4C92C

Crystal structure of the yeast lsm1-7 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92C00
5GAOn 4JLIA 1LNXA 5GAN7 2FYKA 2FB7A 4HT8A 4M7AD 2EJFA 4XQ3A 5LJ5e 5GAOq 4M75B 5GAN2 4XU3A 3JCMc 2HNIA 1Y96A 3VU3C 4PJOE 1I4K1 3INZA 1WNLA 3V7RA 5GANd 3RKWA 3V7CA 2EWNA 1I5LA 4XTVA 4M7AG 4M75F 1BIAA 4M78F 4X9CA 1X01A 3V7SA 3JCMV 3V8JA 4C8QB 3JCMX 4PJOA 2YLBA 4M77D 4M77E 5LJ3d 1HK9A 4V2SA 4XU2A 2E1HA 1LJOA 5LJ3e 4M77G 5GANh 1LOJA 2VXFA 3SB2A 4M7DC 2I2LA 4JRIA 4PJOF 3SWNC 4XU1A 1N9SA 1N9RA 3M4GA 1M5Q1 3FJPA 3JCMd 5LJ3f 5GAN5 5GAOm 2K57A 3JB9H 4M75D 1KQ1A 2E65A 4C92E 5LJ5g 4M78G 4J6YA 4M7AE 4M7AF 3EFSA 4C8QA 5I21A 4QVDA 3JB9F 1U1SA 4M7AB 3QO3A 1KQ2A 2DKGA 4RCBA 4JRKA 3JB9I 4M75E 5GANe 2DXTA 4NL2A 4MMKA 3JB9J 3AHUA 4PJOB 1MGQA 1HXDA 4M78C 3JCMg 2DVEA 3QHSA 2EAYA 3JCMP 3V8LA 4C8QE 1TH7A 5GAOp 4M75C 2CGHA 3SWNA 4C92A 3QUIA 4M77B 4EMKC 3BY7A 1BIBA 4C92D 3JB9G 5LJ5h 5GAN3 4C8QC 4QVCA 1WQ7A 5GMKe 4J6XA 3FIFA 2E64A 3PGGA 5GAMf 1H641 5GANg 1Y96B 2QTXA 3L1AA 5LJ5j 4N0AC 2YLCA 5GANf 4M7DE 4F7UE 2ZGWA 5GANj 3HFNA 1I8FA 2RM4A 5LJ5d 5GAN4 4C8QG 3JCMh 4M7DG 4XTXA 2Y90A 2E41A 3BFMA 3HFOA 4M77A 1YCYA 5GAN8 5GMKj 3BW1A 4Y91A 3RERA 4NL3A 4EMKA 4J6WA 4XTUA 4C92B 2E10A 4PJOG 5GMKm 2EJGA 4RCCA 3RESA 4A53A 5LJ3g 1B34A 1JBMA 4NOYA 4M7DB 4XTYA 3BDUA 5GAN6 2RB6A 2EJ9A 4M7DA 4MMLA 1B34B 1WPYA 5GMKi 5GMKl 4M78B 4C8QF 5CAIA 1D3BB 4M7DD 4C8QD 3GIBA 4F7UA 4PJOD 4F7UF 3JCMe 5GAMe 4HA8A 2YHTA 4M7AC 1WQWA 3RKXA 3JCMf 3JCMW 2DXUA 2DEQA 3V8KA 3QSUA 4XU0A 4PJOC 2DTOA 4DQ2A 3L2ZA 5GAOr 4WF2A 2DZ9A 4M77F 4OP0A 3SWNB 4C92G 3JB9D 3EFRA 4M78E 5GAMj 4A54A 4PNOA 3JCMQ 5GAOl 4M77C 4HT9A 2VC8A 2DJZA 4M75A 1D3BA 2DTHA 5DY9A 4N0AA 5LJ3h 4F7UG 2DTIA 4F7UB 5LJ3j 5GAMh 4M78D 3RIRA 2RA2A 4JUVA 5GMKh 5LJ5f 2JN0A 3JCMb 3RKYA 4M7AA 4M78A 4EMGA 4J5YA 1JRIA 4XTWA 2VXEA 1U1TA 1I81A 4M7DF 2RD1A 2DZCA 4EMHA 4C92C 5GAMd 4C92F 3FB9A 4XTZA 3JCMJ 3RUXA 4M75G 4X9DA 1M8VA 3HSBA 4EMKB 5GAMg
chains in the Genus database with same CATH superfamily
3QJ6A 3TCJA 4B9WA 1XOVA 1JU5C 2VV5A 3E2UA 3CCVQ 1K4US 1M3BA 1T0HA 1WXUA 4XU3A 3JCMc 3H8ZA 2O4XB 4X9CA 3V8JA 1B3QA 1BYMA 1CKAA 1QVPA 4XU2A 3RNJA 1HD3A 5AYFA 3SB2A 2CP6A 2CUBA 2CH4A 3X20B 1B7TA 4BDZA 2KDSA 3EH2A 2X4XA 4JJDA 2DVJA 2WSEE 3OYDA 4NL2A 4R56A 3QHSA 4B9XA 5A0LA 3J80E 3P8HA 3UATA 2ED1A 2PNIA 3JB9G 2YXYA 3OW2A 1FMVA 1RAFB 1H641 3CMEA 2LVMA 1ZLMA 1KG1A 4II1A 1X6BA 4KH1B 4PKCC 2COWA 3CXCS 1UB4A 1YN8A 2LNVA 4E7ZA 2EJ9A 3I56T 1TWBA 2RMOA 2DM1A 3JV3A 3M0QA 5L8RE 1JXOA 4LDYA 3JCMW 1PM3A 4PJOC 3L2ZA 2CSQA 3NGPA 2QEXA 4QW2A 3CMEQ 1D1CA 2DX1A 4M78E 4L5GA 2LT4A 2MCNA 2DF6A 4AFUC 2DTIA 4LN2A 4DEYA 3OW2S 1RL2A 5GMKh 2DXCA 2KROA 3SHWA 1GBRA 2LX9A 4HCZA 3M55A 3J81E 2DO3A 4LUDA 4R55A 1MMNA 3TU4K 3LX7A 4J9IA 4JLIA 4WTOB 2FYKA 1UG1A 2WACA 1ZUUA 3A98A 3X24B 5GANd 1YJWT 3VYGA 1QVGA 2L89A 4RG8A 5I22A 2CT3A 4A4HA 1TUCA 4F14A 3CCJA 2EGEA 2XMFA 4M77G 5GANh 4VUBA 2X3XD 3RDVA 1KHCA 1ZHIA 2MI6A 2J06A 4LD9K 1QCFA 4M78G 2LQKA 1K9MC 2IIMA 2EFIA 4CC7A 1VQNT 4ZTJA 1M3CA 2MAMA 3G7ZA 3M4YA 4AT1B 3CC4T 2LCSA 4QQGA 3CCEQ 4C5HA 4ZGEB 3JCMh 2ROTA 3BE3A 5GAN8 3HKSA 4FL6A 1UECA 3OYCA 1SF9A 1AT1B 1WHLA 4ANJA 4XTYA 5GAN6 4MMLA 1QKXA 8AT1B 4C8QD 4PJOD 1VOMA 3CCQQ 5ECAA 1UUEA 2LJ1A 2DL3A 3CCQA 4AFZC 2ZAEA 4PNOA 2JTEA 1SKUB 2QTVA 2W10A 3OBYA 5LJ5f 1VQ6T 1U8RA 3CCRQ 3GF5A 1ZSZB 4Z02A 1QWEA 1YITT 4FT4A 1U1TA 1I81A 2RD1A 4EMHA 1ZSZA 3RUXA 3A5ZB 4ZN1A 3CC2T 1BCOA 2R58A 2Y4XA 4FM4B 5GAN7 1FMKA 2CSIA 4HT8A 4BI4A 4DEXA 3CMAT 3CCST 1VQ4A 4OF1A 3H41A 4HVWA 1JJ2P 1Y96A 5KYXB 1RLPC 5HK0A 3RMSA 1OI1A 3CC2A 3V7SA 2KE9A 4A4EA 4JRQA 2A37A 3QJYA 2E6ZA 3EFOB 3G6EQ 1M2OA 2EYWA 1Q7YR 3QXEB 3SWNC 1N9RA 3A8OB 4GBQA 4DBFA 5LJ3f 1NG2A 1KQ1A 1PC0A 4BACA 3OQ5A 1KQ2A 3JB9I 2RJFA 4E7SA 4LD6A 1SSHA 3CPWP 5CR2A 3JCMg 4M78C 3JRZA 3CC7A 1IRXA 3L2UA 2HKQB 3MEVA 2K2MA 3EGUA 2KXDA 3QWYA 1IHVA 2FPFA 2GQVA 3R6NA 1GCQA 2YLCA 3OYEA 1X6OA 2ZGWA 1T3SA 3QDFA 1O9SA 2CP3A 2LMJA 3I55Q 1YJ9Q 3BW1A 4CC2A 3C12A 3LH5A 1D0YA 4AFQC 1LCKA 1B34A 2QQAA 2K5FA 3CCVT 3DB3A 3SEMA 5IHNA 3QG1A 2HL3A 3M56A 2GCXA 2DTOA 3P8DA 5GAOr 2HBWA 1SHGA 1GCPA 2YUOA 3JCMQ 2Y4YA 1OPKA 3CBMA 2DIQA 1M2VA 3J7AF 2HMAA 1PKSA 3CXCP 1Q81R 4JDSA 1NJIU 3MP6A 2RJEA 4MDWA 4EMKB 1YHQQ 1LNXA 2X35A 2EJFA 3FLGA 2HKNA 3DKMA 2O4XA 5IT9E 3UPUA 6AT1B 2QEXT 4EPCA 1AWWA 2KK4A 4BUGA 2I0NA 3QWXX 4UC4A 2HD0A 2YUPA 4KBMB 3ULRB 1VQ8A 1N9SA 1Q7YU 2E65A 5A0DA 3L42A 2NUTA 2RK1A 3QO3A 5I11A 1BBZA 4RCBA 1OOTA 5FWCA 2CKKA 3OYHA 2KNBB 1WHJA 1AVZC 2CGHA 3SWNA 2JVVA 1K76A 2L3QA 3OYBA 4HVVA 3OBWA 4QVCA 1W2BS 5GMKe 3VUZA 3OYFA 4J8OA 2DE0X 4FSSA 4OMFB 1VIFA 4RUGA 4QT7A 4XTUA 2D1XA 2LRQA 2ED0A 1UTIA 1B34B 3G1JA 2R5AA 5KCHA 2EQMA 4F7UA 2RF0A 3G6EA 2K3XA 3RKXA 3PIOA 3I55T 3EG3A 4A54A 1IGQA 3A8HB 2GTJA 3PMTA 1WIEA 4JS5A 8ATCB 4AG1C 3QYHB 1VQ9Q 1E6HA 4BI3A 2H8HA 2KAFA 2A28A 1PHTA 5A0GA 4FSXA 1TXQA 5EG2A 1X75C 4XTZA 2LJ0A 1KHIA 5J26A 3NTIA 4X9DA 3EHRA 1JJ2S 2JW4A 2YDLA 2FB7A 3TSZA 1GFDA 4RTXA 4ZN3A 3REBB 3VU3C 2DD5A 3NPFA 1MV3A 2QQ9A 2YLBA 2RQUA 4C5GA 2L8DA 3EH1A 3MPUB 4XAXB 5CK9A 2QA4T 1VQ6A 1QP3A 1D0XA 1QWFA 2E12A 2PVDB 5GAOm 4M75D 2QG9B 2DL7A 1VQ5Q 2H3JA 2QK0A 1G2BA 4AFSC 3R6OA 4D8DA 1C6VX 3JB9J 2DLPA 4BE2A 1K73R 1ARKA 1ZSGA 1YI2A 2XG8D 2BTTA 1Z9QA 1YITQ 1ZBJA 4EMKC 1G83A 5CQXA 3A8MB 2YRDA 3C95A 2K5IA 2AIRB 2DYBA 2E64A 1VQKQ 1HJDA 2BZXA 5GANf 4N0AC 2RQRA 1VQ4Q 3M0TA 4M7DE 1U5SA 4A4GA 3I5SA 1EIFA 2VYTA 1PRLC 2F5KA 2XKOC 1KJWA 4Z89A 3BDUA 2HQXA 2E70A 2FG0A 2QYZA 2OTJA 2V8JA 1ZA1B 4OMPA 1M30A 3LLRA 3ZBDA 2DZ9A 2VUBA 2CP7A 2KGTA 1RADB 2OTJT 1TUDA 2YUQA 4M77C 5GJVB 1X6GA 4Z8AA 4M78D 2JOYA 2E6NA 1JO8A 1JRIA 3M9QA 5I2MA 3CC4Q 4L6V5 3SD4A 2A3LA 2BUDA 2OTLA 2E5KA 3HSBA 2EYYA 1NM7A 3M0PA 3Q1JA 4M7AD 3WXMB 4GLMA 1MMGA 5CIUA 5FU7C 3L2QA 4M75B 3I5RA 3H6ZA 2MIOA 1I4K1 1U3OA 3CCLQ 4IKFA 3V7CA 2EWNA 3NMZC 1TSFA 3JCMV 3P8BB 2CP0A 2KRMA 5LJ3d 2AZVA 2EW3A 2QGGA 2QQSA 1RAEB 5HY6A 1YWOA 2FRWA 3UDCA 3CC4A 1M1KR 2PVGB 1YWPA 1R0CB 2CH4W 2JTFA 4FW2A 1W6XA 4QVDA 1U1SA 3JB9F 2PUKB 4BE0A 1PD1A 4RTTA 3EHQA 2ATCB 1K9MR 1I1JA 2QXFA 1MUZA 5GAOp 3CCLA 2NUZA 4LE9A 2KYMA 1S72Q 3MEUA 3FDRA 2KY9A 5KH6A 1J3TA 3EG2A 3NHNA 3PMIA 2CP2A 3HP9A 5FU6C 1T3LA 1VQ8T 4C5EA 2E41A 2FRYA 2LTOA 3RERA 4E7IA 4EMKA 1M90U 2OJ2A 2RNAA 1X2QA 1I07A 2G6FX 3OMGA 4N4GA 2M02A 2L3PA 3OYYA 2EPDA 3VS1A 3JSCA 3LWIA 2YHTA 1S72A 4M7AC 1WFWA 3PE0A 1VQPQ 1Q82U 2AHJB 3M58A 4WF2A 5AT1B 4OP0A 4N4IA 2VKNA 5KYUB 1VQ4T 2O9SA 1UGQB 3JCMJ 1A0NB 2NYSA 2PVOB 1VQKA 2QAZA 5GAOq 2ROLA 4M75F 4ZGJB 2NUPA 1NLOC 4M78F 4C8QB 3UT1A 1Y57A 4IURA 3JCMX 1JQQA 3MJXA 2GBQA 2BKDN 4J9HA 1BI1A 2XI9A 4IIMA 1IZ6A 2JM9A 3OYIA 1KSWA 2M9UA 3CC7T 3M4GA 3JCMd 4HCKA 3CCMQ 3JB9H 