1HJDA

Melanoma inhibitory activity (mia) protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
101
structure length
101
Chain Sequence
ADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor
molecule keywords HUMAN MELANOMA INHIBITORY ACTIVITY PROTEIN
publication title The Extracellular Human Melanoma Inhibitory Activity (Mia) Protein Adopts an SH3 Domain-Like Fold.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hjdA00
5FW9A 1UG1A 4JPBW 2YUNA 1NG2A 4IIMA 2DVJA 1UHCA 2CUDA 1X6GA 1UTIA 2O31A 1UGVA 3REBB 1AWXA 5I11A 2YSQA 2ED1A 1VYTA 2OJ2A 1MV0B 1X69A 1TUDA 4FSSA 3EHQA 2NWMA 1M27C 4CC3A 1QWEA 1T0HA 1GCQA 2ENMA 2GNCA 4OMQA 1AWJA 2CREA 1RUWA 2BTTA 2C0TA 1JXOA 2KROA 3EG0A 2HEQA 1M3AA 1AWOA 1FYNA 4LUEA 3M0RA 4OMLA 3ULRB 2CT3A 1K0XA 5GJVB 2C0OA 2LJ1A 1I0CA 1QCFA 1JO8A 1U06A 2LX7A 3I5SA 1WIEA 2BZYA 2HSPA 1UDLA 2DF6A 3TSWA 1OOTA 2DA9A 2KRNA 2CSQA 4RTVA 3FJ5A 2OAWA 3RNJA 1NEGA 1VYUA 3REAB 3M0UA 2LNHB 1UHFA 4A63B 1W1FA 2LMJA 2DYBA 1PKTA 2FPEA 1MUZA 3NGPA 1GFCA 1ARKA 1KFZA 5EC7A 3EHRA 2FG0A 2DJQA 1SPKA 2LP5A 1SSHA 4AG1C 1AOJA 1CKAA 4ZNXA 2FO0A 4CC4B 3EGUA 1TUCA 2J06A 2AKLA 1GBRA 3SHWA 4Z89A 4JZ4A 1G2BA 1N5ZA 2W0ZA 2L3QA 2EKHA 1M8MA 5FWCA 1LCKA 3I35A 2KRSA 2ESWA 1YP5A 4AG2C 3CQTA 3H0FA 4R0KA 1W70A 2HDAA 3M0TA 2DE0X 2RQVA 4X1VA 1GCQC 2D8HA 1A0NB 3UATA 2JT4A 2VWFA 3VRZA 1RI9A 2CH4W 4RUGA 3TSZA 3O5ZA 5IHKA 1NLPC 3RBBB 2LZ6B 2O9VA 2RQUA 1UJ0A 4J9HA 3VS2A 2QDLA 3H0HA 1SRMA 3EG2A 3JV3A 1E6GA 2KYMA 2X3XD 1UJYA 2K9GA 2EYWA 2C0IA 3VS4A 4IIOA 2FRYA 3KFVA 3VS1A 2CDTA 2RQWA 4HVUA 1X2KA 2MCNA 1B3QA 1AZGB 2VKNA 1UECA 3TVTA 4J9IA 2A28A 2A36A 1E6HA 4F16A 1ABQA 1UE9A 3NMZC 4D8DA 1QKXA 1WXBA 1Y57A 2RQTA 2L2PA 2YUPA 2DL3A 3EG3A 1BB9A 2KT1A 1U3OA 2DBMA 1K0SA 2J7IA 2DM1A 1PNJA 4HCKA 4Z88A 1WXTA 2EBPA 3NHNA 2E5KA 1PRMC 1Z9ZA 2AZVA 2DLPA 2MOXA 1AEYA 2J05A 3I5RA 4M4ZA 1ZBJA 2XMFA 2ROTA 4GBQA 1PRLC 2PTKA 2G6FX 4JJBA 2ED0A 2KXCA 4Z8AA 1SHGA 4WCIA 2MIOA 1SRLA 5I22A 2LJ3A 1NEBA 3PVLA 2JS2A 2VVKA 5IXBA 2GGRA 4RTZA 2D0NA 1K1ZA 2KGTA 1HSQA 1ZSGA 3VS5A 3THKA 2EYXA 2EYZA 2L3SA 1OPKA 2RMOA 1AZEA 1G83A 3GBQA 2DL7A 5L23A 4AFQC 2K6DA 2DILA 5IXFA 2JS0A 3VS6A 4DEYA 1WX6A 1K9AA 1PWTA 2FRWA 1XOVA 1M3BA 2L0AA 2BZ8A 2ECZA 2K79A 1NYFA 1NM7A 2DX1A 4J9GA 5IHIA 3M0SA 1JXMA 2EGEA 2A08A 3UA7A 4J9CA 2DL8A 1EFNA 4AFUC 4GLMA 4RTUA 3I9QA 4F17A 1KJWA 3A98A 1PKSA 1FMKA 4JJCA 3VS7A 2O9SA 2EGCA 2RF0A 1CKBA 1ABOA 4J9EA 4RTWA 4HVWA 4AFSC 2GQIA 1UFFA 2DNUA 2J6OA 1K76A 1I1JA 2AKKA 2KE9A 2K2MA 1YN8A 2KXDA 1S1NA 1ZUKA 1GFDA 2CSIA 1X43A 1MV3A 4LE9A 2HCKA 2L3PA 3IQLA 4OMMA 4RTXA 4OMPA 3UA6A 1IO6A 1UUEA 2KEAA 4OMNA 1H92A 4EIKA 1WYXA 1W6XA 4CC2A 3M0PA 1AWWA 1HJDA 2KYBA 4AFZC 4JJDA 2M0YA 1GBQA 1HD3A 2JXBA 2KNBB 1T3LA 2K7AA 1YWPA 1ZX6A 2ABLA 1B07A 2AK5A 5IHNA 3VS0A 4ESRA 2GTJA 1VYVA 2FEIA 4J9BA 3H41A 1OEBA 2P4RA 1H3HA 4LUDA 4OMOA 1KIKA 1YCSB 1SHFA 2M51A 2DRMA 2DRKA 1WA7A 2YDLA 2DBKA 1Z9QA 4DEXA 2FPDA 2NUZA 2I0NA 1VA7A 1I07A 2F2VA 3UF4A 2JMAA 4LNPA 2DL5A 2DMOA 2GBQA 3H0IA 2SEMA 2EPDA 3VRYA 2IIMA 1M3CA 1WXUA 2DL4A 1KSWA 2O88A 2RN8A 2AZSA 2GTOA 1SEMA 2D1XA 1U5SA 2H8HA 4D8KA 1WLPB 2K3BA 4RTYA 2V1RA 2J6KA 2EGAA 2JM9A 1NLOC 2BZXA 3M0QA 2D8JA 1JU5C 2V1QA 2ROLA 2A37A 1ZUYA 2KRMA 4RTTA 5ECAA 2O2OA 1V1CA 2J6FA 2KBTA 2LQNA 2F2WA 1RLQC 1ZLMA 1YWOA 2PNIA 1QLYA 1X27A 1AD5A 2JM8A 1M30A 1H8KA 1GRIA 3C0CA 4E6RA 1GCPA 1TG0A 1WI7A 1E7OA 4J9DA 2CH4A 2W10A 1K4US 1JQQA 4K11A 2EVRA 2PZ1A 4HVVA 1AVZC 1QWFA 1BK2A 1J3TA 5IH2A 2EYYA 3SEMA 1NYGA 2OI3A 1YNZA 2LCSA 2JW4A 3ZL7C 1OV3A 1QKWA 4KRTA 4HXJA 1CSKA 3QWXX 5GJWB 4QT7A 1WDXA 1ZUUA 3PVQA 2JTEA 3R6NA 1BBZA 4ORZA 1BU1A 2YUOA 1PHTA 2EQIA 2JMCA 1X6BA 4J9FA 2EW3A 3U23A 2KR3A 4F14A 2HBWA 2FPFA 2RNAA 3LH5A 4Y92A 1T0JA 2LQWA 3QWYA 2RPNA 3VS3A 5HCKA 2SRCA 2KT8A 1X2QA 2CUBA 2B86A 2CT4A 3PE0A 2RQRA 2YUQA 1T3SA 4LN2A 4CC7A 4JZ3A 1OPLA 1WFWA 1RLPC 5FWBA 2X3WD 2F2XA 2YT6A 1GL5A 2LJ0A 3EG1A 1Y0MA 1JEGA 3NPFA
chains in the Genus database with same CATH superfamily
5FW9A 1UG1A 1YJWT 2B8AA 2CUDA 3OYAA 3J80E 3I55A 1VIFA 3CMAA 1VQLA 4O6JA 1C1AA 1FMVA 2YSQA 1YI2A 4FYWB 2NUTB 4EMKC 3G6EQ 4N4HA 5KYWB 2EJ9A 1N27A 1WGSA 2YHTA 2ENMA 1GCQA 2QYZA 1U1TA 1AWJA 2CREA 3MP1A 1WQ7A 3ZFJA 2KROA 1WJRA 2DTOA 4IUVA 2HEQA 1M3AA 1AWOA 4LUEA 1G3WA 3M0RA 2CT3A 2C0OA 4C5HA 3FC3A 2AHJB 2M1HA 1M9SA 3I55T 4UC4A 4II1A 2DZ9A 1VQLT 2HSPA 3CCEQ 3H8ZA 1QVFA 5LJ3e 2QTXA 3QZ9B 3NTHA 1B34A 2HQEA 3TSWA 4QVDA 4JRIA 4KBMB 5CK9A 1B7TA 3VU3C 1MNEA 3M0UA 4M75F 3M4YA 2EJFA 3HFOA 3EAEA 3M55A 3MP6A 3EGDA 4XU3A 3NGPA 3TREA 2A3LA 5EC7A 2FG0A 3CPWA 1SPKA 2GCXA 5GANh 1G5VA 1CKAA 4ZNXA 2O4XB 4M75C 3JCMd 2J06A 2AKLA 1GBRA 3MP8A 2HAXA 3SHWA 1N5ZA 2L3QA 1M8MA 1YJWQ 2VUBA 3GPLA 3I35A 1KQSS 3KUFA 4PJOB 5GAMh 2HNIA 1HYOA 2YWWA 4AG2C 1X6OA 4ELYC 4R0KA 5GMKl 1P92A 4JS5A 1AHJB 1M5Q1 4X1VA 4C5GA 1B34B 3OW2S 1S72A 3X24B 1JB0E 2FZKB 1U8RA 2VWFA 3VRZA 1RI9A 2R5MA 3CPWS 3JB9D 1YJ9T 2LDMA 2O9VA 3QYGB 1EZZB 3EGDB 1TU0B 4RMOA 1IGUA 4RCCA 5L8RE 1RAEB 4RG8A 2X3XD 4ZGJB 3OYJA 5GMKm 2C0IA 4IIOA 3RKYA 2GQVA 4PK4A 3KFVA 3OYLA 1KD1C 1VIEA 2MCNA 1KD1R 3TVTA 1VQ6T 1D1BA 2OAUA 1WXBA 4OB1B 2VYTA 4FIBA 1N8RU 3QDRB 4OB2B 2DERA 5LJ5g 3OYIA 2BKDN 4XTUA 4E47A 1K0SA 4M7DG 3EGXA 2COWA 1YFNA 4Z88A 2EBPA 2XIDA 4J5YA 1ZBJA 2X4XA 1QVGA 3C12A 3M5AA 1NPPA 3LW5E 2ED0A 1K8AC 1RAGB 2R57A 1SHGA 4WCIA 2HQXA 2LJ3A 4E7KA 2FZGB 2GGRA 2LT1A 3THKA 3OYDA 3V8JA 3R6OA 4DBRA 5DM7R 3PNWC 2DL7A 1IHWA 4AFQC 3INZA 2P4TA 3CXCP 5C0MA 1YJ9Q 5IXFA 3VS6A 3QBYA 1YHQA 2JJ9A 2JNGA 2L0AA 2BZ8A 1Q82C 2E12A 3S3NA 1RABB 1Q82R 4DBFA 3G71A 3UA7A 1EFNA 3EGXB 4PJMA 4RTUA 3SDZA 4AFUC 1NE8A 4F7UB 2VGMA 2VGNA 5I2MA 4CRIA 4F17A 9ATCB 1VQ8Q 1N9SA 1VQ6Q 3FIFA 3TCJA 4BY6C 1PD0A 4JJCA 2PVDB 2CZ7B 3M9QA 1C0MA 3A8LB 2FL7A 1ABOA 1MMAA 4HVWA 2BUDA 1JJ2A 2DD5A 3V8KA 1UFFA 3JCMQ 2J6OA 1K76A 1I1JA 3OS5A 4BUGA 4M78A 2K2MA 4FYVB 1V29B 1S1NA 1GFDA 4IUTA 4LE9A 3I56T 2L3PA 3IQLA 3UA6A 1M1GA 1WQWA 3OYNA 4MDWA 3CD6A 4M78E 3CCJQ 5LJ3h 3JCMh 1ACMB 2RHZA 1HD3A 2DXTA 2LC4A 4QQ6A 3OSSC 1I81A 2DK3A 2KNBB 2E64A 4C0DB 2ZAEA 2AK5A 3VS0A 1VYVA 3H41A 2RA2A 2NUPA 4EMHA 4OMOA 5CKFA 3VYHB 1YCSB 4X9CA 5CO7A 1KIKA 1OI1A 