2HKNA

Crystal structure of the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hknA00
2Z0WA 1WHKA 2CP7A 2CP5A 1IXDA 2HL5C 2E4HA 1WHJA 4B6MA 1TXQA 2CP6A 2CP2A 2COYA 1LPLA 2COZA 3E2UA 1WHMA 1WHLA 2MPXC 2HKNA 3RDVA 2QK0A 2HKQB 2CP3A 2CP0A 2HQHA 1WHHA 1TOVA 2HL3A 2COWA 3TQ7P 2E3IA 2M02A 1WHGA 2E3HA
chains in the Genus database with same CATH superfamily
4OGEA 3VS6A 4M78A 2J6FA 4KT0E 1SSHA 1Q86R 2RQWA 1XNIA 4F7UF 5IXFA 1QW1A 2HKNA 2R5MA 1ZUUA 2JTEA 1E6HA 4FU6A 1X2QA 4JRKA 4ZN1A 3GP8A 2FPEA 3QYHB 1WXTA 4KUIA 1FYNA 3J7AF 2ED0A 4C92E 5GMKi 1H8KA 4LDVA 3CPWS 1WJQA 3L2RA 3EH1A 4C92B 2IG0A 3EFOB 3IQLA 3CC4Q 1YJ9T 3CC2A 5FU6B 3V7RA 2E10A 3CCVA 1M9SA 4DBFA 2ZGWA 4QVDA 3G71Q 3MHXA 2I0NA 4JPBW 4ZN3A 2EJ9A 1GRIA 2X4JA 3SEMA 2NLUA 1VQ5Q 1VQ8A 3VS2A 1N8RC 3RKYA 1UGRB 1IXDA 4EMHA 4OMNA 3PMIA 4PJLA 1KC8U 2DL5A 1KQSS 3R6NA 5I2MA 5LJ3h 4J9BA 1JB0E 1KQSA 4C8QD 4FCYA 4R0KA 4ANJA 2YSQA 5GAMe 2KE9A 2F5TX 4C8QA 4EIKA 3QZ9B 4AFZC 1G5VA 4HVVA 3JCMQ 2VUBA 2YLCA 4E7ZA 3M9QA 2F2XA 1ZUYA 2JW4A 1BIBA 2RPNA 4A4HA 2OTJT 2HBPA 1UUEA 4BE0A 1U3OA 3UDCA 1OI1A 2LQNA 2LCLA 1QVFP 1S72Q 3VUZA 1OPLA 2R58A 1VQNT 2GBQA 3I5SA 1N8RR 3REBB 2A28A 2IIMA 2VXEA 1K0SA 1BYMA 1PCXA 1X75C 1YIJT 2X3WD 4AT1B 3VV0A 5EC7A 2NUPB 3CMEQ 2M9UA 3ULRB 1G83A 4BDZA 5KYXA 2CP2A 2VGMA 3UATA 4M7DD 1LPLA 5I2SA 1G3YA 2DD4A 3LWHA 2YT6A 2QI2A 2DXTA 2XICA 4M7DA 4A54A 1YHQA 1YN8A 4M7DF 3PVQA 3VS7A 4XTXA 1ZA1B 1XJWB 4J9HA 1K9MR 4BI4A 3SWNA 5GAMh 5LJ3d 3UA7A 1WIEA 1TUGB 5I11A 3SHWA 2X35A 2J6OA 3CCRA 4CRIA 2QQSA 3TEEA 3KXTA 2PUKB 3M0PA 5AT1B 5CAIA 4E47A 3GIBA 3CC4T 4LE9A 3QXEB 2GF7A 3O8VA 5CQYA 4Z8AA 1UE9A 3G71T 3QG1A 2HAXA 4RTTA 2FZGB 3A1PA 3LH0A 2JN0A 4XK8E 1VQ5T 8AT1B 1TOVA 2HEQA 3V7CA 1WQWA 1YNZA 4J7FA 3JCMP 2RQTA 1NYGA 3WVEB 3OS2A 5A0DA 5KCHA 3X25B 1VIEA 2RQRA 1PKTA 2CS7A 2H8HA 2YUQA 1SG5A 2XG8D 2O2OA 3JCMf 2VYTA 3HKSA 3Q1JA 4UC4A 1QP2A 1Q81U 4GLKA 1YJWA 4OGCA 3JB9D 3M0QA 4ME7A 4FYYB 2JOYA 2Z0WA 5D6YA 5GAMd 3QWYA 3QIIA 4LXCA 2V8KA 1VQ6A 4C92D 4KULA 3I56Q 4L6V5 4AG1C 1KIKA 3CD6A 1S72T 1WJSA 1UG1A 4C92A 4M7AB 3EFOA 4JRQA 4BI3A 4AFSC 3CCJQ 1UGPB 3G4SQ 4E7SA 1W4SA 1B07A 4JLGA 3CMET 4IURA 1O9SA 1UEBA 1GCQC 3S3MA 2K7AA 2VC8A 2CDTA 2BIVA 4XU1A 1MGQA 3BDLA 4C0DB 2EJFA 2HCKA 3NFCA 3PT9A 2QTXA 4QQDA 1WHLA 3CMAQ 4LUEA 3P8BB 1OZ2A 1CKAA 1XTDA 1VQPA 1IZ6A 3CCEA 2IVWA 2V1QA 3OBYA 4Z88A 3JCMJ 2K6DA 4J6WA 3ZEHA 1FXXA 3S6WA 1NYFA 2LQKA 3VS1A 2V26A 2E64A 2K9GA 2LRQA 2QA4A 3S3OA 2O9SA 3TU4K 1TS9A 4XTYA 2BE7D 1M1KR 4PNOA 1LJOA 2J06A 1YI2T 3HRUA 1UJYA 2L3PA 3VYGA 2E5KA 3GF5A 4YTLA 2PUOB 1MMNA 1RI9A 4PJOC 2DYIA 2KQWA 3HFOA 5GMKe 1KG1A 4Y92A 4A4EA 4E2FB 2NUPA 2LNVA 1RAAB 3ZL7C 2DTOA 3L42A 4HCBA 3G7ZA 1LVKA 2PVDB 2L5QA 1QVPA 4PK4A 2RNAA 1YJNA 5IHKA 4E7HA 2VKNA 3INZA 4MDWA 3VJPA 3CCMA 2K3XA 1VQMA 1TG0A 5KYUA 2MCNA 2DMOA 2X4WA 1BU1A 2DVEA 1RLQC 3JCMc 2XIDA 3TSWA 5GANf 3CC7A 2QYZA 4C0ZA 1SKUB 2EYZA 4AFUC 1B7TA 2C06A 1MMGA 5GJVB 1K8AU 4A53A 2XKOC 3I56T 1KC8C 1JEGA 5AYFA 2E1HA 5GMKl 5KYYB 5M9OA 1W6XA 2KT1A 3BY7A 1EFNA 2DILA 4QQGA 4Z02A 1VQ4A 3CCJT 1VYTA 3G4ST 3PIPA 4FT4A 5LJ3j 1AOJA 1MV3A 5GMKh 1WLPB 1WJRA 5C0MA 3CBOA 3I55Q 4RTXA 2QDLA 3JCMX 4JLIA 4OB0B 1AWXA 1NEGA 3CMAT 1WGSA 2QQ9A 1H641 1IREB 3UPUA 4JZ4A 3CCLA 5GAOm 2K5LA 3M4YA 2CH4W 5J3BA 2EQKA 2DRKA 1KC8R 1T3LA 4JZ3A 3RNJA 2COWA 1VQOA 3JV3A 4DQ2A 2NYSA 3M4GA 4FSXA 3OQ5A 1UGVA 2KVQG 2PU9B 2RF0A 2YUNA 1VQKA 4ZTJA 2D8HA 1K0XA 3OS1A 4JRIA 2IPOB 2EPDA 5KYWB 3FRNA 1SRLA 1UFFA 5DM7R 2ED1A 2DVJA 3OYKA 4DEYA 3L2ZA 2DIGA 1KD1U 1G3WA 1VYVA 2XU8A 4XU3A 1TUDA 2V8JA 3QDRB 4L5GA 5GAMj 3CCQQ 4BY6C 5CKHA 2PTKA 4AG2C 4KH0B 4M77C 1R0BG 1K73C 4R56A 1PG5B 1X43A 4PFZA 2C0TA 3RIRA 4QT7A 1K4US 4J6XA 1WDXA 2DD5A 3A8LB 4OMQA 2A37A 1KQ2A 1PNJA 1WA7A 1G8XA 2YHTA 3HL8A 1WHMA 1YWOA 1FMWA 1OULA 2DETA 2DTHA 3RDVA 1H92A 1M1GA 2EAYA 1K9AA 3R6OA 2G3RA 3VRYA 1G3SA 1ZBXA 1VQLQ 4M77G 4QKUA 1YCSB 2C0IA 4NL3A 5LJ3g 3RMSA 3URGA 1Q81C 1AZEA 3PE0A 3I55T 2SRCA 3DB3A 1KQSP 3QDFA 2QXFA 4QVZA 1Q82U 2H3JA 3LGLA 2KRNA 1KK7A 1U06A 3A5ZB 2DL4A 2KYMA 1RACB 1D1CA 2OAWA 