4GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4gbqA00
1KSWA 2RMOA 3KFVA 3O5ZA 1X2QA 2L2PA 2L0AA 2DVJA 2RQTA 1UFFA 3NMZC 2ABLA 2DL7A 1AZEA 3REBB 2EW3A 1W1FA 4IIOA 2DF6A 3VS3A 1K4US 2JS0A 1WXBA 4AG2C 2V1QA 1LCKA 2YUOA 4FSSA 2KRNA 2VWFA 1SPKA 2RN8A 4D8KA 2OJ2A 2YUPA 1PHTA 2JMAA 1W70A 3I5SA 4OMLA 2YUNA 4RTZA 2BZXA 2K2MA 3QWYA 1A0NB 2BZYA 4JZ3A 1SHFA 3SEMA 1J3TA 1M3CA 2KRMA 4AFQC 1UDLA 2DA9A 4HVVA 1VA7A 2KYBA 2AZSA 2DL4A 2KXCA 1K1ZA 1SRLA 2FEIA 4J9GA 2J7IA 1V1CA 3TSZA 1EFNA 3ULRB 2EYZA 3TSWA 1W6XA 1GL5A 2H8HA 4RUGA 4JJBA 2YUQA 1T3SA 3CQTA 2JM8A 4ESRA 2K7AA 4IIMA 4LE9A 4CC4B 2O9VA 1RUWA 5I22A 2FPEA 1OPLA 1YWPA 4HVWA 1OOTA 4J9HA 2J06A 2DBMA 4A63B 2RQWA 4GBQA 1UJYA 1U5SA 2FRYA 1M8MA 1H3HA 1MV3A 2GTJA 2FG0A 1TUDA 4JJDA 2EGEA 2NUZA 3UF4A 1SRMA 1YWOA 2X3WD 2K3BA 1U3OA 1GRIA 3LH5A 1IO6A 4HCKA 1TG0A 2DX1A 3PE0A 4OMMA 1UJ0A 2YDLA 1T3LA 2FRWA 2HBWA 2JW4A 2OAWA 1ZUYA 2CT4A 1ZSGA 1YP5A 3UATA 1MV0B 1QLYA 2LP5A 1ABOA 1AD5A 1Z9QA 2K79A 3A98A 3IQLA 4Z88A 1JO8A 1JU5C 4HXJA 1AWWA 3M0UA 1ZLMA 4RTYA 3VRYA 1KJWA 2EKHA 4LNPA 2E5KA 3M0RA 2MIOA 3UA7A 2LNHB 1JQQA 3THKA 2KYMA 1WLPB 2A08A 2LQWA 4J9IA 2RQRA 2D0NA 5ECAA 1HSQA 3VS5A 2YT6A 3FJ5A 3PVLA 1QWFA 2EYXA 1I1JA 2G6FX 1I07A 3I5RA 1XOVA 3I35A 1T0HA 1SEMA 5IXFA 2LQNA 2EGCA 4RTVA 1M3AA 1JEGA 3M0PA 4LN2A 1UUEA 4WCIA 2V1RA 2DL5A 2MOXA 2DNUA 1U06A 4X1VA 1WX6A 2DJQA 2OI3A 4LUEA 1MUZA 1PRMC 1ARKA 3M0QA 1AVZC 1HD3A 1RLPC 2CSIA 2DL3A 4QT7A 2LJ3A 1T0JA 2LMJA 4CC7A 2CSQA 2F2XA 2KT8A 1GCPA 1NG2A 2CH4W 4OMNA 2C0IA 2DLPA 2KR3A 1PWTA 1E6GA 1QKWA 2EYWA 1PKTA 2X3XD 3JV3A 5I11A 1M27C 2FPDA 2L3SA 4J9CA 2K6DA 2GGRA 1H92A 2ROLA 3M0TA 3EG0A 3ZL7C 1YCSB 2KRSA 1QCFA 2LX7A 1QKXA 2SRCA 2CDTA 1SHGA 2DYBA 3VS4A 1FMKA 2O9SA 1ZX6A 2KROA 2JT4A 2AKKA 1ZUUA 2LCSA 2KGTA 3NHNA 2L3QA 2F2VA 2JMCA 4GLMA 4AFZC 3H0FA 2C0TA 2KXDA 5FWCA 1B07A 3VS0A 1KIKA 2XMFA 2HSPA 1WIEA 4Z8AA 1K0XA 4JPBW 4J9BA 2D8HA 2DMOA 3REAB 2ED1A 4OMPA 5IH2A 1AWXA 3EG2A 4OMOA 2KE9A 3QWXX 2DRMA 4J9EA 3VS2A 1GBQA 1NYFA 3H0IA 1UE9A 3C0CA 2FPFA 1GFCA 1VYTA 1AWOA 2RF0A 4EIKA 4R0KA 1AWJA 1S1NA 2HDAA 2PNIA 5IHNA 1G83A 2GBQA 3SHWA 2ED0A 1UG1A 1PKSA 2LJ0A 1CSKA 2DE0X 2QDLA 2JTEA 2JM9A 4AFUC 2EQIA 2M0YA 2EBPA 4CC2A 1H8KA 2O2OA 2EPDA 1RLQC 1WXTA 3EG3A 2D8JA 4ZNXA 3VS1A 1PNJA 1NLPC 2M51A 3VRZA 1NEBA 1GBRA 2RNAA 1JXMA 1X2KA 2CREA 2KT1A 4JJCA 3VS7A 2J6OA 1WI7A 1WFWA 5IHIA 1ZBJA 2JS2A 1M3BA 2PTKA 2B86A 2ECZA 2EYYA 4K11A 2RPNA 4E6RA 2DILA 4AG1C 5HCKA 5EC7A 1BU1A 2YSQA 2CUBA 2A28A 2HEQA 2RQUA 3EGUA 2F2WA 1E6HA 2AKLA 1CKBA 1UHFA 1X27A 4F14A 4D8DA 4F17A 1CKAA 2DBKA 3H0HA 4RTWA 1B3QA 2DM1A 2CT3A 1OEBA 4ORZA 2D1XA 5GJWB 2LJ1A 1UGVA 2O31A 1TUCA 1X69A 3NPFA 2MCNA 1BBZA 1E7OA 1M30A 2NWMA 1HJDA 1ZUKA 1WYXA 1X43A 4Y92A 2EVRA 3R6NA 5L23A 4KRTA 2P4RA 1QWEA 4M4ZA 4AFSC 2SEMA 4Z89A 3I9QA 2HCKA 2PZ1A 1NLOC 4LUDA 1AEYA 1OV3A 4J9DA 1FYNA 4HVUA 3UA6A 2GTOA 4F16A 1N5ZA 2FO0A 1VYVA 2LZ6B 2KBTA 3EHQA 2CUDA 5FWBA 2IIMA 4DEXA 1Y57A 2ESWA 1JXOA 1OPKA 1BK2A 1Y0MA 4RTTA 2BTTA 4JZ4A 4J9FA 1K76A 2DL8A 4CC3A 2AZVA 1VYUA 2J05A 3U23A 3M0SA 2J6KA 1YNZA 3GBQA 4DEYA 2ENMA 1G2BA 1RI9A 2J6FA 1WA7A 1UTIA 1SSHA 3H41A 1X6GA 3RBBB 2GQIA 3EHRA 1YN8A 1NYGA 1ABQA 1NEGA 3NGPA 1WDXA 4RTUA 2BZ8A 1WXUA 1PRLC 1BB9A 1I0CA 5IHKA 2A37A 1UHCA 3TVTA 2EGAA 5IXBA 2W0ZA 3EG1A 1X6BA 2VVKA 2GNCA 2I0NA 2L3PA 2A36A 4RTXA 2ROTA 1AOJA 1K9AA 2KEAA 5FW9A 3RNJA 2JXBA 2O88A 1NM7A 2KNBB 1GFDA 2AK5A 4OMQA 3PVQA 1AZGB 1K0SA 3VS6A 2C0OA 5GJVB 2RQVA 1KFZA 1GCQC 2DRKA 2VKNA 1GCQA 2CH4A 1UECA 1Z9ZA 2K9GA 2W10A
chains in the Genus database with same CATH superfamily
1XTDA 4KGZB 3GNGA 5HK3A 1UGSB 1IREB 2DVJA 3I55Q 4KT0E 3DLMA 3NMZC 5J3BA 2QQSA 2LVMA 3REBB 3MKDA 3EAEA 1Q7YC 2DIQA 2DF6A 1K4US 4M7AG 2HKNA 2HAXA 2V1QA 1TSFA 2KRNA 2VWFA 4D8KA 4IKFA 1D3BB 3CPFA 4RCCA 1PHTA 1QP2A 2JMAA 2QTVA 1JJ2S 4X34A 3JB9G 4M7AA 3JCMd 2LQKA 1M3CA 1UDLA 2KYBA 3E2UA 3OYYA 1HYOA 2KI7A 1YJWQ 2MF2A 1W2BP 2X4JA 2FEIA 2QK0A 2RA2A 5KYWB 1U8RA 1V1CA 3TSZA 3JAME 1D1BA 1IB8A 4Q5WA 1OX9A 2EYZA 1I5OB 2DXCA 4OB2B 4RUGA 2E6NA 5CO7A 3CCST 5LJ3f 2YUQA 3QZ9B 1EZZB 4ESRA 3N5BB 4EMKC 3SFMA 2O9VA 4NL2A 4F7UE 1K8AR 1OZ2A 3G71A 1VQOQ 4HVWA 4J9HA 3CBOA 3QJYA 2J06A 2RB6A 1C6VX 2RQWA 4RMOA 2NUPA 1AHJB 1YIJA 1U5SA 4C92F 3MEUA 3OS0A 2P4TA 1TUDA 2WSCE 4XAXB 1YWOA 2X3WD 2K3BA 1VQ8T 1KHCA 2RHXA 3BW1A 3CBMA 1TG0A 3FC3A 5DM7R 4DBFA 1LOJA 3QYHB 1VQ4A 2KK4A 4E7KA 3G1JA 2CT4A 1ZSGA 3EFSA 1MV0B 4HKEA 2LP5A 2COYA 1VOMA 1X6OA 2BKDN 2JVVA 4M7DE 1XQHA 4HXJA 2FZKB 4RTYA 3GP8A 4OMFB 2M02A 1R0CB 2YWWA 1JQQA 4DBHA 2KYMA 3V8KA 1KQSS 2A08A 1MMNA 3GF5A 3CCMQ 5ECAA 1HSQA 1QVGS 1D09B 1QQJA 3VS5A 2X51A 3FJ5A 2ZPHB 3MP1A 1OX8A 5AYFA 2G6FX 5GANg 1I07A 2DYIA 4LDWA 1QVFP 2YRVA 3M0PA 4ZN1A 2DL5A 3UT1A 1QMCA 2MOXA 3P8DA 2FYKA 4X1VA 3CXCS 1H641 2OI3A 2E41A 4BE2A 1AVZC 1HD3A 2CSIA 2DL3A 2YRDA 4QT7A 2DXUA 1VQNA 1G3WA 3AHUA 2X4XA 3CC2Q 3L42A 4OMNA 2KR3A 5CKHA 2XKOC 1WHMA 3QXEB 4RKUE 2QQBA 4M78B 4XU1A 2ZPFB 4EMGA 3I55T 2XIDA 2LQ8A 4J9CA 5LL6S 1VQPQ 3M0TA 3EG0A 4R56A 3SWNB 1QKXA 2SRCA 2CDTA 2DYBA 1FMKA 1RAAB 1ZX6A 2KROA 3OSSC 2JT4A 3AT1B 5LJ5g 2OTJQ 2PUOB 4L6V5 3CCQA 4GLMA 3H0FA 3VS0A 3A8LB 4PJOB 3S6WA 1VQ7A 2XMFA 5GAN5 5KCOA 4J9BA 2D8HA 2EJGA 2K4YA 2OX7A 3REAB 2YXYA 2KY9A 1AWXA 1BI3A 1YJWT 2KE9A 4PFPA 2LNVA 4C92G 2OAUA 2DVEA 5FLXE 4MDWA 2QQRA 1O75A 4F7UF 2PVOB 4WTOB 4BI8B 5GAN7 2ZPGB 1OQKA 1GFCA 3DKMA 4C92C 4C92A 2PNIA 5IHNA 1G83A 2GBQA 1WZOA 2HNIA 1LNXA 4AMCA 2GQVA 3A8OB 1PKSA 1CSKA 3LYIA 4A4GA 2JM9A 1UGPB 4AFUC 3SDZA 3M53A 5D6XA 1EX4A 1WHGA 1M4ZA 3M54A 3P8BB 1FX7A 2LT4A 5IT9E 1WXTA 2CKKA 3EG3A 3OYDA 1KHIA 5CKFA 3UPUA 2QA4Q 4RCBA 1GBRA 1EIFA 2O4XA 4M75E 4M7DF 4JJCA 1BI1A 2CZ1B 2J6OA 2LRQA 2YRCA 2EAYA 1M5Q1 2FHDA 2HL5C 1ZBJA 3G6EQ 4JDSA 5A0GA 2EIFA 4O6JA 2DILA 5GMKj 2CP0A 5GAMe 3HRSA 3QZ5B 2M9UA 3CC7T 4CI0C 2HEQA 4C0GA 2QASA 3CCSA 1YBYA 4KGXB 2EQKA 4D8DA 3M56A 3CBPA 2DBKA 4RTWA 1B3QA 2VGNA 1KC8C 2HQXA 4IUTA 2CS7A 5GJWB 3CPWP 1X69A 2MCNA 1E7OA 3CCMT 2DD4A 2HSEB 5GAOp 1N8RR 2C06A 2DERA 2EYQA 1VQLA 4M4ZA 2DEQA 2X4WA 2JUFA 1Q82U 3EGXA 1YITA 1VQ8A 1OV3A 1YI2Q 2D9TA 