1N9RA

Crystal structure of a heptameric ring complex of yeast smf in spacegroup p4122
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
b'LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein F
molecule tags Translation
source organism Saccharomyces cerevisiae
publication title Homomeric ring assemblies of eukaryotic Sm proteins have affinity for both RNA and DNA: Crystal structure of an oligomeric complex of yeast SmF
pubmed doi rcsb
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n9rA00
2I2LA 4M77A 4WF2A 4C8QE 3JCMe 4J6YA 4HT8A 3JB9J 2VXEA 1B34A 3SWNA 4F7UA 5GMKi 5GAN3 4C92B 2VXFA 4XTUA 2DVEA 5GAMf 4PJOD 3AHUA 1M8VA 4M78D 4X9CA 5LJ5e 4M77E 4JUVA 2Y90A 4NOYA 4M7AA 2EWNA 4XTWA 4JRKA 5LJ3d 2E1HA 3V7SA 1I4K1 3JCMJ 1JBMA 2EJ9A 4N0AA 5GAN4 2DTIA 4M7DC 4EMKA 3JCMc 5LJ3e 4M75C 1M5Q1 5GANh 4HT9A 4RCCA 3RESA 5LJ5g 5GMKl 4C8QD 5GAOl 4A53A 2DTOA 4C8QB 4QVDA 1I5LA 3JCMV 4M7DD 4XTXA 2YLCA 3INZA 5GMKj 4M75D 2DXTA 4EMGA 5GMKm 3BDUA 4M75F 2DTHA 4NL3A 2E41A 4M77G 2DEQA 3HFNA 3M4GA 4M78C 4M77F 3V8LA 5GAMg 4M77D 3EFRA 2YHTA 5GMKe 1LJOA 2DXUA 2FB7A 4OP0A 4PJOB 4PJOG 4J6XA 3RIRA 5LJ5h 3JB9F 1BIBA 4M75A 2JN0A 3RUXA 3SWNC 5GAN7 3JB9G 5LJ3h 5GANe 5CAIA 4M7DG 3EFSA 2EAYA 4M77C 1B34B 4PNOA 3SWNB 3JCMW 1HK9A 1WQWA 1X01A 2HNIA 4X9DA 4F7UB 4M77B 3JCMh 5LJ3j 3JCMX 5GAMd 3QHSA 1HXDA 1TH7A 2DJZA 5GAN2 4M7DB 4M7DE 4V2SA 4MMKA 4EMKB 3RERA 4M7DA 2DZ9A 4M7AB 4F7UE 5GANg 3FIFA 4JLIA 5GAMh 1I8FA 2RA2A 2RB6A 3GIBA 3V7RA 3JCMf 3L1AA 2EJGA 4M78G 4RCBA 4XU1A 3QSUA 5GANj 1Y96A 3HFOA 5GMKh 5LJ5d 1KQ2A 2DKGA 5LJ3f 4C92E 2EJFA 4C92A 1KQ1A 1N9RA 1YCYA 4J6WA 4M78B 1H641 4M78E 2RM4A 4C8QF 4C8QG 3BY7A 3JCMb 3V8JA 2ZGWA 3JB9D 3BFMA 4PJOA 1D3BA 2CGHA 3PGGA 4J5YA 4PJOC 3FB9A 4XTYA 1D3BB 1LNXA 4C92F 4PJOE 2YLBA 3BW1A 5GANf 4C92D 5GAN8 4M78A 4EMHA 1U1TA 5LJ3g 4PJOF 4NL2A 4DQ2A 5GAMj 4M75G 5GAOn 4M7DF 1JRIA 3RKYA 4MMLA 4C92G 5GAOq 4M7AC 5DY9A 3JCMg 4F7UF 3JCMP 3V7CA 2FYKA 3QO3A 4F7UG 5GAN5 4M7AE 1U1SA 3VU3C 5GAN6 3HSBA 4A54A 1LOJA 2QTXA 5I21A 3JB9I 5GAOr 3RKWA 4Y91A 3FJPA 1MGQA 5GANd 5GAOp 3V8KA 4M7AF 4XQ3A 1WQ7A 2E65A 4XU0A 4C92C 4M7AG 2VC8A 5LJ5j 4N0AC 1N9SA 4C8QA 1I81A 1WNLA 3QUIA 4XU2A 2E64A 1WPYA 2K57A 2RD1A 4HA8A 1Y96B 4M75E 2DZCA 3JCMQ 1BIAA 4XTVA 5LJ5f 4QVCA 4M7AD 4XU3A 4M75B 5GAOm 3L2ZA 4XTZA 3JB9H 5GAMe 4M78F 4EMKC 3JCMd 4C8QC 3SB2A 2E10A 3RKXA 4JRIA
chains in the Genus database with same CATH superfamily
2OAUA 1Y7XA 4LDVA 2QYZA 3MEUA 3H41A 4MZTA 4QKUA 4A63B 2FZKB 3OQ5A 2K2VA 2KT1A 3HRSA 2GFAA 1PD0A 4M75F 1CKBA 2K4YA 2KMTA 8ATCB 1UFFA 2JM8A 1G3YA 2QEXQ 2FEIA 2D8JA 4OB2B 1WXUA 4LDYA 2ZPGB 4X9DA 1SF9A 2WACA 3I56Q 1X2KA 3RERA 5HCKA 1UGSB 2A3LA 2DIGA 1YBYA 4RKUE 1M8MA 2CP0A 4LD9K 3QSUA 2HKNA 4J9IA 1VUBA 2DAQA 2LMJA 4BY6C 2J7IA 4CC4B 1UB4A 3TEEA 1EIFA 2IPOB 1UG1A 1VQ7Q 3CXCP 2LDMA 5GJWB 4Z02A 1ZSZA 2DFUA 2IG0A 2HSEB 4XAXB 1CSKA 2R5MA 3MP1A 4EMHA 1WHJA 2VV5A 3A8GB 5GAN6 5L23A 5GAOr 3JAME 2FZCB 4CRIA 4QQGA 2JTEA 2YUPA 1PHTA 1VQ8Q 5KCHA 4E7KA 3MHXA 4IUTA 4M75B 1B3QA 2JXBA 2JJ9A 5GAMe 2KNBB 1J3TA 1W70A 2QDLA 3M0RA 3HPWA 1N8RC 3JB9J 1N8RU 1Y07A 3CCJT 1KD1U 4CC2A 4PJOD 1M8VA 3X26B 5IHIA 1VQKQ 4JPBW 2X3XD 1AWJA 1KHIA 1YFNA 2QASA 2E3HA 3PT9A 5IHNA 4MZMA 4WCIA 2K3BA 1M5Q1 4HT9A 1M27C 5LJ5g 3ZFJA 5GMKl 4QW2A 1UTIA 2IIMA 1OZ3A 3F70A 3U23A 1I5LA 5KYWA 4N4GA 1ACMB 1F1BB 1KQSA 2D0NA 2DTHA 2P4RA 3DB4A 4M77D 2DK3A 3EFRA 4A4EA 1BU1A 3SWNC 3CC2Q 1WHLA 4RTVA 3QYGB 3SWNB 4PNOA 1Q81C 2QQ9A 4E7LA 2CDTA 2G3RA 1YHQA 1YITA 2L3RA 2OTJA 3RR6A 1G8XA 1PKTA 2L3PA 1VQMQ 2GQVA 4RCBA 2NUPB 5KYUB 1K9MR 2PQWA 1Q82R 2COZA 2YLBA 1KC8R 4KUIA 3PVQA 2KE9A 3CCJA 2M02A 2CH4W 2F2WA 1KC8U 1BI1A 4OMMA 1TG0A 3GBQA 1YJ9T 2BE7D 2K6DA 2KT8A 2QQRA 4FYXB 4QVZA 3R6OA 3GNFB 5GANd 3CCQA 1M2VA 4ZNXA 4IURA 1I81A 2B86A 2ZCFB 1AWXA 5FU6B 3I35A 2RN8A 2DERA 4ZGJB 2D9TA 4BE1A 2V8IA 3VS2A 4BE2A 4M78F 1QVGA 1QVFP 5CO7A 4II1A 3MEWA 3VKIA 1WI7A 5A0DA 2K79A 1VQ8T 1OX8A 5GAMf 2L5QA 4X9CA 2HBWA 3S3MA 1JBMA 4X1VA 2LT1A 4HCKA 2QDYB 5LJ3e 1S72A 1UGQB 5CCAA 2AT1B 1QQJA 2EKOA 2RK1A 1FMKA 1YJNT 4NL3A 4J9BA 2JMAA 1OX9A 4AMCA 5KYXA 5GAN7 3JB9G 2EGEA 2AZSA 3EGDA 2RHZA 4OB0B 2PVGB 4A4GA 2OX7A 1B07A 4V2SA 5I11A 2DJZA 1YJWA 2DF6A 4RG8A 3CCUT 3G71T 1VQOA 4Z89A 2VGMA 1PM3A 1N9RA 1TSFA 3RBBB 3TREA 1BB9A 4JDSA 4E7HA 3P8BB 2E6NA 4LN2A 1ABOA 4GY5A 1WLPB 2PVDB 3UA7A 1EZZB 2EYYA 1M1FA 3X24B 2MOXA 4PJOF 2AK5A 5LJ3g 3SEMA 3NTHA 1V76A 1QVGS 2FYKA 3QBYA 2P0QA 4PJJA 3M0QA 4D8DA 3HSBA 1LOJA 2NLUA 2W0ZA 1ZX6A 3FDRA 1Q95G 3NFCA 1W2BP 1H3HA 4C92C 3WVEB 1MV0B 1VYUA 2O88A 3CBMA 3OS2A 5KYWB 3X25B 4JRPA 2V1QA 4IUPA 1IRXA 4FU6A 3L2ZA 3JB9H 2FPFA 2YUNA 2LP5A 3CCSA 2BKDN 3A5ZB 4J83A 1R0CB 2ZPBB 1RAAB 1NYFA 4KGXB 2CT3A 4JLGA 1RI9A 1SSHA 4OB3B 3HP9A 3EG9B 4O5VA 3CC7A 4EDUA 3G71A 5GANh 1VQOT 2XKOC 1Z9ZA 2GF7A 3LH5A 2C06A 1SHGA 4XTXA 3CCMT 2EW3A 4M77F 3FC3A 2F5TX 2DL3A 3PTAA 1X27A 3C94A 4R0KA 2DXUA 5CKFA 2JS0A 2PU9B 5CAIA 3LYIA 1KHCA 1WFWA 1M1KC 1M90R 3JCMh 2COYA 3QHSA 1S72T 5J26A 1K73C 2DA9A 2DZ9A 2E3IA 2KYBA 3BDLA 5FW9A 3M54A 4PLLA 1OULA 2EYZA 3OSSC 4FSSA 2RM4A 1VQLQ 3JCMb 1LNXA 3TSZA 1GXIE 1WXTA 2JMCA 2XIDA 2GTOA 5GAN8 2VWFA 1XJWB 2L3SA 2ATCB 3WXMB 4M7DF 3REAB 1MMAA 3JCMP 2Y4XA 1NBEB 3NGPA 4A54A 2K9GA 1DJ7B 2V8JA 2DRMA 4N0AC 3LGFA 1ZA2B 2RD1A 1BYMA 4E47A 1BIAA 3VRZA 2NYSA 4FT2A 2GBQA 5KYXB 2KDSA 1BI0A 1QKWA 2KXDA 1Q82C 4E6RA 2E10A 1M30A 3CMAQ 3CCVQ 3LLRA 1K76A 1UJ0A 4F7UA 1YIJQ 5CKHA 3EHRA 1K0SA 1UGVA 2E5QA 5CKEA 1V29B 2QA4A 1K8AR 2I0NA 4AFSC 1NM7A 4LUDA 5GMKj 3ER0A 1I07A 1HSQA 2CUDA 4M78C 3MKDA 2M1HA 3OW2A 4KULA 2RQUA 1OI1A 4J6XA 3RIRA 1UEBA 2CZ6B 1QVPA 3QJYA 5CKDA 1E6GA 3BE3A 1ZQ1A 1QP3A 3H8ZA 9ATCB 1SSFA 2HNIA 5GAMd 1VQ7T 1TH7A 2ZPHB 2R5AA 2LTOA 2R57A 4RUGA 3M0TA 3RDVA 2QA4T 2LQKA 1TXQA 3E19A 2A0FB 4JZ4A 3RNJA 1H641 3X28B 3HL8A 1AHJB 4GLKA 4RMOA 1D0XA 4C92D 1XNIA 2X3WD 3I56T 7AT1B 2A08A 3M56A 3P8DA 2YWWA 1S72Q 3NMZC 3FRNA 3RKYA 2NUTB 4M4ZA 1GCPA 2QTXA 2DBMA 2LZ6B 1UHFA 1YHQT 2MMPA 2VC8A 1N9SA 2FO0A 4OGEA 1RADB 1AZEA 2LJ3A 5KE2A 4MDXA 4XU3A 1V1CA 5FRMA 3CXCS 2M16A 5FLXE 2RQWA 2Y4YA 2O9VA 2B8AA 4FL6A 5GAN3 2DVEA 4M78D 3VS4A 3C4SA 4PFZA 4OMNA 1KD1R 1ZLMA 3CCRA 1M3AA 6AT1B 2HD0A 1C6VX 4LE9A 5HY6A 2YRCA 3OYFA 3M0UA 2DEQA 2ZZDA 4K11A 4AG2C 1Q86U 1UE9A 2EQJA 2F69A 1WZOA 2LCSA 3ZL7C 1HD3A 5I2SA 3QZ5B 2LCLA 4KH1B 2EYQA 4C5EA 2VGNA 1W2BS 2MAMA 3MPUB 1YJNQ 1UDLA 3CCRT 3GIBA 1K9AA 3V7RA 2G6FX 1RAFB 1HJDA 3I55A 4BI8B 1ARKA 3OYEA 1SEMA 1GFDA 4DOWA 3C0CA 2E4HA 2YUOA 1PC0A 4BY6B 2NWMA 1D3BA 4J5YA 4B9XA 3CD6A 4PJOE 3BW1A 3J7AF 3MP6A 2CP3A 1KC8C 1VA7A 4M7AC 1AVZC 4LD6A 3URGA 2QGGA 1WDXA 2YRDA 1WQ7A 4XU0A 2RHIA 3CBPA 1QWEA 1TU0B 1TTHB 2OI3A 4JJBA 2V26A 1WNLA 3M59A 3EHQA 4IIOA 4DBQA 1RAEB 2X9HA 3EG3A 