2LJ1A 3BW1A 1T0HA 4J5YA 5IT9E 1BB9A 3MPUB 3PGGA 2E12A 1N6AA 4RMOA 2LCSA 3BFMA 5GAN6 2DL8A 4M75G 2CSQA 1W70A 2RHIA 1AVZC 1Q81R 3MEAA 5HK0A 1Y71A 5FROA 1D1AA 4JS5A 3C12A 1FX7A 2O9VA 2LC4A 5KYYA 3WXMB 3J80E 3OYHA 1VUBA 1QKWA 3KUFA 1JXOA 4V2SA 4FYWB 4M78D 4KGZB 3VS3A 5LJ3e 1ACMB 1YFNA 3CCQT 3VU3C 4XAXB 2J05A 3LX7A 1M8MA 4M75F 1PKSA 1AT1B 4CC2A 2D8JA 4JDSA 5DY9A 1M4ZA 1SSFA 1VYUA 4J9CA 2NWMA 4M78F 3TCJA 3CEYA 4OB3B 3RKWA 2E41A 1B34B 1UGSB 1FMVA 1HK9A 3QJ6A 1NG2A 2YUPA 5CO7A 3SD4A 5KH6A 2P0KA 4F14A 3M0UA 4RG8A 3EFSA 3CPWA 3AT1B 3I35A 3OYEA 1QVGS 4BD3A 3CCRT 4HKEA 1VQLT 1TWBA 5CK9A 2QASA 4XU0A 4B9XA 1ZBJA 3EG3A 1CKBA 2KSSA 4C8QG 2VVKA 5KYWA 2E65A 4ZGEB 2YWWA 2GTOA 4OB2B 2B86A 5LJ5f 2DBKA 2F5KA 4M7DC 2W0ZA 2DKGA 3EHRA 6AT1B 2PQWA 3TVTA 1UHFA 1I4K1 1K8AC 2MPXC 3CCSQ 2GCXA 1C6VX 4RTYA 1X2KA 2HBWA 4TVRA 1RADB 1D0ZA 1WYXA 3SWNC 2DE0X 1UGQB 4F17A 2MYSA 2EGEA 4J9EA 3U23A 2CSIA 2OJ2A 2ECZA 2DEQA 1ZLMA 4C8QF 1VQMQ 4XTWA 2CP6A 1D3BB 3OYDA 2D6FA 1U8RA 4QQ6A 3ER0A 1WFWA 3DLLA 1K9MC 4OB1B 1NBEB 3MKDA 4M7DG 3MO8A 3M0TA 5D6WA 5GMKj 4QVCA 2VGNA 2LZ6B 5L8RE 3MEWA 3C94A 3QKJA 4N4GA 2Y4YA 4FSSA 3M55A 4BACA 2F1LA 1K8AR 4R55A 4QW2A 4J6YA 4FT2A 4DOVA 4RTWA 3A8GB 3J81E 4PJNA 2E70A 1Q7YU 3M54A 4OMPA 5GAN3 1YITA 1M2OA 1RLPC 1JU5C 2X9HA 3THKA 1MMDA 1NE8A 3NTKA 5FU7C 4KGVB 3JCMg 2E4HA 1X6BA 2OAUA 1K76A 2GTJA 2E6ZA 2X4XA 5LJ5h 2KRSA 4BE2A 2LMJA 3PFSA 1D1BA 2F69A 4M4ZA 2QQRA 1KD1C 4FIBA 3CCET 3EAEA 1RUWA 4XQ3A 1IO6A 2KY9A 4C92C 3M57A 1YI2Q 4B6MA 1C0MA 1NLOC 2K79A 3JB9J 1QCOA 4NL2A 2W10A 3FDRA 3BE3A 2KBTA 1YJ9A 3E2UA 1I07A 3QPHA 4HVUA 4RCBA 3KFVA 1M1FA 2XK0A 2RJCA 3M59A 4EMGA 4X9CA 4PJOE 1VQ7Q 2WSFE 2CKKA 2CZ6B 3UWNA 1FWZA 4PJOB 2O4XA 1AEYA 3JB9G 3JSCA 1GL5A 2LNHB 3CCST 3LGFA 1KD1R 4C92G 3RMQA 1I5LA 1D0YA 2XMFA 3NMZC 1GBQA 2G6FX 1J3TA 3CQTA 3HTRA 1C1AA 3JB9H 3G6EA 3JCMW 1PRMC 1I8FA 4DBHA 1VQMT 2O88A 2YDLA 3X24B 3V8JA 3OYJA 1QWFA 2KXDA 5LJ5d 2O01E 4J83A 3EHQA 3JCMe 3CXCS 3X26B 1PM3A 3L2WA 2OTJA 3M5AA 4M7AE 3CXCA 1N9RA 4E6RA 1U1SA 3JB9F 1V1CA 5IAYA 3VS0A 1HYOA 1WNLA 3ZBDA 2HQHA 1IGQA 4BDYA 4C92F 1VQNA 1M3AA 2JJ9A 1V76A 2RQUA 1M3BA 1M1KC 1YIJA 2JZ2A 3UT1A 2JT4A 1G2BA 1I1JA 3FEOA 1QVFS 2D9TA 3RKXA 3TREA 2L8DA 4HCZA 1VQ9Q 4N0AC 2JM9A 2KR3A 3H6ZA 1UECA 2XDBA 1RAFB 2J6KA 3JAME 4XTUA 5HCKA 4DBRA 2QTVA 1G3TA 2F2VA 4XTVA 2MIOA 3L1AA 3OYLA 2VV5A 3CCUQ 3A98A 3JCMV 2DIQA 2ZPGB 4A4KA 5GANg 1Q82R 2CZ0B 3PNWC 2PVOB 2LP5A 2KAFA 1BCMA 1T3SA 1WQ7A 2J7IA 2QDYB 2YLBA 4PFOA 2AKKA 2MF2A 3X28B 1E7OA 2PVGB 2V8IA 1D3BA 3O5ZA 5GAOl 3PMTA 2SEMA 1MNDA 3JCMh 4XTZA 3M56A 2QEXQ 1PSEA 2DPPB 3VKIA 5A0LA 2FYKA 3CC4A 3CBPA 4CC4B 2D0QB 2ZAEA 3CBMA 2RA2A 3G71A 4J9IA 1UJ0A 1BI1A 4GLMA 1VQ7T 1Y96B 1K1ZA 2NUTB 3FB9A 5GAN2 1VQ5A 2FZKB 1PWTA 3TQ7P 1BI0A 4OMOA 4WTOB 4GBQA 4RTZA 3MEVA 3E9FA 1WHKA 3NPFA 2BZXA 3NTIA 4BB7A 1WHJA 1SHFA 4AFQC 2ROLA 4MZMA 4EMKC 2CUBA 4ZGDB 4BY6B 4ZNXA 1UDLA 1X6GA 4JUVA 4M77B 3DLMA 1HSQA 4BUGA 2L3RA 2EQUA 4ATOA 2GNCA 1N5ZA 3REAB 4Y28E 4C5EA 4EDUA 3A8OB 2KK4A 5D6XA 3RBBB 5GANe 8ATCB 3OS0A 2DAQA 1UHCA 1TXQA 1EIFA 2LQ8A 4FW1A 1S72A 2LT4A 2HSEB 5IHIA 3VRZA 3JCMd 3T9NA 2P4RA 1ZSZC 3CC2Q 3FC3A 4WF2A 3CCVQ 4NS5A 4MZTA 3I5RA 3CMEA 3MP8A 2E3HA 5J26A 2MI6A 1AHJB 1VQ9T 2A08A 2A36A 2DXCA 3UA6A 1VQ8Q 1RABB 1IGUA 3OBWA 1XOVA 1QP3A 3LYIA 5KYNA 4OMMA 4PJOA 2YXYA 4O5VA 3H0IA 1AZGB 4F7UE 3HPWA 3EG0A 3CCUT 1KHCA 4F7UB 4JS4A 2DZ9A 2ABLA 2ENMA 4HT8A 5KE2A 1AWJA 1PHTA 2HSPA 3OW2S 1Q7YC 3OW2A 2EQMA 1N9SA 1PSFA 1YP5A 1HD3A 2QEXT 2K3BA 4M7AD 5GANh 2M51A 1RAGB 4RCCA 2AKLA 5IXBA 2GFUA 3C4SA 2A0FB 4ELYC 1JO8A 1T0JA 4M7AA 2BE9B 3RUXA 4ESRA 3OYFA 2YUOA 4M7AF 2RQVA 2XDPA 2KRMA 1Z9ZA 2FHDA 3EGXB 2EKHA 4C5GA 1JRIA 4MMLA 3RR6A 4MDXA 2FRYA 3A8MB 3FJPA 4KH1B 1QCFA 1BIAA 1QCNA 4EPCA 1YHQQ 1Q7YR 2LTOA 4ELZC 4IIOA 2DZCA 2LCCA 2DTIA 3HSBA 2RN8A 2A7YA 3CPWP 2DK3A 4PL6A 1LOJA 5GAN8 2ROTA 4A63B 3VYHB 2K5FA 3PIOA 2ESWA 2DJZA 1F1BB 3CCRQ 2LQWA 2FRWA 2ZPBB 4IUQA 4DOWA 3I56A 2ZPEB 4GY5A 1IHVA 4LDWA 4ZTFA 2JS2A 3CC2T 4IKFA 5GANd 3CCJA 3CCVT 3G4SA 1SHGA 4M75C 2JTFA 4HCCA 