4FL6A

Crystal structure of the complex of the 3-mbt repeat domain of l3mbtl3 and unc1215
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
314
structure length
309
Chain Sequence
AWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title Discovery of a chemical probe for the L3MBTL3 methyllysine reader domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 75
structure length 309
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A01
2MWPA 5KCOA 4BE2A 3OYMA 3S6WA 2L89A 4QQ6A 2LCCA 5D6XA 2BIVA 1WJQA 4B9WA 4QVZA 2F5KA 2WACA 2R58A 2XK0A 3S3OA 2JTFA 3OYAA 2EQUA 2B8AA 2RI2A 2RHIA 3MO8A 2L3RA 3MP1A 2BUDA 2M16A 2DIGA 3OY9A 2MWOA 4FL6A 5D6YA 5KE3A 3OYGA 2QQSA 3L2RA 4C5GA 5FRNA 3O8VA 2RO0A 4IUTA 2X4XA 3ME9A 2O4XA 3LGLA 5KE2A 1OI1A 3NTKA 2HQXA 2GFUA 3NTIA 4E7KA 3L2UA 1N27A 2QQRA 4IUVA 4QW2A 4A4HA 4HCZA 2BKDN 3L2VA 4E7JA 2RJCA 1OZ3A 4N4GA 4C5EA 4PLIA 4BDZA 3OYNA 2RJFA 4Q5WA 1WGSA 2D9TA 2RI5A 5KCHA 2RJEA 4GY5A 3DLMA 3OB9A 1G5VA 3DB4A 2RHZA 3SD4A 3OYJA 3MEWA 3QJ6A 3MP6A 3P8HA 3DB3A 4C5HA 5M9OA 2XDPA 3F70A 4N4IA 4IUQA 3OS1A 4NS5A 3NTHA 3L2QA 4E7HA 5J26A 2LTOA 3LX7A 2M0OA 4A4EA 4C5IA 3OYCA 3LGFA 3META 3FC3A 2X35A 1KHCA 3OS2A 1RI0A 2PQWA 4BE1A 4BE0A 2R5MA 5KH6A 3H8ZA 3ASKA 3OYHA 3PNWC 4E7IA 3FEOA 2LVMA 2M1HA 1H3ZA 2GFAA 4II1A 5CIUA 3C4SA 3OYKA 3PMIA 4IURA 2VYTA 2RHYA 4PLLA 5IN1A 2RHUA 3LH0A 2JZ2A 4PL6A 4E7LA 4QQGA 4IUPA 3BDLA 4BACA 2FHDA 3OYLA 5D6WA 2P0KA 5C0MA 3KUFA 3L2WA 2O4XB 4UC4A 4CRIA 3S3NA 2RI3A 4QQDA 4LD6A 3OYEA 3OYFA 3P8DA 2DIQA 3CEYA 2GF7A 3QBYA 3OYBA 4ZTFA 4ZTJA 2CKKA 2E6NA 2R5AA 2YRVA 1OZ2A 2EQJA 1OYXA 1XNIA 2G3RA 2NLUA 3UT1A 3MEAA 4B9XA 5J39A 3OS0A 3UWNA 4N4HA 3S3MA 3E9FA 2EKOA 3L42A 2E5QA 3H6ZA 4IKFA 3Q1JA 5FROA 2L8DA 2IG0A 3PFSA 1MHNA 4OVAA 4Z02A 4L59A 3OYIA 4BD3A 3LLRA 3OQ5A 2HQEA 2K3XA 5FRMA 4X34A 4RG2A 4A4GA 2X4YA 3OMGA 3MEVA 3QIIA 4A4FA 3OMCA 2R57A 3FLGA 3M9QA 5IAYA 3FDRA 2DAQA 1WJSA 2K3YA 3MP8A 4EDUA 2EFIA 3E9GA 4IUUA 3ZEHA 2LDMA 4FU6A 2LRQA 2RHXA 5C6SA 3LYIA 1SSFA 3OA6A 4BDYA 2RJDA 3OYDA 3PMTA 2X4WA 2EQKA 3EAEA 1WJRA 2EQMA 3GOXA 3QKJA 3MEUA
chains in the Genus database with same CATH superfamily
4M77A 2EKHA 3OBYA 2NUPB 1X2KA 2IIMA 1YN8A 2LQ8A 2O2OA 4M78G 3JCMQ 1S1NA 1GBQA 3MO8A 3MP1A 1ABQA 1EIFA 3PIOA 3R6NA 5GAMj 1PNJA 4EMGA 5HKCA 1T3SA 4F7UF 1UGPB 1Q81C 1D0YA 2CT3A 1LPLA 2OI3A 1N27A 3X24B 1JXMA 3NHNA 1Q82R 1TOVA 3OSVA 4X1VA 2FO0A 2XDBA 2ED1A 1MV0B 3FRNA 3I35A 2DYBA 2CREA 4ELZC 2LTOA 1TTHB 2M0OA 4A4EA 2ZCFB 3SWNC 4BE0A 2R5MA 1IREB 4II1A 1X2QA 1KIKA 3JB9I 5L8RE 2VYTA 3CQTA 4PLLA 5IN1A 2JZ2A 2KRMA 3CPWS 1BKBA 3X26B 5D6WA 1NZ9A 3I56Q 4C92D 4M77F 4PFPA 1VQNT 3OYEA 3CBPA 4CC2A 2ROLA 2HKQB 4X9DA 4OMQA 5GANd 4ELYC 1I8FA 1VQPT 3QDRB 1R77A 1ZA1B 1VQ8Q 1K9MC 2MMPA 1RL2A 4LE9A 4FW2A 2R57A 1M1KU 3R6OA 1Q81U 1Z9QA 4D8DA 4JJDA 2JTMA 5I22A 1UGSB 3HRSA 2RJDA 5I21A 5LJ3g 1R0CB 2E1HA 4KGZB 3G6EA 2VGNA 2D6FA 2RN8A 2RK2A 1E6HA 1X6BA 1VQ6A 3DLLA 1PM3A 2B8AA 2RI2A 2ESWA 1ZSZB 1C6VX 3VRYA 3CPWP 2Y4YA 1V76A 2DTHA 5FWBA 4RG8A 3EFOA 4JRPA 2I0NA 4A4HA 2DE0X 3GNFB 4LDYA 3WVEB 2RI5A 1ZX6A 4M78C 2XI9A 3ZBDA 2XG8D 1KD1U 1B34A 2YT6A 3NTHA 2VWFA 2M51A 4C0DB 3AHUA 2HZYA 1FX7A 3L1AA 1OPLA 5KH6A 5GAMh 2EYZA 5LJ3h 2AK5A 3G71A 2MAMA 1RI9A 2QQAA 4RCCA 4OMMA 2AKLA 3JAME 4IUPA 1M2VA 4XTXA 4LUDA 2OTLQ 4KUIA 4UC4A 1AWJA 3P8DA 3OYBA 2DXCA 1WNLA 3UF4A 3GLXA 3OS0A 3M55A 1UTIA 1WHKA 2ZGWA 2DJQA 3RNJA 1MV3A 2K3XA 1MUZA 2HD0A 2KE9A 4XTWA 1WJSA 2EJFA 2K3YA 3E2UA 3E9GA 4C8QD 1Z9ZA 5CKBA 1VQLA 2CP0A 2PU9B 2M02A 3REAB 3EAEA 2V26A 3MEUA 2NUTB 4QQ6A 8AT1B 4B9WA 2A28A 5KYXB 1QP3A 4F04B 4ZN3A 3CD6Q 1YHQT 1KSWA 4M7AD 3CCJA 4C8QG 2QQSA 3EH1A 5FU7C 4XTYA 1Y0MA 3EGXB 1NE8A 3M0UA 1U5SA 2RA2A 1K9AA 4RTXA 2I2LA 3OYNA 4WCIA 1K9MR 5GMKj 1I07A 2DK3A 1RAFB 3SD4A 3MEWA 3G71T 3BDUA 2D0NA 2O31A 2P0PA 4NL3A 2J7IA 5FU6B 1VQKA 2KXCA 4J7FA 1T0JA 5CKEA 5J26A 3A5ZB 2RQWA 1UGVA 4JJNK 1OEBA 1X75C 1V1CA 4DBHA 3E19A 1WHHA 4C0GA 4WTOB 2JUFA 1QW1A 3EG2A 4LD9K 2FPFA 2JT4A 3L2ZA 2FRWA 2P0KA 4PFZA 3S3NA 3G4SA 3EGUA 2CP3A 2ED0A 2GNCA 5GAOp 2EQJA 1KQSS 2B86A 3E9FA 1VQLT 2RH2A 3O5ZA 3I5SA 3I55Q 3MHXA 2O9SA 1M90U 2K5IA 2E3IA 1G8XA 1VQNQ 2EGAA 5C6SA 2J05A 5LJ5e 2EIFA 3CCJT 4JZ4A 3FJPA 1WJRA 4RTVA 2OAUA 1VQPQ 2L89A 1W4SA 1YFNA 1VA7A 1TSFA 5D6XA 4C92B 2F2VA 2RHIA 2KRSA 3MPUB 3JV3A 1YJWA 3G7ZA 5GMKl 4BUGA 2D1XA 1KHIA 4XTVA 2SEMA 5FRNA 3O8VA 1VQ5A 1P92A 3EG9B 1N5ZA 1I81A 1AZGB 3NTKA 5KYUB 2CP6A 1H641 2ZPBB 1VQKT 1G2BA 2LZ6B 4FCYA 2DX1A 1D3BA 5IHIA 5GMKm 3H0HA 3M58A 1OX8A 2D8JA 4AG1C 1KQSP 3RKWA 3CCMA 1GFDA 2V8IA 1RADB 3MP6A 3P8HA 3ZL7C 1BCMA 4OB0B 2FPDA 2L0AA 2KQWA 3JRZA 3OYCA 4PJOA 1RAAB 2EWNA 2K57A 1FXXA 2PZ1A 4M75A 2DTIA 1KC8U 2LMJA 3G1JA 5GJWB 3H8ZA 1G83A 4LNPA 4M77B 3G4ST 2J06A 3FJ5A 4QT7A 1K73C 1QCFA 2Y4XA 2K4YA 1OU9A 1WXTA 3JCMe 1TS9A 3OS5A 3VS5A 4EIKA 3UA6A 1JJ2P 4ZGJB 2LJ3A 4M4ZA 2DVJA 1PD0A 2EYWA 1PKTA 2K6DA 4OMLA 1I4K1 3GP8A 4XTZA 4KRTA 5GAN8 3CC2A 2K5LA 2QDLA 1XTDA 2L8DA 4J83A 1MMNA 4XAXB 1VQ9T 1DJ7B 1LCKA 2YUOA 4P5NA 4FU6A 1YJWT 1SSFA 2CZ7B 1QWEA 3RUXA 4J9DA 5DLOA 1MGQA 1VQ5T 1VYVA 3S6WA 2YXYA 1EX4A 3QZ9B 4HT9A 2LP5A 1WHGA 2RPNA 1Q95G 3G6EQ 2DIGA 2MWOA 5LJ3d 5KE3A 1QWFA 3CCMT 4WF2A 3HFNA 2D0QB 2LCSA 5IH2A 1H8KA 1SKUB 2YHTA 1VQ6Q 2GFUA 4M78E 1IO6A 1VIFA 1QVPA 3P8BB 1N8RU 2BKDN 2RJCA 4C0ZA 4R0KA 2F69A 4NL2A 1G5VA 5A2QE 2RHZA 5FLXE 3CCEA 2QI2A 1G3WA 4IUQA 2E65A 3LX7A 1QVGS 4C5IA 1PKSA 3SEMA 3HPWA 5GAMe 2DJZA 1D09B 4M7AB 1QVFS 2RD1A 5I11A 4PJOD 1GL5A 4M75D 3X20B 3RIRA 4HT8A 2DD5A 3GIBA 3CC2T 3G71Q 3OYLA 1C0MA 1VYUA 2LQKA 3V7RA 1AVZC 2RI3A 4QQDA 3EFRA 1Q86U 2FG0A 4JS5A 3EFOB 2P84A 1R0BG 1X6OA 1IGUA 1NPRA 4F17A 5LJ5g 2YRVA 2CUDA 2G3RA 5FWCA 2HEQA 1TU0B 4N4HA 4F7UA 2OJ2A 3Q1JA 2VV5A 2E41A 2QA4Q 4E6RA 2DERA 4X9CA 3X28B 4M78F 1B34B 1X6GA 3MEVA 3QSUA 3C94A 2YRCA 3MCAB 2C0OA 2ZPEB 2XHCA 2KYMA 1PHTA 3CXCA 2L2PA 2K79A 1QVGP 4K11A 3M0RA 1R8OB 4QVDA 1K73R 4EMKA 2KI7A 1VQLQ 5D7UA 1QVFP 1JXOA 2O01E 1M2VB 4AT1B 2EQUA 3I9QA 2L3RA 4CC7A 1VQMA 1M3CA 1M9SA 2DZCA 1I0CA 1ACMB 1UEBA 1SF9A 4FSSA 3SB2A 4IIOA 4RTUA 3CCET 2RB6A 5KYWA 1AT1B 2GQVA 5LJ5h 1T0HA 1M30A 4BDZA 4C5EA 2A7YA 3IQLA 3CCLA 1NEBA 3INZA 4DOWA 2O88A 3JCMg 2X51A 3PVLA 2EGCA 1UHCA 4N4IA 2QQBA 1RAHB 1E7OA 2GQIA 1M1KC 1ZSZC 2KGTA 2F1LA 2KSSA 3ASKA 2DILA 3OYHA 1J3TA 1VQKQ 2ROTA 4MZMA 5KYYA 2BE9B 1FYNA 3PMIA 2RHYA 3LWIA 4PL6A 1GCPA 4M7DE 2RM4A 2LX7A 2DM1A 4M7DA 2E5KA 1X27A 5GAN4 1OU8A 4J9FA 3BFMA 4RTZA 5C0MA 3M0QA 4JRQA 4ZTFA 1VQ7A 3TU4K 1XNIA 1HSQA 4C0DC 3S3MA 1U3OA 1PD1A 2W10A 3CC4A 1SHFA 3PTAA 3J81E 1X01A 4HA8A 3JCMh 4JDSA 4X34A 4BI8B 4FW1A 1KD1C 3JB9F 1HXDA 1ZA2B 3FDRA 1W2BA 1LJOA 1VQMT 3GNGA 5J3BA 4MZTA 