1N9RA

Crystal structure of a heptameric ring complex of yeast smf in spacegroup p4122
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein F
publication title Homomeric ring assemblies of eukaryotic Sm proteins have affinity for both RNA and DNA: Crystal structure of an oligomeric complex of yeast SmF
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n9rA00
3FB9A 4NL2A 5GAN7 2DJZA 4C8QC 4M75F 2K57A 4M7AC 5GANe 1BIBA 5LJ5g 1U1TA 4M78C 1WNLA 4WF2A 5LJ5h 3BW1A 4F7UB 4PJOC 2RM4A 5GAN6 5LJ5d 3V7CA 3RIRA 2JN0A 3V7SA 3V8JA 3JB9D 3JCMV 2RB6A 4PJOF 3SWNC 3RKXA 3EFSA 1I81A 2VXFA 3JCMX 3HFNA 4DQ2A 4C8QD 2I2LA 4M7AD 2DTOA 1KQ1A 3BFMA 4M75G 4M78D 4Y91A 4C8QE 2DXUA 4C92C 3JB9G 4M7AE 4M78E 4C8QB 4PJOD 5GMKi 4M78B 4XTZA 3L2ZA 2DTHA 3L1AA 5LJ5e 4M75C 3RKYA 2VXEA 4C8QG 5CAIA 1H641 4M7AG 1KQ2A 2DVEA 4A54A 4M78G 3RESA 1I4K1 4C8QA 3GIBA 4M7AA 3QSUA 4PJOG 4M78A 2RA2A 2EWNA 1I8FA 4J6WA 3RERA 2YLCA 4RCCA 3QHSA 3EFRA 4XTVA 4XTUA 3SWNB 5GMKl 3JCMb 5GAMj 3M4GA 5GAN4 2EJFA 3JCMJ 1LJOA 4C92D 4XTYA 4M77F 1B34A 4C92E 5LJ3j 5GMKj 5GAOl 5GANj 1BIAA 4HT9A 4XTXA 3SWNA 4J6XA 4C92B 4HA8A 5LJ5f 4M75D 4JRKA 3JCMg 4N0AC 2EAYA 4M75E 3FJPA 4PNOA 3JCMh 4OP0A 4C92G 4M75B 5GAN2 1MGQA 2DZCA 4XU3A 4C92A 4F7UF 3JCMd 4X9DA 3JCMf 4M75A 4M7AB 5GAOq 4PJOE 4A53A 2CGHA 1N9RA 2FB7A 2Y90A 4M7DF 4PJOB 1D3BB 3JB9H 1N9SA 2E64A 4JUVA 1WQWA 1M5Q1 5GAMg 1HK9A 1X01A 1B34B 1JBMA 2HNIA 4M77C 2E1HA 4QVDA 4PJOA 3RKWA 1D3BA 4XQ3A 1WPYA 5GAN8 4EMKC 3JCMe 5GAN5 5LJ3g 4RCBA 4JLIA 5GAMd 5LJ3h 2DTIA 2QTXA 5I21A 3QUIA 5GMKh 4XU2A 1TH7A 3HFOA 5GMKm 1Y96B 5GAN3 5LJ3d 4X9CA 4M7DG 3BY7A 5GAOm 2DXTA 2YLBA 1I5LA 1Y96A 4M77D 4XTWA 3HSBA 4M77E 4M7DC 2VC8A 4XU1A 3JCMQ 2RD1A 1WQ7A 3JCMc 3QO3A 3RUXA 3AHUA 5GAOn 2E41A 3FIFA 4EMKB 2FYKA 2YHTA 1JRIA 4M77G 2EJGA 3JB9J 2ZGWA 3JB9F 3PGGA 4NL3A 5LJ3e 4MMKA 2DZ9A 4M77A 5GMKe 4F7UE 1LOJA 4EMHA 5GAOr 4EMKA 4XU0A 1YCYA 5LJ5j 5GAMh 4C8QF 3JCMW 4J6YA 4M7AF 1U1SA 4EMGA 4F7UG 4HT8A 4M78F 4MMLA 3V7RA 3BDUA 4QVCA 5GANg 3JCMP 4M7DD 5GANh 1HXDA 3V8LA 4F7UA 4M7DE 2DEQA 5GAMf 4M7DB 2DKGA 4N0AA 5GAOp 3VU3C 5GANd 1LNXA 5LJ3f 5DY9A 3V8KA 5GANf 2EJ9A 4M7DA 4NOYA 2E10A 4J5YA 4JRIA 1M8VA 4M77B 2E65A 3INZA 4C92F 3JB9I 5GAMe 4V2SA 3SB2A
chains in the Genus database with same CATH superfamily
1Q81U 3J80E 5LJ5g 1UJ0A 2EKHA 2KI7A 1OQKA 4DBQA 1M9SA 3QDRB 3EFSA 1I81A 3THKA 1KC8U 4OMFB 1VQNT 4JS4A 3EH1A 5A0GA 2DRKA 5GMKi 3EHRA 1N27A 2PU9B 2K3BA 4J9IA 3CCLA 3GNGA 3EFRA 2DNUA 3A1PA 3QPHA 3EGDA 1VQOA 2OI3A 2KT8A 2PVOB 2DVJA 4HT9A 4JRKA 3LGLA 2LC4A 2QK0A 1YNZA 1QVGS 4AFQC 3PNWC 1K8AU 1RAGB 2JS2A 4FYVB 4PFOA 3JCMf 3AT1B 1Q86R 4KBMB 3OYDA 3LGFA 1M30A 2ECZA 2L3QA 3SHWA 4Z02A 2HNIA 1QP3A 1Y7XA 3RKWA 4EMKC 5LJ3g 5A0LA 4B9WA 1IB8A 5CKHA 2YT6A 3CCQA 4FYYB 1V76A 3ULRB 1UE9A 1BBZA 3TSZA 4XU1A 3JCMQ 1WQ7A 4GLMA 2P4TA 2F2XA 1AVZC 3SD4A 3OS0A 2YXYA 1VQ8A 3BDLA 2HD0A 2RJFA 4RTYA 1YHQA 3QXEB 2KBTA 1PCXA 1M2VB 4BD3A 8AT1B 3NFCA 1M90U 3CPWP 3HRUA 1OU8A 2IG0A 1QKWA 5CKDA 1RAEB 2AKKA 2CS7A 2K5IA 4J5YA 2F2VA 4JS5A 4ZGJB 3OS1A 4HCKA 1Q7YC 2D9TA 1T3SA 2DJZA 3S3MA 5LJ5h 2K9GA 1YITT 3CCVQ 1GBRA 3MP6A 2O4XB 3CCUA 3RIRA 3CCJT 3SWNC 2PVDB 2O9VA 2XI9A 1YP5A 5CQYA 4A4EA 4BE1A 1FMWA 2AT1B 4CI0C 4HVWA 3H8ZA 1M1KC 1RUWA 2BZ8A 4FT4A 3X25B 3E1SA 2FZCB 2EWNA 1VQ4A 2OX7A 4E7SA 3SEMA 4FM4B 4BACA 2EYQA 3C94A 2O31A 2RHUA 2GCXA 2QYZA 3CEYA 3O5ZA 4BE2A 3TU4K 1MGQA 2DZCA 4C92A 2CYZB 1YN8A 2COYA 3DB3A 2PQWA 3CCSQ 4KRTA 4M4ZA 1NPRA 2KRSA 1I5OB 4PJOA 1D3BA 4MZTA 3JCMe 1N8RC 3M0TA 1SF9A 5LJ3h 1ZBJA 3M58A 3P8BB 1YJWA 3OW2A 2DXTA 2YUQA 4WTOB 3CC4Q 2DFUA 2X4JA 2K6DA 3ER0A 1KSWA 5FU6C 2E41A 4EMKB 3ZBDA 2FRYA 2DBMA 4KH1B 2RQRA 4XU0A 3JCMW 1IREB 4OB0B 1KQSP 1NG2A 1DJ7B 4OMQA 2DEQA 5D6WA 4N0AA 1SHGA 2WSEE 1ZUUA 2D8HA 3PTAA 2ENMA 4AG1C 3OYAA 1YJNQ 1NEGA 4JJNK 2CT3A 2EGCA 2D0QB 3M59A 3QKJA 4HKEA 4QQDA 4J9HA 2RHYA 2YDLA 2LQ8A 1LVKA 2K3XA 2QQBA 3TQ7P 3I56T 2KYBA 1KQ1A 4RUGA 5KE3A 3CC2A 3A5ZB 2JMAA 4JDSA 3OS5A 1K9MU 4PJOG 3ASKA 3SWNB 3VS1A 4XTVA 1TUGB 1LJOA 2V8JA 2DIQA 5GANj 2VUBA 4J9DA 4KT0E 2HQEA 2DRMA 1WHJA 1YJ9A 2WSFE 4M75A 1YITA 2JW4A 2RMOA 2IIMA 1PNJA 2KSSA 3OSVA 3CCJA 3EG9B 3NTKA 5GAN8 4A63B 2DTIA 3QUIA 4OB1B 4QQ6A 2FHDA 2LNVA 3A98A 1BI2A 5KCOA 4OMPA 1S72T 3UWNA 2KEAA 2GTJA 1I5LA 3M57A 1IXDA 3A8OB 3JV3A 2FG0A 2EFIA 4C5IA 3CCET 1JJ2A 1M3BA 3PT9A 2ABLA 1NYFA 3CXCA 2E6NA 3CD6A 3FIFA 2K5FA 3HTRA 1TXQA 3FLGA 4KGVB 1M3CA 1ACMB 1VQ5A 2V26A 5C0MA 1WFWA 2NUTB 2CKKA 1VQMT 1YIJQ 5DM7R 5GAOp 4F04B 5GANd 2A28A 2HKQB 4J7IA 4UC4A 3X20B 2FVUA 5M9OA 3H9NA 1OEBA 2IVWA 1VQKQ 3SB2A 2YUPA 4BY6C 3WVEB 1U1TA 5D6XA 1EIFA 1KD1U 1KIKA 3M4YA 5J39A 1QWEA 4KGZB 1H92A 3TREA 2LJ3A 1VQPA 3JCMX 3FEOA 4ELYC 2I2LA 2P0PA 4M75G 4C92C 1Q81R 1UGRB 4PJOD 4JLGA 4A4FA 2DF6A 2LNHB 2DVEA 1QCOA 3EGDB 3QSUA 4M7AA 2R5MA 2VGNA 1VQLQ 1M4ZA 1WHKA 3F70A 1YI2T 1KC8R 1B34A 3META 2QA4T 2LVMA 1IHVA 4PJJA 3L2WA 2LP5A 2PZ1A 2M51A 1AWOA 4OVAA 3E9GA 4WCIA 3CPFA 2LRQA 2K4YA 1C6VX 3MEAA 4RCBA 1QVFS 1G83A 1K8AR 1BI3A 2DAQA 2QGGA 4QQGA 2YWWA 4IUUA 4F16A 3NHNA 1B3QA 3DB4A 1JU5C 3G6ET 5IT9E 1BI1A 2CSIA 1H8KA 4C0FA 1JJ2P 3CXCP 5GAMh 1K73U 1WYXA 4M7DD 4M7DE 2C06A 4F7UA 3DKMA 2BZYA 1Q82U 1QVGA 2ED0A 4ZTFA 3OYGA 2W10A 3EG1A 4LUEA 1AWJA 4C0DC 2BE9B 3HKSA 1RLPC 1UJYA 2GBQA 4BI8B 4PJMA 1M90R 4LNPA 1VQ9A 1VQ6A 2H3EB 2L0AA 4OMOA 3CBOA 3PE0A 3S3NA 3X24B 1IGUA 3CCEA 2MWPA 3HL8A 3CCLT 1NZ9A 1V29B 4RTUA 4DQ2A 3CC7A 2DTOA 4BY6B 4ZGDB 2CZ0B 1VQOT 1WJRA 2QQSA 2EGEA 1BKBA 4M75C 9ATCB 4KGXB 2NUZA 4M78A 2CP0A 5GAN4 3QZ5B 3GLXA 4C92B 4E47A 4PNOA 2F5TX 2A36A 1G3WA 2CREA 2E6ZA 2JTEA 3MKDA 3PMIA 1C0MA 4RG2A 3CCRA 1W2BS 2O88A 4LDUA 1F1BB 5AYFA 4A53A 1SEMA 2FB7A 1SKUB 3CCQT 4ZNXA 5IAYA 1ZUYA 4R56A 1D3BB 2QEXA 4M7DF 4PJOB 4ANJA 5CIUA 1QKXA 2OJ2A 1Z9ZA 1N5ZA 4XQ3A 1WPYA 4JRQA 4JLIA 2J6FA 2EIFA 2EQIA 1PD1A 5HCKA 1MNDA 1ZSGA 1OZ2A 1GXIE 1VQ8T 2HDAA 5FROA 2B86A 1YHQT 1TTHB 4TVRA 3T9NA 4C5GA 2E5QA 2RH2A 1JQQA 3QO3A 4HVVA 4HVUA 1YI2A 2KNBB 5HKCA 1ZA2B 3RMQA 1XOVA 1VIEA 3NTIA 3JB9J 2ZGWA 3MPUB 3VRZA 4HCBA 3QWYA 2A3LA 5CO7A 1WHLA 1QWFA 4EPCA 2CUDA 4DOVA 3V8LA 2DKGA 1NLOC 2ESWA 2YUOA 3TCJA 5GANf 3RMSA 3M0QA 4NOYA 4A4KA 2OTLA 2CZ6B 3CCUT 1M1GA 1VA7A 1UB4A 2LTOA 5GJWB 3FB9A 4ESRA 1QVGP 5CKFA 5CCAA 5GAN7 1MHNA 4M7AC 2K2VA 5KYWA 3OYEA 2V1QA 2JN0A 2VGMA 2CP3A 1CSKA 3G6EA 1UDLA 1VQ4T 2GQVA 5IH2A 3G71A 3M0UA 1QCNA 4OMMA 1VYTA 4DBFA 1ZSZC 3CMEA 2LMJA 3L2ZA 3M9QA 1MMAA 3MP8A 1WIEA 3SDZA 5CR2A 4R55A 2C0IA 3MEVA 3UA7A 2YLCA 2LX7A 4J9CA 4IUPA 2EYXA 5I2SA 1D0ZA 3OY9A 1U5SA 3OYYA 2PVGB 2BE7D 4M75B 1K9MR 4FL6A 3MJXA 2XKOC 3QYGB 2MCNA 2D1XA 2LCCA 1YJWT 4BUGA 3L2UA 1CKAA 1Y07A 2KXDA 2GFAA 4VUBA 5DLQE 1UUEA 3M55A 1TWBA 2RHIA 4JJCA 1KC8C 5CK9A 4FIBA 1AZEA 5GAMd 