2HKNA

Crystal structure of the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
76
Chain Sequence
b'SHMSPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 10
structure length 76
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hknA00
1IXDA 2COYA 2E3IA 1TOVA 2CP5A 2HQHA 1WHLA 1WHHA 1WHMA 2COWA 1WHGA 2E3HA 1WHJA 3RDVA 2M02A 2CP6A 2QK0A 1TXQA 4B6MA 2HL5C 1LPLA 1WHKA 2MPXC 2Z0WA 2CP7A 2E4HA 2HKNA 2CP3A 3E2UA 2CP2A 2COZA 2HKQB 2HL3A 2CP0A 3TQ7P
chains in the Genus database with same CATH superfamily
4RCBA 1SRMA 2GGRA 4JS4A 2DD5A 4N0AC 1UEBA 1PCXA 3L2RA 3MP8A 5GMKm 1JJ2P 3EGXB 1ZUKA 5KYWA 3M58A 1TUDA 1J3TA 4LDUA 1ZQ1A 2SEMA 4OVAA 3RERA 2D6FA 2DYBA 3VS4A 2OTLQ 3G4ST 3P8DA 4M7AF 1WI7A 3HTRA 1B34B 2LJ1A 3HKSA 1AWWA 3CCST 2GCXA 2BZXA 5CO7A 2VXEA 4GY5A 3LGLA 5CKFA 1BYMA 3VKIA 1YI2A 2DFUA 2O4XA 3QO3A 3M5AA 1SG5A 2KRMA 4PJMA 2GFUA 4J9GA 2DO3A 3V8LA 4QQDA 1VQ8A 4XQ3A 1WXTA 2XDDA 1RAAB 3PVQA 3FDRA 2DNUA 4OMNA 2HBPA 4IKFA 3ME9A 4PL6A 1KD1R 1N8RC 1CKAA 5GMKj 3VYHB 3V7CA 2HDAA 3GNFB 2JOYA 1KG1A 4ZN1A 4PJOA 1Q81R 4KGVB 2JMAA 2B8AA 1N9RA 1TWBA 1T0JA 5GAMe 2P84A 2K79A 3NFCA 2X51A 1YI2Q 2DTIA 4M75C 5CQYA 2FL7A 3FC3A 4M77B 3CCJA 5GANg 1VQ8Q 2RJCA 1O9SA 1B34A 2YLBA 3N5BB 2CH4W 3I55A 4FU6A 1TUCA 4ELZC 4ATOA 2KE9A 2DZ9A 2DE0X 3OBWA 1C1AA 1NG2A 4PLLA 5KE2A 4DBFA 3J7AF 2MWOA 2O9SA 4M78D 3JB9G 5GAOn 2O2OA 4TVRA 2V8IA 2KNBB 2F2WA 1I07A 1EFNA 2A28A 2WSEE 1D0ZA 2PU9B 5LJ5j 3OYGA 3HPWA 4J8OA 1K9MC 1K0XA 4M75F 2DKGA 2JS0A 1AZEA 5GANf 1M2VB 3CCJQ 1YJNA 4EMKB 3I55Q 2EGCA 2MWPA 2SRCA 3VYGA 3JCMg 3HHTB 5DLQE 2COZA 4ZGJB 5GAOp 2HKQB 2YLCA 5D6XA 1M30A 4C5EA 2LT1A 1Q86C 1YJWA 5KYUA 3J81E 1QVPA 1ARKA 5DLOA 1M3CA 5EC7A 1K9AA 5C6SA 1Q7YR 3ZL7C 3Q1JA 2KXDA 4WTOB 2ED0A 5CIUA 3UF4A 4A4FA 4E7KA 2BTTA 1QCNA 3WVEB 1E7OA 2E5KA 4NL3A 3I9QA 1Q81U 1YCSB 2H8HA 2YXYA 2XK0A 3NTIA 4F04B 4FYWB 1PSFA 5GANh 2NUTA 4ME7A 1ZX6A 1GCPA 1X2KA 1KK7A 3CCJT 3HRTA 3QBYA 4EDUA 3I55T 3SWNC 1RABB 4RTYA 3CPWS 1WX6A 4CC2A 4M7AB 4HCKA 1JXOA 4E6RA 4DOVA 2NUPB 1IRXA 3OQ5A 4MZMA 3CPWA 3QDFA 1QKWA 3M57A 3NMZC 4NS5A 2KVQG 1N27A 1RADB 2CZ1B 2DA9A 4B9XA 3CPWP 2W0ZA 3GLXA 2EPDA 3CMAA 3RNJA 4E7IA 3CCMA 3GBQA 4EPCA 4XU0A 1IO6A 4M7DA 2EQKA 3CCLA 2M16A 1O75A 1OEBA 4M75D 1YHQA 1NJIR 1PHTA 2CP3A 3MEVA 2RF0A 1UG1A 2BIVA 5FROA 2E65A 2YRCA 2YUQA 2O01E 1ZBXA 3G1JA 4Y91A 5GAN4 5A2QE 1M1FA 2JMCA 2K4YA 2RI3A 1PRLC 3CCQA 2ZZDA 1NLPC 4M7DE 2FPEA 1PD0A 1Y7XA 2RNAA 5A0LA 1R8OB 1HYOA 1OV3A 1Y96B 4HKEA 2EVRA 2QGFB 3CMAQ 1UGQB 4QQ6A 4J9EA 3CCMQ 3A98A 2NUZA 3O5ZA 5LJ3g 1X43A 3TEEA 4KRTA 5IXFA 3CCLQ 4KULA 4LD9K 1RAFB 2OX7A 7AT1B 2JW4A 4LNPA 1YHQQ 4LXCA 1WGSA 4CC3A 4M78G 5FU6B 1GRIA 2HAXA 2RM4A 2DD4A 4RG8A 4HCCA 1LVKA 5IT9E 1QVGS 1TTHB 3QWYA 2DTOA 3CCQQ 3RKXA 4CC4B 4ZN3A 2LNHB 3L1AA 1VQLQ 1AHJB 4EMHA 1W2BS 1X2QA 3OW2S 1X6GA 3VV0A 2F2VA 4JJDA 2EJGA 2RMOA 1PSEA 2LRQA 2DAQA 5GMKe 1ZA2B 1QVGA 1B7TA 1UGRB 1XOVA 2K5IA 4M7AG 1OYXA 3CMAT 2AT1B 3UDCA 1W2BA 3OW2A 2YRDA 1BKBA 3CCMT 5GAOr 2QYZA 1QMCA 1QVGP 4PK4A 2RI5A 3H9NA 4PJOC 3VU3C 1E6GA 3REBB 4BD3A 1K73C 1QWFA 1Y96A 2K5LA 4Y92A 3CCLT 1W2BP 2DEQA 3OW2P 2YUOA 3NPFA 3NTKA 2HEQA 2HKNA 3JB9F 1NJIU 4IUUA 1FMWA 2CP0A 1QW1A 1WQWA 3RESA 4LDYA 2LVMA 2X3XD 1IHWA 3CCQT 4C92A 1VQLT 1QP3A 3A1PA 2DYIA 2KY9A 1U8RA 1GCQC 5J26A 2D0QB 2X3WD 5GAMd 4PJOF 2VC8A 3QYGB 4O6JA 2RJEA 1VYUA 2QA4A 4C92E 5LJ5e 1JU5C 4RMOA 3FIFA 4J9HA 2BE7D 4PJNA 4BDZA 1UGPB 4FL6A 4RTVA 2MPXC 5FWBA 3OY9A 2Y4XA 3RMSA 3H0FA 1D09B 4AFUC 1KC8R 1M1KU 4JLIA 1K8AC 4J83A 4D8DA 2MF2A 3J80E 1VQOT 3OSSC 2C0OA 2GQVA 1GXIE 2B86A 4P5NA 4X9DA 2RPNA 2RO0A 4M4ZA 1M5Q1 3SWNB 4HA8A 4J7FA 2DL7A 4ZGEB 4LN2A 4DBQA 4M75G 2QA4Q 1N6AA 4PFPA 3UPUA 3EH1A 2DTHA 4C0ZA 1BI0A 2J7IA 4IUVA 1R77A 3H0HA 2E41A 2FZCB 2KT8A 3M53A 3CC4A 4J9CA 3CCEQ 1G5VA 4D8KA 1AVZC 2BUDA 2EKHA 3QG1A 3EG9A 2A36A 3ASKA 2VGMA 2AZSA 2KAFA 2LQWA 3VRZA 4E7ZA 2FVUA 1ZA1B 4JDSA 1WHGA 2MI6A 3SD4A 2LQKA 4L5GA 4AFZC 5FWCA 1WYXA 1XJWB 3JSCA 2LQ8A 4F7UA 2EBPA 3QDRB 1QKXA 3CC7T 2V1RA 2QA4T 2KR3A 2ABLA 3CC4Q 4KT0E 3PIOA 3VS7A 4LE9A 2KEAA 1QCOA 5I22A 1AOJA 