4J8OA 4ZN3A 2H3EB 3A8OB 5HK0A 2LX7A 2P84A 1YJ9A 2OTJQ 2L8DA 1Q7YR 1X6GA 1D1AA 3CEYA 1BCOA 2DL4A 3CCQT 2GGRA 3QKJA 5LJ5e 4IKFA 3PVLA 2BZXA 2E1HA 3CPWA 1BK2A 3CCUA 4KT0E 3C12A 3VUBA 4XK8E 2KXCA 1VQNT 2DTOA 1ZUUA 2LJ1A 4C8QB 3CCUQ 4M7DD 2DNUA 3INZA 1WYXA 5FRNA 5DLQE 4FW2A 4J9EA 4CC3A 3QIIA 5GAMg 2PZ1A 3OYCA 1LJOA 4Z88A 5J3BA 4PJOB 2FG0A 4FW1A 2XDDA 2RQTA 2RJDA 3VS1A 1YI2T 4BD3A 2VVKA 3I5RA 5LJ3j 4L59A 3A98A 4EMKB 4M7DA 4F7UE 4RTYA 3L2UA 1PSFA 2EVRA 1JJ2A 3OYNA 1G3SA 1R0BG 2EJGA 2L3QA 1O9SA 1YJWQ 3OW2S 1QMCA 2LQWA 2EJFA 3QYHB 2MWOA 4C8QF 2X51A 3OW2P 4PJOC 2A7YA 2LNHB 1RAGB 4C92F 2VKNA 1WXBA 2P0KA 4QQ6A 2QI2A 1PG5B 1QLYA 4NL2A 4M75G 4AFUC 2YDLA 3CCEA 4IUVA 4FIBA 4HVVA 2COWA 4IIMA 1U8RA 4M7AE 5M9OA 1K8AC 4KH0B 4XQ3A 2E65A 2ED1A 4ORZA 1PRLC 2BZ8A 4MZPA 3VYGA 4HXJA 1ZSGA 2YSQA 3QXEB 2QK0A 4C8QE 3OYAA 3CCLQ 1M1GA 3CMEQ 4NOYA 3KXTA 4M7AA 4AG1C 4N0AA 2MK5A 4YTLA 1ZSZB 1JQQA 2HEQA 4ZTJA 4M75C 2ZPEB 4PL6A 3EFOB 1WJQA 5GAOl 1W1FA 3PE0A 3MO8A 4JS5A 1VIEA 1VQ9A 3PNWC 3VYHB 3CC4Q 2QQAA 2NUTA 3HFNA 3VS6A 4PJOG 3G7ZA 4JRQA 2MF2A 2MYSA 4F16A 3MJXA 3SFMA 5HK3A 3LW5E 1YNZA 1M90U 2GTJA 2J6KA 3D7SB 2KRSA 2OAWA 1YJNA 2D6FA 1IGUA 1IXDA 5GJVB 1PKSA 4M78B 2DVJA 1AT1B 4PFPA 1VQ9T 1WHGA 2BIVA 4LNPA 3PMTA 2E70A 3FB9A 1JXOA 5FU6C 3KFVA 3H6ZA 3OYJA 2RJCA 4JS4A 1YJWT 5GAMj 2DD5A 5DY9A 5A0GA 2X4YA 4FSXA 4OGCA 3NTIA 2P4TA 5I21A 4F17A 2DX1A 3UDCA 4ESRA 4ELZC 3OYYA 2RHXA 3HHTB 2DJQA 1WGSA 1Y96B 2RQRA 1SG5A 2ZAEA 4ZGDB 4HKEA 2EQKA 4EMKC 1VQOQ 1M1KR 4PLIA 4DQ2A 4QVDA 2AHJB 4JRIA 3RMSA 3TVTA 3NHNA 3H0IA 3JCMe 1VQNQ 1B34A 2CYZB 4N4HA 3KUFA 2GCXA 2OJ2A 4JRKA 2D1XA 3JCMc 4AFQC 2QTVA 2J06A 3OYKA 2M0OA 2YLCA 1PCXA 4OMLA 5KE3A 2MIOA 1MMDA 3CCLT 3I56A 3J80E 3OY9A 2FVUA 4C5IA 4M7DG 5GANe 5A2QE 1VQPT 3EFSA 2RH2A 3TSWA 1HK9A 2PUOB 1WQWA 3JCMX 4M77B 3WVDB 5GAN2 4E7SA 4M7DB 2DRKA 3M4YA 2RF0A 4DEXA 1W6XA 1OU8A 2HBPA 2QQBA 1AWWA 2FRYA 3OYIA 2ROTA 2DKGA 3CC4T 3OS0A 4ZN1A 3GF5A 1RAHB 4J7FA 2ZGWA 3JB9D 3BFMA 2FPEA 2VUBA 2ECZA 1NG2A 1N6AA 1MV3A 2ZPIB 2QA4Q 5ECAA 4CI0C 3LWHA 1VQPA 3OA6A 1KG1A 2WSCE 3EG9A 3S6WA 4NS5A 3QO3A 2FRWA 2EPDA 3TCJA 2C0TA 1EX4A 1TUDA 2CH4A 2RK2A 5KH6A 1BI2A 3DLMA 3JRZA 3KBGA 3GNGA 5CKBA 2LJ0A 4QVCA 1E6HA 3X20B 1RUWA 2KROA 5FU7C 3LWIA 4F04B 3OMGA 2HMAA 3A8LB 4FYVB 2CS7A 3CPWS 1VQLA 4M77E 2ED0A 1TUGB 2AIRB 5LJ3d 5GAN4 2DTIA 1ZHIA 5CQYA 4M7DC 4ME7A 1M3BA 2E6ZA 4EMKA 4RTTA 3CC4A 4A53A 1CKAA 3A8MB 1AWOA 3UATA 4A4FA 3G6EQ 3CCRQ 1TOVA 1IO6A 3CC7Q 3DB3A 2ZPFB 5IAYA 1BBZA 3G71Q 1GL5A 1UJYA 3HRTA 1QCNA 1GRIA 5FROA 1JU5C 2R58A 3M4GA 2HZYA 1KJWA 1IREB 4EIKA 1OOTA 2FB7A 4WTOB 1H3ZA 5I2MA 2KVQG 3VS5A 1Q86R 1M3CA 3OMCA 3L2RA 2EBPA 1XQHA 3M55A 5I22A 1X01A 3JB9I 2E5KA 2DM1A 2RMOA 4FM4B 4EPCA 2LVMA 4M7AB 1QCFA 1ABQA 1UGRB 3PIPA 4BDZA 1UUEA 2DD4A 1I1JA 4FYYB 4LXCA 5LJ5d 5LJ3f 2J6OA 2L2PA 4IUQA 3CCLA 1VQMA 1T3LA 1K4US 3CMEA 3I55Q 3PGGA 2RPNA 4PJNA 5CVIA 1K1ZA 3SDZA 4JJDA 1IHWA 4OMOA 2YT6A 1XOVA 4RTUA 3QWXX 2F1LA 5GAOn 1WX6A 1JRIA 2OTJT 1GFCA 4J9DA 2CP2A 5IH2A 1LVKA 3FJPA 2M0YA 2M51A 5GAOp 4M7AF 1MNDA 1S1NA 5LJ5j 1I5OB 2BZYA 4KBMB 4BI3A 4A4KA 4HCBA 3FEOA 4DOVA 1E7OA 2K57A 3CCQQ 2F5KA 2JNGA 4XTVA 3P8HA 1VYVA 5GAOm 4O6JA 2CP6A 1QCOA 3ME9A 1OYXA 4LUEA 5AYFA 2DMOA 4C0FA 3O8VA 3EFOA 4Y92A 1O75A 1YI2Q 4BB7A 2ESWA 2C0OA 2EKHA 8AT1B 2BTTA 2LNVA 1GCQA 1M2OA 4LDWA 4ATOA 1PRMC 4C8QD 4Z8AA 2DE0X 4HVUA 1Q81R 1VQMT 3CCJQ 1Q86C 1VQ4A 2DXTA 1IZ6A 2O4XB 3CMET 1QVGP 2E41A 3CMAT 3OS1A 3OBYA 3V8LA 2KSSA 5FWBA 4DA4A 1QWFA 4PJMA 2AZVA 2AKKA 2JN0A 3CCET 2FHDA 1WHHA 1FYNA 2Z0WA 4BI4A 1KSWA 3FIFA 2RA2A 3OS5A 1WIEA 4XU1A 1AEYA 4OMFB 2LX9A 2RQVA 2EFIA 4C8QG 1NJIR 1U06A 2MWPA 1FXXA 2CGHA 1BCMA 3REBB 2CZ1B 3VS3A 4XTYA 1NJIU 5GANf 1GCQC 2KR3A 1YWOA 1U1TA 3HKSA 1Q7YU 1WHKA 3EH2A 1Q7YC 5FU7B 3CCST 3E9FA 3V7CA 4BE0A 5GAN5 1KQSS 3I55T 1W4SA 2KEAA 1YP5A 3EH1A 2WSEE 2QEXA 4M7AG 1SHFA 3RMQA 5HKCA 5D6YA 4JJCA 1D1BA 2E64A 2HCKA 1VQ4T 1YITQ 2JOYA 3J81E 5D6XA 3L42A 3QDRB 5IN1A 3ZEHA 3CCMA 2PNIA 2I2LA 3MCAB 4QT7A 3THKA 3SWNA 3NTKA 4N4IA 1GBQA 2RI5A 1OEBA 1MHNA 4LDUA 1ZBXA 2XDBA 5C0MA 1VQ5Q 5IHKA 3PFSA 1TUCA 3JCMV 3G4ST 3JSCA 2IVWA 4BDYA 4PKCC 3CC2A 1X6BA 2JZ2A 4KRTA 1W2BA 1NEGA 4DBHA 4GLMA 1YIJT 3OBWA 1QW1A 3CPWP 4MDWA 2EAYA 2QG9B 1AZGB 3VV0A 2BUDA 2EIFA 2RJEA 1HXDA 1YN8A 3G1JA 4JLIA 2HAXA 1YJ9Q 2H8HA 3CQTA 5LL6S 4RTXA 2KY9A 4E7IA 4M78G 1MUZA 2KK4A 1YHQQ 2C0IA 2CSQA 1KQ1A 3GLXA 1G5VA 4E7ZA 3HRUA 1Y71A 4RG2A 1JB0E 5IXFA 4LDXA 4PJOA 3E1SA 2MI6A 3L2VA 1ZUKA 2K7AA 3CBOA 1D3BB 4JZ3A 3EG0A 2X4WA 3CXCA 1X75C 1VQ5A 1RI0A 5L8RE 2V8KA 3H0FA 2HQHA 3VS0A 1VQ9Q 3T9NA 1M4ZA 4C8QA 2OTLA 1NPPA 1ZSZC 4OF1A 1OZ2A 1RACB 2XU8A 2ABLA 3FLGA 1D0YA 1T3SA 4M7AD 3GOXA 2CT4A 4TVRA 1YIJA 1NEBA 5AT1B 5GMKe 1RLPC 4WF2A 2DL8A 2LC4A 3CPFA 4D8KA 3ULRB 4XTUA 3VS7A 3QPHA 1M1KU 1WJSA 3OYGA 1K73U 4UC4A 4XTWA 2EJ9A 1Z9QA 1X6OA 3JV3A 3O5ZA 1VQ4Q 3R6NA 1M2VB 1K73R 1NJIC 3SD4A 1R8OB 1YITT 2OTLT 4CC7A 1NLOC 1TWBA 2DXCA 1G2BA 5GMKm 4PFOA 3A1PA 2J05A 2JUFA 1M9SA 3OYMA 2FL7A 1VQ5T 1BIBA 1M90C 4OMQA 2QXFA 4M77C 1OQKA 2DXBA 2K5FA 1G3TA 4Y28E 3G6ET 1R77A 4F7UB 2BE9B 2FPDA 4F14A 2GFUA 2EGCA 1FWZA 4BUGA 1PSEA 2LCCA 5GANg 2HKQB 1HYOA 1KQSP 2RO0A 3JCMf 1YWPA 3L1AA 3G4SQ 1UECA 1AD5A 5CR2A 3HFOA 1KQ2A 1B7TA 3S3OA 2O9SA 2M9UA 4M78E 2KYMA 2QAZA 2JTMA 2YUQA 2XMFA 1BI3A 2DIQA 1SRLA 1Y0MA 1VQPQ 5CQXA 1VQ7A 4M78A 4DBFA 2A37A 3ZBDA 3Q1JA 2DBKA 1D0ZA 2D0QB 2DYBA 2HL5C 5KYYB 1G83A 3VU3C 1X2QA 2QQSA 4FT4A 1VQ8A 1U3OA 2GNCA 5CIUA 2X4XA 2LRQA 4P5NA 5FWCA 4OB1B 4ELYC 1VQKT 3UA6A 1FX7A 2KRNA 2CUBA 1JEGA 2O2OA 2D8HA 4C0ZA 2LQNA 2RJFA 3QUIA 1N27A 1Y57A 4HA8A 3JCMQ 1G3WA 1NZ9A 4VUBA 2K2MA 3PIOA 4J9HA 2JVVA 2KGTA 1N8RR 3JCMd 1UGPB 2J6FA 4A4HA 2XG8D 3C95A 1KFZA 3M0PA 3OB9A 4RTWA 2EYWA 2WSFE 2YRVA 4C92B 3IQLA 4OVAA 1YCSB 2EWNA 2GQIA 1H92A 5KCOA 1WHMA 4J7IA 1VQKA 3RESA 1JXMA 3SHWA 1QVFA 1NYGA 1ZA1B 2CSIA 1VQ6Q 1ZUYA 1NE8A 2VASA 4J9FA 3PMIA 1VQLT 4OP0A 1N5ZA 1T0HA 5LJ5h 1PWTA 3M58A 3RUXA 3UF4A 5LJ3h 5DLOA 3E2UA 2DL7A 5D7UA 2H3JA 3M53A 5IT9E 2V1RA 4BACA 2K3XA 3M5AA 2PTKA 1FMWA 3CCVA 2RB6A 3M9QA 1D1CA 1K9MU 2L89A 1TS9A 2JS2A 1I0CA 1Q82U 1X43A 2A28A 1LCKA 2O01E 4PJLA 3V8JA 1EFNA 1QVFS 2KQWA 1K0XA 4L6V5 2DPPB 1U5SA 1GBRA 3OYLA 2RHYA 3MEAA 5C6SA 4C92G 4AFZC 2ROLA 3JCMg 1RLQC 1WJRA 4E7JA 3OYBA 2F2XA 1MGQA 3EG1A 2P0PA 3V8KA 2XDPA 4C5GA 4JJNK 1C0MA 3CCVT 1H8KA 1A0NB 2DYIA 4C0GA 3CD6T 2CP7A 4B9WA 1XTDA 3TQ7P 1VQNA 2OTLQ 2NUZA 2A36A 3AT1B 1WA7A 1OU9A 4R55A 4C0DB 2JTFA 3SB2A 4AT1B 4L5GA 3MEVA 1BKBA 4M77A 3MP8A 2W10A 1MMNA 2K3YA 1KK7A 3NPFA 2XI9A 2VXFA 1RAIB 3AHUA 3H0HA 2SEMA 3GPLA 4J9CA 4JUVA 2DL5A 2Y90A 4J9GA 1I4K1 2XD0A 2PVOB 1JO8A 2ENMA 5IXBA 1JJ2S 1KIKA 3VUZA 4OMPA 3VRYA 4RCCA 4IUUA 3CCEQ 2RHUA 3EAEA 1IGQA 3ASKA 2XK0A 2VB6A 