1OEBA

Mona/gads sh3c domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
PLGSVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2-RELATED ADAPTOR PROTEIN 2
publication title Structural Basis for SH3 Domain-Mediated High-Affinity Binding between Mona/Gads and Slp-76
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1oebA00
1K76A 2JT4A 1HD3A 3LH5A 1K4US 2LJ0A 2KNBB 1H8KA 3EHQA 2GTOA 1QWFA 2V1RA 4J9GA 2D1XA 2VKNA 3FJ5A 2CUDA 3O5ZA 2KT8A 1WDXA 2A28A 3ULRB 2YUOA 1S1NA 2GTJA 1GL5A 2OJ2A 1M30A 3C0CA 1YWOA 2YUQA 4RTWA 3QWYA 1KJWA 1ARKA 2HSPA 4AFQC 1YN8A 1GFDA 1ZBJA 1CSKA 2A08A 1GBRA 1ZX6A 3VS3A 4D8KA 2PZ1A 5I11A 4RUGA 3M0UA 2L3PA 1T3LA 3I5RA 4M4ZA 2A36A 2KE9A 2EGAA 3VS4A 2MIOA 2GGRA 3PVLA 1OOTA 4OMMA 2FEIA 4JZ3A 1OPKA 3VS6A 2M0YA 1NYGA 1X69A 3REBB 4RTXA 3M0RA 1ZLMA 1WFWA 2ECZA 2EGEA 3TSZA 2K9GA 2XMFA 2VWFA 2YUNA 1NYFA 2O9VA 1AZEA 1ZSGA 1SHGA 1YCSB 1ZUUA 2LP5A 4JJCA 2PNIA 1UHCA 1UHFA 4RTYA 4WCIA 1SRMA 2CH4A 2AZSA 2VVKA 1ZUKA 2MOXA 2DL3A 2EYWA 1B07A 1I1JA 2D8JA 4AFSC 1X27A 2KRMA 2RQWA 1ZUYA 2DILA 2DBKA 1VA7A 3EG1A 1SEMA 1NEBA 2BTTA 4D8DA 1PNJA 4OMOA 2OAWA 4AG1C 1X6BA 3NPFA 1JXOA 1TG0A 3H0FA 2AK5A 1NM7A 2W0ZA 4ORZA 3U23A 2DM1A 1JQQA 1TUCA 1FYNA 1MV3A 2EYZA 1M8MA 1GCQC 1G2BA 3VRYA 5ECAA 1OPLA 2QDLA 4F16A 1VYTA 2DL4A 4JJBA 5GJVB 2JM9A 1OEBA 2JS0A 2FRWA 2CSQA 2NWMA 1HJDA 2LZ6B 4RTVA 3NMZC 2J7IA 1I0CA 1UJ0A 2RQTA 1W70A 4GBQA 3M0TA 4EIKA 2RF0A 1U5SA 1K9AA 4DEXA 1QKXA 2ABLA 3VS1A 4JJDA 4X1VA 1JU5C 2CUBA 3VS0A 1X2KA 2DRKA 3RBBB 2ED0A 4OMLA 1UECA 4K11A 2DL5A 2RNAA 3GBQA 1RLQC 2L0AA 3THKA 2CH4W 1E7OA 5IXFA 1GBQA 1ABQA 1XOVA 1EFNA 5IH2A 1JO8A 2EGCA 3RNJA 2L2PA 4Z88A 1YNZA 4CC7A 1PRLC 2HBWA 2C0TA 3VS5A 2RMOA 4E6RA 4J9EA 3M0QA 1T3SA 1PRMC 4RTZA 3VS2A 2J06A 2CT4A 3UF4A 2BZYA 2F2WA 1JXMA 1K1ZA 3I5SA 4QT7A 2KRNA 1GCPA 4J9BA 5GJWB 2DX1A 2DNUA 2IIMA 2A37A 3H0IA 2DL7A 1RUWA 1KIKA 2DF6A 2EW3A 4LN2A 3QWXX 2SEMA 2RPNA 3ZL7C 1AVZC 2KRSA 1PWTA 1AEYA 4J9HA 2CDTA 2F2XA 2LCSA 4R0KA 4J9FA 1CKAA 4ZNXA 1RLPC 2DYBA 4LUEA 3EHRA 1SPKA 1WYXA 1LCKA 4F17A 4AG2C 2LX7A 1B3QA 1RI9A 2J6FA 1AD5A 3SEMA 3UATA 1UDLA 2FPEA 4AFUC 5I22A 4Y92A 1BU1A 4HXJA 2BZ8A 1SSHA 3UA7A 1TUDA 2CREA 2I0NA 1G83A 5IHIA 3UA6A 1MUZA 1GFCA 2KT1A 2ROTA 2DVJA 1AZGB 1U3OA 4JPBW 2AZVA 1SHFA 2HDAA 1QWEA 1E6GA 4Z89A 2ESWA 2RQUA 2FG0A 3I35A 3NGPA 3M0SA 5IHNA 4IIOA 2G6FX 2H8HA 1U06A 5L23A 1AWJA 1E6HA 1VYUA 2D0NA 3VS7A 2E5KA 4GLMA 2FPDA 1H92A 1UTIA 2KR3A 3PE0A 1NG2A 2LJ3A 1M3AA 2PTKA 4KRTA 2SRCA 3EG0A 1UFFA 4RTTA 2YDLA 3EG2A 1X6GA 2KGTA 2C0OA 1W6XA 1UE9A 1WLPB 3PVQA 1BB9A 2DJQA 2ENMA 2GBQA 2K3BA 1T0HA 2V1QA 4LUDA 1X43A 2DE0X 2DBMA 1HSQA 4J9IA 2B86A 1WXBA 2J6OA 2JMCA 1YP5A 2KXCA 2KYMA 3I9QA 4HVUA 4CC4B 1UUEA 1QCFA 2DLPA 2J6KA 4CC2A 5IHKA 1FMKA 4LNPA 3TVTA 1KFZA 1NLOC 4HVVA 2LMJA 4Z8AA 1M3CA 4OMPA 2CSIA 2FPFA 2EYXA 2LQWA 1J3TA 1Z9QA 1PHTA 1KSWA 2K2MA 1MV0B 3EG3A 5HCKA 2KEAA 2X3WD 4ESRA 3IQLA 3A98A 2F2VA 4A63B 2FRYA 2EVRA 1W1FA 2DRMA 3SHWA 2JW4A 1WX6A 4FSSA 1V1CA 1PKSA 2O9SA 5IXBA 2RQVA 2YT6A 2EYYA 1WXUA 2KYBA 2W10A 1Y0MA 2HEQA 2K6DA 1CKBA 2L3QA 1UGVA 2K7AA 1OV3A 2ED1A 2LQNA 2CT3A 3R6NA 2MCNA 1AWXA 1WI7A 2BZXA 2AKKA 2O2OA 1K0SA 2C0IA 2P4RA 1Y57A 1BBZA 1VYVA 2O88A 2KBTA 1AWOA 2X3XD 4DEYA 2ROLA 1AOJA 1M3BA 4IIMA 2GQIA 1SRLA 4CC3A 1Z9ZA 2YSQA 4HVWA 2EKHA 5FWBA 1GCQA 2L3SA 2JS2A 3M0PA 4OMNA 2D8HA 4OMQA 2EBPA 2JXBA 3EGUA 3H41A 1BK2A 2JMAA 2DA9A 4RTUA 4F14A 2GNCA 2DL8A 2KROA 2YUPA 3NHNA 2JTEA 2DMOA 2RN8A 2NUZA 1WIEA 1A0NB 2EPDA 1T0JA 1QKWA 1ABOA 3KFVA 1UJYA 1I07A 5EC7A 2FO0A 2RQRA 1WA7A 1N5ZA 1GRIA 5FW9A 2AKLA 1PKTA 2J05A 4AFZC 4LE9A 2HCKA 2O31A 1AWWA 3CQTA 1NEGA 1IO6A 1NLPC 1QLYA 2LNHB 4HCKA 2KXDA 1UG1A 1YWPA 1X2QA 3JV3A 2K79A 1H3HA 2OI3A 3H0HA 2M51A 4JZ4A 1K0XA 2LJ1A 3VRZA 2JM8A 4J9CA 1WXTA 2EQIA 3TSWA 3REAB 1JEGA 4J9DA 5FWCA 1M27C
chains in the Genus database with same CATH superfamily
2JT4A 2Y4XA 3PGGA 1VQKT 2KNBB 4JRQA 4PFOA 1IHVA 2LTOA 4ME7A 2VKNA 3FJ5A 4E7SA 3CMET 4MMLA 5LJ5f 3ULRB 3OYYA 1M8VA 1BIBA 3OYLA 2DKGA 5GANj 2OJ2A 3EFSA 1U1TA 3C0CA 1MGQA 3Q1JA 3MCAB 2VGNA 2QEXT 1WHGA 1ARKA 4AFQC 1YN8A 1GFDA 1CSKA 5GMKh 1KC8R 1VQ6A 4M78F 3ASKA 3M0UA 3CCUQ 3CCEQ 1D0ZA 1T3LA 3FRNA 3G7ZA 2KE9A 2MIOA 3PVLA 2FEIA 5A0DA 1NYGA 1ZLMA 3TSZA 2XIDA 2XMFA 1P92A 3RKXA 1Y96B 1AT1B 5A2QE 1ZSGA 1SHGA 1ZUUA 2DD5A 1K73C 1G3TA 1KQSA 4M7AG 3LX7A 2CH4A 2AZSA 2DL3A 2QA4Q 1XTDA 1W2BS 1I1JA 2D8JA 4AFSC 1X27A 2KRMA 3CCJA 2RQWA 4GY5A 1Y96A 4NL2A 3EG1A 1U8RA 1NEBA 2BTTA 2COZA 4D8DA 2K2VA 3FEOA 3QYHB 1M9SA 2ZCFB 3HFNA 3CCQA 1TG0A 2RHYA 1VQMQ 4ANJA 3U23A 3AHUA 1TUCA 2JTFA 4EPCA 1LPLA 1GCQC 3VRYA 4M77E 3CCJT 1OPLA 1OULA 2QDLA 3URGA 5GJVB 2JM9A 3G1JA 2X4XA 2E5QA 2J7IA 3CCQT 1W4SA 1RAEB 1UJ0A 2XDPA 1W70A 1FMVA 1D1BA 4O6JA 1IHWA 4N4HA 5LJ5e 1JU5C 4ELYC 3VS0A 1M90R 1X2KA 4RG8A 4OGEA 1QVFS 4OMLA 4PJJA 1M1KC 1WPYA 2MK5A 4A4GA 4IUQA 5CKDA 3A8OB 2R5AA 3E19A 2DXUA 1ABQA 4RG2A 2F5TX 4M75G 2L2PA 4Z88A 2DTOA 1YNZA 4L59A 3BY7A 3V8LA 3CXCA 2C0TA 2E10A 1N8RR 3UDCA 2MAMA 4BDZA 1G3YA 1YI2A 1N27A 2CS7A 4ZN3A 3OSSC 2R57A 3UF4A 3RDVA 5EG2A 2XDDA 2QDYB 1JXMA 1M90U 2KRNA 3P8DA 5GJWB 1NPPA 4JJNK 3M58A 3QZ5B 1YITQ 2DNUA 2A37A 2YXYA 5J39A 2DF6A 2FVUA 4LN2A 2RJDA 3QWXX 3JCMc 1KQ2A 2LRQA 3LWIA 2LT1A 2PUOB 4ZNXA 2PUKB 1N8RU 1RLPC 2DYBA 2LX9A 1ZSZC 3LYIA 3V8JA 1B3QA 1RI9A 4RCBA 1QVGA 3ME9A 3VU3C 2J6FA 4OP0A 2H3JA 5I22A 5IAYA 2BZ8A 2CREA 1SSFA 1G83A 4PKCC 1VQ5Q 4M7DE 2ROTA 1WJSA 3HPWA 2DVJA 4M78G 4BB7A 1AZGB 4JPBW 3OS1A 1SHFA 3CBOA 5HK3A 2QXFA 3JB9G 2RH2A 1VQPQ 2RQUA 3ZBDA 4O5VA 4EMKB 4X9CA 1PSEA 1N6AA 2E70A 2G6FX 2H8HA 1U06A 5FLXE 1E6HA 4FSXA 3HRSA 4E2FB 3CMAQ 3CC7A 4MZTA 2OTLQ 1H92A 1UTIA 1NG2A 1UGQB 1Q82R 4EMKA 1PD1A 1WQWA 4OB1B 4OB0B 1UFFA 1X6GA 4JS4A 2KGTA 3UT1A 3L2ZA 3OW2P 1UE9A 3PVQA 2DJQA 1RAFB 4D6WA 4XTUA 5GAMj 1YIJA 5KYWA 2DE0X 3QDFA 1HSQA 1K9MR 2J6OA 1BCMA 2D0QB 1YP5A 3E9GA 3OYBA 2L3RA 4HVUA 4CC4B 1VQOQ 1UUEA 2F1LA 1QCFA 3M54A 1NZ9A 2J6KA 3OQ5A 4C5GA 2E12A 1M5Q1 3CCLQ 3HP9A 3CC7T 1NLOC 4LXCA 1Q82U 2FPFA 3OMGA 4FT2A 2PQWA 1RABB 3G4SQ 5DM7R 1J3TA 3KUFA 3M4YA 2K2MA 1MV0B 2X3WD 1BI0A 4ESRA 3CD6Q 3IQLA 1YIJT 4L5GA 2IVWA 