2HKNA

Crystal structure of the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Dynactin-1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hknA00
2E4HA 2HL5C 2COZA 2CP7A 1WHKA 2HKQB 1WHGA 2E3IA 3TQ7P 2E3HA 2CP5A 1WHMA 4B6MA 1TOVA 2CP2A 2HL3A 2HQHA 2CP0A 2COWA 1WHLA 1IXDA 3E2UA 2CP6A 1WHHA 3RDVA 1LPLA 2CP3A 2QK0A 2Z0WA 2COYA 2HKNA 2M02A 1TXQA 1WHJA 2MPXC
chains in the Genus database with same CATH superfamily
2Y4YA 2E41A 2DTIA 1RABB 2VXEA 3EGXB 1BYMA 1RAEB 2NUTA 1QKXA 5KYWB 3MJXA 4QVZA 4ZGJB 3HHTB 4IUVA 3I9QA 1YIJA 3RMQA 2HEQA 3S3MA 2CT4A 2RMOA 3VS7A 4ELZC 1TU0B 1G3WA 4K11A 3OW2P 3V7CA 2DE0X 1MMNA 3OS5A 1G3SA 1GBQA 2K4YA 2IIMA 4X1VA 2KROA 3FC3A 2WSFE 1QWFA 3SWNB 4M4ZA 2QK0A 2EPDA 3FJ5A 3OYJA 2QQSA 1U06A 1A0NB 3PIPA 5HK3A 1W2BA 2DL4A 2RHXA 1K0SA 1TWBA 5I2MA 1OPLA 2O31A 1QP2A 3EHRA 5CR2A 2RHIA 1WIEA 4MZMA 1QQJA 3I55A 1QVGS 3CCJT 4C8QA 4RUGA 5LJ5f 4J9IA 4N4IA 1YCSB 3NFCA 5GAOr 4J9GA 5CAIA 1X01A 3M0QA 2M1HA 4FYYB 5GAN3 3LLRA 1R8OB 2RPNA 3RKWA 8ATCB 1WHMA 1VYUA 1RLPC 1W2BS 1VQ4Q 1OULA 1K0XA 2LX9A 2F2VA 3PVQA 2CH4A 1KQSA 4KUIA 4O6JA 2MCNA 3CD6T 4HCZA 1YFNA 2RHZA 3LWIA 4KH0B 4J6WA 1AD5A 1CSKA 3HKSA 5L23A 2DBKA 2QEXQ 4FM4B 1YHQT 3NTHA 3D7SB 1VQPA 4E47A 5GAMd 2QGFB 2BE9B 4C8QG 1JJ2A 2RA2A 3CCQT 4DEYA 5EC7A 2QTXA 1AWOA 1PG5B 4OP0A 1CKAA 2L2PA 2BE7D 3CC2Q 3J80E 2DRKA 2M0OA 3HFOA 1KQSS 3UF4A 3CCMT 1IREB 1BU1A 5D6WA 4L5GA 3H6ZA 2CUBA 1K9AA 1X2QA 1M3BA 4M75A 4E7HA 3TSZA 2CS7A 1FWZA 1UE9A 1V76A 3ZEHA 4DBFA 2LQWA 5CK9A 7AT1B 1ARKA 4EMKB 4KT0E 1X27A 3FIFA 2D1XA 5KE3A 1NPPA 4Z8AA 3M9QA 2LCLA 1M3CA 2P84A 4F7UB 2L3RA 1RLQC 5A0DA 4A53A 1KD1C 5KYXB 4E7IA 2BZXA 3EFSA 4CC4B 2DYBA 1WHGA 1N8RC 2E3IA 2O2OA 3CCVA 2FYKA 2J05A 4XTUA 3MEAA 1VQ5T 3JCMg 1U1SA 2PUKB 2I2LA 1SG5A 2XK0A 2XHCA 5GAOm 3QXEB 1YCYA 2RK1A 1T3SA 3NPFA 5IHKA 3HP9A 3H41A 3ZFJA 1NG2A 4Z89A 1NEGA 5GMKl 2CGHA 1PRLC 2ZGWA 2MYSA 4QQ6A 4M7DB 4M75G 2K57A 2O9VA 2ZAEA 3OMCA 1H641 3C95A 3CCET 3C4SA 4V2SA 2E12A 2RK2A 4PFZA 4QQDA 3M57A 1Q7YR 1VUBA 1SRLA 5LJ5h 4RTXA 1PSEA 2ABLA 1M1FA 3CCRQ 2A28A 3R6OA 4M77C 3EFOB 3GBQA 3E9GA 3I5SA 3CC4Q 2X4YA 3AHUA 1QP3A 3CCJA 1CKBA 4JRKA 2DRMA 1MMAA 3CXCS 2HQEA 2OAWA 5L8RE 2KE9A 4BY6C 4NS5A 1JBMA 2MMPA 1D3BA 4J83A 4ZN3A 5CCAA 4C8QF 2HL3A 3MP8A 4BD3A 3CD6Q 1AT1B 3MPUB 3DB4A 2KYBA 2FPEA 1R0CB 1OV3A 3CCLT 4FT2A 1K9MU 1AWWA 1TTHB 3KFVA 2HBWA 2J6KA 2R5MA 3CD6A 1I5OB 4F17A 4HT9A 2GCXA 4BE0A 2E1HA 4HXJA 2K9GA 3M54A 4OGEA 2FVUA 3WVDB 1YHQA 2X4JA 4LDXA 5GAMg 4E6RA 4IURA 3EHQA 2EQIA 2HAXA 2G3RA 3OBYA 3CCQA 1JQQA 1RL2A 2HSEB 3A8MB 2LX7A 2CREA 3META 1M90U 2BIVA 3G71Q 1KC8R 1VIEA 3QZ9B 5GAMj 4B9XA 1KHIA 2NUPA 1SEMA 3CCMA 3G4ST 5ECAA 1G5VA 1NYFA 3OS2A 5J3BA 2QI2A 4C0FA 3QWYA 2RJEA 1XJWB 1RAFB 4M7AD 4KH1B 4R55A 4PLIA 5M9OA 4M75F 1VQ5Q 3EH1A 2CDTA 4OB3B 4CRIA 4F7UA 4C0DB 2FPFA 2XD0A 2A36A 4JJDA 4PNOA 3OY9A 1VQKT 4ATOA 3CMAQ 3CMEQ 5AYFA 3ZL7C 2KMTA 2LCCA 1VQ8Q 3J7AF 5LJ5j 4ELYC 5LJ3d 1PKTA 2EYWA 3A5ZB 3OYFA 4DOVA 1JRIA 2KNBB 3SEMA 1QVFP 4M7DA 2SEMA 2KBTA 1NZ9A 2COYA 4BACA 2DJZA 3M5AA 3VS2A 1BBZA 2EYZA 4CC2A 4A4KA 4JZ3A 4OB2B 2RJFA 1BI1A 1X6OA 3V7RA 1SPKA 3Q1JA 3VS1A 2EAYA 2GTOA 2VWFA 1W4SA 1ZSZB 2JTEA 1MNDA 3CCEA 1G83A 1YNZA 2HQHA 1KIKA 1IHVA 4PJOC 3OSVA 3JB9I 2EYYA 4ZNXA 4N0AA 3L2ZA 4OMQA 1LVKA 2DEUA 2JNGA 4OMMA 2E4HA 3EFOA 3RBBB 1UGQB 3ER0A 4QW2A 5AT1B 4B9WA 4JRQA 3MP1A 1MV3A 2YUQA 2CZ1B 3LYIA 3CPWP 2PUOB 5IAYA 2FZKB 4BE1A 1VQ9T 1OU8A 1RI9A 4PL6A 2VB6A 4C92C 3QZ5B 1P92A 3FLGA 1K4US 1G3YA 2JM8A 3QDRB 3CCLA 1MUZA 1AZEA 3SD4A 2M9UA 8AT1B 2ZPBB 2YUNA 1EZZB 2IVWA 2HKNA 2FHDA 1XQHA 3A8OB 4M78C 3H0FA 3L2QA 3CBMA 3PTAA 2DTOA 4CI0C 3VS5A 3MHXA 3X26B 1WHLA 1IHWA 2W10A 5GANe 4AFUC 1TG0A 2J6FA 1YP5A 1I07A 4O5VA 4XU2A 3JCMf 1K76A 3RESA 3G4SA 1Y96B 1Q86R 5IH2A 1G8XA 2O01E 3CC7Q 1JXMA 1UUEA 2QGGA 2AZVA 1Q7YC 1M30A 1YJ9T 1OX9A 2VUBA 3OQ5A 1W6XA 3EGDB 1PHTA 5FWCA 4HCKA 1BKBA 5GMKi 4J9CA 1HXDA 5FRNA 2LT1A 1UHFA 3JSCA 3JV3A 2K2MA 4FSXA 4J7FA 1VQKA 3EG3A 1X2KA 1Y0MA 4M77D 2KK4A 1WNLA 4MMLA 3UT1A 3VV0A 5LJ3g 4C8QC 1O9SA 1M1KU 1WJSA 1ZBXA 3REBB 4IUPA 