4GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
molecule keywords GRB2
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4gbqA00
2A08A 2FEIA 2IIMA 2JMAA 1SEMA 2EPDA 4GLMA 4AFQC 1KFZA 3U23A 2CH4A 2KROA 2JM8A 2FG0A 3M0RA 2NUZA 2FPDA 5ECAA 4CC2A 2AKLA 2LQNA 2C0TA 1SHGA 4J9IA 2MOXA 5IXBA 2P4RA 2RNAA 3VS1A 4ORZA 3C0CA 1UGVA 1GFCA 4GBQA 1PNJA 1T3LA 1W70A 2GQIA 4RTZA 3PVQA 2RQVA 4LUDA 4R0KA 4LE9A 1NYGA 1GCQC 1NEBA 2KEAA 3REAB 2JS2A 3THKA 2V1RA 4RTWA 1QKXA 3H0FA 1BBZA 2ESWA 1WFWA 4IIMA 2EGCA 4J9GA 2KYMA 3TVTA 2DBMA 1RUWA 2ENMA 1S1NA 2F2WA 2LCSA 4ESRA 1V1CA 4JZ4A 2HEQA 2KYBA 2J6KA 1IO6A 1JQQA 2GBQA 2KRSA 2JT4A 1JO8A 1UJYA 2B86A 3EG2A 1K4US 1J3TA 3EHQA 1JXMA 2XMFA 4F16A 1UJ0A 2DBKA 1T0JA 2JW4A 2MIOA 2EQIA 1G2BA 2G6FX 4JJDA 2O9SA 2YUQA 1K9AA 4KRTA 4JJCA 3UA6A 1NM7A 4EIKA 2AKKA 2EVRA 2YUOA 4HVVA 1TUCA 2DJQA 2DNUA 1I1JA 1QKWA 2O2OA 1W6XA 1YWOA 1AOJA 2KRNA 1WX6A 2L3QA 2QDLA 2F2XA 2LMJA 4F14A 1AWWA 3LH5A 1U06A 1VYVA 3I5SA 4Y92A 2RMOA 1T3SA 2YT6A 4LUEA 1W1FA 2J6FA 2HBWA 1A0NB 2FRYA 1AEYA 2DL8A 2KT8A 3I35A 3VS0A 2CSQA 4J9CA 2DA9A 3FJ5A 1ABOA 3JV3A 1UHCA 3NGPA 4JZ3A 2CH4W 1K0XA 2DRMA 2DL5A 2LJ1A 1T0HA 2J05A 1RLQC 2BZXA 4OMQA 1VA7A 3EG3A 3QWXX 3UF4A 1X6GA 4E6RA 1AWJA 1QCFA 3M0SA 3EG1A 1GBRA 2MCNA 2GTOA 2DILA 2PTKA 1K1ZA 4JPBW 1QWFA 1KIKA 2L2PA 1NYFA 2FO0A 2CREA 1BB9A 4J9FA 2YUNA 1NLPC 1OEBA 2GNCA 2AZVA 2W10A 2D1XA 3H41A 1H3HA 1M27C 2J7IA 4JJBA 1UG1A 1B07A 2DLPA 2K2MA 1MV0B 1SRMA 2ED1A 1UTIA 1E6GA 2JS0A 1M3AA 1YN8A 2D8JA 1AD5A 2GTJA 3TSZA 1E7OA 2A28A 2SRCA 1OPKA 3EG0A 2EYWA 3A98A 3GBQA 1Y0MA 2JXBA 2X3WD 2PZ1A 3CQTA 3TSWA 3NPFA 1N5ZA 2RF0A 4DEYA 2E5KA 2HCKA 1U5SA 1SHFA 2CSIA 2L0AA 1OV3A 2HSPA 1GCQA 2EW3A 2K6DA 1WIEA 2I0NA 1M8MA 4ZNXA 1YP5A 4D8KA 4AFUC 2A36A 2F2VA 2K79A 4LN2A 2CDTA 1G83A 1M30A 4OMPA 2CUBA 1QWEA 2DL3A 2C0OA 3I5RA 2D8HA 1GFDA 3O5ZA 4Z89A 2CT4A 5L23A 1EFNA 2RQUA 2VVKA 4AFZC 2D0NA 1PRMC 2FPFA 2DL4A 1I07A 2NWMA 5FWBA 4OMLA 1X43A 4RTYA 1NG2A 2KGTA 1TUDA 3EGUA 1M3BA 2VKNA 4FSSA 1WXTA 3R6NA 1WDXA 1SRLA 2DVJA 4Z8AA 1GBQA 1UFFA 3IQLA 2M51A 1GL5A 1B3QA 2CUDA 1OOTA 1YCSB 1UUEA 1Z9ZA 3SEMA 2SEMA 2DMOA 5GJWB 1KJWA 2BTTA 4RTVA 2KXDA 2K7AA 4Z88A 1X27A 3M0TA 4J9DA 2DYBA 4F17A 1BU1A 2X3XD 4RTXA 1ZLMA 2DF6A 2EGEA 2RQWA 3PE0A 5GJVB 1I0CA 1YWPA 1K76A 1YNZA 2FPEA 1H92A 2OI3A 1WYXA 3EHRA 1JEGA 1JXOA 2O9VA 3SHWA 3VRYA 2W0ZA 1MV3A 1VYTA 3M0QA 1VYUA 1CSKA 1X69A 2DRKA 1HD3A 2BZYA 5IHKA 3REBB 2YUPA 1WXBA 4J9HA 1Z9QA 3VS6A 1M3CA 3VS2A 4WCIA 1SPKA 1AZEA 2FRWA 1X2QA 5IXFA 1X2KA 4AG1C 3RBBB 3UA7A 4CC3A 5IHNA 1ZUUA 2KXCA 3UATA 4IIOA 3VS3A 2KR3A 4A63B 2EGAA 2O88A 4HCKA 1AWOA 1U3OA 3ZL7C 4M4ZA 2KBTA 1ZBJA 2LX7A 2ED0A 2GGRA 2AK5A 2LP5A 1ABQA 2LNHB 1PHTA 2KNBB 2LJ0A 4AFSC 5FWCA 1XOVA 1K0SA 5I11A 2EBPA 1CKAA 1UECA 5HCKA 1HJDA 2LQWA 2DX1A 3VS5A 1BK2A 3VS4A 2RPNA 5IH2A 2HDAA 2EKHA 3KFVA 2YDLA 2H8HA 1ZUYA 3VS7A 1FMKA 4OMNA 2KRMA 1NEGA 2DM1A 2A37A 1PRLC 4OMMA 2YSQA 1MUZA 1KSWA 1AWXA 1SSHA 1GCPA 2O31A 1QLYA 4HXJA 3NMZC 3M0UA 4RTTA 2PNIA 3PVLA 2JM9A 1FYNA 2EYYA 5IHIA 3QWYA 1ZSGA 4J9EA 2RQTA 1WA7A 3H0IA 1CKBA 1RI9A 2EYZA 4X1VA 1TG0A 4HVUA 1LCKA 4RUGA 1WLPB 2DE0X 1UDLA 2VWFA 2C0IA 2RQRA 5I22A 2KE9A 4LNPA 1NLOC 2JTEA 5FW9A 2LJ3A 2J6OA 2ROLA 1OPLA 2J06A 1ZUKA 3ULRB 4K11A 1RLPC 1E6HA 4DEXA 3M0PA 2AZSA 1Y57A 1HSQA 3NHNA 3RNJA 1AZGB 3H0HA 2KT1A 4J9BA 2EYXA 1UHFA 4HVWA 2ABLA 1H8KA 4RTUA 1PKTA 2M0YA 3VRZA 1GRIA 2LZ6B 3I9QA 1AVZC 4CC7A 2JMCA 4OMOA 2K3BA 2ROTA 5EC7A 4AG2C 1X6BA 4QT7A 2K9GA 4D8DA 1ARKA 1ZX6A 1UE9A 2ECZA 2V1QA 2L3PA 1WI7A 1PWTA 4CC4B 2RN8A 1PKSA 2L3SA 2CT3A 2DL7A 2OAWA 2OJ2A 1JU5C 2BZ8A 1WXUA
chains in the Genus database with same CATH superfamily
2FEIA 2IIMA 2VASA 1O75A 4GLMA 2CH4A 1YCYA 3CCSQ 2FPDA 2XD0A 3CD6A 5D6YA 5ECAA 4CC2A 1OX8A 2LQNA 2C0TA 3GLXA 2PVDB 1Q7YR 5GAOp 1KC8R 4PL6A 2P4RA 3HP9A 4IUUA 2RK1A 1UGVA 5KCHA 2LQKA 3CCEA 3QYGB 3PVQA 3WVDB 3GPLA 4LUDA 3EG9B 4LE9A 3G7ZA 4PJOF 2D6FA 5LJ5d 3JCMW 2FZGB 1PD1A 2JUFA 5KYNA 2MMPA 5DLQE 3URGA 3OYEA 2LRQA 3QSUA 4A4KA 4J9GA 2DBMA 1RUWA 2XKOC 1QCOA 3S3OA 2IPOB 2MK5A 2KRSA 5LJ5h 3OYIA 1RAIB 1PSEA 3EHQA 2XMFA 1UJ0A 1NPRA 1YJNT 4J7FA 2JW4A 4M7DE 3NFCA 3CEYA 1M1KU 2GCXA 3QDFA 2O9SA 1WHGA 2V8IA 5KYUA 1M2OA 1M90R 2RD1A 4D6WA 3UA6A 2LX9A 1UEBA 1KC8C 3OSVA 5GAMf 3A8GB 1W6XA 2DD5A 2LT1A 4C0DC 1VQ6A 1V29B 4X34A 3LH5A 2QTXA 4E7ZA 3I5SA 1U1TA 1WHHA 4Y92A 2RMOA 1FXXA 2E70A 2V26A 2D9TA 1N8RU 1QCNA 5IN1A 1AEYA 4LXCA 2DL8A 2DA9A 2RJDA 1UHCA 2B8AA 1K0XA 4M7DD 2DRMA 3CC2A 4PJLA 4CRIA 3A1PA 2LJ1A 2E10A 5GAOl 5M9OA 3O8VA 3C94A 1VA7A 4E7JA 2IG0A 3UF4A 1YI2T 4E6RA 2QTVA 3V8LA 4DA4A 3M0SA 1HK9A 4A53A 1K73R 5C6SA 2PTKA 3JB9J 3TEEA 2KVQG 3CCST 4JS5A 2HKQB 4OVAA 4LDVA 2QQBA 1NYFA 1BB9A 5A0LA 1OEBA 2GNCA 2AZVA 2DXCA 5CQXA 2W10A 2HL3A 3GF5A 2F1LA 4BI8B 4HCZA 4DOWA 2R5AA 1H3HA 2J7IA 2NUPB 3EFOA 3NTKA 5FRMA 2K4YA 3SDZA 3OA6A 1NBEB 1MV0B 4M7DG 1UTIA 3H6ZA 4J5YA 3JCMf 3ZFJA 2EYWA 4IKFA 2G3RA 4J7IA 2JXBA 4XTUA 4M7DB 3DB4A 2RI3A 4EDUA 1MMNA 2QASA 2E5KA 2XU8A 2YLCA 1SHFA 1OV3A 2XI9A 4EMKA 2A7YA 2EW3A 2I0NA 3MHXA 1NJIU 4D8KA 1D09B 1NJIR 1VQKQ 2DD4A 1WHMA 2JVVA 2F2VA 2QQRA 1VOMA 4C92A 1G83A 3J7AF 2GF7A 2C0OA 2EJGA 2D8HA 2QEXQ 3CMAT 5L23A 2NLUA 1D0YA 2VVKA 2DJZA 1W2BS 2FPFA 4PK4A 1D1BA 1I07A 4M77G 2OAUA 1C6VX 2EQUA 4RTYA 1FWZA 1FX7A 5GAMd 1VQ8Q 1WXTA 1PM3A 1MNDA 4KGXB 1SG5A 1YJ9T 2X35A 3IQLA 3E9FA 2KI7A 5LJ3f 1UUEA 1Z9ZA 2XK0A 3SEMA 2OTLQ 2DMOA 3CC4Q 2VYTA 4KGZB 2LDMA 5GMKe 5GANg 1X27A 2XDPA 2OTJA 4J9DA 2JJ9A 4QVDA 2KSSA 4WTOB 3M58A 2LCCA 1WZOA 3JCMg 2ZPIB 1M1KR 2EGEA 3PE0A 3CCVT 3JB9D 4JRKA 2M0OA 2F5TX 3QUIA 3JB9H 1K76A 1KQSP 1K73U 2FPEA 5A0GA 4PLIA 2EAYA 5IT9E 1VQ4T 1HD3A 5EG2A 2YUPA 1S72A 1YJWT 5FRNA 4C5EA 3I55Q 4C0GA 5J39A 1X2KA 3PIPA 3WVEB 3UA7A 1LPLA 1Y96A 2KR3A 4KT0E 3CPWA 3CCET 2P84A 4A63B 4BE1A 4M4ZA 2KBTA 2LX7A 2KMTA 2GGRA 2AK5A 1PCXA 2LP5A 1ABQA 2LNHB 2KNBB 2HNIA 5FWCA 4E7LA 3GNFB 1I8FA 5HCKA 3MO8A 1UGSB 3SFMA 3VS5A 2RPNA 4DBHA 2EKHA 4QVZA 2YDLA 1K9MU 4XU0A 2KK4A 4OMNA 3A8MB 3M9QA 4J6YA 5GANh 4RKUE 3H8ZA 4BUGA 3OYBA 1QLYA 5GMKi 1QVFA 3M59A 1XQHA 3M0UA 4XQ3A 1YJ9Q 3PVLA 2XHCA 