4FSXA 1YFNA 5ECAA 3I55T 4OGEA 1IO6A 3G4SQ 1GCQC 2D0NA 2ZPHB 3BY7A 2RK1A 2LT4A 4MMKA 4JPBW 3CMAA 2XIDA 3NGPA 2K2MA 2MWOA 1ZHIA 1W4SA 4HT8A 3CQTA 3BDUA 4L59A 1ZQ1A 2FZKB 4QVZA 2GGRA 2V8IA 3LLRA 4C5HA 4N4HA 1WHHA 1MMNA 1NJIC 1UHFA 4DEXA 1WXTA 3CCMA 5FRNA 2H8HA 2K57A 5GANe 2JS0A 4M78C 4PJNA 5DLOA 3H6ZA 4WF2A 4C0GA 3UDCA 3ZL7C 3CC2T 2K3YA 2COWA 1R8OB 2QI2A 2M9UA 3OA6A 3V7SA 3VS5A 3UT1A 4E6RA 1PKTA 2CP6A 3KXTA 1VQ7T 3REBB 3JB9G 2KRNA 1AWWA 1M27C 3N5BB 2RI5A 3TSWA 3A8HB 1WXBA 1KD1R 1VQNQ 2CDTA 3TVTA 1YCSB 2AKLA 3RERA 3MEUA 1YJ9T 1FX7A 1GFDA 3L2VA 1Q7YU 2FPEA 3M0PA 4RMOA 4ME7A 2J05A 3JCMg 1G3TA 2L2PA 3OB9A 4PLIA 2VKNA 1D0XA 4IIMA 5GAOq 3GNFB 2CZ1B 2DBKA 3QZ9B 2B8AA 2E64A 2P84A 1YBYA 3S6WA 2E1HA 2HEQA 1M1KU 2J6KA 3C0CA 2DLPA 4PL6A 5KYXB 2DM1A 3CD6T 1UEBA 1TH7A 4Z8AA 2XHCA 1K9AA 1WXUA 1VQ5T 2DK3A 3U23A 1ZBXA 2QGFB 1Y71A 3VV0A 1W70A 3P8DA 3LH0A 2XK0A 4AG2C 2ZPEB 1U06A 1SSHA 3WVDB 2X4WA 2JTMA 1UHCA 2AK5A 1IZ6A 4LN2A 1X6OA 4RTZA 1XQHA 1K73R 2MOXA 5IHIA 2LQNA 3I55A 1VQPT 1RL2A 3I5SA 4J8OA 2QDLA 1X6GA 2PUKB 1HJDA 2A37A 1BYMA 4LE9A 1O9SA 1WJQA 1Q82R 1R77A 5CKBA 3V7CA 4EDUA 1QVFA 3JB9D 5AT1B 2VXFA 1YITQ 3MCAB 3I35A 3GBQA 2HBPA 3CCJQ 2JM8A 4M78B 2DJQA 4BI3A 2EGAA 1TU0B 3GF5A 1H641 1KQ2A 3GIBA 4D6WA 1YWPA 1I8FA 4OMNA 4K11A 2EJFA 7AT1B 2M0YA 3UF4A 4PK4A 3JCMh 3OMCA 6AT1B 4C92G 1EZZB 2HBWA 1D0YA 2O9SA 2Y90A 1VUBA 1ARKA 3JB9H 3L2RA 4JZ3A 2K5LA 5KH6A 1MV3A 3CCSA 2M0OA 1VQ7A 3JSCA 5L23A 3OBYA 3RR6A 1WI7A 2GTOA 3FJ5A 1AT1B 1S1NA 2QTXA 5I21A 4ZN1A 2VVKA 1BU1A 4ZGEB 2F69A 5GMKm 1GCPA 1T3LA 3G1JA 1B07A 1QQJA 1Y96A 5IXBA 2RNAA 4LDYA 1JRIA 2KQWA 3JB9F 4M77A 2KROA 1LOJA 1YCYA 3NTHA 1JO8A 4QVCA 3JCMP 1N6AA 1I1JA 3OYMA 1FMKA 4N4GA 2P0QA 3E9FA 1K1ZA 1VQ9T 1VQ6T 1G3YA 1SRMA 4J7FA 1W2BA 1EX4A 4E7JA 1Q86C 5KYWB 1KQSS 1YJNA 3OW2P 3E19A 3CC7T 2MMPA 2OTJT 5GJVB 2FEIA 2ROTA 3L42A 5LJ5d 5IHNA 1FMVA 3QJ6A 4D8KA 4KUIA 2ZPFB 1SRLA 5HK0A 1MV0B 5FU6B 4DA4A 1JB0E 4FW2A 2ED1A 2L8DA 2DL4A 2NWMA 4OF1A 2HAXA 2RQVA 3RKYA 4CC3A 2QASA 3I56Q 4XK8E 4C8QA 1D1AA 5KCHA 1IHWA 3CCRT 4E2FB 2YRDA 4LDWA 3E2UA 4MZMA 2SRCA 4C92D 4XTYA 4C92E 4J6XA 2QEXT 4AFUC 3VS0A 4MDWA 3I5RA 5GAN2 2XMFA 4QKUA 4JJBA 1GRIA 1X2QA 1KFZA 4PJOE 1SPKA 4RTTA 3HFOA 5LJ3d 4FU6A 3OSSC 2DIGA 5GAOm 2JNGA 2YLBA 3OYLA 2DXBA 2DEUA 2HMAA 1ZSZA 2KR3A 4Q5WA 1S72Q 3RUXA 1M3AA 5KYUA 5KYYA 3PGGA 4NL3A 2EQJA 2JJ9A 3OYIA 2OTLT 4BDYA 3DLLA 1BCMA 1WHMA 2PNIA 2CZ7B 5J26A 1RAIB 3V8KA 1X69A 3MEWA 1VQMQ 3GPLA 4FYWB 2KE9A 4C92F 2QXFA 4E7HA 3G71T 3PIOA 2G3RA 1W2BP 1VQKA 4J9FA 3CMET 2RM4A 2HQHA 4LD6A 5GAN6 2E3HA 1QW1A 1PSEA 4PJOF 1GCQA 1JEGA 1OOTA 4IURA 2LCLA 2X51A 4N4IA 1RLQC 3EG0A 3KBGA 2DXUA 1EFNA 2LCSA 1K73C 1E7OA 2IPOB 1UFFA 5CAIA 4HCZA 1QVPA 4M7AG 1WDXA 3J7AF 1KJWA 4J6WA 4EIKA 2QTVA 4KH0B 2RI2A 3PIPA 2XDBA 1M8MA 5EG2A 1VQLA 4GY5A 4M75D 4HCCA 2EAYA 4M75E 1SHFA 2KRMA 4JRPA 1YI2Q 2L3RA 3VS6A 2HKNA 4X9DA 4QW2A 3VKIA 3RBBB 2QA4Q 2OTJA 2Y4YA 3X26B 2P4RA 1Q7YR 4DBHA 2OAWA 3LW5E 4M77C 5HY6A 4J83A 3NPFA 4PLLA 3M5AA 1H3HA 2RO0A 3CMAT 5FW9A 3QIIA 3R6OA 2YRVA 2QDYB 1ZA1B 2RHZA 1KHCA 3VYHB 1JXMA 2XDDA 3HSBA 4LUDA 1C1AA 1QMCA 2RD1A 4B9XA 2LJ1A 2YHTA 1M1KR 1QP2A 1K4US 1KHIA 3HP9A 1UG1A 2DZ9A 5LL6S 5GMKe 1BI0A 2FPDA 3G6EQ 4F7UG 1RADB 2NUPA 1WX6A 3CCMT 2DD5A 1RAHB 2E10A 4CC7A 2L89A 4Y28E 4OB3B 4YTLA 2SEMA 5KE2A 1GBQA 3OYKA 1UTIA 4M75F 4C8QC 4P5NA 5C6SA 3BW1A 2E5KA 3RDVA 1OX8A 1GL5A 2JOYA 1U8RA 2ZCFB 2FL7A 3HFNA 2DL8A 1AZGB 4M7AD 4M7AE 1RI0A 4DBRA 3CCLQ 1M8VA 1MMDA 4C5EA 5FWCA 4M78G 1X75C 1VQOQ 1WZOA 3QHSA 5GMKl 5GAMj 4R0KA 5D6YA 2X9HA 3OMGA 4RTXA 1BIAA 3URGA 2BIVA 4C0DB 3QYHB 2VASA 2DD4A 1OV3A 2CGHA 3EFOA 3M0SA 1WQWA 4PFZA 3UATA 2L3SA 3CCQQ 1I0CA 2JTFA 1Y96B 5FLXE 1TUCA 2VWFA 5FRMA 3FC3A 1Q81C 1MUZA 4IKFA 1XNIA 2FO0A 2RN8A 2LQWA 4O6JA 1VQ8Q 2VYTA 1FYNA 3VS7A 1YHQQ 1JXOA 1SG5A 1XJWB 4F7UE 4RKUE 2DX1A 4EMHA 5GAOr 5IHKA 4M7AF 1U1SA 4EMGA 5GANg 3LWHA 2RJCA 4AFZC 1M2OA 2E70A 2DO3A 4B6MA 1B7TA 3EGUA 2LZ6B 3H41A 1NE8A 3CCVT 2FPFA 5I2MA 4CC4B 5CQXA 3JRZA 2HSEB 3CCUQ 4IUVA 1TOVA 4A4HA 1BK2A 3REAB 1K8AC 5HK3A 2ZAEA 3CBPA 3RKXA 2CP2A 2DERA 2MI6A 3VUZA 2KMTA 2AZVA 4M78D 2LX9A 3HPWA 4M78E 4C8QB 4XTZA 2DYBA 2F5KA 4FYXB 3VS2A 5LJ5e 1VQ4Q 4RG8A 3RESA 3PVQA 1PSFA 2RA2A 1HSQA 3JCMJ 3M4GA 1NJIU 5GAOl 2HL5C 2JM9A 5GMKj 4FW1A 3CCST 3VS3A 4F7UF 2RJEA 4L5GA 4M7AB 2BKDN 1E6GA 2MAMA 1KQSA 3GP8A 3SFMA 1M90C 1LCKA 2YSQA 1B34B 1H3ZA 2CT4A 1HD3A 1AOJA 1I07A 3CC4T 3H0HA 3VYGA 3PMTA 1YJWQ 1G5VA 1WA7A 2W0ZA 3HHTB 3I9QA 1X2KA 1ZSZB 4CRIA 1UGQB 4X34A 2V8KA 1BCOA 1TSFA 3DLMA 5KYUB 3I55Q 3G4SA 5KYYB 2QQ9A 3JAME 3AHUA 1WLPB 1PWTA 2CP7A 2FYKA 3LH5A 1J3TA 5LJ3e 4E7ZA 2MPXC 1UGPB 2FRWA 5I11A 3J81E 1HYOA 4M78F 2XDPA 2RQTA 5GANh 4BDZA 1YJNT 4XAXB 4GBQA 3VU3C 2ZPBB 4KULA 1LNXA 3LX7A 1X6BA 2MIOA 1SSFA 3ME9A 4JRIA 2JMCA 4IIOA 1D1BA 2EKOA 2E12A 1RI9A 4F7UB 1RABB 2MK5A 3L2QA 3D7SB 2EYYA 1FWZA 1AWXA 3CC2Q 3EGXA 1N8RU 3LYIA 2AZSA 3BFMA 4OMLA 2JT4A 5A2QE 5D7UA 2HQXA 1VQ7Q 2VXEA 3CPWS 2O01E 2P0KA 2X4YA 2BZXA 2DXCA 2J7IA 5FWBA 1OPKA 4RCCA 5FU7C 2XD0A 8ATCB 1VQNA 4RTVA 1IRXA 4J9EA 1YJ9Q 3CCVA 2AIRB 2JXBA 2ZPIB 4E7IA 1W1FA 5CVIA 1IGQA 1N9RA 3OYBA 1XTDA 4ZN3A 1N9SA 1P92A 1JBMA 3C4SA 5A0DA 2M16A 4XU2A 5I22A 4LXCA 2GFUA 1CKBA 4Z89A 3C12A 4PFPA 3CD6Q 3JCMc 1ABOA 5GAOn 2H3JA 4F14A 1PD0A 1V1CA 3WXMB 1VQ5Q 1YIJT 1X27A 1FXXA 2PTKA 2NUPB 3IQLA 3MHXA 5LJ5j 2XG8D 3LWIA 5IN1A 2FZGB 5GAMf 2NLUA 2PUOB 4FCYA 3OYHA 1O75A 4KUDK 4CC2A 1VQKT 4J9GA 1K9MC 2EJ9A 4M7DA 3H0IA 2E65A 3UA6A 1QCFA 2EVRA 4Z88A 3CC4A 2RJDA 1NEBA 2EYWA 3EAEA 1WJSA 2DPPB 3HRTA 1E6HA 3EHQA 1WNLA 3EG3A 2X35A 1VQPQ 4Y92A 1D1CA 3C95A 1NPPA 1UGSB 2E3IA 1R0BG 2X4XA 2KT1A 2EYZA 2COZA 4Y91A 1NLPC 3QDFA 2RPNA 1VQLT 4LDVA 3G7ZA 4X1VA 4A54A 1X43A 3QG1A 1VYUA 2F2WA 1WHGA 2F1LA 1Y0MA 1Q86U 2NYSA 3CBMA 1TG0A 1W6XA 5LJ3j 4XTXA 4J9BA 2XICA 2QG9B 1QLYA 2RK2A 3PFSA 2KAFA 4XU3A 2WSCE 3EFOB 1QVFP 3PVLA 4GLKA 5FU7B 1G3SA 1T0JA 2MF2A 4MDXA 1M5Q1 5GAMg 1X01A 1RAFB 2YUNA 5GAN5 1G8XA 1ZLMA 2HL3A 1PRMC 3RNJA 5GAN3 2ATCB 4QT7A 4M7DG 2EPDA 1MNEA 1ABQA 4XTWA 5CKEA 2DETA 4M77G 1KD1C 3OYCA 2DILA 3M0RA 3OYFA 2OAUA 4DOWA 3OQ5A 4J6YA 2DA9A 1OX9A 2GF7A 1AD5A 1HXDA 3QWXX 1KK7A 2A0FB 2L5QA 1M2VA 1RAAB 3A8GB 5IXFA 4NS5A 4D8DA 4OGCA 2QQRA 4E7KA 3JB9I 5GAMe 1VQ9Q 3QBYA 1VQ6Q 2C0OA 1AEYA 1WGSA 1PHTA 3OBWA 3EH2A 2J06A 2ROLA 3CCEQ 4PJOC 2LQKA 2DL3A 3V8JA 1AHJB 3NMZC 3JCMV 2RB6A 3CC7Q 1OI1A 3MO8A 3OW2S 2K79A 2O4XA 2J6OA 3VJPA 1NYGA 2OTJQ 1K76A 1YIJA 3OYNA 2WACA 2RQWA 3KUFA 3ZEHA 1UGVA 4C8QG 1I4K1 3M53A 4BB7A 1BB9A 4HXJA 4XTUA 3I56A 3JCMb 3VUBA 1M1FA 4IUTA 2JZ2A 3ZFJA 2EQKA 3CCRQ 3H0FA 4N0AC 5KYXA 4F17A 1TUDA 2QAZA 2KYMA 1Q95G 3JCMd 3P8HA 2QEXQ 4DEYA 1KG1A 2MYSA 1MMGA 1OYXA 2G6FX 4JUVA 1NJIR 1U3OA 