2J05A

Crystal structure of the rasgap sh3 domain at 1.5 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
SHMRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signal transduction
molecule keywords RAS GTPASE-ACTIVATING PROTEIN 1
publication title High Resolution Crystal Structures of the P120 Rasgap SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j05A00
4LE9A 2EYZA 2JS0A 2V1RA 1SRLA 1KJWA 1GFDA 2KE9A 4DEYA 1VYUA 2CDTA 2EBPA 3NMZC 4Y92A 1KFZA 2K3BA 1YN8A 2KR3A 2KGTA 1M30A 1WYXA 2FG0A 3H0HA 1TUDA 1H3HA 4OMPA 2FO0A 1FMKA 1S1NA 2RQRA 4F17A 2AZSA 1CSKA 1GRIA 1ZUUA 2YT6A 1KIKA 2AKLA 1X6BA 4RTZA 1PHTA 1PWTA 4RTXA 2MCNA 3ULRB 4X1VA 1UECA 1T3LA 1V1CA 2C0IA 2EVRA 2RQWA 1Z9QA 2CH4W 2DE0X 1MV0B 2X3WD 2D0NA 1AVZC 2PTKA 4M4ZA 4CC4B 4AFZC 1PRLC 2YUNA 1AWOA 1VA7A 3H0FA 5I22A 2CREA 3PVQA 2KYMA 2EQIA 2DA9A 1W1FA 1WA7A 1WXUA 4QT7A 1RLQC 1ZUKA 1QWEA 3RNJA 1PKTA 2F2VA 1PRMC 3EG2A 2YSQA 3VS0A 4CC7A 1PKSA 3I5RA 1PNJA 1E6HA 1NLOC 1X2KA 1B07A 2BZ8A 2DMOA 5FWCA 3SEMA 5ECAA 4DEXA 2ABLA 1UHFA 4JZ4A 1GCQA 2F2XA 5L23A 3EHQA 1SHFA 2DVJA 3QWYA 1ZSGA 2AZVA 1QWFA 1H8KA 4RTUA 1M3AA 2ED1A 2DILA 1M8MA 2LQNA 1ZX6A 3TVTA 4AG2C 1WFWA 3VS2A 1K4US 3ZL7C 3CQTA 2DYBA 1ABOA 2K2MA 1JO8A 2JM9A 2GTOA 2KRNA 1GBRA 1A0NB 3RBBB 1G2BA 5FWBA 2J06A 2DL5A 2JT4A 1ZUYA 3UF4A 1I07A 4Z88A 5EC7A 3I35A 4GLMA 2HSPA 2ROLA 4HVUA 1UG1A 2JW4A 2MIOA 4J9BA 2DL7A 2O9SA 1B3QA 1QKXA 4WCIA 2GNCA 3EHRA 4JZ3A 1NEGA 2IIMA 1FYNA 1QCFA 2K6DA 1M3BA 2B86A 2K9GA 1QKWA 1NG2A 2BZYA 2KT1A 1NYGA 4EIKA 2RF0A 3VRZA 4A63B 4ORZA 2RMOA 2KYBA 4FSSA 5HCKA 1AD5A 2G6FX 2W0ZA 2HDAA 1UHCA 3LH5A 5I11A 1IO6A 1W70A 2KRMA 1M27C 2J6FA 3EGUA 1OPKA 2EW3A 2OAWA 1VYVA 4AFUC 1Z9ZA 2L3SA 1NEBA 2KXCA 2FEIA 2VKNA 1SRMA 3UATA 2DL4A 4OMMA 1X43A 3PVLA 2YUQA 2KNBB 1MV3A 4JJBA 2GTJA 4ZNXA 4OMQA 2CSQA 5GJWB 4JPBW 2JS2A 4OMNA 4AFSC 2K79A 2D8HA 5IHKA 3VRYA 3THKA 3PE0A 3NGPA 3VS7A 1WXTA 1E7OA 1SSHA 4K11A 2OI3A 2W10A 4Z89A 2JMCA 2ESWA 4IIOA 2AKKA 1T0HA 2EGEA 2PZ1A 1UE9A 1NM7A 1HD3A 2SEMA 1UJ0A 3NHNA 1SPKA 1SEMA 3VS4A 4HVWA 3REBB 1ABQA 2CT3A 3M0TA 1RUWA 1GCQC 1VYTA 1K1ZA 2GQIA 2MOXA 5IXBA 4J9FA 1UDLA 2X3XD 2O88A 2DLPA 1RI9A 1GFCA 1WI7A 2RPNA 2E5KA 2VVKA 2A28A 2RQUA 1UGVA 2YUPA 4KRTA 1JXOA 2CUDA 2KT8A 3KFVA 1X69A 4LUDA 2NUZA 1OOTA 2DM1A 2YUOA 1N5ZA 3I9QA 2A37A 2EYYA 2FPFA 2P4RA 2KRSA 2I0NA 1EFNA 3TSWA 1WXBA 2FRWA 1JU5C 1BBZA 3VS1A 1I1JA 1UJYA 1AWJA 2EYXA 2YDLA 4J9DA 2JMAA 2L3PA 4HVVA 5IHIA 1RLPC 1X2QA 4J9EA 4HCKA 5FW9A 1HSQA 4D8KA 2H8HA 3H41A 3M0UA 2O9VA 2F2WA 4RTYA 1CKBA 3IQLA 2KROA 2LZ6B 3C0CA 1G83A 1WX6A 2LX7A 1Y0MA 2D8JA 1WIEA 2DNUA 2DL8A 2RQVA 1U3OA 4Z8AA 3QWXX 1MUZA 2M51A 2LNHB 3NPFA 3EG3A 1AOJA 1T3SA 1X27A 2L0AA 2LCSA 3VS3A 1UFFA 1YNZA 2KEAA 2A08A 2ED0A 2A36A 1K0XA 2RQTA 2HEQA 4AG1C 4CC2A 1YWOA 1ZLMA 4RTVA 3H0IA 2J7IA 1J3TA 2NWMA 2C0OA 4J9IA 2DF6A 1TUCA 2AK5A 3M0PA 1AEYA 3M0SA 1YCSB 2EPDA 3TSZA 2O31A 3SHWA 2DX1A 2RNAA 2O2OA 3EG1A 2EKHA 2LJ3A 1LCKA 1WDXA 1CKAA 2LMJA 4R0KA 3A98A 1JXMA 4J9GA 1W6XA 4J9HA 3O5ZA 2LJ0A 1GCPA 2JTEA 4LNPA 5GJVB 1UUEA 3REAB 2HCKA 2ECZA 2SRCA 4RUGA 4J9CA 2PNIA 2CSIA 2ENMA 3EG0A 5IH2A 1AWXA 2CUBA 2DBKA 1HJDA 2DJQA 4JJDA 2J05A 1TG0A 1M3CA 1BU1A 2DRMA 2LP5A 4AFQC 1JQQA 1U06A 2DRKA 2QDLA 2D1XA 1T0JA 4CC3A 1NYFA 1AZEA 2J6OA 2BTTA 4LUEA 4F14A 3UA6A 5IXFA 1AWWA 4ESRA 2GGRA 3M0QA 2M0YA 2OJ2A 1JEGA 2DBMA 4OMOA 4GBQA 1YP5A 2JXBA 1OV3A 1GL5A 1YWPA 3FJ5A 1U5SA 1KSWA 2VWFA 1WLPB 1Y57A 2XMFA 1BB9A 2L3QA 2LQWA 2V1QA 2KBTA 2C0TA 1UTIA 1ARKA 4JJCA 1K0SA 4RTWA 1AZGB 2FRYA 1OEBA 2EYWA 3UA7A 1SHGA 3U23A 2FPEA 1OPLA 1K9AA 1H92A 2GBQA 3GBQA 1XOVA 4E6RA 1GBQA 2RN8A 4OMLA 2JM8A 2HBWA 2CT4A 5IHNA 2L2PA 4LN2A 1BK2A 2K7AA 4RTTA 4IIMA 2BZXA 2EGCA 3VS5A 1ZBJA 1NLPC 2CH4A 2KXDA 2LJ1A 2ROTA 1QLYA 4D8DA 4HXJA 1K76A 4F16A 3I5SA 3JV3A 2DL3A 3R6NA 1X6GA 2J6KA 3M0RA 1I0CA 2EGAA 3VS6A 2FPDA 1E6GA
chains in the Genus database with same CATH superfamily
5GAN2 4LE9A 2CP5A 5A0GA 4AT1B 2E3IA 2QG9B 3CCET 1Q86R 3L2ZA 1GFDA 1Q82C 2DAQA 2LNVA 3OYIA 1VYUA 3EGXA 2HQEA 4J7FA 1KFZA 3V8KA 2CP7A 4PKCC 1YJNT 4RMOA 2D9TA 2CKKA 1M30A 4NL3A 2FG0A 2DKGA 5GAMf 2IG0A 2FO0A 3HL8A 1S1NA 2K5IA 2RQRA 1K9MC 2AZSA 2YT6A 1RL2A 4M7DF 2ZGWA 1YCYA 3CCJT 5CVIA 1X01A 5GAMd 3CC7A 4X1VA 1UECA 1VIEA 4XTXA 5CR2A 1KHCA 1Z9QA 5HKCA 2DE0X 1MV0B 2X3WD 2PVOB 1S72A 2CGHA 1VQ8A 1B34B 3BDLA 5I22A 2EJGA 3PVQA 2KYMA 1VQMT 1EZZB 4HCBA 4XTUA 1W1FA 1PCXA 1RLQC 4A4FA 1ZUKA 3RNJA 1PKTA 2DVEA 1TS9A 1KC8C 4ZTFA 4GY5A 1PNJA 5KYNA 2X9HA 2ABLA 1VIFA 2M02A 4A54A 3EHQA 2EYQA 1ZSGA 2DXTA 3I56A 2PVGB 4AG2C 5DLQE 3SWNC 1R0BG 3QSUA 2NUPA 2VGMA 3CQTA 1QMCA 1JO8A 3CBOA 2RH2A 3BE3A 1G2BA 2P0PA 5FWBA 2JT4A 3UF4A 2PUOB 1IGUA 2DERA 3QO3A 3JCMf 3L2QA 1N9SA 4PLIA 2ROLA 3V7CA 1UG1A 2MIOA 4C8QD 4M7AA 2DL7A 1QKXA 4WCIA 2GNCA 4LDUA 1NEGA 5KYYB 3GLXA 1QCFA 2ZZDA 4C92F 2L89A 2Z0WA 2COWA 2K9GA 3CXCA 1QKWA 1NG2A 2BZYA 2FB7A 2KT1A 3JCMd 3JB9F 4QVZA 4C92G 3PIPA 4EIKA 2RF0A 4M7DE 4ORZA 1YHQA 2G6FX 1Q86C 2HDAA 2HQHA 3LH5A 2QK0A 1YITT 2R58A 1M1FA 3I55T 2VC8A 4AFUC 3S6WA 2QTXA 1Z9ZA 1NEBA 1YI2Q 1X6OA 5LL6S 2KXCA 2F5TX 1H3ZA 1D1CA 2GFAA 2YUQA 4HCZA 2KNBB 5GMKm 1FXXA 3EH1A 3FC3A 4M7DB 2O01E 2CSQA 4JPBW 4FYVB 2D8HA 1Y71A 3JCMP 1VQ9A 3JAME 3THKA 1G5VA 2E3HA 4IUQA 5CKHA 1SSHA 5GAOq 2DZ9A 3KBGA 3L2WA 2BIVA 3PIOA 2PZ1A 1JJ2S 4FT4A 3C12A 1BI1A 1UE9A 1RAFB 4XTZA 2RHXA 3KUFA 1UJ0A 3CC7T 3M54A 3VS4A 3GIBA 1KQ1A 2CT3A 2QA4A 1VYTA 3EGDB 2GQIA 2VXEA 2YLBA 3GNGA 3CMAQ 3JCMW 4J9FA 1P92A 1S72T 4C92E 2O88A 2FZKB 1RI9A 1VQ8T 3QPHA 2E5KA 3R6OA 2VVKA 2P4TA 4PK4A 1G3WA 2RQUA 1TWBA 2K5FA 1JXOA 2KT8A 3KFVA 1UB4A 4M78F 2ZCFB 4XTYA 3QYGB 2XD0A 2C06A 2EKOA 2NUZA 1OOTA 2DM1A 2YUOA 1MMAA 1NBEB 2QGGA 4M78G 4O5VA 2O4XA 4GLKA 3ASKA 1ZSZB 5KYXB 1WQWA 2DETA 1JU5C 2MWOA 4FW1A 4C92B 1RABB 4KT0E 4HVVA 3OYAA 1RLPC 4J9EA 3HPWA 3I56T 1K73C 1HYOA 3H41A 2O9VA 4RTYA 1VQ6Q 3IQLA 2KROA 5GAOn 3A8HB 3MO8A 1WX6A 4F7UF 1WHJA 1UGQB 2RQVA 1WIEA 1YBYA 2DL8A 3OYYA 5DM7R 3MEAA 4C5EA 1MUZA 1H641 3HRUA 2LNHB 3NPFA 1SG5A 1YIJA 3MJXA 4M7DC 1VQ7Q 1TH7A 1WHGA 2XU8A 4C8QA 3QDRB 3OYCA 1YHQT 1RI0A 2R57A 3H0IA 4BI3A 2J7IA 2E6NA 3PTAA 2C0OA 4J9IA 