4GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
molecule keywords GRB2
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4gbqA00
1YNZA 4JPBW 4OMMA 1MV3A 1J3TA 3UA7A 1WI7A 1AD5A 1WDXA 2GGRA 2GQIA 4EIKA 2KRMA 1JXOA 2O9SA 4LE9A 4OMQA 1AZEA 1UECA 2D8HA 1N5ZA 2D8JA 4AG2C 4IIMA 1UHFA 1YN8A 2JM9A 3A98A 3EHRA 2JMAA 1UHCA 5GJVB 2LJ0A 2VWFA 2DX1A 4DEXA 4J9HA 2C0TA 3FJ5A 3PVLA 1FYNA 4HVVA 2NWMA 2LJ3A 4OMOA 1WLPB 2EQIA 1RI9A 1SSHA 1JO8A 2FEIA 3M0SA 3EHQA 2OAWA 2OJ2A 4LN2A 4OMLA 3RNJA 3VS0A 1QKXA 4FSSA 1WX6A 2CH4W 4JJDA 3UA6A 1PRLC 2J6OA 1E6GA 2DRMA 2CUDA 4RTUA 3QWYA 3TSZA 3VRZA 1IO6A 3RBBB 1VYVA 2X3XD 2L3SA 2LJ1A 2A37A 4RTTA 1X69A 4D8KA 1SRMA 2FPFA 3M0TA 3VS7A 1T3SA 1W1FA 2BZXA 4F14A 2F2XA 1ZLMA 2LQWA 4D8DA 1U5SA 4JJBA 2K3BA 2LCSA 2EPDA 2FRWA 2KRNA 1UTIA 3IQLA 2EW3A 1AVZC 4LUDA 1HJDA 1AZGB 3JV3A 3VS4A 2KT1A 5FWCA 1SPKA 2EYXA 4WCIA 1U06A 1JXMA 1WXTA 2SRCA 3NMZC 2G6FX 1TG0A 2ESWA 1BB9A 1QKWA 4RTYA 4A63B 1JEGA 1RLQC 2W0ZA 1UGVA 2ED1A 2LNHB 2LZ6B 4OMPA 1GCPA 1GFDA 2BTTA 2KT8A 4RUGA 2DL7A 2DL8A 4IIOA 4QT7A 5FWBA 1H3HA 1KJWA 2IIMA 1OOTA 1T0JA 3M0QA 3R6NA 1SRLA 2QDLA 2KXDA 3VS2A 1ABOA 1ZUUA 2XMFA 2E5KA 4LNPA 1PRMC 1FMKA 4CC3A 2ABLA 1GBRA 2K2MA 1QWFA 2L3PA 2O88A 1GCQA 1LCKA 2DL3A 2I0NA 2W10A 2K79A 2DBMA 2JTEA 3M0PA 1X43A 4Y92A 1GRIA 5IHIA 2X3WD 1AOJA 2BZ8A 1WXBA 2C0OA 2DMOA 3C0CA 1NYGA 2J06A 3O5ZA 4DEYA 3VS3A 1M8MA 2YUPA 4J9FA 5ECAA 2DA9A 5IHNA 2DLPA 4OMNA 2CDTA 1RLPC 2C0IA 4LUEA 5IHKA 2KEAA 3M0UA 4RTWA 1GL5A 1PNJA 1KSWA 1I1JA 1HD3A 2H8HA 1UJYA 2K6DA 3U23A 3EG1A 2JXBA 1KFZA 1NLPC 2RNAA 3LH5A 2YUNA 2ROLA 3M0RA 2KXCA 2K9GA 2RQWA 2EGAA 3VS5A 2DL5A 2MIOA 3TSWA 2PNIA 4J9GA 3I5RA 2CSQA 1U3OA 1VYUA 4CC2A 3I5SA 2DL4A 2O31A 2ROTA 3EG3A 2JW4A 2DRKA 1G83A 1NEGA 4ZNXA 2MOXA 1M30A 3EG2A 2DJQA 1GCQC 2LX7A 3ZL7C 4CC4B 2RQVA 2BZYA 3VRYA 1W70A 3H0FA 2D0NA 1YCSB 2CREA 1Z9QA 2KYBA 4F16A 2O9VA 3GBQA 3SEMA 2OI3A 2KROA 2CT3A 5L23A 2KBTA 4M4ZA 2JS0A 1AWWA 5I22A 2EKHA 1K9AA 1ARKA 2RF0A 2GNCA 1M3BA 1T3LA 5HCKA 1QLYA 1M3AA 1K0SA 2KRSA 1JQQA 1ZX6A 1K1ZA 3REBB 1AWOA 1YP5A 1PWTA 1W6XA 1WYXA 2GBQA 2L2PA 2KR3A 4J9CA 1T0HA 2AKKA 1NM7A 1SHGA 5GJWB 1HSQA 1OPKA 3VS6A 2LQNA 3H0IA 2HSPA 1UFFA 2KE9A 2RQRA 4K11A 1YWPA 4HVUA 2HEQA 1TUDA 2DBKA 1ZBJA 2RMOA 1ZSGA 4GLMA 4JZ3A 4CC7A 2F2WA 2KGTA 1X27A 2J05A 4AFSC 4JZ4A 3THKA 4KRTA 3QWXX 4RTZA 1X2KA 2ECZA 1V1CA 4RTVA 1VYTA 1I0CA 4R0KA 5I11A 2JM8A 1Y57A 2FG0A 1Z9ZA 1ZUKA 2J7IA 2AK5A 2CSIA 3UF4A 2DF6A 4Z89A 1ABQA 1B07A 2DVJA 2KYMA 1VA7A 1WIEA 1I07A 4GBQA 5IXFA 4J9BA 2FPDA 1H92A 1KIKA 1MUZA 1CKAA 1G2BA 3NHNA 2YUOA 2VVKA 2AZVA 1PKSA 2PTKA 2LP5A 3VS1A 2HDAA 2YUQA 3REAB 2FPEA 2RN8A 3ULRB 2A08A 1S1NA 2B86A 1X6GA 2VKNA 1CKBA 1JU5C 1UG1A 2LMJA 2RPNA 4AG1C 3EG0A 1A0NB 4AFQC 1NEBA 2HBWA 1H8KA 3NGPA 1PHTA 2A36A 1WFWA 4ESRA 2V1QA 1E6HA 2EYWA 2FRYA 2P4RA 4E6RA 2MCNA 1PKTA 2L0AA 2ED0A 3I9QA 1RUWA 2AZSA 1UUEA 1SEMA 2A28A 2DYBA 2O2OA 1ZUYA 1QWEA 2EBPA 1OEBA 1OPLA 1XOVA 2DE0X 4AFZC 2HCKA 1UE9A 1BBZA 4Z8AA 2DNUA 2CUBA 2YDLA 1NG2A 1EFNA 2SEMA 1MV0B 2M51A 4J9IA 1CSKA 2DM1A 1GFCA 2M0YA 2CT4A 3TVTA 2KNBB 5IXBA 1AWXA 1SHFA 4HCKA 4AFUC 3EGUA 4HVWA 1NLOC 2GTOA 3H41A 3H0HA 4Z88A 2EVRA 2CH4A 2YSQA 3I35A 2K7AA 2PZ1A 2JMCA 2JS2A 2EGEA 2L3QA 2J6KA 3KFVA 4ORZA 3SHWA 2YT6A 2GTJA 1AEYA 1X6BA 2F2VA 2ENMA 3UATA 2EYYA 2FO0A 2RQUA 1UDLA 4J9EA 1K0XA 1YWOA 3PVQA 1OV3A 2D1XA 2RQTA 1NYFA 2DILA 3CQTA 3PE0A 4X1VA 1WXUA 1BK2A 1E7OA 4HXJA 2JT4A 1B3QA 1BU1A 1AWJA 1QCFA 1M27C 4F17A 5FW9A 1X2QA 2EGCA 3NPFA 2EYZA 1GBQA 1K76A 1Y0MA 2V1RA 1M3CA 2AKLA 4J9DA 1WA7A 2J6FA 5EC7A 4RTXA 1TUCA 1UJ0A 2NUZA 4JJCA 1K4US 5IH2A
chains in the Genus database with same CATH superfamily
1ZSZB 4LDVA 2E4HA 2K5FA 4ZN1A 2GQIA 5FU6C 2P4TA 2D8JA 1N5ZA 2EKOA 4IUPA 4C0FA 4C0ZA 2JM9A 1KC8U 2QASA 2VC8A 3EHRA 1UHCA 5GJVB 4OGCA 3EFSA 2VWFA 1SSFA 4PJLA 4DEXA 4E2FB 3FJ5A 4XK8E 4FW1A 3S3MA 4HVVA 4OMOA 3M0SA 4L5GA 3EHQA 3RNJA 4XTXA 4FL6A 2CP3A 1WX6A 1VQMT 1M2OA 2BUDA 2CH4W 2G3RA 3EG9A 1Q7YR 4XU2A 2CUDA 4RTUA 1TWBA 4FT2A 1UGRB 2RK2A 4V2SA 3TSZA 3VRZA 1IO6A 5LJ5g 5GAOq 3CCVQ 1EZZB 2XDPA 1WHGA 4C8QB 4RTTA 1YITA 2FPFA 2E5QA 1T3SA 1W1FA 5LJ3f 2OTJA 3S6WA 4F7UG 2HSEB 2E64A 1ZHIA 2PVGB 4M75E 1I81A 1U1SA 3CBMA 1IHVA 4NL2A 4LUDA 3LH0A 4Z02A 5HK3A 3CCUQ 1M1KU 3RIRA 3OW2A 4HA8A 3RKYA 5FWCA 1XNIA 1WXTA 3JCMW 3AT1B 3JRZA 1N6AA 2ESWA 1BIAA 4A63B 2XDDA 1VIEA 3BE3A 1BI0A 2IG0A 2YRCA 3G71Q 1WQWA 2LNHB 3HPWA 1GFDA 2DVEA 2DAQA 2K2VA 2DL8A 1G3TA 4QT7A 1VQPT 1T0JA 1VQOQ 3E19A 2QDLA 1KQ2A 3CCLT 4KUDK 3VUBA 4EMKA 1ABOA 1ZUUA 2XMFA 1PRMC 3OYGA 5GAOl 2ABLA 2YRVA 2RI5A 4M75C 4XQ3A 2K2MA 2L3PA 1OULA 1Q86C 2FL7A 1F1BB 2I0NA 2KQWA 2W10A 2KVQG 1RAEB 1PD1A 1Y07A 3EGDB 1ZA2B 3G6ET 2P0QA 1M2VB 2X3WD 2BZ8A 2HL5C 2DMOA 1WJRA 1O9SA 5DY9A 4DEYA 4A4FA 4FYWB 5I21A 4J9FA 1WQ7A 2VGNA 2C0IA 3ASKA 5GMKj 2KEAA 3M0UA 1GL5A 5LJ3e 2RD1A 3OYHA 2H8HA 1UJYA 4C5HA 2H3JA 1W2BP 2ROLA 4OVAA 2RQWA 1KG1A 5GANg 3LLRA 2DD5A 1SF9A 3I5RA 2QQAA 1VQ6T 2CSQA 4CC2A 1VQLT 3OYLA 2DL4A 2O31A 2PU9B 3GOXA 4BI4A 3EG3A 2MOXA 3KUFA 3V8JA 3EG2A 4PFPA 3ZL7C 4IUQA 3JSCA 2CS7A 1YCSB 1B34A 1RI0A 1NJIR 4BACA 3JCMQ 4FIBA 3SEMA 2KROA 4ZN3A 2CT3A 4KULA 4LDYA 3VYHB 4ZTJA 3OSVA 1AWWA 4XU0A 2EKHA 4HCZA 3I55T 2DXBA 2RF0A 2GNCA 4M7DA 4OB0B 1M3AA 4M78C 1K0SA 1JQQA 2R5MA 3RDVA 1AWOA 1YP5A 4KT0E 4FW2A 2HKQB 1T0HA 1VQPA 2AKKA 1NM7A 3G1JA 4JRQA 1HSQA 3VS6A 5FU7C 1VQKT 2KE9A 4HVUA 2DTHA 3L2UA 1VQ4A 4XTVA 2LT1A 1VQ9T 1ZBJA 2RJDA 4X9DA 5GAN2 5FRMA 1IHWA 4PJOB 2QI2A 1VQ8A 2DTOA 4DQ2A 3V8LA 1Q86U 1G3WA 4OGEA 3THKA 4KRTA 5AT1B 2JZ2A 3AHUA 4QVZA 1PG5B 3OYBA 1I0CA 2X35A 4QQ6A 4R0KA 4VUBA 5I11A 2J7IA 3CD6T 2AK5A 4OF1A 4IUUA 1ABQA 2YWWA 1B07A 2KYMA 3OY9A 1QVGS 1GXIE 1G3SA 3M58A 5KE3A 4M7AA 2YUOA 1RACB 1RAGB 3QUIA 1O75A 1PKSA 2PTKA 1KHCA 4OB1B 3DKMA 4C5GA 2LRQA 2YUQA 2QTVA 3REAB 5GAOm 2FPEA 2D6FA 3RKXA 2PQWA 1VQ7Q 3X26B 3J80E 4RG8A 4LDXA 2K4YA 2AT1B 3CCQQ 2EIFA 2VKNA 4B9XA 1SKUB 1G5VA 1I4K1 1UG1A 2LMJA 4M77A 1QP3A 1A0NB 2EQJA 2DIGA 4J6WA 2ZPFB 2A36A 1TU0B 2QA4Q 4ME7A 1IB8A 1DJ7B 4PL6A 1E6HA 2QEXT 1LOJA 3LGFA 3CC2A 5FROA 2YLCA 3G6EA 4E7IA 1SEMA 1TUGB 