1FWZA 4F7UE 3CCET 1UGVA 2FG0A 1U3OA 2AIRB 3RKYA 4PJOD 1P92A 1G3YA 2YWWA 2DM1A 2EKOA 3CC2A 1VUBA 2ZPIB 3X26B 3M59A 1X6BA 3QXEB 1WPYA 1N8RR 1FXXA 1KC8U 2ZGWA 3MO8A 3PT9A 4N4HA 5CKBA 4DQ2A 3GPLA 4J5YA 3BFMA 4VUBA 1WJRA 2Y90A 4BUGA 4B6MA 3L2VA 4E2FB 1V1CA 2D8HA 5CR2A 2K6DA 2KYBA 4M78F 3A8GB 3M4GA 4HVWA 1UB4A 4FW2A 4PFZA 3VS2A 1EZZB 2OTJA 3CC4T 4BY6B 1OQKA 3CD6A 4II1A 2JXBA 4LD6A 3JCMX 2JM8A 1M2OA 3QKJA 5FU7B 2L3SA 3CC2Q 2EAYA 4C8QC 2C0IA 2Y4YA 2R58A 3GOXA 4RKUE 1QCFA 2RHYA 1IGQA 4JS5A 1MMAA 3M0PA 2R5AA 3CQTA 4JRKA 2J06A 3TSZA 3R6OA 5IAYA 2DBMA 1RI9A 9ATCB 2NYSA 1JXMA 1FMKA 2C06A 3TREA 3L2WA 4JRPA 3EHRA 2E3HA 3QYHB 3CBOA 3NGPA 4BE0A 2LTOA 3OMCA 5FRNA 3H8ZA 1AWXA 4XU2A 4DBRA 2OTJQ 1ZBJA 3M0QA 1VQMA 1A0NB 1RAEB 3CD6Q 1NE8A 3PNWC 2LX9A 4FSSA 2JT4A 2E6NA 1M90C 2XMFA 4J6WA 2RJFA 4C8QF 3EGDB 2A37A 3FRNA 1BBZA 1N5ZA 2DX1A 2LJ3A 2YRVA 1PM3A 3CC2T 5HK0A 2DXTA 4V2SA 2EGAA 1Q86R 2J05A 3G71Q 2LCCA 1RLQC 3BDLA 2P0QA 2VKNA 3TSWA 5LL6S 4XTXA 3M56A 1N8RU 3EGXA 2XU8A 4GBQA 2E5QA 1WHMA 2DRKA 1UHCA 2FRWA 2LCLA 1ABOA 3L42A 1PRMC 4C5IA 3JCMQ 2RA2A 1VQMQ 2L3PA 1SSHA 3EG2A 1AT1B 4C92C 4EIKA 5HCKA 1SSFA 2LX7A 1M3AA 3VUZA 3I56A 2OTJT 1YJ9T 3CCVA 1PWTA 3DKMA 3CD6T 4PLIA 2QQRA 2NLUA 5CKHA 5GAN8 4JZ4A 2QQBA 2CS7A 1YIJA 1KSWA 1EIFA 1VYTA 4XTVA 1I81A 2X4WA 2D0NA 2ZPEB 1I4K1 4A4GA 1R0BG 2EJFA 2VV5A 2HD0A 3G71T 4LUDA 2W10A 3E9FA 1Q82C 2DVEA 3EG0A 2C0TA 1ZSGA 2NWMA 2PVOB 3MEAA 4M7DD 2PTKA 1WHJA 1FYNA 4Z8AA 2MYSA 2QI2A 4KGZB 2M0OA 4LDXA 2EQUA 2RH2A 5CQXA 1VQ7T 3I56Q 4LUEA 2X4YA 3CCVQ 2DMOA 1VQMT 2V26A 3LLRA 4PJOG 1K9MU 2RK1A 3CBPA 2JVVA 5DM7R 2X4XA 1VQNA 1BIBA 1NZ9A 5LJ5d 3C95A 5GAMg 2IVWA 1YIJQ 3C0CA 4M77A 4BB7A 2KXCA 1G83A 2L0AA 1KIKA 4E7JA 4OMQA 4MMLA 3VRYA 2VASA 3FLGA 1BB9A 3M0SA 4Q5WA 1KD1C 4JRQA 1Q95G 1YN8A 1Q86U 2PQWA 4M78B 4C8QD 3HP9A 1UHFA 2G6FX 3TVTA 3CCRA 1H3HA 2WACA 4M77E 2F69A 2KYMA 4E7LA 1VQ9Q 2M02A 1X6OA 3JCMf 3SB2A 1U06A 1ZHIA 2ZPFB 4QKUA 1S72Q 1WJQA 1W6XA 2L2PA 3I56T 1HJDA 1VQNQ 3CCVT 3KBGA 4KH0B 2CP2A 2HCKA 1X75C 3H6ZA 3MHXA 1JRIA 2AK5A 4X34A 1M4ZA 1M2VA 4JJNK 3HSBA 2KGTA 1YIJT 4HT8A 5ECAA 3DB4A 1U5SA 4EMKA 3L2ZA 5AT1B 2RHZA 2XDBA 1ZSZC 4JPBW 1IGUA 3JV3A 3R6NA 3PMIA 2CZ7B 1OPLA 3CCRQ 2KMTA 3T9NA 2A08A 1H641 1YFNA 4A4KA 4L59A 4ZTJA 3UA6A 1OU8A 1RI0A 3JCMh 3BY7A 3OS5A 4E7HA 3OYFA 1VQ9T 4B9WA 1RUWA 1K0SA 1S72T 3FJ5A 5KYXB 4NOYA 5GAN6 1VQNT 4BI4A 1D3BB 1OULA 4F17A 1OX8A 3INZA 4C92D 1K73R 2E64A 2LJ0A 3EFOB 2QASA 5CCAA 3HFNA 4XU3A 1KJWA 2RK2A 3E1SA 1OZ3A 4A54A 3A5ZB 4FCYA 5HK3A 5HY6A 3JB9H 2DRMA 1D1AA 2ZCFB 1VQLA 2QQAA 4J9FA 4M78E 2YT6A 1Q7YC 1RACB 1JEGA 4BACA 1OX9A 4M7AA 3M9QA 1MGQA 3CCRT 1WZOA 2NUPA 3PIPA 2XHCA 4DEXA 2K3XA 5FLXE 2M0YA 2HBWA 4F16A 4KUDK 3OB9A 1U1TA 1QP2A 3EFSA 4OMMA 1IZ6A 1WHKA 3QHSA 1H8KA 2A7YA 1RAIB 4N0AA 2HQXA 4M7AE 2CZ6B 1M1KR 2EWNA 1VQKT 4RTXA 3WVDB 4PNOA 4M75B 5CAIA 3JAME 4A4HA 1VQOA 2O9VA 5GANj 2AZVA 3S3NA 1TXQA 3CBMA 2K9GA 2LQNA 2FZGB 1K8AR 2J6KA 4J9IA 1NYGA 4O5VA 5J39A 5LJ3f 4GLMA 1FX7A 1XQHA 2XDPA 3C94A 1I1JA 4LDWA 3EG3A 4MDXA 5GJWB 1AEYA 4FYYB 5GAOl 1UJ0A 4XAXB 4BI8B 2QAZA 1KQSA 2RQUA 5GANd 3OYYA 2HNIA 4C5GA 1Z9ZA 5GAOq 3OS1A 1RLPC 2L89A 4OB0B 2OAWA 4CI0C 2VB6A 2JTFA 1KQSP 1V76A 3E2UA 3LW5E 2P0KA 4C8QG 1VQOQ 1K73U 4KH1B 1UUEA 3GP8A 1B3QA 4X9CA 1TS9A 1BIAA 1K4US 2DBKA 1VOMA 2HSEB 1D1BA 2MAMA 2F2XA 2P0PA 1TSFA 5LJ3h 4JJCA 3OS2A 2K3YA 2VXFA 2MIOA 2X4JA 2E3IA 2MMPA 3CC7A 3CCUT 3QWXX 2FEIA 2V8JA 3RIRA 2CREA 2RQVA 1D0YA 3MEWA 3QPHA 1YP5A 2FB7A 2QGGA 4BE1A 2EQIA 2M1HA 4F14A 5FRMA 2JTMA 3CCEA 2KDSA 4M75E 4HVVA 2ED1A 4N4IA 1U1SA 3SDZA 1JBMA 5GAN7 1F1BB 1ZLMA 5KCHA 3OYNA 2JN0A 4PJJA 2JTEA 2RQTA 1VQ5T 2CT3A 1YNZA 3LX7A 4Z88A 5KCOA 3PGGA 2XI9A 1VIFA 2K5FA 2J6OA 3EG1A 4M77C 3HRSA 2EYXA 3V7RA 1K8AU 3M55A 3M4YA 4XTUA 3CC7Q 1S1NA 2HQEA 4BDYA 1MHNA 1G3SA 2QTXA 2BZ8A 4N4GA 2XG8D 1DJ7B 2F5TX 4C92G 1LCKA 2H3EB 1PNJA 3DLLA 2CGHA 1NLOC 1NEGA 3MKDA 1X01A 2HSPA 4DOWA 4OP0A 4IUPA 1W70A 1G3WA 3V8JA 1SPKA 1NBEB 3OYLA 4JRIA 2X35A 3KFVA 1W4SA 1VIEA 3A8OB 4QVZA 2CP5A 5LJ5g 1WXBA 2ATCB 1I8FA 1KHCA 3RMQA 2CT4A 5GMKl 2KROA 