4C92C

Crystal structure of the yeast lsm1-7 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92C00
4XU3A 1D3BB 1BIAA 1HXDA 2EJGA 4EMKB 4HT8A 4C8QE 5GAOr 4XU0A 3SWNA 5GAMg 3M4GA 3EFRA 5CAIA 3V8KA 4C92B 1N9SA 3PGGA 4C92D 1B34B 2DXTA 4M78D 2E65A 4M78F 1U1TA 4M78A 4A53A 4M7AA 4M7AF 3RKXA 2YHTA 1I81A 2VXFA 3JCMc 5GMKh 4MMKA 2QTXA 3FJPA 3FB9A 5GANj 3QHSA 4JRIA 3RESA 4XTVA 3EFSA 1I8FA 3SWNC 3JCMe 5GANh 1MGQA 2ZGWA 1KQ2A 2E64A 2DZ9A 1WQWA 2YLBA 4C92G 4M78E 1M5Q1 4PJOE 4M75C 1U1SA 4M77C 3JCMP 4XTYA 2DKGA 2I2LA 5GAN3 1LJOA 1TH7A 4XQ3A 4XU1A 1JBMA 5GMKm 4XTXA 2HNIA 2E10A 1WQ7A 3RIRA 3BFMA 4J6WA 3JB9G 4XTUA 3V7CA 4F7UG 5GAN5 4RCBA 3JCMQ 3BY7A 3JCMW 2EWNA 3JB9I 4PJOA 3L2ZA 3RUXA 5GAMf 3RERA 4M7DE 3BW1A 4M7AC 4C92A 4J5YA 4PJOB 1I4K1 1JRIA 2Y90A 1B34A 4M78B 4C8QD 4C8QF 1I5LA 3HSBA 3SWNB 3JB9H 5GANe 2RA2A 4N0AA 2EJFA 3JCMg 4EMKC 1N9RA 2DVEA 2DXUA 4NOYA 5LJ3h 3SB2A 5GAOl 3JB9J 3AHUA 2DZCA 5GAN7 4M7DA 4M7DC 4M77A 4M75A 1Y96A 4C92F 4F7UA 4PJOG 4M78G 5GAOm 2DTHA 4M7DB 4OP0A 3QSUA 4EMHA 5LJ5e 1D3BA 5GMKi 4A54A 3JCMJ 3JB9F 5LJ5h 4HA8A 4C8QB 4XTZA 1H641 4NL3A 5LJ3g 5GAOq 3V7RA 4PJOC 4C8QC 5LJ3j 5GANf 4M7AB 4JLIA 4X9CA 4QVDA 4XU2A 5LJ5f 4X9DA 5GAMd 3V8LA 3GIBA 4M7DG 3QO3A 1M8VA 5GANd 5GANg 5GAOp 3INZA 2K57A 4C8QG 4NL2A 3QUIA 5DY9A 3JCMf 2E1HA 5GAN2 3L1AA 1BIBA 4J6YA 3HFOA 5GAMj 5GAN4 2VXEA 4PNOA 4WF2A 3JCMV 4M7AG 5LJ3d 4J6XA 4M75B 4M77B 4F7UF 5LJ5d 4M77D 2EAYA 2DTIA 4M75D 4M75F 4M77F 3HFNA 4C92E 4M7DF 4EMKA 5GAN8 2JN0A 3JCMb 3JCMh 4F7UE 4V2SA 2EJ9A 2VC8A 4N0AC 3JCMX 1LNXA 1X01A 4HT9A 2DTOA 4F7UB 4QVCA 5GMKe 1LOJA 4JRKA 4RCCA 4C8QA 5GAMe 2E41A 5GAOn 5GMKl 3RKWA 4M75G 4M77G 4M75E 4M77E 5LJ3f 4M78C 1WNLA 2DEQA 4MMLA 2YLCA 3V7SA 3VU3C 4Y91A 4C92C 5I21A 2FYKA 1WPYA 2RD1A 4PJOF 5LJ5j 4PJOD 5LJ5g 2RB6A 3JB9D 3V8JA 4DQ2A 4M7AD 1KQ1A 1YCYA 5GAMh 4XTWA 5GAN6 2CGHA 3FIFA 5LJ3e 4JUVA 3BDUA 3JCMd 5GMKj 1Y96B 1HK9A 4EMGA 4M7AE 2FB7A 2DJZA 4M7DD 3RKYA 2RM4A
chains in the Genus database with same CATH superfamily
4XU3A 1ZUKA 1VQ4Q 1YN8A 1NYGA 4BDYA 2E5QA 1VQ8Q 1NEBA 2YHTA 4QQDA 2OI3A 2DYBA 2GNCA 2MMPA 3QHSA 1K8AU 4XTVA 2MPXC 4E6RA 4PL6A 1RACB 2ZPFB 5A0LA 1N6AA 1IHVA 3TEEA 4XU1A 3I55T 3N5BB 2FVUA 1X69A 2V26A 4EIKA 1M90U 5GAMf 1FMKA 2K4YA 4M78B 4OGCA 4C8QF 4E47A 1WX6A 1AZEA 3OYJA 1YHQQ 1TXQA 1Y57A 4LDYA 2RI2A 2O9VA 2DEUA 4M7DA 4RTUA 2EFIA 2EQUA 4BUGA 4C0FA 2V1RA 5LJ5e 2YRVA 5IN1A 5LJ5h 3UWNA 1VQ9A 3FLGA 1AWOA 4ORZA 3LLRA 2CP3A 4NS5A 3V7RA 2MIOA 1IGUA 2A08A 4RTZA 5GJWB 4C0DB 2H3EB 1NM7A 3P8DA 3TREA 2C0TA 4E2FB 1IHWA 2LVMA 4NL2A 1K9MC 2I0NA 3G6EQ 3MHXA 4WF2A 1JU5C 4M7AG 3LYIA 1YNZA 1RLPC 4EMKA 1VQMA 1ABQA 2VASA 1PSEA 2JTFA 3OA6A 2KI7A 5M9OA 2DL3A 5GAOn 4OMFB 1M1FA 2GCXA 1XTDA 1VQPQ 4OB0B 2LQWA 2EIFA 3CD6A 5CK9A 3MEAA 3GBQA 2YT6A 2HDAA 2YWWA 2PVDB 1GCPA 2LC4A 1BIAA 1YI2Q 1M2VB 2DVJA 2VV5A 1X2QA 3CC7A 2KXCA 2CZ0B 5J26A 3X28B 3EGDA 2JZ2A 3TU4K 4M78F 1YBYA 3EGUA 1H3HA 1Q7YU 4IUTA 1Z9QA 1UJYA 2HCKA 5GANh 4BY6C 3VS1A 4PLIA 3I5RA 1C0MA 1OQKA 3OMCA 3MKDA 1Q86U 2R5AA 1QW1A 2C06A 5CKBA 1GXIE 3SFMA 3JB9G 5GAN5 2L3RA 3BY7A 4M7DE 3CCJT 5KCOA 2ROLA 1JRIA 3Q1JA 2HKQB 2V8IA 3JB9H 1KD1U 2LDMA 4N0AA 5HK0A 2YRCA 1VQ8T 1VQ5A 3U23A 3CCVA 1M3CA 4MZPA 3CD6T 3MJXA 1G3TA 3CCSA 4FYXB 2RI3A 4NL3A 1KD1C 1I0CA 5GANf 5I11A 3CCRT 3CXCP 3V8LA 1VIEA 2DL8A 2M1HA 3QYHB 3NFCA 1V76A 1MHNA 3M58A 1D0XA 1VQPA 4GBQA 1D09B 3G4SA 3META 1Z9ZA 3OYNA 2GFUA 4D6WA 5KYYB 5LJ5d 2DX1A 3CEYA 1QP3A 1BKBA 2D0NA 3VYHB 1B3QA 2LJ1A 1JEGA 2A7YA 1VQLT 1K8AC 4Y92A 4DBHA 1YP5A 2JTMA 2QDYB 2EYXA 1SPKA 5LJ5g 4IUPA 3PMTA 1JQQA 2RHZA 2GFAA 1HSQA 5GMKj 2MF2A 1HK9A 1U3OA 2JMCA 5D6WA 1MMDA 3JV3A 3MP6A 2ZPHB 1TU0B 5HCKA 2PTKA 3SD4A 3CCVT 3M4GA 1K73R 2XIDA 3M0UA 1M90C 2E12A 3JCMc 2PUOB 3J80E 2B8AA 2X35A 2GTJA 2D9TA 2J6OA 2DXCA 5EC7A 2OX7A 5CIUA 4DOWA 4KT0E 2DD4A 5GMKm 1EZZB 1UB4A 1UGSB 2K5FA 3O8VA 2E10A 4MDXA 4YTLA 2V1QA 1RAGB 4RCBA 2RH2A 2RO0A 2DYIA 2EGAA 2JS0A 5CKDA 2KBTA 4DA4A 3JCMg 1ZQ1A 2DVEA 1OOTA 4BDZA 1E6HA 1M4ZA 1QQJA 2FRYA 2ZAEA 4JJCA 2DA9A 2L3SA 4BE1A 3GPLA 1GFDA 1K0SA 1AEYA 1VUBA 2AZSA 3J7AF 1Y0MA 2D1XA 2DF6A 4DBQA 4IUVA 4XTZA 4E7KA 3CC2A 4MZMA 1TSFA 2LNVA 1BK2A 2F5KA 2IVWA 2JVVA 5GAN2 2RJEA 3URGA 2FZCB 3JCMV 2X4WA 3RMQA 4M77F 3RMSA 4ZTFA 2HAXA 1QLYA 2P0QA 3CQTA 3I56Q 4F7UB 2OTJQ 1SSHA 5FW9A 2LMJA 1OX8A 1W70A 2A37A 3L2VA 4J9BA 1AWWA 1NJIR 1WHLA 4J9EA 3GF5A 3M0SA 4OVAA 5CO7A 2DRKA 2P0KA 2LCSA 4JRPA 1VQKT 2CGHA 1Y96B 3DB4A 2DMOA 3CCRA 3RKYA 1RI0A 2NWMA 4EMKB 3SWNA 4ELZC 1N9SA 3PGGA 1K73U 1QCOA 1ZBXA 3EHQA 1RL2A 3J81E 4E7HA 1QVFS 4JRIA 4JZ3A 5I2SA 3NHNA 3ULRB 1ZA1B 4FYVB 1WXUA 1T3LA 2OAWA 2E6NA 2JNGA 4IIMA 4AFZC 5IXBA 3CC2Q 4M7AC 2LQ8A 2YUQA 3VUBA 3G4SQ 2KGTA 3OMGA 3EG9B 1VYUA 2CZ6B 4LDVA 2CH4A 1N27A 4ESRA 3AHUA 3OBWA 3GLXA 4OB2B 5CR2A 2DNUA 2Z0WA 3HP9A 3CCJA 4PK4A 2X4JA 3QDRB 3CCST 2K2MA 3E1SA 2CS7A 4AG1C 3I5SA 3WVDB 1YITT 4JLIA 1YCSB 1JJ2S 2EYZA 1MV3A 3A5ZB 4ZNXA 2DK3A 3VYGA 1PM3A 4N4IA 3DKMA 5FRNA 4MDWA 2C0IA 2BZ8A 1IB8A 1YITQ 2K2VA 5L8RE 3UA7A 3RKWA 3QWYA 2D0QB 4AMCA 2RB6A 2X4YA 3LW5E 1PKTA 1AWXA 3G6ET 3OYAA 3FIFA 1TG0A 2R5MA 3S3MA 4O5VA 5KYXA 2EJGA 4FYYB 1Q81R 3UATA 1SSFA 1RADB 2ECZA 1BBZA 5D6XA 4L6V5 2QQAA 3R6OA 1GCQC 4RUGA 2QXFA 3NMZC 2JUFA 5GANj 4B9WA 1VQPT 2AKLA 3G4ST 4JLGA 5FU7B 2VGMA 4JS4A 3PNWC 1KHCA 3HTRA 3C0CA 4N4GA 1B07A 1IREB 3CCQQ 4LDXA 4BI4A 1QKWA 3RIRA 5IHIA 3MP8A 3CC4A 2VVKA 1KSWA 1QWFA 2RK2A 4D8DA 1ZA2B 2O9SA 3TVTA 3FDRA 2P0PA 2BE7D 1KG1A 1S72Q 3L2QA 1OU9A 2O01E 4J9HA 3X24B 3M0QA 2G6FX 2MK5A 3ASKA 4C8QB 3JAME 1SRMA 4J7FA 2P4TA 1M3AA 1SEMA 3EGDB 2RF0A 1X27A 4X9DA 1YJ9Q 3NGPA 2NYSA 1MMAA 1V1CA 1RAEB 3NTIA 2NUZA 2K57A 1YIJT 3HFOA 4PNOA 2KRNA 3OQ5A 3GNGA 3HFNA 3H8ZA 3JCMb 3QZ5B 4QQ6A 2J6KA 1D0ZA 5J39A 2CT4A 4VUBA 3VS2A 4JJBA 1YHQA 3AT1B 3QYGB 2K9GA 3TCJA 4M77E 2XI9A 3HRTA 1WPYA 3H41A 4A4HA 1BCMA 2RPNA 1ZX6A 3LWHA 2WSFE 1M1KR 3ZL7C 2DAQA 3CBOA 2YUNA 1HXDA 2O4XA 3M5AA 5GAOr 5GAMg 4HCCA 1M27C 4HVVA 3EFRA 2DRMA 1NZ9A 2DXTA 3RKXA 4Q5WA 5A2QE 2Y4YA 4DOVA 2HL5C 1NE8A 2QYZA 1YJWT 3CMET 4ZGDB 3CCJQ 1W2BS 3CXCS 3OYIA 1M5Q1 1G83A 1U1SA 2LQKA 5GAN3 3UA6A 4FSXA 3OYLA 2HNIA 5IT9E 1B7TA 1GBQA 4J6WA 1T0JA 1VQOA 1VQ9T 2X51A 4PFZA 3CD6Q 4J5YA 4M4ZA 2DL4A 3HKSA 5J3BA 1G3YA 1YJ9T 1W2BP 1VQ6A 2PZ1A 4A4KA 1YIJQ 3P8HA 4PJOG 1WA7A 3M54A 3ER0A 1ZHIA 2LP5A 1RI9A 1WHJA 1LPLA 3QJYA 2DD5A 1QKXA 2YDLA 3CCET 1M3BA 2FHDA 3NTHA 2FPFA 3VUZA 3C95A 4AG2C 2MI6A 4FIBA 1VQNT 2E6ZA 2DXBA 4LDWA 3CPWA 3OYFA 2IPOB 3CC4T 2WACA 5CVIA 1K9MU 4OMLA 4V2SA 1AWJA 1C1AA 2ABLA 1UFFA 5D7UA 1EX4A 4C8QA 3FRNA 2E41A 3OYEA 2DE0X 4LUEA 1JJ2A 3REAB 1UDLA 3QXEB 2LT4A 1JXOA 3JCMd 3VRZA 2XU8A 1MNDA 4BY6B 3TSWA 2XICA 1KK7A 3OSSC 5EG2A 4RTYA 