2ZZDA 2XHCA 5C6SA 1ZUYA 2MAMA 2C06A 1OPLA 3MHXA 5GAN3 3CCQA 1VQ6A 2X4JA 3UWNA 4M7AE 3MP6A 5CKHA 5GANd 1WZOA 2HQHA 4M7AC 5LJ3j 1MV0B 4M75A 1GFCA 4B6MA 3TVTA 2MMPA 4QQGA 2KNBB 3LGLA 2QQRA 2EJGA 2HNIA 2X4WA 3M55A 3VUZA 3ME9A 3A8MB 4HVWA 2GTOA 2P84A 1KC8R 3VKIA 4XU1A 1IXDA 2YSQA 5LJ5h 1QVPA 7AT1B 3I55A 4WF2A 2EGEA 4AT1B 3CCMQ 2J6KA 3KFVA 3M59A 1VQ5A 4ORZA 2HQEA 3SHWA 4FYVB 2CP7A 1AEYA 2F2VA 3H8ZA 2OTLA 5KYXB 2FO0A 2RQUA 1VQ8Q 2COYA 3PVQA 2EQMA 2RQTA 3OYJA 3CC7T 4M7DE 2DILA 1HK9A 3BY7A 4X1VA 1PCXA 3MP8A 4M77B 1N9RA 1BU1A 3SWNC 3CCQT 2X4YA 1ZSZC 4F17A 1OZ3A 5GANj 1X75C 3NPFA 1K73R 3OBWA 1GBQA 1K76A 1Y0MA 3WVEB 3SDZA 1TOVA 3LYIA 2AIRB 2QQSA 5GAN8 1YIJA 3T9NA 3JB9G 2HL3A 1U1TA 3A8HB 2YXYA 2RI3A 4P5NA 2DO3A 1QVGA 1KD1R 2L3RA 1J3TA 3UA7A 3CCST 1ZA1B 1AD5A 1VQOA 1WDXA 2H3EB 2Y4YA 1JJ2S 2KRMA 3GNGA 5A0LA 4M77E 4LE9A 4OMQA 4IIMA 4M7DB 1UHFA 3A98A 5KCHA 2A0FB 1YI2T 1QVGP 1TSFA 2JMAA 5KE2A 3OMGA 4J9HA 2C0TA 2LCLA 4XTZA 1MGQA 2GQVA 3PNWC 2QQBA 1WLPB 2OJ2A 2ZPEB 3VS0A 1QKXA 5CKBA 2COWA 3CD6A 3L2RA 2KI7A 2R5AA 3EGDA 1PRLC 2J6OA 2GCXA 3C12A 1E6GA 1Q81R 1W4SA 3QWYA 3CXCS 1K8AR 5GANe 3MEAA 4M78A 3RBBB 3JB9D 3EFRA 3VJPA 1X69A 4M7AB 4D8KA 5KCOA 3M0TA 2O4XA 5GANh 1C1AA 2F2XA 2LQWA 2LCSA 2M16A 3A1PA 1JB0E 2EW3A 1FMVA 1OX9A 1HJDA 3N5BB 3VS4A 1HYOA 2KT1A 2EYXA 4LXCA 4WCIA 2MWOA 4FYYB 1U06A 2HD0A 1BYMA 5HY6A 2LQ8A 3A5ZB 2OX7A 2G6FX 1JRIA 4LD9K 4ATOA 1TG0A 4A53A 2E70A 4XTYA 3FLGA 2K3XA 1X6OA 2LZ6B 4RKUE 2KT8A 2DL7A 4IIOA 5FWBA 1KJWA 3CCMT 2DTIA 3QIIA 2IIMA 1PSEA 3OS5A 3X24B 2KXDA 2OTLT 2CZ0B 2GF7A 4J8OA 1M1KC 1YJ9Q 1LCKA 1JBMA 3HHTB 1WJSA 3OYYA 4EMGA 2CP2A 3V7CA 4BUGA 2E3IA 5LJ3d 2XG8D 1MMAA 2COZA 1M1FA 2JOYA 4Y92A 4TVRA 1VQKQ 5IHIA 4ELYC 3JCMP 1OYXA 3CMET 3HTRA 1VQ4T 2HQXA 5IAYA 5CO7A 4OP0A 2CP0A 4MMLA 2JTMA 1IGUA 5CKEA 4M7DC 3RR6A 2PUOB 2DA9A 5IHNA 4PJOE 4LUEA 1PNJA 1QW1A 3CC7A 2V8IA 3CEYA 5CQXA 4B9WA 3A8GB 3EG1A 3CPFA 4KH0B 1WHHA 3SWNA 2LX9A 4LDWA 2KXCA 2K9GA 2D0QB 3TQ7P 2DL5A 2MIOA 3TSWA 4J9GA 3HRSA 3BDUA 4BY6B 1U3OA 4PLIA 1M9SA 2E3HA 1WHJA 4ZNXA 1M30A 2RQVA 1KC8C 4EDUA 2M0OA 1W70A 4BI8B 1WHMA 2WACA 1RADB 2CREA 3EGXB 4BE1A 2HMAA 2O9VA 1OQKA 2OI3A 1UGSB 2YLBA 1LVKA 3CC7Q 1RAHB 2KBTA 4M4ZA 2M02A 1S72A 5A0GA 4M78G 1FMWA 4C8QF 3JAME 1KK7A 3OS0A 1K9AA 2RB6A 1P92A 3C4SA 1WJQA 1Q7YC 4D6WA 4MZTA 2EYQA 2L89A 2OTJT 3OBYA 4A4GA 3H6ZA 5L8RE 5C0MA 4FYXB 2XICA 1SHGA 1BKBA 1K73C 1XQHA 1OPKA 1OI1A 4QVDA 4J6XA 3H0IA 2HSPA 2RQRA 4K11A 4JLIA 4JS4A 3M53A 4M77C 2FVUA 4F04B 3L2WA 1YJ9A 4KUIA 3QJ6A 3PMIA 4NL3A 1EX4A 3RMQA 4C8QD 1N8RU 2KGTA 1X27A 4JZ4A 1LNXA 5GAOp 2V26A 3VYGA 3SD4A 2HZYA 2JNGA 1V1CA 3MO8A 5KYYB 2WSFE 1Y57A 1ZUKA 2EFIA 3URGA 4X9CA 1Y96B 3UF4A 1R0BG 2DF6A 1V76A 3QDFA 1WIEA 3P8BB 5D6XA 1I07A 4GBQA 2QK0A 5IXFA 4JS5A 1H92A 1FXXA 1G2BA 1R77A 3DB4A 2F1LA 3NHNA 2VVKA 3G7ZA 4ZGEB 4FM4B 1Q82R 3VS1A 1M1KR 2HDAA 1VIFA 4F7UA 2OAUA 1RAAB 3H9NA 2WSCE 2A08A 3FJPA 1S1NA 3QKJA 2LQKA 4M7DD 3OSSC 1VQ7T 1NPRA 3LW5E 3JCMd 3CCJT 3L1AA 2DK3A 1OU8A 3OYMA 2RPNA 4AG1C 2X4XA 1NEBA 2HBWA 3NGPA 1FWZA 2YRDA 4ZTFA 4ESRA 2DEQA 3CC4A 4JRPA 4IURA 2FRYA 4X34A 2P4RA 3TCJA 3PFSA 1I8FA 5KYXA 1N8RC 1Y71A 2YHTA 3JCMe 2AZSA 4MDXA 3OS2A 2DYBA 2LC4A 2P0KA 4C8QG 1QWEA 1YJWQ 1TTHB 4L59A 4MDWA 5GAN5 3RKWA 2ATCB 2CZ1B 4J7IA 3EG9B 4M75G 4N4IA 2DNUA 2CUBA 4C8QE 3VV0A 4PK4A 4RMOA 2DFUA 2SEMA 1EFNA 1WNLA 2M51A 1Q7YU 1YI2Q 2DZCA 5IXBA 3MEUA 2VUBA 1SHFA 1UGPB 3SWNB 2NUTB 2VB6A 5GANf 5GAMg 1M2VA 2EVRA 4ELZC 2CH4A 3KBGA 3I35A 4KGZB 1VQOT 1VQPQ 2NUTA 2L3QA 2M1HA 3X25B 2FZGB 1X6BA 2ENMA 2E1HA 4UC4A 4XTWA 2EYYA 5GAMf 3V7SA 1QVFA 1OV3A 3CQTA 2JJ9A 1WXUA 1U8RA 1E7OA 1IZ6A 1M1GA 3CCUT 1ZSZA 2RHUA 1M27C 2E65A 4QQDA 5FW9A 2LT4A 3RMSA 4C92F 2NUPA 2V1RA 5CQYA 5D7UA 1WA7A 2J6FA 2MI6A 4JUVA 2VYTA 2GFAA 1K4US 1AHJB 5IH2A 5GMKl 1VOMA 1YNZA 4OMMA 3QSUA 3OQ5A 1MV3A 2PVOB 3PIOA 1KQSS 2GGRA 4EIKA 3OB9A 2QAZA 4PJJA 2F5TX 1JXOA 1AZEA 1UECA 2RK1A 3S3NA 1RABB 2ZPIB 1MNEA 3JCMc 1BI3A 4R56A 5DLOA 4C92D 3MEWA 3EFOB 2LJ0A 1TS9A 4CRIA 2FZCB 3CXCA 1D3BB 2DX1A 2AHJB 3WVDB 3PVLA 4C0DB 2CYZB 3G6EQ 2LJ3A 4E7SA 5KH6A 1Q82C 3CCRQ 2FEIA 1Q82U 4LN2A 3CMAQ 2IPOB 1WGSA 1VQNQ 1KQSA 2DD4A 3PGGA 4C92E 3G4SA 1I5OB 5LJ3g 2DIQA 2HKNA 2DRMA 4GY5A 4NOYA 3UT1A 2L3SA 2ZAEA 1I5LA 2LJ1A 4RCBA 2QGGA 4M75B 3VS7A 1R0CB 1K9MR 1ZLMA 3I56T 3CBOA 4JJBA 4C8QA 1VQ7A 2K3BA 3J7AF 2FRWA 2DZ9A 3QJYA 2CP5A 2XIDA 3IQLA 5CVIA 1N8RR 2CGHA 3JB9I 4DBQA 4FT4A 1NJIU 1BCOA 3CCJQ 1AZGB 3LWIA 1YJNA 3JV3A 1BI2A 2NYSA 1SPKA 1ZBXA 5EG2A 1QCNA 3NMZC 1BB9A 4RTYA 3CCUA 4ZGJB 4OMPA 1WPYA 4F7UF 1ZQ1A 2EJ9A 3CCET 1KHIA 4E7KA 1VQNA 3R6NA 1SRLA 3CMAA 3CC4Q 3VS2A 2Y4XA 2XK0A 3BW1A 2PVDB 4C92G 1S72Q 3CPWP 4PNOA 2MWPA 3OW2S 4E7LA 4PFOA 1GCQA 4M77F 8AT1B 3DLLA 1M90R 3QG1A 2K79A 1YHQQ 3NTKA 1X43A 1YHQT 4C8QC 1GRIA 2O01E 3L2ZA 4N4HA 1VUBA 1AOJA 2K57A 5LJ5d 1WXBA 3M5AA 3UPUA 1NYGA 1G8XA 3ZFJA 1ACMB 3O5ZA 2WSEE 3VS3A 1M8MA 5FLXE 1S72T 4E47A 5DM7R 2VASA 5ECAA 3CXCP 2DERA 3DB3A 3CCSA 3JCMb 1RLPC 5IHKA 4RTWA 4M7DG 1C6VX 1I1JA 1QCOA 4OB2B 4M77D 1NBEB 3X20B 2L8DA 2JXBA 4HT9A 3E2UA 3LH5A 1Q81U 1YCYA 2YUNA 4M7AD 1VQ5T 2ZGWA 3TEEA 2EGAA 4DBRA 3RESA 3MJXA 3OMCA 5LL6S 3MKDA 3RUXA 5KYUB 2EQKA 1VYUA 2R58A 2RHYA 3I5SA 3PT9A 4PKCC 2ROTA 1PC0A 1D0YA 2JW4A 3M4YA 1G83A 1N9SA 3BDLA 2DJQA 1UB4A 1GCQC 3I56A 1D09B 2BZYA 3VRYA 3H0FA 3NTIA 2LTOA 1Z9QA 2CKKA 3HFNA 3HKSA 5LJ3h 4LDUA 1QMCA 4FCYA 2E6ZA 1D1BA 3G4ST 4M7AF 1XTDA 4QW2A 1ARKA 1V29B 4DBFA 1R8OB 3OW2P 1T3LA 1HXDA 5GAOr 1MNDA 2F69A 3LWHA 1YITT 1PWTA 1K8AC 1W6XA 1WYXA 2GBQA 2L2PA 4J9CA 4J5YA 2QTXA 4RG2A 3A8LB 1UFFA 4J83A 1YWPA 3GF5A 3CMEQ 1OU9A 2DBKA 2QGFB 2RMOA 3ER0A 1YIJT 5GAMh 1ZSGA 4GLMA 4JZ3A 2QG9B 4M77G 2F2WA 4C5IA 2J05A 2VV5A 1OX8A 3OYNA 1YHQA 3JCMV 1PM3A 2X51A 3QWXX 1X2KA 3CCEA 3LX7A 3X28B 4KBMB 1VQMA 3F70A 4BB7A 4RTVA 5J39A 3G71A 2RH2A 3SFMA 2JM8A 2FG0A 1Z9ZA 3J81E 3PTAA 5IN1A 3CCEQ 3HFOA 2GFUA 1VA7A 2RO0A 2QA4T 4J9BA 2FPDA 1KIKA 1MUZA 1CKAA 3C94A 2AZVA 3E9FA 5GAMe 2RN8A 4HKEA 3ULRB 5FU7B 5GMKm 3OYAA 2K3YA 2MK5A 2FYKA 2BIVA 3M4GA 2Y90A 3QPHA 3HRTA 3GNFB 1Q81C 3C95A 5GAN7 1CKBA 1JU5C 4N4GA 4ANJA 