3CCSQ 2DF6A 2RO0A 3M0PA 3A8LB 2XK0A 3JRZA 3E9GA 3EG9B 4C8QG 1YCSB 2EPDA 2MAMA 4IKFA 4PJMA 4C0DB 2LQKA 4AMCA 1M2VA 3SHWA 2EKHA 1K8AU 1RAAB 2RK1A 1XQHA 3J81E 1JXMA 4XU2A 4J9GA 4M78E 1U1SA 1OYXA 2LJ0A 1NZ9A 2ECZA 5M9OA 4OMFB 2DD4A 1VQKA 2ENMA 4JJDA 1VQ9T 2J05A 4Z02A 4OVAA 2QDLA 1AZEA 2LTOA 4LUEA 3GF5A 5KH6A 4F14A 1AWWA 4ESRA 4M78B 5FLXE 4GBQA 4E7SA 3PGGA 1ZSZC 3FJ5A 5CO7A 4FM4B 1HXDA 4XQ3A 2EFIA 4F7UE 4HCCA 2VWFA 2MYSA 2XMFA 1Q82U 2QA4T 3FB9A 1W2BS 2KBTA 2LQ8A 5IAYA 2LCLA 1K8AR 3NFCA 2MMPA 2GBQA 3OYBA 3CCQQ 2RN8A 3CCUA 4MMLA 5LJ5g 1QQJA 3C94A 1BK2A 2K7AA 2YRDA 5GANg 3VKIA 4IIMA 4R55A 4F7UB 3M55A 4M7DD 4FW2A 1NLPC 4OF1A 1M1GA 1QLYA 4M75F 3PT9A 3MCAB 3QZ5B 4ELYC 2DIGA 2DL3A 2COZA 5I2SA 2DO3A 4BD3A 2JS0A 3GNFB 5GMKh 2V1RA 1SRLA 1KJWA 3CMAA 2ATCB 1YJWA 2E12A 2QI2A 2RI3A 4DOWA 4J6XA 3UT1A 1KC8U 2K3BA 4C0FA 1YN8A 2KR3A 2L5QA 4A53A 4JRIA 3G71Q 2RB6A 5LJ3h 4C0ZA 1TUDA 1TOVA 1YIJT 5KE3A 1VQMA 3M57A 4FIBA 1VQNQ 1FMKA 2RD1A 1GRIA 1KIKA 2AKLA 1X6BA 3CMEA 1PWTA 1VQOA 4C5GA 3ULRB 1KQ2A 1Q7YR 5CAIA 2EJFA 4V2SA 4N0AC 4BI4A 3FLGA 3WVDB 4FL6A 2MPXC 5DY9A 3NTKA 4LDVA 1B34A 2YUNA 1FX7A 1VA7A 1X75C 4OB0B 2EWNA 4O6JA 3META 4HT8A 2DA9A 1HK9A 1MMDA 4PJOC 1TUGB 2YLCA 2GFUA 4QT7A 4C92D 3MKDA 3PMIA 1YJ9Q 1QWEA 3JB9D 2LVMA 1EX4A 4J8OA 3VS0A 1VQKT 1PKSA 1JJ2P 5GAMe 1Q86U 1E6HA 2OAUA 1X2KA 2BZ8A 3SEMA 4DEXA 4M75E 4PFZA 4JZ4A 2CP0A 3OQ5A 5HY6A 1SHFA 1K8AC 3MEUA 3RKXA 1VQLQ 4PL6A 2CS7A 3BW1A 3VJPA 2BE9B 1QWFA 3N5BB 3JB9H 1M3AA 2DILA 3LWHA 3TVTA 1WFWA 3JCMJ 3ME9A 1ABOA 1WZOA 3LW5E 1WJSA 3QIIA 1ZUYA 3SWNB 1FMVA 4GLMA 3M53A 5LJ5h 2OTLQ 2VGNA 2P0QA 4J9BA 4M75B 5KYYA 3OS1A 3S3MA 2V8KA 5GANh 1ZA1B 2VUBA 1FYNA 3VV0A 2VXFA 1QP3A 3CC4Q 1NYGA 3DLMA 2FZCB 2EQKA 4ZTJA 3CCMA 3VRZA 4WF2A 4FSSA 2CZ6B 1AD5A 1MMGA 5FU7C 3CCUT 2JZ2A 3CD6Q 1UHCA 3OYGA 2RI5A 4XU3A 8ATCB 2QAZA 1W70A 1M27C 1I5LA 3CCRQ 2HZYA 2CZ7B 2E64A 3V8LA 4FSXA 4DBFA 2X4WA 1BIAA 3KXTA 5IT9E 2VKNA 3FEOA 4KUIA 2DL4A 2RK2A 1OQKA 1OU9A 4M7DA 4E7IA 3RUXA 1MV3A 4JJBA 3JCMe 5GAOr 1YFNA 2JVVA 4OMNA 2K79A 1Q7YC 1I4K1 1W4SA 3RESA 4NS5A 1U8RA 2D0QB 3CMAT 2DIQA 4M78D 1YJWT 4M7DG 4QQGA 3VS7A 3NGPA 2QQBA 5LJ3f 4K11A 4Z89A 2JMCA 4PJOD 2ESWA 4PJNA 2AKKA 4P5NA 1T0HA 3CCVA 1OU8A 3H8ZA 2NUTB 1HD3A 3CMET 3RR6A 2SEMA 1PC0A 2RHUA 1D1AA 1SPKA 3EGDA 1VQOT 3QDFA 1RUWA 3QXEB 3M9QA 2MOXA 4UC4A 2H3JA 5IXBA 1TTHB 5GAMj 1UGRB 4EMHA 3OYHA 4FYYB 2A28A 2CUDA 3OS2A 3C95A 4EPCA 1MHNA 8AT1B 3DB4A 4LUDA 1W2BA 4Q5WA 3G6EQ 2A3LA 4M75C 4DA4A 1N5ZA 1ZSZA 5KYXA 1Y7XA 3G4SA 2I0NA 4C92A 3TSWA 5GMKi 1PSFA 2FRWA 3HRTA 4KUDK 4ATOA 6AT1B 1ZQ1A 3Q1JA 1O75A 4FT2A 3M4YA 2XIDA 5J26A 1W2BP 2JMAA 2L3PA 4EMKB 4HCKA 5FW9A 3TCJA 4D8KA 2K3XA 1CKBA 1VQ5A 9ATCB 2P0KA 1JBMA 3JB9G 5LJ5f 2D6FA 2LZ6B 1M4ZA 1D3BB 3JCMb 5GANf 1G83A 4J6YA 3RKWA 3NTHA 1U3OA 4Z8AA 3V7RA 1QCOA 4M7AF 4BY6C 2OTJA 5GANd 1ACMB 1VQ4A 2L0AA 1OZ2A 3OS0A 3VS3A 2EQMA 1AHJB 1SKUB 2A08A 2ED0A 2A36A 5A0LA 1K0XA 3CCMT 2QEXA 4R56A 4QQ6A 1YWOA 5IN1A 1F1BB 1KQSS 2XDBA 2Y4YA 3EG9A 4DBQA 1TUCA 2G3RA 4Y91A 1AEYA 4JS4A 4X9CA 4IURA 2KI7A 4FYXB 2WSEE 1XJWB 2O31A 2RNAA 2O2OA 3PFSA 3CPWS 2LJ3A 1OULA 1RAEB 1WDXA 2KVQG 1CKAA 2LMJA 2NLUA 3O5ZA 5GJVB 2MF2A 1UUEA 3FIFA 4RUGA 4J9CA 2CSIA 5IH2A 1AWXA 1G8XA 3V8JA 2DJQA 1G3YA 4N0AA 4M77F 4FCYA 3MEWA 1U06A 2DRKA 4OB3B 1VQPA 4L5GA 5FU6B 4M78A 3HFNA 4QW2A 3E1SA 4M75D 3MPUB 3X20B 3UA6A 5IXFA 3CCVT 2GGRA 3HHTB 4PFOA 5EG2A 2DBMA 4OMOA 3OYFA 2JXBA 1OV3A 3CCJQ 3PNWC 4KGZB 4XAXB 1GXIE 4LDYA 4B6MA 4XTWA 2PVDB 2L3QA 2V1QA 4PJOF 1K0SA 2COYA 1ARKA 4EMKC 4RKUE 1AZGB 3DKMA 2DEUA 4ZGJB 2DYIA 4PJOG 3JSCA 1OPLA 3CPFA 1H92A 1D0XA 1XOVA 4E6RA 2A0FB 1LNXA 2K2VA 2E6ZA 2JM8A 2HBWA 2XDPA 2M16A 1RAIB 2FHDA 5GAOp 3AHUA 4F7UA 3LYIA 2BZXA 5GAN5 4IUTA 4PJLA 1KHIA 3S3NA 2B8AA 2DTHA 3G4ST 2FZGB 3RMQA 2M1HA 4HXJA 1K76A 5C0MA 4F16A 3ER0A 3I5SA 3JV3A 4F7UG 1X6GA 1RACB 3M0RA 2EYZA 2F1LA 3GOXA 4J7IA 1IXDA 4BUGA 4E47A 4J5YA 4KH1B 1PD1A 2LT4A 4J83A 1VQ5T 1NPPA 3MP1A 2KE9A 4DEYA 4M77E 3NMZC 3A8MB 1R0CB 3P8BB 4EMGA 3VYGA 3PMTA 3OSVA 5LJ3g 1M90R 1WYXA 4N4IA 1H3HA 2DTOA 5KCHA 4OMPA 2OTJT 1VQ4T 3M59A 4LD6A 3J7AF 4F17A 4FU6A 5D7UA 1BCMA 1B7TA 1PHTA 1N8RR 1XNIA 3OYMA 4RTXA 2QEXT 2VYTA 4N4GA 2DD5A 2CP6A 4BDZA 3HP9A 4M77B 1D0ZA 2C0IA 2EVRA 4PJOE 2RQWA 1YITQ 1VQLT 2R5AA 4CI0C 3I55Q 1AVZC 5FU6C 2PTKA 3TREA 4CC4B 2KAFA 1AWOA 5I21A 3H0FA 2CREA 4JJNK 1QP2A 1G3SA 3E9FA 2EQUA 4RG8A 2EQIA 3LGFA 2BE7D 1WXUA 2RHYA 4N4HA 2DXCA 2K3YA 1PRMC 1BI2A 2E1HA 2DMOA 5FWCA 3L2UA 4PJOB 5ECAA 3WVEB 3GP8A 2KY9A 1YI2A 3VUZA 1LJOA 5L23A 1M2OA 2QQAA 1KD1R 3QWYA 1PG5B 1IGQA 1H8KA 4ZN3A 2F5KA 1KK7A 1VQPT 1M8MA 4A4KA 2LDMA 2RHZA 2EIFA 3VS2A 4BI8B 3ZL7C 1K4US 2K2MA 3ZBDA 2JM9A 2GTOA 2KRNA 3SWNA 1A0NB 2XI9A 4XU0A 4DQ2A 2J06A 2IVWA 4L6V5 4M75A 4M7AC 1I07A 4Z88A 2HAXA 4B9XA 3CC7Q 1WJQA 3V7SA 1Q7YU 4BE1A 2O9SA 5GAN4 1UGPB 3EHRA 4NOYA 3ZEHA 1S72Q 2K6DA 5D6XA 1M3BA 2B86A 1AT1B 4JRQA 1VQ8Q 4M75G 1OX8A 2NYSA 2DZCA 2KYBA 5HCKA 3CXCS 4J6WA 1PSEA 4DBRA 4C5HA 1I81A 1IO6A 2X4YA 2KRMA 3EGUA 1OPKA 2OAWA 5FU7B 3EFRA 3L2RA 3RIRA 1M90C 2L3SA 4X34A 2XG8D 4VUBA 2XICA 3FJPA 5A2QE 1SRMA 1KQSA 4OMMA 2XDDA 3X26B 2QXFA 3PVLA 2LC4A 3I56Q 2GTJA 4QVCA 4ZNXA 4M77C 1N8RC 2WSCE 5AT1B 5GJWB 3RDVA 3EFOB 2JS2A 4DOVA 1SSFA 4AFSC 5IHKA 2KQWA 3P8HA 3OA6A 3CPWA 3VRYA 1NE8A 4KGVB 1KQSP 1E7OA 2GQVA 2JN0A 2OI3A 2W10A 1QVFS 2PU9B 3A8OB 3HTRA 2HNIA 1JJ2A 4YTLA 2NUTA 3M58A 1VQ6A 3G1JA 3JB9J 3L42A 3CPWP 1NM7A 1WPYA 2BKDN 5DLOA 3UDCA 2AT1B 3MEVA 3NHNA 1YHQQ 3HKSA 2HKQB 1SEMA 3D7SB 4HVWA 1ABQA 1GCQC 5GMKe 3X25B 1QW1A 1IHVA 3CBMA 2QQSA 5GAN6 2X51A 1UDLA 1VQ7A 2X3XD 1KD1C 1RAGB 2I2LA 2GCXA 2YXYA 3JCMQ 2RPNA 3ZFJA 1BYMA 1Y96B 4HKEA 4KRTA 4M7AD 3OBWA 5LJ3e 2CZ0B 2EAYA 1X69A 3H9NA 4JLGA 3CCSA 1MGQA 2QTVA 3I9QA 4E7HA 2FPFA 2KRSA 4JRPA 1VQ9Q 1EFNA 4IUPA 1YI2T 3DB3A 1UJYA 4EMKA 2H3EB 5FRNA 2OX7A 4J9DA 1X2QA 1HSQA 4CRIA 2H8HA 1JB0E 1D3BA 1OI1A 3L1AA 1IHWA 3RKYA 2L3RA 2MI6A 3SFMA 4EDUA 3MHXA 4E7ZA 2DJZA 2R5MA 2E10A 5CQXA 3A5ZB 2LX7A 3X28B 1OX9A 1Y0MA 2D8JA 2QA4Q 3OB9A 4KGXB 4M77D 4II1A 2VV5A 2ZPFB 1T3SA 1X27A 2JUFA 3VU3C 4C5IA 2LCSA 1YNZA 2KEAA 2QQ9A 1M1KU 3OY9A 4BY6B 2RQTA 