4FL6A

Crystal structure of the complex of the 3-mbt repeat domain of l3mbtl3 and unc1215
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
314
structure length
309
Chain Sequence
b'AWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title Discovery of a chemical probe for the L3MBTL3 methyllysine reader domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 75
structure length 309
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fl6A01
2RJCA 3ZEHA 2EKOA 3MP8A 2LTOA 3P8HA 3SD4A 4BE1A 4B9WA 1MHNA 1WGSA 3ME9A 2X35A 1RI0A 2L3RA 2L89A 5C6SA 3OYFA 3E9GA 2BKDN 2M16A 2EQUA 3PFSA 2DIGA 2GFUA 4A4EA 1WJRA 2RJEA 3L2UA 2GF7A 5CIUA 2RHZA 4A4GA 3UT1A 3PNWC 2K3YA 2R58A 4OVAA 3OY9A 2PQWA 2BIVA 4PLIA 3L2WA 1G5VA 3L42A 2LCCA 3ASKA 5D6YA 2K3XA 5FRMA 2WACA 3LGLA 4C5EA 4FU6A 3S3MA 2JZ2A 4QQ6A 4C5GA 3OS1A 3NTKA 3MEAA 4BACA 1WJSA 3OYBA 3OMGA 4BD3A 5KE3A 5J26A 3OYNA 4IUUA 1N27A 2RHIA 3QIIA 5KCOA 3LGFA 2E6NA 3H8ZA 4PLLA 2RHXA 2RJDA 5IN1A 2DIQA 4Q5WA 3QKJA 2R57A 2YRVA 5D6XA 5J39A 4X34A 2MWPA 3OYCA 2M0OA 2G3RA 3OYIA 2RJFA 4BDZA 2RHYA 3LX7A 4IURA 4QW2A 2R5AA 3QJ6A 3LYIA 2CKKA 3MEVA 2MWOA 2EQKA 3NTHA 4BDYA 3OMCA 2F5KA 3Q1JA 4BE2A 4QQGA 3EAEA 1OZ2A 3GOXA 3FDRA 4PL6A 3OS0A 3MP6A 3S3OA 1H3ZA 3MP1A 4NS5A 2RI5A 2X4WA 3P8DA 4N4IA 2QQRA 1WJQA 3L2VA 5IAYA 3OYLA 2DAQA 3E9FA 2RO0A 3H6ZA 4LD6A 4N4GA 2GFAA 5FROA 1OI1A 2EQMA 2XDPA 3LH0A 4E7IA 4ZTJA 4ZTFA 2FHDA 4A4FA 2BUDA 5D6WA 3OQ5A 3MEUA 5KE2A 2LVMA 3C4SA 2LRQA 2E5QA 4A4HA 2B8AA 3DB4A 2EQJA 2X4XA 4L59A 3OYGA 4B9XA 4II1A 4GY5A 3MEWA 3PMIA 5KCHA 3FC3A 1XNIA 3OS2A 4CRIA 3S3NA 1SSFA 4E7LA 3L2QA 5FRNA 3LLRA 3UWNA 3OYKA 3META 1OYXA 2NLUA 3OYHA 3DB3A 3OYAA 3KUFA 4EDUA 3OYJA 4E7HA 4IUTA 2LDMA 3OYEA 2XK0A 2HQXA 2RI2A 3DLMA 2R5MA 4QVZA 4RG2A 2O4XB 4IUVA 5KH6A 5M9OA 3OYDA 2L8DA 3F70A 4IUQA 4N4HA 3PMTA 3S6WA 2X4YA 3BDLA 3OB9A 4BE0A 2O4XA 1KHCA 2RHUA 3FEOA 3CEYA 4C5HA 3L2RA 1OZ3A 4E7JA 4FL6A 3FLGA 4E7KA 3MO8A 2QQSA 4Z02A 5C0MA 2HQEA 2VYTA 4QQDA 4IKFA 3QBYA 3OYMA 4C5IA 3M9QA 3O8VA 2P0KA 4UC4A 3NTIA 2EFIA 2D9TA 4HCZA 3OA6A 4IUPA 2RI3A 2IG0A 2M1HA 2JTFA
chains in the Genus database with same CATH superfamily
2FL7A 4J8OA 5I22A 3CCJQ 2KRMA 1R0BG 1TWBA 3JCMW 3JCMh 5GANe 2DEQA 3JAME 3V8KA 1YJNQ 2DKGA 4WF2A 1V76A 1G3WA 4FCYA 3EFSA 1X6OA 4M4ZA 4PFZA 3I5SA 1NEBA 2PZ1A 3SFMA 2QA4Q 4FYXB 1M2VA 3QIIA 5KCOA 1I1JA 1HJDA 1T3LA 2KGTA 3OS5A 5KYUA 2DNUA 1WHHA 2O9VA 1VQNA 2E70A 2G3RA 3NGPA 1E7OA 1QVFS 2KBTA 2EJGA 2JTEA 4J9FA 2CDTA 1IHWA 2RNAA 1Y57A 1OEBA 3D7SB 1G83A 1OX8A 3S3OA 4M7DF 1AWWA 1R0CB 4ME7A 2HCKA 4YTLA 4N4IA 5IT9E 2QQRA 1QVFP 2QDLA 4F16A 3GPLA 1EIFA 1GCQC 1P92A 1SHGA 1YJ9A 2ZPHB 1QVGS 1FMVA 1G8XA 4FYWB 1RADB 1XQHA 1UHCA 3E19A 5KYNA 4M78C 4QKUA 2D6FA 4J9IA 3O5ZA 4JRPA 3ER0A 3HRTA 2H8HA 1QVGP 1NYFA 3LLRA 4M7AC 1BI2A 4OGCA 3OYKA 3OYAA 2X9HA 2J05A 2CP0A 5FWBA 1N8RC 5GJWB 4M7DG 4C0DB 1TG0A 4AMCA 2MI6A 2JN0A 3RKWA 4GLKA 1VQ6T 4Z02A 4KGVB 2HQEA 4OB2B 4BUGA 1G3TA 1MV0B 1OX9A 4JJNK 2P4RA 3CC7T 3C0CA 2L3RA 5GAOr 3CCSQ 5KYWB 2ATCB 7AT1B 4C92F 3UT1A 3OY9A 2BIVA 4E47A 3I56Q 2KRSA 5D6YA 1AZEA 1Q7YC 4QQ6A 5GMKe 2NUPA 3QYHB 1BI3A 3OMGA 4B6MA 5IHKA 3CCVQ 2A7YA 4DA4A 3CCUA 2RHXA 2BE7D 1IXDA 3M55A 4Z89A 4X34A 2C0IA 1VQPA 2R5AA 3M57A 1VQ5Q 4BDYA 2DK3A 2KXCA 2E10A 4A63B 1Q86R 3EAEA 3MHXA 4HVUA 4DBRA 2DETA 2RPNA 5LJ5j 1R8OB 4R0KA 2VB6A 2DL5A 5LJ3d 4C92G 3VKIA 3OYLA 5FLXE 4J7FA 4XU3A 4OGEA 3CC4A 1GL5A 1UE9A 1GRIA 4C0ZA 1JXOA 2GQIA 1BK2A 3GF5A 3ZFJA 1JJ2A 2CT4A 1MNEA 1RAEB 2Y4XA 4GY5A 3FC3A 4CRIA 1KD1C 1GXIE 3L2QA 1V29B 4RTYA 4C0GA 2QXFA 1WHGA 4LNPA 4DBQA 2FZKB 1RACB 3DLMA 5HKCA 4N4HA 3BE3A 2CH4W 3CCQT 4M75D 3EH2A 4E7SA 1RAGB 4JJBA 2FPDA 8ATCB 3M9QA 3LWIA 1OU9A 3CCMA 3ME9A 2FG0A 2LTOA 3TU4K 2P0QA 3CQTA 3JCMb 4JRQA 4MMKA 1VQMQ 3JCMe 5A0LA 1VQ4A 1M1KU 2K6DA 3J81E 5GAOq 4O6JA 1FWZA 5LJ3h 2A28A 3ASKA 2YUOA 2FVUA 9ATCB 2M9UA 5KYYB 4BI8B 4C5GA 3SHWA 4OB1B 1GFCA 4HCCA 3M53A 3JCMJ 1VQ7A 1K9MR 3LGFA 1BCOA 2EYYA 5IHNA 3X24B 1VQLA 1RLPC 2FB7A 1ZUKA 4BDZA 1K0XA 2EBPA 4BI3A 2CH4A 2J6FA 1M2OA 4PNOA 3MKDA 1YJWA 1ZSZA 1WXTA 3VS0A 1Q81C 1D3BB 3OW2S 4AG2C 1VQ9A 1Z9ZA 2RO0A 5FROA 2YHTA 2RD1A 2LRQA 3QUIA 2F2XA 1ABOA 5KCHA 5FU6B 4M75B 4QVCA 2XI9A 2OTLT 5IH2A 2GTOA 1OYXA 2WSCE 1IZ6A 1OQKA 2XK0A 1M9SA 3OYDA 5LJ5f 2HBPA 1KQ1A 2LNHB 4ZGDB 2NWMA 1ACMB 3MO8A 5GJVB 2DZ9A 2DTHA 3CPWA 4M78E 4C92E 2P0KA 2H3EB 2QI2A 4UC4A 2L3QA 2CP2A 2D9TA 2XHCA 2JT4A 4RTZA 4V2SA 4IUPA 4RTVA 3CMAT 1VQ6A 4M7AE 5DLQE 1KK7A 2X35A 1XOVA 2DXCA 3L2ZA 4ZNXA 2LP5A 3CC7A 4FT2A 3L2WA 2K2MA 1VQOQ 3URGA 1QMCA 5FRMA 3LGLA 1ZQ1A 3CCET 1U1SA 2QEXQ 4VUBA 3RIRA 4XTXA 2D1XA 2PTKA 1BYMA 5AT1B 5CKEA 1U8RA 1HYOA 1ARKA 2CZ7B 1K73U 5J3BA 2EYZA 4PLLA 1TUCA 5J39A 5GAN7 2DILA 2HDAA 2QK0A 1H3HA 4E2FB 4OP0A 1BBZA 1CKBA 1S72T 2ZPBB 5EC7A 2HL5C 1TTHB 1YN8A 1ZSZC 4RKUE 4NS5A 5GAMd 1ZBXA 2KYBA 2BTTA 1VQNT 2E64A 2YUNA 4WCIA 3THKA 3G6ET 1UECA 2ROLA 3C4SA 3M0QA 1VQ8Q 2RF0A 4A4HA 2QTVA 1BIAA 2DBKA 1QVFA 4F7UE 1F1BB 1ZBJA 1PRLC 2ABLA 4PFOA 2JMCA 4XTUA 2O31A 4ANJA 1WHJA 3X28B 3DKMA 3VRYA 1I81A 3UA7A 1JB0E 2R5MA 2HSPA 2KVQG 3M4YA 2MAMA 1QVGA 3QHSA 2KQWA 2NYSA 2ESWA 4L5GA 3RESA 1VQKQ 3CCQA 4L6V5 1I4K1 4KULA 3CCJA 1YHQT 2RA2A 2M0YA 4A54A 2CT3A 5EG2A 3OA6A 3TEEA 2MF2A 3P8HA 2JNGA 2ZPFB 2JM8A 2XICA 4J5YA 4RMOA 3E9GA 5GAN6 4KUIA 2EPDA 1I0CA 5GAMh 4A4GA 3PNWC 2K3YA 4DQ2A 4ZN3A 5LJ3e 2QA4A 1VYTA 4D6WA 1N8RU 2DEUA 3QJYA 3JB9F 5IXBA 4KGZB 2LJ1A 2HD0A 2O01E 2VVKA 4ELZC 5CKDA 4LUDA 2RQRA 2YUPA 3QKJA 2RK1A 1IO6A 2JS0A 5ECAA 4FSSA 2EWNA 2HNIA 2C0TA 4BE2A 1QCOA 4FYVB 4M7DA 1EZZB 3CCUT 1M2VB 4C8QA 3H6ZA 5KYUB 1VQPT 3RR6A 2EQMA 1KFZA 2LJ3A 2GQVA 1K8AC 3CMEQ 1EFNA 3UATA 1KQSS 5D6WA 2F69A 3MEUA 3JB9G 4F17A 2DVJA 3M0PA 2QAZA 1V1CA 5CQXA 2ECZA 1KQSP 5FU6C 4M75C 3CC4T 1WXUA 2DYBA 4PJMA 3TVTA 1Q86C 3E1SA 1X2QA 1N5ZA 1AEYA 1B34A 2RI2A 4RG2A 4QVZA 5KH6A 4IUVA 1B7TA 1PCXA 4X1VA 4C5HA 3M54A 3L2RA 3RERA 1RUWA 4DOVA 4NL2A 3QBYA 3OYMA 1KIKA 2AHJB 2D8HA 2LC4A 1NE8A 2FZCB 3TQ7P 3M0TA 1Q95G 2MCNA 1KD1U 2K5IA 1KQ2A 3PFSA 4M77D 3I56A 1OU8A 4A4EA 1PD1A 1YWOA 4OMFB 3VS7A 1PHTA 2LCCA 1NJIC 2K3XA 3CCMT 3CCVA 1KHIA 4CC4B 5LL6S 2KYMA 2KY9A 4BACA 2LCSA 2DM1A 4AFUC 1NLPC 3RMSA 3LH5A 3QO3A 4EMHA 1VQ5A 2GNCA 2YRVA 4RCCA 2CUBA 3KBGA 4IIMA 4HCBA 4A4KA 5GMKl 1VUBA 4LN2A 1WQWA 2NUPB 1KC8C 1OZ2A 1VQ7T 1LJOA 4OB0B 1WLPB 1UUEA 2D8JA 2I0NA 4C8QC 4JPBW 3TCJA 1SPKA 1S72A 2DO3A 1VQLT 4LDYA 3EHQA 3RBBB 3HRSA 2AZVA 3SB2A 1N9RA 1VA7A 2VC8A 1K9MC 1YJWT 1M90R 3G4SQ 3EFOB 3G6EA 2JJ9A 3I55Q 2CSQA 4BI4A 1VQ9T 1AD5A 2LX7A 2RK2A 1RI9A 1S1NA 5GAOp 5CR2A 1GBQA 5LJ5d 1JQQA 2NLUA 3OW2A 3G71Q 1TSFA 3OYJA 2EYWA 4C0FA 1Q81U 2XDBA 2E6ZA 1BU1A 5IHIA 2A0FB 