4GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
molecule tags Complex (signal transduction/peptide)
source organism Mus musculus
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4gbqA00
3VS1A 2DJQA 2HSPA 2K7AA 1K76A 1NYFA 1UG1A 4OMQA 5FW9A 2SRCA 2DBMA 2AZVA 3RBBB 1X2QA 5GJWB 2AK5A 1QWEA 1X69A 2LCSA 1U06A 1NM7A 2W10A 1ZBJA 1YP5A 2M51A 3M0RA 2DL5A 2XMFA 1VYVA 1PNJA 1VYUA 1GBQA 4Y92A 3I5SA 1W70A 1CKAA 2K9GA 2B86A 2BZ8A 4AFZC 5IHNA 3M0QA 2J06A 3I5RA 1HJDA 4J9EA 1A0NB 2RQRA 1AEYA 2RQVA 2L2PA 3EHRA 1S1NA 2DLPA 1UUEA 1CKBA 2HBWA 2GGRA 2MIOA 2JS2A 4AFQC 1JXOA 2CT3A 4ZNXA 1WYXA 2RQTA 3FJ5A 1PWTA 3KFVA 1JQQA 3TSZA 4HCKA 3SHWA 1Z9QA 2JTEA 4LE9A 2FRWA 2FPDA 2V1QA 2CT4A 1AOJA 2O9VA 1UGVA 2ESWA 5IHIA 1AWXA 2D8JA 2C0IA 2O2OA 4J9CA 2CH4A 1MV0B 2DRKA 3LH5A 3JV3A 2GTOA 3VS4A 2JXBA 1WFWA 4J9IA 4JZ4A 1X2KA 2G6FX 1AVZC 2RNAA 1SRMA 1BB9A 4HVWA 5I11A 2DYBA 2FPFA 4EIKA 2YUNA 1ZUKA 1RI9A 1T0HA 2K6DA 2PNIA 4AFSC 1RLQC 1W1FA 2KRSA 2F2XA 2AZSA 2DL7A 2GNCA 2VVKA 1UDLA 1WIEA 2O31A 3PE0A 4J9GA 2KRMA 1JEGA 3TSWA 5GJVB 1X6GA 3PVLA 2LX7A 3EG2A 2M0YA 5L23A 2MOXA 1KJWA 2KRNA 1T3SA 1YN8A 2DNUA 2F2VA 3VS2A 1M27C 2P4RA 2EYWA 4K11A 1WXTA 1WX6A 4IIOA 2RPNA 1RLPC 1K0XA 4RUGA 1ZSGA 4AFUC 4LNPA 2ED1A 1M3CA 1UTIA 4Z8AA 3M0UA 2SEMA 2KXDA 4OMPA 2A37A 3UATA 1B3QA 1KSWA 1TUCA 3GBQA 4E6RA 2EGEA 1X27A 1PRLC 2HEQA 2DL3A 3I35A 1YWOA 1SRLA 1ABOA 1HD3A 2MCNA 1GCQA 2EBPA 2LQNA 3A98A 1AZGB 1Z9ZA 3VRYA 4HXJA 3IQLA 2BZYA 4F17A 1OPKA 2J05A 1Y0MA 2A36A 1U5SA 2GBQA 1K1ZA 2BTTA 4J9BA 2KYBA 1Y57A 1J3TA 4HVUA 2W0ZA 2DA9A 2E5KA 4IIMA 2KNBB 1MV3A 1K9AA 1YNZA 3VS5A 3RNJA 1GRIA 4J9HA 4R0KA 1ZLMA 4J9DA 1N5ZA 1E6HA 1LCKA 1NEBA 3ZL7C 1TUDA 2CSIA 2LNHB 2CREA 2KGTA 2JW4A 2O88A 4RTUA 2HDAA 3H0IA 3ULRB 3NPFA 2C0TA 2D8HA 2J6FA 1OOTA 2CUBA 4CC4B 2LJ3A 2ED0A 2J6OA 5IXFA 2DILA 1X43A 2FRYA 2LMJA 1H3HA 3O5ZA 4RTTA 3CQTA 4D8DA 1NEGA 1PHTA 3EG1A 2KXCA 2VKNA 4ESRA 2J7IA 1GFDA 1YWPA 2L0AA 4JZ3A 3R6NA 1GFCA 1UJYA 1WDXA 4KRTA 1MUZA 1SHFA 3EG0A 4RTZA 1NLOC 3SEMA 2EGCA 1ABQA 2X3WD 2KEAA 2K2MA 1WI7A 1GCPA 5EC7A 3NGPA 1WLPB 4OMNA 4F16A 1GL5A 4Z88A 4A63B 2BZXA 2LP5A 1E7OA 5ECAA 1AWWA 1QKWA 4JJCA 4HVVA 1M30A 1T3LA 2DE0X 3VS6A 2DL4A 1ZUUA 1G2BA 1GBRA 1UECA 5IHKA 3THKA 3NMZC 1ZUYA 3VRZA 2JT4A 2PZ1A 1GCQC 4GLMA 1QKXA 2RMOA 2FEIA 2FO0A 2JS0A 1E6GA 2EQIA 2EGAA 3TVTA 3VS7A 2L3QA 2KR3A 1JO8A 1WA7A 2YUQA 4DEXA 1BU1A 2CUDA 2EPDA 2KT1A 4LN2A 1K0SA 2V1RA 2CSQA 3UF4A 4JJDA 2GTJA 5I22A 1EFNA 2LQWA 1QCFA 1V1CA 4RTXA 3VS0A 1K4US 2H8HA 2AKKA 1I07A 2YUPA 4OMLA 4X1VA 5FWBA 4GBQA 2VWFA 1U3OA 4RTVA 2YSQA 2CH4W 1JXMA 1XOVA 1PKSA 2KROA 2L3PA 2YUOA 4OMMA 4Z89A 1NYGA 2DVJA 2AKLA 1UJ0A 2KE9A 3NHNA 2KT8A 2KBTA 4J9FA 2NUZA 1PKTA 1KFZA 4D8KA 3I9QA 2RQWA 1SEMA 2ENMA 3EGUA 4FSSA 1CSKA 1OPLA 2JM8A 2EYYA 1WXUA 2K3BA 4JPBW 4DEYA 2K79A 1UHFA 1M3BA 2A28A 2DRMA 2D1XA 3UA7A 2KYMA 1H8KA 1VA7A 4LUDA 2CDTA 3QWYA 3H0FA 1OEBA 2I0NA 3EG3A 1M8MA 1B07A 4RTWA 2DL8A 1QWFA 2DF6A 2ABLA 2FG0A 3C0CA 1NLPC 3U23A 1AWOA 2ROLA 1I1JA 4F14A 3QWXX 3M0SA 2PTKA 3H41A 3H0HA 2C0OA 4LUEA 2EKHA 1OV3A 4WCIA 2FPEA 3M0TA 1UHCA 2HCKA 2LJ1A 1NG2A 2EYZA 3VS3A 1SSHA 1BBZA 1AZEA 2DM1A 3EHQA 2F2WA 1TG0A 3REBB 2OAWA 2OI3A 2YDLA 2LZ6B 2EVRA 2RQUA 2ROTA 3UA6A 2D0NA 2YT6A 2OJ2A 1BK2A 1RUWA 1AD5A 1W6XA 1M3AA 1ARKA 2NWMA 4CC7A 1PRMC 1UFFA 2A08A 3PVQA 4CC2A 1WXBA 2J6KA 1X6BA 5HCKA 2L3SA 1AWJA 1IO6A 1UE9A 2JMCA 2QDLA 4AG1C 2DBKA 4CC3A 2DMOA 3M0PA 5FWCA 2JMAA 4RTYA 1I0CA 1FYNA 4OMOA 1G83A 2DX1A 1VYTA 4QT7A 4ORZA 2LJ0A 4JJBA 1YCSB 1ZX6A 2EW3A 2O9SA 5IH2A 5IXBA 2JM9A 1KIKA 2GQIA 2EYXA 2X3XD 2ECZA 1FMKA 4AG2C 1QLYA 2IIMA 2RF0A 3REAB 1JU5C 1SHGA 1H92A 1HSQA 1T0JA 2RN8A 4M4ZA 1SPKA
chains in the Genus database with same CATH superfamily
3VS1A 1QMCA 2JNGA 2R5MA 2MI6A 3RBBB 1IREB 5GJWB 4NS5A 2LCLA 1VQ4A 1NM7A 3OYIA 2LRQA 4JRKA 2M51A 1NBEB 4M78F 1M90R 1D1CA 4JS5A 2XMFA 1D1AA 3I5SA 1CKAA 2X9HA 1VQNT 2B86A 5CK9A 3CCST 2BZ8A 2WACA 3DKMA 3CC2Q 3I5RA 1A0NB 2D0QB 1AEYA 3EHRA 1Q86U 4M7AC 3EFSA 1VQ8Q 2HL5C 2HBWA 3CCLA 2GGRA 1BIAA 3CPWA 2XU8A 3CXCS 4IUTA 2MIOA 4ZNXA 4X9CA 2RQTA 4MZMA 2HD0A 3FJ5A 1VQ9Q 4HCBA 1PWTA 3KFVA 4WF2A 3JCMe 3TSZA 4HCKA 2DIQA 2EQJA 2HZYA 2JTEA 4QW2A 2FPDA 3BW1A 1UGVA 5IHIA 5KCHA 3PFSA 2CH4A 5D7UA 2CZ7B 1M8VA 2HKNA 1FMWA 3VS4A 1WFWA 3RMSA 5FU7B 1K8AC 1X2KA 4J6XA 2DJZA 2G6FX 4C92F 2PUOB 4ZN3A 3CCMA 1AVZC 1YIJQ 5IAYA 2D6FA 2DYBA 1M1KC 4M7DF 3HP9A 4M77A 3CCSQ 2PNIA 1PM3A 1WPYA 5AYFA 3CC4T 4OB3B 3E19A 5C6SA 2DL7A 4FCYA 1VQLQ 1M2VA 4J9GA 3M56A 1RAHB 5KYXB 3CCQQ 3CMEA 4M7DC 1WHLA 1X6GA 4LD9K 3CBPA 2KSSA 2MOXA 3G71T 3A8GB 1C1AA 1YHQA 2ZPBB 1YN8A 5D6YA 3BDLA 4XTXA 1M27C 4BDZA 1RLPC 2QI2A 4M7AA 5LJ3h 4LNPA 4LD6A 4BE2A 4XU3A 2A7YA 4M75E 2AIRB 3SFMA 3UATA 3GBQA 1WHGA 2LNVA 4KGVB 3EGDA 5IN1A 4ZGJB 3I35A 3MEVA 1ABOA 2MCNA 4E7ZA 1FMVA 2P0KA 4M77E 3G6ET 3A98A 1Z9ZA 5LJ3j 1OPKA 3OYAA 2J05A 2QAZA 4F7UG 5A0GA 2DTIA 2BTTA 1BKBA 1RAGB 1YJNT 3L42A 1J3TA 4HVUA 3WVEB 4GY5A 4HCZA 2KNBB 1K9AA 3T9NA 3VS5A 1GRIA 3OYCA 1N5ZA 1E6HA 1LCKA 3G71Q 3QO3A 2KGTA 3EGDB 4M7DD 2DEUA 2JW4A 1VQKQ 3ULRB 3HHTB 5CKEA 3OYDA 5LL6S 3NPFA 1YIJT 4C8QA 2D8HA 2EJ9A 2ED0A 2J6OA 1OI1A 2DILA 2DKGA 2FRYA 3RESA 2QEXA 4Y28E 1WJQA 1H3HA 3O5ZA 4RTTA 3CQTA 5LJ5g 3G71A 4D8DA 4BY6C 4PJJA 1PHTA 3EG1A 2KXCA 3EFRA 4JRIA 4FT4A 2FZGB 3OSVA 4JZ3A 2PQWA 3OA6A 1IHVA 2V8IA 5CR2A 1GFCA 1KQ1A 3FC3A 2EGCA 3OS0A 3A8MB 2KEAA 2GFAA 4ZTFA 4II1A 1I5LA 1WZOA 2CGHA 4FW1A 4C0FA 2E10A 3DB3A 1VQMQ 4M7AD 3A8HB 5GAMe 4F16A 3MCAB 5KYUB 4BI4A 1KD1U 2F5KA 3M4YA 5IHKA 4JS4A 5D6WA 3NMZC 2DFUA 1IRXA 4GLMA 1E6GA 2EQIA 1VOMA 3VS7A 2PVDB 3ER0A 2KR3A 3CCRT 2YUQA 4DEXA 2KT1A 2JUFA 2LQ8A 4LN2A 5CQYA 3CCJT 2CSQA 2M02A 3OW2P 2YLCA 2L8DA 3KXTA 2HQXA 5CKBA 4RTXA 5GAN6 4OGCA 3JB9I 4F7UE 4OMLA 1R8OB 3OW2S 1XTDA 2QYZA 1TWBA 4FSXA 2RHYA 1XOVA 1PKSA 3FDRA 1TS9A 4C8QD 3V7RA 4C8QF 1G5VA 1QCNA 2K3XA 3S3MA 1QW1A 2AKLA 1Q82U 3CMET 3G1JA 2NUZA 1VQ7A 1SEMA 2ENMA 5GAMj 3HRTA 5GAOq 3OYJA 4PFOA 2K79A 2A28A 2QG9B 2ZGWA 2DRMA 2FL7A 3X28B 2XKOC 3CPWP 2KYMA 2ZAEA 5GMKm 2RI5A 4M75D 3EG3A 1B07A 1W4SA 2DL8A 2Y90A 1M2VB 1PD0A 2BE7D 2DF6A 1WQWA 