4M7AB

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 90
sequence length 90
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aB00
4C92E 4PJOE 3JB9I 1HK9A 1M5Q1 2DVEA 4C8QB 5GMKi 1KQ2A 3M4GA 4M75A 3VU3C 4M77C 5GMKm 5GAMj 4HT9A 2VXFA 5GMKj 4XU0A 5LJ5j 2YLCA 3JCMe 5GAMh 3JB9H 4M75G 4XTZA 3V7SA 5GAOp 3RERA 5GMKh 5LJ5h 2EAYA 3AHUA 1WPYA 5GMKl 3JB9G 4C8QA 4XTYA 3L1AA 3QSUA 4M7DC 3QUIA 1HXDA 3RKXA 4C92F 5GAOr 4PJOF 2RM4A 4M77D 4C8QG 1LNXA 5GANg 5DY9A 5CAIA 4M7AD 1U1SA 4OP0A 4XTVA 3JCMQ 4XU3A 5GAMf 4M77E 3HFNA 5LJ5f 2EJGA 1I4K1 5GAMe 5GMKe 5LJ5e 1LOJA 3QHSA 4N0AA 4X9CA 2FB7A 3V8KA 4M7DE 2RB6A 3JCMJ 5GAN8 4M75D 5GAMg 5LJ5g 3JCMP 1BIAA 3JB9D 3BY7A 2RA2A 3FJPA 4M77F 4DQ2A 3JCMf 1LJOA 2DZ9A 2DTHA 1I81A 2E64A 4M7AF 4M78A 1D3BA 1X01A 4C8QD 5GAOl 3JB9J 2HNIA 4J6XA 4C92B 4M78G 2E41A 1N9RA 1WQWA 4M7DF 5LJ3d 4PJOB 4J6YA 2E1HA 3BW1A 1I5LA 3JCMg 4EMKC 4PNOA 3SWNC 4NL3A 2JN0A 1TH7A 2EJFA 5GAOn 4M75C 3V8JA 4C92A 1JBMA 2RD1A 4MMLA 5I21A 4PJOA 4F7UE 4Y91A 3JCMW 3JB9F 1MGQA 2YLBA 1Y96B 5GAN5 3JCMb 4M7AE 1I8FA 4WF2A 3FB9A 5GANd 2VC8A 3EFRA 1B34B 4C8QC 4EMHA 3JCMV 4QVDA 3EFSA 3RUXA 5LJ3j 5GAN3 4M77B 4J6WA 4EMGA 2DKGA 1Y96A 1H641 3BFMA 5GAOm 5LJ3h 4M78D 1U1TA 4F7UF 4M7AB 5GAN4 2DXUA 3HSBA 2DXTA 2CGHA 1B34A 4M75E 2K57A 4JRIA 3JCMX 5GAN6 2DEQA 4M7DB 5GAN7 4XU1A 1KQ1A 4M77A 3JCMc 2DZCA 2E10A 2EWNA 4JLIA 2ZGWA 3RIRA 4N0AC 4XU2A 3SB2A 3HFOA 4C8QE 1BIBA 3QO3A 2E65A 1JRIA 5LJ3f 4C92D 3GIBA 5GANh 4XQ3A 5LJ3e 4M7DA 4X9DA 4M75F 4JUVA 2DTOA 2YHTA 2VXEA 3PGGA 4XTUA 4M7DG 1N9SA 4M78F 4M78C 3JCMd 4C92G 4M7AC 4MMKA 3RKYA 5GAOq 4PJOG 1M8VA 4JRKA 5LJ3g 3BDUA 4C8QF 4XTXA 5GAN2 2FYKA 3INZA 4NOYA 3V8LA 5GANf 2QTXA 4A53A 4J5YA 5GANe 4F7UB 2Y90A 4QVCA 4C92C 4PJOC 3V7RA 4HT8A 2I2LA 3L2ZA 5GAMd 1YCYA 4XTWA 4M78E 4RCBA 5LJ5d 2EJ9A 4F7UA 4EMKB 3SWNB 4HA8A 5GANj 4M7AA 3RESA 4M77G 3JCMh 4M7DD 3FIFA 4NL2A 4F7UG 2DJZA 4RCCA 1WNLA 3V7CA 4M75B 3RKWA 4PJOD 4M7AG 4V2SA 1WQ7A 4A54A 4M78B 1D3BB 4EMKA 2DTIA 3SWNA
chains in the Genus database with same CATH superfamily
4C92E 2KSSA 2ZCFB 1M5Q1 2MOXA 1D0YA 3UWNA 3HRSA 2RMOA 2GNCA 2QA4Q 3CCMQ 1PHTA 3CPWA 4AT1B 4TVRA 2DL3A 1C1AA 2E5QA 2B8AA 2GF7A 3FDRA 4KH1B 5FW9A 9ATCB 2RQVA 3QHSA 2R58A 2DM1A 4JJDA 3JCMP 4FM4B 4FSSA 5AYFA 1JU5C 1T0HA 2PVDB 2A08A 2YUOA 2LQKA 1QKXA 1M1GA 2E5KA 3THKA 2CT3A 3GF5A 1N9RA 2QDLA 3L2RA 4L59A 1F1BB 1SRMA 1IHVA 3SWNC 3EG1A 2KEAA 2PNIA 4DBRA 1G83A 3UDCA 4BI3A 4WF2A 2D0QB 1Q7YC 2BUDA 2P0QA 4QVDA 1X43A 3CCQT 1IGUA 1Y96A 1IB8A 3OQ5A 4M75E 3CCRT 3H0FA 4ELZC 2HL3A 1BCMA 4C8QE 5L23A 4JUVA 3E1SA 4FT4A 3I55T 1JEGA 2EW3A 3OYJA 1W2BP 1RAFB 1YITA 2KMTA 2OI3A 3M9QA 2X3XD 4IKFA 4OVAA 1BB9A 3IQLA 4RKUE 3G71A 1MNDA 1NLOC 1TG0A 4OMNA 1YWOA 2XI9A 1U06A 4HCBA 1MMNA 1LVKA 1SKUB 4FW2A 2FHDA 2BZXA 4E7IA 2DXBA 4BE0A 1FMVA 4ATOA 3MEAA 2BZ8A 4RTWA 3CBMA 2RH2A 4J9CA 3LH5A 2X3WD 1WXBA 2KE9A 4AFZC 1RAHB 3D7SB 4XU3A 2L0AA 3M0SA 3H9NA 4F16A 2ECZA 2K5LA 1M3BA 2VUBA 5HY6A 4M77F 2X4YA 3G7ZA 5CCAA 2HNIA 2SRCA 4RTVA 1EFNA 1AOJA 4B9XA 3T9NA 2B86A 2CYZB 3RDVA 4IUVA 2CH4W 2LQWA 4F7UE 1MGQA 2HKNA 2LCCA 5GAN5 3JCMb 1WX6A 1GCPA 2LVMA 2X51A 1OX8A 1Q7YR 1BI2A 1H641 1YNZA 3LGFA 1C6VX 2DK3A 2JVVA 2QAZA 3VS1A 2NYSA 3EFOA 2XK0A 5EC7A 4RTZA 1VQOA 2DTOA 2YHTA 1D1CA 4X1VA 2CP0A 2E3HA 1D09B 2KK4A 3TVTA 1QVPA 2EQUA 3OYDA 3A8GB 1K8AU 4Z8AA 4KBMB 2DPPB 1YBYA 4Y28E 4OB2B 2JUFA 4ZN3A 4RCBA 1MV3A 2QA4A 3QPHA 2KDSA 3SWNB 3CCMA 2QI2A 2AT1B 2HCKA 3I9QA 4JJNK 4DBHA 4C0ZA 3JRZA 1NYGA 2DRKA 2LJ0A 4FIBA 5FRMA 1VQKQ 1NEGA 3RERA 4M75G 2RJDA 1KK7A 2A3LA 1AWWA 1Y7XA 2DMOA 3L1AA 1MMAA 5GAOr 1HXDA 2RI3A 3UT1A 3A8MB 4OMMA 4C8QG 3PE0A 2EYWA 1IREB 4DEYA 3JCMQ 1I4K1 2DVJA 2RHUA 1TS9A 1ZSGA 2ROLA 4M7DE 4PL6A 3Q1JA 1M27C 4AFSC 1WZOA 4WTOB 2RA2A 3E9FA 1AWJA 2D6FA 2E64A 4M7AF 4RG2A 3P8DA 2ESWA 2E1HA 2LQ8A 4PJLA 2K3YA 3LYIA 4PLLA 4HCCA 5IAYA 1QWEA 3V8JA 1NYFA 5J39A 3NHNA 1TUCA 2L89A 3M0RA 2VC8A 1O9SA 1BCOA 1BBZA 3JCMV 2KQWA 2KYBA 2CP2A 4VUBA 1VQLT 2KI7A 4P5NA 1WGSA 3GP8A 5CKHA 3E2UA 3JCMc 4CC7A 2LTOA 3OBYA 4KGZB 2D8HA 5D6WA 2LCSA 1X69A 2P0KA 1VQ8T 1N9SA 1UGVA 1YJ9A 2ZPHB 2L5QA 3DB3A 2EGCA 3OB9A 2DAQA 2Y90A 4QVCA 4C5IA 1M4ZA 5HK3A 4HVWA 2FEIA 1N5ZA 4DBFA 2WSCE 1B07A 1XOVA 1ARKA 3VS0A 1K8AC 2V8JA 2LNHB 4F7UG 1AEYA 2DL5A 2HD0A 4NS5A 1K0SA 2RHXA 3CD6Q 4PJOE 1HK9A 1VQ9A 2QGFB 2LP5A 2JJ9A 2MAMA 3PIPA 2RI2A 4PKCC 2PZ1A 2RI5A 4M77D 2GFUA 3M0QA 5CKFA 3PMTA 5GMKe 2H3JA 3G6EA 3OSVA 1LPLA 2JXBA 1QVGP 3S6WA 3M54A 1K9AA 3CMEQ 2JS0A 3P8BB 1VQ7Q 3C95A 1KFZA 3WVEB 1ZSZA 3EG3A 4PFZA 1LCKA 1WHHA 1ZUUA 1HD3A 3QYGB 3FEOA 3FLGA 2K4YA 1JXMA 1TOVA 2GGRA 2RD1A 3CCUT 2O9VA 2LMJA 2QQBA 3R6NA 3MP8A 1B34B 1M3AA 2EYXA 2BZYA 3CD6T 3VUBA 5HCKA 4EMGA 1Y07A 2J6OA 1KG1A 5GAN4 3HSBA 2X4XA 2IPOB 2K57A 1TUDA 3RNJA 1KQ1A 2CZ7B 1WLPB 2HBPA 1KQSS 1JRIA 4FCYA 1N8RU 2JMAA 1TXQA 4XQ3A 1X27A 4A4FA 3OYGA 4F14A 4M7DG 4JRKA 1GL5A 5LJ3g 3BDUA 3E19A 2DO3A 3CC7T 3SFMA 4ZGDB 1RABB 1G2BA 5D7UA 4A53A 2Y4XA 2IIMA 1W2BS 4OMFB 3CCET 1BI3A 1VQKA 3L2ZA 4D6WA 3M57A 1SSHA 3L2QA 2DBMA 3RESA 3EGXB 4M4ZA 5FWCA 3RKWA 4V2SA 2XHCA 2EGAA 2DTIA 4LD9K 3SWNA 2CZ1B 3EGUA 1KQ2A 2QASA 1IXDA 3S3MA 2D1XA 5KCOA 2JS2A 4PJNA 3JB9H 5GAOp 1QWFA 5GMKh 2EAYA 5GMKl 1FX7A 3MO8A 1R0BG 3H6ZA 1I07A 2FZKB 3F70A 5GANg 2ENMA 4M7AD 4J9FA 2JM9A 2HZYA 2XDDA 1RLPC 2LT1A 1W4SA 1IZ6A 2AKKA 4LDVA 1AWOA 2FRYA 5CQYA 2AK5A 4FYVB 1JB0E 3MEVA 4JRQA 3M53A 4AG2C 4HXJA 1D3BA 2J6KA 3ZFJA 3PVQA 1CKBA 2VASA 5DLQE 4EMKC 1M90C 3DKMA 5D6XA 2FRWA 2O31A 2FL7A 2E6NA 2KXCA 1W2BA 2DYBA 4KH0B 5CK9A 2LX7A 5KYUB 1RUWA 5IHNA 5LJ3j 5GAN3 1KHIA 2HQXA 1FMWA 1UE9A 4R55A 2OTLQ 4N0AC 2PVGB 2ZPFB 3I5RA 5LJ3f 4C5GA 2XICA 2AHJB 2E4HA 4X9DA 5DLOA 3SD4A 1VQ4Q 1YITT 1PNJA 2CZ6B 3WVDB 3CPWS 3BE3A 2LQNA 1N8RC 1VOMA 2VB6A 3CD6A 4OB1B 4PK4A 1UGSB 4C92C 5EG2A 4FU6A 3R6OA 4BE1A 5GANj 3RMSA 4RCCA 4PFOA 1Q95G 1KHCA 4A54A 4J8OA 3J7AF 4KULA 1EX4A 2LNVA 1DJ7B 1T3LA 1E6HA 3QZ9B 5KE3A 1G3SA 2DEUA 4XTZA 3CMEA 3LGLA 1QP2A 3M56A 3OS0A 1VQ7A 1OZ3A 2OTLT 1VQOQ 2VYTA 2FPEA 2FPFA 4OMLA 3VS7A 1SF9A 3QJYA 3FJ5A 2DYIA 1H8KA 1VQ4T 5IN1A 5GAMg 1P92A 1MUZA 1OULA 1I81A 1K9MU 1AVZC 3CC4A 4MDXA 3MP1A 2ZAEA 4E6RA 4D8DA 1QVFP 2QYZA 2QEXQ 4DA4A 2NWMA 2K6DA 1ZQ1A 2YRVA 1JBMA 4M75C 1M90R 3JCMW 2OX7A 1PM3A 2CUBA 2EQKA 2DFUA 3PT9A 1PG5B 4IIOA 4C8QC 2EPDA 2VV5A 1B34A 1NZ9A 2EQJA 5GAN6 2MI6A 2F69A 3TREA 3P8HA 4QQDA 1NPRA 2JW4A 1VQOT 1Q86U 1RAEB 1AZGB 2VXEA 4LDWA 1B7TA 4YTLA 1GCQC 1D0XA 1UEBA 5CIUA 4XTXA 3INZA 4ORZA 1KC8U 1EZZB 1N8RR 3OS5A 3M5AA 3UPUA 2QA4T 4XTWA 4M78E 3CCMT 3C94A 4EMKB 4M7AA 3CC2Q 2L3PA 2QEXT 3PIOA 1RACB 2EBPA 1UGRB 3EGXA 5GMKi 5GAMj 2JTEA 3A1PA 3OSSC 1NM7A 2LT4A 2QXFA 4Z88A 3TU4K 4J9GA 5FWBA 4IUPA 3EH2A 2DIQA 4E7SA 