2RHIA 5I21A 1QW1A 5GANe 1TS9A 2DXTA 4MMKA 2RQWA 1KC8C 2PQWA 2DVEA 4OMOA 1VQMQ 4P5NA 1TH7A 2ZCFB 1K73C 2AKLA 2DBMA 2DYIA 2HSPA 1VQMT 3KUFA 5DM7R 5GANg 3JAME 1V1CA 1E6GA 2HEQA 4PJMA 3IQLA 5GAN4 3MEWA 1YIJA 3LH0A 3HTRA 1YCYA 3PIPA 2JNGA 2QI2A 1IGUA 1UJ0A 2D9TA 2GQIA 2E4HA 4OGEA 1JBMA 3EGXA 1UDLA 1TG0A 1KC8U 1WPYA 2V1RA 1NPPA 2JJ9A 3MCAB 5IXFA 2KBTA 4DA4A 2QQRA 4K11A 4RTYA 1M8MA 2QGFB 1WXBA 2JT4A 1FX7A 4HT9A 1MV0B 1D3BA 4LUEA 4OGCA 3CCJQ 2EKHA 2ZPIB 1W2BP 1QVGP 4M7AA 4F17A 5FW9A 5KYWA 1RABB 4XTWA 1Q7YC 2VXEA 4C92C 1QP2A 1M8VA 4XK8E 1D0ZA 2E5QA 5CKFA 1ZUKA 2F5TX 2MF2A 4PJOE 1RACB 3PVQA 2LP5A 3CQTA 1I5LA 3KBGA 2OTJQ 2DILA 3QYGB 2BZYA 4FYWB 1HK9A 2OAUA 3G4SA 2O88A 4V2SA 2X9HA 4DOVA 4WCIA 5LJ3e 3PNWC 3OSSC 4RTVA 4C0ZA 1SHFA 4R0KA 3OA6A 4N4HA 1WXTA 2RJCA 3UA7A 5HK3A 4J9EA 3AHUA 1QCOA 1D09B 5A2QE 5FU7B 2COZA 4BE1A 2F1LA 1ZUYA 2JTMA 4MZMA 3G71A 3WVEB 5LJ5h 4BY6C 3G71Q 2HQHA 1TUGB 1OX8A 1I8FA 2QDLA 2LQNA 3C4SA 2AZSA 3G71T 3M53A 2KSSA 2P0KA 2CUDA 1RLQC 3F70A 3OMCA 1NE8A 2RI2A 1WHKA 3TREA 2DAQA 2M0YA 2DJQA 3X25B 1CKBA 2KT1A 1LPLA 2LNHB 5CKBA 4AG2C 1PSFA 5CCAA 5KYUA 1G3TA 1G3WA 3JCMe 3A8GB 3VS6A 3CCLT 3LGLA 2JUFA 1VQLQ 2M16A 2D0QB 3A1PA 5FRNA 3EFRA 3EG1A 1M9SA 1QMCA 1UGPB 4F7UG 4JUVA 3QDRB 7AT1B 2F69A 3H9NA 2DL4A 3LW5E 2LX7A 2IVWA 4C5IA 1MMAA 5GAMd 1AOJA 3VS7A 1BCMA 2QDYB 2CZ1B 2FZCB 3LWHA 4IUQA 5LJ5e 1WDXA 3OYGA 3EG0A 2HNIA 3MP8A 1XNIA 5IXBA 3RKWA 2LDMA 4PJOA 3CD6T 4ELZC 1VQ6Q 4NS5A 3MHXA 1K8AC 2P4TA 3VJPA 1BU1A 3FEOA 1IB8A 1M5Q1 2KVQG 1KD1C 1YI2T 1AZEA 2K57A 1ZA2B 3EAEA 1WHMA 2F2XA 2D6FA 1V29B 1Y7XA 2DKGA 1EX4A 2E3HA 2RK2A 4M75E 3CCMA 1YI2Q 1VQKT 1YJ9T 4DBHA 4JS4A 3QUIA 1KC8R 2K3BA 1AHJB 2VGNA 3BY7A 2CDTA 3EGXB 3CC7Q 1S1NA 3SDZA 4J7FA 2XIDA 4O6JA 1BI0A 1N6AA 4PJJA 3THKA 2LQWA 1C0MA 1MNEA 1WZOA 4GLKA 2AKKA 2YT6A 4M77A 1N8RU 4J6WA 4HXJA 3TSWA 2LZ6B 4A53A 2O31A 1D1AA 1Y0MA 2OTLQ 1VYTA 1X2KA 4F04B 1VQNQ 1OPLA 4M78B 4C8QF 2DXBA 1D3BB 1UHCA 2DD4A 5FWBA 5GAMe 2M51A 1N5ZA 1NYFA 3QSUA 1OU9A 2DEQA 4E7LA 4FW1A 4XU0A 2ZPHB 5IHKA 3N5BB 4E47A 5FLXE 3OS0A 3GPLA 3I35A 2KR3A 3X28B 2KT8A 1YIJT 2EYZA 1FYNA 3JCMb 4OB1B 1NLPC 4J9BA 4JPBW 2DMOA 1RI0A 1YJNA 3OSVA 3FB9A 1VQLA 1GFCA 1K9MU 1KQSP 4QVZA 3M5AA 3S3OA 3CCEA 1X27A 2KQWA 4KUIA 4BY6B 2VWFA 1YJNT 2VVKA 5GJWB 3L2WA 1G3YA 5HCKA 2K3YA 1WJSA 1OZ2A 1VQ7Q 4A4FA 2PZ1A 1Q95G 2FZKB 2E1HA 3DLMA 2EYXA 4DOWA 4PFOA 2KRSA 4E7KA 3PTAA 3CD6Q 1D1BA 4RTUA 3CBOA 5J3BA 4ELYC 4PK4A 3KFVA 2CP5A 1GBQA 4J9CA 4C8QE 2OX7A 5J39A 4RKUE 4C92A 1NBEB 1QQJA 2HL5C 2CZ6B 3NFCA 3OW2P 2C0OA 3G4ST 5LJ5j 3QBYA 1OU8A 5LJ5d 4XTXA 4EDUA 3HFOA 4FT2A 4JJBA 2A08A 1CSKA 2IG0A 4IIOA 2X3WD 2MMPA 2K4YA 4KULA 2KXCA 2EJGA 4M7DB 4JJNK 1VYVA 4J9FA 1BI2A 2EQUA 2GTOA 2DK3A 2P84A 2DNUA 5CKDA 4MDXA 4QQDA 2P4RA 3FRNA 4Y28E 1H3ZA 2DL5A 2BIVA 2VC8A 5GAMg 1GCQC 4F7UB 2MWOA 3RIRA 4OB3B 2M1HA 3KXTA 2FL7A 2DEUA 4EMGA 3CCUQ 1M90C 3CXCA 2DETA 3M57A 2K7AA 2X4JA 4C92F 2F2WA 2KYBA 2J6FA 1XJWB 2RHUA 1M3AA 3D7SB 1M1KU 2K6DA 2WSCE 5KYXA 3VS5A 3EG9A 1V76A 1K73U 1YIJQ 3I55A 2DRMA 5D6XA 4EIKA 1BIAA 1X01A 2W0ZA 2HBPA 2JS0A 2VB6A 4BB7A 1WHHA 2C0TA 3M0RA 5C0MA 4JRIA 2HCKA 5KE3A 4M7AF 2OAWA 4FIBA 2VGMA 4RTWA 3OYLA 1PSEA 4OB2B 1VQMA 1VQ7A 1ZQ1A 3ER0A 2ZPEB 4PJOB 1MGQA 1FMWA 1BB9A 1KK7A 1XTDA 2EAYA 2O01E 1ACMB 5FROA 3VKIA 1VQ8Q 1QVFS 2XHCA 1VQ7T 2FPDA 2RO0A 4O5VA 1SPKA 4C0GA 5IAYA 1YJNQ 1PD0A 5GANj 3QIIA 2BZ8A 4M7DG 2GNCA 1AEYA 3M59A 2VASA 5IN1A 1T0JA 1ZSZC 1VQ5A 4OB0B 3M0SA 3RESA 2FPEA 1X43A 2RB6A 3MEAA 4M7DD 3AT1B 1VQOQ 4LNPA 2ZZDA 2NLUA 1JEGA 2XK0A 1SRLA 4FYXB 2M0OA 3JB9D 1NPRA 3PVLA 3CCJT 1MMDA 1Q86C 2RA2A 5DLQE 5KYWB 3RKYA 2L2PA 4J5YA 2V26A 5KYYA 5CKHA 2DZCA 4C0DB 1W1FA 2YUNA 2FHDA 4M75G 1AD5A 2HAXA 4M4ZA 4E7JA 3HL8A 1RI9A 1BKBA 2D0NA 4A63B 2LT1A 1MHNA 1IHWA 2HQEA 4M77E 1TTHB 1Q81U 1YCSB 2VXFA 4KRTA 5CVIA 2E3IA 4TVRA 3GNGA 1HSQA 2CZ0B 2V8KA 4C92E 1OQKA 2NUPB 3EFSA 4C8QA 5HKCA 2OTLT 4D8KA 4IUVA 1N27A 3PT9A 3CPWA 3DLLA 3CCET 1U06A 2KRNA 1OX9A 4DBRA 3E9GA 4M75C 2EYQA 4M77B 3OYJA 2EGCA 1IO6A 3FIFA 4PJLA 1VQ9T 1Y96B 2QTXA 2CT4A 3L1AA 1H92A 2COYA 1Y71A 2B8AA 2RM4A 2JM8A 2QASA 1SSFA 1QCNA 3A8LB 5M9OA 5CQYA 4Q5WA 2XDBA 3FC3A 2PUOB 4LDWA 2YRCA 4GY5A 2RHZA 1WGSA 2D8HA 4RCCA 1H8KA 3OS2A 5GMKl 2A36A 1PCXA 1VQPT 5CAIA 2MWPA 1LVKA 3CMAA 4HA8A 1W70A 2FZGB 4PLIA 2FO0A 2P0QA 4L59A 4X34A 3CMAQ 2DFUA 4ZGDB 3TEEA 1VQPA 1Q86R 1RAGB 3VYHB 3H0HA 2CZ7B 2DJZA 2DTHA 5LJ3h 4N0AA 3M0UA 4KGXB 3CEYA 3TQ7P 1I5OB 1ABOA 2H3EB 1XQHA 3E19A 1FWZA 2JMAA 4HCCA 1N8RR 4ATOA 4ZNXA 1BI3A 3ZEHA 1WI7A 3CPFA 4LXCA 2PU9B 2L0AA 1H3HA 2BE9B 2GF7A 1VQOT 5KYNA 1Y07A 1M2VB 4PL6A 3CC2Q 4FYVB 3V7RA 1RAAB 2GFUA 3T9NA 2G3RA 1K9AA 2XICA 4FU6A 4JJCA 5LL6S 1HYOA 1FXXA 2K9GA 3CCMT 1LOJA 1E7OA 4M7DC 4PJOF 1YFNA 2K2VA 2LCCA 5GAN5 1YJ9A 3NTKA 3OY9A 5EC7A 4OMMA 1QLYA 1X69A 4M7AB 3VUBA 4J9DA 1WJQA 3CCVA 3ME9A 4C0DC 3LGFA 2L3SA 3GLXA 4JLGA 4J83A 4C92D 5GAN3 2O9VA 2Z0WA 4C8QC 2JS2A 2EKOA 2KEAA 1K8AU 1R8OB 1OYXA 1SEMA 2AT1B 4HVUA 3BFMA 4MZTA 3H0IA 4DBQA 2X4WA 1PG5B 4HCBA 3GP8A 2DRKA 5D7UA 1VYUA 1EFNA 4C92B 1K0SA 4KH0B 2DERA 4QQ6A 4NOYA 2MK5A 4CRIA 5GMKi 3QZ9B 2JXBA 3RBBB 1TU0B 4LDUA 1C1AA 4BD3A 4F7UF 4KGVB 1UEBA 4J7IA 1NZ9A 2WSFE 1NEBA 4CC3A 4PFZA 2EQJA 1ZX6A 5GAOl 1GL5A 4ZTFA 5DY9A 2QEXQ 3SFMA 3G4SQ 5KE2A 1WHGA 2F2VA 3ASKA 1N8RC 2RN8A 2JN0A 4MZPA 2O2OA 1SG5A 3RMQA 1UHFA 4M7DF 1UFFA 2J7IA 2MOXA 3EGDB 2HSEB 3VRZA 1QKWA 1R77A 2GFAA 2ENMA 1JJ2A 2L3RA 1UGRB 2RH2A 2PTKA 3E9FA 1UJYA 2OI3A 1QVFA 1R0BG 1WNLA 1ABQA 1Q82R 5I2SA 2DL8A 3CCRT 4LDXA 4E6RA 1LJOA 1NJIR 3H0FA 2I2LA 4CI0C 2ECZA 1YJWQ 3C94A 3QZ5B 4RMOA 3VS3A 2ESWA 5CKEA 4JRKA 1YHQA 4IUUA 4E7HA 1HXDA 3JCMP 1AZGB 1M4ZA 3EFOA 4LDVA 3V8LA 4ESRA 3G6ET 3O8VA 2AK5A 4J9GA 4A4KA 1BIBA 4HKEA 1VIEA 3OYNA 1WQ7A 4J6XA 3PGGA 2QQBA 1VQNA 2J6OA 4OMQA 3HFNA 4C8QG 3S3MA 3META 1SRMA 2BE7D 1RAHB 4Z88A 1GRIA 3CCUA 2C06A 4IUTA 1K0XA 2XDDA 3VS0A 3GIBA 3VS2A 2X4YA 3URGA 1YP5A 2DXUA 4DQ2A 1UGVA 1JB0E 1NYGA 1VQ9A 2JMCA 2MPXC 2DBKA 4M75A 5GAMh 1W2BA 5CO7A 2QA4A 4RG2A 3CCQT 1TOVA 2XD0A 4ME7A 2K5LA 4OMNA 5D6YA 1IREB 3OYAA 1F1BB 3OS5A 1RUWA 3I56Q 1AWJA 4KGZB 3MKDA 5GAN2 1Q82C 5DLOA 1RAIB 3INZA 3HHTB 1QVFP 4BDYA 4FCYA 4XTVA 3L2VA 2KI7A 4ORZA 3CMET 1W4SA 5FU6B 1KD1R 2RPNA 2KMTA 1M1FA 4OVAA 4PFPA 5IHIA 2MYSA 3FJPA 2NUTB 2EIFA 3CBPA 2SRCA 1M1KC 1BK2A 5L23A 2J05A 5C6SA 2RJDA 2ZPBB 3I56A 2A7YA 2YRVA 1P92A 2LJ3A 1WX6A 1VQ5T 4RTZA 3CD6A 4F7UE 2RQTA 3GBQA 4OMLA 3OYKA 4CC4B 3U23A 2Y90A 3HRUA 1DJ7B 4E2FB 4Y91A 1OEBA 3DB4A 3GNFB 1NEGA 1JXMA 4PJOG 5GMKm 4FYYB 3HPWA 4BI8B 4M7DA 2EBPA 2V1QA 3UWNA 1I0CA 1B07A 2NWMA 2EVRA 2LQ8A 3HRSA 4PLLA 4JZ4A 1G3SA 1VUBA 3OYMA 4M77F 1YJWA 3MP1A 2ZPGB 4QKUA 4C92G 4AMCA 3MO8A 1UGSB 