2HEQA 2ZPGB 3WXMB 4CC2A 4RTVA 2E41A 2RA2A 1UGSB 3OYLA 3MP6A 3M0SA 5L8RE 1WJRA 3G7ZA 2DX1A 3EG1A 1QVGS 2LX9A 5LJ5e 4NL2A 3CCQA 2IPOB 5GANe 4R0KA 2E65A 3A98A 1XTDA 1WHMA 5LJ3d 4E7JA 2JTEA 3DLLA 4LNPA 5HK3A 2HCKA 5GAOl 2PNIA 5KYUB 1C6VX 2CUBA 1BKBA 5CKBA 1IRXA 2V26A 2JTMA 4OP0A 3VYHB 1M3CA 1RADB 3LX7A 2LP5A 1JQQA 4HT9A 2D1XA 4XTVA 1D0YA 2WACA 2E5QA 2RI2A 2BTTA 4MMKA 4QQDA 4L59A 1MMNA 4PFPA 5GMKj 1YIJQ 1M1KR 1EIFA 2DPPB 4RG2A 3J80E 1VQ6T 2L8DA 3M0QA 3OYEA 2M0YA 2OJ2A 5A0DA 4XU1A 4JLIA 1JEGA 1RAHB 1YP5A 1GL5A 2ZPHB 1YWPA 1U5SA 2FYKA 3T9NA 2JNGA 1R8OB 1WLPB 1Y57A 2HD0A 3G71A 4JS5A 5LJ3j 2LQWA 2C0TA 4JJCA 3M5AA 4RTWA 2FRYA 1M8VA 2ZPEB 4IUVA 3LLRA 1VQNA 1VQ7T 1K9AA 2KDSA 4E7KA 1SF9A 2RJDA 2BUDA 3BY7A 1GBQA 1Q81U 4OMLA 2KMTA 4BACA 3CCLQ 3UPUA 2LT1A 1BI3A 2CT4A 1FWZA 2L2PA 1QVPA 3CCST 3NTIA 2Y4XA 4QKUA 4RTTA 2EGCA 1VQKQ 1D1BA 1ZBJA 2KXDA 2CH4A 4OB1B 1MNEA 2LJ1A 2ROTA 5CKFA 5KYWB 2HQXA 3HRSA 4E2FB 4JDSA 3LH0A 1VOMA 5LJ5d 1N9RA 2J6KA 1I0CA 4CC3A 3VS6A 4M7AG 1TSFA 1YJ9A 4KH0B 3QUIA 1G3TA 4JRKA 2F69A 2MWPA 5CKEA 3CC2Q 2CDTA 1MNDA 2EBPA 3RMSA 4Y92A 3CXCP 3EGXB 1VQLA 2RHIA 2KGTA 3H0HA 1FMWA 1WGSA 1Q81R 2CZ1B 2EQJA 1CSKA 1ZUUA 3EH2A 3BDUA 4RTZA 3QJYA 2MCNA 4M77A 3CCUQ 5LJ5j 2YWWA 5C6SA 3CCEQ 2OTLA 1QVFA 1ZHIA 1T3LA 1V1CA 5GANj 2JJ9A 2CH4W 3A1PA 3TQ7P 2RM4A 1OZ3A 2D0NA 4M4ZA 4AFZC 1PRLC 1YJNQ 1BCOA 4M77G 1V76A 3GPLA 3CC4A 3CCQT 5GAN3 1M1KC 4LDXA 1QVFP 4BB7A 3CD6A 3CEYA 5D6WA 1WA7A 2QQRA 2X35A 3QG1A 4A4HA 2F2VA 3CCRA 4ANJA 2VB6A 4PJOA 3EG2A 2YSQA 4CC7A 3X24B 3I5RA 2HSEB 1NLOC 1B07A 1YJWQ 1UHFA 1GCQA 2MK5A 2F2XA 3S3OA 3LWIA 1I8FA 2DVJA 4M7AE 2RJEA 5I2MA 3EFSA 3C4SA 2AZVA 1M90U 4RTUA 2ED1A 7AT1B 2LQNA 1ZX6A 3LGLA 5D6YA 1VQMQ 2DYBA 3HSBA 3SB2A 3OYKA 4KULA 2PUKB 1GBRA 2NUPB 3QKJA 3RBBB 2RJCA 3CMEQ 2DL5A 1VQOQ 2DK3A 1N8RU 5EC7A 3I35A 5J3BA 2HSPA 5CK9A 3OW2S 3G71T 4HVUA 2JW4A 4MZTA 2X4XA 1B3QA 4JZ3A 2IIMA 4M7AB 1VQNT 4C0GA 3QBYA 5GAOm 4A63B 4B9WA 2KK4A 2RMOA 3E19A 2W0ZA 2K4YA 2DTIA 5I11A 4ME7A 3JCMV 2J6FA 4FYWB 5CKDA 2HL5C 2EW3A 1WHLA 1Y07A 1VYVA 4A4GA 1U1TA 2FEIA 4LDWA 3UATA 5GAMg 2HKNA 2AHJB 1Q81C 3QHSA 3A8GB 4OGCA 3JCMX 1KD1U 1X43A 3TU4K 4XK8E 1N27A 3EFOA 3RERA 3G6EA 1YJ9T 4OMQA 4JUVA 3E2UA 4C8QF 4WTOB 3JB9I 1QVGA 2ZPIB 2EJ9A 4A4EA 3PE0A 1WHKA 1WXTA 1V29B 1ZA2B 3F70A 2E70A 3VUBA 1WQ7A 4IIOA 2CYZB 3CCLA 1C0MA 3QJ6A 1NPRA 3OYDA 2EGEA 1QVGP 2XHCA 3O8VA 2CP3A 3QZ9B 3CCMQ 4F04B 3M4GA 1PM3A 3FDRA 3REBB 2M0OA 2AIRB 5HK0A 2OTLT 3M0TA 1K1ZA 4Y28E 5CCAA 4ELZC 1DJ7B 1I5OB 2DLPA 1Y96A 1GFCA 1WI7A 1NJIU 3CC4T 3SDZA 1UGVA 2YUPA 3CC2A 2K5LA 4MDWA 1ZBXA 1K73U 3CD6T 2FVUA 1BI0A 2PQWA 3L2VA 2FL7A 4IUUA 3CCRT 4C92C 2A37A 2EYYA 2P4RA 3JCMg 1JRIA 1WXBA 2O4XB 1M9SA 2HBPA 3TEEA 1BBZA 3VS1A 2M9UA 1I1JA 4ZN1A 2XKOC 1AWJA 3OS5A 4BE0A 2EYXA 1QCNA 2YDLA 5IHIA 1R77A 2VASA 3CCEA 2KSSA 1K9MU 3M0UA 2F2WA 3CCVQ 4C8QE 3EAEA 3UWNA 3OYNA 1IZ6A 3C0CA 1IREB 1YJNA 4X9DA 3OMGA 4PJJA 1TXQA 4BE2A 1LPLA 5GAN8 2DEQA 4MDXA 2DNUA 3QWXX 2DFUA 2M51A 2QDYB 1NJIR 2RJFA 3EG3A 5AYFA 1AOJA 1LOJA 2QYZA 4BDYA 2V8JA 1K73R 1UFFA 1O9SA 5GAMh 2Y90A 3CCJA 4RCCA 4C8QB 2K57A 3HFOA 4AG1C 2ZPBB 1ZLMA 1Q82R 4LXCA 2QASA 4C0DC 1VUBA 2WSFE 1J3TA 2NWMA 5GAN7 3CBPA 2AK5A 2E4HA 5FROA 3SD4A 3OYJA 3G4SQ 3TSZA 4TVRA 2V8IA 5J39A 1LCKA 1PD0A 1M2VB 1K9MR 1W6XA 4J9HA 3AT1B 1GCPA 1UEBA 4MZMA 5KYUA 3REAB 2X4JA 3G6ET 2SRCA 3BFMA 3URGA 4ZGEB 3INZA 3EG0A 2DBKA 1VQ5Q 1HJDA 1TG0A 5CQYA 2JOYA 4PLLA 4QVDA 1BU1A 2DRMA 4AFQC 5FRMA 4OGEA 4DBHA 1D09B 4M78C 1T0JA 1N6AA 1NYFA 2YHTA 1WNLA 2J6OA 4MZPA 3JCMc 4RCBA 1C1AA 3CCLT 2OTJQ 1Q95G 1VQ4Q 2LRQA 4KBMB 4LD9K 2CP2A 2A7YA 2YRVA 5GMKl 2QEXQ 1KC8R 2HL3A 1KSWA 2LCCA 3H6ZA 1KG1A 1BB9A 4D6WA 1UTIA 3FRNA 1IB8A 4OB2B 1M5Q1 1OEBA 1WHHA 2EYWA 1SHGA 3UA7A 4ZGDB 3JCMh 3U23A 2FPEA 5KE2A 3MP8A 2P84A 3GBQA 3OMCA 3OSSC 3CC2T 4E7LA 2YRCA 3OW2A 1BIBA 5IHNA 5KCOA 2DXUA 4LN2A 1YITA 5KYWA 2GF7A 3I55A 3OBYA 3VS5A 2DXBA 2JTFA 3M56A 4D8DA 4PNOA 1TU0B 1NJIC 2HMAA 1LVKA 3QYHB 3R6NA 3OW2P 5CIUA 4C8QC 4HA8A 2QGFB 1VQPQ 2EGAA 3P8DA 2FPDA 2ZAEA 1E6GA
chains in the Genus database with same CATH topology
4LE9A 2EYZA 2JS0A 2V1RA 1SRLA 1KJWA 1GFDA 2KE9A 4DEYA 1VYUA 2CDTA 2EBPA 3NMZC 4Y92A 1KFZA 2K3BA 1YN8A 2KR3A 2KGTA 1M30A 1WYXA 2FG0A 3H0HA 1TUDA 1H3HA 4OMPA 2FO0A 1FMKA 1S1NA 2RQRA 4F17A 2AZSA 1CSKA 1GRIA 1ZUUA 2YT6A 1KIKA 2AKLA 1X6BA 4RTZA 1PHTA 1PWTA 4RTXA 2MCNA 3ULRB 4X1VA 1UECA 1T3LA 1V1CA 2C0IA 2EVRA 2RQWA 1Z9QA 2CH4W 2DE0X 1MV0B 2X3WD 2D0NA 1AVZC 2PTKA 4M4ZA 4CC4B 4AFZC 1PRLC 2YUNA 1AWOA 1VA7A 3H0FA 5I22A 2CREA 3PVQA 2KYMA 2EQIA 2DA9A 1W1FA 1WA7A 1WXUA 4QT7A 1RLQC 1ZUKA 1QWEA 3RNJA 1PKTA 2F2VA 1PRMC 3EG2A 2YSQA 3VS0A 4CC7A 1PKSA 3I5RA 1PNJA 1E6HA 1NLOC 1X2KA 1B07A 2BZ8A 2DMOA 5FWCA 3SEMA 5ECAA 4DEXA 2ABLA 1UHFA 4JZ4A 1GCQA 2F2XA 5L23A 3EHQA 1SHFA 2DVJA 3QWYA 1ZSGA 2AZVA 1QWFA 1H8KA 4RTUA 1M3AA 2ED1A 2DILA 1M8MA 2LQNA 1ZX6A 3TVTA 4AG2C 1WFWA 3VS2A 1K4US 3ZL7C 3CQTA 2DYBA 1ABOA 2K2MA 1JO8A 2JM9A 2GTOA 2KRNA 1GBRA 1A0NB 3RBBB 1G2BA 5FWBA 2J06A 2DL5A 2JT4A 1ZUYA 3UF4A 1I07A 4Z88A 5EC7A 3I35A 4GLMA 2HSPA 2ROLA 4HVUA 1UG1A 2JW4A 2MIOA 4J9BA 2DL7A 2O9SA 1B3QA 1QKXA 4WCIA 2GNCA 3EHRA 4JZ3A 1NEGA 2IIMA 1FYNA 1QCFA 2K6DA 1M3BA 2B86A 2K9GA 1QKWA 1NG2A 2BZYA 2KT1A 1NYGA 4EIKA 2RF0A 3VRZA 4A63B 4ORZA 2RMOA 2KYBA 4FSSA 5HCKA 1AD5A 2G6FX 2W0ZA 2HDAA 1UHCA 3LH5A 5I11A 1IO6A 1W70A 2KRMA 1M27C 2J6FA 3EGUA 1OPKA 2EW3A 2OAWA 1VYVA 4AFUC 1Z9ZA 2L3SA 1NEBA 2KXCA 2FEIA 2VKNA 1SRMA 3UATA 2DL4A 4OMMA 1X43A 3PVLA 2YUQA 2KNBB 1MV3A 4JJBA 2GTJA 4ZNXA 4OMQA 2CSQA 5GJWB 4JPBW 2JS2A 4OMNA 4AFSC 2K79A 2D8HA 5IHKA 3VRYA 3THKA 3PE0A 3NGPA 3VS7A 1WXTA 1E7OA 1SSHA 4K11A 2OI3A 2W10A 4Z89A 2JMCA 2ESWA 4IIOA 2AKKA 1T0HA 2EGEA 2PZ1A 1UE9A 1NM7A 1HD3A 2SEMA 1UJ0A 3NHNA 1SPKA 1SEMA 3VS4A 4HVWA 3REBB 1ABQA 2CT3A 3M0TA 1RUWA 1GCQC 1VYTA 1K1ZA 2GQIA 2MOXA 5IXBA 4J9FA 1UDLA 2X3XD 2O88A 2DLPA 1RI9A 1GFCA 1WI7A 2RPNA 2E5KA 2VVKA 2A28A 2RQUA 1UGVA 2YUPA 4KRTA 1JXOA 2CUDA 2KT8A 3KFVA 1X69A 4LUDA 2NUZA 1OOTA 2DM1A 2YUOA 1N5ZA 3I9QA 2A37A 2EYYA 2FPFA 2P4RA 2KRSA 2I0NA 1EFNA 3TSWA 1WXBA 2FRWA 1JU5C 1BBZA 3VS1A 1I1JA 1UJYA 1AWJA 2EYXA 