2ABLA 5J3BA 2CP7A 2PVGB 2QK0A 3MJXA 2I2LA 2RHXA 2DIGA 2QGGA 2ROLA 3QWXX 3SWNA 3H41A 1RADB 1H3ZA 4LUEA 2EKHA 3C94A 1OV3A 2FB7A 2GCXA 4FM4B 4XTYA 4QQGA 4WCIA 3CC4Q 1JRIA 1BI2A 1WNLA 1VQNQ 2LQKA 1HK9A 1NG2A 5LJ5j 1BBZA 4R55A 1TG0A 5GAN7 1VQLT 5C0MA 1TTHB 1MNDA 4MZPA 5DLQE 2PU9B 4FU6A 2D0NA 2PUKB 4C92A 1BK2A 2YWWA 2X4WA 1W6XA 3PIOA 3A8LB 3CCSA 5DY9A 1WXBA 2J6KA 4M78B 4EMGA 1NJIU 2L3SA 1KK7A 1M90C 1IO6A 3KBGA 4QQ6A 3OBYA 3QZ5B 1LPLA 2JMCA 2RHZA 3M0PA 3GNGA 1WJRA 4KBMB 1VQ5A 2DX1A 1VYTA 2HQHA 4M75B 3G7ZA 2LJ0A 2QASA 2CP3A 1S72T 2DYIA 3JAME 3VYHB 3X20B 3M57A 4PNOA 2LVMA 1Q81R 3CCRA 3EH2A 2JM9A 3MEUA 1RAEB 3CCUA 2X3XD 2CS7A 5LJ5e 1MMDA 4BE0A 2IIMA 1ZSZB 1JU5C 3FIFA 1H92A 3OMGA 2RM4A 1HSQA 1T0JA 2RN8A 1M90U 3RUXA 2XG8D 4M78G 2DAQA 1OZ3A 2XD0A 1G3WA 2QGFB 1UG1A 2VYTA 4A4EA 2X4XA 1PG5B 2AZVA 3S6WA 1MHNA 5KE3A 1X69A 2KI7A 1U06A 2E6NA 3MO8A 4PJOA 5GANf 1NPPA 2DL5A 2KVQG 1IGQA 1AT1B 4N4GA 2OTLQ 3V7SA 2FZCB 3OB9A 3P8HA 2GQVA 2GF7A 4XK8E 1W70A 2K9GA 2VC8A 1V29B 3RR6A 3M0QA 2J06A 3OYEA 4XU2A 3CCJQ 2RQVA 1VUBA 2L2PA 8ATCB 2DLPA 2DXUA 4J7FA 3VUZA 1UUEA 1CKBA 3UWNA 4BACA 3M55A 1B34B 4HT9A 1WYXA 5GMKe 5A0LA 4A4KA 2DD4A 4M7AG 2CT4A 1AOJA 2M9UA 2O9VA 3WVDB 2CP0A 4PJOF 2O2OA 1RAFB 4J9CA 4OB1B 3EH1A 1P92A 3HL8A 3JV3A 2GTOA 4J9IA 2P4TA 4Q5WA 3QYHB 2RNAA 2HBPA 1SRMA 1BB9A 2CZ0B 4HVWA 3OS5A 3CC7A 3UPUA 2FPFA 2XICA 4O6JA 1ZUKA 2AHJB 2K5IA 1KQSA 2K6DA 4AFSC 1Q7YU 1VQ9A 1VQ5Q 1W1FA 4C0ZA 2HQEA 1BIBA 1YBYA 1UDLA 2O31A 3PE0A 1Q86C 1VQ7T 3FJPA 3EFOA 1NPRA 2E3HA 2EAYA 3PVLA 3EG2A 2M0YA 4NOYA 1KJWA 1BYMA 1ZSZC 1UGQB 1PC0A 2Y4XA 2JTFA 4FYXB 4C5GA 2QEXT 4J6WA 2R58A 4F7UF 3HSBA 2EYWA 4C8QG 4K11A 1WXTA 1VQMT 4C0DB 4QVCA 4FT2A 1M4ZA 1VQNA 1Q95G 4AFUC 5EG2A 1M3CA 2XIDA 3QYGB 4Z8AA 3M0UA 2DETA 4OMPA 1B3QA 3V8LA 5GAN2 3CCJA 4RG2A 1W2BA 4Y91A 2LCCA 2HEQA 1YWOA 2EBPA 2LQNA 4M77D 1AZGB 1X6OA 3IQLA 2V8JA 3CMEQ 3M4GA 4DQ2A 1Y0MA 4PK4A 5KYUA 3X24B 2JN0A 2GBQA 1K1ZA 1U8RA 3S3OA 2KYBA 3M59A 5CQXA 2W0ZA 5KH6A 2OTLT 5GMKj 1RI0A 2LDMA 3CCLQ 1MV3A 2P0PA 4LDVA 4J9HA 4M78A 3RKYA 1S72A 1ZLMA 1EZZB 4BY6B 3CXCP 1NEBA 3VUBA 3ZL7C 4OGEA 2RI3A 1TUDA 3LGLA 3GOXA 2LNHB 3KUFA 4DBRA 4PJNA 5IXFA 2NLUA 1N9SA 4RKUE 3GIBA 4E7KA 2QQRA 4X34A 3VYGA 3CCVQ 3F70A 3NTIA 2DTHA 2VKNA 1K9MC 1K73R 1GFDA 3VKIA 2L0AA 3R6NA 2VGNA 2VB6A 4E7HA 1FWZA 3FLGA 4ELZC 1WDXA 3CC7Q 3EG0A 4RTZA 5DLOA 3G4ST 4LDYA 4C92C 1GCPA 5EC7A 3NGPA 1WLPB 4FYWB 4OMNA 3S3NA 1KC8R 3CEYA 4LDWA 1VQ6T 4PKCC 3AT1B 1VQPA 3CD6A 1GL5A 5GMKl 4A63B 5LJ3e 3AHUA 3PMTA 3GF5A 2LP5A 5GANd 1Y71A 2XDDA 2HMAA 1AWWA 2P0QA 4HVVA 2K5LA 2DL4A 1ZUUA 3D7SB 2AT1B 2MAMA 3I55Q 1YJ9Q 1GBRA 2QTVA 1UECA 1BCOA 4PJOG 1JJ2A 3JB9J 2FVUA 1RAAB 2E65A 4M77F 2FO0A 2RMOA 1N8RR 1C0MA 5A2QE 4KT0E 1Q81U 3L2QA 5D6XA 3CC2T 5GAMd 1OYXA 1K0SA 3WXMB 1TOVA 3QHSA 4JJDA 2GTJA 1VQ5T 1ZBXA 4DOVA 3JCMf 2LQWA 1QCFA 2JOYA 1V1CA 3VS0A 1K4US 2H8HA 3JCMV 3O8VA 5KCOA 4E7JA 5FWBA 2VWFA 4BB7A 1R0CB 4RTVA 1D3BA 3I56A 1JXMA 3JRZA 4RG8A 4FL6A 2KROA 2NUPB 2YUOA 1NYGA 1VQ4T 2C06A 4DA4A 1UJ0A 2KE9A 5KE2A 1EIFA 4N0AC 1PKTA 1KFZA 2RD1A 3I9QA 4JJNK 7AT1B 2RQWA 2LTOA 2R5AA 5GAOn 1WXUA 1WQ7A 2K3BA 1UGSB 1IGUA 1K8AR 1M3BA 2D9TA 1QVFS 2D1XA 2K4YA 2H3JA 2X4JA 3LWHA 2M1HA 5GANh 2CDTA 1M8MA 1M1KR 1QWFA 3CPFA 2F1LA 2FG0A 4LDUA 1I1JA 4M7DB 1VQPT 3CD6T 2YRCA 2C0OA 4XU0A 1ZA1B 2WSCE 1N8RC 2DEQA 4N0AA 2FPEA 4M78C 2LJ1A 3OSSC 2EYZA 3HFNA 2MWOA 2FHDA 2DM1A 1RL2A 2OI3A 2OAUA 3BY7A 1QVFA 2VXEA 2LZ6B 2RQUA 3CCLT 3CCRQ 5FRNA 2ROTA 2DO3A 2DPPB 2OJ2A 1RUWA 2HAXA 1VQLA 2BE9B 1VQOA 1UFFA 3OYKA 1ZA2B 6AT1B 4M78E 2EYQA 3QPHA 4ZTJA 2E3IA 3A5ZB 1LVKA 5I21A 2QDLA 3OYMA 2DBKA 2X4YA 4RTYA 4EMKB 4M77G 2L5QA 1VQOQ 1O75A 1C6VX 1G3YA 1OZ2A 1X01A 4B9WA 2O4XB 1Y96A 4UC4A 1D0ZA 3EG9B 3PTAA 2O4XA 2ECZA 1FMKA 4A53A 3OMCA 4MMLA 1SHGA 2QXFA 2VXFA 5GAMg 2EWNA 3M5AA 3VU3C 4JRPA 2QA4Q 2E64A 2DJQA 2HSPA 2K7AA 1K76A 2IG0A 3QDRB 1OU9A 2CP6A 4OMQA 1HXDA 2ZPFB 1TH7A 5FW9A 2SRCA 1WJSA 2RH2A 1X2QA 2AK5A 3MP1A 2LCSA 1RAIB 3I55T 1YJ9T 2DZ9A 4DBFA 1PNJA 1M1GA 4M7DA 1KD1C 1K73U 1R77A 5IHNA 4CRIA 1HJDA 4J9EA 4J8OA 1VQPQ 3CD6Q 2LT1A 3OS1A 4E47A 1FX7A 2JS2A 1JXOA 2CT3A 3JCMX 2HL3A 3C12A 2CKKA 2FRWA 2V1QA 3BE3A 3QDFA 2ESWA 2D8JA 3N5BB 1OULA 2C0IA 2DVEA 2RHIA 3SWNC 3E9GA 4F7UB 1WHHA 1MV0B 2DRKA 4ZGDB 1I4K1 2JXBA 4JZ4A 1QVGA 3MEAA 3OBWA 1D3BB 1SG5A 4M75F 4KUIA 1SF9A 4ZGEB 1BI0A 2QTXA 3QKJA 3PGGA 4ATOA 5GAN4 4EIKA 5A0DA 2YUNA 3NTHA 4O5VA 2LX9A 5KYWA 2EQKA 1KC8U 1NJIC 1S72Q 2KRSA 8AT1B 2F2XA 1YJNA 2AZSA 3JCMg 4B6MA 2GNCA 2VVKA 4MZTA 2VGMA 2EKOA 3JCMP 3L2UA 4PJLA 2QA4A 3G6EA 4FW2A 3TSWA 3P8BB 1QVFP 5L8RE 4MDWA 5GJVB 1U1TA 2JJ9A 3L2ZA 5L23A 3EAEA 2KRNA 3CMAA 2WSEE 3QG1A 3TU4K 1T3SA 2RO0A 2BKDN 2F2VA 4FYYB 2P4RA 2K3YA 4IIOA 2RPNA 1VQ7Q 2YRDA 2MK5A 5GAMh 4RUGA 1I81A 1ZSGA 1UTIA 2CP5A 2SEMA 5LJ3f 1KHCA 1KSWA 1TUCA 4E6RA 2EGEA 3LGFA 2Z0WA 4KH0B 1PRLC 4XTVA 2DL3A 1HD3A 1GCQA 4JRQA 1NZ9A 4LDXA 4C5EA 2OTLA 3VRYA 3OYFA 2BZYA 4F17A 4M7AF 3JCMh 2NYSA 4PJOB 4J9BA 3RMQA 1Y57A 1N6AA 5FLXE 3CC4A 2DA9A 2FZKB 2VUBA 1VQ9T 1UGPB 4C0GA 1YNZA 5LJ5h 3CCVT 5I2SA 5GAN3 3ZBDA 1ZSZA 1NJIR 1Y7XA 2CSIA 1Q82R 5CAIA 4C92E 2O88A 4RTUA 2HDAA 2Y4YA 3H0IA 1LOJA 4E2FB 4EPCA 3TCJA 2C0TA 2J6FA 4M75C 1OOTA 4PLIA 4CC4B 2LJ3A 1V76A 3CCUQ 1X43A 4X9DA 2LMJA 5FU6C 3X25B 2RHUA 4OB2B 1M5Q1 1NEGA 4C5HA 3BFMA 2DK3A 5GAOm 4ESRA 4QVZA 2J7IA 1VQ6Q 2FYKA 1YWPA 2K2VA 4HA8A 3OS2A 4RMOA 1Q7YC 1IXDA 2R57A 3EGXB 4HKEA 5J39A 3EGXA 4KRTA 3ZEHA 2YHTA 5GANe 3CCMQ 1YIJA 1NLOC 1ABQA 1WI7A 2ZZDA 2BIVA 4DBQA 2ZPHB 5FRMA 2MWPA 4C8QE 1Q81C 2CZ6B 4Z88A 2BZXA 1TU0B 3JCMd 5KYWB 1QKWA 1I5OB 4JJCA 1QCOA 1M30A 1T3LA 3MPUB 5J26A 3UT1A 3M54A 3CCQT 1G2BA 1YITA 3THKA 3EG9A 1ZUYA 1VQ8A 3ME9A 1OX9A 2JT4A 1I8FA 1GCQC 2PZ1A 3SWNB 1QKXA 2FEIA 2X35A 5FU7C 1QQJA 3TVTA 5FROA 2M0OA 2L3QA 3QSUA 5AT1B 2IVWA 3JCMc 2EIFA 1W2BS 3RKWA 5CKDA 2CUDA 1BI1A 4J6YA 5I22A 1X75C 1EFNA 1UGRB 1JB0E 5CKFA 1KQSP 1YJWT 2ZPGB 2YXYA 2AKKA 2EQUA 4V2SA 2YUPA 1IB8A 2DD5A 1VIFA 4GBQA 1U3OA 2YSQA 2CH4W 1K8AU 3SB2A 1YHQT 2L3PA 4OMMA 1VQOT 4M7AE 2DVJA 4XQ3A 1FXXA 3NHNA 2KT8A 2KBTA 1M1KU 4J9FA 4D8KA 3OYBA 3CBMA 3L2WA 3EGUA 