2FVUA 4JRPA 2V8IA 2DIGA 1WYXA 2EQKA 2CYZB 1OULA 3NTHA 1Q81C 3VV0A 1KQSS 2SEMA 2HZYA 1WJRA 3O5ZA 2X51A 2CREA 2FEIA 1OZ3A 2RI3A 2XDPA 3HRTA 1IXDA 2EGAA 5D6WA 2IPOB 3QPHA 1M27C 3X26B 5GAOn 4JZ3A 2EQIA 4KUDK 3VS4A 4XQ3A 3PFSA 2J6KA 3I9QA 3BDLA 1WA7A 4M7AG 3TVTA 2D8JA 4M77D 1VA7A 1KFZA 2RHXA 1Q86U 4B6MA 1OV3A 1QVGS 3RR6A 2RQVA 3C0CA 4XU1A 2DA9A 1NJIC 1Z9ZA 5LJ5g 4M7AE 4J6YA 1VQLT 3L2RA 1PKTA 1O75A 2R57A 3LYIA 3E1SA 4YTLA 3WVDB 1K1ZA 1WLPB 1M1GA 1MNDA 1S72T 3S6WA 4Y92A 3UF4A 2QA4Q 1G5VA 3CCRA 5GAMf 3EG9B 3VRYA 4IUPA 2B86A 4C0FA 2HDAA 3OS1A 1GXIE 3CPWS 2DPPB 2XU8A 2RI5A 1G8XA 2P0PA 1AWOA 5GMKj 4NL3A 4D6WA 1YITA 4X1VA 2LC4A 2E10A 5LJ3g 1YHQT 3OB9A 3UA6A 3CCSQ 3M54A 2L5QA 2RHYA 2CS7A 3FJ5A 2GGRA 5KYYB 1KIKA 1WQWA 3QKJA 3CCSA 4KT0E 3JCMf 2R5MA 3V8KA 3ZL7C 2YSQA 1EZZB 3SWNB 4F16A 1PWTA 1UE9A 2ZPFB 5GAMj 2A0FB 3S3NA 2K79A 4PJNA 2ABLA 2YWWA 5LJ3j 1YBYA 1M90R 5KCOA 1VQOA 1K8AR 2LCLA 4M78A 1AWXA 3REAB 3CCUT 5FRMA 9ATCB 1PRMC 1ZBXA 1YNZA 1KD1U 2JZ2A 3EGDA 5IH2A 3ZFJA 1KQSA 1PNJA 2C0IA 3GOXA
chains in the Genus database with same CATH topology
2QDYB 2CZ1B 3QJ6A 2GF7A 2FB7A 3LWHA 1VQOT 3TCJA 4IUQA 4B9WA 1XOVA 5LJ5e 2VV5A 1Y07A 4PL6A 4XU3A 3OYGA 3JCMc 2HNIA 4ZN3A 3VU3C 3H8ZA 1XNIA 3MP8A 2DD5A 3V7RA 2GFUA 3RKWA 2LDMA 3T9NA 2O4XB 2G3RA 4X9CA 4PJOA 2XICA 4FU6A 3V8JA 2QQ9A 2YLBA 1BYMA 3CD6T 4ELZC 5LL6S 1QVPA 4XU2A 4NS5A 3MHXA 2L8DA 4C5GA 1FXXA 3CCMT 5AYFA 2P4TA 1K8AC 3VJPA 1LOJA 3SB2A 4XAXB 3FEOA 5CK9A 2QA4T 1VQ6A 4M7DC 1QP3A 4PJOF 3X20B 1M5Q1 2K2VA 2KVQG 2LCCA 4BDZA 2E12A 5GAN5 2KDSA 2PVDB 2K57A 3NTKA 2X4XA 4M75D 5GAOm 3OY9A 1YJ9A 2H3JA 3EAEA 2WSEE 3R6OA 4M7AB 3OYDA 2D6FA 1V29B 1Y7XA 2DKGA 3VUBA 3CCMA 2RK2A 4M75E 4NL2A 3JB9J 1WJQA 4BE2A 1VQKT 3CCVA 3ME9A 4R56A 4C0DC 3QHSA 4B9XA 2XG8D 5A0LA 3LGFA 1YI2A 1YJ9T 4JS4A 3GLXA 3P8HA 3QUIA 3J80E 4JLGA 1AHJB 4EMKC 2VGNA 3BY7A 4J83A 5CQXA 3A8MB 4C92D 3JB9G 1KC8C 3SDZA 4J7FA 5GAN3 3OW2A 4C8QC 3C95A 2K5IA 2XIDA 2E64A 4O6JA 2EKOA 1BI0A 1H641 2LVMA 1N6AA 3CMEA 1K8AU 5GANf 4N0AC 4M7DE 1R8OB 1KG1A 1OYXA 4A4GA 4II1A 4GLKA 3BFMA 4MZTA 4M77A 1N8RU 2X4WA 4HCBA 1EIFA 4PKCC 2VYTA 4J6WA 1UB4A 3CXCS 3GP8A 4C92B 2F5KA 2XKOC 4QQ6A 2LNVA 4A53A 4NOYA 3BDUA 2EJ9A 2HQXA 2E70A 4CRIA 5GMKi 3I56T 3QZ9B 4M78B 4C8QF 2DXBA 1D3BB 2OTJA 4LDUA 2V8JA 4BD3A 4F7UF 2DD4A 5GAMe 5L8RE 4LDYA 3JCMW 1UEBA 4J7IA 1NZ9A 2DEQA 2WSFE 3LLRA 4E7LA 3QSUA 4XU0A 3ZBDA 2ZPHB 4PJOC 3N5BB 3L2ZA 2QEXA 2DZ9A 4QW2A 2VUBA 2EQJA 4E47A 5FLXE 4M78E 3OS0A 5GAOl 2OTJT 4ZTFA 3GPLA 4M77C 4L5GA 2LT4A 5DY9A 3X28B 3SFMA 1YIJT 2DTIA 5KE2A 4M78D 3ASKA 1N8RC 3OW2S 1RL2A 2JOYA 2E6NA 5GMKh 3JCMb 2JN0A 2DXCA 4OB1B 4MZPA 1JRIA 3M9QA 3RMQA 2LX9A 1RI0A 1YJNA 4M7DF 3OSVA 4HCZA 3M55A 5I2MA 3J81E 3FB9A 1VQLA 4L6V5 3SD4A 2DO3A 2A3LA 2BUDA 2OTLA 3HSBA 1K9MU 4R55A 4QVZA 3TU4K 3M5AA 3LX7A 3Q1JA 3S3OA 4JLIA 2FYKA 4M7AD 3WXMB 3CCEA 2KQWA 4KUIA 5FU7C 2WACA 5CIUA 4BY6B 3L2QA 2GFAA 4M75B 1JJ2A 2L3RA 1YJNT 1UGRB 2RH2A 3H6ZA 3E9FA 3L2WA 1I4K1 1QVFA 1G3YA 1WNLA 2K3YA 3X24B 1WJSA 4IKFA 5GANd 3V7CA 2EWNA 3VYGA 1YJWT 1QVGA 1OZ2A 4A4FA 5I2SA 3JCMV 3P8BB 3CCRT 2L89A 4RG8A 5LJ3d 4A4HA 4LDXA 2E1HA 3DLMA 3CCJA 1LJOA 2QQSA 4M77G 5GANh 4VUBA 2I2LA 4DOWA 4CI0C 1KHCA 3C94A 3QZ5B 5HY6A 4RMOA 1ZHIA 4E7KA 2MI6A 3CC4A 3UDCA 4LD9K 2PVGB 4M78G 5CKEA 2JTFA 3PTAA 2LQKA 4QVDA 1K9MC 3JB9F 1U1SA 2PUKB 4BE0A 3CBOA 5J3BA 4JRKA 4ELYC 1YHQA 4IUUA 2EFIA 4E7HA 1HXDA 1VQNT 3JCMP 4ZTJA 1M4ZA 4LDVA 2MAMA 2QXFA 3G7ZA 3M4YA 3V8LA 4C8QE 5J39A 5GAOp 4RKUE 4C92A 3G6ET 3CC4T 3CCLA 3O8VA 3MEUA 4A4KA 3FDRA 1BIBA 3NFCA 2CZ6B 1KD1C 4HKEA 2KY9A 5KH6A 1VIEA 3OYNA 1WQ7A 4QQGA 4J6XA 3PGGA 2QQBA 3PMIA 3G4ST 5LJ5j 3QBYA 1VQNA 3HP9A 5FU6C 4C5HA 3HFNA 4ZGEB 5LJ5d 4C8QG 3JCMh 1VQ8T 4XTXA 3META 2E41A 4C5EA 2LTOA 4EDUA 3HFOA 4FT2A 3S3MA 5GAN8 3RERA 3HKSA 4E7IA 2IG0A 4EMKA 3CCUA 2C06A 4FL6A 4IUTA 1M90U 2MMPA 2K4YA 4KULA 3OYCA 2EJGA 3CC2A 4JJNK 4M7DB 3OMGA 4XTYA 5GAN6 2XDDA 4N4GA 4MMLA 3OYYA 1BI2A 4C8QD 3GIBA 4PJOD 3JSCA 3LWIA 2X4YA 2EQUA 3URGA 2YHTA 1S72A 4M7AC 2DK3A 2DXUA 1Q82U 2AHJB 5CKDA 4MDXA 3M58A 4DQ2A 4WF2A 1JB0E 4QQDA 3FRNA 3CCQA 1VQ9A 4OP0A 4Y28E 1H3ZA 4N4IA 4PNOA 2BIVA 2VC8A 4M75A 5GAMg 4F7UB 5GAMh 1W2BA 2MWOA 3RIRA 3OBYA 4OB3B 5CO7A 2M1HA 3KXTA 2FL7A 5LJ5f 2QA4A 1VQ6T 1U8RA 4EMGA 4RG2A 1M90C 3CXCA 3GF5A 4Z02A 3M57A 1YITT 3CCQT 4FT4A 1VQ4T 1U1TA 1I81A 2X4JA 2RD1A 4EMHA 2XD0A 1UGQB 3JCMJ 4C92F 4ME7A 3RUXA 2K5LA 3A5ZB 5D6YA 4ZN1A 2RHUA 3CC2T 2PVOB 1IREB 3OYAA 1M1KU 2R58A 2Y4XA 4FM4B 5GAN7 3OS5A 4HT8A 2WSCE 1VQKA 4BI4A 3CMAT 5GAOq 3CCST 5GAN2 4OF1A 1VQ4A 1Q82C 1Y96A 5HK0A 5DLOA 3INZA 1K73U 3HHTB 3I55A 4BDYA 5D6XA 4XTVA 3RMSA 1OI1A 4M75F 1BIAA 4M78F 4C8QB 1X01A 3V7SA 3UT1A 4A4EA 4ZGJB 2HBPA 4IURA 3JCMX 4JRQA 3L2VA 3QJYA 2E6ZA 3CMET 4BB7A 2XDBA 1W4SA 2BKDN 5FU6B 1BI1A 2KMTA 2XI9A 1M1FA 1IZ6A 5C0MA 4JRIA 3QXEB 3SWNC 4OVAA 2M9UA 3OYIA 3CC7T 3M4GA 1N9RA 3JCMd 3FJPA 3A8OB 2EIFA 3CBPA 5LJ3f 5KE3A 3JB9H 1KQ1A 4M7AF 2RHIA 4FIBA 5I21A 2VGMA 4BACA 3OYLA 1M1KC 3OQ5A 1PSEA 4OB2B 1VQMA 3JB9I 1VQ7A 1KQ2A 2RJFA 1ZQ1A 1QW1A 4LD6A 2DXTA 5GANe 2RJDA 2ZPEB 3ER0A 4MMKA 5C6SA 4PJOB 1MGQA 2ZPBB 5CR2A 2PQWA 4M78C 2A7YA 2DVEA 2YRVA 1XTDA 2EAYA 3JRZA 3JCMg 2O01E 3I56A 3CC7A 4P5NA 1TH7A 2ZCFB 3L2UA 5FROA 1K73C 3VKIA 3MEVA 1P92A 1QVFS 2XHCA 1VQ7T 1VQMT 1VQ5T 2RO0A 4O5VA 2GQVA 3KUFA 3CD6A 5DM7R 5GANg 4C0GA 5IAYA 2YLCA 3OYEA 1X6OA 4F7UE 2ZGWA 3JAME 5GANj 3QIIA 5GAN4 1O9SA 3MEWA 1YIJA 3LH0A 3OYKA 4M7DG 2Y90A 3HRUA 1DJ7B 1YCYA 3M59A 3BW1A 4Y91A 3PIPA 2JNGA 5IN1A 1VQ5A 3DB4A 2QI2A 3C12A 3GNFB 2D9TA 4OB0B 4PJOG 5GMKm 3RESA 1B34A 1JBMA 4OGEA 3HPWA 4BI8B 2QQAA 2K5FA 2RB6A 1KC8U 3MEAA 4M7DA 1WPYA 3CCVT 1NPPA 3UWNA 3DB3A 4M7DD 3MCAB 3QG1A 2LQ8A 3HRSA 4PLLA 2ZZDA 1G3SA 4DA4A 3M56A 2NLUA 2GCXA 2QQRA 2XK0A 2DTOA 1VUBA 3P8DA 3OYMA 5GAOr 4M77F 1YJWA 2M0OA 3MP1A 2ZPGB 4C92G 3JB9D 3MO8A 1UGSB 2FVUA 3JCMQ 4JRPA 1FX7A 4HT9A 2Y4YA 1NPRA 1D3BA 2DIGA 2V8IA 4OGCA 3CCJT 2EQKA 2CYZB 2ZPIB 2RA2A 3CBMA 1Q86C 3NTHA 5DLQE 2DIQA 1Q81C 3VV0A 3RKYA 1KQSS 4M7AA 4J5YA 1WJRA 3J7AF 4XTWA 1Q7YC 2VXEA 4JDSA 1NJIU 5CKHA 1OZ3A 2DZCA 4C0DB 4C92C 1QP2A 3MP6A 1YI2T 2RI3A 2XDPA 3HRTA 2RJEA 2FHDA 4M75G 1M8VA 4MDWA 5D6WA 3QPHA 2HAXA 4XK8E 4EMKB 3X26B 5GAOn 1LNXA 4KUDK 2X35A 2EJFA 4E7JA 2E5QA 3HL8A 3FLGA 3PFSA 4XQ3A 1BKBA 5CKFA 2F5TX 3DKMA 2MF2A 2O4XA 5IT9E 4PJOE 3UPUA 2LT1A 2QEXT 3BDLA 4EPCA 1MHNA 1I5LA 4M7AG 2HQEA 3KBGA 2KK4A 3QYGB 4M77D 4M77E 4BUGA 1HK9A 2OAUA 2RHXA 3G4SA 4V2SA 4UC4A 2HD0A 1Q86U 4DOVA 5LJ3e 3PNWC 3OSSC 1Q81U 4KBMB 2VXFA 1QVGS 5CVIA 4TVRA 3GNGA 1VQ8A 2CZ0B 4XU1A 1N9SA 2V8KA 4C0ZA 1Q7YU 1NJIC 2E65A 4C92E 5A0DA 5LJ5g 3OA6A 3L42A 4J6YA 1VQLT 3EFSA 4C8QA 4M7AE 5HKCA 3L2RA 