4M7AB

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 19
structure length 90
sequence length 90
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aB00
5GMKj 4M7DE 1U1TA 4C8QF 5GAMd 4XU2A 4F7UF 1BIBA 2DEQA 5CAIA 5GMKe 4PJOE 4C92E 1D3BA 2EJFA 2YHTA 4DQ2A 3BFMA 2DKGA 5LJ5g 2RM4A 4XU1A 1MGQA 4C8QG 1LOJA 3SWNC 4XTWA 1LJOA 3M4GA 4M75B 4X9CA 5DY9A 3V7RA 3GIBA 4C92B 3FIFA 1B34B 4XTUA 4JRKA 5GAN7 5GAOl 1N9SA 4RCBA 5GAMh 2RD1A 3JCMX 5GAN5 1KQ1A 3INZA 5LJ5d 5LJ5e 3JCMb 5GAMf 2E1HA 4XQ3A 3JB9I 4M7AC 1D3BB 1HK9A 5GAN6 3RUXA 4F7UA 2E65A 5LJ3e 3V8JA 4C8QA 3JB9D 4V2SA 3BDUA 3V7CA 2I2LA 4JLIA 2YLCA 4NOYA 1B34A 4EMKC 5LJ3f 5GANe 1Y96B 2HNIA 3AHUA 3JCMg 2K57A 4MMKA 4C92D 4M77A 5GAMj 4M7DG 4M78D 1H641 5GMKi 2DXTA 4PJOD 5GAMe 3RKXA 3JCMJ 3QSUA 3V8KA 3BY7A 4C92C 4M77B 3FJPA 3HFOA 4PJOA 4EMHA 4PJOC 4M75E 3RERA 3JCMd 2DVEA 5GAN8 1JRIA 4M7AA 4M78G 2VXFA 4XTVA 1I4K1 3PGGA 4C92F 1LNXA 2JN0A 5LJ3h 3EFSA 3V7SA 4EMKB 4M78F 1N9RA 1U1SA 5LJ3g 2E10A 4NL3A 5GMKh 2DTOA 4M7DD 4XTZA 4M7DF 2VXEA 4OP0A 3JCMf 2QTXA 4HT8A 4EMKA 3RESA 1WPYA 2FB7A 3L1AA 1WQ7A 4N0AC 3JCMh 1WQWA 4M77E 3JB9G 1TH7A 5LJ3d 4HT9A 4M7DC 4PNOA 2DTHA 4PJOB 5GANd 4M78B 1KQ2A 3L2ZA 2DTIA 1WNLA 5GAOq 4EMGA 3HSBA 1YCYA 5GANj 2YLBA 3JB9J 1BIAA 4JRIA 3JB9H 2DJZA 4J6WA 2EJ9A 4M75F 5LJ3j 2EWNA 3SWNA 5GAN3 4QVCA 1I5LA 2RA2A 2Y90A 4MMLA 5GANg 5GAOr 4J6XA 2EAYA 5GAN4 4J6YA 4M75G 3JCMQ 2E64A 1X01A 2VC8A 4F7UG 4M78E 4C8QB 4XTXA 5GANf 5LJ5f 4M75A 3JCMV 3QUIA 4M7AE 5I21A 4NL2A 3JB9F 4A53A 4HA8A 3RKWA 3HFNA 5GAN2 2DXUA 2ZGWA 4M78C 4M78A 4M7AD 3V8LA 4C92A 4J5YA 5GMKl 4PJOG 5GAOn 4XU0A 4M77G 4C92G 4M7AF 5GANh 5LJ5h 1M8VA 1HXDA 4PJOF 3RKYA 2EJGA 4Y91A 4C8QE 4M7DA 3QHSA 3EFRA 4M7DB 2E41A 4X9DA 2CGHA 4A54A 3RIRA 2RB6A 4XU3A 1Y96A 2FYKA 3QO3A 3FB9A 4WF2A 3JCMc 3VU3C 4M75C 4C8QD 4QVDA 3JCMe 4M7AB 3BW1A 4JUVA 4RCCA 4F7UB 5LJ5j 1JBMA 2DZ9A 4F7UE 3JCMP 4XTYA 3SWNB 5GAMg 4M7AG 5GAOm 4M75D 4C8QC 5GMKm 4M77D 5GAOp 4M77F 1M5Q1 4N0AA 3JCMW 2DZCA 3SB2A 1I81A 1I8FA 4M77C
chains in the Genus database with same CATH superfamily
1VQ5A 2YUQA 3VS1A 1LVKA 2JJ9A 2E12A 3A8HB 4E7IA 3MP1A 1PD1A 1LJOA 3VS0A 2ECZA 1HJDA 1ZX6A 2E6ZA 2FG0A 2KAFA 1Q82U 1VQ4T 2D1XA 1RAAB 2LQKA 5IHKA 5IXBA 3V7CA 3G1JA 4JLIA 4L5GA 1Y96B 1R0CB 2LMJA 1SSHA 2XI9A 1YJNQ 4Z89A 2LJ1A 3ZBDA 1FMWA 1H3HA 3RKXA 3QSUA 1OU9A 1IHWA 2FRWA 1D0XA 4YTLA 3RNJA 3FJPA 1JXOA 4M7AA 1JO8A 1M90C 2O01E 2ESWA 3CCEQ 3REBB 3LGFA 3UF4A 2RQVA 3SD4A 3VYGA 2FRYA 4A4KA 5LJ3d 3VUBA 2DA9A 1KQ2A 1RAHB 2E6NA 2RHXA 1GBRA 1U5SA 2DX1A 1NLOC 4VUBA 2LCCA 3VRZA 1EFNA 3T9NA 3Q1JA 4XTXA 2EYWA 5LJ5f 4M75A 3QUIA 1RACB 4A53A 1TUCA 4CC4B 1NLPC 1RABB 1VYUA 2ABLA 1KHIA 3EG9A 5CKEA 4CC3A 1VQMQ 2EKOA 3MEWA 1CKBA 2X4YA 2FO0A 5KYUB 1Q7YC 1VQOQ 2CYZB 2EJGA 2DERA 2M02A 2GTJA 2KRNA 4A54A 3G71Q 3LW5E 1KC8U 4FYXB 4N4IA 2RMOA 2KXDA 3G71T 1WHHA 5IAYA 4M75D 4C8QC 2RN8A 3CPWP 1Q86C 4HVUA 3JCMW 3O8VA 3MCAB 2LX7A 3OS2A 1UJ0A 3L2RA 3CC7T 3MKDA 1TOVA 5CKBA 4A4EA 1B7TA 3CCVT 1OX8A 4C8QG 4FL6A 3CCST 3A8OB 2RHIA 3JCMX 3MEAA 1KC8R 1X6OA 2ZPIB 1MHNA 2OI3A 3TU4K 4C8QA 2YRVA 5GANe 1B34A 2LJ0A 3H9NA 3QWYA 4RG8A 2HNIA 5I11A 3C12A 4OVAA 1WJSA 1C0MA 3JCMJ 1PM3A 3I56T 3DKMA 4A63B 4C92C 1T3LA 1G3YA 3QZ9B 2K6DA 2FPDA 2DLPA 3CXCP 4KT0E 5A0DA 4EMKB 1N9RA 4BE0A 4M7DD 3CMET 2KMTA 1AWJA 3L1AA 5KYYA 2BUDA 2XDDA 3A8MB 2DBMA 4Y92A 3OBYA 3EG0A 2WSEE 1UUEA 4CC7A 3FLGA 5GANg 5GAOr 5CKFA 4F04B 1IO6A 2LC4A 4NL2A 2QQSA 3MEVA 4HVVA 5FWBA 3NFCA 1JJ2S 3C4SA 3ASKA 3NTKA 1QWEA 3M9QA 1UB4A 2QTVA 2IPOB 3PMTA 1Y71A 4DEXA 2O9SA 2HEQA 3QWXX 2HKQB 4MDXA 4NS5A 5C0MA 1WZOA 2LCLA 3OB9A 4FYWB 3OYEA 1MV3A 1PSEA 2E70A 3SB2A 2F1LA 2DYIA 2FHDA 4ANJA 2NWMA 4HCKA 2EJFA 4C0GA 2DJQA 2H3EB 4LD9K 1N5ZA 1YI2T 4M75B 2LT1A 2PVGB 1N9SA 3TEEA 7AT1B 1BKBA 1BCOA 4Y28E 2M0YA 4LDXA 3MP8A 5LJ3e 1OV3A 3BDLA 2CP2A 3BDUA 2JNGA 5HK0A 1W6XA 1X2QA 2YRCA 1AEYA 2DXTA 1JQQA 1Q86R 1AHJB 2OTLT 3HFOA 1YHQA 1RAEB 4QKUA 2KVQG 3QPHA 2D9TA 3V7SA 3CCJA 1N8RC 1SF9A 1F1BB 2LDMA 4OMNA 3RESA 4C0ZA 3JB9G 4HT9A 4R56A 1TH7A 4WTOB 2MMPA 3I5SA 3M55A 3A5ZB 4DBQA 4ZGEB 2HDAA 2PU9B 3JB9J 3JB9H 1NE8A 2EJ9A 3N5BB 3VS3A 1K8AU 2K3YA 2RH2A 1Q86U 4KGXB 3SDZA 3RDVA 2KY9A 1ACMB 5FROA 1G5VA 2LX9A 2CZ1B 3CCQQ 5GMKl 5KYYB 4KH0B 1RUWA 4N4HA 4FSXA 1NBEB 1I5OB 2E41A 4X9DA 1PC0A 3VRYA 4ATOA 2VGNA 1QKXA 4DBHA 3QO3A 2X4JA 1VQKQ 3BW1A 1KD1U 1OPKA 4JPBW 1YJ9A 2IG0A 4BB7A 2QA4A 5CQXA 1GCQC 2B8AA 3QJYA 2ATCB 3CC4Q 3H6ZA 3PMIA 1DJ7B 2AKLA 2COZA 1U1TA 2GF7A 4C8QF 3CCMQ 2BZXA 2YHTA 1IB8A 1LOJA 1EZZB 2LVMA 2FEIA 2ZZDA 2YUNA 1Q7YR 4J9FA 2EQKA 1NZ9A 1M27C 2JM9A 4J7FA 5FW9A 4AFQC 3G6EQ 1K9AA 4LDYA 2I0NA 5DM7R 2FPFA 2GNCA 4L59A 2BE9B 1E6HA 3VKIA 4PJOC 2DEUA 1JRIA 2NUZA 4BE2A 2CREA 2GQIA 3GPLA 4UC4A 1M4ZA 1PWTA 2X4WA 1KQSP 4BDZA 3A8GB 2KE9A 5C6SA 4HT8A 4J9DA 2DM1A 4JS5A 4RKUE 2JTEA 1BYMA 3OY9A 3LH0A 5D6XA 2VASA 1KC8C 1FXXA 2KNBB 2MYSA 2V8KA 3WVEB 1NPPA 2XD0A 3LLRA 2OTJA 4M75G 1YJ9T 3J81E 3JCMV 2DILA 2F2WA 1WHMA 3X28B 2CP3A 2QYZA 2V8JA 2L5QA 1SPKA 3TREA 1OZ3A 4LDUA 2W10A 2ZPGB 4J9HA 2CZ6B 2EFIA 4C8QE 1VQKA 4PJJA 3KBGA 4RG2A 1D1CA 1YWPA 3UDCA 1VQNT 4PL6A 1M3AA 2K4YA 3TVTA 3OYYA 2K2VA 4M77D 1GL5A 3G71A 2YT6A 4KRTA 3ZEHA 4X1VA 3J80E 1FX7A 2G6FX 3NGPA 1QCNA 4O5VA 1YI2A 1ZSZC 4XTUA 3J7AF 4E47A 5KYWA 2YUOA 3QZ5B 2O4XA 2ENMA 5LJ3f 4RMOA 3I56Q 3GOXA 4D6WA 1NG2A 1WDXA 1TTHB 1M1KR 3OW2S 3M0TA 2DK3A 2O88A 1ZSZA 2ZAEA 2RI3A 1NEBA 1T3SA 2HAXA 2E10A 1D1AA 5GJVB 2JOYA 3OS1A 4JJBA 3WXMB 1WQWA 1PNJA 3HHTB 4ORZA 4P5NA 3H8ZA 2COWA 3SWNA 2L89A 1UECA 1UDLA 2P0QA 2GFUA 2DFUA 2VWFA 4DBRA 1BCMA 1RAFB 2LNHB 4C8QB 3CD6T 2GTOA 1JU5C 1GFDA 4HKEA 3M0UA 5FRMA 1K8AR 2EW3A 3QHSA 1ZA2B 4RTWA 3RBBB 4PFOA 1QCFA 3I55T 3H41A 3TQ7P 1SHGA 4KULA 4M7AB 4DBFA 1WA7A 1QP3A 2JW4A 1K73U 2ZPFB 1K9MU 3OSVA 4E2FB 3M53A 1QVFP 1K4US 4XU2A 2O2OA 2O9VA 3QDFA 1XQHA 3JV3A 4DQ2A 5DLQE 4XU1A 8ATCB 4MZTA 5DY9A 1QWFA 2FZGB 5M9OA 1TS9A 5J3BA 1YITQ 1KQ1A 3VV0A 1AVZC 3E19A 1V29B 4JJNK 1X75C 2V1QA 1H3ZA 3AHUA 1O75A 3JCMg 2RQUA 2RJEA 1VYVA 1AWOA 1FMKA 4E6RA 4IIMA 3NMZC 3TSZA 1I1JA 1I4K1 2CP0A 3M56A 1V1CA 2LT4A 1ARKA 2KYBA 4GY5A 3CCET 1VQ9Q 1VQ6T 3UA6A 3L2ZA 2DTIA 1PG5B 1QQJA 3CCLQ 1YCSB 1W2BP 1VQMA 5FWCA 1PCXA 2Y90A 2RJFA 4J6XA 1M1FA 2EAYA 3OYHA 2JS0A 1JJ2P 1N6AA 3OYCA 2FVUA 2KRMA 1ZUKA 2SRCA 4HA8A 3TSWA 1KK7A 3VS6A 3FEOA 1R8OB 4KBMB 1UHCA 3TCJA 3HL8A 1BI1A 4C0DC 1QP2A 2DPPB 1I0CA 5GANh 1KJWA 1AZGB 3JAME 1VQ4A 2DYBA 2WSCE 3EFRA 4M7DB 1AT1B 1VQPA 2F5KA 5KYWB 2YSQA 1VOMA 1MMGA 5LJ5j 3ER0A 5GAMg 1YHQQ 2RK2A 5FU6B 2DXBA 3AT1B 5GAOp 2KEAA 3M0PA 1M5Q1 2AHJB 1K1ZA 3DB4A 3MHXA 2DRKA 1OX9A 1IXDA 4O6JA 5J39A 2V8IA 3P8DA 4KUDK 3EGDA 1D3BA 4X34A 2K9GA 2RM4A 1OZ2A 4C5IA 1M30A 4B6MA 3FIFA 1VQ7Q 