1HJDA

Melanoma inhibitory activity (mia) protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
101
structure length
101
Chain Sequence
ADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MELANOMA INHIBITORY ACTIVITY PROTEIN
publication title The Extracellular Human Melanoma Inhibitory Activity (Mia) Protein Adopts an SH3 Domain-Like Fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 7
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hjdA00
2ECZA 2RF0A 2A36A 4OMOA 1QCFA 1CKAA 1GFCA 1K1ZA 1X2QA 1NEGA 2JXBA 3THKA 2DL5A 3I5SA 4KRTA 2MOXA 2LNHB 4JPBW 2RQRA 4CC4B 1VA7A 1WLPB 2CSQA 2KNBB 1B3QA 4RTTA 2LZ6B 1HD3A 2A08A 2KYBA 3C0CA 3EG0A 2BZXA 1H8KA 2KRNA 4AG1C 3PVLA 5L23A 2EGCA 2ROLA 4AFUC 1GRIA 2DLPA 3UF4A 3GBQA 2L3PA 1M3AA 1H92A 1WI7A 4AG2C 2AZSA 1AVZC 2O9VA 3VRZA 1T0JA 3I5RA 4A63B 3ZL7C 5IH2A 3UATA 2DRMA 2V1QA 1MV0B 4RTZA 4IIMA 3RNJA 1T0HA 3SHWA 2KRMA 1G83A 2JTEA 5IHKA 4ESRA 3LH5A 2GTOA 1UHFA 4HCKA 2DL8A 1NG2A 4RTWA 3VRYA 1X69A 4GLMA 3M0UA 2MIOA 4D8KA 1JXOA 1WA7A 1YWOA 2F2WA 2JW4A 1WDXA 3I9QA 2CT3A 1ABOA 2DILA 2F2XA 1AEYA 2KXCA 2KBTA 4JJCA 2JM8A 1M3CA 2H8HA 1VYUA 3O5ZA 2C0OA 1JO8A 1WYXA 2EPDA 1KSWA 2IIMA 4K11A 2LJ0A 2YT6A 4LNPA 2L3QA 4WCIA 2CH4W 3H0FA 1IO6A 4J9EA 2HEQA 4M4ZA 1JQQA 4F16A 3PVQA 1OPLA 4RTVA 2GQIA 1EFNA 2V1RA 4JJBA 1KIKA 1JXMA 2A37A 3JV3A 1PRLC 5GJVB 1HSQA 1UJYA 2LQWA 1WX6A 1WXUA 2RQUA 5ECAA 4LN2A 2D0NA 2ENMA 3TSWA 2LP5A 1PRMC 2FO0A 1PKTA 1RLQC 3EGUA 4R0KA 1BK2A 1GFDA 3H0HA 1AOJA 4HVWA 2KR3A 2J05A 3NHNA 4RTUA 2PTKA 2NUZA 1SRLA 3M0TA 1WFWA 2AK5A 1ARKA 2FPFA 3FJ5A 3R6NA 2FRWA 1S1NA 2DX1A 1JEGA 3TVTA 2PZ1A 3VS1A 2KGTA 2C0TA 4RTXA 3VS0A 2FEIA 1Z9QA 2DBMA 4J9BA 1MUZA 2RQVA 3M0PA 2LX7A 3EHQA 3RBBB 1Y57A 1SSHA 1UDLA 4JZ4A 2O31A 1NYFA 1U06A 3A98A 1X2KA 4GBQA 2JMCA 2DYBA 2FG0A 1K4US 1YCSB 4Y92A 4OMMA 2HCKA 1RI9A 1QWFA 4F17A 1J3TA 2J7IA 2DRKA 2K2MA 4LUEA 1GBRA 3ULRB 1UTIA 3NPFA 3REBB 2KRSA 2EGAA 1T3LA 2LQNA 2QDLA 5I11A 3M0SA 4LUDA 4OMNA 1U3OA 2CT4A 2KT1A 1YP5A 4OMLA 1BU1A 1SPKA 2I0NA 4JJDA 4AFQC 1KJWA 1AWXA 1X43A 2FPEA 2BTTA 2DNUA 2O2OA 1SRMA 2SRCA 2X3WD 5IHNA 2GGRA 1WXBA 2VKNA 4JZ3A 1HJDA 4CC2A 4HVUA 1I0CA 3QWXX 4ZNXA 2ABLA 1PKSA 2ESWA 2MCNA 4IIOA 2J6OA 2DMOA 1ZX6A 2HDAA 1M8MA 1ZUUA 2OI3A 1SEMA 1NYGA 2HBWA 1ZBJA 1TUDA 2EYWA 4J9DA 1M3BA 5IHIA 2BZ8A 3VS4A 1FMKA 1X6GA 1AWOA 4J9HA 2VWFA 4Z89A 2W10A 2HSPA 1YWPA 2RMOA 4F14A 1NM7A 2AKLA 5GJWB 4Z8AA 1PHTA 4RUGA 2O88A 2M51A 1TUCA 2ED1A 1QLYA 2LCSA 5FWBA 2DA9A 5FW9A 2EW3A 1SHGA 2GNCA 1B07A 1UGVA 3UA7A 3KFVA 1AWJA 1K0XA 1CSKA 1E6GA 3H0IA 2DL7A 1Y0MA 3H41A 4X1VA 2D1XA 2PNIA 4E6RA 3M0RA 1AZGB 1PNJA 3U23A 2OAWA 2YUPA 2LJ3A 1RLPC 2CUBA 1K0SA 3EG1A 1UUEA 3IQLA 4J9IA 1KFZA 4J9FA 2C0IA 2D8HA 2B86A 1T3SA 2DJQA 2K79A 2P4RA 1E7OA 2RN8A 2EYYA 1W1FA 1ABQA 4QT7A 4CC7A 1OV3A 2KYMA 2DF6A 2L0AA 2YDLA 4J9CA 2CH4A 1WXTA 5HCKA 1UHCA 2KEAA 1K9AA 1ZUKA 2LMJA 4CC3A 2AKKA 4FSSA 3PE0A 3QWYA 4D8DA 2D8JA 3NGPA 2CUDA 2EQIA 1OPKA 2RQTA 2X3XD 1E6HA 1QKXA 1RUWA 1BB9A 2YUOA 1YN8A 1JU5C 1N5ZA 1NLPC 1GCPA 2JT4A 1XOVA 3VS3A 3NMZC 4AFZC 2AZVA 2RQWA 2CREA 3VS2A 2XMFA 1OEBA 4LE9A 1VYTA 2YSQA 2G6FX 1UECA 2LJ1A 2EKHA 1ZLMA 2BZYA 2K6DA 1CKBA 3EG2A 2JMAA 2JS2A 4HXJA 2L2PA 4OMQA 2DL3A 2RNAA 2DL4A 1TG0A 2DVJA 4Z88A 4DEYA 2KE9A 3I35A 2DM1A 2E5KA 2DBKA 2CDTA 2GBQA 2GTJA 1M27C 1AZEA 1PWTA 1A0NB 3VS6A 1GCQC 2EGEA 1H3HA 2FRYA 4OMPA 1VYVA 3CQTA 1AWWA 1FYNA 1UE9A 4ORZA 2O9SA 2NWMA 5IXFA 2J6FA 1K76A 2VVKA 1LCKA 3TSZA 1UG1A 2ROTA 1QWEA 2J06A 2EBPA 2A28A 1YNZA 2DE0X 1V1CA 2J6KA 2KT8A 4DEXA 1UJ0A 1UFFA 1W70A 2SEMA 2YUNA 2FPDA 4RTYA 4HVVA 3SEMA 2W0ZA 2EYZA 2F2VA 1GL5A 1M30A 2EYXA 3REAB 1QKWA 1AD5A 2RPNA 2OJ2A 1SHFA 1Z9ZA 1BBZA 2EVRA 2L3SA 1WIEA 2YUQA 3EHRA 1G2BA 3UA6A 2K3BA 2M0YA 1I1JA 2JM9A 5I22A 1NEBA 1GCQA 1I07A 1X27A 2K7AA 5IXBA 3VS7A 1NLOC 2JS0A 5EC7A 2K9GA 1OOTA 5FWCA 4EIKA 3EG3A 3M0QA 4J9GA 3VS5A 1ZSGA 2CSIA 2KXDA 4AFSC 1MV3A 1X6BA 1ZUYA 2KROA 1U5SA 1W6XA 2ED0A 1GBQA
chains in the Genus database with same CATH superfamily
2A36A 1K8AR 2XKOC 2RHYA 1OX8A 1K1ZA 3THKA 3GPLA 4BB7A 2LNHB 4JPBW 2RQRA 1WLPB 5CKFA 1B3QA 3BDUA 3FB9A 1KC8R 2MMPA 4ZTFA 4M7DC 4Y91A 5EG2A 1H8KA 2MF2A 4AG1C 3SFMA 3SWNA 2ROLA 2LCCA 1GRIA 1WQ7A 3GNGA 1H92A 4LD6A 2AZSA 4Z02A 4R55A 2HL3A 4FSXA 1MNEA 3ZL7C 5A0LA 1EX4A 4L59A 2DRMA 3RKYA 1RAHB 2LCLA 3RUXA 1IGUA 2L3RA 3H6ZA 3RNJA 3V8LA 3A1PA 3FJPA 2HBPA 3PIPA 5GAMe 3LH5A 1TUGB 1VQ7A 2JOYA 4BE1A 3VRYA 4PFOA 3CXCP 1YJNA 1TH7A 3M0UA 1R0BG 3JCMd 3OYAA 1WDXA 3OS2A 1W2BA 3CC2T 4ZN1A 3E19A 5KYYB 2F2XA 1VQMA 1OI1A 2KBTA 2H8HA 1WQWA 3G6ET 1MNDA 1N27A 4K11A 4C8QB 2YT6A 1YHQT 4WCIA 2KVQG 3RERA 5LJ5f 1IO6A 1WJRA 3HRUA 3D7SB 4F7UE 2DERA 4F16A 4R56A 1OPLA 2LX9A 4RTVA 1VQOT 2QA4A 3V7RA 4JRPA 4V2SA 1I5OB 4GY5A 5GJVB 1UJYA 2RQUA 5ECAA 4LN2A 3G4SA 2CS7A 3CCUQ 2M02A 2B8AA 4JS5A 3HRTA 2CP5A 2E12A 1QQJA 4BY6B 1OULA 3OYKA 4HCCA 1PM3A 4IKFA 4M75B 2X51A 1BK2A 1WHKA 1GFDA 1VQ6T 3CXCA 4RTUA 2EQUA 2NUZA 4OMFB 1SRLA 1Q86R 2CP0A 2QAZA 2FPFA 3R6NA 1SSFA 4FW2A 1JEGA 2E64A 1QW1A 2E70A 3QDFA 2E5QA 4MMLA 2V8IA 4J6WA 2EKOA 1IHVA 2LC4A 4O6JA 4RTXA 3JCMX 2FEIA 1OU9A 2DBMA 2YWWA 2RQVA 2PUOB 4C0DC 2EJGA 3M55A 3EHQA 3RBBB 4HT8A 3JAME 1WGSA 4JZ4A 4GBQA 1YIJA 1M1FA 2FG0A 4KGVB 2DTOA 3CC7Q 4OMMA 2XD0A 3G7ZA 4D6WA 3GF5A 1GBRA 1AHJB 2KRSA 4C92C 2LQNA 2MK5A 1UGRB 2DJZA 4BE0A 1U3OA 3ZBDA 1YP5A 4PJLA 3V8KA 3AHUA 3JCMP 2I0NA 3TEEA 5A0DA 3L1AA 1KD1C 2FHDA 1JJ2S 2BTTA 2LQKA 4C8QD 1YJ9A 4A54A 4N0AA 1M90R 5IHNA 2X3WD 3DLMA 1M2VA 2GGRA 3A8MB 1JBMA 1BI1A 2RA2A 2JN0A 3I56T 3QWXX 2ABLA 2KY9A 1UGQB 4FYXB 4IIOA 3UWNA 1BIAA 1BI2A 5DM7R 5GMKj 1ZUUA 1SEMA 3L42A 1BYMA 1XQHA 1V76A 4OP0A 1JB0E 4XTUA 2EJFA 1UB4A 2OTJQ 4J9DA 4C92G 3S3NA 3CCRA 4OGEA 1VQ4A 5C6SA 4M75D 3P8BB 1G3SA 4Z8AA 5LJ5d 2KQWA 1S72Q 1TUCA 2ED1A 3P8DA 3FLGA 2LCSA 2DA9A 2X4WA 1QP2A 2E4HA 5FW9A 2RJFA 2NUPB 2DXBA 1NPRA 2EW3A 2GNCA 5LJ3d 1B07A 3KFVA 3TU4K 5HK3A 3QYHB 1VOMA 5HKCA 1JJ2P 1E6GA 3H0IA 1AT1B 5LJ3j 5GANd 1KQSS 1IB8A 3JB9F 2EQKA 5GAOl 4A4FA 4DBQA 4OF1A 5GANj 2YUPA 2LJ3A 2G3RA 1GXIE 1ACMB 4PJOG 2RK2A 4C5HA 4II1A 9ATCB 4J9IA 3CCEQ 1KFZA 2DXUA 4J9FA 2B86A 2DJQA 2HQEA 2K57A 5A0GA 