2OTLT 1O75A 2RK1A 4N4HA 2R57A 3LYIA 3QO3A 4RCBA 3E1SA 4IUVA 2RJCA 5HK3A 1N27A 3PT9A 3CPWA 3DLLA 3AHUA 3CCET 4YTLA 3WVDB 2CKKA 5A2QE 3OYHA 5FU7B 1M1GA 3E9GA 4M75C 2CGHA 3SWNA 4BE1A 3S6WA 2EYQA 4M77B 3OYJA 1S72T 2JTMA 4MZMA 3G71A 2JVVA 3OYBA 3WVEB 5LJ5h 3OBWA 1G5VA 4QVCA 1W2BS 5GMKe 5GAMf 3FIFA 3CCRA 4BY6C 1VQ9T 3VUZA 1Y96B 2QTXA 3L1AA 4IUPA 4C0FA 1Y71A 2B8AA 3OS1A 1I8FA 2RM4A 1GXIE 3OYFA 3CPWS 2DPPB 2XU8A 4J8OA 1SSFA 2RI5A 3A8LB 3C4SA 3G71T 3M53A 4OMFB 2P0PA 4Q5WA 2KSSA 5CQYA 2PUOB 2P0KA 5M9OA 5GMKj 1VIFA 4LDWA 4GY5A 4NL3A 3FC3A 4D6WA 1YITA 3F70A 2LC4A 4XTUA 1NE8A 2RI2A 2RHZA 1WGSA 2E10A 2LRQA 3OMCA 4RCCA 5LJ3g 3TREA 2DAQA 1YHQT 3X25B 3OB9A 3OS2A 1B34B 3M54A 2R5AA 5GMKl 1VQPT 2L5QA 2MWPA 2EQMA 1PSFA 2RHYA 2CS7A 5CKBA 5CAIA 5CCAA 5KCHA 4F7UA 1G3TA 1G3WA 3JCMe 3CMAA 4HA8A 3A8GB 3G6EA 3CCLT 1WQWA 2K3XA 3QKJA 4KT0E 3RKXA 3JCMf 3LGLA 3PIOA 2R5MA 3V8KA 3CCSA 2JUFA 2M16A 4PLIA 2P0QA 4L59A 4X34A 2D0QB 3I55T 3SWNB 5FRNA 4ZGDB 3EFRA 3TEEA 2ZPFB 5GAMj 1M9SA 4A54A 1VQPA 3A8HB 3S3NA 1UGPB 3VYHB 2CZ7B 2DJZA 3PMTA 2DTHA 5LJ3h 1YBYA 4N0AA 4F7UG 3QYHB 5LJ3j 4JS5A 4JUVA 3QDRB 5KCOA 3CEYA 4BI3A 2F69A 1VQOA 2KAFA 2LCLA 4M78A 3CCUT 1XQHA 3E19A 3LW5E 5A0GA 5FRMA 1FWZA 4FSXA 4HCCA 1ZBXA 2IVWA 4ATOA 1KD1U 2JZ2A 1BI3A 5EG2A 3ZEHA 4C5IA 5GAMd 1X75C 4XTZA 3CPFA 1KHIA 2PU9B 3ZFJA 5J26A 1KQSA 3NTIA 4X9DA 1JJ2S 3GOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO n;  4JLI A;  1LNX A;  5GAN 7;  2FYK A;  2FB7 A;  4HT8 A;  4M7A D;  2EJF A;  4XQ3 A;  5LJ5 e;  5GAO q;  4M75 B;  5GAN 2;  4XU3 A;  3JCM c;  2HNI A;  1Y96 A;  3VU3 C;  4PJO E;  1I4K 1;  3INZ A;  1WNL A;  3V7R A;  5GAN d;  3RKW A;  3V7C A;  2EWN A;  1I5L A;  4XTV A;  4M7A G;  4M75 F;  1BIA A;  4M78 F;  4X9C A;  1X01 A;  3V7S A;  3JCM V;  3V8J A;  4C8Q B;  3JCM X;  4PJO A;  2YLB A;  4M77 D;  4M77 E;  5LJ3 d;  1HK9 A;  4V2S A;  4XU2 A;  2E1H A;  1LJO A;  5LJ3 e;  4M77 G;  5GAN h;  1LOJ A;  2VXF A;  3SB2 A;  4M7D C;  2I2L A;  4JRI A;  4PJO F;  3SWN C;  4XU1 A;  1N9S A;  1N9R A;  3M4G A;  1M5Q 1;  3FJP A;  3JCM d;  5LJ3 f;  5GAN 5;  5GAO m;  2K57 A;  3JB9 H;  4M75 D;  1KQ1 A;  2E65 A;  4C92 E;  5LJ5 g;  4M78 G;  4J6Y A;  4M7A E;  4M7A F;  3EFS A;  4C8Q A;  5I21 A;  4QVD A;  3JB9 F;  1U1S A;  4M7A B;  3QO3 A;  1KQ2 A;  2DKG A;  4RCB A;  4JRK A;  3JB9 I;  4M75 E;  5GAN e;  2DXT A;  4NL2 A;  4MMK A;  3JB9 J;  3AHU A;  4PJO B;  1MGQ A;  1HXD A;  4M78 C;  3JCM g;  2DVE A;  3QHS A;  2EAY A;  3JCM P;  3V8L A;  4C8Q E;  1TH7 A;  5GAO p;  4M75 C;  2CGH A;  3SWN A;  4C92 A;  3QUI A;  4M77 B;  4EMK C;  3BY7 A;  1BIB A;  4C92 D;  3JB9 G;  5LJ5 h;  5GAN 3;  4C8Q C;  4QVC A;  1WQ7 A;  5GMK e;  4J6X A;  3FIF A;  2E64 A;  3PGG A;  5GAM f;  1H64 1;  5GAN g;  1Y96 B;  2QTX A;  3L1A A;  5LJ5 j;  4N0A C;  2YLC A;  5GAN f;  4M7D E;  4F7U E;  2ZGW A;  5GAN j;  3HFN A;  1I8F A;  2RM4 A;  5LJ5 d;  5GAN 4;  4C8Q G;  3JCM h;  4M7D G;  4XTX A;  2Y90 A;  2E41 A;  3BFM A;  3HFO A;  4M77 A;  1YCY A;  5GAN 8;  5GMK j;  3BW1 A;  4Y91 A;  3RER A;  4NL3 A;  4EMK A;  4J6W A;  4XTU A;  4C92 B;  2E10 A;  4PJO G;  5GMK m;  2EJG A;  4RCC A;  3RES A;  4A53 A;  5LJ3 g;  1B34 A;  1JBM A;  4NOY A;  4M7D B;  4XTY A;  3BDU A;  5GAN 6;  2RB6 A;  2EJ9 A;  4M7D A;  4MML A;  1B34 B;  1WPY A;  5GMK i;  5GMK l;  4M78 B;  4C8Q F;  5CAI A;  1D3B B;  4M7D D;  4C8Q D;  3GIB A;  4F7U A;  4PJO D;  4F7U F;  3JCM e;  5GAM e;  4HA8 A;  2YHT A;  4M7A C;  1WQW A;  3RKX A;  3JCM f;  3JCM W;  2DXU A;  2DEQ A;  3V8K A;  3QSU A;  4XU0 A;  4PJO C;  2DTO A;  4DQ2 A;  3L2Z A;  5GAO r;  4WF2 A;  2DZ9 A;  4M77 F;  4OP0 A;  3SWN B;  4C92 G;  3JB9 D;  3EFR A;  4M78 E;  5GAM j;  4A54 A;  4PNO A;  3JCM Q;  5GAO l;  4M77 C;  4HT9 A;  2VC8 A;  2DJZ A;  4M75 A;  1D3B A;  2DTH A;  5DY9 A;  4N0A A;  5LJ3 h;  4F7U G;  2DTI A;  4F7U B;  5LJ3 j;  5GAM h;  4M78 D;  3RIR A;  2RA2 A;  4JUV A;  5GMK h;  5LJ5 f;  2JN0 A;  3JCM b;  3RKY A;  4M7A A;  4M78 A;  4EMG A;  4J5Y A;  1JRI A;  4XTW A;  2VXE A;  1U1T A;  1I81 A;  4M7D F;  2RD1 A;  2DZC A;  4EMH A;  4C92 C;  5GAM d;  4C92 F;  3FB9 A;  4XTZ A;  3JCM J;  3RUX A;  4M75 G;  4X9D A;  1M8V A;  3HSB A;  4EMK B;  5GAM g; 
#chains in the Genus database with same CATH topology
 3QJ6 A;  3TCJ A;  4B9W A;  1XOV A;  1JU5 C;  2VV5 A;  3E2U A;  3CCV Q;  1K4U S;  1M3B A;  1T0H A;  1WXU A;  4XU3 A;  3JCM c;  3H8Z A;  2O4X B;  4X9C A;  3V8J A;  1B3Q A;  1BYM A;  1CKA A;  1QVP A;  4XU2 A;  3RNJ A;  1HD3 A;  5AYF A;  3SB2 A;  2CP6 A;  2CUB A;  2CH4 A;  3X20 B;  1B7T A;  4BDZ A;  2KDS A;  3EH2 A;  2X4X A;  4JJD A;  2DVJ A;  2WSE E;  3OYD A;  4NL2 A;  4R56 A;  3QHS A;  4B9X A;  5A0L A;  3J80 E;  3P8H A;  3UAT A;  2ED1 A;  2PNI A;  3JB9 G;  2YXY A;  3OW2 A;  1FMV A;  1RAF B;  1H64 1;  3CME A;  2LVM A;  1ZLM A;  1KG1 A;  4II1 A;  1X6B A;  4KH1 B;  4PKC C;  2COW A;  3CXC S;  1UB4 A;  1YN8 A;  2LNV A;  4E7Z A;  2EJ9 A;  3I56 T;  1TWB A;  2RMO A;  2DM1 A;  3JV3 A;  3M0Q A;  5L8R E;  1JXO A;  4LDY A;  3JCM W;  1PM3 A;  4PJO C;  3L2Z A;  2CSQ A;  3NGP A;  2QEX A;  4QW2 A;  3CME Q;  1D1C A;  2DX1 A;  4M78 E;  4L5G A;  2LT4 A;  2MCN A;  2DF6 A;  4AFU C;  2DTI A;  4LN2 A;  4DEY A;  3OW2 S;  1RL2 A;  5GMK h;  2DXC A;  2KRO A;  3SHW A;  1GBR A;  2LX9 A;  4HCZ A;  3M55 A;  3J81 E;  2DO3 A;  4LUD A;  4R55 A;  1MMN A;  3TU4 K;  3LX7 A;  4J9I A;  4JLI A;  4WTO B;  2FYK A;  1UG1 A;  2WAC A;  1ZUU A;  3A98 A;  3X24 B;  5GAN d;  1YJW T;  3VYG A;  1QVG A;  2L89 A;  4RG8 A;  5I22 A;  2CT3 A;  4A4H A;  1TUC A;  4F14 A;  3CCJ A;  2EGE A;  2XMF A;  4M77 G;  5GAN h;  4VUB A;  2X3X D;  3RDV A;  1KHC A;  1ZHI A;  2MI6 A;  2J06 A;  4LD9 K;  1QCF A;  4M78 G;  2LQK A;  1K9M C;  2IIM A;  2EFI A;  4CC7 A;  1VQN T;  4ZTJ A;  1M3C A;  2MAM A;  3G7Z A;  3M4Y A;  4AT1 B;  3CC4 T;  2LCS A;  4QQG A;  3CCE Q;  4C5H A;  4ZGE B;  3JCM h;  2ROT A;  3BE3 A;  5GAN 8;  3HKS A;  4FL6 A;  1UEC A;  3OYC A;  1SF9 A;  1AT1 B;  1WHL A;  4ANJ A;  4XTY A;  5GAN 6;  4MML A;  1QKX A;  8AT1 B;  4C8Q D;  4PJO D;  1VOM A;  3CCQ Q;  5ECA A;  1UUE A;  2LJ1 A;  2DL3 A;  3CCQ A;  4AFZ C;  2ZAE A;  4PNO A;  2JTE A;  1SKU B;  2QTV A;  2W10 A;  3OBY A;  5LJ5 f;  1VQ6 T;  1U8R A;  3CCR Q;  3GF5 A;  1ZSZ B;  4Z02 A;  1QWE A;  1YIT T;  4FT4 A;  1U1T A;  1I81 A;  2RD1 A;  4EMH A;  1ZSZ A;  3RUX A;  3A5Z B;  4ZN1 A;  3CC2 T;  1BCO A;  2R58 A;  2Y4X A;  4FM4 B;  5GAN 7;  1FMK A;  2CSI A;  4HT8 A;  4BI4 A;  4DEX A;  3CMA T;  3CCS T;  1VQ4 A;  4OF1 A;  3H41 A;  4HVW A;  1JJ2 P;  1Y96 A;  5KYX B;  1RLP C;  5HK0 A;  3RMS A;  1OI1 A;  3CC2 A;  3V7S A;  2KE9 A;  4A4E A;  4JRQ A;  2A37 A;  3QJY A;  