4GBQA

Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2
publication title Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (signal transduction/peptide)
total genus 9
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1996-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4gbqA00
2YUQA 4ESRA 1AWWA 2GQIA 3NHNA 1EFNA 2LMJA 4CC2A 2ECZA 2KGTA 1HSQA 1E6GA 2HDAA 5EC7A 4K11A 2QDLA 2JS2A 2EGEA 1Y0MA 4EIKA 1A0NB 1K76A 1PKTA 2G6FX 1SSHA 2I0NA 2AKKA 2ROLA 2BZXA 2V1QA 2LNHB 2DL7A 2DLPA 3VS4A 2CUBA 2RMOA 4D8DA 1VYTA 2W0ZA 3TSZA 2K6DA 3UF4A 2HCKA 3H0IA 1PWTA 2L2PA 2MIOA 1N5ZA 2FG0A 4JJDA 1X2QA 1UJYA 3C0CA 2LJ3A 5ECAA 1QLYA 4OMPA 1AZGB 2CT4A 1SRMA 2GGRA 2FEIA 1OV3A 2FPFA 2DL3A 2FRYA 1BU1A 1W1FA 1ABQA 3O5ZA 4OMQA 3KFVA 2KR3A 2JW4A 1PRMC 2EQIA 1AD5A 1H92A 1G83A 1WX6A 1G2BA 1YN8A 4J9CA 4LUDA 1SPKA 2GNCA 3M0UA 4RTVA 4AFQC 4GLMA 1QCFA 1GFCA 1AWOA 1WA7A 1OOTA 1MUZA 1SRLA 1ZSGA 2O9VA 2FO0A 3REBB 4JJBA 4RTZA 4HCKA 3TSWA 2PZ1A 1B3QA 2KNBB 1X2KA 4ORZA 1AOJA 5GJWB 2VWFA 4QT7A 2EBPA 1QWEA 1HD3A 1VYUA 1JXMA 4OMLA 3VS1A 2OI3A 1AWXA 1U06A 4J9GA 1GCQA 1Z9QA 4IIMA 1WIEA 1BB9A 2YDLA 1Z9ZA 2P4RA 2OJ2A 4LE9A 1W70A 2KXCA 2FRWA 2KT1A 1NYFA 1K9AA 3SEMA 1UJ0A 2GBQA 2RNAA 2LP5A 1K0SA 2AZVA 1AVZC 1UHCA 2A28A 1WXTA 1QKWA 2DA9A 2LJ0A 1PNJA 4R0KA 3NMZC 2PTKA 5IXFA 2KRNA 1M8MA 1J3TA 1YWPA 2X3XD 4OMOA 2O88A 1JQQA 3NGPA 1I07A 4Y92A 1IO6A 1CKAA 1WFWA 4RTWA 1E6HA 4AG2C 2M0YA 2F2VA 4Z88A 2ED1A 4JPBW 1UDLA 2LX7A 3A98A 4OMMA 2BZ8A 4HVUA 2L3QA 2KRMA 4AFUC 1X6BA 5I22A 1X6GA 1JO8A 3VS0A 2C0OA 1NLOC 1BK2A 2LJ1A 3EG3A 5GJVB 1LCKA 1KIKA 5FWBA 2IIMA 4KRTA 1GCQC 4HVVA 2LZ6B 2KXDA 1WXBA 2LQNA 1UGVA 3LH5A 1CSKA 3I5RA 1NLPC 4J9FA 3QWYA 1UUEA 3VRYA 2EKHA 2OAWA 4LN2A 5IH2A 2CSQA 1NG2A 3SHWA 2SEMA 2AZSA 2O9SA 1T0HA 1M3BA 2DL8A 5HCKA 3VRZA 2L3SA 2DILA 5IXBA 1MV0B 1H8KA 3TVTA 1ZBJA 2RQUA 1GRIA 2C0IA 2HEQA 2EGCA 3M0TA 1UFFA 2AKLA 2W10A 2YUPA 3VS3A 4RTUA 5I11A 2K2MA 2DBKA 1S1NA 1VYVA 2CT3A 4ZNXA 2HBWA 2KEAA 4DEYA 2JMCA 1JXOA 3VS2A 2K7AA 1FYNA 2H8HA 2D8JA 1RUWA 1T3LA 2K3BA 2JT4A 1AEYA 3REAB 1X43A 4JJCA 2EYWA 1KFZA 2DL4A 4Z89A 2JM8A 1E7OA 3VS6A 3EG0A 1M27C 2E5KA 2NUZA 1UECA 3H41A 3M0RA 3M0PA 2V1RA 2KE9A 2ABLA 2J7IA 2A37A 2FPDA 4JZ3A 1ZLMA 1YCSB 2MOXA 2LCSA 4J9EA 1OPKA 1WLPB 2ENMA 1OEBA 1QWFA 1UE9A 1K0XA 2L0AA 2KBTA 4J9IA 2GTOA 3FJ5A 1UTIA 2JXBA 2KYMA 4HXJA 1M3AA 3H0FA 2X3WD 4LNPA 1UG1A 4A63B 1Y57A 2KT8A 3EHQA 1VA7A 1U3OA 4JZ4A 2HSPA 3VS7A 2D8HA 1WI7A 2K9GA 2PNIA 3PVQA 1RI9A 2ROTA 5IHIA 3ULRB 2ED0A 3I35A 2J05A 2JMAA 2ESWA 2EYZA 3JV3A 2J6FA 2YSQA 2K79A 1BBZA 1ABOA 2JTEA 1NEBA 2DBMA 1WDXA 1SHFA 1JEGA 1GL5A 4RUGA 2DRMA 2EVRA 4CC4B 1XOVA 5FWCA 4F16A 2SRCA 3PE0A 1ZUKA 2J6OA 1GBRA 2M51A 2EGAA 1GFDA 4AFZC 1GBQA 2DM1A 2RF0A 1M3CA 1RLPC 4HVWA 2KROA 2CREA 4CC7A 2F2WA 2RPNA 1FMKA 1OPLA 2A36A 4D8KA 3UA7A 2DL5A 3UATA 1PRLC 1KJWA 3CQTA 2NWMA 3M0QA 3M0SA 2EW3A 3EG1A 3U23A 4CC3A 2DMOA 2F2XA 1UHFA 3I5SA 5L23A 1AWJA 2VVKA 1B07A 1ARKA 4E6RA 1RLQC 2KYBA 1X27A 1ZUUA 4RTXA 1NEGA 1TUDA 2EPDA 3GBQA 3IQLA 2KRSA 4RTYA 4LUEA 1K1ZA 4F17A 4OMNA 4AFSC 3VS5A 3ZL7C 2DRKA 1WYXA 2D1XA 3I9QA 1SEMA 1NYGA 1NM7A 4Z8AA 2DF6A 2O31A 5IHNA 2BTTA 5IHKA 1U5SA 5FW9A 2DVJA 2CSIA 2RQWA 4IIOA 1AZEA 4AG1C 1T3SA 1TUCA 2YUOA 3EGUA 3NPFA 1JU5C 2RQRA 3EG2A 2GTJA 4F14A 1GCPA 1QKXA 3THKA 2YUNA 2LQWA 2D0NA 2CUDA 2RQTA 2CH4W 1PKSA 4WCIA 2DYBA 2DJQA 2CH4A 2EYYA 4M4ZA 1TG0A 1PHTA 2JS0A 2VKNA 3RNJA 4GBQA 1T0JA 2FPEA 3PVLA 3QWXX 4X1VA 3RBBB 1V1CA 1I1JA 2A08A 2MCNA 2DE0X 1YP5A 2J06A 2O2OA 2XMFA 4J9DA 4J9BA 1M30A 1SHGA 2B86A 2L3PA 4RTTA 1KSWA 3H0HA 2RQVA 1YNZA 3R6NA 4DEXA 3UA6A 1ZUYA 2DX1A 2JM9A 1ZX6A 2J6KA 1WXUA 1I0CA 1YWOA 4J9HA 4FSSA 1CKBA 1MV3A 3EHRA 2EYXA 1HJDA 2DNUA 1H3HA 1W6XA 1K4US 2RN8A 2AK5A 2CDTA 2C0TA 1X69A 2BZYA 2YT6A
chains in the Genus database with same CATH superfamily
2RO0A 1QCOA 4ESRA 1AWWA 1EFNA 1RACB 1Q86R 3EFRA 5I21A 2NYSA 1OX8A 1BI2A 1RABB 2QDLA 3A8GB 4KULA 2QTXA 3HFOA 4KGZB 4M77A 5KYXA 3CPWP 4M7DE 2DL7A 3JCMh 2QG9B 1YHQA 2RD1A 2Z0WA 3V7CA 3L2UA 4HCBA 2K6DA 3UF4A 2HCKA 3META 1SKUB 1WHHA 1YBYA 3G71A 2HBPA 2COWA 2VUBA 2BIVA 1UJYA 4OMPA 2CT4A 2E12A 4PLLA 4ELYC 4RMOA 2FRYA 1W1FA 5GANe 4ATOA 4HCZA 2RB6A 4KGVB 4FM4B 3CMET 1BCMA 1JJ2A 4MDXA 1AD5A 1BYMA 4QVZA 1YITT 1G2BA 1VQLA 3M0UA 3UDCA 4AT1B 1YJWQ 3M5AA 4A4KA 1WA7A 1QP3A 4M77C 1MUZA 4JJBA 4RTZA 4DBRA 5KH6A 1ZHIA 4J8OA 2KY9A 1TWBA 3X25B 4ORZA 4PK4A 3X20B 3WVEB 4M75C 4PNOA 2VWFA 3CCLQ 1QWEA 3OYYA 4F04B 1I81A 2FL7A 1JXMA 3JCMJ 2OI3A 5CQXA 4LD9K 1AWXA 2CP6A 4IIMA 4JS5A 1BB9A 4LE9A 3PFSA 5KYYB 3LWIA 2KXCA 2CP7A 2FRWA 2LCLA 3PMIA 2Y4YA 4XTZA 2LP5A 2OTLQ 1K0SA 1QQJA 1VQNT 3CD6T 2DA9A 1PNJA 4R0KA 3NMZC 5FU7C 2QQ9A 4C92B 4M78D 2K57A 1YWPA 3H8ZA 4JRIA 2CP2A 2LQ8A 3Q1JA 2PVOB 3OYCA 2LVMA 3P8HA 1G3SA 3CC2T 4C0GA 1O9SA 1IGUA 4C0DB 2KRMA 4AFUC 2LNVA 1X6BA 5A2QE 5I22A 2O4XB 3VS0A 1Y7XA 3GLXA 1BK2A 4ELZC 4PLIA 3EG3A 2QGGA 4EMKA 4KUIA 1NJIC 2MF2A 1WHGA 4C8QD 4C92E 1VQOQ 3CCET 2IIMA 4BI4A 3L42A 3AT1B 2QA4Q 2QEXQ 1BIAA 1K73U 1IRXA 2D0QB 2OAUA 3QWYA 3PT9A 3VRYA 1VQMQ 3X28B 3OB9A 2SEMA 3S3OA 2P0QA 1T0HA 4UC4A 3FB9A 1MV0B 2QYZA 3GPLA 1GRIA 1XQHA 3EH2A 2HEQA 2EGCA 1KQSA 2AKLA 2W10A 2YUPA 2ZPEB 2DPPB 2K2MA 3QZ5B 2DK3A 3NTKA 4ZNXA 3GNFB 2HBWA 3TCJA 1XJWB 5C0MA 2RI2A 2H8HA 3CBMA 3UPUA 2DD5A 4M78A 2IPOB 1WHJA 1X43A 2VGNA 2DL4A 2JM8A 3VS6A 4DQ2A 2NUZA 3M0RA 4R55A 4M7AD 1VOMA 4Z02A 2V1RA 3CPFA 4EMKC 1UGRB 1YI2A 3ASKA 3C4SA 4J83A 3QYHB 3JB9H 3C94A 1M4ZA 3MEVA 3MEWA 1YHQQ 3P8BB 3QDFA 1VQ8T 2B8AA 2JNGA 3BDLA 1Y07A 2KYMA 4HXJA 2KAFA 5GMKm 3G71Q 2FZKB 3EFOA 3EFSA 1KG1A 2EAYA 1Y57A 2JUFA 4L59A 4MMLA 4OB2B 1U3OA 1KD1C 2HSPA 2D8HA 2PNIA 2GFAA 2ROTA 1Q82U 2RJFA 2HKQB 4M78C 3RKYA 2V8IA 4OB3B 2JVVA 4KGXB 2XI9A 3X26B 3OYEA 2JTEA 5J3BA 2OTJT 5AYFA 1GL5A 2DRMA 1VQLQ 1N8RC 3JB9G 2X4XA 1BI3A 4BY6B 3JCMX 3FC3A 3H6ZA 4O5VA 2SRCA 3PE0A 1RAGB 2J6OA 1QP2A 3QIIA 2DM1A 4XTWA 1M3CA 3CCQT 3CCVT 2HQHA 4M7AA 4X34A 2F2WA 1I5OB 2RPNA 1OPLA 2MYSA 5KYWA 5GAN8 1D0YA 5I2SA 2V26A 4D8KA 3UA7A 3CMEA 4D6WA 2ATCB 1KC8C 4KH1B 1SSFA 1MMDA 2ZPBB 2CKKA 3M0QA 4M7DD 4CC3A 3EG1A 3U23A 1UHFA 5CKEA 3CPWA 