1OEBA

Mona/gads sh3c domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
PLGSVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords GRB2-RELATED ADAPTOR PROTEIN 2
publication title Structural Basis for SH3 Domain-Mediated High-Affinity Binding between Mona/Gads and Slp-76
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1oebA00
2FPFA 1BBZA 3THKA 2CUDA 1AOJA 2EKHA 2V1RA 5IHIA 2FEIA 2SEMA 2BZYA 1W1FA 4ESRA 1NEGA 1I0CA 2K2MA 4J9FA 3VS4A 1SHFA 2FG0A 4KRTA 1PNJA 5L23A 3REAB 4GBQA 3LH5A 4LUEA 1WXBA 2KGTA 1GCPA 2HDAA 4JJBA 3U23A 2EYXA 2KXCA 1AEYA 1Y0MA 1PKTA 1W70A 1M3AA 1T0JA 2B86A 1AD5A 2K9GA 2HBWA 1EFNA 4Y92A 1X6BA 2LJ3A 4J9HA 2C0TA 1WYXA 1G2BA 2LNHB 2LMJA 1GRIA 2EYYA 2NWMA 2LCSA 5I11A 2A28A 1QKWA 1WXTA 4D8KA 2V1QA 2H8HA 2CREA 2YDLA 2L3QA 3M0PA 1ABQA 1X43A 2GGRA 1JXOA 2JS2A 1CKAA 1VYUA 4J9EA 4RTYA 1I07A 3RNJA 1PHTA 2CT3A 3VS0A 2O2OA 2RNAA 5EC7A 2KYBA 3R6NA 3H41A 2CUBA 4IIOA 2AKLA 3VRZA 4AG1C 1JU5C 2K7AA 2DA9A 4JPBW 1KFZA 3O5ZA 4D8DA 2EGCA 1RLPC 2RQVA 1E6GA 1Z9ZA 4HXJA 2ENMA 3I5RA 1BU1A 3NPFA 2EW3A 2IIMA 2M0YA 1ZUUA 3M0SA 4J9BA 1PRLC 2DRKA 4CC2A 2EGEA 4JJDA 1M3BA 2EBPA 1U5SA 2MIOA 1UDLA 1SRLA 1SEMA 2DX1A 2QDLA 2XMFA 3KFVA 2OAWA 3RBBB 1RUWA 1AVZC 1UFFA 3QWYA 4IIMA 1SHGA 1GBRA 2JT4A 2RQRA 3EGUA 1T3LA 5FWBA 1SPKA 2A37A 1PKSA 4J9CA 2FPEA 1OPKA 2J06A 4RUGA 2FO0A 1NEBA 2J05A 2KRMA 1CSKA 3EG3A 3C0CA 5IHNA 2A08A 2EPDA 4OMMA 2FPDA 4Z89A 1UECA 2ESWA 2VKNA 4E6RA 1WDXA 3REBB 4JZ3A 1PWTA 3VRYA 4AFUC 1M30A 1ABOA 2DRMA 3ZL7C 2DILA 2L3PA 1M27C 1ZUKA 1W6XA 2A36A 3ULRB 1UTIA 1WXUA 4M4ZA 2M51A 2D8HA 4JZ4A 1K4US 1H92A 4RTZA 1NM7A 4OMQA 1X2KA 2BZXA 1ZSGA 2I0NA 4HVVA 1YCSB 1UHFA 1Y57A 4AFSC 2DYBA 2P4RA 1HJDA 1K1ZA 1GL5A 2DM1A 1KJWA 4DEYA 2KNBB 2BTTA 2LJ1A 1MV0B 2EYZA 2EYWA 2YUQA 4RTWA 1QKXA 5FWCA 3GBQA 1FMKA 1ZBJA 1RLQC 2FRWA 2PNIA 3I35A 5IXFA 4LN2A 1AWXA 4EIKA 3PE0A 1X69A 2RN8A 4R0KA 2AKKA 1YN8A 1TUDA 3M0QA 2D0NA 1U06A 4HVUA 1A0NB 3EG1A 2JMCA 1WA7A 2EQIA 2J7IA 2LX7A 4WCIA 3I5SA 1XOVA 2KXDA 3VS3A 1JXMA 2GQIA 4CC7A 2CH4W 1HD3A 1X27A 1WX6A 1X2QA 3JV3A 1V1CA 2DL7A 2F2WA 2KT8A 2DF6A 2KYMA 1QCFA 3SHWA 2RQTA 2JS0A 3NHNA 1AZGB 1UGVA 1Z9QA 2J6OA 3QWXX 2EVRA 1BK2A 1GCQA 1AWOA 3VS1A 1VYTA 1N5ZA 1HSQA 3UF4A 2JM8A 2O9VA 4RTVA 2SRCA 2W10A 4LUDA 1WLPB 1JQQA 1T0HA 2KR3A 1M8MA 2VWFA 1NLPC 1ZLMA 4OMLA 3TSWA 2J6FA 2MCNA 2DBMA 1QWEA 3H0HA 4LNPA 2KE9A 2YUPA 3EHRA 2PZ1A 3UA7A 2ROTA 4FSSA 2L0AA 1CKBA 1E7OA 1H8KA 2ECZA 4RTXA 5HCKA 2YSQA 1UUEA 3EHQA 2JTEA 1I1JA 1MV3A 1S1NA 1GBQA 4CC4B 4AG2C 1OEBA 2ROLA 3SEMA 2GBQA 3NGPA 2YUNA 2D8JA 1M3CA 3IQLA 4ZNXA 4F17A 1K0SA 2VVKA 4OMNA 4J9DA 1TUCA 2X3XD 1KSWA 2JXBA 4DEXA 4J9IA 2G6FX 4Z8AA 4CC3A 1G83A 1RI9A 2O88A 1UJYA 4RTTA 2MOXA 1UHCA 3NMZC 2RPNA 3EG2A 1FYNA 1YWOA 4AFZC 2PTKA 1GFDA 3TSZA 3H0IA 2JM9A 1LCKA 2JW4A 4X1VA 4OMPA 4RTUA 1WIEA 5IXBA 2AK5A 4QT7A 2ED1A 1T3SA 2GTOA 2HSPA 2KT1A 2RQUA 2YUOA 1VYVA 5ECAA 4A63B 2DLPA 2JMAA 3VS5A 1GCQC 2CSQA 2DE0X 2ED0A 2J6KA 1ARKA 1U3OA 1QWFA 1B07A 2ABLA 2AZSA 3M0TA 1SRMA 2F2VA 1ZX6A 3VS6A 1BB9A 1ZUYA 2E5KA 1TG0A 1H3HA 2GNCA 2D1XA 1MUZA 2O9SA 4ORZA 2X3WD 1AWWA 3FJ5A 2RMOA 4LE9A 2RQWA 1K0XA 2CSIA 1X6GA 2L3SA 2KEAA 2LP5A 2YT6A 5GJWB 2CT4A 1J3TA 2C0OA 3TVTA 1NYGA 3M0RA 2K3BA 2KRSA 1VA7A 5FW9A 1OOTA 1YP5A 2LQNA 2NUZA 2KROA 4AFQC 2KBTA 2OI3A 2CDTA 3UATA 1AZEA 2RF0A 2DL3A 2FRYA 1UE9A 2W0ZA 1K9AA 1IO6A 3A98A 1UJ0A 1OV3A 1GFCA 4HCKA 1K76A 2LJ0A 2DNUA 2DBKA 2DJQA 2K6DA 1NLOC 3EG0A 2LZ6B 1UG1A 2DMOA 1WFWA 2F2XA 2GTJA 4F16A 2HEQA 1JEGA 3VS2A 1E6HA 1WI7A 1QLYA 2HCKA 3I9QA 3M0UA 2BZ8A 4HVWA 4GLMA 1JO8A 4F14A 2DL4A 4J9GA 2CH4A 3H0FA 4Z88A 1AWJA 2L2PA 2K79A 3PVQA 2AZVA 3CQTA 3PVLA 5IHKA 1B3QA 4K11A 2C0IA 2KRNA 1OPLA 3UA6A 5GJVB 1PRMC 2DL8A 2DVJA 4OMOA 1SSHA 1NYFA 1KIKA 4JJCA 2DL5A 1YNZA 5IH2A 2EGAA 5I22A 2O31A 3VS7A 1NG2A 1YWPA 2LQWA 2OJ2A
chains in the Genus database with same CATH superfamily
2FPFA 3HTRA 1BBZA 3VV0A 2CUDA 2F1LA 2FEIA 2BZYA 4F7UF 3RIRA 4FU6A 3I55A 2K2MA 2E6NA 5GMKm 1RI0A 1SHFA 4C0DB 2FG0A 4DBQA 4F7UB 4GBQA 2QEXA 1GCPA 2HDAA 3U23A 1AEYA 1PKTA 1BI2A 1AD5A 4C92G 3META 3JCMV 2QI2A 4HCBA 1Q95G 2JTMA 2DPPB 2PQWA 1WYXA 2LNHB 3WVDB 4PFZA 5KE3A 2E5QA 5I11A 2A28A 5A0LA 4D8KA 4F7UA 4NL2A 3CEYA 4E7LA 4JRQA 2YDLA 4BDZA 1YHQT 4FCYA 4RTYA 2YLBA 5LJ5j 2RI2A 4M7DE 4LD9K 2OTLA 3LYIA 1K8AC 1ZA1B 1IREB 3V7SA 3CCQA 1W4SA 4C8QA 5GAN7 5GAN3 4M7AC 5C6SA 2LX9A 2DA9A 1KFZA 7AT1B 4D8DA 2CYZB 1RLPC 2RQVA 4M78F 2DJZA 2NUPB 1M90C 3I5RA 3VKIA 2X35A 4PLIA 1M1KC 3M0SA 1QP2A 2X9HA 4M78B 1VQ4T 1PG5B 4ANJA 3CC7T 4ZTJA 5GAOl 1M90R 4OB1B 1VQ7Q 2MIOA 3CMAQ 1M1KR 3GPLA 3CD6T 2HL3A 3FJPA 2OAWA 5AYFA 3JCMX 4IIMA 1RAEB 5GMKj 1PKSA 2MF2A 1VQMT 2LNVA 4C92C 4RUGA 1WQ7A 3FRNA 2R57A 2DIQA 2P0QA 2XDDA 3CCLQ 1NPPA 1O9SA 2A08A 4OMMA 2VKNA 2ESWA 4E6RA 2HMAA 1VQ9A 2VYTA 1PWTA 3VRYA 3CCUA 3E9FA 4A54A 1ZUKA 2A36A 4BE2A 2K2VA 3ULRB 1C6VX 1QCOA 4VUBA 2X4WA 1WXUA 1VQKT 3CC2Q 4M7DD 4M4ZA 3JCMP 3EH1A 3S6WA 2M51A 1WJRA 1LNXA 1G3WA 2RJDA 5GMKl 4LDWA 4XAXB 3A8HB 4XK8E 3CCSQ 3EG9B 5CKFA 1OU9A 4EMHA 1Y7XA 1XTDA 4PL6A 2CP6A 3QSUA 5FRMA 2R5AA 2P4RA 1K1ZA 2DZ9A 3QKJA 1KJWA 2BTTA 2LJ1A 5KYWB 2YUQA 2YXYA 1FMKA 1ZBJA 3I35A 1JRIA 5IXFA 2V26A 1OQKA 2ZPBB 1TUDA 3I56T 1VQ5Q 3M0QA 4EMKC 3FC3A 4OB0B 4PJNA 5GAOq 4C0GA 1BKBA 2KMTA 1WA7A 2D9TA 2JN0A 3OBWA 4WCIA 4MDWA 5CAIA 2CZ6B 3MCAB 5KYWA 1Q82U 3RMSA 2RB6A 3JV3A 1ZSZC 2DL7A 2F2WA 1U1TA 3DLMA 3BFMA 3L42A 1QCFA 8AT1B 1OX9A 2RQTA 2JS0A 1M5Q1 4RG8A 3OYKA 3JB9H 1IRXA 3EGXA 1YJ9T 1Z9QA 2J6OA 3X20B 2EVRA 1AWOA 2E10A 4J7FA 5IN1A 1N5ZA 3HP9A 4PJOG 1PC0A 3TEEA 1M8VA 2JM8A 2W10A 1JQQA 1RAFB 5GAN6 4RCCA 2CGHA 2VGMA 4OMLA 1NJIU 2MCNA 3QG1A 1QWEA 3H0HA 2KE9A 4M75G 4OVAA 1D1AA 2YUPA 1VQPQ 1TXQA 5J26A 1VQLA 4GY5A 2PUKB 1EIFA 1TOVA 1VQNQ 3JCMQ 2ROTA 2YWWA 2ECZA 3CMEA 2C06A 1V29B 5HCKA 5GAMd 4CC4B 5CKBA 3S3OA 5GAMg 2YUNA 9ATCB 2D8JA 1K0SA 2VVKA 2X3XD 2E64A 4DOWA 1TUGB 2L89A 4XTUA 4CC3A 1G83A 2ATCB 3RDVA 3NTHA 1UGQB 1UHCA 3INZA 3RESA 3EG2A 2DEUA 3S3MA 2DK3A 2PTKA 4MMKA 1GFDA 4HA8A 4OMPA 3G6ET 4M77A 1WHMA 2COYA 3CC4A 2GTOA 1B34B 4PJOC 4A63B 1JJ2A 2DLPA 1BCMA 1MMAA 3EAEA 3MEUA 2LDMA 2J6KA 1V76A 