1MNDA 4M77B 2ZPIB 1ZX6A 4OMQA 1H92A 2WSEE 2BZXA 4IKFA 1K4US 2RI3A 4QT7A 2DTOA 2EKOA 1AHJB 3MP8A 2EYQA 2LX9A 2FEIA 3SWNA 3JSCA 1YHQA 2BKDN 4RTWA 1PKSA 5GAMe 1YITQ 1PRMC 2PQWA 1AT1B 1U1TA 1M1KR 3M59A 3CBMA 4MZTA 2RMOA 4HT9A 1WJSA 3C12A 2RHIA 1PNJA 3R6OA 1UTIA 3PVLA 4N0AA 1Q82C 4K11A 1ZUYA 2OJ2A 4F14A 2QDYB 1WFWA 4QW2A 2V8KA 4M78F 2F5TX 3MEVA 2DRKA 5LJ5h 3VS5A 3CC2Q 3CD6T 3RDVA 2FRYA 1X6BA 3FDRA 4PL6A 5GAOn 3VV0A 1LNXA 4M7AF 1VYVA 4HVWA 1WQ7A 2L0AA 3MPUB 3A5ZB 2X4JA 1OI1A 2RB6A 1UHFA 3A8OB 1YIJQ 3OQ5A 3V8LA 3L1AA 1W1FA 2OX7A 3QWYA 2EQJA 2LT4A 3CMAQ 3HRUA 4PJOA 2OTJQ 2C0OA 3H41A 1ZSZB 1UDLA 3OS2A 4J7IA 3EFOA 3IQLA 1SKUB 1NPRA 3OBYA 3JB9I 4XAXB 4BY6B 3META 4M78G 5GAN3 4IUTA 2VWFA 4JJCA 1WHMA 4JDSA 2KSSA 3FJPA 4PJLA 1WXBA 2O4XB 3CCEQ 2XD0A 1M90U 2DL7A 1IREB 4KH0B 3BDLA 4M7AG 3OB9A 2Y4YA 4EMKA 1Y71A 2EKHA 4E7KA 1MV3A 5L23A 3VS4A 1W4SA 1JO8A 3HPWA 4M77A 3NHNA 3KXTA 3JV3A 3AHUA 5GANg 2AT1B 1HK9A 2SRCA 1TH7A 2CZ1B 2IG0A 2QASA 4OMOA 2ROTA 1WGSA 4M75E 1YI2T 3H9NA 2HL3A 2L89A 1VQOA 3SWNC 4F7UF 2DIGA 3A8LB 2J06A 2A3LA 1K1ZA 4DEXA 3VYHB 2CREA 2RHZA 1BI0A 3JRZA 4O5VA 4Y92A 4OVAA 2R58A 2HZYA 3BFMA 4XU0A 3CCJT 1NM7A 1RAIB 3MEAA 4OB3B 2KK4A 1YJNT 3JCMf 1U5SA 2E6NA 3H8ZA 1FXXA 4Q5WA 2CS7A 1BCMA 4N0AC 1O9SA 3VUBA 1K73R 1HSQA 2E65A 2QA4T 2RJFA 4HXJA 2L2PA 1YJ9Q 1TUDA 3LYIA 3V7CA 3GBQA 2HAXA 4LXCA 1J3TA 2A08A 4F7UG 2RI5A 4J9CA 2ENMA 5I2MA 3L2VA 5IAYA 3UA6A 2K7AA 5A2QE 3LH0A 1AWXA 2BUDA 2XU8A 3CXCP 1M3BA 3UDCA 4PKCC 1WNLA 4JLGA 4PJOC 3INZA 2DVEA 3PMIA 2ZZDA 1QLYA 5AYFA 2YLBA 3PGGA 3OYHA 3SEMA 4J9EA 2V8JA 3JCMX 2ZAEA 4AFSC 2HQXA 3M56A 2M02A 3FB9A 2MYSA 4JZ3A 3S6WA 1KQSA 4M7DD 1VIFA 2O4XA 4C8QD 1XTDA 1TU0B 1K8AU 3HHTB 1RAFB 4M77C 5GMKm 2E5KA 3O8VA 2XIDA 4RCBA 2KR3A 2LQKA 4F04B 1PC0A 2XKOC 2ED0A 1G5VA 3BDUA 3PVQA 4PLIA 4LDUA 2FYKA 4ZGJB 3CCST 3S3MA 2QQAA 2DL4A 3J7AF 2MK5A 4BB7A 1N8RR 3I56T 3REAB 2DX1A 5IN1A 2RJDA 2CSIA 1OULA 2YDLA 3CCVT 4JS5A 3CC4Q 1X75C 2BZ8A 3M5AA 3RNJA 5LJ5e 3EG1A 5I11A 4PJJA 4Z88A 4ESRA 2YWWA 4QQGA 3WVDB 1PSEA 2DERA 4GLMA 2WSFE 2DFUA 1VQ5T 3CCLA 1NJIU 3TSZA 3CD6A 4LD6A 1Y07A 2EW3A 4ZGEB 2M51A 3A1PA 3EGDA 2XG8D 1A0NB 4LDWA 2DXTA 4RTTA 1N6AA 2B8AA 1WI7A 1OOTA 2VASA 1FMWA 1NLOC 3QDFA 4II1A 4M7DB 4C8QB 1XNIA 2CUDA 4E7LA 1M8MA 2ZCFB 2FPEA 5FRNA 1PKTA 1PSFA 2D0QB 4XTWA 1KC8U 2J6KA 2PNIA 4BY6C 2DLPA 5M9OA 2L8DA 4D8DA 1E6HA 4LDVA 4BE0A 3FEOA 1OZ3A 4E7JA 2LZ6B 2VXEA 1VQ4Q 4DOWA 1R77A 3QZ5B 2EJ9A 3JCMg 1WX6A 4RUGA 3X26B 3SD4A 1B34B 4BE1A 1VIEA 1M1FA 1RI0A 3EG0A 4J6YA 3WXMB 1NPPA 1VQ7Q 1G3YA 2GF7A 2V8IA 1KD1R 3RMQA 1YI2A 3CCRA 1VOMA 1VQLQ 2WACA 4X9CA 4C5EA 1VQMT 8AT1B 3NFCA 4HT8A 2VGMA 4KUDK 3H0IA 1YJWQ 5CQYA 4FIBA 2RM4A 2IIMA 5D6XA 3V7SA 1VQ9Q 1YJNA 2DD4A 3WVEB 2QTXA 1X2KA 2F5KA 2CYZB 3V7RA 2IPOB 2MOXA 3QYGB 3EGXA 5I2SA 4EPCA 4JS4A 1M1KC 4ORZA 4XU1A 1UB4A 2DAQA 3VJPA 1QP3A 2XDPA 3A8HB 3G4SA 2FHDA 4A4FA 1W70A 2K57A 1I5OB 1Y96A 2E5QA 2YXYA 3CBPA 3LWHA 1Q82U 1GCPA 1T0HA 1T3SA 1SEMA 2QG9B 3MEWA 3OBWA 3T9NA 1UG1A 1RABB 3G1JA 4LE9A 1Z9QA 1MUZA 3EGUA 5FWCA 2QGFB 1Q7YU 3EFRA 1MMGA 2PUOB 1VQ6Q 3JB9J 2PVOB 3PMTA 2YLCA 3CPFA 2DL8A 1Q81R 2K4YA 2OAUA 3OYYA 4PJNA 1C6VX 1UJ0A 2CP7A 2LT1A 3CC7Q 3TSWA 3VS6A 2FRWA 4PJOD 1QVPA 3HKSA 4ATOA 3L2UA 5GAN5 1UEBA 3SDZA 3PIOA 1O75A 4DBFA 3E2UA 3JCMc 2JZ2A 4J9GA 3OS1A 2KT8A 1VQOT 3OYBA 3HFNA 4M77E 5KE3A 1WZOA 3QSUA 4IUUA 3CCSA 3SWNB 2QEXT 2DIQA 2B86A 2QYZA 2PUKB 3CC2A 3OYCA 2VXFA 2C06A 2COYA 4M78A 2QQ9A 4C92A 1I07A 2EQKA 2EGCA 2RQTA 2E12A 4JJDA 1UGQB 4M75F 1YIJA 4FT4A 1H8KA 1E6GA 5GANf 2HEQA 3CPWP 1M27C 4ZTJA 4ZTFA 2JVVA 1AZGB 5KE2A 2VV5A 2OAWA 3R6NA 1X69A 3S3NA 1NYGA 5IXFA 1VQ8T 4FYYB 4M7DC 3C95A 3M0UA 3CBOA 3CCQQ 3KUFA 5CKBA 2LDMA 3GNFB 3J80E 1UGSB 3FRNA 3QWXX 3F70A 2VKNA 1I8FA 3NMZC 4M75G 4PJOB 2RHUA 1KHCA 2E1HA 2LMJA 4OMMA 4FL6A 2DJZA 4E7ZA 4J6XA 4J9DA 4MDXA 5C0MA 2DL3A 4XTZA 1YBYA 2DZCA 4HCZA 3NTIA 1HXDA 2EFIA 3EG9A 5HK0A 2JOYA 1EX4A 2M1HA 1HD3A 5GAN2 1VQKT 4AFQC 3PTAA 2DXBA 5I21A 5LJ3g 3MCAB 1ZA2B 4F7UA 2V26A 2DBMA 2EGEA 1QCNA 4EMKB 2HBWA 1MMNA 1PG5B 1IRXA 1SRLA 1KSWA 1YCYA 3FJ5A 2HKNA 2W0ZA 2JXBA 2CZ6B 2E4HA 3A8MB 3VS1A 1PD0A 5CK9A 4C8QF 4A53A 2DTIA 4HA8A 1M1GA 2KDSA 4XU2A 2KRNA 1VQMA 1H641 2RN8A 2CP5A 2SEMA 5GAMf 4DEYA 2YSQA 2GBQA 3PE0A 1WDXA 2ZPEB 1D0YA 1GFDA 3VS3A 3QJ6A 4C92C 2LCLA 3OMCA 2CZ0B 1AOJA 1FYNA 3MP1A 4WTOB 4R55A 1TS9A 4QVDA 2KROA 2Z0WA 2JMAA 2MPXC 2K9GA 3JB9D 4C8QG 2OTLQ 5FU7C 2MMPA 3DB4A 1U3OA 2X4XA 3OYGA 4GBQA 3CMET 2HKQB 3CCLT 2JTMA 3H0FA 2AIRB 2DRMA 4J9BA 3REBB 4J9HA 3UWNA 5DLOA 2GTJA 4E7HA 1X27A 2BZYA 4PK4A 2K3BA 2DMOA 1SHFA 2KMTA 4RTXA 2P0PA 5D7UA 1QP2A 1UJYA 4EMGA 4FW1A 3FLGA 3U23A 3PIPA 2LQWA 2O9SA 3FIFA 2HSEB 1YFNA 2X3WD 2E41A 4JRKA 1IB8A 2PU9B 1W2BS 1K8AR 3M4GA 1WHLA 2XMFA 1MGQA 2DPPB 4XTVA 2KAFA 4FSXA 2GFUA 2RJEA 3HFOA 1W2BP 1QKXA 4X9DA 2COWA 2KXDA 2F1LA 1M8VA 1Y7XA 3NTKA 2NUTB 1SF9A 1AWJA 5HK3A 4BD3A 3OYNA 3I9QA 5KYXB 1SSHA 1I5LA 1NG2A 3NPFA 3CCRT 1S72Q 5GMKi 2DD5A 2RHYA 3LX7A 2QEXA 1NEGA 3N5BB 5HCKA 2G6FX 4RG8A 1VQNQ 1D0ZA 1QWEA 1OPKA 3ULRB 2X3XD 1H3ZA 2AKKA 1NZ9A 3G6EQ 2OI3A 1ZHIA 1UGPB 1WJQA 5HY6A 2DYIA 1RAAB 4N4GA 2AZSA 1M3AA 1QW1A 5CO7A 1C1AA 1ZLMA 1NJIR 2EGAA 3M58A 3G7ZA 1D09B 3EG3A 1U06A 3KFVA 4L59A 2NUZA 2RQUA 2ZGWA 2PVGB 1XJWB 1LPLA 1JEGA 3JCMQ 4JZ4A 3CXCS 3V8JA 3G4ST 3I55T 4DBHA 1VQ8A 3OYEA 2XDDA 3EGDB 2F2VA 2K79A 1MMAA 3QDRB 1KC8R 2A37A 3UPUA 2JM9A 2J7IA 3G71T 4Z8AA 2LNVA 3CEYA 3BW1A 2W10A 1JXMA 1DJ7B 3BY7A 5CVIA 5KYWA 1YHQQ 2FO0A 1G3SA 1W6XA 4KT0E 2QQSA 2RH2A 1FX7A 3X25B 5DY9A 1SRMA 4PFPA 1WPYA 4KGXB 5GAMg 2RJCA 3ZEHA 4IIOA 2I2LA 4M7DE 1MHNA 2D0NA 4C8QE 3OYFA 3QZ9B 4MMLA 1VQKA 2EYXA 5CIUA 1AWOA 3PT9A 4EMKC 4HCKA 2YRDA 3L42A 2FZGB 2IVWA 2JS2A 1YITT 5LJ3j 2Y90A 3OSSC 1N9SA 5J26A 1QQJA 1N27A 2NUTA 5KYXA 3RUXA 5GAOl 2R57A 3QG1A 2MWPA 2M0OA 1Q86U 1K0SA 4IURA 4KBMB 3CCUQ 3OW2P 3RKYA 2DA9A 2CKKA 4PJOF 2MWOA 3VU3C 3M0RA 1BIBA 3Q1JA 2LJ0A 4CC7A 1BKBA 1T0JA 1M5Q1 1VQPQ 2YRCA 5GANd 4MZMA 4TVRA 2X51A 3JCMP 2BE9B 3CC2T 2VGNA 4E7IA 1BI1A 4LUEA 3UF4A 1X43A 2GGRA 2L3SA 4C0DC 4M77F 4B9XA 1YIJT 2ED1A 3EGXB 5CCAA 1X01A 3HP9A 2P84A 4LD9K 2JW4A 2EJFA 1Q82R 1RAHB 2OTJT 2EAYA 3CMEA 4M78D 4EDUA 4PJOG 4C92D 2COZA 3EHRA 3RKXA 1Y96B 1AVZC 1ZSGA 2FPFA 1YP5A 1YWPA 2K2VA 4IUQA 5GAN4 1D1CA 2X4YA 1Q7YR 1MMDA 4M7AD 1UGRB 1WA7A 2V1RA 2QQBA 1K76A 5CKFA 2RQWA 4JUVA 2KI7A 5KYYA 4AFZC 2JUFA 4HVVA 2A36A 2HQHA 1M3CA 2HMAA 4M77G 2M16A 2EQUA 1WJRA 3CCMQ 3H0HA 5GANh 4XQ3A 3QPHA 1GBRA 2EIFA 1C0MA 3VYGA 4ZN1A 1K9MU 3I35A 1M90C 3VRZA 2H3JA 1D3BA 3HL8A 3P8BB 4AG1C 3QXEB 1QCFA 1WHKA 2KNBB 2O2OA 4XK8E 3VUZA 1CSKA 5GAN8 1M30A 1CKAA 1IGUA 2MIOA 2RQVA 2YUQA 5A0GA 1JJ2S 1QKWA 