1N9RA

Crystal structure of a heptameric ring complex of yeast smf in spacegroup p4122
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRELPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Small nuclear ribonucleoprotein F
publication title Homomeric ring assemblies of eukaryotic Sm proteins have affinity for both RNA and DNA: Crystal structure of an oligomeric complex of yeast SmF
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n9rA00
2Y90A 4Y91A 3FJPA 3V7SA 3JCMe 5GANd 5GAN7 3BW1A 5GANh 4V2SA 3RUXA 3JCMb 4M77B 4M7DA 1D3BA 4C8QA 4J6XA 4C92B 4PJOB 1MGQA 3EFSA 1JBMA 4M78B 4XTVA 2DTIA 4C8QC 4M75B 3JCMf 5GMKe 5GAMg 5GAN2 4J5YA 1I8FA 3FIFA 3RERA 4F7UA 3HSBA 4C92E 4PJOE 4XU2A 4M78E 4QVDA 2YLBA 3RESA 5GAOp 2EJ9A 2DVEA 3JCMd 1LJOA 4M75E 4X9CA 5CAIA 4XTUA 3JCMh 3RIRA 1BIBA 5LJ5f 1H641 1KQ2A 1WQ7A 5GANf 4DQ2A 3V7RA 4EMHA 2YLCA 4X9DA 4A53A 1LNXA 1Y96B 3SWNB 4C8QG 1I81A 2EAYA 5GMKh 1X01A 2DXUA 5LJ5h 4HT8A 4C92A 2E1HA 3FB9A 1B34A 4NL2A 4OP0A 5LJ5g 3JB9D 4J6YA 2E10A 4C92C 4F7UG 3QUIA 5GANg 4M78C 2RA2A 4HA8A 3GIBA 4PJOC 2EJGA 4XTZA 5GMKi 5LJ3e 5GAOn 1HK9A 4M77F 3V7CA 4M75C 3V8KA 4M7DD 5GAOr 1LOJA 4PJOF 4C8QD 4C92F 4M78F 4M77E 4EMKA 2DTOA 5LJ3j 5GAOq 2JN0A 4M75F 3HFOA 2DZ9A 4EMKC 4A54A 5GAN3 5GAMj 5GAOm 1KQ1A 2QTXA 4JUVA 3JB9H 4EMGA 1Y96A 3SWNA 4M7AB 3JCMg 3L2ZA 4C92G 4PJOG 4M78G 3INZA 5LJ3d 1M5Q1 3SWNC 1N9RA 5DY9A 2RD1A 4M75G 1BIAA 1WNLA 4M77A 1I5LA 2DXTA 4M7AE 1I4K1 4PJOA 4M78A 4M7DB 1D3BB 4M77C 4NOYA 4C8QB 4WF2A 4M75A 4C92D 2HNIA 4JRIA 5GAOl 2DKGA 5GAN4 2VXFA 2E41A 4M7DE 4NL3A 2EWNA 1HXDA 3EFRA 5GAMe 2E65A 3QO3A 3BFMA 2DZCA 3HFNA 3JCMX 4M7AA 2DTHA 4RCCA 5LJ3f 1U1TA 1M8VA 4XU0A 3L1AA 3JCMJ 2RM4A 3QSUA 4MMKA 4M77G 4M7AC 2K57A 2DEQA 1JRIA 4MMLA 1N9SA 1TH7A 3AHUA 3RKWA 5LJ3h 2I2LA 2FB7A 2VC8A 3JCMc 4JRKA 3JCMQ 4M7AF 2DJZA 2CGHA 2EJFA 4XQ3A 5LJ3g 5GAMd 3JCMV 5GAMh 3BDUA 5GMKm 3RKYA 3JB9F 1B34B 2RB6A 1WQWA 4M7DC 4M77D 5LJ5e 5GAN5 3M4GA 5GANe 3SB2A 4M7DF 4PJOD 4M78D 4RCBA 3BY7A 3VU3C 4C8QF 3JB9J 4M7AG 4J6WA 5GMKj 4EMKB 4M75D 5I21A 5LJ5j 1YCYA 4C8QE 4F7UB 5GANj 2VXEA 4JLIA 3RKXA 5GAN6 2ZGWA 3JB9G 3QHSA 4XTYA 2E64A 4PNOA 4HT9A 4XTXA 1WPYA 4F7UF 3JCMP 4N0AA 1U1SA 2YHTA 3V8LA 5GAN8 4XU3A 2FYKA 4XTWA 4XU1A 3V8JA 4F7UE 3JB9I 3JCMW 4M7DG 4N0AC 4QVCA 5GAMf 3PGGA 5GMKl 5LJ5d 4M7AD
chains in the Genus database with same CATH superfamily
3M9QA 2ZPFB 1VQPT 4HVUA 1SRLA 4AFSC 1K9MC 3OMGA 4HVWA 2FEIA 4EPCA 1M9SA 2NUTA 4ME7A 4PJJA 4QQDA 3I5SA 4GLKA 2KXDA 5KYXB 1Q86U 3RIRA 4DQ2A 4BDZA 3V7RA 1G2BA 3CC2A 3VS0A 4ORZA 2MYSA 2B8AA 1QQJA 2X4JA 4R56A 4NL2A 2PUKB 1GFCA 5GANg 4ELZC 2X3WD 4M78C 5LL6S 2KAFA 1WX6A 3I9QA 1IB8A 4M77E 3OYKA 2OI3A 2ZPGB 2BE7D 4EMKC 4A4KA 1TWBA 5GAOm 4Y92A 5GAMj 1VQ5A 1QVGA 4LDWA 4PFOA 4DBHA 1BI3A 1X2QA 4OGCA 1X43A 4ESRA 4VUBA 3CCEA 5LJ3d 3FEOA 2RK1A 2AK5A 4KUIA 3G6EQ 2FG0A 1NYFA 2LTOA 2JMCA 4QQ6A 2RJCA 1VQNQ 5GAMe 3CC7Q 1KK7A 4FYVB 1H92A 2GBQA 3L1AA 3QSUA 2QQBA 2EKHA 2PQWA 5AT1B 5IN1A 4ZNXA 1YHQA 1NPPA 2I2LA 3P8DA 5FU7C 4OGEA 3G6ET 5GAMh 2XG8D 3MO8A 1AVZC 2NUPA 2PZ1A 4M77D 1QKWA 3MP1A 1T0JA 2AT1B 4Q5WA 4LD6A 1UGSB 2OTJQ 5CVIA 3ULRB 1B7TA 2F2XA 1VQNT 2J7IA 3H9NA 3M54A 3CC7T 3BE3A 1IGQA 2EQIA 1ZUKA 2DILA 2AHJB 4CI0C 1BU1A 2YRDA 2A7YA 1G5VA 1K73C 4J6XA 4AFQC 1VA7A 5CKHA 4JS5A 1SSHA 5KE3A 1X69A 2Y4XA 4F7UA 3C0CA 4C92E 2M51A 2R57A 2OTJT 2VKNA 1H8KA 3LGFA 2NUZA 2CP5A 4LE9A 2M1HA 4J9EA 1UG1A 1PHTA 2K5FA 2KE9A 2DL5A 5ECAA 3C12A 2LCSA 2LVMA 3CCQA 2E10A 4FT2A 2V8JA 1M3CA 4IUTA 1U06A 3SD4A 4PJOF 3LH5A 2LQNA 1VQ5Q 1G83A 2JUFA 2F5KA 3ZEHA 1UUEA 2HSEB 3META 3CCEQ 4IUUA 4HCBA 4M7AB 2FRWA 2SEMA 4GLMA 2K3XA 3QYGB 2KGTA 1KC8R 1V1CA 3OW2A 2XD0A 3P8HA 4C92D 3GBQA 3SFMA 4B6MA 3OYYA 3U23A 3JV3A 1FMWA 1N6AA 1VQ5T 1M8VA 1M1KR 1HJDA 4RG8A 1YHQQ 3CCET 3ZFJA 2M02A 2YT6A 4J9DA 2MWOA 5KYUA 5CQYA 1TH7A 2DL3A 1ZHIA 2V26A 1D0ZA 4JRKA 1UTIA 2XIDA 2LQKA 2PTKA 1ZBXA 4HCZA 4OMQA 2HBWA 3VU3C 4FYYB 4PFPA 4JLIA 1CKAA 3CCUA 2F2WA 4XTXA 3LH0A 3HRUA 4HCCA 3V8JA 3L2VA 4LXCA 1J3TA 1YHQT 3QWYA 2QQSA 3OS0A 3M0QA 1V29B 4M7DA 1VUBA 5IXBA 1MGQA 1RAHB 2MMPA 1FWZA 2G3RA 5CCAA 1RAAB 2X4WA 1I8FA 1YWOA 3JRZA 3MEVA 1PKTA 3N5BB 4XTUA 4JRQA 3E1SA 3SHWA 2QA4A 2XDDA 4EMHA 1Y96B 4AG1C 3VS3A 2QI2A 1YCSB 2JT4A 1T3SA 1X01A 4NS5A 1OZ2A 4HT8A 2BKDN 3J80E 5LJ5g 1YIJQ 1VYVA 1NBEB 2ROLA 4XTZA 2O9VA 4D6WA 2JM8A 5FLXE 3L2WA 4M78F 1C0MA 2JN0A 4IUQA 2LJ0A 4LUEA 4LDYA 2MCNA 2JTEA 2RN8A 3JB9H 3GOXA 1PWTA 1RAGB 2HDAA 4FSXA 1LPLA 1K9MU 3A98A 2O4XB 1FMVA 1TUGB 4C8QB 3O8VA 2RI5A 4WCIA 2ZCFB 4C0DB 3FLGA 1IZ6A 1AWJA 1F1BB 4M7DE 2EWNA 3EFOB 4BACA 2KRSA 2OTLA 3PNWC 1K0XA 2HKQB 1VYTA 2RI3A 3P8BB 3VUBA 2CGHA 2EJFA 1NYGA 3THKA 1W2BS 2CP2A 2LCLA 4FW1A 2RB6A 4FL6A 3OSVA 3M0TA 1QP3A 3EG1A 2LJ3A 3JB9J 1WDXA 3CCUQ 5GMKj 3NTIA 1K0SA 2KY9A 3J81E 4XU1A 2KRMA 4AFUC 2DNUA 5GANd 3V7SA 2YUNA 2LP5A 3OMCA 1KHCA 3EH2A 2ED0A 1YWPA 2P0QA 1KIKA 1UB4A 5GMKe 1LCKA 3GF5A 3FIFA 1Q86R 1SG5A 1T0HA 2DRMA 5J26A 6AT1B 3LX7A 2QA4Q 3CCUT 3EGUA 4ZGEB 4A4EA 1SEMA 2EYYA 2COWA 1GCPA 2PVGB 5GMKh 1EZZB 2PUOB 3GNGA 3DKMA 2QDLA 2JXBA 4HXJA 3JB9D 2BZ8A 3I35A 2X4XA 2DM1A 4M75C 2YUOA 1XQHA 1K1ZA 4E7SA 1A0NB 1MHNA 4E2FB 2QA4T 2BUDA 1XTDA 2L0AA 5KH6A 3JCMg 1WJRA 2CZ6B 2BZYA 1K73U 2CP6A 4PJOA 1BBZA 1JU5C 1ARKA 1WI7A 1Z9ZA 1SKUB 2XI9A 2HNIA 2DKGA 2IG0A 3MP8A 2EQKA 2OTLQ 2E65A 2VWFA 2RJFA 3HFNA 1WFWA 2RHYA 1TUDA 3S3NA 1Q81C 1ZQ1A 3X26B 5KCHA 5KYWA 2GFAA 1MUZA 2EYQA 1G3YA 2X9HA 1UGQB 2YRVA 4JZ4A 1Q81R 2OAWA 1KQSA 4RCBA 5IT9E 1EX4A 2RPNA 2V8IA 1QVPA 2D1XA 4EMKB 3G1JA 3L2UA 4C8QE 3M55A 4ZGDB 2HEQA 1VQOQ 2ZGWA 2OTLT 4N0AA 3UA6A 4R0KA 4XU3A 4J9GA 4GY5A 4DBRA 5CIUA 2V1QA 2JZ2A 2ROTA 4UC4A 1AZEA 2E5QA 1QVFA 2LJ1A 4C0GA 2YDLA 2FZGB 1UECA 2D0QB 2DBKA 2GTOA 1BK2A 4PJOE 2IIMA 4DEXA 3RESA 1NE8A 2KNBB 1U5SA 5GJWB 4E7LA 1VQOT 4CC7A 1BCOA 1M4ZA 2FRYA 2AKLA 3SWNB 1Y7XA 2EAYA 1R8OB 2CS7A 3TU4K 2AKKA 1B34A 4F04B 3TQ7P 1VOMA 3QUIA 2CYZB 2RA2A 1PSEA 2M0OA 5CKBA 4FCYA 3QJ6A 3LGLA 4C8QD 3OYGA 3CCSA 1UGVA 5GAOq 4ZTJA 5CO7A 4A4GA 2JJ9A 2GTJA 2QTXA 5EG2A 1RABB 2MIOA 1KHIA 3NFCA 2VB6A 4IKFA 4FM4B 1O75A 2QXFA 2RHUA 5KYNA 3PTAA 4L59A 2DD4A 2FPFA 3I55A 1I1JA 3QZ9B 3CBPA 4M78A 3FRNA 5IH2A 2DERA 4AT1B 2LRQA 4F14A 3OYBA 1AWOA 2XKOC 3NHNA 2NUTB 1RAEB 1R0CB 2CT4A 1PSFA 5AYFA 1WXUA 2DE0X 1WHLA 2JOYA 4MZPA 2PNIA 1W1FA 3OYMA 1X75C 1VQ6A 1PCXA 2L8DA 5L23A 3EH1A 3MP6A 3SB2A 3KBGA 4M7AG 3HP9A 3VYGA 5FWCA 2J6FA 4AMCA 5GAN6 3JB9G 1JXOA 1WHJA 1Q7YC 1WPYA 1NZ9A 3CC4A 2PVDB 4XTWA 2ZPHB 4N0AC 1RI9A 5LJ5d 2OAUA 3C4SA 4V2SA 1AWWA 2YSQA 3KXTA 2DETA 3JCMb 4C92B 2DIGA 1ZLMA 1Q7YR 1PRMC 1W6XA 1QLYA 1WHHA 2RO0A 1YJWA 3QDFA 2O2OA 4M78E 3M0SA 3OYEA 1M30A 1UDLA 2EJ9A 2RQUA 1YITA 4LDUA 1HD3A 2ZPIB 3TREA 1E6GA 4IIOA 2E1HA 1FYNA 