2YDLA 3L2RA 1NJIC 3CBOA 5GANg 1VQPQ 2KAFA 2YRVA 4VUBA 3CD6T 1UGRB 1ZA2B 1NZ9A 2F2VA 4BI4A 1LNXA 1NJIR 2GBQA 3HL8A 1WXUA 2DL4A 4XTYA 4M78B 2O88A 2ZPBB 5GAMg 3VUBA 4A53A 3M56A 1VQ4T 2GTOA 2LTOA 4RTYA 5KYYA 2H3EB 2JM9A 4DA4A 3UDCA 1I5LA 1NLOC 3G4ST 2WSFE 2BZXA 2XDBA 4OMFB 2XI9A 2WACA 1JU5C 5IT9E 3I56Q 3BE3A 5LJ5f 2NUPB 2ZZDA 2FZCB 3M59A 1M4ZA 3JB9I 2E3IA 2F2WA 2DD4A 1RLQC 4LDWA 3L1AA 1YWOA 2DYIA 2JM8A 4J6WA 1M30A 1IGQA 3C0CA 1YITQ 1GCPA 1TG0A 1WI7A 3G1JA 3URGA 3EH1A 3JB9J 1K4US 1MNDA 1Q7YC 3E19A 3CCMA 4HT9A 5FU6B 1KQ2A 1Q7YR 1QWFA 2K3XA 4EMKA 5IH2A 4M7AG 3SEMA 3UWNA 2JTMA 2LT4A 2RHUA 1KD1U 1QKWA 4KRTA 1PCXA 2XK0A 3BY7A 1VQ4Q 1I5OB 3RESA 3PVQA 1Y7XA 4MDXA 4QQDA 2IPOB 1TSFA 4ORZA 1BU1A 3GNGA 1PHTA 2EQIA 2JMCA 1YBYA 3CCST 2EW3A 2PVGB 4EDUA 4KUDK 4ZTFA 5FU7B 2RPNA 3VS3A 3G4SQ 2DEUA 4MMKA 2YUQA 1T3SA 5CKBA 4JZ3A 5CR2A 3N5BB 1BCOA 1RLPC 5KE2A 4V2SA 2X3WD 3TEEA 5GANe 1BIAA 4BI8B 1N9RA 2XHCA 1WJSA 3BFMA 2JTFA 2D0QB 4M75A 5GAN7 3QSUA 1NG2A 2COYA 1UTIA 1WHJA 3REBB 2HD0A 5GAMe 1AWXA 2K2VA 4KULA 4LDYA 4LD6A 1X69A 5A0DA 5KYUA 3TQ7P 1M27C 3BDLA 1HXDA 1U1SA 2MWPA 1RI0A 1RUWA 2BTTA 1JXOA 4RG2A 2K5LA 4OMLA 5GANf 1C6VX 2V8JA 2I2LA 4A54A 8ATCB 1LVKA 1JO8A 3PT9A 3I5SA 1FX7A 1M2VB 1UEBA 2YRCA 5KH6A 1OOTA 5LJ3g 3JCMg 1WZOA 2MWOA 3S3MA 2CSQA 2OTLT 3CEYA 1NEGA 2QI2A 4ANJA 5GAMf 1BI0A 4GY5A 3CCSQ 4FW1A 1I8FA 2LNHB 3QJYA 2DEQA 4M75B 4A63B 1W1FA 1OQKA 1PKTA 2FPEA 3CCEA 1XJWB 4ZTJA 3V8LA 1TXQA 1SSHA 1VQMQ 1FXXA 4M7DF 3RKXA 2FO0A 5KYUB 2QQ9A 1TUCA 3CC7T 4RCBA 4B9XA 3JB9G 3CCUQ 4J8OA 4C92D 4KUIA 3D7SB 3CQTA 3CCET 3H0FA 4M7DC 2KI7A 2DE0X 2D8HA 4M77C 3E9FA 1NJIU 3DLMA 2WSCE 1YJWA 1LPLA 2CH4W 2HKQB 5GAOl 1TS9A 4C0ZA 4BD3A 5IHKA 3V7RA 2QQSA 2EIFA 2F1LA 2QAZA 4J9HA 3S3OA 3H0HA 4BDZA 1SF9A 4XU1A 2K9GA 2JZ2A 2OTLQ 1Q95G 3GLXA 2CYZB 2RQWA 4A4EA 2MAMA 1MHNA 2E5QA 3V7SA 4PNOA 2A28A 1WNLA 5FRNA 3C95A 4E7HA 5GAOn 3M58A 2L2PA 5KCHA 2EQMA 3EG3A 1X75C 2XG8D 4HCKA 3NHNA 1LJOA 2E5KA 3CC7Q 1PRMC 2RM4A 4D6WA 1QVPA 2DLPA 5LJ5j 1AEYA 2J05A 2RB6A 4M4ZA 2RJEA 2IG0A 1OX8A 1Q7YU 4JJBA 2EWNA 4Z8AA 2FHDA 5CKHA 3JCMe 1KQSA 3OYYA 1SRLA 3CC4Q 2VVKA 5IXBA 1M8VA 1D0YA 3EH2A 1ZSGA 2XDDA 2EYXA 4KGVB 3H6ZA 3M53A 5KYYB 2ZPEB 4FW2A 4B9WA 2K6DA 3LYIA 4RKUE 3OW2A 3HRTA 4DEYA 2DIQA 2FVUA 4E7JA 4BY6B 3PIOA 4PJOD 2K79A 1K73C 1ZBXA 4JDSA 1IXDA 1BIBA 2QA4Q 2DX1A 4C8QC 3M0SA 3HRSA 1K73R 1WHKA 2QQAA 5KYNA 4JLIA 5GAOq 3I9QA 1YJ9A 1PC0A 5LJ3f 3JCMf 3OYGA 1XQHA 2FYKA 3VS7A 2O9SA 3OS2A 2E6ZA 2RF0A 1CKBA 5GMKh 5A2QE 4J9EA 4RTWA 1VQKT 4HCCA 1H3ZA 1SKUB 2D6FA 2LQ8A 3VKIA 2KXDA 1VQ8A 3RMQA 3E9GA 2CSIA 1VQ6A 1X43A 3HRUA 2COZA 1ZSZC 2LNVA 2KEAA 2M02A 2ZCFB 4B6MA 1W6XA 4Y91A 2O01E 4AFZC 4C5EA 3MPUB 2M0YA 1Y96A 4DOWA 1GBQA 2JXBA 1IRXA 1QVFP 2K7AA 1YWPA 3TU4K 5IHNA 4ESRA 2LCCA 2GTJA 2FEIA 2GF7A 4E7SA 1WHGA 3RR6A 1VQ8T 2P4RA 1H3HA 1YJNQ 3CCJA 2ZGWA 2DRKA 3HKSA 4M7AF 4DEXA 2CZ6B 3OSVA 2DJZA 3JRZA 3CPWP 3OMGA 3UF4A 2DKGA 3H0IA 5GAN4 2SEMA 4GLKA 2EPDA 2HBPA 4PJLA 5GANj 3UPUA 4M77G 1KSWA 1R0BG 1VOMA 4M7AC 3LWIA 1VQPA 4L6V5 5J26A 2R58A 1D3BA 2HMAA 1U5SA 3CCJT 3CXCS 4D8KA 2VB6A 1WLPB 5GAMj 4NOYA 2V1RA 5GAN2 4PFOA 5DLOA 1VQKQ 1Y96B 8AT1B 5GMKi 4JRPA 3GF5A 5CIUA 3M0QA 2D8JA 1RADB 2EAYA 2V1QA 1OX9A 1Q86R 1ZUYA 2CP2A 2QASA 1AT1B 2J6FA 2LQNA 1W2BP 1VQPT 2VXEA 1OZ3A 2PNIA 3L42A 1AD5A 5D6YA 3QZ5B 2DIGA 3META 1R77A 4E6RA 3GIBA 2CZ0B 4J9DA 3I56A 1JQQA 2RD1A 4K11A 2WSEE 3A5ZB 4HVVA 3JCMV 3EFRA 1D3BB 2K4YA 4ZGEB 1YITA 1NYGA 4NL2A 4XAXB 1UB4A 2LCSA 3NFCA 2JW4A 1PG5B 4Y28E 1WHMA 4KGZB 3QWXX 1XNIA 1BYMA 5GJWB 4QT7A 1Q81R 4JLGA 4LXCA 1UGSB 4A4FA 1ZUUA 2A7YA 3S6WA 1KK7A 1QVGP 5EG2A 4KT0E 2HQHA 4R56A 4BE1A 1ZQ1A 2KR3A 4J6YA 4F14A 2HBWA 1YITT 4PJOC 2E70A 1MGQA 2RNAA 3LH5A 1EX4A 2NYSA 2HKNA 3GNFB 1T0JA 1TUGB 5HCKA 2XU8A 5CKDA 2CUBA 1KHIA 1VQ4A 2B86A 2CT4A 4C8QG 3MEUA 4CC7A 2ZPFB 1O75A 3GOXA 3KXTA 1OPLA 3QHSA 4M78D 2YT6A 3CCLQ 3JB9F 3QG1A 1OU9A 2PUOB 4LDUA 3O8VA 2E1HA 2DVJA 3G4SA 1MMGA 5J39A 1ZA1B 3M54A 1UGVA 1Y07A 2DXCA 5I11A 3QXEB 1VQ7T 3JCMc 2ED1A 1WHLA 1MV0B 1K9MR 4M7DA 1TUDA 3PMIA 2BE9B 5KCOA 4FSSA 2NWMA 4CC3A 1QWEA 4M77A 4XTZA 2GNCA 1K73U 2C0TA 3L2WA 3VV0A 3VJPA 1JJ2P 1FYNA 4M7DE 1PD1A 4QW2A 3ULRB 5KE3A 1D09B 5GJVB 2IVWA 1I0CA 1QCFA 4M77E 2KQWA 2BZYA 3HHTB 3OYMA 1QW1A 2DF6A 5DLQE 1SSFA 2KRNA 4EMGA 3CCQQ 4RTVA 3FJ5A 3SWNC 1IHVA 5LJ5d 1VYUA 3REAB 2F5KA 3C94A 1UHFA 1DJ7B 4C92G 5LJ3j 2RK2A 5A0LA 1KG1A 1KHCA 1GFCA 2C06A 1ARKA 1UGPB 1KFZA 3EHRA 2NLUA 2DTHA 2LP5A 2X4JA 1M2OA 4M7DB 3CCSA 2P0QA 3EGUA 3JCMX 4Z89A 1G2BA 5FWCA 2ESWA 4DOVA 4JRKA 3LWHA 4QVZA 4PFPA 1VQMA 2JVVA 1VQ7Q 2V8IA 5CKEA 2HDAA 2RQVA 1R8OB 1A0NB 2RJCA 3UATA 4IUPA 5D6WA 3CCUA 4FYXB 3PTAA 2P0KA 1RAIB 3TSZA 3JCMJ 2E4HA 4N4IA 2YLBA 4LDVA 3X26B 3RBBB 5KYXA 2LZ6B 2YXYA 2QDLA 3JV3A 1SRMA 2L5QA 1VQMT 2KYMA 1PM3A 3CMEQ 3VS4A 2PUKB 4BE2A 2FRYA 4EMKB 4HVUA 1X2KA 4C8QA 2ATCB 3CCUT 2Y90A 3FLGA 5GAN3 2MYSA 4J9IA 1JBMA 1YIJQ 1Q86U 1E6HA 3QUIA 1UE9A 3NMZC 1QKXA 3JAME 2LCLA 3ZEHA 4A4KA 4FL6A 2RQTA 4C8QE 2CP0A 1GXIE 5GMKe 3FJPA 2BE7D 2QEXT 4BDYA 2DL3A 2DETA 4OB0B 2OTLA 1BB9A 5D6XA 3X20B 2DBMA 2J7IA 2Z0WA 1PNJA 2OTJQ 3RERA 1WXTA 1OU8A 2HL5C 3ASKA 3MO8A 3OS0A 4AMCA 1Z9ZA 2L3RA 4J7FA 2MOXA 2E3HA 2XMFA 5AT1B 2ROTA 4ZN1A 3NTKA 4GBQA 1ZSZA 1BCMA 1D1CA 2EYQA 3PGGA 5GAOp 4PJOG 2PTKA 2XICA 4XK8E 4M75D 5KYXB 3C4SA 3RMSA 2MIOA 3AT1B 5GAN6 5I22A 3PVLA 2HSEB 2RHYA 5GANd 3CC7A 4RTZA 1QP2A 1K1ZA 2KGTA 4IKFA 3VS5A 4MZMA 1AZEA 3JSCA 3VYGA 5LL6S 2K57A 3E2UA 4LD9K 1N6AA 4OB3B 3A8GB 1I4K1 2BIVA 1TTHB 3DB3A 6AT1B 1Q81U 1WX6A 2X35A 1K9AA 4XTVA 1YCYA 2FRWA 1XOVA 3CC4A 2DPPB 2ECZA 3PIPA 3L2ZA 1PSFA 4J9GA 2X4WA 1JXMA 3SB2A 2A08A 1VQNT 1Y71A 4M77F 4GLMA 2KY9A 3OYEA 2QDYB 3HSBA 1VQ5Q 3A98A 2LRQA 4C92E 2KSSA 4C5IA 3L2UA 1PKSA 4OP0A 2KVQG 4FCYA 1FMKA 4M7AA 1ZSZB 5M9OA 2EGCA 2QA4A 3LGFA 3CC4T 5LJ5h 3CCVA 3ER0A 3X25B 2QEXQ 2DXUA 2GQIA 1D0ZA 4N4GA 1NBEB 1QQJA 2AKKA 7AT1B 4M7AE 1YN8A 5FU6C 1F1BB 1ZUKA 3J81E 4HCBA 4OMMA 2CP7A 4OMPA 4RTXA 1UUEA 4OMNA 4QVCA 1H92A 3P8HA 3OYCA 4F04B 1VQ9Q 4CC2A 1AWWA 2ZPHB 3RIRA 1HJDA 1K9MU 2QA4T 1D0XA 4MMLA 3CCVT 2V8KA 2Y4YA 1T3LA 4C0GA 4OVAA 4Z02A 2QTVA 5GAOm 4LUDA 