2HKNA

Crystal structure of the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Dynactin-1
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hknA00
2E4HA 2E3HA 1WHKA 1TOVA 2CP0A 2HL5C 3RDVA 2M02A 4B6MA 1TXQA 1WHGA 2HQHA 2E3IA 2CP2A 2QK0A 2COYA 1WHJA 2HKNA 2CP7A 1LPLA 2HL3A 3E2UA 1WHLA 2COWA 2CP3A 2CP5A 2COZA 2CP6A 2MPXC 2Z0WA 1WHMA 3TQ7P 1WHHA 1IXDA 2HKQB
chains in the Genus database with same CATH superfamily
2WSCE 4OVAA 1UECA 2GTOA 1UHFA 2HQXA 2RK1A 4Q5WA 3MP8A 1AD5A 3M58A 4C8QF 3JB9I 1IREB 4Z02A 1D09B 1BB9A 1GCQC 4Z88A 4EMKC 2VXFA 3CCJT 2D0NA 2M0YA 4J6YA 2QA4T 3CD6Q 1M1FA 1ACMB 4RMOA 2BZYA 4X34A 2DPPB 4RTVA 4ME7A 2CP7A 2DKGA 1VOMA 1U1SA 3TEEA 2I2LA 1KC8U 1KC8R 2EJ9A 4M7DB 4JZ3A 2KSSA 2EPDA 2VUBA 5GMKi 3CCST 4XQ3A 1UG1A 1AOJA 4JJCA 4MZTA 1M30A 4J9GA 3WVEB 1TUGB 2COYA 1ARKA 1J3TA 5LJ3h 5CVIA 1AVZC 4J5YA 1G8XA 3C95A 1B34B 4PJOD 1Y96B 2YRVA 4M7AB 1YI2A 4LD9K 3REBB 4C8QA 2JMCA 3VS2A 1VQMA 3G6EA 4IIOA 2KDSA 1WNLA 2PQWA 3PMTA 4XTUA 1WJQA 2JM8A 4C92D 1QVFP 4J9HA 3NTIA 2DYIA 3A8HB 3A8LB 1WFWA 5FWCA 2J05A 1WZOA 3PVLA 2E1HA 4FU6A 3OSVA 3I56Q 2CZ0B 2X3WD 5GMKh 2JS2A 4OMLA 1W2BA 1KHCA 4BB7A 3OYFA 4LDVA 1EX4A 1T3LA 1UHCA 2OTLQ 1XTDA 1VIEA 5KYUB 4BI3A 4XU0A 1IGUA 2LX7A 2XDBA 3UF4A 2YRDA 2HBPA 3VS1A 4PJJA 4J7IA 2L5QA 1K76A 4E47A 3M4GA 2RQUA 2MOXA 4PL6A 1OEBA 2CSIA 2QQBA 2SEMA 2XI9A 4XTXA 3OS1A 1TTHB 1MHNA 4C92E 2JT4A 3HRTA 4C0GA 3OYNA 4FT4A 3PTAA 1JU5C 3A98A 4A4HA 4ZN3A 2OTJA 1WX6A 3OS0A 1UTIA 2LZ6B 1SF9A 3META 1M90U 3FEOA 1JB0E 2KVQG 2OJ2A 3UT1A 2P0KA 4C0DC 2CUBA 4ZGEB 4M77G 4M7DD 4Z89A 2DIQA 1RUWA 2MI6A 2ZPHB 3L2RA 4GLKA 1VQ8A 1K9AA 3VKIA 3EG2A 1FMWA 1OPKA 2YRCA 5L8RE 1VQNA 3MEAA 5LJ3d 5KYNA 1AHJB 1RACB 1BKBA 2FL7A 2RF0A 5FWBA 3L1AA 2FZGB 3CC4A 4OMOA 4F7UA 1YI2T 3OB9A 4RG2A 2KYBA 3QYGB 1K9MR 3PFSA 4KT0E 4EMKB 2WACA 3M56A 4A63B 3OMCA 1JJ2S 1FMKA 1AEYA 2LQNA 1M9SA 2HMAA 1TOVA 2CP0A 1WPYA 4N4GA 1UGQB 3G71T 3HSBA 1TS9A 2FPEA 2QAZA 6AT1B 3QZ5B 4EMGA 4NS5A 2DD4A 2V26A 1M8VA 4LN2A 1VQ4Q 2EYZA 4PJOC 3M57A 3OMGA 3RKYA 4C5EA 2EKOA 2IIMA 1VYUA 2MK5A 1PD0A 4J9EA 1YN8A 3EFOB 1G2BA 1K0XA 2YUNA 2K5LA 1RABB 1KSWA 2QDYB 2KYMA 2MCNA 5GAMh 3L2QA 4C0FA 3CMAT 1K8AU 5GAOl 3P8BB 1X43A 2BKDN 3LGFA 2FPDA 3CC7A 1I07A 3CPFA 1YJWA 1RAHB 4M75D 1PSEA 4F04B 4A4EA 1NYGA 2LMJA 1OX8A 3CCVQ 2JTFA 2PUKB 2CKKA 3OW2P 4RTZA 2KY9A 2FZKB 2CZ7B 4KGZB 3JCMX 4KRTA 3FRNA 1AZGB 1I4K1 3L2UA 2X4YA 3E9FA 2VWFA 4JPBW 2EW3A 5CO7A 2EYYA 5CK9A 3INZA 1SSHA 4C8QC 1R0BG 1GCQA 5KYYA 3VS6A 4NL2A 2NUTA 1MNDA 2KMTA 4FYVB 4DA4A 3S3MA 5ECAA 4RTXA 2LDMA 2HSPA 2EQJA 2K2VA 5GAN3 3G7ZA 1NJIU 3A8GB 3JCMh 1OU8A 1NJIC 4EIKA 1SHFA 5EG2A 2ENMA 2K5IA 3G1JA 4M77D 4M7DG 1TWBA 3E19A 3OYBA 1M4ZA 3CBPA 3EGDA 3M0RA 4AFUC 2YT6A 2E3HA 2DM1A 3QUIA 3CPWP 3EGXB 3MO8A 2BZ8A 2EQMA 4PJNA 1Q7YU 4PLLA 3CCSA 1SEMA 1ABOA 1K73U 3S3NA 3JSCA 2BE9B 1GFCA 2DRKA 2DVEA 1K8AR 3C94A 5GAOm 1I81A 3QBYA 3X28B 2BUDA 1QVGS 2MWOA 4AFSC 1G3SA 3TCJA 1T0HA 3CBMA 1RAIB 4YTLA 1WQWA 4XTWA 1OQKA 1D3BA 5IT9E 5FU6B 1V29B 1X2KA 1YCYA 3VRZA 2COWA 2JZ2A 4C8QB 2CP3A 2ROTA 3H41A 3ZFJA 5GMKm 3OY9A 4FYYB 2DJQA 2DNUA 1YJNT 3AHUA 4PKCC 1Y96A 4ANJA 5GAMj 5GJWB 3CC2T 1VQOT 2ZPGB 4XU2A 3V7SA 2EGEA 1KIKA 2EJGA 2CZ1B 3RR6A 3VS7A 3SDZA 1NZ9A 2RNAA 2HKNA 4FT2A 3E9GA 2RI5A 2DERA 4IIMA 2JUFA 3CCLT 3EG1A 1AWOA 5GAN6 1H641 4WCIA 3QO3A 2NUZA 3GNFB 4PJLA 3CXCA 3CCMA 3I5SA 5AYFA 1OZ3A 2CREA 3NHNA 4DBHA 3CCJA 5IN1A 3CBOA 2J7IA 1TU0B 4BI8B 1WHKA 4LDWA 2IG0A 1UGVA 1IRXA 3EFSA 1Q81R 2DTOA 4RUGA 2FYKA 2DA9A 2DK3A 2XHCA 4A4KA 5GJVB 1V76A 3A5ZB 2DBKA 1ZSZA 3QZ9B 3V7CA 5GAN7 1KK7A 1OULA 3RKXA 2KAFA 5HK0A 1YWPA 4M78G 1NLPC 3EHRA 2HKQB 1K73C 4ZNXA 1VQ7Q 1I1JA 1Q7YC 1MV0B 8AT1B 1K1ZA 1KD1U 2RI2A 3CCMT 2KRMA 2I0NA 2GBQA 1QKWA 1ZUYA 4HCZA 4LDYA 2LX9A 2K3YA 3J80E 1VQ8T 2MAMA 4JS5A 1N8RU 2D8HA 2PVOB 1TXQA 3JCMe 1H8KA 2K4YA 3JCMJ 2F5KA 2PU9B 2VC8A 2QTVA 2DTHA 4CC2A 3EFOA 2FHDA 4IURA 4ELYC 1ZSGA 3HTRA 1SKUB 5CKHA 2A08A 4J6WA 4JDSA 4OMQA 3G71A 5CKDA 2YLCA 3DKMA 2ATCB 4FW2A 2QEXA 1MMDA 4ATOA 4IUQA 5CR2A 1FYNA 2D0QB 5GMKe 2HSEB 5HCKA 5D6WA 