1W1FA 1ABQA 3SDZA 4IUTA 1ZSZB 5D6XA 1G5VA 2D9TA 3CCVT 2DXCA 2E10A 3EGXB 3PTAA 5KH6A 5DLQE 3OSVA 2M16A 1ZUKA 2LMJA 3A8HB 4FIBA 3X20B 4LDXA 3CC2A 3NGPA 2VC8A 4QVZA 4DQ2A 4E7SA 2RQTA 5GAN7 1BB9A 2RH2A 1YN8A 1JU5C 5FU6B 3G6EA 1NLPC 1OX9A 3OW2A 1LPLA 1KQSP 2JT4A 2QQSA 2ZGWA 1VQNT 1C6VX 1JJ2A 1N8RC 2CREA 1VQLA 1OEBA 3LX7A 1UECA 4EMGA 1KD1R 5GMKm 3DKMA 2GFUA 2BZYA 4DBFA 3G4SQ 2L2PA 2JTFA 3SB2A 3CEYA 3QSUA 2DVJA 2OTJT 4RG2A 2KE9A 3BY7A 2DM1A 2E5KA 3EFRA 2OTLT 1AZEA 3VS6A 3CCSQ 1FX7A 1GCQC 1H3HA 2FRYA 3MHXA 1S72T 2WSFE 3JCMb 2JZ2A 1VQ6A 4KGXB 3L2UA 1VQ9Q 1AWWA 4ORZA 3EG9A 5IXFA 2FB7A 3E2UA 1D1AA 1LCKA 2HMAA 1QWEA 1ZQ1A 4M77F 3M4GA 1MMGA 2EBPA 2QQ9A 2QQBA 4PFZA 4RKUE 4C8QC 3OYDA 1V1CA 3QG1A 4JLGA 4B9WA 1KQSA 1YIJQ 1NZ9A 3HRSA 4DOWA 5LJ5h 1M30A 3REAB 5CKBA 1AD5A 2RPNA 1PC0A 3CPWS 2QTVA 4M78F 1BBZA 1I4K1 1I8FA 3PT9A 2YUQA 4BY6C 3QJYA 2E3HA 2ZPFB 4N4IA 1I1JA 4PJOE 4M77B 1YJ9Q 2LNVA 3RIRA 4M75C 2ZPHB 3TREA 1G3WA 3M59A 4J8OA 1K9MC 4J6XA 4ZGJB 2RHZA 3L2VA 1RI0A 4ZGDB 4XAXB 2CSIA 5GMKi 5I2MA 1YCYA 2Y4YA 3JCMe 1X6BA 3F70A 4ME7A 1ZUYA 2P0QA 3O8VA 4JDSA 1K8AC 4B6MA 2ECZA 4PK4A 4EDUA 8AT1B 4OMOA 1CKAA 2EWNA 4X9DA 1GFCA 1ZHIA 3I5SA 2MOXA 2AT1B 4LD9K 1KC8C 2DD4A 4EPCA 3H8ZA 3OS1A 4RTTA 1IHWA 3PNWC 1M4ZA 3CPWP 2KRNA 1N8RR 3PVLA 5L23A 4M75G 2EGCA 3CCUA 2DLPA 1MHNA 3UF4A 2DAQA 2L3PA 1M3AA 1M9SA 2FZKB 3S3MA 3M56A 3CCST 2L8DA 1VQ5T 2O9VA 3JCMQ 5CR2A 3QYGB 3I5RA 4TVRA 2CP3A 4PLIA 3JB9I 1U1SA 3WVDB 3E9FA 2E65A 5KYWA 3SHWA 2PVDB 1O75A 3CBOA 5IHKA 3QIIA 4ESRA 1UHFA 4HCKA 3OS0A 2BKDN 4OB3B 3HFNA 3HPWA 3KUFA 1MMAA 3GIBA 3MEVA 4PJOB 1WA7A 2F2WA 3NFCA 4M78A 3CCMT 2K3XA 4EMKB 3EFSA 4QQ6A 2D6FA 4WTOB 1VYUA 3O5ZA 2CYZB 4M7AF 1WYXA 3ZFJA 3P8HA 3OYGA 1WHHA 3CCVA 2ZCFB 2QG9B 2F5TX 2CH4W 3H0FA 4M77D 3S3OA 2RO0A 4FYWB 3CPWA 5CIUA 2XI9A 4M4ZA 2MAMA 2XIDA 3PVQA 2KK4A 3G6EQ 4JUVA 1KIKA 1K73U 3JV3A 2F5KA 2PQWA 4J6YA 1YHQQ 2LQWA 1WXUA 3C94A 5KYXA 5LJ3g 2CZ0B 1Y71A 1LVKA 1TSFA 5KCHA 5GAN8 3TSWA 2LP5A 2D0QB 5GANg 3L2RA 1VQOQ 1PKTA 1RLQC 3FC3A 1RAIB 4OB1B 4MDWA 4RCBA 3LGFA 4ELZC 1YJWQ 1AOJA 4HVWA 5KYNA 3NHNA 1Q86C 1RACB 2DZCA 2PTKA 3M0TA 3OYIA 2OTJA 5CO7A 1ZSZC 2DVEA 4NL3A 1QCNA 3TVTA 2DEQA 3VS1A 2OTLA 1VQ6Q 2KAFA 1H641 4J9BA 1MUZA 1S72A 2COYA 2F1LA 3EFOB 3LYIA 1Y57A 4IUVA 4CRIA 7AT1B 1NYFA 1U06A 3G71T 4DA4A 1FXXA 5FU6C 1K4US 4JRIA 4Y92A 2HCKA 2BUDA 1QWFA 1OYXA 1VQPT 5LJ5e 4XTYA 3OY9A 2DRKA 1WHMA 1TS9A 2MYSA 3OYEA 4HT9A 4M75E 2Y4XA 2Z0WA 4LUEA 5J39A 1OU8A 4PJOD 3REBB 4M7AA 2IG0A 2JJ9A 2QDLA 5LJ3e 2DO3A 2CT4A 2KT1A 4N4HA 2LQ8A 1HYOA 1BU1A 3CCEA 4A4HA 4JJDA 5GANe 3NTIA 1M90C 1Y7XA 3RMQA 2O2OA 2NLUA 5GAOp 2OAUA 2SRCA 1WXBA 3HTRA 1HJDA 4CC2A 4ATOA 3CCQT 1HXDA 4XU2A 1I0CA 1Q7YU 4BD3A 3NTHA 3EFOA 2FZCB 3CBPA 2MCNA 2J6OA 4PJMA 4RCCA 5CQYA 2HDAA 1M8MA 3A5ZB 3CCLT 3CC4T 2OI3A 3I56Q 1LNXA 1TUDA 1ZBJA 5IT9E 3LWIA 4KH0B 5IHIA 1QCOA 2VWFA 1NJIU 2E41A 4F14A 3EH1A 2AKLA 2M51A 2DYIA 2XU8A 5GAN3 1YJWT 2O01E 4VUBA 1D3BA 2RHUA 1UGVA 3CD6T 2XHCA 2F69A 2X4JA 4XU1A 4PKCC 2X4YA 4E6RA 1WZOA 1Q82U 2MI6A 2E1HA 3GLXA 3EAEA 4J5YA 1UUEA 3IQLA 1WHLA 3CCSA 1VQ5A 1RAFB 5GAMf 4M77C 4C5EA 2YHTA 2K5LA 2C0IA 5IN1A 4BUGA 3FIFA 1VQ9A 2K79A 2DIQA 2EYYA 1RADB 3I55T 1M2VB 4CC7A 1ZBXA 1M1KU 2YDLA 4FL6A 4MDXA 1TOVA 2RD1A 2RI3A 2RK1A 5FRMA 4F7UF 2HAXA 3JCMV 3QWYA 4D8DA 3VYGA 3UDCA 4HCBA 1EZZB 5D6WA 2EQIA 1LOJA 4XTXA 3CCVQ 4EMHA 3CBMA 1QKXA 2YUOA 5FLXE 3EH2A 2DXTA 3V7SA 4OVAA 2QTXA 4PJJA 5D7UA 3JSCA 3VS3A 2LDMA 4AFZC 4M77G 2DZ9A 3JRZA 1V29B 2GCXA 2XMFA 3VS2A 5AYFA 1VYTA 1TXQA 3OYMA 2LJ1A 2X4XA 5GAN6 2EJ9A 2XDDA 2JMAA 2JS2A 4HXJA 4PLLA 1VQNQ 2DL3A 2RNAA 1TG0A 1UGPB 1ZA2B 3CMAT 1YI2T 4NL2A 4B9XA 5CQXA 2DBKA 4MZMA 3OYFA 2OX7A 4M78G 3ER0A 3M58A 5CAIA 2XG8D 4PJOC 1BCOA 3BFMA 1VYVA 4EMKC 1UE9A 4LDYA 1UG1A 2OTLQ 1F1BB 3M54A 3PMTA 4L5GA 4ELYC 1OZ3A 2J6KA 4DEXA 3X24B 1UJ0A 3VUZA 4ZN3A 5LJ5j 3DB3A 3OB9A 4RTYA 3SEMA 3RDVA 2JTMA 2CP6A 2EYZA 4F7UA 2M0OA 3HL8A 4E2FB 5GAN2 3CCJT 3SWNC 1VQPA 2L3SA 3R6OA 1WIEA 3UA6A 3DB4A 2K3BA 2EFIA 5I22A 1VUBA 4E7ZA 4M7DF 1NLOC 5EC7A 2K9GA 4BI4A 4EIKA 1SF9A 1WHJA 3CMEQ 3RKXA 1QVPA 4J9GA 3VS5A 1Y07A 1C0MA 3J7AF 1ZSGA 3RR6A 4DBRA 4BI8B 3C12A 1MV3A 4A53A 4A4GA 3CCQA 2VB6A 2KROA 1U5SA 3QZ5B 2HZYA 4X34A 5CKDA 1G3YA 4ZGEB 4FU6A 1VQKT 3EG9B 1X2QA 2I2LA 4KRTA 1TU0B 2WSEE 1VA7A 2KNBB 2PUKB 3G1JA 4RMOA 2LZ6B 1HD3A 2A08A 2DK3A 2KYBA 2M9UA 3M53A 2XDPA 1YHQA 1M2OA 2EIFA 5CK9A 2BZXA 4M7AG 4AFUC 4M77E 1G8XA 3GBQA 2LRQA 1VQOA 1WI7A 4LDVA 2ATCB 2VXFA 3M5AA 4E7LA 4A63B 1YJWA 5IH2A 3UATA 4QKUA 1K73C 1MV0B 3CD6A 2P84A 5HK0A 2KI7A 3OA6A 4Q5WA 3QJ6A 3OYBA 1KQ2A 1FWZA 1VQ5Q 1IZ6A 2CZ7B 2GTOA 4RTWA 1NG2A 3ME9A 5I21A 4PFPA 4GLMA 5DLOA 2JVVA 4M78E 2MIOA 4D8KA 1JXOA 3JCMg 2JW4A 3X28B 2AIRB 2DPPB 3I9QA 1Y96B 1FMWA 1KQ1A 2CT3A 2H3EB 2DILA 2QGFB 1AEYA 1U8RA 2KXCA 3HFOA 4JJCA 1C1AA 2C06A 3MEUA 1JO8A 1WNLA 1IXDA 4M7DA 1Q95G 2IIMA 2RI2A 2L3QA 4AT1B 3CCMQ 1VIFA 4J9EA 3OMCA 1JQQA 1P92A 3MPUB 2GQIA 1EFNA 4JJBA 2GFAA 4BACA 1JXMA 1PCXA 1HSQA 4A4EA 3CMET 1WX6A 5J26A 3X25B 3V7CA 4NS5A 2MPXC 2ZPEB 2D0NA 3MEAA 3JB9D 2ENMA 1PRMC 2FO0A 2DETA 2DTIA 1NBEB 1Y96A 3EGUA 4HCZA 3H0HA 3MJXA 3MCAB 2KSSA 4XTVA 4N0AC 5KYWB 5HY6A 1VQMT 3I56A 2CP2A 1WFWA 2V8JA 3OQ5A 4C92F 3LH0A 5GAMh 3VU3C 1LJOA 3E9GA 3CMAA 3FJ5A 3RMSA 3VV0A 4E7IA 2FRWA 1S1NA 1W4SA 3H9NA 3EGDB 2PZ1A 3C95A 2KDSA 1Q7YC 2C0TA 4M78B 1Z9QA 3QXEB 1WJQA 2LX7A 1IREB 2RM4A 4XTWA 2QEXT 3OYCA 1PD0A 3A98A 5GAOq 1X2KA 5J3BA 2JMCA 1YCSB 4ZTJA 3FDRA 4F17A 2K2MA 3DLLA 3FEOA 1NJIC 4M7AE 3PFSA 3ULRB 4XTZA 1T3LA 1TTHB 5I11A 1ZA1B 1X6OA 3QZ9B 4N4GA 4KUDK 4PL6A 3G71Q 1K73R 1KJWA 2FPEA 5CKEA 1VQPQ 2DNUA 2IPOB 2BE9B 4IUUA 4UC4A 2XK0A 5KYXB 3EGDA 2VKNA 2GF7A 2FZGB 3CCJA 4FM4B 1H3ZA 1BCMA 1N9SA 1Q82C 3LGLA 4HKEA 3MO8A 2COWA 4BDZA 1XTDA 2FL7A 4DOVA 1ZX6A 1UEBA 2R57A 1NYGA 3JB9H 3CCQQ 2DIGA 8ATCB 5CKHA 3URGA 1M1KC 1FMKA 1HK9A 1X6GA 1D1BA 1TWBA 4IUQA 2W10A 1YWPA 2RMOA 1NM7A 5GJWB 4X9CA 3GP8A 4C92A 3CCLQ 3OYHA 3CC4Q 1PHTA 5LJ5g 2O88A 5FWBA 1SHGA 2EQJA 4RG8A 2QXFA 1K0XA 1VQNA 2E6NA 2DL7A 1Y0MA 3H41A 2QDYB 2LT4A 4X1VA 2D1XA 3M0RA 4M78D 1PNJA 3U23A 2IVWA 4M7AB 4IURA 4C0GA 3MKDA 2CUBA 1K0SA 3CD6Q 