1OPLA 4KGXB 2JM8A 3MEWA 2OTJQ 4OB0B 1QP3A 4DEYA 1UHFA 2XI9A 4DOWA 1KG1A 3FEOA 3OYGA 1H8KA 4ELYC 4LUDA 3OY9A 3OYHA 3H0FA 1OEBA 2I0NA 4RTWA 1VQKA 1G3TA 1D09B 1YI2A 4KUDK 3DB4A 3C0CA 1SKUB 4XTUA 2XDPA 2QQSA 4F14A 5CIUA 2RB6A 1VQ6A 4LXCA 4HCCA 3VJPA 1AHJB 5I2MA 2JZ2A 2COYA 4BI3A 3QJYA 5GAOl 4OP0A 3M0TA 1UHCA 3G4SA 4PJMA 4BE1A 3EHQA 3REBB 2OAWA 1D0YA 2OX7A 3MP6A 2XK0A 3URGA 2NUPA 2L89A 2E70A 2YT6A 1JJ2P 2CP2A 4M78D 4N4IA 1M3AA 2LT4A 1ARKA 5HK0A 4CC7A 1PRMC 2JVVA 5LJ5f 1JBMA 1X6BA 4E7LA 5HCKA 3V7CA 3I56T 3E9FA 1O9SA 2QDYB 2DERA 4R56A 1N27A 2RI2A 3J7AF 2DZCA 2DMOA 4CC3A 1N9RA 2K5FA 1OU8A 4FIBA 5FU6B 2WSFE 1FYNA 1I0CA 4OMOA 4QT7A 1PCXA 1D0XA 4PFPA 3CCVA 1JJ2S 2ZCFB 4JJBA 2K57A 5GMKi 3CC2A 2EW3A 1WHJA 2F69A 5IH2A 3C4SA 3CMAQ 1KIKA 1R0BG 3RKXA 4J7IA 4AG2C 3JSCA 3REAB 2RF0A 1MNEA 1UB4A 5GANg 4JLGA 1W2BP 3RERA 4A4FA 1H641 3X26B 3INZA 2RJCA 4M4ZA 2VV5A 1SPKA 3DLLA 1NYFA 2KDSA 4ME7A 2LC4A 2KK4A 2MF2A 1GXIE 4IURA 4L5GA 1XNIA 2DBMA 3GLXA 3SD4A 4MMKA 2BUDA 1QWEA 4YTLA 1M2OA 4M77C 2W10A 1ZBJA 4EMHA 1XJWB 1YP5A 2B8AA 3M0RA 1VYVA 4C5IA 1VYUA 1GBQA 4Y92A 4F04B 1KQSS 1Y96B 3RIRA 4AFZC 4A54A 1YJWA 2RQRA 5GAN8 5GAN5 2YLBA 1S1NA 2RJFA 3J81E 2HKQB 2RK1A 1YFNA 4PFZA 3CMAT 1YITQ 3VV0A 4QKUA 4AFQC 3FB9A 2MYSA 3PNWC 3QBYA 3SDZA 1JQQA 2O01E 5DM7R 2MMPA 1YJNQ 3SHWA 1Z9QA 1KC8C 1ZQ1A 4LE9A 4PJOE 4QVDA 1AWXA 2COZA 3JCMQ 4RCBA 1VQ8T 1PSEA 3LH5A 3CCQA 3QXEB 4AT1B 3GP8A 3DLMA 1TUGB 3CCEA 5KYNA 2V26A 4AMCA 5I11A 3G4SQ 2X51A 4L59A 2KQWA 3UDCA 1RI9A 1T0HA 4BUGA 3H8ZA 3E2UA 1RLQC 4M77B 1QP2A 2H3EB 3HPWA 1M9SA 5GAOp 3PMIA 2ZPEB 1WIEA 1SSFA 2KRMA 1U1SA 3OQ5A 1F1BB 1JEGA 4PLLA 4B9XA 3CPWS 2COWA 3RDVA 5LJ3d 2RA2A 2LX7A 4IUQA 4C92D 3A8OB 4F7UA 4XTWA 5HK3A 3L2RA 4Z02A 3H9NA 2DNUA 3VS2A 2E4HA 3A1PA 3LH0A 2HSEB 3PT9A 2IPOB 1WX6A 3M9QA 2NUTA 1K0XA 1BI3A 2CZ1B 2ED1A 3L1AA 4JUVA 4XU1A 4EMKC 3OYNA 2KXDA 3EFOB 2A37A 1YI2Q 5GAMf 2MPXC 4TVRA 4WTOB 1X27A 3LYIA 1SRLA 1WHKA 1TSFA 4JDSA 2QA4T 4HXJA 2A36A 3NFCA 4C92G 1U5SA 3L2VA 4A4GA 5LJ3g 2V8KA 1YITT 3NTKA 3ZFJA 2E5KA 2E6ZA 2P84A 3V8JA 5CKHA 4D6WA 3QJ6A 4IIMA 3CCUT 1LNXA 4XAXB 4BDYA 3RNJA 4R0KA 4BI8B 4J9DA 1WHMA 1YJWQ 3CCEQ 4IUPA 3HFOA 1VIEA 1M1FA 4OF1A 4GLKA 2CREA 2QQBA 3LW5E 3E1SA 3HTRA 2EQMA 1VQMA 2A3LA 4EDUA 2CUBA 2VASA 2E1HA 1QVGP 1OQKA 4C8QB 4EMKA 3MHXA 2ZPIB 1PD1A 3R6OA 4M7DG 1IZ6A 4QQDA 3GPLA 3JCMW 1UEBA 4P5NA 1WGSA 1UJYA 3JCMb 1MUZA 1SHFA 2RJEA 1DJ7B 3SEMA 3Q1JA 3META 2X3WD 4FYVB 3TQ7P 2K2MA 3TREA 2EJFA 3OYLA 4OMFB 2DXTA 5HY6A 2E41A 2E5QA 2XDBA 3I56Q 1OX8A 1QVGS 4J5YA 3CCET 4VUBA 3CCMT 1Q82C 4PJOD 1E7OA 5ECAA 5CVIA 3JB9H 1EX4A 2RJDA 2DE0X 3VS6A 4HT8A 2DXCA 5KYYB 4E7SA 3VRZA 1PSFA 4IKFA 5M9OA 2M16A 3MKDA 1ZHIA 2JS0A 3ASKA 5HKCA 3LX7A 2EGAA 3JCMJ 4M75A 5GANj 4M7AB 1JO8A 1WA7A 2QQ9A 4MDXA 1BU1A 3BDUA 5GMKh 2EPDA 2V1RA 1KD1R 1MMGA 3UF4A 4N4HA 4J83A 1Q86R 3JB9F 5CO7A 4CI0C 1B34A 4M75G 1YCYA 3H6ZA 3M58A 1I07A 4X1VA 5KYXA 2KAFA 1MMAA 4C92B 2KY9A 4IUVA 3CBOA 2ATCB 1D1BA 2GFUA 4E7IA 4Z89A 2JTMA 3HRSA 1ACMB 3FRNA 4M7DE 1K9MR 1RABB 3J80E 4KULA 2NUTB 4ZN1A 1HYOA 4PL6A 4KGZB 4FSSA 4L6V5 1CSKA 1XQHA 2EYYA 1YHQQ 2QEXQ 4JPBW 4PJOC 5LJ5d 3HRUA 3UA7A 3HKSA 2OTJA 4KH1B 1Y07A 3LWIA 2HNIA 1VA7A 4ANJA 3V8KA 3QWYA 3JB9D 3CC7T 2XHCA 2QQAA 4XTZA 2L3RA 4RCCA 4IUUA 1NLPC 2A0FB 2F5TX 3M53A 3U23A 1AWOA 3CXCA 3M0SA 3P8DA 5CCAA 1G3SA 2PTKA 1VQKT 1TXQA 3H0HA 2EJGA 2E12A 2DTOA 3OW2A 1Q7YR 1KQ2A 4DBHA 2DXBA 3QUIA 1KHIA 4A4HA 2HCKA 3VS3A 1SSHA 1AZEA 2F2WA 1QVPA 3LLRA 2YDLA 2EFIA 2EVRA 2PVOB 3UA6A 5KYYA 3JB9G 1IHWA 1AD5A 3OYYA 5GAOr 2NWMA 2A08A 3PVQA 1MGQA 2YRVA 3G6EQ 4CC2A 1K73C 2G3RA 1AWJA 1B7TA 1NE8A 1LJOA 2KMTA 1UE9A 4BD3A 4C0DC 4AG1C 4OVAA 5IT9E 5FWCA 4JLIA 3MP8A 3I55A 2JMAA 1YJ9A 4C8QC 1RACB 3GNFB 3TEEA 1G83A 4ORZA 1YI2T 1MMNA 1YCSB 3PIPA 1ZX6A 2RK2A 2O9SA 1K9MU 2CYZB 5IXBA 2GQIA 2EYXA 3C95A 1G8XA 3QZ9B 1QLYA 4NL3A 1VQ4Q 2OTJT 9ATCB 3QIIA 1N8RU 4NL2A 1BCMA
chains in the Genus database with same CATH topology
3VS1A 2DJQA 2HSPA 2K7AA 1K76A 1NYFA 1UG1A 4OMQA 5FW9A 2SRCA 2DBMA 2AZVA 3RBBB 1X2QA 5GJWB 2AK5A 1QWEA 1X69A 2LCSA 1U06A 1NM7A 2W10A 1ZBJA 1YP5A 2M51A 3M0RA 2DL5A 2XMFA 1VYVA 1PNJA 1VYUA 1GBQA 4Y92A 3I5SA 1W70A 1CKAA 2K9GA 2B86A 2BZ8A 4AFZC 5IHNA 3M0QA 2J06A 3I5RA 1HJDA 4J9EA 1A0NB 2RQRA 1AEYA 2RQVA 2L2PA 3EHRA 1S1NA 2DLPA 1UUEA 1CKBA 2HBWA 2GGRA 2MIOA 2JS2A 4AFQC 1JXOA 2CT3A 4ZNXA 1WYXA 2RQTA 3FJ5A 1PWTA 3KFVA 1JQQA 3TSZA 4HCKA 3SHWA 1Z9QA 2JTEA 4LE9A 2FRWA 2FPDA 2V1QA 2CT4A 1AOJA 2O9VA 1UGVA 2ESWA 5IHIA 1AWXA 2D8JA 2C0IA 2O2OA 4J9CA 2CH4A 1MV0B 2DRKA 3LH5A 3JV3A 2GTOA 3VS4A 2JXBA 1WFWA 4J9IA 4JZ4A 1X2KA 2G6FX 1AVZC 2RNAA 1SRMA 1BB9A 4HVWA 5I11A 2DYBA 2FPFA 4EIKA 2YUNA 1ZUKA 1RI9A 1T0HA 2K6DA 2PNIA 4AFSC 1RLQC 1W1FA 2KRSA 2F2XA 2AZSA 2DL7A 2GNCA 2VVKA 1UDLA 1WIEA 2O31A 3PE0A 4J9GA 2KRMA 1JEGA 3TSWA 5GJVB 1X6GA 3PVLA 2LX7A 3EG2A 2M0YA 5L23A 2MOXA 1KJWA 2KRNA 1T3SA 1YN8A 2DNUA 2F2VA 3VS2A 1M27C 2P4RA 2EYWA 4K11A 1WXTA 1WX6A 4IIOA 2RPNA 1RLPC 1K0XA 4RUGA 1ZSGA 4AFUC 4LNPA 2ED1A 1M3CA 1UTIA 4Z8AA 3M0UA 2SEMA 2KXDA 4OMPA 2A37A 3UATA 1B3QA 1KSWA 1TUCA 3GBQA 4E6RA 2EGEA 1X27A 1PRLC 2HEQA 2DL3A 3I35A 1YWOA 1SRLA 1ABOA 1HD3A 2MCNA 1GCQA 2EBPA 2LQNA 3A98A 1AZGB 1Z9ZA 3VRYA 4HXJA 3IQLA 2BZYA 4F17A 1OPKA 2J05A 1Y0MA 2A36A 1U5SA 2GBQA 1K1ZA 2BTTA 4J9BA 2KYBA 1Y57A 1J3TA 4HVUA 2W0ZA 2DA9A 2E5KA 4IIMA 2KNBB 1MV3A 1K9AA 1YNZA 3VS5A 3RNJA 1GRIA 4J9HA 4R0KA 1ZLMA 4J9DA 1N5ZA 1E6HA 1LCKA 1NEBA 3ZL7C 1TUDA 2CSIA 2LNHB 2CREA 2KGTA 2JW4A 2O88A 4RTUA 2HDAA 3H0IA 3ULRB 3NPFA 2C0TA 2D8HA 2J6FA 1OOTA 2CUBA 4CC4B 2LJ3A 2ED0A 2J6OA 5IXFA 2DILA 1X43A 2FRYA 2LMJA 1H3HA 3O5ZA 4RTTA 3CQTA 4D8DA 1NEGA 1PHTA 3EG1A 2KXCA 2VKNA 4ESRA 2J7IA 1GFDA 1YWPA 2L0AA 4JZ3A 3R6NA 1GFCA 1UJYA 1WDXA 4KRTA 1MUZA 1SHFA 3EG0A 4RTZA 1NLOC 3SEMA 2EGCA 1ABQA 2X3WD 2KEAA 2K2MA 1WI7A 1GCPA 5EC7A 3NGPA 1WLPB 4OMNA 4F16A 1GL5A 4Z88A 4A63B 2BZXA 2LP5A 1E7OA 5ECAA 1AWWA 1QKWA 4JJCA 4HVVA 1M30A 1T3LA 2DE0X 3VS6A 2DL4A 1ZUUA 1G2BA 1GBRA 1UECA 5IHKA 3THKA 3NMZC 1ZUYA 3VRZA 2JT4A 2PZ1A 1GCQC 4GLMA 1QKXA 2RMOA 2FEIA 2FO0A 2JS0A 1E6GA 2EQIA 2EGAA 3TVTA 3VS7A 