2HKNA

Crystal structure of the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
SHMSPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Dynactin-1
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hknA00
2M02A 1WHMA 2Z0WA 2HQHA 2E3IA 1LPLA 2CP3A 3TQ7P 2HL3A 3E2UA 2COYA 1WHGA 2QK0A 2CP7A 4B6MA 1WHLA 2CP5A 2CP6A 2E4HA 2COWA 1WHJA 2HKNA 1TOVA 2CP0A 1TXQA 2CP2A 3RDVA 1WHKA 2HL5C 2E3HA 2MPXC 1IXDA 1WHHA 2COZA 2HKQB
chains in the Genus database with same CATH superfamily
2F5KA 4LDYA 1X6OA 4JDSA 2VGMA 1VQPT 2D6FA 1PSFA 1HSQA 1T0HA 1YIJQ 4PJOG 2VXFA 3OYMA 4PL6A 1VQ8A 1ABOA 2DEQA 4Z8AA 4M77F 1VQMQ 1KC8R 1N5ZA 1B34B 3H9NA 1VQ7T 1SHGA 4FSXA 4M75A 1UE9A 2MOXA 2CT4A 4BDZA 3V8KA 4R56A 3VU3C 2FVUA 4M7DE 2PTKA 4KRTA 4IUUA 4M78F 3OBWA 2X4XA 4VUBA 1PHTA 2E4HA 2OX7A 4B9XA 3CMEA 4BE1A 4DOVA 3R6NA 2EGAA 2ZPIB 4C92G 4FCYA 2PVDB 1M1KR 2K57A 1NEBA 1TH7A 5DLQE 3CCQA 2DETA 2QEXQ 2EJ9A 3I5RA 1Q86R 3EHRA 3CMAT 1M90R 2J05A 1IGUA 1Q86U 2O9SA 2AK5A 1OQKA 3FC3A 4BI8B 3VV0A 3VYGA 3OMCA 4ZGDB 3OYBA 2M16A 1I1JA 2XD0A 3CCJA 1B07A 1OOTA 4XU3A 1UTIA 2HCKA 1MNDA 3A8HB 2QQ9A 5GMKi 1K0XA 2CGHA 2RM4A 2H3EB 2DNUA 3A8GB 4LDVA 1VYVA 3CD6T 2E64A 3BFMA 3G6EA 3CCVQ 3CEYA 1JB0E 1N9RA 1BI2A 3E9GA 3CXCA 2CP7A 4KH1B 4PKCC 3TU4K 5IH2A 3JAME 5C0MA 1U5SA 3QO3A 1YJWQ 3EFOB 4PFOA 1YJNT 2NUTA 2HKQB 5IXFA 3RMSA 4M75C 2H8HA 2L0AA 2D0QB 2YRDA 1E6GA 2GNCA 2V1RA 4RCCA 3ZL7C 4E7KA 4LDUA 5LJ3f 1YHQT 3FJPA 4FM4B 3H41A 4A4GA 4DBQA 2EWNA 1M3CA 1BCMA 4A54A 4JRQA 1AWJA 3OS5A 1OPKA 2ATCB 2D0NA 2X9HA 3VS2A 1YCSB 2BIVA 1ZQ1A 1K73U 2KQWA 3SHWA 1VQ8Q 1GRIA 3CCMT 3RKWA 3I55A 4OB0B 1N8RR 2QAZA 3PNWC 3CC2A 3E2UA 2YRVA 4M78D 4BUGA 1VQKT 1VQ6Q 2M1HA 1ZBJA 2P84A 1TTHB 2VB6A 1B34A 3VS5A 5GAMd 2P0KA 2E6NA 2EQMA 1JQQA 1WJRA 3A8MB 2JJ9A 2QQRA 3VS1A 2GFAA 3RMQA 4AFUC 2YRCA 2A37A 3JCMb 1H92A 3VS3A 1WXUA 1FYNA 1VQ5Q 3CBMA 2LQ8A 5GAN7 3CXCP 4M77G 3G1JA 1X75C 1O75A 1ACMB 3JCMJ 1UGPB 2LCSA 5EC7A 3M0SA 1D3BA 3I35A 4X9DA 1KC8U 1WHKA 4J83A 4J8OA 2KRMA 1VQ7A 1WQ7A 1VQ8T 3PMIA 4PJJA 2PVGB 4M78G 5CVIA 1QP3A 1Q82R 2M51A 5GMKj 1RUWA 2K5FA 1M2VA 4NOYA 2XDDA 1RAAB 1EX4A 3VRZA 5FU6B 1VQ9Q 1JJ2A 4RTZA 3FJ5A 1G83A 1FXXA 4X34A 2FB7A 1NJIU 1UECA 1ABQA 1K9MC 1VQ6A 2JXBA 2K2MA 3JB9G 2HZYA 4KGXB 4BY6C 3CCQQ 5GAMf 2KNBB 1R0CB 1X2KA 2DLPA 1NEGA 1QVGP 3FDRA 2MK5A 1GFCA 1JRIA 3UA7A 4OP0A 2LNHB 4HA8A 1RABB 1Y71A 5KE3A 4A4HA 2FO0A 1YFNA 5J26A 2ED0A 2FPEA 2QA4Q 3QJYA 1VA7A 3QZ9B 5CKEA 4M7DA 2DMOA 3REBB 1SKUB 4B6MA 5GANe 3OYNA 3OA6A 2CP6A 1YHQA 3I9QA 2FZCB 2RMOA 4Y92A 3PT9A 4QW2A 2DIGA 2J6KA 4C92D 3MP8A 3CCEA 1VIEA 4QKUA 3CPWS 3L2ZA 1GL5A 3C12A 2DYBA 1RI9A 1WHLA 4HT9A 2DRKA 4XAXB 3JSCA 4FW2A 2CZ6B 3HP9A 1AHJB 2NYSA 3CD6A 1S1NA 5GAOl 2D8HA 2DTOA 3HTRA 4LN2A 2RJEA 1VQMT 2CP3A 1G3WA 1YI2Q 3RESA 2K9GA 2XMFA 4OMPA 4OB1B 1WHJA 2W0ZA 4FU6A 3OQ5A 2WSFE 5CKHA 4E47A 1K8AC 3M53A 5LJ5h 1M30A 3PE0A 3CC7Q 3OYIA 1Y57A 2DILA 3EG9B 3SB2A 3EHQA 2ECZA 2MAMA 3PTAA 2EJFA 2E5QA 3C95A 5LJ3g 4JRIA 4F17A 3CMET 4C8QG 1KQSA 1VQ5A 1QVFP 3WVDB 2GBQA 1QVGS 1YITA 4XTXA 1WJSA 2YT6A 3TSZA 4A63B 2WACA 3M55A 3HKSA 2HEQA 4OF1A 2AKLA 2XICA 1TG0A 3CCUA 2QDYB 2RQVA 1BU1A 4GLKA 1ZSZA 5L23A 1YJ9A 3M57A 1UGVA 2K3XA 2ZZDA 2L3QA 2ABLA 1OX8A 1WHGA 1SF9A 1Y96B 2VXEA 2O2OA 1ZLMA 3V7RA 4EMKC 1OZ2A 3HL8A 1SHFA 1VQ9T 1IGQA 3GBQA 1BI1A 1QKXA 1UJ0A 1VQNA 3TVTA 3T9NA 1MHNA 2CH4W 3KUFA 1NYGA 2XDPA 5D6XA 4C5IA 2E3IA 3KFVA 3CCUQ 2O88A 1UGRB 2MCNA 1E7OA 4PFPA 1K9MR 3RBBB 4ELYC 3CBOA 4DBFA 2EQKA 3JRZA 2FYKA 2CP2A 4J9DA 5GAMh 2HL5C 4XU2A 1VQ4A 3JB9D 1MMNA 1T0JA 2WSEE 3C94A 1VQOQ 1M90C 2NUPA 2L2PA 1QW1A 1K1ZA 1M1KC 3FEOA 4PLIA 4B9WA 5KYXA 1TUGB 1XJWB 2RHZA 1R0BG 3FB9A 3CPWA 3GNFB 2AKKA 3CCVA 4M7DD 2RI2A 3I56Q 1YN8A 2FPDA 2GF7A 3OMGA 4M7AA 2CZ1B 4J9BA 5GAOq 4ANJA 1Q82C 3CCMQ 3JCMh 2D9TA 2EGCA 4ZGEB 2KBTA 4DBRA 3N5BB 3P8BB 2EGEA 2CREA 2JTMA 4IUVA 1YHQQ 2QG9B 3P8DA 5CKBA 1TWBA 2RQWA 4JPBW 2X4YA 4M77B 3KBGA 1G8XA 5DM7R 5GAN6 1VQ4T 3MPUB 3L2VA 4EDUA 3E19A 4J9GA 1M9SA 5LL6S 5I22A 1I5OB 2KT8A 1ZA2B 4BB7A 2Y90A 1D1BA 3LGFA 2K79A 4A4KA 2DXTA 4F7UA 1MMGA 4HCZA 