2J05A

Crystal structure of the rasgap sh3 domain at 1.5 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
SHMRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAS GTPASE-ACTIVATING PROTEIN 1
publication title High Resolution Crystal Structures of the P120 Rasgap SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 18
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j05A00
2ECZA 4QT7A 3RBBB 1SSHA 1RI9A 2JM8A 4J9HA 4RTZA 1RLQC 4RTUA 2F2WA 1MUZA 1K9AA 4AFZC 3M0TA 3EG2A 2EKHA 1BB9A 3I5RA 1AZGB 1VA7A 2LQNA 1T3LA 1ZUYA 3EHQA 2JT4A 4HVWA 4FSSA 2CUDA 2XMFA 3M0SA 2MIOA 2LJ0A 4K11A 2C0IA 2O9SA 5L23A 1ZBJA 2LCSA 1OOTA 1M3CA 2CDTA 1X69A 3VS6A 2H8HA 1CKBA 1JU5C 1SHFA 4LUEA 3KFVA 1W1FA 2DBMA 2K7AA 4WCIA 2NWMA 1SEMA 2VWFA 2CSIA 1K0XA 1GL5A 2BZXA 3EG1A 2YUOA 1WLPB 2ENMA 2FRYA 1ARKA 2ROLA 3SEMA 2F2XA 2O88A 4OMPA 2HSPA 2LJ1A 4LN2A 4RUGA 4J9BA 4LE9A 2PNIA 4RTTA 3VRZA 2L2PA 2M51A 2A37A 2J7IA 2KYMA 2EGAA 1GCQA 4AFSC 2RMOA 4CC3A 1E7OA 1ZX6A 1ZUKA 2OJ2A 2J6OA 1T3SA 1UUEA 1ZSGA 4HVVA 2FPEA 2GBQA 3C0CA 1KIKA 1I07A 1PRMC 2YUPA 4CC7A 4ESRA 4OMLA 2J06A 3VS0A 4GLMA 3SHWA 2YDLA 1QWFA 2DMOA 2PTKA 1UFFA 2CUBA 1JO8A 1X2KA 5FWBA 3NPFA 4RTWA 4JJDA 1LCKA 3EHRA 2KNBB 1WDXA 2CH4A 5IHKA 2KE9A 2BTTA 1NLOC 1GCPA 4JPBW 2KYBA 2RNAA 2LX7A 1UHCA 2KT8A 2W10A 4RTYA 1OEBA 1K76A 4OMMA 3GBQA 2P4RA 1ZLMA 4R0KA 2G6FX 2DYBA 3JV3A 2RPNA 2LP5A 2KRSA 2DA9A 5I22A 1NM7A 2D1XA 2DX1A 3TSZA 5I11A 4J9IA 1JXOA 2J6KA 4JJCA 1AOJA 4CC4B 3H0FA 1WFWA 2E5KA 5HCKA 2DRMA 4RTVA 1AWWA 2B86A 2HEQA 2BZ8A 2RN8A 4OMNA 2K2MA 2ROTA 2IIMA 3TSWA 4J9EA 1GFCA 2GTJA 2DL5A 2LZ6B 2KT1A 2L3SA 2KEAA 1YWOA 2LMJA 2YUQA 4AFQC 2K6DA 3PE0A 2DL8A 3PVQA 1H3HA 4Z89A 3QWXX 3CQTA 2RQVA 2RQUA 2LNHB 5EC7A 2JTEA 2MCNA 2FPDA 2DM1A 3VS2A 1GBQA 1TUDA 3M0PA 1YP5A 4CC2A 1SHGA 1BK2A 3I5SA 1YWPA 2EYXA 1EFNA 2A08A 1N5ZA 1AEYA 4X1VA 4J9GA 1GRIA 1M27C 2AK5A 4IIMA 1K0SA 1MV3A 2CT3A 2JS2A 2FRWA 1JXMA 2J6FA 1YN8A 3O5ZA 1T0HA 4DEYA 3FJ5A 2LQWA 2K9GA 1CKAA 1WIEA 2EBPA 4J9CA 2DL4A 4OMOA 1PNJA 2HDAA 1PHTA 1K1ZA 2YT6A 1AD5A 2QDLA 1QKXA 2CSQA 1X27A 2FPFA 2V1QA 3VS1A 3THKA 1NLPC 2K79A 1Y0MA 3QWYA 4AG1C 2PZ1A 1Y57A 2LJ3A 2MOXA 2JM9A 2CH4W 2JS0A 4HCKA 1YNZA 3IQLA 3VS7A 2D8JA 2JW4A 3UA7A 1G2BA 3EGUA 1FYNA 2GQIA 2FEIA 2EVRA 2EQIA 4Z88A 2EGCA 4ORZA 1I1JA 2I0NA 2X3WD 3R6NA 1OPKA 1UG1A 1QWEA 4F16A 3RNJA 2KXDA 2EPDA 5IH2A 2DVJA 2JMCA 1WYXA 2OAWA 2JMAA 1HD3A 1KFZA 2DNUA 1UE9A 3VRYA 1YCSB 1GBRA 3EG3A 3U23A 1WXBA 1B07A 3H0HA 1T0JA 3ZL7C 1SRMA 1UDLA 2M0YA 4HVUA 4OMQA 1TUCA 4J9DA 1SPKA 2AKLA 2ED0A 1XOVA 2DLPA 5IXFA 2W0ZA 3VS5A 1W70A 2VVKA 2GGRA 2C0TA 3M0UA 5GJVB 2EYZA 1M3AA 2BZYA 1WXUA 1A0NB 5GJWB 1JEGA 1U3OA 3A98A 1PWTA 4RTXA 3TVTA 2K3BA 4E6RA 1AWJA 4Z8AA 2L3PA 2KRNA 2NUZA 1UJYA 1KSWA 1NG2A 1WX6A 1WI7A 2C0OA 2D8HA 2ABLA 4DEXA 1NEGA 1QLYA 1HJDA 1M8MA 5ECAA 1W6XA 3REBB 2GNCA 4A63B 2KRMA 1G83A 1BBZA 4AFUC 2AKKA 4D8KA 5IHNA 1AWXA 3M0RA 4KRTA 1X43A 4GBQA 2HBWA 4JZ3A 2OI3A 2EYWA 1OPLA 2DILA 1BU1A 3REAB 1M3BA 2KBTA 3PVLA 4JJBA 3I35A 2DE0X 5FW9A 1J3TA 2EW3A 2RQWA 1E6HA 2DBKA 1NYGA 1ABQA 2DRKA 1VYUA 2EGEA 1RUWA 2D0NA 1SRLA 2RF0A 1HSQA 2YUNA 4Y92A 2SEMA 2AZVA 2RQRA 1UHFA 2DL7A 1CSKA 2O2OA 1PKSA 4ZNXA 2A36A 1B3QA 3UATA 2SRCA 2VKNA 3NHNA 5IXBA 1TG0A 4IIOA 1S1NA 1X2QA 4LNPA 2JXBA 1UECA 5FWCA 2ED1A 2KR3A 1AZEA 1H8KA 1UTIA 1IO6A 1Z9QA 2L0AA 2F2VA 2DL3A 1PKTA 3ULRB 4F17A 1AWOA 4JZ4A 2V1RA 3NGPA 1Z9ZA 2O9VA 3VS3A 3VS4A 1UJ0A 2DF6A 1NEBA 2A28A 2J05A 1NYFA 3H41A 4M4ZA 3EG0A 2GTOA 2HCKA 1RLPC 5IHIA 1ZUUA 1E6GA 1V1CA 3UF4A 3M0QA 3NMZC 3H0IA 1KJWA 1UGVA 2RQTA 1I0CA 1U06A 2DJQA 2KXCA 2L3QA 1GCQC 1PRLC 2KGTA 2FO0A 1JQQA 4EIKA 1MV0B 1X6BA 1WXTA 1FMKA 3LH5A 1H92A 4J9FA 4AG2C 1AVZC 1U5SA 1K4US 3I9QA 1QKWA 2ESWA 1WA7A 2AZSA 1QCFA 4HXJA 2CREA 1VYTA 1ABOA 4D8DA 4LUDA 2YSQA 2CT4A 2X3XD 2FG0A 2O31A 1VYVA 2EYYA 2KROA 3UA6A 4F14A 1X6GA 1GFDA 1OV3A 1M30A
chains in the Genus database with same CATH superfamily
2OTLT 4RTZA 4J9HA 1ACMB 5KYWA 1KC8R 1K9AA 4BY6B 2QI2A 3I5RA 2X4WA 1AZGB 4VUBA 4CI0C 1VQPT 2KAFA 1TSFA 1VQ4Q 2WACA 1IXDA 2V26A 1D3BB 1PD0A 4F7UE 4M7DD 1PC0A 1JJ2A 5LJ3j 2K4YA 3VJPA 1OX9A 3QBYA 3VS6A 4C92B 1RAGB 3QIIA 3CCLA 3TU4K 2NWMA 5GMKl 5I21A 4M75D 2CGHA 2FRYA 2ENMA 1D3BA 2R5AA 3VUZA 2F2XA 2O88A 4HCZA 4OMPA 2LJ1A 1YCYA 1YJNT 1PCXA 3OQ5A 5LJ5j 4J9BA 2CP2A 3QKJA 2PNIA 4XTWA 3VRZA 1YI2Q 4C92A 5GANg 1G3SA 2RMOA 3L2UA 4A54A 1KQ1A 2X9HA 4JRIA 2OJ2A 4M77E 4RKUE 2DD4A 4DA4A 3EH1A 2HAXA 2YUPA 3CCRA 1V29B 4OMLA 2L8DA 4J6YA 3VS0A 3CCQQ 2YDLA 1QWFA 2DMOA 2PTKA 1UFFA 2KY9A 4KULA 1JO8A 1O75A 4E7KA 1WJSA 3NTHA 4RTWA 4JJDA 5GAMd 3EHRA 3ER0A 3JCMd 3OY9A 4LD9K 1YIJT 3CC2Q 4LDXA 2RNAA 4BI8B 3I55A 2X35A 4RTYA 1ZSZC 4RMOA 3G71A 3EG9B 4ATOA 3HRTA 3G4ST 3ASKA 2G6FX 2DYBA 1RAAB 4EMKC 4KGVB 1NM7A 5KE2A 1AOJA 5CQYA 4CC4B 1UGSB 3CMAQ 2DRMA 4C92D 4C5IA 3HL8A 2CZ6B 4ELZC 4OMNA 5A2QE 2JOYA 2ROTA 2IIMA 3RMQA 2P84A 3TSWA 2L5QA 2GTJA 3EG9A 3URGA 1PSFA 2DL5A 2IG0A 4XTVA 1GXIE 2LCCA 2QDYB 4AFQC 5A0LA 5DY9A 1QVPA 1H3HA 1EX4A 1K9MC 3G1JA 2COWA 5LJ3e 1UGQB 5KYXB 4F7UF 2RQVA 2RQUA 4IUPA 2LNHB 1VQKQ 2KQWA 4BE2A 2XIDA 8ATCB 1Q95G 2MCNA 2FPDA 4QQGA 1TUDA 1YP5A 3N5BB 4CC2A 5KYNA 1BK2A 1U1TA 2EQKA 4F7UB 4A4GA 2XICA 3MO8A 4OF1A 4OB1B 4BD3A 1IHWA 2FYKA 1ZSZB 2L3RA 2QTXA 1GRIA 1M27C 3OYFA 3JB9G 1VQ6A 2E6ZA 4HKEA 5LJ5e 1IHVA 2VGNA 5KYXA 1OQKA 2KSSA 2LQWA 1UEBA 1WIEA 5D6WA 2HZYA 1TS9A 2ZPIB 1QVGP 4OMOA 2HDAA 4F7UA 4FW2A 4ZTFA 1K1ZA 1B7TA 2LTOA 1AD5A 4ME7A 1QKXA 3CCJT 3BDLA 1OU9A 3OYGA 1ZSZA 4NOYA 3CC2T 3THKA 2K79A 1ZQ1A 4Y28E 3QWYA 2CH4W 4E7LA 3LWIA 1NJIR 4HCKA 1OYXA 3M59A 2QTVA 3UA7A 1FYNA 4DQ2A 4KUDK 1H3ZA 3JCMc 1SKUB 2QA4A 5C0MA 1VIFA 2EQIA 4Z88A 2CYZB 1I1JA 3R6NA 2JTMA 2LVMA 2LQKA 1I5LA 3RNJA 2KXDA 5D7UA 3QZ9B 2JMCA 2OAWA 3PNWC 2PVGB 3VRYA 3CCSA 2DAQA 3CCUQ 5KCHA 1W4SA 5FRNA 1T0JA 3HRUA 3ZL7C 4PFPA 3GLXA 4JRQA 2ZPEB 5GAMh 3OYNA 2DIGA 2EQMA 1M1KU 3MEVA 1S72Q 2ED0A 2DLPA 2W0ZA 1W70A 1HYOA 2RJEA 4EPCA 1Y7XA 1OZ3A 2RH2A 3LGFA 2VB6A 4XAXB 4D6WA 2A7YA 3VU3C 4M7AC 4ELYC 2M02A 2JTFA 4M75G 4RTXA 1AWJA 1VQOA 2KRNA 1QP2A 4MDXA 1K8AC 3QO3A 3JAME 3NTIA 2JN0A 2CP6A 2V8JA 1HJDA 2XG8D 3ZEHA 