1BU1A 4OB1B 3CMET 4IIMA 4EMKC 5D7UA 3TU4K 1ZUYA 2HL3A 2K7AA 4CRIA 5IN1A 4AMCA 3SWNA 2GBQA 1T0HA 2ENMA 5GMKi 2D9TA 4J9DA 2FYKA 1YWPA 5EG2A 3X28B 2LDMA 2RB6A 2RQWA 1M90R 5KYWB 2CP7A 1AZGB 2CUBA 3C4SA 3S6WA 3V8KA 4LDVA 3QUIA 3EGUA 1UDLA 5LJ3j 1WXUA 4M7DC 2JNGA 3MP6A 4HVUA 1MMDA 1XTDA 4QQGA 1AWJA 1R0CB 2DL4A 3EH2A 3JCMW 1TUGB 3O8VA 8ATCB 5CVIA 4RTWA 3S3MA 2DL5A 1VQ4A 1LJOA 1ABQA 3THKA 2OJ2A 2RHIA 2M9UA 2VVKA 3SHWA 2D1XA 2O4XB 4RTTA 3OYEA 2M51A 1HK9A 3G7ZA 3QJ6A 4MDWA 4X1VA 1BCMA 3SEMA 1YJ9A 2PUKB 3WXMB 2RHUA 4HXJA 4E7SA 3GIBA 4F7UG 5I2MA 2XICA 4E47A 4M7DF 3KXTA 3A8HB 4KUIA 2IIMA 3C12A 2XIDA 4OGCA 4PJOB 1HXDA 4K11A 4RCCA 3G71A 2HQHA 2LP5A 1VQPA 2EIFA 1SF9A 1VQ4Q 4OMPA 4BI3A 1GFDA 1HD3A 4QVDA 2O88A 1PKTA 4RTZA 3RBBB 3QJYA 2JUFA 1CSKA 5GANe 4FW1A 3FJPA 1Q82R 4QT7A 1K9MR 5DY9A 2YDLA 2EQMA 3LWIA 1VQ7A 2DK3A 4C0DC 4D6WA 1YJ9Q 3FB9A 2IPOB 3GNGA 2QDLA 3F70A 4R56A 2LT4A 2V1QA 4M77D 1C0MA 4C0GA 1BI2A 1K1ZA 2RN8A 2RJDA 3JCMP 2KRNA 3QIIA 3IQLA 1G2BA 3OA6A 3VJPA 3MEUA 2FRYA 3MP1A 3BE3A 2PUOB 3CPFA 3OSVA 2XD0A 4OMOA 1M90U 2YUPA 1YBYA 3MJXA 1VQPQ 4XK8E 3OMGA 2MOXA 1Y57A 4OMLA 2AKLA 1G3TA 1UE9A 4A4EA 4OMFB 3ZFJA 1VQ4T 5HKCA 2QDYB 2PNIA 2MCNA 2FZKB 1VQ7Q 1LOJA 3X25B 4OB2B 3JCMe 2I2LA 1WIEA 5FU6C 4J6XA 2OTLT 4RTUA 2CUDA 2EW3A 1QVFS 1WLPB 1MNEA 1WHLA 5KYUB 1AWOA 3X20B 2DXBA 3EAEA 3VS0A 2RHXA 2KQWA 2E4HA 4PJOE 3DB3A 1W1FA 3OYCA 1QVFA 2LC4A 4FSXA 1VQPT 3EGDA 5CKDA 3H0IA 4KGXB 1GCQA 1MNDA 2G3RA 3V7SA 1QVFP 5AYFA 2NUTB 4C92F 5I21A 2HL5C 2LNVA 3M0RA 1I5OB 1VQ9A 1Q82U 2QG9B 1UJYA 1S72A 4PJLA 1GL5A 3LWHA 5M9OA 2IG0A 3H41A 4YTLA 4AFSC 2WSFE 3JB9I 1M8MA 1YI2T 1JO8A 2EYQA 1NPRA 4ANJA 3G6EA 3X24B 2BKDN 2CP6A 4JJBA 2DLPA 1CKBA 4XTYA 2ROLA 2FPFA 2K57A 2ROTA 4M7AD 1VQ8T 1G8XA 1M9SA 4L6V5 4ORZA 3RR6A 2E6ZA 2R57A 2ESWA 4RUGA 1UGSB 5J3BA 2K2VA 2X9HA 3QZ5B 1Q81C 2DPPB 2L8DA 1WHHA 3OYJA 1OU9A 2JJ9A 2DXUA 2DXCA 2CH4A 1MV3A 3UA7A 1KD1U 1GFCA 3REAB 2KSSA 1MMGA 2CZ0B 1Z9QA 1M8VA 1BI1A 2Z0WA 3I5SA 3MPUB 2DIGA 5GAMf 4PKCC 4ELYC 4M7DB 1D0XA 2DL3A 3HFOA 4J6YA 2LCSA 3MCAB 2EYYA 2O31A 2MK5A 1H92A 4A53A 4FT4A 3EFRA 2JM9A 2DEUA 1YJNQ 3G6EQ 2DETA 3S3OA 3A8LB 1VQKA 1NPPA 1AD5A 4ESRA 2YSQA 2GNCA 4QVCA 1QWEA 1TG0A 2GF7A 2F1LA 5IHNA 4J7IA 3VS3A 1YJWQ 2DZCA 5CKEA 4Z02A 4AG2C 2E12A 1VQ6A 4AT1B 3OBYA 5LJ3e 4M77G 5KYNA 3GF5A 1MMNA 3L2UA 1GBQA 2GTOA 4C8QB 3UATA 4WF2A 2LMJA 3CEYA 5GAMh 1PKSA 3P8HA 4M78A 4F7UF 2DL8A 1KQ2A 4C5HA 1XNIA 3CXCS 2CKKA 2YHTA 3RUXA 2J6FA 1VQKQ 2DJZA 1UFFA 1YJNT 3G6ET 3ULRB 5CK9A 1X27A 4JZ3A 3JCMJ 2QK0A 2DJQA 2JZ2A 2GQIA 4MMKA 1Y0MA 3CXCA 4C0DB 5GAN2 1VQ6Q 1MV0B 1ACMB 3M54A 1YJWT 4JUVA 3JCMV 3CXCP 4XTZA 3JB9J 2DVJA 1GBRA 5A0DA 2ZAEA 2KI7A 4OB3B 4A63B 2DIQA 2A3LA 3RDVA 3CCUA 4QW2A 1Q7YU 4JLGA 2EGEA 3PTAA 1OZ2A 2ZPBB 5A0GA 2ZPHB 3EHQA 3AT1B 2VYTA 2AKKA 2FHDA 3D7SB 1QLYA 1QQJA 2V8KA 3LH5A 4Y28E 3RKWA 4C8QA 5KH6A 1M27C 1OI1A 3PMTA 2RD1A 2QTVA 5KE3A 3LYIA 1NEBA 2E1HA 3E19A 1TU0B 2FO0A 5I2SA 3OS0A 1BCOA 4C92B 2ECZA 2VGNA 5KYXA 4M7DG 1VQ5A 3PE0A 3VS6A 5IH2A 1D3BA 5D6YA 1VYVA 4FIBA 1KQSS 3UT1A 3NHNA 3EFOA 2E70A 1VQ6T 3JCMc 2P4RA 2QQ9A 1PD1A 2COYA 4C8QE 1LNXA 3CCUQ 3E9GA 3OYAA 3U23A 4MZPA 2L5QA 1WJSA 4CC7A 1M1GA 3OYDA 4BY6C 1TH7A 3HL8A 1WQ7A 5FU7C 4IURA 2EYZA 2PVGB 4ZTFA 4WCIA 3I5RA 1YITA 1I5LA 1I0CA 2F5KA 2K2MA 3LH0A 4RG2A 1NJIC 2EYWA 1D1CA 3OYMA 1BI3A 2PZ1A 4HCZA 5GAN5 1WDXA 1VQ5Q 3M0UA 2E10A 2CSQA 4DA4A 4NL2A 2RQRA 3OYIA 1YHQT 2YUNA 5IHKA 3VS5A 3OYKA 3HRUA 3NTHA 3VS1A 5GAMj 1JQQA 3CMEA 4AG1C 4M75A 4DEYA 5KYYB 1UTIA 1IXDA 1B07A 5L8RE 1RAGB 4R0KA 1BK2A 8AT1B 2H3JA 2D8JA 1SKUB 4XU1A 1YITQ 1FMVA 2KK4A 3JCMd 1H3ZA 2QQSA 4BE2A 4IUQA 3BDUA 4FT2A 3OYHA 1IHVA 3TQ7P 2P4TA 1N9SA 1PC0A 3EG9B 1M1KC 4GLKA 2EFIA 2VWFA 2L3QA 3OYBA 2LZ6B 2RI2A 4HT9A 3CMEQ 3URGA 2DILA 3META 3TCJA 4F7UB 2XKOC 3BW1A 3PVLA 5GAOm 3ZEHA 4ZGDB 5L23A 2BE9B 4KBMB 3L2QA 1X69A 1ZSZB 2QEXA 2CSIA 1WA7A 3ER0A 3I35A 4R55A 2WSCE 3P8BB 2KBTA 1YITT 2KRSA 5KYYA 2KT1A 1Y07A 2R5MA 5D6WA 4MZTA 2DERA 2AHJB 4J9BA 4FM4B 1YCYA 4M77F 1VA7A 5IHIA 3QZ9B 4FYXB 4EMGA 2CDTA 3A8MB 1UECA 1C6VX 1YWOA 