5J26A

Crystal structure of a 53bp1 tudor domain in complex with a ubiquitin variant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
114
Chain Sequence
VGLRVVAKWSSNGYFYSGKITRDVKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin Variant i53
publication title A genetically encoded inhibitor of 53BP1 to stimulate homology-based gene editing
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 114
sequence length 117
ec nomenclature
pdb deposition date 2016-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5j26A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5j26A01
3KBGA 4OVAA 4IUQA 4II1A 2LQ8A 4BE0A 3OS2A 1KD1U 3UT1A 1W2BA 2DAQA 1M1KC 1VQMT 3LH0A 3CMAT 4B9XA 2BIVA 2L8DA 2R5AA 1YI2A 4ZTJA 3DLMA 3L2RA 2EFIA 1S72A 3Q1JA 3CD6A 4E7KA 1KQSS 2LRQA 4ZTFA 2JZ2A 2PQWA 2NLUA 2M0OA 1YHQA 1N8RU 5KCOA 3OMGA 2RI2A 1Q81C 2DIGA 2MWPA 3C4SA 4C5EA 2KDSA 1YI2T 1S72T 3CD6T 4FL6A 1RL2A 4Z02A 1YHQT 3OYLA 2XDPA 3META 4E7HA 3S3MA 1QVFA 2B8AA 4RG2A 1M1GA 3LYIA 1W2BS 2JVVA 1VQLA 2O4XB 4A4HA 1VQ9A 2RI5A 2JNGA 1QVGA 3L2WA 1RI0A 1VQNA 3OA6A 3QKJA 2QQRA 1VQLT 5C6SA 1VQOA 5D6YA 1VQ9T 2RHZA 3S6WA 5FRMA 3CCUA 1OZ2A 3A5ZB 4GY5A 5DM7R 4CRIA 1VQ4A 1VQNT 3KUFA 4BE2A 1VQKA 1EIFA 1QVFS 1VQOT 2GFUA 2MI6A 3MEUA 1WJRA 2M16A 3QIIA 2L89A 4PLIA 3CCUT 3LLRA 1Q7YU 3OS0A 2RHIA 3J7AF 4E7JA 1VQ4T 1K8AU 1QVGS 1K9MU 1VQKT 2X4XA 1NPRA 3OYCA 2F5KA 2BUDA 3L2QA 3J81E 1OI1A 5D6XA 3PMTA 3CCQA 1YJWT 2LCLA 2BKDN 4IUPA 2LVMA 3PIOA 1M1KU 4IUUA 4EDUA 2QEXA 2P0KA 2WACA 3CEYA 4ZN3A 3I55A 1NZ9A 3E9FA 3PNWC 2LCCA 3CCQT 3S3OA 3FLGA 3OYIA 3DB4A 4LD6A 3OQ5A 3OB9A 3FC3A 2O4XA 3FEOA 1Q81U 2QEXT 2E5QA 3I55T 2EKOA 1UEBA 1NJIC 1NPPA 3GOXA 5J3BA 4UC4A 3OYKA 3OYNA 4BDZA 3PMIA 2FHDA 5C0MA 2EIFA 2OTJA 4IUTA 1YJ9A 3OS1A 3I56A 1X6OA 3OYEA 3OYGA 1KC8C 2JOYA 3CCJA 4BD3A 5J26A 2RJCA 3OYJA 2X35A 3G71A 2OTJT 2RO0A 2HQXA 1YJ9T 3CCMA 4PL6A 3I56T 3NTIA 4A4FA 3CCVA 3MO8A 3P8HA 3CCJT 1VQPA 3CCEA 2GF7A 1YJNA 3PFSA 2R58A 2RJFA 3G71T 1MHNA 3CXCA 2G3RA 2R5MA 5FROA 3G4SA 3CCMT 5KE2A 2XK0A 4A4EA 3MEAA 1VQ6A 3HKSA 3CCVT 1K73C 3QJ6A 1VQPT 2X4YA 2EQUA 3CCET 1YJNT 1SSFA 3CC7A 3ER0A 1XTDA 4X34A 3OMCA 1VQ7A 3G4ST 2JUFA 4E7IA 1YJWA 1VQ6T 2R57A 2RHXA 2D9TA 3OYBA 1H3ZA 3BDLA 2RJEA 2EQKA 2DIQA 2K3YA 3CC7T 4B9WA 1Q82C 3OYDA 2KVQG 3ASKA 1VQ7T 4BDYA 2X4WA 3CXCS 3OW2A 4QQ6A 3ME9A 4QW2A 3OYYA 5HY6A 2CKKA 2E6NA 4TVRA 3EAEA 1Q86C 1WJQA 1YITA 4N4GA 5CIUA 4YTLA 1NJIU 1M90C 4A4GA 5D6WA 3H6ZA 3H8ZA 2E70A 1VQ5A 3P8DA 3L42A 3MP6A 4N4IA 3CC2A 3OYAA 1YITT 1BKBA 3JAME 2L3RA 2EQMA 2LDMA 4IUVA 2XHCA 1VQ5T 3NTKA 4N4HA 3CPWA 3OW2S 1KC8U 5IAYA 3CC2T 4IURA 2QA4A 2EQJA 3TREA 2RHUA 3ZEHA 4HCZA 3OY9A 4ZN1A 3CCRA 1OYXA 3FDRA 1KD1C 5IN1A 4L59A 2LTOA 1IZ6A 3CC4A 2QA4T 4BACA 3OYHA 2IG0A 3CCRT 3S3NA 3PIPA 2MWOA 5FLXE 4QVZA 2HQEA 4C5IA 1VQ8A 5FRNA 1N8RC 3O8VA 2RI3A 1OZ3A 3CC4T 1K73U 1JJ2A 3DB3A 5IT9E 4QQGA 3LGLA 3LX7A 3CPWS 1KHIA 1YIJA 3UWNA 4FU6A 2E6ZA 1VQ8T 4BE1A 2DO3A 4C5GA 3NTHA 3G6EA 3F70A 3QBYA 3MP1A 5DLQE 3MEWA 2VYTA 3CCLA 2K3XA 1G5VA 3OYFA 1KHCA 1YIJT 1N27A 3SD4A 1Q82U 3J80E 4IKFA 3G6ET 3CCLT 5A2QE 2YRVA 3LGFA 5KCHA 4E7LA 5J39A 1JJ2S 3OYMA 2RHYA 1Q86U 2QQSA 2GFAA 4NS5A 3DLLA 5KH6A 5LL6S 1M90U 4Q5WA 3CPFA 1XNIA 3L2UA 3CMEA 2JTFA 3MEVA 2OTLA 2M1HA 3CCSA 1KQSA 4PLLA 5M9OA 3L2VA 1YBYA 1WJSA 1Q7YC 5KE3A 2RJDA 1K8AC 3MP8A 1K9MC 4QQDA 3CMET 2OTLT 4C5HA 1VQMA 3CMAA 3CCST 3M9QA 3E9GA 1WGSA 3P8BB
chains in the Genus database with same CATH superfamily
4GBQA 5KYNA 4OVAA 4IUQA 4C8QA 3OS2A 3G1JA 1WQWA 2BZYA 1VQ8Q 3LH0A 2RM4A 3SFMA 4B9XA 4M7AF 3HL8A 4RTYA 4ZTJA 3DLMA 3L2RA 1PKTA 3Q1JA 3CD6A 4M4ZA 1KQSS 2LRQA 4ZTFA 1D1BA 3VS6A 2YLCA 2HMAA 2NLUA 1U5SA 1JB0E 2PVDB 3OMGA 4C0FA 3A1PA 2KDSA 5DY9A 2LNHB 1V29B 3JCMh 3M58A 4OMMA 2LJ3A 2D8HA 3OW2P 1RL2A 4Z02A 1YHQT 4OMNA 2XDPA 3AT1B 2K6DA 4RG2A 1B7TA 4E47A 2QDLA 1VQLA 1T0HA 4M78A 4JUVA 5L8RE 2IPOB 2ZPFB 2J6FA 1M1FA 1WX6A 1CSKA 1RI0A 4M75D 3G7ZA 4PJOD 4DBQA 3M0TA 4MZTA 2HDAA 1X2QA 4VUBA 2P0QA 3PTAA 1VQOA 5CK9A 2E41A 1IXDA 3BFMA 3S6WA 2F69A 4GY5A 1G3YA 1WI7A 4CRIA 1G3SA 2MPXC 1VQ4A 2EW3A 3LW5E 3BW1A 3E19A 2HBWA 1OEBA 1EIFA 1QVFS 1M8VA 2GFUA 2VASA 4M7DF 1VQMQ 1IGQA 1KQ1A 2J05A 4MZMA 4XK8E 2M16A 3UPUA 1GCQC 2L89A 3CCUT 1OULA 4NL2A 3RMSA 4E7JA 1XJWB 2KRNA 4C0GA 2XDBA 4OB2B 1QVGS 2B86A 3A8LB 4F7UE 5LJ5d 5LJ3d 1NPRA 2CDTA 2FPEA 1EZZB 5I21A 4C0DC 4RTZA 2ATCB 4PFOA 1OI1A 1WZOA 2LQWA 1YI2Q 4OB3B 1X2KA 1YJWT 1MMAA 2BKDN 4R56A 1S72Q 4MMLA 2QG9B 2DEQA 3L1AA 2RF0A 4HCBA 1UB4A 3JSCA 3C95A 2QEXA 2P0KA 2O88A 2OJ2A 3MPUB 3I55A 4M7AD 2V8IA 2LCCA 3OYIA 1BB9A 2DYIA 3OB9A 3FC3A 2DL7A 1JRIA 4RCBA 2O9VA 1AZGB 4WTOB 5GAOm 2E5QA 2K79A 1UEBA 5LJ5j 2D8JA 4BI8B 4C8QD 4PFZA 1AVZC 4UC4A 2ZPHB 1LVKA 1RAHB 2JMAA 2FHDA 5C0MA 2EIFA 4PJOG 1K0SA 2DXBA 2VGNA 1D0ZA 4M77B 1FYNA 2KAFA 2MF2A 3FJPA 2VWFA 3OYEA 1Q81R 3JB9I 4JLIA 4FYWB 2JOYA 3JCMb 2DTHA 3RKWA 2RJCA 3OYJA 4FYYB 4KRTA 1N9SA 2OTJT 1TSFA 3HRUA 4E7ZA 2A36A 1J3TA 3CCVA 3MO8A 1VQPA 1TU0B 3JV3A 1WA7A 4F14A 3M5AA 3PFSA 5EG2A 3G71T 2DILA 2CZ1B 3A98A 4XAXB 4RTWA 4HT8A 3HFOA 3M4GA 5FROA 3G4SA 3CCMT 3HFNA 4M7DD 1PG5B 3QJ6A 3QG1A 2EQUA 2A7YA 3VRZA 4ANJA 3CCQQ 5ECAA 5AYFA 2LMJA 2MIOA 3QJYA 3ER0A 1YCSB 3WXMB 2AKKA 2QQBA 3OMCA 2PZ1A 2K3BA 2DYBA 2PVOB 5KYXA 2EQIA 1YJWA 2RHXA 4A63B 2D9TA 4J9EA 3BDLA 4BY6B 2RJEA 3O5ZA 4M7AG 3CC7T 1BCMA 2MCNA 1Q82C 3OYDA 3M0UA 1Y0MA 4BDYA 2RNAA 1NLPC 3CD6Q 5KYWB 1OPKA 2P4RA 4F7UF 5FU6C 1XOVA 1UGPB 4PK4A 3EAEA 4C8QG 3RERA 3JCMV 4M77A 3SHWA 5CIUA 2YRDA 4Z89A 1NJIU 1M90C 4A4GA 4Y92A 2E70A 2RA2A 3VS5A 5GAOp 3I56Q 2CP5A 5DLOA 2L3RA 2LC4A 2KRMA 1M3AA 2X51A 1KSWA 2XHCA 1HYOA 5GAN8 3JCMX 1ZSZC 4RTTA 4JZ3A 2D0QB 3CPWA 1PCXA 5CKDA 4IURA 2EQJA 4HVUA 3TREA 5CQXA 5GAN3 4HCZA 3CCEQ 1OYXA 4LUEA 3FDRA 1W6XA 1ZBJA 1VQOQ 3X24B 4M78G 1KD1C 4L59A 2LTOA 2FPDA 4BB7A 5IHKA 2RPNA 2X4JA 4DBHA 3OYHA 2W10A 4X9DA 3QHSA 2IG0A 3UATA 1NLOC 2FB7A 5L23A 2LP5A 2MWOA 4QVZA 2EYXA 1VQ8A 1R77A 3O8VA 1OZ3A 5IXFA 2DFUA 3LX7A 1BCOA 4CC7A 4J6XA 1BIAA 2AZVA 4XU0A 2DETA 2FO0A 4PNOA 4JLGA 1CKBA 1RLPC 3H0IA 5KYWA 4PJOE 4PJOC 5FWCA 2RQRA 2JW4A 4Y28E 2GBQA 5GMKh 2X9HA 2ZGWA 2JM9A 3QUIA 2DK3A 4PJLA 3NGPA 4JJBA 1YITQ 2OAUA 2LX7A 3G6ET 2PUOB 4LDXA 8ATCB 1V76A 5A2QE 3VUBA 1FXXA 1VQ5Q 1X01A 2KSSA 3BE3A 2DVEA 2C06A 2GFAA 3CC2Q 2RMOA 2O2OA 4OGCA 1UJYA 1SSHA 4Q5WA 1C1AA 1LJOA 1U06A 2RN8A 4XTZA 1KFZA 3I35A 3CMEA 3PE0A 5GAN7 2M1HA 1FMWA 5M9OA 2L2PA 2AIRB 3L2VA 5GMKm 1WJSA 1BBZA 3QZ5B 4RCCA 1B3QA 5LJ3h 1JXMA 3LWHA 4QQDA 4EPCA 2C0OA 3TU4K 1BU1A 2YSQA 1VQMA 1B07A 2M0YA 4K11A 3CXCP 4M77D 3VRYA 2J6OA 1QWEA 3CBPA 2WSEE 2E1HA 2AT1B 3RDVA 2BZ8A 3VKIA 1TUGB 1TG0A 3MJXA 1H8KA 4BE0A 2OX7A 3LH5A 3SB2A 3TSWA 4F17A 1W2BA 1VA7A 1S1NA 4DEXA 3CMAT 1PSFA 2DRMA 1VQPQ 1YI2A 1BI3A 4E2FB 1S72A 3A8OB 1ZQ1A 4E7KA 3QSUA 4OP0A 3ZL7C 1YIJQ 5GAMh 4PJMA 2E64A 2VXFA 1C0MA 2RI2A 3C4SA 2E65A 1M9SA 2GQIA 5IHNA 1D0YA 3CD6T 1SG5A 4KBMB 1C6VX 2QK0A 3OYLA 4KH1B 3V7SA 2B8AA 2EKHA 1EX4A 2O4XB 2RQUA 4JJDA 2WSFE 2KROA 2XKOC 4J9DA 1AWWA 2RI5A 1ZX6A 3PVQA 2FRYA 1R0BG 3L2WA 3E2UA 