  3PGG A;  1RAG B;  2EW3 A;  2KT1 A;  1TUG B;  3H8Z A;  3URG A;  3CXC A;  2DET A;  1PM3 A;  4KT0 E;  2IPO B;  1VQ6 A;  1MND A;  2E6N A;  2GFA A;  4ELY C;  1JU5 C;  2RJE A;  4BE1 A;  1ZUY A;  4RTT A;  3M0S A;  1PD0 A;  1ZX6 A;  1N6A A;  1Y96 B;  4E7H A;  1Q86 R;  2SRC A;  2DM1 A;  4C8Q A;  2CZ6 B;  1KQ2 A;  2GF7 A;  1QVG S;  2FG0 A;  4F04 B;  2GQV A;  3SWN C;  5GJV B;  2F2X A;  4OVA A;  2C0T A;  3CMA T;  4L59 A;  2DL3 A;  2KEA A;  4AFU C;  3EG9 B;  1M8V A;  1RAF B;  1YJN T;  5CR2 A;  1UJ0 A;  2BZ8 A;  2OTJ A;  2RK1 A;  2CKK A;  4MDW A;  1QVP A;  2O4X A;  1VUB A;  1GXI E;  2K4Y A;  1Y7X A;  4BI3 A;  4M7A C;  1AZE A;  1X43 A;  5KYY B;  1D0Y A;  1RAC B;  5I21 A;  1YJW T;  1QLY A;  3VS3 A;  2LQ8 A;  1YIT A;  4O5V A;  2JUF A;  1VQO A;  4OB3 B;  1B3Q A;  4II1 A;  3V8L A;  3FEO A;  2CUD A;  2RHU A;  1QMC A;  1YWP A;  1UTI A;  1X27 A;  5HY6 A;  1GBR A;  4ZGD B;  1VQ6 T;  1OX8 A;  1K73 U;  1K1Z A;  4M7A F;  3LH0 A;  1GL5 A;  2QTV A;  1B7T A;  1YJN Q;  1UGR B;  1V29 B;  1WX6 A;  2YUN A;  3M0P A;  4F7U F;  4OF1 A;  1JB0 E;  4PL6 A;  2QTX A;  1BB9 A;  2DMO A;  4F14 A;  2RA2 A;  1SPK A;  2AK5 A;  3M58 A;  2DL8 A;  1LVK A;  1S1N A;  5GAN 2;  4DBR A;  3MPU B;  2OTJ T;  5DLQ E;  2DXC A;  1KQS P;  4C5E A;  4RTW A;  1YCS B;  2VB6 A;  1WXU A;  1VQ6 Q;  2ZPG B;  1YHQ A;  3QSU A;  2HAX A;  1AOJ A;  3OS2 A;  3C4S A;  2ROL A;  3OYY A;  2YUO A;  4NL3 A;  2PZ1 A;  2Y90 A;  1KC8 C;  1J3T A;  3SD4 A;  2YLC A;  3MEA A;  1VA7 A;  3S3O A;  1QVF S;  1ABO A;  3PT9 A;  2JZ2 A;  3RMS A;  2CP6 A;  3PVQ A;  4F16 A;  2HL3 A;  2PQW A;  1VQ9 A;  1M1K U;  1D1B A;  2CS7 A;  5GAM f;  2FB7 A;  4FYY B;  4FYW B;  2YT6 A;  1HXD A;  1ZHI A;  3D7S B;  2JT4 A;  3M5A A;  2OTJ Q;  4M78 E;  2LJ1 A;  4Q5W A;  3JRZ A;  3HFO A;  3A8L B;  3CPF A;  4B9X A;  4CC4 B;  3OYC A;  4E7J A;  3L2R A;  4QVC A;  3JSC A;  4E7L A;  2QYZ A;  2FO0 A;  2ZPH B;  1YIT Q;  2AT1 B;  3LW5 E;  4M75 A;  2JTF A;  4CC3 A;  4J6W A;  1VQO