4A63B 5FROA 1K9MU 3SHWA 1Q86C 1WX6A 1UGSB 2D9TA 1PKSA 2RQVA 4RCCA 2EYYA 2KYBA 3L2QA 1Y0MA 3TU4K 1KK7A 2QAZA 2VXFA 4J8OA 1Q7YC 1OV3A 2LQNA 4BI8B 1O75A 1AWXA 5CO7A 4TVRA 2P4RA 4IKFA 2CKKA 1OYXA 3HSBA 4A4FA 3J80E 5AYFA 1TOVA 1HXDA 2EJGA 2GQIA 3CCVA 2VYTA 2NUTB 5GAN8 1YHQQ 2KI7A 2YSQA 2LQKA 1W2BA 2V8JA 1K73R 2E1HA 1D09B 2CP6A 4OGCA 2JS2A 4KGZB 1IRXA 2D8HA 4M75B 3ER0A 3INZA 4DBFA 4F7UF 1VQ7Q 3GIBA 5CKEA 2DYIA 1AHJB 2NUTA 2IG0A 2YLCA 4M75D 5GAOn 2DMOA 3CC2Q 2C06A 2HQEA 1T0JA 1VQ4Q 4PJMA 1WHLA 1K8AR 3PIPA 2JVVA 1UJYA 3NFCA 1I07A 1VQLA 3MHXA 2CP2A 1U1SA 4PJOC 1N5ZA 2AKLA 1K73U 2LNHB 2KXDA 5CVIA 3QBYA 3TCJA 2K79A 2M51A 2QQRA 4JZ4A 2LJ1A 4PJNA 3VRZA 2FZCB 2A0FB 2L5QA 4OVAA 3TSWA 1I8FA 2EJ9A 5D7UA 3CCRT 3KXTA 1QP2A 1UGRB 1K8AU 1K76A 1HD3A 1VQLT 2LJ0A 1TH7A 1H8KA 1QVFA 2DERA 2GTOA 2D1XA 4BE2A 3CXCS 4IURA 1JJ2A 5GAN6 3QPHA 4M78B 2YWWA 2A28A 1YJWA 2A7YA 1GL5A 3DB3A 3H8ZA 1MMAA 2OX7A 4M78D 4QQDA 1QMCA 3RERA 4V2SA 1YBYA 3VYHB 1GXIE 4B6MA 1KJWA 3JB9D 1WQ7A 1ZBJA 2B8AA 1M2VB 1ZX6A 3VS3A 2PZ1A 1EZZB 2IPOB 3LW5E 2EGAA 3DLMA 1IXDA 2GGRA 2K3XA 4OMMA 4M7DA 1KHIA 4JZ3A 2QTVA 4BY6B 3OS5A 2M0YA 5FU6C 3VS6A 2CZ0B 2E6ZA 3I56Q 3M0RA 5GAN2 1WFWA 2ECZA 1M2VA 1YJWT 2K9GA 1M1KU 5GANf 2E6NA 1WHMA 3M4GA 1AZEA 5GANd 2DZCA 1QVGS 1FWZA 4WCIA 4M77F 2CP5A 2VVKA 1ZUKA 2Y4YA 1ZBXA 2VASA 1B07A 2E41A 3BFMA 4C5HA 3C94A 3L2RA 2YRDA 1MNDA 3CCMA 5CK9A 2ZPFB 1VQNA 4E7ZA 1D1CA 1PNJA 3BDUA 4IUTA 4KT0E 3JCMV 4AG1C 5I2MA 2E3IA 2XI9A 4XU2A 5CQYA 2HQHA 3EH1A 8AT1B 3H0FA 4FU6A 2AK5A 8ATCB 2DTIA 4PFZA 4QQGA 5CIUA 1FYNA 4L6V5 2EYZA 2RI2A 2GFUA 3JCMd 2COYA 2F69A 3OYMA 4F16A 2P0PA 1VYTA 2DL4A 4JJBA 2K57A 4C0ZA 3OYIA 1VQNT 3C12A 2JS0A 2FRWA 4F7UE 1M1GA 4DBHA 2CZ6B 3FJPA 5KE2A 4DA4A 1R77A 3M0TA 4XU1A 4EIKA 4E7IA 2RF0A 4NS5A 4EDUA 2QQSA 5C0MA 3CPWA 3L2WA 2BUDA 1PSFA 4X1VA 5CKBA 3RBBB 2DRKA 2RHIA 1KQ1A 2ED0A 1OI1A 5GMKe 2LDMA 2DL5A 2RNAA 2L0AA 5GAN4 2PVOB 3THKA 3CCEA 2CH4W 1E7OA 2EJFA 4JRIA 1XOVA 3JCMX 5IH2A 1JO8A 3RNJA 5CR2A 1M1FA 5LJ3j 3BE3A 3M0QA 2EQMA 1S72Q 2E64A 4RTZA 2J06A 1C6VX 4XTVA 2CZ7B 2F2WA 4ATOA 3LLRA 3I5SA 2RK1A 1GCPA 5GANe 4M7DF 2DX1A 2LCLA 2QA4A 1Q81C 4NL3A 3GNGA 3CCET 1Q86R 1C1AA 4PLLA 3G6EQ 5J26A 5IT9E 2KY9A 5J3BA 1PWTA 2MMPA 4DBRA 3RESA 4QVCA 4J9FA 4BI3A 4KUIA 5FRNA 1YJ9Q 5GANh 2ZGWA 1NE8A 1VQ6T 1NJIC 1LCKA 3PT9A 4AG2C 1VQMA 1OQKA 3QUIA 1QVPA 3UATA 1UDLA 2MWOA 2R5MA 2VUBA 4BDYA 1SSHA 3UA7A 2I0NA 5GMKi 5IHIA 3UA6A 4WTOB 2KDSA 1MMNA 1Q86U 2KT1A 2EQKA 1U3OA 2AZVA 2A3LA 4PJLA 1RL2A 1QWEA 5KCOA 1IZ6A 4Z89A 2ESWA 2FG0A 3X26B 2V26A 5GANg 3M0SA 1KD1C 4KBMB 2LNVA 4IIOA 1AWJA 4E47A 3DLLA 1VQMT 1FX7A 1B34A 1BIAA 1RAHB 3PMIA 2E5KA 2V8KA 3V7RA 5D6XA 4A4KA 1WNLA 3LH0A 1M3AA 2PTKA 4C92C 2YDLA 3OYFA 2L89A 4II1A 3X24B 4PJOE 3VKIA 2RJCA 1WLPB 1BB9A 5L8RE 3FDRA 1T0HA 2ZAEA 5A0GA 1ACMB 4J9IA 3O8VA 2JMCA 2KYMA 3OMCA 1R0BG 4NOYA 1JJ2S 2EQJA 3E1SA 3L2UA 2DPPB 4KULA 1HYOA 3PNWC 1FMKA 4XTWA 4MMKA 1XJWB 4BD3A 3OYJA 4OMPA 4DOVA 1N9SA 6AT1B 1YITA 2PU9B 3HRTA 1OX9A 4YTLA 1KSWA 3I55Q 3JB9I 5GAMf 4HA8A 3UWNA 3SFMA 1I5OB 5GAMd 2FB7A 2JW4A 1SG5A 2FHDA 2BE9B 1RAGB 1RI0A 4C0GA 4J83A 4MDWA 1ZHIA 3F70A 1YFNA 5KE3A 1ZSZA 2HEQA 4EMHA 1OU8A 2OTJQ 2K6DA 5AT1B 1UGVA 2DETA 2CT3A 1YITT 1VQ5A 1WI7A 5CKFA 1YI2T 2NLUA 2ZPIB 2K5FA 1BBZA 2X51A 2O88A 2X3XD 4DEYA 1M3BA 1VQPA 4MZMA 3X20B 4IIMA 1VQ8A 3QG1A 2RB6A 2EYQA 3GPLA 4C0DB 2EKHA 2L3SA 3PMTA 4C8QC 3OBYA 1LNXA 4F7UA 4LDYA 4OMNA 3SWNC 3HL8A 3CMAA 3J7AF 2EBPA 2OTLA 3OYCA 3H9NA 1BK2A 1G3WA 4F04B 5GAOm 5KYYA 1IGUA 3SB2A 1OU9A 5KYXA 4PLIA 1VQ5T 4M7DG 4F14A 2GNCA 2DL8A 5KYUB 2KK4A 2HMAA 4KGVB 2WSFE 1D3BB 2M9UA 4C92F 3TEEA 1WIEA 4N4IA 3KFVA 5EC7A 1VQPT 1VQ8T 5KYWB 2LCCA 4ZGEB 3CCSQ 3BW1A 1VQOA 1WA7A 5KYUA 2V8IA 3VUBA 2JZ2A 1D3BA 1PKTA 2J05A 3OYNA 2HCKA 1C0MA 1AWWA 2XG8D 3CMAT 5I21A 2ZZDA 3CCLA 5GAN7 1IO6A 4HCKA 2OTLT 2X9HA 4JS5A 2DIGA 1UG1A 1YWPA 3CPWS 1H3HA 3M59A 3H0HA 3CBPA 3G4SA 1YCYA 2XHCA 1WXTA 4J9DA 5FWCA 3CD6A 4OF1A 4J5YA 4FYYB 3LH5A 1VUBA 4B9WA 2HAXA 1K4US 3EFRA 4RKUE 3M9QA 1VQOT 3CC7Q 5GAMe 1QCOA 4EMKC 1Y7XA 1HK9A 1EIFA 2MI6A 2YUOA 4OB3B 1S1NA 1QW1A 4LDXA 4PNOA 1YWOA 2YUQA 4KGXB 3G4ST 4XTZA 3QWYA 4DBQA 2AT1B 1KC8C 1BYMA 4ZTJA 5GAMh 5DLQE 4RUGA 1VIFA 3CD6T 2L3PA 2A36A 3VS4A 2QASA 2XU8A 1OOTA 2DO3A 4M77B 4M7AC 1SF9A 2EGEA 3QSUA 2VWFA 4C8QF 1VQ7A 4M77D 1NYFA 2O9VA 2RHXA 2DXBA 1YCSB 2LP5A 4JJCA 4M77A 1UHCA 7AT1B 4RTYA 1YJNQ 2O01E 1Q95G 2HSEB 4XK8E 1DJ7B 2E4HA 3CC2A 2MOXA 5GAMg 1KG1A 4EMGA 4UC4A 2JJ9A 3JSCA 1WJQA 4GLKA 1VA7A 1SEMA 1TU0B 4A53A 5HY6A 3OW2A 4OMOA 4PJOA 2GQVA 1LVKA 1X6BA 2CP0A 3NPFA 4XTYA 3EGDB 1JXOA 3QYGB 4E7JA 4QW2A 1VQ7T 4HT9A 1OZ3A 2DD4A 3CC4Q 3J81E 3OBWA 1NM7A 1ZQ1A 3GOXA 3CCVT 4N0AA 4ORZA 2DM1A 4KH1B 1XNIA 3CC2T 3HRUA 1MV3A 4XQ3A 3EGDA 4WF2A 3G71Q 3C95A 2RJFA 5GAOq 4VUBA 2QGGA 2XK0A 4LD9K 2DVEA 2DZ9A 1HJDA 2LZ6B 2QYZA 2QK0A 3NMZC 3OS0A 1H641 1PCXA 1I0CA 1VIEA 3QJYA 2RQTA 1U5SA 1K9AA 3VUZA 4C92E 4DEXA 2ABLA 3VS1A 1M90C 1QQJA 2LQ8A 4M75C 4OB2B 4JJDA 3SDZA 5GAOr 4Q5WA 1UB4A 3CCRQ 5FU6B 2K3YA 2YHTA 2JOYA 3GBQA 3EH2A 3E9FA 3VYGA 3NTIA 1TUGB 2GCXA 1M1KR 1GBQA 2YRVA 1KD1U 1M4ZA 4E7KA 5C6SA 3OYKA 1EFNA 2P4TA 1N8RC 4FT4A 4M7DB 4J9EA 2WACA 3I56A 1M2OA 4M7AF 4KUDK 1T3SA 5FRMA 5FU7B 4M7DD 3QHSA 4R55A 2CT4A 2DFUA 2BZYA 3ZFJA 4J7FA 1VQ9Q 2YRCA 1JB0E 1RAAB 2M16A 9ATCB 3PIOA 3H0IA 1XQHA 4FW1A 1KIKA 1YJWQ 3TREA 3ZL7C 2KRSA 2CDTA 2F2XA 2LCSA 1G8XA 3I56T 5LJ3f 1CKAA 3EFOB 4ZTFA 5LJ3d 4M78C 5GAOl 1SPKA 2ZPGB 2D6FA 4X34A 2DTHA 5GMKm 3GF5A 4N4GA 3DKMA 4AFUC 4Y92A 3EFOA 4PJOF 1TUDA 1QCNA 2JUFA 5I2SA 2H3EB 1GFCA 3GLXA 1WHKA 4FCYA 2HNIA 2COWA 4C8QE 1WZOA 2MYSA 4HCCA 2Y90A 2DXTA 4BY6C 2HBPA 3JCMf 2VGMA 1SKUB 1WJRA 5IHNA 2DJZA 4QKUA 4FW2A 2DK3A 1KQSP 1VYUA 4IUPA 2D0NA 3V8KA 3JRZA 3CCMT 4P5NA 2FYKA 4M75F 3OYHA 2QI2A 2RA2A 2KR3A 2LJ3A 4AT1B 4J6WA 2RD1A 2SRCA 3EG0A 3EG2A 4X9DA 1X75C 2P84A 3OS2A 2C0OA 2DXCA 1W6XA 2ENMA 1TSFA 4F7UG 2K3BA 1K9MC 3JB9H 2V1QA 1X43A 2DBMA 1VQKQ 2O4XB 2VXEA 2B86A 1IGQA 1WXBA 1S72A 2KXCA 1MHNA 3I9QA 2OAUA 3CCUA 2EIFA 3A8LB 3QXEB 3RR6A 3CMEQ 2DLPA 4BUGA 5A0LA 5M9OA 4LNPA 3TVTA 2JNGA 1KFZA 2LMJA 2O4XA 1M3CA 4Z8AA 3OY9A 