4FL6A

Crystal structure of the complex of the 3-mbt repeat domain of l3mbtl3 and unc1215
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
314
structure length
309
Chain Sequence
AWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title Discovery of a chemical probe for the L3MBTL3 methyllysine reader domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 309
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A01
5C6SA 3MP6A 3P8DA 5KE3A 3OMGA 4IUTA 4A4EA 4C5GA 4B9XA 3MO8A 3OYIA 3OS0A 4N4IA 3MEUA 3P8HA 2LRQA 4IUPA 2WACA 2LTOA 2PQWA 3FLGA 4PLLA 5KE2A 3MP8A 2HQEA 2X4WA 2LDMA 3OA6A 4II1A 2P0KA 3GOXA 3OYAA 5M9OA 3OYMA 2EKOA 3OYLA 3L2WA 2GFUA 2QQRA 2JTFA 3OMCA 4PLIA 4QQDA 3ME9A 4FL6A 4E7HA 2X4XA 2K3YA 4GY5A 2X4YA 4CRIA 3DB4A 2VYTA 4UC4A 5C0MA 2M1HA 3FC3A 3OYKA 2DIGA 2R5MA 4QQGA 4BE1A 3M9QA 3E9GA 3OYGA 5IN1A 1OI1A 5D6YA 4C5IA 3S3NA 4QQ6A 2BKDN 1WJSA 3FEOA 3L2UA 2F5KA 4BE0A 3OYCA 5KCHA 3F70A 3META 2O4XB 2RHYA 4E7LA 3S3OA 2M0OA 2EQKA 4B9WA 3LGFA 3PMTA 5IAYA 1SSFA 2NLUA 2XK0A 3OYEA 2YRVA 4N4GA 4EDUA 2L8DA 3DLMA 2MWPA 4ZTJA 3L42A 3S6WA 2RI2A 4A4GA 2L89A 2RHZA 4IURA 4HCZA 2GFAA 4X34A 2E5QA 3LYIA 3PFSA 2RJCA 3UWNA 1WJRA 3EAEA 4A4FA 3KUFA 3Q1JA 3DB3A 5KH6A 1KHCA 1G5VA 3OB9A 3PNWC 2R58A 4RG2A 3QIIA 3UT1A 2RHIA 3H6ZA 4Z02A 1RI0A 2R5AA 4IUVA 2JZ2A 3OY9A 2L3RA 1OZ2A 2RHXA 4PL6A 2LCCA 2HQXA 3LGLA 2X35A 3LX7A 2O4XA 2XDPA 3H8ZA 2RJFA 2G3RA 2EQMA 3LH0A 1H3ZA 3NTKA 4IKFA 2RJEA 2RI5A 4C5HA 3OYDA 3E9FA 4OVAA 4Q5WA 3OYHA 1XNIA 3MEAA 2RI3A 5D6WA 5CIUA 2DIQA 2CKKA 4BD3A 3OYNA 5FRMA 3QJ6A 2QQSA 2LVMA 2D9TA 2FHDA 3PMIA 3L2VA 2EQUA 3ASKA 2E6NA 3FDRA 2BIVA 2EFIA 2BUDA 4BACA 2K3XA 3NTHA 2MWOA 5FROA 3ZEHA 4E7JA 4E7IA 3L2QA 2GF7A 2EQJA 4BDYA 3QBYA 2RJDA 4ZTFA 4A4HA 2IG0A 5FRNA 1MHNA 3BDLA 3LLRA 4NS5A 1WGSA 3S3MA 2RO0A 3C4SA 5D6XA 3MEWA 3OYFA 2M16A 3OS2A 4LD6A 3NTIA 3OYJA 1OZ3A 5KCOA 4N4HA 4E7KA 5J39A 4FU6A 3SD4A 3CEYA 4IUQA 3L2RA 3MEVA 4BDZA 4QW2A 5J26A 1WJQA 1OYXA 3O8VA 4C5EA 4QVZA 3OQ5A 2DAQA 1N27A 2R57A 3MP1A 4L59A 3QKJA 2B8AA 3OYBA 4IUUA 4BE2A 2RHUA 3OS1A
chains in the Genus database with same CATH superfamily
3SDZA 4C0ZA 2VASA 1SRLA 1VUBA 2QI2A 2K5FA 2ABLA 2PQWA 4XAXB 2JTEA 1K76A 2CSIA 4HCKA 4XTXA 3ME9A 1K9MU 2F2XA 2RMOA 1TG0A 3CC2Q 4M7AG 2FL7A 4C5IA 2DO3A 4FSSA 1RAEB 5HY6A 4C92E 1KD1U 2KYMA 1V76A 4BE0A 2KBTA 3RESA 4M7AC 3S3OA 3M5AA 4NOYA 1JXMA 2E4HA 1MMNA 4J9GA 2JM8A 5GAN5 1I81A 1QLYA 3CC4Q 3EAEA 1JU5C 1UEBA 2DMOA 5KH6A 1G5VA 4B6MA 5AYFA 1PWTA 3G6ET 1SSHA 3RKYA 1RAAB 3LX7A 3CBOA 3H8ZA 3QWYA 2DZCA 2RI5A 5I11A 1RADB 3E1SA 2VC8A 3M0PA 2NUPB 1YBYA 2D9TA 2D6FA 3ASKA 1D0ZA 2EFIA 3REBB 1OU9A 4CC3A 3ZEHA 3TQ7P 4C92B 2QEXT 1D1BA 2WSEE 2DVEA 1YJWT 4OMFB 5D6XA 3MEWA 4M78A 2V8IA 3FJ5A 1P92A 3OS2A 3UF4A 2ZPFB 5KCOA 2V1RA 3SD4A 3CCRA 3RIRA 3CPWS 2EIFA 1OPLA 4JRQA 4BDZA 2CP6A 3CCQT 4L59A 4OMLA 2OTLA 3M59A 3J7AF 1X43A 4EPCA 4XU3A 3OMGA 1AWJA 1M90C 2KMTA 2C0TA 3MEUA 3P8HA 1M8MA 2P0PA 2NUTA 2HL5C 3CC7A 1AZGB 2JTFA 1D1AA 2J6KA 1M3BA 2MI6A 3M58A 2M9UA 1VOMA 2L3PA 2A37A 4KRTA 2QQAA 4C8QD 2PVOB 3FEOA 3CCVA 1KK7A 4M7DD 2DL4A 1VIEA 1KC8U 1X6BA 2COZA 1VYVA 4A63B 3HRUA 1YJ9A 3CD6A 2HNIA 2L89A 1T0JA 3CCRQ 4PNOA 3TEEA 1HXDA 3JCMQ 1TTHB 2DVJA 4ZNXA 5HKCA 4R0KA 1VQ6T 3PVLA 2QXFA 4M75G 2HQXA 1G3SA 1BK2A 2CUBA 2KRMA 5L23A 1SEMA 1D1CA 4J9EA 4C5HA 2JS2A 2ENMA 4M75C 2CUDA 2B86A 3MEAA 3CC7Q 1ZSGA 1G8XA 4DA4A 3G1JA 2MIOA 2HEQA 5KYWA 4ZTFA 1KQSP 3EFRA 3JCMW 2K5IA 3CCVQ 2J7IA 4AFZC 2M16A 1YNZA 3CCLA 1W2BS 4N4HA 5LJ3e 2KGTA 5J39A 3KFVA 4IUQA 5GAN7 4M7AF 3GBQA 1YJ9Q 3O8VA 1YP5A 4ANJA 4JRKA 2R57A 2EYXA 1EFNA 5DY9A 2M0YA 1K9AA 2PZ1A 2O9SA 2LQNA 2RM4A 3JCMe 2F2VA 4A4EA 5FU6C 4N4IA 4LNPA 3G71Q 2PVDB 3V8LA 1VQLT 2CS7A 3X20B 4C0DB 5M9OA 5GAOl 2GFUA 2QQRA 4RTXA 3V8JA 1LVKA 1UDLA 2E70A 2LJ0A 1VQKA 3DB4A 3HTRA 3CMAA 1TH7A 4OMMA 5EG2A 4QQ6A 2BKDN 2LQKA 1VQOA 1GL5A 2MAMA 1N6AA 1OPKA 4NL2A 3G71T 4JRIA 2GTOA 2DRKA 4BI4A 3LGFA 3PMTA 3QPHA 4KH1B 2E3HA 4FYXB 2DILA 1M8VA 4LN2A 1NM7A 1VYUA 3CCLQ 3D7SB 4F16A 3VV0A 2FPFA 3PIOA 1PG5B 1OEBA 3UWNA 4JZ3A 2RB6A 3LH5A 3EG9B 4WCIA 2JMCA 3EHQA 1RI9A 3CCEA 2DBKA 5GAN8 1YI2A 1YIJQ 2O4XA 1DJ7B 4E6RA 2RJEA 3RKXA 4OVAA 1EIFA 3RMSA 1Y71A 1XNIA 3CCLT 1VQ5Q 2D0QB 2EQUA 1VQKQ 5A0GA 1M30A 2C0IA 1ZUUA 3CMAQ 3M0RA 5KYYA 4AG2C 2DXUA 1ZX6A 2HMAA 1VQOQ 4LXCA 4RTYA 3INZA 1YIJT 3EGDB 1YFNA 1JBMA 3R6NA 2E5KA 1VQ5T 1N8RR 1OYXA 3MP1A 3HFNA 1J3TA 2YDLA 5C6SA 3M53A 2NWMA 1WXBA 3VS1A 2A3LA 3CMAT 1B34B 1YWOA 2QYZA 3HRSA 3VKIA 4MDWA 1YN8A 2XDBA 3RNJA 3X28B 3X24B 2H3JA 2EGCA 3FLGA 2DTHA 4OB2B 3ER0A 4R55A 4LDVA 2KEAA 1YI2Q 1W70A 2YRCA 4PLIA 2ZZDA 4J6XA 3JCMf 3M54A 1E7OA 2E1HA 2XU8A 3OSVA 4KH0B 3E9GA 4C92D 3CCJA 2CREA 2FEIA 1Q86U 1Q7YC 1NYFA 3L2UA 2DZ9A 1RACB 2O4XB 2JNGA 1VQ9Q 1H3HA 1D09B 4OMOA 4J7FA 3BDUA 5FU7C 1YI2T 4C8QA 5IAYA 3OYEA 2DNUA 3DLMA 1Q81U 4M7DA 4FSXA 1BCMA 4CI0C 4JZ4A 1X6OA 3I5SA 2K2MA 3EHRA 4A4FA 4PJNA 1M27C 1WLPB 1IHVA 3QO3A 5LJ3h 1YJNA 4IUVA 3TSZA 1FX7A 1WA7A 1QW1A 1VQ9T 4C8QE 2WSCE 2EQMA 1N8RU 4J9DA 3JCMh 2RQWA 3QJ6A 4MZPA 2FHDA 4VUBA 2ZPHB 1Y96B 2P4RA 2D1XA 3ZL7C 2OI3A 3MJXA 2H8HA 5GAOq 5FW9A 4FT4A 4XU0A 5GANg 4O6JA 2FYKA 3CPFA 3OBYA 5CK9A 2QAZA 2VXEA 1X01A 2Y90A 3WVDB 2DL8A 2V1QA 4QVZA 2DAQA 5CAIA 2FPEA 3I35A 2K57A 2PUOB 5LJ3j 1B3QA 4Z8AA 3VS7A 2JXBA 2KDSA 1LCKA 3VS6A 2DTOA 4M78F 1W4SA 3PIPA 1YJNQ 3GF5A 4C8QB 3JRZA 2L5QA 3UATA 4F7UE 5IT9E 4PJLA 3QWXX 2E3IA 3UDCA 4L6V5 3QXEB 3FJPA 4ATOA 2FRYA 3FC3A 4QQGA 1CSKA 3OS5A 3EG1A 1IGQA 1JJ2P 1MV0B 1PRLC 1NEGA 1YITT 2F5KA 5GANd 3VYHB 2AZSA 2A28A 2QQ9A 5IXBA 2L0AA 2ROTA 5GMKl 2K7AA 1I1JA 1PHTA 5A0LA 3SWNA 1X2KA 5DLQE 2RI2A 2KT1A 2HL3A 5CQXA 5GANf 3H41A 1D3BA 3KUFA 5LJ5d 2RQTA 5FWBA 2RHIA 3C95A 5LL6S 4XTWA 3OY9A 3HKSA 4J9HA 4J8OA 1M90R 1W6XA 1QVGS 2XHCA 5HK3A 3X26B 4F7UB 2AK5A 2MOXA 1TS9A 3GPLA 1XQHA 1AWOA 4CC7A 2FB7A 2CP2A 3V7RA 3L2QA 2DLPA 2YUNA 2XICA 1QWEA 1LPLA 4MZTA 2D0NA 1QVFS 1M2OA 3BW1A 1IB8A 1IGUA 1TUDA 4HVVA 3JCMb 5L8RE 3JB9D 5GJVB 4FIBA 3M0TA 5GAOm 1WJQA 3RKWA 2DL5A 4AMCA 2LT4A 3VS2A 2RF0A 3OYLA 5KE3A 3G6EA 1M1GA 1TU0B 1WIEA 3BFMA 2O9VA 1NLOC 3OSSC 2E41A 2K4YA 4ME7A 2IVWA 1Q82R 3ZFJA 3J80E 4PJJA 3VUZA 2DJQA 2DRMA 4UC4A 3OYKA 2NUPA 2KY9A 3C12A 3URGA 2QEXA 1UGVA 2A36A 1YJWA 4Y92A 1C1AA 3HFOA 4C92A 1C0MA 2GNCA 2G6FX 1UGQB 5KYNA 2L3QA 5GAMd 1PRMC 4J9CA 3WXMB 3VS0A 3CCQA 3G7ZA 1K8AC 1WPYA 3LWHA 2EGEA 4BY6C 2GQVA 5CCAA 3I56T 2YLBA 4IIMA 2LQWA 4F17A 3JB9J 1FWZA 5CKHA 2L3RA 3G6EQ 3JCMc 5CR2A 3I9QA 3EGXB 4M77D 2LVMA 4M75E 2DBMA 4DOVA 1M1FA 1ZSZC 4KULA 1IHWA 1MV3A 1YHQT 1B7TA 1U5SA 4E7IA 4JJNK 2LMJA 2RD1A 3A8MB 4A4HA 1SHFA 3BDLA 1Q82U 4NS5A 2QEXQ 3C4SA 1YJWQ 3GIBA 2I0NA 4IIOA 