1LJOA 4JS4A 2GQIA 2RJDA 3Q1JA 2W0ZA 2IPOB 2LCLA 1UGRB 5GAMf 1UGSB 2DRMA 2L3QA 1SG5A 5I2SA 1YJNQ 1UEBA 3CXCP 4AMCA 1PCXA 4M7DC 4ZTFA 3QG1A 5A0LA 4WTOB 3H6ZA 2E70A 1EZZB 2M51A 1SRMA 1HJDA 3I55A 4FYWB 3CCQA 3E1SA 5DLOA 3OW2S 1M27C 1YWOA 4J8OA 4C8QG 1ZA2B 1Q82R 2DJZA 1VQ9T 1S72A 2EGCA 2EYQA 4GBQA 4FM4B 1N5ZA 4M75E 2W10A 4PJMA 1UUEA 4WF2A 3CMAQ 4BE0A 4BACA 4J9DA 4E7JA 3BFMA 3L2WA 2O01E 1QWFA 4RKUE 1M1KC 3UPUA 1WYXA 2KQWA 4KBMB 4J9BA 2VV5A 1WA7A 2DAQA 3MPUB 1M3CA 1VQ8Q 2LJ3A 3MP6A 2OTLT 1AWXA 3CCUT 2L3PA 1YP5A 2RJCA 3SWNA 1VQMT 3NTKA 2CYZB 1PWTA 2RI3A 2R5MA 1NEGA 3CQTA 3GNGA 2CDTA 2F69A 3J7AF 2JS0A 2OTJQ 5GAN5 3JCMc 2CP5A 3O8VA 3LYIA 3U23A 4QVDA 1OX9A 4HCBA 2C0IA 4II1A 3SWNB 2HL5C 4B6MA 1YITT 1KD1C 4JLGA 1AWWA 2P84A 3I55Q 4F17A 4CC7A 4EMHA 4IUVA 2LTOA 2K57A 3V8LA 1NYFA 1MNEA 4O6JA 2VKNA 3CMEQ 1AZEA 4OMMA 4FL6A 3P8DA 1WLPB 2LT1A 3RBBB 1IO6A 1HK9A 5KE2A 4RTWA 3EH2A 1M2VA 1JQQA 3HFOA 5GMKj 1MUZA 1TUCA 1B3QA 1I8FA 5GANe 4BY6B 1K8AC 1LPLA 1TSFA 1ZBJA 3ULRB 2H8HA 3HHTB 4C0DB 4B9WA 4C92G 3CC4T 1RAGB 2J6OA 2RHXA 4DOWA 1E6GA 4Y91A 2QEXQ 2F2WA 5HKCA 3M0PA 1SRLA 4C5IA 3RIRA 3G6EQ 3M53A 1V1CA 1AT1B 1FXXA 1IHVA 1G3YA 2X51A 5CAIA 2KR3A 3KBGA 4ZGDB 1W4SA 1BCMA 4C0ZA 4BE1A 1WJSA 2E65A 3NGPA 1MMNA 1T0JA 2P0QA 3OYAA 3D7SB 4M77F 2LP5A 2P0PA 4JUVA 4AT1B 2KI7A 1LCKA 4F7UF 3PIOA 3N5BB 1BCOA 2QG9B 1JO8A 1U1TA 2OTLA 5I22A 4M7AF 4XK8E 4D8DA 3JRZA 5L23A 4BI4A 3QJ6A 1K73R 5IHIA 2NUPB 1VA7A 1YCSB 3RUXA 3X26B 1OPLA 2FB7A 1IXDA 1HSQA 1LOJA 1BI1A 2DO3A 1FWZA 4KH0B 4C5HA 1YHQA 3JB9D 1ZLMA 1VQ6Q 4K11A 2RJEA 5CCAA 3JCMP 3G71Q 3EGUA 2ZPFB 2ZPEB 1YFNA 1N6AA 1VQMQ 4M78C 4Z8AA 2XK0A 3CCMQ 2IVWA 2QTXA 2QI2A 3HRSA 4E7SA 4JJDA 1W6XA 1RAEB 1W2BS 2J6FA 1RLQC 3SD4A 2YUOA 4P5NA 1VQ7T 1N27A 2FZCB 2HDAA 1NM7A 3EAEA 2DVJA 1D0XA 4F7UB 5GAOn 1F1BB 2D8JA 2RQWA 3T9NA 2V1QA 2DL8A 3MKDA 3SEMA 4QW2A 2KK4A 2CSQA 3RERA 1D1BA 2L8DA 4MDWA 2CS7A 4FSXA 1G83A 2XDDA 4AG1C 3CD6T 1IGQA 1UDLA 1X27A 4M4ZA 1QCOA 1GL5A 5C6SA 2QEXT 3C0CA 4NOYA 2HD0A 2DD5A 4QT7A 2F2VA 2PVGB 4LUDA 4M75F 4EMKA 2AIRB 2QXFA 2XICA 2VYTA 3M0UA 3G6ET 3OYLA 2X4JA 2C0TA 4BY6C 4C92B 2O9SA 2D6FA 4E7IA 4M78A 9ATCB 3LH5A 4RCBA 3LWIA 3MJXA 3ASKA 4JRPA 3X20B 4M78B 2YHTA 2O4XA 2O9VA 1JXMA 3HPWA 2E5KA 2CT4A 3MCAB 5GANf 4C92A 1YITQ 2L3RA 4OB2B 7AT1B 1M5Q1 4KH1B 1ABQA 5DLQE 2LJ1A 3M0QA 1Z9ZA 2NYSA 1OV3A 1PRMC 2B86A 2DXCA 3OYYA 5KYWB 2DILA 1Q7YR 3GF5A 5M9OA 3KUFA 1KJWA 4PFZA 1OYXA 5LJ3g 4A54A 3OYDA 4XAXB 1KC8C 2YWWA 2XG8D 3M55A 2ZAEA 3OYKA 2DFUA 2ED0A 1X75C 1Y71A 1JXOA 3PE0A 2FRWA 1HD3A 1BI2A 4RCCA 1LVKA 3A8OB 4QKUA 2K79A 3QYHB 2GQVA 2RPNA 3ER0A 4FW1A 1BBZA 3OBYA 2VXEA 4A4FA 2VGNA 2XU8A 2ESWA 5DM7R 4J9IA 1Q82U 4X9CA 1SSFA 1VQOA 2DXBA 1G3WA 2PVDB 1KQSP 1R77A 1VQNT 3GOXA 1M1KU 1QKXA 4M75A 1VIFA 2E12A 3ZL7C 2Y4XA 4DQ2A 1ZSZC 2DETA 1N9SA 3FDRA 1A0NB 3NTHA 3C12A 3RMQA 2F5TX 4ESRA 4HXJA 3CMEA 3P8HA 4F7UG 4QVZA 4L6V5 3UA6A 4IUPA 4M7AC 2V8JA 2GGRA 3L42A 4AFQC 5LJ5h 2AZVA 2SRCA 3PMIA 2Y4YA 3OBWA 5FRNA 1VQ6T 3I55T 2GFUA 4JRKA 1RI0A 5KYWA 1VQ5A 3QPHA 1PNJA 4PK4A 1XQHA 1R0CB 1K0SA 1YJ9Q 2MWPA 1BU1A 2X3XD 4XTYA 4M78F 1B07A 3GLXA 4HT8A 2F1LA 1RL2A 3L2ZA 1YIJT 2HQEA 2PZ1A 4HVVA 1RAFB 1VQ4A 1OOTA 3SHWA 2DL5A 2QGFB 5CKBA 2AKKA 2DZ9A 4RTYA 1YJ9A 1N8RC 3H9NA 1QVGP 3SB2A 3OSSC 2JM9A 3JCMV 3VV0A 3M54A 2K6DA 3FLGA 3V8KA 1M2VB 1KHIA 2P4TA 2E3IA 3MHXA 2X9HA 4N4HA 3NFCA 2FG0A 1K4US 4MMKA 2R58A 2G6FX 1D0YA 2E6ZA 5KYUA 1PKTA 5D6YA 1OZ2A 1N9RA 1XNIA 3NMZC 3QXEB 3RESA 3LW5E 3R6OA 1BK2A 1WHMA 2AT1B 4OF1A 1IZ6A 4KULA 1KQ2A 2KBTA 2KT1A 3JCMb 2XDPA 1O9SA 3O5ZA 1U5SA 4M7DA 2HQHA 3ME9A 1D3BB 1YBYA 5FU7B 5J39A 3FC3A 1D1CA 2NWMA 2WSEE 3OS2A 1LNXA 2E10A 5LJ5e 3PGGA 3S3OA 3EG0A 2V1RA 3JAME 2LQ8A 3CPWS 5LJ5f 1YNZA 1VQPT 4HCCA 1MMGA 4M7AA 2EQKA 5LJ5d 1RAAB 4TVRA 2MIOA 3F70A 3CPWA 5FROA 3RNJA 2KROA 2NLUA 1D0ZA 3CCUA 2WSFE 2XKOC 2MYSA 1X6GA 2L89A 4JRQA 1I0CA 2A7YA 2LVMA 5A2QE 2RQRA 4FYXB 3EH1A 2DMOA 4AG2C 3J81E 1S72Q 2O31A 2M9UA 4LNPA 2L0AA 4D6WA 5GANg 2AHJB 4PNOA 2YUPA 2ZCFB 1H3ZA 4E7KA 4KUDK 3OYHA 4GY5A 2RQTA 4C8QD 2GNCA 2XIDA 