1NBEB 1HK9A 2JUFA 4L6V5 1Q82C 1OPLA 2DL7A 2LJ0A 4X9CA 4ATOA 3QJYA 3VRYA 2KVQG 2Z0WA 4A4GA 4M77D 4II1A 2M02A 4M77E 2VC8A 3Q1JA 4MZPA 4M7DC 2R5AA 2R57A 2DMOA 2EJGA 1PC0A 2HSPA 1S72A 2KDSA 2KY9A 3M56A 1G2BA 2BTTA 1LPLA 4EMKA 1RACB 4E7LA 3V7RA 2HCKA 2V1RA 2VB6A 2EQMA 2CSQA 2OTLQ 2QQAA 1R0CB 5DY9A 2LT1A 3S3OA 1PG5B 3KFVA 4LD9K 2X3XD 4V2SA 2LDMA 2M1HA 3X28B 1VQMA 1ZX6A 4NL2A 1K0SA 3HRSA 2A08A 1BIBA 4JZ4A 2L3PA 2BUDA 2RQUA 1K0XA 4AT1B 1Y57A 5KYNA 2EBPA 1PKSA 1GFCA 3EGXB 3G71Q 3BE3A 4O5VA 3OS2A 3CMEQ 4C8QD 4C8QE 1JJ2S 2A7YA 2E4HA 3CXCS 3A8LB 3FRNA 2DTHA 3L1AA 1UECA 1D09B 4ZTJA 3R6NA 5J3BA 2DL5A 3O8VA 3M54A 2GQIA 2KXCA 4M77F 1N8RR 4PJLA 3SWNA 4JJDA 1YWOA 4HA8A 1PM3A 1OULA 5LJ5f 3FJPA 4LDXA 4OP0A 4PKCC 3OYJA 4C0ZA 4BI4A 3TEEA 1PRLC 1Z9QA 3UPUA 2YRCA 2ZPGB 1A0NB 2RI3A 2Y4XA 2CP5A 2O2OA 2QA4A 2DE0X 4BE0A 4FSSA 3A8MB 3G4ST 4QVDA 4ORZA 4RTWA 1NM7A 4OB2B 5GMKh 2D6FA 3EG9A 2CH4A 1T0HA 3GOXA 2XU8A 3MP1A 2D8JA 2K7AA 1ZUKA 1TS9A 2R58A 5L8RE 2GNCA 2EQUA 3CMAQ 2ZZDA 2VV5A 4AMCA 2CUBA 4ELZC 3CPWA 1VOMA 2I0NA 1OZ3A 3EG2A 4C8QF 4AFSC 1VYVA 4MMLA 2RHXA 3VS4A 2AHJB 1VIFA 2C0TA 2JVVA 1OU9A 4M7DB 2KGTA 5LJ3f 2X3WD 2NUTA 2KK4A 2RF0A 4IUQA 2EW3A 2CH4W 3FDRA 3CCMQ 4FT2A 4M77B 3INZA 5EC7A 2DYIA 2HZYA
chains in the Genus database with same CATH topology
2EKOA 2E12A 1Q81U 3E19A 3J80E 3CC7T 5LJ5g 2MMPA 1VQ9A 1VQ6A 4F7UB 2OTJT 3L2QA 3CBOA 3S3NA 5LJ5d 1M9SA 3L42A 1FWZA 3X24B 3QJ6A 4KUIA 3QDRB 3CCEA 2MWPA 3HL8A 3EFSA 2ZPFB 5HK0A 1I81A 3CCLT 1NZ9A 1V29B 1KC8U 5FU6B 4DQ2A 1JB0E 3LYIA 3CC7A 4DA4A 1YJ9T 2DTOA 3BFMA 4OMFB 4BY6B 2L8DA 2CZ0B 4ZGDB 1VQOT 1VQNT 4JS4A 1WJRA 5A0GA 5GMKi 5A2QE 2QQSA 4OF1A 2HAXA 1BKBA 2HQXA 1N27A 2VXEA 4M75C 3RKYA 2PU9B 4XK8E 4C8QA 2O01E 2P0KA 2X4YA 3CPWS 2DXCA 4M78A 3CCLA 3GNGA 5KCHA 3CCRT 4RCCA 3EFRA 4LDWA 5GAN4 4MZMA 5FU7C 2XD0A 3QPHA 1VQOA 4C92D 1VQNA 4XTYA 3QZ5B 4C92E 2PVOB 3GLXA 4HT9A 4C92B 4J6XA 2QEXT 4JRKA 3LGLA 4E47A 2LC4A 4MDWA 4PNOA 2F5TX 1G3WA 3CCVA 2E6ZA 5GAN2 1QVGS 3PNWC 3PMIA 1K8AU 4RG2A 3CCRA 2ZPIB 3JCMf 1W2BS 4E7IA 5CVIA 4LDUA 5AYFA 4PJOE 4A53A 1N9RA 2FB7A 1XTDA 5IAYA 4R56A 3OYBA 4KBMB 1D3BB 4ZN3A 2QEXA 4M7DF 1N9SA 3OYDA 4PJOB 3LGFA 5CIUA 4Z02A 1P92A 1JBMA 2HNIA 1QP3A 3C4SA 1Y7XA 4XQ3A 3RKWA 1WPYA 4JRQA 4EMKC 5LJ3g 4JLIA 5A0LA 2EIFA 4B9WA 2M16A 5A0DA 4XU2A 5CKHA 3HFOA 5LJ3d 4FU6A 3CCQA 2GFUA 1OZ2A 1GXIE 3OSSC 2DIGA 1VQ8T 5GAOm 3C12A 5FROA 2JNGA 2YLBA 3OYLA 2DXBA 1YHQT 4TVRA 3T9NA 4C5GA 2E5QA 4XU1A 3JCMQ 2RH2A 1WQ7A 4Q5WA 3JCMc 3QO3A 3RUXA 5GAOn 1YI2A 2P4TA 5HKCA 3RMQA 1XOVA 2H3JA 1VIEA 3NTIA 3JB9J 2ZGWA 3PGGA 4NL3A 3SD4A 2EQJA 3WXMB 4HCBA 3OYIA 3OS0A 1YIJT 1VQ8A 2A3LA 1FXXA 2HD0A 3BDLA 2RJFA 3MHXA 5LJ5j 3DLLA 4BDYA 2XG8D 3QXEB 5CO7A 3LWIA 5IN1A 1YHQA 4EPCA 4BD3A 2CZ7B 3NFCA 4DOVA 1M90U 3V8LA 3HRUA 2NLUA 2PUOB 5GAMf 2DKGA 3OYHA 1O75A 4KUDK 2IG0A 5J26A 3TCJA 3V8KA 5GANf 3RMSA 5CKDA 2EJ9A 1K9MC 1VQKT 4M7DA 2CS7A 4NOYA 2K5IA 4A4KA 4J5YA 2CZ6B 2OTLA 4JS5A 3MEWA 3CCUT 1M1GA 3GPLA 2E65A 4ZGJB 1UB4A 2QXFA 4C92F 3OS1A 3CC4A 2RJDA 2LTOA 1Q7YC 2D9TA 3EAEA 3FB9A 4E7HA 1WJSA 2DPPB 3HRTA 1MHNA 2DJZA 5CKFA 5CCAA 5GAN7 3G71T 3PIOA 3S3MA 4M7AC 2G3RA 2K2VA 1VQKA 1WNLA 5LJ5h 3OYEA 1YITT 2X35A 3CMET 2RM4A 4LD6A 5GAN6 3MP6A 2O4XB 3CCUA 3C95A 1QW1A 2JN0A 2VGMA 1NPPA 3RIRA 1PSEA 1UGSB 4PJOF 3CCJT 3SWNC 2PVDB 4IURA 2X4XA 3G6EA 2XI9A 2LCLA 2GQVA 4N4IA 5CQYA 4A4EA 3G71A 1VQ4T 3KBGA 4Y91A 4BE1A 1N8RU 2DXUA 3CMEA 4CI0C 1K73C 1VQLT 3L2ZA 3H8ZA 3M9QA 5CAIA 4HCZA 4LDVA 1QVPA 3G7ZA 3MP8A 4A54A 4FT4A 1M1KC 4M7AG 3X25B 3E1SA 3SDZA 5CR2A 3QG1A 4R55A 3J7AF 2EWNA 4J6WA 3MEVA 1VQ4A 2YLCA 1Q86U 3CBMA 2RI2A 4IUPA 3PIPA 5I2SA 2XDBA 4FM4B 5LJ3j 5EG2A 1VQLA 4XTXA 4BACA 2XICA 3OY9A 2EYQA 3C94A 4GY5A 4M75D 3OYYA 4HCCA 2RHUA 2EAYA 2GCXA 2PVGB 2RK2A 4M75E 4M75B 3CEYA 4BE2A 4JRPA 1MGQA 3TU4K 2DZCA 2KAFA 2L3RA 2CYZB 3PFSA 2WSCE 4FL6A 4X9DA 4XU3A 4C92A 4QW2A 3VKIA 2XKOC 3DB3A 3QYGB 4GLKA 2PQWA 2OTJA 2Y4YA 2LCCA 3X26B 5FU7B 1G3SA 1YJWT 2MF2A 4MDXA 4BUGA 3L2UA 1NPRA 1M5Q1 1Y07A 5DLQE 2GFAA 4VUBA 1X01A 3LW5E 4M77C 5HY6A 3M55A 5GAMg 4PJOA 2RHIA 1D3BA 4MZTA 5GAN5 5CK9A 4FIBA 4J83A 3JCMe 1KC8C 1N8RC 5GAMd 5LJ3h 4FSXA 3I55T 4PLLA 3M5AA 3M58A 4OGEA 5GAN3 2RO0A 3CMAT 3P8BB 2ZPHB 1YJWA 4M7DG 3QIIA 3BY7A 3R6OA 3OW2A 2DXTA 2YRVA 2QDYB 2RHZA 1KHCA 3VYHB 4XTWA 2XDDA 3HSBA 2X4JA 2RK1A 2RD1A 4B9XA 3ER0A 5FU6C 5CKEA 2E41A 4EMKB 2LT4A 3ZBDA 2YHTA 1QP2A 4M77G 1KHIA 3HP9A 1KD1C 3OYCA 4MMKA 2DZ9A 5LL6S 5GMKe 3CMAA 1BI0A 2XIDA 2MWOA 4XU0A 3OYFA 1ZHIA 2OAUA 1W4SA 3OQ5A 4DOWA 1IREB 4J6YA 3JCMW 4HT8A 4F7UG 4OB0B 3BDUA 4L59A 2GF7A 1HXDA 1DJ7B 2DEQA 5D6WA 1ZQ1A 3CCMT 4N0AA 2WSEE 2L5QA 2DD5A 3A8GB 4QVZA 3PTAA 3OYAA 2V8IA 4NS5A 2E10A 3LLRA 4C5HA 4N4HA 2L89A 4Y28E 4OB3B 4YTLA 4OGCA 2QQRA 4E7KA 3JB9I 5GAMe 5KE2A 4JJNK 3QBYA 3M59A 2D0QB 1NJIC 1WGSA 3CCMA 5FRNA 3OYKA 3QKJA 4C8QC 4M75F 2K57A 4HKEA 5GANe 4QQDA 4M78C 5DLOA 3H6ZA 3OBWA 4P5NA 3BW1A 4WF2A 4C0GA 5C6SA 3CCQT 3UDCA 3CC2T 4PJOC 2K3YA 2RHYA 1R8OB 2LQKA 2M9UA 2QI2A 3OA6A 3V7SA 2LQ8A 3UT1A 1AHJB 3V8JA 2K3XA 2QQBA 2RB6A 3JCMV 2JOYA 1OI1A 1U8RA 3MO8A 2ZCFB 3KXTA 3OW2S 2FL7A 1VQ7T 3HFNA 2O4XA 3VJPA 3I56T 4M7AD 3JB9G 1KQ1A 4M7AE 1YIJA 3OYNA 1RI0A 5KE3A 3N5BB 2WACA 3CC2A 3KUFA 3ZEHA 2RI5A 1M8VA 3A5ZB 4C8QG 4JDSA 3OS5A 1K9MU 4C5EA 4M78G 1X75C 1I4K1 3A8HB 3M53A 4BB7A 4PJOG 3RERA 3ASKA 3MEUA 3QHSA 4XTUA 4XTVA 3SWNB 1FX7A 5GMKl 3JCMb 5GAMj 3I56A 3VUBA 1LJOA 1M1FA 2V8JA 3OMGA 5D6YA 3L2VA 1Q7YU 2DIQA 5GANj 4IUTA 1BIAA 3URGA 2JZ2A 3ZFJA 4RMOA 2EQKA 4ME7A 3JCMg 2C06A 1G3TA 4N0AC 2VUBA 2BIVA 4C0DB 3OB9A 3QYHB 4PLIA 3JCMd 3P8HA 2DD4A 4KT0E 2HQEA 1YJ9A 2WSFE 1KG1A 4M75A 1YITA 5GAOq 3GNFB 2CGHA 2CZ1B 3QZ9B 1OYXA 2B8AA 2E64A 4JUVA 2KSSA 3OSVA 3CCJA 1WQWA 1YBYA 3NTKA 1HK9A 2JUFA 3S6WA 2E1HA 4L6V5 5GAN8 1M1KU 1Q82C 2DTIA 4PL6A 3CD6T 3QUIA 4OB1B 1UEBA 2JTFA 4QQ6A 1TH7A 2FHDA 2LNVA 1Y96B 1BI2A 5KCOA 1S72T 2XHCA 4X9CA 3UWNA 5FLXE 4ATOA 5FRMA 3QJYA 2KVQG 1I5LA 4A4GA 4M77D 3FC3A 3M57A 4II1A 1Q81C 3A8OB 4M77E 4MZPA 2DK3A 2VC8A 3Q1JA 1VQ5T 4M7DC 2EFIA 4C5IA 3CCET 2R5AA 1XNIA 1JJ2A 3PT9A 3CXCA 4IKFA 1ZBXA 2E6NA 4O6JA 3CD6A 1Y71A 2VYTA 3FIFA 2R57A 2K5FA 2EJGA 3VV0A 1S72A 2KDSA 2KY9A 3FLGA 3M56A 4F7UE 3P8DA 4RKUE 4EMHA 3LH0A 2XK0A 4EMKA 5GAOr 4E7LA 2ZPEB 3WVDB 4M7AF 1U1SA 4EMGA 1VQ5A 2X4WA 3V7RA 5GANg 2RJCA 5C0MA 2JTMA 3LWHA 2CKKA 1VQMT 2EQMA 5DM7R 5GAOp 2E70A 2DO3A 5GANd 2QQAA 5DY9A 1IZ6A 2LT1A 3S3OA 4J7IA 4UC4A 3X20B 1X6OA 2FVUA 5M9OA 4LD9K 1XQHA 2IVWA 1NE8A 4V2SA 3I55A 2LDMA 2M1HA 3SB2A 3CCVT 5I2MA 3X28B 4BY6C 1RL2A 4NL2A 1VQPT 4J8OA 1VQMA 3WVEB 3HRSA 2PUKB 3JRZA 5CQXA 1BIBA 1BYMA 1U1TA 4IUVA 2BUDA 1O9SA 5D6XA 1EIFA 4A4HA 1WJQA 1KD1U 1K8AC 5HK3A 5CKBA 3V7CA 4EDUA 1QVFA 3JB9D 3M4YA 