1HJDA

Melanoma inhibitory activity (mia) protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
101
structure length
101
Chain Sequence
b'ADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MELANOMA INHIBITORY ACTIVITY PROTEIN
publication title The Extracellular Human Melanoma Inhibitory Activity (Mia) Protein Adopts an SH3 Domain-Like Fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 7
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1hjdA00
4JJBA 2EYWA 3FJ5A 1WXBA 1AZEA 1U5SA 1ABQA 2BTTA 2CDTA 2K79A 5GJVB 2K9GA 1CSKA 1H8KA 3C0CA 1E7OA 3QWYA 5ECAA 3M0PA 2L2PA 2B86A 3I9QA 2M0YA 1UFFA 2ROTA 2RN8A 1UG1A 2LCSA 1XOVA 2RQWA 2KEAA 2KROA 2JS2A 1KSWA 4JPBW 4RUGA 2YUPA 2HCKA 1U3OA 1X6BA 3A98A 2EGCA 4OMOA 2LJ1A 2VVKA 1UUEA 2YT6A 2W0ZA 2X3WD 1IO6A 2DNUA 5IHKA 1QKXA 1GBRA 4DEYA 2V1RA 3UATA 2ED1A 2SRCA 1JQQA 1BB9A 4OMPA 2D1XA 1KJWA 1PKTA 2SEMA 2KNBB 2ROLA 1PRLC 2EW3A 2AZSA 2CH4W 1W1FA 3M0SA 1S1NA 4J9EA 1T3LA 2KE9A 1AEYA 3PE0A 1NLPC 3VS2A 1RI9A 3I35A 3I5SA 2EYZA 3EGUA 2K7AA 2GTOA 2ENMA 1J3TA 5L23A 1GCQA 1X69A 5FW9A 1KFZA 2LP5A 4AFSC 2P4RA 2CSIA 2FEIA 3NPFA 2YSQA 4HCKA 4RTTA 2O9SA 4Z89A 4A63B 2LJ3A 2LX7A 2DL5A 2LQWA 1GFDA 1Z9ZA 1GL5A 2I0NA 2JXBA 4CC3A 1K9AA 1SHFA 2CT3A 4LN2A 4J9GA 2DL8A 1WXTA 1AOJA 4E6RA 2JW4A 1GCPA 2KGTA 3EG3A 3LH5A 1CKBA 1UGVA 1VA7A 4FSSA 2KRMA 4OMMA 1JEGA 1NEBA 4AFZC 1H3HA 2CSQA 2KRNA 2DE0X 1WLPB 1I07A 2MIOA 3QWXX 4Y92A 2GTJA 2C0IA 1A0NB 2A08A 2A28A 4Z88A 2FPDA 4HVWA 1RUWA 1PNJA 2DA9A 2LMJA 5IHIA 1LCKA 1JU5C 2CREA 2HEQA 1GBQA 1E6HA 1K0SA 2FO0A 2KXDA 3VRYA 4D8KA 1WXUA 1M3AA 1VYUA 3EG0A 4HVVA 3VRZA 3VS6A 1AD5A 1JO8A 2JM8A 2FPFA 2OAWA 4IIOA 4RTXA 5FWCA 1SPKA 4AG2C 1SSHA 1NEGA 3NMZC 4EIKA 2C0OA 4CC7A 5IXFA 2RF0A 1B07A 2DMOA 1E6GA 2DLPA 3IQLA 1YNZA 2YUNA 2DL3A 1YWPA 2ECZA 3H0IA 1W70A 2X3XD 2D8HA 4DEXA 2DF6A 4K11A 4J9CA 2A37A 2OI3A 5EC7A 2LNHB 2KT1A 1T0HA 1EFNA 1UDLA 1WX6A 2LZ6B 1K1ZA 2EKHA 2F2XA 2EBPA 4ESRA 3SHWA 2HBWA 1K0XA 1SRLA 3TSZA 1OV3A 1NM7A 5FWBA 4RTWA 3RBBB 2LQNA 1CKAA 2YDLA 1UHFA 2KXCA 1X2KA 1BBZA 5I22A 3NHNA 3PVLA 1K76A 4LUEA 1MV0B 3VS3A 2NWMA 3THKA 1Y57A 1KIKA 2O9VA 2EVRA 2ED0A 1AZGB 4J9FA 4CC2A 2M51A 2KYBA 4JJCA 3M0QA 4F16A 2QDLA 5HCKA 1ARKA 1G83A 2KYMA 3GBQA 1WFWA 3EHQA 4RTYA 1B3QA 1HSQA 1X2QA 4F17A 2V1QA 3TVTA 1NG2A 1YCSB 1W6XA 1AWJA 2KBTA 5IXBA 1WA7A 1YWOA 2EYYA 2BZ8A 1Y0MA 2RQVA 1OPKA 1M8MA 1X6GA 4GBQA 1NYFA 1ZX6A 2D0NA 2EPDA 4J9DA 2DVJA 4RTVA 1SRMA 1TUCA 2ESWA 2XMFA 1AVZC 1GRIA 1TUDA 2FG0A 2AZVA 1GCQC 1AWOA 1ZUKA 4LUDA 2O31A 2CT4A 3EG1A 2RPNA 1JXOA 3VS7A 3M0RA 2FPEA 2AKKA 5IHNA 1TG0A 2BZYA 4HXJA 1SEMA 1Z9QA 3VS5A 2DBMA 3JV3A 2L3PA 1I0CA 1QWFA 3VS4A 2YUOA 1PKSA 3EHRA 4R0KA 1OOTA 2FRYA 1UECA 2KR3A 2DX1A 2ABLA 2CUBA 3NGPA 4JZ4A 3O5ZA 3U23A 2FRWA 2DL4A 1QKWA 1UJ0A 5IH2A 4JZ3A 3H0FA 2E5KA 2OJ2A 1M3CA 1M3BA 1ZUUA 2YUQA 2K3BA 2C0TA 3H41A 2PTKA 2RQUA 3REAB 4AFQC 2CUDA 1NLOC 2H8HA 1U06A 2VKNA 2J6FA 4LE9A 1I1JA 2JMAA 2MCNA 1T0JA 3M0UA 4WCIA 2O2OA 2K2MA 2JMCA 2AK5A 4J9IA 4LNPA 3UA6A 4AG1C 2RQRA 1X43A 1YP5A 2EQIA 1WIEA 1VYVA 1G2BA 2L3QA 4GLMA 2K6DA 4J9HA 1HJDA 4D8DA 2F2WA 2HDAA 1UTIA 1ZUYA 1OPLA 3RNJA 1ZLMA 1WI7A 2J6OA 3VS1A 1H92A 2J6KA 1GFCA 4M4ZA 1M30A 1MV3A 1ABOA 2EGEA 2DYBA 1RLQC 3KFVA 1HD3A 4OMLA 1NYGA 2GNCA 4X1VA 4AFUC 1N5ZA 1ZBJA 3ULRB 1SHGA 2PNIA 4JJDA 1UE9A 1JXMA 2DILA 4Z8AA 1FYNA 4OMQA 3CQTA 1QLYA 1UHCA 3UA7A 1ZSGA 4CC4B 1AWXA 4KRTA 5I11A 1PHTA 2CH4A 1X27A 3UF4A 2JT4A 2RQTA 2L0AA 3REBB 2DL7A 2A36A 1K4US 1RLPC 2EGAA 4IIMA 2NUZA 4J9BA 1V1CA 4RTUA 2RNAA 1QWEA 2MOXA 1UJYA 3EG2A 3M0TA 1WYXA 2GQIA 2JS0A 1T3SA 1PWTA 3TSWA 2VWFA 3PVQA 4ZNXA 1FMKA 1AWWA 2JTEA 2RMOA 2KRSA 1M27C 1PRMC 2JM9A 2LJ0A 4F14A 3I5RA 3VS0A 2F2VA 5GJWB 1MUZA 1VYTA 3R6NA 2D8JA 4RTZA 3SEMA 2HSPA 2PZ1A 2DBKA 2GGRA 2DM1A 4HVUA 2J05A 1OEBA 2IIMA 2AKLA 2DRKA 2W10A 3H0HA 2KT8A 2BZXA 2G6FX 1WDXA 4OMNA 2L3SA 2J7IA 4ORZA 1QCFA 1YN8A 2O88A 2J06A 2EYXA 1BU1A 3ZL7C 2DRMA 1BK2A 2DJQA 4QT7A 2GBQA
chains in the Genus database with same CATH superfamily
4JJBA 2EYWA 3FJ5A 1WXBA 2X4WA 1TH7A 2BTTA 3JCMe 2EKOA 2CDTA 2DETA 1CSKA 1E7OA 1QVGP 1WHLA 1PSFA 4M7AE 4YTLA 5DLQE 1Q81U 1UFFA 3V8KA 3R6OA 1W2BS 2KEAA 1KSWA 3JCMf 5KE2A 1HYOA 2VGNA 5CKEA 3O8VA 3CPFA 3VYHB 3G6ET 2FB7A 2LJ1A 1Q7YC 3NTHA 5GMKm 1I8FA 3DKMA 4BB7A 1VQ4T 2OX7A 3OSVA 1IO6A 1WHGA 4M77G 2DNUA 4PKCC 1QKXA 4M7AF 4J83A 3G4SA 5IAYA 2ED1A 1BB9A 1MNEA 5HK3A 1SKUB 3G6EQ 2D1XA 3E9FA 1KJWA 1VQ4Q 3HHTB 2SEMA 2KNBB 2ROLA 2CH4W 1UB4A 1ZBXA 4BDYA 1S1NA 1T3LA 3CCSA 4M7DG 1AEYA 3PE0A 1RI9A 3I5SA 4C5GA 1K73R 4A4EA 3WVDB 3H8ZA 1J3TA 4LDXA 1VQKA 2CZ1B 4IKFA 4PLIA 1KFZA 3GOXA 4C92D 5GMKh 2P4RA 4BUGA 2CSIA 4FM4B 3EFOB 2FEIA 2YSQA 2ZZDA 2X4XA 2EQJA 1Z9ZA 1GL5A 3TQ7P 2QQRA 4VUBA 4ZTJA 3EFRA 2JNGA 2HQEA 2ZCFB 1WXTA 2RJCA 1AOJA 1NJIR 2EQUA 3EG3A 4B9WA 3N5BB 1CKBA 3CCRT 4OMMA 1JEGA 2M02A 4QVDA 4C92E 3TREA 2COYA 2E12A 2RHZA 2A08A 3QSUA 4HVWA 1RUWA 2DA9A 2LRQA 1QVGA 5IHIA 2JUFA 1JU5C 2CREA 2P4TA 1KQSP 3HRTA 3CCRQ 2FVUA 4PNOA 2KXDA 3VRYA 3EG9B 3X24B 4BI8B 1VYUA 3C4SA 3E1SA 1M1FA 3VRZA 2M9UA 1YIJT 3BY7A 2JM8A 3QXEB 2CZ7B 3FJPA 1X01A 1SPKA 4GLKA 8AT1B 4C92F 5I2MA 1NEGA 4M7AG 2C0OA 1M1KC 1ZA2B 5LJ5h 4CC7A 3CCLT 1YHQT 2DIQA 4FU6A 2FZCB 2E6ZA 4Z02A 1YIJQ 3M53A 4PJOA 1YNZA 2DL3A 1YWPA 3UWNA 5GMKl 3OS2A 2QQ9A 2CP7A 5LJ5d 5LJ5g 2OI3A 5EC7A 4PJOD 3CCLQ 1YHQQ 3J7AF 1M90C 2LCCA 2OTLA 1UDLA 3META 2LZ6B 1K1ZA 4NL2A 2EKHA 4KGVB 4DBFA 3E19A 1QCOA 2Y4YA 4LDYA 1K0XA 2CP6A 1TSFA 1OV3A 2QDYB 4RTWA 3RBBB 3OW2S 3M57A 2JVVA 2F1LA 2D6FA 5J39A 1KC8R 2KXCA 2RH2A 2DIGA 1W4SA 4UC4A 1MMNA 1BBZA 2RD1A 5I22A 3NHNA 4NS5A 4OB3B 2HAXA 2K5FA 2CKKA 2Y90A 3GP8A 3THKA 2O9VA 4PJOE 2JZ2A 3HFNA 2E3HA 3BDUA 3LWIA 2Y4XA 3NFCA 3EAEA 4JJCA 1TOVA 1NPPA 3M0QA 4F16A 1Y07A 5GAMh 2QDLA 3HSBA 1ARKA 1G83A 2HNIA 4Q5WA 1LVKA 4GY5A 1W2BP 3RMQA 4C5HA 4QW2A 1HSQA 4FSXA 2K2VA 1QCNA 2VASA 1MGQA 4IUTA 2A0FB 1B34B 2DJZA 5GAMd 1Q7YR 5I21A 2B8AA 2PU9B 4OB2B 4PJOF 1O9SA 4FW2A 3HL8A 1M8MA 3MP8A 4N4IA 2YXYA 2ZPEB 1I5OB 2L3RA 4J9DA 2DVJA 5GAN7 3V7SA 1AVZC 2AZVA 1AWOA 1ZUKA 4OP0A 2CT4A 4IURA 2HSEB 1FWZA 1N9RA 1TS9A 3CCQT 2MYSA 4HXJA 2BZYA 3CMAT 5CVIA 2MWOA 4ZGEB 