4C8QE 1CSKA 1PD0A 4PFPA 1YJNQ 4LD9K 1M90R 1S72A 2RHXA 4A53A 1P92A 1VQOQ 1I81A 4RTXA 1AZGB 4JS5A 1M2VA 4E7JA 1TUGB 1VQKQ 3CPWS 1W6XA 4M77C 3QKJA 3CCQA 1VQLQ 1D1CA 4ME7A 4J9DA 2DIGA 1WHMA 1TH7A 4FT2A 4J83A 4XQ3A 1VQNA 3QJ6A 1X6BA 3MO8A 3JSCA 3OYDA 3CMAQ 1BI3A 2O31A 4FYWB 1VQMQ 1A0NB 4B6MA 4Z88A 1FMWA 1M8MA 1VQ7A 5IXFA 3MCAB 1N8RC 2EBPA 2HEQA 4A4EA 2SRCA 2JT4A 3QSUA 4LDUA 1NBEB 1DJ7B 5DLQE 5FWBA 3WXMB 2ZPGB 1NLPC 2NLUA 3H0FA 3BDLA 5GAOp 4R55A 3CC7Q 1U8RA 1UG1A 1RLQC 4LXCA 5IH2A 2QQBA 4C5GA 2OTLQ 4E7SA 4A4GA 1ARKA 2FZKB 4HKEA 4DEYA 2PVOB 2EAYA 4C92E 1RAHB 2JN0A 2VC8A 3EG1A 2DTOA 2G3RA 1VQ4A 4BB7A 3G7ZA 4M75G 4HXJA 1Q82C 1RUWA 4MMLA 3CCMA 1WXBA 2JM8A 1KIKA 2LJ0A 1LVKA 2QQSA 1X75C 3CCEA 1M1KU 2K3YA 4JUVA 4J9FA 2M51A 3OYGA 1FX7A 4M7AE 1UE9A 2CP5A 2LJ3A 1VQLA 4AT1B 1MNEA 5KYUB 4F14A 3PTAA 4WTOB 1PD1A 2K3XA 3S3OA 2GTOA 1R8OB 3KXTA 2VXFA 2QTXA 3FJPA 2CP2A 3FB9A 2AT1B 4R0KA 1ZBJA 3CXCA 2BE9B 3JCMe 3A1PA 2YLBA 1U5SA 2QA4T 2ESWA 2XDPA 3JCMP 2OTJT 4CC4B 1VYTA 3FEOA 4KUDK 4IIOA 4KGVB 1WQ7A 1OPKA 4RMOA 4F7UG 1KFZA 1FWZA 2HZYA 1QVGP 2FO0A 2CSQA 2PNIA 4OMPA 4EPCA 4ZTJA 4Z89A 1GRIA 1VQ6T 4FM4B 5LJ3h 3EH1A 2EKOA 3PVQA 2QTVA 3G6EA 1K9AA 1R77A 2HQEA 5HK3A 1J3TA 4RTVA 5IHKA 2RJFA 2DJQA 3E2UA 1NEGA 4M7AB 2J6FA 2KQWA 1NJIU 1BI1A 4ELYC 3CCMQ 3GNFB 1FMVA 1V29B 2AK5A 2RQRA 1Y07A 4XK8E 2XMFA 2EVRA 2RHUA 5LJ3d 4BI8B 1KJWA 1H92A 3CBMA 4OGEA 3JRZA 1VYVA 1LNXA 1X01A 4HT9A 2LQNA 3M57A 4IUQA 2HL3A 3OW2P 2SEMA 4ZN1A 5FWCA 1ZSZC 2GQVA 4M75E 1GCQA 2YLCA 4PJOD 2FYKA 2RD1A 4KGXB 1XJWB 3HHTB 1OYXA 1VQNQ 3MPUB 4CC7A 2RJDA 2LCLA 2FB7A 1UECA 2YSQA 4QT7A 1YI2T 2RM4A 2HD0A 1VQ8A 2DBMA 1XOVA 4AFQC 1VQ7Q 4C92D 2EQIA 2KE9A 1MV0B 4M78A 2CREA 4JJNK 4M7AF 2GQIA 3RR6A 2ZPEB 8ATCB 1KQ2A 1U06A 1MGQA 4C92G 1D1AA 3M55A 2CP7A 2VB6A 5KYYA 1M1KC 2K3BA 2LX7A 2ZPBB 4OB3B 3BFMA 3OYHA 3ZFJA 1YWPA 1HYOA 2DIQA 4CC3A 3L2ZA 3RUXA 3CCSQ 2O4XB 3A98A 2DFUA 2E70A 3SEMA 1TWBA 2A3LA 3EHRA 3SWNB 5GANe 1UGRB 1X43A 4GLMA 2YUPA 1MMGA 1QVFA 1WJRA 2FZGB 4C5IA 4A54A 2QQ9A 4R56A 1H641 5HY6A 4C8QC 3I35A 1UGPB 4C5EA 4M7DG 2LX9A 2KRSA 1MUZA 3IQLA 1IXDA 4OMNA 3VS3A 2RJCA 5GAN4 4J6YA 3MEVA 3EGXB 3LGFA 1K0XA 1ZUYA 4M7DF 2FRWA 1AVZC 4Z8AA 4OMMA 2BZXA 2K79A 1LOJA 2VUBA 3JB9J 3VU3C 4X34A 1QWEA 1RAFB 2CZ1B 3UPUA 4CRIA 3M59A 5LJ3e 3VS0A 1GL5A 1YJ9A 3R6NA 2ZZDA 1HJDA 2DJZA 3PT9A 1VIFA 1BI0A 5FRMA 1SHFA 1ABOA 3VV0A 2ZPIB 1Q7YC 4UC4A 1B34B 1BCOA 3G71A 1VA7A 2CUDA 3RBBB 5I2MA 1RABB 2JJ9A 4JZ4A 2L3PA 1UHFA 3CCLT 1WGSA 1PCXA 4K11A 4M78E 4M75C 1UGVA 1Y7XA 1LJOA 1WZOA 3UT1A 2KSSA 1PWTA 2W0ZA 4PJOA 2CP6A 2EWNA 5FU6B 3RERA 3BW1A 4PFOA 4BI3A 1UTIA 2Y90A 2CUBA 4A4FA 3QG1A 1QCFA 3CPWP 1WHHA 3E9GA 3SB2A 4O6JA 5AT1B 2LZ6B 3A8LB 4M75A 2X3XD 1O9SA 4C0GA 4M78G 2HSPA 5GAOm 4OP0A 4EMHA 4PJJA 2WSCE 2RI5A 1IRXA 1HD3A 2AHJB 2YXYA 2Y4XA 1TS9A 3OB9A 2F69A 5C6SA 1F1BB 2FEIA 2M16A 5GANd 2ENMA 2EYWA 4A63B 4C0DC 3OYCA 2QA4A 2ZCFB 2BUDA 2EGEA 3S6WA 5A0DA 3OS0A 3I9QA 1CKAA 1EFNA 1WJQA 1W2BA 4J6XA 4F7UF 3OYBA 2RQTA 4HVWA 3PE0A 2PVGB 4ANJA 4C92F 4M77G 1Q95G 2F2WA 1WI7A 3RNJA 4F16A 4ATOA 2KRMA 3JB9D 1KQ1A 2ED1A 2KDSA 2XK0A 3BDUA 1G3WA 3NPFA 1K9MR 3HL8A 2DLPA 4KH0B 1YWOA 1IGQA 1WDXA 2F2XA 4E7LA 5GMKh 2XDBA 2MAMA 2NUPA 1OULA 4QVZA 1XQHA 5C0MA 2EYYA 3RESA 2CZ7B 2A36A 2DZ9A 1JJ2P 4LN2A 4LUDA 2I2LA 5KYWA 4XAXB 4N4HA 1BB9A 3QBYA 3MEWA 1WYXA 2EQMA 5ECAA 3JCMW 2D8HA 1QVGS 1NJIC 2L2PA 1ZUUA 5KH6A 1JXMA 3HSBA 1KQSS 2RA2A 2V8JA 1YFNA 1AHJB 1VQ7T 2LCCA 3CC7T 2DL5A 2MYSA 4HA8A 2IIMA 4PJOC 1S1NA 2KYMA 4QVDA 3OYYA 3DB3A 1TOVA 4OMOA 1AOJA 3QUIA 1QVPA 2CKKA 1UEBA 2E1HA 1ACMB 1PSFA 3OY9A 3A8OB 3VS7A 4M77B 2FPEA 2QK0A 2DTIA 1G5VA 4F7UE 1G2BA 2AZVA 2OTJA 2EJ9A 2K5IA 1AT1B 3M0TA 3X25B 3H6ZA 2VYTA 5LJ3f 2PQWA 3L2WA 2HSEB 2KXDA 3I55Q 3VS5A 4MZTA 2HKNA 4LD6A 2L8DA 2H3JA 2JTEA 2GF7A 2YRDA 3CCRQ 1EIFA 4OMQA 5I22A 3G71Q 1ZSGA 2EYQA 2OTLT 1GFCA 2HBWA 3H9NA 4MMKA 3CC4Q 4BACA 4HCZA 3EH2A 1Q82R 4D8KA 1GBRA 1I8FA 5CKFA 1BI2A 2M9UA 5CKEA 5DM7R 2ED0A 3GP8A 4XTYA 5A0GA 2E3HA 2QDLA 1PKSA 3VRYA 3M0RA 5FU6C 1OI1A 2HMAA 1NYFA 4C8QD 3QIIA 2RQWA 3KFVA 1N5ZA 3REBB 2KK4A 2NUTB 3VS6A 4CC2A 1NG2A 4M7DC 2QEXQ 1YJNT 4KRTA 1Y96A 3CCUQ 2HQXA 4IUUA 4DEXA 3F70A 1D3BA 4FSSA 4HVUA 2M0OA 3OBYA 4P5NA 1N8RR 1UJ0A 2K5LA 2RHYA 2F2VA 5GAOq 1QP2A 1IO6A 2HBPA 3OS2A 4XU2A 4Z02A 1VQ4T 1KQSA 2CP0A 1M8VA 4LE9A 3M4YA 1QVFP 4B9XA 3I55A 2QEXT 4J9IA 4PJNA 5IHNA 5DY9A 4L5GA 1BIBA 2QGFB 2M0YA 3E9FA 2LTOA 2QQRA 2FG0A 2A28A 3JCMh 3H0IA 2DM1A 2IG0A 4N0AC 1O75A 2JW4A 2XHCA 3GOXA 5GMKe 4RCCA 4EDUA 2EPDA 1R0BG 3V7SA 4F04B 4M78C 4PKCC 4C92C 4Y91A 1BU1A 4F17A 2L3QA 3EG9A 3PIPA 4DQ2A 4E7ZA 5GAN6 2V8KA 3RDVA 2D6FA 4ZGJB 2RMOA 4M7DD 3I56A 3M9QA 3E19A 3EFOB 2PUKB 4XU0A 2QI2A 4KBMB 5LL6S 1WHGA 2J05A 2GBQA 3V8KA 3HPWA 5D6YA 1K76A 1KC8C 3CPFA 6AT1B 1YJWQ 2O88A 3PFSA 3OW2S 4RG8A 3M0PA 2ZGWA 5L23A 1VQ9Q 2RNAA 2DO3A 1Q81U 1I1JA 1WFWA 3S3NA 2QEXA 1JBMA 3MEUA 2P84A 4XTUA 3OS1A 1OEBA 3JB9I 2KY9A 2L0AA 2ROTA 4C92A 1FXXA 4PJOB 4J9GA 1B34A 2K6DA 3EG2A 1N9RA 2DXUA 2C0OA 4QQGA 4GLKA 4QW2A 5GJVB 5KE3A 5CKHA 4M77A 1SRLA 2EKHA 4RTWA 1X6GA 4J9CA 5HKCA 2KT8A 5GMKi 3C12A 3VKIA 4JPBW 4RKUE 4JDSA 1SKUB 1Q82U 4X9CA 4L59A 1CKBA 3OW2A 3QO3A 4BE2A 4FCYA 1ZSZB 3ME9A 3UDCA 3PVLA 4FL6A 3INZA 1R0CB 3DLMA 9ATCB 1VQOT 2R58A 2DILA 5GAMj 1BYMA 8AT1B 4FT4A 3CMEQ 4CI0C 1I5OB 4M77D 3KUFA 5KYUA 3M56A 2QAZA 2KAFA 4JRKA 1AD5A 1D0YA 2F1LA 2DETA 1YJNA 3SHWA 4LNPA 4PJOF 1PG5B 1UUEA 2O2OA 5GAMh 3KBGA 2COWA 4JRQA 1X6OA 1N8RU 3X20B 2RQVA 1YITA 1OU8A 2COZA 5KYNA 3V8JA 4EMKC 1H8KA 2FL7A 3VJPA 3BE3A 3CMAA 2J06A 4M78D 4KULA 5AYFA 1VQ5Q 3C4SA 3CCUA 2VKNA 3SWNC 2KYBA 1M9SA 3OYKA 1WQWA 3MP1A 2MCNA 4HCKA 3QZ9B 4AFSC 2RK1A 4JJDA 1WJSA 4J7IA 3NTKA 1QCNA 3V7CA 3HRUA 3JCMQ 4KUIA 1ZSZA 2HQHA 5FROA 1RAAB 2PU9B 1VQ6Q 1TUDA 1OX9A 2EJFA 2W10A 4NOYA 2KROA 5GAN7 1S72T 3A8MB 4BD3A 2DTHA 4RG2A 3JB9F 2WSEE 1JO8A 2CYZB 4FW1A 1OZ3A 3LWIA 2RN8A 2L89A 1G8XA 5LJ3j 2E4HA 2J7IA 4X1VA 1NLOC 5GANg 2OJ2A 4C8QG 3TSZA 3JCMf 1C6VX 1G3SA 3TQ7P 2X3WD 2B86A 4M75B 4C5HA 2XD0A 5IAYA 5GAN8 1NPPA 1YJWA 5KCHA 3CCLA 1NPRA 1SF9A 3O5ZA 1QMCA 2XKOC 2CDTA 1VQ5T 1WXTA 1YCYA 3EFOA 4XTWA 2EQKA 2CT3A 1Q86C 4C0ZA 1IZ6A 4EMGA 4DBRA 3I56T 1PRMC 1Q81C 2LNHB 2FPDA 4PJLA 1D3BB 2DBKA 1SG5A 2QA4Q 5CAIA 3H0HA 4M7AA 2LRQA 1U1TA 1TUCA 4DBFA 1KC8U 4KGZB 1PRLC 2E3IA 3QDFA 1VQKA 3EFSA 2JXBA 2E64A 4II1A 1UHCA 5FLXE 3EAEA 3ZBDA 4PJOE 2VWFA 5DLOA 2MWOA 3CCMT 2QASA 1WIEA 2BTTA 5KYXB 1X2KA 1OPLA 3FC3A 3G71T 2R57A 4RTTA 3G1JA 2VGNA 4OF1A 1WLPB 1I4K1 3LX7A 3CMEA 2CH4W 2KEAA 1PNJA 1SHGA 3LGLA 7AT1B 2KNBB 2QG9B 4PJMA 5GAOl 2DZCA 5CCAA 4J8OA 3OYMA 2DPPB 1T0HA 1KHIA 2JS2A 2AKKA 3CC2T 2BZYA 2NUTA 1KC8R 1I07A 3QWXX 2RHIA 5CQYA 