4O5VA 5J39A 3CBPA 3OS2A 3RKXA 3TREA 2MI6A 3VUZA 2VXFA 3JCMX 1VQPA 3FEOA 2KMTA 4C8QD 4ELYC 2I2LA 2P0PA 3MCAB 4M75G 4C8QE 4M78D 2LX9A 2HBPA 4C92C 3HPWA 4M78E 4C8QB 1UGRB 1JJ2S 4JLGA 2A7YA 4A4FA 3CXCS 4PJOD 4M78B 3A8LB 3FRNA 4XTZA 2DTHA 4BI3A 3L1AA 2F5KA 5LJ5e 3GF5A 1H641 4RG8A 2DVEA 4ZTJA 1KQ2A 3RESA 3GIBA 4D6WA 5J3BA 2OTLT 3QSUA 3O8VA 4M7AA 1PSFA 2RA2A 1I8FA 2R5MA 2VGNA 3M54A 1M4ZA 3F70A 3JCMJ 3M4GA 2EJFA 1YI2T 4M77F 1NJIU 1B34A 5GAOl 5GMKj 3META 3SWNA 4HA8A 2LVMA 5LJ5f 2QA4T 3JCMh 3OMCA 3FJPA 4LDXA 4OP0A 4C92G 3CCST 3L2WA 4F7UF 4PKCC 3OYJA 4C0ZA 4BI4A 3TEEA 3UPUA 2RJEA 2ZPGB 4L5GA 4M7AB 2BKDN 2RI3A 2Y4XA 4OVAA 2MAMA 2Y90A 1VUBA 3E9GA 1KQSA 3JB9H 3L2RA 2QA4A 2K5LA 3SFMA 3GP8A 5KH6A 1M90C 3CPFA 4BE0A 2LRQA 3A8MB 3CCSA 1B34B 3G4ST 4QVDA 2M0OA 2K4YA 1VQ7A 1H3ZA 3JSCA 3OBYA 3MEAA 4RCBA 3CC4T 1QVFS 3VYGA 2QTXA 3PMTA 4OB2B 5I21A 5GMKh 1BI3A 4ZN1A 2D6FA 1G5VA 2DAQA 4ZGEB 2F69A 3HHTB 5GMKm 3GOXA 2XU8A 3MP1A 4CRIA 1UGQB 4QQGA 4X34A 4IUUA 2R58A 2V8KA 3DLMA 5L8RE 1Y96A 3G4SA 2EQUA 4LDYA 3DB4A 2QQ9A 3JAME 3AHUA 3G6ET 2FYKA 1JRIA 2VV5A 2ZZDA 2KQWA 5IT9E 3JB9F 4ELZC 1BI1A 5LJ3e 4M77A 3CPWA 1LOJA 4C0FA 1UGPB 3J81E 1OZ3A 1YCYA 1K73U 5GAMh 4C8QF 3NTHA 4M7DD 4M78F 4MMLA 2RHXA 4QVCA 3JCMP 2XDPA 4M7DE 2AHJB 4F7UA 1N6AA 1VIFA 3DKMA 2JVVA 5GANh 3OYMA 4BDZA 1YJNT 4M7DB 4XAXB 3VU3C 2ZPBB 4KULA 1LNXA 5LJ3f 4N4GA 2P0QA 3E9FA 3LX7A 1VQ9T 1Q82U 1VQ6T 1G3YA 1QVGA 2KK4A 1SSFA 4J7FA 3ME9A 4ZTFA 4IUQA 3OYGA 4JRIA 3FDRA 4C0DC 1W2BA 4E7JA 4FT2A 1Q86C 4M77B 3INZA 3HKSA 1KQSS 4BI8B 1YJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB9 A;  4NL2 A;  5GAN 7;  2DJZ A;  4C8Q C;  4M75 F;  2K57 A;  4M7A C;  5GAN e;  1BIB A;  5LJ5 g;  1U1T A;  4M78 C;  1WNL A;  4WF2 A;  5LJ5 h;  3BW1 A;  4F7U B;  4PJO C;  2RM4 A;  5GAN 6;  5LJ5 d;  3V7C A;  3RIR A;  2JN0 A;  3V7S A;  3V8J A;  3JB9 D;  3JCM V;  2RB6 A;  4PJO F;  3SWN C;  3RKX A;  3EFS A;  1I81 A;  2VXF A;  3JCM X;  3HFN A;  4DQ2 A;  4C8Q D;  2I2L A;  4M7A D;  2DTO A;  1KQ1 A;  3BFM A;  4M75 G;  4M78 D;  4Y91 A;  4C8Q E;  2DXU A;  4C92 C;  3JB9 G;  4M7A E;  4M78 E;  4C8Q B;  4PJO D;  5GMK i;  4M78 B;  4XTZ A;  3L2Z A;  2DTH A;  3L1A A;  5LJ5 e;  4M75 C;  3RKY A;  2VXE A;  4C8Q G;  5CAI A;  1H64 1;  4M7A G;  1KQ2 A;  2DVE A;  4A54 A;  4M78 G;  3RES A;  1I4K 1;  4C8Q A;  3GIB A;  4M7A A;  3QSU A;  4PJO G;  4M78 A;  2RA2 A;  2EWN A;  1I8F A;  4J6W A;  3RER A;  2YLC A;  4RCC A;  3QHS A;  3EFR A;  4XTV A;  4XTU A;  3SWN B;  5GMK l;  3JCM b;  5GAM j;  3M4G A;  5GAN 4;  2EJF A;  3JCM J;  1LJO A;  4C92 D;  4XTY A;  4M77 F;  1B34 A;  4C92 E;  5LJ3 j;  5GMK j;  5GAO l;  5GAN j;  1BIA A;  4HT9 A;  4XTX A;  3SWN A;  4J6X A;  4C92 B;  4HA8 A;  5LJ5 f;  4M75 D;  4JRK A;  3JCM g;  4N0A C;  2EAY A;  4M75 E;  3FJP A;  4PNO A;  3JCM h;  4OP0 A;  4C92 G;  4M75 B;  5GAN 2;  1MGQ A;  2DZC A;  4XU3 A;  4C92 A;  4F7U F;  3JCM d;  4X9D A;  3JCM f;  4M75 A;  4M7A B;  5GAO q;  4PJO E;  4A53 A;  2CGH A;  1N9R A;  2FB7 A;  2Y90 A;  4M7D F;  4PJO B;  1D3B B;  3JB9 H;  1N9S A;  2E64 A;  4JUV A;  1WQW A;  1M5Q 1;  5GAM g;  1HK9 A;  1X01 A;  1B34 B;  1JBM A;  2HNI A;  4M77 C;  2E1H A;  4QVD A;  4PJO A;  3RKW A;  1D3B A;  4XQ3 A;  1WPY A;  5GAN 8;  4EMK C;  3JCM e;  5GAN 5;  5LJ3 g;  4RCB A;  4JLI A;  5GAM d;  5LJ3 h;  2DTI A;  2QTX A;  5I21 A;  3QUI A;  5GMK h;  4XU2 A;  1TH7 A;  3HFO A;  5GMK m;  1Y96 B;  5GAN 3;  5LJ3 d;  4X9C A;  4M7D G;  3BY7 A;  5GAO m;  2DXT A;  2YLB A;  1I5L A;  1Y96 A;  4M77 D;  4XTW A;  3HSB A;  4M77 E;  4M7D C;  2VC8 A;  4XU1 A;  3JCM Q;  2RD1 A;  1WQ7 A;  3JCM c;  3QO3 A;  3RUX A;  3AHU A;  5GAO n;  2E41 A;  3FIF A;  4EMK B;  2FYK A;  2YHT A;  1JRI A;  4M77 G;  2EJG A;  3JB9 J;  2ZGW A;  3JB9 F;  3PGG A;  4NL3 A;  5LJ3 e;  4MMK A;  2DZ9 A;  4M77 A;  5GMK e;  4F7U E;  1LOJ A;  4EMH A;  5GAO r;  4EMK A;  4XU0 A;  1YCY A;  5LJ5 j;  5GAM h;  4C8Q F;  3JCM W;  4J6Y A;  4M7A F;  1U1S A;  4EMG A;  4F7U G;  4HT8 A;  4M78 F;  4MML A;  3V7R A;  3BDU A;  4QVC A;  5GAN g;  3JCM P;  4M7D D;  5GAN h;  1HXD A;  3V8L A;  4F7U A;  4M7D E;  2DEQ A;  5GAM f;  4M7D B;  2DKG A;  4N0A A;  5GAO p;  3VU3 C;  5GAN d;  1LNX A;  5LJ3 f;  5DY9 A;  3V8K A;  5GAN f;  2EJ9 A;  4M7D A;  4NOY A;  2E10 A;  4J5Y A;  4JRI A;  1M8V A;  4M77 B;  2E65 A;  3INZ A;  4C92 F;  3JB9 I;  5GAM e;  4V2S A;  3SB2 A; 
#chains in the Genus database with same CATH topology
 1Q81 U;  3J80 E;  5LJ5 g;  1UJ0 A;  2EKH A;  2KI7 A;  1OQK A;  4DBQ A;  1M9S A;  3QDR B;  3EFS A;  1I81 A;  3THK A;  1KC8 U;  4OMF B;  1VQN T;  4JS4 A;  3EH1 A;  5A0G A;  2DRK A;  5GMK i;  3EHR A;  1N27 A;  2PU9 B;  2K3B A;  4J9I A;  3CCL A;  3GNG A;  3EFR A;  2DNU A;  3A1P A;  3QPH A;  3EGD A;  1VQO A;  2OI3 A;  2KT8 A;  2PVO B;  2DVJ A;  4HT9 A;  4JRK A;  3LGL A;  2LC4 A;  2QK0 A;  1YNZ A;  1QVG S;  4AFQ C;  3PNW C;  1K8A U;  1RAG B;  2JS2 A;  4FYV B;  4PFO A;  3JCM f;  3AT1 B;  1Q86 R;  4KBM B;  3OYD A;  3LGF A;  1M30 A;  2ECZ A;  2L3Q A;  3SHW A;  4Z02 A;  2HNI A;  1QP3 A;  1Y7X A;  3RKW A;  4EMK C;  5LJ3 g;  5A0L A;  4B9W A;  1IB8 A;  5CKH A;  2YT6 A;  3CCQ A;  4FYY B;  1V76 A;  3ULR B;  1UE9 A;  1BBZ A;  3TSZ A;  4XU1 A;  3JCM Q;  1WQ7 A;  4GLM A;  2P4T A;  2F2X A;  1AVZ C;  3SD4 A;  3OS0 A;  2YXY A;  1VQ8 A;  3BDL A;  2HD0 A;  2RJF A;  4RTY A;  1YHQ A;  3QXE B;  2KBT A;  1PCX A;  1M2V B;  4BD3 A;  8AT1 B;  3NFC A;  1M90 U;  3CPW P;  3HRU A;  1OU8 A;  2IG0 A;  1QKW A;  5CKD A;  1RAE B;  2AKK A;  2CS7 A;  2K5I A;  4J5Y A;  2F2V A;  4JS5 A;  4ZGJ B;  3OS1 A;  4HCK A;  1Q7Y C;  2D9T A;  1T3S A;  2DJZ A;  3S3M A;  5LJ5 h;  2K9G A;  1YIT T;  3CCV Q;  1GBR A;  3MP6 A;  2O4X B;  3CCU A;  3RIR A;  3CCJ T;  3SWN C;  2PVD B;  2O9V A;  2XI9 A;  1YP5 A;  5CQY A;  4A4E A;  4BE1 A;  1FMW A;  2AT1 B;  4CI0 C;  4HVW A;  3H8Z A;  1M1K C;  1RUW A;  2BZ8 A;  4FT4 A;  3X25 B;  3E1S A;  2FZC B;  2EWN A;  1VQ4 A;  2OX7 A;  4E7S A;  3SEM A;  4FM4 B;  4BAC A;  2EYQ A;  3C94 A;  2O31 A;  2RHU A;  2GCX A;  2QYZ A;  3CEY A;  3O5Z A;  4BE2 A;  3TU4 K;  1MGQ A;  2DZC A;  4C92 A;  2CYZ B;  1YN8 A;  2COY A;  3DB3 A;  2PQW A;  3CCS Q;  4KRT A;  4M4Z A;  1NPR A;  2KRS A;  1I5O B;  4PJO A;  1D3B A;  4MZT A;  3JCM e;  1N8R C;  3M0T A;  1SF9 A;  5LJ3 h;  1ZBJ A;  3M58 A;  3P8B B;  1YJW A;  3OW2 A;  2DXT A;  2YUQ A;  4WTO B;  3CC4 Q;  2DFU A;  2X4J A;  2K6D A;  3ER0 A;  1KSW A;  5FU6 C;  2E41 A;  4EMK B;  3ZBD A;  2FRY A;  2DBM A;  4KH1 B;  2RQR A;  4XU0 A;  3JCM W;  1IRE B;  4OB0 B;  1KQS P;  1NG2 A;  1DJ7 B;  4OMQ A;  2DEQ A;  5D6W A;  4N0A A;  1SHG A;  2WSE E;  1ZUU A;  2D8H A;  3PTA A;  2ENM A;  4AG1 C;  3OYA A;  1YJN Q;  1NEG A;  4JJN