1YHQQ 1B07A 4LDUA 1QQJA 2COWA 3OBYA 3SDZA 1SRMA 2GFAA 4AT1B 4M75C 2BKDN 3VS6A 1ZUYA 1R8OB 1H3HA 1C1AA 1B34A 3M55A 2A3LA 2D1XA 3OMCA 2X3WD 3G71A 2RMOA 4BUGA 2PUOB 1DJ7B 5FROA 1Y96A 2M9UA 3URGA 2YT6A 2RD1A 4DBFA 3CCVQ 2HKNA 2C0OA 2Y4YA 2F5KA 4BB7A 3F70A 2K3BA 1VQ4Q 4PLLA 1R0CB 1YP5A 2NUZA 5IT9E 5LJ5f 2CDTA 2RHUA 3CD6Q 3UPUA 2EKOA 5LL6S 5KYXA 1U8RA 4TVRA 1FMWA 5L8RE 1VQ8T 2DJQA 1Q82C 1YI2A 2K6DA 3EG0A 3FEOA 5D6YA 4MZTA 1EZZB 1UG1A 2DMOA 4ME7A 3EFRA 3QYGB 4F16A 1IXDA 3FB9A 1QVGS 2HQXA 3CMAT 2ZCFB 3JCMW 1Q82R 3UWNA 3M0UA 3V7RA 2RA2A 5CIUA 1JO8A 2IPOB 4C92E 1BIAA 3MEWA 2CH4A 3H0FA 4Z88A 1AWJA 2K79A 1QVGP 2AZVA 3CQTA 3PVLA 5IHKA 1B3QA 1P92A 2KRNA 3V7CA 3OY9A 3EFOA 5KH6A 2COZA 1VQKQ 1KIKA 2YRDA 4IUVA 3JCMf 3CCLT 3MO8A 2HD0A 2DL5A 3FIFA 4L59A 3SWNB 3JCMd 2L8DA 4M78G 3JCMg 1YJWA 1YWPA 3G1JA 2H3EB 4R55A 1BI0A 4C0DC 2QQ9A 5IHIA 3CC2T 2FL7A 3RKWA 2MWPA 3OSVA 5LJ5h 2RHXA 1OYXA 3M53A 4L6V5 2EJGA 1X01A 3AHUA 2NYSA 1WJQA 4KRTA 1K8AU 3J7AF 4N4IA 2X4JA 4MDXA 3EFSA 1WXBA 2KGTA 4JJBA 2EYXA 3I56Q 2CP7A 2EJFA 1R77A 4J6YA 1VQOT 2EYQA 1M3AA 1T0JA 1EFNA 3LH0A 4V2SA 1X6BA 5CQXA 2LJ3A 2FZCB 2GF7A 2NWMA 1WXTA 2V1QA 2H8HA 2QA4A 2CREA 3TREA 2L3QA 5LJ3j 3M0PA 4XU3A 2XHCA 2JS2A 2OX7A 3JCMh 2DAQA 1YJ9Q 1PHTA 5EC7A 2KYBA 5GMKh 3MEAA 1G3SA 1Q81U 2CUBA 4IIOA 2MYSA 4AG1C 1JU5C 2EAYA 2K7AA 5GAMe 3CCEA 3MP6A 5CO7A 2E12A 4M78C 2EGCA 1WHGA 4HXJA 2ENMA 3CPWA 5GMKi 3PT9A 1UGPB 3M56A 4R56A 1M2OA 2M0YA 4ZN1A 1ZUUA 5D6WA 1QVPA 2VUBA 4JJDA 4KH1B 4J6WA 3G4ST 1QCNA 5EG2A 3RBBB 1RUWA 1W2BS 2JT4A 4M7DA 1SPKA 2A37A 2DKGA 4J9CA 2FPEA 2J06A 5FU6B 2J05A 2QQSA 3C0CA 3BW1A 1VQPT 1W2BP 2KK4A 3OW2A 4ZN3A 2DVEA 1B7TA 1UECA 2HSEB 4PFPA 2MI6A 1VQNT 2XKOC 3CC7A 2M0OA 4AFUC 1M30A 1ABOA 3VUBA 3ZL7C 2G3RA 2DILA 1W6XA 1YCYA 3CCJT 1LJOA 2RI3A 1UTIA 3C94A 2K3YA 5M9OA 2AT1B 5I2SA 3G6EQ 6AT1B 2D8HA 1VQMA 3PMIA 1Q86C 3DB4A 2QASA 4RTZA 3OSSC 3QDRB 3D7SB 1X2KA 1ZSGA 1G3YA 1Q86R 4HVVA 1YCSB 1UHFA 1Y57A 4N4GA 1JB0E 2RK2A 1GL5A 4C8QF 2DM1A 1YIJQ 4N0AA 2L3RA 2DTOA 5J39A 4PJOE 1TSFA 2KNBB 2XIDA 5LJ5e 4HT9A 4BY6B 2EYZA 4MZMA 5FWCA 4RTWA 1QKXA 3OS1A 3GBQA 1QMCA 2E3HA 4C8QB 1RLQC 3CCMA 1AWXA 4EIKA 2V8KA 1X69A 3EH2A 4R0KA 1RADB 5GANh 3JCMJ 2Y90A 3N5BB 4M75E 2EQUA 1S72A 1RABB 2HNIA 2EQIA 1SSFA 1XOVA 5GAN5 1X6OA 1JXMA 2YRVA 1X2QA 3HHTB 3UDCA 4IKFA 3LX7A 2JVVA 4ZTFA 4E7SA 1K8AR 2GFUA 3SHWA 2LRQA 3NHNA 2MK5A 1VQ8Q 4DBHA 1NPRA 3JCMe 4RCBA 3ZBDA 3CCVT 2WSEE 3JSCA 3I56A 3X24B 1GCQA 3VS1A 1G5VA 1OULA 1PCXA 2MPXC 3DKMA 3HL8A 4FT4A 2JUFA 2SRCA 2AIRB 4LUDA 4JJNK 3DLLA 2ZPHB 5DY9A 1T0HA 1Q81C 2VWFA 1NLPC 1YFNA 2DD4A 3TSWA 2J6FA 1LOJA 4PJOD 1PD0A 3X25B 4LNPA 4QVDA 1TTHB 1Q81R 1ZQ1A 1TWBA 2PZ1A 3QXEB 4O6JA 1LPLA 3OYFA 1KQ1A 2KY9A 2HBPA 4QW2A 1CKBA 1E7OA 4X9CA 5DM7R 3MP8A 3L2ZA 3EHQA 1I1JA 1S1NA 5KYNA 1GBQA 4YTLA 4M75D 4BDYA 4X34A 1M1FA 4AG2C 4FW2A 4JRKA 4P5NA 3NGPA 4PKCC 2BIVA 4BD3A 1YBYA 4J9DA 4A4FA 1KSWA 4J9IA 2QEXT 2G6FX 3M58A 5FU7B 1RI9A 2O88A 2E3IA 2MOXA 4CI0C 2RPNA 1YWOA 2RI5A 4AFZC 1VQOQ 1RAHB 3LW5E 3CCRA 3QZ5B 5J3BA 4A53A 1YITT 5KYYA 4C5IA 5GAN8 5AT1B 1WHKA 2DXCA 2YUOA 2RQUA 5CK9A 3OS2A 4E7IA 2MMPA 2OTLT 1QWFA 5CKEA 3EGXB 2OAUA 3M0TA 3M4GA 3G7ZA 1QVFA 3OYEA 2QXFA 3OB9A 4NOYA 1AWWA 2CZ1B 2E65A 1X6GA 1IGQA 2PVOB 3JCMb 3BY7A 1QP3A 4ELZC 3WXMB 1J3TA 4KUIA 2K3XA 3TVTA 2F5TX 3JRZA 1NYGA 3M0RA 1D0ZA 2KRSA 5LJ3f 5FW9A 3RKXA 4LDYA 3NFCA 2LQNA 3L2RA 4M78E 4AFQC 1TH7A 2OI3A 3E2UA 3QUIA 1VQ6Q 3HKSA 4M7AF 5FLXE 5GANj 4DBRA 3G4SQ 1K9AA 1IO6A 3C12A 1TU0B 1GFCA 2EIFA 1K76A 3A8OB 2LJ0A 2DTHA 4M7AB 1D09B 3OW2S 4Z02A 2I2LA 2DBKA 1NLOC 5HY6A 4E7HA 4B9WA 1VQ9T 3MHXA 3VS2A 3CCUT 1O75A 1D0YA 5DLOA 4QVCA 2M16A 3LGFA 4Y28E 3OW2P 1FWZA 1KQSA 1BCOA 5GAOp 2DL4A 4M77F 3SWNC 1MGQA 4M7AA 4K11A 2DERA 3CCJQ 3FDRA 5GJVB 4C92F 1NYFA 4M77B 2IG0A 2DEQA 2K5FA 4KGZB 3PTAA 4J6XA 1AT1B 3JAME 4C92B 1UB4A 2E1HA 1N9SA 1VQ7A 4XTZA 3CMAA 2X4XA 5KCOA 2YRCA 5LJ3h 3OS5A 2V1RA 4A4EA 2SEMA 5I2MA 1M1GA 3H6ZA 2LVMA 4ESRA 1NBEB 3OYHA 4M78D 1NEGA 3VS4A 4XTYA 1PSEA 4C92A 3CCLA 1PNJA 5L23A 3REAB 1TS9A 2QGFB 4LUEA 3JB9F 1Y96B 2KXCA 3NTKA 2Y4XA 2CZ0B 2HBWA 1YIJT 3KXTA 1WZOA 4QQGA 4XU2A 3QBYA 4Y92A 3CC2A 1K73U 5C0MA 1G2BA 2QAZA 2LMJA 2E4HA 1GRIA 2EYYA 1QKWA 2FB7A 1FMVA 1YJNQ 4WF2A 3CCSA 3CPFA 2GGRA 1SKUB 1X43A 1I81A 1JXOA 2AHJB 1CKAA 1VYUA 5KYXB 3P8HA 3MP1A 1I07A 3RNJA 3VJPA 1BI1A 2CT3A 2O2OA 2RNAA 3R6NA 3HFOA 4F7UG 3H41A 4EPCA 4EDUA 3NTIA 4EMKB 1I5OB 3JCMc 1VIEA 3O5ZA 4ATOA 5D7UA 1Z9ZA 2DYIA 2CP3A 4IURA 4FL6A 5LJ5d 4PFOA 4C8QG 5LJ5g 1BU1A 4IUUA 3M4YA 2EW3A 2DXBA 2HQHA 2IIMA 4J9BA 1VQLT 1VQ5A 3EFOB 1PRLC 2DRKA 3OMGA 3QHSA 4CC2A 1KQ2A 1M3BA 2F69A 3CMET 2EBPA 1SRLA 4JS4A 4EMKA 1N27A 2D0QB 4XU1A 3KFVA 1AVZC 1UFFA 3QWYA 1SHGA 1GBRA 2Z0WA 1Q86U 2RQRA 1T3LA 2GQVA 1OPKA 1ZSZA 2HAXA 2FO0A 1NEBA 2KRMA 1CSKA 2QQRA 3BDUA 3KBGA 3E1SA 3QYHB 2YHTA 4MZPA 4Z89A 1WDXA 2QEXQ 1H3ZA 2EFIA 4JRIA 2KAFA 3RR6A 3CBMA 1I5LA 2CP0A 2K4YA 2CKKA 2R58A 2LT1A 2L3PA 1RAIB 2BUDA 5A2QE 4D6WA 4C5EA 2QYZA 4BI4A 4KGVB 3E19A 1YITQ 4JZ4A 1SG5A 3FLGA 1K4US 2DETA 2WSFE 1WGSA 4OMQA 1VQPA 3M57A 3QJ6A 1VQNA 2OTLQ 3M5AA 2RO0A 4C8QC 3QDFA 3CCQQ 4RMOA 3OYGA 1VOMA 4DEYA 5HKCA 4DOVA 2EYWA 4KH0B 4OP0A 2FRWA 2PNIA 4LN2A 2IVWA 2RJEA 1MNDA 3PE0A 2RN8A 3QZ9B 2AKKA 1KHIA 2JOYA 1YN8A 3PIOA 1H641 2D0NA 4HVUA 4ZGDB 4II1A 4ZGEB 1A0NB 3EG1A 2JMCA 4PK4A 2J7IA 2KXDA 3VS3A 1MNEA 2DFUA 2QQBA 4CC7A 1HD3A 4M7DF 4QQDA 2KT8A 3CBOA 2DF6A 1G3TA 1MMDA 1Y07A 4M7DB 4PJOA 2JZ2A 1AZGB 3GNFB 1K73C 4J8OA 1BK2A 1YHQA 1K9MC 4FYWB 1KQSS 3P8BB 1VQ9Q 2ZPIB 4FT2A 5KYUB 4AMCA 3CCUQ 1PM3A 2RHIA 2H3JA 3OYMA 3CBPA 1VQ6T 1K73R 3UF4A 5KE2A 1K9MR 4M75A 3H9NA 4ELYC 3KUFA 1KQSP 3L1AA 2RM4A 1ZLMA 5GANf 4MMLA 2FVUA 5KYUA 5GANd 1WHLA 5GAOm 1YJWT 2PVGB 3PNWC 3CCVA 1KG1A 1N6AA 5GANg 1D3BA 2K5IA 1VQ4A 3TCJA 2L0AA 1H8KA 3LLRA 4RTXA 1UUEA 2JTEA 3J80E 2VXEA 3CD6A 1WHHA 4A4HA 1KD1C 5CKHA 2ROLA 4CRIA 3SEMA 5CR2A 4F17A 3JB9I 4XU0A 4E7JA 4OMNA 1G8XA 1TUCA 4E2FB 4DEXA 1JJ2S 2MAMA 3OYJA 4M7AG 1KD1R 2K5LA 4Z8AA 1EX4A 1IB8A 5IAYA 3A5ZB 3SFMA 2XU8A 3HSBA 3EGDA 4WTOB 1ACMB 3NMZC 2OTJT 4QQ6A 1JJ2P 2R5MA 4DA4A 2HZYA 3RERA 1IGUA 4FIBA 3TSZA 3H0IA 