3CCLQ 5GAMd 5LJ5f 3A8GB 1VOMA 3PMIA 1M2OA 2X4XA 2YUOA 1T3SA 3A8HB 1D1BA 2KT1A 3QPHA 3L2UA 2RQUA 2XG8D 4E7IA 2KR3A 2MWPA 2KVQG 2ATCB 3D7SB 1VQMT 2BKDN 3EG0A 4QVCA 2M02A 3OS5A 1WNLA 2DEQA 3CCQT 4TVRA 1QVGA 1K73C 3L42A 5KE2A 2LT1A 1Y71A 3FJ5A 3SDZA 1K1ZA 2K7AA 3CCEQ 4FW2A 1E6GA 4ZGEB 4PLLA 4HT8A 2L5QA 2KMTA 2JM9A 4WCIA 3HRSA 4QKUA 4Y28E 4C92B 2XDDA 1LCKA 2E65A 4M7AD 3M53A 3THKA 1Q7YR 1K8AR 2DERA 2DL7A 2A0FB 5FU7C 2JOYA 1WHKA 1XNIA 3EG3A 2E5KA 2DKGA 2H8HA 1FYNA 1Q86R 2OAUA 3L2RA 4FU6A 4XTXA 5KYWB 1KQSP 3CCUT 4IURA 4BE0A 4ZN3A 3VS4A 1PHTA 1YI2A 2MOXA 1KD1R 3LH5A 1I5LA 2EQJA 3DLLA 2F5TX 4IKFA 4KH1B 2NUPB 1UGQB 4GY5A 4AFUC 3WVEB 3X26B 4F7UA 1OZ2A 3UF4A 4HCBA 4M7DB 2GGRA 1K4US 3JCMJ 3C94A 2QGGA 2BIVA 2P4RA 3ZEHA 5LJ3g 1RAIB 2EGCA 3P8BB 3GIBA 1YHQT 2X9HA 2EW3A 1W1FA 1M30A 3L1AA 4OB1B 2VXEA 3T9NA 3LH0A 2CSIA 3CMAT 1M1GA 4M75D 4M75F 3EGXA 1W4SA 3JCMX 2D8JA 1PC0A 3CCVQ 3CBPA 5CQXA 5GAMe 2COYA 5GMKl 1H3ZA 5LJ5j 5I21A 1YIJA 1ZLMA 1JB0E 2OTLA 2JMAA 3OSVA 1E7OA 2AIRB 3PIOA 1OV3A 1MMNA 1TTHB
chains in the Genus database with same CATH topology
4XU3A 2EJGA 3M9QA 1SSFA 3E19A 2PUKB 4XU0A 2QI2A 1VQ8A 4BDYA 1XOVA 4KBMB 5D6XA 5LL6S 4L6V5 2QQAA 3R6OA 2E5QA 3V8KA 3HPWA 4C92D 5D6YA 4M78A 4JJNK 1KC8C 4M7AF 2YHTA 2QXFA 4QQDA 3CPFA 2JUFA 5GANj 4B9WA 1VQPT 3PFSA 3OW2S 2MMPA 3QHSA 2ZPEB 1K8AU 3G4ST 4XTVA 4RG8A 1KQ2A 4JLGA 1MGQA 2ZGWA 5FU7B 2VGMA 4JS4A 4PL6A 4C92G 3PNWC 1KHCA 2DO3A 3M55A 2ZPFB 4N4GA 1Q81U 5A0LA 1IREB 1N6AA 3S3NA 2QEXA 1M1KC 3TEEA 4XU1A 3I55T 1JBMA 4LDXA 4BI4A 2ZPBB 3MEUA 3N5BB 4OB3B 3RIRA 3BFMA 2FVUA 3OYHA 4XTUA 3OS1A 3ZFJA 1M90U 3JB9I 2DIQA 2KY9A 3MP8A 3L2ZA 3RUXA 5GAMf 3CC4A 2O4XB 2RK2A 4C92A 1FXXA 2K4YA 4PJOB 4M78B 2E70A 1B34A 4OGCA 4C8QF 4E47A 2A3LA 3SWNB 5GANe 1UGRB 3FDRA 2P0PA 3OYJA 1N9RA 2DXUA 1KG1A 4LDYA 2RI2A 1QVFA 4QQGA 4GLKA 4QW2A 5KE3A 4M7DA 5CKHA 2EFIA 3L2QA 4M77A 2O01E 2EQUA 4BUGA 3X24B 4C0FA 1WJRA 5HKCA 5LJ5e 5GMKi 4C5IA 4A54A 2YRVA 3ASKA 5IN1A 3UWNA 2QQ9A 3FLGA 5LJ5h 1VQ9A 3C12A 4C8QB 3VKIA 4R56A 1H641 3LLRA 5HY6A 3JAME 4J7FA 4RKUE 2P4TA 4JDSA 4NS5A 3V7RA 4C8QC 1Q82U 1UGPB 4X9CA 4L59A 4C5EA 4X9DA 4M7DG 2LX9A 3OW2A 3QO3A 4BE2A 4C0DB 3ME9A 3UDCA 3P8DA 3TREA 3NTIA 4FL6A 3INZA 2K57A 3DLMA 2LVMA 4NL2A 1YIJT 1K9MC 2RJCA 1VQOT 2R58A 5GAN4 4J6YA 3MEVA 3HFOA 3MHXA 5GAMj 1BYMA 4PNOA 4WF2A 4M7AG 4FT4A 3LYIA 3LGFA 4CI0C 3OQ5A 3GNGA 4M77D 3KUFA 3HFNA 3H8ZA 4M7DF 4EMKA 1VQMA 3JCMb 3M56A 3QZ5B 4QQ6A 1PSEA 2KAFA 2JTFA 3OA6A 5J39A 5M9OA 4VUBA 1YHQA 1LOJA 4JRKA 3QYGB 2VUBA 3TCJA 4OMFB 5GAOn 3JB9J 4M77E 1YJNA 2XI9A 3HRTA 1M1FA 3VU3C 2GCXA 4X34A 1WPYA 4PJOF 4A4HA 1XTDA 2CZ1B 4OB0B 5GAMh 3UPUA 3KBGA 2EIFA 3LWHA 2WSFE 4CRIA 4JRQA 3CD6A 3M59A 5LJ3e 5CK9A 1YJ9A 2ZZDA 3MEAA 1X6OA 1N8RU 3X20B 2DAQA 2DJZA 2PVDB 3CBOA 1YITA 3PT9A 2LC4A 3V8JA 1VIFA 4EMKC 1BI0A 1BIAA 1HXDA 2FL7A 2O4XA 3VJPA 3M5AA 5GAOr 2VV5A 5FRMA 5GAMg 4HCCA 3CC7A 3EFRA 3VV0A 2ZPIB 2CZ0B 1Q7YC 4UC4A 1NZ9A 5J26A 3CMAA 1B34B 2DXTA 2JZ2A 4KULA 4M78D 4M78F 5AYFA 3X28B 3G71A 3TU4K 1YBYA 5I2MA 4Q5WA 3RKXA 5A2QE 2Y4YA 4DOVA 1Q7YU 1NE8A 3C4SA 4IUTA 3CCUA 1YJWT 3CMET 4ZGDB 5GANh 3SWNC 4BY6C 1M9SA 4PLIA 3OYKA 3CXCS 1WGSA 1WQWA 3CCLT 3MP1A 1W2BS 3OYIA 4M78E 1M5Q1 3OMCA 1U1SA 4M75C 1Y7XA 2LQKA 1Q86U 2R5AA 5GAN3 1QW1A 1LJOA 3QZ9B 2C06A 5CKBA 3UT1A 2KSSA 1GXIE 2RK1A 4FSXA 1WJSA 2HNIA 4J7IA 3NTKA 3SFMA 3OYLA 5IT9E 3JB9G 4J6WA 3V7CA 1VQOA 5GAN5 3HRUA 2L3RA 3BY7A 2EWNA 4KUIA 5FU6B 3JCMQ 1VQ9T 4M7DE 4PJOA 3RERA 3BW1A 3CCJT 4J5YA 5FROA 4BI3A 2Y90A 1JRIA 3Q1JA 3HKSA 5KCOA 2V8IA 3JB9H 2PU9B 4A4FA 1KD1U 2LDMA 3QG1A 2EJFA 4N0AA 5J3BA 1G3YA 5HK0A 1YJ9T 4NOYA 3E9GA 1VQ6A 3SB2A 4A4KA 4O6JA 5GAN7 1S72T 1VQ8T 3A8LB 4M75A 1VQ5A 1O9SA 3P8HA 4C0GA 3A8MB 3CCVA 4PJOG 4BD3A 3M54A 4M78G 2DTHA 5GAOm 4OP0A 3ER0A 1ZHIA 4RG2A 4EMHA 2WSCE 2RI5A 4MZPA 3CD6T 3JB9F 2WSEE 2DD5A 3QJYA 1G3TA 2CYZB 1OZ3A 3LWIA 2AHJB 2Y4XA 3CCET 2L89A 3CCSA 3OB9A 2F69A 2RI3A 4NL3A 5C6SA 1KD1C 5LJ3j 2FHDA 5GANf 3CCRT 3NTHA 2M16A 3V8LA 1VIEA 5GANd 5GANg 2M1HA 3VUZA 3C95A 3QYHB 3OYCA 4C0DC 2QA4A 2ZCFB 2MI6A 3NFCA 2BUDA 1MHNA 3M58A 4C8QG 4FIBA 3S6WA 5A0DA 3JCMf 1VQPA 1VQNT 2E6ZA 1G3SA 2DXBA 3OS0A 4LDWA 3META 3G4SA 1WJQA 3OYNA 3CPWA 2GFUA 4J6XA 4M75B 4D6WA 4F7UF 5LJ5d 3OYFA 3CC4T 4C5HA 1W2BA 3CEYA 2XD0A 1QP3A 2WACA 1BKBA 2HD0A 5CVIA 5IAYA 5GAN8 1K9MU 3VYHB 3OYBA 4V2SA 1NPPA 2A7YA 1YJWA 5KCHA 3CCLA 1VQLT 1K8AC 2PVGB 4C8QA 2JTMA 1NPRA 3FRNA 2E41A 2QDYB 3OYEA 4C92F 4M77G 5LJ5g 1JJ2A 4ATOA 2XKOC 3JB9D 1VQ5T 3QXEB 1KQ1A 1YCYA 4IUPA 4XTWA 3PMTA 2RHZA 2LT4A 2EQKA 2GFAA 2KDSA 3JCMd 2XK0A 3BDUA 4C0ZA 4BY6B 2XU8A 1IZ6A 5GMKj 1Q86C 1G3WA 2MF2A 1HK9A 4EMGA 3HL8A 3I56T 5D6WA 1Q81C 1D3BB 2XICA 3MP6A 2ZPHB 3OSSC 5EG2A 4C8QE 3SD4A 3CCVT 3M4GA 5CAIA 4LD9K 1S72A 2RHXA 2XIDA 4A53A 4M7AA 2LRQA 1P92A 1U1TA 1KC8U 4E7LA 2E12A 1I81A 5GMKh 2MAMA 3JCMc 1M90C 2PUOB 2XDBA 3J80E 4QVZA 1VQKA 4JS5A 1XQHA 5C0MA 4E7JA 3RESA 2B8AA 2X35A 3EFSA 2CZ7B 2E64A 3CPWS 4II1A 5FLXE 2DZ9A 2D9TA 3EAEA 3ZBDA 4PJOE 4M77C 2DXCA 3QKJA 2MWOA 5DLOA 3CCMT 3CCQA 4ME7A 2I2LA 5CIUA 2DIGA 4DOWA 4KT0E 1TH7A 2DD4A 4FT2A 4J83A 4XAXB 4XQ3A 5GMKm 1UGSB 1UB4A 2K5FA 3O8VA 3QJ6A 2E10A 4N4HA 3QBYA 1VQNA 4MDXA 3MEWA 3MO8A 4YTLA 3JSCA 3OYDA 3FC3A 2EQMA 3G71T 1BI3A 4RCBA 2R57A 2RH2A 3JCMW 2RO0A 1QVGS 1NJIC 2VGNA 4OF1A 5CKDA 5KH6A 1I4K1 3LX7A 3HSBA 3CMEA 1KQSS 4DA4A 2RA2A 3JCMg 1ZQ1A 3LGLA 2DVEA 1VQ7A 4BDZA 5GAOl 2V8JA 1AHJB 2DZCA 3MCAB 5CCAA 1VQ7T 4J8OA 1M4ZA 1N8RC 3OYMA 4A4EA 2LCCA 3CC7T 2DPPB 4BE1A 3GPLA 3QSUA 4LDUA 1KHIA 1VUBA 3J7AF 3CC2T 4HA8A 4IUVA 4XTZA 1DJ7B 4E7KA 3CC2A 4MZMA 5DLQE 3WXMB 2RHIA 4PJOC 2ZPGB 5CQYA 4QVDA 2NLUA 5LJ5f 3A8GB 3PMIA 3BDLA 3DB3A 2LNVA 3OYYA 5GAMd 2X4XA 5GAOp 2F5KA 2IVWA 4R55A 3A8HB 1U8RA 2JVVA 2QQBA 3QPHA 3QUIA 4C5GA 1QVPA 2CKKA 3L2UA 1UEBA 2E1HA 5GAN2 2XG8D 1PSFA 2RJEA 3URGA 4E7IA 2MWPA 3JCMV 4A4GA 3OY9A 2KVQG 2X4WA 3A8OB 3RMQA 4HKEA 4M77B 2PVOB 2EAYA 2DTIA 4M77F 4C92E 1G5VA 2JN0A 3RMSA 4F7UE 4ZTFA 2HAXA 2P0QA 2VC8A 2EJ9A 1VQMT 2OTJA 2K5IA 2BKDN 3X25B 2DTOA 2G3RA 4F7UB 3H6ZA 4QVCA 1VQ4A 2VYTA 4BB7A 3G7ZA 3OS5A 2PQWA 4M75G 5LJ3f 3L2VA 1WNLA 2DEQA 4MMLA 4TVRA 3L2WA 3CCQT 3CCMA 1QVGA 4MZTA 1K73C 3L42A 3GF5A 5KE2A 2LT1A 4OVAA 1Y71A 5CO7A 2P0KA 1Q82C 4LD6A 3SDZA 2QQSA 1X75C 4JRPA 3CCEA 1M1KU 1VQKT 2CGHA 2K3YA 4JUVA 1Y96B 3OYGA 3DB4A 1FX7A 3CCRA 4M7AE 2L8DA 2H3JA 2GF7A 3RKYA 4ZGEB 1VQLA 1RI0A 4PLLA 4HT8A 4EMKB 1EIFA 2KMTA 2L5QA 3HRSA 3PTAA 2K3XA 3SWNA 4ELZC 4Y28E 3S3OA 4C92B 2XDDA 1N9SA 2EYQA 3PGGA 1K73U 2OTLT 2E65A 1R8OB 4M7AD 3M53A 3KXTA 2VXFA 1ZBXA 4MMKA 2QTXA 3FJPA 1RL2A 3FB9A 4BACA 4HCZA 3J81E 4E7HA 1QVFS 4JRIA 3CXCA 1I8FA 5CKFA 3JCMe 5I2SA 1BI2A 2M9UA 5FU7C 2YLBA 