3HFNA 1YJNA 1U3OA 4Y92A 3CC2A 4PJOA 1Q95G 2DLPA 3HKSA 3QJYA 4LD6A 2H3JA 4BD3A 3OQ5A 1Z9QA 1M3AA 1VYTA 5GAOp 2P4RA 1QQJA 1Q86U 3DB3A 3LGLA 3TSWA 1NJIR 3QWXX 3CCEQ 3FJPA 4PJOB 4ZN1A 4M7AE 4M7AD 2G3RA 2L3SA 2VGMA 2K9GA 1XOVA 3JV3A 2D9TA 2HCKA 3VRYA 1UJ0A 3CCJQ 1EIFA 3BDUA 2X35A 4DBQA 4R0KA 2CUDA 2JJ9A 2BZXA 5LJ3f 3DLMA 1WHLA 2KE9A 2ZZDA 4QQDA 5J3BA 3RMSA 3KXTA 3CCLQ 1QVGA 3OYIA 3S6WA 2R57A 3VS4A 1B7TA 3VS5A 1C0MA 1T3SA 2J06A 2LCSA 4IUTA 3BY7A 1Q86R 3WVDB 5AT1B 5IH2A 2DX1A 2YDLA 2ABLA 1B34A 3RKWA 1VQ7A 1CSKA 3E2UA 2RHUA 2OAWA 3QIIA 3QHSA 4ZGJB 1JJ2A 3TQ7P 2HAXA 4HT9A 8ATCB 1WHHA 2VVKA 1MMAA 5KYXA 4HA8A 2QQSA 3JB9F 5FU7C 4OB1B 5HK3A 2LJ0A 5FRMA 2C0OA 3VYHB 4MZPA 4QVCA 2KXCA 2LNVA 1ZSZB 2RO0A 1YHQT 4CI0C 2FVUA 2OAUA 2FPFA 4OB0B 1QWEA 4C92C 4F14A 1R8OB 2X4WA 5J26A 2E4HA 4M7DE 1NBEB 2QDLA 2PUOB 4A53A 2RH2A 3H0HA 1K9MC 1Y07A 1YHQQ 3BW1A 3TU4K 1PG5B 5CQXA 3EG9B 1QVFS 4AFZC 4KGVB 3EGXA 4EPCA 5I11A 4OGCA 4UC4A 2M16A 1OI1A 2RB6A 2Z0WA 4M75C 3WXMB 2M0OA 1OU9A 3GBQA 3ZEHA 1MGQA 1NG2A 1ZX6A 4M7DF 2VB6A 2O2OA 2JXBA 2KEAA 2RMOA 2DXTA 2MF2A 3OYEA 1GXIE 1PM3A 4J9FA 3VYGA 3PNWC 1W1FA 4XU3A 2DYBA 2CP6A 1PD1A 1YIJA 1U8RA 1DJ7B 5KCHA 2HEQA 3CCSQ 2EVRA 1JJ2P 2LT4A 3QDRB 3DB4A 2AKLA 2DXUA 2QK0A 1BIBA 4PJOG 3LH0A 1YJWQ 4E2FB 2LCCA 2E64A 2JNGA 4QQGA 2KXDA 3REAB 5DY9A 1PC0A 1X6BA 4RG8A 2ZPBB 4F16A 3JCMg 5KCOA 1W2BP 4LDXA 2OX7A 2JOYA 2ROLA 4XTZA 1RLPC 3EGDB 1KQSS 1VQLQ 4PJOE 1EFNA 3H0IA 2EFIA 2X4XA 1NPRA 2CH4A 1PHTA 3GP8A 5CKEA 4MDXA 3GPLA 4JJBA 3VS3A 2EYXA 4HCKA 5IHKA 2GFAA 4F7UE 2BIVA 2EIFA 2K7AA 4RTTA 5KYYB 4VUBA 2KRSA 2C06A 1BI0A 3CCVA 5GAMd 2NUTB 2CZ6B 1KQ1A 1IB8A 1X01A 1VQPA 5GAMg 4PFOA 1Y57A 1KG1A 4JRIA 3CC7Q 2MMPA 2Y90A 2BE7D 1RI9A 1KD1R 4O5VA 2CP2A 4E7ZA 3X24B 3CCLA 4FSSA 5A0DA 1WXBA 1QP2A 1VQNQ 4C8QE 3FJ5A 2EGAA 3OYMA 4BE2A 1G5VA 2DEUA 1QP3A 2D1XA 2COZA 2QQRA 4L5GA 4M77E 4LXCA 3VUZA 4A4GA 3CCRA 3VUBA 5GAN8 2E41A 1M90R 4V2SA 1X69A 4E7HA 1S72T 1VQ9A 1M8MA 2ECZA 4R55A 2E5QA 2A3LA 3C4SA 5KH6A 1M1GA 5GAOq 3EHQA 3CMAA 3G4SA 2B8AA 1TG0A 1UE9A 2F2XA 5IHNA 2XMFA 2O4XB 3CCEA 1AWJA 3JCMd 4XU1A 1NEBA 3R6NA 2K2MA 1UB4A 3I5RA 1QCNA 4HVWA 5LJ5j 3URGA 1BYMA 2JMAA 2FEIA 3CCQQ 1QMCA 3LWHA 3CC4Q 2JTEA 2LQKA 5FU6C 3LLRA 3BDLA 4M78E 1VQ4T 4DOVA 4CC3A 2KNBB 1Y7XA 3RDVA 3ZBDA 3CXCS 3H0FA 2AK5A 1MV3A 4DEYA 2PTKA 3OYCA 1PRLC 2RD1A 3I56A 4OB3B 2V8IA 5GANd 1Q86C 3MEWA 4LUEA 2OI3A 2BTTA 1VQ6A 3IQLA 3FB9A 4DBFA 5KE3A 1QLYA 4J6XA 1M3BA 4XTVA 2M02A 3UDCA 1GFDA 4Y28E 1H3HA 1YI2Q 1JEGA 2JW4A 2KT8A 3I35A 3TSZA 3CC2Q 1WGSA 4M78D 3DLLA 4DEXA 2A0FB 2JTMA 2QA4Q 1QCFA 4GLMA 3M59A 2V8KA 1NE8A 3FIFA 2CGHA 1KFZA 3KFVA 2RM4A 4C92F 3MEVA 2QA4A 3THKA 2EQIA 4CRIA 4B9XA 1I5LA 3SWNC 2RHYA 1ZA1B 1X2QA 5IXFA 1QW1A 1Q82C 1HXDA 1JRIA 2LQWA 1NPPA 1UJYA 4BDZA 1WJRA 2KRNA 1FMVA 4OMNA 3CCUQ 4EDUA 2YUQA 2DTIA 5D6XA 1ZHIA 1Q81U 4X9DA 1YJWT 2PNIA 4BDYA 3M0TA 2ZPIB 1ZUKA 1VYVA 1VQ9Q 2HBWA 1VUBA 4MMLA 3QKJA 5I21A 5LJ3j 2LC4A 2XD0A 2GF7A 5KYXB 2EAYA 4E7LA 2DL4A 1UFFA 3VU3C 4QQ6A 1C1AA 4J9CA 4M75B 1O75A 2A36A 3JB9J 2L2PA 3CMET 3CCQT 2QASA 2DF6A 1SPKA 1VQ5Q 4IUUA 2FRYA 1ZQ1A 2DL7A 4OMFB 4M77C 4ELZC 1QVFA 3OA6A 2E6NA 4JLIA 3I56T 1E7OA 5FW9A 3M9QA 2CT3A 2K5FA 2LRQA 1M90C 1WIEA 2EQUA 2K3BA 1M1KR 4PLIA 1VQKA 1WXUA 4JJNK 3UATA 3HRUA 2DIGA 3CD6A 3OYGA 2EKHA 3HP9A 3G4SQ 1WXTA 1G3TA 5GAN2 2YXYA 1I5OB 1GCPA 3EFRA 2M1HA 1E6HA 2GCXA 2KGTA 3CCRQ 1PSFA 3CEYA 3EG3A 3VJPA 5GANh 4ORZA 1ZBXA 2VASA 1SHGA 3JB9H 1HYOA 2NUPA 1K9MU 2QGGA 2OTJT 2YLBA 1BIAA 4N4IA 1M2OA 1VQLT 3VS0A 1JBMA 4FIBA 1YJ9T 2RHZA 3UWNA 4L59A 4RTUA 4N0AC 4J7FA 2A37A 1KQSA 1C6VX 2RJFA 1X6OA 2QQAA 4OGEA 3PT9A 2O88A 5GANj 1VQPQ 4X1VA 3CCVT 3V8JA 3V7RA 5GAMe 4FCYA 3QDFA 2EWNA 2DE0X 4HVUA 3M0SA 5D7UA 5IXBA 3JCMW 3PVQA 2JVVA 4DBRA 4R56A 4JZ4A 5CIUA 1Y0MA 4M77B 4KUIA 2DEQA 2FO0A 1WI7A 3JCMQ 3SFMA 2DZCA 3UA7A 2J6KA 1GBRA 1WHGA 2ED1A 2RQVA 3EG9A 3NPFA 2LNHB 1GBQA 1NLOC 4MZMA 3X25B 2HZYA 3TVTA 1H92A 3L2VA 3GIBA 2EJFA 1FX7A 2EYWA 1VQLA 2RK2A 2JN0A 1N8RR 4KGXB 3QSUA 3M4YA 3JCMf 5I2MA 2MPXC 4M7AG 1U06A 4J83A 2K3XA 3OYJA 5HY6A 