2E6Z A;  3EFO B;  3G6E Q;  1M2O A;  2EYW A;  1Q7Y R;  3QXE B;  3SWN C;  1N9R A;  3A8O B;  4GBQ A;  4DBF A;  5LJ3 f;  1NG2 A;  1KQ1 A;  1PC0 A;  4BAC A;  3OQ5 A;  1KQ2 A;  3JB9 I;  2RJF A;  4E7S A;  4LD6 A;  1SSH A;  3CPW P;  5CR2 A;  3JCM g;  4M78 C;  3JRZ A;  3CC7 A;  1IRX A;  3L2U A;  2HKQ B;  3MEV A;  2K2M A;  3EGU A;  2KXD A;  3QWY A;  1IHV A;  2FPF A;  2GQV A;  3R6N A;  1GCQ A;  2YLC A;  3OYE A;  1X6O A;  2ZGW A;  1T3S A;  3QDF A;  1O9S A;  2CP3 A;  2LMJ A;  3I55 Q;  1YJ9 Q;  3BW1 A;  4CC2 A;  3C12 A;  3LH5 A;  1D0Y A;  4AFQ C;  1LCK A;  1B34 A;  2QQA A;  2K5F A;  3CCV T;  3DB3 A;  3SEM A;  5IHN A;  3QG1 A;  2HL3 A;  3M56 A;  2GCX A;  2DTO A;  3P8D A;  5GAO r;  2HBW A;  1SHG A;  1GCP A;  2YUO A;  3JCM Q;  2Y4Y A;  1OPK A;  3CBM A;  2DIQ A;  1M2V A;  3J7A F;  2HMA A;  1PKS A;  3CXC P;  1Q81 R;  4JDS A;  1NJI U;  3MP6 A;  2RJE A;  4MDW A;  4EMK B;  1YHQ Q;  1LNX A;  2X35 A;  2EJF A;  3FLG A;  2HKN A;  3DKM A;  2O4X A;  5IT9 E;  3UPU A;  6AT1 B;  2QEX T;  4EPC A;  1AWW A;  2KK4 A;  4BUG A;  2I0N A;  3QWX X;  4UC4 A;  2HD0 A;  2YUP A;  4KBM B;  3ULR B;  1VQ8 A;  1N9S A;  1Q7Y U;  2E65 A;  5A0D A;  3L42 A;  2NUT A;  2RK1 A;  3QO3 A;  5I11 A;  1BBZ A;  4RCB A;  1OOT A;  5FWC A;  2CKK A;  3OYH A;  2KNB B;  1WHJ A;  1AVZ C;  2CGH A;  3SWN A;  2JVV A;  1K76 A;  2L3Q A;  3OYB A;  4HVV A;  3OBW A;  4QVC A;  1W2B S;  5GMK e;  3VUZ A;  3OYF A;  4J8O A;  2DE0 X;  4FSS A;  4OMF B;  1VIF A;  4RUG A;  4QT7 A;  4XTU A;  2D1X A;  2LRQ A;  2ED0 A;  1UTI A;  1B34 B;  3G1J A;  2R5A A;  5KCH A;  2EQM A;  4F7U A;  2RF0 A;  3G6E A;  2K3X A;  3RKX A;  3PIO A;  3I55 T;  3EG3 A;  4A54 A;  1IGQ A;  3A8H B;  2GTJ A;  3PMT A;  1WIE A;  4JS5 A;  8ATC B;  4AG1 C;  3QYH B;  1VQ9 Q;  1E6H A;  4BI3 A;  2H8H A;  2KAF A;  2A28 A;  1PHT A;  5A0G A;  4FSX A;  1TXQ A;  5EG2 A;  1X75 C;  4XTZ A;  2LJ0 A;  1KHI A;  5J26 A;  3NTI A;  4X9D A;  3EHR A;  1JJ2 S;  2JW4 A;  2YDL A;  2FB7 A;  3TSZ A;  1GFD A;  4RTX A;  4ZN3 A;  3REB B;  3VU3 C;  2DD5 A;  3NPF A;  1MV3 A;  2QQ9 A;  2YLB A;  2RQU A;  4C5G A;  2L8D A;  3EH1 A;  3MPU B;  4XAX B;  5CK9 A;  2QA4 T;  1VQ6 A;  1QP3 A;  1D0X A;  1QWF A;  2E12 A;  2PVD B;  5GAO m;  4M75 D;  2QG9 B;  2DL7 A;  1VQ5 Q;  2H3J A;  2QK0 A;  1G2B A;  4AFS C;  3R6O A;  4D8D A;  1C6V X;  3JB9 J;  2DLP A;  4BE2 A;  1K73 R;  1ARK A;  1ZSG A;  1YI2 A;  2XG8 D;  2BTT A;  1Z9Q A;  1YIT Q;  1ZBJ A;  4EMK C;  1G83 A;  5CQX A;  3A8M B;  2YRD A;  3C95 A;  2K5I A;  2AIR B;  2DYB A;  2E64 A;  1VQK Q;  1HJD A;  2BZX A;  5GAN f;  4N0A C;  2RQR A;  1VQ4 Q;  3M0T A;  4M7D E;  1U5S A;  4A4G A;  3I5S A;  1EIF A;  2VYT A;  1PRL C;  2F5K A;  2XKO C;  1KJW A;  4Z89 A;  3BDU A;  2HQX A;  2E70 A;  2FG0 A;  2QYZ A;  2OTJ A;  2V8J A;  1ZA1 B;  4OMP A;  1M30 A;  3LLR A;  3ZBD A;  2DZ9 A;  2VUB A;  2CP7 A;  2KGT A;  1RAD B;  2OTJ T;  1TUD A;  2YUQ A;  4M77 C;  5GJV B;  1X6G A;  4Z8A A;  4M78 D;  2JOY A;  2E6N A;  1JO8 A;  1JRI A;  3M9Q A;  5I2M A;  3CC4 Q;  4L6V 5;  3SD4 A;  2A3L A;  2BUD A;  2OTL A;  2E5K A;  3HSB A;  2EYY A;  1NM7 A;  3M0P A;  3Q1J A;  4M7A D;  3WXM B;  4GLM A;  1MMG A;  5CIU A;  5FU7 C;  3L2Q A;  4M75 B;  3I5R A;  3H6Z A;  2MIO A;  1I4K 1;  1U3O A;  3CCL Q;  4IKF A;  3V7C A;  2EWN A;  3NMZ C;  1TSF A;  3JCM V;  3P8B B;  2CP0 A;  2KRM A;  5LJ3 d;  2AZV A;  2EW3 A;  2QGG A;  2QQS A;  1RAE B;  5HY6 A;  1YWO A;  2FRW A;  3UDC A;  3CC4 A;  1M1K R;  2PVG B;  1YWP A;  1R0C B;  2CH4 W;  2JTF A;  4FW2 A;  1W6X A;  4QVD A;  1U1S A;  3JB9 F;  2PUK B;  4BE0 A;  1PD1 A;  4RTT A;  3EHQ A;  2ATC B;  1K9M R;  1I1J A;  2QXF A;  1MUZ A;  5GAO p;  3CCL A;  2NUZ A;  4LE9 A;  2KYM A;  1S72 Q;  3MEU A;  3FDR A;  2KY9 A;  5KH6 A;  1J3T A;  3EG2 A;  3NHN A;  3PMI A;  2CP2 A;  3HP9 A;  5FU6 C;  1T3L A;  1VQ8 T;  4C5E A;  2E41 A;  2FRY A;  2LTO A;  3RER A;  4E7I A;  4EMK A;  1M90 U;  2OJ2 A;  2RNA A;  1X2Q A;  1I07 A;  2G6F X;  3OMG A;  4N4G A;  2M02 A;  2L3P A;  3OYY A;  2EPD A;  3VS1 A;  3JSC A;  3LWI A;  2YHT A;  1S72 A;  4M7A C;  1WFW A;  3PE0 A;  1VQP Q;  1Q82 U;  2AHJ B;  3M58 A;  4WF2 A;  5AT1 B;  4OP0 A;  4N4I A;  2VKN A;  5KYU B;  1VQ4 T;  2O9S A;  1UGQ B;  3JCM J;  1A0N B;  2NYS A;  2PVO B;  1VQK A;  2QAZ A;  5GAO q;  2ROL A;  4M75 F;  4ZGJ B;  2NUP A;  1NLO C;  4M78 F;  4C8Q B;  3UT1 A;  1Y57 A;  4IUR A;  3JCM X;  1JQQ A;  3MJX A;  2GBQ A;  2BKD N;  4J9H A;  1BI1 A;  2XI9 A;  4IIM A;  1IZ6 A;  2JM9 A;  3OYI A;  1KSW A;  2M9U A;  3CC7 T;  3M4G A;  3JCM d;  4HCK A;  3CCM Q;  3JB9 H;  2RHI A;  5I21 A;  1QW1 A;  5GAN e;  1TS9 A;  2DXT A;  4MMK A;  2RQW A;  1KC8 C;  2PQW A;  2DVE A;  4OMO A;  1VQM Q;  4P5N A;  1TH7 A;  2ZCF B;  1K73 C;  2AKL A;  2DBM A;  2DYI A;  2HSP A;  1VQM T;  3KUF A;  5DM7 R;  5GAN g;  3JAM E;  1V1C A;  1E6G A;  2HEQ A;  4PJM A;  3IQL A;  5GAN 4;  3MEW A;  1YIJ A;  3LH0 A;  3HTR A;  1YCY A;  3PIP A;  2JNG A;  2QI2 A;  1IGU A;  1UJ0 A;  2D9T A;  2GQI A;  2E4H A;  4OGE A;  1JBM A;  3EGX A;  1UDL A;  1TG0 A;  1KC8 U;  1WPY A;  2V1R A;  1NPP A;  2JJ9 A;  3MCA B;  5IXF A;  2KBT A;  4DA4 A;  2QQR A;  4K11 A;  4RTY A;  1M8M A;  2QGF B;  1WXB A;  2JT4 A;  1FX7 A;  4HT9 A;  1MV0 B;  1D3B A;  4LUE A;  4OGC A;  3CCJ Q;  2EKH A;  2ZPI B;  1W2B P;  1QVG P;  4M7A A;  4F17 A;  5FW9 A;  5KYW A;  1RAB B;  4XTW A;  1Q7Y C;  2VXE A;  4C92 C;  1QP2 A;  1M8V A;  4XK8 E;  1D0Z A;  2E5Q A;  5CKF A;  1ZUK A;  2F5T X;  2MF2 A;  4PJO E;  1RAC B;  3PVQ A;  2LP5 A;  3CQT A;  1I5L A;  3KBG A;  2OTJ Q;  2DIL A;  3QYG B;  2BZY A;  4FYW B;  1HK9 A;  2OAU A;  3G4S A;  2O88 A;  4V2S A;  2X9H A;  4DOV A;  4WCI A;  5LJ3 e;  3PNW C;  3OSS C;  4RTV A;  4C0Z A;  1SHF A;  4R0K A;  3OA6 A;  4N4H A;  1WXT A;  2RJC A;  3UA7 A;  5HK3 A;  4J9E A;  3AHU A;  1QCO A;  1D09 B;  5A2Q E;  5FU7 B;  2COZ A;  4BE1 A;  2F1L A;  1ZUY A;  2JTM A;  4MZM A;  3G71 A;  3WVE B;  5LJ5 h;  4BY6 C;  3G71 Q;  2HQH A;  1TUG B;  1OX8 A;  1I8F A;  2QDL A;  2LQN A;  3C4S A;  2AZS A;  3G71 T;  3M53 A;  2KSS A;  2P0K A;  2CUD A;  1RLQ C;  3F70 A;  3OMC A;  1NE8 A;  2RI2 A;  1WHK A;  3TRE A;  2DAQ A;  2M0Y A;  2DJQ A;  3X25 B;  1CKB A;  2KT1 A;  1LPL A;  2LNH B;  5CKB A;  4AG2 C;  1PSF A;  5CCA A;  5KYU A;  1G3T A;  1G3W A;  3JCM e;  3A8G B;  3VS6 A;  3CCL T;  3LGL A;  2JUF A;  1VQL Q;  2M16 A;  2D0Q B;  3A1P A;  5FRN A;  3EFR A;  3EG1 A;  1M9S A;  1QMC A;  1UGP B;  4F7U G;  4JUV A;  3QDR B;  7AT1 B;  2F69 A;  3H9N A;  2DL4 A;  3LW5 E;  2LX7 A;  2IVW A;  4C5I A;  1MMA A;  5GAM d;  1AOJ A;  3VS7 A;  1BCM A;  2QDY B;  2CZ1 B;  2FZC B;  3LWH A;  4IUQ A;  5LJ5 e;  1WDX A;  3OYG A;  3EG0 A;  