4XQ3A 4M78E 4M78C 1R8OB 1DJ7B 3OA6A 2FVUA 3QKJA 2EJFA 4AG2C 2QQRA 1VQLT 1QP2A 2CREA 5D6YA 2OTLQ 4QVCA 4PJOF 2ED1A 2GNCA 2RHZA 2CYZB 1ACMB 4RMOA 5FRMA 2RK2A 1OZ2A 5DM7R 2MAMA 4BE2A 4ELZC 2KBTA 4CC2A 1K0XA 3I5SA 3HTRA 1VQOT 3H0FA 3MEUA 1WDXA 2LT4A 4LUDA 3VU3C 3QIIA 1JQQA 3M0PA 1UHCA 2CP2A 3QXEB 4RKUE 4M77G 2DXTA 3J7AF 1VQ4T 1K8AU 2J7IA 1OOTA 4JS4A 1UGVA 4JRIA 3OYCA 2F5KA 3HRSA 2O9SA 4J9HA 4GLKA 3N5BB 4C92E 4C92C 2DEUA 3VS7A 1VOMA 2EYZA 5D6XA 4V2SA 3JCMe 4FSXA 3CCQA 3M54A 3NFCA 2M9UA 1Z9QA 3PIOA 1Q86R 4LE9A 1M5Q1 4HA8A 2E5KA 4EDUA 2WACA 3CEYA 3X25B 2CT3A 2F2WA 4AT1B 3S3OA 2DLPA 3FLGA 4MDWA 2DERA 3OQ5A 4C92B 2HAXA 2O4XA 2W0ZA 3TQ7P 2QYZA 2KT8A 4AG1C 2QEXT 2DZCA 1E7OA 2EKOA 3I55T 4XTXA 3V7CA 4HKEA 4RTXA 3JB9H 1VQ9Q 3GOXA 4FCYA 2JXBA 3VYGA 2MMPA 2LQNA 2V8KA 4BDZA 2QI2A 1KQ2A 1PRMC 4C8QF 4J8OA 4FW2A 2K5IA 1KG1A 1F1BB 4IUTA 4OMQA 3SDZA 2O31A 1IGUA 3I56A 1X6OA 2HKQB 1I1JA 3THKA 1B34B 1KQSP 2ZPIB 2X35A 1VIFA 1HD3A 2PU9B 2L3QA 3C94A 2RO0A 1VQKQ 1OX8A 3M0SA 1N8RR 2KYBA 2HQXA 4PL6A 3SEMA 1GXIE 3HRTA 1RAIB 1GBQA 1PKSA 1OV3A 3P8HA 3CCEA 2GF7A 4J9FA 4FT4A 1UGRB 2R58A 2RJFA 1ZUKA 4FIBA 3RESA 3CMEQ 5GAOl 4EMGA 1FMKA 2XK0A 2RH2A 1K76A 3GPLA 5FWBA 3HKSA 4M78F 1WHKA 3CCVT 4DQ2A 1VQPT 5GANg 3BY7A 2QTXA 2PUKB 5CVIA 4OMLA 4HVWA 5CKEA 1UGQB 2E12A 2JMCA 3G4ST 5GMKj 4E7IA 3REBB 4C92A 5HK0A 2YUQA 1WHMA 2YDLA 2DIQA 4PKCC 1BIBA 2YUOA 3RIRA 3HP9A 3ASKA 1JU5C 3NPFA 2LNVA 1Y7XA 3OW2A 1QCOA 3UA6A 1QVFP 3OYYA 1X69A 1R0CB 1RAEB 2CKKA 3OBYA 1WJQA 1Q86C 1YITA 4N4GA 1Q7YR 2V8JA 4JRQA 2L0AA 2XMFA 1QVGP 5CR2A 1WQ7A 1YN8A 1K9MR 2PNIA 3H6ZA 3H8ZA 2KNBB 1VQ5A 1B34A 5GAMd 1TUDA 1SEMA 2K2MA 1YJ9Q 2HCKA 3CC2A 4M77E 4M77C 3JAME 3CCJQ 2EQMA 1M4ZA 2LDMA 4XU3A 5LJ3j 5CKFA 2ZCFB 2FYKA 3H9NA 4ZGJB 2KEAA 1M1KR 2KK4A 3NTKA 4N4HA 5GJVB 2RQVA 1YCYA 3EG1A 4LDWA 3EH1A 1M30A 1G3WA 1N9RA 1X27A 4MMKA 3CQTA 1U3OA 1GRIA 2BZXA 3X28B 3ZEHA 1X43A 2LJ0A 3NMZC 1YJNQ 4XTUA 3QWXX 1RLQC 4KGXB 1WYXA 1Y71A 2OAWA 3CC4A 1RACB 2YT6A 3GNGA 2C0IA 4D8KA 1GFDA 3MCAB 2K2VA 5GAMj 2CP0A 4A4KA 3FJ5A 3WVEB 5GANe 2HQEA 3JB9G 5FRNA 4KUDK 1N8RC 2DX1A 3R6NA 1VQ7Q 4XTWA 3GP8A 3PGGA 2DD5A 5D7UA 2M51A 4M78D 3CPWS 1KHIA 1YIJA 2KI7A 2X3WD 2FL7A 3KXTA 2KXCA 4BY6C 3UWNA 1WXBA 4DOVA 5CO7A 2E6ZA 4BE1A 1VQ8T 1D1CA 4HXJA 1Q95G 3NTHA 1UECA 3M57A 2LX9A 3MEWA 4X9CA 2K3XA 2XICA 3OYFA 4CI0C 1M8MA 4A53A 2D0NA 3SD4A 1Q82U 4CC4B 4KULA 1UFFA 3J80E 2VXEA 2COZA 3C12A 4J9GA 5FU7B 3KFVA 1MGQA 1ZSGA 3EFSA 5KCHA 5J39A 1QP3A 1G83A 1KJWA 5LJ5g 3DLLA 4J5YA 2L3PA 5KH6A 4RG8A 2KGTA 2DL4A 5CQYA 5LL6S 2GCXA 2I0NA 4C92D 1M90U 2ZZDA 3CPFA 2QAZA 1M2OA 3L2UA 2JTFA 2OTLA 1D0XA 4KUIA 2AHJB 3A8HB 1WNLA 4PLLA 3RR6A 3HPWA 2QA4Q 1Q7YC 2E10A 1JXOA 3CCRQ 4R55A 1FMVA 3CBMA 1K9MC 4OGEA 1T3SA 3CMET 3JCMJ 2HD0A 2YRCA 4PJJA 4C5HA 2DTOA 4FT2A 2DXUA 2PTKA 4EMKB 1TWBA 1Z9ZA 2HBPA 2KR3A 2NUZA 1WGSA 4DEYA 5GANf 2QASA 3H0HA 2YUNA 2LQ8A 3D7SB 3PVLA 4RTUA 1KD1U 3SWNB 4M77F 5GMKi 1M1KC 1RAGB 4N0AA 1T0JA 1VQMT 1BI1A 1YNZA 2CH4W 2KYMA 1AZEA 4HVVA 2DNUA 4F16A 2M0OA 1MMGA 3GF5A 1Q81C 4C5EA 2E3IA 1YI2T 1S72T 3CCLQ 4FL6A 5CKHA 2CZ6B 2Y4YA 2FPFA 1KC8R 2XD0A 5GMKl 3META 4E7HA 4GLMA 1KIKA 1I81A 2X3XD 4FYVB 5GAN6 2ABLA 2YHTA 1W2BS 4JPBW 3VV0A 4A4HA 1VQ9A 2JNGA 5AT1B 2ZPGB 3C0CA 1U1TA 1MV0B 1VQNA 5GAOr 5LJ5e 5LJ3e 4C92G 5C6SA 1LPLA 4OMFB 1PSEA 5HCKA 4JRPA 3CCSQ 3RUXA 3VJPA 2MYSA 1K73R 4PFPA 3EGDB 3VS1A 4Z8AA 1W2BP 4EMKA 3KUFA 1GCPA 1VQKA 1M2VB 3GBQA 1D3BB 1MUZA 4IIMA 2ZPBB 4PLIA 3SWNA 3OS0A 2DJQA 1M27C 2RHIA 2EYWA 3QYGB 3AHUA 1O75A 1SKUB 1IB8A 2X4XA 1SRMA 4M75B 1X6BA 2QTVA 2BUDA 3L2QA 1W4SA 1AT1B 2P4TA 1ZUUA 3X20B 2RQTA 3PMTA 3DKMA 1HSQA 2LCLA 1LOJA 2LVMA 1NEGA 1I4K1 3T9NA 1YHQQ 2MOXA 3ZBDA 3CC4Q 4ZN3A 3I5RA 3JCMc 3E9FA 2ROTA 3PNWC 3CCQT 3DB4A 4LD6A 3V8JA 4D8DA 2ESWA 3JCMg 3FEOA 2EPDA 2JM8A 2QGFB 2EAYA 5GJWB 4ZGEB 2D1XA 2LZ6B 2HQHA 2CH4A 1EFNA 2QXFA 2CZ7B 4FW1A 3OYKA 1QKWA 3OYNA 5LJ5f 4OMOA 3VUZA 2AKLA 2JS2A 1WXTA 1BI2A 4DBFA 3EGDA 1D1AA 2DTIA 1QCNA 1YJ9A 3RKXA 3RKYA 2DRKA 3OS1A 3M53A 3OYGA 1KC8C 1M2VA 3CCJA 2H8HA 3CCUQ 1D3BA 2E3HA 1PWTA 4J6YA 1VUBA 1WFWA 2RK1A 3M4YA 2PVGB 1H641 1IHWA 4KH0B 3I56T 1YWPA 4A4FA 1A0NB 2BE9B 4M75A 2DXCA 3RBBB 1YJNA 4QT7A 1ZUYA 1MHNA 3CXCA 3EHRA 2COWA 1HXDA 3JCMP 2R5MA 5KE2A 4A4EA 1VQ6A 1YWOA 2KXDA 1K73C 2X4YA 1GBRA 3CCET 3EG9B 4R0KA 3JRZA 1IREB 4BUGA 1XTDA 4X34A 1VQ7A 3QYHB 3JB9F 1H3ZA 2EGCA 2DL3A 1PD0A 2WSCE 2K5FA 2EQKA 1I8FA 1UUEA 3V7RA 4HCCA 4B9WA 1PRLC 2X4WA 4DBRA 2G6FX 3ME9A 1YFNA 3M0RA 3M55A 3PT9A 2E6NA 5HY6A 4M7DB 4TVRA 2A37A 5FW9A 4Y91A 1OPLA 2ZAEA 3E1SA 2A28A 2J6KA 2VB6A 4YTLA 2OTJQ 4ESRA 2IVWA 7AT1B 2HZYA 2F2XA 3L42A 1N6AA 1UE9A 3MP6A 3QPHA 4HT9A 1I5OB 1YITT 4E6RA 2DPPB 1U1SA 1ZA1B 2JTEA 5GAOn 2NUPB 4IUVA 3G71Q 1NM7A 4L5GA 1VQ5T 1PM3A 3QZ9B 3M56A 3OW2S 3QDFA 5IAYA 3CCMQ 3UA7A 3CC2T 2QA4A 1H3HA 2KT1A 2RHUA 1VQNQ 2EYQA 1XQHA 3OY9A 3CCRA 2P0PA 4E7SA 2JT4A 5A0DA 1I07A 1IZ6A 1RI9A 3EG9A 2Y4XA 1QWFA 1E6GA 4BACA 4B6MA 4ZGDB 4LDVA 4KT0E 4J7IA 1NE8A 9ATCB 1W70A 3S3NA 3PIPA 2E4HA 2V1QA 4WF2A 2YLBA 3CC7Q 4AMCA 2DE0X 1SHFA 3FB9A 1BI0A 4XTVA 3CC4T 1JJ2A 1E6HA 3TEEA 5IT9E 2ECZA 4NL3A 2OI3A 6AT1B 4NOYA 3EGXB 3QWYA 3JCMf 2IIMA 1RUWA 2DO3A 4C5GA 2P84A 4M7DA 2DZ9A 3MP1A 5DLQE 1TH7A 2VYTA 4O5VA 5KYUB 5GAOq 3CCLA 2FRWA 2K5LA 4P5NA 4EIKA 3JB9D 1G5VA 5HKCA 1KHCA 1YIJT 3OBWA 1I0CA 2KRSA 2FZKB 2LQKA 1WHLA 3M59A 5GAN4 1NG2A 2V1RA 1UGSB 2RHYA 2NUPA 1Q86U 3TVTA 1X75C 5IH2A 2HNIA 3QDRB 5I2SA 3FRNA 4ME7A 3TSZA 2ENMA 2MK5A 3M0QA 1Q82R 3CCSA 1KQSA 4C92F 2Y90A 2NYSA 2CP3A 2LJ1A 3EG3A 5KE3A 2RJDA 3MP8A 4QKUA 1IO6A 3EFRA 2OTLT 2DKGA 4D6WA 2LT1A 1IRXA 2DVJA 3GLXA 1M90R 1T3LA 4F7UB 3KBGA 3INZA 3URGA 4II1A 2DF6A 1AEYA 3UT1A 5KYXB 2DAQA 2HSEB 4J9IA 4C0DB 4CC3A 1QVPA 4OB0B 2BIVA 2L8DA 2R5AA 3EGXA 2DMOA 1NJIR 2F5TX 2EFIA 2FG0A 4RTVA 4J9CA 3TCJA 2JZ2A 2KE9A 2PQWA 4N0AC 5KYUA 4X1VA 1YHQA 2CUDA 1N8RU 1UTIA 5KCOA 1SPKA 1WHGA 2DBMA 2DIGA 2ROLA 1VQ6Q 2MWPA 3G6EQ 4O6JA 2VVKA 3EFOB 4M75G 1AWXA 1K1ZA 4FM4B 1KD1R 4XTYA 3VS3A 2XU8A 2COYA 3S3MA 3R6OA 1QVFA 4LXCA 1M1GA 3LYIA 3GNFB 2JVVA 2KY9A 4BI3A 3NHNA 2RD1A 1QKXA 5FU7C 3JB9J 1G2BA 2JS0A 1QVGA 1OQKA 4OMPA 3ZFJA 3VYHB 2KQWA 2EBPA 2H3EB 1WPYA 1VQ9T 4KGZB 1BK2A 2EGEA 3CCUA 3A5ZB 3CPWP 1OU8A 4PJNA 1GCQA 1VQNT 1LCKA 2DBKA 4C0ZA 4XU1A 1MNEA 2FZCB 2V26A 1HK9A 2MI6A 4F7UA 1WJRA 4J9BA 5LJ3g 4LNPA 3CMAQ 4EMKC 3LLRA 4EMHA 1Q7YU 1NEBA 2DA9A 2CSQA 1ZA2B 1UDLA 5IXBA 1K9MU 4QVDA 1AOJA 3JCMQ 1VQKT 3EHQA 2JTMA 4ELYC 1JEGA 2XG8D 1UJ0A 2ED0A 1K9AA 3H41A 4LDUA 5GANh 3SWNC 2CGHA 3UDCA 1U8RA 3J81E 5KYYB 1ABQA 1AHJB 1QLYA 2A3LA 3L2ZA 2HKNA 4IUPA 3VS0A 1VYUA 2F1LA 1RAAB 2L3SA 5A0GA 1M1KU 3EFOA 4IUUA 1V1CA 2VKNA 2M02A 5GAMg 4MDXA 2BTTA 2VV5A 1NZ9A 2EGAA 4JZ4A 8AT1B 1JO8A 3MKDA 2CT4A 3V8KA 5I11A 1M3CA 1Q81U 5GMKe 2SRCA 4WCIA 5FU6B 1W1FA 1NJIC 1VQLQ 1FX7A 1NPPA 3JCMd 2HSPA 3HSBA 3BDUA 2FZGB 5J3BA 1AD5A 2QGGA 4JJCA 3PMIA 1N5ZA 3FIFA 1WHHA 4JJNK 2OTJA 3QO3A 3OS5A 3EH2A 4AFZC 2F2VA 2HL3A 3OSSC 1WXUA 4Z88A 4RUGA 2K4YA 3RMQA 1I5LA 4BD3A 2QQ9A 1Y96B 1ABOA 5J26A 3RNJA 2H3JA 1VIEA 3G71A 