4M7AB

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 19
structure length 90
sequence length 90
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aB00
4A54A 1B34A 3JB9I 2DZCA 4M78D 4JUVA 4J6WA 2E41A 3JB9F 2DZ9A 4MMKA 4C8QF 4M7DC 1JBMA 3BDUA 3JCMf 4C92F 1WPYA 5LJ5d 5GAN2 4M7DD 2YHTA 4M77F 4NOYA 3V7SA 2JN0A 2K57A 2I2LA 1LOJA 5GAMf 3L1AA 4OP0A 3BW1A 3JCMJ 4XTZA 1X01A 4EMKA 3AHUA 3RESA 5GMKl 4PJOB 1N9RA 3SWNB 4M7AA 1HK9A 1B34B 5CAIA 3HFNA 4N0AA 3QSUA 4HT8A 5LJ3d 1BIBA 4XU2A 3JCMd 4HT9A 4XU0A 2QTXA 3INZA 4C8QC 3JCMc 4MMLA 5GAOn 2DJZA 4C92C 5LJ5j 4M77C 3RKWA 4DQ2A 4XTYA 3SWNA 4C92D 4QVCA 2VXFA 4J6YA 4XU3A 1I4K1 3EFRA 2YLBA 2RB6A 3QUIA 5LJ5h 5GAOr 4EMKB 4M78A 4M78E 4M75F 2FB7A 1I81A 4PNOA 5GAN5 3JB9J 4EMHA 4M7AB 3JB9H 3JCMb 3HSBA 4M7AG 1M8VA 5GANd 4M7DA 4M7DE 4WF2A 3RKXA 4QVDA 2EAYA 2DXTA 5GMKj 5LJ3j 5GAOm 4RCBA 4EMGA 4F7UA 4F7UE 2EJFA 3BY7A 4HA8A 4JRIA 1WQ7A 3VU3C 3JCMX 1WQWA 2VC8A 5LJ3h 3V8JA 4PJOG 5GMKh 2CGHA 3JCMh 1LNXA 1KQ1A 3QHSA 4M78B 5LJ5g 4M78G 2RM4A 5GAOq 4M75C 3RERA 3JB9D 5I21A 2EWNA 2DXUA 4JRKA 4PJOF 4M75D 2E10A 5GAMh 3JCMP 4C8QD 5GAN4 2Y90A 4M7DB 4PJOA 2DTOA 4M7DG 1M5Q1 3QO3A 1YCYA 3V7RA 4M77D 5GAMd 4C8QE 4NL3A 5GANj 4Y91A 3PGGA 3RUXA 4C92E 4C92A 4M78F 5GAN6 2FYKA 4M77A 4M77E 3RKYA 3SB2A 1U1TA 3BFMA 4F7UB 2E64A 5GANh 4XTWA 4F7UG 3JCMV 1U1SA 3FB9A 4RCCA 5LJ3g 3V8LA 4XTUA 1HXDA 3V8KA 5LJ5f 2RA2A 3M4GA 3JCMg 5GAOp 4M7AF 5LJ5e 1N9SA 3RIRA 5GAMg 4PJOC 3SWNC 2EJ9A 3GIBA 1TH7A 4C92B 2DVEA 4M77B 4C92G 5GAMj 4XU1A 4M77G 3FIFA 1D3BB 5DY9A 4A53A 2DKGA 1JRIA 5GMKi 5GANg 3JCMW 1Y96A 4X9DA 5LJ3f 5GMKe 5LJ3e 1H641 4M75A 4M75E 5GAN3 1KQ2A 4C8QA 4J5YA 3JCMe 1BIAA 4XQ3A 5GAN8 3V7CA 5GMKm 4NL2A 5GAN7 4V2SA 2E1HA 2EJGA 4EMKC 1D3BA 3EFSA 5GAMe 4JLIA 4X9CA 4J6XA 4M7AC 4M7DF 4XTXA 4M7AD 4N0AC 5GAOl 4XTVA 2HNIA 4M7AE 3FJPA 2DTHA 5GANf 4F7UF 5GANe 1Y96B 1I5LA 2DTIA 3HFOA 3L2ZA 2DEQA 1MGQA 2E65A 2RD1A 2VXEA 4M75B 4C8QB 4M75G 1LJOA 3JB9G 4PJOD 4C8QG 1WNLA 3JCMQ 1I8FA 4PJOE 2ZGWA 4M78C 2YLCA
chains in the Genus database with same CATH superfamily
2PVOB 4JUVA 2K9GA 2LMJA 1AWJA 2DZ9A 5LJ5d 3M56A 1M1KU 4R55A 5FRMA 2K79A 4OB1B 4II1A 2K2MA 3CC4T 1RI0A 4RTUA 3CCMA 1U3OA 1JO8A 2O9SA 1KC8C 2RH2A 4PFPA 3L42A 2DD5A 4XTYA 4KGXB 2DPPB 3NTHA 4KULA 3G4SQ 2IG0A 5HCKA 3VRZA 2QA4A 4QVDA 2JTFA 3A1PA 2LRQA 4M7AF 3CCSA 4E7LA 2FHDA 2FRYA 3QWYA 4M78B 5I11A 3UA7A 2BTTA 3I56A 1OPLA 3BE3A 1UG1A 2VGMA 3OYHA 4NL3A 1NEGA 2RJCA 3RMQA 3LH5A 5IN1A 4CC4B 1E6GA 4ZGDB 3WVDB 1QCFA 3LLRA 1MMNA 4B6MA 2ZAEA 4JZ4A 3ZL7C 1IO6A 3EGDA 1FWZA 5FU6C 2GTJA 2K7AA 2NUTA 4AFSC 3OYJA 1K0SA 1V29B 3CMAA 4V2SA 1Q81R 5DM7R 2J6FA 3I55A 2DVJA 1VQOQ 2J6KA 4M7AC 2KAFA 2HQXA 3LWHA 4KH1B 2A37A 4MZMA 2V8JA 2KNBB 4IURA 1AWOA 1D0XA 1G5VA 1U5SA 3VS4A 4Z02A 2IPOB 1WNLA 2XU8A 5A0GA 2EWNA 2ESWA 3CCEA 1K8AC 2DRMA 1A0NB 1JBMA 2PNIA 1WPYA 3PMIA 5GJWB 3DB3A 3G7ZA 2PQWA 4L59A 1AEYA 2L89A 2YUQA 1RAEB 3ZBDA 2HDAA 2CP3A 2DFUA 1VQ4A 1VQ9A 1N5ZA 1BIBA 1SSFA 2LP5A 5KYWA 2XMFA 2HSPA 1MMDA 2DAQA 4IUUA 5CKFA 3CC4Q 1VQ8T 3EFRA 4DBQA 5D6WA 5GAOr 2BZYA 2KRSA 3I9QA 4AT1B 1RAAB 3JB9H 3LGLA 5CCAA 1UJ0A 1VQMA 3L2QA 1BYMA 2HBWA 1BU1A 4UC4A 2L3SA 5D6XA 2QG9B 4J9GA 2LCCA 1UUEA 1I07A 3QYHB 3JB9D 4F16A 4M75D 2E10A 5FU7C 1M5Q1 2P4RA 1YJWT 5FWBA 1EZZB 2QGGA 5GANh 4F7UG 2RQWA 3JCMV 1H3HA 2YDLA 3L2VA 4C5IA 3VS0A 3JCMg 2CUDA 2AHJB 3OA6A 2VKNA 2PTKA 3LWIA 2RF0A 2K5LA 1ABQA 2BE9B 1NLOC 4R0KA 1D3BB 1X27A 4J83A 5KYXB 2QTVA 3QKJA 5LJ3e 1MNEA 1R8OB 4M75A 4HCBA 5I2SA 1WDXA 1TWBA 1UGRB 2EJGA 1D3BA 1GXIE 2EYZA 5KYXA 2COYA 1MHNA 2G6FX 3MHXA 4AFUC 4PFZA 2QA4Q 1Y96B 1JB0E 2ZPFB 3OY9A 1ZBJA 4A63B 3CCSQ 3S3NA 3OS2A 1B34A 4OMPA 2DZCA 2E41A 1YITA 3I5SA 2Z0WA 2M0OA 3I56Q 4C92F 3C94A 2JN0A 2K2VA 1KC8U 2YXYA 2LNHB 3JCMJ 1PRLC 2DL4A 1W2BA 4BE1A 3CCVA 3JCMc 1TXQA 3MEUA 1V76A 2YLBA 4DBHA 3CBOA 2O2OA 1I81A 1UGSB 1MMGA 3WXMB 4LDUA 3M53A 4OMOA 4EDUA 4E7ZA 1KD1R 5IT9E 1VYTA 2PU9B 1TG0A 1Y57A 3VS2A 1GRIA 1Q7YR 5GAOq 4M7DG 3R6NA 2H3JA 2KRNA 3KUFA 3X24B 3CD6A 1OYXA 2DE0X 2NLUA 3NMZC 2FL7A 5LJ5f 1VQKT 1NYGA 2JW4A 4M4ZA 1YJNT 1KIKA 2DL7A 4J9EA 2YRDA 1TH7A 3VUZA 2XKOC 2CUBA 4LDVA 4Q5WA 2EQKA 3VS6A 1VQ4Q 2KE9A 1JXOA 4TVRA 1M30A 2LT4A 1MV3A 2RHZA 5GAN3 1X2KA 3EG3A 3UDCA 3OMCA 1TUGB 2KQWA 4RTXA 2A3LA 2CSQA 2CKKA 3M0SA 5KH6A 1K1ZA 2OTLT 1KHIA 2K5FA 3OYLA 1NJIR 2RHYA 1QKWA 4FU6A 1VQMQ 3CMET 1QP3A 1U06A 3ER0A 1QMCA 1KK7A 1MNDA 5KCHA 4LE9A 4YTLA 1RAHB 4JRQA 2JS0A 3MP8A 4C8QG 5D7UA 4PJOA 5C0MA 4RUGA 2YLCA 5C6SA 1I0CA 4MMKA 4HCZA 2MI6A 4AMCA 2ZPEB 3G1JA 2GQVA 1WHMA 3BW1A 3NGPA 2LX7A 4XTZA 4BI4A 1SEMA 1K73R 3M9QA 2BZXA 3X28B 5HY6A 3REAB 5FU6B 3JCMd 3OW2S 4MDXA 5GAOn 3INZA 4C8QC 3OS5A 4CRIA 3H6ZA 4L6V5 4IUTA 1AWWA 1IZ6A 4M7AB 1M8VA 1ZQ1A 5CQYA 5FLXE 3NFCA 5LJ3j 2F2VA 3V8JA 3CEYA 2WSEE 5J26A 4BUGA 3MO8A 4F17A 1SKUB 3TVTA 3FDRA 4AFZC 2FPDA 1GCQA 3OBWA 1VIEA 4C8QE 1CKBA 2OI3A 2CZ7B 2ECZA 1AZGB 4DOWA 2XDPA 2YWWA 4FW1A 3S3MA 1W70A 3TEEA 2LJ1A 2RQTA 3PIPA 1C0MA 1OULA 2BKDN 4GY5A 4DBRA 5GAMg 2EQJA 2L3QA 1R77A 2AZVA 3PT9A 1RI9A 3I35A 3UA6A 1YP5A 1VQKQ 2GNCA 4E7SA 1KQ2A 2QQRA 5GAN8 2DRKA 4BE0A 5GAN7 2E1HA 1M1KR 5IHKA 2GQIA 1M3AA 3EFOA 1TUCA 4Z89A 3CCLQ 1H3ZA 3OW2P 3HL8A 1LCKA 4PK4A 1FMWA 2HEQA 4BI3A 3CC2T 2RD1A 2PVGB 2NYSA 2QAZA 2LZ6B 3OYKA 1OI1A 3G71T 5FU7B 2OTLQ 3JB9F 2QGFB 4J8OA 3CCQA 2CP5A 1D0ZA 2OTJT 2F1LA 3KBGA 1N9RA 4ZGEB 2YSQA 2CREA 1YNZA 1UGQB 3CCJT 5CQXA 4HVVA 2LQKA 9ATCB 1I4K1 5LJ5h 1QWFA 4J9DA 3MEWA 3H41A 1D1BA 1SRMA 4JS4A 2LQNA 4A4FA 1QP2A 1OEBA 1QWEA 4F7UA 3AHUA 1WZOA 4ORZA 1YBYA 4E47A 4OMNA 1M90C 1IHWA 2C0OA 4M75C 4E7HA 1YJ9T 4JRKA 2CP2A 4BB7A 4C0ZA 2A0FB 4Y28E 1S72A 2EKOA 5GAOm 4PLIA 1U1TA 4JLGA 4XTWA 2XDDA 1VQ6Q 3CCUA 2FZGB 3LX7A 3L2UA 1NBEB 3OYNA 2JNGA 2K4YA 1X69A 3A8HB 3O5ZA 5GAMj 2RQRA 4M77G 2MPXC 3FIFA 1UGVA 2HQHA 2AK5A 4M75E 4J5YA 1WJSA 3O8VA 3M0UA 4C5HA 4HVUA 4JS5A 3OYAA 2EYWA 2D1XA 4LDXA 4FIBA 2AT1B 2DL8A 1ARKA 4IUQA 1QVFP 2GCXA 1C1AA 1YFNA 4HXJA 4ANJA 4Y92A 3A5ZB 2B86A 4OB3B 2EKHA 2ZPGB 4M7DD 2V8KA 1WHKA 2YHTA 2O88A 1Z9ZA 1LOJA 4FYYB 3JRZA 2PUOB 1YIJA 3G71Q 1BKBA 5GMKl 4PL6A 2I0NA 2X3WD 4N0AA 4QW2A 4QKUA 2CP7A 3EGUA 3S3OA 2OTJQ 2PZ1A 4BE2A 3CBPA 2RJDA 4XU3A 1GFDA 1YI2A 5DLQE 2KROA 4DA4A 4EIKA 1R0BG 2L3PA 2DEUA 2MYSA 4F04B 2EQUA 4M7DA 2WSFE 1T3SA 5KYYA 2EAYA 3CCJQ 1WX6A 2R5AA 4EMGA 4HA8A 4ZN1A 4JRIA 2RI3A 4RTVA 4PJOG 1Y0MA 2DXBA 1OOTA 2HQEA 3JCMP 2KK4A 2KT8A 4C8QD 4J9IA 1YCYA 1T0JA 3E9GA 1ABOA 1D1AA 1WHJA 3FB9A 1QVPA 3DLLA 4XTUA 2RA2A 1KHCA 1YJ9Q 2D9TA 3QJ6A 2VYTA 3RIRA 4ELYC 4PJOC 1TS9A 3EG1A 3PIOA 1UDLA 1H8KA 1JRIA 2FPEA 4X9DA 1VYVA 3J80E 1ACMB 4C8QA 1S1NA 2VVKA 2RHIA 3VS7A 3GF5A 2QXFA 1WJQA 3OYMA 2ROTA 3FJPA 3EGDB 5LL6S 2CS7A 2Y4XA 4E7IA 