5IAYA 3KXTA 2RI5A 5KYUA 4C5IA 4LDUA 4KGZB 1WHGA 3LLRA 1RL2A 4QT7A 1OV3A 2HSEB 2DF6A 3J80E 2L0AA 1RABB 4J9CA 2CH4A 2GQVA 1WXTA 1Q7YR 5HCKA 3BW1A 1X75C 1UHCA 3CCRT 3QPHA 1K9AA 4CC3A 2BE7D 1VQ4T 3I55Q 2NUTA 2V26A 3FRNA 5AT1B 1E6HA 1RUWA 1VQ8T 1UGSB 1X01A 3T9NA 3UPUA 1N5ZA 2MWPA 2HL5C 1QVGS 1XOVA 3MEWA 1NJIR 4F04B 4KH1B 2O4XA 2H3JA 2YSQA 2LT1A 1D3BB 1ZLMA 2K6DA 2QI2A 3EG2A 4C8QF 4L6V5 3HSBA 2HQXA 4OMQA 1U1TA 4Y28E 1N9RA 2DL4A 3CMEA 1K9MU 1EIFA 1SKUB 4Z88A 2EQMA 3JB9G 3I35A 4E7JA 1Q82R 5C0MA 4OGCA 2GBQA 2QK0A 3SD4A 4XU0A 1Q81U 2K2VA 4P5NA 3MP6A 2XDBA 1K8AU 4OMPA 3CQTA 3CMAQ 2O9SA 2NWMA 1YI2Q 2J6FA 1K76A 2VVKA 3TSZA 2X9HA 4LDWA 2ROTA 2VGMA 4M7DG 1M1KR 4M7AD 2A28A 1KC8U 5KCOA 5GMKl 1YNZA 3L2ZA 4M75F 1QVGP 3OBYA 2KT8A 1UFFA 4QW2A 3A8OB 1NPPA 2Y90A 1W70A 2SEMA 2YUNA 2FPDA 1VQLT 2F2VA 1BI3A 3VYHB 1NE8A 2QEXA 3UT1A 5LJ3f 1QKWA 3ASKA 2CKKA 2CGHA 2OJ2A 2VV5A 5GANf 1SHFA 1Z9ZA 3LW5E 2HD0A 1N6AA 2EVRA 2A0FB 4FCYA 2LTOA 1M5Q1 4MZPA 2DKGA 5FRNA 2M0YA 1R8OB 2QGGA 2JM9A 4QQDA 1NEBA 1GCQA 1X27A 2K7AA 5IXBA 3VS7A 2JS0A 4C5GA 2DTHA 5KYYA 5FWCA 3JCMJ 3EG3A 3VJPA 3CCJQ 5GAN4 2YLBA 3M0QA 2PVOB 2ZPBB 2BIVA 3X26B 2KXDA 4AFSC 4C8QA 2JUFA 4LXCA 3CCMA 1R0CB 2ED0A 1GBQA 2QASA 1QVGA 4M78C 2RF0A 1KHCA 4XU3A 1QCFA 3OSSC 1QVFS 4XK8E 2JXBA 1NEGA 2JNGA 1G3TA 2DL5A 3VUBA 3OYJA 1D1CA 4CC4B 2CSQA 4MZTA 4CI0C 1YBYA 1YITQ 2M1HA 3C0CA 1I5LA 3EG0A 5FU7B 3OS5A 1FMVA 2PU9B 1VQKQ 1B34B 4AG2C 1AVZC 2R58A 3GNFB 1T0JA 4M75A 3VRZA 4F7UB 2WSCE 1KK7A 2QQRA 2V1QA 1M1GA 3M4YA 1PSEA 4RTZA 1PG5B 4IIMA 3CPFA 5LL6S 3OW2S 2QYZA 4IUPA 2K5IA 1T0HA 3JCMW 1Q86U 2KRMA 1G83A 2JTEA 1O9SA 3MP1A 2DL8A 1OQKA 1X69A 1R77A 1YWOA 3RESA 2RHIA 4AMCA 1ABOA 1QVFP 4A4KA 2YRVA 4JS4A 2JM8A 1M3CA 5CVIA 5KE2A 2C0OA 4M7DE 1SG5A 2EPDA 1KSWA 1BI0A 4BDYA 3JCMh 2LJ0A 4LNPA 1B34A 1I81A 3JB9J 2K4YA 3CCUT 2HEQA 2COZA 2V8KA 2V1RA 3G71A 3PIOA 2LVMA 4OB2B 2CZ1B 3C4SA 2A37A 1PRLC 1VQ8A 2RB6A 1M90U 3OW2P 1XJWB 4M7AC 2X35A 3AT1B 3WXMB 5GAMd 4R0KA 3OYNA 3OMGA 2FYKA 5GAMj 2KR3A 4QVCA 2J05A 2A3LA 3M57A 1YITT 1QVFA 2AK5A 1ARKA 4GLKA 2CZ6B 1VQ7Q 2DX1A 4FT2A 3M9QA 2RJEA 1DJ7B 2KGTA 1YJNQ 3CC7T 3VS0A 3QBYA 3QUIA 5DY9A 3A8LB 3CCLA 2ZZDA 3CC4A 1D0YA 2DD5A 2YLCA 3M0PA 1VQMQ 2E6ZA 4MMKA 3QKJA 1SSHA 1UDLA 2NUPA 3TCJA 2O31A 1B7TA 4FW1A 2DYBA 4M7DB 2L89A 1VIEA 1RI9A 1J3TA 4KULA 3PMIA 2J7IA 2ZAEA 4J7IA 1MMNA 1UTIA 3NPFA 1JRIA 2MWOA 2EGAA 2VXEA 2QEXQ 3M0SA 4LUDA 5FROA 3HHTB 3PGGA 4OMNA 4QVDA 2QA4Q 4OMLA 1SPKA 4AFQC 3JCMc 1AWXA 1X43A 3BE3A 1SRMA 1BKBA 2YRCA 2ZPIB 3VKIA 4JZ3A 1ZSZA 2VASA 1XNIA 4HVUA 3QDRB 3EGXA 3A8GB 4ZNXA 2R5AA 1MMDA 3NTKA 4FT4A 3OYLA 1PKSA 2ESWA 1D09B 2DMOA 1YFNA 3I55A 4E7HA 1PSFA 2VUBA 2HBWA 3INZA 3BDLA 3META 4C0ZA 2CP7A 2EYWA 5GMKh 1M3BA 3GOXA 2BZ8A 3VS4A 5I2SA 1D0XA 2RJDA 4ANJA 1AWOA 4J9HA 1KHIA 4JRKA 4Z89A 1RAGB 2HKNA 2HSPA 4C92E 1RAEB 6AT1B 1M8VA 4RUGA 2K3YA 1QLYA 2P0PA 4O5VA 1BIBA 1OZ2A 1KD1U 3UA7A 4BI3A 4QQGA 1AWJA 4BE2A 3HP9A 3CCET 1CSKA 4J7FA 2RJCA 2VYTA 5CCAA 2PNIA 5KE3A 1VQ7T 1AZGB 2OAWA 5LJ3h 3KBGA 1RLPC 1YJNT 3EG1A 4E7KA 2YRDA 5GANh 3OYYA 2EYQA 1IGQA 3WVEB 4M7DD 2D8HA 1T3SA 2P4RA 3OBWA 1YI2A 1E7OA 2RN8A 5GAOr 2DEUA 2KYMA 4C0FA 1IRXA 4C8QG 5M9OA 2R5MA 3RKWA 2FVUA 2KEAA 1Q81C 2AKKA 4FSSA 3PE0A 4C0DB 2L5QA 2D8JA 2QA4T 2CUDA 1OPKA 2NYSA 2X3XD 1MGQA 4JRQA 3ZEHA 2HNIA 3CCRQ 3LWHA 3G4ST 1GCPA 1VQ4Q 1D0ZA 3NMZC 4PJOF 5FU7C 2AZVA 4HA8A 3L2QA 2RQWA 2QQAA 4C92B 4LE9A 2G6FX 3L2WA 1VQ8Q 2XICA 4M77A 2EKHA 1CKBA 5GAN5 2P0KA 5GAOn 4JJNK 4KUIA 1VQ9T 2AHJB 4DEYA 3S6WA 2CDTA 2GTJA 1M27C 3QO3A 3JCMf 1PWTA 2VGNA 1A0NB 3V8JA 5GAOm 2EGEA 5KYUB 4JLIA 1FYNA 2A7YA 4KT0E 1YIJT 2J06A 1YITA 1PD1A 3MP8A 4OB0B 1W2BS 5D6YA 1N8RU 2DE0X 2P4TA 4FYVB 4PJNA 3CC7A 1VQKA 4F7UG 4PNOA 3Q1JA 3CC2Q 2NUTB 4HVVA 1RAAB 2W0ZA 5A2QE 2PVGB 1GL5A 2EYXA 2YXYA 1YJ9T 4YTLA 3J81E 4FYYB 2O4XB 3EHRA 1VQLQ 1G2BA 1KG1A 2ZPGB 3SWNB 4E47A 4NOYA 2K5FA 1WJSA 2EAYA 3E1SA 3N5BB 4J83A 4KBMB 4PJOA 1I07A 1QP3A 2HQHA 4WF2A 1WPYA 2RHXA 4EMKA 5GAMg 1OOTA 1QMCA 2E3IA 3TQ7P 1K9MR 5L8RE 4DBHA 3HKSA 2DFUA 4C92D 4C8QE 2WACA 4XQ3A 1Q81R 3CXCS 1W2BP 3QHSA 2KMTA 1W6XA 5GMKe 2HKQB
chains in the Genus database with same CATH topology
2ECZA 2RF0A 2A36A 4OMOA 1QCFA 1CKAA 1GFCA 1K1ZA 1X2QA 1NEGA 2JXBA 3THKA 2DL5A 3I5SA 4KRTA 2MOXA 2LNHB 4JPBW 2RQRA 4CC4B 1VA7A 1WLPB 2CSQA 2KNBB 1B3QA 4RTTA 2LZ6B 1HD3A 2A08A 2KYBA 3C0CA 3EG0A 2BZXA 1H8KA 2KRNA 4AG1C 3PVLA 5L23A 2EGCA 2ROLA 4AFUC 1GRIA 2DLPA 3UF4A 3GBQA 2L3PA 1M3AA 1H92A 1WI7A 4AG2C 2AZSA 1AVZC 2O9VA 3VRZA 1T0JA 3I5RA 4A63B 3ZL7C 5IH2A 3UATA 2DRMA 2V1QA 1MV0B 4RTZA 4IIMA 3RNJA 1T0HA 3SHWA 2KRMA 1G83A 2JTEA 5IHKA 4ESRA 3LH5A 2GTOA 1UHFA 4HCKA 2DL8A 1NG2A 4RTWA 3VRYA 1X69A 4GLMA 3M0UA 2MIOA 4D8KA 1JXOA 1WA7A 1YWOA 2F2WA 2JW4A 1WDXA 3I9QA 2CT3A 1ABOA 2DILA 2F2XA 1AEYA 2KXCA 2KBTA 4JJCA 2JM8A 1M3CA 2H8HA 1VYUA 3O5ZA 2C0OA 1JO8A 1WYXA 2EPDA 1KSWA 2IIMA 4K11A 2LJ0A 2YT6A 4LNPA 2L3QA 4WCIA 2CH4W 3H0FA 1IO6A 4J9EA 2HEQA 4M4ZA 1JQQA 4F16A 3PVQA 1OPLA 4RTVA 2GQIA 1EFNA 2V1RA 4JJBA 1KIKA 1JXMA 2A37A 3JV3A 1PRLC 5GJVB 1HSQA 1UJYA 2LQWA 1WX6A 1WXUA 2RQUA 5ECAA 4LN2A 2D0NA 2ENMA 3TSWA 2LP5A 1PRMC 2FO0A 1PKTA 1RLQC 3EGUA 4R0KA 1BK2A 1GFDA 3H0HA 1AOJA 4HVWA 2KR3A 2J05A 3NHNA 4RTUA 2PTKA 2NUZA 1SRLA 3M0TA 1WFWA 2AK5A 1ARKA 2FPFA 3FJ5A 3R6NA 2FRWA 1S1NA 2DX1A 1JEGA 3TVTA 2PZ1A 3VS1A 2KGTA 2C0TA 4RTXA 3VS0A 2FEIA 1Z9QA 2DBMA 4J9BA 1MUZA 2RQVA 3M0PA 2LX7A 3EHQA 3RBBB 1Y57A 1SSHA 1UDLA 4JZ4A 2O31A 1NYFA 1U06A 3A98A 1X2KA 4GBQA 2JMCA 2DYBA 2FG0A 1K4US 1YCSB 4Y92A 4OMMA 2HCKA 1RI9A 1QWFA 4F17A 1J3TA 2J7IA 2DRKA 2K2MA 4LUEA 1GBRA 3ULRB 1UTIA 3NPFA 3REBB 2KRSA 2EGAA 1T3LA 2LQNA 2QDLA 5I11A 3M0SA 4LUDA 4OMNA 1U3OA 2CT4A 2KT1A 1YP5A 4OMLA 1BU1A 1SPKA 2I0NA 4JJDA 4AFQC 1KJWA 1AWXA 1X43A 2FPEA 2BTTA 2DNUA 2O2OA 1SRMA 2SRCA 2X3WD 5IHNA 2GGRA 1WXBA 2VKNA 4JZ3A 1HJDA 4CC2A 4HVUA 1I0CA 3QWXX 4ZNXA 2ABLA 1PKSA 2ESWA 2MCNA 4IIOA 2J6OA 2DMOA 1ZX6A 2HDAA 1M8MA 1ZUUA 2OI3A 1SEMA 1NYGA 2HBWA 1ZBJA 1TUDA 2EYWA 4J9DA 1M3BA 5IHIA 2BZ8A 3VS4A 1FMKA 1X6GA 1AWOA 4J9HA 2VWFA 4Z89A 2W10A 2HSPA 1YWPA 2RMOA 4F14A 1NM7A 2AKLA 5GJWB 4Z8AA 1PHTA 4RUGA 2O88A 2M51A 