4MZPA 1O9SA 4FL6A 2MF2A 2QEXQ 2AHJB 2PVDB 2DEUA 3G6EA 5HK0A 1PHTA 2XICA 4J6YA 3EG3A 1MNEA 3C4SA 5HCKA 2KEAA 2NUPB 5LJ5d 4C5IA 2EFIA 2F2VA 4C5EA 1YJ9A 1W1FA 4A4EA 2DRMA 1S72T 3CCUT 2RHZA 1WXUA 1ZA2B 2W10A 5LJ3e 1VOMA 2NUPA 1CKBA 1EX4A 3JB9F 2K7AA 2ED1A 3MEVA 3R6NA 2MCNA 1Q7YR 5GAN3 2AKKA 2O2OA 3V7CA 3G6ET 1MMGA 1Y57A 4M7AE 3CXCP 2KMTA 2KBTA 1VQ6Q 5LJ3h 2ROLA 1F1BB 1AOJA 3OYDA 3UPUA 1YJ9T 2QA4T 2HL3A 3OW2S 3EGXB 4C92B 3V7SA 3EG9B 1GCQA 1BI2A 3M0PA 3JCMe 1KC8U 4HKEA 1B34B 2QQAA 4C92D 2JXBA 3H41A 3M53A 2JMAA 4JRKA 1JRIA 4RTUA 3EGXA 2BIVA 4C92A 1BKBA 1Q7YU 3EG9A 2FL7A 2DEQA 2YUPA 3R6OA 2JTEA 2RN8A 3WVEB 1K8AC 2NUZA 1A0NB 2EPDA 1PC0A 5LJ3g 1R0CB 5CQXA 3JCMh 4DQ2A 1FXXA 3JB9J 3CCJQ 4MDXA 4M77G 4JRPA 1QVGP 1BCOA 4AFZC 4LE9A 3CQTA 5LJ5j 3CCQQ 2I2LA 4JDSA 1QLYA 4LDVA 1WHHA 3HKSA 1X2QA 2ZPEB 1WGSA 1KHCA 2G3RA 4LD6A 4PJOG 4B9XA 2EQIA 4LDUA 3I55A 3CBMA 3VV0A 1JEGA 3JCMP 1M27C 3JCMg 3QZ9B 2RO0A 4IUVA 4CI0C 1MMDA 3EHQA 1QWFA 2V1RA 4J9GA 2LT4A 4M75E 3HTRA 3MPUB 2CUDA 3O5ZA 2KT8A 2XD0A 1WDXA 2GTJA 3ZEHA 1ZSZB 4FYXB 2OTJA 4BI4A 5KCHA 3A8GB 1M30A 3NTKA 4RTWA 5LJ5h 3JCMW 3I55T 2LC4A 2HSPA 3E2UA 4C8QB 2A08A 1GBRA 4D8KA 5I11A 4PL6A 3SWNB 3I5RA 4M4ZA 3S3MA 2CP3A 1V76A 2HL5C 4C8QD 4R56A 1OPKA 1X69A 3REBB 3QO3A 3RUXA 3P8BB 1TS9A 4RTXA 4C8QA 5GMKl 4F7UB 3RKWA 2KVQG 2YUNA 3LGLA 3SWNA 2OTJT 1YI2Q 2HKQB 4QVDA 3LWHA 2QGFB 5KYYB 4QVZA 2FZKB 2PNIA 5KYXB 1UHFA 5LJ5g 1RADB 3HFOA 2KSSA 1SRMA 1Y07A 2EYWA 4ZGDB 3A8MB 3D7SB 3CEYA 1ZUYA 3N5BB 3S3OA 2DILA 5D6WA 4M78E 2DBKA 2K4YA 3CCSA 1D0XA 2EWNA 2MPXC 2DAQA 3OYEA 3M56A 2OAWA 4A54A 1BI1A 4AMCA 2GF7A 2RI3A 2W0ZA 4HCBA 2LVMA 2M02A 3T9NA 1JQQA 3BDLA 4J6XA 1VQ8Q 2EKOA 1M8MA 1G2BA 1TXQA 5ECAA 3MEAA 3MEWA 1W2BP 4FYVB 3CCST 4CRIA 1OEBA 2X4YA 2CSQA 2NWMA 2XDBA 3S6WA 3KBGA 3OB9A 4RTVA 4ELZC 5IN1A 3L1AA 4C0DC 3TQ7P 3JCMQ 2F5KA 1I5LA 3QKJA 3M57A 4GBQA 1G3SA 3OYAA 1QKXA 2JTMA 2KQWA 3JCMb 3VJPA 3PTAA 2YLBA 2CUBA 3SD4A 4FIBA 4Z02A 4M7AB 2M1HA 3L2VA 1UECA 2RJEA 4K11A 1IB8A 3CPFA 1QP3A 1RLQC 4C0FA 3X25B 3HHTB 5IXFA 3CCLT 2CYZB 4M7AD 4JUVA 4PFPA 2EGCA 3META 3MKDA 3OA6A 4KH0B 2X35A 4CC7A 1PRLC 2VC8A 1YIJQ 4M7AA 2HBWA 4XU3A 3VS5A 2RMOA 4E6RA 2QQBA 4ZGJB 1PRMC 3QIIA 4IUUA 1PD0A 3VS2A 3M5AA 2ZPHB 3A8HB 1K1ZA 4QT7A 1IREB 1YJNA 1YHQA 5GAOp 4J9BA 2GFAA 2IIMA 1QVFP 2DL7A 1RUWA 1Q81R 2X4JA 1UEBA 1JJ2P 1OZ2A 2EW3A 4QQ6A 2SEMA 2RPNA 1AVZC 1I81A 3GNFB 1X6OA 1AEYA 1H3ZA 4J9HA 4R0KA 2CP7A 4PJOB 1N9RA 1NPRA 5D6YA 5CAIA 1VQ4A 1KQSS 4LUEA 3EHRA 1BI3A 1WYXA 3CC4A 2EQUA 4PJOD 1OX8A 2FZGB 4F17A 5KYNA 1ZA1B 2LX7A 2ATCB 1NJIR 3X28B 4XU0A 1AD5A 2WSCE 1YHQT 1YJNT 3SEMA 2FPEA 1BU1A 3EAEA 3L42A 4HXJA 2NYSA 3FB9A 2BE7D 1G5VA 3G71A 1MUZA 1Q81U 1X01A 4A4HA 2MWPA 2HDAA 1E6GA 5HKCA 4M77C 3I35A 3NGPA 3NTHA 3CCVQ 3P8HA 3A5ZB 1VQ4T 2E3HA 2HKNA 2Z0WA 5L23A 3CC4T 1LJOA 1KD1R 1TTHB 4M75A 3CCRA 3VS7A 1NJIU 4GLMA 2FPDA 2RM4A 4DOWA 3H6ZA 2AIRB 3PE0A 2ZPBB 2VB6A 4KRTA 4RTTA 3G71T 4OMFB 3WXMB 4LDWA 2GBQA 2M0OA 1NBEB 3S3NA 4E7LA 4LUDA 4N0AC 4FYWB 1VQLQ 3MO8A 2P0KA 3RKYA 4FM4B 3OYGA 3MP6A 4XTXA 4Y28E 3PFSA 4C92G 3WVDB 3LGFA 1D1AA 2K5IA 4CC2A 5IHKA 1D0YA 1VQ9A 1TWBA 2HQXA 5DY9A 4HVVA 3FC3A 2QG9B 2CSIA 3FIFA 2EYXA 3AT1B 3JCMJ 2LQWA 2E65A 1I4K1 4BE0A 1Z9QA 1V29B 3JAME 3QDRB 4PK4A 5CCAA 3A98A 4HCZA 3MEUA 2FRYA 2EVRA 4FSSA 3QJ6A 2KAFA 1V1CA 3CPWP 2O9SA 5IXBA 2YT6A 1B7TA 4M78A 1RAIB 1VQ9T 1Y71A 3A1PA 1WHJA 2L3QA 4HT8A 1PG5B 2BZXA 3GP8A 1K0SA 3RMQA 2C0IA 2L8DA 3MP8A 1VYVA 5GAN5 1AWOA 3FLGA 1RACB 4M7DC 1SRLA 4CC3A 1Z9ZA 2QQ9A 4JLGA 4HVWA 4Y91A 5FWBA 1UGPB 5FU7C 2VV5A 4BE1A 2JN0A 1JBMA 2HZYA 2HD0A 2X4WA 4OMQA 3EGUA 2QTXA 2DA9A 5KH6A 2BKDN 2XKOC 2CZ1B 2P0QA 2K5LA 2KROA 1PM3A 3NHNA 3MP1A 4E7HA 4C8QG 1QKWA 1ABOA 2WSEE 1Q82C 4BACA 3MJXA 1VQKA 3M55A 2CGHA 2FO0A 3CCMQ 4ZN1A 1VQNQ 2RQRA 5LL6S 1GRIA 2RI5A 5FW9A 5DLOA 3CMEA 4J7IA 2O31A 1FMWA 2RHUA 1NEGA 2RK2A 4XAXB 1NLPC 4RMOA 3DB4A 5GMKj 3JV3A 4JLIA 3RMSA 2OI3A 2R58A 2PVGB 1K0XA 2QEXA 2JM8A 4J9CA 5CKHA 1LOJA 2EAYA 3REAB 2DIQA 3RIRA 1R8OB 3OSVA
chains in the Genus database with same CATH topology
1K76A 2JT4A 1HD3A 3LH5A 1K4US 2LJ0A 2KNBB 1H8KA 3EHQA 2GTOA 1QWFA 2V1RA 4J9GA 2D1XA 2VKNA 3FJ5A 2CUDA 3O5ZA 2KT8A 1WDXA 2A28A 3ULRB 2YUOA 1S1NA 2GTJA 1GL5A 2OJ2A 1M30A 3C0CA 1YWOA 2YUQA 4RTWA 3QWYA 1KJWA 1ARKA 2HSPA 4AFQC 1YN8A 1GFDA 1ZBJA 1CSKA 2A08A 1GBRA 1ZX6A 3VS3A 4D8KA 2PZ1A 5I11A 4RUGA 3M0UA 2L3PA 1T3LA 3I5RA 4M4ZA 2A36A 2KE9A 2EGAA 3VS4A 2MIOA 2GGRA 3PVLA 1OOTA 4OMMA 2FEIA 4JZ3A 1OPKA 3VS6A 2M0YA 1NYGA 1X69A 3REBB 4RTXA 3M0RA 1ZLMA 1WFWA 2ECZA 2EGEA 3TSZA 2K9GA 2XMFA 2VWFA 2YUNA 1NYFA 2O9VA 1AZEA 1ZSGA 1SHGA 1YCSB 1ZUUA 2LP5A 4JJCA 2PNIA 1UHCA 1UHFA 4RTYA 4WCIA 1SRMA 2CH4A 2AZSA 2VVKA 1ZUKA 2MOXA 2DL3A 2EYWA 1B07A 1I1JA 2D8JA 4AFSC 1X27A 2KRMA 2RQWA 1ZUYA 2DILA 2DBKA 1VA7A 3EG1A 1SEMA 1NEBA 2BTTA 4D8DA 1PNJA 4OMOA 2OAWA 4AG1C 1X6BA 3NPFA 1JXOA 1TG0A 3H0FA 2AK5A 1NM7A 2W0ZA 4ORZA 3U23A 2DM1A 1JQQA 1TUCA 1FYNA 1MV3A 2EYZA 1M8MA 1GCQC 1G2BA 3VRYA 5ECAA 1OPLA 2QDLA 4F16A 1VYTA 2DL4A 4JJBA 5GJVB 2JM9A 1OEBA 2JS0A 2FRWA 2CSQA 2NWMA 1HJDA 2LZ6B 4RTVA 3NMZC 2J7IA 1I0CA 1UJ0A 2RQTA 1W70A 4GBQA 3M0TA 4EIKA 2RF0A 1U5SA 1K9AA 4DEXA 1QKXA 2ABLA 3VS1A 4JJDA 4X1VA 1JU5C 2CUBA 3VS0A 1X2KA 2DRKA 3RBBB 2ED0A 4OMLA 1UECA 4K11A 2DL5A 2RNAA 3GBQA 1RLQC 2L0AA 3THKA 2CH4W 1E7OA 5IXFA 1GBQA 1ABQA 1XOVA 1EFNA 5IH2A 1JO8A 2EGCA 3RNJA 2L2PA 4Z88A 1YNZA 4CC7A 1PRLC 2HBWA 2C0TA 3VS5A 2RMOA 4E6RA 4J9EA 3M0QA 1T3SA 1PRMC 4RTZA 3VS2A 2J06A 2CT4A 3UF4A 2BZYA 2F2WA 1JXMA 1K1ZA 3I5SA 4QT7A 2KRNA 1GCPA 4J9BA 5GJWB 2DX1A 2DNUA 2IIMA 2A37A 3H0IA 2DL7A 1RUWA 1KIKA 2DF6A 2EW3A 4LN2A 3QWXX 2SEMA 2RPNA 3ZL7C 1AVZC 2KRSA 1PWTA 1AEYA 4J9HA 2CDTA 2F2XA 2LCSA 4R0KA 4J9FA 1CKAA 4ZNXA 1RLPC 2DYBA 4LUEA 3EHRA 1SPKA 1WYXA 1LCKA 4F17A 4AG2C 2LX7A 1B3QA 1RI9A 2J6FA 1AD5A 3SEMA 3UATA 1UDLA 2FPEA 4AFUC 5I22A 4Y92A 1BU1A 4HXJA 2BZ8A 1SSHA 3UA7A 1TUDA 2CREA 2I0NA 1G83A 5IHIA 3UA6A 1MUZA 1GFCA 2KT1A 2ROTA 2DVJA 1AZGB 1U3OA 4JPBW 2AZVA 1SHFA 2HDAA 1QWEA 1E6GA 4Z89A 2ESWA 2RQUA 2FG0A 3I35A 3NGPA 3M0SA 5IHNA 4IIOA 2G6FX 2H8HA 1U06A 5L23A 1AWJA 1E6HA 1VYUA 