1LPLA 4E2FB 4M75D 2VYTA 4EMGA 1D09B 3OSVA 2HL3A 1QP2A 3HTRA 3QG1A 2EGAA 1MMGA 3EG2A 2YHTA 5KYNA 2DETA 3JB9F 2DLPA 3A8HB 1B34B 3M57A 2RNAA 1P92A 3QWYA 2CREA 4ZGEB 3UWNA 2KAFA 2DO3A 2QEXT 1I8FA 3CCSQ 2K5LA 3DLLA 2CP5A 2SRCA 2CZ0B 1RABB 3I5SA 2KI7A 3CMAA 4FCYA 3G4SA 4KGVB 2RI2A 2EQUA 2O4XA 4X34A 1KD1C 1YI2A 3EGUA 2LQ8A 1IHVA 1VIFA 4HCZA 2HSPA 3EGDB 5GAOq 4ANJA 2AKLA 4F7UF 2K5IA 1U1SA 5DM7R 1RL2A 3RKWA 1T0JA 2MCNA 2XHCA 3OYHA 3UT1A 2RI3A 2QGFB 4QQDA 3EGXB 5A0LA 1WPYA 1AOJA 2CKKA 1PD1A 2DEUA 1NLPC 4FYWB 4DBRA 1Q81U 4M75E 3OYDA 2DZCA 2EQIA 4DEYA 1NPRA 4XTZA 1OV3A 1C1AA 4D6WA 4C8QC 5CK9A 1JJ2P 1VQ6T 3QJ6A 3LX7A 4HT8A 4J6YA 4ZTFA 5D6WA 1K9MC 1SKUB 2VXEA 5GMKi 2YXYA 1VOMA 3CCMQ 2PUKB 3DKMA 3L2WA 5KYYA 3JCMJ 3V7SA 5GANj 2E12A 2CZ7B 3UPUA 5EG2A 3VJPA 2EQMA 4RTZA 3TU4K 4Q5WA 2X35A 3EGXA 3BDUA 2FZGB 4M77G 1SPKA 2O31A 3GP8A 2JM9A 2L0AA 1SRMA 4HVWA 1VQ6A 4M75A 3I9QA 3JCMW 2F2VA 1OPLA 4HCCA 1QKXA 2KBTA 4M7DE 1OPKA 4MMKA 3S3NA 5GAMh 3LH0A 1IB8A 3H9NA 1K8AU 3CC7T 5J39A 3META 4B6MA 2EYXA 3CC2T 1Y96A 5GMKh 3FJ5A 4C92E 3L2QA 4C92A 1YCYA 2NUPA 4J6WA 2HQXA 5KYUA 3N5BB 3BY7A 4PK4A 2JW4A 2JT4A 2XICA 1MNEA 2KRMA 2X4JA 3M0SA 4R56A 3LGLA 3CD6Q 4MMLA 3G6EA 4C0DC 4C5HA 4F7UG 2HDAA 4Y91A 3E9GA 3QZ9B 1UHCA 2DILA 1FMVA 4XU2A 1X69A 4KGZB 2MPXC 2LT4A 5LJ5f 1ZBJA 2HQEA 1PNJA 4KUDK 3QDFA 4GBQA 5EC7A 3RKXA 1VYTA
chains in the Genus database with same CATH topology
3RMSA 4WF2A 2OAUA 3JCMe 3LLRA 1Y7XA 1B34A 2CYZB 2LC4A 3CPFA 4LDVA 4N4HA 3KUFA 4F7UA 2GCXA 4XTUA 1M1KU 3QPHA 1WJSA 3MEUA 3OYGA 5CKHA 1K73U 4UC4A 4XTWA 4JRKA 2E5QA 2EJ9A 5CKEA 4MZTA 1V29B 1X6OA 2QA4A 3JCMc 1NJIC 3SD4A 3OQ5A 2K2VA 4QVDA 1R8OB 1YITT 2OTLT 3OYKA 3HRSA 2M0OA 2YLCA 2DXCA 5GMKj 2GFAA 5KE3A 3ER0A 5GMKm 4M75F 2K4YA 2KMTA 2JUFA 4M78C 2M1HA 1G3YA 1M9SA 3OW2A 4KULA 3OYMA 2FL7A 5GMKe 3CCLT 3I56A 3J80E 1OI1A 4J6XA 3RIRA 4OB2B 1VQ5T 1BIBA 1UEBA 3OY9A 2CZ6B 2FVUA 1QVPA 2QXFA 3QJYA 4C5IA 5GANe 4LDYA 5CKDA 1ZQ1A 1QP3A 2RH2A 3EFSA 2DXBA 2K5FA 3H8ZA 1G3TA 4M77C 4Y28E 3G6ET 1HK9A 1SSFA 1WQWA 2ZPGB 2HNIA 2WACA 2PUOB 4M77B 4X9DA 3WVDB 4F7UB 3JCMX 5GAMd 1TH7A 5GAN2 1VQ7T 4M7DB 2GFUA 3M4YA 2ZPHB 2R5AA 1FWZA 2LTOA 1PSEA 2LCCA 4BUGA 1UGSB 5GANg 3RERA 2A3LA 2HBPA 2R57A 2DIGA 1YBYA 2RO0A 2QQBA 4RKUE 3L1AA 3JCMf 2QA4T 4LD9K 3QSUA 5CR2A 3OYIA 1VUBA 3HFOA 1KQ2A 2DAQA 2DKGA 2LQKA 3CC4T 3S3OA 3E19A 3OS0A 4ZN1A 2M9UA 4M7DG 3GF5A 1H641 4M78E 4BY6C 3X28B 1UB4A 3HL8A 3TEEA 1AHJB 1EIFA 4J7FA 2JTMA 5A2QE 2ZGWA 1BI3A 2DIQA 3BFMA 2LDMA 2VUBA 3JB9D 4Z02A 1N6AA 4GLKA 4RMOA 5CQXA 4C92D 1XNIA 2IG0A 2ZPIB 4XAXB 1VQ7A 3I56T 2R5MA 3MP1A 4M78A 4EMHA 3M56A 3ZBDA 3P8DA 3Q1JA 4DQ2A 4CI0C 3FRNA 3LWHA 1VQPA 3OA6A 3RKYA 2D0QB 2WSCE 1KG1A 2VV5A 3S6WA 4NS5A 3A8GB 3QO3A 3VU3C 5GAN6 2QQSA 4FT4A 2QTXA 3JAME 5GAOr 1VQ8A 5CIUA 2X4XA 3TCJA 2LRQA 4QQGA 4P5NA 4CRIA 1YHQT 4OB1B 4ELYC 1VQKT 1FX7A 2MMPA 2VC8A 2RK2A 4C0ZA 1N9SA 2RJFA 3QUIA 5KH6A 5KCHA 1N27A 1BI2A 3DLMA 4OGEA 3JRZA 3KBGA 4HA8A 4E7KA 3GNGA 5KE2A 5CKBA 3JCMQ 3MHXA 4MDXA 1G3WA 1NZ9A 4VUBA 4IUTA 4QVCA 3X20B 3PIOA 4XU3A 4M75B 2JVVA 5GAMe 5FU7C 3JCMd 3LWIA 1UGPB 5FRMA 3CXCS 2M16A 4A4HA 2XG8D 3C95A 3OMGA 5FLXE 3A8LB 3HPWA 1N8RC 2Y4YA 2CS7A 3OB9A 3CPWS 3JB9J 2WSFE 1N8RU 1Y07A 2B8AA 2YRVA 4FL6A 5GAN3 4C92B 3CCJT 1VQLA 2DVEA 4OVAA 1KD1U 4PJOD 1M8VA 4M78D 3X26B 4M77E 2EWNA 5LJ3d 1VQPT 3C4SA 5KCOA 1KHIA 5GAN4 3CCRA 2DTIA 1ZHIA 3PT9A 5CQYA 4ME7A 4M7DC 4MZMA 4J7IA 2E6ZA 4EMKA 1M5Q1 4HT9A 2HD0A 1VQKA 3RESA 3ZFJA 5LJ5g 5GMKl 4QW2A 3CC4A 4A53A 1OZ3A 3F70A 3A8MB 5HY6A 4A4FA 1I5LA 1QVFA 3DB3A 2ZPFB 5IAYA 4N4GA 1KQSA 3OYFA 3HRTA 5FROA 2DTHA 2R58A 2ZZDA 2DEQA 3M4GA 1IREB 1NE8A 3DB4A 1Q86U 3PMIA 2DK3A 3EFRA 2EQJA 4M77D 4A4EA 1VQLT 2F69A 2FB7A 4OP0A 5LJ5h 3M58A 3RUXA 5I2MA 3SWNC 5I2SA 1H3ZA 2KVQG 5LJ3h 5DLOA 3QYGB 3QZ5B 2LCLA 3OMCA 4PNOA 3SWNB 3L2RA 1XQHA 2EYQA 3M55A 1X01A 2H3JA 3M53A 4C5EA 3JB9I 2QQ9A 2VGNA 1W2BS 5IT9E 4E7LA 4FM4B 4BACA 2K3XA 3M5AA 2MAMA 2G3RA 4EPCA 2LVMA 4M7AB 1YHQA 1UGRB 1YITA 3PIPA 2L3RA 3CCVA 4BDZA 2RB6A 3CCRT 3M9QA 3GIBA 2OTJA 3V7RA 2DD4A 2GQVA 2L89A 1K9MU 4RCBA 3I55A 4BI8B 4JJNK 5LJ5d 3OYEA 5LJ3f 4DOWA 1Q82U 4IUQA 3CCLA 1VQMA 2O01E 3V8JA 4BY6B 1QVFS 3CMEA 1D3BA 2KQWA 3PGGA 2PQWA 4J5YA 4L6V5 4B9XA 5CVIA 3CD6A 4PJOE 2DPPB 2YLBA 3BW1A 3J7AF 3MP6A 4KUIA 3OYLA 3SDZA 2RHYA 3CCJA 1XOVA 3MEAA 1KC8C 5C6SA 5GAOn 1JRIA 4C92G 1KC8U 4M7AC 2OTJT 3JCMg 1BI1A 4LD6A 1YJ9T 1WJRA 4E7JA 2QQRA 3URGA 3OYBA 3FJPA 4QVZA 1MGQA 3GNFB 2P0PA 3R6OA 2XDPA 3V8KA 4C5GA 5GANd 5GAOp 1WQ7A 4IURA 4XU0A 2RHIA 3CBPA 5LJ5j 3CCVT 4KBMB 4BI3A 4A4KA 1I81A 4HCBA 1WNLA 2ZCFB 3FEOA 5FU6B 3M59A 4DOVA 2K57A 4C0GA 4ZGJB 2F5KA 2D9TA 3CD6T 4J8OA 4ZN3A 4BE1A 2V8IA 4M7AF 4B9WA 1XTDA 2JNGA 4XTVA 1VQNA 3P8HA 5GAOm 3A8OB 4BE2A 4R55A 4M78F 4O6JA 4C0DB 5HK0A 1QVGA 3ME9A 2JTFA 1OYXA 5CO7A 3SB2A 4L5GA 3MEVA 1BKBA 3MEWA 4II1A 4M77A 1YJ9A 3MP8A 2L8DA 5AYFA 3VKIA 5A0DA 2K3YA 4C0FA 2XI9A 1VQ8T 3O8VA 2VXFA 3CEYA 5GAMf 2L5QA 3AHUA 3CCQT 4X9CA 3QKJA 5LJ5e 3GPLA 4IKFA 4JUVA 1O75A 2Y90A 4BB7A 3S3MA 2E1HA 3CPWA 1I4K1 1JBMA 2XD0A 2PVOB 2LT1A 3CCUA 1JJ2S 4KT0E 3VUZA 3C12A 2QDYB 5LJ3e 2LNVA 3VUBA 1S72A 4LDWA 4ATOA 4RCCA 4XK8E 1UGQB 4IUUA 4C8QD 5CCAA 1VQNT 2DTOA 4C8QB 2RHUA 3EAEA 3ASKA 2XK0A 2EKOA 4M7DD 1VQMT 1Q86C 3INZA 1VQ4A 4M75D 2RK1A 5FRNA 2DXTA 1IZ6A 2O4XB 2VYTA 5DLQE 4EMGA 3CMET 3OSVA 1YJNT 4NL3A 2E41A 1QP2A 3CMAT 3OS1A 3OBYA 3V8LA 3QG1A 3QIIA 2KSSA 5GAMg 3OYCA 2YHTA 1LJOA 4DA4A 5J3BA 4PJOB 2XDDA 3JB9F 2RJDA 2JN0A 5GAN7 3JB9G 2RHZA 3A8HB 2PVGB 4OB0B 1B34B 2FHDA 3M57A 4A4GA 4BD3A 1YI2T 3CCET 1P92A 5LJ3j 4V2SA 2DJZA 4L59A 4BI4A 4ZGEB 3UWNA 1YJWA 4EMKB 2KAFA 2DO3A 4M7DA 4RG8A 4F7UE 3FIFA 2QEXT 1I8FA 2RA2A 3L2UA 1PSFA 2K5LA 3DLLA 3OS5A 3CCUT 1JJ2A 3OYNA 1G3SA 2CZ0B 2EJGA 4XU1A 3G71T 1VQOA 1O9SA 3OW2S 4OMFB 3CMAA 2VGMA 2EJFA 3QYHB 1N9RA 2LX9A 2MWOA 4C8QF 2EFIA 3TREA 4C8QG 3G4SA 2RI2A 4JDSA 4E7HA 2EQUA 2MWPA 3P8BB 1FXXA 2E6NA 3CCQA 4PJOC 2CGHA 2O4XA 4X34A 1KD1C 2A7YA 2CZ1B 1YI2A 1M90C 4GY5A 4XTYA 4C92F 1NJIU 2PVDB 5GANf 2LQ8A 2P0KA 4QQ6A 2QI2A 1U1TA 3HKSA 1M1FA 3X24B 5LJ3g 4PJOF 4NL2A 1Q7YU 1VIFA 4M75G 1Q7YC 3CCEA 4HCZA 4IUVA 3NTHA 4FIBA 5GAOq 1QVGS 5FU7B 3CCST 3E9FA 4F7UF 3V7CA 4BE0A 2FYKA 3QBYA 2P0QA 5GAN5 5M9OA 2K5IA 1U1SA 5DM7R 1U8RA 1KQSS 3HSBA 4M7AE 1LOJA 1RL2A 2NLUA 3I55T 3RKWA 3FDRA 1W4SA 3NFCA 2XHCA 3OYHA 3UT1A 1K8AC 2RI3A 2WSEE 2QEXA 4XQ3A 4C92C 2E65A 4QQDA 4M7AG 3WVEB 3RMQA 5HKCA 5D6YA 5A0LA 3CBMA 2E64A 4MZPA 1WPYA 3OS2A 3VYGA 2CKKA 1VQ4T 3X25B 1Q81U 4M75E 4JRPA 3OYDA 2DZCA 4IUPA 1NPRA 4FU6A 3L2ZA 4XTZA 2JOYA 3J81E 5D6XA 3JB9H 3L42A 3QDRB 5IN1A 4D6WA 4C8QC 3ZEHA 5CK9A 3CCMA 1VQ6T 3QJ6A 2I2LA 3QXEB 3LX7A 3MCAB 3CCSA 4C8QE 4HT8A 4J6YA 4ZTFA 5D6WA 3OYAA 2VXEA 2BKDN 3NTKA 4N4IA 