2M9UA 2FHDA 5I21A 4GY5A 5GMKl 3OYLA 1ZHIA 2A28A 2QK0A 4PJOD 1VQKA 2MIOA 2A36A 1ZSZC 2J6OA 2HNIA 5GMKe 1PNJA 2RB6A 2L3RA 1FX7A 3CCMA 3HRUA 3OB9A 2R5MA 2DD5A 1F1BB 1R8OB 3QBYA 4JLIA 1IREB 4PJMA 2KDSA 5KYXB 3V8LA 1O9SA 3AT1B 2VUBA 1U3OA 4RKUE 3CMAQ 1AOJA 5KYYA 5AYFA 2QEXT 4D8KA 3M0TA 2LT4A 3CCSA 3HSBA 4DQ2A 4QQGA 3NFCA 1B3QA 3CC4T 2DL4A 4PNOA 2DA9A 2OAWA 2E10A 1ZX6A 1BYMA 3A98A 3M56A 4MZTA 4N4GA 3H6ZA 2VVKA 4OMQA 1M4ZA 2VYTA 2Z0WA 2X3XD 2EKOA 2VASA 1BB9A 1QMCA 5FRMA 3EH2A 4CI0C 2DK3A 3OSSC 4RTVA 4KBMB 1OU9A 1HJDA 3LH5A 3URGA 3G4SQ 2CUDA 5CR2A 1WA7A 2DE0X 1G3TA 3CPFA 3QDRB 4FW1A 3QKJA 3S6WA 2NUTB 2RF0A 1Y0MA 3OYHA 1KQ1A 1OPLA 4WCIA 1GFDA 1AWXA 1Q7YR 4PJOA 1Z9QA 2OTLA 3HPWA 5CKFA 1HYOA 3QHSA 4YTLA 4HXJA 5FRNA 2FZKB 1KC8C 4PK4A 3CC2Q 2K3BA 4J6XA 4MDWA 2CZ7B 4PLLA 3LWHA 1BK2A 3MEUA 5IXBA 3QG1A 2DBKA 5FROA 1QVFA 5GJWB 5KYUA 3QUIA 1G3YA 2O4XA 3KXTA 1VQOA 2P0PA 4XU1A 4EMKA 4X1VA 3A1PA 3S3OA 5GAMe 2QA4A 2CUBA 2BUDA 2DXUA 1X2QA 3OW2S 1M3BA 2DKGA 2NUZA 3PVQA 4M7AC 2MYSA 2HSEB 1N6AA 4C92B 1H641 2LZ6B 3RKXA 3GPLA 2V8JA 2JZ2A 1C6VX 1BKBA 4M75E 4AFSC 4IKFA 4J6WA 1M27C 3OYCA 1PKSA 1WGSA 4FL6A 4E7HA 3LX7A 3MEAA 4LE9A 2P4TA 2MWOA 1VQLT 4RG2A 2JM9A 4FYXB 2RHXA 2LJ3A 1JBMA 4WTOB 2RHUA 4C5HA 1I07A 1ZBXA 1LCKA 3FLGA 1BIBA 2L3PA 3EG0A 3CC4Q 2BZYA 1XNIA 3X24B 1X01A 3CCLA 3I56T 3TCJA 3G6ET 1M8MA 2X51A 4KGVB 4II1A 3ULRB 2EYXA 4C0DB 3QWXX 2QASA 1RI0A 5FU7C 2LNVA 3ZFJA 2ED1A 3HRTA 3M5AA 4JZ4A 3LWIA 1ZUKA 3CCJT 4J9EA 1M3AA 5FWBA 4D6WA 2IVWA 4OGEA 2RA2A 3NTHA 3EGXB 4F7UE 5GANd 4UC4A 4QVZA 4OGCA 2BZ8A 3M4YA 5HCKA 1SSFA 1PG5B 3EG1A 1NYFA 3OS2A 3UT1A 1ZUYA 2YLCA 3OS1A 1SRMA 4CC2A 4E7LA 2A08A 3M0UA 4BI3A 5LJ3d 1RAFB 1X6BA 2E1HA 1YJ9Q 2JVVA 2M02A 3DKMA 2KMTA 2MI6A 3LH0A 4WF2A 5I2SA 3EAEA 4M77A 4O5VA 2HQXA 4BD3A 4ORZA 4M75F 4M78C 2AZVA 3CQTA 4D8DA 4QVCA 3RR6A 3JCMf 2HDAA 1PD1A 2ENMA 3S3NA 2RJFA 3MJXA 5GAOn 1JU5C 4RCBA 3CCST 1D3BB 3HRSA 1S72A 3QWYA 1VQ7Q 4PJLA 5GAN4 1TS9A 4ZTFA 2LX9A 2C0TA 4LDWA 4F7UF 2PZ1A 1N9SA 2CP5A 1WFWA 4XU0A 3CCSQ 2KGTA 2HBWA 4C8QE 3QYGB 1EIFA 1WYXA 2ZPGB 2F69A 3UWNA 4EPCA 2JTEA 1UFFA 4OVAA 2LQKA 1TSFA 2JS2A 3MO8A 2OTJQ 2PUKB 1KD1U 2NUPB 1PCXA 3JB9H 2ZPEB 4Z02A 1TU0B 2J06A 4JJCA 2O01E 4M4ZA 4AT1B 2SEMA 1UB4A 1C1AA 2YUNA 1UGSB 1YI2T 4DEYA 4M7DG 4QQ6A 1QLYA 5HK0A 5GMKm 6AT1B 1CKAA 1UJYA 2PU9B 1Q81C 1YITQ 1K9MU 2PVOB 4MMKA 5CQXA 1G5VA 4PJOC 3JCMd 4FYVB 3BDLA 4IUTA 2IPOB 4GLMA 2LRQA 5EG2A 3LGLA 2F2VA 1JEGA 1MV3A 3PGGA 2CP0A 3OYAA 1QVPA 1K73R 1Q95G 1RACB 2L8DA 3QIIA 5J3BA 4KULA 2EKHA 3TSWA 1TUCA 1OEBA 3MHXA 3P8HA 4F16A 3GF5A 4BDYA 3G6EQ 1I5LA 1WNLA 2RI3A 4HCCA 2B86A 1I81A 2IIMA 4JJBA 2C06A 3SFMA 5DY9A 4EMHA 5KYYB 2IG0A 1TXQA 4C5GA 4NL2A 1YIJA 2FRWA 5ECAA 1E6HA 2RHYA 1V29B 2OTLT 1SSHA 1D0ZA 1D0YA 3VUBA 2CDTA 4J9CA 1IO6A 5FU7B 2OTLQ 3PIOA 1GCPA 2OI3A 4C8QC 2OTJA 3ER0A 3LW5E 2BKDN 2K6DA 4OMMA 2QTVA 1CKBA 5M9OA 2OAUA 3R6OA 3MKDA 1OU8A 5CO7A 5HY6A 1AEYA 1D0XA 3J80E 3PIPA 1QVGA 4JRKA 1RADB 2G3RA 2K5LA 3INZA 1Q81R 2V8KA 5GAMj 2GCXA 7AT1B 4JJNK 3EG2A 2A3LA 4PJNA 5IHIA 1OZ3A 2BE9B 1P92A 4OMFB 4ZNXA 8ATCB 3THKA 3E9FA 2EAYA 2KEAA 3M54A 2QQAA 1W6XA 4M75B 4C8QB 1ZA1B 2HD0A 3SEMA 4MZMA 2C0IA 4QQDA 1NLOC 3JCMX 4QVDA 1UG1A 1PKTA 1AWWA 2FRYA 4JUVA 4EIKA 1I4K1 1WJQA 1WPYA 2JTFA 3META 2YWWA 4RUGA 1WIEA 4CC7A 3UPUA 2HBPA 1VQ5T 3L2UA 4FIBA 3CBPA 4Z88A 1KD1R 2XDBA 2LQNA 5GAOp 1UHCA 4N0AA 2MMPA 3CCEQ 2E65A 1WLPB 3OYDA 2KROA 3U23A 3TEEA 3PVLA 4DOWA 4F14A 3DB3A 1KJWA 1YCYA 2GTJA 4M7DF 2E3HA 3OBYA 4FYYB 2QQSA 2KRNA 4CC4B 3EFRA 5FU6C 2AT1B 4R0KA 3CCQT 4FT2A 2YUQA 2K7AA 2AZSA 2DJZA 2COYA 3VS4A 3CCLQ 1VQNQ 1AZGB 4C8QD 1AWOA 4HCBA 2ZGWA 3JV3A 2DFUA 2DL5A 3X25B 4E7JA 3C0CA 2XI9A 4M7DC 3RERA 4C5EA 2C0OA 1Q7YU 3SWNB 1N8RC 2FZGB 4Y91A 2F5TX 1W2BS 3OW2P 2HMAA 3JB9I 1LPLA 3I55Q 4KGZB 4LDXA 2JS0A 9ATCB 2EPDA 4ME7A 1N8RU 5HKCA 2XG8D 1WQWA 3VKIA 1XOVA 3J81E 3X20B 2QI2A 1KK7A 2XHCA 2QEXA 2DL7A 3A8OB 3M58A 3ME9A 2SRCA 3PMTA 2VGNA 2G6FX 5J39A 1SRLA 2KYMA 5KCHA 1W1FA 4Z89A 2BE7D 1B7TA 3JCMV 1KFZA 5KYUB 2DZ9A 4ZGJB 4RTYA 1IHVA 2CSQA 4TVRA 1MMAA 2YUOA 