2D9TA 5C6SA 3CCRT 1EIFA 2G3RA 1SHFA 2VV5A 1O9SA 3CPFA 2M51A 2DRMA 1WA7A 1TH7A 2DBKA 4M7AB 1QMCA 1Z9QA 1RAHB 1VA7A 2X9HA 2DAQA 4PFZA 1VQNQ 1M3CA 3QPHA 1YJNA 4F7UG 1KQ1A 4Q5WA 2AT1B 5IAYA 2LQKA 4MZPA 2E65A 2D1XA 3JCMW 5FROA 2O4XA 2H8HA 4J7IA 5CVIA 2R5AA 3L2QA 4X34A 2P0PA 3DB4A 5A0GA 2J6KA 2EGAA 3FEOA 1VQOQ 3A8OB 4PJOA 1ZHIA 3QIIA 4N0AC 4C8QF 3OB9A 4E7IA 4RTTA 3A1PA 2EFIA 1YJNT 5ECAA 3OY9A 3ME9A 5HK0A 2VXFA 3CMAT 1YI2T 4PJOE 2GFUA 1VQKA 4E7LA 2CP3A 4PLIA 2DVEA 1X27A 2EQUA 2AIRB 3EG9A 3CCVQ 1MMNA 1LOJA 2CH4A 2W10A 2EVRA 4DQ2A 1M90U 3CCRQ 1AVZC 2CGHA 2CP6A 1BK2A 3MEAA 2EYYA 2OX7A 5LJ3d 2PU9B 2L8DA 5HK3A 3MHXA 2OI3A 1KC8C 1BI3A 1QVFS 1KC8R 3LLRA 3CBMA 4JUVA 4M78G 4ZGDB 5J3BA 2XD0A 3VUZA 2MPXC 4BE0A 4IUQA 3R6NA 2X51A 3OBWA 2E41A 2QGFB 3BDUA 2XKOC 4J9FA 2RI2A 4C92F 3SWNA 3PMTA 1OYXA 3UT1A 1KQSP 4ME7A 3LGLA 3CXCA 4HA8A 3EG9B 3M4GA 4WTOB 1W4SA 4JJNK 2LQWA 3QWYA 1W2BA 4BI3A 2SRCA 1X2QA 4BB7A 4E2FB 3I55Q 2DZCA 2RO0A 1WFWA 3FRNA 3CMAQ 3OW2P 1VQLQ 2MK5A 5FWBA 3AHUA 2F2XA 2VASA 4C92C 3CBPA 1YI2Q 1GL5A 4A4HA 3EG1A 2VC8A 1Y0MA 1WJQA 1JEGA 1S72T 1UGQB 3HTRA 1M1KU 4JPBW 2YUNA 4IIMA 4IUUA 4ELZC 1QCOA 1UHCA 1X6GA 2O31A 4ATOA 3OA6A 1NPRA 1WPYA 2MMPA 1VYTA 2OJ2A 4AT1B 1MMDA 3CCLA 3DLLA 2M0OA 5GAN8 2QXFA 3OQ5A 3V7CA 3EHQA 1RAFB 1T0HA 1W2BS 4F7UA 4OMQA 3SFMA 2KK4A 3EG0A 3SWNB 2DXBA 5GMKj 1Q86C 2F5TX 2JN0A 2M16A 1BI1A 3WVEB 1K0XA 2ZPGB 2LJ1A 1TWBA 2EQKA 3WVDB 1FWZA 1G3TA 2LX7A 1U06A 2L89A 4KGXB 4F7UE 1WIEA 4FT4A 2F69A 1UDLA 3CCLT 4YTLA 2DA9A 1K8AR 2OAWA 1R0CB 3RNJA 4O5VA 5D7UA 4CI0C 3T9NA 3JCMP 3P8DA 2LMJA 2DYBA 1MUZA 2CZ1B 5I2SA 2ZPIB 3A8MB 2DJQA 3CCQA 4AG1C 2RHIA 1AOJA 4CC4B 3LX7A 1QVGS 3JB9H 1S72Q 4JZ4A 2W0ZA 2PQWA 2EKHA 1G8XA 5CQXA 3CC2A 1LCKA 1OZ2A 2KRSA 4PJOF 1Q81C 5CCAA 1YP5A 3RKWA 1BI2A 4JS4A 1YHQT 1W70A 3PFSA 3M0TA 3CCQT 3EFOA 4R55A 2RH2A 1GCQC 2MI6A 5CQYA 3OMCA 2DFUA 2JT4A 4PJNA 3G71T 4HCZA 4RUGA 3O5ZA 1NLPC 4ZN3A 2K5IA 1IB8A 3HP9A 5GAN5 3CC2T 1VQ7A 4FSXA 2RHXA 4EPCA 5FRMA 2RQUA 4P5NA 1UJ0A 5HY6A 2PVOB 3VS2A 3EG2A 1E6GA 4XTWA 3F70A 1UJYA 1VUBA 1G3SA 2EYWA 4C0FA 3OYFA 3VS1A 1TOVA 2CDTA 2E6NA 1B3QA 5I21A 4XU0A 1AZGB 2VKNA 1UECA 1M1FA 4M75G 2A36A 4F16A 1ABQA 5IN1A 1JJ2S 4D8DA 4BACA 1K9MC 1Y57A 4PJJA 3CMEA 2YUPA 5LJ5e 4OF1A 2KT1A 1U3OA 3EFOB 2QQRA 2DM1A 3MJXA 2AZVA 1YIJA 5HKCA 4PKCC 4OGCA 5AYFA 3SD4A 3I5RA 3P8BB 1G3YA 1PRLC 2QGGA 1WHHA 4DBHA 2G6FX 2KXCA 3MEVA 3OYKA 4E7ZA 3CMET 1YHQQ 1NEBA 2OTJA 2JS2A 2D0NA 4KH0B 2RI3A 1H641 1HSQA 2EYZA 2L3SA 1OPKA 2RMOA 4HT8A 4M7DD 3WXMB 1G83A 2CKKA 3GBQA 3G71Q 5L23A 1YIJT 3FDRA 4XQ3A 1KC8U 4QKUA 2DILA 4M77D 3CC2Q 2JS0A 1PWTA 1M3BA 2E10A 1NYFA 1NM7A 4L5GA 2CP5A 2OTJT 2JUFA 5IHIA 4XU2A 2EGEA 4J9CA 2DL8A 2RI5A 4F7UF 4M77B 3HPWA 1KJWA 1JRIA 2M9UA 3H9NA 1SG5A 3CD6Q 4AFSC 3RUXA 2YLCA 3MKDA 2DNUA 3QJ6A 2X4YA 2KE9A 1VQ5A 1MV3A 2HCKA 4N0AA 1M90C 3ZBDA 1IO6A 1BKBA 4NS5A 3CCMT 4EIKA 2LX9A 5GAOr 1WYXA 3M57A 1M90R 3M0PA 2KYBA 2QEXA 4JJDA 3HFNA 3NTIA 3X28B 1RAAB 1ZX6A 2K3YA 2ABLA 1B07A 2RJFA 4J9BA 5DY9A 1OEBA 3L2VA 1VQ5T 1M2VA 1VQ9A 4OGEA 3OYBA 2HZYA 2FPDA 2NUZA 2I0NA 4IURA 4C0DC 1K8AU 3DKMA 2CS7A 1I07A 2JMAA 4FM4B 4X9DA 4LNPA 2DL5A 2DMOA 2P84A 3VRYA 1RL2A 2IIMA 2HL3A 4M78F 1IZ6A 2RN8A 2AZSA 2K5FA 1VQ9T 3QYHB 4FT2A 1SEMA 4M75E 4C8QD 3EFSA 5CAIA 1X01A 2EQJA 1RACB 1XTDA 2K3BA 3Q1JA 2DTIA 1M1KC 1Q82U 1QCNA 1VQNA 2FB7A 4M78C 4NL3A 1M1KR 3JCMb 2QK0A 2RK1A 4C8QB 3QDFA 3FB9A 2ROLA 2A37A 2KRMA 1HK9A 2QG9B 2GFAA 2O2OA 1N8RC 3G6EA 2XDPA 4TVRA 1V1CA 3CCMQ 3J7AF 5GAMd 2KBTA 1N8RR 2YRDA 4QQGA 3OYHA 3E1SA 1ZLMA 4J6XA 1VQOA 4C92A 4LDXA 1IREB 1QLYA 3OBYA 2Y4XA 1H8KA 1GRIA 4J83A 3G7ZA 2EJGA 4HKEA 1E7OA 3GP8A 2A0FB 1PSEA 1QP3A 3RDVA 2PZ1A 3A8HB 3G6ET 2KMTA 2LVMA 1J3TA 2EKOA 1VQOT 1YNZA 3ZL7C 1D1AA 1OV3A 4HXJA 1CSKA 5FLXE 3CCRA 2NUTA 2QQBA 1WDXA 3QO3A 5KYWA 1FMWA 2JTEA 3LH0A 2MF2A 2JOYA 1BBZA 3MCAB 2YUOA 3KBGA 1X6BA 3U23A 1OULA 4C92B 4FU6A 4FYYB 2FPFA 4M7AD 4Y92A 4KH1B 4DBQA 2DO3A 2KT8A 3PE0A 2RJDA 2RQRA 4LN2A 4WF2A 4JRQA 4A4GA 2H3JA 2V26A 3BW1A 3MEWA 4MZTA 4PL6A 2LJ0A 2KDSA 3OS1A 4PLLA 4XTXA 5FU7C 1V76A 3NPFA 3QKJA 4L59A
chains in the Genus database with same CATH topology
5FW9A 1UG1A 4JPBW 2YUNA 1NG2A 4IIMA 2DVJA 1UHCA 2CUDA 1X6GA 1UTIA 2O31A 1UGVA 3REBB 1AWXA 5I11A 2YSQA 2ED1A 1VYTA 2OJ2A 1MV0B 1X69A 1TUDA 4FSSA 3EHQA 2NWMA 1M27C 4CC3A 1QWEA 1T0HA 1GCQA 2ENMA 2GNCA 4OMQA 1AWJA 2CREA 1RUWA 2BTTA 2C0TA 1JXOA 2KROA 3EG0A 2HEQA 1M3AA 1AWOA 1FYNA 4LUEA 3M0RA 4OMLA 3ULRB 2CT3A 1K0XA 5GJVB 2C0OA 2LJ1A 1I0CA 1QCFA 1JO8A 1U06A 2LX7A 3I5SA 1WIEA 2BZYA 2HSPA 1UDLA 2DF6A 3TSWA 1OOTA 2DA9A 2KRNA 2CSQA 4RTVA 3FJ5A 2OAWA 3RNJA 1NEGA 1VYUA 3REAB 3M0UA 2LNHB 1UHFA 4A63B 1W1FA 2LMJA 2DYBA 1PKTA 2FPEA 1MUZA 3NGPA 1GFCA 1ARKA 1KFZA 5EC7A 3EHRA 2FG0A 2DJQA 1SPKA 2LP5A 1SSHA 4AG1C 1AOJA 1CKAA 4ZNXA 2FO0A 4CC4B 3EGUA 1TUCA 2J06A 2AKLA 1GBRA 3SHWA 4Z89A 4JZ4A 1G2BA 1N5ZA 2W0ZA 2L3QA 2EKHA 1M8MA 5FWCA 1LCKA 3I35A 2KRSA 2ESWA 1YP5A 4AG2C 3CQTA 3H0FA 4R0KA 1W70A 2HDAA 3M0TA 2DE0X 2RQVA 4X1VA 1GCQC 2D8HA 1A0NB 3UATA 2JT4A 2VWFA 3VRZA 1RI9A 2CH4W 4RUGA 3TSZA 3O5ZA 5IHKA 1NLPC 3RBBB 2LZ6B 2O9VA 2RQUA 1UJ0A 4J9HA 3VS2A 2QDLA 3H0HA 1SRMA 3EG2A 3JV3A 1E6GA 2KYMA 2X3XD 1UJYA 2K9GA 2EYWA 2C0IA 3VS4A 4IIOA 2FRYA 3KFVA 3VS1A 2CDTA 2RQWA 4HVUA 1X2KA 2MCNA 1B3QA 1AZGB 2VKNA 1UECA 3TVTA 4J9IA 2A28A 2A36A 1E6HA 4F16A 1ABQA 1UE9A 3NMZC 4D8DA 1QKXA 1WXBA 1Y57A 2RQTA 2L2PA 2YUPA 2DL3A 3EG3A 1BB9A 2KT1A 1U3OA 2DBMA 1K0SA 2J7IA 2DM1A 1PNJA 4HCKA 4Z88A 1WXTA 2EBPA 3NHNA 2E5KA 1PRMC 1Z9ZA 2AZVA 2DLPA 2MOXA 1AEYA 2J05A 3I5RA 4M4ZA 1ZBJA 2XMFA 2ROTA 4GBQA 1PRLC 2PTKA 2G6FX 4JJBA 2ED0A 2KXCA 4Z8AA 1SHGA 4WCIA 2MIOA 1SRLA 5I22A 2LJ3A 1NEBA 3PVLA 2JS2A 2VVKA 5IXBA 2GGRA 4RTZA 2D0NA 1K1ZA 2KGTA 1HSQA 1ZSGA 3VS5A 3THKA 2EYXA 2EYZA 2L3SA 1OPKA 2RMOA 1AZEA 1G83A 3GBQA 2DL7A 5L23A 4AFQC 2K6DA 2DILA 5IXFA 2JS0A 3VS6A 4DEYA 1WX6A 1K9AA 1PWTA 2FRWA 1XOVA 1M3BA 2L0AA 2BZ8A 2ECZA 2K79A 1NYFA 1NM7A 2DX1A 4J9GA 5IHIA 3M0SA 1JXMA 2EGEA 2A08A 3UA7A 4J9CA 2DL8A 1EFNA 4AFUC 4GLMA 4RTUA 3I9QA 4F17A 1KJWA 3A98A 1PKSA 1FMKA 4JJCA 3VS7A 2O9SA 2EGCA 2RF0A 1CKBA 1ABOA 4J9EA 4RTWA 4HVWA 