1TUCA 2ED1A 1QLYA 2LCSA 5FWBA 2DA9A 5FW9A 2EW3A 1SHGA 2GNCA 1B07A 1UGVA 3UA7A 3KFVA 1AWJA 1K0XA 1CSKA 1E6GA 3H0IA 2DL7A 1Y0MA 3H41A 4X1VA 2D1XA 2PNIA 4E6RA 3M0RA 1AZGB 1PNJA 3U23A 2OAWA 2YUPA 2LJ3A 1RLPC 2CUBA 1K0SA 3EG1A 1UUEA 3IQLA 4J9IA 1KFZA 4J9FA 2C0IA 2D8HA 2B86A 1T3SA 2DJQA 2K79A 2P4RA 1E7OA 2RN8A 2EYYA 1W1FA 1ABQA 4QT7A 4CC7A 1OV3A 2KYMA 2DF6A 2L0AA 2YDLA 4J9CA 2CH4A 1WXTA 5HCKA 1UHCA 2KEAA 1K9AA 1ZUKA 2LMJA 4CC3A 2AKKA 4FSSA 3PE0A 3QWYA 4D8DA 2D8JA 3NGPA 2CUDA 2EQIA 1OPKA 2RQTA 2X3XD 1E6HA 1QKXA 1RUWA 1BB9A 2YUOA 1YN8A 1JU5C 1N5ZA 1NLPC 1GCPA 2JT4A 1XOVA 3VS3A 3NMZC 4AFZC 2AZVA 2RQWA 2CREA 3VS2A 2XMFA 1OEBA 4LE9A 1VYTA 2YSQA 2G6FX 1UECA 2LJ1A 2EKHA 1ZLMA 2BZYA 2K6DA 1CKBA 3EG2A 2JMAA 2JS2A 4HXJA 2L2PA 4OMQA 2DL3A 2RNAA 2DL4A 1TG0A 2DVJA 4Z88A 4DEYA 2KE9A 3I35A 2DM1A 2E5KA 2DBKA 2CDTA 2GBQA 2GTJA 1M27C 1AZEA 1PWTA 1A0NB 3VS6A 1GCQC 2EGEA 1H3HA 2FRYA 4OMPA 1VYVA 3CQTA 1AWWA 1FYNA 1UE9A 4ORZA 2O9SA 2NWMA 5IXFA 2J6FA 1K76A 2VVKA 1LCKA 3TSZA 1UG1A 2ROTA 1QWEA 2J06A 2EBPA 2A28A 1YNZA 2DE0X 1V1CA 2J6KA 2KT8A 4DEXA 1UJ0A 1UFFA 1W70A 2SEMA 2YUNA 2FPDA 4RTYA 4HVVA 3SEMA 2W0ZA 2EYZA 2F2VA 1GL5A 1M30A 2EYXA 3REAB 1QKWA 1AD5A 2RPNA 2OJ2A 1SHFA 1Z9ZA 1BBZA 2EVRA 2L3SA 1WIEA 2YUQA 3EHRA 1G2BA 3UA6A 2K3BA 2M0YA 1I1JA 2JM9A 5I22A 1NEBA 1GCQA 1I07A 1X27A 2K7AA 5IXBA 3VS7A 1NLOC 2JS0A 5EC7A 2K9GA 1OOTA 5FWCA 4EIKA 3EG3A 3M0QA 4J9GA 3VS5A 1ZSGA 2CSIA 2KXDA 4AFSC 1MV3A 1X6BA 1ZUYA 2KROA 1U5SA 1W6XA 2ED0A 1GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECZ A;  2RF0 A;  2A36 A;  4OMO A;  1QCF A;  1CKA A;  1GFC A;  1K1Z A;  1X2Q A;  1NEG A;  2JXB A;  3THK A;  2DL5 A;  3I5S A;  4KRT A;  2MOX A;  2LNH B;  4JPB W;  2RQR A;  4CC4 B;  1VA7 A;  1WLP B;  2CSQ A;  2KNB B;  1B3Q A;  4RTT A;  2LZ6 B;  1HD3 A;  2A08 A;  2KYB A;  3C0C A;  3EG0 A;  2BZX A;  1H8K A;  2KRN A;  4AG1 C;  3PVL A;  5L23 A;  2EGC A;  2ROL A;  4AFU C;  1GRI A;  2DLP A;  3UF4 A;  3GBQ A;  2L3P A;  1M3A A;  1H92 A;  1WI7 A;  4AG2 C;  2AZS A;  1AVZ C;  2O9V A;  3VRZ A;  1T0J A;  3I5R A;  4A63 B;  3ZL7 C;  5IH2 A;  3UAT A;  2DRM A;  2V1Q A;  1MV0 B;  4RTZ A;  4IIM A;  3RNJ A;  1T0H A;  3SHW A;  2KRM A;  1G83 A;  2JTE A;  5IHK A;  4ESR A;  3LH5 A;  2GTO A;  1UHF A;  4HCK A;  2DL8 A;  1NG2 A;  4RTW A;  3VRY A;  1X69 A;  4GLM A;  3M0U A;  2MIO A;  4D8K A;  1JXO A;  1WA7 A;  1YWO A;  2F2W A;  2JW4 A;  1WDX A;  3I9Q A;  2CT3 A;  1ABO A;  2DIL A;  2F2X A;  1AEY A;  2KXC A;  2KBT A;  4JJC A;  2JM8 A;  1M3C A;  2H8H A;  1VYU A;  3O5Z A;  2C0O A;  1JO8 A;  1WYX A;  2EPD A;  1KSW A;  2IIM A;  4K11 A;  2LJ0 A;  2YT6 A;  4LNP A;  2L3Q A;  4WCI A;  2CH4 W;  3H0F A;  1IO6 A;  4J9E A;  2HEQ A;  4M4Z A;  1JQQ A;  4F16 A;  3PVQ A;  1OPL A;  4RTV A;  2GQI A;  1EFN A;  2V1R A;  4JJB A;  1KIK A;  1JXM A;  2A37 A;  3JV3 A;  1PRL C;  5GJV B;  1HSQ A;  1UJY A;  2LQW A;  1WX6 A;  1WXU A;  2RQU A;  5ECA A;  4LN2 A;  2D0N A;  2ENM A;  3TSW A;  2LP5 A;  1PRM C;  2FO0 A;  1PKT A;  1RLQ C;  3EGU A;  4R0K A;  1BK2 A;  1GFD A;  3H0H A;  1AOJ A;  4HVW A;  2KR3 A;  2J05 A;  3NHN A;  4RTU A;  2PTK A;  2NUZ A;  1SRL A;  3M0T A;  1WFW A;  2AK5 A;  1ARK A;  2FPF A;  3FJ5 A;  3R6N A;  2FRW A;  1S1N A;  2DX1 A;  1JEG A;  3TVT A;  2PZ1 A;  3VS1 A;  2KGT A;  2C0T A;  4RTX A;  3VS0 A;  2FEI A;  1Z9Q A;  2DBM A;  4J9B A;  1MUZ A;  2RQV A;  3M0P A;  2LX7 A;  3EHQ A;  3RBB B;  1Y57 A;  1SSH A;  1UDL A;  4JZ4 A;  2O31 A;  1NYF A;  1U06 A;  3A98 A;  1X2K A;  4GBQ A;  2JMC A;  2DYB A;  2FG0 A;  1K4U S;  1YCS B;  4Y92 A;  4OMM A;  2HCK A;  1RI9 A;  1QWF A;  4F17 A;  1J3T A;  2J7I A;  2DRK A;  2K2M A;  4LUE A;  1GBR A;  3ULR B;  1UTI A;  3NPF A;  3REB B;  2KRS A;  2EGA A;  1T3L A;  2LQN A;  2QDL A;  5I11 A;  3M0S A;  4LUD A;  4OMN A;  1U3O A;  2CT4 A;  2KT1 A;  1YP5 A;  4OML A;  1BU1 A;  1SPK A;  2I0N A;  4JJD A;  4AFQ C;  1KJW A;  1AWX A;  1X43 A;  2FPE A;  2BTT A;  2DNU A;  2O2O A;  1SRM A;  2SRC A;  2X3W D;  5IHN A;  2GGR A;  1WXB A;  2VKN A;  4JZ3 A;  1HJD A;  4CC2 A;  4HVU A;  1I0C A;  3QWX X;  4ZNX A;  2ABL A;  1PKS A;  2ESW A;  2MCN A;  4IIO A;  2J6O A;  2DMO A;  1ZX6 A;  2HDA A;  1M8M A;  1ZUU A;  2OI3 A;  1SEM A;  1NYG A;  2HBW A;  1ZBJ A;  1TUD A;  2EYW A;  4J9D A;  1M3B A;  5IHI A;  2BZ8 A;  3VS4 A;  1FMK A;  1X6G A;  1AWO A;  4J9H A;  2VWF A;  4Z89 A;  2W10 A;  2HSP A;  1YWP A;  2RMO A;  4F14 A;  1NM7 A;  2AKL A;  5GJW B;  4Z8A A;  1PHT A;  4RUG A;  2O88 A;  2M51 A;  1TUC A;  2ED1 A;  1QLY A;  2LCS A;  5FWB A;  2DA9 A;  5FW9 A;  2EW3 A;  1SHG A;  2GNC A;  1B07 A;  1UGV A;  3UA7 A;  3KFV A;  1AWJ A;  1K0X A;  1CSK A;  1E6G A;  3H0I A;  2DL7 A;  1Y0M A;  3H41 A;  4X1V A;  2D1X A;  2PNI A;  4E6R A;  3M0R A;  1AZG B;  1PNJ A;  3U23 A;  2OAW A;  2YUP A;  2LJ3 A;  1RLP C;  2CUB A;  1K0S A;  3EG1 A;  1UUE A;  3IQL A;  4J9I A;  1KFZ A;  4J9F A;  2C0I A;  2D8H A;  2B86 A;  1T3S A;  2DJQ A;  2K79 A;  2P4R A;  1E7O A;  2RN8 A;  2EYY A;  1W1F A;  1ABQ A;  4QT7 A;  4CC7 A;  1OV3 A;  2KYM A;  2DF6 A;  2L0A A;  2YDL A;  4J9C A;  2CH4 A;  1WXT A;  5HCK A;  1UHC A;  2KEA A;  1K9A A;  1ZUK A;  2LMJ A;  4CC3 A;  2AKK A;  4FSS A;  3PE0 A;  3QWY A;  4D8D A;  2D8J A;  3NGP A;  2CUD A;  2EQI A;  1OPK A;  2RQT A;  2X3X D;  1E6H A;  1QKX A;  1RUW A;  1BB9 A;  2YUO A;  1YN8 A;  1JU5 C;  1N5Z A;  1NLP C;  1GCP A;  2JT4 A;  1XOV A;  3VS3 A;  3NMZ C;  4AFZ C;  2AZV A;  2RQW A;  2CRE A;  3VS2 A;  2XMF A;  1OEB A;  4LE9 A;  1VYT A;  2YSQ A;  2G6F X;  1UEC A;  2LJ1 A;  2EKH A;  1ZLM A;  2BZY A;  2K6D A;  1CKB A;  3EG2 A;  2JMA A;  2JS2 A;  4HXJ A;  2L2P A;  4OMQ A;  2DL3 A;  2RNA A;  2DL4 A;  1TG0 A;  2DVJ A;  4Z88 A;  4DEY A;  2KE9 A;  3I35 A;  2DM1 A;  2E5K A;  2DBK A;  2CDT A;  2GBQ A;  2GTJ A;  1M27 C;  1AZE A;  1PWT A;  1A0N B;  3VS6 A;  1GCQ C;  2EGE A;  1H3H A;  2FRY A;  4OMP A;  1VYV A;  3CQT A;  1AWW A;  1FYN A;  1UE9 A;  4ORZ A;  2O9S A;  2NWM A;  5IXF A;  2J6F A;  1K76 A;  2VVK A;  1LCK A;  3TSZ A;  1UG1 A;  2ROT A;  1QWE A;  2J06 A;  2EBP A;  2A28 A;  1YNZ A;  2DE0 X;  1V1C A;  2J6K A;  2KT8 A;  4DEX A;  1UJ0 A;  1UFF A;  1W70 A;  2SEM A;  2YUN A;  2FPD A;  4RTY A;  4HVV A;  3SEM A;  2W0Z A;  2EYZ A;  2F2V A;  1GL5 A;  1M30 A;  2EYX A;  3REA B;  1QKW A;  1AD5 A;  2RPN A;  2OJ2 A;  1SHF A;  1Z9Z A;  1BBZ A;  2EVR A;  2L3S A;  1WIE A;  2YUQ A;  3EHR A;  1G2B A;  3UA6 A;  2K3B A;  2M0Y A;  1I1J A;  2JM9 A;  5I22 A;  1NEB A;  1GCQ A;  1I07 A;  1X27 A;  2K7A A;  5IXB A;  3VS7 A;  1NLO C;  2JS0 A;  5EC7 A;  2K9G A;  1OOT A;  5FWC A;  4EIK A;  3EG3 A;  3M0Q A;  4J9G A;  3VS5 A;  1ZSG A;  2CSI A;  2KXD A;  4AFS C;  1MV3 A;  1X6B A;  1ZUY A;  2KRO A;  1U5S A;  1W6X A;  2ED0 A;  1GBQ A; 