1ARKA 1RLQC 4WF2A 4C5IA 1S72T 2EPDA 4PJNA 2RH2A 2MAMA 3VJPA 1VQPA 2RJCA 3NTIA 5D6YA 2LC4A 4AFSC 5LJ3f 3VS5A 2QI2A 3VYGA 1QVFA 9ATCB 4J7FA 1SEMA 2PUKB 5J39A 3CC7A 1U5SA 1M90C 4IIOA 4AG1C 2YUOA 3EGUA 2QAZA 3RDVA 1K9MU 3EG2A 4YTLA 3I56T 2GTJA 2FB7A 3EAEA 3QHSA 4M7AC 3THKA 2NUTA 4BDZA 2Y90A 4IUQA 2D0NA 1WHMA 3OYKA 2RQTA 1RAEB 4RCCA 3A8HB 2ZPHB 4CI0C 1BI1A 2K3XA 4PJOG 4M4ZA 1VUBA 3QUIA 3KUFA 1D0ZA 3LW5E 3CEYA 3G4SA 3RNJA 3CCUA 1IGQA 4GBQA 3TEEA 4LDUA 5J26A 3OYFA 2ZPFB 3CBPA 2XD0A 2FPEA 1M90U 3RBBB 1D3BB 5LJ3d 1Q81C 4M7DA 1JB0E 1ZSZA 1OYXA 2L3PA 5GAOl 3QJ6A 5AT1B 4L6V5 1ZUYA 2DX1A 1U8RA 4E7ZA 3I55A 1ZX6A 2J6KA 1I0CA 5A0DA 2CGHA 3QPHA 2PUOB 2ZGWA 2DNUA 4C0FA 1W6XA 1WJSA 1VQ7A 2AK5A 2C0TA 3HRSA 2BZYA 2NUPA 4PFOA 2GQIA 4CC2A 4JS4A 1IZ6A 2ECZA 2KGTA 1N6AA 2HDAA 2JS2A 2EGEA 1Y0MA 3RUXA 1PKTA 2G6FX 2I0NA 2ROLA 2BZXA 2V1QA 4ZGJB 3CCRA 5C6SA 4KUDK 3JRZA 4BD3A 1YI2Q 2DVEA 3CCST 3OMGA 2KMTA 3VS4A 2L8DA 2JOYA 2RMOA 4D8DA 3G6EA 2YRDA 3UWNA 2QQSA 1RI0A 4LDXA 1PWTA 3OYIA 2MIOA 1VQ9A 4OP0A 1N5ZA 2FG0A 4JJDA 7AT1B 3EGXA 4M7DC 4LDVA 3HFNA 5ECAA 3MP6A 4N4GA 2DKGA 3S3MA 1SRMA 2QDYB 1YCYA 5IN1A 4IUPA 4C92D 1BU1A 2WSFE 4X9DA 3A8LB 4WTOB 3O5ZA 2DXCA 1VQ6T 2MI6A 1Y96A 1YFNA 3LH0A 2EQIA 3OSVA 3CXCS 2QQBA 4JJNK 1H92A 3V8KA 4XU2A 3QYGB 4J9CA 3DB4A 1D09B 2L5QA 2GNCA 1AT1B 1VQKA 1GFCA 3JSCA 1OOTA 3BE3A 3N5BB 1SRLA 3L2VA 1Q95G 2FO0A 5LL6S 4BI3A 4HCKA 4F7UA 3TSWA 2PZ1A 3KXTA 5GAN5 1UGSB 3ER0A 2KNBB 1X2KA 1K8AU 3P8DA 2P0KA 2DZCA 2QQAA 1FX7A 4QT7A 4BE1A 1K73R 1VYUA 3PIPA 1IHVA 3CMEQ 4J9GA 3CCJA 5KYYA 2P4RA 2OTJA 4A4GA 5GAN7 1X75C 1K9AA 3OYAA 1PD0A 2CP5A 4Y91A 1AVZC 3E9GA 3QJYA 1UHCA 1B34A 2LRQA 1QKWA 2LJ0A 3QG1A 4FSXA 4C92A 2RHIA 1NBEB 2M02A 5IXFA 5D6XA 2KRNA 1P92A 1M8MA 1VQPQ 2X3XD 1JQQA 4JLGA 1G3TA 1VQ4T 1I07A 3OW2A 1IO6A 1CKAA 5FU6B 4M77G 2F2VA 2HQXA 5A0LA 3CC7Q 1UDLA 2LX7A 3FIFA 3JB9I 4EMGA 1O75A 5GAOr 1LVKA 1AHJB 2GFUA 5CIUA 2C0OA 4Y28E 2XICA 1M2VA 1BCOA 1HXDA 3MO8A 4RKUE 5FWBA 1PD1A 3M57A 4M75A 2CP0A 3M54A 3V7SA 4HVVA 1QVFP 5CO7A 2O01E 2LQNA 1WXBA 3G1JA 3G4SQ 1UGVA 3CCUQ 1CSKA 4J9FA 1UUEA 2EKHA 2OAWA 3WVDB 3BW1A 4E7KA 4IUVA 2HKNA 2O9SA 5HCKA 3VRZA 3PGGA 2L3SA 4C92C 4ZTFA 2K2VA 3LYIA 5LJ3j 2RQUA 1Q82R 3M0TA 3VS3A 3VYHB 3URGA 2RK2A 3M56A 1BI0A 1H3ZA 2CT3A 3MHXA 3I55Q 1YJ9T 3QDRB 3LGLA 1QW1A 1ZBXA 3S6WA 4QQGA 4C0DC 3FJPA 3PNWC 3V8JA 2D8JA 1T3LA 2M0OA 4MZPA 2EFIA 4LXCA 2JT4A 4N4IA 1IHWA 1VQ7Q 1TH7A 1OQKA 1YJNA 4CRIA 3DLLA 2E5KA 2VYTA 1UECA 1JBMA 3JB9J 1MMAA 2ABLA 4JZ3A 2XK0A 3CMAT 4KT0E 2JN0A 3CCRQ 1Q7YC 4PFPA 1PC0A 3CC4A 4AMCA 4O6JA 4RG8A 2EWNA 3G6EQ 1EIFA 1UE9A 3OYNA 2L0AA 2KBTA 2JXBA 4JRKA 2X3WD 1VQ9Q 4LNPA 3OQ5A 1UG1A 4A63B 1R8OB 3C12A 4FYXB 1TOVA 4JZ4A 1R0BG 2XIDA 2K9GA 5IAYA 4M77F 1RI9A 5GAMf 3ULRB 2ED0A 3I35A 2J05A 4PJMA 3INZA 3JV3A 3WXMB 4QVCA 4LDYA 4JRPA 1ABOA 1JEGA 1K9MR 4OB1B 4CC4B 3OYGA 1W2BS 1VQKQ 1WHLA 3J80E 1H641 2BUDA 2E6ZA 1GFDA 2RF0A 4HVWA 2K4YA 3DB3A 2EQMA 5GMKj 4E47A 4B9WA 1VQ6A 3D7SB 4M77B 5KYXB 2DL5A 1YJWT 1M1KC 4HA8A 1KJWA 1FWZA 2NWMA 5GAMd 1HK9A 3OSSC 2F2XA 3CCJQ 3I5SA 1HYOA 4E6RA 3EGDA 1YIJA 1ZUUA 2OTJQ 2A7YA 1NEGA 1Q86C 4M78G 1NJIU 1KQ2A 3GBQA 1LJOA 3IQLA 3SWNB 2E10A 2KRSA 4A53A 4RTYA 2PVDB 3CCLT 4F17A 4OMNA 1TXQA 3JCMb 4JUVA 3ZL7C 4BY6C 2DRKA 2CZ0B 4RG2A 4M77E 3QXEB 2L89A 5IHNA 4J5YA 5IT9E 2H3EB 3L1AA 2QGFB 5FW9A 1M1GA 2DVJA 1AZEA 1T3SA 1ZQ1A 2EJ9A 5LJ5f 5FU7B 2RJDA 2OTLT 2DXTA 1GCPA 2CUDA 2CH4W 2YXYA 2NLUA 4QQ6A 2DJQA 2CH4A 3VUBA 2JS0A 4C8QA 3OBWA 3X24B 5GANf 3OW2P 4L5GA 4P5NA 1N9SA 2WACA 4IUUA 1T0JA 1I1JA 2MCNA 1YP5A 4J9BA 2HAXA 1M30A 1SHGA 5GAN4 3H0HA 2RQVA 2V8KA 3HHTB 1WXUA 4FCYA 2X4WA 1VQOT 1ZA2B 4Q5WA 4J9HA 5LJ5d 2QA4T 2F5KA 1H3HA 2RN8A 2CDTA 1VQMT 2YUQA 3NHNA 4DBHA 4M7AG 1RAAB 1RADB 5EG2A 1HSQA 1MHNA 1KD1U 2JTMA 1E6GA 3MEUA 3S3NA 1YJNQ 2YWWA 4K11A 1N27A 1K8AR 1W4SA 1V76A 4EIKA 5GANd 1K76A 1A0NB 1SSHA 2AKKA 1R0CB 2HL5C 4C8QC 4C5EA 2LNHB 2VXFA 3HRUA 4KBMB 5HKCA 2DLPA 1YITA 1MMNA 1TSFA 2YRVA 1N8RU 3CC4Q 3H0IA 3JCMW 2L2PA 2K5FA 5HK0A 1X2QA 3C0CA 2LJ3A 5DLQE 4FYYB 2DXUA 1OV3A 2FPFA 1G3WA 2DL3A 3A1PA 2YLCA 2DERA 2MMPA 5CK9A 4OMQA 1OULA 2EQUA 3KFVA 3EG9A 2KR3A 1YHQT 2JW4A 2JJ9A 1KC8U 3JCMf 1XTDA 1YN8A 4QQDA 4FL6A 1RAFB 1SPKA 1OU9A 3G71T 4AFQC 4BDYA 2HD0A 3MEAA 1AWOA 1M8VA 1ZSGA 2E3IA 3E2UA 3REBB 4FT4A 4E7SA 1U1SA 4XTUA 1B3QA 1QVGS 1VQNA 3CD6A 3RIRA 1TUGB 1AOJA 2DEQA 5GAMh 3OS5A 2EBPA 1PM3A 4M7DG 5GAN6 1VQLT 1VQ6Q 2FZCB 4OMLA 3VS1A 3OYMA 1PCXA 6AT1B 3UT1A 2PQWA 1U06A 3CC2A 2X4JA 8AT1B 1TTHB 2YDLA 3JCMd 2OJ2A 5GAMj 1W70A 1NYFA 3SEMA 3PMTA 2GBQA 1D1AA 2AZVA 3JB9F 2A28A 1YIJQ 4GY5A 2LCCA 4FU6A 2PTKA 1M2OA 1G3YA 1J3TA 3CCEA 1OZ3A 2O88A 3NGPA 2RK1A 2LQKA 3MP1A 4AG2C 2M0YA 3J7AF 4Z88A 3SB2A 1Q81U 1B7TA 2ED1A 1G8XA 2COYA 2AIRB 5DY9A 3A98A 4OMMA 2BZ8A 4HVUA 5FROA 3FEOA 3SD4A 1JO8A 2LTOA 1NLOC 4OGCA 4C5GA 5I2MA 4X9CA 1KIKA 1VQ5T 1ACMB 2FHDA 2H3JA 1UB4A 1RAHB 2AT1B 2DEUA 5KYWB 3LH5A 5GAN3 4A4HA 4LN2A 5IH2A 2CSQA 3SHWA 2HMAA 4QKUA 1GXIE 4QW2A 2QASA 2AZSA 3OA6A 5LJ5h 3M4YA 5IXBA 2C0IA 5FU6C 4RTUA 5I11A 1IB8A 2FVUA 2FZGB 5KE3A 2DBKA 1VYVA 3HPWA 2XG8D 2KEAA 1EX4A 4F7UG 1VQ8A 3VS2A 2K7AA 5LJ5j 2E41A 3GIBA 5KCHA 1RUWA 2K3BA 1JJ2S 1AEYA 4PJOF 4VUBA 2EYWA 1KFZA 5CKDA 2MWOA 3OY9A 3EG0A 1M27C 3GOXA 5GAMe 3C95A 4M77D 1I8FA 2KQWA 3CCMT 4N4HA 3MCAB 4N0AC 1YCSB 5KYUB 5GANj 5CVIA 2KSSA 2A3LA 5CKFA 2LCSA 3R6OA 2NUTB 4J9EA 1OPKA 1OEBA 1BIBA 1I5LA 1K0XA 3E9FA 3RESA 4J9IA 1YITQ 2GTOA 3FJ5A 1MGQA 3OYLA 3RKXA 4C92G 4DOVA 1W2BP 3H0FA 3M58A 3RR6A 5A0GA 5GAOn 3H9NA 1NJIR 2HSEB 3JCMQ 3TQ7P 1VA7A 4PJOB 4IUTA 4PFZA 2E6NA 3CCQA 1YI2T 3CCVA 1WPYA 1JRIA 5IHIA 2JMAA 3LX7A 1ZSZB 2ESWA 2EYZA 5LJ3g 3HSBA 5D7UA 2J6FA 2YSQA 2GQVA 5CKBA 2WSEE 2EYQA 1BBZA 3M59A 1NEBA 2QTVA 3HRTA 4E7HA 1SHFA 2GF7A 3ME9A 4RUGA 2O4XA 2A0FB 2RHXA 2RM4A 1XOVA 4A4EA 2CS7A 5FWCA 3JCMP 2EQKA 1KHIA 2NUPB 4M75G 1ZUKA 1C6VX 3RMSA 3ZFJA 2M51A 4PJOE 4AFZC 1GBQA 4JRQA 1S72A 2X4YA 2F1LA 2CREA 4CC7A 5LJ3h 3OYBA 1VQNQ 3CD6Q 1FMKA 1OX9A 2HQEA 5GAN2 2ZZDA 4ZGDB 4PL6A 2EJGA 2C06A 2LT1A 5LJ5e 2VV5A 2JTFA 2PVGB 3UATA 1PRLC 2DZ9A 8ATCB 4B9XA 1OI1A 3M0SA 2CP3A 1DJ7B 3CC2Q 5L23A 