2YDLA 4J9DA 2JMAA 2L3PA 4HVVA 5IHIA 1RLPC 1X2QA 4J9EA 4HCKA 5FW9A 1HSQA 4D8KA 2H8HA 3H41A 3M0UA 2O9VA 2F2WA 4RTYA 1CKBA 3IQLA 2KROA 2LZ6B 3C0CA 1G83A 1WX6A 2LX7A 1Y0MA 2D8JA 1WIEA 2DNUA 2DL8A 2RQVA 1U3OA 4Z8AA 3QWXX 1MUZA 2M51A 2LNHB 3NPFA 3EG3A 1AOJA 1T3SA 1X27A 2L0AA 2LCSA 3VS3A 1UFFA 1YNZA 2KEAA 2A08A 2ED0A 2A36A 1K0XA 2RQTA 2HEQA 4AG1C 4CC2A 1YWOA 1ZLMA 4RTVA 3H0IA 2J7IA 1J3TA 2NWMA 2C0OA 4J9IA 2DF6A 1TUCA 2AK5A 3M0PA 1AEYA 3M0SA 1YCSB 2EPDA 3TSZA 2O31A 3SHWA 2DX1A 2RNAA 2O2OA 3EG1A 2EKHA 2LJ3A 1LCKA 1WDXA 1CKAA 2LMJA 4R0KA 3A98A 1JXMA 4J9GA 1W6XA 4J9HA 3O5ZA 2LJ0A 1GCPA 2JTEA 4LNPA 5GJVB 1UUEA 3REAB 2HCKA 2ECZA 2SRCA 4RUGA 4J9CA 2PNIA 2CSIA 2ENMA 3EG0A 5IH2A 1AWXA 2CUBA 2DBKA 1HJDA 2DJQA 4JJDA 2J05A 1TG0A 1M3CA 1BU1A 2DRMA 2LP5A 4AFQC 1JQQA 1U06A 2DRKA 2QDLA 2D1XA 1T0JA 4CC3A 1NYFA 1AZEA 2J6OA 2BTTA 4LUEA 4F14A 3UA6A 5IXFA 1AWWA 4ESRA 2GGRA 3M0QA 2M0YA 2OJ2A 1JEGA 2DBMA 4OMOA 4GBQA 1YP5A 2JXBA 1OV3A 1GL5A 1YWPA 3FJ5A 1U5SA 1KSWA 2VWFA 1WLPB 1Y57A 2XMFA 1BB9A 2L3QA 2LQWA 2V1QA 2KBTA 2C0TA 1UTIA 1ARKA 4JJCA 1K0SA 4RTWA 1AZGB 2FRYA 1OEBA 2EYWA 3UA7A 1SHGA 3U23A 2FPEA 1OPLA 1K9AA 1H92A 2GBQA 3GBQA 1XOVA 4E6RA 1GBQA 2RN8A 4OMLA 2JM8A 2HBWA 2CT4A 5IHNA 2L2PA 4LN2A 1BK2A 2K7AA 4RTTA 4IIMA 2BZXA 2EGCA 3VS5A 1ZBJA 1NLPC 2CH4A 2KXDA 2LJ1A 2ROTA 1QLYA 4D8DA 4HXJA 1K76A 4F16A 3I5SA 3JV3A 2DL3A 3R6NA 1X6GA 2J6KA 3M0RA 1I0CA 2EGAA 3VS6A 2FPDA 1E6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LE9 A;  2EYZ A;  2JS0 A;  2V1R A;  1SRL A;  1KJW A;  1GFD A;  2KE9 A;  4DEY A;  1VYU A;  2CDT A;  2EBP A;  3NMZ C;  4Y92 A;  1KFZ A;  2K3B A;  1YN8 A;  2KR3 A;  2KGT A;  1M30 A;  1WYX A;  2FG0 A;  3H0H A;  1TUD A;  1H3H A;  4OMP A;  2FO0 A;  1FMK A;  1S1N A;  2RQR A;  4F17 A;  2AZS A;  1CSK A;  1GRI A;  1ZUU A;  2YT6 A;  1KIK A;  2AKL A;  1X6B A;  4RTZ A;  1PHT A;  1PWT A;  4RTX A;  2MCN A;  3ULR B;  4X1V A;  1UEC A;  1T3L A;  1V1C A;  2C0I A;  2EVR A;  2RQW A;  1Z9Q A;  2CH4 W;  2DE0 X;  1MV0 B;  2X3W D;  2D0N A;  1AVZ C;  2PTK A;  4M4Z A;  4CC4 B;  4AFZ C;  1PRL C;  2YUN A;  1AWO A;  1VA7 A;  3H0F A;  5I22 A;  2CRE A;  3PVQ A;  2KYM A;  2EQI A;  2DA9 A;  1W1F A;  1WA7 A;  1WXU A;  4QT7 A;  1RLQ C;  1ZUK A;  1QWE A;  3RNJ A;  1PKT A;  2F2V A;  1PRM C;  3EG2 A;  2YSQ A;  3VS0 A;  4CC7 A;  1PKS A;  3I5R A;  1PNJ A;  1E6H A;  1NLO C;  1X2K A;  1B07 A;  2BZ8 A;  2DMO A;  5FWC A;  3SEM A;  5ECA A;  4DEX A;  2ABL A;  1UHF A;  4JZ4 A;  1GCQ A;  2F2X A;  5L23 A;  3EHQ A;  1SHF A;  2DVJ A;  3QWY A;  1ZSG A;  2AZV A;  1QWF A;  1H8K A;  4RTU A;  1M3A A;  2ED1 A;  2DIL A;  1M8M A;  2LQN A;  1ZX6 A;  3TVT A;  4AG2 C;  1WFW A;  3VS2 A;  1K4U S;  3ZL7 C;  3CQT A;  2DYB A;  1ABO A;  2K2M A;  1JO8 A;  2JM9 A;  2GTO A;  2KRN A;  1GBR A;  1A0N B;  3RBB B;  1G2B A;  5FWB A;  2J06 A;  2DL5 A;  2JT4 A;  1ZUY A;  3UF4 A;  1I07 A;  4Z88 A;  5EC7 A;  3I35 A;  4GLM A;  2HSP A;  2ROL A;  4HVU A;  1UG1 A;  2JW4 A;  2MIO A;  4J9B A;  2DL7 A;  2O9S A;  1B3Q A;  1QKX A;  4WCI A;  2GNC A;  3EHR A;  4JZ3 A;  1NEG A;  2IIM A;  1FYN A;  1QCF A;  2K6D A;  1M3B A;  2B86 A;  2K9G A;  1QKW A;  1NG2 A;  2BZY A;  2KT1 A;  1NYG A;  4EIK A;  2RF0 A;  3VRZ A;  4A63 B;  4ORZ A;  2RMO A;  2KYB A;  4FSS A;  5HCK A;  1AD5 A;  2G6F X;  2W0Z A;  2HDA A;  1UHC A;  3LH5 A;  5I11 A;  1IO6 A;  1W70 A;  2KRM A;  1M27 C;  2J6F A;  3EGU A;  1OPK A;  2EW3 A;  2OAW A;  1VYV A;  4AFU C;  1Z9Z A;  2L3S A;  1NEB A;  2KXC A;  2FEI A;  2VKN A;  1SRM A;  3UAT A;  2DL4 A;  4OMM A;  1X43 A;  3PVL A;  2YUQ A;  2KNB B;  1MV3 A;  4JJB A;  2GTJ A;  4ZNX A;  4OMQ A;  2CSQ A;  5GJW B;  4JPB W;  2JS2 A;  4OMN A;  4AFS C;  2K79 A;  2D8H A;  5IHK A;  3VRY A;  3THK A;  3PE0 A;  3NGP A;  3VS7 A;  1WXT A;  1E7O A;  1SSH A;  4K11 A;  2OI3 A;  2W10 A;  4Z89 A;  2JMC A;  2ESW A;  4IIO A;  2AKK A;  1T0H A;  2EGE A;  2PZ1 A;  1UE9 A;  1NM7 A;  1HD3 A;  2SEM A;  1UJ0 A;  3NHN A;  1SPK A;  1SEM A;  3VS4 A;  4HVW A;  3REB B;  1ABQ A;  2CT3 A;  3M0T A;  1RUW A;  1GCQ C;  1VYT A;  1K1Z A;  2GQI A;  2MOX A;  5IXB A;  4J9F A;  1UDL A;  2X3X D;  2O88 A;  2DLP A;  1RI9 A;  1GFC A;  1WI7 A;  2RPN A;  2E5K A;  2VVK A;  2A28 A;  2RQU A;  1UGV A;  2YUP A;  4KRT A;  1JXO A;  2CUD A;  2KT8 A;  3KFV A;  1X69 A;  4LUD A;  2NUZ A;  1OOT A;  2DM1 A;  2YUO A;  1N5Z A;  3I9Q A;  2A37 A;  2EYY A;  2FPF A;  2P4R A;  2KRS A;  2I0N A;  1EFN A;  3TSW A;  1WXB A;  2FRW A;  1JU5 C;  1BBZ A;  3VS1 A;  1I1J A;  1UJY A;  1AWJ A;  2EYX A;  2YDL A;  4J9D A;  2JMA A;  2L3P A;  4HVV A;  5IHI A;  1RLP C;  1X2Q A;  4J9E A;  4HCK A;  5FW9 A;  1HSQ A;  4D8K A;  2H8H A;  3H41 A;  3M0U A;  2O9V A;  2F2W A;  4RTY A;  1CKB A;  3IQL A;  2KRO A;  2LZ6 B;  3C0C A;  1G83 A;  1WX6 A;  2LX7 A;  1Y0M A;  2D8J A;  1WIE A;  2DNU A;  2DL8 A;  2RQV A;  1U3O A;  4Z8A A;  3QWX X;  1MUZ A;  2M51 A;  2LNH B;  3NPF A;  3EG3 A;  1AOJ A;  1T3S A;  1X27 A;  2L0A A;  2LCS A;  3VS3 A;  1UFF A;  1YNZ A;  2KEA A;  2A08 A;  2ED0 A;  2A36 A;  1K0X A;  2RQT A;  2HEQ A;  4AG1 C;  4CC2 A;  1YWO A;  1ZLM A;  4RTV A;  3H0I A;  2J7I A;  1J3T A;  2NWM A;  2C0O A;  4J9I A;  2DF6 A;  1TUC A;  2AK5 A;  3M0P A;  1AEY A;  3M0S A;  1YCS B;  2EPD A;  3TSZ A;  2O31 A;  3SHW A;  2DX1 A;  2RNA A;  2O2O A;  3EG1 A;  2EKH A;  2LJ3 A;  1LCK A;  1WDX A;  1CKA A;  2LMJ A;  4R0K A;  3A98 A;  1JXM A;  4J9G A;  1W6X A;  4J9H A;  3O5Z A;  2LJ0 A;  1GCP A;  2JTE A;  4LNP A;  5GJV B;  1UUE A;  3REA B;  2HCK A;  2ECZ A;  2SRC A;  4RUG A;  4J9C A;  2PNI A;  2CSI A;  2ENM A;  3EG0 A;  5IH2 A;  1AWX A;  2CUB A;  2DBK A;  1HJD A;  2DJQ A;  4JJD A;  2J05 A;  1TG0 A;  1M3C A;  1BU1 A;  2DRM A;  2LP5 A;  4AFQ C;  1JQQ A;  1U06 A;  2DRK A;  2QDL A;  2D1X A;  1T0J A;  4CC3 A;  1NYF A;  1AZE A;  2J6O A;  2BTT A;  4LUE A;  4F14 A;  3UA6 A;  5IXF A;  1AWW A;  4ESR A;  2GGR A;  3M0Q A;  2M0Y A;  2OJ2 A;  1JEG A;  2DBM A;  4OMO A;  4GBQ A;  1YP5 A;  2JXB A;  1OV3 A;  1GL5 A;  1YWP A;  3FJ5 A;  1U5S A;  1KSW A;  2VWF A;  1WLP B;  1Y57 A;  2XMF A;  1BB9 A;  2L3Q A;  2LQW A;  2V1Q A;  2KBT A;  2C0T A;  1UTI A;  1ARK A;  4JJC A;  1K0S A;  4RTW A;  1AZG B;  2FRY A;  1OEB A;  2EYW A;  3UA7 A;  1SHG A;  3U23 A;  2FPE A;  1OPL A;  1K9A A;  1H92 A;  2GBQ A;  3GBQ A;  1XOV A;  4E6R A;  1GBQ A;  2RN8 A;  4OML A;  2JM8 A;  2HBW A;  2CT4 A;  5IHN A;  2L2P A;  4LN2 A;  1BK2 A;  2K7A A;  4RTT A;  4IIM A;  2BZX A;  2EGC A;  3VS5 A;  1ZBJ A;  1NLP C;  2CH4 A;  2KXD A;  2LJ1 A;  2ROT A;  1QLY A;  4D8D A;  4HXJ A;  1K76 A;  4F16 A;  3I5S A;  3JV3 A;  2DL3 A;  3R6N A;  1X6G A;  2J6K A;  3M0R A;  1I0C A;  2EGA A;  3VS6 A;  2FPD A;  1E6G A; 