4X1VA 4RTUA 1RACB 1WIEA 2AK5A 4HCCA 4OGEA 4QT7A 3X26B 4Q5WA 2QA4T 2ED1A 2HSPA 2KT1A 1VQKA 1D0XA 3OYYA 3M59A 2E70A 4XTWA 5CQYA 2CSQA 4M77G 4O5VA 3A1PA 2K57A 2DE0X 1ARKA 1XNIA 1U3OA 2QG9B 2ABLA 5DLQE 2LTOA 3Q1JA 2CZ7B 3CCET 1RL2A 4JS5A 2HQEA 1ZX6A 1WQWA 1BB9A 1TG0A 4QKUA 2GNCA 1YITA 3S3NA 1I4K1 1I8FA 2JTFA 4ORZA 5HK3A 1JBMA 3FJ5A 1YJNT 2CSIA 1WNLA 3VYHB 3H8ZA 2LP5A 3HFNA 2EWNA 1C0MA 2CT4A 2RJCA 4BI3A 1VQLQ 1VA7A 5GMKe 2M02A 4XQ3A 1AHJB 3MEVA 1N9RA 4C5HA 3CMEQ 5GAOr 1AZEA 2RF0A 2FRYA 1UE9A 2W0ZA 3A98A 3JB9G 2P0KA 1OV3A 4A4GA 3QJYA 2DNUA 4B9XA 4F04B 3OYNA 1IHWA 4FYYB 1WFWA 2F2XA 3GOXA 2HEQA 1YJ9A 1RAGB 3QPHA 2HCKA 3ZEHA 2LT4A 5I21A 4M77C 1OI1A 2NUPA 4F14A 2V8IA 3OYAA 3VUZA 4J83A 2L2PA 3I55T 3CC4Q 1BI3A 4RG2A 2QK0A 4M78A 2DL8A 3CXCA 2DVJA 1SSHA 5KYYB 3E9GA 2EQMA 2FZKB 1YNZA 3L2UA 2EGAA 1XJWB 2GCXA 3RKYA 3WVEB 3A8GB 1OZ2A 1QVGA 2O31A 3VS7A 1NG2A 2LQKA 2OJ2A 4F7UE 2DTIA 3THKA 1M2VB 1AOJA 2EKHA 3RMQA 3CCMT 1W1FA 1D1CA 2O01E 4NS5A 5CKDA 1I0CA 3G71Q 5GAN4 4J9FA 2JNGA 1D1BA 3OYDA 2ZZDA 1S72T 4C8QE 3OYCA 4OB3B 1NE8A 2DO3A 3LWHA 3LH5A 1BYMA 1OZ3A 4OB2B 1Y0MA 2ZPFB 1M2VA 1W70A 2EJ9A 3CCQT 2B86A 2JJ9A 1KC8U 2K9GA 4A4KA 4J9HA 2C0TA 3CPWS 3EG9A 3G6EA 2LCSA 3ASKA 3O8VA 1YI2Q 1MMGA 5GANe 1ABQA 4FM4B 4J9EA 2RHYA 2A7YA 3CPWP 2EQKA 3VS0A 4KBMB 3GNGA 1WPYA 2AKLA 3VRZA 4OGCA 1NZ9A 5A0GA 3L2QA 1YIJA 3QIIA 4JPBW 2V8JA 5LJ3d 3V8JA 5LJ3g 1E6GA 4JUVA 2KI7A 5FRNA 3ER0A 5A0DA 3NPFA 4PJJA 3L2VA 2P0PA 2EGEA 4OF1A 3PGGA 1YJWQ 3A8MB 1U5SA 1SF9A 1UDLA 1SEMA 2DX1A 2QDLA 2XMFA 3OYIA 4C8QD 2X4YA 4J5YA 4BE0A 3EGUA 3RUXA 2PU9B 5FWBA 2KDSA 3L2WA 2FYKA 4EMGA 4RKUE 3V8LA 5CVIA 4E7ZA 3EG3A 3GIBA 3MJXA 4OMFB 4BACA 1VQ8A 2XI9A 5IHNA 3GP8A 2EPDA 4XTVA 4M7DG 2VV5A 2FPDA 2VGNA 3REBB 2D6FA 4JZ3A 5GAMf 2LCLA 2HKQB 2RH2A 5GAN2 3CCRT 3T9NA 3TU4K 2DRMA 1M27C 8ATCB 2OTJQ 2RHZA 2VB6A 4NL3A 1W2BA 1VIFA 4IUPA 1KK7A 2CP2A 3MKDA 3VYGA 4HKEA 3HRTA 2LCCA 1H92A 2QA4Q 2QTVA 3J81E 1NM7A 4C0ZA 3AT1B 5KCHA 2KVQG 1F1BB 1KHCA 2DIGA 2BZXA 2I0NA 4ZGJB 4AFSC 2DYBA 5D6XA 1HJDA 3CCEQ 2CP5A 1X75C 1OU8A 1MV0B 4KUDK 2DZCA 2LQ8A 1K9MU 2A0FB 4E7KA 2ZPGB 5HK0A 3TQ7P 2QQAA 1Q7YU 1N8RU 1U06A 4UC4A 2LX7A 3I5SA 4HCZA 1VQOA 3SB2A 5GAMh 4M7DC 2GQIA 2CH4W 1XQHA 1OX8A 1X27A 1WX6A 2XICA 1V1CA 1ZA2B 2KYMA 1KC8C 2ZPEB 4C5GA 2RK1A 4M7AE 1UGVA 1ZSZB 3QWXX 2WACA 1KC8R 3CC7Q 3PMTA 1VYTA 1KD1U 4E47A 4PJLA 4IUQA 2VASA 2KQWA 1HSQA 5FU6C 2O9VA 4RTVA 3X28B 1FXXA 1M4ZA 1PD1A 3CXCS 1WLPB 3M54A 2KR3A 1M8MA 1HK9A 2ZGWA 1VQMQ 3I55Q 4FW1A 2DBMA 2BE9B 1R0BG 2XDBA 4DQ2A 2ZAEA 1VQ7T 4JRPA 3CXCP 4M77E 3EHRA 3UA7A 3C95A 4N0AC 4FSSA 3OYBA 2YSQA 2E6ZA 1VQ6A 3M9QA 1MV3A 3G4SA 1OEBA 3CC4T 2GBQA 4BI8B 1RAAB 2HL5C 1M3CA 2LC4A 3IQLA 4ZNXA 3CCMQ 3GF5A 2JXBA 3ME9A 4B6MA 4PJMA 4LD6A 1LVKA 3R6OA 4JLGA 1IHVA 2YLCA 1S72Q 1UJYA 1NJIC 4LXCA 4RTTA 3SD4A 1QVFS 4BY6C 1FYNA 1ZHIA 2XDPA 4M7AD 2JM9A 1LCKA 3UT1A 2JW4A 3V8KA 5LJ3e 5IXBA 4L5GA 2DXTA 2VC8A 1NJIR 5CCAA 4QVZA 1PSFA 3G71T 3CCJA 4XTXA 1T3SA 4PNOA 3SWNA 3CCST 5GAOn 2P4TA 1VYVA 3P8DA 1QVFP 1M9SA 4J7IA 5ECAA 4PJOF 2JMAA 2XG8D 3VS5A 1GCQC 4HT8A 4JLIA 2ED0A 4JDSA 1MMNA 2MWOA 2AZSA 4PJOB 3GLXA 3HRUA 3LGLA 2EQJA 2OTJA 1M90U 3VU3C 2F2VA 2CS7A 2E5KA 1M1KU 4M77D 4M75F 4N4HA 2FHDA 1MUZA 2O9SA 4LDVA 3OYLA 3OA6A 1BIBA 3PIPA 3DB3A 4C92D 4LE9A 2RQWA 1YI2T 1K0XA 1VQ5T 4M75B 2L3SA 2KEAA 2O4XB 2VXFA 5GJWB 2P84A 3ZFJA 1UGSB 4LDXA 4GLKA 4KT0E 1OOTA 2KROA 4FYXB 2KBTA 1D3BB 3UATA 1Q7YC 1N8RC 2DL3A 2L5QA 1HXDA 4FSXA 3LWIA 2FZGB 1VUBA 1UJ0A 3BDLA 4HCKA 3A8LB 3HRSA 4FYVB 2O4XA 1YJNA 2QGGA 3JB9J 1Q7YR 1N8RR 2LZ6B 2BE7D 1QW1A 5GAMj 1U1SA 2GTJA 4BE1A 1MHNA 4IUTA 3C4SA 1JEGA 2QDYB 1E6HA 3JB9D 2E41A 2XD0A 1Y71A 1WI7A 2DD5A 2NLUA 3HPWA 1QLYA 1GXIE 1UGRB 3MPUB 3I9QA 2X51A 2DXUA 2RJFA 2KSSA 2XK0A 2BZ8A 2NUTB 4HVWA 4GLMA 3CCRQ 4KULA 2M1HA 4Y91A 3EGDB 4J9GA 3PVQA 1UEBA 1WJSA 2C0IA 3OQ5A 1OPLA 5FU7C 3UA6A 3BE3A 1IZ6A 1PRMC 4OMOA 3PFSA 4KGXB 1WHJA 2WSCE 1FX7A 4JJCA 5IH2A 1HYOA 3QO3A 3OS0A 1ZBXA 2QTXA 4X9DA 4C0FA 5I22A 2B8AA 2NUTA 2PVDB 2LQWA
chains in the Genus database with same CATH topology
2FPFA 1BBZA 3THKA 2CUDA 1AOJA 2EKHA 2V1RA 5IHIA 2FEIA 2SEMA 2BZYA 1W1FA 4ESRA 1NEGA 1I0CA 2K2MA 4J9FA 3VS4A 1SHFA 2FG0A 4KRTA 1PNJA 5L23A 3REAB 4GBQA 3LH5A 4LUEA 1WXBA 2KGTA 1GCPA 2HDAA 4JJBA 3U23A 2EYXA 2KXCA 1AEYA 1Y0MA 1PKTA 1W70A 1M3AA 1T0JA 2B86A 1AD5A 2K9GA 2HBWA 1EFNA 4Y92A 1X6BA 2LJ3A 4J9HA 2C0TA 1WYXA 1G2BA 2LNHB 2LMJA 1GRIA 2EYYA 2NWMA 2LCSA 5I11A 2A28A 1QKWA 1WXTA 4D8KA 2V1QA 2H8HA 2CREA 2YDLA 2L3QA 3M0PA 1ABQA 1X43A 2GGRA 1JXOA 2JS2A 1CKAA 1VYUA 4J9EA 4RTYA 1I07A 3RNJA 1PHTA 2CT3A 3VS0A 2O2OA 2RNAA 5EC7A 2KYBA 3R6NA 3H41A 2CUBA 4IIOA 2AKLA 3VRZA 4AG1C 1JU5C 2K7AA 2DA9A 4JPBW 1KFZA 3O5ZA 4D8DA 2EGCA 1RLPC 2RQVA 1E6GA 1Z9ZA 4HXJA 2ENMA 3I5RA 1BU1A 3NPFA 2EW3A 2IIMA 2M0YA 1ZUUA 3M0SA 4J9BA 1PRLC 2DRKA 4CC2A 2EGEA 4JJDA 1M3BA 2EBPA 1U5SA 2MIOA 1UDLA 1SRLA 1SEMA 2DX1A 2QDLA 2XMFA 3KFVA 2OAWA 3RBBB 1RUWA 1AVZC 1UFFA 3QWYA 4IIMA 1SHGA 1GBRA 2JT4A 2RQRA 3EGUA 1T3LA 5FWBA 1SPKA 2A37A 1PKSA 4J9CA 2FPEA 1OPKA 2J06A 4RUGA 2FO0A 1NEBA 2J05A 2KRMA 1CSKA 3EG3A 3C0CA 5IHNA 2A08A 2EPDA 4OMMA 2FPDA 4Z89A 1UECA 2ESWA 2VKNA 4E6RA 1WDXA 3REBB 4JZ3A 1PWTA 3VRYA 4AFUC 1M30A 1ABOA 2DRMA 3ZL7C 2DILA 2L3PA 1M27C 1ZUKA 1W6XA 2A36A 3ULRB 1UTIA 1WXUA 4M4ZA 2M51A 2D8HA 4JZ4A 1K4US 1H92A 4RTZA 1NM7A 4OMQA 1X2KA 2BZXA 1ZSGA 2I0NA 4HVVA 1YCSB 1UHFA 1Y57A 4AFSC 2DYBA 2P4RA 1HJDA 1K1ZA 1GL5A 2DM1A 1KJWA 4DEYA 2KNBB 2BTTA 2LJ1A 1MV0B 2EYZA 2EYWA 2YUQA 4RTWA 1QKXA 5FWCA 3GBQA 1FMKA 1ZBJA 1RLQC 2FRWA 2PNIA 3I35A 5IXFA 4LN2A 1AWXA 4EIKA 3PE0A 1X69A 2RN8A 4R0KA 2AKKA 1YN8A 1TUDA 3M0QA 2D0NA 1U06A 4HVUA 1A0NB 3EG1A 2JMCA 1WA7A 2EQIA 2J7IA 2LX7A 4WCIA 3I5SA 1XOVA 2KXDA 3VS3A 1JXMA 2GQIA 4CC7A 2CH4W 1HD3A 1X27A 1WX6A 1X2QA 3JV3A 1V1CA 2DL7A 2F2WA 2KT8A 2DF6A 2KYMA 1QCFA 3SHWA 2RQTA 2JS0A 3NHNA 1AZGB 1UGVA 1Z9QA 2J6OA 3QWXX 2EVRA 1BK2A 1GCQA 1AWOA 3VS1A 1VYTA 1N5ZA 1HSQA 3UF4A 2JM8A 2O9VA 4RTVA 2SRCA 2W10A 4LUDA 1WLPB 1JQQA 1T0HA 2KR3A 1M8MA 2VWFA 1NLPC 1ZLMA 4OMLA 3TSWA 2J6FA 2MCNA 2DBMA 1QWEA 3H0HA 4LNPA 2KE9A 2YUPA 3EHRA 2PZ1A 