1AWJA 2VVKA 3I56A 4XU3A 4RTXA 3EGXB 2AHJB 4E7LA 3SWNA 4F7UF 3CXCA 4XK8E 1TUDA 4FYVB 1WZOA 2HL3A 3A8OB 1K1ZA 4NL2A 2E5QA 4MZMA 3OYDA 4C0ZA 5CQYA 4J6XA 2COZA 1KQSS 1WYXA 4PJLA 4OMFB 1WJQA 4R56A 3CCEQ 1NM7A 2DF6A 2O31A 2BTTA 1Y96B 1KD1R 1C0MA 3JCMV 3QZ9B 2CSIA 2RQWA 2BE7D 3FLGA 4IKFA 3NPFA 1BKBA 2RQRA 4F14A 4ANJA 1QKXA 5HY6A 4XAXB 2LQWA 5D6WA 2DTHA 2IG0A 4DBQA 1VQPT 4BUGA 3JCMc 4C92F 1ZA1B 1N8RR 4F7UB 2EYYA 2QQRA 3RERA 1RL2A 1PHTA 3L2RA 2PU9B 2DFUA 4RCBA 2E1HA 2XDDA 4FW1A 1WQ7A 1X6OA 4BACA 1LNXA 3CC7T 2E4HA 2CZ1B 2LX9A 3SWNC 4MMKA 2DYIA 2J06A 5GAOm 4HT8A 4XTXA 3OS0A 4EDUA 2B86A 2XHCA 3R6NA 1Q7YU 3ZBDA 4DEXA 2ZPGB 1KC8R 2YLBA 3LGFA 1EZZB 3CCSA 1YWOA 4F7UE 3EHRA 2MPXC 2MK5A 5GMKh 3G4ST 3CCUT 1B34B 4M75F 1K4US 3GNGA 1X69A 1VQ5A 4HKEA 1WFWA 2RI5A 4HT9A 3DKMA 1VQ8Q 2LMJA 3A8MB 4OF1A 1KHCA 1K73C 2WSCE 5EC7A 4PJJA 5LJ3e 3BFMA 1LOJA 3JCMe 1M5Q1 2EQJA 3RMQA 3I55T 5FLXE 5CCAA 5CAIA 1M90R 2CUBA 1VYTA 2R57A 2W0ZA 3TSZA 2RA2A 4BI8B 1VQ7T 2XKOC 1M2VB 3RKWA 3GF5A 2X9HA 1WJRA 2ZPIB 4M75B 4XTYA 5KYNA 1QLYA 2M9UA 1AZGB 1MNDA 2GGRA 2FEIA 3VUZA 4E7IA 1WGSA 1QVGP 3VKIA 4XQ3A 1ABQA 4LDWA 3CCRT 3NFCA 3F70A 3QO3A 3JAME 4NOYA 3VU3C 3CPWS 4ME7A 3CCQQ 3CCVQ 3CCMA 4PKCC 1M1KU 1PRMC 3G6ET 2QK0A 1XNIA 2R58A 1G83A 3M53A 1WX6A 1VIFA 2DJZA 2KI7A 1Q81R 4LUDA 4RTVA 4NL3A 1VQ9T 4GLMA 2Y4XA 2FYKA 1KQ1A 3OS2A 1QCFA 3FRNA 2MWPA 1QVFS 4NS5A 3MP8A 4M75E 2O9VA 1Q86U 2I2LA 2X35A 4C8QG 2M16A 1WQWA 5KE2A 4DBFA 5GAOq 3NTHA 3JB9D 3FDRA 2K3YA 3MJXA 1LPLA 2KDSA 3G7ZA 4XU1A 5GJWB 2EIFA 1S72Q 3MPUB 3SDZA 1M9SA 1PSFA 1HD3A 1VQ4A 1Q82C 1D3BA 2F5TX 1OU8A 2HNIA 1VQKT 1PSEA 5GMKi 1GCQA 1Z9QA 1M1FA 1WIEA 3OYJA 1SG5A 3OBYA 1Z9ZA 3V8LA 3L2QA 1QMCA 2DETA 4OGEA 4XU0A 2D9TA 2KT1A 1UJ0A 2DXBA 5DM7R 3I56Q 2RNAA 2EJFA 2LDMA 5GMKe 1WXTA 4B6MA 2QEXT 3KBGA 1MNEA 3QSUA 4OMOA 1W2BA 3HKSA 4Y92A 4BE0A 2YRCA 4FIBA 1TS9A 4BE2A 4RTWA 3VV0A 1E6HA 2QXFA 3CCJT 4JPBW 1TU0B 3V7RA 2VB6A 2IVWA 4V2SA 3E1SA 2L3QA 2E3HA 1X6GA 2BKDN 1UGQB 2JZ2A 4FW2A 3CXCP 5M9OA 2LJ1A 1FMVA 2V8JA 2YHTA 3QKJA 5GJVB 1LCKA 1YJ9A 2F69A 4FYWB 4EMKB 3A5ZB 4KRTA 1GCQC 4M78F 3O8VA 2LZ6B 2KXDA 1JJ2P 1FMWA 4PJOD 3I5RA 3M4GA 1NLPC 3QBYA 5DLOA 1I4K1 3L2WA 1NG2A 2E64A 2DL8A 1M3BA 2DILA 1NE8A 1H8KA 3TVTA 2KK4A 1ZBJA 1K9MC 3CMAA 3HTRA 1UEBA 1UFFA 5GAMg 2DO3A 4QVDA 2CYZB 1G5VA 1S1NA 3EGDB 2DTIA 3CCSQ 1D0XA 4DEYA 2JMCA 1JXOA 4C8QF 3T9NA 5KCOA 1FYNA 3DLMA 1VQ5Q 4A54A 3REAB 1KK7A 4JJCA 4M78B 4Z89A 4ZTJA 1E7OA 4II1A 1U1TA 2RHYA 3H41A 3M0PA 2DAQA 2KE9A 4EPCA 2J7IA 1D1BA 2A37A 2FPDA 5KYUA 5FRMA 1NZ9A 1ZLMA 2MOXA 2K5LA 2VXEA 2EKOA 4C5HA 1D1CA 2E70A 1QVPA 1WLPB 2ENMA 3AHUA 4A4FA 1QWFA 1V29B 4MZTA 2HZYA 1UTIA 1YJNT 1M3AA 4C8QB 4M78E 2R5AA 2VGMA 4PJOA 3TU4K 3EFOB 2KT8A 3EHQA 2CZ7B 3VS7A 4M7AF 2P4TA 1MMGA 1RAIB 1WI7A 3PVQA 2RHZA 1IXDA 4JLIA 4MDWA 1X01A 3BY7A 1R77A 3CC4T 3CCMQ 2CZ6B 2K79A 5CKHA 1YJWA 5HK3A 2DBMA 4J6YA 2P84A 2G3RA 3HP9A 1WDXA 3SFMA 2EVRA 4C8QE 3OW2S 5LJ5g 5CR2A 4F16A 1OZ2A 2LT4A 1WNLA 1GBRA 2EGAA 2ZCFB 3GP8A 2X51A 1RLPC 2DIQA 2K5IA 2KROA 4N0AA 4E2FB 3EH1A 3CCLA 4M7AB 4BB7A 1KQSP 2A36A 1FXXA 5GANg 4HCCA 4PJOC 1VQ4Q 4LD6A 3CQTA 2EW3A 4KH0B 1IREB 2DMOA 4OVAA 2RHUA 5GAOp 2R5MA 4EMHA 1Q7YR 2OTLA 1B07A 3LLRA 2KYBA 1ZSZC 4J6WA 3PTAA 1X27A 3OMCA 4ZGEB 1F1BB 1C1AA 4LUEA 4DA4A 4M7AE 5GANh 1K8AC 3J81E 5FRNA 2D1XA 3I9QA 4J7IA 4ZN3A 2RJEA 2OX7A 3MKDA 4IURA 1NYGA 4Z8AA 3EG9B 3ZEHA 4ZN1A 5IHKA 2DTOA 1N9RA 3HL8A 4JDSA 3BDUA 2XDBA 1TUCA 3OS1A 1QVGA 2M1HA 1JU5C 4XTVA 4M7DF 3E19A 3TREA 2DIGA 2E65A 2VASA 2YUNA 2XDPA 1YIJT 1VIEA 3M55A 1PKSA 4WCIA 2DYBA 3CBOA 1VQOA 4TVRA 2GCXA 1TG0A 2QA4A 2P0PA 4M75D 1UGPB 2QEXA 2D6FA 2VKNA 3L2ZA 1YJ9Q 2VC8A 1SF9A 4DOWA 1NPPA 1VQMA 5GMKl 4FT2A 4GLKA 3QWXX 3PVLA 4X1VA 1V1CA 2A08A 2DD4A 3M9QA 2DE0X 2XMFA 2O2OA 1NPRA 4J9DA 1Y71A 3LWHA 3OYHA 2RI3A 4OB0B 4RTTA 1KSWA 1YNZA 3UA6A 2BE9B 4M7DB 2JM9A 1PG5B 2KVQG 1M1KR 1WHKA 3CMAQ 2L3RA 2ZAEA 4FSSA 1CKBA 3JCMg 4E7JA 1MV3A 2EYXA 5L8RE 1HJDA 3PIOA 1QCNA 2XU8A 2YT6A
chains in the Genus database with same CATH topology
2YUQA 4ESRA 1AWWA 2GQIA 3NHNA 1EFNA 2LMJA 4CC2A 2ECZA 2KGTA 1HSQA 1E6GA 2HDAA 5EC7A 4K11A 2QDLA 2JS2A 2EGEA 1Y0MA 4EIKA 1A0NB 1K76A 1PKTA 2G6FX 1SSHA 2I0NA 2AKKA 2ROLA 2BZXA 2V1QA 2LNHB 2DL7A 2DLPA 3VS4A 2CUBA 2RMOA 4D8DA 1VYTA 2W0ZA 3TSZA 2K6DA 3UF4A 2HCKA 3H0IA 1PWTA 2L2PA 2MIOA 1N5ZA 2FG0A 4JJDA 1X2QA 1UJYA 3C0CA 2LJ3A 5ECAA 1QLYA 4OMPA 1AZGB 2CT4A 1SRMA 2GGRA 2FEIA 1OV3A 2FPFA 2DL3A 2FRYA 1BU1A 1W1FA 1ABQA 3O5ZA 4OMQA 3KFVA 2KR3A 2JW4A 1PRMC 2EQIA 1AD5A 1H92A 1G83A 1WX6A 1G2BA 1YN8A 4J9CA 4LUDA 1SPKA 2GNCA 3M0UA 4RTVA 4AFQC 4GLMA 1QCFA 1GFCA 1AWOA 1WA7A 1OOTA 1MUZA 1SRLA 1ZSGA 2O9VA 2FO0A 3REBB 4JJBA 4RTZA 4HCKA 3TSWA 2PZ1A 1B3QA 2KNBB 1X2KA 4ORZA 1AOJA 5GJWB 2VWFA 4QT7A 2EBPA 1QWEA 1HD3A 1VYUA 1JXMA 4OMLA 3VS1A 2OI3A 1AWXA 1U06A 4J9GA 1GCQA 1Z9QA 4IIMA 1WIEA 1BB9A 2YDLA 1Z9ZA 2P4RA 2OJ2A 4LE9A 1W70A 2KXCA 2FRWA 2KT1A 1NYFA 1K9AA 3SEMA 1UJ0A 2GBQA 2RNAA 2LP5A 1K0SA 2AZVA 1AVZC 1UHCA 2A28A 1WXTA 1QKWA 2DA9A 2LJ0A 1PNJA 4R0KA 3NMZC 2PTKA 5IXFA 2KRNA 1M8MA 1J3TA 1YWPA 2X3XD 4OMOA 2O88A 1JQQA 3NGPA 1I07A 4Y92A 1IO6A 1CKAA 1WFWA 4RTWA 1E6HA 4AG2C 2M0YA 2F2VA 4Z88A 2ED1A 4JPBW 1UDLA 2LX7A 3A98A 4OMMA 2BZ8A 4HVUA 2L3QA 2KRMA 4AFUC 1X6BA 5I22A 1X6GA 1JO8A 3VS0A 2C0OA 1NLOC 1BK2A 2LJ1A 3EG3A 5GJVB 1LCKA 1KIKA 5FWBA 2IIMA 4KRTA 1GCQC 4HVVA 2LZ6B 2KXDA 1WXBA 2LQNA 1UGVA 3LH5A 1CSKA 3I5RA 1NLPC 4J9FA 3QWYA 1UUEA 3VRYA 2EKHA 2OAWA 4LN2A 5IH2A 2CSQA 1NG2A 3SHWA 2SEMA 2AZSA 2O9SA 1T0HA 1M3BA 2DL8A 5HCKA 3VRZA 2L3SA 2DILA 5IXBA 1MV0B 1H8KA 3TVTA 1ZBJA 2RQUA 1GRIA 2C0IA 2HEQA 2EGCA 3M0TA 1UFFA 2AKLA 2W10A 2YUPA 3VS3A 4RTUA 5I11A 2K2MA 2DBKA 1S1NA 1VYVA 2CT3A 4ZNXA 2HBWA 2KEAA 4DEYA 2JMCA 1JXOA 3VS2A 2K7AA 1FYNA 2H8HA 2D8JA 1RUWA 1T3LA 2K3BA 2JT4A 1AEYA 3REAB 1X43A 4JJCA 2EYWA 1KFZA 2DL4A 4Z89A 2JM8A 1E7OA 3VS6A 3EG0A 1M27C 2E5KA 2NUZA 1UECA 3H41A 3M0RA 3M0PA 2V1RA 2KE9A 2ABLA 2J7IA 2A37A 2FPDA 4JZ3A 1ZLMA 1YCSB 2MOXA 2LCSA 4J9EA 1OPKA 1WLPB 2ENMA 1OEBA 1QWFA 1UE9A 1K0XA 2L0AA 2KBTA 4J9IA 2GTOA 3FJ5A 1UTIA 2JXBA 2KYMA 4HXJA 1M3AA 3H0FA 2X3WD 4LNPA 