1FWZA 2FEIA 3OYKA 2COZA 1N27A 3EG9A 3SDZA 4M78A 1VQ6T 1G2BA 4C92E 1H8KA 1PD0A 1LVKA 1EZZB 1K9AA 2VV5A 3EFSA 4BY6B 1QKWA 2VKNA 2RPNA 1KQSS 2KSSA 3L42A 1Q86C 2F2XA 5L8RE 1MGQA 1GCQA 4E7IA 5GANg 2Y4XA 4M78B 1QCFA 2L3SA 3UF4A 3V7CA 3BDUA 2J7IA 3MCAB 2HQHA 3BW1A 2E41A 1RAIB 5GJVB 1GBRA 5LJ5f 4F7UG 4Y28E 2ZCFB 2ZPHB 1MNEA 3F70A 3NHNA 4NS5A 4M75D 1NG2A 5IT9E 4O6JA 1QWFA 5AT1B 1Y07A 2LCCA 1WDXA 3NGPA 5GAOm 2D1XA 3CCVT 1G3SA 4BE0A 1PC0A 2DZCA 2LP5A 4L5GA 2L89A 3JCMe 4OMOA 2FG0A 4Q5WA 4KT0E 4A53A 2DM1A 4RTTA 4ATOA 1X6GA 5A0GA 2K3YA 3CC7A 5GAOr 4LUEA 1SG5A 1U06A 3MP6A 5GAN3 1W2BP 3SWNA 2LTOA 4XQ3A 3CC4A 5FW9A 1YI2A 3JCMP 4N0AC 1PM3A 2MF2A 4J5YA 4M7AF 3I56A 1SEMA 1RAEB 2GQIA 4FYWB 4KUDK 1BBZA 2MPXC 3JCMQ 2LC4A 5IHNA 1GCQC 3VJPA 4LNPA 4JJDA 3UDCA 1YWPA 3L1AA 2OJ2A 3M0PA 1VQ9A 3I5SA 1YJNA 5CCAA 2RNAA 1Y96A 3OS0A 3G4ST 3QXEB 1S72T 1ARKA 2RHIA 5CK9A 2JMAA 1RLPC 1UUEA 2EYYA 2RN8A 3L2WA 4R55A 1PSEA 3H0HA 1ZSZB 3CCRA 4RMOA 5GANj 4MDXA 1FMVA 4IUQA 1OYXA 1HK9A 2DXBA 3ZBDA 4DEXA 3G7ZA 1OX9A 1QP2A 1VQPQ 2PNIA 1JJ2S 1KQSP 3BY7A 1PRMC 4IUPA 3VS0A 1YJWT 3MEWA 3TREA 1FMKA 5I2MA 3NTIA 3CC7T 3L2RA 4J9HA 2HQEA 2JMCA 2K5IA 3Q1JA 1Q81U 2M0OA 4XTWA 4C0ZA 1QVFS 3X28B 2JOYA 4JZ3A 2AIRB 4P5NA 2I2LA 1NJIC 4C8QA 4C92F 1YNZA 1MV0B 3G71A 3RIRA 3OSVA 1CSKA 3QJ6A 5KCOA 3VS7A 2YLBA 1Q82U 1BI0A 4HVVA 1UEBA 4F04B 1DJ7B 1D09B 2DRMA 4XTVA 2EYZA 2FL7A 4IIOA 3VRYA 5KYWB 5LJ5e 3E1SA 1UHFA 1KHIA 1KD1C 4A4EA 3A5ZB 3EGDA 2QTXA 1NE8A 1WXBA 4DA4A 2KAFA 5KYWA 1M8VA 1A0NB 1PRLC 1RLQC 1W4SA 3CCRQ 1VQ4Q 3ZEHA 3QDFA 1NLPC 2LT1A 2LCLA 1Q7YC 1UDLA 1H3ZA 2CKKA 3M0RA 5LJ5d 4M78E 1WZOA 2RQUA 1SPKA 2KVQG 3REAB 2KYBA 1VQLA 4IIMA 2PUOB 4MZPA 2LX7A 2COWA 5IHKA 1W2BA 1D1CA 4PJOF 3CCJQ 2DXCA 4OMNA 1IRXA 3JB9F 1WHHA 2M0YA 2GGRA 1YJWA 5KE2A 3I55T 3G71Q 2QXFA 4J7FA 2EQUA 4XTUA 3IQLA 1BI3A 1V1CA 3EH1A 1J3TA 4RTUA 2GFUA 3EGUA 1D1AA 4FT4A 3GNGA 2FPFA 2ZPFB 3RNJA 5FWCA 4E7SA 1OULA 3OY9A 2KXDA 1VYTA 3H0IA 2DF6A 2CH4A 3G4SA 2YXYA 1VQNT 3OYEA 1VQOT 2XU8A 5GMKh 3HHTB 5D6WA 2RQTA 2DYIA 1X43A 4KUIA 4ESRA 3OW2A 2JN0A 3JB9J 1S72Q 5D6YA 4E7ZA 2L5QA 1NPPA 4HKEA 1LOJA 1JXMA 2QGFB 2GQVA 1RAGB 2D8JA 3GLXA 2VC8A 2RJDA 4HVWA 1IZ6A 3LLRA 2KT1A 4DBHA 4N4IA 5LJ3e 5GAN2 1IHWA 1JXOA 5C6SA 4M77E 2XK0A 3JCMW 3V7SA 2DERA 2QYZA 1YWOA 2BZXA 1K0SA 3ASKA 3NTKA 3DLLA 1RL2A 5KH6A 2O4XB 2DL8A 2CZ0B 2KI7A 4JS5A 3H8ZA 1YBYA 1W70A 2LJ0A 1KQ2A 3FIFA 4M7AG 1VQKQ 3RKYA 1I8FA 2KR3A 3PFSA 3GIBA 3OYGA 2A7YA 4AFQC 3UATA 1RAHB 1K8AR 2J6FA 2RQRA 2BTTA 5LJ3h 1C0MA 5KYNA 2QGGA 1BCOA 4X9CA 3RUXA 4M7AD 1VYUA 2RH2A 3MP1A 2EIFA 3CC2T 1U8RA 1VQLQ 3CMEQ 2VWFA 2JNGA 2ROTA 2DJQA 3AHUA 4JRPA 4CRIA 2CSIA 3H0FA 4XTZA 1IB8A 3TQ7P 3GOXA 1M90U 3M59A 1YJNQ 4ZN1A 3S3MA 1ZUUA 1U1TA 4JS4A 3L2QA 5CQYA 2JW4A 4HT8A 1GBQA 1OV3A 5A2QE 3JCMg 1WX6A 2DEUA 1NPRA 4JLGA 3X26B 2KY9A 1MUZA 3CD6Q 2RK2A 5A0DA 3NPFA 4C0GA 5GANf 4AG1C 1K8AU 2CS7A 1M1FA 4QT7A 2EVRA 3HFNA 4GBQA 5I11A 4OB2B 4NL3A 4EMKB 3GP8A 8AT1B 1QWEA 5LJ5j 2DTIA 2ZPBB 1R77A 1AVZC 2X4JA 3WXMB 4LXCA 4EMGA 1QCNA 4AMCA 2LVMA 2EQIA 1V76A 4J7IA 4J9FA 2V1QA 3QYHB 2QQBA 2GTOA 2YUPA 2XIDA 1WXTA 2QA4T 3BE3A 2R57A 2B8AA 4M77D 2RO0A 4F7UB 2WSCE 2ZAEA 1EFNA 4RTXA 3UA6A 2YHTA 2F1LA 1YITT 4AFZC 4E6RA 1LNXA 2HKNA 1TOVA 2DO3A 3OYFA 1HD3A 2MWPA 2R58A 2RD1A 2EQJA 3JCMc 4AG2C 4C8QF 4C92A 2V8IA 2EYQA 3O8VA 2KE9A 3LYIA 2CT3A 2NWMA 3VUZA 4XTYA 1YIJT 1HXDA 2NLUA 2E6ZA 2I0NA 3A8LB 2DTHA 1Z9ZA 4J9IA 1T3SA 3QPHA 3SD4A 5IN1A 3CCLT 2X4WA 1K4US 2LMJA 3EGXA 1BIAA 3EFOA 3G71T 5FLXE 2DL3A 4L59A 1WI7A 4BE2A 1K73C 3M4GA 1AZEA 4RG8A 4LUDA 5CKDA 5GAN5 1JJ2P 3D7SB 4M75G 1NM7A 1X27A 3WVEB 3EG3A 4M7AE 2DBMA 3CCET 2EYWA 2JT4A 1UGQB 1KIKA 2HAXA 1AD5A 4MMLA 3HFOA 1TUDA 1MMDA 1H3HA 3NMZC 1X69A 4BACA 1WHMA 3DB4A 5GANh 1I0CA 3CXCS 4IURA 4XK8E 1T3LA 4E2FB 3CCRT 1PWTA 3MEVA 1YJ9T 1NBEB 2DD4A 3EGDB 4ZTJA 4PJOE 4OMLA 2E12A 1OI1A 1KHCA 4C92C 1NZ9A 2O9VA 1VOMA 2RI5A 4C0DC 3CCUT 2DIQA 4PFZA 2LJ1A 1M1GA 4RTWA 2LQWA 3O5ZA 1KG1A 1AT1B 2LDMA 2X35A 4FSSA 2DVJA 2RK1A 1IXDA 4ZN3A 3C4SA 2KRSA 1JO8A 3CPWP 3VS6A 4C0FA 4ELZC 5A0LA 1K76A 