Q;  3UWN A;  1W70 A;  3M56 A;  1K8A U;  3CEY A;  1WIE A;  2JW4 A;  4QVD A;  1TU0 B;  2KXC A;  4KUL A;  4J9H A;  4A4G A;  4QW2 A;  2EYY A;  2P0P A;  8ATC B;  1N9R A;  1K0X A;  2M0O A;  3F70 A;  4PJO F;  5FU6 C;  1C6V X;  5GAN h;  2ESW A;  2JM8 A;  1CKA A;  4M7A B;  5FWB A;  5LJ3 f;  1OU9 A;  3CCS T;  3EGX B;  2PUO B;  3P8B B;  2K9G A;  2QDL A;  3S3M A;  2L3Q A;  4JZ3 A;  4M78 A;  4L5G A;  4O6J A;  1K4U S;  4XTU A;  1BI0 A;  2XID A;  1ZSG A;  5IAY A;  1W2B S;  4F7U B;  5CCA A;  4IIO A;  2GTJ A;  3M57 A;  4IUR A;  3JCM f;  3CME A;  2IIM A;  3INZ A;  4TVR A;  1VQ9 T;  1WHJ A;  2RQR A;  1YP5 A;  3L2U A;  2LT1 A;  2ZCF B;  2X9H A;  4BI8 B;  2PUK B;  3RKW A;  5LJ3 h;  5C0M A;  2RHY A;  4ZGJ B;  5IHK A;  2HZY A;  2QQA A;  2HMA A;  4XTY A;  1TOV A;  7AT1 B;  5CQY A;  2XHC A;  3NHN A;  2LDM A;  2E3H A;  4C92 F;  1M3A A;  4BDY A;  2QAS A;  1PSE A;  2P84 A;  3A8O B;  2RK2 A;  4C0Z A;  2KDS A;  1FYN A;  1WPY A;  2WAC A;  1VQN A;  3FRN A;  4GLK A;  2FZC B;  3RR6 A;  2DBK A;  5GAN 5;  3M59 A;  4OMQ A;  4J9F A;  4N0A A;  1N8R U;  2VKN A;  1IRE B;  1K76 A;  3OBW A;  1E6H A;  1W6X A;  4KUI A;  1VQ9 Q;  2QAZ A;  2RMO A;  1NPR A;  1FMW A;  1OX9 A;  3VU3 C;  1VQ5 A;  1ZSZ A;  2YRC A;  1G3S A;  3TEE A;  2FL7 A;  2QGG A;  4M7D G;  4J9C A;  3VV0 A;  2XG8 D;  1I8F A;  3CME T;  1JEG A;  1R0C B;  4P5N A;  1LOJ A;  2RF0 A;  1D0Z A;  1ARK A;  1EZZ B;  3CXC S;  2KR3 A;  4D8K A;  3CCV A;  1U1T A;  2XDD A;  4HVU A;  4XAX B;  2HKQ B;  2D6F A;  3VUZ A;  1Q7Y C;  1B07 A;  1WGS A;  1LNX A;  4LUD A;  3CC2 T;  2DVJ A;  1I5O B;  2GFU A;  1K9A A;  2RNA A;  3G71 A;  1LCK A;  5KE2 A;  2DF6 A;  1QP2 A;  4PJO B;  4ELZ C;  5IH2 A;  5GAN e;  5FWC A;  2CH4 A;  2DL4 A;  5GAM d;  2B8A A;  2L2P A;  2D8J A;  3X26 B;  4X9D A;  1JJ2 P;  1OEB A;  4LD9 K;  1UDL A;  5L23 A;  5IT9 E;  1M2O A;  3CME Q;  5AT1 B;  4M75 D;  2LMJ A;  2FPF A;  1UGS B;  3QYH B;  5L8R E;  1WI7 A;  1UUE A;  3M53 A;  3RKX A;  5LJ3 e;  