2DEUA 2KBTA 4OP0A 1FMVA 5FWBA 2EWNA 1RADB 1Y57A 2ESWA 1OPKA 3JCMf 1Y0MA 1OI1A 2DL8A 5GAN8 4CC3A 3J7AF 3OYKA 4MZMA 1BKBA 3X26B 3CMEQ 2J6KA 2CP7A 3CCVA 3UDCA 1G2BA 3H41A 4LD6A 1X6GA 3NTKA 2GQIA 1ABQA 2A7YA 1NE8A 1I0CA 1VQPT 5L8RE 3A5ZB 5GANd 5KYXA 3OBYA 4HT8A 2EGAA 3OYCA 4F7UG 1WHKA 5IXBA 3EG1A 4BUGA 4C8QB 1WHHA 2ROTA 2E1HA 3V7RA 3RESA 3HP9A 1JB0E 4X9CA 4F7UA 2JXBA 2O88A 4M7AD 1NM7A 2KNBB 3M9QA 5FROA 1GFDA 1R77A 2DTOA 2CP2A 4A53A 4PLIA 3FLGA 1K0SA 4XTUA 2WSFE 1M8VA 4PFOA 3X20B 2AIRB 3FRNA 1GCQC 2DRKA 4BI4A 4NS5A 1GCQA 1HXDA 2CH4A 3E1SA 1OYXA 1MNDA 3JCMW 1KSWA 2RMOA 4M7DG 1OULA 2MMPA 1X2QA 4II1A 3KUFA 2L0AA 1UFFA 3X28B 1VQKT 4M7AF 2P0PA 3S3MA 2DD5A 1AZEA 1QVFA 5I2SA 3QKJA 4IIOA 4M7DC 1Q95G 1JJ2P 4M7DA 5LJ5d 1ZSZA 4M75F 1M9SA 1WXBA 4CRIA 4JRIA 5DLQE 1M90U 4HA8A 3UWNA 2E3IA 5LJ5e 4OMLA 2QA4T 2YUNA 3LW5E 3QWYA 2BZYA 1SHFA 1J3TA 1I8FA 4A4EA 3HSBA 4HVVA 1YJWA 2AZSA 2VC8A 1WJRA 3S3OA 2H3JA 1K8AC 3G6ET 2BUDA 4M78E 1EFNA 4E7IA 1G3TA 4FIBA 3J80E 3FIFA 1HK9A 2K57A 2EQMA 3TCJA 2QAZA 3TSWA 1C0MA 1PCXA 1BYMA 5D7UA 4IUUA 3CQTA 2K7AA 2A3LA 2CZ0B 4IIMA 4CC4B 1C1AA 4NOYA 3JCMb 2FPEA 1VQOA 5FU7B 3PT9A 3CCEA 2DETA 3OYGA 2ZPIB 3QSUA 4PFZA 5AT1B 4GBQA 1UJYA 1M2VA 3CCJA 3EFOB 3VYGA 5LJ3j 4P5NA 1SKUB 4KH1B 4JLIA 4PNOA 2EGEA 3UF4A 1SRMA 3HFOA 1YI2T 1U3OA 3LH5A 4HCKA 3NTIA 2DX1A 2E4HA 2IG0A 3PE0A 3SB2A 4OMMA 3M55A 4JJNK 2DXBA 2I2LA 5KYYA 4ZGDB 1ZUYA 3JCMQ 3JCMV 1BCOA 2EKOA 1AD5A 1Z9QA 1KQSP 2M0OA 3OYMA 1ZLMA 3HPWA 2XG8D 1KJWA 4LNPA 2E5KA 2ZZDA 4C0FA 3UA7A 2LNHB 2IVWA 1YHQQ 1SSFA 2CGHA 3CCMA 2LQWA 4J9IA 3E19A 3M5AA 3CXCP 3JCMJ 1ZQ1A 3EFRA 3I5RA 4J8OA 5GAOr 3I35A 1D0YA 1T0HA 5GAOl 2EGCA 1M1KU 4RTVA 1M3AA 1JEGA 4MDXA 1UUEA 1XJWB 2DKGA 4XTYA 3RR6A 2RM4A 2DJQA 4FSXA 4Y91A 1ARKA 1VUBA 3M0QA 1RAGB 4M75G 4M7AC 5J26A 1RAFB 2XI9A 2LJ3A 1T0JA 3RMSA 3RKXA 5FRMA 3CC2A 4IUQA 5GAMh 3RERA 2KT8A 2AT1B 4M75C 4EMKB 5GAMg 1NG2A 4M75A 1RAEB 3CPWA 2E64A 1E6GA 1PKTA 3JV3A 5I11A 2E6ZA 2NUPB 1Q86U 2L3SA 1VQ6Q 1H92A 1OZ3A 1OU8A 4HCZA 2ROLA 4PK4A 4C92D 2LX7A 8AT1B 3JRZA 5GMKm 3VS4A 1LPLA 2OTJA 4VUBA 4XTVA 3GNFB 2JMCA 4FU6A 1UB4A 4M77E 1D3BA 2WSEE 4QVZA 4LDXA 4C5IA 2Z0WA 1K0XA 3PMIA 4N4HA 2DMOA 2VGMA 1W4SA 4OMPA 5IH2A 3PNWC 1RL2A 4BDZA 1GXIE 1Q82R 4XQ3A 3QWXX 4J9EA 5I2MA 4A4FA 3H0IA 4NL3A 1UE9A 2M1HA 3JCMP 5CIUA 2QQAA 2RF0A 3LGLA 4C5HA 2HDAA 3CC7Q 2ED0A 1FWZA 5CQXA 4C8QE 4BY6C 2V26A 2DE0X 5M9OA 2RJEA 5HKCA 3CMAQ 4V2SA 2MPXC 1H8KA 2O2OA 3VKIA 5GAOn 2D8JA 5GANf 1I5LA 3RMQA 2E65A 4ZNXA 1UGRB 2DTIA 1RI0A 1PNJA 2QA4A 5C0MA 5GANh 1WQ7A 2LDMA 2RNAA 1JXMA 1X2KA 2CREA 1BCMA 1VQ5Q 2PVDB 3OS2A 1M1FA 3MEWA 3CD6T 1WI7A 3URGA 5IHIA 2QTXA 3ZEHA 4E47A 1M3BA 1LVKA 1AT1B 2B86A 3ZBDA 4HT9A 4E6RA 1N8RC 3L2WA 1YJNT 4E7ZA 5HCKA 2NLUA 1BU1A 1PD1A 2A28A 2RQUA 2AKLA 1CKBA 1UHFA 4KH0B 3CCLQ 3EGDB 1JJ2A 3A1PA 4FCYA 2CT3A 1OEBA 4E7HA 2ZPBB 4ORZA 5A2QE 1YHQT 3NPFA 2NUTB 2LCLA 4JUVA 4QW2A 1M30A 2NWMA 4YTLA 2RI5A 2DFUA 3OSVA 3HRTA 4Y92A 4ZGEB 2EVRA 3R6NA 3QYGB 3WXMB 5IN1A 4UC4A 5LJ5f 2GFAA 3VV0A 1YI2A 5LJ5h 2NYSA 4J9DA 2LX9A 2DAQA 1KD1U 2FO0A 3LLRA 2MK5A 2CUDA 3L2ZA 3MCAB 1MMAA 4LD9K 1M90R 2RJFA 4RTTA 1BI0A 2E10A 4J7IA 4C92B 2RHZA 4WF2A 4KUIA 4JS5A 1W2BS 3CMEA 3PGGA 2MAMA 3U23A 3M59A 3GBQA 3CC4Q 2J6FA 1WA7A 2E5QA 2O01E 1SSHA 4TVRA 4PJNA 3KXTA 3EHRA 1YN8A 3BDLA 1NYGA 1NEGA 3NGPA 5CKDA 3I56Q 3JB9J 1WDXA 1FXXA 1VQ6T 2DK3A 3G7ZA 4M78A 5IHKA 1G5VA 4M77F 3OYAA 2A37A 4QKUA 1VQKQ 2O4XB 3BY7A 3SWNA 4M7DD 1QP3A 2MI6A 2R5AA 2I0NA 4J6XA 5DY9A 3E9GA 1Q81U 2RHUA 4RTXA 3H6ZA 8ATCB 2HQEA 1K9MU 3HL8A 1YFNA 3HHTB 4FYXB 4F04B 4XU0A 3JB9H 1KQSA 1WNLA 4BI3A 2AK5A 5GAN4 4OMQA 1AZGB 4ZTJA 5GJVB 5GAMd 1WHJA 1VQMQ 1P92A 4FT4A 1Z9ZA 2KSSA 3T9NA 1RAHB 2W10A 3CCUQ 3KFVA 2VXEA 3FEOA 1IRXA 1N27A 3OYLA 3CXCA 2DL7A 1WJQA 2BE9B 4FYVB 4E7SA 3EGXB 3ME9A 3VS3A 4AG2C 3CMAT 3HRUA 1QCNA 1BIBA 1LCKA 2YUOA 4FSSA 1Y7XA 1IGUA 3M4GA 2YUPA 2COWA 1W70A 3I5SA 2F5TX 3HTRA 1WJSA 3MEAA 1NJIU 1VQ5T 4JZ3A 3OW2S 4B6MA 2KRMA 4AFQC 2DA9A 3MPUB 1KQ2A 1VA7A 2XDPA 2E12A 2KXCA 3GPLA 1M1KR 3FB9A 1OU9A 4J9GA 5LJ3e 1I4K1 4J5YA 1W6XA 4JRKA 1GL5A 2H8HA 3CCLT 2Y4YA 4DBQA 5GMKl 1TTHB 2ZGWA 4LE9A 4JLGA 5I22A 2PU9B 5CR2A 1OPLA 1TWBA 4A4KA 3CCQQ 1SG5A 1YWPA 4F7UB 3G4SQ 3CCRQ 3V7CA 1OOTA 3BFMA 4OB0B 4A63B 1VQ7Q 2P84A 3QPHA 4PKCC 4RG2A 3BDUA 1Q86R 1MV3A 4JJDA 4FYWB 4M77G 1YCYA 1IO6A 4ELZC 1D0ZA 1UJ0A 2YDLA 1T3LA 2FRWA 3A8MB 1TH7A 2HBWA 2JW4A 4M77C 2OAWA 4XTWA 1YP5A 4M77A 2MWPA 1ABOA 2FB7A 3INZA 1JO8A 2VV5A 3ZFJA 3CC4T 4M7DB 3M0UA 1D1CA 1R8OB 3JCMX 4L5GA 3QIIA 4M75D 3O8VA 2CZ6B 1Q81C 3I56T 2P0QA 1D0XA 3RIRA 4KBMB 2DJZA 2RQRA 2D0NA 3I55A 1TUGB 2V8JA 1QWFA 2EYXA 3EG9A 2DXTA 1Q7YU 1XOVA 5IXFA 1SEMA 2LQNA 3QDFA 2MWOA 4LN2A 1G3YA 1ZSZC 2V1RA 4C8QA 3RKWA 3OYNA 1U06A 4D6WA 3C4SA 1WX6A 4OF1A 4MZPA 5C6SA 5FU6C 3FJPA 1TOVA 1H3ZA 3L2VA 2LMJA 5KYUB 2QDYB 1MMDA 1PSFA 4AT1B 4CC7A 2CSQA 2F2XA 2LC4A 2JNGA 2HZYA 1GCPA 4ELYC 4DA4A 1VQMT 2CH4W 2ZAEA 2C0IA 2QEXQ 4GLKA 4XTZA 4E2FB 1QKWA 3MP6A 3CCUT 1PM3A 1WGSA 1VQ6A 1M27C 4FM4B 1M2VB 4LDYA 4Y28E 2K6DA 4KULA 3H8ZA 1NPRA 2BIVA 3BE3A 3ZL7C 1VQLQ 1YCSB 5GAOq 1QCFA 4N4GA 2CP5A 3V7SA 3VUZA 2MYSA 2KAFA 2P0KA 1Q82C 3DB4A 1ZUUA 2LCSA 1B34B 3NHNA 2L3QA 2F2VA 4IURA 1TXQA 4AFZC 4PJOE 3L1AA 2C0TA 4N0AC 1B07A 3P8HA 4N0AA 2HSPA 3VUBA 4PL6A 4JPBW 4BACA 2KVQG 3D7SB 2ED1A 1TS9A 2B8AA 3CCVQ 4OMOA 4R55A 4PJMA 4QQDA 1KG1A 3KBGA 4BDYA 3VS2A 3OS1A 2RJDA 3CD6Q 3RUXA 1NYFA 1Y96A 4JS4A 1KD1R 2VYTA 1D1AA 1B7TA 1VYTA 4C0DC 3DLLA 3CC7A 1YJNQ 2DTHA 1S72Q 4R0KA 1AWJA 1S1NA 1QVGP 3R6OA 2GF7A 4C0ZA 1M1GA 2K3XA 2JTEA 3EH2A 3CMAA 3E9FA 2EQIA 1PD0A 2M0YA 3MJXA 3CCQT 3CCRT 3G4ST 4CC2A 4DQ2A 1RLQC 1VQ7T 3OYIA 3VS1A 4M7AB 3C95A 2YLCA 3EFOA 3MO8A 1RABB 1IZ6A 3A8HB 3VYHB 4M75B 3VS7A 1WFWA 2JS2A 2PTKA 4KGVB 2ECZA 4X9DA 2E70A 4K11A 1Q81R 5GANj 2RPNA 4MZTA 3V8JA 4XU2A 4RG8A 2YLBA 4BB7A 4J6WA 2A0FB 1QVPA 1K9MR 3CCLA 4DOWA 3M4YA 5GAMf 3LWIA 1DJ7B 3L2UA 4F17A 1CKAA 1WPYA 2HQHA 2KMTA 1MMGA 2JZ2A 2DM1A 5IAYA 2VUBA 2LJ1A 1UGVA 2L5QA 1TUCA 2O31A 5I21A 1BBZA 1M90C 4M78D 1HJDA 1ZUKA 1WYXA 4JRPA 1X43A 1VQPA 4KRTA 2FZCB 2P4RA 5D6WA 