2RHXA 2DZ9A 3OYDA 1B07A 2FVUA 2PUKB 3VKIA 4FYWB 1UECA 4KGVB 2LQWA 4O5VA 4QVZA 1WQ7A 5A0LA 4A63B 3H0IA 2JTFA 1EZZB 2FZKB 4C92G 2EBPA 2XICA 3CCLT 3UPUA 1WLPB 3ME9A 4J9CA 1YJWQ 2WSEE 4E7KA 1PCXA 3A1PA 4IUVA 1CKAA 1C1AA 5GAMg 5GANf 4M7DF 2J6KA 1TUCA 4FYXB 3FIFA 2E10A 1ZQ1A 3RKYA 2V1RA 2FPEA 3SHWA 2F2XA 5M9OA 4M77D 2K3BA 4E7HA 2ATCB 4MMLA 3META 3QJYA 2X35A 2K5FA 2DBKA 1IB8A 3NPFA 4E7IA 2JMAA 2RQRA 3VV0A 1GCQA 1WDXA 1YHQA 1VQ7T 2CZ0B 4M77G 5CO7A 3M54A 3RERA 1Y07A 3C0CA 3CC4T 4N0AC 2EGEA 2FZCB 3V7SA 5CR2A 1QP2A 5GMKe 3ULRB 3EHQA 2DD4A 3OYFA 2CYZB 2LJ1A 5FU6C 4PJNA 2E6NA 1ZSGA 1D3BB 1KFZA 1GXIE 3UWNA 2EKOA 2E12A 1Y7XA 4ATOA 2CT4A 1YWOA 2DBMA 4BD3A 4ZNXA 2CZ1B 3CCSA 5DM7R 5FRMA 3CC2Q 1OULA 1B3QA 3QIIA 4A4FA 2DL5A 1Q81R 1M1KR 3FLGA 1K1ZA 3EG0A 4PJOB 2EFIA 3AT1B 2XD0A 4M75B 3OA6A 2HAXA 2CS7A 3SFMA 1S72A 2A08A 1WJQA 2DA9A 2HKNA 1WHLA 4XU2A 1HK9A 1ARKA 5GAOq 2GGRA 2JOYA 2RO0A 2ENMA 2DEUA 3TVTA 1UUEA 1PC0A 2DXBA 1ZBXA 2HQXA 2YSQA 2RF0A 2K9GA 2DL4A 2KT8A 2QXFA 5GJVB 3L2VA 2KEAA 2X4JA 4TVRA 1O9SA 2RJEA 3DLMA 3OB9A 3VU3C 2C06A 4BI4A 4OMPA 4C5HA 1KD1R 1M90C 4PJLA 2XDPA 4C92C 3OS1A 3REBB 3JCMJ 4V2SA 2ABLA 2L5QA 2XU8A 2J6OA 3FC3A 2KYBA 3CCEQ 2PQWA 4BE1A 4KGXB 5GANj 1NG2A 1VOMA 4ZGEB 3JCMP 3OW2S 1H3ZA 1NLOC 2AZVA 4E7LA 1K4US 2YUPA 4MDWA 4M7AG 1PSFA 1JBMA 3KFVA 2QGGA 1BIAA 1U1SA 1M4ZA 3CCST 4MZPA 1TUDA 3QBYA 1A0NB 2LNHB 2JM8A 4HVUA 1SPKA 3HFOA 4DBRA 4IIMA 3C12A 4M77C 2E4HA 4HVWA 3M0PA 1JQQA 2HQEA 5GAN6 5GAOr 1S72T 5LJ5d 1FMVA 8ATCB 1K0SA 3M9QA 5IAYA 3M57A 1X43A 2ZAEA 1PRLC 4OMFB 1KC8C 1SRLA 5HCKA 2JXBA 3OBWA 3TCJA 4AMCA 4D8KA 1AWWA 3OW2P 1OV3A 2HSPA 1I5OB 1M27C 2M16A 4ME7A 1H3HA 3OY9A 2VGMA 3WVDB 4IUTA 4J9IA 2X4XA 3BW1A 1VQMQ 3QO3A 3VJPA 4JJCA 3CCRA 1KJWA 4F7UB 2H8HA 1VQ9A 2VXFA 1ZUUA 3OYJA 3QJ6A 2HQHA 5EG2A 3LWHA 1JJ2S 4Y91A 2E6ZA 2KAFA 3L2QA 2CP5A 1E6GA 1NEGA 3JCMd 4EMKB 2M9UA 2OX7A 4FYYB 2CDTA 1T3LA 2QDYB 2RHUA 2V1QA 4A4KA 1M5Q1 3EGDA 4RTWA 5GAOn 3TSWA 4HCCA 3SWNA 4XU0A 4C8QC 2DLPA 3PE0A 2E3HA 5KYWB 5IT9E 4LDXA 4LDWA 2NWMA 2RNAA 2R5AA 4RTYA 1U1TA 2EPDA 1N8RC 3M0TA 1HJDA 4IKFA 5FROA 4OVAA 5CCAA 1VQ7Q 1M90R 4M7AC 3LLRA 1BI1A 3OQ5A 3NGPA 3TQ7P 2KR3A 3CC4Q 1K8AU 1XQHA 3VS6A 3GF5A 5GMKh 3CMEA 3JB9H 1WQWA 4FSXA 1Q7YC 4JS4A 1NJIU 2P4RA 3H0FA 4BDYA 3VUBA 1JRIA 3OYMA 1N6AA 1SRMA 6AT1B 2BTTA 3S3OA 3CCRT 4M7DB 5CQXA 3HP9A 1PRMC 2DO3A 3I56T 4JUVA 1G3SA 2E64A 4L5GA 1TUGB 1RUWA 4ANJA 3OYGA 4JRIA 4O6JA 1UDLA 5I2SA 1Q86C 3VS3A 2MOXA 3V8JA 1HD3A 3BY7A 2KVQG 3KBGA 1TWBA 4F14A 5KCHA 1YP5A 5KYXA 3RBBB 2DXTA 4BY6B 4ZN1A 1AEYA 2JVVA 1CSKA 4KH1B 1I1JA 4LDUA 5GAOm 3F70A 5GAMd 3FB9A 5DY9A 3A8GB 3QYHB 2OAWA 5GAN7 4R55A 1OPKA 4XQ3A 1KC8R 3PVQA 1RABB 4MMKA 4M78A 2CP2A 2GFAA 1Q82C 2EQIA 2DVEA 4FIBA 4CC4B 3QWYA 3SDZA 3LH0A 3J80E 4QQGA 3NMZC 2FHDA 2MCNA 2QTVA 4BB7A 2Y90A 1YHQQ 2KNBB 5LJ3f 1JEGA 1X69A 1RACB 2NUZA 1FMWA 2YDLA 2QGFB 1Q7YU 1M3BA 1BK2A 2CKKA 2LJ0A 3CMET 3VUZA 2QQ9A 1UJ0A 4FYVB 1UG1A 1MNDA 4ESRA 4CI0C 3PIPA 4AFQC 1AOJA 4RG2A 2DNUA 4A54A 2LCLA 2WSFE 4LDVA 1LOJA 4EDUA 3CCSQ 1SSHA 2X4WA 3GOXA 3QKJA 4PJOG 4M75G 4E7ZA 2F5KA 2WACA 4JLIA 4HCBA 9ATCB 1S72Q 5D6YA 3L2RA 4MDXA 2W0ZA 1UGQB 1YI2A 4Y28E 2O4XA 4JRKA 3NTIA 3L2UA 2QQRA 3M4GA 1N8RR 2VB6A 3EHRA 1KQ2A 4C92E 1Q82U 3HSBA 3CMAA 3DB4A 2QG9B 1YJ9A 4OMOA 3QZ5B 2E70A 3LW5E 1G3TA 1UFFA 2V8JA 1SHGA 2A3LA 3MJXA 2FEIA 4DBFA 3OS2A 1QVGA 1GBRA 1YIJA 4Y92A 3CCJQ 3FEOA 5CIUA 3C4SA 4J9GA 1U8RA 1CKBA 1YCSB 2VKNA 4M78D 4BACA 2EYXA 2MPXC 2QAZA 1W2BS 5CAIA 1OQKA 5CKDA 3KUFA 1KQ1A 1Q86R 3VS2A 3A8MB 3OYYA 1ZLMA 2YRDA 1B7TA 1VYTA 1JO8A 1TG0A 3PFSA 2RK1A 4L59A 1YJNA 4KUDK 2L3PA 4AFZC 3V8LA 3CCQA 4RKUE 3HTRA 5LJ3j 1YITA 4XK8E 4C92F 3QHSA 2EYQA 3QPHA 4VUBA 2LRQA 2RQTA 5L23A 2CZ6B 3C95A 2EQKA 1UHFA 1YI2T 2Z0WA 1O75A 2X3WD 5KCOA 1UB4A 2G6FX 1D0ZA 2DPPB 3G4SQ 1XOVA 5HK0A 2XK0A 4J5YA 1RLPC 4HXJA 2RMOA 2KRNA 4PJJA 1N9RA 4OB2B 2LNVA 3CMAT 1VQOA 4HCKA 2PVDB 2BZYA 4C5GA 1YJ9T 1W2BP 4DEXA 1RAEB 4FM4B 1AZEA 3JCMW 2EW3A 3HRUA 5GAN5 3JSCA 3RKXA 1M1GA 2YUNA 1Y96A 4PJOC 4E7JA 2CGHA 1BU1A 2AIRB 4M75C 1QCNA 4PLIA 2DRMA 3HHTB 3I55T 1ZHIA 1WFWA 2HCKA 3M0SA 1YIJT 2AZSA 1BYMA 4F7UG 2PNIA 3CCRQ 2DYIA 1VQ9Q 2CH4W 3JCMb 4Z89A 2OTJA 1PG5B 4J8OA 1MMGA 3ZFJA 3GPLA 4KH0B 2HSEB 2HL5C 1VQ4A 1AHJB 2DKGA 4LUEA 1G3YA 2LVMA 1VQ5Q 3EH2A 1V29B 4C8QE 3VS1A 4C8QA 4DEYA 2COZA 2QEXA 1WHMA 2KROA 2KXDA 3JB9D 3E1SA 2HBWA 1PWTA 1VIEA 3A8HB 1MMDA 1YJNT 3DKMA 1LNXA 4LD6A 3CCMQ 3CCQT 4PJMA 2C0IA 3M56A 2FZGB 3CC7A 3VS0A 1YITT 1D1AA 1OYXA 1WHJA 4OMNA 3UT1A 4M7AE 2D8HA 2AT1B 2PUOB 4M7AA 4FT4A 2ZPHB 2X3XD 3UDCA 4Z02A 4JJBA 3JB9G 4LXCA 5GANe 4GLKA 4DBQA 4RMOA 3CPWA 3RMSA 3TEEA 1WXBA 4J7IA 5ECAA 4IUUA 2JNGA 2K7AA 1VQOT 4OGCA 4M7DD 1BBZA 2RQVA 4OB3B 2KBTA 1QKXA 2MWPA 3CMEQ 3JCMV 2KMTA 2LCCA 3CBOA 1N9SA 2YLCA 1MNEA 4RTTA 3MKDA 2F2WA 5FW9A 5AYFA 3VS4A 2FB7A 3EGDB 3SWNB 4JLGA 2LC4A 3VYGA 4M7DG 1MMAA 3V8KA 2O9VA 1WI7A 2ZPIB 4C8QF 1WPYA 4QW2A 4YTLA 5CQYA 2OTJT 2P4TA 2DL7A 1OZ3A 2WSCE 4EMHA 1QKWA 1WGSA 2D9TA 1K9MU 1EFNA 1WZOA 1BIBA 3PT9A 1VQ4T 2JW4A 2LT1A 3M4YA 2M0YA 2DFUA 2BZXA 1GFCA 4M7AF 2AHJB 2JMCA 2QEXT 1ABOA 3VYHB 2GTJA 4E7SA 1BI0A 1WYXA 2GCXA 2H3JA 2QA4A 1NLPC 4J9HA 2EJ9A 1ZBJA 3CPFA 3CC7T 2NUPA 3OYKA 2C0TA 2LT4A 3G6ET 3BDLA 4DOVA 5CK9A 2XDDA 3RDVA 1W1FA 1VQ6T 3UATA 2YWWA 4CRIA 2KK4A 1JB0E 1QMCA 2YUQA 1Y71A 2GF7A 2DETA 2KY9A 3CCVA 2CP7A 2K2MA 2NLUA 3MEAA 2JS0A 3CCUA 2FYKA 1YWPA 2PTKA 3L42A 3A98A 2E5QA 2GBQA 4HVVA 2DTOA 4OGEA 5HK3A 4CC3A 1K76A 4EMKC 1QQJA 4A4GA 4PK4A 1RAIB 2MYSA 1M8VA 3MP8A 4RCBA 1K0XA 3ZEHA 1BB9A 3LYIA 4M78B 4NOYA 1M1FA 2DL8A 2QASA 2HDAA 1BI2A 2KT1A 2R58A 2ZPFB 3EFSA 1Y57A 2DRKA 4J6WA 2PVGB 2EVRA 2AKKA 1OOTA 2CH4A 1D0XA 3LGLA 5KE2A 4LN2A 3VS7A 2A0FB 3H41A 1YI2Q 1IHVA 4DA4A 5IXBA 2F5TX 2RJFA 7AT1B 5EC7A 2QA4T 1D1CA 2J6FA 5LJ5f 2COWA 3QXEB 3CMAQ 2CUBA 1YNZA 3EG3A 5AT1B 4M7DC 3PGGA 1K8AC 5CVIA 1YJ9Q 3LGFA 2A36A 3NFCA 5GAN2 5LL6S 1AWXA 1NJIC 3RESA 3T9NA 2M1HA 3CCVT 3OW2A 3I56A 2FRYA 3HRTA 1YIJQ 5GMKi 3THKA 3CCUT 5GANg 2COYA 5HY6A 1ZSZA 4GBQA 4R56A 1NYGA 2VXEA 3UA7A 2KDSA 4PFOA 1W6XA 4BY6C 2O4XB 3CCLQ 2DIQA 3CBMA 3CEYA 4XU3A 1NYFA 3VRZA 1VQ8A 2IVWA 1KK7A 4E2FB 1OZ2A 1ZUKA 4PNOA 2QTXA 3KXTA 4HKEA 1MHNA 3BE3A 3D7SB 1W70A 1HYOA 5FU7B 3OYIA 1NBEB 2SRCA 1IGQA 1YJNQ 3V7CA 3M59A 2K2VA 3CCQQ 2A37A 4J6XA 4J9BA 3JCMf 1YITQ 4B6MA 1KQSA 1YBYA 2BIVA 4OF1A 1BI3A 1NM7A 1UE9A 5GANh 2BUDA 4AG2C 3I5RA 4BI3A 4FL6A 3WXMB 4PJOE 2L3QA 4M75E 5IHKA 1OI1A 4Z8AA 2GTOA 3HKSA 1VQOQ 2ECZA 4RUGA 4N4GA 5KYYB 4Q5WA 2QYZA 2RQUA 4FT2A 4JPBW 2JN0A 4GY5A 4Z88A 5IHNA 2CSQA 2NYSA 1GCQC 1WA7A 3EG1A 5A0GA 2DMOA 4XTUA 1JJ2A 1KHCA 1IRXA 1RI0A 2ZPGB 1TXQA 1NPPA 1ZUYA 4E47A 