2JOYA 5CKEA 5DM7R 2QA4T 2XDPA 3GP8A 3JCMP 1XNIA 2OTJT 4XTYA 5A0GA 2DKGA 3FEOA 4KUDK 2OAUA 3L2RA 4FU6A 4XTXA 1WQ7A 2E6NA 2JNGA 4RMOA 3CCUT 4IURA 4F7UG 1FWZA 1OI1A 5FU6C 4BE0A 4ZN3A 4M7AC 2LQ8A 1YI2A 4C8QD 3VUBA 4EPCA 4ZTJA 1I5LA 2EQJA 3OMGA 3DLLA 2F5TX 3QIIA 4IKFA 1VQ6T 2KK4A 4FM4B 2CZ6B 4LDVA 5LJ3h 1N27A 3AHUA 1UGQB 3OBWA 3GLXA 4GY5A 4OB2B 5CR2A 2EKOA 3WVEB 4M7DC 3X26B 1YJNT 1Y96A 4F7UA 1OZ2A 4HCBA 3G6EA 2HQXA 4M7DB 4IUUA 3F70A 3HP9A 1D3BA 3CCJA 3JCMJ 2HQEA 2M0OA 2X4JA 3C94A 3QDRB 5HK3A 3CCST 2BIVA 3E1SA 3OBYA 4P5NA 2RJFA 3ZEHA 2CS7A 2K5LA 2RHYA 5LJ3g 5GAOq 1QP2A 3WVDB 1YITT 4M7AB 4JLIA 2HBPA 3OS2A 4XU2A 4Z02A 1VQ4T 1KQSA 3P8BB 1JJ2S 3GIBA 1M8VA 2KQWA 1YHQT 1NJIU 3A5ZB 1BI1A 3M4YA 4B9XA 4ELYC 3I55A 3GNFB 1V29B 2DK3A 2QEXT 3VYGA 1Y07A 4XK8E 5DY9A 4L5GA 3L1AA 1BIBA 4OB1B 4N4IA 2VXEA 2RHUA 3DKMA 5FRNA 3T9NA 3LH0A 3E9FA 4MDWA 5LJ3d 2LTOA 2QQRA 1M1GA 3CMAT 4M75D 4M75F 4BI8B 1W4SA 3JCMh 3CBMA 2IG0A 3JRZA 4N0AC 4OGEA 1LNXA 1X01A 2K2VA 1O75A 3JCMX 4HT9A 2XHCA 5L8RE 3GOXA 3M57A 4IUQA 3CBPA 5GMKe 5CQXA 4RCCA 5GAMe 4ZN1A 4EDUA 5GMKl 3RKWA 2GQVA 3V7SA 4M75E 4M78C 4PKCC 2YLCA 4C92C 1H3ZA 4Y91A 5I21A 5LJ5j 2D0QB 2FYKA 2RD1A 1YIJA 4PJOD 1JB0E 2OTLA 2RB6A 3PIPA 2X4YA 3OSVA 4DQ2A 3HHTB 3LW5E 1OYXA 5GAN6 3G6ET 3OYAA 3FIFA 2V8KA 2RJDA 2R5MA 3PIOA 2LCLA 2D6FA 3S3MA 4ZGJB 2FB7A 4O5VA 4M7DD 1YI2T 3I56A 2RM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU3 A;  1D3B B;  1BIA A;  1HXD A;  2EJG A;  4EMK B;  4HT8 A;  4C8Q E;  5GAO r;  4XU0 A;  3SWN A;  5GAM g;  3M4G A;  3EFR A;  5CAI A;  3V8K A;  4C92 B;  1N9S A;  3PGG A;  4C92 D;  1B34 B;  2DXT A;  4M78 D;  2E65 A;  4M78 F;  1U1T A;  4M78 A;  4A53 A;  4M7A A;  4M7A F;  3RKX A;  2YHT A;  1I81 A;  2VXF A;  3JCM c;  5GMK h;  4MMK A;  2QTX A;  3FJP A;  3FB9 A;  5GAN j;  3QHS A;  4JRI A;  3RES A;  4XTV A;  3EFS A;  1I8F A;  3SWN C;  3JCM e;  5GAN h;  1MGQ A;  2ZGW A;  1KQ2 A;  2E64 A;  2DZ9 A;  1WQW A;  2YLB A;  4C92 G;  4M78 E;  1M5Q 1;  4PJO E;  4M75 C;  1U1S A;  4M77 C;  3JCM P;  4XTY A;  2DKG A;  2I2L A;  5GAN 3;  1LJO A;  1TH7 A;  4XQ3 A;  4XU1 A;  1JBM A;  5GMK m;  4XTX A;  2HNI A;  2E10 A;  1WQ7 A;  3RIR A;  3BFM A;  4J6W A;  3JB9 G;  4XTU A;  3V7C A;  4F7U G;  5GAN 5;  4RCB A;  3JCM Q;  3BY7 A;  3JCM W;  2EWN A;  3JB9 I;  4PJO A;  3L2Z A;  3RUX A;  5GAM f;  3RER A;  4M7D E;  3BW1 A;  4M7A C;  4C92 A;  4J5Y A;  4PJO B;  1I4K 1;  1JRI A;  2Y90 A;  1B34 A;  4M78 B;  4C8Q D;  4C8Q F;  1I5L A;  3HSB A;  3SWN B;  3JB9 H;  5GAN e;  2RA2 A;  4N0A A;  2EJF A;  3JCM g;  4EMK C;  1N9R A;  2DVE A;  2DXU A;  4NOY A;  5LJ3 h;  3SB2 A;  5GAO l;  3JB9 J;  3AHU A;  2DZC A;  5GAN 7;  4M7D A;  4M7D C;  4M77 A;  4M75 A;  1Y96 A;  4C92 F;  4F7U A;  4PJO G;  4M78 G;  5GAO m;  2DTH A;  4M7D B;  4OP0 A;  3QSU A;  4EMH A;  5LJ5 e;  1D3B A;  5GMK i;  4A54 A;  3JCM J;  3JB9 F;  5LJ5 h;  4HA8 A;  4C8Q B;  4XTZ A;  1H64 1;  4NL3 A;  5LJ3 g;  5GAO q;  3V7R A;  4PJO C;  4C8Q C;  5LJ3 j;  5GAN f;  4M7A B;  4JLI A;  4X9C A;  4QVD A;  4XU2 A;  5LJ5 f;  4X9D A;  5GAM d;  3V8L A;  3GIB A;  4M7D G;  3QO3 A;  1M8V A;  5GAN d;  5GAN g;  5GAO p;  3INZ A;  2K57 A;  4C8Q G;  4NL2 A;  3QUI A;  5DY9 A;  3JCM f;  2E1H A;  5GAN 2;  3L1A A;  1BIB A;  4J6Y A;  3HFO A;  5GAM j;  5GAN 4;  2VXE A;  4PNO A;  4WF2 A;  3JCM V;  4M7A G;  5LJ3 d;  4J6X A;  4M75 B;  4M77 B;  4F7U F;  5LJ5 d;  4M77 D;  2EAY A;  2DTI A;  4M75 D;  4M75 F;  4M77 F;  3HFN A;  4C92 E;  4M7D F;  4EMK A;  5GAN 8;  2JN0 A;  3JCM b;  3JCM h;  4F7U E;  4V2S A;  2EJ9 A;  2VC8 A;  4N0A C;  3JCM X;  1LNX A;  1X01 A;  4HT9 A;  2DTO A;  4F7U B;  4QVC A;  5GMK e;  1LOJ A;  4JRK A;  4RCC A;  4C8Q A;  5GAM e;  2E41 A;  5GAO n;  5GMK l;  3RKW A;  4M75 G;  4M77 G;  4M75 E;  4M77 E;  5LJ3 f;  4M78 C;  1WNL A;  2DEQ A;  4MML A;  2YLC A;  3V7S A;  3VU3 C;  4Y91 A;  4C92 C;  5I21 A;  2FYK A;  1WPY A;  2RD1 A;  4PJO F;  5LJ5 j;  4PJO D;  5LJ5 g;  2RB6 A;  3JB9 D;  3V8J A;  4DQ2 A;  4M7A D;  1KQ1 A;  1YCY A;  5GAM h;  4XTW A;  5GAN 6;  2CGH A;  3FIF A;  5LJ3 e;  4JUV A;  3BDU A;  3JCM d;  5GMK j;  1Y96 B;  1HK9 A;  4EMG A;  4M7A E;  2FB7 A;  2DJZ A;  4M7D D;  3RKY A;  2RM4 A; 
#chains in the Genus database with same CATH topology
 4XU3 A;  1ZUK A;  1VQ4 Q;  1YN8 A;  1NYG A;  4BDY A;  2E5Q A;  1VQ8 Q;  1NEB A;  2YHT A;  4QQD A;  2OI3 A;  2DYB A;  2GNC A;  2MMP A;  3QHS A;  1K8A U;  4XTV A;  2MPX C;  4E6R A;  4PL6 A;  1RAC B;  2ZPF B;  5A0L A;  1N6A A;  1IHV A;  3TEE A;  4XU1 A;  3I55 T;  3N5B B;  2FVU A;  1X69 A;  2V26 A;  4EIK A;  1M90 U;  5GAM f;  1FMK A;  2K4Y A;  4M78 B;  4OGC A;  4C8Q F;  4E47 A;  1WX6 A;  1AZE A;  3OYJ A;  1YHQ Q;  1TXQ A;  1Y57 A;  4LDY A;  2RI2 A;  2O9V A;  2DEU A;  4M7D A;  4RTU A;  2EFI A;  2EQU A;  4BUG A;  4C0F A;  2V1R A;  5LJ5 e;  2YRV A;  5IN1 A;  5LJ5 h;  3UWN A;  1VQ9 A;  3FLG A;  1AWO A;  4ORZ A;  3LLR A;  2CP3 A;  4NS5 A;  3V7R A;  2MIO A;  1IGU A;  2A08 A;  4RTZ A;  5GJW B;  4C0D B;  2H3E B;  1NM7 A;  3P8D A;  3TRE A;  2C0T A;  4E2F B;  1IHW A;  2LVM A;  4NL2 A;  1K9M C;  2I0N A;  3G6E Q;  3MHX A;  4WF2 A;  1JU5 C;  4M7A G;  3LYI A;  1YNZ A;  1RLP C;  4EMK A;  1VQM A;  1ABQ A;  2VAS A;  1PSE A;  2JTF A;  3OA6 A;  2KI7 A;  5M9O A;  2DL3 A;  5GAO n;  4OMF B;  1M1F A;  2GCX A;  1XTD A;  1VQP Q;  4OB0 B;  2LQW A;  2EIF A;  3CD6 A;  5CK9 A;  3MEA A;  3GBQ A;  2YT6 A;  2HDA A;  2YWW A;  2PVD B;  1GCP A;  2LC4 A;  1BIA A;  1YI2 Q;  1M2V B;  2DVJ A;  2VV5 A;  1X2Q A;  3CC7 A;  2KXC A;  2CZ0 B;  5J26 A;  3X28 B;  3EGD A;  2JZ2 A;  3TU4 K;  4M78 F;  1YBY A;  3EGU A;  1H3H A;  1Q7Y U;  4IUT A;  1Z9Q A;  1UJY A;  2HCK A;  5GAN h;  4BY6 C;  3VS1 A;  4PLI A;  3I5R A;  1C0M A;  1OQK A;  3OMC A;  3MKD A;  1Q86 U;  2R5A A;  1QW1 A;  2C06 A;  5CKB A;  1GXI E;  3SFM A;  3JB9 G;  5GAN 5;  2L3R A;  3BY7 A;  4M7D E;  3CCJ T;  5KCO A;  2ROL A;  1JRI A;  3Q1J A;  2HKQ B;  2V8I A;  3JB9 H;  1KD1 U;  2LDM A;  4N0A A;  5HK0 A;  2YRC A;  1VQ8 T;  1VQ5 A;  3U23 A;  3CCV A;  1M3C A;  4MZP A;  3CD6 T;  3MJX A;  1G3T A;  3CCS A;  4FYX B;  2RI3 A;  4NL3 A;  1KD1 C;  1I0C A;  5GAN f;  5I11 A;  3CCR T;  3CXC P;  3V8L A;  1VIE A;  2DL8 A;  2M1H A;  3QYH B;  3NFC A;  1V76 A;  1MHN A;  3M58 A;  1D0X A;  1VQP A;  4GBQ A;  1D09 B;  3G4S A;  3MET A;  1Z9Z A;  3OYN A;  2GFU A;  4D6W A;  5KYY B;  5LJ5 d;  2DX1 A;  3CEY A;  1QP3 A;  1BKB A;  2D0N A;  3VYH B;  1B3Q A;  2LJ1 A;  1JEG A;  2A7Y A;  1VQL T;  1K8A C;  4Y92 A;  4DBH A;  1YP5 A;  2JTM A;  2QDY B;  2EYX A;  1SPK A;  5LJ5 g;  4IUP A;  3PMT A;  1JQQ A;  2RHZ A;  2GFA A;  1HSQ A;  5GMK j;  2MF2 A;  1HK9 A;  1U3O A;  