2D8JA 1WJQA 5GAMf 4ME7A 1YJ9Q 1D1BA 5LJ5e 5C0MA 1LOJA 4OF1A 1PD0A 3MEUA 4E47A 4F17A 3VYHB 3ASKA 3UATA 3JB9J 3QWXX 4C92B 4K11A 5FU6C 3LWHA 4PNOA 2QQ9A 3OYBA 1GFDA 2EJFA 2OTLA 4MMLA 2YSQA 1K9MC 2F2XA 1VQ9Q 1VYUA 4B9WA 1SHGA 2BE7D 3UA7A 1VQ4A 2JTFA 5CR2A 4J6WA 2W10A 1ZUYA 5KYUA 1PC0A 3GLXA 2CT4A 2DEQA 2BKDN 2NUTB 2K2MA 1OQKA 2EWNA 1BIBA 1M1FA 3EG9B 4C92D 3G6EQ 1TSFA 3OW2P 3OYAA 1YJ9T 4MZTA 4R56A 3CXCP 4C92G 5D6YA 2DILA 1RI0A 5GAN2 2GTJA 5GANe 1Q86C 4E7KA 2CREA 1UJ0A 2I2LA 2RQTA 1VQ5A 3RR6A 5M9OA 5L8RE 2MYSA 1QVGA 4ZTJA 1KC8C 4M75B 4OB0B 4DOVA 2RHYA 3HPWA 4M78B 4L6V5 2XU8A 1VQ9T 3JSCA 4C8QB 3VU3C 2DNUA 2DRMA 1Q82U 5LJ5h 2M16A 3KXTA 1WPYA 3JB9G 1NPPA 4M7DC 3QKJA 4KGXB 1G3YA 4MZMA 4XTVA 1SHFA 2M1HA 1G5VA 4M77E 1BKBA 3G6ET 2CP5A 3ZBDA 4RUGA 1JO8A 2QEXA 1CSKA 1XTDA 3TSWA 4M75D 3HRTA 2PUKB 2AZSA 3FJPA 4JDSA 4DQ2A 5I11A 4A63B 4CC4B 3OS2A 4C8QD 2F2VA 4M78G 4IUQA 3BDLA 1IO6A 1ABOA 3J80E 1VIEA 1OPLA 1YWPA 2RQRA 3KUFA 1GXIE 1S1NA 2EQMA 2YLBA 3NMZC 2K9GA 1PD1A 1BI0A 2RHIA 1PKTA 2P84A 2DERA 1K9MR 2C06A 4E2FB 2DXUA 1M9SA 1PCXA 3OYCA 3QBYA 3I56Q 3OS1A 4GY5A 4BB7A 3HFOA 1BI1A 2D9TA 5GANh 2XDBA 2EKHA 4AMCA 2AKLA 2RQUA 3CC2A 2CP6A 1S72Q 2J05A 1VIFA 2EYZA 2X35A 1RL2A 4E7HA 4E7ZA 2QQSA 4J5YA 2RQWA 4F7UB 1VQKT 4L5GA 4BDYA 4PJOC 3OMGA 1Q86R 3EG2A 4BI4A 1Q81U 1WHGA 5FU6B 2QQRA 4HA8A 2HDAA 2J06A 4LXCA 3EG0A 4EMKA 2DL4A 2MCNA 2RJCA 4OB3B 2DVEA 1U3OA 2G3RA 3M4GA 1M2VB 2YLCA 1VQPQ 1JJ2A 1WHMA 2E6ZA 4PFPA 4XTYA 2ED0A 3I56T 3SEMA 1M8MA 2VGMA 1WXTA 2J7IA 5DM7R 2HQEA 1MMGA 4OP0A 3LLRA 1VYVA 1Q82C 3CBPA 4XAXB 4J9EA 1QKWA 3QG1A 2RPNA 4N0AA 4PJMA 2DX1A 2JNGA 2KRMA 4J7FA 4X34A 3L2UA 3M0TA 1OOTA 2DD4A 2LCLA 1QMCA 1BIAA 3MPUB 1UGQB 1IRXA 2CP3A 2DZ9A 1J3TA 4DEXA 2DTHA 1Z9ZA 4J6XA 2KNBB 2DL7A 8ATCB 4BI8B 4ZGEB 5IXFA 2HAXA 2JN0A 4HCZA 4PJJA 4IURA 3CCVQ 3OMCA 4C92A 4RMOA 2MPXC 3X26B 1FMKA 3A8OB 3M0UA 3EFRA 2FVUA 1RAIB 2PU9B 2YUPA 5GJWB 2MK5A 2FPDA 1VYTA 2O2OA 1U1TA 3PTAA 2CGHA 4CC3A 1OU9A 4M7DB 2DF6A 2V8KA 3CCJQ 2DZCA 2ZGWA 2V1QA 2RHZA 3DLLA 2V1RA 1GBQA 2NUTA 4E7JA 2EGEA 4JJBA 2MWPA 4MMKA 1XNIA 2MWOA 3EG9A 1V76A 3QDFA 1X6OA 4NOYA 2YRCA 4ZNXA 5CKDA 2ATCB 1OX9A 3CC4Q 4HT8A 3CQTA 5LJ5d 1TTHB 1WA7A 3VKIA 1ACMB 4M7DD 2LC4A 3CCVT 2DJZA 4ANJA 3G4SQ 1WQ7A 1I5OB 3JB9I 1Q81C 2ZPIB 1NG2A 3H0IA 4N4GA 4M75A 1G3WA 4MDWA 4Y92A 1M1KU 4XU0A 3CMET 1YJNQ 5KCHA 3TEEA 2L2PA 3AHUA 1X2KA 1VQ7T 4C8QA 2YUNA 1QVFA 4A4HA 2RM4A 4CC2A 2FO0A 4UC4A 1NE8A 4ZGJB 3L42A 4GLKA 1UFFA 4FL6A 1WI7A 2JTMA 1K8AR 1Q82R 2RB6A 5GAN8 2GQVA 4AG1C 2QGGA 2H8HA 1VQ6Q 1GCQA 3NTHA 1X01A 4J9DA 3X20B 2DXCA 2LX9A 2RK1A 3LX7A 3CC4T 4PJOB 1I5LA 3I56A 4NL3A 4LDXA 1UHFA 1VQNQ 1OV3A 1QCFA 2VWFA 2COWA 2PQWA 1RAGB 1WFWA 2RN8A 3FB9A 4HKEA 5GANd 3G1JA 2QDYB 2A36A 2XMFA 5I2SA 3EFSA 2HQHA 3C12A 1AT1B 5GAOm 1S72A 2DLPA 2DXTA 2ED1A 1YJNT 1BK2A 4ZTFA 2C0TA 1AZEA 2JT4A 1TWBA 2E10A 3ZEHA 1JJ2P 4FYYB 1WIEA 2ZPGB 4OGCA 5A0DA 4D8KA 3CEYA 1VQMQ 3PGGA 1UDLA 2COYA 4XTUA 2YRDA 5IXBA 3RKYA 5KYXB 4PJOG 2PVOB 3KBGA 2E12A 3CXCS 2QTXA 1WXUA 2LJ3A 2IVWA 1ZLMA 1CKAA 1VQPA 1YCYA 2ZPBB 4F7UA 1VQNT 3V7CA 1D1AA 3REBB 3JV3A 2WSEE 4HVUA 1RAAB 1X75C 1HSQA 1K0XA 2L3RA 1KD1U 2KAFA 3PMIA 1C0MA 4QVZA 1ZBJA 5GMKm 2YWWA 4C5HA 2VXFA 4LDYA 1RLQC 4RTXA 1Q81R 1ZA1B 4LE9A 4JS4A 3GOXA 4C92F 3VS4A 1M2VA 1V1CA 3QZ5B 1M1KC 3AT1B 2IG0A 1YJWA 1SG5A 3URGA 5I2MA 1V29B 3CCVA 1VQMT 1YHQA 3M55A 5FU7C 3I35A 1WJSA 5HK0A 1VQ5Q 1K73U 1PWTA 3OW2A 1MMDA 1H92A 2HBWA 3JCMg 2P4RA 2HSEB 2EKOA 3CXCA 1I0CA 2QG9B 3TCJA 3VS6A 3CCJA 2DBKA 4BUGA 2MF2A 3JB9F 3A8HB 4AFQC 2DA9A 1YFNA 2KYMA 3QXEB 2FZGB 4JPBW 1ZSZC 4FSXA 4EMHA 4IUUA 1QW1A 3OY9A 3A5ZB 4Z02A 3A8LB 1D0ZA 2E3IA 3M0PA 2XIDA 3OYMA 1Y0MA 4GBQA 5KYYB 3JCMX 2O4XB 4KRTA 4LUEA 3OYNA 3RIRA 4Q5WA 2KR3A 4BY6B 2KRSA 4M7DA 4M75F 2R57A 3META 4M78F 4M78C 4RG8A 2LDMA 5GAOq 3CCQQ 2NUPB 3G4SA 2EYQA 2OAWA 4C8QF 2CSIA 2CP7A 2FYKA 1B3QA 1YN8A 2R5MA 3CCRQ 2WACA 3HP9A 3O8VA 1VUBA 5AT1B 1VQ5T 2QK0A 4RTTA 4ELYC 3NPFA 1YJNA 4JZ4A 4II1A 3VUZA 2GQIA 5LL6S 2CUDA 3FIFA 3I55Q 3CCLQ 3MEWA 4A4GA 2K3BA 1W1FA 1MHNA 4KGVB 2KROA 3QSUA 1VQ6A 2KRNA 2PUOB 6AT1B 1KD1C 2M51A 3VS3A 1ZUKA 1Y71A 4LN2A 4MZPA 2AIRB 3OYIA 3GBQA 1W6XA 2EJGA 3QIIA 3CCSQ 1M1KR 1QLYA 1VQNA 2FB7A 4C0DC 2YUQA 5IT9E 1YIJA 2QQAA 3RBBB 3JCMf 1LJOA 2QTVA 3I5SA 4ESRA 1KQSP 1E7OA 4C0GA 2H3EB 3EH1A 4J9BA 5CO7A 1PRLC 5GAOn 4ZN1A 5I21A 4PJOA 2X4WA 3VJPA 4BACA 1WHJA 2JM8A 4OGEA 3EGDB 1K73C 3HL8A 3EAEA 3CCLT 3NGPA 1VQMA 3QYHB 3M4YA 2DKGA 1RI9A 3X28B 4F7UF 1QVGS 2EQIA 2L3SA 3PFSA 2O88A 4BD3A 2E70A 4XU1A 4AFUC 4RTUA 3H41A 2DETA 1T0JA 3GIBA 2KT1A 5LJ3e 3CC2T 3C0CA 2ZPEB 3TQ7P 3CCST 3UA6A 3ZL7C 2OJ2A 2K5FA 1YP5A 5FU7B 1K4US 1UHCA 5KYXA 4LDUA 2WSFE 1R0CB 3J81E 3KFVA 2K2VA 2EJ9A 2V8IA 1BU1A 5A0LA 4C0FA 1Y57A 5GJVB 4QW2A 2NLUA 1XQHA 3L2WA 1ZSZB 1KJWA 2X4JA 3DLMA 4M77C 3FRNA 5GMKj 5I22A 2DIGA 1NBEB 3QUIA 2R5AA 2A0FB 1LNXA 4BDZA 1I1JA 1UG1A 1KD1R 2DE0X 4QQ6A 4A4KA 1AWXA 3OYKA 3L2VA 2GFAA 5CKEA 5FROA 3V8KA 2JZ2A 1PSFA 3JCMJ 2K7AA 2LJ1A 2RK2A 3JB9D 2KY9A 1SEMA 3MHXA 1K1ZA 1OI1A 4QKUA 3GPLA 3MJXA 1Z9QA 4M7DF 4GLMA 4C5EA 1PKSA 4IUTA 3CPWP 4O6JA 3VRYA 1WDXA 8AT1B 2MMPA 1AD5A 2RJEA 4HVVA 3GNFB 3S3NA 3OYHA 1QQJA 2P0PA 1WYXA 1K73R 5KE2A 3BFMA 5LJ3h 4M78D 3X24B 3CCQA 3WXMB 2K3XA 4JRIA 4LD6A 5HKCA 2SEMA 2CDTA 4KT0E 3CCRA 5KYNA 4JLIA 1VA7A 1NJIU 3OYYA 5KYYA 3A98A 2O4XA 2K79A 7AT1B 2L3QA 1JJ2S 2FG0A 4C0DB 3CMAQ 3I55A 4PLIA 1ZX6A 1VQLQ 2CS7A 3CCLA 2XD0A 3RMQA 2NUPA 2ABLA 3V7RA 5J26A 2O01E 3HHTB 1VQ8Q 2HKQB 4NL2A 1N6AA 2Y4YA 1WNLA 1T3SA 2GTOA 3PNWC 1D3BB 4JRPA 2RJFA 3CCSA 4J7IA 1K76A 2BIVA 1MV0B 1U5SA 2OTJQ 3M59A 2COZA 1SRLA 3JCMe 4M7AC 4JLGA 4PJOF 4R0KA 4WCIA 5KYWB 3TSZA 1U1SA 3VRZA 1H3ZA 5GAMe 2F1LA 1ZBXA 4EIKA 5CQXA 2FZCB 1KC8R 1MNEA 3CMAT 1QCOA 3BY7A 1WHKA 2G6FX 2M9UA 3EHRA 2E41A 1WQWA 1H3HA 2KBTA 3ULRB 2A7YA 2BTTA 3ER0A 1NLPC 1BYMA 4Y91A 2DD5A 1RADB 4M7AE 2HL5C 1I8FA 1TUGB 2RNAA 3NTKA 1S72T 2C0OA 4JZ3A 4Z89A 4M77B 5KH6A 2OTJT 1EIFA 3EGDA 3M58A 3ME9A 1FWZA 2RO0A 1AHJB 3SDZA 1YJWQ 4EDUA 2EIFA 4XU2A 3SB2A 3NTIA 3QO3A 1R77A 1UTIA 2E65A 3CCUQ 4KUDK 2HEQA 5IHKA 1YHQQ 1G8XA 4OMQA 2CSQA 1OPKA 3CPFA 1QVFS 4J9HA 1NJIC 4J83A 3V8LA 3N5BB 3CBOA 4HCKA 2YT6A 1PSEA 1VQPT 4N4HA 2ROTA 2P4TA 3NFCA 1ZHIA 4XK8E 1OYXA 4M77G 3JCMh 3UF4A 4FW1A 3CC7Q 1YI2Q 1M90U 3CCEQ 1E6GA 5CVIA 5GAMh 3FC3A 1UUEA 1OZ2A 3U23A 3VV0A 2O9SA 1GRIA 1X6GA 3REAB 4LUDA 2KXDA 4E7LA 1YJWT 2F5TX 5DY9A 5CAIA 2NUZA 3MCAB 5FLXE 2V26A 2GCXA 1OU8A 1YHQT 2L8DA 2HSPA 2EYYA 2VKNA 4JJCA 2XG8D 2AZVA 3OBWA 1M2OA 5LJ5g 1N27A 3HRUA 4M78A 3DB4A 5GAOl 1X2QA 1UGPB 5LJ3d 1UECA 4J6YA 3BW1A 1IHWA 2D0NA 3CCJT 2OAUA 1TH7A 4BY6C 1Y96B 1WHLA 3QDRB 3E9GA 1PRMC 2YDLA 4BE2A 2J6FA 2A37A 