4A63B 4FL6A 4DBHA 4PNOA 3QYHB 2DTIA 5L8RE 2AKKA 4J8OA 1QVGA 4JZ3A 2OI3A 1BU1A 2DILA 5AT1B 1VQ4A 3FRNA 3REAB 5KYYB 3I35A 1AT1B 2O4XB 5FW9A 2RQWA 3JCMf 2R57A 1WHGA 5LJ3g 4M7AF 3HPWA 3OYCA 1HSQA 3MHXA 1I81A 4JDSA 4PFOA 2IPOB 3CD6T 2DL7A 2O2OA 4M7DE 1YHQQ 3C94A 4M7AB 3L2ZA 1WQ7A 3MP6A 5DLQE 1LPLA 5KYYA 4N0AC 4M78E 2ED1A 3CCUT 1H8KA 2O4XA 1N6AA 1Q82U 2CZ0B 1IO6A 3VUBA 5LJ5g 1YI2A 1G3TA 2Z0WA 1QW1A 1PKTA 3SFMA 1Z9ZA 5CK9A 3VS4A 1S72T 2DF6A 1QVFS 2VYTA 4BB7A 1MMGA 4M7AA 5IHIA 1ZUUA 2LDMA 3META 3SD4A 3UDCA 3L42A 5GMKj 3CCQA 1KJWA 3RDVA 3HRSA 3TQ7P 1C0MA 2DJQA 1KQSP 2L3QA 3L2WA 4FIBA 2FO0A 1JQQA 1ZBXA 2K5FA 4EIKA 2BIVA 1MV0B 1H92A 4J9FA 2C06A 1U5SA 1K8AR 2AZSA 2M0OA 5GAOq 3BE3A 1VYTA 3CCLT 5FU7C 4C0DC 5CCAA 2XDBA 1BKBA 3E9FA 2DIQA 4M7DC 1G5VA 5GAOm 3UA6A 4ZGDB 4BUGA 1FMWA 4ZGEB 5LJ3f 1GFDA 1M30A 3CMAA 3CMEA 3OYMA 1N8RC 1SSHA 1RI9A 3HFNA 2VV5A 1BCOA 3C12A 4M78C 1MUZA 3EG2A 2EKHA 1BB9A 4M7AD 3M4GA 4EDUA 3L2RA 1Q86U 3OYEA 4J6XA 2XD0A 3KUFA 4RCBA 1ZUYA 3MEWA 1D09B 4YTLA 3HSBA 4XU0A 3M0SA 1RI0A 4C92E 1M4ZA 2LJ0A 3CCRT 2C0IA 1KC8C 5LJ5f 1K73U 5CR2A 2LCSA 1MGQA 4N0AA 1M3CA 1VQKA 1JU5C 4PJJA 4LDWA 1W2BS 4LUEA 3KFVA 1IGUA 1WHHA 1VQ9Q 3V7SA 2DBMA 4C8QA 2K7AA 3RR6A 1Q81U 3LLRA 2VWFA 3I55T 2DXTA 4BI4A 3EG1A 3G71T 5FU7B 4M7DF 2COZA 3SEMA 3DLMA 4PJNA 2ZZDA 3UWNA 4C0DB 5CKFA 2HSPA 2EAYA 2RJFA 4LN2A 3CBMA 2QGGA 4LE9A 4B9WA 4M78F 4F7UG 2L2PA 3FDRA 2J7IA 2AHJB 3RIRA 4AFSC 2I2LA 5HKCA 2RHXA 3V7RA 4A4EA 2MMPA 1WNLA 2XU8A 1T3SA 4M78B 1ZSGA 4HVVA 2FZGB 2GBQA 3EGDB 2YXYA 1PRMC 4ESRA 1KQSA 2YLCA 5GMKe 3SHWA 2DEQA 1IZ6A 3OSVA 1X2KA 3NPFA 2OTJQ 1TXQA 2KNBB 2H3EB 3JB9J 5CIUA 3ZFJA 4L5GA 4MZPA 1NLOC 1GCPA 4C92C 1D0YA 4C8QD 2YHTA 4J7IA 1EIFA 1K76A 1M1KR 3GBQA 2GFAA 5IN1A 5KYWB 4M78A 3HKSA 3EGDA 2RPNA 4DBFA 3V7CA 4OVAA 2DX1A 1Y71A 3OYAA 4M77G 5I11A 4JJCA 3H0FA 2E5KA 1VQ6T 4ZN3A 3A8OB 1AHJB 1AWWA 2B86A 2RN8A 1OX8A 2EQUA 5GAOn 4J9EA 3QPHA 1YJWQ 5GMKi 2LZ6B 4PJOC 2L3SA 2KEAA 1YWOA 4UC4A 1D1BA 2K6DA 3PE0A 1RAIB 2F1LA 4C92F 4J83A 5EC7A 2E5QA 1UB4A 2DM1A 3VS2A 3M0PA 1WGSA 3I5SA 3OW2P 1EFNA 3E9GA 4M78D 1R0BG 4C5HA 1OULA 2QA4T 2D9TA 2AK5A 2GF7A 5GAN7 2LRQA 1K0SA 1MV3A 2CT3A 2HD0A 4FCYA 2JS2A 2FRWA 1JXMA 3O5ZA 3PIPA 5DLOA 2NUTB 1CKAA 5GAMe 5J39A 1WJQA 2JNGA 2LC4A 2DEUA 3CCST 3JCMe 3VV0A 2HBPA 3FC3A 3V8LA 1G3WA 4PJOF 1VQMA 4KGZB 2E3HA 2FPFA 4MZMA 5CQXA 1HK9A 1Q82R 4PJLA 4PJOB 5GMKm 3CCVQ 2MOXA 2JM9A 2JS0A 3I56Q 3JCMJ 1YNZA 3IQLA 2NUTA 2D8JA 1YHQA 1KK7A 1QCOA 1G2BA 2QXFA 3EGUA 5AYFA 3CXCS 4XTYA 2PUKB 1VQOT 4ORZA 2RI2A 1MHNA 3GF5A 2X3WD 2HL5C 1UG1A 1Y07A 4HT9A 1QWEA 2EPDA 1NJIC 2RK2A 5CAIA 3VYHB 5GANh 4PJOA 1WJRA 2DNUA 4M7AG 1ZHIA 1BI3A 4Q5WA 1SRMA 1UDLA 2VXFA 2X51A 2DZCA 2AKLA 3CMEQ 1I4K1 3AT1B 4GY5A 1U1SA 2GGRA 4C5GA 1M8VA 1VQ4T 3JB9H 1BYMA 5GJVB 5FRMA 2BZYA 4II1A 1X01A 3OYLA 1IRXA 1U8RA 1JJ2S 2EJGA 1SSFA 1PWTA 3A8HB 4XTXA 1M90U 4E6RA 2E41A 3OW2A 2QQ9A 3OMGA 5CKBA 1M5Q1 1KSWA 1NG2A 1XTDA 1Q86R 4FU6A 5I2MA 2D8HA 3V8JA 4DEXA 2DZ9A 1RAHB 3CPWP 5FLXE 1M8MA 1TTHB 1W6XA 3BFMA 1RADB 4PJOD 1K73R 5KE3A 1RL2A 4D8KA 4IUVA 2PQWA 2EJ9A 1YI2T 2HKNA 4KRTA 3GIBA 1D1CA 1Q81R 1FXXA 4Z02A 4PKCC 1M3BA 4Y91A 2EIFA 3OYKA 4E7JA 2KBTA 2QQBA 2PUOB 2ZPFB 5FU6C 1J3TA 1M2OA 2PVDB 3M54A 1Q7YU 3CCQT 2DBKA 1ABQA 1VYUA 2EGEA 1X6OA 4NS5A 1SRLA 4M7AE 2E64A 2MI6A 1VQ5Q 2QYZA 1VQ9A 3HFOA 1LJOA 2DKGA 2RI5A 2A36A 1B3QA 3UATA 3CCEQ 3FEOA 2SRCA 3S3MA 1QP3A 2HSEB 5IXBA 3PIOA 3M58A 3L2VA 1TG0A 1S1NA 4QQDA 1UECA 5FWCA 4AT1B 2KR3A 4ANJA 1UTIA 4PFZA 2EKOA 2RO0A 2F2VA 4F17A 3NGPA 1UJ0A 3CMAT 1MMAA 2A28A 3JCMg 1RAFB 1WHMA 3J81E 3D7SB 4OP0A 4M4ZA 3G7ZA 2GTOA 5CKDA 4P5NA 4JLGA 2E4HA 2HCKA 2X4JA 1E6GA 3UF4A 4DOWA 1UGPB 3NMZC 3OS1A 2H3JA 2RQTA 3NFCA 4M7DG 3QYGB 3CC4A 1GCQC 2GCXA 2OX7A 3EFOB 2E10A 2KGTA 2OTJA 1QCNA 2ZPHB 1WXTA 5FU6B 1AVZC 4M78G 2AT1B 2ESWA 4QVCA 1VQKT 2DXBA 4OB2B 2PVOB 3CPWA 3PMIA 2X3XD 2FG0A 1VYVA 2QK0A 4R56A 2M9UA 3JB9I 1X6GA 2YWWA 3EFOA 1OV3A 2XKOC 4C8QE 3FIFA 1X75C 3RBBB 2VUBA 1P92A 2P0KA 2LT4A 1RLQC 3CBOA 4MMLA 2Y4YA 2XDPA 3M0TA 1LVKA 2COYA 1F1BB 1FX7A 1YJWA 3PT9A 2LQNA 4IKFA 1T3LA 3EHQA 3INZA 2CZ7B 4HVWA 3O8VA 4FSSA 2BUDA 3BDUA 2XMFA 2KMTA 4K11A 4IUQA 2O9SA 1ZBJA 3OBWA 3CC7Q 1XJWB 3P8HA 1VQMQ 1ZA2B 2CDTA 4KBMB 4CRIA 1KD1U 2H8HA 5GAMf 3A8MB 1JB0E 5GAN4 4WCIA 3LX7A 2CSIA 1YBYA 2DJZA 2VC8A 2YUOA 1WLPB 2EYQA 1BIAA 2DTOA 2MAMA 2M16A 3LYIA 4X9DA 1NZ9A 4RTTA 4N4IA 1YITQ 2EGAA 3R6OA 4C92G 1GCQA 1VQ7A 4RG8A 4CC3A 4FSXA 2QEXA 1E7OA 1ZX6A 4C8QC 1ZUKA 3SWNC 5DM7R 2P4TA 1KIKA 1I07A 5LJ3h 4CC7A 4N4HA 4XU1A 2J06A 3OYHA 3CCMA 1KHIA 2KVQG 3CCVA 2RJCA 5D6YA 1LCKA 1ZA1B 3A5ZB 4KUIA 3I56A 1M1FA 5IHKA 2KE9A 2G3RA 3MCAB 2F5KA 2QQSA 4JPBW 2KYBA 1UHCA 2KT8A 3DLLA 2CP5A 4N4GA 1OEBA 2FZCB 1ZLMA 4R0KA 1BI0A 3JV3A 5LJ5h 2NYSA 2KRSA 2DA9A 3OBYA 1NPRA 3TSZA 4J9IA 4J5YA 2J6KA 1WFWA 4KT0E 5HCKA 2ATCB 1M90R 5GAOr 1M1KC 1N9SA 2HEQA 4C8QF 5CKHA 4FYWB 2RK1A 3DKMA 2K2MA 4JS4A 1QVGS 2YRVA 1GFCA 4JS5A 2DD5A 4E7IA 2RB6A 2KT1A 2CP0A 2BE7D 2LMJA 4C8QB 1VQMT 3SWNB 2DL8A 3SB2A 4BACA 3X24B 3UT1A 4Z89A 2CP7A 1D0ZA 3QWXX 2DYIA 4C0FA 3E2UA 4A4FA 2DO3A 1YJ9A 1YFNA 5IT9E 1SHGA 2VGMA 1YHQT 1VQ8Q 2A08A 5A0DA 3KBGA 3BW1A 4X1VA 3BY7A 4J9GA 2IVWA 1FMVA 1Q7YR 3EFRA 4IIMA 3SWNA 4MZTA 3M4YA 4BDYA 2KK4A 1YN8A 2HQHA 4DEYA 2CKKA 3LH0A 3M56A 2EBPA 3OS2A 4O6JA 1VQPQ 3CPFA 3L1AA 5GAMj 2RHUA 1DJ7B 4PJOE 1M9SA 4KH1B 4A4KA 1PHTA 4OMFB 3RUXA 2YT6A 3M57A 2QDLA 4AMCA 2CSQA 4EMHA 3VS1A 1HXDA 3H6ZA 1Y0MA 1VQ5A 3OYJA 4WF2A 5GANd 5D6XA 1XQHA 2Y90A 1WPYA 3AHUA 4FYVB 3PTAA 3VS7A 3RKYA 3QXEB 2JW4A 3CC4Q 4BE0A 3CCEA 2GQIA 2FEIA 1KG1A 3MP8A 2EGCA 1Q82C 2I0NA 3X20B 4XK8E 2ZPGB 5GAN2 4F16A 5EG2A 3JB9D 1YJNQ 5IH2A 4OB3B 5FROA 3RKWA 1UE9A 2VASA 2YRCA 3EG3A 3U23A 2E6NA 3DB4A 4PLIA 1TWBA 4OMQA 4J9DA 5IXFA 1WHKA 4QKUA 2GFUA 3M0UA 1RAEB 1M3AA 5A0GA 1WXUA 4J7FA 2P0PA 8AT1B 1A0NB 5GJWB 1JEGA 2X4YA 1SG5A 3A98A 1YIJQ 5KH6A 2KI7A 1O9SA 1R8OB 2JVVA 1K9MU 2NLUA 4KGXB 4E7HA 1VQ9T 3G4SQ 3PMTA 1WI7A 2MK5A 2EWNA 2WSEE 2B8AA 2V8IA 3J80E 1QLYA 6AT1B 1PD1A 3MPUB 3REBB 3OMCA 2GNCA 2K57A 1EZZB 2KRMA 1G83A 5J3BA 4JRKA 3C4SA 4AFUC 1KD1R 5IHNA 2QQRA 3M0RA 1Q86C 4JRPA 2ZAEA 