1Q81C 5GANe 2NUTB 1VQPA 1G8XA 4PJOE 2AZSA 3AT1B 4A54A 3A98A 2LVMA 3OMGA 4ME7A 2QA4T 2R5MA 2EPDA 1YN8A 3SDZA 3CCST 1S72Q 3L1AA 1VQ5A 2JM8A 1QKXA 1HJDA 2QQBA 4EMKA 3SFMA 3H0HA 2DX1A 2NUPB 1WGSA 2M1HA 3I56T 3CCUQ 4KGVB 2X51A 2M02A 4NS5A 1AD5A 1GCQC 2KYMA 2DBMA 2NUPA 2KGTA 4C5GA 1SPKA 4BY6C 3OYBA 2KSSA 2RB6A 4JJDA 4OB2B 3OYIA 1M90U 4R56A 1N27A 1VQ8A 2XD0A 5KYUA 5KYWB 1BI3A 2JT4A 5IHIA 5IXFA 4J7IA 4FM4B 4DBFA 1LNXA 1R0CB 1YHQA 3CMAT 4D8KA 1CKAA 1RAFB 2DXUA 5I21A 4QQ6A 3RR6A 2EGEA 1W1FA 3M0RA 1RUWA 2EQMA 3CBMA 3TSWA 4GBQA 1T0HA 5GAOp 1AZEA 2O9VA 2KI7A 2C0TA 2K3BA 4BACA 3CCET 2QDYB 2P0QA 2DL3A 1VQLA 4C5EA 1Q82C 2EIFA 2D8JA 4KUDK 2DK3A 5FW9A 3QJYA 3T9NA 4OGEA 3JAME 3OYEA 4A4KA 1ZA2B 1YI2Q 1T3LA 4JLIA 1VQ4T 1VQ9T 3OYDA 2EVRA 3PTAA 1M2VA 3TCJA 2QQ9A 3ULRB 6AT1B 1WHLA 2YUOA 2XI9A 2L5QA 2V8IA 4M75B 5CK9A 1K4US 4J9BA 1JJ2P 3CCMQ 2RMOA 2ZPIB 2RI2A 3OW2A 4ELZC 3H8ZA 2X9HA 1VQMT 1X2QA 3LW5E 3BDUA 2L2PA 4BD3A 5CVIA 2HSEB 1KQSS 1UJYA 2KXCA 2O4XA 2JM9A 1HD3A 4OP0A 1G83A 1UHFA 5CKBA 1B34B 3QSUA 1NPPA 4LUDA 5I2MA 2QTXA 2DJZA 3EGXA 4QVCA 1E7OA 3QWXX 4EMHA 5CKEA 1AHJB 3GP8A 1G3SA 1D0YA 3I5RA 3RKXA 1QQJA 1FMVA 4PLLA 4F7UE 4CI0C 1QCNA 1PCXA 3JCMh 1OX8A 2BE7D 4GLMA 1M1GA 4ZGJB 2H8HA 4QT7A 1KD1C 2GF7A 4E7JA 3HPWA 3V7RA 5GANj 5GAN6 2ZPHB 4M77A 1Q7YC 1QVGP 3EHRA 1FX7A 3KXTA 5LJ3g 1ZSZA 3CMAQ 2OJ2A 1SG5A 3I55Q 1YITT 4C92G 1YJNA 2RO0A 4P5NA 2P4TA 1KQSP 2CP0A 3QYGB 3OYYA 5FROA 1Q81U 1PG5B 2FO0A 5IHNA 4NL2A 3CCEQ 1KJWA 4XTXA 3C95A 4N0AC 3CCVT 2R58A 2HNIA 2QK0A 3CCRA 2MAMA 1WFWA 2VXEA 4KH0B 4PJOD 1IREB 2OAUA 3CMEA 1NJIC 2ZGWA 3CCLT 2D0QB 1MUZA 3NHNA 3NPFA 4X34A 1VQ9Q 1QVFA 1IXDA 1YHQQ 1VOMA 4M7DC 4C8QF 1BCOA 3VUBA 3LYIA 4ESRA 2CZ6B 2DO3A 2NUZA 7AT1B 3U23A 3VYHB 2DF6A 2K3XA 2VWFA 3MP1A 1M2OA 4PJOB 1K8AU 2IIMA 3N5BB 2RJEA 3QBYA 3VS3A 2QASA 1K73C 3CD6T 2W10A 1VQLQ 3UWNA 1N8RR 1VQNA 3E19A 4KBMB 2DD4A 4M7DE 5HK3A 1O75A 3G6EA 2KT1A 3LH0A 1Z9QA 4IIMA 4RKUE 2M0YA 4JRPA 3VU3C 1WQWA 5GMKh 2A28A 3MP6A 1RLQC 4M78G 1TU0B 3CPWP 4OMMA 4J7FA 1NYFA 4Y91A 3RUXA 4FSXA 1RABB 1IRXA 3C12A 5I22A 1Q82U 2PUKB 5LJ5e 2E3HA 2ZCFB 5KCOA 2RPNA 1K9MR 1JU5C 2X4YA 3QPHA 1HSQA 3SWNC 3OYFA 1VQ6T 2M16A 2DVEA 5IXBA 4JJCA 4BY6B 4CC2A 1ZLMA 2E3IA 2JZ2A 3CC7A 2RJFA 1IGUA 2QYZA 2QEXA 2LJ3A 1VIFA 2DL5A 4J9CA 4EMKC 2Y4YA 5L8RE 2D8HA 1YITQ 2KMTA 3EG0A 1TUDA 2MIOA 2DTHA 4RTYA 3PFSA 3UATA 2VGNA 1M1KC 3WVEB 4WTOB 1J3TA 1EIFA 1HYOA 4BDZA 2GTOA 1M4ZA 1YCSB 4B9XA 1SHFA 5HKCA 1KG1A 3CC2A 3EH2A 3CCVQ 3EFOB 2E4HA 1WIEA 2I2LA 3TREA 4CC7A 1RAGB 1PM3A 3S6WA 3GOXA 1X01A 3M5AA 1BK2A 2PVDB 3OS0A 3PNWC 5LJ3d 2EYQA 2RK2A 2CH4W 4HT9A 3QZ9B 2M51A 1X6BA 4KGZB 2XIDA 1OZ2A 3RKWA 1Y7XA 3H0FA 4JDSA 4M75F 2F2XA 4F14A 3ZFJA 2QDLA 2ATCB 3HSBA 4MZPA 1KD1U 2KBTA 3BY7A 3CD6Q 1SSHA 3FLGA 1Q86C 2MK5A 1KFZA 1YWOA 4KUIA 3HRUA 1M3CA 2EGAA 2DETA 1G3YA 4JJNK 5GAMh 3G4SA 2DYIA 2FPFA 2DJQA 2CZ1B 1QVFS 1GFCA 1RLPC 2J05A 3CXCP 4F7UB 2C0IA 4LN2A 5IH2A 2P0KA 3EG9A 1VQ7A 1HXDA 3QZ5B 2LX9A 3VYGA 4PKCC 4QQDA 2LDMA 2YRCA 2K6DA 2YUPA 3VS1A 3VV0A 1B07A 4BDYA 4GLKA 1NJIU 3HRSA 5FWCA 3THKA 3MPUB 2X4JA 1VQNQ 3QDFA 3ME9A 4FYXB 1PD0A 2DTIA 1VA7A 3HFOA 3UF4A 3REBB 4X1VA 2HBPA 2KDSA 1LJOA 2MCNA 4A4GA 1NE8A 1BIAA 4OGCA 4O6JA 2EW3A 1VQOA 1JJ2A 3HRTA 5ECAA 1X43A 4NOYA 1Y71A 4OB0B 4QQGA 1Y07A 3RESA 3X26B 1PRMC 1ZBXA 1S72T 4PJLA 4XU2A 1WLPB 4QVZA 1WI7A 5LJ5j 4M77C 4C92D 2RQVA 4J6YA 1AWXA 2NWMA 4IUPA 3CCUT 2WSCE 4C0DC 2F5KA 4LXCA 1PD1A 2CP6A 1ZSZC 2V26A 3TQ7P 3DB4A 8ATCB 1LVKA 3OB9A 3CC7Q 3C0CA 2QEXQ 4WF2A 4E2FB 4RCBA 3A8OB 1X6OA 1FXXA 2VASA 1KSWA 3CC4A 3H9NA 3QXEB 3DLMA 5L23A 1WHGA 3RERA 2RHUA 3GNFB 3M4YA 4PJOF 3OYGA 4M7DB 1SF9A 5KYYB 5GAMd 1GCPA 4C92A 4M77E 3BFMA 1EFNA 4IIOA 2DILA 5KYNA 2KVQG 2QQSA 2F69A 1QVGA 3TU4K 2EJ9A 1GBRA 5A2QE 2FG0A 3VJPA 2E12A 1RL2A 4CC3A 2VV5A 4BI8B 1YIJT 2GGRA 3IQLA 2LT1A 4RTZA 3L2WA 2X4XA 2DM1A 1KQSA 3EFSA 2DLPA 1M8MA 2CT4A 4AG2C 3CCQQ 3FJ5A 1FMKA 1FYNA 2CZ0B 4EPCA 3JSCA 3M0QA 1ZUYA 1YI2T 4C8QB 3M0PA 1XTDA 1I8FA 3E2UA 4M78D 3EG2A 4A4HA 1OZ3A 4OMLA 3JCMf 2ABLA 5J3BA 3M0TA 2K57A 3CCMT 2JUFA 1B7TA 1AT1B 4JZ3A 4VUBA 1W4SA 1ZUUA 1KC8R 3SWNB 1VQ7Q 2H3EB 1WA7A 1UHCA 3HKSA 2ROLA 1QCOA 2YT6A 3FC3A 1UTIA 2KYBA 4B9WA 3SWNA 1UECA 4J9FA 2L3RA 1M3BA 1UE9A 2DYBA 1C6VX 2HMAA 4M78A 2CH4A 4EMKB 2EYYA 3JB9J 1Q86U 4M7AG 2V1QA 2F5TX 4OMQA 2O31A 4RG8A 1OPKA 2EJFA 3F70A 2VC8A 2JTEA 2AKLA 2FRWA 2J6OA 2E5KA 2WACA 1G3TA 5EG2A 2LTOA 2Y90A 5KYUB 3QO3A 1X75C 1JJ2S 3MCAB 3CPWA 1BI1A 2ZZDA 1CSKA 1UGPB 2LQWA 4FYWB 3OSSC 1VQPT 2E5QA 4FW2A 2COWA 1XQHA 4D6WA 2X35A 2DERA 2DXCA 1MMAA 1WYXA 2DKGA 5GANg 5GMKi 3JCMW 5LJ3f 3VRYA 1VQ5T 3I55T 1D09B 4FSSA 3JCMe 1WJRA 5GMKm 5CKHA 1I1JA 1WHHA 4J6XA 2JS2A 1XOVA 5AT1B 2EBPA 1MV0B 2HD0A 1YJWA 4M7AE 2J06A 2P0PA 4F7UF 1TSFA 3PE0A 1K8AR 4ATOA 1YIJQ 2DEQA 1MGQA 1BI2A 2X4WA 2RN8A 4FT4A 1JXMA 3URGA 4D8DA 2DIGA 3EAEA 2EQIA 2ENMA 1M2VB 2K3YA 2LJ0A 3NTIA 4KRTA 1K76A 1BBZA 4HCCA 4E6RA 1YHQT 1QVGS 2D0NA 1UFFA 3HFNA 1PSEA 3M55A 2M9UA 1ZSGA 1PKTA 3HP9A 2O4XB 1ZX6A 2A36A 4LD9K 4KT0E 4PJJA 2XG8D 2JMAA 4ZTJA 3A8LB 2DXTA 1Q82R 3MKDA 1VQLT 1VYUA 3EGXB 3R6OA 5M9OA 1OQKA 3E1SA 1OU9A 1GBQA 2C06A 3FRNA 5GAN4 1TTHB 1QW1A 4M77D 3JV3A 1U1SA 4RMOA 3CXCA 4RTTA 3C4SA 4LUEA 2GBQA 2E6ZA 2FVUA 2OX7A 4LDYA 3EHQA 2X3XD 3BDLA 1G2BA 4RTWA 4M77B 3D7SB 4A53A 2KR3A 4C0DB 1Y96A 2FEIA 5GMKe 1VQPQ 3A8MB 1ZSZB 4XQ3A 3PMTA 5DLOA 1DJ7B 3OQ5A 4M7DF 2XK0A 4XTVA 1VQ5Q 3TSZA 2CDTA 1NZ9A 1RAIB 1VQKA 1Q95G 2JTMA 2EGCA 3VS5A 2HCKA 1SHGA 2SEMA 2FZKB 2VUBA 1PWTA 1G3WA 1LPLA 3V7SA 3CCLA 1H92A 3CPWS 4IKFA 2B8AA 5GAMf 5J39A 1D1CA 4PFOA 2E70A 2ED1A 2VB6A 3OYCA 2HL3A 2GFUA 1VQ8Q 2CT3A 3META 5EC7A 2MOXA 2HAXA 3EH1A 1NPRA 2OTLA 1AVZC 4DEYA 3RDVA 4ZTFA 3RNJA 4C92C 2RHXA 1YWPA 3QUIA 3P8BB 2LC4A 4XK8E 2FB7A 5GAN5 4MZTA 3JCMb 2HZYA 1XNIA 5GANd 1IHVA 4A4EA 1K9AA 1N8RC 4C0FA 4MDWA 5CKDA 1WQ7A 5LJ3h 1RADB 3PVQA 1YJWQ 2CGHA 1JEGA 2QQAA 2MWPA 1E6HA 2XICA 2RM4A 1M1FA 3OBYA 4L5GA 3UT1A 2LNVA 3GBQA 4ZNXA 1M27C 3CPFA 1OU8A 2COZA 1V1CA 3MEAA 4M78F 2FYKA 4C92E 3SB2A 2RI5A 1P92A 1WXUA 4HCKA 8AT1B 3MEVA 3CCRT 1NEBA 1ZHIA 3QIIA 4Z8AA 3V8LA 3X25B 3M58A 5HK0A 4N4GA 1N9SA 2YUNA 4Z88A 2KY9A 2RK1A 2EFIA 5DY9A 1K9MC 4N4IA 1VQ6A 2LQ8A 1N6AA 4ZN3A 2FZCB 5GAMe 4FL6A 4E7KA 1AOJA 4M7AD 5GAOl 1WXTA 1UEBA 2YRVA 1I5LA 2ED0A 4FYVB 1TOVA 3J7AF 4DOVA 3L2ZA 4OF1A 2IVWA 4IUVA 1VQNT 5CIUA 4M78C 3J81E 4J6WA 3G6ET 2R57A 5GAN2 1M9SA 4DEXA 1JQQA 4K11A 3CXCS 1F1BB 1IB8A 1U8RA 4M7AA 4JJBA 4HT8A 4FCYA 1IGQA 4J9HA 4XU0A 3P8HA 2DBKA 4MMLA 2VXFA 2BUDA 2HKQB 2HL5C 4M78E 2BZ8A 2OAWA 1NG2A 4PNOA 3G71A 1PNJA 2K5IA 2KXDA 3GPLA 5GMKj 2JOYA 3JCMX 1EX4A 2OTJA 2E6NA 3NTKA 1W2BS 3H0IA 4XAXB 3CC7T 2GFAA 3QHSA 3LGFA 5LJ5g 2QEXT 