1M1KC 2YUOA 3JSCA 3RMQA 3CEYA 1SRMA 2KR3A 2QA4A 2EAYA 1NEBA 1BU1A 3DKMA 3CCQQ 3AHUA 1WZOA 3KBGA 1TOVA 4FT2A 5FLXE 4BE2A 1VQ6A 2CZ7B 5I21A 1IXDA 3MO8A 3OS0A 5IHIA 5HK0A 4DEYA 3TU4K 2XD0A 2EYQA 4XU1A 2HSPA 3QYGB 2MF2A 2HQEA 2X4WA 3SHWA 2YT6A 1WHLA 3FB9A 1PM3A 1WHKA 4AG1C 4PJOE 1AZEA 2KRNA 4M75B 1NJIC 1WX6A 2PUKB 1WNLA 1FMKA 2DEQA 2CZ1B 1UHCA 2IPOB 4J9IA 1GBRA 2BE7D 1T0HA 3QG1A 1NG2A 3TVTA 1WI7A 3CCUT 4K11A 4BB7A 2XK0A 3FIFA 1XJWB 1OU8A 4OMQA 3L2ZA 1OX9A 2SRCA 2XG8D 2QA4Q 1U8RA 1IO6A 4J6WA 3EGUA 2QG9B 2LCSA 2O01E 3HRTA 4EMKB 3JB9I 1VQ6Q 4XK8E 1RI0A 2QTVA 3M0SA 2OJ2A 4X9CA 2VKNA 4XTUA 4C8QF 1VQLA 4FW2A 2FZCB 2HSEB 1I8FA 5FU6B 2MYSA 4M7DF 3E9FA 4LDYA 2V8KA 1XTDA 1VQ7Q 2LCLA 3CBMA 1BIAA 1K9MC 2QQSA 1M3AA 5I2SA 3GNFB 4PJOB 2QA4T 1UHFA 2HCKA 3VS4A 3CPWP 1BKBA 1I5LA 1KIKA 2FZGB 4E7JA 2AKLA 3G71A 2RQRA 1H92A 2RO0A 1K1ZA 2K5LA 2GQIA 1WHGA 1Q7YR 2ZCFB 4C92G 4FU6A 1UGSB 1VQ7T 2CP3A 3V7SA 4JUVA 3OQ5A 2GGRA 4C92C 3OYBA 1JXOA 2RHUA 3N5BB 1V29B 3BE3A 3MP6A 1K0SA 1PCXA 2DM1A 3G4SQ 3EG9A 4B9XA 3I5RA 1YWPA 4KUIA 2LTOA 3VU3C 4RTTA 1V1CA 4XU2A 1RAIB 1VQLQ 5GMKm 1AD5A 4ZGEB 2V26A 2RQUA 4BUGA 1SKUB 1QQJA 1E6HA 2RN8A 3I55T 2LQ8A 2AT1B 4Z88A 3G4ST 1QP3A 3JB9H 3OW2A 5GAN4 1SG5A 1YIJA 2EGAA 2LT1A 2OTJQ 3PT9A 1ZA1B 3HP9A 3H0IA 3EGDA 1VQ5A 4ZTJA 4LDUA 5D7UA 2RJCA 2COWA 3Q1JA 1AT1B 2Y4YA 2K9GA 2P0QA 4Y28E 1NLPC 4AFUC 2GTJA 2J05A 4PFOA 1Q7YU 1HSQA 2DPPB 2OAUA 3HPWA 3EG2A 1B34A 4JDSA 1JB0E 2D8HA 2OTJT 3LH0A 2BTTA 3NTKA 4IKFA 4M78G 2CT4A 2DXTA 6AT1B 3LWIA 4MDXA 1W2BP 2VGNA 1LOJA 3P8BB 2BE9B 4M78C 4M77A 4HT9A 2KSSA 2LNHB 4HVUA 3CXCS 4KGXB 4L5GA 1KC8C 3A8OB 3H0HA 4A54A 1QVGA 1OZ3A 4JRPA 1PKSA 4J6YA 5FU7B 3HSBA 4C5EA 2DYBA 2B8AA 4OF1A 4M77E 3THKA 5HCKA 2LX7A 2MPXC 1E6GA 2ESWA 1VQ9A 1VQ8A 2X3WD 1QVFA 3MKDA 1GBQA 3L2WA 2YUPA 3OMCA 1ZHIA 4JJBA 4OB1B 5I2MA 3R6OA 1X2QA 3UA7A 4BE1A 4XTYA 5CKDA 4XTZA 1Y96A 2EWNA 3M0UA 4OP0A 4X1VA 2GBQA 1VQ4A 2ATCB 1TUCA 4D8DA 3VRZA 2HQHA 2ZPGB 4TVRA 1NYGA 1QCOA 1W1FA 2RHZA 2X9HA 4JLIA 2AZVA 1WJRA 1OV3A 2DX1A 4M77B 3QZ9B 1O75A 2BZ8A 2EYYA 2R58A 1UJ0A 5GANe 2LP5A 4C92F 3LGLA 2AKKA 3VYGA 2X35A 2XI9A 3U23A 1G2BA 1VQ8Q 1S1NA 1M2VB 1T3SA 2X3XD 4M75D 1M3CA 1Z9ZA 3OYHA 1K73C 1Y57A 2ED0A 4BD3A 4WF2A 1HJDA 3QYHB 2CSQA 2YWWA 3HL8A 1ZA2B 2DF6A 1YITA 4BI3A 3JCMP 1M9SA 1R77A 3NHNA 1RLPC 2RJDA 4F04B 2MCNA 3JAME 2EQIA 4BI8B 1VQ4Q 4LD6A 5CKEA 1VQ8T 3M4YA 2BZXA 3L2RA 8ATCB 1H8KA 4A4KA 3EG0A 1A0NB 1GXIE 1K8AR 3OS1A 3FRNA 1MMGA 2JVVA 5KYUA 4IUTA 4EMHA 2JOYA 4C5GA 2DA9A 4XTVA 4RKUE 1HK9A 4ZN3A 4ZN1A 1QKXA 1TUGB 1WHHA 5KE2A 1VQ4T 1WFWA 4PJOD 1FMVA 3A8LB 3A5ZB 1N9RA 2EBPA 4OGCA 1JJ2S 4OB3B 1KSWA 4F7UA 1KFZA 1YCYA 1OQKA 2VYTA 3EFSA 1TWBA 1OI1A 1MUZA 5LJ5g 1WHMA 3CCMT 4O5VA 3BY7A 1YITQ 5CO7A 2F69A 1WDXA 5J3BA 3OW2S 1X75C 3META 4RCBA 1K0XA 1EZZB 4N4GA 2XMFA 1M1KR 1R0BG 3VS3A 1NE8A 2RH2A 2QGGA 4ZGJB 3MCAB 1AWXA 4C0FA 2JW4A 3L1AA 4RG2A 1O9SA 1BI0A 5EC7A 1JRIA 2RHXA 4PL6A 2KVQG 1VQNT 1IRXA 2E12A 3CCSQ 3PE0A 1U3OA 1JQQA 3RDVA 4RCCA 5A0DA 2ZPIB 2C06A 4M7AE 1S72Q 1VQPT 1ZUKA 2GCXA 1UECA 2E6NA 2XKOC 2JN0A 4N0AA 3TSWA 3FDRA 4PFZA 1Q86C 5KYUB 2XDDA 2YHTA 4ESRA 2VUBA 1UGRB 1MHNA 2LJ3A 1UGPB 2KK4A 1MMDA 1X27A 2ROLA 4OGEA 5CKFA 3CCST 1WHJA 3QSUA 1Y0MA 3ULRB 5LJ5f 1Q81C 4LUEA 1I0CA 1BI1A 1FYNA 2DERA 1S72T 3I56A 1KQSA 4ELYC 3NGPA 3JCMV 2CP0A 4LUDA 2ZPEB 2DYIA 2LRQA 2C0OA 9ATCB 5GAOp 1UTIA 1M1KU 2ZPBB 2EPDA 2Z0WA 1N8RC 1JO8A 2LDMA 5GAMg 4M7AB 2X4XA 2K3YA 1QP2A 3EGXA 5IHKA 2SEMA 4E47A 1HD3A 4C8QG 5GANh 3JB9F 3JCMJ 3EFOA 1T3LA 5GJWB 1YHQA 3M9QA 1K9MR 4M7DG 2Y4XA 2DK3A 2HZYA 4C8QC 1ZSZB 1GCQA 4HVWA 3OYCA 3M55A 4M7DC 2DKGA 4EIKA 4HXJA 4QVCA 2M0OA 2EQKA 3HHTB 2K2VA 5GAN6 3IQLA 5LJ5h 2YRVA 2LC4A 1NPPA 2L8DA 2E64A 3L42A 3S6WA 4RTZA 3QDFA 3I56Q 1WYXA 3DB3A 3PNWC 4F14A 2JT4A 3QIIA 4M4ZA 1LNXA 4JLGA 1G83A 1CKBA 1Z9QA 3RBBB 1M90U 2P84A 1QMCA 4LDWA 4E7SA 2RJFA 2L2PA 3OYDA 4DOWA 5GANj 4AFSC 2QK0A 1QVFP 3PMIA 1UUEA 4FW1A 2BIVA 4M75A 4RTWA 5GMKi 1YHQQ 1EX4A 3CMEQ 2EW3A 5GAMf 4JPBW 3DLLA 3LLRA 1RL2A 4X9DA 5LJ5j 3CCUA 1I5OB 3M4GA 1ZLMA 3A8GB 2J6OA 2FRWA 1BI2A 2JJ9A 1C6VX 2YRDA 1ABQA 4QW2A 1N27A 1OX8A 3EFOB 1QCNA 3SB2A 4M77F 4IUUA 1RUWA 4RTVA 4CC4B 3P8DA 4RG8A 5IH2A 3CMET 5FWCA 4EMKA 1PNJA 3CXCA 2VB6A 4FYWB 2WACA 1U06A 2P0KA 3GOXA 2EKOA 5A2QE 5CKBA 4QQDA 2CDTA 2DFUA 2EYZA 1Q95G 3A1PA 1BYMA 4FYYB 1ZQ1A 4PJOA 3CC2T 4FM4B 5GAMh 3SWNC 4Z89A 2K79A 5KCHA 4E2FB 4LDXA 4N0AC 1UB4A 3RR6A 3CCUQ 1SSFA 1VQ7A 3O5ZA 1KC8R 2JUFA 1RABB 1SF9A 3SFMA 1D0XA 2F5TX 2GFAA 3KXTA 3LYIA 3CC4T 2QQBA 3MPUB 2I2LA 2M51A 5GAOn 2XIDA 1KHCA 4E7ZA 2JM9A 3OB9A 3VS5A 4Z02A 2ZAEA 3QUIA 1OZ2A 2HBWA 5GAN3 1IREB 3ZBDA 2OAWA 2O88A 2LX9A 2DL7A 3VRYA 1M4ZA 1WXUA 1WQWA 4Q5WA 5D6WA 2DIQA 3OYNA 1HYOA 1U1SA 4DBHA 5GAMj 3I55A 1KJWA 1LJOA 3C0CA 3QHSA 4DQ2A 1VQMA 4BACA 3G4SA 2V8JA 2FG0A 4NL3A 4BDYA 4M78E 3M56A 3M0QA 1BCOA 5CVIA 3VJPA 5AT1B 3GLXA 4HCBA 8AT1B 1GCQC 2K6DA 3QKJA 3H9NA 2ECZA 1KQSS 1G3WA 1GCPA 2KNBB 1OULA 2COYA 2LZ6B 1KD1C 4MMLA 2FO0A 3JCMX 1NBEB 2OTJA 2CYZB 2EJ9A 2JTMA 3OYAA 3OYMA 1QWFA 3OYYA 1KQ2A 1XOVA 2AIRB 3NFCA 4FL6A 2VV5A 2DJZA 2QDLA 2X4YA 4J83A 1ZUYA 1K73R 1BI3A 2DEUA 2OTLQ 2K3BA 5IN1A 4ELZC 3I55Q 1QCFA 1VQMQ 1Q82C 4M78B 2RHYA 2BZYA 5DLOA 3NPFA 4QT7A 4EDUA 4F7UF 2VVKA 4QKUA 1JJ2A 3CCRT 2E5QA 2P4TA 4OMPA 3TREA 2O31A 2OTLT 2DTIA 3UA6A 1R0CB 1FXXA 1I4K1 1VQMT 2X4JA 3VUBA 5I22A 3PTAA 1GFCA 3H0FA 2NUTB 2JZ2A 4JS4A 4ZGDB 2OX7A 2YXYA 2CT3A 1SPKA 5IXFA 4M7AD 2G3RA 4DBRA 2J06A 2KYBA 2RQVA 3CC7T 2H3EB 2RI3A 3NMZC 4FCYA 3CD6Q 4EMKC 5FRMA 4QVDA 2MWOA 2QTXA 2KXDA 4J5YA 4PJOG 2IG0A 2CZ6B 3CCVT 3WVEB 3RERA 4PJOC 3EH1A 1K73U 4RTUA 2EVRA 1YJ9T 3CD6T 1WXTA 4JJDA 3EG3A 4HA8A 2AHJB 3REAB 2EJFA 4GBQA 4CC2A 2RPNA 4MMKA 1U1TA 3QJYA 4R56A 4RUGA 3SEMA 2WSFE 1N9SA 4D8KA 4IUPA 4YTLA 1PD0A 4J7IA 4PLLA 2ED1A 7AT1B 1FMWA 2DXBA 1PSEA 1M2VA 4HKEA 2A0FB 2HKQB 5LJ3g 4E7HA 2LNVA 2RK1A 4CRIA 2F1LA 2M1HA 2R5MA 3TCJA 5KYWB 1OOTA 5GMKe 2FZKB 3JCMg 1AEYA 2KROA 2RNAA 1Q86R 2D8JA 2HD0A 4ORZA 4LD9K 1CKAA 2EKHA 5GAOr 2PNIA 1BBZA 4A4GA 3GP8A 4HCZA 1GFDA 4X34A 3PFSA 4A53A 1Q81R 1WQ7A 4OB0B 1PSFA 3V7CA 5DM7R 3UT1A 3H6ZA 2CP5A 4HCCA 1YCSB 4J9BA 4C0DC 1MGQA 2LCCA 2NYSA 2E65A 1UE9A 1RAFB 2QASA 1H641 1H3ZA 2DL3A 3CXCP 5LJ3d 4WTOB 3E2UA 1B07A 3QZ5B 3V8KA 4AFQC 2CZ0B 1VQKT 4MZMA 3A98A 1D0YA 3RUXA 2JS0A 4KGVB 3CBPA 3NTHA 3CCMA 2L3SA 5FROA 3PVQA 2A7YA 1NZ9A 2GF7A 2EQJA 3JCMd 1ABOA 1VIFA 3T9NA 3JB9G 5LJ3f 1VQOT 1ZBJA 2KT8A 3S3MA 1F1BB 3CCEQ 1UG1A 1PC0A 2W0ZA 1K4US 1UFFA 1ARKA 2FPDA 4M75F 2JMAA 5LJ5e 3X25B 2CH4A 3A8HB 2YUQA 1KG1A 3E19A 2DE0X 3GNGA 4PJMA 4LE9A 1VQNA 4DEXA 3J81E 3CCET 2KRSA 3C94A 3MP8A 4GLMA 2NUZA 1BB9A 4PKCC 1VQPA 