2LCSA 1KIKA 5L23A 4Z88A 5LJ5d 2V1RA 1KSWA 1ZUUA 2PQWA 2JTFA 1NYFA 4V2SA 1NJIU 2KK4A 1MMNA 2NUTA 5EG2A 1NM7A 2KT1A 1M1KC 2X3XD 3M0RA 5GAMe 3G4SA 2MAMA 4M77B 4M75E 2DL8A 4PJMA 4M78F 2K2MA 3S3MA 1VQ9A 1UHFA 3F70A 1S72A 4OP0A 3G6EA 2KSSA 2O31A 2QXFA 2QDYB 2OTJT 2QG9B 1CKAA 4JZ4A 2J06A 1Y07A 3CPFA 2RHUA 3L2QA 1YJ9Q 4XAXB 1YITT 2DBKA 4JRPA 3JCMQ 1X01A 4JRQA 2DL4A 3KUFA 3CC7A 1TUGB 1N27A 3RKWA 3CCVA 1VQ4Q 4LUEA 4JS4A 3CCRQ 1R77A 1YIJT 4LN2A 3M0SA 2F2XA 4PLIA 1ZUYA 4E7JA 3HTRA 3OBWA 1Q82C 1G3TA 4J9EA 2VYTA 1YIJQ 2EGAA 3OYBA 2AK5A 2BTTA 2FYKA 5DLOA 3I55A 4MZMA 4RCCA 2ED1A 2LQWA 3S3OA 3NTIA 1WXUA 5CO7A 1D1BA 4FIBA 3U23A 2XMFA 4M4ZA 2C0IA 2K7AA 2JXBA 5I2MA 4PKCC 5CIUA 2GBQA 3PIPA 1CSKA 2XU8A 3A1PA 1RADB 3CC2Q 2FZCB 2KXCA 4EIKA 4MDWA 2HSEB 2Y4XA 4R0KA 1OEBA 2BKDN 1AZEA 2P0PA 2I2LA 1Y57A 4OB3B 1WXBA 3MEUA 4AFSC 1VQPQ 3CXCA 4C92D 1H641 3V8KA 2DXCA 1YITA 4ZN1A 2EPDA 3EG2A 1SEMA 1XOVA 1AOJA 2FZKB 4ZNXA 1NPRA 1PD0A 1RI9A 4NL3A 2M51A 2W0ZA 2HZYA 2VXEA 1BI0A 2WACA 4OMFB 1A0NB 3A8LB 4JLGA 2IVWA 1OOTA 1KFZA 1ABOA 3OYFA 4C5HA 4HCBA 2QEXQ 1BIAA 1GFCA 3DLLA 5GAN3 5LL6S 4CC2A 3JSCA 1JXMA 1UFFA 4TVRA 2E64A 2MK5A 2RJDA 3M4YA 3EH2A 2RNAA 2EQUA 2L8DA 2RQTA 4M7AD 3V8LA 2NUTB 2KR3A 2R5MA 1VYTA 2RO0A 5LJ5h 4F17A 2CP7A 2KDSA 3H0HA 2HSPA 2CGHA 5EC7A 2LZ6B 2XDBA 1SSFA 1J3TA 4KGVB 3QYHB 3OYLA 3CBPA 5GMKm 4M77F 1PKSA 2C0OA 1I8FA 2CH4W 1UG1A 2EQJA 1VQ5T 3P8HA 4C92E 1K0SA 2L3QA 5LJ5g 2HD0A 3QBYA 4LXCA 3V7RA 1WYXA 1S1NA 1IGQA 1WHLA 4JJCA 4E7ZA 3CMEA 3IQLA 3HRTA 3L42A 3FC3A 3JB9D 2EGEA 1TXQA 1Q95G 3CXCS 2K57A 4E7HA 4M78D 5D7UA 4CRIA 2LRQA 4AG1C 2A37A 3UT1A 3UATA 4CI0C 1LNXA 1RAIB 3OW2P 5LJ3g 4BI8B 3ZL7C 2SEMA 4EMKA 2FB7A 3MJXA 2EYQA 4E7SA 3R6NA 2DTHA 2LQNA 2AKKA 4EMGA 3HRSA 4RTYA 1VIFA 2QA4T 3PVQA 4J6WA 4ELYC 1HD3A 3S6WA 1WHKA 5CQYA 4ELZC 4KUIA 2VV5A 3L2UA 2JS2A 1VQMT 5KYNA 2GFAA 4Q5WA 2MCNA 2DXUA 1UGRB 1N8RU 3PIOA 1YJWT 4HCZA 4QT7A 1KD1R 2MI6A 1M8VA 4M7AF 3VUZA 1PKTA 5A0GA 1MV0B 3EFOB 2LJ3A 4XU3A 2K79A 5IHNA 2XICA 4IUPA 3H0IA 1QVFS 1D0YA 3GNGA 1Z9ZA 1JBMA 4PK4A 4XTYA 2MWPA 5FLXE 2D0NA 2DL7A 5FU7B 2QEXT 1K0XA 2DIQA 3URGA 3S3NA 3NHNA 3OYGA 3EGUA 3BFMA 3CCSA 4DA4A 1UJYA 1M9SA 2ZPEB 3O5ZA 2F69A 5GAOl 1TUDA 5GAN5 4AMCA 1C1AA 2R5AA 2YDLA 5GAMf 3PTAA 2E1HA 5A0LA 3OYMA 1FYNA 3LYIA 4FW1A 3VS2A 2QQRA 1X69A 2HQXA 2DF6A 3OW2A 2CP6A 5GMKi 4PJOD 4PJLA 4RTXA 5CKHA 3LGLA 4AFUC 3JCMd 2PUOB 2JMCA 1QVGP 2Y4YA 2OAUA 2CDTA 4BE1A 4FSSA 1WGSA 1BU1A 3G4ST 2CZ0B 3PE0A 1YFNA 2E5KA 2XK0A 5KCOA 4E7LA 1VQKT 2HQHA 3EGDB 3X26B 3JCMh 2QK0A 4HCCA 2A08A 4PJOB 3CMEQ 3CMAA 3HSBA 2CP5A 2KBTA 3CBOA 3OYDA 2DJZA 2M1HA 1KD1C 1AWWA 4ZN3A 2J6OA 1RL2A 3LWHA 4BACA 4M78E 4K11A 2Z0WA 1YIJA 2PZ1A 1SHFA 2RK1A 4LNPA 2XDPA 3I35A 1K76A 1SG5A 3HFNA 3CD6Q 1WHJA 4PJOG 1IREB 3EFOA 9ATCB 4FW2A 3OYNA 1VQ7A 2FL7A 1WX6A 1HSQA 1ZLMA 2PTKA 5AT1B 2PVOB 4BUGA 5ECAA 4ZGDB 2CZ7B 2EGCA 4F7UB 2K5LA 3M57A 4D8DA 4N0AA 4ZTJA 1WFWA 1JEGA 3VS7A 4F7UF 4PJOE 5GMKe 5CAIA 4EDUA 1AD5A 4LUDA 2DKGA 3PNWC 2DD4A 2QDLA 2JUFA 2P4TA 2DETA 5KYXB 1G83A 4OB1B 1B34B 1JB0E 4RCBA 5L8RE 4JZ3A 2D8JA 3HKSA 4BY6B 1VQ8T 2NLUA 1VQPT 1QVPA 1MNEA 4F7UA 2KGTA 2KI7A 4EMKC 3NPFA 4BI4A 5FU6C 1ZSZB 5HK3A 3A98A 3REAB 3M5AA 4IURA 1H92A 2OTLA 3BY7A 3OS5A 3CCRA 1Q81U 4OMMA 3OYKA 2ZPBB 4A4FA 1D0ZA 4GLKA 1U1SA 3M59A 3L2WA 4FCYA 1IHVA 4C0DB 3KFVA 2R58A 1OYXA 5IN1A 2HQEA 1ZSGA 4M78B 5AYFA 1WNLA 3FRNA 1YCYA 1XNIA 1VQ6Q 4N4GA 2RA2A 3G7ZA 1X2KA 4MMLA 1VQNA 1TSFA 4OGEA 4F7UG 1Q81R 1W2BS 2YRDA 5I2SA 1UGVA 3CCLA 1BK2A 2X51A 4M78A 2M9UA 8AT1B 3CC2A 1BBZA 3META 1YJWA 2GCXA 4ME7A 4C92G 4IUUA 4BD3A 2QQBA 2CT4A 1S72T 1M1GA 2VGMA 2CH4A 2D0QB 2DMOA 3CQTA 4DOWA 1Y0MA 2X35A 3JCMe 3SFMA 2D6FA 4F7UE 3SWNB 4FU6A 3QDRB 2MPXC 2QQ9A 2KT8A 1BI3A 3M58A 2K5IA 1TWBA 4OMOA 2H3JA 1VQLQ 2K3BA 4IUTA 1U8RA 2HCKA 1QCOA 2X3WD 4XTWA 4X9CA 2ROTA 4LD6A 1QKWA 3ULRB 4QQGA 1VQ6A 3QIIA 1RLPC 3ZFJA 1ZA1B 1D3BB 3SHWA 5GAN6 2E65A 2QGFB 2YLCA 1I07A 4OMLA 1P92A 1K9MC 1H8KA 1OPLA 2CSQA 4HVWA 1SRMA 5GAMj 1YWOA 2RF0A 2K3XA 2EYZA 4J7IA 4C92F 1TG0A 3CD6A 2VKNA 4HXJA 5GMKh 2CSIA 1RAGB 3R6OA 1G3WA 4J9BA 1Q7YU 1WPYA 2XG8D 3MO8A 2CUDA 4M77E 3UA7A 4GLMA 1NYGA 4DOVA 4RTUA 1YI2Q 3E1SA 3OMCA 1UGSB 4JRIA 1FMVA 2LP5A 4M75F 2MWOA 2D8HA 3E9GA 3RMQA 1XTDA 2A7YA 3EGXB 4BI3A 2AIRB 2QI2A 1UTIA 3I56A 1YJWQ 3JB9F 3OYJA 1X27A 4A4HA 3WVDB 2COYA 2HBWA 2RI5A 4J5YA 4QW2A 4XU0A 4M77G 1AWXA 2A28A 3LX7A 2PNIA 3RKYA 4JJDA 2XKOC 3CPWS 3EAEA 3GLXA 4WF2A 3EH1A 2MIOA 1QW1A 2M16A 1NJIC 2F5TX 2WSFE 4M7AG 5IHIA 1MMAA 2KQWA 1M1KU 2QGGA 1FWZA 3QG1A 3L2VA 2G3RA 5GMKj 4J9IA 4M7DE 2EKHA 1Q81C 3KXTA 3UWNA 4L6V5 2A3LA 1VQ9T 3OQ5A 1Z9QA 5IXFA 1G2BA 1EIFA 1M2VB 4PFZA 2RI2A 2JTMA 4C92B 1WJRA 3CEYA 3INZA 5LJ5e 4OMPA 3JB9I 3FJ5A 2CT3A 1LCKA 3X24B 4NOYA 1KHCA 4Z02A 2NUPB 1EX4A 1QVGA 2L3RA 1W70A 5FRNA 4M77A 4M7DG 1IGUA 4KH1B 3CC4A 2DRMA 4IKFA 1YN8A 3OMGA 4B9XA 1QMCA 1VQOT 4PJOA 3JRZA 4M78G 3RERA 3EFSA 4RTVA 3DB3A 4RTTA 3CMAT 2L0AA 1Y7XA 1WIEA 2H8HA 2ROLA 2XHCA 3H0FA 1WQ7A 3PFSA 2OX7A 4PNOA 5J26A 1ZBJA 5GAOq 2J7IA 5GANj 4ZGJB 3CC7Q 1K73R 3HRUA 2EBPA 2P0KA 3LH5A 3CCSQ 5A2QE 5I21A 3C0CA 1VQ7T 2MOXA 2HL5C 3GP8A 2ZGWA 3GBQA 2EQIA 4Z8AA 1JJ2A 4EPCA 4C5GA 2LNVA 4QQ6A 4PJOF 4M7DA 4Y91A 2NYSA 1U3OA 1ZBXA 2KYMA 3OYIA 3CPWA 2P4RA 3RIRA 2JZ2A 5I22A 2BIVA 3CBMA 5GAOn 4M75C 4C8QD 3OYAA 2RQRA 2DL3A 4JUVA 4AFZC 2DZ9A 3CCQA 1D09B 4DEYA 4QQDA 4A4GA 4IUVA 2VUBA 3RMSA 1IZ6A 2JVVA 2LTOA 3D7SB 3C95A 3G4SQ 1VA7A 1PRMC 2DZCA 1I81A 5HY6A 2QA4Q 4FT4A 2JT4A 2J6KA 2OAWA 1KG1A 1VQ5Q 5KE2A 3M4GA 5D6WA 1VQ8Q 1WHGA 4PFPA 4JRKA 1OU8A 5GAMh 2RD1A 3GF5A 3JCMb 3THKA 4XQ3A 4M7AC 4QVZA 2DD5A 2P84A 4LE9A 3EG9B 6AT1B 1QVGS 2F2VA 4MMKA 4GBQA 2XIDA 3E9FA 3EG1A 2RQWA 1X6GA 2LQ8A 4FT2A 1W1FA 2HMAA 1K8AC 1YJNT 4EMHA 2A0FB 2K5FA 2DVEA 5GAN8 4XTVA 2VXFA 3VS4A 1B07A 1GCPA 2DL5A 2HKNA 4F16A 5KCHA 1PRLC 3JCMf 4M7DC 4N0AC 1LPLA 5CR2A 4IIOA 1WXTA 2KRSA 3OS0A 2EYYA 1PSFA 1UGQB 4IUQA 4OB2B 3CCLT 1IRXA 1O9SA 1WLPB 2HBPA 1W4SA 2AZVA 4OF1A 3CC2T 3RR6A 1M8MA 1R0BG 5FU7C 4PLLA 1RLQC 1SKUB 5KE3A 4R55A 1T0HA 2NUPA 4C92A 3HP9A 1U06A 3PVLA 3PT9A 4AT1B 5HKCA 1UGPB 2RHZA 2E3IA 3EG3A 4FYYB 2RB6A 3EHRA 1QVFA 5D6YA 1NJIR 2X4XA 3JCMP 5CK9A 3I9QA 2QAZA 3CCMT 2RHYA 1VQLT 3DLMA 3EHQA 1BI2A 1YHQT 4M77C 1GXIE 5GAMd 1BIBA 2DEQA 3BE3A 3GNFB 5HCKA 2VB6A 1X6BA 5CCAA 1UEBA 3MPUB 2BZYA 1M2OA 5IH2A 2PVDB 3SWNC 2OJ2A 3CCJQ 2E4HA 2J05A 3M54A 2QASA 2IIMA 3CCUT 2X9HA 4LDVA 4D8KA 1HK9A 3RUXA 3CCUQ 3V8JA 1K73C 4RUGA 2CUBA 2M0OA 1M3BA 2L3PA 4FYVB 1KQSA 2FPEA 1RI0A 2ZCFB 1MUZA 3I5RA 1X43A 2GGRA 4MZPA 3EGXA 2O4XB 2GQVA 3PGGA 5GJWB 2JN0A 2JM8A 2DTOA 1ZHIA 4XTZA 1E6GA 2OTJQ 3SEMA 1VQ8A 1ZQ1A 2DO3A 2YLBA 2L2PA 5KH6A 4C5EA 4ZTFA 2RPNA 4QVCA 