4C92C

Crystal structure of the yeast lsm1-7 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92C00
1H641 2DJZA 1Y96A 3V7CA 1Y96B 2VXEA 4C92B 3BY7A 4F7UG 2RB6A 5LJ3d 2YLBA 3JCMf 4QVDA 5GANj 3GIBA 1TH7A 5GMKj 3QSUA 4HT9A 1N9SA 1D3BA 4XTWA 5GANf 5GAMh 4M7DF 2EJFA 3EFSA 3FB9A 4MMKA 5LJ5e 5LJ3g 2DXUA 5GMKm 2HNIA 4F7UA 4F7UB 3JCMX 5GAMd 4WF2A 3RERA 4M7DB 4M78D 4DQ2A 4M78F 1N9RA 1B34B 4M75A 4XQ3A 3RUXA 4PNOA 3SWNB 3JCMc 4C8QD 3RKWA 5GAN5 3JB9I 4PJOC 4M7AA 1HK9A 1LNXA 4M7AB 4C92F 2EAYA 2YHTA 4C92D 5GAMg 2FB7A 3HFNA 5GMKi 1KQ1A 3QUIA 5GAMe 3AHUA 4M77A 1WQWA 3BFMA 4J6XA 5GAN6 4X9CA 5GAOm 2DTIA 4XU0A 2I2LA 4JRIA 4A53A 3JCMQ 3JCMh 1M8VA 4EMKA 5GAN2 4XTUA 4EMKB 5GANh 2QTXA 4M77E 4F7UF 4M75G 5GMKh 4M7DD 2E64A 1D3BB 1M5Q1 4M75F 2E1HA 4C92A 4M7AG 4HA8A 4NL2A 5GAOp 5GANd 3JB9G 1WQ7A 3BDUA 5LJ5j 4M7AF 3V8KA 2EJGA 1X01A 2DTOA 4M77G 2E10A 4RCBA 5LJ3e 5LJ5f 2EWNA 1I4K1 2DZCA 2FYKA 3V7SA 2DEQA 2DXTA 1I81A 4M75B 4M78C 4M77F 4XTVA 4XTZA 2Y90A 4C8QC 5GANg 4V2SA 4J6WA 4XU2A 4MMLA 5GAOr 2DTHA 2VC8A 4EMGA 5GAN8 3RIRA 2CGHA 4Y91A 2DVEA 4J5YA 3HFOA 4M77B 5GAN4 4C8QE 4PJOE 4A54A 2E41A 3FJPA 3QHSA 4EMHA 1I5LA 3FIFA 3INZA 4N0AC 2ZGWA 5GAN7 4M7DC 4M75D 1MGQA 4XU3A 4XU1A 4PJOG 3VU3C 3JCMd 3SWNC 2DZ9A 2YLCA 3JCMb 2JN0A 5GMKl 4NOYA 3JB9J 1I8FA 4M7AD 5LJ5h 3JB9D 3JB9F 3M4GA 4M7DG 3JCMg 4NL3A 4XTXA 4M77D 5LJ3j 5GAOq 4M78A 3RESA 1JBMA 3JCMe 4C8QA 5GAN3 5LJ5d 4PJOB 5LJ3f 4PJOA 2RA2A 2RM4A 3BW1A 3JCMP 5GANe 4C92C 1JRIA 3L1AA 1LOJA 1U1TA 3L2ZA 4JRKA 4QVCA 5GMKe 3JCMV 4M78E 3JCMJ 5GAOl 5LJ5g 4JUVA 1WNLA 5GAMj 3JCMW 3QO3A 4X9DA 4C92E 5GAMf 1YCYA 2EJ9A 1U1SA 4JLIA 2VXFA 3SB2A 5GAOn 4RCCA 4M78G 4N0AA 4HT8A 2E65A 4C8QG 4M7DA 1BIBA 1LJOA 5I21A 4M75C 3V7RA 1B34A 2DKGA 3SWNA 4PJOD 4C8QF 4PJOF 3V8JA 1HXDA 4C92G 3RKYA 3V8LA 4M7AC 3PGGA 4F7UE 4OP0A 2RD1A 4M7DE 5DY9A 1WPYA 4J6YA 2K57A 4XTYA 4M75E 5LJ3h 3EFRA 4M77C 1KQ2A 4M78B 1BIAA 4C8QB 5CAIA 3HSBA 4M7AE 3JB9H 4EMKC 3RKXA
chains in the Genus database with same CATH superfamily
4C92B 1LVKA 2HSEB 1K8AC 2DBKA 1MMNA 1VQLQ 1OU9A 3QZ9B 1KC8U 2HCKA 3CCEA 3LH5A 4DEYA 1YJWA 2AIRB 3CMAA 1RACB 1N9RA 2CT3A 4UC4A 4HVWA 2RK2A 2EAYA 2M16A 1X6GA 1AWXA 4KGXB 1NYFA 2EYQA 3JCMQ 3OS0A 4EMKB 3KXTA 2QTXA 4JLGA 1QCOA 1SHGA 4Z89A 4A63B 1QKWA 3NTHA 1Y0MA 4M7AG 2MAMA 1WQ7A 2J7IA 3V8KA 3R6NA 4PJLA 2EKHA 1EIFA 2OTJT 4XTZA 4PJJA 3X28B 4LDWA 3VS2A 3CCSA 2LTOA 2HAXA 3RMSA 3LWHA 2K79A 4N4IA 2NUPA 4PKCC 1JJ2P 1E7OA 1UG1A 3EH1A 3GNGA 3HP9A 3F70A 4QVZA 3TU4K 4QQDA 1OPKA 3I56T 2CP0A 3THKA 1Q7YR 4L59A 3G7ZA 2NUTA 1K73U 3DLMA 1AEYA 2L2PA 1YNZA 1VQ5A 2K3XA 3H0IA 5L8RE 2AHJB 2EFIA 5CVIA 4ELZC 1VQKT 4FU6A 4II1A 4HT8A 1IO6A 4C8QG 4M7DA 4E6RA 2KAFA 4PJOD 2CZ6B 2X3XD 5KH6A 3I9QA 1JQQA 2EQKA 5DY9A 3PIPA 2K57A 4M75E 5LJ3h 2RQVA 3EGDB 3MHXA 5KYUA 2GTJA 5FROA 3CCEQ 3WXMB 2DJZA 1Y96A 2ZPIB 2YLBA 2VGMA 5GMKj 1FMKA 3CMAQ 1Q82C 2MWPA 5HKCA 2O9VA 3X26B 2JTFA 4DA4A 2ZPHB 3JCMc 2IG0A 1OYXA 1HK9A 2MF2A 4HXJA 4MZMA 4Z88A 5GAMe 1FMWA 1QLYA 2QQBA 1MMDA 4RTXA 4X9CA 1NG2A 4A4GA 1VQNA 3M4YA 4A4HA 1BKBA 2D6FA 2A3LA 2DEUA 5KYWA 5LJ3e 3CCSQ 1G3SA 3A8MB 2DZCA 8AT1B 4M77F 2DF6A 2J06A 2COWA 1FMVA 2LC4A 4M77B 5GAN4 1MMAA 2HL5C 1V29B 1UECA 2QGGA 3TVTA 2KYMA 3FJPA 3QHSA 4E7SA 1M1KU 4QKUA 1JJ2S 3G71T 3EGUA 2RI5A 1E6GA 4XTXA 1KD1C 3CCMA 1VQ5Q 2CH4W 3VV0A 4F04B 3C94A 2FRWA 2YXYA 4QVCA 3EG1A 4RTVA 2XDDA 1Y7XA 2QDLA 5GAMf 1YJ9T 1Z9QA 1XQHA 3QYGB 2H8HA 1RAIB 4JZ3A 2LCCA 2WSFE 3RKYA 3PGGA 1M4ZA 1T3LA 4ORZA 4J6YA 2ZAEA 1MV3A 2DMOA 2FPEA 4F17A 4RUGA 1QVFA 2EIFA 3RR6A 4F7UG 4DBHA 3EG2A 5LJ3d 5DLOA 2EJFA 2DIQA 4IUPA 3TQ7P 2JUFA 4E47A 1AT1B 2C0OA 4WF2A 1T0HA 2RQRA 4PNOA 4OB2B 2ROLA 1VQNQ 2AZSA 4QQGA 1RAHB 1KK7A 2HQEA 5KE3A 4ZN1A 3CD6T 2HQXA 4LN2A 4KGVB 1HSQA 5GANh 1PNJA 1UGVA 1D3BB 2XHCA 2JTMA 3H41A 1ACMB 3HL8A 2EJGA 3O8VA 2K2MA 4O6JA 2Y90A 1GFCA 4MMLA 3L2WA 3OSVA 1I07A 4L5GA 5AT1B 2BIVA 5LL6S 1N6AA 2K3BA 1Y07A 2D0QB 1SHFA 1PG5B 3CCMQ 4N4HA 3REAB 1W4SA 1D1CA 1BI3A 2COZA 2K5LA 3CBOA 1VQ8T 3VUZA 2KE9A 3JB9F 1YCSB 3ZFJA 5GAOq 3O5ZA 3RESA 2RM4A 1I1JA 4FYWB 5GANe 4M78E 2DLPA 1R0CB 3E19A 2KK4A 2ED1A 4C92E 1V76A 2CP2A 2CREA 4C5IA 4B9WA 3QJYA 5IN1A 3OSSC 5J26A 1WGSA 2YRCA 2YUNA 4JPBW 1X27A 1VQ6A 2RN8A 3FC3A 2SEMA 1KQ2A 2L3SA 5FW9A 2FRYA 2QK0A 4ZN3A 2F1LA 3V7CA 3M0QA 4M7DG 4MDWA 2RB6A 1YJWT 3FRNA 2FO0A 1O75A 2DILA 3CMAT 1RL2A 3OW2P 2KDSA 2GF7A 3CCRA 3CC2Q 1Q7YC 2SRCA 5GAN5 1K9MU 4J83A 4OF1A 1IRXA 1LNXA 4M7AB 2EGEA 1TS9A 3HFNA 1WJSA 4XAXB 3VUBA 3AHUA 2RHUA 2K3YA 2O4XA 3OMGA 4XTUA 5IAYA 2E64A 2KMTA 1KC8R 1P92A 4M75F 5L23A 4NL2A 4OB1B 4IUUA 5GANd 2L0AA 3QDFA 4A4KA 4M4ZA 2DRKA 4M75B 1KQSP 3EG0A 2QQ9A 4Y91A 3CBMA 1ZSGA 3HFOA 4RTZA 2KT8A 2KEAA 4ZGJB 1A0NB 1IREB 3CC4T 4JS4A 4KRTA 3FIFA 5CK9A 2MMPA 4XU3A 1WA7A 2AZVA 3JCMb 2QEXA 5LJ5h 4KT0E 4NL3A 1OOTA 1NPRA 3PIOA 1X6OA 2D8HA 3Q1JA 1VQ5T 2DL7A 1WI7A 3CXCP 1OZ3A 2LZ6B 1W2BP 1SRLA 2P0PA 1NLOC 1WNLA 3CQTA 2KI7A 1U1SA 2DYIA 3EG9B 2YRDA 3SFMA 1TTHB 1VYUA 2YWWA 1RLQC 3M54A 1PKSA 4J7FA 2PVOB 3QJ6A 4KULA 3VRYA 4EIKA 3VS6A 2NLUA 2QDYB 1K73R 1RADB 2E4HA 2VXEA 3GIBA 4KGZB 3OYIA 4OMLA 3CCRQ 2D1XA 3A8GB 5LJ5e 3HRUA 3I55T 2A0FB 4KBMB 1H92A 1T3SA 2ENMA 2MOXA 1OU8A 1IHWA 1B34B 2QG9B 3GNFB 1GXIE 2MWOA 1H8KA 1N8RU 2DE0X 2FB7A 2LX7A 5FU7B 1IB8A 2FPFA 5CR2A 5KYYA 2FG0A 5DLQE 4J6XA 5GAN6 2DTIA 4A53A 3UA7A 4CC2A 4OB3B 4M77E 4FYYB 4FT4A 1XTDA 1WHGA 1Y71A 4HA8A 2X4XA 3CCUA 1QVGA 3LX7A 1VQLA 2DEQA 4FW2A 4M78C 1PWTA 1X43A 2X4WA 4EMGA 2K6DA 4GBQA 3RIRA 1TWBA 2CGHA 4OMOA 2L8DA 2QA4A 1KQSS 4CC7A 1D09B 2PU9B 2EYYA 2R58A 1T0JA 4BDZA 4CC3A 1XOVA 1UHCA 4NOYA 4PFOA 2LMJA 4N4GA 2LQNA 4M7AD 3M0PA 2LT1A 4E7KA 2M0OA 4Y28E 1VQ4A 1RLPC 1ZHIA 2DXBA 5LJ5d 4L6V5 1VQ7A 4PJOB 2JM9A 1WDXA 2W10A 3L2ZA 2R57A 1RAEB 3CXCS 3MCAB 3JCMJ 2E3HA 1W2BS 1ZBXA 2IVWA 1AZEA 1Q86U 2O01E 1WX6A 3UATA 1M1KR 3LH0A 3V8JA 2BZ8A 1VYVA 1IHVA 4OGEA 4IUVA 1Q81U 4LD9K 1AD5A 2RD1A 4A4FA 2DA9A 2AK5A 3MJXA 5J39A 3FJ5A 4F16A 2VASA 5HY6A 3M0TA 1QCFA 4JDSA 2BUDA 1K8AU 1RAGB 3C95A 1M1GA 2H3EB 4BB7A 4F7UA 3JCMX 1NJIC 2MIOA 3HTRA 3LWIA 4M78F 1G3YA 4C8QD 3RKWA 2OTLT 2DD4A 2F5KA 2ATCB 3C0CA 2FEIA 1HJDA 4C92F 1JEGA 2RJEA 3EGXA 2FZKB 2CP5A 5D7UA 1D1AA 3TSZA 4FCYA 1FXXA 3CCUQ 1IXDA 3HPWA 1X6BA 2E6ZA 3R6OA 2DO3A 5CQYA 2KNBB 3NFCA 1YHQA 1GBRA 3JB9G 3CMEA 2WSCE 2DK3A 1X01A 3UWNA 2QA4Q 2G6FX 3V7SA 2VV5A 1I81A 3ZEHA 4XU2A 3CCJQ 1GFDA 1KHIA 1DJ7B 1IGUA 1UJYA 1BK2A 1OPLA 2PUOB 1I5LA 4HCCA 1ZA1B 3JCMd 1VQ4Q 2LJ0A 3U23A 1VQ7Q 1PHTA 4CRIA 4ZGDB 3OYNA 1Z9ZA 5LJ3j 4M78A 2FZCB 2AKLA 1LOJA 1SG5A 3PFSA 3JCMV 2EGCA 4X1VA 4IKFA 2RNAA 3BE3A 1FX7A 2XDBA 3NTIA 1VQOQ 1VQ6T 1UEBA 5CKBA 3OYMA 3A5ZB 2V8JA 2BE9B 4OP0A 2EYXA 5D6WA 1VOMA 1S72Q 3CEYA 4M77C 