3NTHA 5CKHA 2DXUA 3ZBDA 2VUBA 3GIBA 5GANj 1NBEB 3OSVA 2KT1A 2V1QA 1YJ9T 4M75A 2KE9A 1KJWA 2YT6A 2CP6A 3MJXA 1JBMA 3P8DA 4J83A 3EH1A 1JJ2P 2CGHA 3X20B 3GNGA 5L8RE 2EQIA 1PWTA 4OMPA 2LQ8A 4M78B 5LJ3f 4C92B 1X6GA 5DM7R 1M4ZA 3GLXA 1WIEA 1JU5C 1RL2A 1B07A 4M7AB 6AT1B 3C94A 1RLQC 3EG2A 3A8GB 2PVDB 4OMLA 1YCSB 2K5LA 3ZL7C 5FW9A 1D1AA 1G2BA 1ABQA 5FU7B 4AT1B 3I55A 4E6RA 1B3QA 4QQDA 4Y91A 1WYXA 3G71A 4Y28E 4XTYA 5CAIA 1OPLA 4B9WA 2KEAA 5C6SA 2P4TA 2F2WA 2AKLA 2CP3A 1D0XA 4OF1A 3JCMV 3M0SA 2K5FA 4CC2A 4LDXA 4KH1B 5A0DA 4CI0C 5GAMj 4FU6A 5GMKh 3EG9B 4ELYC 2E3IA 4PJOE 1W2BA 4F7UB 5LJ5g 4OMNA 1YITA 4MZPA 4NL3A 1JRIA 3CCLQ 1LVKA 4JLIA 4MDWA 2E3HA 2J6OA 3CD6Q 3OYIA 4P5NA 1UGVA 2DF6A 4NOYA 4FM4B 3DLLA 2QGGA 4FW2A 3GOXA 3JCMd 3OS0A 3MP6A 4JRIA 2X4WA 4R56A 1TXQA 2AK5A 1GCQA 2OTLA 3E9FA 5GMKj 3TREA 2GFAA 2LQNA 1FMKA 1UFFA 1SG5A 2LVMA 4KRTA 4RTUA 1KG1A 1TOVA 3CPWS 3HTRA 1BB9A 1OV3A 3HSBA 1SSFA 2DJQA 4M7AA 3A98A 3AT1B 1YNZA 1LCKA 1K9AA 3GP8A 3DB3A 2L3PA 1PM3A 4EIKA 2L5QA 2GCXA 4CC3A 3JB9H 1TUGB 2EVRA 3CMAA 2OTJA 1Y0MA 4HKEA 2DE0X 1LOJA 1D1BA 2ZPGB 3VS2A 4D8KA 1IHVA 4J6WA 5GAOm 1VYUA 1ZA1B 2VYTA 3I5RA 1K73C 1YI2Q 3CCRQ 4C5IA 1ZUUA 3LW5E 1IGQA 1QWFA 3CXCA 2O88A 1VQ4T 2JTFA 3CCEA
chains in the Genus database with same CATH topology
1MGQA 2MF2A 2FL7A 3P8HA 2DPPB 2JNGA 2LQKA 2ZPFB 4J8OA 2XICA 4XTVA 4J5YA 2KAFA 2XKOC 4FSXA 4RMOA 3E9GA 5GAN6 4KUIA 2GFUA 3JCMW 2RJEA 3JCMh 5GANe 3HFOA 2DEQA 3JAME 5GAMh 3V8KA 4A4GA 3PNWC 4X9DA 2K3YA 1G5VA 3BDUA 4DQ2A 4PLIA 4ZN3A 4LDUA 5LJ3e 2DKGA 2QA4A 2FYKA 4ZGJB 4WF2A 4D6WA 3CCST 1N8RU 1M8VA 1G3WA 2QQAA 3S3MA 3QJYA 3EFSA 3JB9F 1Y7XA 1X6OA 3NTKA 3J7AF 2HD0A 2O01E 5HK3A 3SFMA 4BB7A 4ELZC 4BD3A 5CKDA 3OYNA 3I56T 3QIIA 5KCOA 1I5LA 5IN1A 2RJDA 3CCRT 3OS5A 3QKJA 2RK1A 5GMKi 1VQNA 2E70A 2G3RA 4JS5A 2DD5A 3CCVT 2RHYA 1QVFS 3LX7A 2EJGA 2QEXA 1X75C 2EWNA 2HNIA 3M5AA 5LJ5e 3N5BB 4BE2A 4RG8A 4QQGA 3WVDB 1PSEA 3S3OA 1H3ZA 4M7DA 2WSFE 4M7DF 1NZ9A 4C8QA 3CCUT 4ME7A 1VQ5T 3CCLA 1ZHIA 4N4IA 1UGPB 1WJQA 2QQRA 4YTLA 5HY6A 5IT9E 1NJIU 3CD6A 3GPLA 1EIFA 4LD6A 4N4GA 1P92A 1QW1A 1Y07A 3H6ZA 5CO7A 1YJ9A 1VQPT 2EQMA 4ZGEB 2GQVA 2ZPHB 1QVGS 1K8AC 1KQSS 5D6WA 2F69A 2XG8D 3MEUA 4LDWA 3JB9G 2DXTA 3M58A 3G7ZA 1N6AA 2B8AA 1XQHA 3E19A 4L59A 4M78C 2D6FA 2ZGWA 2PVGB 4II1A 4M7DB 4JRPA 4C8QB 1XNIA 3ER0A 3JCMQ 3HRTA 4E7LA 3CXCS 2ZCFB 5CQXA 3V8JA 5FRNA 3LLRA 4M75C 5FU6C 3CC4T 4M7AC 3G4ST 1BI2A 1Q86C 3E1SA 4OGCA 1PSFA 2D0QB 3OYKA 4XTWA 3I55T 1KC8U 3OYAA 1VQ8A 3OYEA 2XDDA 4BY6C 1B34A 2RI2A 4RG2A 4QVZA 3QDRB 5KH6A 4IUVA 5M9OA 2L8DA 1N8RC 3UPUA 4M7DG 3G71T 4LDVA 4C0DB 2LNVA 3FEOA 4C5HA 3CEYA 3M54A 3BW1A 2MI6A 1OZ3A 1DJ7B 3BY7A 5CVIA 3L2RA 2JN0A 4E7JA 3RERA 1G3SA 2VXEA 4DOVA 4DOWA 3RKWA 4NL2A 4GLKA 4KT0E 1VQ6T 2QQSA 4Z02A 2HQEA 3QBYA 2RH2A 4OB2B 3OYMA 1FX7A 2AHJB 2LC4A 3QZ5B 5DY9A 1G3TA 3X25B 2EJ9A 4BUGA 1NE8A 3JCMg 1WPYA 3CCEA 5GAMg 4JJNK 2RJCA 3ZEHA 3X26B 3SD4A 1B34B 2I2LA 4BE1A 3CC7T 1KD1U 2K5IA 1MHNA 1VIEA 4M7DE 1M1FA 1RI0A 2L3RA 4J6YA 4C8QE 3OYFA 1KQ2A 3PFSA 4M77D 3I56A 3WXMB 3QZ9B 1NPPA 4MMLA 4A4EA 5GAOr 1G3YA 2GF7A 2V8IA 1VQKA 5CIUA 3RMQA 4PJOB 4C92F 3PT9A 4OMFB 3UT1A 3CCRA 1YI2A 3OY9A 4EMKC 2BIVA 4E47A 3L42A 2LCCA 5D6YA 1NJIC 2K3XA 2WACA 2IVWA 4X9CA 4C5EA 3CCMT 3CCVA 1VQMT 1Q7YC 1KHIA 4QQ6A 5GMKe 5LL6S 3QYHB 1YITT 5LJ3j 2Y90A 2KY9A 3NFCA 4HT8A 4BACA 2VGMA 3OSSC 1BI3A 4KUDK 1N9SA 3OMGA 5J26A 3RMSA 1N27A 2A7YA 3QO3A 5CQYA 4FIBA 3CCUA 4DA4A 2RHXA 4EMHA 2RM4A 1VQ5A 3RUXA 5GAOl 3M55A 2R57A 2YRVA 4RCCA 5D6XA 3V7SA 3QG1A 1YJNA 4X34A 2MWPA 2M0OA 3KBGA 2DD4A 1Q86U 4A4KA 5GMKl 1VUBA 1VQPA 4HCBA 4IURA 4KBMB 3WVEB 2R5AA 3M57A 3RKYA 2QTXA 2CKKA 4PJOF 2MWOA 4BDYA 2DK3A 3VU3C 1WQWA 1BIBA 2E10A 2F5KA 2CYZB 3Q1JA 3V7RA 1BKBA 1KC8C 3EAEA 1OZ2A 3MHXA 1M5Q1 1LJOA 3QYGB 5GANd 1VQ7T 4OB0B 4MZMA 5LJ5j 4TVRA 5I2SA 4EPCA 4JS4A 4C8QC 1R8OB 3JCMP 1M1KC 3TCJA 1S72A 2DO3A 5LJ3d 4C92G 4XU1A 3CC2T 1VQLT 3VKIA 1UB4A 2DAQA 3VJPA 5FLXE 3OYLA 4J7FA 4XU3A 1QP3A 4LDYA 2VGNA 4OGEA 3CC4A 2XDPA 3A8HB 1BI1A 3G4SA 4E7IA 2FHDA 4A4FA 3HRSA 2K57A 3SB2A 1N9RA 2VC8A 1K9MC 1Y96A 2E5QA 4C0ZA 1YJWT 3CBPA 3GF5A 3ZFJA 1JJ2A 3LWHA 3G6EA 1Q82U 4C0DC 4M77F 4B9XA 2Y4XA 3MEWA 3OBWA 4GY5A 4BI4A 3FC3A 1VQ9T 1YIJT 5CCAA 4CRIA 1KD1C 3T9NA 1GXIE 1X01A 3L2QA 3HP9A 1V29B 4LD9K 2EJFA 2RK2A 4C0GA 2QXFA 5GAOp 2OTJT 5CR2A 2EAYA 3CMEA 5LJ5d 2NLUA 3OW2A 4M78D 4EDUA 4PJOG 4C92D 3OYJA 1Q7YU 3EFRA 4C0FA 1Q81U 3RKXA 3DLMA 2XDBA 2PUOB 5HKCA 1Y96B 3JB9J 2PVOB 2K2VA 3PMTA 2E6ZA 2YLCA 2X4YA 3CPFA 4IUQA 4N4HA 4M75D 5GAN4 3CCQT 4M7AD 1UGRB 2K4YA 4M77B 2QQBA 2OAUA 2ZPIB 3OYYA 2LT1A 2WSEE 5CKFA 4IKFA 4JUVA 3M9QA 3LWIA 2JUFA 2RI3A 3CCMA 3ME9A 2DTOA 2EKOA 1AHJB 3MP8A 2EYQA 2LTOA 2LX9A 2P0QA 3TU4K 4PJOD 3JCMb 3OA6A 3SWNA 4JRQA 3JSCA 1QVPA 2BKDN 2M16A 2EQUA 3HKSA 4M77G 4MMKA 1YHQA 4ATOA 1WJRA 3JCMe 5A0LA 1VQ4A 1M1KU 5GANh 3L2UA 5GAMe 4XQ3A 5GAN5 3QPHA 3J81E 5GAOq 1UEBA 2EIFA 3SDZA 2PQWA 4O6JA 1U1TA 1FWZA 5LJ3h 3PIOA 1O75A 3VYGA 3ASKA 3M59A 2FVUA 2M9UA 3JCMc 4BI8B 2JZ2A 3CBMA 4C5GA 4ZN1A 3OS1A 4MZTA 1K9MU 4HT9A 4OB1B 1WJSA 3C12A 3OYBA 1VQOT 3HFNA 4M77E 5KE3A 2H3JA 3M53A 1M90C 3JCMJ 1D3BA 3HL8A 3P8BB 2RHIA 4IUUA 3CCSA 3QXEB 1VQ7A 3QSUA 3SWNB 3R6OA 3LGFA 2QEXT 4N0AA 2DIQA 4XK8E 3VUZA 1Q82C 5GAN8 2PUKB 3X24B 3CC2A 3OYCA 2VXFA 1VQLA 2C06A 2FB7A 2QDYB 5A0GA 4BDZA 1JJ2S 4M78A 2QQ9A 4QW2A 4BI3A 2V8KA 4M78F 2F5TX 4C92A 3MEVA 2EQKA 3NTHA 5CKHA 5LJ5h 2DXUA 3ZBDA 4PNOA 2E12A 2VUBA 3GIBA 5GANj 3OSVA 3CD6T 1YJWA 1UGQB 3FDRA 4PL6A 1YJ9T 5GAOn 3VV0A 4M75A 1Q81C 4M75F 1LNXA 1D3BB 4M7AF 1JBMA 3P8DA 1WQ7A 4J83A 3OW2S 1YIJA 3A5ZB 1VQ9A 4FT4A 2CGHA 5GANf 2RO0A 3X20B 5FROA 2X4JA 3GNGA 1OI1A 2RB6A 5L8RE 4ZTJA 2YHTA 4ZTFA 3A8OB 2RD1A 2JVVA 2LQ8A 3OQ5A 4M78B 5LJ3f 3L1AA 3V8LA 4C92B 5KE2A 4BE0A 2LRQA 3QUIA 2VV5A 5DM7R 1M4ZA 2EQJA 2LT4A 3HRUA 4PJOA 3GLXA 1RL2A 5FU6B 4M75B 4QVCA 4M7AB 2XI9A 5KCHA 3OS2A 4J7IA 3S3NA 2OTLT 1VQ8T 1NPRA 3OBYA 3JB9I 3C94A 4M7DC 4XAXB 3C95A 4BY6B 3CBOA 1OYXA 3META 3A8GB 2PVDB 2WSCE 3KUFA 4M78G 5CKBA 1IZ6A 4IUTA 2K5LA 5GAN3 2LDMA 3GNFB 4JDSA 3J80E 2KSSA 3FJPA 2XK0A 1M9SA 3OYDA 2O4XB 5FU7B 1UGSB 3FRNA 2XD0A 5LJ5f 3F70A 1M90U 3I55A 1IREB 1I8FA 4M75G 3BDLA 2HBPA 1KQ1A 3OB9A 2Y4YA 4EMKA 2RHUA 1KHCA 4M7AG 1Y71A 4ZGDB 2E1HA 4FL6A 1YI2T 2DJZA 4E7KA 3MO8A 4J6XA 1W4SA 4MDXA 3KXTA 3HPWA 4M77A 5C0MA 2DZ9A 4QQDA 2DTHA 4Y91A 3CPWA 3G71A 4M78E 4XTZA 4Y28E 4C92E 2P0KA 2QI2A 3AHUA 1YBYA 2DZCA 4UC4A 1HXDA 2EFIA 2D9TA 2XHCA 1HK9A 3NTIA 4HCZA 5GANg 4XTYA 4IUPA 4V2SA 5HK0A 2IG0A 2M1HA 2JOYA 1TH7A 2CZ1B 5CAIA 5GAN2 1VQKT 3PTAA 3CMAT 1VQ6A 2DXBA 5I21A 4B9WA 1WGSA 3MCAB 4M75E 5DLQE 2X35A 5C6SA 5LJ3g 2L89A 2P4TA 1VQOA 