1YI2T 1ABQA 2HMAA 1U8RA 2LZ6B 4F04B 4M7AB 3JAME 3CMAA 2KVQG 1QCNA 1A0NB 1VQLA 1FXXA 5IH2A 2KGTA 5GAN7 2MIOA 3S3OA 2M0OA 2DL8A 3VYGA 2BE9B 1M3CA 3H0HA 3G4ST 3O5ZA 1VQ8A 1YIJQ 2VGNA 3PVLA 2W0ZA 2ZZDA 2RF0A 5ECAA 3OYFA 4LNPA 1X6BA 1NJIR 2OTJA 1NEBA 3LW5E 2M02A 5CKBA 4QQGA 4EPCA 1YITQ 4PJOD 4M7AG 5A2QE 1G3TA 3H8ZA 3QWYA 1IGQA 1KQSA 3OW2S 4HT9A 1JXOA 5LJ5j 2LRQA 3G71Q 5J3BA 3V7SA 1VQ6T 1GBRA 5A0GA 3OYEA 5FRNA 3RKXA 4B6MA 1ZA2B 1HYOA 4N4IA 3EHQA 3OA6A 4FYXB 3HFNA 2CKKA 5LJ5f 2JOYA 1JQQA 5KYWA 2XKOC 4X9CA 1FYNA 1YIJT 4KUIA 2CZ0B 5C6SA 3GNGA 1KSWA 1GFCA 2F5KA 1Q7YU 2KT8A 1UB4A 4JS5A 4O5VA 4OMOA 1YCSB 1SPKA 2F2WA 3VS2A 1O75A 3HTRA 3CCUA 3OYLA 3MKDA 2I0NA 2DJQA 4OMPA 2M0YA 1M30A 2Z0WA 1OEBA 3RUXA 1WJRA 1QP3A 2YXYA 3G71T 3C4SA 3EFOB 2K5IA 4A4EA 1KIKA 3LH0A 4M77A 3VS5A 1UJYA 1XJWB 1HJDA 5IHIA 4RTYA 2GBQA 2JMCA 4DBQA 4DOWA 2EFIA 3HKSA 3JCMd 1M8VA 2X9HA 4FYWB 2PTKA 2EVRA 5GANf 2C0IA 4QT7A 3CC7A 1YI2A 1TU0B 3X25B 3LWIA 1R8OB 2VVKA 3CCEA 4FT2A 3MP6A 5GAMd 1SSFA 3QJ6A 1W70A 3SHWA 4J9IA 2A28A 4IIMA 2CH4A 4CRIA 2XDPA 4CI0C
chains in the Genus database with same CATH topology
4C92E 2CZ1B 2KSSA 2RJCA 2ZCFB 4OB3B 1M5Q1 1KQ2A 2DVEA 2X4JA 3DLMA 2G3RA 3M4GA 3S3MA 4M77C 5KCOA 3FRNA 5GMKj 3UWNA 2YLCA 3JB9H 5GAOp 1JJ2A 5GMKh 2EAYA 5GMKl 3HRSA 1FX7A 2E6ZA 2DIGA 4XTYA 3QUIA 3I56T 2R5AA 3MO8A 3CPWA 3H6ZA 4TVRA 2VGMA 1LNXA 4BDZA 3F70A 2E5QA 2B8AA 2GF7A 2HQEA 5DM7R 3FDRA 5GANg 4M7AD 4OP0A 4QQ6A 3LLRA 2XDDA 1Q82C 2LT1A 4A4KA 3CBPA 4XAXB 1W4SA 3OYKA 3L2VA 2GFAA 1IZ6A 3QHSA 4LDVA 5CKEA 2R58A 3QG1A 4N0AA 5FROA 3V8KA 2JNGA 2JZ2A 4J7FA 4X34A 1PSFA 3L2UA 5CQYA 3JCMJ 2DD4A 2LCLA 2RK2A 1JB0E 3MEVA 1BIAA 4FM4B 4JRQA 3JCMP 3JB9D 5AYFA 1UGQB 2KY9A 2DZ9A 2PVDB 3M53A 2DTHA 3MHXA 2LQKA 1D3BA 1OI1A 1M1GA 3GPLA 3ZFJA 4J6XA 3GF5A 4M7DF 1N9RA 3L2RA 4L59A 5DLQE 4C5EA 4BI8B 4EMKC 1M90C 3SWNC 3DKMA 5D6XA 4ZGEB 2HAXA 2JN0A 4HCZA 4IUTA 4IURA 2FL7A 3OMCA 2E6NA 4O6JA 4C92A 4RMOA 1W2BA 2MMPA 3X26B 2RJEA 3A8OB 4ZN3A 3UDCA 4BI3A 4WF2A 2D0QB 3GNFB 3S3NA 1Q7YC 5CK9A 3OYHA 3EFRA 2FVUA 2P0PA 2BUDA 2P0QA 4QVDA 2PU9B 5LJ3j 5GAN3 3CCQT 1Y96A 5KE2A 3BFMA 5LJ3h 4M78D 3X24B 1U1TA 3PTAA 3CCQA 1KHIA 2HQXA 3WXMB 2CGHA 2K3XA 3OQ5A 4M75E 3CCRT 4JRIA 4LD6A 5HKCA 4M7DB 4KT0E 4ELZC 3CCRA 2V8KA 2DZCA 4JLIA 4R55A 2ZGWA 4N0AC 2PVGB 2ZPFB 4C8QE 1NJIU 3OYYA 5LJ3f 4C5GA 2XICA 2O4XA 2AHJB 2RHZA 3DLLA 4X9DA 4JUVA 4E7JA 5DLOA 3E1SA 4FT4A 1JJ2S 3SD4A 1YITT 3I55T 2MWPA 4MMKA 3OYJA 2CZ6B 1XNIA 3WVDB 2KMTA 2MWOA 4C0DB 4PLIA 3I55A 3CPWS 3M9QA 1YITA 1X6OA 4NOYA 1N8RC 2CS7A 3CCLA 2XD0A 3RMQA 3CD6A 4IKFA 4OB1B 4OVAA 5CKDA 1UGSB 4RKUE 5EG2A 4C92C 3G71A 3V7RA 4HT8A 4FU6A 3R6OA 5LJ5d 5J26A 4BE1A 3VKIA 5GANj 2O01E 3HHTB 4M7DD 3RMSA 2LC4A 4NL2A 3CCVT 1N6AA 2DJZA 1WNLA 2Y4YA 4RCCA 2XI9A 4HCBA 1WQ7A 1KHCA 3PNWC 4A54A 1D3BB 4JRPA 2FHDA 4J8OA 2RJFA 3J7AF 4KULA 3JB9I 1Q81C 2ZPIB 4J7IA 4N4GA 3CCSA 4E7IA 2LNVA 2DXBA 4M75A 4BE0A 1DJ7B 1G3WA 2BIVA 3QZ9B 3M59A 3MEAA 4MDWA 4XU0A 1M1KU 3CMET 5KE3A 3JCMe 1G3SA 4M7AC 3CBMA 4XTZA 5KCHA 2RH2A 3TEEA 3CMEA 3AHUA 1VQ7T 4JLGA 4C8QA 3LGLA 1QP2A 3M56A 3OS0A 1QVFA 4PJOF 4A4HA 1VQ7A 2RM4A 4UC4A 1OZ3A 2OTLT 1NE8A 4ZGJB 1U1SA 3L42A 2VYTA 4XU3A 4GLKA 1H3ZA 5GAMe 4FL6A 3QJYA 1ZBXA 2K5LA 5CQXA 2JTMA 1VQ4T 5IN1A 2VUBA 2RB6A 5GAN8 5GAMg 1P92A 2GQVA 3CMAT 5HY6A 3BY7A 2M9UA 4M77F 2X4YA 3G7ZA 1I81A 3NTHA 1X01A 5CCAA 2HNIA 3X20B 2DXCA 2LX9A 2RK1A 3LX7A 2E41A 3CC4T 1WQWA 4B9XA 1K9MU 4PJOB 1I5LA 3CC4A 4MDXA 3T9NA 3MP1A 2CYZB 3I56A 4NL3A 4LDXA 4IUVA 4DA4A 2A7YA 2YRVA 3ER0A 1ZQ1A 4M75C 1JBMA 1BYMA 4F7UE 4Y91A 3JCMW 2PQWA 1MGQA 2DD5A 2LCCA 5GAN5 3JCMb 4M7AE 1I8FA 3FB9A 2EQKA 4HKEA 5GANd 2LVMA 3PT9A 4C8QC 2QDYB 3NTKA 1S72T 5I2SA 3EFSA 1BI2A 3C12A 4M77B 5GAOm 5KH6A 1S72A 2VV5A 1H641 2OTJT 1EIFA 3M58A 3LGFA 2DXTA 1B34A 1NZ9A 1YJNT 3ME9A 1FWZA 2RO0A 2EQJA 1AHJB 4ZTFA 2DK3A 5GAN6 2MI6A 2JVVA 3SDZA 2F69A 3TREA 2E10A 2EIFA 3ZEHA 4EDUA 4XU2A 3SB2A 3NTIA 3QO3A 2E65A 3P8HA 4QQDA 4OGCA 2ZPGB 1NPRA 1VQOT 4KUDK 2XK0A 1Q86U 5A0DA 3CEYA 2DTOA 2YHTA 1VQOA 1VQPA 2VXEA 3PGGA 4XTUA 4LDWA 4YTLA 3RKYA 3CPFA 4PJOG 1QVFS 1UEBA 2KK4A 2PVOB 5CIUA 4XTXA 1QVPA 2EQUA 2E12A 3KBGA 3INZA 4J83A 3OYDA 3V8LA 3A8GB 3CXCS 2QTXA 3N5BB 1K8AU 3CBOA 4KBMB 1KC8U 2DPPB 1PSEA 2IVWA 3OS5A 1YBYA 4Y28E 4N4HA 1VQPT 3M5AA 3UPUA 2QA4T 4OB2B 2JUFA 1YCYA 4XTWA 2P4TA 4M78E 3C94A 2ZPBB 1ZHIA 3NFCA 4RCBA 4F7UA 4XK8E 3CCMT 3QPHA 4EMKB 2QA4A 2KDSA 3SWNB 3CCMA 1OYXA 4M7AA 4M77G 3JCMh 2QI2A 2QEXT 1VQNT 3PIOA 3V7CA 2WSEE 1X75C 4JJNK 1UGRB 4C0ZA 3JRZA 2L3RA 1KD1U 2KAFA 3PMIA 1M90U 4QVZA 5GMKi 5GMKm 4C5HA 4FIBA 5GAMj 5FRMA 2VXFA 4LDYA 3OSSC 5CVIA 5GAMh 4M75G 3FC3A 3RERA 2LT4A 2RJDA 1OZ2A 3VV0A 2A3LA 1Y7XA 4JS4A 3L1AA 3GOXA 2QXFA 4C92F 1HXDA 5GAOr 2RI3A 3UT1A 3TU4K 3A8MB 4IUPA 2DIQA 4C8QG 4E7LA 1YJWT 2F5TX 5DY9A 3QZ5B 5CAIA 1M1KC 1WJQA 1IREB 2IG0A 3JCMQ 3MCAB 1YJWA 5GAMf 5FLXE 2GCXA 4ME7A 1I4K1 3URGA 5LJ5e 5I2MA 1V29B 2L8DA 1YHQT 5C0MA 1LOJA 3CCVA 1VQMT 4OF1A 2RHUA 1YHQA 2XG8D 4M7DE 4PL6A 3Q1JA 4ATOA 3MEUA 3M55A 3OBWA 5FU7C 5LJ5g 2RA2A 3E9FA 4E47A 1N27A 2D6FA 1WJSA 2E64A 3HRUA 3VYHB 4M7AF 4M78A 3ASKA 3DB4A 4RG2A 3JB9J 3P8DA 5HK0A 5GAOl 4C92B 1K73U 1UGPB 5LJ3d 4J6YA 3OW2A 2E1HA 3BW1A 5FU6C 2LQ8A 3JCMg 3LWHA 4PNOA 3CCJT 2K3YA 2EKOA 2OAUA 2QQ9A 3OYBA 3CXCA 1TH7A 2EJFA 3LYIA 4PLLA 3TCJA 4BY6C 5IAYA 3CCJA 4HCCA 3V8JA 4BUGA 2OTLA 4MMLA 5J39A 2MF2A 3JB9F 3A8HB 2L89A 1Y96B 3QXEB 3QDRB 1K9MC 3E9GA 4FSXA 2VC8A 1O9SA 4B9WA 4BE2A 4EMHA 4IUUA 1QW1A 3JCMV 2KQWA 1YI2T 1VQ4A 3OY9A 3A5ZB 2JTFA 4Z02A 5CR2A 4J6WA 1U8RA 3A8LB 2XIDA 4VUBA 3CMAA 3JAME 4M7AB 1VQLT 3OYMA 4P5NA 2KVQG 1WGSA 3GP8A 3GLXA 3JCMX 1FXXA 2O4XB 1VQLA 2DEQA 5CKHA 5GAN7 3JCMc 3S3OA 2BKDN 3OYNA 2EWNA 2LTOA 3OBYA 3RIRA 1BIBA 4Q5WA 1M1FA 2M0OA 5D6WA 4BY6B 4C92D 2P0KA 4M7DA 4M75F 3VYGA 3OYAA 1YJ9T 1VQ8T 4MZTA 4R56A 2R57A 3META 3G4ST 1N9SA 4M78F 4M78C 1YJ9A 1VQ8A 4C92G 5D6YA 4RG8A 2LDMA 5GAOq 3G4SA 2EYQA 2VGNA 2L5QA 2ZPHB 4C8QF 1RI0A 5GAN2 2ZZDA 3DB3A 2FYKA 2R5MA 3OB9A 2DAQA 3OYFA 2WACA 5GANe 1Q86C 2Y90A 4QVCA 4E7KA 3HP9A 4C5IA 3O8VA 1M4ZA 1VUBA 5HK3A 2OTJA 3LW5E 1VQ5T 4ELYC 2I2LA 1YJNA 1VQ5A 2WSCE 5CKBA 1XOVA 4II1A 3VUZA 5M9OA 1K8AC 2V8JA 4QQGA 5L8RE 5LL6S 4EPCA 3FIFA 4F7UG 4ZTJA 1QVGA 1KC8C 4M75B 4PJOD 4OB0B 4DOVA 5A2QE 4M7AG 2HD0A 2RHYA 3HPWA 4M78B 4NS5A 4L6V5 1G3TA 2RHXA 3H8ZA 2XU8A 1VQ9T 3MEWA 4A4GA 4PJOE 1HK9A 3JSCA 4C8QB 3OW2S 1KQSA 3VU3C 1VQ9A 4HT9A 5LJ5j 2LRQA 5J3BA 1Q82U 3V7SA 1MHNA 2MAMA 2M16A 5LJ5h 3PIPA 3KXTA 5A0GA 1VQ6T 1WPYA 3OYEA 1NPPA 2RI2A 3JB9G 4M7DC 3QSUA 1VQ6A 2PUOB 4PKCC 2RI5A 3RKXA 1KD1C 3QKJA 5FRNA 4M77D 1G3YA 2GFUA 4N4IA 4MZMA 1Y71A 5CKFA 3OA6A 4MZPA 3OYIA 4XTVA 3PMTA 2M1HA 1G5VA 4M77E 