5C0MA 1GRIA 2MMPA 5GAN2 1ACMB 2DIGA 3OYGA 4KBMB 5CQYA 5D6YA 5KYYB 3CCMQ 4GLKA 3CCSA 3F70A 2EJGA 4B9WA 5KYXA 1MNDA 3JV3A 4M7DE 2O2OA 2A08A 1PKTA 2MWPA 1S72A 4C0GA 4IURA 2CGHA 4PJOF 3CQTA 4V2SA 2PVGB 1KQ1A 3CCJQ 2DD4A 2YLCA 2PTKA 4EMGA 1RLQC 1VQNQ 4M77G 2XDPA 2KQWA 1QKWA 1G3TA 1M5Q1 3UPUA 1TXQA 4M77C 5CIUA 4DBFA 3OBWA 2M02A 4M7AA 3MHXA 4DBQA 1VQPQ 1I07A 2PU9B 4M78D 2K3XA 3CCJT 4JJCA 4PK4A 5FRNA 2VXFA 2W10A 1ZSZA 2HDAA 4P5NA 3NTIA 3AT1B 3OYJA 5GAMe 4M7DB 3CPWA 2CH4W 2DXCA 3MEVA 4KUDK 1RAHB 4JS5A 5J26A 5IHNA 3M57A 5GMKh 1K8AU 1VYTA 1VA7A 3QDRB 4FYVB 2KI7A 2X51A 1PD1A 1TSFA 2HBPA 1NJIR 3OYIA 1AHJB 1YJNT 2HKNA 5KYXB 3OA6A 4II1A 3OW2P 3LW5E 2ZGWA 1MMAA 4J9FA 4GY5A 1AWWA 1UJYA 4RMOA 2LJ1A 3S3NA 3EH2A 1ZBXA 4BY6B 1WJSA 1KHIA 2E6ZA 1JEGA 2EYWA 4PFPA 4E7LA 2VWFA 2J6FA 2NLUA 1RAGB 2DD5A 5GMKj 2HAXA 1X69A 2KAFA 1IZ6A 4Y91A 3CMEA 1Y7XA 2FVUA 2R5AA 4AT1B 2MK5A 1KD1R 4D6WA 1X6GA 1MNEA 2KE9A 2KXCA 2CKKA 2QDYB 3L2VA 2CP7A 3CC2A 1QVGP 1NJIU 2DETA 1Y07A 1SHGA 1N5ZA 2BUDA 4KGZB 2IIMA 2E10A 4HT8A 3QBYA 4OMNA 1WGSA 2QGFB 1NPRA 1R8OB 2RA2A 1BIBA 2VGMA 3OYFA 2YSQA 1W2BA 3SWNB 2F2WA 1AOJA 1G3YA 4E7KA 2RK2A 3CC4A 1QVPA 1D3BB 3PGGA 4XQ3A 5ECAA 1AVZC 4KT0E 4F7UG
chains in the Genus database with same CATH topology
3SDZA 4C0ZA 2KDSA 1KD1C 1VUBA 2DTOA 2QI2A 4M78F 2K5FA 1W4SA 4MMLA 3JCMX 1VQ9A 1VQ8A 2OTJA 3PIPA 2PQWA 2CYZB 3GF5A 4XAXB 1QVFA 4C8QB 3JRZA 2EJ9A 2JTMA 3OYAA 2L5QA 3OYMA 3OYYA 4XTXA 4F7UE 3L2WA 5IT9E 1KQ2A 1XOVA 3OMCA 3ME9A 3NFCA 4FL6A 2VV5A 3UDCA 4L6V5 2DJZA 2X4YA 1ZHIA 3QXEB 4J83A 4OB1B 3FJPA 1K9MU 5I2MA 4ATOA 3FC3A 1BI3A 3R6OA 4BE1A 4QQGA 5IN1A 3OS5A 4XTYA 2FL7A 4C5IA 4ELZC 5CKDA 4M7AG 2DO3A 4XTZA 1Y96A 2EWNA 5HY6A 1YITT 4C92E 1KD1U 1Q82C 2F5KA 4M78B 4OP0A 5GANd 4BE0A 3VYHB 1VQ4A 2QQ9A 3RESA 4M7AC 2RHYA 3S3OA 3M5AA 5GMKl 2ZPGB 5DLOA 4NOYA 5A0LA 4EDUA 3SWNA 4F7UF 4TVRA 5DLQE 2RI2A 2RHZA 1JJ2A 3CCRT 5GAN5 1I81A 2E5QA 5CQXA 5GANf 4JLIA 2P4TA 1WJRA 3EAEA 3TREA 1D3BA 2OTLT 3KUFA 5LJ5d 1UEBA 2DTIA 4M77B 3QZ9B 1O75A 5KH6A 1FXXA 1I4K1 1G5VA 2R58A 5AYFA 2X4JA 3VUBA 3PTAA 2RHIA 5GANe 1VQMT 3C95A 4C92F 3G6ET 2JZ2A 4XTWA 5LL6S 4ZGDB 3RKYA 3OY9A 4JS4A 3LGLA 3VYGA 3HKSA 2X35A 3LX7A 3CBOA 4J8OA 3H8ZA 4M7AD 2G3RA 2XI9A 1QVGS 2DZCA 2RI5A 2XHCA 5HK3A 3X26B 4M75D 4F7UB 3E1SA 1K73C 3CC7T 3OYHA 2VC8A 2RI3A 4EMKC 4BD3A 5FRMA 4WF2A 1YBYA 3GPLA 2D9TA 4QVDA 2D6FA 3ASKA 3QYHB 1XQHA 3HL8A 2EFIA 2FB7A 3ZEHA 2MWOA 3V7RA 3L2QA 1YITA 2QTXA 4BI3A 3JCMP 1M9SA 4J5YA 4PJOG 2XICA 2RJDA 2IG0A 4C92B 2QEXT 2CZ6B 2WSEE 2DVEA 3CCVT 4OMFB 1YJWT 4MZTA 5D6XA 3MEWA 4M78A 3WVEB 4BI8B 2V8IA 3JAME 1P92A 3RERA 3OS2A 1QVFS 3BW1A 4LD6A 5CKEA 1VQ8T 4PJOC 2ZPFB 3M4YA 5KCOA 3JCMb 5L8RE 3JB9D 3SD4A 3CCRA 4FIBA 3RIRA 3L2RA 3CPWS 2EIFA 1K73U 1YJ9T 5GAOm 4JRQA 4BDZA 3CD6T 1WJQA 3CCQT 3RKWA 4L59A 4A4KA 4HA8A 2AHJB 2OTLA 2LT4A 2EJFA 3M59A 1GXIE 3J7AF 3OS1A 3OYLA 4EPCA 4XU3A 3FRNA 2JVVA 4MMKA 3OMGA 5KE3A 1U1TA 3QJYA 4IUTA 2JOYA 4C5GA 4EMHA 1M1GA 4R56A 2WSFE 3G6EA 1M90C 2KMTA 1N9SA 3BFMA 3MEUA 4RKUE 1HK9A 3P8HA 4XTVA 4IUPA 2P0PA 2E41A 3OSSC 4YTLA 4ZN1A 4ZN3A 4J7IA 2K4YA 4ME7A 4PLLA 5KE2A 2IVWA 1VQ4T 3ZFJA 3J80E 2DXBA 3CC7A 4PJOD 3A8LB 1PSEA 2JTFA 3A5ZB 1N9RA 4OGCA 3VUZA 4HKEA 5LJ3g 4E7HA 1JJ2S 4OB3B 2MI6A 4F7UA 2LNVA 2RK1A 1YCYA 4CRIA 2VYTA 4M77E 3EFSA 2M1HA 4UC4A 3OYKA 3M58A 2M9UA 2R5MA 3TCJA 2KY9A 3C12A 1OI1A 3URGA 5LJ5g 2QQAA 3CCMT 4C8QD 2QEXA 5GMKe 3JCMg 2PVOB 4O5VA 3BY7A 3FEOA 3CCVA 1YJWA 5CO7A 2F69A 3OW2S 5J3BA 3HFOA 1X75C 2HD0A 3META 4C92A 4M7DD 1VIEA 1KC8U 1UGQB 3HRUA 4LD9K 4RCBA 5GAMd 4N4GA 5GAOr 1YJ9A 3CD6A 3WXMB 2HNIA 4A4GA 2L89A 3GP8A 3G7ZA 3CCQA 4HCZA 1NE8A 1WPYA 1K8AC 2RH2A 4X34A 4PNOA 3PFSA 3TEEA 3LWHA 1HXDA 4A53A 1WQ7A 3JCMQ 4OB0B 4BY6C 2GQVA 4ZGJB 3MCAB 1PSFA 5CCAA 3I56T 2YLBA 4C0FA 3V7CA 5HKCA 3L1AA 1VQ6T 4RG2A 5DM7R 3JB9J 1FWZA 1O9SA 3H6ZA 5CKHA 3UT1A 1BI0A 4HCCA 2QXFA 1JRIA 4M75G 2L3RA 1MGQA 2RHXA 4PL6A 4C0DC 2KVQG 2LCCA 2HQXA 1VQNT 1G3SA 2E65A 2E12A 1H641 3JCMc 1H3ZA 4RCCA 5CR2A 4C5HA 5A0DA 4M75C 2ZPIB 2C06A 4M7AE 3MEAA 5LJ3d 4M77D 3QZ5B 1VQPT 3V8KA 2LVMA 2GCXA 2CZ0B 4M75E 4DOVA 1VQKT 4MZMA 3RUXA 1M1FA 2E6NA 2XKOC 2JN0A 4N0AA 3FDRA 4KULA 3CBPA 3NTHA 3CCMA 5FROA 4DA4A 1YHQT 1Q86C 2A7YA 4E7IA 2XDDA 1NZ9A 2GF7A 4JJNK 2YHTA 2EQJA 2RD1A 3JCMd 3A8MB 4ZTFA 2VUBA 4A4HA 1UGRB 1VIFA 3T9NA 1MHNA 3JB9G 3BDLA 5LJ3f 1VQOT 1Q82U 4NS5A 3EFRA 3JCMW 3S3MA 1UGPB 2K5IA 2KK4A 3C4SA 3GIBA 4OGEA 3CCST 1M1KC 5CKFA 2M16A 3JSCA 3RMQA 1W2BS 3CCLA 3QSUA 4N4HA 5LJ3e 5J39A 5LJ5f 1Q81C 3CEYA 4IUQA 5GAN7 4M7AF 2QA4A 1BI1A 2EAYA 1S72T 3O8VA 3DKMA 4M75F 4JRKA 2R57A 3I56A 3AHUA 1KQSA 4KT0E 5DY9A 3KBGA 5LJ5e 4ELYC 4FT2A 3X25B 5FLXE 4BE2A 1VQ6A 3A8HB 1KG1A 2RM4A 3JCMe 2CZ7B 5I21A 3JCMV 4A4EA 2ZPEB 3MO8A 3E19A 3OS0A 3GNGA 4N4IA 5FU6C 5HK0A 1VQNA 2LRQA 3TU4K 5GAOp 2XD0A 2EYQA 4XU1A 3J81E 3CCET 1M1KU 2ZPBB 3QYGB 2MF2A 2PVDB 3C94A 3MP8A 2HQEA 2X4WA 2LDMA 3V8LA 5LJ3j 1N8RC 2CS7A 3X20B 1VQLT 4C0DB 5M9OA 3FB9A 5GAOl 2GFUA 2QQRA 3V8JA 5GAMg 4PKCC 4M7AB 1VQPA 2E70A 2X4XA 2K3YA 1QP2A 1VQKA 5GANh 4E47A 3JB9F 4C8QG 4PJOE 3DB4A 5C0MA 4M75B 3JCMJ 1NJIC 2PUKB 2MMPA 5GAN2 1YHQA 2DIGA 1WNLA 2DEQA 3M9QA 3OYGA 4KBMB 2CZ1B 5CQYA 3CMAA 4M7DG 5D6YA 1TH7A 5EG2A 2Y4XA 2DK3A 4QQ6A 2BKDN 4C8QC 2LQKA 1VQOA 2MAMA 1N6AA 3OYCA 3M55A 4NL2A 4GLKA 3QG1A 3CCSA 3G71T 3F70A 4JRIA 4M7DC 2DKGA 4QVCA 2EJGA 2M0OA 3CCUT 2EQKA 3HHTB 2K2VA 4B9WA 4BI4A 3LGFA 3PMTA 5GAN6 3QPHA 4BB7A 5LJ5h 4M7DE 2XK0A 2YRVA 2LC4A 3FIFA 1M8VA 1NPPA 2L8DA 2MWPA 1S72A 2E64A 3L42A 3S6WA 4C0GA 3VV0A 4IURA 3L2ZA 2CGHA 2XG8D 4PJOF 3PIOA 3UWNA 1U8RA 4V2SA 4J6WA 2RB6A 2PVGB 3DB3A 1KQ1A 2O01E 3HRTA 4EMKB 3PNWC 3JB9I 2DD4A 3QIIA 1LNXA 4JLGA 4XK8E 2YLCA 1RI0A 4EMGA 1M90U 4X9CA 3CCEA 4LDWA 5GAN8 4XTUA 4M77G 4C8QF 1YI2A 1VQLA 2O4XA 2XDPA 2KQWA 2RJFA 1DJ7B 1I8FA 5FU6B 2RJEA 3RKXA 3OYDA 4M7DF 3E9FA 4LDYA 4OVAA 1G3TA 2V8KA 1M5Q1 1EIFA 4DOWA 5GANj 1XTDA 1Y71A 1XNIA 3RMSA 3CCLT 2D0QB 2LCLA 4M77C 5CIUA 3UPUA 3OBWA 3CBMA 1BIAA 1K9MC 2QQSA 3PMIA 3GNFB 3MHXA 5I2SA 2QA4T 4M7AA 2EQUA 4PJOB 5A0GA 2BIVA 2PU9B 4M75A 1BKBA 4M78D 2K3XA 1I5LA 5GMKi 3CCJT 4E7JA 5GAMf 5FRNA 2VXFA 3G71A 3DLLA 3LLRA 2DXUA 1RL2A 4X9DA 5LJ5j 2RO0A 3CCUA 3INZA 1YIJT 3M4GA 2K5LA 4P5NA 3A8GB 3NTIA 3OYJA 2ZCFB 5GAMe 4M7DB 4C92G 3CPWA 2DXCA 1JBMA 4FU6A 1UGSB 1BI2A 1VQ5T 3MEVA 1VQ7T 4KUDK 4JS5A 4QW2A 5J26A 4JUVA 3V7SA 1OYXA 3M57A 5GMKh 1K8AU 3OQ5A 3MP1A 1N27A 3HFNA 4C92C 3SB2A 4M77F 3OYBA 4IUUA 2RHUA 3N5BB 5C6SA 1V29B 3M53A 3MP6A 3QDRB 3P8DA 4RG8A 3CMET 2HBPA 2A3LA 3CMAT 4B9XA 1B34B 4EMKA 3HRSA 3VKIA 4MDWA 3OYIA 2XDBA 3CXCA 1AHJB 3X28B 1YJNT 2WACA 2H3JA 2LTOA 4KUIA 3FLGA 3VU3C 3X24B 2DTHA 