2HNI A;  3MP8 A;  1XNI A;  5IXB A;  3RKW A;  2LDM A;  4PJO A;  3CD6 T;  4ELZ C;  1VQ6 Q;  4NS5 A;  3MHX A;  1K8A C;  2P4T A;  3VJP A;  1BU1 A;  3FEO A;  1IB8 A;  1M5Q 1;  2KVQ G;  1KD1 C;  1YI2 T;  1AZE A;  2K57 A;  1ZA2 B;  3EAE A;  1WHM A;  2F2X A;  2D6F A;  1V29 B;  1Y7X A;  2DKG A;  1EX4 A;  2E3H A;  2RK2 A;  4M75 E;  3CCM A;  1YI2 Q;  1VQK T;  1YJ9 T;  4DBH A;  4JS4 A;  3QUI A;  1KC8 R;  2K3B A;  1AHJ B;  2VGN A;  3BY7 A;  2CDT A;  3EGX B;  3CC7 Q;  1S1N A;  3SDZ A;  4J7F A;  2XID A;  4O6J A;  1BI0 A;  1N6A A;  4PJJ A;  3THK A;  2LQW A;  1C0M A;  1MNE A;  1WZO A;  4GLK A;  2AKK A;  2YT6 A;  4M77 A;  1N8R U;  4J6W A;  4HXJ A;  3TSW A;  2LZ6 B;  4A53 A;  2O31 A;  1D1A A;  1Y0M A;  2OTL Q;  1VYT A;  1X2K A;  4F04 B;  1VQN Q;  1OPL A;  4M78 B;  4C8Q F;  2DXB A;  1D3B B;  1UHC A;  2DD4 A;  5FWB A;  5GAM e;  2M51 A;  1N5Z A;  1NYF A;  3QSU A;  1OU9 A;  2DEQ A;  4E7L A;  4FW1 A;  4XU0 A;  2ZPH B;  5IHK A;  3N5B B;  4E47 A;  5FLX E;  3OS0 A;  3GPL A;  3I35 A;  2KR3 A;  3X28 B;  2KT8 A;  1YIJ T;  2EYZ A;  1FYN A;  3JCM b;  4OB1 B;  1NLP C;  4J9B A;  4JPB W;  2DMO A;  1RI0 A;  1YJN A;  3OSV A;  3FB9 A;  1VQL A;  1GFC A;  1K9M U;  1KQS P;  4QVZ A;  3M5A A;  3S3O A;  3CCE A;  1X27 A;  2KQW A;  4KUI A;  4BY6 B;  2VWF A;  1YJN T;  2VVK A;  5GJW B;  3L2W A;  1G3Y A;  5HCK A;  2K3Y A;  1WJS A;  1OZ2 A;  1VQ7 Q;  4A4F A;  2PZ1 A;  1Q95 G;  2FZK B;  2E1H A;  3DLM A;  2EYX A;  4DOW A;  4PFO A;  2KRS A;  4E7K A;  3PTA A;  3CD6 Q;  1D1B A;  4RTU A;  3CBO A;  5J3B A;  4ELY C;  4PK4 A;  3KFV A;  2CP5 A;  1GBQ A;  4J9C A;  4C8Q E;  2OX7 A;  5J39 A;  4RKU E;  4C92 A;  1NBE B;  1QQJ A;  2HL5 C;  2CZ6 B;  3NFC A;  3OW2 P;  2C0O A;  3G4S T;  5LJ5 j;  3QBY A;  1OU8 A;  5LJ5 d;  4XTX A;  4EDU A;  3HFO A;  4FT2 A;  4JJB A;  2A08 A;  1CSK A;  2IG0 A;  4IIO A;  2X3W D;  2MMP A;  2K4Y A;  4KUL A;  2KXC A;  2EJG A;  4M7D B;  4JJN K;  1VYV A;  4J9F A;  1BI2 A;  2EQU A;  2GTO A;  2DK3 A;  2P84 A;  2DNU A;  5CKD A;  4MDX A;  4QQD A;  2P4R A;  3FRN A;  4Y28 E;  1H3Z A;  2DL5 A;  2BIV A;  2VC8 A;  5GAM g;  1GCQ C;  4F7U B;  2MWO A;  3RIR A;  4OB3 B;  2M1H A;  3KXT A;  2FL7 A;  2DEU A;  4EMG A;  3CCU Q;  1M90 C;  3CXC A;  2DET A;  3M57 A;  2K7A A;  2X4J A;  4C92 F;  2F2W A;  2KYB A;  2J6F A;  1XJW B;  2RHU A;  1M3A A;  3D7S B;  1M1K U;  2K6D A;  2WSC E;  5KYX A;  3VS5 A;  3EG9 A;  1V76 A;  1K73 U;  1YIJ Q;  3I55 A;  2DRM A;  5D6X A;  4EIK A;  1BIA A;  1X01 A;  2W0Z A;  2HBP A;  2JS0 A;  2VB6 A;  4BB7 A;  1WHH A;  2C0T A;  3M0R A;  5C0M A;  4JRI A;  2HCK A;  5KE3 A;  4M7A F;  2OAW A;  4FIB A;  2VGM A;  4RTW A;  3OYL A;  1PSE A;  4OB2 B;  1VQM A;  1VQ7 A;  1ZQ1 A;  3ER0 A;  2ZPE B;  4PJO B;  1MGQ A;  1FMW A;  1BB9 A;  1KK7 A;  1XTD A;  2EAY A;  2O01 E;  1ACM B;  5FRO A;  3VKI A;  1VQ8 Q;  1QVF S;  2XHC A;  1VQ7 T;  2FPD A;  2RO0 A;  4O5V A;  1SPK A;  4C0G A;  5IAY A;  1YJN Q;  1PD0 A;  5GAN j;  3QII A;  2BZ8 A;  4M7D G;  2GNC A;  1AEY A;  3M59 A;  2VAS A;  5IN1 A;  1T0J A;  1ZSZ C;  1VQ5 A;  4OB0 B;  3M0S A;  3RES A;  2FPE A;  1X43 A;  2RB6 A;  3MEA A;  4M7D D;  3AT1 B;  1VQO Q;  4LNP A;  2ZZD A;  2NLU A;  1JEG A;  2XK0 A;  1SRL A;  4FYX B;  2M0O A;  3JB9 D;  1NPR A;  3PVL A;  3CCJ T;  1MMD A;  1Q86 C;  2RA2 A;  5DLQ E;  5KYW B;  3RKY A;  2L2P A;  4J5Y A;  2V26 A;  5KYY A;  5CKH A;  2DZC A;  4C0D B;  1W1F A;  2YUN A;  2FHD A;  4M75 G;  1AD5 A;  2HAX A;  4M4Z A;  4E7J A;  3HL8 A;  1RI9 A;  1BKB A;  2D0N A;  4A63 B;  2LT1 A;  1MHN A;  1IHW A;  2HQE A;  4M77 E;  1TTH B;  1Q81 U;  1YCS B;  2VXF A;  4KRT A;  5CVI A;  2E3I A;  4TVR A;  3GNG A;  1HSQ A;  2CZ0 B;  2V8K A;  4C92 E;  1OQK A;  2NUP B;  3EFS A;  4C8Q A;  5HKC A;  2OTL T;  4D8K A;  4IUV A;  1N27 A;  3PT9 A;  3CPW A;  3DLL A;  3CCE T;  1U06 A;  2KRN A;  1OX9 A;  4DBR A;  3E9G A;  4M75 C;  2EYQ A;  4M77 B;  3OYJ A;  2EGC A;  1IO6 A;  3FIF A;  4PJL A;  1VQ9 T;  1Y96 B;  2QTX A;  2CT4 A;  3L1A A;  1H92 A;  2COY A;  1Y71 A;  2B8A A;  2RM4 A;  2JM8 A;  2QAS A;  1SSF A;  1QCN A;  3A8L B;  5M9O A;  5CQY A;  4Q5W A;  2XDB A;  3FC3 A;  2PUO B;  4LDW A;  2YRC A;  4GY5 A;  2RHZ A;  1WGS A;  2D8H A;  4RCC A;  1H8K A;  3OS2 A;  5GMK l;  2A36 A;  1PCX A;  1VQP T;  5CAI A;  2MWP A;  1LVK A;  3CMA A;  4HA8 A;  1W70 A;  2FZG B;  4PLI A;  2FO0 A;  2P0Q A;  4L59 A;  4X34 A;  3CMA Q;  2DFU A;  4ZGD B;  3TEE A;  1VQP A;  1Q86 R;  1RAG B;  3VYH B;  3H0H A;  2CZ7 B;  2DJZ A;  2DTH A;  5LJ3 h;  4N0A A;  3M0U A;  4KGX B;  3CEY A;  3TQ7 P;  1I5O B;  1ABO A;  2H3E B;  1XQH A;  3E19 A;  1FWZ A;  2JMA A;  4HCC A;  1N8R R;  4ATO A;  4ZNX A;  1BI3 A;  3ZEH A;  1WI7 A;  3CPF A;  4LXC A;  2PU9 B;  2L0A A;  1H3H A;  2BE9 B;  2GF7 A;  1VQO T;  5KYN A;  1Y07 A;  1M2V B;  4PL6 A;  3CC2 Q;  4FYV B;  3V7R A;  1RAA B;  2GFU A;  3T9N A;  2G3R A;  1K9A A;  2XIC A;  4FU6 A;  4JJC A;  5LL6 S;  1HYO A;  1FXX A;  2K9G A;  3CCM T;  1LOJ A;  1E7O A;  4M7D C;  4PJO F;  1YFN A;  2K2V A;  2LCC A;  5GAN 5;  1YJ9 A;  3NTK A;  3OY9 A;  5EC7 A;  4OMM A;  1QLY A;  1X69 A;  4M7A B;  3VUB A;  4J9D A;  1WJQ A;  3CCV A;  3ME9 A;  4C0D C;  3LGF A;  2L3S A;  3GLX A;  4JLG A;  4J83 A;  4C92 D;  5GAN 3;  2O9V A;  2Z0W A;  4C8Q C;  2JS2 A;  2EKO A;  2KEA A;  1K8A U;  1R8O B;  1OYX A;  1SEM A;  2AT1 B;  4HVU A;  3BFM A;  4MZT A;  3H0I A;  4DBQ A;  2X4W A;  1PG5 B;  4HCB A;  3GP8 A;  2DRK A;  5D7U A;  1VYU A;  1EFN A;  4C92 B;  1K0S A;  4KH0 B;  2DER A;  4QQ6 A;  4NOY A;  2MK5 A;  4CRI A;  5GMK i;  3QZ9 B;  2JXB A;  3RBB B;  1TU0 B;  4LDU A;  1C1A A;  4BD3 A;  4F7U F;  4KGV B;  1UEB A;  4J7I A;  1NZ9 A;  2WSF E;  1NEB A;  4CC3 A;  4PFZ A;  2EQJ A;  1ZX6 A;  5GAO l;  1GL5 A;  4ZTF A;  5DY9 A;  2QEX Q;  3SFM A;  3G4S Q;  5KE2 A;  1WHG A;  2F2V A;  3ASK A;  1N8R C;  2RN8 A;  2JN0 A;  4MZP A;  2O2O A;  1SG5 A;  3RMQ A;  1UHF A;  4M7D F;  1UFF A;  2J7I A;  2MOX A;  3EGD B;  2HSE B;  3VRZ A;  1QKW A;  1R77 A;  2GFA A;  2ENM A;  1JJ2 A;  2L3R A;  1UGR B;  2RH2 A;  2PTK A;  3E9F A;  1UJY A;  2OI3 A;  1QVF A;  1R0B G;  1WNL A;  1ABQ A;  1Q82 R;  5I2S A;  2DL8 A;  3CCR T;  4LDX A;  4E6R A;  1LJO A;  1NJI R;  3H0F A;  2I2L A;  4CI0 C;  2ECZ A;  1YJW Q;  3C94 A;  3QZ5 B;  4RMO A;  3VS3 A;  2ESW A;  5CKE A;  4JRK A;  1YHQ A;  4IUU A;  4E7H A;  1HXD A;  3JCM P;  1AZG B;  1M4Z A;  3EFO A;  4LDV A;  3V8L A;  4ESR A;  3G6E T;  3O8V A;  2AK5 A;  4J9G A;  4A4K A;  1BIB A;  4HKE A;  1VIE A;  3OYN A;  1WQ7 A;  4J6X A;  3PGG A;  2QQB A;  1VQN A;  2J6O A;  4OMQ A;  3HFN A;  4C8Q G;  3S3M A;  3MET A;  1SRM A;  2BE7 D;  1RAH B;  4Z88 A;  1GRI A;  3CCU A;  2C06 A;  4IUT A;  