#chains in the Genus database with same CATH topology
 2A36 A;  1K8A R;  2XKO C;  2RHY A;  1OX8 A;  1K1Z A;  3THK A;  3GPL A;  4BB7 A;  2LNH B;  4JPB W;  2RQR A;  1WLP B;  5CKF A;  1B3Q A;  3BDU A;  3FB9 A;  1KC8 R;  2MMP A;  4ZTF A;  4M7D C;  4Y91 A;  5EG2 A;  1H8K A;  2MF2 A;  4AG1 C;  3SFM A;  3SWN A;  2ROL A;  2LCC A;  1GRI A;  1WQ7 A;  3GNG A;  1H92 A;  4LD6 A;  2AZS A;  4Z02 A;  4R55 A;  2HL3 A;  4FSX A;  1MNE A;  3ZL7 C;  5A0L A;  1EX4 A;  4L59 A;  2DRM A;  3RKY A;  1RAH B;  2LCL A;  3RUX A;  1IGU A;  2L3R A;  3H6Z A;  3RNJ A;  3V8L A;  3A1P A;  3FJP A;  2HBP A;  3PIP A;  5GAM e;  3LH5 A;  1TUG B;  1VQ7 A;  2JOY A;  4BE1 A;  3VRY A;  4PFO A;  3CXC P;  1YJN A;  1TH7 A;  3M0U A;  1R0B G;  3JCM d;  3OYA A;  1WDX A;  3OS2 A;  1W2B A;  3CC2 T;  4ZN1 A;  3E19 A;  5KYY B;  2F2X A;  1VQM A;  1OI1 A;  2KBT A;  2H8H A;  1WQW A;  3G6E T;  1MND A;  1N27 A;  4K11 A;  4C8Q B;  2YT6 A;  1YHQ T;  4WCI A;  2KVQ G;  3RER A;  5LJ5 f;  1IO6 A;  1WJR A;  3HRU A;  3D7S B;  4F7U E;  2DER A;  4F16 A;  4R56 A;  1OPL A;  2LX9 A;  4RTV A;  1VQO T;  2QA4 A;  3V7R A;  4JRP A;  4V2S A;  1I5O B;  4GY5 A;  5GJV B;  1UJY A;  2RQU A;  5ECA A;  4LN2 A;  3G4S A;  2CS7 A;  3CCU Q;  2M02 A;  2B8A A;  4JS5 A;  3HRT A;  2CP5 A;  2E12 A;  1QQJ A;  4BY6 B;  1OUL A;  3OYK A;  4HCC A;  1PM3 A;  4IKF A;  4M75 B;  2X51 A;  1BK2 A;  1WHK A;  1GFD A;  1VQ6 T;  3CXC A;  4RTU A;  2EQU A;  2NUZ A;  4OMF B;  1SRL A;  1Q86 R;  2CP0 A;  2QAZ A;  2FPF A;  3R6N A;  1SSF A;  4FW2 A;  1JEG A;  2E64 A;  1QW1 A;  2E70 A;  3QDF A;  2E5Q A;  4MML A;  2V8I A;  4J6W A;  2EKO A;  1IHV A;  2LC4 A;  4O6J A;  4RTX A;  3JCM X;  2FEI A;  1OU9 A;  2DBM A;  2YWW A;  2RQV A;  2PUO B;  4C0D C;  2EJG A;  3M55 A;  3EHQ A;  3RBB B;  4HT8 A;  3JAM E;  1WGS A;  4JZ4 A;  4GBQ A;  1YIJ A;  1M1F A;  2FG0 A;  4KGV B;  2DTO A;  3CC7 Q;  4OMM A;  2XD0 A;  3G7Z A;  4D6W A;  3GF5 A;  1GBR A;  1AHJ B;  2KRS A;  4C92 C;  2LQN A;  2MK5 A;  1UGR B;  2DJZ A;  4BE0 A;  1U3O A;  3ZBD A;  1YP5 A;  4PJL A;  3V8K A;  3AHU A;  3JCM P;  2I0N A;  3TEE A;  5A0D A;  3L1A A;  1KD1 C;  2FHD A;  1JJ2 S;  2BTT A;  2LQK A;  4C8Q D;  1YJ9 A;  4A54 A;  4N0A A;  1M90 R;  5IHN A;  2X3W D;  3DLM A;  1M2V A;  2GGR A;  3A8M B;  1JBM A;  1BI1 A;  2RA2 A;  2JN0 A;  3I56 T;  3QWX X;  2ABL A;  2KY9 A;  1UGQ B;  4FYX B;  4IIO A;  3UWN A;  1BIA A;  1BI2 A;  5DM7 R;  5GMK j;  1ZUU A;  1SEM A;  3L42 A;  1BYM A;  1XQH A;  1V76 A;  4OP0 A;  1JB0 E;  4XTU A;  2EJF A;  1UB4 A;  2OTJ Q;  4J9D A;  4C92 G;  3S3N A;  3CCR A;  4OGE A;  1VQ4 A;  5C6S A;  4M75 D;  3P8B B;  1G3S A;  4Z8A A;  5LJ5 d;  2KQW A;  1S72 Q;  1TUC A;  2ED1 A;  3P8D A;  3FLG A;  2LCS A;  2DA9 A;  2X4W A;  1QP2 A;  2E4H A;  5FW9 A;  2RJF A;  2NUP B;  2DXB A;  1NPR A;  2EW3 A;  2GNC A;  5LJ3 d;  1B07 A;  3KFV A;  3TU4 K;  5HK3 A;  3QYH B;  1VOM A;  5HKC A;  1JJ2 P;  1E6G A;  3H0I A;  1AT1 B;  5LJ3 j;  5GAN d;  1KQS S;  1IB8 A;  3JB9 F;  2EQK A;  5GAO l;  4A4F A;  4DBQ A;  4OF1 A;  5GAN j;  2YUP A;  2LJ3 A;  2G3R A;  1GXI E;  1ACM B;  4PJO G;  2RK2 A;  4C5H A;  4II1 A;  9ATC B;  4J9I A;  3CCE Q;  1KFZ A;  2DXU A;  4J9F A;  2B86 A;  2DJQ A;  2HQE A;  2K57 A;  5A0G A;  1W1F A;  1ABQ A;  3SDZ A;  4IUT A;  1ZSZ B;  5D6X A;  1G5V A;  2D9T A;  3CCV T;  2DXC A;  2E10 A;  3EGX B;  3PTA A;  5KH6 A;  5DLQ E;  3OSV A;  2M16 A;  1ZUK A;  2LMJ A;  3A8H B;  4FIB A;  3X20 B;  4LDX A;  3CC2 A;  3NGP A;  2VC8 A;  4QVZ A;  4DQ2 A;  4E7S A;  2RQT A;  5GAN 7;  1BB9 A;  2RH2 A;  1YN8 A;  1JU5 C;  5FU6 B;  3G6E A;  1NLP C;  1OX9 A;  3OW2 A;  1LPL A;  1KQS P;  2JT4 A;  2QQS A;  2ZGW A;  1VQN T;  1C6V X;  1JJ2 A;  1N8R C;  2CRE A;  1VQL A;  1OEB A;  3LX7 A;  1UEC A;  4EMG A;  1KD1 R;  5GMK m;  3DKM A;  2GFU A;  2BZY A;  4DBF A;  3G4S Q;  2L2P A;  2JTF A;  3SB2 A;  3CEY A;  3QSU A;  2DVJ A;  2OTJ T;  4RG2 A;  2KE9 A;  3BY7 A;  2DM1 A;  2E5K A;  3EFR A;  2OTL T;  1AZE A;  3VS6 A;  3CCS Q;  1FX7 A;  1GCQ C;  1H3H A;  2FRY A;  3MHX A;  1S72 T;  2WSF E;  3JCM b;  2JZ2 A;  1VQ6 A;  4KGX B;  3L2U A;  1VQ9 Q;  1AWW A;  4ORZ A;  3EG9 A;  5IXF A;  2FB7 A;  3E2U A;  1D1A A;  1LCK A;  2HMA A;  1QWE A;  1ZQ1 A;  4M77 F;  3M4G A;  1MMG A;  2EBP A;  2QQ9 A;  2QQB A;  4PFZ A;  4RKU E;  4C8Q C;  3OYD A;  1V1C A;  3QG1 A;  4JLG A;  4B9W A;  1KQS A;  1YIJ Q;  1NZ9 A;  3HRS A;  4DOW A;  5LJ5 h;  1M30 A;  3REA B;  5CKB A;  1AD5 A;  2RPN A;  1PC0 A;  3CPW S;  2QTV A;  4M78 F;  1BBZ A;  1I4K 1;  1I8F A;  3PT9 A;  2YUQ A;  4BY6 C;  3QJY A;  2E3H A;  2ZPF B;  4N4I A;  1I1J A;  4PJO E;  4M77 B;  1YJ9 Q;  2LNV A;  3RIR A;  4M75 C;  2ZPH B;  3TRE A;  1G3W A;  3M59 A;  4J8O A;  1K9M C;  4J6X A;  4ZGJ B;  2RHZ A;  3L2V A;  1RI0 A;  4ZGD B;  4XAX B;  2CSI A;  5GMK i;  5I2M A;  1YCY A;  2Y4Y A;  3JCM e;  1X6B A;  3F70 A;  4ME7 A;  1ZUY A;  2P0Q A;  3O8V A;  4JDS A;  1K8A C;  4B6M A;  2ECZ A;  4PK4 A;  4EDU A;  8AT1 B;  4OMO A;  1CKA A;  2EWN A;  4X9D A;  1GFC A;  1ZHI A;  3I5S A;  2MOX A;  2AT1 B;  4LD9 K;  1KC8 C;  2DD4 A;  4EPC A;  3H8Z A;  3OS1 A;  4RTT A;  1IHW A;  3PNW C;  1M4Z A;  3CPW P;  2KRN A;  1N8R R;  3PVL A;  5L23 A;  4M75 G;  2EGC A;  3CCU A;  2DLP A;  1MHN A;  3UF4 A;  2DAQ A;  2L3P A;  1M3A A;  1M9S A;  2FZK B;  3S3M A;  3M56 A;  3CCS T;  2L8D A;  1VQ5 T;  2O9V A;  3JCM Q;  5CR2 A;  3QYG B;  3I5R A;  4TVR A;  2CP3 A;  4PLI A;  3JB9 I;  1U1S A;  3WVD B;  3E9F A;  2E65 A;  5KYW A;  3SHW A;  2PVD B;  1O75 A;  3CBO A;  5IHK