1ZSZB 2JJ9A 1VQ4Q 3VS4A 4M7DG 4DA4A 3REAB 1YJ9T 3CCMA 1D09B 2HEQA 1PC0A 2QDYB 3NTIA 4DOWA 3CCJT 1ARKA 1UHFA 2RQWA 1QCFA 2QQAA 2L5QA 5A0LA 4JDSA 2O01E 2A0FB 5KYYA 2XI9A 1ZHIA 1WLPB 2G3RA 3X26B 1YP5A 2K9GA 4M75E 4M75C 2RB6A 3MEAA 2DL5A 1UG1A 3OSVA 2CUBA 2CSIA 2GTJA 1YJNT 1VYTA 1SSFA 1TTHB 2EJGA 3CC7A 3A8MB 2BE7D 1G3TA 2JUFA 2QEXQ 2R57A 1VQ6T 3OYBA 3I55Q 5GAMe 1AWOA 1QQJA 1P92A 2YWWA 1LNXA 4LN2A 4F04B 2GQVA 4KGVB 2VC8A 2EJ9A 4PJOB 2K3YA 2KVQG 5GAN2 1VQ7T 3VS2A 2HL5C 2K57A 3CXCS 4QQ6A 4QW2A 4ZNXA 1H92A 1NYFA 1G8XA 2VUBA 2D6FA 4BI4A 2AK5A 3HHTB 1K8AR 4FYXB 5D6WA 1TUCA 3P8DA 1MMNA 1Y96A 2LCSA 1SF9A 5LJ5h 1BYMA 1PD1A 1ZSZA 4N4IA 3OYAA 2EWNA 4A54A 3JCMW 1BKBA 3EG2A 1HJDA 1PHTA 4M7AE 4M7AC 1IHVA 1QW1A 1Y57A 2C0TA 1ZLMA 2NWMA 2DL8A 4J83A 3A8GB 2EVRA 3ULRB 1TS9A 1KC8U 2Z0WA 3CBOA 5LJ3f 4AFSC 2DM1A 2JN0A 5HK3A 1ZBXA 1TOVA 3CCVQ 4FSSA 3WVDB 2NUTB 4ZN1A 1RADB 2DJZA 4C8QE 4C8QC 3EGUA 5CKBA 4OF1A 3MHXA 5IN1A 1K4US 1AWJA 4M7AB 1O9SA 3G4SQ 4L6V5 2QA4T 2KMTA 5CAIA 2I2LA 4ATOA 2EYYA 3CCRT 4AFUC 5I2MA 5FLXE 2ZPEB 4C5IA 4XU2A 2FEIA 2RI3A 5GAMf 4PJOA 1K73U 1FWZA 3GIBA 4C8QB 1YJWQ 3DB3A 4QQGA 3LGLA 1SRLA 1MNDA 1MV3A 3IQLA 1OU9A 2CP7A 5IHIA 4FU6A 3UF4A 5GAN5 1JBMA 1NYGA 1NBEB 2AZSA 3G6EA 5I22A 2DD4A 3F70A 4F7UG 3QBYA 1SHGA 5EC7A 1KK7A 4J7FA 2XDDA 1CKAA 2YUPA 1X6GA 1N27A 1GFCA 4M75F 1WIEA 1Y07A 2CP6A 4IKFA 5GANd 4M7DE 4M7DC 2XIDA 2CS7A 4JS5A 2VGMA 2YXYA 2CZ0B 3CCLT 2YRVA 3LGFA 4E7LA 1JJ2S 4IIOA 3OYMA 2QQSA 1GL5A 3EG0A 4JRKA 4M78B 4NS5A 3U23A 1OX9A 4ORZA 4AFQC 4LD9K 4MZPA 1QMCA 1XNIA 1RABB 3MEVA 2K7AA 1MMDA 1RAFB 2NUTA 2GTOA 4LDYA 2SEMA 3LWIA 2J06A 4HCKA 1YBYA 4OB1B 4M7AA 2GGRA 3I9QA 1PNJA 5CCAA 1K8AC 1JJ2P 1TXQA 1WHJA 1M3BA 5GANj 1VYVA 3CMAA 3CCST 3M9QA 2A08A 4J6WA 3E9GA 3V8LA 3P8BB
chains in the Genus database with same CATH topology
4F7UB 3KBGA 4OVAA 3INZA 4IUQA 3URGA 4II1A 2LQ8A 4C8QA 3OS2A 4BE0A 1KD1U 3UT1A 3SB2A 1W2BA 3SWNB 4M77F 5GMKi 2DAQA 4C0DB 1M1KC 1WQWA 4N0AA 1QVPA 1VQMT 1BI1A 3LH0A 2RM4A 3SFMA 3CMAT 4OB0B 4B9XA 2BIVA 4M7AF 2L8DA 2R5AA 1PSFA 3HL8A 1YI2A 4ZTJA 1BI3A 3DLMA 3L2RA 2F5TX 2EFIA 1S72A 3A8OB 3Q1JA 1ZQ1A 3CD6A 4E7KA 1KQSS 2LRQA 4ZTFA 3QSUA 4OP0A 3TCJA 2YLCA 2JZ2A 2PQWA 5GAMh 1G5VA 2NLUA 4N0AC 2M0OA 2E64A 2VXFA 1YHQA 1JB0E 1N8RU 5KCOA 3GF5A 2PVDB 3OMGA 2RI2A 2DIGA 1Q81C 4C0FA 2MWPA 3C4SA 4C5EA 4O6JA 2E65A 1M9SA 2KDSA 1YI2T 5DY9A 1V29B 1S72T 4M75G 3JCMh 3M58A 3CD6T 4FL6A 5CKHA 2CZ6B 4FM4B 4KBMB 2Y4YA 4XTYA 1RL2A 2XU8A 5GMKl 2XD0A 4Z02A 3OYLA 1YHQT 3V7SA 2XDPA 3META 4E7HA 3S3MA 3R6OA 1QVFA 1I81A 2B8AA 5GAN6 4RG2A 1M1GA 2YHTA 3LYIA 3GNFB 1W2BS 4E47A 3VV0A 2JVVA 2KY9A 2O4XB 4M78A 4A4HA 4JUVA 5L8RE 4BI3A 1VQLA 2ZPFB 2RD1A 1VQ9A 5FU7C 1M1FA 2WSFE 2XKOC 2RI5A 2JNGA 3JB9J 2ZPGB 1QVGA 1U1TA 3L2WA 1RI0A 4M75D 3G7ZA 4PJOD 4XQ3A 1VQNA 4M78E 4M78C 5GAOr 1R8OB 1DJ7B 3ZFJA 3OA6A 2FVUA 3QKJA 5LJ5e 5LJ3e 2EJFA 2QQRA 3VYHB 4C92G 4MZTA 1VQLT 5C6SA 2KQWA 4VUBA 2P0QA 1WPYA 3PTAA 1QP2A 4OMFB 5D6YA 1VQ9T 1VQOA 1PSEA 4QVCA 5CK9A 2E41A 4PJOF 4JRPA 3BFMA 3RUXA 3VJPA 2RHZA 2CYZB 3S6WA 4RMOA 5FRMA 2RK2A 3CCUA 1OZ2A 2F69A 3A5ZB 4GY5A 5DM7R 1G3YA 2MAMA 4CRIA 1G3SA 3GLXA 4EMKA 1VQ4A 3KUFA 4BE2A 1VQNT 4ELZC 4C0ZA 4XU1A 3LW5E 1VQKA 3BW1A 3E19A 1EIFA 1QVFS 1VQOT 1M8VA 1D3BB 1HK9A 2GFUA 2MI6A 4F7UA 3MEUA 4M7DF 1WJRA 2LT4A 5LJ3g 1KQ1A 4XK8E 4MZMA 3VU3C 2M16A 3QIIA 3UPUA 2ZPBB 2L89A 4PLIA 4EMKC 3LLRA 3SWNA 4EMHA 3CCUT 1Q7YU 3OS0A 4NL2A 3QXEB 4RKUE 2RHIA 4M77G 2DXTA 3QYGB 3RMSA 4C0GA 4E7JA 1VQ4T 1K8AU 2XDBA 3J7AF 4OB2B 1QVGS 3AHUA 1K9MU 1O75A 4QVDA 3JCMQ 4JS4A 1VQKT 2X4XA 2JTMA 3A8LB 4ELYC 4F7UE 4JRIA 5LJ3d 4M75B 1NPRA 2XG8D 5LJ5d 2F5KA 3HRSA 3OYCA 2BUDA 4GLKA 1W4SA 4LDUA 3L2QA 5GANh 2P4TA 3SWNC 5I21A 2CGHA 3UDCA 4C0DC 3N5BB 1U8RA 4C92E 4C92C 3J81E 1OI1A 5D6XA 3X20B 4V2SA 3PMTA 3JCMe 1YJWT 1AHJB 4FSXA 3DKMA 4OB3B 3CCQA 2BKDN 2LCLA 1LOJA 2A3LA 3L2ZA 3M54A 3NFCA 4IUPA 4MMLA 2LVMA 4R56A 2M9UA 3PIOA 2DEQA 3L1AA 5A0GA 1I4K1 1M1KU 1M5Q1 4HA8A 3T9NA 1UB4A 3JSCA 4IUUA 4HCBA 3JB9D 3ZBDA 3C95A 4EDUA 5GAMg 2P0KA 2QEXA 2WACA 3CEYA 4ZN3A 4MDXA 3JCMc 3X25B 2VV5A 3I55A 1NZ9A 3E9FA 4M7AD 2V8IA 3PNWC 2LCCA 3CCQT 3S3OA 3FLGA 3OYIA 3DB4A 4LD6A 4MDWA 3V8JA 3OQ5A 3OB9A 3FC3A 1JRIA 3V8KA 4C92B 4RCBA 3JCMg 2O4XA 3FEOA 2HAXA 1Q81U 5GMKe 2EAYA 5GAOm 4ZGEB 2QEXT 2DZCA 2E5QA 3I55T 2EKOA 5FU6B 1UEBA 4XTXA 3V7CA 5LJ5j 1NJIC 4HKEA 1FX7A 1NPPA 3JB9H 3JCMd 4BI8B 4C8QD 3GOXA 3VYGA 2MMPA 3HSBA 3BDUA 2QXFA 4UC4A 5J3BA 2CZ7B 2ZPHB 2V8KA 3OYKA 3OYNA 4BDZA 5LJ5f 2QI2A 1KQ2A 3PMIA 3VUZA 2FHDA 3FIFA 5C0MA 4C8QF 2EIFA 4J8OA 2K5IA 4PJOG 4JJNK 1KG1A 2OTJA 1BI2A 3QO3A 2DXBA 4IUTA 2VGNA 2DTIA 3OS5A 3SDZA 4M77B 1YJ9A 2KAFA 3RKXA 2MF2A 3OSSC 3RKYA 3OS1A 3FJPA 3I56A 1X6OA 3M53A 3OYEA 3OYGA 3JB9I 1KC8C 2K4YA 4JLIA 3JCMb 2JOYA 3RMQA 3CCJA 1I5LA 2DTHA 3RKWA 4BD3A 2QQ9A 1D3BA 1Y96B 1B34B 5J26A 2RJCA 3OYJA 2H3JA 1VIEA 2X35A 2ZPIB 1VIFA 3G71A 2PU9B 1VUBA 4J6YA 2RK1A 4M7DG 1N9SA 2OTJT 3C94A 2RO0A 4DA4A 3HRUA 3M4YA 2PVGB 1H641 2HQXA 1YJ9T 3CCMA 4PL6A 3I56T 1GXIE 2QDYB 3HRTA 3NTIA 4A4FA 3CCVA 3MO8A 4DOWA 3P8HA 4M75A 3CCJT 1VQPA 2DXCA 3CCEA 2GF7A 4FT4A 2QQAA 2L5QA 1UGRB 1YJNA 3M5AA 3PFSA 2R58A 2RJFA 4FIBA 5EG2A 3RESA 3G71T 5A0LA 1MHNA 2CZ1B 4JDSA 2O01E 4XAXB 3CXCA 2XI9A 1ZHIA 4HT8A 2G3RA 3HFOA 3X26B 5GAOl 1HXDA 3JCMP 3M4GA 2R5MA 5FROA 4EMGA 5KE2A 3G4SA 3CCMT 4M75E 4M75C 2XK0A 2RH2A 3HFNA 2RB6A 3MEAA 4A4EA 3GPLA 1VQ6A 4M7DD 3HKSA 4M78F 3CCVT 1K73C 3QJ6A 4DQ2A 2X4YA 3OSVA 3QG1A 2EQUA 5GANg 1VQPT 3CCET 2A7YA 3BY7A 1YJNT 5AYFA 3JRZA 2QTXA 1SSFA 2PUKB 2EJGA 5CVIA 3QJYA 3CC7A 3ER0A 3WXMB 1IREB 5CKEA 4BUGA 1XTDA 2QQBA 3OMCA 4X34A 1UGQB 2E12A 3A8MB 1VQ7A 3QYHB 2PVOB 3G4ST 5GMKj 1G3TA 2JUFA 4E7IA 1YJWA 2R57A 4C92A 2RHXA 1VQ6T 5HK0A 3JB9F 2D9TA 3OYBA 1H3ZA 5GAMe 3BDLA 1P92A 1LNXA 4BY6B 2RJEA 2GQVA 4M7AG 2WSCE 2K5FA 2EQKA 2EJ9A 2VC8A 1I8FA 2DIQA 2K3YA 4PKCC 4PJOB 1BIBA 3V7RA 4HCCA 3CC7T 4B9WA 1Q82C 3RIRA 3OYDA 3HP9A 2KVQG 3ASKA 5GAN2 1VQ7T 4BDYA 2X4WA 2K57A 1Y7XA 2LNVA 3CXCS 3OW2A 4QQ6A 3ME9A 4QW2A 3OYYA 3M55A 4F7UF 5FU6C 1XOVA 3PT9A 1UGPB 2E6NA 2CKKA 5HY6A 4M7DB 4TVRA 3EAEA 3OBYA 1WJQA 4C8QG 1Q86C 1YITA 4N4GA 4Y91A 3RERA 2VUBA 3JCMV 4M77A 2D6FA 4BI4A 2V8JA 4JRQA 3E1SA 3HHTB 5CIUA 5CR2A 4YTLA 1WQ7A 1NJIU 4A4GA 1M90C 5D6WA 3H6ZA 3H8ZA 2IVWA 2E70A 3P8DA 1VQ5A 1Y96A 1B34A 2RA2A 5LJ5h 5GAMd 1BYMA 3L42A 1N6AA 3MP6A 3QPHA 4HT9A 4N4IA 3CC2A 4M77E 4M77C 5GAOp 3OYAA 2EWNA 4A54A 3JCMW 1YITT 1BKBA 3JAME 5DLOA 2L3RA 2EQMA 4M7AE 4M7AC 2DPPB 1M4ZA 1QW1A 2LC4A 1U1SA 5GAOn 2LDMA 4XU3A 5LJ3j 4IUVA 5CKFA 2ZCFB 2XHCA 2FYKA 3JCMX 5GAN8 4J83A 4ZGJB 3A8GB 4L5GA 2KK4A 1VQ5T 3NTKA 4N4HA 2D0QB 1YCYA 4LDWA 3QZ9B 3M56A 1G3WA 1N9RA 3CPWA 3OW2S 1KC8U 3CBOA 4MMKA 5IAYA 5LJ3f 5CKDA 3CC2T 4IURA 2QA4A 2EQJA 5HK3A 2JN0A 3TREA 3X28B 1ZBXA 2RHUA 3ZEHA 5CQXA 2EYQA 5GAN3 1XQHA 4HCZA 3WVDB 4ZN1A 3OY9A 1OYXA 3CCRA 3FDRA 2DJZA 2P0PA 4C8QE 4C8QC 4XTUA 5CKBA 3X24B 5A0DA 4OF1A 3MHXA 4M78G 5IN1A 1KD1C 4L59A 1Y71A 2LTOA 4M7AB 1O9SA 1IZ6A 4BB7A 2X4JA 2Y4XA 3CC4A 4L6V5 2QA4T 4BACA 2KMTA 