5LJ3d 1VQ6T 1RI0A 2KY9A 3MCAB 2EYQA 3EHRA 4R0KA 1Q82C 2CS7A 4E7JA 3HTRA 3C95A 1KD1C 2CUBA 3CCQQ 3OYKA 1HK9A 2HZYA 5KCHA 4J7IA 2DL4A 1RAHB 3CMAQ 3G7ZA 2L89A 1EX4A 1VQ6Q 2E5KA 1KHCA 1Y71A 4KGXB 2K3BA 3H41A 4AFQC 4PJNA 2RQUA 1M2VA 2HKQB 2ZPIB 5KYYA 5D6YA 1NLOC 3CCVT 4LE9A 1G3SA 3LX7A 1I1JA 2H3EB 2OTJA 2MCNA 1UGQB 4RG8A 3V8JA 5CCAA 4JUVA 3P8HA 2O2OA 3A8LB 3L2QA 1OZ2A 3A8OB 4LNPA 1FX7A 1IGUA 2RQRA 3LWHA 2H3JA 2EQIA 3RKXA 2HKNA 3OB9A 4M77B 3QPHA 1VYVA 4GLMA 2DZ9A 1MHNA 4EMKC 4PJOG 1ZA1B 1ZUYA 4PJOC 1TXQA 1NZ9A 3KXTA 1YJWA 2X51A 3CC7T 4M4ZA 1ABOA 3F70A 4J5YA 3RESA 1RLQC 3JB9H 1HD3A 4X1VA 4M7DB 2KSSA 4AFUC 1VUBA 1N5ZA 2PNIA 1KQ1A 4JJDA 5FU6B 4HT8A 4Z8AA 2JOYA 2ZPGB 1G3WA 3CC7Q 1QP2A 4KRTA 5KYUB 1X27A 3PGGA 1M90R 2QG9B 3UF4A 3OYAA 3OYHA 2JT4A 1N6AA 2QQBA 1RLPC 1EZZB 3CCJT 1NPRA 3OYJA 2RNAA 1UEBA 3CCEA 3CCUA 2VWFA 3PVQA 1FMKA 3PT9A 2RMOA 2KRSA 1WJRA 1PRMC 5HY6A 4XU2A 2LJ0A 5GANh 2F2VA 5GJWB 1MUZA 3CBPA 4FW1A 3OYLA 3CBOA 2GGRA 4HVUA 4FCYA 1TWBA 3JCMg 2YWWA 3DLMA 2DRKA 3EFSA 2A7YA 3I55A 1GXIE 1WDXA 5GANd 3EGDA 3A5ZB 3QYGB 2J7IA 4MDWA 5GANg 4P5NA 4PJMA 3CPWA 3SD4A 2EYXA 1BU1A 2DRMA 1VQ5T 3MHXA 4PK4A 4M7AB 1YI2A 1AZEA 1U5SA 3VKIA 2JN0A 4J6XA 3OYBA 1ABQA 1MMDA 3I56A 5GJVB 4IUPA 1QVFP 2YRDA 2HL5C 3M0PA 3M58A 3G4SQ 2MI6A 3I9QA 1VQ5Q 3SDZA 3LGLA 2DKGA 4E7ZA 1D0YA 2LCSA 1OI1A 1NBEB 1F1BB 3CD6A 4JPBW 4RUGA 5FU7C 3DB4A 3DLLA 2HCKA 2YRCA 4ZN3A 1ZSZA 5LJ3e 3A98A 2EGCA 3PMIA 4OMOA 4XTZA 2RJFA 2M1HA 2C06A 2XI9A 2X3WD 3JSCA 5GAN4 1GBRA 4DEYA 1Q82R 1MMAA 3UATA 5LJ3f 2DFUA 1D3BB 1KD1R 1I5LA 2VV5A 1S72T 1VQ7A 3NTIA 3L1AA 3GNFB 3V8LA 1W1FA 3M0SA 3VU3C 1Y7XA 2KE9A 1NLPC 4FIBA 3VS2A 5KH6A 2QA4T 3I35A 5KCOA 1IXDA 3EGUA 2GTOA 4MZPA 3E9GA 5L23A 1OYXA 1X69A 5FW9A 3CCMT 1XNIA 1S72Q 4O5VA 3NPFA 4RTTA 4TVRA 4Z89A 1D1BA 1WHJA 2LJ3A 3BE3A 1GFDA 2I0NA 1SF9A 2QA4Q 3WXMB 4C92B 3EGXB 1QVPA 2P0KA 3L2ZA 4E6RA 2E41A 2JTFA 2RJEA 2X4YA 4QKUA 3SWNA 3LLRA 2QASA 1VA7A 3QBYA 4FSSA 4ATOA 3GPLA 3OYCA 1WLPB 4JRKA 1R0CB 4DA4A 4Y92A 1A0NB 1JJ2P 1QVFA 1PNJA 1C6VX 1G3TA 4M78A 1PG5B 2RHIA 1E6HA 2R5AA 1K0SA 1XTDA 2V8IA 1M3AA 2XU8A 1AD5A 1JO8A 1D09B 4E7KA 1VQNA 4AG2C 4A4KA 5GAOr 3HFOA 2YLBA 2DD5A 1B07A 2EIFA 2A3LA 2DMOA 3IQLA 1M9SA 3H0IA 1BKBA 2DZCA 2D8HA 3J81E 1D0XA 4K11A 2HQHA 4A4FA 3OYMA 1VOMA 2LNHB 2R5MA 1Y96A 4FT2A 4JDSA 1G5VA 1K9MU 2E4HA 1UGRB 4ESRA 2HBWA 2XDDA 2FL7A 1NM7A 2MF2A 4C0DC 1QP3A 3MJXA 4PJOB 4F7UA 3HP9A 3CMEA 1P92A 1UHFA 4RCCA 1UGSB 4N4GA 1Q95G 1VQMT 4WF2A 3PVLA 4OMFB 3RKWA 3X20B 1MNDA 2ED0A 2NUTA 5FRNA 1AZGB 4J9FA 1WHMA 1LJOA 1VQPT 2M51A 6AT1B 2O4XA 1ZSZC 4CI0C 1YBYA 3BFMA 1X6OA 3H6ZA 1V76A 4BE0A 1VQMQ 4HA8A 5HCKA 2O01E 1WFWA 2COWA 4RTYA 2QTXA 3CXCP 1YJ9A 3PIPA 3MKDA 4ZTFA 1VQPQ 1NG2A 1WQ7A 2KQWA 1JJ2A 1B7TA 2DAQA 1AWJA 2L8DA 2EYYA 4PJLA 1D1AA 4M75A 1X6GA 1WJQA 1VQOA 3VUZA 2D0NA 3CC2T 1YITA 1SRMA 3ASKA 1TUCA 2ESWA 3QYHB 2FG0A 3RKYA 2O31A 1VQLA 3EG1A 1YCYA 1JXOA 2FPEA 3CC2Q 2AKKA 1N8RU 1SEMA 1VQ8T 2QEXA 2K4YA 3VS5A 1N27A 3SWNC 3X26B 3FIFA 4DBRA 1PKSA 2FRYA 3OYIA 1M4ZA 4EMKA 2ABLA 3NGPA 4XTYA 2FRWA 3M54A 1VQ8Q 1QKWA 4MMKA 1M3BA 2YUQA 3RDVA 4NL3A 2QTVA 3REAB 1VQ9A 4M78C 1PCXA 1K8AU 4ZGDB 2VKNA 2J6FA 3TU4K 2GCXA 4J7FA 3G71A 2JMAA 2DTOA 5CQYA 1YFNA 3VUBA 5CKDA 1BI2A 4LDVA 5GAOq 4WCIA 3L42A 2COZA 4J9IA 3UA6A 3S3OA 1X43A 1YP5A 3C12A 3OYEA 2NUPB 5LL6S 2DXCA 2E5QA 4F04B 4D8DA 1OPLA 1PC0A 1WI7A 2J6OA 3VS1A 1OZ3A 3CXCA 3L2UA 1FMWA 2GFUA 2AIRB 3V7RA 1M30A 1MV3A 3QUIA 3CCEQ 3EFOA 3KFVA 1QQJA 2XD0A 2DO3A 1ZBJA 1SHGA 3S3MA 1G8XA 3OYYA 1XQHA 2QGFB 2XK0A 1FYNA 4OMQA 1QW1A 4A54A 1UHCA 3UA7A 5LJ3j 3JCMP 1KC8U 1AWXA 1TTHB 5DLOA 4KGZB 3OYGA 2HMAA 1LOJA 4EMHA 2RQTA 3I55Q 1ZHIA 2E64A 1KQSA 4LXCA 1SSFA 2G3RA 4J9BA 1V1CA 3EG2A 2MOXA 5I2SA 5GAN5 3FC3A 5L8RE 4OGEA 2IG0A 3TSWA 2IPOB 3G6EA 3JCMX 3P8DA 1VQ4A 2JM9A 4XTWA 4F14A 3VS0A 3I56Q 3R6NA 2F5KA 2D8JA 4RTZA 2PZ1A 1Q7YU 2V8KA 3QZ5B 2DPPB 2LX9A 3OS1A 3CEYA 2J05A 1OEBA 2W10A 4BY6B 2BZXA 2G6FX 4N4HA 3URGA 5CIUA 4OMNA 3RR6A 2O88A 5GMKe 1IB8A 3ZL7C 4M75C 4BI3A 4QT7A 4FYXB 3X28B 3LYIA 1M5Q1 2PVGB 2ATCB 2K79A 2XG8D 3PIOA 2QGGA 4QVCA 5ECAA 3OS5A 4E7IA 4C8QA 3QO3A 2M0YA 1UG1A 2E10A 2RQWA 4BD3A 2KROA 2JS2A 2YLCA 1FMVA 1M1GA 2YUPA 3H9NA 4EPCA 3CCRA 5J3BA 4C8QD 1U3OA 4C0DB 2VVKA 3BDLA 2YT6A 2W0ZA 1W2BA 2QK0A 3M56A 2XDPA 3QJ6A 2QYZA 3D7SB 3ME9A 5IHKA 4ME7A 1M1KR 3MP1A 1JQQA 2E3IA 4OMPA 5LJ5e 1WHKA 1PKTA 1OX9A 3QDRB 2F5TX 2RHXA 1PRLC 2EW3A 4C8QE 4BE1A 2AZSA 4KH1B 1B34A 2BKDN 1TU0B 3NTKA 2XICA 1WHHA 4JLIA 5C0MA 3J80E 2RA2A 2KMTA 3CCLA 1YHQA 1V29B 1GCQA 3TCJA 1WJSA 4AFSC 5KYWA 5LJ5f 2CZ0B 1DJ7B 1Q81C 1BCMA 4HCKA 4NOYA 2O9SA 4C5EA 2RM4A 1TUGB 2E6NA 4JLGA 4LD9K 2LQWA 4PJJA 3GLXA 2HBPA 2JXBA 3E2UA 4CC3A 4LN2A 2JJ9A 2CT3A 2DVEA 4J9GA 3JCMh 3OW2P 4C8QF 4BE2A 3L2VA 3S3NA 2KGTA 2OAUA 1QVGS 5KYXA 1UGVA 1K9MC 1VQNQ 4DOVA 2KRMA 2LVMA 4AFZC 1H3HA 2BE9B 2CSQA 3JCMd 2DE0X 4MZMA 2R58A 2E70A 5CO7A 1KHIA 2MIOA 2C0IA 2VB6A 1JBMA 4Z88A 2FPDA 2LMJA 1LCKA 4N0AA 4JRIA 2F69A 5GAMe 2HEQA 5IT9E 3FEOA 3JCMV 3G4ST 2DXBA 2FO0A 3VYGA 1WXUA 4X9DA 2QI2A 3X25B 2CGHA 4IIOA 5KYNA 3CC4A 3UDCA 4E47A 4RTXA 2GQVA 5FWCA 4CRIA 2BIVA 4E2FB 3CCST 1WZOA 4EIKA 1KQ2A 5GAMf 3A8GB 2P84A 5IXFA 2RF0A 4E7SA 4QQGA 1E6GA 2DLPA 1VQKT 3QIIA 1QMCA 2YUNA 3HRUA 1W70A 4EMGA 2X3XD 3CCSQ 4J9CA 2K5IA 3QDFA 1YJ9T 3RMSA 2KT1A 4A53A 1T0HA 2CZ6B 2D0QB 1EFNA 2MWPA 1VQKQ 4KUDK 4KULA 2V8JA 4RG2A 2EBPA 4RKUE 4XTVA 3SHWA 5HKCA 2E65A 1SRLA 3TSZA 1RAEB 2EJGA 1RABB 4M7DA 2YDLA 1WPYA 1YJ9Q 2EQKA 3CCQA 4HCZA 4C8QG 2CP0A 3CMAA 4C8QC 3MEAA 1IREB 2R57A 1N8RC 1MV0B 1N9SA 5KYUA 5J26A 4L59A 1HXDA 2EVRA 3OW2A 4CC2A 2RHYA 2DEUA 1D1CA 1Q86U 2DTHA 5GAN2 2K3XA 2P0PA 3GBQA 1Q82U 3EHQA 4V2SA 4X34A 1VIEA 1OU8A 1H3ZA 3Q1JA 5C6SA 1RAFB 3CCVA 3TVTA 5IN1A 1K8AC 2KBTA 2BZ8A 3PFSA 1Y0MA 2RQVA 1OPKA 3JAME 1ZX6A 2EPDA 2WSFE 1R0BG 2OTLT 1NE8A 4A4HA 3MO8A 1BYMA 1TUDA 1GRIA 1GCQC 1RL2A 1XJWB 4LUDA 4JS5A 3OYDA 3EH2A 2M0OA 2WACA 3S6WA 3M9QA 4QQ6A 4M7AA 3CC7A 4E7HA 2BUDA 2RPNA 2MMPA 3M0RA 2OTLQ 2RHUA 5IHNA 4M78D 1BI1A 1Z9QA 1Q81R 3A8HB 5A0LA 2VXFA 1KK7A 1I0CA 5DY9A 2ZGWA 2XDBA 1IHWA 2NLUA 2KR3A 2DX1A 2MAMA 3ER0A 3U23A 2L5QA 2JTMA 2LQ8A 