3HFNA 2CKKA 1BKBA 2EJGA 5LJ5f 2JOYA 3QIIA 3ZBDA 3G6ET 5GMKe 2H3JA 3G6EA 3OSVA 2QEXA 1VQNA 2XKOC 4X9CA 2FB7A 4C0DC 3S6WA 1YIJT 1XTDA 3M54A 4KUIA 4M75D 2CZ0B 5IT9E 1YIJA 2QQAA 3HRTA 2PUKB 5C6SA 3FJPA 4JDSA 4DQ2A 3GNGA 3P8BB 1LJOA 3JCMf 3C95A 3OS2A 3WVEB 4C8QD 2F5KA 4M78G 4C0GA 1Q7YU 4IUQA 3BDLA 1UB4A 5CO7A 4JS5A 3QYGB 3J80E 3FEOA 1VIEA 4O5VA 3FLGA 5GAOn 2K4YA 4ZN1A 3KUFA 3CCUT 2RD1A 5I21A 1O75A 4PJOA 2X4WA 2EQMA 3VJPA 1GXIE 4BACA 2YLBA 4OGEA 3CCUA 1K73C 2QQBA 3HL8A 1BI0A 2RHIA 3MP8A 3OYLA 1B34B 3EAEA 3CCLT 1VQMA 3QYHB 3CD6T 3RUXA 3VUBA 3M4YA 2DKGA 1WJRA 4EMGA 3X28B 1QP3A 2C06A 1Y07A 3G71T 4F7UF 1KG1A 5GAN4 2DXUA 1QVGS 3HSBA 2X4XA 3C4SA 2K57A 3PFSA 1M9SA 3OYCA 3QBYA 4BD3A 2K5IA 2E70A 4A4EA 4XU1A 3OS1A 1KQ1A 2CZ7B 3LH0A 4M77A 4GY5A 4BB7A 2HBPA 1BI1A 3HFOA 1KQSS 1JRIA 2D9TA 1N8RU 3GIBA 5GANh 4XQ3A 5LJ3e 2XDBA 3CC2T 4A4FA 4DOWA 2ZPEB 2EFIA 3OYGA 3CCST 4M7DG 3HKSA 3CC2A 3JCMd 1M8VA 2K5FA 1VIFA 4JRKA 5LJ3g 3BDUA 2X35A 1RL2A 2DO3A 3E19A 5FU7B 4E7HA 3SFMA 3CC7T 4ZGDB 5GANf 2QQSA 4A53A 4J5YA 3CC7A 2Y4XA 4F7UB 1YI2A 1W2BS 1VQKT 4OMFB 3CCET 3X25B 1BI3A 3LWIA 1R8OB 4L5GA 2WSFE 4LDUA 1VQKA 3CCEA 4BDYA 4FT2A 3J81E 3MP6A 1NJIC 4PJOC 3OMGA 2K2VA 3L2ZA 1SSFA 3M57A 4D6WA 4BI4A 3QJ6A 5GAMd 3L2QA 2EJ9A 2V8IA 5FU6B 2QQRA 1Q81U 5A0LA 4HA8A 3RESA 4C0FA 3RKWA 4QW2A 4CRIA 4V2SA 2NLUA 2XHCA 1XQHA 2XDPA 3L2WA 4EMKA 4CI0C 2DTIA 4LD9K 3SWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 E;  4PJO E;  3JB9 I;  1HK9 A;  1M5Q 1;  2DVE A;  4C8Q B;  5GMK i;  1KQ2 A;  3M4G A;  4M75 A;  3VU3 C;  4M77 C;  5GMK m;  5GAM j;  4HT9 A;  2VXF A;  5GMK j;  4XU0 A;  5LJ5 j;  2YLC A;  3JCM e;  5GAM h;  3JB9 H;  4M75 G;  4XTZ A;  3V7S A;  5GAO p;  3RER A;  5GMK h;  5LJ5 h;  2EAY A;  3AHU A;  1WPY A;  5GMK l;  3JB9 G;  4C8Q A;  4XTY A;  3L1A A;  3QSU A;  4M7D C;  3QUI A;  1HXD A;  3RKX A;  4C92 F;  5GAO r;  4PJO F;  2RM4 A;  4M77 D;  4C8Q G;  1LNX A;  5GAN g;  5DY9 A;  5CAI A;  4M7A D;  1U1S A;  4OP0 A;  4XTV A;  3JCM Q;  4XU3 A;  5GAM f;  4M77 E;  3HFN A;  5LJ5 f;  2EJG A;  1I4K 1;  5GAM e;  5GMK e;  5LJ5 e;  1LOJ A;  3QHS A;  4N0A A;  4X9C A;  2FB7 A;  3V8K A;  4M7D E;  2RB6 A;  3JCM J;  5GAN 8;  4M75 D;  5GAM g;  5LJ5 g;  3JCM P;  1BIA A;  3JB9 D;  3BY7 A;  2RA2 A;  3FJP A;  4M77 F;  4DQ2 A;  3JCM f;  1LJO A;  2DZ9 A;  2DTH A;  1I81 A;  2E64 A;  4M7A F;  4M78 A;  1D3B A;  1X01 A;  4C8Q D;  5GAO l;  3JB9 J;  2HNI A;  4J6X A;  4C92 B;  4M78 G;  2E41 A;  1N9R A;  1WQW A;  4M7D F;  5LJ3 d;  4PJO B;  4J6Y A;  2E1H A;  3BW1 A;  1I5L A;  3JCM g;  4EMK C;  4PNO A;  3SWN C;  4NL3 A;  2JN0 A;  1TH7 A;  2EJF A;  5GAO n;  4M75 C;  3V8J A;  4C92 A;  1JBM A;  2RD1 A;  4MML A;  5I21 A;  4PJO A;  4F7U E;  4Y91 A;  3JCM W;  3JB9 F;  1MGQ A;  2YLB A;  1Y96 B;  5GAN 5;  3JCM b;  4M7A E;  1I8F A;  4WF2 A;  3FB9 A;  5GAN d;  2VC8 A;  3EFR A;  1B34 B;  4C8Q C;  4EMH A;  3JCM V;  4QVD A;  3EFS A;  3RUX A;  5LJ3 j;  5GAN 3;  4M77 B;  4J6W A;  4EMG A;  2DKG A;  1Y96 A;  1H64 1;  3BFM A;  5GAO m;  5LJ3 h;  4M78 D;  1U1T A;  4F7U F;  4M7A B;  5GAN 4;  2DXU A;  3HSB A;  2DXT A;  2CGH A;  1B34 A;  4M75 E;  2K57 A;  4JRI A;  3JCM X;  5GAN 6;  2DEQ A;  4M7D B;  5GAN 7;  4XU1 A;  1KQ1 A;  4M77 A;  3JCM c;  2DZC A;  2E10 A;  2EWN A;  4JLI A;  2ZGW A;  3RIR A;  4N0A C;  4XU2 A;  3SB2 A;  3HFO A;  4C8Q E;  1BIB A;  3QO3 A;  2E65 A;  1JRI A;  5LJ3 f;  4C92 D;  3GIB A;  5GAN h;  4XQ3 A;  5LJ3 e;  4M7D A;  4X9D A;  4M75 F;  4JUV A;  2DTO A;  2YHT A;  2VXE A;  3PGG A;  4XTU A;  4M7D G;  1N9S A;  4M78 F;  4M78 C;  3JCM d;  4C92 G;  4M7A C;  4MMK A;  3RKY A;  5GAO q;  4PJO G;  1M8V A;  4JRK A;  5LJ3 g;  3BDU A;  4C8Q F;  4XTX A;  5GAN 2;  2FYK A;  3INZ A;  4NOY A;  3V8L A;  5GAN f;  2QTX A;  4A53 A;  4J5Y A;  5GAN e;  4F7U B;  2Y90 A;  4QVC A;  4C92 C;  4PJO C;  3V7R A;  4HT8 A;  2I2L A;  3L2Z A;  5GAM d;  1YCY A;  4XTW A;  4M78 E;  4RCB A;  5LJ5 d;  2EJ9 A;  4F7U A;  4EMK B;  3SWN B;  4HA8 A;  5GAN j;  4M7A A;  3RES A;  4M77 G;  3JCM h;  4M7D D;  3FIF A;  4NL2 A;  4F7U G;  2DJZ A;  4RCC A;  1WNL A;  3V7C A;  4M75 B;  3RKW A;  4PJO D;  4M7A G;  4V2S A;  1WQ7 A;  4A54 A;  4M78 B;  1D3B B;  4EMK A;  2DTI A;  3SWN A; 
#chains in the Genus database with same CATH topology
 4C92 E;  2KSS A;  2ZCF B;  1M5Q 1;  2MOX A;  1D0Y A;  3UWN A;  3HRS A;  2RMO A;  2GNC A;  2QA4 Q;  3CCM Q;  1PHT A;  3CPW A;  4AT1 B;  4TVR A;  2DL3 A;  1C1A A;  2E5Q A;  2B8A A;  2GF7 A;  3FDR A;  4KH1 B;  5FW9 A;  9ATC B;  2RQV A;  3QHS A;  2R58 A;  2DM1 A;  4JJD A;  3JCM P;  4FM4 B;  4FSS A;  5AYF A;  1JU5 C;  1T0H A;  2PVD B;  2A08 A;  2YUO A;  2LQK A;  1QKX A;  1M1G A;  2E5K A;  3THK A;  2CT3 A;  3GF5 A;  1N9R A;  2QDL A;  3L2R A;  4L59 A;  1F1B B;  1SRM A;  1IHV A;  3SWN C;  3EG1 A;  2KEA A;  2PNI A;  4DBR A;  1G83 A;  3UDC A;  4BI3 A;  4WF2 A;  2D0Q B;  1Q7Y C;  2BUD A;  2P0Q A;  4QVD A;  1X43 A;  3CCQ T;  1IGU A;  1Y96 A;  1IB8 A;  3OQ5 A;  4M75 E;  3CCR T;  3H0F A;  4ELZ C;  2HL3 A;  1BCM A;  4C8Q E;  5L23 A;  4JUV A;  3E1S A;  4FT4 A;  3I55 T;  1JEG A;  2EW3 A;  3OYJ A;  1W2B P;  1RAF B;  1YIT A;  2KMT A;  2OI3 A;  3M9Q A;  2X3X D;  4IKF A;  4OVA A;  1BB9 A;  3IQL A;  4RKU E;  3G71 A;  1MND A;  1NLO C;  1TG0 A;  4OMN A;  1YWO A;  2XI9 A;  1U06 A;  4HCB A;  1MMN A;  1LVK A;  1SKU B;  4FW2 A;  2FHD A;  2BZX A;  4E7I A;  2DXB A;  4BE0 A;  1FMV A;  4ATO A;  3MEA A;  2BZ8 A;  4RTW A;  3CBM A;  2RH2 A;  4J9C A;  3LH5 A;  2X3W D;  1WXB A;  2KE9 A;  4AFZ C;  1RAH B;  3D7S B;  4XU3 A;  2L0A A;  3M0S A;  3H9N A;  4F16 A;  2ECZ A;  2K5L A;  1M3B A;  2VUB A;  5HY6 A;  4M77 F;  2X4Y A;  3G7Z A;  5CCA A;  2HNI A;  2SRC A;  4RTV A;  1EFN A;  1AOJ A;  4B9X A;  3T9N A;  2B86 A;  2CYZ B;  3RDV A;  4IUV A;  2CH4 W;  2LQW A;  4F7U E;  1MGQ A;  2HKN A;  2LCC A;  5GAN 5;  3JCM b;  1WX6 A;  1GCP A;  2LVM A;  2X51 A;  1OX8 A;  1Q7Y R;  1BI2 A;  1H64 1;  1YNZ A;  3LGF A;  1C6V X;  2DK3 A;  2JVV A;  2QAZ A;  3VS1 A;  2NYS A;  3EFO A;  2XK0 A;  5EC7 A;  4RTZ A;  1VQO A;  2DTO A;  2YHT A;  1D1C A;  4X1V A;  2CP0 A;  2E3H A;  1D09 B;  2KK4 A;  3TVT A;  1QVP A;  2EQU A;  3OYD A;  3A8G B;  1K8A U;  4Z8A A;  4KBM B;  2DPP B;  1YBY A;  4Y28 E;  4OB2 B;  2JUF A;  4ZN3 A;  4RCB A;  1MV3 A;  2QA4 A;  3QPH A;  2KDS A;  3SWN B;  3CCM A;  2QI2 A;  2AT1 B;  2HCK A;  3I9Q A;  4JJN K;  4DBH A;  4C0Z A;  3JRZ A;  1NYG A;  2DRK A;  2LJ0 A;  4FIB A;  5FRM A;  1VQK Q;  1NEG A;  3RER A;  4M75 G;  2RJD A;  1KK7 A;  2A3L A;  1AWW A;  1Y7X A;  2DMO A;  3L1A A;  1MMA A;  5GAO r;  1HXD A;  2RI3 A;  3UT1 A;  3A8M B;  4OMM A;  4C8Q G;  3PE0 A;  2EYW A;  1IRE B;  