2J05A

Crystal structure of the rasgap sh3 domain at 1.5 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
SHMRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High Resolution Crystal Structures of the P120 Rasgap SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
molecule keywords RAS GTPASE-ACTIVATING PROTEIN 1
total genus 18
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j05A00
2CT4A 2K7AA 1X2KA 3TSWA 2M0YA 4J9CA 1Y0MA 2RQRA 1G83A 4HVVA 2DJQA 3EG3A 2OJ2A 4A63B 3ZL7C 2F2XA 2VKNA 2GBQA 1HJDA 1MV3A 2CSQA 2CREA 4HVWA 2EBPA 2KE9A 3H41A 2DL4A 2DYBA 2KYMA 4RTUA 1YP5A 2PNIA 1Z9QA 2DVJA 2A36A 1QCFA 2DL7A 3REBB 2FPDA 2P4RA 3VS4A 4LUEA 1X27A 2KXCA 1CSKA 3I5RA 2EVRA 2ECZA 1FMKA 1UUEA 4CC4B 3EG0A 3SHWA 1PRLC 1JQQA 5IHNA 1A0NB 1K9AA 1H8KA 2EYWA 4OMQA 2CSIA 4LUDA 3VS3A 2C0TA 2O88A 4JPBW 1UE9A 1I07A 2EPDA 2VVKA 2IIMA 1GRIA 1OOTA 3A98A 1UGVA 2DL5A 5ECAA 1GCQC 2CUBA 1RUWA 1WIEA 2EGAA 4OMMA 1BK2A 1K4US 1M30A 2YT6A 2MOXA 1AVZC 1X6GA 1TUDA 5IHKA 2FPFA 1NM7A 1UJ0A 4X1VA 2AKKA 2MCNA 1JEGA 1BB9A 2CH4A 2NUZA 2ABLA 2HDAA 2J06A 2JS2A 1GL5A 1AWXA 3EHRA 2L2PA 2DRKA 2CDTA 2SEMA 1JXOA 2KNBB 2J7IA 1JXMA 4JJCA 1PKSA 1TG0A 2JM8A 1UFFA 2J6KA 2KGTA 1ZSGA 2W0ZA 4J9BA 1BU1A 3TSZA 4GLMA 3M0RA 3VRZA 1N5ZA 1TUCA 1YWPA 1UG1A 2GTJA 2DX1A 1QKXA 2O9SA 4FSSA 2LJ0A 1AZGB 4ESRA 2D0NA 1OV3A 3EGUA 4LN2A 1I0CA 3FJ5A 2A37A 2FPEA 2JS0A 1E6HA 5HCKA 3M0TA 1ZUYA 2FO0A 4Z8AA 1BBZA 1ZUUA 2CUDA 4ZNXA 3RBBB 1PKTA 1YWOA 2BZXA 1ARKA 1UHCA 2JW4A 2A28A 2CH4W 4Z89A 2QDLA 4CC7A 1NG2A 2L3SA 2YUQA 3M0QA 2YUNA 2YUOA 1SSHA 4J9IA 2DBKA 4J9GA 4RTXA 1SRMA 4CC2A 4F17A 1AOJA 1V1CA 1QKWA 2D8HA 1ZLMA 4OMOA 1H3HA 2KRMA 1X43A 2BZ8A 2DMOA 1AEYA 1UTIA 4JJDA 4AFSC 4E6RA 3THKA 1UECA 2DBMA 2GGRA 3PE0A 1M8MA 2LJ3A 1FYNA 1T3SA 1UDLA 2EYYA 3QWYA 2X3WD 1J3TA 3UA6A 1M3BA 2OI3A 1X69A 4AFZC 2JM9A 2ESWA 4JZ4A 1ZX6A 2EGCA 4HCKA 1M3CA 2ROLA 1PRMC 1NEBA 1WA7A 3KFVA 2RQVA 4JZ3A 3VS5A 1GBRA 4Y92A 1EFNA 3PVQA 2YDLA 1K76A 2O9VA 4D8KA 4J9DA 2FG0A 5EC7A 3U23A 1JU5C 2PZ1A 1U06A 1CKBA 1X2QA 5GJWB 2ENMA 1W1FA 3R6NA 2DL8A 3VS0A 2HCKA 1OEBA 2BTTA 4LNPA 2DL3A 2LQWA 4OMLA 2LCSA 4F16A 4CC3A 1T3LA 1GCPA 2I0NA 1QWEA 2RN8A 1NEGA 1RI9A 3O5ZA 4ORZA 4AG2C 1I1JA 2EW3A 1GBQA 2LJ1A 2NWMA 4GBQA 1E7OA 3NHNA 3EG1A 1M3AA 4RTZA 1GCQA 2FRWA 2JMAA 3RNJA 4D8DA 1NYGA 2DE0X 2MIOA 2PTKA 4R0KA 2DRMA 1WFWA 2W10A 1AWJA 2AKLA 3JV3A 1OPLA 1H92A 3VS2A 2KXDA 3M0SA 5GJVB 2RQTA 2JMCA 2KYBA 5FWCA 2LP5A 1W70A 4Z88A 1KSWA 2F2WA 4RTWA 2G6FX 2FRYA 2L0AA 1K0XA 1PHTA 1ABQA 1CKAA 1HD3A 4RTYA 1PWTA 4OMNA 1XOVA 2LX7A 3VRYA 2DA9A 2J6OA 3I35A 5I11A 5FW9A 2RPNA 2EKHA 2YSQA 2ROTA 2AK5A 3EHQA 2L3PA 1YCSB 4RTVA 2A08A 3QWXX 2JT4A 4EIKA 3NMZC 2K79A 1YNZA 1U3OA 2KEAA 2KRNA 4OMPA 1LCKA 2X3XD 3M0PA 1HSQA 2EQIA 1KFZA 1WLPB 2CT3A 2V1RA 1AD5A 3I9QA 3VS6A 1YN8A 2J6FA 2KR3A 4AFUC 2O31A 1GFDA 1SRLA 2KROA 1AWWA 2DLPA 5FWBA 3GBQA 4HXJA 5I22A 1NLOC 2C0IA 2KRSA 3EG2A 1UJYA 3CQTA 1VYUA 1SHGA 2E5KA 2GTOA 3UF4A 1JO8A 1T0HA 2RQWA 1WXTA 1QLYA 1ZUKA 3NGPA 1X6BA 4KRTA 4RUGA 1WYXA 2C0OA 1MV0B 3TVTA 1B3QA 1WXUA 1WXBA 4LE9A 2L3QA 4AFQC 3M0UA 4J9FA 4RTTA 3VS7A 4DEYA 3UATA 2V1QA 2XMFA 1W6XA 1E6GA 2DM1A 2K2MA 3PVLA 5L23A 3IQLA 4J9HA 2H8HA 1VYTA 3H0HA 2ED0A 1MUZA 2ED1A 1ZBJA 2D8JA 2OAWA 2K3BA 1K0SA 4DEXA 3I5SA 3SEMA 2AZSA 5IXBA 2YUPA 2FEIA 2K6DA 1GFCA 2SRCA 3H0FA 2RQUA 1NYFA 1UHFA 2M51A 4HVUA 1T0JA 2RNAA 3ULRB 3NPFA 1WI7A 2EGEA 4F14A 2DNUA 1VYVA 1RLPC 4IIOA 2K9GA 1KIKA 2DF6A 1S1NA 1Z9ZA 1SEMA 1PNJA 2AZVA 3H0IA 1IO6A 1RLQC 2EYXA 2LNHB 1OPKA 2J05A 1U5SA 2KT8A 3VS1A 2O2OA 2RMOA 4M4ZA 2LQNA 1VA7A 2D1XA 4WCIA 3LH5A 1G2BA 2DILA 2BZYA 1AWOA 2LMJA 2HSPA 4JJBA 1K1ZA 1Y57A 4QT7A 1AZEA 1WDXA 4K11A 3UA7A 2JTEA 5IHIA 2F2VA 2EYZA 3REAB 1B07A 2RF0A 2VWFA 4J9EA 1SPKA 5IXFA 2B86A 1KJWA 1NLPC 4IIMA 1ABOA 2GNCA 3C0CA 5IH2A 1M27C 1WX6A 2JXBA 2KBTA 1QWFA 1SHFA 2KT1A 4AG1C 2HBWA 2LZ6B 2HEQA 2GQIA
chains in the Genus database with same CATH superfamily
4OB0B 3CC2Q 4IUTA 5HK3A 2M0YA 2YLBA 1MGQA 1G83A 4PKCC 2PVGB 1N8RC 1VQPQ 1YCYA 5CKBA 2RJEA 3MO8A 3OBWA 2GBQA 1K8AC 2QQRA 2HQXA 1YIJT 2CREA 4A4EA 2KQWA 3MPUB 2QEXQ 3L2UA 2EBPA 4JRQA 3H41A 3OYHA 4C0FA 1YP5A 1W4SA 1OZ2A 3RDVA 3L2ZA 1QCFA 3REBB 2FPDA 2DK3A 2P4RA 3HFOA 1PSFA 1C0MA 5I2MA 3PTAA 1X27A 2KXCA 3JCMJ 2AHJB 1Q82C 1VQ5T 2MYSA 2ECZA 3JB9J 1YHQA 1UUEA 4C8QD 1S72A 4JJNK 1ZBXA 3A8LB 2ZCFB 4DOVA 5IHNA 2P0QA 1VQ9Q 2MK5A 1K9AA 1H8KA 2DETA 4LUDA 1YJ9A 2C0TA 2ZPFB 2FZCB 1GRIA 2AIRB 2HD0A 1M90C 5GMKj 2CUBA 2EGAA 4E7LA 4C92E 1K4US 1M30A 4M7DC 4NOYA 2COZA 4OGEA 4LXCA 1D1CA 1BKBA 3NTHA 4Y28E 3FDRA 5IHKA 1C1AA 1YI2T 4C92G 3MP6A 1PCXA 4F7UB 5M9OA 4NS5A 4OB1B 2AKKA 5IAYA 2CH4A 2NUZA 2ABLA 5GAN6 4OVAA 5LJ3d 3OYBA 2F69A 3CBMA 3H6ZA 2Z0WA 3HHTB 2Y90A 1WQWA 2JOYA 2QXFA 2SEMA 1JXOA 4JJCA 1IB8A 5IT9E 3MEAA 1PKSA 2IPOB 2ZZDA 2QI2A 4JRIA 2JN0A 1G3SA 4GLMA 4M77A 1NE8A 1YWPA 4FYXB 2D0NA 3EGUA 4BD3A 4RCBA 2A37A 1E6HA 2X4XA 3QKJA 5HCKA 5LJ5j 3SDZA 3CPFA 1ZUUA 4BACA 4ZNXA 3L2WA 3ZEHA 1NZ9A 1PKTA 2C06A 2VC8A 4EPCA 2L3RA 2JW4A 3OSSC 5CKEA 3ER0A 3CXCS 2LT1A 2QDLA 2YUQA 5KYWA 4JDSA 4BE0A 1VQ4Q 5LJ5g 2YUOA 1QMCA 3QZ5B 2GQVA 2M02A 5FRMA 4NL3A 2D8HA 3I55A 4M77C 2E5QA 3CBOA 3OMGA 1VQ5A 2KRMA 1VQ9T 1X43A 2BZ8A 2KMTA 1UTIA 2E12A 4JJDA 3JRZA 4E6RA 2CKKA 1I8FA 3VV0A 1WHMA 2NLUA 4F7UG 5KYUA 4ZN1A 3QWYA 2CS7A 3UT1A 2KK4A 1KD1C 1G5VA 4M7AF 2JZ2A 1J3TA 3MEUA 3UA6A 5LJ3j 2K4YA 3ME9A 4AFZC 1QVFA 2HL3A 1ZX6A 2EGCA 2X4JA 2DERA 3PMIA 1KHCA 1G3YA 4FYWB 4RCCA 1NEBA 1PSEA 1FWZA 2K2VA 2RD1A 4PL6A 3VS5A 5A0GA 1BYMA 4Y92A 1TUGB 4BI3A 2YDLA 4C92F 5CK9A 1UGSB 4M75F 3CC4Q 3GIBA 1JJ2P 3U23A 4M77B 3LLRA 1X2QA 3R6NA 2DL8A 2COYA 2E6ZA 2QEXA 4DQ2A 1VQ7A 2RN8A 3RIRA 1NEGA 2MF2A 1RI9A 5L8RE 3O5ZA 1VOMA 4ORZA 2HKQB 4L5GA 1VQ6Q 1GBQA 2NWMA 3EFRA 2I2LA 3NHNA 5D6WA 3EG1A 5GANg 1M3AA 5CQXA 3OYYA 5FLXE 2JJ9A 1VQOQ 1VQ8T 1NYGA 4E7IA 3E19A 3CMEQ 2W10A 4LDYA 2VXEA 1H92A 3VS2A 2LCLA 4JLIA 3EGXB 4RG2A 3EFOB 3CD6A 3H8ZA 1KQSP 2F2WA 4DBQA 3G71T 3X28B 2LVMA 2G6FX 3CCJQ 1OZ3A 1YBYA 3RUXA 3EH2A 4C8QG 4KUIA 3MEVA 1PD1A 3CC2T 3OS0A 3M59A 1KQSS 4M75A 3MCAB 4FSXA 1WQ7A 4XTYA 2YSQA 2ROTA 3GPLA 2L3PA 1QCOA 1G8XA 