4E6RA 1VQOQ 3AT1B 2DBMA 1D1AA 3CCET 5LJ3e 3MEUA 2RA2A 1BI3A 3G4ST 2H3EB 2R5AA 3OW2A 4ZTJA 1WQ7A 3HL8A 4C5GA 2CH4W 1S1NA 1XJWB 1Q81C 3LX7A 2A28A 1VQKT 3I9QA 4HKEA 4D8KA 2QQ9A 2DL3A 3A8MB 5IAYA 4IKFA 3CCRT 4M75G 4LE9A 1P92A 1YIJQ 2AZSA 4BUGA 1UGPB 3OS5A 5FLXE 3H8ZA 1WHJA 3PIPA 2ZGWA 5A0GA 4PJOF 1VQ5T 4LDUA 1RADB 3TREA 5EC7A 2YSQA 1VQKQ 2QYZA 4CC4B 3CC7T 1WDXA 3MP1A 4NL3A 5LL6S 1GRIA 5GAOr 1TH7A 4N0AA 2EBPA 4PFPA 1CKBA 1W70A 5C0MA 1CKAA 2RN8A 5LJ5g 5CKFA 2HL3A 4M77A 1ZUUA 3QWYA 1PKSA 5CQYA 1YITA 1IHWA 3A1PA 4OMPA 3BE3A 2HNIA 2GTJA 1QVPA 1TUDA 2RHIA 4OP0A 3M5AA 3JB9G 5GAN4 5GMKl
chains in the Genus database with same CATH topology
2E4HA 2E3HA 1WHKA 1TOVA 2CP0A 2HL5C 3RDVA 2M02A 4B6MA 1TXQA 1WHGA 2HQHA 2E3IA 2CP2A 2QK0A 2COYA 1WHJA 2HKNA 2CP7A 1LPLA 2HL3A 3E2UA 1WHLA 2COWA 2CP3A 2CP5A 2COZA 2CP6A 2MPXC 2Z0WA 1WHMA 3TQ7P 1WHHA 1IXDA 2HKQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4H A;  2E3H A;  1WHK A;  1TOV A;  2CP0 A;  2HL5 C;  3RDV A;  2M02 A;  4B6M A;  1TXQ A;  1WHG A;  2HQH A;  2E3I A;  2CP2 A;  2QK0 A;  2COY A;  1WHJ A;  2HKN A;  2CP7 A;  1LPL A;  2HL3 A;  3E2U A;  1WHL A;  2COW A;  2CP3 A;  2CP5 A;  2COZ A;  2CP6 A;  2MPX C;  2Z0W A;  1WHM A;  3TQ7 P;  1WHH A;  1IXD A;  2HKQ B; 
#chains in the Genus database with same CATH topology
 2WSC E;  4OVA A;  1UEC A;  2GTO A;  1UHF A;  2HQX A;  2RK1 A;  4Q5W A;  3MP8 A;  1AD5 A;  3M58 A;  4C8Q F;  3JB9 I;  1IRE B;  4Z02 A;  1D09 B;  1BB9 A;  1GCQ C;  4Z88 A;  4EMK C;  2VXF A;  3CCJ T;  2D0N A;  2M0Y A;  4J6Y A;  2QA4 T;  3CD6 Q;  1M1F A;  1ACM B;  4RMO A;  2BZY A;  4X34 A;  2DPP B;  4RTV A;  4ME7 A;  2CP7 A;  2DKG A;  1VOM A;  1U1S A;  3TEE A;  2I2L A;  1KC8 U;  1KC8 R;  2EJ9 A;  4M7D B;  4JZ3 A;  2KSS A;  2EPD A;  2VUB A;  5GMK i;  3CCS T;  4XQ3 A;  1UG1 A;  1AOJ A;  4JJC A;  4MZT A;  1M30 A;  4J9G A;  3WVE B;  1TUG B;  2COY A;  1ARK A;  1J3T A;  5LJ3 h;  5CVI A;  1AVZ C;  4J5Y A;  1G8X A;  3C95 A;  1B34 B;  4PJO D;  1Y96 B;  2YRV A;  4M7A B;  1YI2 A;  4LD9 K;  3REB B;  4C8Q A;  2JMC A;  3VS2 A;  1VQM A;  3G6E A;  4IIO A;  2KDS A;  1WNL A;  2PQW A;  3PMT A;  4XTU A;  1WJQ A;  2JM8 A;  4C92 D;  1QVF P;  4J9H A;  3NTI A;  2DYI A;  3A8H B;  3A8L B;  1WFW A;  5FWC A;  2J05 A;  1WZO A;  3PVL A;  2E1H A;  4FU6 A;  3OSV A;  3I56 Q;  2CZ0 B;  2X3W D;  5GMK h;  2JS2 A;  4OML A;  1W2B A;  1KHC A;  4BB7 A;  3OYF A;  4LDV A;  1EX4 A;  1T3L A;  1UHC A;  2OTL Q;  1XTD A;  1VIE A;  5KYU B;  4BI3 A;  4XU0 A;  1IGU A;  2LX7 A;  2XDB A;  3UF4 A;  2YRD A;  2HBP A;  3VS1 A;  4PJJ A;  4J7I A;  2L5Q A;  1K76 A;  4E47 A;  3M4G A;  2RQU A;  2MOX A;  4PL6 A;  1OEB A;  2CSI A;  2QQB A;  2SEM A;  2XI9 A;  4XTX A;  3OS1 A;  1TTH B;  1MHN A;  4C92 E;  2JT4 A;  3HRT A;  4C0G A;  3OYN A;  4FT4 A;  3PTA A;  1JU5 C;  3A98 A;  4A4H A;  4ZN3 A;  2OTJ A;  1WX6 A;  3OS0 A;  1UTI A;  2LZ6 B;  1SF9 A;  3MET A;  1M90 U;  3FEO A;  1JB0 E;  2KVQ G;  2OJ2 A;  3UT1 A;  2P0K A;  4C0D C;  2CUB A;  4ZGE B;  4M77 G;  4M7D D;  4Z89 A;  2DIQ A;  1RUW A;  2MI6 A;  2ZPH B;  3L2R A;  4GLK A;  1VQ8 A;  1K9A A;  3VKI A;  3EG2 A;  1FMW A;  1OPK A;  2YRC A;  5L8R E;  1VQN A;  3MEA A;  5LJ3 d;  5KYN A;  1AHJ B;  1RAC B;  1BKB A;  2FL7 A;  2RF0 A;  5FWB A;  3L1A A;  2FZG B;  3CC4 A;  4OMO A;  4F7U A;  1YI2 T;  3OB9 A;  4RG2 A;  2KYB A;  3QYG B;  1K9M R;  3PFS A;  4KT0 E;  4EMK B;  2WAC A;  3M56 A;  4A63 B;  3OMC A;  1JJ2 S;  1FMK A;  1AEY A;  2LQN A;  1M9S A;  2HMA A;  1TOV A;  2CP0 A;  1WPY A;  4N4G A;  1UGQ B;  3G71 T;  3HSB A;  1TS9 A;  2FPE A;  2QAZ A;  6AT1 B;  3QZ5 B;  4EMG A;  4NS5 A;  2DD4 A;  2V26 A;  1M8V A;  4LN2 A;  1VQ4 Q;  2EYZ A;  4PJO C;  3M57 A;  3OMG A;  3RKY A;  4C5E A;  2EKO A;  2IIM A;  1VYU A;  2MK5 A;  1PD0 A;  4J9E A;  1YN8 A;  3EFO B;  1G2B A;  1K0X A;  2YUN A;  2K5L A;  1RAB B;  1KSW A;  2QDY B;  2KYM A;  2MCN A;  5GAM h;  3L2Q A;  4C0F A;  3CMA T;  1K8A U;  5GAO l;  3P8B B;  1X43 A;  2BKD N;  3LGF A;  2FPD A;  3CC7 A;  1I07 A;  3CPF A;  1YJW A;  1RAH B;  4M75 