4AFSC 2GQIA 1UFFA 2DNUA 2J6OA 1K76A 1I1JA 2AKKA 2KE9A 2K2MA 1YN8A 2KXDA 1S1NA 1ZUKA 1GFDA 2CSIA 1X43A 1MV3A 4LE9A 2HCKA 2L3PA 3IQLA 4OMMA 4RTXA 4OMPA 3UA6A 1IO6A 1UUEA 2KEAA 4OMNA 1H92A 4EIKA 1WYXA 1W6XA 4CC2A 3M0PA 1AWWA 1HJDA 2KYBA 4AFZC 4JJDA 2M0YA 1GBQA 1HD3A 2JXBA 2KNBB 1T3LA 2K7AA 1YWPA 1ZX6A 2ABLA 1B07A 2AK5A 5IHNA 3VS0A 4ESRA 2GTJA 1VYVA 2FEIA 4J9BA 3H41A 1OEBA 2P4RA 1H3HA 4LUDA 4OMOA 1KIKA 1YCSB 1SHFA 2M51A 2DRMA 2DRKA 1WA7A 2YDLA 2DBKA 1Z9QA 4DEXA 2FPDA 2NUZA 2I0NA 1VA7A 1I07A 2F2VA 3UF4A 2JMAA 4LNPA 2DL5A 2DMOA 2GBQA 3H0IA 2SEMA 2EPDA 3VRYA 2IIMA 1M3CA 1WXUA 2DL4A 1KSWA 2O88A 2RN8A 2AZSA 2GTOA 1SEMA 2D1XA 1U5SA 2H8HA 4D8KA 1WLPB 2K3BA 4RTYA 2V1RA 2J6KA 2EGAA 2JM9A 1NLOC 2BZXA 3M0QA 2D8JA 1JU5C 2V1QA 2ROLA 2A37A 1ZUYA 2KRMA 4RTTA 5ECAA 2O2OA 1V1CA 2J6FA 2KBTA 2LQNA 2F2WA 1RLQC 1ZLMA 1YWOA 2PNIA 1QLYA 1X27A 1AD5A 2JM8A 1M30A 1H8KA 1GRIA 3C0CA 4E6RA 1GCPA 1TG0A 1WI7A 1E7OA 4J9DA 2CH4A 2W10A 1K4US 1JQQA 4K11A 2EVRA 2PZ1A 4HVVA 1AVZC 1QWFA 1BK2A 1J3TA 5IH2A 2EYYA 3SEMA 1NYGA 2OI3A 1YNZA 2LCSA 2JW4A 3ZL7C 1OV3A 1QKWA 4KRTA 4HXJA 1CSKA 3QWXX 5GJWB 4QT7A 1WDXA 1ZUUA 3PVQA 2JTEA 3R6NA 1BBZA 4ORZA 1BU1A 2YUOA 1PHTA 2EQIA 2JMCA 1X6BA 4J9FA 2EW3A 3U23A 2KR3A 4F14A 2HBWA 2FPFA 2RNAA 3LH5A 4Y92A 1T0JA 2LQWA 3QWYA 2RPNA 3VS3A 5HCKA 2SRCA 2KT8A 1X2QA 2CUBA 2B86A 2CT4A 3PE0A 2RQRA 2YUQA 1T3SA 4LN2A 4CC7A 4JZ3A 1OPLA 1WFWA 1RLPC 5FWBA 2X3WD 2F2XA 2YT6A 1GL5A 2LJ0A 3EG1A 1Y0MA 1JEGA 3NPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW9 A;  1UG1 A;  4JPB W;  2YUN A;  1NG2 A;  4IIM A;  2DVJ A;  1UHC A;  2CUD A;  1X6G A;  1UTI A;  2O31 A;  1UGV A;  3REB B;  1AWX A;  5I11 A;  2YSQ A;  2ED1 A;  1VYT A;  2OJ2 A;  1MV0 B;  1X69 A;  1TUD A;  4FSS A;  3EHQ A;  2NWM A;  1M27 C;  4CC3 A;  1QWE A;  1T0H A;  1GCQ A;  2ENM A;  2GNC A;  4OMQ A;  1AWJ A;  2CRE A;  1RUW A;  2BTT A;  2C0T A;  1JXO A;  2KRO A;  3EG0 A;  2HEQ A;  1M3A A;  1AWO A;  1FYN A;  4LUE A;  3M0R A;  4OML A;  3ULR B;  2CT3 A;  1K0X A;  5GJV B;  2C0O A;  2LJ1 A;  1I0C A;  1QCF A;  1JO8 A;  1U06 A;  2LX7 A;  3I5S A;  1WIE A;  2BZY A;  2HSP A;  1UDL A;  2DF6 A;  3TSW A;  1OOT A;  2DA9 A;  2KRN A;  2CSQ A;  4RTV A;  3FJ5 A;  2OAW A;  3RNJ A;  1NEG A;  1VYU A;  3REA B;  3M0U A;  2LNH B;  1UHF A;  4A63 B;  1W1F A;  2LMJ A;  2DYB A;  1PKT A;  2FPE A;  1MUZ A;  3NGP A;  1GFC A;  1ARK A;  1KFZ A;  5EC7 A;  3EHR A;  2FG0 A;  2DJQ A;  1SPK A;  2LP5 A;  1SSH A;  4AG1 C;  1AOJ A;  1CKA A;  4ZNX A;  2FO0 A;  4CC4 B;  3EGU A;  1TUC A;  2J06 A;  2AKL A;  1GBR A;  3SHW A;  4Z89 A;  4JZ4 A;  1G2B A;  1N5Z A;  2W0Z A;  2L3Q A;  2EKH A;  1M8M A;  5FWC A;  1LCK A;  3I35 A;  2KRS A;  2ESW A;  1YP5 A;  4AG2 C;  3CQT A;  3H0F A;  4R0K A;  1W70 A;  2HDA A;  3M0T A;  2DE0 X;  2RQV A;  4X1V A;  1GCQ C;  2D8H A;  1A0N B;  3UAT A;  2JT4 A;  2VWF A;  3VRZ A;  1RI9 A;  2CH4 W;  4RUG A;  3TSZ A;  3O5Z A;  5IHK A;  1NLP C;  3RBB B;  2LZ6 B;  2O9V A;  2RQU A;  1UJ0 A;  4J9H A;  3VS2 A;  2QDL A;  3H0H A;  1SRM A;  3EG2 A;  3JV3 A;  1E6G A;  2KYM A;  2X3X D;  1UJY A;  2K9G A;  2EYW A;  2C0I A;  3VS4 A;  4IIO A;  2FRY A;  3KFV A;  3VS1 A;  2CDT A;  2RQW A;  4HVU A;  1X2K A;  2MCN A;  1B3Q A;  1AZG B;  2VKN A;  1UEC A;  3TVT A;  4J9I A;  2A28 A;  2A36 A;  1E6H A;  4F16 A;  1ABQ A;  1UE9 A;  3NMZ C;  4D8D A;  1QKX A;  1WXB A;  1Y57 A;  2RQT A;  2L2P A;  2YUP A;  2DL3 A;  3EG3 A;  1BB9 A;  2KT1 A;  1U3O A;  2DBM A;  1K0S A;  2J7I A;  2DM1 A;  1PNJ A;  4HCK A;  4Z88 A;  1WXT A;  2EBP A;  3NHN A;  2E5K A;  1PRM C;  1Z9Z A;  2AZV A;  2DLP A;  2MOX A;  1AEY A;  2J05 A;  3I5R A;  4M4Z A;  1ZBJ A;  2XMF A;  2ROT A;  4GBQ A;  1PRL C;  2PTK A;  2G6F X;  4JJB A;  2ED0 A;  2KXC A;  4Z8A A;  1SHG A;  4WCI A;  2MIO A;  1SRL A;  5I22 A;  2LJ3 A;  1NEB A;  3PVL A;  2JS2 A;  2VVK A;  5IXB A;  2GGR A;  4RTZ A;  2D0N A;  1K1Z A;  2KGT A;  1HSQ A;  1ZSG A;  3VS5 A;  3THK A;  2EYX A;  2EYZ A;  2L3S A;  1OPK A;  2RMO A;  1AZE A;  1G83 A;  3GBQ A;  2DL7 A;  5L23 A;  4AFQ C;  2K6D A;  2DIL A;  5IXF A;  2JS0 A;  3VS6 A;  4DEY A;  1WX6 A;  1K9A A;  1PWT A;  2FRW A;  1XOV A;  1M3B A;  2L0A A;  2BZ8 A;  2ECZ A;  2K79 A;  1NYF A;  1NM7 A;  2DX1 A;  4J9G A;  5IHI A;  3M0S A;  1JXM A;  2EGE A;  2A08 A;  3UA7 A;  4J9C A;  2DL8 A;  1EFN A;  4AFU C;  4GLM A;  4RTU A;  3I9Q A;  4F17 A;  1KJW A;  3A98 A;  1PKS A;  1FMK A;  4JJC A;  3VS7 A;  2O9S A;  2EGC A;  2RF0 A;  1CKB A;  1ABO A;  4J9E A;  4RTW A;  4HVW A;  4AFS C;  2GQI A;  1UFF A;  2DNU A;  2J6O A;  1K76 A;  1I1J A;  2AKK A;  2KE9 A;  2K2M A;  1YN8 A;  2KXD A;  1S1N A;  1ZUK A;  1GFD A;  2CSI A;  1X43 A;  1MV3 A;  4LE9 A;  2HCK A;  2L3P A;  3IQL A;  4OMM A;  4RTX A;  4OMP A;  3UA6 A;  1IO6 A;  1UUE A;  2KEA A;  4OMN A;  1H92 A;  4EIK A;  1WYX A;  1W6X A;  4CC2 A;  3M0P A;  1AWW A;  1HJD A;  2KYB A;  4AFZ C;  4JJD A;  2M0Y A;  1GBQ A;  1HD3 A;  2JXB A;  2KNB B;  1T3L A;  2K7A A;  1YWP A;  1ZX6 A;  2ABL A;  1B07 A;  2AK5 A;  5IHN A;  3VS0 A;  4ESR A;  2GTJ A;  1VYV A;  2FEI A;  4J9B A;  3H41 A;  1OEB A;  2P4R A;  1H3H A;  4LUD A;  4OMO A;  1KIK A;  1YCS B;  1SHF A;  2M51 A;  2DRM A;  2DRK A;  1WA7 A;  2YDL A;  2DBK A;  1Z9Q A;  4DEX A;  2FPD A;  2NUZ A;  2I0N A;  1VA7 A;  1I07 A;  2F2V A;  3UF4 A;  2JMA A;  4LNP A;  2DL5 A;  2DMO A;  2GBQ A;  3H0I A;  2SEM A;  2EPD A;  3VRY A;  2IIM A;  1M3C A;  1WXU A;  2DL4 A;  1KSW A;  2O88 A;  2RN8 A;  2AZS A;  2GTO A;  1SEM A;  2D1X A;  1U5S A;  2H8H A;  4D8K A;  1WLP B;  2K3B A;  4RTY A;  2V1R A;  2J6K A;  2EGA A;  2JM9 A;  1NLO C;  2BZX A;  3M0Q A;  2D8J A;  1JU5 C;  2V1Q A;  2ROL A;  2A37 A;  1ZUY A;  2KRM A;  4RTT A;  5ECA A;  2O2O A;  1V1C A;  2J6F A;  2KBT A;  2LQN A;  2F2W A;  1RLQ C;  1ZLM A;  1YWO A;  2PNI A;  1QLY A;  1X27 A;  1AD5 A;  2JM8 A;  1M30 A;  1H8K A;  1GRI A;  3C0C A;  4E6R A;  1GCP A;  1TG0 A;  1WI7 A;  1E7O A;  4J9D A;  2CH4 A;  2W10 A;  1K4U S;  1JQQ A;  4K11 A;  2EVR A;  2PZ1 A;  4HVV A;  1AVZ C;  1QWF A;  1BK2 A;  1J3T A;  5IH2 A;  2EYY A;  3SEM A;  1NYG A;  2OI3 A;  1YNZ A;  2LCS A;  2JW4 A;  3ZL7 C;  1OV3 A;  1QKW A;  4KRT A;  4HXJ A;  1CSK A;  3QWX X;  5GJW B;  4QT7 A;  1WDX A;  1ZUU A;  3PVQ A;  2JTE A;  3R6N A;  1BBZ A;  4ORZ A;  1BU1 A;  2YUO A;  1PHT A;  2EQI A;  2JMC A;  1X6B A;  4J9F A;  2EW3 A;  3U23 A;  2KR3 A;  4F14 A;  2HBW A;  2FPF A;  2RNA A;  3LH5 A;  4Y92 A;  1T0J A;  2LQW A;  3QWY A;  2RPN A;  3VS3 A;  5HCK A;  2SRC A;  2KT8 A;  1X2Q A;  2CUB A;  2B86 A;  2CT4 A;  3PE0 A;  2RQR A;  2YUQ A;  1T3S A;  4LN2 A;  4CC7 A;  4JZ3 A;  1OPL A;  1WFW A;  1RLP C;  5FWB A;  2X3W D;  2F2X A;  2YT6 A;  1GL5 A;  2LJ0 A;  3EG1 A;  1Y0M A;  1JEG A;  3NPF A; 