2JMC A;  5D6W A;  1MMD A;  3JV3 A;  3MP6 A;  2ZPH B;  1TU0 B;  5HCK A;  2PTK A;  3SD4 A;  3CCV T;  3M4G A;  1K73 R;  2XID A;  3M0U A;  1M90 C;  2E12 A;  3JCM c;  2PUO B;  3J80 E;  2B8A A;  2X35 A;  2GTJ A;  2D9T A;  2J6O A;  2DXC A;  5EC7 A;  2OX7 A;  5CIU A;  4DOW A;  4KT0 E;  2DD4 A;  5GMK m;  1EZZ B;  1UB4 A;  1UGS B;  2K5F A;  3O8V A;  2E10 A;  4MDX A;  4YTL A;  2V1Q A;  1RAG B;  4RCB A;  2RH2 A;  2RO0 A;  2DYI A;  2EGA A;  2JS0 A;  5CKD A;  2KBT A;  4DA4 A;  3JCM g;  1ZQ1 A;  2DVE A;  1OOT A;  4BDZ A;  1E6H A;  1M4Z A;  1QQJ A;  2FRY A;  2ZAE A;  4JJC A;  2DA9 A;  2L3S A;  4BE1 A;  3GPL A;  1GFD A;  1K0S A;  1AEY A;  1VUB A;  2AZS A;  3J7A F;  1Y0M A;  2D1X A;  2DF6 A;  4DBQ A;  4IUV A;  4XTZ A;  4E7K A;  3CC2 A;  4MZM A;  1TSF A;  2LNV A;  1BK2 A;  2F5K A;  2IVW A;  2JVV A;  5GAN 2;  2RJE A;  3URG A;  2FZC B;  3JCM V;  2X4W A;  3RMQ A;  4M77 F;  3RMS A;  4ZTF A;  2HAX A;  1QLY A;  2P0Q A;  3CQT A;  3I56 Q;  4F7U B;  2OTJ Q;  1SSH A;  5FW9 A;  2LMJ A;  1OX8 A;  1W70 A;  2A37 A;  3L2V A;  4J9B A;  1AWW A;  1NJI R;  1WHL A;  4J9E A;  3GF5 A;  3M0S A;  4OVA A;  5CO7 A;  2DRK A;  2P0K A;  2LCS A;  4JRP A;  1VQK T;  2CGH A;  1Y96 B;  3DB4 A;  2DMO A;  3CCR A;  3RKY A;  1RI0 A;  2NWM A;  4EMK B;  3SWN A;  4ELZ C;  1N9S A;  3PGG A;  1K73 U;  1QCO A;  1ZBX A;  3EHQ A;  1RL2 A;  3J81 E;  4E7H A;  1QVF S;  4JRI A;  4JZ3 A;  5I2S A;  3NHN A;  3ULR B;  1ZA1 B;  4FYV B;  1WXU A;  1T3L A;  2OAW A;  2E6N A;  2JNG A;  4IIM A;  4AFZ C;  5IXB A;  3CC2 Q;  4M7A C;  2LQ8 A;  2YUQ A;  3VUB A;  3G4S Q;  2KGT A;  3OMG A;  3EG9 B;  1VYU A;  2CZ6 B;  4LDV A;  2CH4 A;  1N27 A;  4ESR A;  3AHU A;  3OBW A;  3GLX A;  4OB2 B;  5CR2 A;  2DNU A;  2Z0W A;  3HP9 A;  3CCJ A;  4PK4 A;  2X4J A;  3QDR B;  3CCS T;  2K2M A;  3E1S A;  2CS7 A;  4AG1 C;  3I5S A;  3WVD B;  1YIT T;  4JLI A;  1YCS B;  1JJ2 S;  2EYZ A;  1MV3 A;  3A5Z B;  4ZNX A;  2DK3 A;  3VYG A;  1PM3 A;  4N4I A;  3DKM A;  5FRN A;  4MDW A;  2C0I A;  2BZ8 A;  1IB8 A;  1YIT Q;  2K2V A;  5L8R E;  3UA7 A;  3RKW A;  3QWY A;  2D0Q B;  4AMC A;  2RB6 A;  2X4Y A;  3LW5 E;  1PKT A;  1AWX A;  3G6E T;  3OYA A;  3FIF A;  1TG0 A;  2R5M A;  3S3M A;  4O5V A;  5KYX A;  2EJG A;  4FYY B;  1Q81 R;  3UAT A;  1SSF A;  1RAD B;  2ECZ A;  1BBZ A;  5D6X A;  4L6V 5;  2QQA A;  3R6O A;  1GCQ C;  4RUG A;  2QXF A;  3NMZ C;  2JUF A;  5GAN j;  4B9W A;  1VQP T;  2AKL A;  3G4S T;  4JLG A;  5FU7 B;  2VGM A;  4JS4 A;  3PNW C;  1KHC A;  3HTR A;  3C0C A;  4N4G A;  1B07 A;  1IRE B;  3CCQ Q;  4LDX A;  4BI4 A;  1QKW A;  3RIR A;  5IHI A;  3MP8 A;  3CC4 A;  2VVK A;  1KSW A;  1QWF A;  2RK2 A;  4D8D A;  1ZA2 B;  2O9S A;  3TVT A;  3FDR A;  2P0P A;  2BE7 D;  1KG1 A;  1S72 Q;  3L2Q A;  1OU9 A;  2O01 E;  4J9H A;  3X24 B;  3M0Q A;  2G6F X;  2MK5 A;  3ASK A;  4C8Q B;  3JAM E;  1SRM A;  4J7F A;  2P4T A;  1M3A A;  1SEM A;  3EGD B;  2RF0 A;  1X27 A;  4X9D A;  1YJ9 Q;  3NGP A;  2NYS A;  1MMA A;  1V1C A;  1RAE B;  3NTI A;  2NUZ A;  2K57 A;  1YIJ T;  3HFO A;  4PNO A;  2KRN A;  3OQ5 A;  3GNG A;  3HFN A;  3H8Z A;  3JCM b;  3QZ5 B;  4QQ6 A;  2J6K A;  1D0Z A;  5J39 A;  2CT4 A;  4VUB A;  3VS2 A;  4JJB A;  1YHQ A;  3AT1 B;  3QYG B;  2K9G A;  3TCJ A;  4M77 E;  2XI9 A;  3HRT A;  1WPY A;  3H41 A;  4A4H A;  1BCM A;  2RPN A;  1ZX6 A;  3LWH A;  2WSF E;  1M1K R;  3ZL7 C;  2DAQ A;  3CBO A;  2YUN A;  1HXD A;  2O4X A;  3M5A A;  5GAO r;  5GAM g;  4HCC A;  1M27 C;  4HVV A;  3EFR A;  2DRM A;  1NZ9 A;  2DXT A;  3RKX A;  4Q5W A;  5A2Q E;  2Y4Y A;  4DOV A;  2HL5 C;  1NE8 A;  2QYZ A;  1YJW T;  3CME T;  4ZGD B;  3CCJ Q;  1W2B S;  3CXC S;  3OYI A;  1M5Q 1;  1G83 A;  1U1S A;  2LQK A;  5GAN 3;  3UA6 A;  4FSX A;  3OYL A;  2HNI A;  5IT9 E;  1B7T A;  1GBQ A;  4J6W A;  1T0J A;  1VQO A;  1VQ9 T;  2X51 A;  4PFZ A;  3CD6 Q;  4J5Y A;  4M4Z A;  2DL4 A;  3HKS A;  5J3B A;  1G3Y A;  1YJ9 T;  1W2B P;  1VQ6 A;  2PZ1 A;  4A4K A;  1YIJ Q;  3P8H A;  4PJO G;  1WA7 A;  3M54 A;  3ER0 A;  1ZHI A;  2LP5 A;  1RI9 A;  1WHJ A;  1LPL A;  3QJY A;  2DD5 A;  1QKX A;  2YDL A;  3CCE T;  1M3B A;  2FHD A;  3NTH A;  2FPF A;  3VUZ A;  3C95 A;  4AG2 C;  2MI6 A;  4FIB A;  1VQN T;  2E6Z A;  2DXB A;  4LDW A;  3CPW A;  3OYF A;  2IPO B;  3CC4 T;  2WAC A;  5CVI A;  1K9M U;  4OML A;  4V2S A;  1AWJ A;  1C1A A;  2ABL A;  1UFF A;  5D7U A;  1EX4 A;  4C8Q A;  3FRN A;  2E41 A;  3OYE A;  2DE0 X;  4LUE A;  1JJ2 A;  3REA B;  1UDL A;  3QXE B;  2LT4 A;  1JXO A;  3JCM d;  3VRZ A;  2XU8 A;  1MND A;  4BY6 B;  3TSW A;  2XIC A;  1KK7 A;  3OSS C;  5EG2 A;  4RTY A;  4C8Q E;  1CSK A;  1PD0 A;  4PFP A;  1YJN Q;  4LD9 K;  1M90 R;  1S72 A;  2RHX A;  4A53 A;  1P92 A;  1VQO Q;  1I81 A;  4RTX A;  1AZG B;  4JS5 A;  1M2V A;  4E7J A;  1TUG B;  1VQK Q;  3CPW S;  1W6X A;  4M77 C;  3QKJ A;  3CCQ A;  1VQL Q;  1D1C A;  4ME7 A;  4J9D A;  2DIG A;  1WHM A;  1TH7 A;  4FT2 A;  4J83 A;  4XQ3 A;  1VQN A;  3QJ6 A;  1X6B A;  3MO8 A;  3JSC A;  3OYD A;  3CMA Q;  1BI3 A;  2O31 A;  4FYW B;  1VQM Q;  1A0N B;  4B6M A;  4Z88 A;  1FMW A;  1M8M A;  1VQ7 A;  5IXF A;  3MCA B;  1N8R C;  2EBP A;  2HEQ A;  4A4E A;  2SRC A;  2JT4 A;  3QSU A;  4LDU A;  1NBE B;  1DJ7 B;  5DLQ E;  5FWB A;  3WXM B;  2ZPG B;  1NLP C;  2NLU A;  3H0F A;  3BDL A;  5GAO p;  4R55 A;  3CC7 Q;  1U8R A;  1UG1 A;  1RLQ C;  4LXC A;  5IH2 A;  2QQB A;  4C5G A;  2OTL Q;  4E7S A;  4A4G A;  1ARK A;  2FZK B;  4HKE A;  4DEY A;  2PVO B;  2EAY A;  4C92 E;  1RAH B;  2JN0 A;  2VC8 A;  3EG1 A;  2DTO A;  2G3R A;  1VQ4 A;  4BB7 A;  3G7Z A;  4M75 G;  4HXJ A;  1Q82 C;  1RUW A;  4MML A;  3CCM A;  1WXB A;  2JM8 A;  1KIK A;  2LJ0 A;  1LVK A;  2QQS A;  1X75 C;  3CCE A;  1M1K U;  2K3Y A;  4JUV A;  4J9F A;  2M51 A;  3OYG A;  1FX7 A;  4M7A E;  1UE9 A;  2CP5 A;  2LJ3 A;  1VQL A;  4AT1 B;  1MNE A;  5KYU B;  4F14 A;  3PTA A;  4WTO B;  1PD1 A;  2K3X A;  3S3O A;  2GTO A;  1R8O B;  3KXT A;  2VXF A;  2QTX A;  3FJP A;  2CP2 A;  3FB9 A;  2AT1 B;  4R0K A;  1ZBJ A;  3CXC A;  2BE9 B;  3JCM e;  3A1P A;  2YLB A;  1U5S A;  2QA4 T;  2ESW A;  2XDP A;  3JCM P;  2OTJ T;  4CC4 B;  1VYT A;  3FEO A;  4KUD K;  4IIO A;  4KGV B;  1WQ7 A;  1OPK A;  4RMO A;  4F7U G;  1KFZ A;  1FWZ A;  2HZY A;  1QVG P;  2FO0 A;  2CSQ A;  2PNI A;  4OMP A;  4EPC A;  4ZTJ A;  4Z89 A;  1GRI A;  1VQ6 T;  4FM4 B;  5LJ3 h;  3EH1 A;  2EKO A;  3PVQ A;  2QTV A;  3G6E A;  1K9A A;  1R77 A;  2HQE A;  5HK3 A;  1J3T A;  4RTV A;  5IHK A;  2RJF A;  2DJQ A;  3E2U A;  1NEG A;  4M7A B;  2J6F A;  2KQW A;  1NJI U;  1BI1 A;  4ELY C;  3CCM Q;  3GNF B;  1FMV A;  1V29 B;  2AK5 A;  2RQR A;  1Y07 A;  4XK8 E;  2XMF A;  2EVR A;  2RHU A;  5LJ3 d;  4BI8 B;  1KJW A;  1H92 A;  3CBM A;  