5KYWB 1KQSA 3M56A 1YI2A 2EYYA 1GXIE 1ZSGA 5GMKl 1WJQA 3H0IA 2I2LA 4KH0B 4IUVA 4PNOA 4HA8A 4PFZA 4FYXB 2XICA 2QK0A 2HMAA 1LCKA 1ZA1B 2EQKA 4QQDA 4PJOE 2FHDA 1TSFA 3CCRA 1OZ2A 1UDLA 2C0IA 3CCQQ 1QVFP 2ZPFB 4C92F 1KC8U 1XNIA 2JTEA 3ASKA 3A5ZB 2J6OA 2VXEA 1RAFB 2ROLA 3CMAA 4F7UB 2J06A 1RLPC 4WF2A 1YHQA 4FW2A 3X24B 1RAEB 3META 3QG1A 2CP5A 2A3LA 4F04B 5GANd 1AZGB 3HFOA 5GAN4 1JJ2P 2KT1A 2EYXA 1UHFA 1VQ8T 3CPWP 1H8KA 1D0XA 2JNGA 1PKTA 4OF1A 1R77A 3I9QA 1AVZC 4PKCC 1BKBA 1ZSZA 1Q86R 1M8VA 4OGEA 3CCMQ 2DTIA 5KYYB 1ZX6A 2DERA 2AHJB 3CCLT 2DL7A 1QMCA 4C5GA 2NYSA 2WACA 2BZ8A 2A08A 3MCAB 2EPDA 3MP8A 1WPYA 1JJ2S 4M7AB 1G8XA 4RG8A 4KH1B 2FG0A 4JRQA 2NUZA 3D7SB 3DLLA 3T9NA 3MEWA 1TOVA 3PNWC 3VS1A 3MEUA 2LC4A 3KBGA 1BI3A 1GFCA 1YITQ 3MKDA 3L2RA 4RTZA 4R0KA 3VJPA 1NE8A 1NEBA 4ELYC 2KEAA 4M77F 2DETA 3THKA 3AHUA 3H0FA 3M55A 1BBZA 3CCLA 1VQLT 4IIMA 2EGCA 4YTLA 3TVTA 5CKEA 2ENMA 4Y28E 3GNGA 1S1NA 5D6WA 2RB6A 1V1CA 5KYXA 5GAOr 2JOYA 2YLBA 3R6OA 2FZKB 2QEXA 2CP6A 2K2VA 3J80E 1Q82R 3SWNC 2F69A 1AHJB 1JB0E 5KH6A 2ZGWA 5CKHA 1PG5B 2QDYB 2LVMA 1JXMA 2FZCB 2MIOA 4PJNA 1YJWQ 4M77C 4KRTA 1Y07A 2KY9A 3OB9A 3Q1JA 4JJCA 4DBFA 3OS1A 1NM7A 4EIKA 8ATCB 2EVRA 4MZPA 2WSCE 3OW2P 1OX9A 1N6AA 2DJQA 1I1JA 3BDUA 3QKJA 3M53A 1R0BG 4ZN3A 3SWNA 1WX6A 2FVUA 2QXFA 2QDLA 1NPPA 3JCMd 3PMIA 3GOXA 1M2VA 3CMEA 3E9GA 1U06A 1VYVA 4OB3B 3CCVQ 3M4YA 2FYKA 5GMKm 2YT6A 1VQ4Q 4LUEA 3INZA 1WHKA 1X75C 5C0MA 4BE2A 2CP7A 4HCCA 4M7AE 4FYWB 3FJ5A 3NGPA 3CCUT 4FIBA 2CH4W 1M4ZA 1N9SA 2KQWA 2QQ9A 3JCMX 2O4XA 5CQYA 1KG1A 2BZXA 5GAMg 3LH0A 2DK3A 3EGDB 3MJXA 3BFMA 2COYA 3SB2A 5GAOm 4KULA 2GTOA 9ATCB 1K1ZA 3QXEB 4M7DC 3L42A 1KIKA 3V8JA 1IB8A 2CREA 2YUNA 1NLPC 3C4SA 4EPCA 3QIIA 1M27C 3X20B 4E7SA 3OYLA 4JJBA 4M7AC 3KUFA 3G6EQ 4M78B 2DLPA 3CPWS 4QVCA 4XAXB 2K2MA 3JRZA 1SRMA 3S6WA 2M16A 4JS4A 2D8JA 1G3WA 1E7OA 3MEVA 3OMCA 1OPKA 5KYUB 3CCQA 2HQHA 1R8OB 3OW2A 3CQTA 1HYOA 4BDZA 3LWHA 1N5ZA 2RF0A 2HCKA 2QA4Q 1N8RR 2V8JA 1YHQQ 2COWA 2AT1B 2MF2A 4N0AC 2K6DA 3EGXB 3PT9A 4LDXA 1LVKA 1K8AC 4M77D 2RJFA 2A36A 3CCRQ 2K79A 3JAME 3FC3A 4QQ6A 5DY9A 4OB1B 3ZBDA 3I5RA 3OYFA 1EX4A 4M75F 3F70A 3O5ZA 4B6MA 2CT4A 4DQ2A 4OB2B 2VGNA 1JRIA 5FWBA 1X43A 1NG2A 2CZ1B 1M3BA 1BYMA 1YHQT 4BE0A 2H3JA 1WDXA 1SRLA 4C92C 2M51A 1GL5A 2CUDA 5GANf 1OOTA 2H3EB 1OU8A 5D7UA 2SEMA 4N4HA 5GJWB 3A8LB 5I2MA 1Q81U 4A4HA 3SWNB 2DYBA 4C0FA 3VV0A 1BU1A 4UC4A 1MMGA 1V76A 2PUOB 1M2VB 2DF6A 2RM4A 5GJVB 1P92A 1MGQA 5AYFA 1XTDA 1I0CA 1EIFA 4ZGJB 2DEUA 4FT2A 1B7TA 2VV5A 1VQLQ 4E7HA 1JXOA 2QGFB 3CBPA 2QEXT 1VQ7Q 3VRYA 3BE3A 1IGUA 1Q7YU 1F1BB 1CSKA 4LDUA 5IHKA 3REBB 3VS6A 4HT9A 2IVWA 2X9HA 1SPKA 4M75A 4AG1C 4BY6C 2P0PA 2KXCA 2L3RA 3QDRB 2E5QA 4A54A 4FT4A 2O88A 1VQOT 1AT1B 1U3OA 4BI3A 3OS5A 2L89A 3CD6T 4PJMA 2NUTA 3RKXA 3QYHB 1WHJA 1PHTA 3EFSA 4AFSC 2RA2A 4XTXA 2HL5C 3LGLA 1XOVA 3CC7T 2EBPA 3VKIA 1HJDA 4PJOC 2BE9B 4Z02A 3CCVA 5GAN7 2DX1A 5GANj 2HDAA 3CCSA 1ACMB 3OYHA 2H8HA 5CO7A 3VS7A 2DM1A 1OYXA 2HQEA 1KD1R 3FRNA 2R5MA 4M78G 5GAMh 2O31A 2PNIA 1ZA2B 5I21A 1VQMA 1VQ7T 2HD0A 4X1VA 2EYZA 3OBYA 4N4IA 1I5LA 1TG0A 3G71T 1M1KC 4HVUA 5AT1B 2QQAA 4C5IA 4RUGA 3RR6A 5LL6S 4GLKA 1TU0B 1KHIA 1C0MA 1Q7YC 2LJ3A 2X4YA 1ZBXA 1WHLA 5A0DA 4C92E 1VQ5T 2AZSA 1Y57A 2GQVA 1HSQA 1VQ5Q 4MZMA 3NTIA 2DXUA 5CAIA 4IUQA 4J9BA 1ZHIA 3OYMA 4JUVA 4ANJA 3OMGA 1BI1A 3M54A 3WXMB 3PFSA 2M0YA 3VRZA 3EG9A 2LZ6B 3CC2Q 2DFUA 5FU7C 4LD6A 2QA4A 3JB9I 3G6EA 4X9DA 2K3BA 2CZ0B 2ROTA 4AG2C 1X6BA 4XTVA 3CBMA 1ARKA 4RMOA 3A8OB 2ECZA 4CC4B 2QGGA 5GAOq 3JB9G 2L3SA 2OJ2A 4A4FA 3G1JA 2LQ8A 1RAGB 1WXUA 2RH2A 2JMAA 1SEMA 5LJ5j 3HPWA 1KFZA 2KROA 1VQ9T 4E7KA 3OS2A 3M0RA 1XJWB 4FM4B 4JLIA 4M75D 3G71Q 4ZTFA 1SHGA 4J9IA 2EQJA 2MOXA 1RAHB 2YHTA 5GMKj 2PU9B 2COZA 5IXBA 1VQ9A 5HK3A 4EMKB 3C0CA 1QVGP 2EWNA 5KYWA 2E3IA 3CCUA 3RERA 1WNLA 4PLLA 1UGRB 2MI6A 4M77E 1K8AU 2GQIA 1W70A 2CS7A 2EIFA 2RQVA 2EJ9A 4E2FB 1GCQC 3REAB 2JS2A 4ATOA 3V7SA 2V1RA 4RTWA 3P8HA 1QKXA 2ESWA 1WFWA 4FYYB 4MMLA 1QVGA 2LCSA 1VQNQ 4ESRA 2VC8A 4HCBA 4F7UA 1N9RA 1H3ZA 4QW2A 2DZCA 1D3BB 3BW1A 1JQQA 2GBQA 3PGGA 2JT4A 1JO8A 1UJYA 2B86A 3EG2A 3JCMb 1K4US 2DIQA 1YIJA 1RL2A 6AT1B 4VUBA 1IHVA 2M9UA 1G2BA 2JTFA 5FROA 2BKDN 2YUQA 4OMFB 5A2QE 2WSFE 2CP0A 2QQSA 3OW2S 5J3BA 3MPUB 2AKKA 2YUOA 3EGDA 4HVVA 1VQPQ 1G3YA 3CCLQ 4BI4A 1S72T 2OX7A 1RI0A 1QKWA 1YWOA 1AOJA 2KRNA 1VQMT 4PJOA 1W2BA 2L3QA 3JCMJ 1VQLA 1AWWA 4IUPA 2J6FA 3HHTB 2FRYA 2DKGA 2K57A 2KT8A 3G4SA 2HSEB 3M57A 3VS0A 2CSQA 4M7AD 4J9CA 4F7UG 4M78A 3FDRA 1VQ6T 3RKWA 2DL5A 2J05A 3I56Q 1RLQC 3CCEQ 3P8BB 4OMQA 1VIEA 4OP0A 1Y96B 3EG3A 1X6GA 3V8KA 3HFNA 3JCMc 2CZ6B 1PC0A 1VQKA 1B34B 4R56A 2LCLA 2L2PA 2MAMA 1UGQB 4JRIA 5GAOn 3TU4K 1TXQA 2FO0A 3OYGA 2LT4A 3LLRA 2D1XA 3I56T 1IGQA 1TUGB 3ER0A 3H41A 3OYCA 3CXCP 4XU2A 1VQOA 3FEOA 3UT1A 5CR2A 4J8OA 4DOVA 4V2SA 1B07A 3VU3C 2DAQA 3VUZA 1WQ7A 5HK0A 3HRSA 2XDBA 1MMAA 2A0FB 3MP1A 2ED1A 2JS0A 1M3AA 1YN8A 4M75G 2GTJA 3TSZA 5KYXB 2A28A 1M5Q1 2SRCA 4ZGDB 3GBQA 3E1SA 3TQ7P 1I81A 2BUDA 5CKBA 2PZ1A 3NPFA 4DEYA 1JBMA 3L2QA 3OYKA 1U5SA 1TH7A 2L0AA 4ME7A 3RESA 5FU6B 1UGPB 4C8QD 4C92G 4EMKC 5GAMj 3MEAA 1GCQA 2PUKB 3JSCA 1VQ5A 1DJ7B 2GFUA 1WIEA 1M8MA 1IXDA 4ZNXA 5LJ3j 4AFUC 3JCMP 2ZPEB 2RHYA 4OMPA 2M02A 4Q5WA 2CZ7B 2YRCA 2DPPB 1GFDA 1QVFS 4MDWA 4Z89A 2FL7A 1D3BA 1EFNA 2RQUA 1WQWA 4L59A 2DEQA 3LW5E 3I55A 1VQNT 3TCJA 2EYQA 2EFIA 1IZ6A 4J83A 3RMSA 5LJ5f 2KGTA 1TUDA 3EGUA 2L5QA 3HRTA 4FSSA 1SSFA 4RG2A 1UFFA 1X01A 1B3QA 4JJNK 1KJWA 4RTVA 2KXDA 3GP8A 3M0TA 3CMAQ 2ZCFB 4C8QB 3V7CA 4C8QG 4F17A 3VYHB 4M78F 2X3XD 1WGSA 4C8QE 4RTXA 2ZPHB 3CXCA 2RQWA 4M7AA 4C5HA 1YWPA 2DXBA 5KE2A 2NUTB 1SF9A 4Y91A 1YNZA 2OI3A 1WYXA 3QZ9B 2HQXA 2RJCA 3BDLA 3S3NA 4M7AG 2OTJT 3M0QA 1VYUA 4L5GA 1U1SA 2BZYA 1WXBA 3CCRT 1Z9QA 1M3CA 2M1HA 3VS2A 4WCIA 2JZ2A 2LNVA 3CC2T 4NS5A 4BDYA 1JJ2A 3RBBB 4ZN1A 5KCOA 4CC3A 5CKFA 3VS3A 1EZZB 3CMEQ 1BIAA 3C95A 1YIJQ 3ZL7C 1ZBJA 3CBOA 2HZYA 1HXDA 4M77A 4QKUA 2Y4YA 3EGXA 3LYIA 1Q95G 4AT1B 1VIFA 3P8DA 1UECA 1D1CA 4O6JA 1VQPA 4OB0B 4BB7A 4C92D 2DTOA 2NUPA 1BK2A 3KFVA 2MWOA 1K73C 1QVPA 1ZUYA 1FMKA 1BCOA 3RMQA 2OTLA 4M7AF 3X28B 