2DYBA 4RTYA 1ABQA 3G71A 3VJPA 3CCSQ 4C0ZA 1VQKA 1M2VA 3GIBA 2LCCA 5LJ3e 5GAOn 2NUPB 4KRTA 1ABOA 1TUCA 1VQ9A 2L3PA 4M75F 1NG2A 2HQXA 4A54A 1R77A 4O5VA 1K9MR 4MZTA 4JPBW 4E47A 2BZXA 3PIOA 1WNLA 1YJ9A 2K79A 5FU6B 1I5LA 2DXTA 1OX8A 4NOYA 3S6WA 1M3AA 3M59A 1ZSZB 3LLRA 4J83A 2E5KA 3CCST 1LVKA 1Y57A 3BDLA 3EFRA 5CKFA 3REBB 3E9FA 3UF4A 3BFMA 1BCMA 4E7JA 2YRCA 2HCKA 4XU0A 4C0FA 2ABLA 3JCMQ 1SRMA 3WXMB 2DJZA 2PVOB 3CPWP 3JCMV 5GMKm 4BE2A 3M4YA 4FYXB 4XK8E 4JZ3A 4R55A 2BE9B 3MKDA 3HL8A 4KH1B 4AFZC 1AZGB 1CKBA 3CCRA 1YCYA 4KGXB 3CC4Q 2CREA 2FO0A 1OOTA 1SHFA 3UDCA 4F17A 1C6VX 1GBQA 4BY6C 5GAMf 3RERA 2LMJA 1QCFA 3TSWA 1OX9A 1YBYA 1D3BA 2EIFA 4OB3B 2CP3A 2K3BA 1YJWQ 2LZ6B 1KJWA 2RK2A 2VGMA 8ATCB 1YITQ 4BI8B 4XU2A 4Y28E 2DIQA 1RLQC 3JCMd 1Q81U 4OMLA 2A28A 4J8OA 3CC4T 1VYUA 5D6WA 2RQWA 3G71Q 1H3HA 1M2OA 5KYUB 1VQKQ 2W10A 4J9HA 3NTKA 2E6NA 1VQ9Q 1Y0MA 2KVQG 2ZPBB 1K8AC 1E6HA 1YJWT 5GAOr 4LUDA 5IAYA 1U8RA 3VYHB 5KYXA 1YITT 5CKDA 2DA9A 2QGGA 2JTFA 2KMTA 3OYFA 3CC2Q 1K73R 1K8AR 3VUZA 3PFSA 1YJ9Q 1TOVA 2RNAA 5D6XA 2A3LA 2CP7A 3SEMA 1X27A 3LWIA 4E7HA 3G71T 4MZMA 1VQKT 3MHXA 4M7DB 4ELYC 1VQ9T 2HSPA 5EC7A 4X34A 1QW1A 1NEBA 1O9SA 1MV3A 4BE1A 2DTHA 4RTWA 3MPUB 5I2SA 3CC2T 2M9UA 4OB2B 1YJ9T 3E2UA 1WXBA 2L5QA 2IPOB 3EAEA 4C5IA 3NMZC 2YUPA 3A8GB 3QZ5B 3M4GA 3CCRQ 1WGSA 2L89A 5GAN8 1K9AA 4GBQA 4F7UE 4RTUA 4NL3A 4Y91A 1I0CA 3OQ5A 5KYYA 2P0PA 3UWNA 1JB0E 3RR6A 5A2QE 2K2MA 2K6DA 2MWPA 2R5MA 4OB1B 2CSIA 2RHZA 1QWEA 3CCRT 2VV5A 3QIIA 1JXMA 4OMPA 3E19A 1NJIC 1JJ2A 3R6OA 3VV0A 2YLCA 2COZA 1WHKA 1GL5A 1AD5A 2J05A 3OW2S 3QPHA 2GNCA 1SF9A 1OEBA 3CMAA 3GP8A 1KSWA 1N8RC 4HA8A 3HRSA 3VS7A 5GMKi 2NLUA 2QQRA 1Q7YU 3OYHA 4JUVA 4RTVA 1OPLA 1N8RR 4LDVA 2JW4A 2QGFB 2GQVA 1M5Q1 3UATA 3VKIA 5DY9A 2LT4A 3CCQQ 3H8ZA 3ER0A 1V76A 1QVGP 1WLPB 4M75A 2DD5A 2P4RA 2VXFA 2COYA 2LQ8A 4KT0E 5HK3A 4M7AA 2LC4A 4M77G 2AZSA 5KCOA 3H0IA 4OMFB 1P92A 2VC8A 4XQ3A 3CCQT 4JJDA 2D0NA 2XU8A 3A8OB 2QEXA 4C5HA 2XICA 2D8HA 5GANe 1W2BA 3C95A 2FVUA 1JEGA 3BY7A 3QKJA 1TSFA 4CC2A 3RKXA 4L6V5 1RAFB 2EFIA 3JSCA 1KFZA 2QYZA 2QG9B 3JB9I 3JCMW 1XOVA 3S3OA 5GANh 3ZBDA 5IHNA 3RUXA 4IUVA 1RUWA 2A36A 4PJOB 4BI3A 1KG1A 1BI0A 1G3SA 2YLBA 4M75E 1RAIB 2XMFA 4E7ZA 1LNXA 1I07A 4B9WA 2P4TA 4IUPA 1YJNA 5KYWB 2KR3A 4J6YA 4E6RA 2RJDA 4M77F 2DF6A 1IO6A 1BB9A 3X20B 3G4SA 4M7DD 2RH2A 2X4YA 1D1CA 3QG1A 2JNGA 2HAXA 2KSSA 5J3BA 1Q82C 1AOJA 1Y96A 5KE2A 4JLGA 4C92G 3EG2A 1N9RA 5I2MA 2EQUA 1MMGA 4BUGA 3CCLA 4FIBA 1MNEA 2RJEA 3QDRB 2KT8A 4JRIA 1G8XA 1SSFA 3MJXA 1VQ4A 3CXCA 4PLLA 4RCCA 4QW2A 3OW2P 2HL3A 3DLLA 4M7AC 4WTOB 2K57A 2O4XA 2EQJA 1WA7A 2MOXA 3CCJA 1K8AU 2QEXQ 4JS4A 3VS2A 1KD1C 1B34B 2CSQA 1UHCA 1GRIA 1ZUUA 4IIMA 3UPUA 1YP5A 4ZTFA 1KD1R 2EGEA 7AT1B 4BE0A 2KEAA 3EG9B 1H3ZA 5GAN7 3S3MA 1Z9QA 2VYTA 3E9GA 2FZKB 2QEXT 4M78B 1FX7A 3QWXX 5GAMg 1AHJB 3F70A 3VS4A 2DAQA 4IURA 4X9CA 1UJYA 2VUBA 5CAIA 3M5AA 1YJNQ 1AT1B 1PD1A 1OPKA 2DBMA 4KUDK 3PE0A 2FZCB 2DRKA 2RHIA 1VIFA 4E7IA 2SRCA 3G4SQ 3H0FA 1K76A 3RDVA 2RQTA 3V8KA 2HZYA 2C0IA 2DZ9A 3OYAA 2WSFE 5GAN3 3KUFA 2JTMA 2P84A 3REAB 5CQXA 2J06A 2KRNA 4D8DA 5D7UA 1YJNT 2C0OA 4EDUA 2HKNA 1BIAA 1OQKA 2L3QA 1OU8A 5FU7B 1W70A 1M27C 4ZN1A 1JQQA 3G4ST 1D0YA 2ECZA 1VQ4Q 5IHKA 1ZUYA 5GAN4 1NEGA 1HSQA 2MPXC 4MDWA 3CPWS 1NJIU 2DL7A 2J6OA 1HXDA 1OU9A 2DK3A 2ED1A 5IXFA 1W4SA 4FU6A 3EGDB 3D7SB 3JCMX 1UEBA 2GQIA 2ENMA 1N5ZA 4BDYA 1QVFS 2D8JA 3EG0A 1N8RU 2WSEE 4E7KA 2QQ9A 4PL6A 3BDUA 2MAMA 3RKYA 1WQWA 1UJ0A 5LJ5e 5GAN5 4C0DC 1S72A 5I22A 4PJOD 4PFZA 1VQ4T 3PMTA 1X6BA 4PLIA 3O5ZA 4C5EA 1UGRB 3NTHA 1RACB 3OB9A 3AT1B 1BI2A 1AWXA 3V8LA 4O6JA 2EQMA 4M7DG 4P5NA 4FT4A 2O01E 1DJ7B 1VQMA 3ASKA 2Z0WA 1YN8A 4N4GA 1QKXA 3QXEB 3GPLA 2DLPA 2F2VA 3HSBA 1ACMB 5DLOA 4QVDA 3TVTA 4TVRA 2FPEA 1QCOA 2VASA 4J7IA 4RKUE 1SPKA 2CUDA 2E70A 1HK9A 3DLMA 4DA4A 3ZL7C 5LJ3j 2CH4A 1PG5B 2OX7A 2HD0A 3MEUA 3SWNA 2J6KA 3PVQA 4B9XA 4JJNK 2RD1A 1K4US 4M77A 4FSSA 3OBWA 1X2KA 2KXCA 1X6OA 2HBPA 1D3BB 1MV0B 1VQ7A 5GAOl 2QTVA 1UFFA 1QMCA 1ZA2B 3QO3A 1UE9A 2OTJA 4CC4B 3OYJA 5LJ3f 3I56A 1U1TA 3I5RA 2A08A 3JCMJ 2CT3A 4J9FA 3I55Q 2JS2A 4MMLA 1N9SA 2LNHB 5LJ3h 4M7AF 2H8HA 3JB9F 1S72Q 3L42A 5FRMA 4A4HA 1IXDA 2KDSA 2LQWA 2EGAA 4RTZA 2CUBA 4M78D 2YUQA 4J6WA 1RL2A 1Q82U 4F7UB 2QQAA 2EVRA 3QJYA 4HVVA 1Q95G 4PJNA 3OS1A 2RMOA 1B3QA 2E3HA 4DOVA 3OYIA 1KQSP 4QVCA 1OULA 1VQMQ 1VQ6Q 2JM9A 2M16A 4OMNA 3JCMe 2RF0A 3I55T 3BW1A 4HKEA 2DEUA 2L3SA 4DBFA 4K11A 3PT9A 4Z8AA 1OZ3A 3JCMf 1S72T 1XJWB 5GAN2 1ZX6A 1U3OA 4Z02A 1SHGA 3JCMh 2JS0A 1QVFP 1H641 1WQ7A 4C8QG 1KD1U 1VQ6T 1VQMT 4C92A 3RBBB 2LX9A 4DEYA 2HL5C 2X35A 4KBMB 5J39A 4QVZA 2K7AA 1S1NA 1PRLC 3V7CA 3A8MB 2XHCA 4DOWA 3RMSA 3A5ZB 1LOJA 2L2PA 1QVGS 2RQVA 3M0PA 3EGXA 5CK9A 4Z88A 4PJOG 4ATOA 3CCMA 3SWNC 4ZGJB 1WYXA 3C94A 1TU0B 5KYYB 1M90C 1PKSA 1VQ7Q 4X1VA 4M77C 1Y71A 4WF2A 5FWBA 1VIEA 3OBYA 3OY9A 4PKCC 3H6ZA 2YWWA 4QT7A 2ESWA 3I56Q 1NLOC 1G3TA 1M90R 2L3RA 2LX7A 2CP0A 1WZOA 4ZN3A 4RG2A 2K9GA 1MMAA 1GCQC 3RKWA 3JCMc 5L8RE 5GAMd 1AEYA 1ZSZA 4RTTA 2DMOA 2NYSA 3VRZA 1VQ7T 5A0DA 3L2RA 1B07A 1TS9A 2F1LA 4C8QF 5I21A 3A8LB 3M0RA 3G7ZA 5D6YA 4XTYA 3I56T 4HT9A 4PNOA 2GCXA 2DPPB 3JCMP 2E12A 2C0TA 2DL4A 3HPWA 3OA6A 1D0XA 3DB3A 3PGGA 2FHDA 3FJPA 1E7OA 3HTRA 4LD9K 2BIVA 3CEYA 3EFSA 1YIJA 2Y4YA 2EGCA 4KH0B 4M75B 3TSZA 2P0KA 4QKUA 5GAOp 2QK0A 1PC0A 2DVEA 4KGVB 1KC8C 3UA7A 3LYIA 5I11A 4II1A 3OS2A 2H3EB 4KULA 1Y07A 8AT1B 1M1KC 2R5AA 2R58A 2CZ7B 1EIFA 4C92C 1GXIE 4HCKA 2DTOA 4OF1A 1QCNA 3CCMQ 5HCKA 1YFNA 4M78G 3OS5A 4BB7A 2DX1A 1VQ8A 2F5TX 1BYMA 1NJIR 2KROA 1IGUA 1PNJA 3R6NA 2FPDA 1OV3A 2O88A 3VS6A 4N4IA 3LW5E 1GFDA 1JO8A 2X3XD 2QDYB 3CCMT 1FMKA 3T9NA 1IRXA 2MF2A 5FU6C 3VS5A 5HK0A 1QWFA 3HHTB 3WVEB 4LNPA 5DLQE 1ZSZC 1JJ2S 3NGPA 2ZPEB 5GANj 2VXEA 1OI1A 2CKKA 2E64A 1NPRA 2DFUA 2WACA 9ATCB 1HYOA 1TXQA 2A0FB 4QQGA 1YNZA 5DM7R 4PJMA 4RUGA 4PK4A 4FYWB 2DXBA 4ANJA 3MCAB 5A0GA 5GANf 2E4HA 2O9SA 3OYDA 4AG2C 2LT1A 2I0NA 2A37A 2B86A 4BD3A 3RMQA 4OP0A 1WJSA 1YIJT 4LDXA 4OVAA 2D6FA 1N27A 2EW3A 4RTXA 2EYWA 3M0UA 2LDMA 1MNDA 2KK4A 4F16A 2D9TA 4J9CA 1KQ1A 2ATCB 5IHIA 2WSCE 1ZBJA 1X6GA 1VQ8Q 3CMAQ 2K3YA 3ME9A 4M7AE 1I4K1 1I5OB 2DL8A 3CCVA 2CH4W 1ZA1B 2RQRA 1TTHB 1R0BG 2E41A 2NWMA 4JJBA 4KGZB 2DO3A 2BTTA 4CRIA 4OMOA 2EPDA 1VQOA 2RM4A 4MMKA 1Q86C 4MDXA 1JRIA 2KYBA 4FW2A 5C0MA 2FB7A 2VGNA 2MI6A 1VQ8T 3CMAT 1BKBA 5LJ3g 2HMAA 2EYZA 3VS1A 4M7DC 3UT1A 3X24B 1WXTA 2MK5A 3IQLA 1Q82R 2JMAA 1BI1A 4M75D 4CC3A 4M4ZA 3QHSA 1GBRA 4J9IA 2VVKA 2QASA 1U1SA 1M1GA 3QBYA 2G6FX 1M90U 4M7AD 1FXXA 2K5IA 2K5LA 2PU9B 4C8QA 4RMOA 2XDPA 2V1RA 2DTIA 3CD6A 2X51A 3M58A 2V8KA 1M3BA 4J5YA 3M57A 1VQLA 2GFUA 3EFOA 3A1PA 1LJOA 3HRTA 4YTLA 1BIBA 3DB4A 2DVJA 4JJCA 1KQ2A 2ZAEA 1RI0A 3URGA 2KBTA 1D1AA 1I81A 5FW9A 4A63B 