2D0NA 3VS7A 2E5KA 4GLMA 2FPDA 1H92A 1UTIA 2KR3A 3PE0A 1NG2A 2LJ3A 1M3AA 2PTKA 4KRTA 2SRCA 3EG0A 1UFFA 4RTTA 2YDLA 3EG2A 1X6GA 2KGTA 2C0OA 1W6XA 1UE9A 1WLPB 3PVQA 1BB9A 2DJQA 2ENMA 2GBQA 2K3BA 1T0HA 2V1QA 4LUDA 1X43A 2DE0X 2DBMA 1HSQA 4J9IA 2B86A 1WXBA 2J6OA 2JMCA 1YP5A 2KXCA 2KYMA 3I9QA 4HVUA 4CC4B 1UUEA 1QCFA 2DLPA 2J6KA 4CC2A 5IHKA 1FMKA 4LNPA 3TVTA 1KFZA 1NLOC 4HVVA 2LMJA 4Z8AA 1M3CA 4OMPA 2CSIA 2FPFA 2EYXA 2LQWA 1J3TA 1Z9QA 1PHTA 1KSWA 2K2MA 1MV0B 3EG3A 5HCKA 2KEAA 2X3WD 4ESRA 3IQLA 3A98A 2F2VA 4A63B 2FRYA 2EVRA 1W1FA 2DRMA 3SHWA 2JW4A 1WX6A 4FSSA 1V1CA 1PKSA 2O9SA 5IXBA 2RQVA 2YT6A 2EYYA 1WXUA 2KYBA 2W10A 1Y0MA 2HEQA 2K6DA 1CKBA 2L3QA 1UGVA 2K7AA 1OV3A 2ED1A 2LQNA 2CT3A 3R6NA 2MCNA 1AWXA 1WI7A 2BZXA 2AKKA 2O2OA 1K0SA 2C0IA 2P4RA 1Y57A 1BBZA 1VYVA 2O88A 2KBTA 1AWOA 2X3XD 4DEYA 2ROLA 1AOJA 1M3BA 4IIMA 2GQIA 1SRLA 4CC3A 1Z9ZA 2YSQA 4HVWA 2EKHA 5FWBA 1GCQA 2L3SA 2JS2A 3M0PA 4OMNA 2D8HA 4OMQA 2EBPA 2JXBA 3EGUA 3H41A 1BK2A 2JMAA 2DA9A 4RTUA 4F14A 2GNCA 2DL8A 2KROA 2YUPA 3NHNA 2JTEA 2DMOA 2RN8A 2NUZA 1WIEA 1A0NB 2EPDA 1T0JA 1QKWA 1ABOA 3KFVA 1UJYA 1I07A 5EC7A 2FO0A 2RQRA 1WA7A 1N5ZA 1GRIA 5FW9A 2AKLA 1PKTA 2J05A 4AFZC 4LE9A 2HCKA 2O31A 1AWWA 3CQTA 1NEGA 1IO6A 1NLPC 1QLYA 2LNHB 4HCKA 2KXDA 1UG1A 1YWPA 1X2QA 3JV3A 2K79A 1H3HA 2OI3A 3H0HA 2M51A 4JZ4A 1K0XA 2LJ1A 3VRZA 2JM8A 4J9CA 1WXTA 2EQIA 3TSWA 3REAB 1JEGA 4J9DA 5FWCA 1M27C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  2JT4 A;  1HD3 A;  3LH5 A;  1K4U S;  2LJ0 A;  2KNB B;  1H8K A;  3EHQ A;  2GTO A;  1QWF A;  2V1R A;  4J9G A;  2D1X A;  2VKN A;  3FJ5 A;  2CUD A;  3O5Z A;  2KT8 A;  1WDX A;  2A28 A;  3ULR B;  2YUO A;  1S1N A;  2GTJ A;  1GL5 A;  2OJ2 A;  1M30 A;  3C0C A;  1YWO A;  2YUQ A;  4RTW A;  3QWY A;  1KJW A;  1ARK A;  2HSP A;  4AFQ C;  1YN8 A;  1GFD A;  1ZBJ A;  1CSK A;  2A08 A;  1GBR A;  1ZX6 A;  3VS3 A;  4D8K A;  2PZ1 A;  5I11 A;  4RUG A;  3M0U A;  2L3P A;  1T3L A;  3I5R A;  4M4Z A;  2A36 A;  2KE9 A;  2EGA A;  3VS4 A;  2MIO A;  2GGR A;  3PVL A;  1OOT A;  4OMM A;  2FEI A;  4JZ3 A;  1OPK A;  3VS6 A;  2M0Y A;  1NYG A;  1X69 A;  3REB B;  4RTX A;  3M0R A;  1ZLM A;  1WFW A;  2ECZ A;  2EGE A;  3TSZ A;  2K9G A;  2XMF A;  2VWF A;  2YUN A;  1NYF A;  2O9V A;  1AZE A;  1ZSG A;  1SHG A;  1YCS B;  1ZUU A;  2LP5 A;  4JJC A;  2PNI A;  1UHC A;  1UHF A;  4RTY A;  4WCI A;  1SRM A;  2CH4 A;  2AZS A;  2VVK A;  1ZUK A;  2MOX A;  2DL3 A;  2EYW A;  1B07 A;  1I1J A;  2D8J A;  4AFS C;  1X27 A;  2KRM A;  2RQW A;  1ZUY A;  2DIL A;  2DBK A;  1VA7 A;  3EG1 A;  1SEM A;  1NEB A;  2BTT A;  4D8D A;  1PNJ A;  4OMO A;  2OAW A;  4AG1 C;  1X6B A;  3NPF A;  1JXO A;  1TG0 A;  3H0F A;  2AK5 A;  1NM7 A;  2W0Z A;  4ORZ A;  3U23 A;  2DM1 A;  1JQQ A;  1TUC A;  1FYN A;  1MV3 A;  2EYZ A;  1M8M A;  1GCQ C;  1G2B A;  3VRY A;  5ECA A;  1OPL A;  2QDL A;  4F16 A;  1VYT A;  2DL4 A;  4JJB A;  5GJV B;  2JM9 A;  1OEB A;  2JS0 A;  2FRW A;  2CSQ A;  2NWM A;  1HJD A;  2LZ6 B;  4RTV A;  3NMZ C;  2J7I A;  1I0C A;  1UJ0 A;  2RQT A;  1W70 A;  4GBQ A;  3M0T A;  4EIK A;  2RF0 A;  1U5S A;  1K9A A;  4DEX A;  1QKX A;  2ABL A;  3VS1 A;  4JJD A;  4X1V A;  1JU5 C;  2CUB A;  3VS0 A;  1X2K A;  2DRK A;  3RBB B;  2ED0 A;  4OML A;  1UEC A;  4K11 A;  2DL5 A;  2RNA A;  3GBQ A;  1RLQ C;  2L0A A;  3THK A;  2CH4 W;  1E7O A;  5IXF A;  1GBQ A;  1ABQ A;  1XOV A;  1EFN A;  5IH2 A;  1JO8 A;  2EGC A;  3RNJ A;  2L2P A;  4Z88 A;  1YNZ A;  4CC7 A;  1PRL C;  2HBW A;  2C0T A;  3VS5 A;  2RMO A;  4E6R A;  4J9E A;  3M0Q A;  1T3S A;  1PRM C;  4RTZ A;  3VS2 A;  2J06 A;  2CT4 A;  3UF4 A;  2BZY A;  2F2W A;  1JXM A;  1K1Z A;  3I5S A;  4QT7 A;  2KRN A;  1GCP A;  4J9B A;  5GJW B;  2DX1 A;  2DNU A;  2IIM A;  2A37 A;  3H0I A;  2DL7 A;  1RUW A;  1KIK A;  2DF6 A;  2EW3 A;  4LN2 A;  3QWX X;  2SEM A;  2RPN A;  3ZL7 C;  1AVZ C;  2KRS A;  1PWT A;  1AEY A;  4J9H A;  2CDT A;  2F2X A;  2LCS A;  4R0K A;  4J9F A;  1CKA A;  4ZNX A;  1RLP C;  2DYB A;  4LUE A;  3EHR A;  1SPK A;  1WYX A;  1LCK A;  4F17 A;  4AG2 C;  2LX7 A;  1B3Q A;  1RI9 A;  2J6F A;  1AD5 A;  3SEM A;  3UAT A;  1UDL A;  2FPE A;  4AFU C;  5I22 A;  4Y92 A;  1BU1 A;  4HXJ A;  2BZ8 A;  1SSH A;  3UA7 A;  1TUD A;  2CRE A;  2I0N A;  1G83 A;  5IHI A;  3UA6 A;  1MUZ A;  1GFC A;  2KT1 A;  2ROT A;  2DVJ A;  1AZG B;  1U3O A;  4JPB W;  2AZV A;  1SHF A;  2HDA A;  1QWE A;  1E6G A;  4Z89 A;  2ESW A;  2RQU A;  2FG0 A;  3I35 A;  3NGP A;  3M0S A;  5IHN A;  4IIO A;  2G6F X;  2H8H A;  1U06 A;  5L23 A;  1AWJ A;  1E6H A;  1VYU A;  2D0N A;  3VS7 A;  2E5K A;  4GLM A;  2FPD A;  1H92 A;  1UTI A;  2KR3 A;  3PE0 A;  1NG2 A;  2LJ3 A;  1M3A A;  2PTK A;  4KRT A;  2SRC A;  3EG0 A;  1UFF A;  4RTT A;  2YDL A;  3EG2 A;  1X6G A;  2KGT A;  2C0O A;  1W6X A;  1UE9 A;  1WLP B;  3PVQ A;  1BB9 A;  2DJQ A;  2ENM A;  2GBQ A;  2K3B A;  1T0H A;  2V1Q A;  4LUD A;  1X43 A;  2DE0 X;  2DBM A;  1HSQ A;  4J9I A;  2B86 A;  1WXB A;  2J6O A;  2JMC A;  1YP5 A;  2KXC A;  2KYM A;  3I9Q A;  4HVU A;  4CC4 B;  1UUE A;  1QCF A;  2DLP A;  2J6K A;  4CC2 A;  5IHK A;  1FMK A;  4LNP A;  3TVT A;  1KFZ A;  1NLO C;  4HVV A;  2LMJ A;  4Z8A A;  1M3C A;  4OMP A;  2CSI A;  2FPF A;  2EYX A;  2LQW A;  1J3T A;  1Z9Q A;  1PHT A;  1KSW A;  2K2M A;  1MV0 B;  3EG3 A;  5HCK A;  2KEA A;  2X3W D;  4ESR A;  3IQL A;  3A98 A;  2F2V A;  4A63 B;  2FRY A;  2EVR A;  1W1F A;  2DRM A;  3SHW A;  2JW4 A;  1WX6 A;  4FSS A;  1V1C A;  1PKS A;  2O9S A;  5IXB A;  2RQV A;  2YT6 A;  2EYY A;  1WXU A;  2KYB A;  2W10 A;  1Y0M A;  2HEQ A;  2K6D A;  1CKB A;  2L3Q A;  1UGV A;  2K7A A;  1OV3 A;  2ED1 A;  2LQN A;  2CT3 A;  3R6N A;  2MCN A;  1AWX A;  1WI7 A;  2BZX A;  2AKK A;  2O2O A;  1K0S A;  2C0I A;  2P4R A;  1Y57 A;  1BBZ A;  1VYV A;  2O88 A;  2KBT A;  1AWO A;  2X3X D;  4DEY A;  2ROL A;  1AOJ A;  1M3B A;  4IIM A;  2GQI A;  1SRL A;  4CC3 A;  1Z9Z A;  2YSQ A;  4HVW A;  2EKH A;  5FWB A;  1GCQ A;  2L3S A;  2JS2 A;  3M0P A;  4OMN A;  2D8H A;  4OMQ A;  2EBP A;  2JXB A;  3EGU A;  3H41 A;  1BK2 A;  2JMA A;  2DA9 A;  4RTU A;  4F14 A;  2GNC A;  2DL8 A;  2KRO A;  2YUP A;  3NHN A;  2JTE A;  2DMO A;  2RN8 A;  2NUZ A;  1WIE A;  1A0N B;  2EPD A;  1T0J A;  1QKW A;  1ABO A;  3KFV A;  1UJY A;  1I07 A;  5EC7 A;  2FO0 A;  2RQR A;  1WA7 A;  1N5Z A;  1GRI A;  5FW9 A;  2AKL A;  1PKT A;  2J05 A;  4AFZ C;  4LE9 A;  2HCK A;  2O31 A;  1AWW A;  3CQT A;  1NEG A;  1IO6 A;  1NLP C;  1QLY A;  2LNH B;  4HCK A;  2KXD A;  1UG1 A;  1YWP A;  1X2Q A;  3JV3 A;  2K79 A;  1H3H A;  2OI3 A;  3H0H A;  2M51 A;  4JZ4 A;  1K0X A;  2LJ1 A;  3VRZ A;  2JM8 A;  4J9C A;  1WXT A;  2EQI A;  3TSW A;  3REA B;  1JEG A;  4J9D A;  5FWC A;  1M27 C; 