2GTJA 4IUTA 4PFOA 1OOTA 1NM7A 3JRZA 1SRLA 3QSUA 3SFMA 5GAN3 1PG5B 3G4SA 2QEXQ 1WFWA 5GJVB 2PVDB 4XTWA 2EQJA 3DLMA 5GMKh 2COWA 1V29B 2DF6A 1M3BA 3CCSA 3JB9D 5IXBA 1K76A 2OI3A 4Z89A 5LJ5f 1IB8A 1RL2A 2QXFA 1ZSZA 3FEOA 1SEMA 3VUBA 4M78C 1TOVA 1ZUUA 2I0NA 4C0FA 4AFQC 3LGFA 6AT1B 1IREB 3PFSA 1KC8C 3ZBDA 4OGEA 1Y71A 1WNLA 2CYZB 2ZPGB 1T3LA 3UWNA 2HZYA 1RAHB 4DBHA 1KFZA 1SHGA 5C0MA 3G4SQ 1MUZA 2OAUA 1SHFA 5LJ3d 1KHIA 1JB0E 2VUBA 5FW9A 3CCSQ 2OTLA 2K3BA 4OF1A 2QEXT 4HCBA 1JJ2S 1NYFA 1E6HA 3JCMb 4IIOA 4M7AC 1OPKA 4ZNXA 2JS2A 2L3RA 1EX4A 1T3SA 4FYVB 2FPDA 2A0FB 1LPLA 1KQ1A 3M0TA 5LJ5h 3AHUA 4UC4A 2GFAA 1HSQA 2BZYA 5I11A 2EJ9A 3KUFA 2HMAA 1JJ2A
chains in the Genus database with same CATH topology
1IXDA 2COYA 2E3IA 1TOVA 2CP5A 2HQHA 1WHLA 1WHHA 1WHMA 2COWA 1WHGA 2E3HA 1WHJA 3RDVA 2M02A 2CP6A 2QK0A 1TXQA 4B6MA 2HL5C 1LPLA 1WHKA 2MPXC 2Z0WA 2CP7A 2E4HA 2HKNA 2CP3A 3E2UA 2CP2A 2COZA 2HKQB 2HL3A 2CP0A 3TQ7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXD A;  2COY A;  2E3I A;  1TOV A;  2CP5 A;  2HQH A;  1WHL A;  1WHH A;  1WHM A;  2COW A;  1WHG A;  2E3H A;  1WHJ A;  3RDV A;  2M02 A;  2CP6 A;  2QK0 A;  1TXQ A;  4B6M A;  2HL5 C;  1LPL A;  1WHK A;  2MPX C;  2Z0W A;  2CP7 A;  2E4H A;  2HKN A;  2CP3 A;  3E2U A;  2CP2 A;  2COZ A;  2HKQ B;  2HL3 A;  2CP0 A;  3TQ7 P; 
#chains in the Genus database with same CATH topology
 4RCB A;  1SRM A;  2GGR A;  4JS4 A;  2DD5 A;  4N0A C;  1UEB A;  1PCX A;  3L2R A;  3MP8 A;  5GMK m;  1JJ2 P;  3EGX B;  1ZUK A;  5KYW A;  3M58 A;  1TUD A;  1J3T A;  4LDU A;  1ZQ1 A;  2SEM A;  4OVA A;  3RER A;  2D6F A;  2DYB A;  3VS4 A;  2OTL Q;  3G4S T;  3P8D A;  4M7A F;  1WI7 A;  3HTR A;  1B34 B;  2LJ1 A;  3HKS A;  1AWW A;  3CCS T;  2GCX A;  2BZX A;  5CO7 A;  2VXE A;  4GY5 A;  3LGL A;  5CKF A;  1BYM A;  3VKI A;  1YI2 A;  2DFU A;  2O4X A;  3QO3 A;  3M5A A;  1SG5 A;  2KRM A;  4PJM A;  2GFU A;  4J9G A;  2DO3 A;  3V8L A;  4QQD A;  1VQ8 A;  4XQ3 A;  1WXT A;  2XDD A;  1RAA B;  3PVQ A;  3FDR A;  2DNU A;  4OMN A;  2HBP A;  4IKF A;  3ME9 A;  4PL6 A;  1KD1 R;  1N8R C;  1CKA A;  5GMK j;  3VYH B;  3V7C A;  2HDA A;  3GNF B;  2JOY A;  1KG1 A;  4ZN1 A;  4PJO A;  1Q81 R;  4KGV B;  2JMA A;  2B8A A;  1N9R A;  1TWB A;  1T0J A;  5GAM e;  2P84 A;  2K79 A;  3NFC A;  2X51 A;  1YI2 Q;  2DTI A;  4M75 C;  5CQY A;  2FL7 A;  3FC3 A;  4M77 B;  3CCJ A;  5GAN g;  1VQ8 Q;  2RJC A;  1O9S A;  1B34 A;  2YLB A;  3N5B B;  2CH4 W;  3I55 A;  4FU6 A;  1TUC A;  4ELZ C;  4ATO A;  2KE9 A;  2DZ9 A;  2DE0 X;  3OBW A;  1C1A A;  1NG2 A;  4PLL A;  5KE2 A;  4DBF A;  3J7A F;  2MWO A;  2O9S A;  4M78 D;  3JB9 G;  5GAO n;  2O2O A;  4TVR A;  2V8I A;  2KNB B;  2F2W A;  1I07 A;  1EFN A;  2A28 A;  2WSE E;  1D0Z A;  2PU9 B;  5LJ5 j;  3OYG A;  3HPW A;  4J8O A;  1K9M C;  1K0X A;  4M75 F;  2DKG A;  2JS0 A;  1AZE A;  5GAN f;  1M2V B;  3CCJ Q;  1YJN A;  4EMK B;  3I55 Q;  2EGC A;  2MWP A;  2SRC A;  3VYG A;  3JCM g;  3HHT B;  5DLQ E;  2COZ A;  4ZGJ B;  5GAO p;  2HKQ B;  2YLC A;  5D6X A;  1M30 A;  4C5E A;  2LT1 A;  1Q86 C;  1YJW A;  5KYU A;  3J81 E;  1QVP A;  1ARK A;  5DLO A;  1M3C A;  5EC7 A;  1K9A A;  5C6S A;  1Q7Y R;  3ZL7 C;  3Q1J A;  2KXD A;  4WTO B;  2ED0 A;  5CIU A;  3UF4 A;  4A4F A;  4E7K A;  2BTT A;  1QCN A;  3WVE B;  1E7O A;  2E5K A;  4NL3 A;  3I9Q A;  1Q81 U;  1YCS B;  2H8H A;  2YXY A;  2XK0 A;  3NTI A;  4F04 B;  4FYW B;  1PSF A;  5GAN h;  2NUT A;  4ME7 A;  1ZX6 A;  1GCP A;  1X2K A;  1KK7 A;  3CCJ T;  3HRT A;  3QBY A;  4EDU A;  3I55 T;  3SWN C;  1RAB B;  4RTY A;  3CPW S;  1WX6 A;  4CC2 A;  4M7A B;  4HCK A;  1JXO A;  4E6R A;  4DOV A;  2NUP B;  1IRX A;  3OQ5 A;  4MZM A;  3CPW A;  3QDF A;  1QKW A;  3M57 A;  3NMZ C;  4NS5 A;  2KVQ G;  1N27 A;  1RAD B;  2CZ1 B;  2DA9 A;  4B9X A;  3CPW P;  2W0Z A;  3GLX A;  2EPD A;  3CMA A;  3RNJ A;  4E7I A;  3CCM A;  3GBQ A;  4EPC A;  4XU0 A;  1IO6 A;  4M7D A;  2EQK A;  3CCL A;  2M16 A;  1O75 A;  1OEB A;  4M75 D;  1YHQ A;  1NJI R;  1PHT A;  2CP3 A;  3MEV A;  2RF0 A;  1UG1 A;  2BIV A;  5FRO A;  2E65 A;  2YRC A;  2YUQ A;  2O01 