3MEVA 3CCUT 3TVTA 2X4WA 1K8AU 4JRIA 1J3TA 4B6MA 2EQMA 1FX7A 1ZUKA 3BDLA 2X9HA 4ZTJA 2EJFA 4X9CA 3JCMX 1NJIU 3GIBA 1HSQA 3HFNA 2QXFA 1T0HA 2COWA 2GQVA 4LXCA 3JCMW 2VGMA 3GF5A 3QG1A 2CYZB 1VYVA 3EGUA 1QKWA 2QQBA 4PJOG 2V1QA 1NYGA 3JCMb 1OU9A 2E5QA 4PKCC 2YXYA 3A8HB 3G6ET 4M7AB 2DM1A 1RAGB 2KEAA 3UATA 2ZCFB 1QCFA 3V8JA 5J26A 3VRYA 2D8JA 3JCMP 2KT1A 4ESRA 2DFUA 1KC8C 2CP6A 3QYGB 2RB6A 3EG9B 5I21A 5FU7C 3O5ZA 1W1FA 2XU8A 2DIGA 1V1CA 1H3HA 3KXTA 4ANJA 4C92G 4OB0B 1VQ9A 4M75C 2KAFA 1GBRA 4KRTA 4RTTA 1QVFA 1IGQA 2V8KA 5GAMf 4XU1A 3RERA 5CO7A 5KYYB 1YI2T 3VS4A 1KD1U 2K5IA 4GBQA 1N8RU 3I55Q 3LGFA 2ZPHB 1SKUB 1WGSA 2XDPA 2H3JA 2HL5C 2H3EB 4M78G 1HD3A 3L2RA 4HKEA 1UGRB 2RF0A 4AFZC 1RUWA 3JCMh 1VA7A 2YRDA 3RDVA 1M8MA 2FZGB 2QQ9A 2AKKA 2ROLA 2DA9A 4JJCA 1BI2A 2KXCA 1KK7A 1WPYA 2XICA 2YHTA 2D0NA 4ME7A 3CBPA 1M1KC 2DERA 3LX7A 5GMKh 4IKFA 2QDYB 4J9BA 1K1ZA 1MMGA 4IUQA 1K8AC 4QKUA 2BTTA 4A4FA 1WHHA 1H8KA 2KRNA 4J6XA 5KYUB 1K73U 1BK2A 1VQPQ 4WCIA 1Z9QA 4GY5A 5DY9A 1BCOA 2FB7A 3NHNA 3EGDA 4LD9K 1NJIC 1YJ9A 4RG8A 2BZYA 1LNXA 4BI3A 5GJWB 4PJOD 4KULA 3VKIA 2R57A 2FL7A 2BZ8A 3MO8A 3A8GB 4L6V5 1HJDA 1Y57A 2MI6A 4PJOF 2DXUA 1KG1A 2L5QA 3OYGA 2F69A 2GFAA 3M4YA 2DF6A 2ZZDA 1U8RA 1ABQA 3QKJA 4XQ3A 3THKA 1WHKA 3CCUA 3TQ7P 5C0MA 1K9MR 2DZ9A 3UPUA 1WXTA 4J9HA 4C92D 2GNCA 3CCVQ 3L2UA 2FPDA 2B8AA 1PWTA 4PJMA 5GAN8 3QHSA 4X9DA 1UG1A 1JJ2S 5I11A 2JW4A 3M58A 4OGCA 4C92F 1ZA1B 3V7SA 2OTLT 1E6GA 1QCOA 4KGZB 2VVKA 4F04B 2ECZA 4M78D 1LJOA 1N27A 3EGXA 3HRSA 1WDXA 2HZYA 2CZ7B 3NGPA 5KE2A 5KYWA 1FXXA 3G6EA 2V8IA 4AFSC 4PFPA 3ZBDA 4OF1A 5GAMh 1YITT 2DLPA 1O75A 1PD1A 4M78F 4E7JA 4OMOA 3EG0A 1VQOT 2DXCA 1WJRA 1Q86C 1WYXA 2R5AA 3HRUA 4D6WA 4M77B 2K6DA 3MEWA 2DXBA 3OMGA 1I5LA 2DK3A 5GMKj 3VUZA 1JB0E 1PM3A 2ED0A 1RAAB 4QVCA 3SWNA 5GAN4 3H0HA 4XK8E 1YI2A 3EG2A 5FRMA 2EYXA 1VQ7T 1K73C 3DKMA 1N9SA 3CCJQ 2AK5A 5KH6A 3UWNA 2K3XA 3QIIA 4VUBA 5FROA 1X75C 2DL3A 3M0RA 4C8QD 5IHNA 2KXDA 2Y4XA 1WX6A 1YJNT 1RACB 1AOJA 2HD0A 2RH2A 2AZSA 1Q81R 3FDRA 1OI1A 4M7DC 1NLPC 1PC0A 2XKOC 5IXFA 1Q95G 1D09B 3OYMA 2DMOA 5LJ3f 3OW2A 1Q82C 2EYQA 2RD1A 3OYDA 3NTIA 1YHQQ 4PJLA 5LJ5e 4QQGA 3A98A 1N5ZA 2LTOA 3JAME 3P8HA 1NM7A 2GQIA 1G2BA 1GCQA 2C0IA 2CP2A 4FL6A 1SSFA 3CCQQ 1WXBA 4Z02A 1TUGB 2MOXA 3DB3A 2YSQA 2HBPA 3INZA 3SB2A 4N0AC 1BI3A 3CCMQ 1KSWA 1I81A 2RHUA 3OYIA 3PE0A 4J7IA 4LUDA 2DL5A 1KJWA 1TSFA 1BIBA 3OW2S 2VXFA 2QG9B 2LP5A 4GLKA 2RNAA 3RR6A 2JM9A 4XU3A 4DEXA 3V8KA 4UC4A 2LC4A 3P8BB 4M75D 2PVOB 2RQRA 3KUFA 4BB7A 2GBQA 4EMKA 5KCHA 4AG1C 3E9FA 5I2SA 1AWJA 5GAN6 4M7AE 5J39A 4CC3A 4XU0A 3EAEA 1IGUA 5KYXA 5D7UA 1YWOA 3RNJA 5IN1A 2OTLA 1LPLA 2DEQA 4EPCA 3FEOA 3HTRA 2X51A 4JS4A 2M0YA 5CQXA 2BUDA 1WZOA 4KGXB 1RAHB 2PNIA 5HKCA 4XTZA 2J7IA 1B34B 2HMAA 4ZGEB 1UEBA 2NYSA 5I22A 4FYVB 4RCCA 1YITA 1IRXA 1VQLT 2QAZA 3VJPA 2HQXA 1UDLA 3AT1B 3H9NA 4DBRA 5EG2A 1VQOA 3CCEQ 1UGVA 1ZUYA 2DX1A 3BDUA 2DL7A 2XIDA 2ESWA 1Q7YU 1VQ7Q 1WQ7A 2CZ6B 2XMFA 2ZPIB 2LNHB 4PJNA 4BUGA 4AMCA 1V29B 1IB8A 4F7UG 2AIRB 5GANd 1QVGP 4HCBA 2WSCE 4C0DC 2F5KA 1LOJA 1VQ7A 5GAOn 3I56T 3J81E 1YWPA 2C06A 2D6FA 1S72T 4OMFB 1WHJA 1YJNQ 2GFUA 4CC7A 4MZTA 3OBWA 3L42A 2KRMA 5LJ3h 1SSHA 5FW9A 1AVZC 1ZLMA 2K2VA 4F14A 3LGLA 2FO0A 2LRQA 1YJNA 4M7DG 3CCLQ 2KYMA 1X6BA 1AZGB 3PFSA 4NOYA 4C5IA 2F5TX 2ZPFB 3WVEB 3REAB 2LVMA 3X25B 4E7SA 4FYWB 4RCBA 4LDYA 4JZ4A 4OVAA 4L59A 2RO0A 2HSPA 3U23A 2PZ1A 3UDCA 5HY6A 1DJ7B 3HL8A 1U5SA 2G6FX 4HVUA 4C0GA 2P0KA 1Y71A 2M02A 4N4GA 1KQSP 3RMSA 1EIFA 3URGA 1QCNA 3HPWA 1M2VB 4LUEA 2KRSA 1KC8U 3DLLA 3MKDA 5KYNA 2EFIA 3L1AA 3JB9H 3G4SQ 2KDSA 1RAIB 4JPBW 4IUTA 2CP0A 1M9SA 2YUOA 4JRPA 1UHCA 1MNEA 3QYHB 2MK5A 2XI9A 1VYTA 5CVIA 2KI7A 3MEUA 1WI7A 1N8RR 2D0QB 3MP6A 4ORZA 3PT9A 4XTWA 4C8QB 1VQNT 4IIMA 3M53A 3ULRB 3PNWC 4C5GA 2I0NA 1E7OA 2L3PA 1N6AA 1VQKQ 2A08A 3E19A 2MAMA 2QQRA 2E6NA 1C1AA 2A37A 2DTHA 2EKHA 2DBMA 1BB9A 2MPXC 1M1GA 3M0PA 1I1JA 2EQJA 2LJ3A 4F7UF 4C0ZA 1D1BA 5FU6C 1QWEA 4JLIA 2CSQA 2CP5A 1H3ZA 2E5KA 4HCCA 1B34A 3C94A 3E1SA 2ATCB 2RM4A 1VQ4T 2AT1B 1XTDA 4M77E 2X4XA 2HDAA 1R0BG 