K;  2CT3 A;  2EGC A;  2D0Q B;  3M59 A;  3QKJ A;  4HKE A;  4QQD A;  4J9H A;  2RHY A;  2YDL A;  2LQ8 A;  1LVK A;  2K3X A;  2QQB A;  3TQ7 P;  3I56 T;  2KYB A;  1KQ1 A;  4RUG A;  5KE3 A;  3CC2 A;  3A5Z B;  2JMA A;  4JDS A;  3OS5 A;  1K9M U;  4PJO G;  3ASK A;  3SWN B;  3VS1 A;  4XTV A;  1TUG B;  1LJO A;  2V8J A;  2DIQ A;  5GAN j;  2VUB A;  4J9D A;  4KT0 E;  2HQE A;  2DRM A;  1WHJ A;  1YJ9 A;  2WSF E;  4M75 A;  1YIT A;  2JW4 A;  2RMO A;  2IIM A;  1PNJ A;  2KSS A;  3OSV A;  3CCJ A;  3EG9 B;  3NTK A;  5GAN 8;  4A63 B;  2DTI A;  3QUI A;  4OB1 B;  4QQ6 A;  2FHD A;  2LNV A;  3A98 A;  1BI2 A;  5KCO A;  4OMP A;  1S72 T;  3UWN A;  2KEA A;  2GTJ A;  1I5L A;  3M57 A;  1IXD A;  3A8O B;  3JV3 A;  2FG0 A;  2EFI A;  4C5I A;  3CCE T;  1JJ2 A;  1M3B A;  3PT9 A;  2ABL A;  1NYF A;  3CXC A;  2E6N A;  3CD6 A;  3FIF A;  2K5F A;  3HTR A;  1TXQ A;  3FLG A;  4KGV B;  1M3C A;  1ACM B;  1VQ5 A;  2V26 A;  5C0M A;  1WFW A;  2NUT B;  2CKK A;  1VQM T;  1YIJ Q;  5DM7 R;  5GAO p;  4F04 B;  5GAN d;  2A28 A;  2HKQ B;  4J7I A;  4UC4 A;  3X20 B;  2FVU A;  5M9O A;  3H9N A;  1OEB A;  2IVW A;  1VQK Q;  3SB2 A;  2YUP A;  4BY6 C;  3WVE B;  1U1T A;  5D6X A;  1EIF A;  1KD1 U;  1KIK A;  3M4Y A;  5J39 A;  1QWE A;  4KGZ B;  1H92 A;  3TRE A;  2LJ3 A;  1VQP A;  3JCM X;  3FEO A;  4ELY C;  2I2L A;  2P0P A;  4M75 G;  4C92 C;  1Q81 R;  1UGR B;  4PJO D;  4JLG A;  4A4F A;  2DF6 A;  2LNH B;  2DVE A;  1QCO A;  3EGD B;  3QSU A;  4M7A A;  2R5M A;  2VGN A;  1VQL Q;  1M4Z A;  1WHK A;  3F70 A;  1YI2 T;  1KC8 R;  1B34 A;  3MET A;  2QA4 T;  2LVM A;  1IHV A;  4PJJ A;  3L2W A;  2LP5 A;  2PZ1 A;  2M51 A;  1AWO A;  4OVA A;  3E9G A;  4WCI A;  3CPF A;  2LRQ A;  2K4Y A;  1C6V X;  3MEA A;  4RCB A;  1QVF S;  1G83 A;  1K8A R;  1BI3 A;  2DAQ A;  2QGG A;  4QQG A;  2YWW A;  4IUU A;  4F16 A;  3NHN A;  1B3Q A;  3DB4 A;  1JU5 C;  3G6E T;  5IT9 E;  1BI1 A;  2CSI A;  1H8K A;  4C0F A;  1JJ2 P;  3CXC P;  5GAM h;  1K73 U;  1WYX A;  4M7D D;  4M7D E;  2C06 A;  4F7U A;  3DKM A;  2BZY A;  1Q82 U;  1QVG A;  2ED0 A;  4ZTF A;  3OYG A;  2W10 A;  3EG1 A;  4LUE A;  1AWJ A;  4C0D C;  2BE9 B;  3HKS A;  1RLP C;  1UJY A;  2GBQ A;  4BI8 B;  4PJM A;  1M90 R;  4LNP A;  1VQ9 A;  1VQ6 A;  2H3E B;  2L0A A;  4OMO A;  3CBO A;  3PE0 A;  3S3N A;  3X24 B;  1IGU A;  3CCE A;  2MWP A;  3HL8 A;  3CCL T;  1NZ9 A;  1V29 B;  4RTU A;  4DQ2 A;  3CC7 A;  2DTO A;  4BY6 B;  4ZGD B;  2CZ0 B;  1VQO T;  1WJR A;  2QQS A;  2EGE A;  1BKB A;  4M75 C;  9ATC B;  4KGX B;  2NUZ A;  4M78 A;  2CP0 A;  5GAN 4;  3QZ5 B;  3GLX A;  4C92 B;  4E47 A;  4PNO A;  2F5T X;  2A36 A;  1G3W A;  2CRE A;  2E6Z A;  2JTE A;  3MKD A;  3PMI A;  1C0M A;  4RG2 A;  3CCR A;  1W2B S;  2O88 A;  4LDU A;  1F1B B;  5AYF A;  4A53 A;  1SEM A;  2FB7 A;  1SKU B;  3CCQ T;  4ZNX A;  5IAY A;  1ZUY A;  4R56 A;  1D3B B;  2QEX A;  4M7D F;  4PJO B;  4ANJ A;  5CIU A;  1QKX A;  2OJ2 A;  1Z9Z A;  1N5Z A;  4XQ3 A;  1WPY A;  4JRQ A;  4JLI A;  2J6F A;  2EIF A;  2EQI A;  1PD1 A;  5HCK A;  1MND A;  1ZSG A;  1OZ2 A;  1GXI E;  1VQ8 T;  2HDA A;  5FRO A;  2B86 A;  1YHQ T;  1TTH B;  4TVR A;  3T9N A;  4C5G A;  2E5Q A;  2RH2 A;  1JQQ A;  3QO3 A;  4HVV A;  4HVU A;  1YI2 A;  2KNB B;  5HKC A;  1ZA2 B;  3RMQ A;  1XOV A;  1VIE A;  3NTI A;  3JB9 J;  2ZGW A;  3MPU B;  3VRZ A;  4HCB A;  3QWY A;  2A3L A;  5CO7 A;  1WHL A;  1QWF A;  4EPC A;  2CUD A;  4DOV A;  3V8L A;  2DKG A;  1NLO C;  2ESW A;  2YUO A;  3TCJ A;  5GAN f;  3RMS A;  3M0Q A;  4NOY A;  4A4K A;  2OTL A;  2CZ6 B;  3CCU T;  1M1G A;  1VA7 A;  1UB4 A;  2LTO A;  5GJW B;  3FB9 A;  4ESR A;  1QVG P;  5CKF A;  5CCA A;  5GAN 7;  1MHN A;  4M7A C;  2K2V A;  5KYW A;  3OYE A;  2V1Q A;  2JN0 A;  2VGM A;  2CP3 A;  1CSK A;  3G6E A;  1UDL A;  1VQ4 T;  2GQV A;  5IH2 A;  3G71 A;  3M0U A;  1QCN A;  4OMM A;  1VYT A;  4DBF A;  1ZSZ C;  3CME A;  2LMJ A;  3L2Z A;  3M9Q A;  1MMA A;  3MP8 A;  1WIE A;  3SDZ A;  5CR2 A;  4R55 A;  2C0I A;  3MEV A;  3UA7 A;  2YLC A;  2LX7 A;  4J9C A;  4IUP A;  2EYX A;  5I2S A;  1D0Z A;  3OY9 A;  1U5S A;  3OYY A;  2PVG B;  2BE7 D;  4M75 B;  1K9M R;  4FL6 A;  3MJX A;  2XKO C;  3QYG B;  2MCN A;  2D1X A;  2LCC A;  1YJW T;  4BUG A;  3L2U A;  1CKA A;  1Y07 A;  2KXD A;  2GFA A;  4VUB A;  5DLQ E;  1UUE A;  3M55 A;  1TWB A;  2RHI A;  4JJC A;  1KC8 C;  5CK9 A;  4FIB A;  1AZE A;  5GAM d;  4FSX A;  1YFN A;  5ECA A;  3I55 T;  4OGE A;  1IO6 A;  3G4S Q;  1GCQ C;  2D0N A;  2ZPH B;  3BY7 A;  2RK1 A;  2LT4 A;  4MMK A;  4JPB W;  3CMA A;  2XID A;  3NGP A;  2K2M A;  2MWO A;  1ZHI A;  1W4S A;  4HT8 A;  3CQT A;  3BDU A;  4L59 A;  1ZQ1 A;  2FZK B;  4QVZ A;  2GGR A;  2V8I A;  3LLR A;  4C5H A;  4N4H A;  1WHH A;  1MMN A;  1NJI C;  1UHF A;  4DEX A;  1WXT A;  3CCM A;  5FRN A;  2H8H A;  2K57 A;  5GAN e;  2JS0 A;  4M78 C;  4PJN A;  5DLO A;  3H6Z A;  4WF2 A;  4C0G A;  3UDC A;  3ZL7 C;  3CC2 T;  2K3Y A;  2COW A;  1R8O B;  2QI2 A;  2M9U A;  3OA6 A;  3V7S A;  3VS5 A;  3UT1 A;  4E6R A;  1PKT A;  2CP6 A;  3KXT A;  1VQ7 T;  3REB B;  3JB9 G;  2KRN A;  1AWW A;  1M27 C;  3N5B B;  2RI5 A;  3TSW A;  3A8H B;  1WXB A;  1KD1 R;  1VQN Q;  2CDT A;  3TVT A;  1YCS B;  2AKL A;  3RER A;  3MEU A;  1YJ9 T;  1FX7 A;  1GFD A;  3L2V A;  1Q7Y U;  2FPE A;  3M0P A;  4RMO A;  4ME7 A;  2J05 A;  3JCM g;  1G3T A;  2L2P A;  3OB9 A;  4PLI A;  2VKN A;  1D0X A;  4IIM A;  5GAO q;  3GNF B;  2CZ1 B;  2DBK A;  3QZ9 B;  2B8A A;  2E64 A;  2P84 A;  1YBY A;  3S6W A;  2E1H A;  2HEQ A;  1M1K U;  2J6K A;  3C0C A;  2DLP A;  4PL6 A;  5KYX B;  2DM1 A;  3CD6 T;  1UEB A;  1TH7 A;  4Z8A A;  2XHC A;  1K9A A;  1WXU A;  1VQ5 T;  2DK3 A;  3U23 A;  1ZBX A;  2QGF B;  1Y71 A;  3VV0 A;  1W70 A;  3P8D A;  3LH0 A;  2XK0 A;  4AG2 C;  2ZPE B;  1U06 A;  1SSH A;  3WVD B;  2X4W A;  2JTM A;  1UHC A;  2AK5 A;  1IZ6 A;  4LN2 A;  1X6O A;  4RTZ A;  1XQH A;  1K73 R;  2MOX A;  5IHI A;  2LQN A;  3I55 A;  1VQP T;  1RL2 A;  3I5S A;  4J8O A;  2QDL A;  1X6G A;  2PUK B;  1HJD A;  2A37 A;  1BYM A;  4LE9 A;  1O9S A;  1WJQ A;  1Q82 R;  1R77 A;  5CKB A;  3V7C A;  4EDU A;  1QVF A;  3JB9 D;  5AT1 B;  2VXF A;  1YIT Q;  3MCA B;  3I35 A;  3GBQ A;  2HBP A;  3CCJ Q;  2JM8 A;  4M78 B;  2DJQ A;  4BI3 A;  2EGA A;  1TU0 B;  3GF5 A;  1H64 1;  1KQ2 A;  3GIB A;  4D6W A;  1YWP A;  1I8F A;  4OMN A;  4K11 A;  2EJF A;  7AT1 B;  2M0Y A;  3UF4 A;  4PK4 A;  3JCM h;  3OMC A;  6AT1 B;  4C92 G;  1EZZ B;  2HBW A;  1D0Y A;  2O9S A;  2Y90 A;  1VUB A;  1ARK A;  3JB9 H;  3L2R A;  4JZ3 A;  2K5L A;  5KH6 A;  1MV3 A;  3CCS A;  2M0O A;  1VQ7 A;  3JSC A;  5L23 A;  3OBY A;  3RR6 A;  1WI7 A;  2GTO A;  3FJ5 A;  1AT1 B;  1S1N A;  2QTX A;  5I21 A;  4ZN1 A;  2VVK A;  1BU1 A;  4ZGE B;  2F69 A;  5GMK m;  1GCP A;  1T3L A;  