E;  1ZBX A;  3G1J A;  4Y91 A;  5GAN 4;  5A2Q E;  1M1F A;  2JMC A;  2K4Y A;  2RI3 A;  1PRL C;  3CCQ A;  2ZZD A;  1NLP C;  4M7D E;  2FPE A;  1PD0 A;  1Y7X A;  2RNA A;  5A0L A;  1R8O B;  1HYO A;  1OV3 A;  1Y96 B;  4HKE A;  2EVR A;  2QGF B;  3CMA Q;  1UGQ B;  4QQ6 A;  4J9E A;  3CCM Q;  3A98 A;  2NUZ A;  3O5Z A;  5LJ3 g;  1X43 A;  3TEE A;  4KRT A;  5IXF A;  3CCL Q;  4KUL A;  4LD9 K;  1RAF B;  2OX7 A;  7AT1 B;  2JW4 A;  4LNP A;  1YHQ Q;  4LXC A;  1WGS A;  4CC3 A;  4M78 G;  5FU6 B;  1GRI A;  2HAX A;  2RM4 A;  2DD4 A;  4RG8 A;  4HCC A;  1LVK A;  5IT9 E;  1QVG S;  1TTH B;  3QWY A;  2DTO A;  3CCQ Q;  3RKX A;  4CC4 B;  4ZN3 A;  2LNH B;  3L1A A;  1VQL Q;  1AHJ B;  4EMH A;  1W2B S;  1X2Q A;  3OW2 S;  1X6G A;  3VV0 A;  2F2V A;  4JJD A;  2EJG A;  2RMO A;  1PSE A;  2LRQ A;  2DAQ A;  5GMK e;  1ZA2 B;  1QVG A;  1B7T A;  1UGR B;  1XOV A;  2K5I A;  4M7A G;  1OYX A;  3CMA T;  2AT1 B;  3UDC A;  1W2B A;  3OW2 A;  2YRD A;  1BKB A;  3CCM T;  5GAO r;  2QYZ A;  1QMC A;  1QVG P;  4PK4 A;  2RI5 A;  3H9N A;  4PJO C;  3VU3 C;  1E6G A;  3REB B;  4BD3 A;  1K73 C;  1QWF A;  1Y96 A;  2K5L A;  4Y92 A;  3CCL T;  1W2B P;  2DEQ A;  3OW2 P;  2YUO A;  3NPF A;  3NTK A;  2HEQ A;  2HKN A;  3JB9 F;  1NJI U;  4IUU A;  1FMW A;  2CP0 A;  1QW1 A;  1WQW A;  3RES A;  4LDY A;  2LVM A;  2X3X D;  1IHW A;  3CCQ T;  4C92 A;  1VQL T;  1QP3 A;  3A1P A;  2DYI A;  2KY9 A;  1U8R A;  1GCQ C;  5J26 A;  2D0Q B;  2X3W D;  5GAM d;  4PJO F;  2VC8 A;  3QYG B;  4O6J A;  2RJE A;  1VYU A;  2QA4 A;  4C92 E;  5LJ5 e;  1JU5 C;  4RMO A;  3FIF A;  4J9H A;  2BE7 D;  4PJN A;  4BDZ A;  1UGP B;  4FL6 A;  4RTV A;  2MPX C;  5FWB A;  3OY9 A;  2Y4X A;  3RMS A;  3H0F A;  1D09 B;  4AFU C;  1KC8 R;  1M1K U;  4JLI A;  1K8A C;  4J83 A;  4D8D A;  2MF2 A;  3J80 E;  1VQO T;  3OSS C;  2C0O A;  2GQV A;  1GXI E;  2B86 A;  4P5N A;  4X9D A;  2RPN A;  2RO0 A;  4M4Z A;  1M5Q 1;  3SWN B;  4HA8 A;  4J7F A;  2DL7 A;  4ZGE B;  4LN2 A;  4DBQ A;  4M75 G;  2QA4 Q;  1N6A A;  4PFP A;  3UPU A;  3EH1 A;  2DTH A;  4C0Z A;  1BI0 A;  2J7I A;  4IUV A;  1R77 A;  3H0H A;  2E41 A;  2FZC B;  2KT8 A;  3M53 A;  3CC4 A;  4J9C A;  3CCE Q;  1G5V A;  4D8K A;  1AVZ C;  2BUD A;  2EKH A;  3QG1 A;  3EG9 A;  2A36 A;  3ASK A;  2VGM A;  2AZS A;  2KAF A;  2LQW A;  3VRZ A;  4E7Z A;  2FVU A;  1ZA1 B;  4JDS A;  1WHG A;  2MI6 A;  3SD4 A;  2LQK A;  4L5G A;  4AFZ C;  5FWC A;  1WYX A;  1XJW B;  3JSC A;  2LQ8 A;  4F7U A;  2EBP A;  3QDR B;  1QKX A;  3CC7 T;  2V1R A;  2QA4 T;  2KR3 A;  2ABL A;  3CC4 Q;  4KT0 E;  3PIO A;  3VS7 A;  4LE9 A;  2KEA A;  1QCO A;  5I22 A;  1AOJ A;  1FWZ A;  4F7U E;  3CCE T;  1UGV A;  2FG0 A;  1U3O A;  2AIR B;  3RKY A;  4PJO D;  1P92 A;  1G3Y A;  2YWW A;  2DM1 A;  2EKO A;  3CC2 A;  1VUB A;  2ZPI B;  3X26 B;  3M59 A;  1X6B A;  3QXE B;  1WPY A;  1N8R R;  1FXX A;  1KC8 U;  2ZGW A;  3MO8 A;  3PT9 A;  4N4H A;  5CKB A;  4DQ2 A;  3GPL A;  4J5Y A;  3BFM A;  4VUB A;  1WJR A;  2Y90 A;  4BUG A;  4B6M A;  3L2V A;  4E2F B;  1V1C A;  2D8H A;  5CR2 A;  2K6D A;  2KYB A;  4M78 F;  3A8G B;  3M4G A;  4HVW A;  1UB4 A;  4FW2 A;  4PFZ A;  3VS2 A;  1EZZ B;  2OTJ A;  3CC4 T;  4BY6 B;  1OQK A;  3CD6 A;  4II1 A;  2JXB A;  4LD6 A;  3JCM X;  2JM8 A;  1M2O A;  3QKJ A;  5FU7 B;  2L3S A;  3CC2 Q;  2EAY A;  4C8Q C;  2C0I A;  2Y4Y A;  2R58 A;  3GOX A;  4RKU E;  1QCF A;  2RHY A;  1IGQ A;  4JS5 A;  1MMA A;  3M0P A;  2R5A A;  3CQT A;  4JRK A;  2J06 A;  3TSZ A;  3R6O A;  5IAY A;  2DBM A;  1RI9 A;  9ATC B;  2NYS A;  1JXM A;  1FMK A;  2C06 A;  3TRE A;  3L2W A;  4JRP A;  3EHR A;  2E3H A;  3QYH B;  3CBO A;  3NGP A;  4BE0 A;  2LTO A;  3OMC A;  5FRN A;  3H8Z A;  1AWX A;  4XU2 A;  4DBR A;  2OTJ Q;  1ZBJ A;  3M0Q A;  1VQM A;  1A0N B;  1RAE B;  3CD6 Q;  1NE8 A;  3PNW C;  2LX9 A;  4FSS A;  2JT4 A;  2E6N A;  1M90 C;  2XMF A;  4J6W A;  2RJF A;  4C8Q F;  3EGD B;  2A37 A;  3FRN A;  1BBZ A;  1N5Z A;  2DX1 A;  2LJ3 A;  2YRV A;  1PM3 A;  3CC2 T;  5HK0 A;  2DXT A;  4V2S A;  2EGA A;  1Q86 R;  2J05 A;  3G71 Q;  2LCC A;  1RLQ C;  3BDL A;  2P0Q A;  2VKN A;  3TSW