2DJZA 4KGXB 5HK0A 3E9GA 1QVFS 4F7UE 3EG0A 3CCVA 5J3BA 4AFQC 3CPWA 1H8KA 1PHTA 3QYGB 1WFWA 3JCMf 4Q5WA 3L2VA 1FX7A 3EGXA 1MHNA 2RHIA 2ED0A 2L0AA 2RA2A 3I9QA 1RUWA 3MEVA 3M56A 4A4EA 1MMGA 1KQSP 1YIJQ 2O2OA 4E7ZA 4M7AG 1OEBA 1XOVA 2DE0X 3V7RA 2HCKA 1C0MA 1UGQB 1UE9A 4EMKC 5KYWA 2XD0A 1M4ZA 3FDRA 1NG2A 3GIBA 4NS5A 3M54A 1QP2A 2DM1A 2M0YA 1JJ2P 5CR2A 4HCBA 4QKUA 4M78D 3OS1A 3JB9H 1NLOC 4PJOF 4Z88A 5KYNA 2RJCA 2K7AA 2PZ1A 3EH1A 3GP8A 2JS2A 5A2QE 5LJ5f 4CI0C 2GTJA 1Q86R 1M90C 3I55Q 3QZ5B 3CCSQ 4DA4A 4J9EA 1UDLA 5GAMd 2D1XA 4A54A 3PE0A 1BK2A 4HXJA 2JT4A 1B3QA 8ATCB 2BE7D 4M78F 4IUVA 5GAN4 1X2QA 2EGCA 4PJOD 2DKGA 2CP6A 2EYZA 1AT1B 2Z0WA 4O5VA 1M3CA 2AKLA 2DXTA 4J9DA 1RAIB 2O4XB 4RTXA 3OA6A 1TUCA 4E7HA 4EMHA 3PMTA 1QVFP 1UJ0A 1PSFA 4JJCA 1LPLA 2JTFA 5AYFA 4BE0A 4JPBW 2QEXA 1VQ8T 2EAYA 1WI7A 2B8AA 2RI2A 5J26A 5KYUA 3HL8A 3P8DA 5CIUA 2K5IA 3SB2A 1M8VA 2O9SA 3CCVT 5HKCA 4M78E 2QA4A 2XDBA 2D8HA 3D7SB 4AG2C 1VQNT 2VXEA 1YN8A 1VQKA 3PIPA 2RHXA 1D0XA 4BI3A 1YJNT 3OYDA 5FRNA 1IRXA 2ZPHB 3M9QA 3QZ9B 4N0AC 1YJNQ 1FYNA 1XJWB 4JRKA 2NWMA 2EQIA 1RI9A 1SSHA 1JO8A 4HCCA 2OAWA 4OMLA 2D9TA 3MPUB 1VQ9A 4OMFB 2NUPB 4FSSA 4PFZA 1WHLA 2OTLQ 2M9UA 4JJDA 3UA6A 1H641 3CC4T 2BE9B 2JVVA 1MMNA 4JLGA 3MCAB 1OZ2A 1VYVA 2X3XD 4WTOB 3CCLQ 2A37A 1SRMA 5D6WA 4BDZA 2QQ9A 3CC2T 3FEOA 2BZXA 4F14A 5CCAA 3G4SQ 2R57A 4PJOG 4IKFA 4D8DA 1U5SA 3M57A 2EPDA 2KRNA 4XAXB 4R55A 1UTIA 3TU4K 3FIFA 1AVZC 3OYCA 3R6OA 3GPLA 3INZA 3HRUA 4GLKA 1BI1A 1JXMA 2SRCA 4DBHA 1VQ6Q 1NZ9A 3MP1A 1PD0A 3QHSA 1BIBA 1QKWA 3UDCA 1JEGA 1TXQA 2DYIA 1RLQC 2EQUA 2W0ZA 4N0AA 1UGVA 3CPWS 2ED1A 2LCCA 3FRNA 1GCPA 1K73U 2BTTA 4RUGA 1H3HA 4KH1B 4C92C 3CC2Q 1G3YA 4C92A 4BDYA 1OOTA 3CD6Q 2MPXC 3M0QA 3P8HA 4J7FA 4PJMA 2KK4A 4O6JA 4MMKA 4L6V5 4HT8A 2E5KA 1QQJA 2QYZA 4LNPA 1FMKA 1KD1U 4CC3A 1TH7A 1GBRA 4BY6C 1NE8A 1QWFA 1X01A 2O88A 4Y28E 4M7DF 3KXTA 1W2BA 4BE2A 2DL3A 2E12A 2DBMA 1K8AU 2JTEA 3M0PA 2KMTA 2VGMA 1JJ2A 1VQ9Q 3CCJA 4C5EA 2KSSA 2EJFA 2L5QA 1YJWT 2C0OA 3C0CA 3DLMA 3QO3A 4XTUA 2J06A 1YJ9T 1WHKA 4Y91A 5I2SA 2YUPA 4JDSA 3JB9J 2RM4A 2DLPA 4QVCA 4OMNA 2CDTA 3HP9A 3JCMJ 1KSWA 5A0DA 2RJFA 1HD3A 2ZCFB 3TREA 3QXEB 3JCMX 4MZPA 2K6DA 4ZGDB 2VXFA 3U23A 2P0PA 5GAMj 1KFZA 1NLPC 2E6NA 2RNAA 3G71T 4OB3B 3M0RA 4KGVB 3VU3C 1KD1C 3L2QA 3VS5A 2PNIA 3BFMA 3E1SA 6AT1B 5KYYA 3CCRA 2RHZA 1K9MU 2DRKA 1KQ1A 1NEGA 2LX7A 4CC4B 4J6YA 2HAXA 2D0NA 2JN0A 2KYBA 4F16A 1YJWA 2HBPA 3GBQA 1VQ5Q 2DXCA 3CCMA 5L23A 3EFOA 1D1CA 2JS0A 3NTHA 1SG5A 5I22A 2CZ7B 4A4HA 1IGQA 1M3BA 3HSBA 2MYSA 5HCKA 1QLYA 1RL2A 2FB7A 2KRSA 3JCMg 1ZX6A 1K1ZA 4PJOA 2RJEA 3REBB 3WXMB 1D1AA 3JB9F 4FSXA 2KR3A 4AMCA 3OYFA 2ZPGB 2ZPBB 5GJWB 1RAFB 4DOWA 2LQNA 2QDYB 2EWNA 2A7YA 2JUFA 3META 2HEQA 1TUDA 3EAEA 2IVWA 3QBYA 2LVMA 1D0ZA 5IT9E 3S3OA 3QDRB 2XI9A 5CAIA 4CC7A 3FB9A 3RERA 2CZ6B 2BKDN 2DPPB 4F7UB 4AFSC 4RTZA 4FU6A 3ZEHA 3O8VA 2KAFA 2ECZA 1VYTA 3FC3A 4A4KA 1BCMA 2DXUA 2CSIA 2MF2A 4Z89A 2DVJA 4EPCA 4PLLA 5LJ5e 4JJNK 3NFCA 4C0GA 1IREB 4XU3A 2LP5A 4PJOC 1YI2A 4IUTA 4PJNA 2FZKB 1H3ZA 5FU6B 5GAN6 5GMKi 2KY9A 4YTLA 2B86A 1NPPA 1X6GA 3OYKA 2XKOC 5GMKh 3CCLA 4EMKB 1YFNA 4JRIA 2E10A 4E7JA 2QXFA 5I2MA 1K9MC 2V1QA 2EYWA 4E6RA 2MCNA 1B34B 2PUKB 5CKFA 1PKTA 2F5KA 1UUEA 3CMAT 1Y96A 2A28A 4M75D 2DEUA 5KYWB 1VQ4Q 1M90U 3CCRT 1VQMQ 2EBPA 1W2BS 4AFZC 1BBZA 4Z8AA 2XU8A 1VQLA 3OYEA 2YDLA 3ZBDA 4J9IA 1EIFA 1CSKA 1M5Q1 3A8OB 1MMDA 2DETA 2CT4A 2V8KA 5GAOn 4C92B 1AWXA 2KDSA 4HCKA 4AFUC 3EGUA 3CMEA 3EH2A 2NLUA 2E41A 3Q1JA 2OTJQ 3H41A 3H0HA 1D3BA 1Y7XA 3OYIA 1UEBA 2A3LA 2QEXQ 2FHDA 2JMCA 1YITQ 2LDMA 1NJIC 1YBYA 5M9OA 4DOVA 3L42A 2K5LA 3JCMh 9ATCB 4II1A 4M75F 2I2LA 2YT6A 1Q95G 5GMKe 4LD6A 2X9HA 3UATA 1N27A 1K0XA 4BD3A 1YWOA 3V8KA 1NYFA 4M78B 4C0DC 1AWJA 1QCFA 3GLXA 1VQLQ 1LJOA 2V8JA 5CKDA 5D6YA 3QYHB 5DLQE 5LJ5j 5EC7A 4RCCA 3I56Q 5CK9A 3CBPA 2NUZA 4MZMA 1B7TA 2LNVA
chains in the Genus database with same CATH topology
1YNZA 4JPBW 4OMMA 1MV3A 1J3TA 3UA7A 1WI7A 1AD5A 1WDXA 2GGRA 2GQIA 4EIKA 2KRMA 1JXOA 2O9SA 4LE9A 4OMQA 1AZEA 1UECA 2D8HA 1N5ZA 2D8JA 4AG2C 4IIMA 1UHFA 1YN8A 2JM9A 3A98A 3EHRA 2JMAA 1UHCA 5GJVB 2LJ0A 2VWFA 2DX1A 4DEXA 4J9HA 2C0TA 3FJ5A 3PVLA 1FYNA 4HVVA 2NWMA 2LJ3A 4OMOA 1WLPB 2EQIA 1RI9A 1SSHA 1JO8A 2FEIA 3M0SA 3EHQA 2OAWA 2OJ2A 4LN2A 4OMLA 3RNJA 3VS0A 1QKXA 4FSSA 1WX6A 2CH4W 4JJDA 3UA6A 1PRLC 2J6OA 1E6GA 2DRMA 2CUDA 4RTUA 3QWYA 3TSZA 3VRZA 1IO6A 3RBBB 1VYVA 2X3XD 2L3SA 2LJ1A 2A37A 4RTTA 1X69A 4D8KA 1SRMA 2FPFA 3M0TA 3VS7A 1T3SA 1W1FA 2BZXA 4F14A 2F2XA 1ZLMA 2LQWA 4D8DA 1U5SA 4JJBA 2K3BA 2LCSA 2EPDA 2FRWA 2KRNA 1UTIA 3IQLA 2EW3A 1AVZC 4LUDA 1HJDA 1AZGB 3JV3A 3VS4A 2KT1A 5FWCA 1SPKA 2EYXA 4WCIA 1U06A 1JXMA 1WXTA 2SRCA 3NMZC 2G6FX 1TG0A 2ESWA 1BB9A 1QKWA 4RTYA 4A63B 1JEGA 1RLQC 2W0ZA 1UGVA 2ED1A 2LNHB 2LZ6B 4OMPA 1GCPA 1GFDA 2BTTA 2KT8A 4RUGA 2DL7A 2DL8A 4IIOA 4QT7A 5FWBA 1H3HA 1KJWA 2IIMA 1OOTA 1T0JA 3M0QA 3R6NA 1SRLA 2QDLA 2KXDA 3VS2A 1ABOA 1ZUUA 2XMFA 2E5KA 4LNPA 1PRMC 1FMKA 4CC3A 2ABLA 1GBRA 2K2MA 1QWFA 2L3PA 2O88A 1GCQA 1LCKA 2DL3A 2I0NA 2W10A 2K79A 2DBMA 2JTEA 3M0PA 1X43A 4Y92A 1GRIA 5IHIA 2X3WD 1AOJA 2BZ8A 1WXBA 2C0OA 2DMOA 3C0CA 1NYGA 2J06A 3O5ZA 4DEYA 3VS3A 1M8MA 2YUPA 4J9FA 5ECAA 2DA9A 5IHNA 2DLPA 4OMNA 2CDTA 1RLPC 2C0IA 4LUEA 5IHKA 2KEAA 3M0UA 4RTWA 1GL5A 1PNJA 1KSWA 1I1JA 1HD3A 2H8HA 1UJYA 2K6DA 3U23A 3EG1A 2JXBA 1KFZA 1NLPC 2RNAA 3LH5A 2YUNA 2ROLA 3M0RA 2KXCA 2K9GA 2RQWA 2EGAA 3VS5A 2DL5A 2MIOA 3TSWA 2PNIA 4J9GA 3I5RA 2CSQA 1U3OA 1VYUA 4CC2A 3I5SA 2DL4A 2O31A 2ROTA 3EG3A 2JW4A 2DRKA 1G83A 1NEGA 4ZNXA 2MOXA 1M30A 3EG2A 2DJQA 1GCQC 2LX7A 3ZL7C 4CC4B 2RQVA 2BZYA 3VRYA 1W70A 3H0FA 2D0NA 1YCSB 2CREA 1Z9QA 2KYBA 4F16A 2O9VA 3GBQA 3SEMA 2OI3A 2KROA 2CT3A 5L23A 2KBTA 4M4ZA 2JS0A 1AWWA 5I22A 2EKHA 1K9AA 1ARKA 2RF0A 2GNCA 1M3BA 1T3LA 5HCKA 1QLYA 1M3AA 1K0SA 2KRSA 1JQQA 1ZX6A 1K1ZA 3REBB 1AWOA 1YP5A 1PWTA 1W6XA 1WYXA 2GBQA 2L2PA 2KR3A 4J9CA 1T0HA 2AKKA 1NM7A 1SHGA 5GJWB 1HSQA 1OPKA 3VS6A 2LQNA 3H0IA 2HSPA 1UFFA 2KE9A 2RQRA 4K11A 1YWPA 4HVUA 2HEQA 1TUDA 2DBKA 1ZBJA 2RMOA 1ZSGA 4GLMA 4JZ3A 4CC7A 2F2WA 2KGTA 1X27A 2J05A 4AFSC 4JZ4A 