D;  1PSE A;  4F04 B;  4A4E A;  1NYG A;  2LMJ A;  1OX8 A;  3CCV Q;  2JTF A;  2PUK B;  2CKK A;  3OW2 P;  4RTZ A;  2KY9 A;  2FZK B;  2CZ7 B;  4KGZ B;  3JCM X;  4KRT A;  3FRN A;  1AZG B;  1I4K 1;  3L2U A;  2X4Y A;  3E9F A;  2VWF A;  4JPB W;  2EW3 A;  5CO7 A;  2EYY A;  5CK9 A;  3INZ A;  1SSH A;  4C8Q C;  1R0B G;  1GCQ A;  5KYY A;  3VS6 A;  4NL2 A;  2NUT A;  1MND A;  2KMT A;  4FYV B;  4DA4 A;  3S3M A;  5ECA A;  4RTX A;  2LDM A;  2HSP A;  2EQJ A;  2K2V A;  5GAN 3;  3G7Z A;  1NJI U;  3A8G B;  3JCM h;  1OU8 A;  1NJI C;  4EIK A;  1SHF A;  5EG2 A;  2ENM A;  2K5I A;  3G1J A;  4M77 D;  4M7D G;  1TWB A;  3E19 A;  3OYB A;  1M4Z A;  3CBP A;  3EGD A;  3M0R A;  4AFU C;  2YT6 A;  2E3H A;  2DM1 A;  3QUI A;  3CPW P;  3EGX B;  3MO8 A;  2BZ8 A;  2EQM A;  4PJN A;  1Q7Y U;  4PLL A;  3CCS A;  1SEM A;  1ABO A;  1K73 U;  3S3N A;  3JSC A;  2BE9 B;  1GFC A;  2DRK A;  2DVE A;  1K8A R;  3C94 A;  5GAO m;  1I81 A;  3QBY A;  3X28 B;  2BUD A;  1QVG S;  2MWO A;  4AFS C;  1G3S A;  3TCJ A;  1T0H A;  3CBM A;  1RAI B;  4YTL A;  1WQW A;  4XTW A;  1OQK A;  1D3B A;  5IT9 E;  5FU6 B;  1V29 B;  1X2K A;  1YCY A;  3VRZ A;  2COW A;  2JZ2 A;  4C8Q B;  2CP3 A;  2ROT A;  3H41 A;  3ZFJ A;  5GMK m;  3OY9 A;  4FYY B;  2DJQ A;  2DNU A;  1YJN T;  3AHU A;  4PKC C;  1Y96 A;  4ANJ A;  5GAM j;  5GJW B;  3CC2 T;  1VQO T;  2ZPG B;  4XU2 A;  3V7S A;  2EGE A;  1KIK A;  2EJG A;  2CZ1 B;  3RR6 A;  3VS7 A;  3SDZ A;  1NZ9 A;  2RNA A;  2HKN A;  4FT2 A;  3E9G A;  2RI5 A;  2DER A;  4IIM A;  2JUF A;  3CCL T;  3EG1 A;  1AWO A;  5GAN 6;  1H64 1;  4WCI A;  3QO3 A;  2NUZ A;  3GNF B;  4PJL A;  3CXC A;  3CCM A;  3I5S A;  5AYF A;  1OZ3 A;  2CRE A;  3NHN A;  4DBH A;  3CCJ A;  5IN1 A;  3CBO A;  2J7I A;  1TU0 B;  4BI8 B;  1WHK A;  4LDW A;  2IG0 A;  1UGV A;  1IRX A;  3EFS A;  1Q81 R;  2DTO A;  4RUG A;  2FYK A;  2DA9 A;  2DK3 A;  2XHC A;  4A4K A;  5GJV B;  1V76 A;  3A5Z B;  2DBK A;  1ZSZ A;  3QZ9 B;  3V7C A;  5GAN 7;  1KK7 A;  1OUL A;  3RKX A;  2KAF A;  5HK0 A;  1YWP A;  4M78 G;  1NLP C;  3EHR A;  2HKQ B;  1K73 C;  4ZNX A;  1VQ7 Q;  1I1J A;  1Q7Y C;  1MV0 B;  8AT1 B;  1K1Z A;  1KD1 U;  2RI2 A;  3CCM T;  2KRM A;  2I0N A;  2GBQ A;  1QKW A;  1ZUY A;  4HCZ A;  4LDY A;  2LX9 A;  2K3Y A;  3J80 E;  1VQ8 T;  2MAM A;  4JS5 A;  1N8R U;  2D8H A;  2PVO B;  1TXQ A;  3JCM e;  1H8K A;  2K4Y A;  3JCM J;  2F5K A;  2PU9 B;  2VC8 A;  2QTV A;  2DTH A;  4CC2 A;  3EFO A;  2FHD A;  4IUR A;  4ELY C;  1ZSG A;  3HTR A;  1SKU B;  5CKH A;  2A08 A;  4J6W A;  4JDS A;  4OMQ A;  3G71 A;  5CKD A;  2YLC A;  3DKM A;  2ATC B;  4FW2 A;  2QEX A;  1MMD A;  4ATO A;  4IUQ A;  5CR2 A;  1FYN A;  2D0Q B;  5GMK e;  2HSE B;  5HCK A;  5D6W A;  1LJO A;  4JS4 A;  2GQI A;  2RJD A;  3Q1J A;  2W0Z A;  2IPO B;  2LCL A;  1UGR B;  5GAM f;  1UGS B;  2DRM A;  2L3Q A;  1SG5 A;  5I2S A;  1YJN Q;  1UEB A;  3CXC P;  4AMC A;  1PCX A;  4M7D C;  4ZTF A;  3QG1 A;  5A0L A;  4WTO B;  3H6Z A;  2E70 A;  1EZZ B;  2M51 A;  1SRM A;  1HJD A;  3I55 A;  4FYW B;  3CCQ A;  3E1S A;  5DLO A;  3OW2 S;  1M27 C;  1YWO A;  4J8O A;  4C8Q G;  1ZA2 B;  1Q82 R;  2DJZ A;  1VQ9 T;  1S72 A;  2EGC A;  2EYQ A;  4GBQ A;  4FM4 B;  1N5Z A;  4M75 E;  2W10 A;  4PJM A;  1UUE A;  4WF2 A;  3CMA Q;  4BE0 A;  4BAC A;  4J9D A;  4E7J A;  3BFM A;  3L2W A;  2O01 E;  1QWF A;  4RKU E;  1M1K C;  3UPU A;  1WYX A;  2KQW A;  4KBM B;  4J9B A;  2VV5 A;  1WA7 A;  2DAQ A;  3MPU B;  1M3C A;  1VQ8 Q;  2LJ3 A;  3MP6 A;  2OTL T;  1AWX A;  3CCU T;  2L3P A;  1YP5 A;  2RJC A;  3SWN A;  1VQM T;  3NTK A;  2CYZ B;  1PWT A;  2RI3 A;  2R5M A;  1NEG A;  3CQT A;  3GNG A;  2CDT A;  2F69 A;  3J7A F;  2JS0 A;  2OTJ Q;  5GAN 5;  3JCM c;  2CP5 A;  3O8V A;  3LYI A;  3U23 A;  4QVD A;  1OX9 A;  4HCB A;  2C0I A;  4II1 A;  3SWN B;  2HL5 C;  4B6M A;  1YIT T;  1KD1 C;  4JLG A;  1AWW A;  2P84 A;  3I55 Q;  4F17 A;  4CC7 A;  4EMH A;  4IUV A;  2LTO A;  2K57 A;  3V8L A;  1NYF A;  1MNE A;  4O6J A;  2VKN A;  3CME Q;  1AZE A;  4OMM A;  4FL6 A;  3P8D A;  1WLP B;  2LT1 A;  3RBB B;  1IO6 A;  1HK9 A;  5KE2 A;  