1UJ0A 4DQ2A 4QQDA 5IH2A 3M4GA 3H0FA 3UT1A 3CCJA 2OJ2A 1M3CA 1K9MR 1ZUUA 2C0TA 2PTKA 2CP3A 4N0AC 3OS0A 5GANe 2CUDA 2DTIA 1WQWA 2K5LA 4M78E 2VXEA 4EMKB 2K2MA 1D3BA 5GMKj 2AK5A 5CQXA 2CP5A 4AG1C 2FHDA 5GANf 2HL3A 1G2BA 2L3QA 2MPXC 4J9HA 2K6DA 2LC4A 1HJDA 4HCBA 2F2WA 2AT1B 3RNJA 5A2QE 3RIRA 3M55A 4M78F 3G1JA 2J6KA 4M77C 1GFCA 1YJNA 4FYYB 1EIFA 2DYBA 5CKBA 1VQ5A 4OMLA 3OYFA 2WSEE 4JRPA 1UE9A 3MPUB 1JXMA 2DILA 1LNXA 3QKJA 1PSEA 4C92A 3CQTA 3EGXA 1M8VA 4KUIA 3JCMb 1ZSGA 4CC4B 3LW5E 4M7DC 1PHTA 2CH4A 4MDXA 3QJYA 4F7UE 5FU6C 3M59A 3REBB 2DL7A 4ELZC 1K4US 3OY9A 1BIBA 1K73U 2ZPBB 4RTUA 1QWEA 1UJYA 1WYXA 2GQIA 4KBMB 2RB6A 1T3SA 1PWTA 2EQMA 2OTJT 1AWWA 5LJ5j 1IHVA 2P0QA 3QG1A 1M27C 4IUQA 4M75D 3CPWS 3I5RA 1N8RR 2DD4A 2WSCE 5D6WA 5KE3A 1RAGB 4AMCA 4F7UF 3SEMA 1D0ZA 1NJIU 3KBGA 4R56A 2DBKA 2DM1A 2Z0WA 2AHJB 2IIMA 2HQXA 2OTJQ 3RERA 5CR2A 2DXUA 1S72A 4PL6A 4ORZA 1QCFA 1YJWT 4C5IA 2K3YA 1YN8A 4Y28E 4MMLA 1BK2A 2QA4A 2GBQA 1OULA 4M75E 3JCMJ 2RI5A 1K8AR 3CCMA 3TEEA 2K9GA 3PMTA 3FDRA 1H8KA 4M78G 3JCMQ 1YJWQ 3C0CA 3QWYA 3PTAA 4BDZA 5FU7B 4FL6A 4X9CA 4M7AC 2L2PA 8ATCB 3ZEHA 3ZBDA 2RJDA 2EFIA 2B86A 3VJPA 2ROTA 2RN8A 2XIDA 1XOVA 3HKSA 2MK5A 3JB9D 4R55A 4J8OA 5GAMj 2CYZB 5HK0A 4M75F 1X6BA 3CCET 4II1A 3CCUT 3P8BB 4KT0E 1U8RA 1UUEA 2KI7A 1M2VB 5KYYB 2M16A 5GAN3 5GMKi 4C8QB 4ZN1A 1H641 1RAAB 4C0GA 3MEWA 2V1RA 3FRNA 2SRCA 4J6WA 4C0FA 3CCUQ 1WGSA 4MZTA 5GAOp 3I55T 1IRXA 1OX8A 2LNVA 4FT4A 5CKFA 3QHSA 3M4YA 2ZPFB 5CK9A 2KDSA 4J9EA 2X4JA 3JB9I 2FZKB 4F7UG 2X9HA 2DEQA 2EYZA 2K7AA 1LPLA 1IGQA 1R77A 2ENMA 1YI2T 3PNWC 4LDWA 3CC4T 2LP5A 2XHCA 3I56T 4O6JA 3JRZA 4A63B 2LX7A 4PFPA 5A0GA 4E7LA 4OB1B 3VV0A 2DL5A 3JB9F 5CKHA 2LT4A 4FYWB 1K9AA 1SHFA 1RADB 3A8MB 2DL8A 1C0MA 2KAFA 1YI2Q 2VGMA 2JW4A 1GCPA 5FROA 1QVFS 5GAMg 3CC4Q 3LH5A 3CD6T 3EG9A 4XTXA 3L2RA 4PFZA 4C92G 1NEBA 4JS4A 2LTOA 2PVOB 5KYWB 3AT1B 4C92C 4ZGJB 3FB9A 2RK1A 4HCCA 2KRNA 1IZ6A 1I07A 1RAIB 3QWXX 2GTJA 1VQMA 2A28A 3CD6Q 5LJ3h 4ELYC 2X35A 4M75G 1GBQA 4D8KA 5KYXB 2VUBA 4EDUA 3EG0A 2RI2A 1VQPA 1RACB 4HVVA 2ZPHB 3VS6A 3GF5A 2FPFA 2OAWA 1Q86C 1VQ7T 4HKEA 4PFOA 3OYNA 2EWNA 4XQ3A 5LJ3g 1SSHA 4B6MA 3NMZC 1SG5A 3EGDB 1BI0A 2PVDB 3OBWA 1JB0E 2FZGB 2YHTA 1G3YA 1OU9A 4L6V5 2ECZA 2VYTA 1VQ7Q 2NUPA 9ATCB 4BACA 4DEXA 2EJ9A 2QAZA 2DF6A 4DBHA 3EH1A 2K57A 2QQSA 1ZQ1A 3CPWP 2A37A 3L2WA 3LGFA 3CC2A 3JCMW 4L5GA 3HRSA 1WX6A 1KG1A 2LQKA 2F2XA 1U1TA 1I81A 3QZ9B 3A1PA 1X75C 1O75A 5FWBA 2V26A 4RMOA 2LQNA 3JB9G 1JRIA 1CKAA 3CCVQ 3OMCA 2LDMA 4JRQA 1X2KA 1YIJA 1ZSZB 4B9XA 1VQ8A 3INZA 1WNLA 1K76A 4XAXB 4LUEA 3VS3A 1BIAA 2NWMA 1Y57A 1KIKA 4OB0B 5GANj 2RO0A 3JCMc 2KYBA 2QXFA 5M9OA 1JJ2S 2CP2A 4OGCA 2D9TA 5AT1B 1VQNT 1M1KU 2KYMA 1PM3A 1M2OA 4LDUA 4LD6A 4IUUA 3SB2A 1B3QA 3WVEB 2VC8A 5FRMA 1X2QA 3AHUA 2RI3A 2KK4A 4F17A 2V1QA 3OSSC 1YCSB 1W6XA 5CAIA 1UGPB 5IXBA 1WA7A 1YWOA 5GAOm 1ACMB 2I2LA 2LCLA 1M90U 4GBQA 3MEVA 2BE7D 1NYFA 2XKOC 4KH0B 2DXTA 3C94A 4RTVA 3M5AA 2XMFA 4AT1B 4DOWA 5D7UA 3HPWA 3CCJQ 3SWNB 3CMET 2DYIA 3VS7A 1FXXA 4JJNK 1TG0A 3OMGA 2DERA 2DBMA 2EJFA 3JV3A 2L3PA 1QWFA 3VS4A 2YUOA 1OOTA 4OVAA 5A0DA 1YJNT 1UECA 4OF1A 3CMEQ 2FYKA 2EAYA 5EG2A 4JZ4A 4M78B 3O5ZA 2QQAA 3MEUA 4JZ3A 4M77A 1BCOA 5GAN6 2PUKB 5AYFA 1K73C 1YJNQ 2H8HA 1U06A 2KVQG 3V7CA 4M77D 1MMGA 1T0JA 3M0UA 3CXCS 4J6YA 2JMCA 3BW1A 1VQOT 3CBMA 4XK8E 1YITT 1WIEA 1NJIC 4PLLA 3LH0A 2HDAA 1Q86R 1UTIA 2HD0A 4M7DD 3DB3A 1ZLMA 4BI4A 1VQ6A 1OQKA 1Y96B 1U1SA 4XU1A 1H92A 1VQLT 7AT1B 4XTUA 1VQOQ 4M77E 3T9NA 2EGEA 4Y91A 2RK2A 3SFMA 1YITQ 2PQWA 2GFAA 2QEXT 3FLGA 1NYGA 2GNCA 4F7UB 5FLXE 4D6WA 1KQSS 3ULRB 4C0ZA 4FYVB 4WTOB 1BI3A 4RCBA 1C1AA 1KD1U 1QLYA 1VQLQ 5GAOl 1AHJB 2NYSA 1VIFA 5I11A 2LT1A 4M7DE 2NUTB 2ZAEA 3OBYA 2L0AA 3ZFJA 3OA6A 2QEXQ 4DBQA 2A36A 5GAOn 3GNGA 1I4K1 2EGAA 2O4XB 4IIMA 2NUZA 4M77F 3GIBA 1R8OB 3M0TA 3UPUA 1VQ9T 2JS0A 5GAN8 1PD0A 2DK3A 3G71T 4ZNXA 2JTEA 4QVZA 3KUFA 3JB9J 2IVWA 3CCMQ 4ANJA 1VYTA 5D6XA 5DM7R 4M7DF 2GF7A 1VQ9Q 2HSPA 2YRVA 4XU0A 3MP6A 3RUXA 4IUVA 3G71Q 2AKLA 1PD1A 3H0HA 4M75B 2KT8A 3OQ5A 4M7AD 2L3SA 4HT9A 4XU3A 2J06A 2E1HA 1AT1B 2PUOB 4BY6C 2DJQA 1KC8C 4A4GA
chains in the Genus database with same CATH topology
4JJBA 2EYWA 3FJ5A 1WXBA 1AZEA 1U5SA 1ABQA 2BTTA 2CDTA 2K79A 5GJVB 2K9GA 1CSKA 1H8KA 3C0CA 1E7OA 3QWYA 5ECAA 3M0PA 2L2PA 2B86A 3I9QA 2M0YA 1UFFA 2ROTA 2RN8A 1UG1A 2LCSA 1XOVA 2RQWA 2KEAA 2KROA 2JS2A 1KSWA 4JPBW 4RUGA 2YUPA 2HCKA 1U3OA 1X6BA 3A98A 2EGCA 4OMOA 2LJ1A 2VVKA 1UUEA 2YT6A 2W0ZA 2X3WD 1IO6A 2DNUA 5IHKA 1QKXA 1GBRA 4DEYA 2V1RA 3UATA 2ED1A 2SRCA 1JQQA 1BB9A 4OMPA 2D1XA 1KJWA 1PKTA 2SEMA 2KNBB 2ROLA 1PRLC 2EW3A 2AZSA 2CH4W 1W1FA 3M0SA 1S1NA 4J9EA 1T3LA 2KE9A 1AEYA 3PE0A 1NLPC 3VS2A 1RI9A 3I35A 3I5SA 2EYZA 3EGUA 2K7AA 2GTOA 2ENMA 1J3TA 5L23A 1GCQA 1X69A 5FW9A 1KFZA 2LP5A 4AFSC 2P4RA 2CSIA 2FEIA 3NPFA 2YSQA 4HCKA 4RTTA 2O9SA 4Z89A 4A63B 2LJ3A 2LX7A 2DL5A 2LQWA 1GFDA 1Z9ZA 1GL5A 2I0NA 2JXBA 4CC3A 1K9AA 1SHFA 2CT3A 4LN2A 4J9GA 2DL8A 1WXTA 1AOJA 4E6RA 2JW4A 1GCPA 2KGTA 3EG3A 3LH5A 1CKBA 1UGVA 1VA7A 4FSSA 2KRMA 4OMMA 1JEGA 1NEBA 4AFZC 1H3HA 2CSQA 2KRNA 2DE0X 1WLPB 1I07A 2MIOA 3QWXX 4Y92A 2GTJA 2C0IA 1A0NB 2A08A 2A28A 4Z88A 2FPDA 4HVWA 1RUWA 1PNJA 2DA9A 2LMJA 5IHIA 1LCKA 1JU5C 2CREA 2HEQA 1GBQA 1E6HA 1K0SA 2FO0A 2KXDA 3VRYA 4D8KA 1WXUA 1M3AA 1VYUA 3EG0A 4HVVA 3VRZA 3VS6A 1AD5A 1JO8A 2JM8A 2FPFA 2OAWA 4IIOA 4RTXA 5FWCA 1SPKA 4AG2C 1SSHA 1NEGA 3NMZC 4EIKA 2C0OA 4CC7A 5IXFA 2RF0A 1B07A 2DMOA 1E6GA 2DLPA 3IQLA 1YNZA 2YUNA 2DL3A 1YWPA 2ECZA 3H0IA 1W70A 2X3XD 2D8HA 4DEXA 2DF6A 4K11A 4J9CA 2A37A 2OI3A 5EC7A 2LNHB 2KT1A 1T0HA 1EFNA 1UDLA 1WX6A 2LZ6B 1K1ZA 2EKHA 2F2XA 2EBPA 4ESRA 3SHWA 2HBWA 1K0XA 1SRLA 3TSZA 1OV3A 1NM7A 5FWBA 4RTWA 3RBBB 2LQNA 1CKAA 2YDLA 1UHFA 2KXCA 1X2KA 1BBZA 5I22A 3NHNA 3PVLA 1K76A 4LUEA 1MV0B 3VS3A 2NWMA 3THKA 1Y57A 1KIKA 2O9VA 2EVRA 2ED0A 1AZGB 4J9FA 4CC2A 2M51A 2KYBA 4JJCA 3M0QA 4F16A 2QDLA 5HCKA 1ARKA 1G83A 2KYMA 3GBQA 1WFWA 3EHQA 4RTYA 1B3QA 1HSQA 1X2QA 4F17A 2V1QA 3TVTA 1NG2A 1YCSB 1W6XA 1AWJA 2KBTA 5IXBA 1WA7A 1YWOA 2EYYA 2BZ8A 1Y0MA 2RQVA 1OPKA 1M8MA 1X6GA 4GBQA 1NYFA 1ZX6A 2D0NA 2EPDA 4J9DA 2DVJA 4RTVA 1SRMA 