3EH1A 1OULA 2DTOA 2VGNA 3OW2S 2RH2A 4DBRA 4E7JA 1WNLA 2JT4A 2K79A 1YIJQ 1WJSA 5GAOq 4II1A 3CCJT 2DYIA 5FRNA 3RKYA 3X26B 1I81A 3M0PA 1HSQA 1KFZA 1OU9A 3WXMB 2K3YA 2V1RA 4QW2A 3X20B 4D6WA 1SRLA 5KYNA 5CKDA 3HSBA 1Q81C 2DVEA 1UGRB 1WXTA 1ZUKA 4XU0A 1X6BA 3QDRB 2OTJA 1IGUA 1ZHIA 3TVTA 1I4K1 4KUDK 1B3QA 1WXUA 1WXBA 3LW5E 2D9TA 1VQPA 4M77E 3M0UA 1WGSA 4J9FA 2V8KA 4C5EA 3JCMb 2VASA 2XMFA 5J39A 1V76A 2DM1A 5L23A 3PVLA 3CMET 2FHDA 3M55A 3PGGA 1YJNA 2E64A 2E1HA 3GNFB 2MMPA 2QA4A 3G4SQ 3SEMA 2O01E 4IUUA 4HCCA 2YLCA 2R5MA 3H0FA 1KQSA 3D7SB 4ELZC 3SWNA 3VJPA 2R57A 2V26A 3MKDA 2RJCA 3OS1A 4HVUA 1WI7A 1MMAA 1OQKA 4F14A 1LVKA 1Q7YC 1SG5A 2DF6A 4PFOA 2HQEA 4EMKC 1IO6A 1RLQC 2LNHB 1OPKA 1U5SA 2KT8A 4M7DE 2RMOA 2JVVA 2OTLT 4M4ZA 2L89A 1M1GA 4JRKA 4HCZA 2YXYA 4PJJA 1AWOA 1YJNT 1K1ZA 1AZEA 4QT7A 4C0DC 1WZOA 2QQBA 1LOJA 1DJ7B 2F2VA 2EYZA 2XU8A 2DJZA 5GAMe 4X9DA 4A54A 1YJ9Q 1RACB 1VIEA 1BIAA 3TCJA 3M9QA 4C8QE 5GAN8 3FB9A 1VQMT 1WX6A 4M75G 5KCHA 4XU1A 2FZGB 1YITQ 2NUTB 1QW1A 2P84A 4AG1C 3QZ9B 2E4HA 4ZN3A 4M75E 3WVEB 2PVOB 3CPWA 2F5KA 3M56A 1X2KA 5GAOr 4J9CA 1Y0MA 2DD4A 2DJQA 2RHXA 3EG3A 3RMQA 2OJ2A 2COWA 1O75A 1B7TA 4NL2A 4FT2A 1VQ8A 3J81E 1K9MC 5J26A 4AMCA 4TVRA 1QVPA 5GAN3 3CD6T 3QG1A 5KYYB 2KE9A 2R5AA 2DYBA 1VIFA 4R55A 2PNIA 2WSFE 2DVJA 1YITA 3LX7A 2IVWA 3BDLA 4HA8A 1VQ6A 2DL7A 3M4YA 1MNDA 3LYIA 4LUEA 4OGCA 1HK9A 4C92A 1M8VA 1CSKA 1M2VA 3G6EQ 1FMKA 2EFIA 4L6V5 3JCMe 1PRLC 1PM3A 3CPWP 2EYWA 2KVQG 2FVUA 3JSCA 1OX8A 3OYCA 4OMQA 1Y96B 4XTUA 3VS3A 5GAOl 2VVKA 2IIMA 1OOTA 4ZGEB 1UGVA 2DL5A 1RABB 1Q81R 2QQ9A 1RADB 4PLLA 1BK2A 4E7SA 4RG8A 1NPRA 1OU8A 1YJWA 1IHVA 2DKGA 1TWBA 1AVZC 1X6GA 4XTZA 4HT8A 1VQ7T 2YRVA 4X1VA 3OMCA 3A8HB 5CR2A 2MCNA 5A0DA 2WSEE 3PIOA 3CMAQ 2FB7A 3FC3A 3MP1A 4C5HA 2RA2A 2L2PA 2CDTA 3G4SA 2J7IA 4FIBA 1RAHB 4O6JA 2PQWA 2JM8A 1UFFA 2Y4YA 2J6KA 4HT9A 2KGTA 1ZSGA 2CYZB 2LCCA 3LGFA 5GAOn 3J7AF 1AZGB 2XDPA 4ESRA 2EQUA 3MP8A 4M7AC 2B8AA 2BIVA 4LN2A 4AT1B 3M54A 3M0TA 1ZUYA 4FCYA 1XNIA 4KGVB 2FO0A 2CUDA 4YTLA 3HKSA 1ARKA 3PFSA 2BKDN 4Z89A 1NG2A 1G3TA 3M0QA 2L5QA 3RR6A 1AHJB 2O4XA 2H3JA 4A4HA 4J9IA 4C8QC 2DBKA 4PNOA 1SRMA 3SWNC 3TU4K 1AOJA 4M7AD 1WHGA 3I56T 4E7ZA 1BCOA 1AEYA 2GFUA 3OYJA 5LJ3g 2DBMA 5LJ3f 1NPPA 4RMOA 3CCST 3CCEQ 2EYYA 4LD6A 3FJPA 5FU6B 2JM9A 1N8RU 1KC8C 5DLOA 4HCKA 3EAEA 3A8GB 1IXDA 2HZYA 3INZA 2PUOB 2ROLA 1KK7A 3OYAA 3BFMA 1X6OA 3PVQA 3OYEA 1RAEB 3V8JA 1K76A 3QIIA 5GANh 2FG0A 4BE1A 1JU5C 3WVDB 1U06A 3M58A 4RKUE 2QASA 2OX7A 3OA6A 2HCKA 5DLQE 2QK0A 1G3WA 2XICA 4LNPA 2LQWA 3OYDA 5D7UA 1T3LA 1QWEA 5D6YA 3CCRT 2EW3A 3QYHB 4GBQA 1D0YA 5GANf 1M1KU 3HRUA 2KAFA 1BI2A 1GCQA 3CMAT 4D8DA 3EG9B 1AWJA 2AKLA 3A8OB 1IZ6A 3LWHA 1HXDA 5I21A 3NTIA 3OS2A 4BI4A 3QJ6A 2LDMA 3M0SA 2RQTA 2EWNA 4OMFB 1R0CB 5C0MA 2QTVA 4RTWA 2DD5A 1K8AR 2FRYA 2CP6A 1B34B 5IN1A 1VQPT 1PHTA 3N5BB 4JS4A 1CKAA 3I56A 3QJYA 4M7AB 5LJ3h 4OMNA 3OS5A 3CCLQ 3I35A 1S72Q 5FW9A 1SSFA 5GAN5 2AK5A 2YRCA 4MMLA 2XG8D 1MMNA 2EIFA 4ELYC 2DXTA 3OYMA 1U1SA 1U3OA 2KRNA 2JUFA 1KHIA 1VQ4T 1YJWT 1BI1A 3VUBA 3PIPA 4FT4A 1WLPB 3VS6A 1AD5A 4M7DG 1YN8A 2YRDA 5KCOA 1GFDA 3CCVA 5I2SA 1AWWA 3ASKA 3GBQA 2K57A 4ZGDB 3V8LA 3MHXA 4J83A 3UF4A 1VYUA 2GTOA 1XJWB 4B9WA 3L2VA 4LDVA 1VQ7Q 3A5ZB 2L3QA 4AFQC 3VS7A 4J7IA 3UATA 1KG1A 2V1QA 5J3BA 3L1AA 1QVFS 2QYZA 4EDUA 4FW1A 2VXFA 4J9HA 1WJRA 4M7AA 2ED1A 2D8JA 3CCMQ 2RI3A 4LDXA 2K3BA 1K0SA 4C5GA 4DEXA 1K8AU 3BW1A 3CMEA 1NJIC 2XD0A 1NYFA 4PJOB 1FX7A 1TXQA 2VB6A 2M51A 3CCQQ 1SKUB 2EGEA 2DNUA 1VYVA 2LRQA 4M78E 3OW2P 3CC4T 3CC2A 3E2UA 3ZFJA 2X9HA 3S3NA 3CCRQ 3G1JA 5KE2A 3H0IA 4WF2A 2LX9A 2EYXA 1D0ZA 2QQAA 2ZPIB 3VS1A 3OQ5A 1PC0A 4XU2A 3JCMQ 3V7SA 5A0LA 1G2BA 4M78G 2DILA 2WACA 2KI7A 4MDXA 4JJBA 1W2BS 2ZPHB 4K11A 3S6WA 2JTEA 4DA4A 1VQ8Q 5IHIA 1RAIB 1B07A 2RF0A 2RB6A 1SPKA 4M7DD 1KJWA 1NLPC 4F7UF 2MAMA 3C0CA 4BDZA 8ATCB 3RESA 3GOXA 1SHFA 1ZQ1A 4IURA 3O8VA 2RI2A 1ZA2B 3JCMV 4KH1B 2GQIA 4C0ZA 4BDYA 1O9SA 1UGPB 1Q81U 2RQRA 3V8KA 4A63B 3ZL7C 4LD9K 4O5VA 2NUPB 3G71Q 1HJDA 3C94A 1R77A 3EGDB 1XTDA 2EQJA 2EQKA 3CMAA 2CP5A 2QA4T 3CCVQ 2CSQA 1ZSZC 1QVGS 1ZSZB 2DL4A 4RTUA 3OYIA 2HKNA 2F5TX 2E65A 1OYXA 2RJDA 3CCUQ 2RHIA 1W2BA 3M5AA 1FMWA 5CQYA 5KYXB 3I5RA 2HQHA 4A53A 2EVRA 5GAOm 3M53A 4CC4B 3SHWA 4M78A 1JQQA 1A0NB 2HNIA 5FU7B 1Q82R 3J80E 4JPBW 1UE9A 1H3ZA 3RKWA 2MPXC 1QCNA 2EJ9A 4M7AE 1HYOA 2BE7D 1RUWA 4FU6A 4BY6C 2VYTA 4KH0B 1YFNA 1RAAB 2MOXA 4IUPA 5AYFA 1QVFP 2CZ0B 2LC4A 1UJ0A 1C6VX 1BB9A 2DPPB 4BI8B 2KSSA 2V8IA 1VQ9A 4ZTFA 2OTJQ 3QPHA 5EG2A 1AWXA 4CI0C 1JXMA 1M9SA 1VQLT 4HCBA 3GF5A 1NBEB 3UPUA 1TG0A 4A4GA 2DZ9A 2LQKA 4J9BA 3QYGB 1JJ2S 3TSZA 3DKMA 3QSUA 3M0RA 1N5ZA 1TUCA 2JNGA 1QP2A 3PMTA 5GAMd 2DX1A 4PJOG 4L59A 1YJWQ 3JCMW 4PJOC 2LJ0A 1I0CA 3FJ5A 4GY5A 2BUDA 3TREA 2DEQA 2X4WA 2DIGA 3JCMd 1YWOA 1Q95G 1N27A 1UHCA 1OI1A 2A28A 2CH4W 1M1FA 5HKCA 2L3SA 2EAYA 2YUNA 3FLGA 2HSEB 3P8BB 4FW2A 4RTXA 4Z02A 3E9FA 4CC2A 4F17A 1V1CA 1ZLMA 1P92A 3VU3C 1BCMA 4QKUA 4E2FB 4F7UE 4PJOD 2CGHA 2DMOA 2P0PA 3FIFA 3VYGA 5CAIA 4AFSC 3THKA 1IRXA 4C8QA 1MMGA 1WHKA 1UECA 1M90U 4M78D 1M8MA 1D1AA 4PLIA 4FM4B 4PJOA 2LJ3A 1FYNA 1T3SA 1UDLA 1YI2A 2HBPA 4QQDA 3CCMT 3CCVT 2X3WD 3JB9I 1M3BA 2V8JA 2OI3A 3VYHB 4N4HA 1TTHB 2VGMA 1M3CA 3CCLA 4QVZA 1PRMC 1VQ4A 1WA7A 4JZ3A 3URGA 5CKHA 3G4ST 3EFOA 4HKEA 4D8KA 2CP2A 3LGLA 1CKBA 5GJWB 2FYKA 3CCSQ 1W1FA 2EQMA 1OEBA 4XQ3A 2DL3A 3SD4A 2LCSA 4F16A 5CO7A 2H3EB 2VV5A 4J8OA 4N0AC 4UC4A 4AG2C 1I1JA 2E70A 2LJ1A 4M75B 3G6ET 5GMKi 2ZPEB 4C8QF 4M75C 3PT9A 2OTJT 2XIDA 2DO3A 2FRWA 2JMAA 3V7RA 2DE0X 2PTKA 4PJMA 4R0KA 1WFWA 2QDYB 2KXDA 2FZKB 5GMKm 2FL7A 2JMCA 4QQGA 5FWCA 2LP5A 1W70A 3SWNB 1K9MU 1KSWA 3FRNA 1KD1R 2L0AA 1K0XA 4M75D 3OYNA 1VQLA 2QGFB 4JLGA 1KQ2A 1HD3A 4RTYA 1PWTA 3EGDA 1XOVA 2QQSA 2LX7A 2K3XA 3JAME 1VQ6T 2RO0A 2J6OA 4QVDA 5I11A 1IHWA 2ZPGB 5GMKe 3MEWA 4MDWA 3OYFA 3EHQA 3LH0A 2GCXA 1ZSZA 5GANj 2KY9A 4KGXB 1YCSB 2DXUA 5CIUA 4C92C 1W2BP 4RTVA 4DBFA 1JB0E 1IGQA 3QWXX 4EIKA 1KC8R 5KYUB 1YNZA 4OMPA 2QA4Q 4XK8E 1LCKA 5CCAA 3V7CA 2EQIA 2CT3A 4B9XA 2OTLA 4PJOF 1VQKQ 3NFCA 2XHCA 5LJ5h 2DLPA 5GAN7 3CD6Q 3PNWC 4HXJA 1M5Q1 5I22A 1NLOC 2C0IA 1Q7YU 3EG2A 3VUZA 3CQTA 4MZTA 2E5KA 1JO8A 1RI0A 1T0HA 2QGGA 3HFNA 3NGPA 3LWIA 1F1BB 3DLLA 1Q86C 4XAXB 1K9MR 3BY7A 4RUGA 5CKFA 2XK0A 3G6EA 3CXCP 2DEUA 2DXBA 3JCMg 3ZBDA 4DEYA 1VQNT 1KQ1A 3VKIA 1E6GA 2A0FB 2XKOC 4P5NA 2ED0A 4PJLA 2YWWA 1I5OB 5DM7R 1YJNQ 1ZBJA 5GAMg 2OAWA 5GAMf 3I5SA 2AZSA 3OYLA 3AT1B 2DZCA 2LNVA 2RHUA 2FEIA 3EGXA 2K6DA 1GFCA 3C95A 4JRPA 2RQUA 4IUVA 1U8RA 4J6XA 1RAFB 2ZPBB 4KT0E 1UHFA 1T0JA 3ULRB 2M16A 1TS9A 1QP3A 1YHQQ 2RM4A 1RLPC 2M0OA 2K9GA 4IIOA 3OW2A 5GMKl 1PG5B 1Z9ZA 4XU3A 1AT1B 1N9SA 2BE9B 2ATCB 2CP3A 1Q7YR 2OTLQ 4PFZA 2J05A 1Q86R 3HPWA 2O2OA 5FU7C 5FU6C 2M1HA 1U1TA 2LQNA 1VA7A 2D1XA 2L8DA 1MHNA 3LH5A 1VQ5Q 1WPYA 3L42A 1WHJA 1VQMQ 4VUBA 3CEYA 3QXEB 4OP0A 4XTWA 3F70A 5D6XA 1XQHA 3CCUT 3QHSA 5HK0A 3CCET 3UA7A 4JS5A 3GLXA 2E3HA 2RK2A 1YIJA 2CZ7B 1X01A 3CCQA 3CC7Q 2VWFA 3I56Q 4J9EA 5KYYA 3BE3A 4C8QB 4IIMA 2GNCA 1ACMB 1M27C 2JXBA 4M7DA 3META 4C0GA 3SFMA 1BI0A 2XDDA 2HBWA 4PK4A 2LZ6B 2HEQA 3JCMf 1TOVA 4KGZB 2JTFA 2CT4A 2K7AA 4X9CA 3TSWA 3AHUA 4M77G 4BUGA 4HVVA 1RAGB 3CC7T 2F2XA 3P8HA 2VKNA 2CP7A 3KUFA 2CZ6B 3JCMh 3TQ7P 2RHYA 2EKOA 1MV3A 4HVWA 1VQOA 3QUIA 3JB9F 2DAQA 3A8MB 1V29B 5GAN2 2GF7A 2KYMA 3L2RA 1N8RR 1R8OB 1Z9QA 2A36A 1K73R 2O4XB 3VS4A 1UEBA 3RKXA 1JBMA 1UGQB 4MZMA 1UB4A 4DOWA 3HP9A 3CC7A 3EG0A 2PUKB 2DFUA 2XI9A 2X35A 3M4GA 1LNXA 1S72T 3RERA 4FL6A 5GAOp 1WJQA 3OB9A 2MWOA 3CCLT 2CSIA 2A3LA 4A4FA 3CCEA 2O88A 1I07A 2EPDA 3S3OA 3A98A 1JRIA 2VUBA 5ECAA 3CCQT 1GCQC 3DB4A 1WIEA 4OMMA 2DTIA 5KH6A 2YT6A 3UDCA 3CCUA 1ZA1B 1KC8U 1TUDA 1N6AA 4C0DB 2FPFA 1NM7A 4BB7A 4BE2A 1JEGA 4FYVB 4KULA 3CCRA 2HDAA 1M2VB 1H641 2NUTA 2J06A 2JS2A 3TEEA 1GL5A 3OY9A 4ATOA 3JCMc 2A7YA 3EHRA 3SB2A 2DRKA 2LTOA 3L2QA 2KNBB 2MI6A 2RK1A 9ATCB 1Y96A 4C5IA 3QBYA 4EMKB 2W0ZA 1BU1A 4GLKA 4J7FA 3VRZA 4KBMB 1UG1A 2GTJA 1QKXA 4ME7A 2O9SA 4M77D 4FSSA 1OV3A 2FPEA 2JS0A 5AT1B 2LT4A 4LDWA 5GAN4 3QDFA 2DXCA 2P0KA 4Z8AA 3X25B 1BBZA 3RBBB 1QVGA 2CZ1B 4B6MA 2BZXA 3DLMA 4X34A 2E3IA 4FYYB 4CC7A 1B34A 3H9NA 5LJ5f 4M77F 1NJIU 1SSHA 1D0XA 4J9GA 4C92B 3Q1JA 1GXIE 1QKWA 2RI5A 4OMOA 1H3HA 4N4GA 1YI2Q 1K73C 5GAMj 5GANe 4N4IA 1TH7A 5C6SA 4ZTJA 2GGRA 1TU0B 3PE0A 1YITT 2D0QB 2QG9B 4E7KA 2PU9B 3E9GA 3T9NA 3I55Q 3A1PA 2X51A 4J5YA 1X69A 4R56A 2ESWA 4Q5WA 4JZ4A 1YJ9T 4DBHA 1VQKT 4IKFA 2QAZA 2RJFA 2HL5C 4M7DF 1LJOA 3KFVA 2RQVA 5A2QE 3HL8A 1GBRA 1EFNA 2O9VA 1VQLQ 4J9DA 3CCJA 5EC7A 4M78C 2PZ1A 2ENMA 3UWNA 3VS0A 5CVIA 2BTTA 3MJXA 3DB3A 1M4ZA 4OMLA 3CBPA 4CC3A 4WTOB 1GCPA 2I0NA 1QVGP 3HTRA 1NJIR 2E6NA 1E7OA 1RL2A 1YHQT 3G71A 5DY9A 4RTZA 5LJ3e 3OBYA 2MWPA 4M7DB 3RNJA 2XDBA 2MIOA 3HRSA 3M57A 2DRMA 1M90R 1PD0A 1Y07A 2R58A 1K73U 3JV3A 1VQKA 1OPLA 5GAMh 1I5LA 3BDUA 2Y4XA 5GJVB 2KYBA 1QQJA 4Z88A 4MZPA 1EX4A 3EFSA 3CCSA 3OYKA 1SF9A 4OF1A 4MMKA 1ABQA 1VQNQ 8AT1B 3FEOA 4PJNA 3VRYA 1BI3A 2DA9A 2K5IA 2OAUA 4ZGJB 1X75C 2JTMA 1LPLA 2QTXA 2RPNA 2EKHA 2PVDB 2WSCE 1EZZB 2K5LA 2EJFA 4F7UA 2X4YA 1VQMA 2A08A 2IG0A 2HMAA 2QEXT 2DTHA 3JB9D 1Q86U 2G3RA 1VUBA 3NMZC 2KEAA 4PFPA 4PJOE 2E10A 4ANJA 2X3XD 3CXCA 2EJGA 3OSVA 3JCMX 3I9QA 1BIBA 2J6FA 2KR3A 4AFUC 2O31A 4N0AA 2KROA 4XTVA 1D3BB 1N9RA 5FWBA 1IREB 5LJ5e 2YHTA 2KRSA 3I55T 1UJYA 1M2OA 3OYGA 1SHGA 2DIQA 2RQWA 1QLYA 2P4TA 1TSFA 3NTKA 3QO3A 4KRTA 5GANd 1MMDA 4XTXA 1WYXA 2C0OA 1MV0B 2GFAA 5LJ5d 2F1LA 4EMHA 4QVCA 4LE9A 4J6YA 2AT1B 4JUVA 2ZAEA 4RTTA 1Y7XA 5KYWB 1W6XA 3P8DA 2K2MA 3IQLA 2H8HA 1VYTA 3H0HA 1M1KR 1WHHA 4M7AG 1VQOT 1R0BG 2RHZA 1MUZA 3G7ZA 3EG9A 1Y71A 1Q82U 4V2SA 5KE3A 5IXBA 2YUPA 1WHLA 2SRCA 4BY6B 4EMKA 2D6FA 5FROA 5HY6A 2HAXA 2RNAA 3NPFA 4F04B 4CRIA 1KIKA 1S1NA 1JJ2A 2ZGWA 1SEMA 1PNJA 2AZVA 1KD1U 4M78B 4Y91A 4C92D 7AT1B 3R6OA 1D09B 2NYSA 4LDUA 3X24B 1D3BA 3JB9H 1MNEA 1D1BA 3CC4A 4WCIA 3KBGA 3HRTA 3RMSA 2M9UA 1FMVA 3C12A 2BZYA 2LMJA 3C4SA 2CP0A 2EYQA 2HSPA 1EIFA 1Y57A 3JB9G 5GMKh 1WDXA 4A4KA 4J6WA 2NUPA 2K5FA 4E7HA 3JCMP 4QQ6A 6AT1B 4IUQA 4EMGA 3REAB 3CCMA 3E1SA 3KXTA 4E47A 5IXFA 2B86A 4OB3B 1VQNA 1ABOA 2KDSA 4OB2B 3CPWS 5IH2A 3S3MA 1QWFA 1FXXA 2E41A 2KBTA 2KT1A 2LQ8A 5KYXA 1M1KC 3GP8A 4M78F 3GNGA 1OX9A 5LL6S
chains in the Genus database with same CATH topology
2CT4A 2K7AA 1X2KA 3TSWA 2M0YA 4J9CA 1Y0MA 2RQRA 1G83A 4HVVA 2DJQA 3EG3A 2OJ2A 4A63B 3ZL7C 2F2XA 2VKNA 2GBQA 1HJDA 1MV3A 2CSQA 2CREA 4HVWA 2EBPA 2KE9A 3H41A 2DL4A 2DYBA 2KYMA 4RTUA 1YP5A 2PNIA 1Z9QA 2DVJA 2A36A 1QCFA 2DL7A 3REBB 2FPDA 2P4RA 3VS4A 4LUEA 1X27A 2KXCA 1CSKA 3I5RA 2EVRA 2ECZA 1FMKA 1UUEA 4CC4B 3EG0A 3SHWA 1PRLC 1JQQA 5IHNA 1A0NB 1K9AA 1H8KA 2EYWA 4OMQA 2CSIA 4LUDA 3VS3A 2C0TA 2O88A 4JPBW 1UE9A 1I07A 2EPDA 2VVKA 2IIMA 1GRIA 1OOTA 3A98A 1UGVA 2DL5A 5ECAA 1GCQC 2CUBA 1RUWA 1WIEA 2EGAA 4OMMA 1BK2A 1K4US 1M30A 2YT6A 2MOXA 1AVZC 1X6GA 1TUDA 5IHKA 2FPFA 1NM7A 1UJ0A 4X1VA 2AKKA 2MCNA 1JEGA 1BB9A 2CH4A 2NUZA 2ABLA 2HDAA 2J06A 2JS2A 1GL5A 1AWXA 3EHRA 2L2PA 2DRKA 2CDTA 2SEMA 1JXOA 2KNBB 2J7IA 1JXMA 4JJCA 1PKSA 1TG0A 2JM8A 1UFFA 2J6KA 2KGTA 1ZSGA 2W0ZA 4J9BA 1BU1A 3TSZA 4GLMA 3M0RA 3VRZA 1N5ZA 1TUCA 1YWPA 1UG1A 2GTJA 2DX1A 1QKXA 2O9SA 4FSSA 2LJ0A 1AZGB 4ESRA 2D0NA 1OV3A 3EGUA 4LN2A 1I0CA 3FJ5A 2A37A 2FPEA 2JS0A 1E6HA 5HCKA 3M0TA 1ZUYA 2FO0A 4Z8AA 1BBZA 1ZUUA 2CUDA 4ZNXA 3RBBB 1PKTA 1YWOA 2BZXA 1ARKA 1UHCA 2JW4A 2A28A 2CH4W 4Z89A 2QDLA 4CC7A 1NG2A 2L3SA 2YUQA 3M0QA 2YUNA 2YUOA 1SSHA 4J9IA 2DBKA 4J9GA 4RTXA 1SRMA 4CC2A 4F17A 1AOJA 1V1CA 1QKWA 2D8HA 1ZLMA 4OMOA 1H3HA 2KRMA 1X43A 2BZ8A 2DMOA 1AEYA 1UTIA 4JJDA 4AFSC 4E6RA 3THKA 1UECA 2DBMA 2GGRA 3PE0A 1M8MA 2LJ3A 1FYNA 1T3SA 1UDLA 2EYYA 3QWYA 2X3WD 1J3TA 3UA6A 1M3BA 2OI3A 1X69A 4AFZC 2JM9A 2ESWA 4JZ4A 1ZX6A 2EGCA 4HCKA 1M3CA 2ROLA 1PRMC 1NEBA 1WA7A 3KFVA 2RQVA 4JZ3A 3VS5A 1GBRA 4Y92A 1EFNA 3PVQA 2YDLA 1K76A 2O9VA 4D8KA 4J9DA 2FG0A 5EC7A 3U23A 1JU5C 2PZ1A 1U06A 1CKBA 1X2QA 5GJWB 2ENMA 1W1FA 3R6NA 2DL8A 3VS0A 2HCKA 1OEBA 2BTTA 4LNPA 2DL3A 2LQWA 4OMLA 2LCSA 4F16A 4CC3A 1T3LA 1GCPA 2I0NA 1QWEA 2RN8A 1NEGA 1RI9A 3O5ZA 4ORZA 4AG2C 1I1JA 2EW3A 1GBQA 2LJ1A 2NWMA 4GBQA 1E7OA 3NHNA 3EG1A 1M3AA 4RTZA 1GCQA 2FRWA 2JMAA 3RNJA 4D8DA 1NYGA 2DE0X 2MIOA 2PTKA 4R0KA 2DRMA 1WFWA 2W10A 1AWJA 2AKLA 3JV3A 1OPLA 1H92A 3VS2A 2KXDA 3M0SA 5GJVB 