3SWNA 3A5ZB 2RI5A 4J83A 5GMKi 2ZPBB 1M1GA 1MHNA 4LDUA 2PUKB 3DKMA 3L2WA 1ZBXA 2XDBA 4NOYA 4JLGA 3KXTA 4M7AA 3JCMJ 3V7SA 5C0MA 4OB3B 5GANj 3HP9A 4N0AA 4YTLA 2E12A 2CZ7B 4O5VA 3CC7A 4EDUA 3UPUA 5EG2A 3G71A 5GANh 4ZTJA 1VQOT 2XKOC 4M75C 2ZPEB 4PL6A 3VJPA 2EQMA 1WJQA 2GF7A 3PFSA 5GAOl 3TU4K 2C06A 4Q5WA 2X35A 3MO8A 3JCMV 4XTXA 3G4ST 3JSCA 4JS5A 2IVWA 1VIEA 4BDYA 3CCMT 1VQ9A 3PNWC 3BDUA 4PKCC 3VYHB 3CC2A 2JZ2A 2QQAA 4M77G 3HFNA 4M77F 1W2BA 3FC3A 2F5TX 3PTAA 3GP8A 3C94A 5CKFA 2DXUA 1YIJT 3OBWA 1QW1A 4PJOG 3G7ZA 1VQ6A 2PU9B 4M75A 4JRQA 4MDWA 5CAIA 3LYIA 1KHCA 2EAYA 3JCMW 1M1KC 4HCCA 2MF2A 3VV0A 2BUDA 2EIFA 3JCMh 2RJEA 1HXDA 3QHSA 4M7DE 3SFMA 1S72T 4MMKA 5J26A 5HK3A 1K73C 1Q81C 3LW5E 2DZ9A 3BDLA 4JLIA 3S3NA 5GAMh 3M54A 3LH0A 1M90U 2HAXA 1K8AU 5LL6S 3CC7T 2KY9A 5J39A 4PLLA 4E7IA 4M78G 3META 3CC2T 2KK4A 1YJNA 1Y96A 5GMKh 2D6FA 4C92E 3L2QA 4C92A 1KQ1A 1YCYA 3OSSC 4J6WA 2HQXA 4M78B 3N5BB 2RM4A 3GLXA 3BY7A 1G5VA 3HRUA 3JCMb 1VQ9T 1Y71A 4RG2A 2XICA 1JB0E 1K9MC 4LDXA 3E1SA 2MI6A 3L2VA 4PJOA 2BIVA 3PMTA 2E70A 2X4JA 3CBOA 1D3BB 1LNXA 3FB9A 5FU6C 1GXIE 3H6ZA 2X4WA 3CXCA 2XIDA 1X75C 5GAN8 2RJCA 3OYJA 4JS4A 1YJWT 1VQ5A 3WXMB 5GAMj 1RI0A 3LGLA 5L8RE 4R56A 4M7DF 2DD5A 4MMLA 5DY9A 5A0GA 3G6EA 4C0DC 2V8KA 2X4YA 4C5HA 4FSXA 3JCMP 4OGCA 4F7UG 2Y4XA 3NTIA 2P4TA 4A54A 3T9NA 5I21A 4Y91A 3E9GA 3QZ9B 1M4ZA 3UDCA 1DJ7B 2V8JA 4ELZC 4N0AC 4C8QA 2OTLA 1NPPA 4XU2A 3OYYA 2RHXA 3HHTB 3LGFA 1WGSA 1OZ2A 4OF1A 2XU8A 2RD1A 1BYMA 1Y96B 3FLGA 4E47A 1BIAA 2LT4A 5LJ5f 4ZGDB 2HQEA 4FT2A 4HKEA 3GOXA 4M7AD 2EQKA 2KDSA 1BI0A 4KUDK 4TVRA 4EMKC 1YIJA 1Q82C 2E10A 4PLIA 3RKXA 2AHJB 4JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2L A;  4M77 A;  4WF2 A;  4C8Q E;  3JCM e;  4J6Y A;  4HT8 A;  3JB9 J;  2VXE A;  1B34 A;  3SWN A;  4F7U A;  5GMK i;  5GAN 3;  4C92 B;  2VXF A;  4XTU A;  2DVE A;  5GAM f;  4PJO D;  3AHU A;  1M8V A;  4M78 D;  4X9C A;  5LJ5 e;  4M77 E;  4JUV A;  2Y90 A;  4NOY A;  4M7A A;  2EWN A;  4XTW A;  4JRK A;  5LJ3 d;  2E1H A;  3V7S A;  1I4K 1;  3JCM J;  1JBM A;  2EJ9 A;  4N0A A;  5GAN 4;  2DTI A;  4M7D C;  4EMK A;  3JCM c;  5LJ3 e;  4M75 C;  1M5Q 1;  5GAN h;  4HT9 A;  4RCC A;  3RES A;  5LJ5 g;  5GMK l;  4C8Q D;  5GAO l;  4A53 A;  2DTO A;  4C8Q B;  4QVD A;  1I5L A;  3JCM V;  4M7D D;  4XTX A;  2YLC A;  3INZ A;  5GMK j;  4M75 D;  2DXT A;  4EMG A;  5GMK m;  3BDU A;  4M75 F;  2DTH A;  4NL3 A;  2E41 A;  4M77 G;  2DEQ A;  3HFN A;  3M4G A;  4M78 C;  4M77 F;  3V8L A;  5GAM g;  4M77 D;  3EFR A;  2YHT A;  5GMK e;  1LJO A;  2DXU A;  2FB7 A;  4OP0 A;  4PJO B;  4PJO G;  4J6X A;  3RIR A;  5LJ5 h;  3JB9 F;  1BIB A;  4M75 A;  2JN0 A;  3RUX A;  3SWN C;  5GAN 7;  3JB9 G;  5LJ3 h;  5GAN e;  5CAI A;  4M7D G;  3EFS A;  2EAY A;  4M77 C;  1B34 B;  4PNO A;  3SWN B;  3JCM W;  1HK9 A;  1WQW A;  1X01 A;  2HNI A;  4X9D A;  4F7U B;  4M77 B;  3JCM h;  5LJ3 j;  3JCM X;  5GAM d;  3QHS A;  1HXD A;  1TH7 A;  2DJZ A;  5GAN 2;  4M7D B;  4M7D E;  4V2S A;  4MMK A;  4EMK B;  3RER A;  4M7D A;  2DZ9 A;  4M7A B;  4F7U E;  5GAN g;  3FIF A;  4JLI A;  5GAM h;  1I8F A;  2RA2 A;  2RB6 A;  3GIB A;  3V7R A;  3JCM f;  3L1A A;  2EJG A;  4M78 G;  4RCB A;  4XU1 A;  3QSU A;  5GAN j;  1Y96 A;  3HFO A;  5GMK h;  5LJ5 d;  1KQ2 A;  2DKG A;  5LJ3 f;  4C92 E;  2EJF A;  4C92 A;  1KQ1 A;  1N9R A;  1YCY A;  4J6W A;  4M78 B;  1H64 1;  4M78 E;  2RM4 A;  4C8Q F;  4C8Q G;  3BY7 A;  3JCM b;  3V8J A;  2ZGW A;  3JB9 D;  3BFM A;  4PJO A;  1D3B A;  2CGH A;  3PGG A;  4J5Y A;  4PJO C;  3FB9 A;  4XTY A;  1D3B B;  1LNX A;  4C92 F;  4PJO E;  2YLB A;  3BW1 A;  5GAN f;  4C92 D;  5GAN 8;  4M78 A;  4EMH A;  1U1T A;  5LJ3 g;  4PJO F;  4NL2 A;  4DQ2 A;  5GAM j;  4M75 G;  5GAO n;  4M7D F;  1JRI A;  3RKY A;  4MML A;  4C92 G;  5GAO q;  4M7A C;  5DY9 A;  3JCM g;  4F7U F;  3JCM P;  3V7C A;  2FYK A;  3QO3 A;  4F7U G;  5GAN 5;  4M7A E;  1U1S A;  3VU3 C;  5GAN 6;  3HSB A;  4A54 A;  1LOJ A;  2QTX A;  5I21 A;  3JB9 I;  5GAO r;  3RKW A;  4Y91 A;  3FJP A;  1MGQ A;  5GAN d;  5GAO p;  3V8K A;  4M7A F;  4XQ3 A;  1WQ7 A;  2E65 A;  4XU0 A;  4C92 C;  4M7A G;  2VC8 A;  5LJ5 j;  4N0A C;  1N9S A;  4C8Q A;  1I81 A;  1WNL A;  3QUI A;  4XU2 A;  2E64 A;  1WPY A;  2K57 A;  2RD1 A;  4HA8 A;  1Y96 B;  4M75 E;  2DZC A;  3JCM Q;  1BIA A;  4XTV A;  5LJ5 f;  4QVC A;  4M7A D;  4XU3 A;  4M75 B;  5GAO m;  3L2Z A;  4XTZ A;  3JB9 H;  5GAM e;  4M78 F;  4EMK C;  3JCM d;  4C8Q C;  3SB2 A;  2E10 A;  3RKX A;  4JRI A; 
#chains in the Genus database with same CATH topology
 2OAU A;  1Y7X A;  4LDV A;  2QYZ A;  3MEU A;  3H41 A;  4MZT A;  4QKU A;  4A63 B;  2FZK B;  3OQ5 A;  2K2V A;  2KT1 A;  3HRS A;  2GFA A;  1PD0 A;  4M75 F;  1CKB A;  2K4Y A;  2KMT A;  8ATC B;  1UFF A;  2JM8 A;  1G3Y A;  2QEX Q;  2FEI A;  2D8J A;  4OB2 B;  1WXU A;  4LDY A;  2ZPG B;  4X9D A;  1SF9 A;  2WAC A;  3I56 Q;  1X2K A;  3RER A;  5HCK A;  1UGS B;  2A3L A;  2DIG A;  1YBY A;  4RKU E;  1M8M A;  2CP0 A;  4LD9 K;  3QSU A;  2HKN A;  4J9I A;  1VUB A;  2DAQ A;  2LMJ A;  4BY6 C;  2J7I A;  4CC4 B;  1UB4 A;  3TEE A;  1EIF A;  2IPO B;  1UG1 A;  1VQ7 Q;  3CXC P;  2LDM A;  5GJW B;  4Z02 A;  1ZSZ A;  2DFU A;  2IG0 A;  2HSE B;  4XAX B;  1CSK A;  2R5M A;  3MP1 A;  4EMH A;  1WHJ A;  2VV5 A;  3A8G B;  5GAN 6;  5L23 A;  5GAO r;  3JAM E;  2FZC B;  4CRI A;  4QQG A;  2JTE A;  2YUP A;  1PHT A;  1VQ8 Q;  5KCH A;  4E7K A;  3MHX A;  4IUT A;  4M75 B;  1B3Q A;  2JXB A;  2JJ9 A;  5GAM e;  2KNB B;  1J3T A;  1W70 A;  2QDL A;  3M0R A;  3HPW A;  1N8R C;  3JB9 J;  1N8R U;  1Y07 A;  3CCJ T;  1KD1 U;  4CC2 A;  4PJO D;  1M8V A;  3X26 B;  5IHI A;  1VQK Q;  4JPB W;  2X3X D;  1AWJ A;  1KHI A;  1YFN A;  2QAS A;  2E3H A;  3PT9 A;  5IHN A;  4MZM A;  4WCI A;  2K3B A;  1M5Q 1;  4HT9 A;  1M27 C;  5LJ5 g;  3ZFJ A;  5GMK l;  4QW2 A;  1UTI A;  2IIM A;  1OZ3 A;  3F70 A;  3U23 A;  1I5L A;  5KYW A;  4N4G A;  1ACM B;  1F1B B;  1KQS A;  2D0N A;  2DTH A;  2P4R A;  3DB4 A;  4M77 D;  2DK3 A;  3EFR A;  4A4E A;  1BU1 A;  3SWN C;  3CC2 Q;  1WHL A;  4RTV A;  3QYG B;  3SWN B;  4PNO A;  1Q81 C;  2QQ9 A;  4E7L A;  2CDT A;  2G3R A;  1YHQ A;  1YIT A;  2L3R A;  2OTJ A;  3RR6 A;  1G8X A;  1PKT A;  2L3P A;  1VQM Q;  2GQV A;  4RCB A;  2NUP B;  5KYU B;  1K9M R;  2PQW A;  1Q82 R;  2COZ A;  2YLB A;  1KC8 R;  4KUI A;  3PVQ A;  2KE9 A;  3CCJ A;  2M02 A;  2CH4 W;  2F2W A;  1KC8 U;  1BI1 A;  4OMM A;  1TG0 A;  3GBQ A;  1YJ9 T;  2BE7 D;  2K6D A;  2KT8 A;  2QQR A;  4FYX B;  4QVZ A;  3R6O A;  3GNF B;  5GAN d;  3CCQ A;  1M2V A;  4ZNX A;  4IUR A;  1I81 A;  2B86 A;  2ZCF B;  1AWX A;  5FU6 B;  3I35 A;  2RN8 A;  2DER A;  4ZGJ B;  2D9T A;  4BE1 A;  2V8I A;  3VS2 A;  4BE2 A;  4M78 F;  1QVG A;  1QVF P;  5CO7 A;  4II1 A;  3MEW