1K0X A;  2XDD A;  3VS0 A;  3GIB A;  3VS2 A;  2X4Y A;  3URG A;  1YP5 A;  2DXU A;  4DQ2 A;  1UGV A;  1JB0 E;  1NYG A;  1VQ9 A;  2JMC A;  2MPX C;  2DBK A;  4M75 A;  5GAM h;  1W2B A;  5CO7 A;  2QA4 A;  4RG2 A;  3CCQ T;  1TOV A;  2XD0 A;  4ME7 A;  2K5L A;  4OMN A;  5D6Y A;  1IRE B;  3OYA A;  1F1B B;  3OS5 A;  1RUW A;  3I56 Q;  1AWJ A;  4KGZ B;  3MKD A;  5GAN 2;  1Q82 C;  5DLO A;  1RAI B;  3INZ A;  3HHT B;  1QVF P;  4BDY A;  4FCY A;  4XTV A;  3L2V A;  2KI7 A;  4ORZ A;  3CME T;  1W4S A;  5FU6 B;  1KD1 R;  2RPN A;  2KMT A;  1M1F A;  4OVA A;  4PFP A;  5IHI A;  2MYS A;  3FJP A;  2NUT B;  2EIF A;  3CBP A;  2SRC A;  1M1K C;  1BK2 A;  5L23 A;  2J05 A;  5C6S A;  2RJD A;  2ZPB B;  3I56 A;  2A7Y A;  2YRV A;  1P92 A;  2LJ3 A;  1WX6 A;  1VQ5 T;  4RTZ A;  3CD6 A;  4F7U E;  2RQT A;  3GBQ A;  4OML A;  3OYK A;  4CC4 B;  3U23 A;  2Y90 A;  3HRU A;  1DJ7 B;  4E2F B;  4Y91 A;  1OEB A;  3DB4 A;  3GNF B;  1NEG A;  1JXM A;  4PJO G;  5GMK m;  4FYY B;  3HPW A;  4BI8 B;  4M7D A;  2EBP A;  2V1Q A;  3UWN A;  1I0C A;  1B07 A;  2NWM A;  2EVR A;  2LQ8 A;  3HRS A;  4PLL A;  4JZ4 A;  1G3S A;  1VUB A;  3OYM A;  4M77 F;  1YJW A;  3MP1 A;  2ZPG B;  4QKU A;  4C92 G;  4AMC A;  3MO8 A;  1UGS B;  2FVU A;  4JRP A;  2V8I A;  2DIG A;  1WYX A;  2EQK A;  2CYZ B;  1OUL A;  3NTH A;  1Q81 C;  3VV0 A;  1KQS S;  2SEM A;  2HZY A;  1WJR A;  3O5Z A;  2X51 A;  2CRE A;  2FEI A;  1OZ3 A;  2RI3 A;  2XDP A;  3HRT A;  1IXD A;  2EGA A;  5D6W A;  2IPO B;  3QPH A;  1M27 C;  3X26 B;  5GAO n;  4JZ3 A;  2EQI A;  4KUD K;  3VS4 A;  4XQ3 A;  3PFS A;  2J6K A;  3I9Q A;  3BDL A;  1WA7 A;  4M7A G;  3TVT A;  2D8J A;  4M77 D;  1VA7 A;  1KFZ A;  2RHX A;  1Q86 U;  4B6M A;  1OV3 A;  1QVG S;  3RR6 A;  2RQV A;  3C0C A;  4XU1 A;  2DA9 A;  1NJI C;  1Z9Z A;  5LJ5 g;  4M7A E;  4J6Y A;  1VQL T;  3L2R A;  1PKT A;  1O75 A;  2R57 A;  3LYI A;  3E1S A;  4YTL A;  3WVD B;  1K1Z A;  1WLP B;  1M1G A;  1MND A;  1S72 T;  3S6W A;  4Y92 A;  3UF4 A;  2QA4 Q;  1G5V A;  3CCR A;  5GAM f;  3EG9 B;  3VRY A;  4IUP A;  2B86 A;  4C0F A;  2HDA A;  3OS1 A;  1GXI E;  3CPW S;  2DPP B;  2XU8 A;  2RI5 A;  1G8X A;  2P0P A;  1AWO A;  5GMK j;  4NL3 A;  4D6W A;  1YIT A;  4X1V A;  2LC4 A;  2E10 A;  5LJ3 g;  1YHQ T;  3OB9 A;  3UA6 A;  3CCS Q;  3M54 A;  2L5Q A;  2RHY A;  2CS7 A;  3FJ5 A;  2GGR A;  5KYY B;  1KIK A;  1WQW A;  3QKJ A;  3CCS A;  4KT0 E;  3JCM f;  2R5M A;  3V8K A;  3ZL7 C;  2YSQ A;  1EZZ B;  3SWN B;  4F16 A;  1PWT A;  1UE9 A;  2ZPF B;  5GAM j;  2A0F B;  3S3N A;  2K79 A;  4PJN A;  2ABL A;  2YWW A;  5LJ3 j;  1YBY A;  1M90 R;  5KCO A;  1VQO A;  1K8A R;  2LCL A;  4M78 A;  1AWX A;  3REA B;  3CCU T;  5FRM A;  9ATC B;  1PRM C;  1ZBX A;  1YNZ A;  1KD1 U;  2JZ2 A;  3EGD A;  5IH2 A;  3ZFJ A;  1KQS A;  1PNJ A;  2C0I A;  3GOX A; 
#chains in the Genus database with same CATH homology
 2QDY B;  2CZ1 B;  3QJ6 A;  2GF7 A;  2FB7 A;  3LWH A;  1VQO T;  3TCJ A;  4IUQ A;  4B9W A;  1XOV A;  5LJ5 e;  2VV5 A;  1Y07 A;  4PL6 A;  4XU3 A;  3OYG A;  3JCM c;  2HNI A;  4ZN3 A;  3VU3 C;  3H8Z A;  1XNI A;  3MP8 A;  2DD5 A;  3V7R A;  2GFU A;  3RKW A;  2LDM A;  3T9N A;  2O4X B;  2G3R A;  4X9C A;  4PJO A;  2XIC A;  4FU6 A;  3V8J A;  2QQ9 A;  2YLB A;  1BYM A;  3CD6 T;  4ELZ C;  5LL6 S;  1QVP A;  4XU2 A;  4NS5 A;  3MHX A;  2L8D A;  4C5G A;  1FXX A;  3CCM T;  5AYF A;  2P4T A;  1K8A C;  3VJP A;  1LOJ A;  3SB2 A;  4XAX B;  3FEO A;  5CK9 A;  2QA4 T;  1VQ6 A;  4M7D C;  1QP3 A;  4PJO F;  3X20 B;  1M5Q 1;  2K2V A;  2KVQ G;  2LCC A;  4BDZ A;  2E12 A;  5GAN 5;  2KDS A;  2PVD B;  2K57 A;  3NTK A;  2X4X A;  4M75 D;  5GAO m;  3OY9 A;  1YJ9 A;  2H3J A;  3EAE A;  2WSE E;  3R6O A;  4M7A B;  3OYD A;  2D6F A;  1V29 B;  1Y7X A;  2DKG A;  3VUB A;  3CCM A;  2RK2 A;  4M75 E;  4NL2 A;  3JB9 J;  1WJQ A;  4BE2 A;  1VQK T;  3CCV A;  3ME9 A;  4R56 A;  4C0D C;  3QHS A;  4B9X A;  2XG8 D;  5A0L A;  3LGF A;  1YI2 A;  1YJ9 T;  4JS4 A;  3GLX A;  3P8H A;  3QUI A;  3J80 E;  4JLG A;  1AHJ B;  4EMK C;  2VGN A;  3BY7 A;  4J83 A;  5CQX A;  3A8M B;  4C92 D;  3JB9 G;  1KC8 C;  3SDZ A;  4J7F A;  5GAN 3;  3OW2 A;  4C8Q C;  3C95 A;  2K5I A;  2XID A;  2E64 A;  4O6J A;  2EKO A;  1BI0 A;  1H64 1;  2LVM A;  1N6A A;  3CME A;  1K8A U;  5GAN f;  4N0A C;  4M7D E;  1R8O B;  1KG1 A;  1OYX A;  4A4G A;  4II1 A;  4GLK A;  3BFM A;  4MZT A;  4M77 A;  1N8R U;  2X4W A;  4HCB A;  1EIF A;  4PKC C;  2VYT A;  4J6W A;  1UB4 A;  3CXC S;  3GP8 A;  4C92 B;  2F5K A;  2XKO C;  4QQ6 A;  2LNV A;  4A53 A;  4NOY A;  3BDU A;  2EJ9 A;  2HQX A;  2E70 A;  4CRI A;  5GMK i;  3I56 T;  3QZ9 B;  4M78 B;  4C8Q F;  2DXB A;  1D3B B;  2OTJ A;  4LDU A;  2V8J A;  4BD3 A;  4F7U F;  2DD4 A;  5GAM e;  5L8R E;  4LDY A;  3JCM W;  1UEB A;  4J7I A;  1NZ9 A;  2DEQ A;  2WSF E;  3LLR A;  4E7L A;  3QSU A;  4XU0 A;  3ZBD A;  2ZPH B;  4PJO C;  3N5B B;  3L2Z A;  2QEX A;  2DZ9 A;  4QW2 A;  2VUB A;  2EQJ A;  4E47 A;  5FLX E;  4M78 E;  3OS0 A;  5GAO l;  2OTJ T;  4ZTF A;  3GPL A;  4M77 C;  4L5G A;  2LT4 A;  5DY9 A;  3X28 B;  3SFM A;  1YIJ T;  2DTI A;  5KE2 A;  4M78 D;  3ASK A;  1N8R C;  3OW2 S;  1RL2 A;  2JOY A;  2E6N A;  5GMK h;  3JCM b;  2JN0 A;  2DXC A;  4OB1 B;  4MZP A;  1JRI A;  3M9Q A;  3RMQ A;  2LX9 A;  1RI0 A;  1YJN A;  4M7D F;  3OSV A;  4HCZ A;  3M55 A;  5I2M A;  3J81 E;  3FB9 A;  1VQL A;  4L6V 5;  3SD4 A;  2DO3 A;  2A3L A;  2BUD A;  2OTL A;  3HSB A;  1K9M U;  4R55 A;  4QVZ A;  3TU4 K;  3M5A A;  3LX7 A;  3Q1J A;  3S3O A;  4JLI A;  2FYK A;  4M7A D;  3WXM B;  3CCE A;  2KQW A;  4KUI A;  5FU7 C;  2WAC A;  5CIU A;  4BY6 B;  3L2Q A;  2GFA A;  4M75 B;  1JJ2 A;  2L3R A;  1YJN T;  1UGR B;  2RH2 A;  3H6Z A;  3E9F A;  3L2W A;  1I4K 1;  1QVF A;  1G3Y A;  1WNL A;  2K3Y A;  3X24 B;  1WJS A;  4IKF A;  5GAN d;  3V7C A;  2EWN A;  3VYG A;  1YJW T;  1QVG A;  1OZ2 A;  4A4F A;  5I2S A;  3JCM V;  3P8B B;  3CCR T;  2L89 A;  4RG8 A;  5LJ3 d;  4A4H A;  4LDX A;  2E1H A;  3DLM A;  3CCJ A;  1LJO A;  2QQS A;  4M77 G;  5GAN h;  4VUB A;  2I2L A;  4DOW A;  4CI0 C;  1KHC A;  3C94 A;  3QZ5 B;  5HY6 A;  4RMO A;  1ZHI A;  4E7K A;  2MI6 A;  3CC4 A;  3UDC A;  4LD9 K;  2PVG B;  4M78 G;  5CKE A;  2JTF A;  3PTA A;  2LQK A;  4QVD A;  1K9M C;  3JB9 F;  1U1S A;  2PUK B;  4BE0 A;  3CBO A;  5J3B A;  4JRK A;  4ELY C;  1YHQ A;  4IUU A;  2EFI A;  4E7H A;  1HXD A;  1VQN T;  3JCM P;  4ZTJ A;  1M4Z A;  4LDV A;  2MAM A;  2QXF A;  3G7Z A;  3M4Y A;  3V8L A;  4C8Q E;  5J39 A;  5GAO p;  4RKU E;  4C92 A;  3G6E T;  3CC4 T;  3CCL A;  3O8V A;  3MEU A;  4A4K A;  3FDR A;  1BIB A;  3NFC A;  2CZ6 B;  1KD1 C;  4HKE A;  2KY9 A;  5KH6 A;  1VIE A;  3OYN A;  1WQ7 A;  4QQG A;  4J6X A;  3PGG A;  2QQB A;  3PMI