1I5LA 2ED0A 1N8RR 5GAN4 3VYHB 4J6YA 2VC8A 1G3SA 3M0QA 4M7AE 5GANf 4XK8E 4F14A 3CCMA 4JDSA 3CCRT 1MNDA 1VQLA 2J6FA 5KYUA 1YBYA 3VS5A 1B3QA 2E5QA 4BDYA 1M90R 1WJQA 1WI7A 2L3SA 4OMQA 5CVIA 1V76A 3LWIA 1VIEA 1T0JA 2PUKB 4BY6C 3NTHA 3CCUA 2BE7D 2YWWA 2C06A 1E7OA 3QXEB 1PHTA 1UE9A 1M3CA 1HYOA 3UPUA 3OSSC 3C94A 5LJ3h 2DNUA 2MF2A 5IT9E 1OQKA 4OB0B 4B9WA 4PJNA 4C0FA 1MGQA 1K9MR 1M90U 3X20B 3X25B 3GIBA 1MMDA 5GAN7 2YXYA 2DAQA 1OULA 1ABQA 1G8XA 2BZ8A 1GCQA 4AG2C 2CS7A 1C6VX 4LDWA 3VJPA 2EIFA 1KQSS 2AZSA 2DVJA 4FM4B 1XJWB 2C0TA 1YJNA 3CMAQ 1GBQA 1M2VA 3CC4T 2EVRA 2OTLQ 5CKDA 1NEGA 2QQAA 4M7DF 1YNZA 1VQNQ 2A36A 2QTXA 1VQOA 1VUBA 3QKJA 5GANd 3HPWA 4KGZB 3CCJT 2E3HA 4II1A 4J83A 2JMAA 3MP6A 5LJ3j 2R57A 2EWNA 2YUPA 2B86A 3CCVQ 2RJCA 3QYGB 1YP5A 3QJ6A 1OI1A 4RTZA 1W2BA 4ESRA 4E7KA 4OGCA 2DE0X 5GAN2 3G6ET 2QEXA 4M78C 1GRIA 2ZPHB 2CKKA 1BB9A 2V26A 2EYXA 2HL3A 1HXDA 3CCQT 3I55Q 1QLYA 3E2UA 1Q82R 3OA6A 3CCEA 4J9CA 3P8BB 1Y96A 4J9GA 3JCMc 3FB9A 2VVKA 2EQMA 3VU3C 4QVDA 1S72Q 4J8OA 5KYXA 3FDRA 1SRLA 2KROA 5GAOm 1TU0B 2AT1B 3ME9A 4WCIA 2DIGA
chains in the Genus database with same CATH topology
5GMKj 1VQ5A 4M7DE 3G71A 2EQJA 1VQ5T 1Q81C 3KXTA 3UWNA 4L6V5 3ZEHA 3P8HA 4C92E 2E12A 3J80E 2A3LA 3A8HB 1VQ9T 5LJ5g 3OQ5A 4E7IA 1FX7A 3MP1A 2HD0A 1LJOA 3QBYA 4O5VA 1EIFA 5GANg 1YI2A 3V7RA 2RI2A 2JTMA 4XTUA 4C92B 3J7AF 2E6ZA 2KAFA 4E47A 1WJRA 1Q82U 3CEYA 1VQ4T 3INZA 5LJ5e 3QZ5B 3JB9I 3CMEA 2LQKA 3HRTA 3L42A 3X24B 3FC3A 3JB9D 1I8FA 3V7CA 2O4XA 4JLIA 4NOYA 4L5GA 1KHCA 4Z02A 1Y96B 5LJ3f 4RMOA 3GOXA 3CXCS 2L3RA 4D6WA 1QVGA 2K57A 2XI9A 5FRNA 4M77A 4M7DG 3OW2S 4E7HA 4M78D 3ZBDA 3CC4A 2DK3A 4IKFA 3RKXA 3QSUA 3OMGA 4B9XA 4CRIA 2LRQA 4YTLA 3FJPA 1VQOT 4PJOA 4M7AA 3JRZA 2RI3A 4M78G 3UT1A 2HAXA 4CI0C 1LNXA 1M90C 3RERA 3EFSA 5LJ3g 2O01E 3DB3A 4BI8B 2E10A 3CMAT 3LGFA 1Y7XA 3SD4A 2JOYA 3OS1A 2XHCA 3VYGA 4EMKA 2FB7A 1WQ7A 2EYQA 3PFSA 1WQWA 3WXMB 4A4KA 5LJ3d 3VUBA 3HHTB 2DTHA 4PNOA 5J26A 1KQ2A 2E6NA 5GAOq 4EMGA 3HRSA 4P5NA 5GANj 3H8ZA 2RHXA 1VIFA 2QA4T 4J6WA 4ZGJB 3SWNA 4ELYC 2L89A 3HRUA 4VUBA 2LCCA 3S6WA 3T9NA 2P0QA 5CQYA 2GFUA 3Q1JA 4ELZC 2P0KA 4KUIA 2VV5A 4C8QB 5A2QE 4XTXA 3L2UA 5LJ5f 4M75A 3QUIA 3CD6T 5I21A 4A53A 1VQMT 1VQ7T 4HKEA 2GFAA 4Q5WA 3GP8A 2DXUA 2ZGWA 1UGRB 1N8RU 3PIOA 1YJWT 1KHIA 4HCZA 5CKEA 5FRMA 2EKOA 1JJ2A 3MEWA 4EPCA 2X4YA 2MI6A 2LNVA 4C5GA 4M7AF 1M8VA 4QQ6A 1Q7YC 4PJOF 2CYZB 3VUZA 2EJGA 4Y91A 4M7DA 3QHSA 1ZBXA 5A0GA 3OYIA 3CPWA 4A54A 3LW5E 2JZ2A 3RIRA 1KC8U 4XU3A 2BIVA 3CBMA 3I55T 4N4IA 5GAOn 2XICA 4IUPA 4M75C 4KULA 4C8QD 3OYAA 4M7AB 1QVFS 4JUVA 3G71T 3GNGA 1JBMA 1QP3A 2DZ9A 5IAYA 4XTYA 3CCQA 1K73U 2MWPA 5FLXE 4M75D 4QQDA 4A4GA 4C8QC 2ZPFB 1K9MU 4IUVA 3OSVA 2VUBA 3RMSA 1IZ6A 1Q86C 2JVVA 2LTOA 3C95A 3JCMW 2DZCA 5FU7B 1I81A 3O8VA 3MCAB 3M53A 5HY6A 3OS2A 2DIQA 3URGA 2QEXT 4FT4A 3L2RA 4XU2A 3S3NA 3CC7T 5CKBA 3OYGA 1XQHA 4A4EA 4DQ2A 1KG1A 3BFMA 5DLQE 3CCVT 3CCSA 4DA4A 1M9SA 4XU1A 2ZPEB 4FL6A 4C8QG 3CCST 5KE2A 4MZTA 3M4GA 5DY9A 5D6WA 5M9OA 2F69A 3A8OB 2RHIA 4JRKA 5J3BA 5GAOl 5GAMh 2RD1A 3JCMX 5GAN5 1KQ1A 3GF5A 3MEAA 3VV0A 2R5AA 3E19A 3JCMb 5GAMf 1X6OA 1V29B 2E1HA 4XQ3A 3PTAA 4M7AC 5A0LA 2ZPIB 3OYMA 1MHNA 4QVZA 4JJNK 3TU4K 3LYIA 1X75C 4C8QA 2YRVA 2DD5A 2QQRA 5GANe 1B34A 4RG8A 1H3ZA 2HQXA 2HNIA 1QVGS 1O75A 3AHUA 3JCMg 4MMKA 3C12A 2RJEA 2XIDA 3E9FA 4OVAA 3OW2A 1WJSA 5GMKi 4PJOD 3JCMJ 3I56T 2LQ8A 3DKMA 4FT2A 5CKHA 1K8AC 4C92C 1YJNT 3LGLA 4EMHA 1G3YA 3QZ9B 2K5FA 3JCMd 2DVEA 2PUOB 5GAN8 4XTVA 2VXFA 1I4K1 2Y4YA 4KT0E 2OAUA 5A0DA 4EMKB 4BE1A 1N9RA 1WGSA 2LT4A 3M56A 3G4ST 4BE0A 2CZ0B 4M7DD 2XK0A 5KCHA 5KCOA 4E7LA 1VQKT 3JCMf 4GY5A 3CMET 2KMTA 3X26B 3CCET 3L1AA 3JCMh 4N0AC 4M7DC 4HCCA 1VQ6T 2BUDA 4PJOB 5CR2A 3L2ZA 2DTIA 3CMAA 3HSBA 3OS0A 3CBOA 3OYDA 1PSFA 1UGQB 3A8MB 4IUQA 2XDDA 2DJZA 2M1HA 1VQMA 1KD1C 4OB2B 3CCLT 2Y90A 1O9SA 4ZN3A 2HBPA 2RJFA 1W4SA 1RL2A 2WSEE 3OBYA 3FLGA 1M1FA 2EAYA 4J6XA 4OF1A 5CKFA 3OYHA 4BACA 5GAOr 3CC2T 4M78E 1N6AA 3OYCA 2FVUA 1YIJA 2LC4A 4NL2A 2RK1A 4HA8A 2QQSA 3MEVA 5FU7C 2XDPA 4PLLA 3FEOA 1R8OB 4KBMB 3HFNA 3TCJA 3HL8A 5KE3A 4R55A 1BI1A 4C92A 4C0DC 3NFCA 1QP2A 1IREB 3HP9A 4PJOG 1JJ2S 2DPPB 3C4SA 3PT9A 3ASKA 3NTKA 5GANh 5HKCA 1UGPB 1UB4A 3M9QA 3JAME 3OYNA 2FL7A 2RHZA 2WSCE 3L2VA 1VQ4A 3EFRA 1VQ7A 3PMTA 4M7DB 1Y71A 1VQPA 2PVOB 4BUGA 2RB6A 2F5KA 4ZGDB 2CZ7B 4MDXA 4NS5A 5C0MA 1QVFA 5D6YA 2X4XA 4F7UB 5LJ5j 3JCMP 5CK9A 3ER0A 2K5LA 2LCLA 5GAMg 3OB9A 2RK2A 5FU6B 2DXBA 5GAOp 3M57A 3OYEA 3CCMT 2RHYA 1VQLT 3DLMA 1M5Q1 1PSEA 2E70A 4N0AA 2AHJB 1BI2A 3SB2A 3DB4A 4ZTJA 3MHXA 1YHQT 4M77C 2FHDA 1GXIE 5GAMd 4O6JA 4F7UF 5J39A 1BIBA 2DEQA 2V8IA 3GNFB 3P8DA 5CAIA 4EDUA 5GMKe 4KUDK 4PJOE 1D3BA 2EJFA 4X34A 4C0GA 2DKGA 5CCAA 1UEBA 4LD9K 2DD4A 2RM4A 3PNWC 1OZ2A 2PVDB 3SWNC 2JUFA 2P4TA 4C5IA 4M75B 1YI2T 2LT1A 4OB1B 2PVGB 1JB0E 1B34B 3FIFA 3M54A 1N9SA 4RCBA 5L8RE 3TEEA 3HKSA 3CCUT 1BKBA 4BY6B 5LJ5d 1VQ8T 2PQWA 4Y28E 2JTFA 2NLUA 4LDXA 4LDVA 3MP8A 1QVPA 1VQPT 1HK9A 3RUXA 4F7UA 5LJ3e 4V2SA 3V8JA 1NJIU 3BDLA 1K73C 3BDUA 2KK4A 2M0OA 4EMKC 2JNGA 5EG2A 4BI4A 5FU6C 5HK0A 1M1KC 5HK3A 3M5AA 2DXTA 4IURA 5GAMe 1KQSA 3G4SA 2MAMA 2OTLA 1RI0A 3BY7A 3OS5A 1AHJB 2ZCFB 4M77B 3CCRA 3HFOA 1YHQA 1Q81U 2OTLT 4M75E 4MZPA 2KVQG 3QPHA 3LWHA 2O4XB 2GQVA 2D9TA 3PGGA 3OYKA 2JN0A 2ZPBB 3V7SA 4A4FA 4M78F 4GLKA 1U1SA 3M59A 3CCJA 3S3MA 3L2WA 2DTOA 1ZHIA 1N8RC 1VQ9A 4XTZA 3F70A 1S72A 4OP0A 3G6EA 2LDMA 4C0DB 2KSSA 2R58A 3RESA 1OYXA 5IN1A 2HQEA 4C0ZA 3JB9G 4R56A 1TH7A 4HT9A 2QXFA 2MMPA 3M55A 3A5ZB 2QDYB 4ZGEB 2OTJT 4M78B 5AYFA 1VQ8A 1WNLA 1ZQ1A 3FRNA 1Y07A 1YCYA 2DO3A 2YLBA 2PU9B 2RHUA 3CPFA 3L2QA 1XNIA 1NE8A 4N4GA 5KH6A 3JB9J 2EJ9A 3JB9H 4C5EA 4XAXB 4ZTFA 4QVCA 1I5LA 2RA2A 1YITT 3G7ZA 4MMLA 1VQNA 3N5BB 5GAN4 3VYHB 4OGEA 4J6YA 3JCMQ 4JRPA 1K8AU 1X01A 2K3YA 2RH2A 2VC8A 1G3SA 4F7UG 4JRQA 1Q86U 5GANf 4M7AE 3KUFA 4XK8E 3SDZA 3CC7A 1W2BS 1N27A 2KY9A 5I2SA 3CCMA 4JDSA 3CCRT 3RKWA 5FROA 3CCVA 1VQLA 2LX9A 3CCLA 1G5VA 1YBYA 2CZ1B 4M78A 2M9UA 4JS4A 3CC2A 2E5QA 5GMKl 4BDYA 1YJWA 3META 2GCXA 1WJQA 4ME7A 4C92G 4IUUA 4FSXA 4N4HA 1YIJT 4BD3A 2QQBA 4PLIA 5CVIA 4E7JA 1M1GA 1S72T 2E41A 2VGMA 4X9DA 2D0QB 3LWIA 3OBWA 1Q82C 4ATOA 1G3TA 1VIEA 2VGNA 2PUKB 2VYTA 4DOWA 3OYBA 2FYKA 3QO3A 2X35A 2X4JA 4BY6C 5DLOA 3JCMe 3NTHA 3CCUA 3I55A 3BW1A 3SFMA 4MZMA 1KD1U 4RCCA 1YJ9A 2C06A 2D6FA 4F7UE 2IG0A 3QDRB 3QXEB 2QQ9A 4FU6A 5CQXA 3SWNB 4BB7A 2QA4A 3S3OA 2B8AA 3NTIA 3QJYA 3UPUA 5CO7A 3H6ZA 4FIBA 3OSSC 3PMIA 1BI3A 3C94A 3M58A 5LJ3h 2K5IA 1DJ7B 1U1TA 2GF7A 4C8QF 2H3JA 2MF2A 5I2MA 4PKCC 5CIUA 5IT9E 4OB0B 2YHTA 4B9WA 3PIPA 4IUTA 2XU8A 1U8RA 4C0FA 1MGQA 1LOJA 1M90U 4XTWA 3X20B 2LVMA 4X9CA 3X25B 3GIBA 4LD6A 4MDWA 2ZZDA 5GAN7 4QQGA 