1VQ8A 3E19A 1IRXA 4BY6B 2A37A 5L8RE 2OTJQ 4OMMA 2E6NA 3DB3A 4C8QF 1KSWA 1AWXA 1SSHA 1GCPA 2OTLT 3JCMe 3NMZC 3OSSC 3JCMV 1RABB 3RIRA 4RTTA 5CK9A 2F5KA 4A4GA 3OY9A 2DXTA 1M9SA 3CXCS 1FYNA 4MDXA 5IHIA 2X4XA 2L8DA 3PIOA 4J9EA 1WA7A 5KYYA 1K8AR 1CKBA 4ZGEB 5HKCA 2RO0A 3L2UA 3FJPA 2DE0X 2VWFA 2RQRA 5I22A 1NLOC 5FW9A 1TTHB 2CGHA 4B9XA 2QA4T 1Y71A 1OPLA 2DZ9A 1ZUKA 3MP6A 3ULRB 3ZEHA 1YITA 3LX7A 1E6HA 4DEXA 3M0PA 1YBYA 4N4GA 4M7DA 3CD6Q 3H0HA 2QG9B 2YXYA 1RADB 2ZAEA 2JN0A 2R58A 3QBYA 1GRIA 5LJ5g 2Y90A 3CCQT 3OYJA 2VXFA 4QT7A 2K9GA 4D8DA 2XG8D 1I4K1 5FLXE 2V1QA 1WI7A 2RN8A 2RHZA 3J81E 3FIFA 3DKMA 4HCKA 4CI0C 5LJ5e 1VQ4A 4FL6A 4A4EA 2D0QB 3JCMh 4AFQC 3U23A 1G3TA 2JM8A 1YJWA 2MWPA 4M75E 2AKLA 2K3YA 4XU3A 2R57A 2CKKA 2RI5A 3EH1A 5KE3A 1O9SA 2RNAA 4FYVB 4ORZA 1M1GA 1NZ9A 2BE7D 2K5LA 3L1AA 2VUBA 1H641 1G5VA 4GBQA 1PNJA 2HAXA 3L2VA 4JLGA 1T3LA 4KUDK 2C06A 5LJ3e 1YI2Q 1NYGA 1X6OA 1Q82C 4PJJA 4C0ZA 3OYAA 2YRDA 1OULA 3AT1B 2KYMA 2RJEA 2F2WA 4JZ4A 2HEQA 5LJ3g 4II1A 2KYBA 2JTMA 1Q81C 1I5OB 4N0AA 2J6KA 1IO6A 2EKOA 4JRPA 1WJSA 3EFOB 1BIBA 1J3TA 1BI0A 2RHXA 1M1FA 4F16A 2O4XB 2DBKA 1IHWA 4LDWA 1T0JA 4FSXA 4NL2A 5IAYA 5LJ3h 2EQIA 3I55T 1W4SA 1TS9A 2G6FX 4JJDA 1K9AA 3SD4A 1YIJT 3FB9A 4EMGA 1FMWA 2FB7A 3PTAA 4LD9K 1TUCA 3HTRA 2LTOA 4C92B 2DNUA 2X4JA 3RKYA 2O2OA 1VQNA 4HT8A 4R55A 2HBPA 2E64A 4E7IA 1D1AA 2F2XA 2LMJA 4F14A 4M78D 5CKDA 2GFAA 3QZ5B 1OZ3A 5CIUA 1T3SA 1K9MR 1W2BP 3KXTA 4FU6A 1W1FA 3EH2A 3H9NA 5CVIA 2HBWA 1A0NB 3QJ6A 4FCYA 3GIBA 4RCBA 3I35A 1OQKA 4RCCA 5GMKh 1ABOA 3JV3A 4JZ3A 1YITT 4M75B 3L2ZA 2P0KA 1T0HA 3EAEA 4QQGA 1C1AA 1VQPT 3N5BB 5J26A 3QWXX 2Z0WA 1AWJA 1QCFA 3EG1A 1GBRA 2EQMA 2MCNA 2DILA 2VB6A 5GAN5 3CCJQ 2DO3A 4JPBW 1QWFA 5DM7R 2CYZB 2P4TA 1MHNA 1G3SA 3PMTA 4J9FA 3JCMQ 4JDSA 4PFPA 1WJRA 3S3MA 3CCUQ 1UG1A 3G6ET 2E4HA 5GAN8 3RUXA 5DLOA 1YJNA 3NTHA 1E6GA 4MMKA 1AD5A 5GAN3 4XU1A 3G71A 2K3XA 3EG0A 3A98A 1Y0MA 3OS0A 1BI2A 2X3WD 4C0DB 3CCJT 3X26B 2E1HA 2YWWA 3TSWA 1VQ9Q 2ATCB 1Q86U 4XK8E 1D0ZA 2QYZA 2CSIA 5GAMe 2Y4XA 4O5VA 2HSPA 4P5NA 3QPHA 4L6V5 2BIVA 4KBMB 3BY7A 2X4WA 1M90U 1YP5A 1FMVA 4HKEA 4LN2A 2CDTA 5GAN2 4C8QC 1RACB 1M30A 2PQWA 2CUBA 4ZTJA 1QWEA 4C8QA 2DL3A 3HSBA 8AT1B 1QQJA 4NOYA 4DBRA 5FU7B 4AFZC 1KQSS 2D0NA 4M78C 1KD1C 1LNXA 1PRMC 2DL4A 2NWMA 4OMLA 3EFRA 1VUBA 4F7UF 2RHUA 3CMET 1R0CB 2VKNA 3E2UA 2K5FA 3R6NA 2DVJA 4Z8AA 1GBQA 4KUIA 4X9CA 1KQ1A 1YCSB 4M78E 4PJOD 3CC4T 2BTTA 2E6ZA 2DVEA 2K7AA 4Z88A 1UB4A 2ZZDA 3OYDA 1Q86C 3CC7A 3A8HB 2MYSA 3HKSA 1ZLMA 3HL8A 1YFNA 4EMHA 3OYNA 4LDYA 3QHSA 1H92A 4M77B 1KHCA 3EHRA 1VQMQ 1JEGA 3JB9F 2O9VA 3RDVA 3SHWA 3G4SQ 1MMDA 4B9WA 5GAN6 4OGCA 2W0ZA 1MV3A 2CP2A 1VYTA 4PFOA 4GY5A 5FU6C 4M7DF 2XIDA 3M5AA 1X69A 2DRKA 1QP3A 2DIGA 2K5IA 2P0QA 4J9HA 2ZPBB 1VQ6Q 2YRVA 2HKNA 2QI2A 1AZEA 4M75C 2FRWA 2O01E 1X2QA 1IREB 1RAAB 2E41A 5IXFA 2E12A 4J6WA 5D6XA 1N27A 5IHNA 1ZUUA 7AT1B 3UATA 4IIOA 3UWNA 2EGAA 1AWOA 2DTHA 4IUTA 4PJOB 3OBWA 2E3HA 2ED0A 2VGMA 1Q81R 2LJ0A 1VQOQ 1S72Q 2ZPGB 1PSFA 3CC7Q 1ZSZB 1BCMA 1K0SA 4F7UE 5I11A 1CKAA 3VUBA 3I56A 2LQWA 4XTYA 2RHIA 4DBQA 3CCMT 2MPXC 3VS4A 5IH2A 1SKUB 4NL3A 1TWBA 2WSEE 1LOJA 3UPUA 4J6XA 2KRMA 1NEGA 4IURA 1VQ7A 2RK2A 1Q82U 1PRLC 2QAZA 3G4ST 2XDDA 2YSQA 2X51A 1MUZA 1B34A 3C12A 3FLGA 3QO3A 3HRUA 1MNEA 3QJYA 4HXJA 1M90C 1QP2A 2JM9A 4BACA 1K9MC 3QWYA 5I2SA 1NJIC 2RI2A 2RQTA 1KK7A 2PVGB 2DYIA 1RI9A 2CP3A 1LJOA 4E47A 2E65A 1VQKT 3CPFA 1KQ2A 1WLPB 5CCAA 1N8RC 3M4GA 3CCMA 1KD1U 2KDSA 4AMCA 3LGFA 1ZSZC 2KE9A 1QVGS 1OU9A 4LNPA 3ME9A 2KAFA 1YJ9A 4K11A 4KGVB 3CCJA 2EJFA 3TREA 1Y7XA 3OQ5A 5GANe 3NHNA 3RNJA 5LJ3d 4FW1A 3UDCA 1QW1A 4ELZC 4PJOG 4HVWA 4XTZA 2PVOB 2ABLA 3VYGA 3L2WA 4RTUA 4MZTA 3DLMA 2AIRB 4BD3A 1PD0A 4CC7A 1U8RA 2JMCA 2V8KA 5HY6A 4OMOA 3V7RA 3LWIA 5EC7A 3CC4A 1YJNQ 4XTWA 1UE9A 1ZQ1A 2L3PA 1PWTA 1PKSA 3OYYA 4TVRA 2CT3A 2OAWA 3X25B 1OI1A 1JU5C
chains in the Genus database with same CATH topology
2A08A 2FEIA 2IIMA 2JMAA 1SEMA 2EPDA 4GLMA 4AFQC 1KFZA 3U23A 2CH4A 2KROA 2JM8A 2FG0A 3M0RA 2NUZA 2FPDA 5ECAA 4CC2A 2AKLA 2LQNA 2C0TA 1SHGA 4J9IA 2MOXA 5IXBA 2P4RA 2RNAA 3VS1A 4ORZA 3C0CA 1UGVA 1GFCA 4GBQA 1PNJA 1T3LA 1W70A 2GQIA 4RTZA 3PVQA 2RQVA 4LUDA 4R0KA 4LE9A 1NYGA 1GCQC 1NEBA 2KEAA 3REAB 2JS2A 3THKA 2V1RA 4RTWA 1QKXA 3H0FA 1BBZA 2ESWA 1WFWA 4IIMA 2EGCA 4J9GA 2KYMA 3TVTA 2DBMA 1RUWA 2ENMA 1S1NA 2F2WA 2LCSA 4ESRA 1V1CA 4JZ4A 2HEQA 2KYBA 2J6KA 1IO6A 1JQQA 2GBQA 2KRSA 2JT4A 1JO8A 1UJYA 2B86A 3EG2A 1K4US 1J3TA 3EHQA 1JXMA 2XMFA 4F16A 1UJ0A 2DBKA 1T0JA 2JW4A 2MIOA 2EQIA 1G2BA 2G6FX 4JJDA 2O9SA 2YUQA 1K9AA 4KRTA 4JJCA 3UA6A 1NM7A 4EIKA 2AKKA 2EVRA 2YUOA 4HVVA 1TUCA 2DJQA 2DNUA 1I1JA 1QKWA 2O2OA 1W6XA 1YWOA 1AOJA 2KRNA 1WX6A 2L3QA 2QDLA 2F2XA 2LMJA 4F14A 1AWWA 3LH5A 1U06A 1VYVA 3I5SA 4Y92A 2RMOA 1T3SA 2YT6A 4LUEA 1W1FA 2J6FA 2HBWA 1A0NB 2FRYA 1AEYA 2DL8A 2KT8A 3I35A 3VS0A 2CSQA 4J9CA 2DA9A 3FJ5A 1ABOA 3JV3A 1UHCA 3NGPA 4JZ3A 2CH4W 1K0XA 2DRMA 2DL5A 2LJ1A 1T0HA 2J05A 1RLQC 2BZXA 4OMQA 1VA7A 3EG3A 3QWXX 3UF4A 1X6GA 4E6RA 1AWJA 1QCFA 3M0SA 3EG1A 1GBRA 2MCNA 2GTOA 2DILA 2PTKA 1K1ZA 4JPBW 1QWFA 1KIKA 2L2PA 1NYFA 2FO0A 2CREA 1BB9A 4J9FA 2YUNA 1NLPC 1OEBA 2GNCA 2AZVA 2W10A 2D1XA 3H41A 1H3HA 1M27C 2J7IA 4JJBA 1UG1A 1B07A 2DLPA 2K2MA 1MV0B 1SRMA 2ED1A 1UTIA 1E6GA 2JS0A 1M3AA 1YN8A 2D8JA 1AD5A 2GTJA 3TSZA 1E7OA 2A28A 2SRCA 1OPKA 3EG0A 2EYWA 3A98A 3GBQA 1Y0MA 2JXBA 2X3WD 2PZ1A 3CQTA 3TSWA 3NPFA 1N5ZA 2RF0A 4DEYA 2E5KA 2HCKA 1U5SA 1SHFA 2CSIA 2L0AA 1OV3A 2HSPA 1GCQA 2EW3A 2K6DA 1WIEA 2I0NA 1M8MA 4ZNXA 1YP5A 4D8KA 4AFUC 2A36A 2F2VA 2K79A 4LN2A 2CDTA 1G83A 1M30A 4OMPA 2CUBA 1QWEA 2DL3A 2C0OA 3I5RA 2D8HA 1GFDA 3O5ZA 4Z89A 2CT4A 5L23A 1EFNA 2RQUA 2VVKA 4AFZC 2D0NA 1PRMC 2FPFA 2DL4A 1I07A 2NWMA 5FWBA 4OMLA 1X43A 4RTYA 1NG2A 2KGTA 1TUDA 3EGUA 1M3BA 2VKNA 4FSSA 1WXTA 3R6NA 1WDXA 1SRLA 2DVJA 4Z8AA 1GBQA 1UFFA 3IQLA 2M51A 1GL5A 1B3QA 2CUDA 1OOTA 1YCSB 1UUEA 1Z9ZA 3SEMA 2SEMA 2DMOA 5GJWB 1KJWA 2BTTA 4RTVA 2KXDA 2K7AA 4Z88A 1X27A 3M0TA 4J9DA 2DYBA 4F17A 1BU1A 2X3XD 4RTXA 1ZLMA 2DF6A 2EGEA 2RQWA 3PE0A 5GJVB 1I0CA 1YWPA 1K76A 1YNZA 2FPEA 1H92A 2OI3A 1WYXA 