2OTLQ 5CQYA 2SEMA 4Z89A 2DIGA 1F1BB 2QI2A 1NLOC 1ACMB 4OVAA 1PC0A 3OMGA 4HVUA 4FW2A 3UA6A 4FW1A 2GTOA 4F16A 3JCMe 1N5ZA 1VYVA 1IGQA 3OB9A 4MMKA 1JXOA 4PJOD 1BK2A 4M78F 1K76A 1ZBXA 2R57A 2AZVA 5LJ5j 1VYUA 2J05A 4PJJA 3CC4A 1ZHIA 1R0BG 1QCOA 3DB3A 5LJ3h 1VQ9Q 1RI9A 4BY6B 4ZN3A 1NJIR 1UTIA 9ATCB 5LJ3g 2QEXT 1WHLA 4EMKA 1YJ9Q 2KDSA 3A8GB 3I56A 3GIBA 1UGQB 2L89A 4XU3A 3CCEQ 4BE0A 5KYWA 2K5IA 2FZGB 4J83A 1BB9A 4PJOF 4EPCA 2X9HA 1VQKA 3CCJQ 1VQLT 5HY6A 3M58A 1UHCA 3TVTA 1X6BA 1YITT 2GNCA 1IXDA 3OQ5A 4B9XA 2L3PA 3V8LA 5CK9A 1V76A 5GMKe 6AT1B 5DLOA 5GMKi 3RNJA 2L3RA 1ZA1B 4QQGA 2R58A 3PVQA 3OYHA 4JRQA 3CCVT 3VS6A 1VQMA 2RQVA 3M57A 4GY5A 3QJ6A 4KUDK 3G6EA 2VKNA 1UECA 1V29B 3CCUA 3NTHA 3OS5A 3O5ZA 2L2PA 4C5EA 2RQTA 1S72T 3OMCA 3TU4K 2ABLA 2QGGA 1PSEA 2EW3A 1IHVA 1W1FA 2JTFA 2RI2A 4Z02A 2HKQB 1NZ9A 1KC8U 1M1KC 2JS0A 1Y07A 3OW2P 3QBYA 4ATOA 1SF9A 2H3EB 2VASA 1SPKA 2RN8A 3OY9A 3PIPA 1G3SA 2XU8A 1PG5B 2OJ2A 4RTZA 2BZXA 2XDDA 2K2MA 1A0NB 2IPOB 2QXFA 3SEMA 2K2VA 2XICA 3QHSA 2RH2A 1Q7YR 2DL4A 1BI2A 1K1ZA 1SRLA 4ZGJB 3WVEB 4FL6A 2J7IA 1N6AA 3NFCA 3PMTA 2QYZA 2D0QB 4QVCA 3OYEA 3ULRB 4M77D 2DO3A 3PFSA 2CP3A 1Q86C 2L8DA 5CKEA 4JJBA 1JRIA 1T3SA 3TEEA 3EGDA 2JM8A 4M78G 4OB1B 4A4HA 2BE7D 1RUWA 2PVGB 5CVIA 1VIEA 3CCRA 3G4SA 1LJOA 4EDUA 4DOVA 3G71Q 2NUTA 2DBMA 4M78C 5CAIA 3GLXA 4LXCA 3S3NA 3JB9I 1K73U 1YIJQ 2FRYA 1M8MA 2OTLT 2RD1A 1H3HA 2GTJA 2FG0A 3SWNC 2RI3A 2NUZA 2RHYA 3QUIA 4PJOG 1GRIA 4C8QD 1M2OA 4XTXA 2EQUA 2ZCFB 1RACB 4OGCA 4E7JA 4ZTFA 4PJOC 2RK2A 1VQ4Q 3UATA 4PJOA 3F70A 1QLYA 2K79A 4FYYB 1RAIB 2RK1A 3IQLA 3A98A 4Z88A 4OB3B 3RDVA 5KE3A 1JU5C 1QVGA 1AWWA 1VQ9T 3L2RA 4IUVA 3QDRB 1N9SA 4LDUA 3VRYA 1YJ9T 2EKHA 2JJ9A 3M0RA 2MIOA 1ZA2B 1VQOT 3CCET 4C8QF 1X75C 5A0LA 3THKA 5FRNA 3PTAA 1WLPB 5EG2A 3OA6A 4M7AE 2YT6A 1QW1A 2EJFA 3PVLA 3CCJT 5GAOm 1I1JA 3JSCA 2F5KA 4QVDA 1XNIA 4N4IA 3PIOA 4WCIA 4DBRA 5A0DA 4HCCA 2K5FA 2DNUA 5HK0A 4LUEA 2E3HA 1MUZA 1QVFS 1PRMC 1RLPC 2LCCA 4ME7A 3JCMc 2JN0A 3FDRA 1VQNQ 5KE2A 4ANJA 1K8AU 5LJ3d 1G8XA 2QEXA 2HD0A 1U1SA 4J7FA 2DLPA 1PWTA 3ER0A 7AT1B 3LGFA 2EYWA 3ASKA 2X3XD 2PQWA 2FPDA 1JBMA 5D6YA 2JTMA 2GGRA 1X01A 5KYXB 2GCXA 2K3YA 2EJ9A 1BIAA 2KRSA 5KH6A 1SHGA 2O9SA 2RO0A 1W2BA 2AKKA 2KGTA 3EH1A 1KD1C 2KXDA 5FWCA 2KQWA 1KIKA 3OYFA 4M77B 2X4YA 1WIEA 4C5GA 3JCMh 3Q1JA 4Z8AA 5CKBA 2CP6A 3C12A 3H9NA 3VJPA 3JCMg 3CC2T 3EG2A 2RJCA 3CD6A 3C94A 2DRMA 1GBQA 3QO3A 3LWHA 1NPPA 3C0CA 3LH0A 3WVDB 2FPFA 1YJNA 1S72A 3EG9B 2CZ7B 4LDVA 1AWOA 2EQJA 5GAN3 2V8KA 4EIKA 3VU3C 1K73C 5KCHA 1VIFA 3SHWA 1TU0B 1UG1A 5GAN2 2EFIA 3QG1A 2LJ0A 1ZSZB 2GFUA 2YHTA 2OTJT 2QDLA 5GANe 1YHQA 2G3RA 4BE1A 3G71T 2EBPA 3RKYA 3HKSA 2EPDA 5FU6B 4HCBA 4PJLA 2Y90A 4QQ6A 1YIJT 1K9MC 1NLPC 3X24B 4C8QG 5GMKh 2M51A 3VRZA 1NEBA 2KT1A 3OYBA 1MNEA 3JB9D 4IUPA 4C8QC 2D6FA 2V8IA 1Y71A 2K5LA 1MGQA 3MHXA 2EYYA 1VQ4T 4AG1C 5EC7A 2YSQA 2CUBA 1KK7A 3EGUA 2F2WA 1E6HA 1X27A 4F14A 4B9WA 3CCSQ 2JOYA 2XDBA 2AHJB 3H0HA 2DZCA 3OW2A 3JB9F 5GAN6 4OGEA 2D1XA 2M16A 2R5MA 2F69A 3HFNA 2ZPEB 2HL3A 2VB6A 2VXFA 2WACA 2XHCA 1N9RA 1O9SA 2LTOA 2OTLA 3TQ7P 5L23A 4O5VA 5GAMj 2QG9B 1QWEA 4AFSC 3GOXA 3I9QA 3MEVA 2HCKA 1I81A 2PZ1A 3CPWS 1NJIC 3LX7A 4LUDA 1AEYA 3MP8A 1FYNA 1YITQ 2QQ9A 4EMHA 4E7LA 1VQ8Q 2COZA 2XD0A 1Y96B 1KC8R 2LZ6B 3EHQA 2IIMA 4DEXA 2ATCB 5KYYB 1NBEB 2QGFB 4C92E 2BTTA 4JZ4A 4PLLA 4J9FA 4C0DB 3J81E 2FL7A 5KYUA 1VQ9A 3M0SA 1VQNT 1YNZA 4FT2A 4A54A 4DEYA 2CYZB 2ENMA 5J39A 2X35A 1YJ9A 2HBPA 4J6YA 3RBBB 2Y4XA 3L2QA 1IHWA 2RHIA 4RTUA 5CCAA 2DZ9A 2BZ8A 1WXUA 1PRLC 2LT1A 3OBWA 5KYNA 4XK8E 1FMWA 2W0ZA 2VVKA 2PUKB 1U1TA 2XK0A 3TREA 3META 2A36A 1B34A 4L59A 5FU7C 1WQWA 3OYJA 1AOJA 1K9AA 2F1LA 2KEAA 5FW9A 3X25B 3CMET 2HMAA 1VQ5A 2FVUA 1MHNA 1K73R 1KQ1A 1UEBA 2C0OA 4MMLA 4BD3A 2DPPB 1KFZA 3SD4A 3CEYA 2K9GA 1N8RU
chains in the Genus database with same CATH topology
1KSWA 2RMOA 3KFVA 3O5ZA 1X2QA 2L2PA 2L0AA 2DVJA 2RQTA 1UFFA 3NMZC 2ABLA 2DL7A 1AZEA 3REBB 2EW3A 1W1FA 4IIOA 2DF6A 3VS3A 1K4US 2JS0A 1WXBA 4AG2C 2V1QA 1LCKA 2YUOA 4FSSA 2KRNA 2VWFA 1SPKA 2RN8A 4D8KA 2OJ2A 2YUPA 1PHTA 2JMAA 1W70A 3I5SA 4OMLA 2YUNA 4RTZA 2BZXA 2K2MA 3QWYA 1A0NB 2BZYA 4JZ3A 1SHFA 3SEMA 1J3TA 1M3CA 2KRMA 4AFQC 1UDLA 2DA9A 4HVVA 1VA7A 2KYBA 2AZSA 2DL4A 2KXCA 1K1ZA 1SRLA 2FEIA 4J9GA 2J7IA 1V1CA 3TSZA 1EFNA 3ULRB 2EYZA 3TSWA 1W6XA 1GL5A 2H8HA 4RUGA 4JJBA 2YUQA 1T3SA 3CQTA 2JM8A 4ESRA 2K7AA 4IIMA 4LE9A 4CC4B 2O9VA 1RUWA 5I22A 2FPEA 1OPLA 1YWPA 4HVWA 1OOTA 4J9HA 2J06A 2DBMA 4A63B 2RQWA 4GBQA 1UJYA 1U5SA 2FRYA 1M8MA 1H3HA 1MV3A 2GTJA 2FG0A 1TUDA 4JJDA 2EGEA 2NUZA 3UF4A 1SRMA 1YWOA 2X3WD 2K3BA 1U3OA 1GRIA 3LH5A 1IO6A 4HCKA 1TG0A 2DX1A 3PE0A 4OMMA 1UJ0A 2YDLA 1T3LA 2FRWA 2HBWA 2JW4A 2OAWA 1ZUYA 2CT4A 1ZSGA 1YP5A 3UATA 1MV0B 1QLYA 2LP5A 1ABOA 1AD5A 1Z9QA 2K79A 3A98A 3IQLA 4Z88A 1JO8A 1JU5C 4HXJA 1AWWA 3M0UA 1ZLMA 4RTYA 3VRYA 1KJWA 2EKHA 4LNPA 2E5KA 3M0RA 2MIOA 3UA7A 2LNHB 1JQQA 3THKA 2KYMA 1WLPB 2A08A 2LQWA 4J9IA 2RQRA 2D0NA 5ECAA 1HSQA 3VS5A 2YT6A 3FJ5A 3PVLA 1QWFA 2EYXA 1I1JA 2G6FX 1I07A 3I5RA 1XOVA 3I35A 1T0HA 1SEMA 5IXFA 2LQNA 2EGCA 4RTVA 1M3AA 1JEGA 3M0PA 4LN2A 1UUEA 4WCIA 2V1RA 2DL5A 2MOXA 2DNUA 1U06A 4X1VA 1WX6A 2DJQA 2OI3A 4LUEA 1MUZA 1PRMC 1ARKA 3M0QA 1AVZC 1HD3A 1RLPC 2CSIA 2DL3A 4QT7A 2LJ3A 1T0JA 2LMJA 4CC7A 2CSQA 2F2XA 2KT8A 1GCPA 1NG2A 2CH4W 4OMNA 2C0IA 2DLPA 2KR3A 1PWTA 1E6GA 1QKWA 2EYWA 1PKTA 2X3XD 3JV3A 5I11A 1M27C 2FPDA 2L3SA 4J9CA 2K6DA 2GGRA 1H92A 2ROLA 3M0TA 3EG0A 3ZL7C 1YCSB 2KRSA 1QCFA 2LX7A 1QKXA 2SRCA 2CDTA 1SHGA 2DYBA 3VS4A 1FMKA 2O9SA 1ZX6A 2KROA 2JT4A 2AKKA 1ZUUA 2LCSA 2KGTA 3NHNA 2L3QA 2F2VA 2JMCA 4GLMA 4AFZC 3H0FA 2C0TA 2KXDA 5FWCA 1B07A 3VS0A 1KIKA 2XMFA 2HSPA 1WIEA 4Z8AA 1K0XA 4JPBW 4J9BA 2D8HA 2DMOA 3REAB 2ED1A 4OMPA 5IH2A 1AWXA 3EG2A 4OMOA 2KE9A 3QWXX 2DRMA 4J9EA 3VS2A 1GBQA 1NYFA 3H0IA 1UE9A 3C0CA 2FPFA 1GFCA 1VYTA 1AWOA 2RF0A 4EIKA 4R0KA 1AWJA 1S1NA 2HDAA 2PNIA 5IHNA 1G83A 2GBQA 3SHWA 2ED0A 1UG1A 1PKSA 2LJ0A 1CSKA 2DE0X 2QDLA 2JTEA 2JM9A 4AFUC 2EQIA 2M0YA 2EBPA 4CC2A 1H8KA 2O2OA 2EPDA 1RLQC 1WXTA 3EG3A 2D8JA 4ZNXA 3VS1A 1PNJA 1NLPC 2M51A 