1N9RA

Crystal structure of a heptameric ring complex of yeast smf in spacegroup p4122
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homomeric ring assemblies of eukaryotic Sm proteins have affinity for both RNA and DNA: Crystal structure of an oligomeric complex of yeast SmF
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Small nuclear ribonucleoprotein F
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n9rA00
4XQ3A 5GMKl 1X01A 3QUIA 4M75A 5GMKi 5GAMe 3JCMe 1I4K1 5LJ3g 3JCMc 3L2ZA 3V7SA 4M7DE 2DKGA 3RESA 1WQ7A 3V7CA 1HK9A 4M7AG 4C92E 4J6YA 4XU0A 4XTWA 4XTUA 4C8QA 4X9DA 4M7AC 2DJZA 4M75C 4RCCA 5CAIA 4PJOB 3BW1A 5GAOn 3JCMW 4PJOD 1LOJA 3RKYA 4M7AB 3V8KA 4EMKA 5GANf 4M7AD 1LNXA 4M7DF 4EMKC 4PJOA 1MGQA 4M75B 4M75D 2DXTA 3JCMb 1D3BB 3V7RA 4C92G 5GAN5 4M7AE 2VC8A 4F7UB 4C8QC 4M7DG 4XU3A 4RCBA 2HNIA 4J5YA 4NOYA 3JCMg 4DQ2A 5LJ3e 5GAMg 1YCYA 4J6WA 3AHUA 3HSBA 4M75G 4F7UA 5GMKe 2E1HA 3BFMA 4C8QB 5DY9A 4C8QD 4C92D 4XU1A 4C92B 5I21A 1N9RA 5LJ3j 5GAN7 5LJ5d 5GAN4 4V2SA 2DXUA 2DTHA 3HFNA 4M77G 2JN0A 4EMKB 5LJ5e 4M7AA 3PGGA 4M7AF 4M78E 2YHTA 1WQWA 4EMGA 5GAOq 3JCMJ 2EJ9A 3JCMP 4C8QG 2YLBA 4M7DC 1KQ2A 3INZA 3JCMX 4A54A 4M77D 4M77B 1U1SA 3JCMd 5GAMd 1I81A 2DZ9A 3QHSA 3SWNB 2DTIA 2E41A 4JRKA 4F7UF 2K57A 3RUXA 2FYKA 5GAOl 1M8VA 1BIAA 4PJOG 3JCMf 4M77C 5GAMf 3FIFA 4C92A 3QSUA 3JB9G 4M7DA 3RKWA 2EAYA 5GAN2 2EWNA 4XU2A 5GAN8 1JBMA 4MMKA 4F7UG 4JLIA 3RKXA 5GMKm 3JCMV 3V8LA 3JB9D 4NL3A 3JCMQ 5GANh 4X9CA 3GIBA 1KQ1A 4M77A 2FB7A 3VU3C 5GANe 5GAOm 3JCMh 4C8QF 5GAMh 3M4GA 4QVCA 3EFSA 4HT8A 2DEQA 1B34B 2DZCA 2E65A 4M78C 3BY7A 1I8FA 2EJGA 4M77F 4M78D 4M78B 3QO3A 4HA8A 1D3BA 3FB9A 2QTXA 4XTVA 2E64A 3RERA 4HT9A 1B34A 2RB6A 4M75F 4PNOA 5LJ5h 4M78F 3HFOA 4C8QE 3EFRA 5GAN3 5LJ3h 1Y96B 4PJOC 1WNLA 5GANg 4M78G 5GMKh 4C92F 4MMLA 1N9SA 2Y90A 4F7UE 2CGHA 3BDUA 5GAMj 4JUVA 4WF2A 4A53A 4M75E 4QVDA 3V8JA 1M5Q1 2DTOA 2VXFA 1TH7A 4C92C 5GMKj 3L1AA 3JB9H 4N0AA 2EJFA 1I5LA 4OP0A 3JB9I 4JRIA 3JB9J 2DVEA 5LJ3f 4PJOE 5LJ5j 1LJOA 3FJPA 1H641 3SWNC 1HXDA 1WPYA 5GAOp 1Y96A 3SB2A 5LJ3d 1U1TA 3RIRA 2I2LA 2RM4A 2ZGWA 4J6XA 4NL2A 4EMHA 5LJ5f 5GAOr 4M7DD 4M7DB 4XTYA 1BIBA 3JB9F 4Y91A 1JRIA 4N0AC 5GANd 4XTXA 5GAN6 2E10A 4PJOF 4M78A 2RA2A 4M77E 2YLCA 3SWNA 5LJ5g 2VXEA 4XTZA 5GANj 2RD1A
chains in the Genus database with same CATH superfamily
4FSXA 2MOXA 2RNAA 3JCMe 4J9FA 4QT7A 2X4YA 2B8AA 1SPKA 2R58A 4RTUA 2EGCA 2G6FX 1O9SA 1SEMA 4PJOD 4IURA 2L5QA 1TU0B 1P92A 1VYVA 4F17A 2IIMA 4C8QC 4L59A 4BE0A 3HP9A 2HNIA 5J39A 1SKUB 4JPBW 1YCYA 1WZOA 3FDRA 1PNJA 2DM1A 2WSFE 4PKCC 3CC2T 3H8ZA 3RMSA 3J80E 3CCVA 4M7DC 4E7JA 3PE0A 3DLMA 1TUGB 3DKMA 1OU9A 2RQRA 2D6FA 3PIPA 1M8VA 1Q86U 2IPOB 2KE9A 5HY6A 2BKDN 2EWNA 5GAN8 3CCLT 3M55A 4D8KA 5L23A 1K8AC 2KGTA 1YIJA 3VS5A 5D6YA 2OTJA 3TQ7P 2EQKA 1OV3A 1IGQA 1I5OB 2PU9B 2COZA 4JZ3A 4M78C 2NUTB 2KYBA 3QO3A 4HA8A 1VQ7Q 1UDLA 2KI7A 2V1QA 1YNZA 3KUFA 3DLLA 2EYWA 2VWFA 1NE8A 3N5BB 1QVFP 1M1FA 2CT4A 2MWOA 3L2VA 1IHVA 3VV0A 1PCXA 4J9DA 5IXBA 4UC4A 3JB9I 3CC2Q 1UEBA 1LJOA 1W2BA 3BDLA 2AIRB 4OMQA 2ZGWA 3OYFA 1CSKA 3CCET 4PLIA 4Y91A 2V8IA 4M78A 5FU7C 2CP2A 5FWBA 5KH6A 2EQIA 2FPEA 3GBQA 1VQNQ 4JLGA 3L2ZA 1K8AR 1VQPQ 3VYHB 1AOJA 4XTWA 3QJ6A 3NHNA 4BB7A 1AD5A 5CKDA 1UTIA 2XHCA 2HMAA 3I56T 2A28A 2KRMA 1IO6A 1VQLA 1OX8A 2CZ0B 4EMGA 5KYUA 3M0UA 2JTEA 4P5NA 4Y28E 3OYIA 1Y57A 3TREA 4C0DC 1IXDA 2RHIA 1UG1A 4MZPA 4C5HA 2QGFB 2XMFA 1H8KA 3JCMd 1Q82R 2DIQA 3QDRB 3CQTA 2R5AA 3FIFA 3QSUA 2C0OA 3JB9G 2O2OA 1IGUA 2CDTA 3CBOA 1KQSA 2SEMA 4PFPA 4PFOA 2OI3A 1LCKA 5I2MA 2O4XA 1TG0A 4DBFA 1JJ2S 3EHQA 4PJNA 5A0LA 4HT8A 4RTTA 3QKJA 1S72A 5KCOA 1X6GA 1B34B 1GCPA 3UDCA 5KYYA 1VYUA 2HQXA 3HTRA 5FRNA 3URGA 5LJ5h 2XDDA 3E9GA 3EFRA 2GFUA 2DFUA 2O88A 4C0ZA 1GCQC 4D8DA 3PIOA 2KBTA 4N0AA 3CMAT 2DL4A 5FRMA 4L6V5 1M2VA 3HPWA 2YRVA 3S3MA 4E6RA 3OS2A 4M7DD 2XKOC 2KQWA 3CCQA 3SWNA 4AG1C 1EZZB 4HCZA 2ZPGB 2DERA 1M90R 1D1BA 1HK9A 2QA4A 1U5SA 2DL8A 1PG5B 1U3OA 3FLGA 3JCMW 3TU4K 4EMKA 1MV3A 1FMWA 2CS7A 2DILA 2H3JA 2KDSA 4M7DF 1RLPC 2BE7D 4F7UB 3L2WA 2DRKA 2V26A 4OB0B 5GMKe 4ORZA 1ZBJA 1S1NA 4JJNK 4M7AA 4M7AF 3PGGA 1C6VX 2D9TA 4M78E 1OULA 2KVQG 3OW2P 3THKA 1YJWT 3JCMX 2XG8D 1M3BA 2DD5A 2DZ9A 4NS5A 4AFZC 3QXEB 4BE2A 3SHWA 2HSPA 4HCBA 1YI2A 4QQGA 1Q81C 4M7DA 4E7IA 1M1KU 2ROTA 3J7AF 4ME7A 2LQWA 4F7UG 3LH0A 2O9VA 2JTFA 3OYMA 2XDPA 4LDYA 2QK0A 2KK4A 2DJQA 1Q95G 2JM8A 4M78B 2YT6A 4LXCA 2LRQA 1QVGS 2QTXA 2KR3A 3VYGA 5FROA 2COYA 3EH1A 1VQOQ 3HFOA 2DK3A 3S6WA 1ABOA 2I0NA 1VQ8T 2ZPEB 4X34A 4F7UE 3QWYA 2KY9A 2MIOA 3PFSA 4JUVA 4WF2A 4A53A 3A8HB 1VQOA 1VQ9T 4LNPA 2YUNA 2NUZA 5GJVB 2D0NA 3G4SQ 1TUDA 2LNVA 3RIRA 3JSCA 5KYXB 1YHQT 5FW9A 3CMEA 1E7OA 2GQIA 1NM7A 3VS0A 2NUTA 2E3HA 2L2PA 1YITA 4R0KA 3VUBA 4CRIA 1AZGB 2X4WA 4IUUA 2ZPFB 2LQ8A 4J9CA 3CPWP 1F1BB 1ZSGA 2ROLA 3V7SA 2DKGA 3CCLA 2JXBA 2Y4XA 2FZGB 5KCHA 4AFSC 1Z9ZA 3CMET 1UGVA 2OTJT 2CP7A 2LTOA 1PD0A 2DLPA 2KT1A 4ZGDB 5GAOn 4E7KA 5CVIA 1SSHA 1VQOT 3OA6A 1VA7A 5I2SA 4FYXB 1Q7YR 4C8QD 1AWXA 4C5GA 4N4IA 4KGZB 1D0XA 2QXFA 3M53A 4IIMA 2FPDA 3CMAQ 2RK2A 2QQAA 5DM7R 3QHSA 1K8AU 3MP1A 1PSEA 4KRTA 2HKQB 4Y92A 2K7AA 4KH0B 5HKCA 4TVRA 1K9MC 3T9NA 5FU7B 1M90C 1YI2T 3JB9D 5J26A 1I0CA 2QAZA 3EAEA 2AZSA 3A8OB 2NWMA 5HK0A 2DAQA 2QEXQ 4M78D 2A08A 2AT1B 4M78F 1K0XA 4R56A 1QVGA 1X2QA 1M8MA 2CGHA 1GFCA 2EYZA 2JW4A 4QQDA 2L3PA 2D8HA 1JU5C 3A1PA 2HKNA 3OW2A 1UFFA 1WPYA 2RI2A 1BU1A 2CZ1B 5D7UA 3G71A 2JUFA 4J9EA 4HVVA 3GPLA 2DIGA 1KK7A 1RLQC 1GBQA 3OBYA 2RA2A 1KHIA 2MK5A 4OB3B 3EG9B 2ECZA 2OTLT 1MNDA 1UGPB 2FHDA 3D7SB 1OZ2A 5GMKi 1N8RR 1AZEA 1KD1C 3RESA 3GP8A 3E19A 4XTUA 5IN1A 1KC8U 1VQNT 1BCOA 1G3WA 1D1CA 3NTHA 5I22A 2GNCA 3QYHB 1QLYA 3HSBA 1VQ6T 3LH5A 3O8VA 1WJSA 2E1HA 5DY9A 2F2WA 5GAN7 3UA6A 2D1XA 3WVEB 4YTLA 2RF0A 2KSSA 2JN0A 1ACMB 1OI1A 1YJNQ 1Z9QA 2F1LA 2P84A 2EYXA 2RJCA 4OMLA 3RERA 3ER0A 2CP6A 1NYFA 4KBMB 2YUQA 2BZYA 1YWPA 4AMCA 3CCRT 2K3XA 2HQHA 2L3RA 3HRSA 1KFZA 2YUPA 1YJ9Q 5GANh 3VU3C 2EYQA 5D6WA 1K4US 1G3YA 2F2XA 2EJGA 3EFOB 3PVQA 3O5ZA 4GLKA 3CCUT 4DOWA 3RBBB 1JO8A 1YBYA 5KE3A 5C0MA 1WHMA 2RH2A 1Q81U 3VJPA 3CC7Q 5FU6B 3FJPA 5GAOp 2YUOA 4RKUE 5HK3A 1CKBA 2RM4A 4J6XA 1DJ7B 2P0QA 3OW2S 4XTXA 1I07A 1BBZA 4JS4A 1YHQA 1NYGA 1RUWA 1QCFA 1D0YA 4QVCA 1Y71A 3QIIA 2COWA 5GANj 4PJJA 1WXUA 2KRNA 3V7CA 4BUGA 2CH4W 3ZBDA 4F04B 5KYNA 4M7AC 1UGQB 3BW1A 2E5QA 3OSVA 4PK4A 3JCMb 1YHQQ 3V7RA 4BI4A 4C92G 2LCCA 2K5IA 2JS0A 4D6WA 1MNEA 4DQ2A 2K9GA 3AHUA 1UJ0A 3CCSA 4JJCA 1RAEB 4M77G 1B3QA 5LJ5e 2RJFA 1ZUYA 2DL5A 4LD6A 4C8QG 3I55Q 3OYEA 1D0ZA 2E41A 4JRKA 2EIFA 3HHTB 4CC7A 1YJ9A 4M77C 3HRTA 3OQ5A 2EAYA 4OGEA 1JBMA 3OYAA 2JMCA 4ZN1A 4EPCA 3RKXA 1WDXA 2ED1A 4BDZA 3JCMV 4RG2A 3GIBA 1PC0A 1N8RC 1QCNA 3EGXA 5IAYA 