3E1S A;  4A63 B;  2NLU A;  3MP1 A;  3JCM P;  2GTO A;  4IUP A;  1NEB A;  3EAE A;  5LL6 S;  1MNE A;  4C92 B;  1K9M U;  1HJD A;  3I9Q A;  3EG3 A;  4M78 D;  3ZFJ A;  3CCV T;  1VQN Q;  4C0D C;  3FC3 A;  2HL5 C;  2JS0 A;  1GCQ A;  1P92 A;  2DIQ A;  2OAU A;  5A0L A;  2AHJ B;  1Q82 U;  4IUV A;  5A0G A;  1KK7 A;  3JCM d;  1UGV A;  1WJR A;  2DFU A;  1WJQ A;  1LPL A;  2DPP B;  4KH1 B;  3E19 A;  2FEI A;  2V8J A;  3CQT A;  3REA B;  3OQ5 A;  4FT4 A;  1H8K A;  2K6D A;  4IUU A;  1PC0 A;  5KYX A;  3LX7 A;  1UHF A;  1DJ7 B;  2CSI A;  1ACM B;  2EKO A;  1NJI U;  3V7C A;  2NUP A;  1V1C A;  1D1A A;  1SRL A;  3OYI A;  2HEQ A;  4ZNX A;  5GAM j;  1ZLM A;  3EFR A;  2O9S A;  3CCV Q;  5KYW B;  1Y07 A;  4LDU A;  5LJ5 f;  1QCF A;  2RH2 A;  1SSH A;  1PCX A;  2JMC A;  1BU1 A;  2HQX A;  1WNL A;  1KC8 R;  2E10 A;  2V1Q A;  4BB7 A;  2EYW A;  4JS4 A;  3GLX A;  4ZN3 A;  1MMA A;  1OYX A;  4JRP A;  3C95 A;  4FT2 A;  1UGP B;  4OMO A;  1B34 A;  1YN8 A;  4KBM B;  4C8Q C;  3CD6 A;  3OYF A;  2LZ6 B;  1WQW A;  5GAO r;  3OW2 P;  2VGN A;  1IZ6 A;  4FIB A;  2MMP A;  1ZA1 B;  2YWW A;  1BI3 A;  2I2L A;  3MET A;  1KG1 A;  1G3T A;  5J3B A;  4MMK A;  3P8D A;  3I56 A;  3A8M B;  2O9V A;  4JLI A;  1OPK A;  3M55 A;  4ANJ A;  4ESR A;  2RN8 A;  3M0Q A;  2MYS A;  4B6M A;  2DIG A;  4OML A;  4VUB A;  4AFQ C;  1IGQ A;  4AG2 C;  5EG2 A;  1YI2 T;  2E70 A;  2E12 A;  5HKC A;  1BBZ A;  1ABQ A; 
#chains in the Genus database with same CATH homology
 1BIA A;  5I2M A;  3DLL A;  2RD1 A;  4DA4 A;  3JCM X;  1RI0 A;  5FU6 B;  3JCM b;  5HY6 A;  1G5V A;  2E5Q A;  1G3W A;  4ZGD B;  2BKD N;  2RI5 A;  1KHI A;  4XTV A;  4E47 A;  3LWH A;  1ZBX A;  1KQS A;  4F7U F;  1VQ6 T;  1K73 U;  3NTK A;  5KCO A;  3TCJ A;  2RO0 A;  4C92 C;  2VGM A;  4BY6 B;  4QQ6 A;  5GAO n;  4M7A F;  2YLB A;  4ZGE B;  3LH0 A;  2MWP A;  5DM7 R;  1KC8 U;  2EIF A;  3CPW S;  2CZ0 B;  2QQS A;  3JCM e;  1UGR B;  4M7A G;  1BYM A;  1V29 B;  3R6O A;  2K57 A;  3GNF B;  4M77 F;  