#chains in the Genus database with same CATH topology
 5GAN 2;  4LE9 A;  2CP5 A;  5A0G A;  4AT1 B;  2E3I A;  2QG9 B;  3CCE T;  1Q86 R;  3L2Z A;  1GFD A;  1Q82 C;  2DAQ A;  2LNV A;  3OYI A;  1VYU A;  3EGX A;  2HQE A;  4J7F A;  1KFZ A;  3V8K A;  2CP7 A;  4PKC C;  1YJN T;  4RMO A;  2D9T A;  2CKK A;  1M30 A;  4NL3 A;  2FG0 A;  2DKG A;  5GAM f;  2IG0 A;  2FO0 A;  3HL8 A;  1S1N A;  2K5I A;  2RQR A;  1K9M C;  2AZS A;  2YT6 A;  1RL2 A;  4M7D F;  2ZGW A;  1YCY A;  3CCJ T;  5CVI A;  1X01 A;  5GAM d;  3CC7 A;  4X1V A;  1UEC A;  1VIE A;  4XTX A;  5CR2 A;  1KHC A;  1Z9Q A;  5HKC A;  2DE0 X;  1MV0 B;  2X3W D;  2PVO B;  1S72 A;  2CGH A;  1VQ8 A;  1B34 B;  3BDL A;  5I22 A;  2EJG A;  3PVQ A;  2KYM A;  1VQM T;  1EZZ B;  4HCB A;  4XTU A;  1W1F A;  1PCX A;  1RLQ C;  4A4F A;  1ZUK A;  3RNJ A;  1PKT A;  2DVE A;  1TS9 A;  1KC8 C;  4ZTF A;  4GY5 A;  1PNJ A;  5KYN A;  2X9H A;  2ABL A;  1VIF A;  2M02 A;  4A54 A;  3EHQ A;  2EYQ A;  1ZSG A;  2DXT A;  3I56 A;  2PVG B;  4AG2 C;  5DLQ E;  3SWN C;  1R0B G;  3QSU A;  2NUP A;  2VGM A;  3CQT A;  1QMC A;  1JO8 A;  3CBO A;  2RH2 A;  3BE3 A;  1G2B A;  2P0P A;  5FWB A;  2JT4 A;  3UF4 A;  2PUO B;  1IGU A;  2DER A;  3QO3 A;  3JCM f;  3L2Q A;  1N9S A;  4PLI A;  2ROL A;  3V7C A;  1UG1 A;  2MIO A;  4C8Q D;  4M7A A;  2DL7 A;  1QKX A;  4WCI A;  2GNC A;  4LDU A;  1NEG A;  5KYY B;  3GLX A;  1QCF A;  2ZZD A;  4C92 F;  2L89 A;  2Z0W A;  2COW A;  2K9G A;  3CXC A;  1QKW A;  1NG2 A;  2BZY A;  2FB7 A;  2KT1 A;  3JCM d;  3JB9 F;  4QVZ A;  4C92 G;  3PIP A;  4EIK A;  2RF0 A;  4M7D E;  4ORZ A;  1YHQ A;  2G6F X;  1Q86 C;  2HDA A;  2HQH A;  3LH5 A;  2QK0 A;  1YIT T;  2R58 A;  1M1F A;  3I55 T;  2VC8 A;  4AFU C;  3S6W A;  2QTX A;  1Z9Z A;  1NEB A;  1YI2 Q;  1X6O A;  5LL6 S;  2KXC A;  2F5T X;  1H3Z A;  1D1C A;  2GFA A;  2YUQ A;  4HCZ A;  2KNB B;  5GMK m;  1FXX A;  3EH1 A;  3FC3 A;  4M7D B;  2O01 E;  2CSQ A;  4JPB W;  4FYV B;  2D8H A;  1Y71 A;  3JCM P;  1VQ9 A;  3JAM E;  3THK A;  1G5V A;  2E3H A;  4IUQ A;  5CKH A;  1SSH A;  5GAO q;  2DZ9 A;  3KBG A;  3L2W A;  2BIV A;  3PIO A;  2PZ1 A;  1JJ2 S;  4FT4 A;  3C12 A;  1BI1 A;  1UE9 A;  1RAF B;  4XTZ A;  2RHX A;  3KUF A;  1UJ0 A;  3CC7 T;  3M54 A;  3VS4 A;  3GIB A;  1KQ1 A;  2CT3 A;  2QA4 A;  1VYT A;  3EGD B;  2GQI A;  2VXE A;  2YLB A;  3GNG A;  3CMA Q;  3JCM W;  4J9F A;  1P92 A;  1S72 T;  4C92 E;  2O88 A;  2FZK B;  1RI9 A;  1VQ8 T;  3QPH A;  2E5K A;  3R6O A;  2VVK A;  2P4T A;  4PK4 A;  1G3W A;  2RQU A;  1TWB A;  2K5F A;  1JXO A;  2KT8 A;  3KFV A;  1UB4 A;  4M78 F;  2ZCF B;  4XTY A;  3QYG B;  2XD0 A;  2C06 A;  2EKO A;  2NUZ A;  1OOT A;  2DM1 A;  2YUO A;  1MMA A;  1NBE B;  2QGG A;  4M78 G;  4O5V A;  2O4X A;  4GLK A;  3ASK A;  1ZSZ B;  5KYX B;  1WQW A;  2DET A;  1JU5 C;  2MWO A;  4FW1 A;  4C92 B;  1RAB B;  4KT0 E;  4HVV A;  3OYA A;  1RLP C;  4J9E A;  3HPW A;  3I56 T;  1K73 C;  1HYO A;  3H41 A;  2O9V A;  4RTY A;  1VQ6 Q;  3IQL A;  2KRO A;  5GAO n;  3A8H B;  3MO8 A;  1WX6 A;  4F7U F;  1WHJ A;  1UGQ B;  2RQV A;  1WIE A;  1YBY A;  2DL8 A;  3OYY A;  5DM7 R;  3MEA A;  4C5E A;  1MUZ A;  1H64 1;  3HRU A;  2LNH B;  3NPF A;  1SG5 A;  1YIJ A;  3MJX A;  4M7D C;  1VQ7 Q;  1TH7 A;  1WHG A;  2XU8 A;  4C8Q A;  3QDR B;  3OYC A;  1YHQ T;  1RI0 A;  2R57 A;  3H0I A;  4BI3 A;  2J7I A;  2E6N A;  3PTA A;  2C0O A;  4J9I A;  3CCS Q;  2DF6 A;  2RO0 A;  3M0P A;  3A8L B;  2XK0 A;  3JRZ A;  3E9G A;  3EG9 B;  4C8Q G;  1YCS B;  2EPD A;  2MAM A;  4IKF A;  4PJM A;  4C0D B;  2LQK A;  4AMC A;  1M2V A;  3SHW A;  2EKH A;  1K8A U;  1RAA B;  2RK1 A;  1XQH A;  3J81 E;  1JXM A;  4XU2 A;  4J9G A;  4M78 E;  1U1S A;  1OYX A;  2LJ0 A;  1NZ9 A;  2ECZ A;  5M9O A;  4OMF B;  2DD4 A;  1VQK A;  2ENM A;  4JJD A;  1VQ9 T;  2J05 A;  4Z02 A;  4OVA A;  2QDL A;  1AZE A;  2LTO A;  4LUE A;  3GF5 A;  5KH6 A;  4F14 A;  1AWW A;  4ESR A;  4M78 B;  5FLX E;  4GBQ A;  4E7S A;  3PGG A;  1ZSZ C;  3FJ5 A;  5CO7 A;  4FM4 B;  1HXD A;  4XQ3 A;  2EFI A;  4F7U E;  4HCC A;  2VWF A;  2MYS A;  2XMF A;  1Q82 U;  2QA4 T;  3FB9 A;  1W2B S;  2KBT A;  2LQ8 A;  5IAY A;  2LCL A;  1K8A R;  3NFC A;  2MMP A;  2GBQ A;  3OYB A;  3CCQ Q;  2RN8 A;  3CCU A;  4MML A;  5LJ5 g;  1QQJ A;  3C94 A;  1BK2 A;  2K7A A;  2YRD A;  5GAN g;  3VKI A;  4IIM A;  4R55 A;  4F7U B;  3M55 A;  4M7D D;  4FW2 A;  1NLP C;  4OF1 A;  1M1G A;  1QLY A;  4M75 F;  3PT9 A;  3MCA B;  3QZ5 B;  4ELY C;  2DIG A;  2DL3 A;  2COZ A;  5I2S A;  2DO3 A;  4BD3 A;  2JS0 A;  3GNF B;  5GMK h;  2V1R A;  1SRL A;  1KJW A;  3CMA A;  2ATC B;  1YJW A;  2E12 A;  2QI2 A;  2RI3 A;  4DOW A;  4J6X A;  3UT1 A;  1KC8 U;  2K3B A;  4C0F A;  1YN8 A;  2KR3 A;  2L5Q A;  4A53 A;  4JRI A;  3G71 Q;  2RB6 A;  5LJ3 h;  4C0Z A;  1TUD A;  1TOV A;  1YIJ T;  5KE3 A;  1VQM A;  3M57 A;  4FIB A;  1VQN Q;  1FMK A;  2RD1 A;  1GRI A;  1KIK A;  2AKL A;  1X6B A;  3CME A;  1PWT A;  1VQO A;  4C5G A;  3ULR B;  1KQ2 A;  1Q7Y R;  5CAI A;  2EJF A;  4V2S A;  4N0A C;  4BI4 A;  3FLG A;  3WVD B;  4FL6 A;  2MPX C;  5DY9 A;  3NTK A;  4LDV A;  1B34 A;  2YUN A;  1FX7 A;  1VA7 A;  1X75 C;  4OB0 B;  2EWN A;  4O6J A;  3MET A;  4HT8 A;  2DA9 A;  1HK9 A;  1MMD A;  4PJO C;  1TUG B;  2YLC A;  2GFU A;  4QT7 A;  4C92 D;  3MKD A;  3PMI A;  1YJ9 Q;  1QWE A;  3JB9 D;  2LVM A;  1EX4 A;  4J8O A;  3VS0 A;  1VQK T;  1PKS A;  1JJ2 P;  5GAM e;  1Q86 U;  1E6H A;  2OAU A;  1X2K A;  2BZ8 A;  3SEM A;  4DEX A;  4M75 E;  4PFZ A;  4JZ4 A;  2CP0 A;  3OQ5 A;  5HY6 A;  1SHF A;  1K8A C;  3MEU A;  3RKX A;  1VQL Q;  4PL6 A;  2CS7 A;  3BW1 A;  