A;  3QII A;  4ESR A;  1UHF A;  4HCK A;  3OS0 A;  2BKD N;  4OB3 B;  3HFN A;  3HPW A;  3KUF A;  1MMA A;  3GIB A;  3MEV A;  4PJO B;  1WA7 A;  2F2W A;  3NFC A;  4M78 A;  3CCM T;  2K3X A;  4EMK B;  3EFS A;  4QQ6 A;  2D6F A;  4WTO B;  1VYU A;  3O5Z A;  2CYZ B;  4M7A F;  1WYX A;  3ZFJ A;  3P8H A;  3OYG A;  1WHH A;  3CCV A;  2ZCF B;  2QG9 B;  2F5T X;  2CH4 W;  3H0F A;  4M77 D;  3S3O A;  2RO0 A;  4FYW B;  3CPW A;  5CIU A;  2XI9 A;  4M4Z A;  2MAM A;  2XID A;  3PVQ A;  2KK4 A;  3G6E Q;  4JUV A;  1KIK A;  1K73 U;  3JV3 A;  2F5K A;  2PQW A;  4J6Y A;  1YHQ Q;  2LQW A;  1WXU A;  3C94 A;  5KYX A;  5LJ3 g;  2CZ0 B;  1Y71 A;  1LVK A;  1TSF A;  5KCH A;  5GAN 8;  3TSW A;  2LP5 A;  2D0Q B;  5GAN g;  3L2R A;  1VQO Q;  1PKT A;  1RLQ C;  3FC3 A;  1RAI B;  4OB1 B;  4MDW A;  4RCB A;  3LGF A;  4ELZ C;  1YJW Q;  1AOJ A;  4HVW A;  5KYN A;  3NHN A;  1Q86 C;  1RAC B;  2DZC A;  2PTK A;  3M0T A;  3OYI A;  2OTJ A;  5CO7 A;  1ZSZ C;  2DVE A;  4NL3 A;  1QCN A;  3TVT A;  2DEQ A;  3VS1 A;  2OTL A;  1VQ6 Q;  2KAF A;  1H64 1;  4J9B A;  1MUZ A;  1S72 A;  2COY A;  2F1L A;  3EFO B;  3LYI A;  1Y57 A;  4IUV A;  4CRI A;  7AT1 B;  1NYF A;  1U06 A;  3G71 T;  4DA4 A;  1FXX A;  5FU6 C;  1K4U S;  4JRI A;  4Y92 A;  2HCK A;  2BUD A;  1QWF A;  1OYX A;  1VQP T;  5LJ5 e;  4XTY A;  3OY9 A;  2DRK A;  1WHM A;  1TS9 A;  2MYS A;  3OYE A;  4HT9 A;  4M75 E;  2Y4X A;  2Z0W A;  4LUE A;  5J39 A;  1OU8 A;  4PJO D;  3REB B;  4M7A A;  2IG0 A;  2JJ9 A;  2QDL A;  5LJ3 e;  2DO3 A;  2CT4 A;  2KT1 A;  4N4H A;  2LQ8 A;  1HYO A;  1BU1 A;  3CCE A;  4A4H A;  4JJD A;  5GAN e;  3NTI A;  1M90 C;  1Y7X A;  3RMQ A;  2O2O A;  2NLU A;  5GAO p;  2OAU A;  2SRC A;  1WXB A;  3HTR A;  1HJD A;  4CC2 A;  4ATO A;  3CCQ T;  1HXD A;  4XU2 A;  1I0C A;  1Q7Y U;  4BD3 A;  3NTH A;  3EFO A;  2FZC B;  3CBP A;  2MCN A;  2J6O A;  4PJM A;  4RCC A;  5CQY A;  2HDA A;  1M8M A;  3A5Z B;  3CCL T;  3CC4 T;  2OI3 A;  3I56 Q;  1LNX A;  1TUD A;  1ZBJ A;  5IT9 E;  3LWI A;  4KH0 B;  5IHI A;  1QCO A;  2VWF A;  1NJI U;  2E41 A;  4F14 A;  3EH1 A;  2AKL A;  2M51 A;  2DYI A;  2XU8 A;  5GAN 3;  1YJW T;  2O01 E;  4VUB A;  1D3B A;  2RHU A;  1UGV A;  3CD6 T;  2XHC A;  2F69 A;  2X4J A;  4XU1 A;  4PKC C;  2X4Y A;  4E6R A;  1WZO A;  1Q82 U;  2MI6 A;  2E1H A;  3GLX A;  3EAE A;  4J5Y A;  1UUE A;  3IQL A;  1WHL A;  3CCS A;  1VQ5 A;  1RAF B;  5GAM f;  4M77 C;  4C5E A;  2YHT A;  2K5L A;  2C0I A;  5IN1 A;  4BUG A;  3FIF A;  1VQ9 A;  2K79 A;  2DIQ A;  2EYY A;  1RAD B;  3I55 T;  1M2V B;  4CC7 A;  1ZBX A;  1M1K U;  2YDL A;  4FL6 A;  4MDX A;  1TOV A;  2RD1 A;  2RI3 A;  2RK1 A;  5FRM A;  4F7U F;  2HAX A;  3JCM V;  3QWY A;  4D8D A;  3VYG A;  3UDC A;  4HCB A;  1EZZ B;  5D6W A;  2EQI A;  1LOJ A;  4XTX A;  3CCV Q;  4EMH A;  3CBM A;  1QKX A;  2YUO A;  5FLX E;  3EH2 A;  2DXT A;  3V7S A;  4OVA A;  2QTX A;  4PJJ A;  5D7U A;  3JSC A;  3VS3 A;  2LDM A;  4AFZ C;  4M77 G;  2DZ9 A;  3JRZ A;  1V29 B;  2GCX A;  2XMF A;  3VS2 A;  5AYF A;  1VYT A;  1TXQ A;  3OYM A;  2LJ1 A;  2X4X A;  5GAN 6;  2EJ9 A;  2XDD A;  2JMA A;  2JS2 A;  4HXJ A;  4PLL A;  1VQN Q;  2DL3 A;  2RNA A;  1TG0 A;  1UGP B;  1ZA2 B;  3CMA T;  1YI2 T;  4NL2 A;  4B9X A;  5CQX A;  2DBK A;  4MZM A;  3OYF A;  2OX7 A;  4M78 G;  3ER0 A;  3M58 A;  5CAI A;  2XG8 D;  4PJO C;  1BCO A;  3BFM A;  1VYV A;  4EMK C;  1UE9 A;  4LDY A;  1UG1 A;  2OTL Q;  1F1B B;  3M54 A;  3PMT A;  4L5G A;  4ELY C;  1OZ3 A;  2J6K A;  4DEX A;  3X24 B;  1UJ0 A;  3VUZ A;  4ZN3 A;  5LJ5 j;  3DB3 A;  3OB9 A;  4RTY A;  3SEM A;  3RDV A;  2JTM A;  2CP6 A;  2EYZ A;  4F7U A;  2M0O A;  3HL8 A;  4E2F B;  5GAN 2;  3CCJ T;  3SWN C;  1VQP A;  2L3S A;  3R6O A;  1WIE A;  3UA6 A;  3DB4 A;  2K3B A;  2EFI A;  5I22 A;  1VUB A;  4E7Z A;  4M7D F;  1NLO C;  5EC7 A;  2K9G A;  4BI4 A;  4EIK A;  1SF9 A;  1WHJ A;  3CME Q;  3RKX A;  1QVP A;  4J9G A;  3VS5 A;  1Y07 A;  1C0M A;  3J7A F;  1ZSG A;  3RR6 A;  4DBR A;  4BI8 B;  3C12 A;  1MV3 A;  4A53 A;  4A4G A;  3CCQ A;  2VB6 A;  2KRO A;  1U5S A;  3QZ5 B;  2HZY A;  4X34 A;  5CKD A;  1G3Y A;  4ZGE B;  4FU6 A;  1VQK T;  3EG9 B;  1X2Q A;  2I2L A;  4KRT A;  1TU0 B;  2WSE E;  1VA7 A;  2KNB B;  2PUK B;  3G1J A;  4RMO A;  2LZ6 B;  1HD3 A;  2A08 A;  2DK3 A;  2KYB A;  2M9U A;  3M53 A;  2XDP A;  1YHQ A;  1M2O A;  2EIF A;  5CK9 A;  2BZX A;  4M7A G;  4AFU C;  4M77 E;  1G8X A;  3GBQ A;  2LRQ A;  1VQO A;  1WI7 A;  4LDV A;  2ATC B;  2VXF A;  3M5A A;  4E7L A;  4A63 B;  1YJW A;  5IH2 A;  3UAT A;  4QKU A;  1K73 C;  1MV0 B;  3CD6 A;  2P84 A;  5HK0 A;  2KI7 A;  3OA6 A;  4Q5W A;  3QJ6 A;  3OYB A;  1KQ2 A;  1FWZ A;  1VQ5 Q;  1IZ6 A;  2CZ7 B;  2GTO A;  4RTW A;  1NG2 A;  3ME9 A;  5I21 A;  4PFP A;  4GLM A;  5DLO A;  2JVV A;  4M78 E;  2MIO A;  4D8K A;  1JXO A;  3JCM g;  2JW4 A;  3X28 B;  2AIR B;  2DPP B;  3I9Q A;  1Y96 B;  1FMW A;  1KQ1 A;  2CT3 A;  2H3E B;  2DIL A;  2QGF B;  1AEY A;  1U8R A;  2KXC A;  3HFO A;  4JJC A;  1C1A A;  2C06 A;  3MEU A;  1JO8 A;  1WNL A;  1IXD A;  4M7D A;  1Q95 G;  2IIM A;  2RI2 A;  2L3Q A;  4AT1 B;  3CCM Q;  1VIF A;  4J9E A;  3OMC A;  1JQQ A;  1P92 A;  3MPU B;  2GQI A;  1EFN A;  4JJB A;  2GFA A;  4BAC A;  1JXM A;  1PCX A;  1HSQ A;  4A4E A;  3CME T;  1WX6 A;  5J26 A;  3X25 B;  3V7C A;  4NS5 A;  2MPX C;  2ZPE B;  2D0N A;  3MEA A;  3JB9 D;  2ENM A;  1PRM C;  2FO0 A;  2DET A;  2DTI A;  1NBE B;  1Y96 A;  3EGU A;  4HCZ A;  3H0H A;  3MJX A;  3MCA B;  2KSS A;  4XTV A;  4N0A C;  5KYW B;  5HY6 A;  1VQM T;  3I56 A;  2CP2 A;  1WFW A;  2V8J A;  3OQ5 A;  4C92 F;  3LH0 A;  5GAM h;  3VU3 C;  1LJO A;  3E9G A;  3CMA A;  3FJ5 A;  3RMS A;  3VV0 A;  4E7I A;  2FRW A;  1S1N A;  1W4S A;  3H9N A;  3EGD B;  2PZ1 A;  3C95 A;  2KDS A;  1Q7Y C;  2C0T A;  4M78 B;  1Z9Q A;  3QXE B;  1WJQ A;  2LX7 A;  1IRE B;  2RM4 A;  4XTW A;  2QEX T;  3OYC A;  1PD0 A;  3A98 A;  5GAO q;  1X2K A;  5J3B A;  2JMC A;  1YCS B;  4ZTJ A;  3FDR A;  4F17 A;  2K2M A;  3DLL A;  3FEO A;  1NJI C;  4M7A E;  3PFS A;  3ULR B;  4XTZ A;  1T3L A;  1TTH B;  5I11 A;  1ZA1 B;  1X6O A;  3QZ9 B;  4N4G A;  4KUD K;  4PL6 A;  3G71 Q;  1K73 R;  1KJW A;  2FPE A;  5CKE A;  1VQP Q;  