3GNGA 4LDVA 4ZGDB 4X9DA 5CAIA 3OYHA 4KT0E 2I2LA 3QHSA 4J7IA 1NE8A 2IG0A 4ATOA 3MCAB 2K2VA 5GAMj 3CCRT 2FB7A 5I2MA 3S3NA 3PIPA 4A4KA 2MWOA 3WVEB 5FLXE 4QVZA 2HQEA 2ZPEB 4WF2A 5GANe 2YLBA 4C5IA 3JB9G 1VQ8A 5FRNA 4KUDK 3O8VA 1N8RC 4XU2A 3FB9A 2RI3A 1BI0A 4XTVA 5GAMf 4XTWA 1OZ3A 3GP8A 4PJOA 3CC4T 1K73U 1FWZA 1JJ2A 3GIBA 4C8QB 3PGGA 3TEEA 2DD5A 3DB3A 5IT9E 4QQGA 3LGLA 3LX7A 4M78D 4J6XA 3CPWS 4NL3A 1BIAA 4XU0A 1KHIA 1YIJA 2FL7A 4PNOA 3KXTA 4JLGA 4BY6C 4NOYA 3UWNA 4DOVA 4FU6A 5CO7A 3JCMf 2E6ZA 5GAN5 4BE1A 1VQ8T 1JBMA 4PJOC 4PJOE 2DO3A 4C5GA 3NTHA 3G6EA 2DD4A 3F70A 3M57A 4Y28E 2LX9A 3QBYA 4F7UG 2DZ9A 4M7DA 3MP1A 5DLQE 1TH7A 2VYTA 3MEWA 4O5VA 5GMKh 5GAOq 3CCLA 2ZGWA 2K5LA 4P5NA 2K3XA 2XICA 4X9CA 3OYFA 3QUIA 2DK3A 4J7FA 4CI0C 5HKCA 2XDDA 1KHCA 1YIJT 4A53A 1N27A 3SD4A 1Q82U 3OBWA 4KULA 4M75F 3J80E 1Y07A 2VXEA 4IKFA 5GANd 4M7DE 4M7DC 2LQKA 2XIDA 2CS7A 4JS5A 2OAUA 2VGMA 3G6ET 2PUOB 4LDXA 3C12A 3M59A 5GAN4 2CZ0B 5FU7B 1MGQA 3CCLT 5A2QE 3EFSA 2YRVA 3LGFA 3VUBA 5KCHA 4E7LA 5J39A 1FXXA 1QP3A 1JJ2S 1X01A 2KSSA 1UGSB 2RHYA 3OYMA 1Q86U 2QQSA 2DVEA 2C06A 1X75C 2GFAA 4JRKA 2HNIA 3QDRB 5I2SA 4M78B 5LJ5g 4NS5A 3DLLA 4J5YA 3FRNA 5KH6A 4RG8A 5LL6S 5CQYA 2GCXA 4ME7A 4OGCA 4C92D 1M90U 4Q5WA 4LD9K 2ZZDA 4MZPA 1LJOA 3CPFA 4XTZA 1XNIA 3L2UA 3CMEA 2JTFA 3MEVA 2OTLA 4KUIA 5GAN7 2M1HA 3CCSA 2AHJB 4LDYA 1KQSA 4C92F 3A8HB 1WNLA 3LWIA 4PLLA 5M9OA 3L2VA 2Y90A 3HPWA 5GMKm 1YBYA 4OB1B 1WJSA 4M7AA 1Q7YC 2E10A 3QZ5B 4RCCA 5KE3A 4R55A 5CCAA 2RJDA 3CBMA 1K8AC 3MP8A 5LJ3h 3LWHA 1K9MC 4QQDA 4EPCA 4OGEA 3CMET 5GANj 2OTLT 3EFRA 3JCMJ 2HD0A 2DKGA 4D6WA 3TU4K 2LT1A 4C5HA 2DTOA 4FT2A 2DXUA 1VQMA 3CMAA 4EMKB 3CCST 3M9QA 4M77D 2HBPA 4J6WA 3E9GA 3CBPA 2WSEE 3V8LA 2E1HA 1WGSA 5GANf 3P8BB 3VKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KBG A;  4OVA A;  4IUQ A;  4II1 A;  2LQ8 A;  4BE0 A;  3OS2 A;  1KD1 U;  3UT1 A;  1W2B A;  2DAQ A;  1M1K C;  1VQM T;  3LH0 A;  3CMA T;  4B9X A;  2BIV A;  2L8D A;  2R5A A;  1YI2 A;  4ZTJ A;  3DLM A;  3L2R A;  2EFI A;  1S72 A;  3Q1J A;  3CD6 A;  4E7K A;  1KQS S;  2LRQ A;  4ZTF A;  2JZ2 A;  2PQW A;  2NLU A;  2M0O A;  1YHQ A;  1N8R U;  5KCO A;  3OMG A;  2RI2 A;  1Q81 C;  2DIG A;  2MWP A;  3C4S A;  4C5E A;  2KDS A;  1YI2 T;  1S72 T;  3CD6 T;  4FL6 A;  1RL2 A;  4Z02 A;  1YHQ T;  3OYL A;  2XDP A;  3MET A;  4E7H A;  3S3M A;  1QVF A;  2B8A A;  4RG2 A;  1M1G A;  3LYI A;  1W2B S;  2JVV A;  1VQL A;  2O4X B;  4A4H A;  1VQ9 A;  2RI5 A;  2JNG A;  1QVG A;  3L2W A;  1RI0 A;  1VQN A;  3OA6 A;  3QKJ A;  2QQR A;  1VQL T;  5C6S A;  1VQO A;  5D6Y A;  1VQ9 T;  2RHZ A;  3S6W A;  5FRM A;  3CCU A;  1OZ2 A;  3A5Z B;  4GY5 A;  5DM7 R;  4CRI A;  1VQ4 A;  1VQN T;  3KUF A;  4BE2 A;  1VQK A;  1EIF A;  1QVF S;  1VQO T;  2GFU A;  2MI6 A;  3MEU A;  1WJR A;  2M16 A;  3QII A;  2L89 A;  4PLI A;  3CCU T;  3LLR A;  1Q7Y U;  3OS0 A;  2RHI A;  3J7A F;  4E7J A;  1VQ4 T;  1K8A U;  1QVG S;  1K9M U;  1VQK T;  2X4X A;  1NPR A;  3OYC A;  2F5K A;  2BUD A;  3L2Q A;  3J81 E;  1OI1 A;  5D6X A;  3PMT A;  3CCQ A;  1YJW T;  2LCL A;  2BKD N;  4IUP A;  2LVM A;  3PIO A;  1M1K U;  4IUU A;  4EDU A;  2QEX A;  2P0K A;  2WAC A;  3CEY A;  4ZN3 A;  3I55 A;  1NZ9 A;  3E9F A;  3PNW C;  2LCC A;  3CCQ T;  3S3O A;  3FLG A;  3OYI A;  3DB4 A;  4LD6 A;  3OQ5 A;  3OB9 A;  3FC3 A;  2O4X A;  3FEO A;  1Q81 U;  2QEX T;  2E5Q A;  3I55 T;  2EKO A;  1UEB A;  1NJI C;  1NPP A;  3GOX A;  5J3B A;  4UC4 A;  3OYK A;  3OYN A;  4BDZ A;  3PMI A;  2FHD A;  5C0M A;  2EIF A;  2OTJ A;  4IUT A;  1YJ9 A;  3OS1 A;  3I56 A;  1X6O A;  3OYE A;  3OYG A;  1KC8 C;  2JOY A;  3CCJ A;  4BD3 A;  5J26 A;  2RJC A;  3OYJ A;  2X35 A;  3G71 A;  2OTJ T;  2RO0 A;  2HQX A;  1YJ9 T;  3CCM A;  4PL6 A;  3I56 T;  3NTI A;  4A4F A;  3CCV A;  3MO8 A;  3P8H A;  3CCJ T;  1VQP A;  3CCE A;  2GF7 A;  1YJN A;  3PFS A;  2R58 A;  2RJF A;  3G71 T;  1MHN A;  3CXC A;  2G3R A;  2R5M A;  5FRO A;  3G4S A;  3CCM T;  5KE2 A;  2XK0 A;  4A4E A;  3MEA A;  1VQ6 A;  3HKS A;  3CCV T;  1K73 C;  3QJ6 A;  1VQP T;  2X4Y A;  2EQU A;  3CCE T;  1YJN T;  1SSF A;  3CC7 A;  3ER0 A;  1XTD A;  4X34 A;  3OMC A;  1VQ7 A;  3G4S T;  2JUF A;  4E7I A;  1YJW A;  1VQ6 T;  2R57 A;  2RHX A;  2D9T A;  3OYB A;  1H3Z A;  3BDL A;  2RJE A;  2EQK A;  2DIQ A;  2K3Y A;  3CC7 T;  4B9W A;  1Q82 C;  3OYD A;  2KVQ G;  3ASK A;  1VQ7 T;  4BDY A;  2X4W A;  3CXC S;  3OW2 A;  4QQ6 A;  3ME9 A;  4QW2 A;  3OYY A;  5HY6 A;  2CKK A;  2E6N A;  4TVR A;  3EAE A;  1Q86 C;  1WJQ A;  1YIT A;  4N4G A;  5CIU A;  4YTL A;  1NJI U;  1M90 C;  4A4G A;  5D6W A;  3H6Z A;  3H8Z A;  2E70 A;  1VQ5 A;  3P8D A;  3L42 A;  3MP6 A;  4N4I A;  3CC2 A;  3OYA A;  1YIT T;  1BKB A;  3JAM E;  2L3R A;  2EQM A;  2LDM A;  4IUV A;  2XHC A;  1VQ5 T;  3NTK A;  4N4H A;  3CPW A;  3OW2 S;  1KC8 U;  5IAY A;  3CC2 T;  4IUR A;  2QA4 A;  2EQJ A;  3TRE A;  2RHU A;  3ZEH A;  4HCZ A;  3OY9 A;  4ZN1 A;  3CCR A;  1OYX A;  3FDR A;  1KD1 C;  5IN1 A;  4L59 A;  2LTO A;  1IZ6 A;  3CC4 A;  2QA4 T;  4BAC A;  3OYH A;  2IG0 A;  3CCR T;  3S3N A;  3PIP A;  2MWO A;  5FLX E;  4QVZ A;  2HQE A;  4C5I A;  1VQ8 A;  5FRN A;  1N8R C;  3O8V A;  2RI3 A;  1OZ3 A;  3CC4 T;  1K73 U;  1JJ2 A;  3DB3 A;  5IT9 E;  4QQG A;  3LGL A;  3LX7 A;  3CPW S;  1KHI A;  1YIJ A;  3UWN A;  4FU6 A;  2E6Z A;  1VQ8 T;  4BE1 A;  2DO3 A;  4C5G A;  3NTH A;  3G6E A;  3F70 A;  3QBY A;  3MP1 A;  5DLQ E;  3MEW A;  2VYT A;  3CCL A;  2K3X A;  1G5V A;  3OYF A;  1KHC A;  1YIJ T;  1N27 A;  3SD4 A;  1Q82 U;  3J80 E;  4IKF A;  3G6E T;  3CCL T;  5A2Q E;  2YRV A;  3LGF A;  5KCH A;  4E7L A;  5J39 A;  1JJ2 S;  3OYM A;  2RHY A;  1Q86 U;  2QQS A;  2GFA A;  4NS5 A;  3DLL A;  5KH6 A;  5LL6 S;  1M90 U;  4Q5W A;  3CPF A;  1XNI A;  3L2U A;  3CME A;  2JTF A;  3MEV A;  2OTL A;  2M1H A;  3CCS A;  1KQS A;  4PLL A;  5M9O A;  3L2V A;  1YBY A;  1WJS A;  1Q7Y C;  5KE3 A;  2RJD A;  1K8A C;  3MP8 A;  1K9M C;  4QQD A;  3CME T;  2OTL T;  4C5H A;  1VQM A;  3CMA A;  3CCS T;  3M9Q A;  3E9G A;  1WGS A;  3P8B B; 
#chains in the Genus database with same CATH topology