#chains in the Genus database with same CATH topology
 2JT4 A;  2Y4X A;  3PGG A;  1VQK T;  2KNB B;  4JRQ A;  4PFO A;  1IHV A;  2LTO A;  4ME7 A;  2VKN A;  3FJ5 A;  4E7S A;  3CME T;  4MML A;  5LJ5 f;  3ULR B;  3OYY A;  1M8V A;  1BIB A;  3OYL A;  2DKG A;  5GAN j;  2OJ2 A;  3EFS A;  1U1T A;  3C0C A;  1MGQ A;  3Q1J A;  3MCA B;  2VGN A;  2QEX T;  1WHG A;  1ARK A;  4AFQ C;  1YN8 A;  1GFD A;  1CSK A;  5GMK h;  1KC8 R;  1VQ6 A;  4M78 F;  3ASK A;  3M0U A;  3CCU Q;  3CCE Q;  1D0Z A;  1T3L A;  3FRN A;  3G7Z A;  2KE9 A;  2MIO A;  3PVL A;  2FEI A;  5A0D A;  1NYG A;  1ZLM A;  3TSZ A;  2XID A;  2XMF A;  1P92 A;  3RKX A;  1Y96 B;  1AT1 B;  5A2Q E;  1ZSG A;  1SHG A;  1ZUU A;  2DD5 A;  1K73 C;  1G3T A;  1KQS A;  4M7A G;  3LX7 A;  2CH4 A;  2AZS A;  2DL3 A;  2QA4 Q;  1XTD A;  1W2B S;  1I1J A;  2D8J A;  4AFS C;  1X27 A;  2KRM A;  3CCJ A;  2RQW A;  4GY5 A;  1Y96 A;  4NL2 A;  3EG1 A;  1U8R A;  1NEB A;  2BTT A;  2COZ A;  4D8D A;  2K2V A;  3FEO A;  3QYH B;  1M9S A;  2ZCF B;  3HFN A;  3CCQ A;  1TG0 A;  2RHY A;  1VQM Q;  4ANJ A;  3U23 A;  3AHU A;  1TUC A;  2JTF A;  4EPC A;  1LPL A;  1GCQ C;  3VRY A;  4M77 E;  3CCJ T;  1OPL A;  1OUL A;  2QDL A;  3URG A;  5GJV B;  2JM9 A;  3G1J A;  2X4X A;  2E5Q A;  2J7I A;  3CCQ T;  1W4S A;  1RAE B;  1UJ0 A;  2XDP A;  1W70 A;  1FMV A;  1D1B A;  4O6J A;  1IHW A;  4N4H A;  5LJ5 e;  1JU5 C;  4ELY C;  3VS0 A;  1M90 R;  1X2K A;  4RG8 A;  4OGE A;  1QVF S;  4OML A;  4PJJ A;  1M1K C;  1WPY A;  2MK5 A;  4A4G A;  4IUQ A;  5CKD A;  3A8O B;  2R5A A;  3E19 A;  2DXU A;  1ABQ A;  4RG2 A;  2F5T X;  4M75 G;  2L2P A;  4Z88 A;  2DTO A;  1YNZ A;  4L59 A;  3BY7 A;  3V8L A;  3CXC A;  2C0T A;  2E10 A;  1N8R R;  3UDC A;  2MAM A;  4BDZ A;  1G3Y A;  1YI2 A;  1N27 A;  2CS7 A;  4ZN3 A;  3OSS C;  2R57 A;  3UF4 A;  3RDV A;  5EG2 A;  2XDD A;  2QDY B;  1JXM A;  1M90 U;  2KRN A;  3P8D A;  5GJW B;  1NPP A;  4JJN K;  3M58 A;  3QZ5 B;  1YIT Q;  2DNU A;  2A37 A;  2YXY A;  5J39 A;  2DF6 A;  2FVU A;  4LN2 A;  2RJD A;  3QWX X;  3JCM c;  1KQ2 A;  2LRQ A;  3LWI A;  2LT1 A;  2PUO B;  4ZNX A;  2PUK B;  1N8R U;  1RLP C;  2DYB A;  2LX9 A;  1ZSZ C;  3LYI A;  3V8J A;  1B3Q A;  1RI9 A;  4RCB A;  1QVG A;  3ME9 A;  3VU3 C;  2J6F A;  4OP0 A;  2H3J A;  5I22 A;  5IAY A;  2BZ8 A;  2CRE A;  1SSF A;  1G83 A;  4PKC C;  1VQ5 Q;  4M7D E;  2ROT A;  1WJS A;  3HPW A;  2DVJ A;  4M78 G;  4BB7 A;  1AZG B;  4JPB W;  3OS1 A;  1SHF A;  3CBO A;  5HK3 A;  2QXF A;  3JB9 G;  2RH2 A;  1VQP Q;  2RQU A;  3ZBD A;  4O5V A;  4EMK B;  4X9C A;  1PSE A;  1N6A A;  2E70 A;  2G6F X;  2H8H A;  1U06 A;  5FLX E;  1E6H A;  4FSX A;  3HRS A;  4E2F B;  3CMA Q;  3CC7 A;  4MZT A;  2OTL Q;  1H92 A;  1UTI A;  1NG2 A;  1UGQ B;  1Q82 R;  4EMK A;  1PD1 A;  1WQW A;  4OB1 B;  4OB0 B;  1UFF A;  1X6G A;  4JS4 A;  2KGT A;  3UT1 A;  3L2Z A;  3OW2 P;  1UE9 A;  3PVQ A;  2DJQ A;  1RAF B;  4D6W A;  4XTU A;  5GAM j;  1YIJ A;  5KYW A;  2DE0 X;  3QDF A;  1HSQ A;  1K9M R;  2J6O A;  1BCM A;  2D0Q B;  1YP5 A;  3E9G A;  3OYB A;  2L3R A;  4HVU A;  4CC4 B;  1VQO Q;  1UUE A;  2F1L A;  1QCF A;  3M54 A;  1NZ9 A;  2J6K A;  3OQ5 A;  4C5G A;  2E12 A;  1M5Q 1;  3CCL Q;  3HP9 A;  3CC7 T;  1NLO C;  4LXC A;  1Q82 U;  2FPF A;  3OMG A;  4FT2 A;  2PQW A;  1RAB B;  3G4S Q;  5DM7 R;  1J3T A;  3KUF A;  3M4Y A;  2K2M A;  1MV0 B;  2X3W D;  1BI0 A;  4ESR A;  3CD6 Q;  3IQL A;  1YIJ T;  4L5G A;  2IVW A;  4A63 B;  5FRO A;  1K9M U;  3SHW A;  1Q86 C;  1WX6 A;  1UGS B;  2D9T A;  1PKS A;  2RQV A;  4RCC A;  2EYY A;  2KYB A;  3L2Q A;  1Y0M A;  3TU4 K;  1KK7 A;  2QAZ A;  2VXF A;  4J8O A;  1Q7Y C;  1OV3 A;  2LQN A;  4BI8 B;  1O75 A;  1AWX A;  5CO7 A;  4TVR A;  2P4R A;  4IKF A;  2CKK A;  1OYX A;  3HSB A;  4A4F A;  3J80 E;  5AYF A;  1TOV A;  1HXD A;  2EJG A;  2GQI A;  3CCV A;  2VYT A;  2NUT B;  5GAN 8;  1YHQ Q;  2KI7 A;  2YSQ A;  2LQK A;  1W2B A;  2V8J A;  1K73 R;  2E1H A;  1D09 B;  2CP6 A;  4OGC A;  2JS2 A;  4KGZ B;  1IRX A;  2D8H A;  4M75 B;  3ER0 A;  3INZ A;  4DBF A;  4F7U F;  1VQ7 Q;  3GIB A;  5CKE A;  2DYI A;  1AHJ B;  2NUT A;  2IG0 A;  2YLC A;  4M75 D;  5GAO n;  2DMO A;  3CC2 Q;  2C06 A;  2HQE A;  1T0J A;  1VQ4 Q;  4PJM A;  1WHL A;  1K8A R;  3PIP A;  2JVV A;  1UJY A;  3NFC A;  1I07 A;  1VQL A;  3MHX A;  2CP2 A;  1U1S A;  4PJO C;  1N5Z A;  2AKL A;  1K73 U;  2LNH B;  2KXD A;  5CVI A;  3QBY A;  3TCJ A;  2K79 A;  2M51 A;  2QQR A;  4JZ4 A;  2LJ1 A;  4PJN A;  3VRZ A;  2FZC B;  2A0F B;  2L5Q A;  4OVA A;  3TSW A;  1I8F A;  2EJ9 A;  5D7U A;  3CCR T;  3KXT A;  1QP2 A;  1UGR B;  1K8A U;  1K76 A;  1HD3 A;  1VQL T;  2LJ0 A;  1TH7 A;  1H8K A;  1QVF A;  2DER A;  2GTO A;  2D1X A;  4BE2 A;  3CXC S;  4IUR A;  1JJ2 A;  5GAN 6;  3QPH A;  4M78 B;  2YWW A;  2A28 A;  1YJW A;  2A7Y A;  1GL5 A;  3DB3 A;  3H8Z A;  1MMA A;  2OX7 A;  4M78 D;  4QQD A;  1QMC A;  3RER A;  4V2S A;  1YBY A;  3VYH B;  1GXI E;  4B6M A;  1KJW A;  3JB9 D;  1WQ7 A;  1ZBJ A;  2B8A A;  1M2V B;  1ZX6 A;  3VS3 A;  2PZ1 A;  1EZZ B;  2IPO B;  3LW5 E;  2EGA A;  3DLM A;  1IXD A;  2GGR A;  2K3X A;  4OMM A;  4M7D A;  1KHI A;  4JZ3 A;  2QTV A;  4BY6 B;  3OS5 A;  2M0Y A;  5FU6 C;  3VS6 A;  2CZ0 B;  2E6Z A;  3I56 Q;  3M0R A;  5GAN 2;  1WFW A;  2ECZ A;  1M2V A;  1YJW T;  2K9G A;  1M1K U;  5GAN f;  2E6N A;  1WHM A;  3M4G A;  1AZE A;  5GAN d;  2DZC A;  1QVG S;  1FWZ A;  4WCI A;  4M77 F;  2CP5 A;  2VVK A;  1ZUK A;  2Y4Y A;  1ZBX A;  2VAS A;  1B07 A;  2E41 A;  3BFM A;  4C5H A;  3C94 A;  3L2R A;  2YRD A;  1MND A;  3CCM A;  5CK9 A;  2ZPF B;  1VQN A;  4E7Z A;  1D1C A;  1PNJ A;  3BDU A;  