3Q1JA 1JJ2P 1PM3A 4C5GA 4F7UG 3CXCS 1XNIA 2EJGA 3H41A 3TEEA 3MEWA 4C92F 3PIPA 2JVVA 4PJLA 2RHXA 1RADB 3OYCA 4EMGA 1T3LA 3L2ZA 3CMEA 2LNVA 3CCVQ 4EIKA 4LN2A 3RNJA 3QYHB 1G3WA 3X28B 2CDTA 5CKEA 2DXCA 1KC8U 1MMDA 2HQEA 1C1AA 4L5GA 2DZCA 5HY6A 3OYNA 3CPWA 2AIRB 1YI2A 4BY6B 3JAME 2DEQA 1IREB 2C06A 3CBOA 1M1KU 3AHUA 4JRPA 3CCLQ 1VQPA 3CCVT 1KQSS 4J7FA 3X25B 5CR2A 1WHMA 2KI7A 1IHVA 1ZSGA 5LJ5j 2ZZDA 3WVDB 3L2QA 5FROA 2K2VA 2KYMA 4F7UF 2YHTA 1W2BP 3EHQA 2AZVA 3CCJQ 2Y90A 5A0LA 3NPFA 3J7AF 2EBPA 3CD6Q 3H0HA 4M77B 4DBQA 3SDZA 2KT1A 3CCLT 1JBMA 4XTVA 1VQLQ 4C8QC 3FC3A 1M2VB 2XK0A 1QP2A 2GF7A 2QAZA 3FJ5A 1OYXA 1MMNA 2HQHA 1TG0A 5LJ5f 3EG9A 2DJQA 4X9DA 4A53A 3A8HB 3OYLA 1WHGA 1PD0A 2DXUA 5LJ5h 3CCJT 3FB9A 2YXYA 3CD6T 4PJOC 4XAXB 2OJ2A 3FDRA 1VQLT 3PMIA 3PVLA 2F69A 4EMKA 2CZ1B 2KQWA 3CPFA 1WJQA 2EYXA 3HFOA 5HKCA 2EKOA 5FRNA 3CMEQ 3TCJA 3INZA 1RLPC 3HKSA 5M9OA 3GLXA 3M53A 2DYIA 4M75G 3EG3A 4D8KA 3EHRA 4J9BA 3G6EA 2GGRA 3M56A 4OB0B 1M8MA 1M1FA 3LWHA 5GJVB 4BI4A 1YI2Q 3CBMA 1VQNA 1EFNA 2W0ZA 3CC7A 2IVWA 3CMET 3CQTA 3GNFB 3VRYA 1D1BA 4N4HA 1VQPQ 2H3JA 3CXCP 2O31A 2XDBA 5C6SA 2K4YA 1UGPB 3MEAA 1NM7A 1IHWA 1D09B 1UHFA 4M7DF 2RI2A 3EGDA 4JDSA 2M0YA 1NLPC 1WIEA 2E6ZA 3OSSC 1YI2T 1CSKA 2CZ0B 3EGXB 4OMMA 2FL7A 2FYKA 2E3IA 4Z89A 3KFVA 1GCQA 4A4FA 5GMKl
chains in the Genus database with same CATH topology
5CIUA 3M9QA 2ZPFB 3FJPA 5GANh 3ZBDA 1VQPT 4LD9K 3RUXA 4IUVA 2JZ2A 4UC4A 2BIVA 3CEYA 1K9MC 2E5QA 4PJOB 1QVFA 3EFSA 4C0GA 1YIJA 2Y4YA 4BI3A 4M75B 1KG1A 3OMGA 2D0QB 4EPCA 1BI0A 2P0KA 1M9SA 4PJOE 1G3SA 5GAOp 2YLBA 3RESA 4ME7A 2DVEA 1NE8A 1KC8C 4M75E 4QQDA 4GLKA 1Q86U 3RIRA 3LYIA 4E7LA 1VQOT 4DQ2A 4BDZA 3V7RA 1M4ZA 4II1A 3CC2A 1LNXA 3SWNB 4B9WA 3OS2A 1Y7XA 2P4TA 2B8AA 2EAYA 1R8OB 2CS7A 2X4JA 4IUPA 4R56A 3TU4K 1YJNA 4KULA 1Y07A 1B34A 4NL2A 2PUKB 1M1KC 2R5AA 4J6YA 4ELZC 2R58A 2CZ7B 1EIFA 3QUIA 4M78C 2CYZB 2RA2A 2RJDA 4C92C 1PSEA 2M0OA 1GXIE 4M77F 5CKBA 3CMAT 3X20B 3G4SA 4M7DD 5LL6S 3QJ6A 2KAFA 3LGLA 4C8QD 3OYGA 3CCSA 2RH2A 2X4YA 4M77E 2DTOA 4OF1A 5GAOq 3QG1A 3OYKA 2JNGA 2ZPGB 5CO7A 4A4GA 4ZTJA 4EMKC 2HAXA 2KSSA 4A4KA 5GAOm 5GAMj 2QTXA 5J3BA 5EG2A 1VQ5A 1QVGA 1Q82C 4LDWA 1KHIA 1Y96A 5KE2A 1BI3A 3NFCA 4JLGA 4OGCA 4C92G 4IKFA 4M78G 4VUBA 3CCEA 4FM4B 5LJ3d 1O75A 2QXFA 2RK1A 1N9RA 3FEOA 3OS5A 4KUIA 2RHUA 5I2MA 3PTAA 4L59A 2DD4A 3I55A 3QZ9B 2EQUA 4BB7A 3CBPA 4M78A 4BUGA 1VQ8A 4PJOC 2F5TX 3CCLA 1BYMA 4FIBA 2LTOA 3FRNA 2RJEA 3QDRB 2LRQA 4QQ6A 4JRIA 3OYBA 1SSFA 2RJCA 5GAMe 2XKOC 1VQ4A 4N4IA 3CXCA 3LW5E 4PLLA 4RCCA 1PSFA 4QW2A 3L1AA 3QSUA 2QDYB 5AYFA 2QQBA 3DLLA 3CCMT 4M7AC 2PQWA 2JOYA 2K57A 4MZPA 3T9NA 2O4XA 5IN1A 3OYMA 2EQJA 1NPPA 1YHQA 1X75C 1VQ6A 2I2LA 3P8DA 1K8AU 3CCJA 2MF2A 5FU7C 5FU6C 5HK0A 4JS4A 3HHTB 4OGEA 3G6ET 1KD1C 3WVEB 5GAMh 2XG8D 1B34B 3MO8A 5DLQE 2L8DA 4M77D 1JJ2S 3MP6A 3SB2A 3KBGA 3MP1A 4Q5WA 4M7AG 3HP9A 4LD6A 1UGSB 3VYGA 5CVIA 3UPUA 2ZPEB 1VQNT 5GANj 2VXEA 1OI1A 2CKKA 3M54A 5GAN6 3JB9G 4ZTFA 3CC7T 2E64A 1Q7YC 1WPYA 1NPRA 1NZ9A 4BE0A 3CC4A 2PVDB 4XTWA 2ZPHB 2WACA 4N0AC 5LJ5d 1H3ZA 2OAUA 2AHJB 4CI0C 3C4SA 5GAN7 3S3MA 4V2SA 3KXTA 2VYTA 3JCMb 2A7YA 3E9GA 4QQGA 1G5VA 1K73C 4J6XA 4C92B 2DIGA 5DM7R 4M78B 2QEXT 1FX7A 5CKHA 4JS5A 5GAMg 5KE3A 2DXBA 2RO0A 1AHJB 2Y4XA 3F70A 4F7UA 1YJWA 4C92E 2DAQA 4M78E 3OYEA 4IURA 2R57A 2EJ9A 4X9CA 5CAIA 2VUBA 3LGFA 4LDUA 1YITA 2OTJT 3M5AA 3MCAB 5A0GA 2M1HA 5GANf 3OYDA 2LT1A 2ZPIB 3TREA 2K5FA 4KUDK 4BD3A 2RHIA 2E1HA 1VIFA 3RMQA 4E7IA 3C12A 2LVMA 4OP0A 3G71A 1WJSA 3VJPA 3PGGA 3CCQA 2E10A 4FT2A 2V8JA 4C0ZA 4OVAA 1YIJT 1VQKA 4LDXA 2LCCA 1N27A 2D6FA 5LJ3e 3GIBA 4IUTA 5GAOn 3V8KA 1VQ9A 3SD4A 4PJOF 2LDMA 2KK4A 4M75F 2DZ9A 2JUFA 3OYAA 2F5KA 3ZEHA 2D9TA 2HQXA 2WSFE 4A54A 5GAN3 1KQ1A 3META 3KUFA 2JTMA 4IUUA 4O5VA 4HCBA 4MZTA 5CQXA 4M7AB 4E47A 2WSCE 1YJNT 3PIOA 4EDUA 2K3XA 1BIAA 1WNLA 1YJ9A 5FU7B 2K3YA 5FU6B 2DXTA 3ME9A 1I5LA 3QYGB 1I4K1 4M7AE 4NOYA 3S6WA 3M59A 3CCVA 4ZN1A 3LLRA 3G4ST 4J83A 3OW2A 2XD0A 3P8HA 4C92D 3CCST 5GAN4 3CPWS 2E41A 4MDWA 3BDLA 1NJIU 3SFMA 3EFRA 1HXDA 2DK3A 3OYYA 5CKFA 3E9FA 1W4SA 4FU6A 3BFMA 2DO3A 4E7JA 1N6AA 1VQ5T 4CRIA 3JCMX 1M8VA 1UEBA 4XU0A 1VQOA 2RM4A 4RG8A 4MMKA 3CCET 4C0FA 1Q86C 3ZFJA 4BDYA 4MDXA 1JRIA 1QVFS 2MWOA 5CQYA 5C0MA 1TH7A 1ZHIA 2FB7A 2VGNA 3JCMQ 4JRKA 2MI6A 2WSEE 3WXMB 4E7KA 2DJZA 1N8RU 2QQ9A 1BKBA 2PVOB 4PL6A 3JCMV 5LJ3g 2XIDA 3BDUA 2LQKA 2MAMA 3RKYA 5GMKm 3UT1A 1WQWA 3M4YA 4BE2A 4M7DC 4XK8E 3X24B 5LJ5e 4R55A 5GAN5 4C0DC 1ZBXA 3HL8A 1S72A 4PJOD 4HCZA 1VQ4T 3VU3C 3PMTA 4PLIA 1BI1A 4M75D 3CCRA 1YCYA 4C5EA 1UGRB 3NTHA 4JLIA 3OB9A 3QHSA 3CCUA 1BI2A 4A4FA 4XTXA 3LH0A 3UDCA 3HRUA 1U1SA 4BY6C 4HCCA 3V8LA 1M1GA 4O6JA 2EQMA 3V8JA 4M7DG 3L2VA 3QBYA 4P5NA 5GAMf 1YHQT 3RERA 1M90U 2QQSA 4M7AD 1FXXA 4FT4A 2O01E 1DJ7B 2K5IA 3OS0A 1YBYA 2K5LA 1VQMA 1V29B 3ASKA 4M7DA 1D3BA 1VUBA 2EIFA 2PU9B 4OB3B 4C8QA 4RMOA 2XDPA 1MGQA 2MMPA 2DTIA 3CD6A 4N4GA 1FWZA 3QXEB 3M58A 2G3RA 5CCAA 2RK2A 3GPLA 2V8KA 2VGMA 2X4WA 4J5YA 1I8FA 3M57A 1VQLA 2GFUA 3JRZA 3HSBA 4BI8B 4XU2A 4Y28E 3MEVA 5DLOA 2DIQA 4QVDA 3JCMd 1LJOA 3HRTA 1Q81U 3N5BB 4XTUA 4JRQA 3E1SA 4TVRA 4YTLA 4J8OA 1BIBA 3DB4A 3CC4T 1KQ2A 2QA4A 2XDDA 4EMHA 1RI0A 3URGA 4J7IA 5D6WA 1Y96B 1I81A 2QI2A 1X01A 4NS5A 1OZ2A 4HT8A 3Q1JA 2BKDN 4RKUE 3NTKA 3J80E 5LJ5g 2E6NA 4C5GA 2KVQG 2ZPBB 4F7UG 1K8AC 3CXCS 2E70A 1XNIA 2EJGA 4XTZA 3TEEA 3MEWA 1HK9A 3DLMA 4D6WA 1YJWT 5GAOr 5IAYA 4C92F 5FLXE 3L2WA 4DA4A 4M78F 1U8RA 3VYHB 5LJ3j 2JN0A 3PIPA 1YITT 4IUQA 5CKDA 2JVVA 4LDYA 3JB9H 2RHXA 3GOXA 2JTFA 3OYCA 2KMTA 3OYFA 2HD0A 3MEUA 4EMGA 3SWNA 3VUZA 3L2ZA 3PFSA 4FSXA 3CMEA 5D6XA 4B9XA 2A3LA 4JJNK 2LNVA 2RD1A 1K9MU 4M77A 3LWIA 2O4XB 4E7HA 3G71T 3OBWA 4MZMA 1X6OA 1VQKT 3MHXA 2HBPA 1D3BB 4M7DB 3QYHB 4C8QB 4ELYC 1G3WA 3X28B 3O8VA 2RI5A 5CKEA 1VQ9T 2ZCFB 4C0DB 1VQ7A 5GAOl 3FLGA 4X34A 2DXCA 1IZ6A 1QW1A 1KC8U 4M7DE 1O9SA 2EWNA 2HQEA 3QO3A 4L5GA 4BE1A 2DZCA 5HY6A 3OYNA 2OTJA 3CPWA 4BACA 3OYJA 2OTLA 2DTHA 5LJ3f 3I56A 1U1TA 1YI2A 4BY6B 2OTLT 3JCMJ 5I2SA 3PNWC 3JAME 3CC2T 2DEQA 1IREB 2M9UA 2RI3A 4MMLA 4OB2B 2C06A 1YJ9T 1N9SA 3CBOA 1M1KU 4JRPA 3AHUA 3P8BB 5LJ3h 4M7AF 2L5QA 3EAEA 3VUBA 2CGHA 2EJFA 1VQPA 1W2BS 3CCVT 4C5IA 1KQSS 4J7FA 3JB9F 2LCLA 3X25B 2RB6A 3L42A 4FL6A 5FRMA 4A4HA 2KDSA 3A8GB 3OSVA 3QZ5B 1QP3A 3M4GA 5CR2A 4M78D 3JB9J 4J6WA 5GMKj 3NTIA 5LJ5j 2ZZDA 1RL2A 1Q82U 3WVDB 1WGSA 4F7UB 3L2QA 2KY9A 2QQAA 5FROA 2K2VA 2L89A 3QJYA 3J81E 4F7UF 3OS1A 2YHTA 5GAN8 4DOVA 4XU1A 4F7UE 3OYIA 4QVCA 4NL3A 2M16A 2Y90A 4Y91A 3V7SA 5A0LA 3JCMe 5GANd 3OQ5A 3BW1A 4HKEA 3I55T 3J7AF 4M77B 2P0PA 3PT9A 1JB0E 3UWNA 3SDZA 3OMCA 5GANg 1KHCA 1OZ3A 5A2QE 3CCLT 1JBMA 4XTVA 2MWPA 2R5MA 2P0QA 4C8QC 1UB4A 4OB1B 3JCMf 5GMKe 3FC3A 1YI2T 1S72T 2RHZA 5GAN2 