2OTL T;  1R8O B;  4OB1 B;  2DTH A;  3OSV A;  4C5H A;  1WJS A;  3CMA A;  5CKB A;  3QZ9 B;  2P0Q A;  3ZEH A;  4M77 G;  2K5L A;  4OF1 A;  3V7R A;  2FVU A;  3LGF A;  4LDV A;  3V8K A;  4QVZ A;  2DO3 A;  5GMK j;  1JB0 E;  1NPP A;  4M78 B;  3OYA A;  4F7U G;  4PJO E;  3QG1 A;  4PL6 A;  2QTX A;  4A4K A;  4C92 D;  3KXT A;  1N27 A;  3OS0 A;  2X4W A;  2RA2 A;  3KUF A;  4M7D A;  4FSX A;  3M58 A;  3CCM A;  5I2S A;  3CCQ T;  2IVW A;  2PU9 B;  5GAN 2;  2EJG A;  3CD6 T;  3PMI A;  3MP6 A;  1BKB A;  4C0F A;  2XD0 A;  2DKG A;  5HK3 A;  3G4S A;  4WF2 A;  3WVE B;  5GMK e;  1YJW A;  3M54 A;  3OS5 A;  4Z02 A;  2OTJ T;  5DLQ E;  2DXC A;  2D0Q B;  4C5E A;  1VQ4 T;  2VV5 A;  1I81 A;  3PIP A;  3CC7 T;  2PVG B;  4JRQ A;  4M7D C;  3JCM g;  4HCC A;  1YI2 A;  3LWI A;  1K73 C;  4C0D B;  2XK0 A;  1XTD A;  3CCU A;  2ZPG B;  4BUG A;  1YHQ A;  4NL2 A;  1M1F A;  3QSU A;  3P8H A;  2VC8 A;  3OB9 A;  3CBO A;  3TRE A;  3VYH B;  4A4H A;  2HAX A;  2E41 A;  3S3N A;  1VQ7 A;  2QQR A;  2JNG A;  2BIV A;  1Y71 A;  1Y96 A;  1VIF A;  3OS2 A;  1VQM T;  1YJ9 T;  5D6W A;  2KVQ G;  3C4S A;  1VQ8 T;  3OY9 A;  3OYY A;  4NL3 A;  3V7S A;  5GAO p;  1Q86 C;  4PKC C;  2XIC A;  2Y90 A;  2CGH A;  3M4G A;  2F69 A;  3CC4 T;  1KC8 C;  2DXB A;  4C5G A;  3SD4 A;  2YLC A;  2PVD B;  3MEA A;  1QVG A;  3S3O A;  3PNW C;  4HCZ A;  4CI0 C;  2R58 A;  5CKH A;  1QVF S;  3PT9 A;  2JZ2 A;  3RMS A;  3CCE A;  1VQK T;  5M9O A;  3A5Z B;  2OTL A;  1OZ2 A;  2QXF A;  2PQW A;  4JJN K;  1VQ9 A;  1KQ1 A;  5CKE A;  1M1K U;  3EFS A;  2CS7 A;  5GAM f;  1VQL A;  2FB7 A;  3L2V A;  1H3Z A;  2JTM A;  1YIJ A;  2EJ9 A;  1HXD A;  4IUQ A;  1ZHI A;  2HD0 A;  4N4G A;  2DTI A;  3L1A A;  3M5A A;  5CKF A;  4M78 E;  1HK9 A;  5CR2 A;  3X28 B;  4Q5W A;  5GMK i;  3JRZ A;  3HFO A;  3A8L B;  3CPF A;  4B9X A;  3OYC A;  4E7J A;  4OP0 A;  5LJ5 h;  3CCR A;  3G6E T;  4QQD A;  3RER A;  4RKU E;  4A54 A;  3L2R A;  4QVC A;  4ME7 A;  3JSC A;  2E6Z A;  4E7L A;  3CCM T;  2ZPH