3VRZA 1NEBA 1GBRA 2RNAA 1JXMA 1X2KA 2CREA 2KT1A 4JJCA 3VS7A 2J6OA 1WI7A 1WFWA 5IHIA 1ZBJA 2JS2A 1M3BA 2PTKA 2B86A 2ECZA 2EYYA 4K11A 2RPNA 4E6RA 2DILA 4AG1C 5HCKA 5EC7A 1BU1A 2YSQA 2CUBA 2A28A 2HEQA 2RQUA 3EGUA 2F2WA 1E6HA 2AKLA 1CKBA 1UHFA 1X27A 4F14A 4D8DA 4F17A 1CKAA 2DBKA 3H0HA 4RTWA 1B3QA 2DM1A 2CT3A 1OEBA 4ORZA 2D1XA 5GJWB 2LJ1A 1UGVA 2O31A 1TUCA 1X69A 3NPFA 2MCNA 1BBZA 1E7OA 1M30A 2NWMA 1HJDA 1ZUKA 1WYXA 1X43A 4Y92A 2EVRA 3R6NA 5L23A 4KRTA 2P4RA 1QWEA 4M4ZA 4AFSC 2SEMA 4Z89A 3I9QA 2HCKA 2PZ1A 1NLOC 4LUDA 1AEYA 1OV3A 4J9DA 1FYNA 4HVUA 3UA6A 2GTOA 4F16A 1N5ZA 2FO0A 1VYVA 2LZ6B 2KBTA 3EHQA 2CUDA 5FWBA 2IIMA 4DEXA 1Y57A 2ESWA 1JXOA 1OPKA 1BK2A 1Y0MA 4RTTA 2BTTA 4JZ4A 4J9FA 1K76A 2DL8A 4CC3A 2AZVA 1VYUA 2J05A 3U23A 3M0SA 2J6KA 1YNZA 3GBQA 4DEYA 2ENMA 1G2BA 1RI9A 2J6FA 1WA7A 1UTIA 1SSHA 3H41A 1X6GA 3RBBB 2GQIA 3EHRA 1YN8A 1NYGA 1ABQA 1NEGA 3NGPA 1WDXA 4RTUA 2BZ8A 1WXUA 1PRLC 1BB9A 1I0CA 5IHKA 2A37A 1UHCA 3TVTA 2EGAA 5IXBA 2W0ZA 3EG1A 1X6BA 2VVKA 2GNCA 2I0NA 2L3PA 2A36A 4RTXA 2ROTA 1AOJA 1K9AA 2KEAA 5FW9A 3RNJA 2JXBA 2O88A 1NM7A 2KNBB 1GFDA 2AK5A 4OMQA 3PVQA 1AZGB 1K0SA 3VS6A 2C0OA 5GJVB 2RQVA 1KFZA 1GCQC 2DRKA 2VKNA 1GCQA 2CH4A 1UECA 1Z9ZA 2K9GA 2W10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  2RMO A;  3KFV A;  3O5Z A;  1X2Q A;  2L2P A;  2L0A A;  2DVJ A;  2RQT A;  1UFF A;  3NMZ C;  2ABL A;  2DL7 A;  1AZE A;  3REB B;  2EW3 A;  1W1F A;  4IIO A;  2DF6 A;  3VS3 A;  1K4U S;  2JS0 A;  1WXB A;  4AG2 C;  2V1Q A;  1LCK A;  2YUO A;  4FSS A;  2KRN A;  2VWF A;  1SPK A;  2RN8 A;  4D8K A;  2OJ2 A;  2YUP A;  1PHT A;  2JMA A;  1W70 A;  3I5S A;  4OML A;  2YUN A;  4RTZ A;  2BZX A;  2K2M A;  3QWY A;  1A0N B;  2BZY A;  4JZ3 A;  1SHF A;  3SEM A;  1J3T A;  1M3C A;  2KRM A;  4AFQ C;  1UDL A;  2DA9 A;  4HVV A;  1VA7 A;  2KYB A;  2AZS A;  2DL4 A;  2KXC A;  1K1Z A;  1SRL A;  2FEI A;  4J9G A;  2J7I A;  1V1C A;  3TSZ A;  1EFN A;  3ULR B;  2EYZ A;  3TSW A;  1W6X A;  1GL5 A;  2H8H A;  4RUG A;  4JJB A;  2YUQ A;  1T3S A;  3CQT A;  2JM8 A;  4ESR A;  2K7A A;  4IIM A;  4LE9 A;  4CC4 B;  2O9V A;  1RUW A;  5I22 A;  2FPE A;  1OPL A;  1YWP A;  4HVW A;  1OOT A;  4J9H A;  2J06 A;  2DBM A;  4A63 B;  2RQW A;  4GBQ A;  1UJY A;  1U5S A;  2FRY A;  1M8M A;  1H3H A;  1MV3 A;  2GTJ A;  2FG0 A;  1TUD A;  4JJD A;  2EGE A;  2NUZ A;  3UF4 A;  1SRM A;  1YWO A;  2X3W D;  2K3B A;  1U3O A;  1GRI A;  3LH5 A;  1IO6 A;  4HCK A;  1TG0 A;  2DX1 A;  3PE0 A;  4OMM A;  1UJ0 A;  2YDL A;  1T3L A;  2FRW A;  2HBW A;  2JW4 A;  2OAW A;  1ZUY A;  2CT4 A;  1ZSG A;  1YP5 A;  3UAT A;  1MV0 B;  1QLY A;  2LP5 A;  1ABO A;  1AD5 A;  1Z9Q A;  2K79 A;  3A98 A;  3IQL A;  4Z88 A;  1JO8 A;  1JU5 C;  4HXJ A;  1AWW A;  3M0U A;  1ZLM A;  4RTY A;  3VRY A;  1KJW A;  2EKH A;  4LNP A;  2E5K A;  3M0R A;  2MIO A;  3UA7 A;  2LNH B;  1JQQ A;  3THK A;  2KYM A;  1WLP B;  2A08 A;  2LQW A;  4J9I A;  2RQR A;  2D0N A;  5ECA A;  1HSQ A;  3VS5 A;  2YT6 A;  3FJ5 A;  3PVL A;  1QWF A;  2EYX A;  1I1J A;  2G6F X;  1I07 A;  3I5R A;  1XOV A;  3I35 A;  1T0H A;  1SEM A;  5IXF A;  2LQN A;  2EGC A;  4RTV A;  1M3A A;  1JEG A;  3M0P A;  4LN2 A;  1UUE A;  4WCI A;  2V1R A;  2DL5 A;  2MOX A;  2DNU A;  1U06 A;  4X1V A;  1WX6 A;  2DJQ A;  2OI3 A;  4LUE A;  1MUZ A;  1PRM C;  1ARK A;  3M0Q A;  1AVZ C;  1HD3 A;  1RLP C;  2CSI A;  2DL3 A;  4QT7 A;  2LJ3 A;  1T0J A;  2LMJ A;  4CC7 A;  2CSQ A;  2F2X A;  2KT8 A;  1GCP A;  1NG2 A;  2CH4 W;  4OMN A;  2C0I A;  2DLP A;  2KR3 A;  1PWT A;  1E6G A;  1QKW A;  2EYW A;  1PKT A;  2X3X D;  3JV3 A;  5I11 A;  1M27 C;  2FPD A;  2L3S A;  4J9C A;  2K6D A;  2GGR A;  1H92 A;  2ROL A;  3M0T A;  3EG0 A;  3ZL7 C;  1YCS B;  2KRS A;  1QCF A;  2LX7 A;  1QKX A;  2SRC A;  2CDT A;  1SHG A;  2DYB A;  3VS4 A;  1FMK A;  2O9S A;  1ZX6 A;  2KRO A;  2JT4 A;  2AKK A;  1ZUU A;  2LCS A;  2KGT A;  3NHN A;  2L3Q A;  2F2V A;  2JMC A;  4GLM A;  4AFZ C;  3H0F A;  2C0T A;  2KXD A;  5FWC A;  1B07 A;  3VS0 A;  1KIK A;  2XMF A;  2HSP A;  1WIE A;  4Z8A A;  1K0X A;  4JPB W;  4J9B A;  2D8H A;  2DMO A;  3REA B;  2ED1 A;  4OMP A;  5IH2 A;  1AWX A;  3EG2 A;  4OMO A;  2KE9 A;  3QWX X;  2DRM A;  4J9E A;  3VS2 A;  1GBQ A;  1NYF A;  3H0I A;  1UE9 A;  3C0C A;  2FPF A;  1GFC A;  1VYT A;  1AWO A;  2RF0 A;  4EIK A;  4R0K A;  1AWJ A;  1S1N A;  2HDA A;  2PNI A;  5IHN A;  1G83 A;  2GBQ A;  3SHW A;  2ED0 A;  1UG1 A;  1PKS A;  2LJ0 A;  1CSK A;  2DE0 X;  2QDL A;  2JTE A;  2JM9 A;  4AFU C;  2EQI A;  2M0Y A;  2EBP A;  4CC2 A;  1H8K A;  2O2O A;  2EPD A;  1RLQ C;  1WXT A;  3EG3 A;  2D8J A;  4ZNX A;  3VS1 A;  1PNJ A;  1NLP C;  2M51 A;  3VRZ A;  1NEB A;  1GBR A;  2RNA A;  1JXM A;  1X2K A;  2CRE A;  2KT1 A;  4JJC A;  3VS7 A;  2J6O A;  1WI7 A;  1WFW A;  5IHI A;  1ZBJ A;  2JS2 A;  1M3B A;  2PTK A;  2B86 A;  2ECZ A;  2EYY A;  4K11 A;  2RPN A;  4E6R A;  2DIL A;  4AG1 C;  5HCK A;  5EC7 A;  1BU1 A;  2YSQ A;  2CUB A;  2A28 A;  2HEQ A;  2RQU A;  3EGU A;  2F2W A;  1E6H A;  2AKL A;  1CKB A;  1UHF A;  1X27 A;  4F14 A;  4D8D A;  4F17 A;  1CKA A;  2DBK A;  3H0H A;  4RTW A;  1B3Q A;  2DM1 A;  2CT3 A;  1OEB A;  4ORZ A;  2D1X A;  5GJW B;  2LJ1 A;  1UGV A;  2O31 A;  1TUC A;  1X69 A;  3NPF A;  2MCN A;  1BBZ A;  1E7O A;  1M30 A;  2NWM A;  1HJD A;  1ZUK A;  1WYX A;  1X43 A;  4Y92 A;  2EVR A;  3R6N A;  5L23 A;  4KRT A;  2P4R A;  1QWE A;  4M4Z A;  4AFS C;  2SEM A;  4Z89 A;  3I9Q A;  2HCK A;  2PZ1 A;  1NLO C;  4LUD A;  1AEY A;  1OV3 A;  4J9D A;  1FYN A;  4HVU A;  3UA6 A;  2GTO A;  4F16 A;  1N5Z A;  2FO0 A;  1VYV A;  2LZ6 B;  2KBT A;  3EHQ A;  2CUD A;  5FWB A;  2IIM A;  4DEX A;  1Y57 A;  2ESW A;  1JXO A;  1OPK A;  1BK2 A;  1Y0M A;  4RTT A;  2BTT A;  4JZ4 A;  4J9F A;  1K76 A;  2DL8 A;  4CC3 A;  2AZV A;  1VYU A;  2J05 A;  3U23 A;  3M0S A;  2J6K A;  1YNZ A;  3GBQ A;  4DEY A;  2ENM A;  1G2B A;  1RI9 A;  2J6F A;  1WA7 A;  1UTI A;  1SSH A;  3H41 A;  1X6G A;  3RBB B;  2GQI A;  3EHR A;  1YN8 A;  1NYG A;  1ABQ A;  1NEG A;  3NGP A;  1WDX A;  4RTU A;  2BZ8 A;  1WXU A;  1PRL C;  1BB9 A;  1I0C A;  5IHK A;  2A37 A;  1UHC A;  3TVT A;  2EGA A;  5IXB A;  2W0Z A;  3EG1 A;  1X6B A;  2VVK A;  2GNC A;  2I0N A;  2L3P A;  2A36 A;  4RTX A;  2ROT A;  1AOJ A;  1K9A A;  2KEA A;  5FW9 A;  3RNJ A;  2JXB A;  2O88 A;  1NM7 A;  2KNB B;  1GFD A;  2AK5 A;  4OMQ A;  3PVQ A;  1AZG B;  1K0S A;  3VS6 A;  2C0O A;  5GJV B;  2RQV A;  1KFZ A;  1GCQ C;  2DRK A;  2VKN A;  1GCQ A;  2CH4 A;  1UEC A;  1Z9Z A;  2K9G A;  2W10 A; 