2JMAA 4RMOA 5LJ3j 2GTJA 1VQLA 1S1NA 1TH7A 3QPHA 2YRVA 4M7DD 4E7LA 2V1RA 4PK4A 3CCST 1OEBA 2NUZA 4Y92A 1VIFA 1AWXA 2QA4T 1ZA2B 2M16A 3OYYA 2KY9A 2QEXT 1QMCA 4BE2A 4QT7A 5A2QE 1IXDA 4M7DF 2OTJT 1ZUUA 4HA8A 1AHJB 3PGGA 4FU6A 1ZSZA 1YN8A 2K5LA 2GGRA 4ZN1A 5GANg 1JXOA 4JUVA 3M0SA 2QASA 3OYBA 2JZ2A 3CXCP 4M75B 3CC2T 4BI8B 3OYHA 4Z88A 1GL5A 3I56A 2H8HA 1WXUA 2EIFA 1S72A 2K5FA 2C0TA 2EKOA 1X43A 4JJBA 1VQ9Q 3A1PA 1GFCA 2DPPB 1WFWA 4A63B 1C6VX 3UA6A 2YLCA 3FRNA 2LCSA 1EFNA 1M4ZA 1TUCA 1IZ6A 1GXIE 3S3NA 3LH0A 2CP7A 2DILA 4YTLA 3RIRA 1PCXA 2CSIA 1UJYA 1TUDA 3QJ6A 3GPLA 2KSSA 5C6SA 4OMLA 1D0XA 2DJQA 2RI2A 2JMCA 4EDUA 4J9EA 1UGPB 1M27C 2L3SA 4QVDA 1OYXA 2L89A 3I5RA 1QVGA 3X24B 2JT4A 5KCOA 2YDLA 1I0CA 1M2VA 2B86A 3OYNA 6AT1B 4E7KA 4M7AC 3PMIA 3TSWA 2DVJA 4N4HA 2EW3A 4LE9A 1OZ3A 2FEIA 1U3OA 3T9NA 3QBYA 1QVFS 1Q86U 2BKDN 1VQNQ 4FW1A 2XDDA 3PVLA 4PLLA 5HK0A 1T0JA 2V8JA 4Q5WA 1X69A 1YJ9Q 2LJ1A 3CPWA 2FG0A 1VQ6T 1Y96A 4F16A 1SRMA 2QDLA 1Z9ZA 4KBMB 4RTZA 1VQNA 2SRCA 3RKYA 1D0ZA 3CCRT 3H8ZA 2DETA 2DD4A 3GP8A 2VGNA 4XTXA 3M4GA 3SWNC 4C5HA 1D3BB 3KBGA 3NMZC 5CKFA 2JOYA 3CC4T 2LT4A 2JN0A 3QO3A 4C5EA 5GAOp 2FRYA 3JCMe 1OX8A 1PRMC 2CUDA 2YUPA 4PJOE 3CCUQ 1RI0A 3CPWS 1VQMT 1W70A 2F2XA 4FYXB 3CCSQ 2WACA 2JS2A 2P4TA 2QA4Q 1I8FA 1VQ4A 5GMKe 2K3BA 4J9FA 5GAN2 1ZHIA 2O88A 2AKLA 4EMGA 2OTJQ 1Q82U 1TOVA 4WF2A 2RQVA 2F1LA 1H92A 2XDBA 1JEGA 2PQWA 1WLPB 2FRWA 3CCSA 1LCKA 2A0FB 1UGSB 3PIOA 2IG0A 3VYHB 2QA4A 2DL8A 4C92E 1OZ2A 1TXQA 3GNFB 2QEXA 2KT8A 3G6EQ 2P4RA 2OTJA 4J9DA 2NUPB 1GCQC 4FCYA 3SHWA 4ZTFA 1MGQA 2GF7A 2PVDB 2LQKA 1OQKA 3CC2A 5HCKA 2WSEE 3G71T 5GAOq 4M7AA 1M90R 1BIAA 1WJQA 2P0QA 5DLQE 4M78E 4LDWA 4LDUA 5GAOl 3M56A 5LJ5d 4HVWA 4FT4A 3A8LB 5DM7R 1ZBJA 4DOWA 3EG9A 5CQYA 3OYAA 2VYTA 3QJYA 4LN2A 3EFRA 1YI2Q 3L2VA 5D6XA 4HT8A 2EVRA 3M55A 1SHGA 3M59A 4HVVA 3HRTA 1UTIA 2JS0A 2X3XD 2KVQG 4RTYA 2QYZA 2DVEA 2RJCA 2VC8A 4RTWA 4EMKC 1B7TA 3CMAT 4E7ZA 2IPOB 5KYYA 3CMET 2EJGA 2RI5A 1QVPA 4BY6B 1R77A 1VQ8T 4A54A 5GMKm 5FLXE 3VU3C 4OMNA 2YWWA 5D6YA 3JCMJ 3TREA 3OYEA 4IUUA 3QWXX 4MDXA 3LH5A 2LMJA 5FWBA 3JCMQ 2CZ0B 3CBOA 4M7AG 2M51A 3EH2A 2FZCB 2JUFA 3OSSC 2ENMA 3CXCA 4X34A 1Y07A 5GAMe 3OYLA 2OI3A 1M2OA 2CKKA 1FMKA 2RHYA 1B3QA 3OA6A 1NEBA 4AG2C 1TS9A 4IIOA 4NL2A 3UA7A 2X3WD 4EMHA 4EIKA 1VQ6Q 1XNIA 3QSUA 2EGAA 2DO3A 1ACMB 2DIQA 5GJVB 4C8QE 1FMWA 2K7AA 2OX7A 5LL6S 4J8OA 3FB9A 3S6WA 1ZSGA 5GAN5 4XAXB 4WTOB 1OOTA 2PTKA 3PMTA 1VQ6A 2K79A 4XTVA 3RUXA 4KUDK 5KYUA 1AEYA 2LQ8A 4JDSA 3CCRA 2MWOA 1VQMQ 3CC4A 2RQWA 2YLBA 2D9TA 2EGCA 2A3LA 3OYKA 4RG2A 1PKSA 1WQWA 1WA7A 2F2WA 2DAQA 3DLMA 4LD6A 2RQTA 1M5Q1 1VQMA 5IXBA 3BW1A 3ME9A 5GANf 2EQUA 2KGTA 4KGVB 2QQAA 3X20B 2YT6A 2EWNA 4DBQA 2A7YA 4II1A 3G7ZA 1UFFA 2E10A 2HCKA 2MWPA 3JCMc 4AFQC 4PFOA 2OTLQ 2L8DA 4FSSA 1GRIA 2E64A 4M75E 2D8HA 2HNIA 3ASKA 2AHJB 1ABOA 1IO6A 2EQKA 3WXMB 1BI0A 3LWHA 2O4XB 3M0TA 2RI3A 3E2UA 1SHFA 1YITQ 4RKUE 3OS1A 2KQWA 3NTKA 1B07A 1MHNA 5GAN7 2RQUA 3SDZA 2KR3A 4BI4A 3JCMV 1VQOQ 3G71A 2COZA 2HKQB 4R56A 4MDWA 3FJPA 1YJWT 1EX4A 1C0MA 5LJ5g 3CC7T 1JO8A 4M7AF 4PJOB 5CIUA 3TEEA 4RTUA 2E65A 4GLMA 2VV5A 2CT3A 2DNUA 4BDYA 1M8VA 5A0LA 3F70A 4M77A 1VQ5A 4OB1B 4A4EA 2Y90A 1YBYA 3JB9J 5CKHA 5IT9E 3R6NA 4J6YA 4XTYA 3LW5E 2W0ZA 1VOMA 2X35A 2E3HA 3GLXA 3CMAA 3CMEA 4LDVA 3OYCA 1VQ8A 1UECA 2LDMA 1GCPA 2CP3A 1FYNA 4P5NA 1M1KR 1Y7XA 4C92B 1MV0B 2EJ9A 1GFDA 1FMVA 3QUIA 4RTVA 2P0PA 3HSBA 4NL3A 1K8AR 5DLOA 1NPRA 3OS0A 3CEYA 1Q81U 4AT1B 1W2BP 4A4HA 2EGEA 1K9MC 3N5BB 3SFMA 3C12A 1U1TA 4M78B 1NJIR 2LNVA 5A0GA 3X28B 1RADB 3EG1A 2NUTB 4M77G 4TVRA 4JLGA 3BE3A 1YIJT 1I4K1 3L2WA 2CH4W 3TU4K 2L0AA 1KQ1A 4LNPA 2DZCA 1PD0A 4D8KA 2PU9B 3VS3A 2LZ6B 2ZPEB 3BY7A 1E6HA 1ZSZC 2LQNA 2MIOA 5GANh 2PVGB 3VYGA 2Z0WA 1M90C 1QW1A 3C0CA 3RKXA 4DA4A 1UB4A 1PSFA 3JB9G 2XG8D 3GNGA 2DD5A 4JJNK 1D1AA 5LJ3e 2LJ0A 2YRCA 3VS6A 1UJ0A 4JS5A 1D0YA 2J06A 3MCAB 2L3QA 1KFZA 1ZX6A 4FW2A 1NE8A 3O8VA 2JTFA 2DXTA 4R0KA 3VRZA 1KD1R 2JTMA 1JJ2P 1JU5C 5IHIA 2E70A 1M3AA 3I55T 5FU6B 2K3YA 4DBHA 3OB9A 5CKBA 3BFMA 1N9RA 4A4GA 2O4XA 2EBPA 2VASA 