2GBQA 2OI3A 3REBB 4J9FA 3HSBA 5KYUB 3G6EQ 4M7AE 2A37A 1G8XA 4J8OA 4LUDA 1Y96B 2YUOA 1JU5C 3M5AA 4JJDA 1VUBA 5GAMh 3ZBDA 3EFOA 2PTKA 1Q82U 2L89A 4AFUC 2MK5A 3DLLA 2PVDB 2P84A 3A1PA 3EH2A 1M90R 2P0KA 5J3BA 3CPWP 2O88A 5GAOm 1YI2A 4JRIA 1YHQQ 2GGRA 3CMEQ 3MEWA 2DL4A 1M2OA 2JMAA 2NWMA 1WYXA 2P4TA 3PVLA 2LQWA 1WHHA 5I22A 5KYWB 1M1FA 2QASA 1YWOA 3CCVT 1M3BA 4HVVA 1B07A 1ZX6A 3VS5A 2VYTA 3TSWA 4BY6B 2LCSA 4C8QE 3ER0A 2ECZA 2XI9A 2XD0A 2QEXT 1N5ZA 2NUZA 1Y57A 1H3ZA 2FVUA 3RMQA 1VQMQ 2L5QA 3J7AF 2FHDA 3QWYA 3EGDA 1KD1U 1QCNA 1SKUB 3OW2A 2HBWA 4JZ4A 3L1AA 1YFNA 5IHKA 1VQPT 2QTVA 4RTTA 4LDYA 1QWFA 1VIEA 1NYGA 2E6NA 3JAME 4WTOB 4RCCA 1M27C 4KH0B 5IHIA 3M58A 3V7RA 1W70A 2Z0WA 1QMCA 1YIJA 4FYVB 1YITA 3V8LA 3VS7A 2MI6A 3OYCA 3X20B 3PMTA 1AWJA 2EVRA 3UDCA 4PLIA 3FEOA 3WVDB 3RKXA 1TUCA 4AG2C 5GANj 3OYDA 2PZ1A 1MNEA 2GFAA 3CPFA 2RF0A 4AFQC 2ZCFB 1I5OB 2DERA 5EC7A 4HCBA 3QIIA 5GAMd 2ABLA 2LDMA 3NGPA 1ZA2B 1YI2Q 3I5SA 1SEMA 1WZOA 2QGFB 4Y92A 3S3MA 1KQ1A 4FT2A 2LNHB 2KSSA 4M77A 3NTKA 3CCQT 1M8VA 3CPWS 4OMQA 3E9GA 4M7DD 3GOXA 5I2MA 1VQLT 2Y4YA 1EX4A 2E1HA 2LRQA 3MPUB 2QA4T 5IH2A 2KYBA 1N8RR 5FLXE 4QW2A 2DTHA 5GAOr 5GAN8 2LQKA 3CC2A 1PKTA 2X35A 4PJOE 3GPLA 2JT4A 1GCQC 2F69A 5IHNA 4B6MA 2V8KA 1UB4A 5KCOA 2JN0A 2RH2A 1VQ4T 2D9TA 3MEUA 3SDZA 4LDUA 2LVMA 2O9SA 3M55A 5I2SA 3GLXA 4ZGEB 2RA2A 2HD0A 3J80E 2RHXA 3QZ5B 3URGA 2CSIA 2COYA 1YIJQ 1YITQ 4J9CA 2XMFA 2BTTA 1MV0B 4M78G 4FL6A 2QQRA 1SPKA 1IZ6A 2GTOA 4M75C 1NPPA 4DBFA 1RABB 4C92G 1G5VA 3PMIA 1OQKA 1ZSZB 4DBRA 2C0IA 1FWZA 1RI9A 3H0HA 3P8HA 1QVPA 3KUFA 4HT9A 1D3BA 4FIBA 1WHKA 4GLKA 2L3QA 5M9OA 4PFPA 2ESWA 1G3TA 3MO8A 1WIEA 1B7TA 2HKNA 2I0NA 3SWNB 3E2UA 1Q81R 2JMCA 2KRMA 1Q7YU 2J05A 2YUQA 2YHTA 2E5KA 2ZZDA 4E7LA 3MEAA 2EBPA 1FYNA 4RTWA 4BE1A 3P8BB 4BACA 3CCET 1UE9A 3OBYA 2O4XB 2JVVA 2KT1A 3EG3A 3A8LB 3VS1A 2P0QA 1SRMA 2RQWA 2EYWA 2DAQA 5LJ5j 4M7AF 2ED0A 2GQVA 5KYXA 2J6KA 2E10A 3M0RA 2RHZA 5FRNA 5A2QE 1AOJA 1QP3A 3CC7Q 4AT1B 3S6WA 2HL3A 4PLLA 4JS5A 3MP1A 1VQ9Q 1X69A 2LNVA 2ZPFB 2ZGWA 1CSKA 1VQKA 3JB9J 1AWWA 1VYTA 3OYGA 1M3CA 4K11A 1M90C 4J9BA 5FU7C 3IQLA 5CKFA 2B8AA 3CCST 3MP6A 2E3IA 3NMZC 2PNIA 1G83A 5D6YA 1JRIA 4JRKA 2YSQA 2EYZA 5GAOl 1GCQA 4EDUA 4B9XA 4IUQA 1BI1A 1ZBJA 1YCYA 3M53A 1TUGB 5I11A 2KXCA 3H9NA 3L42A 4C8QF 2KRNA 1C1AA 1S1NA 2LP5A 1JB0E 4AFSC 4C8QB 1NM7A 1JXMA 3QBYA 5GJWB 1UFFA 1MUZA 4ESRA 4QVDA 3QSUA 4E7HA 1OI1A 1OV3A 1M2VA 5A0LA 2M0YA 2JM8A 5LJ3g 4O5VA 2DJQA 4ATOA 1ARKA 2OTJQ 2CZ0B 1U5SA 4M75A 1WHLA 5FU6B 1MNDA 4PJOC 2J6OA 2CSQA 5GMKi 5KYYB 3SEMA 2VGNA 6AT1B 4ZNXA 3X25B 3DB3A 2O2OA 2DTOA 4M77G 4RCBA 5KYNA 3OYKA 1NEGA 2DXTA 1V1CA 4J9EA 1JJ2A 3HHTB 3P8DA 3QDRB 2VC8A 2XIDA 4J9IA 2DVEA 1VQNT 3X24B 4RG2A 1VQKQ 2JZ2A 2FPDA 2LT4A 3LGFA 4ANJA 1K9AA 2E70A 4EMHA 4IURA 3BDLA 1ZQ1A 1G2BA 1YJ9A 4C0FA 3QKJA 3ULRB 1M3AA 3JB9D 2KR3A 1U8RA 1UTIA 2EQIA 1D1BA 3EAEA 4OVAA 3CCLA 3DKMA 4C92C 1U1TA 4JUVA 2H3JA 3CCJA 2V26A 2A28A 4CI0C 2AKKA 1PSFA 1TOVA 1YIJT 2HMAA 1LJOA 2WACA 1B34A 3CCMT 4PJOF 4QT7A 1BCMA 2CKKA 1KD1R 4A4EA 3JB9H 4EMKC 5FWBA 4JJBA 1CKAA 3NPFA 2RJFA 1OX9A 1W1FA 1JXOA 3M56A 2DXCA 2CUDA 3NHNA 1AZGB 1SSFA 5C0MA 1YJNA 1BU1A 4F7UB 2EW3A 2V1QA 1PM3A 3RERA 3ASKA 1NJIU 1QVFS 3QWXX 3PE0A 1C6VX 1MHNA 1VQOA 3OQ5A 3QUIA 1WFWA 2YT6A 2RPNA 3M0UA 2JTEA 4LNPA 4E2FB 2HSPA 1S72A 3G71Q 3TEEA 3G6EA 2GNCA 1BCOA 2ZPBB 2K9GA 2CYZB 1VIFA 3SHWA 2EWNA 5GAOn 2BZXA 2EQUA 3DB4A 5GANg 1VQ8A 3CC2T 4V2SA 2RK1A 1PRMC 2KVQG 3WVEB 2VB6A 2CH4A 3LYIA 2R5AA 4A54A 5HK0A 1YJ9Q 3JSCA 5CKEA 2CZ1B 2E5QA 4J9GA 4RTUA 4E7IA 1MGQA 2KROA 2DZ9A 2YLCA 3UF4A 1I8FA 3G4SA 3CCLQ 3GBQA 1Q95G 1UGQB 3QG1A 1CKBA 1GCPA 4OMFB 2RO0A 3HRTA 2BKDN 2XICA 3OYYA 4AG1C 4C0DB 2LCLA 2OJ2A 2OAWA 2A36A 2CUBA 1OZ2A 2BE7D 2GFUA 5GAMj 3QYHB 2NUPB 2XG8D 4JLIA 4KUDK 2VXFA 1TXQA 5AYFA 1TUDA 3JRZA 5I21A 2J6FA 3S3OA 1K0SA 2L3PA 2R5MA 2YUPA 2C0TA 4J7IA 4FW1A 1M9SA 3EFRA 4RG8A 2M02A 1YP5A 4BY6C 2B86A 4PJNA 3CD6Q 1G3WA 4LDVA 3VS3A 1VQMA 4WCIA 4C92A 2NUTB 2XK0A 1YJNQ 3JCMf 1NZ9A 3VYGA 1TH7A 1KC8C 4M7DF 4MZPA 1WLPB 1WJQA 1PC0A 1TG0A 2QI2A 2KRSA 3L2UA 3EFOB 3LLRA 4MDXA 2HNIA 4X34A 4M7DB 4XQ3A 3RUXA 5FWCA 9ATCB 4KUIA 3OYHA 1N27A 4IUTA 3PT9A 2F2VA 2M9UA 4EMKA 2DFUA 2WSEE 1PD0A 2F5TX 4M75G 3M59A 3J81E 1R0BG 3CCRT 3CC4A 1VQ8Q 2X3WD 3OS5A 2HBPA 1GBQA 1HD3A 2QYZA 1KJWA 4Z02A 3KBGA 3G1JA 1UDLA 1UHFA 1QVGP 2HDAA 3TREA 4MZTA 2OAUA 3G4SQ 4D6WA 1D0YA 5GAN7 4DEXA 3LGLA 3M57A 2RI2A 2DYBA 1K9MR 1R77A 4ELYC 1K73C 3JCMP 1YBYA 1YJWQ 4RKUE 5LJ5g 2CP7A 2IPOB 1K4US 3JCMW 2JXBA 4X9DA 3L2VA 4FSSA 2A7YA 2EQMA 2D0NA 4HVUA 1XJWB 2X4JA 4R0KA 2FZGB 1BIBA 3I55A 4AFZC 2DKGA 4GLMA 1RI0A 4C5EA 4IIOA 5FRMA 1QWEA 2Y4XA 4JRPA 1KG1A 1WPYA 2DNUA 1X2QA 3TCJA 4JJCA 4BE2A 3M9QA 7AT1B 2RHIA 1N9SA 2EQJA 2AT1B 5CO7A 2HQHA 4M78D 4DQ2A 3GP8A 3PVQA 4PFZA 3OYAA 1R8OB 1HYOA 4C92D 4XK8E 3QPHA 2RI3A 3CC4Q 3EHRA 1RUWA 2VVKA 2HEQA 1UJ0A 2D8JA 2L3RA 2M1HA 5GMKh 2VUBA 1KQSA 5GJVB 3E9FA 1JO8A 3MEVA 1M5Q1 2RQUA 3I5RA 3BDUA 1OEBA 4PL6A 1ZUKA 3T9NA 1I4K1 2FYKA 1ZSZC 4KH1B 4D8DA 2RQTA 4DOWA 1WJRA 1K76A 1ZLMA 2V8IA 1QVGS 1EFNA 1QKXA 1M1KC 3CCUT 3INZA 4N0AC 5KCHA 2DRMA 4PJOG 1NE8A 3CXCA 3SWNC 3SD4A 1YN8A 1W2BA 4E7ZA 3CCLT 1U3OA 3D7SB 3JCMg 4J9DA 5A0DA 3MKDA 4C0ZA 1W6XA 3UPUA 1JBMA 5LJ3f 1ZUUA 4HCKA 4NS5A 3CCJT 5GMKe 3E1SA 1PSEA 4F14A 3I35A 3I55Q 2K5IA 8ATCB 3CC7A 3VS0A 2EJ9A 1K0XA 5CKDA 3SB2A 4Q5WA 1VQ9A 2CDTA 2E65A 1QQJA 2M51A 2ZPEB 4BI8B 5CQXA 4BUGA 4M7AC 4GY5A 1VQ7T 2JS2A 4F7UE 1M30A 4XTYA 3PTAA 2OTLA 5CAIA 4QQ6A 5KE2A 3ME9A 4J9HA 2GCXA 1YJNT 2CS7A 4C0GA 2KQWA 3KFVA 1WXBA 2K7AA 1TU0B 2DXUA 5GMKm 2CP6A 2HZYA 1BBZA 1VQOT 2JW4A 2QAZA 1J3TA 4FYXB 1M8MA 5IXFA 2CP3A 1WQWA 1S72T 1NLPC 2V1RA 3G6ET 2K4YA 4JJNK 5CCAA 2K2VA 2P4RA 5HCKA 2DM1A 4OMNA 2O31A 1WHJA 1Q86R 1ABQA 5GAOp 3OBWA 3N5BB 4RMOA 5KYXB 2EPDA 4EPCA 1NJIR 3A8HB 2EGAA 4C8QC 2OTJA 4D8KA 4ME7A 3FDRA 4LUEA 1D0XA 2BZYA 4OMPA 1YHQT 4P5NA 1K8AR 3G4ST 3CMET 3VJPA 1GRIA 2CZ7B 3VU3C 3ZL7C 5FU6C 2DPPB 1ZUYA 3FLGA 3RNJA 1PD1A 3GF5A 2KGTA 5IT9E 3M4GA 2C06A 4M77D 3OS1A 1M90U 1ZSZA 2EKOA 2RJDA 2XKOC 1KSWA 2LJ1A 3C12A 2DL3A 3I56A 3M0SA 1UGSB 4C5HA 2X9HA 1O9SA 1H3HA 1XNIA 1LCKA 1SF9A 4N0AA 3OA6A 2OTLQ 3SWNA 1BB9A 3META 4M7DE 4HKEA 1BI2A 1VQMT 3AT1B 2DD5A 4E7JA 2MCNA 2QQAA 1AWOA 3H0FA 3RBBB 3JV3A 3BY7A 4LXCA 1VA7A 5GANf 4VUBA 2DETA 3FB9A 1M2VB 1WXTA 1RAAB 4PJMA 4YTLA 1WHMA 2CT4A 1K9MC 3OMCA 3OY9A 2PQWA 1PRLC 4BD3A 4M7AA 5GAMg 4JRQA 3HKSA 1AVZC 2X51A 1K1ZA 3CCVA 3BFMA 2VWFA 3UT1A 3A98A 2W0ZA 2I2LA 1OX8A 3VYHB 5GAN2 3PNWC 1EZZB 1YWPA 1BYMA 4R55A 1IGQA 3OB9A 2E12A 2HKQB 1OULA 1UGPB 1QVFP 2JOYA 1X75C 4XTVA 4J6WA 1NBEB 1YI2T 5CKHA 4J5YA 2F2WA 2YRVA 1KHCA 4BI4A 2YDLA 2JJ9A 3H6ZA 3VRZA 