4DEY A;  3JCM Q;  1I4K 1;  2DVJ A;  2RHU A;  1TS9 A;  1ZSG A;  2ROL A;  4M7D E;  4PL6 A;  3Q1J A;  1M27 C;  4AFS C;  1WZO A;  4WTO B;  2RA2 A;  3E9F A;  1AWJ A;  2D6F A;  2E64 A;  4M7A F;  4RG2 A;  3P8D A;  2ESW A;  2E1H A;  2LQ8 A;  4PJL A;  2K3Y A;  3LYI A;  4PLL A;  4HCC A;  5IAY A;  1QWE A;  3V8J A;  1NYF A;  5J39 A;  3NHN A;  1TUC A;  2L89 A;  3M0R A;  2VC8 A;  1O9S A;  1BCO A;  1BBZ A;  3JCM V;  2KQW A;  2KYB A;  2CP2 A;  4VUB A;  1VQL T;  2KI7 A;  4P5N A;  1WGS A;  3GP8 A;  5CKH A;  3E2U A;  3JCM c;  4CC7 A;  2LTO A;  3OBY A;  4KGZ B;  2D8H A;  5D6W A;  2LCS A;  1X69 A;  2P0K A;  1VQ8 T;  1N9S A;  1UGV A;  1YJ9 A;  2ZPH B;  2L5Q A;  3DB3 A;  2EGC A;  3OB9 A;  2DAQ A;  2Y90 A;  4QVC A;  4C5I A;  1M4Z A;  5HK3 A;  4HVW A;  2FEI A;  1N5Z A;  4DBF A;  2WSC E;  1B07 A;  1XOV A;  1ARK A;  3VS0 A;  1K8A C;  2V8J A;  2LNH B;  4F7U G;  1AEY A;  2DL5 A;  2HD0 A;  4NS5 A;  1K0S A;  2RHX A;  3CD6 Q;  4PJO E;  1HK9 A;  1VQ9 A;  2QGF B;  2LP5 A;  2JJ9 A;  2MAM A;  3PIP A;  2RI2 A;  4PKC C;  2PZ1 A;  2RI5 A;  4M77 D;  2GFU A;  3M0Q A;  5CKF A;  3PMT A;  5GMK e;  2H3J A;  3G6E A;  3OSV A;  1LPL A;  2JXB A;  1QVG P;  3S6W A;  3M54 A;  1K9A A;  3CME Q;  2JS0 A;  3P8B B;  1VQ7 Q;  3C95 A;  1KFZ A;  3WVE B;  1ZSZ A;  3EG3 A;  4PFZ A;  1LCK A;  1WHH A;  1ZUU A;  1HD3 A;  3QYG B;  3FEO A;  3FLG A;  2K4Y A;  1JXM A;  1TOV A;  2GGR A;  2RD1 A;  3CCU T;  2O9V A;  2LMJ A;  2QQB A;  3R6N A;  3MP8 A;  1B34 B;  1M3A A;  2EYX A;  2BZY A;  3CD6 T;  3VUB A;  5HCK A;  4EMG A;  1Y07 A;  2J6O A;  1KG1 A;  5GAN 4;  3HSB A;  2X4X A;  2IPO B;  2K57 A;  1TUD A;  3RNJ A;  1KQ1 A;  2CZ7 B;  1WLP B;  2HBP A;  1KQS S;  1JRI A;  4FCY A;  1N8R U;  2JMA A;  1TXQ A;  4XQ3 A;  1X27 A;  4A4F A;  3OYG A;  4F14 A;  4M7D G;  4JRK A;  1GL5 A;  5LJ3 g;  3BDU A;  3E19 A;  2DO3 A;  3CC7 T;  3SFM A;  4ZGD B;  1RAB B;  1G2B A;  5D7U A;  4A53 A;  2Y4X A;  2IIM A;  1W2B S;  4OMF B;  3CCE T;  1BI3 A;  1VQK A;  3L2Z A;  4D6W A;  3M57 A;  1SSH A;  3L2Q A;  2DBM A;  3RES A;  3EGX B;  4M4Z A;  5FWC A;  3RKW A;  4V2S A;  2XHC A;  2EGA A;  2DTI A;  4LD9 K;  3SWN A;  2CZ1 B;  3EGU A;  1KQ2 A;  2QAS A;  1IXD A;  3S3M A;  2D1X A;  5KCO A;  2JS2 A;  4PJN A;  3JB9 H;  5GAO p;  1QWF A;  5GMK h;  2EAY A;  5GMK l;  1FX7 A;  3MO8 A;  1R0B G;  3H6Z A;  1I07 A;  2FZK B;  3F70 A;  5GAN g;  2ENM A;  4M7A D;  4J9F A;  2JM9 A;  2HZY A;  2XDD A;  1RLP C;  2LT1 A;  1W4S A;  1IZ6 A;  2AKK A;  4LDV A;  1AWO A;  2FRY A;  5CQY A;  2AK5 A;  4FYV B;  1JB0 E;  3MEV A;  4JRQ A;  3M53 A;  4AG2 C;  4HXJ A;  1D3B A;  2J6K A;  3ZFJ A;  3PVQ A;  1CKB A;  2VAS A;  5DLQ E;  4EMK C;  1M90 C;  3DKM A;  5D6X A;  2FRW A;  2O31 A;  2FL7 A;  2E6N A;  2KXC A;  1W2B A;  2DYB A;  4KH0 B;  5CK9 A;  2LX7 A;  5KYU B;  1RUW A;  5IHN A;  5LJ3 j;  5GAN 3;  1KHI A;  2HQX A;  1FMW A;  1UE9 A;  4R55 A;  2OTL Q;  4N0A C;  2PVG B;  2ZPF B;  3I5R A;  5LJ3 f;  4C5G A;  2XIC A;  2AHJ B;  2E4H A;  4X9D A;  5DLO A;  3SD4 A;  1VQ4 Q;  1YIT T;  1PNJ A;  2CZ6 B;  3WVD B;  3CPW S;  3BE3 A;  2LQN A;  1N8R C;  1VOM A;  2VB6 A;  3CD6 A;  4OB1 B;  4PK4 A;  1UGS B;  4C92 C;  5EG2 A;  4FU6 A;  3R6O A;  4BE1 A;  5GAN j;  3RMS A;  4RCC A;  4PFO A;  1Q95 G;  1KHC A;  4A54 A;  4J8O A;  3J7A F;  4KUL A;  1EX4 A;  2LNV A;  1DJ7 B;  1T3L A;  1E6H A;  3QZ9 B;  5KE3 A;  1G3S A;  2DEU A;  4XTZ A;  3CME A;  3LGL A;  1QP2 A;  3M56 A;  3OS0 A;  1VQ7 A;  1OZ3 A;  2OTL T;  1VQO Q;  2VYT A;  2FPE A;  2FPF A;  4OML A;  3VS7 A;  1SF9 A;  3QJY A;  3FJ5 A;  2DYI A;  1H8K A;  1VQ4 T;  5IN1 A;  5GAM g;  1P92 A;  1MUZ A;  1OUL A;  1I81 A;  1K9M U;  1AVZ C;  3CC4 A;  4MDX A;  3MP1 A;  2ZAE A;  4E6R A;  4D8D A;  1QVF P;  2QYZ A;  2QEX Q;  4DA4 A;  2NWM A;  2K6D A;  1ZQ1 A;  2YRV A;  1JBM A;  4M75 C;  1M90 R;  3JCM W;  2OX7 A;  1PM3 A;  2CUB A;  2EQK A;  2DFU A;  3PT9 A;  1PG5 B;  4IIO A;  4C8Q C;  2EPD A;  2VV5 A;  1B34 A;  1NZ9 A;  2EQJ A;  5GAN 6;  2MI6 A;  2F69 A;  3TRE A;  3P8H A;  4QQD A;  1NPR A;  2JW4 A;  1VQO T;  1Q86 U;  1RAE B;  1AZG B;  2VXE A;  4LDW A;  1B7T A;  4YTL A;  1GCQ C;  1D0X A;  1UEB A;  5CIU A;  4XTX A;  3INZ A;  4ORZ A;  1KC8 U;  1EZZ B;  1N8R R;  3OS5 A;  3M5A A;  3UPU A;  2QA4 T;  4XTW A;  4M78 E;  3CCM T;  3C94 A;  4EMK B;  4M7A A;  3CC2 Q;  2L3P A;  2QEX T;  3PIO A;  1RAC B;  2EBP A;  1UGR B;  3EGX A;  5GMK i;  5GAM j;  2JTE A;  3A1P A;  3OSS C;  1NM7 A;  2LT4 A;  2QXF A;  4Z88 A;  3TU4 K;  4J9G A;  5FWB A;  4IUP A;  3EH2 A;  2DIQ A;  4E7S A;  2D8J A;  1WJQ A;  5GAM f;  4ME7 A;  1YJ9 Q;  1D1B A;  5LJ5 e;  5C0M A;  1LOJ A;  4OF1 A;  1PD0 A;  3MEU A;  4E47 A;  4F17 A;  3VYH B;  3ASK A;  3UAT A;  3JB9 J;  3QWX X;  4C92 B;  4K11 A;  5FU6 C;  3LWH A;  4PNO A;  2QQ9 A;  3OYB A;  1GFD A;  2EJF A;  2OTL A;  4MML A;  2YSQ A;  1K9M C;  2F2X A;  1VQ9 Q;  1VYU A;  4B9W A;  1SHG A;  2BE7 D;  3UA7 A;  1VQ4 A;  2JTF A;  5CR2 A;  4J6W A;  2W10 A;  1ZUY A;  5KYU A;  1PC0 A;  3GLX A;  2CT4 A;  2DEQ A;  2BKD N;  2NUT B;  2K2M A;  1OQK A;  2EWN A;  1BIB A;  1M1F A;  3EG9 B;  4C92 D;  3G6E Q;  1TSF A;  3OW2 P;  3OYA A;  1YJ9 T;  4MZT A;  4R56 A;  3CXC P;  4C92 G;  5D6Y A;  2DIL A;  1RI0 A;  5GAN 2;  2GTJ A;  5GAN e;  1Q86 C;  4E7K A;  2CRE A;  1UJ0 A;  2I2L A;  2RQT A;  1VQ5 A;  3RR6 A;  5M9O A;  5L8R E;  2MYS A;  1QVG A;  4ZTJ A;  1KC8 C;  4M75 B;  4OB0 B;  4DOV A;  2RHY A;  3HPW A;  4M78 B;  4L6V 5;  2XU8 A;  1VQ9 T;  3JSC A;  4C8Q B;  3VU3 C;  2DNU A;  2DRM A;  1Q82 U;  5LJ5 h;  2M16 A;  3KXT A;  1WPY A;  3JB9 G;  1NPP A;  4M7D C;  3QKJ A;  4KGX B;  1G3Y A;  4MZM A;  4XTV A;  1SHF A;  2M1H A;  1G5V A;  4M77 E;  1BKB A;  3G6E T;  2CP5 A;  3ZBD A;  4RUG A;  1JO8 A;  2QEX A;  1CSK A;  1XTD A;  3TSW A;  4M75 D;  3HRT A;  2PUK B;  2AZS A;  3FJP A;  4JDS A;  4DQ2 A;  5I11 A;  4A63 B;  4CC4 B;  3OS2 A;  4C8Q D;  2F2V A;  4M78 G;  4IUQ A;  3BDL A;  1IO6 A;  1ABO A;  3J80 E;  1VIE A;  1OPL A;  1YWP A;  2RQR A;  3KUF A;  1GXI E;  1S1N A;  2EQM A;  2YLB A;  3NMZ C;  2K9G A;  1PD1 A;  1BI0 A;  2RHI A;  1PKT A;  2P84 A;  2DER A;  1K9M R;  2C06 A;  4E2F B;  2DXU A;  1M9S A;  1PCX A;  3OYC A;  3QBY A;  3I56 Q;  3OS1 A;  4GY5 A;  4BB7 A;  3HFO A;  1BI1 A;  2D9T A;  5GAN h;  2XDB A;  2EKH A;  4AMC A;  2AKL A;  2RQU A;  3CC2 A;  2CP6 A;  1S72 Q;  2J05 A;  1VIF A;  2EYZ A;  2X35 A;  1RL2 A;  4E7H A;  4E7Z A;  2QQS A;  4J5Y A;  2RQW A;  4F7U B;  1VQK T;  4L5G A;  4BDY A;  4PJO C;  3OMG A;  1Q86 R;  3EG2 A;  4BI4 A;  1Q81 U;  1WHG A;  5FU6 B;  2QQR A;  4HA8 A;  2HDA A;  2J06 A;  4LXC A;  3EG0 A;  4EMK A;  2DL4 A;  2MCN A;  2RJC A;  4OB3 B;  2DVE A;  1U3O A;  2G3R