3UA7A 2ROTA 4FSSA 2L0AA 1CKBA 1E7OA 1H8KA 2ECZA 4RTXA 5HCKA 2YSQA 1UUEA 3EHQA 2JTEA 1I1JA 1MV3A 1S1NA 1GBQA 4CC4B 4AG2C 1OEBA 2ROLA 3SEMA 2GBQA 3NGPA 2YUNA 2D8JA 1M3CA 3IQLA 4ZNXA 4F17A 1K0SA 2VVKA 4OMNA 4J9DA 1TUCA 2X3XD 1KSWA 2JXBA 4DEXA 4J9IA 2G6FX 4Z8AA 4CC3A 1G83A 1RI9A 2O88A 1UJYA 4RTTA 2MOXA 1UHCA 3NMZC 2RPNA 3EG2A 1FYNA 1YWOA 4AFZC 2PTKA 1GFDA 3TSZA 3H0IA 2JM9A 1LCKA 2JW4A 4X1VA 4OMPA 4RTUA 1WIEA 5IXBA 2AK5A 4QT7A 2ED1A 1T3SA 2GTOA 2HSPA 2KT1A 2RQUA 2YUOA 1VYVA 5ECAA 4A63B 2DLPA 2JMAA 3VS5A 1GCQC 2CSQA 2DE0X 2ED0A 2J6KA 1ARKA 1U3OA 1QWFA 1B07A 2ABLA 2AZSA 3M0TA 1SRMA 2F2VA 1ZX6A 3VS6A 1BB9A 1ZUYA 2E5KA 1TG0A 1H3HA 2GNCA 2D1XA 1MUZA 2O9SA 4ORZA 2X3WD 1AWWA 3FJ5A 2RMOA 4LE9A 2RQWA 1K0XA 2CSIA 1X6GA 2L3SA 2KEAA 2LP5A 2YT6A 5GJWB 2CT4A 1J3TA 2C0OA 3TVTA 1NYGA 3M0RA 2K3BA 2KRSA 1VA7A 5FW9A 1OOTA 1YP5A 2LQNA 2NUZA 2KROA 4AFQC 2KBTA 2OI3A 2CDTA 3UATA 1AZEA 2RF0A 2DL3A 2FRYA 1UE9A 2W0ZA 1K9AA 1IO6A 3A98A 1UJ0A 1OV3A 1GFCA 4HCKA 1K76A 2LJ0A 2DNUA 2DBKA 2DJQA 2K6DA 1NLOC 3EG0A 2LZ6B 1UG1A 2DMOA 1WFWA 2F2XA 2GTJA 4F16A 2HEQA 1JEGA 3VS2A 1E6HA 1WI7A 1QLYA 2HCKA 3I9QA 3M0UA 2BZ8A 4HVWA 4GLMA 1JO8A 4F14A 2DL4A 4J9GA 2CH4A 3H0FA 4Z88A 1AWJA 2L2PA 2K79A 3PVQA 2AZVA 3CQTA 3PVLA 5IHKA 1B3QA 4K11A 2C0IA 2KRNA 1OPLA 3UA6A 5GJVB 1PRMC 2DL8A 2DVJA 4OMOA 1SSHA 1NYFA 1KIKA 4JJCA 2DL5A 1YNZA 5IH2A 2EGAA 5I22A 2O31A 3VS7A 1NG2A 1YWPA 2LQWA 2OJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPF A;  1BBZ A;  3THK A;  2CUD A;  1AOJ A;  2EKH A;  2V1R A;  5IHI A;  2FEI A;  2SEM A;  2BZY A;  1W1F A;  4ESR A;  1NEG A;  1I0C A;  2K2M A;  4J9F A;  3VS4 A;  1SHF A;  2FG0 A;  4KRT A;  1PNJ A;  5L23 A;  3REA B;  4GBQ A;  3LH5 A;  4LUE A;  1WXB A;  2KGT A;  1GCP A;  2HDA A;  4JJB A;  3U23 A;  2EYX A;  2KXC A;  1AEY A;  1Y0M A;  1PKT A;  1W70 A;  1M3A A;  1T0J A;  2B86 A;  1AD5 A;  2K9G A;  2HBW A;  1EFN A;  4Y92 A;  1X6B A;  2LJ3 A;  4J9H A;  2C0T A;  1WYX A;  1G2B A;  2LNH B;  2LMJ A;  1GRI A;  2EYY A;  2NWM A;  2LCS A;  5I11 A;  2A28 A;  1QKW A;  1WXT A;  4D8K A;  2V1Q A;  2H8H A;  2CRE A;  2YDL A;  2L3Q A;  3M0P A;  1ABQ A;  1X43 A;  2GGR A;  1JXO A;  2JS2 A;  1CKA A;  1VYU A;  4J9E A;  4RTY A;  1I07 A;  3RNJ A;  1PHT A;  2CT3 A;  3VS0 A;  2O2O A;  2RNA A;  5EC7 A;  2KYB A;  3R6N A;  3H41 A;  2CUB A;  4IIO A;  2AKL A;  3VRZ A;  4AG1 C;  1JU5 C;  2K7A A;  2DA9 A;  4JPB W;  1KFZ A;  3O5Z A;  4D8D A;  2EGC A;  1RLP C;  2RQV A;  1E6G A;  1Z9Z A;  4HXJ A;  2ENM A;  3I5R A;  1BU1 A;  3NPF A;  2EW3 A;  2IIM A;  2M0Y A;  1ZUU A;  3M0S A;  4J9B A;  1PRL C;  2DRK A;  4CC2 A;  2EGE A;  4JJD A;  1M3B A;  2EBP A;  1U5S A;  2MIO A;  1UDL A;  1SRL A;  1SEM A;  2DX1 A;  2QDL A;  2XMF A;  3KFV A;  2OAW A;  3RBB B;  1RUW A;  1AVZ C;  1UFF A;  3QWY A;  4IIM A;  1SHG A;  1GBR A;  2JT4 A;  2RQR A;  3EGU A;  1T3L A;  5FWB A;  1SPK A;  2A37 A;  1PKS A;  4J9C A;  2FPE A;  1OPK A;  2J06 A;  4RUG A;  2FO0 A;  1NEB A;  2J05 A;  2KRM A;  1CSK A;  3EG3 A;  3C0C A;  5IHN A;  2A08 A;  2EPD A;  4OMM A;  2FPD A;  4Z89 A;  1UEC A;  2ESW A;  2VKN A;  4E6R A;  1WDX A;  3REB B;  4JZ3 A;  1PWT A;  3VRY A;  4AFU C;  1M30 A;  1ABO A;  2DRM A;  3ZL7 C;  2DIL A;  2L3P A;  1M27 C;  1ZUK A;  1W6X A;  2A36 A;  3ULR B;  1UTI A;  1WXU A;  4M4Z A;  2M51 A;  2D8H A;  4JZ4 A;  1K4U S;  1H92 A;  4RTZ A;  1NM7 A;  4OMQ A;  1X2K A;  2BZX A;  1ZSG A;  2I0N A;  4HVV A;  1YCS B;  1UHF A;  1Y57 A;  4AFS C;  2DYB A;  2P4R A;  1HJD A;  1K1Z A;  1GL5 A;  2DM1 A;  1KJW A;  4DEY A;  2KNB B;  2BTT A;  2LJ1 A;  1MV0 B;  2EYZ A;  2EYW A;  2YUQ A;  4RTW A;  1QKX A;  5FWC A;  3GBQ A;  1FMK A;  1ZBJ A;  1RLQ C;  2FRW A;  2PNI A;  3I35 A;  5IXF A;  4LN2 A;  1AWX A;  4EIK A;  3PE0 A;  1X69 A;  2RN8 A;  4R0K A;  2AKK A;  1YN8 A;  1TUD A;  3M0Q A;  2D0N A;  1U06 A;  4HVU A;  1A0N B;  3EG1 A;  2JMC A;  1WA7 A;  2EQI A;  2J7I A;  2LX7 A;  4WCI A;  3I5S A;  1XOV A;  2KXD A;  3VS3 A;  1JXM A;  2GQI A;  4CC7 A;  2CH4 W;  1HD3 A;  1X27 A;  1WX6 A;  1X2Q A;  3JV3 A;  1V1C A;  2DL7 A;  2F2W A;  2KT8 A;  2DF6 A;  2KYM A;  1QCF A;  3SHW A;  2RQT A;  2JS0 A;  3NHN A;  1AZG B;  1UGV A;  1Z9Q A;  2J6O A;  3QWX X;  2EVR A;  1BK2 A;  1GCQ A;  1AWO A;  3VS1 A;  1VYT A;  1N5Z A;  1HSQ A;  3UF4 A;  2JM8 A;  2O9V A;  4RTV A;  2SRC A;  2W10 A;  4LUD A;  1WLP B;  1JQQ A;  1T0H A;  2KR3 A;  1M8M A;  2VWF A;  1NLP C;  1ZLM A;  4OML A;  3TSW A;  2J6F A;  2MCN A;  2DBM A;  1QWE A;  3H0H A;  4LNP A;  2KE9 A;  2YUP A;  3EHR A;  2PZ1 A;  3UA7 A;  2ROT A;  4FSS A;  2L0A A;  1CKB A;  1E7O A;  1H8K A;  2ECZ A;  4RTX A;  5HCK A;  2YSQ A;  1UUE A;  3EHQ A;  2JTE A;  1I1J A;  1MV3 A;  1S1N A;  1GBQ A;  4CC4 B;  4AG2 C;  1OEB A;  2ROL A;  3SEM A;  2GBQ A;  3NGP A;  2YUN A;  2D8J A;  1M3C A;  3IQL A;  4ZNX A;  4F17 A;  1K0S A;  2VVK A;  4OMN A;  4J9D A;  1TUC A;  2X3X D;  1KSW A;  2JXB A;  4DEX A;  4J9I A;  2G6F X;  4Z8A A;  4CC3 A;  1G83 A;  1RI9 A;  2O88 A;  1UJY A;  4RTT A;  2MOX A;  1UHC A;  3NMZ C;  2RPN A;  3EG2 A;  1FYN A;  1YWO A;  4AFZ C;  2PTK A;  1GFD A;  3TSZ A;  3H0I A;  2JM9 A;  1LCK A;  2JW4 A;  4X1V A;  4OMP A;  4RTU A;  1WIE A;  5IXB A;  2AK5 A;  4QT7 A;  2ED1 A;  1T3S A;  2GTO A;  2HSP A;  2KT1 A;  2RQU A;  2YUO A;  1VYV A;  5ECA A;  4A63 B;  2DLP A;  2JMA A;  3VS5 A;  1GCQ C;  2CSQ A;  2DE0 X;  2ED0 A;  2J6K A;  1ARK A;  1U3O A;  1QWF A;  1B07 A;  2ABL A;  2AZS A;  3M0T A;  1SRM A;  2F2V A;  1ZX6 A;  3VS6 A;  1BB9 A;  1ZUY A;  2E5K A;  1TG0 A;  1H3H A;  2GNC A;  2D1X A;  1MUZ A;  2O9S A;  4ORZ A;  2X3W D;  1AWW A;  3FJ5 A;  2RMO A;  4LE9 A;  2RQW A;  1K0X A;  2CSI A;  1X6G A;  2L3S A;  2KEA A;  2LP5 A;  2YT6 A;  5GJW B;  2CT4 A;  1J3T A;  2C0O A;  3TVT A;  1NYG A;  3M0R A;  2K3B A;  2KRS A;  1VA7 A;  5FW9 A;  1OOT A;  1YP5 A;  2LQN A;  2NUZ A;  2KRO A;  4AFQ C;  2KBT A;  2OI3 A;  2CDT A;  3UAT A;  1AZE A;  2RF0 A;  2DL3 A;  2FRY A;  1UE9 A;  2W0Z A;  1K9A A;  1IO6 A;  3A98 A;  1UJ0 A;  1OV3 A;  1GFC A;  4HCK A;  1K76 A;  2LJ0 A;  2DNU A;  2DBK A;  2DJQ A;  2K6D A;  1NLO C;  3EG0 A;  2LZ6 B;  1UG1 A;  2DMO A;  1WFW A;  2F2X A;  2GTJ A;  4F16 A;  2HEQ A;  1JEG A;  3VS2 A;  1E6H A;  1WI7 A;  1QLY A;  2HCK A;  3I9Q A;  3M0U A;  2BZ8 A;  4HVW A;  4GLM A;  1JO8 A;  4F14 A;  2DL4 A;  4J9G A;  2CH4 A;  3H0F A;  4Z88 A;  1AWJ A;  2L2P A;  2K79 A;  3PVQ A;  2AZV A;  3CQT A;  3PVL A;  5IHK A;  1B3Q A;  4K11 A;  2C0I A;  2KRN A;  1OPL A;  3UA6 A;  5GJV B;  1PRM C;  2DL8 A;  2DVJ A;  4OMO A;  1SSH A;  1NYF A;  1KIK A;  4JJC A;  2DL5 A;  1YNZ A;  5IH2 A;  2EGA A;  5I22 A;  2O31 A;  3VS7 A;  1NG2 A;  1YWP A;  2LQW A;  2OJ2 A; 