A;  3VKI A;  1WI7 A;  5A0D A;  2K79 A;  1VQ8 T;  1OX8 A;  5GAM f;  2L5Q A;  4X9C A;  2HBW A;  3S3M A;  1JBM A;  4X1V A;  2LT1 A;  4HCK A;  2QDY B;  5LJ3 e;  1S72 A;  1UGQ B;  5CCA A;  2AT1 B;  1QQJ A;  2EKO A;  2RK1 A;  1FMK A;  1YJN T;  4NL3 A;  4J9B A;  2JMA A;  1OX9 A;  4AMC A;  5KYX A;  5GAN 7;  3JB9 G;  2EGE A;  2AZS A;  3EGD A;  2RHZ A;  4OB0 B;  2PVG B;  4A4G A;  2OX7 A;  1B07 A;  4V2S A;  5I11 A;  2DJZ A;  1YJW A;  2DF6 A;  4RG8 A;  3CCU T;  3G71 T;  1VQO A;  4Z89 A;  2VGM A;  1PM3 A;  1N9R A;  1TSF A;  3RBB B;  3TRE A;  1BB9 A;  4JDS A;  4E7H A;  3P8B B;  2E6N A;  4LN2 A;  1ABO A;  4GY5 A;  1WLP B;  2PVD B;  3UA7 A;  1EZZ B;  2EYY A;  1M1F A;  3X24 B;  2MOX A;  4PJO F;  2AK5 A;  5LJ3 g;  3SEM A;  3NTH A;  1V76 A;  1QVG S;  2FYK A;  3QBY A;  2P0Q A;  4PJJ A;  3M0Q A;  4D8D A;  3HSB A;  1LOJ A;  2NLU A;  2W0Z A;  1ZX6 A;  3FDR A;  1Q95 G;  3NFC A;  1W2B P;  1H3H A;  4C92 C;  3WVE B;  1MV0 B;  1VYU A;  2O88 A;  3CBM A;  3OS2 A;  5KYW B;  3X25 B;  4JRP A;  2V1Q A;  4IUP A;  1IRX A;  4FU6 A;  3L2Z A;  3JB9 H;  2FPF A;  2YUN A;  2LP5 A;  3CCS A;  2BKD N;  3A5Z B;  4J83 A;  1R0C B;  2ZPB B;  1RAA B;  1NYF A;  4KGX B;  2CT3 A;  4JLG A;  1RI9 A;  1SSH A;  4OB3 B;  3HP9 A;  3EG9 B;  4O5V A;  3CC7 A;  4EDU A;  3G71 A;  5GAN h;  1VQO T;  2XKO C;  1Z9Z A;  2GF7 A;  3LH5 A;  2C06 A;  1SHG A;  4XTX A;  3CCM T;  2EW3 A;  4M77 F;  3FC3 A;  2F5T X;  2DL3 A;  3PTA A;  1X27 A;  3C94 A;  4R0K A;  2DXU A;  5CKF A;  2JS0 A;  2PU9 B;  5CAI A;  3LYI A;  1KHC A;  1WFW A;  1M1K C;  1M90 R;  3JCM h;  2COY A;  3QHS A;  1S72 T;  5J26 A;  1K73 C;  2DA9 A;  2DZ9 A;  2E3I A;  2KYB A;  3BDL A;  5FW9 A;  3M54 A;  4PLL A;  1OUL A;  2EYZ A;  3OSS C;  4FSS A;  2RM4 A;  1VQL Q;  3JCM b;  1LNX A;  3TSZ A;  1GXI E;  1WXT A;  2JMC A;  2XID A;  2GTO A;  5GAN 8;  2VWF A;  1XJW B;  2L3S A;  2ATC B;  3WXM B;  4M7D F;  3REA B;  1MMA A;  3JCM P;  2Y4X A;  1NBE B;  3NGP A;  4A54 A;  2K9G A;  1DJ7 B;  2V8J A;  2DRM A;  4N0A C;  3LGF A;  1ZA2 B;  2RD1 A;  1BYM A;  4E47 A;  1BIA A;  3VRZ A;  2NYS A;  4FT2 A;  2GBQ A;  5KYX B;  2KDS A;  1BI0 A;  1QKW A;  2KXD A;  1Q82 C;  4E6R A;  2E10 A;  1M30 A;  3CMA Q;  3CCV Q;  3LLR A;  1K76 A;  1UJ0 A;  4F7U A;  1YIJ Q;  5CKH A;  3EHR A;  1K0S A;  1UGV A;  2E5Q A;  5CKE A;  1V29 B;  2QA4 A;  1K8A R;  2I0N A;  4AFS C;  1NM7 A;  4LUD A;  5GMK j;  3ER0 A;  1I07 A;  1HSQ A;  2CUD A;  4M78 C;  3MKD A;  2M1H A;  3OW2 A;  4KUL A;  2RQU A;  1OI1 A;  4J6X A;  3RIR A;  1UEB A;  2CZ6 B;  1QVP A;  3QJY A;  5CKD A;  1E6G A;  3BE3 A;  1ZQ1 A;  1QP3 A;  3H8Z A;  9ATC B;  1SSF A;  2HNI A;  5GAM d;  1VQ7 T;  1TH7 A;  2ZPH B;  2R5A A;  2LTO A;  2R57 A;  4RUG A;  3M0T A;  3RDV A;  2QA4 T;  2LQK A;  1TXQ A;  3E19 A;  2A0F B;  4JZ4 A;  3RNJ A;  1H64 1;  3X28 B;  3HL8 A;  1AHJ B;  4GLK A;  4RMO A;  1D0X A;  4C92 D;  1XNI A;  2X3W D;  3I56 T;  7AT1 B;  2A08 A;  3M56 A;  3P8D A;  2YWW A;  1S72 Q;  3NMZ C;  3FRN A;  3RKY A;  2NUT B;  4M4Z A;  1GCP A;  2QTX A;  2DBM A;  2LZ6 B;  1UHF A;  1YHQ T;  2MMP A;  2VC8 A;  1N9S A;  2FO0 A;  4OGE A;  1RAD B;  1AZE A;  2LJ3 A;  5KE2 A;  4MDX A;  4XU3 A;  1V1C A;  5FRM A;  3CXC S;  2M16 A;  5FLX E;  2RQW A;  2Y4Y A;  2O9V A;  2B8A A;  4FL6 A;  5GAN 3;  2DVE A;  4M78 D;  3VS4 A;  3C4S A;  4PFZ A;  4OMN A;  1KD1 R;  1ZLM A;  3CCR A;  1M3A A;  6AT1 B;  2HD0 A;  1C6V X;  4LE9 A;  5HY6 A;  2YRC A;  3OYF A;  3M0U A;  2DEQ A;  2ZZD A;  4K11 A;  4AG2 C;  1Q86 U;  1UE9 A;  2EQJ A;  2F69 A;  1WZO A;  2LCS A;  3ZL7 C;  1HD3 A;  5I2S A;  3QZ5 B;  2LCL A;  4KH1 B;  2EYQ A;  4C5E A;  2VGN A;  1W2B S;  2MAM A;  3MPU B;  1YJN Q;  1UDL A;  3CCR T;  3GIB A;  1K9A A;  3V7R A;  2G6F X;  1RAF B;  1HJD A;  3I55 A;  4BI8 B;  1ARK A;  3OYE A;  1SEM A;  1GFD A;  4DOW A;  3C0C A;  2E4H A;  2YUO A;  1PC0 A;  4BY6 B;  2NWM A;  1D3B A;  4J5Y A;  4B9X A;  3CD6 A;  4PJO E;  3BW1 A;  3J7A F;  3MP6 A;  2CP3 A;  1KC8 C;  1VA7 A;  4M7A C;  1AVZ C;  4LD6 A;  3URG A;  2QGG A;  1WDX A;  2YRD A;  1WQ7 A;  4XU0 A;  2RHI A;  3CBP A;  1QWE A;  1TU0 B;  1TTH B;  2OI3 A;  4JJB A;  2V26 A;  1WNL A;  3M59 A;  3EHQ A;  4IIO A;  4DBQ A;  1RAE B;  2X9H A;  3EG3 A;  4J8O A;  4ZN3 A;  2H3E B;  3A8O B;  5HK0 A;  2LX7 A;  2P84 A;  1YJ9 A;  2OTJ Q;  2L8D A;  1Q7Y R;  1X6G A;  1D1A A;  3CEY A;  1BCO A;  2DL4 A;  3CCQ T;  2GGR A;  3QKJ A;  5LJ5 e;  4IKF A;  3PVL A;  2BZX A;  2E1H A;  3CPW A;  1BK2 A;  3CCU A;  4KT0 E;  3C12 A;  3VUB A;  4XK8 E;  2KXC A;  1VQN T;  2DTO A;  1ZUU A;  2LJ1 A;  4C8Q B;  3CCU Q;  4M7D D;  2DNU A;  3INZ A;  1WYX A;  5FRN A;  5DLQ E;  4FW2 A;  4J9E A;  4CC3 A;  3QII A;  5GAM g;  2PZ1 A;  3OYC A;  1LJO A;  4Z88 A;  5J3B A;  4PJO B;  2FG0 A;  4FW1 A;  2XDD A;  2RQT A;  2RJD A;  3VS1 A;  1YI2 T;  4BD3 A;  2VVK A;  3I5R A;  5LJ3 j;  4L59 A;  3A98 A;  4EMK B;  4M7D A;  4F7U E;  4RTY A;  3L2U A;  1PSF A;  2EVR A;  1JJ2 A;  3OYN A;  1G3S A;  1R0B G;  2EJG A;  2L3Q A;  1O9S A;  1YJW Q;  3OW2 S;  1QMC A;  2LQW A;  2EJF A;  3QYH B;  2MWO A;  4C8Q F;  2X51 A;  3OW2 P;  4PJO C;  2A7Y A;  2LNH B;  1RAG B;  4C92 F;  2VKN A;  1WXB A;  2P0K A;  4QQ6 A;  2QI2 A;  1PG5 B;  1QLY A;  4NL2 A;  4M75 G;  4AFU C;  2YDL A;  3CCE A;  4IUV A;  4FIB A;  4HVV A;  2COW A;  4IIM A;  1U8R A;  4M7A E;  5M9O A;  1K8A C;  4KH0 B;  4XQ3 A;  2E65 A;  2ED1 A;  4ORZ A;  1PRL C;  2BZ8 A;  4MZP A;  3VYG A;  4HXJ A;  1ZSG A;  2YSQ A;  3QXE B;  2QK0 A;  4C8Q E;  3OYA A;  3CCL Q;  1M1G A;  3CME Q;  4NOY A;  3KXT A;  4M7A A;  4AG1 C;  4N0A A;  2MK5 A;  4YTL A;  1ZSZ B;  1JQQ A;  2HEQ A;  4ZTJ A;  4M75 C;  2ZPE B;  4PL6 A;  3EFO B;  1WJQ A;  5GAO l;  1W1F A;  3PE0 A;  3MO8 A;  4JS5 A;  1VIE A;  1VQ9 A;  3PNW C;  3VYH B;  3CC4 Q;  2QQA A;  2NUT A;  3HFN A;  3VS6 A;  4PJO G;  3G7Z A;  4JRQ A;  2MF2 A;  2MYS A;  4F16 A;  3MJX A;  3SFM A;  5HK3 A;  3LW5 E;  1YNZ A;  1M90 U;  2GTJ A;  2J6K A;  3D7S B;  2KRS A;  2OAW A;  1YJN A;  2D6F A;  1IGU A;  1IXD A;  5GJV B;  1PKS A;  4M78 B;  2DVJ A;  1AT1 B;  4PFP A;  1VQ9 T;  1WHG A;  2BIV A;  4LNP A;  3PMT A;  2E70 A;  3FB9 A;  1JXO A;  5FU6 C;  3KFV A;  3H6Z A;  3OYJ A;  2RJC A;  4JS4 A;  1YJW T;  5GAM j;  2DD5 A;  5DY9 A;  5A0G A;  2X4Y A;  4FSX A;  4OGC A;  3NTI A;  2P4T A;  5I21 A;  4F17 A;  2DX1 A;  3UDC A;  4ESR A;  4ELZ C;  3OYY A;  2RHX A;  3HHT B;  2DJQ A;  1WGS A;  1Y96 B;  2RQR A;  1SG5 A;  2ZAE A;  4ZGD B;  4HKE A;  2EQK A;  4EMK C;  1VQO Q;  1M1K R;  4PLI A;  4DQ2 A;  4QVD A;  2AHJ B;  4JRI A;  3RMS A;  3TVT A;  3NHN A;  3H0I A;  3JCM e;  1VQN Q;  1B34 A;  2CYZ B;  4N4H A;  3KUF A;  2GCX A;  2OJ2 A;  4JRK A;  2D1X A;  3JCM c;  4AFQ C;  2QTV A;  2J06 A;  3OYK A;  