2DIQA 2AIRB 4N4HA 4WCIA 1YJNQ 3CCJA 2P84A 5AYFA 2E64A 4HVWA 3VKIA 2DA9A 2A08A 3OSVA 3V8KA 2MWOA 3PVLA 5KE2A 3E9FA 1Q7YU 3GIBA 1BB9A 3HHTB 2J7IA 3SHWA 4AFQC 3M54A 4XU1A 3FEOA 3CCRQ 2KRMA 2KEAA 3QDRB 1OX9A 2CYZB 1ZUKA 3EG9B 1H641 2JVVA 5D6YA 3A8GB 3CMEQ 3V7CA 2MMPA 1YJ9A 5GJVB 1RACB 1BCMA 4LD6A 2XDBA 4PJNA 2XHCA 3JB9G 4M75G 2LCLA 2LCSA 4LDWA 3CCQT 2F2WA 5CR2A 1PSFA 3M59A 3DKMA 3JB9I 2O01E 4C0GA 2A7YA 3RBBB 1X6GA 4M77F 1K0XA 1Q86R 3Q1JA 3M57A 1W2BP 1SRLA 2RQUA 3SEMA 5A0LA 3G4ST 1HK9A 3X20B 4FT2A 5CAIA 1PKSA 3G6EQ 1XJWB 1B3QA 5CO7A 2BIVA 2HKNA 4OVAA 1N8RU 4DQ2A 2ZPBB 1VUBA 3OS1A 5KE3A 1VQ7T 2SRCA 4O5VA 5IAYA 2G3RA 2JJ9A 1M90R 3ZEHA 4AG1C 1W6XA 1K73U 1QLYA 2L0AA 3JCMQ 2DNUA 4RG2A 2L8DA 1ZA1B 1GL5A 1UB4A 1KQ1A 1I5OB 3MJXA 2AKKA 5A0DA 3L2RA 3GLXA 2DTOA 2V1RA 1WXBA 3PGGA 3QG1A 3RKYA 2JMCA 3P8DA 4RCCA 1K9MU 3M4GA 2D6FA 4JPBW 2EYXA 1PC0A 1NM7A 4LNPA 1BI0A 1VQOT 4C92B 4PJMA 3ASKA 3KFVA 3CQTA 2CSIA 2MF2A 1NLPC 1PHTA 2W0ZA 2DMOA 1OV3A 4OMFB 5FRNA 3CC2Q 4X9CA 3SD4A 3HTRA 5GANf 2QI2A 3RMSA 2JXBA 2E65A 1O9SA 4HKEA 2RNAA 3UPUA 3GNGA
chains in the Genus database with same CATH topology
3CCLT 2D0QB 2DIGA 3EAEA 2PVOB 4X34A 4JUVA 1QVFA 3JB9F 2DZ9A 4M7DC 4C8QF 4J8OA 3VUBA 3CCQA 5LJ5d 3LYIA 2K3YA 3M56A 4R55A 1M1KU 5FRMA 2CZ6B 2DO3A 4OB1B 3NTIA 2OTJT 3VYHB 4II1A 3CC4T 4HCCA 2K3XA 1RI0A 3MP1A 1YHQT 1QVGS 3CCMA 4PJOB 3KBGA 1N9RA 1K8AU 3HFNA 4ZGEB 1PSEA 3M55A 2M9UA 3N5BB 2RJEA 1UGQB 3QBYA 3CCJT 2RH2A 5CQXA 1KC8C 3HP9A 2LQKA 3L42A 1K73C 2DD5A 3CD6T 4XTYA 2O4XB 2DPPB 1I4K1 5LJ5h 3UWNA 4LD9K 3NTHA 3MEWA 4KULA 4KT0E 1VQNA 3E19A 2XG8D 2IG0A 4KBMB 4JS4A 2DD4A 4ZTJA 4M7DE 4A4FA 5HK3A 1O75A 3A8LB 2QA4A 1QP2A 4QVDA 3G6EA 2DXTA 2JTFA 3LH0A 4JRPA 2LRQA 4RKUE 4F7UA 1VQLT 3AHUA 3VU3C 4M7AF 3CCSA 3R6OA 1WQWA 2FHDA 5GMKh 4E7LA 1YBYA 5M9OA 3MP6A 3E1SA 4E47A 1M90C 4M78B 4M78G 2C06A 4M75C 4E7HA 3FRNA 4JRKA 4BB7A 4C0ZA 3I56A 1YJ9T 4Y28E 5GAN4 1QW1A 2VGMA 3OYHA 4M77D 4J7FA 4NL3A 4Y91A 3RUXA 1S72A 2EKOA 2RJCA 4FSXA 4PLIA 5GAOm 1U1TA 4JLGA 3RMQA 4XTWA 1U1SA 3C12A 2XDDA 1YI2T 4RMOA 1Q82U 3CCUA 5IN1A 2PUKB 3LX7A 3CXCA 3C4SA 3L2UA 5LJ5e 2ZCFB 2JNGA 5KCOA 3OYNA 2E6ZA 4ZGDB 2K4YA 2FVUA 3WVDB 2X4YA 3QPHA 4LDYA 3A8HB 3SWNC 3OYFA 3BDLA 3LLRA 1VQ6T 2M16A 2DVEA 4M77B 5GAMj 4M77G 3FIFA 4A53A 1FWZA 4BY6B 5FU6C 4C0DB 1Y96A 5GMKe 2JZ2A 3CC7A 3A8MB 4M75E 2RJFA 3OYJA 4J5YA 2QEXA 4XQ3A 1V29B 3CMAA 1VIFA 3PMTA 4V2SA 4EMKC 2Y4YA 5DLOA 1DJ7B 5L8RE 5DM7R 1WJSA 3O8VA 3OQ5A 4C5HA 3I55A 4M7DF 4JS5A 4M7AC 2KAFA 3OYAA 2HQXA 2KMTA 2XK0A 4XTVA 4LDXA 3LWHA 2DTHA 4FIBA 3PFSA 2VGNA 1M1KC 3WVEB 4MZMA 2V8JA 4IUQA 4IURA 1G5VA 1NZ9A 1EIFA 2GCXA 4Z02A 1VQKA 1WNLA 4BDZA 2JTMA 2XU8A 1M4ZA 5A0GA 2EWNA 4B9XA 5HKCA 1KG1A 3CC2A 3CCEA 3A5ZB 1K8AC 2VUBA 4OB3B 2ZPGB 1JBMA 1G3WA 1WPYA 4M7DD 3PMIA 2V8KA 2YHTA 3V7SA 3CCLA 3CPWS 2I2LA 1LOJA 3TREA 4IKFA 3DB3A 2B8AA 3G7ZA 5GAMf 3JRZA 5J39A 2PQWA 3S6WA 3GOXA 2PUOB 4L59A 1YIJA 1X01A 2E70A 3OYCA 3M5AA 1BKBA 2L89A 2GFUA 5GMKl 4PL6A 3ZBDA 2PVDB 3META 3OS0A 4N0AA 4QW2A 3CMEA 1VQ4A 3PNWC 1VQ9A 5LJ3d 1NPRA 2EYQA 2HAXA 2RK2A 2OTLA 1BIBA 1SSFA 3S3OA 4HT9A 3QZ9B 4ZTFA 2XIDA 4C92C 1OZ2A 3RKWA 2RHXA 4BE2A 3CBPA 2DAQA 2RJDA 4IUUA 4XU3A 5CKFA 1VQ8T 3EFRA 3QUIA 1YI2A 5DLQE 1Y7XA 5D6WA 5GAOr 3P8BB 2LC4A 4XK8E 4DA4A 4JDSA 4M75F 2FB7A 3ZFJA 5GAN5 4MZTA 3JB9H 3JCMb 3LGLA 3HSBA 5CCAA 1XNIA 5GANd 2EQUA 4M7DA 2WSFE 4MZPA 1KD1U 1VQMA 4A4EA 3L2QA 2EAYA 1BYMA 1N8RC 2R5AA 4UC4A 4MDWA 4C0FA 4HA8A 3BY7A 4JRIA 4EMGA 1WQ7A 2RI3A 4ZN1A 5LJ3h 5CKDA 5D6XA 4PJOG 2CGHA 3FLGA 1Q86C 2QQAA 2LCCA 2MWPA 4KUIA 3QYHB 3HRUA 2DXBA 2XICA 2RM4A 1G3YA 1M1FA 3OBYA 2HQEA 4L5GA 3UT1A 5GAMh 2LNVA 3G4SA 4JJNK 3JCMP 4M75D 2E10A 3JB9D 2KK4A 4C8QD 2CZ1B 5FU7C 1M5Q1 3CPFA 1YCYA 1QVFS 1YJWT 3E9GA 4C92E 3MEAA 4M78F 2FYKA 3SB2A 2RI5A 1P92A 4F7UB 5GANh 4F7UG 3MEVA 3JCMV 3FB9A 1QVPA 3CCRT 1ZHIA 3QIIA 3L2VA 4C5IA 3DLLA 2P0KA 3V8LA 1VQ7A 4XTUA 1HXDA 3X25B 2RA2A 1KHCA 3M58A 3JCMg 2AHJB 5HK0A 4N4GA 1N9SA 2D9TA 3QZ5B 3QJ6A 3OA6A 2LX9A 2VYTA 3RIRA 3VYGA 3LWIA 4ELYC 4PJOC 3PIOA 1NJIC 4PKCC 4QQDA 2K5LA 2KY9A 2RK1A 2EFIA 2LDMA 1D3BB 5DY9A 1K9MC 1JRIA 4J83A 4X9DA 4N4IA 3QKJA 1VQ6A 2LQ8A 1N6AA 5LJ3e 1R8OB 3VV0A 3J80E 4M75A 4HCBA 4C8QA 4ZN3A 5I2SA 4BDYA 1UGRB 2EJGA 1D3BA 2RHIA 1GXIE 5GAMe 3GF5A 2QXFA 4GLKA 1NJIU 1WJQA 3HRSA 4FL6A 1MHNA 3OYMA 4E7KA 4M7AD 2X4JA 5GAOl 3MHXA 1UEBA 3ME9A 3FJPA 2YRVA 5LL6S 2CS7A 2Y4XA 4E7IA 1Q81C 5GANe 1Y96B 1I5LA 2DTIA 1JB0E 3HFOA 4DOVA 3J7AF 2ZPFB 3L2ZA 3OY9A 2HBPA 2KDSA 1LJOA 4OF1A 1VQPA 2IVWA 4IUVA 3S3NA 3OS2A 4PJOE 4A4GA 1VQNT 5CIUA 1NE8A 1BIAA 4M78C 4OGCA 4A54A 1B34A 3J81E 2DZCA 2LVMA 4O6JA 4J6WA 2E41A 3OMGA 4ME7A 3G6ET 2QA4T 2R5MA 1VQOA 2R57A 1YITA 1JJ2A 3HRTA 2M0OA 4C92F 5GAN2 1M9SA 3SDZA 4NOYA 3C94A 2JN0A 1Y71A 3CCST 2K2VA 1KC8U 3L1AA 1VQ5A 4OB0B 3JCMJ 2QQBA 4QQGA 3CXCS 4EMKA 3SFMA 1Y07A 3RESA 3X26B 1U8RA 4M7AA 3I56T 1WGSA 2M1HA 1W2BA 4HT8A 4NS5A 1ZBXA 4BE1A 1S72T 4XU2A 4QVZA 4XU0A 3P8HA 3CCVA 3JCMc 4MMLA 3MEUA 5LJ5j 4M77C 4C92D 2VXFA 4J6YA 2BUDA 4IUPA 4C5GA 3CCUT 4BY6C 2WSCE 2KSSA 2RB6A 2YLBA 2F5KA 4C0DC 3OYBA 3CBOA 4M78E 4PNOA 1I81A 1UGSB 3G71A 4OB2B 3OYIA 1M90U 2K5IA 3WXMB 4R56A 1N27A 3DB4A 1VQ8A 3OB9A 2XD0A 4LDUA 4WF2A 3M53A 4EDUA 3GPLA 5GMKj 2JOYA 4RCBA 3A8OB 3JCMX 1BI3A 1X6OA 5IT9E 2OTJA 2E6NA 3NTKA 2PU9B 1FXXA 4J7IA 1W2BS 4FM4B 4XAXB 3CC4A 3CC7T 1LNXA 2GFAA 3QXEB 3DLMA 3QHSA 3LGFA 5LJ5g 2QEXT 1YHQA 2DIQA 5GAOq 3CMAT 3RERA 2RHUA 2DXUA 3GNFB 3M4YA 4PJOF 4N4HA 5I21A 3OYGA 4QQ6A 4M7DB 4M7DG 5GAMd 2H3JA 4C92A 3CCJA 4M77E 5AYFA 3BFMA 3KUFA 2E64A 3VKIA 3X24B 3CD6A 2KVQG 1OYXA 2EQMA 2NLUA 3CBMA 2FL7A 2QQSA 3OSVA 3V8KA 5LJ5f 2F69A 2MWOA 5GAOp 1VQKT 1QVGA 1YJNT 3TU4K 5KE2A 4BACA 3CCET 3E9FA 2EJ9A 2P0QA 2QDYB 1Q7YU 1TH7A 3GIBA 3HHTB 3VUZA 2XKOC 5A2QE 3M54A 3VJPA 2E12A 4LDVA 4Q5WA 4XU1A 1VQLA 2EQKA 4C5EA 1Q82C 3FEOA 2EIFA 4TVRA 3QDRB 4KUDK 2DK3A 2CYZB 1RL2A 3QJYA 3T9NA 2LT4A 2VV5A 4BI8B 1H641 2JVVA 2RHZA 5GAN3 1YIJT 5D6YA 2LT1A 3A8GB 4OGEA 3L2WA 3UDCA 3V7CA 3JAME 2MMPA 2X4XA 3OYEA 3OMCA 1YJ9A 4A4KA 1KQSA 3EFSA 2KQWA 2A3LA 4JLIA 5KH6A 2CKKA 1VQ4T 3OYDA 1VQ9T 2OTLT 3PTAA 1KHIA 2K5FA 3OYLA 3TCJA 2CZ0B 2RHYA 2QQ9A 4FU6A 4EPCA 3CMET 4LD6A 1QP3A 3JSCA 2XDBA 3ER0A 5KCHA 2XHCA 2L5QA 2XI9A 4YTLA 2V8IA 4M75B 5CK9A 3JB9G 4C8QB 4M75G 1XTDA 2LCLA 4JRQA 3MP8A 4LDWA 2ZPIB 2RI2A 4C8QG 3OW2A 3CCQT 1I8FA 4PJOA 5C0MA 5CR2A 1PSFA 2YLCA 4ELZC 3M59A 3DKMA 5C6SA 3H8ZA 3JB9I 4M78D 2O01E 4A4HA 1VQMT 1OZ3A 3LW5E 4HCZA 4MMKA 4C0GA 3JCMf 2A7YA 3BDUA 2MI6A 4BD3A 4M77F 5CVIA 5J3BA 2K57A 2ZPEB 1KQSS 3CCMT 2JUFA 2GQVA 2O4XA 3Q1JA 3M57A 4OP0A 3BW1A 4VUBA 1W4SA 4XTZA 4BI4A 5A0LA 3SWNB 3G4ST 1HK9A 3X20B 5CKBA 1B34B 3M9QA 4FT2A 