#chains in the Genus database with same CATH topology
 2FPF A;  3HTR A;  1BBZ A;  3VV0 A;  2CUD A;  2F1L A;  2FEI A;  2BZY A;  4F7U F;  3RIR A;  4FU6 A;  3I55 A;  2K2M A;  2E6N A;  5GMK m;  1RI0 A;  1SHF A;  4C0D B;  2FG0 A;  4DBQ A;  4F7U B;  4GBQ A;  2QEX A;  1GCP A;  2HDA A;  3U23 A;  1AEY A;  1PKT A;  1BI2 A;  1AD5 A;  4C92 G;  3MET A;  3JCM V;  2QI2 A;  4HCB A;  1Q95 G;  2JTM A;  2DPP B;  2PQW A;  1WYX A;  2LNH B;  3WVD B;  4PFZ A;  5KE3 A;  2E5Q A;  5I11 A;  2A28 A;  5A0L A;  4D8K A;  4F7U A;  4NL2 A;  3CEY A;  4E7L A;  4JRQ A;  2YDL A;  4BDZ A;  1YHQ T;  4FCY A;  4RTY A;  2YLB A;  5LJ5 j;  2RI2 A;  4M7D E;  4LD9 K;  2OTL A;  3LYI A;  1K8A C;  1ZA1 B;  1IRE B;  3V7S A;  3CCQ A;  1W4S A;  4C8Q A;  5GAN 7;  5GAN 3;  4M7A C;  5C6S A;  2LX9 A;  2DA9 A;  1KFZ A;  7AT1 B;  4D8D A;  2CYZ B;  1RLP C;  2RQV A;  4M78 F;  2DJZ A;  2NUP B;  1M90 C;  3I5R A;  3VKI A;  2X35 A;  4PLI A;  1M1K C;  3M0S A;  1QP2 A;  2X9H A;  4M78 B;  1VQ4 T;  1PG5 B;  4ANJ A;  3CC7 T;  4ZTJ A;  5GAO l;  1M90 R;  4OB1 B;  1VQ7 Q;  2MIO A;  3CMA Q;  1M1K R;  3GPL A;  3CD6 T;  2HL3 A;  3FJP A;  2OAW A;  5AYF A;  3JCM X;  4IIM A;  1RAE B;  5GMK j;  1PKS A;  2MF2 A;  1VQM T;  2LNV A;  4C92 C;  4RUG A;  1WQ7 A;  3FRN A;  2R57 A;  2DIQ A;  2P0Q A;  2XDD A;  3CCL Q;  1NPP A;  1O9S A;  2A08 A;  4OMM A;  2VKN A;  2ESW A;  4E6R A;  2HMA A;  1VQ9 A;  2VYT A;  1PWT A;  3VRY A;  3CCU A;  3E9F A;  4A54 A;  1ZUK A;  2A36 A;  4BE2 A;  2K2V A;  3ULR B;  1C6V X;  1QCO A;  4VUB A;  2X4W A;  1WXU A;  1VQK T;  3CC2 Q;  4M7D D;  4M4Z A;  3JCM P;  3EH1 A;  3S6W A;  2M51 A;  1WJR A;  1LNX A;  1G3W A;  2RJD A;  5GMK l;  4LDW A;  4XAX B;  3A8H B;  4XK8 E;  3CCS Q;  3EG9 B;  5CKF A;  1OU9 A;  4EMH A;  1Y7X A;  1XTD A;  4PL6 A;  2CP6 A;  3QSU A;  5FRM A;  2R5A A;  2P4R A;  1K1Z A;  2DZ9 A;  3QKJ A;  1KJW A;  2BTT A;  2LJ1 A;  5KYW B;  2YUQ A;  2YXY A;  1FMK A;  1ZBJ A;  3I35 A;  1JRI A;  5IXF A;  2V26 A;  1OQK A;  2ZPB B;  1TUD A;  3I56 T;  1VQ5 Q;  3M0Q A;  4EMK C;  3FC3 A;  4OB0 B;  4PJN A;  5GAO q;  4C0G A;  1BKB A;  2KMT A;  1WA7 A;  2D9T A;  2JN0 A;  3OBW A;  4WCI A;  4MDW A;  5CAI A;  2CZ6 B;  3MCA B;  5KYW A;  1Q82 U;  3RMS A;  2RB6 A;  3JV3 A;  1ZSZ C;  2DL7 A;  2F2W A;  1U1T A;  3DLM A;  3BFM A;  3L42 A;  1QCF A;  8AT1 B;  1OX9 A;  2RQT A;  2JS0 A;  1M5Q 1;  4RG8 A;  3OYK A;  3JB9 H;  1IRX A;  3EGX A;  1YJ9 T;  1Z9Q A;  2J6O A;  3X20 B;  2EVR A;  1AWO A;  2E10 A;  4J7F A;  5IN1 A;  1N5Z A;  3HP9 A;  4PJO G;  1PC0 A;  3TEE A;  1M8V A;  2JM8 A;  2W10 A;  1JQQ A;  1RAF B;  5GAN 6;  4RCC A;  2CGH A;  2VGM A;  4OML A;  1NJI U;  2MCN A;  3QG1 A;  1QWE A;  3H0H A;  2KE9 A;  4M75 G;  4OVA A;  1D1A A;  2YUP A;  1VQP Q;  1TXQ A;  5J26 A;  1VQL A;  4GY5 A;  2PUK B;  1EIF A;  1TOV A;  1VQN Q;  3JCM Q;  2ROT A;  2YWW A;  2ECZ A;  3CME A;  2C06 A;  1V29 B;  5HCK A;  5GAM d;  4CC4 B;  5CKB A;  3S3O A;  5GAM g;  2YUN A;  9ATC B;  2D8J A;  1K0S A;  2VVK A;  2X3X D;  2E64 A;  4DOW A;  1TUG B;  2L89 A;  4XTU A;  4CC3 A;  1G83 A;  2ATC B;  3RDV A;  3NTH A;  1UGQ B;  1UHC A;  3INZ A;  3RES A;  3EG2 A;  2DEU A;  3S3M A;  2DK3 A;  2PTK A;  4MMK A;  1GFD A;  4HA8 A;  4OMP A;  3G6E T;  4M77 A;  1WHM A;  2COY A;  3CC4 A;  2GTO A;  1B34 B;  4PJO C;  4A63 B;  1JJ2 A;  2DLP A;  1BCM A;  1MMA A;  3EAE A;  3MEU A;  2LDM A;  2J6K A;  1V76 A;  1YHQ Q;  1B07 A;  4LDU A;  1QQJ A;  2COW A;  3OBY A;  3SDZ A;  1SRM A;  2GFA A;  4AT1 B;  4M75 C;  2BKD N;  3VS6 A;  1ZUY A;  1R8O B;  1H3H A;  1C1A A;  1B34 A;  3M55 A;  2A3L A;  2D1X A;  3OMC A;  2X3W D;  3G71 A;  2RMO A;  4BUG A;  2PUO B;  1DJ7 B;  5FRO A;  1Y96 A;  2M9U A;  3URG A;  2YT6 A;  2RD1 A;  4DBF A;  3CCV Q;  2HKN A;  2C0O A;  2Y4Y A;  2F5K A;  4BB7 A;  3F70 A;  2K3B A;  1VQ4 Q;  4PLL A;  1R0C B;  1YP5 A;  2NUZ A;  5IT9 E;  5LJ5 f;  2CDT A;  2RHU A;  3CD6 Q;  3UPU A;  2EKO A;  5LL6 S;  5KYX A;  1U8R A;  4TVR A;  1FMW A;  5L8R E;  1VQ8 T;  2DJQ A;  1Q82 C;  1YI2 A;  2K6D A;  3EG0 A;  3FEO A;  5D6Y A;  4MZT A;  1EZZ B;  1UG1 A;  2DMO A;  4ME7 A;  3EFR A;  3QYG B;  4F16 A;  1IXD A;  3FB9 A;  1QVG S;  2HQX A;  3CMA T;  2ZCF B;  3JCM W;  1Q82 R;  3UWN A;  3M0U A;  3V7R A;  2RA2 A;  5CIU A;  1JO8 A;  2IPO B;  4C92 E;  1BIA A;  3MEW A;  2CH4 A;  3H0F A;  4Z88 A;  1AWJ A;  2K79 A;  1QVG P;  2AZV A;  3CQT A;  3PVL A;  5IHK A;  1B3Q A;  1P92 A;  2KRN A;  3V7C A;  3OY9 A;  3EFO A;  5KH6 A;  2COZ A;  1VQK Q;  1KIK A;  2YRD A;  4IUV A;  3JCM f;  3CCL T;  3MO8 A;  2HD0 A;  2DL5 A;  3FIF A;  4L59 A;  3SWN B;  3JCM d;  2L8D A;  4M78 G;  3JCM g;  1YJW A;  1YWP A;  3G1J A;  2H3E B;  4R55 A;  1BI0 A;  4C0D C;  2QQ9 A;  5IHI A;  3CC2 T;  2FL7 A;  3RKW A;  2MWP A;  3OSV A;  5LJ5 h;  2RHX A;  1OYX A;  3M53 A;  4L6V 5;  2EJG A;  1X01 A;  3AHU A;  2NYS A;  1WJQ A;  4KRT A;  1K8A U;  3J7A F;  4N4I A;  2X4J A;  4MDX A;  3EFS A;  1WXB A;  2KGT A;  4JJB A;  2EYX A;  3I56 Q;  2CP7 A;  2EJF A;  1R77 A;  4J6Y A;  1VQO T;  2EYQ A;  1M3A A;  1T0J A;  1EFN A;  3LH0 A;  4V2S A;  1X6B A;  5CQX A;  2LJ3 A;  2FZC B;  2GF7 A;  2NWM A;  1WXT A;  2V1Q A;  2H8H A;  2QA4 A;  2CRE A;  3TRE A;  2L3Q A;  5LJ3 j;  3M0P A;  4XU3 A;  2XHC A;  2JS2 A;  2OX7 A;  3JCM h;  2DAQ A;  1YJ9 Q;  1PHT A;  5EC7 A;  2KYB A;  5GMK h;  3MEA A;  1G3S A;  1Q81 U;  2CUB A;  4IIO A;  2MYS A;  4AG1 C;  1JU5 C;  2EAY A;  2K7A A;  5GAM e;  3CCE A;  3MP6 A;  5CO7 A;  2E12 A;  4M78 C;  2EGC A;  1WHG A;  4HXJ A;  2ENM A;  3CPW A;  5GMK i;  3PT9 A;  1UGP B;  3M56 A;  4R56 