 4GBQ A;  5KYN A;  4OVA A;  4IUQ A;  4C8Q A;  3OS2 A;  3G1J A;  1WQW A;  2BZY A;  1VQ8 Q;  3LH0 A;  2RM4 A;  3SFM A;  4B9X A;  4M7A F;  3HL8 A;  4RTY A;  4ZTJ A;  3DLM A;  3L2R A;  1PKT A;  3Q1J A;  3CD6 A;  4M4Z A;  1KQS S;  2LRQ A;  4ZTF A;  1D1B A;  3VS6 A;  2YLC A;  2HMA A;  2NLU A;  1U5S A;  1JB0 E;  2PVD B;  3OMG A;  4C0F A;  3A1P A;  2KDS A;  5DY9 A;  2LNH B;  1V29 B;  3JCM h;  3M58 A;  4OMM A;  2LJ3 A;  2D8H A;  3OW2 P;  1RL2 A;  4Z02 A;  1YHQ T;  4OMN A;  2XDP A;  3AT1 B;  2K6D A;  4RG2 A;  1B7T A;  4E47 A;  2QDL A;  1VQL A;  1T0H A;  4M78 A;  4JUV A;  5L8R E;  2IPO B;  2ZPF B;  2J6F A;  1M1F A;  1WX6 A;  1CSK A;  1RI0 A;  4M75 D;  3G7Z A;  4PJO D;  4DBQ A;  3M0T A;  4MZT A;  2HDA A;  1X2Q A;  4VUB A;  2P0Q A;  3PTA A;  1VQO A;  5CK9 A;  2E41 A;  1IXD A;  3BFM A;  3S6W A;  2F69 A;  4GY5 A;  1G3Y A;  1WI7 A;  4CRI A;  1G3S A;  2MPX C;  1VQ4 A;  2EW3 A;  3LW5 E;  3BW1 A;  3E19 A;  2HBW A;  1OEB A;  1EIF A;  1QVF S;  1M8V A;  2GFU A;  2VAS A;  4M7D F;  1VQM Q;  1IGQ A;  1KQ1 A;  2J05 A;  4MZM A;  4XK8 E;  2M16 A;  3UPU A;  1GCQ C;  2L89 A;  3CCU T;  1OUL A;  4NL2 A;  3RMS A;  4E7J A;  1XJW B;  2KRN A;  4C0G A;  2XDB A;  4OB2 B;  1QVG S;  2B86 A;  3A8L B;  4F7U E;  5LJ5 d;  5LJ3 d;  1NPR A;  2CDT A;  2FPE A;  1EZZ B;  5I21 A;  4C0D C;  4RTZ A;  2ATC B;  4PFO A;  1OI1 A;  1WZO A;  2LQW A;  1YI2 Q;  4OB3 B;  1X2K A;  1YJW T;  1MMA A;  2BKD N;  4R56 A;  1S72 Q;  4MML A;  2QG9 B;  2DEQ A;  3L1A A;  2RF0 A;  4HCB A;  1UB4 A;  3JSC A;  3C95 A;  2QEX A;  2P0K A;  2O88 A;  2OJ2 A;  3MPU B;  3I55 A;  4M7A D;  2V8I A;  2LCC A;  3OYI A;  1BB9 A;  2DYI A;  3OB9 A;  3FC3 A;  2DL7 A;  1JRI A;  4RCB A;  2O9V A;  1AZG B;  4WTO B;  5GAO m;  2E5Q A;  2K79 A;  1UEB A;  5LJ5 j;  2D8J A;  4BI8 B;  4C8Q D;  4PFZ A;  1AVZ C;  4UC4 A;  2ZPH B;  1LVK A;  1RAH B;  2JMA A;  2FHD A;  5C0M A;  2EIF A;  4PJO G;  1K0S A;  2DXB A;  2VGN A;  1D0Z A;  4M77 B;  1FYN A;  2KAF A;  2MF2 A;  3FJP A;  2VWF A;  3OYE A;  1Q81 R;  3JB9 I;  4JLI A;  4FYW B;  2JOY A;  3JCM b;  2DTH A;  3RKW A;  2RJC A;  3OYJ A;  4FYY B;  4KRT A;  1N9S A;  2OTJ T;  1TSF A;  3HRU A;  4E7Z A;  2A36 A;  1J3T A;  3CCV A;  3MO8 A;  1VQP A;  1TU0 B;  3JV3 A;  1WA7 A;  4F14 A;  3M5A A;  3PFS A;  5EG2 A;  3G71 T;  2DIL A;  2CZ1 B;  3A98 A;  4XAX B;  4RTW A;  4HT8 A;  3HFO A;  3M4G A;  5FRO A;  3G4S A;  3CCM T;  3HFN A;  4M7D D;  1PG5 B;  3QJ6 A;  3QG1 A;  2EQU A;  2A7Y A;  3VRZ A;  4ANJ A;  3CCQ Q;  5ECA A;  5AYF A;  2LMJ A;  2MIO A;  3QJY A;  3ER0 A;  1YCS B;  3WXM B;  2AKK A;  2QQB A;  3OMC A;  2PZ1 A;  2K3B A;  2DYB A;  2PVO B;  5KYX A;  2EQI A;  1YJW A;  2RHX A;  4A63 B;  2D9T A;  4J9E A;  3BDL A;  4BY6 B;  2RJE A;  3O5Z A;  4M7A G;  3CC7 T;  1BCM A;  2MCN A;  1Q82 C;  3OYD A;  3M0U A;  1Y0M A;  4BDY A;  2RNA A;  1NLP C;  3CD6 Q;  5KYW B;  1OPK A;  2P4R A;  4F7U F;  5FU6 C;  1XOV A;  1UGP B;  4PK4 A;  3EAE A;  4C8Q G;  3RER A;  3JCM V;  4M77 A;  3SHW A;  5CIU A;  2YRD A;  4Z89 A;  1NJI U;  1M90 C;  4A4G A;  4Y92 A;  2E70 A;  2RA2 A;  3VS5 A;  5GAO p;  3I56 Q;  2CP5 A;  5DLO A;  2L3R A;  2LC4 A;  2KRM A;  1M3A A;  2X51 A;  1KSW A;  2XHC A;  1HYO A;  5GAN 8;  3JCM X;  1ZSZ C;  4RTT A;  4JZ3 A;  2D0Q B;  3CPW A;  1PCX A;  5CKD A;  4IUR A;  2EQJ A;  4HVU A;  3TRE A;  5CQX A;  5GAN 3;  4HCZ A;  3CCE Q;  1OYX A;  4LUE A;  3FDR A;  1W6X A;  1ZBJ A;  1VQO Q;  3X24 B;  4M78 G;  1KD1 C;  4L59 A;  2LTO A;  2FPD A;  4BB7 A;  5IHK A;  2RPN A;  2X4J A;  4DBH A;  3OYH A;  2W10 A;  4X9D A;  3QHS A;  2IG0 A;  3UAT A;  1NLO C;  2FB7 A;  5L23 A;  2LP5 A;  2MWO A;  4QVZ A;  2EYX A;  1VQ8 A;  1R77 A;  3O8V A;  1OZ3 A;  5IXF A;  2DFU A;  3LX7 A;  1BCO A;  4CC7 A;  4J6X A;  1BIA A;  2AZV A;  4XU0 A;  2DET A;  2FO0 A;  4PNO A;  4JLG A;  1CKB A;  1RLP C;  3H0I A;  5KYW A;  4PJO E;  4PJO C;  5FWC A;  2RQR A;  2JW4 A;  4Y28 E;  2GBQ A;  5GMK h;  2X9H A;  2ZGW A;  2JM9 A;  3QUI A;  2DK3 A;  4PJL A;  3NGP A;  4JJB A;  1YIT Q;  2OAU A;  2LX7 A;  3G6E T;  2PUO B;  4LDX A;  8ATC B;  1V76 A;  5A2Q E;  3VUB A;  1FXX A;  1VQ5 Q;  1X01 A;  2KSS A;  3BE3 A;  2DVE A;  2C06 A;  2GFA A;  3CC2 Q;  2RMO A;  2O2O A;  4OGC A;  1UJY A;  1SSH A;  4Q5W A;  1C1A A;  1LJO A;  1U06 A;  2RN8 A;  4XTZ A;  1KFZ A;  3I35 A;  3CME A;  3PE0 A;  5GAN 7;  2M1H A;  1FMW A;  5M9O A;  2L2P A;  2AIR B;  3L2V A;  5GMK m;  1WJS A;  1BBZ A;  3QZ5 B;  4RCC A;  1B3Q A;  5LJ3 h;  1JXM A;  3LWH A;  4QQD A;  4EPC A;  2C0O A;  3TU4 K;  1BU1 A;  2YSQ A;  1VQM A;  1B07 A;  2M0Y A;  4K11 A;  3CXC P;  4M77 D;  3VRY A;  2J6O A;  1QWE A;  3CBP A;  2WSE E;  2E1H A;  2AT1 B;  3RDV A;  2BZ8 A;  3VKI A;  1TUG B;  1TG0 A;  3MJX A;  1H8K A;  4BE0 A;  2OX7 A;  3LH5 A;  3SB2 A;  3TSW A;  4F17 A;  1W2B A;  1VA7 A;  1S1N A;  4DEX A;  3CMA T;  1PSF A;  2DRM A;  1VQP Q;  1YI2 A;  1BI3 A;  4E2F B;  1S72 A;  3A8O B;  1ZQ1 A;  4E7K A;  3QSU A;  4OP0 A;  3ZL7 C;  1YIJ Q;  5GAM h;  4PJM A;  2E64 A;  2VXF A;  1C0M A;  2RI2 A;  3C4S A;  2E65 A;  1M9S A;  2GQI A;  5IHN A;  1D0Y A;  3CD6 T;  1SG5 A;  4KBM B;  1C6V X;  2QK0 A;  3OYL A;  4KH1 B;  3V7S A;  2B8A A;  2EKH A;  1EX4 A;  2O4X B;  2RQU A;  4JJD A;  2WSF E;  2KRO A;  2XKO C;  4J9D A;  1AWW A;  2RI5 A;  1ZX6 A;  3PVQ A;  2FRY A;  1R0B G;  3L2W A;  3E2U A;  4XQ3 A;  4M78 E;  4M78 C;  1R8O B;  1DJ7 B;  3OA6 A;  2FVU A;  3QKJ A;  2EJF A;  4AG2 C;  2QQR A;  1VQL T;  1QP2 A;  2CRE A;  5D6Y A;  2OTL Q;  4QVC A;  4PJO F;  2ED1 A;  2GNC A;  2RHZ A;  2CYZ B;  1ACM B;  4RMO A;  5FRM A;  2RK2 A;  1OZ2 A;  5DM7 R;  2MAM A;  4BE2 A;  4ELZ C;  2KBT A;  4CC2 A;  1K0X A;  3I5S A;  3HTR A;  1VQO T;  3H0F A;  3MEU A;  1WDX A;  2LT4 A;  4LUD A;  3VU3 C;  3QII A;  1JQQ A;  3M0P A;  1UHC A;  2CP2 A;  3QXE B;  4RKU E;  4M77 G;  2DXT A;  3J7A F;  1VQ4 T;  1K8A U;  2J7I A;  1OOT A;  4JS4 A;  1UGV A;  4JRI A;  3OYC A;  2F5K A;  3HRS A;  2O9S A;  4J9H A;  4GLK A;  3N5B B;  4C92 E;  4C92 C;  2DEU A;  3VS7 A;  1VOM A;  2EYZ A;  5D6X A;  4V2S A;  3JCM e;  4FSX A;  3CCQ A;  3M54 A;  3NFC A;  2M9U A;  1Z9Q A;  3PIO A;  1Q86 R;  4LE9 A;  1M5Q 1;  4HA8 A;  2E5K A;  4EDU A;  2WAC A;  3CEY A;  3X25 B;  2CT3 A;  2F2W A;  4AT1 B;  3S3O A;  2DLP A;  3FLG A;  4MDW A;  2DER A;  3OQ5 A;  4C92 B;  2HAX A;  2O4X A;  2W0Z A;  3TQ7 P;  2QYZ A;  2KT8 A;  4AG1 C;  2QEX T;  2DZC A;  1E7O A;  2EKO A;  3I55 T;  4XTX A;  3V7C A;  4HKE A;  4RTX A;  3JB9 H;  1VQ9 Q;  3GOX A;  4FCY A;  2JXB A;  3VYG A;  2MMP A;  2LQN A;  2V8K A;  4BDZ A;  2QI2 A;  1KQ2 A;  1PRM C;  4C8Q F;  4J8O A;  4FW2 A;  2K5I A;  1KG1 A;  1F1B B;  4IUT A;  4OMQ A;  3SDZ A;  2O31 A;  1IGU A;  3I56 A;  1X6O A;  2HKQ B;  1I1J A;  3THK A;  1B34 B;  1KQS P;  2ZPI B;  2X35 A;  1VIF A;  1HD3 A;  2PU9 B;  2L3Q A;  3C94 A;  2RO0 A;  1VQK Q;  1OX8 A;  3M0S A;  1N8R R;  2KYB A;  2HQX A;  4PL6 A;  3SEM A;  1GXI E;  3HRT A;  1RAI B;  1GBQ A;  1PKS A;  1OV3 A;  3P8H A;  3CCE A;  2GF7 A;  4J9F A;  4FT4 A;  1UGR B;  2R58 A;  2RJF A;  1ZUK A;  4FIB A;  3RES A;  3CME Q;  5GAO l;  4EMG A;  1FMK A;  2XK0 A;  2RH2 A;  1K76 A;  3GPL A;  5FWB A;  3HKS A;  4M78 F;  1WHK A;  3CCV T;  4DQ2 A;  1VQP T;  5GAN g;  3BY7 A;  2QTX A;  2PUK B;  5CVI A;  4OML A;  4HVW A;  5CKE A;  1UGQ B;  2E12 A;  2JMC A;  3G4S T;  5GMK j;  4E7I A;  3REB B;  4C92 A;  5HK0 A;  2YUQ A;  1WHM A;  2YDL A;  2DIQ A;  4PKC C;  1BIB A;  2YUO A;  3RIR A;  3HP9 A;  3ASK A;  1JU5 C;  3NPF A;  2LNV A;  1Y7X A;  3OW2 A;  1QCO A;  3UA6 A;  1QVF P;  3OYY A;  1X69 A;  1R0C B;  1RAE B;  2CKK A;  3OBY A;  1WJQ A;  1Q86 C;  1YIT A;  4N4G A;  1Q7Y R;  2V8J A;  4JRQ A;  2L0A A;  2XMF A;  1QVG P;  5CR2 A;  1WQ7 A;  1YN8 A;  1K9M R;  2PNI A;  3H6Z A;  3H8Z A;  2KNB B;  1VQ5 A;  1B34 A;  5GAM d;  1TUD A;  1SEM A;  2K2M A;  1YJ9 Q;  2HCK A;  3CC2 A;  4M77 E;  4M77 C;  3JAM E;  3CCJ Q;  2EQM A;  1M4Z A;  2LDM A;  4XU3 A;  5LJ3 j;  5CKF A;  2ZCF B;  2FYK A;  3H9N A;  4ZGJ B;  2KEA A;  1M1K