#chains in the Genus database with same CATH topology
 5FW9 A;  1UG1 A;  1YJW T;  2B8A A;  2CUD A;  3OYA A;  3J80 E;  3I55 A;  1VIF A;  3CMA A;  1VQL A;  4O6J A;  1C1A A;  1FMV A;  2YSQ A;  1YI2 A;  4FYW B;  2NUT B;  4EMK C;  3G6E Q;  4N4H A;  5KYW B;  2EJ9 A;  1N27 A;  1WGS A;  2YHT A;  2ENM A;  1GCQ A;  2QYZ A;  1U1T A;  1AWJ A;  2CRE A;  3MP1 A;  1WQ7 A;  3ZFJ A;  2KRO A;  1WJR A;  2DTO A;  4IUV A;  2HEQ A;  1M3A A;  1AWO A;  4LUE A;  1G3W A;  3M0R A;  2CT3 A;  2C0O A;  4C5H A;  3FC3 A;  2AHJ B;  2M1H A;  1M9S A;  3I55 T;  4UC4 A;  4II1 A;  2DZ9 A;  1VQL T;  2HSP A;  3CCE Q;  3H8Z A;  1QVF A;  5LJ3 e;  2QTX A;  3QZ9 B;  3NTH A;  1B34 A;  2HQE A;  3TSW A;  4QVD A;  4JRI A;  4KBM B;  5CK9 A;  1B7T A;  3VU3 C;  1MNE A;  3M0U A;  4M75 F;  3M4Y A;  2EJF A;  3HFO A;  3EAE A;  3M55 A;  3MP6 A;  3EGD A;  4XU3 A;  3NGP A;  3TRE A;  2A3L A;  5EC7 A;  2FG0 A;  3CPW A;  1SPK A;  2GCX A;  5GAN h;  1G5V A;  1CKA A;  4ZNX A;  2O4X B;  4M75 C;  3JCM d;  2J06 A;  2AKL A;  1GBR A;  3MP8 A;  2HAX A;  3SHW A;  1N5Z A;  2L3Q A;  1M8M A;  1YJW Q;  2VUB A;  3GPL A;  3I35 A;  1KQS S;  3KUF A;  4PJO B;  5GAM h;  2HNI A;  1HYO A;  2YWW A;  4AG2 C;  1X6O A;  4ELY C;  4R0K A;  5GMK l;  1P92 A;  4JS5 A;  1AHJ B;  1M5Q 1;  4X1V A;  4C5G A;  1B34 B;  3OW2 S;  1S72 A;  3X24 B;  1JB0 E;  2FZK B;  1U8R A;  2VWF A;  3VRZ A;  1RI9 A;  2R5M A;  3CPW S;  3JB9 D;  1YJ9 T;  2LDM A;  2O9V A;  3QYG B;  1EZZ B;  3EGD B;  1TU0 B;  4RMO A;  1IGU A;  4RCC A;  5L8R E;  1RAE B;  4RG8 A;  2X3X D;  4ZGJ B;  3OYJ A;  5GMK m;  2C0I A;  4IIO A;  3RKY A;  2GQV A;  4PK4 A;  3KFV A;  3OYL A;  1KD1 C;  1VIE A;  2MCN A;  1KD1 R;  3TVT A;  1VQ6 T;  1D1B A;  2OAU A;  1WXB A;  4OB1 B;  2VYT A;  4FIB A;  1N8R U;  3QDR B;  4OB2 B;  2DER A;  5LJ5 g;  3OYI A;  2BKD N;  4XTU A;  4E47 A;  1K0S A;  4M7D G;  3EGX A;  2COW A;  1YFN A;  4Z88 A;  2EBP A;  2XID A;  4J5Y A;  1ZBJ A;  2X4X A;  1QVG A;  3C12 A;  3M5A A;  1NPP A;  3LW5 E;  2ED0 A;  1K8A C;  1RAG B;  2R57 A;  1SHG A;  4WCI A;  2HQX A;  2LJ3 A;  4E7K A;  2FZG B;  2GGR A;  2LT1 A;  3THK A;  3OYD A;  3V8J A;  3R6O A;  4DBR A;  5DM7 R;  3PNW C;  2DL7 A;  1IHW A;  4AFQ C;  3INZ A;  2P4T A;  3CXC P;  5C0M A;  1YJ9 Q;  5IXF A;  3VS6 A;  3QBY A;  1YHQ A;  2JJ9 A;  2JNG A;  2L0A A;  2BZ8 A;  1Q82 C;  2E12 A;  3S3N A;  1RAB B;  1Q82 R;  4DBF A;  3G71 A;  3UA7 A;  1EFN A;  3EGX B;  4PJM A;  4RTU A;  3SDZ A;  4AFU C;  1NE8 A;  4F7U B;  2VGM A;  2VGN A;  5I2M A;  4CRI A;  4F17 A;  9ATC B;  1VQ8 Q;  1N9S A;  1VQ6 Q;  3FIF A;  3TCJ A;  4BY6 C;  1PD0 A;  4JJC A;  2PVD B;  2CZ7 B;  3M9Q A;  1C0M A;  3A8L B;  2FL7 A;  1ABO A;  1MMA A;  4HVW A;  2BUD A;  1JJ2 A;  2DD5 A;  3V8K A;  1UFF A;  3JCM Q;  2J6O A;  1K76 A;  1I1J A;  3OS5 A;  4BUG A;  4M78 A;  2K2M A;  4FYV B;  1V29 B;  1S1N A;  1GFD A;  4IUT A;  4LE9 A;  3I56 T;  2L3P A;  3IQL A;  3UA6 A;  1M1G A;  1WQW A;  3OYN A;  4MDW A;  3CD6 A;  4M78 E;  3CCJ Q;  5LJ3 h;  3JCM h;  1ACM B;  2RHZ A;  1HD3 A;  2DXT A;  2LC4 A;  4QQ6 A;  3OSS C;  1I81 A;  2DK3 A;  2KNB B;  2E64 A;  4C0D B;  2ZAE A;  2AK5 A;  3VS0 A;  1VYV A;  3H41 A;  2RA2 A;  2NUP A;  4EMH A;  4OMO A;  5CKF A;  3VYH B;  1YCS B;  4X9C A;  5CO7 A;  1KIK A;  1OI1 A;  2YDL A;  3L2R A;  1NJI C;  3CBO A;  5GAN g;  1VQP Q;  2KAF A;  2YRV A;  4VUB A;  3CD6 T;  1UGR B;  1ZA2 B;  1NZ9 A;  2F2V A;  4BI4 A;  1LNX A;  1NJI R;  2GBQ A;  3HL8 A;  1WXU A;  2DL4 A;  4XTY A;  4M78 B;  2O88 A;  2ZPB B;  5GAM g;  3VUB A;  4A53 A;  3M56 A;  1VQ4 T;  2GTO A;  2LTO A;  4RTY A;  5KYY A;  2H3E B;  2JM9 A;  4DA4 A;  3UDC A;  1I5L A;  1NLO C;  3G4S T;  2WSF E;  2BZX A;  2XDB A;  4OMF B;  2XI9 A;  2WAC A;  1JU5 C;  5IT9 E;  3I56 Q;  3BE3 A;  5LJ5 f;  2NUP B;  2ZZD A;  2FZC B;  3M59 A;  1M4Z A;  3JB9 I;  2E3I A;  2F2W A;  2DD4 A;  1RLQ C;  4LDW A;  3L1A A;  1YWO A;  2DYI A;  2JM8 A;  4J6W A;  1M30 A;  1IGQ A;  3C0C A;  1YIT Q;  1GCP A;  1TG0 A;  1WI7 A;  3G1J A;  3URG A;  3EH1 A;  3JB9 J;  1K4U S;  1MND A;  1Q7Y C;  3E19 A;  3CCM A;  4HT9 A;  5FU6 B;  1KQ2 A;  1Q7Y R;  1QWF A;  2K3X A;  4EMK A;  5IH2 A;  4M7A G;  3SEM A;  3UWN A;  2JTM A;  2LT4 A;  2RHU A;  1KD1 U;  1QKW A;  4KRT A;  1PCX A;  2XK0 A;  3BY7 A;  1VQ4 Q;  1I5O B;  3RES A;  3PVQ A;  1Y7X A;  4MDX A;  4QQD A;  2IPO B;  1TSF A;  4ORZ A;  1BU1 A;  3GNG A;  1PHT A;  2EQI A;  2JMC A;  1YBY A;  3CCS T;  2EW3 A;  2PVG B;  4EDU A;  4KUD K;  4ZTF A;  5FU7 B;  2RPN A;  3VS3 A;  3G4S Q;  2DEU A;  4MMK A;  2YUQ A;  1T3S A;  5CKB A;  4JZ3 A;  5CR2 A;  3N5B B;  1BCO A;  1RLP C;  5KE2 A;  4V2S A;  2X3W D;  3TEE A;  5GAN e;  1BIA A;  4BI8 B;  1N9R A;  2XHC A;  1WJS A;  3BFM A;  2JTF A;  2D0Q B;  4M75 A;  5GAN 7;  3QSU A;  1NG2 A;  2COY A;  1UTI A;  1WHJ A;  3REB B;  2HD0 A;  5GAM e;  1AWX A;  2K2V A;  4KUL A;  4LDY A;  4LD6 A;  1X69 A;  5A0D A;  5KYU A;  3TQ7 P;  1M27 C;  3BDL A;  1HXD A;  1U1S A;  2MWP A;  1RI0 A;  1RUW A;  2BTT A;  1JXO A;  4RG2 A;  2K5L A;  4OML A;  5GAN f;  1C6V X;  2V8J A;  2I2L A;  4A54 A;  8ATC B;  1LVK A;  1JO8 A;  3PT9 A;  3I5S A;  1FX7 A;  1M2V B;  1UEB A;  2YRC A;  5KH6 A;  1OOT A;  5LJ3 g;  3JCM g;  1WZO A;  2MWO A;  3S3M A;  2CSQ A;  2OTL T;  3CEY A;  1NEG A;  2QI2 A;  4ANJ A;  5GAM f;  1BI0 A;  4GY5 A;  3CCS Q;  4FW1 A;  1I8F A;  2LNH B;  3QJY A;  2DEQ A;  4M75 B;  4A63 B;  1W1F A;  1OQK A;  1PKT A;  2FPE A;  3CCE A;  1XJW B;  4ZTJ A;  3V8L A;  1TXQ A;  1SSH A;  1VQM Q;  1FXX A;  4M7D F;  3RKX A;  2FO0 