2XK0A 3GF5A 3FIFA 1QP2A 2GF7A 3CCRT 2VV5A 5J26A 3QIIA 3LX7A 3E19A 3CCUT 4Z02A 1NJIC 1OYXA 1JJ2A 3JCMh 4ZGEB 4A4EA 5LJ5f 1H641 3R6OA 1WQ7A 3VV0A 2YLCA 4X9DA 4A53A 2PVGB 3A8HB 4C8QG 3OYLA 1KD1U 1VQ6T 5GMKh 1VQMT 2DXUA 5LJ5h 3QPHA 3CCJT 2PUOB 3GNGA 4C92A 3DKMA 3CCMA 3OW2S 3FB9A 2LX9A 3CMAA 3JB9D 3GP8A 3CD6T 2X35A 4KBMB 4XAXB 2X4XA 4HA8A 4QVZA 3HRSA 5J39A 5GMKi 1N8RC 2NLUA 3V7CA 3A8MB 2XHCA 3FDRA 4M75C 3PMIA 3A5ZB 3RMSA 1XQHA 4DOWA 1LOJA 1VQLT 2F69A 4EMKA 2CZ1B 2KQWA 1QVGS 2QQRA 1Q7YU 3CPFA 1WJQA 3HFOA 5HKCA 1MHNA 2EKOA 5FRNA 3OYHA 4JUVA 2QA4T 2BUDA 3TCJA 5CK9A 1XTDA 4LDVA 5KH6A 3JCMg 4PJOG 4ATOA 3INZA 2GQVA 1M5Q1 3VKIA 3HKSA 1WJRA 3GLXA 3SWNC 5DY9A 2CZ6B 3M53A 4M75G 4ZGJB 5M9OA 1K73U 2LT4A 3C94A 3H8ZA 1M90C 3ER0A 4PJOA 4M77C 1Y71A 3G6EA 4WF2A 3M56A 4M75A 2DD5A 4OB0B 2XI9A 1M1FA 2HNIA 1VIEA 3OBYA 2DKGA 3OY9A 4PKCC 3H6ZA 2VXFA 2IG0A 3LWHA 3MP8A 4BI4A 2EQKA 2E65A 3CBMA 2LQ8A 1G3TA 4KT0E 5HK3A 2RJFA 1VQNA 3HFNA 2L3RA 4M7AA 2LC4A 2RHYA 3CC7A 3S3NA 1Q81C 2IVWA 4M77G 3CMET 1ZQ1A 3X26B 5KCHA 3GNFB 4ZN3A 5KCOA 4RG2A 4N4HA 4OMFB 1P92A 2GFAA 2H3JA 3RKWA 2VC8A 3JCMc 5L8RE 2EYQA 4XQ3A 5GAMd 2XDBA 1G3YA 5C6SA 2K4YA 3CCQT 1UGQB 2XU8A 1UGPB 2YRVA 3MEAA 1VQ7T 3A8OB 5A0DA 3L2RA 2QEXA 4C5HA 1VQ8T 2XICA 1W2BA 5GANe 1KQSA 4M7DF 3C95A 2FVUA 4RCBA 3BY7A 4C8QF 5IT9E 3QKJA 2RI2A 2V8IA 1QVPA 4EMKB 5I21A 3L2UA 3A8LB 4JDSA 4C8QE 3M55A 3RKXA 4ZGDB 3OSSC 2ZGWA 2E6ZA 3G7ZA 4XTYA 4L6V5 4PNOA 2GCXA 5D6YA 2DPPB 3I56T 4HT9A 3JCMP 2CZ0B 2E12A 2EFIA 3JSCA 4N0AA 3HPWA 2FL7A 2FYKA 4XU3A 3OA6A 3JB9I 4GY5A 3JCMW 1XOVA 3S3OA 3DB3A 2FHDA 5GMKl
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y90 A;  4Y91 A;  3FJP A;  3V7S A;  3JCM e;  5GAN d;  5GAN 7;  3BW1 A;  5GAN h;  4V2S A;  3RUX A;  3JCM b;  4M77 B;  4M7D A;  1D3B A;  4C8Q A;  4J6X A;  4C92 B;  4PJO B;  1MGQ A;  3EFS A;  1JBM A;  4M78 B;  4XTV A;  2DTI A;  4C8Q C;  4M75 B;  3JCM f;  5GMK e;  5GAM g;  5GAN 2;  4J5Y A;  1I8F A;  3FIF A;  3RER A;  4F7U A;  3HSB A;  4C92 E;  4PJO E;  4XU2 A;  4M78 E;  4QVD A;  2YLB A;  3RES A;  5GAO p;  2EJ9 A;  2DVE A;  3JCM d;  1LJO A;  4M75 E;  4X9C A;  5CAI A;  4XTU A;  3JCM h;  3RIR A;  1BIB A;  5LJ5 f;  1H64 1;  1KQ2 A;  1WQ7 A;  5GAN f;  4DQ2 A;  3V7R A;  4EMH A;  2YLC A;  4X9D A;  4A53 A;  1LNX A;  1Y96 B;  3SWN B;  4C8Q G;  1I81 A;  2EAY A;  5GMK h;  1X01 A;  2DXU A;  5LJ5 h;  4HT8 A;  4C92 A;  2E1H A;  3FB9 A;  1B34 A;  4NL2 A;  4OP0 A;  5LJ5 g;  3JB9 D;  4J6Y A;  2E10 A;  4C92 C;  4F7U G;  3QUI A;  5GAN g;  4M78 C;  2RA2 A;  4HA8 A;  3GIB A;  4PJO C;  2EJG A;  4XTZ A;  5GMK i;  5LJ3 e;  5GAO n;  1HK9 A;  4M77 F;  3V7C A;  4M75 C;  3V8K A;  4M7D D;  5GAO r;  1LOJ A;  4PJO F;  4C8Q D;  4C92 F;  4M78 F;  4M77 E;  4EMK A;  2DTO A;  5LJ3 j;  5GAO q;  2JN0 A;  4M75 F;  3HFO A;  2DZ9 A;  4EMK C;  4A54 A;  5GAN 3;  5GAM j;  5GAO m;  1KQ1 A;  2QTX A;  4JUV A;  3JB9 H;  4EMG A;  1Y96 A;  3SWN A;  4M7A B;  3JCM g;  3L2Z A;  4C92 G;  4PJO G;  4M78 G;  3INZ A;  5LJ3 d;  1M5Q 1;  3SWN C;  1N9R A;  5DY9 A;  2RD1 A;  4M75 G;  1BIA A;  1WNL A;  4M77 A;  1I5L A;  2DXT A;  4M7A E;  1I4K 1;  4PJO A;  4M78 A;  4M7D B;  1D3B B;  4M77 C;  4NOY A;  4C8Q B;  4WF2 A;  4M75 A;  4C92 D;  2HNI A;  4JRI A;  5GAO l;  2DKG A;  5GAN 4;  2VXF A;  2E41 A;  4M7D E;  4NL3 A;  2EWN A;  1HXD A;  3EFR A;  5GAM e;  2E65 A;  3QO3 A;  3BFM A;  2DZC A;  3HFN A;  3JCM X;  4M7A A;  2DTH A;  4RCC A;  5LJ3 f;  1U1T A;  1M8V A;  4XU0 A;  3L1A A;  3JCM J;  2RM4 A;  3QSU A;  4MMK A;  4M77 G;  4M7A C;  2K57 A;  2DEQ A;  1JRI A;  4MML A;  1N9S A;  1TH7 A;  3AHU A;  3RKW A;  5LJ3 h;  2I2L A;  2FB7 A;  2VC8 A;  3JCM c;  4JRK A;  3JCM Q;  4M7A F;  2DJZ A;  2CGH A;  2EJF A;  4XQ3 A;  5LJ3 g;  5GAM d;  3JCM V;  5GAM h;  3BDU A;  5GMK m;  3RKY A;  3JB9 F;  1B34 B;  2RB6 A;  1WQW A;  4M7D C;  4M77 D;  5LJ5 e;  5GAN 5;  3M4G A;  5GAN e;  3SB2 A;  4M7D F;  4PJO D;  4M78 D;  4RCB A;  3BY7 A;  3VU3 C;  4C8Q F;  3JB9 J;  4M7A G;  4J6W A;  5GMK j;  4EMK B;  4M75 D;  5I21 A;  5LJ5 j;  1YCY A;  4C8Q E;  4F7U B;  5GAN j;  2VXE A;  4JLI A;  3RKX A;  5GAN 6;  2ZGW A;  3JB9 G;  3QHS A;  4XTY A;  2E64 A;  4PNO A;  4HT9 A;  4XTX A;  1WPY A;  4F7U F;  3JCM P;  4N0A A;  1U1S A;  2YHT A;  3V8L A;  5GAN 8;  4XU3 A;  2FYK A;  4XTW A;  4XU1 A;  3V8J A;  4F7U E;  3JB9 I;  3JCM W;  4M7D G;  4N0A C;  4QVC A;  5GAM f;  3PGG A;  5GMK l;  5LJ5 d;  4M7A D; 
#chains in the Genus database with same CATH topology
 3M9Q A;  2ZPF B;  1VQP T;  4HVU A;  1SRL A;  4AFS C;  1K9M C;  3OMG A;  4HVW A;  2FEI A;  4EPC A;  1M9S A;  2NUT A;  4ME7 A;  4PJJ A;  4QQD A;  3I5S A;  4GLK A;  2KXD A;  5KYX B;  1Q86 U;  3RIR A;  4DQ2 A;  4BDZ A;  3V7R A;  1G2B A;  3CC2 A;  3VS0 A;  4ORZ A;  2MYS A;  2B8A A;  1QQJ A;  2X4J A;  4R56 A;  4NL2 A;  2PUK B;  1GFC A;  5GAN g;  4ELZ C;  2X3W D;  4M78 C;  5LL6 S;  2KAF A;  1WX6 A;  3I9Q A;  1IB8 A;  4M77 E;  3OYK A;  2OI3 A;  2ZPG B;  2BE7 D;  4EMK C;  4A4K A;  1TWB A;  5GAO m;  4Y92 A;  5GAM j;  1VQ5 A;  1QVG A;  4LDW A;  4PFO A;  4DBH A;  1BI3 A;  1X2Q A;  4OGC A;  1X43 A;  4ESR A;  4VUB A;  3CCE A;  5LJ3 d;  3FEO A;  2RK1 A;  2AK5 A;  4KUI A;  3G6E Q;  2FG0 A;  1NYF A;  2LTO A;  2JMC A;  4QQ6 A;  2RJC A;  1VQN Q;  5GAM e;  3CC7 Q;  1KK7 A;  4FYV B;  1H92 A;  2GBQ A;  3L1A A;  3QSU A;  2QQB A;  2EKH A;  2PQW A;  5AT1 B;  5IN1 A;  4ZNX A;  1YHQ A;  1NPP A;  2I2L A;  3P8D A;  5FU7 C;  4OGE A;  3G6E T;  5GAM h;  2XG8 D;  3MO8 A;  1AVZ C;  2NUP A;  2PZ1 A;  4M77 D;  1QKW A;  3MP1 A;  1T0J A;  2AT1 B;  4Q5W A;  4LD6 A;  1UGS B;  2OTJ Q;  5CVI A;  3ULR B;  1B7T A;  2F2X A;  1VQN T;  2J7I A;  3H9N A;  3M54 A;  3CC7 T;  3BE3 A;  1IGQ A;  2EQI A;  1ZUK A;  2DIL A;  2AHJ B;  4CI0 C;  1BU1 A;  2YRD A;  2A7Y A;  1G5V A;  1K73 C;  4J6X A;  4AFQ C;  1VA7 A;  5CKH A;  4JS5 A;  1SSH A;  5KE3 A;  1X69 A;  2Y4X A;  4F7U A;  3C0C A;  4C92 E;  2M51 A;  2R57 A;  2OTJ T;  2VKN A;  1H8K A;  3LGF A;  2NUZ A;  2CP5 A;  4LE9 A;  2M1H A;  4J9E A;  1UG1 A;  1PHT A;  2K5F A;  2KE9 A;  2DL5 A;  5ECA A;  3C12 A;  2LCS A;  2LVM A;  3CCQ A;  2E10 A;  4FT2 A;  2V8J A;  1M3C A;  4IUT A;  1U06 A;  3SD4 A;  4PJO F;  3LH5 A;  2LQN A;  1VQ5 Q;  1G83 A;  2JUF A;  2F5K A;  3ZEH A;  1UUE A;  2HSE B;  3MET A;  3CCE Q;  4IUU A;  4HCB A;  4M7A B;  2FRW A;  2SEM A;  4GLM A;  2K3X A;  3QYG B;  2KGT A;  1KC8 R;  1V1C A;  3OW2 A;  2XD0 A;  3P8H A;  4C92 D;  3GBQ A;  3SFM A;  4B6M A;  3OYY A;  3U23 A;  3JV3 A;  1FMW A;  1N6A A;  1VQ5 T;  1M8V A;  1M1K R;  1HJD A;  4RG8 A;  1YHQ Q;  3CCE T;  3ZFJ A;  2M02 A;  2YT6 A;  4J9D A;  2MWO A;  5KYU A;  5CQY A;  1TH7 A;  2DL3 A;  1ZHI A;  2V26 A;  1D0Z A;  4JRK