3VJP A;  2BE9 B;  1QWF A;  3N5B B;  3JB9 H;  1M3A A;  2DIL A;  3LWH A;  3TVT A;  1WFW A;  3JCM J;  3ME9 A;  1ABO A;  1WZO A;  3LW5 E;  1WJS A;  3QII A;  1ZUY A;  3SWN B;  1FMV A;  4GLM A;  3M53 A;  5LJ5 h;  2OTL Q;  2VGN A;  2P0Q A;  4J9B A;  4M75 B;  5KYY A;  3OS1 A;  3S3M A;  2V8K A;  5GAN h;  1ZA1 B;  2VUB A;  1FYN A;  3VV0 A;  2VXF A;  1QP3 A;  3CC4 Q;  1NYG A;  3DLM A;  2FZC B;  2EQK A;  4ZTJ A;  3CCM A;  3VRZ A;  4WF2 A;  4FSS A;  2CZ6 B;  1AD5 A;  1MMG A;  5FU7 C;  3CCU T;  2JZ2 A;  3CD6 Q;  1UHC A;  3OYG A;  2RI5 A;  4XU3 A;  8ATC B;  2QAZ A;  1W70 A;  1M27 C;  1I5L A;  3CCR Q;  2HZY A;  2CZ7 B;  2E64 A;  3V8L A;  4FSX A;  4DBF A;  2X4W A;  1BIA A;  3KXT A;  5IT9 E;  2VKN A;  3FEO A;  4KUI A;  2DL4 A;  2RK2 A;  1OQK A;  1OU9 A;  4M7D A;  4E7I A;  3RUX A;  1MV3 A;  4JJB A;  3JCM e;  5GAO r;  1YFN A;  2JVV A;  4OMN A;  2K79 A;  1Q7Y C;  1I4K 1;  1W4S A;  3RES A;  4NS5 A;  1U8R A;  2D0Q B;  3CMA T;  2DIQ A;  4M78 D;  1YJW T;  4M7D G;  4QQG A;  3VS7 A;  3NGP A;  2QQB A;  5LJ3 f;  4K11 A;  4Z89 A;  2JMC A;  4PJO D;  2ESW A;  4PJN A;  2AKK A;  4P5N A;  1T0H A;  3CCV A;  1OU8 A;  3H8Z A;  2NUT B;  1HD3 A;  3CME T;  3RR6 A;  2SEM A;  1PC0 A;  2RHU A;  1D1A A;  1SPK A;  3EGD A;  1VQO T;  3QDF A;  1RUW A;  3QXE B;  3M9Q A;  2MOX A;  4UC4 A;  2H3J A;  5IXB A;  1TTH B;  5GAM j;  1UGR B;  4EMH A;  3OYH A;  4FYY B;  2A28 A;  2CUD A;  3OS2 A;  3C95 A;  4EPC A;  1MHN A;  8AT1 B;  3DB4 A;  4LUD A;  1W2B A;  4Q5W A;  3G6E Q;  2A3L A;  4M75 C;  4DA4 A;  1N5Z A;  1ZSZ A;  5KYX A;  1Y7X A;  3G4S A;  2I0N A;  4C92 A;  3TSW A;  5GMK i;  1PSF A;  2FRW A;  3HRT A;  4KUD K;  4ATO A;  6AT1 B;  1ZQ1 A;  3Q1J A;  1O75 A;  4FT2 A;  3M4Y A;  2XID A;  5J26 A;  1W2B P;  2JMA A;  2L3P A;  4EMK B;  4HCK A;  5FW9 A;  3TCJ A;  4D8K A;  2K3X A;  1CKB A;  1VQ5 A;  9ATC B;  2P0K A;  1JBM A;  3JB9 G;  5LJ5 f;  2D6F A;  2LZ6 B;  1M4Z A;  1D3B B;  3JCM b;  5GAN f;  1G83 A;  4J6Y A;  3RKW A;  3NTH A;  1U3O A;  4Z8A A;  3V7R A;  1QCO A;  4M7A F;  4BY6 C;  2OTJ A;  5GAN d;  1ACM B;  1VQ4 A;  2L0A A;  1OZ2 A;  3OS0 A;  3VS3 A;  2EQM A;  1AHJ B;  1SKU B;  2A08 A;  2ED0 A;  2A36 A;  5A0L A;  1K0X A;  3CCM T;  2QEX A;  4R56 A;  4QQ6 A;  1YWO A;  5IN1 A;  1F1B B;  1KQS S;  2XDB A;  2Y4Y A;  3EG9 A;  4DBQ A;  1TUC A;  2G3R A;  4Y91 A;  1AEY A;  4JS4 A;  4X9C A;  4IUR A;  2KI7 A;  4FYX B;  2WSE E;  1XJW B;  2O31 A;  2RNA A;  2O2O A;  3PFS A;  3CPW S;  2LJ3 A;  1OUL A;  1RAE B;  1WDX A;  2KVQ G;  1CKA A;  2LMJ A;  2NLU A;  3O5Z A;  5GJV B;  2MF2 A;  1UUE A;  3FIF A;  4RUG A;  4J9C A;  2CSI A;  5IH2 A;  1AWX A;  1G8X A;  3V8J A;  2DJQ A;  1G3Y A;  4N0A A;  4M77 F;  4FCY A;  3MEW A;  1U06 A;  2DRK A;  4OB3 B;  1VQP A;  4L5G A;  5FU6 B;  4M78 A;  3HFN A;  4QW2 A;  3E1S A;  4M75 D;  3MPU B;  3X20 B;  3UA6 A;  5IXF A;  3CCV T;  2GGR A;  3HHT B;  4PFO A;  5EG2 A;  2DBM A;  4OMO A;  3OYF A;  2JXB A;  1OV3 A;  3CCJ Q;  3PNW C;  4KGZ B;  4XAX B;  1GXI E;  4LDY A;  4B6M A;  4XTW A;  2PVD B;  2L3Q A;  2V1Q A;  4PJO F;  1K0S A;  2COY A;  1ARK A;  4EMK C;  4RKU E;  1AZG B;  3DKM A;  2DEU A;  4ZGJ B;  2DYI A;  4PJO G;  3JSC A;  1OPL A;  3CPF A;  1H92 A;  1D0X A;  1XOV A;  4E6R A;  2A0F B;  1LNX A;  2K2V A;  2E6Z A;  2JM8 A;  2HBW A;  2XDP A;  2M16 A;  1RAI B;  2FHD A;  5GAO p;  3AHU A;  4F7U A;  3LYI A;  2BZX A;  5GAN 5;  4IUT A;  4PJL A;  1KHI A;  3S3N A;  2B8A A;  2DTH A;  3G4S T;  2FZG B;  3RMQ A;  2M1H A;  4HXJ A;  1K76 A;  5C0M A;  4F16 A;  3ER0 A;  3I5S A;  3JV3 A;  4F7U G;  1X6G A;  1RAC B;  3M0R A;  2EYZ A;  2F1L A;  3GOX A;  4J7I A;  1IXD A;  4BUG A;  4E47 A;  4J5Y A;  4KH1 B;  1PD1 A;  2LT4 A;  4J83 A;  1VQ5 T;  1NPP A;  3MP1 A;  2KE9 A;  4DEY A;  4M77 E;  3NMZ C;  3A8M B;  1R0C B;  3P8B B;  4EMG A;  3VYG A;  3PMT A;  3OSV A;  5LJ3 g;  1M90 R;  1WYX A;  4N4I A;  1H3H A;  2DTO A;  5KCH A;  4OMP A;  2OTJ T;  1VQ4 T;  3M59 A;  4LD6 A;  3J7A F;  4F17 A;  4FU6 A;  5D7U A;  1BCM A;  1B7T A;  1PHT A;  1N8R R;  1XNI A;  3OYM A;  4RTX A;  2QEX T;  2VYT A;  4N4G A;  2DD5 A;  2CP6 A;  4BDZ A;  3HP9 A;  4M77 B;  1D0Z A;  2C0I A;  2EVR A;  4PJO E;  2RQW A;  1YIT Q;  1VQL T;  2R5A A;  4CI0 C;  3I55 Q;  1AVZ C;  5FU6 C;  2PTK A;  3TRE A;  4CC4 B;  2KAF A;  1AWO A;  5I21 A;  3H0F A;  2CRE A;  4JJN K;  1QP2 A;  1G3S A;  3E9F A;  2EQU A;  4RG8 A;  2EQI A;  3LGF A;  2BE7 D;  1WXU A;  2RHY A;  4N4H A;  2DXC A;  2K3Y A;  1PRM C;  1BI2 A;  2E1H A;  2DMO A;  5FWC A;  3L2U A;  4PJO B;  5ECA A;  3WVE B;  3GP8 A;  2KY9 A;  1YI2 A;  3VUZ A;  1LJO A;  5L23 A;  1M2O A;  2QQA A;  1KD1 R;  3QWY A;  1PG5 B;  1IGQ A;  1H8K A;  4ZN3 A;  2F5K A;  1KK7 A;  1VQP T;  1M8M A;  4A4K A;  2LDM A;  2RHZ A;  2EIF A;  3VS2 A;  4BI8 B;  3ZL7 C;  1K4U S;  2K2M A;  3ZBD A;  2JM9 A;  2GTO A;  2KRN A;  3SWN A;  1A0N B;  2XI9 A;  4XU0 A;  4DQ2 A;  2J06 A;  2IVW A;  4L6V 5;  4M75 A;  4M7A C;  1I07 A;  4Z88 A;  2HAX A;  4B9X A;  3CC7 Q;  1WJQ A;  3V7S A;  1Q7Y U;  4BE1 A;  2O9S A;  5GAN 4;  1UGP B;  3EHR A;  4NOY A;  3ZEH A;  1S72 Q;  2K6D A;  5D6X A;  1M3B A;  2B86 A;  1AT1 B;  4JRQ A;  1VQ8 Q;  4M75 G;  1OX8 A;  2NYS A;  2DZC A;  2KYB A;  5HCK A;  3CXC S;  4J6W A;  1PSE A;  4DBR A;  4C5H A;  1I81 A;  1IO6 A;  2X4Y A;  2KRM A;  3EGU A;  1OPK A;  2OAW A;  5FU7 B;  3EFR A;  3L2R A;  3RIR A;  1M90 C;  2L3S A;  4X34 A;  2XG8 D;  4VUB A;  2XIC A;  3FJP A;  5A2Q E;  1SRM A;  1KQS A;  4OMM A;  2XDD A;  3X26 B;  2QXF A;  3PVL A;  2LC4 A;  3I56 Q;  2GTJ A;  4QVC A;  4ZNX A;  4M77 C;  1N8R C;  2WSC E;  5AT1 B;  5GJW B;  3RDV A;  3EFO B;  2JS2 A;  4DOV A;  1SSF A;  4AFS C;  5IHK A;  2KQW A;  3P8H A;  3OA6 A;  3CPW A;  3VRY A;  1NE8 A;  4KGV B;  1KQS P;  1E7O A;  2GQV A;  2JN0 A;  2OI3 A;  2W10 A;  1QVF S;  2PU9 B;  3A8O B;  3HTR A;  2HNI A;  1JJ2 A;  4YTL A;  2NUT A;  3M58 A;  1VQ6 A;  3G1J A;  3JB9 J;  3L42 A;  3CPW P;  1NM7 A;  1WPY A;  2BKD N;  5DLO A;  3UDC A;  2AT1 B;  3MEV A;  3NHN A;  1YHQ Q;  3HKS A;  2HKQ B;  1SEM A;  3D7S B;  4HVW A;  1ABQ A;  1GCQ C;  5GMK e;  3X25 B;  1QW1 A;  1IHV A;  3CBM