3EHRA 1JEGA 1JXOA 2O9VA 3SHWA 3VRYA 2W0ZA 1MV3A 1VYTA 3M0QA 1VYUA 1CSKA 1X69A 2DRKA 1HD3A 2BZYA 5IHKA 3REBB 2YUPA 1WXBA 4J9HA 1Z9QA 3VS6A 1M3CA 3VS2A 4WCIA 1SPKA 1AZEA 2FRWA 1X2QA 5IXFA 1X2KA 4AG1C 3RBBB 3UA7A 4CC3A 5IHNA 1ZUUA 2KXCA 3UATA 4IIOA 3VS3A 2KR3A 4A63B 2EGAA 2O88A 4HCKA 1AWOA 1U3OA 3ZL7C 4M4ZA 2KBTA 1ZBJA 2LX7A 2ED0A 2GGRA 2AK5A 2LP5A 1ABQA 2LNHB 1PHTA 2KNBB 2LJ0A 4AFSC 5FWCA 1XOVA 1K0SA 5I11A 2EBPA 1CKAA 1UECA 5HCKA 1HJDA 2LQWA 2DX1A 3VS5A 1BK2A 3VS4A 2RPNA 5IH2A 2HDAA 2EKHA 3KFVA 2YDLA 2H8HA 1ZUYA 3VS7A 1FMKA 4OMNA 2KRMA 1NEGA 2DM1A 2A37A 1PRLC 4OMMA 2YSQA 1MUZA 1KSWA 1AWXA 1SSHA 1GCPA 2O31A 1QLYA 4HXJA 3NMZC 3M0UA 4RTTA 2PNIA 3PVLA 2JM9A 1FYNA 2EYYA 5IHIA 3QWYA 1ZSGA 4J9EA 2RQTA 1WA7A 3H0IA 1CKBA 1RI9A 2EYZA 4X1VA 1TG0A 4HVUA 1LCKA 4RUGA 1WLPB 2DE0X 1UDLA 2VWFA 2C0IA 2RQRA 5I22A 2KE9A 4LNPA 1NLOC 2JTEA 5FW9A 2LJ3A 2J6OA 2ROLA 1OPLA 2J06A 1ZUKA 3ULRB 4K11A 1RLPC 1E6HA 4DEXA 3M0PA 2AZSA 1Y57A 1HSQA 3NHNA 3RNJA 1AZGB 3H0HA 2KT1A 4J9BA 2EYXA 1UHFA 4HVWA 2ABLA 1H8KA 4RTUA 1PKTA 2M0YA 3VRZA 1GRIA 2LZ6B 3I9QA 1AVZC 4CC7A 2JMCA 4OMOA 2K3BA 2ROTA 5EC7A 4AG2C 1X6BA 4QT7A 2K9GA 4D8DA 1ARKA 1ZX6A 1UE9A 2ECZA 2V1QA 2L3PA 1WI7A 1PWTA 4CC4B 2RN8A 1PKSA 2L3SA 2CT3A 2DL7A 2OAWA 2OJ2A 1JU5C 2BZ8A 1WXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A08 A;  2FEI A;  2IIM A;  2JMA A;  1SEM A;  2EPD A;  4GLM A;  4AFQ C;  1KFZ A;  3U23 A;  2CH4 A;  2KRO A;  2JM8 A;  2FG0 A;  3M0R A;  2NUZ A;  2FPD A;  5ECA A;  4CC2 A;  2AKL A;  2LQN A;  2C0T A;  1SHG A;  4J9I A;  2MOX A;  5IXB A;  2P4R A;  2RNA A;  3VS1 A;  4ORZ A;  3C0C A;  1UGV A;  1GFC A;  4GBQ A;  1PNJ A;  1T3L A;  1W70 A;  2GQI A;  4RTZ A;  3PVQ A;  2RQV A;  4LUD A;  4R0K A;  4LE9 A;  1NYG A;  1GCQ C;  1NEB A;  2KEA A;  3REA B;  2JS2 A;  3THK A;  2V1R A;  4RTW A;  1QKX A;  3H0F A;  1BBZ A;  2ESW A;  1WFW A;  4IIM A;  2EGC A;  4J9G A;  2KYM A;  3TVT A;  2DBM A;  1RUW A;  2ENM A;  1S1N A;  2F2W A;  2LCS A;  4ESR A;  1V1C A;  4JZ4 A;  2HEQ A;  2KYB A;  2J6K A;  1IO6 A;  1JQQ A;  2GBQ A;  2KRS A;  2JT4 A;  1JO8 A;  1UJY A;  2B86 A;  3EG2 A;  1K4U S;  1J3T A;  3EHQ A;  1JXM A;  2XMF A;  4F16 A;  1UJ0 A;  2DBK A;  1T0J A;  2JW4 A;  2MIO A;  2EQI A;  1G2B A;  2G6F X;  4JJD A;  2O9S A;  2YUQ A;  1K9A A;  4KRT A;  4JJC A;  3UA6 A;  1NM7 A;  4EIK A;  2AKK A;  2EVR A;  2YUO A;  4HVV A;  1TUC A;  2DJQ A;  2DNU A;  1I1J A;  1QKW A;  2O2O A;  1W6X A;  1YWO A;  1AOJ A;  2KRN A;  1WX6 A;  2L3Q A;  2QDL A;  2F2X A;  2LMJ A;  4F14 A;  1AWW A;  3LH5 A;  1U06 A;  1VYV A;  3I5S A;  4Y92 A;  2RMO A;  1T3S A;  2YT6 A;  4LUE A;  1W1F A;  2J6F A;  2HBW A;  1A0N B;  2FRY A;  1AEY A;  2DL8 A;  2KT8 A;  3I35 A;  3VS0 A;  2CSQ A;  4J9C A;  2DA9 A;  3FJ5 A;  1ABO A;  3JV3 A;  1UHC A;  3NGP A;  4JZ3 A;  2CH4 W;  1K0X A;  2DRM A;  2DL5 A;  2LJ1 A;  1T0H A;  2J05 A;  1RLQ C;  2BZX A;  4OMQ A;  1VA7 A;  3EG3 A;  3QWX X;  3UF4 A;  1X6G A;  4E6R A;  1AWJ A;  1QCF A;  3M0S A;  3EG1 A;  1GBR A;  2MCN A;  2GTO A;  2DIL A;  2PTK A;  1K1Z A;  4JPB W;  1QWF A;  1KIK A;  2L2P A;  1NYF A;  2FO0 A;  2CRE A;  1BB9 A;  4J9F A;  2YUN A;  1NLP C;  1OEB A;  2GNC A;  2AZV A;  2W10 A;  2D1X A;  3H41 A;  1H3H A;  1M27 C;  2J7I A;  4JJB A;  1UG1 A;  1B07 A;  2DLP A;  2K2M A;  1MV0 B;  1SRM A;  2ED1 A;  1UTI A;  1E6G A;  2JS0 A;  1M3A A;  1YN8 A;  2D8J A;  1AD5 A;  2GTJ A;  3TSZ A;  1E7O A;  2A28 A;  2SRC A;  1OPK A;  3EG0 A;  2EYW A;  3A98 A;  3GBQ A;  1Y0M A;  2JXB A;  2X3W D;  2PZ1 A;  3CQT A;  3TSW A;  3NPF A;  1N5Z A;  2RF0 A;  4DEY A;  2E5K A;  2HCK A;  1U5S A;  1SHF A;  2CSI A;  2L0A A;  1OV3 A;  2HSP A;  1GCQ A;  2EW3 A;  2K6D A;  1WIE A;  2I0N A;  1M8M A;  4ZNX A;  1YP5 A;  4D8K A;  4AFU C;  2A36 A;  2F2V A;  2K79 A;  4LN2 A;  2CDT A;  1G83 A;  1M30 A;  4OMP A;  2CUB A;  1QWE A;  2DL3 A;  2C0O A;  3I5R A;  2D8H A;  1GFD A;  3O5Z A;  4Z89 A;  2CT4 A;  5L23 A;  1EFN A;  2RQU A;  2VVK A;  4AFZ C;  2D0N A;  1PRM C;  2FPF A;  2DL4 A;  1I07 A;  2NWM A;  5FWB A;  4OML A;  1X43 A;  4RTY A;  1NG2 A;  2KGT A;  1TUD A;  3EGU A;  1M3B A;  2VKN A;  4FSS A;  1WXT A;  3R6N A;  1WDX A;  1SRL A;  2DVJ A;  4Z8A A;  1GBQ A;  1UFF A;  3IQL A;  2M51 A;  1GL5 A;  1B3Q A;  2CUD A;  1OOT A;  1YCS B;  1UUE A;  1Z9Z A;  3SEM A;  2SEM A;  2DMO A;  5GJW B;  1KJW A;  2BTT A;  4RTV A;  2KXD A;  2K7A A;  4Z88 A;  1X27 A;  3M0T A;  4J9D A;  2DYB A;  4F17 A;  1BU1 A;  2X3X D;  4RTX A;  1ZLM A;  2DF6 A;  2EGE A;  2RQW A;  3PE0 A;  5GJV B;  1I0C A;  1YWP A;  1K76 A;  1YNZ A;  2FPE A;  1H92 A;  2OI3 A;  1WYX A;  3EHR A;  1JEG A;  1JXO A;  2O9V A;  3SHW A;  3VRY A;  2W0Z A;  1MV3 A;  1VYT A;  3M0Q A;  1VYU A;  1CSK A;  1X69 A;  2DRK A;  1HD3 A;  2BZY A;  5IHK A;  3REB B;  2YUP A;  1WXB A;  4J9H A;  1Z9Q A;  3VS6 A;  1M3C A;  3VS2 A;  4WCI A;  1SPK A;  1AZE A;  2FRW A;  1X2Q A;  5IXF A;  1X2K A;  4AG1 C;  3RBB B;  3UA7 A;  4CC3 A;  5IHN A;  1ZUU A;  2KXC A;  3UAT A;  4IIO A;  3VS3 A;  2KR3 A;  4A63 B;  2EGA A;  2O88 A;  4HCK A;  1AWO A;  1U3O A;  3ZL7 C;  4M4Z A;  2KBT A;  1ZBJ A;  2LX7 A;  2ED0 A;  2GGR A;  2AK5 A;  2LP5 A;  1ABQ A;  2LNH B;  1PHT A;  2KNB B;  2LJ0 A;  4AFS C;  5FWC A;  1XOV A;  1K0S A;  5I11 A;  2EBP A;  1CKA A;  1UEC A;  5HCK A;  1HJD A;  2LQW A;  2DX1 A;  3VS5 A;  1BK2 A;  3VS4 A;  2RPN A;  5IH2 A;  2HDA A;  2EKH A;  3KFV A;  2YDL A;  2H8H A;  1ZUY A;  3VS7 A;  1FMK A;  4OMN A;  2KRM A;  1NEG A;  2DM1 A;  2A37 A;  1PRL C;  4OMM A;  2YSQ A;  1MUZ A;  1KSW A;  1AWX A;  1SSH A;  1GCP A;  2O31 A;  1QLY A;  4HXJ A;  3NMZ C;  3M0U A;  4RTT A;  2PNI A;  3PVL A;  2JM9 A;  1FYN A;  2EYY A;  5IHI A;  3QWY A;  1ZSG A;  4J9E A;  2RQT A;  1WA7 A;  3H0I A;  1CKB A;  1RI9 A;  2EYZ A;  4X1V A;  1TG0 A;  4HVU A;  1LCK A;  4RUG A;  1WLP B;  2DE0 X;  1UDL A;  2VWF A;  2C0I A;  2RQR A;  5I22 A;  2KE9 A;  4LNP A;  1NLO C;  2JTE A;  5FW9 A;  2LJ3 A;  2J6O A;  2ROL A;  1OPL A;  2J06 A;  1ZUK A;  3ULR B;  4K11 A;  1RLP C;  1E6H A;  4DEX A;  3M0P A;  2AZS A;  1Y57 A;  1HSQ A;  3NHN A;  3RNJ A;  1AZG B;  3H0H A;  2KT1 A;  4J9B A;  2EYX A;  1UHF A;  4HVW A;  2ABL A;  1H8K A;  4RTU A;  1PKT A;  2M0Y A;  3VRZ A;  1GRI A;  2LZ6 B;  3I9Q A;  1AVZ C;  4CC7 A;  2JMC A;  4OMO A;  2K3B A;  2ROT A;  5EC7 A;  4AG2 C;  1X6B A;  4QT7 A;  2K9G A;  4D8D A;  1ARK A;  1ZX6 A;  1UE9 A;  2ECZ A;  2V1Q A;  2L3P A;  1WI7 A;  1PWT A;  4CC4 B;  2RN8 A;  1PKS A;  2L3S A;  2CT3 A;  2DL7 A;  2OAW A;  2OJ2 A;  1JU5 C;  2BZ8 A;  1WXU A; 