2KNBB 2KT8A 1Y57A 2CYZB 2R57A 2LVMA 3PVLA 4M78C 4X9DA 1EZZB 1Y96A 1OX8A 2NUTA 1VQ8T 5A0GA 2K57A 3H41A 1R8OB 2MOXA 1KFZA 3QWXX 1BI2A 2DEUA 3E1SA 4C5IA 4MZPA 2JTMA 3CMAA 4M7DB 3P8DA 5HKCA 2QGFB 2DERA 1M90U 4RG2A 4N4HA 1W2BS 2K4YA 3MP6A 1VA7A 2FB7A 2CH4A 4FM4B 5CKFA 1TSFA 4PJJA 4Z89A 1W2BA 2C0OA 3FIFA 1ZX6A 2RD1A 3G6EQ 1YJWQ 4F04B 1M27C 4M78G 3G1JA 2VASA 4E7LA 1VQ6Q 2X3XD 4K11A 1WPYA 3CD6Q 2PZ1A 4Y91A 3ASKA 4RTUA 3OYMA 1YCYA 4JRPA 9ATCB 5LJ5g 2DJQA 1VIFA 4AMCA 5DLOA 1U1TA 4OMLA 2FL7A 2XDDA 2DO3A 4PJMA 2EVRA 2BZYA 1ZUKA 2AIRB 4C0GA 2EYQA 2COZA 3GBQA 3L2QA 3OMCA 4BE1A 4JJCA 4C8QC 2WSEE 2JMAA 2DXUA 2QK0A 2EQIA 1OV3A 1YHQT 5FWCA 1WHGA 7AT1B 4BI8B 4F7UA 4LD6A 1VQPQ 2EGAA 4Q5WA 5KE3A 2KROA 3CCEQ 3EGDB 2DYBA 1EX4A 5FU7B 5ECAA 1CSKA 4PLIA 3JB9I 4LN2A 3M58A 3EFRA 5IN1A 5FLXE 2RH2A 1ZA2B 3L2VA 1HXDA 5GAN5 1QVGA 3EG2A 1I0CA 2QA4Q 3LWIA 4B9WA 1NLPC 2EWNA 1WXUA 2EW3A 3NGPA 2QAZA 3V7SA 1OU8A 1ZHIA 1A0NB 2AZVA 2DL3A 2RK2A 4X34A 2BTTA 2BKDN 2CP5A 4E7KA 1WX6A 2V1RA 3QO3A 4JJNK 5EG2A 3OYIA 2YRDA 1WXBA 2KXCA 2OTLA 4VUBA 3I55A 3HFNA 3EGXA 4IIMA 1YWPA 4L59A 1SF9A 2BZ8A 5CIUA 3VUBA 5LJ5e 1YJNQ 2HD0A 4XU2A 5GAMf 2CUDA 3CCMQ 1FMKA 2RJEA 3I9QA 1JQQA 4O6JA 3RERA 2KDSA 4IUPA 1TUCA 5CR2A 3OYAA 3CXCP 4C0FA 3GOXA 3LW5E 1AD5A 3QBYA 2EYXA 5IH2A 3CC7Q 2LJ3A 5CCAA 3G6ET 1YJWT 3OYBA 1O75A 1PD1A 1SEMA 2HZYA 2Y4XA 5FW9A 5I21A 2DM1A 2D1XA 1QLYA 4DBQA 1VQ6T 3SDZA 3SFMA 1UTIA 5CKEA 3CD6T 2EJGA 3E9GA 2HNIA 1ZQ1A 3QYGB 2MK5A 5I22A 2EYYA 1BCOA 3TSZA 1VQ4Q 5L23A 1KJWA 2X51A 2CP3A 2BUDA 4JJDA 2HQXA 3OYNA 1NPRA 1MV0B 3GNFB 2KYBA 4WCIA 2WSCE 1JJ2S 1V29B 4PLLA 2X4YA 1JJ2A 3CCQA 4KBMB 3EH2A 4HA8A 1MMAA 2RHUA 1OQKA 4PFPA 1M30A 4OF1A 3CCLQ 3C95A 1DJ7B 5GANj 5KYUB 1VQPT 2JVVA 2YRVA 4J9DA 2EBPA 1PRLC 1VQOQ 1PD0A 2NUZA 3VS4A 2DA9A 1ABOA 4PKCC 5FU6C 5GAOn 2QA4T 3PTAA 3EGUA 4C5HA 2EFIA 1VQLA 1VQKQ 4LDYA 2CZ7B 2EGCA 3E19A 3KBGA 1K73U 2EQJA 1BKBA 1Q95G 2XD0A 1QKXA 1Z9QA 1OU9A 2DBMA 1GFCA 2K2MA 3HRSA 2RO0A 1BBZA 1YJNT 1BK2A 1M2VB 3OS5A 5HY6A 2LT1A 4J9GA 3C0CA 3QUIA 3EG1A 2LJ0A 3CCMT 1IB8A 1LCKA 3P8HA 2DRMA 1B34A 2VXFA 3GNGA 2WACA 4FL6A 1ARKA 4FYVB 4EMKB 4ORZA 3CC7T 3M0SA 1Q82C 1MNEA 3EGDA 1NJIU 2P0QA 3QZ5B 3HRTA 2KI7A 1BI3A 4D6WA 2EYWA 5J39A 2DNUA 4OP0A 5CKBA 3MCAB 1RAHB 2K2VA 1WZOA 1GCPA 1M90C 1RL2A 3JRZA 3FJ5A 3QJYA 4LD9K 5HK3A 3LLRA 1NM7A 1VQ4T 2H3EB 1I81A 4J9FA 1E6GA 2COYA 1QVFA 3QSUA 1QQJA 4KGXB 2P84A 1ZSZB 5CKDA 4RUGA 2F2WA 4ZGJB 1WHHA 1U5SA 4HXJA 2MWPA 1M5Q1 3UF4A 3V8LA 4HT9A 1VOMA 1Q86U 1SPKA 1H3ZA 4DA4A 2ZCFB 4RTVA 2HL5C 1QMCA 2ZZDA 1X27A 2L2PA 3CCLT 1LNXA 2M1HA 3OW2P 2GQIA 2AHJB 1OZ3A 1GFDA 5FRMA 2K3YA 2XI9A 1M90R 2L3SA 1VQOT 1GBRA 5CQXA 3H0FA 1MUZA 2FG0A 5GAOq 2JM8A 4CC3A 2CP7A 2R5AA 3M0RA 1Y7XA 2PNIA 3OY9A 2KGTA 1VQKT 2LX7A 3N5BB 3OA6A 2L0AA 2LX9A 2FVUA 2HL3A 1HJDA 1NZ9A 4CI0C 2RMOA 2RHYA 3CCSA 4CC7A 1GCQA 4M77E 1XQHA 3OYCA 4D8KA 2HKQB 3EG9B 2M0OA 4N0AA 4IUVA 1P92A 4DEXA 2RK1A 4J8OA 4D8DA 2CREA 2VWFA 4MMKA 1D09B 3NHNA 2CZ1B 4PJOG 1KHIA 1N8RU 4KUDK 1NPPA 4M7AC 1N27A 1Y07A 2HQEA 3META 1YBYA 2LDMA 5GAOr 3LH5A 2XHCA 3DKMA 2CGHA 4PJOD 2M16A 4HVWA 2AK5A 3H8ZA 4X1VA 2GGRA 4C0DC 3GLXA 3NTHA 4M75E 2Y90A 2B8AA 4N4IA 1R0CB 3L2UA 1ZSGA 4M75B 4OVAA 2DX1A 4M78E 4PJOF 2OTLQ 2JUFA 2MMPA 1W2BP 2JMCA 4HCKA 2KEAA 2VB6A 4M78B 4M7AG 2KMTA 1ABQA 1K9MU 2HDAA 5C6SA 3WVDB 1M2VA 4E7JA 3AHUA 3A8HB 4E7IA 4A4GA 3MP1A 1JBMA 3OYYA 3H0HA 5GAN7 4II1A 4IUUA 2MWOA 2DF6A 4EMKA 2FPFA 1IRXA 2JNGA 3OSSC 1YI2A 2JXBA 1Y0MA 2HMAA 1GXIE 4LNPA 1QWEA 3VS5A 5A2QE 3JCMb 5LJ5j 4F16A 3QHSA 3DB4A 1VQ7A 1OYXA 4RKUE 3MEUA 2CT4A 1SRMA 2O31A 1PC0A 2K5IA 3GPLA 2GFAA 1RAIB 4OMFB 1B3QA 2RM4A 1ZSZA 1OEBA 5CVIA 2DFUA 1YITQ 1KQ1A 2MAMA 2QG9B 2FEIA 1MHNA 2RHZA 3HHTB 4C8QE 3OYGA 3RESA 1OX9A 2AT1B 2RI3A 4C8QB 5KCOA 2CP0A 1AWOA 1QVGP 3OB9A 3V8KA 2AZSA 4NOYA 1S1NA 5GMKm 1R77A 3ZFJA 3M53A 2P4TA 3FLGA 2RI2A 2RI5A 4FYXB 2P0PA 5FWBA 4A4FA 3OSVA 2ATCB 2M0YA 2I2LA 1NEBA 2RJFA 4LDUA 1OOTA 3HP9A 1YJ9Q 1H3HA 1TH7A 4LUDA 2E3IA 2JS0A 2M02A 5KYXB 4FW2A 2CT3A 1IHWA 1NJIC 2OI3A 2QGGA 3MJXA 4M7DE 2A3LA 1VQ9A 5DLQE 3ME9A 1TU0B 2OX7A 2FZCB 1K73R 1W1FA 1RI0A 2OTLT 1I5OB 3D7SB 1M3CA 2EKOA 4J7IA 1D0XA 1UB4A 1RAEB 4M77D 2L3QA 3X20B 2D0NA 3CCUA 2QQBA 2L89A 4IUTA 2RB6A 2QQAA 4M77A 3SWNB 3EG9A 5LL6S 2YRCA 4M77F 1OPKA 2GQVA 2FO0A 4P5NA 1TTHB 3F70A 4JJBA 1M1KU 5IHNA 2ZPHB 1X69A 3H9NA 5GAOp 5GJWB 1Q86C 2OTJQ 2EIFA 2QEXA 1WI7A 4LDXA 1NJIR 2DLPA 5GAN4 4F7UG 1JXMA 1VQNQ 4KRTA 1JJ2P 2ZPFB 1AWWA 1YIJQ 3S3NA 5LJ3f 2RHXA 5D7UA 1M8VA 2DL7A 2FPDA 2RJDA 4M75D 1X6OA 2O4XB 5FRNA 1X01A 5GAMg 2E5QA 3CPFA 1KSWA 1YITT 3SB2A 4M75A 2ZPIB 2E6NA 3OMGA 3BDUA 2DXBA