2VKNA 4F7UE 4E2FB 1YJWQ 1PNJA 2JXBA 3S3OA 5CKEA 4OMPA 1QLYA 1VQLQ 1SF9A 2V26A 2O9SA 3H0IA 2JJ9A 1D1CA 2R58A 2DYIA 2NLUA 3QDFA 2QTVA 1MMDA 1T3LA 2DKGA 4J5YA 1YJWA 4PJOA 1Q81C 3M0UA 4DQ2A 3CC7A 2J6OA 1VQPT 1K73R 2JVVA 1XOVA 4FIBA 2OJ2A 2OAUA 5CKDA 1F1BB 4D8DA 4M7DE 1HK9A 3I56Q 3I35A 1KQ2A 5FU7B 1S72Q 2C0OA 4Y28E 1KHCA 4M77F 4MZPA 4MMKA 3GOXA 3CQTA 3V8LA 2ZPGB 3VS0A 4ZGDB 9ATCB 2MF2A 3G1JA 4BDZA 1BCMA 1NLOC 4C92A 3JRZA 5GANj 3JB9D 3CPFA 3P8DA 1X6GA 1ZQ1A 1NBEB 3VUBA 1Q82R 1G3TA 2RJDA 3TCJA 1OPKA 2ROTA 2ED1A 1YIJQ 2E6ZA 2NWMA 4PJJA 3CCVT 3IQLA 1HYOA 4Y91A 3JB9F 2RN8A 3JCMd 4M78A
chains in the Genus database with same CATH topology
2E4HA 2HL5C 2COZA 2CP7A 1WHKA 2HKQB 1WHGA 2E3IA 3TQ7P 2E3HA 2CP5A 1WHMA 4B6MA 1TOVA 2CP2A 2HL3A 2HQHA 2CP0A 2COWA 1WHLA 1IXDA 3E2UA 2CP6A 1WHHA 3RDVA 1LPLA 2CP3A 2QK0A 2Z0WA 2COYA 2HKNA 2M02A 1TXQA 1WHJA 2MPXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4H A;  2HL5 C;  2COZ A;  2CP7 A;  1WHK A;  2HKQ B;  1WHG A;  2E3I A;  3TQ7 P;  2E3H A;  2CP5 A;  1WHM A;  4B6M A;  1TOV A;  2CP2 A;  2HL3 A;  2HQH A;  2CP0 A;  2COW A;  1WHL A;  1IXD A;  3E2U A;  2CP6 A;  1WHH A;  3RDV A;  1LPL A;  2CP3 A;  2QK0 A;  2Z0W A;  2COY A;  2HKN A;  2M02 A;  1TXQ A;  1WHJ A;  2MPX C; 
#chains in the Genus database with same CATH topology
 2Y4Y A;  2E41 A;  2DTI A;  1RAB B;  2VXE A;  3EGX B;  1BYM A;  1RAE B;  2NUT A;  1QKX A;  5KYW B;  3MJX A;  4QVZ A;  4ZGJ B;  3HHT B;  4IUV A;  3I9Q A;  1YIJ A;  3RMQ A;  2HEQ A;  3S3M A;  2CT4 A;  2RMO A;  3VS7 A;  4ELZ C;  1TU0 B;  1G3W A;  4K11 A;  3OW2 P;  3V7C A;  2DE0 X;  1MMN A;  3OS5 A;  1G3S A;  1GBQ A;  2K4Y A;  2IIM A;  4X1V A;  2KRO A;  3FC3 A;  2WSF E;  1QWF A;  3SWN B;  4M4Z A;  2QK0 A;  2EPD A;  3FJ5 A;  3OYJ A;  2QQS A;  1U06 A;  1A0N B;  3PIP A;  5HK3 A;  1W2B A;  2DL4 A;  2RHX A;  1K0S A;  1TWB A;  5I2M A;  1OPL A;  2O31 A;  1QP2 A;  3EHR A;  5CR2 A;  2RHI A;  1WIE A;  4MZM A;  1QQJ A;  3I55 A;  1QVG S;  3CCJ T;  4C8Q A;  4RUG A;  5LJ5 f;  4J9I A;  4N4I A;  1YCS B;  3NFC A;  5GAO r;  4J9G A;  5CAI A;  1X01 A;  3M0Q A;  2M1H A;  4FYY B;  5GAN 3;  3LLR A;  1R8O B;  2RPN A;  3RKW A;  8ATC B;  1WHM A;  1VYU A;  1RLP C;  1W2B S;  1VQ4 Q;  1OUL A;  1K0X A;  2LX9 A;  2F2V A;  3PVQ A;  2CH4 A;  1KQS A;  4KUI A;  4O6J A;  2MCN A;  3CD6 T;  4HCZ A;  1YFN A;  2RHZ A;  3LWI A;  4KH0 B;  4J6W A;  1AD5 A;  1CSK A;  3HKS A;  5L23 A;  2DBK A;  2QEX Q;  4FM4 B;  1YHQ T;  3NTH A;  3D7S B;  1VQP A;  4E47 A;  5GAM d;  2QGF B;  2BE9 B;  4C8Q G;  1JJ2 A;  2RA2 A;  3CCQ T;  4DEY A;  5EC7 A;  2QTX A;  1AWO A;  1PG5 B;  4OP0 A;  1CKA A;  2L2P A;  2BE7 D;  3CC2 Q;  3J80 E;  2DRK A;  2M0O A;  3HFO A;  1KQS S;  3UF4 A;  3CCM T;  1IRE B;  1BU1 A;  5D6W A;  4L5G A;  3H6Z A;  2CUB A;  1K9A A;  1X2Q A;  1M3B A;  4M75 A;  4E7H A;  3TSZ A;  2CS7 A;  1FWZ A;  1UE9 A;  1V76 A;  3ZEH A;  4DBF A;  2LQW A;  5CK9 A;  7AT1 B;  1ARK A;  4EMK B;  4KT0 E;  1X27 A;  3FIF A;  2D1X A;  5KE3 A;  1NPP A;  4Z8A A;  3M9Q A;  2LCL A;  1M3C A;  2P84 A;  4F7U B;  2L3R A;  1RLQ C;  5A0D A;  4A53 A;  1KD1 C;  5KYX B;  4E7I A;  2BZX A;  3EFS A;  4CC4 B;  2DYB A;  1WHG A;  1N8R C;  2E3I A;  2O2O A;  3CCV A;  2FYK A;  2J05 A;  4XTU A;  3MEA A;  1VQ5 T;  3JCM g;  1U1S A;  2PUK B;  2I2L A;  1SG5 A;  2XK0 A;  2XHC A;  5GAO m;  3QXE B;  1YCY A;  2RK1 A;  1T3S A;  3NPF A;  5IHK A;  3HP9 A;  3H41 A;  3ZFJ A;  1NG2 A;  4Z89 A;  1NEG A;  5GMK l;  2CGH A;  1PRL C;  2ZGW A;  2MYS A;  4QQ6 A;  4M7D B;  4M75 G;  2K57 A;  2O9V A;  2ZAE A;  3OMC A;  1H64 1;  3C95 A;  3CCE T;  3C4S A;  4V2S A;  2E12 A;  2RK2 A;  4PFZ A;  4QQD A;  3M57 A;  1Q7Y R;  1VUB A;  1SRL A;  5LJ5 h;  4RTX A;  1PSE A;  2ABL A;  1M1F A;  3CCR Q;  2A28 A;  3R6O A;  4M77 C;  3EFO B;  3GBQ A;  3E9G A;  3I5S A;  3CC4 Q;  2X4Y A;  3AHU A;  1QP3 A;  3CCJ A;  1CKB A;  4JRK A;  2DRM A;  1MMA A;  3CXC S;  2HQE A;  2OAW A;  5L8R E;  2KE9 A;  4BY6 C;  4NS5 A;  1JBM A;  2MMP A;  1D3B A;  4J83 A;  4ZN3 A;  5CCA A;  4C8Q F;  2HL3 A;  3MP8 