#chains in the Genus database with same CATH topology
 1XTD A;  4KGZ B;  3GNG A;  5HK3 A;  1UGS B;  1IRE B;  2DVJ A;  3I55 Q;  4KT0 E;  3DLM A;  3NMZ C;  5J3B A;  2QQS A;  2LVM A;  3REB B;  3MKD A;  3EAE A;  1Q7Y C;  2DIQ A;  2DF6 A;  1K4U S;  4M7A G;  2HKN A;  2HAX A;  2V1Q A;  1TSF A;  2KRN A;  2VWF A;  4D8K A;  4IKF A;  1D3B B;  3CPF A;  4RCC A;  1PHT A;  1QP2 A;  2JMA A;  2QTV A;  1JJ2 S;  4X34 A;  3JB9 G;  4M7A A;  3JCM d;  2LQK A;  1M3C A;  1UDL A;  2KYB A;  3E2U A;  3OYY A;  1HYO A;  2KI7 A;  1YJW Q;  2MF2 A;  1W2B P;  2X4J A;  2FEI A;  2QK0 A;  2RA2 A;  5KYW B;  1U8R A;  1V1C A;  3TSZ A;  3JAM E;  1D1B A;  1IB8 A;  4Q5W A;  1OX9 A;  2EYZ A;  1I5O B;  2DXC A;  4OB2 B;  4RUG A;  2E6N A;  5CO7 A;  3CCS T;  5LJ3 f;  2YUQ A;  3QZ9 B;  1EZZ B;  4ESR A;  3N5B B;  4EMK C;  3SFM A;  2O9V A;  4NL2 A;  4F7U E;  1K8A R;  1OZ2 A;  3G71 A;  1VQO Q;  4HVW A;  4J9H A;  3CBO A;  3QJY A;  2J06 A;  2RB6 A;  1C6V X;  2RQW A;  4RMO A;  2NUP A;  1AHJ B;  1YIJ A;  1U5S A;  4C92 F;  3MEU A;  3OS0 A;  2P4T A;  1TUD A;  2WSC E;  4XAX B;  1YWO A;  2X3W D;  2K3B A;  1VQ8 T;  1KHC A;  2RHX A;  3BW1 A;  3CBM A;  1TG0 A;  3FC3 A;  5DM7 R;  4DBF A;  1LOJ A;  3QYH B;  1VQ4 A;  2KK4 A;  4E7K A;  3G1J A;  2CT4 A;  1ZSG A;  3EFS A;  1MV0 B;  4HKE A;  2LP5 A;  2COY A;  1VOM A;  1X6O A;  2BKD N;  2JVV A;  4M7D E;  1XQH A;  4HXJ A;  2FZK B;  4RTY A;  3GP8 A;  4OMF B;  2M02 A;  1R0C B;  2YWW A;  1JQQ A;  4DBH A;  2KYM A;  3V8K A;  1KQS S;  2A08 A;  1MMN A;  3GF5 A;  3CCM Q;  5ECA A;  1HSQ A;  1QVG S;  1D09 B;  1QQJ A;  3VS5 A;  2X51 A;  3FJ5 A;  2ZPH B;  3MP1 A;  1OX8 A;  5AYF A;  2G6F X;  5GAN g;  1I07 A;  2DYI A;  4LDW A;  1QVF P;  2YRV A;  3M0P A;  4ZN1 A;  2DL5 A;  3UT1 A;  1QMC A;  2MOX A;  3P8D A;  2FYK A;  4X1V A;  3CXC S;  1H64 1;  2OI3 A;  2E41 A;  4BE2 A;  1AVZ C;  1HD3 A;  2CSI A;  2DL3 A;  2YRD A;  4QT7 A;  2DXU A;  1VQN A;  1G3W A;  3AHU A;  2X4X A;  3CC2 Q;  3L42 A;  4OMN A;  2KR3 A;  5CKH A;  2XKO C;  1WHM A;  3QXE B;  4RKU E;  2QQB A;  4M78 B;  4XU1 A;  2ZPF B;  4EMG A;  3I55 T;  2XID A;  2LQ8 A;  4J9C A;  5LL6 S;  1VQP Q;  3M0T A;  3EG0 A;  4R56 A;  3SWN B;  1QKX A;  2SRC A;  2CDT A;  2DYB A;  1FMK A;  1RAA B;  1ZX6 A;  2KRO A;  3OSS C;  2JT4 A;  3AT1 B;  5LJ5 g;  2OTJ Q;  2PUO B;  4L6V 5;  3CCQ A;  4GLM A;  3H0F A;  3VS0 A;  3A8L B;  4PJO B;  3S6W A;  1VQ7 A;  2XMF A;  5GAN 5;  5KCO A;  4J9B A;  2D8H A;  2EJG A;  2K4Y A;  2OX7 A;  3REA B;  2YXY A;  2KY9 A;  1AWX A;  1BI3 A;  1YJW T;  2KE9 A;  4PFP A;  2LNV A;  4C92 G;  2OAU A;  2DVE A;  5FLX E;  4MDW A;  2QQR A;  1O75 A;  4F7U F;  2PVO B;  4WTO B;  4BI8 B;  5GAN 7;  2ZPG B;  1OQK A;  1GFC A;  3DKM A;  4C92 C;  4C92 A;  2PNI A;  5IHN A;  1G83 A;  2GBQ A;  1WZO A;  2HNI A;  1LNX A;  4AMC A;  2GQV A;  3A8O B;  1PKS A;  1CSK A;  3LYI A;  4A4G A;  2JM9 A;  1UGP B;  4AFU C;  3SDZ A;  3M53 A;  5D6X A;  1EX4 A;  1WHG A;  1M4Z A;  3M54 A;  3P8B B;  1FX7 A;  2LT4 A;  5IT9 E;  1WXT A;  2CKK A;  3EG3 A;  3OYD A;  1KHI A;  5CKF A;  3UPU A;  2QA4 Q;  4RCB A;  1GBR A;  1EIF A;  2O4X A;  4M75 E;  4M7D F;  4JJC A;  1BI1 A;  2CZ1 B;  2J6O A;  2LRQ A;  2YRC A;  2EAY A;  1M5Q 1;  2FHD A;  2HL5 C;  1ZBJ A;  3G6E Q;  4JDS A;  5A0G A;  2EIF A;  4O6J A;  2DIL A;  5GMK j;  2CP0 A;  5GAM e;  3HRS A;  3QZ5 B;  2M9U A;  3CC7 T;  4CI0 C;  2HEQ A;  4C0G A;  2QAS A;  3CCS A;  1YBY A;  4KGX B;  2EQK A;  4D8D A;  3M56 A;  3CBP A;  2DBK A;  4RTW A;  1B3Q A;  2VGN A;  1KC8 C;  2HQX A;  4IUT A;  2CS7 A;  5GJW B;  3CPW P;  1X69 A;  2MCN A;  1E7O A;  3CCM T;  2DD4 A;  2HSE B;  5GAO p;  1N8R R;  2C06 A;  2DER A;  2EYQ A;  1VQL A;  4M4Z A;  2DEQ A;  2X4W A;  2JUF A;  1Q82 U;  3EGX A;  1YIT A;  1VQ8 A;  1OV3 A;  1YI2 Q;  2D9T A;  2DEU A;  2KBT A;  4OP0 A;  1FMV A;  5FWB A;  2EWN A;  1RAD B;  1Y57 A;  2ESW A;  1OPK A;  3JCM f;  1Y0M A;  1OI1 A;  2DL8 A;  5GAN 8;  4CC3 A;  3J7A F;  3OYK A;  4MZM A;  1BKB A;  3X26 B;  3CME Q;  2J6K A;  2CP7 A;  3CCV A;  3UDC A;  1G2B A;  3H41 A;  4LD6 A;  1X6G A;  3NTK A;  2GQI A;  1ABQ A;  2A7Y A;  1NE8 A;  1I0C A;  1VQP T;  5L8R E;  3A5Z B;  5GAN d;  5KYX A;  3OBY A;  4HT8 A;  2EGA A;  3OYC A;  4F7U G;  1WHK A;  5IXB A;  3EG1 A;  4BUG A;  4C8Q B;  1WHH A;  2ROT A;  2E1H A;  3V7R A;  3RES A;  3HP9 A;  1JB0 E;  4X9C A;  4F7U A;  2JXB A;  2O88 A;  4M7A D;  1NM7 A;  2KNB B;  3M9Q A;  5FRO A;  1GFD A;  1R77 A;  2DTO A;  2CP2 A;  4A53 A;  4PLI A;  3FLG A;  1K0S A;  4XTU A;  2WSF E;  1M8V A;  4PFO A;  3X20 B;  2AIR B;  3FRN A;  1GCQ C;  2DRK A;  4BI4 A;  4NS5 A;  1GCQ A;  1HXD A;  2CH4 A;  3E1S A;  1OYX A;  1MND A;  3JCM W;  1KSW A;  2RMO A;  4M7D G;  1OUL A;  2MMP A;  1X2Q A;  4II1 A;  3KUF A;  2L0A A;  1UFF A;  3X28 B;  1VQK T;  4M7A F;  2P0P A;  3S3M A;  2DD5 A;  1AZE A;  1QVF A;  5I2S A;  3QKJ A;  4IIO A;  4M7D C;  1Q95 G;  1JJ2 P;  4M7D A;  5LJ5 d;  1ZSZ A;  4M75 F;  1M9S A;  1WXB A;  4CRI A;  4JRI A;  5DLQ E;  1M90 U;  4HA8 A;  3UWN A;  2E3I A;  5LJ5 e;  4OML A;  2QA4 T;  2YUN A;  3LW5 E;  3QWY A;  2BZY A;  1SHF A;  1J3T A;  1I8F A;  4A4E A;  3HSB A;  4HVV A;  1YJW A;  2AZS A;  2VC8 A;  1WJR A;  3S3O A;  2H3J A;  1K8A C;  3G6E T;  2BUD A;  4M78 E;  1EFN A;  4E7I A;  1G3T A;  4FIB A;  3J80 E;  3FIF A;  1HK9 A;  2K57 A;  2EQM A;  3TCJ A;  2QAZ A;  3TSW A;  1C0M A;  1PCX A;  1BYM A;  5D7U A;  4IUU A;  3CQT A;  2K7A A;  2A3L A;  2CZ0 B;  4IIM A;  4CC4 B;  1C1A A;  4NOY A;  3JCM b;  2FPE A;  1VQO A;  5FU7 B;  3PT9 A;  3CCE A;  2DET A;  3OYG A;  2ZPI B;  3QSU A;  4PFZ A;  5AT1 B;  4GBQ A;  1UJY A;  1M2V A;  3CCJ A;  3EFO B;  3VYG A;  5LJ3 j;  4P5N A;  1SKU