chains in the Genus database with same CATH topology
2Z0WA 1WHKA 2CP7A 2CP5A 1IXDA 2HL5C 2E4HA 1WHJA 4B6MA 1TXQA 2CP6A 2CP2A 2COYA 1LPLA 2COZA 3E2UA 1WHMA 1WHLA 2MPXC 2HKNA 3RDVA 2QK0A 2HKQB 2CP3A 2CP0A 2HQHA 1WHHA 1TOVA 2HL3A 2COWA 3TQ7P 2E3IA 2M02A 1WHGA 2E3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0W A;  1WHK A;  2CP7 A;  2CP5 A;  1IXD A;  2HL5 C;  2E4H A;  1WHJ A;  4B6M A;  1TXQ A;  2CP6 A;  2CP2 A;  2COY A;  1LPL A;  2COZ A;  3E2U A;  1WHM A;  1WHL A;  2MPX C;  2HKN A;  3RDV A;  2QK0 A;  2HKQ B;  2CP3 A;  2CP0 A;  2HQH A;  1WHH A;  1TOV A;  2HL3 A;  2COW A;  3TQ7 P;  2E3I A;  2M02 A;  1WHG A;  2E3H A; 
#chains in the Genus database with same CATH topology
 4OGE A;  3VS6 A;  4M78 A;  2J6F A;  4KT0 E;  1SSH A;  1Q86 R;  2RQW A;  1XNI A;  4F7U F;  5IXF A;  1QW1 A;  2HKN A;  2R5M A;  1ZUU A;  2JTE A;  1E6H A;  4FU6 A;  1X2Q A;  4JRK A;  4ZN1 A;  3GP8 A;  2FPE A;  3QYH B;  1WXT A;  4KUI A;  1FYN A;  3J7A F;  2ED0 A;  4C92 E;  5GMK i;  1H8K A;  4LDV A;  3CPW S;  1WJQ A;  3L2R A;  3EH1 A;  4C92 B;  2IG0 A;  3EFO B;  3IQL A;  3CC4 Q;  1YJ9 T;  3CC2 A;  5FU6 B;  3V7R A;  2E10 A;  3CCV A;  1M9S A;  4DBF A;  2ZGW A;  4QVD A;  3G71 Q;  3MHX A;  2I0N A;  4JPB W;  4ZN3 A;  2EJ9 A;  1GRI A;  2X4J A;  3SEM A;  2NLU A;  1VQ5 Q;  1VQ8 A;  3VS2 A;  1N8R C;  3RKY A;  1UGR B;  1IXD A;  4EMH A;  4OMN A;  3PMI A;  4PJL A;  1KC8 U;  2DL5 A;  1KQS S;  3R6N A;  5I2M A;  5LJ3 h;  4J9B A;  1JB0 E;  1KQS A;  4C8Q D;  4FCY A;  4R0K A;  4ANJ A;  2YSQ A;  5GAM e;  2KE9 A;  2F5T X;  4C8Q A;  4EIK A;  3QZ9 B;  4AFZ C;  1G5V A;  4HVV A;  3JCM Q;  2VUB A;  2YLC A;  4E7Z A;  3M9Q A;  2F2X A;  1ZUY A;  2JW4 A;  1BIB A;  2RPN A;  4A4H A;  2OTJ T;  2HBP A;  1UUE A;  4BE0 A;  1U3O A;  3UDC A;  1OI1 A;  2LQN A;  2LCL A;  1QVF P;  1S72 Q;  3VUZ A;  1OPL A;  2R58 A;  1VQN T;  2GBQ A;  3I5S A;  1N8R R;  3REB B;  2A28 A;  2IIM A;  2VXE A;  1K0S A;  1BYM A;  1PCX A;  1X75 C;  1YIJ T;  2X3W D;  4AT1 B;  3VV0 A;  5EC7 A;  2NUP B;  3CME Q;  2M9U A;  3ULR B;  1G83 A;  4BDZ A;  5KYX A;  2CP2 A;  2VGM A;  3UAT A;  4M7D D;  1LPL A;  5I2S A;  1G3Y A;  2DD4 A;  3LWH A;  2YT6 A;  2QI2 A;  2DXT A;  2XIC A;  4M7D A;  4A54 A;  1YHQ A;  1YN8 A;  4M7D F;  3PVQ A;  3VS7 A;  4XTX A;  1ZA1 B;  1XJW B;  4J9H A;  1K9M R;  4BI4 A;  3SWN A;  5GAM h;  5LJ3 d;  3UA7 A;  1WIE A;  1TUG B;  5I11 A;  3SHW A;  2X35 A;  2J6O A;  3CCR A;  4CRI A;  2QQS A;  3TEE A;  3KXT A;  2PUK B;  3M0P A;  5AT1 B;  5CAI A;  4E47 A;  3GIB A;  3CC4 T;  4LE9 A;  3QXE B;  2GF7 A;  3O8V A;  5CQY A;  4Z8A A;  1UE9 A;  3G71 T;  3QG1 A;  2HAX A;  4RTT A;  2FZG B;  3A1P A;  3LH0 A;  2JN0 A;  4XK8 E;  1VQ5 T;  8AT1 B;  1TOV A;  2HEQ A;  3V7C A;  1WQW A;  1YNZ A;  4J7F A;  3JCM P;  2RQT A;  1NYG A;  3WVE B;  3OS2 A;  5A0D A;  5KCH A;  3X25 B;  1VIE A;  2RQR A;  1PKT A;  2CS7 A;  2H8H A;  2YUQ A;  1SG5 A;  2XG8 D;  2O2O A;  3JCM f;  2VYT A;  3HKS A;  3Q1J A;  4UC4 A;  1QP2 A;  1Q81 U;  4GLK A;  1YJW A;  4OGC A;  3JB9 D;  3M0Q A;  4ME7 A;  4FYY B;  2JOY A;  2Z0W A;  5D6Y A;  5GAM d;  3QWY A;  3QII A;  4LXC A;  2V8K A;  1VQ6 A;  4C92 D;  4KUL A;  3I56 Q;  4L6V 5;  4AG1 C;  1KIK A;  3CD6 A;  1S72 T;  1WJS A;  1UG1 A;  4C92 A;  4M7A B;  3EFO A;  4JRQ A;  4BI3 A;  4AFS C;  3CCJ Q;  1UGP B;  3G4S Q;  4E7S A;  1W4S A;  1B07 A;  4JLG A;  3CME T;  4IUR A;  1O9S A;  1UEB A;  1GCQ C;  3S3M A;  2K7A A;  2VC8 A;  2CDT A;  2BIV A;  4XU1 A;  