4OB2B 3ER0A 3OA6A 4XU2A 4LDVA 4R55A 4II1A 2P0KA 3GOXA 5GMKm 2EKOA 4ZGEB 5A2QE 5CKBA 3LW5E 2ZGWA 4PLIA 4QQDA 4BUGA 2ZZDA 4GY5A 4J6XA 3JCMf 3M54A 1BYMA 1ZQ1A 4RMOA 2E1HA 2XU8A 3OSVA 3CC2T 4PJOA 3E9GA 4C92D 3I55T 3CCJA 4FM4B 3S3NA 1Q86U 2LQ8A 5GAMh 1ZBXA 3G4ST 1QP3A 1WJSA 3SWNC 4BY6B 1KHIA 2E6ZA 3L2UA 3OW2A 1Q7YC 3JB9H 5GAN4 2DZ9A 5KCHA 1YIJA 2LT1A 2O4XB 2JNGA 4E7LA 4LDXA 3PT9A 4J7FA 4N0AC 1UB4A 3BDUA 3HP9A 5FU7C 1YI2T 4C8QA 1SSFA 5IAYA 2NLUA 3OYEA 1VQ5A 1VQ7A 2JUFA 2DD5A 5GMKj 2HAXA 3DLMA 4ZTJA 1Q81U 4LDUA 4M7DA 2KAFA 4FSXA 3SFMA 1IZ6A 2F5TX 2GFAA 3KXTA 4CI0C 3LYIA 3CC4T 2QQBA 2RJCA 1X6OA 2I2LA 4A4FA 4Y91A 5GAOn 2XIDA 3Q1JA 2Y4YA 3CMEA 1KHCA 2P0QA 3OB9A 4Y28E 3QO3A 1Y7XA 2FVUA 4Z02A 1Q7YU 2R5AA 5LJ3h 3QUIA 4IUVA 2DPPB 1FX7A 2OAUA 1YJNA 1OZ2A 3HPWA 1B34A 5GAN3 1IREB 1QW1A 4JDSA 3ZBDA 1VQ9T 1JB0E 4C8QE 3LH0A 4D6WA 2OTJT 2WSCE 2EQMA 2LX9A 3NTKA 1N8RU 4IKFA 1M4ZA 1WQWA 4Q5WA 4M78G 5D6WA 3JCMh 2DIQA 2DXTA 2CKKA 3OYNA 3LWIA 2QDYB 3QJ6A 4MZPA 2FHDA 3L2VA 1U1SA 4MDXA 3CC2A 2VGNA 1LOJA 4VUBA 3P8BB 5GAMj 2ZPHB 3I55A 1LJOA 1Y07A 1NJIU 3QHSA 4DQ2A 4M78C 1Y96B 2BUDA 1VQMA 4BACA 3G4SA 2V8JA 4M77A 4NL3A 2E10A 4BDYA 2KSSA 4HT8A 4HT9A 5GAOq 3QBYA 4FT4A 4M78E 4XU0A 3M56A 5GANg 4O6JA 2FYKA 3CPFA 5CVIA 1WGSA 3VJPA 3CXCS 1NPRA 1R8OB 4L5GA 1KC8C 2RA2A 3OBYA 5CK9A 1BIBA 2VGMA 3A8OB 3OYFA 4A54A 2VXEA 3SWNB 1W2BA 1QVGA 1OZ3A 4JRPA 1G3YA 1X01A 3GLXA 2Y90A 3WVDB 4E7KA 4HCBA 2RK2A 4J6YA 3CC4A 5FU7B 1QVPA 3HSBA 1D3BB 3PGGA 4QVZA 2DAQA 4C5EA 3QKJA 4XQ3A 5CAIA 2B8AA 1KQSS 1G3WA 4OF1A 2K57A 2PUOB 4F7UG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C6S A;  3MP6 A;  3P8D A;  5KE3 A;  3OMG A;  4IUT A;  4A4E A;  4C5G A;  4B9X A;  3MO8 A;  3OYI A;  3OS0 A;  4N4I A;  3MEU A;  3P8H A;  2LRQ A;  4IUP A;  2WAC A;  2LTO A;  2PQW A;  3FLG A;  4PLL A;  5KE2 A;  3MP8 A;  2HQE A;  2X4W A;  2LDM A;  3OA6 A;  4II1 A;  2P0K A;  3GOX A;  3OYA A;  5M9O A;  3OYM A;  2EKO A;  3OYL A;  3L2W A;  2GFU A;  2QQR A;  2JTF A;  3OMC A;  4PLI A;  4QQD A;  3ME9 A;  4FL6 A;  4E7H A;  2X4X A;  2K3Y A;  4GY5 A;  2X4Y A;  4CRI A;  3DB4 A;  2VYT A;  4UC4 A;  5C0M A;  2M1H A;  3FC3 A;  3OYK A;  2DIG A;  2R5M A;  4QQG A;  4BE1 A;  3M9Q A;  3E9G A;  3OYG A;  5IN1 A;  1OI1 A;  5D6Y A;  4C5I A;  3S3N A;  4QQ6 A;  2BKD N;  1WJS A;  3FEO A;  3L2U A;  2F5K A;  4BE0 A;  3OYC A;  5KCH A;  3F70 A;  3MET A;  2O4X B;  2RHY A;  4E7L A;  3S3O A;  2M0O A;  2EQK A;  4B9W A;  3LGF A;  3PMT A;  5IAY A;  1SSF A;  2NLU A;  2XK0 A;  3OYE A;  2YRV A;  4N4G A;  4EDU A;  2L8D A;  3DLM A;  2MWP A;  4ZTJ A;  3L42 A;  3S6W A;  2RI2 A;  4A4G A;  2L89 A;  2RHZ A;  4IUR A;  4HCZ A;  2GFA A;  4X34 A;  2E5Q A;  3LYI A;  3PFS A;  2RJC A;  3UWN A;  1WJR A;  3EAE A;  4A4F A;  3KUF A;  3Q1J A;  3DB3 A;  5KH6 A;  1KHC A;  1G5V A;  3OB9 A;  3PNW C;  2R58 A;  4RG2 A;  3QII A;  3UT1 A;  2RHI A;  3H6Z A;  4Z02 A;  1RI0 A;  2R5A A;  4IUV A;  2JZ2 A;  3OY9 A;  2L3R A;  1OZ2 A;  2RHX A;  4PL6 A;  2LCC A;  2HQX A;  3LGL A;  2X35 A;  3LX7 A;  2O4X A;  2XDP A;  3H8Z A;  2RJF A;  2G3R A;  2EQM A;  3LH0 A;  1H3Z A;  3NTK A;  4IKF A;  2RJE A;  2RI5 A;  4C5H A;  3OYD A;  3E9F A;  4OVA A;  4Q5W A;  3OYH A;  1XNI A;  3MEA A;  2RI3 A;  5D6W A;  5CIU A;  2DIQ A;  2CKK A;  4BD3 A;  3OYN A;  5FRM A;  3QJ6 A;  2QQS A;  2LVM A;  2D9T A;  2FHD A;  3PMI A;  3L2V A;  2EQU A;  3ASK A;  2E6N A;  3FDR A;  2BIV A;  2EFI A;  2BUD A;  4BAC A;  2K3X A;  3NTH A;  2MWO A;  5FRO A;  3ZEH A;  4E7J A;  4E7I A;  3L2Q A;  2GF7 A;  2EQJ A;  4BDY A;  3QBY A;  2RJD A;  4ZTF A;  4A4H A;  2IG0 A;  5FRN A;  1MHN A;  3BDL A;  3LLR A;  4NS5 A;  1WGS A;  3S3M A;  2RO0 A;  3C4S A;  5D6X A;  3MEW A;  3OYF A;  2M16 A;  3OS2 A;  4LD6 A;  3NTI A;  3OYJ A;  1OZ3 A;  5KCO A;  4N4H A;  4E7K A;  5J39 A;  4FU6 A;  3SD4 A;  3CEY A;  4IUQ A;  3L2R A;  3MEV A;  4BDZ A;  4QW2 A;  5J26 A;  1WJQ A;  1OYX A;  3O8V A;  4C5E A;  4QVZ A;  3OQ5 A;  2DAQ A;  1N27 A;  2R57 A;  3MP1 A;  4L59 A;  3QKJ A;  2B8A A;  3OYB A;  4IUU A;  4BE2 A;  2RHU A;  3OS1 A; 
#chains in the Genus database with same CATH topology
 3SDZ A;  4C0Z A;  2VAS A;  1SRL A;  1VUB A;  2QI2 A;  2K5F A;  2ABL A;  2PQW A;  4XAX B;  2JTE A;  1K76 A;  2CSI A;  4HCK A;  4XTX A;  3ME9 A;  1K9M U;  2F2X A;  2RMO A;  1TG0 A;  3CC2 Q;  4M7A G;  2FL7 A;  4C5I A;  2DO3 A;  4FSS A;  1RAE B;  5HY6 A;  4C92 E;  1KD1 U;  2KYM A;  1V76 A;  4BE0 A;  2KBT A;  3RES A;  4M7A C;  3S3O A;  3M5A A;  4NOY A;  1JXM A;  2E4H A;  1MMN A;  4J9G A;  2JM8 A;  5GAN 5;  1I81 A;  1QLY A;  3CC4 Q;  3EAE A;  1JU5 C;  1UEB A;  2DMO A;  5KH6 A;  1G5V A;  4B6M A;  5AYF A;  1PWT A;  3G6E T;  1SSH A;  3RKY A;  1RAA B;  3LX7 A;  3CBO A;  3H8Z A;  3QWY A;  2DZC A;  2RI5 A;  5I11 A;  1RAD B;  3E1S A;  2VC8 A;  3M0P A;  2NUP B;  1YBY A;  2D9T A;  2D6F A;  3ASK A;  1D0Z A;  2EFI A;  3REB B;  1OU9 A;  4CC3 A;  3ZEH A;  3TQ7 P;  4C92 B;  2QEX T;  1D1B A;  2WSE E;  2DVE A;  1YJW T;  4OMF B;  5D6X A;  3MEW A;  4M78 A;  2V8I A;  3FJ5 A;  1P92 A;  3OS2 A;  3UF4 A;  2ZPF B;  5KCO A;  2V1R A;  3SD4 A;  3CCR A;  3RIR A;  3CPW S;  2EIF A;  1OPL A;  4JRQ A;  4BDZ A;  2CP6 A;  3CCQ T;  4L59 A;  4OML A;  2OTL A;  3M59 A;  3J7A F;  1X43 A;  4EPC A;  4XU3 A;  3OMG A;  1AWJ A;  1M90 C;  2KMT A;  2C0T A;  3MEU A;  3P8H A;  1M8M A;  2P0P A;  2NUT A;  2HL5 C;  3CC7 A;  1AZG B;  2JTF A;  1D1A A;  2J6K A;  1M3B A;  2MI6 A;  3M58 A;  2M9U A;  1VOM A;  2L3P A;  2A37 A;  4KRT A;  2QQA A;  4C8Q D;  2PVO B;  3FEO A;  3CCV A;  1KK7 A;  4M7D D;  2DL4 A;  1VIE A;  1KC8 U;  1X6B A;  2COZ A;  1VYV A;  4A63 B;  3HRU A;  1YJ9 A;  3CD6 A;  2HNI A;  2L89 A;  1T0J A;  3CCR Q;  4PNO A;  3TEE A;  1HXD A;  3JCM Q;  1TTH B;  2DVJ A;  4ZNX A;  5HKC A;  4R0K A;  1VQ6 T;  3PVL A;  2QXF A;  4M75 G;  2HQX A;  1G3S A;  1BK2 A;  2CUB A;  2KRM A;  5L23 A;  1SEM A;  1D1C A;  4J9E A;  4C5H A;  2JS2 A;  2ENM A;  4M75 C;  2CUD A;  2B86 A;  3MEA A;  3CC7 Q;  1ZSG A;  1G8X A;  4DA4 A;  3G1J A;  2MIO A;  2HEQ A;  5KYW A;  4ZTF A;  1KQS P;  3EFR A;  3JCM W;  2K5I A;  3CCV Q;  2J7I A;  4AFZ C;  2M16 A;  1YNZ A;  3CCL A;  1W2B S;  4N4H A;  5LJ3 e;  2KGT A;  5J39 A;  3KFV A;  4IUQ A;  5GAN 7;  4M7A F;  3GBQ A;  1YJ9 Q;  3O8V A;  1YP5 A;  4ANJ A;  4JRK A;  2R57 A;  2EYX A;  1EFN A;  5DY9 A;  2M0Y A;  1K9A A;  2PZ1 A;  2O9S A;  2LQN A;  2RM4 A;  3JCM e;  2F2V A;  4A4E A;  5FU6 C;  4N4I A;  4LNP A;  3G71 Q;  2PVD B;  3V8L A;  1VQL T;  2CS7 A;  3X20 B;  4C0D B;  5M9O A;  5GAO l;  2GFU A;  2QQR A;  4RTX A;  3V8J A;  1LVK A;  1UDL A;  2E70 A;  2LJ0 A;  1VQK A;  3DB4 A;  3HTR A;  