2V8KA 5GAOl 2DEQA 1I5LA 1FWZA 1FMKA 4AFSC 1IHWA 1UJYA 2NUTA 2OTJQ 2MIOA 3H9NA 1VQ8T 2OTLA 3QWXX 1VQ4Q 2IPOB 5LJ5j 5IXFA 3GBQA 1BCOA 4KBMB 2LX9A 4ORZA 1KG1A 2VASA 3A8OB 1YCYA 2QEXQ 2MK5A 3EGXA 4ZTJA 1Y96B 4B9XA 3JCMc 5J39A 2VVKA 1WIEA 5A0DA 4QVCA 3H6ZA 3CC7Q 4N0AA 4PJOF 3RR6A 3JCMX 1IXDA 2XMFA 4M75F 2HMAA 1RLQC 2VUBA 3OMGA 3N5BB 1M3AA 5GAMf 1K8AR 1QLYA 2YLBA 4L6V5 5DLQE 2DAQA 1AWOA 3CXCS 1NJIR 4KULA 1M2OA 3RMQA 2DXUA 3QUIA 1WXUA 1M8MA 5CKFA 2BE7D 2MF2A 3CD6A 1K73U 4BE2A 3QG1A 2L3SA 2P0QA 4C8QB 3OYAA 2VC8A 1QCOA 2HBPA 3M5AA 3TSZA 4DQ2A 2PVOB 4A53A 1RAGB 2EAYA 2HNIA 5LJ3e 4C0FA 3J7AF 4HCZA 3LH5A 4OB1B 3URGA 3X25B 4EPCA 1WX6A 1JU5C 3OSSC 1H92A 1AD5A 4D6WA 2JTEA 4J9EA 3DB3A 2EJGA 2OTLT 1XJWB 4NS5A 1IZ6A 2JJ9A 2XKOC 3HL8A 4F16A 3CXCP 3PNWC 1D1BA 4F7UE 2CSIA 3ER0A 4OP0A 4IURA 4C92A 1UGRB 1VUBA 5CKHA 1GRIA 3QYGB 3M53A 1U06A 1OX9A 2XIDA 4KT0E 2QK0A 1PSEA 1TH7A 3L2WA 4J6YA 1SEMA 4PKCC 4QKUA 3EG9A 5I2MA 3JB9J 1Q7YR 2FL7A 2JS2A 2EYYA 5KYUA 2LQNA 3I55A 2DF6A 4XU1A 2DL3A 2H3EB 5GAN3 3QDFA 2BZ8A 3U23A 1QVFA 3CCVQ 2IG0A 3CD6T 2HL3A 4AFUC 1VQNA 3CCUQ 2ZZDA 2X9HA 2X4YA 2JM9A 4JZ3A 3OMCA 5KYNA 4GLMA 4ZGDB 1F1BB 1VQPA 2MI6A 2LDMA 3TREA 1LVKA 3A8LB 3PMTA 2EQMA 1SG5A 4M77E
chains in the Genus database with same CATH topology
2MWPA 3OBWA 4M77A 3TCJA 3OBYA 3S6WA 3JCMV 2KMTA 2LCCA 2LQ8A 3CBOA 3QZ9B 1N9SA 2YLCA 4M78G 4HT9A 3JCMQ 5AYFA 3MO8A 2FB7A 3MP1A 4ME7A 2M16A 2DIGA 1EIFA 3PIOA 3OY9A 5GAMj 4EMGA 2MWOA 3SWNB 4JLGA 5LJ3d 5KE3A 2LC4A 3CCMT 4WF2A 5HKCA 2VGMA 3VYGA 1UGPB 2D0QB 3HFNA 4IUTA 3WVDB 2X4XA 4F7UF 3BW1A 1Q81C 4M7DD 2YHTA 3V8KA 4M7DG 2GFUA 4M78E 2ZPIB 1VIFA 1N27A 1WPYA 1QVPA 3QO3A 4QW2A 4YTLA 3VJPA 3X24B 3P8BB 3CCRA 5CQYA 1N8RU 2BKDN 4F7UB 2OTJT 2P4TA 2RJCA 1OZ3A 4C0ZA 2WSCE 4EMHA 1VQ9A 3OSVA 2VXFA 2F69A 1WGSA 2D9TA 4NL2A 1K9MU 1BIBA 3PT9A 1VQ4T 1G5VA 5A2QE 2RHZA 2LT1A 3OYJA 2XDBA 5FLXE 3M4YA 3QJ6A 5EG2A 3LWHA 1JJ2S 3CCEA 3FRNA 4Y91A 2QI2A 1G3WA 4IUQA 2E6ZA 2E65A 2KAFA 3L2QA 4M7AF 4ELZC 2AHJB 2LTOA 3LX7A 2M0OA 4A4EA 4C5IA 2QEXT 1QVGS 3VYHB 2ZCFB 3SWNC 4BE0A 2R5MA 3HPWA 1BI0A 3JCMd 5GAMe 2GCXA 3OA6A 2H3JA 2QA4A 2DJZA 2EJ9A 1QVFS 4M7AB 3CPFA 2RD1A 4EMKB 1IREB 3CC7T 4II1A 2M9UA 4PJOD 3OYKA 3JB9I 5L8RE 2QDYB 2VYTA 4M75D 3X20B 4PLLA 2LT4A 5IN1A 2RHUA 3RIRA 2JZ2A 3G6ET 3CPWS 1BKBA 4HT8A 2DD5A 3GIBA 3BDLA 3CC2T 4DOVA 4A4KA 3X26B 5CK9A 2XDDA 1M5Q1 5D6WA 5GAOn 3OYLA 1NZ9A 4HCCA 1VQ6T 2LQKA 3SWNA 4XU0A 3V7RA 4C92D 4C8QC 4M77F 4CRIA 2RI3A 2KK4A 1JB0E 3CBPA 3EFRA 4QQDA 3OYEA 4JS5A 1Q86U 1VQNT 5IT9E 1Y71A 2GF7A 4LDXA 4LDWA 1X6OA 2KY9A 4X9DA 3CCVA 1NPRA 2R5AA 2YRVA 5LJ5g 2NLUA 2G3RA 5GANd 3MEAA 4ELYC 1I8FA 3CCUA 1VQPT 3QDRB 1U1TA 2FYKA 4N4HA 4F7UA 1N8RC 3L42A 2E5QA 4OGEA 2DTOA 4IKFA 3Q1JA 5FROA 2VV5A 5HK3A 2E41A 4OVAA 5CCAA 1K9MC 2MMPA 4M7AC 3LLRA 1BI1A 1RL2A 3OQ5A 4EMKC 4X9CA 4A4GA 3X28B 4M78F 1B34B 3MEVA 3QSUA 2R57A 3C94A 1M1KU 3MCAB 3R6OA 1Q81U 1XQHA 1K8AU 1M8VA 5GMKh 3GF5A 3MP8A 4RCBA 2ZPEB 2XHCA 3CMEA 2JTMA 1WQWA 4FSXA 3ZEHA 1Q7YC 3JB9H 3CXCA 4JS4A 1NJIU 1UGSB 3LYIA 4BDYA 3HRSA 2RJDA 3VUBA 1JRIA 4M78B 5I21A 1R8OB 4NOYA 1M1FA 4QVDA 5LJ3g 2E1HA 1BI2A 3G6EA 2VGNA 3OYMA 1N6AA 4EMKA 2D6FA 2RK2A 2R58A 2ZPFB 3EFSA 2O01E 3S3OA 3DLLA 3CCRT 1VQ6A 4M7DB 2EQUA 2B8AA 2RI2A 3HP9A 5CQXA 2L3RA 2DO3A 3I56T 1VQMA 4JUVA 1M9SA 2DZCA 4J6WA 1G3SA 2E64A 2PVGB 4L5GA 3OYGA 2Y4YA 4JRIA 1UEBA 4O6JA 3SB2A 2DTHA 3LGLA 5KE2A 5I2SA 3CCET 2RB6A 4RG8A 1Q86C 4JRPA 2GQVA 5LJ5h 3V8JA 4A4HA 3BY7A 4DA4A 2KVQG 4BDZA 3KBGA 3GNFB 4C5EA 2A7YA 2F5TX 4LDYA 2RJFA 3WVEB 2RI5A 4M78C 5KCHA 3CCLA 2XI9A 2QA4T 2DXTA 3INZA 3ZBDA 4BY6B 4DOWA 4ZN1A 3JCMg 2JVVA 2XG8D 4LDUA 5LJ5f 5GAOm 3F70A 1KD1U 4N4IA 3QXEB 1B34A 5GAMd 3NTHA 3FB9A 2QQBA 4M7DC 5DY9A 3PGGA 3A8GB 1M1KC 1K8AC 3QYHB 5CVIA 4R55A 3LGFA 5GAN7 4C0DB 3NFCA 4XQ3A 5GAN2 3AHUA 5LL6S 2KSSA 1NJIC 1FX7A 3L1AA 5KH6A 3RESA 3ASKA 4MMKA 5GAMh 3OYHA 4M78A 3T9NA 5LJ3h 4MZMA 3G71A 2M1HA 2GFAA 3CCVT 3OW2A 3I56A 1Q82C 2DVEA 4FIBA 3HRTA 3PMIA 2MAMA 2RHYA 2QQAA 4RCCA 3SDZA 5GMKi 3LH0A 3JAME 4PL6A 3J80E 3LWIA 3CCUT 4M7DE 2RM4A 4QQGA 4IUPA 5GANg 4XTXA 4M7DA 2FHDA 5HY6A 4BB7A 5GAN4 4R56A 2Y90A 2VXEA 3BFMA 5LJ3f 2KDSA 5C0MA 4BY6C 4KUIA 2O4XB 4UC4A 4JRQA 3P8DA 2DIQA 1Q7YU 3CBMA 3CEYA 4XU3A 3OYBA 4ZTFA 2DXCA 1WNLA 1VQ8A 2CKKA 2IVWA 1OZ2A 1VQ7A 3GLXA 1XNIA 3TU4K 4PNOA 2QTXA 3CMET 3VUZA 2QQ9A 3OS0A 3M55A 4C0DC 3S3MA 3KXTA 3CC4A 4HKEA 4CI0C 3PIPA 3PTAA 2ZGWA 1MHNA 3J81E 5FU7B 3OYIA 1X01A 4HA8A 3JCMh 4JDSA 2K3XA 4X34A 4RG2A 4BI8B 2HD0A 4XTWA 1KD1C 4A54A 2LCLA 1HXDA 2WSFE 4LDVA 3JB9F 1LOJA 3FDRA 1W2BA 1WJSA 2EJFA 2K3YA 1LJOA 3V7CA 4EDUA 3E9GA 2K2VA 3GNGA 3M59A 5J3BA 4C8QD 1VQMT 5CKBA 4MZTA 4J6XA 1VQLA 2RHXA 2DZ9A 2PU9B 2X4WA 3OYDA 3EAEA 3JCMf 3GOXA 2FVUA 3QKJA 3MEUA 4PJOG 2PUKB 4M75G 4QQ6A 3VKIA 1KQSA 1YBYA 2BIVA 4O5VA 4OF1A 4B9WA 4QVZA 2F5KA 1QP3A 1WQ7A 2WACA 5A0LA 4JLIA 2JTFA 1BI3A 4ZN3A 5GANh 1YHQT 2BUDA 4HCBA 4BI3A 4C92G 2XICA 4M7AD 4FL6A 3CCLT 5D6YA 3CCJA 4C8QG 3WXMB 2QQSA 3L2RA 3UPUA 4MDXA 5FU7C 1UGQB 4PJOE 4XTYA 1YI2A 3ME9A 4M75E 2O4XA 4Y28E 1OI1A 3HKSA 4JRKA 3NTIA 2WSEE 3L2UA 4IUVA 2QQRA 4E7KA 1NE8A 3M4GA 5GAMg 5GANf 4M7DF 2RA2A 1KQ2A 4N4GA 4C92E 2I2LA 3OYNA 3FIFA 4Q5WA 5GMKj 1Q82U 3HSBA 3CMAA 4FT2A 2DK3A 1ZQ1A 2E10A 2JN0A 4GY5A 3RKYA 3DB4A 3SD4A 1YJ9A 3MEWA 3G71T 3BDUA 2P0PA 5A0GA 3QZ5B 4NL3A 2E70A 5M9OA 3LW5E 4XTUA 1G3TA 4M77D 5FU6B 1JJ2A 2V8JA 1VQKA 4E7HA 4J7FA 5CKEA 5J26A 2A3LA 4MMLA 3A5ZB 3META 3QJYA 2X35A 1KHCA 3OS2A 1QVGA 1RI0A 2ZPGB 4E47A 1NPPA 2K5FA 4JJNK 1YIJA 2V8KA 5GAOl 2DEQA 4E7IA 1I5LA 1FWZA 1X75C 3FEOA 3VV0A 3E19A 5CIUA 1YHQA 3C4SA 4C0GA 1VQ8T 1U8RA 2OTLA 1VQ7T 2CZ0B 2JUFA 4M77G 5CO7A 1QW1A 4LD9K 4M78D 4BACA 3M54A 3RERA 1Y07A 5LJ5j 3CC4T 4N0AC 1W2BS 3L2ZA 2LX9A 4KBMB 2P0KA 3V7SA 5CAIA 5CKDA 1QP2A 5GMKe 3KUFA 5CR2A 1KQ1A 1KG1A 3A8OB 3S3NA 1YCYA 2DD4A 3OYFA 3G4SA 2CYZB 5FU6C 3A8MB 5GAOp 4ZTJA 2E6NA 3OYYA 2EQJA 1Y96B 1KQSS 1D3BB 1GXIE 4B9XA 3JCMc 5J39A 3UWNA 3E9FA 5A0DA 1VQLT 2EKOA 4QVCA 2E12A 3H6ZA 2RH2A 1Y7XA 4ATOA 4N0AA 3PFSA 3MHXA 4PJOF 2RK1A 4L59A 4BD3A 3JCMX 1YJNA 4KUDK 2CZ1B 4M75F 3CCSA 1M90U 3V8LA 5DM7R 3CCQA 5FRMA 4RKUE 2K5IA 2VUBA 5LJ3j 3OMGA 3QIIA 3N5BB 4A4FA 1YITA 5GAMf 2YLBA 3FLGA 4L6V5 5DLQE 2DAQA 3CXCS 4PJOB 2EFIA 4XK8E 4C92F 2XD0A 3QHSA 2EYQA 3QPHA 4KULA 2LRQA 4M75B 4VUBA 3RMQA 5C6SA 5LJ5e 2DXUA 4C8QF 2EIFA 3QUIA 2CZ6B 5CKFA 3FJPA 3C95A 3CCJT 2EQKA 1WJRA 2HAXA 2MF2A 1YI2T 2CS7A 3CD6A 1O75A 1K73U 5KCOA 3SFMA 2OAUA 2P0QA 1UB4A 3QG1A 2L89A 4BE2A 1W4SA 2DPPB 1S72A 5D6XA 4C92B 1WJQA 1XOVA 5HK0A 4C8QB 2XK0A 4J5YA 4XU2A 1HK9A 3OYAA 2VC8A 2RHIA 1N9RA 5GAOq 2HBPA 4OB2B 2LNVA 3M5AA 3G7ZA 5GMKl 1YJWA 