3LW5E 4FM4B 4OB0B 1VQ6Q 1VQPA 4DBQA 3OYEA 4CC4B 1Q82R 3QXEB 4LD6A 2RHYA 2PUKB 2A08A 2KBTA 3G71A 3I56Q 2DBMA 1WXUA 5HK3A 4C8QA 5GAN3 4PK4A 3BW1A 3C4SA 2LX9A 1UGRB 4LE9A 3L2RA 3EG9A 2IIMA 2PVGB 1U06A 2DIGA 4ZTJA 3OW2S 1HXDA 3OYFA 2VKNA 3VKIA 1ABOA 1QP2A 3RDVA 1BIAA 1H641 3OYBA 1KIKA 1LPLA 1KFZA 1AHJB 3CCQA 2MYSA 4XTWA 2XDPA 4MMKA 3EFSA 3S3NA 5C6SA 3HRSA 4Z8AA 1YITT 3CPWA 3CCVQ 1UUEA 3OYLA 4LDXA 3JB9I 1N8RC 3MP8A 4OGCA 4C0DC 2XU8A 3H8ZA 5EG2A 4ZTFA 2DL8A 4XU0A 3JCMh 2FL7A 2QEXQ 3EHQA 4FSXA 4BI3A 4F7UF 3CD6A 1RAFB 4TVRA 2DVJA 2OX7A 1NEBA 3CBPA 3OYJA 4OMMA 2ROTA 2GQIA 5LJ5f 4HCZA 2QQSA 3L2QA 5CIUA 5ECAA 4RTYA 2DX1A 3EGXB 1F1BB 1VQPQ 1I0CA 1SSHA 1E6HA 1GL5A 2E41A 2G3RA 2X4YA 5DM7R 1BI0A 2KY9A 2K5FA 4M7DC 4M75D 4DOVA 4XU1A 2JS0A 2ZPGB 4C5GA 5GMKl 5A0GA 4BDYA 5D6XA 5IXBA 2LQ8A 3OS2A 3JCMe 4PJOA 1X2KA 2QXFA 3A8OB 3UA6A 4IIMA 3CC7T 1B3QA 1QW1A 4AMCA 2F2XA 3QO3A 1Q86C 1VQ9T 4R56A 2KXDA 2LJ3A 1PCXA 4BE0A 1C0MA 1MMGA 1Q81C 2JNGA 2DL5A 2MPXC 1TSFA 2NYSA 2RJCA 4M78B 3CCQQ 2RMOA 3VS4A 1D0ZA
chains in the Genus database with same CATH topology
4C92B 4BE2A 2VXEA 3KUFA 1K8AC 3M9QA 3GIBA 2RHIA 4HT9A 3OYIA 1N9SA 1D3BA 2EQJA 3QZ9B 4FIBA 3A8GB 4GLKA 1KC8U 3CCEA 5LJ5e 3HRUA 3I55T 5M9OA 5CO7A 1YJWA 1G3TA 4KBMB 3CMAA 3MO8A 4M78D 4DQ2A 1N9RA 1B34B 3GNFB 3SWNB 3GP8A 4UC4A 1GXIE 3OYAA 2MWOA 1R8OB 1Q7YU 4C92D 1N8RU 2RK2A 2EAYA 2YHTA 2ZZDA 2FB7A 5FU7B 4E7LA 2M16A 3MEAA 5CR2A 4XK8E 5DLQE 4BE1A 4J6XA 3QPHA 2RI3A 5GAN6 2DTIA 2EYQA 3P8BB 4A53A 3JCMQ 3OS0A 4BACA 3CCET 3OBYA 4OB3B 2O4XB 2JVVA 4EMKB 3KXTA 2QTXA 3A8LB 2P0QA 4JLGA 4M77E 2L3RA 2M1HA 4FT4A 2VUBA 5GMKh 1KQSA 1XTDA 3E9FA 3MEVA 1M5Q1 3NTHA 4M7AG 1Y71A 2MAMA 4HA8A 2X4XA 3CCUA 1WQ7A 2DAQA 3BDUA 5LJ5j 3V8KA 1QVGA 4M7AF 2GQVA 4PL6A 3T9NA 3LX7A 1VQLA 2E10A 1EIFA 1I4K1 2FYKA 2OTJT 2DEQA 2RHZA 4XTZA 4M78C 3X28B 5FRNA 5A2QE 4LDWA 2X4WA 4EMGA 1QP3A 4DOWA 1KQSS 3RIRA 2CGHA 3S6WA 2LTOA 2L8DA 3CCSA 2QA4A 4PLLA 3RMSA 4JS5A 2HAXA 3LWHA 1WJRA 3MP1A 2PU9B 2LNVA 2V8IA 1QVGS 2ZPFB 2R58A 4N4IA 4PKCC 1M1KC 4BDZA 3CCUT 3INZA 4N0AC 2ZGWA 5KCHA 1XOVA 3GNGA 4PJOG 1NE8A 3CXCA 3HP9A 1VQKA 3SWNC 3F70A 4NOYA 3SD4A 4QVZA 4N4GA 3JB9J 3OYGA 3TU4K 4M7AD 4QQDA 1W2BA 1M90C 5FU7C 3JCMg 3CCLT 2LT1A 5CKFA 2B8AA 2M0OA 4C0ZA 5A0DA 3CCST 3MP6A 4E7KA 4Y28E 3I56T 1VQ4A 1ZHIA 3UPUA 1JBMA 2DXBA 5D6YA 4L59A 4L6V5 5LJ3f 5LJ5d 1VQ7A 4PJOB 4NS5A 3CCJT 3G7ZA 1JRIA 3L2ZA 4JRKA 5GMKe 2R57A 3DLMA 3E1SA 1K73U 3CXCS 1PSEA 3MCAB 3JCMJ 5GAOl 1VQ5A 2K3XA 2K5IA 4EDUA 4B9XA 4IUQA 5L8RE 1BI1A 1W2BS 2AHJB 2EFIA 5CVIA 4ELZC 1ZBXA 2IVWA 1YCYA 2EJ9A 3CC7A 1Q86U 1VQKT 2O01E 5CKDA 3SB2A 4FU6A 4II1A 3M53A 4Q5WA 1VQ9A 4HT8A 2E65A 4C8QG 4M7DA 2ZPEB 4BI8B 2KAFA 3LH0A 3L42A 5CQXA 4PJOD 2CZ6B 3V8JA 4C8QF 4BUGA 4OGEA 4M7AC 4GY5A 4IUVA 5KH6A 1Q81U 4F7UE 1VQ7T 4LD9K 2RD1A 4A4FA 2EQKA 5DY9A 4XTYA 2K57A 5J39A 4M75E 3PIPA 5LJ3h 3PTAA 3MHXA 2OTLA 5CAIA 1JB0E 4QQ6A 4C8QB 5KE2A 5FROA 3WXMB 2DJZA 3QBYA 1Y96A 3ME9A 5HY6A 2ZPIB 2YLBA 4JDSA 2VGMA 4QVDA 3QSUA 5GMKj 4E7HA 1OI1A 2GCXA 1YJNT 2BUDA 1K8AU 3C95A 1Q82C 2MWPA 1M1GA 2CS7A 4C0GA 2KQWA 5A0LA 5HKCA 4BB7A 5LJ3g 4O5VA 4ATOA 2DXUA 5GMKm 3X26B 4F7UA 3JCMX 2JTFA 1NJIC 4DA4A 2CZ0B 3LWIA 1VQOT 4M78F 1G3YA 2ZPHB 4M75A 4C8QD 3JCMc 5FU6B 3RKWA 4PJOC 2IG0A 2OTLT 2DD4A 2F5KA 1OYXA 1HK9A 2MF2A 4C92F 4MZMA 5GMKi 2RJEA 5GAMe 1WQWA 1S72T 2QQBA 4X9CA 3G6ET 4A4GA 1VQNA 1FXXA 2K4YA 3HPWA 5CCAA 4JJNK 2VGNA 2K2VA 2E6ZA 3R6OA 3M4YA 4A4HA 2DO3A 5CQYA 1BKBA 3NFCA 2D6FA 2A3LA 1YHQA 5GAOp 3OBWA 3N5BB 3JB9G 3CMEA 4RMOA 2WSCE 3X25B 2DK3A 3DB3A 1X01A 2DTOA 4M77G 4RCBA 3UWNA 5LJ3e 1G3SA 3A8MB 3V7SA 3OYKA 2DZCA 4EPCA 2VV5A 2DXTA 1I81A 3A8HB 4M77F 3ZEHA 4C8QC 4XU2A 1JJ2A 3HHTB 3P8DA 3QDRB 2VC8A 2OTJA 2XIDA 1VQNT 2DVEA 2LC4A 3FDRA 4ME7A 3X24B 1KHIA 4M77B 5GAN4 1DJ7B 1V29B 4RG2A 2JZ2A 2LT4A 3LGFA 1YHQT 2E70A 2PUOB 4P5NA 3FJPA 3QHSA 4EMHA 1I5LA 3G4ST 3CMET 4HCCA 4IURA 3BDLA 1M1KU 1JJ2S 1ZQ1A 3VJPA 3G71T 2CZ7B 3VU3C 3JCMd 1YJ9A 5FU6C 4C0FA 2DPPB 3FLGA 3QKJA 4CRIA 3GF5A 4ZGDB 2RI5A 5IT9E 3JB9D 3M4GA 3OYNA 2C06A 1U8RA 4XTXA 1KD1C 3CCMA 4M77D 3OS1A 5LJ3j 1M90U 3VV0A 3C94A 3EAEA 4M78A 2EKOA 4OVAA 2RJDA 2XKOC 3CCLA 3DKMA 4C92C 4QVCA 1LOJA 1U1TA 3C12A 3PFSA 2XDDA 3I56A 3JCMV 1Y7XA 4JUVA 2H3JA 3CCJA 1UGSB 4C5HA 4IKFA 5GAMf 1O9SA 4CI0C 1YJ9T 1PSFA 1XNIA 1XQHA 1YIJT 3QYGB 1FX7A 2XDBA 3NTIA 4N0AA 3OA6A 1VQ6T 1LJOA 1UEBA 2WACA 1B34A 5CKBA 3CCMT 3SWNA 4PJOF 3OYMA 3A5ZB 2LCCA 2WSFE 2V8JA 3RKYA 3PGGA 3META 2CKKA 4OP0A 4M7DE 1M4ZA 1BI2A 4HKEA 5D6WA 4J6YA 1VQMT 3CEYA 4M77C 4A4EA 2DD5A 4E7JA 3HSBA 2QQAA 3JB9H 4M7AE 4EMKC 1QVFA 2EIFA 4F7UG 4J8OA 1Y96B 2RJFA 3BY7A 5LJ3d 5DLOA 3M5AA 3M56A 5GANf 2DXCA 1VUBA 4VUBA 3ZBDA 5GAMh 2EJFA 3FB9A 2DIQA 4IUPA 1Q82U 1SSFA 5C0MA 1YJNA 2JUFA 4E47A 4YTLA 4F7UB 1K9MC 4WF2A 3RERA 3OMCA 3OY9A 2L89A 3ASKA 1NJIU 2PQWA 4PNOA 4BD3A 3DLLA 2PVDB 1QVFS 4OB2B 4M7AA 1MHNA 5GAMg 3HKSA 4JRQA 1VQOA 4QQGA 3OQ5A 3QUIA 3CCVA 2P0KA 3BFMA 2HQEA 5J3BA 3UT1A 5KE3A 4ZN1A 5GAOm 2I2LA 4JRIA 1YI2A 3CD6T 2HQXA 3VYHB 5GAN2 3PNWC 3MEWA 5GANh 1S72A 1D3BB 3TEEA 4R55A 2XHCA 2JTMA 3G6EA 1BYMA 3OB9A 2P4TA 2E12A 2ZPBB 3HL8A 1UGPB 2CYZB 2EJGA 1VIFA 3O8VA 4O6JA 2EWNA 1M1FA 2JOYA 5GAOn 1X75C 4XTVA 2EQUA 3DB4A 5GANg 2Y90A 3CCVT 1VQ8A 2RK1A 4J6WA 3CC2T 4V2SA 4MMLA 3L2WA 3OSVA 1YI2T 2KVQG 3WVEB 4L5GA 2VYTA 5CKHA 4J5YA 4BY6B 2YRVA 4C8QE 1KHCA 3ER0A 2R5AA 3LYIA 4A54A 4BI4A 5HK0A 3H6ZA 2XI9A 3JSCA 2BIVA 3LW5E 5CKEA 5LL6S 4FM4B 1N6AA 2CZ1B 2XD0A 2QEXT 2E5QA 4OB0B 1Y07A 1VQPA 2D0QB 4E7IA 4N4HA 3OYEA 1MGQA 1W4SA 1BI3A 3CBOA 2K5LA 3QXEB 2FVUA 2DZ9A 2YLCA 1H3ZA 4LD6A 2RHYA 2PUKB 1I8FA 3G4SA 1VQ8T 3RMQA 3VUZA 3G71A 3JB9F 2L5QA 3J7AF 1UGQB 3QG1A 4OMFB 2FHDA 3ZFJA 5HK3A 2RO0A 3HRTA 3RESA 5GAOq 2BKDN 2XICA 4C8QA 5GAN3 1KD1U 2RM4A 3BW1A 3OYYA 4C0DB 5GANe 3OW2A 3C4SA 2LCLA 2LX9A 3L1AA 4M78E 1OZ2A 3E19A 2GFUA 1UGRB 5GAMj 1VQPT 2KK4A 3QYHB 4C92E 4LDYA 3L2RA 2XG8D 4JLIA 4KUDK 2VXFA 1VIEA 2E6NA 4B9WA 4C5IA 3JAME 2PVGB 4RCCA 3QJYA 2DIGA 5IN1A 4ZTJA 5AYFA 3M58A 3JRZA 3OSSC 5I21A 5J26A 3V7RA 3OW2S 3S3OA 1YIJA 1HXDA 2R5MA 1WGSA 1YITA 3OYFA 3V8LA 4J7IA 1VQ6A 3FC3A 2MI6A 3VKIA 3OYCA 1M9SA 3X20B 3EFRA 1QP2A 4RG8A 4BY6C 1KQ2A 3PMTA 1BIAA 1G3WA 3UDCA 4LDVA 4ZN3A 4PLIA 3FEOA 3WVDB 3RKXA 1H641 3V7CA 4C92A 1VQMA 2XK0A 3OYBA 4MDWA 5GANj 2RB6A 3JCMf 3OYDA 1AHJB 1NZ9A 1YJWT 3VYGA 1TH7A 1KC8C 3FRNA 2GFAA 3CCQA 4XTWA 4M7DF 1O75A 3CPFA 2XDPA 4MMKA 3EFSA 4MZPA 2ZCFB 3S3NA 1WJQA 2QI2A 3HRSA 5C6SA 3L2UA 3CMAT 3LLRA 4MDXA 1RL2A 1YITT 4HCBA 2HNIA 3QIIA 2KDSA 4X34A 5GAMd 2GF7A 3CPWA 3CCRA 4M7DB 2LDMA 4XQ3A 3RUXA 3OYLA 5GAN5 3JB9I 1Q7YC 1N8RC 4J83A 1K9MU 4LDXA 3MP8A 4OGCA 4KUIA 4C0DC 4OF1A 3OYHA 1LNXA 