4C8QF 2FPFA 1YJNA 2J05A 5EG2A 4M77F 3H0IA 1VYTA 3MO8A 4LD9K 1OPKA 3BE3A 5CQYA 4C92F 1K9AA 1RAGB 4AG2C 1RACB 3KBGA 4IUQA 2QTVA 3OYBA 4QVDA 3EH2A 2SRCA 4WTOB 2EKOA 4J9GA 2CREA 1M9SA 1VQ4Q 1UUEA 1M3AA 1V29B 2DA9A 3R6NA 4BDYA 3I55A 5LJ5f 2RJEA 4XTYA 3EG1A 4LUDA 1G3TA 1RI9A 4XTZA 2KRSA 1V76A 2FRWA 2DL7A 2XU8A 4KT0E 2MWPA 3RMQA 2FL7A 3J81E 4B9XA 2VVKA 4GLMA 2P0PA 1VQ7A 3M0TA 2V8KA 1OX9A 1U06A 1X43A 4M7AB 5GANf 1N27A 2JMAA 5J3BA 1IRXA 2LQNA 2K5FA 2VC8A 3PTAA 4E47A 2QDLA 1OU8A 3E2UA 1H3HA 2X3WD 1SHFA 1W2BP 2OAUA 2LZ6B 4DBRA 1WIEA 3C12A 2X3XD 1FX7A 4OB2B 3EFOA 4EMKB 2DEUA 1KQ2A 2M0YA 3QJYA 4DA4A 1QWFA 3LX7A 3A5ZB 4HVUA 1NJIC 2MAMA 4OMOA 4MZMA 4FYWB 3VS1A 2KNBB 4FYYB 1QVGP 1GFDA 3OSSC 2DRMA 1ABQA 1Q86R 1N6AA 2AHJB 5GMKm 3PT9A 3EG0A 1W6XA 1KQ1A 2X51A 2QGGA 3LGLA 4PJLA 3ZEHA 1BK2A 4EDUA 2EYYA 1T3LA 2DEQA 2E65A 4RG8A 3CMAA 7AT1B 1RAIB 1B34A 2RB6A 4OVAA 1ZA2B 4OGCA 1SHGA 2Y90A 2DE0X 4JJDA 4RTYA 1VQ7T 1QWEA 2E3IA 2LMJA 1VQMQ 3QZ9B 1BI3A 2GTJA 4FCYA 1YCSB 1Y0MA 3TEEA 2YRCA 2FRYA 3X24B 1M1KR 4J9IA 1NEBA 4FT4A 2L8DA 1HYOA 1X75C 3OYCA 2VXEA 3A8GB 1X27A 2BZ8A 4XQ3A 2DVJA 3NTKA 4M75A 4ANJA 3OBWA 2AZVA 3CMEQ 4A4EA 1KHCA 4J6YA 2XDBA 2QQ9A 1Q81R 1OZ3A 4PJOB 1XNIA 3LWHA 1X6BA 1MGQA 1KQSS 1VQ8Q 1WXTA 2PZ1A 5M9OA 5CK9A 3EHRA 1JJ2A 2K3YA 4C92D 4B9WA 1PRMC 2DXUA 2KEAA 2PVDB 4OMPA 2BIVA 1I1JA 3CCMA 1GRIA 3INZA 5KE2A 1J3TA 4IUVA 4M77D 3MPUB 1BI0A 1BIAA 3JCMf 1UB4A 1RAAB 3E9FA 3PVLA 4XU2A 4JRPA 2QDYB 5DLOA 4QVZA 1VQKQ 3CBPA 2EW3A 3CCVT 4N4HA 1QP2A 2LCSA 4PL6A 1AT1B 3JCMQ 4X9CA 5FLXE 2EPDA 2M0OA 3L2UA 3UF4A 3CPFA 1KJWA 1N5ZA 4FSSA 4PJMA 1AWWA 1R0CB 1FYNA 4MMLA 3F70A 1M27C 2ESWA 3E1SA 2JJ9A 2JOYA 5FWCA 3AT1B 4J9BA 1R77A 2QEXA 1PD1A 1VQLT 1BI1A 2K3BA 3SB2A 3M5AA 4J9HA 1RAHB 4NL2A 5GAOr 1N8RU 2DYIA 3P8HA 4E7HA 4BI8B 4M77E 2FVUA 2DXBA 4OMNA 2FO0A 4QQ6A 5EC7A 2BUDA 1HD3A 4AT1B 2RPNA 2RN8A 4C92E 2E6ZA 1RADB 4XU0A 4R55A 4LUEA 2HD0A 3MP8A 5CAIA 2J6OA 1KD1U 1UHFA 4ZGJB 2RQTA 4CI0C 2XIDA 1VQ5T 2OAWA 3EGDA 4ESRA 4PJOA 2CKKA 4ELYC 1WX6A 4FW1A 3CCEA 4OMFB 4J5YA 3JCMg 4J6WA 4C92B 1WHGA 5IHKA 2HCKA 1M30A 3HFNA 3OYGA 1G5VA 3CCEQ 4A4GA 2FEIA 5IH2A 5D6XA 1VQLQ 4A54A 4M77B 2O31A 4F7UF 5GAOl 2NUPA 2CSIA 4QW2A 5IHIA 5IXFA 5AYFA 4Q5WA 1WHHA 4ATOA 1W1FA 5GANe 3REBB 3C94A 5CO7A 2CH4A 4ZGEB 4A63B 2LX9A 4ZTFA 1YJ9T 2RHUA 3M0RA 4Z02A 3G6EQ 4KGVB 4PNOA 1MHNA 1SSFA 2K79A 1YITQ 4ZN3A 1QW1A 1H3ZA 3EG2A 1VQ4A 1EX4A 2QI2A 1BKBA 2VB6A 3RNJA 1G8XA 3OYHA 5CQXA 4A4HA 2VYTA 4MDXA 3KFVA 2VGNA 1ZHIA 1HXDA 5LJ3d 2BZXA 5ECAA 1VQ8A 2O9SA 4EMHA 3VS4A 3OB9A 5A2QE 3JB9F 2KXDA 1JRIA 4N0AC 2CP0A 2PUOB 2YLCA 1IZ6A 1V1CA 2DX1A 2RO0A 1T0HA 1FMVA 3OS1A 1BI2A 4O6JA 3ZFJA 1VQKA 2DBKA 4RTVA 2LT4A 1WQ7A 2ZPIB 1WLPB 1YWOA 3CC4A 3OYDA 4X9DA 2DJZA 4M75C 1YFNA 3CCMT 2QA4Q 2PVGB 2E12A 1D09B 2L89A 1C0MA 2MYSA 2MCNA 4CC2A 1PRLC 4V2SA 4LN2A 2LC4A 2MMPA 1UHCA 2CP3A 3CC7T 2FZKB 1HJDA 4A4KA 2X4XA 3OMCA 5GAOq 1VQPT 2WSCE 3VUZA 3M58A 3PMIA 2DMOA 1S72T 1YN8A 1NZ9A 1K0SA 1VQ9Q 2E6NA 1ZBXA 4BY6B 3I9QA 2LCLA 1BB9A 1RI0A 1ZX6A 3GNFB 5CR2A 3G6ET 3CCJA 2FZCB 2M1HA 1GXIE 3C4SA 2CT3A 2C0IA 3L2QA 4E2FB 3CCRA 2FB7A 1WFWA 1X6OA 5GAMh 1M1GA 2LDMA 1AVZC 1OPLA 4KULA 3UATA 2RI3A 2RK1A 5GAN3 1K73U 2X9HA 5CKBA 4PJOC 4M78G 4N4GA 2LJ0A 3QG1A 4DEYA 1X69A 2K2VA 4M75E 4X1VA 1KSWA 3X28B 4E7SA 3L1AA 3L42A 4FU6A 9ATCB 1EIFA 3GOXA 2W10A 2AK5A 2MI6A 1H92A 2OTLQ 2DNUA 2RHZA 4HKEA 2LJ3A 5GANd 4K11A 1UGRB 1PKTA 1AWJA 3C95A 3JAME 1U8RA 3CCMQ 3M0PA 5LJ3g 2E70A 3OS0A 2OTLA 3LLRA 4M7DE 3FRNA 1VUBA 3C0CA 2CZ7B 1NJIR 2XD0A 5AT1B 2MPXC 2R57A 2F5KA 1VQ6Q 2QYZA 2D0QB 4M7AE 1ZSZA 1VIEA 1ZQ1A 4XU3A 2ABLA 2LQKA 5LJ3e 2GBQA 1AHJB 4FYVB 4C8QB 4XU1A 1VQPA 3MP6A 1M2VB 1JJ2P 3OYYA 3I35A 2EJ9A 2JVVA 3A8MB 4IUTA 2GF7A 2L0AA 1IREB 4MDWA 3CCRQ 1TTHB 4KUIA 2FYKA 1TS9A 3CC4T 2FG0A 2P4RA 2B86A 2HL5C 2MF2A 3TCJA 1VQKT 3QPHA 3OYNA 2V1RA 2XK0A 2QEXT 3MHXA 2DO3A 3V8LA 3H41A 1FWZA 2KXCA 3M56A 4HVWA 3CC4Q 1UE9A 3P8BB 2JTMA 3CBMA 4C5IA 2YRDA 1LPLA 2A37A 2CZ6B 1UECA 1A0NB 3G71Q 4C8QE 1NLPC 1WNLA 2RQWA 1OYXA 3EGUA 3H9NA 1SG5A 1ARKA 4RUGA 2GQVA 2QASA 1YJWQ 5IT9E 1M5Q1 2VXFA 3CCQQ 4LDUA 2WSEE 2EJFA 2IVWA 4M4ZA 1YIJQ 1OQKA 1WGSA 4BI3A 5LJ3f 3VRYA 4M7DB 1TSFA 4MZTA 3EG3A 3NMZC 2E10A 4PJOF 4KUDK 5CIUA 5LJ5g 2A7YA 2PQWA 4DBQA 3I56Q 1QP3A 2PNIA 1K73C 3LW5E 4M7AG 3UPUA 1IHWA 1VQ6A 1KG1A 1NBEB 4KGXB 4RCCA 2PUKB 3V8KA 3META 4CC3A 3A98A 1B7TA 2F5TX 1W2BS 4M75B 1JB0E 2RI5A 1D3BB 5GAN5 3M0SA 4M7DG 4NOYA 5LL6S 1VQ5Q 4F7UA 3BFMA 4J7FA 3JV3A 3LGFA 1QMCA 5LJ5d 2J6FA 3KXTA 2DTHA 3G6EA 2QQSA 2DETA 1NEGA 3M54A 1WQWA 3JCMP 3OYKA 1K1ZA 2K4YA 1OOTA 2LX7A 4DEXA 5FU6C 2BE9B 4C0FA 3S3OA 2A36A 1NLOC 1XQHA 8ATCB 1VQ5A 2EBPA 2GFAA 1G3SA 1TUCA 3RDVA 3SDZA 5A0GA 1WA7A 2J7IA 1PHTA 2OX7A 1M2OA 4IUPA 6AT1B 1D1AA 1MUZA 2F69A 3P8DA 2E64A 1YITT 2RQVA 4O5VA 2ATCB 4ELZC 1Y96B 1LVKA 1XOVA 1ZSZC 1Y7XA 1N9SA 2JZ2A 1KC8C 5DLQE 3UWNA 3FJ5A 3V8JA 2VV5A 2DTOA 5GMKj 2LT1A 4WCIA 2HAXA 2DVEA 5LJ5j 3NFCA 4JZ4A 1BIBA 2EKHA 2JNGA 1QCOA 2ZCFB 3IQLA 3CCJQ 4HCKA 3GLXA 1UGSB 2NUPB 2ZZDA 2W0ZA 4II1A 4VUBA 2YWWA 2O01E 1XTDA 1MMDA 1VQ4T 2RHYA 4JDSA 3FC3A 2ZPBB 2QQRA 2RHXA 2YDLA 3R6OA 2M9UA 5A0DA 4J83A 5HCKA 1YP5A 1WHLA 1PSFA 4M75D 3G4SA 1GL5A 4RCBA 1WHKA 5IHNA 5I21A 1N9RA 4AFQC 1SF9A 2AKKA 1Q86C 1YIJT 1TOVA 3M57A 1VIFA 2A3LA 3CCSQ 2K57A 2KT8A 2X35A 5GAMf 2Z0WA 4C92A 1O75A 3S3NA 4Z88A 4MMKA 2DF6A 1G83A 2EVRA 2IG0A 1ZSZB 1QKWA 2J06A 3H0HA 3SEMA 4M77A 3TSWA 3TSZA 5GAOm 1T3SA 3MJXA 1WYXA 3QBYA 2XICA 3FB9A 3NPFA 4M75F 5CKFA 2ED0A 1C1AA 2K5LA 4J7IA 2OJ2A 3CXCS 3CD6A 1YJNT 1Y07A 4C92C 1W4SA 3VKIA 1JEGA 3JB9J 1R0BG 4XAXB 1XJWB 4FL6A 1K76A 3TVTA 2E4HA 3CD6T 2P4TA 3NTIA 1QQJA 1H641 1G2BA 1ZLMA 3CEYA 4PLLA 4GY5A 5GAMe 1I4K1 2DBMA 3HKSA 1M3CA 3I55T 3CPWS 2GCXA 5L8RE 4DBHA 2GTOA 1VQ9A 3DB3A 4F16A 2HDAA 4M7AD 4LDWA 1LNXA 4BD3A 3M9QA 2DPPB 3MKDA 3X26B 5GAMg 2QA4T 3QYGB 3OY9A 1HSQA 2CP5A 2HBPA 3VS7A 4BE1A 1K9MR 1TXQA 1BYMA 2JM9A 2YSQA 4RTWA 3WVDB 1RABB 1T0JA 3VRZA 2YXYA 3QZ5B 3CCQT 4JRQA 1I81A 3H0FA 1Q82C 3RUXA 3QWXX 3PMTA 4F14A 5CCAA 3MCAB 3CCLQ 4JLIA 1Q82U 1WJRA 1PM3A 1WI7A 4A4FA 1VQNA 1Q7YU 4GBQA 2M02A 3M4GA 4BY6C 4RMOA 1PWTA 3I5SA 1YI2Q 3QDFA 3BY7A 1I8FA 4Z89A 4XTVA 2EGAA 2HL3A 5KYWA 2M16A 5LJ3h 2L3SA 1WXBA 2O4XB 2DXCA 1MMAA 3DB4A 3CC2A 2XI9A 1GCQA 4LDXA 2RJDA 1B07A 1M4ZA 2KROA 2LJ1A 4JRIA 1EFNA 3EGDB 4Z8AA 5C6SA 4PJOE 3CXCA 2K2MA 4PFZA 4J8OA 1U1TA 1MMGA 4IIOA 4L5GA 2QG9B 4RTXA 4B6MA 2VKNA 1VQMA 1JQQA 4IKFA 2J6KA 2A0FB 1SRLA 1RAFB 3Q1JA 3VS6A 3X25B 4QKUA 3OYLA 4OF1A 5CKEA 3VS2A 1MMNA 4FT2A 4XK8E 1FMKA 5KYYB 5KYWB 4FM4B 4C8QA 2C0TA 3G4ST 1UJYA 1LOJA 3RKYA 3CPWA 4LDVA 2HQEA 4EMKC 2HZYA 2DXTA 3FEOA 2LP5A 2V8JA 1WHJA 4FIBA 1VQMT 2C06A 1GBRA 3CCUA 4M75G 2P0KA 5LJ3j 2CUDA 