A;  2QQS A;  5GAN 6;  2X51 A;  1UDL A;  1VQ7 A;  2X3X D;  1KD1 C;  1RAG B;  2I2L A;  2GCX A;  2YXY A;  3JCM Q;  2RPN A;  3ZFJ A;  1BYM A;  1Y96 B;  4HKE A;  4KRT A;  4M7A D;  3OBW A;  5LJ3 e;  2CZ0 B;  2EAY A;  1X69 A;  3H9N A;  4JLG A;  3CCS A;  1MGQ A;  2QTV A;  3I9Q A;  4E7H A;  2FPF A;  2KRS A;  4JRP A;  1VQ9 Q;  1EFN A;  4IUP A;  1YI2 T;  3DB3 A;  1UJY A;  4EMK A;  2H3E B;  5FRN A;  2OX7 A;  4J9D A;  1X2Q A;  1HSQ A;  4CRI A;  2H8H A;  1JB0 E;  1D3B A;  1OI1 A;  3L1A A;  1IHW A;  3RKY A;  2L3R A;  2MI6 A;  3SFM A;  4EDU A;  3MHX A;  4E7Z A;  2DJZ A;  2R5M A;  2E10 A;  5CQX A;  3A5Z B;  2LX7 A;  3X28 B;  1OX9 A;  1Y0M A;  2D8J A;  2QA4 Q;  3OB9 A;  4KGX B;  4M77 D;  4II1 A;  2VV5 A;  2ZPF B;  1T3S A;  1X27 A;  2JUF A;  3VU3 C;  4C5I A;  2LCS A;  1YNZ A;  2KEA A;  2QQ9 A;  1M1K U;  3OY9 A;  4BY6 B;  2RQT A;  2HEQ A;  2ZPG B;  3WXM B;  4CC2 A;  4RTV A;  2E41 A;  2RA2 A;  1UGS B;  3OYL A;  3MP6 A;  3M0S A;  5L8R E;  1WJR A;  3G7Z A;  2DX1 A;  3EG1 A;  1QVG S;  2LX9 A;  5LJ5 e;  4NL2 A;  3CCQ A;  2IPO B;  5GAN e;  4R0K A;  2E65 A;  3A98 A;  1XTD A;  1WHM A;  5LJ3 d;  4E7J A;  2JTE A;  3DLL A;  4LNP A;  5HK3 A;  2HCK A;  5GAO l;  2PNI A;  5KYU B;  1C6V X;  2CUB A;  1BKB A;  5CKB A;  1IRX A;  2V26 A;  2JTM A;  4OP0 A;  3VYH B;  1M3C A;  1RAD B;  3LX7 A;  2LP5 A;  1JQQ A;  4HT9 A;  2D1X A;  4XTV A;  1D0Y A;  2WAC A;  2E5Q A;  2RI2 A;  2BTT A;  4MMK A;  4QQD A;  4L59 A;  1MMN A;  4PFP A;  5GMK j;  1YIJ Q;  1M1K R;  1EIF A;  2DPP B;  4RG2 A;  3J80 E;  1VQ6 T;  2L8D A;  3M0Q A;  3OYE A;  2M0Y A;  2OJ2 A;  5A0D A;  4XU1 A;  4JLI A;  1JEG A;  1RAH B;  1YP5 A;  1GL5 A;  2ZPH B;  1YWP A;  1U5S A;  2FYK A;  3T9N A;  2JNG A;  1R8O B;  1WLP B;  1Y57 A;  2HD0 A;  3G71 A;  4JS5 A;  5LJ3 j;  2LQW A;  2C0T A;  4JJC A;  3M5A A;  4RTW A;  2FRY A;  1M8V A;  2ZPE B;  4IUV A;  3LLR A;  1VQN A;  1VQ7 T;  1K9A A;  2KDS A;  4E7K A;  1SF9 A;  2RJD A;  2BUD A;  3BY7 A;  1GBQ A;  1Q81 U;  4OML A;  2KMT A;  4BAC A;  3CCL Q;  3UPU A;  2LT1 A;  1BI3 A;  2CT4 A;  1FWZ A;  2L2P A;  1QVP A;  3CCS T;  3NTI A;  2Y4X A;  4QKU A;  4RTT A;  2EGC A;  1VQK Q;  1D1B A;  1ZBJ A;  2KXD A;  2CH4 A;  4OB1 B;  1MNE A;  2LJ1 A;  2ROT A;  5CKF A;  5KYW B;  2HQX A;  3HRS A;  4E2F B;  4JDS A;  3LH0 A;  1VOM A;  5LJ5 d;  1N9R A;  2J6K A;  1I0C A;  4CC3 A;  3VS6 A;  4M7A G;  1TSF A;  1YJ9 A;  4KH0 B;  3QUI A;  1G3T A;  4JRK A;  2F69 A;  2MWP A;  5CKE A;  3CC2 Q;  2CDT A;  1MND A;  2EBP A;  3RMS A;  4Y92 A;  3CXC P;  3EGX B;  1VQL A;  2RHI A;  2KGT A;  3H0H A;  1FMW A;  1WGS A;  1Q81 R;  2CZ1 B;  2EQJ A;  1CSK A;  1ZUU A;  3EH2 A;  3BDU A;  4RTZ A;  3QJY A;  2MCN A;  4M77 A;  3CCU Q;  5LJ5 j;  2YWW A;  5C6S A;  3CCE Q;  2OTL A;  1QVF A;  1ZHI A;  1T3L A;  1V1C A;  5GAN j;  2JJ9 A;  2CH4 W;  3A1P A;  3TQ7 P;  2RM4 A;  1OZ3 A;  2D0N A;  4M4Z A;  4AFZ C;  1PRL C;  1YJN Q;  1BCO A;  4M77 G;  1V76 A;  3GPL A;  3CC4 A;  3CCQ T;  5GAN 3;  1M1K C;  4LDX A;  1QVF P;  4BB7 A;  3CD6 A;  3CEY A;  5D6W A;  1WA7 A;  2QQR A;  2X35 A;  3QG1 A;  4A4H A;  2F2V A;  3CCR A;  4ANJ A;  2VB6 A;  4PJO A;  3EG2 A;  2YSQ A;  4CC7 A;  3X24 B;  3I5R A;  2HSE B;  1NLO C;  1B07 A;  1YJW Q;  1UHF A;  1GCQ A;  2MK5 A;  2F2X A;  3S3O A;  3LWI A;  1I8F A;  2DVJ A;  4M7A E;  2RJE A;  5I2M A;  3EFS A;  3C4S A;  2AZV A;  1M90 U;  4RTU A;  2ED1 A;  7AT1 B;  2LQN A;  1ZX6 A;  3LGL A;  5D6Y A;  1VQM Q;  2DYB A;  3HSB A;  3SB2 A;  3OYK A;  4KUL A;  2PUK B;  1GBR A;  2NUP B;  3QKJ A;  3RBB B;  2RJC A;  3CME Q;  2DL5 A;  1VQO Q;  2DK3 A;  1N8R U;  5EC7 A;  3I35 A;  5J3B A;  2HSP A;  5CK9 A;  3OW2 S;  3G71 T;  4HVU A;  2JW4 A;  4MZT A;  2X4X A;  1B3Q A;  4JZ3 A;  2IIM A;  4M7A B;  1VQN T;  4C0G A;  3QBY A;  5GAO m;  4A63 B;  4B9W A;  2KK4 A;  2RMO A;  3E19 A;  2W0Z A;  2K4Y A;  2DTI A;  5I11 A;  4ME7 A;  3JCM V;  2J6F A;  4FYW B;  5CKD A;  2HL5 C;  2EW3 A;  1WHL A;  1Y07 A;  1VYV A;  4A4G A;  1U1T A;  2FEI A;  4LDW A;  3UAT A;  5GAM g;  2HKN A;  2AHJ B;  1Q81 C;  3QHS A;  3A8G B;  4OGC A;  3JCM X;  1KD1 U;  1X43 A;  3TU4 K;  4XK8 E;  1N27 A;  3EFO A;  3RER A;  3G6E A;  1YJ9 T;  4OMQ A;  4JUV A;  3E2U A;  4C8Q F;  4WTO B;  3JB9 I;  1QVG A;  2ZPI B;  2EJ9 A;  4A4E A;  3PE0 A;  1WHK A;  1WXT A;  1V29 B;  1ZA2 B;  3F70 A;  2E70 A;  3VUB A;  1WQ7 A;  4IIO A;  2CYZ B;  3CCL A;  1C0M A;  3QJ6 A;  1NPR A;  3OYD A;  2EGE A;  1QVG P;  2XHC A;  3O8V A;  2CP3 A;  3QZ9 B;  3CCM Q;  4F04 B;  3M4G A;  1PM3 A;  3FDR A;  3REB B;  2M0O A;  2AIR B;  5HK0 A;  2OTL T;  3M0T A;  1K1Z A;  4Y28 E;  5CCA A;  4ELZ C;  1DJ7 B;  1I5O B;  2DLP A;  1Y96 A;  1GFC A;  1WI7 A;  1NJI U;  3CC4 T;  3SDZ A;  1UGV A;  2YUP A;  3CC2 A;  2K5L A;  4MDW A;  1ZBX A;  1K73 U;  3CD6 T;  2FVU A;  1BI0 A;  2PQW A;  3L2V A;  2FL7 A;  4IUU A;  3CCR T;  4C92 C;  2A37 A;  2EYY A;  2P4R A;  3JCM g;  1JRI A;  1WXB A;  2O4X B;  1M9S A;  2HBP A;  3TEE A;  1BBZ A;  3VS1 A;  2M9U A;  1I1J A;  4ZN1 A;  2XKO C;  1AWJ A;  3OS5 A;  4BE0 A;  2EYX A;  1QCN A;  2YDL A;  5IHI A;  1R77 A;  2VAS A;  3CCE A;  2KSS A;  1K9M U;  3M0U A;  2F2W A;  3CCV Q;  4C8Q E;  3EAE A;  3UWN A;  3OYN A;  1IZ6 A;  3C0C A;  1IRE B;  1YJN A;  4X9D A;  3OMG A;  4PJJ A;  1TXQ A;  4BE2 A;  1LPL A;  5GAN 8;  2DEQ A;  4MDX A;  2DNU A;  3QWX X;  2DFU A;  2M51 A;  2QDY B;  1NJI R;  2RJF A;  3EG3 A;  5AYF A;  1AOJ A;  1LOJ A;  2QYZ A;  4BDY A;  2V8J A;  1K73 R;  1UFF A;  1O9S A;  5GAM h;  2Y90 A;  3CCJ A;  4RCC A;  4C8Q B;  2K57 A;  3HFO A;  4AG1 C;  2ZPB B;  1ZLM A;  1Q82 R;  4LXC A;  2QAS A;  4C0D C;  1VUB A;  2WSF E;  1J3T A;  2NWM A;  5GAN 7;  3CBP A;  2AK5 A;  2E4H A;  5FRO A;  3SD4 A;  3OYJ A;  3G4S Q;  3TSZ A;  4TVR A;  2V8I A;  5J39 A;  1LCK A;  1PD0 A;  1M2V B;  1K9M R;  1W6X A;  4J9H A;  3AT1 B;  1GCP A;  1UEB A;  4MZM A;  5KYU A;  3REA B;  2X4J A;  3G6E T;  2SRC A;  3BFM A;  3URG A;  4ZGE B;  3INZ A;  3EG0 A;  2DBK A;  1VQ5 Q;  1HJD A;  1TG0 A;  5CQY A;  2JOY A;  4PLL A;  4QVD A;  1BU1 A;  2DRM A;  4AFQ C;  5FRM A;  4OGE A;  4DBH A;  1D09 B;  4M78 C;  1T0J A;  1N6A A;  1NYF A;  2YHT A;  1WNL A;  2J6O A;  4MZP A;  3JCM c;  4RCB A;  1C1A A;  3CCL T;  2OTJ Q;  1Q95 G;  1VQ4 Q;  2LRQ A;  4KBM B;  4LD9 K;  2CP2 A;  2A7Y A;  2YRV A;  5GMK l;  2QEX Q;  1KC8 R;  2HL3 A;  1KSW A;  2LCC A;  3H6Z A;  1KG1 A;  1BB9 A;  4D6W A;  1UTI A;  3FRN A;  1IB8 A;  4OB2 B;  1M5Q 1;  1OEB A;  1WHH A;  2EYW A;  1SHG A;  3UA7 A;  4ZGD B;  3JCM h;  3U23 A;  2FPE A;  5KE2 A;  3MP8 A;  2P84 A;  3GBQ A;  3OMC A;  3OSS C;  3CC2 T;  4E7L A;  2YRC A;  3OW2 A;  1BIB A;  5IHN A;  5KCO A;  2DXU A;  4LN2 A;  1YIT A;  5KYW A;  2GF7 A;  3I55 A;  3OBY A;  3VS5 A;  2DXB A;  2JTF A;  3M56 A;  4D8D A;  4PNO A;  1TU0 B;  1NJI C;  2HMA A;  1LVK A;  3QYH B;  3R6N A;  3OW2 P;  5CIU A;  4C8Q C;  4HA8 A;  2QGF B;  1VQP Q;  2EGA A;  3P8D A;  2FPD A;  2ZAE A;  1E6G A; 