A;  5KYU B;  2QQ9 A;  1TUC A;  3CC7 T;  4RCB A;  4B9X A;  3JB9 G;  3CCU Q;  4J8O A;  4C92 D;  4KUI A;  3D7S B;  3CQT A;  3CCE T;  3H0F A;  4M7D C;  2KI7 A;  2DE0 X;  2D8H A;  4M77 C;  3E9F A;  1NJI U;  3DLM A;  2WSC E;  1YJW A;  1LPL A;  2CH4 W;  2HKQ B;  5GAO l;  1TS9 A;  4C0Z A;  4BD3 A;  5IHK A;  3V7R A;  2QQS A;  2EIF A;  2F1L A;  2QAZ A;  4J9H A;  3S3O A;  3H0H A;  4BDZ A;  1SF9 A;  4XU1 A;  2K9G A;  2JZ2 A;  2OTL Q;  1Q95 G;  3GLX A;  2CYZ B;  2RQW A;  4A4E A;  2MAM A;  1MHN A;  2E5Q A;  3V7S A;  4PNO A;  2A28 A;  1WNL A;  5FRN A;  3C95 A;  4E7H A;  5GAO n;  3M58 A;  2L2P A;  5KCH A;  2EQM A;  3EG3 A;  1X75 C;  2XG8 D;  4HCK A;  3NHN A;  1LJO A;  2E5K A;  3CC7 Q;  1PRM C;  2RM4 A;  4D6W A;  1QVP A;  2DLP A;  5LJ5 j;  1AEY A;  2J05 A;  2RB6 A;  4M4Z A;  2RJE A;  2IG0 A;  1OX8 A;  1Q7Y U;  4JJB A;  2EWN A;  4Z8A A;  2FHD A;  5CKH A;  3JCM e;  1KQS A;  3OYY A;  1SRL A;  3CC4 Q;  2VVK A;  5IXB A;  1M8V A;  1D0Y A;  3EH2 A;  1ZSG A;  2XDD A;  2EYX A;  4KGV B;  3H6Z A;  3M53 A;  5KYY B;  2ZPE B;  4FW2 A;  4B9W A;  2K6D A;  3LYI A;  4RKU E;  3OW2 A;  3HRT A;  4DEY A;  2DIQ A;  2FVU A;  4E7J A;  4BY6 B;  3PIO A;  4PJO D;  2K79 A;  1K73 C;  1ZBX A;  4JDS A;  1IXD A;  1BIB A;  2QA4 Q;  2DX1 A;  4C8Q C;  3M0S A;  3HRS A;  1K73 R;  1WHK A;  2QQA A;  5KYN A;  4JLI A;  5GAO q;  3I9Q A;  1YJ9 A;  1PC0 A;  5LJ3 f;  3JCM f;  3OYG A;  1XQH A;  2FYK A;  3VS7 A;  2O9S A;  3OS2 A;  2E6Z A;  2RF0 A;  1CKB A;  5GMK h;  5A2Q E;  4J9E A;  4RTW A;  1VQK T;  4HCC A;  1H3Z A;  1SKU B;  2D6F A;  2LQ8 A;  3VKI A;  2KXD A;  1VQ8 A;  3RMQ A;  3E9G A;  2CSI A;  1VQ6 A;  1X43 A;  3HRU A;  2COZ A;  1ZSZ C;  2LNV A;  2KEA A;  2M02 A;  2ZCF B;  4B6M A;  1W6X A;  4Y91 A;  2O01 E;  4AFZ C;  4C5E A;  3MPU B;  2M0Y A;  1Y96 A;  4DOW A;  1GBQ A;  2JXB A;  1IRX A;  1QVF P;  2K7A A;  1YWP A;  3TU4 K;  5IHN A;  4ESR A;  2LCC A;  2GTJ A;  2FEI A;  2GF7 A;  4E7S A;  1WHG A;  3RR6 A;  1VQ8 T;  2P4R A;  1H3H A;  1YJN Q;  3CCJ A;  2ZGW A;  2DRK A;  3HKS A;  4M7A F;  4DEX A;  2CZ6 B;  3OSV A;  2DJZ A;  3JRZ A;  3CPW P;  3OMG A;  3UF4 A;  2DKG A;  3H0I A;  5GAN 4;  2SEM A;  4GLK A;  2EPD A;  2HBP A;  4PJL A;  5GAN j;  3UPU A;  4M77 G;  1KSW A;  1R0B G;  1VOM A;  4M7A C;  3LWI A;  1VQP A;  4L6V 5;  5J26 A;  2R58 A;  1D3B A;  2HMA A;  1U5S A;  3CCJ T;  3CXC S;  4D8K A;  2VB6 A;  1WLP B;  5GAM j;  4NOY A;  2V1R A;  5GAN 2;  4PFO A;  5DLO A;  1VQK Q;  1Y96 B;  8AT1 B;  5GMK i;  4JRP A;  3GF5 A;  5CIU A;  3M0Q A;  2D8J A;  1RAD B;  2EAY A;  2V1Q A;  1OX9 A;  1Q86 R;  1ZUY A;  2CP2 A;  2QAS A;  1AT1 B;  2J6F A;  2LQN A;  1W2B P;  1VQP T;  2VXE A;  1OZ3 A;  2PNI A;  3L42 A;  1AD5 A;  5D6Y A;  3QZ5 B;  2DIG A;  3MET A;  1R77 A;  4E6R A;  3GIB A;  2CZ0 B;  4J9D A;  3I56 A;  1JQQ A;  2RD1 A;  4K11 A;  2WSE E;  3A5Z B;  4HVV A;  3JCM V;  3EFR A;  1D3B B;  2K4Y A;  4ZGE B;  1YIT A;  1NYG A;  4NL2 A;  4XAX B;  1UB4 A;  2LCS A;  3NFC A;  2JW4 A;  1PG5 B;  4Y28 E;  1WHM A;  4KGZ B;  3QWX X;  1XNI A;  1BYM A;  5GJW B;  4QT7 A;  1Q81 R;  4JLG A;  4LXC A;  1UGS B;  4A4F A;  1ZUU A;  2A7Y A;  3S6W A;  1KK7 A;  1QVG P;  5EG2 A;  4KT0 E;  2HQH A;  4R56 A;  4BE1 A;  1ZQ1 A;  2KR3 A;  4J6Y A;  4F14 A;  2HBW A;  1YIT T;  4PJO C;  2E70 A;  1MGQ A;  2RNA A;  3LH5 A;  1EX4 A;  2NYS A;  2HKN A;  3GNF B;  1T0J A;  1TUG B;  5HCK A;  2XU8 A;  5CKD A;  2CUB A;  1KHI A;  1VQ4 A;  2B86 A;  2CT4 A;  4C8Q G;  3MEU A;  4CC7 A;  2ZPF B;  1O75 A;  3GOX A;  3KXT A;  1OPL A;  3QHS A;  4M78 D;  2YT6 A;  3CCL Q;  3JB9 F;  3QG1 A;  1OU9 A;  2PUO B;  4LDU A;  3O8V A;  2E1H A;  2DVJ A;  3G4S A;  1MMG A;  5J39 A;  1ZA1 B;  3M54 A;  1UGV A;  1Y07 A;  2DXC A;  5I11 A;  3QXE B;  1VQ7 T;  3JCM c;  2ED1 A;  1WHL A;  1MV0 B;  1K9M R;  4M7D A;  1TUD A;  3PMI A;  2BE9 B;  5KCO A;  4FSS A;  2NWM A;  4CC3 A;  1QWE A;  4M77 A;  4XTZ A;  2GNC A;  1K73 U;  2C0T A;  3L2W A;  3VV0 A;  3VJP A;  1JJ2 P;  1FYN A;  4M7D E;  1PD1 A;  4QW2 A;  3ULR B;  5KE3 A;  1D09 B;  5GJV B;  2IVW A;  1I0C A;  1QCF A;  4M77 E;  2KQW A;  2BZY A;  3HHT B;  3OYM A;  1QW1 A;  2DF6 A;  5DLQ E;  1SSF A;  2KRN A;  4EMG A;  3CCQ Q;  4RTV A;  3FJ5 A;  3SWN C;  1IHV A;  5LJ5 d;  1VYU A;  3REA B;  2F5K A;  3C94 A;  1UHF A;  1DJ7 B;  4C92 G;  5LJ3 j;  2RK2 A;  5A0L A;  1KG1 A;  1KHC A;  1GFC A;  2C06 A;  1ARK A;  1UGP B;  1KFZ A;  3EHR A;  2NLU A;  2DTH A;  2LP5 A;  2X4J A;  1M2O A;  4M7D B;  3CCS A;  2P0Q A;  3EGU A;  3JCM X;  4Z89 A;  1G2B A;  5FWC A;  2ESW A;  4DOV A;  4JRK A;  3LWH A;  4QVZ A;  4PFP A;  1VQM A;  2JVV A;  1VQ7 Q;  2V8I A;  5CKE A;  2HDA A;  2RQV A;  1R8O B;  1A0N B;  2RJC A;  3UAT A;  4IUP A;  5D6W A;  3CCU A;  4FYX B;  3PTA A;  2P0K A;  1RAI B;  3TSZ A;  3JCM J;  2E4H A;  4N4I A;  2YLB A;  4LDV A;  3X26 B;  3RBB B;  5KYX A;  2LZ6 B;  2YXY A;  2QDL A;  3JV3 A;  1SRM A;  2L5Q A;  1VQM T;  2KYM A;  1PM3 A;  3CME Q;  3VS4 A;  2PUK B;  4BE2 A;  2FRY A;  4EMK B;  4HVU A;  1X2K A;  4C8Q A;  2ATC B;  3CCU T;  2Y90 A;  3FLG A;  5GAN 3;  2MYS A;  4J9I A;  1JBM A;  1YIJ Q;  1Q86 U;  1E6H A;  3QUI A;  1UE9 A;  3NMZ C;  1QKX A;  3JAM E;  2LCL A;  3ZEH A;  4A4K A;  4FL6 A;  2RQT A;  4C8Q E;  2CP0 A;  1GXI E;  5GMK e;  3FJP A;  2BE7 D;  2QEX T;  4BDY A;  2DL3 A;  2DET A;  4OB0 B;  2OTL A;  1BB9 A;  5D6X A;  3X20 B;  2DBM A;  2J7I A;  2Z0W A;  1PNJ A;  2OTJ Q;  3RER A;  1WXT A;  1OU8 A;  2HL5 C;  3ASK A;  3MO8 A;  3OS0 A;  4AMC A;  1Z9Z A;  2L3R A;  4J7F A;  2MOX A;  2E3H A;  2XMF A;  5AT1 B;  2ROT A;  4ZN1 A;  3NTK A;  4GBQ A;  1ZSZ A;  1BCM A;  1D1C A;  2EYQ A;  3PGG A;  5GAO p;  4PJO G;  2PTK A;  2XIC A;  4XK8 E;  4M75 D;  5KYX B;  3C4S A;  3RMS A;  2MIO A;  3AT1 B;  5GAN 6;  5I22 A;  3PVL A;  2HSE B;  2RHY A;  5GAN d;  3CC7 A;  4RTZ A;  1QP2 A;  1K1Z A;  2KGT A;  4IKF A;  3VS5 A;  4MZM A;  1AZE A;  3JSC A;  3VYG A;  5LL6 S;  2K57 A;  3E2U A;  4LD9 K;  1N6A A;  4OB3 B;  3A8G B;  1I4K 1;  2BIV A;  1TTH B;  3DB3 A;  6AT1 B;  1Q81 U;  1WX6 A;  2X35 A;  1K9A A;  4XTV A;  1YCY A;  2FRW A;  1XOV A;  3CC4 A;  2DPP B;  2ECZ A;  3PIP