B;  3OYN A;  3CC7 A;  3GPL A;  4PJO D;  3LW5 E;  4M75 A;  4PLL A;  3OYK A;  2JTF A;  1JJ2 S;  4J6W A;  2EJF A;  4C5I A;  3HPW A;  3G4S T;  4JS5 A;  5LJ5 d;  3UWN A;  3SFM A;  3M56 A;  1G3Y A;  1K8A U;  2EFI A;  3CEY A;  5CQX A;  3OYM A;  4M7D E;  4QVD A;  2LQK A;  1VQM A;  4KUL A;  4DOV A;  2C06 A;  1YJ9 A;  3QKJ A;  5FU7 C;  2F5K A;  4A4G A;  1VQ8 A;  4QW2 A;  2P0P A;  4RMO A;  3QYG B;  4C8Q B;  4V2S A;  1KHC A;  1N9R A;  4M75 C;  1OZ3 A;  2M0O A;  2LNV A;  3F70 A;  3CC4 A;  4EMK A;  4PJO F;  4NOY A;  2KK4 A;  4MZT A;  2X35 A;  5FU6 C;  4GY5 A;  5GAN h;  1VQN T;  3C94 A;  4PJO G;  2ZPE B;  3CPW A;  4C8Q F;  2P0K A;  1M1K C;  2L89 A;  2QI2 A;  5A2Q E;  1B34 B;  4M7A B;  3ZBD A;  2L3R A;  1O75 A;  5LJ3 f;  3HRT A;  3CCS T;  4C8Q G;  4FL6 A;  1VQK A;  1I4K 1;  2PUO B;  3P8B B;  4JUV A;  4BY6 C;  4DOW A;  4IKF A;  3S3M A;  4EMK C;  2K2V A;  3ASK A;  4LD6 A;  4M78 A;  3MO8 A;  4MDX A;  4OMF B;  4L5G A;  3LLR A;  4O6J A;  4OGC A;  4M77 B;  4PNO A;  4XTU A;  1BI0 A;  1OI1 A;  2XID A;  3LGL A;  4Y28 E;  3X24 B;  5GAN d;  1Q86 U;  1YBY A;  5IAY A;  4ZTF A;  4JRK A;  2LRQ A;  1W2B S;  4F7U B;  2Y4Y A;  5CCA A;  3M57 A;  3CCE T;  3RUX A;  3QII A;  4IUR A;  3JCM f;  3FDR A;  3C12 A;  3CME A;  3E9G A;  3H6Z A;  1KD1 C;  2MI6 A;  3INZ A;  2DXU A;  1VQ5 T;  1NE8 A;  4LDX A;  4TVR A;  1M1G A;  1VQ9 T;  2DD5 A;  4X9C A;  2VUB A;  3BY7 A;  4M78 C;  4XTX A;  2KSS A;  3TU4 K;  3UPU A;  3QPH A;  3JAM E;  3GP8 A;  3L2U A;  1YIJ T;  2QEX A;  2LT1 A;  2JOY A;  2WSC E;  2ZCF B;  3MP8 A;  3HSB A;  3G6E A;  1EIF A;  2V8K A;  4BI8 B;  2PUK B;  2LCL A;  4ZN1 A;  5GMK l;  1X75 C;  2RHI A;  1UB4 A;  2EWN A;  2K5I A;  4IUT A;  3RKW A;  2RHY A;  5LJ3 h;  5C0M A;  4BE2 A;  4E7K A;  1YCY A;  4J6Y A;  4ZGJ B;  5D6X A;  1K8A C;  1D3B B;  1I5L A;  5KH6 A;  5FRN A;  4MZP A;  2HQE A;  2K3X A;  2L8D A;  2QQA A;  4XTY A;  2DXT A;  4EMG A;  3CCR T;  2QA4 T;  3GOX A;  5CQY A;  1BI2 A;  2XHC A;  2DVE