2M51A 3EG9A 2DD4A 3UT1A 4C5EA 1QVPA 1QVFA 1U1SA 2JS2A 5KYUB 5GAMd 3SWNB 2DTIA 4CC4B 1MV0B 2BTTA 3M59A 3OYJA 1IB8A 4DOVA 4HCCA 3G71T 4LE9A 3CD6Q 3CCUQ 3HRUA 2KYMA 1JXMA 3MEUA 2ZPHB 3M0QA 4JS5A 4NL3A 2KAFA 3JCMh 2CYZB 3EFSA 3GNGA 2DZCA 3MEVA 1OEBA 1ZUUA 4EIKA 1NPRA 2LNHB 4HT9A 4FW2A 2HBWA 2L3QA 3I56A 1S72Q 2ZAEA 3I5RA 2D8JA 3PNWC 3A8LB 2EQJA 2NYSA 2QQBA 2EQUA 2KMTA 3BDUA 8AT1B 1VOMA 2AKLA 1KD1R 2VASA 1ZA1B 2DYBA 1AEYA 2EGEA 1W70A 2K6DA 3MEAA 3VS3A 1NPPA 1PKSA 4AFUC 3X20B 2I2LA 1SRMA 3REAB 2VUBA 3NGPA 3L2RA 1X2KA 3CCJT 3UA7A 3GF5A 5GAN6 3CCST 5GJWB 5GMKl 3LWIA 1X01A 3QUIA 2DL3A 2NLUA 3JCMc 1FXXA 2CUBA 3SD4A 2LVMA 2EFIA 2PTKA 1WJQA 3CC7A 2X4JA 1K9MU 2G3RA 1R8OB 1KIKA 1CKAA 3RR6A 1Q7YC 3ULRB 1AWOA 2HEQA 2ENMA 1NJIU 5GAN4 1YJWA 2OTJQ 3WXMB 4ZTJA 2YHTA 3JCMJ 3CXCP 2YLBA 3JRZA 3OS5A 4ZNXA 3OMGA 2EQMA 4C0GA 3G1JA 2CSQA 4KH1B 1M90U 4PJOG 1E6GA 3M4YA 2HSEB 3HL8A 2RMOA 3RKWA 1QVFS 5GAN2 2H8HA 4BACA 2H3EB 1BCMA 2WACA 1E6HA 1JXOA 4OB1B 1M1KC 4E7ZA 3ASKA 1ZUKA 4E7LA 4JJBA 1D3BA 3U23A 2JT4A 3MEWA 2F2VA 1QKXA 1KQSP 5GANg 2GGRA 5GMKh 5CKHA 4RTZA 4HXJA 2E5KA 5GAMj 3H6ZA 1K73R 2VGMA 1TH7A 3SFMA 3ME9A 3JB9H 3CCVQ 4OMMA 1KC8R 4OP0A 3LYIA 1I5LA 5I11A 2R5MA 1TWBA 3G7ZA 3SWNC 2PVOB 1Y96A 3EGXB 1RL2A 2Y4YA 2RQUA 1NG2A 4C0DB 5KYXA 3ZL7C 2RD1A
chains in the Genus database with same CATH topology
2DXBA 2FHDA 1UGPB 4FSXA 4II1A 4VUBA 4QQ6A 1OZ2A 2O01E 2BUDA 5GMKi 3JCMe 1KD1C 1XTDA 2X4YA 2B8AA 3RESA 3GP8A 2R58A 1VQ4T 3E19A 4C92E 2RHYA 4JDSA 2E6ZA 4XU0A 4R55A 4XTUA 3FC3A 2ZPBB 1O9SA 2HD0A 5IN1A 1KC8U 3MP8A 1VQNT 2QQRA 5CAIA 4PJOD 2RHXA 3R6OA 1KD1U 4ZGJB 2M9UA 4IURA 2L5QA 5A0DA 4J83A 4CI0C 2XIDA 1VQ5T 1P92A 4PJOA 1PSFA 4M75D 1G3WA 3G4SA 2CKKA 4ELYC 4C8QC 4L59A 4BE0A 3NTHA 3HP9A 4RCBA 2HNIA 3CCEA 4OMFB 4J5YA 3JCMg 5J39A 3QYHB 1YCYA 4J6WA 1VQ6T 3HSBA 3O8VA 1WJSA 2E1HA 4C92B 5I21A 3FDRA 5DY9A 1N9RA 5GAN7 3WVEB 3OYGA 2WSFE 3HFNA 4PKCC 2KSSA 2JN0A 4YTLA 3CC2T 3H8ZA 1G5VA 1Q86C 4A4GA 1OI1A 3RMSA 3J80E 3CCVA 1YIJT 3M57A 4M7DC 1VIFA 4E7JA 5D6XA 2A3LA 3DLMA 4A54A 3DKMA 4M77B 2RJCA 3RERA 2D6FA 3ER0A 3PIPA 4F7UF 5GAOl 1M8VA 2K57A 1Q86U 2X35A 5GAMf 4KBMB 4C92A 1O75A 4QW2A 5HY6A 3S3NA 2BKDN 2EWNA 5GAN8 5AYFA 3CCLT 3CCRT 2K3XA 4MMKA 3M55A 4Q5WA 1K8AC 2L3RA 2IG0A 3HRSA 1YIJA 5D6YA 2OTJA 5GANh 4ATOA 2EQKA 4M77A 3VU3C 2EYQA 5GANe 3C94A 5CO7A 5D6WA 5GAOm 2PU9B 4ZGEB 1G3YA 3QBYA 2XICA 2LX9A 4M78C 4ZTFA 1YJ9T 2EJGA 2RHUA 3QO3A 4HA8A 3FB9A 4Z02A 4M75F 1MHNA 4PNOA 1SSFA 4ZN3A 1QW1A 3KUFA 4GLKA 3DLLA 3CCUT 4DOWA 5CKFA 1NE8A 1H3ZA 3N5BB 1M1FA 1YBYA 2K5LA 2MWOA 1VQ4A 3L2VA 4J7IA 2QI2A 3CXCS 5KE3A 1YJNT 3CD6A 1BKBA 1Y07A 4C92C 5C0MA 1W4SA 3VKIA 2RH2A 3OYHA 3VV0A 1Q81U 5CQXA 3VJPA 4A4HA 3JB9I 4UC4A 2VYTA 3JB9J 4MDXA 5FU6B 1UEBA 2VGNA 1LJOA 3FJPA 1ZHIA 4XAXB 1HXDA 5GAOp 1W2BA 5LJ3d 3BDLA 4RKUE 5HK3A 1VQ8A 2RM4A 2ZGWA 4J6XA 3OYFA 1DJ7B 2P0QA 4EMHA 4FL6A 3CCET 3OB9A 5A2QE 3OW2S 4PLIA 4Y91A 1JRIA 4N0AC 3JB9F 4XTXA 3CD6T 2P4TA 2V8IA 4M78A 4JS4A 1YHQA 2PUOB 2YLCA 3NTIA 1IZ6A 5FU7C 4QVCA 1Y71A 1H641 3QIIA 5GANj 5KH6A 2RO0A 3CEYA 4PLLA 4GY5A 5GAMe 1I4K1 4JLGA 3L2ZA 3OS1A 3HKSA 1BI2A 4O6JA 3ZFJA 1VQKA 2LT4A 1WQ7A 3V7CA 3I55T 3CPWS 2GCXA 5L8RE 2ZPIB 3VYHB 4XTWA 4BUGA 3QJ6A 3ZBDA 3CC4A 3OYDA 4X9DA 1VQ9A 2DJZA 1UGQB 3DB3A 4M75C 4M7AC 3BW1A 2E5QA 3OSVA 4M7AD 4LDWA 4BB7A 5CKDA 3CCMT 1LNXA 3JCMb 4BD3A 3M9QA 2XHCA 2PVGB 3V7RA 4BI4A 4C92G 2DPPB 2LCCA 2E12A 2K5IA 4D6WA 3X26B 4DQ2A 5GAMg 3I56T 2L89A 3AHUA 2QA4T 3QYGB 3CCSA 1UGSB 3OY9A 1VQLA 4V2SA 2LC4A 2MMPA 2HBPA 4M77G 5LJ5e 3CC7T 2CZ0B 4BE1A 4A4KA 2RJFA 1BYMA 2X4XA 4EMGA 3OMCA 5GAOq 4Y28E 4P5NA 4LD6A 3OYIA 3WVDB 3TREA 4C8QG 4C0DC 1VQPT 2RHIA 2WSCE 4MZPA 3QZ5B 3VUZA 4C5HA 3M58A 3CCQT 3PMIA 3OYEA 4JRQA 3JCMd 1I81A 2E41A 4JRKA 1S72T 1Q82C 1NZ9A 2DIQA 3RUXA 2EIFA 3QDRB 3HHTB 1YJ9A 4M77C 2E6NA 2R5AA 3FIFA 3HRTA 3PMTA 1ZBXA 4BY6B 3JB9G 3QSUA 3OQ5A 2LCLA 2EAYA 4OGEA 1JBMA 1RI0A 3CBOA 3OYAA 5CCAA 1KQSA 3MCAB 3GNFB 5CR2A 4ZN1A 3G6ET 4EPCA 3CCJA 2M1HA 1GXIE 3C4SA 4JLIA 3RKXA 4BDZA 1WJRA 3JCMV 1Q82U 4RG2A 5I2MA 4A4FA 3L2QA 1VQNA 2O4XA 3GIBA 3CCRA 1N8RC 1JJ2S 2FB7A 1Q7YU 5IAYA 1X6OA 4C8QF 5A0LA 3M4GA 5GAMh 4HT8A 1YJNA 3QKJA 1S72A 4BY6C 5KCOA 4RMOA 1B34B 1M1GA 5EG2A 3BY7A 1I8FA 4M77F 2LDMA 3UDCA 3MO8A 2HQXA 4XTVA 4LD9K 5FRNA 4KULA 3URGA 5LJ5h 2XDDA 3E9GA 2RI3A 2RK1A 2M16A 2GFUA 3EFRA 5GAN3 5LJ3h 1K73U 5CKBA 4PJOC 4M78G 2O4XB 4N4GA 5CQYA 4C0ZA 4C92F 2DXCA 3CC2A 3DB4A 3PIOA 3QG1A 2XI9A 3KBGA 4IUQA 3OYBA 2K2VA 4QVDA 4M75E 4LDXA 2RJDA 3X28B 3L1AA 2EKOA 1M4ZA 4N0AA 3L42A 3CMAT 5FRMA 1M9SA 4JRIA 4FU6A 5C6SA 4PJOE 3GOXA 1EIFA 3CXCA 1V29B 4L6V5 4J8OA 3HPWA 1U1TA 4L5GA 4BDYA 3I55A 2YRVA 3S3MA 2MI6A 3OS2A 4M7DD 5LJ5f 2RJEA 2XKOC 4XTYA 2RHZA 4HKEA 1VQMA 2KQWA 5GANd 3CCQA 1G3TA 4IKFA 3SWNA 4XTZA 1UGRB 3C95A 3Q1JA 3JAME 3X25B 1U8RA 2XU8A 4KT0E 2MWPA 3RMQA 4HCZA 4OB3B 4OF1A 2FL7A 5CKEA 5LJ3g 3J81E 3OYLA 2E70A 4B9XA 2ZPGB 3OS0A 4FT2A 3LLRA 2OTLA 4M7DE 1HK9A 2QA4A 3FRNA 4XK8E 1VUBA 2P0PA 2CZ7B 1VQ7A 2XD0A 4FM4B 4C8QA 3G4ST 2V8KA 3FLGA 3JCMW 1LOJA 3RKYA 3TU4K 4M7AB 4EMKA 2R57A 5GANf 3CPWA 4LDVA 2F5KA 2CS7A 2HQEA 2D0QB 1N27A 2H3JA 2KDSA 4EMKC 5J3BA 4M7DF 2DXTA 2K5FA 3FEOA 4M7AE 1VIEA 2VC8A 1ZQ1A 2V8JA 4E47A 4XU3A 4F7UB 3PTAA 3L2WA 2LQKA 4FIBA 5LJ3e 4OB0B 1VQMT 2C06A 1AHJB 2OAUA 3CCUA 4M75G 2P0KA 5GMKe 3C12A 4C8QB 5LJ3j 4XU1A 1VQPA 1FX7A 4OB2B 3MP6A 4JJNK 4EMKB 4M7AA 4M7AF 3PGGA 3OYYA 2D9TA 4M78E 2DD4A 2KVQG 2EJ9A 2JVVA 3A8MB 4IUTA 3UT1A 1KQ2A 4C5EA 1YJWT 2GF7A 3QJYA 3JCMX 1IREB 1QVPA 3LX7A 3A5ZB 4DA4A 1QVFA 1NJIC 2XG8D 1U1SA 2DD5A 4MDWA 2DZ9A 2MAMA 4NS5A 3SWNB 2DTIA 5GAMd 4KUIA 2FYKA 3QXEB 3CC4T 4BE2A 3M59A 4MZMA 3OYJA 4HCBA 4DOVA 4HCCA 1YI2A 4QQGA 1Q81C 3G71T 4M7DA 2MF2A 4E7IA 3OSSC 2QEXT 1M1KU 3TCJA 1VQKT 3J7AF 3QPHA 3HRUA 3MEUA 4ME7A 3OYNA 1N6AA 2XK0A 2AHJB 2ZPHB 4F7UG 5GMKm 3MHXA 2DO3A 3LH0A 3PT9A 3V8LA 2JTFA 3OYMA 4NL3A 4JS5A 2KAFA 1FWZA 1KQ1A 3M56A 3LGLA 2XDPA 3P8BB 4LDYA 3JCMh 3ZEHA 2CYZB 3EFSA 2JTMA 4EDUA 3CBMA 4C5IA 2DEQA 2KK4A 3GNGA 2DZCA 2E65A 3MEVA 4RG8A 4M78B 3CMAA 1NPRA 2LRQA 1QVGS 2QTXA 2CZ6B 3VYGA 4HT9A 5FROA 1B34A 2RB6A 3I56A 4OVAA 3HFOA 4C8QE 2DK3A 3S6WA 4OGCA 3PNWC 1WNLA 1VQ8T 3A8LB 2EQJA 1OYXA 2Y90A 2ZPEB 2QQBA 4X34A 4F7UE 2EQUA 2KMTA 3BDUA 2KY9A 2GQVA 3PFSA 4JUVA 4WF2A 4A53A 3A8HB 5IT9E 1VQOA 1VQ7T 1M5Q1 2VXFA 1VQ9T 4LDUA 2WSEE 2EJFA 2IVWA 1WGSA 4BI3A 5LJ3f 3QZ9B 1BI3A 3MEAA 1NPPA 2LNVA 3RIRA 3JSCA 3TEEA 2I2LA 3X20B 1YHQT 3X24B 3CMEA 4M7DB 2VUBA 4MZTA 4FT4A 3L2RA 2L8DA 3CCJT 3GF5A 1X75C 2E10A 4PJOF 5GAN6 3CCST 4KUDK 5CIUA 5LJ5g 3OYCA 2A7YA 2VXEA 3A8GB 1YITA 3VUBA 2PQWA 4XQ3A 4CRIA 2X4WA 5GMKl 3LWIA 4IUUA 1X01A 3NTKA 3QUIA 4M75A 2ZPFB 2NLUA 1QP3A 2LQ8A 3OBWA 3JCMc 1FXXA 1K73C 