R;  2KK4 A;  3NTK A;  4N4H A;  5GJV B;  2RQV A;  1YCY A;  3EG1 A;  4LDW A;  3EH1 A;  1M30 A;  1G3W A;  1N9R A;  1X27 A;  4MMK A;  3CQT A;  1U3O A;  1GRI A;  2BZX A;  3X28 B;  3ZEH A;  1X43 A;  2LJ0 A;  3NMZ C;  1YJN Q;  4XTU A;  3QWX X;  1RLQ C;  4KGX B;  1WYX A;  1Y71 A;  2OAW A;  3CC4 A;  1RAC B;  2YT6 A;  3GNG A;  2C0I A;  4D8K A;  1GFD A;  3MCA B;  2K2V A;  5GAM j;  2CP0 A;  4A4K A;  3FJ5 A;  3WVE B;  5GAN e;  2HQE A;  3JB9 G;  5FRN A;  4KUD K;  1N8R C;  2DX1 A;  3R6N A;  1VQ7 Q;  4XTW A;  3GP8 A;  3PGG A;  2DD5 A;  5D7U A;  2M51 A;  4M78 D;  3CPW S;  1KHI A;  1YIJ A;  2KI7 A;  2X3W D;  2FL7 A;  3KXT A;  2KXC A;  4BY6 C;  3UWN A;  1WXB A;  4DOV A;  5CO7 A;  2E6Z A;  4BE1 A;  1VQ8 T;  1D1C A;  4HXJ A;  1Q95 G;  3NTH A;  1UEC A;  3M57 A;  2LX9 A;  3MEW A;  4X9C A;  2K3X A;  2XIC A;  3OYF A;  4CI0 C;  1M8M A;  4A53 A;  2D0N A;  3SD4 A;  1Q82 U;  4CC4 B;  4KUL A;  1UFF A;  3J80 E;  2VXE A;  2COZ A;  3C12 A;  4J9G A;  5FU7 B;  3KFV A;  1MGQ A;  1ZSG A;  3EFS A;  5KCH A;  5J39 A;  1QP3 A;  1G83 A;  1KJW A;  5LJ5 g;  3DLL A;  4J5Y A;  2L3P A;  5KH6 A;  4RG8 A;  2KGT A;  2DL4 A;  5CQY A;  5LL6 S;  2GCX A;  2I0N A;  4C92 D;  1M90 U;  2ZZD A;  3CPF A;  2QAZ A;  1M2O A;  3L2U A;  2JTF A;  2OTL A;  1D0X A;  4KUI A;  2AHJ B;  3A8H B;  1WNL A;  4PLL A;  3RR6 A;  3HPW A;  2QA4 Q;  1Q7Y C;  2E10 A;  1JXO A;  3CCR Q;  4R55 A;  1FMV A;  3CBM A;  1K9M C;  4OGE A;  1T3S A;  3CME T;  3JCM J;  2HD0 A;  2YRC A;  4PJJ A;  4C5H A;  2DTO A;  4FT2 A;  2DXU A;  2PTK A;  4EMK B;  1TWB A;  1Z9Z A;  2HBP A;  2KR3 A;  2NUZ A;  1WGS A;  4DEY A;  5GAN f;  2QAS A;  3H0H A;  2YUN A;  2LQ8 A;  3D7S B;  3PVL A;  4RTU A;  1KD1 U;  3SWN B;  4M77 F;  5GMK i;  1M1K C;  1RAG B;  4N0A A;  1T0J A;  1VQM T;  1BI1 A;  1YNZ A;  2CH4 W;  2KYM A;  1AZE A;  4HVV A;  2DNU A;  4F16 A;  2M0O A;  1MMG A;  3GF5 A;  1Q81 C;  4C5E A;  2E3I A;  1YI2 T;  1S72 T;  3CCL Q;  4FL6 A;  5CKH A;  2CZ6 B;  2Y4Y A;  2FPF A;  1KC8 R;  2XD0 A;  5GMK l;  3MET A;  4E7H A;  4GLM A;  1KIK A;  1I81 A;  2X3X D;  4FYV B;  5GAN 6;  2ABL A;  2YHT A;  1W2B S;  4JPB W;  3VV0 A;  4A4H A;  1VQ9 A;  2JNG A;  5AT1 B;  2ZPG B;  3C0C A;  1U1T A;  1MV0 B;  1VQN A;  5GAO r;  5LJ5 e;  5LJ3 e;  4C92 G;  5C6S A;  1LPL A;  4OMF B;  1PSE A;  5HCK A;  4JRP A;  3CCS Q;  3RUX A;  3VJP A;  2MYS A;  1K73 R;  4PFP A;  3EGD B;  3VS1 A;  4Z8A A;  1W2B P;  4EMK A;  3KUF A;  1GCP A;  1VQK A;  1M2V B;  3GBQ A;  1D3B B;  1MUZ A;  4IIM A;  2ZPB B;  4PLI A;  3SWN A;  3OS0 A;  2DJQ A;  1M27 C;  2RHI A;  2EYW A;  3QYG B;  3AHU A;  1O75 A;  1SKU B;  1IB8 A;  2X4X A;  1SRM A;  4M75 B;  1X6B A;  2QTV A;  2BUD A;  3L2Q A;  1W4S A;  1AT1 B;  2P4T A;  1ZUU A;  3X20 B;  2RQT A;  3PMT A;  3DKM A;  1HSQ A;  2LCL A;  1LOJ A;  2LVM A;  1NEG A;  1I4K 1;  3T9N A;  1YHQ Q;  2MOX A;  3ZBD A;  3CC4 Q;  4ZN3 A;  3I5R A;  3JCM c;  3E9F A;  2ROT A;  3PNW C;  3CCQ T;  3DB4 A;  4LD6 A;  3V8J A;  4D8D A;  2ESW A;  3JCM g;  3FEO A;  2EPD A;  2JM8 A;  2QGF B;  2EAY A;  5GJW B;  4ZGE B;  2D1X A;  2LZ6 B;  2HQH A;  2CH4 A;  1EFN A;  2QXF A;  2CZ7 B;  4FW1 A;  3OYK A;  1QKW A;  3OYN A;  5LJ5 f;  4OMO A;  3VUZ A;  2AKL A;  2JS2 A;  1WXT A;  1BI2 A;  4DBF A;  3EGD A;  1D1A A;  2DTI A;  1QCN A;  1YJ9 A;  3RKX A;  3RKY A;  2DRK A;  3OS1 A;  3M53 A;  3OYG A;  1KC8 C;  1M2V A;  3CCJ A;  2H8H A;  3CCU Q;  1D3B A;  2E3H A;  1PWT A;  4J6Y A;  1VUB A;  1WFW A;  2RK1 A;  3M4Y A;  2PVG B;  1H64 1;  1IHW A;  4KH0 B;  3I56 T;  1YWP A;  4A4F A;  1A0N B;  2BE9 B;  4M75 A;  2DXC A;  3RBB B;  1YJN A;  4QT7 A;  1ZUY A;  1MHN A;  3CXC A;  3EHR A;  2COW A;  1HXD A;  3JCM P;  2R5M A;  5KE2 A;  4A4E A;  1VQ6 A;  1YWO A;  2KXD A;  1K73 C;  2X4Y A;  1GBR A;  3CCE T;  3EG9 B;  4R0K A;  3JRZ A;  1IRE B;  4BUG A;  1XTD A;  4X34 A;  1VQ7 A;  3QYH B;  3JB9 F;  1H3Z A;  2EGC A;  2DL3 A;  1PD0 A;  2WSC E;  2K5F A;  2EQK A;  1I8F A;  1UUE A;  3V7R A;  4HCC A;  4B9W A;  1PRL C;  2X4W A;  4DBR A;  2G6F X;  3ME9 A;  1YFN A;  3M0R A;  3M55 A;  3PT9 A;  2E6N A;  5HY6 A;  4M7D B;  4TVR A;  2A37 A;  5FW9 A;  4Y91 A;  1OPL A;  2ZAE A;  3E1S A;  2A28 A;  2J6K A;  2VB6 A;  4YTL A;  2OTJ Q;  4ESR A;  2IVW A;  7AT1 B;  2HZY A;  2F2X A;  3L42 A;  1N6A A;  1UE9 A;  3MP6 A;  3QPH A;  4HT9 A;  1I5O B;  1YIT T;  4E6R A;  2DPP B;  1U1S A;  1ZA1 B;  2JTE A;  5GAO n;  2NUP B;  4IUV A;  3G71 Q;  1NM7 A;  4L5G A;  1VQ5 T;  1PM3 A;  3QZ9 B;  3M56 A;  3OW2 S;  3QDF A;  5IAY A;  3CCM Q;  3UA7 A;  3CC2 T;  2QA4 A;  1H3H A;  2KT1 A;  2RHU A;  1VQN Q;  2EYQ A;  1XQH A;  3OY9 A;  3CCR A;  2P0P A;  4E7S A;  2JT4 A;  5A0D A;  1I07 A;  1IZ6 A;  1RI9 A;  3EG9 A;  2Y4X A;  1QWF A;  1E6G A;  4BAC A;  4B6M A;  4ZGD B;  4LDV A;  4KT0 E;  4J7I A;  1NE8 A;  9ATC B;  1W70 A;  3S3N A;  3PIP A;  2E4H A;  2V1Q A;  4WF2 A;  2YLB A;  3CC7 Q;  4AMC A;  2DE0 X;  1SHF A;  3FB9 A;  1BI0 A;  4XTV A;  3CC4 T;  1JJ2 A;  1E6H A;  3TEE A;  5IT9 E;  2ECZ A;  4NL3 A;  2OI3 A;  6AT1 B;  4NOY A;  3EGX B;  3QWY A;  3JCM f;  2IIM A;  1RUW A;  2DO3 A;  4C5G A;  2P84 A;  4M7D A;  2DZ9 A;  3MP1 A;  5DLQ E;  1TH7 A;  2VYT A;  4O5V A;  5KYU B;  5GAO q;  3CCL A;  2FRW A;  2K5L A;  4P5N A;  4EIK A;  3JB9 D;  1G5V A;  5HKC A;  1KHC A;  1YIJ T;  3OBW A;  1I0C A;  2KRS A;  2FZK B;  2LQK A;  1WHL A;  3M59 A;  5GAN 4;  1NG2 A;  2V1R A;  1UGS B;  2RHY A;  2NUP A;  1Q86 U;  3TVT A;  1X75 C;  5IH2 A;  2HNI A;  3QDR B;  5I2S A;  3FRN A;  4ME7 A;  3TSZ A;  2ENM A;  2MK5 A;  3M0Q A;  1Q82 R;  3CCS A;  1KQS A;  4C92 F;  2Y90 A;  2NYS A;  2CP3 A;  2LJ1 A;  3EG3 A;  5KE3 A;  2RJD A;  3MP8 A;  4QKU A;  1IO6 A;  3EFR A;  2OTL T;  2DKG A;  4D6W A;  2LT1 A;  1IRX A;  2DVJ A;  3GLX A;  1M90 R;  1T3L A;  4F7U B;  3KBG A;  3INZ A;  3URG A;  4II1 A;  2DF6 A;  1AEY A;  3UT1 A;  5KYX B;  2DAQ A;  2HSE B;  4J9I A;  4C0D B;  4CC3 A;  1QVP A;  4OB0 B;  2BIV A;  2L8D A;  2R5A A;  3EGX A;  2DMO A;  1NJI R;  2F5T X;  2EFI A;  2FG0 A;  4RTV A;  4J9C A;  3TCJ A;  2JZ2 A;  2KE9 A;  2PQW A;  4N0A C;  5KYU A;  4X1V A;  1YHQ A;  2CUD A;  1N8R U;  1UTI A;  5KCO A;  1SPK A;  1WHG A;  2DBM A;  2DIG A;  2ROL A;  1VQ6 Q;  2MWP A;  3G6E Q;  4O6J A;  2VVK A;  3EFO B;  4M75 G;  1AWX A;  1K1Z A;  4FM4 B;  1KD1 R;  4XTY A;  3VS3 A;  2XU8 A;  2COY A;  3S3M A;  3R6O A;  1QVF A;  4LXC A;  1M1G A;  3LYI A;  3GNF B;  2JVV A;  2KY9 A;  4BI3 A;  3NHN A;  2RD1 A;  1QKX A;  5FU7 C;  3JB9 J;  1G2B A;  2JS0 A;  1QVG A;  1OQK A;  4OMP A;  3ZFJ A;  3VYH B;  2KQW A;  2EBP A;  2H3E B;  1WPY A;  1VQ9 T;  4KGZ B;  1BK2 A;  2EGE A;  3CCU A;  3A5Z B;  3CPW P;  1OU8 A;  4PJN A;  1GCQ A;  1VQN T;  1LCK A;  2DBK A;  4C0Z A;  4XU1 A;  1MNE A;  2FZC B;  2V26 A;  1HK9 A;  2MI6 A;  4F7U A;  1WJR A;  4J9B A;  5LJ3 g;  4LNP A;  3CMA Q;  4EMK C;  3LLR A;  4EMH A;  1Q7Y U;  1NEB A;  2DA9 A;  2CSQ A;  1ZA2 B;  1UDL A;  5IXB A;  1K9M U;  4QVD A;  1AOJ A;  3JCM Q;  1VQK T;  3EHQ A;  2JTM A;  4ELY C;  1JEG A;  2XG8 D;  1UJ0 A;  2ED0 A;  1K9A