A;  1ZQ1 A;  4A4F A;  5DLO A;  2MAM A;  3UDC A;  2LDM A;  3OBY A;  1U1S A;  5LJ3 d;  4C92 F;  4BDY A;  3GIB A;  3JB9 H;  2ZZD A;  3OA6 A;  1PSE A;  4J8O A;  3A8O B;  2VXF A;  4C92 G;  3OS1 A;  2RK2 A;  4C0Z A;  2KDS A;  1QVF A;  3MCA B;  3G71 T;  4E7I A;  1Q7Y U;  1WPY A;  3OYH A;  2WAC A;  1VQN A;  3FRN A;  3JCM V;  4GLK A;  4N4I A;  5GAN 5;  2BUD A;  3M59 A;  4XK8 E;  2RJD A;  5GAO l;  3DB3 A;  4N0A A;  4M75 E;  1N8R U;  4J5Y A;  1IRE B;  2CYZ B;  3HP9 A;  2GCX A;  3OBW A;  3CCS A;  3PIO A;  4KUI A;  3QJY A;  2KAF A;  3ME9 A;  4M7D D;  2X4Y A;  2Y4X A;  5CO7 A;  2E1H A;  2LVM A;  2ZGW A;  2FYK A;  1XOV A;  3X25 B;  3DLM A;  1O9S A;  4MZM A;  3FJP A;  1QW1 A;  1NPR A;  4J7I A;  4M77 E;  2K5F A;  3RMQ A;  2RI3 A;  4N0A C;  3VU3 C;  5LJ5 j;  1XNI A;  1VQ5 A;  4BD3 A;  2QDY B;  5HK0 A;  3OYG A;  1G3S A;  2DAQ A;  4HT8 A;  4M7D F;  3TEE A;  3Q1J A;  2FL7 A;  2KMT A;  4Y91 A;  2ZPB B;  4A53 A;  2LCC A;  2RB6 A;  4HCB A;  4M7D G;  2R57 A;  4FU6 A;  3VV0 A;  2XG8 D;  1I8F A;  5GAN 7;  3CME T;  4CRI A;  3RKY A;  3J80 E;  5LJ5 e;  4P5N A;  1VIE A;  1LOJ A;  1JJ2 A;  2M9U A;  2RJF A;  3HRU A;  4XTZ A;  3PTA A;  3OMG A;  4RCC A;  3CBM A;  1KD1 U;  1MGQ A;  3CCL T;  3OW2 S;  3M4Y A;  2QEX T;  1M5Q 1;  2G3R A;  2EYQ A;  5CK9 A;  3CXC S;  2K3Y A;  2QA4 A;  3UT1 A;  4RCB A;  3QDR B;  3DB4 A;  2O01 E;  1XQH A;  3CCV A;  1QP3 A;  1U1T A;  2XDD A;  2D6F A;  4XAX B;  2RHX A;  1WQ7 A;  5J39 A;  5GAN j;  1M4Z A;  3VUZ A;  1Q7Y C;  2DJZ A;  1WGS A;  2M1H A;  3BDU A;  3JCM Q;  1LNX A;  3T9N A;  3HHT B;  4FM4 B;  3WXM B;  3CC2 T;  3O8V A;  1RL2 A;  3HFN A;  5GAM h;  3MEU A;  3E9F A;  1N9S A;  2CZ7 B;  1AHJ B;  2GFU A;  2YRV A;  3DKM A;  3QHS A;  3L2Q A;  3G71 A;  1N8R C;  5KE2 A;  2E64 A;  3SWN B;  1QP2 A;  5KCH A;  4PJO B;  2JVV A;  4ELZ C;  1SSF A;  2VYT A;  2XDP A;  4PLI A;  1FX7 A;  2RHZ A;  3NTH A;  1FWZ A;  4XU0 A;  2QQB A;  4XU1 A;  5GAN 8;  2ZPI B;  5GAN e;  3I55 A;  