5CAIA 3X28B 3QSUA 5HY6A 5CO7A 3HKSA 1NPPA 2BIVA 5I2MA 5FU6B 3JCMd 3OW2S 3FC3A 4MDXA 2QTXA 3INZA 4C8QC 5GAOn 4OVAA 2DJZA 4B9WA 1N8RU 3OS5A 4DQ2A 3SWNA 4QVCA 4CRIA 2ZPBB 2L3RA 1VUBA 3OS1A 3H6ZA 5KE3A 1VQ7T 4L6V5 4IUTA 4EMKB 4M78A 3JB9J 4O5VA 1IZ6A 4EMHA 5CKEA 4M7AB 1Q86U 1AHJB 4M7AG 3GP8A 1M8VA 1ZQ1A 5IAYA 1G3SA 5CQYA 2F5TX 5FLXE 2G3RA 3RKXA 3NFCA 3ZEHA 1K73U 5LJ3j 4RG8A 4PLLA 4F7UE 2EJFA 3F70A 3JCMQ 4RG2A 4CI0C 2VC8A 3V8JA 3CEYA 2L8DA 2WSEE 5J26A 3JCMh 4BUGA 1UB4A 1KQ1A 1M1GA 4ZGJB 3MO8A 2WACA 1G3TA 3FDRA 5A0DA 5EG2A 2GF7A 3L2RA 1KD1C 2LTOA 4E7JA 3GLXA 2Y90A 2DTOA 3HPWA 3QO3A 3OBWA 1X75C 3V7RA 1VIEA 4C8QE 5GANj 3PGGA 5GAN6 2CZ7B 2ZPHB 3QG1A 4M77A 1Q7YC 3RKYA 1JJ2S 4DOWA 3MCAB 1FX7A 2XDPA 3CPWA 1BI1A 3P8DA 4RCCA 2ZZDA 3KXTA 3S3MA 1UGPB 5LJ3g 1K9MU 3OSSC 3M4GA 2D6FA 3TEEA 1VQPT 2E5QA 3PIPA 2BKDN 1XQHA 4GY5A 5GAMg 2EQJA 4D6WA 1BI0A 2X35A 1VQOT 1YITT 4C92B 3ASKA 4C92G 1YJNA 2DXCA 2RO0A 2MF2A 2DKGA 2P4TA 3PT9A 4P5NA 5GMKi 5GANg 5LJ3f 3JCMW 3QYGB 1VQ5T 3OYYA 5FROA 3I55T 4OMFB 1Q81U 1KQ2A 2QQRA 3JCMe 5GAN8 1WJRA 5GMKm 4NL2A 4BE0A 5FRNA 5GAN7 5CKHA 2E1HA 4X9CA 3SD4A 4J6XA 4XTXA 1XOVA 3C95A 1YJWA 2HD0A 4N0AC 3CCVT 2R58A 2HNIA 4M7AE 1H3ZA 3HL8A 5GANf 2P0PA 2QI2A 4F7UF 3CCRA 2MAMA 3RMSA 4ATOA 3CC2T 4BI3A 2VXEA 2RD1A 2PVGB 2DEQA 1MGQA 2E65A 1BI2A 1O9SA 2X4WA 4HKEA 3OYKA 1IREB 2OAUA 4PJOD 1OI1A 3G71T 5FU7B 4FT4A 3URGA 3UPUA 2ZGWA 3GNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A54 A;  1B34 A;  3JB9 I;  2DZC A;  4M78 D;  4JUV A;  4J6W A;  2E41 A;  3JB9 F;  2DZ9 A;  4MMK A;  4C8Q F;  4M7D C;  1JBM A;  3BDU A;  3JCM f;  4C92 F;  1WPY A;  5LJ5 d;  5GAN 2;  4M7D D;  2YHT A;  4M77 F;  4NOY A;  3V7S A;  2JN0 A;  2K57 A;  2I2L A;  1LOJ A;  5GAM f;  3L1A A;  4OP0 A;  3BW1 A;  3JCM J;  4XTZ A;  1X01 A;  4EMK A;  3AHU A;  3RES A;  5GMK l;  4PJO B;  1N9R A;  3SWN B;  4M7A A;  1HK9 A;  1B34 B;  5CAI A;  3HFN A;  4N0A A;  3QSU A;  4HT8 A;  5LJ3 d;  1BIB A;  4XU2 A;  3JCM d;  4HT9 A;  4XU0 A;  2QTX A;  3INZ A;  4C8Q C;  3JCM c;  4MML A;  5GAO n;  2DJZ A;  4C92 C;  5LJ5 j;  4M77 C;  3RKW A;  4DQ2 A;  4XTY A;  3SWN A;  4C92 D;  4QVC A;  2VXF A;  4J6Y A;  4XU3 A;  1I4K 1;  3EFR A;  2YLB A;  2RB6 A;  3QUI A;  5LJ5 h;  5GAO r;  4EMK B;  4M78 A;  4M78 E;  4M75 F;  2FB7 A;  1I81 A;  4PNO A;  5GAN 5;  3JB9 J;  4EMH A;  4M7A B;  3JB9 H;  3JCM b;  3HSB A;  4M7A G;  1M8V A;  5GAN d;  4M7D A;  4M7D E;  4WF2 A;  3RKX A;  4QVD A;  2EAY A;  2DXT A;  5GMK j;  5LJ3 j;  5GAO m;  4RCB A;  4EMG A;  4F7U A;  4F7U E;  2EJF A;  3BY7 A;  4HA8 A;  4JRI A;  1WQ7 A;  3VU3 C;  3JCM X;  1WQW A;  2VC8 A;  5LJ3 h;  3V8J A;  4PJO G;  5GMK h;  2CGH A;  3JCM h;  1LNX A;  1KQ1 A;  3QHS A;  4M78 B;  5LJ5 g;  4M78 G;  2RM4 A;  5GAO q;  4M75 C;  3RER A;  3JB9 D;  5I21 A;  2EWN A;  2DXU A;  4JRK A;  4PJO F;  4M75 D;  2E10 A;  5GAM h;  3JCM P;  4C8Q D;  5GAN 4;  2Y90 A;  4M7D B;  4PJO A;  2DTO A;  4M7D G;  1M5Q 1;  3QO3 A;  1YCY A;  3V7R A;  4M77 D;  5GAM d;  4C8Q E;  4NL3 A;  5GAN j;  4Y91 A;  3PGG A;  3RUX A;  4C92 E;  4C92 A;  4M78 F;  5GAN 6;  2FYK A;  4M77 A;  4M77 E;  3RKY A;  3SB2 A;  1U1T A;  3BFM A;  4F7U B;  2E64 A;  5GAN h;  4XTW A;  4F7U G;  3JCM V;  1U1S A;  3FB9 A;  4RCC A;  5LJ3 g;  3V8L A;  4XTU A;  1HXD A;  3V8K A;  5LJ5 f;  2RA2 A;  3M4G A;  3JCM g;  5GAO p;  4M7A F;  5LJ5 e;  1N9S A;  3RIR A;  5GAM g;  4PJO C;  3SWN C;  2EJ9 A;  3GIB A;  1TH7 A;  4C92 B;  2DVE A;  4M77 B;  4C92 G;  5GAM j;  4XU1 A;  4M77 G;  3FIF A;  1D3B B;  5DY9 A;  4A53 A;  2DKG A;  1JRI A;  5GMK i;  5GAN g;  3JCM W;  1Y96 A;  4X9D A;  5LJ3 f;  5GMK e;  5LJ3 e;  1H64 1;  4M75 A;  4M75 E;  5GAN 3;  1KQ2 A;  4C8Q A;  4J5Y A;  3JCM e;  1BIA A;  4XQ3 A;  5GAN 8;  3V7C A;  5GMK m;  4NL2 A;  5GAN 7;  4V2S A;  2E1H A;  2EJG A;  4EMK C;  1D3B A;  3EFS A;  5GAM e;  4JLI A;  4X9C A;  4J6X A;  4M7A C;  4M7D F;  4XTX A;  4M7A D;  4N0A C;  5GAO l;  4XTV A;  2HNI A;  4M7A E;  3FJP A;  2DTH A;  5GAN f;  4F7U F;  5GAN e;  1Y96 B;  1I5L A;  2DTI A;  3HFO A;  3L2Z A;  2DEQ A;  1MGQ A;  2E65 A;  2RD1 A;  2VXE A;  4M75 B;  4C8Q B;  4M75 G;  1LJO A;  3JB9 G;  4PJO D;  4C8Q G;  1WNL A;  3JCM Q;  1I8F A;  4PJO E;  2ZGW A;  4M78 C;  2YLC A; 
#chains in the Genus database with same CATH topology
 2PVO B;  4JUV A;  2K9G A;  2LMJ A;  1AWJ A;  2DZ9 A;  5LJ5 d;  3M56 A;  1M1K U;  4R55 A;  5FRM A;  2K79 A;  4OB1 B;  4II1 A;  2K2M A;  3CC4 T;  1RI0 A;  4RTU A;  3CCM A;  1U3O A;  1JO8 A;  2O9S A;  1KC8 C;  2RH2 A;  4PFP A;  3L42 A;  2DD5 A;  4XTY A;  4KGX B;  2DPP B;  3NTH A;  4KUL A;  3G4S Q;  2IG0 A;  5HCK A;  3VRZ A;  2QA4 A;  4QVD A;  2JTF A;  3A1P A;  2LRQ A;  4M7A F;  3CCS A;  4E7L A;  2FHD A;  2FRY A;  3QWY A;  4M78 B;  5I11 A;  3UA7 A;  2BTT A;  3I56 A;  1OPL A;  3BE3 A;  1UG1 A;  2VGM A;  3OYH A;  4NL3 A;  1NEG A;  2RJC A;  3RMQ A;  3LH5 A;  5IN1 A;  4CC4 B;  1E6G A;  4ZGD B;  3WVD B;  1QCF A;  3LLR A;  1MMN A;  4B6M A;  2ZAE A;  4JZ4 A;  3ZL7 C;  1IO6 A;  3EGD A;  1FWZ A;  5FU6 C;  2GTJ A;  2K7A A;  2NUT A;  4AFS C;  3OYJ A;  1K0S A;  1V29 B;  3CMA A;  4V2S A;  1Q81 R;  5DM7 R;  2J6F A;  3I55 A;  2DVJ A;  1VQO Q;  2J6K A;  4M7A C;  2KAF A;  2HQX A;  3LWH A;  4KH1 B;  2A37 A;  4MZM A;  2V8J A;  2KNB B;  4IUR A;  1AWO A;  1D0X A;  1G5V A;  1U5S A;  3VS4 A;  4Z02 A;  2IPO B;  1WNL A;  2XU8 A;  5A0G A;  2EWN A;  2ESW A;  3CCE A;  1K8A C;  2DRM A;  1A0N B;  1JBM A;  2PNI A;  1WPY A;  3PMI A;  5GJW B;  3DB3 A;  3G7Z A;  2PQW A;  4L59 A;  1AEY A;  2L89 A;  2YUQ A;  1RAE B;  3ZBD A;  2HDA A;  2CP3 A;  2DFU A;  1VQ4 A;  1VQ9 A;  1N5Z A;  1BIB A;  1SSF A;  2LP5 A;  5KYW A;  2XMF A;  2HSP A;  1MMD A;  2DAQ A;  4IUU A;  5CKF A;  3CC4 Q;  1VQ8 T;  3EFR A;  4DBQ A;  5D6W A;  5GAO r;  2BZY A;  2KRS A;  3I9Q A;  4AT1 B;  1RAA B;  3JB9 H;  3LGL A;  5CCA A;  1UJ0 A;  1VQM A;  3L2Q A;  1BYM A;  2HBW A;  1BU1 A;  4UC4 A;  2L3S A;  5D6X A;  2QG9 B;  4J9G A;  2LCC A;  1UUE A;  1I07 A;  3QYH B;  3JB9 D;  4F16 A;  4M75 D;  2E10 A;  5FU7 C;  1M5Q 1;  2P4R A;  1YJW T;  5FWB A;  1EZZ B;  2QGG A;  5GAN h;  4F7U G;  2RQW A;  3JCM V;  1H3H A;  2YDL A;  3L2V A;  4C5I A;  3VS0 A;  3JCM g;  2CUD A;  2AHJ B;  3OA6 A;  2VKN A;  2PTK A;  3LWI A;  2RF0 A;  2K5L A;  1ABQ A;  2BE9 B;  1NLO C;  4R0K A;  1D3B B;  1X27 A;  4J83 A;  5KYX B;  2QTV A;  3QKJ A;  5LJ3 e;  1MNE A;  1R8O B;  4M75 A;  4HCB A;  5I2S A;  1WDX A;  1TWB A;  1UGR B;  2EJG A;  1D3B A;  1GXI E;  2EYZ A;  5KYX A;  2COY A;  1MHN A;  2G6F X;  3MHX A;  4AFU C;  4PFZ A;  2QA4 Q;  1Y96 B;  1JB0 E;  2ZPF B;  3OY9 A;  1ZBJ A;  4A63 B;  3CCS Q;  3S3N A;  3OS2 A;  1B34 A;  4OMP A;  