A;  3H41 A;  4LDU A;  5GAN h;  3SWN C;  2CGH A;  3UDC A;  1U8R A;  3J81 E;  5KYY B;  1ABQ A;  1AHJ B;  1QLY A;  2A3L A;  3L2Z A;  2HKN A;  4IUP A;  3VS0 A;  1VYU A;  2F1L A;  1RAA B;  2L3S A;  5A0G A;  1M1K U;  3EFO A;  4IUU A;  1V1C A;  2VKN A;  2M02 A;  5GAM g;  4MDX A;  2BTT A;  2VV5 A;  1NZ9 A;  2EGA A;  4JZ4 A;  8AT1 B;  1JO8 A;  3MKD A;  2CT4 A;  3V8K A;  5I11 A;  1M3C A;  1Q81 U;  5GMK e;  2SRC A;  4WCI A;  5FU6 B;  1W1F A;  1NJI C;  1VQL Q;  1FX7 A;  1NPP A;  3JCM d;  2HSP A;  3HSB A;  3BDU A;  2FZG B;  5J3B A;  1AD5 A;  2QGG A;  4JJC A;  3PMI A;  1N5Z A;  3FIF A;  1WHH A;  4JJN K;  2OTJ A;  3QO3 A;  3OS5 A;  3EH2 A;  4AFZ C;  2F2V A;  2HL3 A;  3OSS C;  1WXU A;  4Z88 A;  4RUG A;  2K4Y A;  3RMQ A;  1I5L A;  4BD3 A;  2QQ9 A;  1Y96 B;  1ABO A;  5J26 A;  3RNJ A;  2H3J A;  1VIE A;  3G71 A;  1ZSZ B;  2JJ9 A;  1VQ4 Q;  3VS4 A;  4M7D G;  4DA4 A;  3REA B;  1YJ9 T;  3CCM A;  1D09 B;  2HEQ A;  1PC0 A;  2QDY B;  3NTI A;  4DOW A;  3CCJ T;  1ARK A;  1UHF A;  2RQW A;  1QCF A;  2QQA A;  2L5Q A;  5A0L A;  4JDS A;  2O01 E;  2A0F B;  5KYY A;  2XI9 A;  1ZHI A;  1WLP B;  2G3R A;  3X26 B;  1YP5 A;  2K9G A;  4M75 E;  4M75 C;  2RB6 A;  3MEA A;  2DL5 A;  1UG1 A;  3OSV A;  2CUB A;  2CSI A;  2GTJ A;  1YJN T;  1VYT A;  1SSF A;  1TTH B;  2EJG A;  3CC7 A;  3A8M B;  2BE7 D;  1G3T A;  2JUF A;  2QEX Q;  2R57 A;  1VQ6 T;  3OYB A;  3I55 Q;  5GAM e;  1AWO A;  1QQJ A;  1P92 A;  2YWW A;  1LNX A;  4LN2 A;  4F04 B;  2GQV A;  4KGV B;  2VC8 A;  2EJ9 A;  4PJO B;  2K3Y A;  2KVQ G;  5GAN 2;  1VQ7 T;  3VS2 A;  2HL5 C;  2K57 A;  3CXC S;  4QQ6 A;  4QW2 A;  4ZNX A;  1H92 A;  1NYF A;  1G8X A;  2VUB A;  2D6F A;  4BI4 A;  2AK5 A;  3HHT B;  1K8A R;  4FYX B;  5D6W A;  1TUC A;  3P8D A;  1MMN A;  1Y96 A;  2LCS A;  1SF9 A;  5LJ5 h;  1BYM A;  1PD1 A;  1ZSZ A;  4N4I A;  3OYA A;  2EWN A;  4A54 A;  3JCM W;  1BKB A;  3EG2 A;  1HJD A;  1PHT A;  4M7A E;  4M7A C;  1IHV A;  1QW1 A;  1Y57 A;  2C0T A;  1ZLM A;  2NWM A;  2DL8 A;  4J83 A;  3A8G B;  2EVR A;  3ULR B;  1TS9 A;  1KC8 U;  2Z0W A;  3CBO A;  5LJ3 f;  4AFS C;  2DM1 A;  2JN0 A;  5HK3 A;  1ZBX A;  1TOV A;  3CCV Q;  4FSS A;  3WVD B;  2NUT B;  4ZN1 A;  1RAD B;  2DJZ A;  4C8Q E;  4C8Q C;  3EGU A;  5CKB A;  4OF1 A;  3MHX A;  5IN1 A;  1K4U S;  1AWJ A;  4M7A B;  1O9S A;  3G4S Q;  4L6V 5;  2QA4 T;  2KMT A;  5CAI A;  2I2L A;  4ATO A;  2EYY A;  3CCR T;  4AFU C;  5I2M A;  5FLX E;  2ZPE B;  4C5I A;  4XU2 A;  2FEI A;  2RI3 A;  5GAM f;  4PJO A;  1K73 U;  1FWZ A;  3GIB A;  4C8Q B;  1YJW Q;  3DB3 A;  4QQG A;  3LGL A;  1SRL A;  1MND A;  1MV3 A;  3IQL A;  1OU9 A;  2CP7 A;  5IHI A;  4FU6 A;  3UF4 A;  5GAN 5;  1JBM A;  1NYG A;  1NBE B;  2AZS A;  3G6E A;  5I22 A;  2DD4 A;  3F70 A;  4F7U G;  3QBY A;  1SHG A;  5EC7 A;  1KK7 A;  4J7F A;  2XDD A;  1CKA A;  2YUP A;  1X6G A;  1N27 A;  1GFC A;  4M75 F;  1WIE A;  1Y07 A;  2CP6 A;  4IKF A;  5GAN d;  4M7D E;  4M7D C;  2XID A;  2CS7 A;  4JS5 A;  2VGM A;  2YXY A;  2CZ0 B;  3CCL T;  2YRV A;  3LGF A;  4E7L A;  1JJ2 S;  4IIO A;  3OYM A;  2QQS A;  1GL5 A;  3EG0 A;  4JRK A;  4M78 B;  4NS5 A;  3U23 A;  1OX9 A;  4ORZ A;  4AFQ C;  4LD9 K;  4MZP A;  1QMC A;  1XNI A;  1RAB B;  3MEV A;  2K7A A;  1MMD A;  1RAF B;  2NUT A;  2GTO A;  4LDY A;  2SEM A;  3LWI A;  2J06 A;  4HCK A;  1YBY A;  4OB1 B;  4M7A A;  2GGR A;  3I9Q A;  1PNJ A;  5CCA A;  1K8A C;  1JJ2 P;  1TXQ A;  1WHJ A;  1M3B A;  5GAN j;  1VYV A;  3CMA A;  3CCS T;  3M9Q A;  2A08 A;  4J6W A;  3E9G A;  3V8L A;  3P8B B; 
#chains in the Genus database with same CATH homology
 4F7U B;  3KBG A;  4OVA A;  3INZ A;  4IUQ A;  3URG A;  4II1 A;  2LQ8 A;  4C8Q A;  3OS2 A;  4BE0 A;  1KD1 U;  3UT1 A;  3SB2 A;  1W2B A;  3SWN B;  4M77 F;  5GMK i;  2DAQ A;  4C0D B;  1M1K C;  1WQW A;  4N0A A;  1QVP A;  1VQM T;  1BI1 A;  3LH0 A;  2RM4 A;  3SFM A;  3CMA T;  4OB0 B;  4B9X A;  2BIV A;  4M7A F;  2L8D A;  2R5A A;  1PSF A;  3HL8 A;  1YI2 A;  4ZTJ A;  1BI3 A;  3DLM A;  3L2R A;  2F5T X;  2EFI A;  1S72 A;  3A8O B;  3Q1J A;  1ZQ1 A;  3CD6 A;  4E7K A;  1KQS S;  2LRQ A;  4ZTF A;  3QSU A;  4OP0 A;  3TCJ A;  2YLC A;  2JZ2 A;  2PQW A;  5GAM h;  1G5V A;  2NLU A;  4N0A C;  2M0O A;  2E64 A;  2VXF A;  1YHQ A;  1JB0 E;  1N8R U;  5KCO A;  3GF5 A;  2PVD B;  3OMG A;  2RI2 A;  2DIG A;  1Q81 C;  4C0F A;  2MWP A;  3C4S A;  4C5E A;  4O6J A;  2E65 A;  1M9S A;  2KDS A;  1YI2 T;  5DY9 A;  1V29 B;  1S72 T;  4M75 G;  3JCM h;  3M58 A;  3CD6 T;  4FL6 A;  5CKH A;  2CZ6 B;  4FM4 B;  4KBM B;  2Y4Y A;  4XTY A;  1RL2 A;  2XU8 A;  5GMK l;  2XD0 A;  4Z02 A;  3OYL A;  1YHQ T;  3V7S A;  2XDP A;  3MET A;  4E7H A;  3S3M A;  3R6O A;  1QVF A;  1I81 A;  2B8A A;  5GAN 6;  4RG2 A;  1M1G A;  2YHT A;  3LYI A;  3GNF B;  1W2B S;  4E47 A;  3VV0 A;  2JVV A;  2KY9 A;  2O4X B;  4M78 A;  4A4H A;  4JUV A;  5L8R E;  4BI3 A;  1VQL A;  2ZPF B;  2RD1 A;  1VQ9 A;  5FU7 C;  1M1F A;  2WSF E;  2XKO C;  2RI5 A;  2JNG A;  3JB9 J;  2ZPG B;  1QVG A;  1U1T A;  3L2W A;  1RI0 A;  4M75 D;  3G7Z A;  4PJO D;  4XQ3 A;  1VQN A;  4M78 E;  4M78 C;  5GAO r;  1R8O B;  1DJ7 B;  3ZFJ A;  3OA6 A;  2FVU A;  3QKJ A;  5LJ5 e;  5LJ3 e;  2EJF A;  2QQR A;  3VYH B;  4C92 G;  4MZT A;  1VQL T;  5C6S A;  2KQW A;  4VUB A;  2P0Q A;  1WPY A;  3PTA A;  1QP2 A;  4OMF B;  5D6Y A;  1VQ9 T;  1VQO A;  1PSE A;  4QVC A;  5CK9 A;  2E41 A;  4PJO F;  4JRP A;  3BFM A;  3RUX A;  3VJP A;  2RHZ A;  2CYZ B;  3S6W A;  4RMO A;  5FRM A;  2RK2 A;  3CCU A;  1OZ2 A;  2F69 A;  3A5Z B;  4GY5 A;  5DM7 R;  1G3Y A;  2MAM A;  4CRI A;  1G3S A;  3GLX A;  4EMK A;  1VQ4 A;  3KUF A;  4BE2 A;  1VQN T;  4ELZ C;  4C0Z A;  4XU1 A;  3LW5 E;  1VQK A;  3BW1 A;  3E19 A;  1EIF A;  1QVF S;  1VQO T;  1M8V A;  1D3B B;  1HK9 A;  2GFU A;  2MI6 A;  4F7U A;  3MEU A;  4M7D F;  1WJR A;  2LT4 A;  5LJ3 g;  1KQ1 A;  4XK8 E;  4MZM A;  3VU3 C;  2M16 A;  3QII A;  3UPU A;  2ZPB B;  2L89 A;  4PLI A;  4EMK C;  3LLR A;  3SWN A;  4EMH A;  3CCU T;  1Q7Y U;  3OS0 A;  4NL2 A;  3QXE B;  4RKU E;  2RHI A;  4M77 G;  2DXT A;  3QYG B;  3RMS A;  4C0G A;  4E7J A;  1VQ4 T;  1K8A U;  2XDB A;  3J7A F;  4OB2 B;  1QVG S;  3AHU A;  1K9M U;  1O75 A;  4QVD A;  3JCM Q;  4JS4 A;  1VQK T;  2X4X A;  2JTM A;  3A8L B;  4ELY C;  4F7U E;  4JRI A;  5LJ3 d;  4M75 B;  1NPR A;  2XG8 D;  5LJ5 d;  2F5K A;  3HRS A;  3OYC A;  2BUD A;  4GLK A;  1W4S A;  4LDU A;  3L2Q A;  5GAN h;  2P4T A;  3SWN C;  5I21 A;  2CGH A;  3UDC A;  4C0D C;  3N5B B;  1U8R A;  4C92 E;  4C92 C;  3J81 E;  1OI1 A;  5D6X A;  3X20 B;  4V2S A;  3PMT A;  3JCM e;  1YJW T;  1AHJ B;  4FSX A;  3DKM A;  4OB3 B;  3CCQ A;  2BKD N;  2LCL A;  1LOJ A;  2A3L A;  3L2Z A;  3M54 A;  3NFC A;  4IUP A;  4MML A;  2LVM A;  4R56 A;  2M9U A;  3PIO A;  2DEQ A;  3L1A A;  5A0G A;  1I4K 1;  1M1K U;  1M5Q 1;  4HA8 A;  3T9N A;  1UB4 A;  3JSC A;  4IUU A;  4HCB A;  3JB9 D;  3ZBD A;  3C95 A;  4EDU A;  5GAM g;  2P0K A;  2QEX A;  2WAC A;  3CEY A;  4ZN3 A;  4MDX A;  3JCM c;  3X25 B;  2VV5 A;  3I55 A;  1NZ9 A;  3E9F A;  4M7A D;  2V8I A;  3PNW C;  2LCC A;  