A;  3M4G A;  1M2V B;  2YLC A;  1VQP Q;  1JJ2 A;  1WHM A;  2E6Z A;  4PFP A;  4XTY A;  2ED0 A;  3I56 T;  3SEM A;  1M8M A;  2VGM A;  1WXT A;  2J7I A;  5DM7 R;  2HQE A;  1MMG A;  4OP0 A;  3LLR A;  1VYV A;  1Q82 C;  3CBP A;  4XAX B;  4J9E A;  1QKW A;  3QG1 A;  2RPN A;  4N0A A;  4PJM A;  2DX1 A;  2JNG A;  2KRM A;  4J7F A;  4X34 A;  3L2U A;  3M0T A;  1OOT A;  2DD4 A;  2LCL A;  1QMC A;  1BIA A;  3MPU B;  1UGQ B;  1IRX A;  2CP3 A;  2DZ9 A;  1J3T A;  4DEX A;  2DTH A;  1Z9Z A;  4J6X A;  2KNB B;  2DL7 A;  8ATC B;  4BI8 B;  4ZGE B;  5IXF A;  2HAX A;  2JN0 A;  4HCZ A;  4PJJ A;  4IUR A;  3CCV Q;  3OMC A;  4C92 A;  4RMO A;  2MPX C;  3X26 B;  1FMK A;  3A8O B;  3M0U A;  3EFR A;  2FVU A;  1RAI B;  2PU9 B;  2YUP A;  5GJW B;  2MK5 A;  2FPD A;  1VYT A;  2O2O A;  1U1T A;  3PTA A;  2CGH A;  4CC3 A;  1OU9 A;  4M7D B;  2DF6 A;  2V8K A;  3CCJ Q;  2DZC A;  2ZGW A;  2V1Q A;  2RHZ A;  3DLL A;  2V1R A;  1GBQ A;  2NUT A;  4E7J A;  2EGE A;  4JJB A;  2MWP A;  4MMK A;  1XNI A;  2MWO A;  3EG9 A;  1V76 A;  3QDF A;  1X6O A;  4NOY A;  2YRC A;  4ZNX A;  5CKD A;  2ATC B;  1OX9 A;  3CC4 Q;  4HT8 A;  3CQT A;  5LJ5 d;  1TTH B;  1WA7 A;  3VKI A;  1ACM B;  4M7D D;  2LC4 A;  3CCV T;  2DJZ A;  4ANJ A;  3G4S Q;  1WQ7 A;  1I5O B;  3JB9 I;  1Q81 C;  2ZPI B;  1NG2 A;  3H0I A;  4N4G A;  4M75 A;  1G3W A;  4MDW A;  4Y92 A;  1M1K U;  4XU0 A;  3CME T;  1YJN Q;  5KCH A;  3TEE A;  2L2P A;  3AHU A;  1X2K A;  1VQ7 T;  4C8Q A;  2YUN A;  1QVF A;  4A4H A;  2RM4 A;  4CC2 A;  2FO0 A;  4UC4 A;  1NE8 A;  4ZGJ B;  3L42 A;  4GLK A;  1UFF A;  4FL6 A;  1WI7 A;  2JTM A;  1K8A R;  1Q82 R;  2RB6 A;  5GAN 8;  2GQV A;  4AG1 C;  2QGG A;  2H8H A;  1VQ6 Q;  1GCQ A;  3NTH A;  1X01 A;  4J9D A;  3X20 B;  2DXC A;  2LX9 A;  2RK1 A;  3LX7 A;  3CC4 T;  4PJO B;  1I5L A;  3I56 A;  4NL3 A;  4LDX A;  1UHF A;  1VQN Q;  1OV3 A;  1QCF A;  2VWF A;  2COW A;  2PQW A;  1RAG B;  1WFW A;  2RN8 A;  3FB9 A;  4HKE A;  5GAN d;  3G1J A;  2QDY B;  2A36 A;  2XMF A;  5I2S A;  3EFS A;  2HQH A;  3C12 A;  1AT1 B;  5GAO m;  1S72 A;  2DLP A;  2DXT A;  2ED1 A;  1YJN T;  1BK2 A;  4ZTF A;  2C0T A;  1AZE A;  2JT4 A;  1TWB A;  2E10 A;  3ZEH A;  1JJ2 P;  4FYY B;  1WIE A;  2ZPG B;  4OGC A;  5A0D A;  4D8K A;  3CEY A;  1VQM Q;  3PGG A;  1UDL A;  2COY A;  4XTU A;  2YRD A;  5IXB A;  3RKY A;  5KYX B;  4PJO G;  2PVO B;  3KBG A;  2E12 A;  3CXC S;  2QTX A;  1WXU A;  2LJ3 A;  2IVW A;  1ZLM A;  1CKA A;  1VQP A;  1YCY A;  2ZPB B;  4F7U A;  1VQN T;  3V7C A;  1D1A A;  3REB B;  3JV3 A;  2WSE E;  4HVU A;  1RAA B;  1X75 C;  1HSQ A;  1K0X A;  2L3R A;  1KD1 U;  2KAF A;  3PMI A;  1C0M A;  4QVZ A;  1ZBJ A;  5GMK m;  2YWW A;  4C5H A;  2VXF A;  4LDY A;  1RLQ C;  4RTX A;  1Q81 R;  1ZA1 B;  4LE9 A;  4JS4 A;  3GOX A;  4C92 F;  3VS4 A;  1M2V A;  1V1C A;  3QZ5 B;  1M1K C;  3AT1 B;  2IG0 A;  1YJW A;  1SG5 A;  3URG A;  5I2M A;  1V29 B;  3CCV A;  1VQM T;  1YHQ A;  3M55 A;  5FU7 C;  3I35 A;  1WJS A;  5HK0 A;  1VQ5 Q;  1K73 U;  1PWT A;  3OW2 A;  1MMD A;  1H92 A;  2HBW A;  3JCM g;  2P4R A;  2HSE B;  2EKO A;  3CXC A;  1I0C A;  2QG9 B;  3TCJ A;  3VS6 A;  3CCJ A;  2DBK A;  4BUG A;  2MF2 A;  3JB9 F;  3A8H B;  4AFQ C;  2DA9 A;  1YFN A;  2KYM A;  3QXE B;  2FZG B;  4JPB W;  1ZSZ C;  4FSX A;  4EMH A;  4IUU A;  1QW1 A;  3OY9 A;  3A5Z B;  4Z02 A;  3A8L B;  1D0Z A;  2E3I A;  3M0P A;  2XID A;  3OYM A;  1Y0M A;  4GBQ A;  5KYY B;  3JCM X;  2O4X B;  4KRT A;  4LUE A;  3OYN A;  3RIR A;  4Q5W A;  2KR3 A;  4BY6 B;  2KRS A;  4M7D A;  4M75 F;  2R57 A;  3MET A;  4M78 F;  4M78 C;  4RG8 A;  2LDM A;  5GAO q;  3CCQ Q;  2NUP B;  3G4S A;  2EYQ A;  2OAW A;  4C8Q F;  2CSI A;  2CP7 A;  2FYK A;  1B3Q A;  1YN8 A;  2R5M A;  3CCR Q;  2WAC A;  3HP9 A;  3O8V A;  1VUB A;  5AT1 B;  1VQ5 T;  2QK0 A;  4RTT A;  4ELY C;  3NPF A;  1YJN A;  4JZ4 A;  4II1 A;  3VUZ A;  2GQI A;  5LL6 S;  2CUD A;  3FIF A;  3I55 Q;  3CCL Q;  3MEW A;  4A4G A;  2K3B A;  1W1F A;  1MHN A;  4KGV B;  2KRO A;  3QSU A;  1VQ6 A;  2KRN A;  2PUO B;  6AT1 B;  1KD1 C;  2M51 A;  3VS3 A;  1ZUK A;  1Y71 A;  4LN2 A;  4MZP A;  2AIR B;  3OYI A;  3GBQ A;  1W6X A;  2EJG A;  3QII A;  3CCS Q;  1M1K R;  1QLY A;  1VQN A;  2FB7 A;  4C0D C;  2YUQ A;  5IT9 E;  1YIJ A;  2QQA A;  3RBB B;  3JCM f;  1LJO A;  2QTV A;  3I5S A;  4ESR A;  1KQS P;  1E7O A;  4C0G A;  2H3E B;  3EH1 A;  4J9B A;  5CO7 A;  1PRL C;  5GAO n;  4ZN1 A;  5I21 A;  4PJO A;  2X4W A;  3VJP A;  4BAC A;  1WHJ A;  2JM8 A;  4OGE A;  3EGD B;  1K73 C;  3HL8 A;  3EAE A;  3CCL T;  3NGP A;  1VQM A;  3QYH B;  3M4Y A;  2DKG A;  1RI9 A;  3X28 B;  4F7U F;  1QVG S;  2EQI A;  2L3S A;  3PFS A;  2O88 A;  4BD3 A;  2E70 A;  4XU1 A;  4AFU C;  4RTU A;  3H41 A;  2DET A;  1T0J A;  3GIB A;  2KT1 A;  5LJ3 e;  3CC2 T;  3C0C A;  2ZPE B;  3TQ7 P;  3CCS T;  3UA6 A;  3ZL7 C;  2OJ2 A;  2K5F A;  1YP5 A;  5FU7 B;  1K4U S;  1UHC A;  5KYX A;  4LDU A;  2WSF E;  1R0C B;  3J81 E;  3KFV A;  2K2V A;  2EJ9 A;  2V8I A;  1BU1 A;  5A0L A;  4C0F A;  1Y57 A;  5GJV B;  4QW2 A;  2NLU A;  1XQH A;  3L2W A;  1ZSZ B;  1KJW A;  2X4J A;  3DLM A;  4M77 C;  3FRN A;  5GMK j;  5I22 A;  2DIG A;  1NBE B;  3QUI A;  2R5A A;  2A0F B;  1LNX A;  4BDZ A;  1I1J A;  1UG1 A;  1KD1 R;  2DE0 X;  4QQ6 A;  4A4K A;  1AWX A;  3OYK A;  3L2V A;  2GFA A;  5CKE A;  5FRO A;  3V8K A;  2JZ2 A;  1PSF A;  3JCM J;  2K7A A;  2LJ1 A;  2RK2 A;  3JB9 D;  2KY9 A;  1SEM A;  3MHX A;  1K1Z A;  1OI1 A;  4QKU A;  3GPL A;  3MJX A;  1Z9Q A;  4M7D F;  4GLM A;  4C5E A;  1PKS A;  4IUT A;  3CPW P;  4O6J A;  3VRY A;  1WDX A;  8AT1 B;  2MMP A;  1AD5 A;  2RJE A;  4HVV A;  3GNF B;  3S3N A;  3OYH A;  1QQJ A;  2P0P A;  1WYX A;  1K73 R;  5KE2 A;  3BFM A;  5LJ3 h;  4M78 D;  3X24 B;  3CCQ A;  3WXM B;  2K3X A;  4JRI A;  4LD6 A;  5HKC A;  2SEM A;  2CDT A;  4KT0 E;  3CCR A;  5KYN A;  4JLI A;  1VA7 A;  1NJI U;  3OYY A;  5KYY A;  3A98 A;  2O4X A;  2K79 A;  7AT1 B;  2L3Q A;  1JJ2 S;  2FG0 A;  4C0D B;  3CMA Q;  3I55 A;  4PLI A;  1ZX6 A;  1VQL Q;  2CS7 A;  3CCL A;  2XD0 A;  3RMQ A;  2NUP A;  2ABL A;  3V7R A;  5J26 A;  2O01 E;  3HHT B;  1VQ8 Q;  2HKQ B;  4NL2 A;  1N6A A;  2Y4Y A;  1WNL A;  1T3S A;  2GTO A;  3PNW C;  1D3B B;  4JRP A;  2RJF A;  3CCS A;  4J7I A;  1K76 A;  2BIV A;  1MV0 B;  1U5S A;  2OTJ Q;  3M59 A;  2COZ A;  1SRL A;  3JCM e;  4M7A C;  4JLG A;  4PJO F;  4R0K A;  4WCI A;  5KYW B;  3TSZ A;  1U1S A;  3VRZ A;  1H3Z A;  5GAM e;  2F1L A;  1ZBX A;  4EIK A;  5CQX A;  2FZC B;  1KC8 R;  1MNE A;  3CMA T;  1QCO A;  3BY7 A;  1WHK A;  2G6F X;  2M9U A;  3EHR A;  2E41 A;  1WQW A;  1H3H A;  2KBT A;  3ULR B;  2A7Y A;  2BTT A;  3ER0 A;  1NLP C;  1BYM A;  4Y91 A;  2DD5 A;  1RAD B;  4M7A E;  2HL5 C;  1I8F A;  