4OGE A;  3JRZ A;  1VYV A;  1LNX A;  1X01 A;  4HT9 A;  2LQN A;  3M57 A;  4IUQ A;  2HL3 A;  3OW2 P;  2SEM A;  4ZN1 A;  5FWC A;  1ZSZ C;  2GQV A;  4M75 E;  1GCQ A;  2YLC A;  4PJO D;  2FYK A;  2RD1 A;  4KGX B;  1XJW B;  3HHT B;  1OYX A;  1VQN Q;  3MPU B;  4CC7 A;  2RJD A;  2LCL A;  2FB7 A;  1UEC A;  2YSQ A;  4QT7 A;  1YI2 T;  2RM4 A;  2HD0 A;  1VQ8 A;  2DBM A;  1XOV A;  4AFQ C;  1VQ7 Q;  4C92 D;  2EQI A;  2KE9 A;  1MV0 B;  4M78 A;  2CRE A;  4JJN K;  4M7A F;  2GQI A;  3RR6 A;  2ZPE B;  8ATC B;  1KQ2 A;  1U06 A;  1MGQ A;  4C92 G;  1D1A A;  3M55 A;  2CP7 A;  2VB6 A;  5KYY A;  1M1K C;  2K3B A;  2LX7 A;  2ZPB B;  4OB3 B;  3BFM A;  3OYH A;  3ZFJ A;  1YWP A;  1HYO A;  2DIQ A;  4CC3 A;  3L2Z A;  3RUX A;  3CCS Q;  2O4X B;  3A98 A;  2DFU A;  2E70 A;  3SEM A;  1TWB A;  2A3L A;  3EHR A;  3SWN B;  5GAN e;  1UGR B;  1X43 A;  4GLM A;  2YUP A;  1MMG A;  1QVF A;  1WJR A;  2FZG B;  4C5I A;  4A54 A;  2QQ9 A;  4R56 A;  1H64 1;  5HY6 A;  4C8Q C;  3I35 A;  1UGP B;  4C5E A;  4M7D G;  2LX9 A;  2KRS A;  1MUZ A;  3IQL A;  1IXD A;  4OMN A;  3VS3 A;  2RJC A;  5GAN 4;  4J6Y A;  3MEV A;  3EGX B;  3LGF A;  1K0X A;  1ZUY A;  4M7D F;  2FRW A;  1AVZ C;  4Z8A A;  4OMM A;  2BZX A;  2K79 A;  1LOJ A;  2VUB A;  3JB9 J;  3VU3 C;  4X34 A;  1QWE A;  1RAF B;  2CZ1 B;  3UPU A;  4CRI A;  3M59 A;  5LJ3 e;  3VS0 A;  1GL5 A;  1YJ9 A;  3R6N A;  2ZZD A;  1HJD A;  2DJZ A;  3PT9 A;  1VIF A;  1BI0 A;  5FRM A;  1SHF A;  1ABO A;  3VV0 A;  2ZPI B;  1Q7Y C;  4UC4 A;  1B34 B;  1BCO A;  3G71 A;  1VA7 A;  2CUD A;  3RBB B;  5I2M A;  1RAB B;  2JJ9 A;  4JZ4 A;  2L3P A;  1UHF A;  3CCL T;  1WGS A;  1PCX A;  4K11 A;  4M78 E;  4M75 C;  1UGV A;  1Y7X A;  1LJO A;  1WZO A;  3UT1 A;  2KSS A;  1PWT A;  2W0Z A;  4PJO A;  2CP6 A;  2EWN A;  5FU6 B;  3RER A;  3BW1 A;  4PFO A;  4BI3 A;  1UTI A;  2Y90 A;  2CUB A;  4A4F A;  3QG1 A;  1QCF A;  3CPW P;  1WHH A;  3E9G A;  3SB2 A;  4O6J A;  5AT1 B;  2LZ6 B;  3A8L B;  4M75 A;  2X3X D;  1O9S A;  4C0G A;  4M78 G;  2HSP A;  5GAO m;  4OP0 A;  4EMH A;  4PJJ A;  2WSC E;  2RI5 A;  1IRX A;  1HD3 A;  2AHJ B;  2YXY A;  2Y4X A;  1TS9 A;  3OB9 A;  2F69 A;  5C6S A;  1F1B B;  2FEI A;  2M16 A;  5GAN d;  2ENM A;  2EYW A;  4A63 B;  4C0D C;  3OYC A;  2QA4 A;  2ZCF B;  2BUD A;  2EGE A;  3S6W A;  5A0D A;  3OS0 A;  3I9Q A;  1CKA A;  1EFN A;  1WJQ A;  1W2B A;  4J6X A;  4F7U F;  3OYB A;  2RQT A;  4HVW A;  3PE0 A;  2PVG B;  4ANJ A;  4C92 F;  4M77 G;  1Q95 G;  2F2W A;  1WI7 A;  3RNJ A;  4F16 A;  4ATO A;  2KRM A;  3JB9 D;  1KQ1 A;  2ED1 A;  2KDS A;  2XK0 A;  3BDU A;  1G3W A;  3NPF A;  1K9M R;  3HL8 A;  2DLP A;  4KH0 B;  1YWO A;  1IGQ A;  1WDX A;  2F2X A;  4E7L A;  5GMK h;  2XDB A;  2MAM A;  2NUP A;  1OUL A;  4QVZ A;  1XQH A;  5C0M A;  2EYY A;  3RES A;  2CZ7 B;  2A36 A;  2DZ9 A;  1JJ2 P;  4LN2 A;  4LUD A;  2I2L A;  5KYW A;  4XAX B;  4N4H A;  1BB9 A;  3QBY A;  3MEW A;  1WYX A;  2EQM A;  5ECA A;  3JCM W;  2D8H A;  1QVG S;  1NJI C;  2L2P A;  1ZUU A;  5KH6 A;  1JXM A;  3HSB A;  1KQS S;  2RA2 A;  2V8J A;  1YFN A;  1AHJ B;  1VQ7 T;  2LCC A;  3CC7 T;  2DL5 A;  2MYS A;  4HA8 A;  2IIM A;  4PJO C;  1S1N A;  2KYM A;  4QVD A;  3OYY A;  3DB3 A;  1TOV A;  4OMO A;  1AOJ A;  3QUI A;  1QVP A;  2CKK A;  1UEB A;  2E1H A;  1ACM B;  1PSF A;  3OY9 A;  3A8O B;  3VS7 A;  4M77 B;  2FPE A;  2QK0 A;  2DTI A;  1G5V A;  4F7U E;  1G2B A;  2AZV A;  2OTJ A;  2EJ9 A;  2K5I A;  1AT1 B;  3M0T A;  3X25 B;  3H6Z A;  2VYT A;  5LJ3 f;  2PQW A;  3L2W A;  2HSE B;  2KXD A;  3I55 Q;  3VS5 A;  4MZT A;  2HKN A;  4LD6 A;  2L8D A;  2H3J A;  2JTE A;  2GF7 A;  2YRD A;  3CCR Q;  1EIF A;  4OMQ A;  5I22 A;  3G71 Q;  1ZSG A;  2EYQ A;  2OTL T;  1GFC A;  2HBW A;  3H9N A;  4MMK A;  3CC4 Q;  4BAC A;  4HCZ A;  3EH2 A;  1Q82 R;  4D8K A;  1GBR A;  1I8F A;  5CKF A;  1BI2 A;  2M9U A;  5CKE A;  5DM7 R;  2ED0 A;  3GP8 A;  4XTY A;  5A0G A;  2E3H A;  2QDL A;  1PKS A;  3VRY A;  3M0R A;  5FU6 C;  1OI1 A;  2HMA A;  1NYF A;  4C8Q D;  3QII A;  2RQW A;  3KFV A;  1N5Z A;  3REB B;  2KK4 A;  2NUT B;  3VS6 A;  4CC2 A;  1NG2 A;  4M7D C;  2QEX Q;  1YJN T;  4KRT A;  1Y96 A;  3CCU Q;  2HQX A;  4IUU A;  4DEX A;  3F70 A;  1D3B A;  4FSS A;  4HVU A;  2M0O A;  3OBY A;  4P5N A;  1N8R R;  1UJ0 A;  2K5L A;  2RHY A;  2F2V A;  5GAO q;  1QP2 A;  1IO6 A;  2HBP A;  3OS2 A;  4XU2 A;  4Z02 A;  1VQ4 T;  1KQS A;  2CP0 A;  1M8V A;  4LE9 A;  3M4Y A;  1QVF P;  4B9X A;  3I55 A;  2QEX T;  4J9I A;  4PJN A;  5IHN A;  5DY9 A;  4L5G A;  1BIB A;  2QGF B;  2M0Y A;  3E9F A;  2LTO A;  2QQR A;  2FG0 A;  2A28 A;  3JCM h;  3H0I A;  2DM1 A;  2IG0 A;  4N0A C;  1O75 A;  2JW4 A;  2XHC A;  3GOX A;  5GMK e;  4RCC A;  4EDU A;  2EPD A;  1R0B G;  3V7S A;  4F04 B;  4M78 C;  4PKC C;  4C92 C;  4Y91 A;  1BU1 A;  4F17 A;  2L3Q A;  3EG9 A;  3PIP A;  4DQ2 A;  4E7Z A;  5GAN 6;  2V8K A;  3RDV A;  2D6F A;  4ZGJ B;  2RMO A;  4M7D D;  3I56 A;  3M9Q A;  3E19 A;  3EFO B;  2PUK B;  4XU0 A;  2QI2 A;  4KBM B;  5LL6 S;  1WHG A;  2J05 A;  2GBQ A;  3V8K A;  3HPW A;  5D6Y A;  1K76 A;  1KC8 C;  3CPF A;  6AT1 B;  1YJW Q;  2O88 A;  3PFS A;  3OW2 S;  4RG8 A;  3M0P A;  2ZGW A;  5L23 A;  1VQ9 Q;  2RNA A;  2DO3 A;  1Q81 U;  1I1J A;  1WFW A;  3S3N A;  2QEX A;  1JBM A;  3MEU A;  2P84 A;  4XTU A;  3OS1 A;  1OEB A;  3JB9 I;  2KY9 A;  2L0A A;  2ROT A;  4C92 A;  1FXX A;  4PJO B;  4J9G A;  1B34 A;  2K6D A;  3EG2 A;  1N9R A;  2DXU A;  2C0O A;  4QQG A;  4GLK A;  4QW2 A;  5GJV B;  5KE3 A;  5CKH A;  4M77 A;  1SRL A;  2EKH A;  4RTW A;  1X6G A;  4J9C A;  5HKC A;  2KT8 A;  5GMK i;  3C12 A;  3VKI A;  4JPB W;  4RKU E;  4JDS A;  1SKU B;  1Q82 U;  4X9C A;  4L59 A;  1CKB A;  3OW2 A;  3QO3 A;  4BE2 A;  4FCY A;  1ZSZ B;  3ME9 A;  3UDC A;  3PVL A;  4FL6 A;  3INZ A;  1R0C B;  3DLM A;  9ATC B;  1VQO T;  2R58 A;  2DIL A;  5GAM j;  1BYM A;  8AT1 B;  4FT4 A;  3CME Q;  4CI0 C;  1I5O B;  4M77 D;  3KUF A;  5KYU A;  3M56 A;  2QAZ A;  2KAF A;  4JRK A;  1AD5 A;  1D0Y A;  2F1L A;  2DET A;  1YJN A;  3SHW A;  4LNP A;  4PJO F;  1PG5 B;  1UUE A;  2O2O A;  5GAM h;  3KBG A;  2COW A;  4JRQ A;  1X6O A;  1N8R U;  3X20 B;  2RQV A;  1YIT A;  1OU8 A;  2COZ A;  5KYN A;  3V8J A;  4EMK C;  1H8K A;  2FL7 A;  3VJP A;  3BE3 A;  3CMA A;  2J06 A;  4M78 D;  4KUL A;  5AYF A;  1VQ5 Q;  3C4S A;  3CCU A;  2VKN A;  3SWN C;  2KYB A;  1M9S A;  3OYK A;  1WQW A;  3MP1 A;  2MCN A;  4HCK A;  3QZ9 B;  4AFS C;  2RK1 A;  4JJD A;  1WJS A;  4J7I A;  3NTK A;  1QCN A;  3V7C A;  3HRU A;  3JCM Q;  4KUI A;  1ZSZ A;  2HQH A;  5FRO A;  1RAA B;  2PU9 B;  1VQ6 Q;  1TUD A;  1OX9 A;  2EJF A;  2W10 A;  4NOY A;  2KRO A;  5GAN 7;  1S72 T;  3A8M B;  4BD3 A;  2DTH A;  4RG2 A;  3JB9 F;  2WSE E;  