3G1J A;  1B07 A;  1QQJ A;  1Y96 A;  5IXB A;  2RNA A;  4LDY A;  1JRI A;  2KQW A;  3JB9 F;  4M77 A;  2KRO A;  1LOJ A;  1YCY A;  3NTH A;  1JO8 A;  4QVC A;  3JCM P;  1N6A A;  1I1J A;  3OYM A;  1FMK A;  4N4G A;  2P0Q A;  3E9F A;  1K1Z A;  1VQ9 T;  1VQ6 T;  1G3Y A;  1SRM A;  4J7F A;  1W2B A;  1EX4 A;  4E7J A;  1Q86 C;  5KYW B;  1KQS S;  1YJN A;  3OW2 P;  3E19 A;  3CC7 T;  2MMP A;  2OTJ T;  5GJV B;  2FEI A;  2ROT A;  3L42 A;  5LJ5 d;  5IHN A;  1FMV A;  3QJ6 A;  4D8K A;  4KUI A;  2ZPF B;  1SRL A;  5HK0 A;  1MV0 B;  5FU6 B;  4DA4 A;  1JB0 E;  4FW2 A;  2ED1 A;  2L8D A;  2DL4 A;  2NWM A;  4OF1 A;  2HAX A;  2RQV A;  3RKY A;  4CC3 A;  2QAS A;  3I56 Q;  4XK8 E;  4C8Q A;  1D1A A;  5KCH A;  1IHW A;  3CCR T;  4E2F B;  2YRD A;  4LDW A;  3E2U A;  4MZM A;  2SRC A;  4C92 D;  4XTY A;  4C92 E;  4J6X A;  2QEX T;  4AFU C;  3VS0 A;  4MDW A;  3I5R A;  5GAN 2;  2XMF A;  4QKU A;  4JJB A;  1GRI A;  1X2Q A;  1KFZ A;  4PJO E;  1SPK A;  4RTT A;  3HFO A;  5LJ3 d;  4FU6 A;  3OSS C;  2DIG A;  5GAO m;  2JNG A;  2YLB A;  3OYL A;  2DXB A;  2DEU A;  2HMA A;  1ZSZ A;  2KR3 A;  4Q5W A;  1S72 Q;  3RUX A;  1M3A A;  5KYU A;  5KYY A;  3PGG A;  4NL3 A;  2EQJ A;  2JJ9 A;  3OYI A;  2OTL T;  4BDY A;  3DLL A;  1BCM A;  1WHM A;  2PNI A;  2CZ7 B;  5J26 A;  1RAI B;  3V8K A;  1X69 A;  3MEW A;  1VQM Q;  3GPL A;  4FYW B;  2KE9 A;  4C92 F;  2QXF A;  4E7H A;  3G71 T;  3PIO A;  2G3R A;  1W2B P;  1VQK A;  4J9F A;  3CME T;  2RM4 A;  2HQH A;  4LD6 A;  5GAN 6;  2E3H A;  1QW1 A;  1PSE A;  4PJO F;  1GCQ A;  1JEG A;  1OOT A;  4IUR A;  2LCL A;  2X51 A;  4N4I A;  1RLQ C;  3EG0 A;  3KBG A;  2DXU A;  1EFN A;  2LCS A;  1K73 C;  1E7O A;  2IPO B;  1UFF A;  5CAI A;  4HCZ A;  1QVP A;  4M7A G;  1WDX A;  3J7A F;  1KJW A;  4J6W A;  4EIK A;  2QTV A;  4KH0 B;  2RI2 A;  3PIP A;  2XDB A;  1M8M A;  5EG2 A;  1VQL A;  4GY5 A;  4M75 D;  4HCC A;  2EAY A;  4M75 E;  1SHF A;  2KRM A;  4JRP A;  1YI2 Q;  2L3R A;  3VS6 A;  2HKN A;  4X9D A;  4QW2 A;  3VKI A;  3RBB B;  2QA4 Q;  2OTJ A;  2Y4Y A;  3X26 B;  2P4R A;  1Q7Y R;  4DBH A;  2OAW A;  3LW5 E;  4M77 C;  5HY6 A;  4J83 A;  3NPF A;  4PLL A;  3M5A A;  1H3H A;  2RO0 A;  3CMA T;  5FW9 A;  3QII A;  3R6O A;  2YRV A;  2QDY B;  1ZA1 B;  2RHZ A;  1KHC A;  3VYH B;  1JXM A;  2XDD A;  3HSB A;  4LUD A;  1C1A A;  1QMC A;  2RD1 A;  4B9X A;  2LJ1 A;  2YHT A;  1M1K R;  1QP2 A;  1K4U S;  1KHI A;  3HP9 A;  1UG1 A;  2DZ9 A;  5LL6 S;  5GMK e;  1BI0 A;  2FPD A;  3G6E Q;  4F7U G;  1RAD B;  2NUP A;  1WX6 A;  3CCM T;  2DD5 A;  1RAH B;  2E10 A;  4CC7 A;  2L89 A;  4Y28 E;  4OB3 B;  4YTL A;  2SEM A;  5KE2 A;  1GBQ A;  3OYK A;  1UTI A;  4M75 F;  4C8Q C;  4P5N A;  5C6S A;  3BW1 A;  2E5K A;  3RDV A;  1OX8 A;  1GL5 A;  2JOY A;  1U8R A;  2ZCF B;  2FL7 A;  3HFN A;  2DL8 A;  1AZG B;  4M7A D;  4M7A E;  1RI0 A;  4DBR A;  3CCL Q;  1M8V A;  1MMD A;  4C5E A;  5FWC A;  4M78 G;  1X75 C;  1VQO Q;  1WZO A;  3QHS A;  5GMK l;  5GAM j;  4R0K A;  5D6Y A;  2X9H A;  3OMG A;  4RTX A;  1BIA A;  3URG A;  2BIV A;  4C0D B;  3QYH B;  2VAS A;  2DD4 A;  1OV3 A;  2CGH A;  3EFO A;  3M0S A;  1WQW A;  4PFZ A;  3UAT A;  2L3S A;  3CCQ Q;  1I0C A;  2JTF A;  1Y96 B;  5FLX E;  1TUC A;  2VWF A;  5FRM A;  3FC3 A;  1Q81 C;  1MUZ A;  4IKF A;  1XNI A;  2FO0 A;  2RN8 A;  2LQW A;  4O6J A;  1VQ8 Q;  2VYT A;  1FYN A;  3VS7 A;  1YHQ Q;  1JXO A;  1SG5 A;  1XJW B;  4F7U E;  4RKU E;  2DX1 A;  4EMH A;  5GAO r;  5IHK A;  4M7A F;  1U1S A;  4EMG A;  5GAN g;  3LWH A;  2RJC A;  4AFZ C;  1M2O A;  2E70 A;  2DO3 A;  4B6M A;  1B7T A;  3EGU A;  2LZ6 B;  3H41 A;  1NE8 A;  3CCV T;  2FPF A;  5I2M A;  4CC4 B;  5CQX A;  3JRZ A;  2HSE B;  3CCU Q;  4IUV A;  1TOV A;  4A4H A;  1BK2 A;  3REA B;  1K8A C;  5HK3 A;  2ZAE A;  3CBP A;  3RKX A;  2CP2 A;  2DER A;  2MI6 A;  3VUZ A;  2KMT A;  2AZV A;  4M78 D;  2LX9 A;  3HPW A;  4M78 E;  4C8Q B;  4XTZ A;  2DYB A;  2F5K A;  4FYX B;  3VS2 A;  5LJ5 e;  1VQ4 Q;  4RG8 A;  3RES A;  3PVQ A;  1PSF A;  2RA2 A;  1HSQ A;  3JCM J;  3M4G A;  1NJI U;  5GAO l;  2HL5 C;  2JM9 A;  5GMK j;  4FW1 A;  3CCS T;  3VS3 A;  4F7U F;  2RJE A;  4L5G A;  4M7A B;  2BKD N;  1E6G A;  2MAM A;  1KQS A;  3GP8 A;  3SFM A;  1M90 C;  1LCK A;  2YSQ A;  1B34 B;  1H3Z A;  2CT4 A;  1HD3 A;  1AOJ A;  1I07 A;  3CC4 T;  3H0H A;  3VYG A;  3PMT A;  1YJW Q;  1G5V A;  1WA7 A;  2W0Z A;  3HHT B;  3I9Q A;  1X2K A;  1ZSZ B;  4CRI A;  1UGQ B;  4X34 A;  2V8K A;  1BCO A;  1TSF A;  3DLM A;  5KYU B;  3I55 Q;  3G4S A;  5KYY B;  2QQ9 A;  3JAM E;  3AHU A;  1WLP B;  1PWT A;  2CP7 A;  2FYK A;  3LH5 A;  1J3T A;  5LJ3 e;  4E7Z A;  2MPX C;  1UGP B;  2FRW A;  5I11 A;  3J81 E;  1HYO A;  4M78 F;  2XDP A;  2RQT A;  5GAN h;  4BDZ A;  1YJN T;  4XAX B;  4GBQ A;  3VU3 C;  2ZPB B;  4KUL A;  1LNX A;  3LX7 A;  1X6B A;  2MIO A;  1SSF A;  3ME9 A;  4JRI A;  2JMC A;  4IIO A;  1D1B A;  2EKO A;  2E12 A;  1RI9 A;  4F7U B;  1RAB B;  2MK5 A;  3L2Q A;  3D7S B;  2EYY A;  1FWZ A;  1AWX A;  3CC2 Q;  3EGX A;  1N8R U;  3LYI A;  2AZS A;  3BFM A;  4OML A;  2JT4 A;  5A2Q E;  5D7U A;  2HQX A;  1VQ7 Q;  2VXE A;  3CPW S;  2O01 E;  2P0K A;  2X4Y A;  2BZX A;  2DXC A;  2J7I A;  5FWB A;  1OPK A;  4RCC A;  5FU7 C;  2XD0 A;  8ATC B;  1VQN A;  4RTV A;  1IRX A;  4J9E A;  1YJ9 Q;  3CCV A;  2AIR B;  2JXB A;  2ZPI B;  4E7I A;  1W1F A;  5CVI A;  1IGQ A;  1N9R A;  3OYB A;  1XTD A;  4ZN3 A;  1N9S A;  1P92 A;  1JBM A;  3C4S A;  5A0D A;  2M16 A;  4XU2 A;  5I22 A;  4LXC A;  2GFU A;  1CKB A;  4Z89 A;  3C12 A;  4PFP A;  3CD6 Q;  3JCM c;  1ABO A;  5GAO n;  2H3J A;  4F14 A;  1PD0 A;  1V1C A;  3WXM B;  1VQ5 Q;  1YIJ T;  1X27 A;  1FXX A;  2PTK A;  2NUP B;  3IQL A;  3MHX A;  5LJ5 j;  2XG8 D;  3LWI A;  5IN1 A;  2FZG B;  5GAM f;  2NLU A;  2PUO B;  4FCY A;  3OYH A;  1O75 A;  4KUD K;  4CC2 A;  1VQK T;  4J9G A;  1K9M C;  2EJ9 A;  4M7D A;  3H0I A;  2E65 A;  3UA6 A;  1QCF A;  2EVR A;  4Z88 A;  3CC4 A;  2RJD A;  1NEB A;  2EYW A;  3EAE A;  1WJS A;  2DPP B;  3HRT A;  1E6H A;  3EHQ A;  1WNL A;  3EG3 A;  2X35 A;  1VQP Q;  4Y92 A;  1D1C A;  3C95 A;  1NPP A;  1UGS B;  2E3I A;  1R0B G;  2X4X A;  2KT1 A;  2EYZ A;  2COZ A;  4Y91 A;  1NLP C;  3QDF A;  2RPN A;  1VQL T;  4LDV A;  3G7Z A;  4X1V A;  4A54 A;  1X43 A;  3QG1 A;  1VYU A;  2F2W A;  1WHG A;  2F1L A;  1Y0M A;  1Q86 U;  2NYS A;  3CBM A;  1TG0 A;  1W6X A;  5LJ3 j;  4XTX A;  4J9B A;  2XIC A;  2QG9 B;  1QLY A;  2RK2 A;  3PFS A;  2KAF A;  4XU3 A;  2WSC E;  3EFO B;  1QVF P;  3PVL A;  4GLK A;  5FU7 B;  1G3S A;  1T0J A;  2MF2 A;  4MDX A;  1M5Q 1;  5GAM g;  1X01 A;  1RAF B;  2YUN A;  5GAN 5;  1G8X A;  1ZLM A;  2HL3 A;  1PRM C;  3RNJ A;  5GAN 3;  2ATC B;  4QT7 A;  4M7D G;  2EPD A;  1MNE A;  1ABQ A;  4XTW A;  5CKE A;  2DET