2L3QA 2KR3A 1JO8A 1WA7A 2YUQA 4DEXA 1BU1A 2CUDA 2EPDA 2KT1A 4LN2A 1K0SA 2V1RA 2CSQA 3UF4A 4JJDA 2GTJA 5I22A 1EFNA 2LQWA 1QCFA 1V1CA 4RTXA 3VS0A 1K4US 2H8HA 2AKKA 1I07A 2YUPA 4OMLA 4X1VA 5FWBA 4GBQA 2VWFA 1U3OA 4RTVA 2YSQA 2CH4W 1JXMA 1XOVA 1PKSA 2KROA 2L3PA 2YUOA 4OMMA 4Z89A 1NYGA 2DVJA 2AKLA 1UJ0A 2KE9A 3NHNA 2KT8A 2KBTA 4J9FA 2NUZA 1PKTA 1KFZA 4D8KA 3I9QA 2RQWA 1SEMA 2ENMA 3EGUA 4FSSA 1CSKA 1OPLA 2JM8A 2EYYA 1WXUA 2K3BA 4JPBW 4DEYA 2K79A 1UHFA 1M3BA 2A28A 2DRMA 2D1XA 3UA7A 2KYMA 1H8KA 1VA7A 4LUDA 2CDTA 3QWYA 3H0FA 1OEBA 2I0NA 3EG3A 1M8MA 1B07A 4RTWA 2DL8A 1QWFA 2DF6A 2ABLA 2FG0A 3C0CA 1NLPC 3U23A 1AWOA 2ROLA 1I1JA 4F14A 3QWXX 3M0SA 2PTKA 3H41A 3H0HA 2C0OA 4LUEA 2EKHA 1OV3A 4WCIA 2FPEA 3M0TA 1UHCA 2HCKA 2LJ1A 1NG2A 2EYZA 3VS3A 1SSHA 1BBZA 1AZEA 2DM1A 3EHQA 2F2WA 1TG0A 3REBB 2OAWA 2OI3A 2YDLA 2LZ6B 2EVRA 2RQUA 2ROTA 3UA6A 2D0NA 2YT6A 2OJ2A 1BK2A 1RUWA 1AD5A 1W6XA 1M3AA 1ARKA 2NWMA 4CC7A 1PRMC 1UFFA 2A08A 3PVQA 4CC2A 1WXBA 2J6KA 1X6BA 5HCKA 2L3SA 1AWJA 1IO6A 1UE9A 2JMCA 2QDLA 4AG1C 2DBKA 4CC3A 2DMOA 3M0PA 5FWCA 2JMAA 4RTYA 1I0CA 1FYNA 4OMOA 1G83A 2DX1A 1VYTA 4QT7A 4ORZA 2LJ0A 4JJBA 1YCSB 1ZX6A 2EW3A 2O9SA 5IH2A 5IXBA 2JM9A 1KIKA 2GQIA 2EYXA 2X3XD 2ECZA 1FMKA 4AG2C 1QLYA 2IIMA 2RF0A 3REAB 1JU5C 1SHGA 1H92A 1HSQA 1T0JA 2RN8A 4M4ZA 1SPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS1 A;  2DJQ A;  2HSP A;  2K7A A;  1K76 A;  1NYF A;  1UG1 A;  4OMQ A;  5FW9 A;  2SRC A;  2DBM A;  2AZV A;  3RBB B;  1X2Q A;  5GJW B;  2AK5 A;  1QWE A;  1X69 A;  2LCS A;  1U06 A;  1NM7 A;  2W10 A;  1ZBJ A;  1YP5 A;  2M51 A;  3M0R A;  2DL5 A;  2XMF A;  1VYV A;  1PNJ A;  1VYU A;  1GBQ A;  4Y92 A;  3I5S A;  1W70 A;  1CKA A;  2K9G A;  2B86 A;  2BZ8 A;  4AFZ C;  5IHN A;  3M0Q A;  2J06 A;  3I5R A;  1HJD A;  4J9E A;  1A0N B;  2RQR A;  1AEY A;  2RQV A;  2L2P A;  3EHR A;  1S1N A;  2DLP A;  1UUE A;  1CKB A;  2HBW A;  2GGR A;  2MIO A;  2JS2 A;  4AFQ C;  1JXO A;  2CT3 A;  4ZNX A;  1WYX A;  2RQT A;  3FJ5 A;  1PWT A;  3KFV A;  1JQQ A;  3TSZ A;  4HCK A;  3SHW A;  1Z9Q A;  2JTE A;  4LE9 A;  2FRW A;  2FPD A;  2V1Q A;  2CT4 A;  1AOJ A;  2O9V A;  1UGV A;  2ESW A;  5IHI A;  1AWX A;  2D8J A;  2C0I A;  2O2O A;  4J9C A;  2CH4 A;  1MV0 B;  2DRK A;  3LH5 A;  3JV3 A;  2GTO A;  3VS4 A;  2JXB A;  1WFW A;  4J9I A;  4JZ4 A;  1X2K A;  2G6F X;  1AVZ C;  2RNA A;  1SRM A;  1BB9 A;  4HVW A;  5I11 A;  2DYB A;  2FPF A;  4EIK A;  2YUN A;  1ZUK A;  1RI9 A;  1T0H A;  2K6D A;  2PNI A;  4AFS C;  1RLQ C;  1W1F A;  2KRS A;  2F2X A;  2AZS A;  2DL7 A;  2GNC A;  2VVK A;  1UDL A;  1WIE A;  2O31 A;  3PE0 A;  4J9G A;  2KRM A;  1JEG A;  3TSW A;  5GJV B;  1X6G A;  3PVL A;  2LX7 A;  3EG2 A;  2M0Y A;  5L23 A;  2MOX A;  1KJW A;  2KRN A;  1T3S A;  1YN8 A;  2DNU A;  2F2V A;  3VS2 A;  1M27 C;  2P4R A;  2EYW A;  4K11 A;  1WXT A;  1WX6 A;  4IIO A;  2RPN A;  1RLP C;  1K0X A;  4RUG A;  1ZSG A;  4AFU C;  4LNP A;  2ED1 A;  1M3C A;  1UTI A;  4Z8A A;  3M0U A;  2SEM A;  2KXD A;  4OMP A;  2A37 A;  3UAT A;  1B3Q A;  1KSW A;  1TUC A;  3GBQ A;  4E6R A;  2EGE A;  1X27 A;  1PRL C;  2HEQ A;  2DL3 A;  3I35 A;  1YWO A;  1SRL A;  1ABO A;  1HD3 A;  2MCN A;  1GCQ A;  2EBP A;  2LQN A;  3A98 A;  1AZG B;  1Z9Z A;  3VRY A;  4HXJ A;  3IQL A;  2BZY A;  4F17 A;  1OPK A;  2J05 A;  1Y0M A;  2A36 A;  1U5S A;  2GBQ A;  1K1Z A;  2BTT A;  4J9B A;  2KYB A;  1Y57 A;  1J3T A;  4HVU A;  2W0Z A;  2DA9 A;  2E5K A;  4IIM A;  2KNB B;  1MV3 A;  1K9A A;  1YNZ A;  3VS5 A;  3RNJ A;  1GRI A;  4J9H A;  4R0K A;  1ZLM A;  4J9D A;  1N5Z A;  1E6H A;  1LCK A;  1NEB A;  3ZL7 C;  1TUD A;  2CSI A;  2LNH B;  2CRE A;  2KGT A;  2JW4 A;  2O88 A;  4RTU A;  2HDA A;  3H0I A;  3ULR B;  3NPF A;  2C0T A;  2D8H A;  2J6F A;  1OOT A;  2CUB A;  4CC4 B;  2LJ3 A;  2ED0 A;  2J6O A;  5IXF A;  2DIL A;  1X43 A;  2FRY A;  2LMJ A;  1H3H A;  3O5Z A;  4RTT A;  3CQT A;  4D8D A;  1NEG A;  1PHT A;  3EG1 A;  2KXC A;  2VKN A;  4ESR A;  2J7I A;  1GFD A;  1YWP A;  2L0A A;  4JZ3 A;  3R6N A;  1GFC A;  1UJY A;  1WDX A;  4KRT A;  1MUZ A;  1SHF A;  3EG0 A;  4RTZ A;  1NLO C;  3SEM A;  2EGC A;  1ABQ A;  2X3W D;  2KEA A;  2K2M A;  1WI7 A;  1GCP A;  5EC7 A;  3NGP A;  1WLP B;  4OMN A;  4F16 A;  1GL5 A;  4Z88 A;  4A63 B;  2BZX A;  2LP5 A;  1E7O A;  5ECA A;  1AWW A;  1QKW A;  4JJC A;  4HVV A;  1M30 A;  1T3L A;  2DE0 X;  3VS6 A;  2DL4 A;  1ZUU A;  1G2B A;  1GBR A;  1UEC A;  5IHK A;  3THK A;  3NMZ C;  1ZUY A;  3VRZ A;  2JT4 A;  2PZ1 A;  1GCQ C;  4GLM A;  1QKX A;  2RMO A;  2FEI A;  2FO0 A;  2JS0 A;  1E6G A;  2EQI A;  2EGA A;  3TVT A;  3VS7 A;  2L3Q A;  2KR3 A;  1JO8 A;  1WA7 A;  2YUQ A;  4DEX A;  1BU1 A;  2CUD A;  2EPD A;  2KT1 A;  4LN2 A;  1K0S A;  2V1R A;  2CSQ A;  3UF4 A;  4JJD A;  2GTJ A;  5I22 A;  1EFN A;  2LQW A;  1QCF A;  1V1C A;  4RTX A;  3VS0 A;  1K4U S;  2H8H A;  2AKK A;  1I07 A;  2YUP A;  4OML A;  4X1V A;  5FWB A;  4GBQ A;  2VWF A;  1U3O A;  4RTV A;  2YSQ A;  2CH4 W;  1JXM A;  1XOV A;  1PKS A;  2KRO A;  2L3P A;  2YUO A;  4OMM A;  4Z89 A;  1NYG A;  2DVJ A;  2AKL A;  1UJ0 A;  2KE9 A;  3NHN A;  2KT8 A;  2KBT A;  4J9F A;  2NUZ A;  1PKT A;  1KFZ A;  4D8K A;  3I9Q A;  2RQW A;  1SEM A;  2ENM A;  3EGU A;  4FSS A;  1CSK A;  1OPL A;  2JM8 A;  2EYY A;  1WXU A;  2K3B A;  4JPB W;  4DEY A;  2K79 A;  1UHF A;  1M3B A;  2A28 A;  2DRM A;  2D1X A;  3UA7 A;  2KYM A;  1H8K A;  1VA7 A;  4LUD A;  2CDT A;  3QWY A;  3H0F A;  1OEB A;  2I0N A;  3EG3 A;  1M8M A;  1B07 A;  4RTW A;  2DL8 A;  1QWF A;  2DF6 A;  2ABL A;  2FG0 A;  3C0C A;  1NLP C;  3U23 A;  1AWO A;  2ROL A;  1I1J A;  4F14 A;  3QWX X;  3M0S A;  2PTK A;  3H41 A;  3H0H A;  2C0O A;  4LUE A;  2EKH A;  1OV3 A;  4WCI A;  2FPE A;  3M0T A;  1UHC A;  2HCK A;  2LJ1 A;  1NG2 A;  2EYZ A;  3VS3 A;  1SSH A;  1BBZ A;  1AZE A;  2DM1 A;  3EHQ A;  2F2W A;  1TG0 A;  3REB B;  2OAW A;  2OI3 A;  2YDL A;  2LZ6 B;  2EVR A;  2RQU A;  2ROT A;  3UA6 A;  2D0N A;  2YT6 A;  2OJ2 A;  1BK2 A;  1RUW A;  1AD5 A;  1W6X A;  1M3A A;  1ARK A;  2NWM A;  4CC7 A;  1PRM C;  1UFF A;  2A08 A;  3PVQ A;  4CC2 A;  1WXB A;  2J6K A;  1X6B A;  5HCK A;  2L3S A;  1AWJ A;  1IO6 A;  1UE9 A;  2JMC A;  2QDL A;  4AG1 C;  2DBK A;  4CC3 A;  2DMO A;  3M0P A;  5FWC A;  2JMA A;  4RTY A;  1I0C A;  1FYN A;  4OMO A;  1G83 A;  2DX1 A;  1VYT A;  4QT7 A;  4ORZ A;  2LJ0 A;  4JJB A;  1YCS B;  1ZX6 A;  2EW3 A;  2O9S A;  5IH2 A;  5IXB A;  2JM9 A;  1KIK A;  2GQI A;  2EYX A;  2X3X D;  2ECZ A;  1FMK A;  4AG2 C;  1QLY A;  2IIM A;  2RF0 A;  3REA B;  1JU5 C;  1SHG A;  1H92 A;  1HSQ A;  1T0J A;  2RN8 A;  4M4Z A;  1SPK A; 