1TUCA 2ESWA 2XMFA 1AVZC 1GRIA 1TUDA 2FG0A 2AZVA 1GCQC 1AWOA 1ZUKA 4LUDA 2O31A 2CT4A 3EG1A 2RPNA 1JXOA 3VS7A 3M0RA 2FPEA 2AKKA 5IHNA 1TG0A 2BZYA 4HXJA 1SEMA 1Z9QA 3VS5A 2DBMA 3JV3A 2L3PA 1I0CA 1QWFA 3VS4A 2YUOA 1PKSA 3EHRA 4R0KA 1OOTA 2FRYA 1UECA 2KR3A 2DX1A 2ABLA 2CUBA 3NGPA 4JZ4A 3O5ZA 3U23A 2FRWA 2DL4A 1QKWA 1UJ0A 5IH2A 4JZ3A 3H0FA 2E5KA 2OJ2A 1M3CA 1M3BA 1ZUUA 2YUQA 2K3BA 2C0TA 3H41A 2PTKA 2RQUA 3REAB 4AFQC 2CUDA 1NLOC 2H8HA 1U06A 2VKNA 2J6FA 4LE9A 1I1JA 2JMAA 2MCNA 1T0JA 3M0UA 4WCIA 2O2OA 2K2MA 2JMCA 2AK5A 4J9IA 4LNPA 3UA6A 4AG1C 2RQRA 1X43A 1YP5A 2EQIA 1WIEA 1VYVA 1G2BA 2L3QA 4GLMA 2K6DA 4J9HA 1HJDA 4D8DA 2F2WA 2HDAA 1UTIA 1ZUYA 1OPLA 3RNJA 1ZLMA 1WI7A 2J6OA 3VS1A 1H92A 2J6KA 1GFCA 4M4ZA 1M30A 1MV3A 1ABOA 2EGEA 2DYBA 1RLQC 3KFVA 1HD3A 4OMLA 1NYGA 2GNCA 4X1VA 4AFUC 1N5ZA 1ZBJA 3ULRB 1SHGA 2PNIA 4JJDA 1UE9A 1JXMA 2DILA 4Z8AA 1FYNA 4OMQA 3CQTA 1QLYA 1UHCA 3UA7A 1ZSGA 4CC4B 1AWXA 4KRTA 5I11A 1PHTA 2CH4A 1X27A 3UF4A 2JT4A 2RQTA 2L0AA 3REBB 2DL7A 2A36A 1K4US 1RLPC 2EGAA 4IIMA 2NUZA 4J9BA 1V1CA 4RTUA 2RNAA 1QWEA 2MOXA 1UJYA 3EG2A 3M0TA 1WYXA 2GQIA 2JS0A 1T3SA 1PWTA 3TSWA 2VWFA 3PVQA 4ZNXA 1FMKA 1AWWA 2JTEA 2RMOA 2KRSA 1M27C 1PRMC 2JM9A 2LJ0A 4F14A 3I5RA 3VS0A 2F2VA 5GJWB 1MUZA 1VYTA 3R6NA 2D8JA 4RTZA 3SEMA 2HSPA 2PZ1A 2DBKA 2GGRA 2DM1A 4HVUA 2J05A 1OEBA 2IIMA 2AKLA 2DRKA 2W10A 3H0HA 2KT8A 2BZXA 2G6FX 1WDXA 4OMNA 2L3SA 2J7IA 4ORZA 1QCFA 1YN8A 2O88A 2J06A 2EYXA 1BU1A 3ZL7C 2DRMA 1BK2A 2DJQA 4QT7A 2GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJB A;  2EYW A;  3FJ5 A;  1WXB A;  1AZE A;  1U5S A;  1ABQ A;  2BTT A;  2CDT A;  2K79 A;  5GJV B;  2K9G A;  1CSK A;  1H8K A;  3C0C A;  1E7O A;  3QWY A;  5ECA A;  3M0P A;  2L2P A;  2B86 A;  3I9Q A;  2M0Y A;  1UFF A;  2ROT A;  2RN8 A;  1UG1 A;  2LCS A;  1XOV A;  2RQW A;  2KEA A;  2KRO A;  2JS2 A;  1KSW A;  4JPB W;  4RUG A;  2YUP A;  2HCK A;  1U3O A;  1X6B A;  3A98 A;  2EGC A;  4OMO A;  2LJ1 A;  2VVK A;  1UUE A;  2YT6 A;  2W0Z A;  2X3W D;  1IO6 A;  2DNU A;  5IHK A;  1QKX A;  1GBR A;  4DEY A;  2V1R A;  3UAT A;  2ED1 A;  2SRC A;  1JQQ A;  1BB9 A;  4OMP A;  2D1X A;  1KJW A;  1PKT A;  2SEM A;  2KNB B;  2ROL A;  1PRL C;  2EW3 A;  2AZS A;  2CH4 W;  1W1F A;  3M0S A;  1S1N A;  4J9E A;  1T3L A;  2KE9 A;  1AEY A;  3PE0 A;  1NLP C;  3VS2 A;  1RI9 A;  3I35 A;  3I5S A;  2EYZ A;  3EGU A;  2K7A A;  2GTO A;  2ENM A;  1J3T A;  5L23 A;  1GCQ A;  1X69 A;  5FW9 A;  1KFZ A;  2LP5 A;  4AFS C;  2P4R A;  2CSI A;  2FEI A;  3NPF A;  2YSQ A;  4HCK A;  4RTT A;  2O9S A;  4Z89 A;  4A63 B;  2LJ3 A;  2LX7 A;  2DL5 A;  2LQW A;  1GFD A;  1Z9Z A;  1GL5 A;  2I0N A;  2JXB A;  4CC3 A;  1K9A A;  1SHF A;  2CT3 A;  4LN2 A;  4J9G A;  2DL8 A;  1WXT A;  1AOJ A;  4E6R A;  2JW4 A;  1GCP A;  2KGT A;  3EG3 A;  3LH5 A;  1CKB A;  1UGV A;  1VA7 A;  4FSS A;  2KRM A;  4OMM A;  1JEG A;  1NEB A;  4AFZ C;  1H3H A;  2CSQ A;  2KRN A;  2DE0 X;  1WLP B;  1I07 A;  2MIO A;  3QWX X;  4Y92 A;  2GTJ A;  2C0I A;  1A0N B;  2A08 A;  2A28 A;  4Z88 A;  2FPD A;  4HVW A;  1RUW A;  1PNJ A;  2DA9 A;  2LMJ A;  5IHI A;  1LCK A;  1JU5 C;  2CRE A;  2HEQ A;  1GBQ A;  1E6H A;  1K0S A;  2FO0 A;  2KXD A;  3VRY A;  4D8K A;  1WXU A;  1M3A A;  1VYU A;  3EG0 A;  4HVV A;  3VRZ A;  3VS6 A;  1AD5 A;  1JO8 A;  2JM8 A;  2FPF A;  2OAW A;  4IIO A;  4RTX A;  5FWC A;  1SPK A;  4AG2 C;  1SSH A;  1NEG A;  3NMZ C;  4EIK A;  2C0O A;  4CC7 A;  5IXF A;  2RF0 A;  1B07 A;  2DMO A;  1E6G A;  2DLP A;  3IQL A;  1YNZ A;  2YUN A;  2DL3 A;  1YWP A;  2ECZ A;  3H0I A;  1W70 A;  2X3X D;  2D8H A;  4DEX A;  2DF6 A;  4K11 A;  4J9C A;  2A37 A;  2OI3 A;  5EC7 A;  2LNH B;  2KT1 A;  1T0H A;  1EFN A;  1UDL A;  1WX6 A;  2LZ6 B;  1K1Z A;  2EKH A;  2F2X A;  2EBP A;  4ESR A;  3SHW A;  2HBW A;  1K0X A;  1SRL A;  3TSZ A;  1OV3 A;  1NM7 A;  5FWB A;  4RTW A;  3RBB B;  2LQN A;  1CKA A;  2YDL A;  1UHF A;  2KXC A;  1X2K A;  1BBZ A;  5I22 A;  3NHN A;  3PVL A;  1K76 A;  4LUE A;  1MV0 B;  3VS3 A;  2NWM A;  3THK A;  1Y57 A;  1KIK A;  2O9V A;  2EVR A;  2ED0 A;  1AZG B;  4J9F A;  4CC2 A;  2M51 A;  2KYB A;  4JJC A;  3M0Q A;  4F16 A;  2QDL A;  5HCK A;  1ARK A;  1G83 A;  2KYM A;  3GBQ A;  1WFW A;  3EHQ A;  4RTY A;  1B3Q A;  1HSQ A;  1X2Q A;  4F17 A;  2V1Q A;  3TVT A;  1NG2 A;  1YCS B;  1W6X A;  1AWJ A;  2KBT A;  5IXB A;  1WA7 A;  1YWO A;  2EYY A;  2BZ8 A;  1Y0M A;  2RQV A;  1OPK A;  1M8M A;  1X6G A;  4GBQ A;  1NYF A;  1ZX6 A;  2D0N A;  2EPD A;  4J9D A;  2DVJ A;  4RTV A;  1SRM A;  1TUC A;  2ESW A;  2XMF A;  1AVZ C;  1GRI A;  1TUD A;  2FG0 A;  2AZV A;  1GCQ C;  1AWO A;  1ZUK A;  4LUD A;  2O31 A;  2CT4 A;  3EG1 A;  2RPN A;  1JXO A;  3VS7 A;  3M0R A;  2FPE A;  2AKK A;  5IHN A;  1TG0 A;  2BZY A;  4HXJ A;  1SEM A;  1Z9Q A;  3VS5 A;  2DBM A;  3JV3 A;  2L3P A;  1I0C A;  1QWF A;  3VS4 A;  2YUO A;  1PKS A;  3EHR A;  4R0K A;  1OOT A;  2FRY A;  1UEC A;  2KR3 A;  2DX1 A;  2ABL A;  2CUB A;  3NGP A;  4JZ4 A;  3O5Z A;  3U23 A;  2FRW A;  2DL4 A;  1QKW A;  1UJ0 A;  5IH2 A;  4JZ3 A;  3H0F A;  2E5K A;  2OJ2 A;  1M3C A;  1M3B A;  1ZUU A;  2YUQ A;  2K3B A;  2C0T A;  3H41 A;  2PTK A;  2RQU A;  3REA B;  4AFQ C;  2CUD A;  1NLO C;  2H8H A;  1U06 A;  2VKN A;  2J6F A;  4LE9 A;  1I1J A;  2JMA A;  2MCN A;  1T0J A;  3M0U A;  4WCI A;  2O2O A;  2K2M A;  2JMC A;  2AK5 A;  4J9I A;  4LNP A;  3UA6 A;  4AG1 C;  2RQR A;  1X43 A;  1YP5 A;  2EQI A;  1WIE A;  1VYV A;  1G2B A;  2L3Q A;  4GLM A;  2K6D A;  4J9H A;  1HJD A;  4D8D A;  2F2W A;  2HDA A;  1UTI A;  1ZUY A;  1OPL A;  3RNJ A;  1ZLM A;  1WI7 A;  2J6O A;  3VS1 A;  1H92 A;  2J6K A;  1GFC A;  4M4Z A;  1M30 A;  1MV3 A;  1ABO A;  2EGE A;  2DYB A;  1RLQ C;  3KFV A;  1HD3 A;  4OML A;  1NYG A;  2GNC A;  4X1V A;  4AFU C;  1N5Z A;  1ZBJ A;  3ULR B;  1SHG A;  2PNI A;  4JJD A;  1UE9 A;  1JXM A;  2DIL A;  4Z8A A;  1FYN A;  4OMQ A;  3CQT A;  1QLY A;  1UHC A;  3UA7 A;  1ZSG A;  4CC4 B;  1AWX A;  4KRT A;  5I11 A;  1PHT A;  2CH4 A;  1X27 A;  3UF4 A;  2JT4 A;  2RQT A;  2L0A A;  3REB B;  2DL7 A;  2A36 A;  1K4U S;  1RLP C;  2EGA A;  4IIM A;  2NUZ A;  4J9B A;  1V1C A;  4RTU A;  2RNA A;  1QWE A;  2MOX A;  1UJY A;  3EG2 A;  3M0T A;  1WYX A;  2GQI A;  2JS0 A;  1T3S A;  1PWT A;  3TSW A;  2VWF A;  3PVQ A;  4ZNX A;  1FMK A;  1AWW A;  2JTE A;  2RMO A;  2KRS A;  1M27 C;  1PRM C;  2JM9 A;  2LJ0 A;  4F14 A;  3I5R A;  3VS0 A;  2F2V A;  5GJW B;  1MUZ A;  1VYT A;  3R6N A;  2D8J A;  4RTZ A;  3SEM A;  2HSP A;  2PZ1 A;  2DBK A;  2GGR A;  2DM1 A;  4HVU A;  2J05 A;  1OEB A;  2IIM A;  2AKL A;  2DRK A;  2W10 A;  3H0H A;  2KT8 A;  2BZX A;  2G6F X;  1WDX A;  4OMN A;  2L3S A;  2J7I A;  4ORZ A;  1QCF A;  1YN8 A;  2O88 A;  2J06 A;  2EYX A;  1BU1 A;  3ZL7 C;  2DRM A;  1BK2 A;  2DJQ A;  4QT7 A;  2GBQ A; 