2RQTA 2JMCA 2KYBA 5FWCA 2LP5A 1W70A 4Z88A 1KSWA 2F2WA 4RTWA 2G6FX 2FRYA 2L0AA 1K0XA 1PHTA 1ABQA 1CKAA 1HD3A 4RTYA 1PWTA 4OMNA 1XOVA 2LX7A 3VRYA 2DA9A 2J6OA 3I35A 5I11A 5FW9A 2RPNA 2EKHA 2YSQA 2ROTA 2AK5A 3EHQA 2L3PA 1YCSB 4RTVA 2A08A 3QWXX 2JT4A 4EIKA 3NMZC 2K79A 1YNZA 1U3OA 2KEAA 2KRNA 4OMPA 1LCKA 2X3XD 3M0PA 1HSQA 2EQIA 1KFZA 1WLPB 2CT3A 2V1RA 1AD5A 3I9QA 3VS6A 1YN8A 2J6FA 2KR3A 4AFUC 2O31A 1GFDA 1SRLA 2KROA 1AWWA 2DLPA 5FWBA 3GBQA 4HXJA 5I22A 1NLOC 2C0IA 2KRSA 3EG2A 1UJYA 3CQTA 1VYUA 1SHGA 2E5KA 2GTOA 3UF4A 1JO8A 1T0HA 2RQWA 1WXTA 1QLYA 1ZUKA 3NGPA 1X6BA 4KRTA 4RUGA 1WYXA 2C0OA 1MV0B 3TVTA 1B3QA 1WXUA 1WXBA 4LE9A 2L3QA 4AFQC 3M0UA 4J9FA 4RTTA 3VS7A 4DEYA 3UATA 2V1QA 2XMFA 1W6XA 1E6GA 2DM1A 2K2MA 3PVLA 5L23A 3IQLA 4J9HA 2H8HA 1VYTA 3H0HA 2ED0A 1MUZA 2ED1A 1ZBJA 2D8JA 2OAWA 2K3BA 1K0SA 4DEXA 3I5SA 3SEMA 2AZSA 5IXBA 2YUPA 2FEIA 2K6DA 1GFCA 2SRCA 3H0FA 2RQUA 1NYFA 1UHFA 2M51A 4HVUA 1T0JA 2RNAA 3ULRB 3NPFA 1WI7A 2EGEA 4F14A 2DNUA 1VYVA 1RLPC 4IIOA 2K9GA 1KIKA 2DF6A 1S1NA 1Z9ZA 1SEMA 1PNJA 2AZVA 3H0IA 1IO6A 1RLQC 2EYXA 2LNHB 1OPKA 2J05A 1U5SA 2KT8A 3VS1A 2O2OA 2RMOA 4M4ZA 2LQNA 1VA7A 2D1XA 4WCIA 3LH5A 1G2BA 2DILA 2BZYA 1AWOA 2LMJA 2HSPA 4JJBA 1K1ZA 1Y57A 4QT7A 1AZEA 1WDXA 4K11A 3UA7A 2JTEA 5IHIA 2F2VA 2EYZA 3REAB 1B07A 2RF0A 2VWFA 4J9EA 1SPKA 5IXFA 2B86A 1KJWA 1NLPC 4IIMA 1ABOA 2GNCA 3C0CA 5IH2A 1M27C 1WX6A 2JXBA 2KBTA 1QWFA 1SHFA 2KT1A 4AG1C 2HBWA 2LZ6B 2HEQA 2GQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CT4 A;  2K7A A;  1X2K A;  3TSW A;  2M0Y A;  4J9C A;  1Y0M A;  2RQR A;  1G83 A;  4HVV A;  2DJQ A;  3EG3 A;  2OJ2 A;  4A63 B;  3ZL7 C;  2F2X A;  2VKN A;  2GBQ A;  1HJD A;  1MV3 A;  2CSQ A;  2CRE A;  4HVW A;  2EBP A;  2KE9 A;  3H41 A;  2DL4 A;  2DYB A;  2KYM A;  4RTU A;  1YP5 A;  2PNI A;  1Z9Q A;  2DVJ A;  2A36 A;  1QCF A;  2DL7 A;  3REB B;  2FPD A;  2P4R A;  3VS4 A;  4LUE A;  1X27 A;  2KXC A;  1CSK A;  3I5R A;  2EVR A;  2ECZ A;  1FMK A;  1UUE A;  4CC4 B;  3EG0 A;  3SHW A;  1PRL C;  1JQQ A;  5IHN A;  1A0N B;  1K9A A;  1H8K A;  2EYW A;  4OMQ A;  2CSI A;  4LUD A;  3VS3 A;  2C0T A;  2O88 A;  4JPB W;  1UE9 A;  1I07 A;  2EPD A;  2VVK A;  2IIM A;  1GRI A;  1OOT A;  3A98 A;  1UGV A;  2DL5 A;  5ECA A;  1GCQ C;  2CUB A;  1RUW A;  1WIE A;  2EGA A;  4OMM A;  1BK2 A;  1K4U S;  1M30 A;  2YT6 A;  2MOX A;  1AVZ C;  1X6G A;  1TUD A;  5IHK A;  2FPF A;  1NM7 A;  1UJ0 A;  4X1V A;  2AKK A;  2MCN A;  1JEG A;  1BB9 A;  2CH4 A;  2NUZ A;  2ABL A;  2HDA A;  2J06 A;  2JS2 A;  1GL5 A;  1AWX A;  3EHR A;  2L2P A;  2DRK A;  2CDT A;  2SEM A;  1JXO A;  2KNB B;  2J7I A;  1JXM A;  4JJC A;  1PKS A;  1TG0 A;  2JM8 A;  1UFF A;  2J6K A;  2KGT A;  1ZSG A;  2W0Z A;  4J9B A;  1BU1 A;  3TSZ A;  4GLM A;  3M0R A;  3VRZ A;  1N5Z A;  1TUC A;  1YWP A;  1UG1 A;  2GTJ A;  2DX1 A;  1QKX A;  2O9S A;  4FSS A;  2LJ0 A;  1AZG B;  4ESR A;  2D0N A;  1OV3 A;  3EGU A;  4LN2 A;  1I0C A;  3FJ5 A;  2A37 A;  2FPE A;  2JS0 A;  1E6H A;  5HCK A;  3M0T A;  1ZUY A;  2FO0 A;  4Z8A A;  1BBZ A;  1ZUU A;  2CUD A;  4ZNX A;  3RBB B;  1PKT A;  1YWO A;  2BZX A;  1ARK A;  1UHC A;  2JW4 A;  2A28 A;  2CH4 W;  4Z89 A;  2QDL A;  4CC7 A;  1NG2 A;  2L3S A;  2YUQ A;  3M0Q A;  2YUN A;  2YUO A;  1SSH A;  4J9I A;  2DBK A;  4J9G A;  4RTX A;  1SRM A;  4CC2 A;  4F17 A;  1AOJ A;  1V1C A;  1QKW A;  2D8H A;  1ZLM A;  4OMO A;  1H3H A;  2KRM A;  1X43 A;  2BZ8 A;  2DMO A;  1AEY A;  1UTI A;  4JJD A;  4AFS C;  4E6R A;  3THK A;  1UEC A;  2DBM A;  2GGR A;  3PE0 A;  1M8M A;  2LJ3 A;  1FYN A;  1T3S A;  1UDL A;  2EYY A;  3QWY A;  2X3W D;  1J3T A;  3UA6 A;  1M3B A;  2OI3 A;  1X69 A;  4AFZ C;  2JM9 A;  2ESW A;  4JZ4 A;  1ZX6 A;  2EGC A;  4HCK A;  1M3C A;  2ROL A;  1PRM C;  1NEB A;  1WA7 A;  3KFV A;  2RQV A;  4JZ3 A;  3VS5 A;  1GBR A;  4Y92 A;  1EFN A;  3PVQ A;  2YDL A;  1K76 A;  2O9V A;  4D8K A;  4J9D A;  2FG0 A;  5EC7 A;  3U23 A;  1JU5 C;  2PZ1 A;  1U06 A;  1CKB A;  1X2Q A;  5GJW B;  2ENM A;  1W1F A;  3R6N A;  2DL8 A;  3VS0 A;  2HCK A;  1OEB A;  2BTT A;  4LNP A;  2DL3 A;  2LQW A;  4OML A;  2LCS A;  4F16 A;  4CC3 A;  1T3L A;  1GCP A;  2I0N A;  1QWE A;  2RN8 A;  1NEG A;  1RI9 A;  3O5Z A;  4ORZ A;  4AG2 C;  1I1J A;  2EW3 A;  1GBQ A;  2LJ1 A;  2NWM A;  4GBQ A;  1E7O A;  3NHN A;  3EG1 A;  1M3A A;  4RTZ A;  1GCQ A;  2FRW A;  2JMA A;  3RNJ A;  4D8D A;  1NYG A;  2DE0 X;  2MIO A;  2PTK A;  4R0K A;  2DRM A;  1WFW A;  2W10 A;  1AWJ A;  2AKL A;  3JV3 A;  1OPL A;  1H92 A;  3VS2 A;  2KXD A;  3M0S A;  5GJV B;  2RQT A;  2JMC A;  2KYB A;  5FWC A;  2LP5 A;  1W70 A;  4Z88 A;  1KSW A;  2F2W A;  4RTW A;  2G6F X;  2FRY A;  2L0A A;  1K0X A;  1PHT A;  1ABQ A;  1CKA A;  1HD3 A;  4RTY A;  1PWT A;  4OMN A;  1XOV A;  2LX7 A;  3VRY A;  2DA9 A;  2J6O A;  3I35 A;  5I11 A;  5FW9 A;  2RPN A;  2EKH A;  2YSQ A;  2ROT A;  2AK5 A;  3EHQ A;  2L3P A;  1YCS B;  4RTV A;  2A08 A;  3QWX X;  2JT4 A;  4EIK A;  3NMZ C;  2K79 A;  1YNZ A;  1U3O A;  2KEA A;  2KRN A;  4OMP A;  1LCK A;  2X3X D;  3M0P A;  1HSQ A;  2EQI A;  1KFZ A;  1WLP B;  2CT3 A;  2V1R A;  1AD5 A;  3I9Q A;  3VS6 A;  1YN8 A;  2J6F A;  2KR3 A;  4AFU C;  2O31 A;  1GFD A;  1SRL A;  2KRO A;  1AWW A;  2DLP A;  5FWB A;  3GBQ A;  4HXJ A;  5I22 A;  1NLO C;  2C0I A;  2KRS A;  3EG2 A;  1UJY A;  3CQT A;  1VYU A;  1SHG A;  2E5K A;  2GTO A;  3UF4 A;  1JO8 A;  1T0H A;  2RQW A;  1WXT A;  1QLY A;  1ZUK A;  3NGP A;  1X6B A;  4KRT A;  4RUG A;  1WYX A;  2C0O A;  1MV0 B;  3TVT A;  1B3Q A;  1WXU A;  1WXB A;  4LE9 A;  2L3Q A;  4AFQ C;  3M0U A;  4J9F A;  4RTT A;  3VS7 A;  4DEY A;  3UAT A;  2V1Q A;  2XMF A;  1W6X A;  1E6G A;  2DM1 A;  2K2M A;  3PVL A;  5L23 A;  3IQL A;  4J9H A;  2H8H A;  1VYT A;  3H0H A;  2ED0 A;  1MUZ A;  2ED1 A;  1ZBJ A;  2D8J A;  2OAW A;  2K3B A;  1K0S A;  4DEX A;  3I5S A;  3SEM A;  2AZS A;  5IXB A;  2YUP A;  2FEI A;  2K6D A;  1GFC A;  2SRC A;  3H0F A;  2RQU A;  1NYF A;  1UHF A;  2M51 A;  4HVU A;  1T0J A;  2RNA A;  3ULR B;  3NPF A;  1WI7 A;  2EGE A;  4F14 A;  2DNU A;  1VYV A;  1RLP C;  4IIO A;  2K9G A;  1KIK A;  2DF6 A;  1S1N A;  1Z9Z A;  1SEM A;  1PNJ A;  2AZV A;  3H0I A;  1IO6 A;  1RLQ C;  2EYX A;  2LNH B;  1OPK A;  2J05 A;  1U5S A;  2KT8 A;  3VS1 A;  2O2O A;  2RMO A;  4M4Z A;  2LQN A;  1VA7 A;  2D1X A;  4WCI A;  3LH5 A;  1G2B A;  2DIL A;  2BZY A;  1AWO A;  2LMJ A;  2HSP A;  4JJB A;  1K1Z A;  1Y57 A;  4QT7 A;  1AZE A;  1WDX A;  4K11 A;  3UA7 A;  2JTE A;  5IHI A;  2F2V A;  2EYZ A;  3REA B;  1B07 A;  2RF0 A;  2VWF A;  4J9E A;  1SPK A;  5IXF A;  2B86 A;  1KJW A;  1NLP C;  4IIM A;  1ABO A;  2GNC A;  3C0C A;  5IH2 A;  1M27 C;  1WX6 A;  2JXB A;  2KBT A;  1QWF A;  1SHF A;  2KT1 A;  4AG1 C;  2HBW A;  2LZ6 B;  2HEQ A;  2GQI A; 