1QMCA 3JRZA 1X43A 1WHLA 4B6MA 3Q1JA 4DOVA 4QVZA 2EYWA 4FT4A 3EH2A 2FB7A 3PVLA 4JJBA 4IUUA 1K73C 2HKQB 1VQ7Q 1KHCA 3CC7A 1N27A 2QEXQ 1KQSS 3CC4T 5CO7A 2YUNA 2OTJT 2SEMA 1Q81C 2AZVA 4DBRA 2KDSA 3CCMQ 1JBMA 1C6VX 2ZPBB 3CEYA 2RHIA 1FWZA 4PL6A 4IIOA 4LNPA 2JXBA 3MEUA 4XU2A 3GP8A 3NTKA 2HMAA 2E12A 1AZEA 2EJFA 2QQAA 2DVEA 1RABB 3QHSA 2HNIA 4BDZA 3T9NA 1YITA 3P8DA 3M5AA 1AWOA 4JZ4A 4BE1A 4OB0B 1BI2A 4NL3A 2FHDA 2A0FB 1M1GA 2BE9B 3C95A 2JJ9A 3M0QA 3CCJQ 1YJWT 3H0IA 1UGVA 3G6EA 1I0CA 1U06A 2KXCA 2K5IA 1PRLC 1FMKA 3LH5A 3QUIA 2RI3A 4AG2C 3TREA 1D0XA 3I9QA 1VQNA 4HCCA 4E7SA 1WA7A 2E65A 3MJXA 4HXJA 1TUGB 2CREA 1ABOA 2A3LA 4D8DA 4LUDA 4E47A 2YSQA 3GNGA 3UPUA 1YJ9Q 2VXEA 2KROA 1K8AU 5J26A 4F14A 2YRDA 3LWHA 2ECZA 4QT7A 2JM8A 1BI1A 4RTUA 2F2WA 3SDZA 4QVDA 1QVFP 4AFZC 1VQLA 4KH0B 2CP3A 1VQ7T 5GMKh 1VA7A 3RKXA 2JT4A 2QEXT 4M77C 1RACB 2CUDA 1LNXA 3ME9A 2MIOA 1R77A 5GANf 4HA8A 2QGFB 4B9XA 1V76A 5L23A 3CCMT 1OOTA 4OGEA 3CCVT 5GAOp 1X69A 1CKBA 1SHFA 3OYYA 5M9OA 3I56T 3FLGA 1W1FA 4C8QG 1VQ8A 3RMSA 1B34B 5LL6S 1SEMA 3P8BB 2AIRB 1K0XA 1GL5A 2E70A 2BZXA 4EMKB 1ARKA 2HQXA 2ROLA 5LJ3d 2OTLA 3L2QA 1TU0B 2LX9A 4RUGA 1H641 1Y96B 2XHCA 2RM4A 2M51A 2A37A 2KYMA 1G8XA 1NBEB 1VQPA 3HTRA 1UGRB 1QQJA 1XNIA 4IUTA 5KCOA 3M55A 3GOXA 2J6OA 4M77F 1UUEA 2DPPB 4E2FB 1R0CB 4E7ZA 1B34A 1N9RA 2FPEA 5GAMg 3C0CA 3CMET 3MP1A 3JCMX 2FVUA 4EMKA 5CKEA 4GLMA 2K3XA 5LJ5d 4RG2A 2CUBA 4M77B 5FWBA 3CD6Q 1Y96A 1WDXA 2CH4A 4QQ6A 1W2BP 1OI1A 3FB9A 2BTTA 1MNEA 1NE8A 2WSCE 2LX7A 2YLBA 1BCMA 2W10A 1YJ9T 3OS5A 4OMMA 3OW2S 2Y4XA 4X9CA 2P4RA 2F69A 3KXTA 3QG1A 3HHTB 1YJNA 5HY6A 1TOVA 4J6WA 2LP5A 4FW1A 2ZCFB 5I22A 2D1XA 3OA6A 2RHZA 4M77A 4IURA 3A8LB 3E19A 1JXOA 3JCMh 1NPPA 2RHYA 1QVFA 2ZGWA 2P0QA 4RTVA 4ZN1A 1K9MR 2HL3A 1IGQA 1N8RU 2BZ8A 2RD1A 5KYUB 2K2VA 3H9NA 4A4HA 4JUVA 4L6V5 4PK4A 3JCMQ 3LW5E 2DFUA 1VIEA 1JRIA 2DETA 3X28B 3OS0A 4F04B 4XU3A 2YUQA 3E1SA 3WVDB 3RESA 3PVQA 3X25B 1M90C 2DK3A 2FZKB 2MWPA 1YIJA 3CQTA 3GNFB 2K3YA 2JTEA 1VQ5T 2QAZA 2MYSA 1KC8U 3CCLQ 3EGXB 4L59A 1GBQA 2JZ2A 3G4SA 4NL2A 5KYUA 1M2VB 2BKDN 1YWPA 2EYXA 4WTOB 1N5ZA 4C0GA 2DERA 3JCMb 1AEYA 3CCET 3A1PA 3M9QA 1MNDA 2L89A 1OZ2A 4M77D 4LDUA 2R58A 4XTUA 2J6FA 3M53A 1T0HA 1PG5B 3S3NA 3FJ5A 2LCLA 3GPLA 5GANj 2K9GA 4DBQA 3QSUA 3EGXA 4J9CA 4JLIA 2DL4A 2HQEA 1M2VA 1PNJA 4C0ZA 3CBPA 1Q7YC 4BI3A 5I2SA 3LGLA 2LNVA 1X27A 2WSFE 2V1QA 3CCRQ 9ATCB 5CVIA 4JJNK 1NLPC 4MDWA 2FL7A 4AG1C 2PZ1A 1Y57A 2MWOA 1W2BA 2LJ3A 2E1HA 1OU8A 2O01E 5GAN5 4QW2A 3H8ZA 3G6EQ 3VKIA 4FT2A 1I5OB 3A8GB 3QJYA 2EVRA 3I55Q 1G3YA 3OYDA 3G71Q 2M1HA 1OPKA 1VQNQ 3OSSC 3CPWS 4M75E 2DVJA 2XDDA 1WYXA 3JCMV 2JMAA 1HD3A 3FJPA 4FM4B 1KFZA 4PJOG 1YCSB 5HK0A 1GBRA 1WXBA 1B07A 3F70A 3H0HA 4XQ3A 3RERA 3EAEA 2QASA 2M0YA 4HVUA 1PSEA 2CS7A 5GAOl 1TUCA 3QZ5B 1SPKA 3CCJA 1XOVA 3VS5A 2VVKA 4OGCA 2LQ8A 3CC2A 2C0TA 4O5VA 3JB9F 2EYZA 1VQLQ 3QDRB 1U3OA 1LOJA 3CC7T 4LDVA 5C6SA 1VUBA 4PJMA 3TVTA 1SF9A 2K3BA 5IAYA 3CXCP 4Z8AA 2L3PA 4HT8A 2NUZA 2D0QB 2XK0A 3MKDA 2LT1A 1UJYA 4LXCA 3OYIA 1WX6A 4FYYB 1WZOA 2C0OA 2ABLA 3OB9A 1D1AA 1NEGA 5GAN3 3WVEB 1TH7A 3HP9A 3QDFA 5ECAA 3VYGA 1WQWA 2X4XA 2XI9A 3PFSA 3J7AF 1BBZA 7AT1B 1VQ6Q 2RJDA 4HCBA 1PM3A 1AWXA 5GANe 1YITT 1IREB 4M75C 1IB8A 2HBWA 4GBQA 2OTLQ 3JCMP 3JSCA 1WHJA 1OPLA 2QG9B 3WXMB 2DE0X 4MMKA 2PU9B 5HK3A 1VOMA 2EW3A 1KD1C 4ZTJA 2EQJA 1E6HA 1NYGA 2DRKA 1RUWA 2D0NA 4PLLA 3G6ET 1JJ2P 2RF0A 4RCCA 4ZGJB 3ZBDA 4Y92A 2RQRA 1UHFA 4TVRA 2GQVA 1MMDA 1CSKA 1PKSA 4ZNXA 1MMNA 1VQNT 3PGGA 3TEEA 2R5MA 2VKNA 2QA4Q 4X34A 3NHNA 3S6WA 1X2QA 4M7DB 4A53A 3OYBA 1KQ2A 4BY6C 3EFSA 1Z9QA 2L0AA 1C1AA 4GLKA 2DL3A 3ULRB 1NJIU 3VS3A 2V1RA 4M75F 2O9VA 3CCSQ 2JUFA 2RA2A 1NEBA 2J05A 1NYFA 3H41A 2E3IA 3EG0A 1RLPC 3QJ6A 1V1CA 1VQLT 4M75B 4XTZA 2DXUA 5GAN6 5GAN8 4R55A 4M7DA 3TCJA 3X26B 2K5LA 2NUPB 4LDYA 2DXCA 3CD6A 1X6BA 3CXCA 1K4US 1QKWA 1BIBA 4V2SA 1N8RR 1QCFA 2MPXC 1VQOQ 2MF2A 4C5EA 3MEAA 2OAUA 2CZ1B 4LD6A 3S3OA 3V8KA 2CT4A 1I8FA 2DTHA 1VQ8T 3CCUA 2EFIA 4M75A 2V8KA 2O31A 2EYYA 4EMGA 4FYXB 3JCMW 2F5TX 2NUPA 3DB3A 2D6FA 1S72A
chains in the Genus database with same CATH topology
2ECZA 4QT7A 3RBBB 1SSHA 1RI9A 2JM8A 4J9HA 4RTZA 1RLQC 4RTUA 2F2WA 1MUZA 1K9AA 4AFZC 3M0TA 3EG2A 2EKHA 1BB9A 3I5RA 1AZGB 1VA7A 2LQNA 1T3LA 1ZUYA 3EHQA 2JT4A 4HVWA 4FSSA 2CUDA 2XMFA 3M0SA 2MIOA 2LJ0A 4K11A 2C0IA 2O9SA 5L23A 1ZBJA 2LCSA 1OOTA 1M3CA 2CDTA 1X69A 3VS6A 2H8HA 1CKBA 1JU5C 1SHFA 4LUEA 3KFVA 1W1FA 2DBMA 2K7AA 4WCIA 2NWMA 1SEMA 2VWFA 2CSIA 1K0XA 1GL5A 2BZXA 3EG1A 2YUOA 1WLPB 2ENMA 2FRYA 1ARKA 2ROLA 3SEMA 2F2XA 2O88A 4OMPA 2HSPA 2LJ1A 4LN2A 4RUGA 4J9BA 4LE9A 2PNIA 4RTTA 3VRZA 2L2PA 2M51A 2A37A 2J7IA 2KYMA 2EGAA 1GCQA 4AFSC 2RMOA 4CC3A 1E7OA 1ZX6A 1ZUKA 2OJ2A 2J6OA 1T3SA 1UUEA 1ZSGA 4HVVA 2FPEA 2GBQA 3C0CA 1KIKA 1I07A 1PRMC 2YUPA 4CC7A 4ESRA 4OMLA 2J06A 3VS0A 4GLMA 3SHWA 2YDLA 1QWFA 2DMOA 2PTKA 1UFFA 2CUBA 1JO8A 1X2KA 5FWBA 3NPFA 4RTWA 4JJDA 1LCKA 3EHRA 2KNBB 1WDXA 2CH4A 5IHKA 2KE9A 2BTTA 1NLOC 1GCPA 4JPBW 2KYBA 2RNAA 2LX7A 1UHCA 2KT8A 2W10A 4RTYA 1OEBA 1K76A 4OMMA 3GBQA 2P4RA 1ZLMA 4R0KA 2G6FX 2DYBA 3JV3A 2RPNA 2LP5A 2KRSA 2DA9A 5I22A 1NM7A 2D1XA 2DX1A 3TSZA 5I11A 4J9IA 1JXOA 2J6KA 4JJCA 1AOJA 4CC4B 3H0FA 1WFWA 2E5KA 5HCKA 2DRMA 4RTVA 1AWWA 2B86A 2HEQA 2BZ8A 2RN8A 4OMNA 2K2MA 2ROTA 2IIMA 3TSWA 4J9EA 1GFCA 2GTJA 2DL5A 2LZ6B 2KT1A 2L3SA 2KEAA 1YWOA 2LMJA 2YUQA 4AFQC 2K6DA 3PE0A 2DL8A 3PVQA 1H3HA 4Z89A 3QWXX 3CQTA 2RQVA 2RQUA 2LNHB 5EC7A 2JTEA 2MCNA 2FPDA 2DM1A 3VS2A 1GBQA 1TUDA 3M0PA 1YP5A 4CC2A 1SHGA 1BK2A 3I5SA 1YWPA 2EYXA 1EFNA 2A08A 1N5ZA 1AEYA 4X1VA 4J9GA 1GRIA 1M27C 2AK5A 4IIMA 1K0SA 1MV3A 2CT3A 2JS2A 2FRWA 1JXMA 2J6FA 1YN8A 3O5ZA 1T0HA 4DEYA 3FJ5A 2LQWA 2K9GA 1CKAA 1WIEA 2EBPA 4J9CA 2DL4A 4OMOA 1PNJA 2HDAA 1PHTA 1K1ZA 2YT6A 1AD5A 2QDLA 1QKXA 2CSQA 1X27A 2FPFA 2V1QA 3VS1A 3THKA 1NLPC 2K79A 1Y0MA 3QWYA 4AG1C 2PZ1A 1Y57A 2LJ3A 2MOXA 2JM9A 2CH4W 2JS0A 4HCKA 1YNZA 3IQLA 3VS7A 2D8JA 2JW4A 3UA7A 1G2BA 3EGUA 1FYNA 2GQIA 2FEIA 2EVRA 2EQIA 4Z88A 2EGCA 4ORZA 1I1JA 2I0NA 2X3WD 3R6NA 1OPKA 1UG1A 1QWEA 4F16A 3RNJA 2KXDA 2EPDA 5IH2A 2DVJA 2JMCA 1WYXA 2OAWA 2JMAA 1HD3A 1KFZA 2DNUA 