2DAQA 1VQ6A 3QIIA 3ZFJA 2EQKA 1NZ9A 2Y4XA 4J7FA 1D3BB 5GAN6 2E65A 2BKDN 2P0PA 2I2LA 2YLCA 4OB3B 3MEUA 1P92A 2CS7A 3CXCA 1K9MC 4C92D 4LDWA 5GAMj 4LDYA 3VJPA 2EIFA 1H641 1KQSS 5DM7R 4FM4B 3V8KA 2DXCA 1YITA 4L59A 4ZN1A 2K3XA 3VKIA 4PJOC 1YJNA 1XOVA 1JRIA 1NPRA 4BE2A 3GPLA 4J7IA 4C92F 4UC4A 3CD6A 1M4ZA 4NL3A 3CC4T 5CKDA 2X4WA 2QQAA 5GMKh 4BDZA 3A8GB 4M7DF 5C6SA 2VXEA 1BI0A 1G3WA 2QTXA 2WACA 3R6OA 4OMFB 1VQOA 4HT8A 4JS5A 1VUBA 1Q7YU 1WPYA 2XG8D 3A8LB 3MO8A 4JLGA 4M77E 3QKJA 4RKUE 4DOVA 2IVWA 3OY9A 1BYMA 3LH0A 5GANd 3HPWA 3CCJT 3E1SA 5D6XA 3OYFA 1FXXA 4C5HA 1KC8C 3OMCA 4II1A 4HCBA 1UGSB 4J83A 3MP6A 1BIAA 4JRIA 2V8KA 3WVEB 4M75F 3DLLA 5LJ3j 2R57A 2EWNA 5GAN3 2MWOA 5LL6S 1NPPA 2XD0A 3E9GA 3RMQA 3LLRA 1XTDA 2A7YA 3JSCA 4BI3A 2OTJA 4M75G 4TVRA 2RJCA 2E64A 3QYGB 1YJ9T 3J81E 2QI2A 3JCMV 3QJ6A 1OI1A 3I56A 1W2BA 2RJDA 3M4YA 3JB9F 3OYJA 4E7KA 4OGCA 3WVDB 4A4HA 5GAN2 3G6ET 3X28B 2QEXA 2EQUA 2L8DA 2RI5A 2ZPHB 4M78C 2CKKA 3V8LA 2V8JA 4J5YA 4M7AD 2L5QA 4QW2A 2R5MA 4M77G 4XU0A 1OZ3A 3TREA 2ZPGB 3LX7A 2RO0A 4LDUA 5LJ5h 1HXDA 2CZ6B 3RKYA 2EFIA 4C8QE 2KDSA 3CCQT 1VQKA 3OA6A 3CCEA 2CGHA 2XKOC 3CPWS 3EAEA 3KBGA 3P8BB 4RG2A 3GLXA 1Y96A 3JCMc 3UDCA 3FB9A 4WF2A 2EQMA 3VU3C 4QVDA 1VQNT 4J8OA 4PL6A 2XDBA 1SSFA 1QW1A 2M16A 1NJIC 2K4YA 2F5TX 3QYHB 3OYLA 2WSFE 3FDRA 3CBPA 4M7AG 5GAOm 5GMKm 3OYYA 2K2VA 4M77D 4M77F 2KQWA 1M1KU 3ME9A 1FWZA 3QG1A 2G3RA 2DIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK j;  4M7D E;  1U1T A;  4C8Q F;  5GAM d;  4XU2 A;  4F7U F;  1BIB A;  2DEQ A;  5CAI A;  5GMK e;  4PJO E;  4C92 E;  1D3B A;  2EJF A;  2YHT A;  4DQ2 A;  3BFM A;  2DKG A;  5LJ5 g;  2RM4 A;  4XU1 A;  1MGQ A;  4C8Q G;  1LOJ A;  3SWN C;  4XTW A;  1LJO A;  3M4G A;  4M75 B;  4X9C A;  5DY9 A;  3V7R A;  3GIB A;  4C92 B;  3FIF A;  1B34 B;  4XTU A;  4JRK A;  5GAN 7;  5GAO l;  1N9S A;  4RCB A;  5GAM h;  2RD1 A;  3JCM X;  5GAN 5;  1KQ1 A;  3INZ A;  5LJ5 d;  5LJ5 e;  3JCM b;  5GAM f;  2E1H A;  4XQ3 A;  3JB9 I;  4M7A C;  1D3B B;  1HK9 A;  5GAN 6;  3RUX A;  4F7U A;  2E65 A;  5LJ3 e;  3V8J A;  4C8Q A;  3JB9 D;  4V2S A;  3BDU A;  3V7C A;  2I2L A;  4JLI A;  2YLC A;  4NOY A;  1B34 A;  4EMK C;  5LJ3 f;  5GAN e;  1Y96 B;  2HNI A;  3AHU A;  3JCM g;  2K57 A;  4MMK A;  4C92 D;  4M77 A;  5GAM j;  4M7D G;  4M78 D;  1H64 1;  5GMK i;  2DXT A;  4PJO D;  5GAM e;  3RKX A;  3JCM J;  3QSU A;  3V8K A;  3BY7 A;  4C92 C;  4M77 B;  3FJP A;  3HFO A;  4PJO A;  4EMH A;  4PJO C;  4M75 E;  3RER A;  3JCM d;  2DVE A;  5GAN 8;  1JRI A;  4M7A A;  4M78 G;  2VXF A;  4XTV A;  1I4K 1;  3PGG A;  4C92 F;  1LNX A;  2JN0 A;  5LJ3 h;  3EFS A;  3V7S A;  4EMK B;  4M78 F;  1N9R A;  1U1S A;  5LJ3 g;  2E10 A;  4NL3 A;  5GMK h;  2DTO A;  4M7D D;  4XTZ A;  4M7D F;  2VXE A;  4OP0 A;  3JCM f;  2QTX A;  4HT8 A;  4EMK A;  3RES A;  1WPY A;  2FB7 A;  3L1A A;  1WQ7 A;  4N0A C;  3JCM h;  1WQW A;  4M77 E;  3JB9 G;  1TH7 A;  5LJ3 d;  4HT9 A;  4M7D C;  4PNO A;  2DTH A;  4PJO B;  5GAN d;  4M78 B;  1KQ2 A;  3L2Z A;  2DTI A;  1WNL A;  5GAO q;  4EMG A;  3HSB A;  1YCY A;  5GAN j;  2YLB A;  3JB9 J;  1BIA A;  4JRI A;  3JB9 H;  2DJZ A;  4J6W A;  2EJ9 A;  4M75 F;  5LJ3 j;  2EWN A;  3SWN A;  5GAN 3;  4QVC A;  1I5L A;  2RA2 A;  2Y90 A;  4MML A;  5GAN g;  5GAO r;  4J6X A;  2EAY A;  5GAN 4;  4J6Y A;  4M75 G;  3JCM Q;  2E64 A;  1X01 A;  2VC8 A;  4F7U G;  4M78 E;  4C8Q B;  4XTX A;  5GAN f;  5LJ5 f;  4M75 A;  3JCM V;  3QUI A;  4M7A E;  5I21 A;  4NL2 A;  3JB9 F;  4A53 A;  4HA8 A;  3RKW A;  3HFN A;  5GAN 2;  2DXU A;  2ZGW A;  4M78 C;  4M78 A;  4M7A D;  3V8L A;  4C92 A;  4J5Y A;  5GMK l;  4PJO G;  5GAO n;  4XU0 A;  4M77 G;  4C92 G;  4M7A F;  5GAN h;  5LJ5 h;  1M8V A;  1HXD A;  4PJO F;  3RKY A;  2EJG A;  4Y91 A;  4C8Q E;  4M7D A;  3QHS A;  3EFR A;  4M7D B;  2E41 A;  4X9D A;  2CGH A;  4A54 A;  3RIR A;  2RB6 A;  4XU3 A;  1Y96 A;  2FYK A;  3QO3 A;  3FB9 A;  4WF2 A;  3JCM c;  3VU3 C;  4M75 C;  4C8Q D;  4QVD A;  3JCM e;  4M7A B;  3BW1 A;  4JUV A;  4RCC A;  4F7U B;  5LJ5 j;  1JBM A;  2DZ9 A;  4F7U E;  3JCM P;  4XTY A;  3SWN B;  5GAM g;  4M7A G;  5GAO m;  4M75 D;  4C8Q C;  5GMK m;  4M77 D;  5GAO p;  4M77 F;  1M5Q 1;  4N0A A;  3JCM W;  2DZC A;  3SB2 A;  1I81 A;  1I8F A;  4M77 C; 
#chains in the Genus database with same CATH topology
 1VQ5 A;  2YUQ A;  3VS1 A;  1LVK A;  2JJ9 A;  2E12 A;  3A8H B;  4E7I A;  3MP1 A;  1PD1 A;  1LJO A;  3VS0 A;  2ECZ A;  1HJD A;  1ZX6 A;  2E6Z A;  2FG0 A;  2KAF A;  1Q82 U;  1VQ4 T;  2D1X A;  1RAA B;  2LQK A;  5IHK A;  5IXB A;  3V7C A;  3G1J A;  4JLI A;  4L5G A;  1Y96 B;  1R0C B;  2LMJ A;  1SSH A;  2XI9 A;  1YJN Q;  4Z89 A;  2LJ1 A;  3ZBD A;  1FMW A;  1H3H A;  3RKX A;  3QSU A;  1OU9 A;  1IHW A;  2FRW A;  1D0X A;  4YTL A;  3RNJ A;  3FJP A;  1JXO A;  4M7A A;  1JO8 A;  1M90 C;  2O01 E;  2ESW A;  3CCE Q;  3REB B;  3LGF A;  3UF4 A;  2RQV A;  3SD4 A;  3VYG A;  2FRY A;  4A4K A;  5LJ3 d;  3VUB A;  2DA9 A;  1KQ2 A;  1RAH B;  2E6N A;  2RHX A;  1GBR A;  1U5S A;  2DX1 A;  1NLO C;  4VUB A;  2LCC A;  3VRZ A;  1EFN A;  3T9N A;  3Q1J A;  4XTX A;  2EYW A;  5LJ5 f;  4M75 A;  3QUI A;  1RAC B;  4A53 A;  1TUC A;  4CC4 B;  1NLP C;  1RAB B;  1VYU A;  2ABL A;  1KHI A;  3EG9 A;  5CKE A;  4CC3 A;  1VQM Q;  2EKO A;  3MEW A;  1CKB A;  2X4Y A;  2FO0 A;  5KYU B;  1Q7Y C;  1VQO Q;  2CYZ B;  2EJG A;  2DER A;  2M02 A;  2GTJ A;  2KRN A;  4A54 A;  3G71 Q;  3LW5 E;  1KC8 U;  4FYX B;  4N4I A;  2RMO A;  2KXD A;  3G71 T;  1WHH A;  5IAY A;  4M75 D;  4C8Q C;  2RN8 A;  3CPW P;  1Q86 C;  4HVU A;  3JCM W;  3O8V A;  3MCA B;  2LX7 A;  3OS2 A;  1UJ0 A;  3L2R A;  3CC7 T;  3MKD A;  1TOV A;  5CKB A;  4A4E A;  1B7T A;  3CCV T;  1OX8 A;  4C8Q G;  4FL6 A;  3CCS T;  3A8O B;  2RHI A;  3JCM X;  3MEA A;  1KC8 R;  1X6O A;  2ZPI B;  1MHN A;  2OI3 A;  3TU4 K;  4C8Q A;  2YRV A;  5GAN e;  1B34 A;  2LJ0 A;  3H9N A;  3QWY A;  4RG8 A;  2HNI A;  5I11 A;  3C12 A;  4OVA A;  1WJS A;  1C0M A;  3JCM J;  1PM3 A;  3I56 T;  3DKM A;  4A63 B;  4C92 C;  1T3L A;  1G3Y A;  3QZ9 B;  2K6D A;  2FPD A;  2DLP A;  3CXC P;  4KT0 E;  5A0D A;  4EMK B;  1N9R A;  4BE0 A;  4M7D D;  3CME T;  2KMT A;  1AWJ A;  3L1A A;  5KYY A;  2BUD A;  2XDD A;  3A8M B;  2DBM A;  4Y92 A;  3OBY A;  3EG0 A;  2WSE E;  1UUE A;  4CC7 A;  3FLG A;  5GAN g;  5GAO r;  5CKF A;  4F04 B;  1IO6 A;  2LC4 A;  4NL2 A;  2QQS A;  3MEV A;  4HVV A;  5FWB A;  3NFC A;  1JJ2 S;  3C4S A;  3ASK A;  3NTK A;  1QWE A;  3M9Q A;  1UB4 A;  2QTV A;  2IPO B;  3PMT A;  1Y71 A;  4DEX A;  2O9S A;  2HEQ A;  3QWX X;  2HKQ B;  4MDX A;  4NS5 A;  5C0M A;  1WZO A;  2LCL A;  3OB9 A;  4FYW B;  3OYE A;  1MV3 A;  1PSE A;  2E70 A;  3SB2 A;  2F1L A;  2DYI A;  2FHD A;  