#chains in the Genus database with same CATH topology
 2FEI A;  2IIM A;  2VAS A;  1O75 A;  4GLM A;  2CH4 A;  1YCY A;  3CCS Q;  2FPD A;  2XD0 A;  3CD6 A;  5D6Y A;  5ECA A;  4CC2 A;  1OX8 A;  2LQN A;  2C0T A;  3GLX A;  2PVD B;  1Q7Y R;  5GAO p;  1KC8 R;  4PL6 A;  2P4R A;  3HP9 A;  4IUU A;  2RK1 A;  1UGV A;  5KCH A;  2LQK A;  3CCE A;  3QYG B;  3PVQ A;  3WVD B;  3GPL A;  4LUD A;  3EG9 B;  4LE9 A;  3G7Z A;  4PJO F;  2D6F A;  5LJ5 d;  3JCM W;  2FZG B;  1PD1 A;  2JUF A;  5KYN A;  2MMP A;  5DLQ E;  3URG A;  3OYE A;  2LRQ A;  3QSU A;  4A4K A;  4J9G A;  2DBM A;  1RUW A;  2XKO C;  1QCO A;  3S3O A;  2IPO B;  2MK5 A;  2KRS A;  5LJ5 h;  3OYI A;  1RAI B;  1PSE A;  3EHQ A;  2XMF A;  1UJ0 A;  1NPR A;  1YJN T;  4J7F A;  2JW4 A;  4M7D E;  3NFC A;  3CEY A;  1M1K U;  2GCX A;  3QDF A;  2O9S A;  1WHG A;  2V8I A;  5KYU A;  1M2O A;  1M90 R;  2RD1 A;  4D6W A;  3UA6 A;  2LX9 A;  1UEB A;  1KC8 C;  3OSV A;  5GAM f;  3A8G B;  1W6X A;  2DD5 A;  2LT1 A;  4C0D C;  1VQ6 A;  1V29 B;  4X34 A;  3LH5 A;  2QTX A;  4E7Z A;  3I5S A;  1U1T A;  1WHH A;  4Y92 A;  2RMO A;  1FXX A;  2E70 A;  2V26 A;  2D9T A;  1N8R U;  1QCN A;  5IN1 A;  1AEY A;  4LXC A;  2DL8 A;  2DA9 A;  2RJD A;  1UHC A;  2B8A A;  1K0X A;  4M7D D;  2DRM A;  3CC2 A;  4PJL A;  4CRI A;  3A1P A;  2LJ1 A;  2E10 A;  5GAO l;  5M9O A;  3O8V A;  3C94 A;  1VA7 A;  4E7J A;  2IG0 A;  3UF4 A;  1YI2 T;  4E6R A;  2QTV A;  3V8L A;  4DA4 A;  3M0S A;  1HK9 A;  4A53 A;  1K73 R;  5C6S A;  2PTK A;  3JB9 J;  3TEE A;  2KVQ G;  3CCS T;  4JS5 A;  2HKQ B;  4OVA A;  4LDV A;  2QQB A;  1NYF A;  1BB9 A;  5A0L A;  1OEB A;  2GNC A;  2AZV A;  2DXC A;  5CQX A;  2W10 A;  2HL3 A;  3GF5 A;  2F1L A;  4BI8 B;  4HCZ A;  4DOW A;  2R5A A;  1H3H A;  2J7I A;  2NUP B;  3EFO A;  3NTK A;  5FRM A;  2K4Y A;  3SDZ A;  3OA6 A;  1NBE B;  1MV0 B;  4M7D G;  1UTI A;  3H6Z A;  4J5Y A;  3JCM f;  3ZFJ A;  2EYW A;  4IKF A;  2G3R A;  4J7I A;  2JXB A;  4XTU A;  4M7D B;  3DB4 A;  2RI3 A;  4EDU A;  1MMN A;  2QAS A;  2E5K A;  2XU8 A;  2YLC A;  1SHF A;  1OV3 A;  2XI9 A;  4EMK A;  2A7Y A;  2EW3 A;  2I0N A;  3MHX A;  1NJI U;  4D8K A;  1D09 B;  1NJI R;  1VQK Q;  2DD4 A;  1WHM A;  2JVV A;  2F2V A;  2QQR A;  1VOM A;  4C92 A;  1G83 A;  3J7A F;  2GF7 A;  2C0O A;  2EJG A;  2D8H A;  2QEX Q;  3CMA T;  5L23 A;  2NLU A;  1D0Y A;  2VVK A;  2DJZ A;  1W2B S;  2FPF A;  4PK4 A;  1D1B A;  1I07 A;  4M77 G;  2OAU A;  1C6V X;  2EQU A;  4RTY A;  1FWZ A;  1FX7 A;  5GAM d;  1VQ8 Q;  1WXT A;  1PM3 A;  1MND A;  4KGX B;  1SG5 A;  1YJ9 T;  2X35 A;  3IQL A;  3E9F A;  2KI7 A;  5LJ3 f;  1UUE A;  1Z9Z A;  2XK0 A;  3SEM A;  2OTL Q;  2DMO A;  3CC4 Q;  2VYT A;  4KGZ B;  2LDM A;  5GMK e;  5GAN g;  1X27 A;  2XDP A;  2OTJ A;  4J9D A;  2JJ9 A;  4QVD A;  2KSS A;  4WTO B;  3M58 A;  2LCC A;  1WZO A;  3JCM g;  2ZPI B;  1M1K R;  2EGE A;  3PE0 A;  3CCV T;  3JB9 D;  4JRK A;  2M0O A;  2F5T X;  3QUI A;  3JB9 H;  1K76 A;  1KQS P;  1K73 U;  2FPE A;  5A0G A;  4PLI A;  2EAY A;  5IT9 E;  1VQ4 T;  1HD3 A;  5EG2 A;  2YUP A;  1S72 A;  1YJW T;  5FRN A;  4C5E A;  3I55 Q;  4C0G A;  5J39 A;  1X2K A;  3PIP A;  3WVE B;  3UA7 A;  1LPL A;  1Y96 A;  2KR3 A;  4KT0 E;  3CPW A;  3CCE T;  2P84 A;  4A63 B;  4BE1 A;  4M4Z A;  2KBT A;  2LX7 A;  2KMT A;  2GGR A;  2AK5 A;  1PCX A;  2LP5 A;  1ABQ A;  2LNH B;  2KNB B;  2HNI A;  5FWC A;  4E7L A;  3GNF B;  1I8F A;  5HCK A;  3MO8 A;  1UGS B;  3SFM A;  3VS5 A;  2RPN A;  4DBH A;  2EKH A;  4QVZ A;  2YDL A;  1K9M U;  4XU0 A;  2KK4 A;  4OMN A;  3A8M B;  3M9Q A;  4J6Y A;  5GAN h;  4RKU E;  3H8Z A;  4BUG A;  3OYB A;  1QLY A;  5GMK i;  1QVF A;  3M59 A;  1XQH A;  3M0U A;  4XQ3 A;  1YJ9 Q;  3PVL A;  2XHC A;  5KYW B;  1KQS A;  3M56 A;  1YI2 A;  2EYY A;  1GXI E;  1ZSG A;  5GMK l;  1WJQ A;  3H0I A;  2I2L A;  4KH0 B;  4IUV A;  4PNO A;  4HA8 A;  4PFZ A;  4FYX B;  2XIC A;  2QK0 A;  2HMA A;  1LCK A;  1ZA1 B;  2EQK A;  4QQD A;  4PJO E;  2FHD A;  1TSF A;  3CCR A;  1OZ2 A;  1UDL A;  2C0I A;  3CCQ Q;  1QVF P;  2ZPF B;  4C92 F;  1KC8 U;  1XNI A;  2JTE A;  3ASK A;  3A5Z B;  2J6O A;  2VXE A;  1RAF B;  2ROL A;  3CMA A;  4F7U B;  2J06 A;  1RLP C;  4WF2 A;  1YHQ A;  4FW2 A;  3X24 B;  1RAE B;  3MET A;  3QG1 A;  2CP5 A;  2A3L A;  4F04 B;  5GAN d;  1AZG B;  3HFO A;  5GAN 4;  1JJ2 P;  2KT1 A;  2EYX A;  1UHF A;  1VQ8 T;  3CPW P;  1H8K A;  1D0X A;  2JNG A;  1PKT A;  4OF1 A;  1R77 A;  3I9Q A;  1AVZ C;  4PKC C;  1BKB A;  1ZSZ A;  1Q86 R;  1M8V A;  4OGE A;  3CCM Q;  2DTI A;  5KYY B;  1ZX6 A;  2DER A;  2AHJ B;  3CCL T;  2DL7 A;  1QMC A;  4C5G A;  2NYS A;  2WAC A;  2BZ8 A;  2A08 A;  3MCA B;  2EPD A;  3MP8 A;  1WPY A;  1JJ2 S;  4M7A B;  1G8X A;  4RG8 A;  4KH1 B;  2FG0 A;  4JRQ A;  2NUZ A;  3D7S B;  3DLL A;  3T9N A;  3MEW A;  1TOV A;  3PNW C;  3VS1 A;  3MEU A;  2LC4 A;  3KBG A;  1BI3 A;  1GFC A;  1YIT Q;  3MKD A;  3L2R A;  4RTZ A;  4R0K A;  3VJP A;  1NE8 A;  1NEB A;  4ELY C;  2KEA A;  4M77 F;  2DET A;  3THK A;  3AHU A;  3H0F A;  3M55 A;  1BBZ A;  3CCL A;  1VQL T;  4IIM A;  2EGC A;  4YTL A;  3TVT A;  5CKE A;  2ENM A;  4Y28 E;  3GNG A;  1S1N A;  5D6W A;  2RB6 A;  1V1C A;  5KYX A;  5GAO r;  2JOY A;  2YLB A;  3R6O A;  2FZK B;  2QEX A;  2CP6 A;  2K2V A;  3J80 E;  1Q82 R;  3SWN C;  2F69 A;  1AHJ B;  1JB0 E;  5KH6 A;  2ZGW A;  5CKH A;  1PG5 B;  2QDY B;  2LVM A;  1JXM A;  2FZC B;  2MIO A;  4PJN A;  1YJW Q;  4M77 C;  4KRT A;  1Y07 A;  2KY9 A;  3OB9 A;  3Q1J A;  4JJC A;  4DBF A;  3OS1 A;  1NM7 A;  4EIK A;  8ATC B;  2EVR A;  4MZP A;  2WSC E;  3OW2 P;  1OX9 A;  1N6A A;  2DJQ A;  1I1J A;  3BDU A;  3QKJ A;  3M53 A;  1R0B G;  4ZN3 A;  3SWN A;  1WX6 A;  2FVU A;  2QXF A;  