4M7AB 1U1SA 2EFIA 5GAMg 2DAQA 3M9QA 3OYJA 1YP5A 3DLMA 1VQMA 3RDVA 3CMAA 5GAN8 1XQHA 2P4RA 3QZ5B 2O31A 2QDLA 3M0QA 2Y4YA 1QQJA 3OYYA 3QSUA 4HCKA 4J6YA 5LJ3j 4M7DB 2CYZB 5CIUA 2ROLA 2F2WA 2HL3A 2YSQA 2K2VA 2W10A 1ZSGA 5DLOA 4A4FA 5CAIA 4PJOB 5IAYA 1Y7XA 2EW3A 2JUFA 2X3WD 2K4YA 1VIFA 1VUBA 4OB3B 2EBPA 2EJGA 1XTDA 1NJIR 2DVEA 5D7UA 3FRNA 2A0FB 3V8JA 1LJOA 2PQWA 4K11A 4V2SA 1M1KU 4CC3A 2JM8A 2XKOC 2KK4A 2HSPA 1M2OA 1QCOA 2R5AA 4N4HA 3J7AF 1KSWA 4LD9K 1VQPA 1M2VB 1M5Q1 2RJCA 2KXCA 1GXIE 2DX1A 2H3JA 1FMWA 3VYHB 2P0QA 2DPPB 2ESWA 5LJ5g 4LD6A 4HVUA 4BI4A 2E70A 3SWNC 2AHJB 4KH0B 2YDLA 5HK3A 4L6V5 2V26A 4M77C 2OTJT 2E5KA
chains in the Genus database with same CATH topology
2M02A 1WHMA 2Z0WA 2HQHA 2E3IA 1LPLA 2CP3A 3TQ7P 2HL3A 3E2UA 2COYA 1WHGA 2QK0A 2CP7A 4B6MA 1WHLA 2CP5A 2CP6A 2E4HA 2COWA 1WHJA 2HKNA 1TOVA 2CP0A 1TXQA 2CP2A 3RDVA 1WHKA 2HL5C 2E3HA 2MPXC 1IXDA 1WHHA 2COZA 2HKQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M02 A;  1WHM A;  2Z0W A;  2HQH A;  2E3I A;  1LPL A;  2CP3 A;  3TQ7 P;  2HL3 A;  3E2U A;  2COY A;  1WHG A;  2QK0 A;  2CP7 A;  4B6M A;  1WHL A;  2CP5 A;  2CP6 A;  2E4H A;  2COW A;  1WHJ A;  2HKN A;  1TOV A;  2CP0 A;  1TXQ A;  2CP2 A;  3RDV A;  1WHK A;  2HL5 C;  2E3H A;  2MPX C;  1IXD A;  1WHH A;  2COZ A;  2HKQ B; 
#chains in the Genus database with same CATH topology
 2F5K A;  4LDY A;  1X6O A;  4JDS A;  2VGM A;  1VQP T;  2D6F A;  1PSF A;  1HSQ A;  1T0H A;  1YIJ Q;  4PJO G;  2VXF A;  3OYM A;  4PL6 A;  1VQ8 A;  1ABO A;  2DEQ A;  4Z8A A;  4M77 F;  1VQM Q;  1KC8 R;  1N5Z A;  1B34 B;  3H9N A;  1VQ7 T;  1SHG A;  4FSX A;  4M75 A;  1UE9 A;  2MOX A;  2CT4 A;  4BDZ A;  3V8K A;  4R56 A;  3VU3 C;  2FVU A;  4M7D E;  2PTK A;  4KRT A;  4IUU A;  4M78 F;  3OBW A;  2X4X A;  4VUB A;  1PHT A;  2E4H A;  2OX7 A;  4B9X A;  3CME A;  4BE1 A;  4DOV A;  3R6N A;  2EGA A;  2ZPI B;  4C92 G;  4FCY A;  2PVD B;  1M1K R;  2K57 A;  1NEB A;  1TH7 A;  5DLQ E;  3CCQ A;  2DET A;  2QEX Q;  2EJ9 A;  3I5R A;  1Q86 R;  3EHR A;  3CMA T;  1M90 R;  2J05 A;  1IGU A;  1Q86 U;  2O9S A;  2AK5 A;  1OQK A;  3FC3 A;  4BI8 B;  3VV0 A;  3VYG A;  3OMC A;  4ZGD B;  3OYB A;  2M16 A;  1I1J A;  2XD0 A;  3CCJ A;  1B07 A;  1OOT A;  4XU3 A;  1UTI A;  2HCK A;  1MND A;  3A8H B;  2QQ9 A;  5GMK i;  1K0X A;  2CGH A;  2RM4 A;  2H3E B;  2DNU A;  3A8G B;  4LDV A;  1VYV A;  3CD6 T;  2E64 A;  3BFM A;  3G6E A;  3CCV Q;  3CEY A;  1JB0 E;  1N9R A;  1BI2 A;  3E9G A;  3CXC A;  2CP7 A;  4KH1 B;  4PKC C;  3TU4 K;  5IH2 A;  3JAM E;  5C0M A;  1U5S A;  3QO3 A;  1YJW Q;  3EFO B;  4PFO A;  1YJN T;  2NUT A;  2HKQ B;  5IXF A;  3RMS A;  4M75 C;  2H8H A;  2L0A A;  2D0Q B;  2YRD A;  1E6G A;  2GNC A;  2V1R A;  4RCC A;  3ZL7 C;  4E7K A;  4LDU A;  5LJ3 f;  1YHQ T;  3FJP A;  4FM4 B;  3H41 A;  4A4G A;  4DBQ A;  2EWN A;  1M3C A;  1BCM A;  4A54 A;  4JRQ A;  1AWJ A;  3OS5 A;  1OPK A;  2ATC B;  2D0N A;  2X9H A;  3VS2 A;  1YCS B;  2BIV A;  1ZQ1 A;  1K73 U;  2KQW A;  3SHW A;  1VQ8 Q;  1GRI A;  3CCM T;  3RKW A;  3I55 A;  4OB0 B;  1N8R R;  2QAZ A;  3PNW C;  3CC2 A;  3E2U A;  2YRV A;  4M78 D;  4BUG A;  1VQK T;  1VQ6 Q;  2M1H A;  1ZBJ A;  2P84 A;  1TTH B;  2VB6 A;  1B34 A;  3VS5 A;  5GAM d;  2P0K A;  2E6N A;  2EQM A;  1JQQ A;  1WJR A;  3A8M B;  2JJ9 A;  2QQR A;  3VS1 A;  2GFA A;  3RMQ A;  4AFU C;  2YRC A;  2A37 A;  3JCM b;  1H92 A;  3VS3 A;  1WXU A;  1FYN A;  1VQ5 Q;  3CBM A;  2LQ8 A;  5GAN 7;  3CXC P;  4M77 G;  3G1J A;  1X75 C;  1O75 A;  1ACM B;  3JCM J;  1UGP B;  2LCS A;  5EC7 A;  3M0S A;  1D3B A;  3I35 A;  4X9D A;  1KC8 U;  1WHK A;  4J83 A;  4J8O A;  2KRM A;  1VQ7 A;  1WQ7 A;  1VQ8 T;  3PMI A;  4PJJ A;  2PVG B;  4M78 G;  5CVI A;  1QP3 A;  1Q82 R;  2M51 A;  5GMK j;  1RUW A;  2K5F A;  1M2V A;  4NOY A;  2XDD A;  1RAA B;  1EX4 A;  3VRZ A;  5FU6 B;  1VQ9 Q;  1JJ2 A;  4RTZ A;  3FJ5 A;  1G83 A;  1FXX A;  4X34 A;  2FB7 A;  1NJI U;  1UEC A;  1ABQ A;  1K9M C;  1VQ6 A;  2JXB A;  2K2M A;  3JB9 G;  2HZY A;  4KGX B;  4BY6 C;  3CCQ Q;  5GAM f;  2KNB B;  1R0C B;  1X2K A;  2DLP A;  1NEG A;  