A;  5LL6 S;  4XTX A;  3M56 A;  1N8R U;  3EGX A;  2XU8 A;  4GBQ A;  2E5Q A;  1WHM A;  2DRK A;  1UHC A;  2FRW A;  2LCL A;  1ABO A;  3L42 A;  1PRM C;  4C5I A;  3JCM Q;  2RA2 A;  1VQM Q;  2L3P A;  1SSH A;  3EG2 A;  1AT1 B;  4C92 C;  4EIK A;  5HCK A;  1SSF A;  2LX7 A;  1M3A A;  3VUZ A;  3I56 A;  2OTJ T;  1YJ9 T;  3CCV A;  1PWT A;  3DKM A;  3CD6 T;  4PLI A;  2QQR A;  2NLU A;  5CKH A;  5GAN 8;  4JZ4 A;  2QQB A;  2CS7 A;  1YIJ A;  1KSW A;  1EIF A;  1VYT A;  4XTV A;  1I81 A;  2X4W A;  2D0N A;  2ZPE B;  1I4K 1;  4A4G A;  1R0B G;  2EJF A;  2VV5 A;  2HD0 A;  3G71 T;  4LUD A;  2W10 A;  3E9F A;  1Q82 C;  2DVE A;  3EG0 A;  2C0T A;  1ZSG A;  2NWM A;  2PVO B;  3MEA A;  4M7D D;  2PTK A;  1WHJ A;  1FYN A;  4Z8A A;  2MYS A;  2QI2 A;  4KGZ B;  2M0O A;  4LDX A;  2EQU A;  2RH2 A;  5CQX A;  1VQ7 T;  3I56 Q;  4LUE A;  2X4Y A;  3CCV Q;  2DMO A;  1VQM T;  2V26 A;  3LLR A;  4PJO G;  1K9M U;  2RK1 A;  3CBP A;  2JVV A;  5DM7 R;  2X4X A;  1VQN A;  1BIB A;  1NZ9 A;  5LJ5 d;  3C95 A;  5GAM g;  2IVW A;  1YIJ Q;  3C0C A;  4M77 A;  4BB7 A;  2KXC A;  1G83 A;  2L0A A;  1KIK A;  4E7J A;  4OMQ A;  4MML A;  3VRY A;  2VAS A;  3FLG A;  1BB9 A;  3M0S A;  4Q5W A;  1KD1 C;  4JRQ A;  1Q95 G;  1YN8 A;  1Q86 U;  2PQW A;  4M78 B;  4C8Q D;  3HP9 A;  1UHF A;  2G6F X;  3TVT A;  3CCR A;  1H3H A;  2WAC A;  4M77 E;  2F69 A;  2KYM A;  4E7L A;  1VQ9 Q;  2M02 A;  1X6O A;  3JCM f;  3SB2 A;  1U06 A;  1ZHI A;  2ZPF B;  4QKU A;  1S72 Q;  1WJQ A;  1W6X A;  2L2P A;  3I56 T;  1HJD A;  1VQN Q;  3CCV T;  3KBG A;  4KH0 B;  2CP2 A;  2HCK A;  1X75 C;  3H6Z A;  3MHX A;  1JRI A;  2AK5 A;  4X34 A;  1M4Z A;  1M2V A;  4JJN K;  3HSB A;  2KGT A;  1YIJ T;  4HT8 A;  5ECA A;  3DB4 A;  1U5S A;  4EMK A;  3L2Z A;  5AT1 B;  2RHZ A;  2XDB A;  1ZSZ C;  4JPB W;  1IGU A;  3JV3 A;  3R6N A;  3PMI A;  2CZ7 B;  1OPL A;  3CCR Q;  2KMT A;  3T9N A;  2A08 A;  1H64 1;  1YFN A;  4A4K A;  4L59 A;  4ZTJ A;  3UA6 A;  1OU8 A;  1RI0 A;  3JCM h;  3BY7 A;  3OS5 A;  4E7H A;  3OYF A;  1VQ9 T;  4B9W A;  1RUW A;  1K0S A;  1S72 T;  3FJ5 A;  5KYX B;  4NOY A;  5GAN 6;  1VQN T;  4BI4 A;  1D3B B;  1OUL A;  4F17 A;  1OX8 A;  3INZ A;  4C92 D;  1K73 R;  2E64 A;  2LJ0 A;  3EFO B;  2QAS A;  5CCA A;  3HFN A;  4XU3 A;  1KJW A;  2RK2 A;  3E1S A;  1OZ3 A;  4A54 A;  3A5Z B;  4FCY A;  5HK3 A;  5HY6 A;  3JB9 H;  2DRM A;  1D1A A;  2ZCF B;  1VQL A;  2QQA A;  4J9F A;  4M78 E;  2YT6 A;  1Q7Y C;  1RAC B;  1JEG A;  4BAC A;  1OX9 A;  4M7A A;  3M9Q A;  1MGQ A;  3CCR T;  1WZO A;  2NUP A;  3PIP A;  2XHC A;  4DEX A;  2K3X A;  5FLX E;  2M0Y A;  2HBW A;  4F16 A;  4KUD K;  3OB9 A;  1U1T A;  1QP2 A;  3EFS A;  4OMM A;  1IZ6 A;  1WHK A;  3QHS A;  1H8K A;  2A7Y A;  1RAI B;  4N0A A;  2HQX A;  4M7A E;  2CZ6 B;  1M1K R;  2EWN A;  1VQK T;  4RTX A;  3WVD B;  4PNO A;  4M75 B;  5CAI A;  3JAM E;  4A4H A;  1VQO A;  2O9V A;  5GAN j;  2AZV A;  3S3N A;  1TXQ A;  3CBM A;  2K9G A;  2LQN A;  2FZG B;  1K8A R;  2J6K A;  4J9I A;  1NYG A;  4O5V A;  5J39 A;  5LJ3 f;  4GLM A;  1FX7 A;  1XQH A;  2XDP A;  3C94 A;  1I1J A;  4LDW A;  3EG3 A;  4MDX A;  5GJW B;  1AEY A;  4FYY B;  5GAO l;  1UJ0 A;  4XAX B;  4BI8 B;  2QAZ A;  1KQS A;  2RQU A;  5GAN d;  3OYY A;  2HNI A;  4C5G A;  1Z9Z A;  5GAO q;  3OS1 A;  1RLP C;  2L89 A;  4OB0 B;  2OAW A;  4CI0 C;  2VB6 A;  2JTF A;  1KQS P;  1V76 A;  3E2U A;  3LW5 E;  2P0K A;  4C8Q G;  1VQO Q;  1K73 U;  4KH1 B;  1UUE A;  3GP8 A;  1B3Q A;  4X9C A;  1TS9 A;  1BIA A;  1K4U S;  2DBK A;  1VOM A;  2HSE B;  1D1B A;  2MAM A;  2F2X A;  2P0P A;  1TSF A;  5LJ3 h;  4JJC A;  3OS2 A;  2K3Y A;  2VXF A;  2MIO A;  2X4J A;  2E3I A;  2MMP A;  3CC7 A;  3CCU T;  3QWX X;  2FEI A;  2V8J A;  3RIR A;  2CRE A;  2RQV A;  1D0Y A;  3MEW A;  3QPH A;  1YP5 A;  2FB7 A;  2QGG A;  4BE1 A;  2EQI A;  2M1H A;  4F14 A;  5FRM A;  2JTM A;  3CCE A;  2KDS A;  4M75 E;  4HVV A;  2ED1 A;  4N4I A;  1U1S A;  3SDZ A;  1JBM A;  5GAN 7;  1F1B B;  1ZLM A;  5KCH A;  3OYN A;  2JN0 A;  4PJJ A;  2JTE A;  2RQT A;  1VQ5 T;  2CT3 A;  1YNZ A;  3LX7 A;  4Z88 A;  5KCO A;  3PGG A;  2XI9 