1XOVA 4F7UA 3SWNC 2DXCA 4F7UF 2DIGA 3A8LB 4OF1A 2A3LA 4EMKB 3L2ZA 3JCMV 3VYHB 2RHZA 2K5FA 1BI0A 3JRZA 4O5VA 3CC7A 4FT2A 4LDXA 4OVAA 2R58A 1YCYA 3BFMA 3URGA 5A0DA 3L2WA 4XU0A 3CCJT 4CI0C 5FRMA 3LGLA 2CZ6B 5GAMj 4FU6A 1ZQ1A 3A8MB 3CCET 1U1SA 4VUBA 5CK9A 5GMKh 3RIRA 4ELYC 4C8QF 4A53A 2DTIA 3MEAA 4HA8A 4XTXA 4PJOE 1M1GA 2KDSA 4OB3B 4XU2A 5CKEA 1BYMA 1U8RA 2KK4A 1YJNT 1W2BA 3JCMf 1VQMA 1H641 2CZ7B 1K73U 5J3BA 4F7UB 5GAMf 2E6NA 3H8ZA 4PLLA 5LJ5g 1YITA 4MZPA 1FXXA 1JRIA 4NL3A 4N0AC 2CS7A 4Q5WA 4JLIA 5J39A 4MDWA 5GAN7 1O9SA 3VUBA 2E65A 3OYIA 2QA4T 2RJFA 2ZPEB 4P5NA 3QJ6A 4OP0A 3LYIA 2LCLA 4C92C 4NOYA 3OMCA 3V7CA 4FM4B 3DLLA 3CXCA 1S72T 2HAXA 2ZPBB 2CZ0B 3GOXA 3JCMd 3OS0A 3MP6A 4JRIA 3MP1A 4RKUE 4NS5A 4F7UG 2RI5A 5GAMd 4R55A 2X4WA 4R56A 1ZBXA 4QVDA 5I2MA 3L2VA 1VQNT 5IAYA 2OTLA 3E9FA 2E64A 5GMKj 3TREA 2GFAA 5A2QE 3LH0A 3G6ET 2BUDA 2XU8A 3JB9D 2LVMA 3C4SA 4C8QG 1KG1A 5FU7C 2MMPA 4A4HA 3DB4A 3UDCA 1BIAA 4PKCC 1QVFA 2X4XA 1WNLA 4F7UE 4JLGA 3OYGA 4PJOC 3INZA 2DVEA 3CMET 3CPWS 3CCLT 3PMIA 3HSBA 2JTMA 1SSFA 4XTUA 2ZZDA 4M7AA 5AYFA 3UWNA 2YLBA 3DKMA 3PGGA 3X28B 5DLOA 3OYHA 3GP8A 3DB3A 4HCCA 1I81A 4E7HA 2L5QA 2GCXA 2V8JA 3JCMX 4M7AE 3JB9H 1JB0E 2HQXA 3M56A 2R5MA 3CMAA 2KVQG 3M4YA 3FB9A 2OTJA 2KMTA 2MAMA 3S6WA 1QVGA 2P0PA 1KQSA 4M7DD 1VIFA 1QP2A 3QHSA 2KQWA 2O4XA 1LOJA 2ZPGB 4HKEA 4C8QD 4EMGA 1XTDA 3FLGA 4J6WA 4L5GA 5GAOm 1K8AU 3RESA 3PIPA 3HHTB 2VYTA 3FIFA 4M77C 1K73C 3CCQA 2E41A 4C5IA 3O8VA 4JRKA 5GMKm 4L6V5 1I4K1 3LW5E 4KULA 2PU9B 1W2BS 3CCJA 1YHQT 2RA2A 4A54A 2XIDA 5EG2A 3M4GA 4RCBA 1VQ4T 2JTFA 3TEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJC A;  3ZEH A;  2EKO A;  3MP8 A;  2LTO A;  3P8H A;  3SD4 A;  4BE1 A;  4B9W A;  1MHN A;  1WGS A;  3ME9 A;  2X35 A;  1RI0 A;  2L3R A;  2L89 A;  5C6S A;  3OYF A;  3E9G A;  2BKD N;  2M16 A;  2EQU A;  3PFS A;  2DIG A;  2GFU A;  4A4E A;  1WJR A;  2RJE A;  3L2U A;  2GF7 A;  5CIU A;  2RHZ A;  4A4G A;  3UT1 A;  3PNW C;  2K3Y A;  2R58 A;  4OVA A;  3OY9 A;  2PQW A;  2BIV A;  4PLI A;  3L2W A;  1G5V A;  3L42 A;  2LCC A;  3ASK A;  5D6Y A;  2K3X A;  5FRM A;  2WAC A;  3LGL A;  4C5E A;  4FU6 A;  3S3M A;  2JZ2 A;  4QQ6 A;  4C5G A;  3OS1 A;  3NTK A;  3MEA A;  4BAC A;  1WJS A;  3OYB A;  3OMG A;  4BD3 A;  5KE3 A;  5J26 A;  3OYN A;  4IUU A;  1N27 A;  2RHI A;  3QII A;  5KCO A;  3LGF A;  2E6N A;  3H8Z A;  4PLL A;  2RHX A;  2RJD A;  5IN1 A;  2DIQ A;  4Q5W A;  3QKJ A;  2R57 A;  2YRV A;  5D6X A;  5J39 A;  4X34 A;  2MWP A;  3OYC A;  2M0O A;  2G3R A;  3OYI A;  2RJF A;  4BDZ A;  2RHY A;  3LX7 A;  4IUR A;  4QW2 A;  2R5A A;  3QJ6 A;  3LYI A;  2CKK A;  3MEV A;  2MWO A;  2EQK A;  3NTH A;  4BDY A;  3OMC A;  2F5K A;  3Q1J A;  4BE2 A;  4QQG A;  3EAE A;  1OZ2 A;  3GOX A;  3FDR A;  4PL6 A;  3OS0 A;  3MP6 A;  3S3O A;  1H3Z A;  3MP1 A;  4NS5 A;  2RI5 A;  2X4W A;  3P8D A;  4N4I A;  2QQR A;  1WJQ A;  3L2V A;  5IAY A;  3OYL A;  2DAQ A;  3E9F A;  2RO0 A;  3H6Z A;  4LD6 A;  4N4G A;  2GFA A;  5FRO A;  1OI1 A;  2EQM A;  2XDP A;  3LH0 A;  4E7I A;  4ZTJ A;  4ZTF A;  2FHD A;  4A4F A;  2BUD A;  5D6W A;  3OQ5 A;  3MEU A;  5KE2 A;  2LVM A;  3C4S A;  2LRQ A;  2E5Q A;  4A4H A;  2B8A A;  3DB4 A;  2EQJ A;  2X4X A;  4L59 A;  3OYG A;  4B9X A;  4II1 A;  4GY5 A;  3MEW A;  3PMI A;  5KCH A;  3FC3 A;  1XNI A;  3OS2 A;  4CRI A;  3S3N A;  1SSF A;  4E7L A;  3L2Q A;  5FRN A;  3LLR A;  3UWN A;  3OYK A;  3MET A;  1OYX A;  2NLU A;  3OYH A;  3DB3 A;  3OYA A;  3KUF A;  4EDU A;  3OYJ A;  4E7H A;  4IUT A;  2LDM A;  3OYE A;  2XK0 A;  2HQX A;  2RI2 A;  3DLM A;  2R5M A;  4QVZ A;  4RG2 A;  2O4X B;  4IUV A;  5KH6 A;  5M9O A;  3OYD A;  2L8D A;  3F70 A;  4IUQ A;  4N4H A;  3PMT A;  3S6W A;  2X4Y A;  3BDL A;  3OB9 A;  4BE0 A;  2O4X A;  1KHC A;  2RHU A;  3FEO A;  3CEY A;  4C5H A;  3L2R A;  1OZ3 A;  4E7J A;  4FL6 A;  3FLG A;  4E7K A;  3MO8 A;  2QQS A;  4Z02 A;  5C0M A;  2HQE A;  2VYT A;  4QQD A;  4IKF A;  3QBY A;  3OYM A;  4C5I A;  3M9Q A;  3O8V A;  2P0K A;  4UC4 A;  3NTI A;  2EFI A;  2D9T A;  4HCZ A;  3OA6 A;  4IUP A;  2RI3 A;  2IG0 A;  2M1H A;  2JTF A; 
#chains in the Genus database with same CATH topology
 2FL7 A;  4J8O A;  5I22 A;  3CCJ Q;  2KRM A;  1R0B G;  1TWB A;  3JCM W;  3JCM h;  5GAN e;  2DEQ A;  3JAM E;  3V8K A;  1YJN Q;  2DKG A;  4WF2 A;  1V76 A;  1G3W A;  4FCY A;  3EFS A;  1X6O A;  4M4Z A;  4PFZ A;  3I5S A;  1NEB A;  2PZ1 A;  3SFM A;  2QA4 Q;  4FYX B;  1M2V A;  3QII A;  5KCO A;  1I1J A;  1HJD A;  1T3L A;  2KGT A;  3OS5 A;  5KYU A;  2DNU A;  1WHH A;  2O9V A;  1VQN A;  2E70 A;  2G3R A;  3NGP A;  1E7O A;  1QVF S;  2KBT A;  2EJG A;  2JTE A;  4J9F A;  2CDT A;  1IHW A;  2RNA A;  1Y57 A;  1OEB A;  3D7S B;  1G83 A;  1OX8 A;  3S3O A;  4M7D F;  1AWW A;  1R0C B;  4ME7 A;  2HCK A;  4YTL A;  4N4I A;  5IT9 E;  2QQR A;  1QVF P;  2QDL A;  4F16 A;  3GPL A;  1EIF A;  1GCQ C;  1P92 A;  1SHG A;  1YJ9 A;  2ZPH B;  1QVG S;  1FMV A;  1G8X A;  4FYW B;  1RAD B;  1XQH A;  1UHC A;  3E19 A;  5KYN A;  4M78 C;  4QKU A;  2D6F A;  4J9I A;  3O5Z A;  4JRP A;  3ER0 A;  3HRT A;  2H8H A;  1QVG P;  1NYF A;  3LLR A;  4M7A C;  1BI2 A;  4OGC A;  3OYK A;  3OYA A;  2X9H A;  2J05 A;  2CP0 A;  5FWB A;  1N8R C;  5GJW B;  4M7D G;  4C0D B;  1TG0 A;  4AMC A;  2MI6 A;  2JN0 A;  3RKW A;  4GLK A;  1VQ6 T;  4Z02 A;  4KGV B;  2HQE A;  4OB2 B;  4BUG A;  1G3T A;  1MV0 B;  1OX9 A;  4JJN K;  2P4R A;  3CC7 T;  3C0C A;  2L3R A;  5GAO r;  3CCS Q;  5KYW B;  2ATC B;  7AT1 B;  4C92 F;  3UT1 A;  3OY9 A;  2BIV A;  4E47 A;  3I56 Q;  2KRS A;  5D6Y A;  1AZE A;  1Q7Y C;  4QQ6 A;  5GMK e;  2NUP A;  3QYH B;  1BI3 A;  3OMG A;  4B6M A;  5IHK A;  3CCV Q;  2A7Y A;  4DA4 A;  3CCU A;  2RHX A;  2BE7 D;  1IXD A;  3M55 A;  4Z89 A;  4X34 A;  2C0I A;  1VQP A;  2R5A A;  3M57 A;  1VQ5 Q;  4BDY A;  2DK3 A;  2KXC A;  2E10 A;  4A63 B;  1Q86 R;  3EAE A;  3MHX A;  4HVU A;  4DBR A;  2DET A;  2RPN A;  5LJ5 j;  1R8O B;  4R0K A;  2VB6 A;  2DL5 A;  5LJ3 d;  4C92 G;  3VKI A;  3OYL A;  5FLX E;  4J7F A;  4XU3 A;  4OGE A;  3CC4 A;  1GL5 A;  1UE9 A;  1GRI A;  4C0Z A;  1JXO A;  2GQI A;  1BK2 A;  3GF5 A;  3ZFJ A;  1JJ2 A;  2CT4 A;  1MNE A;  1RAE B;  2Y4X A;  4GY5 A;  3FC3 A;  4CRI A;  1KD1 C;  1GXI E;  3L2Q A;  1V29 B;  4RTY A;  4C0G A;  2QXF A;  1WHG A;  4LNP A;  4DBQ A;  2FZK B;  1RAC B;  3DLM A;  5HKC A;  4N4H A;  3BE3 A;  2CH4 W;  3CCQ T;  4M75 D;  3EH2 A;  4E7S A;  1RAG B;  4JJB A;  2FPD A;  8ATC B;  3M9Q A;  3LWI A;  1OU9 A;  3CCM A;  3ME9 A;  2FG0 A;  2LTO A;  3TU4 K;  2P0Q A;  3CQT A;  3JCM b;  4JRQ A;  4MMK A;  1VQM Q;  3JCM e;  5A0L A;  1VQ4 A;  1M1K U;  2K6D A;  3J81 E;  5GAO q;  4O6J A;  1FWZ A;  5LJ3 h;  