2QDL A;  1NPP A;  3JCM d;  3PMI A;  3GOX A;  1M2V A;  3CME A;  3E9G A;  1U06 A;  1VYV A;  4OB3 B;  3CCV Q;  3M4Y A;  2FYK A;  5GMK m;  2YT6 A;  1VQ4 Q;  4LUE A;  3INZ A;  1WHK A;  1X75 C;  5C0M A;  4BE2 A;  2CP7 A;  4HCC A;  4M7A E;  4FYW B;  3FJ5 A;  3NGP A;  3CCU T;  4FIB A;  2CH4 W;  1M4Z A;  1N9S A;  2KQW A;  2QQ9 A;  3JCM X;  2O4X A;  5CQY A;  1KG1 A;  2BZX A;  5GAM g;  3LH0 A;  2DK3 A;  3EGD B;  3MJX A;  3BFM A;  2COY A;  3SB2 A;  5GAO m;  4KUL A;  2GTO A;  9ATC B;  1K1Z A;  3QXE B;  4M7D C;  3L42 A;  1KIK A;  3V8J A;  1IB8 A;  2CRE A;  2YUN A;  1NLP C;  3C4S A;  4EPC A;  3QII A;  1M27 C;  3X20 B;  4E7S A;  3OYL A;  4JJB A;  4M7A C;  3KUF A;  3G6E Q;  4M78 B;  2DLP A;  3CPW S;  4QVC A;  4XAX B;  2K2M A;  3JRZ A;  1SRM A;  3S6W A;  2M16 A;  4JS4 A;  2D8J A;  1G3W A;  1E7O A;  3MEV A;  3OMC A;  1OPK A;  5KYU B;  3CCQ A;  2HQH A;  1R8O B;  3OW2 A;  3CQT A;  1HYO A;  4BDZ A;  3LWH A;  1N5Z A;  2RF0 A;  2HCK A;  2QA4 Q;  1N8R R;  2V8J A;  1YHQ Q;  2COW A;  2AT1 B;  2MF2 A;  4N0A C;  2K6D A;  3EGX B;  3PT9 A;  4LDX A;  1LVK A;  1K8A C;  4M77 D;  2RJF A;  2A36 A;  3CCR Q;  2K79 A;  3JAM E;  3FC3 A;  4QQ6 A;  5DY9 A;  4OB1 B;  3ZBD A;  3I5R A;  3OYF A;  1EX4 A;  4M75 F;  3F70 A;  3O5Z A;  4B6M A;  2CT4 A;  4DQ2 A;  4OB2 B;  2VGN A;  1JRI A;  5FWB A;  1X43 A;  1NG2 A;  2CZ1 B;  1M3B A;  1BYM A;  1YHQ T;  4BE0 A;  2H3J A;  1WDX A;  1SRL A;  4C92 C;  2M51 A;  1GL5 A;  2CUD A;  5GAN f;  1OOT A;  2H3E B;  1OU8 A;  5D7U A;  2SEM A;  4N4H A;  5GJW B;  3A8L B;  5I2M A;  1Q81 U;  4A4H A;  3SWN B;  2DYB A;  4C0F A;  3VV0 A;  1BU1 A;  4UC4 A;  1MMG A;  1V76 A;  2PUO B;  1M2V B;  2DF6 A;  2RM4 A;  5GJV B;  1P92 A;  1MGQ A;  5AYF A;  1XTD A;  1I0C A;  1EIF A;  4ZGJ B;  2DEU A;  4FT2 A;  1B7T A;  2VV5 A;  1VQL Q;  4E7H A;  1JXO A;  2QGF B;  3CBP A;  2QEX T;  1VQ7 Q;  3VRY A;  3BE3 A;  1IGU A;  1Q7Y U;  1F1B B;  1CSK A;  4LDU A;  5IHK A;  3REB B;  3VS6 A;  4HT9 A;  2IVW A;  2X9H A;  1SPK A;  4M75 A;  4AG1 C;  4BY6 C;  2P0P A;  2KXC A;  2L3R A;  3QDR B;  2E5Q A;  4A54 A;  4FT4 A;  2O88 A;  1VQO T;  1AT1 B;  1U3O A;  4BI3 A;  3OS5 A;  2L89 A;  3CD6 T;  4PJM A;  2NUT A;  3RKX A;  3QYH B;  1WHJ A;  1PHT A;  3EFS A;  4AFS C;  2RA2 A;  4XTX A;  2HL5 C;  3LGL A;  1XOV A;  3CC7 T;  2EBP A;  3VKI A;  1HJD A;  4PJO C;  2BE9 B;  4Z02 A;  3CCV A;  5GAN 7;  2DX1 A;  5GAN j;  2HDA A;  3CCS A;  1ACM B;  3OYH A;  2H8H A;  5CO7 A;  3VS7 A;  2DM1 A;  1OYX A;  2HQE A;  1KD1 R;  3FRN A;  2R5M A;  4M78 G;  5GAM h;  2O31 A;  2PNI A;  1ZA2 B;  5I21 A;  1VQM A;  1VQ7 T;  2HD0 A;  4X1V A;  2EYZ A;  3OBY A;  4N4I A;  1I5L A;  1TG0 A;  3G71 T;  1M1K C;  4HVU A;  5AT1 B;  2QQA A;  4C5I A;  4RUG A;  3RR6 A;  5LL6 S;  4GLK A;  1TU0 B;  1KHI A;  1C0M A;  1Q7Y C;  2LJ3 A;  2X4Y A;  1ZBX A;  1WHL A;  5A0D A;  4C92 E;  1VQ5 T;  2AZS A;  1Y57 A;  2GQV A;  1HSQ A;  1VQ5 Q;  4MZM A;  3NTI A;  2DXU A;  5CAI A;  4IUQ A;  4J9B A;  1ZHI A;  3OYM A;  4JUV A;  4ANJ A;  3OMG A;  1BI1 A;  3M54 A;  3WXM B;  3PFS A;  2M0Y A;  3VRZ A;  3EG9 A;  2LZ6 B;  3CC2 Q;  2DFU A;  5FU7 C;  4LD6 A;  2QA4 A;  3JB9 I;  3G6E A;  4X9D A;  2K3B A;  2CZ0 B;  2ROT A;  4AG2 C;  1X6B A;  4XTV A;  3CBM A;  1ARK A;  4RMO A;  3A8O B;  2ECZ A;  4CC4 B;  2QGG A;  5GAO q;  3JB9 G;  2L3S A;  2OJ2 A;  4A4F A;  3G1J A;  2LQ8 A;  1RAG B;  1WXU A;  2RH2 A;  2JMA A;  1SEM A;  5LJ5 j;  3HPW A;  1KFZ A;  2KRO A;  1VQ9 T;  4E7K A;  3OS2 A;  3M0R A;  1XJW B;  4FM4 B;  4JLI A;  4M75 D;  3G71 Q;  4ZTF A;  1SHG A;  4J9I A;  2EQJ A;  2MOX A;  1RAH B;  2YHT A;  5GMK j;  2PU9 B;  2COZ A;  5IXB A;  1VQ9 A;  5HK3 A;  4EMK B;  3C0C A;  1QVG P;  2EWN A;  5KYW A;  2E3I A;  3CCU A;  3RER A;  1WNL A;  4PLL A;  1UGR B;  2MI6 A;  4M77 E;  1K8A U;  2GQI A;  1W70 A;  2CS7 A;  2EIF A;  2RQV A;  2EJ9 A;  4E2F B;  1GCQ C;  3REA B;  2JS2 A;  4ATO A;  3V7S A;  2V1R A;  4RTW A;  3P8H A;  1QKX A;  2ESW A;  1WFW A;  4FYY B;  4MML A;  1QVG A;  2LCS A;  1VQN Q;  4ESR A;  2VC8 A;  4HCB A;  4F7U A;  1N9R A;  1H3Z A;  4QW2 A;  2DZC A;  1D3B B;  3BW1 A;  1JQQ A;  2GBQ A;  3PGG A;  2JT4 A;  1JO8 A;  1UJY A;  2B86 A;  3EG2 A;  3JCM b;  1K4U S;  2DIQ A;  1YIJ A;  1RL2 A;  6AT1 B;  4VUB A;  1IHV A;  2M9U A;  1G2B A;  2JTF A;  5FRO A;  2BKD N;  2YUQ A;  4OMF B;  5A2Q E;  2WSF E;  2CP0 A;  2QQS A;  3OW2 S;  5J3B A;  3MPU B;  2AKK A;  2YUO A;  3EGD A;  4HVV A;  1VQP Q;  1G3Y A;  3CCL Q;  4BI4 A;  1S72 T;  2OX7 A;  1RI0 A;  1QKW A;  1YWO A;  1AOJ A;  2KRN A;  1VQM T;  4PJO A;  1W2B A;  2L3Q A;  3JCM J;  1VQL A;  1AWW A;  4IUP A;  2J6F A;  3HHT B;  2FRY A;  2DKG A;  2K57 A;  2KT8 A;  3G4S A;  2HSE B;  3M57 A;  3VS0 A;  2CSQ A;  4M7A D;  4J9C A;  4F7U G;  4M78 A;  3FDR A;  1VQ6 T;  3RKW A;  2DL5 A;  2J05 A;  3I56 Q;  1RLQ C;  3CCE Q;  3P8B B;  4OMQ A;  1VIE A;  4OP0 A;  1Y96 B;  3EG3 A;  1X6G A;  3V8K A;  3HFN A;  3JCM c;  2CZ6 B;  1PC0 A;  1VQK A;  1B34 B;  4R56 A;  2LCL A;  2L2P A;  2MAM A;  1UGQ B;  4JRI A;  5GAO n;  3TU4 K;  1TXQ A;  2FO0 A;  3OYG A;  2LT4 A;  3LLR A;  2D1X A;  3I56 T;  1IGQ A;  1TUG B;  3ER0 A;  3H41 A;  3OYC A;  3CXC P;  4XU2 A;  1VQO A;  3FEO A;  3UT1 A;  5CR2 A;  4J8O A;  4DOV A;  4V2S A;  1B07 A;  3VU3 C;  2DAQ A;  3VUZ A;  1WQ7 A;  5HK0 A;  3HRS A;  2XDB A;  1MMA A;  2A0F B;  3MP1 A;  2ED1 A;  2JS0 A;  1M3A A;  1YN8 A;  4M75 G;  2GTJ A;  3TSZ A;  5KYX B;  2A28 A;  1M5Q 1;  2SRC A;  4ZGD B;  3GBQ A;  3E1S A;  3TQ7 P;  1I81 A;  2BUD A;  5CKB A;  2PZ1 A;  3NPF A;  4DEY A;  1JBM A;  3L2Q A;  3OYK A;  1U5S A;  1TH7 A;  2L0A A;  4ME7 A;  3RES A;  5FU6 B;  1UGP B;  4C8Q D;  4C92 G;  4EMK C;  5GAM j;  3MEA A;  1GCQ A;  2PUK B;  3JSC A;  1VQ5 A;  1DJ7 B;  2GFU A;  1WIE A;  1M8M A;  1IXD A;  4ZNX A;  5LJ3 j;  4AFU C;  3JCM P;  2ZPE B;  2RHY A;  4OMP A;  2M02 A;  4Q5W A;  2CZ7 B;  2YRC A;  2DPP B;  1GFD A;  1QVF S;  4MDW A;  4Z89 A;  2FL7 A;  1D3B A;  1EFN A;  2RQU A;  1WQW A;  4L59 A;  2DEQ A;  3LW5 E;  3I55 A;  1VQN T;  3TCJ A;  2EYQ A;  2EFI A;  1IZ6 A;  4J83 A;  3RMS A;  5LJ5 