A;  3G4S T;  5LJ5 j;  3QBY A;  1VQN A;  3HP9 A;  5FU6 C;  4C5H A;  3HFN A;  4ZGE B;  5LJ5 d;  4C8Q G;  3JCM h;  1VQ8 T;  4XTX A;  3MET A;  2E41 A;  4C5E A;  2LTO A;  4EDU A;  3HFO A;  4FT2 A;  3S3M A;  5GAN 8;  3RER A;  3HKS A;  4E7I A;  2IG0 A;  4EMK A;  3CCU A;  2C06 A;  4FL6 A;  4IUT A;  1M90 U;  2MMP A;  2K4Y A;  4KUL A;  3OYC A;  2EJG A;  3CC2 A;  4JJN K;  4M7D B;  3OMG A;  4XTY A;  5GAN 6;  2XDD A;  4N4G A;  4MML A;  3OYY A;  1BI2 A;  4C8Q D;  3GIB A;  4PJO D;  3JSC A;  3LWI A;  2X4Y A;  2EQU A;  3URG A;  2YHT A;  1S72 A;  4M7A C;  2DK3 A;  2DXU A;  1Q82 U;  2AHJ B;  5CKD A;  4MDX A;  3M58 A;  4DQ2 A;  4WF2 A;  1JB0 E;  4QQD A;  3FRN A;  3CCQ A;  1VQ9 A;  4OP0 A;  4Y28 E;  1H3Z A;  4N4I A;  4PNO A;  2BIV A;  2VC8 A;  4M75 A;  5GAM g;  4F7U B;  5GAM h;  1W2B A;  2MWO A;  3RIR A;  3OBY A;  4OB3 B;  5CO7 A;  2M1H A;  3KXT A;  2FL7 A;  5LJ5 f;  2QA4 A;  1VQ6 T;  1U8R A;  4EMG A;  4RG2 A;  1M90 C;  3CXC A;  3GF5 A;  4Z02 A;  3M57 A;  1YIT T;  3CCQ T;  4FT4 A;  1VQ4 T;  1U1T A;  1I81 A;  2X4J A;  2RD1 A;  4EMH A;  2XD0 A;  1UGQ B;  3JCM J;  4C92 F;  4ME7 A;  3RUX A;  2K5L A;  3A5Z B;  5D6Y A;  4ZN1 A;  2RHU A;  3CC2 T;  2PVO B;  1IRE B;  3OYA A;  1M1K U;  2R58 A;  2Y4X A;  4FM4 B;  5GAN 7;  3OS5 A;  4HT8 A;  2WSC E;  1VQK A;  4BI4 A;  3CMA T;  5GAO q;  3CCS T;  5GAN 2;  4OF1 A;  1VQ4 A;  1Q82 C;  1Y96 A;  5HK0 A;  5DLO A;  3INZ A;  1K73 U;  3HHT B;  3I55 A;  4BDY A;  5D6X A;  4XTV A;  3RMS A;  1OI1 A;  4M75 F;  1BIA A;  4M78 F;  4C8Q B;  1X01 A;  3V7S A;  3UT1 A;  4A4E A;  4ZGJ B;  2HBP A;  4IUR A;  3JCM X;  4JRQ A;  3L2V A;  3QJY A;  2E6Z A;  3CME T;  4BB7 A;  2XDB A;  1W4S A;  2BKD N;  5FU6 B;  1BI1 A;  2KMT A;  2XI9 A;  1M1F A;  1IZ6 A;  5C0M A;  4JRI A;  3QXE B;  3SWN C;  4OVA A;  2M9U A;  3OYI A;  3CC7 T;  3M4G A;  1N9R A;  3JCM d;  3FJP A;  3A8O B;  2EIF A;  3CBP A;  5LJ3 f;  5KE3 A;  3JB9 H;  1KQ1 A;  4M7A F;  2RHI A;  4FIB A;  5I21 A;  2VGM A;  4BAC A;  3OYL A;  1M1K C;  3OQ5 A;  1PSE A;  4OB2 B;  1VQM A;  3JB9 I;  1VQ7 A;  1KQ2 A;  2RJF A;  1ZQ1 A;  1QW1 A;  4LD6 A;  2DXT A;  5GAN e;  2RJD A;  2ZPE B;  3ER0 A;  4MMK A;  5C6S A;  4PJO B;  1MGQ A;  2ZPB B;  5CR2 A;  2PQW A;  4M78 C;  2A7Y A;  2DVE A;  2YRV A;  1XTD A;  2EAY A;  3JRZ A;  3JCM g;  2O01 E;  3I56 A;  3CC7 A;  4P5N A;  1TH7 A;  2ZCF B;  3L2U A;  5FRO A;  1K73 C;  3VKI A;  3MEV A;  1P92 A;  1QVF S;  2XHC A;  1VQ7 T;  1VQM T;  1VQ5 T;  2RO0 A;  4O5V A;  2GQV A;  3KUF A;  3CD6 A;  5DM7 R;  5GAN g;  4C0G A;  5IAY A;  2YLC A;  3OYE A;  1X6O A;  4F7U E;  2ZGW A;  3JAM E;  5GAN j;  3QII A;  5GAN 4;  1O9S A;  3MEW A;  1YIJ A;  3LH0 A;  3OYK A;  4M7D G;  2Y90 A;  3HRU A;  1DJ7 B;  1YCY A;  3M59 A;  3BW1 A;  4Y91 A;  3PIP A;  2JNG A;  5IN1 A;  1VQ5 A;  3DB4 A;  2QI2 A;  3C12 A;  3GNF B;  2D9T A;  4OB0 B;  4PJO G;  5GMK m;  3RES A;  1B34 A;  1JBM A;  4OGE A;  3HPW A;  4BI8 B;  2QQA A;  2K5F A;  2RB6 A;  1KC8 U;  3MEA A;  4M7D A;  1WPY A;  3CCV T;  1NPP A;  3UWN A;  3DB3 A;  4M7D D;  3MCA B;  3QG1 A;  2LQ8 A;  3HRS A;  4PLL A;  2ZZD A;  1G3S A;  4DA4 A;  3M56 A;  2NLU A;  2GCX A;  2QQR A;  2XK0 A;  2DTO A;  1VUB A;  3P8D A;  3OYM A;  5GAO r;  4M77 F;  1YJW A;  2M0O A;  3MP1 A;  2ZPG B;  4C92 G;  3JB9 D;  3MO8 A;  1UGS B;  2FVU A;  3JCM Q;  4JRP A;  1FX7 A;  4HT9 A;  2Y4Y A;  1NPR A;  1D3B A;  2DIG A;  2V8I A;  4OGC A;  3CCJ T;  2EQK A;  2CYZ B;  2ZPI B;  2RA2 A;  3CBM A;  1Q86 C;  3NTH A;  5DLQ E;  2DIQ A;  1Q81 C;  3VV0 A;  3RKY A;  1KQS S;  4M7A A;  4J5Y A;  1WJR A;  3J7A F;  4XTW A;  1Q7Y C;  2VXE A;  4JDS A;  1NJI U;  5CKH A;  1OZ3 A;  2DZC A;  4C0D B;  4C92 C;  1QP2 A;  3MP6 A;  1YI2 T;  2RI3 A;  2XDP A;  3HRT A;  2RJE A;  2FHD A;  4M75 G;  1M8V A;  4MDW A;  5D6W A;  3QPH A;  2HAX A;  4XK8 E;  4EMK B;  3X26 B;  5GAO n;  1LNX A;  4KUD K;  2X35 A;  2EJF A;  4E7J A;  2E5Q A;  3HL8 A;  3FLG A;  3PFS A;  4XQ3 A;  1BKB A;  5CKF A;  2F5T X;  3DKM A;  2MF2 A;  2O4X A;  5IT9 E;  4PJO E;  3UPU A;  2LT1 A;  2QEX T;  3BDL A;  4EPC A;  1MHN A;  1I5L A;  4M7A G;  2HQE A;  3KBG A;  2KK4 A;  3QYG B;  4M77 D;  4M77 E;  4BUG A;  1HK9 A;  2OAU A;  2RHX A;  3G4S A;  4V2S A;  4UC4 A;  2HD0 A;  1Q86 U;  4DOV A;  5LJ3 e;  3PNW C;  3OSS C;  1Q81 U;  4KBM B;  2VXF A;  1QVG S;  5CVI A;  4TVR A;  3GNG A;  1VQ8 A;  2CZ0 B;  4XU1 A;  1N9S A;  2V8K A;  4C0Z A;  1Q7Y U;  1NJI C;  2E65 A;  4C92 E;  5A0D A;  5LJ5 g;  3OA6 A;  3L42 A;  4J6Y A;  1VQL T;  3EFS A;  4C8Q A;  4M7A E;  5HKC A;  3L2R A;  2OTL T;  1O75 A;  2RK1 A;  4N4H A;  2R57 A;  3LYI A;  3QO3 A;  4RCB A;  3E1S A;  4IUV A;  2RJC A;  5HK3 A;  1N27 A;  3PT9 A;  3CPW A;  3DLL A;  3AHU A;  3CCE T;  4YTL A;  3WVD B;  2CKK A;  5A2Q E;  3OYH A;  5FU7 B;  1M1G A;  3E9G A;  4M75 C;  2CGH A;  3SWN A;  4BE1 A;  3S6W A;  2EYQ A;  4M77 B;  3OYJ A;  1S72 T;  2JTM A;  4MZM A;  3G71 A;  2JVV A;  3OYB A;  3WVE B;  5LJ5 h;  3OBW A;  1G5V A;  4QVC A;  1W2B S;  5GMK e;  5GAM f;  3FIF A;  3CCR A;  4BY6 C;  1VQ9 T;  3VUZ A;  1Y96 B;  2QTX A;  3L1A A;  4IUP A;  4C0F A;  1Y71 A;  2B8A A;  3OS1 A;  1I8F A;  2RM4 A;  1GXI E;  3OYF A;  3CPW S;  2DPP B;  2XU8 A;  4J8O A;  1SSF A;  2RI5 A;  3A8L B;  3C4S A;  3G71 T;  3M53 A;  4OMF B;  2P0P A;  4Q5W A;  2KSS A;  5CQY A;  2PUO B;  2P0K A;  5M9O A;  5GMK j;  1VIF A;  4LDW A;  4GY5 A;  4NL3 A;  3FC3 A;  4D6W A;  1YIT A;  3F70 A;  2LC4 A;  4XTU A;  1NE8 A;  2RI2 A;  2RHZ A;  1WGS A;  2E10 A;  2LRQ A;  3OMC A;  4RCC A;  5LJ3 g;  3TRE A;  2DAQ A;  1YHQ T;  3X25 B;  3OB9 A;  3OS2 A;  1B34 B;  3M54 A;  2R5A A;  5GMK l;  1VQP T;  2L5Q A;  2MWP A;  2EQM A;  1PSF A;  2RHY A;  2CS7 A;  5CKB A;  5CAI A;  5CCA A;  5KCH A;  4F7U A;  1G3T A;  1G3W A;  3JCM e;  3CMA A;  4HA8 A;  3A8G B;  3G6E A;  3CCL T;  1WQW A;  2K3X A;  3QKJ A;  4KT0 E;  3RKX A;  3JCM f;  3LGL A;  3PIO A;  2R5M A;  3V8K A;  3CCS A;  2JUF A;  2M16 A;  4PLI A;  2P0Q A;  4L59 A;  4X34 A;  2D0Q B;  3I55 T;  3SWN B;  5FRN A;  4ZGD B;  3EFR A;  3TEE A;  2ZPF B;  5GAM j;  1M9S A;  4A54 A;  1VQP A;  3A8H B;  3S3N A;  1UGP B;  3VYH B;  2CZ7 B;  2DJZ A;  3PMT A;  2DTH A;  5LJ3 h;  1YBY A;  4N0A A;  4F7U G;  3QYH B;  5LJ3 j;  4JS5 A;  4JUV A;  3QDR B;  5KCO A;  3CEY A;  4BI3 A;  2F69 A;  1VQO A;  2KAF A;  2LCL A;  4M78 A;  3CCU T;  1XQH A;  3E19 A;  3LW5 E;  5A0G A;  5FRM A;  1FWZ A;  4FSX A;  4HCC A;  1ZBX A;  2IVW A;  4ATO A;  1KD1 U;  2JZ2 A;  1BI3 A;  5EG2 A;  3ZEH A;  4C5I A;  5GAM d;  1X75 C;  4XTZ A;  3CPF A;  1KHI A;  2PU9 B;  3ZFJ A;  5J26 A;  1KQS A;  3NTI A;  4X9D A;  1JJ2 S;  3GOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...