#chains in the Genus database with same CATH topology
 4JJB A;  2EYW A;  3FJ5 A;  1WXB A;  2X4W A;  1TH7 A;  2BTT A;  3JCM e;  2EKO A;  2CDT A;  2DET A;  1CSK A;  1E7O A;  1QVG P;  1WHL A;  1PSF A;  4M7A E;  4YTL A;  5DLQ E;  1Q81 U;  1UFF A;  3V8K A;  3R6O A;  1W2B S;  2KEA A;  1KSW A;  3JCM f;  5KE2 A;  1HYO A;  2VGN A;  5CKE A;  3O8V A;  3CPF A;  3VYH B;  3G6E T;  2FB7 A;  2LJ1 A;  1Q7Y C;  3NTH A;  5GMK m;  1I8F A;  3DKM A;  4BB7 A;  1VQ4 T;  2OX7 A;  3OSV A;  1IO6 A;  1WHG A;  4M77 G;  2DNU A;  4PKC C;  1QKX A;  4M7A F;  4J83 A;  3G4S A;  5IAY A;  2ED1 A;  1BB9 A;  1MNE A;  5HK3 A;  1SKU B;  3G6E Q;  2D1X A;  3E9F A;  1KJW A;  1VQ4 Q;  3HHT B;  2SEM A;  2KNB B;  2ROL A;  2CH4 W;  1UB4 A;  1ZBX A;  4BDY A;  1S1N A;  1T3L A;  3CCS A;  4M7D G;  1AEY A;  3PE0 A;  1RI9 A;  3I5S A;  4C5G A;  1K73 R;  4A4E A;  3WVD B;  3H8Z A;  1J3T A;  4LDX A;  1VQK A;  2CZ1 B;  4IKF A;  4PLI A;  1KFZ A;  3GOX A;  4C92 D;  5GMK h;  2P4R A;  4BUG A;  2CSI A;  4FM4 B;  3EFO B;  2FEI A;  2YSQ A;  2ZZD A;  2X4X A;  2EQJ A;  1Z9Z A;  1GL5 A;  3TQ7 P;  2QQR A;  4VUB A;  4ZTJ A;  3EFR A;  2JNG A;  2HQE A;  2ZCF B;  1WXT A;  2RJC A;  1AOJ A;  1NJI R;  2EQU A;  3EG3 A;  4B9W A;  3N5B B;  1CKB A;  3CCR T;  4OMM A;  1JEG A;  2M02 A;  4QVD A;  4C92 E;  3TRE A;  2COY A;  2E12 A;  2RHZ A;  2A08 A;  3QSU A;  4HVW A;  1RUW A;  2DA9 A;  2LRQ A;  1QVG A;  5IHI A;  2JUF A;  1JU5 C;  2CRE A;  2P4T A;  1KQS P;  3HRT A;  3CCR Q;  2FVU A;  4PNO A;  2KXD A;  3VRY A;  3EG9 B;  3X24 B;  4BI8 B;  1VYU A;  3C4S A;  3E1S A;  1M1F A;  3VRZ A;  2M9U A;  1YIJ T;  3BY7 A;  2JM8 A;  3QXE B;  2CZ7 B;  3FJP A;  1X01 A;  1SPK A;  4GLK A;  8AT1 B;  4C92 F;  5I2M A;  1NEG A;  4M7A G;  2C0O A;  1M1K C;  1ZA2 B;  5LJ5 h;  4CC7 A;  3CCL T;  1YHQ T;  2DIQ A;  4FU6 A;  2FZC B;  2E6Z A;  4Z02 A;  1YIJ Q;  3M53 A;  4PJO A;  1YNZ A;  2DL3 A;  1YWP A;  3UWN A;  5GMK l;  3OS2 A;  2QQ9 A;  2CP7 A;  5LJ5 d;  5LJ5 g;  2OI3 A;  5EC7 A;  4PJO D;  3CCL Q;  1YHQ Q;  3J7A F;  1M90 C;  2LCC A;  2OTL A;  1UDL A;  3MET A;  2LZ6 B;  1K1Z A;  4NL2 A;  2EKH A;  4KGV B;  4DBF A;  3E19 A;  1QCO A;  2Y4Y A;  4LDY A;  1K0X A;  2CP6 A;  1TSF A;  1OV3 A;  2QDY B;  4RTW A;  3RBB B;  3OW2 S;  3M57 A;  2JVV A;  2F1L A;  2D6F A;  5J39 A;  1KC8 R;  2KXC A;  2RH2 A;  2DIG A;  1W4S A;  4UC4 A;  1MMN A;  1BBZ A;  2RD1 A;  5I22 A;  3NHN A;  4NS5 A;  4OB3 B;  2HAX A;  2K5F A;  2CKK A;  2Y90 A;  3GP8 A;  3THK A;  2O9V A;  4PJO E;  2JZ2 A;  3HFN A;  2E3H A;  3BDU A;  3LWI A;  2Y4X A;  3NFC A;  3EAE A;  4JJC A;  1TOV A;  1NPP A;  3M0Q A;  4F16 A;  1Y07 A;  5GAM h;  2QDL A;  3HSB A;  1ARK A;  1G83 A;  2HNI A;  4Q5W A;  1LVK A;  4GY5 A;  1W2B P;  3RMQ A;  4C5H A;  4QW2 A;  1HSQ A;  4FSX A;  2K2V A;  1QCN A;  2VAS A;  1MGQ A;  4IUT A;  2A0F B;  1B34 B;  2DJZ A;  5GAM d;  1Q7Y R;  5I21 A;  2B8A A;  2PU9 B;  4OB2 B;  4PJO F;  1O9S A;  4FW2 A;  3HL8 A;  1M8M A;  3MP8 A;  4N4I A;  2YXY A;  2ZPE B;  1I5O B;  2L3R A;  4J9D A;  2DVJ A;  5GAN 7;  3V7S A;  1AVZ C;  2AZV A;  1AWO A;  1ZUK A;  4OP0 A;  2CT4 A;  4IUR A;  2HSE B;  1FWZ A;  1N9R A;  1TS9 A;  3CCQ T;  2MYS A;  4HXJ A;  2BZY A;  3CMA T;  5CVI A;  2MWO A;  4ZGE B;  5LJ3 d;  1VQ6 T;  1RI0 A;  2KY9 A;  3MCA B;  2EYQ A;  3EHR A;  4R0K A;  1Q82 C;  2CS7 A;  4E7J A;  3HTR A;  3C95 A;  1KD1 C;  2CUB A;  3CCQ Q;  3OYK A;  1HK9 A;  2HZY A;  5KCH A;  4J7I A;  2DL4 A;  1RAH B;  3CMA Q;  3G7Z A;  2L89 A;  1EX4 A;  1VQ6 Q;  2E5K A;  1KHC A;  1Y71 A;  4KGX B;  2K3B A;  3H41 A;  4AFQ C;  4PJN A;  2RQU A;  1M2V A;  2HKQ B;  2ZPI B;  5KYY A;  5D6Y A;  1NLO C;  3CCV T;  4LE9 A;  1G3S A;  3LX7 A;  1I1J A;  2H3E B;  2OTJ A;  2MCN A;  1UGQ B;  4RG8 A;  3V8J A;  5CCA A;  4JUV A;  3P8H A;  2O2O A;  3A8L B;  3L2Q A;  1OZ2 A;  3A8O B;  4LNP A;  1FX7 A;  1IGU A;  2RQR A;  3LWH A;  2H3J A;  2EQI A;  3RKX A;  2HKN A;  3OB9 A;  4M77 B;  3QPH A;  1VYV A;  4GLM A;  2DZ9 A;  1MHN A;  4EMK C;  4PJO G;  1ZA1 B;  1ZUY A;  4PJO C;  1TXQ A;  1NZ9 A;  3KXT A;  1YJW A;  2X51 A;  3CC7 T;  4M4Z A;  1ABO A;  3F70 A;  4J5Y A;  3RES A;  1RLQ C;  3JB9 H;  1HD3 A;  4X1V A;  4M7D B;  2KSS A;  4AFU C;  1VUB A;  1N5Z A;  2PNI A;  1KQ1 A;  4JJD A;  5FU6 B;  4HT8 A;  4Z8A A;  2JOY A;  2ZPG B;  1G3W A;  3CC7 Q;  1QP2 A;  4KRT A;  5KYU B;  1X27 A;  3PGG A;  1M90 R;  2QG9 B;  3UF4 A;  3OYA A;  3OYH A;  2JT4 A;  1N6A A;  2QQB A;  1RLP C;  1EZZ B;  3CCJ T;  1NPR A;  3OYJ A;  2RNA A;  1UEB A;  3CCE A;  3CCU A;  2VWF A;  3PVQ A;  1FMK A;  3PT9 A;  2RMO A;  2KRS A;  1WJR A;  1PRM C;  5HY6 A;  4XU2 A;  2LJ0 A;  5GAN h;  2F2V A;  5GJW B;  1MUZ A;  3CBP A;  4FW1 A;  3OYL A;  3CBO A;  2GGR A;  4HVU A;  4FCY A;  1TWB A;  3JCM g;  2YWW A;  3DLM A;  2DRK A;  3EFS A;  2A7Y A;  3I55 A;  1GXI E;  1WDX A;  5GAN d;  3EGD A;  3A5Z B;  3QYG B;  2J7I A;  4MDW A;  5GAN g;  4P5N A;  4PJM A;  3CPW A;  3SD4 A;  2EYX A;  1BU1 A;  2DRM A;  1VQ5 T;  3MHX A;  4PK4 A;  4M7A B;  1YI2 A;  1AZE A;  1U5S A;  3VKI A;  2JN0 A;  4J6X A;  3OYB A;  1ABQ A;  1MMD A;  3I56 A;  5GJV B;  4IUP A;  1QVF P;  2YRD A;  2HL5 C;  3M0P A;  3M58 A;  3G4S Q;  2MI6 A;  3I9Q A;  1VQ5 Q;  3SDZ A;  3LGL A;  2DKG A;  4E7Z A;  1D0Y A;  2LCS A;  1OI1 A;  1NBE B;  1F1B B;  3CD6 A;  4JPB W;  4RUG A;  5FU7 C;  3DB4 A;  3DLL A;  2HCK A;  2YRC A;  4ZN3 A;  1ZSZ A;  5LJ3 e;  3A98 A;  2EGC A;  3PMI A;  4OMO A;  4XTZ A;  2RJF A;  2M1H A;  2C06 A;  2XI9 A;  2X3W D;  3JSC A;  5GAN 4;  1GBR A;  4DEY