A;  4M77 G;  1KD1 C;  3OYC A;  2DIL A;  3M0R A;  3OYF A;  2OAU A;  4DOW A;  3OQ5 A;  4J6Y A;  2DA9 A;  1OX9 A;  2GF7 A;  1AD5 A;  1HXD A;  3QWX X;  1KK7 A;  2A0F B;  2L5Q A;  1M2V A;  1RAA B;  3A8G B;  5IXF A;  4NS5 A;  4D8D A;  4OGC A;  2QQR A;  4E7K A;  3JB9 I;  5GAM e;  1VQ9 Q;  3QBY A;  1VQ6 Q;  2C0O A;  1AEY A;  1WGS A;  1PHT A;  3OBW A;  3EH2 A;  2J06 A;  2ROL A;  3CCE Q;  4PJO C;  2LQK A;  2DL3 A;  3V8J A;  1AHJ B;  3NMZ C;  3JCM V;  2RB6 A;  3CC7 Q;  1OI1 A;  3MO8 A;  3OW2 S;  2K79 A;  2O4X A;  2J6O A;  3VJP A;  1NYG A;  2OTJ Q;  1K76 A;  1YIJ A;  3OYN A;  2WAC A;  2RQW A;  3KUF A;  3ZEH A;  1UGV A;  4C8Q G;  1I4K 1;  3M53 A;  4BB7 A;  1BB9 A;  4HXJ A;  4XTU A;  3I56 A;  3JCM b;  3VUB A;  1M1F A;  4IUT A;  2JZ2 A;  3ZFJ A;  2EQK A;  3CCR Q;  3H0F A;  4N0A C;  5KYX A;  4F17 A;  1TUD A;  2QAZ A;  2KYM A;  1Q95 G;  3JCM d;  3P8H A;  2QEX Q;  4DEY A;  1KG1 A;  2MYS A;  1MMG A;  1OYX A;  2G6F X;  4JUV A;  1NJI R;  1U3O A;  1NBE B;  1HK9 A;  2JUF A;  4L6V 5;  1Q82 C;  1OPL A;  2DL7 A;  2LJ0 A;  4X9C A;  4ATO A;  3QJY A;  3VRY A;  2KVQ G;  2Z0W A;  4A4G A;  4M77 D;  4II1 A;  2M02 A;  4M77 E;  2VC8 A;  3Q1J A;  4MZP A;  4M7D C;  2R5A A;  2R57 A;  2DMO A;  2EJG A;  1PC0 A;  2HSP A;  1S72 A;  2KDS A;  2KY9 A;  3M56 A;  1G2B A;  2BTT A;  1LPL A;  4EMK A;  1RAC B;  4E7L A;  3V7R A;  2HCK A;  2V1R A;  2VB6 A;  2EQM A;  2CSQ A;  2OTL Q;  2QQA A;  1R0C B;  5DY9 A;  2LT1 A;  3S3O A;  1PG5 B;  3KFV A;  4LD9 K;  2X3X D;  4V2S A;  2LDM A;  2M1H A;  3X28 B;  1VQM A;  1ZX6 A;  4NL2 A;  1K0S A;  3HRS A;  2A08 A;  1BIB A;  4JZ4 A;  2L3P A;  2BUD A;  2RQU A;  1K0X A;  4AT1 B;  1Y57 A;  5KYN A;  2EBP A;  1PKS A;  1GFC A;  3EGX B;  3G71 Q;  3BE3 A;  4O5V A;  3OS2 A;  3CME Q;  4C8Q D;  4C8Q E;  1JJ2 S;  2A7Y A;  2E4H A;  3CXC S;  3A8L B;  3FRN A;  2DTH A;  3L1A A;  1UEC A;  1D09 B;  4ZTJ A;  3R6N A;  5J3B A;  2DL5 A;  3O8V A;  3M54 A;  2GQI A;  2KXC A;  4M77 F;  1N8R R;  4PJL A;  3SWN A;  4JJD A;  1YWO A;  4HA8 A;  1PM3 A;  1OUL A;  5LJ5 f;  3FJP A;  4LDX A;  4OP0 A;  4PKC C;  3OYJ A;  4C0Z A;  4BI4 A;  3TEE A;  1PRL C;  1Z9Q A;  3UPU A;  2YRC A;  2ZPG B;  1A0N B;  2RI3 A;  2Y4X A;  2CP5 A;  2O2O A;  2QA4 A;  2DE0 X;  4BE0 A;  4FSS A;  3A8M B;  3G4S T;  4QVD A;  4ORZ A;  4RTW A;  1NM7 A;  4OB2 B;  5GMK h;  2D6F A;  3EG9 A;  2CH4 A;  1T0H A;  3GOX A;  2XU8 A;  3MP1 A;  2D8J A;  2K7A A;  1ZUK A;  1TS9 A;  2R58 A;  5L8R E;  2GNC A;  2EQU A;  3CMA Q;  2ZZD A;  2VV5 A;  4AMC A;  2CUB A;  4ELZ C;  3CPW A;  1VOM A;  2I0N A;  1OZ3 A;  3EG2 A;  4C8Q F;  4AFS C;  1VYV A;  4MML A;  2RHX A;  3VS4 A;  2AHJ B;  1VIF A;  2C0T A;  2JVV A;  1OU9 A;  4M7D B;  2KGT A;  5LJ3 f;  2X3W D;  2NUT A;  2KK4 A;  2RF0 A;  4IUQ A;  2EW3 A;  2CH4 W;  3FDR A;  3CCM Q;  4FT2 A;  4M77 B;  3INZ A;  5EC7 A;  2DYI A;  2HZY A; 
#chains in the Genus database with same CATH homology
 2EKO A;  2E12 A;  1Q81 U;  3E19 A;  3J80 E;  3CC7 T;  5LJ5 g;  2MMP A;  1VQ9 A;  1VQ6 A;  4F7U B;  2OTJ T;  3L2Q A;  3CBO A;  3S3N A;  5LJ5 d;  1M9S A;  3L42 A;  1FWZ A;  3X24 B;  3QJ6 A;  4KUI A;  3QDR B;  3CCE A;  2MWP A;  3HL8 A;  3EFS A;  2ZPF B;  5HK0 A;  1I81 A;  3CCL T;  1NZ9 A;  1V29 B;  1KC8 U;  5FU6 B;  4DQ2 A;  1JB0 E;  3LYI A;  3CC7 A;  4DA4 A;  1YJ9 T;  2DTO A;  3BFM A;  4OMF B;  4BY6 B;  2L8D A;  2CZ0 B;  4ZGD B;  1VQO T;  1VQN T;  4JS4 A;  1WJR A;  5A0G A;  5GMK i;  5A2Q E;  2QQS A;  4OF1 A;  2HAX A;  1BKB A;  2HQX A;  1N27 A;  2VXE A;  4M75 C;  3RKY A;  2PU9 B;  4XK8 E;  4C8Q A;  2O01 E;  2P0K A;  2X4Y A;  3CPW S;  2DXC A;  4M78 A;  3CCL A;  3GNG A;  5KCH A;  3CCR T;  4RCC A;  3EFR A;  4LDW A;  5GAN 4;  4MZM A;  5FU7 C;  2XD0 A;  3QPH A;  1VQO A;  4C92 D;  1VQN A;  4XTY A;  3QZ5 B;  4C92 E;  2PVO B;  3GLX A;  4HT9 A;  4C92 B;  4J6X A;  2QEX T;  4JRK A;  3LGL A;  4E47 A;  2LC4 A;  4MDW A;  4PNO A;  2F5T X;  1G3W A;  3CCV A;  2E6Z A;  5GAN 2;  1QVG S;  3PNW C;  3PMI A;  1K8A U;  4RG2 A;  3CCR A;  2ZPI B;  3JCM f;  1W2B S;  4E7I A;  5CVI A;  4LDU A;  5AYF A;  4PJO E;  4A53 A;  1N9R A;  2FB7 A;  1XTD A;  5IAY A;  4R56 A;  3OYB A;  4KBM B;  1D3B B;  4ZN3 A;  2QEX A;  4M7D F;  1N9S A;  3OYD A;  4PJO B;  3LGF A;  5CIU A;  4Z02 A;  1P92 A;  1JBM A;  2HNI A;  1QP3 A;  3C4S A;  1Y7X A;  4XQ3 A;  3RKW A;  1WPY A;  4JRQ A;  4EMK C;  5LJ3 g;  4JLI A;  5A0L A;  2EIF A;  4B9W A;  2M16 A;  5A0D A;  4XU2 A;  5CKH A;  3HFO A;  5LJ3 d;  4FU6 A;  3CCQ A;  2GFU A;  1OZ2 A;  1GXI E;  3OSS C;  2DIG A;  1VQ8 T;  5GAO m;  3C12 A;  5FRO A;  2JNG A;  2YLB A;  3OYL A;  2DXB A;  1YHQ T;  4TVR A;  3T9N A;  4C5G A;  2E5Q A;  4XU1 A;  3JCM Q;  2RH2 A;  1WQ7 A;  4Q5W A;  3JCM c;  3QO3 A;  3RUX A;  5GAO n;  1YI2 A;  2P4T A;  5HKC A;  3RMQ A;  1XOV A;  2H3J A;  1VIE A;  3NTI A;  3JB9 J;  2ZGW A;  3PGG A;  4NL3 A;  3SD4 A;  2EQJ A;  3WXM B;  4HCB A;  3OYI A;  3OS0 A;  1YIJ T;  1VQ8 A;  2A3L A;  1FXX A;  2HD0 A;  3BDL A;  2RJF A;  3MHX A;  5LJ5 j;  3DLL A;  4BDY A;  2XG8 D;  3QXE B;  5CO7 A;  3LWI A;  5IN1 A;  1YHQ A;  4EPC A;  4BD3 A;  2CZ7 B;  3NFC A;  4DOV A;  1M90 U;  3V8L A;  3HRU A;  2NLU A;  2PUO B;  5GAM f;  2DKG A;  3OYH A;  1O75 A;  4KUD K;  2IG0 A;  5J26 A;  3TCJ A;  3V8K A;  5GAN f;  3RMS A;  5CKD A;  2EJ9 A;  1K9M C;  1VQK T;  4M7D A;  2CS7 A;  4NOY A;  2K5I A;  4A4K A;  4J5Y A;  2CZ6 B;  2OTL A;  4JS5 A;  3MEW A;  3CCU T;  1M1G A;  3GPL A;  2E65 A;  4ZGJ B;  1UB4 A;  2QXF A;  4C92 F;  3OS1 A;  3CC4 A;  2RJD A;  2LTO A;  1Q7Y C;  2D9T A;  3EAE A;  3FB9 A;  4E7H A;  1WJS A;  2DPP B;  3HRT A;  1MHN A;  2DJZ A;  5CKF A;  5CCA A;  5GAN 7;  3G71 T;  3PIO A;  3S3M A;  4M7A C;  2G3R A;  2K2V A;  1VQK A;  1WNL A;  5LJ5 h;  3OYE A;  1YIT T;  2X35 A;  3CME T;  2RM4 A;  4LD6 A;  5GAN 6;  3MP6 A;  2O4X B;  3CCU A;  3C95 A;  1QW1 A;  2JN0 A;  2VGM A;  1NPP A;  3RIR A;  1PSE A;  1UGS B;  4PJO F;  3CCJ T;  3SWN C;  2PVD B;  4IUR A;  2X4X A;  3G6E A;  2XI9 A;  2LCL A;  2GQV A;  4N4I A;  5CQY A;  4A4E A;  3G71 A;  1VQ4 T;  3KBG A;  4Y91 A;  4BE1 A;  1N8R U;  2DXU A;  3CME A;  4CI0 C;  1K73 C;  1VQL T;  3L2Z A;  3H8Z A;  3M9Q A;  5CAI A;  4HCZ A;  4LDV A;  1QVP A;  3G7Z A;  3MP8 A;  4A54 A;  4FT4 A;  1M1K C;  4M7A G;  3X25 B;  3E1S A;  3SDZ A;  5CR2 A;  3QG1 A;  4R55 A;  3J7A F;  2EWN A;  4J6W A;  3MEV A;  1VQ4 A;  2YLC A;  1Q86 U;  3CBM A;  2RI2 A;  4IUP A;  3PIP A;  5I2S A;  2XDB A;  4FM4 B;  5LJ3 j;  5EG2 A;  1VQL A;  4XTX A;  4BAC A;  2XIC A;  3OY9 A;  2EYQ A;  3C94 A;  4GY5 A;  4M75 D;  3OYY A;  4HCC A;  2RHU A;  2EAY A;  2GCX A;  2PVG B;  2RK2 A;  4M75 E;  4M75 B;  3CEY A;  4BE2 A;  4JRP A;  1MGQ A;  3TU4 K;  2DZC A;  2KAF A;  