B;  4KH1 B;  4JLI A;  4PNO A;  2EGE A;  3UF4 A;  1SRM A;  3HFO A;  1YI2 T;  1U3O A;  3LH5 A;  4HCK A;  3NTI A;  2DX1 A;  2E4H A;  2IG0 A;  3PE0 A;  3SB2 A;  4OMM A;  3M55 A;  4JJN K;  2DXB A;  2I2L A;  5KYY A;  4ZGD B;  1ZUY A;  3JCM Q;  3JCM V;  1BCO A;  2EKO A;  1AD5 A;  1Z9Q A;  1KQS P;  2M0O A;  3OYM A;  1ZLM A;  3HPW A;  2XG8 D;  1KJW A;  4LNP A;  2E5K A;  2ZZD A;  4C0F A;  3UA7 A;  2LNH B;  2IVW A;  1YHQ Q;  1SSF A;  2CGH A;  3CCM A;  2LQW A;  4J9I A;  3E19 A;  3M5A A;  3CXC P;  3JCM J;  1ZQ1 A;  3EFR A;  3I5R A;  4J8O A;  5GAO r;  3I35 A;  1D0Y A;  1T0H A;  5GAO l;  2EGC A;  1M1K U;  4RTV A;  1M3A A;  1JEG A;  4MDX A;  1UUE A;  1XJW B;  2DKG A;  4XTY A;  3RR6 A;  2RM4 A;  2DJQ A;  4FSX A;  4Y91 A;  1ARK A;  1VUB A;  3M0Q A;  1RAG B;  4M75 G;  4M7A C;  5J26 A;  1RAF B;  2XI9 A;  2LJ3 A;  1T0J A;  3RMS A;  3RKX A;  5FRM A;  3CC2 A;  4IUQ A;  5GAM h;  3RER A;  2KT8 A;  2AT1 B;  4M75 C;  4EMK B;  5GAM g;  1NG2 A;  4M75 A;  1RAE B;  3CPW A;  2E64 A;  1E6G A;  1PKT A;  3JV3 A;  5I11 A;  2E6Z A;  2NUP B;  1Q86 U;  2L3S A;  1VQ6 Q;  1H92 A;  1OZ3 A;  1OU8 A;  4HCZ A;  2ROL A;  4PK4 A;  4C92 D;  2LX7 A;  8AT1 B;  3JRZ A;  5GMK m;  3VS4 A;  1LPL A;  2OTJ A;  4VUB A;  4XTV A;  3GNF B;  2JMC A;  4FU6 A;  1UB4 A;  4M77 E;  1D3B A;  2WSE E;  4QVZ A;  4LDX A;  4C5I A;  2Z0W A;  1K0X A;  3PMI A;  4N4H A;  2DMO A;  2VGM A;  1W4S A;  4OMP A;  5IH2 A;  3PNW C;  1RL2 A;  4BDZ A;  1GXI E;  1Q82 R;  4XQ3 A;  3QWX X;  4J9E A;  5I2M A;  4A4F A;  3H0I A;  4NL3 A;  1UE9 A;  2M1H A;  3JCM P;  5CIU A;  2QQA A;  2RF0 A;  3LGL A;  4C5H A;  2HDA A;  3CC7 Q;  2ED0 A;  1FWZ A;  5CQX A;  4C8Q E;  4BY6 C;  2V26 A;  2DE0 X;  5M9O A;  2RJE A;  5HKC A;  3CMA Q;  4V2S A;  2MPX C;  1H8K A;  2O2O A;  3VKI A;  5GAO n;  2D8J A;  5GAN f;  1I5L A;  3RMQ A;  2E65 A;  4ZNX A;  1UGR B;  2DTI A;  1RI0 A;  1PNJ A;  2QA4 A;  5C0M A;  5GAN h;  1WQ7 A;  2LDM A;  2RNA A;  1JXM A;  1X2K A;  2CRE A;  1BCM A;  1VQ5 Q;  2PVD B;  3OS2 A;  1M1F A;  3MEW A;  3CD6 T;  1WI7 A;  3URG A;  5IHI A;  2QTX A;  3ZEH A;  4E47 A;  1M3B A;  1LVK A;  1AT1 B;  2B86 A;  3ZBD A;  4HT9 A;  4E6R A;  1N8R C;  3L2W A;  1YJN T;  4E7Z A;  5HCK A;  2NLU A;  1BU1 A;  1PD1 A;  2A28 A;  2RQU A;  2AKL A;  1CKB A;  1UHF A;  4KH0 B;  3CCL Q;  3EGD B;  1JJ2 A;  3A1P A;  4FCY A;  2CT3 A;  1OEB A;  4E7H A;  2ZPB B;  4ORZ A;  5A2Q E;  1YHQ T;  3NPF A;  2NUT B;  2LCL A;  4JUV A;  4QW2 A;  1M30 A;  2NWM A;  4YTL A;  2RI5 A;  2DFU A;  3OSV A;  3HRT A;  4Y92 A;  4ZGE B;  2EVR A;  3R6N A;  3QYG B;  3WXM B;  5IN1 A;  4UC4 A;  5LJ5 f;  2GFA A;  3VV0 A;  1YI2 A;  5LJ5 h;  2NYS A;  4J9D A;  2LX9 A;  2DAQ A;  1KD1 U;  2FO0 A;  3LLR A;  2MK5 A;  2CUD A;  3L2Z A;  3MCA B;  1MMA A;  4LD9 K;  1M90 R;  2RJF A;  4RTT A;  1BI0 A;  2E10 A;  4J7I A;  4C92 B;  2RHZ A;  4WF2 A;  4KUI A;  4JS5 A;  1W2B S;  3CME A;  3PGG A;  2MAM A;  3U23 A;  3M59 A;  3GBQ A;  3CC4 Q;  2J6F A;  1WA7 A;  2E5Q A;  2O01 E;  1SSH A;  4TVR A;  4PJN A;  3KXT A;  3EHR A;  1YN8 A;  3BDL A;  1NYG A;  1NEG A;  3NGP A;  5CKD A;  3I56 Q;  3JB9 J;  1WDX A;  1FXX A;  1VQ6 T;  2DK3 A;  3G7Z A;  4M78 A;  5IHK A;  1G5V A;  4M77 F;  3OYA A;  2A37 A;  4QKU A;  1VQK Q;  2O4X B;  3BY7 A;  3SWN A;  4M7D D;  1QP3 A;  2MI6 A;  2R5A A;  2I0N A;  4J6X A;  5DY9 A;  3E9G A;  1Q81 U;  2RHU A;  4RTX A;  3H6Z A;  8ATC B;  2HQE A;  1K9M U;  3HL8 A;  1YFN A;  3HHT B;  4FYX B;  4F04 B;  4XU0 A;  3JB9 H;  1KQS A;  1WNL A;  4BI3 A;  2AK5 A;  5GAN 4;  4OMQ A;  1AZG B;  4ZTJ A;  5GJV B;  5GAM d;  1WHJ A;  1VQM Q;  1P92 A;  4FT4 A;  1Z9Z A;  2KSS A;  3T9N A;  1RAH B;  2W10 A;  3CCU Q;  3KFV A;  2VXE A;  3FEO A;  1IRX A;  1N27 A;  3OYL A;  3CXC A;  2DL7 A;  1WJQ A;  2BE9 B;  4FYV B;  4E7S A;  3EGX B;  3ME9 A;  3VS3 A;  4AG2 C;  3CMA T;  3HRU A;  1QCN A;  1BIB A;  1LCK A;  2YUO A;  4FSS A;  1Y7X A;  1IGU A;  3M4G A;  2YUP A;  2COW A;  1W70 A;  3I5S A;  2F5T X;  3HTR A;  1WJS A;  3MEA A;  1NJI U;  1VQ5 T;  4JZ3 A;  3OW2 S;  4B6M A;  2KRM A;  4AFQ C;  2DA9 A;  3MPU B;  1KQ2 A;  1VA7 A;  2XDP A;  2E12 A;  2KXC A;  3GPL A;  1M1K R;  3FB9 A;  1OU9 A;  4J9G A;  5LJ3 e;  1I4K 1;  4J5Y A;  1W6X A;  4JRK A;  1GL5 A;  2H8H A;  3CCL T;  2Y4Y A;  4DBQ A;  5GMK l;  1TTH B;  2ZGW A;  4LE9 A;  4JLG A;  5I22 A;  2PU9 B;  5CR2 A;  1OPL A;  1TWB A;  4A4K A;  3CCQ Q;  1SG5 A;  1YWP A;  4F7U B;  3G4S Q;  3CCR Q;  3V7C A;  1OOT A;  3BFM A;  4OB0 B;  4A63 B;  1VQ7 Q;  2P84 A;  3QPH A;  4PKC C;  4RG2 A;  3BDU A;  1Q86 R;  1MV3 A;  4JJD A;  4FYW B;  4M77 G;  1YCY A;  1IO6 A;  4ELZ C;  1D0Z A;  1UJ0 A;  2YDL A;  1T3L A;  2FRW A;  3A8M B;  1TH7 A;  2HBW A;  2JW4 A;  4M77 C;  2OAW A;  4XTW A;  1YP5 A;  4M77 A;  2MWP A;  1ABO A;  2FB7 A;  3INZ A;  1JO8 A;  2VV5 A;  3ZFJ A;  3CC4 T;  4M7D B;  3M0U A;  1D1C A;  1R8O B;  3JCM X;  4L5G A;  3QII A;  4M75 D;  3O8V A;  2CZ6 B;  1Q81 C;  3I56 T;  2P0Q A;  1D0X A;  3RIR A;  4KBM B;  2DJZ A;  2RQR A;  2D0N A;  3I55 A;  1TUG B;  2V8J A;  1QWF A;  2EYX A;  3EG9 A;  2DXT A;  1Q7Y U;  1XOV A;  5IXF A;  1SEM A;  2LQN A;  3QDF A;  2MWO A;  4LN2 A;  1G3Y A;  1ZSZ C;  2V1R A;  4C8Q A;  3RKW A;  3OYN A;  1U06 A;  4D6W A;  3C4S A;  1WX6 A;  4OF1 A;  4MZP A;  5C6S A;  5FU6 C;  3FJP A;  1TOV A;  1H3Z A;  3L2V A;  2LMJ A;  5KYU B;  2QDY B;  1MMD A;  1PSF A;  4AT1 B;  4CC7 A;  2CSQ A;  2F2X A;  2LC4 A;  2JNG A;  2HZY A;  1GCP A;  4ELY C;  4DA4 A;  1VQM T;  2CH4 W;  2ZAE A;  2C0I A;  2QEX Q;  4GLK A;  4XTZ A;  4E2F B;  1QKW A;  3MP6 A;  3CCU T;  1PM3 A;  1WGS A;  1VQ6 A;  1M27 C;  4FM4 B;  1M2V B;  4LDY A;  4Y28 E;  2K6D A;  4KUL A;  3H8Z A;  1NPR A;  2BIV A;  3BE3 A;  3ZL7 C;  1VQL Q;  1YCS B;  5GAO q;  1QCF A;  4N4G A;  2CP5 A;  3V7S A;  3VUZ A;  2MYS A;  2KAF A;  2P0K A;  1Q82 C;  3DB4 A;  1ZUU A;  2LCS A;  1B34 B;  3NHN A;  2L3Q A;  2F2V A;  4IUR A;  1TXQ A;  4AFZ C;  4PJO E;  3L1A A;  2C0T A;  4N0A C;  1B07 A;  3P8H A;  4N0A A;  2HSP A;  3VUB A;  4PL6 A;  4JPB W;  4BAC A;  2KVQ G;  3D7S B;  2ED1 A;  1TS9 A;  