3THKA 4KRTA 3QWXX 4RTZA 1X2KA 2ECZA 1V1CA 4RTVA 1VYTA 1I0CA 4R0KA 5I11A 2JM8A 1Y57A 2FG0A 1Z9ZA 1ZUKA 2J7IA 2AK5A 2CSIA 3UF4A 2DF6A 4Z89A 1ABQA 1B07A 2DVJA 2KYMA 1VA7A 1WIEA 1I07A 4GBQA 5IXFA 4J9BA 2FPDA 1H92A 1KIKA 1MUZA 1CKAA 1G2BA 3NHNA 2YUOA 2VVKA 2AZVA 1PKSA 2PTKA 2LP5A 3VS1A 2HDAA 2YUQA 3REAB 2FPEA 2RN8A 3ULRB 2A08A 1S1NA 2B86A 1X6GA 2VKNA 1CKBA 1JU5C 1UG1A 2LMJA 2RPNA 4AG1C 3EG0A 1A0NB 4AFQC 1NEBA 2HBWA 1H8KA 3NGPA 1PHTA 2A36A 1WFWA 4ESRA 2V1QA 1E6HA 2EYWA 2FRYA 2P4RA 4E6RA 2MCNA 1PKTA 2L0AA 2ED0A 3I9QA 1RUWA 2AZSA 1UUEA 1SEMA 2A28A 2DYBA 2O2OA 1ZUYA 1QWEA 2EBPA 1OEBA 1OPLA 1XOVA 2DE0X 4AFZC 2HCKA 1UE9A 1BBZA 4Z8AA 2DNUA 2CUBA 2YDLA 1NG2A 1EFNA 2SEMA 1MV0B 2M51A 4J9IA 1CSKA 2DM1A 1GFCA 2M0YA 2CT4A 3TVTA 2KNBB 5IXBA 1AWXA 1SHFA 4HCKA 4AFUC 3EGUA 4HVWA 1NLOC 2GTOA 3H41A 3H0HA 4Z88A 2EVRA 2CH4A 2YSQA 3I35A 2K7AA 2PZ1A 2JMCA 2JS2A 2EGEA 2L3QA 2J6KA 3KFVA 4ORZA 3SHWA 2YT6A 2GTJA 1AEYA 1X6BA 2F2VA 2ENMA 3UATA 2EYYA 2FO0A 2RQUA 1UDLA 4J9EA 1K0XA 1YWOA 3PVQA 1OV3A 2D1XA 2RQTA 1NYFA 2DILA 3CQTA 3PE0A 4X1VA 1WXUA 1BK2A 1E7OA 4HXJA 2JT4A 1B3QA 1BU1A 1AWJA 1QCFA 1M27C 4F17A 5FW9A 1X2QA 2EGCA 3NPFA 2EYZA 1GBQA 1K76A 1Y0MA 2V1RA 1M3CA 2AKLA 4J9DA 1WA7A 2J6FA 5EC7A 4RTXA 1TUCA 1UJ0A 2NUZA 4JJCA 1K4US 5IH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNZ A;  4JPB W;  4OMM A;  1MV3 A;  1J3T A;  3UA7 A;  1WI7 A;  1AD5 A;  1WDX A;  2GGR A;  2GQI A;  4EIK A;  2KRM A;  1JXO A;  2O9S A;  4LE9 A;  4OMQ A;  1AZE A;  1UEC A;  2D8H A;  1N5Z A;  2D8J A;  4AG2 C;  4IIM A;  1UHF A;  1YN8 A;  2JM9 A;  3A98 A;  3EHR A;  2JMA A;  1UHC A;  5GJV B;  2LJ0 A;  2VWF A;  2DX1 A;  4DEX A;  4J9H A;  2C0T A;  3FJ5 A;  3PVL A;  1FYN A;  4HVV A;  2NWM A;  2LJ3 A;  4OMO A;  1WLP B;  2EQI A;  1RI9 A;  1SSH A;  1JO8 A;  2FEI A;  3M0S A;  3EHQ A;  2OAW A;  2OJ2 A;  4LN2 A;  4OML A;  3RNJ A;  3VS0 A;  1QKX A;  4FSS A;  1WX6 A;  2CH4 W;  4JJD A;  3UA6 A;  1PRL C;  2J6O A;  1E6G A;  2DRM A;  2CUD A;  4RTU A;  3QWY A;  3TSZ A;  3VRZ A;  1IO6 A;  3RBB B;  1VYV A;  2X3X D;  2L3S A;  2LJ1 A;  2A37 A;  4RTT A;  1X69 A;  4D8K A;  1SRM A;  2FPF A;  3M0T A;  3VS7 A;  1T3S A;  1W1F A;  2BZX A;  4F14 A;  2F2X A;  1ZLM A;  2LQW A;  4D8D A;  1U5S A;  4JJB A;  2K3B A;  2LCS A;  2EPD A;  2FRW A;  2KRN A;  1UTI A;  3IQL A;  2EW3 A;  1AVZ C;  4LUD A;  1HJD A;  1AZG B;  3JV3 A;  3VS4 A;  2KT1 A;  5FWC A;  1SPK A;  2EYX A;  4WCI A;  1U06 A;  1JXM A;  1WXT A;  2SRC A;  3NMZ C;  2G6F X;  1TG0 A;  2ESW A;  1BB9 A;  1QKW A;  4RTY A;  4A63 B;  1JEG A;  1RLQ C;  2W0Z A;  1UGV A;  2ED1 A;  2LNH B;  2LZ6 B;  4OMP A;  1GCP A;  1GFD A;  2BTT A;  2KT8 A;  4RUG A;  2DL7 A;  2DL8 A;  4IIO A;  4QT7 A;  5FWB A;  1H3H A;  1KJW A;  2IIM A;  1OOT A;  1T0J A;  3M0Q A;  3R6N A;  1SRL A;  2QDL A;  2KXD A;  3VS2 A;  1ABO A;  1ZUU A;  2XMF A;  2E5K A;  4LNP A;  1PRM C;  1FMK A;  4CC3 A;  2ABL A;  1GBR A;  2K2M A;  1QWF A;  2L3P A;  2O88 A;  1GCQ A;  1LCK A;  2DL3 A;  2I0N A;  2W10 A;  2K79 A;  2DBM A;  2JTE A;  3M0P A;  1X43 A;  4Y92 A;  1GRI A;  5IHI A;  2X3W D;  1AOJ A;  2BZ8 A;  1WXB A;  2C0O A;  2DMO A;  3C0C A;  1NYG A;  2J06 A;  3O5Z A;  4DEY A;  3VS3 A;  1M8M A;  2YUP A;  4J9F A;  5ECA A;  2DA9 A;  5IHN A;  2DLP A;  4OMN A;  2CDT A;  1RLP C;  2C0I A;  4LUE A;  5IHK A;  2KEA A;  3M0U A;  4RTW A;  1GL5 A;  1PNJ A;  1KSW A;  1I1J A;  1HD3 A;  2H8H A;  1UJY A;  2K6D A;  3U23 A;  3EG1 A;  2JXB A;  1KFZ A;  1NLP C;  2RNA A;  3LH5 A;  2YUN A;  2ROL A;  3M0R A;  2KXC A;  2K9G A;  2RQW A;  2EGA A;  3VS5 A;  2DL5 A;  2MIO A;  3TSW A;  2PNI A;  4J9G A;  3I5R A;  2CSQ A;  1U3O A;  1VYU A;  4CC2 A;  3I5S A;  2DL4 A;  2O31 A;  2ROT A;  3EG3 A;  2JW4 A;  2DRK A;  1G83 A;  1NEG A;  4ZNX A;  2MOX A;  1M30 A;  3EG2 A;  2DJQ A;  1GCQ C;  2LX7 A;  3ZL7 C;  4CC4 B;  2RQV A;  2BZY A;  3VRY A;  1W70 A;  3H0F A;  2D0N A;  1YCS B;  2CRE A;  1Z9Q A;  2KYB A;  4F16 A;  2O9V A;  3GBQ A;  3SEM A;  2OI3 A;  2KRO A;  2CT3 A;  5L23 A;  2KBT A;  4M4Z A;  2JS0 A;  1AWW A;  5I22 A;  2EKH A;  1K9A A;  1ARK A;  2RF0 A;  2GNC A;  1M3B A;  1T3L A;  5HCK A;  1QLY A;  1M3A A;  1K0S A;  2KRS A;  1JQQ A;  1ZX6 A;  1K1Z A;  3REB B;  1AWO A;  1YP5 A;  1PWT A;  1W6X A;  1WYX A;  2GBQ A;  2L2P A;  2KR3 A;  4J9C A;  1T0H A;  2AKK A;  1NM7 A;  1SHG A;  5GJW B;  1HSQ A;  1OPK A;  3VS6 A;  2LQN A;  3H0I A;  2HSP A;  1UFF A;  2KE9 A;  2RQR A;  4K11 A;  1YWP A;  4HVU A;  2HEQ A;  1TUD A;  2DBK A;  1ZBJ A;  2RMO A;  1ZSG A;  4GLM A;  4JZ3 A;  4CC7 A;  2F2W A;  2KGT A;  1X27 A;  2J05 A;  4AFS C;  4JZ4 A;  3THK A;  4KRT A;  3QWX X;  4RTZ A;  1X2K A;  2ECZ A;  1V1C A;  4RTV A;  1VYT A;  1I0C A;  4R0K A;  5I11 A;  2JM8 A;  1Y57 A;  2FG0 A;  1Z9Z A;  1ZUK A;  2J7I A;  2AK5 A;  2CSI A;  3UF4 A;  2DF6 A;  4Z89 A;  1ABQ A;  1B07 A;  2DVJ A;  2KYM A;  1VA7 A;  1WIE A;  1I07 A;  4GBQ A;  5IXF A;  4J9B A;  2FPD A;  1H92 A;  1KIK A;  1MUZ A;  1CKA A;  1G2B A;  3NHN A;  2YUO A;  2VVK A;  2AZV A;  1PKS A;  2PTK A;  2LP5 A;  3VS1 A;  2HDA A;  2YUQ A;  3REA B;  2FPE A;  2RN8 A;  3ULR B;  2A08 A;  1S1N A;  2B86 A;  1X6G A;  2VKN A;  1CKB A;  1JU5 C;  1UG1 A;  2LMJ A;  2RPN A;  4AG1 C;  3EG0 A;  1A0N B;  4AFQ C;  1NEB A;  2HBW A;  1H8K A;  3NGP A;  1PHT A;  2A36 A;  1WFW A;  4ESR A;  2V1Q A;  1E6H A;  2EYW A;  2FRY A;  2P4R A;  4E6R A;  2MCN A;  1PKT A;  2L0A A;  2ED0 A;  3I9Q A;  1RUW A;  2AZS A;  1UUE A;  1SEM A;  2A28 A;  2DYB A;  2O2O A;  1ZUY A;  1QWE A;  2EBP A;  1OEB A;  1OPL A;  1XOV A;  2DE0 X;  4AFZ C;  2HCK A;  1UE9 A;  1BBZ A;  4Z8A A;  2DNU A;  2CUB A;  2YDL A;  1NG2 A;  1EFN A;  2SEM A;  1MV0 B;  2M51 A;  4J9I A;  1CSK A;  2DM1 A;  1GFC A;  2M0Y A;  2CT4 A;  3TVT A;  2KNB B;  5IXB A;  1AWX A;  1SHF A;  4HCK A;  4AFU C;  3EGU A;  4HVW A;  1NLO C;  2GTO A;  3H41 A;  3H0H A;  4Z88 A;  2EVR A;  2CH4 A;  2YSQ A;  3I35 A;  2K7A A;  2PZ1 A;  2JMC A;  2JS2 A;  2EGE A;  2L3Q A;  2J6K A;  3KFV A;  4ORZ A;  3SHW A;  2YT6 A;  2GTJ A;  1AEY A;  1X6B A;  2F2V A;  2ENM A;  3UAT A;  2EYY A;  2FO0 A;  2RQU A;  1UDL A;  4J9E A;  1K0X A;  1YWO A;  3PVQ A;  1OV3 A;  2D1X A;  2RQT A;  1NYF A;  2DIL A;  3CQT A;  3PE0 A;  4X1V A;  1WXU A;  1BK2 A;  1E7O A;  4HXJ A;  2JT4 A;  1B3Q A;  1BU1 A;  1AWJ A;  1QCF A;  1M27 C;  4F17 A;  5FW9 A;  1X2Q A;  2EGC A;  3NPF A;  2EYZ A;  1GBQ A;  1K76 A;  1Y0M A;  2V1R A;  1M3C A;  2AKL A;  4J9D A;  1WA7 A;  2J6F A;  5EC7 A;  4RTX A;  1TUC A;  1UJ0 A;  2NUZ A;  4JJC A;  1K4U S;  5IH2 A; 