3CCLA 3V7SA 3LW5E 2DKGA 4A4EA 3SD4A 3UPUA 2Y4XA 1VQ6A 1KHCA 2LVMA 5KCHA 4M7AG 3CMET 4J6YA 1KG1A 2EFIA 1WJQA 2XDBA 2OTJT 2LTOA 2QQ9A 4ZGDB 1OZ3A 4RCCA 4PJOB 5GAOn 3CC7A 2PUKB 4E7KA 2X4JA 3V8KA 1XNIA 3META 5CVIA 1K9MU 3LWHA 2G3RA 1R8OB 1W2BS 2F5TX 1MGQA 4M75B 1KQSS 1JB0E 2RI5A 1D3BB 5GAN5 5M9OA 1VQOT 1Q7YC 4M7DG 3OA6A 5CK9A 4NOYA 5I2SA 1JJ2A 5LL6S 2K3YA 4F7UA 3BFMA 4C8QD 4J7FA 4C92D 4B9WA 4C5GA 1NJIU 5GAN4 3LGFA 5LJ5d 4N4IA 3KXTA 2DXUA 2DTHA 1YJWA 2PVDB 2QQSA 2QXFA 3M53A 3WXMB 3G6EA 4ZTJA 2BIVA 3M54A 2YHTA 1WQWA 3CCMA 3JCMJ 2RK2A 3JCMP 2QQAA 2YLBA 3OYKA 3INZA 5KE2A 3JRZA 5DM7R 3OS5A 2K4YA 4IUVA 4M77D 5FU6C 3OMGA 3QHSA 4C0FA 3S3OA 2EQMA 1K8AU 3MP1A 4C0GA 1M90U 1BI0A 1BIAA 4PJOG 3JCMf 1PSEA 1UB4A 1XQHA 3M4YA 3E9FA 3HL8A 3RKWA 1QVFS 5GAN2 4XU2A 4JRPA 5HKCA 2QDYB 1VQ5A 5DLOA 4BACA 4QVZA 2GFAA 4TVRA 3CBPA 1K9MC 1G3SA 3T9NA 5FU7B 4N4HA 3CCVT 1QP2A 1M90C 1YI2T 4PL6A 3JB9D 5J26A 3JCMQ 2WACA 4X9CA 5FLXE 3SDZA 4OB1B 5A0GA 2M0OA 3EAEA 1M1KC 3A8OB 5HK0A 3L2UA 4IUPA 2DAQA 3CPFA 3ASKA 4M78D 4E7LA 1D3BA 2F69A 3P8DA 2E64A 1YITT 4O5VA 3MEWA 4M78F 4ELZC 1Y96B 5GANg 1XOVA 4R56A 5GMKh 1QVGA 5CKHA 4MMLA 1Y7XA 1N9SA 3F70A 2JZ2A 2CGHA 3E1SA 1KC8C 5DLQE 5GAMj 4QQDA 2JOYA 3H6ZA 3UWNA 2VGMA 3V8JA 2VV5A 2DTOA 1TH7A 3SFMA 5GMKj 3ME9A 3JB9H 2LT1A 1I5LA 4OP0A 3LYIA 2HAXA 2DVEA 2QEXA 2R5MA 3G7ZA 3OW2A 5LJ5j 1VQLT 3SWNC 2PVOB 3NFCA 1BI1A 1WPYA 1Y96A 3SB2A 2RI2A 2CZ1B 3M5AA 3G71A 1RL2A 2JUFA 4NL2A 5GAOr 1N8RU 3GPLA 2Y4YA 1BIBA 2JNGA 4E7HA 2DIGA 3P8HA 4C0DB 2ZCFB 4BI8B 3OBYA 2RA2A 4M77E 1KHIA 3GLXA 2FVUA 2ZZDA 2RD1A 2OTLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQ3 A;  5GMK l;  1X01 A;  3QUI A;  4M75 A;  5GMK i;  5GAM e;  3JCM e;  1I4K 1;  5LJ3 g;  3JCM c;  3L2Z A;  3V7S A;  4M7D E;  2DKG A;  3RES A;  1WQ7 A;  3V7C A;  1HK9 A;  4M7A G;  4C92 E;  4J6Y A;  4XU0 A;  4XTW A;  4XTU A;  4C8Q A;  4X9D A;  4M7A C;  2DJZ A;  4M75 C;  4RCC A;  5CAI A;  4PJO B;  3BW1 A;  5GAO n;  3JCM W;  4PJO D;  1LOJ A;  3RKY A;  4M7A B;  3V8K A;  4EMK A;  5GAN f;  4M7A D;  1LNX A;  4M7D F;  4EMK C;  4PJO A;  1MGQ A;  4M75 B;  4M75 D;  2DXT A;  3JCM b;  1D3B B;  3V7R A;  4C92 G;  5GAN 5;  4M7A E;  2VC8 A;  4F7U B;  4C8Q C;  4M7D G;  4XU3 A;  4RCB A;  2HNI A;  4J5Y A;  4NOY A;  3JCM g;  4DQ2 A;  5LJ3 e;  5GAM g;  1YCY A;  4J6W A;  3AHU A;  3HSB A;  4M75 G;  4F7U A;  5GMK e;  2E1H A;  3BFM A;  4C8Q B;  5DY9 A;  4C8Q D;  4C92 D;  4XU1 A;  4C92 B;  5I21 A;  1N9R A;  5LJ3 j;  5GAN 7;  5LJ5 d;  5GAN 4;  4V2S A;  2DXU A;  2DTH A;  3HFN A;  4M77 G;  2JN0 A;  4EMK B;  5LJ5 e;  4M7A A;  3PGG A;  4M7A F;  4M78 E;  2YHT A;  1WQW A;  4EMG A;  5GAO q;  3JCM J;  2EJ9 A;  3JCM P;  4C8Q G;  2YLB A;  4M7D C;  1KQ2 A;  3INZ A;  3JCM X;  4A54 A;  4M77 D;  4M77 B;  1U1S A;  3JCM d;  5GAM d;  1I81 A;  2DZ9 A;  3QHS A;  3SWN B;  2DTI A;  2E41 A;  4JRK A;  4F7U F;  2K57 A;  3RUX A;  2FYK A;  5GAO l;  1M8V A;  1BIA A;  4PJO G;  3JCM f;  4M77 C;  5GAM f;  3FIF A;  4C92 A;  3QSU A;  3JB9 G;  4M7D A;  3RKW A;  2EAY A;  5GAN 2;  2EWN A;  4XU2 A;  5GAN 8;  1JBM A;  4MMK A;  4F7U G;  4JLI A;  3RKX A;  5GMK m;  3JCM V;  3V8L A;  3JB9 D;  4NL3 A;  3JCM Q;  5GAN h;  4X9C A;  3GIB A;  1KQ1 A;  4M77 A;  2FB7 A;  3VU3 C;  5GAN e;  5GAO m;  3JCM h;  4C8Q F;  5GAM h;  3M4G A;  4QVC A;  3EFS A;  4HT8 A;  2DEQ A;  1B34 B;  2DZC A;  2E65 A;  4M78 C;  3BY7 A;  1I8F A;  2EJG A;  4M77 F;  4M78 D;  4M78 B;  3QO3 A;  4HA8 A;  1D3B A;  3FB9 A;  2QTX A;  4XTV A;  2E64 A;  3RER A;  4HT9 A;  1B34 A;  2RB6 A;  4M75 F;  4PNO A;  5LJ5 h;  4M78 F;  3HFO A;  4C8Q E;  3EFR A;  5GAN 3;  5LJ3 h;  1Y96 B;  4PJO C;  1WNL A;  5GAN g;  4M78 G;  5GMK h;  4C92 F;  4MML A;  1N9S A;  2Y90 A;  4F7U E;  2CGH A;  3BDU A;  5GAM j;  4JUV A;  4WF2 A;  4A53 A;  4M75 E;  4QVD A;  3V8J A;  1M5Q 1;  2DTO A;  2VXF A;  1TH7 A;  4C92 C;  5GMK j;  3L1A A;  3JB9 H;  4N0A A;  2EJF A;  1I5L A;  4OP0 A;  3JB9 I;  4JRI A;  3JB9 J;  2DVE A;  5LJ3 f;  4PJO E;  5LJ5 j;  1LJO A;  3FJP A;  1H64 1;  3SWN C;  1HXD A;  1WPY A;  5GAO p;  1Y96 A;  3SB2 A;  5LJ3 d;  1U1T A;  3RIR A;  2I2L A;  2RM4 A;  2ZGW A;  4J6X A;  4NL2 A;  4EMH A;  5LJ5 f;  5GAO r;  4M7D D;  4M7D B;  4XTY A;  1BIB A;  3JB9 F;  4Y91 A;  1JRI A;  4N0A C;  5GAN d;  4XTX A;  5GAN 6;  2E10 A;  4PJO F;  4M78 A;  2RA2 A;  4M77 E;  2YLC A;  3SWN A;  5LJ5 g;  2VXE A;  4XTZ A;  5GAN j;  2RD1 A; 
#chains in the Genus database with same CATH topology
 4FSX A;  2MOX A;  2RNA A;  3JCM e;  4J9F A;  4QT7 A;  2X4Y A;  2B8A A;  1SPK A;  2R58 A;  4RTU A;  2EGC A;  2G6F X;  1O9S A;  1SEM A;  4PJO D;  4IUR A;  2L5Q A;  1TU0 B;  1P92 A;  1VYV A;  4F17 A;  2IIM A;  4C8Q C;  4L59 A;  4BE0 A;  3HP9 A;  2HNI A;  5J39 A;  1SKU B;  4JPB W;  1YCY A;  1WZO A;  3FDR A;  1PNJ A;  2DM1 A;  2WSF E;  4PKC C;  3CC2 T;  3H8Z A;  3RMS A;  3J80 E;  3CCV A;  4M7D C;  4E7J A;  3PE0 A;  3DLM A;  1TUG B;  3DKM A;  1OU9 A;  2RQR A;  2D6F A;  3PIP A;  1M8V A;  1Q86 U;  2IPO B;  2KE9 A;  5HY6 A;  2BKD N;  2EWN A;  5GAN 8;  3CCL T;  3M55 A;  4D8K A;  5L23 A;  1K8A C;  2KGT A;  1YIJ A;  3VS5 A;  5D6Y A;  2OTJ A;  3TQ7 P;  2EQK A;  1OV3 A;  1IGQ A;  1I5O B;  2PU9 B;  2COZ A;  4JZ3 A;  4M78 C;  2NUT B;  2KYB A;  3QO3 A;  4HA8 A;  1VQ7 Q;  1UDL A;  2KI7 A;  2V1Q A;  1YNZ A;  3KUF A;  3DLL A;  2EYW A;  2VWF A;  1NE8 A;  3N5B B;  1QVF P;  1M1F A;  2CT4 A;  2MWO A;  3L2V A;  1IHV A;  3VV0 A;  1PCX A;  4J9D A;  5IXB A;  4UC4 A;  3JB9 I;  3CC2 Q;  1UEB A;  1LJO A;  1W2B A;  3BDL A;  2AIR B;  4OMQ A;  2ZGW A;  3OYF A;  1CSK A;  3CCE T;  4PLI A;  4Y91 A;  2V8I A;  4M78 A;  5FU7 C;  2CP2 A;  5FWB A;  5KH6 A;  2EQI A;  2FPE A;  3GBQ A;  1VQN Q;  4JLG A;  3L2Z A;  1K8A R;  1VQP Q;  3VYH B;  1AOJ A;  4XTW A;  3QJ6 A;  3NHN A;  4BB7 A;  1AD5 A;  5CKD A;  1UTI A;  2XHC A;  2HMA A;  3I56 T;  2A28 A;  2KRM A;  1IO6 A;  1VQL A;  1OX8 A;  2CZ0 B;  4EMG A;  5KYU A;  3M0U A;  2JTE A;  4P5N A;  4Y28 E;  3OYI A;  1Y57 A;  3TRE A;  4C0D C;  1IXD A;  2RHI A;  1UG1 A;  4MZP A;  4C5H A;  2QGF B;  2XMF A;  1H8K A;  3JCM d;  1Q82 R;  2DIQ A;  3QDR B;  3CQT A;  2R5A A;  3FIF A;  3QSU A;  2C0O A;  3JB9 G;  2O2O A;  1IGU A;  2CDT A;  3CBO A;  1KQS A;  2SEM A;  4PFP A;  4PFO A;  2OI3 A;  1LCK A;  5I2M A;  2O4X A;  1TG0 A;  4DBF A;  1JJ2 S;  3EHQ A;  4PJN A;  5A0L A;  4HT8 A;  4RTT A;  3QKJ A;  1S72 A;  5KCO A;  1X6G A;  1B34 B;  1GCP A;  3UDC A;  5KYY A;  1VYU A;  2HQX A;  3HTR A;  5FRN A;  3URG A;  5LJ5 h;  2XDD A;  3E9G A;  3EFR A;  2GFU A;  2DFU A;  2O88 A;  4C0Z A;  1GCQ C;  4D8D A;  3PIO A;  2KBT A;  4N0A A;  3CMA T;  2DL4 A;  5FRM A;  4L6V 5;  1M2V A;  3HPW A;  2YRV A;  3S3M A;  4E6R A;  