1UE9A 3VRYA 1YCSB 1GBRA 3EG3A 3U23A 1WXBA 1B07A 3H0HA 1T0JA 3ZL7C 1SRMA 1UDLA 2M0YA 4HVUA 4OMQA 1TUCA 4J9DA 1SPKA 2AKLA 2ED0A 1XOVA 2DLPA 5IXFA 2W0ZA 3VS5A 1W70A 2VVKA 2GGRA 2C0TA 3M0UA 5GJVB 2EYZA 1M3AA 2BZYA 1WXUA 1A0NB 5GJWB 1JEGA 1U3OA 3A98A 1PWTA 4RTXA 3TVTA 2K3BA 4E6RA 1AWJA 4Z8AA 2L3PA 2KRNA 2NUZA 1UJYA 1KSWA 1NG2A 1WX6A 1WI7A 2C0OA 2D8HA 2ABLA 4DEXA 1NEGA 1QLYA 1HJDA 1M8MA 5ECAA 1W6XA 3REBB 2GNCA 4A63B 2KRMA 1G83A 1BBZA 4AFUC 2AKKA 4D8KA 5IHNA 1AWXA 3M0RA 4KRTA 1X43A 4GBQA 2HBWA 4JZ3A 2OI3A 2EYWA 1OPLA 2DILA 1BU1A 3REAB 1M3BA 2KBTA 3PVLA 4JJBA 3I35A 2DE0X 5FW9A 1J3TA 2EW3A 2RQWA 1E6HA 2DBKA 1NYGA 1ABQA 2DRKA 1VYUA 2EGEA 1RUWA 2D0NA 1SRLA 2RF0A 1HSQA 2YUNA 4Y92A 2SEMA 2AZVA 2RQRA 1UHFA 2DL7A 1CSKA 2O2OA 1PKSA 4ZNXA 2A36A 1B3QA 3UATA 2SRCA 2VKNA 3NHNA 5IXBA 1TG0A 4IIOA 1S1NA 1X2QA 4LNPA 2JXBA 1UECA 5FWCA 2ED1A 2KR3A 1AZEA 1H8KA 1UTIA 1IO6A 1Z9QA 2L0AA 2F2VA 2DL3A 1PKTA 3ULRB 4F17A 1AWOA 4JZ4A 2V1RA 3NGPA 1Z9ZA 2O9VA 3VS3A 3VS4A 1UJ0A 2DF6A 1NEBA 2A28A 2J05A 1NYFA 3H41A 4M4ZA 3EG0A 2GTOA 2HCKA 1RLPC 5IHIA 1ZUUA 1E6GA 1V1CA 3UF4A 3M0QA 3NMZC 3H0IA 1KJWA 1UGVA 2RQTA 1I0CA 1U06A 2DJQA 2KXCA 2L3QA 1GCQC 1PRLC 2KGTA 2FO0A 1JQQA 4EIKA 1MV0B 1X6BA 1WXTA 1FMKA 3LH5A 1H92A 4J9FA 4AG2C 1AVZC 1U5SA 1K4US 3I9QA 1QKWA 2ESWA 1WA7A 2AZSA 1QCFA 4HXJA 2CREA 1VYTA 1ABOA 4D8DA 4LUDA 2YSQA 2CT4A 2X3XD 2FG0A 2O31A 1VYVA 2EYYA 2KROA 3UA6A 4F14A 1X6GA 1GFDA 1OV3A 1M30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECZ A;  4QT7 A;  3RBB B;  1SSH A;  1RI9 A;  2JM8 A;  4J9H A;  4RTZ A;  1RLQ C;  4RTU A;  2F2W A;  1MUZ A;  1K9A A;  4AFZ C;  3M0T A;  3EG2 A;  2EKH A;  1BB9 A;  3I5R A;  1AZG B;  1VA7 A;  2LQN A;  1T3L A;  1ZUY A;  3EHQ A;  2JT4 A;  4HVW A;  4FSS A;  2CUD A;  2XMF A;  3M0S A;  2MIO A;  2LJ0 A;  4K11 A;  2C0I A;  2O9S A;  5L23 A;  1ZBJ A;  2LCS A;  1OOT A;  1M3C A;  2CDT A;  1X69 A;  3VS6 A;  2H8H A;  1CKB A;  1JU5 C;  1SHF A;  4LUE A;  3KFV A;  1W1F A;  2DBM A;  2K7A A;  4WCI A;  2NWM A;  1SEM A;  2VWF A;  2CSI A;  1K0X A;  1GL5 A;  2BZX A;  3EG1 A;  2YUO A;  1WLP B;  2ENM A;  2FRY A;  1ARK A;  2ROL A;  3SEM A;  2F2X A;  2O88 A;  4OMP A;  2HSP A;  2LJ1 A;  4LN2 A;  4RUG A;  4J9B A;  4LE9 A;  2PNI A;  4RTT A;  3VRZ A;  2L2P A;  2M51 A;  2A37 A;  2J7I A;  2KYM A;  2EGA A;  1GCQ A;  4AFS C;  2RMO A;  4CC3 A;  1E7O A;  1ZX6 A;  1ZUK A;  2OJ2 A;  2J6O A;  1T3S A;  1UUE A;  1ZSG A;  4HVV A;  2FPE A;  2GBQ A;  3C0C A;  1KIK A;  1I07 A;  1PRM C;  2YUP A;  4CC7 A;  4ESR A;  4OML A;  2J06 A;  3VS0 A;  4GLM A;  3SHW A;  2YDL A;  1QWF A;  2DMO A;  2PTK A;  1UFF A;  2CUB A;  1JO8 A;  1X2K A;  5FWB A;  3NPF A;  4RTW A;  4JJD A;  1LCK A;  3EHR A;  2KNB B;  1WDX A;  2CH4 A;  5IHK A;  2KE9 A;  2BTT A;  1NLO C;  1GCP A;  4JPB W;  2KYB A;  2RNA A;  2LX7 A;  1UHC A;  2KT8 A;  2W10 A;  4RTY A;  1OEB A;  1K76 A;  4OMM A;  3GBQ A;  2P4R A;  1ZLM A;  4R0K A;  2G6F X;  2DYB A;  3JV3 A;  2RPN A;  2LP5 A;  2KRS A;  2DA9 A;  5I22 A;  1NM7 A;  2D1X A;  2DX1 A;  3TSZ A;  5I11 A;  4J9I A;  1JXO A;  2J6K A;  4JJC A;  1AOJ A;  4CC4 B;  3H0F A;  1WFW A;  2E5K A;  5HCK A;  2DRM A;  4RTV A;  1AWW A;  2B86 A;  2HEQ A;  2BZ8 A;  2RN8 A;  4OMN A;  2K2M A;  2ROT A;  2IIM A;  3TSW A;  4J9E A;  1GFC A;  2GTJ A;  2DL5 A;  2LZ6 B;  2KT1 A;  2L3S A;  2KEA A;  1YWO A;  2LMJ A;  2YUQ A;  4AFQ C;  2K6D A;  3PE0 A;  2DL8 A;  3PVQ A;  1H3H A;  4Z89 A;  3QWX X;  3CQT A;  2RQV A;  2RQU A;  2LNH B;  5EC7 A;  2JTE A;  2MCN A;  2FPD A;  2DM1 A;  3VS2 A;  1GBQ A;  1TUD A;  3M0P A;  1YP5 A;  4CC2 A;  1SHG A;  1BK2 A;  3I5S A;  1YWP A;  2EYX A;  1EFN A;  2A08 A;  1N5Z A;  1AEY A;  4X1V A;  4J9G A;  1GRI A;  1M27 C;  2AK5 A;  4IIM A;  1K0S A;  1MV3 A;  2CT3 A;  2JS2 A;  2FRW A;  1JXM A;  2J6F A;  1YN8 A;  3O5Z A;  1T0H A;  4DEY A;  3FJ5 A;  2LQW A;  2K9G A;  1CKA A;  1WIE A;  2EBP A;  4J9C A;  2DL4 A;  4OMO A;  1PNJ A;  2HDA A;  1PHT A;  1K1Z A;  2YT6 A;  1AD5 A;  2QDL A;  1QKX A;  2CSQ A;  1X27 A;  2FPF A;  2V1Q A;  3VS1 A;  3THK A;  1NLP C;  2K79 A;  1Y0M A;  3QWY A;  4AG1 C;  2PZ1 A;  1Y57 A;  2LJ3 A;  2MOX A;  2JM9 A;  2CH4 W;  2JS0 A;  4HCK A;  1YNZ A;  3IQL A;  3VS7 A;  2D8J A;  2JW4 A;  3UA7 A;  1G2B A;  3EGU A;  1FYN A;  2GQI A;  2FEI A;  2EVR A;  2EQI A;  4Z88 A;  2EGC A;  4ORZ A;  1I1J A;  2I0N A;  2X3W D;  3R6N A;  1OPK A;  1UG1 A;  1QWE A;  4F16 A;  3RNJ A;  2KXD A;  2EPD A;  5IH2 A;  2DVJ A;  2JMC A;  1WYX A;  2OAW A;  2JMA A;  1HD3 A;  1KFZ A;  2DNU A;  1UE9 A;  3VRY A;  1YCS B;  1GBR A;  3EG3 A;  3U23 A;  1WXB A;  1B07 A;  3H0H A;  1T0J A;  3ZL7 C;  1SRM A;  1UDL A;  2M0Y A;  4HVU A;  4OMQ A;  1TUC A;  4J9D A;  1SPK A;  2AKL A;  2ED0 A;  1XOV A;  2DLP A;  5IXF A;  2W0Z A;  3VS5 A;  1W70 A;  2VVK A;  2GGR A;  2C0T A;  3M0U A;  5GJV B;  2EYZ A;  1M3A A;  2BZY A;  1WXU A;  1A0N B;  5GJW B;  1JEG A;  1U3O A;  3A98 A;  1PWT A;  4RTX A;  3TVT A;  2K3B A;  4E6R A;  1AWJ A;  4Z8A A;  2L3P A;  2KRN A;  2NUZ A;  1UJY A;  1KSW A;  1NG2 A;  1WX6 A;  1WI7 A;  2C0O A;  2D8H A;  2ABL A;  4DEX A;  1NEG A;  1QLY A;  1HJD A;  1M8M A;  5ECA A;  1W6X A;  3REB B;  2GNC A;  4A63 B;  2KRM A;  1G83 A;  1BBZ A;  4AFU C;  2AKK A;  4D8K A;  5IHN A;  1AWX A;  3M0R A;  4KRT A;  1X43 A;  4GBQ A;  2HBW A;  4JZ3 A;  2OI3 A;  2EYW A;  1OPL A;  2DIL A;  1BU1 A;  3REA B;  1M3B A;  2KBT A;  3PVL A;  4JJB A;  3I35 A;  2DE0 X;  5FW9 A;  1J3T A;  2EW3 A;  2RQW A;  1E6H A;  2DBK A;  1NYG A;  1ABQ A;  2DRK A;  1VYU A;  2EGE A;  1RUW A;  2D0N A;  1SRL A;  2RF0 A;  1HSQ A;  2YUN A;  4Y92 A;  2SEM A;  2AZV A;  2RQR A;  1UHF A;  2DL7 A;  1CSK A;  2O2O A;  1PKS A;  4ZNX A;  2A36 A;  1B3Q A;  3UAT A;  2SRC A;  2VKN A;  3NHN A;  5IXB A;  1TG0 A;  4IIO A;  1S1N A;  1X2Q A;  4LNP A;  2JXB A;  1UEC A;  5FWC A;  2ED1 A;  2KR3 A;  1AZE A;  1H8K A;  1UTI A;  1IO6 A;  1Z9Q A;  2L0A A;  2F2V A;  2DL3 A;  1PKT A;  3ULR B;  4F17 A;  1AWO A;  4JZ4 A;  2V1R A;  3NGP A;  1Z9Z A;  2O9V A;  3VS3 A;  3VS4 A;  1UJ0 A;  2DF6 A;  1NEB A;  2A28 A;  2J05 A;  1NYF A;  3H41 A;  4M4Z A;  3EG0 A;  2GTO A;  2HCK A;  1RLP C;  5IHI A;  1ZUU A;  1E6G A;  1V1C A;  3UF4 A;  3M0Q A;  3NMZ C;  3H0I A;  1KJW A;  1UGV A;  2RQT A;  1I0C A;  1U06 A;  2DJQ A;  2KXC A;  2L3Q A;  1GCQ C;  1PRL C;  2KGT A;  2FO0 A;  1JQQ A;  4EIK A;  1MV0 B;  1X6B A;  1WXT A;  1FMK A;  3LH5 A;  1H92 A;  4J9F A;  4AG2 C;  1AVZ C;  1U5S A;  1K4U S;  3I9Q A;  1QKW A;  2ESW A;  1WA7 A;  2AZS A;  1QCF A;  4HXJ A;  2CRE A;  1VYT A;  1ABO A;  4D8D A;  4LUD A;  2YSQ A;  2CT4 A;  2X3X D;  2FG0 A;  2O31 A;  1VYV A;  2EYY A;  2KRO A;  3UA6 A;  4F14 A;  1X6G A;  1GFD A;  1OV3 A;  1M30 A; 