1N27A 4M7AB 4IUTA 2XU8A 3HFNA 1WJSA 3H8ZA 4XAXB 1KQ1A 3PT9A 5EG2A 3VUBA 4FT2A 3S3MA 4ZTFA 3AHUA 2KSSA 4M77A 2RHUA 3NTKA 2K3YA 2M9UA 3CCQT 4XU0A 1M8VA 3JCMh 2FL7A 4EMKA 2O4XA 3OMGA 4XTUA 3CPWS 4FSXA 3E9GA 2WSEE 4BI3A 4F7UF 5IAYA 2F5TX 4M75G 3M59A 2E64A 2KMTA 3GOXA 3J81E 4M7DD 3CD6A 5I2MA 1P92A 1VQLT 2Y4YA 4M75F 2E1HA 4TVRA 3CCRT 3OYJA 3CBPA 3OS5A 2LRQA 3CC4A 4NL2A 4OB1B 4IUUA 5GANd 2HBPA 4A4KA 5LJ5f 4HCZA 2QQSA 4M75B 3L2QA 2QA4T 5CIUA 4Z02A 3KBGA 5FLXE 2QQ9A 4QW2A 2DTHA 5GAOr 5GAN8 2LQKA 4Y91A 3CBMA 3CC2A 3HFOA 2X35A 4PJOE 3GPLA 2F69A 3TREA 4ZGJB 4MZTA 1IREB 2OAUA 3CC4T 2E41A 2G3RA 2X4YA 4D6WA 5DM7R 1BI0A 2KY9A 2K5FA 2V8KA 1UB4A 3FIFA 5GAN7 4JS4A 4M7DC 5CK9A 5KCOA 2MMPA 4M75D 4XU3A 4XU1A 4DOVA 2ZPGB 4C5GA 3JCMb 2JN0A 3LGLA 5GMKl 5A0GA 2QEXA 2RH2A 1VQ4T 2D9TA 5LJ5h 3MEUA 3M57A 4KT0E 3SDZA 4BDYA 2RI2A 4LDUA 2LVMA 3M55A 4M7DG 5I2SA 4NL3A 1NPRA 5D6XA 3PIOA 1X6OA 2LQ8A 3OS2A 3JCMe 3GLXA 3Q1JA 4ZGEB 1VQ5T 4ELYC 4PJOA 2RA2A 1K73C 2HD0A 3JCMP 3J80E 1YBYA 2QXFA 1OZ3A 2RHXA 3A8OB 4RKUE 3CC7T 3QZ5B 3URGA 1QW1A 5LJ5g 2P0PA 1WNLA 3JCMW 3QO3A 1Q86C 1VQ9T 4R56A 4X9DA 3L2VA 2A7YA 1U1SA 2EQMA 4M78G 4BE0A 2X4JA 3SFMA 4FL6A 2QQRA 1BIBA 3I55A 1IZ6A 4M75C 1Q81C 1NPPA 2DKGA 2JNGA 4C92G 1RI0A 4C5EA 1G5VA 5FRMA 3M54A 2Y4XA 4JRPA 4J7FA 2PVOB 3QJ6A 1WPYA 4KULA 1KG1A 3PMIA 2RJCA 4M78B 1FWZA 3P8HA 1QVPA 3TCJA 2NLUA 2QDYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H64 1;  2DJZ A;  1Y96 A;  3V7C A;  1Y96 B;  2VXE A;  4C92 B;  3BY7 A;  4F7U G;  2RB6 A;  5LJ3 d;  2YLB A;  3JCM f;  4QVD A;  5GAN j;  3GIB A;  1TH7 A;  5GMK j;  3QSU A;  4HT9 A;  1N9S A;  1D3B A;  4XTW A;  5GAN f;  5GAM h;  4M7D F;  2EJF A;  3EFS A;  3FB9 A;  4MMK A;  5LJ5 e;  5LJ3 g;  2DXU A;  5GMK m;  2HNI A;  4F7U A;  4F7U B;  3JCM X;  5GAM d;  4WF2 A;  3RER A;  4M7D B;  4M78 D;  4DQ2 A;  4M78 F;  1N9R A;  1B34 B;  4M75 A;  4XQ3 A;  3RUX A;  4PNO A;  3SWN B;  3JCM c;  4C8Q D;  3RKW A;  5GAN 5;  3JB9 I;  4PJO C;  4M7A A;  1HK9 A;  1LNX A;  4M7A B;  4C92 F;  2EAY A;  2YHT A;  4C92 D;  5GAM g;  2FB7 A;  3HFN A;  5GMK i;  1KQ1 A;  3QUI A;  5GAM e;  3AHU A;  4M77 A;  1WQW A;  3BFM A;  4J6X A;  5GAN 6;  4X9C A;  5GAO m;  2DTI A;  4XU0 A;  2I2L A;  4JRI A;  4A53 A;  3JCM Q;  3JCM h;  1M8V A;  4EMK A;  5GAN 2;  4XTU A;  4EMK B;  5GAN h;  2QTX A;  4M77 E;  4F7U F;  4M75 G;  5GMK h;  4M7D D;  2E64 A;  1D3B B;  1M5Q 1;  4M75 F;  2E1H A;  4C92 A;  4M7A G;  4HA8 A;  4NL2 A;  5GAO p;  5GAN d;  3JB9 G;  1WQ7 A;  3BDU A;  5LJ5 j;  4M7A F;  3V8K A;  2EJG A;  1X01 A;  2DTO A;  4M77 G;  2E10 A;  4RCB A;  5LJ3 e;  5LJ5 f;  2EWN A;  1I4K 1;  2DZC A;  2FYK A;  3V7S A;  2DEQ A;  2DXT A;  1I81 A;  4M75 B;  4M78 C;  4M77 F;  4XTV A;  4XTZ A;  2Y90 A;  4C8Q C;  5GAN g;  4V2S A;  4J6W A;  4XU2 A;  4MML A;  5GAO r;  2DTH A;  2VC8 A;  4EMG A;  5GAN 8;  3RIR A;  2CGH A;  4Y91 A;  2DVE A;  4J5Y A;  3HFO A;  4M77 B;  5GAN 4;  4C8Q E;  4PJO E;  4A54 A;  2E41 A;  3FJP A;  3QHS A;  4EMH A;  1I5L A;  3FIF A;  3INZ A;  4N0A C;  2ZGW A;  5GAN 7;  4M7D C;  4M75 D;  1MGQ A;  4XU3 A;  4XU1 A;  4PJO G;  3VU3 C;  3JCM d;  3SWN C;  2DZ9 A;  2YLC A;  3JCM b;  2JN0 A;  5GMK l;  4NOY A;  3JB9 J;  1I8F A;  4M7A D;  5LJ5 h;  3JB9 D;  3JB9 F;  3M4G A;  4M7D G;  3JCM g;  4NL3 A;  4XTX A;  4M77 D;  5LJ3 j;  5GAO q;  4M78 A;  3RES A;  1JBM A;  3JCM e;  4C8Q A;  5GAN 3;  5LJ5 d;  4PJO B;  5LJ3 f;  4PJO A;  2RA2 A;  2RM4 A;  3BW1 A;  3JCM P;  5GAN e;  4C92 C;  1JRI A;  3L1A A;  1LOJ A;  1U1T A;  3L2Z A;  4JRK A;  4QVC A;  5GMK e;  3JCM V;  4M78 E;  3JCM J;  5GAO l;  5LJ5 g;  4JUV A;  1WNL A;  5GAM j;  3JCM W;  3QO3 A;  4X9D A;  4C92 E;  5GAM f;  1YCY A;  2EJ9 A;  1U1S A;  4JLI A;  2VXF A;  3SB2 A;  5GAO n;  4RCC A;  4M78 G;  4N0A A;  4HT8 A;  2E65 A;  4C8Q G;  4M7D A;  1BIB A;  1LJO A;  5I21 A;  4M75 C;  3V7R A;  1B34 A;  2DKG A;  3SWN A;  4PJO D;  4C8Q F;  4PJO F;  3V8J A;  1HXD A;  4C92 G;  3RKY A;  3V8L A;  4M7A C;  3PGG A;  4F7U E;  4OP0 A;  2RD1 A;  4M7D E;  5DY9 A;  1WPY A;  4J6Y A;  2K57 A;  4XTY A;  4M75 E;  5LJ3 h;  3EFR A;  4M77 C;  1KQ2 A;  4M78 B;  1BIA A;  4C8Q B;  5CAI A;  3HSB A;  4M7A E;  3JB9 H;  4EMK C;  3RKX A; 
#chains in the Genus database with same CATH topology
 4C92 B;  1LVK A;  2HSE B;  1K8A C;  2DBK A;  1MMN A;  1VQL Q;  1OU9 A;  3QZ9 B;  1KC8 U;  2HCK A;  3CCE A;  3LH5 A;  4DEY A;  1YJW A;  2AIR B;  3CMA A;  1RAC B;  1N9R A;  2CT3 A;  4UC4 A;  4HVW A;  2RK2 A;  2EAY A;  2M16 A;  1X6G A;  1AWX A;  4KGX B;  1NYF A;  2EYQ A;  3JCM Q;  3OS0 A;  4EMK B;  3KXT A;  2QTX A;  4JLG A;  1QCO A;  1SHG A;  4Z89 A;  4A63 B;  1QKW A;  3NTH A;  1Y0M A;  4M7A G;  2MAM A;  1WQ7 A;  2J7I A;  3V8K A;  3R6N A;  4PJL A;  2EKH A;  1EIF A;  2OTJ T;  4XTZ A;  4PJJ A;  3X28 B;  4LDW A;  3VS2 A;  3CCS A;  2LTO A;  2HAX A;  3RMS A;  3LWH A;  2K79 A;  4N4I A;  2NUP A;  4PKC C;  1JJ2 P;  1E7O A;  1UG1 A;  3EH1 A;  3GNG A;  3HP9 A;  3F70 A;  4QVZ A;  3TU4 K;  4QQD A;  1OPK A;  3I56 T;  2CP0 A;  3THK A;  1Q7Y R;  4L59 A;  3G7Z A;  2NUT A;  1K73 U;  3DLM A;  1AEY A;  2L2P A;  1YNZ A;  1VQ5 A;  2K3X A;  3H0I A;  5L8R E;  2AHJ B;  2EFI A;  5CVI A;  4ELZ C;  1VQK T;  4FU6 A;  4II1 A;  4HT8 A;  1IO6 A;  4C8Q G;  4M7D A;  4E6R A;  2KAF A;  4PJO D;  2CZ6 B;  2X3X D;  5KH6 A;  3I9Q A;  1JQQ A;  2EQK A;  5DY9 A;  3PIP A;  2K57 A;  4M75 E;  5LJ3 h;  2RQV A;  3EGD B;  3MHX A;  5KYU A;  2GTJ A;  5FRO A;  3CCE Q;  3WXM B;  2DJZ A;  1Y96 A;  2ZPI B;  2YLB A;  2VGM A;  5GMK j;  1FMK A;  3CMA Q;  1Q82 C;  2MWP A;  5HKC A;  2O9V A;  3X26 B;  2JTF A;  4DA4 A;  2ZPH B;  3JCM c;  2IG0 A;  1OYX A;  1HK9 A;  2MF2 A;  4HXJ A;  4MZM A;  4Z88 A;  5GAM e;  1FMW A;  1QLY A;  2QQB A;  1MMD A;  4RTX A;  4X9C A;  1NG2 A;  4A4G A;  1VQN A;  3M4Y A;  4A4H A;  1BKB A;  2D6F A;  2A3L A;  2DEU A;  5KYW A;  5LJ3 e;  3CCS Q;  1G3S A;  3A8M B;  2DZC A;  8AT1 B;  4M77 F;  2DF6 A;  2J06 A;  2COW A;  1FMV A;  2LC4 A;  4M77 B;  5GAN 4;  1MMA A;  2HL5 C;  1V29 B;  1UEC A;  2QGG A;  3TVT A;  2KYM A;  3FJP A;  3QHS A;  4E7S A;  1M1K U;  4QKU A;  1JJ2 S;  3G71 T;  3EGU A;  2RI5 A;  1E6G A;  4XTX A;  1KD1 C;  3CCM A;  1VQ5 Q;  2CH4 W;  3VV0 A;  4F04 B;  3C94 A;  2FRW A;  2YXY A;  4QVC A;  3EG1 A;  4RTV A;  2XDD A;  1Y7X A;  2QDL A;  5GAM f;  1YJ9 T;  1Z9Q A;  1XQH A;  3QYG B;  2H8H A;  1RAI B;  4JZ3 A;  2LCC A;  2WSF E;  3RKY A;  3PGG A;  1M4Z A;  1T3L A;  4ORZ A;  4J6Y A;  2ZAE A;  1MV3 A;  2DMO A;  2FPE A;  4F17 A;  4RUG A;  1QVF A;  2EIF A;  3RR6 A;  4F7U G;  4DBH A;  3EG2 A;  5LJ3 d;  5DLO A;  2EJF A;  2DIQ A;  4IUP A;  3TQ7 P;  2JUF A;  4E47 A;  1AT1 B;  2C0O