#chains in the Genus database with same CATH topology
 4OB0 B;  3CC2 Q;  4IUT A;  5HK3 A;  2M0Y A;  2YLB A;  1MGQ A;  1G83 A;  4PKC C;  2PVG B;  1N8R C;  1VQP Q;  1YCY A;  5CKB A;  2RJE A;  3MO8 A;  3OBW A;  2GBQ A;  1K8A C;  2QQR A;  2HQX A;  1YIJ T;  2CRE A;  4A4E A;  2KQW A;  3MPU B;  2QEX Q;  3L2U A;  2EBP A;  4JRQ A;  3H41 A;  3OYH A;  4C0F A;  1YP5 A;  1W4S A;  1OZ2 A;  3RDV A;  3L2Z A;  1QCF A;  3REB B;  2FPD A;  2DK3 A;  2P4R A;  3HFO A;  1PSF A;  1C0M A;  5I2M A;  3PTA A;  1X27 A;  2KXC A;  3JCM J;  2AHJ B;  1Q82 C;  1VQ5 T;  2MYS A;  2ECZ A;  3JB9 J;  1YHQ A;  1UUE A;  4C8Q D;  1S72 A;  4JJN K;  1ZBX A;  3A8L B;  2ZCF B;  4DOV A;  5IHN A;  2P0Q A;  1VQ9 Q;  2MK5 A;  1K9A A;  1H8K A;  2DET A;  4LUD A;  1YJ9 A;  2C0T A;  2ZPF B;  2FZC B;  1GRI A;  2AIR B;  2HD0 A;  1M90 C;  5GMK j;  2CUB A;  2EGA A;  4E7L A;  4C92 E;  1K4U S;  1M30 A;  4M7D C;  4NOY A;  2COZ A;  4OGE A;  4LXC A;  1D1C A;  1BKB A;  3NTH A;  4Y28 E;  3FDR A;  5IHK A;  1C1A A;  1YI2 T;  4C92 G;  3MP6 A;  1PCX A;  4F7U B;  5M9O A;  4NS5 A;  4OB1 B;  2AKK A;  5IAY A;  2CH4 A;  2NUZ A;  2ABL A;  5GAN 6;  4OVA A;  5LJ3 d;  3OYB A;  2F69 A;  3CBM A;  3H6Z A;  2Z0W A;  3HHT B;  2Y90 A;  1WQW A;  2JOY A;  2QXF A;  2SEM A;  1JXO A;  4JJC A;  1IB8 A;  5IT9 E;  3MEA A;  1PKS A;  2IPO B;  2ZZD A;  2QI2 A;  4JRI A;  2JN0 A;  1G3S A;  4GLM A;  4M77 A;  1NE8 A;  1YWP A;  4FYX B;  2D0N A;  3EGU A;  4BD3 A;  4RCB A;  2A37 A;  1E6H A;  2X4X A;  3QKJ A;  5HCK A;  5LJ5 j;  3SDZ A;  3CPF A;  1ZUU A;  4BAC A;  4ZNX A;  3L2W A;  3ZEH A;  1NZ9 A;  1PKT A;  2C06 A;  2VC8 A;  4EPC A;  2L3R A;  2JW4 A;  3OSS C;  5CKE A;  3ER0 A;  3CXC S;  2LT1 A;  2QDL A;  2YUQ A;  5KYW A;  4JDS A;  4BE0 A;  1VQ4 Q;  5LJ5 g;  2YUO A;  1QMC A;  3QZ5 B;  2GQV A;  2M02 A;  5FRM A;  4NL3 A;  2D8H A;  3I55 A;  4M77 C;  2E5Q A;  3CBO A;  3OMG A;  1VQ5 A;  2KRM A;  1VQ9 T;  1X43 A;  2BZ8 A;  2KMT A;  1UTI A;  2E12 A;  4JJD A;  3JRZ A;  4E6R A;  2CKK A;  1I8F A;  3VV0 A;  1WHM A;  2NLU A;  4F7U G;  5KYU A;  4ZN1 A;  3QWY A;  2CS7 A;  3UT1 A;  2KK4 A;  1KD1 C;  1G5V A;  4M7A F;  2JZ2 A;  1J3T A;  3MEU A;  3UA6 A;  5LJ3 j;  2K4Y A;  3ME9 A;  4AFZ C;  1QVF A;  2HL3 A;  1ZX6 A;  2EGC A;  2X4J A;  2DER A;  3PMI A;  1KHC A;  1G3Y A;  4FYW B;  4RCC A;  1NEB A;  1PSE A;  1FWZ A;  2K2V A;  2RD1 A;  4PL6 A;  3VS5 A;  5A0G A;  1BYM A;  4Y92 A;  1TUG B;  4BI3 A;  2YDL A;  4C92 F;  5CK9 A;  1UGS B;  4M75 F;  3CC4 Q;  3GIB A;  1JJ2 P;  3U23 A;  4M77 B;  3LLR A;  1X2Q A;  3R6N A;  2DL8 A;  2COY A;  2E6Z A;  2QEX A;  4DQ2 A;  1VQ7 A;  2RN8 A;  3RIR A;  1NEG A;  2MF2 A;  1RI9 A;  5L8R E;  3O5Z A;  1VOM A;  4ORZ A;  2HKQ B;  4L5G A;  1VQ6 Q;  1GBQ A;  2NWM A;  3EFR A;  2I2L A;  3NHN A;  5D6W A;  3EG1 A;  5GAN g;  1M3A A;  5CQX A;  3OYY A;  5FLX E;  2JJ9 A;  1VQO Q;  1VQ8 T;  1NYG A;  4E7I A;  3E19 A;  3CME Q;  2W10 A;  4LDY A;  2VXE A;  1H92 A;  3VS2 A;  2LCL A;  4JLI A;  3EGX B;  4RG2 A;  3EFO B;  3CD6 A;  3H8Z A;  1KQS P;  2F2W A;  4DBQ A;  3G71 T;  3X28 B;  2LVM A;  2G6F X;  3CCJ Q;  1OZ3 A;  1YBY A;  3RUX A;  3EH2 A;  4C8Q G;  4KUI A;  3MEV A;  1PD1 A;  3CC2 T;  3OS0 A;  3M59 A;  1KQS S;  4M75 A;  3MCA B;  4FSX A;  1WQ7 A;  4XTY A;  2YSQ A;  2ROT A;  3GPL A;  2L3P A;  1QCO A;  1G8X A;  3EH1 A;  1OUL A;  2DTO A;  2VGN A;  3OW2 S;  2RH2 A;  4DBR A;  4E7J A;  1WNL A;  2JT4 A;  2K79 A;  1YIJ Q;  1WJS A;  5GAO q;  4II1 A;  3CCJ T;  2DYI A;  5FRN A;  3RKY A;  3X26 B;  1I81 A;  3M0P A;  1HSQ A;  1KFZ A;  1OU9 A;  3WXM B;  2K3Y A;  2V1R A;  4QW2 A;  3X20 B;  4D6W A;  1SRL A;  5KYN A;  5CKD A;  3HSB A;  1Q81 C;  2DVE A;  1UGR B;  1WXT A;  1ZUK A;  4XU0 A;  1X6B A;  3QDR B;  2OTJ A;  1IGU A;  1ZHI A;  3TVT A;  1I4K 1;  4KUD K;  1B3Q A;  1WXU A;  1WXB A;  3LW5 E;  2D9T A;  1VQP A;  4M77 E;  3M0U A;  1WGS A;  4J9F A;  2V8K A;  4C5E A;  3JCM b;  2VAS A;  2XMF A;  5J39 A;  1V76 A;  2DM1 A;  5L23 A;  3PVL A;  3CME T;  2FHD A;  3M55 A;  3PGG A;  1YJN A;  2E64 A;  2E1H A;  3GNF B;  2MMP A;  2QA4 A;  3G4S Q;  3SEM A;  2O01 E;  4IUU A;  4HCC A;  2YLC A;  2R5M A;  3H0F A;  1KQS A;  3D7S B;  4ELZ C;  3SWN A;  3VJP A;  2R57 A;  2V26 A;  3MKD A;  2RJC A;  3OS1 A;  4HVU A;  1WI7 A;  1MMA A;  1OQK A;  4F14 A;  1LVK A;  1Q7Y C;  1SG5 A;  2DF6 A;  4PFO A;  2HQE A;  4EMK C;  1IO6 A;  1RLQ C;  2LNH B;  1OPK A;  1U5S A;  2KT8 A;  4M7D E;  2RMO A;  2JVV A;  2OTL T;  4M4Z A;  2L89 A;  1M1G A;  4JRK A;  4HCZ A;  2YXY A;  4PJJ A;  1AWO A;  1YJN T;  1K1Z A;  1AZE A;  4QT7 A;  4C0D C;  1WZO A;  2QQB A;  1LOJ A;  1DJ7 B;  2F2V A;  2EYZ A;  2XU8 A;  2DJZ A;  5GAM e;  4X9D A;  4A54 A;  1YJ9 Q;  1RAC B;  1VIE A;  1BIA A;  3TCJ A;  3M9Q A;  4C8Q E;  5GAN 8;  3FB9 A;  1VQM T;  1WX6 A;  4M75 G;  5KCH A;  4XU1 A;  2FZG B;  1YIT Q;  2NUT B;  1QW1 A;  2P84 A;  4AG1 C;  3QZ9 B;  2E4H A;  4ZN3 A;  4M75 E;  3WVE B;  2PVO B;  3CPW A;  2F5K A;  3M56 A;  1X2K A;  5GAO r;  4J9C A;  1Y0M A;  2DD4 A;  2DJQ A;  2RHX A;  3EG3 A;  3RMQ A;  2OJ2 A;  2COW A;  1O75 A;  1B7T A;  4NL2 A;  4FT2 A;  1VQ8 A;  3J81 E;  1K9M C;  5J26 A;  4AMC A;  4TVR A;  1QVP A;  5GAN 3;  3CD6 T;  3QG1 A;  5KYY B;  2KE9 A;  2R5A A;  2DYB A;  1VIF A;  4R55 A;  2PNI A;  2WSF E;  2DVJ A;  1YIT A;  3LX7 A;  2IVW A;  3BDL A;  4HA8 A;  1VQ6 A;  2DL7 A;  3M4Y A;  1MND A;  3LYI A;  4LUE A;  4OGC A;  1HK9 A;  4C92 A;  1M8V A;  1CSK A;  1M2V A;  3G6E Q;  1FMK A;  2EFI A;  4L6V 5;  3JCM e;  1PRL C;  1PM3 A;  3CPW P;  2EYW A;  2KVQ G;  