A;  1M2O A;  2M0Y A;  4ZN1 A;  1ZUU A;  5D6W A;  1QVP A;  2VUB A;  4JJD A;  4KH1 B;  4J6W A;  3G4S T;  1QCN A;  5EG2 A;  3RBB B;  1RUW A;  1W2B S;  2JT4 A;  4M7D A;  1SPK A;  2A37 A;  2DKG A;  4J9C A;  2FPE A;  2J06 A;  5FU6 B;  2J05 A;  2QQS A;  3C0C A;  3BW1 A;  1VQP T;  1W2B P;  2KK4 A;  3OW2 A;  4ZN3 A;  2DVE A;  1B7T A;  1UEC A;  2HSE B;  4PFP A;  2MI6 A;  1VQN T;  2XKO C;  3CC7 A;  2M0O A;  4AFU C;  1M30 A;  1ABO A;  3VUB A;  3ZL7 C;  2G3R A;  2DIL A;  1W6X A;  1YCY A;  3CCJ T;  1LJO A;  2RI3 A;  1UTI A;  3C94 A;  2K3Y A;  5M9O A;  2AT1 B;  5I2S A;  3G6E Q;  6AT1 B;  2D8H A;  1VQM A;  3PMI A;  1Q86 C;  3DB4 A;  2QAS A;  4RTZ A;  3OSS C;  3QDR B;  3D7S B;  1X2K A;  1ZSG A;  1G3Y A;  1Q86 R;  4HVV A;  1YCS B;  1UHF A;  1Y57 A;  4N4G A;  1JB0 E;  2RK2 A;  1GL5 A;  4C8Q F;  2DM1 A;  1YIJ Q;  4N0A A;  2L3R A;  2DTO A;  5J39 A;  4PJO E;  1TSF A;  2KNB B;  2XID A;  5LJ5 e;  4HT9 A;  4BY6 B;  2EYZ A;  4MZM A;  5FWC A;  4RTW A;  1QKX A;  3OS1 A;  3GBQ A;  1QMC A;  2E3H A;  4C8Q B;  1RLQ C;  3CCM A;  1AWX A;  4EIK A;  2V8K A;  1X69 A;  3EH2 A;  4R0K A;  1RAD B;  5GAN h;  3JCM J;  2Y90 A;  3N5B B;  4M75 E;  2EQU A;  1S72 A;  1RAB B;  2HNI A;  2EQI A;  1SSF A;  1XOV A;  5GAN 5;  1X6O A;  1JXM A;  2YRV A;  1X2Q A;  3HHT B;  3UDC A;  4IKF A;  3LX7 A;  2JVV A;  4ZTF A;  4E7S A;  1K8A R;  2GFU A;  3SHW A;  2LRQ A;  3NHN A;  2MK5 A;  1VQ8 Q;  4DBH A;  1NPR A;  3JCM e;  4RCB A;  3ZBD A;  3CCV T;  2WSE E;  3JSC A;  3I56 A;  3X24 B;  1GCQ A;  3VS1 A;  1G5V A;  1OUL A;  1PCX A;  2MPX C;  3DKM A;  3HL8 A;  4FT4 A;  2JUF A;  2SRC A;  2AIR B;  4LUD A;  4JJN K;  3DLL A;  2ZPH B;  5DY9 A;  1T0H A;  1Q81 C;  2VWF A;  1NLP C;  1YFN A;  2DD4 A;  3TSW A;  2J6F A;  1LOJ A;  4PJO D;  1PD0 A;  3X25 B;  4LNP A;  4QVD A;  1TTH B;  1Q81 R;  1ZQ1 A;  1TWB A;  2PZ1 A;  3QXE B;  4O6J A;  1LPL A;  3OYF A;  1KQ1 A;  2KY9 A;  2HBP A;  4QW2 A;  1CKB A;  1E7O A;  4X9C A;  5DM7 R;  3MP8 A;  3L2Z A;  3EHQ A;  1I1J A;  1S1N A;  5KYN A;  1GBQ A;  4YTL A;  4M75 D;  4BDY A;  4X34 A;  1M1F A;  4AG2 C;  4FW2 A;  4JRK A;  4P5N A;  3NGP A;  4PKC C;  2BIV A;  4BD3 A;  1YBY A;  4J9D A;  4A4F A;  1KSW A;  4J9I A;  2QEX T;  2G6F X;  3M58 A;  5FU7 B;  1RI9 A;  2O88 A;  2E3I A;  2MOX A;  4CI0 C;  2RPN A;  1YWO A;  2RI5 A;  4AFZ C;  1VQO Q;  1RAH B;  3LW5 E;  3CCR A;  3QZ5 B;  5J3B A;  4A53 A;  1YIT T;  5KYY A;  4C5I A;  5GAN 8;  5AT1 B;  1WHK A;  2DXC A;  2YUO A;  2RQU A;  5CK9 A;  3OS2 A;  4E7I A;  2MMP A;  2OTL T;  1QWF A;  5CKE A;  3EGX B;  2OAU A;  3M0T A;  3M4G A;  3G7Z A;  1QVF A;  3OYE A;  2QXF A;  3OB9 A;  4NOY A;  1AWW A;  2CZ1 B;  2E65 A;  1X6G A;  1IGQ A;  2PVO B;  3JCM b;  3BY7 A;  1QP3 A;  4ELZ C;  3WXM B;  1J3T A;  4KUI A;  2K3X A;  3TVT A;  2F5T X;  3JRZ A;  1NYG A;  3M0R A;  1D0Z A;  2KRS A;  5LJ3 f;  5FW9 A;  3RKX A;  4LDY A;  3NFC A;  2LQN A;  3L2R A;  4M78 E;  4AFQ C;  1TH7 A;  2OI3 A;  3E2U A;  3QUI A;  1VQ6 Q;  3HKS A;  4M7A F;  5FLX E;  5GAN j;  4DBR A;  3G4S Q;  1K9A A;  1IO6 A;  3C12 A;  1TU0 B;  1GFC A;  2EIF A;  1K76 A;  3A8O B;  2LJ0 A;  2DTH A;  4M7A B;  1D09 B;  3OW2 S;  4Z02 A;  2I2L A;  2DBK A;  1NLO C;  5HY6 A;  4E7H A;  4B9W A;  1VQ9 T;  3MHX A;  3VS2 A;  3CCU T;  1O75 A;  1D0Y A;  5DLO A;  4QVC A;  2M16 A;  3LGF A;  4Y28 E;  3OW2 P;  1FWZ A;  1KQS A;  1BCO A;  5GAO p;  2DL4 A;  4M77 F;  3SWN C;  1MGQ A;  4M7A A;  4K11 A;  2DER A;  3CCJ Q;  3FDR A;  5GJV B;  4C92 F;  1NYF A;  4M77 B;  2IG0 A;  2DEQ A;  2K5F A;  4KGZ B;  3PTA A;  4J6X A;  1AT1 B;  3JAM E;  4C92 B;  1UB4 A;  2E1H A;  1N9S A;  1VQ7 A;  4XTZ A;  3CMA A;  2X4X A;  5KCO A;  2YRC A;  5LJ3 h;  3OS5 A;  2V1R A;  4A4E A;  2SEM A;  5I2M A;  1M1G A;  3H6Z A;  2LVM A;  4ESR A;  1NBE B;  3OYH A;  4M78 D;  1NEG A;  3VS4 A;  4XTY A;  1PSE A;  4C92 A;  3CCL A;  1PNJ A;  5L23 A;  3REA B;  1TS9 A;  2QGF B;  4LUE A;  3JB9 F;  1Y96 B;  2KXC A;  3NTK A;  2Y4X A;  2CZ0 B;  2HBW A;  1YIJ T;  3KXT A;  1WZO A;  4QQG A;  4XU2 A;  3QBY A;  4Y92 A;  3CC2 A;  1K73 U;  5C0M A;  1G2B A;  2QAZ A;  2LMJ A;  2E4H A;  1GRI A;  2EYY A;  1QKW A;  2FB7 A;  1FMV A;  1YJN Q;  4WF2 A;  3CCS A;  3CPF A;  2GGR A;  1SKU B;  1X43 A;  1I81 A;  1JXO A;  2AHJ B;  1CKA A;  1VYU A;  5KYX B;  3P8H A;  3MP1 A;  1I07 A;  3RNJ A;  3VJP A;  1BI1 A;  2CT3 A;  2O2O A;  2RNA A;  3R6N A;  3HFO A;  4F7U G;  3H41 A;  4EPC A;  4EDU A;  3NTI A;  4EMK B;  1I5O B;  3JCM c;  1VIE A;  3O5Z A;  4ATO A;  5D7U A;  1Z9Z A;  2DYI A;  2CP3 A;  4IUR A;  4FL6 A;  5LJ5 d;  4PFO A;  4C8Q G;  5LJ5 g;  1BU1 A;  4IUU A;  3M4Y A;  2EW3 A;  2DXB A;  2HQH A;  2IIM A;  4J9B A;  1VQL T;  1VQ5 A;  3EFO B;  1PRL C;  2DRK A;  3OMG A;  3QHS A;  4CC2 A;  1KQ2 A;  1M3B A;  2F69 A;  3CME T;  2EBP A;  1SRL A;  4JS4 A;  4EMK A;  1N27 A;  2D0Q B;  4XU1 A;  3KFV A;  1AVZ C;  1UFF A;  3QWY A;  1SHG A;  1GBR A;  2Z0W A;  1Q86 U;  2RQR A;  1T3L A;  2GQV A;  1OPK A;  1ZSZ A;  2HAX A;  2FO0 A;  1NEB A;  2KRM A;  1CSK A;  2QQR A;  3BDU A;  3KBG A;  3E1S A;  3QYH B;  2YHT A;  4MZP A;  4Z89 A;  1WDX A;  2QEX Q;  1H3Z A;  2EFI A;  4JRI A;  2KAF A;  3RR6 A;  3CBM A;  1I5L A;  2CP0 A;  2K4Y A;  2CKK A;  2R58 A;  2LT1 A;  2L3P A;  1RAI B;  2BUD A;  5A2Q E;  4D6W A;  4C5E A;  2QYZ A;  4BI4 A;  4KGV B;  3E19 A;  1YIT Q;  4JZ4 A;  1SG5 A;  3FLG A;  1K4U S;  2DET A;  2WSF E;  1WGS A;  4OMQ A;  1VQP A;  3M57 A;  3QJ6 A;  1VQN A;  2OTL Q;  3M5A A;  2RO0 A;  4C8Q C;  3QDF A;  3CCQ Q;  4RMO A;  3OYG A;  1VOM A;  4DEY A;  5HKC A;  4DOV A;  2EYW A;  4KH0 B;  4OP0 A;  2FRW A;  2PNI A;  4LN2 A;  2IVW A;  2RJE A;  1MND A;  3PE0 A;  2RN8 A;  3QZ9 B;  2AKK A;  1KHI A;  2JOY A;  1YN8 A;  3PIO A;  1H64 1;  2D0N A;  4HVU A;  4ZGD B;  4II1 A;  4ZGE B;  1A0N B;  3EG1 A;  2JMC A;  4PK4 A;  2J7I A;  2KXD A;  3VS3 A;  1MNE A;  2DFU A;  2QQB A;  4CC7 A;  1HD3 A;  4M7D F;  4QQD A;  2KT8 A;  3CBO A;  2DF6 A;  1G3T A;  1MMD A;  1Y07 A;  4M7D B;  4PJO A;  2JZ2 A;  1AZG B;  3GNF B;  1K73 C;  4J8O A;  1BK2 A;  1YHQ A;  1K9M C;  4FYW B;  1KQS S;  3P8B B;  1VQ9 Q;  2ZPI B;  