2B8A A;  3CCV Q;  4OMO A;  4R55 A;  4PJM A;  4QQD A;  1KG1 A;  3KBG A;  4BDY A;  3VS2 A;  3OS1 A;  2RJD A;  3CD6 Q;  3RUX A;  1NYF A;  1Y96 A;  4JS4 A;  1KD1 R;  2VYT A;  1D1A A;  1B7T A;  1VYT A;  4C0D C;  3DLL A;  3CC7 A;  1YJN Q;  2DTH A;  1S72 Q;  4R0K A;  1AWJ A;  1S1N A;  1QVG P;  3R6O A;  2GF7 A;  4C0Z A;  1M1G A;  2K3X A;  2JTE A;  3EH2 A;  3CMA A;  3E9F A;  2EQI A;  1PD0 A;  2M0Y A;  3MJX A;  3CCQ T;  3CCR T;  3G4S T;  4CC2 A;  4DQ2 A;  1RLQ C;  1VQ7 T;  3OYI A;  3VS1 A;  4M7A B;  3C95 A;  2YLC A;  3EFO A;  3MO8 A;  1RAB B;  1IZ6 A;  3A8H B;  3VYH B;  4M75 B;  3VS7 A;  1WFW A;  2JS2 A;  2PTK A;  4KGV B;  2ECZ A;  4X9D A;  2E70 A;  4K11 A;  1Q81 R;  5GAN j;  2RPN A;  4MZT A;  3V8J A;  4XU2 A;  4RG8 A;  2YLB A;  4BB7 A;  4J6W A;  2A0F B;  1QVP A;  1K9M R;  3CCL A;  4DOW A;  3M4Y A;  5GAM f;  3LWI A;  1DJ7 B;  3L2U A;  4F17 A;  1CKA A;  1WPY A;  2HQH A;  2KMT A;  1MMG A;  2JZ2 A;  2DM1 A;  5IAY A;  2VUB A;  2LJ1 A;  1UGV A;  2L5Q A;  1TUC A;  2O31 A;  5I21 A;  1BBZ A;  1M90 C;  4M78 D;  1HJD A;  1ZUK A;  1WYX A;  4JRP A;  1X43 A;  1VQP A;  4KRT A;  2FZC B;  2P4R A;  5D6W A;  2OTL Q;  5CQY A;  2SEM A;  4Z89 A;  2DIG A;  1F1B B;  2QI2 A;  1NLO C;  1ACM B;  4OVA A;  1PC0 A;  3OMG A;  4HVU A;  4FW2 A;  3UA6 A;  4FW1 A;  2GTO A;  4F16 A;  3JCM e;  1N5Z A;  1VYV A;  1IGQ A;  3OB9 A;  4MMK A;  1JXO A;  4PJO D;  1BK2 A;  4M78 F;  1K76 A;  1ZBX A;  2R57 A;  2AZV A;  5LJ5 j;  1VYU A;  2J05 A;  4PJJ A;  3CC4 A;  1ZHI A;  1R0B G;  1QCO A;  3DB3 A;  5LJ3 h;  1VQ9 Q;  1RI9 A;  4BY6 B;  4ZN3 A;  1NJI R;  1UTI A;  9ATC B;  5LJ3 g;  2QEX T;  1WHL A;  4EMK A;  1YJ9 Q;  2KDS A;  3A8G B;  3I56 A;  3GIB A;  1UGQ B;  2L89 A;  4XU3 A;  3CCE Q;  4BE0 A;  5KYW A;  2K5I A;  2FZG B;  4J83 A;  1BB9 A;  4PJO F;  4EPC A;  2X9H A;  1VQK A;  3CCJ Q;  1VQL T;  5HY6 A;  3M58 A;  1UHC A;  3TVT A;  1X6B A;  1YIT T;  2GNC A;  1IXD A;  3OQ5 A;  4B9X A;  2L3P A;  3V8L A;  5CK9 A;  1V76 A;  5GMK e;  6AT1 B;  5DLO A;  5GMK i;  3RNJ A;  2L3R A;  1ZA1 B;  4QQG A;  2R58 A;  3PVQ A;  3OYH A;  4JRQ A;  3CCV T;  3VS6 A;  1VQM A;  2RQV A;  3M57 A;  4GY5 A;  3QJ6 A;  4KUD K;  3G6E A;  2VKN A;  1UEC A;  1V29 B;  3CCU A;  3NTH A;  3OS5 A;  3O5Z A;  2L2P A;  4C5E A;  2RQT A;  1S72 T;  3OMC A;  3TU4 K;  2ABL A;  2QGG A;  1PSE A;  2EW3 A;  1IHV A;  1W1F A;  2JTF A;  2RI2 A;  4Z02 A;  2HKQ B;  1NZ9 A;  1KC8 U;  1M1K C;  2JS0 A;  1Y07 A;  3OW2 P;  3QBY A;  4ATO A;  1SF9 A;  2H3E B;  2VAS A;  1SPK A;  2RN8 A;  3OY9 A;  3PIP A;  1G3S A;  2XU8 A;  1PG5 B;  2OJ2 A;  4RTZ A;  2BZX A;  2XDD A;  2K2M A;  1A0N B;  2IPO B;  2QXF A;  3SEM A;  2K2V A;  2XIC A;  3QHS A;  2RH2 A;  1Q7Y R;  2DL4 A;  1BI2 A;  1K1Z A;  1SRL A;  4ZGJ B;  3WVE B;  4FL6 A;  2J7I A;  1N6A A;  3NFC A;  3PMT A;  2QYZ A;  2D0Q B;  4QVC A;  3OYE A;  3ULR B;  4M77 D;  2DO3 A;  3PFS A;  2CP3 A;  1Q86 C;  2L8D A;  5CKE A;  4JJB A;  1JRI A;  1T3S A;  3TEE A;  3EGD A;  2JM8 A;  4M78 G;  4OB1 B;  4A4H A;  2BE7 D;  1RUW A;  2PVG B;  5CVI A;  1VIE A;  3CCR A;  3G4S A;  1LJO A;  4EDU A;  4DOV A;  3G71 Q;  2NUT A;  2DBM A;  4M78 C;  5CAI A;  3GLX A;  4LXC A;  3S3N A;  3JB9 I;  1K73 U;  1YIJ Q;  2FRY A;  1M8M A;  2OTL T;  2RD1 A;  1H3H A;  2GTJ A;  2FG0 A;  3SWN C;  2RI3 A;  2NUZ A;  2RHY A;  3QUI A;  4PJO G;  1GRI A;  4C8Q D;  1M2O A;  4XTX A;  2EQU A;  2ZCF B;  1RAC B;  4OGC A;  4E7J A;  4ZTF A;  4PJO C;  2RK2 A;  1VQ4 Q;  3UAT A;  4PJO A;  3F70 A;  1QLY A;  2K79 A;  4FYY B;  1RAI B;  2RK1 A;  3IQL A;  3A98 A;  4Z88 A;  4OB3 B;  3RDV A;  5KE3 A;  1JU5 C;  1QVG A;  1AWW A;  1VQ9 T;  3L2R A;  4IUV A;  3QDR B;  1N9S A;  4LDU A;  3VRY A;  1YJ9 T;  2EKH A;  2JJ9 A;  3M0R A;  2MIO A;  1ZA2 B;  1VQO T;  3CCE T;  4C8Q F;  1X75 C;  5A0L A;  3THK A;  5FRN A;  3PTA A;  1WLP B;  5EG2 A;  3OA6 A;  4M7A E;  2YT6 A;  1QW1 A;  2EJF A;  3PVL A;  3CCJ T;  5GAO m;  1I1J A;  3JSC A;  2F5K A;  4QVD A;  1XNI A;  4N4I A;  3PIO A;  4WCI A;  4DBR A;  5A0D A;  4HCC A;  2K5F A;  2DNU A;  5HK0 A;  4LUE A;  2E3H A;  1MUZ A;  1QVF S;  1PRM C;  1RLP C;  2LCC A;  4ME7 A;  3JCM c;  2JN0 A;  3FDR A;  1VQN Q;  5KE2 A;  4ANJ A;  1K8A U;  5LJ3 d;  1G8X A;  2QEX A;  2HD0 A;  1U1S A;  4J7F A;  2DLP A;  1PWT A;  3ER0 A;  7AT1 B;  3LGF A;  2EYW A;  3ASK A;  2X3X D;  2PQW A;  2FPD A;  1JBM A;  5D6Y A;  2JTM A;  2GGR A;  1X01 A;  5KYX B;  2GCX A;  2K3Y A;  2EJ9 A;  1BIA A;  2KRS A;  5KH6 A;  1SHG A;  2O9S A;  2RO0 A;  1W2B A;  2AKK A;  2KGT A;  3EH1 A;  1KD1 C;  2KXD A;  5FWC A;  2KQW A;  1KIK A;  3OYF A;  4M77 B;  2X4Y A;  1WIE A;  4C5G A;  3JCM h;  3Q1J A;  4Z8A A;  5CKB A;  2CP6 A;  3C12 A;  3H9N A;  3VJP A;  3JCM g;  3CC2 T;  3EG2 A;  2RJC A;  3CD6 A;  3C94 A;  2DRM A;  1GBQ A;  3QO3 A;  3LWH A;  1NPP A;  3C0C A;  3LH0 A;  3WVD B;  2FPF A;  1YJN A;  1S72 A;  3EG9 B;  2CZ7 B;  4LDV A;  1AWO A;  2EQJ A;  5GAN 3;  2V8K A;  4EIK A;  3VU3 C;  1K73 C;  5KCH A;  1VIF A;  3SHW A;  1TU0 B;  1UG1 A;  5GAN 2;  2EFI A;  3QG1 A;  2LJ0 A;  1ZSZ B;  2GFU A;  2YHT A;  2OTJ T;  2QDL A;  5GAN e;  1YHQ A;  2G3R A;  4BE1 A;  3G71 T;  2EBP A;  3RKY A;  3HKS A;  2EPD A;  5FU6 B;  4HCB A;  4PJL A;  2Y90 A;  4QQ6 A;  1YIJ T;  1K9M C;  1NLP C;  3X24 B;  4C8Q G;  5GMK h;  2M51 A;  3VRZ A;  1NEB A;  2KT1 A;  3OYB A;  1MNE A;  3JB9 D;  4IUP A;  4C8Q C;  2D6F A;  2V8I A;  1Y71 A;  2K5L A;  1MGQ A;  3MHX A;  2EYY A;  1VQ4 T;  4AG1 C;  5EC7 A;  2YSQ A;  2CUB A;  1KK7 A;  3EGU A;  2F2W A;  1E6H A;  1X27 A;  4F14 A;  4B9W A;  3CCS Q;  2JOY A;  2XDB A;  2AHJ B;  3H0H A;  2DZC A;  3OW2 A;  3JB9 F;  5GAN 6;  4OGE A;  2D1X A;  2M16 A;  2R5M A;  2F69 A;  3HFN A;  2ZPE B;  2HL3 A;  2VB6 A;  2VXF A;  2WAC A;  2XHC A;  1N9R A;  1O9S A;  2LTO A;  2OTL A;  3TQ7 P;  5L23 A;  4O5V A;  5GAM j;  2QG9 B;  1QWE A;  4AFS C;  3GOX A;  3I9Q A;  3MEV A;  2HCK A;  1I81 A;  2PZ1 A;  3CPW S;  1NJI C;  3LX7 A;  4LUD A;  1AEY A;  3MP8 A;  1FYN A;  1YIT Q;  2QQ9 A;  4EMH A;  4E7L A;  1VQ8 Q;  2COZ A;  2XD0 A;  1Y96 B;  1KC8 R;  2LZ6 B;  3EHQ A;  2IIM A;  4DEX A;  2ATC B;  5KYY B;  1NBE B;  2QGF B;  4C92 E;  2BTT A;  4JZ4 A;  4PLL A;  4J9F A;  4C0D B;  3J81 E;  2FL7 A;  5KYU A;  1VQ9 A;  3M0S A;  1VQN T;  1YNZ A;  4FT2 A;  4A54 A;  4DEY A;  2CYZ B;  2ENM A;  5J39 A;  2X35 A;  1YJ9 A;  2HBP A;  4J6Y A;  3RBB B;  2Y4X A;  3L2Q A;  1IHW A;  2RHI A;  4RTU A;  5CCA A;  2DZ9 A;  2BZ8 A;  1WXU A;  1PRL C;  2LT1 A;  3OBW A;  5KYN A;  4XK8 E;  1FMW A;  2W0Z A;  2VVK A;  2PUK B;  1U1T A;  2XK0 A;  3TRE A;  3MET A;  2A36 A;  1B34 A;  4L59 A;  5FU7 C;  1WQW A;  3OYJ A;  1AOJ A;  1K9A A;  2F1L A;  2KEA A;  5FW9 A;  3X25 B;  3CME T;  2HMA A;  1VQ5 A;  2FVU A;  1MHN A;  1K73 R;  1KQ1 A;  1UEB A;  2C0O A;  4MML A;  4BD3 A;  2DPP B;  1KFZ A;  3SD4 A;  3CEY A;  2K9G A;  1N8R U; 