3OS2 A;  4M7D D;  2XKO C;  2KQW A;  3CCQ A;  3SWN A;  4AG1 C;  1EZZ B;  4HCZ A;  2ZPG B;  2DER A;  1M90 R;  1D1B A;  1HK9 A;  2QA4 A;  1U5S A;  2DL8 A;  1PG5 B;  1U3O A;  3FLG A;  3JCM W;  3TU4 K;  4EMK A;  1MV3 A;  1FMW A;  2CS7 A;  2DIL A;  2H3J A;  2KDS A;  4M7D F;  1RLP C;  2BE7 D;  4F7U B;  3L2W A;  2DRK A;  2V26 A;  4OB0 B;  5GMK e;  4ORZ A;  1ZBJ A;  1S1N A;  4JJN K;  4M7A A;  4M7A F;  3PGG A;  1C6V X;  2D9T A;  4M78 E;  1OUL A;  2KVQ G;  3OW2 P;  3THK A;  1YJW T;  3JCM X;  2XG8 D;  1M3B A;  2DD5 A;  2DZ9 A;  4NS5 A;  4AFZ C;  3QXE B;  4BE2 A;  3SHW A;  2HSP A;  4HCB A;  1YI2 A;  4QQG A;  1Q81 C;  4M7D A;  4E7I A;  1M1K U;  2ROT A;  3J7A F;  4ME7 A;  2LQW A;  4F7U G;  3LH0 A;  2O9V A;  2JTF A;  3OYM A;  2XDP A;  4LDY A;  2QK0 A;  2KK4 A;  2DJQ A;  1Q95 G;  2JM8 A;  4M78 B;  2YT6 A;  4LXC A;  2LRQ A;  1QVG S;  2QTX A;  2KR3 A;  3VYG A;  5FRO A;  2COY A;  3EH1 A;  1VQO Q;  3HFO A;  2DK3 A;  3S6W A;  1ABO A;  2I0N A;  1VQ8 T;  2ZPE B;  4X34 A;  4F7U E;  3QWY A;  2KY9 A;  2MIO A;  3PFS A;  4JUV A;  4WF2 A;  4A53 A;  3A8H B;  1VQO A;  1VQ9 T;  4LNP A;  2YUN A;  2NUZ A;  5GJV B;  2D0N A;  3G4S Q;  1TUD A;  2LNV A;  3RIR A;  3JSC A;  5KYX B;  1YHQ T;  5FW9 A;  3CME A;  1E7O A;  2GQI A;  1NM7 A;  3VS0 A;  2NUT A;  2E3H A;  2L2P A;  1YIT A;  4R0K A;  3VUB A;  4CRI A;  1AZG B;  2X4W A;  4IUU A;  2ZPF B;  2LQ8 A;  4J9C A;  3CPW P;  1F1B B;  1ZSG A;  2ROL A;  3V7S A;  2DKG A;  3CCL A;  2JXB A;  2Y4X A;  2FZG B;  5KCH A;  4AFS C;  1Z9Z A;  3CME T;  1UGV A;  2OTJ T;  2CP7 A;  2LTO A;  1PD0 A;  2DLP A;  2KT1 A;  4ZGD B;  5GAO n;  4E7K A;  5CVI A;  1SSH A;  1VQO T;  3OA6 A;  1VA7 A;  5I2S A;  4FYX B;  1Q7Y R;  4C8Q D;  1AWX A;  4C5G A;  4N4I A;  4KGZ B;  1D0X A;  2QXF A;  3M53 A;  4IIM A;  2FPD A;  3CMA Q;  2RK2 A;  2QQA A;  5DM7 R;  3QHS A;  1K8A U;  3MP1 A;  1PSE A;  4KRT A;  2HKQ B;  4Y92 A;  2K7A A;  4KH0 B;  5HKC A;  4TVR A;  1K9M C;  3T9N A;  5FU7 B;  1M90 C;  1YI2 T;  3JB9 D;  5J26 A;  1I0C A;  2QAZ A;  3EAE A;  2AZS A;  3A8O B;  2NWM A;  5HK0 A;  2DAQ A;  2QEX Q;  4M78 D;  2A08 A;  2AT1 B;  4M78 F;  1K0X A;  4R56 A;  1QVG A;  1X2Q A;  1M8M A;  2CGH A;  1GFC A;  2EYZ A;  2JW4 A;  4QQD A;  2L3P A;  2D8H A;  1JU5 C;  3A1P A;  2HKN A;  3OW2 A;  1UFF A;  1WPY A;  2RI2 A;  1BU1 A;  2CZ1 B;  5D7U A;  3G71 A;  2JUF A;  4J9E A;  4HVV A;  3GPL A;  2DIG A;  1KK7 A;  1RLQ C;  1GBQ A;  3OBY A;  2RA2 A;  1KHI A;  2MK5 A;  4OB3 B;  3EG9 B;  2ECZ A;  2OTL T;  1MND A;  1UGP B;  2FHD A;  3D7S B;  1OZ2 A;  5GMK i;  1N8R R;  1AZE A;  1KD1 C;  3RES A;  3GP8 A;  3E19 A;  4XTU A;  5IN1 A;  1KC8 U;  1VQN T;  1BCO A;  1G3W A;  1D1C A;  3NTH A;  5I22 A;  2GNC A;  3QYH B;  1QLY A;  3HSB A;  1VQ6 T;  3LH5 A;  3O8V A;  1WJS A;  2E1H A;  5DY9 A;  2F2W A;  5GAN 7;  3UA6 A;  2D1X A;  3WVE B;  4YTL A;  2RF0 A;  2KSS A;  2JN0 A;  1ACM B;  1OI1 A;  1YJN Q;  1Z9Q A;  2F1L A;  2P84 A;  2EYX A;  2RJC A;  4OML A;  3RER A;  3ER0 A;  2CP6 A;  1NYF A;  4KBM B;  2YUQ A;  2BZY A;  1YWP A;  4AMC A;  3CCR T;  2K3X A;  2HQH A;  2L3R A;  3HRS A;  1KFZ A;  2YUP A;  1YJ9 Q;  5GAN h;  3VU3 C;  2EYQ A;  5D6W A;  1K4U S;  1G3Y A;  2F2X A;  2EJG A;  3EFO B;  3PVQ A;  3O5Z A;  4GLK A;  3CCU T;  4DOW A;  3RBB B;  1JO8 A;  1YBY A;  5KE3 A;  5C0M A;  1WHM A;  2RH2 A;  1Q81 U;  3VJP A;  3CC7 Q;  5FU6 B;  3FJP A;  5GAO p;  2YUO A;  4RKU E;  5HK3 A;  1CKB A;  2RM4 A;  4J6X A;  1DJ7 B;  2P0Q A;  3OW2 S;  4XTX A;  1I07 A;  1BBZ A;  4JS4 A;  1YHQ A;  1NYG A;  1RUW A;  1QCF A;  1D0Y A;  4QVC A;  1Y71 A;  3QII A;  2COW A;  5GAN j;  4PJJ A;  1WXU A;  2KRN A;  3V7C A;  4BUG A;  2CH4 W;  3ZBD A;  4F04 B;  5KYN A;  4M7A C;  1UGQ B;  3BW1 A;  2E5Q A;  3OSV A;  4PK4 A;  3JCM b;  1YHQ Q;  3V7R A;  4BI4 A;  4C92 G;  2LCC A;  2K5I A;  2JS0 A;  4D6W A;  1MNE A;  4DQ2 A;  2K9G A;  3AHU A;  1UJ0 A;  3CCS A;  4JJC A;  1RAE B;  4M77 G;  1B3Q A;  5LJ5 e;  2RJF A;  1ZUY A;  2DL5 A;  4LD6 A;  4C8Q G;  3I55 Q;  3OYE A;  1D0Z A;  2E41 A;  4JRK A;  2EIF A;  3HHT B;  4CC7 A;  1YJ9 A;  4M77 C;  3HRT A;  3OQ5 A;  2EAY A;  4OGE A;  1JBM A;  3OYA A;  2JMC A;  4ZN1 A;  4EPC A;  3RKX A;  1WDX A;  2ED1 A;  4BDZ A;  3JCM V;  4RG2 A;  3GIB A;  1PC0 A;  1N8R C;  1QCN A;  3EGX A;  5IAY A;  4C8Q F;  2FPF A;  1YJN A;  2J05 A;  5EG2 A;  4M77 F;  3H0I A;  1VYT A;  3MO8 A;  4LD9 K;  1OPK A;  3BE3 A;  5CQY A;  4C92 F;  1K9A A;  1RAG B;  4AG2 C;  1RAC B;  3KBG A;  4IUQ A;  2QTV A;  3OYB A;  4QVD A;  3EH2 A;  2SRC A;  4WTO B;  2EKO A;  4J9G A;  2CRE A;  1M9S A;  1VQ4 Q;  1UUE A;  1M3A A;  1V29 B;  2DA9 A;  3R6N A;  4BDY A;  3I55 A;  5LJ5 f;  2RJE A;  4XTY A;  3EG1 A;  4LUD A;  1G3T A;  1RI9 A;  4XTZ A;  2KRS A;  1V76 A;  2FRW A;  2DL7 A;  2XU8 A;  4KT0 E;  2MWP A;  3RMQ A;  2FL7 A;  3J81 E;  4B9X A;  2VVK A;  4GLM A;  2P0P A;  1VQ7 A;  3M0T A;  2V8K A;  1OX9 A;  1U06 A;  1X43 A;  4M7A B;  5GAN f;  1N27 A;  2JMA A;  5J3B A;  1IRX A;  2LQN A;  2K5F A;  2VC8 A;  3PTA A;  4E47 A;  2QDL A;  1OU8 A;  3E2U A;  1H3H A;  2X3W D;  1SHF A;  1W2B P;  2OAU A;  2LZ6 B;  4DBR A;  1WIE A;  3C12 A;  2X3X D;  1FX7 A;  4OB2 B;  3EFO A;  4EMK B;  2DEU A;  1KQ2 A;  2M0Y A;  3QJY A;  4DA4 A;  1QWF A;  3LX7 A;  3A5Z B;  4HVU A;  1NJI C;  2MAM A;  4OMO A;  4MZM A;  4FYW B;  3VS1 A;  2KNB B;  4FYY B;  1QVG P;  1GFD A;  3OSS C;  2DRM A;  1ABQ A;  1Q86 R;  1N6A A;  2AHJ B;  5GMK m;  3PT9 A;  3EG0 A;  1W6X A;  1KQ1 A;  2X51 A;  2QGG A;  3LGL A;  4PJL A;  3ZEH A;  1BK2 A;  4EDU A;  2EYY A;  1T3L A;  2DEQ A;  2E65 A;  4RG8 A;  3CMA A;  7AT1 B;  1RAI B;  1B34 A;  2RB6 A;  4OVA A;  1ZA2 B;  4OGC A;  1SHG A;  2Y90 A;  2DE0 X;  4JJD A;  4RTY A;  1VQ7 T;  1QWE A;  2E3I A;  2LMJ A;  1VQM Q;  3QZ9 B;  1BI3 A;  2GTJ A;  4FCY A;  1YCS B;  1Y0M A;  3TEE A;  2YRC A;  2FRY A;  3X24 B;  1M1K R;  4J9I A;  1NEB A;  4FT4 A;  2L8D A;  1HYO A;  1X75 C;  3OYC A;  2VXE A;  3A8G B;  1X27 A;  2BZ8 A;  4XQ3 A;  2DVJ A;  3NTK A;  4M75 A;  4ANJ A;  3OBW A;  2AZV A;  3CME Q;  4A4E A;  1KHC A;  4J6Y A;  2XDB A;  2QQ9 A;  1Q81 R;  1OZ3 A;  4PJO B;  1XNI A;  3LWH A;  1X6B A;  1MGQ A;  1KQS S;  1VQ8 Q;  1WXT A;  2PZ1 A;  5M9O A;  5CK9 A;  3EHR A;  1JJ2 A;  2K3Y A;  4C92 D;  4B9W A;  1PRM C;  2DXU A;  2KEA A;  2PVD B;  4OMP A;  2BIV A;  1I1J A;  3CCM A;  1GRI A;  3INZ A;  5KE2 A;  1J3T A;  4IUV A;  4M77 D;  3MPU B;  1BI0 A;  1BIA A;  3JCM f;  1UB4 A;  1RAA B;  3E9F A;  3PVL A;  4XU2 A;  4JRP A;  2QDY B;  5DLO A;  4QVZ A;  1VQK Q;  3CBP A;  2EW3 A;  3CCV T;  4N4H A;  1QP2 A;  2LCS A;  4PL6 A;  1AT1 B;  3JCM Q;  4X9C A;  5FLX E;  2EPD A;  2M0O A;  3L2U A;  3UF4 A;  3CPF A;  1KJW A;  1N5Z A;  4FSS A;  4PJM