4RTW A;  3EH2 A;  1M2V A;  1JQQ A;  3HFO A;  5GMK j;  1MUZ A;  1TUC A;  1B3Q A;  1I8F A;  5GAN e;  4BY6 B;  1K8A C;  1LPL A;  1TSF A;  1ZBJ A;  3ULR B;  2H8H A;  3HHT B;  4C0D B;  4B9W A;  4C92 G;  3CC4 T;  1RAG B;  2J6O A;  2RHX A;  4DOW A;  1E6G A;  4Y91 A;  2QEX Q;  2F2W A;  5HKC A;  3M0P A;  1SRL A;  4C5I A;  3RIR A;  3G6E Q;  3M53 A;  1V1C A;  1AT1 B;  1FXX A;  1IHV A;  1G3Y A;  2X51 A;  5CAI A;  2KR3 A;  3KBG A;  4ZGD B;  1W4S A;  1BCM A;  4C0Z A;  4BE1 A;  1WJS A;  2E65 A;  3NGP A;  1MMN A;  1T0J A;  2P0Q A;  3OYA A;  3D7S B;  4M77 F;  2LP5 A;  2P0P A;  4JUV A;  4AT1 B;  2KI7 A;  1LCK A;  4F7U F;  3PIO A;  3N5B B;  1BCO A;  2QG9 B;  1JO8 A;  1U1T A;  2OTL A;  5I22 A;  4M7A F;  4XK8 E;  4D8D A;  3JRZ A;  5L23 A;  4BI4 A;  3QJ6 A;  1K73 R;  5IHI A;  2NUP B;  1VA7 A;  1YCS B;  3RUX A;  3X26 B;  1OPL A;  2FB7 A;  1IXD A;  1HSQ A;  1LOJ A;  1BI1 A;  2DO3 A;  1FWZ A;  4KH0 B;  4C5H A;  1YHQ A;  3JB9 D;  1ZLM A;  1VQ6 Q;  4K11 A;  2RJE A;  5CCA A;  3JCM P;  3G71 Q;  3EGU A;  2ZPF B;  2ZPE B;  1YFN A;  1N6A A;  1VQM Q;  4M78 C;  4Z8A A;  2XK0 A;  3CCM Q;  2IVW A;  2QTX A;  2QI2 A;  3HRS A;  4E7S A;  4JJD A;  1W6X A;  1RAE B;  1W2B S;  2J6F A;  1RLQ C;  3SD4 A;  2YUO A;  4P5N A;  1VQ7 T;  1N27 A;  2FZC B;  2HDA A;  1NM7 A;  3EAE A;  2DVJ A;  1D0X A;  4F7U B;  5GAO n;  1F1B B;  2D8J A;  2RQW A;  3T9N A;  2V1Q A;  2DL8 A;  3MKD A;  3SEM A;  4QW2 A;  2KK4 A;  2CSQ A;  3RER A;  1D1B A;  2L8D A;  4MDW A;  2CS7 A;  4FSX A;  1G83 A;  2XDD A;  4AG1 C;  3CD6 T;  1IGQ A;  1UDL A;  1X27 A;  4M4Z A;  1QCO A;  1GL5 A;  5C6S A;  2QEX T;  3C0C A;  4NOY A;  2HD0 A;  2DD5 A;  4QT7 A;  2F2V A;  2PVG B;  4LUD A;  4M75 F;  4EMK A;  2AIR B;  2QXF A;  2XIC A;  2VYT A;  3M0U A;  3G6E T;  3OYL A;  2X4J A;  2C0T A;  4BY6 C;  4C92 B;  2O9S A;  2D6F A;  4E7I A;  4M78 A;  9ATC B;  3LH5 A;  4RCB A;  3LWI A;  3MJX A;  3ASK A;  4JRP A;  3X20 B;  4M78 B;  2YHT A;  2O4X A;  2O9V A;  1JXM A;  3HPW A;  2E5K A;  2CT4 A;  3MCA B;  5GAN f;  4C92 A;  1YIT Q;  2L3R A;  4OB2 B;  7AT1 B;  1M5Q 1;  4KH1 B;  1ABQ A;  5DLQ E;  2LJ1 A;  3M0Q A;  1Z9Z A;  2NYS A;  1OV3 A;  1PRM C;  2B86 A;  2DXC A;  3OYY A;  5KYW B;  2DIL A;  1Q7Y R;  3GF5 A;  5M9O A;  3KUF A;  1KJW A;  4PFZ A;  1OYX A;  5LJ3 g;  4A54 A;  3OYD A;  4XAX B;  1KC8 C;  2YWW A;  2XG8 D;  3M55 A;  2ZAE A;  3OYK A;  2DFU A;  2ED0 A;  1X75 C;  1Y71 A;  1JXO A;  3PE0 A;  2FRW A;  1HD3 A;  1BI2 A;  4RCC A;  1LVK A;  3A8O B;  4QKU A;  2K79 A;  3QYH B;  2GQV A;  2RPN A;  3ER0 A;  4FW1 A;  1BBZ A;  3OBY A;  2VXE A;  4A4F A;  2VGN A;  2XU8 A;  2ESW A;  5DM7 R;  4J9I A;  1Q82 U;  4X9C A;  1SSF A;  1VQO A;  2DXB A;  1G3W A;  2PVD B;  1KQS P;  1R77 A;  1VQN T;  3GOX A;  1M1K U;  1QKX A;  4M75 A;  1VIF A;  2E12 A;  3ZL7 C;  2Y4X A;  4DQ2 A;  1ZSZ C;  2DET A;  1N9S A;  3FDR A;  1A0N B;  3NTH A;  3C12 A;  3RMQ A;  2F5T X;  4ESR A;  4HXJ A;  3CME A;  3P8H A;  4F7U G;  4QVZ A;  4L6V 5;  3UA6 A;  4IUP A;  4M7A C;  2V8J A;  2GGR A;  3L42 A;  4AFQ C;  5LJ5 h;  2AZV A;  2SRC A;  3PMI A;  2Y4Y A;  3OBW A;  5FRN A;  1VQ6 T;  3I55 T;  2GFU A;  4JRK A;  1RI0 A;  5KYW A;  1VQ5 A;  3QPH A;  1PNJ A;  4PK4 A;  1XQH A;  1R0C B;  1K0S A;  1YJ9 Q;  2MWP A;  1BU1 A;  2X3X D;  4XTY A;  4M78 F;  1B07 A;  3GLX A;  4HT8 A;  2F1L A;  1RL2 A;  3L2Z A;  1YIJ T;  2HQE A;  2PZ1 A;  4HVV A;  1RAF B;  1VQ4 A;  1OOT A;  3SHW A;  2DL5 A;  2QGF B;  5CKB A;  2AKK A;  2DZ9 A;  4RTY A;  1YJ9 A;  1N8R C;  3H9N A;  1QVG P;  3SB2 A;  3OSS C;  2JM9 A;  3JCM V;  3VV0 A;  3M54 A;  2K6D A;  3FLG A;  3V8K A;  1M2V B;  1KHI A;  2P4T A;  2E3I A;  3MHX A;  2X9H A;  4N4H A;  3NFC A;  2FG0 A;  1K4U S;  4MMK A;  2R58 A;  2G6F X;  1D0Y A;  2E6Z A;  5KYU A;  1PKT A;  5D6Y A;  1OZ2 A;  1N9R A;  1XNI A;  3NMZ C;  3QXE B;  3RES A;  3LW5 E;  3R6O A;  1BK2 A;  1WHM A;  2AT1 B;  4OF1 A;  1IZ6 A;  4KUL A;  1KQ2 A;  2KBT A;  2KT1 A;  3JCM b;  2XDP A;  1O9S A;  3O5Z A;  1U5S A;  4M7D A;  2HQH A;  3ME9 A;  1D3B B;  1YBY A;  5FU7 B;  5J39 A;  