2DZC A;  2E41 A;  1YIT A;  3I5S A;  2Z0W A;  2M0O A;  3I56 Q;  4C92 F;  3C94 A;  2JN0 A;  2K2V A;  1KC8 U;  2YXY A;  2LNH B;  3JCM J;  1PRL C;  2DL4 A;  1W2B A;  4BE1 A;  3CCV A;  3JCM c;  1TXQ A;  3MEU A;  1V76 A;  2YLB A;  4DBH A;  3CBO A;  2O2O A;  1I81 A;  1UGS B;  1MMG A;  3WXM B;  4LDU A;  3M53 A;  4OMO A;  4EDU A;  4E7Z A;  1KD1 R;  5IT9 E;  1VYT A;  2PU9 B;  1TG0 A;  1Y57 A;  3VS2 A;  1GRI A;  1Q7Y R;  5GAO q;  4M7D G;  3R6N A;  2H3J A;  2KRN A;  3KUF A;  3X24 B;  3CD6 A;  1OYX A;  2DE0 X;  2NLU A;  3NMZ C;  2FL7 A;  5LJ5 f;  1VQK T;  1NYG A;  2JW4 A;  4M4Z A;  1YJN T;  1KIK A;  2DL7 A;  4J9E A;  2YRD A;  1TH7 A;  3VUZ A;  2XKO C;  2CUB A;  4LDV A;  4Q5W A;  2EQK A;  3VS6 A;  1VQ4 Q;  2KE9 A;  1JXO A;  4TVR A;  1M30 A;  2LT4 A;  1MV3 A;  2RHZ A;  5GAN 3;  1X2K A;  3EG3 A;  3UDC A;  3OMC A;  1TUG B;  2KQW A;  4RTX A;  2A3L A;  2CSQ A;  2CKK A;  3M0S A;  5KH6 A;  1K1Z A;  2OTL T;  1KHI A;  2K5F A;  3OYL A;  1NJI R;  2RHY A;  1QKW A;  4FU6 A;  1VQM Q;  3CME T;  1QP3 A;  1U06 A;  3ER0 A;  1QMC A;  1KK7 A;  1MND A;  5KCH A;  4LE9 A;  4YTL A;  1RAH B;  4JRQ A;  2JS0 A;  3MP8 A;  4C8Q G;  5D7U A;  4PJO A;  5C0M A;  4RUG A;  2YLC A;  5C6S A;  1I0C A;  4MMK A;  4HCZ A;  2MI6 A;  4AMC A;  2ZPE B;  3G1J A;  2GQV A;  1WHM A;  3BW1 A;  3NGP A;  2LX7 A;  4XTZ A;  4BI4 A;  1SEM A;  1K73 R;  3M9Q A;  2BZX A;  3X28 B;  5HY6 A;  3REA B;  5FU6 B;  3JCM d;  3OW2 S;  4MDX A;  5GAO n;  3INZ A;  4C8Q C;  3OS5 A;  4CRI A;  3H6Z A;  4L6V 5;  4IUT A;  1AWW A;  1IZ6 A;  4M7A B;  1M8V A;  1ZQ1 A;  5CQY A;  5FLX E;  3NFC A;  5LJ3 j;  2F2V A;  3V8J A;  3CEY A;  2WSE E;  5J26 A;  4BUG A;  3MO8 A;  4F17 A;  1SKU B;  3TVT A;  3FDR A;  4AFZ C;  2FPD A;  1GCQ A;  3OBW A;  1VIE A;  4C8Q E;  1CKB A;  2OI3 A;  2CZ7 B;  2ECZ A;  1AZG B;  4DOW A;  2XDP A;  2YWW A;  4FW1 A;  3S3M A;  1W70 A;  3TEE A;  2LJ1 A;  2RQT A;  3PIP A;  1C0M A;  1OUL A;  2BKD N;  4GY5 A;  4DBR A;  5GAM g;  2EQJ A;  2L3Q A;  1R77 A;  2AZV A;  3PT9 A;  1RI9 A;  3I35 A;  3UA6 A;  1YP5 A;  1VQK Q;  2GNC A;  4E7S A;  1KQ2 A;  2QQR A;  5GAN 8;  2DRK A;  4BE0 A;  5GAN 7;  2E1H A;  1M1K R;  5IHK A;  2GQI A;  1M3A A;  3EFO A;  1TUC A;  4Z89 A;  3CCL Q;  1H3Z A;  3OW2 P;  3HL8 A;  1LCK A;  4PK4 A;  1FMW A;  2HEQ A;  4BI3 A;  3CC2 T;  2RD1 A;  2PVG B;  2NYS A;  2QAZ A;  2LZ6 B;  3OYK A;  1OI1 A;  3G71 T;  5FU7 B;  2OTL Q;  3JB9 F;  2QGF B;  4J8O A;  3CCQ A;  2CP5 A;  1D0Z A;  2OTJ T;  2F1L A;  3KBG A;  1N9R A;  4ZGE B;  2YSQ A;  2CRE A;  1YNZ A;  1UGQ B;  3CCJ T;  5CQX A;  4HVV A;  2LQK A;  9ATC B;  1I4K 1;  5LJ5 h;  1QWF A;  4J9D A;  3MEW A;  3H41 A;  1D1B A;  1SRM A;  4JS4 A;  2LQN A;  4A4F A;  1QP2 A;  1OEB A;  1QWE A;  4F7U A;  3AHU A;  1WZO A;  4ORZ A;  1YBY A;  4E47 A;  4OMN A;  1M90 C;  1IHW A;  2C0O A;  4M75 C;  4E7H A;  1YJ9 T;  4JRK A;  2CP2 A;  4BB7 A;  4C0Z A;  2A0F B;  4Y28 E;  1S72 A;  2EKO A;  5GAO m;  4PLI A;  1U1T A;  4JLG A;  4XTW A;  2XDD A;  1VQ6 Q;  3CCU A;  2FZG B;  3LX7 A;  3L2U A;  1NBE B;  3OYN A;  2JNG A;  2K4Y A;  1X69 A;  3A8H B;  3O5Z A;  5GAM j;  2RQR A;  4M77 G;  2MPX C;  3FIF A;  1UGV A;  2HQH A;  2AK5 A;  4M75 E;  4J5Y A;  1WJS A;  3O8V A;  3M0U A;  4C5H A;  4HVU A;  4JS5 A;  3OYA A;  2EYW A;  2D1X A;  4LDX A;  4FIB A;  2AT1 B;  2DL8 A;  1ARK A;  4IUQ A;  1QVF P;  2GCX A;  1C1A A;  1YFN A;  4HXJ A;  4ANJ A;  4Y92 A;  3A5Z B;  2B86 A;  4OB3 B;  2EKH A;  2ZPG B;  4M7D D;  2V8K A;  1WHK A;  2YHT A;  2O88 A;  1Z9Z A;  1LOJ A;  4FYY B;  3JRZ A;  2PUO B;  1YIJ A;  3G71 Q;  1BKB A;  5GMK l;  4PL6 A;  2I0N A;  2X3W D;  4N0A A;  4QW2 A;  4QKU A;  2CP7 A;  3EGU A;  3S3O A;  2OTJ Q;  2PZ1 A;  4BE2 A;  3CBP A;  2RJD A;  4XU3 A;  1GFD A;  1YI2 A;  5DLQ E;  2KRO A;  4DA4 A;  4EIK A;  1R0B G;  2L3P A;  2DEU A;  2MYS A;  4F04 B;  2EQU A;  4M7D A;  2WSF E;  1T3S A;  5KYY A;  2EAY A;  3CCJ Q;  1WX6 A;  2R5A A;  4EMG A;  4HA8 A;  4ZN1 A;  4JRI A;  2RI3 A;  4RTV A;  4PJO G;  1Y0M A;  2DXB A;  1OOT A;  2HQE A;  3JCM P;  2KK4 A;  2KT8 A;  4C8Q D;  4J9I A;  1YCY A;  1T0J A;  3E9G A;  1ABO A;  1D1A A;  1WHJ A;  3FB9 A;  1QVP A;  3DLL A;  4XTU A;  2RA2 A;  1KHC A;  1YJ9 Q;  2D9T A;  3QJ6 A;  2VYT A;  3RIR A;  4ELY C;  4PJO C;  1TS9 A;  3EG1 A;  3PIO A;  1UDL A;  1H8K A;  1JRI A;  2FPE A;  4X9D A;  1VYV A;  3J80 E;  1ACM B;  4C8Q A;  1S1N A;  2VVK A;  2RHI A;  3VS7 A;  3GF5 A;  2QXF A;  1WJQ A;  3OYM A;  2ROT A;  3FJP A;  3EGD B;  5LL6 S;  2CS7 A;  2Y4X A;  4E7I A;  1Q81 C;  5GAN e;  2NUT B;  1VQP A;  1G8X A;  4PJO E;  2AZS A;  3AT1 B;  4A54 A;  3A98 A;  2LVM A;  3OMG A;  4ME7 A;  2QA4 T;  2R5M A;  2EPD A;  1YN8 A;  3SDZ A;  3CCS T;  1S72 Q;  3L1A A;  1VQ5 A;  2JM8 A;  1QKX A;  1HJD A;  2QQB A;  4EMK A;  3SFM A;  3H0H A;  2DX1 A;  2NUP B;  1WGS A;  2M1H A;  3I56 T;  3CCU Q;  4KGV B;  2X51 A;  2M02 A;  4NS5 A;  1AD5 A;  1GCQ C;  2KYM A;  2DBM A;  2NUP A;  2KGT A;  4C5G A;  1SPK A;  4BY6 C;  3OYB A;  2KSS A;  2RB6 A;  4JJD A;  4OB2 B;  3OYI A;  1M90 U;  4R56 A;  1N27 A;  1VQ8 A;  2XD0 A;  5KYU A;  5KYW B;  1BI3 A;  2JT4 A;  5IHI A;  5IXF A;  4J7I A;  4FM4 B;  4DBF A;  1LNX A;  1R0C B;  1YHQ A;  3CMA T;  4D8K A;  1CKA A;  1RAF B;  2DXU A;  5I21 A;  4QQ6 A;  3RR6 A;  2EGE A;  1W1F A;  3M0R A;  1RUW A;  2EQM A;  3CBM A;  3TSW A;  4GBQ A;  1T0H A;  5GAO p;  1AZE A;  2O9V A;  2KI7 A;  2C0T A;  2K3B A;  4BAC A;  3CCE T;  2QDY B;  2P0Q A;  2DL3 A;  1VQL A;  4C5E A;  1Q82 C;  2EIF A;  2D8J A;  4KUD K;  2DK3 A;  5FW9 A;  3QJY A;  3T9N A;  4OGE A;  3JAM E;  3OYE A;  4A4K A;  1ZA2 B;  1YI2 Q;  1T3L A;  4JLI A;  1VQ4 T;  1VQ9 T;  3OYD A;  2EVR A;  3PTA A;  1M2V A;  3TCJ A;  2QQ9 A;  3ULR B;  6AT1 B;  1WHL A;  2YUO A;  2XI9 A;  2L5Q A;  2V8I A;  4M75 B;  5CK9 A;  1K4U S;  4J9B A;  1JJ2 P;  3CCM Q;  2RMO A;  2ZPI B;  2RI2 A;  3OW2 A;  4ELZ C;  3H8Z A;  2X9H A;  1VQM T;  1X2Q A;  3LW5 E;  3BDU A;  2L2P A;  4BD3 A;  5CVI A;  2HSE B;  1KQS S;  1UJY A;  2KXC A;  2O4X A;  2JM9 A;  1HD3 A;  4OP0 A;  1G83 A;  1UHF A;  5CKB A;  1B34 B;  3QSU A;  1NPP A;  4LUD A;  5I2M A;  2QTX A;  2DJZ A;  3EGX A;  4QVC A;  1E7O A;  3QWX X;  4EMH A;  5CKE A;  1AHJ B;  3GP8 A;  1G3S A;  1D0Y A;  3I5R A;  3RKX A;  1QQJ A;  1FMV A;  4PLL A;  4F7U E;  4CI0 C;  1QCN A;  1PCX A;  3JCM h;  1OX8 A;  2BE7 D;  4GLM A;  1M1G A;  4ZGJ B;  2H8H A;  4QT7 A;  1KD1 C;  2GF7 A;  4E7J A;  3HPW A;  3V7R A;  5GAN j;  5GAN 6;  2ZPH B;  4M77 A;  1Q7Y C;  1QVG P;  3EHR A;  1FX7 A;  3KXT A;  5LJ3 g;  1ZSZ A;  3CMA Q;  2OJ2 A;  1SG5 A;  3I55 Q;  1YIT T;  4C92 G;  1YJN A;  2RO0 A;  4P5N A;  2P4T A;  1KQS P;  2CP0 A;  3QYG B;  3OYY