A;  1AWW A;  1R0C B;  1FYN A;  4MML A;  3F70 A;  1M27 C;  2ESW A;  3E1S A;  2JJ9 A;  2JOY A;  5FWC A;  3AT1 B;  4J9B A;  1R77 A;  2QEX A;  1PD1 A;  1VQL T;  1BI1 A;  2K3B A;  3SB2 A;  3M5A A;  4J9H A;  1RAH B;  4NL2 A;  5GAO r;  1N8R U;  2DYI A;  3P8H A;  4E7H A;  4BI8 B;  4M77 E;  2FVU A;  2DXB A;  4OMN A;  2FO0 A;  4QQ6 A;  5EC7 A;  2BUD A;  1HD3 A;  4AT1 B;  2RPN A;  2RN8 A;  4C92 E;  2E6Z A;  1RAD B;  4XU0 A;  4R55 A;  4LUE A;  2HD0 A;  3MP8 A;  5CAI A;  2J6O A;  1KD1 U;  1UHF A;  4ZGJ B;  2RQT A;  4CI0 C;  2XID A;  1VQ5 T;  2OAW A;  3EGD A;  4ESR A;  4PJO A;  2CKK A;  4ELY C;  1WX6 A;  4FW1 A;  3CCE A;  4OMF B;  4J5Y A;  3JCM g;  4J6W A;  4C92 B;  1WHG A;  5IHK A;  2HCK A;  1M30 A;  3HFN A;  3OYG A;  1G5V A;  3CCE Q;  4A4G A;  2FEI A;  5IH2 A;  5D6X A;  1VQL Q;  4A54 A;  4M77 B;  2O31 A;  4F7U F;  5GAO l;  2NUP A;  2CSI A;  4QW2 A;  5IHI A;  5IXF A;  5AYF A;  4Q5W A;  1WHH A;  4ATO A;  1W1F A;  5GAN e;  3REB B;  3C94 A;  5CO7 A;  2CH4 A;  4ZGE B;  4A63 B;  2LX9 A;  4ZTF A;  1YJ9 T;  2RHU A;  3M0R A;  4Z02 A;  3G6E Q;  4KGV B;  4PNO A;  1MHN A;  1SSF A;  2K79 A;  1YIT Q;  4ZN3 A;  1QW1 A;  1H3Z A;  3EG2 A;  1VQ4 A;  1EX4 A;  2QI2 A;  1BKB A;  2VB6 A;  3RNJ A;  1G8X A;  3OYH A;  5CQX A;  4A4H A;  2VYT A;  4MDX A;  3KFV A;  2VGN A;  1ZHI A;  1HXD A;  5LJ3 d;  2BZX A;  5ECA A;  1VQ8 A;  2O9S A;  4EMH A;  3VS4 A;  3OB9 A;  5A2Q E;  3JB9 F;  2KXD A;  1JRI A;  4N0A C;  2CP0 A;  2PUO B;  2YLC A;  1IZ6 A;  1V1C A;  2DX1 A;  2RO0 A;  1T0H A;  1FMV A;  3OS1 A;  1BI2 A;  4O6J A;  3ZFJ A;  1VQK A;  2DBK A;  4RTV A;  2LT4 A;  1WQ7 A;  2ZPI B;  1WLP B;  1YWO A;  3CC4 A;  3OYD A;  4X9D A;  2DJZ A;  4M75 C;  1YFN A;  3CCM T;  2QA4 Q;  2PVG B;  2E12 A;  1D09 B;  2L89 A;  1C0M A;  2MYS A;  2MCN A;  4CC2 A;  1PRL C;  4V2S A;  4LN2 A;  2LC4 A;  2MMP A;  1UHC A;  2CP3 A;  3CC7 T;  2FZK B;  1HJD A;  4A4K A;  2X4X A;  3OMC A;  5GAO q;  1VQP T;  2WSC E;  3VUZ A;  3M58 A;  3PMI A;  2DMO A;  1S72 T;  1YN8 A;  1NZ9 A;  1K0S A;  1VQ9 Q;  2E6N A;  1ZBX A;  4BY6 B;  3I9Q A;  2LCL A;  1BB9 A;  1RI0 A;  1ZX6 A;  3GNF B;  5CR2 A;  3G6E T;  3CCJ A;  2FZC B;  2M1H A;  1GXI E;  3C4S A;  2CT3 A;  2C0I A;  3L2Q A;  4E2F B;  3CCR A;  2FB7 A;  1WFW A;  1X6O A;  5GAM h;  1M1G A;  2LDM A;  1AVZ C;  1OPL A;  4KUL A;  3UAT A;  2RI3 A;  2RK1 A;  5GAN 3;  1K73 U;  2X9H A;  5CKB A;  4PJO C;  4M78 G;  4N4G A;  2LJ0 A;  3QG1 A;  4DEY A;  1X69 A;  2K2V A;  4M75 E;  4X1V A;  1KSW A;  3X28 B;  4E7S A;  3L1A A;  3L42 A;  4FU6 A;  9ATC B;  1EIF A;  3GOX A;  2W10 A;  2AK5 A;  2MI6 A;  1H92 A;  2OTL Q;  2DNU A;  2RHZ A;  4HKE A;  2LJ3 A;  5GAN d;  4K11 A;  1UGR B;  1PKT A;  1AWJ A;  3C95 A;  3JAM E;  1U8R A;  3CCM Q;  3M0P A;  5LJ3 g;  2E70 A;  3OS0 A;  2OTL A;  3LLR A;  4M7D E;  3FRN A;  1VUB A;  3C0C A;  2CZ7 B;  1NJI R;  2XD0 A;  5AT1 B;  2MPX C;  2R57 A;  2F5K A;  1VQ6 Q;  2QYZ A;  2D0Q B;  4M7A E;  1ZSZ A;  1VIE A;  1ZQ1 A;  4XU3 A;  2ABL A;  2LQK A;  5LJ3 e;  2GBQ A;  1AHJ B;  4FYV B;  4C8Q B;  4XU1 A;  1VQP A;  3MP6 A;  1M2V B;  1JJ2 P;  3OYY A;  3I35 A;  2EJ9 A;  2JVV A;  3A8M B;  4IUT A;  2GF7 A;  2L0A A;  1IRE B;  4MDW A;  3CCR Q;  1TTH B;  4KUI A;  2FYK A;  1TS9 A;  3CC4 T;  2FG0 A;  2P4R A;  2B86 A;  2HL5 C;  2MF2 A;  3TCJ A;  1VQK T;  3QPH A;  3OYN A;  2V1R A;  2XK0 A;  2QEX T;  3MHX A;  2DO3 A;  3V8L A;  3H41 A;  1FWZ A;  2KXC A;  3M56 A;  4HVW A;  3CC4 Q;  1UE9 A;  3P8B B;  2JTM A;  3CBM A;  4C5I A;  2YRD A;  1LPL A;  2A37 A;  2CZ6 B;  1UEC A;  1A0N B;  3G71 Q;  4C8Q E;  1NLP C;  1WNL A;  2RQW A;  1OYX A;  3EGU A;  3H9N A;  1SG5 A;  1ARK A;  4RUG A;  2GQV A;  2QAS A;  1YJW Q;  5IT9 E;  1M5Q 1;  2VXF A;  3CCQ Q;  4LDU A;  2WSE E;  2EJF A;  2IVW A;  4M4Z A;  1YIJ Q;  1OQK A;  1WGS A;  4BI3 A;  5LJ3 f;  3VRY A;  4M7D B;  1TSF A;  4MZT A;  3EG3 A;  3NMZ C;  2E10 A;  4PJO F;  4KUD K;  5CIU A;  5LJ5 g;  2A7Y A;  2PQW A;  4DBQ A;  3I56 Q;  1QP3 A;  2PNI A;  1K73 C;  3LW5 E;  4M7A G;  3UPU A;  1IHW A;  1VQ6 A;  1KG1 A;  1NBE B;  4KGX B;  4RCC A;  2PUK B;  3V8K A;  3MET A;  4CC3 A;  3A98 A;  1B7T A;  2F5T X;  1W2B S;  4M75 B;  1JB0 E;  2RI5 A;  1D3B B;  5GAN 5;  3M0S A;  4M7D G;  4NOY A;  5LL6 S;  1VQ5 Q;  4F7U A;  3BFM A;  4J7F A;  3JV3 A;  3LGF A;  1QMC A;  5LJ5 d;  2J6F A;  3KXT A;  2DTH A;  3G6E A;  2QQS A;  2DET A;  1NEG A;  3M54 A;  1WQW A;  3JCM P;  3OYK A;  1K1Z A;  2K4Y A;  1OOT A;  2LX7 A;  4DEX A;  5FU6 C;  2BE9 B;  4C0F A;  3S3O A;  2A36 A;  1NLO C;  1XQH A;  8ATC B;  1VQ5 A;  2EBP A;  2GFA A;  1G3S A;  1TUC A;  3RDV A;  3SDZ A;  5A0G A;  1WA7 A;  2J7I A;  1PHT A;  2OX7 A;  1M2O A;  4IUP A;  6AT1 B;  1D1A A;  1MUZ A;  2F69 A;  3P8D A;  2E64 A;  1YIT T;  2RQV A;  4O5V A;  2ATC B;  4ELZ C;  1Y96 B;  1LVK A;  1XOV A;  1ZSZ C;  1Y7X A;  1N9S A;  2JZ2 A;  1KC8 C;  5DLQ E;  3UWN A;  3FJ5 A;  3V8J A;  2VV5 A;  2DTO A;  5GMK j;  2LT1 A;  4WCI A;  2HAX A;  2DVE A;  5LJ5 j;  3NFC A;  4JZ4 A;  1BIB A;  2EKH A;  2JNG A;  1QCO A;  2ZCF B;  3IQL A;  3CCJ Q;  4HCK A;  3GLX A;  1UGS B;  2NUP B;  2ZZD A;  2W0Z A;  4II1 A;  4VUB A;  2YWW A;  2O01 E;  1XTD A;  1MMD A;  1VQ4 T;  2RHY A;  4JDS A;  3FC3 A;  2ZPB B;  2QQR A;  2RHX A;  2YDL A;  3R6O A;  2M9U A;  5A0D A;  4J83 A;  5HCK A;  1YP5 A;  1WHL A;  1PSF A;  4M75 D;  3G4S A;  1GL5 A;  4RCB A;  1WHK A;  5IHN A;  5I21 A;  1N9R A;  4AFQ C;  1SF9 A;  2AKK A;  1Q86 C;  1YIJ T;  1TOV A;  3M57 A;  1VIF A;  2A3L A;  3CCS Q;  2K57 A;  2KT8 A;  2X35 A;  5GAM f;  2Z0W A;  4C92 A;  1O75 A;  3S3N A;  4Z88 A;  4MMK A;  2DF6 A;  1G83 A;  2EVR A;  2IG0 A;  1ZSZ B;  1QKW A;  2J06 A;  3H0H A;  3SEM A;  4M77 A;  3TSW A;  3TSZ A;  5GAO m;  1T3S A;  3MJX A;  1WYX A;  3QBY A;  2XIC A;  3FB9 A;  3NPF A;  4M75 F;  5CKF A;  2ED0 A;  1C1A A;  2K5L A;  4J7I A;  2OJ2 A;  3CXC S;  3CD6 A;  1YJN T;  1Y07 A;  4C92 C;  1W4S A;  3VKI A;  1JEG A;  3JB9 J;  1R0B G;  4XAX B;  1XJW B;  4FL6 A;  1K76 A;  3TVT A;  2E4H A;  3CD6 T;  2P4T A;  3NTI A;  1QQJ A;  1H64 1;  1G2B A;  1ZLM A;  3CEY A;  4PLL A;  4GY5 A;  5GAM e;  1I4K 1;  2DBM A;  3HKS A;  1M3C A;  3I55 T;  3CPW S;  2GCX A;  5L8R E;  4DBH A;  2GTO A;  1VQ9 A;  3DB3 A;  4F16 A;  2HDA A;  4M7A D;  4LDW A;  1LNX A;  4BD3 A;  3M9Q A;  2DPP B;  3MKD A;  3X26 B;  5GAM g;  2QA4 T;  3QYG B;  3OY9 A;  1HSQ A;  2CP5 A;  2HBP A;  3VS7 A;  4BE1 A;  1K9M R;  1TXQ A;  1BYM A;  2JM9 A;  2YSQ A;  4RTW A;  3WVD B;  1RAB B;  1T0J A;  3VRZ A;  2YXY A;  3QZ5 B;  3CCQ T;  4JRQ A;  1I81 A;  3H0F A;  1Q82 C;  3RUX A;  3QWX X;  3PMT A;  4F14 A;  5CCA A;  3MCA B;  3CCL Q;  4JLI A;  1Q82 U;  1WJR A;  1PM3 A;  1WI7 A;  4A4F A;  1VQN A;  1Q7Y U;  