#chains in the Genus database with same CATH topology
 1ZSZ B;  4LDV A;  2E4H A;  2K5F A;  4ZN1 A;  2GQI A;  5FU6 C;  2P4T A;  2D8J A;  1N5Z A;  2EKO A;  4IUP A;  4C0F A;  4C0Z A;  2JM9 A;  1KC8 U;  2QAS A;  2VC8 A;  3EHR A;  1UHC A;  5GJV B;  4OGC A;  3EFS A;  2VWF A;  1SSF A;  4PJL A;  4DEX A;  4E2F B;  3FJ5 A;  4XK8 E;  4FW1 A;  3S3M A;  4HVV A;  4OMO A;  3M0S A;  4L5G A;  3EHQ A;  3RNJ A;  4XTX A;  4FL6 A;  2CP3 A;  1WX6 A;  1VQM T;  1M2O A;  2BUD A;  2CH4 W;  2G3R A;  3EG9 A;  1Q7Y R;  4XU2 A;  2CUD A;  4RTU A;  1TWB A;  4FT2 A;  1UGR B;  2RK2 A;  4V2S A;  3TSZ A;  3VRZ A;  1IO6 A;  5LJ5 g;  5GAO q;  3CCV Q;  1EZZ B;  2XDP A;  1WHG A;  4C8Q B;  4RTT A;  1YIT A;  2FPF A;  2E5Q A;  1T3S A;  1W1F A;  5LJ3 f;  2OTJ A;  3S6W A;  4F7U G;  2HSE B;  2E64 A;  1ZHI A;  2PVG B;  4M75 E;  1I81 A;  1U1S A;  3CBM A;  1IHV A;  4NL2 A;  4LUD A;  3LH0 A;  4Z02 A;  5HK3 A;  3CCU Q;  1M1K U;  3RIR A;  3OW2 A;  4HA8 A;  3RKY A;  5FWC A;  1XNI A;  1WXT A;  3JCM W;  3AT1 B;  3JRZ A;  1N6A A;  2ESW A;  1BIA A;  4A63 B;  2XDD A;  1VIE A;  3BE3 A;  1BI0 A;  2IG0 A;  2YRC A;  3G71 Q;  1WQW A;  2LNH B;  3HPW A;  1GFD A;  2DVE A;  2DAQ A;  2K2V A;  2DL8 A;  1G3T A;  4QT7 A;  1VQP T;  1T0J A;  1VQO Q;  3E19 A;  2QDL A;  1KQ2 A;  3CCL T;  4KUD K;  3VUB A;  4EMK A;  1ABO A;  1ZUU A;  2XMF A;  1PRM C;  3OYG A;  5GAO l;  2ABL A;  2YRV A;  2RI5 A;  4M75 C;  4XQ3 A;  2K2M A;  2L3P A;  1OUL A;  1Q86 C;  2FL7 A;  1F1B B;  2I0N A;  2KQW A;  2W10 A;  2KVQ G;  1RAE B;  1PD1 A;  1Y07 A;  3EGD B;  1ZA2 B;  3G6E T;  2P0Q A;  1M2V B;  2X3W D;  2BZ8 A;  2HL5 C;  2DMO A;  1WJR A;  1O9S A;  5DY9 A;  4DEY A;  4A4F A;  4FYW B;  5I21 A;  4J9F A;  1WQ7 A;  2VGN A;  2C0I A;  3ASK A;  5GMK j;  2KEA A;  3M0U A;  1GL5 A;  5LJ3 e;  2RD1 A;  3OYH A;  2H8H A;  1UJY A;  4C5H A;  2H3J A;  1W2B P;  2ROL A;  4OVA A;  2RQW A;  1KG1 A;  5GAN g;  3LLR A;  2DD5 A;  1SF9 A;  3I5R A;  2QQA A;  1VQ6 T;  2CSQ A;  4CC2 A;  1VQL T;  3OYL A;  2DL4 A;  2O31 A;  2PU9 B;  3GOX A;  4BI4 A;  3EG3 A;  2MOX A;  3KUF A;  3V8J A;  3EG2 A;  4PFP A;  3ZL7 C;  4IUQ A;  3JSC A;  2CS7 A;  1YCS B;  1B34 A;  1RI0 A;  1NJI R;  4BAC A;  3JCM Q;  4FIB A;  3SEM A;  2KRO A;  4ZN3 A;  2CT3 A;  4KUL A;  4LDY A;  3VYH B;  4ZTJ A;  3OSV A;  1AWW A;  4XU0 A;  2EKH A;  4HCZ A;  3I55 T;  2DXB A;  2RF0 A;  2GNC A;  4M7D A;  4OB0 B;  1M3A A;  4M78 C;  1K0S A;  1JQQ A;  2R5M A;  3RDV A;  1AWO A;  1YP5 A;  4KT0 E;  4FW2 A;  2HKQ B;  1T0H A;  1VQP A;  2AKK A;  1NM7 A;  3G1J A;  4JRQ A;  1HSQ A;  3VS6 A;  5FU7 C;  1VQK T;  2KE9 A;  4HVU A;  2DTH A;  3L2U A;  1VQ4 A;  4XTV A;  2LT1 A;  1VQ9 T;  1ZBJ A;  2RJD A;  4X9D A;  5GAN 2;  5FRM A;  1IHW A;  4PJO B;  2QI2 A;  1VQ8 A;  2DTO A;  4DQ2 A;  3V8L A;  1Q86 U;  1G3W A;  4OGE A;  3THK A;  4KRT A;  5AT1 B;  2JZ2 A;  3AHU A;  4QVZ A;  1PG5 B;  3OYB A;  1I0C A;  2X35 A;  4QQ6 A;  4R0K A;  4VUB A;  5I11 A;  2J7I A;  3CD6 T;  2AK5 A;  4OF1 A;  4IUU A;  1ABQ A;  2YWW A;  1B07 A;  2KYM A;  3OY9 A;  1QVG S;  1GXI E;  1G3S A;  3M58 A;  5KE3 A;  4M7A A;  2YUO A;  1RAC B;  1RAG B;  3QUI A;  1O75 A;  1PKS A;  2PTK A;  1KHC A;  4OB1 B;  3DKM A;  4C5G A;  2LRQ A;  2YUQ A;  2QTV A;  3REA B;  5GAO m;  2FPE A;  2D6F A;  3RKX A;  2PQW A;  1VQ7 Q;  3X26 B;  3J80 E;  4RG8 A;  4LDX A;  2K4Y A;  2AT1 B;  3CCQ Q;  2EIF A;  2VKN A;  4B9X A;  1SKU B;  1G5V A;  1I4K 1;  1UG1 A;  2LMJ A;  4M77 A;  1QP3 A;  1A0N B;  2EQJ A;  2DIG A;  4J6W A;  2ZPF B;  2A36 A;  1TU0 B;  2QA4 Q;  4ME7 A;  1IB8 A;  1DJ7 B;  4PL6 A;  1E6H A;  2QEX T;  1LOJ A;  3LGF A;  3CC2 A;  5FRO A;  2YLC A;  3G6E A;  4E7I A;  1SEM A;  1TUG B;  2ZZD A;  2XHC A;  5C6S A;  1ZUY A;  2MAM A;  2C06 A;  1OPL A;  3MHX A;  5GAN 3;  3CCQ A;  1VQ6 A;  2X4J A;  3UWN A;  4M7A E;  3MP6 A;  5CKH A;  5GAN d;  1WZO A;  2HQH A;  4M7A C;  5LJ3 j;  1MV0 B;  4M75 A;  1GFC A;  4B6M A;  3TVT A;  2MMP A;  4QQG A;  2KNB B;  3LGL A;  2QQR A;  2EJG A;  2HNI A;  2X4W A;  3M55 A;  3VUZ A;  3ME9 A;  3A8M B;  4HVW A;  2GTO A;  2P84 A;  1KC8 R;  3VKI A;  4XU1 A;  1IXD A;  2YSQ A;  5LJ5 h;  1QVP A;  7AT1 B;  3I55 A;  4WF2 A;  2EGE A;  4AT1 B;  3CCM Q;  2J6K A;  3KFV A;  3M59 A;  1VQ5 A;  4ORZ A;  2HQE A;  3SHW A;  4FYV B;  2CP7 A;  1AEY A;  2F2V A;  3H8Z A;  2OTL A;  5KYX B;  2FO0 A;  2RQU A;  1VQ8 Q;  2COY A;  3PVQ A;  2EQM A;  2RQT A;  3OYJ A;  3CC7 T;  4M7D E;  2DIL A;  1HK9 A;  3BY7 A;  4X1V A;  1PCX A;  3MP8 A;  4M77 B;  1N9R A;  1BU1 A;  3SWN C;  3CCQ T;  2X4Y A;  1ZSZ C;  4F17 A;  1OZ3 A;  5GAN j;  1X75 C;  3NPF A;  1K73 R;  3OBW A;  1GBQ A;  1K76 A;  1Y0M A;  3WVE B;  3SDZ A;  1TOV A;  3LYI A;  2AIR B;  2QQS A;  5GAN 8;  1YIJ A;  3T9N A;  3JB9 G;  2HL3 A;  1U1T A;  3A8H B;  2YXY A;  2RI3 A;  4P5N A;  2DO3 A;  1QVG A;  1KD1 R;  2L3R A;  1J3T A;  3UA7 A;  3CCS T;  1ZA1 B;  1AD5 A;  1VQO A;  1WDX A;  2H3E B;  2Y4Y A;  1JJ2 S;  2KRM A;  3GNG A;  5A0L A;  4M77 E;  4LE9 A;  4OMQ A;  4IIM A;  4M7D B;  1UHF A;  3A98 A;  5KCH A;  2A0F B;  1YI2 T;  1QVG P;  1TSF A;  2JMA A;  5KE2 A;  3OMG A;  4J9H A;  2C0T A;  2LCL A;  4XTZ A;  1MGQ A;  2GQV A;  3PNW C;  2QQB A;  1WLP B;  2OJ2 A;  2ZPE B;  3VS0 A;  1QKX A;  5CKB A;  2COW A;  3CD6 A;  3L2R A;  2KI7 A;  2R5A A;  3EGD A;  1PRL C;  2J6O A;  2GCX A;  3C12 A;  1E6G A;  1Q81 R;  1W4S A;  3QWY A;  3CXC S;  1K8A R;  5GAN e;  3MEA A;  4M78 A;  3RBB B;  3JB9 D;  3EFR A;  3VJP A;  1X69 A;  4M7A B;  4D8K A;  5KCO A;  3M0T A;  2O4X A;  5GAN h;  1C1A A;  2F2X A;  2LQW A;  2LCS A;  2M16 A;  3A1P A;  1JB0 E;  2EW3 A;  1FMV A;  1OX9 A;  1HJD A;  3N5B B;  3VS4 A;  