#chains in the Genus database with same CATH topology
 2OTL T;  4RTZ A;  4J9H A;  1ACM B;  5KYW A;  1KC8 R;  1K9A A;  4BY6 B;  2QI2 A;  3I5R A;  2X4W A;  1AZG B;  4VUB A;  4CI0 C;  1VQP T;  2KAF A;  1TSF A;  1VQ4 Q;  2WAC A;  1IXD A;  2V26 A;  1D3B B;  1PD0 A;  4F7U E;  4M7D D;  1PC0 A;  1JJ2 A;  5LJ3 j;  2K4Y A;  3VJP A;  1OX9 A;  3QBY A;  3VS6 A;  4C92 B;  1RAG B;  3QII A;  3CCL A;  3TU4 K;  2NWM A;  5GMK l;  5I21 A;  4M75 D;  2CGH A;  2FRY A;  2ENM A;  1D3B A;  2R5A A;  3VUZ A;  2F2X A;  2O88 A;  4HCZ A;  4OMP A;  2LJ1 A;  1YCY A;  1YJN T;  1PCX A;  3OQ5 A;  5LJ5 j;  4J9B A;  2CP2 A;  3QKJ A;  2PNI A;  4XTW A;  3VRZ A;  1YI2 Q;  4C92 A;  5GAN g;  1G3S A;  2RMO A;  3L2U A;  4A54 A;  1KQ1 A;  2X9H A;  4JRI A;  2OJ2 A;  4M77 E;  4RKU E;  2DD4 A;  4DA4 A;  3EH1 A;  2HAX A;  2YUP A;  3CCR A;  1V29 B;  4OML A;  2L8D A;  4J6Y A;  3VS0 A;  3CCQ Q;  2YDL A;  1QWF A;  2DMO A;  2PTK A;  1UFF A;  2KY9 A;  4KUL A;  1JO8 A;  1O75 A;  4E7K A;  1WJS A;  3NTH A;  4RTW A;  4JJD A;  5GAM d;  3EHR A;  3ER0 A;  3JCM d;  3OY9 A;  4LD9 K;  1YIJ T;  3CC2 Q;  4LDX A;  2RNA A;  4BI8 B;  3I55 A;  2X35 A;  4RTY A;  1ZSZ C;  4RMO A;  3G71 A;  3EG9 B;  4ATO A;  3HRT A;  3G4S T;  3ASK A;  2G6F X;  2DYB A;  1RAA B;  4EMK C;  4KGV B;  1NM7 A;  5KE2 A;  1AOJ A;  5CQY A;  4CC4 B;  1UGS B;  3CMA Q;  2DRM A;  4C92 D;  4C5I A;  3HL8 A;  2CZ6 B;  4ELZ C;  4OMN A;  5A2Q E;  2JOY A;  2ROT A;  2IIM A;  3RMQ A;  2P84 A;  3TSW A;  2L5Q A;  2GTJ A;  3EG9 A;  3URG A;  1PSF A;  2DL5 A;  2IG0 A;  4XTV A;  1GXI E;  2LCC A;  2QDY B;  4AFQ C;  5A0L A;  5DY9 A;  1QVP A;  1H3H A;  1EX4 A;  1K9M C;  3G1J A;  2COW A;  5LJ3 e;  1UGQ B;  5KYX B;  4F7U F;  2RQV A;  2RQU A;  4IUP A;  2LNH B;  1VQK Q;  2KQW A;  4BE2 A;  2XID A;  8ATC B;  1Q95 G;  2MCN A;  2FPD A;  4QQG A;  1TUD A;  1YP5 A;  3N5B B;  4CC2 A;  5KYN A;  1BK2 A;  1U1T A;  2EQK A;  4F7U B;  4A4G A;  2XIC A;  3MO8 A;  4OF1 A;  4OB1 B;  4BD3 A;  1IHW A;  2FYK A;  1ZSZ B;  2L3R A;  2QTX A;  1GRI A;  1M27 C;  3OYF A;  3JB9 G;  1VQ6 A;  2E6Z A;  4HKE A;  5LJ5 e;  1IHV A;  2VGN A;  5KYX A;  1OQK A;  2KSS A;  2LQW A;  1UEB A;  1WIE A;  5D6W A;  2HZY A;  1TS9 A;  2ZPI B;  1QVG P;  4OMO A;  2HDA A;  4F7U A;  4FW2 A;  4ZTF A;  1K1Z A;  1B7T A;  2LTO A;  1AD5 A;  4ME7 A;  1QKX A;  3CCJ T;  3BDL A;  1OU9 A;  3OYG A;  1ZSZ A;  4NOY A;  3CC2 T;  3THK A;  2K79 A;  1ZQ1 A;  4Y28 E;  3QWY A;  2CH4 W;  4E7L A;  3LWI A;  1NJI R;  4HCK A;  1OYX A;  3M59 A;  2QTV A;  3UA7 A;  1FYN A;  4DQ2 A;  4KUD K;  1H3Z A;  3JCM c;  1SKU B;  2QA4 A;  5C0M A;  1VIF A;  2EQI A;  4Z88 A;  2CYZ B;  1I1J A;  3R6N A;  2JTM A;  2LVM A;  2LQK A;  1I5L A;  3RNJ A;  2KXD A;  5D7U A;  3QZ9 B;  2JMC A;  2OAW A;  3PNW C;  2PVG B;  3VRY A;  3CCS A;  2DAQ A;  3CCU Q;  5KCH A;  1W4S A;  5FRN A;  1T0J A;  3HRU A;  3ZL7 C;  4PFP A;  3GLX A;  4JRQ A;  2ZPE B;  5GAM h;  3OYN A;  2DIG A;  2EQM A;  1M1K U;  3MEV A;  1S72 Q;  2ED0 A;  2DLP A;  2W0Z A;  1W70 A;  1HYO A;  2RJE A;  4EPC A;  1Y7X A;  1OZ3 A;  2RH2 A;  3LGF A;  2VB6 A;  4XAX B;  4D6W A;  2A7Y A;  3VU3 C;  4M7A C;  4ELY C;  2M02 A;  2JTF A;  4M75 G;  4RTX A;  1AWJ A;  1VQO A;  2KRN A;  1QP2 A;  4MDX A;  1K8A C;  3QO3 A;  3JAM E;  3NTI A;  2JN0 A;  2CP6 A;  2V8J A;  1HJD A;  2XG8 D;  3ZEH A;  4A63 B;  4FL6 A;  4DBH A;  4PNO A;  3QYH B;  2DTI A;  5L8R E;  2AKK A;  4J8O A;  1QVG A;  4JZ3 A;  2OI3 A;  1BU1 A;  2DIL A;  5AT1 B;  1VQ4 A;  3FRN A;  3REA B;  5KYY B;  3I35 A;  1AT1 B;  2O4X B;  5FW9 A;  2RQW A;  3JCM f;  2R57 A;  1WHG A;  5LJ3 g;  4M7A F;  3HPW A;  3OYC A;  1HSQ A;  3MHX A;  1I81 A;  4JDS A;  4PFO A;  2IPO B;  3CD6 T;  2DL7 A;  2O2O A;  4M7D E;  1YHQ Q;  3C94 A;  4M7A B;  3L2Z A;  1WQ7 A;  3MP6 A;  5DLQ E;  1LPL A;  5KYY A;  4N0A C;  4M78 E;  2ED1 A;  3CCU T;  1H8K A;  2O4X A;  1N6A A;  1Q82 U;  2CZ0 B;  1IO6 A;  3VUB A;  5LJ5 g;  1YI2 A;  1G3T A;  2Z0W A;  1QW1 A;  1PKT A;  3SFM A;  1Z9Z A;  5CK9 A;  3VS4 A;  1S72 T;  2DF6 A;  1QVF S;  2VYT A;  4BB7 A;  1MMG A;  4M7A A;  5IHI A;  1ZUU A;  2LDM A;  3MET A;  3SD4 A;  3UDC A;  3L42 A;  5GMK j;  3CCQ A;  1KJW A;  3RDV A;  3HRS A;  3TQ7 P;  1C0M A;  2DJQ A;  1KQS P;  2L3Q A;  3L2W A;  4FIB A;  2FO0 A;  1JQQ A;  1ZBX A;  2K5F A;  4EIK A;  2BIV A;  1MV0 B;  1H92 A;  4J9F A;  2C06 A;  1U5S A;  1K8A R;  2AZS A;  2M0O A;  5GAO q;  3BE3 A;  1VYT A;  3CCL T;  5FU7 C;  4C0D C;  5CCA A;  2XDB A;  1BKB A;  3E9F A;  2DIQ A;  4M7D C;  1G5V A;  5GAO m;  3UA6 A;  4ZGD B;  4BUG A;  1FMW A;  4ZGE B;  5LJ3 f;  1GFD A;  1M30 A;  3CMA A;  3CME A;  3OYM A;  1N8R C;  1SSH A;  1RI9 A;  3HFN A;  2VV5 A;  1BCO A;  3C12 A;  4M78 C;  1MUZ A;  3EG2 A;  2EKH A;  1BB9 A;  4M7A D;  3M4G A;  4EDU A;  3L2R A;  1Q86 U;  3OYE A;  4J6X A;  2XD0 A;  3KUF A;  4RCB A;  1ZUY A;  3MEW A;  1D09 B;  4YTL A;  3HSB A;  4XU0 A;  3M0S A;  1RI0 A;  4C92 E;  1M4Z A;  2LJ0 A;  3CCR T;  2C0I A;  1KC8 C;  5LJ5 f;  1K73 U;  5CR2 A;  2LCS A;  1MGQ A;  4N0A A;  1M3C A;  1VQK A;  1JU5 C;  4PJJ A;  4LDW A;  1W2B S;  4LUE A;  3KFV A;  1IGU A;  1WHH A;  1VQ9 Q;  3V7S A;  2DBM A;  4C8Q A;  2K7A A;  3RR6 A;  1Q81 U;  3LLR A;  2VWF A;  3I55 T;  2DXT A;  4BI4 A;  3EG1 A;  3G71 T;  5FU7 B;  4M7D F;  2COZ A;  3SEM A;  3DLM A;  4PJN A;  2ZZD A;  3UWN A;  4C0D B;  5CKF A;  2HSP A;  2EAY A;  2RJF A;  4LN2 A;  3CBM A;  2QGG A;  4LE9 A;  4B9W A;  4M78 F;  4F7U G;  2L2P A;  3FDR A;  2J7I A;  2AHJ B;  3RIR A;  4AFS C;  2I2L A;  5HKC A;  2RHX A;  3V7R A;  4A4E