A;  4WF2 A;  1T0H A;  2RQR A;  4PNO A;  4OB2 B;  2ROL A;  1VQN Q;  2AZS A;  4QQG A;  1RAH B;  1KK7 A;  2HQE A;  5KE3 A;  4ZN1 A;  3CD6 T;  2HQX A;  4LN2 A;  4KGV B;  1HSQ A;  5GAN h;  1PNJ A;  1UGV A;  1D3B B;  2XHC A;  2JTM A;  3H41 A;  1ACM B;  3HL8 A;  2EJG A;  3O8V A;  2K2M A;  4O6J A;  2Y90 A;  1GFC A;  4MML A;  3L2W A;  3OSV A;  1I07 A;  4L5G A;  5AT1 B;  2BIV A;  5LL6 S;  1N6A A;  2K3B A;  1Y07 A;  2D0Q B;  1SHF A;  1PG5 B;  3CCM Q;  4N4H A;  3REA B;  1W4S A;  1D1C A;  1BI3 A;  2COZ A;  2K5L A;  3CBO A;  1VQ8 T;  3VUZ A;  2KE9 A;  3JB9 F;  1YCS B;  3ZFJ A;  5GAO q;  3O5Z A;  3RES A;  2RM4 A;  1I1J A;  4FYW B;  5GAN e;  4M78 E;  2DLP A;  1R0C B;  3E19 A;  2KK4 A;  2ED1 A;  4C92 E;  1V76 A;  2CP2 A;  2CRE A;  4C5I A;  4B9W A;  3QJY A;  5IN1 A;  3OSS C;  5J26 A;  1WGS A;  2YRC A;  2YUN A;  4JPB W;  1X27 A;  1VQ6 A;  2RN8 A;  3FC3 A;  2SEM A;  1KQ2 A;  2L3S A;  5FW9 A;  2FRY A;  2QK0 A;  4ZN3 A;  2F1L A;  3V7C A;  3M0Q A;  4M7D G;  4MDW A;  2RB6 A;  1YJW T;  3FRN A;  2FO0 A;  1O75 A;  2DIL A;  3CMA T;  1RL2 A;  3OW2 P;  2KDS A;  2GF7 A;  3CCR A;  3CC2 Q;  1Q7Y C;  2SRC A;  5GAN 5;  1K9M U;  4J83 A;  4OF1 A;  1IRX A;  1LNX A;  4M7A B;  2EGE A;  1TS9 A;  3HFN A;  1WJS A;  4XAX B;  3VUB A;  3AHU A;  2RHU A;  2K3Y A;  2O4X A;  3OMG A;  4XTU A;  5IAY A;  2E64 A;  2KMT A;  1KC8 R;  1P92 A;  4M75 F;  5L23 A;  4NL2 A;  4OB1 B;  4IUU A;  5GAN d;  2L0A A;  3QDF A;  4A4K A;  4M4Z A;  2DRK A;  4M75 B;  1KQS P;  3EG0 A;  2QQ9 A;  4Y91 A;  3CBM A;  1ZSG A;  3HFO A;  4RTZ A;  2KT8 A;  2KEA A;  4ZGJ B;  1A0N B;  1IRE B;  3CC4 T;  4JS4 A;  4KRT A;  3FIF A;  5CK9 A;  2MMP A;  4XU3 A;  1WA7 A;  2AZV A;  3JCM b;  2QEX A;  5LJ5 h;  4KT0 E;  4NL3 A;  1OOT A;  1NPR A;  3PIO A;  1X6O A;  2D8H A;  3Q1J A;  1VQ5 T;  2DL7 A;  1WI7 A;  3CXC P;  1OZ3 A;  2LZ6 B;  1W2B P;  1SRL A;  2P0P A;  1NLO C;  1WNL A;  3CQT A;  2KI7 A;  1U1S A;  2DYI A;  3EG9 B;  2YRD A;  3SFM A;  1TTH B;  1VYU A;  2YWW A;  1RLQ C;  3M54 A;  1PKS A;  4J7F A;  2PVO B;  3QJ6 A;  4KUL A;  3VRY A;  4EIK A;  3VS6 A;  2NLU A;  2QDY B;  1K73 R;  1RAD B;  2E4H A;  2VXE A;  3GIB A;  4KGZ B;  3OYI A;  4OML A;  3CCR Q;  2D1X A;  3A8G B;  5LJ5 e;  3HRU A;  3I55 T;  2A0F B;  4KBM B;  1H92 A;  1T3S A;  2ENM A;  2MOX A;  1OU8 A;  1IHW A;  1B34 B;  2QG9 B;  3GNF B;  1GXI E;  2MWO A;  1H8K A;  1N8R U;  2DE0 X;  2FB7 A;  2LX7 A;  5FU7 B;  1IB8 A;  2FPF A;  5CR2 A;  5KYY A;  2FG0 A;  5DLQ E;  4J6X A;  5GAN 6;  2DTI A;  4A53 A;  3UA7 A;  4CC2 A;  4OB3 B;  4M77 E;  4FYY B;  4FT4 A;  1XTD A;  1WHG A;  1Y71 A;  4HA8 A;  2X4X A;  3CCU A;  1QVG A;  3LX7 A;  1VQL A;  2DEQ A;  4FW2 A;  4M78 C;  1PWT A;  1X43 A;  2X4W A;  4EMG A;  2K6D A;  4GBQ A;  3RIR A;  1TWB A;  2CGH A;  4OMO A;  2L8D A;  2QA4 A;  1KQS S;  4CC7 A;  1D09 B;  2PU9 B;  2EYY A;  2R58 A;  1T0J A;  4BDZ A;  4CC3 A;  1XOV A;  1UHC A;  4NOY A;  4PFO A;  2LMJ A;  4N4G A;  2LQN A;  4M7A D;  3M0P A;  2LT1 A;  4E7K A;  2M0O A;  4Y28 E;  1VQ4 A;  1RLP C;  1ZHI A;  2DXB A;  5LJ5 d;  4L6V 5;  1VQ7 A;  4PJO B;  2JM9 A;  1WDX A;  2W10 A;  3L2Z A;  2R57 A;  1RAE B;  3CXC S;  3MCA B;  3JCM J;  2E3H A;  1W2B S;  1ZBX A;  2IVW A;  1AZE A;  1Q86 U;  2O01 E;  1WX6 A;  3UAT A;  1M1K R;  3LH0 A;  3V8J A;  2BZ8 A;  1VYV A;  1IHV A;  4OGE A;  4IUV A;  1Q81 U;  4LD9 K;  1AD5 A;  2RD1 A;  4A4F A;  2DA9 A;  2AK5 A;  3MJX A;  5J39 A;  3FJ5 A;  4F16 A;  2VAS A;  5HY6 A;  3M0T A;  1QCF A;  4JDS A;  2BUD A;  1K8A U;  1RAG B;  3C95 A;  1M1G A;  2H3E B;  4BB7 A;  4F7U A;  3JCM X;  1NJI C;  2MIO A;  3HTR A;  3LWI A;  4M78 F;  1G3Y A;  4C8Q D;  3RKW A;  2OTL T;  2DD4 A;  2F5K A;  2ATC B;  3C0C A;  2FEI A;  1HJD A;  4C92 F;  1JEG A;  2RJE A;  3EGX A;  2FZK B;  2CP5 A;  5D7U A;  1D1A A;  3TSZ A;  4FCY A;  1FXX A;  3CCU Q;  1IXD A;  3HPW A;  1X6B A;  2E6Z A;  3R6O A;  2DO3 A;  5CQY A;  2KNB B;  3NFC A;  1YHQ A;  1GBR A;  3JB9 G;  3CME A;  2WSC E;  2DK3 A;  1X01 A;  3UWN A;  2QA4 Q;  2G6F X;  3V7S A;  2VV5 A;  1I81 A;  3ZEH A;  4XU2 A;  3CCJ Q;  1GFD A;  1KHI A;  1DJ7 B;  1IGU A;  1UJY A;  1BK2 A;  1OPL A;  2PUO B;  1I5L A;  4HCC A;  1ZA1 B;  3JCM d;  1VQ4 Q;  2LJ0 A;  3U23 A;  1VQ7 Q;  1PHT A;  4CRI A;  4ZGD B;  3OYN A;  1Z9Z A;  5LJ3 j;  4M78 A;  2FZC B;  2AKL A;  1LOJ A;  1SG5 A;  3PFS A;  3JCM V;  2EGC A;  4X1V A;  4IKF A;  2RNA A;  3BE3 A;  1FX7 A;  2XDB A;  3NTI A;  1VQO Q;  1VQ6 T;  1UEB A;  5CKB A;  3OYM A;  3A5Z B;  2V8J A;  2BE9 B;  4OP0 A;  2EYX A;  5D6W A;  1VOM A;  1S72 Q;  3CEY A;  4M77 C;  2GBQ A;  2OI3 A;  3REB B;  4J9F A;  3HSB A;  5KYU B;  3G6E Q;  4M7A E;  2A37 A;  1G8X A;  4J8O A;  4LUD A;  1Y96 B;  2YUO A;  1JU5 C;  3M5A A;  4JJD A;  1VUB A;  5GAM h;  3ZBD A;  3EFO A;  2PTK A;  1Q82 U;  2L89 A;  4AFU C;  2MK5 A;  3DLL A;  2PVD B;  2P84 A;  3A1P A;  3EH2 A;  1M90 R;  2P0K A;  5J3B A;  3CPW P;  2O88 A;  5GAO m;  1YI2 A;  4JRI A;  1YHQ Q;  2GGR A;  3CME Q;  3MEW A;  2DL4 A;  1M2O A;  2JMA A;  2NWM A;  1WYX A;  2P4T A;  3PVL A;  2LQW A;  1WHH A;  5I22 A;  5KYW B;  1M1F A;  2QAS A;  1YWO A;  3CCV T;  1M3B A;  4HVV A;  1B07 A;  1ZX6 A;  3VS5 A;  2VYT A;  3TSW A;  4BY6 B;  2LCS A;  4C8Q E;  3ER0 A;  2ECZ A;  2XI9 A;  2XD0 A;  2QEX T;  1N5Z A;  2NUZ A;  1Y57 A;  1H3Z A;  2FVU A;  3RMQ A;  1VQM Q;  2L5Q A;  3J7A F;  2FHD A;  3QWY A;  3EGD A;  1KD1 U;  1QCN A;  1SKU B;  3OW2 A;  2HBW A;  4JZ4 A;  3L1A A;  1YFN A;  5IHK A;  1VQP T;  2QTV A;  4RTT A;  4LDY A;  1QWF A;  1VIE A;  1NYG A;  2E6N A;  3JAM E;  4WTO B;  4RCC A;  1M27 C;  4KH0 B;  5IHI A;  3M58 A;  3V7R A;  1W70 A;  2Z0W A;  1QMC A;  1YIJ A;  4FYV B;  1YIT A;  3V8L A;  3VS7 A;  2MI6 A;  3OYC A;  3X20 B;  3PMT A;  1AWJ A;  2EVR A;  3UDC A;  4PLI A;  3FEO A;  3WVD B;  3RKX A;  1TUC A;  4AG2 C;  5GAN j;  3OYD A;  2PZ1 A;  1MNE A;  2GFA A;  3CPF A;  2RF0 A;  4AFQ C;  2ZCF B;  1I5O B;  2DER A;  5EC7 A;  4HCB A;  3QII A;  5GAM d;  2ABL A;  2LDM A;  3NGP A;  1ZA2 B;  1YI2 Q;  3I5S A;  1SEM A;  1WZO A;  2QGF B;  4Y92 A;  3S3M A;  1KQ1 A;  4FT2 A;  2LNH B;  2KSS A;  4M77 A;  3NTK A;  3CCQ T;  1M8V A;  3CPW S;  4OMQ A;  3E9G A;  4M7D D;  3GOX A;  5I2M A;  1VQL T;  2Y4Y A;  1EX4 A;  2E1H A;  2LRQ A;  3MPU B;  2QA4 T;  5IH2 A;  2KYB A;  1N8R R;  5FLX E;  4QW2 A;  2DTH A;  5GAO r;  5GAN 8;  2LQK A;  3CC2 A;  1PKT A;  2X35 A;  4PJO E;  3GPL A;  2JT4 A;  1GCQ C;  2F69 A;  5IHN A;  4B6M A;  2V8K A;  1UB4 A;  5KCO A;  2JN0 A;  2RH2 A;  1VQ4 T;  2D9T A;  3MEU A;  3SDZ A;  4LDU A;  2LVM A;  2O9S A;  3M55 A;  5I2S A;  3GLX A;  4ZGE B;  2RA2 A;  2HD0 A;  3J80 E;  2RHX A;  3QZ5 B;  3URG A;  2CSI A;  