1MGQ A;  3BDL A;  4C0D B;  2EJF A;  2HCK A;  3NFC A;  3PT9 A;  2QTX A;  4QQD A;  1WHL A;  3CMA Q;  4LUE A;  3P8B B;  1OZ2 A;  1CKA A;  1XTD A;  1VQP A;  1IZ6 A;  3CCE A;  2IVW A;  2V1Q A;  3OBY A;  4Z88 A;  3JCM J;  2K6D A;  4J6W A;  3ZEH A;  1FXX A;  3S6W A;  1NYF A;  2LQK A;  3VS1 A;  2V26 A;  2E64 A;  2K9G A;  2LRQ A;  2QA4 A;  3S3O A;  2O9S A;  3TU4 K;  1TS9 A;  4XTY A;  2BE7 D;  1M1K R;  4PNO A;  1LJO A;  2J06 A;  1YI2 T;  3HRU A;  1UJY A;  2L3P A;  3VYG A;  2E5K A;  3GF5 A;  4YTL A;  2PUO B;  1MMN A;  1RI9 A;  4PJO C;  2DYI A;  2KQW A;  3HFO A;  5GMK e;  1KG1 A;  4Y92 A;  4A4E A;  4E2F B;  2NUP A;  2LNV A;  1RAA B;  3ZL7 C;  2DTO A;  3L42 A;  4HCB A;  3G7Z A;  1LVK A;  2PVD B;  2L5Q A;  1QVP A;  4PK4 A;  2RNA A;  1YJN A;  5IHK A;  4E7H A;  2VKN A;  3INZ A;  4MDW A;  3VJP A;  3CCM A;  2K3X A;  1VQM A;  1TG0 A;  5KYU A;  2MCN A;  2DMO A;  2X4W A;  1BU1 A;  2DVE A;  1RLQ C;  3JCM c;  2XID A;  3TSW A;  5GAN f;  3CC7 A;  2QYZ A;  4C0Z A;  1SKU B;  2EYZ A;  4AFU C;  1B7T A;  2C06 A;  1MMG A;  5GJV B;  1K8A U;  4A53 A;  2XKO C;  3I56 T;  1KC8 C;  1JEG A;  5AYF A;  2E1H A;  5GMK l;  5KYY B;  5M9O A;  1W6X A;  2KT1 A;  3BY7 A;  1EFN A;  2DIL A;  4QQG A;  4Z02 A;  1VQ4 A;  3CCJ T;  1VYT A;  3G4S T;  3PIP A;  4FT4 A;  5LJ3 j;  1AOJ A;  1MV3 A;  5GMK h;  1WLP B;  1WJR A;  5C0M A;  3CBO A;  3I55 Q;  4RTX A;  2QDL A;  3JCM X;  4JLI A;  4OB0 B;  1AWX A;  1NEG A;  3CMA T;  1WGS A;  2QQ9 A;  1H64 1;  1IRE B;  3UPU A;  4JZ4 A;  3CCL A;  5GAO m;  2K5L A;  3M4Y A;  2CH4 W;  5J3B A;  2EQK A;  2DRK A;  1KC8 R;  1T3L A;  4JZ3 A;  3RNJ A;  2COW A;  1VQO A;  3JV3 A;  4DQ2 A;  2NYS A;  3M4G A;  4FSX A;  3OQ5 A;  1UGV A;  2KVQ G;  2PU9 B;  2RF0 A;  2YUN A;  1VQK A;  4ZTJ A;  2D8H A;  1K0X A;  3OS1 A;  4JRI A;  2IPO B;  2EPD A;  5KYW B;  3FRN A;  1SRL A;  1UFF A;  5DM7 R;  2ED1 A;  2DVJ A;  3OYK A;  4DEY A;  3L2Z A;  2DIG A;  1KD1 U;  1G3W A;  1VYV A;  2XU8 A;  4XU3 A;  1TUD A;  2V8J A;  3QDR B;  4L5G A;  5GAM j;  3CCQ Q;  4BY6 C;  5CKH A;  2PTK A;  4AG2 C;  4KH0 B;  4M77 C;  1R0B G;  1K73 C;  4R56 A;  1PG5 B;  1X43 A;  4PFZ A;  2C0T A;  3RIR A;  4QT7 A;  1K4U S;  4J6X A;  1WDX A;  2DD5 A;  3A8L B;  4OMQ A;  2A37 A;  1KQ2 A;  1PNJ A;  1WA7 A;  1G8X A;  2YHT A;  3HL8 A;  1WHM A;  1YWO A;  1FMW A;  1OUL A;  2DET A;  2DTH A;  3RDV A;  1H92 A;  1M1G A;  2EAY A;  1K9A A;  3R6O A;  2G3R A;  3VRY A;  1G3S A;  1ZBX A;  1VQL Q;  4M77 G;  4QKU A;  1YCS B;  2C0I A;  4NL3 A;  5LJ3 g;  3RMS A;  3URG A;  1Q81 C;  1AZE A;  3PE0 A;  3I55 T;  2SRC A;  3DB3 A;  1KQS P;  3QDF A;  2QXF A;  4QVZ A;  1Q82 U;  2H3J A;  3LGL A;  2KRN A;  1KK7 A;  1U06 A;  3A5Z B;  2DL4 A;  2KYM A;  1RAC B;  1D1C A;  2OAW A;  2LJ1 A;  3BW1 A;  1T0H A;  4J5Y A;  5IT9 E;  1BB9 A;  3MPU B;  3PGG A;  2E12 A;  1N6A A;  4RMO A;  2LCS A;  3BFM A;  5GAN 6;  2DL8 A;  4M75 G;  2CSQ A;  1W70 A;  2RHI A;  1AVZ C;  1Q81 R;  3MEA A;  5HK0 A;  1Y71 A;  5FRO A;  1D1A A;  4JS5 A;  3C12 A;  1FX7 A;  2O9V A;  2LC4 A;  5KYY A;  3WXM B;  3J80 E;  3OYH A;  1VUB A;  1QKW A;  3KUF A;  1JXO A;  4V2S A;  4FYW B;  4M78 D;  4KGZ B;  3VS3 A;  5LJ3 e;  1ACM B;  1YFN A;  3CCQ T;  3VU3 C;  4XAX B;  2J05 A;  3LX7 A;  1M8M A;  4M75 F;  1PKS A;  1AT1 B;  4CC2 A;  2D8J A;  4JDS A;  5DY9 A;  1M4Z A;  1SSF A;  1VYU A;  4J9C A;  2NWM A;  4M78 F;  3TCJ A;  3CEY A;  4OB3 B;  3RKW A;  2E41 A;  1B34 B;  1UGS B;  1FMV A;  1HK9 A;  3QJ6 A;  1NG2 A;  2YUP A;  5CO7 A;  3SD4 A;  5KH6 A;  2P0K A;  4F14 A;  3M0U A;  4RG8 A;  3EFS A;  3CPW A;  3AT1 B;  3I35 A;  3OYE A;  1QVG S;  4BD3 A;  3CCR T;  4HKE A;  1VQL T;  1TWB A;  5CK9 A;  2QAS A;  4XU0 A;  4B9X A;  1ZBJ A;  3EG3 A;  1CKB A;  2KSS A;  4C8Q G;  2VVK A;  5KYW A;  2E65 A;  4ZGE B;  2YWW A;  2GTO A;  4OB2 B;  2B86 A;  5LJ5 f;  2DBK A;  2F5K A;  4M7D C;  2W0Z A;  2DKG A;  3EHR A;  6AT1 B;  2PQW A;  3TVT A;  1UHF A;  1I4K 1;  1K8A C;  2MPX C;  3CCS Q;  2GCX A;  1C6V X;  4RTY A;  1X2K A;  2HBW A;  4TVR A;  1RAD B;  1D0Z A;  1WYX A;  