#chains in the Genus database with same CATH topology
 3VS1 A;  1QMC A;  2JNG A;  2R5M A;  2MI6 A;  3RBB B;  1IRE B;  5GJW B;  4NS5 A;  2LCL A;  1VQ4 A;  1NM7 A;  3OYI A;  2LRQ A;  4JRK A;  2M51 A;  1NBE B;  4M78 F;  1M90 R;  1D1C A;  4JS5 A;  2XMF A;  1D1A A;  3I5S A;  1CKA A;  2X9H A;  1VQN T;  2B86 A;  5CK9 A;  3CCS T;  2BZ8 A;  2WAC A;  3DKM A;  3CC2 Q;  3I5R A;  1A0N B;  2D0Q B;  1AEY A;  3EHR A;  1Q86 U;  4M7A C;  3EFS A;  1VQ8 Q;  2HL5 C;  2HBW A;  3CCL A;  2GGR A;  1BIA A;  3CPW A;  2XU8 A;  3CXC S;  4IUT A;  2MIO A;  4ZNX A;  4X9C A;  2RQT A;  4MZM A;  2HD0 A;  3FJ5 A;  1VQ9 Q;  4HCB A;  1PWT A;  3KFV A;  4WF2 A;  3JCM e;  3TSZ A;  4HCK A;  2DIQ A;  2EQJ A;  2HZY A;  2JTE A;  4QW2 A;  2FPD A;  3BW1 A;  1UGV A;  5IHI A;  5KCH A;  3PFS A;  2CH4 A;  5D7U A;  2CZ7 B;  1M8V A;  2HKN A;  1FMW A;  3VS4 A;  1WFW A;  3RMS A;  5FU7 B;  1K8A C;  1X2K A;  4J6X A;  2DJZ A;  2G6F X;  4C92 F;  2PUO B;  4ZN3 A;  3CCM A;  1AVZ C;  1YIJ Q;  5IAY A;  2D6F A;  2DYB A;  1M1K C;  4M7D F;  3HP9 A;  4M77 A;  3CCS Q;  2PNI A;  1PM3 A;  1WPY A;  5AYF A;  3CC4 T;  4OB3 B;  3E19 A;  5C6S A;  2DL7 A;  4FCY A;  1VQL Q;  1M2V A;  4J9G A;  3M56 A;  1RAH B;  5KYX B;  3CCQ Q;  3CME A;  4M7D C;  1WHL A;  1X6G A;  4LD9 K;  3CBP A;  2KSS A;  2MOX A;  3G71 T;  3A8G B;  1C1A A;  1YHQ A;  2ZPB B;  1YN8 A;  5D6Y A;  3BDL A;  4XTX A;  1M27 C;  4BDZ A;  1RLP C;  2QI2 A;  4M7A A;  5LJ3 h;  4LNP A;  4LD6 A;  4BE2 A;  4XU3 A;  2A7Y A;  4M75 E;  2AIR B;  3SFM A;  3UAT A;  3GBQ A;  1WHG A;  2LNV A;  4KGV B;  3EGD A;  5IN1 A;  4ZGJ B;  3I35 A;  3MEV A;  1ABO A;  2MCN A;  4E7Z A;  1FMV A;  2P0K A;  4M77 E;  3G6E T;  3A98 A;  1Z9Z A;  5LJ3 j;  1OPK A;  3OYA A;  2J05 A;  2QAZ A;  4F7U G;  5A0G A;  2DTI A;  2BTT A;  1BKB A;  1RAG B;  1YJN T;  3L42 A;  1J3T A;  4HVU A;  3WVE B;  4GY5 A;  4HCZ A;  2KNB B;  1K9A A;  3T9N A;  3VS5 A;  1GRI A;  3OYC A;  1N5Z A;  1E6H A;  1LCK A;  3G71 Q;  3QO3 A;  2KGT A;  3EGD B;  4M7D D;  2DEU A;  2JW4 A;  1VQK Q;  3ULR B;  3HHT B;  5CKE A;  3OYD A;  5LL6 S;  3NPF A;  1YIJ T;  4C8Q A;  2D8H A;  2EJ9 A;  2ED0 A;  2J6O A;  1OI1 A;  2DIL A;  2DKG A;  2FRY A;  3RES A;  2QEX A;  4Y28 E;  1WJQ A;  1H3H A;  3O5Z A;  4RTT A;  3CQT A;  5LJ5 g;  3G71 A;  4D8D A;  4BY6 C;  4PJJ A;  1PHT A;  3EG1 A;  2KXC A;  3EFR A;  4JRI A;  4FT4 A;  2FZG B;  3OSV A;  4JZ3 A;  2PQW A;  3OA6 A;  1IHV A;  2V8I A;  5CR2 A;  1GFC A;  1KQ1 A;  3FC3 A;  2EGC A;  3OS0 A;  3A8M B;  2KEA A;  2GFA A;  4ZTF A;  4II1 A;  1I5L A;  1WZO A;  2CGH A;  4FW1 A;  4C0F A;  2E10 A;  3DB3 A;  1VQM Q;  4M7A D;  3A8H B;  5GAM e;  4F16 A;  3MCA B;  5KYU B;  4BI4 A;  1KD1 U;  2F5K A;  3M4Y A;  5IHK A;  4JS4 A;  5D6W A;  3NMZ C;  2DFU A;  1IRX A;  4GLM A;  1E6G A;  2EQI A;  1VOM A;  3VS7 A;  2PVD B;  3ER0 A;  2KR3 A;  3CCR T;  2YUQ A;  4DEX A;  2KT1 A;  2JUF A;  2LQ8 A;  4LN2 A;  5CQY A;  3CCJ T;  2CSQ A;  2M02 A;  3OW2 P;  2YLC A;  2L8D A;  3KXT A;  2HQX A;  5CKB A;  4RTX A;  5GAN 6;  4OGC A;  3JB9 I;  4F7U E;  4OML A;  1R8O B;  3OW2 S;  1XTD A;  2QYZ A;  1TWB A;  4FSX A;  2RHY A;  1XOV A;  1PKS A;  3FDR A;  1TS9 A;  4C8Q D;  3V7R A;  4C8Q F;  1G5V A;  1QCN A;  2K3X A;  3S3M A;  1QW1 A;  2AKL A;  1Q82 U;  3CME T;  3G1J A;  2NUZ A;  1VQ7 A;  1SEM A;  2ENM A;  5GAM j;  3HRT A;  5GAO q;  3OYJ A;  4PFO A;  2K79 A;  2A28 A;  2QG9 B;  2ZGW A;  2DRM A;  2FL7 A;  3X28 B;  2XKO C;  3CPW P;  2KYM A;  2ZAE A;  5GMK m;  2RI5 A;  4M75 D;  3EG3 A;  1B07 A;  1W4S A;  2DL8 A;  2Y90 A;  1M2V B;  1PD0 A;  2BE7 D;  2DF6 A;  1WQW A;  2ABL A;  5J3B A;  2CP7 A;  2PVG B;  2QK0 A;  3MJX A;  2I2L A;  2RHX A;  2DIG A;  2QGG A;  2ROL A;  3QWX X;  3SWN A;  3H41 A;  1RAD B;  1H3Z A;  4LUE A;  2EKH A;  3C94 A;  1OV3 A;  2FB7 A;  2GCX A;  4FM4 B;  4XTY A;  4QQG A;  4WCI A;  3CC4 Q;  1JRI A;  1BI2 A;  1WNL A;  1VQN Q;  2LQK A;  1HK9 A;  1NG2 A;  5LJ5 j;  1BBZ A;  4R55 A;  1TG0 A;  5GAN 7;  1VQL T;  5C0M A;  1TTH B;  1MND A;  4MZP A;  5DLQ E;  2PU9 B;  4FU6 A;  2D0N A;  2PUK B;  4C92 A;  1BK2 A;  2YWW A;  2X4W A;  1W6X A;  3PIO A;  3A8L B;  3CCS A;  5DY9 A;  1WXB A;  2J6K A;  4M78 B;  4EMG A;  1NJI U;  2L3S A;  1KK7 A;  1M90 C;  1IO6 A;  3KBG A;  4QQ6 A;  3OBY A;  3QZ5 B;  1LPL A;  2JMC A;  2RHZ A;  3M0P A;  3GNG A;  1WJR A;  4KBM B;  1VQ5 A;  2DX1 A;  1VYT A;  2HQH A;  4M75 B;  3G7Z A;  2LJ0 A;  2QAS A;  2CP3 A;  1S72 T;  2DYI A;  3JAM E;  3VYH B;  3X20 B;  3M57 A;  4PNO A;  2LVM A;  1Q81 R;  3CCR A;  3EH2 A;  2JM9 A;  3MEU A;  1RAE B;  3CCU A;  2X3X D;  2CS7 A;  5LJ5 e;  1MMD A;  4BE0 A;  2IIM A;  1ZSZ B;  1JU5 C;  3FIF A;  1H92 A;  3OMG A;  2RM4 A;  1HSQ A;  1T0J A;  2RN8 A;  1M90 U;  3RUX A;  2XG8 D;  4M78 G;  2DAQ A;  1OZ3 A;  2XD0 A;  1G3W A;  2QGF B;  1UG1 A;  2VYT A;  4A4E A;  2X4X A;  1PG5 B;  2AZV A;  3S6W A;  1MHN A;  5KE3 A;  1X69 A;  2KI7 A;  1U06 A;  2E6N A;  3MO8 A;  4PJO A;  5GAN f;  1NPP A;  2DL5 A;  2KVQ G;  1IGQ A;  1AT1 B;  4N4G A;  2OTL Q;  3V7S A;  2FZC B;  3OB9 A;  3P8H A;  2GQV A;  2GF7 A;  4XK8 E;  1W70 A;  2K9G A;  2VC8 A;  1V29 B;  3RR6 A;  3M0Q A;  2J06 A;  3OYE A;  4XU2 A;  3CCJ Q;  2RQV A;  1VUB A;  2L2P A;  8ATC B;  2DLP A;  2DXU A;  4J7F A;  3VUZ A;  1UUE A;  1CKB A;  3UWN A;  4BAC A;  3M55 A;  1B34 B;  4HT9 A;  1WYX A;  5GMK e;  5A0L A;  4A4K A;  2DD4 A;  4M7A G;  2CT4 A;  1AOJ A;  2M9U A;  2O9V A;  3WVD B;  2CP0 A;  4PJO F;  2O2O A;  1RAF B;  4J9C A;  4OB1 B;  3EH1 A;  1P92 A;  3HL8 A;  3JV3 A;  2GTO A;  4J9I A;  2P4T A;  4Q5W A;  3QYH B;  2RNA A;  2HBP A;  1SRM A;  1BB9 A;  2CZ0 B;  4HVW