2DNU A;  2IPO B;  2BE9 B;  4IUU A;  4UC4 A;  2XK0 A;  5KYX B;  3EGD A;  2VKN A;  2GF7 A;  2FZG B;  3CCJ A;  4FM4 B;  1H3Z A;  1BCM A;  1N9S A;  1Q82 C;  3LGL A;  4HKE A;  3MO8 A;  2COW A;  4BDZ A;  1XTD A;  2FL7 A;  4DOV A;  1ZX6 A;  1UEB A;  2R57 A;  1NYG A;  3JB9 H;  3CCQ Q;  2DIG A;  8ATC B;  5CKH A;  3URG A;  1M1K C;  1FMK A;  1HK9 A;  1X6G A;  1D1B A;  1TWB A;  4IUQ A;  2W10 A;  1YWP A;  2RMO A;  1NM7 A;  5GJW B;  4X9C A;  3GP8 A;  4C92 A;  3CCL Q;  3OYH A;  3CC4 Q;  1PHT A;  5LJ5 g;  2O88 A;  5FWB A;  1SHG A;  2EQJ A;  4RG8 A;  2QXF A;  1K0X A;  1VQN A;  2E6N A;  2DL7 A;  1Y0M A;  3H41 A;  2QDY B;  2LT4 A;  4X1V A;  2D1X A;  3M0R A;  4M78 D;  1PNJ A;  3U23 A;  2IVW A;  4M7A B;  4IUR A;  4C0G A;  3MKD A;  2CUB A;  1K0S A;  3CD6 Q;  5IAY A;  3KXT A;  2RI5 A;  5KYU A;  4C5I A;  4LDU A;  4KGZ B;  1WHG A;  3LLR A;  1RL2 A;  4QT7 A;  1OV3 A;  2HSE B;  2DF6 A;  3J80 E;  2L0A A;  1RAB B;  4J9C A;  2CH4 A;  2GQV A;  1WXT A;  1Q7Y R;  5HCK A;  3BW1 A;  1X75 C;  1UHC A;  3CCR T;  3QPH A;  1K9A A;  4CC3 A;  2BE7 D;  1VQ4 T;  3I55 Q;  2NUT A;  2V26 A;  3FRN A;  5AT1 B;  1E6H A;  1RUW A;  1VQ8 T;  1UGS B;  1X01 A;  3T9N A;  3UPU A;  1N5Z A;  2MWP A;  2HL5 C;  1QVG S;  1XOV A;  3MEW A;  1NJI R;  4F04 B;  4KH1 B;  2O4X A;  2H3J A;  2YSQ A;  2LT1 A;  1D3B B;  1ZLM A;  2K6D A;  2QI2 A;  3EG2 A;  4C8Q F;  4L6V 5;  3HSB A;  2HQX A;  4OMQ A;  1U1T A;  4Y28 E;  1N9R A;  2DL4 A;  3CME A;  1K9M U;  1EIF A;  1SKU B;  4Z88 A;  2EQM A;  3JB9 G;  3I35 A;  4E7J A;  1Q82 R;  5C0M A;  4OGC A;  2GBQ A;  2QK0 A;  3SD4 A;  4XU0 A;  1Q81 U;  2K2V A;  4P5N A;  3MP6 A;  2XDB A;  1K8A U;  4OMP A;  3CQT A;  3CMA Q;  2O9S A;  2NWM A;  1YI2 Q;  2J6F A;  1K76 A;  2VVK A;  3TSZ A;  2X9H A;  4LDW A;  2ROT A;  2VGM A;  4M7D G;  1M1K R;  4M7A D;  2A28 A;  1KC8 U;  5KCO A;  5GMK l;  1YNZ A;  3L2Z A;  4M75 F;  1QVG P;  3OBY A;  2KT8 A;  1UFF A;  4QW2 A;  3A8O B;  1NPP A;  2Y90 A;  1W70 A;  2SEM A;  2YUN A;  2FPD A;  1VQL T;  2F2V A;  1BI3 A;  3VYH B;  1NE8 A;  2QEX A;  3UT1 A;  5LJ3 f;  1QKW A;  3ASK A;  2CKK A;  2CGH A;  2OJ2 A;  2VV5 A;  5GAN f;  1SHF A;  1Z9Z A;  3LW5 E;  2HD0 A;  1N6A A;  2EVR A;  2A0F B;  4FCY A;  2LTO A;  1M5Q 1;  4MZP A;  2DKG A;  5FRN A;  2M0Y A;  1R8O B;  2QGG A;  2JM9 A;  4QQD A;  1NEB A;  1GCQ A;  1X27 A;  2K7A A;  5IXB A;  3VS7 A;  2JS0 A;  4C5G A;  2DTH A;  5KYY A;  5FWC A;  3JCM J;  3EG3 A;  3VJP A;  3CCJ Q;  5GAN 4;  2YLB A;  3M0Q A;  2PVO B;  2ZPB B;  2BIV A;  3X26 B;  2KXD A;  4AFS C;  4C8Q A;  2JUF A;  4LXC A;  3CCM A;  1R0C B;  2ED0 A;  1GBQ A;  2QAS A;  1QVG A;  4M78 C;  2RF0 A;  1KHC A;  4XU3 A;  1QCF A;  3OSS C;  1QVF S;  4XK8 E;  2JXB A;  1NEG A;  2JNG A;  1G3T A;  2DL5 A;  3VUB A;  3OYJ A;  1D1C A;  4CC4 B;  2CSQ A;  4MZT A;  4CI0 C;  1YBY A;  1YIT Q;  2M1H A;  3C0C A;  1I5L A;  3EG0 A;  5FU7 B;  3OS5 A;  1FMV A;  2PU9 B;  1VQK Q;  1B34 B;  4AG2 C;  1AVZ C;  2R58 A;  3GNF B;  1T0J A;  4M75 A;  3VRZ A;  4F7U B;  2WSC E;  1KK7 A;  2QQR A;  2V1Q A;  1M1G A;  3M4Y A;  1PSE A;  4RTZ A;  1PG5 B;  4IIM A;  3CPF A;  5LL6 S;  3OW2 S;  2QYZ A;  4IUP A;  2K5I A;  1T0H A;  3JCM W;  1Q86 U;  2KRM A;  1G83 A;  2JTE A;  1O9S A;  3MP1 A;  2DL8 A;  1OQK A;  1X69 A;  1R77 A;  1YWO A;  3RES A;  2RHI A;  4AMC A;  1ABO A;  1QVF P;  4A4K A;  2YRV A;  4JS4 A;  2JM8 A;  1M3C A;  5CVI A;  5KE2 A;  2C0O A;  4M7D E;  1SG5 A;  2EPD A;  1KSW A;  1BI0 A;  4BDY A;  3JCM h;  2LJ0 A;  4LNP A;  1B34 A;  1I81 A;  3JB9 J;  2K4Y A;  3CCU T;  2HEQ A;  2COZ A;  2V8K A;  2V1R A;  3G71 A;  3PIO A;  2LVM A;  4OB2 B;  2CZ1 B;  3C4S A;  2A37 A;  1PRL C;  1VQ8 A;  2RB6 A;  1M90 U;  3OW2 P;  1XJW B;  4M7A C;  2X35 A;  3AT1 B;  3WXM B;  5GAM d;  4R0K A;  3OYN A;  3OMG A;  2FYK A;  5GAM j;  2KR3 A;  4QVC A;  2J05 A;  2A3L A;  3M57 A;  1YIT T;  1QVF A;  2AK5 A;  1ARK A;  4GLK A;  2CZ6 B;  1VQ7 Q;  2DX1 A;  4FT2 A;  3M9Q A;  2RJE A;  1DJ7 B;  2KGT A;  1YJN Q;  3CC7 T;  3VS0 A;  3QBY A;  3QUI A;  5DY9 A;  3A8L B;  3CCL A;  2ZZD A;  3CC4 A;  1D0Y A;  2DD5 A;  2YLC A;  3M0P A;  1VQM Q;  2E6Z A;  4MMK A;  3QKJ A;  1SSH A;  1UDL A;  2NUP A;  3TCJ A;  2O31 A;  1B7T A;  4FW1 A;  2DYB A;  4M7D B;  2L89 A;  1VIE A;  1RI9 A;  1J3T A;  4KUL A;  3PMI A;  2J7I A;  2ZAE A;  4J7I A;  1MMN A;  1UTI A;  3NPF A;  1JRI A;  2MWO A;  2EGA A;  2VXE A;  2QEX Q;  3M0S A;  4LUD A;  5FRO A;  3HHT B;  3PGG A;  4OMN A;  4QVD A;  2QA4 Q;  4OML A;  1SPK A;  4AFQ C;  3JCM c;  1AWX A;  1X43 A;  3BE3 A;  1SRM A;  1BKB A;  2YRC A;  2ZPI B;  3VKI A;  4JZ3 A;  1ZSZ A;  2VAS A;  1XNI A;  4HVU A;  3QDR B;  3EGX A;  3A8G B;  4ZNX A;  2R5A A;  1MMD A;  3NTK A;  4FT4 A;  3OYL A;  1PKS A;  2ESW A;  1D09 B;  2DMO A;  1YFN A;  3I55 A;  4E7H A;  1PSF A;  2VUB A;  2HBW A;  3INZ A;  3BDL A;  3MET A;  4C0Z A;  2CP7 A;  2EYW A;  5GMK h;  1M3B A;  3GOX A;  2BZ8 A;  3VS4 A;  5I2S A;  1D0X A;  2RJD A;  4ANJ A;  1AWO A;  4J9H A;  1KHI A;  4JRK A;  4Z89 A;  1RAG B;  2HKN A;  2HSP A;  4C92 E;  1RAE B;  6AT1 B;  1M8V A;  4RUG A;  2K3Y A;  1QLY A;  2P0P A;  4O5V A;  1BIB A;  1OZ2 A;  1KD1 U;  3UA7 A;  4BI3 A;  4QQG A;  1AWJ A;  4BE2 A;  3HP9 A;  3CCE T;  1CSK A;  4J7F A;  2RJC A;  2VYT A;  5CCA A;  2PNI A;  5KE3 A;  1VQ7 T;  1AZG B;  2OAW A;  5LJ3 h;  3KBG A;  1RLP C;  1YJN T;  3EG1 A;  4E7K A;  2YRD A;  5GAN h;  3OYY A;  2EYQ A;  1IGQ A;  3WVE B;  4M7D D;  2D8H A;  1T3S A;  2P4R A;  3OBW A;  1YI2 A;  1E7O A;  2RN8 A;  5GAO r;  2DEU A;  2KYM A;  4C0F A;  1IRX A;  4C8Q G;  5M9O A;  2R5M A;  3RKW A;  2FVU A;  2KEA A;  1Q81 C;  2AKK A;  4FSS A;  3PE0 A;  4C0D B;  2L5Q A;  2D8J A;  2QA4 T;  2CUD A;  1OPK A;  2NYS A;  2X3X D;  1MGQ A;  4JRQ A;  3ZEH A;  2HNI A;  3CCR Q;  3LWH A;  3G4S T;  1GCP A;  1VQ4 Q;  1D0Z A;  3NMZ C;  4PJO F;  5FU7 C;  2AZV A;  4HA8 A;  3L2Q A;  2RQW A;  2QQA A;  4C92 B;  4LE9 A;  2G6F X;  3L2W A;  1VQ8 Q;  2XIC A;  4M77 A;  2EKH A;  1CKB A;  5GAN 5;  2P0K A;  5GAO n;  4JJN K;  4KUI A;  1VQ9 T;  2AHJ B;  4DEY A;  3S6W A;  2CDT A;  2GTJ A;  1M27 C;  3QO3 A;  3JCM f;  1PWT A;  2VGN A;  1A0N B;  3V8J A;  5GAO m;  2EGE A;  5KYU B;  4JLI A;  1FYN A;  2A7Y A;  4KT0 E;  1YIJ T;  2J06 A;  1YIT A;  1PD1 A;  3MP8 A;  4OB0 B;  1W2B S;  5D6Y A;  1N8R U;  2DE0 X;  2P4T A;  4FYV B;  4PJN A;  3CC7 A;  1VQK A;  4F7U G;  4PNO A;  3Q1J A;  3CC2 Q;  2NUT B;  4HVV A;  1RAA B;  2W0Z A;  5A2Q E;  2PVG B;  1GL5 A;  2EYX A;  2YXY A;  1YJ9 T;  4YTL A;  3J81 E;  4FYY B;  2O4X B;  3EHR A;  1VQL Q;  1G2B A;  1KG1 A;  2ZPG B;  3SWN B;  4E47 A;  4NOY A;  2K5F A;  1WJS A;  2EAY A;  3E1S A;  3N5B B;  4J83 A;  4KBM B;  4PJO A;  1I07 A;  1QP3 A;  2HQH A;  4WF2 A;  1WPY A;  2RHX A;  4EMK A;  5GAM g;  1OOT A;  1QMC A;  2E3I A;  3TQ7 P;  1K9M R;  5L8R E;  4DBH A;  3HKS A;  2DFU A;  4C92 D;  4C8Q E;  2WAC A;  4XQ3 A;  1Q81 R;  3CXC S;  1W2B P;  3QHS A;  2KMT A;  1W6X A;  5GMK e;  2HKQ B; 