A;  5FRO A;  1Q81 U;  1PG5 B;  2FO0 A;  5IHN A;  4NL2 A;  3CCE Q;  1KJW A;  4XTX A;  3C95 A;  4N0A C;  3CCV T;  2R58 A;  2HNI A;  2QK0 A;  3CCR A;  2MAM A;  1WFW A;  2VXE A;  4KH0 B;  4PJO D;  1IRE B;  2OAU A;  3CME A;  1NJI C;  2ZGW A;  3CCL T;  2D0Q B;  1MUZ A;  3NHN A;  3NPF A;  4X34 A;  1VQ9 Q;  1QVF A;  1IXD A;  1YHQ Q;  1VOM A;  4M7D C;  4C8Q F;  1BCO A;  3VUB A;  3LYI A;  4ESR A;  2CZ6 B;  2DO3 A;  2NUZ A;  7AT1 B;  3U23 A;  3VYH B;  2DF6 A;  2K3X A;  2VWF A;  3MP1 A;  1M2O A;  4PJO B;  1K8A U;  2IIM A;  3N5B B;  2RJE A;  3QBY A;  3VS3 A;  2QAS A;  1K73 C;  3CD6 T;  2W10 A;  1VQL Q;  3UWN A;  1N8R R;  1VQN A;  3E19 A;  4KBM B;  2DD4 A;  4M7D E;  5HK3 A;  1O75 A;  3G6E A;  2KT1 A;  3LH0 A;  1Z9Q A;  4IIM A;  4RKU E;  2M0Y A;  4JRP A;  3VU3 C;  1WQW A;  5GMK h;  2A28 A;  3MP6 A;  1RLQ C;  4M78 G;  1TU0 B;  3CPW P;  4OMM A;  4J7F A;  1NYF A;  4Y91 A;  3RUX A;  4FSX A;  1RAB B;  1IRX A;  3C12 A;  5I22 A;  1Q82 U;  2PUK B;  5LJ5 e;  2E3H A;  2ZCF B;  5KCO A;  2RPN A;  1K9M R;  1JU5 C;  2X4Y A;  3QPH A;  1HSQ A;  3SWN C;  3OYF A;  1VQ6 T;  2M16 A;  2DVE A;  5IXB A;  4JJC A;  4BY6 B;  4CC2 A;  1ZLM A;  2E3I A;  2JZ2 A;  3CC7 A;  2RJF A;  1IGU A;  2QYZ A;  2QEX A;  2LJ3 A;  1VIF A;  2DL5 A;  4J9C A;  4EMK C;  2Y4Y A;  5L8R E;  2D8H A;  1YIT Q;  2KMT A;  3EG0 A;  1TUD A;  2MIO A;  2DTH A;  4RTY A;  3PFS A;  3UAT A;  2VGN A;  1M1K C;  3WVE B;  4WTO B;  1J3T A;  1EIF A;  1HYO A;  4BDZ A;  2GTO A;  1M4Z A;  1YCS B;  4B9X A;  1SHF A;  5HKC A;  1KG1 A;  3CC2 A;  3EH2 A;  3CCV Q;  3EFO B;  2E4H A;  1WIE A;  2I2L A;  3TRE A;  4CC7 A;  1RAG B;  1PM3 A;  3S6W A;  3GOX A;  1X01 A;  3M5A A;  1BK2 A;  2PVD B;  3OS0 A;  3PNW C;  5LJ3 d;  2EYQ A;  2RK2 A;  2CH4 W;  4HT9 A;  3QZ9 B;  2M51 A;  1X6B A;  4KGZ B;  2XID A;  1OZ2 A;  3RKW A;  1Y7X A;  3H0F A;  4JDS A;  4M75 F;  2F2X A;  4F14 A;  3ZFJ A;  2QDL A;  2ATC B;  3HSB A;  4MZP A;  1KD1 U;  2KBT A;  3BY7 A;  3CD6 Q;  1SSH A;  3FLG A;  1Q86 C;  2MK5 A;  1KFZ A;  1YWO A;  4KUI A;  3HRU A;  1M3C A;  2EGA A;  2DET A;  1G3Y A;  4JJN K;  5GAM h;  3G4S A;  2DYI A;  2FPF A;  2DJQ A;  2CZ1 B;  1QVF S;  1GFC A;  1RLP C;  2J05 A;  3CXC P;  4F7U B;  2C0I A;  4LN2 A;  5IH2 A;  2P0K A;  3EG9 A;  1VQ7 A;  1HXD A;  3QZ5 B;  2LX9 A;  3VYG A;  4PKC C;  4QQD A;  2LDM A;  2YRC A;  2K6D A;  2YUP A;  3VS1 A;  3VV0 A;  1B07 A;  4BDY A;  4GLK A;  1NJI U;  3HRS A;  5FWC A;  3THK A;  3MPU B;  2X4J A;  1VQN Q;  3QDF A;  3ME9 A;  4FYX B;  1PD0 A;  2DTI A;  1VA7 A;  3HFO A;  3UF4 A;  3REB B;  4X1V A;  2HBP A;  2KDS A;  1LJO A;  2MCN A;  4A4G A;  1NE8 A;  1BIA A;  4OGC A;  4O6J A;  2EW3 A;  1VQO A;  1JJ2 A;  3HRT A;  5ECA A;  1X43 A;  4NOY A;  1Y71 A;  4OB0 B;  4QQG A;  1Y07 A;  3RES A;  3X26 B;  1PRM C;  1ZBX A;  1S72 T;  4PJL A;  4XU2 A;  1WLP B;  4QVZ A;  1WI7 A;  5LJ5 j;  4M77 C;  4C92 D;  2RQV A;  4J6Y A;  1AWX A;  2NWM A;  4IUP A;  3CCU T;  2WSC E;  4C0D C;  2F5K A;  4LXC A;  1PD1 A;  2CP6 A;  1ZSZ C;  2V26 A;  3TQ7 P;  3DB4 A;  8ATC B;  1LVK A;  3OB9 A;  3CC7 Q;  3C0C A;  2QEX Q;  4WF2 A;  4E2F B;  4RCB A;  3A8O B;  1X6O A;  1FXX A;  2VAS A;  1KSW A;  3CC4 A;  3H9N A;  3QXE B;  3DLM A;  5L23 A;  1WHG A;  3RER A;  2RHU A;  3GNF B;  3M4Y A;  4PJO F;  3OYG A;  4M7D B;  1SF9 A;  5KYY B;  5GAM d;  1GCP A;  4C92 A;  4M77 E;  3BFM A;  1EFN A;  4IIO A;  2DIL A;  5KYN A;  2KVQ G;  2QQS A;  2F69 A;  1QVG A;  3TU4 K;  2EJ9 A;  1GBR A;  5A2Q E;  2FG0 A;  3VJP A;  2E12 A;  1RL2 A;  4CC3 A;  2VV5 A;  4BI8 B;  1YIJ T;  2GGR A;  3IQL A;  2LT1 A;  4RTZ A;  3L2W A;  2X4X A;  2DM1 A;  1KQS A;  3EFS A;  2DLP A;  1M8M A;  2CT4 A;  4AG2 C;  3CCQ Q;  3FJ5 A;  1FMK A;  1FYN A;  2CZ0 B;  4EPC A;  3JSC A;  3M0Q A;  1ZUY A;  1YI2 T;  4C8Q B;  3M0P A;  1XTD A;  1I8F A;  3E2U A;  4M78 D;  3EG2 A;  4A4H A;  1OZ3 A;  4OML A;  3JCM f;  2ABL A;  5J3B A;  3M0T A;  2K57 A;  3CCM T;  2JUF A;  1B7T A;  1AT1 B;  4JZ3 A;  4VUB A;  1W4S A;  1ZUU A;  1KC8 R;  3SWN B;  1VQ7 Q;  2H3E B;  1WA7 A;  1UHC A;  3HKS A;  2ROL A;  1QCO A;  2YT6 A;  3FC3 A;  1UTI A;  2KYB A;  4B9W A;  3SWN A;  1UEC A;  4J9F A;  2L3R A;  1M3B A;  1UE9 A;  2DYB A;  1C6V X;  2HMA A;  4M78 A;  2CH4 A;  4EMK B;  2EYY A;  3JB9 J;  1Q86 U;  4M7A G;  2V1Q A;  2F5T X;  4OMQ A;  2O31 A;  4RG8 A;  1OPK A;  2EJF A;  3F70 A;  2VC8 A;  2JTE A;  2AKL A;  2FRW A;  2J6O A;  2E5K A;  2WAC A;  1G3T A;  5EG2 A;  2LTO A;  2Y90 A;  5KYU B;  3QO3 A;  1X75 C;  1JJ2 S;  3MCA B;  3CPW A;  1BI1 A;  2ZZD A;  1CSK A;  1UGP B;  2LQW A;  4FYW B;  3OSS C;  1VQP T;  2E5Q A;  4FW2 A;  2COW A;  1XQH A;  4D6W A;  2X35 A;  2DER A;  2DXC A;  1MMA A;  1WYX A;  2DKG A;  5GAN g;  5GMK i;  3JCM W;  5LJ3 f;  3VRY A;  1VQ5 T;  3I55 T;  1D09 B;  4FSS A;  3JCM e;  1WJR A;  5GMK m;  5CKH A;  1I1J A;  1WHH A;  4J6X A;  2JS2 A;  1XOV A;  5AT1 B;  2EBP A;  1MV0 B;  2HD0 A;  1YJW A;  4M7A E;  2J06 A;  2P0P A;  4F7U F;  1TSF A;  3PE0 A;  1K8A R;  4ATO A;  1YIJ Q;  2DEQ A;  1MGQ A;  1BI2 A;  2X4W A;  2RN8 A;  4FT4 A;  1JXM A;  3URG A;  4D8D A;  2DIG A;  3EAE A;  2EQI A;  2ENM A;  1M2V B;  2K3Y A;  2LJ0 A;  3NTI A;  4KRT A;  1K76 A;  1BBZ A;  4HCC A;  4E6R A;  1YHQ T;  1QVG S;  2D0N A;  1UFF A;  3HFN A;  1PSE A;  3M55 A;  2M9U A;  1ZSG A;  1PKT A;  3HP9 A;  2O4X B;  1ZX6 A;  2A36 A;  4LD9 K;  4KT0 E;  4PJJ A;  2XG8 D;  2JMA A;  4ZTJ A;  3A8L B;  2DXT A;  1Q82 R;  3MKD A;  1VQL T;  1VYU A;  3EGX B;  3R6O A;  5M9O A;  1OQK A;  3E1S A;  1OU9 A;  1GBQ A;  2C06 A;  3FRN A;  5GAN 4;  1TTH B;  1QW1 A;  4M77 D;  3JV3 A;  1U1S A;  4RMO A;  3CXC A;  4RTT A;  3C4S A;  4LUE A;  2GBQ A;  2E6Z A;  2FVU A;  2OX7 A;  4LDY A;  3EHQ A;  2X3X D;  3BDL A;  1G2B A;  4RTW A;  4M77 B;  3D7S B;  4A53 A;  2KR3 A;  4C0D B;  1Y96 A;  2FEI A;  5GMK e;  1VQP Q;  3A8M B;  1ZSZ B;  4XQ3 A;  3PMT A;  5DLO A;  1DJ7 B;  3OQ5 A;  4M7D F;  2XK0 A;  4XTV A;  1VQ5 Q;  3TSZ A;  2CDT A;  1NZ9 A;  1RAI B;  1VQK A;  1Q95 G;  2JTM A;  2EGC A;  3VS5 A;  2HCK A;  1SHG A;  2SEM A;  2FZK B;  2VUB A;  1PWT A;  1G3W A;  1LPL A;  3V7S A;  3CCL A;  1H92 A;  3CPW S;  4IKF A;  2B8A A;  5GAM f;  5J39 A;  1D1C A;  4PFO A;  2E70 A;  2ED1 A;  2VB6 A;  3OYC A;  2HL3 A;  2GFU A;  1VQ8 Q;  2CT3 A;  3MET A;  5EC7 A;  2MOX A;  2HAX A;  3EH1 A;  1NPR A;  2OTL A;  1AVZ C;  4DEY A;  3RDV A;  4ZTF A;  3RNJ A;  4C92 C;  2RHX A;  1YWP A;  3QUI A;  3P8B B;  2LC4 A;  4XK8 E;  2FB7 A;  5GAN 5;  4MZT A;  3JCM b;  2HZY A;  1XNI A;  5GAN d;  1IHV A;  4A4E A;  1K9A A;  1N8R C;  4C0F A;  4MDW A;  5CKD A;  1WQ7 A;  5LJ3 h;  1RAD B;  3PVQ A;  1YJW Q;  2CGH A;  1JEG A;  2QQA A;  2MWP A;  