2FVU A;  3JSC A;  1OX8 A;  3OYC A;  4OMQ A;  1Y96 B;  4XTU A;  3VS3 A;  5GAO l;  2VVK A;  2IIM A;  1OOT A;  4ZGE B;  1UGV A;  2DL5 A;  1RAB B;  1Q81 R;  2QQ9 A;  1RAD B;  4PLL A;  1BK2 A;  4E7S A;  4RG8 A;  1NPR A;  1OU8 A;  1YJW A;  1IHV A;  2DKG A;  1TWB A;  1AVZ C;  1X6G A;  4XTZ A;  4HT8 A;  1VQ7 T;  2YRV A;  4X1V A;  3OMC A;  3A8H B;  5CR2 A;  2MCN A;  5A0D A;  2WSE E;  3PIO A;  3CMA Q;  2FB7 A;  3FC3 A;  3MP1 A;  4C5H A;  2RA2 A;  2L2P A;  2CDT A;  3G4S A;  2J7I A;  4FIB A;  1RAH B;  4O6J A;  2PQW A;  2JM8 A;  1UFF A;  2Y4Y A;  2J6K A;  4HT9 A;  2KGT A;  1ZSG A;  2CYZ B;  2LCC A;  3LGF A;  5GAO n;  3J7A F;  1AZG B;  2XDP A;  4ESR A;  2EQU A;  3MP8 A;  4M7A C;  2B8A A;  2BIV A;  4LN2 A;  4AT1 B;  3M54 A;  3M0T A;  1ZUY A;  4FCY A;  1XNI A;  4KGV B;  2FO0 A;  2CUD A;  4YTL A;  3HKS A;  1ARK A;  3PFS A;  2BKD N;  4Z89 A;  1NG2 A;  1G3T A;  3M0Q A;  2L5Q A;  3RR6 A;  1AHJ B;  2O4X A;  2H3J A;  4A4H A;  4J9I A;  4C8Q C;  2DBK A;  4PNO A;  1SRM A;  3SWN C;  3TU4 K;  1AOJ A;  4M7A D;  1WHG A;  3I56 T;  4E7Z A;  1BCO A;  1AEY A;  2GFU A;  3OYJ A;  5LJ3 g;  2DBM A;  5LJ3 f;  1NPP A;  4RMO A;  3CCS T;  3CCE Q;  2EYY A;  4LD6 A;  3FJP A;  5FU6 B;  2JM9 A;  1N8R U;  1KC8 C;  5DLO A;  4HCK A;  3EAE A;  3A8G B;  1IXD A;  2HZY A;  3INZ A;  2PUO B;  2ROL A;  1KK7 A;  3OYA A;  3BFM A;  1X6O A;  3PVQ A;  3OYE A;  1RAE B;  3V8J A;  1K76 A;  3QII A;  5GAN h;  2FG0 A;  4BE1 A;  1JU5 C;  3WVD B;  1U06 A;  3M58 A;  4RKU E;  2QAS A;  2OX7 A;  3OA6 A;  2HCK A;  5DLQ E;  2QK0 A;  1G3W A;  2XIC A;  4LNP A;  2LQW A;  3OYD A;  5D7U A;  1T3L A;  1QWE A;  5D6Y A;  3CCR T;  2EW3 A;  3QYH B;  4GBQ A;  1D0Y A;  5GAN f;  1M1K U;  3HRU A;  2KAF A;  1BI2 A;  1GCQ A;  3CMA T;  4D8D A;  3EG9 B;  1AWJ A;  2AKL A;  3A8O B;  1IZ6 A;  3LWH A;  1HXD A;  5I21 A;  3NTI A;  3OS2 A;  4BI4 A;  3QJ6 A;  2LDM A;  3M0S A;  2RQT A;  2EWN A;  4OMF B;  1R0C B;  5C0M A;  2QTV A;  4RTW A;  2DD5 A;  1K8A R;  2FRY A;  2CP6 A;  1B34 B;  5IN1 A;  1VQP T;  1PHT A;  3N5B B;  4JS4 A;  1CKA A;  3I56 A;  3QJY A;  4M7A B;  5LJ3 h;  4OMN A;  3OS5 A;  3CCL Q;  3I35 A;  1S72 Q;  5FW9 A;  1SSF A;  5GAN 5;  2AK5 A;  2YRC A;  4MML A;  2XG8 D;  1MMN A;  2EIF A;  4ELY C;  2DXT A;  3OYM A;  1U1S A;  1U3O A;  2KRN A;  2JUF A;  1KHI A;  1VQ4 T;  1YJW T;  1BI1 A;  3VUB A;  3PIP A;  4FT4 A;  1WLP B;  3VS6 A;  1AD5 A;  4M7D G;  1YN8 A;  2YRD A;  5KCO A;  1GFD A;  3CCV A;  5I2S A;  1AWW A;  3ASK A;  3GBQ A;  2K57 A;  4ZGD B;  3V8L A;  3MHX A;  4J83 A;  3UF4 A;  1VYU A;  2GTO A;  1XJW B;  4B9W A;  3L2V A;  4LDV A;  1VQ7 Q;  3A5Z B;  2L3Q A;  4AFQ C;  3VS7 A;  4J7I A;  3UAT A;  1KG1 A;  2V1Q A;  5J3B A;  3L1A A;  1QVF S;  2QYZ A;  4EDU A;  4FW1 A;  2VXF A;  4J9H A;  1WJR A;  4M7A A;  2ED1 A;  2D8J A;  3CCM Q;  2RI3 A;  4LDX A;  2K3B A;  1K0S A;  4C5G A;  4DEX A;  1K8A U;  3BW1 A;  3CME A;  1NJI C;  2XD0 A;  1NYF A;  4PJO B;  1FX7 A;  1TXQ A;  2VB6 A;  2M51 A;  3CCQ Q;  1SKU B;  2EGE A;  2DNU A;  1VYV A;  2LRQ A;  4M78 E;  3OW2 P;  3CC4 T;  3CC2 A;  3E2U A;  3ZFJ A;  2X9H A;  3S3N A;  3CCR Q;  3G1J A;  5KE2 A;  3H0I A;  4WF2 A;  2LX9 A;  2EYX A;  1D0Z A;  2QQA A;  2ZPI B;  3VS1 A;  3OQ5 A;  1PC0 A;  4XU2 A;  3JCM Q;  3V7S A;  5A0L A;  1G2B A;  4M78 G;  2DIL A;  2WAC A;  2KI7 A;  4MDX A;  4JJB A;  1W2B S;  2ZPH B;  4K11 A;  3S6W A;  2JTE A;  4DA4 A;  1VQ8 Q;  5IHI A;  1RAI B;  1B07 A;  2RF0 A;  2RB6 A;  1SPK A;  4M7D D;  1KJW A;  1NLP C;  4F7U F;  2MAM A;  3C0C A;  4BDZ A;  8ATC B;  3RES A;  3GOX A;  1SHF A;  1ZQ1 A;  4IUR A;  3O8V A;  2RI2 A;  1ZA2 B;  3JCM V;  4KH1 B;  2GQI A;  4C0Z A;  4BDY A;  1O9S A;  1UGP B;  1Q81 U;  2RQR A;  3V8K A;  4A63 B;  3ZL7 C;  4LD9 K;  4O5V A;  2NUP B;  3G71 Q;  1HJD A;  3C94 A;  1R77 A;  3EGD B;  1XTD A;  2EQJ A;  2EQK A;  3CMA A;  2CP5 A;  2QA4 T;  3CCV Q;  2CSQ A;  1ZSZ C;  1QVG S;  1ZSZ B;  2DL4 A;  4RTU A;  3OYI A;  2HKN A;  2F5T X;  2E65 A;  1OYX A;  2RJD A;  3CCU Q;  2RHI A;  1W2B A;  3M5A A;  1FMW A;  5CQY A;  5KYX B;  3I5R A;  2HQH A;  4A53 A;  2EVR A;  5GAO m;  3M53 A;  4CC4 B;  3SHW A;  4M78 A;  1JQQ A;  1A0N B;  2HNI A;  5FU7 B;  1Q82 R;  3J80 E;  4JPB W;  1UE9 A;  1H3Z A;  3RKW A;  2MPX C;  1QCN A;  2EJ9 A;  4M7A E;  1HYO A;  2BE7 D;  1RUW A;  4FU6 A;  4BY6 C;  2VYT A;  4KH0 B;  1YFN A;  1RAA B;  2MOX A;  4IUP A;  5AYF A;  1QVF P;  2CZ0 B;  2LC4 A;  1UJ0 A;  1C6V X;  1BB9 A;  2DPP B;  4BI8 B;  2KSS A;  2V8I A;  1VQ9 A;  4ZTF A;  2OTJ Q;  3QPH A;  5EG2 A;  1AWX A;  4CI0 C;  1JXM A;  1M9S A;  1VQL T;  4HCB A;  3GF5 A;  1NBE B;  3UPU A;  1TG0 A;  4A4G A;  2DZ9 A;  2LQK A;  4J9B A;  3QYG B;  1JJ2 S;  3TSZ A;  3DKM A;  3QSU A;  3M0R A;  1N5Z A;  1TUC A;  2JNG A;  1QP2 A;  3PMT A;  5GAM d;  2DX1 A;  4PJO G;  4L59 A;  1YJW Q;  3JCM W;  4PJO C;  2LJ0 A;  1I0C A;  3FJ5 A;  4GY5 A;  2BUD A;  3TRE A;  2DEQ A;  2X4W A;  2DIG A;  3JCM d;  1YWO A;  1Q95 G;  1N27 A;  1UHC A;  1OI1 A;  2A28 A;  2CH4 W;  1M1F A;  5HKC A;  2L3S A;  2EAY A;  2YUN A;  3FLG A;  2HSE B;  3P8B B;  4FW2 A;  4RTX A;  4Z02 A;  3E9F A;  4CC2 A;  4F17 A;  1V1C A;  1ZLM A;  1P92 A;  3VU3 C;  1BCM A;  4QKU A;  4E2F B;  4F7U E;  4PJO D;  2CGH A;  2DMO A;  2P0P A;  3FIF A;  3VYG A;  5CAI A;  4AFS C;  3THK A;  1IRX A;  4C8Q A;  1MMG A;  1WHK A;  1UEC A;  1M90 U;  4M78 D;  1M8M A;  1D1A A;  4PLI A;  4FM4 B;  4PJO A;  2LJ3 A;  1FYN A;  1T3S A;  1UDL A;  1YI2 A;  2HBP A;  4QQD A;  3CCM T;  3CCV T;  2X3W D;  3JB9 I;  1M3B A;  2V8J A;  2OI3 A;  3VYH B;  4N4H A;  1TTH B;  2VGM A;  1M3C A;  3CCL A;  4QVZ A;  1PRM C;  1VQ4 A;  1WA7 A;  4JZ3 A;  3URG A;  5CKH A;  3G4S T;  3EFO A;  4HKE A;  4D8K A;  2CP2 A;  3LGL A;  1CKB A;  5GJW B;  2FYK A;  3CCS Q;  1W1F A;  2EQM A;  1OEB A;  4XQ3 A;  2DL3 A;  3SD4 A;  2LCS A;  4F16 A;  5CO7 A;  2H3E B;  2VV5 A;  4J8O A;  4N0A C;  4UC4 A;  4AG2 C;  1I1J A;  2E70 A;  2LJ1 A;  4M75 B;  3G6E T;  5GMK i;  2ZPE B;  4C8Q F;  4M75 C;  3PT9 A;  2OTJ T;  2XID A;  2DO3 A;  2FRW A;  2JMA A;  3V7R A;  2DE0 X;  2PTK A;  4PJM A;  4R0K A;  1WFW A;  2QDY B;  2KXD