f;  2KGT A;  1TUD A;  3EGU A;  2L5Q A;  3HRT A;  4FSS A;  1SSF A;  4RG2 A;  1UFF A;  1X01 A;  1B3Q A;  4JJN K;  1KJW A;  4RTV A;  2KXD A;  3GP8 A;  3M0T A;  3CMA Q;  2ZCF B;  4C8Q B;  3V7C A;  4C8Q G;  4F17 A;  3VYH B;  4M78 F;  2X3X D;  1WGS A;  4C8Q E;  4RTX A;  2ZPH B;  3CXC A;  2RQW A;  4M7A A;  4C5H A;  1YWP A;  2DXB A;  5KE2 A;  2NUT B;  1SF9 A;  4Y91 A;  1YNZ A;  2OI3 A;  1WYX A;  3QZ9 B;  2HQX A;  2RJC A;  3BDL A;  3S3N A;  4M7A G;  2OTJ T;  3M0Q A;  1VYU A;  4L5G A;  1U1S A;  2BZY A;  1WXB A;  3CCR T;  1Z9Q A;  1M3C A;  2M1H A;  3VS2 A;  4WCI A;  2JZ2 A;  2LNV A;  3CC2 T;  4NS5 A;  4BDY A;  1JJ2 A;  3RBB B;  4ZN1 A;  5KCO A;  4CC3 A;  5CKF A;  3VS3 A;  1EZZ B;  3CME Q;  1BIA A;  3C95 A;  1YIJ Q;  3ZL7 C;  1ZBJ A;  3CBO A;  2HZY A;  1HXD A;  4M77 A;  4QKU A;  2Y4Y A;  3EGX A;  3LYI A;  1Q95 G;  4AT1 B;  1VIF A;  3P8D A;  1UEC A;  1D1C A;  4O6J A;  1VQP A;  4OB0 B;  4BB7 A;  4C92 D;  2DTO A;  2NUP A;  1BK2 A;  3KFV A;  2MWO A;  1K73 C;  1QVP A;  1ZUY A;  1FMK A;  1BCO A;  3RMQ A;  2OTL A;  4M7A F;  3X28 B;  1VQ8 A;  3E19 A;  1IRX A;  4BY6 B;  2A37 A;  5L8R E;  2OTJ Q;  4OMM A;  2E6N A;  3DB3 A;  4C8Q F;  1KSW A;  1AWX A;  1SSH A;  1GCP A;  2OTL T;  3JCM e;  3NMZ C;  3OSS C;  3JCM V;  1RAB B;  3RIR A;  4RTT A;  5CK9 A;  2F5K A;  4A4G A;  3OY9 A;  2DXT A;  1M9S A;  3CXC S;  1FYN A;  4MDX A;  5IHI A;  2X4X A;  2L8D A;  3PIO A;  4J9E A;  1WA7 A;  5KYY A;  1K8A R;  1CKB A;  4ZGE B;  5HKC A;  2RO0 A;  3L2U A;  3FJP A;  2DE0 X;  2VWF A;  2RQR A;  5I22 A;  1NLO C;  5FW9 A;  1TTH B;  2CGH A;  4B9X A;  2QA4 T;  1Y71 A;  1OPL A;  2DZ9 A;  1ZUK A;  3MP6 A;  3ULR B;  3ZEH A;  1YIT A;  3LX7 A;  1E6H A;  4DEX A;  3M0P A;  1YBY A;  4N4G A;  4M7D A;  3CD6 Q;  3H0H A;  2QG9 B;  2YXY A;  1RAD B;  2ZAE A;  2JN0 A;  2R58 A;  3QBY A;  1GRI A;  5LJ5 g;  2Y90 A;  3CCQ T;  3OYJ A;  2VXF A;  4QT7 A;  2K9G A;  4D8D A;  2XG8 D;  1I4K 1;  5FLX E;  2V1Q A;  1WI7 A;  2RN8 A;  2RHZ A;  3J81 E;  3FIF A;  3DKM A;  4HCK A;  4CI0 C;  5LJ5 e;  1VQ4 A;  4FL6 A;  4A4E A;  2D0Q B;  3JCM h;  4AFQ C;  3U23 A;  1G3T A;  2JM8 A;  1YJW A;  2MWP A;  4M75 E;  2AKL A;  2K3Y A;  4XU3 A;  2R57 A;  2CKK A;  2RI5 A;  3EH1 A;  5KE3 A;  1O9S A;  2RNA A;  4FYV B;  4ORZ A;  1M1G A;  1NZ9 A;  2BE7 D;  2K5L A;  3L1A A;  2VUB A;  1H64 1;  1G5V A;  4GBQ A;  1PNJ A;  2HAX A;  3L2V A;  4JLG A;  1T3L A;  4KUD K;  2C06 A;  5LJ3 e;  1YI2 Q;  1NYG A;  1X6O A;  1Q82 C;  4PJJ A;  4C0Z A;  3OYA A;  2YRD A;  1OUL A;  3AT1 B;  2KYM A;  2RJE A;  2F2W A;  4JZ4 A;  2HEQ A;  5LJ3 g;  4II1 A;  2KYB A;  2JTM A;  1Q81 C;  1I5O B;  4N0A A;  2J6K A;  1IO6 A;  2EKO A;  4JRP A;  1WJS A;  3EFO B;  1BIB A;  1J3T A;  1BI0 A;  2RHX A;  1M1F A;  4F16 A;  2O4X B;  2DBK A;  1IHW A;  4LDW A;  1T0J A;  4FSX A;  4NL2 A;  5IAY A;  5LJ3 h;  2EQI A;  3I55 T;  1W4S A;  1TS9 A;  2G6F X;  4JJD A;  1K9A A;  3SD4 A;  1YIJ T;  3FB9 A;  4EMG A;  1FMW A;  2FB7 A;  3PTA A;  4LD9 K;  1TUC A;  3HTR A;  2LTO A;  4C92 B;  2DNU A;  2X4J A;  3RKY A;  2O2O A;  1VQN A;  4HT8 A;  4R55 A;  2HBP A;  2E64 A;  4E7I A;  1D1A A;  2F2X A;  2LMJ A;  4F14 A;  4M78 D;  5CKD A;  2GFA A;  3QZ5 B;  1OZ3 A;  5CIU A;  1T3S A;  1K9M R;  1W2B P;  3KXT A;  4FU6 A;  1W1F A;  3EH2 A;  3H9N A;  5CVI A;  2HBW A;  1A0N B;  3QJ6 A;  4FCY A;  3GIB A;  4RCB A;  3I35 A;  1OQK A;  4RCC A;  5GMK h;  1ABO A;  3JV3 A;  4JZ3 A;  1YIT T;  4M75 B;  3L2Z A;  2P0K A;  1T0H A;  3EAE A;  4QQG A;  1C1A A;  1VQP T;  3N5B B;  5J26 A;  3QWX X;  2Z0W A;  1AWJ A;  1QCF A;  3EG1 A;  1GBR A;  2EQM A;  2MCN A;  2DIL A;  2VB6 A;  5GAN 5;  3CCJ Q;  2DO3 A;  4JPB W;  1QWF A;  5DM7 R;  2CYZ B;  2P4T A;  1MHN A;  1G3S A;  3PMT A;  4J9F A;  3JCM Q;  4JDS A;  4PFP A;  1WJR A;  3S3M A;  3CCU Q;  1UG1 A;  3G6E T;  2E4H A;  5GAN 8;  3RUX A;  5DLO A;  1YJN A;  3NTH A;  1E6G A;  4MMK A;  1AD5 A;  5GAN 3;  4XU1 A;  3G71 A;  2K3X A;  3EG0 A;  3A98 A;  1Y0M A;  3OS0 A;  1BI2 A;  2X3W D;  4C0D B;  3CCJ T;  3X26 B;  2E1H A;  2YWW A;  3TSW A;  1VQ9 Q;  2ATC B;  1Q86 U;  4XK8 E;  1D0Z A;  2QYZ A;  2CSI A;  5GAM e;  2Y4X A;  4O5V A;  2HSP A;  4P5N A;  3QPH A;  4L6V 5;  2BIV A;  4KBM B;  3BY7 A;  2X4W A;  1M90 U;  1YP5 A;  1FMV A;  4HKE A;  4LN2 A;  2CDT A;  5GAN 2;  4C8Q C;  1RAC B;  1M30 A;  2PQW A;  2CUB A;  4ZTJ A;  1QWE A;  4C8Q A;  2DL3 A;  3HSB A;  8AT1 B;  1QQJ A;  4NOY A;  4DBR A;  5FU7 B;  4AFZ C;  1KQS S;  2D0N A;  4M78 C;  1KD1 C;  1LNX A;  1PRM C;  2DL4 A;  2NWM A;  4OML A;  3EFR A;  1VUB A;  4F7U F;  2RHU A;  3CME T;  1R0C B;  2VKN A;  3E2U A;  2K5F A;  3R6N A;  2DVJ A;  4Z8A A;  1GBQ A;  4KUI A;  4X9C A;  1KQ1 A;  1YCS B;  4M78 E;  4PJO D;  3CC4 T;  2BTT A;  2E6Z A;  2DVE A;  2K7A A;  4Z88 A;  1UB4 A;  2ZZD A;  3OYD A;  1Q86 C;  3CC7 A;  3A8H B;  2MYS A;  3HKS A;  1ZLM A;  3HL8 A;  1YFN A;  4EMH A;  3OYN A;  4LDY A;  3QHS A;  1H92 A;  4M77 B;  1KHC A;  3EHR A;  1VQM Q;  1JEG A;  3JB9 F;  2O9V A;  3RDV A;  3SHW A;  3G4S Q;  1MMD A;  4B9W A;  5GAN 6;  4OGC A;  2W0Z A;  1MV3 A;  2CP2 A;  1VYT A;  4PFO A;  4GY5 A;  5FU6 C;  4M7D F;  2XID A;  3M5A A;  1X69 A;  2DRK A;  1QP3 A;  2DIG A;  2K5I A;  2P0Q A;  4J9H A;  2ZPB B;  1VQ6 Q;  2YRV A;  2HKN A;  2QI2 A;  1AZE A;  4M75 C;  2FRW A;  2O01 E;  1X2Q A;  1IRE B;  1RAA B;  2E41 A;  5IXF A;  2E12 A;  4J6W A;  5D6X A;  1N27 A;  5IHN A;  1ZUU A;  7AT1 B;  3UAT A;  4IIO A;  3UWN A;  2EGA A;  1AWO A;  2DTH A;  4IUT A;  4PJO B;  3OBW A;  2E3H A;  2ED0 A;  2VGM A;  1Q81 R;  2LJ0 A;  1VQO Q;  1S72 Q;  2ZPG B;  1PSF A;  3CC7 Q;  1ZSZ B;  1BCM A;  1K0S A;  4F7U E;  5I11 A;  1CKA A;  3VUB A;  3I56 A;  2LQW A;  4XTY A;  2RHI A;  4DBQ A;  3CCM T;  2MPX C;  3VS4 A;  5IH2 A;  1SKU B;  4NL3 A;  1TWB A;  2WSE E;  1LOJ A;  3UPU A;  4J6X A;  2KRM A;  1NEG A;  4IUR A;  1VQ7 A;  2RK2 A;  1Q82 U;  1PRL C;  2QAZ A;  3G4S T;  2XDD A;  2YSQ A;  2X51 A;  1MUZ A;  1B34 A;  3C12 A;  3FLG A;  3QO3 A;  3HRU A;  1MNE A;  3QJY A;  4HXJ A;  1M90 C;  1QP2 A;  2JM9 A;  4BAC A;  1K9M C;  3QWY A;  5I2S A;  1NJI C;  2RI2 A;  2RQT A;  1KK7 A;  2PVG B;  2DYI A;  1RI9 A;  2CP3 A;  1LJO A;  4E47 A;  2E65 A;  1VQK T;  3CPF A;  1KQ2 A;  1WLP B;  5CCA A;  1N8R C;  3M4G A;  3CCM A;  1KD1 U;  2KDS A;  4AMC A;  3LGF A;  1ZSZ C;  2KE9 A;  1QVG S;  1OU9 A;  4LNP A;  3ME9 A;  2KAF A;  1YJ9 A;  4K11 A;  4KGV B;  3CCJ A;  2EJF A;  3TRE A;  1Y7X A;  3OQ5 A;  5GAN e;  3NHN A;  3RNJ A;  5LJ3 d;  4FW1 A;  3UDC A;  1QW1 A;  4ELZ C;  4PJO G;  4HVW A;  4XTZ A;  2PVO B;  2ABL A;  3VYG A;  3L2W A;  4RTU A;  4MZT A;  3DLM A;  2AIR B;  4BD3 A;  1PD0 A;  4CC7 A;  1U8R A;  2JMC A;  2V8K A;  5HY6 A;  4OMO A;  3V7R A;  3LWI A;  5EC7 A;  3CC4 A;  1YJN Q;  4XTW A;  1UE9 A;  1ZQ1 A;  2L3P A;  1PWT A;  1PKS A;  3OYY A;  4TVR A;  2CT3 A;  2OAW A;  3X25 B;  1OI1 A;  1JU5 C; 