#chains in the Genus database with same CATH homology
 4LE9 A;  2EYZ A;  2JS0 A;  2V1R A;  1SRL A;  1KJW A;  1GFD A;  2KE9 A;  4DEY A;  1VYU A;  2CDT A;  2EBP A;  3NMZ C;  4Y92 A;  1KFZ A;  2K3B A;  1YN8 A;  2KR3 A;  2KGT A;  1M30 A;  1WYX A;  2FG0 A;  3H0H A;  1TUD A;  1H3H A;  4OMP A;  2FO0 A;  1FMK A;  1S1N A;  2RQR A;  4F17 A;  2AZS A;  1CSK A;  1GRI A;  1ZUU A;  2YT6 A;  1KIK A;  2AKL A;  1X6B A;  4RTZ A;  1PHT A;  1PWT A;  4RTX A;  2MCN A;  3ULR B;  4X1V A;  1UEC A;  1T3L A;  1V1C A;  2C0I A;  2EVR A;  2RQW A;  1Z9Q A;  2CH4 W;  2DE0 X;  1MV0 B;  2X3W D;  2D0N A;  1AVZ C;  2PTK A;  4M4Z A;  4CC4 B;  4AFZ C;  1PRL C;  2YUN A;  1AWO A;  1VA7 A;  3H0F A;  5I22 A;  2CRE A;  3PVQ A;  2KYM A;  2EQI A;  2DA9 A;  1W1F A;  1WA7 A;  1WXU A;  4QT7 A;  1RLQ C;  1ZUK A;  1QWE A;  3RNJ A;  1PKT A;  2F2V A;  1PRM C;  3EG2 A;  2YSQ A;  3VS0 A;  4CC7 A;  1PKS A;  3I5R A;  1PNJ A;  1E6H A;  1NLO C;  1X2K A;  1B07 A;  2BZ8 A;  2DMO A;  5FWC A;  3SEM A;  5ECA A;  4DEX A;  2ABL A;  1UHF A;  4JZ4 A;  1GCQ A;  2F2X A;  5L23 A;  3EHQ A;  1SHF A;  2DVJ A;  3QWY A;  1ZSG A;  2AZV A;  1QWF A;  1H8K A;  4RTU A;  1M3A A;  2ED1 A;  2DIL A;  1M8M A;  2LQN A;  1ZX6 A;  3TVT A;  4AG2 C;  1WFW A;  3VS2 A;  1K4U S;  3ZL7 C;  3CQT A;  2DYB A;  1ABO A;  2K2M A;  1JO8 A;  2JM9 A;  2GTO A;  2KRN A;  1GBR A;  1A0N B;  3RBB B;  1G2B A;  5FWB A;  2J06 A;  2DL5 A;  2JT4 A;  1ZUY A;  3UF4 A;  1I07 A;  4Z88 A;  5EC7 A;  3I35 A;  4GLM A;  2HSP A;  2ROL A;  4HVU A;  1UG1 A;  2JW4 A;  2MIO A;  4J9B A;  2DL7 A;  2O9S A;  1B3Q A;  1QKX A;  4WCI A;  2GNC A;  3EHR A;  4JZ3 A;  1NEG A;  2IIM A;  1FYN A;  1QCF A;  2K6D A;  1M3B A;  2B86 A;  2K9G A;  1QKW A;  1NG2 A;  2BZY A;  2KT1 A;  1NYG A;  4EIK A;  2RF0 A;  3VRZ A;  4A63 B;  4ORZ A;  2RMO A;  2KYB A;  4FSS A;  5HCK A;  1AD5 A;  2G6F X;  2W0Z A;  2HDA A;  1UHC A;  3LH5 A;  5I11 A;  1IO6 A;  1W70 A;  2KRM A;  1M27 C;  2J6F A;  3EGU A;  1OPK A;  2EW3 A;  2OAW A;  1VYV A;  4AFU C;  1Z9Z A;  2L3S A;  1NEB A;  2KXC A;  2FEI A;  2VKN A;  1SRM A;  3UAT A;  2DL4 A;  4OMM A;  1X43 A;  3PVL A;  2YUQ A;  2KNB B;  1MV3 A;  4JJB A;  2GTJ A;  4ZNX A;  4OMQ A;  2CSQ A;  5GJW B;  4JPB W;  2JS2 A;  4OMN A;  4AFS C;  2K79 A;  2D8H A;  5IHK A;  3VRY A;  3THK A;  3PE0 A;  3NGP A;  3VS7 A;  1WXT A;  1E7O A;  1SSH A;  4K11 A;  2OI3 A;  2W10 A;  4Z89 A;  2JMC A;  2ESW A;  4IIO A;  2AKK A;  1T0H A;  2EGE A;  2PZ1 A;  1UE9 A;  1NM7 A;  1HD3 A;  2SEM A;  1UJ0 A;  3NHN A;  1SPK A;  1SEM A;  3VS4 A;  4HVW A;  3REB B;  1ABQ A;  2CT3 A;  3M0T A;  1RUW A;  1GCQ C;  1VYT A;  1K1Z A;  2GQI A;  2MOX A;  5IXB A;  4J9F A;  1UDL A;  2X3X D;  2O88 A;  2DLP A;  1RI9 A;  1GFC A;  1WI7 A;  2RPN A;  2E5K A;  2VVK A;  2A28 A;  2RQU A;  1UGV A;  2YUP A;  4KRT A;  1JXO A;  2CUD A;  2KT8 A;  3KFV A;  1X69 A;  4LUD A;  2NUZ A;  1OOT A;  2DM1 A;  2YUO A;  1N5Z A;  3I9Q A;  2A37 A;  2EYY A;  2FPF A;  2P4R A;  2KRS A;  2I0N A;  1EFN A;  3TSW A;  1WXB A;  2FRW A;  1JU5 C;  1BBZ A;  3VS1 A;  1I1J A;  1UJY A;  1AWJ A;  2EYX A;  2YDL A;  4J9D A;  2JMA A;  2L3P A;  4HVV A;  5IHI A;  1RLP C;  1X2Q A;  4J9E A;  4HCK A;  5FW9 A;  1HSQ A;  4D8K A;  2H8H A;  3H41 A;  3M0U A;  2O9V A;  2F2W A;  4RTY A;  1CKB A;  3IQL A;  2KRO A;  2LZ6 B;  3C0C A;  1G83 A;  1WX6 A;  2LX7 A;  1Y0M A;  2D8J A;  1WIE A;  2DNU A;  2DL8 A;  2RQV A;  1U3O A;  4Z8A A;  3QWX X;  1MUZ A;  2M51 A;  2LNH B;  3NPF A;  3EG3 A;  1AOJ A;  1T3S A;  1X27 A;  2L0A A;  2LCS A;  3VS3 A;  1UFF A;  1YNZ A;  2KEA A;  2A08 A;  2ED0 A;  2A36 A;  1K0X A;  2RQT A;  2HEQ A;  4AG1 C;  4CC2 A;  1YWO A;  1ZLM A;  4RTV A;  3H0I A;  2J7I A;  1J3T A;  2NWM A;  2C0O A;  4J9I A;  2DF6 A;  1TUC A;  2AK5 A;  3M0P A;  1AEY A;  3M0S A;  1YCS B;  2EPD A;  3TSZ A;  2O31 A;  3SHW A;  2DX1 A;  2RNA A;  2O2O A;  3EG1 A;  2EKH A;  2LJ3 A;  1LCK A;  1WDX A;  1CKA A;  2LMJ A;  4R0K A;  3A98 A;  1JXM A;  4J9G A;  1W6X A;  4J9H A;  3O5Z A;  2LJ0 A;  1GCP A;  2JTE A;  4LNP A;  5GJV B;  1UUE A;  3REA B;  2HCK A;  2ECZ A;  2SRC A;  4RUG A;  4J9C A;  2PNI A;  2CSI A;  2ENM A;  3EG0 A;  5IH2 A;  1AWX A;  2CUB A;  2DBK A;  1HJD A;  2DJQ A;  4JJD A;  2J05 A;  1TG0 A;  1M3C A;  1BU1 A;  2DRM A;  2LP5 A;  4AFQ C;  1JQQ A;  1U06 A;  2DRK A;  2QDL A;  2D1X A;  1T0J A;  4CC3 A;  1NYF A;  1AZE A;  2J6O A;  2BTT A;  4LUE A;  4F14 A;  3UA6 A;  5IXF A;  1AWW A;  4ESR A;  2GGR A;  3M0Q A;  2M0Y A;  2OJ2 A;  1JEG A;  2DBM A;  4OMO A;  4GBQ A;  1YP5 A;  2JXB A;  1OV3 A;  1GL5 A;  1YWP A;  3FJ5 A;  1U5S A;  1KSW A;  2VWF A;  1WLP B;  1Y57 A;  2XMF A;  1BB9 A;  2L3Q A;  2LQW A;  2V1Q A;  2KBT A;  2C0T A;  1UTI A;  1ARK A;  4JJC A;  1K0S A;  4RTW A;  1AZG B;  2FRY A;  1OEB A;  2EYW A;  3UA7 A;  1SHG A;  3U23 A;  2FPE A;  1OPL A;  1K9A A;  1H92 A;  2GBQ A;  3GBQ A;  1XOV A;  4E6R A;  1GBQ A;  2RN8 A;  4OML A;  2JM8 A;  2HBW A;  2CT4 A;  5IHN A;  2L2P A;  4LN2 A;  1BK2 A;  2K7A A;  4RTT A;  4IIM A;  2BZX A;  2EGC A;  3VS5 A;  1ZBJ A;  1NLP C;  2CH4 A;  2KXD A;  2LJ1 A;  2ROT A;  1QLY A;  4D8D A;  4HXJ A;  1K76 A;  4F16 A;  3I5S A;  3JV3 A;  2DL3 A;  3R6N A;  1X6G A;  2J6K A;  3M0R A;  1I0C A;  2EGA A;  3VS6 A;  2FPD A;  1E6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...