3CMAT 4BUGA 1VQOA 2JOYA 1KHIA 2PVDB 4XTVA 4C5GA 4DQ2A 5FRNA 3O8VA 2RO0A 1P92A 1VQ5A 1YJ9T 1I81A 2DXBA 2PVOB 4A53A 1ZBXA 3NTKA 2HQXA 4FM4B 3JCMW 5GAN5 3HRUA 1H641 2ZPBB 3JSCA 1VQKT 3RKXA 2HNIA 1M1GA 2EAYA 5LJ3e 2QXFA 4C0FA 1Y96A 3J7AF 4PJOC 4HCZA 1D3BA 2CGHA 3L2VA 4E7JA 3URGA 4OB1B 4M75C 3X25B 4PLIA 3HHTB 5GMKm 3I55T 1ZHIA 3M58A 4EPCA 1YIJT 2X4JA 4TVRA 1O9SA 3OSSC 1BYMA 3RKWA 2RJEA 3CCMA 3DLMA 2V8IA 3OB9A 3VU3C 4F7UG 4D6WA 3MP6A 3P8HA 4BI4A 3DB3A 4C5HA 2C06A 1M90C 2XDPA 4OB0B 4C92C 2EJGA 2OTLT 3OS1A 2KQWA 3JRZA 4NS5A 3JCMJ 4V2SA 2XU8A 2L5QA 3JCMb 3OYCA 1IZ6A 2XKOC 3FC3A 4PJOA 2OTJA 3HL8A 2EWNA 2K57A 1FXXA 4J8OA 4M75A 2PQWA 4BE1A 2DTIA 3ZFJA 3GPLA 1KC8U 5GANj 4ZGEB 3H8ZA 3PNWC 1VQ4A 4F7UE 1AHJB 4M77B 2DKGA 3JCMP 3ER0A 3G4ST 3OW2S 1G3YA 2LVMA 1H3ZA 1K73C 4OP0A 2Y4XA 1V29B 2K4YA 4IURA 4C92A 1UGRB 4C8QE 4E7LA 1VUBA 5CKHA 3JCMe 4C8QA 4MDWA 3QYGB 3M53A 3OS5A 4M7AG 2QEXA 1PSFA 2XIDA 4KT0E 1JBMA 1PSEA 3E1SA 3JB9D 1TH7A 1VIEA 3A8HB 4ZGJB 1BIAA 3L2WA 1U1SA 1YJNT 1M4ZA 4J6YA 4PKCC 3CCST 3DKMA 1LNXA 4LD6A 4MZPA 5I2MA 3CCQT 3JB9J 2FL7A 3M56A 1I4K1 3QBYA 3GP8A 3CC7A 4XTZA 3I55A 1YITT 5GAN8 1OYXA 4XU1A 3UT1A 4M7AE 3HFOA 2PUOB 4M7AA 4FT4A 2K5LA 2ZPHB 5GAN3 3CC2A 1XTDA 1QVFA 3UDCA 3C12A 2L8DA 2IG0A 4J83A 4Z02A 3JB9G 4M77C 5GANe 3CD6T 4XAXB 1VQNA 2HQEA 2ZZDA 4GLKA 5GAN6 4RMOA 5GAOr 1VQ9T 1S72T 1DJ7B 5LJ5d 3CPWA 2X4YA 3RMSA 3TEEA 3OMCA 3M9QA 4J7IA 5IAYA 3M57A 4P5NA 4ZGDB 1VQPA 2MI6A 4IUUA 2LDMA 3TREA 4FU6A 2JNGA 1YJWT 1SSFA 2CZ7B 4OGCA 3A8LB 3RUXA 5DLOA 3PMTA 4OB3B 1VQOT 4OMFB 1KC8C 1MGQA 1VQ5T 2EQMA 4M77E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWP A;  5KCO A;  4BE2 A;  3OYM A;  3S6W A;  2L89 A;  4QQ6 A;  2LCC A;  5D6X A;  2BIV A;  1WJQ A;  4B9W A;  4QVZ A;  2F5K A;  2WAC A;  2R58 A;  2XK0 A;  3S3O A;  2JTF A;  3OYA A;  2EQU A;  2B8A A;  2RI2 A;  2RHI A;  3MO8 A;  2L3R A;  3MP1 A;  2BUD A;  2M16 A;  2DIG A;  3OY9 A;  2MWO A;  4FL6 A;  5D6Y A;  5KE3 A;  3OYG A;  2QQS A;  3L2R A;  4C5G A;  5FRN A;  3O8V A;  2RO0 A;  4IUT A;  2X4X A;  3ME9 A;  2O4X A;  3LGL A;  5KE2 A;  1OI1 A;  3NTK A;  2HQX A;  2GFU A;  3NTI A;  4E7K A;  3L2U A;  1N27 A;  2QQR A;  4IUV A;  4QW2 A;  4A4H A;  4HCZ A;  2BKD N;  3L2V A;  4E7J A;  2RJC A;  1OZ3 A;  4N4G A;  4C5E A;  4PLI A;  4BDZ A;  3OYN A;  2RJF A;  4Q5W A;  1WGS A;  2D9T A;  2RI5 A;  5KCH A;  2RJE A;  4GY5 A;  3DLM A;  3OB9 A;  1G5V A;  3DB4 A;  2RHZ A;  3SD4 A;  3OYJ A;  3MEW A;  3QJ6 A;  3MP6 A;  3P8H A;  3DB3 A;  4C5H A;  5M9O A;  2XDP A;  3F70 A;  4N4I A;  4IUQ A;  3OS1 A;  4NS5 A;  3NTH A;  3L2Q A;  4E7H A;  5J26 A;  2LTO A;  3LX7 A;  2M0O A;  4A4E A;  4C5I A;  3OYC A;  3LGF A;  3MET A;  3FC3 A;  2X35 A;  1KHC A;  3OS2 A;  1RI0 A;  2PQW A;  4BE1 A;  4BE0 A;  2R5M A;  5KH6 A;  3H8Z A;  3ASK A;  3OYH A;  3PNW C;  4E7I A;  3FEO A;  2LVM A;  2M1H A;  1H3Z A;  2GFA A;  4II1 A;  5CIU A;  3C4S A;  3OYK A;  3PMI A;  4IUR A;  2VYT A;  2RHY A;  4PLL A;  5IN1 A;  2RHU A;  3LH0 A;  2JZ2 A;  4PL6 A;  4E7L A;  4QQG A;  4IUP A;  3BDL A;  4BAC A;  2FHD A;  3OYL A;  5D6W A;  2P0K A;  5C0M A;  3KUF A;  3L2W A;  2O4X B;  4UC4 A;  4CRI A;  3S3N A;  2RI3 A;  4QQD A;  4LD6 A;  3OYE A;  3OYF A;  3P8D A;  2DIQ A;  3CEY A;  2GF7 A;  3QBY A;  3OYB A;  4ZTF A;  4ZTJ A;  2CKK A;  2E6N A;  2R5A A;  2YRV A;  1OZ2 A;  2EQJ A;  1OYX A;  1XNI A;  2G3R A;  2NLU A;  3UT1 A;  3MEA A;  4B9X A;  5J39 A;  3OS0 A;  3UWN A;  4N4H A;  3S3M A;  3E9F A;  2EKO A;  3L42 A;  2E5Q A;  3H6Z A;  4IKF A;  3Q1J A;  5FRO A;  2L8D A;  2IG0 A;  3PFS A;  1MHN A;  4OVA A;  4Z02 A;  4L59 A;  3OYI A;  4BD3 A;  3LLR A;  3OQ5 A;  2HQE A;  2K3X A;  5FRM A;  4X34 A;  4RG2 A;  4A4G A;  2X4Y A;  3OMG A;  3MEV A;  3QII A;  4A4F A;  3OMC A;  2R57 A;  3FLG A;  3M9Q A;  5IAY A;  3FDR A;  2DAQ A;  1WJS A;  2K3Y A;  3MP8 A;  4EDU A;  2EFI A;  3E9G A;  4IUU A;  3ZEH A;  2LDM A;  4FU6 A;  2LRQ A;  2RHX A;  5C6S A;  3LYI A;  1SSF A;  3OA6 A;  4BDY A;  2RJD A;  3OYD A;  3PMT A;  2X4W A;  2EQK A;  3EAE A;  1WJR A;  2EQM A;  3GOX A;  3QKJ A;  3MEU A; 
#chains in the Genus database with same CATH topology
 4M77 A;  2EKH A;  3OBY A;  2NUP B;  1X2K A;  2IIM A;  1YN8 A;  2LQ8 A;  2O2O A;  4M78 G;  3JCM Q;  1S1N A;  1GBQ A;  3MO8 A;  3MP1 A;  1ABQ A;  1EIF A;  3PIO A;  3R6N A;  5GAM j;  1PNJ A;  4EMG A;  5HKC A;  1T3S A;  4F7U F;  1UGP B;  1Q81 C;  1D0Y A;  2CT3 A;  1LPL A;  2OI3 A;  1N27 A;  3X24 B;  1JXM A;  3NHN A;  1Q82 R;  1TOV A;  3OSV A;  4X1V A;  2FO0 A;  2XDB A;  2ED1 A;  1MV0 B;  3FRN A;  3I35 A;  2DYB A;  2CRE A;  4ELZ C;  2LTO A;  1TTH B;  2M0O A;  4A4E A;  2ZCF B;  3SWN C;  4BE0 A;  2R5M A;  1IRE B;  4II1 A;  1X2Q A;  1KIK A;  3JB9 I;  5L8R E;  2VYT A;  3CQT A;  4PLL A;  5IN1 A;  2JZ2 A;  2KRM A;  3CPW S;  1BKB A;  3X26 B;  5D6W A;  1NZ9 A;  3I56 Q;  4C92 D;  4M77 F;  4PFP A;  1VQN T;  3OYE A;  3CBP A;  4CC2 A;  2ROL A;  2HKQ B;  4X9D A;  4OMQ A;  5GAN d;  4ELY C;  1I8F A;  1VQP T;  3QDR B;  1R77 A;  1ZA1 B;  1VQ8 Q;  1K9M C;  2MMP A;  1RL2 A;  4LE9 A;  4FW2 A;  2R57 A;  1M1K U;  3R6O A;  1Q81 U;  1Z9Q A;  4D8D A;  4JJD A;  2JTM A;  5I22 A;  1UGS B;  3HRS A;  2RJD A;  5I21 A;  5LJ3 g;  1R0C B;  2E1H A;  4KGZ B;  3G6E A;  2VGN A;  2D6F A;  2RN8 A;  2RK2 A;  1E6H A;  1X6B A;  1VQ6 A;  3DLL A;  1PM3 A;  2B8A A;  2RI2 A;  2ESW A;  1ZSZ B;  1C6V X;  3VRY A;  3CPW P;  2Y4Y A;  1V76 A;  2DTH A;  5FWB A;  4RG8 A;  3EFO A;  4JRP A;  2I0N A;  4A4H A;  2DE0 X;  3GNF B;  4LDY A;  3WVE B;  2RI5 A;  1ZX6 A;  4M78 C;  2XI9 A;  3ZBD A;  2XG8 D;  1KD1 U;  1B34 A;  2YT6 A;  3NTH A;  2VWF A;  2M51 A;  4C0D B;  3AHU A;  2HZY A;  1FX7 A;  3L1A A;  1OPL A;  5KH6 A;  5GAM h;  2EYZ A;  5LJ3 h;  2AK5 A;  3G71 A;  2MAM A;  1RI9 A;  2QQA A;  4RCC A;  4OMM A;  2AKL A;  3JAM E;  4IUP A;  1M2V A;  4XTX A;  4LUD A;  2OTL Q;  4KUI A;  4UC4 A;  1AWJ A;  3P8D A;  3OYB A;  2DXC A;  1WNL A;  3UF4 A;  3GLX A;  3OS0 A;  3M55 A;  1UTI A;  1WHK A;  2ZGW A;  2DJQ A;  3RNJ A;  1MV3 A;  2K3X A;  1MUZ A;  2HD0 A;  2KE9 A;  4XTW A;  1WJS A;  2EJF A;  2K3Y A;  3E2U A;  3E9G A;  4C8Q D;  1Z9Z A;  5CKB A;  1VQL A;  2CP0 A;  2PU9 B;  2M02 A;  3REA B;  3EAE A;  2V26 A;  3MEU A;  2NUT B;  4QQ6 A;  8AT1 B;  4B9W A;  2A28 A;  5KYX B;  1QP3 A;  4F04 B;  4ZN3 A;  3CD6 Q;  1YHQ T;  1KSW A;  4M7A D;  3CCJ A;  4C8Q G;  2QQS A;  3EH1 A;  5FU7 C;  4XTY A;  1Y0M A;  3EGX B;  1NE8 A;  3M0U A;  1U5S A;  2RA2 A;  1K9A A;  4RTX A;  2I2L A;  3OYN A;  4WCI A;  1K9M R;  5GMK j;  1I07 A;  2DK3 A;  1RAF B;  3SD4 A;  3MEW A;  3G71 T;  3BDU A;  2D0N A;  2O31 A;  2P0P A;  4NL3 A;  2J7I A;  