4IUT A;  4KT0 E;  3JCM V;  4AG1 C;  5I2M A;  2E3I A;  2XI9 A;  4XU2 A;  5CQY A;  2HQH A;  3EH1 A;  8AT1 B;  3H0F A;  4FU6 A;  2AK5 A;  8ATC B;  2DTI A;  4PFZ A;  4QQG A;  5CIU A;  1FYN A;  4L6V 5;  2EYZ A;  2RI2 A;  2GFU A;  3JCM d;  2COY A;  2F69 A;  3OYM A;  4F16 A;  2P0P A;  1VYT A;  2DL4 A;  4JJB A;  2K57 A;  4C0Z A;  3OYI A;  1VQN T;  3C12 A;  2JS0 A;  2FRW A;  4F7U E;  1M1G A;  4DBH A;  2CZ6 B;  3FJP A;  5KE2 A;  4DA4 A;  1R77 A;  3M0T A;  4XU1 A;  4EIK A;  4E7I A;  2RF0 A;  4NS5 A;  4EDU A;  2QQS A;  5C0M A;  3CPW A;  3L2W A;  2BUD A;  1PSF A;  4X1V A;  5CKB A;  3RBB B;  2DRK A;  2RHI A;  1KQ1 A;  2ED0 A;  1OI1 A;  5GMK e;  2LDM A;  2DL5 A;  2RNA A;  2L0A A;  5GAN 4;  2PVO B;  3THK A;  3CCE A;  2CH4 W;  1E7O A;  2EJF A;  4JRI A;  1XOV A;  3JCM X;  5IH2 A;  1JO8 A;  3RNJ A;  5CR2 A;  1M1F A;  5LJ3 j;  3BE3 A;  3M0Q A;  2EQM A;  1S72 Q;  2E64 A;  4RTZ A;  2J06 A;  1C6V X;  4XTV A;  2CZ7 B;  2F2W A;  4ATO A;  3LLR A;  3I5S A;  2RK1 A;  1GCP A;  5GAN e;  4M7D F;  2DX1 A;  2LCL A;  2QA4 A;  1Q81 C;  4NL3 A;  3GNG A;  3CCE T;  1Q86 R;  1C1A A;  4PLL A;  3G6E Q;  5J26 A;  5IT9 E;  2KY9 A;  5J3B A;  1PWT A;  2MMP A;  4DBR A;  3RES A;  4QVC A;  4J9F A;  4BI3 A;  4KUI A;  5FRN A;  1YJ9 Q;  5GAN h;  2ZGW A;  1NE8 A;  1VQ6 T;  1NJI C;  1LCK A;  3PT9 A;  4AG2 C;  1VQM A;  1OQK A;  3QUI A;  1QVP A;  3UAT A;  1UDL A;  2MWO A;  2R5M A;  2VUB A;  4BDY A;  1SSH A;  3UA7 A;  2I0N A;  5GMK i;  5IHI A;  3UA6 A;  4WTO B;  2KDS A;  1MMN A;  1Q86 U;  2KT1 A;  2EQK A;  1U3O A;  2AZV A;  2A3L A;  4PJL A;  1RL2 A;  1QWE A;  5KCO A;  1IZ6 A;  4Z89 A;  2ESW A;  2FG0 A;  3X26 B;  2V26 A;  5GAN g;  3M0S A;  1KD1 C;  4KBM B;  2LNV A;  4IIO A;  1AWJ A;  4E47 A;  3DLL A;  1VQM T;  1FX7 A;  1B34 A;  1BIA A;  1RAH B;  3PMI A;  2E5K A;  2V8K A;  3V7R A;  5D6X A;  4A4K A;  1WNL A;  3LH0 A;  1M3A A;  2PTK A;  4C92 C;  2YDL A;  3OYF A;  2L89 A;  4II1 A;  3X24 B;  4PJO E;  3VKI A;  2RJC A;  1WLP B;  1BB9 A;  5L8R E;  3FDR A;  1T0H A;  2ZAE A;  5A0G A;  1ACM B;  4J9I A;  3O8V A;  2JMC A;  2KYM A;  3OMC A;  1R0B G;  4NOY A;  1JJ2 S;  2EQJ A;  3E1S A;  3L2U A;  2DPP B;  4KUL A;  1HYO A;  3PNW C;  1FMK A;  4XTW A;  4MMK A;  1XJW B;  4BD3 A;  3OYJ A;  4OMP A;  4DOV A;  1N9S A;  6AT1 B;  1YIT A;  2PU9 B;  3HRT A;  1OX9 A;  4YTL A;  1KSW A;  3I55 Q;  3JB9 I;  5GAM f;  4HA8 A;  3UWN A;  3SFM A;  1I5O B;  5GAM d;  2FB7 A;  2JW4 A;  1SG5 A;  2FHD A;  2BE9 B;  1RAG B;  1RI0 A;  4C0G A;  4J83 A;  4MDW A;  1ZHI A;  3F70 A;  1YFN A;  5KE3 A;  1ZSZ A;  2HEQ A;  4EMH A;  1OU8 A;  2OTJ Q;  2K6D A;  5AT1 B;  1UGV A;  2DET A;  2CT3 A;  1YIT T;  1VQ5 A;  1WI7 A;  5CKF A;  1YI2 T;  2NLU A;  2ZPI B;  2K5F A;  1BBZ A;  2X51 A;  2O88 A;  2X3X D;  4DEY A;  1M3B A;  1VQP A;  4MZM A;  3X20 B;  4IIM A;  1VQ8 A;  3QG1 A;  2RB6 A;  2EYQ A;  3GPL A;  4C0D B;  2EKH A;  2L3S A;  3PMT A;  4C8Q C;  3OBY A;  1LNX A;  4F7U A;  4LDY A;  4OMN A;  3SWN C;  3HL8 A;  3CMA A;  3J7A F;  2EBP A;  2OTL A;  3OYC A;  3H9N A;  1BK2 A;  1G3W A;  4F04 B;  5GAO m;  5KYY A;  1IGU A;  3SB2 A;  1OU9 A;  5KYX A;  4PLI A;  1VQ5 T;  4M7D G;  4F14 A;  2GNC A;  2DL8 A;  5KYU B;  2KK4 A;  2HMA A;  4KGV B;  2WSF E;  1D3B B;  2M9U A;  4C92 F;  3TEE A;  1WIE A;  4N4I A;  3KFV A;  5EC7 A;  1VQP T;  1VQ8 T;  5KYW B;  2LCC A;  4ZGE B;  3CCS Q;  3BW1 A;  1VQO A;  1WA7 A;  5KYU A;  2V8I A;  3VUB A;  2JZ2 A;  1D3B A;  1PKT A;  2J05 A;  3OYN A;  2HCK A;  1C0M A;  1AWW A;  2XG8 D;  3CMA T;  5I21 A;  2ZZD A;  3CCL A;  5GAN 7;  1IO6 A;  4HCK A;  2OTL T;  2X9H A;  4JS5 A;  2DIG A;  1UG1 A;  1YWP A;  3CPW S;  1H3H A;  3M59 A;  3H0H A;  3CBP A;  3G4S A;  1YCY A;  2XHC A;  1WXT A;  4J9D A;  5FWC A;  3CD6 A;  4OF1 A;  4J5Y A;  4FYY B;  3LH5 A;  1VUB A;  4B9W A;  2HAX A;  1K4U S;  3EFR A;  4RKU E;  3M9Q A;  1VQO T;  3CC7 Q;  5GAM e;  1QCO A;  4EMK C;  1Y7X A;  1HK9 A;  1EIF A;  2MI6 A;  2YUO A;  4OB3 B;  1S1N A;  1QW1 A;  4LDX A;  4PNO A;  1YWO A;  2YUQ A;  4KGX B;  3G4S T;  4XTZ A;  3QWY A;  4DBQ A;  2AT1 B;  1KC8 C;  1BYM A;  4ZTJ A;  5GAM h;  5DLQ E;  4RUG A;  1VIF A;  3CD6 T;  2L3P A;  2A36 A;  3VS4 A;  2QAS A;  2XU8 A;  1OOT A;  2DO3 A;  4M77 B;  4M7A C;  1SF9 A;  2EGE A;  3QSU A;  2VWF A;  4C8Q F;  1VQ7 A;  4M77 D;  1NYF A;  2O9V A;  2RHX A;  2DXB A;  1YCS B;  2LP5 A;  4JJC A;  4M77 A;  1UHC A;  7AT1 B;  4RTY A;  1YJN Q;  2O01 E;  1Q95 G;  2HSE B;  4XK8 E;  1DJ7 B;  2E4H A;  3CC2 A;  2MOX A;  5GAM g;  1KG1 A;  4EMG A;  4UC4 A;  2JJ9 A;  3JSC A;  1WJQ A;  4GLK A;  1VA7 A;  1SEM A;  1TU0 B;  4A53 A;  5HY6 A;  3OW2 A;  4OMO A;  4PJO A;  2GQV A;  1LVK A;  1X6B A;  2CP0 A;  3NPF A;  4XTY A;  3EGD B;  1JXO A;  3QYG B;  4E7J A;  4QW2 A;  1VQ7 T;  4HT9 A;  1OZ3 A;  2DD4 A;  3CC4 Q;  3J81 E;  3OBW A;  1NM7 A;  1ZQ1 A;  3GOX A;  3CCV T;  4N0A A;  4ORZ A;  2DM1 A;  4KH1 B;  1XNI A;  3CC2 T;  3HRU A;  1MV3 A;  4XQ3 A;  3EGD A;  4WF2 A;  3G71 Q;  3C95 A;  2RJF A;  5GAO q;  4VUB A;  2QGG A;  2XK0 A;  4LD9 K;  2DVE A;  2DZ9 A;  1HJD A;  2LZ6 B;  2QYZ A;  2QK0 A;  3NMZ C;  3OS0 A;  1H64 1;  1PCX A;  1I0C A;  1VIE A;  3QJY A;  2RQT A;  1U5S A;  1K9A A;  3VUZ A;  4C92 E;  4DEX A;  2ABL A;  3VS1 A;  1M90 C;  1QQJ A;  2LQ8 A;  4M75 C;  4OB2 B;  4JJD A;  3SDZ A;  5GAO r;  4Q5W A;  1UB4 A;  3CCR Q;  5FU6 B;  2K3Y A;  2YHT A;  2JOY A;  3GBQ A;  3EH2 A;  3E9F A;  3VYG A;  3NTI A;  1TUG B;  2GCX A;  1M1K R;  1GBQ A;  2YRV A;  1KD1 U;  1M4Z A;  4E7K A;  5C6S A;  3OYK A;  1EFN A;  2P4T A;  1N8R C;  4FT4 A;  4M7D B;  4J9E A;  2WAC A;  3I56 A;  1M2O A;  4M7A F;  4KUD K;  1T3S A;  5FRM A;  5FU7 B;  4M7D D;  3QHS A;  4R55 A;  2CT4 A;  2DFU A;  2BZY A;  3ZFJ A;  4J7F A;  1VQ9 Q;  2YRC A;  1JB0 E;  1RAA B;  2M16 A;  9ATC B;  3PIO A;  3H0I A;  1XQH A;  4FW1 A;  1KIK A;  1YJW Q;  3TRE A;  3ZL7 C;  2KRS A;  2CDT A;  2F2X A;  2LCS A;  1G8X A;  3I56 T;  5LJ3 f;  1CKA A;  3EFO B;  4ZTF A;  5LJ3 d;  4M78 C;  5GAO l;  1SPK A;  2ZPG B;  2D6F A;  4X34 A;  2DTH A;  5GMK m;  3GF5 A;  4N4G A;  3DKM A;  4AFU C;  4Y92 A;  3EFO A;  4PJO