1QVG P;  3FDR A;  2MK5 A;  1GFC A;  1JRI A;  3UA7 A;  4OP0 A;  2LNH B;  4HA8 A;  1RAB B;  1Y71 A;  5KE3 A;  4A4H A;  2FO0 A;  1YFN A;  5J26 A;  2ED0 A;  2FPE A;  2QA4 Q;  3QJY A;  1VA7 A;  3QZ9 B;  5CKE A;  4M7D A;  2DMO A;  3REB B;  1SKU B;  4B6M A;  5GAN e;  3OYN A;  3OA6 A;  2CP6 A;  1YHQ A;  3I9Q A;  2FZC B;  2RMO A;  4Y92 A;  3PT9 A;  4QW2 A;  2DIG A;  2J6K A;  4C92 D;  3MP8 A;  3CCE A;  1VIE A;  4QKU A;  3CPW S;  3L2Z A;  1GL5 A;  3C12 A;  2DYB A;  1RI9 A;  1WHL A;  4HT9 A;  2DRK A;  4XAX B;  3JSC A;  4FW2 A;  2CZ6 B;  3HP9 A;  1AHJ B;  2NYS A;  3CD6 A;  1S1N A;  5GAO l;  2D8H A;  2DTO A;  3HTR A;  4LN2 A;  2RJE A;  1VQM T;  2CP3 A;  1G3W A;  1YI2 Q;  3RES A;  2K9G A;  2XMF A;  4OMP A;  4OB1 B;  1WHJ A;  2W0Z A;  4FU6 A;  3OQ5 A;  2WSF E;  5CKH A;  4E47 A;  1K8A C;  3M53 A;  5LJ5 h;  1M30 A;  3PE0 A;  3CC7 Q;  3OYI A;  1Y57 A;  2DIL A;  3EG9 B;  3SB2 A;  3EHQ A;  2ECZ A;  2MAM A;  3PTA A;  2EJF A;  2E5Q A;  3C95 A;  5LJ3 g;  4JRI A;  4F17 A;  3CME T;  4C8Q G;  1KQS A;  1VQ5 A;  1QVF P;  3WVD B;  2GBQ A;  1QVG S;  1YIT A;  4XTX A;  1WJS A;  2YT6 A;  3TSZ A;  4A63 B;  2WAC A;  3M55 A;  3HKS A;  2HEQ A;  4OF1 A;  2AKL A;  2XIC A;  1TG0 A;  3CCU A;  2QDY B;  2RQV A;  1BU1 A;  4GLK A;  1ZSZ A;  5L23 A;  1YJ9 A;  3M57 A;  1UGV A;  2K3X A;  2ZZD A;  2L3Q A;  2ABL A;  1OX8 A;  1WHG A;  1SF9 A;  1Y96 B;  2VXE A;  2O2O A;  1ZLM A;  3V7R A;  4EMK C;  1OZ2 A;  3HL8 A;  1SHF A;  1VQ9 T;  1IGQ A;  3GBQ A;  1BI1 A;  1QKX A;  1UJ0 A;  1VQN A;  3TVT A;  3T9N A;  1MHN A;  2CH4 W;  3KUF A;  1NYG A;  2XDP A;  5D6X A;  4C5I A;  2E3I A;  3KFV A;  3CCU Q;  2O88 A;  1UGR B;  2MCN A;  1E7O A;  4PFP A;  1K9M R;  3RBB B;  4ELY C;  3CBO A;  4DBF A;  2EQK A;  3JRZ A;  2FYK A;  2CP2 A;  4J9D A;  5GAM h;  2HL5 C;  4XU2 A;  1VQ4 A;  3JB9 D;  1MMN A;  1T0J A;  2WSE E;  3C94 A;  1VQO Q;  1M90 C;  2NUP A;  2L2P A;  1QW1 A;  1K1Z A;  1M1K C;  3FEO A;  4PLI A;  4B9W A;  5KYX A;  1TUG B;  1XJW B;  2RHZ A;  1R0B G;  3FB9 A;  3CPW A;  3GNF B;  2AKK A;  3CCV A;  4M7D D;  2RI2 A;  3I56 Q;  1YN8 A;  2FPD A;  2GF7 A;  3OMG A;  4M7A A;  2CZ1 B;  4J9B A;  5GAO q;  4ANJ A;  1Q82 C;  3CCM Q;  3JCM h;  2D9T A;  2EGC A;  4ZGE B;  2KBT A;  4DBR A;  3N5B B;  3P8B B;  2EGE A;  2CRE A;  2JTM A;  4IUV A;  1YHQ Q;  2QG9 B;  3P8D A;  5CKB A;  1TWB A;  2RQW A;  4JPB W;  2X4Y A;  4M77 B;  3KBG A;  1G8X A;  5DM7 R;  5GAN 6;  1VQ4 T;  3MPU B;  3L2V A;  4EDU A;  3E19 A;  4J9G A;  1M9S A;  5LL6 S;  5I22 A;  1I5O B;  2KT8 A;  1ZA2 B;  4BB7 A;  2Y90 A;  1D1B A;  3LGF A;  2K79 A;  4A4K A;  2DXT A;  4F7U A;  1MMG A;  4HCZ A;  2M9U A;  2FHD A;  5I21 A;  4GY5 A;  5GMK l;  3OYL A;  1ZHI A;  2A28 A;  2QK0 A;  4PJO D;  1VQK A;  2MIO A;  2A36 A;  1ZSZ C;  2J6O A;  2HNI A;  5GMK e;  1PNJ A;  2RB6 A;  2L3R A;  1FX7 A;  3CCM A;  3HRU A;  3OB9 A;  2R5M A;  2DD5 A;  1F1B B;  1R8O B;  3QBY A;  4JLI A;  1IRE B;  4PJM A;  2KDS A;  5KYX B;  3V8L A;  1O9S A;  3AT1 B;  2VUB A;  1U3O A;  4RKU E;  3CMA Q;  1AOJ A;  5KYY A;  5AYF A;  2QEX T;  4D8K A;  3M0T A;  2LT4 A;  3CCS A;  3HSB A;  4DQ2 A;  4QQG A;  3NFC A;  1B3Q A;  3CC4 T;  2DL4 A;  4PNO A;  2DA9 A;  2OAW A;  2E10 A;  1ZX6 A;  1BYM A;  3A98 A;  3M56 A;  4MZT A;  4N4G A;  3H6Z A;  2VVK A;  4OMQ A;  1M4Z A;  2VYT A;  2Z0W A;  2X3X D;  2EKO A;  2VAS A;  1BB9 A;  1QMC A;  5FRM A;  3EH2 A;  4CI0 C;  2DK3 A;  3OSS C;  4RTV A;  4KBM B;  1OU9 A;  1HJD A;  3LH5 A;  3URG A;  3G4S Q;  2CUD A;  5CR2 A;  1WA7 A;  2DE0 X;  1G3T A;  3CPF A;  3QDR B;  4FW1 A;  3QKJ A;  3S6W A;  2NUT B;  2RF0 A;  1Y0M A;  3OYH A;  1KQ1 A;  1OPL A;  4WCI A;  1GFD A;  1AWX A;  1Q7Y R;  4PJO A;  1Z9Q A;  2OTL A;  3HPW A;  5CKF A;  1HYO A;  3QHS A;  4YTL A;  4HXJ A;  5FRN A;  2FZK B;  1KC8 C;  4PK4 A;  3CC2 Q;  2K3B A;  4J6X A;  4MDW A;  2CZ7 B;  4PLL A;  3LWH A;  1BK2 A;  3MEU A;  5IXB A;  3QG1 A;  2DBK A;  5FRO A;  1QVF A;  5GJW B;  5KYU A;  3QUI A;  1G3Y A;  2O4X A;  3KXT A;  1VQO A;  2P0P A;  4XU1 A;  4EMK A;  4X1V A;  3A1P A;  3S3O A;  5GAM