3FC3 A;  1D1C A;  2NWM A;  2WSE E;  3OS2 A;  1LNX A;  2E10 A;  5LJ5 e;  3PGG A;  3S3O A;  3EG0 A;  2V1R A;  3JAM E;  2LQ8 A;  3CPW S;  5LJ5 f;  1YNZ A;  1VQP T;  4HCC A;  1MMG A;  4M7A A;  2EQK A;  5LJ5 d;  1RAA B;  4TVR A;  2MIO A;  3F70 A;  3CPW A;  5FRO A;  3RNJ A;  2KRO A;  2NLU A;  1D0Z A;  3CCU A;  2WSF E;  2XKO C;  2MYS A;  1X6G A;  2L89 A;  4JRQ A;  1I0C A;  2A7Y A;  2LVM A;  5A2Q E;  2RQR A;  4FYX B;  3EH1 A;  2DMO A;  4AG2 C;  3J81 E;  1S72 Q;  2O31 A;  2M9U A;  4LNP A;  2L0A A;  4D6W A;  5GAN g;  2AHJ B;  4PNO A;  2YUP A;  2ZCF B;  1H3Z A;  4E7K A;  4KUD K;  3OYH A;  4GY5 A;  2RQT A;  4C8Q D;  2GNC A;  2XID A;  3HFN A;  1YJN A;  1U3O A;  4Y92 A;  3CC2 A;  4PJO A;  1Q95 G;  2DLP A;  3HKS A;  3QJY A;  4LD6 A;  2H3J A;  4BD3 A;  3OQ5 A;  1Z9Q A;  1M3A A;  1VYT A;  5GAO p;  2P4R A;  1QQJ A;  1Q86 U;  3DB3 A;  3LGL A;  3TSW A;  1NJI R;  3QWX X;  3CCE Q;  3FJP A;  4PJO B;  4ZN1 A;  4M7A E;  4M7A D;  2G3R A;  2L3S A;  2VGM A;  2K9G A;  1XOV A;  3JV3 A;  2D9T A;  2HCK A;  3VRY A;  1UJ0 A;  3CCJ Q;  1EIF A;  3BDU A;  2X35 A;  4DBQ A;  4R0K A;  2CUD A;  2JJ9 A;  2BZX A;  5LJ3 f;  3DLM A;  1WHL A;  2KE9 A;  2ZZD A;  4QQD A;  5J3B A;  3RMS A;  3KXT A;  3CCL Q;  1QVG A;  3OYI A;  3S6W A;  2R57 A;  3VS4 A;  1B7T A;  3VS5 A;  1C0M A;  1T3S A;  2J06 A;  2LCS A;  4IUT A;  3BY7 A;  1Q86 R;  3WVD B;  5AT1 B;  5IH2 A;  2DX1 A;  2YDL A;  2ABL A;  1B34 A;  3RKW A;  1VQ7 A;  1CSK A;  3E2U A;  2RHU A;  2OAW A;  3QII A;  3QHS A;  4ZGJ B;  1JJ2 A;  3TQ7 P;  2HAX A;  4HT9 A;  8ATC B;  1WHH A;  2VVK A;  1MMA A;  5KYX A;  4HA8 A;  2QQS A;  3JB9 F;  5FU7 C;  4OB1 B;  5HK3 A;  2LJ0 A;  5FRM A;  2C0O A;  3VYH B;  4MZP A;  4QVC A;  2KXC A;  2LNV A;  1ZSZ B;  2RO0 A;  1YHQ T;  4CI0 C;  2FVU A;  2OAU A;  2FPF A;  4OB0 B;  1QWE A;  4C92 C;  4F14 A;  1R8O B;  2X4W A;  5J26 A;  2E4H A;  4M7D E;  1NBE B;  2QDL A;  2PUO B;  4A53 A;  2RH2 A;  3H0H A;  1K9M C;  1Y07 A;  1YHQ Q;  3BW1 A;  3TU4 K;  1PG5 B;  5CQX A;  3EG9 B;  1QVF S;  4AFZ C;  4KGV B;  3EGX A;  4EPC A;  5I11 A;  4OGC A;  4UC4 A;  2M16 A;  1OI1 A;  2RB6 A;  2Z0W A;  4M75 C;  3WXM B;  2M0O A;  1OU9 A;  3GBQ A;  3ZEH A;  1MGQ A;  1NG2 A;  1ZX6 A;  4M7D F;  2VB6 A;  2O2O A;  2JXB A;  2KEA A;  2RMO A;  2DXT A;  2MF2 A;  3OYE A;  1GXI E;  1PM3 A;  4J9F A;  3VYG A;  3PNW C;  1W1F A;  4XU3 A;  2DYB A;  2CP6 A;  1PD1 A;  1YIJ A;  1U8R A;  1DJ7 B;  5KCH A;  2HEQ A;  3CCS Q;  2EVR A;  1JJ2 P;  2LT4 A;  3QDR B;  3DB4 A;  2AKL A;  2DXU A;  2QK0 A;  1BIB A;  4PJO G;  3LH0 A;  1YJW Q;  4E2F B;  2LCC A;  2E64 A;  2JNG A;  4QQG A;  2KXD A;  3REA B;  5DY9 A;  1PC0 A;  1X6B A;  4RG8 A;  2ZPB B;  4F16 A;  3JCM g;  5KCO A;  1W2B P;  4LDX A;  2OX7 A;  2JOY A;  2ROL A;  4XTZ A;  1RLP C;  3EGD B;  1KQS S;  1VQL Q;  4PJO E;  1EFN A;  3H0I A;  2EFI A;  2X4X A;  1NPR A;  2CH4 A;  1PHT A;  3GP8 A;  5CKE A;  4MDX A;  3GPL A;  4JJB A;  3VS3 A;  2EYX A;  4HCK A;  5IHK A;  2GFA A;  4F7U E;  2BIV A;  2EIF A;  2K7A A;  4RTT A;  5KYY B;  4VUB A;  2KRS A;  2C06 A;  1BI0 A;  3CCV A;  5GAM d;  2NUT B;  2CZ6 B;  1KQ1 A;  1IB8 A;  1X01 A;  1VQP A;  5GAM g;  4PFO A;  1Y57 A;  1KG1 A;  4JRI A;  3CC7 Q;  2MMP A;  2Y90 A;  2BE7 D;  1RI9 A;  1KD1 R;  4O5V A;  2CP2 A;  4E7Z A;  3X24 B;  3CCL A;  4FSS A;  5A0D A;  1WXB A;  1QP2 A;  1VQN Q;  4C8Q E;  3FJ5 A;  2EGA A;  3OYM A;  4BE2 A;  1G5V A;  2DEU A;  1QP3 A;  2D1X A;  2COZ A;  2QQR A;  4L5G A;  4M77 E;  4LXC A;  3VUZ A;  4A4G A;  3CCR A;  3VUB A;  5GAN 8;  2E41 A;  1M90 R;  4V2S A;  1X69 A;  4E7H A;  1S72 T;  1VQ9 A;  1M8M A;  2ECZ A;  4R55 A;  2E5Q A;  2A3L A;  3C4S A;  5KH6 A;  1M1G A;  5GAO q;  3EHQ A;  3CMA A;  3G4S A;  2B8A A;  1TG0 A;  1UE9 A;  2F2X A;  5IHN A;  2XMF A;  2O4X B;  3CCE A;  1AWJ A;  3JCM d;  4XU1 A;  1NEB A;  3R6N A;  2K2M A;  1UB4 A;  3I5R A;  1QCN A;  4HVW A;  5LJ5 j;  3URG A;  1BYM A;  2JMA A;  2FEI A;  3CCQ Q;  1QMC A;  3LWH A;  3CC4 Q;  2JTE A;  2LQK A;  5FU6 C;  3LLR A;  3BDL A;  4M78 E;  1VQ4 T;  4DOV A;  4CC3 A;  