A;  3OS5 A;  3CC7 A;  3UPU A;  2FPF A;  2XIC A;  4O6J A;  1ZUK A;  2AHJ B;  2K5I A;  1KQS A;  2K6D A;  4AFS C;  1Q7Y U;  1VQ9 A;  1VQ5 Q;  1W1F A;  4C0Z A;  2HQE A;  1BIB A;  1YBY A;  1UDL A;  2O31 A;  3PE0 A;  1Q86 C;  1VQ7 T;  3FJP A;  3EFO A;  1NPR A;  2E3H A;  2EAY A;  3PVL A;  3EG2 A;  2M0Y A;  4NOY A;  1KJW A;  1BYM A;  1ZSZ C;  1UGQ B;  1PC0 A;  2Y4X A;  2JTF A;  4FYX B;  4C5G A;  2QEX T;  4J6W A;  2R58 A;  4F7U F;  3HSB A;  2EYW A;  4C8Q G;  4K11 A;  1WXT A;  1VQM T;  4C0D B;  4QVC A;  4FT2 A;  1M4Z A;  1VQN A;  1Q95 G;  4AFU C;  5EG2 A;  1M3C A;  2XID A;  3QYG B;  4Z8A A;  3M0U A;  2DET A;  4OMP A;  1B3Q A;  3V8L A;  5GAN 2;  3CCJ A;  4RG2 A;  1W2B A;  4Y91 A;  2LCC A;  2HEQ A;  1YWO A;  2EBP A;  2LQN A;  4M77 D;  1AZG B;  1X6O A;  3IQL A;  2V8J A;  3CME Q;  3M4G A;  4DQ2 A;  1Y0M A;  4PK4 A;  5KYU A;  3X24 B;  2JN0 A;  2GBQ A;  1K1Z A;  1U8R A;  3S3O A;  2KYB A;  3M59 A;  5CQX A;  2W0Z A;  5KH6 A;  2OTL T;  5GMK j;  1RI0 A;  2LDM A;  3CCL Q;  1MV3 A;  2P0P A;  4LDV A;  4J9H A;  4M78 A;  3RKY A;  1S72 A;  1ZLM A;  1EZZ B;  4BY6 B;  3CXC P;  1NEB A;  3VUB A;  3ZL7 C;  4OGE A;  2RI3 A;  1TUD A;  3LGL A;  3GOX A;  2LNH B;  3KUF A;  4DBR A;  4PJN A;  5IXF A;  2NLU A;  1N9S A;  4RKU E;  3GIB A;  4E7K A;  2QQR A;  4X34 A;  3VYG A;  3CCV Q;  3F70 A;  3NTI A;  2DTH A;  2VKN A;  1K9M C;  1K73 R;  1GFD A;  3VKI A;  2L0A A;  3R6N A;  2VGN A;  2VB6 A;  4E7H A;  1FWZ A;  3FLG A;  4ELZ C;  1WDX A;  3CC7 Q;  3EG0 A;  4RTZ A;  5DLO A;  3G4S T;  4LDY A;  4C92 C;  1GCP A;  5EC7 A;  3NGP A;  1WLP B;  4FYW B;  4OMN A;  3S3N A;  1KC8 R;  3CEY A;  4LDW A;  1VQ6 T;  4PKC C;  3AT1 B;  1VQP A;  3CD6 A;  1GL5 A;  5GMK l;  4A63 B;  5LJ3 e;  3AHU A;  3PMT A;  3GF5 A;  2LP5 A;  5GAN d;  1Y71 A;  2XDD A;  2HMA A;  1AWW A;  2P0Q A;  4HVV A;  2K5L A;  2DL4 A;  1ZUU A;  3D7S B;  2AT1 B;  2MAM A;  3I55 Q;  1YJ9 Q;  1GBR A;  2QTV A;  1UEC A;  1BCO A;  4PJO G;  1JJ2 A;  3JB9 J;  2FVU A;  1RAA B;  2E65 A;  4M77 F;  2FO0 A;  2RMO A;  1N8R R;  1C0M A;  5A2Q E;  4KT0 E;  1Q81 U;  3L2Q A;  5D6X A;  3CC2 T;  5GAM d;  1OYX A;  1K0S A;  3WXM B;  1TOV A;  3QHS A;  4JJD A;  2GTJ A;  1VQ5 T;  1ZBX A;  4DOV A;  3JCM f;  2LQW A;  1QCF A;  2JOY A;  1V1C A;  3VS0 A;  1K4U S;  2H8H A;  3JCM V;  3O8V A;  5KCO A;  4E7J A;  5FWB A;  2VWF A;  4BB7 A;  1R0C B;  4RTV A;  1D3B A;  3I56 A;  1JXM A;  3JRZ A;  4RG8 A;  4FL6 A;  2KRO A;  2NUP B;  2YUO A;  1NYG A;  1VQ4 T;  2C06 A;  4DA4 A;  1UJ0 A;  2KE9 A;  5KE2 A;  1EIF A;  4N0A C;  1PKT A;  1KFZ A;  2RD1 A;  3I9Q A;  4JJN K;  7AT1 B;  2RQW A;  2LTO A;  2R5A A;  5GAO n;  1WXU A;  1WQ7 A;  2K3B A;  1UGS B;  1IGU A;  1K8A R;  1M3B A;  2D9T A;  1QVF S;  2D1X A;  2K4Y A;  2H3J A;  2X4J A;  3LWH A;  2M1H A;  5GAN h;  2CDT A;  1M8M A;  1M1K R;  1QWF A;  3CPF A;  2F1L A;  2FG0 A;  4LDU A;  1I1J A;  4M7D B;  1VQP T;  3CD6 T;  2YRC A;  2C0O A;  4XU0 A;  1ZA1 B;  2WSC E;  1N8R C;  2DEQ A;  4N0A A;  2FPE A;  4M78 C;  2LJ1 A;  3OSS C;  2EYZ A;  3HFN A;  2MWO A;  2FHD A;  2DM1 A;  1RL2 A;  2OI3 A;  2OAU A;  3BY7 A;  1QVF A;  2VXE A;  2LZ6 B;  2RQU A;  3CCL T;  3CCR Q;  5FRN A;  2ROT A;  2DO3 A;  2DPP B;  2OJ2 A;  1RUW A;  2HAX A;  1VQL A;  2BE9 B;  1VQO A;  1UFF A;  3OYK A;  1ZA2 B;  6AT1 B;  4M78 E;  2EYQ A;  3QPH A;  4ZTJ A;  2E3I A;  3A5Z B;  1LVK A;  5I21 A;  2QDL A;  3OYM A;  2DBK A;  2X4Y A;  4RTY A;  4EMK B;  4M77 G;  2L5Q A;  1VQO Q;  1O75 A;  1C6V X;  1G3Y A;  1OZ2 A;  1X01 A;  4B9W A;  2O4X B;  1Y96 A;  4UC4 A;  1D0Z A;  3EG9 B;  3PTA A;  2O4X A;  2ECZ A;  1FMK A;  4A53 A;  3OMC A;  4MML A;  1SHG A;  2QXF A;  2VXF A;  5GAM g;  2EWN A;  3M5A A;  3VU3 C;  4JRP A;  2QA4 Q;  2E64 A;  2DJQ A;  2HSP A;  2K7A A;  1K76 A;  2IG0 A;  3QDR B;  1OU9 A;  2CP6 A;  4OMQ A;  1HXD A;  2ZPF B;  1TH7 A;  5FW9 A;  2SRC A;  1WJS A;  2RH2 A;  1X2Q A;  2AK5 A;  3MP1 A;  2LCS A;  1RAI B;  3I55 T;  1YJ9 T;  2DZ9 A;  4DBF A;  1PNJ A;  1M1G A;  4M7D A;  1KD1 C;  1K73 U;  1R77 A;  5IHN A;  4CRI A;  1HJD A;  4J9E A;  4J8O A;  1VQP Q;  3CD6 Q;  2LT1 A;  3OS1 A;  4E47 A;  1FX7 A;  2JS2 A;  1JXO A;  2CT3 A;  3JCM X;  2HL3 A;  3C12 A;  2CKK A;  2FRW A;  2V1Q A;  3BE3 A;  3QDF A;  2ESW A;  2D8J A;  3N5B B;  1OUL A;  2C0I A;  2DVE A;  2RHI A;  3SWN C;  3E9G A;  4F7U B;  1WHH A;  1MV0 B;  2DRK A;  4ZGD B;  1I4K 1;  2JXB A;  4JZ4 A;  1QVG A;  3MEA A;  3OBW A;  1D3B B;  1SG5 A;  4M75 F;  4KUI A;  1SF9 A;  4ZGE B;  1BI0 A;  2QTX A;  3QKJ A;  3PGG A;  4ATO A;  5GAN 4;  4EIK A;  5A0D A;  2YUN A;  3NTH A;  4O5V A;  2LX9 A;  5KYW A;  2EQK A;  1KC8 U;  1NJI C;  1S72 Q;  2KRS A;  8AT1 B;  2F2X A;  1YJN A;  2AZS A;  3JCM g;  4B6M A;  2GNC A;  2VVK A;  4MZT A;  2VGM A;  2EKO A;  3JCM P;  3L2U A;  4PJL A;  2QA4 A;  3G6E A;  4FW2 A;  3TSW A;  3P8B B;  1QVF P;  5L8R E;  4MDW A;  5GJV B;  1U1T A;  2JJ9 A;  3L2Z A;  5L23 A;  3EAE A;  2KRN A;  3CMA A;  2WSE E;  3QG1 A;  3TU4 K;  1T3S A;  2RO0 A;  2BKD N;  2F2V A;  4FYY B;  2P4R A;  2K3Y A;  4IIO A;  2RPN A;  1VQ7 Q;  2YRD A;  2MK5 A;  5GAM h;  4RUG A;  1I81 A;  1ZSG A;  1UTI A;  2CP5 A;  2SEM A;  5LJ3 f;  1KHC A;  1KSW A;  1TUC A;  4E6R A;  2EGE A;  3LGF A;  2Z0W A;  4KH0 B;  1PRL C;  4XTV A;  2DL3 A;  1HD3 A;  1GCQ A;  4JRQ A;  1NZ9 A;  4LDX A;  4C5E A;  2OTL A;  3VRY A;  3OYF A;  2BZY A;  4F17 A;  4M7A F;  3JCM h;  2NYS A;  4PJO B;  4J9B A;  3RMQ A;  1Y57 A;  1N6A A;  5FLX E;  3CC4 A;  2DA9 A;  2FZK B;  2VUB A;  1VQ9 T;  1UGP B;  4C0G A;  1YNZ A;  5LJ5 h;  3CCV T;  5I2S A;  5GAN 3;  3ZBD A;  1ZSZ A;  1NJI R;  1Y7X A;  2CSI A;  1Q82 R;  5CAI A;  4C92 E;  2O88 A;  4RTU A;  2HDA A;  2Y4Y A;  3H0I A;  1LOJ A;  4E2F B;  4EPC A;  3TCJ A;  2C0T A;  2J6F A;  4M75 C;  1OOT A;  4PLI A;  4CC4 B;  2LJ3 A;  1V76 A;  3CCU Q;  1X43 A;  4X9D A;  2LMJ A;  5FU6 C;  3X25 B;  2RHU A;  4OB2 B;  1M5Q 1;  1NEG A;  4C5H A;  3BFM A;  2DK3 A;  5GAO m;  4ESR A;  4QVZ A;  2J7I A;  1VQ6 Q;  2FYK A;  1YWP A;  2K2V A;  4HA8 A;  3OS2 A;  4RMO A;  1Q7Y C;  1IXD A;  2R57 A;  3EGX B;  4HKE A;  5J39 A;  