3CMA A;  1TH7 A;  4OMM A;  5EG2 A;  4QQ6 A;  2BKD N;  2LQK A;  1VQO A;  1GL5 A;  2MAM A;  1N6A A;  1OPK A;  4NL2 A;  3G71 T;  4JRI A;  2GTO A;  2DRK A;  4BI4 A;  3LGF A;  3PMT A;  3QPH A;  4KH1 B;  2E3H A;  4FYX B;  2DIL A;  1M8V A;  4LN2 A;  1NM7 A;  1VYU A;  3CCL Q;  3D7S B;  4F16 A;  3VV0 A;  2FPF A;  3PIO A;  1PG5 B;  1OEB A;  3UWN A;  4JZ3 A;  2RB6 A;  3LH5 A;  3EG9 B;  4WCI A;  2JMC A;  3EHQ A;  1RI9 A;  3CCE A;  2DBK A;  5GAN 8;  1YI2 A;  1YIJ Q;  2O4X A;  1DJ7 B;  4E6R A;  2RJE A;  3RKX A;  4OVA A;  1EIF A;  3RMS A;  1Y71 A;  1XNI A;  3CCL T;  1VQ5 Q;  2D0Q B;  2EQU A;  1VQK Q;  5A0G A;  1M30 A;  2C0I A;  1ZUU A;  3CMA Q;  3M0R A;  5KYY A;  4AG2 C;  2DXU A;  1ZX6 A;  2HMA A;  1VQO Q;  4LXC A;  4RTY A;  3INZ A;  1YIJ T;  3EGD B;  1YFN A;  1JBM A;  3R6N A;  2E5K A;  1VQ5 T;  1N8R R;  1OYX A;  3MP1 A;  3HFN A;  1J3T A;  2YDL A;  5C6S A;  3M53 A;  2NWM A;  1WXB A;  3VS1 A;  2A3L A;  3CMA T;  1B34 B;  1YWO A;  2QYZ A;  3HRS A;  3VKI A;  4MDW A;  1YN8 A;  2XDB A;  3RNJ A;  3X28 B;  3X24 B;  2H3J A;  2EGC A;  3FLG A;  2DTH A;  4OB2 B;  3ER0 A;  4R55 A;  4LDV A;  2KEA A;  1YI2 Q;  1W70 A;  2YRC A;  4PLI A;  2ZZD A;  4J6X A;  3JCM f;  3M54 A;  1E7O A;  2E1H A;  2XU8 A;  3OSV A;  4KH0 B;  3E9G A;  4C92 D;  3CCJ A;  2CRE A;  2FEI A;  1Q86 U;  1Q7Y C;  1NYF A;  3L2U A;  2DZ9 A;  1RAC B;  2O4X B;  2JNG A;  1VQ9 Q;  1H3H A;  1D09 B;  4OMO A;  4J7F A;  3BDU A;  5FU7 C;  1YI2 T;  4C8Q A;  5IAY A;  3OYE A;  2DNU A;  3DLM A;  1Q81 U;  4M7D A;  4FSX A;  1BCM A;  4CI0 C;  4JZ4 A;  1X6O A;  3I5S A;  2K2M A;  3EHR A;  4A4F A;  4PJN A;  1M27 C;  1WLP B;  1IHV A;  3QO3 A;  5LJ3 h;  1YJN A;  4IUV A;  3TSZ A;  1FX7 A;  1WA7 A;  1QW1 A;  1VQ9 T;  4C8Q E;  2WSC E;  2EQM A;  1N8R U;  4J9D A;  3JCM h;  2RQW A;  3QJ6 A;  4MZP A;  2FHD A;  4VUB A;  2ZPH B;  1Y96 B;  2P4R A;  2D1X A;  3ZL7 C;  2OI3 A;  3MJX A;  2H8H A;  5GAO q;  5FW9 A;  4FT4 A;  4XU0 A;  5GAN g;  4O6J A;  2FYK A;  3CPF A;  3OBY A;  5CK9 A;  2QAZ A;  2VXE A;  1X01 A;  2Y90 A;  3WVD B;  2DL8 A;  2V1Q A;  4QVZ A;  2DAQ A;  5CAI A;  2FPE A;  3I35 A;  2K57 A;  2PUO B;  5LJ3 j;  1B3Q A;  4Z8A A;  3VS7 A;  2JXB A;  2KDS A;  1LCK A;  3VS6 A;  2DTO A;  4M78 F;  1W4S A;  3PIP A;  1YJN Q;  3GF5 A;  4C8Q B;  3JRZ A;  2L5Q A;  3UAT A;  4F7U E;  5IT9 E;  4PJL A;  3QWX X;  2E3I A;  3UDC A;  4L6V 5;  3QXE B;  3FJP A;  4ATO A;  2FRY A;  3FC3 A;  4QQG A;  1CSK A;  3OS5 A;  3EG1 A;  1IGQ A;  1JJ2 P;  1MV0 B;  1PRL C;  1NEG A;  1YIT T;  2F5K A;  5GAN d;  3VYH B;  2AZS A;  2A28 A;  2QQ9 A;  5IXB A;  2L0A A;  2ROT A;  5GMK l;  2K7A A;  1I1J A;  1PHT A;  5A0L A;  3SWN A;  1X2K A;  5DLQ E;  2RI2 A;  2KT1 A;  2HL3 A;  5CQX A;  5GAN f;  3H41 A;  1D3B A;  3KUF A;  5LJ5 d;  2RQT A;  5FWB A;  2RHI A;  3C95 A;  5LL6 S;  4XTW A;  3OY9 A;  3HKS A;  4J9H A;  4J8O A;  1M90 R;  1W6X A;  1QVG S;  2XHC A;  5HK3 A;  3X26 B;  4F7U B;  2AK5 A;  2MOX A;  1TS9 A;  3GPL A;  1XQH A;  1AWO A;  4CC7 A;  2FB7 A;  2CP2 A;  3V7R A;  3L2Q A;  2DLP A;  2YUN A;  2XIC A;  1QWE A;  1LPL A;  4MZT A;  2D0N A;  1QVF S;  1M2O A;  3BW1 A;  1IB8 A;  1IGU A;  1TUD A;  4HVV A;  3JCM b;  5L8R E;  3JB9 D;  5GJV B;  4FIB A;  3M0T A;  5GAO m;  1WJQ A;  3RKW A;  2DL5 A;  4AMC A;  2LT4 A;  3VS2 A;  2RF0 A;  3OYL A;  5KE3 A;  3G6E A;  1M1G A;  1TU0 B;  1WIE A;  3BFM A;  2O9V A;  1NLO C;  3OSS C;  2E41 A;  2K4Y A;  4ME7 A;  2IVW A;  1Q82 R;  3ZFJ A;  3J80 E;  4PJJ A;  3VUZ A;  2DJQ A;  2DRM A;  4UC4 A;  3OYK A;  2NUP A;  2KY9 A;  3C12 A;  3URG A;  2QEX A;  1UGV A;  2A36 A;  1YJW A;  4Y92 A;  1C1A A;  3HFO A;  4C92 A;  1C0M A;  2GNC A;  2G6F X;  1UGQ B;  5KYN A;  2L3Q A;  5GAM d;  1PRM C;  4J9C A;  3WXM B;  3VS0 A;  3CCQ A;  3G7Z A;  1K8A C;  1WPY A;  3LWH A;  2EGE A;  4BY6 C;  2GQV A;  5CCA A;  3I56 T;  2YLB A;  4IIM A;  2LQW A;  4F17 A;  3JB9 J;  1FWZ A;  5CKH A;  2L3R A;  3G6E Q;  3JCM c;  5CR2 A;  3I9Q A;  3EGX B;  4M77 D;  2LVM A;  4M75 E;  2DBM A;  4DOV A;  1M1F A;  1ZSZ C;  4KUL A;  1IHW A;  1MV3 A;  1YHQ T;  1B7T A;  1U5S A;  4E7I A;  4JJN K;  2LMJ A;  2RD1 A;  3A8M B;  4A4H A;  1SHF A;  3BDL A;  1Q82 U;  4NS5 A;  2QEX Q;  3C4S A;  1YJW Q;  3GIB A;  2I0N A;  4IIO A;  1M1K C;  2YUO A;  3JSC A;  3RMQ A;  3CEY A;  1SRM A;  2KR3 A;  2QA4 A;  2EAY A;  1NEB A;  1BU1 A;  3DKM A;  3CCQ Q;  3AHU A;  1WZO A;  3KBG A;  1TOV A;  4FT2 A;  5FLX E;  4BE2 A;  1VQ6 A;  2CZ7 B;  5I21 A;  1IXD A;  3MO8 A;  3OS0 A;  5IHI A;  5HK0 A;  4DEY A;  3TU4 K;  2XD0 A;  2EYQ A;  4XU1 A;  2HSP A;  3QYG B;  2MF2 A;  2HQE A;  2X4W A;  3SHW A;  2YT6 A;  1WHL A;  3FB9 A;  1PM3 A;  1WHK A;  4AG1 C;  4PJO E;  1AZE A;  2KRN A;  4M75 B;  1NJI C;  1WX6 A;  2PUK B;  1WNL A;  1FMK A;  2DEQ A;  2CZ1 B;  1UHC A;  2IPO B;  4J9I A;  1GBR A;  2BE7 D;  1T0H A;  3QG1 A;  1NG2 A;  3TVT A;  1WI7 A;  3CCU T;  4K11 A;  4BB7 A;  2XK0 A;  3FIF A;  1XJW B;  1OU8 A;  4OMQ A;  3L2Z A;  1OX9 A;  2SRC A;  2XG8 D;  2QA4 Q;  1U8R A;  1IO6 A;  4J6W A;  3EGU A;  2QG9 B;  2LCS A;  2O01 E;  3HRT A;  4EMK B;  3JB9 I;  1VQ6 Q;  4XK8 E;  1RI0 A;  2QTV A;  3M0S A;  2OJ2 A;  4X9C A;  2VKN A;  4XTU A;  4C8Q F;  1VQL A;  4FW2 A;  2FZC B;  2HSE B;  1I8F A;  5FU6 B;  2MYS A;  4M7D F;  3E9F A;  4LDY A;  2V8K A;  1XTD A;  1VQ7 Q;  2LCL A;  3CBM A;  1BIA A;  1K9M C;  2QQS A;  1M3A A;  5I2S A;  3GNF B;  4PJO B;  2QA4 T;  1UHF A;  2HCK A;  3VS4 A;  3CPW P;  1BKB A;  1I5L A;  1KIK A;  2FZG B;  4E7J A;  2AKL A;  3G71 A;  2RQR A;  1H92 A;  2RO0 A;  1K1Z A;  2K5L A;  2GQI A;  1WHG A;  1Q7Y R;  2ZCF B;  4C92 G;  4FU6 A;  1UGS B;  1VQ7 T;  2CP3 A;  3V7S A;  4JUV A;  3OQ5 A;  2GGR A;  4C92 C;  3OYB A;  1JXO A;  2RHU A;  3N5B B;  1V29 B;  3BE3 A;  3MP6 A;  1K0S A;  1PCX A;  2DM1 A;  3G4S Q;  3EG9 A;  4B9X A;  3I5R A;  1YWP A;  4KUI A;  2LTO A;  3VU3 C;  4RTT A;  1V1C A;  4XU2 A;  1RAI B;  1VQL Q;  5GMK m;  1AD5 A;  4ZGE B;  2V26 A;  2RQU A;  4BUG A;  1SKU B;  1QQJ A;  1E6H A;  2RN8 A;  3I55 T;  2LQ8 A;  2AT1 B;  4Z88 A;  3G4S T;  1QP3 A;  3JB9 H;  3OW2 A;  5GAN 4;  1SG5 A;  1YIJ A;  2EGA A;  2LT1 A;  2OTJ Q;  3PT9 A;  1ZA1 B;  3HP9 A;  3H0I A;  3EGD A;  1VQ5 A;  4ZTJ A;  4LDU A;  5D7U A;  2RJC A;  2COW A;  3Q1J A;  1AT1 B;  2Y4Y A;  2K9G A;  2P0Q A;  4Y28 E;  1NLP C;  4AFU C;  2GTJ A;  2J05 A;  4PFO A;  1Q7Y U;  1HSQ A;  2DPP B;  2OAU A;  3HPW A;  3EG2 A;  1B34 A;  4JDS A;  1JB0 E;  2D8H A;  2OTJ T;  3LH0 A;  2BTT A;  3NTK A;  4IKF A;  4M78 G;  2CT4 A;  2DXT A;  6AT1 B;  3LWI A;  4MDX A;  1W2B P;  2VGN A;  1LOJ A;  3P8B B;  2BE9 B;  4M78 C;  4M77 A;  4HT9 A;  2KSS A;  2LNH B;  4HVU