1UG1A 4A63B 1Y57A 2KT8A 3EHQA 1VA7A 1U3OA 4JZ4A 2HSPA 3VS7A 2D8HA 1WI7A 2K9GA 2PNIA 3PVQA 1RI9A 2ROTA 5IHIA 3ULRB 2ED0A 3I35A 2J05A 2JMAA 2ESWA 2EYZA 3JV3A 2J6FA 2YSQA 2K79A 1BBZA 1ABOA 2JTEA 1NEBA 2DBMA 1WDXA 1SHFA 1JEGA 1GL5A 4RUGA 2DRMA 2EVRA 4CC4B 1XOVA 5FWCA 4F16A 2SRCA 3PE0A 1ZUKA 2J6OA 1GBRA 2M51A 2EGAA 1GFDA 4AFZC 1GBQA 2DM1A 2RF0A 1M3CA 1RLPC 4HVWA 2KROA 2CREA 4CC7A 2F2WA 2RPNA 1FMKA 1OPLA 2A36A 4D8KA 3UA7A 2DL5A 3UATA 1PRLC 1KJWA 3CQTA 2NWMA 3M0QA 3M0SA 2EW3A 3EG1A 3U23A 4CC3A 2DMOA 2F2XA 1UHFA 3I5SA 5L23A 1AWJA 2VVKA 1B07A 1ARKA 4E6RA 1RLQC 2KYBA 1X27A 1ZUUA 4RTXA 1NEGA 1TUDA 2EPDA 3GBQA 3IQLA 2KRSA 4RTYA 4LUEA 1K1ZA 4F17A 4OMNA 4AFSC 3VS5A 3ZL7C 2DRKA 1WYXA 2D1XA 3I9QA 1SEMA 1NYGA 1NM7A 4Z8AA 2DF6A 2O31A 5IHNA 2BTTA 5IHKA 1U5SA 5FW9A 2DVJA 2CSIA 2RQWA 4IIOA 1AZEA 4AG1C 1T3SA 1TUCA 2YUOA 3EGUA 3NPFA 1JU5C 2RQRA 3EG2A 2GTJA 4F14A 1GCPA 1QKXA 3THKA 2YUNA 2LQWA 2D0NA 2CUDA 2RQTA 2CH4W 1PKSA 4WCIA 2DYBA 2DJQA 2CH4A 2EYYA 4M4ZA 1TG0A 1PHTA 2JS0A 2VKNA 3RNJA 4GBQA 1T0JA 2FPEA 3PVLA 3QWXX 4X1VA 3RBBB 1V1CA 1I1JA 2A08A 2MCNA 2DE0X 1YP5A 2J06A 2O2OA 2XMFA 4J9DA 4J9BA 1M30A 1SHGA 2B86A 2L3PA 4RTTA 1KSWA 3H0HA 2RQVA 1YNZA 3R6NA 4DEXA 3UA6A 1ZUYA 2DX1A 2JM9A 1ZX6A 2J6KA 1WXUA 1I0CA 1YWOA 4J9HA 4FSSA 1CKBA 1MV3A 3EHRA 2EYXA 1HJDA 2DNUA 1H3HA 1W6XA 1K4US 2RN8A 2AK5A 2CDTA 2C0TA 1X69A 2BZYA 2YT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUQ A;  4ESR A;  1AWW A;  2GQI A;  3NHN A;  1EFN A;  2LMJ A;  4CC2 A;  2ECZ A;  2KGT A;  1HSQ A;  1E6G A;  2HDA A;  5EC7 A;  4K11 A;  2QDL A;  2JS2 A;  2EGE A;  1Y0M A;  4EIK A;  1A0N B;  1K76 A;  1PKT A;  2G6F X;  1SSH A;  2I0N A;  2AKK A;  2ROL A;  2BZX A;  2V1Q A;  2LNH B;  2DL7 A;  2DLP A;  3VS4 A;  2CUB A;  2RMO A;  4D8D A;  1VYT A;  2W0Z A;  3TSZ A;  2K6D A;  3UF4 A;  2HCK A;  3H0I A;  1PWT A;  2L2P A;  2MIO A;  1N5Z A;  2FG0 A;  4JJD A;  1X2Q A;  1UJY A;  3C0C A;  2LJ3 A;  5ECA A;  1QLY A;  4OMP A;  1AZG B;  2CT4 A;  1SRM A;  2GGR A;  2FEI A;  1OV3 A;  2FPF A;  2DL3 A;  2FRY A;  1BU1 A;  1W1F A;  1ABQ A;  3O5Z A;  4OMQ A;  3KFV A;  2KR3 A;  2JW4 A;  1PRM C;  2EQI A;  1AD5 A;  1H92 A;  1G83 A;  1WX6 A;  1G2B A;  1YN8 A;  4J9C A;  4LUD A;  1SPK A;  2GNC A;  3M0U A;  4RTV A;  4AFQ C;  4GLM A;  1QCF A;  1GFC A;  1AWO A;  1WA7 A;  1OOT A;  1MUZ A;  1SRL A;  1ZSG A;  2O9V A;  2FO0 A;  3REB B;  4JJB A;  4RTZ A;  4HCK A;  3TSW A;  2PZ1 A;  1B3Q A;  2KNB B;  1X2K A;  4ORZ A;  1AOJ A;  5GJW B;  2VWF A;  4QT7 A;  2EBP A;  1QWE A;  1HD3 A;  1VYU A;  1JXM A;  4OML A;  3VS1 A;  2OI3 A;  1AWX A;  1U06 A;  4J9G A;  1GCQ A;  1Z9Q A;  4IIM A;  1WIE A;  1BB9 A;  2YDL A;  1Z9Z A;  2P4R A;  2OJ2 A;  4LE9 A;  1W70 A;  2KXC A;  2FRW A;  2KT1 A;  1NYF A;  1K9A A;  3SEM A;  1UJ0 A;  2GBQ A;  2RNA A;  2LP5 A;  1K0S A;  2AZV A;  1AVZ C;  1UHC A;  2A28 A;  1WXT A;  1QKW A;  2DA9 A;  2LJ0 A;  1PNJ A;  4R0K A;  3NMZ C;  2PTK A;  5IXF A;  2KRN A;  1M8M A;  1J3T A;  1YWP A;  2X3X D;  4OMO A;  2O88 A;  1JQQ A;  3NGP A;  1I07 A;  4Y92 A;  1IO6 A;  1CKA A;  1WFW A;  4RTW A;  1E6H A;  4AG2 C;  2M0Y A;  2F2V A;  4Z88 A;  2ED1 A;  4JPB W;  1UDL A;  2LX7 A;  3A98 A;  4OMM A;  2BZ8 A;  4HVU A;  2L3Q A;  2KRM A;  4AFU C;  1X6B A;  5I22 A;  1X6G A;  1JO8 A;  3VS0 A;  2C0O A;  1NLO C;  1BK2 A;  2LJ1 A;  3EG3 A;  5GJV B;  1LCK A;  1KIK A;  5FWB A;  2IIM A;  4KRT A;  1GCQ C;  4HVV A;  2LZ6 B;  2KXD A;  1WXB A;  2LQN A;  1UGV A;  3LH5 A;  1CSK A;  3I5R A;  1NLP C;  4J9F A;  3QWY A;  1UUE A;  3VRY A;  2EKH A;  2OAW A;  4LN2 A;  5IH2 A;  2CSQ A;  1NG2 A;  3SHW A;  2SEM A;  2AZS A;  2O9S A;  1T0H A;  1M3B A;  2DL8 A;  5HCK A;  3VRZ A;  2L3S A;  2DIL A;  5IXB A;  1MV0 B;  1H8K A;  3TVT A;  1ZBJ A;  2RQU A;  1GRI A;  2C0I A;  2HEQ A;  2EGC A;  3M0T A;  1UFF A;  2AKL A;  2W10 A;  2YUP A;  3VS3 A;  4RTU A;  5I11 A;  2K2M A;  2DBK A;  1S1N A;  1VYV A;  2CT3 A;  4ZNX A;  2HBW A;  2KEA A;  4DEY A;  2JMC A;  1JXO A;  3VS2 A;  2K7A A;  1FYN A;  2H8H A;  2D8J A;  1RUW A;  1T3L A;  2K3B A;  2JT4 A;  1AEY A;  3REA B;  1X43 A;  4JJC A;  2EYW A;  1KFZ A;  2DL4 A;  4Z89 A;  2JM8 A;  1E7O A;  3VS6 A;  3EG0 A;  1M27 C;  2E5K A;  2NUZ A;  1UEC A;  3H41 A;  3M0R A;  3M0P A;  2V1R A;  2KE9 A;  2ABL A;  2J7I A;  2A37 A;  2FPD A;  4JZ3 A;  1ZLM A;  1YCS B;  2MOX A;  2LCS A;  4J9E A;  1OPK A;  1WLP B;  2ENM A;  1OEB A;  1QWF A;  1UE9 A;  1K0X A;  2L0A A;  2KBT A;  4J9I A;  2GTO A;  3FJ5 A;  1UTI A;  2JXB A;  2KYM A;  4HXJ A;  1M3A A;  3H0F A;  2X3W D;  4LNP A;  1UG1 A;  4A63 B;  1Y57 A;  2KT8 A;  3EHQ A;  1VA7 A;  1U3O A;  4JZ4 A;  2HSP A;  3VS7 A;  2D8H A;  1WI7 A;  2K9G A;  2PNI A;  3PVQ A;  1RI9 A;  2ROT A;  5IHI A;  3ULR B;  2ED0 A;  3I35 A;  2J05 A;  2JMA A;  2ESW A;  2EYZ A;  3JV3 A;  2J6F A;  2YSQ A;  2K79 A;  1BBZ A;  1ABO A;  2JTE A;  1NEB A;  2DBM A;  1WDX A;  1SHF A;  1JEG A;  1GL5 A;  4RUG A;  2DRM A;  2EVR A;  4CC4 B;  1XOV A;  5FWC A;  4F16 A;  2SRC A;  3PE0 A;  1ZUK A;  2J6O A;  1GBR A;  2M51 A;  2EGA A;  1GFD A;  4AFZ C;  1GBQ A;  2DM1 A;  2RF0 A;  1M3C A;  1RLP C;  4HVW A;  2KRO A;  2CRE A;  4CC7 A;  2F2W A;  2RPN A;  1FMK A;  1OPL A;  2A36 A;  4D8K A;  3UA7 A;  2DL5 A;  3UAT A;  1PRL C;  1KJW A;  3CQT A;  2NWM A;  3M0Q A;  3M0S A;  2EW3 A;  3EG1 A;  3U23 A;  4CC3 A;  2DMO A;  2F2X A;  1UHF A;  3I5S A;  5L23 A;  1AWJ A;  2VVK A;  1B07 A;  1ARK A;  4E6R A;  1RLQ C;  2KYB A;  1X27 A;  1ZUU A;  4RTX A;  1NEG A;  1TUD A;  2EPD A;  3GBQ A;  3IQL A;  2KRS A;  4RTY A;  4LUE A;  1K1Z A;  4F17 A;  4OMN A;  4AFS C;  3VS5 A;  3ZL7 C;  2DRK A;  1WYX A;  2D1X A;  3I9Q A;  1SEM A;  1NYG A;  1NM7 A;  4Z8A A;  2DF6 A;  2O31 A;  5IHN A;  2BTT A;  5IHK A;  1U5S A;  5FW9 A;  2DVJ A;  2CSI A;  2RQW A;  4IIO A;  1AZE A;  4AG1 C;  1T3S A;  1TUC A;  2YUO A;  3EGU A;  3NPF A;  1JU5 C;  2RQR A;  3EG2 A;  2GTJ A;  4F14 A;  1GCP A;  1QKX A;  3THK A;  2YUN A;  2LQW A;  2D0N A;  2CUD A;  2RQT A;  2CH4 W;  1PKS A;  4WCI A;  2DYB A;  2DJQ A;  2CH4 A;  2EYY A;  4M4Z A;  1TG0 A;  1PHT A;  2JS0 A;  2VKN A;  3RNJ A;  4GBQ A;  1T0J A;  2FPE A;  3PVL A;  3QWX X;  4X1V A;  3RBB B;  1V1C A;  1I1J A;  2A08 A;  2MCN A;  2DE0 X;  1YP5 A;  2J06 A;  2O2O A;  2XMF A;  4J9D A;  4J9B A;  1M30 A;  1SHG A;  2B86 A;  2L3P A;  4RTT A;  1KSW A;  3H0H A;  2RQV A;  1YNZ A;  3R6N A;  4DEX A;  3UA6 A;  1ZUY A;  2DX1 A;  2JM9 A;  1ZX6 A;  2J6K A;  1WXU A;  1I0C A;  1YWO A;  4J9H A;  4FSS A;  1CKB A;  1MV3 A;  3EHR A;  2EYX A;  1HJD A;  2DNU A;  1H3H A;  1W6X A;  1K4U S;  2RN8 A;  2AK5 A;  2CDT A;  2C0T A;  1X69 A;  2BZY A;  2YT6 A; 