2A28 A;  3ASK A;  2YUO A;  2FVU A;  9ATC B;  2M9U A;  5KYY B;  4BI8 B;  4C5G A;  3SHW A;  4OB1 B;  1GFC A;  4HCC A;  3M53 A;  3JCM J;  1VQ7 A;  1K9M R;  3LGF A;  1BCO A;  2EYY A;  5IHN A;  3X24 B;  1VQL A;  1RLP C;  2FB7 A;  1ZUK A;  4BDZ A;  1K0X A;  2EBP A;  4BI3 A;  2CH4 A;  2J6F A;  1M2O A;  4PNO A;  3MKD A;  1YJW A;  1ZSZ A;  1WXT A;  3VS0 A;  1Q81 C;  1D3B B;  3OW2 S;  4AG2 C;  1VQ9 A;  1Z9Z A;  2RO0 A;  5FRO A;  2YHT A;  2RD1 A;  2LRQ A;  3QUI A;  2F2X A;  1ABO A;  5KCH A;  5FU6 B;  4M75 B;  4QVC A;  2XI9 A;  2OTL T;  5IH2 A;  2GTO A;  1OYX A;  2WSC E;  1IZ6 A;  1OQK A;  2XK0 A;  1M9S A;  3OYD A;  5LJ5 f;  2HBP A;  1KQ1 A;  2LNH B;  4ZGD B;  2NWM A;  1ACM B;  3MO8 A;  5GJV B;  2DZ9 A;  2DTH A;  3CPW A;  4M78 E;  4C92 E;  2P0K A;  2H3E B;  2QI2 A;  4UC4 A;  2L3Q A;  2CP2 A;  2D9T A;  2XHC A;  2JT4 A;  4RTZ A;  4V2S A;  4IUP A;  4RTV A;  3CMA T;  1VQ6 A;  4M7A E;  5DLQ E;  1KK7 A;  2X35 A;  1XOV A;  2DXC A;  3L2Z A;  4ZNX A;  2LP5 A;  3CC7 A;  4FT2 A;  3L2W A;  2K2M A;  1VQO Q;  3URG A;  1QMC A;  5FRM A;  3LGL A;  1ZQ1 A;  3CCE T;  1U1S A;  2QEX Q;  4VUB A;  3RIR A;  4XTX A;  2D1X A;  2PTK A;  1BYM A;  5AT1 B;  5CKE A;  1U8R A;  1HYO A;  1ARK A;  2CZ7 B;  1K73 U;  5J3B A;  2EYZ A;  4PLL A;  1TUC A;  5J39 A;  5GAN 7;  2DIL A;  2HDA A;  2QK0 A;  1H3H A;  4E2F B;  4OP0 A;  1BBZ A;  1CKB A;  1S72 T;  2ZPB B;  5EC7 A;  2HL5 C;  1TTH B;  1YN8 A;  1ZSZ C;  4RKU E;  4NS5 A;  5GAM d;  1ZBX A;  2KYB A;  2BTT A;  1VQN T;  2E64 A;  2YUN A;  4WCI A;  3THK A;  3G6E T;  1UEC A;  2ROL A;  3C4S A;  3M0Q A;  1VQ8 Q;  2RF0 A;  4A4H A;  2QTV A;  1BIA A;  2DBK A;  1QVF A;  4F7U E;  1F1B B;  1ZBJ A;  1PRL C;  2ABL A;  4PFO A;  2JMC A;  4XTU A;  2O31 A;  4ANJ A;  1WHJ A;  3X28 B;  3DKM A;  3VRY A;  1I81 A;  3UA7 A;  1JB0 E;  2R5M A;  2HSP A;  2KVQ G;  3M4Y A;  2MAM A;  1QVG A;  3QHS A;  2KQW A;  2NYS A;  2ESW A;  4L5G A;  3RES A;  1VQK Q;  3CCQ A;  4L6V 5;  1I4K 1;  4KUL A;  3CCJ A;  1YHQ T;  2RA2 A;  2M0Y A;  4A54 A;  2CT3 A;  5EG2 A;  3OA6 A;  3TEE A;  2MF2 A;  3P8H A;  2JNG A;  2ZPF B;  2JM8 A;  2XIC A;  4J5Y A;  4RMO A;  3E9G A;  5GAN 6;  4KUI A;  2EPD A;  1I0C A;  5GAM h;  4A4G A;  3PNW C;  2K3Y A;  4DQ2 A;  4ZN3 A;  5LJ3 e;  2QA4 A;  1VYT A;  4D6W A;  1N8R U;  2DEU A;  3QJY A;  3JB9 F;  5IXB A;  4KGZ B;  2LJ1 A;  2HD0 A;  2O01 E;  2VVK A;  4ELZ C;  5CKD A;  4LUD A;  2RQR A;  2YUP A;  3QKJ A;  2RK1 A;  1IO6 A;  2JS0 A;  5ECA A;  4FSS A;  2EWN A;  2HNI A;  2C0T A;  4BE2 A;  1QCO A;  4FYV B;  4M7D A;  1EZZ B;  3CCU T;  1M2V B;  4C8Q A;  3H6Z A;  5KYU B;  1VQP T;  3RR6 A;  2EQM A;  1KFZ A;  2LJ3 A;  2GQV A;  1K8A C;  3CME Q;  1EFN A;  3UAT A;  1KQS S;  5D6W A;  2F69 A;  3MEU A;  3JB9 G;  4F17 A;  2DVJ A;  3M0P A;  2QAZ A;  1V1C A;  5CQX A;  2ECZ A;  1KQS P;  5FU6 C;  4M75 C;  3CC4 T;  1WXU A;  2DYB A;  4PJM A;  3TVT A;  1Q86 C;  3E1S A;  1X2Q A;  1N5Z A;  1AEY A;  1B34 A;  2RI2 A;  4RG2 A;  4QVZ A;  5KH6 A;  4IUV A;  1B7T A;  1PCX A;  4X1V A;  4C5H A;  3M54 A;  3L2R A;  3RER A;  1RUW A;  4DOV A;  4NL2 A;  3QBY A;  3OYM A;  1KIK A;  2AHJ B;  2D8H A;  2LC4 A;  1NE8 A;  2FZC B;  3TQ7 P;  3M0T A;  1Q95 G;  2MCN A;  1KD1 U;  2K5I A;  1KQ2 A;  3PFS A;  4M77 D;  3I56 A;  1OU8 A;  4A4E A;  1PD1 A;  1YWO A;  4OMF B;  3VS7 A;  1PHT A;  2LCC A;  1NJI C;  2K3X A;  3CCM T;  3CCV A;  1KHI A;  4CC4 B;  5LL6 S;  2KYM A;  2KY9 A;  4BAC A;  2LCS A;  2DM1 A;  4AFU C;  1NLP C;  3RMS A;  3LH5 A;  3QO3 A;  4EMH A;  1VQ5 A;  2GNC A;  2YRV A;  4RCC A;  2CUB A;  3KBG A;  4IIM A;  4HCB A;  4A4K A;  5GMK l;  1VUB A;  4LN2 A;  1WQW A;  2NUP B;  1KC8 C;  1OZ2 A;  1VQ7 T;  1LJO A;  4OB0 B;  1WLP B;  1UUE A;  2D8J A;  2I0N A;  4C8Q C;  4JPB W;  3TCJ A;  1SPK A;  1S72 A;  2DO3 A;  1VQL T;  4LDY A;  3EHQ A;  3RBB B;  3HRS A;  2AZV A;  3SB2 A;  1N9R A;  1VA7 A;  2VC8 A;  1K9M C;  1YJW T;  1M90 R;  3G4S Q;  3EFO B;  3G6E A;  2JJ9 A;  3I55 Q;  2CSQ A;  4BI4 A;  1VQ9 T;  1AD5 A;  2LX7 A;  2RK2 A;  1RI9 A;  1S1N A;  5GAO p;  5CR2 A;  1GBQ A;  5LJ5 d;  1JQQ A;  2NLU A;  3OW2 A;  3G71 Q;  1TSF A;  3OYJ A;  2EYW A;  4C0F A;  1Q81 U;  2XDB A;  2E6Z A;  1BU1 A;  5IHI A;  2A0F B;  1MND A;  4M77 B;  2ZPI B;  1ZX6 A;  4OMQ A;  1H92 A;  2WSE E;  2BZX A;  4IKF A;  1K4U S;  2RI3 A;  4QT7 A;  2DTO A;  2EKO A;  1AHJ B;  3MP8 A;  2EYQ A;  2LX9 A;  2FEI A;  3SWN A;  3JSC A;  1YHQ A;  2BKD N;  4RTW A;  1PKS A;  5GAM e;  1YIT Q;  1PRM C;  2PQW A;  1AT1 B;  1U1T A;  1M1K R;  3M59 A;  3CBM A;  4MZT A;  2RMO A;  4HT9 A;  1WJS A;  3C12 A;  2RHI A;  1PNJ A;  3R6O A;  1UTI A;  3PVL A;  4N0A A;  1Q82 C;  4K11 A;  1ZUY A;  2OJ2 A;  4F14 A;  2QDY B;  1WFW A;  4QW2 A;  2V8K A;  4M78 F;  2F5T X;  3MEV A;  2DRK A;  5LJ5 h;  3VS5 A;  3CC2 Q;  3CD6 T;  3RDV A;  2FRY A;  1X6B A;  3FDR A;  4PL6 A;  5GAO n;  3VV0 A;  1LNX A;  4M7A F;  1VYV A;  4HVW A;  1WQ7 A;  2L0A A;  3MPU B;  3A5Z B;  2X4J A;  1OI1 A;  2RB6 A;  1UHF A;  3A8O B;  1YIJ Q;  3OQ5 A;  3V8L A;  3L1A A;  1W1F A;  2OX7 A;  3QWY A;  2EQJ A;  2LT4 A;  3CMA Q;  3HRU A;  4PJO A;  2OTJ Q;  2C0O A;  3H41 A;  1ZSZ B;  1UDL A;  3OS2 A;  4J7I A;  3EFO A;  3IQL A;  1SKU B;  1NPR A;  3OBY A;  3JB9 I;  4XAX B;  4BY6 B;  3MET A;  4M78 G;  5GAN 3;  4IUT A;  2VWF A;  4JJC A;  1WHM A;  4JDS A;  2KSS A;  3FJP A;  4PJL A;  1WXB A;  2O4X B;  3CCE Q;  2XD0 A;  1M90 U;  2DL7 A;  1IRE B;  4KH0 B;  3BDL A;  4M7A G;  3OB9 A;  2Y4Y A;  4EMK A;  1Y71 A;  2EKH A;  4E7K A;  1MV3 A;  5L23 A;  3VS4 A;  1W4S A;  1JO8 A;  3HPW A;  4M77 A;  3NHN A;  3KXT A;  3JV3 A;  3AHU A;  5GAN g;  2AT1 B;  1HK9 A;  2SRC A;  1TH7 A;  2CZ1 B;  2IG0 A;  2QAS A;  4OMO A;  2ROT A;  1WGS A;  4M75 E;  1YI2 T;  3H9N A;  2HL3 A;  2L89 A;  1VQO A;  3SWN C;  4F7U F;  2DIG A;  3A8L B;  2J06 A;  2A3L A;  1K1Z A;  4DEX A;  3VYH B;  2CRE A;  2RHZ A;  1BI0 A;  3JRZ A;  4O5V A;  4Y92 A;  4OVA A;  2R58 A;  2HZY A;  3BFM A;  4XU0 A;  3CCJ T;  1NM7 A;  1RAI B;  3MEA A;  4OB3 B;  2KK4 A;  1YJN T;  3JCM f;  1U5S A;  2E6N A;  3H8Z A;  1FXX A;  4Q5W A;  2CS7 A;  1BCM A;  4N0A C;  1O9S A;  3VUB A;  1K73 R;  1HSQ A;  2E65 A;  2QA4 T;  2RJF A;  4HXJ A;  2L2P A;  1YJ9 Q;  1TUD A;  3LYI A;  3V7C A;  3GBQ A;  2HAX A;  4LXC A;  1J3T A;  2A08 A;  4F7U G;  2RI5 A;  4J9C A;  2ENM A;  5I2M A;  3L2V A;  5IAY A;  3UA6 A;  2K7A A;  5A2Q E;  3LH0 A;  1AWX A;  2BUD A;  2XU8 A;  3CXC P;  1M3B A;  3UDC A;  4PKC C;  1WNL A;  4JLG A;  4PJO C;  3INZ A;  2DVE A;  3PMI A;  2ZZD A;  1QLY A;  5AYF A;  2YLB A;  3PGG A;  3OYH A;  3SEM A;  4J9E A;  2V8J A;  3JCM X;  2ZAE A;  4AFS C;  2HQX A;  3M56 