2L3R A;  2CYZ B;  3PFS A;  2WSC E;  4FL6 A;  4X9D A;  4XU3 A;  4C92 A;  4QW2 A;  3VKI A;  2XKO C;  3DB3 A;  3QYG B;  4GLK A;  2PQW A;  2OTJ A;  2Y4Y A;  2LCC A;  3X26 B;  5FU7 B;  1G3S A;  1YJW T;  2MF2 A;  4MDX A;  4BUG A;  3L2U A;  1NPR A;  1M5Q 1;  1Y07 A;  5DLQ E;  2GFA A;  4VUB A;  1X01 A;  3LW5 E;  4M77 C;  5HY6 A;  3M55 A;  5GAM g;  4PJO A;  2RHI A;  1D3B A;  4MZT A;  5GAN 5;  5CK9 A;  4FIB A;  4J83 A;  3JCM e;  1KC8 C;  1N8R C;  5GAM d;  5LJ3 h;  4FSX A;  3I55 T;  4PLL A;  3M5A A;  3M58 A;  4OGE A;  5GAN 3;  2RO0 A;  3CMA T;  3P8B B;  2ZPH B;  1YJW A;  4M7D G;  3QII A;  3BY7 A;  3R6O A;  3OW2 A;  2DXT A;  2YRV A;  2QDY B;  2RHZ A;  1KHC A;  3VYH B;  4XTW A;  2XDD A;  3HSB A;  2X4J A;  2RK1 A;  2RD1 A;  4B9X A;  3ER0 A;  5FU6 C;  5CKE A;  2E41 A;  4EMK B;  2LT4 A;  3ZBD A;  2YHT A;  1QP2 A;  4M77 G;  1KHI A;  3HP9 A;  1KD1 C;  3OYC A;  4MMK A;  2DZ9 A;  5LL6 S;  5GMK e;  3CMA A;  1BI0 A;  2XID A;  2MWO A;  4XU0 A;  3OYF A;  1ZHI A;  2OAU A;  1W4S A;  3OQ5 A;  4DOW A;  1IRE B;  4J6Y A;  3JCM W;  4HT8 A;  4F7U G;  4OB0 B;  3BDU A;  4L59 A;  2GF7 A;  1HXD A;  1DJ7 B;  2DEQ A;  5D6W A;  1ZQ1 A;  3CCM T;  4N0A A;  2WSE E;  2L5Q A;  2DD5 A;  3A8G B;  4QVZ A;  3PTA A;  3OYA A;  2V8I A;  4NS5 A;  2E10 A;  3LLR A;  4C5H A;  4N4H A;  2L89 A;  4Y28 E;  4OB3 B;  4YTL A;  4OGC A;  2QQR A;  4E7K A;  3JB9 I;  5GAM e;  5KE2 A;  4JJN K;  3QBY A;  3M59 A;  2D0Q B;  1NJI C;  1WGS A;  3CCM A;  5FRN A;  3OYK A;  3QKJ A;  4C8Q C;  4M75 F;  2K57 A;  4HKE A;  5GAN e;  4QQD A;  4M78 C;  5DLO A;  3H6Z A;  3OBW A;  4P5N A;  3BW1 A;  4WF2 A;  4C0G A;  5C6S A;  3CCQ T;  3UDC A;  3CC2 T;  4PJO C;  2K3Y A;  2RHY A;  1R8O B;  2LQK A;  2M9U A;  2QI2 A;  3OA6 A;  3V7S A;  2LQ8 A;  3UT1 A;  1AHJ B;  3V8J A;  2K3X A;  2QQB A;  2RB6 A;  3JCM V;  2JOY A;  1OI1 A;  1U8R A;  3MO8 A;  2ZCF B;  3KXT A;  3OW2 S;  2FL7 A;  1VQ7 T;  3HFN A;  2O4X A;  3VJP A;  3I56 T;  4M7A D;  3JB9 G;  1KQ1 A;  4M7A E;  1YIJ A;  3OYN A;  1RI0 A;  5KE3 A;  3N5B B;  2WAC A;  3CC2 A;  3KUF A;  3ZEH A;  2RI5 A;  1M8V A;  3A5Z B;  4C8Q G;  4JDS A;  3OS5 A;  1K9M U;  4C5E A;  4M78 G;  1X75 C;  1I4K 1;  3A8H B;  3M53 A;  4BB7 A;  4PJO G;  3RER A;  3ASK A;  3MEU A;  3QHS A;  4XTU A;  4XTV A;  3SWN B;  1FX7 A;  5GMK l;  3JCM b;  5GAM j;  3I56 A;  3VUB A;  1LJO A;  1M1F A;  2V8J A;  3OMG A;  5D6Y A;  3L2V A;  1Q7Y U;  2DIQ A;  5GAN j;  4IUT A;  1BIA A;  3URG A;  2JZ2 A;  3ZFJ A;  4RMO A;  2EQK A;  4ME7 A;  3JCM g;  2C06 A;  1G3T A;  4N0A C;  2VUB A;  2BIV A;  4C0D B;  3OB9 A;  3QYH B;  4PLI A;  3JCM d;  3P8H A;  2DD4 A;  4KT0 E;  2HQE A;  1YJ9 A;  2WSF E;  1KG1 A;  4M75 A;  1YIT A;  5GAO q;  3GNF B;  2CGH A;  2CZ1 B;  3QZ9 B;  1OYX A;  2B8A A;  2E64 A;  4JUV A;  2KSS A;  3OSV A;  3CCJ A;  1WQW A;  1YBY A;  3NTK A;  1HK9 A;  2JUF A;  3S6W A;  2E1H A;  4L6V 5;  5GAN 8;  1M1K U;  1Q82 C;  2DTI A;  4PL6 A;  3CD6 T;  3QUI A;  4OB1 B;  1UEB A;  2JTF A;  4QQ6 A;  1TH7 A;  2FHD A;  2LNV A;  1Y96 B;  1BI2 A;  5KCO A;  1S72 T;  2XHC A;  4X9C A;  3UWN A;  5FLX E;  4ATO A;  5FRM A;  3QJY A;  2KVQ G;  1I5L A;  4A4G A;  4M77 D;  3FC3 A;  3M57 A;  4II1 A;  1Q81 C;  3A8O B;  4M77 E;  4MZP A;  2DK3 A;  2VC8 A;  3Q1J A;  1VQ5 T;  4M7D C;  2EFI A;  4C5I A;  3CCE T;  2R5A A;  1XNI A;  1JJ2 A;  3PT9 A;  3CXC A;  4IKF A;  1ZBX A;  2E6N A;  4O6J A;  3CD6 A;  1Y71 A;  2VYT A;  3FIF A;  2R57 A;  2K5F A;  2EJG A;  3VV0 A;  1S72 A;  2KDS A;  2KY9 A;  3FLG A;  3M56 A;  4F7U E;  3P8D A;  4RKU E;  4EMH A;  3LH0 A;  2XK0 A;  4EMK A;  5GAO r;  4E7L A;  2ZPE B;  3WVD B;  4M7A F;  1U1S A;  4EMG A;  1VQ5 A;  2X4W A;  3V7R A;  5GAN g;  2RJC A;  5C0M A;  2JTM A;  3LWH A;  2CKK A;  1VQM T;  2EQM A;  5DM7 R;  5GAO p;  2E70 A;  2DO3 A;  5GAN d;  2QQA A;  5DY9 A;  1IZ6 A;  2LT1 A;  3S3O A;  4J7I A;  4UC4 A;  3X20 B;  1X6O A;  2FVU A;  5M9O A;  4LD9 K;  1XQH A;  2IVW A;  1NE8 A;  4V2S A;  3I55 A;  2LDM A;  2M1H A;  3SB2 A;  3CCV T;  5I2M A;  3X28 B;  4BY6 C;  1RL2 A;  4NL2 A;  1VQP T;  4J8O A;  1VQM A;  3WVE B;  3HRS A;  2PUK B;  3JRZ A;  5CQX A;  1BIB A;  1BYM A;  1U1T A;  4IUV A;  2BUD A;  1O9S A;  5D6X A;  1EIF A;  4A4H A;  1WJQ A;  1KD1 U;  1K8A C;  5HK3 A;  5CKB A;  3V7C A;  4EDU A;  1QVF A;  3JB9 D;  3M4Y A;  4O5V A;  5J39 A;  3CBP A;  3OS2 A;  3RKX A;  3TRE A;  2MI6 A;  3VUZ A;  2VXF A;  3JCM X;  1VQP A;  3FEO A;  2KMT A;  4C8Q D;  4ELY C;  2I2L A;  2P0P A;  3MCA B;  4M75 G;  4C8Q E;  4M78 D;  2LX9 A;  2HBP A;  4C92 C;  3HPW A;  4M78 E;  4C8Q B;  1UGR B;  1JJ2 S;  4JLG A;  2A7Y A;  4A4F A;  3CXC S;  4PJO D;  4M78 B;  3A8L B;  3FRN A;  4XTZ A;  2DTH A;  4BI3 A;  3L1A A;  2F5K A;  5LJ5 e;  3GF5 A;  1H64 1;  4RG8 A;  2DVE A;  4ZTJ A;  1KQ2 A;  3RES A;  3GIB A;  4D6W A;  5J3B A;  2OTL T;  3QSU A;  3O8V A;  4M7A A;  1PSF A;  2RA2 A;  1I8F A;  2R5M A;  2VGN A;  3M54 A;  1M4Z A;  3F70 A;  3JCM J;  3M4G A;  2EJF A;  1YI2 T;  4M77 F;  1NJI U;  1B34 A;  5GAO l;  5GMK j;  3MET A;  3SWN A;  4HA8 A;  2LVM A;  5LJ5 f;  2QA4 T;  3JCM h;  3OMC A;  3FJP A;  4LDX A;  4OP0 A;  4C92 G;  3CCS T;  3L2W A;  4F7U F;  4PKC C;  3OYJ A;  4C0Z A;  4BI4 A;  3TEE A;  3UPU A;  2RJE A;  2ZPG B;  4L5G A;  4M7A B;  2BKD N;  2RI3 A;  2Y4X A;  4OVA A;  2MAM A;  2Y90 A;  1VUB A;  3E9G A;  1KQS A;  3JB9 H;  3L2R A;  2QA4 A;  2K5L A;  3SFM A;  3GP8 A;  5KH6 A;  1M90 C;  3CPF A;  4BE0 A;  2LRQ A;  3A8M B;  3CCS A;  1B34 B;  3G4S T;  4QVD A;  2M0O A;  2K4Y A;  1VQ7 A;  1H3Z A;  3JSC A;  3OBY A;  3MEA A;  4RCB A;  3CC4 T;  1QVF S;  3VYG A;  2QTX A;  3PMT A;  4OB2 B;  5I21 A;  5GMK h;  1BI3 A;  4ZN1 A;  2D6F A;  1G5V A;  2DAQ A;  4ZGE B;  2F69 A;  3HHT B;  5GMK m;  3GOX A;  2XU8 A;  3MP1 A;  4CRI A;  1UGQ B;  4QQG A;  4X34 A;  4IUU A;  2R58 A;  2V8K A;  3DLM A;  5L8R E;  1Y96 A;  3G4S A;  2EQU A;  4LDY A;  3DB4 A;  2QQ9 A;  3JAM E;  3AHU A;  3G6E T;  2FYK A;  1JRI A;  2VV5 A;  2ZZD A;  2KQW A;  5IT9 E;  3JB9 F;  4ELZ C;  1BI1 A;  5LJ3 e;  4M77 A;  3CPW A;  1LOJ A;  4C0F A;  1UGP B;  3J81 E;  1OZ3 A;  1YCY A;  1K73 U;  5GAM h;  4C8Q F;  3NTH A;  4M7D D;  4M78 F;  4MML A;  2RHX A;  4QVC A;  3JCM P;  2XDP A;  4M7D E;  2AHJ B;  4F7U A;  1N6A A;  1VIF A;  3DKM A;  2JVV A;  5GAN h;  3OYM A;  4BDZ A;  1YJN T;  4M7D B;  4XAX B;  3VU3 C;  2ZPB B;  4KUL A;  1LNX A;  5LJ3 f;  4N4G A;  2P0Q A;  3E9F A;  3LX7 A;  1VQ9 T;  1Q82 U;  1VQ6 T;  1G3Y A;  1QVG A;  2KK4 A;  1SSF A;  4J7F A;  3ME9 A;  4ZTF A;  4IUQ A;  3OYG A;  4JRI A;  3FDR A;  4C0D C;  1W2B A;  4E7J A;  4FT2 A;  1Q86 C;  4M77 B;  3INZ A;  3HKS A;  1KQS S;  4BI8 B;  1YJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...