F;  1TUD A;  1QCN A;  2JUF A;  5I2S A;  2H3E B;  1GFC A;  3GLX A;  1WHK A;  4FCY A;  2HNI A;  2COW A;  4C8Q E;  1WZO A;  2MYS A;  4HCC A;  2Y90 A;  2DXT A;  4BY6 C;  2HBP A;  3JCM f;  2VGM A;  1SKU B;  1WJR A;  5IHN A;  2DJZ A;  4QKU A;  4FW2 A;  2DK3 A;  1KQS P;  1VYU A;  4IUP A;  2D0N A;  3V8K A;  3JRZ A;  3CCM T;  4P5N A;  2FYK A;  4M75 F;  3OYH A;  2QI2 A;  2RA2 A;  2KR3 A;  2LJ3 A;  4AT1 B;  4J6W A;  2RD1 A;  2SRC A;  3EG0 A;  3EG2 A;  4X9D A;  1X75 C;  2P84 A;  3OS2 A;  2C0O A;  2DXC A;  1W6X A;  2ENM A;  1TSF A;  4F7U G;  2K3B A;  1K9M C;  3JB9 H;  2V1Q A;  1X43 A;  2DBM A;  1VQK Q;  2O4X B;  2VXE A;  2B86 A;  1IGQ A;  1WXB A;  1S72 A;  2KXC A;  1MHN A;  3I9Q A;  2OAU A;  3CCU A;  2EIF A;  3A8L B;  3QXE B;  3RR6 A;  3CME Q;  2DLP A;  4BUG A;  5A0L A;  5M9O A;  4LNP A;  3TVT A;  2JNG A;  1KFZ A;  2LMJ A;  2O4X A;  1M3C A;  4Z8A A;  3OY9 A;  4MZP A;  1O9S A;  4FL6 A;  2MF2 A;  2QEX Q;  2AHJ B;  2PVD B;  2DEU A;  3G6E A;  5HK0 A;  1PHT A;  2XIC A;  4J6Y A;  3EG3 A;  1MNE A;  3C4S A;  5HCK A;  2KEA A;  2NUP B;  5LJ5 d;  4C5I A;  2EFI A;  2F2V A;  4C5E A;  1YJ9 A;  1W1F A;  4A4E A;  2DRM A;  1S72 T;  3CCU T;  2RHZ A;  1WXU A;  1ZA2 B;  2W10 A;  5LJ3 e;  1VOM A;  2NUP A;  1CKB A;  1EX4 A;  3JB9 F;  2K7A A;  2ED1 A;  3MEV A;  3R6N A;  2MCN A;  1Q7Y R;  5GAN 3;  2AKK A;  2O2O A;  3V7C A;  3G6E T;  1MMG A;  1Y57 A;  4M7A E;  3CXC P;  2KMT A;  2KBT A;  1VQ6 Q;  5LJ3 h;  2ROL A;  1F1B B;  1AOJ A;  3OYD A;  3UPU A;  1YJ9 T;  2QA4 T;  2HL3 A;  3OW2 S;  3EGX B;  4C92 B;  3V7S A;  3EG9 B;  1GCQ A;  1BI2 A;  3M0P A;  3JCM e;  1KC8 U;  4HKE A;  1B34 B;  2QQA A;  4C92 D;  2JXB A;  3H41 A;  3M53 A;  2JMA A;  4JRK A;  1JRI A;  4RTU A;  3EGX A;  2BIV A;  4C92 A;  1BKB A;  1Q7Y U;  3EG9 A;  2FL7 A;  2DEQ A;  2YUP A;  3R6O A;  2JTE A;  2RN8 A;  3WVE B;  1K8A C;  2NUZ A;  1A0N B;  2EPD A;  1PC0 A;  5LJ3 g;  1R0C B;  5CQX A;  3JCM h;  4DQ2 A;  1FXX A;  3JB9 J;  3CCJ Q;  4MDX A;  4M77 G;  4JRP A;  1QVG P;  1BCO A;  4AFZ C;  4LE9 A;  3CQT A;  5LJ5 j;  3CCQ Q;  2I2L A;  4JDS A;  1QLY A;  4LDV A;  1WHH A;  3HKS A;  1X2Q A;  2ZPE B;  1WGS A;  1KHC A;  2G3R A;  4LD6 A;  4PJO G;  4B9X A;  2EQI A;  4LDU A;  3I55 A;  3CBM A;  3VV0 A;  1JEG A;  3JCM P;  1M27 C;  3JCM g;  3QZ9 B;  2RO0 A;  4IUV A;  4CI0 C;  1MMD A;  3EHQ A;  1QWF A;  2V1R A;  4J9G A;  2LT4 A;  4M75 E;  3HTR A;  3MPU B;  2CUD A;  3O5Z A;  2KT8 A;  2XD0 A;  1WDX A;  2GTJ A;  3ZEH A;  1ZSZ B;  4FYX B;  2OTJ A;  4BI4 A;  5KCH A;  3A8G B;  1M30 A;  3NTK A;  4RTW A;  5LJ5 h;  3JCM W;  3I55 T;  2LC4 A;  2HSP A;  3E2U A;  4C8Q B;  2A08 A;  1GBR A;  4D8K A;  5I11 A;  4PL6 A;  3SWN B;  3I5R A;  4M4Z A;  3S3M A;  2CP3 A;  1V76 A;  2HL5 C;  4C8Q D;  4R56 A;  1OPK A;  1X69 A;  3REB B;  3QO3 A;  3RUX A;  3P8B B;  1TS9 A;  4RTX A;  4C8Q A;  5GMK l;  4F7U B;  3RKW A;  2KVQ G;  2YUN A;  3LGL A;  3SWN A;  2OTJ T;  1YI2 Q;  2HKQ B;  4QVD A;  3LWH A;  2QGF B;  5KYY B;  4QVZ A;  2FZK B;  2PNI A;  5KYX B;  1UHF A;  5LJ5 g;  1RAD B;  3HFO A;  2KSS A;  1SRM A;  1Y07 A;  2EYW A;  4ZGD B;  3A8M B;  3D7S B;  3CEY A;  1ZUY A;  3N5B B;  3S3O A;  2DIL A;  5D6W A;  4M78 E;  2DBK A;  2K4Y A;  3CCS A;  1D0X A;  2EWN A;  2MPX C;  2DAQ A;  3OYE A;  3M56 A;  2OAW A;  4A54 A;  1BI1 A;  4AMC A;  2GF7 A;  2RI3 A;  2W0Z A;  4HCB A;  2LVM A;  2M02 A;  3T9N A;  1JQQ A;  3BDL A;  4J6X A;  1VQ8 Q;  2EKO A;  1M8M A;  1G2B A;  1TXQ A;  5ECA A;  3MEA A;  3MEW A;  1W2B P;  4FYV B;  3CCS T;  4CRI A;  1OEB A;  2X4Y A;  2CSQ A;  2NWM A;  2XDB A;  3S6W A;  3KBG A;  3OB9 A;  4RTV A;  4ELZ C;  5IN1 A;  3L1A A;  4C0D C;  3TQ7 P;  3JCM Q;  2F5K A;  1I5L A;  3QKJ A;  3M57 A;  4GBQ A;  1G3S A;  3OYA A;  1QKX A;  2JTM A;  2KQW A;  3JCM b;  3VJP A;  3PTA A;  2YLB A;  2CUB A;  3SD4 A;  4FIB A;  4Z02 A;  4M7A B;  2M1H A;  3L2V A;  1UEC A;  2RJE A;  4K11 A;  1IB8 A;  3CPF A;  1QP3 A;  1RLQ C;  4C0F A;  3X25 B;  3HHT B;  5IXF A;  3CCL T;  2CYZ B;  4M7A D;  4JUV A;  4PFP A;  2EGC A;  3MET A;  3MKD A;  3OA6 A;  4KH0 B;  2X35 A;  4CC7 A;  1PRL C;  2VC8 A;  1YIJ Q;  4M7A A;  2HBW A;  4XU3 A;  3VS5 A;  2RMO A;  4E6R A;  2QQB A;  4ZGJ B;  1PRM C;  3QII A;  4IUU A;  1PD0 A;  3VS2 A;  3M5A A;  2ZPH B;  3A8H B;  1K1Z A;  4QT7 A;  1IRE B;  1YJN A;  1YHQ A;  5GAO p;  4J9B A;  2GFA A;  2IIM A;  1QVF P;  2DL7 A;  1RUW A;  1Q81 R;  2X4J A;  1UEB A;  1JJ2 P;  1OZ2 A;  2EW3 A;  4QQ6 A;  2SEM A;  2RPN A;  1AVZ C;  1I81 A;  3GNF B;  1X6O A;  1AEY A;  1H3Z A;  4J9H A;  4R0K A;  2CP7 A;  4PJO B;  1N9R A;  1NPR A;  5D6Y A;  5CAI A;  1VQ4 A;  1KQS S;  4LUE A;  3EHR A;  1BI3 A;  1WYX A;  3CC4 A;  2EQU A;  4PJO D;  1OX8 A;  2FZG B;  4F17 A;  5KYN A;  1ZA1 B;  2LX7 A;  2ATC B;  1NJI R;  3X28 B;  4XU0 A;  1AD5 A;  2WSC E;  1YHQ T;  1YJN T;  3SEM A;  2FPE A;  1BU1 A;  3EAE A;  3L42 A;  4HXJ A;  2NYS A;  3FB9 A;  2BE7 D;  1G5V A;  3G71 A;  1MUZ A;  1Q81 U;  1X01 A;  4A4H A;  2MWP A;  2HDA A;  1E6G A;  5HKC A;  4M77 C;  3I35 A;  3NGP A;  3NTH A;  3CCV Q;  3P8H A;  3A5Z B;  1VQ4 T;  2E3H A;  2HKN A;  2Z0W A;  5L23 A;  3CC4 T;  1LJO A;  1KD1 R;  1TTH B;  4M75 A;  3CCR A;  3VS7 A;  1NJI U;  4GLM A;  2FPD A;  2RM4 A;  4DOW A;  3H6Z A;  2AIR B;  3PE0 A;  2ZPB B;  2VB6 A;  4KRT A;  4RTT A;  3G71 T;  4OMF B;  3WXM B;  4LDW A;  2GBQ A;  2M0O A;  1NBE B;  3S3N A;  4E7L A;  4LUD A;  4N0A C;  4FYW B;  1VQL Q;  3MO8 A;  2P0K A;  3RKY A;  4FM4 B;  3OYG A;  3MP6 A;  4XTX A;  4Y28 E;  3PFS A;  4C92 G;  3WVD B;  3LGF A;  1D1A A;  2K5I A;  4CC2 A;  5IHK A;  1D0Y A;  1VQ9 A;  1TWB A;  2HQX A;  5DY9 A;  4HVV A;  3FC3 A;  2QG9 B;  2CSI A;  3FIF A;  2EYX A;  3AT1 B;  3JCM J;  2LQW A;  2E65 A;  1I4K 1;  4BE0 A;  1Z9Q A;  1V29 B;  3JAM E;  3QDR B;  4PK4 A;  5CCA A;  3A98 A;  4HCZ A;  3MEU A;  2FRY A;  2EVR A;  4FSS A;  3QJ6 A;  2KAF A;  1V1C A;  3CPW P;  2O9S A;  5IXB A;  2YT6 A;  1B7T A;  4M78 A;  1RAI B;  1VQ9 T;  1Y71 A;  3A1P A;  1WHJ A;  2L3Q A;  4HT8 A;  1PG5 B;  2BZX A;  3GP8 A;  1K0S A;  3RMQ A;  2C0I A;  2L8D A;  3MP8 A;  1VYV A;  5GAN 5;  1AWO A;  3FLG A;  1RAC B;  4M7D C;  1SRL A;  4CC3 A;  1Z9Z A;  2QQ9 A;  4JLG A;  4HVW A;  4Y91 A;  5FWB A;  1UGP B;  5FU7 C;  2VV5 A;  4BE1 A;  2JN0 A;  1JBM A;  2HZY A;  2HD0 A;  2X4W A;  4OMQ A;  3EGU A;  2QTX A;  2DA9 A;  5KH6 A;  2BKD N;  2XKO C;  2CZ1 B;  2P0Q A;  2K5L A;  2KRO A;  1PM3 A;  3NHN A;  3MP1 A;  4E7H A;  4C8Q G;  1QKW A;  1ABO A;  2WSE E;  1Q82 C;  4BAC A;  3MJX A;  1VQK A;  3M55 A;  2CGH A;  2FO0 A;  3CCM Q;  4ZN1 A;  1VQN Q;  2RQR A;  5LL6 S;  1GRI A;  2RI5 A;  5FW9 A;  5DLO A;  3CME A;  4J7I A;  2O31 A;  1FMW A;  2RHU A;  1NEG A;  2RK2 A;  4XAX B;  1NLP C;  4RMO A;  3DB4 A;  5GMK j;  3JV3 A;  4JLI A;  3RMS A;  2OI3 A;  2R58 A;  2PVG B;  1K0X A;  2QEX A;  2JM8 A;  4J9C A;  5CKH A;  1LOJ A;  2EAY A;  3REA B;  2DIQ A;  3RIR A;  1R8O B;  3OSV A; 
#chains in the Genus database with same CATH homology
 1K76 A;  2JT4 A;  1HD3 A;  3LH5 A;  1K4U S;  2LJ0 A;  2KNB B;  1H8K A;  3EHQ A;  2GTO A;  1QWF A;  2V1R A;  4J9G A;  2D1X A;  2VKN A;  3FJ5 A;  2CUD A;  3O5Z A;  2KT8 A;  1WDX A;  2A28 A;  3ULR B;  2YUO A;  1S1N A;  2GTJ A;  1GL5 A;  2OJ2 A;  1M30 A;  3C0C A;  1YWO A;  2YUQ A;  4RTW A;  3QWY A;  1KJW A;  1ARK A;  2HSP A;  4AFQ C;  1YN8 A;  1GFD A;  1ZBJ A;  1CSK A;  2A08 A;  1GBR A;  1ZX6 A;  3VS3 A;  4D8K A;  2PZ1 A;  5I11 A;  4RUG A;  3M0U A;  2L3P A;  1T3L A;  3I5R A;  4M4Z A;  2A36 A;  2KE9 A;  2EGA A;  3VS4 A;  2MIO A;  2GGR A;  3PVL A;  1OOT A;  4OMM A;  2FEI A;  4JZ3 A;  1OPK A;  3VS6 A;  2M0Y A;  1NYG A;  1X69 A;  3REB B;  4RTX A;  3M0R A;  1ZLM A;  1WFW A;  2ECZ A;  2EGE A;  3TSZ A;  2K9G A;  2XMF A;  2VWF A;  2YUN A;  1NYF A;  2O9V A;  1AZE A;  1ZSG A;  1SHG A;  1YCS B;  1ZUU A;  2LP5 A;  4JJC A;  2PNI A;  1UHC A;  1UHF A;  4RTY A;  4WCI A;  1SRM A;  2CH4 A;  2AZS A;  2VVK A;  1ZUK A;  2MOX A;  2DL3 A;  2EYW A;  1B07 A;  1I1J A;  2D8J A;  4AFS C;  1X27 A;  2KRM A;  2RQW A;  1ZUY A;  2DIL A;  2DBK A;  1VA7 A;  3EG1 A;  1SEM A;  1NEB A;  2BTT A;  4D8D A;  1PNJ A;  4OMO A;  2OAW A;  4AG1 C;  1X6B A;  3NPF A;  1JXO A;  1TG0 A;  3H0F A;  2AK5 A;  1NM7 A;  2W0Z A;  4ORZ A;  3U23 A;  2DM1 A;  1JQQ A;  1TUC A;  1FYN A;  1MV3 A;  2EYZ A;  1M8M A;  1GCQ C;  1G2B A;  3VRY A;  5ECA A;  1OPL A;  2QDL A;  4F16 A;  1VYT A;  2DL4 A;  4JJB A;  5GJV B;  2JM9 A;  1OEB A;  2JS0 A;  2FRW A;  2CSQ A;  2NWM A;  1HJD A;  2LZ6 B;  4RTV A;  3NMZ C;  2J7I A;  1I0C A;  1UJ0 A;  2RQT A;  1W70 A;  4GBQ A;  3M0T A;  4EIK A;  2RF0 A;  1U5S A;  1K9A A;  4DEX A;  1QKX A;  2ABL A;  3VS1 A;  4JJD A;  4X1V A;  1JU5 C;  2CUB A;  3VS0 A;  1X2K A;  2DRK A;  3RBB B;  2ED0 A;  4OML A;  1UEC A;  4K11 A;  2DL5 A;  2RNA A;  3GBQ A;  1RLQ C;  2L0A A;  3THK A;  2CH4 W;  1E7O A;  5IXF A;  1GBQ A;  1ABQ A;  1XOV A;  1EFN A;  5IH2 A;  1JO8 A;  2EGC A;  3RNJ A;  2L2P A;  4Z88 A;  1YNZ A;  4CC7 A;  1PRL C;  2HBW A;  2C0T A;  3VS5 A;  2RMO A;  4E6R A;  4J9E A;  3M0Q A;  1T3S A;  1PRM C;  4RTZ A;  3VS2 A;  2J06 A;  2CT4 A;  3UF4 A;  2BZY A;  2F2W A;  1JXM A;  1K1Z A;  3I5S A;  4QT7 A;  2KRN A;  1GCP A;  4J9B A;  5GJW B;  2DX1 A;  2DNU A;  2IIM A;  2A37 A;  3H0I A;  2DL7 A;  1RUW A;  1KIK A;  2DF6 A;  2EW3 A;  4LN2 A;  3QWX X;  2SEM A;  2RPN A;  3ZL7 C;  1AVZ C;  2KRS A;  1PWT A;  1AEY A;  4J9H A;  2CDT A;  2F2X A;  2LCS A;  4R0K A;  4J9F A;  1CKA A;  4ZNX A;  1RLP C;  2DYB A;  4LUE A;  3EHR A;  1SPK A;  1WYX A;  1LCK A;  4F17 A;  4AG2 C;  2LX7 A;  1B3Q A;  1RI9 A;  2J6F A;  1AD5 A;  3SEM A;  3UAT A;  1UDL A;  2FPE A;  4AFU C;  5I22 A;  4Y92 A;  1BU1 A;  4HXJ A;  2BZ8 A;  1SSH A;  3UA7 A;  1TUD A;  2CRE A;  2I0N A;  1G83 A;  5IHI A;  3UA6 A;  1MUZ A;  1GFC A;  2KT1 A;  2ROT A;  2DVJ A;  1AZG B;  1U3O A;  4JPB W;  2AZV A;  1SHF A;  2HDA A;  1QWE A;  1E6G A;  4Z89 A;  2ESW A;  2RQU A;  2FG0 A;  3I35 A;  3NGP A;  3M0S A;  5IHN A;  4IIO A;  2G6F X;  2H8H A;  1U06 A;  5L23 A;  1AWJ A;  1E6H A;  1VYU A;  2D0N A;  3VS7 A;  2E5K A;  4GLM A;  2FPD A;  1H92 A;  1UTI A;  2KR3 A;  3PE0 A;  1NG2 A;  2LJ3 A;  1M3A A;  2PTK A;  4KRT A;  2SRC A;  3EG0 A;  1UFF A;  4RTT A;  2YDL A;  3EG2 A;  1X6G A;  2KGT A;  2C0O A;  1W6X A;  1UE9 A;  1WLP B;  3PVQ A;  1BB9 A;  2DJQ A;  2ENM A;  2GBQ A;  2K3B A;  1T0H A;  2V1Q A;  4LUD A;  1X43 A;  2DE0 X;  2DBM A;  1HSQ A;  4J9I A;  2B86 A;  1WXB A;  2J6O A;  2JMC A;  1YP5 A;  2KXC A;  2KYM A;  3I9Q A;  4HVU A;  4CC4 B;  1UUE A;  1QCF A;  2DLP A;  2J6K A;  4CC2 A;  5IHK A;  1FMK A;  4LNP A;  3TVT A;  1KFZ A;  1NLO C;  4HVV A;  2LMJ A;  4Z8A A;  1M3C A;  4OMP A;  2CSI A;  2FPF A;  2EYX A;  2LQW A;  1J3T A;  1Z9Q A;  1PHT A;  1KSW A;  2K2M A;  1MV0 B;  3EG3 A;  5HCK A;  2KEA A;  2X3W D;  4ESR A;  3IQL A;  3A98 A;  2F2V A;  4A63 B;  2FRY A;  2EVR A;  1W1F A;  2DRM A;  3SHW A;  2JW4 A;  1WX6 A;  4FSS A;  1V1C A;  1PKS A;  2O9S A;  5IXB A;  2RQV A;  2YT6 A;  2EYY A;  1WXU A;  2KYB A;  2W10 A;  1Y0M A;  2HEQ A;  2K6D A;  1CKB A;  2L3Q A;  1UGV A;  2K7A A;  1OV3 A;  2ED1 A;  2LQN A;  2CT3 A;  3R6N A;  2MCN A;  1AWX A;  1WI7 A;  2BZX A;  2AKK A;  2O2O A;  1K0S A;  2C0I A;  2P4R A;  1Y57 A;  1BBZ A;  1VYV A;  2O88 A;  2KBT A;  1AWO A;  2X3X D;  4DEY A;  2ROL A;  1AOJ A;  1M3B A;  4IIM A;  2GQI A;  1SRL A;  4CC3 A;  1Z9Z A;  2YSQ A;  4HVW A;  2EKH A;  5FWB A;  1GCQ A;  2L3S A;  2JS2 A;  3M0P A;  4OMN A;  2D8H A;  4OMQ A;  2EBP A;  2JXB A;  3EGU A;  3H41 A;  1BK2 A;  2JMA A;  2DA9 A;  4RTU A;  4F14 A;  2GNC A;  2DL8 A;  2KRO A;  2YUP A;  3NHN A;  2JTE A;  2DMO A;  2RN8 A;  2NUZ A;  1WIE A;  1A0N B;  2EPD A;  1T0J A;  1QKW A;  1ABO A;  3KFV A;  1UJY A;  1I07 A;  5EC7 A;  2FO0 A;  2RQR A;  1WA7 A;  1N5Z A;  1GRI A;  5FW9 A;  2AKL A;  1PKT A;  2J05 A;  4AFZ C;  4LE9 A;  2HCK A;  2O31 A;  1AWW A;  3CQT A;  1NEG A;  1IO6 A;  1NLP C;  1QLY A;  2LNH B;  4HCK A;  2KXD A;  1UG1 A;  1YWP A;  1X2Q A;  3JV3 A;  2K79 A;  1H3H A;  2OI3 A;  3H0H A;  2M51 A;  4JZ4 A;  1K0X A;  2LJ1 A;  3VRZ A;  2JM8 A;  4J9C A;  1WXT A;  2EQI A;  3TSW A;  3REA B;  1JEG A;  4J9D A;  5FWC A;  1M27 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...