A;  2M02 A;  3FB9 A;  2MYS A;  4JZ3 A;  3S6W A;  1KQS A;  4M7D D;  1VIF A;  2O4X A;  4C8Q D;  1XTD A;  1TU0 B;  1K8A U;  3HHT B;  1RAF B;  4M77 C;  5GMK m;  2E5K A;  3O8V A;  2XID A;  4RCB A;  2KR3 A;  2LQK A;  4F04 B;  1PC0 A;  2XKO C;  2ED0 A;  1G5V A;  3BDU A;  3PVQ A;  4PLI A;  4LDU A;  2FYK A;  4ZGJ B;  3CCS T;  3S3M A;  2QQA A;  2DL4 A;  3J7A F;  2MK5 A;  4BB7 A;  1N8R R;  3I56 T;  3REA B;  2DX1 A;  5IN1 A;  2RJD A;  2CSI A;  1OUL A;  2YDL A;  3CCV T;  4JS5 A;  3CC4 Q;  1X75 C;  2BZ8 A;  3M5A A;  3RNJ A;  5LJ5 e;  3EG1 A;  5I11 A;  4PJJ A;  4Z88 A;  4ESR A;  2YWW A;  4QQG A;  3WVD B;  1PSE A;  2DER A;  4GLM A;  2WSF E;  2DFU A;  1VQ5 T;  3CCL A;  1NJI U;  3TSZ A;  3CD6 A;  4LD6 A;  1Y07 A;  2EW3 A;  4ZGE B;  2M51 A;  3A1P A;  3EGD A;  2XG8 D;  1A0N B;  4LDW A;  2DXT A;  4RTT A;  1N6A A;  2B8A A;  1WI7 A;  1OOT A;  2VAS A;  1FMW A;  1NLO C;  3QDF A;  4II1 A;  4M7D B;  4C8Q B;  1XNI A;  2CUD A;  4E7L A;  1M8M A;  2ZCF B;  2FPE A;  5FRN A;  1PKT A;  1PSF A;  2D0Q B;  4XTW A;  1KC8 U;  2J6K A;  2PNI A;  4BY6 C;  2DLP A;  5M9O A;  2L8D A;  4D8D A;  1E6H A;  4LDV A;  4BE0 A;  3FEO A;  1OZ3 A;  4E7J A;  2LZ6 B;  2VXE A;  1VQ4 Q;  4DOW A;  1R77 A;  3QZ5 B;  2EJ9 A;  3JCM g;  1WX6 A;  4RUG A;  3X26 B;  3SD4 A;  1B34 B;  4BE1 A;  1VIE A;  1M1F A;  1RI0 A;  3EG0 A;  4J6Y A;  3WXM B;  1NPP A;  1VQ7 Q;  1G3Y A;  2GF7 A;  2V8I A;  1KD1 R;  3RMQ A;  1YI2 A;  3CCR A;  1VOM A;  1VQL Q;  2WAC A;  4X9C A;  4C5E A;  1VQM T;  8AT1 B;  3NFC A;  4HT8 A;  2VGM A;  4KUD K;  3H0I A;  1YJW Q;  5CQY A;  4FIB A;  2RM4 A;  2IIM A;  5D6X A;  3V7S A;  1VQ9 Q;  1YJN A;  2DD4 A;  3WVE B;  2QTX A;  1X2K A;  2F5K A;  2CYZ B;  3V7R A;  2IPO B;  2MOX A;  3QYG B;  3EGX A;  5I2S A;  4EPC A;  4JS4 A;  1M1K C;  4ORZ A;  4XU1 A;  1UB4 A;  2DAQ A;  3VJP A;  1QP3 A;  2XDP A;  3A8H B;  3G4S A;  2FHD A;  4A4F A;  1W70 A;  2K57 A;  1I5O B;  1Y96 A;  2E5Q A;  2YXY A;  3CBP A;  3LWH A;  1Q82 U;  1GCP A;  1T0H A;  1T3S A;  1SEM A;  2QG9 B;  3MEW A;  3OBW A;  3T9N A;  1UG1 A;  1RAB B;  3G1J A;  4LE9 A;  1Z9Q A;  1MUZ A;  3EGU A;  5FWC A;  2QGF B;  1Q7Y U;  3EFR A;  1MMG A;  2PUO B;  1VQ6 Q;  3JB9 J;  2PVO B;  3PMT A;  2YLC A;  3CPF A;  2DL8 A;  1Q81 R;  2K4Y A;  2OAU A;  3OYY A;  4PJN A;  1C6V X;  1UJ0 A;  2CP7 A;  2LT1 A;  3CC7 Q;  3TSW A;  3VS6 A;  2FRW A;  4PJO D;  1QVP A;  3HKS A;  4ATO A;  3L2U A;  5GAN 5;  1UEB A;  3SDZ A;  3PIO A;  1O75 A;  4DBF A;  3E2U A;  3JCM c;  2JZ2 A;  4J9G A;  3OS1 A;  2KT8 A;  1VQO T;  3OYB A;  3HFN A;  4M77 E;  5KE3 A;  1WZO A;  3QSU A;  4IUU A;  3CCS A;  3SWN B;  2QEX T;  2DIQ A;  2B86 A;  2QYZ A;  2PUK B;  3CC2 A;  3OYC A;  2VXF A;  2C06 A;  2COY A;  4M78 A;  2QQ9 A;  4C92 A;  1I07 A;  2EQK A;  2EGC A;  2RQT A;  2E12 A;  4JJD A;  1UGQ B;  4M75 F;  1YIJ A;  4FT4 A;  1H8K A;  1E6G A;  5GAN f;  2HEQ A;  3CPW P;  1M27 C;  4ZTJ A;  4ZTF A;  2JVV A;  1AZG B;  5KE2 A;  2VV5 A;  2OAW A;  3R6N A;  1X69 A;  3S3N A;  1NYG A;  5IXF A;  1VQ8 T;  4FYY B;  4M7D C;  3C95 A;  3M0U A;  3CBO A;  3CCQ Q;  3KUF A;  5CKB A;  2LDM A;  3GNF B;  3J80 E;  1UGS B;  3FRN A;  3QWX X;  3F70 A;  2VKN A;  1I8F A;  3NMZ C;  4M75 G;  4PJO B;  2RHU A;  1KHC A;  2E1H A;  2LMJ A;  4OMM A;  4FL6 A;  2DJZ A;  4E7Z A;  4J6X A;  4J9D A;  4MDX A;  5C0M A;  2DL3 A;  4XTZ A;  1YBY A;  2DZC A;  4HCZ A;  3NTI A;  1HXD A;  2EFI A;  3EG9 A;  5HK0 A;  2JOY A;  1EX4 A;  2M1H A;  1HD3 A;  5GAN 2;  1VQK T;  4AFQ C;  3PTA A;  2DXB A;  5I21 A;  5LJ3 g;  3MCA B;  1ZA2 B;  4F7U A;  2V26 A;  2DBM A;  2EGE A;  1QCN A;  4EMK B;  2HBW A;  1MMN A;  1PG5 B;  1IRX A;  1SRL A;  1KSW A;  1YCY A;  3FJ5 A;  2HKN A;  2W0Z A;  2JXB A;  2CZ6 B;  2E4H A;  3A8M B;  3VS1 A;  1PD0 A;  5CK9 A;  4C8Q F;  4A53 A;  2DTI A;  4HA8 A;  1M1G A;  2KDS A;  4XU2 A;  2KRN A;  1VQM A;  1H64 1;  2RN8 A;  2CP5 A;  2SEM A;  5GAM f;  4DEY A;  2YSQ A;  2GBQ A;  3PE0 A;  1WDX A;  2ZPE B;  1D0Y A;  1GFD A;  3VS3 A;  3QJ6 A;  4C92 C;  2LCL A;  3OMC A;  2CZ0 B;  1AOJ A;  1FYN A;  3MP1 A;  4WTO B;  4R55 A;  1TS9 A;  4QVD A;  2KRO A;  2Z0W A;  2JMA A;  2MPX C;  2K9G A;  3JB9 D;  4C8Q G;  2OTL Q;  5FU7 C;  2MMP A;  3DB4 A;  1U3O A;  2X4X A;  3OYG A;  4GBQ A;  3CME T;  2HKQ B;  3CCL T;  2JTM A;  3H0F A;  2AIR B;  2DRM A;  4J9B A;  3REB B;  4J9H A;  3UWN A;  5DLO A;  2GTJ A;  4E7H A;  1X27 A;  2BZY A;  4PK4 A;  2K3B A;  2DMO A;  1SHF A;  2KMT A;  4RTX A;  2P0P A;  5D7U A;  1QP2 A;  1UJY A;  4EMG A;  4FW1 A;  3FLG A;  3U23 A;  3PIP A;  2LQW A;  2O9S A;  3FIF A;  2HSE B;  1YFN A;  2X3W D;  2E41 A;  4JRK A;  1IB8 A;  2PU9 B;  1W2B S;  1K8A R;  3M4G A;  1WHL A;  2XMF A;  1MGQ A;  2DPP B;  4XTV A;  2KAF A;  4FSX A;  2GFU A;  2RJE A;  3HFO A;  1W2B P;  1QKX A;  4X9D A;  2COW A;  2KXD A;  2F1L A;  1M8V A;  1Y7X A;  3NTK A;  2NUT B;  1SF9 A;  1AWJ A;  5HK3 A;  4BD3 A;  3OYN A;  3I9Q A;  5KYX B;  1SSH A;  1I5L A;  1NG2 A;  3NPF A;  3CCR T;  1S72 Q;  5GMK i;  2DD5 A;  2RHY A;  3LX7 A;  2QEX A;  1NEG A;  3N5B B;  5HCK A;  2G6F X;  4RG8 A;  1VQN Q;  1D0Z A;  1QWE A;  1OPK A;  3ULR B;  2X3X D;  1H3Z A;  2AKK A;  1NZ9 A;  3G6E Q;  2OI3 A;  1ZHI A;  1UGP B;  1WJQ A;  5HY6 A;  2DYI A;  1RAA B;  4N4G A;  2AZS A;  1M3A A;  1QW1 A;  5CO7 A;  1C1A A;  1ZLM A;  1NJI R;  2EGA A;  3M58 A;  3G7Z A;  1D09 B;  3EG3 A;  1U06 A;  3KFV A;  4L59 A;  2NUZ A;  2RQU A;  2ZGW A;  2PVG B;  1XJW B;  1LPL A;  1JEG A;  3JCM Q;  4JZ4 A;  3CXC S;  3V8J A;  3G4S T;  3I55 T;  4DBH A;  1VQ8 A;  3OYE A;  2XDD A;  3EGD B;  2F2V A;  2K79 A;  1MMA A;  3QDR B;  1KC8 R;  2A37 A;  3UPU A;  2JM9 A;  2J7I A;  3G71 T;  4Z8A A;  2LNV A;  3CEY A;  3BW1 A;  2W10 A;  1JXM A;  1DJ7 B;  3BY7 A;  5CVI A;  5KYW A;  1YHQ Q;  2FO0 A;  1G3S A;  1W6X A;  4KT0 E;  2QQS A;  2RH2 A;  1FX7 A;  3X25 B;  5DY9 A;  1SRM A;  4PFP A;  1WPY A;  4KGX B;  5GAM g;  2RJC A;  3ZEH A;  4IIO A;  2I2L A;  4M7D E;  1MHN A;  2D0N A;  4C8Q E;  3OYF A;  3QZ9 B;  4MML A;  1VQK A;  2EYX A;  5CIU A;  1AWO A;  3PT9 A;  4EMK C;  4HCK A;  2YRD A;  3L42 A;  2FZG B;  2IVW A;  2JS2 A;  1YIT T;  5LJ3 j;  2Y90 A;  3OSS C;  1N9S A;  5J26 A;  1QQJ A;  1N27 A;  2NUT A;  5KYX A;  3RUX A;  5GAO l;  2R57 A;  3QG1 A;  2MWP A;  2M0O A;  1Q86 U;  1K0S A;  4IUR A;  4KBM B;  3CCU Q;  3OW2 P;  3RKY A;  2DA9 A;  2CKK A;  4PJO F;  2MWO A;  3VU3 C;  3M0R A;  1BIB A;  3Q1J A;  2LJ0 A;  4CC7 A;  1BKB A;  1T0J A;  1M5Q 1;  1VQP Q;  2YRC A;  5GAN d;  4MZM A;  4TVR A;  2X51 A;  3JCM P;  2BE9 B;  3CC2 T;  2VGN A;  4E7I A;  1BI1 A;  4LUE A;  3UF4 A;  1X43 A;  2GGR A;  2L3S A;  4C0D C;  4M77 F;  4B9X