A;  3CXC S;  4KGX B;  4L5G A;  1KC8 C;  3A8O B;  3H0H A;  4A54 A;  1QVG A;  1OZ3 A;  4JRP A;  1PKS A;  4J6Y A;  5FU7 B;  3HSB A;  4C5E A;  2DYB A;  2B8A A;  4OF1 A;  4M77 E;  3THK A;  5HCK A;  2LX7 A;  2MPX C;  1E6G A;  2ESW A;  1VQ9 A;  1VQ8 A;  2X3W D;  1QVF A;  3MKD A;  1GBQ A;  3L2W A;  2YUP A;  3OMC A;  1ZHI A;  4JJB A;  4OB1 B;  5I2M A;  3R6O A;  1X2Q A;  3UA7 A;  4BE1 A;  4XTY A;  5CKD A;  4XTZ A;  1Y96 A;  2EWN A;  3M0U A;  4OP0 A;  4X1V A;  2GBQ A;  1VQ4 A;  2ATC B;  1TUC A;  4D8D A;  3VRZ A;  2HQH A;  2ZPG B;  4TVR A;  1NYG A;  1QCO A;  1W1F A;  2RHZ A;  2X9H A;  4JLI A;  2AZV A;  1WJR A;  1OV3 A;  2DX1 A;  4M77 B;  3QZ9 B;  1O75 A;  2BZ8 A;  2EYY A;  2R58 A;  1UJ0 A;  5GAN e;  2LP5 A;  4C92 F;  3LGL A;  2AKK A;  3VYG A;  2X35 A;  2XI9 A;  3U23 A;  1G2B A;  1VQ8 Q;  1S1N A;  1M2V B;  1T3S A;  2X3X D;  4M75 D;  1M3C A;  1Z9Z A;  3OYH A;  1K73 C;  1Y57 A;  2ED0 A;  4BD3 A;  4WF2 A;  1HJD A;  3QYH B;  2CSQ A;  2YWW A;  3HL8 A;  1ZA2 B;  2DF6 A;  1YIT A;  4BI3 A;  3JCM P;  1M9S A;  1R77 A;  3NHN A;  1RLP C;  2RJD A;  4F04 B;  2MCN A;  3JAM E;  2EQI A;  4BI8 B;  1VQ4 Q;  4LD6 A;  5CKE A;  1VQ8 T;  3M4Y A;  2BZX A;  3L2R A;  8ATC B;  1H8K A;  4A4K A;  3EG0 A;  1A0N B;  1GXI E;  1K8A R;  3OS1 A;  3FRN A;  1MMG A;  2JVV A;  5KYU A;  4IUT A;  4EMH A;  2JOY A;  4C5G A;  2DA9 A;  4XTV A;  4RKU E;  1HK9 A;  4ZN3 A;  4ZN1 A;  1QKX A;  1TUG B;  1WHH A;  5KE2 A;  1VQ4 T;  1WFW A;  4PJO D;  1FMV A;  3A8L B;  3A5Z B;  1N9R A;  2EBP A;  4OGC A;  1JJ2 S;  4OB3 B;  1KSW A;  4F7U A;  1KFZ A;  1YCY A;  1OQK A;  2VYT A;  3EFS A;  1TWB A;  1OI1 A;  1MUZ A;  5LJ5 g;  1WHM A;  3CCM T;  4O5V A;  3BY7 A;  1YIT Q;  5CO7 A;  2F69 A;  1WDX A;  5J3B A;  3OW2 S;  1X75 C;  3MET A;  4RCB A;  1K0X A;  1EZZ B;  4N4G A;  2XMF A;  1M1K R;  1R0B G;  3VS3 A;  1NE8 A;  2RH2 A;  2QGG A;  4ZGJ B;  3MCA B;  1AWX A;  4C0F A;  2JW4 A;  3L1A A;  4RG2 A;  1O9S A;  1BI0 A;  5EC7 A;  1JRI A;  2RHX A;  4PL6 A;  2KVQ G;  1VQN T;  1IRX A;  2E12 A;  3CCS Q;  3PE0 A;  1U3O A;  1JQQ A;  3RDV A;  4RCC A;  5A0D A;  2ZPI B;  2C06 A;  4M7A E;  1S72 Q;  1VQP T;  1ZUK A;  2GCX A;  1UEC A;  2E6N A;  2XKO C;  2JN0 A;  4N0A A;  3TSW A;  3FDR A;  4PFZ A;  1Q86 C;  5KYU B;  2XDD A;  2YHT A;  4ESR A;  2VUB A;  1UGR B;  1MHN A;  2LJ3 A;  1UGP B;  2KK4 A;  1MMD A;  1X27 A;  2ROL A;  4OGE A;  5CKF A;  3CCS T;  1WHJ A;  3QSU A;  1Y0M A;  3ULR B;  5LJ5 f;  1Q81 C;  4LUE A;  1I0C A;  1BI1 A;  1FYN A;  2DER A;  1S72 T;  3I56 A;  1KQS A;  4ELY C;  3NGP A;  3JCM V;  2CP0 A;  4LUD A;  2ZPE B;  2DYI A;  2LRQ A;  2C0O A;  9ATC B;  5GAO p;  1UTI A;  1M1K U;  2ZPB B;  2EPD A;  2Z0W A;  1N8R C;  1JO8 A;  2LDM A;  5GAM g;  4M7A B;  2X4X A;  2K3Y A;  1QP2 A;  3EGX A;  5IHK A;  2SEM A;  4E47 A;  1HD3 A;  4C8Q G;  5GAN h;  3JB9 F;  3JCM J;  3EFO A;  1T3L A;  5GJW B;  1YHQ A;  3M9Q A;  1K9M R;  4M7D G;  2Y4X A;  2DK3 A;  2HZY A;  4C8Q C;  1ZSZ B;  1GCQ A;  4HVW A;  3OYC A;  3M55 A;  4M7D C;  2DKG A;  4EIK A;  4HXJ A;  4QVC A;  2M0O A;  2EQK A;  3HHT B;  2K2V A;  5GAN 6;  3IQL A;  5LJ5 h;  2YRV A;  2LC4 A;  1NPP A;  2L8D A;  2E64 A;  3L42 A;  3S6W A;  4RTZ A;  3QDF A;  3I56 Q;  1WYX A;  3DB3 A;  3PNW C;  4F14 A;  2JT4 A;  3QII A;  4M4Z A;  1LNX A;  4JLG A;  1G83 A;  1CKB A;  1Z9Q A;  3RBB B;  1M90 U;  2P84 A;  1QMC A;  4LDW A;  4E7S A;  2RJF A;  2L2P A;  3OYD A;  4DOW A;  5GAN j;  4AFS C;  2QK0 A;  1QVF P;  3PMI A;  1UUE A;  4FW1 A;  2BIV A;  4M75 A;  4RTW A;  5GMK i;  1YHQ Q;  1EX4 A;  3CME Q;  2EW3 A;  5GAM f;  4JPB W;  3DLL A;  3LLR A;  1RL2 A;  4X9D A;  5LJ5 j;  3CCU A;  1I5O B;  3M4G A;  1ZLM A;  3A8G B;  2J6O A;  2FRW A;  1BI2 A;  2JJ9 A;  1C6V X;  2YRD A;  1ABQ A;  4QW2 A;  1N27 A;  1OX8 A;  3EFO B;  1QCN A;  3SB2 A;  4M77 F;  4IUU A;  1RUW A;  4RTV A;  4CC4 B;  3P8D A;  4RG8 A;  5IH2 A;  3CME T;  5FWC A;  4EMK A;  1PNJ A;  3CXC A;  2VB6 A;  4FYW B;  2WAC A;  1U06 A;  2P0K A;  3GOX A;  2EKO A;  5A2Q E;  5CKB A;  4QQD A;  2CDT A;  2DFU A;  2EYZ A;  1Q95 G;  3A1P A;  1BYM A;  4FYY B;  1ZQ1 A;  4PJO A;  3CC2 T;  4FM4 B;  5GAM h;  3SWN C;  4Z89 A;  2K79 A;  5KCH A;  4E2F B;  4LDX A;  4N0A C;  1UB4 A;  3RR6 A;  3CCU Q;  1SSF A;  1VQ7 A;  3O5Z A;  1KC8 R;  2JUF A;  1RAB B;  1SF9 A;  3SFM A;  1D0X A;  2F5T X;  2GFA A;  3KXT A;  3LYI A;  3CC4 T;  2QQB A;  3MPU B;  2I2L A;  2M51 A;  5GAO n;  2XID A;  1KHC A;  4E7Z A;  2JM9 A;  3OB9 A;  3VS5 A;  4Z02 A;  2ZAE A;  3QUI A;  1OZ2 A;  2HBW A;  5GAN 3;  1IRE B;  3ZBD A;  2OAW A;  2O88 A;  2LX9 A;  2DL7 A;  3VRY A;  1M4Z A;  1WXU A;  1WQW A;  4Q5W A;  5D6W A;  2DIQ A;  3OYN A;  1HYO A;  1U1S A;  4DBH A;  5GAM j;  3I55 A;  1KJW A;  1LJO A;  3C0C A;  3QHS A;  4DQ2 A;  1VQM A;  4BAC A;  3G4S A;  2V8J A;  2FG0 A;  4NL3 A;  4BDY A;  4M78 E;  3M56 A;  3M0Q A;  1BCO A;  5CVI A;  3VJP A;  5AT1 B;  3GLX A;  4HCB A;  8AT1 B;  1GCQ C;  2K6D A;  3QKJ A;  3H9N A;  2ECZ A;  1KQS S;  1G3W A;  1GCP A;  2KNB B;  1OUL A;  2COY A;  2LZ6 B;  1KD1 C;  4MML A;  2FO0 A;  3JCM X;  1NBE B;  2OTJ A;  2CYZ B;  2EJ9 A;  2JTM A;  3OYA A;  3OYM A;  1QWF A;  3OYY A;  1KQ2 A;  1XOV A;  2AIR B;  3NFC A;  4FL6 A;  2VV5 A;  2DJZ A;  2QDL A;  2X4Y A;  4J83 A;  1ZUY A;  1K73 R;  1BI3 A;  2DEU A;  2OTL Q;  2K3B A;  5IN1 A;  4ELZ C;  3I55 Q;  1QCF A;  1VQM Q;  1Q82 C;  4M78 B;  2RHY A;  2BZY A;  5DLO A;  3NPF A;  4QT7 A;  4EDU A;  4F7U F;  2VVK A;  4QKU A;  1JJ2 A;  3CCR T;  2E5Q A;  2P4T A;  4OMP A;  3TRE A;  2O31 A;  2OTL T;  2DTI A;  3UA6 A;  1R0C B;  1FXX A;  1I4K 1;  1VQM T;  2X4J A;  3VUB A;  5I22 A;  3PTA A;  1GFC A;  3H0F A;  2NUT B;  2JZ2 A;  4JS4 A;  4ZGD B;  2OX7 A;  2YXY A;  2CT3 A;  1SPK A;  5IXF A;  4M7A D;  2G3R A;  4DBR A;  2J06 A;  2KYB A;  2RQV A;  3CC7 T;  2H3E B;  2RI3 A;  3NMZ C;  4FCY A;  3CD6 Q;  4EMK C;  5FRM A;  4QVD A;  2MWO A;  2QTX A;  2KXD A;  4J5Y A;  4PJO G;  2IG0 A;  2CZ6 B;  3CCV T;  3WVE B;  3RER A;  4PJO C;  3EH1 A;  1K73 U;  4RTU A;  2EVR A;  1YJ9 T;  3CD6 T;  1WXT A;  4JJD A;  3EG3 A;  4HA8 A;  2AHJ B;  3REA B;  2EJF A;  4GBQ A;  4CC2 A;  2RPN A;  4MMK A;  1U1T A;  3QJY A;  4R56 A;  4RUG A;  3SEM A;  2WSF E;  1N9S A;  4D8K A;  4IUP A;  4YTL A;  1PD0 A;  4J7I A;  4PLL A;  2ED1 A;  7AT1 B;  1FMW A;  2DXB A;  1PSE A;  1M2V A;  4HKE A;  2A0F B;  2HKQ B;  5LJ3 g;  4E7H A;  2LNV A;  2RK1 A;  4CRI A;  2F1L A;  2M1H A;  2R5M A;  3TCJ A;  5KYW B;  1OOT A;  5GMK e;  2FZK B;  3JCM g;  1AEY A;  2KRO A;  2RNA A;  1Q86 R;  2D8J A;  2HD0 A;  4ORZ A;  4LD9 K;  1CKA A;  2EKH A;  5GAO r;  2PNI A;  1BBZ A;  4A4G A;  3GP8 A;  4HCZ A;  1GFD A;  4X34 A;  3PFS A;  4A53 A;  1Q81 R;  1WQ7 A;  4OB0 B;  1PSF A;  3V7C A;  5DM7 R;  3UT1 A;  3H6Z A;  2CP5 A;  4HCC A;  1YCS B;  4J9B A;  4C0D C;  1MGQ A;  2LCC A;  2NYS A;  2E65 A;  1UE9 A;  1RAF B;  2QAS A;  1H64 1;  1H3Z A;  2DL3 A;  3CXC P;  5LJ3 d;  4WTO B;  3E2U A;  1B07 A;  3QZ5 B;  3V8K A;  4AFQ C;  2CZ0 B;  1VQK T;  4MZM A;  3A98 A;  1D0Y A;  3RUX A;  2JS0 A;  4KGV B;  3CBP A;  3NTH A;  3CCM A;  2L3S A;  5FRO A;  3PVQ A;  2A7Y A;  1NZ9 A;  2GF7 A;  2EQJ A;  3JCM d;  1ABO A;  1VIF A;  3T9N A;  3JB9 G;  5LJ3 f;  1VQO T;  1ZBJ A;  2KT8 A;  3S3M A;  1F1B B;  3CCE Q;  1UG1 A;  1PC0 A;  2W0Z A;  1K4U S;  1UFF A;  1ARK A;  2FPD A;  4M75 F;  2JMA A;  5LJ5 e;  3X25 B;  2CH4 A;  3A8H B;  2YUQ A;  1KG1 A;  3E19 A;  2DE0 X;  3GNG A;  4PJM A;  4LE9 A;  1VQN A;  4DEX A;  3J81 E;  3CCE T;  2KRS A;  3C94 A;  3MP8 A;  4GLM A;  2NUZ A;  1BB9 A;  4PKC C;  1VQP A;  5C0M A;  1GRI A;  2MMP A;  5GAN 2;  1ACM B;  2DIG A;  3OYG A;  4KBM B;  5CQY A;  5D6Y A;  5KYY B;  3CCM Q;  4GLK A;  3CCS A;  3F70 A;  2EJG A;  4B9W A;  5KYX A;  1MND A;  3JV3 A;  4M7D E;  2O2O A;  2A08 A;  1PKT A;  2MWP A;  1S72 A;  4C0G A;  4IUR A;  2CGH A;  4PJO F;  3CQT A;  4V2S A;  2PVG B;  1KQ1 A;  3CCJ Q;  2DD4 A;  2YLC A;  2PTK A;  4EMG A;  1RLQ C;  1VQN Q;  4M77 G;  2XDP A;  2KQW A;  1QKW A;  1G3T A;  1M5Q 1;  3UPU A;  1TXQ A;  4M77 C;  5CIU A;  4DBF A;  3OBW A;  2M02 A;  4M7A A;  3MHX A;  4DBQ A;  1VQP Q;  1I07 A;  2PU9 B;  4M78 D;  2K3X A;  3CCJ T;  4JJC A;  4PK4 A;  5FRN A;  2VXF A;  2W10 A;  1ZSZ A;  2HDA A;  4P5N A;  3NTI A;  3AT1 B;  3OYJ A;  5GAM e;  4M7D B;  3CPW A;  2CH4 W;  2DXC A;  3MEV A;  4KUD K;  1RAH B;  4JS5 A;  5J26 A;  5IHN A;  3M57 A;  5GMK h;  1K8A U;  1VYT A;  1VA7 A;  3QDR B;  4FYV B;  2KI7 A;  2X51 A;  1PD1 A;  1TSF A;  2HBP A;  1NJI R;  3OYI A;  1AHJ B;  1YJN T;  2HKN A;  5KYX B;  3OA6 A;  4II1 A;  3OW2 P;  3LW5 E;  2ZGW A;  1MMA A;  4J9F A;  4GY5 A;  1AWW A;  1UJY A;  4RMO A;  2LJ1 A;  3S3N A;  3EH2 A;  1ZBX A;  4BY6 B;  1WJS A;  1KHI A;  2E6Z A;  1JEG A;  2EYW A;  4PFP A;  4E7L A;  2VWF A;  2J6F A;  2NLU A;  1RAG B;  2DD5 A;  5GMK j;  2HAX A;  1X69 A;  2KAF A;  1IZ6 A;  4Y91 A;  3CME A;  1Y7X A;  2FVU A;  2R5A A;  4AT1 B;  2MK5 A;  1KD1 R;  4D6W A;  1X6G A;  1MNE A;  2KE9 A;  2KXC A;  2CKK A;  2QDY B;  3L2V A;  2CP7 A;  3CC2 A;  1QVG P;  1NJI U;  2DET A;  1Y07 A;  1SHG A;  1N5Z A;  2BUD A;  4KGZ B;  2IIM A;  2E10 A;  4HT8 A;  3QBY A;  4OMN A;  1WGS A;  2QGF B;  1NPR A;  1R8O B;  2RA2 A;  1BIB A;  2VGM A;  3OYF A;  2YSQ A;  1W2B A;  3SWN B;  2F2W A;  1AOJ A;  1G3Y A;  4E7K A;  2RK2 A;  3CC4 A;  1QVP A;  1D3B B;  3PGG A;  4XQ3 A;  5ECA A;  1AVZ C;  4KT0 E;  4F7U G; 
#chains in the Genus database with same CATH homology
 3SDZ A;  4C0Z A;  2KDS A;  1KD1 C;  1VUB A;  2DTO A;  2QI2 A;  4M78 F;  2K5F A;  1W4S A;  4MML A;  3JCM X;  1VQ9 A;  1VQ8 A;  2OTJ A;  3PIP A;  2PQW A;  2CYZ B;  3GF5 A;  4XAX B;  1QVF A;  4C8Q B;  3JRZ A;  2EJ9 A;  2JTM A;  3OYA A;  2L5Q A;  3OYM A;  3OYY A;  4XTX A;  4F7U E;  3L2W A;  5IT9 E;  1KQ2 A;  1XOV A;  3OMC A;  3ME9 A;  3NFC A;  4FL6 A;  2VV5 A;  3UDC A;  4L6V 5;  2DJZ A;  2X4Y A;  1ZHI A;  3QXE B;  4J83 A;  4OB1 B;  3FJP A;  1K9M U;  5I2M A;  4ATO A;  3FC3 A;  1BI3 A;  3R6O A;  4BE1 A;  4QQG A;  5IN1 A;  3OS5 A;  4XTY A;  2FL7 A;  4C5I A;  4ELZ C;  5CKD A;  4M7A G;  2DO3 A;  4XTZ A;  1Y96 A;  2EWN A;  5HY6 A;  1YIT T;  4C92 E;  1KD1 U;  1Q82 C;  2F5K A;  4M78 B;  4OP0 A;  5GAN d;  4BE0 A;  3VYH B;  1VQ4 A;  2QQ9 A;  3RES A;  4M7A C;  2RHY A;  3S3O A;  3M5A A;  5GMK l;  2ZPG B;  5DLO A;  4NOY A;  5A0L A;  4EDU A;  3SWN A;  4F7U F;  4TVR A;  5DLQ E;  2RI2 A;  2RHZ A;  1JJ2 A;  3CCR T;  5GAN 5;  1I81 A;  2E5Q A;  5CQX A;  5GAN f;  4JLI A;  2P4T A;  1WJR A;  3EAE A;  3TRE A;  1D3B A;  2OTL T;  3KUF A;  5LJ5 d;  1UEB A;  2DTI A;  4M77 B;  3QZ9 B;  1O75 A;  5KH6 A;  1FXX A;  1I4K 1;  1G5V A;  2R58 A;  5AYF A;  2X4J A;  3VUB A;  3PTA A;  2RHI A;  5GAN e;  1VQM T;  3C95 A;  4C92 F;  3G6E T;  2JZ2 A;  4XTW A;  5LL6 S;  4ZGD B;  3RKY A;  3OY9 A;  4JS4 A;  3LGL A;  3VYG A;  3HKS A;  2X35 A;  3LX7 A;  3CBO A;  4J8O A;  3H8Z A;  4M7A D;  2G3R A;  2XI9 A;  1QVG S;  2DZC A;  2RI5 A;  2XHC A;  5HK3 A;  3X26 B;  4M75 D;  4F7U B;  3E1S A;  1K73 C;  3CC7 T;  3OYH A;  2VC8 A;  2RI3 A;  4EMK C;  4BD3 A;  5FRM A;  4WF2 A;  1YBY A;  3GPL A;  2D9T A;  4QVD A;  2D6F A;  3ASK A;  3QYH B;  1XQH A;  3HL8 A;  2EFI A;  2FB7 A;  3ZEH A;  2MWO A;  3V7R A;  3L2Q A;  1YIT A;  2QTX A;  4BI3 A;  3JCM P;  1M9S A;  4J5Y A;  4PJO G;  2XIC A;  2RJD A;  2IG0 A;  4C92 B;  2QEX T;  2CZ6 B;  2WSE E;  2DVE A;  3CCV T;  4OMF B;  1YJW T;  4MZT A;  5D6X A;  3MEW A;  4M78 A;  3WVE B;  4BI8 B;  2V8I A;  3JAM E;  1P92 A;  3RER A;  3OS2 A;  1QVF S;  3BW1 A;  4LD6 A;  5CKE A;  1VQ8 T;  4PJO C;  2ZPF B;  3M4Y A;  5KCO A;  3JCM b;  5L8R E;  3JB9 D;  3SD4 A;  3CCR A;  4FIB A;  3RIR A;  3L2R A;  3CPW S;  2EIF A;  1K73 U;  1YJ9 T;  5GAO m;  4JRQ A;  4BDZ A;  3CD6 T;  1WJQ A;  3CCQ T;  3RKW A;  4L59 A;  4A4K A;  4HA8 A;  2AHJ B;  2OTL A;  2LT4 A;  2EJF A;  3M59 A;  1GXI E;  3J7A F;  3OS1 A;  3OYL A;  4EPC A;  4XU3 A;  3FRN A;  2JVV A;  4MMK A;  3OMG A;  5KE3 A;  1U1T A;  3QJY A;  4IUT A;  2JOY A;  4C5G A;  4EMH A;  1M1G A;  4R56 A;  2WSF E;  3G6E A;  1M90 C;  2KMT A;  1N9S A;  3BFM A;  3MEU A;  4RKU E;  1HK9 A;  3P8H A;  4XTV A;  4IUP A;  2P0P A;  2E41 A;  3OSS C;  4YTL A;  4ZN1 A;  4ZN3 A;  4J7I A;  2K4Y A;  4ME7 A;  4PLL A;  5KE2 A;  2IVW A;  1VQ4 T;  3ZFJ A;  3J80 E;  2DXB A;  3CC7 A;  4PJO D;  3A8L B;  1PSE A;  2JTF A;  3A5Z B;  1N9R A;  4OGC A;  3VUZ A;  4HKE A;  5LJ3 g;  4E7H A;  1JJ2 S;  4OB3 B;  2MI6 A;  4F7U A;  2LNV A;  2RK1 A;  1YCY A;  4CRI A;  2VYT A;  4M77 E;  3EFS A;  2M1H A;  4UC4 A;  3OYK A;  3M58 A;  2M9U A;  2R5M A;  3TCJ A;  2KY9 A;  3C12 A;  1OI1 A;  3URG A;  5LJ5 g;  2QQA A;  3CCM T;  4C8Q D;  2QEX A;  5GMK e;  3JCM g;  2PVO B;  4O5V A;  3BY7 A;  3FEO A;  3CCV A;  1YJW A;  5CO7 A;  2F69 A;  3OW2 S;  5J3B A;  3HFO A;  1X75 C;  2HD0 A;  3MET A;  4C92 A;  4M7D D;  1VIE A;  1KC8 U;  1UGQ B;  3HRU A;  4LD9 K;  4RCB A;  5GAM d;  4N4G A;  5GAO r;  1YJ9 A;  3CD6 A;  3WXM B;  2HNI A;  4A4G A;  2L89 A;  3GP8 A;  3G7Z A;  3CCQ A;  4HCZ A;  1NE8 A;  1WPY A;  1K8A C;  2RH2 A;  4X34 A;  4PNO A;  3PFS A;  3TEE A;  3LWH A;  1HXD A;  4A53 A;  1WQ7 A;  3JCM Q;  4OB0 B;  4BY6 C;  2GQV A;  4ZGJ B;  3MCA B;  1PSF A;  5CCA A;  3I56 T;  2YLB A;  4C0F A;  3V7C A;  5HKC A;  3L1A A;  1VQ6 T;  4RG2 A;  5DM7 R;  3JB9 