4FT2 A;  5KYU B;  4AMC A;  3CCU Q;  1PM3 A;  2RHI A;  2H3J A;  3OYM A;  3CBP A;  1VQ6 T;  1K73 R;  3UF4 A;  5KE2 A;  1K9M R;  4M75 A;  3H9N A;  4ELY C;  3KUF A;  1KQS P;  3L1A A;  2RM4 A;  1ZLM A;  5GAN f;  4MML A;  2FVU A;  5KYU A;  5GAN d;  1WHL A;  5GAO m;  1YJW T;  2PVG B;  3PNW C;  3CCV A;  1KG1 A;  1N6A A;  5GAN g;  1D3B A;  2K5I A;  1VQ4 A;  3TCJ A;  2L0A A;  1H8K A;  3LLR A;  4RTX A;  1UUE A;  2JTE A;  3J80 E;  2VXE A;  3CD6 A;  1WHH A;  4A4H A;  1KD1 C;  5CKH A;  2ROL A;  4CRI A;  3SEM A;  5CR2 A;  4F17 A;  3JB9 I;  4XU0 A;  4E7J A;  4OMN A;  1G8X A;  1TUC A;  4E2F B;  4DEX A;  1JJ2 S;  2MAM A;  3OYJ A;  4M7A G;  1KD1 R;  2K5L A;  4Z8A A;  1EX4 A;  1IB8 A;  5IAY A;  3A5Z B;  3SFM A;  2XU8 A;  3HSB A;  3EGD A;  4WTO B;  1ACM B;  3NMZ C;  2OTJ T;  4QQ6 A;  1JJ2 P;  2R5M A;  4DA4 A;  2HZY A;  3RER A;  1IGU A;  4FIB A;  3TSZ A;  3H0I A;  4X1V A;  4RTU A;  1RAC B;  1WIE A;  2AK5 A;  4HCC A;  4OGE A;  4QT7 A;  3X26 B;  4Q5W A;  2QA4 T;  2ED1 A;  2HSP A;  2KT1 A;  1VQK A;  1D0X A;  3OYY A;  3M59 A;  2E70 A;  4XTW A;  5CQY A;  2CSQ A;  4M77 G;  4O5V A;  3A1P A;  2K57 A;  2DE0 X;  1ARK A;  1XNI A;  1U3O A;  2QG9 B;  2ABL A;  5DLQ E;  2LTO A;  3Q1J A;  2CZ7 B;  3CCE T;  1RL2 A;  4JS5 A;  2HQE A;  1ZX6 A;  1WQW A;  1BB9 A;  1TG0 A;  4QKU A;  2GNC A;  1YIT A;  3S3N A;  1I4K 1;  1I8F A;  2JTF A;  4ORZ A;  5HK3 A;  1JBM A;  3FJ5 A;  1YJN T;  2CSI A;  1WNL A;  3VYH B;  3H8Z A;  2LP5 A;  3HFN A;  2EWN A;  1C0M A;  2CT4 A;  2RJC A;  4BI3 A;  1VQL Q;  1VA7 A;  5GMK e;  2M02 A;  4XQ3 A;  1AHJ B;  3MEV A;  1N9R A;  4C5H A;  3CME Q;  5GAO r;  1AZE A;  2RF0 A;  2FRY A;  1UE9 A;  2W0Z A;  3A98 A;  3JB9 G;  2P0K A;  1OV3 A;  4A4G A;  3QJY A;  2DNU A;  4B9X A;  4F04 B;  3OYN A;  1IHW A;  4FYY B;  1WFW A;  2F2X A;  3GOX A;  2HEQ A;  1YJ9 A;  1RAG B;  3QPH A;  2HCK A;  3ZEH A;  2LT4 A;  5I21 A;  4M77 C;  1OI1 A;  2NUP A;  4F14 A;  2V8I A;  3OYA A;  3VUZ A;  4J83 A;  2L2P A;  3I55 T;  3CC4 Q;  1BI3 A;  4RG2 A;  2QK0 A;  4M78 A;  2DL8 A;  3CXC A;  2DVJ A;  1SSH A;  5KYY B;  3E9G A;  2EQM A;  2FZK B;  1YNZ A;  3L2U A;  2EGA A;  1XJW B;  2GCX A;  3RKY A;  3WVE B;  3A8G B;  1OZ2 A;  1QVG A;  2O31 A;  3VS7 A;  1NG2 A;  2LQK A;  2OJ2 A;  4F7U E;  2DTI A;  3THK A;  1M2V B;  1AOJ A;  2EKH A;  3RMQ A;  3CCM T;  1W1F A;  1D1C A;  2O01 E;  4NS5 A;  5CKD A;  1I0C A;  3G71 Q;  5GAN 4;  4J9F A;  2JNG A;  1D1B A;  3OYD A;  2ZZD A;  1S72 T;  4C8Q E;  3OYC A;  4OB3 B;  1NE8 A;  2DO3 A;  3LWH A;  3LH5 A;  1BYM A;  1OZ3 A;  4OB2 B;  1Y0M A;  2ZPF B;  1M2V A;  1W70 A;  2EJ9 A;  3CCQ T;  2B86 A;  2JJ9 A;  1KC8 U;  2K9G A;  4A4K A;  4J9H A;  2C0T A;  3CPW S;  3EG9 A;  3G6E A;  2LCS A;  3ASK A;  3O8V A;  1YI2 Q;  1MMG A;  5GAN e;  1ABQ A;  4FM4 B;  4J9E A;  2RHY A;  2A7Y A;  3CPW P;  2EQK A;  3VS0 A;  4KBM B;  3GNG A;  1WPY A;  2AKL A;  3VRZ A;  4OGC A;  1NZ9 A;  5A0G A;  3L2Q A;  1YIJ A;  3QII A;  4JPB W;  2V8J A;  5LJ3 d;  3V8J A;  5LJ3 g;  1E6G A;  4JUV A;  2KI7 A;  5FRN A;  3ER0 A;  5A0D A;  3NPF A;  4PJJ A;  3L2V A;  2P0P A;  2EGE A;  4OF1 A;  3PGG A;  1YJW Q;  3A8M B;  1U5S A;  1SF9 A;  1UDL A;  1SEM A;  2DX1 A;  2QDL A;  2XMF A;  3OYI A;  4C8Q D;  2X4Y A;  4J5Y A;  4BE0 A;  3EGU A;  3RUX A;  2PU9 B;  5FWB A;  2KDS A;  3L2W A;  2FYK A;  4EMG A;  4RKU E;  3V8L A;  5CVI A;  4E7Z A;  3EG3 A;  3GIB A;  3MJX A;  4OMF B;  4BAC A;  1VQ8 A;  2XI9 A;  5IHN A;  3GP8 A;  2EPD A;  4XTV A;  4M7D G;  2VV5 A;  2FPD A;  2VGN A;  3REB B;  2D6F A;  4JZ3 A;  5GAM f;  2LCL A;  2HKQ B;  2RH2 A;  5GAN 2;  3CCR T;  3T9N A;  3TU4 K;  2DRM A;  1M27 C;  8ATC B;  2OTJ Q;  2RHZ A;  2VB6 A;  4NL3 A;  1W2B A;  1VIF A;  4IUP A;  1KK7 A;  2CP2 A;  3MKD A;  3VYG A;  4HKE A;  3HRT A;  2LCC A;  1H92 A;  2QA4 Q;  2QTV A;  3J81 E;  1NM7 A;  4C0Z A;  3AT1 B;  5KCH A;  2KVQ G;  1F1B B;  1KHC A;  2DIG A;  2BZX A;  2I0N A;  4ZGJ B;  4AFS C;  2DYB A;  5D6X A;  1HJD A;  3CCE Q;  2CP5 A;  1X75 C;  1OU8 A;  1MV0 B;  4KUD K;  2DZC A;  2LQ8 A;  1K9M U;  2A0F B;  4E7K A;  2ZPG B;  5HK0 A;  3TQ7 P;  2QQA A;  1Q7Y U;  1N8R U;  1U06 A;  4UC4 A;  2LX7 A;  3I5S A;  4HCZ A;  1VQO A;  3SB2 A;  5GAM h;  4M7D C;  2GQI A;  2CH4 W;  1XQH A;  1OX8 A;  1X27 A;  1WX6 A;  2XIC A;  1V1C A;  1ZA2 B;  2KYM A;  1KC8 C;  2ZPE B;  4C5G A;  2RK1 A;  4M7A E;  1UGV A;  1ZSZ B;  3QWX X;  2WAC A;  1KC8 R;  3CC7 Q;  3PMT A;  1VYT A;  1KD1 U;  4E47 A;  4PJL A;  4IUQ A;  2VAS A;  2KQW A;  1HSQ A;  5FU6 C;  2O9V A;  4RTV A;  3X28 B;  1FXX A;  1M4Z A;  1PD1 A;  3CXC S;  1WLP B;  3M54 A;  2KR3 A;  1M8M A;  1HK9 A;  2ZGW A;  1VQM Q;  3I55 Q;  4FW1 A;  2DBM A;  2BE9 B;  1R0B G;  2XDB A;  4DQ2 A;  2ZAE A;  1VQ7 T;  4JRP A;  3CXC P;  4M77 E;  3EHR A;  3UA7 A;  3C95 A;  4N0A C;  4FSS A;  3OYB A;  2YSQ A;  2E6Z A;  1VQ6 A;  3M9Q A;  1MV3 A;  3G4S A;  1OEB A;  3CC4 T;  2GBQ A;  4BI8 B;  1RAA B;  2HL5 C;  1M3C A;  2LC4 A;  3IQL A;  4ZNX A;  3CCM Q;  3GF5 A;  2JXB A;  3ME9 A;  4B6M A;  4PJM A;  4LD6 A;  1LVK A;  3R6O A;  4JLG A;  1IHV A;  2YLC A;  1S72 Q;  1UJY A;  1NJI C;  4LXC A;  4RTT A;  3SD4 A;  1QVF S;  4BY6 C;  1FYN A;  1ZHI A;  2XDP A;  4M7A D;  2JM9 A;  1LCK A;  3UT1 A;  2JW4 A;  3V8K A;  5LJ3 e;  5IXB A;  4L5G A;  2DXT A;  2VC8 A;  1NJI R;  5CCA A;  4QVZ A;  1PSF A;  3G71 T;  3CCJ A;  4XTX A;  1T3S A;  4PNO A;  3SWN A;  3CCS T;  5GAO n;  2P4T A;  1VYV A;  3P8D A;  1QVF P;  1M9S A;  4J7I A;  5ECA A;  4PJO F;  2JMA A;  2XG8 D;  3VS5 A;  1GCQ C;  4HT8 A;  4JLI A;  2ED0 A;  4JDS A;  1MMN A;  2MWO A;  2AZS A;  4PJO B;  3GLX A;  3HRU A;  3LGL A;  2EQJ A;  2OTJ A;  1M90 U;  3VU3 C;  2F2V A;  2CS7 A;  2E5K A;  1M1K U;  4M77 D;  4M75 F;  4N4H A;  2FHD A;  1MUZ A;  2O9S A;  4LDV A;  3OYL A;  3OA6 A;  1BIB A;  3PIP A;  3DB3 A;  4C92 D;  4LE9 A;  2RQW A;  1YI2 T;  1K0X A;  1VQ5 T;  4M75 B;  2L3S A;  2KEA A;  2O4X B;  2VXF A;  5GJW B;  2P84 A;  3ZFJ A;  1UGS B;  4LDX A;  4GLK A;  4KT0 E;  1OOT A;  2KRO A;  4FYX B;  2KBT A;  1D3B B;  3UAT A;  1Q7Y C;  1N8R C;  2DL3 A;  2L5Q A;  1HXD A;  4FSX A;  3LWI A;  2FZG B;  1VUB A;  1UJ0 A;  3BDL A;  4HCK A;  3A8L B;  3HRS A;  4FYV B;  2O4X A;  1YJN A;  2QGG A;  3JB9 J;  1Q7Y R;  1N8R R;  2LZ6 B;  2BE7 D;  1QW1 A;  5GAM j;  1U1S A;  2GTJ A;  4BE1 A;  1MHN A;  4IUT A;  3C4S A;  1JEG A;  2QDY B;  1E6H A;  3JB9 D;  2E41 A;  2XD0 A;  1Y71 A;  1WI7 A;  2DD5 A;  2NLU A;  3HPW A;  1QLY A;  1GXI E;  1UGR B;  3MPU B;  3I9Q A;  2X51 A;  2DXU A;  2RJF A;  2KSS A;  2XK0 A;  2BZ8 A;  2NUT B;  4HVW A;  4GLM A;  3CCR Q;  4KUL A;  2M1H A;  4Y91 A;  3EGD B;  4J9G A;  3PVQ A;  1UEB A;  1WJS A;  2C0I A;  3OQ5 A;  1OPL A;  5FU7 C;  3UA6 A;  3BE3 A;  1IZ6 A;  1PRM C;  4OMO A;  3PFS A;  4KGX B;  1WHJ A;  2WSC E;  1FX7 A;  4JJC A;  5IH2 A;  1HYO A;  3QO3 A;  3OS0 A;  1ZBX A;  2QTX A;  4X9D A;  4C0F A;  5I22 A;  2B8A A;  2NUT A;  2PVD B;  2LQW A; 