#chains in the Genus database with same CATH topology
 2RO0 A;  1QCO A;  4ESR A;  1AWW A;  1EFN A;  1RAC B;  1Q86 R;  3EFR A;  5I21 A;  2NYS A;  1OX8 A;  1BI2 A;  1RAB B;  2QDL A;  3A8G B;  4KUL A;  2QTX A;  3HFO A;  4KGZ B;  4M77 A;  5KYX A;  3CPW P;  4M7D E;  2DL7 A;  3JCM h;  2QG9 B;  1YHQ A;  2RD1 A;  2Z0W A;  3V7C A;  3L2U A;  4HCB A;  2K6D A;  3UF4 A;  2HCK A;  3MET A;  1SKU B;  1WHH A;  1YBY A;  3G71 A;  2HBP A;  2COW A;  2VUB A;  2BIV A;  1UJY A;  4OMP A;  2CT4 A;  2E12 A;  4PLL A;  4ELY C;  4RMO A;  2FRY A;  1W1F A;  5GAN e;  4ATO A;  4HCZ A;  2RB6 A;  4KGV B;  4FM4 B;  3CME T;  1BCM A;  1JJ2 A;  4MDX A;  1AD5 A;  1BYM A;  4QVZ A;  1YIT T;  1G2B A;  1VQL A;  3M0U A;  3UDC A;  4AT1 B;  1YJW Q;  3M5A A;  4A4K A;  1WA7 A;  1QP3 A;  4M77 C;  1MUZ A;  4JJB A;  4RTZ A;  4DBR A;  5KH6 A;  1ZHI A;  4J8O A;  2KY9 A;  1TWB A;  3X25 B;  4ORZ A;  4PK4 A;  3X20 B;  3WVE B;  4M75 C;  4PNO A;  2VWF A;  3CCL Q;  1QWE A;  3OYY A;  4F04 B;  1I81 A;  2FL7 A;  1JXM A;  3JCM J;  2OI3 A;  5CQX A;  4LD9 K;  1AWX A;  2CP6 A;  4IIM A;  4JS5 A;  1BB9 A;  4LE9 A;  3PFS A;  5KYY B;  3LWI A;  2KXC A;  2CP7 A;  2FRW A;  2LCL A;  3PMI A;  2Y4Y A;  4XTZ A;  2LP5 A;  2OTL Q;  1K0S A;  1QQJ A;  1VQN T;  3CD6 T;  2DA9 A;  1PNJ A;  4R0K A;  3NMZ C;  5FU7 C;  2QQ9 A;  4C92 B;  4M78 D;  2K57 A;  1YWP A;  3H8Z A;  4JRI A;  2CP2 A;  2LQ8 A;  3Q1J A;  2PVO B;  3OYC A;  2LVM A;  3P8H A;  1G3S A;  3CC2 T;  4C0G A;  1O9S A;  1IGU A;  4C0D B;  2KRM A;  4AFU C;  2LNV A;  1X6B A;  5A2Q E;  5I22 A;  2O4X B;  3VS0 A;  1Y7X A;  3GLX A;  1BK2 A;  4ELZ C;  4PLI A;  3EG3 A;  2QGG A;  4EMK A;  4KUI A;  1NJI C;  2MF2 A;  1WHG A;  4C8Q D;  4C92 E;  1VQO Q;  3CCE T;  2IIM A;  4BI4 A;  3L42 A;  3AT1 B;  2QA4 Q;  2QEX Q;  1BIA A;  1K73 U;  1IRX A;  2D0Q B;  2OAU A;  3QWY A;  3PT9 A;  3VRY A;  1VQM Q;  3X28 B;  3OB9 A;  2SEM A;  3S3O A;  2P0Q A;  1T0H A;  4UC4 A;  3FB9 A;  1MV0 B;  2QYZ A;  3GPL A;  1GRI A;  1XQH A;  3EH2 A;  2HEQ A;  2EGC A;  1KQS A;  2AKL A;  2W10 A;  2YUP A;  2ZPE B;  2DPP B;  2K2M A;  3QZ5 B;  2DK3 A;  3NTK A;  4ZNX A;  3GNF B;  2HBW A;  3TCJ A;  1XJW B;  5C0M A;  2RI2 A;  2H8H A;  3CBM A;  3UPU A;  2DD5 A;  4M78 A;  2IPO B;  1WHJ A;  1X43 A;  2VGN A;  2DL4 A;  2JM8 A;  3VS6 A;  4DQ2 A;  2NUZ A;  3M0R A;  4R55 A;  4M7A D;  1VOM A;  4Z02 A;  2V1R A;  3CPF A;  4EMK C;  1UGR B;  1YI2 A;  3ASK A;  3C4S A;  4J83 A;  3QYH B;  3JB9 H;  3C94 A;  1M4Z A;  3MEV A;  3MEW A;  1YHQ Q;  3P8B B;  3QDF A;  1VQ8 T;  2B8A A;  2JNG A;  3BDL A;  1Y07 A;  2KYM A;  4HXJ A;  2KAF A;  5GMK m;  3G71 Q;  2FZK B;  3EFO A;  3EFS A;  1KG1 A;  2EAY A;  1Y57 A;  2JUF A;  4L59 A;  4MML A;  4OB2 B;  1U3O A;  1KD1 C;  2HSP A;  2D8H A;  2PNI A;  2GFA A;  2ROT A;  1Q82 U;  2RJF A;  2HKQ B;  4M78 C;  3RKY A;  2V8I A;  4OB3 B;  2JVV A;  4KGX B;  2XI9 A;  3X26 B;  3OYE A;  2JTE A;  5J3B A;  2OTJ T;  5AYF A;  1GL5 A;  2DRM A;  1VQL Q;  1N8R C;  3JB9 G;  2X4X A;  1BI3 A;  4BY6 B;  3JCM X;  3FC3 A;  3H6Z A;  4O5V A;  2SRC A;  3PE0 A;  1RAG B;  2J6O A;  1QP2 A;  3QII A;  2DM1 A;  4XTW A;  1M3C A;  3CCQ T;  3CCV T;  2HQH A;  4M7A A;  4X34 A;  2F2W A;  1I5O B;  2RPN A;  1OPL A;  2MYS A;  5KYW A;  5GAN 8;  1D0Y A;  5I2S A;  2V26 A;  4D8K A;  3UA7 A;  3CME A;  4D6W A;  2ATC B;  1KC8 C;  4KH1 B;  1SSF A;  1MMD A;  2ZPB B;  2CKK A;  3M0Q A;  4M7D D;  4CC3 A;  3EG1 A;  3U23 A;  1UHF A;  5CKE A;  3CPW A;  1ARK A;  1RLQ C;  4WF2 A;  4C5I A;  1S72 T;  2EPD A;  4PJN A;  2RH2 A;  2MAM A;  3VJP A;  1VQP A;  2RJC A;  3NTI A;  5D6Y A;  2LC4 A;  4AFS C;  5LJ3 f;  3VS5 A;  2QI2 A;  3VYG A;  1QVF A;  9ATC B;  4J7F A;  1SEM A;  2PUK B;  5J39 A;  3CC7 A;  1U5S A;  1M90 C;  4IIO A;  4AG1 C;  2YUO A;  3EGU A;  2QAZ A;  3RDV A;  1K9M U;  3EG2 A;  4YTL A;  3I56 T;  2GTJ A;  2FB7 A;  3EAE A;  3QHS A;  4M7A C;  3THK A;  2NUT A;  4BDZ A;  2Y90 A;  4IUQ A;  2D0N A;  1WHM A;  3OYK A;  2RQT A;  1RAE B;  4RCC A;  3A8H B;  2ZPH B;  4CI0 C;  1BI1 A;  2K3X A;  4PJO G;  4M4Z A;  1VUB A;  3QUI A;  3KUF A;  1D0Z A;  3LW5 E;  3CEY A;  3G4S A;  3RNJ A;  3CCU A;  1IGQ A;  4GBQ A;  3TEE A;  4LDU A;  5J26 A;  3OYF A;  2ZPF B;  3CBP A;  2XD0 A;  2FPE A;  1M90 U;  3RBB B;  1D3B B;  5LJ3 d;  1Q81 C;  4M7D A;  1JB0 E;  1ZSZ A;  1OYX A;  2L3P A;  5GAO l;  3QJ6 A;  5AT1 B;  4L6V 5;  1ZUY A;  2DX1 A;  1U8R A;  4E7Z A;  3I55 A;  1ZX6 A;  2J6K A;  1I0C A;  5A0D A;  2CGH A;  3QPH A;  2PUO B;  2ZGW A;  2DNU A;  4C0F A;  1W6X A;  1WJS A;  1VQ7 A;  2AK5 A;  2C0T A;  3HRS A;  2BZY A;  2NUP A;  4PFO A;  2GQI A;  4CC2 A;  4JS4 A;  1IZ6 A;  2ECZ A;  2KGT A;  1N6A A;  2HDA A;  2JS2 A;  2EGE A;  1Y0M A;  3RUX A;  1PKT A;  2G6F X;  2I0N A;  2ROL A;  2BZX A;  2V1Q A;  4ZGJ B;  3CCR A;  5C6S A;  4KUD K;  3JRZ A;  4BD3 A;  1YI2 Q;  2DVE A;  3CCS T;  3OMG A;  2KMT A;  3VS4 A;  2L8D A;  2JOY A;  2RMO A;  4D8D A;  3G6E A;  2YRD A;  3UWN A;  2QQS A;  1RI0 A;  4LDX A;  1PWT A;  3OYI A;  2MIO A;  1VQ9 A;  4OP0 A;  1N5Z A;  2FG0 A;  4JJD A;  7AT1 B;  3EGX A;  4M7D C;  4LDV A;  3HFN A;  5ECA A;  3MP6 A;  4N4G A;  2DKG A;  3S3M A;  1SRM A;  2QDY B;  1YCY A;  5IN1 A;  4IUP A;  4C92 D;  1BU1 A;  2WSF E;  4X9D A;  3A8L B;  4WTO B;  3O5Z A;  2DXC A;  1VQ6 T;  2MI6 A;  1Y96 A;  1YFN A;  3LH0 A;  2EQI A;  3OSV A;  3CXC S;  2QQB A;  4JJN K;  1H92 A;  3V8K A;  4XU2 A;  3QYG B;  4J9C A;  3DB4 A;  1D09 B;  2L5Q A;  2GNC A;  1AT1 B;  1VQK A;  1GFC A;  3JSC A;  1OOT A;  3BE3 A;  3N5B B;  1SRL A;  3L2V A;  1Q95 G;  2FO0 A;  5LL6 S;  4BI3 A;  4HCK