4GBQ A;  2M02 A;  3M4G A;  4BY6 C;  4RMO A;  1PWT A;  3I5S A;  1YI2 Q;  3QDF A;  3BY7 A;  1I8F A;  4Z89 A;  4XTV A;  2EGA A;  2HL3 A;  5KYW A;  2M16 A;  5LJ3 h;  2L3S A;  1WXB A;  2O4X B;  2DXC A;  1MMA A;  3DB4 A;  3CC2 A;  2XI9 A;  1GCQ A;  4LDX A;  2RJD A;  1B07 A;  1M4Z A;  2KRO A;  2LJ1 A;  4JRI A;  1EFN A;  3EGD B;  4Z8A A;  5C6S A;  4PJO E;  3CXC A;  2K2M A;  4PFZ A;  4J8O A;  1U1T A;  1MMG A;  4IIO A;  4L5G A;  2QG9 B;  4RTX A;  4B6M A;  2VKN A;  1VQM A;  1JQQ A;  4IKF A;  2J6K A;  2A0F B;  1SRL A;  1RAF B;  3Q1J A;  3VS6 A;  3X25 B;  4QKU A;  3OYL A;  4OF1 A;  5CKE A;  3VS2 A;  1MMN A;  4FT2 A;  4XK8 E;  1FMK A;  5KYY B;  5KYW B;  4FM4 B;  4C8Q A;  2C0T A;  3G4S T;  1UJY A;  1LOJ A;  3RKY A;  3CPW A;  4LDV A;  2HQE A;  4EMK C;  2HZY A;  2DXT A;  3FEO A;  2LP5 A;  2V8J A;  1WHJ A;  4FIB A;  1VQM T;  2C06 A;  1GBR A;  3CCU A;  4M75 G;  2P0K A;  5LJ3 j;  2CUD A;  2M51 A;  3EG9 A;  2DD4 A;  3UT1 A;  4C5E A;  1QVP A;  1QVF A;  1U1S A;  2JS2 A;  5KYU B;  5GAM d;  3SWN B;  2DTI A;  4CC4 B;  1MV0 B;  2BTT A;  3M59 A;  3OYJ A;  1IB8 A;  4DOV A;  4HCC A;  3G71 T;  4LE9 A;  3CD6 Q;  3CCU Q;  3HRU A;  2KYM A;  1JXM A;  3MEU A;  2ZPH B;  3M0Q A;  4JS5 A;  4NL3 A;  2KAF A;  3JCM h;  2CYZ B;  3EFS A;  3GNG A;  2DZC A;  3MEV A;  1OEB A;  1ZUU A;  4EIK A;  1NPR A;  2LNH B;  4HT9 A;  4FW2 A;  2HBW A;  2L3Q A;  3I56 A;  1S72 Q;  2ZAE A;  3I5R A;  2D8J A;  3PNW C;  3A8L B;  2EQJ A;  2NYS A;  2QQB A;  2EQU A;  2KMT A;  3BDU A;  8AT1 B;  1VOM A;  2AKL A;  1KD1 R;  2VAS A;  1ZA1 B;  2DYB A;  1AEY A;  2EGE A;  1W70 A;  2K6D A;  3MEA A;  3VS3 A;  1NPP A;  1PKS A;  4AFU C;  3X20 B;  2I2L A;  1SRM A;  3REA B;  2VUB A;  3NGP A;  3L2R A;  1X2K A;  3CCJ T;  3UA7 A;  3GF5 A;  5GAN 6;  3CCS T;  5GJW B;  5GMK l;  3LWI A;  1X01 A;  3QUI A;  2DL3 A;  2NLU A;  3JCM c;  1FXX A;  2CUB A;  3SD4 A;  2LVM A;  2EFI A;  2PTK A;  1WJQ A;  3CC7 A;  2X4J A;  1K9M U;  2G3R A;  1R8O B;  1KIK A;  1CKA A;  3RR6 A;  1Q7Y C;  3ULR B;  1AWO A;  2HEQ A;  2ENM A;  1NJI U;  5GAN 4;  1YJW A;  2OTJ Q;  3WXM B;  4ZTJ A;  2YHT A;  3JCM J;  3CXC P;  2YLB A;  3JRZ A;  3OS5 A;  4ZNX A;  3OMG A;  2EQM A;  4C0G A;  3G1J A;  2CSQ A;  4KH1 B;  1M90 U;  4PJO G;  1E6G A;  3M4Y A;  2HSE B;  3HL8 A;  2RMO A;  3RKW A;  1QVF S;  5GAN 2;  2H8H A;  4BAC A;  2H3E B;  1BCM A;  2WAC A;  1E6H A;  1JXO A;  4OB1 B;  1M1K C;  4E7Z A;  3ASK A;  1ZUK A;  4E7L A;  4JJB A;  1D3B A;  3U23 A;  2JT4 A;  3MEW A;  2F2V A;  1QKX A;  1KQS P;  5GAN g;  2GGR A;  5GMK h;  5CKH A;  4RTZ A;  4HXJ A;  2E5K A;  5GAM j;  3H6Z A;  1K73 R;  2VGM A;  1TH7 A;  3SFM A;  3ME9 A;  3JB9 H;  3CCV Q;  4OMM A;  1KC8 R;  4OP0 A;  3LYI A;  1I5L A;  5I11 A;  2R5M A;  1TWB A;  3G7Z A;  3SWN C;  2PVO B;  1Y96 A;  3EGX B;  1RL2 A;  2Y4Y A;  2RQU A;  1NG2 A;  4C0D B;  5KYX A;  3ZL7 C;  2RD1 A; 
#chains in the Genus database with same CATH homology
 2DXB A;  2FHD A;  1UGP B;  4FSX A;  4II1 A;  4VUB A;  4QQ6 A;  1OZ2 A;  2O01 E;  2BUD A;  5GMK i;  3JCM e;  1KD1 C;  1XTD A;  2X4Y A;  2B8A A;  3RES A;  3GP8 A;  2R58 A;  1VQ4 T;  3E19 A;  4C92 E;  2RHY A;  4JDS A;  2E6Z A;  4XU0 A;  4R55 A;  4XTU A;  3FC3 A;  2ZPB B;  1O9S A;  2HD0 A;  5IN1 A;  1KC8 U;  3MP8 A;  1VQN T;  2QQR A;  5CAI A;  4PJO D;  2RHX A;  3R6O A;  1KD1 U;  4ZGJ B;  2M9U A;  4IUR A;  2L5Q A;  5A0D A;  4J83 A;  4CI0 C;  2XID A;  1VQ5 T;  1P92 A;  4PJO A;  1PSF A;  4M75 D;  1G3W A;  3G4S A;  2CKK A;  4ELY C;  4C8Q C;  4L59 A;  4BE0 A;  3NTH A;  3HP9 A;  4RCB A;  2HNI A;  3CCE A;  4OMF B;  4J5Y A;  3JCM g;  5J39 A;  3QYH B;  1YCY A;  4J6W A;  1VQ6 T;  3HSB A;  3O8V A;  1WJS A;  2E1H A;  4C92 B;  5I21 A;  3FDR A;  5DY9 A;  1N9R A;  5GAN 7;  3WVE B;  3OYG A;  2WSF E;  3HFN A;  4PKC C;  2KSS A;  2JN0 A;  4YTL A;  3CC2 T;  3H8Z A;  1G5V A;  1Q86 C;  4A4G A;  1OI1 A;  3RMS A;  3J80 E;  3CCV A;  1YIJ T;  3M57 A;  4M7D C;  1VIF A;  4E7J A;  5D6X A;  2A3L A;  3DLM A;  4A54 A;  3DKM A;  4M77 B;  2RJC A;  3RER A;  2D6F A;  3ER0 A;  3PIP A;  4F7U F;  5GAO l;  1M8V A;  2K57 A;  1Q86 U;  2X35 A;  5GAM f;  4KBM B;  4C92 A;  1O75 A;  4QW2 A;  5HY6 A;  3S3N A;  2BKD N;  2EWN A;  5GAN 8;  5AYF A;  3CCL T;  3CCR T;  2K3X A;  4MMK A;  3M55 A;  4Q5W A;  1K8A C;  2L3R A;  2IG0 A;  3HRS A;  1YIJ A;  5D6Y A;  2OTJ A;  5GAN h;  4ATO A;  2EQK A;  4M77 A;  3VU3 C;  2EYQ A;  5GAN e;  3C94 A;  5CO7 A;  5D6W A;  5GAO m;  2PU9 B;  4ZGE B;  1G3Y A;  3QBY A;  2XIC A;  2LX9 A;  4M78 C;  4ZTF A;  1YJ9 T;  2EJG A;  2RHU A;  3QO3 A;  4HA8 A;  3FB9 A;  4Z02 A;  4M75 F;  1MHN A;  4PNO A;  1SSF A;  4ZN3 A;  1QW1 A;  3KUF A;  4GLK A;  3DLL A;  3CCU T;  4DOW A;  5CKF A;  1NE8 A;  1H3Z A;  3N5B B;  1M1F A;  1YBY A;  2K5L A;  2MWO A;  1VQ4 A;  3L2V A;  4J7I A;  2QI2 A;  3CXC S;  5KE3 A;  1YJN T;  3CD6 A;  1BKB A;  1Y07 A;  4C92 C;  5C0M A;  1W4S A;  3VKI A;  2RH2 A;  3OYH A;  3VV0 A;  1Q81 U;  5CQX A;  3VJP A;  4A4H A;  3JB9 I;  4UC4 A;  2VYT A;  3JB9 J;  4MDX A;  5FU6 B;  1UEB A;  2VGN A;  1LJO A;  3FJP A;  1ZHI A;  4XAX B;  1HXD A;  5GAO p;  1W2B A;  5LJ3 d;  3BDL A;  4RKU E;  5HK3 A;  1VQ8 A;  2RM4 A;  2ZGW A;  4J6X A;  3OYF A;  1DJ7 B;  2P0Q A;  4EMH A;  4FL6 A;  3CCE T;  3OB9 A;  5A2Q E;  3OW2 S;  4PLI A;  4Y91 A;  1JRI A;  4N0A C;  3JB9 F;  4XTX A;  3CD6 T;  2P4T A;  2V8I A;  4M78 A;  4JS4 A;  1YHQ A;  2PUO B;  2YLC A;  3NTI A;  1IZ6 A;  5FU7 C;  4QVC A;  1Y71 A;  1H64 1;  3QII A;  5GAN j;  5KH6 A;  2RO0 A;  3CEY A;  4PLL A;  4GY5 A;  5GAM e;  1I4K 1;  4JLG A;  3L2Z A;  3OS1 A;  3HKS A;  1BI2 A;  4O6J A;  3ZFJ A;  1VQK A;  2LT4 A;  1WQ7 A;  3V7C A;  3I55 T;  3CPW S;  2GCX A;  5L8R E;  2ZPI B;  3VYH B;  4XTW A;  4BUG A;  3QJ6 A;  3ZBD A;  3CC4 A;  3OYD A;  4X9D A;  1VQ9 A;  2DJZ A;  1UGQ B;  3DB3 A;  4M75 C;  4M7A C;  3BW1 A;  2E5Q A;  3OSV A;  4M7A D;  4LDW A;  4BB7 A;  5CKD A;  3CCM T;  1LNX A;  3JCM b;  4BD3 A;  3M9Q A;  2XHC A;  2PVG B;  3V7R A;  4BI4 A;  4C92 G;  2DPP B;  2LCC A;  2E12 A;  2K5I A;  4D6W A;  3X26 B;  4DQ2 A;  5GAM g;  3I56 T;  2L89 A;  3AHU A;  2QA4 T;  3QYG B;  3CCS A;  1UGS B;  3OY9 A;  1VQL A;  4V2S A;  2LC4 A;  2MMP A;  2HBP A;  4M77 G;  5LJ5 e;  3CC7 T;  2CZ0 B;  4BE1 A;  4A4K A;  2RJF A;  1BYM A;  2X4X A;  4EMG A;  3OMC A;  5GAO q;  4Y28 E;  4P5N A;  4LD6 A;  3OYI A;  3WVD B;  3TRE A;  4C8Q G;  4C0D C;  1VQP T;  2RHI A;  2WSC E;  4MZP A;  3QZ5 B;  3VUZ A;  4C5H A;  3M58 A;  3CCQ T;  3PMI A;  3OYE A;  4JRQ A;  3JCM d;  1I81 A;  2E41 A;  4JRK A;  1S72 T;  1Q82 C;  1NZ9 A;  2DIQ A;  3RUX A;  2EIF A;  3QDR B;  3HHT B;  1YJ9 A;  4M77 C;  2E6N A;  2R5A A;  3FIF A;  3HRT A;  3PMT A;  1ZBX A;  4BY6 B;  