A;  1UTI A;  2XID A;  2LQK A;  2PTK A;  1ZBX A;  4HCZ A;  4OMQ A;  2HBW A;  3VU3 C;  4FYY B;  4PFP A;  4JLI A;  1CKA A;  3CCU A;  2F2W A;  4XTX A;  3LH0 A;  3HRU A;  4HCC A;  3V8J A;  3L2V A;  4LXC A;  1J3T A;  1YHQ T;  3QWY A;  2QQS A;  3OS0 A;  3M0Q A;  1V29 B;  4M7D A;  1VUB A;  5IXB A;  1MGQ A;  1RAH B;  2MMP A;  1FWZ A;  2G3R A;  5CCA A;  1RAA B;  2X4W A;  1I8F A;  1YWO A;  3JRZ A;  3MEV A;  1PKT A;  3N5B B;  4XTU A;  4JRQ A;  3E1S A;  3SHW A;  2QA4 A;  2XDD A;  4EMH A;  1Y96 B;  4AG1 C;  3VS3 A;  2QI2 A;  1YCS B;  2JT4 A;  1T3S A;  1X01 A;  4NS5 A;  1OZ2 A;  4HT8 A;  2BKD N;  3J80 E;  5LJ5 g;  1YIJ Q;  1VYV A;  1NBE B;  2ROL A;  4XTZ A;  2O9V A;  4D6W A;  2JM8 A;  5FLX E;  3L2W A;  4M78 F;  1C0M A;  2JN0 A;  4IUQ A;  2LJ0 A;  4LUE A;  4LDY A;  2MCN A;  2JTE A;  2RN8 A;  3JB9 H;  3GOX A;  1PWT A;  1RAG B;  2HDA A;  4FSX A;  1LPL A;  1K9M U;  3A98 A;  2O4X B;  1FMV A;  1TUG B;  4C8Q B;  3O8V A;  2RI5 A;  4WCI A;  2ZCF B;  4C0D B;  3FLG A;  1IZ6 A;  1AWJ A;  1F1B B;  4M7D E;  2EWN A;  3EFO B;  4BAC A;  2KRS A;  2OTL A;  3PNW C;  1K0X A;  2HKQ B;  1VYT A;  2RI3 A;  3P8B B;  3VUB A;  2CGH A;  2EJF A;  1NYG A;  3THK A;  1W2B S;  2CP2 A;  2LCL A;  4FW1 A;  2RB6 A;  4FL6 A;  3OSV A;  3M0T A;  1QP3 A;  3EG1 A;  2LJ3 A;  3JB9 J;  1WDX A;  3CCU Q;  5GMK j;  3NTI A;  1K0S A;  2KY9 A;  3J81 E;  4XU1 A;  2KRM A;  4AFU C;  2DNU A;  5GAN d;  3V7S A;  2YUN A;  2LP5 A;  3OMC A;  1KHC A;  3EH2 A;  2ED0 A;  1YWP A;  2P0Q A;  1KIK A;  1UB4 A;  5GMK e;  1LCK A;  3GF5 A;  3FIF A;  1Q86 R;  1SG5 A;  1T0H A;  2DRM A;  5J26 A;  6AT1 B;  3LX7 A;  2QA4 Q;  3CCU T;  3EGU A;  4ZGE B;  4A4E A;  1SEM A;  2EYY A;  2COW A;  1GCP A;  2PVG B;  5GMK h;  1EZZ B;  2PUO B;  3GNG A;  3DKM A;  2QDL A;  2JXB A;  4HXJ A;  3JB9 D;  2BZ8 A;  3I35 A;  2X4X A;  2DM1 A;  4M75 C;  2YUO A;  1XQH A;  1K1Z A;  4E7S A;  1A0N B;  1MHN A;  4E2F B;  2QA4 T;  2BUD A;  1XTD A;  2L0A A;  5KH6 A;  3JCM g;  1WJR A;  2CZ6 B;  2BZY A;  1K73 U;  2CP6 A;  4PJO A;  1BBZ A;  1JU5 C;  1ARK A;  1WI7 A;  1Z9Z A;  1SKU B;  2XI9 A;  2HNI A;  2DKG A;  2IG0 A;  3MP8 A;  2EQK A;  2OTL Q;  2E65 A;  2VWF A;  2RJF A;  3HFN A;  1WFW A;  2RHY A;  1TUD A;  3S3N A;  1Q81 C;  1ZQ1 A;  3X26 B;  5KCH A;  5KYW A;  2GFA A;  1MUZ A;  2EYQ A;  1G3Y A;  2X9H A;  1UGQ B;  2YRV A;  4JZ4 A;  1Q81 R;  2OAW A;  1KQS A;  4RCB A;  5IT9 E;  1EX4 A;  2RPN A;  2V8I A;  1QVP A;  2D1X A;  4EMK B;  3G1J A;  3L2U A;  4C8Q E;  3M55 A;  4ZGD B;  2HEQ A;  1VQO Q;  2ZGW A;  2OTL T;  4N0A A;  3UA6 A;  4R0K A;  4XU3 A;  4J9G A;  4GY5 A;  4DBR A;  5CIU A;  2V1Q A;  2JZ2 A;  2ROT A;  4UC4 A;  1AZE A;  2E5Q A;  1QVF A;  2LJ1 A;  4C0G A;  2YDL A;  2FZG B;  1UEC A;  2D0Q B;  2DBK A;  2GTO A;  1BK2 A;  4PJO E;  2IIM A;  4DEX A;  3RES A;  1NE8 A;  2KNB B;  1U5S A;  5GJW B;  4E7L A;  1VQO T;  4CC7 A;  1BCO A;  1M4Z A;  2FRY A;  2AKL A;  3SWN B;  1Y7X A;  2EAY A;  1R8O B;  2CS7 A;  3TU4 K;  2AKK A;  1B34 A;  4F04 B;  3TQ7 P;  1VOM A;  3QUI A;  2CYZ B;  2RA2 A;  1PSE A;  2M0O A;  5CKB A;  4FCY A;  3QJ6 A;  3LGL A;  4C8Q D;  3OYG A;  3CCS A;  1UGV A;  5GAO q;  4ZTJ A;  5CO7 A;  4A4G A;  2JJ9 A;  2GTJ A;  2QTX A;  5EG2 A;  1RAB B;  2MIO A;  1KHI A;  3NFC A;  2VB6 A;  4IKF A;  4FM4 B;  1O75 A;  2QXF A;  2RHU A;  5KYN A;  3PTA A;  4L59 A;  2DD4 A;  2FPF A;  3I55 A;  1I1J A;  3QZ9 B;  3CBP A;  4M78 A;  3FRN A;  5IH2 A;  2DER A;  4AT1 B;  2LRQ A;  4F14 A;  3OYB A;  1AWO A;  2XKO C;  3NHN A;  2NUT B;  1RAE B;  1R0C B;  2CT4 A;  1PSF A;  5AYF A;  1WXU A;  2DE0 X;  1WHL A;  2JOY A;  4MZP A;  2PNI A;  1W1F A;  3OYM A;  1X75 C;  1VQ6 A;  1PCX A;  2L8D A;  5L23 A;  3EH1 A;  3MP6 A;  3SB2 A;  3KBG A;  4M7A G;  3HP9 A;  3VYG A;  5FWC A;  2J6F A;  4AMC A;  5GAN 6;  3JB9 G;  1JXO A;  1WHJ A;  1Q7Y C;  1WPY A;  1NZ9 A;  3CC4 A;  2PVD B;  4XTW A;  2ZPH B;  4N0A C;  1RI9 A;  5LJ5 d;  2OAU A;  3C4S A;  4V2S A;  1AWW A;  2YSQ A;  3KXT A;  2DET A;  3JCM b;  4C92 B;  2DIG A;  1ZLM A;  1Q7Y R;  1PRM C;  1W6X A;  1QLY A;  1WHH A;  2RO0 A;  1YJW A;  3QDF A;  2O2O A;  4M78 E;  3M0S A;  3OYE A;  1M30 A;  1UDL A;  2EJ9 A;  2RQU A;  1YIT A;  4LDU A;  1HD3 A;  2ZPI B;  3TRE A;  1E6G A;  4IIO A;  2E1H A;  1FYN A;  2DYB A;  4RTY A;  1ABQ A;  3G71 A;  3VJP A;  3CCS Q;  4C0Z A;  1VQK A;  1M2V A;  3GIB A;  2LCC A;  5LJ3 e;  5GAO n;  2NUP B;  4KRT A;  1ABO A;  1TUC A;  1VQ9 A;  2L3P A;  4M75 F;  1NG2 A;  2HQX A;  4A54 A;  1R77 A;  4O5V A;  1K9M R;  4MZT A;  4JPB W;  4E47 A;  2BZX A;  3PIO A;  1WNL A;  1YJ9 A;  2K79 A;  5FU6 B;  1I5L A;  2DXT A;  1OX8 A;  4NOY A;  3S6W A;  1M3A A;  3M59 A;  1ZSZ B;  3LLR A;  4J83 A;  2E5K A;  3CCS T;  1LVK A;  1Y57 A;  3BDL A;  3EFR A;  5CKF A;  3REB B;  3E9F A;  3UF4 A;  3BFM A;  1BCM A;  4E7J A;  2YRC A;  2HCK A;  4XU0 A;  4C0F A;  2ABL A;  3JCM Q;  1SRM A;  3WXM B;  2DJZ A;  2PVO B;  3CPW P;  3JCM V;  5GMK m;  4BE2 A;  3M4Y A;  4FYX B;  4XK8 E;  4JZ3 A;  4R55 A;  2BE9 B;  3MKD A;  3HL8 A;  4KH1 B;  4AFZ C;  1AZG B;  1CKB A;  3CCR A;  1YCY A;  4KGX B;  3CC4 Q;  2CRE A;  2FO0 A;  1OOT A;  1SHF A;  3UDC A;  4F17 A;  1C6V X;  1GBQ A;  4BY6 C;  5GAM f;  3RER A;  2LMJ A;  1QCF A;  3TSW A;  1OX9 A;  1YBY A;  1D3B A;  2EIF A;  4OB3 B;  2CP3 A;  2K3B A;  1YJW Q;  2LZ6 B;  1KJW A;  2RK2 A;  2VGM A;  8ATC B;  1YIT Q;  4BI8 B;  4XU2 A;  4Y28 E;  2DIQ A;  1RLQ C;  3JCM d;  1Q81 U;  4OML A;  2A28 A;  4J8O A;  3CC4 T;  1VYU A;  5D6W A;  2RQW A;  3G71 Q;  1H3H A;  1M2O A;  5KYU B;  1VQK Q;  2W10 A;  4J9H A;  3NTK A;  2E6N A;  1VQ9 Q;  1Y0M A;  2KVQ G;  2ZPB B;  1K8A C;  1E6H A;  1YJW T;  5GAO r;  4LUD A;  5IAY A;  1U8R A;  3VYH B;  5KYX A;  1YIT T;  5CKD A;  2DA9 A;  2QGG A;  2JTF A;  2KMT A;  3OYF A;  3CC2 Q;  1K73 R;  1K8A R;  3VUZ A;  3PFS A;  1YJ9 Q;  1TOV A;  2RNA A;  5D6X A;  2A3L A;  2CP7 A;  3SEM A;  1X27 A;  3LWI A;  4E7H A;  3G71 T;  4MZM A;  1VQK T;  3MHX A;  4M7D B;  4ELY C;  1VQ9 T;  2HSP A;  5EC7 A;  4X34 A;  1QW1 A;  1NEB A;  1O9S A;  1MV3 A;  4BE1 A;  2DTH A;  4RTW A;  3MPU B;  5I2S A;  3CC2 T;  2M9U A;  4OB2 B;  1YJ9 T;  3E2U A;  1WXB A;  2L5Q A;  2IPO B;  3EAE A;  4C5I A;  3NMZ C;  2YUP A;  3A8G B;  3QZ5 B;  3M4G A;  3CCR Q;  1WGS A;  2L89 A;  5GAN 8;  1K9A A;  4GBQ A;  4F7U E;  4RTU A;  4NL3 A;  4Y91 A;  1I0C A;  3OQ5 A;  5KYY A;  2P0P A;  3UWN A;  1JB0 E;  3RR6 A;  5A2Q E;  2K2M A;  2K6D A;  2MWP A;  2R5M A;  4OB1 B;  2CSI A;  2RHZ A;  1QWE A;  3CCR T;  2VV5 A;  3QII A;  1JXM A;  4OMP A;  3E19 A;  1NJI C;  1JJ2 A;  3R6O A;  3VV0 A;  2YLC A;  2COZ A;  1WHK A;  1GL5 A;  1AD5 A;  2J05 A;  3OW2 S;  3QPH A;  2GNC A;  1SF9 A;  1OEB A;  3CMA A;  3GP8 A;  1KSW