3SWN C;  2DE0 X;  1UGQ B;  4F17 A;  2MYS A;  2EGE A;  4J9E A;  3U23 A;  2CSI A;  2OJ2 A;  2ECZ A;  2DEQ A;  1ZLM A;  4C8Q F;  1VQM Q;  4XTW A;  2CP6 A;  1D3B B;  3OYD A;  2D6F A;  1U8R A;  4QQ6 A;  3ER0 A;  1WFW A;  3DLL A;  1K9M C;  4OB1 B;  1NBE B;  3MKD A;  4M7D G;  3MO8 A;  3M0T A;  5D6W A;  5GMK j;  4QVC A;  2VGN A;  2LZ6 B;  5L8R E;  3MEW A;  3C94 A;  3QKJ A;  4N4G A;  2Y4Y A;  4FSS A;  3M55 A;  4BAC A;  2F1L A;  1K8A R;  4R55 A;  4QW2 A;  4J6Y A;  4FT2 A;  4DOV A;  4RTW A;  3A8G B;  3J81 E;  4PJN A;  2E70 A;  1Q7Y U;  3M54 A;  4OMP A;  5GAN 3;  1YIT A;  1M2O A;  1RLP C;  1JU5 C;  2X9H A;  3THK A;  1MMD A;  1NE8 A;  3NTK A;  5FU7 C;  4KGV B;  3JCM g;  2E4H A;  1X6B A;  2OAU A;  1K76 A;  2GTJ A;  2E6Z A;  2X4X A;  5LJ5 h;  2KRS A;  4BE2 A;  2LMJ A;  3PFS A;  1D1B A;  2F69 A;  4M4Z A;  2QQR A;  1KD1 C;  4FIB A;  3CCE T;  3EAE A;  1RUW A;  4XQ3 A;  1IO6 A;  2KY9 A;  4C92 C;  3M57 A;  1YI2 Q;  4B6M A;  1C0M A;  1NLO C;  2K79 A;  3JB9 J;  1QCO A;  4NL2 A;  2W10 A;  3FDR A;  3BE3 A;  2KBT A;  1YJ9 A;  3E2U A;  1I07 A;  3QPH A;  4HVU A;  4RCB A;  3KFV A;  1M1F A;  2XK0 A;  2RJC A;  3M59 A;  4EMG A;  4X9C A;  4PJO E;  1VQ7 Q;  2WSF E;  2CKK A;  2CZ6 B;  3UWN A;  1FWZ A;  4PJO B;  2O4X A;  1AEY A;  3JB9 G;  3JSC A;  1GL5 A;  2LNH B;  3CCS T;  3LGF A;  1KD1 R;  4C92 G;  3RMQ A;  1I5L A;  1D0Y A;  2XMF A;  3NMZ C;  1GBQ A;  2G6F X;  1J3T A;  3CQT A;  3HTR A;  1C1A A;  3JB9 H;  3G6E A;  3JCM W;  1PRM C;  1I8F A;  4DBH A;  1VQM T;  2O88 A;  2YDL A;  3X24 B;  3V8J A;  3OYJ A;  1QWF A;  2KXD A;  5LJ5 d;  2O01 E;  4J83 A;  3EHQ A;  3JCM e;  3CXC S;  3X26 B;  1PM3 A;  3L2W A;  2OTJ A;  3M5A A;  4M7A E;  3CXC A;  1N9R A;  4E6R A;  1U1S A;  3JB9 F;  1V1C A;  5IAY A;  3VS0 A;  1HYO A;  1WNL A;  3ZBD A;  2HQH A;  1IGQ A;  4BDY A;  4C92 F;  1VQN A;  1M3A A;  2JJ9 A;  1V76 A;  2RQU A;  1M3B A;  1M1K C;  1YIJ A;  2JZ2 A;  3UT1 A;  2JT4 A;  1G2B A;  1I1J A;  3FEO A;  1QVF S;  2D9T A;  3RKX A;  3TRE A;  2L8D A;  4HCZ A;  1VQ9 Q;  4N0A C;  2JM9 A;  2KR3 A;  3H6Z A;  1UEC A;  2XDB A;  1RAF B;  2J6K A;  3JAM E;  4XTU A;  5HCK A;  4DBR A;  2QTV A;  1G3T A;  2F2V A;  4XTV A;  2MIO A;  3L1A A;  3OYL A;  2VV5 A;  3CCU Q;  3A98 A;  3JCM V;  2DIQ A;  2ZPG B;  4A4K A;  5GAN g;  1Q82 R;  2CZ0 B;  3PNW C;  2PVO B;  2LP5 A;  2KAF A;  1BCM A;  1T3S A;  1WQ7 A;  2J7I A;  2QDY B;  2YLB A;  4PFO A;  2AKK A;  2MF2 A;  3X28 B;  1E7O A;  2PVG B;  2V8I A;  1D3B A;  3O5Z A;  5GAO l;  3PMT A;  2SEM A;  1MND A;  3JCM h;  4XTZ A;  3M56 A;  2QEX Q;  1PSE A;  2DPP B;  3VKI A;  5A0L A;  2FYK A;  3CC4 A;  3CBP A;  4CC4 B;  2D0Q B;  2ZAE A;  3CBM A;  2RA2 A;  3G71 A;  4J9I A;  1UJ0 A;  1BI1 A;  4GLM A;  1VQ7 T;  1Y96 B;  1K1Z A;  2NUT B;  3FB9 A;  5GAN 2;  1VQ5 A;  2FZK B;  1PWT A;  3TQ7 P;  1BI0 A;  4OMO A;  4WTO B;  4GBQ A;  4RTZ A;  3MEV A;  3E9F A;  1WHK A;  3NPF A;  2BZX A;  3NTI A;  4BB7 A;  1WHJ A;  1SHF A;  4AFQ C;  2ROL A;  4MZM A;  4EMK C;  2CUB A;  4ZGD B;  4BY6 B;  4ZNX A;  1UDL A;  1X6G A;  4JUV A;  4M77 B;  3DLM A;  1HSQ A;  4BUG A;  2L3R A;  2EQU A;  4ATO A;  2GNC A;  1N5Z A;  3REA B;  4Y28 E;  4C5E A;  4EDU A;  3A8O B;  2KK4 A;  5D6X A;  3RBB B;  5GAN e;  8ATC B;  3OS0 A;  2DAQ A;  1UHC A;  1TXQ A;  1EIF A;  2LQ8 A;  4FW1 A;  1S72 A;  2LT4 A;  2HSE B;  5IHI A;  3VRZ A;  3JCM d;  3T9N A;  2P4R A;  1ZSZ C;  3CC2 Q;  3FC3 A;  4WF2 A;  3CCV Q;  4NS5 A;  4MZT A;  3I5R A;  3CME A;  3MP8 A;  2E3H A;  5J26 A;  2MI6 A;  1AHJ B;  1VQ9 T;  2A08 A;  2A36 A;  2DXC A;  3UA6 A;  1VQ8 Q;  1RAB B;  1IGU A;  3OBW A;  1XOV A;  1QP3 A;  3LYI A;  5KYN A;  4OMM A;  4PJO A;  2YXY A;  4O5V A;  3H0I A;  1AZG B;  4F7U E;  3HPW A;  3EG0 A;  3CCU T;  1KHC A;  4F7U B;  4JS4 A;  2DZ9 A;  2ABL A;  2ENM A;  4HT8 A;  5KE2 A;  1AWJ A;  1PHT A;  2HSP A;  3OW2 S;  1Q7Y C;  3OW2 A;  2EQM A;  1N9S A;  1PSF A;  1YP5 A;  1HD3 A;  2QEX T;  2K3B A;  4M7A D;  5GAN h;  2M51 A;  1RAG B;  4RCC A;  2AKL A;  5IXB A;  2GFU A;  3C4S A;  2A0F B;  4ELY C;  