5FU6 B;  1VQK A;  2KXC A;  4J7F A;  1T0J A;  5CKE A;  5J26 A;  3A5Z B;  2RQW A;  1UGV A;  4JJN K;  1OEB A;  1X75 C;  1V1C A;  4DBH A;  3E19 A;  1WHH A;  4C0G A;  4WTO B;  2JUF A;  1QW1 A;  3EG2 A;  4LD9 K;  2FPF A;  2JT4 A;  3L2Z A;  2FRW A;  2P0K A;  4PFZ A;  3S3N A;  3G4S A;  3EGU A;  2CP3 A;  2ED0 A;  2GNC A;  5GAO p;  2EQJ A;  1KQS S;  2B86 A;  3E9F A;  1VQL T;  2RH2 A;  3O5Z A;  3I5S A;  3I55 Q;  3MHX A;  2O9S A;  1M90 U;  2K5I A;  2E3I A;  1G8X A;  1VQN Q;  2EGA A;  5C6S A;  2J05 A;  5LJ5 e;  2EIF A;  3CCJ T;  4JZ4 A;  3FJP A;  1WJR A;  4RTV A;  2OAU A;  1VQP Q;  2L89 A;  1W4S A;  1YFN A;  1VA7 A;  1TSF A;  5D6X A;  4C92 B;  2F2V A;  2RHI A;  2KRS A;  3MPU B;  3JV3 A;  1YJW A;  3G7Z A;  5GMK l;  4BUG A;  2D1X A;  1KHI A;  4XTV A;  2SEM A;  5FRN A;  3O8V A;  1VQ5 A;  1P92 A;  3EG9 B;  1N5Z A;  1I81 A;  1AZG B;  3NTK A;  5KYU B;  2CP6 A;  1H64 1;  2ZPB B;  1VQK T;  1G2B A;  2LZ6 B;  4FCY A;  2DX1 A;  1D3B A;  5IHI A;  5GMK m;  3H0H A;  3M58 A;  1OX8 A;  2D8J A;  4AG1 C;  1KQS P;  3RKW A;  3CCM A;  1GFD A;  2V8I A;  1RAD B;  3MP6 A;  3P8H A;  3ZL7 C;  1BCM A;  4OB0 B;  2FPD A;  2L0A A;  2KQW A;  3JRZ A;  3OYC A;  4PJO A;  1RAA B;  2EWN A;  2K57 A;  1FXX A;  2PZ1 A;  4M75 A;  2DTI A;  1KC8 U;  2LMJ A;  3G1J A;  5GJW B;  3H8Z A;  1G83 A;  4LNP A;  4M77 B;  3G4S T;  2J06 A;  3FJ5 A;  4QT7 A;  1K73 C;  1QCF A;  2Y4X A;  2K4Y A;  1OU9 A;  1WXT A;  3JCM e;  1TS9 A;  3OS5 A;  3VS5 A;  4EIK A;  3UA6 A;  1JJ2 P;  4ZGJ B;  2LJ3 A;  4M4Z A;  2DVJ A;  1PD0 A;  2EYW A;  1PKT A;  2K6D A;  4OML A;  1I4K 1;  3GP8 A;  4XTZ A;  4KRT A;  5GAN 8;  3CC2 A;  2K5L A;  2QDL A;  1XTD A;  2L8D A;  4J83 A;  1MMN A;  4XAX B;  1VQ9 T;  1DJ7 B;  1LCK A;  2YUO A;  4P5N A;  4FU6 A;  1YJW T;  1SSF A;  2CZ7 B;  1QWE A;  3RUX A;  4J9D A;  5DLO A;  1MGQ A;  1VQ5 T;  1VYV A;  3S6W A;  2YXY A;  1EX4 A;  3QZ9 B;  4HT9 A;  2LP5 A;  1WHG A;  2RPN A;  1Q95 G;  3G6E Q;  2DIG A;  2MWO A;  5LJ3 d;  5KE3 A;  1QWF A;  3CCM T;  4WF2 A;  3HFN A;  2D0Q B;  2LCS A;  5IH2 A;  1H8K A;  1SKU B;  2YHT A;  1VQ6 Q;  2GFU A;  4M78 E;  1IO6 A;  1VIF A;  1QVP A;  3P8B B;  1N8R U;  2BKD N;  2RJC A;  4C0Z A;  4R0K A;  2F69 A;  4NL2 A;  1G5V A;  5A2Q E;  2RHZ A;  5FLX E;  3CCE A;  2QI2 A;  1G3W A;  4IUQ A;  2E65 A;  3LX7 A;  1QVG S;  4C5I A;  1PKS A;  3SEM A;  3HPW A;  5GAM e;  2DJZ A;  1D09 B;  4M7A B;  1QVF S;  2RD1 A;  5I11 A;  4PJO D;  1GL5 A;  4M75 D;  3X20 B;  3RIR A;  4HT8 A;  2DD5 A;  3GIB A;  3CC2 T;  3G71 Q;  3OYL A;  1C0M A;  1VYU A;  2LQK A;  3V7R A;  1AVZ C;  2RI3 A;  4QQD A;  3EFR A;  1Q86 U;  2FG0 A;  4JS5 A;  3EFO B;  2P84 A;  1R0B G;  1X6O A;  1IGU A;  1NPR A;  4F17 A;  5LJ5 g;  2YRV A;  2CUD A;  2G3R A;  5FWC A;  2HEQ A;  1TU0 B;  4N4H A;  4F7U A;  2OJ2 A;  3Q1J A;  2VV5 A;  2E41 A;  2QA4 Q;  4E6R A;  2DER A;  4X9C A;  3X28 B;  4M78 F;  1B34 B;  1X6G A;  3MEV A;  3QSU A;  3C94 A;  2YRC A;  3MCA B;  2C0O A;  2ZPE B;  2XHC A;  2KYM A;  1PHT A;  3CXC A;  2L2P A;  2K79 A;  1QVG P;  4K11 A;  3M0R A;  1R8O B;  4QVD A;  1K73 R;  4EMK A;  2KI7 A;  1VQL Q;  5D7U A;  1QVF P;  1JXO A;  2O01 E;  1M2V B;  4AT1 B;  2EQU A;  3I9Q A;  2L3R A;  4CC7 A;  1VQM A;  1M3C A;  1M9S A;  2DZC A;  1I0C A;  1ACM B;  1UEB A;  1SF9 A;  4FSS A;  3SB2 A;  4IIO A;  4RTU A;  3CCE T;  2RB6 A;  5KYW A;  1AT1 B;  2GQV A;  5LJ5 h;  1T0H A;  1M30 A;  4BDZ A;  4C5E A;  2A7Y A;  3IQL A;  3CCL A;  1NEB A;  3INZ A;  4DOW A;  2O88 A;  3JCM g;  2X51 A;  3PVL A;  2EGC A;  1UHC A;  4N4I A;  2QQB A;  1RAH B;  1E7O A;  2GQI A;  1M1K C;  1ZSZ C;  2KGT A;  2F1L A;  2KSS A;  3ASK A;  2DIL A;  3OYH A;  1J3T A;  1VQK Q;  2ROT A;  4MZM A;  5KYY A;  2BE9 B;  1FYN A;  3PMI A;  2RHY A;  3LWI A;  4PL6 A;  1GCP A;  4M7D E;  2RM4 A;  2LX7 A;  2DM1 A;  4M7D A;  2E5K A;  1X27 A;  5GAN 4;  1OU8 A;  4J9F A;  3BFM A;  4RTZ A;  5C0M A;  3M0Q A;  4JRQ A;  4ZTF A;  1VQ7 A;  3TU4 K;  1XNI A;  1HSQ A;  4C0D C;  3S3M A;  1U3O A;  1PD1 A;  2W10 A;  3CC4 A;  1SHF A;  3PTA A;  3J81 E;  1X01 A;  4HA8 A;  3JCM h;  4JDS A;  4X34 A;  4BI8 B;  4FW1 A;  1KD1 C;  3JB9 F;  1HXD A;  1ZA2 B;  3FDR A;  1W2B A;  1LJO A;  1VQM T;  3GNG A;  5J3B A;  4MZT A;  2RHX A;  2DZ9 A;  3OYD A;  1B07 A;  2FVU A;  2PUK B;  3VKI A;  4FYW B;  1UEC A;  4KGV B;  2LQW A;  4O5V A;  4QVZ A;  1WQ7 A;  5A0L A;  4A63 B;  3H0I A;  2JTF A;  1EZZ B;  2FZK B;  4C92 G;  2EBP A;  2XIC A;  3CCL T;  3UPU A;  1WLP B;  3ME9 A;  4J9C A;  1YJW Q;  2WSE E;  4E7K A;  1PCX A;  3A1P A;  4IUV A;  1CKA A;  1C1A A;  5GAM g;  5GAN f;  4M7D F;  2J6K A;  1TUC A;  4FYX B;  3FIF A;  2E10 A;  1ZQ1 A;  3RKY A;  2V1R A;  2FPE A;  3SHW A;  2F2X A;  5M9O A;  4M77 D;  2K3B A;  4E7H A;  2ATC B;  4MML A;  3MET A;  3QJY A;  2X35 A;  2K5F A;  2DBK A;  1IB8 A;  3NPF A;  4E7I A;  2JMA A;  2RQR A;  3VV0 A;  1GCQ A;  1WDX A;  1YHQ A;  1VQ7 T;  2CZ0 B;  4M77 G;  5CO7 A;  3M54 A;  3RER A;  1Y07 A;  3C0C A;  3CC4 T;  4N0A C;  2EGE A;  2FZC B;  3V7S A;  5CR2 A;  1QP2 A;  5GMK e;  3ULR B;  3EHQ A;  2DD4 A;  3OYF A;  2CYZ B;  2LJ1 A;  5FU6 C;  4PJN A;  2E6N A;  1ZSG A;  1D3B B;  1KFZ A;  1GXI E;  3UWN A;  2EKO A;  2E12 A;  1Y7X A;  4ATO A;  2CT4 A;  1YWO A;  2DBM A;  4BD3 A;  4ZNX A;  2CZ1 B;  3CCS A;  5DM7 R;  5FRM A;  3CC2 Q;  1OUL A;  1B3Q A;  3QII A;  4A4F A;  2DL5 A;  1Q81 R;  1M1K R;  3FLG A;  1K1Z A;  3EG0 A;  4PJO B;  2EFI A;  3AT1 B;  2XD0 A;  4M75 B;  3OA6 A;  2HAX A;  2CS7 A;  3SFM A;  1S72 A;  2A08 A;  1WJQ A;  2DA9 A;  2HKN A;  1WHL A;  4XU2 A;  1HK9 A;  1ARK A;  5GAO q;  2GGR A;  2JOY A;  2RO0 A;  2ENM A;  2DEU A;  3TVT A;  1UUE A;  1PC0 A;  2DXB A;  1ZBX A;  2HQX A;  2YSQ A;  2RF0 A;  2K9G A;  2DL4 A;  2KT8 A;  2QXF A;  5GJV B;  3L2V A;  2KEA A;  2X4J A;  4TVR A;  1O9S A;  2RJE A;  3DLM A;  3OB9 A;  3VU3 C;  2C06 A;  4BI4 A;  4OMP A;  4C5H A;  1KD1 R;  1M90 C;  4PJL A;  2XDP A;  4C92 C;  3OS1 A;  3REB B;  3JCM J;  4V2S A;  2ABL A;  2L5Q A;  2XU8 A;  2J6O A;  3FC3 A;  2KYB A;  3CCE Q;  2PQW A;  4BE1 A;  4KGX B;  5GAN j;  1NG2 A;  1VOM A;  4ZGE B;  3JCM P;  3OW2 S;  1H3Z A;  1NLO C;  2AZV A;  4E7L A;  1K4U S;  2YUP A;  4MDW A;  4M7A G;  1PSF A;  1JBM A;  3KFV A;  2QGG A;  1BIA A;  1U1S A;  1M4Z A;  3CCS T;  4MZP A;  1TUD A;  3QBY A;  1A0N B;  2LNH B;  2JM8 A;  4HVU A;  1SPK A;  3HFO A;  4DBR A;  4IIM A;  3C12 A;  4M77 C;  2E4H A;  4HVW A;  3M0P A;  1JQQ A;  2HQE A;  5GAN 6;  5GAO r;  1S72 T;  5LJ5 d;  1FMV A;  8ATC B;  1K0S A;  3M9Q A;  5IAY A;  3M57 A;  1X43 A;  2ZAE A;  1PRL C;  4OMF B;  1KC8 C;  1SRL A;  5HCK A;  2JXB A;  3OBW A;  3TCJ A;  4AMC A;  4D8K