2KNB B;  1Y7X A;  3RDV A;  3ZBD A;  3CXC S;  3H0F A;  2AK5 A;  1MV3 A;  4DEY A;  2PTK A;  3OYC A;  1PRL C;  2RD1 A;  3I56 A;  4OB3 B;  2V8I A;  5GAN d;  1Q86 C;  3MEW A;  4LUE A;  2OI3 A;  2BTT A;  1VQ6 A;  3IQL A;  3FB9 A;  4DBF A;  5KE3 A;  1QLY A;  4J6X A;  1M3B A;  4XTV A;  2M02 A;  3UDC A;  1GFD A;  4Y28 E;  1H3H A;  1YI2 Q;  1JEG A;  2JW4 A;  2KT8 A;  3I35 A;  3TSZ A;  3CC2 Q;  1WGS A;  4M78 D;  3DLL A;  4DEX A;  2A0F B;  2JTM A;  2QA4 Q;  1QCF A;  4GLM A;  3M59 A;  2V8K A;  1NE8 A;  3FIF A;  2CGH A;  1KFZ A;  3KFV A;  2RM4 A;  4C92 F;  3MEV A;  2QA4 A;  3THK A;  2EQI A;  4CRI A;  4B9X A;  1I5L A;  3SWN C;  2RHY A;  1ZA1 B;  1X2Q A;  5IXF A;  1QW1 A;  1Q82 C;  1HXD A;  1JRI A;  2LQW A;  1NPP A;  1UJY A;  4BDZ A;  1WJR A;  2KRN A;  1FMV A;  4OMN A;  3CCU Q;  4EDU A;  2YUQ A;  2DTI A;  5D6X A;  1ZHI A;  1Q81 U;  4X9D A;  1YJW T;  2PNI A;  4BDY A;  3M0T A;  2ZPI B;  1ZUK A;  1VYV A;  1VQ9 Q;  2HBW A;  1VUB A;  4MML A;  3QKJ A;  5I21 A;  5LJ3 j;  2LC4 A;  2XD0 A;  2GF7 A;  5KYX B;  2EAY A;  4E7L A;  2DL4 A;  1UFF A;  3VU3 C;  4QQ6 A;  1C1A A;  4J9C A;  4M75 B;  1O75 A;  2A36 A;  3JB9 J;  2L2P A;  3CME T;  3CCQ T;  2QAS A;  2DF6 A;  1SPK A;  1VQ5 Q;  4IUU A;  2FRY A;  1ZQ1 A;  2DL7 A;  4OMF B;  4M77 C;  4ELZ C;  1QVF A;  3OA6 A;  2E6N A;  4JLI A;  3I56 T;  1E7O A;  5FW9 A;  3M9Q A;  2CT3 A;  2K5F A;  2LRQ A;  1M90 C;  1WIE A;  2EQU A;  2K3B A;  1M1K R;  4PLI A;  1VQK A;  1WXU A;  4JJN K;  3UAT A;  3HRU A;  2DIG A;  3CD6 A;  3OYG A;  2EKH A;  3HP9 A;  3G4S Q;  1WXT A;  1G3T A;  5GAN 2;  2YXY A;  1I5O B;  1GCP A;  3EFR A;  2M1H A;  1E6H A;  2GCX A;  2KGT A;  3CCR Q;  1PSF A;  3CEY A;  3EG3 A;  3VJP A;  5GAN h;  4ORZ A;  1ZBX A;  2VAS A;  1SHG A;  3JB9 H;  1HYO A;  2NUP A;  1K9M U;  2QGG A;  2OTJ T;  2YLB A;  1BIA A;  4N4I A;  1M2O A;  1VQL T;  3VS0 A;  1JBM A;  4FIB A;  1YJ9 T;  2RHZ A;  3UWN A;  4L59 A;  4RTU A;  4N0A C;  4J7F A;  2A37 A;  1KQS A;  1C6V X;  2RJF A;  1X6O A;  2QQA A;  4OGE A;  3PT9 A;  2O88 A;  5GAN j;  1VQP Q;  4X1V A;  3CCV T;  3V8J A;  3V7R A;  5GAM e;  4FCY A;  3QDF A;  2EWN A;  2DE0 X;  4HVU A;  3M0S A;  5D7U A;  5IXB A;  3JCM W;  3PVQ A;  2JVV A;  4DBR A;  4R56 A;  4JZ4 A;  5CIU A;  1Y0M A;  4M77 B;  4KUI A;  2DEQ A;  2FO0 A;  1WI7 A;  3JCM Q;  3SFM A;  2DZC A;  3UA7 A;  2J6K A;  1GBR A;  1WHG A;  2ED1 A;  2RQV A;  3EG9 A;  3NPF A;  2LNH B;  1GBQ A;  1NLO C;  4MZM A;  3X25 B;  2HZY A;  3TVT A;  1H92 A;  3L2V A;  3GIB A;  2EJF A;  1FX7 A;  2EYW A;  1VQL A;  2RK2 A;  2JN0 A;  1N8R R;  4KGX B;  3QSU A;  3M4Y A;  3JCM f;  5I2M A;  2MPX C;  4M7A G;  1U06 A;  4J83 A;  2K3X A;  3OYJ A;  5HY6 A;  4E6R A;  1VQO Q;  3AT1 B;  2DBM A;  1D1A A;  3CCE T;  5LJ3 e;  3MEU A;  2RA2 A;  1BI3 A;  3G4S T;  2H3E B;  2R5A A;  3OW2 A;  4ZTJ A;  1WQ7 A;  3HL8 A;  4C5G A;  2CH4 W;  1S1N A;  1XJW B;  1Q81 C;  3LX7 A;  2A28 A;  1VQK T;  3I9Q A;  4HKE A;  4D8K A;  2QQ9 A;  2DL3 A;  3A8M B;  5IAY A;  4IKF A;  3CCR T;  4M75 G;  4LE9 A;  1P92 A;  1YIJ Q;  2AZS A;  4BUG A;  1UGP B;  3OS5 A;  5FLX E;  3H8Z A;  1WHJ A;  3PIP A;  2ZGW A;  5A0G A;  4PJO F;  1VQ5 T;  4LDU A;  1RAD B;  3TRE A;  5EC7 A;  2YSQ A;  1VQK Q;  2QYZ A;  4CC4 B;  3CC7 T;  1WDX A;  3MP1 A;  4NL3 A;  5LL6 S;  1GRI A;  5GAO r;  1TH7 A;  4N0A A;  2EBP A;  4PFP A;  1CKB A;  1W70 A;  5C0M A;  1CKA A;  2RN8 A;  5LJ5 g;  5CKF A;  2HL3 A;  4M77 A;  1ZUU A;  3QWY A;  1PKS A;  5CQY A;  1YIT A;  1IHW A;  3A1P A;  4OMP A;  3BE3 A;  2HNI A;  2GTJ A;  1QVP A;  1TUD A;  2RHI A;  4OP0 A;  3M5A A;  3JB9 G;  5GAN 4;  5GMK l; 
#chains in the Genus database with same CATH homology
 2E4H A;  2E3H A;  1WHK A;  1TOV A;  2CP0 A;  2HL5 C;  3RDV A;  2M02 A;  4B6M A;  1TXQ A;  1WHG A;  2HQH A;  2E3I A;  2CP2 A;  2QK0 A;  2COY A;  1WHJ A;  2HKN A;  2CP7 A;  1LPL A;  2HL3 A;  3E2U A;  1WHL A;  2COW A;  2CP3 A;  2CP5 A;  2COZ A;  2CP6 A;  2MPX C;  2Z0W A;  1WHM A;  3TQ7 P;  1WHH A;  1IXD A;  2HKQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...