e;  2QA4 A;  2CUB A;  2BUD A;  2DXU A;  1X2Q A;  3OW2 S;  1M3B A;  2DKG A;  2NUZ A;  3PVQ A;  4M7A C;  2MYS A;  2HSE B;  1N6A A;  4C92 B;  1H64 1;  2LZ6 B;  3RKX A;  3GPL A;  2V8J A;  2JZ2 A;  1C6V X;  1BKB A;  4M75 E;  4AFS C;  4IKF A;  4J6W A;  1M27 C;  3OYC A;  1PKS A;  1WGS A;  4FL6 A;  4E7H A;  3LX7 A;  3MEA A;  4LE9 A;  2P4T A;  2MWO A;  1VQL T;  4RG2 A;  2JM9 A;  4FYX B;  2RHX A;  2LJ3 A;  1JBM A;  4WTO B;  2RHU A;  4C5H A;  1I07 A;  1ZBX A;  1LCK A;  3FLG A;  1BIB A;  2L3P A;  3EG0 A;  3CC4 Q;  2BZY A;  1XNI A;  3X24 B;  1X01 A;  3CCL A;  3I56 T;  3TCJ A;  3G6E T;  1M8M A;  2X51 A;  4KGV B;  4II1 A;  3ULR B;  2EYX A;  4C0D B;  3QWX X;  2QAS A;  1RI0 A;  5FU7 C;  2LNV A;  3ZFJ A;  2ED1 A;  3HRT A;  3M5A A;  4JZ4 A;  3LWI A;  1ZUK A;  3CCJ T;  4J9E A;  1M3A A;  5FWB A;  4D6W A;  2IVW A;  4OGE A;  2RA2 A;  3NTH A;  3EGX B;  4F7U E;  5GAN d;  4UC4 A;  4QVZ A;  4OGC A;  2BZ8 A;  3M4Y A;  5HCK A;  1SSF A;  1PG5 B;  3EG1 A;  1NYF A;  3OS2 A;  3UT1 A;  1ZUY A;  2YLC A;  3OS1 A;  1SRM A;  4CC2 A;  4E7L A;  2A08 A;  3M0U A;  4BI3 A;  5LJ3 d;  1RAF B;  1X6B A;  2E1H A;  1YJ9 Q;  2JVV A;  2M02 A;  3DKM A;  2KMT A;  2MI6 A;  3LH0 A;  4WF2 A;  5I2S A;  3EAE A;  4M77 A;  4O5V A;  2HQX A;  4BD3 A;  4ORZ A;  4M75 F;  4M78 C;  2AZV A;  3CQT A;  4D8D A;  4QVC A;  3RR6 A;  3JCM f;  2HDA A;  1PD1 A;  2ENM A;  3S3N A;  2RJF A;  3MJX A;  5GAO n;  1JU5 C;  4RCB A;  3CCS T;  1D3B B;  3HRS A;  1S72 A;  3QWY A;  1VQ7 Q;  4PJL A;  5GAN 4;  1TS9 A;  4ZTF A;  2LX9 A;  2C0T A;  4LDW A;  4F7U F;  2PZ1 A;  1N9S A;  2CP5 A;  1WFW A;  4XU0 A;  3CCS Q;  2KGT A;  2HBW A;  4C8Q E;  3QYG B;  1EIF A;  1WYX A;  2ZPG B;  2F69 A;  3UWN A;  4EPC A;  2JTE A;  1UFF A;  4OVA A;  2LQK A;  1TSF A;  2JS2 A;  3MO8 A;  2OTJ Q;  2PUK B;  1KD1 U;  2NUP B;  1PCX A;  3JB9 H;  2ZPE B;  4Z02 A;  1TU0 B;  2J06 A;  4JJC A;  2O01 E;  4M4Z A;  4AT1 B;  2SEM A;  1UB4 A;  1C1A A;  2YUN A;  1UGS B;  1YI2 T;  4DEY A;  4M7D G;  4QQ6 A;  1QLY A;  5HK0 A;  5GMK m;  6AT1 B;  1CKA A;  1UJY A;  2PU9 B;  1Q81 C;  1YIT Q;  1K9M U;  2PVO B;  4MMK A;  5CQX A;  1G5V A;  4PJO C;  3JCM d;  4FYV B;  3BDL A;  4IUT A;  2IPO B;  4GLM A;  2LRQ A;  5EG2 A;  3LGL A;  2F2V A;  1JEG A;  1MV3 A;  3PGG A;  2CP0 A;  3OYA A;  1QVP A;  1K73 R;  1Q95 G;  1RAC B;  2L8D A;  3QII A;  5J3B A;  4KUL A;  2EKH A;  3TSW A;  1TUC A;  1OEB A;  3MHX A;  3P8H A;  4F16 A;  3GF5 A;  4BDY A;  3G6E Q;  1I5L A;  1WNL A;  2RI3 A;  4HCC A;  2B86 A;  1I81 A;  2IIM A;  4JJB A;  2C06 A;  3SFM A;  5DY9 A;  4EMH A;  5KYY B;  2IG0 A;  1TXQ A;  4C5G A;  4NL2 A;  1YIJ A;  2FRW A;  5ECA A;  1E6H A;  2RHY A;  1V29 B;  2OTL T;  1SSH A;  1D0Z A;  1D0Y A;  3VUB A;  2CDT A;  4J9C A;  1IO6 A;  5FU7 B;  2OTL Q;  3PIO A;  1GCP A;  2OI3 A;  4C8Q C;  2OTJ A;  3ER0 A;  3LW5 E;  2BKD N;  2K6D A;  4OMM A;  2QTV A;  1CKB A;  5M9O A;  2OAU A;  3R6O A;  3MKD A;  1OU8 A;  5CO7 A;  5HY6 A;  1AEY A;  1D0X A;  3J80 E;  3PIP A;  1QVG A;  4JRK A;  1RAD B;  2G3R A;  2K5L A;  3INZ A;  1Q81 R;  2V8K A;  5GAM j;  2GCX A;  7AT1 B;  4JJN K;  3EG2 A;  2A3L A;  4PJN A;  5IHI A;  1OZ3 A;  2BE9 B;  1P92 A;  4OMF B;  4ZNX A;  8ATC B;  3THK A;  3E9F A;  2EAY A;  2KEA A;  3M54 A;  2QQA A;  1W6X A;  4M75 B;  4C8Q B;  1ZA1 B;  2HD0 A;  3SEM A;  4MZM A;  2C0I A;  4QQD A;  1NLO C;  3JCM X;  4QVD A;  1UG1 A;  1PKT A;  1AWW A;  2FRY A;  4JUV A;  4EIK A;  1I4K 1;  1WJQ A;  1WPY A;  2JTF A;  3MET A;  2YWW A;  4RUG A;  1WIE A;  4CC7 A;  3UPU A;  2HBP A;  1VQ5 T;  3L2U A;  4FIB A;  3CBP A;  4Z88 A;  1KD1 R;  2XDB A;  2LQN A;  5GAO p;  1UHC A;  4N0A A;  2MMP A;  3CCE Q;  2E65 A;  1WLP B;  3OYD A;  2KRO A;  3U23 A;  3TEE A;  3PVL A;  4DOW A;  4F14 A;  3DB3 A;  1KJW A;  1YCY A;  2GTJ A;  4M7D F;  2E3H A;  3OBY A;  4FYY B;  2QQS A;  2KRN A;  4CC4 B;  3EFR A;  5FU6 C;  2AT1 B;  4R0K A;  3CCQ T;  4FT2 A;  2YUQ A;  2K7A A;  2AZS A;  2DJZ A;  2COY A;  3VS4 A;  3CCL Q;  1VQN Q;  1AZG B;  4C8Q D;  1AWO A;  4HCB A;  2ZGW A;  3JV3 A;  2DFU A;  2DL5 A;  3X25 