1HYO A;  2KT1 A;  2EYX A;  4LXC A;  4WCI A;  2MWO A;  4FYY B;  1U06 A;  2HD0 A;  1BYM A;  5HY6 A;  2LQ8 A;  3A5Z B;  2OX7 A;  2G6F X;  1JRI A;  4LD9 K;  4ATO A;  1TG0 A;  4A53 A;  2E70 A;  4XTY A;  3FLG A;  2K3X A;  1X6O A;  2LZ6 B;  4RKU E;  2KT8 A;  2DL7 A;  4IIO A;  5FWB A;  1KJW A;  3CCM T;  2DTI A;  3QII A;  2IIM A;  1PSE A;  3OS5 A;  3X24 B;  2KXD A;  2OTL T;  2CZ0 B;  2GF7 A;  4J8O A;  1M1K C;  1YJ9 Q;  1LCK A;  1JBM A;  3HHT B;  1WJS A;  3OYY A;  4EMG A;  2CP2 A;  3V7C A;  4BUG A;  2E3I A;  5LJ3 d;  2XG8 D;  1MMA A;  2COZ A;  1M1F A;  2JOY A;  4Y92 A;  4TVR A;  1VQK Q;  5IHI A;  4ELY C;  3JCM P;  1OYX A;  3CME T;  3HTR A;  1VQ4 T;  2HQX A;  5IAY A;  5CO7 A;  4OP0 A;  2CP0 A;  4MML A;  2JTM A;  1IGU A;  5CKE A;  4M7D C;  3RR6 A;  2PUO B;  2DA9 A;  5IHN A;  4PJO E;  4LUE A;  1PNJ A;  1QW1 A;  3CC7 A;  2V8I A;  3CEY A;  5CQX A;  4B9W A;  3A8G B;  3EG1 A;  3CPF A;  4KH0 B;  1WHH A;  3SWN A;  2LX9 A;  4LDW A;  2KXC A;  2K9G A;  2D0Q B;  3TQ7 P;  2DL5 A;  2MIO A;  3TSW A;  4J9G A;  3HRS A;  3BDU A;  4BY6 B;  1U3O A;  4PLI A;  1M9S A;  2E3H A;  1WHJ A;  4ZNX A;  1M30 A;  2RQV A;  1KC8 C;  4EDU A;  2M0O A;  1W70 A;  4BI8 B;  1WHM A;  2WAC A;  1RAD B;  2CRE A;  3EGX B;  4BE1 A;  2HMA A;  2O9V A;  1OQK A;  2OI3 A;  1UGS B;  2YLB A;  1LVK A;  3CC7 Q;  1RAH B;  2KBT A;  4M4Z A;  2M02 A;  1S72 A;  5A0G A;  4M78 G;  1FMW A;  4C8Q F;  3JAM E;  1KK7 A;  3OS0 A;  1K9A A;  2RB6 A;  1P92 A;  3C4S A;  1WJQ A;  1Q7Y C;  4D6W A;  4MZT A;  2EYQ A;  2L89 A;  2OTJ T;  3OBY A;  4A4G A;  3H6Z A;  5L8R E;  5C0M A;  4FYX B;  2XIC A;  1SHG A;  1BKB A;  1K73 C;  1XQH A;  1OPK A;  1OI1 A;  4QVD A;  4J6X A;  3H0I A;  2HSP A;  2RQR A;  4K11 A;  4JLI A;  4JS4 A;  3M53 A;  4M77 C;  2FVU A;  4F04 B;  3L2W A;  1YJ9 A;  4KUI A;  3QJ6 A;  3PMI A;  4NL3 A;  1EX4 A;  3RMQ A;  4C8Q D;  1N8R U;  2KGT A;  1X27 A;  4JZ4 A;  1LNX A;  5GAO p;  2V26 A;  3VYG A;  3SD4 A;  2HZY A;  2JNG A;  1V1C A;  3MO8 A;  5KYY B;  2WSF E;  1Y57 A;  1ZUK A;  2EFI A;  3URG A;  4X9C A;  1Y96 B;  3UF4 A;  1R0B G;  2DF6 A;  1V76 A;  3QDF A;  1WIE A;  3P8B B;  5D6X A;  1I07 A;  4GBQ A;  2QK0 A;  5IXF A;  4JS5 A;  1H92 A;  1FXX A;  1G2B A;  1R77 A;  3DB4 A;  2F1L A;  3NHN A;  2VVK A;  3G7Z A;  4ZGE B;  4FM4 B;  1Q82 R;  3VS1 A;  1M1K R;  2HDA A;  1VIF A;  4F7U A;  2OAU A;  1RAA B;  3H9N A;  2WSC E;  2A08 A;  3FJP A;  1S1N A;  3QKJ A;  2LQK A;  4M7D D;  3OSS C;  1VQ7 T;  1NPR A;  3LW5 E;  3JCM d;  3CCJ T;  3L1A A;  2DK3 A;  1OU8 A;  3OYM A;  2RPN A;  4AG1 C;  2X4X A;  1NEB A;  2HBW A;  3NGP A;  1FWZ A;  2YRD A;  4ZTF A;  4ESR A;  2DEQ A;  3CC4 A;  4JRP A;  4IUR A;  2FRY A;  4X34 A;  2P4R A;  3TCJ A;  3PFS A;  1I8F A;  5KYX A;  1N8R C;  1Y71 A;  2YHT A;  3JCM e;  2AZS A;  4MDX A;  3OS2 A;  2DYB A;  2LC4 A;  2P0K A;  4C8Q G;  1QWE A;  1YJW Q;  1TTH B;  4L59 A;  4MDW A;  5GAN 5;  3RKW A;  2ATC B;  2CZ1 B;  4J7I A;  3EG9 B;  4M75 G;  4N4I A;  2DNU A;  2CUB A;  4C8Q E;  3VV0 A;  4PK4 A;  4RMO A;  2DFU A;  2SEM A;  1EFN A;  1WNL A;  2M51 A;  1Q7Y U;  1YI2 Q;  2DZC A;  5IXB A;  3MEU A;  2VUB A;  1SHF A;  1UGP B;  3SWN B;  2NUT B;  2VB6 A;  5GAN f;  5GAM g;  1M2V A;  2EVR A;  4ELZ C;  2CH4 A;  3KBG A;  3I35 A;  4KGZ B;  1VQO T;  1VQP Q;  2NUT A;  2L3Q A;  2M1H A;  3X25 B;  2FZG B;  1X6B A;  2ENM A;  2E1H A;  4UC4 A;  4XTW A;  2EYY A;  5GAM f;  3V7S A;  1QVF A;  1OV3 A;  3CQT A;  2JJ9 A;  1WXU A;  1U8R A;  1E7O A;  1IZ6 A;  1M1G A;  3CCU T;  1ZSZ A;  2RHU A;  1M27 C;  2E65 A;  4QQD A;  5FW9 A;  2LT4 A;  3RMS A;  4C92 F;  2NUP A;  2V1R A;  5CQY A;  5D7U A;  1WA7 A;  2J6F A;  2MI6 A;  4JUV A;  2VYT A;  2GFA A;  1K4U S;  1AHJ B;  5IH2 A;  5GMK l;  1VOM A;  1YNZ A;  4OMM A;  3QSU A;  3OQ5 A;  1MV3 A;  2PVO B;  3PIO A;  1KQS S;  2GGR A;  4EIK A;  3OB9 A;  2QAZ A;  4PJJ A;  2F5T X;  1JXO A;  1AZE A;  1UEC A;  2RK1 A;  3S3N A;  1RAB B;  2ZPI B;  1MNE A;  3JCM c;  1BI3 A;  4R56 A;  5DLO A;  4C92 D;  3MEW A;  3EFO B;  2LJ0 A;  1TS9 A;  4CRI A;  2FZC B;  3CXC A;  1D3B B;  2DX1 A;  2AHJ B;  3WVD B;  3PVL A;  4C0D B;  2CYZ B;  3G6E Q;  2LJ3 A;  4E7S A;  5KH6 A;  1Q82 C;  3CCR Q;  2FEI A;  1Q82 U;  4LN2 A;  3CMA Q;  2IPO B;  1WGS A;  1VQN Q;  1KQS A;  2DD4 A;  3PGG A;  4C92 E;  3G4S A;  1I5O B;  5LJ3 g;  2DIQ A;  2HKN A;  2DRM A;  4GY5 A;  4NOY A;  3UT1 A;  2L3S A;  2ZAE A;  1I5L A;  2LJ1 A;  4RCB A;  2QGG A;  4M75 B;  3VS7 A;  1R0C B;  1K9M R;  1ZLM A;  3I56 T;  3CBO A;  4JJB A;  4C8Q A;  1VQ7 A;  2K3B A;  3J7A F;  2FRW A;  2DZ9 A;  3QJY A;  2CP5 A;  2XID A;  3IQL A;  5CVI A;  1N8R R;  2CGH A;  3JB9 I;  4DBQ A;  4FT4 A;  1NJI U;  1BCO A;  3CCJ Q;  1AZG B;  3LWI A;  1YJN A;  3JV3 A;  1BI2 A;  2NYS A;  1SPK A;  1ZBX A;  5EG2 A;  1QCN A;  3NMZ C;  1BB9 A;  4RTY A;  3CCU A;  4ZGJ B;  4OMP A;  1WPY A;  4F7U F;  1ZQ1 A;  2EJ9 A;  3CCE T;  1KHI A;  4E7K A;  1VQN A;  3R6N A;  1SRL A;  3CMA A;  3CC4 Q;  3VS2 A;  2Y4X A;  2XK0 A;  3BW1 A;  2PVD B;  4C92 G;  1S72 Q;  3CPW P;  4PNO A;  2MWP A;  3OW2 S;  4E7L A;  4PFO A;  1GCQ A;  4M77 F;  8AT1 B;  3DLL A;  1M90 R;  3QG1 A;  2K79 A;  1YHQ Q;  3NTK A;  1X43 A;  1YHQ T;  4C8Q C;  1GRI A;  2O01 E;  3L2Z A;  4N4H A;  1VUB A;  1AOJ A;  2K57 A;  5LJ5 d;  1WXB A;  3M5A A;  3UPU A;  1NYG A;  1G8X A;  3ZFJ A;  1ACM B;  3O5Z A;  2WSE E;  3VS3 A;  1M8M A;  5FLX E;  1S72 T;  4E47 A;  5DM7 R;  2VAS A;  5ECA A;  3CXC P;  2DER A;  3DB3 A;  3CCS A;  3JCM b;  1RLP C;  5IHK A;  4RTW A;  4M7D G;  1C6V X;  1I1J A;  1QCO A;  4OB2 B;  4M77 D;  1NBE B;  3X20 B;  2L8D A;  2JXB A;  4HT9 A;  3E2U A;  3LH5 A;  1Q81 U;  1YCY A;  2YUN A;  4M7A D;  1VQ5 T;  2ZGW A;  3TEE A;  2EGA A;  4DBR A;  3RES A;  3MJX A;  3OMC A;  5LL6 S;  3MKD A;  3RUX A;  5KYU B;  2EQK A;  1VYU A;  2R58 A;  2RHY A;  3I5S A;  3PT9 A;  4PKC C;  2ROT A;  1PC0 A;  1D0Y A;  2JW4 A;  3M4Y A;  1G83 A;  1N9S A;  3BDL A;  2DJQ A;  1UB4 A;  1GCQ C;  3I56 A;  1D09 B;  2BZY A;  3VRY A;  3H0F A;  3NTI A;  2LTO A;  1Z9Q A;  2CKK A;  3HFN A;  3HKS A;  5LJ3 h;  4LDU A;  1QMC A;  