1E6H A;  2XIC A;  2RM4 A;  1M1F A;  3OBY A;  4L5G A;  3UT1 A;  2LNV A;  3GBQ A;  4ZNX A;  1M27 C;  3CPF A;  1OU8 A;  2COZ A;  1V1C A;  3MEA A;  4M78 F;  2FYK A;  4C92 E;  3SB2 A;  2RI5 A;  1P92 A;  1WXU A;  4HCK A;  8AT1 B;  3MEV A;  3CCR T;  1NEB A;  1ZHI A;  3QII A;  4Z8A A;  3V8L A;  3X25 B;  3M58 A;  5HK0 A;  4N4G A;  1N9S A;  2YUN A;  4Z88 A;  2KY9 A;  2RK1 A;  2EFI A;  5DY9 A;  1K9M C;  4N4I A;  1VQ6 A;  2LQ8 A;  1N6A A;  4ZN3 A;  2FZC B;  5GAM e;  4FL6 A;  4E7K A;  1AOJ A;  4M7A D;  5GAO l;  1WXT A;  1UEB A;  2YRV A;  1I5L A;  2ED0 A;  4FYV B;  1TOV A;  3J7A F;  4DOV A;  3L2Z A;  4OF1 A;  2IVW A;  4IUV A;  1VQN T;  5CIU A;  4M78 C;  3J81 E;  4J6W A;  3G6E T;  2R57 A;  5GAN 2;  1M9S A;  4DEX A;  1JQQ A;  4K11 A;  3CXC S;  1F1B B;  1IB8 A;  1U8R A;  4M7A A;  4JJB A;  4HT8 A;  4FCY A;  1IGQ A;  4J9H A;  4XU0 A;  3P8H A;  2DBK A;  4MML A;  2VXF A;  2BUD A;  2HKQ B;  2HL5 C;  4M78 E;  2BZ8 A;  2OAW A;  1NG2 A;  4PNO A;  3G71 A;  1PNJ A;  2K5I A;  2KXD A;  3GPL A;  5GMK j;  2JOY A;  3JCM X;  1EX4 A;  2OTJ A;  2E6N A;  3NTK A;  1W2B S;  3H0I A;  4XAX B;  3CC7 T;  2GFA A;  3QHS A;  3LGF A;  5LJ5 g;  2QEX T;  2DIQ A;  2AIR B;  4N4H A;  4WCI A;  1YJN Q;  3CCJ A;  2P84 A;  5AYF A;  2E64 A;  4HVW A;  3VKI A;  2DA9 A;  2A08 A;  3OSV A;  3V8K A;  2MWO A;  3PVL A;  5KE2 A;  3E9F A;  1Q7Y U;  3GIB A;  1BB9 A;  3HHT B;  2J7I A;  3SHW A;  4AFQ C;  3M54 A;  4XU1 A;  3FEO A;  3CCR Q;  2KRM A;  2KEA A;  3QDR B;  1OX9 A;  2CYZ B;  1ZUK A;  3EG9 B;  1H64 1;  2JVV A;  5D6Y A;  3A8G B;  3CME Q;  3V7C A;  2MMP A;  1YJ9 A;  5GJV B;  1RAC B;  1BCM A;  4LD6 A;  2XDB A;  4PJN A;  2XHC A;  3JB9 G;  4M75 G;  2LCL A;  2LCS A;  4LDW A;  3CCQ T;  2F2W A;  5CR2 A;  1PSF A;  3M59 A;  3DKM A;  3JB9 I;  2O01 E;  4C0G A;  2A7Y A;  3RBB B;  1X6G A;  4M77 F;  1K0X A;  1Q86 R;  3Q1J A;  3M57 A;  1W2B P;  1SRL A;  2RQU A;  3SEM A;  5A0L A;  3G4S T;  1HK9 A;  3X20 B;  4FT2 A;  5CAI A;  1PKS A;  3G6E Q;  1XJW B;  1B3Q A;  5CO7 A;  2BIV A;  2HKN A;  4OVA A;  1N8R U;  4DQ2 A;  2ZPB B;  1VUB A;  3OS1 A;  5KE3 A;  1VQ7 T;  2SRC A;  4O5V A;  5IAY A;  2G3R A;  2JJ9 A;  1M90 R;  3ZEH A;  4AG1 C;  1W6X A;  1K73 U;  1QLY A;  2L0A A;  3JCM Q;  2DNU A;  4RG2 A;  2L8D A;  1ZA1 B;  1GL5 A;  1UB4 A;  1KQ1 A;  1I5O B;  3MJX A;  2AKK A;  5A0D A;  3L2R A;  3GLX A;  2DTO A;  2V1R A;  1WXB A;  3PGG A;  3QG1 A;  3RKY A;  2JMC A;  3P8D A;  4RCC A;  1K9M U;  3M4G A;  2D6F A;  4JPB W;  2EYX A;  1PC0 A;  1NM7 A;  4LNP A;  1BI0 A;  1VQO T;  4C92 B;  4PJM A;  3ASK A;  3KFV A;  3CQT A;  2CSI A;  2MF2 A;  1NLP C;  1PHT A;  2W0Z A;  2DMO A;  1OV3 A;  4OMF B;  5FRN A;  3CC2 Q;  4X9C A;  3SD4 A;  3HTR A;  5GAN f;  2QI2 A;  3RMS A;  2JXB A;  2E65 A;  1O9S A;  4HKE A;  2RNA A;  3UPU A;  3GNG A; 
#chains in the Genus database with same CATH homology
 3CCL T;  2D0Q B;  2DIG A;  3EAE A;  2PVO B;  4X34 A;  4JUV A;  1QVF A;  3JB9 F;  2DZ9 A;  4M7D C;  4C8Q F;  4J8O A;  3VUB A;  3CCQ A;  5LJ5 d;  3LYI A;  2K3Y A;  3M56 A;  4R55 A;  1M1K U;  5FRM A;  2CZ6 B;  2DO3 A;  4OB1 B;  3NTI A;  2OTJ T;  3VYH B;  4II1 A;  3CC4 T;  4HCC A;  2K3X A;  1RI0 A;  3MP1 A;  1YHQ T;  1QVG S;  3CCM A;  4PJO B;  3KBG A;  1N9R A;  1K8A U;  3HFN A;  4ZGE B;  1PSE A;  3M55 A;  2M9U A;  3N5B B;  2RJE A;  1UGQ B;  3QBY A;  3CCJ T;  2RH2 A;  5CQX A;  1KC8 C;  3HP9 A;  2LQK A;  3L42 A;  1K73 C;  2DD5 A;  3CD6 T;  4XTY A;  2O4X B;  2DPP B;  1I4K 1;  5LJ5 h;  3UWN A;  4LD9 K;  3NTH A;  3MEW A;  4KUL A;  4KT0 E;  1VQN A;  3E19 A;  2XG8 D;  2IG0 A;  4KBM B;  4JS4 A;  2DD4 A;  4ZTJ A;  4M7D E;  4A4F A;  5HK3 A;  1O75 A;  3A8L B;  2QA4 A;  1QP2 A;  4QVD A;  3G6E A;  2DXT A;  2JTF A;  3LH0 A;  4JRP A;  2LRQ A;  4RKU E;  4F7U A;  1VQL T;  3AHU A;  3VU3 C;  4M7A F;  3CCS A;  3R6O A;  1WQW A;  2FHD A;  5GMK h;  4E7L A;  1YBY A;  5M9O A;  3MP6 A;  3E1S A;  4E47 A;  1M90 C;  4M78 B;  4M78 G;  2C06 A;  4M75 C;  4E7H A;  3FRN A;  4JRK A;  4BB7 A;  4C0Z A;  3I56 A;  1YJ9 T;  4Y28 E;  5GAN 4;  1QW1 A;  2VGM A;  3OYH A;  4M77 D;  4J7F A;  4NL3 A;  4Y91 A;  3RUX A;  1S72 A;  2EKO A;  2RJC A;  4FSX A;  4PLI A;  5GAO m;  1U1T A;  4JLG A;  3RMQ A;  4XTW A;  1U1S A;  3C12 A;  2XDD A;  1YI2 T;  4RMO A;  1Q82 U;  3CCU A;  5IN1 A;  2PUK B;  3LX7 A;  3CXC A;  3C4S A;  3L2U A;  5LJ5 e;  2ZCF B;  2JNG A;  5KCO A;  3OYN A;  2E6Z A;  4ZGD B;  2K4Y A;  2FVU A;  3WVD B;  2X4Y A;  3QPH A;  4LDY A;  3A8H B;  3SWN C;  3OYF A;  3BDL A;  3LLR A;  1VQ6 T;  2M16 A;  2DVE A;  4M77 B;  5GAM j;  4M77 G;  3FIF A;  4A53 A;  1FWZ A;  4BY6 B;  5FU6 C;  4C0D B;  1Y96 A;  5GMK e;  2JZ2 A;  3CC7 A;  3A8M B;  4M75 E;  2RJF A;  3OYJ A;  4J5Y A;  2QEX A;  4XQ3 A;  1V29 B;  3CMA A;  1VIF A;  3PMT A;  4V2S A;  4EMK C;  2Y4Y A;  5DLO A;  1DJ7 B;  5L8R E;  5DM7 R;  1WJS A;  3O8V A;  3OQ5 A;  4C5H A;  3I55 A;  4M7D F;  4JS5 A;  4M7A C;  2KAF A;  3OYA A;  2HQX A;  2KMT A;  2XK0 A;  4XTV A;  4LDX A;  3LWH A;  2DTH A;  4FIB A;  3PFS A;  2VGN A;  1M1K C;  3WVE B;  4MZM A;  2V8J A;  4IUQ A;  4IUR A;  1G5V A;  1NZ9 A;  1EIF A;  2GCX A;  4Z02 A;  1VQK A;  1WNL A;  4BDZ A;  2JTM A;  2XU8 A;  1M4Z A;  5A0G A;  2EWN A;  4B9X A;  5HKC A;  1KG1 A;  3CC2 A;  3CCE A;  3A5Z B;  1K8A C;  2VUB A;  4OB3 B;  2ZPG B;  1JBM A;  1G3W A;  1WPY A;  4M7D D;  3PMI A;  2V8K A;  2YHT A;  3V7S A;  3CCL A;  3CPW S;  2I2L A;  1LOJ A;  3TRE A;  4IKF A;  3DB3 A;  2B8A A;  3G7Z A;  5GAM f;  3JRZ A;  5J39 A;  2PQW A;  3S6W A;  3GOX A;  2PUO B;  4L59 A;  1YIJ A;  1X01 A;  2E70 A;  3OYC A;  3M5A A;  1BKB A;  2L89 A;  2GFU A;  5GMK l;  4PL6 A;  3ZBD A;  2PVD B;  3MET A;  3OS0 A;  4N0A A;  4QW2 A;  3CME A;  1VQ4 A;  3PNW C;  1VQ9 A;  5LJ3 d;  1NPR A;  2EYQ A;  2HAX A;  2RK2 A;  2OTL A;  1BIB A;  1SSF A;  3S3O A;  4HT9 A;  3QZ9 B;  4ZTF A;  2XID A;  4C92 C;  1OZ2 A;  3RKW A;  2RHX A;  4BE2 A;  3CBP A;  2DAQ A;  2RJD A;  4IUU A;  4XU3 A;  5CKF A;  1VQ8 T;  3EFR A;  3QUI A;  1YI2 A;  5DLQ E;  1Y7X A;  5D6W A;  5GAO r;  3P8B B;  2LC4 A;  4XK8 E;  4DA4 A;  4JDS A;  4M75 F;  2FB7 A;  3ZFJ A;  5GAN 5;  4MZT A;  3JB9 H;  3JCM b;  3LGL A;  3HSB A;  5CCA A;  1XNI A;  5GAN d;  2EQU A;  4M7D A;  2WSF E;  4MZP A;  1KD1 U;  1VQM A;  4A4E A;  3L2Q A;  2EAY A;  1BYM A;  1N8R C;  2R5A A;  4UC4 A;  4MDW A;  4C0F A;  4HA8 A;  3BY7 A;  4JRI A;  4EMG A;  1WQ7 A;  2RI3 A;  4ZN1 A;  5LJ3 h;  5CKD A;  5D6X A;  4PJO G;  2CGH A;  3FLG A;  1Q86 C;  2QQA A;  2LCC A;  2MWP A;  4KUI A;  3QYH B;  3HRU A;  2DXB A;  2XIC A;  2RM4 A;  1G3Y A;  1M1F A;  3OBY A;  2HQE A;  4L5G A;  3UT1 A;  5GAM h;  2LNV A;  3G4S A;  4JJN K;  3JCM P;  4M75 D;  