J;  1FWZ A;  1O9S A;  3H6Z A;  5CKH A;  3UT1 A;  1BI0 A;  4HCC A;  2QXF A;  1JRI A;  4M75 G;  2L3R A;  1MGQ A;  2RHX A;  4PL6 A;  4C0D C;  2KVQ G;  2LCC A;  2HQX A;  1VQN T;  1G3S A;  2E65 A;  2E12 A;  1H64 1;  3JCM c;  1H3Z A;  4RCC A;  5CR2 A;  4C5H A;  5A0D A;  4M75 C;  2ZPI B;  2C06 A;  4M7A E;  3MEA A;  5LJ3 d;  4M77 D;  3QZ5 B;  1VQP T;  3V8K A;  2LVM A;  2GCX A;  2CZ0 B;  4M75 E;  4DOV A;  1VQK T;  4MZM A;  3RUX A;  1M1F A;  2E6N A;  2XKO C;  2JN0 A;  4N0A A;  3FDR A;  4KUL A;  3CBP A;  3NTH A;  3CCM A;  5FRO A;  4DA4 A;  1YHQ T;  1Q86 C;  2A7Y A;  4E7I A;  2XDD A;  1NZ9 A;  2GF7 A;  4JJN K;  2YHT A;  2EQJ A;  2RD1 A;  3JCM d;  3A8M B;  4ZTF A;  2VUB A;  4A4H A;  1UGR B;  1VIF A;  3T9N A;  1MHN A;  3JB9 G;  3BDL A;  5LJ3 f;  1VQO T;  1Q82 U;  4NS5 A;  3EFR A;  3JCM W;  3S3M A;  1UGP B;  2K5I A;  2KK4 A;  3C4S A;  3GIB A;  4OGE A;  3CCS T;  1M1K C;  5CKF A;  2M16 A;  3JSC A;  3RMQ A;  1W2B S;  3CCL A;  3QSU A;  4N4H A;  5LJ3 e;  5J39 A;  5LJ5 f;  1Q81 C;  3CEY A;  4IUQ A;  5GAN 7;  4M7A F;  2QA4 A;  1BI1 A;  2EAY A;  1S72 T;  3O8V A;  3DKM A;  4M75 F;  4JRK A;  2R57 A;  3I56 A;  3AHU A;  1KQS A;  4KT0 E;  5DY9 A;  3KBG A;  5LJ5 e;  4ELY C;  4FT2 A;  3X25 B;  5FLX E;  4BE2 A;  1VQ6 A;  3A8H B;  1KG1 A;  2RM4 A;  3JCM e;  2CZ7 B;  5I21 A;  3JCM V;  4A4E A;  2ZPE B;  3MO8 A;  3E19 A;  3OS0 A;  3GNG A;  4N4I A;  5FU6 C;  5HK0 A;  1VQN A;  2LRQ A;  3TU4 K;  5GAO p;  2XD0 A;  2EYQ A;  4XU1 A;  3J81 E;  3CCE T;  1M1K U;  2ZPB B;  3QYG B;  2MF2 A;  2PVD B;  3C94 A;  3MP8 A;  2HQE A;  2X4W A;  2LDM A;  3V8L A;  5LJ3 j;  1N8R C;  2CS7 A;  3X20 B;  1VQL T;  4C0D B;  5M9O A;  3FB9 A;  5GAO l;  2GFU A;  2QQR A;  3V8J A;  5GAM g;  4PKC C;  4M7A B;  1VQP A;  2E70 A;  2X4X A;  2K3Y A;  1QP2 A;  1VQK A;  5GAN h;  4E47 A;  3JB9 F;  4C8Q G;  4PJO E;  3DB4 A;  5C0M A;  4M75 B;  3JCM J;  1NJI C;  2PUK B;  2MMP A;  5GAN 2;  1YHQ A;  2DIG A;  1WNL A;  2DEQ A;  3M9Q A;  3OYG A;  4KBM B;  2CZ1 B;  5CQY A;  3CMA A;  4M7D G;  5D6Y A;  1TH7 A;  5EG2 A;  2Y4X A;  2DK3 A;  4QQ6 A;  2BKD N;  4C8Q C;  2LQK A;  1VQO A;  2MAM A;  1N6A A;  3OYC A;  3M55 A;  4NL2 A;  4GLK A;  3QG1 A;  3CCS A;  3G71 T;  3F70 A;  4JRI A;  4M7D C;  2DKG A;  4QVC A;  2EJG A;  2M0O A;  3CCU T;  2EQK A;  3HHT B;  2K2V A;  4B9W A;  4BI4 A;  3LGF A;  3PMT A;  5GAN 6;  3QPH A;  4BB7 A;  5LJ5 h;  4M7D E;  2XK0 A;  2YRV A;  2LC4 A;  3FIF A;  1M8V A;  1NPP A;  2L8D A;  2MWP A;  1S72 A;  2E64 A;  3L42 A;  3S6W A;  4C0G A;  3VV0 A;  4IUR A;  3L2Z A;  2CGH A;  2XG8 D;  4PJO F;  3PIO A;  3UWN A;  1U8R A;  4V2S A;  4J6W A;  2RB6 A;  2PVG B;  3DB3 A;  1KQ1 A;  2O01 E;  3HRT A;  4EMK B;  3PNW C;  3JB9 I;  2DD4 A;  3QII A;  1LNX A;  4JLG A;  4XK8 E;  2YLC A;  1RI0 A;  4EMG A;  1M90 U;  4X9C A;  3CCE A;  4LDW A;  5GAN 8;  4XTU A;  4M77 G;  4C8Q F;  1YI2 A;  1VQL A;  2O4X A;  2XDP A;  2KQW A;  2RJF A;  1DJ7 B;  1I8F A;  5FU6 B;  2RJE A;  3RKX A;  3OYD A;  4M7D F;  3E9F A;  4LDY A;  4OVA A;  1G3T A;  2V8K A;  1M5Q 1;  1EIF A;  4DOW A;  5GAN j;  1XTD A;  1Y71 A;  1XNI A;  3RMS A;  3CCL T;  2D0Q B;  2LCL A;  4M77 C;  5CIU A;  3UPU A;  3OBW A;  3CBM A;  1BIA A;  1K9M C;  2QQS A;  3PMI A;  3GNF B;  3MHX A;  5I2S A;  2QA4 T;  4M7A A;  2EQU A;  4PJO B;  5A0G A;  2BIV A;  2PU9 B;  4M75 A;  1BKB A;  4M78 D;  2K3X A;  1I5L A;  5GMK i;  3CCJ T;  4E7J A;  5GAM f;  5FRN A;  2VXF A;  3G71 A;  3DLL A;  3LLR A;  2DXU A;  1RL2 A;  4X9D A;  5LJ5 j;  2RO0 A;  3CCU A;  3INZ A;  1YIJ T;  3M4G A;  2K5L A;  4P5N A;  3A8G B;  3NTI A;  3OYJ A;  2ZCF B;  5GAM e;  4M7D B;  4C92 G;  3CPW A;  2DXC A;  1JBM A;  4FU6 A;  1UGS B;  1BI2 A;  1VQ5 T;  3MEV A;  1VQ7 T;  4KUD K;  4JS5 A;  4QW2 A;  5J26 A;  4JUV A;  3V7S A;  1OYX A;  3M57 A;  5GMK h;  1K8A U;  3OQ5 A;  3MP1 A;  1N27 A;  3HFN A;  4C92 C;  3SB2 A;  4M77 F;  3OYB A;  4IUU A;  2RHU A;  3N5B B;  5C6S A;  1V29 B;  3M53 A;  3MP6 A;  3QDR B;  3P8D A;  4RG8 A;  3CME T;  2HBP A;  2A3L A;  3CMA T;  4B9X A;  1B34 B;  4EMK A;  3HRS A;  3VKI A;  4MDW A;  3OYI A;  2XDB A;  3CXC A;  1AHJ B;  3X28 B;  1YJN T;  2WAC A;  2H3J A;  2LTO A;  4KUI A;  3FLG A;  3VU3 C;  3X24 B;  2DTH A;  4OB2 B;  3ER0 A;  3OA6 A;  4XU2 A;  4LDV A;  4R55 A;  4II1 A;  2P0K A;  3GOX A;  5GMK m;  2EKO A;  4ZGE B;  5A2Q E;  5CKB A;  3LW5 E;  2ZGW A;  4PLI A;  4QQD A;  4BUG A;  2ZZD A;  4GY5 A;  4J6X A;  3JCM f;  3M54 A;  1BYM A;  1ZQ1 A;  4RMO A;  2E1H A;  2XU8 A;  3OSV A;  3CC2 T;  4PJO A;  3E9G A;  4C92 D;  3I55 T;  3CCJ A;  4FM4 B;  3S3N A;  1Q86 U;  2LQ8 A;  5GAM h;  1ZBX A;  3G4S T;  1QP3 A;  1WJS A;  3SWN C;  4BY6 B;  1KHI A;  2E6Z A;  3L2U A;  3OW2 A;  1Q7Y C;  3JB9 H;  5GAN 4;  2DZ9 A;  5KCH A;  1YIJ A;  2LT1 A;  2O4X B;  2JNG A;  4E7L A;  4LDX A;  3PT9 A;  4J7F A;  4N0A C;  1UB4 A;  3BDU A;  3HP9 A;  5FU7 C;  1YI2 T;  4C8Q A;  1SSF A;  5IAY A;  2NLU A;  3OYE A;  1VQ5 A;  1VQ7 A;  2JUF A;  2DD5 A;  5GMK j;  2HAX A;  3DLM A;  4ZTJ A;  1Q81 U;  4LDU A;  4M7D A;  2KAF A;  4FSX A;  3SFM A;  1IZ6 A;  2F5T X;  2GFA A;  3KXT A;  4CI0 C;  3LYI A;  3CC4 T;  2QQB A;  2RJC A;  1X6O A;  2I2L A;  4A4F A;  4Y91 A;  5GAO n;  2XID A;  3Q1J A;  2Y4Y A;  3CME A;  1KHC A;  2P0Q A;  3OB9 A;  4Y28 E;  3QO3 A;  1Y7X A;  2FVU A;  4Z02 A;  1Q7Y U;  2R5A A;  5LJ3 h;  3QUI A;  4IUV A;  2DPP B;  1FX7 A;  2OAU A;  1YJN A;  1OZ2 A;  3HPW A;  1B34 A;  5GAN 3;  1IRE B;  1QW1 A;  4JDS A;  3ZBD A;  1VQ9 T;  1JB0 E;  4C8Q E;  3LH0 A;  4D6W A;  2OTJ T;  2WSC E;  2EQM A;  2LX9 A;  3NTK A;  1N8R U;  4IKF A;  1M4Z A;  1WQW A;  4Q5W A;  4M78 G;  5D6W A;  3JCM h;  2DIQ A;  2DXT A;  2CKK A;  3OYN A;  3LWI A;  2QDY B;  3QJ6 A;  4MZP A;  2FHD A;  3L2V A;  1U1S A;  4MDX A;  3CC2 A;  2VGN A;  1LOJ A;  4VUB A;  3P8B B;  5GAM j;  2ZPH B;  3I55 A;  1LJO A;  1Y07 A;  1NJI U;  3QHS A;  4DQ2 A;  4M78 C;  1Y96 B;  2BUD A;  1VQM A;  4BAC A;  3G4S A;  2V8J A;  4M77 A;  4NL3 A;  2E10 A;  4BDY A;  2KSS A;  4HT8 A;  4HT9 A;  5GAO q;  3QBY A;  4FT4 A;  4M78 E;  4XU0 A;  3M56 A;  5GAN g;  4O6J A;  2FYK A;  3CPF A;  5CVI A;  1WGS A;  3VJP A;  3CXC S;  1NPR A;  1R8O B;  4L5G A;  1KC8 C;  2RA2 A;  3OBY A;  5CK9 A;  1BIB A;  2VGM A;  3A8O B;  3OYF A;  4A54 A;  2VXE A;  3SWN B;  1W2B A;  1QVG A;  1OZ3 A;  4JRP A;  1G3Y A;  1X01 A;  3GLX A;  2Y90 A;  3WVD B;  4E7K A;  4HCB A;  2RK2 A;  4J6Y A;  3CC4 A;  5FU7 B;  1QVP A;  3HSB A;  1D3B B;  3PGG A;  4QVZ A;  2DAQ A;  4C5E A;  3QKJ A;  4XQ3 A;  5CAI A;  2B8A A;  1KQS S;  1G3W A;  4OF1 A;  2K57 A;  2PUO B;  4F7U G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...