1TUG B;  2RNA A;  3NTK A;  1S72 T;  2C0O A;  4JZ3 A;  4Z89 A;  4M77 B;  5KH6 A;  2OTJ T;  1EIF A;  3EGD A;  3M58 A;  3ME9 A;  1FWZ A;  2RO0 A;  1AHJ B;  3SDZ A;  1YJW Q;  4EDU A;  2EIF A;  4XU2 A;  3SB2 A;  3NTI A;  3QO3 A;  1R77 A;  1UTI A;  2E65 A;  3CCU Q;  4KUD K;  2HEQ A;  5IHK A;  1YHQ Q;  1G8X A;  4OMQ A;  2CSQ A;  1OPK A;  3CPF A;  1QVF S;  4J9H A;  1NJI C;  4J83 A;  3V8L A;  3N5B B;  3CBO A;  4HCK A;  2YT6 A;  1PSE A;  1VQP T;  4N4H A;  2ROT A;  2P4T A;  3NFC A;  1ZHI A;  4XK8 E;  1OYX A;  4M77 G;  3JCM h;  3UF4 A;  4FW1 A;  3CC7 Q;  1YI2 Q;  1M90 U;  3CCE Q;  1E6G A;  5CVI A;  5GAM h;  3FC3 A;  1UUE A;  1OZ2 A;  3U23 A;  3VV0 A;  2O9S A;  1GRI A;  1X6G A;  3REA B;  4LUD A;  2KXD A;  4E7L A;  1YJW T;  2F5T X;  5DY9 A;  5CAI A;  2NUZ A;  3MCA B;  5FLX E;  2V26 A;  2GCX A;  1OU8 A;  1YHQ T;  2L8D A;  2HSP A;  2EYY A;  2VKN A;  4JJC A;  2XG8 D;  2AZV A;  3OBW A;  1M2O A;  5LJ5 g;  1N27 A;  3HRU A;  4M78 A;  3DB4 A;  5GAO l;  1X2Q A;  1UGP B;  5LJ3 d;  1UEC A;  4J6Y A;  3BW1 A;  1IHW A;  2D0N A;  3CCJ T;  2OAU A;  1TH7 A;  4BY6 C;  1Y96 B;  1WHL A;  3QDR B;  3E9G A;  1PRM C;  2YDL A;  4BE2 A;  2J6F A;  2A37 A;  1YI2 T;  1ABQ A;  2HMA A;  1U8R A;  2LZ6 B;  4F04 B;  4M7A B;  3JAM E;  3CMA A;  2KVQ G;  1QCN A;  1A0N B;  1VQL A;  1FXX A;  5IH2 A;  2KGT A;  5GAN 7;  2MIO A;  3S3O A;  2M0O A;  2DL8 A;  3VYG A;  2BE9 B;  1M3C A;  3H0H A;  3G4S T;  3O5Z A;  1VQ8 A;  1YIJ Q;  2VGN A;  3PVL A;  2W0Z A;  2ZZD A;  2RF0 A;  5ECA A;  3OYF A;  4LNP A;  1X6B A;  1NJI R;  2OTJ A;  1NEB A;  3LW5 E;  2M02 A;  5CKB A;  4QQG A;  4EPC A;  1YIT Q;  4PJO D;  4M7A G;  5A2Q E;  1G3T A;  3H8Z A;  3QWY A;  1IGQ A;  1KQS A;  3OW2 S;  4HT9 A;  1JXO A;  5LJ5 j;  2LRQ A;  3G71 Q;  5J3B A;  3V7S A;  1VQ6 T;  1GBR A;  5A0G A;  3OYE A;  5FRN A;  3RKX A;  4B6M A;  1ZA2 B;  1HYO A;  4N4I A;  3EHQ A;  3OA6 A;  4FYX B;  3HFN A;  2CKK A;  5LJ5 f;  2JOY A;  1JQQ A;  5KYW A;  2XKO C;  4X9C A;  1FYN A;  1YIJ T;  4KUI A;  2CZ0 B;  5C6S A;  3GNG A;  1KSW A;  1GFC A;  2F5K A;  1Q7Y U;  2KT8 A;  1UB4 A;  4JS5 A;  4O5V A;  4OMO A;  1YCS B;  1SPK A;  2F2W A;  3VS2 A;  1O75 A;  3HTR A;  3CCU A;  3OYL A;  3MKD A;  2I0N A;  2DJQ A;  4OMP A;  2M0Y A;  1M30 A;  2Z0W A;  1OEB A;  3RUX A;  1WJR A;  1QP3 A;  2YXY A;  3G71 T;  3C4S A;  3EFO B;  2K5I A;  4A4E A;  1KIK A;  3LH0 A;  4M77 A;  3VS5 A;  1UJY A;  1XJW B;  1HJD A;  5IHI A;  4RTY A;  2GBQ A;  2JMC A;  4DBQ A;  4DOW A;  2EFI A;  3HKS A;  3JCM d;  1M8V A;  2X9H A;  4FYW B;  2PTK A;  2EVR A;  5GAN f;  2C0I A;  4QT7 A;  3CC7 A;  1YI2 A;  1TU0 B;  3X25 B;  3LWI A;  1R8O B;  2VVK A;  3CCE A;  4FT2 A;  3MP6 A;  5GAM d;  1SSF A;  3QJ6 A;  1W70 A;  3SHW A;  4J9I A;  2A28 A;  4IIM A;  2CH4 A;  4CRI A;  2XDP A;  4CI0 C; 
#chains in the Genus database with same CATH homology
 4C92 E;  2CZ1 B;  2KSS A;  2RJC A;  2ZCF B;  4OB3 B;  1M5Q 1;  1KQ2 A;  2DVE A;  2X4J A;  3DLM A;  2G3R A;  3M4G A;  3S3M A;  4M77 C;  5KCO A;  3FRN A;  5GMK j;  3UWN A;  2YLC A;  3JB9 H;  5GAO p;  1JJ2 A;  5GMK h;  2EAY A;  5GMK l;  3HRS A;  1FX7 A;  2E6Z A;  2DIG A;  4XTY A;  3QUI A;  3I56 T;  2R5A A;  3MO8 A;  3CPW A;  3H6Z A;  4TVR A;  2VGM A;  1LNX A;  4BDZ A;  3F70 A;  2E5Q A;  2B8A A;  2GF7 A;  2HQE A;  5DM7 R;  3FDR A;  5GAN g;  4M7A D;  4OP0 A;  4QQ6 A;  3LLR A;  2XDD A;  1Q82 C;  2LT1 A;  4A4K A;  3CBP A;  4XAX B;  1W4S A;  3OYK A;  3L2V A;  2GFA A;  1IZ6 A;  3QHS A;  4LDV A;  5CKE A;  2R58 A;  3QG1 A;  4N0A A;  5FRO A;  3V8K A;  2JNG A;  2JZ2 A;  4J7F A;  4X34 A;  1PSF A;  3L2U A;  5CQY A;  3JCM J;  2DD4 A;  2LCL A;  2RK2 A;  1JB0 E;  3MEV A;  1BIA A;  4FM4 B;  4JRQ A;  3JCM P;  3JB9 D;  5AYF A;  1UGQ B;  2KY9 A;  2DZ9 A;  2PVD B;  3M53 A;  2DTH A;  3MHX A;  2LQK A;  1D3B A;  1OI1 A;  1M1G A;  3GPL A;  3ZFJ A;  4J6X A;  3GF5 A;  4M7D F;  1N9R A;  3L2R A;  4L59 A;  5DLQ E;  4C5E A;  4BI8 B;  4EMK C;  1M90 C;  3SWN C;  3DKM A;  5D6X A;  4ZGE B;  2HAX A;  2JN0 A;  4HCZ A;  4IUT A;  4IUR A;  2FL7 A;  3OMC A;  2E6N A;  4O6J A;  4C92 A;  4RMO A;  1W2B A;  2MMP A;  3X26 B;  2RJE A;  3A8O B;  4ZN3 A;  3UDC A;  4BI3 A;  4WF2 A;  2D0Q B;  3GNF B;  3S3N A;  1Q7Y C;  5CK9 A;  3OYH A;  3EFR A;  2FVU A;  2P0P A;  2BUD A;  2P0Q A;  4QVD A;  2PU9 B;  5LJ3 j;  5GAN 3;  3CCQ T;  1Y96 A;  5KE2 A;  3BFM A;  5LJ3 h;  4M78 D;  3X24 B;  1U1T A;  3PTA A;  3CCQ A;  1KHI A;  2HQX A;  3WXM B;  2CGH A;  2K3X A;  3OQ5 A;  4M75 E;  3CCR T;  4JRI A;  4LD6 A;  5HKC A;  4M7D B;  4KT0 E;  4ELZ C;  3CCR A;  2V8K A;  2DZC A;  4JLI A;  4R55 A;  2ZGW A;  4N0A C;  2PVG B;  2ZPF B;  4C8Q E;  1NJI U;  3OYY A;  5LJ3 f;  4C5G A;  2XIC A;  2O4X A;  2AHJ B;  2RHZ A;  3DLL A;  4X9D A;  4JUV A;  4E7J A;  5DLO A;  3E1S A;  4FT4 A;  1JJ2 S;  3SD4 A;  1YIT T;  3I55 T;  2MWP A;  4MMK A;  3OYJ A;  2CZ6 B;  1XNI A;  3WVD B;  2KMT A;  2MWO A;  4C0D B;  4PLI A;  3I55 A;  3CPW S;  3M9Q A;  1YIT A;  1X6O A;  4NOY A;  1N8R C;  2CS7 A;  3CCL A;  2XD0 A;  3RMQ A;  3CD6 A;  4IKF A;  4OB1 B;  4OVA A;  5CKD A;  1UGS B;  4RKU E;  5EG2 A;  4C92 C;  3G71 A;  3V7R A;  4HT8 A;  4FU6 A;  3R6O A;  5LJ5 d;  5J26 A;  4BE1 A;  3VKI A;  5GAN j;  2O01 E;  3HHT B;  4M7D D;  3RMS A;  2LC4 A;  4NL2 A;  3CCV T;  1N6A A;  2DJZ A;  1WNL A;  2Y4Y A;  4RCC A;  2XI9 A;  4HCB A;  1WQ7 A;  1KHC A;  3PNW C;  4A54 A;  1D3B B;  4JRP A;  2FHD A;  4J8O A;  2RJF A;  3J7A F;  4KUL A;  3JB9 I;  1Q81 C;  2ZPI B;  4J7I A;  4N4G A;  3CCS A;  4E7I A;  2LNV A;  2DXB A;  4M75 A;  4BE0 A;  1DJ7 B;  1G3W A;  2BIV A;  3QZ9 B;  3M59 A;  3MEA A;  4MDW A;  4XU0 A;  1M1K U;  3CME T;  5KE3 A;  3JCM e;  1G3S A;  4M7A C;  3CBM A;  4XTZ A;  5KCH A;  2RH2 A;  3TEE A;  3CME A;  3AHU A;  1VQ7 T;  4JLG A;  4C8Q A;  3LGL A;  1QP2 A;  3M56 A;  3OS0 A;  1QVF A;  4PJO F;  4A4H A;  1VQ7 A;  2RM4 A;  4UC4 A;  1OZ3 A;  2OTL T;  1NE8 A;  4ZGJ B;  1U1S A;  3L42 A;  2VYT A;  4XU3 A;  4GLK A;  1H3Z A;  5GAM e;  4FL6 A;  3QJY A;  1ZBX A;  2K5L A;  5CQX A;  2JTM A;  1VQ4 T;  5IN1 A;  2VUB A;  2RB6 A;  5GAN 8;  5GAM g;  1P92 A;  2GQV A;  3CMA T;  5HY6 A;  3BY7 A;  2M9U A;  4M77 F;  2X4Y A;  3G7Z A;  1I81 A;  3NTH A;  1X01 A;  5CCA A;  2HNI A;  3X20 B;  2DXC A;  2LX9 A;  2RK1 A;  3LX7 A;  2E41 A;  3CC4 T;  1WQW A;  4B9X A;  1K9M U;  4PJO B;  1I5L A;  3CC4 A;  4MDX A;  3T9N A;  3MP1 A;  2CYZ B;  3I56 A;  4NL3 A;  4LDX A;  4IUV A;  4DA4 A;  2A7Y A;  2YRV A;  3ER0 A;  1ZQ1 A;  4M75 C;  1JBM A;  1BYM A;  4F7U E;  4Y91 A;  3JCM W;  2PQW A;  1MGQ A;  2DD5 A;  2LCC A;  5GAN 5;  3JCM b;  4M7A E;  1I8F A;  3FB9 A;  2EQK A;  4HKE A;  5GAN d;  2LVM A;  3PT9 A;  