3EGX A;  4KRT A;  3ZEH A;  2YHT A;  5GAN e;  3CCM Q;  1YIJ A;  1NLO C;  1ABQ A;  1WI7 A;  2ZZD A;  2BIV A;  4DBQ A;  2ZPH B;  5FRM A;  2MWP A;  4C8Q E;  1Q81 C;  2CZ6 B;  4Z88 A;  2BZX A;  1TU0 B;  3JCM d;  5KYW B;  1QKW A;  1I5O B;  4JJC A;  1QCO A;  1M30 A;  1T3L A;  3MPU B;  5J26 A;  3UT1 A;  3M54 A;  3CCQ T;  1G2B A;  1YIT A;  3THK A;  3EG9 A;  1ZUY A;  1VQ8 A;  3ME9 A;  1OX9 A;  2JT4 A;  1I8F A;  1GCQ C;  2PZ1 A;  3SWN B;  1QKX A;  2FEI A;  2X35 A;  5FU7 C;  1QQJ A;  3TVT A;  5FRO A;  2M0O A;  2L3Q A;  3QSU A;  5AT1 B;  2IVW A;  3JCM c;  2EIF A;  1W2B S;  3RKW A;  5CKD A;  2CUD A;  1BI1 A;  4J6Y A;  5I22 A;  1X75 C;  1EFN A;  1UGR B;  1JB0 E;  5CKF A;  1KQS P;  1YJW T;  2ZPG B;  2YXY A;  2AKK A;  2EQU A;  4V2S A;  2YUP A;  1IB8 A;  2DD5 A;  1VIF A;  4GBQ A;  1U3O A;  2YSQ A;  2CH4 W;  1K8A U;  3SB2 A;  1YHQ T;  2L3P A;  4OMM A;  1VQO T;  4M7A E;  2DVJ A;  4XQ3 A;  1FXX A;  3NHN A;  2KT8 A;  2KBT A;  1M1K U;  4J9F A;  4D8K A;  3OYB A;  3CBM A;  3L2W A;  3EGU A;  1OPL A;  4KGX B;  2JM8 A;  3MEW A;  2OTJ Q;  4OB0 B;  1QP3 A;  4DEY A;  1UHF A;  2XI9 A;  4DOW A;  1KG1 A;  3FEO A;  3OYG A;  1H8K A;  4ELY C;  4LUD A;  3OY9 A;  3OYH A;  3H0F A;  1OEB A;  2I0N A;  4RTW A;  1VQK A;  1G3T A;  1D09 B;  1YI2 A;  4KUD K;  3DB4 A;  3C0C A;  1SKU B;  4XTU A;  2XDP A;  2QQS A;  4F14 A;  5CIU A;  2RB6 A;  1VQ6 A;  4LXC A;  4HCC A;  3VJP A;  1AHJ B;  5I2M A;  2JZ2 A;  2COY A;  4BI3 A;  3QJY A;  5GAO l;  4OP0 A;  3M0T A;  1UHC A;  3G4S A;  4PJM A;  4BE1 A;  3EHQ A;  3REB B;  2OAW A;  1D0Y A;  2OX7 A;  3MP6 A;  2XK0 A;  3URG A;  2NUP A;  2L89 A;  2E70 A;  2YT6 A;  1JJ2 P;  2CP2 A;  4M78 D;  4N4I A;  1M3A A;  2LT4 A;  1ARK A;  5HK0 A;  4CC7 A;  1PRM C;  2JVV A;  5LJ5 f;  1JBM A;  1X6B A;  4E7L A;  5HCK A;  3V7C A;  3I56 T;  3E9F A;  1O9S A;  2QDY B;  2DER A;  4R56 A;  1N27 A;  2RI2 A;  3J7A F;  2DZC A;  2DMO A;  4CC3 A;  1N9R A;  2K5F A;  1OU8 A;  4FIB A;  5FU6 B;  2WSF E;  1FYN A;  1I0C A;  4OMO A;  4QT7 A;  1PCX A;  1D0X A;  4PFP A;  3CCV A;  1JJ2 S;  2ZCF B;  4JJB A;  2K57 A;  5GMK i;  3CC2 A;  2EW3 A;  1WHJ A;  2F69 A;  5IH2 A;  3C4S A;  3CMA Q;  1KIK A;  1R0B G;  3RKX A;  4J7I A;  4AG2 C;  3JSC A;  3REA B;  2RF0 A;  1MNE A;  1UB4 A;  5GAN g;  4JLG A;  1W2B P;  3RER A;  4A4F A;  1H64 1;  3X26 B;  3INZ A;  2RJC A;  4M4Z A;  2VV5 A;  1SPK A;  3DLL A;  1NYF A;  2KDS A;  4ME7 A;  2LC4 A;  2KK4 A;  2MF2 A;  1GXI E;  4IUR A;  4L5G A;  1XNI A;  2DBM A;  3GLX A;  3SD4 A;  4MMK A;  2BUD A;  1QWE A;  4YTL A;  1M2O A;  4M77 C;  2W10 A;  1ZBJ A;  4EMH A;  1XJW B;  1YP5 A;  2B8A A;  3M0R A;  1VYV A;  4C5I A;  1VYU A;  1GBQ A;  4Y92 A;  4F04 B;  1KQS S;  1Y96 B;  3RIR A;  4AFZ C;  4A54 A;  1YJW A;  2RQR A;  5GAN 8;  5GAN 5;  2YLB A;  1S1N A;  2RJF A;  3J81 E;  2HKQ B;  2RK1 A;  1YFN A;  4PFZ A;  3CMA T;  1YIT Q;  3VV0 A;  4QKU A;  4AFQ C;  3FB9 A;  2MYS A;  3PNW C;  3QBY A;  3SDZ A;  1JQQ A;  2O01 E;  5DM7 R;  2MMP A;  1YJN Q;  3SHW A;  1Z9Q A;  1KC8 C;  1ZQ1 A;  4LE9 A;  4PJO E;  4QVD A;  1AWX A;  2COZ A;  3JCM Q;  4RCB A;  1VQ8 T;  1PSE A;  3LH5 A;  3CCQ A;  3QXE B;  4AT1 B;  3GP8 A;  3DLM A;  1TUG B;  3CCE A;  5KYN A;  2V26 A;  4AMC A;  5I11 A;  3G4S Q;  2X51 A;  4L59 A;  2KQW A;  3UDC A;  1RI9 A;  1T0H A;  4BUG A;  3H8Z A;  3E2U A;  1RLQ C;  4M77 B;  1QP2 A;  2H3E B;  3HPW A;  1M9S A;  5GAO p;  3PMI A;  2ZPE B;  1WIE A;  1SSF A;  2KRM A;  1U1S A;  3OQ5 A;  1F1B B;  1JEG A;  4PLL A;  4B9X A;  3CPW S;  2COW A;  3RDV A;  5LJ3 d;  2RA2 A;  2LX7 A;  4IUQ A;  4C92 D;  3A8O B;  4F7U A;  4XTW A;  5HK3 A;  3L2R A;  4Z02 A;  3H9N A;  2DNU A;  3VS2 A;  2E4H A;  3A1P A;  3LH0 A;  2HSE B;  3PT9 A;  2IPO B;  1WX6 A;  3M9Q A;  2NUT A;  1K0X A;  1BI3 A;  2CZ1 B;  2ED1 A;  3L1A A;  4JUV A;  4XU1 A;  4EMK C;  3OYN A;  2KXD A;  3EFO B;  2A37 A;  1YI2 Q;  5GAM f;  2MPX C;  4TVR A;  4WTO B;  1X27 A;  3LYI A;  1SRL A;  1WHK A;  1TSF A;  4JDS A;  2QA4 T;  4HXJ A;  2A36 A;  3NFC A;  4C92 G;  1U5S A;  3L2V A;  4A4G A;  5LJ3 g;  2V8K A;  1YIT T;  3NTK A;  3ZFJ A;  2E5K A;  2E6Z A;  2P84 A;  3V8J A;  5CKH A;  4D6W A;  3QJ6 A;  4IIM A;  3CCU T;  1LNX A;  4XAX B;  4BDY A;  3RNJ A;  4R0K A;  4BI8 B;  4J9D A;  1WHM A;  1YJW Q;  3CCE Q;  4IUP A;  3HFO A;  1VIE A;  1M1F A;  4OF1 A;  4GLK A;  2CRE A;  2QQB A;  3LW5 E;  3E1S A;  3HTR A;  2EQM A;  1VQM A;  2A3L A;  4EDU A;  2CUB A;  2VAS A;  2E1H A;  1QVG P;  1OQK A;  4C8Q B;  4EMK A;  3MHX A;  2ZPI B;  1PD1 A;  3R6O A;  4M7D G;  1IZ6 A;  4QQD A;  3GPL A;  3JCM W;  1UEB A;  4P5N A;  1WGS A;  1UJY A;  3JCM b;  1MUZ A;  1SHF A;  2RJE A;  1DJ7 B;  3SEM A;  3Q1J A;  3MET A;  2X3W D;  4FYV B;  3TQ7 P;  2K2M A;  3TRE A;  2EJF A;  3OYL A;  4OMF B;  2DXT A;  5HY6 A;  2E41 A;  2E5Q A;  2XDB A;  3I56 Q;  1OX8 A;  1QVG S;  4J5Y A;  3CCE T;  4VUB A;  3CCM T;  1Q82 C;  4PJO D;  1E7O A;  5ECA A;  5CVI A;  3JB9 H;  1EX4 A;  2RJD A;  2DE0 X;  3VS6 A;  4HT8 A;  2DXC A;  5KYY B;  4E7S A;  3VRZ A;  1PSF A;  4IKF A;  5M9O A;  2M16 A;  3MKD A;  1ZHI A;  2JS0 A;  3ASK A;  5HKC A;  3LX7 A;  2EGA A;  3JCM J;  4M75 A;  5GAN j;  4M7A B;  1JO8 A;  1WA7 A;  2QQ9 A;  4MDX A;  1BU1 A;  3BDU A;  5GMK h;  2EPD A;  2V1R A;  1KD1 R;  1MMG A;  3UF4 A;  4N4H A;  4J83 A;  1Q86 R;  3JB9 F;  5CO7 A;  4CI0 C;  1B34 A;  4M75 G;  1YCY A;  3H6Z A;  3M58 A;  1I07 A;  4X1V A;  5KYX A;  2KAF A;  1MMA A;  4C92 B;  2KY9 A;  4IUV A;  3CBO A;  2ATC B;  1D1B A;  2GFU A;  4E7I A;  4Z89 A;  2JTM A;  3HRS A;  1ACM B;  3FRN A;  4M7D E;  1K9M R;  1RAB B;  3J80 E;  4KUL A;  2NUT B;  4ZN1 A;  1HYO A;  4PL6 A;  4KGZ B;  4FSS A;  4L6V 5;  1CSK A;  1XQH A;  2EYY A;  1YHQ Q;  2QEX Q;  4JPB W;  4PJO C;  5LJ5 d;  3HRU A;  3UA7 A;  3HKS A;  2OTJ A;  4KH1 B;  1Y07 A;  3LWI A;  2HNI A;  1VA7 A;  4ANJ A;  3V8K A;  3QWY A;  3JB9 D;  3CC7 T;  2XHC A;  2QQA A;  4XTZ A;  2L3R A;  4RCC A;  4IUU A;  1NLP C;  2A0F B;  2F5T X;  3M53 A;  3U23 A;  1AWO A;  3CXC A;  3M0S A;  3P8D A;  5CCA A;  1G3S A;  2PTK A;  1VQK T;  1TXQ A;  3H0H A;  2EJG A;  2E12 A;  2DTO A;  3OW2 A;  1Q7Y R;  1KQ2 A;  4DBH A;  2DXB A;  3QUI A;  1KHI A;  4A4H A;  2HCK A;  3VS3 A;  1SSH A;  1AZE A;  2F2W A;  1QVP A;  3LLR A;  2YDL A;  2EFI A;  2EVR A;  2PVO B;  3UA6 A;  5KYY A;  3JB9 G;  1IHW A;  1AD5 A;  3OYY A;  5GAO r;  2NWM A;  2A08 A;  3PVQ A;  1MGQ A;  2YRV A;  3G6E Q;  4CC2 A;  1K73 C;  2G3R A;  1AWJ A;  1B7T A;  1NE8 A;  1LJO A;  2KMT A;  1UE9 A;  4BD3 A;  4C0D C;  4AG1 C;  4OVA A;  5IT9 E;  5FWC A;  4JLI A;  3MP8 A;  3I55 A;  2JMA A;  1YJ9 A;  4C8Q C;  1RAC B;  3GNF B;  3TEE A;  1G83 A;  4ORZ A;  1YI2 T;  1MMN A;  1YCS B;  3PIP A;  1ZX6 A;  2RK2 A;  2O9S A;  1K9M U;  2CYZ B;  5IXB A;  2GQI A;  2EYX A;  3C95 A;  1G8X A;  3QZ9 B;  1QLY A;  4NL3 A;  1VQ4 Q;  2OTJ T;  9ATC B;  3QII A;  1N8R U;  4NL2 A;  1BCM A; 