A;  1VIF A;  2K5F A;  2J6O A;  3EG1 A;  4M77 C;  3HRS A;  2EYX A;  3V7R A;  1K8A U;  3M55 A;  3M4Y A;  4XTU A;  3CC7 Q;  1S1N A;  2HQE A;  4BDY A;  1MHN A;  1G3S A;  2QTX A;  2BZ8 A;  4N4G A;  2XG8 D;  1DJ7 B;  2F5T X;  4C92 G;  1LCK A;  2H3E B;  1PNJ A;  3DLL A;  2CGH A;  1NLO C;  1NEG A;  3MKD A;  1X01 A;  2HSP A;  4DOW A;  4OP0 A;  4IUP A;  1W70 A;  1G3W A;  3V8J A;  1SPK A;  1NBE B;  3OYL A;  4JRI A;  2X35 A;  3KFV A;  1W4S A;  1VIE A;  3A8O B;  4QVZ A;  2CP5 A;  5LJ5 g;  1WXB A;  2ATC B;  1I8F A;  1KHC A;  3RMQ A;  2CT4 A;  5GMK l;  2KRO A;  1BU1 A;  4OB1 B;  3CME T;  4IIM A;  4EMK C;  5D7U A;  3TU4 K;  1ZUY A;  2HL3 A;  2K7A A;  4CRI A;  5IN1 A;  4AMC A;  3SWN A;  2GBQ A;  1T0H A;  2ENM A;  5GMK i;  2D9T A;  4J9D A;  2FYK A;  1YWP A;  5EG2 A;  3X28 B;  2LDM A;  2RB6 A;  2RQW A;  1M90 R;  5KYW B;  2CP7 A;  1AZG B;  2CUB A;  3C4S A;  3S6W A;  3V8K A;  4LDV A;  3QUI A;  3EGU A;  1UDL A;  5LJ3 j;  1WXU A;  4M7D C;  2JNG A;  3MP6 A;  4HVU A;  1MMD A;  1XTD A;  4QQG A;  1AWJ A;  1R0C B;  2DL4 A;  3EH2 A;  3JCM W;  1TUG B;  3O8V A;  8ATC B;  5CVI A;  4RTW A;  3S3M A;  2DL5 A;  1VQ4 A;  1LJO A;  1ABQ A;  3THK A;  2OJ2 A;  2RHI A;  2M9U A;  2VVK A;  3SHW A;  2D1X A;  2O4X B;  4RTT A;  3OYE A;  2M51 A;  1HK9 A;  3G7Z A;  3QJ6 A;  4MDW A;  4X1V A;  1BCM A;  3SEM A;  1YJ9 A;  2PUK B;  3WXM B;  2RHU A;  4HXJ A;  4E7S A;  3GIB A;  4F7U G;  5I2M A;  2XIC A;  4E47 A;  4M7D F;  3KXT A;  3A8H B;  4KUI A;  2IIM A;  3C12 A;  2XID A;  4OGC A;  4PJO B;  1HXD A;  4K11 A;  4RCC A;  3G71 A;  2HQH A;  2LP5 A;  1VQP A;  2EIF A;  1SF9 A;  1VQ4 Q;  4OMP A;  4BI3 A;  1GFD A;  1HD3 A;  4QVD A;  2O88 A;  1PKT A;  4RTZ A;  3RBB B;  3QJY A;  2JUF A;  1CSK A;  5GAN e;  4FW1 A;  3FJP A;  1Q82 R;  4QT7 A;  1K9M R;  5DY9 A;  2YDL A;  2EQM A;  3LWI A;  1VQ7 A;  2DK3 A;  4C0D C;  4D6W A;  1YJ9 Q;  3FB9 A;  2IPO B;  3GNG A;  2QDL A;  3F70 A;  4R56 A;  2LT4 A;  2V1Q A;  4M77 D;  1C0M A;  4C0G A;  1BI2 A;  1K1Z A;  2RN8 A;  2RJD A;  3JCM P;  2KRN A;  3QII A;  3IQL A;  1G2B A;  3OA6 A;  3VJP A;  3MEU A;  2FRY A;  3MP1 A;  3BE3 A;  2PUO B;  3CPF A;  3OSV A;  2XD0 A;  4OMO A;  1M90 U;  2YUP A;  1YBY A;  3MJX A;  1VQP Q;  4XK8 E;  3OMG A;  2MOX A;  1Y57 A;  4OML A;  2AKL A;  1G3T A;  1UE9 A;  4A4E A;  4OMF B;  3ZFJ A;  1VQ4 T;  5HKC A;  2QDY B;  2PNI A;  2MCN A;  2FZK B;  1VQ7 Q;  1LOJ A;  3X25 B;  4OB2 B;  3JCM e;  2I2L A;  1WIE A;  5FU6 C;  4J6X A;  2OTL T;  4RTU A;  2CUD A;  2EW3 A;  1QVF S;  1WLP B;  1MNE A;  1WHL A;  5KYU B;  1AWO A;  3X20 B;  2DXB A;  3EAE A;  3VS0 A;  2RHX A;  2KQW A;  2E4H A;  4PJO E;  3DB3 A;  1W1F A;  3OYC A;  1QVF A;  2LC4 A;  4FSX A;  1VQP T;  3EGD A;  5CKD A;  3H0I A;  4KGX B;  1GCQ A;  1MND A;  2G3R A;  3V7S A;  1QVF P;  5AYF A;  2NUT B;  4C92 F;  5I21 A;  2HL5 C;  2LNV A;  3M0R A;  1I5O B;  1VQ9 A;  1Q82 U;  2QG9 B;  1UJY A;  1S72 A;  4PJL A;  1GL5 A;  3LWH A;  5M9O A;  2IG0 A;  3H41 A;  4YTL A;  4AFS C;  2WSF E;  3JB9 I;  1M8M A;  1YI2 T;  1JO8 A;  2EYQ A;  1NPR A;  4ANJ A;  3G6E A;  3X24 B;  2BKD N;  2CP6 A;  4JJB A;  2DLP A;  1CKB A;  4XTY A;  2ROL A;  2FPF A;  2K57 A;  2ROT A;  4M7A D;  1VQ8 T;  1G8X A;  1M9S A;  4L6V 5;  4ORZ A;  3RR6 A;  2E6Z A;  2R57 A;  2ESW A;  4RUG A;  1UGS B;  5J3B A;  2K2V A;  2X9H A;  3QZ5 B;  1Q81 C;  2DPP B;  2L8D A;  1WHH A;  3OYJ A;  1OU9 A;  2JJ9 A;  2DXU A;  2DXC A;  2CH4 A;  1MV3 A;  3UA7 A;  1KD1 U;  1GFC A;  3REA B;  2KSS A;  1MMG A;  2CZ0 B;  1Z9Q A;  1M8V A;  1BI1 A;  2Z0W A;  3I5S A;  3MPU B;  2DIG A;  5GAM f;  4PKC C;  4ELY C;  4M7D B;  1D0X A;  2DL3 A;  3HFO A;  4J6Y A;  2LCS A;  3MCA B;  2EYY A;  2O31 A;  2MK5 A;  1H92 A;  4A53 A;  4FT4 A;  3EFR A;  2JM9 A;  2DEU A;  1YJN Q;  3G6E Q;  2DET A;  3S3O A;  3A8L B;  1VQK A;  1NPP A;  1AD5 A;  4ESR A;  2YSQ A;  2GNC A;  4QVC A;  1QWE A;  1TG0 A;  2GF7 A;  2F1L A;  5IHN A;  4J7I A;  3VS3 A;  1YJW Q;  2DZC A;  5CKE A;  4Z02 A;  4AG2 C;  2E12 A;  1VQ6 A;  4AT1 B;  3OBY A;  5LJ3 e;  4M77 G;  5KYN A;  3GF5 A;  1MMN