1JO8 A;  1T0J A;  4M7A A;  2BE9 B;  3RUX A;  4ESR A;  3OYF A;  2YUO A;  4M7A F;  2RQV A;  2XDP A;  2KRM A;  1Z9Z A;  2FHD A;  3EGX B;  2EKH A;  4C5G A;  1JRI A;  4MML A;  3RR6 A;  4MDX A;  2FRY A;  3A8M B;  3FJP A;  4KH1 B;  1QCF A;  1BIA A;  1QCN A;  4EPC A;  1YHQ Q;  1Q7Y R;  2LTO A;  4ELZ C;  4IIO A;  2DZC A;  2LCC A;  2DTI A;  3HSB A;  2RN8 A;  2A7Y A;  3CPW P;  2DK3 A;  4PL6 A;  1LOJ A;  5GAN 8;  2ROT A;  4A63 B;  3VYH B;  2K5F A;  3PIO A;  2ESW A;  2DJZ A;  1F1B B;  3CCR Q;  2LQW A;  2FRW A;  2ZPB B;  4IUQ A;  4DOW A;  3I56 A;  2ZPE B;  4GY5 A;  1IHV A;  4LDW A;  4ZTF A;  2JS2 A;  3CC2 T;  4IKF A;  5GAN d;  3CCJ A;  3CCV T;  3G4S A;  1SHG A;  4M75 C;  2JTF A;  4HCC A;  2KNB B;  2KT8 A;  1Y57 A;  2CYZ B;  2R57 A;  2LVM A;  3PVL A;  4M78 C;  4X9D A;  1EZZ B;  1Y96 A;  1OX8 A;  2NUT A;  1VQ8 T;  5A0G A;  2K57 A;  3H41 A;  1R8O B;  2MOX A;  1KFZ A;  3QWX X;  1BI2 A;  2DEU A;  3E1S A;  4C5I A;  4MZP A;  2JTM A;  3CMA A;  4M7D B;  3P8D A;  5HKC A;  2QGF B;  2DER A;  1M90 U;  4RG2 A;  4N4H A;  1W2B S;  2K4Y A;  3MP6 A;  1VA7 A;  2FB7 A;  2CH4 A;  4FM4 B;  5CKF A;  1TSF A;  4PJJ A;  4Z89 A;  1W2B A;  2C0O A;  3FIF A;  1ZX6 A;  2RD1 A;  3G6E Q;  1YJW Q;  4F04 B;  1M27 C;  4M78 G;  3G1J A;  2VAS A;  4E7L A;  1VQ6 Q;  2X3X D;  4K11 A;  1WPY A;  3CD6 Q;  2PZ1 A;  4Y91 A;  3ASK A;  4RTU A;  3OYM A;  1YCY A;  4JRP A;  9ATC B;  5LJ5 g;  2DJQ A;  1VIF A;  4AMC A;  5DLO A;  1U1T A;  4OML A;  2FL7 A;  2XDD A;  2DO3 A;  4PJM A;  2EVR A;  2BZY A;  1ZUK A;  2AIR B;  4C0G A;  2EYQ A;  2COZ A;  3GBQ A;  3L2Q A;  3OMC A;  4BE1 A;  4JJC A;  4C8Q C;  2WSE E;  2JMA A;  2DXU A;  2QK0 A;  2EQI A;  1OV3 A;  1YHQ T;  5FWC A;  1WHG A;  7AT1 B;  4BI8 B;  4F7U A;  4LD6 A;  1VQP Q;  2EGA A;  4Q5W A;  5KE3 A;  2KRO A;  3CCE Q;  3EGD B;  2DYB A;  1EX4 A;  5FU7 B;  5ECA A;  1CSK A;  4PLI A;  3JB9 I;  4LN2 A;  3M58 A;  3EFR A;  5IN1 A;  5FLX E;  2RH2 A;  1ZA2 B;  3L2V A;  1HXD A;  5GAN 5;  1QVG A;  3EG2 A;  1I0C A;  2QA4 Q;  3LWI A;  4B9W A;  1NLP C;  2EWN A;  1WXU A;  2EW3 A;  3NGP A;  2QAZ A;  3V7S A;  1OU8 A;  1ZHI A;  1A0N B;  2AZV A;  2DL3 A;  2RK2 A;  4X34 A;  2BTT A;  2BKD N;  2CP5 A;  4E7K A;  1WX6 A;  2V1R A;  3QO3 A;  4JJN K;  5EG2 A;  3OYI A;  2YRD A;  1WXB A;  2KXC A;  2OTL A;  4VUB A;  3I55 A;  3HFN A;  3EGX A;  4IIM A;  1YWP A;  4L59 A;  1SF9 A;  2BZ8 A;  5CIU A;  3VUB A;  5LJ5 e;  1YJN Q;  2HD0 A;  4XU2 A;  5GAM f;  2CUD A;  3CCM Q;  1FMK A;  2RJE A;  3I9Q A;  1JQQ A;  4O6J A;  3RER A;  2KDS A;  4IUP A;  1TUC A;  5CR2 A;  3OYA A;  3CXC P;  4C0F A;  3GOX A;  3LW5 E;  1AD5 A;  3QBY A;  2EYX A;  5IH2 A;  3CC7 Q;  2LJ3 A;  5CCA A;  3G6E T;  1YJW T;  3OYB A;  1O75 A;  1PD1 A;  1SEM A;  2HZY A;  2Y4X A;  5FW9 A;  5I21 A;  2DM1 A;  2D1X A;  1QLY A;  4DBQ A;  1VQ6 T;  3SDZ A;  3SFM A;  1UTI A;  5CKE A;  3CD6 T;  2EJG A;  3E9G A;  2HNI A;  1ZQ1 A;  3QYG B;  2MK5 A;  5I22 A;  2EYY A;  1BCO A;  3TSZ A;  1VQ4 Q;  5L23 A;  1KJW A;  2X51 A;  2CP3 A;  2BUD A;  4JJD A;  2HQX A;  3OYN A;  1NPR A;  1MV0 B;  3GNF B;  2KYB A;  4WCI A;  2WSC E;  1JJ2 S;  1V29 B;  4PLL A;  2X4Y A;  1JJ2 A;  3CCQ A;  4KBM B;  3EH2 A;  4HA8 A;  1MMA A;  2RHU A;  1OQK A;  4PFP A;  1M30 A;  4OF1 A;  3CCL Q;  3C95 A;  1DJ7 B;  5GAN j;  5KYU B;  1VQP T;  2JVV A;  2YRV A;  4J9D A;  2EBP A;  1PRL C;  1VQO Q;  1PD0 A;  2NUZ A;  3VS4 A;  2DA9 A;  1ABO A;  4PKC C;  5FU6 C;  5GAO n;  2QA4 T;  3PTA A;  3EGU A;  4C5H A;  2EFI A;  1VQL A;  1VQK Q;  4LDY A;  2CZ7 B;  2EGC A;  3E19 A;  3KBG A;  1K73 U;  2EQJ A;  1BKB A;  1Q95 G;  2XD0 A;  1QKX A;  1Z9Q A;  1OU9 A;  2DBM A;  1GFC A;  2K2M A;  3HRS A;  2RO0 A;  1BBZ A;  1YJN T;  1BK2 A;  1M2V B;  3OS5 A;  5HY6 A;  2LT1 A;  4J9G A;  3C0C A;  3QUI A;  3EG1 A;  2LJ0 A;  3CCM T;  1IB8 A;  1LCK A;  3P8H A;  2DRM A;  1B34 A;  2VXF A;  3GNG A;  2WAC A;  4FL6 A;  1ARK A;  4FYV B;  4EMK B;  4ORZ A;  3CC7 T;  3M0S A;  1Q82 C;  1MNE A;  3EGD A;  1NJI U;  2P0Q A;  3QZ5 B;  3HRT A;  2KI7 A;  1BI3 A;  4D6W