A;  4BD3 A;  3CD6 Q;  1AT1 B;  3MPU B;  3DB4 A;  2KYB A;  2FPE A;  1R0C B;  1OV3 A;  3CCL T;  4FT2 A;  1K9M U;  1AWW A;  1TTH B;  3KFV A;  2HBW A;  2J6K A;  2R5M A;  3CD6 A;  1I5O B;  4F17 A;  4HT9 A;  2GCX A;  4BE0 A;  2E1H A;  4HXJ A;  2K9G A;  3M54 A;  4OGE A;  2FVU A;  3WVD B;  1YHQ A;  2X4J A;  4LDX A;  5GAM g;  4E6R A;  4IUR A;  3EHQ A;  2EQI A;  2HAX A;  2G3R A;  3OBY A;  3CCQ A;  1JQQ A;  1RL2 A;  2HSE B;  3A8M B;  2LX7 A;  2CRE A;  3MET A;  1M90 U;  2BIV A;  3G71 Q;  1KC8 R;  1VIE A;  3QZ9 B;  5GAM j;  4B9X A;  1KHI A;  2NUP A;  1SEM A;  3CCM A;  3G4S T;  5ECA A;  1G5V A;  1NYF A;  3OS2 A;  5J3B A;  2QI2 A;  4C0F A;  3QWY A;  2RJE A;  1XJW B;  1RAF B;  4M7A D;  4KH1 B;  4R55 A;  4PLI A;  5M9O A;  4M75 F;  1VQ5 Q;  3EH1 A;  2CDT A;  4OB3 B;  4CRI A;  4F7U A;  4C0D B;  2FPF A;  2XD0 A;  2A36 A;  4JJD A;  4PNO A;  3OY9 A;  1VQK T;  4ATO A;  3CMA Q;  3CME Q;  5AYF A;  3ZL7 C;  2KMT A;  2LCC A;  1VQ8 Q;  3J7A F;  5LJ5 j;  4ELY C;  5LJ3 d;  1PKT A;  2EYW A;  3A5Z B;  3OYF A;  4DOV A;  1JRI A;  2KNB B;  3SEM A;  1QVF P;  4M7D A;  2SEM A;  2KBT A;  1NZ9 A;  2COY A;  4BAC A;  2DJZ A;  3M5A A;  3VS2 A;  1BBZ A;  2EYZ A;  4CC2 A;  4A4K A;  4JZ3 A;  4OB2 B;  2RJF A;  1BI1 A;  1X6O A;  3V7R A;  1SPK A;  3Q1J A;  3VS1 A;  2EAY A;  2GTO A;  2VWF A;  1W4S A;  1ZSZ B;  2JTE A;  1MND A;  3CCE A;  1G83 A;  1YNZ A;  2HQH A;  1KIK A;  1IHV A;  4PJO C;  3OSV A;  3JB9 I;  2EYY A;  4ZNX A;  4N0A A;  3L2Z A;  4OMQ A;  1LVK A;  2DEU A;  2JNG A;  4OMM A;  2E4H A;  3EFO A;  3RBB B;  1UGQ B;  3ER0 A;  4QW2 A;  5AT1 B;  4B9W A;  4JRQ A;  3MP1 A;  1MV3 A;  2YUQ A;  2CZ1 B;  3LYI A;  3CPW P;  2PUO B;  5IAY A;  2FZK B;  4BE1 A;  1VQ9 T;  1OU8 A;  1RI9 A;  4PL6 A;  2VB6 A;  4C92 C;  3QZ5 B;  1P92 A;  3FLG A;  1K4U S;  1G3Y A;  2JM8 A;  3QDR B;  3CCL A;  1MUZ A;  1AZE A;  3SD4 A;  2M9U A;  8AT1 B;  2ZPB B;  2YUN A;  1EZZ B;  2IVW A;  2HKN A;  2FHD A;  1XQH A;  3A8O B;  4M78 C;  3H0F A;  3L2Q A;  3CBM A;  3PTA A;  2DTO A;  4CI0 C;  3VS5 A;  3MHX A;  3X26 B;  1WHL A;  1IHW A;  2W10 A;  5GAN e;  4AFU C;  1TG0 A;  2J6F A;  1YP5 A;  1I07 A;  4O5V A;  4XU2 A;  3JCM f;  1K76 A;  3RES A;  3G4S A;  1Y96 B;  1Q86 R;  5IH2 A;  1G8X A;  2O01 E;  3CC7 Q;  1JXM A;  1UUE A;  2QGG A;  2AZV A;  1Q7Y C;  1M30 A;  1YJ9 T;  1OX9 A;  2VUB A;  3OQ5 A;  1W6X A;  3EGD B;  1PHT A;  5FWC A;  4HCK A;  1BKB A;  5GMK i;  4J9C A;  1HXD A;  5FRN A;  2LT1 A;  1UHF A;  3JSC A;  3JV3 A;  2K2M A;  4FSX A;  4J7F A;  1VQK A;  3EG3 A;  1X2K A;  1Y0M A;  4M77 D;  2KK4 A;  1WNL A;  4MML A;  3UT1 A;  3VV0 A;  5LJ3 g;  4C8Q C;  1O9S A;  1M1K U;  1WJS A;  1ZBX A;  3REB B;  4IUP A;  3MEV A;  3CCU T;  3TVT A;  2X4W A;  1K8A U;  4JRI A;  1J3T A;  4B6M A;  2EQM A;  1FX7 A;  1ZUK A;  3BDL A;  2X9H A;  4ZTJ A;  2EJF A;  4X9C A;  3JCM X;  1NJI U;  3GIB A;  1HSQ A;  3HFN A;  2QXF A;  1T0H A;  2COW A;  2GQV A;  4LXC A;  3JCM W;  2VGM A;  3GF5 A;  3QG1 A;  2CYZ B;  1VYV A;  3EGU A;  1QKW A;  2QQB A;  4PJO G;  2V1Q A;  1NYG A;  3JCM b;  1OU9 A;  2E5Q A;  4PKC C;  2YXY A;  3A8H B;  3G6E T;  4M7A B;  2DM1 A;  1RAG B;  2KEA A;  3UAT A;  2ZCF B;  1QCF A;  3V8J A;  5J26 A;  3VRY A;  2D8J A;  3JCM P;  2KT1 A;  4ESR A;  2DFU A;  1KC8 C;  2CP6 A;  3QYG B;  2RB6 A;  3EG9 B;  5I21 A;  5FU7 C;  3O5Z A;  1W1F A;  2XU8 A;  2DIG A;  1V1C A;  1H3H A;  3KXT A;  4ANJ A;  4C92 G;  4OB0 B;  1VQ9 A;  4M75 C;  2KAF A;  1GBR A;  4KRT A;  4RTT A;  1QVF A;  1IGQ A;  2V8K A;  5GAM f;  4XU1 A;  3RER A;  5CO7 A;  5KYY B;  1YI2 T;  3VS4 A;  1KD1 U;  2K5I A;  4GBQ A;  1N8R U;  3I55 Q;  3LGF A;  2ZPH B;  1SKU B;  1WGS A;  2XDP A;  2H3J A;  2HL5 C;  2H3E B;  4M78 G;  1HD3 A;  3L2R A;  4HKE A;  1UGR B;  2RF0 A;  4AFZ C;  1RUW A;  3JCM h;  1VA7 A;  2YRD A;  3RDV A;  1M8M A;  2FZG B;  2QQ9 A;  2AKK A;  2ROL A;  2DA9 A;  4JJC A;  1BI2 A;  2KXC A;  1KK7 A;  1WPY A;  2XIC A;  2YHT A;  2D0N A;  4ME7 A;  3CBP A;  1M1K C;  2DER A;  3LX7 A;  5GMK h;  4IKF A;  2QDY B;  4J9B A;  1K1Z A;  1MMG A;  4IUQ A;  1K8A C;  4QKU A;  2BTT A;  4A4F A;  1WHH A;  1H8K A;  2KRN A;  4J6X A;  5KYU B;  1K73 U;  1BK2 A;  1VQP Q;  4WCI A;  1Z9Q A;  4GY5 A;  5DY9 A;  1BCO A;  2FB7 A;  3NHN A;  3EGD A;  4LD9 K;  1NJI C;  1YJ9 A;  4RG8 A;  2BZY A;  1LNX A;  4BI3 A;  5GJW B;  4PJO D;  4KUL A;  3VKI A;  2R57 A;  2FL7 A;  2BZ8 A;  3MO8 A;  3A8G B;  4L6V 5;  1HJD A;  1Y57 A;  2MI6 A;  4PJO F;  2DXU A;  1KG1 A;  2L5Q A;  3OYG A;  2F69 A;  2GFA A;  3M4Y A;  2DF6 A;  2ZZD A;  1U8R A;  1ABQ A;  3QKJ A;  4XQ3 A;  3THK A;  1WHK A;  3CCU A;  3TQ7 P;  5C0M A;  1K9M R;  2DZ9 A;  3UPU A;  1WXT A;  4J9H A;  4C92 D;  2GNC A;  3CCV Q;  3L2U A;  2FPD A;  2B8A A;  1PWT A;  4PJM A;  5GAN 8;  3QHS A;  4X9D A;  1UG1 A;  1JJ2 S;  5I11 A;  2JW4 A;  3M58 A;  4OGC A;  4C92 F;  1ZA1 B;  3V7S A;  2OTL T;  1E6G A;  1QCO A;  4KGZ B;  2VVK A;  4F04 B;  2ECZ A;  4M78 D;  1LJO A;  1N27 A;  3EGX A;  3HRS A;  1WDX A;  2HZY A;  2CZ7 B;  3NGP A;  5KE2 A;  5KYW A;  1FXX A;  3G6E A;  2V8I A;  4AFS C;  4PFP A;  3ZBD A;  4OF1 A;  5GAM h;  1YIT T;  2DLP A;  1O75 A;  1PD1 A;  4M78 F;  4E7J A;  4OMO A;  3EG0 A;  1VQO T;  2DXC A;  1WJR A;  1Q86 C;  1WYX A;  2R5A A;  3HRU A;  4D6W A;  4M77 B;  2K6D A;  3MEW A;  2DXB A;  3OMG A;  1I5L A;  2DK3 A;  5GMK j;  3VUZ A;  1JB0 E;  1PM3 A;  2ED0 A;  1RAA B;  4QVC A;  3SWN A;  5GAN 4;  3H0H A;  4XK8 E;  1YI2 A;  3EG2 A;  5FRM A;  2EYX A;  1VQ7 T;  1K73 C;  3DKM A;  1N9S A;  3CCJ Q;  2AK5 A;  5KH6 A;  3UWN A;  2K3X A;  3QII A;  4VUB A;  5FRO A;  1X75 C;  2DL3 A;  3M0R A;  4C8Q D;  5IHN A;  2KXD A;  2Y4X A;  1WX6 A;  1YJN T;  1RAC B;  1AOJ A;  2HD0 A;  2RH2 A;  2AZS A;  1Q81 R;  3FDR A;  1OI1 A;  4M7D C;  1NLP C;  1PC0 A;  2XKO C;  5IXF A;  1Q95 G;  1D09 B;  3OYM A;  2DMO A;  5LJ3 f;  3OW2 A;  1Q82 C;  2EYQ A;  2RD1 A;  3OYD A;  3NTI A;  1YHQ Q;  4PJL A;  5LJ5 e;  4QQG A;  3A98 A;  1N5Z A;  2LTO A;  3JAM E;  3P8H A;  1NM7 A;  2GQI A;  1G2B A;  1GCQ A;  2C0I A;  2CP2 A;  4FL6 A;  1SSF A;  3CCQ Q;  1WXB A;  4Z02 A;  1TUG B;  2MOX A;  3DB3 A;  2YSQ A;  2HBP A;  3INZ A;  3SB2 A;  4N0A C;  1BI3 A;  3CCM Q;  1KSW A;  1I81 A;  2RHU A;  3OYI A;  3PE0 A;  4J7I A;  4LUD A;  2DL5 A;  1KJW A;  1TSF A;  1BIB A;  3OW2 S;  2VXF A;  2QG9 B;  2LP5 A;  4GLK A;  2RNA A;  3RR6 A;  2JM9 A;  4XU3 A;  4DEX A;  3V8K A;  4UC4 A;  2LC4 A;  3P8B B;  4M75 D;  2PVO B;  2RQR A;  3KUF A;  4BB7 A;  2GBQ A;  4EMK A;  5KCH A;  4AG1 C;  3E9F A;  5I2S A;  1AWJ A;  5GAN 6;  4M7A E;  5J39 A;  4CC3 A;  4XU0 A;  3EAE A;  1IGU A;  5KYX A;  5D7U A;  1YWO A;  3RNJ A;  5IN1 A;  2OTL A;  1LPL A;  2DEQ A;  4EPC A;  3FEO A;  3HTR A;  2X51 A;  4JS4 A;  2M0Y A;  5CQX A;  2BUD A;  1WZO A;  4KGX B;  1RAH B;  2PNI A;  5HKC A;  4XTZ A;  2J7I A;  1B34 B;  2HMA A;  4ZGE B;  1UEB A;  2NYS A;  5I22 A;  4FYV B;  4RCC A;  1YIT A;  1IRX A;  1VQL T;  2QAZ A;  3VJP A;  2HQX A;  1UDL A;  3AT1 B;  3H9N A;  4DBR A;  5EG2 A;  1VQO A;  3CCE Q;  1UGV A;  1ZUY A;  2DX1 A;  3BDU A;  2DL7 A;  2XID A;  2ESW A;  1Q7Y U;  1VQ7 Q;  1WQ7 A;  2CZ6 B;  2XMF A;  2ZPI B;  2LNH B;  4PJN A;  4BUG A;  4AMC A;  1V29 B;  1IB8 A;  4F7U G;  2AIR B;  5GAN d;  1QVG P;  4HCB A;  2WSC E;  4C0D C;  2F5K A;  1LOJ A;  1VQ7 A;  5GAO n;  3I56 T;  3J81 E;  1YWP A;  2C06 A;  2D6F A;  1S72 T;  4OMF B;  1WHJ A;  1YJN Q;  2GFU A;  4CC7 A;  4MZT A;  3OBW A;  3L42 A;  2KRM A;  5LJ3 h;  1SSH A;  5FW9 A;  1AVZ C;  1ZLM A;  2K2V A;  4F14 A;  3LGL A;  2FO0 A;  2LRQ A;  1YJN A;  4M7D G;  3CCL Q;  2KYM A;  1X6B A;  1AZG B;  3PFS A;  4NOY A;  4C5I A;  2F5T X;  2ZPF B;  3WVE B;  3REA B;  2LVM A;  3X25 B;  4E7S A;  4FYW B;  4RCB A;  4LDY A;  4JZ4 A;  4OVA A;  4L59 A;  2RO0 A;  2HSP A;  3U23 A;  2PZ1 A;  3UDC A;  5HY6 A;  1DJ7 B;  3HL8 A;  1U5S A;  2G6F X;  4HVU A;  4C0G A;  2P0K A;  1Y71 A;  2M02 A;  4N4G A;  1KQS P;  3RMS A;  1EIF A;  3URG A;  1QCN A;  3HPW A;  1M2V B;  4LUE A;  2KRS A;  1KC8 U;  3DLL A;  3MKD A;  5KYN A;  2EFI A;  3L1A A;  3JB9 H;  3G4S Q;  2KDS A;  1RAI B;  4JPB W;  4IUT A;  2CP0 A;  1M9S A;  