#chains in the Genus database with same CATH homology
 1KSW A;  2RMO A;  3KFV A;  3O5Z A;  1X2Q A;  2L2P A;  2L0A A;  2DVJ A;  2RQT A;  1UFF A;  3NMZ C;  2ABL A;  2DL7 A;  1AZE A;  3REB B;  2EW3 A;  1W1F A;  4IIO A;  2DF6 A;  3VS3 A;  1K4U S;  2JS0 A;  1WXB A;  4AG2 C;  2V1Q A;  1LCK A;  2YUO A;  4FSS A;  2KRN A;  2VWF A;  1SPK A;  2RN8 A;  4D8K A;  2OJ2 A;  2YUP A;  1PHT A;  2JMA A;  1W70 A;  3I5S A;  4OML A;  2YUN A;  4RTZ A;  2BZX A;  2K2M A;  3QWY A;  1A0N B;  2BZY A;  4JZ3 A;  1SHF A;  3SEM A;  1J3T A;  1M3C A;  2KRM A;  4AFQ C;  1UDL A;  2DA9 A;  4HVV A;  1VA7 A;  2KYB A;  2AZS A;  2DL4 A;  2KXC A;  1K1Z A;  1SRL A;  2FEI A;  4J9G A;  2J7I A;  1V1C A;  3TSZ A;  1EFN A;  3ULR B;  2EYZ A;  3TSW A;  1W6X A;  1GL5 A;  2H8H A;  4RUG A;  4JJB A;  2YUQ A;  1T3S A;  3CQT A;  2JM8 A;  4ESR A;  2K7A A;  4IIM A;  4LE9 A;  4CC4 B;  2O9V A;  1RUW A;  5I22 A;  2FPE A;  1OPL A;  1YWP A;  4HVW A;  1OOT A;  4J9H A;  2J06 A;  2DBM A;  4A63 B;  2RQW A;  4GBQ A;  1UJY A;  1U5S A;  2FRY A;  1M8M A;  1H3H A;  1MV3 A;  2GTJ A;  2FG0 A;  1TUD A;  4JJD A;  2EGE A;  2NUZ A;  3UF4 A;  1SRM A;  1YWO A;  2X3W D;  2K3B A;  1U3O A;  1GRI A;  3LH5 A;  1IO6 A;  4HCK A;  1TG0 A;  2DX1 A;  3PE0 A;  4OMM A;  1UJ0 A;  2YDL A;  1T3L A;  2FRW A;  2HBW A;  2JW4 A;  2OAW A;  1ZUY A;  2CT4 A;  1ZSG A;  1YP5 A;  3UAT A;  1MV0 B;  1QLY A;  2LP5 A;  1ABO A;  1AD5 A;  1Z9Q A;  2K79 A;  3A98 A;  3IQL A;  4Z88 A;  1JO8 A;  1JU5 C;  4HXJ A;  1AWW A;  3M0U A;  1ZLM A;  4RTY A;  3VRY A;  1KJW A;  2EKH A;  4LNP A;  2E5K A;  3M0R A;  2MIO A;  3UA7 A;  2LNH B;  1JQQ A;  3THK A;  2KYM A;  1WLP B;  2A08 A;  2LQW A;  4J9I A;  2RQR A;  2D0N A;  5ECA A;  1HSQ A;  3VS5 A;  2YT6 A;  3FJ5 A;  3PVL A;  1QWF A;  2EYX A;  1I1J A;  2G6F X;  1I07 A;  3I5R A;  1XOV A;  3I35 A;  1T0H A;  1SEM A;  5IXF A;  2LQN A;  2EGC A;  4RTV A;  1M3A A;  1JEG A;  3M0P A;  4LN2 A;  1UUE A;  4WCI A;  2V1R A;  2DL5 A;  2MOX A;  2DNU A;  1U06 A;  4X1V A;  1WX6 A;  2DJQ A;  2OI3 A;  4LUE A;  1MUZ A;  1PRM C;  1ARK A;  3M0Q A;  1AVZ C;  1HD3 A;  1RLP C;  2CSI A;  2DL3 A;  4QT7 A;  2LJ3 A;  1T0J A;  2LMJ A;  4CC7 A;  2CSQ A;  2F2X A;  2KT8 A;  1GCP A;  1NG2 A;  2CH4 W;  4OMN A;  2C0I A;  2DLP A;  2KR3 A;  1PWT A;  1E6G A;  1QKW A;  2EYW A;  1PKT A;  2X3X D;  3JV3 A;  5I11 A;  1M27 C;  2FPD A;  2L3S A;  4J9C A;  2K6D A;  2GGR A;  1H92 A;  2ROL A;  3M0T A;  3EG0 A;  3ZL7 C;  1YCS B;  2KRS A;  1QCF A;  2LX7 A;  1QKX A;  2SRC A;  2CDT A;  1SHG A;  2DYB A;  3VS4 A;  1FMK A;  2O9S A;  1ZX6 A;  2KRO A;  2JT4 A;  2AKK A;  1ZUU A;  2LCS A;  2KGT A;  3NHN A;  2L3Q A;  2F2V A;  2JMC A;  4GLM A;  4AFZ C;  3H0F A;  2C0T A;  2KXD A;  5FWC A;  1B07 A;  3VS0 A;  1KIK A;  2XMF A;  2HSP A;  1WIE A;  4Z8A A;  1K0X A;  4JPB W;  4J9B A;  2D8H A;  2DMO A;  3REA B;  2ED1 A;  4OMP A;  5IH2 A;  1AWX A;  3EG2 A;  4OMO A;  2KE9 A;  3QWX X;  2DRM A;  4J9E A;  3VS2 A;  1GBQ A;  1NYF A;  3H0I A;  1UE9 A;  3C0C A;  2FPF A;  1GFC A;  1VYT A;  1AWO A;  2RF0 A;  4EIK A;  4R0K A;  1AWJ A;  1S1N A;  2HDA A;  2PNI A;  5IHN A;  1G83 A;  2GBQ A;  3SHW A;  2ED0 A;  1UG1 A;  1PKS A;  2LJ0 A;  1CSK A;  2DE0 X;  2QDL A;  2JTE A;  2JM9 A;  4AFU C;  2EQI A;  2M0Y A;  2EBP A;  4CC2 A;  1H8K A;  2O2O A;  2EPD A;  1RLQ C;  1WXT A;  3EG3 A;  2D8J A;  4ZNX A;  3VS1 A;  1PNJ A;  1NLP C;  2M51 A;  3VRZ A;  1NEB A;  1GBR A;  2RNA A;  1JXM A;  1X2K A;  2CRE A;  2KT1 A;  4JJC A;  3VS7 A;  2J6O A;  1WI7 A;  1WFW A;  5IHI A;  1ZBJ A;  2JS2 A;  1M3B A;  2PTK A;  2B86 A;  2ECZ A;  2EYY A;  4K11 A;  2RPN A;  4E6R A;  2DIL A;  4AG1 C;  5HCK A;  5EC7 A;  1BU1 A;  2YSQ A;  2CUB A;  2A28 A;  2HEQ A;  2RQU A;  3EGU A;  2F2W A;  1E6H A;  2AKL A;  1CKB A;  1UHF A;  1X27 A;  4F14 A;  4D8D A;  4F17 A;  1CKA A;  2DBK A;  3H0H A;  4RTW A;  1B3Q A;  2DM1 A;  2CT3 A;  1OEB A;  4ORZ A;  2D1X A;  5GJW B;  2LJ1 A;  1UGV A;  2O31 A;  1TUC A;  1X69 A;  3NPF A;  2MCN A;  1BBZ A;  1E7O A;  1M30 A;  2NWM A;  1HJD A;  1ZUK A;  1WYX A;  1X43 A;  4Y92 A;  2EVR A;  3R6N A;  5L23 A;  4KRT A;  2P4R A;  1QWE A;  4M4Z A;  4AFS C;  2SEM A;  4Z89 A;  3I9Q A;  2HCK A;  2PZ1 A;  1NLO C;  4LUD A;  1AEY A;  1OV3 A;  4J9D A;  1FYN A;  4HVU A;  3UA6 A;  2GTO A;  4F16 A;  1N5Z A;  2FO0 A;  1VYV A;  2LZ6 B;  2KBT A;  3EHQ A;  2CUD A;  5FWB A;  2IIM A;  4DEX A;  1Y57 A;  2ESW A;  1JXO A;  1OPK A;  1BK2 A;  1Y0M A;  4RTT A;  2BTT A;  4JZ4 A;  4J9F A;  1K76 A;  2DL8 A;  4CC3 A;  2AZV A;  1VYU A;  2J05 A;  3U23 A;  3M0S A;  2J6K A;  1YNZ A;  3GBQ A;  4DEY A;  2ENM A;  1G2B A;  1RI9 A;  2J6F A;  1WA7 A;  1UTI A;  1SSH A;  3H41 A;  1X6G A;  3RBB B;  2GQI A;  3EHR A;  1YN8 A;  1NYG A;  1ABQ A;  1NEG A;  3NGP A;  1WDX A;  4RTU A;  2BZ8 A;  1WXU A;  1PRL C;  1BB9 A;  1I0C A;  5IHK A;  2A37 A;  1UHC A;  3TVT A;  2EGA A;  5IXB A;  2W0Z A;  3EG1 A;  1X6B A;  2VVK A;  2GNC A;  2I0N A;  2L3P A;  2A36 A;  4RTX A;  2ROT A;  1AOJ A;  1K9A A;  2KEA A;  5FW9 A;  3RNJ A;  2JXB A;  2O88 A;  1NM7 A;  2KNB B;  1GFD A;  2AK5 A;  4OMQ A;  3PVQ A;  1AZG B;  1K0S A;  3VS6 A;  2C0O A;  5GJV B;  2RQV A;  1KFZ A;  1GCQ C;  2DRK A;  2VKN A;  1GCQ A;  2CH4 A;  1UEC A;  1Z9Z A;  2K9G A;  2W10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...