2COY A;  1YIJ Q;  1YIT Q;  4J9C A;  2XMF A;  2BTT A;  1MV0 B;  4M78 G;  4FL6 A;  2QQR A;  1SPK A;  1IZ6 A;  2GTO A;  4M75 C;  1NPP A;  4DBF A;  1RAB B;  4C92 G;  1G5V A;  3PMI A;  1OQK A;  1ZSZ B;  4DBR A;  2C0I A;  1FWZ A;  1RI9 A;  3H0H A;  3P8H A;  1QVP A;  3KUF A;  4HT9 A;  1D3B A;  4FIB A;  1WHK A;  4GLK A;  2L3Q A;  5M9O A;  4PFP A;  2ESW A;  1G3T A;  3MO8 A;  1WIE A;  1B7T A;  2HKN A;  2I0N A;  3SWN B;  3E2U A;  1Q81 R;  2JMC A;  2KRM A;  1Q7Y U;  2J05 A;  2YUQ A;  2YHT A;  2E5K A;  2ZZD A;  4E7L A;  3MEA A;  2EBP A;  1FYN A;  4RTW A;  4BE1 A;  3P8B B;  4BAC A;  3CCE T;  1UE9 A;  3OBY A;  2O4X B;  2JVV A;  2KT1 A;  3EG3 A;  3A8L B;  3VS1 A;  2P0Q A;  1SRM A;  2RQW A;  2EYW A;  2DAQ A;  5LJ5 j;  4M7A F;  2ED0 A;  2GQV A;  5KYX A;  2J6K A;  2E10 A;  3M0R A;  2RHZ A;  5FRN A;  5A2Q E;  1AOJ A;  1QP3 A;  3CC7 Q;  4AT1 B;  3S6W A;  2HL3 A;  4PLL A;  4JS5 A;  3MP1 A;  1VQ9 Q;  1X69 A;  2LNV A;  2ZPF B;  2ZGW A;  1CSK A;  1VQK A;  3JB9 J;  1AWW A;  1VYT A;  3OYG A;  1M3C A;  4K11 A;  1M90 C;  4J9B A;  5FU7 C;  3IQL A;  5CKF A;  2B8A A;  3CCS T;  3MP6 A;  2E3I A;  3NMZ C;  2PNI A;  1G83 A;  5D6Y A;  1JRI A;  4JRK A;  2YSQ A;  2EYZ A;  5GAO l;  1GCQ A;  4EDU A;  4B9X A;  4IUQ A;  1BI1 A;  1ZBJ A;  1YCY A;  3M53 A;  1TUG B;  5I11 A;  2KXC A;  3H9N A;  3L42 A;  4C8Q F;  2KRN A;  1C1A A;  1S1N A;  2LP5 A;  1JB0 E;  4AFS C;  4C8Q B;  1NM7 A;  1JXM A;  3QBY A;  5GJW B;  1UFF A;  1MUZ A;  4ESR A;  4QVD A;  3QSU A;  4E7H A;  1OI1 A;  1OV3 A;  1M2V A;  5A0L A;  2M0Y A;  2JM8 A;  5LJ3 g;  4O5V A;  2DJQ A;  4ATO A;  1ARK A;  2OTJ Q;  2CZ0 B;  1U5S A;  4M75 A;  1WHL A;  5FU6 B;  1MND A;  4PJO C;  2J6O A;  2CSQ A;  5GMK i;  5KYY B;  3SEM A;  2VGN A;  6AT1 B;  4ZNX A;  3X25 B;  3DB3 A;  2O2O A;  2DTO A;  4M77 G;  4RCB A;  5KYN A;  3OYK A;  1NEG A;  2DXT A;  1V1C A;  4J9E A;  1JJ2 A;  3HHT B;  3P8D A;  3QDR B;  2VC8 A;  2XID A;  4J9I A;  2DVE A;  1VQN T;  3X24 B;  4RG2 A;  1VQK Q;  2JZ2 A;  2FPD A;  2LT4 A;  3LGF A;  4ANJ A;  1K9A A;  2E70 A;  4EMH A;  4IUR A;  3BDL A;  1ZQ1 A;  1G2B A;  1YJ9 A;  4C0F A;  3QKJ A;  3ULR B;  1M3A A;  3JB9 D;  2KR3 A;  1U8R A;  1UTI A;  2EQI A;  1D1B A;  3EAE A;  4OVA A;  3CCL A;  3DKM A;  4C92 C;  1U1T A;  4JUV A;  2H3J A;  3CCJ A;  2V26 A;  2A28 A;  4CI0 C;  2AKK A;  1PSF A;  1TOV A;  1YIJ T;  2HMA A;  1LJO A;  2WAC A;  1B34 A;  3CCM T;  4PJO F;  4QT7 A;  1BCM A;  2CKK A;  1KD1 R;  4A4E A;  3JB9 H;  4EMK C;  5FWB A;  4JJB A;  1CKA A;  3NPF A;  2RJF A;  1OX9 A;  1W1F A;  1JXO A;  3M56 A;  2DXC A;  2CUD A;  3NHN A;  1AZG B;  1SSF A;  5C0M A;  1YJN A;  1BU1 A;  4F7U B;  2EW3 A;  2V1Q A;  1PM3 A;  3RER A;  3ASK A;  1NJI U;  1QVF S;  3QWX X;  3PE0 A;  1C6V X;  1MHN A;  1VQO A;  3OQ5 A;  3QUI A;  1WFW A;  2YT6 A;  2RPN A;  3M0U A;  2JTE A;  4LNP A;  4E2F B;  2HSP A;  1S72 A;  3G71 Q;  3TEE A;  3G6E A;  2GNC A;  1BCO A;  2ZPB B;  2K9G A;  2CYZ B;  1VIF A;  3SHW A;  2EWN A;  5GAO n;  2BZX A;  2EQU A;  3DB4 A;  5GAN g;  1VQ8 A;  3CC2 T;  4V2S A;  2RK1 A;  1PRM C;  2KVQ G;  3WVE B;  2VB6 A;  2CH4 A;  3LYI A;  2R5A A;  4A54 A;  5HK0 A;  1YJ9 Q;  3JSC A;  5CKE A;  2CZ1 B;  2E5Q A;  4J9G A;  4RTU A;  4E7I A;  1MGQ A;  2KRO A;  2DZ9 A;  2YLC A;  3UF4 A;  1I8F A;  3G4S A;  3CCL Q;  3GBQ A;  1Q95 G;  1UGQ B;  3QG1 A;  1CKB A;  1GCP A;  4OMF B;  2RO0 A;  3HRT A;  2BKD N;  2XIC A;  3OYY A;  4AG1 C;  4C0D B;  2LCL A;  2OJ2 A;  2OAW A;  2A36 A;  2CUB A;  1OZ2 A;  2BE7 D;  2GFU A;  5GAM j;  3QYH B;  2NUP B;  2XG8 D;  4JLI A;  4KUD K;  2VXF A;  1TXQ A;  5AYF A;  1TUD A;  3JRZ A;  5I21 A;  2J6F A;  3S3O A;  1K0S A;  2L3P A;  2R5M A;  2YUP A;  2C0T A;  4J7I A;  4FW1 A;  1M9S A;  3EFR A;  4RG8 A;  2M02 A;  1YP5 A;  4BY6 C;  2B86 A;  4PJN A;  3CD6 Q;  1G3W A;  4LDV A;  3VS3 A;  1VQM A;  4WCI A;  4C92 A;  2NUT B;  2XK0 A;  1YJN Q;  3JCM f;  1NZ9 A;  3VYG A;  1TH7 A;  1KC8 C;  4M7D F;  4MZP A;  1WLP B;  1WJQ A;  1PC0 A;  1TG0 A;  2QI2 A;  2KRS A;  3L2U A;  3EFO B;  3LLR A;  4MDX A;  2HNI A;  4X34 A;  4M7D B;  4XQ3 A;  3RUX A;  5FWC A;  9ATC B;  4KUI A;  3OYH A;  1N27 A;  4IUT A;  3PT9 A;  2F2V A;  2M9U A;  4EMK A;  2DFU A;  2WSE E;  1PD0 A;  2F5T X;  4M75 G;  3M59 A;  3J81 E;  1R0B G;  3CCR T;  3CC4 A;  1VQ8 Q;  2X3W D;  3OS5 A;  2HBP A;  1GBQ A;  1HD3 A;  2QYZ A;  1KJW A;  4Z02 A;  3KBG A;  3G1J A;  1UDL A;  1UHF A;  1QVG P;  2HDA A;  3TRE A;  4MZT A;  2OAU A;  3G4S Q;  4D6W A;  1D0Y A;  5GAN 7;  4DEX A;  3LGL A;  3M57 A;  2RI2 A;  2DYB A;  1K9M R;  1R77 A;  4ELY C;  1K73 C;  3JCM P;  1YBY A;  1YJW Q;  4RKU E;  5LJ5 g;  2CP7 A;  2IPO B;  1K4U S;  3JCM W;  2JXB A;  4X9D A;  3L2V A;  4FSS A;  2A7Y A;  2EQM A;  2D0N A;  4HVU A;  1XJW B;  2X4J A;  4R0K A;  2FZG B;  1BIB A;  3I55 A;  4AFZ C;  2DKG A;  4GLM A;  1RI0 A;  4C5E A;  4IIO A;  5FRM A;  1QWE A;  2Y4X A;  4JRP A;  1KG1 A;  1WPY A;  2DNU A;  1X2Q A;  3TCJ A;  4JJC A;  4BE2 A;  3M9Q A;  7AT1 B;  2RHI A;  1N9S A;  2EQJ A;  2AT1 B;  5CO7 A;  2HQH A;  4M78 D;  4DQ2 A;  3GP8 A;  3PVQ A;  4PFZ A;  3OYA A;  1R8O B;  1HYO A;  4C92 D;  4XK8 E;  3QPH A;  2RI3 A;  3CC4 Q;  3EHR A;  1RUW A;  2VVK A;  2HEQ A;  1UJ0 A;  2D8J A;  2L3R A;  2M1H A;  5GMK h;  2VUB A;  1KQS A;  5GJV B;  3E9F A;  1JO8 A;  3MEV A;  1M5Q 1;  2RQU A;  3I5R A;  3BDU A;  1OEB A;  4PL6 A;  1ZUK A;  3T9N A;  1I4K 1;  2FYK A;  1ZSZ C;  4KH1 B;  4D8D A;  2RQT A;  4DOW A;  1WJR A;  1K76 A;  1ZLM A;  2V8I A;  1QVG S;  1EFN A;  1QKX A;  1M1K C;  3CCU T;  3INZ A;  4N0A C;  5KCH A;  2DRM A;  4PJO G;  1NE8 A;  3CXC A;  3SWN C;  3SD4 A;  1YN8 A;  1W2B A;  4E7Z A;  3CCL T;  1U3O A;  3D7S B;  3JCM g;  4J9D A;  5A0D A;  3MKD A;  4C0Z A;  1W6X A;  3UPU A;  1JBM A;  5LJ3 f;  1ZUU A;  4HCK A;  4NS5 A;  3CCJ T;  5GMK e;  3E1S A;  1PSE A;  4F14 A;  3I35 A;  3I55 Q;  2K5I A;  8ATC B;  3CC7 A;  3VS0 A;  2EJ9 A;  1K0X A;  5CKD A;  3SB2 A;  4Q5W A;  1VQ9 A;  2CDT A;  2E65 A;  1QQJ A;  2M51 A;  2ZPE B;  4BI8 B;  5CQX A;  4BUG A;  4M7A C;  4GY5 A;  1VQ7 T;  2JS2 A;  4F7U E;  1M30 A;  4XTY A;  3PTA A;  2OTL A;  5CAI A;  4QQ6 A;  5KE2 A;  3ME9 A;  4J9H A;  2GCX A;  1YJN T;  2CS7 A;  4C0G A;  2KQW A;  3KFV A;  1WXB A;  2K7A A;  1TU0 B;  2DXU A;  5GMK m;  2CP6 A;  2HZY A;  1BBZ A;  1VQO T;  2JW4 A;  2QAZ A;  1J3T A;  4FYX B;  1M8M A;  5IXF A;  2CP3 A;  1WQW A;  1S72 T;  1NLP C;  2V1R A;  3G6E T;  2K4Y A;  4JJN K;  5CCA A;  2K2V A;  2P4R A;  5HCK A;  2DM1 A;  4OMN A;  2O31 A;  1WHJ A;  1Q86 R;  1ABQ A;  5GAO p;  3OBW A;  3N5B B;  4RMO A;  5KYX B;  2EPD A;  4EPC A;  1NJI R;  3A8H B;  2EGA A;  4C8Q C;  2OTJ A;  4D8K A;  4ME7 A;  