A;  2MMP A;  1WNL A;  2XU8 A;  1T3S A;  4M78 B;  1ZSG A;  4HVV A;  2FZG B;  2GBQ A;  3EGD B;  2YXY A;  1PRM C;  4ESR A;  1KQS A;  2YLC A;  5GMK e;  3SHW A;  2DEQ A;  1IZ6 A;  3OSV A;  1X2K A;  3NPF A;  2OTJ Q;  1TXQ A;  2KNB B;  2H3E B;  3JB9 J;  5CIU A;  3ZFJ A;  4L5G A;  4MZP A;  1NLO C;  1GCP A;  4C92 C;  1D0Y A;  4C8Q D;  2YHT A;  4J7I A;  1EIF A;  1K76 A;  1M1K R;  3GBQ A;  2GFA A;  5IN1 A;  5KYW B;  4M78 A;  3HKS A;  3EGD A;  2RPN A;  4DBF A;  3V7C A;  4OVA A;  2DX1 A;  1Y71 A;  3OYA A;  4M77 G;  5I11 A;  4JJC A;  3H0F A;  2E5K A;  1VQ6 T;  4ZN3 A;  3A8O B;  1AHJ B;  1AWW A;  2B86 A;  2RN8 A;  1OX8 A;  2EQU A;  5GAO n;  4J9E A;  3QPH A;  1YJW Q;  5GMK i;  2LZ6 B;  4PJO C;  2L3S A;  2KEA A;  1YWO A;  4UC4 A;  1D1B A;  2K6D A;  3PE0 A;  1RAI B;  2F1L A;  4C92 F;  4J83 A;  5EC7 A;  2E5Q A;  1UB4 A;  2DM1 A;  3VS2 A;  3M0P A;  1WGS A;  3I5S A;  3OW2 P;  1EFN A;  3E9G A;  4M78 D;  1R0B G;  4C5H A;  1OUL A;  2QA4 T;  2D9T A;  2AK5 A;  2GF7 A;  5GAN 7;  2LRQ A;  1K0S A;  1MV3 A;  2CT3 A;  2HD0 A;  4FCY A;  2JS2 A;  2FRW A;  1JXM A;  3O5Z A;  3PIP A;  5DLO A;  2NUT B;  1CKA A;  5GAM e;  5J39 A;  1WJQ A;  2JNG A;  2LC4 A;  2DEU A;  3CCS T;  3JCM e;  3VV0 A;  2HBP A;  3FC3 A;  3V8L A;  1G3W A;  4PJO F;  1VQM A;  4KGZ B;  2E3H A;  2FPF A;  4MZM A;  5CQX A;  1HK9 A;  1Q82 R;  4PJL A;  4PJO B;  5GMK m;  3CCV Q;  2MOX A;  2JM9 A;  2JS0 A;  3I56 Q;  3JCM J;  1YNZ A;  3IQL A;  2NUT A;  2D8J A;  1YHQ A;  1KK7 A;  1QCO A;  1G2B A;  2QXF A;  3EGU A;  5AYF A;  3CXC S;  4XTY A;  2PUK B;  1VQO T;  4ORZ A;  2RI2 A;  1MHN A;  3GF5 A;  2X3W D;  2HL5 C;  1UG1 A;  1Y07 A;  4HT9 A;  1QWE A;  2EPD A;  1NJI C;  2RK2 A;  5CAI A;  3VYH B;  5GAN h;  4PJO A;  1WJR A;  2DNU A;  4M7A G;  1ZHI A;  1BI3 A;  4Q5W A;  1SRM A;  1UDL A;  2VXF A;  2X51 A;  2DZC A;  2AKL A;  3CME Q;  1I4K 1;  3AT1 B;  4GY5 A;  1U1S A;  2GGR A;  4C5G A;  1M8V A;  1VQ4 T;  3JB9 H;  1BYM A;  5GJV B;  5FRM A;  2BZY A;  4II1 A;  1X01 A;  3OYL A;  1IRX A;  1U8R A;  1JJ2 S;  2EJG A;  1SSF A;  1PWT A;  3A8H B;  4XTX A;  1M90 U;  4E6R A;  2E41 A;  3OW2 A;  2QQ9 A;  3OMG A;  5CKB A;  1M5Q 1;  1KSW A;  1NG2 A;  1XTD A;  1Q86 R;  4FU6 A;  5I2M A;  2D8H A;  3V8J A;  4DEX A;  2DZ9 A;  1RAH B;  3CPW P;  5FLX E;  1M8M A;  1TTH B;  1W6X A;  3BFM A;  1RAD B;  4PJO D;  1K73 R;  5KE3 A;  1RL2 A;  4D8K A;  4IUV A;  2PQW A;  2EJ9 A;  1YI2 T;  2HKN A;  4KRT A;  3GIB A;  1D1C A;  1Q81 R;  1FXX A;  4Z02 A;  4PKC C;  1M3B A;  4Y91 A;  2EIF A;  3OYK A;  4E7J A;  2KBT A;  2QQB A;  2PUO B;  2ZPF B;  5FU6 C;  1J3T A;  1M2O A;  2PVD B;  3M54 A;  1Q7Y U;  3CCQ T;  2DBK A;  1ABQ A;  1VYU A;  2EGE A;  1X6O A;  4NS5 A;  1SRL A;  4M7A E;  2E64 A;  2MI6 A;  1VQ5 Q;  2QYZ A;  1VQ9 A;  3HFO A;  1LJO A;  2DKG A;  2RI5 A;  2A36 A;  1B3Q A;  3UAT A;  3CCE Q;  3FEO A;  2SRC A;  3S3M A;  1QP3 A;  2HSE B;  5IXB A;  3PIO A;  3M58 A;  3L2V A;  1TG0 A;  1S1N A;  4QQD A;  1UEC A;  5FWC A;  4AT1 B;  2KR3 A;  4ANJ A;  1UTI A;  4PFZ A;  2EKO A;  2RO0 A;  2F2V A;  4F17 A;  3NGP A;  1UJ0 A;  3CMA T;  1MMA A;  2A28 A;  3JCM g;  1RAF B;  1WHM A;  3J81 E;  3D7S B;  4OP0 A;  4M4Z A;  3G7Z A;  2GTO A;  5CKD A;  4P5N A;  4JLG A;  2E4H A;  2HCK A;  2X4J A;  1E6G A;  3UF4 A;  4DOW A;  1UGP B;  3NMZ C;  3OS1 A;  2H3J A;  2RQT A;  3NFC A;  4M7D G;  3QYG B;  3CC4 A;  1GCQ C;  2GCX A;  2OX7 A;  3EFO B;  2E10 A;  2KGT A;  2OTJ A;  1QCN A;  2ZPH B;  1WXT A;  5FU6 B;  1AVZ C;  4M78 G;  2AT1 B;  2ESW A;  4QVC A;  1VQK T;  2DXB A;  4OB2 B;  2PVO B;  3CPW A;  3PMI A;  2X3X D;  2FG0 A;  1VYV A;  2QK0 A;  4R56 A;  2M9U A;  3JB9 I;  1X6G A;  2YWW A;  3EFO A;  1OV3 A;  2XKO C;  4C8Q E;  3FIF A;  1X75 C;  3RBB B;  2VUB A;  1P92 A;  2P0K A;  2LT4 A;  1RLQ C;  3CBO A;  4MML A;  2Y4Y A;  2XDP A;  3M0T A;  1LVK A;  2COY A;  1F1B B;  1FX7 A;  1YJW A;  3PT9 A;  2LQN A;  4IKF A;  1T3L A;  3EHQ A;  3INZ A;  2CZ7 B;  4HVW A;  3O8V A;  4FSS A;  2BUD A;  3BDU A;  2XMF A;  2KMT A;  4K11 A;  4IUQ A;  2O9S A;  1ZBJ A;  3OBW A;  3CC7 Q;  1XJW B;  3P8H A;  1VQM Q;  1ZA2 B;  2CDT A;  4KBM B;  4CRI A;  1KD1 U;  2H8H A;  5GAM f;  3A8M B;  1JB0 E;  5GAN 4;  4WCI A;  3LX7 A;  2CSI A;  1YBY A;  2DJZ A;  2VC8 A;  2YUO A;  1WLP B;  2EYQ A;  1BIA A;  2DTO A;  2MAM A;  2M16 A;  3LYI A;  4X9D A;  1NZ9 A;  4RTT A;  4N4I A;  1YIT Q;  2EGA A;  3R6O A;  4C92 G;  1GCQ A;  1VQ7 A;  4RG8 A;  4CC3 A;  4FSX A;  2QEX A;  1E7O A;  1ZX6 A;  4C8Q C;  1ZUK A;  3SWN C;  5DM7 R;  2P4T A;  1KIK A;  1I07 A;  5LJ3 h;  4CC7 A;  4N4H A;  4XU1 A;  2J06 A;  3OYH A;  3CCM A;  1KHI A;  2KVQ G;  3CCV A;  2RJC A;  5D6Y A;  1LCK A;  1ZA1 B;  3A5Z B;  4KUI A;  3I56 A;  1M1F A;  5IHK A;  2KE9 A;  2G3R A;  3MCA B;  2F5K A;  2QQS A;  4JPB W;  2KYB A;  1UHC A;  2KT8 A;  3DLL A;  2CP5 A;  4N4G A;  1OEB A;  2FZC B;  1ZLM A;  4R0K A;  1BI0 A;  3JV3 A;  5LJ5 h;  2NYS A;  2KRS A;  2DA9 A;  3OBY A;  1NPR A;  3TSZ A;  4J9I A;  4J5Y A;  2J6K A;  1WFW A;  4KT0 E;  5HCK A;  2ATC B;  1M90 R;  5GAO r;  1M1K C;  1N9S A;  2HEQ A;  4C8Q F;  5CKH A;  4FYW B;  2RK1 A;  3DKM A;  2K2M A;  4JS4 A;  1QVG S;  2YRV A;  1GFC A;  4JS5 A;  2DD5 A;  4E7I A;  2RB6 A;  2KT1 A;  2CP0 A;  2BE7 D;  2LMJ A;  4C8Q B;  1VQM T;  3SWN B;  2DL8 A;  3SB2 A;  4BAC A;  3X24 B;  3UT1 A;  4Z89 A;  2CP7 A;  1D0Z A;  3QWX X;  2DYI A;  4C0F A;  3E2U A;  4A4F A;  2DO3 A;  1YJ9 A;  1YFN A;  5IT9 E;  1SHG A;  2VGM A;  1YHQ T;  1VQ8 Q;  2A08 A;  5A0D A;  3KBG A;  3BW1 A;  4X1V A;  3BY7 A;  4J9G A;  2IVW A;  1FMV A;  1Q7Y R;  3EFR A;  4IIM A;  3SWN A;  4MZT A;  3M4Y A;  4BDY A;  2KK4 A;  1YN8 A;  2HQH A;  4DEY A;  2CKK A;  3LH0 A;  3M56 A;  2EBP A;  3OS2 A;  4O6J A;  1VQP Q;  3CPF A;  3L1A A;  5GAM j;  2RHU A;  1DJ7 B;  4PJO E;  1M9S A;  4KH1 B;  4A4K A;  1PHT A;  4OMF B;  3RUX A;  2YT6 A;  3M57 A;  2QDL A;  4AMC A;  2CSQ A;  4EMH A;  3VS1 A;  1HXD A;  3H6Z A;  1Y0M A;  1VQ5 A;  3OYJ A;  4WF2 A;  5GAN d;  5D6X A;  1XQH A;  2Y90 A;  1WPY A;  3AHU A;  4FYV B;  3PTA A;  3VS7 A;  3RKY A;  3QXE B;  2JW4 A;  3CC4 Q;  4BE0 A;  3CCE A;  