2E10 A;  3JB9 D;  2KK4 A;  4C8Q D;  2CZ1 B;  5FU7 C;  1M5Q 1;  3CPF A;  1YCY A;  1QVF S;  1YJW T;  3E9G A;  4C92 E;  3MEA A;  4M78 F;  2FYK A;  3SB2 A;  2RI5 A;  1P92 A;  4F7U B;  5GAN h;  4F7U G;  3MEV A;  3JCM V;  3FB9 A;  1QVP A;  3CCR T;  1ZHI A;  3QII A;  3L2V A;  4C5I A;  3DLL A;  2P0K A;  3V8L A;  1VQ7 A;  4XTU A;  1HXD A;  3X25 B;  2RA2 A;  1KHC A;  3M58 A;  3JCM g;  2AHJ B;  5HK0 A;  4N4G A;  1N9S A;  2D9T A;  3QZ5 B;  3QJ6 A;  3OA6 A;  2LX9 A;  2VYT A;  3RIR A;  3VYG A;  3LWI A;  4ELY C;  4PJO C;  3PIO A;  1NJI C;  4PKC C;  4QQD A;  2K5L A;  2KY9 A;  2RK1 A;  2EFI A;  2LDM A;  1D3B B;  5DY9 A;  1K9M C;  1JRI A;  4J83 A;  4X9D A;  4N4I A;  3QKJ A;  1VQ6 A;  2LQ8 A;  1N6A A;  5LJ3 e;  1R8O B;  3VV0 A;  3J80 E;  4M75 A;  4HCB A;  4C8Q A;  4ZN3 A;  5I2S A;  4BDY A;  1UGR B;  2EJG A;  1D3B A;  2RHI A;  1GXI E;  5GAM e;  3GF5 A;  2QXF A;  4GLK A;  1NJI U;  1WJQ A;  3HRS A;  4FL6 A;  1MHN A;  3OYM A;  4E7K A;  4M7A D;  2X4J A;  5GAO l;  3MHX A;  1UEB A;  3ME9 A;  3FJP A;  2YRV A;  5LL6 S;  2CS7 A;  2Y4X A;  4E7I A;  1Q81 C;  5GAN e;  1Y96 B;  1I5L A;  2DTI A;  1JB0 E;  3HFO A;  4DOV A;  3J7A F;  2ZPF B;  3L2Z A;  3OY9 A;  2HBP A;  2KDS A;  1LJO A;  4OF1 A;  1VQP A;  2IVW A;  4IUV A;  3S3N A;  3OS2 A;  4PJO E;  4A4G A;  1VQN T;  5CIU A;  1NE8 A;  1BIA A;  4M78 C;  4OGC A;  4A54 A;  1B34 A;  3J81 E;  2DZC A;  2LVM A;  4O6J A;  4J6W A;  2E41 A;  3OMG A;  4ME7 A;  3G6E T;  2QA4 T;  2R5M A;  1VQO A;  2R57 A;  1YIT A;  1JJ2 A;  3HRT A;  2M0O A;  4C92 F;  5GAN 2;  1M9S A;  3SDZ A;  4NOY A;  3C94 A;  2JN0 A;  1Y71 A;  3CCS T;  2K2V A;  1KC8 U;  3L1A A;  1VQ5 A;  4OB0 B;  3JCM J;  2QQB A;  4QQG A;  3CXC S;  4EMK A;  3SFM A;  1Y07 A;  3RES A;  3X26 B;  1U8R A;  4M7A A;  3I56 T;  1WGS A;  2M1H A;  1W2B A;  4HT8 A;  4NS5 A;  1ZBX A;  4BE1 A;  1S72 T;  4XU2 A;  4QVZ A;  4XU0 A;  3P8H A;  3CCV A;  3JCM c;  4MML A;  3MEU A;  5LJ5 j;  4M77 C;  4C92 D;  2VXF A;  4J6Y A;  2BUD A;  4IUP A;  4C5G A;  3CCU T;  4BY6 C;  2WSC E;  2KSS A;  2RB6 A;  2YLB A;  2F5K A;  4C0D C;  3OYB A;  3CBO A;  4M78 E;  4PNO A;  1I81 A;  1UGS B;  3G71 A;  4OB2 B;  3OYI A;  1M90 U;  2K5I A;  3WXM B;  4R56 A;  1N27 A;  3DB4 A;  1VQ8 A;  3OB9 A;  2XD0 A;  4LDU A;  4WF2 A;  3M53 A;  4EDU A;  3GPL A;  5GMK j;  2JOY A;  4RCB A;  3A8O B;  3JCM X;  1BI3 A;  1X6O A;  5IT9 E;  2OTJ A;  2E6N A;  3NTK A;  2PU9 B;  1FXX A;  4J7I A;  1W2B S;  4FM4 B;  4XAX B;  3CC4 A;  3CC7 T;  1LNX A;  2GFA A;  3QXE B;  3DLM A;  3QHS A;  3LGF A;  5LJ5 g;  2QEX T;  1YHQ A;  2DIQ A;  5GAO q;  3CMA T;  3RER A;  2RHU A;  2DXU A;  3GNF B;  3M4Y A;  4PJO F;  4N4H A;  5I21 A;  3OYG A;  4QQ6 A;  4M7D B;  4M7D G;  5GAM d;  2H3J A;  4C92 A;  3CCJ A;  4M77 E;  5AYF A;  3BFM A;  3KUF A;  2E64 A;  3VKI A;  3X24 B;  3CD6 A;  2KVQ G;  1OYX A;  2EQM A;  2NLU A;  3CBM A;  2FL7 A;  2QQS A;  3OSV A;  3V8K A;  5LJ5 f;  2F69 A;  2MWO A;  5GAO p;  1VQK T;  1QVG A;  1YJN T;  3TU4 K;  5KE2 A;  4BAC A;  3CCE T;  3E9F A;  2EJ9 A;  2P0Q A;  2QDY B;  1Q7Y U;  1TH7 A;  3GIB A;  3HHT B;  3VUZ A;  2XKO C;  5A2Q E;  3M54 A;  3VJP A;  2E12 A;  4LDV A;  4Q5W A;  4XU1 A;  1VQL A;  2EQK A;  4C5E A;  1Q82 C;  3FEO A;  2EIF A;  4TVR A;  3QDR B;  4KUD K;  2DK3 A;  2CYZ B;  1RL2 A;  3QJY A;  3T9N A;  2LT4 A;  2VV5 A;  4BI8 B;  1H64 1;  2JVV A;  2RHZ A;  5GAN 3;  1YIJ T;  5D6Y A;  2LT1 A;  3A8G B;  4OGE A;  3L2W A;  3UDC A;  3V7C A;  3JAM E;  2MMP A;  2X4X A;  3OYE A;  3OMC A;  1YJ9 A;  4A4K A;  1KQS A;  3EFS A;  2KQW A;  2A3L A;  4JLI A;  5KH6 A;  2CKK A;  1VQ4 T;  3OYD A;  1VQ9 T;  2OTL T;  3PTA A;  1KHI A;  2K5F A;  3OYL A;  3TCJ A;  2CZ0 B;  2RHY A;  2QQ9 A;  4FU6 A;  4EPC A;  3CME T;  4LD6 A;  1QP3 A;  3JSC A;  2XDB A;  3ER0 A;  5KCH A;  2XHC A;  2L5Q A;  2XI9 A;  4YTL A;  2V8I A;  4M75 B;  5CK9 A;  3JB9 G;  4C8Q B;  4M75 G;  1XTD A;  2LCL A;  4JRQ A;  3MP8 A;  4LDW A;  2ZPI B;  2RI2 A;  4C8Q G;  3OW2 A;  3CCQ T;  1I8F A;  4PJO A;  5C0M A;  5CR2 A;  1PSF A;  2YLC A;  4ELZ C;  3M59 A;  3DKM A;  5C6S A;  3H8Z A;  3JB9 I;  4M78 D;  2O01 E;  4A4H A;  1VQM T;  1OZ3 A;  3LW5 E;  4HCZ A;  4MMK A;  4C0G A;  3JCM f;  2A7Y A;  3BDU A;  2MI6 A;  4BD3 A;  4M77 F;  5CVI A;  5J3B A;  2K57 A;  2ZPE B;  1KQS S;  3CCM T;  2JUF A;  2GQV A;  2O4X A;  3Q1J A;  3M57 A;  4OP0 A;  3BW1 A;  4VUB A;  1W4S A;  4XTZ A;  4BI4 A;  5A0L A;  3SWN B;  3G4S T;  1HK9 A;  3X20 B;  5CKB A;  1B34 B;  3M9Q A;  4FT2 A;  5CAI A;  3X28 B;  3QSU A;  5HY6 A;  5CO7 A;  3HKS A;  1NPP A;  2BIV A;  5I2M A;  5FU6 B;  3JCM d;  3OW2 S;  3FC3 A;  4MDX A;  2QTX A;  3INZ A;  4C8Q C;  5GAO n;  4OVA A;  2DJZ A;  4B9W A;  1N8R U;  3OS5 A;  4DQ2 A;  3SWN A;  4QVC A;  4CRI A;  2ZPB B;  2L3R A;  1VUB A;  3OS1 A;  3H6Z A;  5KE3 A;  1VQ7 T;  4L6V 5;  4IUT A;  4EMK B;  4M78 A;  3JB9 J;  4O5V A;  1IZ6 A;  4EMH A;  5CKE A;  4M7A B;  1Q86 U;  1AHJ B;  4M7A G;  3GP8 A;  1M8V A;  1ZQ1 A;  5IAY A;  1G3S A;  5CQY A;  2F5T X;  5FLX E;  2G3R A;  3RKX A;  3NFC A;  3ZEH A;  1K73 U;  5LJ3 j;  4RG8 A;  4PLL A;  4F7U E;  2EJF A;  3F70 A;  3JCM Q;  4RG2 A;  4CI0 C;  2VC8 A;  3V8J A;  3CEY A;  2L8D A;  2WSE E;  5J26 A;  3JCM h;  4BUG A;  1UB4 A;  1KQ1 A;  1M1G A;  4ZGJ B;  3MO8 A;  2WAC A;  1G3T A;  3FDR A;  5A0D A;  5EG2 A;  2GF7 A;  3L2R A;  1KD1 C;  2LTO A;  4E7J A;  3GLX A;  2Y90 A;  2DTO A;  3HPW A;  3QO3 A;  3OBW A;  1X75 C;  3V7R A;  1VIE A;  4C8Q E;  5GAN j;  3PGG A;  5GAN 6;  2CZ7 B;  2ZPH B;  3QG1 A;  4M77 A;  1Q7Y C;  3RKY A;  1JJ2 S;  4DOW A;  3MCA B;  1FX7 A;  2XDP A;  3CPW A;  1BI1 A;  3P8D A;  4RCC A;  2ZZD A;  3KXT A;  3S3M A;  1UGP B;  5LJ3 g;  1K9M U;  3OSS C;  3M4G A;  2D6F A;  3TEE A;  1VQP T;  2E5Q A;  3PIP A;  2BKD N;  1XQH A;  4GY5 A;  5GAM g;  2EQJ A;  4D6W A;  1BI0 A;  2X35 A;  1VQO T;  1YIT T;  4C92 B;  3ASK A;  4C92 G;  1YJN A;  2DXC A;  2RO0 A;  2MF2 A;  2DKG A;  2P4T A;  3PT9 A;  4P5N A;  5GMK i;  5GAN g;  5LJ3 f;  3JCM W;  3QYG B;  1VQ5 T;  3OYY A;  5FRO A;  3I55 T;  4OMF B;  1Q81 U;  1KQ2 A;  2QQR A;  3JCM e;  5GAN 8;  1WJR A;  5GMK m;  4NL2 A;  4BE0 A;  5FRN A;  5GAN 7;  5CKH A;  2E1H A;  4X9C A;  3SD4 A;  4J6X A;  4XTX A;  1XOV A;  3C95 A;  1YJW A;  2HD0 A;  4N0A C;  3CCV T;  2R58 A;  2HNI A;  4M7A E;  1H3Z A;  3HL8 A;  5GAN f;  2P0P A;  2QI2 A;  4F7U F;  3CCR A;  2MAM A;  3RMS A;  4ATO A;  3CC2 T;  4BI3 A;  2VXE A;  2RD1 A;  2PVG B;  2DEQ A;  1MGQ A;  2E65 A;  1BI2 A;  1O9S A;  2X4W A;  4HKE A;  3OYK A;  1IRE B;  2OAU A;  4PJO D;  1OI1 A;  3G71 T;  5FU7 B;  4FT4 A;  3URG A;  3UPU A;  2ZGW A;  3GNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...