A;  1YIJ T;  2ED1 A;  3EGX B;  5CCA A;  1X01 A;  3HP9 A;  2P84 A;  4LD9 K;  2JW4 A;  2EJF A;  1Q82 R;  1RAH B;  2OTJ T;  2EAY A;  3CME A;  4M78 D;  4EDU A;  4PJO G;  4C92 D;  2COZ A;  3EHR A;  3RKX A;  1Y96 B;  1AVZ C;  1ZSG A;  2FPF A;  1YP5 A;  1YWP A;  2K2V A;  4IUQ A;  5GAN 4;  1D1C A;  2X4Y A;  1Q7Y R;  1MMD A;  4M7A D;  1UGR B;  1WA7 A;  2V1R A;  2QQB A;  1K76 A;  5CKF A;  2RQW A;  4JUV A;  2KI7 A;  5KYY A;  4AFZ C;  2JUF A;  4HVV A;  2A36 A;  2HQH A;  1M3C A;  2HMA A;  4M77 G;  2M16 A;  2EQU A;  1WJR A;  3CCM Q;  3H0H A;  5GAN h;  4XQ3 A;  3QPH A;  1GBR A;  2EIF A;  1C0M A;  3VYG A;  4ZN1 A;  1K9M U;  3I35 A;  1M90 C;  3VRZ A;  2H3J A;  1D3B A;  3HL8 A;  3P8B B;  4AG1 C;  3QXE B;  1QCF A;  1WHK A;  2KNB B;  2O2O A;  4XK8 E;  3VUZ A;  1CSK A;  5GAN 8;  1M30 A;  1CKA A;  1IGU A;  2MIO A;  2RQV A;  2YUQ A;  5A0G A;  1JJ2 S;  1QKW A;  3NTH A;  5CKH A;  2DXU A;  3ZBD A;  2VUB A;  3GIB A;  5GAN j;  1NBE B;  3OSV A;  2KT1 A;  2V1Q A;  1YJ9 T;  4M75 A;  2KE9 A;  1KJW A;  2YT6 A;  2CP6 A;  3MJX A;  1JBM A;  3P8D A;  4J83 A;  3EH1 A;  1JJ2 P;  2CGH A;  3X20 B;  3GNG A;  5L8R E;  2EQI A;  1PWT A;  4OMP A;  2LQ8 A;  4M78 B;  5LJ3 f;  4C92 B;  1X6G A;  5DM7 R;  1M4Z A;  3GLX A;  1WIE A;  1JU5 C;  1RL2 A;  1B07 A;  4M7A B;  6AT1 B;  3C94 A;  1RLQ C;  3EG2 A;  3A8G B;  2PVD B;  4OML A;  1YCS B;  2K5L A;  3ZL7 C;  5FW9 A;  1D1A A;  1G2B A;  1ABQ A;  5FU7 B;  4AT1 B;  3I55 A;  4E6R A;  1B3Q A;  4QQD A;  4Y91 A;  1WYX A;  3G71 A;  4Y28 E;  4XTY A;  5CAI A;  1OPL A;  4B9W A;  2KEA A;  5C6S A;  2P4T A;  2F2W A;  2AKL A;  2CP3 A;  1D0X A;  4OF1 A;  3JCM V;  3M0S A;  2K5F A;  4CC2 A;  4LDX A;  4KH1 B;  5A0D A;  4CI0 C;  5GAM j;  4FU6 A;  5GMK h;  3EG9 B;  4ELY C;  2E3I A;  4PJO E;  1W2B A;  4F7U B;  5LJ5 g;  4OMN A;  1YIT A;  4MZP A;  4NL3 A;  1JRI A;  3CCL Q;  1LVK A;  4JLI A;  4MDW A;  2E3H A;  2J6O A;  3CD6 Q;  3OYI A;  4P5N A;  1UGV A;  2DF6 A;  4NOY A;  4FM4 B;  3DLL A;  2QGG A;  4FW2 A;  3GOX A;  3JCM d;  3OS0 A;  3MP6 A;  4JRI A;  2X4W A;  4R56 A;  1TXQ A;  2AK5 A;  1GCQ A;  2OTL A;  3E9F A;  5GMK j;  3TRE A;  2GFA A;  2LQN A;  1FMK A;  1UFF A;  1SG5 A;  2LVM A;  4KRT A;  4RTU A;  1KG1 A;  1TOV A;  3CPW S;  3HTR A;  1BB9 A;  1OV3 A;  3HSB A;  1SSF A;  2DJQ A;  4M7A A;  3A98 A;  3AT1 B;  1YNZ A;  1LCK A;  1K9A A;  3GP8 A;  3DB3 A;  2L3P A;  1PM3 A;  4EIK A;  2L5Q A;  2GCX A;  4CC3 A;  3JB9 H;  1TUG B;  2EVR A;  3CMA A;  2OTJ A;  1Y0M A;  4HKE A;  2DE0 X;  1LOJ A;  1D1B A;  2ZPG B;  3VS2 A;  4D8K A;  1IHV A;  4J6W A;  5GAO m;  1VYU A;  1ZA1 B;  2VYT A;  3I5R A;  1K73 C;  1YI2 Q;  3CCR Q;  4C5I A;  1ZUU A;  3LW5 E;  1IGQ A;  1QWF A;  3CXC A;  2O88 A;  1VQ4 T;  2JTF A;  3CCE A; 
#chains in the Genus database with same CATH homology
 1MGQ A;  2MF2 A;  2FL7 A;  3P8H A;  2DPP B;  2JNG A;  2LQK A;  2ZPF B;  4J8O A;  2XIC A;  4XTV A;  4J5Y A;  2KAF A;  2XKO C;  4FSX A;  4RMO A;  3E9G A;  5GAN 6;  4KUI A;  2GFU A;  3JCM W;  2RJE A;  3JCM h;  5GAN e;  3HFO A;  2DEQ A;  3JAM E;  5GAM h;  3V8K A;  4A4G A;  3PNW C;  4X9D A;  2K3Y A;  1G5V A;  3BDU A;  4DQ2 A;  4PLI A;  4ZN3 A;  4LDU A;  5LJ3 e;  2DKG A;  2QA4 A;  2FYK A;  4ZGJ B;  4WF2 A;  4D6W A;  3CCS T;  1N8R U;  1M8V A;  1G3W A;  2QQA A;  3S3M A;  3QJY A;  3EFS A;  3JB9 F;  1Y7X A;  1X6O A;  3NTK A;  3J7A F;  2HD0 A;  2O01 E;  5HK3 A;  3SFM A;  4BB7 A;  4ELZ C;  4BD3 A;  5CKD A;  3OYN A;  3I56 T;  3QII A;  5KCO A;  1I5L A;  5IN1 A;  2RJD A;  3CCR T;  3OS5 A;  3QKJ A;  2RK1 A;  5GMK i;  1VQN A;  2E70 A;  2G3R A;  4JS5 A;  2DD5 A;  3CCV T;  2RHY A;  1QVF S;  3LX7 A;  2EJG A;  2QEX A;  1X75 C;  2EWN A;  2HNI A;  3M5A A;  5LJ5 e;  3N5B B;  4BE2 A;  4RG8 A;  4QQG A;  3WVD B;  1PSE A;  3S3O A;  1H3Z A;  4M7D A;  2WSF E;  4M7D F;  1NZ9 A;  4C8Q A;  3CCU T;  4ME7 A;  1VQ5 T;  3CCL A;  1ZHI A;  4N4I A;  1UGP B;  1WJQ A;  2QQR A;  4YTL A;  5HY6 A;  5IT9 E;  1NJI U;  3CD6 A;  3GPL A;  1EIF A;  4LD6 A;  4N4G A;  1P92 A;  1QW1 A;  1Y07 A;  3H6Z A;  5CO7 A;  1YJ9 A;  1VQP T;  2EQM A;  4ZGE B;  2GQV A;  2ZPH B;  1QVG S;  1K8A C;  1KQS S;  5D6W A;  2F69 A;  2XG8 D;  3MEU A;  4LDW A;  3JB9 G;  2DXT A;  3M58 A;  3G7Z A;  1N6A A;  2B8A A;  1XQH A;  3E19 A;  4L59 A;  4M78 C;  2D6F A;  2ZGW A;  2PVG B;  4II1 A;  4M7D B;  4JRP A;  4C8Q B;  1XNI A;  3ER0 A;  3JCM Q;  3HRT A;  4E7L A;  3CXC S;  2ZCF B;  5CQX A;  3V8J A;  5FRN A;  3LLR A;  4M75 C;  5FU6 C;  3CC4 T;  4M7A C;  3G4S T;  1BI2 A;  1Q86 C;  3E1S A;  4OGC A;  1PSF A;  2D0Q B;  3OYK A;  4XTW A;  3I55 T;  1KC8 U;  3OYA A;  1VQ8 A;  3OYE A;  2XDD A;  4BY6 C;  1B34 A;  2RI2 A;  4RG2 A;  4QVZ A;  3QDR B;  5KH6 A;  4IUV A;  5M9O A;  2L8D A;  1N8R C;  3UPU A;  4M7D G;  3G71 T;  4LDV A;  4C0D B;  2LNV A;  3FEO A;  4C5H A;  3CEY A;  3M54 A;  3BW1 A;  2MI6 A;  1OZ3 A;  1DJ7 B;  3BY7 A;  5CVI A;  3L2R A;  2JN0 A;  4E7J A;  3RER A;  1G3S A;  2VXE A;  4DOV A;  4DOW A;  3RKW A;  4NL2 A;  4GLK A;  4KT0 E;  1VQ6 T;  2QQS A;  4Z02 A;  2HQE A;  3QBY A;  2RH2 A;  4OB2 B;  3OYM A;  1FX7 A;  2AHJ B;  2LC4 A;  3QZ5 B;  5DY9 A;  1G3T A;  3X25 B;  2EJ9 A;  4BUG A;  1NE8 A;  3JCM g;  1WPY A;  3CCE A;  5GAM g;  4JJN K;  2RJC A;  3ZEH A;  3X26 B;  3SD4 A;  1B34 B;  2I2L A;  4BE1 A;  3CC7 T;  1KD1 U;  2K5I A;  1MHN A;  1VIE A;  4M7D E;  1M1F A;  1RI0 A;  2L3R A;  4J6Y A;  4C8Q E;  3OYF A;  1KQ2 A;  3PFS A;  4M77 D;  3I56 A;  3WXM B;  3QZ9 B;  1NPP A;  4MML A;  4A4E A;  5GAO r;  1G3Y A;  2GF7 A;  2V8I A;  1VQK A;  5CIU A;  3RMQ A;  4PJO B;  4C92 F;  3PT9 A;  4OMF B;  3UT1 A;  3CCR A;  1YI2 A;  3OY9 A;  4EMK C;  2BIV A;  4E47 A;  3L42 A;  2LCC A;  5D6Y A;  1NJI C;  2K3X A;  2WAC A;  2IVW A;  4X9C A;  4C5E A;  3CCM T;  3CCV A;  1VQM T;  1Q7Y C;  1KHI A;  4QQ6 A;  5GMK e;  5LL6 S;  3QYH B;  1YIT T;  5LJ3 j;  2Y90 A;  2KY9 A;  3NFC A;  4HT8 A;  4BAC A;  2VGM A;  3OSS C;  1BI3 A;  4KUD K;  1N9S A;  3OMG A;  5J26 A;  3RMS A;  1N27 A;  2A7Y A;  3QO3 A;  5CQY A;  4FIB A;  3CCU A;  4DA4 A;  2RHX A;  4EMH A;  2RM4 A;  1VQ5 A;  3RUX A;  5GAO l;  3M55 A;  2R57 A;  2YRV A;  4RCC A;  5D6X A;  3V7S A;  3QG1 A;  1YJN A;  4X34 A;  2MWP A;  2M0O A;  3KBG A;  2DD4 A;  1Q86 U;  4A4K A;  5GMK l;  1VUB A;  1VQP A;  4HCB A;  4IUR A;  4KBM B;  3WVE B;  2R5A A;  3M57 A;  3RKY A;  2QTX A;  2CKK A;  4PJO F;  2MWO A;  4BDY A;  2DK3 A;  3VU3 C;  1WQW A;  1BIB A;  2E10 A;  2F5K A;  2CYZ B;  3Q1J A;  3V7R A;  1BKB A;  1KC8 C;  3EAE A;  1OZ2 A;  3MHX A;  1M5Q 1;  1LJO A;  3QYG B;  5GAN d;  1VQ7 T;  4OB0 B;  4MZM A;  5LJ5 j;  4TVR A;  5I2S A;  4EPC A;  4JS4 A;  4C8Q C;  