A;  2EYW A;  5J39 A;  2DNU A;  4OP0 A;  5CKB A;  3MCA B;  1RAH B;  2K2V A;  1WZO A;  1GCP A;  1M90 C;  1RL2 A;  3JRZ A;  3FJ5 A;  3QJY A;  4LD9 K;  5HK3 A;  3LLR A;  1NM7 A;  1VQ4 T;  2H3E B;  1I81 A;  4J9F A;  1E6G A;  2COY A;  1QVF A;  3QSU A;  1QQJ A;  4KGX B;  2P84 A;  1ZSZ B;  5CKD A;  4RUG A;  2F2W A;  4ZGJ B;  1WHH A;  1U5S A;  4HXJ A;  2MWP A;  1M5Q 1;  3UF4 A;  3V8L A;  4HT9 A;  1VOM A;  1Q86 U;  1SPK A;  1H3Z A;  4DA4 A;  2ZCF B;  4RTV A;  2HL5 C;  1QMC A;  2ZZD A;  1X27 A;  2L2P A;  3CCL T;  1LNX A;  2M1H A;  3OW2 P;  2GQI A;  2AHJ B;  1OZ3 A;  1GFD A;  5FRM A;  2K3Y A;  2XI9 A;  1M90 R;  2L3S A;  1VQO T;  1GBR A;  5CQX A;  3H0F A;  1MUZ A;  2FG0 A;  5GAO q;  2JM8 A;  4CC3 A;  2CP7 A;  2R5A A;  3M0R A;  1Y7X A;  2PNI A;  3OY9 A;  2KGT A;  1VQK T;  2LX7 A;  3N5B B;  3OA6 A;  2L0A A;  2LX9 A;  2FVU A;  2HL3 A;  1HJD A;  1NZ9 A;  4CI0 C;  2RMO A;  2RHY A;  3CCS A;  4CC7 A;  1GCQ A;  4M77 E;  1XQH A;  3OYC A;  4D8K A;  2HKQ B;  3EG9 B;  2M0O A;  4N0A A;  4IUV A;  1P92 A;  4DEX A;  2RK1 A;  4J8O A;  4D8D A;  2CRE A;  2VWF A;  4MMK A;  1D09 B;  3NHN A;  2CZ1 B;  4PJO G;  1KHI A;  1N8R U;  4KUD K;  1NPP A;  4M7A C;  1N27 A;  1Y07 A;  2HQE A;  3MET A;  1YBY A;  2LDM A;  5GAO r;  3LH5 A;  2XHC A;  3DKM A;  2CGH A;  4PJO D;  2M16 A;  4HVW A;  2AK5 A;  3H8Z A;  4X1V A;  2GGR A;  4C0D C;  3GLX A;  3NTH A;  4M75 E;  2Y90 A;  2B8A A;  4N4I A;  1R0C B;  3L2U A;  1ZSG A;  4M75 B;  4OVA A;  2DX1 A;  4M78 E;  4PJO F;  2OTL Q;  2JUF A;  2MMP A;  1W2B P;  2JMC A;  4HCK A;  2KEA A;  2VB6 A;  4M78 B;  4M7A G;  2KMT A;  1ABQ A;  1K9M U;  2HDA A;  5C6S A;  3WVD B;  1M2V A;  4E7J A;  3AHU A;  3A8H B;  4E7I A;  4A4G A;  3MP1 A;  1JBM A;  3OYY A;  3H0H A;  5GAN 7;  4II1 A;  4IUU A;  2MWO A;  2DF6 A;  4EMK A;  2FPF A;  1IRX A;  2JNG A;  3OSS C;  1YI2 A;  2JXB A;  1Y0M A;  2HMA A;  1GXI E;  4LNP A;  1QWE A;  3VS5 A;  5A2Q E;  3JCM b;  5LJ5 j;  4F16 A;  3QHS A;  3DB4 A;  1VQ7 A;  1OYX A;  4RKU E;  3MEU A;  2CT4 A;  1SRM A;  2O31 A;  1PC0 A;  2K5I A;  3GPL A;  2GFA A;  1RAI B;  4OMF B;  1B3Q A;  2RM4 A;  1ZSZ A;  1OEB A;  5CVI A;  2DFU A;  1YIT Q;  1KQ1 A;  2MAM A;  2QG9 B;  2FEI A;  1MHN A;  2RHZ A;  3HHT B;  4C8Q E;  3OYG A;  3RES A;  1OX9 A;  2AT1 B;  2RI3 A;  4C8Q B;  5KCO A;  2CP0 A;  1AWO A;  1QVG P;  3OB9 A;  3V8K A;  2AZS A;  4NOY A;  1S1N A;  5GMK m;  1R77 A;  3ZFJ A;  3M53 A;  2P4T A;  3FLG A;  2RI2 A;  2RI5 A;  4FYX B;  2P0P A;  5FWB A;  4A4F A;  3OSV A;  2ATC B;  2M0Y A;  2I2L A;  1NEB A;  2RJF A;  4LDU A;  1OOT A;  3HP9 A;  1YJ9 Q;  1H3H A;  1TH7 A;  4LUD A;  2E3I A;  2JS0 A;  2M02 A;  5KYX B;  4FW2 A;  2CT3 A;  1IHW A;  1NJI C;  2OI3 A;  2QGG A;  3MJX A;  4M7D E;  2A3L A;  1VQ9 A;  5DLQ E;  3ME9 A;  1TU0 B;  2OX7 A;  2FZC B;  1K73 R;  1W1F A;  1RI0 A;  2OTL T;  1I5O B;  3D7S B;  1M3C A;  2EKO A;  4J7I A;  1D0X A;  1UB4 A;  1RAE B;  4M77 D;  2L3Q A;  3X20 B;  2D0N A;  3CCU A;  2QQB A;  2L89 A;  4IUT A;  2RB6 A;  2QQA A;  4M77 A;  3SWN B;  3EG9 A;  5LL6 S;  2YRC A;  4M77 F;  1OPK A;  2GQV A;  2FO0 A;  4P5N A;  1TTH B;  3F70 A;  4JJB A;  1M1K U;  5IHN A;  2ZPH B;  1X69 A;  3H9N A;  5GAO p;  5GJW B;  1Q86 C;  2OTJ Q;  2EIF A;  2QEX A;  1WI7 A;  4LDX A;  1NJI R;  2DLP A;  5GAN 4;  4F7U G;  1JXM A;  1VQN Q;  4KRT A;  1JJ2 P;  2ZPF B;  1AWW A;  1YIJ Q;  3S3N A;  5LJ3 f;  2RHX A;  5D7U A;  1M8V A;  2DL7 A;  2FPD A;  2RJD A;  4M75 D;  1X6O A;  2O4X B;  5FRN A;  1X01 A;  5GAM g;  2E5Q A;  3CPF A;  1KSW A;  1YIT T;  3SB2 A;  4M75 A;  2ZPI B;  2E6N A;  3OMG A;  3BDU A;  2DXB A; 
#chains in the Genus database with same CATH homology
 2Z0W A;  1WHK A;  2CP7 A;  2CP5 A;  1IXD A;  2HL5 C;  2E4H A;  1WHJ A;  4B6M A;  1TXQ A;  2CP6 A;  2CP2 A;  2COY A;  1LPL A;  2COZ A;  3E2U A;  1WHM A;  1WHL A;  2MPX C;  2HKN A;  3RDV A;  2QK0 A;  2HKQ B;  2CP3 A;  2CP0 A;  2HQH A;  1WHH A;  1TOV A;  2HL3 A;  2COW A;  3TQ7 P;  2E3I A;  2M02 A;  1WHG A;  2E3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...