A;  1N8R C;  4HA8 A;  3HRS A;  3VS7 A;  5GMK i;  2NLU A;  2QQR A;  1Q7Y U;  3OYH A;  4JUV A;  4RTV A;  1OPL A;  1N8R R;  4LDV A;  2JW4 A;  2QGF B;  2GQV A;  1M5Q 1;  3UAT A;  3VKI A;  5DY9 A;  2LT4 A;  3CCQ Q;  3H8Z A;  3ER0 A;  1V76 A;  1QVG P;  1WLP B;  4M75 A;  2DD5 A;  2P4R A;  2VXF A;  2COY A;  2LQ8 A;  4KT0 E;  5HK3 A;  4M7A A;  2LC4 A;  4M77 G;  2AZS A;  5KCO A;  3H0I A;  4OMF B;  1P92 A;  2VC8 A;  4XQ3 A;  3CCQ T;  4JJD A;  2D0N A;  2XU8 A;  3A8O B;  2QEX A;  4C5H A;  2XIC A;  2D8H A;  5GAN e;  1W2B A;  3C95 A;  2FVU A;  1JEG A;  3BY7 A;  3QKJ A;  1TSF A;  4CC2 A;  3RKX A;  4L6V 5;  1RAF B;  2EFI A;  3JSC A;  1KFZ A;  2QYZ A;  2QG9 B;  3JB9 I;  3JCM W;  1XOV A;  3S3O A;  5GAN h;  3ZBD A;  5IHN A;  3RUX A;  4IUV A;  1RUW A;  2A36 A;  4PJO B;  4BI3 A;  1KG1 A;  1BI0 A;  1G3S A;  2YLB A;  4M75 E;  1RAI B;  2XMF A;  4E7Z A;  1LNX A;  1I07 A;  4B9W A;  2P4T A;  4IUP A;  1YJN A;  5KYW B;  2KR3 A;  4J6Y A;  4E6R A;  2RJD A;  4M77 F;  2DF6 A;  1IO6 A;  1BB9 A;  3X20 B;  3G4S A;  4M7D D;  2RH2 A;  2X4Y A;  1D1C A;  3QG1 A;  2JNG A;  2HAX A;  2KSS A;  5J3B A;  1Q82 C;  1AOJ A;  1Y96 A;  5KE2 A;  4JLG A;  4C92 G;  3EG2 A;  1N9R A;  5I2M A;  2EQU A;  1MMG A;  4BUG A;  3CCL A;  4FIB A;  1MNE A;  2RJE A;  3QDR B;  2KT8 A;  4JRI A;  1G8X A;  1SSF A;  3MJX A;  1VQ4 A;  3CXC A;  4PLL A;  4RCC A;  4QW2 A;  3OW2 P;  2HL3 A;  3DLL A;  4M7A C;  4WTO B;  2K57 A;  2O4X A;  2EQJ A;  1WA7 A;  2MOX A;  3CCJ A;  1K8A U;  2QEX Q;  4JS4 A;  3VS2 A;  1KD1 C;  1B34 B;  2CSQ A;  1UHC A;  1GRI A;  1ZUU A;  4IIM A;  3UPU A;  1YP5 A;  4ZTF A;  1KD1 R;  2EGE A;  7AT1 B;  4BE0 A;  2KEA A;  3EG9 B;  1H3Z A;  5GAN 7;  3S3M A;  1Z9Q A;  2VYT A;  3E9G A;  2FZK B;  2QEX T;  4M78 B;  1FX7 A;  3QWX X;  5GAM g;  1AHJ B;  3F70 A;  3VS4 A;  2DAQ A;  4IUR A;  4X9C A;  1UJY A;  2VUB A;  5CAI A;  3M5A A;  1YJN Q;  1AT1 B;  1PD1 A;  1OPK A;  2DBM A;  4KUD K;  3PE0 A;  2FZC B;  2DRK A;  2RHI A;  1VIF A;  4E7I A;  2SRC A;  3G4S Q;  3H0F A;  1K76 A;  3RDV A;  2RQT A;  3V8K A;  2HZY A;  2C0I A;  2DZ9 A;  3OYA A;  2WSF E;  5GAN 3;  3KUF A;  2JTM A;  2P84 A;  3REA B;  5CQX A;  2J06 A;  2KRN A;  4D8D A;  5D7U A;  1YJN T;  2C0O A;  4EDU A;  2HKN A;  1BIA A;  1OQK A;  2L3Q A;  1OU8 A;  5FU7 B;  1W70 A;  1M27 C;  4ZN1 A;  1JQQ A;  3G4S T;  1D0Y A;  2ECZ A;  1VQ4 Q;  5IHK A;  1ZUY A;  5GAN 4;  1NEG A;  1HSQ A;  2MPX C;  4MDW A;  3CPW S;  1NJI U;  2DL7 A;  2J6O A;  1HXD A;  1OU9 A;  2DK3 A;  2ED1 A;  5IXF A;  1W4S A;  4FU6 A;  3EGD B;  3D7S B;  3JCM X;  1UEB A;  2GQI A;  2ENM A;  1N5Z A;  4BDY A;  1QVF S;  2D8J A;  3EG0 A;  1N8R U;  2WSE E;  4E7K A;  2QQ9 A;  4PL6 A;  3BDU A;  2MAM A;  3RKY A;  1WQW A;  1UJ0 A;  5LJ5 e;  5GAN 5;  4C0D C;  1S72 A;  5I22 A;  4PJO D;  4PFZ A;  1VQ4 T;  3PMT A;  1X6B A;  4PLI A;  3O5Z A;  4C5E A;  1UGR B;  3NTH A;  1RAC B;  3OB9 A;  3AT1 B;  1BI2 A;  1AWX A;  3V8L A;  4O6J A;  2EQM A;  4M7D G;  4P5N A;  4FT4 A;  2O01 E;  1DJ7 B;  1VQM A;  3ASK A;  2Z0W A;  1YN8 A;  4N4G A;  1QKX A;  3QXE B;  3GPL A;  2DLP A;  2F2V A;  3HSB A;  1ACM B;  5DLO A;  4QVD A;  3TVT A;  4TVR A;  2FPE A;  1QCO A;  2VAS A;  4J7I A;  4RKU E;  1SPK A;  2CUD A;  2E70 A;  1HK9 A;  3DLM A;  4DA4 A;  3ZL7 C;  5LJ3 j;  2CH4 A;  1PG5 B;  2OX7 A;  2HD0 A;  3MEU A;  3SWN A;  2J6K A;  3PVQ A;  4B9X A;  4JJN K;  2RD1 A;  1K4U S;  4M77 A;  4FSS A;  3OBW A;  1X2K A;  2KXC A;  1X6O A;  2HBP A;  1D3B B;  1MV0 B;  1VQ7 A;  5GAO l;  2QTV A;  1UFF A;  1QMC A;  1ZA2 B;  3QO3 A;  1UE9 A;  2OTJ A;  4CC4 B;  3OYJ A;  5LJ3 f;  3I56 A;  1U1T A;  3I5R A;  2A08 A;  3JCM J;  2CT3 A;  4J9F A;  3I55 Q;  2JS2 A;  4MML A;  1N9S A;  2LNH B;  5LJ3 h;  4M7A F;  2H8H A;  3JB9 F;  1S72 Q;  3L42 A;  5FRM A;  4A4H A;  1IXD A;  2KDS A;  2LQW A;  2EGA A;  4RTZ A;  2CUB A;  4M78 D;  2YUQ A;  4J6W A;  1RL2 A;  1Q82 U;  4F7U B;  2QQA A;  2EVR A;  3QJY A;  4HVV A;  1Q95 G;  4PJN A;  3OS1 A;  2RMO A;  1B3Q A;  2E3H A;  4DOV A;  3OYI A;  1KQS P;  4QVC A;  1OUL A;  1VQM Q;  1VQ6 Q;  2JM9 A;  2M16 A;  4OMN A;  3JCM e;  2RF0 A;  3I55 T;  3BW1 A;  4HKE A;  2DEU A;  2L3S A;  4DBF A;  4K11 A;  3PT9 A;  4Z8A A;  1OZ3 A;  3JCM f;  1S72 T;  1XJW B;  5GAN 2;  1ZX6 A;  1U3O A;  4Z02 A;  1SHG A;  3JCM h;  2JS0 A;  1QVF P;  1H64 1;  1WQ7 A;  4C8Q G;  1KD1 U;  1VQ6 T;  1VQM T;  4C92 A;  3RBB B;  2LX9 A;  4DEY A;  2HL5 C;  2X35 A;  4KBM B;  5J39 A;  4QVZ A;  2K7A A;  1S1N A;  1PRL C;  3V7C A;  3A8M B;  2XHC A;  4DOW A;  3RMS A;  3A5Z B;  1LOJ A;  2L2P A;  1QVG S;  2RQV A;  3M0P A;  3EGX A;  5CK9 A;  4Z88 A;  4PJO G;  4ATO A;  3CCM A;  3SWN C;  4ZGJ B;  1WYX A;  3C94 A;  1TU0 B;  5KYY B;  1M90 C;  1PKS A;  1VQ7 Q;  4X1V A;  4M77 C;  1Y71 A;  4WF2 A;  5FWB A;  1VIE A;  3OBY A;  3OY9 A;  4PKC C;  3H6Z A;  2YWW A;  4QT7 A;  2ESW A;  3I56 Q;  1NLO C;  1G3T A;  1M90 R;  2L3R A;  2LX7 A;  2CP0 A;  1WZO A;  4ZN3 A;  4RG2 A;  2K9G A;  1MMA A;  1GCQ C;  3RKW A;  3JCM c;  5L8R E;  5GAM d;  1AEY A;  1ZSZ A;  4RTT A;  2DMO A;  2NYS A;  3VRZ A;  1VQ7 T;  5A0D A;  3L2R A;  1B07 A;  1TS9 A;  2F1L A;  4C8Q F;  5I21 A;  3A8L B;  3M0R A;  3G7Z A;  5D6Y A;  4XTY A;  3I56 T;  4HT9 A;  4PNO A;  2GCX A;  2DPP B;  3JCM P;  2E12 A;  2C0T A;  2DL4 A;  3HPW A;  3OA6 A;  1D0X A;  3DB3 A;  3PGG A;  2FHD A;  3FJP A;  1E7O A;  3HTR A;  4LD9 K;  2BIV A;  3CEY A;  3EFS A;  1YIJ A;  2Y4Y A;  2EGC A;  4KH0 B;  4M75 B;  3TSZ A;  2P0K A;  4QKU A;  5GAO p;  2QK0 A;  1PC0 A;  2DVE A;  4KGV B;  1KC8 C;  3UA7 A;  3LYI A;  5I11 A;  4II1 A;  3OS2 A;  2H3E B;  4KUL A;  1Y07 A;  8AT1 B;  1M1K C;  2R5A A;  2R58 A;  2CZ7 B;  1EIF A;  4C92 C;  1GXI E;  4HCK A;  2DTO A;  4OF1 A;  1QCN A;  3CCM Q;  5HCK A;  1YFN A;  4M78 G;  3OS5 A;  4BB7 A;  2DX1 A;  1VQ8 A;  2F5T X;  1BYM A;  1NJI R;  2KRO A;  1IGU A;  1PNJ A;  3R6N A;  2FPD A;  1OV3 A;  2O88 A;  3VS6 A;  4N4I A;  3LW5 E;  1GFD A;  1JO8 A;  2X3X D;  2QDY B;  3CCM T;  1FMK A;  3T9N A;  1IRX A;  2MF2 A;  5FU6 C;  3VS5 A;  5HK0 A;  1QWF A;  3HHT B;  3WVE B;  4LNP A;  5DLQ E;  1ZSZ C;  1JJ2 S;  3NGP A;  2ZPE B;  5GAN j;  2VXE A;  1OI1 A;  2CKK A;  2E64 A;  1NPR A;  2DFU A;  2WAC A;  9ATC B;  1HYO A;  1TXQ A;  2A0F B;  4QQG A;  1YNZ A;  5DM7 R;  4PJM A;  4RUG A;  4PK4 A;  4FYW B;  2DXB A;  4ANJ A;  3MCA B;  5A0G A;  5GAN f;  2E4H A;  2O9S A;  3OYD A;  4AG2 C;  2LT1 A;  2I0N A;  2A37 A;  2B86 A;  4BD3 A;  3RMQ A;  4OP0 A;  1WJS A;  1YIJ T;  4LDX A;  4OVA A;  2D6F A;  1N27 A;  2EW3 A;  4RTX A;  2EYW A;  3M0U A;  2LDM A;  1MND A;  2KK4 A;  4F16 A;  2D9T A;  4J9C A;  1KQ1 A;  2ATC B;  5IHI A;  2WSC E;  1ZBJ A;  1X6G A;  1VQ8 Q;  3CMA Q;  2K3Y A;  3ME9 A;  4M7A