#chains in the Genus database with same CATH homology
 2A08 A;  2FEI A;  2IIM A;  2JMA A;  1SEM A;  2EPD A;  4GLM A;  4AFQ C;  1KFZ A;  3U23 A;  2CH4 A;  2KRO A;  2JM8 A;  2FG0 A;  3M0R A;  2NUZ A;  2FPD A;  5ECA A;  4CC2 A;  2AKL A;  2LQN A;  2C0T A;  1SHG A;  4J9I A;  2MOX A;  5IXB A;  2P4R A;  2RNA A;  3VS1 A;  4ORZ A;  3C0C A;  1UGV A;  1GFC A;  4GBQ A;  1PNJ A;  1T3L A;  1W70 A;  2GQI A;  4RTZ A;  3PVQ A;  2RQV A;  4LUD A;  4R0K A;  4LE9 A;  1NYG A;  1GCQ C;  1NEB A;  2KEA A;  3REA B;  2JS2 A;  3THK A;  2V1R A;  4RTW A;  1QKX A;  3H0F A;  1BBZ A;  2ESW A;  1WFW A;  4IIM A;  2EGC A;  4J9G A;  2KYM A;  3TVT A;  2DBM A;  1RUW A;  2ENM A;  1S1N A;  2F2W A;  2LCS A;  4ESR A;  1V1C A;  4JZ4 A;  2HEQ A;  2KYB A;  2J6K A;  1IO6 A;  1JQQ A;  2GBQ A;  2KRS A;  2JT4 A;  1JO8 A;  1UJY A;  2B86 A;  3EG2 A;  1K4U S;  1J3T A;  3EHQ A;  1JXM A;  2XMF A;  4F16 A;  1UJ0 A;  2DBK A;  1T0J A;  2JW4 A;  2MIO A;  2EQI A;  1G2B A;  2G6F X;  4JJD A;  2O9S A;  2YUQ A;  1K9A A;  4KRT A;  4JJC A;  3UA6 A;  1NM7 A;  4EIK A;  2AKK A;  2EVR A;  2YUO A;  4HVV A;  1TUC A;  2DJQ A;  2DNU A;  1I1J A;  1QKW A;  2O2O A;  1W6X A;  1YWO A;  1AOJ A;  2KRN A;  1WX6 A;  2L3Q A;  2QDL A;  2F2X A;  2LMJ A;  4F14 A;  1AWW A;  3LH5 A;  1U06 A;  1VYV A;  3I5S A;  4Y92 A;  2RMO A;  1T3S A;  2YT6 A;  4LUE A;  1W1F A;  2J6F A;  2HBW A;  1A0N B;  2FRY A;  1AEY A;  2DL8 A;  2KT8 A;  3I35 A;  3VS0 A;  2CSQ A;  4J9C A;  2DA9 A;  3FJ5 A;  1ABO A;  3JV3 A;  1UHC A;  3NGP A;  4JZ3 A;  2CH4 W;  1K0X A;  2DRM A;  2DL5 A;  2LJ1 A;  1T0H A;  2J05 A;  1RLQ C;  2BZX A;  4OMQ A;  1VA7 A;  3EG3 A;  3QWX X;  3UF4 A;  1X6G A;  4E6R A;  1AWJ A;  1QCF A;  3M0S A;  3EG1 A;  1GBR A;  2MCN A;  2GTO A;  2DIL A;  2PTK A;  1K1Z A;  4JPB W;  1QWF A;  1KIK A;  2L2P A;  1NYF A;  2FO0 A;  2CRE A;  1BB9 A;  4J9F A;  2YUN A;  1NLP C;  1OEB A;  2GNC A;  2AZV A;  2W10 A;  2D1X A;  3H41 A;  1H3H A;  1M27 C;  2J7I A;  4JJB A;  1UG1 A;  1B07 A;  2DLP A;  2K2M A;  1MV0 B;  1SRM A;  2ED1 A;  1UTI A;  1E6G A;  2JS0 A;  1M3A A;  1YN8 A;  2D8J A;  1AD5 A;  2GTJ A;  3TSZ A;  1E7O A;  2A28 A;  2SRC A;  1OPK A;  3EG0 A;  2EYW A;  3A98 A;  3GBQ A;  1Y0M A;  2JXB A;  2X3W D;  2PZ1 A;  3CQT A;  3TSW A;  3NPF A;  1N5Z A;  2RF0 A;  4DEY A;  2E5K A;  2HCK A;  1U5S A;  1SHF A;  2CSI A;  2L0A A;  1OV3 A;  2HSP A;  1GCQ A;  2EW3 A;  2K6D A;  1WIE A;  2I0N A;  1M8M A;  4ZNX A;  1YP5 A;  4D8K A;  4AFU C;  2A36 A;  2F2V A;  2K79 A;  4LN2 A;  2CDT A;  1G83 A;  1M30 A;  4OMP A;  2CUB A;  1QWE A;  2DL3 A;  2C0O A;  3I5R A;  2D8H A;  1GFD A;  3O5Z A;  4Z89 A;  2CT4 A;  5L23 A;  1EFN A;  2RQU A;  2VVK A;  4AFZ C;  2D0N A;  1PRM C;  2FPF A;  2DL4 A;  1I07 A;  2NWM A;  5FWB A;  4OML A;  1X43 A;  4RTY A;  1NG2 A;  2KGT A;  1TUD A;  3EGU A;  1M3B A;  2VKN A;  4FSS A;  1WXT A;  3R6N A;  1WDX A;  1SRL A;  2DVJ A;  4Z8A A;  1GBQ A;  1UFF A;  3IQL A;  2M51 A;  1GL5 A;  1B3Q A;  2CUD A;  1OOT A;  1YCS B;  1UUE A;  1Z9Z A;  3SEM A;  2SEM A;  2DMO A;  5GJW B;  1KJW A;  2BTT A;  4RTV A;  2KXD A;  2K7A A;  4Z88 A;  1X27 A;  3M0T A;  4J9D A;  2DYB A;  4F17 A;  1BU1 A;  2X3X D;  4RTX A;  1ZLM A;  2DF6 A;  2EGE A;  2RQW A;  3PE0 A;  5GJV B;  1I0C A;  1YWP A;  1K76 A;  1YNZ A;  2FPE A;  1H92 A;  2OI3 A;  1WYX A;  3EHR A;  1JEG A;  1JXO A;  2O9V A;  3SHW A;  3VRY A;  2W0Z A;  1MV3 A;  1VYT A;  3M0Q A;  1VYU A;  1CSK A;  1X69 A;  2DRK A;  1HD3 A;  2BZY A;  5IHK A;  3REB B;  2YUP A;  1WXB A;  4J9H A;  1Z9Q A;  3VS6 A;  1M3C A;  3VS2 A;  4WCI A;  1SPK A;  1AZE A;  2FRW A;  1X2Q A;  5IXF A;  1X2K A;  4AG1 C;  3RBB B;  3UA7 A;  4CC3 A;  5IHN A;  1ZUU A;  2KXC A;  3UAT A;  4IIO A;  3VS3 A;  2KR3 A;  4A63 B;  2EGA A;  2O88 A;  4HCK A;  1AWO A;  1U3O A;  3ZL7 C;  4M4Z A;  2KBT A;  1ZBJ A;  2LX7 A;  2ED0 A;  2GGR A;  2AK5 A;  2LP5 A;  1ABQ A;  2LNH B;  1PHT A;  2KNB B;  2LJ0 A;  4AFS C;  5FWC A;  1XOV A;  1K0S A;  5I11 A;  2EBP A;  1CKA A;  1UEC A;  5HCK A;  1HJD A;  2LQW A;  2DX1 A;  3VS5 A;  1BK2 A;  3VS4 A;  2RPN A;  5IH2 A;  2HDA A;  2EKH A;  3KFV A;  2YDL A;  2H8H A;  1ZUY A;  3VS7 A;  1FMK A;  4OMN A;  2KRM A;  1NEG A;  2DM1 A;  2A37 A;  1PRL C;  4OMM A;  2YSQ A;  1MUZ A;  1KSW A;  1AWX A;  1SSH A;  1GCP A;  2O31 A;  1QLY A;  4HXJ A;  3NMZ C;  3M0U A;  4RTT A;  2PNI A;  3PVL A;  2JM9 A;  1FYN A;  2EYY A;  5IHI A;  3QWY A;  1ZSG A;  4J9E A;  2RQT A;  1WA7 A;  3H0I A;  1CKB A;  1RI9 A;  2EYZ A;  4X1V A;  1TG0 A;  4HVU A;  1LCK A;  4RUG A;  1WLP B;  2DE0 X;  1UDL A;  2VWF A;  2C0I A;  2RQR A;  5I22 A;  2KE9 A;  4LNP A;  1NLO C;  2JTE A;  5FW9 A;  2LJ3 A;  2J6O A;  2ROL A;  1OPL A;  2J06 A;  1ZUK A;  3ULR B;  4K11 A;  1RLP C;  1E6H A;  4DEX A;  3M0P A;  2AZS A;  1Y57 A;  1HSQ A;  3NHN A;  3RNJ A;  1AZG B;  3H0H A;  2KT1 A;  4J9B A;  2EYX A;  1UHF A;  4HVW A;  2ABL A;  1H8K A;  4RTU A;  1PKT A;  2M0Y A;  3VRZ A;  1GRI A;  2LZ6 B;  3I9Q A;  1AVZ C;  4CC7 A;  2JMC A;  4OMO A;  2K3B A;  2ROT A;  5EC7 A;  4AG2 C;  1X6B A;  4QT7 A;  2K9G A;  4D8D A;  1ARK A;  1ZX6 A;  1UE9 A;  2ECZ A;  2V1Q A;  2L3P A;  1WI7 A;  1PWT A;  4CC4 B;  2RN8 A;  1PKS A;  2L3S A;  2CT3 A;  2DL7 A;  2OAW A;  2OJ2 A;  1JU5 C;  2BZ8 A;  1WXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...