3JB9 G;  3QSU A;  3OQ5 A;  2LCL A;  2EAY A;  4OGE A;  1JBM A;  1RI0 A;  3CBO A;  3OYA A;  5CCA A;  1KQS A;  3MCA B;  3GNF B;  5CR2 A;  4ZN1 A;  3G6E T;  4EPC A;  3CCJ A;  2M1H A;  1GXI E;  3C4S A;  4JLI A;  3RKX A;  4BDZ A;  1WJR A;  3JCM V;  1Q82 U;  4RG2 A;  5I2M A;  4A4F A;  3L2Q A;  1VQN A;  2O4X A;  3GIB A;  3CCR A;  1N8R C;  1JJ2 S;  2FB7 A;  1Q7Y U;  5IAY A;  1X6O A;  4C8Q F;  5A0L A;  3M4G A;  5GAM h;  4HT8 A;  1YJN A;  3QKJ A;  1S72 A;  4BY6 C;  5KCO A;  4RMO A;  1B34 B;  1M1G A;  5EG2 A;  3BY7 A;  1I8F A;  4M77 F;  2LDM A;  3UDC A;  3MO8 A;  2HQX A;  4XTV A;  4LD9 K;  5FRN A;  4KUL A;  3URG A;  5LJ5 h;  2XDD A;  3E9G A;  2RI3 A;  2RK1 A;  2M16 A;  2GFU A;  3EFR A;  5GAN 3;  5LJ3 h;  1K73 U;  5CKB A;  4PJO C;  4M78 G;  2O4X B;  4N4G A;  5CQY A;  4C0Z A;  4C92 F;  2DXC A;  3CC2 A;  3DB4 A;  3PIO A;  3QG1 A;  2XI9 A;  3KBG A;  4IUQ A;  3OYB A;  2K2V A;  4QVD A;  4M75 E;  4LDX A;  2RJD A;  3X28 B;  3L1A A;  2EKO A;  1M4Z A;  4N0A A;  3L42 A;  3CMA T;  5FRM A;  1M9S A;  4JRI A;  4FU6 A;  5C6S A;  4PJO E;  3GOX A;  1EIF A;  3CXC A;  1V29 B;  4L6V 5;  4J8O A;  3HPW A;  1U1T A;  4L5G A;  4BDY A;  3I55 A;  2YRV A;  3S3M A;  2MI6 A;  3OS2 A;  4M7D D;  5LJ5 f;  2RJE A;  2XKO C;  4XTY A;  2RHZ A;  4HKE A;  1VQM A;  2KQW A;  5GAN d;  3CCQ A;  1G3T A;  4IKF A;  3SWN A;  4XTZ A;  1UGR B;  3C95 A;  3Q1J A;  3JAM E;  3X25 B;  1U8R A;  2XU8 A;  4KT0 E;  2MWP A;  3RMQ A;  4HCZ A;  4OB3 B;  4OF1 A;  2FL7 A;  5CKE A;  5LJ3 g;  3J81 E;  3OYL A;  2E70 A;  4B9X A;  2ZPG B;  3OS0 A;  4FT2 A;  3LLR A;  2OTL A;  4M7D E;  1HK9 A;  2QA4 A;  3FRN A;  4XK8 E;  1VUB A;  2P0P A;  2CZ7 B;  1VQ7 A;  2XD0 A;  4FM4 B;  4C8Q A;  3G4S T;  2V8K A;  3FLG A;  3JCM W;  1LOJ A;  3RKY A;  3TU4 K;  4M7A B;  4EMK A;  2R57 A;  5GAN f;  3CPW A;  4LDV A;  2F5K A;  2CS7 A;  2HQE A;  2D0Q B;  1N27 A;  2H3J A;  2KDS A;  4EMK C;  5J3B A;  4M7D F;  2DXT A;  2K5F A;  3FEO A;  4M7A E;  1VIE A;  2VC8 A;  1ZQ1 A;  2V8J A;  4E47 A;  4XU3 A;  4F7U B;  3PTA A;  3L2W A;  2LQK A;  4FIB A;  5LJ3 e;  4OB0 B;  1VQM T;  2C06 A;  1AHJ B;  2OAU A;  3CCU A;  4M75 G;  2P0K A;  5GMK e;  3C12 A;  4C8Q B;  5LJ3 j;  4XU1 A;  1VQP A;  1FX7 A;  4OB2 B;  3MP6 A;  4JJN K;  4EMK B;  4M7A A;  4M7A F;  3PGG A;  3OYY A;  2D9T A;  4M78 E;  2DD4 A;  2KVQ G;  2EJ9 A;  2JVV A;  3A8M B;  4IUT A;  3UT1 A;  1KQ2 A;  4C5E A;  1YJW T;  2GF7 A;  3QJY A;  3JCM X;  1IRE B;  1QVP A;  3LX7 A;  3A5Z B;  4DA4 A;  1QVF A;  1NJI C;  2XG8 D;  1U1S A;  2DD5 A;  4MDW A;  2DZ9 A;  2MAM A;  4NS5 A;  3SWN B;  2DTI A;  5GAM d;  4KUI A;  2FYK A;  3QXE B;  3CC4 T;  4BE2 A;  3M59 A;  4MZM A;  3OYJ A;  4HCB A;  4DOV A;  4HCC A;  1YI2 A;  4QQG A;  1Q81 C;  3G71 T;  4M7D A;  2MF2 A;  4E7I A;  3OSS C;  2QEX T;  1M1K U;  3TCJ A;  1VQK T;  3J7A F;  3QPH A;  3HRU A;  3MEU A;  4ME7 A;  3OYN A;  1N6A A;  2XK0 A;  2AHJ B;  2ZPH B;  4F7U G;  5GMK m;  3MHX A;  2DO3 A;  3LH0 A;  3PT9 A;  3V8L A;  2JTF A;  3OYM A;  4NL3 A;  4JS5 A;  2KAF A;  1FWZ A;  1KQ1 A;  3M56 A;  3LGL A;  2XDP A;  3P8B B;  4LDY A;  3JCM h;  3ZEH A;  2CYZ B;  3EFS A;  2JTM A;  4EDU A;  3CBM A;  4C5I A;  2DEQ A;  2KK4 A;  3GNG A;  2DZC A;  2E65 A;  3MEV A;  4RG8 A;  4M78 B;  3CMA A;  1NPR A;  2LRQ A;  1QVG S;  2QTX A;  2CZ6 B;  3VYG A;  4HT9 A;  5FRO A;  1B34 A;  2RB6 A;  3I56 A;  4OVA A;  3HFO A;  4C8Q E;  2DK3 A;  3S6W A;  4OGC A;  3PNW C;  1WNL A;  1VQ8 T;  3A8L B;  2EQJ A;  1OYX A;  2Y90 A;  2ZPE B;  2QQB A;  4X34 A;  4F7U E;  2EQU A;  2KMT A;  3BDU A;  2KY9 A;  2GQV A;  3PFS A;  4JUV A;  4WF2 A;  4A53 A;  3A8H B;  5IT9 E;  1VQO A;  1VQ7 T;  1M5Q 1;  2VXF A;  1VQ9 T;  4LDU A;  2WSE E;  2EJF A;  2IVW A;  1WGS A;  4BI3 A;  5LJ3 f;  3QZ9 B;  1BI3 A;  3MEA A;  1NPP A;  2LNV A;  3RIR A;  3JSC A;  3TEE A;  2I2L A;  3X20 B;  1YHQ T;  3X24 B;  3CME A;  4M7D B;  2VUB A;  4MZT A;  4FT4 A;  3L2R A;  2L8D A;  3CCJ T;  3GF5 A;  1X75 C;  2E10 A;  4PJO F;  5GAN 6;  3CCS T;  4KUD K;  5CIU A;  5LJ5 g;  3OYC A;  2A7Y A;  2VXE A;  3A8G B;  1YIT A;  3VUB A;  2PQW A;  4XQ3 A;  4CRI A;  2X4W A;  5GMK l;  3LWI A;  4IUU A;  1X01 A;  3NTK A;  3QUI A;  4M75 A;  2ZPF B;  2NLU A;  1QP3 A;  2LQ8 A;  3OBW A;  3JCM c;  1FXX A;  1K73 C;  3CCL A;  3V7S A;  3LW5 E;  2DKG A;  4A4E A;  3SD4 A;  3UPU A;  2Y4X A;  1VQ6 A;  1KHC A;  2LVM A;  5KCH A;  4M7A G;  3CME T;  4J6Y A;  1KG1 A;  2EFI A;  1WJQ A;  2XDB A;  2OTJ T;  2LTO A;  2QQ9 A;  4ZGD B;  1OZ3 A;  4RCC A;  4PJO B;  5GAO n;  3CC7 A;  2PUK B;  4E7K A;  2X4J A;  3V8K A;  1XNI A;  3MET A;  5CVI A;  1K9M U;  3LWH A;  2G3R A;  1R8O B;  1W2B S;  2F5T X;  1MGQ A;  4M75 B;  1KQS S;  1JB0 E;  2RI5 A;  1D3B B;  5GAN 5;  5M9O A;  1VQO T;  1Q7Y C;  4M7D G;  3OA6 A;  5CK9 A;  4NOY A;  5I2S A;  1JJ2 A;  5LL6 S;  2K3Y A;  4F7U A;  3BFM A;  4C8Q D;  4J7F A;  4C92 D;  4B9W A;  4C5G A;  1NJI U;  5GAN 4;  3LGF A;  5LJ5 d;  4N4I A;  3KXT A;  2DXU A;  2DTH A;  1YJW A;  2PVD B;  2QQS A;  2QXF A;  3M53 A;  3WXM B;  3G6E A;  4ZTJ A;  2BIV A;  3M54 A;  2YHT A;  1WQW A;  3CCM A;  3JCM J;  2RK2 A;  3JCM P;  2QQA A;  2YLB A;  3OYK A;  3INZ A;  5KE2 A;  3JRZ A;  5DM7 R;  3OS5 A;  2K4Y A;  4IUV A;  4M77 D;  5FU6 C;  3OMG A;  3QHS A;  4C0F A;  3S3O A;  2EQM A;  1K8A U;  3MP1 A;  4C0G A;  1M90 U;  1BI0 A;  1BIA A;  4PJO G;  3JCM f;  1PSE A;  1UB4 A;  1XQH A;  3M4Y A;  3E9F A;  3HL8 A;  3RKW A;  1QVF S;  5GAN 2;  4XU2 A;  4JRP A;  5HKC A;  2QDY B;  1VQ5 A;  5DLO A;  4BAC A;  4QVZ A;  2GFA A;  4TVR A;  3CBP A;  1K9M C;  1G3S A;  3T9N A;  5FU7 B;  4N4H A;  3CCV T;  1QP2 A;  1M90 C;  1YI2 T;  4PL6 A;  3JB9 D;  5J26 A;  3JCM Q;  2WAC A;  4X9C A;  5FLX E;  3SDZ A;  4OB1 B;  5A0G A;  2M0O A;  3EAE A;  1M1K C;  3A8O B;  5HK0 A;  3L2U A;  4IUP A;  2DAQ A;  3CPF A;  3ASK A;  4M78 D;  4E7L A;  1D3B A;  2F69 A;  3P8D A;  2E64 A;  1YIT T;  4O5V A;  3MEW A;  4M78 F;  4ELZ C;  1Y96 B;  5GAN g;  1XOV A;  4R56 A;  5GMK h;  1QVG A;  5CKH A;  4MML A;  1Y7X A;  1N9S A;  3F70 A;  2JZ2 A;  2CGH A;  3E1S A;  1KC8 C;  5DLQ E;  5GAM j;  4QQD A;  2JOY A;  3H6Z A;  3UWN A;  2VGM A;  3V8J A;  2VV5 A;  2DTO A;  1TH7 A;  3SFM A;  5GMK j;  3ME9 A;  3JB9 H;  2LT1 A;  1I5L A;  4OP0 A;  3LYI A;  2HAX A;  2DVE A;  2QEX A;  2R5M A;  3G7Z A;  3OW2 A;  5LJ5 j;  1VQL T;  3SWN C;  2PVO B;  3NFC A;  1BI1 A;  1WPY A;  1Y96 A;  3SB2 A;  2RI2 A;  2CZ1 B;  3M5A A;  3G71 A;  1RL2 A;  2JUF A;  4NL2 A;  5GAO r;  1N8R U;  3GPL A;  2Y4Y A;  1BIB A;  2JNG A;  4E7H A;  2DIG A;  3P8H A;  4C0D B;  2ZCF B;  4BI8 B;  3OBY A;  2RA2 A;  4M77 E;  1KHI A;  3GLX A;  2FVU A;  2ZZD A;  2RD1 A;  2OTL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...