3FDR A;  4LUE A;  1D0X A;  2BZY A;  4OMP A;  1YHQ T;  4P5N A;  1K8A R;  3G4S T;  3CME T;  3VJP A;  1GRI A;  2CZ7 B;  3VU3 C;  3ZL7 C;  5FU6 C;  2DPP B;  1ZUY A;  3FLG A;  3RNJ A;  1PD1 A;  3GF5 A;  2KGT A;  5IT9 E;  3M4G A;  2C06 A;  4M77 D;  3OS1 A;  1M90 U;  1ZSZ A;  2EKO A;  2RJD A;  2XKO C;  1KSW A;  2LJ1 A;  3C12 A;  2DL3 A;  3I56 A;  3M0S A;  1UGS B;  4C5H A;  2X9H A;  1O9S A;  1H3H A;  1XNI A;  1LCK A;  1SF9 A;  4N0A A;  3OA6 A;  2OTL Q;  3SWN A;  1BB9 A;  3MET A;  4M7D E;  4HKE A;  1BI2 A;  1VQM T;  3AT1 B;  2DD5 A;  4E7J A;  2MCN A;  2QQA A;  1AWO A;  3H0F A;  3RBB B;  3JV3 A;  3BY7 A;  4LXC A;  1VA7 A;  5GAN f;  4VUB A;  2DET A;  3FB9 A;  1M2V B;  1WXT A;  1RAA B;  4PJM A;  4YTL A;  1WHM A;  2CT4 A;  1K9M C;  3OMC A;  3OY9 A;  2PQW A;  1PRL C;  4BD3 A;  4M7A A;  5GAM g;  4JRQ A;  3HKS A;  1AVZ C;  2X51 A;  1K1Z A;  3CCV A;  3BFM A;  2VWF A;  3UT1 A;  3A98 A;  2W0Z A;  2I2L A;  1OX8 A;  3VYH B;  5GAN 2;  3PNW C;  1EZZ B;  1YWP A;  1BYM A;  4R55 A;  1IGQ A;  3OB9 A;  2E12 A;  2HKQ B;  1OUL A;  1UGP B;  1QVF P;  2JOY A;  1X75 C;  4XTV A;  4J6W A;  1NBE B;  1YI2 T;  5CKH A;  4J5Y A;  2F2W A;  2YRV A;  1KHC A;  4BI4 A;  2YDL A;  2JJ9 A;  3H6Z A;  3VRZ A;  3LW5 E;  4FM4 B;  4OB0 B;  1VQ6 Q;  1VQP A;  4DBQ A;  3OYE A;  4CC4 B;  1Q82 R;  3QXE B;  4LD6 A;  2RHY A;  2PUK B;  2A08 A;  2KBT A;  3G71 A;  3I56 Q;  2DBM A;  1WXU A;  5HK3 A;  4C8Q A;  5GAN 3;  4PK4 A;  3BW1 A;  3C4S A;  2LX9 A;  1UGR B;  4LE9 A;  3L2R A;  3EG9 A;  2IIM A;  2PVG B;  1U06 A;  2DIG A;  4ZTJ A;  3OW2 S;  1HXD A;  3OYF A;  2VKN A;  3VKI A;  1ABO A;  1QP2 A;  3RDV A;  1BIA A;  1H64 1;  3OYB A;  1KIK A;  1LPL A;  1KFZ A;  1AHJ B;  3CCQ A;  2MYS A;  4XTW A;  2XDP A;  4MMK A;  3EFS A;  3S3N A;  5C6S A;  3HRS A;  4Z8A A;  1YIT T;  3CPW A;  3CCV Q;  1UUE A;  3OYL A;  4LDX A;  3JB9 I;  1N8R C;  3MP8 A;  4OGC A;  4C0D C;  2XU8 A;  3H8Z A;  5EG2 A;  4ZTF A;  2DL8 A;  4XU0 A;  3JCM h;  2FL7 A;  2QEX Q;  3EHQ A;  4FSX A;  4BI3 A;  4F7U F;  3CD6 A;  1RAF B;  4TVR A;  2DVJ A;  2OX7 A;  1NEB A;  3CBP A;  3OYJ A;  4OMM A;  2ROT A;  2GQI A;  5LJ5 f;  4HCZ A;  2QQS A;  3L2Q A;  5CIU A;  5ECA A;  4RTY A;  2DX1 A;  3EGX B;  1F1B B;  1VQP Q;  1I0C A;  1SSH A;  1E6H A;  1GL5 A;  2E41 A;  2G3R A;  2X4Y A;  5DM7 R;  1BI0 A;  2KY9 A;  2K5F A;  4M7D C;  4M75 D;  4DOV A;  4XU1 A;  2JS0 A;  2ZPG B;  4C5G A;  5GMK l;  5A0G A;  4BDY A;  5D6X A;  5IXB A;  2LQ8 A;  3OS2 A;  3JCM e;  4PJO A;  1X2K A;  2QXF A;  3A8O B;  3UA6 A;  4IIM A;  3CC7 T;  1B3Q A;  1QW1 A;  4AMC A;  2F2X A;  3QO3 A;  1Q86 C;  1VQ9 T;  4R56 A;  2KXD A;  2LJ3 A;  1PCX A;  4BE0 A;  1C0M A;  1MMG A;  1Q81 C;  2JNG A;  2DL5 A;  2MPX C;  1TSF A;  2NYS A;  2RJC A;  4M78 B;  3CCQ Q;  2RMO A;  3VS4 A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 4C92 B;  4BE2 A;  2VXE A;  3KUF A;  1K8A C;  3M9Q A;  3GIB A;  2RHI A;  4HT9 A;  3OYI A;  1N9S A;  1D3B A;  2EQJ A;  3QZ9 B;  4FIB A;  3A8G B;  4GLK A;  1KC8 U;  3CCE A;  5LJ5 e;  3HRU A;  3I55 T;  5M9O A;  5CO7 A;  1YJW A;  1G3T A;  4KBM B;  3CMA A;  3MO8 A;  4M78 D;  4DQ2 A;  1N9R A;  1B34 B;  3GNF B;  3SWN B;  3GP8 A;  4UC4 A;  1GXI E;  3OYA A;  2MWO A;  1R8O B;  1Q7Y U;  4C92 D;  1N8R U;  2RK2 A;  2EAY A;  2YHT A;  2ZZD A;  2FB7 A;  5FU7 B;  4E7L A;  2M16 A;  3MEA A;  5CR2 A;  4XK8 E;  5DLQ E;  4BE1 A;  4J6X A;  3QPH A;  2RI3 A;  5GAN 6;  2DTI A;  2EYQ A;  3P8B B;  4A53 A;  3JCM Q;  3OS0 A;  4BAC A;  3CCE T;  3OBY A;  4OB3 B;  2O4X B;  2JVV A;  4EMK B;  3KXT A;  2QTX A;  3A8L B;  2P0Q A;  4JLG A;  4M77 E;  2L3R A;  2M1H A;  4FT4 A;  2VUB A;  5GMK h;  1KQS A;  1XTD A;  3E9F A;  3MEV A;  1M5Q 1;  3NTH A;  4M7A G;  1Y71 A;  2MAM A;  4HA8 A;  2X4X A;  3CCU A;  1WQ7 A;  2DAQ A;  3BDU A;  5LJ5 j;  3V8K A;  1QVG A;  4M7A F;  2GQV A;  4PL6 A;  3T9N A;  3LX7 A;  1VQL A;  2E10 A;  1EIF A;  1I4K 1;  2FYK A;  2OTJ T;  2DEQ A;  2RHZ A;  4XTZ A;  4M78 C;  3X28 B;  5FRN A;  5A2Q E;  4LDW A;  2X4W A;  4EMG A;  1QP3 A;  4DOW A;  1KQS S;  3RIR A;  2CGH A;  3S6W A;  2LTO A;  2L8D A;  3CCS A;  2QA4 A;  4PLL A;  3RMS A;  4JS5 A;  2HAX A;  3LWH A;  1WJR A;  3MP1 A;  2PU9 B;  2LNV A;  2V8I A;  1QVG S;  2ZPF B;  2R58 A;  4N4I A;  4PKC C;  1M1K C;  4BDZ A;  3CCU T;  3INZ A;  4N0A C;  2ZGW A;  5KCH A;  1XOV A;  3GNG A;  4PJO G;  1NE8 A;  3CXC A;  3HP9 A;  1VQK A;  3SWN C;  3F70 A;  4NOY A;  3SD4 A;  4QVZ A;  4N4G A;  3JB9 J;  3OYG A;  3TU4 K;  4M7A D;  4QQD A;  1W2B A;  1M90 C;  5FU7 C;  3JCM g;  3CCL T;  2LT1 A;  5CKF A;  2B8A A;  2M0O A;  4C0Z A;  5A0D A;  3CCS T;  3MP6 A;  4E7K A;  4Y28 E;  3I56 T;  1VQ4 A;  1ZHI A;  3UPU A;  1JBM A;  2DXB A;  5D6Y A;  4L59 A;  4L6V 5;  5LJ3 f;  5LJ5 d;  1VQ7 A;  4PJO B;  4NS5 A;  3CCJ T;  3G7Z A;  1JRI A;  3L2Z A;  4JRK A;  5GMK e;  2R57 A;  3DLM A;  3E1S A;  1K73 U;  3CXC S;  1PSE A;  3MCA B;  3JCM J;  5GAO l;  1VQ5 A;  2K3X A;  2K5I A;  4EDU A;  4B9X A;  4IUQ A;  5L8R E;  1BI1 A;  1W2B S;  2AHJ B;  2EFI A;  5CVI A;  4ELZ C;  1ZBX A;  2IVW A;  1YCY A;  2EJ9 A;  3CC7 A;  1Q86 U;  1VQK T;  2O01 E;  5CKD A;  3SB2 A;  4FU6 A;  4II1 A;  3M53 A;  4Q5W A;  1VQ9 A;  4HT8 A;  2E65 A;  4C8Q G;  4M7D A;  2ZPE B;  4BI8 B;  2KAF A;  3LH0 A;  3L42 A;  5CQX A;  4PJO D;  2CZ6 B;  3V8J A;  4C8Q F;  4BUG A;  4OGE A;  4M7A C;  4GY5 A;  4IUV A;  5KH6 A;  1Q81 U;  4F7U E;  1VQ7 T;  4LD9 K;  2RD1 A;  4A4F A;  2EQK A;  5DY9 A;  4XTY A;  2K57 A;  5J39 A;  4M75 E;  3PIP A;  5LJ3 h;  3PTA A;  3MHX A;  2OTL A;  5CAI A;  1JB0 E;  4QQ6 A;  4C8Q B;  5KE2 A;  5FRO A;  3WXM B;  2DJZ A;  3QBY A;  1Y96 A;  3ME9 A;  5HY6 A;  2ZPI B;  2YLB A;  4JDS A;  2VGM A;  4QVD A;  3QSU A;  5GMK j;  4E7H A;  1OI1 A;  2GCX A;  1YJN T;  2BUD A;  1K8A U;  3C95 A;  1Q82 C;  2MWP A;  1M1G A;  2CS7 A;  4C0G A;  2KQW A;  5A0L A;  5HKC A;  4BB7 A;  5LJ3 g;  4O5V A;  4ATO A;  2DXU A;  5GMK m;  3X26 B;  4F7U A;  3JCM X;  2JTF A;  1NJI C;  4DA4 A;  2CZ0 B;  3LWI A;  1VQO T;  4M78 F;  1G3Y A;  2ZPH B;  4M75 A;  4C8Q D;  3JCM c;  5FU6 B;  3RKW A;  4PJO C;  2IG0 A;  2OTL T;  2DD4 A;  2F5K A;  1OYX A;  1HK9 A;  2MF2 A;  4C92 F;  4MZM A;  5GMK i;  2RJE A;  5GAM e;  1WQW A;  1S72 T;  2QQB A;  4X9C A;  3G6E T;  4A4G A;  1VQN A;  1FXX A;  2K4Y A;  3HPW A;  5CCA A;  4JJN K;  2VGN A;  2K2V A;  2E6Z A;  3R6O A;  3M4Y A;  4A4H A;  2DO3 A;  5CQY A;  1BKB A;  3NFC A;  2D6F A;  2A3L A;  1YHQ A;  5GAO p;  3OBW A;  3N5B B;  3JB9 G;  3CME A;  4RMO A;  2WSC E;  3X25 B;  2DK3 A;  3DB3 A;  1X01 A;  2DTO A;  4M77 G;  4RCB A;  3UWN A;  5LJ3 e;  1G3S A;  3A8M B;  3V7S A;  3OYK A;  2DZC A;  4EPC A;  2VV5 A;  