A;  1Q82 R;  1MMA A;  3UAT A;  5LJ3 f;  2DFU A;  1D3B B;  1KD1 R;  1I5L A;  2VV5 A;  1S72 T;  1VQ7 A;  3NTI A;  3L1A A;  3GNF B;  3V8L A;  1W1F A;  3M0S A;  3VU3 C;  1Y7X A;  2KE9 A;  1NLP C;  4FIB A;  3VS2 A;  5KH6 A;  2QA4 T;  3I35 A;  5KCO A;  1IXD A;  3EGU A;  2GTO A;  4MZP A;  3E9G A;  5L23 A;  1OYX A;  1X69 A;  5FW9 A;  3CCM T;  1XNI A;  1S72 Q;  4O5V A;  3NPF A;  4RTT A;  4TVR A;  4Z89 A;  1D1B A;  1WHJ A;  2LJ3 A;  3BE3 A;  1GFD A;  2I0N A;  1SF9 A;  2QA4 Q;  3WXM B;  4C92 B;  3EGX B;  1QVP A;  2P0K A;  3L2Z A;  4E6R A;  2E41 A;  2JTF A;  2RJE A;  2X4Y A;  4QKU A;  3SWN A;  3LLR A;  2QAS A;  1VA7 A;  3QBY A;  4FSS A;  4ATO A;  3GPL A;  3OYC A;  1WLP B;  4JRK A;  1R0C B;  4DA4 A;  4Y92 A;  1A0N B;  1JJ2 P;  1QVF A;  1PNJ A;  1C6V X;  1G3T A;  4M78 A;  1PG5 B;  2RHI A;  1E6H A;  2R5A A;  1K0S A;  1XTD A;  2V8I A;  1M3A A;  2XU8 A;  1AD5 A;  1JO8 A;  1D09 B;  4E7K A;  1VQN A;  4AG2 C;  4A4K A;  5GAO r;  3HFO A;  2YLB A;  2DD5 A;  1B07 A;  2EIF A;  2A3L A;  2DMO A;  3IQL A;  1M9S A;  3H0I A;  1BKB A;  2DZC A;  2D8H A;  3J81 E;  1D0X A;  4K11 A;  2HQH A;  4A4F A;  3OYM A;  1VOM A;  2LNH B;  2R5M A;  1Y96 A;  4FT2 A;  4JDS A;  1G5V A;  1K9M U;  2E4H A;  1UGR B;  4ESR A;  2HBW A;  2XDD A;  2FL7 A;  1NM7 A;  2MF2 A;  4C0D C;  1QP3 A;  3MJX A;  4PJO B;  4F7U A;  3HP9 A;  3CME A;  1P92 A;  1UHF A;  4RCC A;  1UGS B;  4N4G A;  1Q95 G;  1VQM T;  4WF2 A;  3PVL A;  4OMF B;  3RKW A;  3X20 B;  1MND A;  2ED0 A;  2NUT A;  5FRN A;  1AZG B;  4J9F A;  1WHM A;  1LJO A;  1VQP T;  2M51 A;  6AT1 B;  2O4X A;  1ZSZ C;  4CI0 C;  1YBY A;  3BFM A;  1X6O A;  3H6Z A;  1V76 A;  4BE0 A;  1VQM Q;  4HA8 A;  5HCK A;  2O01 E;  1WFW A;  2COW A;  4RTY A;  2QTX A;  3CXC P;  1YJ9 A;  3PIP A;  3MKD A;  4ZTF A;  1VQP Q;  1NG2 A;  1WQ7 A;  2KQW A;  1JJ2 A;  1B7T A;  2DAQ A;  1AWJ A;  2L8D A;  2EYY A;  4PJL A;  1D1A A;  4M75 A;  1X6G A;  1WJQ A;  1VQO A;  3VUZ A;  2D0N A;  3CC2 T;  1YIT A;  1SRM A;  3ASK A;  1TUC A;  2ESW A;  3QYH B;  2FG0 A;  3RKY A;  2O31 A;  1VQL A;  3EG1 A;  1YCY A;  1JXO A;  2FPE A;  3CC2 Q;  2AKK A;  1N8R U;  1SEM A;  1VQ8 T;  2QEX A;  2K4Y A;  3VS5 A;  1N27 A;  3SWN C;  3X26 B;  3FIF A;  4DBR A;  1PKS A;  2FRY A;  3OYI A;  1M4Z A;  4EMK A;  2ABL A;  3NGP A;  4XTY A;  2FRW A;  3M54 A;  1VQ8 Q;  1QKW A;  4MMK A;  1M3B A;  2YUQ A;  3RDV A;  4NL3 A;  2QTV A;  3REA B;  1VQ9 A;  4M78 C;  1PCX A;  1K8A U;  4ZGD B;  2VKN A;  2J6F A;  3TU4 K;  2GCX A;  4J7F A;  3G71 A;  2JMA A;  2DTO A;  5CQY A;  1YFN A;  3VUB A;  5CKD A;  1BI2 A;  4LDV A;  5GAO q;  4WCI A;  3L42 A;  2COZ A;  4J9I A;  3UA6 A;  3S3O A;  1X43 A;  1YP5 A;  3C12 A;  3OYE A;  2NUP B;  5LL6 S;  2DXC A;  2E5Q A;  4F04 B;  4D8D A;  1OPL A;  1PC0 A;  1WI7 A;  2J6O A;  3VS1 A;  1OZ3 A;  3CXC A;  3L2U A;  1FMW A;  2GFU A;  2AIR B;  3V7R A;  1M30 A;  1MV3 A;  3QUI A;  3CCE Q;  3EFO A;  3KFV A;  1QQJ A;  2XD0 A;  2DO3 A;  1ZBJ A;  1SHG A;  3S3M A;  1G8X A;  3OYY A;  1XQH A;  2QGF B;  2XK0 A;  1FYN A;  4OMQ A;  1QW1 A;  4A54 A;  1UHC A;  3UA7 A;  5LJ3 j;  3JCM P;  1KC8 U;  1AWX A;  1TTH B;  5DLO A;  4KGZ B;  3OYG A;  2HMA A;  1LOJ A;  4EMH A;  2RQT A;  3I55 Q;  1ZHI A;  2E64 A;  1KQS A;  4LXC A;  1SSF A;  2G3R A;  4J9B A;  1V1C A;  3EG2 A;  2MOX A;  5I2S A;  5GAN 5;  3FC3 A;  5L8R E;  4OGE A;  2IG0 A;  3TSW A;  2IPO B;  3G6E A;  3JCM X;  3P8D A;  1VQ4 A;  2JM9 A;  4XTW A;  4F14 A;  3VS0 A;  3I56 Q;  3R6N A;  2F5K A;  2D8J A;  4RTZ A;  2PZ1 A;  1Q7Y U;  2V8K A;  3QZ5 B;  2DPP B;  2LX9 A;  3OS1 A;  3CEY A;  2J05 A;  1OEB A;  2W10 A;  4BY6 B;  2BZX A;  2G6F X;  4N4H A;  3URG A;  5CIU A;  4OMN A;  3RR6 A;  2O88 A;  5GMK e;  1IB8 A;  3ZL7 C;  4M75 C;  4BI3 A;  4QT7 A;  4FYX B;  3X28 B;  3LYI A;  1M5Q 1;  2PVG B;  2ATC B;  2K79 A;  2XG8 D;  3PIO A;  2QGG A;  4QVC A;  5ECA A;  3OS5 A;  4E7I A;  4C8Q A;  3QO3 A;  2M0Y A;  1UG1 A;  2E10 A;  2RQW A;  4BD3 A;  2KRO A;  2JS2 A;  2YLC A;  1FMV A;  1M1G A;  2YUP A;  3H9N A;  4EPC A;  3CCR A;  5J3B A;  4C8Q D;  1U3O A;  4C0D B;  2VVK A;  3BDL A;  2YT6 A;  2W0Z A;  1W2B A;  2QK0 A;  3M56 A;  2XDP A;  3QJ6 A;  2QYZ A;  3D7S B;  3ME9 A;  5IHK A;  4ME7 A;  1M1K R;  3MP1 A;  1JQQ A;  2E3I A;  4OMP A;  5LJ5 e;  1WHK A;  1PKT A;  1OX9 A;  3QDR B;  2F5T X;  2RHX A;  1PRL C;  2EW3 A;  4C8Q E;  4BE1 A;  2AZS A;  4KH1 B;  1B34 A;  2BKD N;  1TU0 B;  3NTK A;  2XIC A;  1WHH A;  4JLI A;  5C0M A;  3J80 E;  2RA2 A;  2KMT A;  3CCL A;  1YHQ A;  1V29 B;  1GCQ A;  3TCJ A;  1WJS A;  4AFS C;  5KYW A;  5LJ5 f;  2CZ0 B;  1DJ7 B;  1Q81 C;  1BCM A;  4HCK A;  4NOY A;  2O9S A;  4C5E A;  2RM4 A;  1TUG B;  2E6N A;  4JLG A;  4LD9 K;  2LQW A;  4PJJ A;  3GLX A;  2HBP A;  2JXB A;  3E2U A;  4CC3 A;  4LN2 A;  2JJ9 A;  2CT3 A;  2DVE A;  4J9G A;  3JCM h;  3OW2 P;  4C8Q F;  4BE2 A;  3L2V A;  3S3N A;  2KGT A;  2OAU A;  1QVG S;  5KYX A;  1UGV A;  1K9M C;  1VQN Q;  4DOV A;  2KRM A;  2LVM A;  4AFZ C;  1H3H A;  2BE9 B;  2CSQ A;  3JCM d;  2DE0 X;  4MZM A;  2R58 A;  2E70 A;  5CO7 A;  1KHI A;  2MIO A;  2C0I A;  2VB6 A;  1JBM A;  4Z88 A;  2FPD A;  2LMJ A;  1LCK A;  4N0A A;  4JRI A;  2F69 A;  5GAM e;  2HEQ A;  5IT9 E;  3FEO A;  3JCM V;  3G4S T;  2DXB A;  2FO0 A;  3VYG A;  1WXU A;  4X9D A;  2QI2 A;  3X25 B;  2CGH A;  4IIO A;  5KYN A;  3CC4 A;  3UDC A;  4E47 A;  4RTX A;  2GQV A;  5FWC A;  4CRI A;  2BIV A;  4E2F B;  3CCS T;  1WZO A;  4EIK A;  1KQ2 A;  5GAM f;  3A8G B;  2P84 A;  5IXF A;  2RF0 A;  4E7S A;  4QQG A;  1E6G A;  2DLP A;  1VQK T;  3QII A;  1QMC A;  2YUN A;  3HRU A;  1W70 A;  4EMG A;  2X3X D;  3CCS Q;  4J9C A;  2K5I A;  3QDF A;  1YJ9 T;  3RMS A;  2KT1 A;  4A53 A;  1T0H A;  2CZ6 B;  2D0Q B;  1EFN A;  2MWP A;  1VQK Q;  4KUD K;  4KUL A;  2V8J A;  4RG2 A;  2EBP A;  4RKU E;  4XTV A;  3SHW A;  5HKC A;  2E65 A;  1SRL A;  3TSZ A;  1RAE B;  2EJG A;  1RAB B;  4M7D A;  2YDL A;  1WPY A;  1YJ9 Q;  2EQK A;  3CCQ A;  4HCZ A;  4C8Q G;  2CP0 A;  3CMA A;  4C8Q C;  3MEA A;  1IRE B;  2R57 A;  1N8R C;  1MV0 B;  1N9S A;  5KYU A;  5J26 A;  4L59 A;  1HXD A;  2EVR A;  3OW2 A;  4CC2 A;  2RHY A;  2DEU