4ANJ A;  2NWM A;  4HCK A;  2EJF A;  4C0G A;  2DJQ A;  2H3E B;  4LD9 K;  1N5Z A;  1YI2 T;  4M75 B;  2LT1 A;  2PVG B;  1N9S A;  3TEE A;  7AT1 B;  1BKB A;  1BCO A;  4Y28 E;  2M0Y A;  4LDX A;  3MP8 A;  5LJ3 e;  1OV3 A;  3BDL A;  2CP2 A;  3BDU A;  2JNG A;  5HK0 A;  1W6X A;  1X2Q A;  2YRC A;  1AEY A;  2DXT A;  1JQQ A;  1Q86 R;  1AHJ B;  2OTL T;  3HFO A;  1YHQ A;  1RAE B;  4QKU A;  2KVQ G;  3QPH A;  2D9T A;  3V7S A;  3CCJ A;  1N8R C;  1SF9 A;  1F1B B;  2LDM A;  4OMN A;  3RES A;  4C0Z A;  3JB9 G;  4HT9 A;  4R56 A;  1TH7 A;  4WTO B;  2MMP A;  3I5S A;  3M55 A;  3A5Z B;  4DBQ A;  4ZGE B;  2HDA A;  2PU9 B;  3JB9 J;  3JB9 H;  1NE8 A;  2EJ9 A;  3N5B B;  3VS3 A;  1K8A U;  2K3Y A;  2RH2 A;  1Q86 U;  4KGX B;  3SDZ A;  3RDV A;  2KY9 A;  1ACM B;  5FRO A;  1G5V A;  2LX9 A;  2CZ1 B;  3CCQ Q;  5GMK l;  5KYY B;  4KH0 B;  1RUW A;  4N4H A;  4FSX A;  1NBE B;  1I5O B;  2E41 A;  4X9D A;  1PC0 A;  3VRY A;  4ATO A;  2VGN A;  1QKX A;  4DBH A;  3QO3 A;  2X4J A;  1VQK Q;  3BW1 A;  1KD1 U;  1OPK A;  4JPB W;  1YJ9 A;  2IG0 A;  4BB7 A;  2QA4 A;  5CQX A;  1GCQ C;  2B8A A;  3QJY A;  2ATC B;  3CC4 Q;  3H6Z A;  3PMI A;  1DJ7 B;  2AKL A;  2COZ A;  1U1T A;  2GF7 A;  4C8Q F;  3CCM Q;  2BZX A;  2YHT A;  1IB8 A;  1LOJ A;  1EZZ B;  2LVM A;  2FEI A;  2ZZD A;  2YUN A;  1Q7Y R;  4J9F A;  2EQK A;  1NZ9 A;  1M27 C;  2JM9 A;  4J7F A;  5FW9 A;  4AFQ C;  3G6E Q;  1K9A A;  4LDY A;  2I0N A;  5DM7 R;  2FPF A;  2GNC A;  4L59 A;  2BE9 B;  1E6H A;  3VKI A;  4PJO C;  2DEU A;  1JRI A;  2NUZ A;  4BE2 A;  2CRE A;  2GQI A;  3GPL A;  4UC4 A;  1M4Z A;  1PWT A;  2X4W A;  1KQS P;  4BDZ A;  3A8G B;  2KE9 A;  5C6S A;  4HT8 A;  4J9D A;  2DM1 A;  4JS5 A;  4RKU E;  2JTE A;  1BYM A;  3OY9 A;  3LH0 A;  5D6X A;  2VAS A;  1KC8 C;  1FXX A;  2KNB B;  2MYS A;  2V8K A;  3WVE B;  1NPP A;  2XD0 A;  3LLR A;  2OTJ A;  4M75 G;  1YJ9 T;  3J81 E;  3JCM V;  2DIL A;  2F2W A;  1WHM A;  3X28 B;  2CP3 A;  2QYZ A;  2V8J A;  2L5Q A;  1SPK A;  3TRE A;  1OZ3 A;  4LDU A;  2W10 A;  2ZPG B;  4J9H A;  2CZ6 B;  2EFI A;  4C8Q E;  1VQK A;  4PJJ A;  3KBG A;  4RG2 A;  1D1C A;  1YWP A;  3UDC A;  1VQN T;  4PL6 A;  1M3A A;  2K4Y A;  3TVT A;  3OYY A;  2K2V A;  4M77 D;  1GL5 A;  3G71 A;  2YT6 A;  4KRT A;  3ZEH A;  4X1V A;  3J80 E;  1FX7 A;  2G6F X;  3NGP A;  1QCN A;  4O5V A;  1YI2 A;  1ZSZ C;  4XTU A;  3J7A F;  4E47 A;  5KYW A;  2YUO A;  3QZ5 B;  2O4X A;  2ENM A;  5LJ3 f;  4RMO A;  3I56 Q;  3GOX A;  4D6W A;  1NG2 A;  1WDX A;  1TTH B;  1M1K R;  3OW2 S;  3M0T A;  2DK3 A;  2O88 A;  1ZSZ A;  2ZAE A;  2RI3 A;  1NEB A;  1T3S A;  2HAX A;  2E10 A;  1D1A A;  5GJV B;  2JOY A;  3OS1 A;  4JJB A;  3WXM B;  1WQW A;  1PNJ A;  3HHT B;  4ORZ A;  4P5N A;  3H8Z A;  2COW A;  3SWN A;  2L89 A;  1UEC A;  1UDL A;  2P0Q A;  2GFU A;  2DFU A;  2VWF A;  4DBR A;  1BCM A;  1RAF B;  2LNH B;  4C8Q B;  3CD6 T;  2GTO A;  1JU5 C;  1GFD A;  4HKE A;  3M0U A;  5FRM A;  1K8A R;  2EW3 A;  3QHS A;  1ZA2 B;  4RTW A;  3RBB B;  4PFO A;  1QCF A;  3I55 T;  3H41 A;  3TQ7 P;  1SHG A;  4KUL A;  4M7A B;  4DBF A;  1WA7 A;  1QP3 A;  2JW4 A;  1K73 U;  2ZPF B;  1K9M U;  3OSV A;  4E2F B;  3M53 A;  1QVF P;  1K4U S;  4XU2 A;  2O2O A;  2O9V A;  3QDF A;  1XQH A;  3JV3 A;  4DQ2 A;  5DLQ E;  4XU1 A;  8ATC B;  4MZT A;  5DY9 A;  1QWF A;  2FZG B;  5M9O A;  1TS9 A;  5J3B A;  1YIT Q;  1KQ1 A;  3VV0 A;  1AVZ C;  3E19 A;  1V29 B;  4JJN K;  1X75 C;  2V1Q A;  1H3Z A;  3AHU A;  1O75 A;  3JCM g;  2RQU A;  2RJE A;  1VYV A;  1AWO A;  1FMK A;  4E6R A;  4IIM A;  3NMZ C;  3TSZ A;  1I1J A;  1I4K 1;  2CP0 A;  3M56 A;  1V1C A;  2LT4 A;  1ARK A;  2KYB A;  4GY5 A;  3CCE T;  1VQ9 Q;  1VQ6 T;  3UA6 A;  3L2Z A;  2DTI A;  1PG5 B;  1QQJ A;  3CCL Q;  1YCS B;  1W2B P;  1VQM A;  5FWC A;  1PCX A;  2Y90 A;  2RJF A;  4J6X A;  1M1F A;  2EAY A;  3OYH A;  2JS0 A;  1JJ2 P;  1N6A A;  3OYC A;  2FVU A;  2KRM A;  1ZUK A;  2SRC A;  4HA8 A;  3TSW A;  1KK7 A;  3VS6 A;  3FEO A;  1R8O B;  4KBM B;  1UHC A;  3TCJ A;  3HL8 A;  1BI1 A;  4C0D C;  1QP2 A;  2DPP B;  1I0C A;  5GAN h;  1KJW A;  1AZG B;  3JAM E;  1VQ4 A;  2DYB A;  2WSC E;  3EFR A;  4M7D B;  1AT1 B;  1VQP A;  2F5K A;  5KYW B;  2YSQ A;  1VOM A;  1MMG A;  5LJ5 j;  3ER0 A;  5GAM g;  1YHQ Q;  2RK2 A;  5FU6 B;  2DXB A;  3AT1 B;  5GAO p;  2KEA A;  3M0P A;  1M5Q 1;  2AHJ B;  1K1Z A;  3DB4 A;  3MHX A;  2DRK A;  1OX9 A;  1IXD A;  4O6J A;  5J39 A;  2V8I A;  3P8D A;  4KUD K;  3EGD A;  1D3B A;  4X34 A;  2K9G A;  2RM4 A;  1OZ2 A;  4C5I A;  1M30 A;  4B6M A;  3FIF A;  1VQ7 Q;  2LCS A;  1KIK A;  5L23 A;  4Z88 A;  5LJ5 d;  2V1R A;  1KSW A;  1ZUU A;  2PQW A;  2JTF A;  1NYF A;  4V2S A;  1NJI U;  2KK4 A;  1MMN A;  2NUT A;  5EG2 A;  1NM7 A;  2KT1 A;  1M1K C;  2X3X D;  3M0R A;  5GAM e;  3G4S A;  2MAM A;  4M77 B;  4M75 E;  2DL8 A;  4PJM A;  4M78 F;  2K2M A;  3S3M A;  1VQ9 A;  1UHF A;  3F70 A;  1S72 A;  4OP0 A;  3G6E A;  2KSS A;  2O31 A;  2QXF A;  2QDY B;  2OTJ T;  2QG9 B;  1CKA A;  4JZ4 A;  2J06 A;  1Y07 A;  3CPF A;  2RHU A;  3L2Q A;  1YJ9 Q;  4XAX B;  1YIT T;  2DBK A;  4JRP A;  3JCM Q;  1X01 A;  4JRQ A;  2DL4 A;  3KUF A;  3CC7 A;  1TUG B;  1N27 A;  3RKW A;  3CCV A;  1VQ4 Q;  4LUE A;  4JS4 A;  3CCR Q;  1R77 A;  1YIJ T;  4LN2 A;  3M0S A;  2F2X A;  4PLI A;  1ZUY A;  4E7J A;  3HTR A;  3OBW A;  1Q82 C;  1G3T A;  4J9E A;  2VYT A;  1YIJ Q;  2EGA A;  3OYB A;  2AK5 A;  2BTT A;  2FYK A;  5DLO A;  3I55 A;  4MZM A;  4RCC A;  2ED1 A;  2LQW A;  3S3O A;  3NTI A;  1WXU A;  5CO7 A;  1D1B A;  4FIB A;  3U23 A;  2XMF A;  4M4Z A;  2C0I A;  2K7A A;  2JXB A;  5I2M A;  4PKC C;  5CIU A;  2GBQ A;  3PIP A;  1CSK A;  2XU8 A;  3A1P A;  1RAD B;  3CC2 Q;  2FZC B;  2KXC A;  4EIK A;  4MDW A;  2HSE B;  2Y4X A;  4R0K A;  1OEB A;  2BKD N;  1AZE A;  2P0P A;  2I2L A;  1Y57 A;  4OB3 B;  1WXB A;  3MEU A;  4AFS C;  1VQP Q;  3CXC A;  4C92 D;  1H64 1;  3V8K A;  2DXC A;  1YIT A;  4ZN1 A;  2EPD A;  3EG2 A;  1SEM A;  1XOV A;  1AOJ A;  2FZK B;  4ZNX A;  1NPR A;  1PD0 A;  1RI9 A;  4NL3 A;  2M51 A;  2W0Z A;  2HZY A;  2VXE A;  1BI0 A;  2WAC A;  4OMF B;  1A0N B;  3A8L B;  4JLG A;  2IVW A;  1OOT A;  1KFZ A;  1ABO A;  3OYF A;  4C5H A;  4HCB A;  2QEX Q;  1BIA A;  1GFC A;  3DLL A;  5GAN 3;  5LL6 S;  4CC2 A;  3JSC A;  1JXM A;  1UFF A;  4TVR A;  2E64 A;  2MK5 A;  2RJD A;  3M4Y A;  3EH2 A;  2RNA A;  2EQU A;  2L8D A;  2RQT A;  4M7A D;  3V8L A;  2NUT B;  2KR3 A;  2R5M A;  1VYT A;  2RO0 A;  5LJ5 h;  4F17 A;  2CP7 A;  2KDS A;  3H0H A;  2HSP A;  2CGH A;  5EC7 A;  2LZ6 B;  2XDB A;  1SSF A;  1J3T A;  4KGV B;  3QYH B;  3OYL A;  3CBP A;  5GMK m;  4M77 F;  1PKS A;  2C0O A;  1I8F A;  2CH4 W;  1UG1 A;  2EQJ A;  1VQ5 T;  3P8H A;  4C92 E;  1K0S A;  2L3Q