#chains in the Genus database with same CATH homology
 2FPF A;  1BBZ A;  3THK A;  2CUD A;  1AOJ A;  2EKH A;  2V1R A;  5IHI A;  2FEI A;  2SEM A;  2BZY A;  1W1F A;  4ESR A;  1NEG A;  1I0C A;  2K2M A;  4J9F A;  3VS4 A;  1SHF A;  2FG0 A;  4KRT A;  1PNJ A;  5L23 A;  3REA B;  4GBQ A;  3LH5 A;  4LUE A;  1WXB A;  2KGT A;  1GCP A;  2HDA A;  4JJB A;  3U23 A;  2EYX A;  2KXC A;  1AEY A;  1Y0M A;  1PKT A;  1W70 A;  1M3A A;  1T0J A;  2B86 A;  1AD5 A;  2K9G A;  2HBW A;  1EFN A;  4Y92 A;  1X6B A;  2LJ3 A;  4J9H A;  2C0T A;  1WYX A;  1G2B A;  2LNH B;  2LMJ A;  1GRI A;  2EYY A;  2NWM A;  2LCS A;  5I11 A;  2A28 A;  1QKW A;  1WXT A;  4D8K A;  2V1Q A;  2H8H A;  2CRE A;  2YDL A;  2L3Q A;  3M0P A;  1ABQ A;  1X43 A;  2GGR A;  1JXO A;  2JS2 A;  1CKA A;  1VYU A;  4J9E A;  4RTY A;  1I07 A;  3RNJ A;  1PHT A;  2CT3 A;  3VS0 A;  2O2O A;  2RNA A;  5EC7 A;  2KYB A;  3R6N A;  3H41 A;  2CUB A;  4IIO A;  2AKL A;  3VRZ A;  4AG1 C;  1JU5 C;  2K7A A;  2DA9 A;  4JPB W;  1KFZ A;  3O5Z A;  4D8D A;  2EGC A;  1RLP C;  2RQV A;  1E6G A;  1Z9Z A;  4HXJ A;  2ENM A;  3I5R A;  1BU1 A;  3NPF A;  2EW3 A;  2IIM A;  2M0Y A;  1ZUU A;  3M0S A;  4J9B A;  1PRL C;  2DRK A;  4CC2 A;  2EGE A;  4JJD A;  1M3B A;  2EBP A;  1U5S A;  2MIO A;  1UDL A;  1SRL A;  1SEM A;  2DX1 A;  2QDL A;  2XMF A;  3KFV A;  2OAW A;  3RBB B;  1RUW A;  1AVZ C;  1UFF A;  3QWY A;  4IIM A;  1SHG A;  1GBR A;  2JT4 A;  2RQR A;  3EGU A;  1T3L A;  5FWB A;  1SPK A;  2A37 A;  1PKS A;  4J9C A;  2FPE A;  1OPK A;  2J06 A;  4RUG A;  2FO0 A;  1NEB A;  2J05 A;  2KRM A;  1CSK A;  3EG3 A;  3C0C A;  5IHN A;  2A08 A;  2EPD A;  4OMM A;  2FPD A;  4Z89 A;  1UEC A;  2ESW A;  2VKN A;  4E6R A;  1WDX A;  3REB B;  4JZ3 A;  1PWT A;  3VRY A;  4AFU C;  1M30 A;  1ABO A;  2DRM A;  3ZL7 C;  2DIL A;  2L3P A;  1M27 C;  1ZUK A;  1W6X A;  2A36 A;  3ULR B;  1UTI A;  1WXU A;  4M4Z A;  2M51 A;  2D8H A;  4JZ4 A;  1K4U S;  1H92 A;  4RTZ A;  1NM7 A;  4OMQ A;  1X2K A;  2BZX A;  1ZSG A;  2I0N A;  4HVV A;  1YCS B;  1UHF A;  1Y57 A;  4AFS C;  2DYB A;  2P4R A;  1HJD A;  1K1Z A;  1GL5 A;  2DM1 A;  1KJW A;  4DEY A;  2KNB B;  2BTT A;  2LJ1 A;  1MV0 B;  2EYZ A;  2EYW A;  2YUQ A;  4RTW A;  1QKX A;  5FWC A;  3GBQ A;  1FMK A;  1ZBJ A;  1RLQ C;  2FRW A;  2PNI A;  3I35 A;  5IXF A;  4LN2 A;  1AWX A;  4EIK A;  3PE0 A;  1X69 A;  2RN8 A;  4R0K A;  2AKK A;  1YN8 A;  1TUD A;  3M0Q A;  2D0N A;  1U06 A;  4HVU A;  1A0N B;  3EG1 A;  2JMC A;  1WA7 A;  2EQI A;  2J7I A;  2LX7 A;  4WCI A;  3I5S A;  1XOV A;  2KXD A;  3VS3 A;  1JXM A;  2GQI A;  4CC7 A;  2CH4 W;  1HD3 A;  1X27 A;  1WX6 A;  1X2Q A;  3JV3 A;  1V1C A;  2DL7 A;  2F2W A;  2KT8 A;  2DF6 A;  2KYM A;  1QCF A;  3SHW A;  2RQT A;  2JS0 A;  3NHN A;  1AZG B;  1UGV A;  1Z9Q A;  2J6O A;  3QWX X;  2EVR A;  1BK2 A;  1GCQ A;  1AWO A;  3VS1 A;  1VYT A;  1N5Z A;  1HSQ A;  3UF4 A;  2JM8 A;  2O9V A;  4RTV A;  2SRC A;  2W10 A;  4LUD A;  1WLP B;  1JQQ A;  1T0H A;  2KR3 A;  1M8M A;  2VWF A;  1NLP C;  1ZLM A;  4OML A;  3TSW A;  2J6F A;  2MCN A;  2DBM A;  1QWE A;  3H0H A;  4LNP A;  2KE9 A;  2YUP A;  3EHR A;  2PZ1 A;  3UA7 A;  2ROT A;  4FSS A;  2L0A A;  1CKB A;  1E7O A;  1H8K A;  2ECZ A;  4RTX A;  5HCK A;  2YSQ A;  1UUE A;  3EHQ A;  2JTE A;  1I1J A;  1MV3 A;  1S1N A;  1GBQ A;  4CC4 B;  4AG2 C;  1OEB A;  2ROL A;  3SEM A;  2GBQ A;  3NGP A;  2YUN A;  2D8J A;  1M3C A;  3IQL A;  4ZNX A;  4F17 A;  1K0S A;  2VVK A;  4OMN A;  4J9D A;  1TUC A;  2X3X D;  1KSW A;  2JXB A;  4DEX A;  4J9I A;  2G6F X;  4Z8A A;  4CC3 A;  1G83 A;  1RI9 A;  2O88 A;  1UJY A;  4RTT A;  2MOX A;  1UHC A;  3NMZ C;  2RPN A;  3EG2 A;  1FYN A;  1YWO A;  4AFZ C;  2PTK A;  1GFD A;  3TSZ A;  3H0I A;  2JM9 A;  1LCK A;  2JW4 A;  4X1V A;  4OMP A;  4RTU A;  1WIE A;  5IXB A;  2AK5 A;  4QT7 A;  2ED1 A;  1T3S A;  2GTO A;  2HSP A;  2KT1 A;  2RQU A;  2YUO A;  1VYV A;  5ECA A;  4A63 B;  2DLP A;  2JMA A;  3VS5 A;  1GCQ C;  2CSQ A;  2DE0 X;  2ED0 A;  2J6K A;  1ARK A;  1U3O A;  1QWF A;  1B07 A;  2ABL A;  2AZS A;  3M0T A;  1SRM A;  2F2V A;  1ZX6 A;  3VS6 A;  1BB9 A;  1ZUY A;  2E5K A;  1TG0 A;  1H3H A;  2GNC A;  2D1X A;  1MUZ A;  2O9S A;  4ORZ A;  2X3W D;  1AWW A;  3FJ5 A;  2RMO A;  4LE9 A;  2RQW A;  1K0X A;  2CSI A;  1X6G A;  2L3S A;  2KEA A;  2LP5 A;  2YT6 A;  5GJW B;  2CT4 A;  1J3T A;  2C0O A;  3TVT A;  1NYG A;  3M0R A;  2K3B A;  2KRS A;  1VA7 A;  5FW9 A;  1OOT A;  1YP5 A;  2LQN A;  2NUZ A;  2KRO A;  4AFQ C;  2KBT A;  2OI3 A;  2CDT A;  3UAT A;  1AZE A;  2RF0 A;  2DL3 A;  2FRY A;  1UE9 A;  2W0Z A;  1K9A A;  1IO6 A;  3A98 A;  1UJ0 A;  1OV3 A;  1GFC A;  4HCK A;  1K76 A;  2LJ0 A;  2DNU A;  2DBK A;  2DJQ A;  2K6D A;  1NLO C;  3EG0 A;  2LZ6 B;  1UG1 A;  2DMO A;  1WFW A;  2F2X A;  2GTJ A;  4F16 A;  2HEQ A;  1JEG A;  3VS2 A;  1E6H A;  1WI7 A;  1QLY A;  2HCK A;  3I9Q A;  3M0U A;  2BZ8 A;  4HVW A;  4GLM A;  1JO8 A;  4F14 A;  2DL4 A;  4J9G A;  2CH4 A;  3H0F A;  4Z88 A;  1AWJ A;  2L2P A;  2K79 A;  3PVQ A;  2AZV A;  3CQT A;  3PVL A;  5IHK A;  1B3Q A;  4K11 A;  2C0I A;  2KRN A;  1OPL A;  3UA6 A;  5GJV B;  1PRM C;  2DL8 A;  2DVJ A;  4OMO A;  1SSH A;  1NYF A;  1KIK A;  4JJC A;  2DL5 A;  1YNZ A;  5IH2 A;  2EGA A;  5I22 A;  2O31 A;  3VS7 A;  1NG2 A;  1YWP A;  2LQW A;  2OJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...