A;  4F7U A;  3TSW A;  2PZ1 A;  3KXT A;  5GAN 5;  1UGS B;  3ER0 A;  2KNB B;  1X2K A;  1K8A U;  3P8D A;  2P0K A;  2DZC A;  2QQA A;  1FX7 A;  4QT7 A;  4BE1 A;  1K73 R;  1VYU A;  3PIP A;  1IHV A;  3CME Q;  4J9G A;  3CCJ A;  5KYY A;  2P4R A;  2OTJ A;  4A4G A;  5GAN 7;  1X75 C;  1K9A A;  3OYA A;  1PD0 A;  2CP5 A;  4Y91 A;  1AVZ C;  3E9G A;  3QJY A;  1UHC A;  1B34 A;  2LRQ A;  1QKW A;  2LJ0 A;  3QG1 A;  4FSX A;  4C92 A;  2RHI A;  1NBE B;  2M02 A;  5IXF A;  5D6X A;  2KRN A;  1P92 A;  1M8M A;  1VQP Q;  2X3X D;  1JQQ A;  4JLG A;  1G3T A;  1VQ4 T;  1I07 A;  3OW2 A;  1IO6 A;  1CKA A;  5FU6 B;  4M77 G;  2F2V A;  2HQX A;  5A0L A;  3CC7 Q;  1UDL A;  2LX7 A;  3FIF A;  3JB9 I;  4EMG A;  1O75 A;  5GAO r;  1LVK A;  1AHJ B;  2GFU A;  5CIU A;  2C0O A;  4Y28 E;  2XIC A;  1M2V A;  1BCO A;  1HXD A;  3MO8 A;  4RKU E;  5FWB A;  1PD1 A;  3M57 A;  4M75 A;  2CP0 A;  3M54 A;  3V7S A;  4HVV A;  1QVF P;  5CO7 A;  2O01 E;  2LQN A;  1WXB A;  3G1J A;  3G4S Q;  1UGV A;  3CCU Q;  1CSK A;  4J9F A;  1UUE A;  2EKH A;  2OAW A;  3WVD B;  3BW1 A;  4E7K A;  4IUV A;  2HKN A;  2O9S A;  5HCK A;  3VRZ A;  3PGG A;  2L3S A;  4C92 C;  4ZTF A;  2K2V A;  3LYI A;  5LJ3 j;  2RQU A;  1Q82 R;  3M0T A;  3VS3 A;  3VYH B;  3URG A;  2RK2 A;  3M56 A;  1BI0 A;  1H3Z A;  2CT3 A;  3MHX A;  3I55 Q;  1YJ9 T;  3QDR B;  3LGL A;  1QW1 A;  1ZBX A;  3S6W A;  4QQG A;  4C0D C;  3FJP A;  3PNW C;  3V8J A;  2D8J A;  1T3L A;  2M0O A;  4MZP A;  2EFI A;  4LXC A;  2JT4 A;  4N4I A;  1IHW A;  1VQ7 Q;  1TH7 A;  1OQK A;  1YJN A;  4CRI A;  3DLL A;  2E5K A;  2VYT A;  1UEC A;  1JBM A;  3JB9 J;  1MMA A;  2ABL A;  4JZ3 A;  2XK0 A;  3CMA T;  4KT0 E;  2JN0 A;  3CCR Q;  1Q7Y C;  4PFP A;  1PC0 A;  3CC4 A;  4AMC A;  4O6J A;  4RG8 A;  2EWN A;  3G6E Q;  1EIF A;  1UE9 A;  3OYN A;  2L0A A;  2KBT A;  2JXB A;  4JRK A;  2X3W D;  1VQ9 Q;  4LNP A;  3OQ5 A;  1UG1 A;  4A63 B;  1R8O B;  3C12 A;  4FYX B;  1TOV A;  4JZ4 A;  1R0B G;  2XID A;  2K9G A;  5IAY A;  4M77 F;  1RI9 A;  5GAM f;  3ULR B;  2ED0 A;  3I35 A;  2J05 A;  4PJM A;  3INZ A;  3JV3 A;  3WXM B;  4QVC A;  4LDY A;  4JRP A;  1ABO A;  1JEG A;  1K9M R;  4OB1 B;  4CC4 B;  3OYG A;  1W2B S;  1VQK Q;  1WHL A;  3J80 E;  1H64 1;  2BUD A;  2E6Z A;  1GFD A;  2RF0 A;  4HVW A;  2K4Y A;  3DB3 A;  2EQM A;  5GMK j;  4E47 A;  4B9W A;  1VQ6 A;  3D7S B;  4M77 B;  5KYX B;  2DL5 A;  1YJW T;  1M1K C;  4HA8 A;  1KJW A;  1FWZ A;  2NWM A;  5GAM d;  1HK9 A;  3OSS C;  2F2X A;  3CCJ Q;  3I5S A;  1HYO A;  4E6R A;  3EGD A;  1YIJ A;  1ZUU A;  2OTJ Q;  2A7Y A;  1NEG A;  1Q86 C;  4M78 G;  1NJI U;  1KQ2 A;  3GBQ A;  1LJO A;  3IQL A;  3SWN B;  2E10 A;  2KRS A;  4A53 A;  4RTY A;  2PVD B;  3CCL T;  4F17 A;  4OMN A;  1TXQ A;  3JCM b;  4JUV A;  3ZL7 C;  4BY6 C;  2DRK A;  2CZ0 B;  4RG2 A;  4M77 E;  3QXE B;  2L89 A;  5IHN A;  4J5Y A;  5IT9 E;  2H3E B;  3L1A A;  2QGF B;  5FW9 A;  1M1G A;  2DVJ A;  1AZE A;  1T3S A;  1ZQ1 A;  2EJ9 A;  5LJ5 f;  5FU7 B;  2RJD A;  2OTL T;  2DXT A;  1GCP A;  2CUD A;  2CH4 W;  2YXY A;  2NLU A;  4QQ6 A;  2DJQ A;  2CH4 A;  3VUB A;  2JS0 A;  4C8Q A;  3OBW A;  3X24 B;  5GAN f;  3OW2 P;  4L5G A;  4P5N A;  1N9S A;  2WAC A;  4IUU A;  1T0J A;  1I1J A;  2MCN A;  1YP5 A;  4J9B A;  2HAX A;  1M30 A;  1SHG A;  5GAN 4;  3H0H A;  2RQV A;  2V8K A;  3HHT B;  1WXU A;  4FCY A;  2X4W A;  1VQO T;  1ZA2 B;  4Q5W A;  4J9H A;  5LJ5 d;  2QA4 T;  2F5K A;  1H3H A;  2RN8 A;  2CDT A;  1VQM T;  2YUQ A;  3NHN A;  4DBH A;  4M7A G;  1RAA B;  1RAD B;  5EG2 A;  1HSQ A;  1MHN A;  1KD1 U;  2JTM A;  1E6G A;  3MEU A;  3S3N A;  1YJN Q;  2YWW A;  4K11 A;  1N27 A;  1K8A R;  1W4S A;  1V76 A;  4EIK A;  5GAN d;  1K76 A;  1A0N B;  1SSH A;  2AKK A;  1R0C B;  2HL5 C;  4C8Q C;  4C5E A;  2LNH B;  2VXF A;  3HRU A;  4KBM B;  5HKC A;  2DLP A;  1YIT A;  1MMN A;  1TSF A;  2YRV A;  1N8R U;  3CC4 Q;  3H0I A;  3JCM W;  2L2P A;  2K5F A;  5HK0 A;  1X2Q A;  3C0C A;  2LJ3 A;  5DLQ E;  4FYY B;  2DXU A;  1OV3 A;  2FPF A;  1G3W A;  2DL3 A;  3A1P A;  2YLC A;  2DER A;  2MMP A;  5CK9 A;  4OMQ A;  1OUL A;  2EQU A;  3KFV A;  3EG9 A;  2KR3 A;  1YHQ T;  2JW4 A;  2JJ9 A;  1KC8 U;  3JCM f;  1XTD A;  1YN8 A;  4QQD A;  4FL6 A;  1RAF B;  1SPK A;  1OU9 A;  3G71 T;  4AFQ C;  4BDY A;  2HD0 A;  3MEA A;  1AWO A;  1M8V A;  1ZSG A;  2E3I A;  3E2U A;  3REB B;  4FT4 A;  4E7S A;  1U1S A;  4XTU A;  1B3Q A;  1QVG S;  1VQN A;  3CD6 A;  3RIR A;  1TUG B;  1AOJ A;  2DEQ A;  5GAM h;  3OS5 A;  2EBP A;  1PM3 A;  4M7D G;  5GAN 6;  1VQL T;  1VQ6 Q;  2FZC B;  4OML A;  3VS1 A;  3OYM A;  1PCX A;  6AT1 B;  3UT1 A;  2PQW A;  1U06 A;  3CC2 A;  2X4J A;  8AT1 B;  1TTH B;  2YDL A;  3JCM d;  2OJ2 A;  5GAM j;  1W70 A;  1NYF A;  3SEM A;  3PMT A;  2GBQ A;  1D1A A;  2AZV A;  3JB9 F;  2A28 A;  1YIJ Q;  4GY5 A;  2LCC A;  4FU6 A;  2PTK A;  1M2O A;  1G3Y A;  1J3T A;  3CCE A;  1OZ3 A;  2O88 A;  3NGP A;  2RK1 A;  2LQK A;  3MP1 A;  4AG2 C;  2M0Y A;  3J7A F;  4Z88 A;  3SB2 A;  1Q81 U;  1B7T A;  2ED1 A;  1G8X A;  2COY A;  2AIR B;  5DY9 A;  3A98 A;  4OMM A;  2BZ8 A;  4HVU A;  5FRO A;  3FEO A;  3SD4 A;  1JO8 A;  2LTO A;  1NLO C;  4OGC A;  4C5G A;  5I2M A;  4X9C A;  1KIK A;  1VQ5 T;  1ACM B;  2FHD A;  2H3J A;  1UB4 A;  1RAH B;  2AT1 B;  2DEU A;  5KYW B;  3LH5 A;  5GAN 3;  4A4H A;  4LN2 A;  5IH2 A;  2CSQ A;  3SHW A;  2HMA A;  4QKU A;  1GXI E;  4QW2 A;  2QAS A;  2AZS A;  3OA6 A;  5LJ5 h;  3M4Y A;  5IXB A;  2C0I A;  5FU6 C;  4RTU A;  5I11 A;  1IB8 A;  2FVU A;  2FZG B;  5KE3 A;  2DBK A;  1VYV A;  3HPW A;  2XG8 D;  2KEA A;  1EX4 A;  4F7U G;  1VQ8 A;  3VS2 A;  2K7A A;  5LJ5 j;  2E41 A;  3GIB A;  5KCH A;  1RUW A;  2K3B A;  1JJ2 S;  1AEY A;  4PJO F;  4VUB A;  2EYW A;  1KFZ A;  5CKD A;  2MWO A;  3OY9 A;  3EG0 A;  1M27 C;  3GOX A;  5GAM e;  3C95 A;  4M77 D;  1I8F A;  2KQW A;  3CCM T;  4N4H A;  3MCA B;  4N0A C;  1YCS B;  5KYU B;  5GAN j;  5CVI A;  2KSS A;  2A3L A;  5CKF A;  2LCS A;  3R6O A;  2NUT B;  4J9E A;  1OPK A;  1OEB A;  1BIB A;  1I5L A;  1K0X A;  3E9F A;  3RES A;  4J9I A;  1YIT Q;  2GTO A;  3FJ5 A;  1MGQ A;  3OYL A;  3RKX A;  4C92 G;  4DOV A;  1W2B P;  3H0F A;  3M58 