2DXT A;  1I81 A;  3A8H B;  4M77 F;  3ZEH A;  4C8Q C;  4XU2 A;  1JJ2 A;  3HHT B;  3P8D A;  3QDR B;  2VC8 A;  2OTJ A;  2XID A;  1VQN T;  2DVE A;  2LC4 A;  3FDR A;  4ME7 A;  3X24 B;  1KHI A;  4M77 B;  5GAN 4;  1DJ7 B;  1V29 B;  4RG2 A;  2JZ2 A;  2LT4 A;  3LGF A;  1YHQ T;  2E70 A;  2PUO B;  4P5N A;  3FJP A;  3QHS A;  4EMH A;  1I5L A;  3G4S T;  3CME T;  4HCC A;  4IUR A;  3BDL A;  1M1K U;  1JJ2 S;  1ZQ1 A;  3VJP A;  3G71 T;  2CZ7 B;  3VU3 C;  3JCM d;  1YJ9 A;  5FU6 C;  4C0F A;  2DPP B;  3FLG A;  3QKJ A;  4CRI A;  3GF5 A;  4ZGD B;  2RI5 A;  5IT9 E;  3JB9 D;  3M4G A;  3OYN A;  2C06 A;  1U8R A;  4XTX A;  1KD1 C;  3CCM A;  4M77 D;  3OS1 A;  5LJ3 j;  1M90 U;  3VV0 A;  3C94 A;  3EAE A;  4M78 A;  2EKO A;  4OVA A;  2RJD A;  2XKO C;  3CCL A;  3DKM A;  4C92 C;  4QVC A;  1LOJ A;  1U1T A;  3C12 A;  3PFS A;  2XDD A;  3I56 A;  3JCM V;  1Y7X A;  4JUV A;  2H3J A;  3CCJ A;  1UGS B;  4C5H A;  4IKF A;  5GAM f;  1O9S A;  4CI0 C;  1YJ9 T;  1PSF A;  1XNI A;  1XQH A;  1YIJ T;  3QYG B;  1FX7 A;  2XDB A;  3NTI A;  4N0A A;  3OA6 A;  1VQ6 T;  1LJO A;  1UEB A;  2WAC A;  1B34 A;  5CKB A;  3CCM T;  3SWN A;  4PJO F;  3OYM A;  3A5Z B;  2LCC A;  2WSF E;  2V8J A;  3RKY A;  3PGG A;  3MET A;  2CKK A;  4OP0 A;  4M7D E;  1M4Z A;  1BI2 A;  4HKE A;  5D6W A;  4J6Y A;  1VQM T;  3CEY A;  4M77 C;  4A4E A;  2DD5 A;  4E7J A;  3HSB A;  2QQA A;  3JB9 H;  4M7A E;  4EMK C;  1QVF A;  2EIF A;  4F7U G;  4J8O A;  1Y96 B;  2RJF A;  3BY7 A;  5LJ3 d;  5DLO A;  3M5A A;  3M56 A;  5GAN f;  2DXC A;  1VUB A;  4VUB A;  3ZBD A;  5GAM h;  2EJF A;  3FB9 A;  2DIQ A;  4IUP A;  1Q82 U;  1SSF A;  5C0M A;  1YJN A;  2JUF A;  4E47 A;  4YTL A;  4F7U B;  1K9M C;  4WF2 A;  3RER A;  3OMC A;  3OY9 A;  2L89 A;  3ASK A;  1NJI U;  2PQW A;  4PNO A;  4BD3 A;  3DLL A;  2PVD B;  1QVF S;  4OB2 B;  4M7A A;  1MHN A;  5GAM g;  3HKS A;  4JRQ A;  1VQO A;  4QQG A;  3OQ5 A;  3QUI A;  3CCV A;  2P0K A;  3BFM A;  2HQE A;  5J3B A;  3UT1 A;  5KE3 A;  4ZN1 A;  5GAO m;  2I2L A;  4JRI A;  1YI2 A;  3CD6 T;  2HQX A;  3VYH B;  5GAN 2;  3PNW C;  3MEW A;  5GAN h;  1S72 A;  1D3B B;  3TEE A;  4R55 A;  2XHC A;  2JTM A;  3G6E A;  1BYM A;  3OB9 A;  2P4T A;  2E12 A;  2ZPB B;  3HL8 A;  1UGP B;  2CYZ B;  2EJG A;  1VIF A;  3O8V A;  4O6J A;  2EWN A;  1M1F A;  2JOY A;  5GAO n;  1X75 C;  4XTV A;  2EQU A;  3DB4 A;  5GAN g;  2Y90 A;  3CCV T;  1VQ8 A;  2RK1 A;  4J6W A;  3CC2 T;  4V2S A;  4MML A;  3L2W A;  3OSV A;  1YI2 T;  2KVQ G;  3WVE B;  4L5G A;  2VYT A;  5CKH A;  4J5Y A;  4BY6 B;  2YRV A;  4C8Q E;  1KHC A;  3ER0 A;  2R5A A;  3LYI A;  4A54 A;  4BI4 A;  5HK0 A;  3H6Z A;  2XI9 A;  3JSC A;  2BIV A;  3LW5 E;  5CKE A;  5LL6 S;  4FM4 B;  1N6A A;  2CZ1 B;  2XD0 A;  2QEX T;  2E5Q A;  4OB0 B;  1Y07 A;  1VQP A;  2D0Q B;  4E7I A;  4N4H A;  3OYE A;  1MGQ A;  1W4S A;  1BI3 A;  3CBO A;  2K5L A;  3QXE B;  2FVU A;  2DZ9 A;  2YLC A;  1H3Z A;  4LD6 A;  2RHY A;  2PUK B;  1I8F A;  3G4S A;  1VQ8 T;  3RMQ A;  3VUZ A;  3G71 A;  3JB9 F;  2L5Q A;  3J7A F;  1UGQ B;  3QG1 A;  4OMF B;  2FHD A;  3ZFJ A;  5HK3 A;  2RO0 A;  3HRT A;  3RES A;  5GAO q;  2BKD N;  2XIC A;  4C8Q A;  5GAN 3;  1KD1 U;  2RM4 A;  3BW1 A;  3OYY A;  4C0D B;  5GAN e;  3OW2 A;  3C4S A;  2LCL A;  2LX9 A;  3L1A A;  4M78 E;  1OZ2 A;  3E19 A;  2GFU A;  1UGR B;  5GAM j;  1VQP T;  2KK4 A;  3QYH B;  4C92 E;  4LDY A;  3L2R A;  2XG8 D;  4JLI A;  4KUD K;  2VXF A;  1VIE A;  2E6N A;  4B9W A;  4C5I A;  3JAM E;  2PVG B;  4RCC A;  3QJY A;  2DIG A;  5IN1 A;  4ZTJ A;  5AYF A;  3M58 A;  3JRZ A;  3OSS C;  5I21 A;  5J26 A;  3V7R A;  3OW2 S;  3S3O A;  1YIJ A;  1HXD A;  2R5M A;  1WGS A;  1YIT A;  3OYF A;  3V8L A;  4J7I A;  1VQ6 A;  3FC3 A;  2MI6 A;  3VKI A;  3OYC A;  1M9S A;  3X20 B;  3EFR A;  1QP2 A;  4RG8 A;  4BY6 C;  1KQ2 A;  3PMT A;  1BIA A;  1G3W A;  3UDC A;  4LDV A;  4ZN3 A;  4PLI A;  3FEO A;  3WVD B;  3RKX A;  1H64 1;  3V7C A;  4C92 A;  1VQM A;  2XK0 A;  3OYB A;  4MDW A;  5GAN j;  2RB6 A;  3JCM f;  3OYD A;  1AHJ B;  1NZ9 A;  1YJW T;  3VYG A;  1TH7 A;  1KC8 C;  3FRN A;  2GFA A;  3CCQ A;  4XTW A;  4M7D F;  1O75 A;  3CPF A;  2XDP A;  4MMK A;  3EFS A;  4MZP A;  2ZCF B;  3S3N A;  1WJQ A;  2QI2 A;  3HRS A;  5C6S A;  3L2U A;  3CMA T;  3LLR A;  4MDX A;  1RL2 A;  1YIT T;  4HCB A;  2HNI A;  3QII A;  2KDS A;  4X34 A;  5GAM d;  2GF7 A;  3CPW A;  3CCR A;  4M7D B;  2LDM A;  4XQ3 A;  3RUX A;  3OYL A;  5GAN 5;  3JB9 I;  1Q7Y C;  1N8R C;  4J83 A;  1K9M U;  4LDX A;  3MP8 A;  4OGC A;  4KUI A;  4C0D C;  4OF1 A;  3OYH A;  1LNX A;  1N27 A;  4M7A B;  4IUT A;  2XU8 A;  3HFN A;  1WJS A;  3H8Z A;  4XAX B;  1KQ1 A;  3PT9 A;  5EG2 A;  3VUB A;  4FT2 A;  3S3M A;  4ZTF A;  3AHU A;  2KSS A;  4M77 A;  2RHU A;  3NTK A;  2K3Y A;  2M9U A;  3CCQ T;  4XU0 A;  1M8V A;  3JCM h;  2FL7 A;  4EMK A;  2O4X A;  3OMG A;  4XTU A;  3CPW S;  4FSX A;  3E9G A;  2WSE E;  4BI3 A;  4F7U F;  5IAY A;  2F5T X;  4M75 G;  3M59 A;  2E64 A;  2KMT A;  3GOX A;  3J81 E;  4M7D D;  3CD6 A;  5I2M A;  1P92 A;  1VQL T;  2Y4Y A;  4M75 F;  2E1H A;  4TVR A;  3CCR T;  3OYJ A;  3CBP A;  3OS5 A;  2LRQ A;  3CC4 A;  4NL2 A;  4OB1 B;  4IUU A;  5GAN d;  2HBP A;  4A4K A;  5LJ5 f;  4HCZ A;  2QQS A;  4M75 B;  3L2Q A;  2QA4 T;  5CIU A;  4Z02 A;  3KBG A;  5FLX E;  2QQ9 A;  4QW2 A;  2DTH A;  5GAO r;  5GAN 8;  2LQK A;  4Y91 A;  3CBM A;  3CC2 A;  3HFO A;  2X35 A;  4PJO E;  3GPL A;  2F69 A;  3TRE A;  4ZGJ B;  4MZT A;  1IRE B;  2OAU A;  3CC4 T;  2E41 A;  2G3R A;  2X4Y A;  4D6W A;  5DM7 R;  1BI0 A;  2KY9 A;  2K5F A;  2V8K A;  1UB4 A;  3FIF A;  5GAN 7;  4JS4 A;  4M7D C;  5CK9 A;  5KCO A;  2MMP A;  4M75 D;  4XU3 A;  4XU1 A;  4DOV A;  2ZPG B;  4C5G A;  3JCM b;  2JN0 A;  3LGL A;  5GMK l;  5A0G A;  2QEX A;  2RH2 A;  1VQ4 T;  2D9T A;  5LJ5 h;  3MEU A;  3M57 A;  4KT0 E;  3SDZ A;  4BDY A;  2RI2 A;  4LDU A;  2LVM A;  3M55 A;  4M7D G;  5I2S A;  4NL3 A;  1NPR A;  5D6X A;  3PIO A;  1X6O A;  2LQ8 A;  3OS2 A;  3JCM e;  3GLX A;  3Q1J A;  4ZGE B;  1VQ5 T;  4ELY C;  4PJO A;  2RA2 A;  1K73 C;  2HD0 A;  3JCM P;  3J80 E;  1YBY A;  2QXF A;  1OZ3 A;  2RHX A;  3A8O B;  4RKU E;  3CC7 T;  3QZ5 B;  3URG A;  1QW1 A;  5LJ5 g;  2P0P A;  1WNL A;  3JCM W;  3QO3 A;  1Q86 C;  1VQ9 T;  4R56 A;  4X9D A;  3L2V A;  2A7Y A;  1U1S A;  2EQM A;  4M78 G;  4BE0 A;  2X4J A;  3SFM A;  4FL6 A;  2QQR A;  1BIB A;  3I55 A;  1IZ6 A;  4M75 C;  1Q81 C;  1NPP A;  2DKG A;  2JNG A;  4C92 G;  1RI0 A;  4C5E A;  1G5V A;  5FRM A;  3M54 A;  2Y4X A;  4JRP A;  4J7F A;  2PVO B;  3QJ6 A;  1WPY A;  4KUL A;  1KG1 A;  3PMI A;  2RJC A;  4M78 B;  1FWZ A;  3P8H A;  1QVP A;  3TCJ A;  2NLU A;  2QDY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...