3CCQ T;  3S3O A;  3FLG A;  3OYI A;  3DB4 A;  4LD6 A;  4MDW A;  3V8J A;  3OQ5 A;  3OB9 A;  3FC3 A;  1JRI A;  3V8K A;  4C92 B;  4RCB A;  3JCM g;  2O4X A;  3FEO A;  2HAX A;  1Q81 U;  5GMK e;  2EAY A;  5GAO m;  4ZGE B;  2QEX T;  2DZC A;  2E5Q A;  3I55 T;  2EKO A;  5FU6 B;  1UEB A;  4XTX A;  3V7C A;  5LJ5 j;  1NJI C;  4HKE A;  1FX7 A;  1NPP A;  3JB9 H;  3JCM d;  4BI8 B;  4C8Q D;  3GOX A;  3VYG A;  2MMP A;  3HSB A;  3BDU A;  2QXF A;  4UC4 A;  5J3B A;  2CZ7 B;  2ZPH B;  2V8K A;  3OYK A;  3OYN A;  4BDZ A;  5LJ5 f;  2QI2 A;  1KQ2 A;  3PMI A;  3VUZ A;  2FHD A;  3FIF A;  5C0M A;  4C8Q F;  2EIF A;  4J8O A;  2K5I A;  4PJO G;  4JJN K;  1KG1 A;  2OTJ A;  1BI2 A;  3QO3 A;  2DXB A;  4IUT A;  2VGN A;  2DTI A;  3OS5 A;  3SDZ A;  4M77 B;  1YJ9 A;  2KAF A;  3RKX A;  2MF2 A;  3OSS C;  3RKY A;  3OS1 A;  3FJP A;  3I56 A;  1X6O A;  3M53 A;  3OYE A;  3OYG A;  3JB9 I;  1KC8 C;  2K4Y A;  4JLI A;  3JCM b;  2JOY A;  3RMQ A;  3CCJ A;  1I5L A;  2DTH A;  3RKW A;  4BD3 A;  2QQ9 A;  1D3B A;  1Y96 B;  1B34 B;  5J26 A;  2RJC A;  3OYJ A;  2H3J A;  1VIE A;  2X35 A;  2ZPI B;  1VIF A;  3G71 A;  2PU9 B;  1VUB A;  4J6Y A;  2RK1 A;  4M7D G;  1N9S A;  2OTJ T;  3C94 A;  2RO0 A;  4DA4 A;  3HRU A;  3M4Y A;  2PVG B;  1H64 1;  2HQX A;  1YJ9 T;  3CCM A;  4PL6 A;  3I56 T;  1GXI E;  2QDY B;  3HRT A;  3NTI A;  4A4F A;  3CCV A;  3MO8 A;  4DOW A;  3P8H A;  4M75 A;  3CCJ T;  1VQP A;  2DXC A;  3CCE A;  2GF7 A;  4FT4 A;  2QQA A;  2L5Q A;  1UGR B;  1YJN A;  3M5A A;  3PFS A;  2R58 A;  2RJF A;  4FIB A;  5EG2 A;  3RES A;  3G71 T;  5A0L A;  1MHN A;  2CZ1 B;  4JDS A;  2O01 E;  4XAX B;  3CXC A;  2XI9 A;  1ZHI A;  4HT8 A;  2G3R A;  3HFO A;  3X26 B;  5GAO l;  1HXD A;  3JCM P;  3M4G A;  2R5M A;  5FRO A;  4EMG A;  5KE2 A;  3G4S A;  3CCM T;  4M75 E;  4M75 C;  2XK0 A;  2RH2 A;  3HFN A;  2RB6 A;  3MEA A;  4A4E A;  3GPL A;  1VQ6 A;  4M7D D;  3HKS A;  4M78 F;  3CCV T;  1K73 C;  3QJ6 A;  4DQ2 A;  2X4Y A;  3OSV A;  3QG1 A;  2EQU A;  5GAN g;  1VQP T;  3CCE T;  2A7Y A;  3BY7 A;  1YJN T;  5AYF A;  3JRZ A;  2QTX A;  1SSF A;  2PUK B;  2EJG A;  5CVI A;  3QJY A;  3CC7 A;  3ER0 A;  3WXM B;  1IRE B;  5CKE A;  4BUG A;  1XTD A;  2QQB A;  3OMC A;  4X34 A;  1UGQ B;  2E12 A;  3A8M B;  1VQ7 A;  3QYH B;  2PVO B;  3G4S T;  5GMK j;  1G3T A;  2JUF A;  4E7I A;  1YJW A;  2R57 A;  4C92 A;  2RHX A;  1VQ6 T;  5HK0 A;  3JB9 F;  2D9T A;  3OYB A;  1H3Z A;  5GAM e;  3BDL A;  1P92 A;  1LNX A;  4BY6 B;  2RJE A;  2GQV A;  4M7A G;  2WSC E;  2K5F A;  2EQK A;  2EJ9 A;  2VC8 A;  1I8F A;  2DIQ A;  2K3Y A;  4PKC C;  4PJO B;  1BIB A;  3V7R A;  4HCC A;  3CC7 T;  4B9W A;  1Q82 C;  3RIR A;  3OYD A;  3HP9 A;  2KVQ G;  3ASK A;  5GAN 2;  1VQ7 T;  4BDY A;  2X4W A;  2K57 A;  1Y7X A;  2LNV A;  3CXC S;  3OW2 A;  4QQ6 A;  3ME9 A;  4QW2 A;  3OYY A;  3M55 A;  4F7U F;  5FU6 C;  1XOV A;  3PT9 A;  1UGP B;  2E6N A;  2CKK A;  5HY6 A;  4M7D B;  4TVR A;  3EAE A;  3OBY A;  1WJQ A;  4C8Q G;  1Q86 C;  1YIT A;  4N4G A;  4Y91 A;  3RER A;  2VUB A;  3JCM V;  4M77 A;  2D6F A;  4BI4 A;  2V8J A;  4JRQ A;  3E1S A;  3HHT B;  5CIU A;  5CR2 A;  4YTL A;  1WQ7 A;  1NJI U;  4A4G A;  1M90 C;  5D6W A;  3H6Z A;  3H8Z A;  2IVW A;  2E70 A;  3P8D A;  1VQ5 A;  1Y96 A;  1B34 A;  2RA2 A;  5LJ5 h;  5GAM d;  1BYM A;  3L42 A;  1N6A A;  3MP6 A;  3QPH A;  4HT9 A;  4N4I A;  3CC2 A;  4M77 E;  4M77 C;  5GAO p;  3OYA A;  2EWN A;  4A54 A;  3JCM W;  1YIT T;  1BKB A;  3JAM E;  5DLO A;  2L3R A;  2EQM A;  4M7A E;  4M7A C;  2DPP B;  1M4Z A;  1QW1 A;  2LC4 A;  1U1S A;  5GAO n;  2LDM A;  4XU3 A;  5LJ3 j;  4IUV A;  5CKF A;  2ZCF B;  2XHC A;  2FYK A;  3JCM X;  5GAN 8;  4J83 A;  4ZGJ B;  3A8G B;  4L5G A;  2KK4 A;  1VQ5 T;  3NTK A;  4N4H A;  2D0Q B;  1YCY A;  4LDW A;  3QZ9 B;  3M56 A;  1G3W A;  1N9R A;  3CPW A;  3OW2 S;  1KC8 U;  3CBO A;  4MMK A;  5IAY A;  5LJ3 f;  5CKD A;  3CC2 T;  4IUR A;  2QA4 A;  2EQJ A;  5HK3 A;  2JN0 A;  3TRE A;  3X28 B;  1ZBX A;  2RHU A;  3ZEH A;  5CQX A;  2EYQ A;  5GAN 3;  1XQH A;  4HCZ A;  3WVD B;  4ZN1 A;  3OY9 A;  1OYX A;  3CCR A;  3FDR A;  2DJZ A;  2P0P A;  4C8Q E;  4C8Q C;  4XTU A;  5CKB A;  3X24 B;  5A0D A;  4OF1 A;  3MHX A;  4M78 G;  5IN1 A;  1KD1 C;  4L59 A;  1Y71 A;  2LTO A;  4M7A B;  1O9S A;  1IZ6 A;  4BB7 A;  2X4J A;  2Y4X A;  3CC4 A;  4L6V 5;  2QA4 T;  4BAC A;  2KMT A;  3GNG A;  4LDV A;  4ZGD B;  4X9D A;  5CAI A;  3OYH A;  4KT0 E;  2I2L A;  3QHS A;  4J7I A;  1NE8 A;  2IG0 A;  4ATO A;  3MCA B;  2K2V A;  5GAM j;  3CCR T;  2FB7 A;  5I2M A;  3S3N A;  3PIP A;  4A4K A;  2MWO A;  3WVE B;  5FLX E;  4QVZ A;  2HQE A;  2ZPE B;  4WF2 A;  5GAN e;  2YLB A;  4C5I A;  3JB9 G;  1VQ8 A;  5FRN A;  4KUD K;  3O8V A;  1N8R C;  4XU2 A;  3FB9 A;  2RI3 A;  1BI0 A;  4XTV A;  5GAM f;  4XTW A;  1OZ3 A;  3GP8 A;  4PJO A;  3CC4 T;  1K73 U;  1FWZ A;  1JJ2 A;  3GIB A;  4C8Q B;  3PGG A;  3TEE A;  2DD5 A;  3DB3 A;  5IT9 E;  4QQG A;  3LGL A;  3LX7 A;  4M78 D;  4J6X A;  3CPW S;  4NL3 A;  1BIA A;  4XU0 A;  1KHI A;  1YIJ A;  2FL7 A;  4PNO A;  3KXT A;  4JLG A;  4BY6 C;  4NOY A;  3UWN A;  4DOV A;  4FU6 A;  5CO7 A;  3JCM f;  2E6Z A;  5GAN 5;  4BE1 A;  1VQ8 T;  1JBM A;  4PJO C;  4PJO E;  2DO3 A;  4C5G A;  3NTH A;  3G6E A;  2DD4 A;  3F70 A;  3M57 A;  4Y28 E;  2LX9 A;  3QBY A;  4F7U G;  2DZ9 A;  4M7D A;  3MP1 A;  5DLQ E;  1TH7 A;  2VYT A;  3MEW A;  4O5V A;  5GMK h;  5GAO q;  3CCL A;  2ZGW A;  2K5L A;  4P5N A;  2K3X A;  2XIC A;  4X9C A;  3OYF A;  3QUI A;  2DK3 A;  4J7F A;  4CI0 C;  5HKC A;  2XDD A;  1KHC A;  1YIJ T;  4A53 A;  1N27 A;  3SD4 A;  1Q82 U;  3OBW A;  4KUL A;  4M75 F;  3J80 E;  1Y07 A;  2VXE A;  4IKF A;  5GAN d;  4M7D E;  4M7D C;  2LQK A;  2XID A;  2CS7 A;  4JS5 A;  2OAU A;  2VGM A;  3G6E T;  2PUO B;  4LDX A;  3C12 A;  3M59 A;  5GAN 4;  2CZ0 B;  5FU7 B;  1MGQ A;  3CCL T;  5A2Q E;  3EFS A;  2YRV A;  3LGF A;  3VUB A;  5KCH A;  4E7L A;  5J39 A;  1FXX A;  1QP3 A;  1JJ2 S;  1X01 A;  2KSS A;  1UGS B;  2RHY A;  3OYM A;  1Q86 U;  2QQS A;  2DVE A;  2C06 A;  1X75 C;  2GFA A;  4JRK A;  2HNI A;  3QDR B;  5I2S A;  4M78 B;  5LJ5 g;  4NS5 A;  3DLL A;  4J5Y A;  3FRN A;  5KH6 A;  4RG8 A;  5LL6 S;  5CQY A;  2GCX A;  4ME7 A;  4OGC A;  4C92 D;  1M90 U;  4Q5W A;  4LD9 K;  2ZZD A;  4MZP A;  1LJO A;  3CPF A;  4XTZ A;  1XNI A;  3L2U A;  3CME A;  2JTF A;  3MEV A;  2OTL A;  4KUI A;  5GAN 7;  2M1H A;  3CCS A;  2AHJ B;  4LDY A;  1KQS A;  4C92 F;  3A8H B;  1WNL A;  3LWI A;  4PLL A;  5M9O A;  3L2V A;  2Y90 A;  3HPW A;  5GMK m;  1YBY A;  4OB1 B;  1WJS A;  4M7A A;  1Q7Y C;  2E10 A;  3QZ5 B;  4RCC A;  5KE3 A;  4R55 A;  5CCA A;  2RJD A;  3CBM A;  1K8A C;  3MP8 A;  5LJ3 h;  3LWH A;  1K9M C;  4QQD A;  4EPC A;  4OGE A;  3CME T;  5GAN j;  2OTL T;  3EFR A;  3JCM J;  2HD0 A;  2DKG A;  4D6W A;  3TU4 K;  2LT1 A;  4C5H A;  2DTO A;  4FT2 A;  2DXU A;  1VQM A;  3CMA A;  4EMK B;  3CCS T;  3M9Q A;  4M77 D;  2HBP A;  4J6W A;  3E9G A;  3CBP A;  2WSE E;  3V8L A;  2E1H A;  1WGS A;  5GAN f;  3P8B B;  3VKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...