A;  1AWW A;  3OW2 P;  1OV3 A;  2HSP A;  1I5O B;  1M27 C;  2M16 A;  4ME7 A;  1H3H A;  3OY9 A;  2VGM A;  3WVD B;  4IUT A;  4J9I A;  2X4X A;  3BW1 A;  1VQM Q;  3QO3 A;  3VJP A;  4JJC A;  3CCR A;  1KJW A;  4F7U B;  2H8H A;  1VQ9 A;  2VXF A;  1ZUU A;  3OYJ A;  3QJ6 A;  2HQH A;  5EG2 A;  3LWH A;  1JJ2 S;  4Y91 A;  2E6Z A;  2KAF A;  3L2Q A;  2CP5 A;  1E6G A;  1NEG A;  3JCM d;  4EMK B;  2M9U A;  2OX7 A;  4FYY B;  2CDT A;  1T3L A;  2QDY B;  2RHU A;  2V1Q A;  4A4K A;  1M5Q 1;  3EGD A;  4RTW A;  5GAO n;  3TSW A;  4HCC A;  3SWN A;  4XU0 A;  4C8Q C;  2DLP A;  3PE0 A;  2E3H A;  5KYW B;  5IT9 E;  4LDX A;  4LDW A;  2NWM A;  2RNA A;  2R5A A;  4RTY A;  1U1T A;  2EPD A;  1N8R C;  3M0T A;  1HJD A;  4IKF A;  5FRO A;  4OVA A;  5CCA A;  1VQ7 Q;  1M90 R;  4M7A C;  3LLR A;  1BI1 A;  3OQ5 A;  3NGP A;  3TQ7 P;  2KR3 A;  3CC4 Q;  1K8A U;  1XQH A;  3VS6 A;  3GF5 A;  5GMK h;  3CME A;  3JB9 H;  1WQW A;  4FSX A;  1Q7Y C;  4JS4 A;  1NJI U;  2P4R A;  3H0F A;  4BDY A;  3VUB A;  1JRI A;  3OYM A;  1N6A A;  1SRM A;  6AT1 B;  2BTT A;  3S3O A;  3CCR T;  4M7D B;  5CQX A;  3HP9 A;  1PRM C;  2DO3 A;  3I56 T;  4JUV A;  1G3S A;  2E64 A;  4L5G A;  1TUG B;  1RUW A;  4ANJ A;  3OYG A;  4JRI A;  4O6J A;  1UDL A;  5I2S A;  1Q86 C;  3VS3 A;  2MOX A;  3V8J A;  1HD3 A;  3BY7 A;  2KVQ G;  3KBG A;  1TWB A;  4F14 A;  5KCH A;  1YP5 A;  5KYX A;  3RBB B;  2DXT A;  4BY6 B;  4ZN1 A;  1AEY A;  2JVV A;  1CSK A;  4KH1 B;  1I1J A;  4LDU A;  5GAO m;  3F70 A;  5GAM d;  3FB9 A;  5DY9 A;  3A8G B;  3QYH B;  2OAW A;  5GAN 7;  4R55 A;  1OPK A;  4XQ3 A;  1KC8 R;  3PVQ A;  1RAB B;  4MMK A;  4M78 A;  2CP2 A;  2GFA A;  1Q82 C;  2EQI A;  2DVE A;  4FIB A;  4CC4 B;  3QWY A;  3SDZ A;  3LH0 A;  3J80 E;  4QQG A;  3NMZ C;  2FHD A;  2MCN A;  2QTV A;  4BB7 A;  2Y90 A;  1YHQ Q;  2KNB B;  5LJ3 f;  1JEG A;  1X69 A;  1RAC B;  2NUZ A;  1FMW A;  2YDL A;  2QGF B;  1Q7Y U;  1M3B A;  1BK2 A;  2CKK A;  2LJ0 A;  3CME T;  3VUZ A;  2QQ9 A;  1UJ0 A;  4FYV B;  1UG1 A;  1MND A;  4ESR A;  4CI0 C;  3PIP A;  4AFQ C;  1AOJ A;  4RG2 A;  2DNU A;  4A54 A;  2LCL A;  2WSF E;  4LDV A;  1LOJ A;  4EDU A;  3CCS Q;  1SSH A;  2X4W A;  3GOX A;  3QKJ A;  4PJO G;  4M75 G;  4E7Z A;  2F5K A;  2WAC A;  4JLI A;  4HCB A;  9ATC B;  1S72 Q;  5D6Y A;  3L2R A;  4MDX A;  2W0Z A;  1UGQ B;  1YI2 A;  4Y28 E;  2O4X A;  4JRK A;  3NTI A;  3L2U A;  2QQR A;  3M4G A;  1N8R R;  2VB6 A;  3EHR A;  1KQ2 A;  4C92 E;  1Q82 U;  3HSB A;  3CMA A;  3DB4 A;  2QG9 B;  1YJ9 A;  4OMO A;  3QZ5 B;  2E70 A;  3LW5 E;  1G3T A;  1UFF A;  2V8J A;  1SHG A;  2A3L A;  3MJX A;  2FEI A;  4DBF A;  3OS2 A;  1QVG A;  1GBR A;  1YIJ A;  4Y92 A;  3CCJ Q;  3FEO A;  5CIU A;  3C4S A;  4J9G A;  1U8R A;  1CKB A;  1YCS B;  2VKN A;  4M78 D;  4BAC A;  2EYX A;  2MPX C;  2QAZ A;  1W2B S;  5CAI A;  1OQK A;  5CKD A;  3KUF A;  1KQ1 A;  1Q86 R;  3VS2 A;  3A8M B;  3OYY A;  1ZLM A;  2YRD A;  1B7T A;  1VYT A;  1JO8 A;  1TG0 A;  3PFS A;  2RK1 A;  4L59 A;  1YJN A;  4KUD K;  2L3P A;  4AFZ C;  3V8L A;  3CCQ A;  4RKU E;  3HTR A;  5LJ3 j;  1YIT A;  4XK8 E;  4C92 F;  3QHS A;  2EYQ A;  3QPH A;  4VUB A;  2LRQ A;  2RQT A;  5L23 A;  2CZ6 B;  3C95 A;  2EQK A;  1UHF A;  1YI2 T;  2Z0W A;  1O75 A;  2X3W D;  5KCO A;  1UB4 A;  2G6F X;  1D0Z A;  2DPP B;  3G4S Q;  1XOV A;  5HK0 A;  2XK0 A;  4J5Y A;  1RLP C;  4HXJ A;  2RMO A;  2KRN A;  4PJJ A;  1N9R A;  4OB2 B;  2LNV A;  3CMA T;  1VQO A;  4HCK A;  2PVD B;  2BZY A;  4C5G A;  1YJ9 T;  1W2B P;  4DEX A;  1RAE B;  4FM4 B;  1AZE A;  3JCM W;  2EW3 A;  3HRU A;  5GAN 5;  3JSC A;  3RKX A;  1M1G A;  2YUN A;  1Y96 A;  4PJO C;  4E7J A;  2CGH A;  1BU1 A;  2AIR B;  4M75 C;  1QCN A;  4PLI A;  2DRM A;  3HHT B;  3I55 T;  1ZHI A;  1WFW A;  2HCK A;  3M0S A;  1YIJ T;  2AZS A;  1BYM A;  4F7U G;  2PNI A;  3CCR Q;  2DYI A;  1VQ9 Q;  2CH4 W;  3JCM b;  4Z89 A;  2OTJ A;  1PG5 B;  4J8O A;  1MMG A;  3ZFJ A;  3GPL A;  4KH0 B;  2HSE B;  2HL5 C;  1VQ4 A;  1AHJ B;  2DKG A;  4LUE A;  1G3Y A;  2LVM A;  1VQ5 Q;  3EH2 A;  1V29 B;  4C8Q E;  3VS1 A;  4C8Q A;  4DEY A;  2COZ A;  2QEX A;  1WHM A;  2KRO A;  2KXD A;  3JB9 D;  3E1S A;  2HBW A;  1PWT A;  1VIE A;  3A8H B;  1MMD A;  1YJN T;  3DKM A;  1LNX A;  4LD6 A;  3CCM Q;  3CCQ T;  4PJM A;  2C0I A;  3M56 A;  2FZG B;  3CC7 A;  3VS0 A;  1YIT T;  1D1A A;  1OYX A;  1WHJ A;  4OMN A;  3UT1 A;  4M7A E;  2D8H A;  2AT1 B;  2PUO B;  4M7A A;  4FT4 A;  2ZPH B;  2X3X D;  3UDC A;  4Z02 A;  4JJB A;  3JB9 G;  4LXC A;  5GAN e;  4GLK A;  4DBQ A;  4RMO A;  3CPW A;  3RMS A;  3TEE A;  1WXB A;  4J7I A;  5ECA A;  4IUU A;  2JNG A;  2K7A A;  1VQO T;  4OGC A;  4M7D D;  1BBZ A;  2RQV A;  4OB3 B;  2KBT A;  1QKX A;  2MWP A;  3CME Q;  3JCM V;  2KMT A;  2LCC A;  3CBO A;  1N9S A;  2YLC A;  1MNE A;  4RTT A;  3MKD A;  2F2W A;  5FW9 A;  5AYF A;  3VS4 A;  2FB7 A;  3EGD B;  3SWN B;  4JLG A;  2LC4 A;  3VYG A;  4M7D G;  1MMA A;  3V8K A;  2O9V A;  1WI7 A;  2ZPI B;  4C8Q F;  1WPY A;  4QW2 A;  4YTL A;  5CQY A;  2OTJ T;  2P4T A;  2DL7 A;  1OZ3 A;  2WSC E;  4EMH A;  1QKW A;  1WGS A;  2D9T A;  1K9M U;  1EFN A;  1WZO A;  1BIB A;  3PT9 A;  1VQ4 T;  2JW4 A;  2LT1 A;  3M4Y A;  2M0Y A;  2DFU A;  2BZX A;  1GFC A;  4M7A F;  2AHJ B;  2JMC A;  2QEX T;  1ABO A;  3VYH B;  2GTJ A;  4E7S A;  1BI0 A;  1WYX A;  2GCX A;  2H3J A;  2QA4 A;  1NLP C;  4J9H A;  2EJ9 A;  1ZBJ A;  3CPF A;  3CC7 T;  2NUP A;  3OYK A;  2C0T A;  2LT4 A;  3G6E T;  3BDL A;  4DOV A;  5CK9 A;  2XDD A;  3RDV A;  1W1F A;  1VQ6 T;  3UAT A;  2YWW A;  4CRI A;  2KK4 A;  1JB0 E;  1QMC A;  2YUQ A;  1Y71 A;  2GF7 A;  2DET A;  2KY9 A;  3CCV A;  2CP7 A;  2K2M A;  2NLU A;  3MEA A;  2JS0 A;  3CCU A;  2FYK A;  1YWP A;  2PTK A;  3L42 A;  3A98 A;  2E5Q A;  2GBQ A;  4HVV A;  2DTO A;  4OGE A;  5HK3 A;  4CC3 A;  1K76 A;  4EMK C;  1QQJ A;  4A4G A;  4PK4 A;  1RAI B;  2MYS A;  1M8V A;  3MP8 A;  4RCB A;  1K0X A;  3ZEH A;  1BB9 A;  3LYI A;  4M78 B;  4NOY A;  1M1F A;  2DL8 A;  2QAS A;  2HDA A;  1BI2 A;  2KT1 A;  2R58 A;  2ZPF B;  3EFS A;  1Y57 A;  2DRK A;  4J6W A;  2PVG B;  2EVR A;  2AKK A;  1OOT A;  2CH4 A;  1D0X A;  3LGL A;  5KE2 A;  4LN2 A;  3VS7 A;  2A0F B;  3H41 A;  1YI2 Q;  1IHV A;  4DA4 A;  5IXB A;  2F5T X;  2RJF A;  7AT1 B;  5EC7 A;  2QA4 T;  1D1C A;  2J6F A;  5LJ5 f;  2COW A;  3QXE B;  3CMA Q;  2CUB A;  1YNZ A;  3EG3 A;  5AT1 B;  4M7D C;  3PGG A;  1K8A C;  5CVI A;  1YJ9 Q;  3LGF A;  2A36 A;  3NFC A;  5GAN 2;  5LL6 S;  1AWX A;  1NJI C;  3RES A;  3T9N A;  2M1H A;  3CCV T;  3OW2 A;  3I56 A;  2FRY A;  3HRT A;  1YIJ Q;  5GMK i;  3THK A;  3CCU T;  5GAN g;  2COY A;  5HY6 A;  1ZSZ A;  4GBQ A;  4R56 A;  1NYG A;  2VXE A;  3UA7 A;  2KDS A;  