2YUO A;  4JRP A;  1UHC A;  1MNE A;  3QYH B;  2MK5 A;  2XI9 A;  1VYT A;  5CVI A;  2KI7 A;  3MEU A;  1WI7 A;  1N8R R;  2D0Q B;  3MP6 A;  4ORZ A;  3PT9 A;  4XTW A;  4C8Q B;  1VQN T;  4IIM A;  3M53 A;  3ULR B;  3PNW C;  4C5G A;  2I0N A;  1E7O A;  2L3P A;  1N6A A;  1VQK Q;  2A08 A;  3E19 A;  2MAM A;  2QQR A;  2E6N A;  1C1A A;  2A37 A;  2DTH A;  2EKH A;  2DBM A;  1BB9 A;  2MPX C;  1M1G A;  3M0P A;  1I1J A;  2EQJ A;  2LJ3 A;  4F7U F;  4C0Z A;  1D1B A;  5FU6 C;  1QWE A;  4JLI A;  2CSQ A;  2CP5 A;  1H3Z A;  2E5K A;  4HCC A;  1B34 A;  3C94 A;  3E1S A;  2ATC B;  2RM4 A;  1VQ4 T;  2AT1 B;  1XTD A;  4M77 E;  2X4X A;  2HDA A;  1R0B G;  2JMA A;  4RMO A;  5LJ3 j;  2GTJ A;  1VQL A;  1S1N A;  1TH7 A;  3QPH A;  2YRV A;  4M7D D;  4E7L A;  2V1R A;  4PK4 A;  3CCS T;  1OEB A;  2NUZ A;  4Y92 A;  1VIF A;  1AWX A;  2QA4 T;  1ZA2 B;  2M16 A;  3OYY A;  2KY9 A;  2QEX T;  1QMC A;  4BE2 A;  4QT7 A;  5A2Q E;  1IXD A;  4M7D F;  2OTJ T;  1ZUU A;  4HA8 A;  1AHJ B;  3PGG A;  4FU6 A;  1ZSZ A;  1YN8 A;  2K5L A;  2GGR A;  4ZN1 A;  5GAN g;  1JXO A;  4JUV A;  3M0S A;  2QAS A;  3OYB A;  2JZ2 A;  3CXC P;  4M75 B;  3CC2 T;  4BI8 B;  3OYH A;  4Z88 A;  1GL5 A;  3I56 A;  2H8H A;  1WXU A;  2EIF A;  1S72 A;  2K5F A;  2C0T A;  2EKO A;  1X43 A;  4JJB A;  1VQ9 Q;  3A1P A;  1GFC A;  2DPP B;  1WFW A;  4A63 B;  1C6V X;  3UA6 A;  2YLC A;  3FRN A;  2LCS A;  1EFN A;  1M4Z A;  1TUC A;  1IZ6 A;  1GXI E;  3S3N A;  3LH0 A;  2CP7 A;  2DIL A;  4YTL A;  3RIR A;  1PCX A;  2CSI A;  1UJY A;  1TUD A;  3QJ6 A;  3GPL A;  2KSS A;  5C6S A;  4OML A;  1D0X A;  2DJQ A;  2RI2 A;  2JMC A;  4EDU A;  4J9E A;  1UGP B;  1M27 C;  2L3S A;  4QVD A;  1OYX A;  2L89 A;  3I5R A;  1QVG A;  3X24 B;  2JT4 A;  5KCO A;  2YDL A;  1I0C A;  1M2V A;  2B86 A;  3OYN A;  6AT1 B;  4E7K A;  4M7A C;  3PMI A;  3TSW A;  2DVJ A;  4N4H A;  2EW3 A;  4LE9 A;  1OZ3 A;  2FEI A;  1U3O A;  3T9N A;  3QBY A;  1QVF S;  1Q86 U;  2BKD N;  1VQN Q;  4FW1 A;  2XDD A;  3PVL A;  4PLL A;  5HK0 A;  1T0J A;  2V8J A;  4Q5W A;  1X69 A;  1YJ9 Q;  2LJ1 A;  3CPW A;  2FG0 A;  1VQ6 T;  1Y96 A;  4F16 A;  1SRM A;  2QDL A;  1Z9Z A;  4KBM B;  4RTZ A;  1VQN A;  2SRC A;  3RKY A;  1D0Z A;  3CCR T;  3H8Z A;  2DET A;  2DD4 A;  3GP8 A;  2VGN A;  4XTX A;  3M4G A;  3SWN C;  4C5H A;  1D3B B;  3KBG A;  3NMZ C;  5CKF A;  2JOY A;  3CC4 T;  2LT4 A;  2JN0 A;  3QO3 A;  4C5E A;  5GAO p;  2FRY A;  3JCM e;  1OX8 A;  1PRM C;  2CUD A;  2YUP A;  4PJO E;  3CCU Q;  1RI0 A;  3CPW S;  1VQM T;  1W70 A;  2F2X A;  4FYX B;  3CCS Q;  2WAC A;  2JS2 A;  2P4T A;  2QA4 Q;  1I8F A;  1VQ4 A;  5GMK e;  2K3B A;  4J9F A;  5GAN 2;  1ZHI A;  2O88 A;  2AKL A;  4EMG A;  2OTJ Q;  1Q82 U;  1TOV A;  4WF2 A;  2RQV A;  2F1L A;  1H92 A;  2XDB A;  1JEG A;  2PQW A;  1WLP B;  2FRW A;  3CCS A;  1LCK A;  2A0F B;  1UGS B;  3PIO A;  2IG0 A;  3VYH B;  2QA4 A;  2DL8 A;  4C92 E;  1OZ2 A;  1TXQ A;  3GNF B;  2QEX A;  2KT8 A;  3G6E Q;  2P4R A;  2OTJ A;  4J9D A;  2NUP B;  1GCQ C;  4FCY A;  3SHW A;  4ZTF A;  1MGQ A;  2GF7 A;  2PVD B;  2LQK A;  1OQK A;  3CC2 A;  5HCK A;  2WSE E;  3G71 T;  5GAO q;  4M7A A;  1M90 R;  1BIA A;  1WJQ A;  2P0Q A;  5DLQ E;  4M78 E;  4LDW A;  4LDU A;  5GAO l;  3M56 A;  5LJ5 d;  4HVW A;  4FT4 A;  3A8L B;  5DM7 R;  1ZBJ A;  4DOW A;  3EG9 A;  5CQY A;  3OYA A;  2VYT A;  3QJY A;  4LN2 A;  3EFR A;  1YI2 Q;  3L2V A;  5D6X A;  4HT8 A;  2EVR A;  3M55 A;  1SHG A;  3M59 A;  4HVV A;  3HRT A;  1UTI A;  2JS0 A;  2X3X D;  2KVQ G;  4RTY A;  2QYZ A;  2DVE A;  2RJC A;  2VC8 A;  4RTW A;  4EMK C;  1B7T A;  3CMA T;  4E7Z A;  2IPO B;  5KYY A;  3CME T;  2EJG A;  2RI5 A;  1QVP A;  4BY6 B;  1R77 A;  1VQ8 T;  4A54 A;  5GMK m;  5FLX E;  3VU3 C;  4OMN A;  2YWW A;  5D6Y A;  3JCM J;  3TRE A;  3OYE A;  4IUU A;  3QWX X;  4MDX A;  3LH5 A;  2LMJ A;  5FWB A;  3JCM Q;  2CZ0 B;  3CBO A;  4M7A G;  2M51 A;  3EH2 A;  2FZC B;  2JUF A;  3OSS C;  2ENM A;  3CXC A;  4X34 A;  1Y07 A;  5GAM e;  3OYL A;  2OI3 A;  1M2O A;  2CKK A;  1FMK A;  2RHY A;  1B3Q A;  3OA6 A;  1NEB A;  4AG2 C;  1TS9 A;  4IIO A;  