2GQI A;  2FEI A;  1KG1 A;  3MP8 A;  2EGC A;  1Q82 C;  2I0N A;  3X20 B;  4XK8 E;  2ZPG B;  5GAN 2;  4F16 A;  5EG2 A;  3JB9 D;  1YJN Q;  5IH2 A;  4OB3 B;  5FRO A;  3RKW A;  1UE9 A;  2VAS A;  2YRC A;  3EG3 A;  3U23 A;  2E6N A;  3DB4 A;  4PLI A;  1TWB A;  4OMQ A;  4J9D A;  5IXF A;  1WHK A;  4QKU A;  2GFU A;  3M0U A;  1RAE B;  1M3A A;  5A0G A;  1WXU A;  4J7F A;  2P0P A;  8AT1 B;  1A0N B;  5GJW B;  1JEG A;  2X4Y A;  1SG5 A;  3A98 A;  1YIJ Q;  5KH6 A;  2KI7 A;  1O9S A;  1R8O B;  2JVV A;  1K9M U;  2NLU A;  4KGX B;  4E7H A;  1VQ9 T;  3G4S Q;  3PMT A;  1WI7 A;  2MK5 A;  2EWN A;  2WSE E;  2B8A A;  2V8I A;  3J80 E;  1QLY A;  6AT1 B;  1PD1 A;  3MPU B;  3REB B;  3OMC A;  2GNC A;  2K57 A;  1EZZ B;  2KRM A;  1G83 A;  5J3B A;  4JRK A;  3C4S A;  4AFU C;  1KD1 R;  5IHN A;  2QQR A;  3M0R A;  1Q86 C;  4JRP A;  2ZAE A;  1QMC A;  3JRZ A;  1X43 A;  1WHL A;  4B6M A;  3Q1J A;  4DOV A;  4QVZ A;  2EYW A;  4FT4 A;  3EH2 A;  2FB7 A;  3PVL A;  4JJB A;  4IUU A;  1K73 C;  2HKQ B;  1VQ7 Q;  1KHC A;  3CC7 A;  1N27 A;  2QEX Q;  1KQS S;  3CC4 T;  5CO7 A;  2YUN A;  2OTJ T;  2SEM A;  1Q81 C;  2AZV A;  4DBR A;  2KDS A;  3CCM Q;  1JBM A;  1C6V X;  2ZPB B;  3CEY A;  2RHI A;  1FWZ A;  4PL6 A;  4IIO A;  4LNP A;  2JXB A;  3MEU A;  4XU2 A;  3GP8 A;  3NTK A;  2HMA A;  2E12 A;  1AZE A;  2EJF A;  2QQA A;  2DVE A;  1RAB B;  3QHS A;  2HNI A;  4BDZ A;  3T9N A;  1YIT A;  3P8D A;  3M5A A;  1AWO A;  4JZ4 A;  4BE1 A;  4OB0 B;  1BI2 A;  4NL3 A;  2FHD A;  2A0F B;  1M1G A;  2BE9 B;  3C95 A;  2JJ9 A;  3M0Q A;  3CCJ Q;  1YJW T;  3H0I A;  1UGV A;  3G6E A;  1I0C A;  1U06 A;  2KXC A;  2K5I A;  1PRL C;  1FMK A;  3LH5 A;  3QUI A;  2RI3 A;  4AG2 C;  3TRE A;  1D0X A;  3I9Q A;  1VQN A;  4HCC A;  4E7S A;  1WA7 A;  2E65 A;  3MJX A;  4HXJ A;  1TUG B;  2CRE A;  1ABO A;  2A3L A;  4D8D A;  4LUD A;  4E47 A;  2YSQ A;  3GNG A;  3UPU A;  1YJ9 Q;  2VXE A;  2KRO A;  1K8A U;  5J26 A;  4F14 A;  2YRD A;  3LWH A;  2ECZ A;  4QT7 A;  2JM8 A;  1BI1 A;  4RTU A;  2F2W A;  3SDZ A;  4QVD A;  1QVF P;  4AFZ C;  1VQL A;  4KH0 B;  2CP3 A;  1VQ7 T;  5GMK h;  1VA7 A;  3RKX A;  2JT4 A;  2QEX T;  4M77 C;  1RAC B;  2CUD A;  1LNX A;  3ME9 A;  2MIO A;  1R77 A;  5GAN f;  4HA8 A;  2QGF B;  4B9X A;  1V76 A;  5L23 A;  3CCM T;  1OOT A;  4OGE A;  3CCV T;  5GAO p;  1X69 A;  1CKB A;  1SHF A;  3OYY A;  5M9O A;  3I56 T;  3FLG A;  1W1F A;  4C8Q G;  1VQ8 A;  3RMS A;  1B34 B;  5LL6 S;  1SEM A;  3P8B B;  2AIR B;  1K0X A;  1GL5 A;  2E70 A;  2BZX A;  4EMK B;  1ARK A;  2HQX A;  2ROL A;  5LJ3 d;  2OTL A;  3L2Q A;  1TU0 B;  2LX9 A;  4RUG A;  1H64 1;  1Y96 B;  2XHC A;  2RM4 A;  2M51 A;  2A37 A;  2KYM A;  1G8X A;  1NBE B;  1VQP A;  3HTR A;  1UGR B;  1QQJ A;  1XNI A;  4IUT A;  5KCO A;  3M55 A;  3GOX A;  2J6O A;  4M77 F;  1UUE A;  2DPP B;  4E2F B;  1R0C B;  4E7Z A;  1B34 A;  1N9R A;  2FPE A;  5GAM g;  3C0C A;  3CME T;  3MP1 A;  3JCM X;  2FVU A;  4EMK A;  5CKE A;  4GLM A;  2K3X A;  5LJ5 d;  4RG2 A;  2CUB A;  4M77 B;  5FWB A;  3CD6 Q;  1Y96 A;  1WDX A;  2CH4 A;  4QQ6 A;  1W2B P;  1OI1 A;  3FB9 A;  2BTT A;  1MNE A;  1NE8 A;  2WSC E;  2LX7 A;  2YLB A;  1BCM A;  2W10 A;  1YJ9 T;  3OS5 A;  4OMM A;  3OW2 S;  2Y4X A;  4X9C A;  2P4R A;  2F69 A;  3KXT A;  3QG1 A;  3HHT B;  1YJN A;  5HY6 A;  1TOV A;  4J6W A;  2LP5 A;  4FW1 A;  2ZCF B;  5I22 A;  2D1X A;  3OA6 A;  2RHZ A;  4M77 A;  4IUR A;  3A8L B;  3E19 A;  1JXO A;  3JCM h;  1NPP A;  2RHY A;  1QVF A;  2ZGW A;  2P0Q A;  4RTV A;  4ZN1 A;  1K9M R;  2HL3 A;  1IGQ A;  1N8R U;  2BZ8 A;  2RD1 A;  5KYU B;  2K2V A;  3H9N A;  4A4H A;  4JUV A;  4L6V 5;  4PK4 A;  3JCM Q;  3LW5 E;  2DFU A;  1VIE A;  1JRI A;  2DET A;  3X28 B;  3OS0 A;  4F04 B;  4XU3 A;  2YUQ A;  3E1S A;  3WVD B;  3RES A;  3PVQ A;  3X25 B;  1M90 C;  2DK3 A;  2FZK B;  2MWP A;  1YIJ A;  3CQT A;  3GNF B;  2K3Y A;  2JTE A;  1VQ5 T;  2QAZ A;  2MYS A;  1KC8 U;  3CCL Q;  3EGX B;  4L59 A;  1GBQ A;  2JZ2 A;  3G4S A;  4NL2 A;  5KYU A;  1M2V B;  2BKD N;  1YWP A;  2EYX A;  4WTO B;  1N5Z A;  4C0G A;  2DER A;  3JCM b;  1AEY A;  3CCE T;  3A1P A;  3M9Q A;  1MND A;  2L89 A;  1OZ2 A;  4M77 D;  4LDU A;  2R58 A;  4XTU A;  2J6F A;  3M53 A;  1T0H A;  1PG5 B;  3S3N A;  3FJ5 A;  2LCL A;  3GPL A;  5GAN j;  2K9G A;  4DBQ A;  3QSU A;  3EGX A;  4J9C A;  4JLI A;  2DL4 A;  2HQE A;  1M2V A;  1PNJ A;  4C0Z A;  3CBP A;  1Q7Y C;  4BI3 A;  5I2S A;  3LGL A;  2LNV A;  1X27 A;  2WSF E;  2V1Q A;  3CCR Q;  9ATC B;  5CVI A;  4JJN K;  1NLP C;  4MDW A;  2FL7 A;  4AG1 C;  2PZ1 A;  1Y57 A;  2MWO A;  1W2B A;  2LJ3 A;  2E1H A;  1OU8 A;  2O01 E;  5GAN 5;  4QW2 A;  3H8Z A;  3G6E Q;  3VKI A;  4FT2 A;  1I5O B;  3A8G B;  3QJY A;  2EVR A;  3I55 Q;  1G3Y A;  3OYD A;  3G71 Q;  2M1H A;  1OPK A;  1VQN Q;  3OSS C;  3CPW S;  4M75 E;  2DVJ A;  2XDD A;  1WYX A;  3JCM V;  2JMA A;  1HD3 A;  3FJP A;  4FM4 B;  1KFZ A;  4PJO G;  1YCS B;  5HK0 A;  1GBR A;  1WXB A;  1B07 A;  3F70 A;  3H0H A;  4XQ3 A;  3RER A;  3EAE A;  2QAS A;  2M0Y A;  4HVU A;  1PSE A;  2CS7 A;  5GAO l;  1TUC A;  3QZ5 B;  1SPK A;  3CCJ A;  1XOV A;  3VS5 A;  2VVK A;  4OGC A;  2LQ8 A;  3CC2 A;  2C0T A;  4O5V A;  3JB9 F;  2EYZ A;  1VQL Q;  3QDR B;  1U3O A;  1LOJ A;  3CC7 T;  4LDV A;  5C6S A;  1VUB A;  4PJM A;  3TVT A;  1SF9 A;  2K3B A;  5IAY A;  3CXC P;  4Z8A A;  2L3P A;  4HT8 A;  2NUZ A;  2D0Q B;  2XK0 A;  3MKD A;  2LT1 A;  1UJY A;  4LXC A;  3OYI A;  1WX6 A;  4FYY B;  1WZO A;  2C0O A;  2ABL A;  3OB9 A;  1D1A A;  1NEG A;  5GAN 3;  3WVE B;  1TH7 A;  3HP9 A;  3QDF A;  5ECA A;  3VYG A;  1WQW A;  2X4X A;  2XI9 A;  3PFS A;  3J7A F;  1BBZ A;  7AT1 B;  1VQ6 Q;  2RJD A;  4HCB A;  1PM3 A;  1AWX A;  5GAN e;  1YIT T;  1IRE B;  4M75 C;  1IB8 A;  2HBW A;  4GBQ A;  2OTL Q;  3JCM P;  3JSC A;  1WHJ A;  1OPL A;  2QG9 B;  3WXM B;  2DE0 X;  4MMK A;  2PU9 B;  5HK3 A;  1VOM A;  2EW3 A;  1KD1 C;  4ZTJ A;  2EQJ A;  1E6H A;  1NYG A;  2DRK A;  1RUW A;  2D0N A;  4PLL A;  3G6E T;  1JJ2 P;  2RF0 A;  4RCC A;  4ZGJ B;  3ZBD A;  4Y92 A;  2RQR A;  1UHF A;  4TVR A;  2GQV A;  1MMD A;  1CSK A;  1PKS A;  4ZNX A;  1MMN A;  1VQN T;  3PGG A;  3TEE A;  2R5M A;  2VKN A;  2QA4 Q;  4X34 A;  3NHN A;  3S6W A;  1X2Q A;  4M7D B;  4A53 A;  3OYB A;  1KQ2 A;  4BY6 C;  3EFS A;  1Z9Q A;  2L0A A;  1C1A A;  4GLK A;  2DL3 A;  3ULR B;  1NJI U;  3VS3 A;  2V1R A;  4M75 F;  2O9V A;  3CCS Q;  2JUF A;  2RA2 A;  1NEB A;  2J05 A;  1NYF A;  3H41 A;  2E3I A;  3EG0 A;  1RLP C;  3QJ6 A;  1V1C A;  1VQL T;  4M75 B;  4XTZ A;  2DXU A;  5GAN 6;  5GAN 8;  4R55 A;  4M7D A;  3TCJ A;  3X26 B;  2K5L A;  2NUP B;  4LDY A;  2DXC A;  3CD6 A;  1X6B A;  3CXC A;  1K4U S;  1QKW A;  1BIB A;  4V2S A;  1N8R R;  1QCF A;  2MPX C;  1VQO Q;  2MF2 A;  4C5E A;  3MEA A;  2OAU A;  2CZ1 B;  4LD6 A;  3S3O A;  3V8K A;  2CT4 A;  1I8F A;  2DTH A;  1VQ8 T;  3CCU A;  2EFI A;  4M75 A;  2V8K A;  2O31 A;  2EYY A;  4EMG A;  4FYX B;  3JCM W;  2F5T X;  2NUP A;  3DB3 A;  2D6F A;  1S72 A; 