2M0O A;  2YLC A;  1PCX A;  4OML A;  5KE3 A;  2MIO A;  1MMD A;  3CCL T;  3I56 A;  3J80 E;  3OY9 A;  2FVU A;  4C5I A;  4M7D G;  5GAN e;  5A2Q E;  1VQP T;  3EFS A;  2RH2 A;  3TSW A;  1HK9 A;  2PUO B;  1WQW A;  3JCM X;  4M77 B;  3WVD B;  5GAN 2;  4E7S A;  4M7D B;  2DRK A;  3M4Y A;  2RF0 A;  4DEX A;  1W6X A;  1OU8 A;  2HBP A;  2QQB A;  1AWW A;  2FRY A;  3OYI A;  2ROT A;  2DKG A;  3CC4 T;  3OS0 A;  4ZN1 A;  3GF5 A;  1RAH B;  4J7F A;  2ZGW A;  3JB9 D;  3BFM A;  2FPE A;  2VUB A;  2ECZ A;  1NG2 A;  1N6A A;  1MV3 A;  2ZPI B;  2QA4 Q;  5ECA A;  4CI0 C;  3LWH A;  1VQP A;  3OA6 A;  1KG1 A;  2WSC E;  3EG9 A;  3S6W A;  4NS5 A;  3QO3 A;  2FRW A;  2EPD A;  3TCJ A;  2C0T A;  1EX4 A;  1TUD A;  2CH4 A;  2RK2 A;  5KH6 A;  1BI2 A;  3DLM A;  3JRZ A;  3KBG A;  3GNG A;  5CKB A;  2LJ0 A;  4QVC A;  1E6H A;  3X20 B;  1RUW A;  2KRO A;  5FU7 C;  3LWI A;  4F04 B;  3OMG A;  2HMA A;  3A8L B;  4FYV B;  2CS7 A;  3CPW S;  1VQL A;  4M77 E;  2ED0 A;  1TUG B;  2AIR B;  5LJ3 d;  5GAN 4;  2DTI A;  1ZHI A;  5CQY A;  4M7D C;  4ME7 A;  1M3B A;  2E6Z A;  4EMK A;  4RTT A;  3CC4 A;  4A53 A;  1CKA A;  3A8M B;  1AWO A;  3UAT A;  4A4F A;  3G6E Q;  3CCR Q;  1TOV A;  1IO6 A;  3CC7 Q;  3DB3 A;  2ZPF B;  5IAY A;  1BBZ A;  3G71 Q;  1GL5 A;  1UJY A;  3HRT A;  1QCN A;  1GRI A;  5FRO A;  1JU5 C;  2R58 A;  3M4G A;  2HZY A;  1KJW A;  1IRE B;  4EIK A;  1OOT A;  2FB7 A;  4WTO B;  1H3Z A;  5I2M A;  2KVQ G;  3VS5 A;  1Q86 R;  1M3C A;  3OMC A;  3L2R A;  2EBP A;  1XQH A;  3M55 A;  5I22 A;  1X01 A;  3JB9 I;  2E5K A;  2DM1 A;  2RMO A;  4FM4 B;  4EPC A;  2LVM A;  4M7A B;  1QCF A;  1ABQ A;  1UGR B;  3PIP A;  4BDZ A;  1UUE A;  2DD4 A;  1I1J A;  4FYY B;  4LXC A;  5LJ5 d;  5LJ3 f;  2J6O A;  2L2P A;  4IUQ A;  3CCL A;  1VQM A;  1T3L A;  1K4U S;  3CME A;  3I55 Q;  3PGG A;  2RPN A;  4PJN A;  5CVI A;  1K1Z A;  3SDZ A;  4JJD A;  1IHW A;  4OMO A;  2YT6 A;  1XOV A;  4RTU A;  3QWX X;  2F1L A;  5GAO n;  1WX6 A;  1JRI A;  2OTJ T;  1GFC A;  4J9D A;  2CP2 A;  5IH2 A;  1LVK A;  3FJP A;  2M0Y A;  2M51 A;  5GAO p;  4M7A F;  1MND A;  1S1N A;  5LJ5 j;  1I5O B;  2BZY A;  4KBM B;  4BI3 A;  4A4K A;  4HCB A;  3FEO A;  4DOV A;  1E7O A;  2K57 A;  3CCQ Q;  2F5K A;  2JNG A;  4XTV A;  3P8H A;  1VYV A;  5GAO m;  4O6J A;  2CP6 A;  1QCO A;  3ME9 A;  1OYX A;  4LUE A;  5AYF A;  2DMO A;  4C0F A;  3O8V A;  3EFO A;  4Y92 A;  1O75 A;  1YI2 Q;  4BB7 A;  2ESW A;  2C0O A;  2EKH A;  8AT1 B;  2BTT A;  2LNV A;  1GCQ A;  1M2O A;  4LDW A;  4ATO A;  1PRM C;  4C8Q D;  4Z8A A;  2DE0 X;  4HVU A;  1Q81 R;  1VQM T;  3CCJ Q;  1Q86 C;  1VQ4 A;  2DXT A;  1IZ6 A;  2O4X B;  3CME T;  1QVG P;  2E41 A;  3CMA T;  3OS1 A;  3OBY A;  3V8L A;  2KSS A;  5FWB A;  4DA4 A;  1QWF A;  4PJM A;  2AZV A;  2AKK A;  2JN0 A;  3CCE T;  2FHD A;  1WHH A;  1FYN A;  2Z0W A;  4BI4 A;  1KSW A;  3FIF A;  2RA2 A;  3OS5 A;  1WIE A;  4XU1 A;  1AEY A;  4OMF B;  2LX9 A;  2RQV A;  2EFI A;  4C8Q G;  1NJI R;  1U06 A;  2MWP A;  1FXX A;  2CGH A;  1BCM A;  3REB B;  2CZ1 B;  3VS3 A;  4XTY A;  1NJI U;  5GAN f;  1GCQ C;  2KR3 A;  1YWO A;  1U1T A;  3HKS A;  1Q7Y U;  1WHK A;  3EH2 A;  1Q7Y C;  5FU7 B;  3CCS T;  3E9F A;  3V7C A;  4BE0 A;  5GAN 5;  1KQS S;  3I55 T;  1W4S A;  2KEA A;  1YP5 A;  3EH1 A;  2WSE E;  2QEX A;  4M7A G;  1SHF A;  3RMQ A;  5HKC A;  5D6Y A;  4JJC A;  1D1B A;  2E64 A;  2HCK A;  1VQ4 T;  1YIT Q;  2JOY A;  3J81 E;  5D6X A;  3L42 A;  3QDR B;  5IN1 A;  3ZEH A;  3CCM A;  2PNI A;  2I2L A;  3MCA B;  4QT7 A;  3THK A;  3SWN A;  3NTK A;  4N4I A;  1GBQ A;  2RI5 A;  1OEB A;  1MHN A;  4LDU A;  1ZBX A;  2XDB A;  5C0M A;  1VQ5 Q;  5IHK A;  3PFS A;  1TUC A;  3JCM V;  3G4S T;  3JSC A;  2IVW A;  4BDY A;  4PKC C;  3CC2 A;  1X6B A;  2JZ2 A;  4KRT A;  1W2B A;  1NEG A;  4DBH A;  4GLM A;  1YIJ T;  3OBW A;  1QW1 A;  3CPW P;  4MDW A;  2EAY A;  2QG9 B;  1AZG B;  3VV0 A;  2BUD A;  2EIF A;  2RJE A;  1HXD A;  1YN8 A;  3G1J A;  4JLI A;  2HAX A;  1YJ9 Q;  2H8H A;  3CQT A;  5LL6 S;  4RTX A;  2KY9 A;  4E7I A;  4M78 G;  1MUZ A;  2KK4 A;  1YHQ Q;  2C0I A;  2CSQ A;  1KQ1 A;  3GLX A;  1G5V A;  4E7Z A;  3HRU A;  1Y71 A;  4RG2 A;  1JB0 E;  5IXF A;  4LDX A;  4PJO A;  3E1S A;  2MI6 A;  3L2V A;  1ZUK A;  2K7A A;  3CBO A;  1D3B B;  4JZ3 A;  3EG0 A;  2X4W A;  3CXC A;  1X75 C;  1VQ5 A;  1RI0 A;  5L8R E;  2V8K A;  3H0F A;  2HQH A;  3VS0 A;  1VQ9 Q;  3T9N A;  1M4Z A;  4C8Q A;  2OTL A;  1NPP A;  1ZSZ C;  4OF1 A;  1OZ2 A;  1RAC B;  2XU8 A;  2ABL A;  3FLG A;  1D0Y A;  1T3S A;  4M7A D;  3GOX A;  2CT4 A;  4TVR A;  1YIJ A;  1NEB A;  5AT1 B;  5GMK e;  1RLP C;  4WF2 A;  2DL8 A;  2LC4 A;  3CPF A;  4D8K A;  3ULR B;  4XTU A;  3VS7 A;  3QPH A;  1M1K U;  1WJS A;  3OYG A;  1K73 U;  4UC4 A;  4XTW A;  2EJ9 A;  1Z9Q A;  1X6O A;  3JV3 A;  3O5Z A;  1VQ4 Q;  3R6N A;  1M2V B;  1K73 R;  1NJI C;  3SD4 A;  1R8O B;  1YIT T;  2OTL T;  4CC7 A;  1NLO C;  1TWB A;  2DXC A;  1G2B A;  5GMK m;  4PFO A;  3A1P A;  2J05 A;  2JUF A;  1M9S A;  3OYM A;  2FL7 A;  1VQ5 T;  1BIB A;  1M90 C;  4OMQ A;  2QXF A;  4M77 C;  1OQK A;  2DXB A;  2K5F A;  1G3T A;  4Y28 E;  3G6E T;  1R77 A;  4F7U B;  2BE9 B;  2FPD A;  4F14 A;  2GFU A;  2EGC A;  1FWZ A;  4BUG A;  1PSE A;  2LCC A;  5GAN g;  2HKQ B;  1HYO A;  1KQS P;  2RO0 A;  3JCM f;  1YWP A;  3L1A A;  3G4S Q;  1UEC A;  1AD5 A;  5CR2 A;  3HFO A;  1KQ2 A;  1B7T A;  3S3O A;  2O9S A;  2M9U A;  4M78 E;  2KYM A;  2QAZ A;  2JTM A;  2YUQ A;  2XMF A;  1BI3 A;  2DIQ A;  1SRL A;  1Y0M A;  1VQP Q;  5CQX A;  1VQ7 A;  4M78 A;  4DBF A;  2A37 A;  3ZBD A;  3Q1J A;  2DBK A;  1D0Z A;  2D0Q B;  2DYB A;  2HL5 C;  5KYY B;  1G83 A;  3VU3 C;  1X2Q A;  2QQS A;  4FT4 A;  1VQ8 A;  1U3O A;  2GNC A;  5CIU A;  2X4X A;  2LRQ A;  4P5N A;  5FWC A;  4OB1 B;  4ELY C;  1VQK T;  3UA6 A;  1FX7 A;  2KRN A;  2CUB A;  1JEG A;  2O2O A;  2D8H A;  4C0Z A;  2LQN A;  2RJF A;  3QUI A;  1N27 A;  1Y57 A;  4HA8 A;  3JCM Q;  1G3W A;  1NZ9 A;  4VUB A;  2K2M A;  3PIO A;  4J9H A;  2JVV A;  2KGT A;  1N8R R;  3JCM d;  1UGP B;  2J6F A;  4A4H A;  2XG8 D;  3C95 A;  1KFZ A;  3M0P A;  3OB9 A;  4RTW A;  2EYW A;  2WSF E;  2YRV A;  4C92 B;  3IQL A;  4OVA A;  1YCS B;  2EWN A;  2GQI A;  1H92 A;  5KCO A;  1WHM A;  4J7I A;  1VQK A;  3RES A;  1JXM A;  3SHW A;  1QVF A;  1NYG A;  1ZA1 B;  2CSI A;  1VQ6 Q;  1ZUY A;  1NE8 A;  2VAS A;  4J9F A;  3PMI A;  1VQL T;  4OP0 A;  1N5Z A;  1T0H A;  5LJ5 h;  1PWT A;  3M58 A;  3RUX A;  3UF4 A;  5LJ3 h;  5DLO A;  3E2U A;  2DL7 A;  5D7U A;  2H3J A;  3M53 A;  5IT9 E;  2V1R A;  4BAC A;  2K3X A;  3M5A A;  2PTK A;  1FMW A;  3CCV A;  2RB6 A;  3M9Q A;  1D1C A;  1K9M U;  2L89 A;  1TS9 A;  2JS2 A;  1I0C A;  1Q82 U;  1X43 A;  2A28 A;  1LCK A;  2O01 E;  4PJL A;  3V8J A;  1EFN A;  1QVF S;  2KQW