A;  3L2Z A;  1PSF A;  4J9G A;  2X4W A;  1JXM A;  3SB2 A;  2A08 A;  1VQN T;  1Y71 A;  4M77 F;  4GLM A;  2KY9 A;  3OYE A;  2QDY B;  3HSB A;  1VQ5 Q;  3A98 A;  2LRQ A;  4C92 E;  2KSS A;  4C5I A;  3L2U A;  1PKS A;  4OP0 A;  2KVQ G;  4FCY A;  1FMK A;  4M7A A;  1ZSZ B;  5M9O A;  2EGC A;  2QA4 A;  3LGF A;  3CC4 T;  5LJ5 h;  3CCV A;  3ER0 A;  3X25 B;  2QEX Q;  2DXU A;  2GQI A;  1D0Z A;  4N4G A;  1NBE B;  1QQJ A;  2AKK A;  7AT1 B;  4M7A E;  1YN8 A;  5FU6 C;  1F1B B;  1ZUK A;  3J81 E;  4HCB A;  4OMM A;  2CP7 A;  4OMP A;  4RTX A;  1UUE A;  4OMN A;  4QVC A;  1H92 A;  3P8H A;  3OYC A;  4F04 B;  1VQ9 Q;  4CC2 A;  1AWW A;  2ZPH B;  3RIR A;  1HJD A;  1K9M U;  2QA4 T;  1D0X A;  4MML A;  3CCV T;  2V8K A;  2Y4Y A;  1T3L A;  4C0G A;  4OVA A;  4Z02 A;  2QTV A;  5GAO m;  4LUD A;  2D9T A;  5C6S A;  3CCR T;  1EIF A;  2G3R A;  1SHF A;  2VV5 A;  1O9S A;  3CPF A;  2M51 A;  2DRM A;  1WA7 A;  1TH7 A;  2DBK A;  4M7A B;  1QMC A;  1Z9Q A;  1RAH B;  1VA7 A;  2X9H A;  2DAQ A;  4PFZ A;  1VQN Q;  1M3C A;  3QPH A;  1YJN A;  4F7U G;  1KQ1 A;  4Q5W A;  2AT1 B;  5IAY A;  2LQK A;  4MZP A;  2E65 A;  2D1X A;  3JCM W;  5FRO A;  2O4X A;  2H8H A;  4J7I A;  5CVI A;  2R5A A;  3L2Q A;  4X34 A;  2P0P A;  3DB4 A;  5A0G A;  2J6K A;  2EGA A;  3FEO A;  1VQO Q;  3A8O B;  4PJO A;  1ZHI A;  3QII A;  4N0A C;  4C8Q F;  3OB9 A;  4E7I A;  4RTT A;  3A1P A;  2EFI A;  1YJN T;  5ECA A;  3OY9 A;  3ME9 A;  5HK0 A;  2VXF A;  3CMA T;  1YI2 T;  4PJO E;  2GFU A;  1VQK A;  4E7L A;  2CP3 A;  4PLI A;  2DVE A;  1X27 A;  2EQU A;  2AIR B;  3EG9 A;  3CCV Q;  1MMN A;  1LOJ A;  2CH4 A;  2W10 A;  2EVR A;  4DQ2 A;  1M90 U;  3CCR Q;  1AVZ C;  2CGH A;  2CP6 A;  1BK2 A;  3MEA A;  2EYY A;  2OX7 A;  5LJ3 d;  2PU9 B;  2L8D A;  5HK3 A;  3MHX A;  2OI3 A;  1KC8 C;  1BI3 A;  1QVF S;  1KC8 R;  3LLR A;  3CBM A;  4JUV A;  4M78 G;  4ZGD B;  5J3B A;  2XD0 A;  3VUZ A;  2MPX C;  4BE0 A;  4IUQ A;  3R6N A;  2X51 A;  3OBW A;  2E41 A;  2QGF B;  3BDU A;  2XKO C;  4J9F A;  2RI2 A;  4C92 F;  3SWN A;  3PMT A;  1OYX A;  3UT1 A;  1KQS P;  4ME7 A;  3LGL A;  3CXC A;  4HA8 A;  3EG9 B;  3M4G A;  4WTO B;  1W4S A;  4JJN K;  2LQW A;  3QWY A;  1W2B A;  4BI3 A;  2SRC A;  1X2Q A;  4BB7 A;  4E2F B;  3I55 Q;  2DZC A;  2RO0 A;  1WFW A;  3FRN A;  3CMA Q;  3OW2 P;  1VQL Q;  2MK5 A;  5FWB A;  3AHU A;  2F2X A;  2VAS A;  4C92 C;  3CBP A;  1YI2 Q;  1GL5 A;  4A4H A;  3EG1 A;  2VC8 A;  1Y0M A;  1WJQ A;  1JEG A;  1S72 T;  1UGQ B;  3HTR A;  1M1K U;  4JPB W;  2YUN A;  4IIM A;  4IUU A;  4ELZ C;  1QCO A;  1UHC A;  1X6G A;  2O31 A;  4ATO A;  3OA6 A;  1NPR A;  1WPY A;  2MMP A;  1VYT A;  2OJ2 A;  4AT1 B;  1MMD A;  3CCL A;  3DLL A;  2M0O A;  5GAN 8;  2QXF A;  3OQ5 A;  3V7C A;  3EHQ A;  1RAF B;  1T0H A;  1W2B S;  4F7U A;  4OMQ A;  3SFM A;  2KK4 A;  3EG0 A;  3SWN B;  2DXB A;  5GMK j;  1Q86 C;  2F5T X;  2JN0 A;  2M16 A;  1BI1 A;  3WVE B;  1K0X A;  2ZPG B;  2LJ1 A;  1TWB A;  2EQK A;  3WVD B;  1FWZ A;  1G3T A;  2LX7 A;  1U06 A;  2L89 A;  4KGX B;  4F7U E;  1WIE A;  4FT4 A;  2F69 A;  1UDL A;  3CCL T;  4YTL A;  2DA9 A;  1K8A R;  2OAW A;  1R0C B;  3RNJ A;  4O5V A;  5D7U A;  4CI0 C;  3T9N A;  3JCM P;  3P8D A;  2LMJ A;  2DYB A;  1MUZ A;  2CZ1 B;  5I2S A;  2ZPI B;  3A8M B;  2DJQ A;  3CCQ A;  4AG1 C;  2RHI A;  1AOJ A;  4CC4 B;  3LX7 A;  1QVG S;  3JB9 H;  1S72 Q;  4JZ4 A;  2W0Z A;  2PQW A;  2EKH A;  1G8X A;  5CQX A;  3CC2 A;  1LCK A;  1OZ2 A;  2KRS A;  4PJO F;  1Q81 C;  5CCA A;  1YP5 A;  3RKW A;  1BI2 A;  4JS4 A;  1YHQ T;  1W70 A;  3PFS A;  3M0T A;  3CCQ T;  3EFO A;  4R55 A;  2RH2 A;  1GCQ C;  2MI6 A;  5CQY A;  3OMC A;  2DFU A;  2JT4 A;  4PJN A;  3G71 T;  4HCZ A;  4RUG A;  3O5Z A;  1NLP C;  4ZN3 A;  2K5I A;  1IB8 A;  3HP9 A;  5GAN 5;  3CC2 T;  1VQ7 A;  4FSX A;  2RHX A;  4EPC A;  5FRM A;  2RQU A;  4P5N A;  1UJ0 A;  5HY6 A;  2PVO B;  3VS2 A;  3EG2 A;  1E6G A;  4XTW A;  3F70 A;  1UJY A;  1VUB A;  1G3S A;  2EYW A;  4C0F A;  3OYF A;  3VS1 A;  1TOV A;  2CDT A;  2E6N A;  1B3Q A;  5I21 A;  4XU0 A;  1AZG B;  2VKN A;  1UEC A;  1M1F A;  4M75 G;  2A36 A;  4F16 A;  1ABQ A;  5IN1 A;  1JJ2 S;  4D8D A;  4BAC A;  1K9M C;  1Y57 A;  4PJJ A;  3CME A;  2YUP A;  5LJ5 e;  4OF1 A;  2KT1 A;  1U3O A;  3EFO B;  2QQR A;  2DM1 A;  3MJX A;  2AZV A;  1YIJ A;  5HKC A;  4PKC C;  4OGC A;  5AYF A;  3SD4 A;  3I5R A;  3P8B B;  1G3Y A;  1PRL C;  2QGG A;  1WHH A;  4DBH A;  2G6F X;  2KXC A;  3MEV A;  3OYK A;  4E7Z A;  3CME T;  1YHQ Q;  1NEB A;  2OTJ A;  2JS2 A;  2D0N A;  4KH0 B;  2RI3 A;  1H64 1;  1HSQ A;  2EYZ A;  2L3S A;  1OPK A;  2RMO A;  4HT8 A;  4M7D D;  3WXM B;  1G83 A;  2CKK A;  3GBQ A;  3G71 Q;  5L23 A;  1YIJ T;  3FDR A;  4XQ3 A;  1KC8 U;  4QKU A;  2DIL A;  4M77 D;  3CC2 Q;  2JS0 A;  1PWT A;  1M3B A;  2E10 A;  1NYF A;  1NM7 A;  4L5G A;  2CP5 A;  2OTJ T;  2JUF A;  5IHI A;  4XU2 A;  2EGE A;  4J9C A;  2DL8 A;  2RI5 A;  4F7U F;  4M77 B;  3HPW A;  1KJW A;  1JRI A;  2M9U A;  3H9N A;  1SG5 A;  3CD6 Q;  4AFS C;  3RUX A;  2YLC A;  3MKD A;  2DNU A;  3QJ6 A;  2X4Y A;  2KE9 A;  1VQ5 A;  1MV3 A;  2HCK A;  4N0A A;  1M90 C;  3ZBD A;  1IO6 A;  1BKB A;  4NS5 A;  3CCM T;  4EIK A;  2LX9 A;  5GAO r;  1WYX A;  3M57 A;  1M90 R;  3M0P A;  2KYB A;  2QEX A;  4JJD A;  3HFN A;  3NTI A;  3X28 B;  1RAA B;  1ZX6 A;  2K3Y A;  2ABL A;  1B07 A;  2RJF A;  4J9B A;  5DY9 A;  1OEB A;  3L2V A;  1VQ5 T;  1M2V A;  1VQ9 A;  4OGE A;  3OYB A;  2HZY A;  2FPD A;  2NUZ A;  2I0N A;  4IUR A;  4C0D C;  1K8A U;  3DKM A;  2CS7 A;  1I07 A;  2JMA A;  4FM4 B;  4X9D A;  4LNP A;  2DL5 A;  2DMO A;  2P84 A;  3VRY A;  1RL2 A;  2IIM A;  2HL3 A;  4M78 F;  1IZ6 A;  2RN8 A;  2AZS A;  2K5F A;  1VQ9 T;  3QYH B;  4FT2 A;  1SEM A;  4M75 E;  4C8Q D;  3EFS A;  5CAI A;  1X01 A;  2EQJ A;  1RAC B;  1XTD A;  2K3B A;  3Q1J A;  2DTI A;  1M1K C;  1Q82 U;  1QCN A;  1VQN A;  2FB7 A;  4M78 C;  4NL3 A;  1M1K R;  3JCM b;  2QK0 A;  2RK1 A;  4C8Q B;  3QDF A;  3FB9 A;  2ROL A;  2A37 A;  2KRM A;  1HK9 A;  2QG9 B;  2GFA A;  2O2O A;  1N8R C;  3G6E A;  2XDP A;  4TVR A;  1V1C A;  3CCM Q;  3J7A F;  5GAM d;  2KBT A;  1N8R R;  2YRD A;  4QQG A;  3OYH A;  3E1S A;  1ZLM A;  4J6X A;  1VQO A;  4C92 A;  4LDX A;  1IRE B;  1QLY A;  3OBY A;  2Y4X A;  1H8K A;  1GRI A;  4J83 A;  3G7Z A;  2EJG A;  4HKE A;  1E7O A;  3GP8 A;  2A0F B;  1PSE A;  1QP3 A;  3RDV A;  2PZ1 A;  3A8H B;  3G6E T;  2KMT A;  2LVM A;  1J3T A;  2EKO A;  1VQO T;  1YNZ A;  3ZL7 C;  1D1A A;  1OV3 A;  4HXJ A;  1CSK A;  5FLX E;  3CCR A;  2NUT A;  2QQB A;  1WDX A;  3QO3 A;  5KYW A;  1FMW A;  2JTE A;  3LH0 A;  2MF2 A;  2JOY A;  1BBZ A;  3MCA B;  2YUO A;  3KBG A;  1X6B A;  3U23 A;  1OUL A;  4C92 B;  4FU6 A;  4FYY B;  2FPF A;  4M7A D;  4Y92 A;  4KH1 B;  4DBQ A;  2DO3 A;  2KT8 A;  3PE0 A;  2RJD A;  2RQR A;  4LN2 A;  4WF2 A;  4JRQ A;  4A4G A;  2H3J A;  2V26 A;  3BW1 A;  3MEW A;  4MZT A;  4PL6 A;  2LJ0 A;  2KDS A;  3OS1 A;  4PLL A;  4XTX A;  5FU7 C;  1V76 A;  3NPF A;  3QKJ A;  4L59 A; 