A;  2FZK B;  5GMK m;  2FL7 A;  2JMC A;  4QQG A;  5FWC A;  2LP5 A;  1W70 A;  3SWN B;  1K9M U;  1KSW A;  3FRN A;  1KD1 R;  2L0A A;  1K0X A;  4M75 D;  3OYN A;  1VQL A;  2QGF B;  4JLG A;  1KQ2 A;  1HD3 A;  4RTY A;  1PWT A;  3EGD A;  1XOV A;  2QQS A;  2LX7 A;  2K3X A;  3JAM E;  1VQ6 T;  2RO0 A;  2J6O A;  4QVD A;  5I11 A;  1IHW A;  2ZPG B;  5GMK e;  3MEW A;  4MDW A;  3OYF A;  3EHQ A;  3LH0 A;  2GCX A;  1ZSZ A;  5GAN j;  2KY9 A;  4KGX B;  1YCS B;  2DXU A;  5CIU A;  4C92 C;  1W2B P;  4RTV A;  4DBF A;  1JB0 E;  1IGQ A;  3QWX X;  4EIK A;  1KC8 R;  5KYU B;  1YNZ A;  4OMP A;  2QA4 Q;  4XK8 E;  1LCK A;  5CCA A;  3V7C A;  2EQI A;  2CT3 A;  4B9X A;  2OTL A;  4PJO F;  1VQK Q;  3NFC A;  2XHC A;  5LJ5 h;  2DLP A;  5GAN 7;  3CD6 Q;  3PNW C;  4HXJ A;  1M5Q 1;  5I22 A;  1NLO C;  2C0I A;  1Q7Y U;  3EG2 A;  3VUZ A;  3CQT A;  4MZT A;  2E5K A;  1JO8 A;  1RI0 A;  1T0H A;  2QGG A;  3HFN A;  3NGP A;  3LWI A;  1F1B B;  3DLL A;  1Q86 C;  4XAX B;  1K9M R;  3BY7 A;  4RUG A;  5CKF A;  2XK0 A;  3G6E A;  3CXC P;  2DEU A;  2DXB A;  3JCM g;  3ZBD A;  4DEY A;  1VQN T;  1KQ1 A;  3VKI A;  1E6G A;  2A0F B;  2XKO C;  4P5N A;  2ED0 A;  4PJL A;  2YWW A;  1I5O B;  5DM7 R;  1YJN Q;  1ZBJ A;  5GAM g;  2OAW A;  5GAM f;  3I5S A;  2AZS A;  3OYL A;  3AT1 B;  2DZC A;  2LNV A;  2RHU A;  2FEI A;  3EGX A;  2K6D A;  1GFC A;  3C95 A;  4JRP A;  2RQU A;  4IUV A;  1U8R A;  4J6X A;  1RAF B;  2ZPB B;  4KT0 E;  1UHF A;  1T0J A;  3ULR B;  2M16 A;  1TS9 A;  1QP3 A;  1YHQ Q;  2RM4 A;  1RLP C;  2M0O A;  2K9G A;  4IIO A;  3OW2 A;  5GMK l;  1PG5 B;  1Z9Z A;  4XU3 A;  1AT1 B;  1N9S A;  2BE9 B;  2ATC B;  2CP3 A;  1Q7Y R;  2OTL Q;  4PFZ A;  2J05 A;  1Q86 R;  3HPW A;  2O2O A;  5FU7 C;  5FU6 C;  2M1H A;  1U1T A;  2LQN A;  1VA7 A;  2D1X A;  2L8D A;  1MHN A;  3LH5 A;  1VQ5 Q;  1WPY A;  3L42 A;  1WHJ A;  1VQM Q;  4VUB A;  3CEY A;  3QXE B;  4OP0 A;  4XTW A;  3F70 A;  5D6X A;  1XQH A;  3CCU T;  3QHS A;  5HK0 A;  3CCE T;  3UA7 A;  4JS5 A;  3GLX A;  2E3H A;  2RK2 A;  1YIJ A;  2CZ7 B;  1X01 A;  3CCQ A;  3CC7 Q;  2VWF A;  3I56 Q;  4J9E A;  5KYY A;  3BE3 A;  4C8Q B;  4IIM A;  2GNC A;  1ACM B;  1M27 C;  2JXB A;  4M7D A;  3MET A;  4C0G A;  3SFM A;  1BI0 A;  2XDD A;  2HBW A;  4PK4 A;  2LZ6 B;  2HEQ A;  3JCM f;  1TOV A;  4KGZ B;  2JTF A;  2CT4 A;  2K7A A;  4X9C A;  3TSW A;  3AHU A;  4M77 G;  4BUG A;  4HVV A;  1RAG B;  3CC7 T;  2F2X A;  3P8H A;  2VKN A;  2CP7 A;  3KUF A;  2CZ6 B;  3JCM h;  3TQ7 P;  2RHY A;  2EKO A;  1MV3 A;  4HVW A;  1VQO A;  3QUI A;  3JB9 F;  2DAQ A;  3A8M B;  1V29 B;  5GAN 2;  2GF7 A;  2KYM A;  3L2R A;  1N8R R;  1R8O B;  1Z9Q A;  2A36 A;  1K73 R;  2O4X B;  3VS4 A;  1UEB A;  3RKX A;  1JBM A;  1UGQ B;  4MZM A;  1UB4 A;  4DOW A;  3HP9 A;  3CC7 A;  3EG0 A;  2PUK B;  2DFU A;  2XI9 A;  2X35 A;  3M4G A;  1LNX A;  1S72 T;  3RER A;  4FL6 A;  5GAO p;  1WJQ A;  3OB9 A;  2MWO A;  3CCL T;  2CSI A;  2A3L A;  4A4F A;  3CCE A;  2O88 A;  1I07 A;  2EPD A;  3S3O A;  3A98 A;  1JRI A;  2VUB A;  5ECA A;  3CCQ T;  1GCQ C;  3DB4 A;  1WIE A;  4OMM A;  2DTI A;  5KH6 A;  2YT6 A;  3UDC A;  3CCU A;  1ZA1 B;  1KC8 U;  1TUD A;  1N6A A;  4C0D B;  2FPF A;  1NM7 A;  4BB7 A;  4BE2 A;  1JEG A;  4FYV B;  4KUL A;  3CCR A;  2HDA A;  1M2V B;  1H64 1;  2NUT A;  2J06 A;  2JS2 A;  3TEE A;  1GL5 A;  3OY9 A;  4ATO A;  3JCM c;  2A7Y A;  3EHR A;  3SB2 A;  2DRK A;  2LTO A;  3L2Q A;  2KNB B;  2MI6 A;  2RK1 A;  9ATC B;  1Y96 A;  4C5I A;  3QBY A;  4EMK B;  2W0Z A;  1BU1 A;  4GLK A;  4J7F A;  3VRZ A;  4KBM B;  1UG1 A;  2GTJ A;  1QKX A;  4ME7 A;  2O9S A;  4M77 D;  4FSS A;  1OV3 A;  2FPE A;  2JS0 A;  5AT1 B;  2LT4 A;  4LDW A;  5GAN 4;  3QDF A;  2DXC A;  2P0K A;  4Z8A A;  3X25 B;  1BBZ A;  3RBB B;  1QVG A;  2CZ1 B;  4B6M A;  2BZX A;  3DLM A;  4X34 A;  2E3I A;  4FYY B;  4CC7 A;  1B34 A;  3H9N A;  5LJ5 f;  4M77 F;  1NJI U;  1SSH A;  1D0X A;  4J9G A;  4C92 B;  3Q1J A;  1GXI E;  1QKW A;  2RI5 A;  4OMO A;  1H3H A;  4N4G A;  1YI2 Q;  1K73 C;  5GAM j;  5GAN e;  4N4I A;  1TH7 A;  5C6S A;  4ZTJ A;  2GGR A;  1TU0 B;  3PE0 A;  1YIT T;  2D0Q B;  2QG9 B;  4E7K A;  2PU9 B;  3E9G A;  3T9N A;  3I55 Q;  3A1P A;  2X51 A;  4J5Y A;  1X69 A;  4R56 A;  2ESW A;  4Q5W A;  4JZ4 A;  1YJ9 T;  4DBH A;  1VQK T;  4IKF A;  2QAZ A;  2RJF A;  2HL5 C;  4M7D F;  1LJO A;  3KFV A;  2RQV A;  5A2Q E;  3HL8 A;  1GBR A;  1EFN A;  2O9V A;  1VQL Q;  4J9D A;  3CCJ A;  5EC7 A;  4M78 C;  2PZ1 A;  2ENM A;  3UWN A;  3VS0 A;  5CVI A;  2BTT A;  3MJX A;  3DB3 A;  1M4Z A;  4OML A;  3CBP A;  4CC3 A;  4WTO B;  1GCP A;  2I0N A;  1QVG P;  3HTR A;  1NJI R;  2E6N A;  1E7O A;  1RL2 A;  1YHQ T;  3G71 A;  5DY9 A;  4RTZ A;  5LJ3 e;  3OBY A;  2MWP A;  4M7D B;  3RNJ A;  2XDB A;  2MIO A;  3HRS A;  3M57 A;  2DRM A;  1M90 R;  1PD0 A;  1Y07 A;  2R58 A;  1K73 U;  3JV3 A;  1VQK A;  1OPL A;  5GAM h;  1I5L A;  3BDU A;  2Y4X A;  5GJV B;  2KYB A;  1QQJ A;  4Z88 A;  4MZP A;  1EX4 A;  3EFS A;  3CCS A;  3OYK A;  1SF9 A;  4OF1 A;  4MMK A;  1ABQ A;  1VQN Q;  8AT1 B;  3FEO A;  4PJN A;  3VRY A;  1BI3 A;  2DA9 A;  2K5I A;  2OAU A;  4ZGJ B;  1X75 C;  2JTM A;  1LPL A;  2QTX A;  2RPN A;  2EKH A;  2PVD B;  2WSC E;  1EZZ B;  2K5L A;  2EJF A;  4F7U A;  2X4Y A;  1VQM A;  2A08 A;  2IG0 A;  2HMA A;  2QEX T;  2DTH A;  3JB9 D;  1Q86 U;  2G3R A;  1VUB A;  3NMZ C;  2KEA A;  4PFP A;  4PJO E;  2E10 A;  4ANJ A;  2X3X D;  3CXC A;  2EJG A;  3OSV A;  3JCM X;  3I9Q A;  1BIB A;  2J6F A;  2KR3 A;  4AFU C;  2O31 A;  4N0A A;  2KRO A;  4XTV A;  1D3B B;  1N9R A;  5FWB A;  1IRE B;  5LJ5 e;  2YHT A;  2KRS A;  3I55 T;  1UJY A;  1M2O A;  3OYG A;  1SHG A;  2DIQ A;  2RQW A;  1QLY A;  2P4T A;  1TSF A;  3NTK A;  3QO3 A;  4KRT A;  5GAN d;  1MMD A;  4XTX A;  1WYX A;  2C0O A;  1MV0 B;  2GFA A;  5LJ5 d;  2F1L A;  4EMH A;  4QVC A;  4LE9 A;  4J6Y A;  2AT1 B;  4JUV A;  2ZAE A;  4RTT A;  1Y7X A;  5KYW B;  1W6X A;  3P8D A;  2K2M A;  3IQL A;  2H8H A;  1VYT A;  3H0H A;  1M1K R;  1WHH A;  4M7A G;  1VQO T;  1R0B G;  2RHZ A;  1MUZ A;  3G7Z A;  3EG9 A;  1Y71 A;  1Q82 U;  4V2S A;  5KE3 A;  5IXB A;  2YUP A;  1WHL A;  2SRC A;  4BY6 B;  4EMK A;  2D6F A;  5FRO A;  5HY6 A;  2HAX A;  2RNA A;  3NPF A;  4F04 B;  4CRI A;  1KIK A;  1S1N A;  1JJ2 A;  2ZGW A;  1SEM A;  1PNJ A;  2AZV A;  1KD1 U;  4M78 B;  4Y91 A;  4C92 D;  7AT1 B;  3R6O A;  1D09 B;  2NYS A;  4LDU A;  3X24 B;  1D3B A;  3JB9 H;  1MNE A;  1D1B A;  3CC4 A;  4WCI A;  3KBG A;  3HRT A;  3RMS A;  2M9U A;  1FMV A;  3C12 A;  2BZY A;  2LMJ A;  3C4S A;  2CP0 A;  2EYQ A;  2HSP A;  1EIF A;  1Y57 A;  3JB9 G;  5GMK h;  1WDX A;  4A4K A;  4J6W A;  2NUP A;  2K5F A;  4E7H A;  3JCM P;  4QQ6 A;  6AT1 B;  4IUQ A;  4EMG A;  3REA B;  3CCM A;  3E1S A;  3KXT A;  4E47 A;  5IXF A;  2B86 A;  4OB3 B;  1VQN A;  1ABO A;  2KDS A;  4OB2 B;  3CPW S;  5IH2 A;  3S3M A;  1QWF A;  1FXX A;  2E41 A;  2KBT A;  2KT1 A;  2LQ8 A;  5KYX A;  1M1K C;  3GP8 A;  4M78 F;  3GNG A;  1OX9 A;  5LL6 S; 