A;  1K0X A;  4L6V 5;  2DPP B;  1U5S A;  1GBR A;  3OYL A;  2RHY A;  3MEA A;  5C6S A;  4C92 G;  4AFZ C;  2ROL A;  3JCM g;  1RLQ C;  1WJR A;  4E7J A;  3OYB A;  2F2X A;  1MGQ A;  3EG1 A;  2P0P A;  3V8K A;  2XDP A;  4C5G A;  4JJN K;  1C0M A;  3CCV T;  1H8K A;  1A0N B;  2DYI A;  4C0G A;  3CD6 T;  2CP7 A;  4B9W A;  1XTD A;  3TQ7 P;  1VQN A;  2OTL Q;  2NUZ A;  2A36 A;  3AT1 B;  1WA7 A;  1OU9 A;  4R55 A;  4C0D B;  2JTF A;  3SB2 A;  4AT1 B;  4L5G A;  3MEV A;  1BKB A;  4M77 A;  3MP8 A;  2W10 A;  1MMN A;  2K3Y A;  1KK7 A;  3NPF A;  2XI9 A;  2VXF A;  1RAI B;  3AHU A;  3H0H A;  2SEM A;  3GPL A;  4J9C A;  4JUV A;  2DL5 A;  2Y90 A;  4J9G A;  1I4K 1;  2XD0 A;  2PVO B;  1JO8 A;  2ENM A;  5IXB A;  1JJ2 S;  1KIK A;  3VUZ A;  4OMP A;  3VRY A;  4RCC A;  4IUU A;  3CCE Q;  2RHU A;  3EAE A;  1IGQ A;  3ASK A;  2XK0 A;  2VB6 A;  1LPL A;  4E2F B;  4M75 D;  2VYT A;  4EMG A;  1D09 B;  3OSV A;  2HL3 A;  1QP2 A;  3HTR A;  3QG1 A;  2EGA A;  1MMG A;  3EG2 A;  2YHT A;  5KYN A;  2DET A;  3JB9 F;  2DLP A;  3A8H B;  1B34 B;  3M57 A;  2RNA A;  1P92 A;  3QWY A;  2CRE A;  4ZGE B;  3UWN A;  2KAF A;  2DO3 A;  2QEX T;  1I8F A;  3CCS Q;  2K5L A;  3DLL A;  2CP5 A;  2SRC A;  2CZ0 B;  1RAB B;  3I5S A;  2KI7 A;  3CMA A;  4FCY A;  3G4S A;  4KGV B;  2RI2 A;  2EQU A;  2O4X A;  4X34 A;  1KD1 C;  1YI2 A;  3EGU A;  2LQ8 A;  1IHV A;  1VIF A;  4HCZ A;  2HSP A;  3EGD B;  5GAO q;  4ANJ A;  2AKL A;  4F7U F;  2K5I A;  1U1S A;  5DM7 R;  1RL2 A;  3RKW A;  1T0J A;  2MCN A;  2XHC A;  3OYH A;  3UT1 A;  2RI3 A;  2QGF B;  4QQD A;  3EGX B;  5A0L A;  1WPY A;  1AOJ A;  2CKK A;  1PD1 A;  2DEU A;  1NLP C;  4FYW B;  4DBR A;  1Q81 U;  4M75 E;  3OYD A;  2DZC A;  2EQI A;  4DEY A;  1NPR A;  4XTZ A;  1OV3 A;  1C1A A;  4D6W A;  4C8Q C;  5CK9 A;  1JJ2 P;  1VQ6 T;  3QJ6 A;  3LX7 A;  4HT8 A;  4J6Y A;  4ZTF A;  5D6W A;  1K9M C;  1SKU B;  2VXE A;  5GMK i;  2YXY A;  1VOM A;  3CCM Q;  2PUK B;  3DKM A;  3L2W A;  5KYY A;  3JCM J;  3V7S A;  5GAN j;  2E12 A;  2CZ7 B;  3UPU A;  5EG2 A;  3VJP A;  2EQM A;  4RTZ A;  3TU4 K;  4Q5W A;  2X35 A;  3EGX A;  3BDU A;  2FZG B;  4M77 G;  1SPK A;  2O31 A;  3GP8 A;  2JM9 A;  2L0A A;  1SRM A;  4HVW A;  1VQ6 A;  4M75 A;  3I9Q A;  3JCM W;  2F2V A;  1OPL A;  4HCC A;  1QKX A;  2KBT A;  4M7D E;  1OPK A;  4MMK A;  3S3N A;  5GAM h;  3LH0 A;  1IB8 A;  3H9N A;  1K8A U;  3CC7 T;  5J39 A;  3MET A;  4B6M A;  2EYX A;  3CC2 T;  1Y96 A;  5GMK h;  3FJ5 A;  4C92 E;  3L2Q A;  4C92 A;  1YCY A;  2NUP A;  4J6W A;  2HQX A;  5KYU A;  3N5B B;  3BY7 A;  4PK4 A;  2JW4 A;  2JT4 A;  2XIC A;  1MNE A;  2KRM A;  2X4J A;  3M0S A;  4R56 A;  3LGL A;  3CD6 Q;  4MML A;  3G6E A;  4C0D C;  4C5H A;  4F7U G;  2HDA A;  4Y91 A;  3E9G A;  3QZ9 B;  1UHC A;  2DIL A;  1FMV A;  4XU2 A;  1X69 A;  4KGZ B;  2MPX C;  2LT4 A;  5LJ5 f;  1ZBJ A;  2HQE A;  1PNJ A;  4KUD K;  3QDF A;  4GBQ A;  5EC7 A;  3RKX A;  1VYT A; 
#chains in the Genus database with same CATH homology
 3RMS A;  4WF2 A;  2OAU A;  3JCM e;  3LLR A;  1Y7X A;  1B34 A;  2CYZ B;  2LC4 A;  3CPF A;  4LDV A;  4N4H A;  3KUF A;  4F7U A;  2GCX A;  4XTU A;  1M1K U;  3QPH A;  1WJS A;  3MEU A;  3OYG A;  5CKH A;  1K73 U;  4UC4 A;  4XTW A;  4JRK A;  2E5Q A;  2EJ9 A;  5CKE A;  4MZT A;  1V29 B;  1X6O A;  2QA4 A;  3JCM c;  1NJI C;  3SD4 A;  3OQ5 A;  2K2V A;  4QVD A;  1R8O B;  1YIT T;  2OTL T;  3OYK A;  3HRS A;  2M0O A;  2YLC A;  2DXC A;  5GMK j;  2GFA A;  5KE3 A;  3ER0 A;  5GMK m;  4M75 F;  2K4Y A;  2KMT A;  2JUF A;  4M78 C;  2M1H A;  1G3Y A;  1M9S A;  3OW2 A;  4KUL A;  3OYM A;  2FL7 A;  5GMK e;  3CCL T;  3I56 A;  3J80 E;  1OI1 A;  4J6X A;  3RIR A;  4OB2 B;  1VQ5 T;  1BIB A;  1UEB A;  3OY9 A;  2CZ6 B;  2FVU A;  1QVP A;  2QXF A;  3QJY A;  4C5I A;  5GAN e;  4LDY A;  5CKD A;  1ZQ1 A;  1QP3 A;  2RH2 A;  3EFS A;  2DXB A;  2K5F A;  3H8Z A;  1G3T A;  4M77 C;  4Y28 E;  3G6E T;  1HK9 A;  1SSF A;  1WQW A;  2ZPG B;  2HNI A;  2WAC A;  2PUO B;  4M77 B;  4X9D A;  3WVD B;  4F7U B;  3JCM X;  5GAM d;  1TH7 A;  5GAN 2;  1VQ7 T;  4M7D B;  2GFU A;  3M4Y A;  2ZPH B;  2R5A A;  1FWZ A;  2LTO A;  1PSE A;  2LCC A;  4BUG A;  1UGS B;  5GAN g;  3RER A;  2A3L A;  2HBP A;  2R57 A;  2DIG A;  1YBY A;  2RO0 A;  2QQB A;  4RKU E;  3L1A A;  3JCM f;  2QA4 T;  4LD9 K;  3QSU A;  5CR2 A;  3OYI A;  1VUB A;  3HFO A;  1KQ2 A;  2DAQ A;  2DKG A;  2LQK A;  3CC4 T;  3S3O A;  3E19 A;  3OS0 A;  4ZN1 A;  2M9U A;  4M7D G;  3GF5 A;  1H64 1;  4M78 E;  4BY6 C;  3X28 B;  1UB4 A;  3HL8 A;  3TEE A;  1AHJ B;  1EIF A;  4J7F A;  2JTM A;  5A2Q E;  2ZGW A;  1BI3 A;  2DIQ A;  3BFM A;  2LDM A;  2VUB A;  3JB9 D;  4Z02 A;  1N6A A;  4GLK A;  4RMO A;  5CQX A;  4C92 D;  1XNI A;  2IG0 A;  2ZPI B;  4XAX B;  1VQ7 A;  3I56 T;  2R5M A;  3MP1 A;  4M78 A;  4EMH A;  3M56 A;  3ZBD A;  3P8D A;  3Q1J A;  4DQ2 A;  4CI0 C;  3FRN A;  3LWH A;  1VQP A;  3OA6 A;  3RKY A;  2D0Q B;  2WSC E;  1KG1 A;  2VV5 A;  3S6W A;  4NS5 A;  3A8G B;  3QO3 A;  3VU3 C;  5GAN 6;  2QQS A;  4FT4 A;  2QTX A;  3JAM E;  5GAO r;  1VQ8 A;  5CIU A;  2X4X A;  3TCJ A;  2LRQ A;  4QQG A;  4P5N A;  4CRI A;  1YHQ T;  4OB1 B;  4ELY C;  1VQK T;  1FX7 A;  2MMP A;  2VC8 A;  2RK2 A;  4C0Z A;  1N9S A;  2RJF A;  3QUI A;  5KH6 A;  5KCH A;  1N27 A;  1BI2 A;  3DLM A;  4OGE A;  3JRZ A;  3KBG A;  4HA8 A;  4E7K A;  3GNG A;  5KE2 A;  5CKB A;  3JCM Q;  3MHX A;  4MDX A;  1G3W A;  1NZ9 A;  4VUB A;  4IUT A;  4QVC A;  3X20 B;  3PIO A;  4XU3 A;  4M75 B;  2JVV A;  5GAM e;  5FU7 C;  3JCM d;  3LWI A;  1UGP B;  5FRM A;  3CXC S;  2M16 A;  4A4H A;  2XG8 D;  3C95 A;  3OMG A;  5FLX E;  3A8L B;  3HPW A;  1N8R C;  2Y4Y A;  2CS7 A;  3OB9 A;  3CPW S;  3JB9 J;  2WSF E;  1N8R U;  1Y07 A;  2B8A A;  2YRV A;  4FL6 A;  5GAN 3;  4C92 B;  3CCJ T;  1VQL A;  2DVE A;  4OVA A;  1KD1 U;  4PJO D;  1M8V A;  4M78 D;  3X26 B;  4M77 E;  2EWN A;  5LJ3 d;  1VQP T;  3C4S A;  5KCO A;  1KHI A;  5GAN 4;  3CCR A;  2DTI A;  1ZHI A;  3PT9 A;  5CQY A;  4ME7 A;  4M7D C;  4MZM A;  4J7I A;  2E6Z A;  4EMK A;  1M5Q 1;  4HT9 A;  2HD0 A;  1VQK A;  3RES A;  3ZFJ A;  5LJ5 g;  5GMK l;  4QW2 A;  3CC4 A;  4A53 A;  1OZ3 A;  3F70 A;  3A8M B;  5HY6 A;  4A4F A;  1I5L A;  1QVF A;  3DB3 A;  2ZPF B;  5IAY A;  4N4G A;  1KQS A;  3OYF A;  3HRT A;  5FRO A;  2DTH A;  2R58 A;  2ZZD A;  2DEQ A;  3M4G A;  1IRE B;  1NE8 A;  3DB4 A;  1Q86 U;  3PMI A;  2DK3 A;  3EFR A;  2EQJ A;  4M77 D;  4A4E A;  1VQL T;  2F69 A;  2FB7 A;  4OP0 A;  5LJ5 h;  3M58 A;  3RUX A;  5I2M A;  3SWN C;  5I2S A;  1H3Z A;  2KVQ G;  5LJ3 h;  5DLO A;  3QYG B;  3QZ5 B;  2LCL A;  3OMC A;  4PNO A;  3SWN B;  3L2R A;  1XQH A;  2EYQ A;  3M55 A;  1X01 A;  2H3J A;  3M53 A;  4C5E A;  3JB9 I;  2QQ9 A;  2VGN A;  1W2B S;  5IT9 E;  4E7L A;  4FM4 B;  4BAC A;  