E;  1I4K 1;  1I5O B;  2DL8 A;  3CCV A;  2CH4 W;  1ZA1 B;  2RQR A;  1TTH B;  1R0B G;  2E41 A;  2NWM A;  4JJB A;  4KGZ B;  2DO3 A;  2BTT A;  4CRI A;  4OMO A;  2EPD A;  1VQO A;  2RM4 A;  4MMK A;  1Q86 C;  4MDX A;  1JRI A;  2KYB A;  4FW2 A;  5C0M A;  2FB7 A;  2VGN A;  2MI6 A;  1VQ8 T;  3CMA T;  1BKB A;  5LJ3 g;  2HMA A;  2EYZ A;  3VS1 A;  4M7D C;  3UT1 A;  3X24 B;  1WXT A;  2MK5 A;  3IQL A;  1Q82 R;  2JMA A;  1BI1 A;  4M75 D;  4CC3 A;  4M4Z A;  3QHS A;  1GBR A;  4J9I A;  2VVK A;  2QAS A;  1U1S A;  1M1G A;  3QBY A;  2G6F X;  1M90 U;  4M7A D;  1FXX A;  2K5I A;  2K5L A;  2PU9 B;  4C8Q A;  4RMO A;  2XDP A;  2V1R A;  2DTI A;  3CD6 A;  2X51 A;  3M58 A;  2V8K A;  1M3B A;  4J5Y A;  3M57 A;  1VQL A;  2GFU A;  3EFO A;  3A1P A;  1LJO A;  3HRT A;  4YTL A;  1BIB A;  3DB4 A;  2DVJ A;  4JJC A;  1KQ2 A;  2ZAE A;  1RI0 A;  3URG A;  2KBT A;  1D1A A;  1I81 A;  5FW9 A;  4A63 B;  3Q1J A;  1JJ2 P;  1PM3 A;  4C5G A;  4F7U G;  3CXC S;  1XNI A;  2EJG A;  3H41 A;  3TEE A;  3MEW A;  4C92 F;  3PIP A;  2JVV A;  4PJL A;  2RHX A;  1RAD B;  3OYC A;  4EMG A;  1T3L A;  3L2Z A;  3CME A;  2LNV A;  3CCV Q;  4EIK A;  4LN2 A;  3RNJ A;  3QYH B;  1G3W A;  3X28 B;  2CDT A;  5CKE A;  2DXC A;  1KC8 U;  1MMD A;  2HQE A;  1C1A A;  4L5G A;  2DZC A;  5HY6 A;  3OYN A;  3CPW A;  2AIR B;  1YI2 A;  4BY6 B;  3JAM E;  2DEQ A;  1IRE B;  2C06 A;  3CBO A;  1M1K U;  3AHU A;  4JRP A;  3CCL Q;  1VQP A;  3CCV T;  1KQS S;  4J7F A;  3X25 B;  5CR2 A;  1WHM A;  2KI7 A;  1IHV A;  1ZSG A;  5LJ5 j;  2ZZD A;  3WVD B;  3L2Q A;  5FRO A;  2K2V A;  2KYM A;  4F7U F;  2YHT A;  1W2B P;  3EHQ A;  2AZV A;  3CCJ Q;  2Y90 A;  5A0L A;  3NPF A;  3J7A F;  2EBP A;  3CD6 Q;  3H0H A;  4M77 B;  4DBQ A;  3SDZ A;  2KT1 A;  3CCL T;  1JBM A;  4XTV A;  1VQL Q;  4C8Q C;  3FC3 A;  1M2V B;  2XK0 A;  1QP2 A;  2GF7 A;  2QAZ A;  3FJ5 A;  1OYX A;  1MMN A;  2HQH A;  1TG0 A;  5LJ5 f;  3EG9 A;  2DJQ A;  4X9D A;  4A53 A;  3A8H B;  3OYL A;  1WHG A;  1PD0 A;  2DXU A;  5LJ5 h;  3CCJ T;  3FB9 A;  2YXY A;  3CD6 T;  4PJO C;  4XAX B;  2OJ2 A;  3FDR A;  1VQL T;  3PMI A;  3PVL A;  2F69 A;  4EMK A;  2CZ1 B;  2KQW A;  3CPF A;  1WJQ A;  2EYX A;  3HFO A;  5HKC A;  2EKO A;  5FRN A;  3CME Q;  3TCJ A;  3INZ A;  1RLP C;  3HKS A;  5M9O A;  3GLX A;  3M53 A;  2DYI A;  4M75 G;  3EG3 A;  4D8K A;  3EHR A;  4J9B A;  3G6E A;  2GGR A;  3M56 A;  4OB0 B;  1M8M A;  1M1F A;  3LWH A;  5GJV B;  4BI4 A;  1YI2 Q;  3CBM A;  1VQN A;  1EFN A;  2W0Z A;  3CC7 A;  2IVW A;  3CME T;  3CQT A;  3GNF B;  3VRY A;  1D1B A;  4N4H A;  1VQP Q;  2H3J A;  3CXC P;  2O31 A;  2XDB A;  5C6S A;  2K4Y A;  1UGP B;  3MEA A;  1NM7 A;  1IHW A;  1D09 B;  1UHF A;  4M7D F;  2RI2 A;  3EGD A;  4JDS A;  2M0Y A;  1NLP C;  1WIE A;  2E6Z A;  3OSS C;  1YI2 T;  1CSK A;  2CZ0 B;  3EGX B;  4OMM A;  2FL7 A;  2FYK A;  2E3I A;  4Z89 A;  3KFV A;  1GCQ A;  4A4F A;  5GMK l; 
#chains in the Genus database with same CATH homology
 5CIU A;  3M9Q A;  2ZPF B;  3FJP A;  5GAN h;  3ZBD A;  1VQP T;  4LD9 K;  3RUX A;  4IUV A;  2JZ2 A;  4UC4 A;  2BIV A;  3CEY A;  1K9M C;  2E5Q A;  4PJO B;  1QVF A;  3EFS A;  4C0G A;  1YIJ A;  2Y4Y A;  4BI3 A;  4M75 B;  1KG1 A;  3OMG A;  2D0Q B;  4EPC A;  1BI0 A;  2P0K A;  1M9S A;  4PJO E;  1G3S A;  5GAO p;  2YLB A;  3RES A;  4ME7 A;  2DVE A;  1NE8 A;  1KC8 C;  4M75 E;  4QQD A;  4GLK A;  1Q86 U;  3RIR A;  3LYI A;  4E7L A;  1VQO T;  4DQ2 A;  4BDZ A;  3V7R A;  1M4Z A;  4II1 A;  3CC2 A;  1LNX A;  3SWN B;  4B9W A;  3OS2 A;  1Y7X A;  2P4T A;  2B8A A;  2EAY A;  1R8O B;  2CS7 A;  2X4J A;  4IUP A;  4R56 A;  3TU4 K;  1YJN A;  4KUL A;  1Y07 A;  1B34 A;  4NL2 A;  2PUK B;  1M1K C;  2R5A A;  4J6Y A;  4ELZ C;  2R58 A;  2CZ7 B;  1EIF A;  3QUI A;  4M78 C;  2CYZ B;  2RA2 A;  2RJD A;  4C92 C;  1PSE A;  2M0O A;  1GXI E;  4M77 F;  5CKB A;  3CMA T;  3X20 B;  3G4S A;  4M7D D;  5LL6 S;  3QJ6 A;  2KAF A;  3LGL A;  4C8Q D;  3OYG A;  3CCS A;  2RH2 A;  2X4Y A;  4M77 E;  2DTO A;  4OF1 A;  5GAO q;  3QG1 A;  3OYK A;  2JNG A;  2ZPG B;  5CO7 A;  4A4G A;  4ZTJ A;  4EMK C;  2HAX A;  2KSS A;  4A4K A;  5GAO m;  5GAM j;  2QTX A;  5J3B A;  5EG2 A;  1VQ5 A;  1QVG A;  1Q82 C;  4LDW A;  1KHI A;  1Y96 A;  5KE2 A;  1BI3 A;  3NFC A;  4JLG A;  4OGC A;  4C92 G;  4IKF A;  4M78 G;  4VUB A;  3CCE A;  4FM4 B;  5LJ3 d;  1O75 A;  2QXF A;  2RK1 A;  1N9R A;  3FEO A;  3OS5 A;  4KUI A;  2RHU A;  5I2M A;  3PTA A;  4L59 A;  2DD4 A;  3I55 A;  3QZ9 B;  2EQU A;  4BB7 A;  3CBP A;  4M78 A;  4BUG A;  1VQ8 A;  4PJO C;  2F5T X;  3CCL A;  1BYM A;  4FIB A;  2LTO A;  3FRN A;  2RJE A;  3QDR B;  2LRQ A;  4QQ6 A;  4JRI A;  3OYB A;  1SSF A;  2RJC A;  5GAM e;  2XKO C;  1VQ4 A;  4N4I A;  3CXC A;  3LW5 E;  4PLL A;  4RCC A;  1PSF A;  4QW2 A;  3L1A A;  3QSU A;  2QDY B;  5AYF A;  2QQB A;  3DLL A;  3CCM T;  4M7A C;  2PQW A;  2JOY A;  2K57 A;  4MZP A;  3T9N A;  2O4X A;  5IN1 A;  3OYM A;  2EQJ A;  1NPP A;  1YHQ A;  1X75 C;  1VQ6 A;  2I2L A;  3P8D A;  1K8A U;  3CCJ A;  2MF2 A;  5FU7 C;  5FU6 C;  5HK0 A;  4JS4 A;  3HHT B;  4OGE A;  3G6E T;  1KD1 C;  3WVE B;  5GAM h;  2XG8 D;  1B34 B;  3MO8 A;  5DLQ E;  2L8D A;  4M77 D;  1JJ2 S;  3MP6 A;  3SB2 A;  3KBG A;  3MP1 A;  4Q5W A;  4M7A G;  3HP9 A;  4LD6 A;  1UGS B;  3VYG A;  5CVI A;  3UPU A;  2ZPE B;  1VQN T;  5GAN j;  2VXE A;  1OI1 A;  2CKK A;  3M54 A;  5GAN 6;  3JB9 G;  4ZTF A;  3CC7 T;  2E64 A;  1Q7Y C;  1WPY A;  1NPR A;  1NZ9 A;  4BE0 A;  3CC4 A;  2PVD B;  4XTW A;  2ZPH B;  2WAC A;  4N0A C;  5LJ5 d;  1H3Z A;  2OAU A;  2AHJ B;  4CI0 C;  3C4S A;  5GAN 7;  3S3M A;  4V2S A;  3KXT A;  2VYT A;  3JCM b;  2A7Y A;  3E9G A;  4QQG A;  1G5V A;  1K73 C;  4J6X A;  4C92 B;  2DIG A;  5DM7 R;  4M78 B;  2QEX T;  1FX7 A;  5CKH A;  4JS5 A;  5GAM g;  5KE3 A;  2DXB A;  2RO0 A;  1AHJ B;  2Y4X A;  3F70 A;  4F7U A;  1YJW A;  4C92 E;  2DAQ A;  4M78 E;  3OYE A;  4IUR A;  2R57 A;  2EJ9 A;  4X9C A;  5CAI A;  2VUB A;  3LGF A;  4LDU A;  1YIT A;  2OTJ T;  3M5A A;  3MCA B;  5A0G A;  2M1H A;  5GAN f;  3OYD A;  2LT1 A;  2ZPI B;  3TRE A;  2K5F A;  4KUD K;  4BD3 A;  2RHI A;  2E1H A;  1VIF A;  3RMQ A;  4E7I A;  3C12 A;  2LVM A;  4OP0 A;  3G71 A;  1WJS A;  3VJP A;  3PGG A;  3CCQ A;  2E10 A;  4FT2 A;  2V8J A;  4C0Z A;  4OVA A;  1YIJ T;  1VQK A;  4LDX A;  2LCC A;  1N27 A;  2D6F A;  5LJ3 e;  3GIB A;  4IUT A;  5GAO n;  3V8K A;  1VQ9 A;  3SD4 A;  4PJO F;  2LDM A;  2KK4 A;  4M75 F;  2DZ9 A;  2JUF A;  3OYA A;  2F5K A;  3ZEH A;  2D9T A;  2HQX A;  2WSF E;  4A54 A;  5GAN 3;  1KQ1 A;  3MET A;  3KUF A;  2JTM A;  4IUU A;  4O5V A;  4HCB A;  4MZT A;  5CQX A;  4M7A B;  4E47 A;  2WSC E;  1YJN T;  3PIO A;  4EDU A;  2K3X A;  1BIA A;  1WNL A;  1YJ9 A;  5FU7 B;  2K3Y A;  5FU6 B;  2DXT A;  3ME9 A;  