4PFO A;  1W6X A;  4BY6 C;  2O4X B;  3CCL Q;  2DIQ A;  3CBM A;  3CEY A;  4XU3 A;  1NYF A;  3VRZ A;  1VQ8 A;  2IVW A;  1KK7 A;  4E2F B;  1OZ2 A;  1ZUK A;  4PNO A;  2QTX A;  3KXT A;  4HKE A;  1MHN A;  3BE3 A;  3D7S B;  1W70 A;  1HYO A;  5FU7 B;  3OYI A;  1NBE B;  2SRC A;  1IGQ A;  1YJN Q;  3V7C A;  3M59 A;  2K2V A;  3CCQ Q;  2A37 A;  4J6X A;  4J9B A;  3JCM f;  1YIT Q;  4B6M A;  1KQS A;  1YBY A;  2BIV A;  4OF1 A;  1BI3 A;  1NM7 A;  1UE9 A;  5GAN h;  2BUD A;  4AG2 C;  3I5R A;  4BI3 A;  4FL6 A;  3WXM B;  4PJO E;  2L3Q A;  4M75 E;  5IHK A;  1OI1 A;  4Z8A A;  2GTO A;  3HKS A;  1VQO Q;  2ECZ A;  4RUG A;  4N4G A;  5KYY B;  4Q5W A;  2QYZ A;  2RQU A;  4FT2 A;  4JPB W;  2JN0 A;  4GY5 A;  4Z88 A;  5IHN A;  2CSQ A;  2NYS A;  1GCQ C;  1WA7 A;  3EG1 A;  5A0G A;  2DMO A;  4XTU A;  1JJ2 A;  1KHC A;  1IRX A;  1RI0 A;  2ZPG B;  1TXQ A;  1NPP A;  1ZUY A;  4E47 A;  2V8K A;  5GAO l;  2DEQ A;  1I5L A;  1FWZ A;  1FMK A;  4AFS C;  1IHW A;  1UJY A;  2NUT A;  2OTJ Q;  2MIO A;  3H9N A;  1VQ8 T;  2OTL A;  3QWX X;  1VQ4 Q;  2IPO B;  5LJ5 j;  5IXF A;  3GBQ A;  1BCO A;  4KBM B;  2LX9 A;  4ORZ A;  1KG1 A;  2VAS A;  3A8O B;  1YCY A;  2QEX Q;  2MK5 A;  3EGX A;  4ZTJ A;  1Y96 B;  4B9X A;  3JCM c;  5J39 A;  2VVK A;  1WIE A;  5A0D A;  4QVC A;  3H6Z A;  3CC7 Q;  4N0A A;  4PJO F;  3RR6 A;  3JCM X;  1IXD A;  2XMF A;  4M75 F;  2HMA A;  1RLQ C;  2VUB A;  3OMG A;  3N5B B;  1M3A A;  5GAM f;  1K8A R;  1QLY A;  2YLB A;  4L6V 5;  5DLQ E;  2DAQ A;  1AWO A;  3CXC S;  1NJI R;  4KUL A;  1M2O A;  3RMQ A;  2DXU A;  3QUI A;  1WXU A;  1M8M A;  5CKF A;  2BE7 D;  2MF2 A;  3CD6 A;  1K73 U;  4BE2 A;  3QG1 A;  2L3S A;  2P0Q A;  4C8Q B;  3OYA A;  2VC8 A;  1QCO A;  2HBP A;  3M5A A;  3TSZ A;  4DQ2 A;  2PVO B;  4A53 A;  1RAG B;  2EAY A;  2HNI A;  5LJ3 e;  4C0F A;  3J7A F;  4HCZ A;  3LH5 A;  4OB1 B;  3URG A;  3X25 B;  4EPC A;  1WX6 A;  1JU5 C;  3OSS C;  1H92 A;  1AD5 A;  4D6W A;  2JTE A;  4J9E A;  3DB3 A;  2EJG A;  2OTL T;  1XJW B;  4NS5 A;  1IZ6 A;  2JJ9 A;  2XKO C;  3HL8 A;  4F16 A;  3CXC P;  3PNW C;  1D1B A;  4F7U E;  2CSI A;  3ER0 A;  4OP0 A;  4IUR A;  4C92 A;  1UGR B;  1VUB A;  5CKH A;  1GRI A;  3QYG B;  3M53 A;  1U06 A;  1OX9 A;  2XID A;  4KT0 E;  2QK0 A;  1PSE A;  1TH7 A;  3L2W A;  4J6Y A;  1SEM A;  4PKC C;  4QKU A;  3EG9 A;  5I2M A;  3JB9 J;  1Q7Y R;  2FL7 A;  2JS2 A;  2EYY A;  5KYU A;  2LQN A;  3I55 A;  2DF6 A;  4XU1 A;  2DL3 A;  2H3E B;  5GAN 3;  3QDF A;  2BZ8 A;  3U23 A;  1QVF A;  3CCV Q;  2IG0 A;  3CD6 T;  2HL3 A;  4AFU C;  1VQN A;  3CCU Q;  2ZZD A;  2X9H A;  2X4Y A;  2JM9 A;  4JZ3 A;  3OMC A;  5KYN A;  4GLM A;  4ZGD B;  1F1B B;  1VQP A;  2MI6 A;  2LDM A;  3TRE A;  1LVK A;  3A8L B;  3PMT A;  2EQM A;  1SG5 A;  4M77 E; 
#chains in the Genus database with same CATH homology
 2MWP A;  3OBW A;  4M77 A;  3TCJ A;  3OBY A;  3S6W A;  3JCM V;  2KMT A;  2LCC A;  2LQ8 A;  3CBO A;  3QZ9 B;  1N9S A;  2YLC A;  4M78 G;  4HT9 A;  3JCM Q;  5AYF A;  3MO8 A;  2FB7 A;  3MP1 A;  4ME7 A;  2M16 A;  2DIG A;  1EIF A;  3PIO A;  3OY9 A;  5GAM j;  4EMG A;  2MWO A;  3SWN B;  4JLG A;  5LJ3 d;  5KE3 A;  2LC4 A;  3CCM T;  4WF2 A;  5HKC A;  2VGM A;  3VYG A;  1UGP B;  2D0Q B;  3HFN A;  4IUT A;  3WVD B;  2X4X A;  4F7U F;  3BW1 A;  1Q81 C;  4M7D D;  2YHT A;  3V8K A;  4M7D G;  2GFU A;  4M78 E;  2ZPI B;  1VIF A;  1N27 A;  1WPY A;  1QVP A;  3QO3 A;  4QW2 A;  4YTL A;  3VJP A;  3X24 B;  3P8B B;  3CCR A;  5CQY A;  1N8R U;  2BKD N;  4F7U B;  2OTJ T;  2P4T A;  2RJC A;  1OZ3 A;  4C0Z A;  2WSC E;  4EMH A;  1VQ9 A;  3OSV A;  2VXF A;  2F69 A;  1WGS A;  2D9T A;  4NL2 A;  1K9M U;  1BIB A;  3PT9 A;  1VQ4 T;  1G5V A;  5A2Q E;  2RHZ A;  2LT1 A;  3OYJ A;  2XDB A;  5FLX E;  3M4Y A;  3QJ6 A;  5EG2 A;  3LWH A;  1JJ2 S;  3CCE A;  3FRN A;  4Y91 A;  2QI2 A;  1G3W A;  4IUQ A;  2E6Z A;  2E65 A;  2KAF A;  3L2Q A;  4M7A F;  4ELZ C;  2AHJ B;  2LTO A;  3LX7 A;  2M0O A;  4A4E A;  4C5I A;  2QEX T;  1QVG S;  3VYH B;  2ZCF B;  3SWN C;  4BE0 A;  2R5M A;  3HPW A;  1BI0 A;  3JCM d;  5GAM e;  2GCX A;  3OA6 A;  2H3J A;  2QA4 A;  2DJZ A;  2EJ9 A;  1QVF S;  4M7A B;  3CPF A;  2RD1 A;  4EMK B;  1IRE B;  3CC7 T;  4II1 A;  2M9U A;  4PJO D;  3OYK A;  3JB9 I;  5L8R E;  2QDY B;  2VYT A;  4M75 D;  3X20 B;  4PLL A;  2LT4 A;  5IN1 A;  2RHU A;  3RIR A;  2JZ2 A;  3G6E T;  3CPW S;  1BKB A;  4HT8 A;  2DD5 A;  3GIB A;  3BDL A;  3CC2 T;  4DOV A;  4A4K A;  3X26 B;  5CK9 A;  2XDD A;  1M5Q 1;  5D6W A;  5GAO n;  3OYL A;  1NZ9 A;  4HCC A;  1VQ6 T;  2LQK A;  3SWN A;  4XU0 A;  3V7R A;  4C92 D;  4C8Q C;  4M77 F;  4CRI A;  2RI3 A;  2KK4 A;  1JB0 E;  3CBP A;  3EFR A;  4QQD A;  3OYE A;  4JS5 A;  1Q86 U;  1VQN T;  5IT9 E;  1Y71 A;  2GF7 A;  4LDX A;  4LDW A;  1X6O A;  2KY9 A;  4X9D A;  3CCV A;  1NPR A;  2R5A A;  2YRV A;  5LJ5 g;  2NLU A;  2G3R A;  5GAN d;  3MEA A;  4ELY C;  1I8F A;  3CCU A;  1VQP T;  3QDR B;  1U1T A;  2FYK A;  4N4H A;  4F7U A;  1N8R C;  3L42 A;  2E5Q A;  4OGE A;  2DTO A;  4IKF A;  3Q1J A;  5FRO A;  2VV5 A;  5HK3 A;  2E41 A;  4OVA A;  5CCA A;  1K9M C;  2MMP A;  4M7A C;  3LLR A;  1BI1 A;  1RL2 A;  3OQ5 A;  4EMK C;  4X9C A;  4A4G A;  3X28 B;  4M78 F;  1B34 B;  3MEV A;  3QSU A;  2R57 A;  3C94 A;  1M1K U;  3MCA B;  3R6O A;  1Q81 U;  1XQH A;  1K8A U;  1M8V A;  5GMK h;  3GF5 A;  3MP8 A;  4RCB A;  2ZPE B;  2XHC A;  3CME A;  2JTM A;  1WQW A;  4FSX A;  3ZEH A;  1Q7Y C;  3JB9 H;  3CXC A;  4JS4 A;  1NJI U;  1UGS B;  3LYI A;  4BDY A;  3HRS A;  2RJD A;  3VUB A;  1JRI A;  4M78 B;  5I21 A;  1R8O B;  4NOY A;  1M1F A;  4QVD A;  5LJ3 g;  2E1H A;  1BI2 A;  3G6E A;  2VGN A;  3OYM A;  1N6A A;  4EMK A;  2D6F A;  2RK2 A;  2R58 A;  2ZPF B;  3EFS A;  2O01 E;  3S3O A;  3DLL A;  3CCR T;  1VQ6 A;  4M7D B;  2EQU A;  2B8A A;  2RI2 A;  3HP9 A;  5CQX A;  2L3R A;  2DO3 A;  3I56 T;  1VQM A;  4JUV A;  1M9S A;  2DZC A;  4J6W A;  1G3S A;  2E64 A;  2PVG B;  4L5G A;  3OYG A;  2Y4Y A;  4JRI A;  1UEB A;  4O6J A;  3SB2 A;  2DTH A;  3LGL A;  5KE2 A;  5I2S A;  3CCE T;  2RB6 A;  4RG8 A;  1Q86 C;  4JRP A;  2GQV A;  5LJ5 h;  3V8J A;  4A4H A;  3BY7 A;  4DA4 A;  2KVQ G;  4BDZ A;  3KBG A;  3GNF B;  4C5E A;  2A7Y A;  2F5T X;  4LDY A;  2RJF A;  3WVE B;  2RI5 A;  4M78 C;  5KCH A;  3CCL A;  2XI9 A;  2QA4 T;  2DXT A;  3INZ A;  3ZBD A;  4BY6 B;  4DOW A;  4ZN1 A;  3JCM g;  2JVV A;  2XG8 D;  4LDU A;  5LJ5 f;  5GAO m;  3F70 A;  1KD1 U;  4N4I A;  3QXE B;  1B34 A;  5GAM d;  3NTH A;  3FB9 A;  2QQB A;  4M7D C;  5DY9 A;  3PGG A;  3A8G B;  1M1K C;  1K8A C;  3QYH B;  5CVI A;  4R55 A;  3LGF A;  5GAN 7;  4C0D B;  3NFC A;  4XQ3 A;  5GAN 2;  3AHU A;  5LL6 S;  2KSS A;  1NJI C;  1FX7 A;  3L1A