4FCY A;  2E6Z A;  1D1B A;  3G4S T;  4M7A F;  1XTD A;  4QW2 A;  1ARK A;  1V29 B;  4DBF A;  1R8O B;  3OW2 P;  1T3L A;  1HXD A;  5GAO r;  1MND A;  2F69 A;  3LWH A;  1YIT T;  1PWT A;  1K8A C;  1W6X A;  1WYX A;  2GBQ A;  2L2P A;  4J9C A;  4J5Y A;  2QTX A;  4RG2 A;  3A8L B;  1UFF A;  4J83 A;  1YWP A;  3GF5 A;  3CME Q;  1OU9 A;  2DBK A;  2QGF B;  2RMO A;  3ER0 A;  1YIJ T;  5GAM h;  1ZSG A;  4GLM A;  4JZ3 A;  2QG9 B;  4M77 G;  2F2W A;  4C5I A;  2J05 A;  2VV5 A;  1OX8 A;  3OYN A;  1YHQ A;  3JCM V;  1PM3 A;  2X51 A;  3QWX X;  1X2K A;  3CCE A;  3LX7 A;  3X28 B;  4KBM B;  1VQM A;  3F70 A;  4BB7 A;  4RTV A;  5J39 A;  3G71 A;  2RH2 A;  3SFM A;  2JM8 A;  2FG0 A;  1Z9Z A;  3J81 E;  3PTA A;  5IN1 A;  3CCE Q;  3HFO A;  2GFU A;  1VA7 A;  2RO0 A;  2QA4 T;  4J9B A;  2FPD A;  1KIK A;  1MUZ A;  1CKA A;  3C94 A;  2AZV A;  3E9F A;  5GAM e;  2RN8 A;  4HKE A;  3ULR B;  5FU7 B;  5GMK m;  3OYA A;  2K3Y A;  2MK5 A;  2FYK A;  2BIV A;  3M4G A;  2Y90 A;  3QPH A;  3HRT A;  3GNF B;  1Q81 C;  3C95 A;  5GAN 7;  1CKB A;  1JU5 C;  4N4G A;  4ANJ A;  2DJZ A;  4KGX B;  5HK0 A;  3E9G A;  1QVF S;  4F7U E;  3EG0 A;  3CCV A;  5J3B A;  4AFQ C;  3CPW A;  1H8K A;  1PHT A;  3QYG B;  1WFW A;  3JCM f;  4Q5W A;  3L2V A;  1FX7 A;  3EGX A;  1MHN A;  2RHI A;  2ED0 A;  2L0A A;  2RA2 A;  3I9Q A;  1RUW A;  3MEV A;  3M56 A;  4A4E A;  1MMG A;  1KQS P;  1YIJ Q;  2O2O A;  4E7Z A;  4M7A G;  1OEB A;  1XOV A;  2DE0 X;  3V7R A;  2HCK A;  1C0M A;  1UGQ B;  1UE9 A;  4EMK C;  5KYW A;  2XD0 A;  1M4Z A;  3FDR A;  1NG2 A;  3GIB A;  4NS5 A;  3M54 A;  1QP2 A;  2DM1 A;  2M0Y A;  1JJ2 P;  5CR2 A;  4HCB A;  4QKU A;  4M78 D;  3OS1 A;  3JB9 H;  1NLO C;  4PJO F;  4Z88 A;  5KYN A;  2RJC A;  2K7A A;  2PZ1 A;  3EH1 A;  3GP8 A;  2JS2 A;  5A2Q E;  5LJ5 f;  4CI0 C;  2GTJ A;  1Q86 R;  1M90 C;  3I55 Q;  3QZ5 B;  3CCS Q;  4DA4 A;  4J9E A;  1UDL A;  5GAM d;  2D1X A;  4A54 A;  3PE0 A;  1BK2 A;  4HXJ A;  2JT4 A;  1B3Q A;  8ATC B;  2BE7 D;  4M78 F;  4IUV A;  5GAN 4;  1X2Q A;  2EGC A;  4PJO D;  2DKG A;  2CP6 A;  2EYZ A;  1AT1 B;  2Z0W A;  4O5V A;  1M3C A;  2AKL A;  2DXT A;  4J9D A;  1RAI B;  2O4X B;  4RTX A;  3OA6 A;  1TUC A;  4E7H A;  4EMH A;  3PMT A;  1QVF P;  1UJ0 A;  1PSF A;  4JJC A;  1LPL A;  2JTF A;  5AYF A;  4BE0 A;  4JPB W;  2QEX A;  1VQ8 T;  2EAY A;  1WI7 A;  2B8A A;  2RI2 A;  5J26 A;  5KYU A;  3HL8 A;  3P8D A;  5CIU A;  2K5I A;  3SB2 A;  1M8V A;  2O9S A;  3CCV T;  5HKC A;  4M78 E;  2QA4 A;  2XDB A;  2D8H A;  3D7S B;  4AG2 C;  1VQN T;  2VXE A;  1YN8 A;  1VQK A;  3PIP A;  2RHX A;  1D0X A;  4BI3 A;  1YJN T;  3OYD A;  5FRN A;  1IRX A;  2ZPH B;  3M9Q A;  3QZ9 B;  4N0A C;  1YJN Q;  1FYN A;  1XJW B;  4JRK A;  2NWM A;  2EQI A;  1RI9 A;  1SSH A;  1JO8 A;  4HCC A;  2OAW A;  4OML A;  2D9T A;  3MPU B;  1VQ9 A;  4OMF B;  2NUP B;  4FSS A;  4PFZ A;  1WHL A;  2OTL Q;  2M9U A;  4JJD A;  3UA6 A;  1H64 1;  3CC4 T;  2BE9 B;  2JVV A;  1MMN A;  4JLG A;  3MCA B;  1OZ2 A;  1VYV A;  2X3X D;  4WTO B;  3CCL Q;  2A37 A;  1SRM A;  5D6W A;  4BDZ A;  2QQ9 A;  3CC2 T;  3FEO A;  2BZX A;  4F14 A;  5CCA A;  3G4S Q;  2R57 A;  4PJO G;  4IKF A;  4D8D A;  1U5S A;  3M57 A;  2EPD A;  2KRN A;  4XAX B;  4R55 A;  1UTI A;  3TU4 K;  3FIF A;  1AVZ C;  3OYC A;  3R6O A;  3GPL A;  3INZ A;  3HRU A;  4GLK A;  1BI1 A;  1JXM A;  2SRC A;  4DBH A;  1VQ6 Q;  1NZ9 A;  3MP1 A;  1PD0 A;  3QHS A;  1BIB A;  1QKW A;  3UDC A;  1JEG A;  1TXQ A;  2DYI A;  1RLQ C;  2EQU A;  2W0Z A;  4N0A A;  1UGV A;  3CPW S;  2ED1 A;  2LCC A;  3FRN A;  1GCP A;  1K73 U;  2BTT A;  4RUG A;  1H3H A;  4KH1 B;  4C92 C;  3CC2 Q;  1G3Y A;  4C92 A;  4BDY A;  1OOT A;  3CD6 Q;  2MPX C;  3M0Q A;  3P8H A;  4J7F A;  4PJM A;  2KK4 A;  4O6J A;  4MMK A;  4L6V 5;  4HT8 A;  2E5K A;  1QQJ A;  2QYZ A;  4LNP A;  1FMK A;  1KD1 U;  4CC3 A;  1TH7 A;  1GBR A;  4BY6 C;  1NE8 A;  1QWF A;  1X01 A;  2O88 A;  4Y28 E;  4M7D F;  3KXT A;  1W2B A;  4BE2 A;  2DL3 A;  2E12 A;  2DBM A;  1K8A U;  2JTE A;  3M0P A;  2KMT A;  2VGM A;  1JJ2 A;  1VQ9 Q;  3CCJ A;  4C5E A;  2KSS A;  2EJF A;  2L5Q A;  1YJW T;  2C0O A;  3C0C A;  3DLM A;  3QO3 A;  4XTU A;  2J06 A;  1YJ9 T;  1WHK A;  4Y91 A;  5I2S A;  2YUP A;  4JDS A;  3JB9 J;  2RM4 A;  2DLP A;  4QVC A;  4OMN A;  2CDT A;  3HP9 A;  3JCM J;  1KSW A;  5A0D A;  2RJF A;  1HD3 A;  2ZCF B;  3TRE A;  3QXE B;  3JCM X;  4MZP A;  2K6D A;  4ZGD B;  2VXF A;  3U23 A;  2P0P A;  5GAM j;  1KFZ A;  1NLP C;  2E6N A;  2RNA A;  3G71 T;  4OB3 B;  3M0R A;  4KGV B;  3VU3 C;  1KD1 C;  3L2Q A;  3VS5 A;  2PNI A;  3BFM A;  3E1S A;  6AT1 B;  5KYY A;  3CCR A;  2RHZ A;  1K9M U;  2DRK A;  1KQ1 A;  1NEG A;  2LX7 A;  4CC4 B;  4J6Y A;  2HAX A;  2D0N A;  2JN0 A;  2KYB A;  4F16 A;  1YJW A;  2HBP A;  3GBQ A;  1VQ5 Q;  2DXC A;  3CCM A;  5L23 A;  3EFO A;  1D1C A;  2JS0 A;  3NTH A;  1SG5 A;  5I22 A;  2CZ7 B;  4A4H A;  1IGQ A;  1M3B A;  3HSB A;  2MYS A;  5HCK A;  1QLY A;  1RL2 A;  2FB7 A;  2KRS A;  3JCM g;  1ZX6 A;  1K1Z A;  4PJO A;  2RJE A;  3REB B;  3WXM B;  1D1A A;  3JB9 F;  4FSX A;  2KR3 A;  4AMC A;  3OYF A;  2ZPG B;  2ZPB B;  5GJW B;  1RAF B;  4DOW A;  2LQN A;  2QDY B;  2EWN A;  2A7Y A;  2JUF A;  3MET A;  2HEQ A;  1TUD A;  3EAE A;  2IVW A;  3QBY A;  2LVM A;  1D0Z A;  5IT9 E;  3S3O A;  3QDR B;  2XI9 A;  5CAI A;  4CC7 A;  3FB9 A;  3RER A;  2CZ6 B;  2BKD N;  2DPP B;  4F7U B;  4AFS C;  4RTZ A;  4FU6 A;  3ZEH A;  3O8V A;  2KAF A;  2ECZ A;  1VYT A;  3FC3 A;  4A4K A;  1BCM A;  2DXU A;  2CSI A;  2MF2 A;  4Z89 A;  2DVJ A;  4EPC A;  4PLL A;  5LJ5 e;  4JJN K;  3NFC A;  4C0G A;  1IRE B;  4XU3 A;  2LP5 A;  4PJO C;  1YI2 A;  4IUT A;  4PJN A;  2FZK B;  1H3Z A;  5FU6 B;  5GAN 6;  5GMK i;  2KY9 A;  4YTL A;  2B86 A;  1NPP A;  1X6G A;  3OYK A;  2XKO C;  5GMK h;  3CCL A;  4EMK B;  1YFN A;  4JRI A;  2E10 A;  4E7J A;  2QXF A;  5I2M A;  1K9M C;  2V1Q A;  2EYW A;  4E6R A;  2MCN A;  1B34 B;  2PUK B;  5CKF A;  1PKT A;  2F5K A;  1UUE A;  3CMA T;  1Y96 A;  2A28 A;  4M75 D;  2DEU A;  5KYW B;  1VQ4 Q;  1M90 U;  3CCR T;  1VQM Q;  2EBP A;  1W2B S;  4AFZ C;  1BBZ A;  4Z8A A;  2XU8 A;  1VQL A;  3OYE A;  2YDL A;  3ZBD A;  4J9I A;  1EIF A;  1CSK A;  1M5Q 1;  3A8O B;  1MMD A;  2DET A;  2CT4 A;  2V8K A;  5GAO n;  4C92 B;  1AWX A;  2KDS A;  4HCK A;  4AFU C;  3EGU A;  3CME A;  3EH2 A;  2NLU A;  2E41 A;  3Q1J A;  2OTJ Q;  3H41 A;  3H0H A;  1D3B A;  1Y7X A;  3OYI A;  1UEB A;  2A3L A;  2QEX Q;  2FHD A;  2JMC A;  1YIT Q;  2LDM A;  1NJI C;  1YBY A;  5M9O A;  4DOV A;  3L42 A;  2K5L A;  3JCM h;  9ATC B;  4II1 A;  4M75 F;  2I2L A;  2YT6 A;  1Q95 G;  5GMK e;  4LD6 A;  2X9H A;  3UAT A;  1N27 A;  1K0X A;  4BD3 A;  1YWO A;  3V8K A;  1NYF A;  4M78 B;  4C0D C;  1AWJ A;  1QCF A;  3GLX A;  1VQL Q;  1LJO A;  2V8J A;  5CKD A;  5D6Y A;  3QYH B;  5DLQ E;  5LJ5 j;  5EC7 A;  4RCC A;  3I56 Q;  5CK9 A;  3CBP A;  2NUZ A;  4MZM A;  1B7T A;  2LNV A; 