A;  3RR6 A;  5A0G A;  5GAO n;  3H9N A;  1NJI R;  2HSE B;  3JCM Q;  3TQ7 P;  1VA7 A;  4PJO B;  4IUT A;  4PFZ A;  2E6N A;  3CCQ A;  1YI2 T;  3CCV A;  1WPY A;  1JRI A;  5IHI A;  2JMA A;  3LX7 A;  1ZSZ B;  2ESW A;  2EYZ A;  5LJ3 g;  3HSB A;  5D7U A;  2J6F A;  2YSQ A;  2GQV A;  5CKB A;  2WSE E;  2EYQ A;  1BBZ A;  3M59 A;  1NEB A;  2QTV A;  3HRT A;  4E7H A;  1SHF A;  2GF7 A;  3ME9 A;  4RUG A;  2O4X A;  2A0F B;  2RHX A;  2RM4 A;  1XOV A;  4A4E A;  2CS7 A;  5FWC A;  3JCM P;  2EQK A;  1KHI A;  2NUP B;  4M75 G;  1ZUK A;  1C6V X;  3RMS A;  3ZFJ A;  2M51 A;  4PJO E;  4AFZ C;  1GBQ A;  4JRQ A;  1S72 A;  2X4Y A;  2F1L A;  2CRE A;  4CC7 A;  5LJ3 h;  3OYB A;  1VQN Q;  3CD6 Q;  1FMK A;  1OX9 A;  2HQE A;  5GAN 2;  2ZZD A;  4ZGD B;  4PL6 A;  2EJG A;  2C06 A;  2LT1 A;  5LJ5 e;  2VV5 A;  2JTF A;  2PVG B;  3UAT A;  1PRL C;  2DZ9 A;  8ATC B;  4B9X A;  1OI1 A;  3M0S A;  2CP3 A;  1DJ7 B;  3CC2 Q;  5L23 A;  1AWJ A;  2VVK A;  3I56 A;  4XU3 A;  4RTX A;  3EGX B;  2AHJ B;  4E7L A;  3SWN A;  4F7U F;  3CXC A;  4XK8 E;  1TUD A;  4FYV B;  1WZO A;  2HL3 A;  3A8O B;  1K1Z A;  4NL2 A;  2E5Q A;  4MZM A;  3OYD A;  4C0Z A;  5CQY A;  4J6X A;  2COZ A;  1KQS S;  1WYX A;  4PJL A;  4OMF B;  1WJQ A;  4R56 A;  3CCE Q;  1NM7 A;  2DF6 A;  2O31 A;  2BTT A;  1Y96 B;  1KD1 R;  1C0M A;  3JCM V;  3QZ9 B;  2CSI A;  2RQW A;  2BE7 D;  3FLG A;  4IKF A;  3NPF A;  1BKB A;  2RQR A;  4F14 A;  4ANJ A;  1QKX A;  5HY6 A;  4XAX B;  2LQW A;  5D6W A;  2DTH A;  2IG0 A;  4DBQ A;  1VQP T;  4BUG A;  3JCM c;  4C92 F;  1ZA1 B;  1N8R R;  4F7U B;  2EYY A;  2QQR A;  3RER A;  1RL2 A;  1PHT A;  3L2R A;  2PU9 B;  2DFU A;  4RCB A;  2E1H A;  2XDD A;  4FW1 A;  1WQ7 A;  1X6O A;  4BAC A;  1LNX A;  3CC7 T;  2E4H A;  2CZ1 B;  2LX9 A;  3SWN C;  4MMK A;  2DYI A;  2J06 A;  5GAO m;  4HT8 A;  4XTX A;  3OS0 A;  4EDU A;  2B86 A;  2XHC A;  3R6N A;  1Q7Y U;  3ZBD A;  4DEX A;  2ZPG B;  1KC8 R;  2YLB A;  3LGF A;  1EZZ B;  3CCS A;  1YWO A;  4F7U E;  3EHR A;  2MPX C;  2MK5 A;  5GMK h;  3G4S T;  3CCU T;  1B34 B;  4M75 F;  1K4U S;  3GNG A;  1X69 A;  1VQ5 A;  4HKE A;  1WFW A;  2RI5 A;  4HT9 A;  3DKM A;  1VQ8 Q;  2LMJ A;  3A8M B;  4OF1 A;  1KHC A;  1K73 C;  2WSC E;  5EC7 A;  4PJJ A;  5LJ3 e;  3BFM A;  1LOJ A;  3JCM e;  1M5Q 1;  2EQJ A;  3RMQ A;  3I55 T;  5FLX E;  5CCA A;  5CAI A;  1M90 R;  2CUB A;  1VYT A;  2R57 A;  2W0Z A;  3TSZ A;  2RA2 A;  4BI8 B;  1VQ7 T;  2XKO C;  1M2V B;  3RKW A;  3GF5 A;  2X9H A;  1WJR A;  2ZPI B;  4M75 B;  4XTY A;  5KYN A;  1QLY A;  2M9U A;  1AZG B;  1MND A;  2GGR A;  2FEI A;  3VUZ A;  4E7I A;  1WGS A;  1QVG P;  3VKI A;  4XQ3 A;  1ABQ A;  4LDW A;  3CCR T;  3NFC A;  3F70 A;  3QO3 A;  3JAM E;  4NOY A;  3VU3 C;  3CPW S;  4ME7 A;  3CCQ Q;  3CCV Q;  3CCM A;  4PKC C;  1M1K U;  1PRM C;  3G6E T;  2QK0 A;  1XNI A;  2R58 A;  1G83 A;  3M53 A;  1WX6 A;  1VIF A;  2DJZ A;  2KI7 A;  1Q81 R;  4LUD A;  4RTV A;  4NL3 A;  1VQ9 T;  4GLM A;  2Y4X A;  2FYK A;  1KQ1 A;  3OS2 A;  1QCF A;  3FRN A;  2MWP A;  1QVF S;  4NS5 A;  3MP8 A;  4M75 E;  2O9V A;  1Q86 U;  2I2L A;  2X35 A;  4C8Q G;  2M16 A;  1WQW A;  5KE2 A;  4DBF A;  5GAO q;  3NTH A;  3JB9 D;  3FDR A;  2K3Y A;  3MJX A;  1LPL A;  2KDS A;  3G7Z A;  4XU1 A;  5GJW B;  2EIF A;  1S72 Q;  3MPU B;  3SDZ A;  1M9S A;  1PSF A;  1HD3 A;  1VQ4 A;  1Q82 C;  1D3B A;  2F5T X;  1OU8 A;  2HNI A;  1VQK T;  1PSE A;  5GMK i;  1GCQ A;  1Z9Q A;  1M1F A;  1WIE A;  3OYJ A;  1SG5 A;  3OBY A;  1Z9Z A;  3V8L A;  3L2Q A;  1QMC A;  2DET A;  4OGE A;  4XU0 A;  2D9T A;  2KT1 A;  1UJ0 A;  2DXB A;  5DM7 R;  3I56 Q;  2RNA A;  2EJF A;  2LDM A;  5GMK e;  1WXT A;  4B6M A;  2QEX T;  3KBG A;  1MNE A;  3QSU A;  4OMO A;  1W2B A;  3HKS A;  4Y92 A;  4BE0 A;  2YRC A;  4FIB A;  1TS9 A;  4BE2 A;  4RTW A;  3VV0 A;  1E6H A;  2QXF A;  3CCJ T;  4JPB W;  1TU0 B;  3V7R A;  2VB6 A;  2IVW A;  4V2S A;  3E1S A;  2L3Q A;  2E3H A;  1X6G A;  2BKD N;  1UGQ B;  2JZ2 A;  4FW2 A;  3CXC P;  5M9O A;  2LJ1 A;  1FMV A;  2V8J A;  2YHT A;  3QKJ A;  5GJV B;  1LCK A;  1YJ9 A;  2F69 A;  4FYW B;  4EMK B;  3A5Z B;  4KRT A;  1GCQ C;  4M78 F;  3O8V A;  2LZ6 B;  2KXD A;  1JJ2 P;  1FMW A;  4PJO D;  3I5R A;  3M4G A;  1NLP C;  3QBY A;  5DLO A;  1I4K 1;  3L2W A;  1NG2 A;  2E64 A;  2DL8 A;  1M3B A;  2DIL A;  1NE8 A;  1H8K A;  3TVT A;  2KK4 A;  1ZBJ A;  1K9M C;  3CMA A;  3HTR A;  1UEB A;  1UFF A;  5GAM g;  2DO3 A;  4QVD A;  2CYZ B;  1G5V A;  1S1N A;  3EGD B;  2DTI A;  3CCS Q;  1D0X A;  4DEY A;  2JMC A;  1JXO A;  4C8Q F;  3T9N A;  5KCO A;  1FYN A;  3DLM A;  1VQ5 Q;  4A54 A;  3REA B;  1KK7 A;  4JJC A;  4M78 B;  4Z89 A;  4ZTJ A;  1E7O A;  4II1 A;  1U1T A;  2RHY A;  3H41 A;  3M0P A;  2DAQ A;  2KE9 A;  4EPC A;  2J7I A;  1D1B A;  2A37 A;  2FPD A;  5KYU A;  5FRM A;  1NZ9 A;  1ZLM A;  2MOX A;  2K5L A;  2VXE A;  2EKO A;  4C5H A;  1D1C A;  2E70 A;  1QVP A;  1WLP B;  2ENM A;  3AHU A;  4A4F A;  1QWF A;  1V29 B;  4MZT A;  2HZY A;  1UTI A;  1YJN T;  1M3A A;  4C8Q B;  4M78 E;  2R5A A;  2VGM A;  4PJO A;  3TU4 K;  3EFO B;  2KT8 A;  3EHQ A;  2CZ7 B;  3VS7 A;  4M7A F;  2P4T A;  1MMG A;  1RAI B;  1WI7 A;  3PVQ A;  2RHZ A;  1IXD A;  4JLI A;  4MDW A;  1X01 A;  3BY7 A;  1R77 A;  3CC4 T;  3CCM Q;  2CZ6 B;  2K79 A;  5CKH A;  1YJW A;  5HK3 A;  2DBM A;  4J6Y A;  2P84 A;  2G3R A;  3HP9 A;  1WDX A;  3SFM A;  2EVR A;  4C8Q E;  3OW2 S;  5LJ5 g;  5CR2 A;  4F16 A;  1OZ2 A;  2LT4 A;  1WNL A;  1GBR A;  2EGA A;  2ZCF B;  3GP8 A;  2X51 A;  1RLP C;  2DIQ A;  2K5I A;  2KRO A;  4N0A A;  4E2F B;  3EH1 A;  3CCL A;  4M7A B;  4BB7 A;  1KQS P;  2A36 A;  1FXX A;  5GAN g;  4HCC A;  4PJO C;  1VQ4 Q;  4LD6 A;  3CQT A;  2EW3 A;  4KH0 B;  1IRE B;  2DMO A;  4OVA A;  2RHU A;  5GAO p;  2R5M A;  4EMH A;  1Q7Y R;  2OTL A;  1B07 A;  3LLR A;  2KYB A;  1ZSZ C;  4J6W A;  3PTA A;  1X27 A;  3OMC A;  4ZGE B;  1F1B B;  1C1A A;  4LUE A;  4DA4 A;  4M7A E;  5GAN h;  1K8A C;  3J81 E;  5FRN A;  2D1X A;  3I9Q A;  4J7I A;  4ZN3 A;  2RJE A;  2OX7 A;  3MKD A;  4IUR A;  1NYG A;  4Z8A A;  3EG9 B;  3ZEH A;  4ZN1 A;  5IHK A;  2DTO A;  1N9R A;  3HL8 A;  4JDS A;  3BDU A;  2XDB A;  1TUC A;  3OS1 A;  1QVG A;  2M1H A;  1JU5 C;  4XTV A;  4M7D F;  3E19 A;  3TRE A;  2DIG A;  2E65 A;  2VAS A;  2YUN A;  2XDP A;  1YIJ T;  1VIE A;  3M55 A;  1PKS A;  4WCI A;  2DYB A;  3CBO A;  1VQO A;  4TVR A;  2GCX A;  1TG0 A;  2QA4 A;  2P0P A;  4M75 D;  1UGP B;  2QEX A;  2D6F A;  2VKN A;  3L2Z A;  1YJ9 Q;  2VC8 A;  1SF9 A;  4DOW A;  1NPP A;  1VQM A;  5GMK l;  4FT2 A;  4GLK A;  3QWX X;  3PVL A;  4X1V A;  1V1C A;  2A08 A;  2DD4 A;  3M9Q A;  2DE0 X;  2XMF A;  2O2O A;  1NPR A;  4J9D A;  1Y71 A;  3LWH A;  3OYH A;  2RI3 A;  4OB0 B;  4RTT A;  1KSW A;  1YNZ A;  3UA6 A;  2BE9 B;  4M7D B;  2JM9 A;  1PG5 B;  2KVQ G;  1M1K R;  1WHK A;  3CMA Q;  2L3R A;  2ZAE A;  4FSS A;  1CKB A;  3JCM g;  4E7J A;  1MV3 A;  2EYX A;  5L8R E;  1HJD A;  3PIO A;  1QCN A;  2XU8 A;  2YT6 A; 