A;  5LJ5 g;  2HD0 A;  3QBY A;  4LXC A;  3V7R A;  1WYX A;  1S1N A;  1IGQ A;  1WHL A;  4JJC A;  4E7Z A;  3CME A;  3IQL A;  3HRT A;  3L42 A;  3FC3 A;  3JB9 D;  2EGE A;  1TXQ A;  1Q95 G;  3CXC S;  2K57 A;  4E7H A;  4M78 D;  5D7U A;  4CRI A;  2LRQ A;  4AG1 C;  2A37 A;  3UT1 A;  3UAT A;  4CI0 C;  1LNX A;  1RAI B;  3OW2 P;  5LJ3 g;  4BI8 B;  3ZL7 C;  2SEM A;  4EMK A;  2FB7 A;  3MJX A;  2EYQ A;  4E7S A;  3R6N A;  2DTH A;  2LQN A;  2AKK A;  4EMG A;  3HRS A;  4RTY A;  1VIF A;  2QA4 T;  3PVQ A;  4J6W A;  4ELY C;  1HD3 A;  3S6W A;  1WHK A;  5CQY A;  4ELZ C;  4KUI A;  2VV5 A;  3L2U A;  2JS2 A;  1VQM T;  5KYN A;  2GFA A;  4Q5W A;  2MCN A;  2DXU A;  1UGR B;  1N8R U;  3PIO A;  1YJW T;  4HCZ A;  4QT7 A;  1KD1 R;  2MI6 A;  1M8V A;  4M7A F;  3VUZ A;  1PKT A;  5A0G A;  1MV0 B;  3EFO B;  2LJ3 A;  4XU3 A;  2K79 A;  5IHN A;  2XIC A;  4IUP A;  3H0I A;  1QVF S;  1D0Y A;  3GNG A;  1Z9Z A;  1JBM A;  4PK4 A;  4XTY A;  2MWP A;  5FLX E;  2D0N A;  2DL7 A;  5FU7 B;  2QEX T;  1K0X A;  2DIQ A;  3URG A;  3S3N A;  3NHN A;  3OYG A;  3EGU A;  3BFM A;  3CCS A;  4DA4 A;  1UJY A;  1M9S A;  2ZPE B;  3O5Z A;  2F69 A;  5GAO l;  1TUD A;  5GAN 5;  4AMC A;  1C1A A;  2R5A A;  2YDL A;  5GAM f;  3PTA A;  2E1H A;  5A0L A;  3OYM A;  1FYN A;  3LYI A;  4FW1 A;  3VS2 A;  2QQR A;  1X69 A;  2HQX A;  2DF6 A;  3OW2 A;  2CP6 A;  5GMK i;  4PJO D;  4PJL A;  4RTX A;  5CKH A;  3LGL A;  4AFU C;  3JCM d;  2PUO B;  2JMC A;  1QVG P;  2Y4Y A;  2OAU A;  2CDT A;  4BE1 A;  4FSS A;  1WGS A;  1BU1 A;  3G4S T;  2CZ0 B;  3PE0 A;  1YFN A;  2E5K A;  2XK0 A;  5KCO A;  4E7L A;  1VQK T;  2HQH A;  3EGD B;  3X26 B;  3JCM h;  2QK0 A;  4HCC A;  2A08 A;  4PJO B;  3CME Q;  3CMA A;  3HSB A;  2CP5 A;  2KBT A;  3CBO A;  3OYD A;  2DJZ A;  2M1H A;  1KD1 C;  1AWW A;  4ZN3 A;  2J6O A;  1RL2 A;  3LWH A;  4BAC A;  4M78 E;  4K11 A;  2Z0W A;  1YIJ A;  2PZ1 A;  1SHF A;  2RK1 A;  4LNP A;  2XDP A;  3I35 A;  1K76 A;  1SG5 A;  3HFN A;  3CD6 Q;  1WHJ A;  4PJO G;  1IRE B;  3EFO A;  9ATC B;  4FW2 A;  3OYN A;  1VQ7 A;  2FL7 A;  1WX6 A;  1HSQ A;  1ZLM A;  2PTK A;  5AT1 B;  2PVO B;  4BUG A;  5ECA A;  4ZGD B;  2CZ7 B;  2EGC A;  4F7U B;  2K5L A;  3M57 A;  4D8D A;  4N0A A;  4ZTJ A;  1WFW A;  1JEG A;  3VS7 A;  4F7U F;  4PJO E;  5GMK e;  5CAI A;  4EDU A;  1AD5 A;  4LUD A;  2DKG A;  3PNW C;  2DD4 A;  2QDL A;  2JUF A;  2P4T A;  2DET A;  5KYX B;  1G83 A;  4OB1 B;  1B34 B;  1JB0 E;  4RCB A;  5L8R E;  4JZ3 A;  2D8J A;  3HKS A;  4BY6 B;  1VQ8 T;  2NLU A;  1VQP T;  1QVP A;  1MNE A;  4F7U A;  2KGT A;  2KI7 A;  4EMK C;  3NPF A;  4BI4 A;  5FU6 C;  1ZSZ B;  5HK3 A;  3A98 A;  3REA B;  3M5A A;  4IUR A;  1H92 A;  2OTL A;  3BY7 A;  3OS5 A;  3CCR A;  1Q81 U;  4OMM A;  3OYK A;  2ZPB B;  4A4F A;  1D0Z A;  4GLK A;  1U1S A;  3M59 A;  3L2W A;  4FCY A;  1IHV A;  4C0D B;  3KFV A;  2R58 A;  1OYX A;  5IN1 A;  2HQE A;  1ZSG A;  4M78 B;  5AYF A;  1WNL A;  3FRN A;  1YCY A;  1XNI A;  1VQ6 Q;  4N4G A;  2RA2 A;  3G7Z A;  1X2K A;  4MML A;  1VQN A;  1TSF A;  4OGE A;  4F7U G;  1Q81 R;  1W2B S;  2YRD A;  5I2S A;  1UGV A;  3CCL A;  1BK2 A;  2X51 A;  4M78 A;  2M9U A;  8AT1 B;  3CC2 A;  1BBZ A;  3MET A;  1YJW A;  2GCX A;  4ME7 A;  4C92 G;  4IUU A;  4BD3 A;  2QQB A;  2CT4 A;  1S72 T;  1M1G A;  2VGM A;  2CH4 A;  2D0Q B;  2DMO A;  3CQT A;  4DOW A;  1Y0M A;  2X35 A;  3JCM e;  3SFM A;  2D6F A;  4F7U E;  3SWN B;  4FU6 A;  3QDR B;  2MPX C;  2QQ9 A;  2KT8 A;  1BI3 A;  3M58 A;  2K5I A;  1TWB A;  4OMO A;  2H3J A;  1VQL Q;  2K3B A;  4IUT A;  1U8R A;  2HCK A;  1QCO A;  2X3W D;  4XTW A;  4X9C A;  2ROT A;  4LD6 A;  1QKW A;  3ULR B;  4QQG A;  1VQ6 A;  3QII A;  1RLP C;  3ZFJ A;  1ZA1 B;  1D3B B;  3SHW A;  5GAN 6;  2E65 A;  2QGF B;  2YLC A;  1I07 A;  4OML A;  1P92 A;  1K9M C;  1H8K A;  1OPL A;  2CSQ A;  4HVW A;  1SRM A;  5GAM j;  1YWO A;  2RF0 A;  2K3X A;  2EYZ A;  4J7I A;  4C92 F;  1TG0 A;  3CD6 A;  2VKN A;  4HXJ A;  5GMK h;  2CSI A;  1RAG B;  3R6O A;  1G3W A;  4J9B A;  1Q7Y U;  1WPY A;  2XG8 D;  3MO8 A;  2CUD A;  4M77 E;  3UA7 A;  4GLM A;  1NYG A;  4DOV A;  4RTU A;  1YI2 Q;  3E1S A;  3OMC A;  1UGS B;  4JRI A;  1FMV A;  2LP5 A;  4M75 F;  2MWO A;  2D8H A;  3E9G A;  3RMQ A;  1XTD A;  2A7Y A;  3EGX B;  4BI3 A;  2AIR B;  2QI2 A;  1UTI A;  3I56 A;  1YJW Q;  3JB9 F;  3OYJ A;  1X27 A;  4A4H A;  3WVD B;  2COY A;  2HBW A;  2RI5 A;  4J5Y A;  4QW2 A;  4XU0 A;  4M77 G;  1AWX A;  2A28 A;  3LX7 A;  2PNI A;  3RKY A;  4JJD A;  2XKO C;  3CPW S;  3EAE A;  3GLX A;  4WF2 A;  3EH1 A;  2MIO A;  1QW1 A;  2M16 A;  1NJI C;  2F5T X;  2WSF E;  4M7A G;  5IHI A;  1MMA A;  2KQW A;  1M1K U;  2QGG A;  1FWZ A;  3QG1 A;  3L2V A;  2G3R A;  5GMK j;  4J9I A;  4M7D E;  2EKH A;  1Q81 C;  3KXT A;  3UWN A;  4L6V 5;  2A3L A;  1VQ9 T;  3OQ5 A;  1Z9Q A;  5IXF A;  1G2B A;  1EIF A;  1M2V B;  4PFZ A;  2RI2 A;  2JTM A;  4C92 B;  1WJR A;  3CEY A;  3INZ A;  5LJ5 e;  4OMP A;  3JB9 I;  3FJ5 A;  2CT3 A;  1LCK A;  3X24 B;  4NOY A;  1KHC A;  4Z02 A;  2NUP B;  1EX4 A;  1QVG A;  2L3R A;  1W70 A;  5FRN A;  4M77 A;  4M7D G;  1IGU A;  4KH1 B;  3CC4 A;  2DRM A;  4IKF A;  1YN8 A;  3OMG A;  4B9X A;  1QMC A;  1VQO T;  4PJO A;  3JRZ A;  4M78 G;  3RER A;  3EFS A;  4RTV A;  3DB3 A;  4RTT A;  3CMA T;  2L0A A;  1Y7X A;  1WIE A;  2H8H A;  2ROL A;  2XHC A;  3H0F A;  1WQ7 A;  3PFS A;  2OX7 A;  4PNO A;  5J26 A;  1ZBJ A;  5GAO q;  2J7I A;  5GAN j;  4ZGJ B;  3CC7 Q;  1K73 R;  3HRU A;  2EBP A;  2P0K A;  3LH5 A;  3CCS Q;  5A2Q E;  5I21 A;  3C0C A;  1VQ7 T;  2MOX A;  2HL5 C;  3GP8 A;  2ZGW A;  3GBQ A;  2EQI A;  4Z8A A;  1JJ2 A;  4EPC A;  4C5G A;  2LNV A;  4QQ6 A;  4PJO F;  4M7D A;  4Y91 A;  2NYS A;  1U3O A;  1ZBX A;  2KYM A;  3OYI A;  3CPW A;  2P4R A;  3RIR A;  2JZ2 A;  5I22 A;  2BIV A;  3CBM A;  5GAO n;  4M75 C;  4C8Q D;  3OYA A;  2RQR A;  2DL3 A;  4JUV A;  4AFZ C;  2DZ9 A;  3CCQ A;  1D09 B;  4DEY A;  4QQD A;  4A4G A;  4IUV A;  2VUB A;  3RMS A;  1IZ6 A;  2JVV A;  2LTO A;  3D7S B;  3C95 A;  3G4S Q;  1VA7 A;  1PRM C;  2DZC A;  1I81 A;  5HY6 A;  2QA4 Q;  4FT4 A;  2JT4 A;  2J6K A;  2OAW A;  1KG1 A;  1VQ5 Q;  5KE2 A;  3M4G A;  5D6W A;  1VQ8 Q;  1WHG A;  4PFP A;  4JRK A;  1OU8 A;  5GAM h;  2RD1 A;  3GF5 A;  3JCM b;  3THK A;  4XQ3 A;  4M7A C;  4QVZ A;  2DD5 A;  2P84 A;  4LE9 A;  3EG9 B;  6AT1 B;  1QVG S;  2F2V A;  4MMK A;  4GBQ A;  2XID A;  3E9F A;  3EG1 A;  2RQW A;  1X6G A;  2LQ8 A;  4FT2 A;  1W1F A;  2HMA A;  1K8A C;  1YJN T;  4EMH A;  2A0F B;  2K5F A;  2DVE A;  5GAN 8;  4XTV A;  2VXF A;  3VS4 A;  1B07 A;  1GCP A;  2DL5 A;  2HKN A;  4F16 A;  5KCH A;  1PRL C;  3JCM f;  4M7D C;  4N0A C;  1LPL A;  5CR2 A;  4IIO A;  1WXT A;  2KRS A;  3OS0 A;  2EYY A;  1PSF