3JB9 J;  2ZPF B;  3FB9 A;  4M77 A;  2M16 A;  3VJP A;  2EQK A;  5LJ5 g;  5GAM d;  4EPC A;  2WSF E;  2R5A A;  2QQ9 A;  4F7U A;  1W2B A;  2B8A A;  3J7A F;  2PVO B;  3JB9 D;  4OB0 B;  3HKS A;  2DTO A;  3KBG A;  3X26 B;  1Q81 U;  4X9D A;  3MEV A;  4X34 A;  2L5Q A;  4N4H A;  5GAN 6;  5GAN 4;  4J7F A;  4LD9 K;  2LX9 A;  4XQ3 A;  3L2W A;  5IT9 E;  4M77 C;  4J6X A;  2RI2 A;  2MF2 A;  3HL8 A;  2A3L A;  4MDW A;  3X20 B;  4JRI A;  5LJ3 j;  4MML A;  4M75 D;  3JCM J;  3JCM W;  1PSF A;  2O4X B;  4HKE A;  3A8H B;  5FU7 B;  3JB9 F;  3GNG A;  1D3B A;  1UGS B;  3QYH B;  5CIU A;  5L8R E;  4C0G A;  2EQM A;  3M53 A;  2LT4 A;  5GAN g;  2E65 A;  3RKX A;  4XU2 A;  1X6O A;  1S72 A;  1FXX A;  3MEW A;  5GMK m;  4M77 D;  3V8J A;  3E1S A;  4HA8 A;  5LJ3 e;  1BI1 A;  3JB9 I;  1M90 C;  3CCL A;  4ZTJ A;  2NLU A;  1X01 A;  2EQU A;  3MP1 A;  4M75 F;  4JDS A;  5J26 A;  3JCM P;  2LC4 A;  3NTI A;  4IUP A;  4D6W A;  3CCJ T;  4R56 A;  3EAE A;  3MHX A;  4M75 G;  5LL6 S;  4EDU A;  4QQG A;  4BI4 A;  4OB2 B;  3FLG A;  4EMK B;  3OYL A;  3RIR A;  2HNI A;  3QUI A;  3PFS A;  3AHU A;  4C92 B;  1K9M U;  3CC2 A;  3QO3 A;  3BFM A;  3VYG A;  3OYE A;  3J81 E;  2DEQ A;  2RM4 A;  4M78 D;  3ZFJ A;  4J83 A;  2DZC A;  3CCV T;  3OYJ A;  2DD4 A;  1KQS S;  4A4E A;  3JCM h;  4C0D C;  3FC3 A;  2RJC A;  5FLX E;  4BDZ A;  1YJN A;  2P4T A;  5D6Y A;  3JCM c;  4L6V 5;  1P92 A;  2DIQ A;  4NS5 A;  2OAU A;  3SDZ A;  5A0L A;  4JLG A;  4BAC A;  1Q81 C;  2DK3 A;  3RES A;  2AHJ B;  3M9Q A;  4EMH A;  5GAO m;  1Q82 U;  4IUV A;  4C8Q E;  3N5B B;  2EQJ A;  5LJ3 g;  5A0G A;  4M78 F;  3JCM d;  3VUB A;  1WJR A;  3BW1 A;  3I55 T;  1WJQ A;  2H3J A;  2DPP B;  4M78 G;  1UGQ B;  2D9T A;  2FHD A;  2R5M A;  3E19 A;  4ATO A;  2V8J A;  1BIB A;  3OQ5 A;  3WVD B;  4FT4 A;  4M7A E;  3A8G B;  5GMK h;  4IUU A;  3QJ6 A;  4HT9 A;  4LDY A;  3OSS C;  3I56 T;  3L42 A;  3LX7 A;  4M7D B;  3PGG A;  4RG8 A;  1DJ7 B;  4DQ2 A;  2EKO A;  4F7U E;  1YIT T;  3H8Z A;  