#chains in the Genus database with same CATH homology
 3VS1 A;  2DJQ A;  2HSP A;  2K7A A;  1K76 A;  1NYF A;  1UG1 A;  4OMQ A;  5FW9 A;  2SRC A;  2DBM A;  2AZV A;  3RBB B;  1X2Q A;  5GJW B;  2AK5 A;  1QWE A;  1X69 A;  2LCS A;  1U06 A;  1NM7 A;  2W10 A;  1ZBJ A;  1YP5 A;  2M51 A;  3M0R A;  2DL5 A;  2XMF A;  1VYV A;  1PNJ A;  1VYU A;  1GBQ A;  4Y92 A;  3I5S A;  1W70 A;  1CKA A;  2K9G A;  2B86 A;  2BZ8 A;  4AFZ C;  5IHN A;  3M0Q A;  2J06 A;  3I5R A;  1HJD A;  4J9E A;  1A0N B;  2RQR A;  1AEY A;  2RQV A;  2L2P A;  3EHR A;  1S1N A;  2DLP A;  1UUE A;  1CKB A;  2HBW A;  2GGR A;  2MIO A;  2JS2 A;  4AFQ C;  1JXO A;  2CT3 A;  4ZNX A;  1WYX A;  2RQT A;  3FJ5 A;  1PWT A;  3KFV A;  1JQQ A;  3TSZ A;  4HCK A;  3SHW A;  1Z9Q A;  2JTE A;  4LE9 A;  2FRW A;  2FPD A;  2V1Q A;  2CT4 A;  1AOJ A;  2O9V A;  1UGV A;  2ESW A;  5IHI A;  1AWX A;  2D8J A;  2C0I A;  2O2O A;  4J9C A;  2CH4 A;  1MV0 B;  2DRK A;  3LH5 A;  3JV3 A;  2GTO A;  3VS4 A;  2JXB A;  1WFW A;  4J9I A;  4JZ4 A;  1X2K A;  2G6F X;  1AVZ C;  2RNA A;  1SRM A;  1BB9 A;  4HVW A;  5I11 A;  2DYB A;  2FPF A;  4EIK A;  2YUN A;  1ZUK A;  1RI9 A;  1T0H A;  2K6D A;  2PNI A;  4AFS C;  1RLQ C;  1W1F A;  2KRS A;  2F2X A;  2AZS A;  2DL7 A;  2GNC A;  2VVK A;  1UDL A;  1WIE A;  2O31 A;  3PE0 A;  4J9G A;  2KRM A;  1JEG A;  3TSW A;  5GJV B;  1X6G A;  3PVL A;  2LX7 A;  3EG2 A;  2M0Y A;  5L23 A;  2MOX A;  1KJW A;  2KRN A;  1T3S A;  1YN8 A;  2DNU A;  2F2V A;  3VS2 A;  1M27 C;  2P4R A;  2EYW A;  4K11 A;  1WXT A;  1WX6 A;  4IIO A;  2RPN A;  1RLP C;  1K0X A;  4RUG A;  1ZSG A;  4AFU C;  4LNP A;  2ED1 A;  1M3C A;  1UTI A;  4Z8A A;  3M0U A;  2SEM A;  2KXD A;  4OMP A;  2A37 A;  3UAT A;  1B3Q A;  1KSW A;  1TUC A;  3GBQ A;  4E6R A;  2EGE A;  1X27 A;  1PRL C;  2HEQ A;  2DL3 A;  3I35 A;  1YWO A;  1SRL A;  1ABO A;  1HD3 A;  2MCN A;  1GCQ A;  2EBP A;  2LQN A;  3A98 A;  1AZG B;  1Z9Z A;  3VRY A;  4HXJ A;  3IQL A;  2BZY A;  4F17 A;  1OPK A;  2J05 A;  1Y0M A;  2A36 A;  1U5S A;  2GBQ A;  1K1Z A;  2BTT A;  4J9B A;  2KYB A;  1Y57 A;  1J3T A;  4HVU A;  2W0Z A;  2DA9 A;  2E5K A;  4IIM A;  2KNB B;  1MV3 A;  1K9A A;  1YNZ A;  3VS5 A;  3RNJ A;  1GRI A;  4J9H A;  4R0K A;  1ZLM A;  4J9D A;  1N5Z A;  1E6H A;  1LCK A;  1NEB A;  3ZL7 C;  1TUD A;  2CSI A;  2LNH B;  2CRE A;  2KGT A;  2JW4 A;  2O88 A;  4RTU A;  2HDA A;  3H0I A;  3ULR B;  3NPF A;  2C0T A;  2D8H A;  2J6F A;  1OOT A;  2CUB A;  4CC4 B;  2LJ3 A;  2ED0 A;  2J6O A;  5IXF A;  2DIL A;  1X43 A;  2FRY A;  2LMJ A;  1H3H A;  3O5Z A;  4RTT A;  3CQT A;  4D8D A;  1NEG A;  1PHT A;  3EG1 A;  2KXC A;  2VKN A;  4ESR A;  2J7I A;  1GFD A;  1YWP A;  2L0A A;  4JZ3 A;  3R6N A;  1GFC A;  1UJY A;  1WDX A;  4KRT A;  1MUZ A;  1SHF A;  3EG0 A;  4RTZ A;  1NLO C;  3SEM A;  2EGC A;  1ABQ A;  2X3W D;  2KEA A;  2K2M A;  1WI7 A;  1GCP A;  5EC7 A;  3NGP A;  1WLP B;  4OMN A;  4F16 A;  1GL5 A;  4Z88 A;  4A63 B;  2BZX A;  2LP5 A;  1E7O A;  5ECA A;  1AWW A;  1QKW A;  4JJC A;  4HVV A;  1M30 A;  1T3L A;  2DE0 X;  3VS6 A;  2DL4 A;  1ZUU A;  1G2B A;  1GBR A;  1UEC A;  5IHK A;  3THK A;  3NMZ C;  1ZUY A;  3VRZ A;  2JT4 A;  2PZ1 A;  1GCQ C;  4GLM A;  1QKX A;  2RMO A;  2FEI A;  2FO0 A;  2JS0 A;  1E6G A;  2EQI A;  2EGA A;  3TVT A;  3VS7 A;  2L3Q A;  2KR3 A;  1JO8 A;  1WA7 A;  2YUQ A;  4DEX A;  1BU1 A;  2CUD A;  2EPD A;  2KT1 A;  4LN2 A;  1K0S A;  2V1R A;  2CSQ A;  3UF4 A;  4JJD A;  2GTJ A;  5I22 A;  1EFN A;  2LQW A;  1QCF A;  1V1C A;  4RTX A;  3VS0 A;  1K4U S;  2H8H A;  2AKK A;  1I07 A;  2YUP A;  4OML A;  4X1V A;  5FWB A;  4GBQ A;  2VWF A;  1U3O A;  4RTV A;  2YSQ A;  2CH4 W;  1JXM A;  1XOV A;  1PKS A;  2KRO A;  2L3P A;  2YUO A;  4OMM A;  4Z89 A;  1NYG A;  2DVJ A;  2AKL A;  1UJ0 A;  2KE9 A;  3NHN A;  2KT8 A;  2KBT A;  4J9F A;  2NUZ A;  1PKT A;  1KFZ A;  4D8K A;  3I9Q A;  2RQW A;  1SEM A;  2ENM A;  3EGU A;  4FSS A;  1CSK A;  1OPL A;  2JM8 A;  2EYY A;  1WXU A;  2K3B A;  4JPB W;  4DEY A;  2K79 A;  1UHF A;  1M3B A;  2A28 A;  2DRM A;  2D1X A;  3UA7 A;  2KYM A;  1H8K A;  1VA7 A;  4LUD A;  2CDT A;  3QWY A;  3H0F A;  1OEB A;  2I0N A;  3EG3 A;  1M8M A;  1B07 A;  4RTW A;  2DL8 A;  1QWF A;  2DF6 A;  2ABL A;  2FG0 A;  3C0C A;  1NLP C;  3U23 A;  1AWO A;  2ROL A;  1I1J A;  4F14 A;  3QWX X;  3M0S A;  2PTK A;  3H41 A;  3H0H A;  2C0O A;  4LUE A;  2EKH A;  1OV3 A;  4WCI A;  2FPE A;  3M0T A;  1UHC A;  2HCK A;  2LJ1 A;  1NG2 A;  2EYZ A;  3VS3 A;  1SSH A;  1BBZ A;  1AZE A;  2DM1 A;  3EHQ A;  2F2W A;  1TG0 A;  3REB B;  2OAW A;  2OI3 A;  2YDL A;  2LZ6 B;  2EVR A;  2RQU A;  2ROT A;  3UA6 A;  2D0N A;  2YT6 A;  2OJ2 A;  1BK2 A;  1RUW A;  1AD5 A;  1W6X A;  1M3A A;  1ARK A;  2NWM A;  4CC7 A;  1PRM C;  1UFF A;  2A08 A;  3PVQ A;  4CC2 A;  1WXB A;  2J6K A;  1X6B A;  5HCK A;  2L3S A;  1AWJ A;  1IO6 A;  1UE9 A;  2JMC A;  2QDL A;  4AG1 C;  2DBK A;  4CC3 A;  2DMO A;  3M0P A;  5FWC A;  2JMA A;  4RTY A;  1I0C A;  1FYN A;  4OMO A;  1G83 A;  2DX1 A;  1VYT A;  4QT7 A;  4ORZ A;  2LJ0 A;  4JJB A;  1YCS B;  1ZX6 A;  2EW3 A;  2O9S A;  5IH2 A;  5IXB A;  2JM9 A;  1KIK A;  2GQI A;  2EYX A;  2X3X D;  2ECZ A;  1FMK A;  4AG2 C;  1QLY A;  2IIM A;  2RF0 A;  3REA B;  1JU5 C;  1SHG A;  1H92 A;  1HSQ A;  1T0J A;  2RN8 A;  4M4Z A;  1SPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...