1JO8 A;  2CYZ B;  4FW1 A;  1OZ3 A;  3LWI A;  2RN8 A;  2L89 A;  1G8X A;  5LJ3 j;  2E4H A;  2J7I A;  4X1V A;  1NLO C;  5GAN g;  2OJ2 A;  4C8Q G;  3TSZ A;  3JCM f;  1C6V X;  1G3S A;  3TQ7 P;  2X3W D;  2B86 A;  4M75 B;  4C5H A;  2XD0 A;  5IAY A;  5GAN 8;  1NPP A;  1YJW A;  5KCH A;  3CCL A;  1NPR A;  1SF9 A;  3O5Z A;  1QMC A;  2XKO C;  2CDT A;  1VQ5 T;  1WXT A;  1YCY A;  3EFO A;  4XTW A;  2EQK A;  2CT3 A;  1Q86 C;  4C0Z A;  1IZ6 A;  4EMG A;  4DBR A;  3I56 T;  1PRM C;  1Q81 C;  2LNH B;  2FPD A;  4PJL A;  1D3B B;  2DBK A;  1SG5 A;  2QA4 Q;  5CAI A;  3H0H A;  4M7A A;  2LRQ A;  1U1T A;  1TUC A;  4DBF A;  1KC8 U;  4KGZ B;  1PRL C;  2E3I A;  3QDF A;  1VQK A;  3EFS A;  2JXB A;  2E64 A;  4II1 A;  1UHC A;  5FLX E;  3EAE A;  3ZBD A;  4PJO E;  2VWF A;  5DLO A;  2MWO A;  3CCM T;  2QAS A;  1WIE A;  2BTT A;  5KYX B;  1X2K A;  1OPL A;  3FC3 A;  3G71 T;  2R57 A;  4RTT A;  3G1J A;  2VGN A;  4OF1 A;  1WLP B;  1I4K 1;  3LX7 A;  3CME A;  2CH4 W;  2KEA A;  1PNJ A;  1SHG A;  3LGL A;  7AT1 B;  2KNB B;  2QG9 B;  4PJM A;  5GAO l;  2DZC A;  5CCA A;  4J8O A;  3OYM A;  2DPP B;  1T0H A;  1KHI A;  2JS2 A;  2AKK A;  3CC2 T;  2BZY A;  2NUT A;  1KC8 R;  1I07 A;  3QWX X;  2RHI A;  5CQY A;  3CCL Q;  5GAM d;  5LJ5 f;  3A8G B;  1VOM A;  3PMI A;  1M2O A;  2X4X A;  2YUO A;  1T3S A;  3A8H B;  1D1B A;  2KT1 A;  3QPH A;  3L2U A;  2RQU A;  2XG8 D;  4E7I A;  2KR3 A;  2MWP A;  2KVQ G;  2ATC B;  3D7S B;  1VQM T;  2BKD N;  3EG0 A;  4QVC A;  2M02 A;  3OS5 A;  1WNL A;  2DEQ A;  3CCQ T;  4TVR A;  1QVG A;  1K73 C;  3L42 A;  5KE2 A;  2LT1 A;  1Y71 A;  3FJ5 A;  3SDZ A;  1K1Z A;  2K7A A;  3CCE Q;  4FW2 A;  1E6G A;  4ZGE B;  4PLL A;  4HT8 A;  2L5Q A;  2KMT A;  2JM9 A;  4WCI A;  3HRS A;  4QKU A;  4Y28 E;  4C92 B;  2XDD A;  1LCK A;  2E65 A;  4M7A D;  3M53 A;  3THK A;  1Q7Y R;  1K8A R;  2DER A;  2DL7 A;  2A0F B;  5FU7 C;  2JOY A;  1WHK A;  1XNI A;  3EG3 A;  2E5K A;  2DKG A;  2H8H A;  1FYN A;  1Q86 R;  2OAU A;  3L2R A;  4FU6 A;  4XTX A;  5KYW B;  1KQS P;  3CCU T;  4IUR A;  4BE0 A;  4ZN3 A;  3VS4 A;  1PHT A;  1YI2 A;  2MOX A;  1KD1 R;  3LH5 A;  1I5L A;  2EQJ A;  3DLL A;  2F5T X;  4IKF A;  4KH1 B;  2NUP B;  1UGQ B;  4GY5 A;  4AFU C;  3WVE B;  3X26 B;  4F7U A;  1OZ2 A;  3UF4 A;  4HCB A;  4M7D B;  2GGR A;  1K4U S;  3JCM J;  3C94 A;  2QGG A;  2BIV A;  2P4R A;  3ZEH A;  5LJ3 g;  1RAI B;  2EGC A;  3P8B B;  3GIB A;  1YHQ T;  2X9H A;  2EW3 A;  1W1F A;  1M30 A;  3L1A A;  4OB1 B;  2VXE A;  3T9N A;  3LH0 A;  2CSI A;  3CMA T;  1M1G A;  4M75 D;  4M75 F;  3EGX A;  1W4S A;  3JCM X;  2D8J A;  1PC0 A;  3CCV Q;  3CBP A;  5CQX A;  5GAM e;  2COY A;  5GMK l;  1H3Z A;  5LJ5 j;  5I21 A;  1YIJ A;  1ZLM A;  1JB0 E;  2OTL A;  2JMA A;  3OSV A;  1E7O A;  2AIR B;  3PIO A;  1OV3 A;  1MMN A;  1TTH B; 
#chains in the Genus database with same CATH homology
 4XU3 A;  2EJG A;  3M9Q A;  1SSF A;  3E19 A;  2PUK B;  4XU0 A;  2QI2 A;  1VQ8 A;  4BDY A;  1XOV A;  4KBM B;  5D6X A;  5LL6 S;  4L6V 5;  2QQA A;  3R6O A;  2E5Q A;  3V8K A;  3HPW A;  4C92 D;  5D6Y A;  4M78 A;  4JJN K;  1KC8 C;  4M7A F;  2YHT A;  2QXF A;  4QQD A;  3CPF A;  2JUF A;  5GAN j;  4B9W A;  1VQP T;  3PFS A;  3OW2 S;  2MMP A;  3QHS A;  2ZPE B;  1K8A U;  3G4S T;  4XTV A;  4RG8 A;  1KQ2 A;  4JLG A;  1MGQ A;  2ZGW A;  5FU7 B;  2VGM A;  4JS4 A;  4PL6 A;  4C92 G;  3PNW C;  1KHC A;  2DO3 A;  3M55 A;  2ZPF B;  4N4G A;  1Q81 U;  5A0L A;  1IRE B;  1N6A A;  3S3N A;  2QEX A;  1M1K C;  3TEE A;  4XU1 A;  3I55 T;  1JBM A;  4LDX A;  4BI4 A;  2ZPB B;  3MEU A;  3N5B B;  4OB3 B;  3RIR A;  3BFM A;  2FVU A;  3OYH A;  4XTU A;  3OS1 A;  3ZFJ A;  1M90 U;  3JB9 I;  2DIQ A;  2KY9 A;  3MP8 A;  3L2Z A;  3RUX A;  5GAM f;  3CC4 A;  2O4X B;  2RK2 A;  4C92 A;  1FXX A;  2K4Y A;  4PJO B;  4M78 B;  2E70 A;  1B34 A;  4OGC A;  4C8Q F;  4E47 A;  2A3L A;  3SWN B;  5GAN e;  1UGR B;  3FDR A;  2P0P A;  3OYJ A;  1N9R A;  2DXU A;  1KG1 A;  4LDY A;  2RI2 A;  1QVF A;  4QQG A;  4GLK A;  4QW2 A;  5KE3 A;  4M7D A;  5CKH A;  2EFI A;  3L2Q A;  4M77 A;  2O01 E;  2EQU A;  4BUG A;  3X24 B;  4C0F A;  1WJR A;  5HKC A;  5LJ5 e;  5GMK i;  4C5I A;  4A54 A;  2YRV A;  3ASK A;  5IN1 A;  3UWN A;  2QQ9 A;  3FLG A;  5LJ5 h;  1VQ9 A;  3C12 A;  4C8Q B;  3VKI A;  4R56 A;  1H64 1;  3LLR A;  5HY6 A;  3JAM E;  4J7F A;  4RKU E;  2P4T A;  4JDS A;  4NS5 A;  3V7R A;  4C8Q C;  1Q82 U;  1UGP B;  4X9C A;  4L59 A;  4C5E A;  4X9D A;  4M7D G;  2LX9 A;  3OW2 A;  3QO3 A;  4BE2 A;  4C0D B;  3ME9 A;  3UDC A;  3P8D A;  3TRE A;  3NTI A;  4FL6 A;  3INZ A;  2K57 A;  3DLM A;  2LVM A;  4NL2 A;  1YIJ T;  1K9M C;  2RJC A;  1VQO T;  2R58 A;  5GAN 4;  4J6Y A;  3MEV A;  3HFO A;  3MHX A;  5GAM j;  1BYM A;  4PNO A;  4WF2 A;  4M7A G;  4FT4 A;  3LYI A;  3LGF A;  4CI0 C;  3OQ5 A;  3GNG A;  4M77 D;  3KUF A;  3HFN A;  3H8Z A;  4M7D F;  4EMK A;  1VQM A;  3JCM b;  3M56 A;  3QZ5 B;  4QQ6 A;  1PSE A;  2KAF A;  2JTF A;  3OA6 A;  5J39 A;  5M9O A;  4VUB A;  1YHQ A;  1LOJ A;  4JRK A;  3QYG B;  2VUB A;  3TCJ A;  4OMF B;  5GAO n;  3JB9 J;  4M77 E;  1YJN A;  2XI9 A;  3HRT A;  1M1F A;  3VU3 C;  2GCX A;  4X34 A;  1WPY A;  4PJO F;  4A4H A;  1XTD A;  2CZ1 B;  4OB0 B;  5GAM h;  3UPU A;  3KBG A;  2EIF A;  3LWH A;  2WSF E;  4CRI A;  4JRQ A;  3CD6 A;  3M59 A;  5LJ3 e;  5CK9 A;  1YJ9 A;  2ZZD A;  3MEA A;  1X6O A;  1N8R U;  3X20 B;  2DAQ A;  2DJZ A;  2PVD B;  3CBO A;  1YIT A;  3PT9 A;  2LC4 A;  3V8J A;  1VIF A;  4EMK C;  1BI0 A;  1BIA A;  1HXD A;  2FL7 A;  2O4X A;  3VJP A;  3M5A A;  5GAO r;  2VV5 A;  5FRM A;  5GAM g;  4HCC A;  3CC7 A;  3EFR A;  3VV0 A;  2ZPI B;  2CZ0 B;  1Q7Y C;  4UC4 A;  1NZ9 A;  5J26 A;  3CMA A;  1B34 B;  2DXT A;  2JZ2 A;  4KUL A;  4M78 D;  4M78 F;  5AYF A;  3X28 B;  3G71 A;  3TU4 K;  1YBY A;  5I2M A;  4Q5W A;  3RKX A;  5A2Q E;  2Y4Y A;  4DOV A;  1Q7Y U;  1NE8 A;  3C4S A;  4IUT A;  3CCU A;  1YJW T;  3CME T;  4ZGD B;  5GAN h;  3SWN C;  4BY6 C;  1M9S A;  4PLI A;  3OYK A;  3CXC S;  1WGS A;  1WQW A;  3CCL T;  3MP1 A;  1W2B S;  3OYI A;  4M78 E;  1M5Q 1;  3OMC A;  1U1S A;  4M75 C;  1Y7X A;  2LQK A;  1Q86 U;  2R5A A;  5GAN 3;  1QW1 A;  1LJO A;  3QZ9 B;  2C06 A;  5CKB A;  3UT1 A;  2KSS A;  1GXI E;  2RK1 A;  4FSX A;  1WJS A;  2HNI A;  4J7I A;  3NTK A;  3SFM A;  3OYL A;  5IT9 E;  3JB9 G;  4J6W A;  3V7C A;  1VQO A;  5GAN 5;  3HRU A;  2L3R A;  3BY7 A;  2EWN A;  4KUI A;  5FU6 B;  3JCM Q;  1VQ9 T;  4M7D E;  4PJO A;  3RER A;  3BW1 A;  3CCJ T;  4J5Y A;  5FRO A;  4BI3 A;  2Y90 A;  1JRI A;  3Q1J A;  3HKS A;  5KCO A;  2V8I A;  3JB9 H;  2PU9 B;  4A4F A;  1KD1 U;  2LDM A;  3QG1 A;  2EJF A;  4N0A A;  5J3B A;  1G3Y A;  5HK0 A;  1YJ9 T;  4NOY A;  3E9G A;  1VQ6 