#chains in the Genus database with same CATH homology
 2ECZ A;  4QT7 A;  3RBB B;  1SSH A;  1RI9 A;  2JM8 A;  4J9H A;  4RTZ A;  1RLQ C;  4RTU A;  2F2W A;  1MUZ A;  1K9A A;  4AFZ C;  3M0T A;  3EG2 A;  2EKH A;  1BB9 A;  3I5R A;  1AZG B;  1VA7 A;  2LQN A;  1T3L A;  1ZUY A;  3EHQ A;  2JT4 A;  4HVW A;  4FSS A;  2CUD A;  2XMF A;  3M0S A;  2MIO A;  2LJ0 A;  4K11 A;  2C0I A;  2O9S A;  5L23 A;  1ZBJ A;  2LCS A;  1OOT A;  1M3C A;  2CDT A;  1X69 A;  3VS6 A;  2H8H A;  1CKB A;  1JU5 C;  1SHF A;  4LUE A;  3KFV A;  1W1F A;  2DBM A;  2K7A A;  4WCI A;  2NWM A;  1SEM A;  2VWF A;  2CSI A;  1K0X A;  1GL5 A;  2BZX A;  3EG1 A;  2YUO A;  1WLP B;  2ENM A;  2FRY A;  1ARK A;  2ROL A;  3SEM A;  2F2X A;  2O88 A;  4OMP A;  2HSP A;  2LJ1 A;  4LN2 A;  4RUG A;  4J9B A;  4LE9 A;  2PNI A;  4RTT A;  3VRZ A;  2L2P A;  2M51 A;  2A37 A;  2J7I A;  2KYM A;  2EGA A;  1GCQ A;  4AFS C;  2RMO A;  4CC3 A;  1E7O A;  1ZX6 A;  1ZUK A;  2OJ2 A;  2J6O A;  1T3S A;  1UUE A;  1ZSG A;  4HVV A;  2FPE A;  2GBQ A;  3C0C A;  1KIK A;  1I07 A;  1PRM C;  2YUP A;  4CC7 A;  4ESR A;  4OML A;  2J06 A;  3VS0 A;  4GLM A;  3SHW A;  2YDL A;  1QWF A;  2DMO A;  2PTK A;  1UFF A;  2CUB A;  1JO8 A;  1X2K A;  5FWB A;  3NPF A;  4RTW A;  4JJD A;  1LCK A;  3EHR A;  2KNB B;  1WDX A;  2CH4 A;  5IHK A;  2KE9 A;  2BTT A;  1NLO C;  1GCP A;  4JPB W;  2KYB A;  2RNA A;  2LX7 A;  1UHC A;  2KT8 A;  2W10 A;  4RTY A;  1OEB A;  1K76 A;  4OMM A;  3GBQ A;  2P4R A;  1ZLM A;  4R0K A;  2G6F X;  2DYB A;  3JV3 A;  2RPN A;  2LP5 A;  2KRS A;  2DA9 A;  5I22 A;  1NM7 A;  2D1X A;  2DX1 A;  3TSZ A;  5I11 A;  4J9I A;  1JXO A;  2J6K A;  4JJC A;  1AOJ A;  4CC4 B;  3H0F A;  1WFW A;  2E5K A;  5HCK A;  2DRM A;  4RTV A;  1AWW A;  2B86 A;  2HEQ A;  2BZ8 A;  2RN8 A;  4OMN A;  2K2M A;  2ROT A;  2IIM A;  3TSW A;  4J9E A;  1GFC A;  2GTJ A;  2DL5 A;  2LZ6 B;  2KT1 A;  2L3S A;  2KEA A;  1YWO A;  2LMJ A;  2YUQ A;  4AFQ C;  2K6D A;  3PE0 A;  2DL8 A;  3PVQ A;  1H3H A;  4Z89 A;  3QWX X;  3CQT A;  2RQV A;  2RQU A;  2LNH B;  5EC7 A;  2JTE A;  2MCN A;  2FPD A;  2DM1 A;  3VS2 A;  1GBQ A;  1TUD A;  3M0P A;  1YP5 A;  4CC2 A;  1SHG A;  1BK2 A;  3I5S A;  1YWP A;  2EYX A;  1EFN A;  2A08 A;  1N5Z A;  1AEY A;  4X1V A;  4J9G A;  1GRI A;  1M27 C;  2AK5 A;  4IIM A;  1K0S A;  1MV3 A;  2CT3 A;  2JS2 A;  2FRW A;  1JXM A;  2J6F A;  1YN8 A;  3O5Z A;  1T0H A;  4DEY A;  3FJ5 A;  2LQW A;  2K9G A;  1CKA A;  1WIE A;  2EBP A;  4J9C A;  2DL4 A;  4OMO A;  1PNJ A;  2HDA A;  1PHT A;  1K1Z A;  2YT6 A;  1AD5 A;  2QDL A;  1QKX A;  2CSQ A;  1X27 A;  2FPF A;  2V1Q A;  3VS1 A;  3THK A;  1NLP C;  2K79 A;  1Y0M A;  3QWY A;  4AG1 C;  2PZ1 A;  1Y57 A;  2LJ3 A;  2MOX A;  2JM9 A;  2CH4 W;  2JS0 A;  4HCK A;  1YNZ A;  3IQL A;  3VS7 A;  2D8J A;  2JW4 A;  3UA7 A;  1G2B A;  3EGU A;  1FYN A;  2GQI A;  2FEI A;  2EVR A;  2EQI A;  4Z88 A;  2EGC A;  4ORZ A;  1I1J A;  2I0N A;  2X3W D;  3R6N A;  1OPK A;  1UG1 A;  1QWE A;  4F16 A;  3RNJ A;  2KXD A;  2EPD A;  5IH2 A;  2DVJ A;  2JMC A;  1WYX A;  2OAW A;  2JMA A;  1HD3 A;  1KFZ A;  2DNU A;  1UE9 A;  3VRY A;  1YCS B;  1GBR A;  3EG3 A;  3U23 A;  1WXB A;  1B07 A;  3H0H A;  1T0J A;  3ZL7 C;  1SRM A;  1UDL A;  2M0Y A;  4HVU A;  4OMQ A;  1TUC A;  4J9D A;  1SPK A;  2AKL A;  2ED0 A;  1XOV A;  2DLP A;  5IXF A;  2W0Z A;  3VS5 A;  1W70 A;  2VVK A;  2GGR A;  2C0T A;  3M0U A;  5GJV B;  2EYZ A;  1M3A A;  2BZY A;  1WXU A;  1A0N B;  5GJW B;  1JEG A;  1U3O A;  3A98 A;  1PWT A;  4RTX A;  3TVT A;  2K3B A;  4E6R A;  1AWJ A;  4Z8A A;  2L3P A;  2KRN A;  2NUZ A;  1UJY A;  1KSW A;  1NG2 A;  1WX6 A;  1WI7 A;  2C0O A;  2D8H A;  2ABL A;  4DEX A;  1NEG A;  1QLY A;  1HJD A;  1M8M A;  5ECA A;  1W6X A;  3REB B;  2GNC A;  4A63 B;  2KRM A;  1G83 A;  1BBZ A;  4AFU C;  2AKK A;  4D8K A;  5IHN A;  1AWX A;  3M0R A;  4KRT A;  1X43 A;  4GBQ A;  2HBW A;  4JZ3 A;  2OI3 A;  2EYW A;  1OPL A;  2DIL A;  1BU1 A;  3REA B;  1M3B A;  2KBT A;  3PVL A;  4JJB A;  3I35 A;  2DE0 X;  5FW9 A;  1J3T A;  2EW3 A;  2RQW A;  1E6H A;  2DBK A;  1NYG A;  1ABQ A;  2DRK A;  1VYU A;  2EGE A;  1RUW A;  2D0N A;  1SRL A;  2RF0 A;  1HSQ A;  2YUN A;  4Y92 A;  2SEM A;  2AZV A;  2RQR A;  1UHF A;  2DL7 A;  1CSK A;  2O2O A;  1PKS A;  4ZNX A;  2A36 A;  1B3Q A;  3UAT A;  2SRC A;  2VKN A;  3NHN A;  5IXB A;  1TG0 A;  4IIO A;  1S1N A;  1X2Q A;  4LNP A;  2JXB A;  1UEC A;  5FWC A;  2ED1 A;  2KR3 A;  1AZE A;  1H8K A;  1UTI A;  1IO6 A;  1Z9Q A;  2L0A A;  2F2V A;  2DL3 A;  1PKT A;  3ULR B;  4F17 A;  1AWO A;  4JZ4 A;  2V1R A;  3NGP A;  1Z9Z A;  2O9V A;  3VS3 A;  3VS4 A;  1UJ0 A;  2DF6 A;  1NEB A;  2A28 A;  2J05 A;  1NYF A;  3H41 A;  4M4Z A;  3EG0 A;  2GTO A;  2HCK A;  1RLP C;  5IHI A;  1ZUU A;  1E6G A;  1V1C A;  3UF4 A;  3M0Q A;  3NMZ C;  3H0I A;  1KJW A;  1UGV A;  2RQT A;  1I0C A;  1U06 A;  2DJQ A;  2KXC A;  2L3Q A;  1GCQ C;  1PRL C;  2KGT A;  2FO0 A;  1JQQ A;  4EIK A;  1MV0 B;  1X6B A;  1WXT A;  1FMK A;  3LH5 A;  1H92 A;  4J9F A;  4AG2 C;  1AVZ C;  1U5S A;  1K4U S;  3I9Q A;  1QKW A;  2ESW A;  1WA7 A;  2AZS A;  1QCF A;  4HXJ A;  2CRE A;  1VYT A;  1ABO A;  4D8D A;  4LUD A;  2YSQ A;  2CT4 A;  2X3X D;  2FG0 A;  2O31 A;  1VYV A;  2EYY A;  2KRO A;  3UA6 A;  4F14 A;  1X6G A;  1GFD A;  1OV3 A;  1M30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...