#chains in the Genus database with same CATH homology
 1YNZ A;  4JPB W;  4OMM A;  1MV3 A;  1J3T A;  3UA7 A;  1WI7 A;  1AD5 A;  1WDX A;  2GGR A;  2GQI A;  4EIK A;  2KRM A;  1JXO A;  2O9S A;  4LE9 A;  4OMQ A;  1AZE A;  1UEC A;  2D8H A;  1N5Z A;  2D8J A;  4AG2 C;  4IIM A;  1UHF A;  1YN8 A;  2JM9 A;  3A98 A;  3EHR A;  2JMA A;  1UHC A;  5GJV B;  2LJ0 A;  2VWF A;  2DX1 A;  4DEX A;  4J9H A;  2C0T A;  3FJ5 A;  3PVL A;  1FYN A;  4HVV A;  2NWM A;  2LJ3 A;  4OMO A;  1WLP B;  2EQI A;  1RI9 A;  1SSH A;  1JO8 A;  2FEI A;  3M0S A;  3EHQ A;  2OAW A;  2OJ2 A;  4LN2 A;  4OML A;  3RNJ A;  3VS0 A;  1QKX A;  4FSS A;  1WX6 A;  2CH4 W;  4JJD A;  3UA6 A;  1PRL C;  2J6O A;  1E6G A;  2DRM A;  2CUD A;  4RTU A;  3QWY A;  3TSZ A;  3VRZ A;  1IO6 A;  3RBB B;  1VYV A;  2X3X D;  2L3S A;  2LJ1 A;  2A37 A;  4RTT A;  1X69 A;  4D8K A;  1SRM A;  2FPF A;  3M0T A;  3VS7 A;  1T3S A;  1W1F A;  2BZX A;  4F14 A;  2F2X A;  1ZLM A;  2LQW A;  4D8D A;  1U5S A;  4JJB A;  2K3B A;  2LCS A;  2EPD A;  2FRW A;  2KRN A;  1UTI A;  3IQL A;  2EW3 A;  1AVZ C;  4LUD A;  1HJD A;  1AZG B;  3JV3 A;  3VS4 A;  2KT1 A;  5FWC A;  1SPK A;  2EYX A;  4WCI A;  1U06 A;  1JXM A;  1WXT A;  2SRC A;  3NMZ C;  2G6F X;  1TG0 A;  2ESW A;  1BB9 A;  1QKW A;  4RTY A;  4A63 B;  1JEG A;  1RLQ C;  2W0Z A;  1UGV A;  2ED1 A;  2LNH B;  2LZ6 B;  4OMP A;  1GCP A;  1GFD A;  2BTT A;  2KT8 A;  4RUG A;  2DL7 A;  2DL8 A;  4IIO A;  4QT7 A;  5FWB A;  1H3H A;  1KJW A;  2IIM A;  1OOT A;  1T0J A;  3M0Q A;  3R6N A;  1SRL A;  2QDL A;  2KXD A;  3VS2 A;  1ABO A;  1ZUU A;  2XMF A;  2E5K A;  4LNP A;  1PRM C;  1FMK A;  4CC3 A;  2ABL A;  1GBR A;  2K2M A;  1QWF A;  2L3P A;  2O88 A;  1GCQ A;  1LCK A;  2DL3 A;  2I0N A;  2W10 A;  2K79 A;  2DBM A;  2JTE A;  3M0P A;  1X43 A;  4Y92 A;  1GRI A;  5IHI A;  2X3W D;  1AOJ A;  2BZ8 A;  1WXB A;  2C0O A;  2DMO A;  3C0C A;  1NYG A;  2J06 A;  3O5Z A;  4DEY A;  3VS3 A;  1M8M A;  2YUP A;  4J9F A;  5ECA A;  2DA9 A;  5IHN A;  2DLP A;  4OMN A;  2CDT A;  1RLP C;  2C0I A;  4LUE A;  5IHK A;  2KEA A;  3M0U A;  4RTW A;  1GL5 A;  1PNJ A;  1KSW A;  1I1J A;  1HD3 A;  2H8H A;  1UJY A;  2K6D A;  3U23 A;  3EG1 A;  2JXB A;  1KFZ A;  1NLP C;  2RNA A;  3LH5 A;  2YUN A;  2ROL A;  3M0R A;  2KXC A;  2K9G A;  2RQW A;  2EGA A;  3VS5 A;  2DL5 A;  2MIO A;  3TSW A;  2PNI A;  4J9G A;  3I5R A;  2CSQ A;  1U3O A;  1VYU A;  4CC2 A;  3I5S A;  2DL4 A;  2O31 A;  2ROT A;  3EG3 A;  2JW4 A;  2DRK A;  1G83 A;  1NEG A;  4ZNX A;  2MOX A;  1M30 A;  3EG2 A;  2DJQ A;  1GCQ C;  2LX7 A;  3ZL7 C;  4CC4 B;  2RQV A;  2BZY A;  3VRY A;  1W70 A;  3H0F A;  2D0N A;  1YCS B;  2CRE A;  1Z9Q A;  2KYB A;  4F16 A;  2O9V A;  3GBQ A;  3SEM A;  2OI3 A;  2KRO A;  2CT3 A;  5L23 A;  2KBT A;  4M4Z A;  2JS0 A;  1AWW A;  5I22 A;  2EKH A;  1K9A A;  1ARK A;  2RF0 A;  2GNC A;  1M3B A;  1T3L A;  5HCK A;  1QLY A;  1M3A A;  1K0S A;  2KRS A;  1JQQ A;  1ZX6 A;  1K1Z A;  3REB B;  1AWO A;  1YP5 A;  1PWT A;  1W6X A;  1WYX A;  2GBQ A;  2L2P A;  2KR3 A;  4J9C A;  1T0H A;  2AKK A;  1NM7 A;  1SHG A;  5GJW B;  1HSQ A;  1OPK A;  3VS6 A;  2LQN A;  3H0I A;  2HSP A;  1UFF A;  2KE9 A;  2RQR A;  4K11 A;  1YWP A;  4HVU A;  2HEQ A;  1TUD A;  2DBK A;  1ZBJ A;  2RMO A;  1ZSG A;  4GLM A;  4JZ3 A;  4CC7 A;  2F2W A;  2KGT A;  1X27 A;  2J05 A;  4AFS C;  4JZ4 A;  3THK A;  4KRT A;  3QWX X;  4RTZ A;  1X2K A;  2ECZ A;  1V1C A;  4RTV A;  1VYT A;  1I0C A;  4R0K A;  5I11 A;  2JM8 A;  1Y57 A;  2FG0 A;  1Z9Z A;  1ZUK A;  2J7I A;  2AK5 A;  2CSI A;  3UF4 A;  2DF6 A;  4Z89 A;  1ABQ A;  1B07 A;  2DVJ A;  2KYM A;  1VA7 A;  1WIE A;  1I07 A;  4GBQ A;  5IXF A;  4J9B A;  2FPD A;  1H92 A;  1KIK A;  1MUZ A;  1CKA A;  1G2B A;  3NHN A;  2YUO A;  2VVK A;  2AZV A;  1PKS A;  2PTK A;  2LP5 A;  3VS1 A;  2HDA A;  2YUQ A;  3REA B;  2FPE A;  2RN8 A;  3ULR B;  2A08 A;  1S1N A;  2B86 A;  1X6G A;  2VKN A;  1CKB A;  1JU5 C;  1UG1 A;  2LMJ A;  2RPN A;  4AG1 C;  3EG0 A;  1A0N B;  4AFQ C;  1NEB A;  2HBW A;  1H8K A;  3NGP A;  1PHT A;  2A36 A;  1WFW A;  4ESR A;  2V1Q A;  1E6H A;  2EYW A;  2FRY A;  2P4R A;  4E6R A;  2MCN A;  1PKT A;  2L0A A;  2ED0 A;  3I9Q A;  1RUW A;  2AZS A;  1UUE A;  1SEM A;  2A28 A;  2DYB A;  2O2O A;  1ZUY A;  1QWE A;  2EBP A;  1OEB A;  1OPL A;  1XOV A;  2DE0 X;  4AFZ C;  2HCK A;  1UE9 A;  1BBZ A;  4Z8A A;  2DNU A;  2CUB A;  2YDL A;  1NG2 A;  1EFN A;  2SEM A;  1MV0 B;  2M51 A;  4J9I A;  1CSK A;  2DM1 A;  1GFC A;  2M0Y A;  2CT4 A;  3TVT A;  2KNB B;  5IXB A;  1AWX A;  1SHF A;  4HCK A;  4AFU C;  3EGU A;  4HVW A;  1NLO C;  2GTO A;  3H41 A;  3H0H A;  4Z88 A;  2EVR A;  2CH4 A;  2YSQ A;  3I35 A;  2K7A A;  2PZ1 A;  2JMC A;  2JS2 A;  2EGE A;  2L3Q A;  2J6K A;  3KFV A;  4ORZ A;  3SHW A;  2YT6 A;  2GTJ A;  1AEY A;  1X6B A;  2F2V A;  2ENM A;  3UAT A;  2EYY A;  2FO0 A;  2RQU A;  1UDL A;  4J9E A;  1K0X A;  1YWO A;  3PVQ A;  1OV3 A;  2D1X A;  2RQT A;  1NYF A;  2DIL A;  3CQT A;  3PE0 A;  4X1V A;  1WXU A;  1BK2 A;  1E7O A;  4HXJ A;  2JT4 A;  1B3Q A;  1BU1 A;  1AWJ A;  1QCF A;  1M27 C;  4F17 A;  5FW9 A;  1X2Q A;  2EGC A;  3NPF A;  2EYZ A;  1GBQ A;  1K76 A;  1Y0M A;  2V1R A;  1M3C A;  2AKL A;  4J9D A;  1WA7 A;  2J6F A;  5EC7 A;  4RTX A;  1TUC A;  1UJ0 A;  2NUZ A;  4JJC A;  1K4U S;  5IH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...