B;  4E7J A;  3C0C A;  2XI9 A;  4M7D C;  3RER A;  4C5E A;  2C0O A;  1Q7Y U;  3SWN B;  1N8R C;  2FZG B;  4Y91 A;  2F5T X;  1W2B S;  3OW2 P;  2HMA A;  3JB9 I;  1LPL A;  3I55 Q;  4KGZ B;  4LDX A;  2JS0 A;  9ATC B;  2EPD A;  4ME7 A;  1N8R U;  5HKC A;  2XG8 D;  1WQW A;  3VKI A;  1XOV A;  3J81 E;  3X20 B;  2QI2 A;  1KK7 A;  2XHC A;  2QEX A;  2DL7 A;  3A8O B;  3M58 A;  3ME9 A;  2SRC A;  3PMT A;  2VGN A;  2G6F X;  5J39 A;  1SRL A;  2KYM A;  5KCH A;  1W1F A;  4Z89 A;  2BE7 D;  1B7T A;  3JCM V;  1KFZ A;  5KYU B;  2DZ9 A;  4ZGJ B;  4RTY A;  1IHV A;  2CSQ A;  4TVR A;  1MMA A;  2YUO A;  1FWZ A;  2FEI A;  3OYK A;  2COZ A;  1N27 A;  3EG9 A;  3SDZ A;  4M78 A;  1VQ6 T;  1G2B A;  4C92 E;  1H8K A;  1PD0 A;  1LVK A;  1EZZ B;  1K9A A;  2VV5 A;  3EFS A;  4BY6 B;  1QKW A;  2VKN A;  2RPN A;  1KQS S;  2KSS A;  3L42 A;  1Q86 C;  2F2X A;  5L8R E;  1MGQ A;  1GCQ A;  4E7I A;  5GAN g;  2Y4X A;  4M78 B;  1QCF A;  2L3S A;  3UF4 A;  3V7C A;  3BDU A;  2J7I A;  3MCA B;  2HQH A;  3BW1 A;  2E41 A;  1RAI B;  5GJV B;  1GBR A;  5LJ5 f;  4F7U G;  4Y28 E;  2ZCF B;  2ZPH B;  1MNE A;  3F70 A;  3NHN A;  4NS5 A;  4M75 D;  1NG2 A;  5IT9 E;  4O6J A;  1QWF A;  5AT1 B;  1Y07 A;  2LCC A;  1WDX A;  3NGP A;  5GAO m;  2D1X A;  3CCV T;  1G3S A;  4BE0 A;  1PC0 A;  2DZC A;  2LP5 A;  4L5G A;  2L89 A;  3JCM e;  4OMO A;  2FG0 A;  4Q5W A;  4KT0 E;  4A53 A;  2DM1 A;  4RTT A;  4ATO A;  1X6G A;  5A0G A;  2K3Y A;  3CC7 A;  5GAO r;  4LUE A;  1SG5 A;  1U06 A;  3MP6 A;  5GAN 3;  1W2B P;  3SWN A;  2LTO A;  4XQ3 A;  3CC4 A;  5FW9 A;  1YI2 A;  3JCM P;  4N0A C;  1PM3 A;  2MF2 A;  4J5Y A;  4M7A F;  3I56 A;  1SEM A;  1RAE B;  2GQI A;  4FYW B;  4KUD K;  1BBZ A;  2MPX C;  3JCM Q;  2LC4 A;  5IHN A;  1GCQ C;  3VJP A;  4LNP A;  4JJD A;  3UDC A;  1YWP A;  3L1A A;  2OJ2 A;  3M0P A;  1VQ9 A;  3I5S A;  1YJN A;  5CCA A;  2RNA A;  1Y96 A;  3OS0 A;  3G4S T;  3QXE B;  1S72 T;  1ARK A;  2RHI A;  5CK9 A;  2JMA A;  1RLP C;  1UUE A;  2EYY A;  2RN8 A;  3L2W A;  4R55 A;  1PSE A;  3H0H A;  1ZSZ B;  3CCR A;  4RMO A;  5GAN j;  4MDX A;  1FMV A;  4IUQ A;  1OYX A;  1HK9 A;  2DXB A;  3ZBD A;  4DEX A;  3G7Z A;  1OX9 A;  1QP2 A;  1VQP Q;  2PNI A;  1JJ2 S;  1KQS P;  3BY7 A;  1PRM C;  4IUP A;  3VS0 A;  1YJW T;  3MEW A;  3TRE A;  1FMK A;  5I2M A;  3NTI A;  3CC7 T;  3L2R A;  4J9H A;  2HQE A;  2JMC A;  2K5I A;  3Q1J A;  1Q81 U;  2M0O A;  4XTW A;  4C0Z A;  1QVF S;  3X28 B;  2JOY A;  4JZ3 A;  2AIR B;  4P5N A;  2I2L A;  1NJI C;  4C8Q A;  4C92 F;  1YNZ A;  1MV0 B;  3G71 A;  3RIR A;  3OSV A;  1CSK A;  3QJ6 A;  5KCO A;  3VS7 A;  2YLB A;  1Q82 U;  1BI0 A;  4HVV A;  1UEB A;  4F04 B;  1DJ7 B;  1D09 B;  2DRM A;  4XTV A;  2EYZ A;  2FL7 A;  4IIO A;  3VRY A;  5KYW B;  5LJ5 e;  3E1S A;  1UHF A;  1KHI A;  1KD1 C;  4A4E A;  3A5Z B;  3EGD A;  2QTX A;  1NE8 A;  1WXB A;  4DA4 A;  2KAF A;  5KYW A;  1M8V A;  1A0N B;  1PRL C;  1RLQ C;  1W4S A;  3CCR Q;  1VQ4 Q;  3ZEH A;  3QDF A;  1NLP C;  2LT1 A;  2LCL A;  1Q7Y C;  1UDL A;  1H3Z A;  2CKK A;  3M0R A;  5LJ5 d;  4M78 E;  1WZO A;  2RQU A;  1SPK A;  2KVQ G;  3REA B;  2KYB A;  1VQL A;  4IIM A;  2PUO B;  4MZP A;  2LX7 A;  2COW A;  5IHK A;  1W2B A;  1D1C A;  4PJO F;  3CCJ Q;  2DXC A;  4OMN A;  1IRX A;  3JB9 F;  1WHH A;  2M0Y A;  2GGR A;  1YJW A;  5KE2 A;  3I55 T;  3G71 Q;  2QXF A;  4J7F A;  2EQU A;  4XTU A;  3IQL A;  1BI3 A;  1V1C A;  3EH1 A;  1J3T A;  4RTU A;  2GFU A;  3EGU A;  1D1A A;  4FT4 A;  3GNG A;  2FPF A;  2ZPF B;  3RNJ A;  5FWC A;  4E7S A;  1OUL A;  3OY9 A;  2KXD A;  1VYT A;  3H0I A;  2DF6 A;  2CH4 A;  3G4S A;  2YXY A;  1VQN T;  3OYE A;  1VQO T;  2XU8 A;  5GMK h;  3HHT B;  5D6W A;  2RQT A;  2DYI A;  1X43 A;  4KUI A;  4ESR A;  3OW2 A;  2JN0 A;  3JB9 J;  1S72 Q;  5D6Y A;  4E7Z A;  2L5Q A;  1NPP A;  4HKE A;  1LOJ A;  1JXM A;  2QGF B;  2GQV A;  1RAG B;  2D8J A;  3GLX A;  2VC8 A;  2RJD A;  4HVW A;  1IZ6 A;  3LLR A;  2KT1 A;  4DBH A;  4N4I A;  5LJ3 e;  5GAN 2;  1IHW A;  1JXO A;  5C6S A;  4M77 E;  2XK0 A;  3JCM W;  3V7S A;  2DER A;  2QYZ A;  1YWO A;  2BZX A;  1K0S A;  