A;  1D1C A;  1Q86 U;  2DTH A;  5GAN 2;  2K3X A;  2P0P A;  3GBQ A;  1Q82 U;  3EHQ A;  4V2S A;  4X34 A;  1VIE A;  1OU8 A;  1H3Z A;  3Q1J A;  5C6S A;  1RAF B;  3CCV A;  3TVT A;  5IN1 A;  1K8A C;  2KBT A;  2BZ8 A;  3PFS A;  1Y0M A;  2RQV A;  1OPK A;  3JAM E;  1ZX6 A;  2EPD A;  2WSF E;  1R0B G;  2OTL T;  1NE8 A;  4A4H A;  3MO8 A;  1BYM A;  1TUD A;  1GRI A;  1GCQ C;  1RL2 A;  1XJW B;  4LUD A;  4JS5 A;  3OYD A;  3EH2 A;  2M0O A;  2WAC A;  3S6W A;  3M9Q A;  4QQ6 A;  4M7A A;  3CC7 A;  4E7H A;  2BUD A;  2RPN A;  2MMP A;  3M0R A;  2OTL Q;  2RHU A;  5IHN A;  4M78 D;  1BI1 A;  1Z9Q A;  1Q81 R;  3A8H B;  5A0L A;  2VXF A;  1KK7 A;  1I0C A;  5DY9 A;  2ZGW A;  2XDB A;  1IHW A;  2NLU A;  2KR3 A;  2DX1 A;  2MAM A;  3ER0 A;  3U23 A;  2L5Q A;  2JTM A;  2LQ8 A;  1UJ0 A;  4DQ2 A;  4QQD A;  5IH2 A;  3M4G A;  3H0F A;  3UT1 A;  3CCJ A;  2OJ2 A;  1M3C A;  1K9M R;  1ZUU A;  2C0T A;  2PTK A;  2CP3 A;  4N0A C;  3OS0 A;  5GAN e;  2CUD A;  2DTI A;  1WQW A;  2K5L A;  4M78 E;  2VXE A;  4EMK B;  2K2M A;  1D3B A;  5GMK j;  2AK5 A;  5CQX A;  2CP5 A;  4AG1 C;  2FHD A;  5GAN f;  2HL3 A;  1G2B A;  2L3Q A;  2MPX C;  4J9H A;  2K6D A;  2LC4 A;  1HJD A;  4HCB A;  2F2W A;  2AT1 B;  3RNJ A;  5A2Q E;  3RIR A;  3M55 A;  4M78 F;  3G1J A;  2J6K A;  4M77 C;  1GFC A;  1YJN A;  4FYY B;  1EIF A;  2DYB A;  5CKB A;  1VQ5 A;  4OML A;  3OYF A;  2WSE E;  4JRP A;  1UE9 A;  3MPU B;  1JXM A;  2DIL A;  1LNX A;  3QKJ A;  1PSE A;  4C92 A;  3CQT A;  3EGX A;  1M8V A;  4KUI A;  3JCM b;  1ZSG A;  4CC4 B;  3LW5 E;  4M7D C;  1PHT A;  2CH4 A;  4MDX A;  3QJY A;  4F7U E;  5FU6 C;  3M59 A;  3REB B;  2DL7 A;  4ELZ C;  1K4U S;  3OY9 A;  1BIB A;  1K73 U;  2ZPB B;  4RTU A;  1QWE A;  1UJY A;  1WYX A;  2GQI A;  4KBM B;  2RB6 A;  1T3S A;  1PWT A;  2EQM A;  2OTJ T;  1AWW A;  5LJ5 j;  1IHV A;  2P0Q A;  3QG1 A;  1M27 C;  4IUQ A;  4M75 D;  3CPW S;  3I5R A;  1N8R R;  2DD4 A;  2WSC E;  5D6W A;  5KE3 A;  1RAG B;  4AMC A;  4F7U F;  3SEM A;  1D0Z A;  1NJI U;  3KBG A;  4R56 A;  2DBK A;  2DM1 A;  2Z0W A;  2AHJ B;  2IIM A;  2HQX A;  2OTJ Q;  3RER A;  5CR2 A;  2DXU A;  1S72 A;  4PL6 A;  4ORZ A;  1QCF A;  1YJW T;  4C5I A;  2K3Y A;  1YN8 A;  4Y28 E;  4MML A;  1BK2 A;  2QA4 A;  2GBQ A;  1OUL A;  4M75 E;  3JCM J;  2RI5 A;  1K8A R;  3CCM A;  3TEE A;  2K9G A;  3PMT A;  3FDR A;  1H8K A;  4M78 G;  3JCM Q;  1YJW Q;  3C0C A;  3QWY A;  3PTA A;  4BDZ A;  5FU7 B;  4FL6 A;  4X9C A;  4M7A C;  2L2P A;  8ATC B;  3ZEH A;  3ZBD A;  2RJD A;  2EFI A;  2B86 A;  3VJP A;  2ROT A;  2RN8 A;  2XID A;  1XOV A;  3HKS A;  2MK5 A;  3JB9 D;  4R55 A;  4J8O A;  5GAM j;  2CYZ B;  5HK0 A;  4M75 F;  1X6B A;  3CCE T;  4II1 A;  3CCU T;  3P8B B;  4KT0 E;  1U8R A;  1UUE A;  2KI7 A;  1M2V B;  5KYY B;  2M16 A;  5GAN 3;  5GMK i;  4C8Q B;  4ZN1 A;  1H64 1;  1RAA B;  4C0G A;  3MEW A;  2V1R A;  3FRN A;  2SRC A;  4J6W A;  4C0F A;  3CCU Q;  1WGS A;  4MZT A;  5GAO p;  3I55 T;  1IRX A;  1OX8 A;  2LNV A;  4FT4 A;  5CKF A;  3QHS A;  3M4Y A;  2ZPF B;  5CK9 A;  2KDS A;  4J9E A;  2X4J A;  3JB9 I;  2FZK B;  4F7U G;  2X9H A;  2DEQ A;  2EYZ A;  2K7A A;  1LPL A;  1IGQ A;  1R77 A;  2ENM A;  1YI2 T;  3PNW C;  4LDW A;  3CC4 T;  2LP5 A;  2XHC A;  3I56 T;  4O6J A;  3JRZ A;  4A63 B;  2LX7 A;  4PFP A;  5A0G A;  4E7L A;  4OB1 B;  3VV0 A;  2DL5 A;  3JB9 F;  5CKH A;  2LT4 A;  4FYW B;  1K9A A;  1SHF A;  1RAD B;  3A8M B;  2DL8 A;  1C0M A;  2KAF A;  1YI2 Q;  2VGM A;  2JW4 A;  1GCP A;  5FRO A;  1QVF S;  5GAM g;  3CC4 Q;  3LH5 A;  3CD6 T;  3EG9 A;  4XTX A;  3L2R A;  4PFZ A;  4C92 G;  1NEB A;  4JS4 A;  2LTO A;  2PVO B;  5KYW B;  3AT1 B;  4C92 C;  4ZGJ B;  3FB9 A;  2RK1 A;  4HCC A;  2KRN A;  1IZ6 A;  1I07 A;  1RAI B;  3QWX X;  2GTJ A;  1VQM A;  2A28 A;  3CD6 Q;  5LJ3 h;  4ELY C;  2X35 A;  4M75 G;  1GBQ A;  4D8K A;  5KYX B;  2VUB A;  4EDU A;  3EG0 A;  2RI2 A;  1VQP A;  1RAC B;  4HVV A;  2ZPH B;  3VS6 A;  3GF5 A;  2FPF A;  2OAW A;  1Q86 C;  1VQ7 T;  4HKE A;  4PFO A;  3OYN A;  2EWN A;  4XQ3 A;  5LJ3 g;  1SSH A;  4B6M A;  3NMZ C;  1SG5 A;  3EGD B;  1BI0 A;  2PVD B;  3OBW A;  1JB0 E;  2FZG B;  2YHT A;  1G3Y A;  1OU9 A;  4L6V 5;  2ECZ A;  2VYT A;  1VQ7 Q;  2NUP A;  9ATC B;  4BAC A;  4DEX A;  2EJ9 A;  2QAZ A;  2DF6 A;  4DBH A;  3EH1 A;  2K57 A;  2QQS A;  1ZQ1 A;  3CPW P;  2A37 A;  3L2W A;  3LGF A;  3CC2 A;  3JCM W;  4L5G A;  3HRS A;  1WX6 A;  1KG1 A;  2LQK A;  2F2X A;  1U1T A;  1I81 A;  3QZ9 B;  3A1P A;  1X75 C;  1O75 A;  5FWB A;  2V26 A;  4RMO A;  2LQN A;  3JB9 G;  1JRI A;  1CKA A;  3CCV Q;  3OMC A;  2LDM A;  4JRQ A;  1X2K A;  1YIJ A;  1ZSZ B;  4B9X A;  1VQ8 A;  3INZ A;  1WNL A;  1K76 A;  4XAX B;  4LUE A;  3VS3 A;  1BIA A;  2NWM A;  1Y57 A;  1KIK A;  4OB0 B;  5GAN j;  2RO0 A;  3JCM c;  2KYB A;  2QXF A;  5M9O A;  1JJ2 S;  2CP2 A;  4OGC A;  2D9T A;  5AT1 B;  1VQN T;  1M1K U;  2KYM A;  1PM3 A;  1M2O A;  4LDU A;  4LD6 A;  4IUU A;  3SB2 A;  1B3Q A;  3WVE B;  2VC8 A;  5FRM A;  1X2Q A;  3AHU A;  2RI3 A;  2KK4 A;  4F17 A;  2V1Q A;  3OSS C;  1YCS B;  1W6X A;  5CAI A;  1UGP B;  5IXB A;  1WA7 A;  1YWO A;  5GAO m;  1ACM B;  2I2L A;  2LCL A;  1M90 U;  4GBQ A;  3MEV A;  2BE7 D;  1NYF A;  2XKO C;  4KH0 B;  2DXT A;  3C94 A;  4RTV A;  3M5A A;  2XMF A;  4AT1 B;  4DOW A;  5D7U A;  3HPW A;  3CCJ Q;  3SWN B;  3CME T;  2DYI A;  3VS7 A;  1FXX A;  4JJN K;  1TG0 A;  3OMG A;  2DER A;  2DBM A;  2EJF A;  3JV3 A;  2L3P A;  1QWF A;  3VS4 A;  2YUO A;  1OOT A;  4OVA A;  5A0D A;  1YJN T;  1UEC A;  4OF1 A;  3CME Q;  2FYK A;  2EAY A;  5EG2 A;  4JZ4 A;  4M78 B;  3O5Z A;  2QQA A;  3MEU A;  4JZ3 A;  4M77 A;  1BCO A;  5GAN 6;  2PUK B;  5AYF A;  1K73 C;  1YJN Q;  2H8H A;  1U06 A;  2KVQ G;  3V7C A;  4M77 D;  1MMG A;  1T0J A;  3M0U A;  3CXC S;  4J6Y A;  2JMC A;  3BW1 A;  1VQO T;  3CBM A;  4XK8 E;  1YIT T;  1WIE A;  1NJI C;  4PLL A;  3LH0 A;  2HDA A;  1Q86 R;  1UTI A;  2HD0 A;  4M7D D;  3DB3 A;  1ZLM A;  4BI4 A;  1VQ6 A;  1OQK A;  1Y96 B;  1U1S A;  4XU1 A;  1H92 A;  1VQL T;  7AT1 B;  4XTU A;  1VQO Q;  4M77 E;  3T9N A;  2EGE A;  4Y91 A;  2RK2 A;  3SFM A;  1YIT Q;  2PQW A;  2GFA A;  2QEX T;  3FLG A;  1NYG A;  2GNC A;  4F7U B;  5FLX E;  4D6W A;  1KQS S;  3ULR B;  4C0Z A;  4FYV B;  4WTO B;  1BI3 A;  4RCB A;  1C1A A;  1KD1 U;  1QLY A;  1VQL Q;  5GAO l;  1AHJ B;  2NYS A;  1VIF A;  5I11 A;  2LT1 A;  4M7D E;  2NUT B;  2ZAE A;  3OBY A;  2L0A A;  3ZFJ A;  3OA6 A;  2QEX Q;  4DBQ A;  2A36 A;  5GAO n;  3GNG A;  1I4K 1;  2EGA A;  2O4X B;  4IIM A;  2NUZ A;  4M77 F;  3GIB A;  1R8O B;  3M0T A;  3UPU A;  1VQ9 T;  2JS0 A;  5GAN 8;  1PD0 A;  2DK3 A;  3G71 T;  4ZNX A;  2JTE A;  4QVZ A;  3KUF A;  3JB9 J;  2IVW A;  3CCM Q;  4ANJ A;  1VYT A;  5D6X A;  5DM7 R;  4M7D F;  2GF7 A;  1VQ9 Q;  2HSP A;  2YRV A;  4XU0 A;  3MP6 A;  3RUX A;  4IUV A;  3G71 Q;  2AKL A;  1PD1 A;  3H0H A;  4M75 B;  2KT8 A;  3OQ5 A;  4M7A D;  2L3S A;  4HT9 A;  4XU3 A;  2J06 A;  2E1H A;  1AT1 B;  2PUO B;  4BY6 C;  2DJQ A;  1KC8 C;  4A4G A; 