A;  1UGQ B;  4IUQ A;  4OB2 B;  3CCL T;  1IRX A;  1O9S A;  1WLP B;  2HBP A;  1W4S A;  2AZV A;  4OF1 A;  3CC2 T;  3RR6 A;  1M8M A;  1R0B G;  5FU7 C;  4PLL A;  1RLQ C;  1SKU B;  5KE3 A;  4R55 A;  1T0H A;  2NUP A;  4C92 A;  3HP9 A;  1U06 A;  3PVL A;  3PT9 A;  4AT1 B;  5HKC A;  1UGP B;  2RHZ A;  2E3I A;  3EG3 A;  4FYY B;  2RB6 A;  3EHR A;  1QVF A;  5D6Y A;  1NJI R;  2X4X A;  3JCM P;  5CK9 A;  3I9Q A;  2QAZ A;  3CCM T;  2RHY A;  1VQL T;  3DLM A;  3EHQ A;  1BI2 A;  1YHQ T;  4M77 C;  1GXI E;  5GAM d;  1BIB A;  2DEQ A;  3BE3 A;  3GNF B;  5HCK A;  2VB6 A;  1X6B A;  5CCA A;  1UEB A;  3MPU B;  2BZY A;  1M2O A;  5IH2 A;  2PVD B;  3SWN C;  2OJ2 A;  3CCJ Q;  2E4H A;  2J05 A;  3M54 A;  2QAS A;  2IIM A;  3CCU T;  2X9H A;  4LDV A;  4D8K A;  1HK9 A;  3RUX A;  3CCU Q;  3V8J A;  1K73 C;  4RUG A;  2CUB A;  2M0O A;  1M3B A;  2L3P A;  4FYV B;  1KQS A;  2FPE A;  1RI0 A;  2ZCF B;  1MUZ A;  3I5R A;  1X43 A;  2GGR A;  4MZP A;  3EGX A;  2O4X B;  2GQV A;  3PGG A;  5GJW B;  2JN0 A;  2JM8 A;  2DTO A;  1ZHI A;  4XTZ A;  1E6G A;  2OTJ Q;  3SEM A;  1VQ8 A;  1ZQ1 A;  2DO3 A;  2YLB A;  2L2P A;  5KH6 A;  4C5E A;  4ZTF A;  2RPN A;  4QVC A;  1I5L A;  2ED0 A;  1N8R R;  5GAN 4;  3VYH B;  4J6Y A;  2VC8 A;  1G3S A;  3M0Q A;  4M7A E;  5GAN f;  4XK8 E;  4F14 A;  3CCM A;  4JDS A;  3CCR T;  1MND A;  1VQL A;  2J6F A;  5KYU A;  1YBY A;  3VS5 A;  1B3Q A;  2E5Q A;  4BDY A;  1M90 R;  1WJQ A;  1WI7 A;  2L3S A;  4OMQ A;  5CVI A;  1V76 A;  3LWI A;  1VIE A;  1T0J A;  2PUK B;  4BY6 C;  3NTH A;  3CCU A;  2BE7 D;  2YWW A;  2C06 A;  1E7O A;  3QXE B;  1PHT A;  1UE9 A;  1M3C A;  1HYO A;  3UPU A;  3OSS C;  3C94 A;  5LJ3 h;  2DNU A;  2MF2 A;  5IT9 E;  1OQK A;  4OB0 B;  4B9W A;  4PJN A;  4C0F A;  1MGQ A;  1K9M R;  1M90 U;  3X20 B;  3X25 B;  3GIB A;  1MMD A;  5GAN 7;  2YXY A;  2DAQ A;  1OUL A;  1ABQ A;  1G8X A;  2BZ8 A;  1GCQ A;  4AG2 C;  2CS7 A;  1C6V X;  4LDW A;  3VJP A;  2EIF A;  1KQS S;  2AZS A;  2DVJ A;  4FM4 B;  1XJW B;  2C0T A;  1YJN A;  3CMA Q;  1GBQ A;  1M2V A;  3CC4 T;  2EVR A;  2OTL Q;  5CKD A;  1NEG A;  2QQA A;  4M7D F;  1YNZ A;  1VQN Q;  2A36 A;  2QTX A;  1VQO A;  1VUB A;  3QKJ A;  5GAN d;  3HPW A;  4KGZ B;  3CCJ T;  2E3H A;  4II1 A;  4J83 A;  2JMA A;  3MP6 A;  5LJ3 j;  2R57 A;  2EWN A;  2YUP A;  2B86 A;  3CCV Q;  2RJC A;  3QYG B;  1YP5 A;  3QJ6 A;  1OI1 A;  4RTZ A;  1W2B A;  4ESR A;  4E7K A;  4OGC A;  2DE0 X;  5GAN 2;  3G6E T;  2QEX A;  4M78 C;  1GRI A;  2ZPH B;  2CKK A;  1BB9 A;  2V26 A;  2EYX A;  2HL3 A;  1HXD A;  3CCQ T;  3I55 Q;  1QLY A;  3E2U A;  1Q82 R;  3OA6 A;  3CCE A;  4J9C A;  3P8B B;  1Y96 A;  4J9G A;  3JCM c;  3FB9 A;  2VVK A;  2EQM A;  3VU3 C;  4QVD A;  1S72 Q;  4J8O A;  5KYX A;  3FDR A;  1SRL A;  2KRO A;  5GAO m;  1TU0 B;  2AT1 B;  3ME9 A;  4WCI A;  2DIG A; 
#chains in the Genus database with same CATH homology
 5GMK j;  1VQ5 A;  4M7D E;  3G71 A;  2EQJ A;  1VQ5 T;  1Q81 C;  3KXT A;  3UWN A;  4L6V 5;  3ZEH A;  3P8H A;  4C92 E;  2E12 A;  3J80 E;  2A3L A;  3A8H B;  1VQ9 T;  5LJ5 g;  3OQ5 A;  4E7I A;  1FX7 A;  3MP1 A;  2HD0 A;  1LJO A;  3QBY A;  4O5V A;  1EIF A;  5GAN g;  1YI2 A;  3V7R A;  2RI2 A;  2JTM A;  4XTU A;  4C92 B;  3J7A F;  2E6Z A;  2KAF A;  4E47 A;  1WJR A;  1Q82 U;  3CEY A;  1VQ4 T;  3INZ A;  5LJ5 e;  3QZ5 B;  3JB9 I;  3CME A;  2LQK A;  3HRT A;  3L42 A;  3X24 B;  3FC3 A;  3JB9 D;  1I8F A;  3V7C A;  2O4X A;  4JLI A;  4NOY A;  4L5G A;  1KHC A;  4Z02 A;  1Y96 B;  5LJ3 f;  4RMO A;  3GOX A;  3CXC S;  2L3R A;  4D6W A;  1QVG A;  2K57 A;  2XI9 A;  5FRN A;  4M77 A;  4M7D G;  3OW2 S;  4E7H A;  4M78 D;  3ZBD A;  3CC4 A;  2DK3 A;  4IKF A;  3RKX A;  3QSU A;  3OMG A;  4B9X A;  4CRI A;  2LRQ A;  4YTL A;  3FJP A;  1VQO T;  4PJO A;  4M7A A;  3JRZ A;  2RI3 A;  4M78 G;  3UT1 A;  2HAX A;  4CI0 C;  1LNX A;  1M90 C;  3RER A;  3EFS A;  5LJ3 g;  2O01 E;  3DB3 A;  4BI8 B;  2E10 A;  3CMA T;  3LGF A;  1Y7X A;  3SD4 A;  2JOY A;  3OS1 A;  2XHC A;  3VYG A;  4EMK A;  2FB7 A;  1WQ7 A;  2EYQ A;  3PFS A;  1WQW A;  3WXM B;  4A4K A;  5LJ3 d;  3VUB A;  3HHT B;  2DTH A;  4PNO A;  5J26 A;  1KQ2 A;  2E6N A;  5GAO q;  4EMG A;  3HRS A;  4P5N A;  5GAN j;  3H8Z A;  2RHX A;  1VIF A;  2QA4 T;  4J6W A;  4ZGJ B;  3SWN A;  4ELY C;  2L89 A;  3HRU A;  4VUB A;  2LCC A;  3S6W A;  3T9N A;  2P0Q A;  5CQY A;  2GFU A;  3Q1J A;  4ELZ C;  2P0K A;  4KUI A;  2VV5 A;  4C8Q B;  5A2Q E;  4XTX A;  3L2U A;  5LJ5 f;  4M75 A;  3QUI A;  3CD6 T;  5I21 A;  4A53 A;  1VQM T;  1VQ7 T;  4HKE A;  2GFA A;  4Q5W A;  3GP8 A;  2DXU A;  2ZGW A;  1UGR B;  1N8R U;  3PIO A;  1YJW T;  1KHI A;  4HCZ A;  5CKE A;  5FRM A;  2EKO A;  1JJ2 A;  3MEW A;  4EPC A;  2X4Y A;  2MI6 A;  2LNV A;  4C5G A;  4M7A F;  1M8V A;  4QQ6 A;  1Q7Y C;  4PJO F;  2CYZ B;  3VUZ A;  2EJG A;  4Y91 A;  4M7D A;  3QHS A;  1ZBX A;  5A0G A;  3OYI A;  3CPW A;  4A54 A;  3LW5 E;  2JZ2 A;  3RIR A;  1KC8 U;  4XU3 A;  2BIV A;  3CBM A;  3I55 T;  4N4I A;  5GAO n;  2XIC A;  4IUP A;  4M75 C;  4KUL A;  4C8Q D;  3OYA A;  4M7A B;  1QVF S;  4JUV A;  3G71 T;  3GNG A;  1JBM A;  1QP3 A;  2DZ9 A;  5IAY A;  4XTY A;  3CCQ A;  1K73 U;  2MWP A;  5FLX E;  4M75 D;  4QQD A;  4A4G A;  4C8Q C;  2ZPF B;  1K9M U;  4IUV A;  3OSV A;  2VUB A;  3RMS A;  1IZ6 A;  1Q86 C;  2JVV A;  2LTO A;  3C95 A;  3JCM W;  2DZC A;  5FU7 B;  1I81 A;  3O8V A;  3MCA B;  3M53 A;  5HY6 A;  3OS2 A;  2DIQ A;  3URG A;  2QEX T;  4FT4 A;  3L2R A;  4XU2 A;  3S3N A;  3CC7 T;  5CKB A;  3OYG A;  1XQH A;  4A4E A;  4DQ2 A;  1KG1 A;  3BFM A;  5DLQ E;  3CCV T;  3CCS A;  4DA4 A;  1M9S A;  4XU1 A;  2ZPE B;  4FL6 A;  4C8Q G;  3CCS T;  5KE2 A;  4MZT A;  3M4G A;  5DY9 A;  5D6W A;  5M9O A;  2F69 A;  3A8O B;  2RHI A;  4JRK A;  5J3B A;  5GAO l;  5GAM h;  2RD1 A;  3JCM X;  5GAN 5;  1KQ1 A;  3GF5 A;  3MEA A;  3VV0 A;  2R5A A;  3E19 A;  3JCM b;  5GAM f;  1X6O A;  1V29 B;  2E1H A;  4XQ3 A;  3PTA A;  4M7A C;  5A0L A;  2ZPI B;  3OYM A;  1MHN A;  4QVZ A;  4JJN K;  3TU4 K;  3LYI A;  1X75 C;  4C8Q A;  2YRV A;  2DD5 A;  2QQR A;  5GAN e;  1B34 A;  4RG8 A;  1H3Z A;  2HQX A;  2HNI A;  1QVG S;  1O75 A;  3AHU A;  3JCM g;  4MMK A;  3C12 A;  2RJE A;  2XID A;  3E9F A;  4OVA A;  3OW2 A;  1WJS A;  5GMK i;  4PJO D;  3JCM J;  3I56 T;  2LQ8 A;  3DKM A;  4FT2 A;  5CKH A;  1K8A C;  4C92 C;  1YJN T;  3LGL A;  4EMH A;  1G3Y A;  3QZ9 B;  2K5F A;  3JCM d;  2DVE A;  2PUO B;  5GAN 8;  4XTV A;  2VXF A;  1I4K 1;  2Y4Y A;  4KT0 E;  2OAU A;  5A0D A;  4EMK B;  4BE1 A;  1N9R A;  1WGS A;  2LT4 A;  3M56 A;  3G4S T;  4BE0 A;  2CZ0 B;  4M7D D;  2XK0 A;  5KCH A;  5KCO A;  4E7L A;  1VQK T;  3JCM f;  4GY5 A;  3CME T;  2KMT A;  3X26 B;  3CCE T;  3L1A A;  3JCM h;  4N0A C;  