#chains in the Genus database with same CATH homology
 2YUQ A;  4ESR A;  1AWW A;  2GQI A;  3NHN A;  1EFN A;  2LMJ A;  4CC2 A;  2ECZ A;  2KGT A;  1HSQ A;  1E6G A;  2HDA A;  5EC7 A;  4K11 A;  2QDL A;  2JS2 A;  2EGE A;  1Y0M A;  4EIK A;  1A0N B;  1K76 A;  1PKT A;  2G6F X;  1SSH A;  2I0N A;  2AKK A;  2ROL A;  2BZX A;  2V1Q A;  2LNH B;  2DL7 A;  2DLP A;  3VS4 A;  2CUB A;  2RMO A;  4D8D A;  1VYT A;  2W0Z A;  3TSZ A;  2K6D A;  3UF4 A;  2HCK A;  3H0I A;  1PWT A;  2L2P A;  2MIO A;  1N5Z A;  2FG0 A;  4JJD A;  1X2Q A;  1UJY A;  3C0C A;  2LJ3 A;  5ECA A;  1QLY A;  4OMP A;  1AZG B;  2CT4 A;  1SRM A;  2GGR A;  2FEI A;  1OV3 A;  2FPF A;  2DL3 A;  2FRY A;  1BU1 A;  1W1F A;  1ABQ A;  3O5Z A;  4OMQ A;  3KFV A;  2KR3 A;  2JW4 A;  1PRM C;  2EQI A;  1AD5 A;  1H92 A;  1G83 A;  1WX6 A;  1G2B A;  1YN8 A;  4J9C A;  4LUD A;  1SPK A;  2GNC A;  3M0U A;  4RTV A;  4AFQ C;  4GLM A;  1QCF A;  1GFC A;  1AWO A;  1WA7 A;  1OOT A;  1MUZ A;  1SRL A;  1ZSG A;  2O9V A;  2FO0 A;  3REB B;  4JJB A;  4RTZ A;  4HCK A;  3TSW A;  2PZ1 A;  1B3Q A;  2KNB B;  1X2K A;  4ORZ A;  1AOJ A;  5GJW B;  2VWF A;  4QT7 A;  2EBP A;  1QWE A;  1HD3 A;  1VYU A;  1JXM A;  4OML A;  3VS1 A;  2OI3 A;  1AWX A;  1U06 A;  4J9G A;  1GCQ A;  1Z9Q A;  4IIM A;  1WIE A;  1BB9 A;  2YDL A;  1Z9Z A;  2P4R A;  2OJ2 A;  4LE9 A;  1W70 A;  2KXC A;  2FRW A;  2KT1 A;  1NYF A;  1K9A A;  3SEM A;  1UJ0 A;  2GBQ A;  2RNA A;  2LP5 A;  1K0S A;  2AZV A;  1AVZ C;  1UHC A;  2A28 A;  1WXT A;  1QKW A;  2DA9 A;  2LJ0 A;  1PNJ A;  4R0K A;  3NMZ C;  2PTK A;  5IXF A;  2KRN A;  1M8M A;  1J3T A;  1YWP A;  2X3X D;  4OMO A;  2O88 A;  1JQQ A;  3NGP A;  1I07 A;  4Y92 A;  1IO6 A;  1CKA A;  1WFW A;  4RTW A;  1E6H A;  4AG2 C;  2M0Y A;  2F2V A;  4Z88 A;  2ED1 A;  4JPB W;  1UDL A;  2LX7 A;  3A98 A;  4OMM A;  2BZ8 A;  4HVU A;  2L3Q A;  2KRM A;  4AFU C;  1X6B A;  5I22 A;  1X6G A;  1JO8 A;  3VS0 A;  2C0O A;  1NLO C;  1BK2 A;  2LJ1 A;  3EG3 A;  5GJV B;  1LCK A;  1KIK A;  5FWB A;  2IIM A;  4KRT A;  1GCQ C;  4HVV A;  2LZ6 B;  2KXD A;  1WXB A;  2LQN A;  1UGV A;  3LH5 A;  1CSK A;  3I5R A;  1NLP C;  4J9F A;  3QWY A;  1UUE A;  3VRY A;  2EKH A;  2OAW A;  4LN2 A;  5IH2 A;  2CSQ A;  1NG2 A;  3SHW A;  2SEM A;  2AZS A;  2O9S A;  1T0H A;  1M3B A;  2DL8 A;  5HCK A;  3VRZ A;  2L3S A;  2DIL A;  5IXB A;  1MV0 B;  1H8K A;  3TVT A;  1ZBJ A;  2RQU A;  1GRI A;  2C0I A;  2HEQ A;  2EGC A;  3M0T A;  1UFF A;  2AKL A;  2W10 A;  2YUP A;  3VS3 A;  4RTU A;  5I11 A;  2K2M A;  2DBK A;  1S1N A;  1VYV A;  2CT3 A;  4ZNX A;  2HBW A;  2KEA A;  4DEY A;  2JMC A;  1JXO A;  3VS2 A;  2K7A A;  1FYN A;  2H8H A;  2D8J A;  1RUW A;  1T3L A;  2K3B A;  2JT4 A;  1AEY A;  3REA B;  1X43 A;  4JJC A;  2EYW A;  1KFZ A;  2DL4 A;  4Z89 A;  2JM8 A;  1E7O A;  3VS6 A;  3EG0 A;  1M27 C;  2E5K A;  2NUZ A;  1UEC A;  3H41 A;  3M0R A;  3M0P A;  2V1R A;  2KE9 A;  2ABL A;  2J7I A;  2A37 A;  2FPD A;  4JZ3 A;  1ZLM A;  1YCS B;  2MOX A;  2LCS A;  4J9E A;  1OPK A;  1WLP B;  2ENM A;  1OEB A;  1QWF A;  1UE9 A;  1K0X A;  2L0A A;  2KBT A;  4J9I A;  2GTO A;  3FJ5 A;  1UTI A;  2JXB A;  2KYM A;  4HXJ A;  1M3A A;  3H0F A;  2X3W D;  4LNP A;  1UG1 A;  4A63 B;  1Y57 A;  2KT8 A;  3EHQ A;  1VA7 A;  1U3O A;  4JZ4 A;  2HSP A;  3VS7 A;  2D8H A;  1WI7 A;  2K9G A;  2PNI A;  3PVQ A;  1RI9 A;  2ROT A;  5IHI A;  3ULR B;  2ED0 A;  3I35 A;  2J05 A;  2JMA A;  2ESW A;  2EYZ A;  3JV3 A;  2J6F A;  2YSQ A;  2K79 A;  1BBZ A;  1ABO A;  2JTE A;  1NEB A;  2DBM A;  1WDX A;  1SHF A;  1JEG A;  1GL5 A;  4RUG A;  2DRM A;  2EVR A;  4CC4 B;  1XOV A;  5FWC A;  4F16 A;  2SRC A;  3PE0 A;  1ZUK A;  2J6O A;  1GBR A;  2M51 A;  2EGA A;  1GFD A;  4AFZ C;  1GBQ A;  2DM1 A;  2RF0 A;  1M3C A;  1RLP C;  4HVW A;  2KRO A;  2CRE A;  4CC7 A;  2F2W A;  2RPN A;  1FMK A;  1OPL A;  2A36 A;  4D8K A;  3UA7 A;  2DL5 A;  3UAT A;  1PRL C;  1KJW A;  3CQT A;  2NWM A;  3M0Q A;  3M0S A;  2EW3 A;  3EG1 A;  3U23 A;  4CC3 A;  2DMO A;  2F2X A;  1UHF A;  3I5S A;  5L23 A;  1AWJ A;  2VVK A;  1B07 A;  1ARK A;  4E6R A;  1RLQ C;  2KYB A;  1X27 A;  1ZUU A;  4RTX A;  1NEG A;  1TUD A;  2EPD A;  3GBQ A;  3IQL A;  2KRS A;  4RTY A;  4LUE A;  1K1Z A;  4F17 A;  4OMN A;  4AFS C;  3VS5 A;  3ZL7 C;  2DRK A;  1WYX A;  2D1X A;  3I9Q A;  1SEM A;  1NYG A;  1NM7 A;  4Z8A A;  2DF6 A;  2O31 A;  5IHN A;  2BTT A;  5IHK A;  1U5S A;  5FW9 A;  2DVJ A;  2CSI A;  2RQW A;  4IIO A;  1AZE A;  4AG1 C;  1T3S A;  1TUC A;  2YUO A;  3EGU A;  3NPF A;  1JU5 C;  2RQR A;  3EG2 A;  2GTJ A;  4F14 A;  1GCP A;  1QKX A;  3THK A;  2YUN A;  2LQW A;  2D0N A;  2CUD A;  2RQT A;  2CH4 W;  1PKS A;  4WCI A;  2DYB A;  2DJQ A;  2CH4 A;  2EYY A;  4M4Z A;  1TG0 A;  1PHT A;  2JS0 A;  2VKN A;  3RNJ A;  4GBQ A;  1T0J A;  2FPE A;  3PVL A;  3QWX X;  4X1V A;  3RBB B;  1V1C A;  1I1J A;  2A08 A;  2MCN A;  2DE0 X;  1YP5 A;  2J06 A;  2O2O A;  2XMF A;  4J9D A;  4J9B A;  1M30 A;  1SHG A;  2B86 A;  2L3P A;  4RTT A;  1KSW A;  3H0H A;  2RQV A;  1YNZ A;  3R6N A;  4DEX A;  3UA6 A;  1ZUY A;  2DX1 A;  2JM9 A;  1ZX6 A;  2J6K A;  1WXU A;  1I0C A;  1YWO A;  4J9H A;  4FSS A;  1CKB A;  1MV3 A;  3EHR A;  2EYX A;  1HJD A;  2DNU A;  1H3H A;  1W6X A;  1K4U S;  2RN8 A;  2AK5 A;  2CDT A;  2C0T A;  1X69 A;  2BZY A;  2YT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...