#chains in the Genus database with same CATH homology
 5FW9 A;  1UG1 A;  4JPB W;  2YUN A;  1NG2 A;  4IIM A;  2DVJ A;  1UHC A;  2CUD A;  1X6G A;  1UTI A;  2O31 A;  1UGV A;  3REB B;  1AWX A;  5I11 A;  2YSQ A;  2ED1 A;  1VYT A;  2OJ2 A;  1MV0 B;  1X69 A;  1TUD A;  4FSS A;  3EHQ A;  2NWM A;  1M27 C;  4CC3 A;  1QWE A;  1T0H A;  1GCQ A;  2ENM A;  2GNC A;  4OMQ A;  1AWJ A;  2CRE A;  1RUW A;  2BTT A;  2C0T A;  1JXO A;  2KRO A;  3EG0 A;  2HEQ A;  1M3A A;  1AWO A;  1FYN A;  4LUE A;  3M0R A;  4OML A;  3ULR B;  2CT3 A;  1K0X A;  5GJV B;  2C0O A;  2LJ1 A;  1I0C A;  1QCF A;  1JO8 A;  1U06 A;  2LX7 A;  3I5S A;  1WIE A;  2BZY A;  2HSP A;  1UDL A;  2DF6 A;  3TSW A;  1OOT A;  2DA9 A;  2KRN A;  2CSQ A;  4RTV A;  3FJ5 A;  2OAW A;  3RNJ A;  1NEG A;  1VYU A;  3REA B;  3M0U A;  2LNH B;  1UHF A;  4A63 B;  1W1F A;  2LMJ A;  2DYB A;  1PKT A;  2FPE A;  1MUZ A;  3NGP A;  1GFC A;  1ARK A;  1KFZ A;  5EC7 A;  3EHR A;  2FG0 A;  2DJQ A;  1SPK A;  2LP5 A;  1SSH A;  4AG1 C;  1AOJ A;  1CKA A;  4ZNX A;  2FO0 A;  4CC4 B;  3EGU A;  1TUC A;  2J06 A;  2AKL A;  1GBR A;  3SHW A;  4Z89 A;  4JZ4 A;  1G2B A;  1N5Z A;  2W0Z A;  2L3Q A;  2EKH A;  1M8M A;  5FWC A;  1LCK A;  3I35 A;  2KRS A;  2ESW A;  1YP5 A;  4AG2 C;  3CQT A;  3H0F A;  4R0K A;  1W70 A;  2HDA A;  3M0T A;  2DE0 X;  2RQV A;  4X1V A;  1GCQ C;  2D8H A;  1A0N B;  3UAT A;  2JT4 A;  2VWF A;  3VRZ A;  1RI9 A;  2CH4 W;  4RUG A;  3TSZ A;  3O5Z A;  5IHK A;  1NLP C;  3RBB B;  2LZ6 B;  2O9V A;  2RQU A;  1UJ0 A;  4J9H A;  3VS2 A;  2QDL A;  3H0H A;  1SRM A;  3EG2 A;  3JV3 A;  1E6G A;  2KYM A;  2X3X D;  1UJY A;  2K9G A;  2EYW A;  2C0I A;  3VS4 A;  4IIO A;  2FRY A;  3KFV A;  3VS1 A;  2CDT A;  2RQW A;  4HVU A;  1X2K A;  2MCN A;  1B3Q A;  1AZG B;  2VKN A;  1UEC A;  3TVT A;  4J9I A;  2A28 A;  2A36 A;  1E6H A;  4F16 A;  1ABQ A;  1UE9 A;  3NMZ C;  4D8D A;  1QKX A;  1WXB A;  1Y57 A;  2RQT A;  2L2P A;  2YUP A;  2DL3 A;  3EG3 A;  1BB9 A;  2KT1 A;  1U3O A;  2DBM A;  1K0S A;  2J7I A;  2DM1 A;  1PNJ A;  4HCK A;  4Z88 A;  1WXT A;  2EBP A;  3NHN A;  2E5K A;  1PRM C;  1Z9Z A;  2AZV A;  2DLP A;  2MOX A;  1AEY A;  2J05 A;  3I5R A;  4M4Z A;  1ZBJ A;  2XMF A;  2ROT A;  4GBQ A;  1PRL C;  2PTK A;  2G6F X;  4JJB A;  2ED0 A;  2KXC A;  4Z8A A;  1SHG A;  4WCI A;  2MIO A;  1SRL A;  5I22 A;  2LJ3 A;  1NEB A;  3PVL A;  2JS2 A;  2VVK A;  5IXB A;  2GGR A;  4RTZ A;  2D0N A;  1K1Z A;  2KGT A;  1HSQ A;  1ZSG A;  3VS5 A;  3THK A;  2EYX A;  2EYZ A;  2L3S A;  1OPK A;  2RMO A;  1AZE A;  1G83 A;  3GBQ A;  2DL7 A;  5L23 A;  4AFQ C;  2K6D A;  2DIL A;  5IXF A;  2JS0 A;  3VS6 A;  4DEY A;  1WX6 A;  1K9A A;  1PWT A;  2FRW A;  1XOV A;  1M3B A;  2L0A A;  2BZ8 A;  2ECZ A;  2K79 A;  1NYF A;  1NM7 A;  2DX1 A;  4J9G A;  5IHI A;  3M0S A;  1JXM A;  2EGE A;  2A08 A;  3UA7 A;  4J9C A;  2DL8 A;  1EFN A;  4AFU C;  4GLM A;  4RTU A;  3I9Q A;  4F17 A;  1KJW A;  3A98 A;  1PKS A;  1FMK A;  4JJC A;  3VS7 A;  2O9S A;  2EGC A;  2RF0 A;  1CKB A;  1ABO A;  4J9E A;  4RTW A;  4HVW A;  4AFS C;  2GQI A;  1UFF A;  2DNU A;  2J6O A;  1K76 A;  1I1J A;  2AKK A;  2KE9 A;  2K2M A;  1YN8 A;  2KXD A;  1S1N A;  1ZUK A;  1GFD A;  2CSI A;  1X43 A;  1MV3 A;  4LE9 A;  2HCK A;  2L3P A;  3IQL A;  4OMM A;  4RTX A;  4OMP A;  3UA6 A;  1IO6 A;  1UUE A;  2KEA A;  4OMN A;  1H92 A;  4EIK A;  1WYX A;  1W6X A;  4CC2 A;  3M0P A;  1AWW A;  1HJD A;  2KYB A;  4AFZ C;  4JJD A;  2M0Y A;  1GBQ A;  1HD3 A;  2JXB A;  2KNB B;  1T3L A;  2K7A A;  1YWP A;  1ZX6 A;  2ABL A;  1B07 A;  2AK5 A;  5IHN A;  3VS0 A;  4ESR A;  2GTJ A;  1VYV A;  2FEI A;  4J9B A;  3H41 A;  1OEB A;  2P4R A;  1H3H A;  4LUD A;  4OMO A;  1KIK A;  1YCS B;  1SHF A;  2M51 A;  2DRM A;  2DRK A;  1WA7 A;  2YDL A;  2DBK A;  1Z9Q A;  4DEX A;  2FPD A;  2NUZ A;  2I0N A;  1VA7 A;  1I07 A;  2F2V A;  3UF4 A;  2JMA A;  4LNP A;  2DL5 A;  2DMO A;  2GBQ A;  3H0I A;  2SEM A;  2EPD A;  3VRY A;  2IIM A;  1M3C A;  1WXU A;  2DL4 A;  1KSW A;  2O88 A;  2RN8 A;  2AZS A;  2GTO A;  1SEM A;  2D1X A;  1U5S A;  2H8H A;  4D8K A;  1WLP B;  2K3B A;  4RTY A;  2V1R A;  2J6K A;  2EGA A;  2JM9 A;  1NLO C;  2BZX A;  3M0Q A;  2D8J A;  1JU5 C;  2V1Q A;  2ROL A;  2A37 A;  1ZUY A;  2KRM A;  4RTT A;  5ECA A;  2O2O A;  1V1C A;  2J6F A;  2KBT A;  2LQN A;  2F2W A;  1RLQ C;  1ZLM A;  1YWO A;  2PNI A;  1QLY A;  1X27 A;  1AD5 A;  2JM8 A;  1M30 A;  1H8K A;  1GRI A;  3C0C A;  4E6R A;  1GCP A;  1TG0 A;  1WI7 A;  1E7O A;  4J9D A;  2CH4 A;  2W10 A;  1K4U S;  1JQQ A;  4K11 A;  2EVR A;  2PZ1 A;  4HVV A;  1AVZ C;  1QWF A;  1BK2 A;  1J3T A;  5IH2 A;  2EYY A;  3SEM A;  1NYG A;  2OI3 A;  1YNZ A;  2LCS A;  2JW4 A;  3ZL7 C;  1OV3 A;  1QKW A;  4KRT A;  4HXJ A;  1CSK A;  3QWX X;  5GJW B;  4QT7 A;  1WDX A;  1ZUU A;  3PVQ A;  2JTE A;  3R6N A;  1BBZ A;  4ORZ A;  1BU1 A;  2YUO A;  1PHT A;  2EQI A;  2JMC A;  1X6B A;  4J9F A;  2EW3 A;  3U23 A;  2KR3 A;  4F14 A;  2HBW A;  2FPF A;  2RNA A;  3LH5 A;  4Y92 A;  1T0J A;  2LQW A;  3QWY A;  2RPN A;  3VS3 A;  5HCK A;  2SRC A;  2KT8 A;  1X2Q A;  2CUB A;  2B86 A;  2CT4 A;  3PE0 A;  2RQR A;  2YUQ A;  1T3S A;  4LN2 A;  4CC7 A;  4JZ3 A;  1OPL A;  1WFW A;  1RLP C;  5FWB A;  2X3W D;  2F2X A;  2YT6 A;  1GL5 A;  2LJ0 A;  3EG1 A;  1Y0M A;  1JEG A;  3NPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...