3ASK A;  3NTK A;  3DLL A;  1RL2 A;  5KH6 A;  2O4X B;  2DL8 A;  2CZ0 B;  2KI7 A;  4JS5 A;  3H8Z A;  1YBY A;  1W70 A;  2LJ0 A;  1KQ2 A;  3FIF A;  4M7A G;  1VQK Q;  3RKY A;  1I8F A;  2KR3 A;  3PFS A;  3GIB A;  3OYG A;  2A7Y A;  4AFQ C;  3UAT A;  1RAH B;  1K8A R;  2J6F A;  2RQR A;  2BTT A;  5LJ3 h;  1C0M A;  5KYN A;  2QGG A;  1BCO A;  4X9C A;  3RUX A;  4M7A D;  1VYU A;  2RH2 A;  3MP1 A;  2EIF A;  3CC2 T;  1U8R A;  1VQL Q;  3CME Q;  2VWF A;  2JNG A;  2ROT A;  2DJQ A;  3AHU A;  4JRP A;  4CRI A;  2CSI A;  3H0F A;  4XTZ A;  1IB8 A;  3TQ7 P;  3GOX A;  1M90 U;  3M59 A;  1YJN Q;  4ZN1 A;  3S3M A;  1ZUU A;  1U1T A;  4JS4 A;  3L2Q A;  5CQY A;  2JW4 A;  4HT8 A;  1GBQ A;  1OV3 A;  5A2Q E;  3JCM g;  1WX6 A;  2DEU A;  1NPR A;  4JLG A;  3X26 B;  2KY9 A;  1MUZ A;  3CD6 Q;  2RK2 A;  5A0D A;  3NPF A;  4C0G A;  5GAN f;  4AG1 C;  1K8A U;  2CS7 A;  1M1F A;  4QT7 A;  2EVR A;  3HFN A;  4GBQ A;  5I11 A;  4OB2 B;  4NL3 A;  4EMK B;  3GP8 A;  8AT1 B;  1QWE A;  5LJ5 j;  2DTI A;  2ZPB B;  1R77 A;  1AVZ C;  2X4J A;  3WXM B;  4LXC A;  4EMG A;  1QCN A;  4AMC A;  2LVM A;  2EQI A;  1V76 A;  4J7I A;  4J9F A;  2V1Q A;  3QYH B;  2QQB A;  2GTO A;  2YUP A;  2XID A;  1WXT A;  2QA4 T;  3BE3 A;  2R57 A;  2B8A A;  4M77 D;  2RO0 A;  4F7U B;  2WSC E;  2ZAE A;  1EFN A;  4RTX A;  3UA6 A;  2YHT A;  2F1L A;  1YIT T;  4AFZ C;  4E6R A;  1LNX A;  2HKN A;  1TOV A;  2DO3 A;  3OYF A;  1HD3 A;  2MWP A;  2R58 A;  2RD1 A;  2EQJ A;  3JCM c;  4AG2 C;  4C8Q F;  4C92 A;  2V8I A;  2EYQ A;  3O8V A;  2KE9 A;  3LYI A;  2CT3 A;  2NWM A;  3VUZ A;  4XTY A;  1YIJ T;  1HXD A;  2NLU A;  2E6Z A;  2I0N A;  3A8L B;  2DTH A;  1Z9Z A;  4J9I A;  1T3S A;  3QPH A;  3SD4 A;  5IN1 A;  3CCL T;  2X4W A;  1K4U S;  2LMJ A;  3EGX A;  1BIA A;  3EFO A;  3G71 T;  5FLX E;  2DL3 A;  4L59 A;  1WI7 A;  4BE2 A;  1K73 C;  3M4G A;  1AZE A;  4RG8 A;  4LUD A;  5CKD A;  5GAN 5;  1JJ2 P;  3D7S B;  4M75 G;  1NM7 A;  1X27 A;  3WVE B;  3EG3 A;  4M7A E;  2DBM A;  3CCE T;  2EYW A;  2JT4 A;  1UGQ B;  1KIK A;  2HAX A;  1AD5 A;  4MML A;  3HFO A;  1TUD A;  1MMD A;  1H3H A;  3NMZ C;  1X69 A;  4BAC A;  1WHM A;  3DB4 A;  5GAN h;  1I0C A;  3CXC S;  4IUR A;  4XK8 E;  1T3L A;  4E2F B;  3CCR T;  1PWT A;  3MEV A;  1YJ9 T;  1NBE B;  2DD4 A;  3EGD B;  4ZTJ A;  4PJO E;  4OML A;  2E12 A;  1OI1 A;  1KHC A;  4C92 C;  1NZ9 A;  2O9V A;  1VOM A;  2RI5 A;  4C0D C;  3CCU T;  2DIQ A;  4PFZ A;  2LJ1 A;  1M1G A;  4RTW A;  2LQW A;  3O5Z A;  1KG1 A;  1AT1 B;  2LDM A;  2X35 A;  4FSS A;  2DVJ A;  2RK1 A;  1IXD A;  4ZN3 A;  3C4S A;  2KRS A;  1JO8 A;  3CPW P;  3VS6 A;  4C0F A;  4ELZ C;  5A0L A;  1K76 A;  4M7A B;  1U1S A;  2EFI A;  5GAM g;  2DAQ A;  3M9Q A;  3OYJ A;  1YP5 A;  3DLM A;  1VQM A;  3RDV A;  3CMA A;  5GAN 8;  1XQH A;  2P4R A;  3QZ5 B;  2O31 A;  2QDL A;  3M0Q A;  2Y4Y A;  1QQJ A;  3OYY A;  3QSU A;  4HCK A;  4J6Y A;  5LJ3 j;  4M7D B;  2CYZ B;  5CIU A;  2ROL A;  2F2W A;  2HL3 A;  2YSQ A;  2K2V A;  2W10 A;  1ZSG A;  5DLO A;  4A4F A;  5CAI A;  4PJO B;  5IAY A;  1Y7X A;  2EW3 A;  2JUF A;  2X3W D;  2K4Y A;  1VIF A;  1VUB A;  4OB3 B;  2EBP A;  2EJG A;  1XTD A;  1NJI R;  2DVE A;  5D7U A;  3FRN A;  2A0F B;  3V8J A;  1LJO A;  2PQW A;  4K11 A;  4V2S A;  1M1K U;  4CC3 A;  2JM8 A;  2XKO C;  2KK4 A;  2HSP A;  1M2O A;  1QCO A;  2R5A A;  4N4H A;  3J7A F;  1KSW A;  4LD9 K;  1VQP A;  1M2V B;  1M5Q 1;  2RJC A;  2KXC A;  1GXI E;  2DX1 A;  2H3J A;  1FMW A;  3VYH B;  2P0Q A;  2DPP B;  2ESW A;  5LJ5 g;  4LD6 A;  4HVU A;  4BI4 A;  2E70 A;  3SWN C;  2AHJ B;  4KH0 B;  2YDL A;  5HK3 A;  4L6V 5;  2V26 A;  4M77 C;  2OTJ T;  2E5K A; 
#chains in the Genus database with same CATH homology
 2M02 A;  1WHM A;  2Z0W A;  2HQH A;  2E3I A;  1LPL A;  2CP3 A;  3TQ7 P;  2HL3 A;  3E2U A;  2COY A;  1WHG A;  2QK0 A;  2CP7 A;  4B6M A;  1WHL A;  2CP5 A;  2CP6 A;  2E4H A;  2COW A;  1WHJ A;  2HKN A;  1TOV A;  2CP0 A;  1TXQ A;  2CP2 A;  3RDV A;  1WHK A;  2HL5 C;  2E3H A;  2MPX C;  1IXD A;  1WHH A;  2COZ A;  2HKQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...