2K3X A;  3M5A A;  2MAM A;  2G3R A;  4EPC A;  2LVM A;  4M7A B;  1YHQ A;  1UGR B;  1YIT A;  3PIP A;  2L3R A;  3CCV A;  4BDZ A;  2RB6 A;  3CCR T;  3M9Q A;  3GIB A;  2OTJ A;  3V7R A;  2DD4 A;  2GQV A;  2L89 A;  1K9M U;  4RCB A;  3I55 A;  4BI8 B;  4JJN K;  5LJ5 d;  3OYE A;  5LJ3 f;  4DOW A;  1Q82 U;  4IUQ A;  3CCL A;  1VQM A;  2O01 E;  3V8J A;  4BY6 B;  1QVF S;  3CME A;  1D3B A;  2KQW A;  3PGG A;  2PQW A;  4J5Y A;  4L6V 5;  4B9X A;  5CVI A;  3CD6 A;  4PJO E;  2DPP B;  2YLB A;  3BW1 A;  3J7A F;  3MP6 A;  4KUI A;  3OYL A;  3SDZ A;  2RHY A;  3CCJ A;  1XOV A;  3MEA A;  1KC8 C;  5C6S A;  5GAO n;  1JRI A;  4C92 G;  1KC8 U;  4M7A C;  2OTJ T;  3JCM g;  1BI1 A;  4LD6 A;  1YJ9 T;  1WJR A;  4E7J A;  2QQR A;  3URG A;  3OYB A;  3FJP A;  4QVZ A;  1MGQ A;  3GNF B;  2P0P A;  3R6O A;  2XDP A;  3V8K A;  4C5G A;  5GAN d;  5GAO p;  1WQ7 A;  4IUR A;  4XU0 A;  2RHI A;  3CBP A;  5LJ5 j;  3CCV T;  4KBM B;  4BI3 A;  4A4K A;  1I81 A;  4HCB A;  1WNL A;  2ZCF B;  3FEO A;  5FU6 B;  3M59 A;  4DOV A;  2K57 A;  4C0G A;  4ZGJ B;  2F5K A;  2D9T A;  3CD6 T;  4J8O A;  4ZN3 A;  4BE1 A;  2V8I A;  4M7A F;  4B9W A;  1XTD A;  2JNG A;  4XTV A;  1VQN A;  3P8H A;  5GAO m;  3A8O B;  4BE2 A;  4R55 A;  4M78 F;  4O6J A;  4C0D B;  5HK0 A;  1QVG A;  3ME9 A;  2JTF A;  1OYX A;  5CO7 A;  3SB2 A;  4L5G A;  3MEV A;  1BKB A;  3MEW A;  4II1 A;  4M77 A;  1YJ9 A;  3MP8 A;  2L8D A;  5AYF A;  3VKI A;  5A0D A;  2K3Y A;  4C0F A;  2XI9 A;  1VQ8 T;  3O8V A;  2VXF A;  3CEY A;  5GAM f;  2L5Q A;  3AHU A;  3CCQ T;  4X9C A;  3QKJ A;  5LJ5 e;  3GPL A;  4IKF A;  4JUV A;  1O75 A;  2Y90 A;  4BB7 A;  3S3M A;  2E1H A;  3CPW A;  1I4K 1;  1JBM A;  2XD0 A;  2PVO B;  2LT1 A;  3CCU A;  1JJ2 S;  4KT0 E;  3VUZ A;  3C12 A;  2QDY B;  5LJ3 e;  2LNV A;  3VUB A;  1S72 A;  4LDW A;  4ATO A;  4RCC A;  4XK8 E;  1UGQ B;  4IUU A;  4C8Q D;  5CCA A;  1VQN T;  2DTO A;  4C8Q B;  2RHU A;  3EAE A;  3ASK A;  2XK0 A;  2EKO A;  4M7D D;  1VQM T;  1Q86 C;  3INZ A;  1VQ4 A;  4M75 D;  2RK1 A;  5FRN A;  2DXT A;  1IZ6 A;  2O4X B;  2VYT A;  5DLQ E;  4EMG A;  3CME T;  3OSV A;  1YJN T;  4NL3 A;  2E41 A;  1QP2 A;  3CMA T;  3OS1 A;  3OBY A;  3V8L A;  3QG1 A;  3QII A;  2KSS A;  5GAM g;  3OYC A;  2YHT A;  1LJO A;  4DA4 A;  5J3B A;  4PJO B;  2XDD A;  3JB9 F;  2RJD A;  2JN0 A;  5GAN 7;  3JB9 G;  2RHZ A;  3A8H B;  2PVG B;  4OB0 B;  1B34 B;  2FHD A;  3M57 A;  4A4G A;  4BD3 A;  1YI2 T;  3CCE T;  1P92 A;  5LJ3 j;  4V2S A;  2DJZ A;  4L59 A;  4BI4 A;  4ZGE B;  3UWN A;  1YJW A;  4EMK B;  2KAF A;  2DO3 A;  4M7D A;  4RG8 A;  4F7U E;  3FIF A;  2QEX T;  1I8F A;  2RA2 A;  3L2U A;  1PSF A;  2K5L A;  3DLL A;  3OS5 A;  3CCU T;  1JJ2 A;  3OYN A;  1G3S A;  2CZ0 B;  2EJG A;  4XU1 A;  3G71 T;  1VQO A;  1O9S A;  3OW2 S;  4OMF B;  3CMA A;  2VGM A;  2EJF A;  3QYH B;  1N9R A;  2LX9 A;  2MWO A;  4C8Q F;  2EFI A;  3TRE A;  4C8Q G;  3G4S A;  2RI2 A;  4JDS A;  4E7H A;  2EQU A;  2MWP A;  3P8B B;  1FXX A;  2E6N A;  3CCQ A;  4PJO C;  2CGH A;  2O4X A;  4X34 A;  1KD1 C;  2A7Y A;  2CZ1 B;  1YI2 A;  1M90 C;  4GY5 A;  4XTY A;  4C92 F;  1NJI U;  2PVD B;  5GAN f;  2LQ8 A;  2P0K A;  4QQ6 A;  2QI2 A;  1U1T A;  3HKS A;  1M1F A;  3X24 B;  5LJ3 g;  4PJO F;  4NL2 A;  1Q7Y U;  1VIF A;  4M75 G;  1Q7Y C;  3CCE A;  4HCZ A;  4IUV A;  3NTH A;  4FIB A;  5GAO q;  1QVG S;  5FU7 B;  3CCS T;  3E9F A;  4F7U F;  3V7C A;  4BE0 A;  2FYK A;  3QBY A;  2P0Q A;  5GAN 5;  5M9O A;  2K5I A;  1U1S A;  5DM7 R;  1U8R A;  1KQS S;  3HSB A;  4M7A E;  1LOJ A;  1RL2 A;  2NLU A;  3I55 T;  3RKW A;  3FDR A;  1W4S A;  3NFC A;  2XHC A;  3OYH A;  3UT1 A;  1K8A C;  2RI3 A;  2WSE E;  2QEX A;  4XQ3 A;  4C92 C;  2E65 A;  4QQD A;  4M7A G;  3WVE B;  3RMQ A;  5HKC A;  5D6Y A;  5A0L A;  3CBM A;  2E64 A;  4MZP A;  1WPY A;  3OS2 A;  3VYG A;  2CKK A;  1VQ4 T;  3X25 B;  1Q81 U;  4M75 E;  4JRP A;  3OYD A;  2DZC A;  4IUP A;  1NPR A;  4FU6 A;  3L2Z A;  4XTZ A;  2JOY A;  3J81 E;  5D6X A;  3JB9 H;  3L42 A;  3QDR B;  5IN1 A;  4D6W A;  4C8Q C;  3ZEH A;  5CK9 A;  3CCM A;  1VQ6 T;  3QJ6 A;  2I2L A;  3QXE B;  3LX7 A;  3MCA B;  3CCS A;  4C8Q E;  4HT8 A;  4J6Y A;  4ZTF A;  5D6W A;  3OYA A;  2VXE A;  2BKD N;  3NTK A;  4N4I A;  3SWN A;  3A5Z B;  2RI5 A;  4J83 A;  5GMK i;  2ZPB B;  1M1G A;  1MHN A;  4LDU A;  2PUK B;  3DKM A;  3L2W A;  1ZBX A;  2XDB A;  4NOY A;  4JLG A;  3KXT A;  4M7A A;  3JCM J;  3V7S A;  5C0M A;  4OB3 B;  5GAN j;  3HP9 A;  4N0A A;  4YTL A;  2E12 A;  2CZ7 B;  4O5V A;  3CC7 A;  4EDU A;  3UPU A;  5EG2 A;  3G71 A;  5GAN h;  4ZTJ A;  1VQO T;  2XKO C;  4M75 C;  2ZPE B;  4PL6 A;  3VJP A;  2EQM A;  1WJQ A;  2GF7 A;  3PFS A;  5GAO l;  3TU4 K;  2C06 A;  4Q5W A;  2X35 A;  3MO8 A;  3JCM V;  4XTX A;  3G4S T;  3JSC A;  4JS5 A;  2IVW A;  1VIE A;  4BDY A;  3CCM T;  1VQ9 A;  3PNW C;  3BDU A;  4PKC C;  3VYH B;  3CC2 A;  2JZ2 A;  2QQA A;  4M77 G;  3HFN A;  4M77 F;  1W2B A;  3FC3 A;  2F5T X;  3PTA A;  3GP8 A;  3C94 A;  5CKF A;  2DXU A;  1YIJ T;  3OBW A;  1QW1 A;  4PJO G;  3G7Z A;  1VQ6 A;  2PU9 B;  4M75 A;  4JRQ A;  4MDW A;  5CAI A;  3LYI A;  1KHC A;  2EAY A;  3JCM W;  1M1K C;  4HCC A;  2MF2 A;  3VV0 A;  2BUD A;  2EIF A;  3JCM h;  2RJE A;  1HXD A;  3QHS A;  4M7D E;  3SFM A;  1S72 T;  4MMK A;  5J26 A;  5HK3 A;  1K73 C;  1Q81 C;  3LW5 E;  2DZ9 A;  3BDL A;  4JLI A;  3S3N A;  5GAM h;  3M54 A;  3LH0 A;  1M90 U;  2HAX A;  1K8A U;  5LL6 S;  3CC7 T;  2KY9 A;  5J39 A;  4PLL A;  4E7I A;  4M78 G;  3MET A;  3CC2 T;  2KK4 A;  1YJN A;  1Y96 A;  5GMK h;  2D6F A;  4C92 E;  3L2Q A;  4C92 A;  1KQ1 A;  1YCY A;  3OSS C;  4J6W A;  2HQX A;  4M78 B;  3N5B B;  2RM4 A;  3GLX A;  3BY7 A;  1G5V A;  3HRU A;  3JCM b;  1VQ9 T;  1Y71 A;  4RG2 A;  2XIC A;  1JB0 E;  1K9M C;  4LDX A;  3E1S A;  2MI6 A;  3L2V A;  4PJO A;  2BIV A;  3PMT A;  2E70 A;  2X4J A;  3CBO A;  1D3B B;  1LNX A;  3FB9 A;  5FU6 C;  1GXI E;  3H6Z A;  2X4W A;  3CXC A;  2XID A;  1X75 C;  5GAN 8;  2RJC A;  3OYJ A;  4JS4 A;  1YJW T;  1VQ5 A;  3WXM B;  5GAM j;  1RI0 A;  3LGL A;  5L8R E;  4R56 A;  4M7D F;  2DD5 A;  4MML A;  5DY9 A;  5A0G A;  3G6E A;  4C0D C;  2V8K A;  2X4Y A;  4C5H A;  4FSX A;  3JCM P;  4OGC A;  4F7U G;  2Y4X A;  3NTI A;  2P4T A;  4A54 A;  3T9N A;  5I21 A;  4Y91 A;  3E9G A;  3QZ9 B;  1M4Z A;  3UDC A;  1DJ7 B;  2V8J A;  4ELZ C;  4N0A C;  4C8Q A;  2OTL A;  1NPP A;  4XU2 A;  3OYY A;  2RHX A;  3HHT B;  3LGF A;  1WGS A;  1OZ2 A;  4OF1 A;  2XU8 A;  2RD1 A;  1BYM A;  1Y96 B;  3FLG A;  4E47 A;  1BIA A;  2LT4 A;  5LJ5 f;  4ZGD B;  2HQE A;  4FT2 A;  4HKE A;  3GOX A;  4M7A D;  2EQK A;  2KDS A;  1BI0 A;  4KUD K;  4TVR A;  4EMK C;  1YIJ A;  1Q82 C;  2E10 A;  4PLI A;  3RKX A;  2AHJ B;  4JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...