#chains in the Genus database with same CATH homology
 2ECZ A;  2RF0 A;  2A36 A;  4OMO A;  1QCF A;  1CKA A;  1GFC A;  1K1Z A;  1X2Q A;  1NEG A;  2JXB A;  3THK A;  2DL5 A;  3I5S A;  4KRT A;  2MOX A;  2LNH B;  4JPB W;  2RQR A;  4CC4 B;  1VA7 A;  1WLP B;  2CSQ A;  2KNB B;  1B3Q A;  4RTT A;  2LZ6 B;  1HD3 A;  2A08 A;  2KYB A;  3C0C A;  3EG0 A;  2BZX A;  1H8K A;  2KRN A;  4AG1 C;  3PVL A;  5L23 A;  2EGC A;  2ROL A;  4AFU C;  1GRI A;  2DLP A;  3UF4 A;  3GBQ A;  2L3P A;  1M3A A;  1H92 A;  1WI7 A;  4AG2 C;  2AZS A;  1AVZ C;  2O9V A;  3VRZ A;  1T0J A;  3I5R A;  4A63 B;  3ZL7 C;  5IH2 A;  3UAT A;  2DRM A;  2V1Q A;  1MV0 B;  4RTZ A;  4IIM A;  3RNJ A;  1T0H A;  3SHW A;  2KRM A;  1G83 A;  2JTE A;  5IHK A;  4ESR A;  3LH5 A;  2GTO A;  1UHF A;  4HCK A;  2DL8 A;  1NG2 A;  4RTW A;  3VRY A;  1X69 A;  4GLM A;  3M0U A;  2MIO A;  4D8K A;  1JXO A;  1WA7 A;  1YWO A;  2F2W A;  2JW4 A;  1WDX A;  3I9Q A;  2CT3 A;  1ABO A;  2DIL A;  2F2X A;  1AEY A;  2KXC A;  2KBT A;  4JJC A;  2JM8 A;  1M3C A;  2H8H A;  1VYU A;  3O5Z A;  2C0O A;  1JO8 A;  1WYX A;  2EPD A;  1KSW A;  2IIM A;  4K11 A;  2LJ0 A;  2YT6 A;  4LNP A;  2L3Q A;  4WCI A;  2CH4 W;  3H0F A;  1IO6 A;  4J9E A;  2HEQ A;  4M4Z A;  1JQQ A;  4F16 A;  3PVQ A;  1OPL A;  4RTV A;  2GQI A;  1EFN A;  2V1R A;  4JJB A;  1KIK A;  1JXM A;  2A37 A;  3JV3 A;  1PRL C;  5GJV B;  1HSQ A;  1UJY A;  2LQW A;  1WX6 A;  1WXU A;  2RQU A;  5ECA A;  4LN2 A;  2D0N A;  2ENM A;  3TSW A;  2LP5 A;  1PRM C;  2FO0 A;  1PKT A;  1RLQ C;  3EGU A;  4R0K A;  1BK2 A;  1GFD A;  3H0H A;  1AOJ A;  4HVW A;  2KR3 A;  2J05 A;  3NHN A;  4RTU A;  2PTK A;  2NUZ A;  1SRL A;  3M0T A;  1WFW A;  2AK5 A;  1ARK A;  2FPF A;  3FJ5 A;  3R6N A;  2FRW A;  1S1N A;  2DX1 A;  1JEG A;  3TVT A;  2PZ1 A;  3VS1 A;  2KGT A;  2C0T A;  4RTX A;  3VS0 A;  2FEI A;  1Z9Q A;  2DBM A;  4J9B A;  1MUZ A;  2RQV A;  3M0P A;  2LX7 A;  3EHQ A;  3RBB B;  1Y57 A;  1SSH A;  1UDL A;  4JZ4 A;  2O31 A;  1NYF A;  1U06 A;  3A98 A;  1X2K A;  4GBQ A;  2JMC A;  2DYB A;  2FG0 A;  1K4U S;  1YCS B;  4Y92 A;  4OMM A;  2HCK A;  1RI9 A;  1QWF A;  4F17 A;  1J3T A;  2J7I A;  2DRK A;  2K2M A;  4LUE A;  1GBR A;  3ULR B;  1UTI A;  3NPF A;  3REB B;  2KRS A;  2EGA A;  1T3L A;  2LQN A;  2QDL A;  5I11 A;  3M0S A;  4LUD A;  4OMN A;  1U3O A;  2CT4 A;  2KT1 A;  1YP5 A;  4OML A;  1BU1 A;  1SPK A;  2I0N A;  4JJD A;  4AFQ C;  1KJW A;  1AWX A;  1X43 A;  2FPE A;  2BTT A;  2DNU A;  2O2O A;  1SRM A;  2SRC A;  2X3W D;  5IHN A;  2GGR A;  1WXB A;  2VKN A;  4JZ3 A;  1HJD A;  4CC2 A;  4HVU A;  1I0C A;  3QWX X;  4ZNX A;  2ABL A;  1PKS A;  2ESW A;  2MCN A;  4IIO A;  2J6O A;  2DMO A;  1ZX6 A;  2HDA A;  1M8M A;  1ZUU A;  2OI3 A;  1SEM A;  1NYG A;  2HBW A;  1ZBJ A;  1TUD A;  2EYW A;  4J9D A;  1M3B A;  5IHI A;  2BZ8 A;  3VS4 A;  1FMK A;  1X6G A;  1AWO A;  4J9H A;  2VWF A;  4Z89 A;  2W10 A;  2HSP A;  1YWP A;  2RMO A;  4F14 A;  1NM7 A;  2AKL A;  5GJW B;  4Z8A A;  1PHT A;  4RUG A;  2O88 A;  2M51 A;  1TUC A;  2ED1 A;  1QLY A;  2LCS A;  5FWB A;  2DA9 A;  5FW9 A;  2EW3 A;  1SHG A;  2GNC A;  1B07 A;  1UGV A;  3UA7 A;  3KFV A;  1AWJ A;  1K0X A;  1CSK A;  1E6G A;  3H0I A;  2DL7 A;  1Y0M A;  3H41 A;  4X1V A;  2D1X A;  2PNI A;  4E6R A;  3M0R A;  1AZG B;  1PNJ A;  3U23 A;  2OAW A;  2YUP A;  2LJ3 A;  1RLP C;  2CUB A;  1K0S A;  3EG1 A;  1UUE A;  3IQL A;  4J9I A;  1KFZ A;  4J9F A;  2C0I A;  2D8H A;  2B86 A;  1T3S A;  2DJQ A;  2K79 A;  2P4R A;  1E7O A;  2RN8 A;  2EYY A;  1W1F A;  1ABQ A;  4QT7 A;  4CC7 A;  1OV3 A;  2KYM A;  2DF6 A;  2L0A A;  2YDL A;  4J9C A;  2CH4 A;  1WXT A;  5HCK A;  1UHC A;  2KEA A;  1K9A A;  1ZUK A;  2LMJ A;  4CC3 A;  2AKK A;  4FSS A;  3PE0 A;  3QWY A;  4D8D A;  2D8J A;  3NGP A;  2CUD A;  2EQI A;  1OPK A;  2RQT A;  2X3X D;  1E6H A;  1QKX A;  1RUW A;  1BB9 A;  2YUO A;  1YN8 A;  1JU5 C;  1N5Z A;  1NLP C;  1GCP A;  2JT4 A;  1XOV A;  3VS3 A;  3NMZ C;  4AFZ C;  2AZV A;  2RQW A;  2CRE A;  3VS2 A;  2XMF A;  1OEB A;  4LE9 A;  1VYT A;  2YSQ A;  2G6F X;  1UEC A;  2LJ1 A;  2EKH A;  1ZLM A;  2BZY A;  2K6D A;  1CKB A;  3EG2 A;  2JMA A;  2JS2 A;  4HXJ A;  2L2P A;  4OMQ A;  2DL3 A;  2RNA A;  2DL4 A;  1TG0 A;  2DVJ A;  4Z88 A;  4DEY A;  2KE9 A;  3I35 A;  2DM1 A;  2E5K A;  2DBK A;  2CDT A;  2GBQ A;  2GTJ A;  1M27 C;  1AZE A;  1PWT A;  1A0N B;  3VS6 A;  1GCQ C;  2EGE A;  1H3H A;  2FRY A;  4OMP A;  1VYV A;  3CQT A;  1AWW A;  1FYN A;  1UE9 A;  4ORZ A;  2O9S A;  2NWM A;  5IXF A;  2J6F A;  1K76 A;  2VVK A;  1LCK A;  3TSZ A;  1UG1 A;  2ROT A;  1QWE A;  2J06 A;  2EBP A;  2A28 A;  1YNZ A;  2DE0 X;  1V1C A;  2J6K A;  2KT8 A;  4DEX A;  1UJ0 A;  1UFF A;  1W70 A;  2SEM A;  2YUN A;  2FPD A;  4RTY A;  4HVV A;  3SEM A;  2W0Z A;  2EYZ A;  2F2V A;  1GL5 A;  1M30 A;  2EYX A;  3REA B;  1QKW A;  1AD5 A;  2RPN A;  2OJ2 A;  1SHF A;  1Z9Z A;  1BBZ A;  2EVR A;  2L3S A;  1WIE A;  2YUQ A;  3EHR A;  1G2B A;  3UA6 A;  2K3B A;  2M0Y A;  1I1J A;  2JM9 A;  5I22 A;  1NEB A;  1GCQ A;  1I07 A;  1X27 A;  2K7A A;  5IXB A;  3VS7 A;  1NLO C;  2JS0 A;  5EC7 A;  2K9G A;  1OOT A;  5FWC A;  4EIK A;  3EG3 A;  3M0Q A;  4J9G A;  3VS5 A;  1ZSG A;  2CSI A;  2KXD A;  4AFS C;  1MV3 A;  1X6B A;  1ZUY A;  2KRO A;  1U5S A;  1W6X A;  2ED0 A;  1GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...