4NL2 A;  3UA7 A;  2X3W D;  4EMH A;  4EIK A;  1VQ6 Q;  1XNI A;  3QSU A;  2EGA A;  2DO3 A;  1ACM B;  2DIQ A;  5GJV B;  4C8Q E;  1FMW A;  2K7A A;  2OX7 A;  5LL6 S;  4J8O A;  3FB9 A;  3S6W A;  1ZSG A;  5GAN 5;  4XAX B;  4WTO B;  1OOT A;  2PTK A;  3PMT A;  1VQ6 A;  2K79 A;  4XTV A;  3RUX A;  4KUD K;  5KYU A;  1AEY A;  2LQ8 A;  4JDS A;  3CCR A;  2MWO A;  1VQM Q;  3CC4 A;  2RQW A;  2YLB A;  2D9T A;  2EGC A;  2A3L A;  3OYK A;  4RG2 A;  1PKS A;  1WQW A;  1WA7 A;  2F2W A;  2DAQ A;  3DLM A;  4LD6 A;  2RQT A;  1M5Q 1;  1VQM A;  5IXB A;  3BW1 A;  3ME9 A;  5GAN f;  2EQU A;  2KGT A;  4KGV B;  2QQA A;  3X20 B;  2YT6 A;  2EWN A;  4DBQ A;  2A7Y A;  4II1 A;  3G7Z A;  1UFF A;  2E10 A;  2HCK A;  2MWP A;  3JCM c;  4AFQ C;  4PFO A;  2OTL Q;  2L8D A;  4FSS A;  1GRI A;  2E64 A;  4M75 E;  2D8H A;  2HNI A;  3ASK A;  2AHJ B;  1ABO A;  1IO6 A;  2EQK A;  3WXM B;  1BI0 A;  3LWH A;  2O4X B;  3M0T A;  2RI3 A;  3E2U A;  1SHF A;  1YIT Q;  4RKU E;  3OS1 A;  2KQW A;  3NTK A;  1B07 A;  1MHN A;  5GAN 7;  2RQU A;  3SDZ A;  2KR3 A;  4BI4 A;  3JCM V;  1VQO Q;  3G71 A;  2COZ A;  2HKQ B;  4R56 A;  4MDW A;  3FJP A;  1YJW T;  1EX4 A;  1C0M A;  5LJ5 g;  3CC7 T;  1JO8 A;  4M7A F;  4PJO B;  5CIU A;  3TEE A;  4RTU A;  2E65 A;  4GLM A;  2VV5 A;  2CT3 A;  2DNU A;  4BDY A;  1M8V A;  5A0L A;  3F70 A;  4M77 A;  1VQ5 A;  4OB1 B;  4A4E A;  2Y90 A;  1YBY A;  3JB9 J;  5CKH A;  5IT9 E;  3R6N A;  4J6Y A;  4XTY A;  3LW5 E;  2W0Z A;  1VOM A;  2X35 A;  2E3H A;  3GLX A;  3CMA A;  3CME A;  4LDV A;  3OYC A;  1VQ8 A;  1UEC A;  2LDM A;  1GCP A;  2CP3 A;  1FYN A;  4P5N A;  1M1K R;  1Y7X A;  4C92 B;  1MV0 B;  2EJ9 A;  1GFD A;  1FMV A;  3QUI A;  4RTV A;  2P0P A;  3HSB A;  4NL3 A;  1K8A R;  5DLO A;  1NPR A;  3OS0 A;  3CEY A;  1Q81 U;  4AT1 B;  1W2B P;  4A4H A;  2EGE A;  1K9M C;  3N5B B;  3SFM A;  3C12 A;  1U1T A;  4M78 B;  1NJI R;  2LNV A;  5A0G A;  3X28 B;  1RAD B;  3EG1 A;  2NUT B;  4M77 G;  4TVR A;  4JLG A;  3BE3 A;  1YIJ T;  1I4K 1;  3L2W A;  2CH4 W;  3TU4 K;  2L0A A;  1KQ1 A;  4LNP A;  2DZC A;  1PD0 A;  4D8K A;  2PU9 B;  3VS3 A;  2LZ6 B;  2ZPE B;  3BY7 A;  1E6H A;  1ZSZ C;  2LQN A;  2MIO A;  5GAN h;  2PVG B;  3VYG A;  2Z0W A;  1M90 C;  1QW1 A;  3C0C A;  3RKX A;  4DA4 A;  1UB4 A;  1PSF A;  3JB9 G;  2XG8 D;  3GNG A;  2DD5 A;  4JJN K;  1D1A A;  5LJ3 e;  2LJ0 A;  2YRC A;  3VS6 A;  1UJ0 A;  4JS5 A;  1D0Y A;  2J06 A;  3MCA B;  2L3Q A;  1KFZ A;  1ZX6 A;  4FW2 A;  1NE8 A;  3O8V A;  2JTF A;  2DXT A;  4R0K A;  3VRZ A;  1KD1 R;  2JTM A;  1JJ2 P;  1JU5 C;  5IHI A;  2E70 A;  1M3A A;  3I55 T;  5FU6 B;  2K3Y A;  4DBH A;  3OB9 A;  5CKB A;  3BFM A;  1N9R A;  4A4G A;  2O4X A;  2EBP A;  2VAS A;  2VKN A;  4F7U E;  4E2F B;  1YJW Q;  1PNJ A;  2JXB A;  3S3O A;  5CKE A;  4OMP A;  1QLY A;  1VQL Q;  1SF9 A;  2V26 A;  2O9S A;  3H0I A;  2JJ9 A;  1D1C A;  2R58 A;  2DYI A;  2NLU A;  3QDF A;  2QTV A;  1MMD A;  1T3L A;  2DKG A;  4J5Y A;  1YJW A;  4PJO A;  1Q81 C;  3M0U A;  4DQ2 A;  3CC7 A;  2J6O A;  1VQP T;  1K73 R;  2JVV A;  1XOV A;  4FIB A;  2OJ2 A;  2OAU A;  5CKD A;  1F1B B;  4D8D A;  4M7D E;  1HK9 A;  3I56 Q;  3I35 A;  1KQ2 A;  5FU7 B;  1S72 Q;  2C0O A;  4Y28 E;  1KHC A;  4M77 F;  4MZP A;  4MMK A;  3GOX A;  3CQT A;  3V8L A;  2ZPG B;  3VS0 A;  4ZGD B;  9ATC B;  2MF2 A;  3G1J A;  4BDZ A;  1BCM A;  1NLO C;  4C92 A;  3JRZ A;  5GAN j;  3JB9 D;  3CPF A;  3P8D A;  1X6G A;  1ZQ1 A;  1NBE B;  3VUB A;  1Q82 R;  1G3T A;  2RJD A;  3TCJ A;  1OPK A;  2ROT A;  2ED1 A;  1YIJ Q;  2E6Z A;  2NWM A;  4PJJ A;  3CCV T;  3IQL A;  1HYO A;  4Y91 A;  3JB9 F;  2RN8 A;  3JCM d;  4M78 A; 
#chains in the Genus database with same CATH homology
 2E4H A;  2HL5 C;  2COZ A;  2CP7 A;  1WHK A;  2HKQ B;  1WHG A;  2E3I A;  3TQ7 P;  2E3H A;  2CP5 A;  1WHM A;  4B6M A;  1TOV A;  2CP2 A;  2HL3 A;  2HQH A;  2CP0 A;  2COW A;  1WHL A;  1IXD A;  3E2U A;  2CP6 A;  1WHH A;  3RDV A;  1LPL A;  2CP3 A;  2QK0 A;  2Z0W A;  2COY A;  2HKN A;  2M02 A;  1TXQ A;  1WHJ A;  2MPX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...