A;  5KH6 A;  3RES A;  3ASK A;  4MMK A;  5GAM h;  3OYH A;  4M78 A;  3T9N A;  5LJ3 h;  4MZM A;  3G71 A;  2M1H A;  2GFA A;  3CCV T;  3OW2 A;  3I56 A;  1Q82 C;  2DVE A;  4FIB A;  3HRT A;  3PMI A;  2MAM A;  2RHY A;  2QQA A;  4RCC A;  3SDZ A;  5GMK i;  3LH0 A;  3JAM E;  4PL6 A;  3J80 E;  3LWI A;  3CCU T;  4M7D E;  2RM4 A;  4QQG A;  4IUP A;  5GAN g;  4XTX A;  4M7D A;  2FHD A;  5HY6 A;  4BB7 A;  5GAN 4;  4R56 A;  2Y90 A;  2VXE A;  3BFM A;  5LJ3 f;  2KDS A;  5C0M A;  4BY6 C;  4KUI A;  2O4X B;  4UC4 A;  4JRQ A;  3P8D A;  2DIQ A;  1Q7Y U;  3CBM A;  3CEY A;  4XU3 A;  3OYB A;  4ZTF A;  2DXC A;  1WNL A;  1VQ8 A;  2CKK A;  2IVW A;  1OZ2 A;  1VQ7 A;  3GLX A;  1XNI A;  3TU4 K;  4PNO A;  2QTX A;  3CME T;  3VUZ A;  2QQ9 A;  3OS0 A;  3M55 A;  4C0D C;  3S3M A;  3KXT A;  3CC4 A;  4HKE A;  4CI0 C;  3PIP A;  3PTA A;  2ZGW A;  1MHN A;  3J81 E;  5FU7 B;  3OYI A;  1X01 A;  4HA8 A;  3JCM h;  4JDS A;  2K3X A;  4X34 A;  4RG2 A;  4BI8 B;  2HD0 A;  4XTW A;  1KD1 C;  4A54 A;  2LCL A;  1HXD A;  2WSF E;  4LDV A;  3JB9 F;  1LOJ A;  3FDR A;  1W2B A;  1WJS A;  2EJF A;  2K3Y A;  1LJO A;  3V7C A;  4EDU A;  3E9G A;  2K2V A;  3GNG A;  3M59 A;  5J3B A;  4C8Q D;  1VQM T;  5CKB A;  4MZT A;  4J6X A;  1VQL A;  2RHX A;  2DZ9 A;  2PU9 B;  2X4W A;  3OYD A;  3EAE A;  3JCM f;  3GOX A;  2FVU A;  3QKJ A;  3MEU A;  4PJO G;  2PUK B;  4M75 G;  4QQ6 A;  3VKI A;  1KQS A;  1YBY A;  2BIV A;  4O5V A;  4OF1 A;  4B9W A;  4QVZ A;  2F5K A;  1QP3 A;  1WQ7 A;  2WAC A;  5A0L A;  4JLI A;  2JTF A;  1BI3 A;  4ZN3 A;  5GAN h;  1YHQ T;  2BUD A;  4HCB A;  4BI3 A;  4C92 G;  2XIC A;  4M7A D;  4FL6 A;  3CCL T;  5D6Y A;  3CCJ A;  4C8Q G;  3WXM B;  2QQS A;  3L2R A;  3UPU A;  4MDX A;  5FU7 C;  1UGQ B;  4PJO E;  4XTY A;  1YI2 A;  3ME9 A;  4M75 E;  2O4X A;  4Y28 E;  1OI1 A;  3HKS A;  4JRK A;  3NTI A;  2WSE E;  3L2U A;  4IUV A;  2QQR A;  4E7K A;  1NE8 A;  3M4G A;  5GAM g;  5GAN f;  4M7D F;  2RA2 A;  1KQ2 A;  4N4G A;  4C92 E;  2I2L A;  3OYN A;  3FIF A;  4Q5W A;  5GMK j;  1Q82 U;  3HSB A;  3CMA A;  4FT2 A;  2DK3 A;  1ZQ1 A;  2E10 A;  2JN0 A;  4GY5 A;  3RKY A;  3DB4 A;  3SD4 A;  1YJ9 A;  3MEW A;  3G71 T;  3BDU A;  2P0P A;  5A0G A;  3QZ5 B;  4NL3 A;  2E70 A;  5M9O A;  3LW5 E;  4XTU A;  1G3T A;  4M77 D;  5FU6 B;  1JJ2 A;  2V8J A;  1VQK A;  4E7H A;  4J7F A;  5CKE A;  5J26 A;  2A3L A;  4MML A;  3A5Z B;  3MET A;  3QJY A;  2X35 A;  1KHC A;  3OS2 A;  1QVG A;  1RI0 A;  2ZPG B;  4E47 A;  1NPP A;  2K5F A;  4JJN K;  1YIJ A;  2V8K A;  5GAO l;  2DEQ A;  4E7I A;  1I5L A;  1FWZ A;  1X75 C;  3FEO A;  3VV0 A;  3E19 A;  5CIU A;  1YHQ A;  3C4S A;  4C0G A;  1VQ8 T;  1U8R A;  2OTL A;  1VQ7 T;  2CZ0 B;  2JUF A;  4M77 G;  5CO7 A;  1QW1 A;  4LD9 K;  4M78 D;  4BAC A;  3M54 A;  3RER A;  1Y07 A;  5LJ5 j;  3CC4 T;  4N0A C;  1W2B S;  3L2Z A;  2LX9 A;  4KBM B;  2P0K A;  3V7S A;  5CAI A;  5CKD A;  1QP2 A;  5GMK e;  3KUF A;  5CR2 A;  1KQ1 A;  1KG1 A;  3A8O B;  3S3N A;  1YCY A;  2DD4 A;  3OYF A;  3G4S A;  2CYZ B;  5FU6 C;  3A8M B;  5GAO p;  4ZTJ A;  2E6N A;  3OYY A;  2EQJ A;  1Y96 B;  1KQS S;  1D3B B;  1GXI E;  4B9X A;  3JCM c;  5J39 A;  3UWN A;  3E9F A;  5A0D A;  1VQL T;  2EKO A;  4QVC A;  2E12 A;  3H6Z A;  2RH2 A;  1Y7X A;  4ATO A;  4N0A A;  3PFS A;  3MHX A;  4PJO F;  2RK1 A;  4L59 A;  4BD3 A;  3JCM X;  1YJN A;  4KUD K;  2CZ1 B;  4M75 F;  3CCS A;  1M90 U;  3V8L A;  5DM7 R;  3CCQ A;  5FRM A;  4RKU E;  2K5I A;  2VUB A;  5LJ3 j;  3OMG A;  3QII A;  3N5B B;  4A4F A;  1YIT A;  5GAM f;  2YLB A;  3FLG A;  4L6V 5;  5DLQ E;  2DAQ A;  3CXC S;  4PJO B;  2EFI A;  4XK8 E;  4C92 F;  2XD0 A;  3QHS A;  2EYQ A;  3QPH A;  4KUL A;  2LRQ A;  4M75 B;  4VUB A;  3RMQ A;  5C6S A;  5LJ5 e;  2DXU A;  4C8Q F;  2EIF A;  3QUI A;  2CZ6 B;  5CKF A;  3FJP A;  3C95 A;  3CCJ T;  2EQK A;  1WJR A;  2HAX A;  2MF2 A;  1YI2 T;  2CS7 A;  3CD6 A;  1O75 A;  1K73 U;  5KCO A;  3SFM A;  2OAU A;  2P0Q A;  1UB4 A;  3QG1 A;  2L89 A;  4BE2 A;  1W4S A;  2DPP B;  1S72 A;  5D6X A;  4C92 B;  1WJQ A;  1XOV A;  5HK0 A;  4C8Q B;  2XK0 A;  4J5Y A;  4XU2 A;  1HK9 A;  3OYA A;  2VC8 A;  2RHI A;  1N9R A;  5GAO q;  2HBP A;  4OB2 B;  2LNV A;  3M5A A;  3G7Z A;  5GMK l;  1YJW A;  3CMA T;  4BUG A;  1VQO A;  2JOY A;  1KHI A;  2PVD B;  4XTV A;  4C5G A;  4DQ2 A;  5FRN A;  3O8V A;  2RO0 A;  1P92 A;  1VQ5 A;  1YJ9 T;  1I81 A;  2DXB A;  2PVO B;  4A53 A;  1ZBX A;  3NTK A;  2HQX A;  4FM4 B;  3JCM W;  5GAN 5;  3HRU A;  1H64 1;  2ZPB B;  3JSC A;  1VQK T;  3RKX A;  2HNI A;  1M1G A;  2EAY A;  5LJ3 e;  2QXF A;  4C0F A;  1Y96 A;  3J7A F;  4PJO C;  4HCZ A;  1D3B A;  2CGH A;  3L2V A;  4E7J A;  3URG A;  4OB1 B;  4M75 C;  3X25 B;  4PLI A;  3HHT B;  5GMK m;  3I55 T;  1ZHI A;  3M58 A;  4EPC A;  1YIJ T;  2X4J A;  4TVR A;  1O9S A;  3OSS C;  1BYM A;  3RKW A;  2RJE A;  3CCM A;  3DLM A;  2V8I A;  3OB9 A;  3VU3 C;  4F7U G;  4D6W A;  3MP6 A;  3P8H A;  4BI4 A;  3DB3 A;  4C5H A;  2C06 A;  1M90 C;  2XDP A;  4OB0 B;  4C92 C;  2EJG A;  2OTL T;  3OS1 A;  2KQW A;  3JRZ A;  4NS5 A;  3JCM J;  4V2S A;  2XU8 A;  2L5Q A;  3JCM b;  3OYC A;  1IZ6 A;  2XKO C;  3FC3 A;  4PJO A;  2OTJ A;  3HL8 A;  2EWN A;  2K57 A;  1FXX A;  4J8O A;  4M75 A;  2PQW A;  4BE1 A;  2DTI A;  3ZFJ A;  3GPL A;  1KC8 U;  5GAN j;  4ZGE B;  3H8Z A;  3PNW C;  1VQ4 A;  4F7U E;  1AHJ B;  4M77 B;  2DKG A;  3JCM P;  3ER0 A;  3G4S T;  3OW2 S;  1G3Y A;  2LVM A;  1H3Z A;  1K73 C;  4OP0 A;  2Y4X A;  1V29 B;  2K4Y A;  4IUR A;  4C92 A;  1UGR B;  4C8Q E;  4E7L A;  1VUB A;  5CKH A;  3JCM e;  4C8Q A;  4MDW A;  3QYG B;  3M53 A;  3OS5 A;  4M7A G;  2QEX A;  1PSF A;  2XID A;  4KT0 E;  1JBM A;  1PSE A;  3E1S A;  3JB9 D;  1TH7 A;  1VIE A;  3A8H B;  4ZGJ B;  1BIA A;  3L2W A;  1U1S A;  1YJN T;  1M4Z A;  4J6Y A;  4PKC C;  3CCS T;  3DKM A;  1LNX A;  4LD6 A;  4MZP A;  5I2M A;  3CCQ T;  3JB9 J;  2FL7 A;  3M56 A;  1I4K 1;  3QBY A;  3GP8 A;  3CC7 A;  4XTZ A;  3I55 A;  1YIT T;  5GAN 8;  1OYX A;  4XU1 A;  3UT1 A;  4M7A E;  3HFO A;  2PUO B;  4M7A A;  4FT4 A;  2K5L A;  2ZPH B;  5GAN 3;  3CC2 A;  1XTD A;  1QVF A;  3UDC A;  3C12 A;  2L8D A;  2IG0 A;  4J83 A;  4Z02 A;  3JB9 G;  4M77 C;  5GAN e;  3CD6 T;  4XAX B;  1VQN A;  2HQE A;  2ZZD A;  4GLK A;  5GAN 6;  4RMO A;  5GAO r;  1VQ9 T;  1S72 T;  1DJ7 B;  5LJ5 d;  3CPW A;  2X4Y A;  3RMS A;  3TEE A;  3OMC A;  3M9Q A;  4J7I A;  5IAY A;  3M57 A;  4P5N A;  4ZGD B;  1VQP A;  2MI6 A;  4IUU A;  2LDM A;  3TRE A;  4FU6 A;  2JNG A;  1YJW T;  1SSF A;  2CZ7 B;  4OGC A;  3A8L B;  3RUX A;  5DLO A;  3PMT A;  4OB3 B;  1VQO T;  4OMF B;  1KC8 C;  1MGQ A;  1VQ5 T;  2EQM A;  4M77 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...