1I5L A;  3QYG B;  1I4K 1;  4M7A E;  4NOY A;  3S6W A;  3M59 A;  3CCV A;  4ZN1 A;  3LLR A;  3G4S T;  4J83 A;  3OW2 A;  2XD0 A;  3P8H A;  4C92 D;  3CCS T;  5GAN 4;  3CPW S;  2E41 A;  4MDW A;  3BDL A;  1NJI U;  3SFM A;  3EFR A;  1HXD A;  2DK3 A;  3OYY A;  5CKF A;  3E9F A;  1W4S A;  4FU6 A;  3BFM A;  2DO3 A;  4E7J A;  1N6A A;  1VQ5 T;  4CRI A;  3JCM X;  1M8V A;  1UEB A;  4XU0 A;  1VQO A;  2RM4 A;  4RG8 A;  4MMK A;  3CCE T;  4C0F A;  1Q86 C;  3ZFJ A;  4BDY A;  4MDX A;  1JRI A;  1QVF S;  2MWO A;  5CQY A;  5C0M A;  1TH7 A;  1ZHI A;  2FB7 A;  2VGN A;  3JCM Q;  4JRK A;  2MI6 A;  2WSE E;  3WXM B;  4E7K A;  2DJZ A;  1N8R U;  2QQ9 A;  1BKB A;  2PVO B;  4PL6 A;  3JCM V;  5LJ3 g;  2XID A;  3BDU A;  2LQK A;  2MAM A;  3RKY A;  5GMK m;  3UT1 A;  1WQW A;  3M4Y A;  4BE2 A;  4M7D C;  4XK8 E;  3X24 B;  5LJ5 e;  4R55 A;  5GAN 5;  4C0D C;  1ZBX A;  3HL8 A;  1S72 A;  4PJO D;  4HCZ A;  1VQ4 T;  3VU3 C;  3PMT A;  4PLI A;  1BI1 A;  4M75 D;  3CCR A;  1YCY A;  4C5E A;  1UGR B;  3NTH A;  4JLI A;  3OB9 A;  3QHS A;  3CCU A;  1BI2 A;  4A4F A;  4XTX A;  3LH0 A;  3UDC A;  3HRU A;  1U1S A;  4BY6 C;  4HCC A;  3V8L A;  1M1G A;  4O6J A;  2EQM A;  3V8J A;  4M7D G;  3L2V A;  3QBY A;  4P5N A;  5GAM f;  1YHQ T;  3RER A;  1M90 U;  2QQS A;  4M7A D;  1FXX A;  4FT4 A;  2O01 E;  1DJ7 B;  2K5I A;  3OS0 A;  1YBY A;  2K5L A;  1VQM A;  1V29 B;  3ASK A;  4M7D A;  1D3B A;  1VUB A;  2EIF A;  2PU9 B;  4OB3 B;  4C8Q A;  4RMO A;  2XDP A;  1MGQ A;  2MMP A;  2DTI A;  3CD6 A;  4N4G A;  1FWZ A;  3QXE B;  3M58 A;  2G3R A;  5CCA A;  2RK2 A;  3GPL A;  2V8K A;  2VGM A;  2X4W A;  4J5Y A;  1I8F A;  3M57 A;  1VQL A;  2GFU A;  3JRZ A;  3HSB A;  4BI8 B;  4XU2 A;  4Y28 E;  3MEV A;  5DLO A;  2DIQ A;  4QVD A;  3JCM d;  1LJO A;  3HRT A;  1Q81 U;  3N5B B;  4XTU A;  4JRQ A;  3E1S A;  4TVR A;  4YTL A;  4J8O A;  1BIB A;  3DB4 A;  3CC4 T;  1KQ2 A;  2QA4 A;  2XDD A;  4EMH A;  1RI0 A;  3URG A;  4J7I A;  5D6W A;  1Y96 B;  1I81 A;  2QI2 A;  1X01 A;  4NS5 A;  1OZ2 A;  4HT8 A;  3Q1J A;  2BKD N;  4RKU E;  3NTK A;  3J80 E;  5LJ5 g;  2E6N A;  4C5G A;  2KVQ G;  2ZPB B;  4F7U G;  1K8A C;  3CXC S;  2E70 A;  1XNI A;  2EJG A;  4XTZ A;  3TEE A;  3MEW A;  1HK9 A;  3DLM A;  4D6W A;  1YJW T;  5GAO r;  5IAY A;  4C92 F;  5FLX E;  3L2W A;  4DA4 A;  4M78 F;  1U8R A;  3VYH B;  5LJ3 j;  2JN0 A;  3PIP A;  1YIT T;  4IUQ A;  5CKD A;  2JVV A;  4LDY A;  3JB9 H;  2RHX A;  3GOX A;  2JTF A;  3OYC A;  2KMT A;  3OYF A;  2HD0 A;  3MEU A;  4EMG A;  3SWN A;  3VUZ A;  3L2Z A;  3PFS A;  4FSX A;  3CME A;  5D6X A;  4B9X A;  2A3L A;  4JJN K;  2LNV A;  2RD1 A;  1K9M U;  4M77 A;  3LWI A;  2O4X B;  4E7H A;  3G71 T;  3OBW A;  4MZM A;  1X6O A;  1VQK T;  3MHX A;  2HBP A;  1D3B B;  4M7D B;  3QYH B;  4C8Q B;  4ELY C;  1G3W A;  3X28 B;  3O8V A;  2RI5 A;  5CKE A;  1VQ9 T;  2ZCF B;  4C0D B;  1VQ7 A;  5GAO l;  3FLG A;  4X34 A;  2DXC A;  1IZ6 A;  1QW1 A;  1KC8 U;  4M7D E;  1O9S A;  2EWN A;  2HQE A;  3QO3 A;  4L5G A;  4BE1 A;  2DZC A;  5HY6 A;  3OYN A;  2OTJ A;  3CPW A;  4BAC A;  3OYJ A;  2OTL A;  2DTH A;  5LJ3 f;  3I56 A;  1U1T A;  1YI2 A;  4BY6 B;  2OTL T;  3JCM J;  5I2S A;  3PNW C;  3JAM E;  3CC2 T;  2DEQ A;  1IRE B;  2M9U A;  2RI3 A;  4MML A;  4OB2 B;  2C06 A;  1YJ9 T;  1N9S A;  3CBO A;  1M1K U;  4JRP A;  3AHU A;  3P8B B;  5LJ3 h;  4M7A F;  2L5Q A;  3EAE A;  3VUB A;  2CGH A;  2EJF A;  1VQP A;  1W2B S;  3CCV T;  4C5I A;  1KQS S;  4J7F A;  3JB9 F;  2LCL A;  3X25 B;  2RB6 A;  3L42 A;  4FL6 A;  5FRM A;  4A4H A;  2KDS A;  3A8G B;  3OSV A;  3QZ5 B;  1QP3 A;  3M4G A;  5CR2 A;  4M78 D;  3JB9 J;  4J6W A;  5GMK j;  3NTI A;  5LJ5 j;  2ZZD A;  1RL2 A;  1Q82 U;  3WVD B;  1WGS A;  4F7U B;  3L2Q A;  2KY9 A;  2QQA A;  5FRO A;  2K2V A;  2L89 A;  3QJY A;  3J81 E;  4F7U F;  3OS1 A;  2YHT A;  5GAN 8;  4DOV A;  4XU1 A;  4F7U E;  3OYI A;  4QVC A;  4NL3 A;  2M16 A;  2Y90 A;  4Y91 A;  3V7S A;  5A0L A;  3JCM e;  5GAN d;  3OQ5 A;  3BW1 A;  4HKE A;  3I55 T;  3J7A F;  4M77 B;  2P0P A;  3PT9 A;  1JB0 E;  3UWN A;  3SDZ A;  3OMC A;  5GAN g;  1KHC A;  1OZ3 A;  5A2Q E;  3CCL T;  1JBM A;  4XTV A;  2MWP A;  2R5M A;  2P0Q A;  4C8Q C;  1UB4 A;  4OB1 B;  3JCM f;  5GMK e;  3FC3 A;  1YI2 T;  1S72 T;  2RHZ A;  5GAN 2;  2XK0 A;  3GF5 A;  3FIF A;  1QP2 A;  2GF7 A;  3CCR T;  2VV5 A;  5J26 A;  3QII A;  3LX7 A;  3E19 A;  3CCU T;  4Z02 A;  1NJI C;  1OYX A;  1JJ2 A;  3JCM h;  4ZGE B;  4A4E A;  5LJ5 f;  1H64 1;  3R6O A;  1WQ7 A;  3VV0 A;  2YLC A;  4X9D A;  4A53 A;  2PVG B;  3A8H B;  4C8Q G;  3OYL A;  1KD1 U;  1VQ6 T;  5GMK h;  1VQM T;  2DXU A;  5LJ5 h;  3QPH A;  3CCJ T;  2PUO B;  3GNG A;  4C92 A;  3DKM A;  3CCM A;  3OW2 S;  3FB9 A;  2LX9 A;  3CMA A;  3JB9 D;  3GP8 A;  3CD6 T;  2X35 A;  4KBM B;  4XAX B;  2X4X A;  4HA8 A;  4QVZ A;  3HRS A;  5J39 A;  5GMK i;  1N8R C;  2NLU A;  3V7C A;  3A8M B;  2XHC A;  3FDR A;  4M75 C;  3PMI A;  3A5Z B;  3RMS A;  1XQH A;  4DOW A;  1LOJ A;  1VQL T;  2F69 A;  4EMK A;  2CZ1 B;  2KQW A;  1QVG S;  2QQR A;  1Q7Y U;  3CPF A;  1WJQ A;  3HFO A;  5HKC A;  1MHN A;  2EKO A;  5FRN A;  3OYH A;  4JUV A;  2QA4 T;  2BUD A;  3TCJ A;  5CK9 A;  1XTD A;  4LDV A;  5KH6 A;  3JCM g;  4PJO G;  4ATO A;  3INZ A;  2GQV A;  1M5Q 1;  3VKI A;  3HKS A;  1WJR A;  3GLX A;  3SWN C;  5DY9 A;  2CZ6 B;  3M53 A;  4M75 G;  4ZGJ B;  5M9O A;  1K73 U;  2LT4 A;  3C94 A;  3H8Z A;  1M90 C;  3ER0 A;  4PJO A;  4M77 C;  1Y71 A;  3G6E A;  4WF2 A;  3M56 A;  4M75 A;  2DD5 A;  4OB0 B;  2XI9 A;  1M1F A;  2HNI A;  1VIE A;  3OBY A;  2DKG A;  3OY9 A;  4PKC C;  3H6Z A;  2VXF A;  2IG0 A;  3LWH A;  3MP8 A;  4BI4 A;  2EQK A;  2E65 A;  3CBM A;  2LQ8 A;  1G3T A;  4KT0 E;  5HK3 A;  2RJF A;  1VQN A;  3HFN A;  2L3R A;  4M7A A;  2LC4 A;  2RHY A;  3CC7 A;  3S3N A;  1Q81 C;  2IVW A;  4M77 G;  3CME T;  1ZQ1 A;  3X26 B;  5KCH A;  3GNF B;  4ZN3 A;  5KCO A;  4RG2 A;  4N4H A;  4OMF B;  1P92 A;  2GFA A;  2H3J A;  3RKW A;  2VC8 A;  3JCM c;  5L8R E;  2EYQ A;  4XQ3 A;  5GAM d;  2XDB A;  1G3Y A;  5C6S A;  2K4Y A;  3CCQ T;  1UGQ B;  2XU8 A;  1UGP B;  2YRV A;  3MEA A;  1VQ7 T;  3A8O B;  5A0D A;  3L2R A;  2QEX A;  4C5H A;  1VQ8 T;  2XIC A;  1W2B A;  5GAN e;  1KQS A;  4M7D F;  3C95 A;  2FVU A;  4RCB A;  3BY7 A;  4C8Q F;  5IT9 E;  3QKJ A;  2RI2 A;  2V8I A;  1QVP A;  4EMK B;  5I21 A;  3L2U A;  3A8L B;  4JDS A;  4C8Q E;  3M55 A;  3RKX A;  4ZGD B;  3OSS C;  2ZGW A;  2E6Z A;  3G7Z A;  4XTY A;  4L6V 5;  4PNO A;  2GCX A;  5D6Y A;  2DPP B;  3I56 T;  4HT9 A;  3JCM P;  2CZ0 B;  2E12 A;  2EFI A;  3JSC A;  4N0A A;  3HPW A;  2FL7 A;  2FYK A;  4XU3 A;  3OA6 A;  3JB9 I;  4GY5 A;  3JCM W;  1XOV A;  3S3O A;  3DB3 A;  2FHD A;  5GMK l; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...