#chains in the Genus database with same CATH homology
 4JJB A;  2EYW A;  3FJ5 A;  1WXB A;  1AZE A;  1U5S A;  1ABQ A;  2BTT A;  2CDT A;  2K79 A;  5GJV B;  2K9G A;  1CSK A;  1H8K A;  3C0C A;  1E7O A;  3QWY A;  5ECA A;  3M0P A;  2L2P A;  2B86 A;  3I9Q A;  2M0Y A;  1UFF A;  2ROT A;  2RN8 A;  1UG1 A;  2LCS A;  1XOV A;  2RQW A;  2KEA A;  2KRO A;  2JS2 A;  1KSW A;  4JPB W;  4RUG A;  2YUP A;  2HCK A;  1U3O A;  1X6B A;  3A98 A;  2EGC A;  4OMO A;  2LJ1 A;  2VVK A;  1UUE A;  2YT6 A;  2W0Z A;  2X3W D;  1IO6 A;  2DNU A;  5IHK A;  1QKX A;  1GBR A;  4DEY A;  2V1R A;  3UAT A;  2ED1 A;  2SRC A;  1JQQ A;  1BB9 A;  4OMP A;  2D1X A;  1KJW A;  1PKT A;  2SEM A;  2KNB B;  2ROL A;  1PRL C;  2EW3 A;  2AZS A;  2CH4 W;  1W1F A;  3M0S A;  1S1N A;  4J9E A;  1T3L A;  2KE9 A;  1AEY A;  3PE0 A;  1NLP C;  3VS2 A;  1RI9 A;  3I35 A;  3I5S A;  2EYZ A;  3EGU A;  2K7A A;  2GTO A;  2ENM A;  1J3T A;  5L23 A;  1GCQ A;  1X69 A;  5FW9 A;  1KFZ A;  2LP5 A;  4AFS C;  2P4R A;  2CSI A;  2FEI A;  3NPF A;  2YSQ A;  4HCK A;  4RTT A;  2O9S A;  4Z89 A;  4A63 B;  2LJ3 A;  2LX7 A;  2DL5 A;  2LQW A;  1GFD A;  1Z9Z A;  1GL5 A;  2I0N A;  2JXB A;  4CC3 A;  1K9A A;  1SHF A;  2CT3 A;  4LN2 A;  4J9G A;  2DL8 A;  1WXT A;  1AOJ A;  4E6R A;  2JW4 A;  1GCP A;  2KGT A;  3EG3 A;  3LH5 A;  1CKB A;  1UGV A;  1VA7 A;  4FSS A;  2KRM A;  4OMM A;  1JEG A;  1NEB A;  4AFZ C;  1H3H A;  2CSQ A;  2KRN A;  2DE0 X;  1WLP B;  1I07 A;  2MIO A;  3QWX X;  4Y92 A;  2GTJ A;  2C0I A;  1A0N B;  2A08 A;  2A28 A;  4Z88 A;  2FPD A;  4HVW A;  1RUW A;  1PNJ A;  2DA9 A;  2LMJ A;  5IHI A;  1LCK A;  1JU5 C;  2CRE A;  2HEQ A;  1GBQ A;  1E6H A;  1K0S A;  2FO0 A;  2KXD A;  3VRY A;  4D8K A;  1WXU A;  1M3A A;  1VYU A;  3EG0 A;  4HVV A;  3VRZ A;  3VS6 A;  1AD5 A;  1JO8 A;  2JM8 A;  2FPF A;  2OAW A;  4IIO A;  4RTX A;  5FWC A;  1SPK A;  4AG2 C;  1SSH A;  1NEG A;  3NMZ C;  4EIK A;  2C0O A;  4CC7 A;  5IXF A;  2RF0 A;  1B07 A;  2DMO A;  1E6G A;  2DLP A;  3IQL A;  1YNZ A;  2YUN A;  2DL3 A;  1YWP A;  2ECZ A;  3H0I A;  1W70 A;  2X3X D;  2D8H A;  4DEX A;  2DF6 A;  4K11 A;  4J9C A;  2A37 A;  2OI3 A;  5EC7 A;  2LNH B;  2KT1 A;  1T0H A;  1EFN A;  1UDL A;  1WX6 A;  2LZ6 B;  1K1Z A;  2EKH A;  2F2X A;  2EBP A;  4ESR A;  3SHW A;  2HBW A;  1K0X A;  1SRL A;  3TSZ A;  1OV3 A;  1NM7 A;  5FWB A;  4RTW A;  3RBB B;  2LQN A;  1CKA A;  2YDL A;  1UHF A;  2KXC A;  1X2K A;  1BBZ A;  5I22 A;  3NHN A;  3PVL A;  1K76 A;  4LUE A;  1MV0 B;  3VS3 A;  2NWM A;  3THK A;  1Y57 A;  1KIK A;  2O9V A;  2EVR A;  2ED0 A;  1AZG B;  4J9F A;  4CC2 A;  2M51 A;  2KYB A;  4JJC A;  3M0Q A;  4F16 A;  2QDL A;  5HCK A;  1ARK A;  1G83 A;  2KYM A;  3GBQ A;  1WFW A;  3EHQ A;  4RTY A;  1B3Q A;  1HSQ A;  1X2Q A;  4F17 A;  2V1Q A;  3TVT A;  1NG2 A;  1YCS B;  1W6X A;  1AWJ A;  2KBT A;  5IXB A;  1WA7 A;  1YWO A;  2EYY A;  2BZ8 A;  1Y0M A;  2RQV A;  1OPK A;  1M8M A;  1X6G A;  4GBQ A;  1NYF A;  1ZX6 A;  2D0N A;  2EPD A;  4J9D A;  2DVJ A;  4RTV A;  1SRM A;  1TUC A;  2ESW A;  2XMF A;  1AVZ C;  1GRI A;  1TUD A;  2FG0 A;  2AZV A;  1GCQ C;  1AWO A;  1ZUK A;  4LUD A;  2O31 A;  2CT4 A;  3EG1 A;  2RPN A;  1JXO A;  3VS7 A;  3M0R A;  2FPE A;  2AKK A;  5IHN A;  1TG0 A;  2BZY A;  4HXJ A;  1SEM A;  1Z9Q A;  3VS5 A;  2DBM A;  3JV3 A;  2L3P A;  1I0C A;  1QWF A;  3VS4 A;  2YUO A;  1PKS A;  3EHR A;  4R0K A;  1OOT A;  2FRY A;  1UEC A;  2KR3 A;  2DX1 A;  2ABL A;  2CUB A;  3NGP A;  4JZ4 A;  3O5Z A;  3U23 A;  2FRW A;  2DL4 A;  1QKW A;  1UJ0 A;  5IH2 A;  4JZ3 A;  3H0F A;  2E5K A;  2OJ2 A;  1M3C A;  1M3B A;  1ZUU A;  2YUQ A;  2K3B A;  2C0T A;  3H41 A;  2PTK A;  2RQU A;  3REA B;  4AFQ C;  2CUD A;  1NLO C;  2H8H A;  1U06 A;  2VKN A;  2J6F A;  4LE9 A;  1I1J A;  2JMA A;  2MCN A;  1T0J A;  3M0U A;  4WCI A;  2O2O A;  2K2M A;  2JMC A;  2AK5 A;  4J9I A;  4LNP A;  3UA6 A;  4AG1 C;  2RQR A;  1X43 A;  1YP5 A;  2EQI A;  1WIE A;  1VYV A;  1G2B A;  2L3Q A;  4GLM A;  2K6D A;  4J9H A;  1HJD A;  4D8D A;  2F2W A;  2HDA A;  1UTI A;  1ZUY A;  1OPL A;  3RNJ A;  1ZLM A;  1WI7 A;  2J6O A;  3VS1 A;  1H92 A;  2J6K A;  1GFC A;  4M4Z A;  1M30 A;  1MV3 A;  1ABO A;  2EGE A;  2DYB A;  1RLQ C;  3KFV A;  1HD3 A;  4OML A;  1NYG A;  2GNC A;  4X1V A;  4AFU C;  1N5Z A;  1ZBJ A;  3ULR B;  1SHG A;  2PNI A;  4JJD A;  1UE9 A;  1JXM A;  2DIL A;  4Z8A A;  1FYN A;  4OMQ A;  3CQT A;  1QLY A;  1UHC A;  3UA7 A;  1ZSG A;  4CC4 B;  1AWX A;  4KRT A;  5I11 A;  1PHT A;  2CH4 A;  1X27 A;  3UF4 A;  2JT4 A;  2RQT A;  2L0A A;  3REB B;  2DL7 A;  2A36 A;  1K4U S;  1RLP C;  2EGA A;  4IIM A;  2NUZ A;  4J9B A;  1V1C A;  4RTU A;  2RNA A;  1QWE A;  2MOX A;  1UJY A;  3EG2 A;  3M0T A;  1WYX A;  2GQI A;  2JS0 A;  1T3S A;  1PWT A;  3TSW A;  2VWF A;  3PVQ A;  4ZNX A;  1FMK A;  1AWW A;  2JTE A;  2RMO A;  2KRS A;  1M27 C;  1PRM C;  2JM9 A;  2LJ0 A;  4F14 A;  3I5R A;  3VS0 A;  2F2V A;  5GJW B;  1MUZ A;  1VYT A;  3R6N A;  2D8J A;  4RTZ A;  3SEM A;  2HSP A;  2PZ1 A;  2DBK A;  2GGR A;  2DM1 A;  4HVU A;  2J05 A;  1OEB A;  2IIM A;  2AKL A;  2DRK A;  2W10 A;  3H0H A;  2KT8 A;  2BZX A;  2G6F X;  1WDX A;  4OMN A;  2L3S A;  2J7I A;  4ORZ A;  1QCF A;  1YN8 A;  2O88 A;  2J06 A;  2EYX A;  1BU1 A;  3ZL7 C;  2DRM A;  1BK2 A;  2DJQ A;  4QT7 A;  2GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...