A;  3SB2 A;  4A4K A;  4O6J A;  5GAN 7;  1S72 T;  1VQ8 T;  3A8L B;  4M75 A;  1VQ5 A;  1O9S A;  3P8H A;  4C0G A;  3A8M B;  3CCV A;  4PJO G;  4BD3 A;  3M54 A;  4M78 G;  2DTH A;  5GAO m;  4OP0 A;  3ER0 A;  1ZHI A;  4RG2 A;  4EMH A;  2WSC E;  2RI5 A;  4MZP A;  3CD6 T;  3JB9 F;  2WSE E;  2DD5 A;  3QJY A;  1G3T A;  2CYZ B;  1OZ3 A;  3LWI A;  2AHJ B;  2Y4X A;  3CCE T;  2L89 A;  3CCS A;  3OB9 A;  2F69 A;  2RI3 A;  4NL3 A;  5C6S A;  1KD1 C;  5LJ3 j;  2FHD A;  5GAN f;  3CCR T;  3NTH A;  2M16 A;  3V8L A;  1VIE A;  5GAN d;  5GAN g;  2M1H A;  3VUZ A;  3C95 A;  3QYH B;  3OYC A;  4C0D C;  2QA4 A;  2ZCF B;  2MI6 A;  3NFC A;  2BUD A;  1MHN A;  3M58 A;  4C8Q G;  4FIB A;  3S6W A;  5A0D A;  3JCM f;  1VQP A;  1VQN T;  2E6Z A;  1G3S A;  2DXB A;  3OS0 A;  4LDW A;  3MET A;  3G4S A;  1WJQ A;  3OYN A;  3CPW A;  2GFU A;  4J6X A;  4M75 B;  4D6W A;  4F7U F;  5LJ5 d;  3OYF A;  3CC4 T;  4C5H A;  1W2B A;  3CEY A;  2XD0 A;  1QP3 A;  2WAC A;  1BKB A;  2HD0 A;  5CVI A;  5IAY A;  5GAN 8;  1K9M U;  3VYH B;  3OYB A;  4V2S A;  1NPP A;  2A7Y A;  1YJW A;  5KCH A;  3CCL A;  1VQL T;  1K8A C;  2PVG B;  4C8Q A;  2JTM A;  1NPR A;  3FRN A;  2E41 A;  2QDY B;  3OYE A;  4C92 F;  4M77 G;  5LJ5 g;  1JJ2 A;  4ATO A;  2XKO C;  3JB9 D;  1VQ5 T;  3QXE B;  1KQ1 A;  1YCY A;  4IUP A;  4XTW A;  3PMT A;  2RHZ A;  2LT4 A;  2EQK A;  2GFA A;  2KDS A;  3JCM d;  2XK0 A;  3BDU A;  4C0Z A;  4BY6 B;  2XU8 A;  1IZ6 A;  5GMK j;  1Q86 C;  1G3W A;  2MF2 A;  1HK9 A;  4EMG A;  3HL8 A;  3I56 T;  5D6W A;  1Q81 C;  1D3B B;  2XIC A;  3MP6 A;  2ZPH B;  3OSS C;  5EG2 A;  4C8Q E;  3SD4 A;  3CCV T;  3M4G A;  5CAI A;  4LD9 K;  1S72 A;  2RHX A;  2XID A;  4A53 A;  4M7A A;  2LRQ A;  1P92 A;  1U1T A;  1KC8 U;  4E7L A;  2E12 A;  1I81 A;  5GMK h;  2MAM A;  3JCM c;  1M90 C;  2PUO B;  2XDB A;  3J80 E;  4QVZ A;  1VQK A;  4JS5 A;  1XQH A;  5C0M A;  4E7J A;  3RES A;  2B8A A;  2X35 A;  3EFS A;  2CZ7 B;  2E64 A;  3CPW S;  4II1 A;  5FLX E;  2DZ9 A;  2D9T A;  3EAE A;  3ZBD A;  4PJO E;  4M77 C;  2DXC A;  3QKJ A;  2MWO A;  5DLO A;  3CCM T;  3CCQ A;  4ME7 A;  2I2L A;  5CIU A;  2DIG A;  4DOW A;  4KT0 E;  1TH7 A;  2DD4 A;  4FT2 A;  4J83 A;  4XAX B;  4XQ3 A;  5GMK m;  1UGS B;  1UB4 A;  2K5F A;  3O8V A;  3QJ6 A;  2E10 A;  4N4H A;  3QBY A;  1VQN A;  4MDX A;  3MEW A;  3MO8 A;  4YTL A;  3JSC A;  3OYD A;  3FC3 A;  2EQM A;  3G71 T;  1BI3 A;  4RCB A;  2R57 A;  2RH2 A;  3JCM W;  2RO0 A;  1QVG S;  1NJI C;  2VGN A;  4OF1 A;  5CKD A;  5KH6 A;  1I4K 1;  3LX7 A;  3HSB A;  3CME A;  1KQS S;  4DA4 A;  2RA2 A;  3JCM g;  1ZQ1 A;  3LGL A;  2DVE A;  1VQ7 A;  4BDZ A;  5GAO l;  2V8J A;  1AHJ B;  2DZC A;  3MCA B;  5CCA A;  1VQ7 T;  4J8O A;  1M4Z A;  1N8R C;  3OYM A;  4A4E A;  2LCC A;  3CC7 T;  2DPP B;  4BE1 A;  3GPL A;  3QSU A;  4LDU A;  1KHI A;  1VUB A;  3J7A F;  3CC2 T;  4HA8 A;  4IUV A;  4XTZ A;  1DJ7 B;  4E7K A;  3CC2 A;  4MZM A;  5DLQ E;  3WXM B;  2RHI A;  4PJO C;  2ZPG B;  5CQY A;  4QVD A;  2NLU A;  5LJ5 f;  3A8G B;  3PMI A;  3BDL A;  3DB3 A;  2LNV A;  3OYY A;  5GAM d;  2X4X A;  5GAO p;  2F5K A;  2IVW A;  4R55 A;  3A8H B;  1U8R A;  2JVV A;  2QQB A;  3QPH A;  3QUI A;  4C5G A;  1QVP A;  2CKK A;  3L2U A;  1UEB A;  2E1H A;  5GAN 2;  2XG8 D;  1PSF A;  2RJE A;  3URG A;  4E7I A;  2MWP A;  3JCM V;  4A4G A;  3OY9 A;  2KVQ G;  2X4W A;  3A8O B;  3RMQ A;  4HKE A;  4M77 B;  2PVO B;  2EAY A;  2DTI A;  4M77 F;  4C92 E;  1G5V A;  2JN0 A;  3RMS A;  4F7U E;  4ZTF A;  2HAX A;  2P0Q A;  2VC8 A;  2EJ9 A;  1VQM T;  2OTJ A;  2K5I A;  2BKD N;  3X25 B;  2DTO A;  2G3R A;  4F7U B;  3H6Z A;  4QVC A;  1VQ4 A;  2VYT A;  4BB7 A;  3G7Z A;  3OS5 A;  2PQW A;  4M75 G;  5LJ3 f;  3L2V A;  1WNL A;  2DEQ A;  4MML A;  4TVR A;  3L2W A;  3CCQ T;  3CCM A;  1QVG A;  4MZT A;  1K73 C;  3L42 A;  3GF5 A;  5KE2 A;  2LT1 A;  4OVA A;  1Y71 A;  5CO7 A;  2P0K A;  1Q82 C;  4LD6 A;  3SDZ A;  2QQS A;  1X75 C;  4JRP A;  3CCE A;  1M1K U;  1VQK T;  2CGH A;  2K3Y A;  4JUV A;  1Y96 B;  3OYG A;  3DB4 A;  1FX7 A;  3CCR A;  4M7A E;  2L8D A;  2H3J A;  2GF7 A;  3RKY A;  4ZGE B;  1VQL A;  1RI0 A;  4PLL A;  4HT8 A;  4EMK B;  1EIF A;  2KMT A;  2L5Q A;  3HRS A;  3PTA A;  2K3X A;  3SWN A;  4ELZ C;  4Y28 E;  3S3O A;  4C92 B;  2XDD A;  1N9S A;  2EYQ A;  3PGG A;  1K73 U;  2OTL T;  2E65 A;  1R8O B;  4M7A D;  3M53 A;  3KXT A;  2VXF A;  1ZBX A;  4MMK A;  2QTX A;  3FJP A;  1RL2 A;  3FB9 A;  4BAC A;  4HCZ A;  3J81 E;  4E7H A;  1QVF S;  4JRI A;  3CXC A;  1I8F A;  5CKF A;  3JCM e;  5I2S A;  1BI2 A;  2M9U A;  5FU7 C;  2YLB A;  2JOY A;  5CKE A;  5DM7 R;  2QA4 T;  2XDP A;  3GP8 A;  3JCM P;  1XNI A;  2OTJ T;  4XTY A;  5A0G A;  2DKG A;  3FEO A;  4KUD K;  2OAU A;  3L2R A;  4FU6 A;  4XTX A;  1WQ7 A;  2E6N A;  2JNG A;  4RMO A;  3CCU T;  4IUR A;  4F7U G;  1FWZ A;  1OI1 A;  5FU6 C;  4BE0 A;  4ZN3 A;  4M7A C;  2LQ8 A;  1YI2 A;  4C8Q D;  3VUB A;  4EPC A;  4ZTJ A;  1I5L A;  2EQJ A;  3OMG A;  3DLL A;  2F5T X;  3QII A;  4IKF A;  1VQ6 T;  2KK4 A;  4FM4 B;  2CZ6 B;  4LDV A;  5LJ3 h;  1N27 A;  3AHU A;  1UGQ B;  3OBW A;  3GLX A;  4GY5 A;  4OB2 B;  5CR2 A;  2EKO A;  3WVE B;  4M7D C;  3X26 B;  1YJN T;  1Y96 A;  4F7U A;  1OZ2 A;  4HCB A;  3G6E A;  2HQX A;  4M7D B;  4IUU A;  3F70 A;  3HP9 A;  1D3B A;  3CCJ A;  3JCM J;  2HQE A;  2M0O A;  2X4J A;  3C94 A;  3QDR B;  5HK3 A;  3CCS T;  2BIV A;  3E1S A;  3OBY A;  4P5N A;  2RJF A;  3ZEH A;  2CS7 A;  2K5L A;  2RHY A;  5LJ3 g;  5GAO q;  1QP2 A;  3WVD B;  1YIT T;  4M7A B;  4JLI A;  2HBP A;  3OS2 A;  4XU2 A;  4Z02 A;  1VQ4 T;  1KQS A;  3P8B B;  1JJ2 S;  3GIB A;  1M8V A;  2KQW A;  1YHQ T;  1NJI U;  3A5Z B;  1BI1 A;  3M4Y A;  4B9X A;  4ELY C;  3I55 A;  3GNF B;  1V29 B;  2DK3 A;  2QEX T;  3VYG A;  1Y07 A;  4XK8 E;  5DY9 A;  4L5G A;  3L1A A;  1BIB A;  4OB1 B;  4N4I A;  2VXE A;  2RHU A;  3DKM A;  5FRN A;  3T9N A;  3LH0 A;  3E9F A;  4MDW A;  5LJ3 d;  2LTO A;  2QQR A;  1M1G A;  3CMA T;  4M75 D;  4M75 F;  4BI8 B;  1W4S A;  3JCM h;  3CBM A;  2IG0 A;  3JRZ A;  4N0A C;  4OGE A;  1LNX A;  1X01 A;  2K2V A;  1O75 A;  3JCM X;  4HT9 A;  2XHC A;  5L8R E;  3GOX A;  3M57 A;  4IUQ A;  3CBP A;  5GMK e;  5CQX A;  4RCC A;  5GAM e;  4ZN1 A;  4EDU A;  5GMK l;  3RKW A;  2GQV A;  3V7S A;  4M75 E;  4M78 C;  4PKC C;  2YLC A;  4C92 C;  1H3Z A;  4Y91 A;  5I21 A;  5LJ5 j;  2D0Q B;  2FYK A;  2RD1 A;  1YIJ A;  4PJO D;  1JB0 E;  2OTL A;  2RB6 A;  3PIP A;  2X4Y A;  3OSV A;  4DQ2 A;  3HHT B;  3LW5 E;  1OYX A;  5GAN 6;  3G6E T;  3OYA A;  3FIF A;  2V8K A;  2RJD A;  2R5M A;  3PIO A;  2LCL A;  2D6F A;  3S3M A;  4ZGJ B;  2FB7 A;  4O5V A;  4M7D D;  1YI2 T;  3I56 A;  2RM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...