4C8Q C;  2QDY B;  3NTK A;  1S72 T;  5I2S A;  3EFS A;  1BI2 A;  3C12 A;  4M77 B;  5GAO m;  5KH6 A;  1S72 A;  2VV5 A;  1H64 1;  2OTJ T;  1EIF A;  3M58 A;  3LGF A;  2DXT A;  1B34 A;  1NZ9 A;  1YJN T;  3ME9 A;  1FWZ A;  2RO0 A;  2EQJ A;  1AHJ B;  4ZTF A;  2DK3 A;  5GAN 6;  2MI6 A;  2JVV A;  3SDZ A;  2F69 A;  3TRE A;  2E10 A;  2EIF A;  3ZEH A;  4EDU A;  4XU2 A;  3SB2 A;  3NTI A;  3QO3 A;  2E65 A;  3P8H A;  4QQD A;  4OGC A;  2ZPG B;  1NPR A;  1VQO T;  4KUD K;  2XK0 A;  1Q86 U;  5A0D A;  3CEY A;  2DTO A;  2YHT A;  1VQO A;  1VQP A;  2VXE A;  3PGG A;  4XTU A;  4LDW A;  4YTL A;  3RKY A;  3CPF A;  4PJO G;  1QVF S;  1UEB A;  2KK4 A;  2PVO B;  5CIU A;  4XTX A;  1QVP A;  2EQU A;  2E12 A;  3KBG A;  3INZ A;  4J83 A;  3OYD A;  3V8L A;  3A8G B;  3CXC S;  2QTX A;  3N5B B;  1K8A U;  3CBO A;  4KBM B;  1KC8 U;  2DPP B;  1PSE A;  2IVW A;  3OS5 A;  1YBY A;  4Y28 E;  4N4H A;  1VQP T;  3M5A A;  3UPU A;  2QA4 T;  4OB2 B;  2JUF A;  1YCY A;  4XTW A;  2P4T A;  4M78 E;  3C94 A;  2ZPB B;  1ZHI A;  3NFC A;  4RCB A;  4F7U A;  4XK8 E;  3CCM T;  3QPH A;  4EMK B;  2QA4 A;  2KDS A;  3SWN B;  3CCM A;  1OYX A;  4M7A A;  4M77 G;  3JCM h;  2QI2 A;  2QEX T;  1VQN T;  3PIO A;  3V7C A;  2WSE E;  1X75 C;  4JJN K;  1UGR B;  4C0Z A;  3JRZ A;  2L3R A;  1KD1 U;  2KAF A;  3PMI A;  1M90 U;  4QVZ A;  5GMK i;  5GMK m;  4C5H A;  4FIB A;  5GAM j;  5FRM A;  2VXF A;  4LDY A;  3OSS C;  5CVI A;  5GAM h;  4M75 G;  3FC3 A;  3RER A;  2LT4 A;  2RJD A;  1OZ2 A;  3VV0 A;  2A3L A;  1Y7X A;  4JS4 A;  3L1A A;  3GOX A;  2QXF A;  4C92 F;  1HXD A;  5GAO r;  2RI3 A;  3UT1 A;  3TU4 K;  3A8M B;  4IUP A;  2DIQ A;  4C8Q G;  4E7L A;  1YJW T;  2F5T X;  5DY9 A;  3QZ5 B;  5CAI A;  1M1K C;  1WJQ A;  1IRE B;  2IG0 A;  3JCM Q;  3MCA B;  1YJW A;  5GAM f;  5FLX E;  2GCX A;  4ME7 A;  1I4K 1;  3URG A;  5LJ5 e;  5I2M A;  1V29 B;  2L8D A;  1YHQ T;  5C0M A;  1LOJ A;  3CCV A;  1VQM T;  4OF1 A;  2RHU A;  1YHQ A;  2XG8 D;  4M7D E;  4PL6 A;  3Q1J A;  4ATO A;  3MEU A;  3M55 A;  3OBW A;  5FU7 C;  5LJ5 g;  2RA2 A;  3E9F A;  4E47 A;  1N27 A;  2D6F A;  1WJS A;  2E64 A;  3HRU A;  3VYH B;  4M7A F;  4M78 A;  3ASK A;  3DB4 A;  4RG2 A;  3JB9 J;  3P8D A;  5HK0 A;  5GAO l;  4C92 B;  1K73 U;  1UGP B;  5LJ3 d;  4J6Y A;  3OW2 A;  2E1H A;  3BW1 A;  5FU6 C;  2LQ8 A;  3JCM g;  3LWH A;  4PNO A;  3CCJ T;  2K3Y A;  2EKO A;  2OAU A;  2QQ9 A;  3OYB A;  3CXC A;  1TH7 A;  2EJF A;  3LYI A;  4PLL A;  3TCJ A;  4BY6 C;  5IAY A;  3CCJ A;  4HCC A;  3V8J A;  4BUG A;  2OTL A;  4MML A;  5J39 A;  2MF2 A;  3JB9 F;  3A8H B;  2L89 A;  1Y96 B;  3QXE B;  3QDR B;  1K9M C;  3E9G A;  4FSX A;  2VC8 A;  1O9S A;  4B9W A;  4BE2 A;  4EMH A;  4IUU A;  1QW1 A;  3JCM V;  2KQW A;  1YI2 T;  1VQ4 A;  3OY9 A;  3A5Z B;  2JTF A;  4Z02 A;  5CR2 A;  4J6W A;  1U8R A;  3A8L B;  2XID A;  4VUB A;  3CMA A;  3JAM E;  4M7A B;  1VQL T;  3OYM A;  4P5N A;  2KVQ G;  1WGS A;  3GP8 A;  3GLX A;  3JCM X;  1FXX A;  2O4X B;  1VQL A;  2DEQ A;  5CKH A;  5GAN 7;  3JCM c;  3S3O A;  2BKD N;  3OYN A;  2EWN A;  2LTO A;  3OBY A;  3RIR A;  1BIB A;  4Q5W A;  1M1F A;  2M0O A;  5D6W A;  4BY6 B;  4C92 D;  2P0K A;  4M7D A;  4M75 F;  3VYG A;  3OYA A;  1YJ9 T;  1VQ8 T;  4MZT A;  4R56 A;  2R57 A;  3MET A;  3G4S T;  1N9S A;  4M78 F;  4M78 C;  1YJ9 A;  1VQ8 A;  4C92 G;  5D6Y A;  4RG8 A;  2LDM A;  5GAO q;  3G4S A;  2EYQ A;  2VGN A;  2L5Q A;  2ZPH B;  4C8Q F;  1RI0 A;  5GAN 2;  2ZZD A;  3DB3 A;  2FYK A;  2R5M A;  3OB9 A;  2DAQ A;  3OYF A;  2WAC A;  5GAN e;  1Q86 C;  2Y90 A;  4QVC A;  4E7K A;  3HP9 A;  4C5I A;  3O8V A;  1M4Z A;  1VUB A;  5HK3 A;  2OTJ A;  3LW5 E;  1VQ5 T;  4ELY C;  2I2L A;  1YJN A;  1VQ5 A;  2WSC E;  5CKB A;  1XOV A;  4II1 A;  3VUZ A;  5M9O A;  1K8A C;  2V8J A;  4QQG A;  5L8R E;  5LL6 S;  4EPC A;  3FIF A;  4F7U G;  4ZTJ A;  1QVG A;  1KC8 C;  4M75 B;  4PJO D;  4OB0 B;  4DOV A;  5A2Q E;  4M7A G;  2HD0 A;  2RHY A;  3HPW A;  4M78 B;  4NS5 A;  4L6V 5;  1G3T A;  2RHX A;  3H8Z A;  2XU8 A;  1VQ9 T;  3MEW A;  4A4G A;  4PJO E;  1HK9 A;  3JSC A;  4C8Q B;  3OW2 S;  1KQS A;  3VU3 C;  1VQ9 A;  4HT9 A;  5LJ5 j;  2LRQ A;  5J3B A;  1Q82 U;  3V7S A;  1MHN A;  2MAM A;  2M16 A;  5LJ5 h;  3PIP A;  3KXT A;  5A0G A;  1VQ6 T;  1WPY A;  3OYE A;  1NPP A;  2RI2 A;  3JB9 G;  4M7D C;  3QSU A;  1VQ6 A;  2PUO B;  4PKC C;  2RI5 A;  3RKX A;  1KD1 C;  3QKJ A;  5FRN A;  4M77 D;  1G3Y A;  2GFU A;  4N4I A;  4MZM A;  1Y71 A;  5CKF A;  3OA6 A;  4MZP A;  3OYI A;  4XTV A;  3PMT A;  2M1H A;  1G5V A;  4M77 E;  3HFN A;  2CKK A;  1BKB A;  2EJG A;  5LJ5 f;  2JOY A;  3QII A;  3ZBD A;  3G6E T;  5GMK e;  2H3J A;  3G6E A;  3OSV A;  2QEX A;  1VQN A;  2XKO C;  4X9C A;  2FB7 A;  4C0D C;  3S6W A;  1YIJ T;  1XTD A;  3M54 A;  4KUI A;  4M75 D;  2CZ0 B;  5IT9 E;  1YIJ A;  2QQA A;  3HRT A;  2PUK B;  5C6S A;  3FJP A;  4JDS A;  4DQ2 A;  3GNG A;  3P8B B;  1LJO A;  3JCM f;  3C95 A;  3OS2 A;  3WVE B;  4C8Q D;  2F5K A;  4M78 G;  4C0G A;  1Q7Y U;  4IUQ A;  3BDL A;  1UB4 A;  5CO7 A;  4JS5 A;  3QYG B;  3J80 E;  3FEO A;  1VIE A;  4O5V A;  3FLG A;  5GAO n;  2K4Y A;  4ZN1 A;  3KUF A;  3CCU T;  2RD1 A;  5I21 A;  1O75 A;  4PJO A;  2X4W A;  2EQM A;  3VJP A;  1GXI E;  4BAC A;  2YLB A;  4OGE A;  3CCU A;  1K73 C;  2QQB A;  3HL8 A;  1BI0 A;  2RHI A;  3MP8 A;  3OYL A;  1B34 B;  3EAE A;  3CCL T;  1VQM A;  3QYH B;  3CD6 T;  3RUX A;  3VUB A;  3M4Y A;  2DKG A;  1WJR A;  4EMG A;  3X28 B;  1QP3 A;  2C06 A;  1Y07 A;  3G71 T;  4F7U F;  1KG1 A;  5GAN 4;  2DXU A;  1QVG S;  3HSB A;  2X4X A;  3C4S A;  2K57 A;  3PFS A;  1M9S A;  3OYC A;  3QBY A;  4BD3 A;  2K5I A;  2E70 A;  4A4E A;  4XU1 A;  3OS1 A;  1KQ1 A;  2CZ7 B;  3LH0 A;  4M77 A;  4GY5 A;  4BB7 A;  2HBP A;  1BI1 A;  3HFO A;  1KQS S;  1JRI A;  2D9T A;  1N8R U;  3GIB A;  5GAN h;  4XQ3 A;  5LJ3 e;  2XDB A;  3CC2 T;  4A4F A;  4DOW A;  2ZPE B;  2EFI A;  3OYG A;  3CCS T;  4M7D G;  3HKS A;  3CC2 A;  3JCM d;  1M8V A;  2K5F A;  1VIF A;  4JRK A;  5LJ3 g;  3BDU A;  2X35 A;  1RL2 A;  2DO3 A;  3E19 A;  5FU7 B;  4E7H A;  3SFM A;  3CC7 T;  4ZGD B;  5GAN f;  2QQS A;  4A53 A;  4J5Y A;  3CC7 A;  2Y4X A;  4F7U B;  1YI2 A;  1W2B S;  1VQK T;  4OMF B;  3CCE T;  3X25 B;  1BI3 A;  3LWI A;  1R8O B;  4L5G A;  2WSF E;  4LDU A;  1VQK A;  3CCE A;  4BDY A;  4FT2 A;  3J81 E;  3MP6 A;  1NJI C;  4PJO C;  3OMG A;  2K2V A;  3L2Z A;  1SSF A;  3M57 A;  4D6W A;  4BI4 A;  3QJ6 A;  5GAM d;  3L2Q A;  2EJ9 A;  2V8I A;  5FU6 B;  2QQR A;  1Q81 U;  5A0L A;  4HA8 A;  3RES A;  4C0F A;  3RKW A;  4QW2 A;  4CRI A;  4V2S A;  2NLU A;  2XHC A;  1XQH A;  2XDP A;  3L2W A;  4EMK A;  4CI0 C;  2DTI A;  4LD9 K;  3SWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...