4M7D C;  4HCC A;  1VQ6 T;  2BUD A;  4PJO B;  5CR2 A;  3L2Z A;  2DTI A;  3CMA A;  3HSB A;  3OS0 A;  3CBO A;  3OYD A;  1PSF A;  1UGQ B;  3A8M B;  4IUQ A;  2XDD A;  2DJZ A;  2M1H A;  1VQM A;  1KD1 C;  4OB2 B;  3CCL T;  2Y90 A;  1O9S A;  4ZN3 A;  2HBP A;  2RJF A;  1W4S A;  1RL2 A;  2WSE E;  3OBY A;  3FLG A;  1M1F A;  2EAY A;  4J6X A;  4OF1 A;  5CKF A;  3OYH A;  4BAC A;  5GAO r;  3CC2 T;  4M78 E;  1N6A A;  3OYC A;  2FVU A;  1YIJ A;  2LC4 A;  4NL2 A;  2RK1 A;  4HA8 A;  2QQS A;  3MEV A;  5FU7 C;  2XDP A;  4PLL A;  3FEO A;  1R8O B;  4KBM B;  3HFN A;  3TCJ A;  3HL8 A;  5KE3 A;  4R55 A;  1BI1 A;  4C92 A;  4C0D C;  3NFC A;  1QP2 A;  1IRE B;  3HP9 A;  4PJO G;  1JJ2 S;  2DPP B;  3C4S A;  3PT9 A;  3ASK A;  3NTK A;  5GAN h;  5HKC A;  1UGP B;  1UB4 A;  3M9Q A;  3JAM E;  3OYN A;  2FL7 A;  2RHZ A;  2WSC E;  3L2V A;  1VQ4 A;  3EFR A;  1VQ7 A;  3PMT A;  4M7D B;  1Y71 A;  1VQP A;  2PVO B;  4BUG A;  2RB6 A;  2F5K A;  4ZGD B;  2CZ7 B;  4MDX A;  4NS5 A;  5C0M A;  1QVF A;  5D6Y A;  2X4X A;  4F7U B;  5LJ5 j;  3JCM P;  5CK9 A;  3ER0 A;  2K5L A;  2LCL A;  5GAM g;  3OB9 A;  2RK2 A;  5FU6 B;  2DXB A;  5GAO p;  3M57 A;  3OYE A;  3CCM T;  2RHY A;  1VQL T;  3DLM A;  1M5Q 1;  1PSE A;  2E70 A;  4N0A A;  2AHJ B;  1BI2 A;  3SB2 A;  3DB4 A;  4ZTJ A;  3MHX A;  1YHQ T;  4M77 C;  2FHD A;  1GXI E;  5GAM d;  4O6J A;  4F7U F;  5J39 A;  1BIB A;  2DEQ A;  2V8I A;  3GNF B;  3P8D A;  5CAI A;  4EDU A;  5GMK e;  4KUD K;  4PJO E;  1D3B A;  2EJF A;  4X34 A;  4C0G A;  2DKG A;  5CCA A;  1UEB A;  4LD9 K;  2DD4 A;  2RM4 A;  3PNW C;  1OZ2 A;  2PVD B;  3SWN C;  2JUF A;  2P4T A;  4C5I A;  4M75 B;  1YI2 T;  2LT1 A;  4OB1 B;  2PVG B;  1JB0 E;  1B34 B;  3FIF A;  3M54 A;  1N9S A;  4RCB A;  5L8R E;  3TEE A;  3HKS A;  3CCU T;  1BKB A;  4BY6 B;  5LJ5 d;  1VQ8 T;  2PQW A;  4Y28 E;  2JTF A;  2NLU A;  4LDX A;  4LDV A;  3MP8 A;  1QVP A;  1VQP T;  1HK9 A;  3RUX A;  4F7U A;  5LJ3 e;  4V2S A;  3V8J A;  1NJI U;  3BDL A;  1K73 C;  3BDU A;  2KK4 A;  2M0O A;  4EMK C;  2JNG A;  5EG2 A;  4BI4 A;  5FU6 C;  5HK0 A;  1M1K C;  5HK3 A;  3M5A A;  2DXT A;  4IUR A;  5GAM e;  1KQS A;  3G4S A;  2MAM A;  2OTL A;  1RI0 A;  3BY7 A;  3OS5 A;  1AHJ B;  2ZCF B;  4M77 B;  3CCR A;  3HFO A;  1YHQ A;  1Q81 U;  2OTL T;  4M75 E;  4MZP A;  2KVQ G;  3QPH A;  3LWH A;  2O4X B;  2GQV A;  2D9T A;  3PGG A;  3OYK A;  2JN0 A;  2ZPB B;  3V7S A;  4A4F A;  4M78 F;  4GLK A;  1U1S A;  3M59 A;  3CCJ A;  3S3M A;  3L2W A;  2DTO A;  1ZHI A;  1N8R C;  1VQ9 A;  4XTZ A;  3F70 A;  1S72 A;  4OP0 A;  3G6E A;  2LDM A;  4C0D B;  2KSS A;  2R58 A;  3RES A;  1OYX A;  5IN1 A;  2HQE A;  4C0Z A;  3JB9 G;  4R56 A;  1TH7 A;  4HT9 A;  2QXF A;  2MMP A;  3M55 A;  3A5Z B;  2QDY B;  4ZGE B;  2OTJ T;  4M78 B;  5AYF A;  1VQ8 A;  1WNL A;  1ZQ1 A;  3FRN A;  1Y07 A;  1YCY A;  2DO3 A;  2YLB A;  2PU9 B;  2RHU A;  3CPF A;  3L2Q A;  1XNI A;  1NE8 A;  4N4G A;  5KH6 A;  3JB9 J;  2EJ9 A;  3JB9 H;  4C5E A;  4XAX B;  4ZTF A;  4QVC A;  1I5L A;  2RA2 A;  1YIT T;  3G7Z A;  4MML A;  1VQN A;  3N5B B;  5GAN 4;  3VYH B;  4OGE A;  4J6Y A;  3JCM Q;  4JRP A;  1K8A U;  1X01 A;  2K3Y A;  2RH2 A;  2VC8 A;  1G3S A;  4F7U G;  4JRQ A;  1Q86 U;  5GAN f;  4M7A E;  3KUF A;  4XK8 E;  3SDZ A;  3CC7 A;  1W2B S;  1N27 A;  2KY9 A;  5I2S A;  3CCM A;  4JDS A;  3CCR T;  3RKW A;  5FRO A;  3CCV A;  1VQL A;  2LX9 A;  3CCL A;  1G5V A;  1YBY A;  2CZ1 B;  4M78 A;  2M9U A;  4JS4 A;  3CC2 A;  2E5Q A;  5GMK l;  4BDY A;  1YJW A;  3MET A;  2GCX A;  1WJQ A;  4ME7 A;  4C92 G;  4IUU A;  4FSX A;  4N4H A;  1YIJ T;  4BD3 A;  2QQB A;  4PLI A;  5CVI A;  4E7J A;  1M1G A;  1S72 T;  2E41 A;  2VGM A;  4X9D A;  2D0Q B;  3LWI A;  3OBW A;  1Q82 C;  4ATO A;  1G3T A;  1VIE A;  2VGN A;  2PUK B;  2VYT A;  4DOW A;  3OYB A;  2FYK A;  3QO3 A;  2X35 A;  2X4J A;  4BY6 C;  5DLO A;  3JCM e;  3NTH A;  3CCU A;  3I55 A;  3BW1 A;  3SFM A;  4MZM A;  1KD1 U;  4RCC A;  1YJ9 A;  2C06 A;  2D6F A;  4F7U E;  2IG0 A;  3QDR B;  3QXE B;  2QQ9 A;  4FU6 A;  5CQX A;  3SWN B;  4BB7 A;  2QA4 A;  3S3O A;  2B8A A;  3NTI A;  3QJY A;  3UPU A;  5CO7 A;  3H6Z A;  4FIB A;  3OSS C;  3PMI A;  1BI3 A;  3C94 A;  3M58 A;  5LJ3 h;  2K5I A;  1DJ7 B;  1U1T A;  2GF7 A;  4C8Q F;  2H3J A;  2MF2 A;  5I2M A;  4PKC C;  5CIU A;  5IT9 E;  4OB0 B;  2YHT A;  4B9W A;  3PIP A;  4IUT A;  2XU8 A;  1U8R A;  4C0F A;  1MGQ A;  1LOJ A;  1M90 U;  4XTW A;  3X20 B;  2LVM A;  4X9C A;  3X25 B;  3GIB A;  4LD6 A;  4MDW A;  2ZZD A;  5GAN 7;  4QQG A;  2DAQ A;  1VQ6 A;  3QII A;  3ZFJ A;  2EQK A;  1NZ9 A;  2Y4X A;  4J7F A;  1D3B B;  5GAN 6;  2E65 A;  2BKD N;  2P0P A;  2I2L A;  2YLC A;  4OB3 B;  3MEU A;  1P92 A;  2CS7 A;  3CXC A;  1K9M C;  4C92 D;  4LDW A;  5GAM j;  4LDY A;  3VJP A;  2EIF A;  1H64 1;  1KQS S;  5DM7 R;  4FM4 B;  3V8K A;  2DXC A;  1YIT A;  4L59 A;  4ZN1 A;  2K3X A;  3VKI A;  4PJO C;  1YJN A;  1XOV A;  1JRI A;  1NPR A;  4BE2 A;  3GPL A;  4J7I A;  4C92 F;  4UC4 A;  3CD6 A;  1M4Z A;  4NL3 A;  3CC4 T;  5CKD A;  2X4W A;  2QQA A;  5GMK h;  4BDZ A;  3A8G B;  4M7D F;  5C6S A;  2VXE A;  1BI0 A;  1G3W A;  2QTX A;  2WAC A;  3R6O A;  4OMF B;  1VQO A;  4HT8 A;  4JS5 A;  1VUB A;  1Q7Y U;  1WPY A;  2XG8 D;  3A8L B;  3MO8 A;  4JLG A;  4M77 E;  3QKJ A;  4RKU E;  4DOV A;  2IVW A;  3OY9 A;  1BYM A;  3LH0 A;  5GAN d;  3HPW A;  3CCJ T;  3E1S A;  5D6X A;  3OYF A;  1FXX A;  4C5H A;  1KC8 C;  3OMC A;  4II1 A;  4HCB A;  1UGS B;  4J83 A;  3MP6 A;  1BIA A;  4JRI A;  2V8K A;  3WVE B;  4M75 F;  3DLL A;  5LJ3 j;  2R57 A;  2EWN A;  5GAN 3;  2MWO A;  5LL6 S;  1NPP A;  2XD0 A;  3E9G A;  3RMQ A;  3LLR A;  1XTD A;  2A7Y A;  3JSC A;  4BI3 A;  2OTJ A;  4M75 G;  4TVR A;  2RJC A;  2E64 A;  3QYG B;  1YJ9 T;  3J81 E;  2QI2 A;  3JCM V;  3QJ6 A;  1OI1 A;  3I56 A;  1W2B A;  2RJD A;  3M4Y A;  3JB9 F;  3OYJ A;  4E7K A;  4OGC A;  3WVD B;  4A4H A;  5GAN 2;  3G6E T;  3X28 B;  2QEX A;  2EQU A;  2L8D A;  2RI5 A;  2ZPH B;  4M78 C;  2CKK A;  3V8L A;  2V8J A;  4J5Y A;  4M7A D;  2L5Q A;  4QW2 A;  2R5M A;  4M77 G;  4XU0 A;  1OZ3 A;  3TRE A;  2ZPG B;  3LX7 A;  2RO0 A;  4LDU A;  5LJ5 h;  1HXD A;  2CZ6 B;  3RKY A;  2EFI A;  4C8Q E;  2KDS A;  3CCQ T;  1VQK A;  3OA6 A;  3CCE A;  2CGH A;  2XKO C;  3CPW S;  3EAE A;  3KBG A;  3P8B B;  4RG2 A;  3GLX A;  1Y96 A;  3JCM c;  3UDC A;  3FB9 A;  4WF2 A;  2EQM A;  3VU3 C;  4QVD A;  1VQN T;  4J8O A;  4PL6 A;  2XDB A;  1SSF A;  1QW1 A;  2M16 A;  1NJI C;  2K4Y A;  2F5T X;  3QYH B;  3OYL A;  2WSF E;  3FDR A;  3CBP A;  4M7A G;  5GAO m;  5GMK m;  3OYY A;  2K2V A;  4M77 D;  4M77 F;  2KQW A;  1M1K U;  3ME9 A;  1FWZ A;  3QG1 A;  2G3R A;  2DIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...