1R8O B;  3JCM P;  1M1K C;  3TCJ A;  1S72 A;  2DO3 A;  5LJ3 d;  4C92 G;  4XU1 A;  3CC2 T;  1VQL T;  3VKI A;  1UB4 A;  2DAQ A;  3VJP A;  5FLX E;  3OYL A;  4J7F A;  4XU3 A;  1QP3 A;  4LDY A;  2VGN A;  4OGE A;  3CC4 A;  2XDP A;  3A8H B;  1BI1 A;  3G4S A;  4E7I A;  2FHD A;  4A4F A;  3HRS A;  2K57 A;  3SB2 A;  1N9R A;  2VC8 A;  1K9M C;  1Y96 A;  2E5Q A;  4C0Z A;  1YJW T;  3CBP A;  3GF5 A;  3ZFJ A;  1JJ2 A;  3LWH A;  3G6E A;  1Q82 U;  4C0D C;  4M77 F;  4B9X A;  2Y4X A;  3MEW A;  3OBW A;  4GY5 A;  4BI4 A;  3FC3 A;  1VQ9 T;  1YIJ T;  5CCA A;  4CRI A;  1KD1 C;  3T9N A;  1GXI E;  1X01 A;  3L2Q A;  3HP9 A;  1V29 B;  4LD9 K;  2EJF A;  2RK2 A;  4C0G A;  2QXF A;  5GAO p;  2OTJ T;  5CR2 A;  2EAY A;  3CME A;  5LJ5 d;  2NLU A;  3OW2 A;  4M78 D;  4EDU A;  4PJO G;  4C92 D;  3OYJ A;  1Q7Y U;  3EFR A;  4C0F A;  1Q81 U;  3RKX A;  3DLM A;  2XDB A;  2PUO B;  5HKC A;  1Y96 B;  3JB9 J;  2PVO B;  2K2V A;  3PMT A;  2E6Z A;  2YLC A;  2X4Y A;  3CPF A;  4IUQ A;  4N4H A;  4M75 D;  5GAN 4;  3CCQ T;  4M7A D;  1UGR B;  2K4Y A;  4M77 B;  2QQB A;  2OAU A;  2ZPI B;  3OYY A;  2LT1 A;  2WSE E;  5CKF A;  4IKF A;  4JUV A;  3M9Q A;  3LWI A;  2JUF A;  2RI3 A;  3CCM A;  3ME9 A;  2DTO A;  2EKO A;  1AHJ B;  3MP8 A;  2EYQ A;  2LTO A;  2LX9 A;  2P0Q A;  3TU4 K;  4PJO D;  3JCM b;  3OA6 A;  3SWN A;  4JRQ A;  3JSC A;  1QVP A;  2BKD N;  2M16 A;  2EQU A;  3HKS A;  4M77 G;  4MMK A;  1YHQ A;  4ATO A;  1WJR A;  3JCM e;  5A0L A;  1VQ4 A;  1M1K U;  5GAN h;  3L2U A;  5GAM e;  4XQ3 A;  5GAN 5;  3QPH A;  3J81 E;  5GAO q;  1UEB A;  2EIF A;  3SDZ A;  2PQW A;  4O6J A;  1U1T A;  1FWZ A;  5LJ3 h;  3PIO A;  1O75 A;  3VYG A;  3ASK A;  3M59 A;  2FVU A;  2M9U A;  3JCM c;  4BI8 B;  2JZ2 A;  3CBM A;  4C5G A;  4ZN1 A;  3OS1 A;  4MZT A;  1K9M U;  4HT9 A;  4OB1 B;  1WJS A;  3C12 A;  3OYB A;  1VQO T;  3HFN A;  4M77 E;  5KE3 A;  2H3J A;  3M53 A;  1M90 C;  3JCM J;  1D3B A;  3HL8 A;  3P8B B;  2RHI A;  4IUU A;  3CCS A;  3QXE B;  1VQ7 A;  3QSU A;  3SWN B;  3R6O A;  3LGF A;  2QEX T;  4N0A A;  2DIQ A;  4XK8 E;  3VUZ A;  1Q82 C;  5GAN 8;  2PUK B;  3X24 B;  3CC2 A;  3OYC A;  2VXF A;  1VQL A;  2C06 A;  2FB7 A;  2QDY B;  5A0G A;  4BDZ A;  1JJ2 S;  4M78 A;  2QQ9 A;  4QW2 A;  4BI3 A;  2V8K A;  4M78 F;  2F5T X;  4C92 A;  3MEV A;  2EQK A;  3NTH A;  5CKH A;  5LJ5 h;  2DXU A;  3ZBD A;  4PNO A;  2E12 A;  2VUB A;  3GIB A;  5GAN j;  3OSV A;  3CD6 T;  1YJW A;  1UGQ B;  3FDR A;  4PL6 A;  1YJ9 T;  5GAO n;  3VV0 A;  4M75 A;  1Q81 C;  4M75 F;  1LNX A;  1D3B B;  4M7A F;  1JBM A;  3P8D A;  1WQ7 A;  4J83 A;  3OW2 S;  1YIJ A;  3A5Z B;  1VQ9 A;  4FT4 A;  2CGH A;  5GAN f;  2RO0 A;  3X20 B;  5FRO A;  2X4J A;  3GNG A;  1OI1 A;  2RB6 A;  5L8R E;  4ZTJ A;  2YHT A;  4ZTF A;  3A8O B;  2RD1 A;  2JVV A;  2LQ8 A;  3OQ5 A;  4M78 B;  5LJ3 f;  3L1A A;  3V8L A;  4C92 B;  5KE2 A;  4BE0 A;  2LRQ A;  3QUI A;  2VV5 A;  5DM7 R;  1M4Z A;  2EQJ A;  2LT4 A;  3HRU A;  4PJO A;  3GLX A;  1RL2 A;  5FU6 B;  4M75 B;  4QVC A;  4M7A B;  2XI9 A;  5KCH A;  3OS2 A;  4J7I A;  3S3N A;  2OTL T;  1VQ8 T;  1NPR A;  3OBY A;  3JB9 I;  3C94 A;  4M7D C;  4XAX B;  3C95 A;  4BY6 B;  3CBO A;  1OYX A;  3MET A;  3A8G B;  2PVD B;  2WSC E;  3KUF A;  4M78 G;  5CKB A;  1IZ6 A;  4IUT A;  2K5L A;  5GAN 3;  2LDM A;  3GNF B;  4JDS A;  3J80 E;  2KSS A;  3FJP A;  2XK0 A;  1M9S A;  3OYD A;  2O4X B;  5FU7 B;  1UGS B;  3FRN A;  2XD0 A;  5LJ5 f;  3F70 A;  1M90 U;  3I55 A;  1IRE B;  1I8F A;  4M75 G;  3BDL A;  2HBP A;  1KQ1 A;  3OB9 A;  2Y4Y A;  4EMK A;  2RHU A;  1KHC A;  4M7A G;  1Y71 A;  4ZGD B;  2E1H A;  4FL6 A;  1YI2 T;  2DJZ A;  4E7K A;  3MO8 A;  4J6X A;  1W4S A;  4MDX A;  3KXT A;  3HPW A;  4M77 A;  5C0M A;  2DZ9 A;  4QQD A;  2DTH A;  4Y91 A;  3CPW A;  3G71 A;  4M78 E;  4XTZ A;  4Y28 E;  4C92 E;  2P0K A;  2QI2 A;  3AHU A;  1YBY A;  2DZC A;  4UC4 A;  1HXD A;  2EFI A;  2D9T A;  2XHC A;  1HK9 A;  3NTI A;  4HCZ A;  5GAN g;  4XTY A;  4IUP A;  4V2S A;  5HK0 A;  2IG0 A;  2M1H A;  2JOY A;  1TH7 A;  2CZ1 B;  5CAI A;  5GAN 2;  1VQK T;  3PTA A;  3CMA T;  1VQ6 A;  2DXB A;  5I21 A;  4B9W A;  1WGS A;  3MCA B;  4M75 E;  5DLQ E;  2X35 A;  5C6S A;  5LJ3 g;  2L89 A;  2P4T A;  1VQO A;  1XOV A;  4F7U A;  3SWN C;  2DXC A;  4F7U F;  2DIG A;  3A8L B;  4OF1 A;  2A3L A;  4EMK B;  3L2Z A;  3JCM V;  3VYH B;  2RHZ A;  2K5F A;  1BI0 A;  3JRZ A;  4O5V A;  3CC7 A;  4FT2 A;  4LDX A;  4OVA A;  2R58 A;  1YCY A;  3BFM A;  3URG A;  5A0D A;  3L2W A;  4XU0 A;  3CCJ T;  4CI0 C;  5FRM A;  3LGL A;  2CZ6 B;  5GAM j;  4FU6 A;  1ZQ1 A;  3A8M B;  3CCE T;  1U1S A;  4VUB A;  5CK9 A;  5GMK h;  3RIR A;  4ELY C;  4C8Q F;  4A53 A;  2DTI A;  3MEA A;  4HA8 A;  4XTX A;  4PJO E;  1M1G A;  2KDS A;  4OB3 B;  4XU2 A;  5CKE A;  1BYM A;  1U8R A;  2KK4 A;  1YJN T;  1W2B A;  3JCM f;  1VQM A;  1H64 1;  2CZ7 B;  1K73 U;  5J3B A;  4F7U B;  5GAM f;  2E6N A;  3H8Z A;  4PLL A;  5LJ5 g;  1YIT A;  4MZP A;  1FXX A;  1JRI A;  4NL3 A;  4N0A C;  2CS7 A;  4Q5W A;  4JLI A;  5J39 A;  4MDW A;  5GAN 7;  1O9S A;  3VUB A;  2E65 A;  3OYI A;  2QA4 T;  2RJF A;  2ZPE B;  4P5N A;  3QJ6 A;  4OP0 A;  3LYI A;  2LCL A;  4C92 C;  4NOY A;  3OMC A;  3V7C A;  4FM4 B;  3DLL A;  3CXC A;  1S72 T;  2HAX A;  2ZPB B;  2CZ0 B;  3GOX A;  3JCM d;  3OS0 A;  3MP6 A;  4JRI A;  3MP1 A;  4RKU E;  4NS5 A;  4F7U G;  2RI5 A;  5GAM d;  4R55 A;  2X4W A;  4R56 A;  1ZBX A;  4QVD A;  5I2M A;  3L2V A;  1VQN T;  5IAY A;  2OTL A;  3E9F A;  2E64 A;  5GMK j;  3TRE A;  2GFA A;  5A2Q E;  3LH0 A;  3G6E T;  2BUD A;  2XU8 A;  3JB9 D;  2LVM A;  3C4S A;  4C8Q G;  1KG1 A;  5FU7 C;  2MMP A;  4A4H A;  3DB4 A;  3UDC A;  1BIA A;  4PKC C;  1QVF A;  2X4X A;  1WNL A;  4F7U E;  4JLG A;  3OYG A;  4PJO C;  3INZ A;  2DVE A;  3CME T;  3CPW S;  3CCL T;  3PMI A;  3HSB A;  2JTM A;  1SSF A;  4XTU A;  2ZZD A;  4M7A A;  5AYF A;  3UWN A;  2YLB A;  3DKM A;  3PGG A;  3X28 B;  5DLO A;  3OYH A;  3GP8 A;  3DB3 A;  4HCC A;  1I81 A;  4E7H A;  2L5Q A;  2GCX A;  2V8J A;  3JCM X;  4M7A E;  3JB9 H;  1JB0 E;  2HQX A;  3M56 A;  2R5M A;  3CMA A;  2KVQ G;  3M4Y A;  3FB9 A;  2OTJ A;  2KMT A;  2MAM A;  3S6W A;  1QVG A;  2P0P A;  1KQS A;  4M7D D;  1VIF A;  1QP2 A;  3QHS A;  2KQW A;  2O4X A;  1LOJ A;  2ZPG B;  4HKE A;  4C8Q D;  4EMG A;  1XTD A;  3FLG A;  4J6W A;  4L5G A;  5GAO m;  1K8A U;  3RES A;  3PIP A;  3HHT B;  2VYT A;  3FIF A;  4M77 C;  1K73 C;  3CCQ A;  2E41 A;  4C5I A;  3O8V A;  4JRK A;  5GMK m;  4L6V 5;  1I4K 1;  3LW5 E;  4KUL A;  2PU9 B;  1W2B S;  3CCJ A;  1YHQ T;  2RA2 A;  4A54 A;  2XID A;  5EG2 A;  3M4G A;  4RCB A;  1VQ4 T;  2JTF A;  3TEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...