1NJI U;  3OW2 A;  3CBP A;  3V7C A;  3URG A;  1H64 1;  3CXC A;  4RG2 A;  3S6W A;  1W4S A;  1VQO T;  3G7Z A;  4KT0 E;  5AYF A;  5GAN 3;  3OYI A;  1VQ6 A;  2E6N A;  2GFA A;  2VXE A;  4ELY C;  1VQP A;  1VQ4 A;  1K9M C;  5GAM j;  2MWO A;  3CCJ A;  3EFR A;  4UC4 A;  5A0D A;  2RJE A;  1Y07 A;  4LDU A;  5LJ5 f;  4BE1 A;  1S72 T;  2RH2 A;  2X4X A;  3VKI A;  4LDW A;  3SWN A;  4PJO A;  3QXE B;  1N6A A;  2DZ9 A;  1Y96 B;  4E7H A;  1NZ9 A;  1U8R A;  2HQX A;  1WNL A;  4C92 E;  2CZ1 B;  2E10 A;  4C8Q A;  5GAM e;  2CZ6 B;  1JBM A;  1M90 U;  1KQ2 A;  2GF7 A;  4BB7 A;  3FIF A;  2KQW A;  4XTW A;  4JS4 A;  1QVG S;  3GLX A;  4ZN3 A;  1Q82 C;  2KY9 A;  2XDB A;  2V8I A;  1OYX A;  1VQ7 T;  2IG0 A;  4JRP A;  2GQV A;  4OGE A;  3C95 A;  3SWN C;  4PJO C;  3ER0 A;  4FT2 A;  1GXI E;  4OVA A;  2XU8 A;  3OMC A;  1UGP B;  1B34 A;  4M7A A;  3CCQ A;  2LTO A;  1VQP T;  4L59 A;  3CMA T;  4KBM B;  4C8Q C;  3CD6 A;  1JRI A;  1VQL T;  3OYF A;  2X4J A;  2XKO C;  3HRS A;  1M8V A;  1WQW A;  5GAN f;  5GAO r;  1YJN T;  2EAY A;  2VGN A;  5CVI A;  1MHN A;  3QBY A;  2WSE E;  3NFC A;  5IN1 A;  1IZ6 A;  2YHT A;  3SB2 A;  2OTJ A;  2MMP A;  2RK1 A;  4FIB A;  2O4X A;  2CKK A;  1QVP A;  2HBP A;  1VUB A;  1BI3 A;  2I2L A;  2K4Y A;  1UEB A;  3LYI A;  3MET A;  4BE0 A;  1G3T A;  1TH7 A;  1Y7X A;  5J3B A;  4BI3 A;  4XU3 A;  4M7A C;  1LJO A;  4MMK A;  1M9S A;  3P8D A;  5C6S A;  5DY9 A;  3I56 A;  1NJI C;  3A8M B;  4JLI A;  5I21 A;  3BDL A;  1YJW T;  3M55 A;  2F5T X;  3PMT A;  1KG1 A;  5CAI A;  4C8Q D;  5GAM g;  2A7Y A;  5KE3 A;  3QZ5 B;  2XI9 A;  4YTL A;  5FRO A;  2LQ8 A;  3OYB A;  1YIT A;  4O5V A;  2JUF A;  2DIG A;  4VUB A;  5EG2 A;  1YI2 T;  5GAO q;  1VQO A;  4OB3 B;  4KUD K;  2E70 A;  3V8L A;  4II1 A;  5CKD A;  3FEO A;  2E12 A;  3OYD A;  5HKC A;  3L2Z A;  3GF5 A;  3CCU T;  1YHQ T;  2JN0 A;  4B9W A;  4M7A D;  4C92 A;  2RHU A;  4M75 B;  5FRM A;  3JB9 G;  4R55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...