A;  3L2U A;  1GBQ A;  2GTO A;  4C8Q B;  3UAT A;  4WF2 A;  2LMJ A;  3CEY A;  5GAM h;  1PKS A;  3P8H A;  4M78 A;  4F7U F;  2DL8 A;  1KQ2 A;  4C5H A;  1XNI A;  3CXC S;  2CKK A;  2YHT A;  3RUX A;  2J6F A;  1VQK Q;  2DJZ A;  1UFF A;  1YJN T;  3G6E T;  3ULR B;  5CK9 A;  1X27 A;  4JZ3 A;  3JCM J;  2QK0 A;  2DJQ A;  2JZ2 A;  2GQI A;  4MMK A;  1Y0M A;  3CXC A;  4C0D B;  5GAN 2;  1VQ6 Q;  1MV0 B;  1ACM B;  3M54 A;  1YJW T;  4JUV A;  3JCM V;  3CXC P;  4XTZ A;  3JB9 J;  2DVJ A;  1GBR A;  5A0D A;  2ZAE A;  2KI7 A;  4OB3 B;  4A63 B;  2DIQ A;  2A3L A;  3RDV A;  3CCU A;  4QW2 A;  1Q7Y U;  4JLG A;  2EGE A;  3PTA A;  1OZ2 A;  2ZPB B;  5A0G A;  2ZPH B;  3EHQ A;  3AT1 B;  2VYT A;  2AKK A;  2FHD A;  3D7S B;  1QLY A;  1QQJ A;  2V8K A;  3LH5 A;  4Y28 E;  3RKW A;  4C8Q A;  5KH6 A;  1M27 C;  1OI1 A;  3PMT A;  2RD1 A;  2QTV A;  5KE3 A;  3LYI A;  1NEB A;  2E1H A;  3E19 A;  1TU0 B;  2FO0 A;  5I2S A;  3OS0 A;  1BCO A;  4C92 B;  2ECZ A;  2VGN A;  5KYX A;  4M7D G;  1VQ5 A;  3PE0 A;  3VS6 A;  5IH2 A;  1D3B A;  5D6Y A;  1VYV A;  4FIB A;  1KQS S;  3UT1 A;  3NHN A;  3EFO A;  2E70 A;  1VQ6 T;  3JCM c;  2P4R A;  2QQ9 A;  1PD1 A;  2COY A;  4C8Q E;  1LNX A;  3CCU Q;  3E9G A;  3OYA A;  3U23 A;  4MZP A;  2L5Q A;  1WJS A;  4CC7 A;  1M1G A;  3OYD A;  4BY6 C;  1TH7 A;  3HL8 A;  1WQ7 A;  5FU7 C;  4IUR A;  2EYZ A;  2PVG B;  4ZTF A;  4WCI A;  3I5R A;  1YIT A;  1I5L A;  1I0C A;  2F5K A;  2K2M A;  3LH0 A;  4RG2 A;  1NJI C;  2EYW A;  1D1C A;  3OYM A;  1BI3 A;  2PZ1 A;  4HCZ A;  5GAN 5;  1WDX A;  1VQ5 Q;  3M0U A;  2E10 A;  2CSQ A;  4DA4 A;  4NL2 A;  2RQR A;  3OYI A;  1YHQ T;  2YUN A;  5IHK A;  3VS5 A;  3OYK A;  3HRU A;  3NTH A;  3VS1 A;  5GAM j;  1JQQ A;  3CME A;  4AG1 C;  4M75 A;  4DEY A;  5KYY B;  1UTI A;  1IXD A;  1B07 A;  5L8R E;  1RAG B;  4R0K A;  1BK2 A;  8AT1 B;  2H3J A;  2D8J A;  1SKU B;  4XU1 A;  1YIT Q;  1FMV A;  2KK4 A;  3JCM d;  1H3Z A;  2QQS A;  4BE2 A;  4IUQ A;  3BDU A;  4FT2 A;  3OYH A;  1IHV A;  3TQ7 P;  2P4T A;  1N9S A;  1PC0 A;  3EG9 B;  1M1K C;  4GLK A;  2EFI A;  2VWF A;  2L3Q A;  3OYB A;  2LZ6 B;  2RI2 A;  4HT9 A;  3CME Q;  3URG A;  2DIL A;  3MET A;  3TCJ A;  4F7U B;  2XKO C;  3BW1 A;  3PVL A;  5GAO m;  3ZEH A;  4ZGD B;  5L23 A;  2BE9 B;  4KBM B;  3L2Q A;  1X69 A;  1ZSZ B;  2QEX A;  2CSI A;  1WA7 A;  3ER0 A;  3I35 A;  4R55 A;  2WSC E;  3P8B B;  2KBT A;  1YIT T;  2KRS A;  5KYY A;  2KT1 A;  1Y07 A;  2R5M A;  5D6W A;  4MZT A;  2DER A;  2AHJ B;  4J9B A;  4FM4 B;  1YCY A;  4M77 F;  1VA7 A;  5IHI A;  3QZ9 B;  4FYX B;  4EMG A;  2CDT A;  3A8M B;  1UEC A;  1C6V X;  1YWO A;  2GTJ A;  4IUT A;  4PFO A;  1OOT A;  1NM7 A;  3JRZ A;  1SRL A;  3QSU A;  3SFM A;  5GAN 3;  1PG5 B;  3G4S A;  2QEX Q;  1WFW A;  5GJV B;  2PVD B;  4XTW A;  2EQJ A;  3DLM A;  5GMK h;  2COW A;  1V29 B;  2DF6 A;  1M3B A;  3CCS A;  3JB9 D;  5IXB A;  1K76 A;  2OI3 A;  4Z89 A;  5LJ5 f;  1IB8 A;  1RL2 A;  2QXF A;  1ZSZ A;  3FEO A;  1SEM A;  3VUB A;  4M78 C;  1TOV A;  1ZUU A;  2I0N A;  4C0F A;  4AFQ C;  3LGF A;  6AT1 B;  1IRE B;  3PFS A;  1KC8 C;  3ZBD A;  4OGE A;  1Y71 A;  1WNL A;  2CYZ B;  2ZPG B;  1T3L A;  3UWN A;  2HZY A;  1RAH B;  4DBH A;  1KFZ A;  1SHG A;  5C0M A;  3G4S Q;  1MUZ A;  2OAU A;  1SHF A;  5LJ3 d;  1KHI A;  1JB0 E;  2VUB A;  5FW9 A;  3CCS Q;  2OTL A;  2K3B A;  4OF1 A;  2QEX T;  4HCB A;  1JJ2 S;  1NYF A;  1E6H A;  3JCM b;  4IIO A;  4M7A C;  1OPK A;  4ZNX A;  2JS2 A;  2L3R A;  1EX4 A;  1T3S A;  4FYV B;  2FPD A;  2A0F B;  1LPL A;  1KQ1 A;  3M0T A;  5LJ5 h;  3AHU A;  4UC4 A;  2GFA A;  1HSQ A;  2BZY A;  5I11 A;  2EJ9 A;  3KUF A;  2HMA A;  1JJ2 A; 
#chains in the Genus database with same CATH homology
 1IXD A;  2COY A;  2E3I A;  1TOV A;  2CP5 A;  2HQH A;  1WHL A;  1WHH A;  1WHM A;  2COW A;  1WHG A;  2E3H A;  1WHJ A;  3RDV A;  2M02 A;  2CP6 A;  2QK0 A;  1TXQ A;  4B6M A;  2HL5 C;  1LPL A;  1WHK A;  2MPX C;  2Z0W A;  2CP7 A;  2E4H A;  2HKN A;  2CP3 A;  3E2U A;  2CP2 A;  2COZ A;  2HKQ B;  2HL3 A;  2CP0 A;  3TQ7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...