#chains in the Genus database with same CATH homology
 2CT4 A;  2K7A A;  1X2K A;  3TSW A;  2M0Y A;  4J9C A;  1Y0M A;  2RQR A;  1G83 A;  4HVV A;  2DJQ A;  3EG3 A;  2OJ2 A;  4A63 B;  3ZL7 C;  2F2X A;  2VKN A;  2GBQ A;  1HJD A;  1MV3 A;  2CSQ A;  2CRE A;  4HVW A;  2EBP A;  2KE9 A;  3H41 A;  2DL4 A;  2DYB A;  2KYM A;  4RTU A;  1YP5 A;  2PNI A;  1Z9Q A;  2DVJ A;  2A36 A;  1QCF A;  2DL7 A;  3REB B;  2FPD A;  2P4R A;  3VS4 A;  4LUE A;  1X27 A;  2KXC A;  1CSK A;  3I5R A;  2EVR A;  2ECZ A;  1FMK A;  1UUE A;  4CC4 B;  3EG0 A;  3SHW A;  1PRL C;  1JQQ A;  5IHN A;  1A0N B;  1K9A A;  1H8K A;  2EYW A;  4OMQ A;  2CSI A;  4LUD A;  3VS3 A;  2C0T A;  2O88 A;  4JPB W;  1UE9 A;  1I07 A;  2EPD A;  2VVK A;  2IIM A;  1GRI A;  1OOT A;  3A98 A;  1UGV A;  2DL5 A;  5ECA A;  1GCQ C;  2CUB A;  1RUW A;  1WIE A;  2EGA A;  4OMM A;  1BK2 A;  1K4U S;  1M30 A;  2YT6 A;  2MOX A;  1AVZ C;  1X6G A;  1TUD A;  5IHK A;  2FPF A;  1NM7 A;  1UJ0 A;  4X1V A;  2AKK A;  2MCN A;  1JEG A;  1BB9 A;  2CH4 A;  2NUZ A;  2ABL A;  2HDA A;  2J06 A;  2JS2 A;  1GL5 A;  1AWX A;  3EHR A;  2L2P A;  2DRK A;  2CDT A;  2SEM A;  1JXO A;  2KNB B;  2J7I A;  1JXM A;  4JJC A;  1PKS A;  1TG0 A;  2JM8 A;  1UFF A;  2J6K A;  2KGT A;  1ZSG A;  2W0Z A;  4J9B A;  1BU1 A;  3TSZ A;  4GLM A;  3M0R A;  3VRZ A;  1N5Z A;  1TUC A;  1YWP A;  1UG1 A;  2GTJ A;  2DX1 A;  1QKX A;  2O9S A;  4FSS A;  2LJ0 A;  1AZG B;  4ESR A;  2D0N A;  1OV3 A;  3EGU A;  4LN2 A;  1I0C A;  3FJ5 A;  2A37 A;  2FPE A;  2JS0 A;  1E6H A;  5HCK A;  3M0T A;  1ZUY A;  2FO0 A;  4Z8A A;  1BBZ A;  1ZUU A;  2CUD A;  4ZNX A;  3RBB B;  1PKT A;  1YWO A;  2BZX A;  1ARK A;  1UHC A;  2JW4 A;  2A28 A;  2CH4 W;  4Z89 A;  2QDL A;  4CC7 A;  1NG2 A;  2L3S A;  2YUQ A;  3M0Q A;  2YUN A;  2YUO A;  1SSH A;  4J9I A;  2DBK A;  4J9G A;  4RTX A;  1SRM A;  4CC2 A;  4F17 A;  1AOJ A;  1V1C A;  1QKW A;  2D8H A;  1ZLM A;  4OMO A;  1H3H A;  2KRM A;  1X43 A;  2BZ8 A;  2DMO A;  1AEY A;  1UTI A;  4JJD A;  4AFS C;  4E6R A;  3THK A;  1UEC A;  2DBM A;  2GGR A;  3PE0 A;  1M8M A;  2LJ3 A;  1FYN A;  1T3S A;  1UDL A;  2EYY A;  3QWY A;  2X3W D;  1J3T A;  3UA6 A;  1M3B A;  2OI3 A;  1X69 A;  4AFZ C;  2JM9 A;  2ESW A;  4JZ4 A;  1ZX6 A;  2EGC A;  4HCK A;  1M3C A;  2ROL A;  1PRM C;  1NEB A;  1WA7 A;  3KFV A;  2RQV A;  4JZ3 A;  3VS5 A;  1GBR A;  4Y92 A;  1EFN A;  3PVQ A;  2YDL A;  1K76 A;  2O9V A;  4D8K A;  4J9D A;  2FG0 A;  5EC7 A;  3U23 A;  1JU5 C;  2PZ1 A;  1U06 A;  1CKB A;  1X2Q A;  5GJW B;  2ENM A;  1W1F A;  3R6N A;  2DL8 A;  3VS0 A;  2HCK A;  1OEB A;  2BTT A;  4LNP A;  2DL3 A;  2LQW A;  4OML A;  2LCS A;  4F16 A;  4CC3 A;  1T3L A;  1GCP A;  2I0N A;  1QWE A;  2RN8 A;  1NEG A;  1RI9 A;  3O5Z A;  4ORZ A;  4AG2 C;  1I1J A;  2EW3 A;  1GBQ A;  2LJ1 A;  2NWM A;  4GBQ A;  1E7O A;  3NHN A;  3EG1 A;  1M3A A;  4RTZ A;  1GCQ A;  2FRW A;  2JMA A;  3RNJ A;  4D8D A;  1NYG A;  2DE0 X;  2MIO A;  2PTK A;  4R0K A;  2DRM A;  1WFW A;  2W10 A;  1AWJ A;  2AKL A;  3JV3 A;  1OPL A;  1H92 A;  3VS2 A;  2KXD A;  3M0S A;  5GJV B;  2RQT A;  2JMC A;  2KYB A;  5FWC A;  2LP5 A;  1W70 A;  4Z88 A;  1KSW A;  2F2W A;  4RTW A;  2G6F X;  2FRY A;  2L0A A;  1K0X A;  1PHT A;  1ABQ A;  1CKA A;  1HD3 A;  4RTY A;  1PWT A;  4OMN A;  1XOV A;  2LX7 A;  3VRY A;  2DA9 A;  2J6O A;  3I35 A;  5I11 A;  5FW9 A;  2RPN A;  2EKH A;  2YSQ A;  2ROT A;  2AK5 A;  3EHQ A;  2L3P A;  1YCS B;  4RTV A;  2A08 A;  3QWX X;  2JT4 A;  4EIK A;  3NMZ C;  2K79 A;  1YNZ A;  1U3O A;  2KEA A;  2KRN A;  4OMP A;  1LCK A;  2X3X D;  3M0P A;  1HSQ A;  2EQI A;  1KFZ A;  1WLP B;  2CT3 A;  2V1R A;  1AD5 A;  3I9Q A;  3VS6 A;  1YN8 A;  2J6F A;  2KR3 A;  4AFU C;  2O31 A;  1GFD A;  1SRL A;  2KRO A;  1AWW A;  2DLP A;  5FWB A;  3GBQ A;  4HXJ A;  5I22 A;  1NLO C;  2C0I A;  2KRS A;  3EG2 A;  1UJY A;  3CQT A;  1VYU A;  1SHG A;  2E5K A;  2GTO A;  3UF4 A;  1JO8 A;  1T0H A;  2RQW A;  1WXT A;  1QLY A;  1ZUK A;  3NGP A;  1X6B A;  4KRT A;  4RUG A;  1WYX A;  2C0O A;  1MV0 B;  3TVT A;  1B3Q A;  1WXU A;  1WXB A;  4LE9 A;  2L3Q A;  4AFQ C;  3M0U A;  4J9F A;  4RTT A;  3VS7 A;  4DEY A;  3UAT A;  2V1Q A;  2XMF A;  1W6X A;  1E6G A;  2DM1 A;  2K2M A;  3PVL A;  5L23 A;  3IQL A;  4J9H A;  2H8H A;  1VYT A;  3H0H A;  2ED0 A;  1MUZ A;  2ED1 A;  1ZBJ A;  2D8J A;  2OAW A;  2K3B A;  1K0S A;  4DEX A;  3I5S A;  3SEM A;  2AZS A;  5IXB A;  2YUP A;  2FEI A;  2K6D A;  1GFC A;  2SRC A;  3H0F A;  2RQU A;  1NYF A;  1UHF A;  2M51 A;  4HVU A;  1T0J A;  2RNA A;  3ULR B;  3NPF A;  1WI7 A;  2EGE A;  4F14 A;  2DNU A;  1VYV A;  1RLP C;  4IIO A;  2K9G A;  1KIK A;  2DF6 A;  1S1N A;  1Z9Z A;  1SEM A;  1PNJ A;  2AZV A;  3H0I A;  1IO6 A;  1RLQ C;  2EYX A;  2LNH B;  1OPK A;  2J05 A;  1U5S A;  2KT8 A;  3VS1 A;  2O2O A;  2RMO A;  4M4Z A;  2LQN A;  1VA7 A;  2D1X A;  4WCI A;  3LH5 A;  1G2B A;  2DIL A;  2BZY A;  1AWO A;  2LMJ A;  2HSP A;  4JJB A;  1K1Z A;  1Y57 A;  4QT7 A;  1AZE A;  1WDX A;  4K11 A;  3UA7 A;  2JTE A;  5IHI A;  2F2V A;  2EYZ A;  3REA B;  1B07 A;  2RF0 A;  2VWF A;  4J9E A;  1SPK A;  5IXF A;  2B86 A;  1KJW A;  1NLP C;  4IIM A;  1ABO A;  2GNC A;  3C0C A;  5IH2 A;  1M27 C;  1WX6 A;  2JXB A;  2KBT A;  1QWF A;  1SHF A;  2KT1 A;  4AG1 C;  2HBW A;  2LZ6 B;  2HEQ A;  2GQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...