3HRTA

Crystal structure of scar with bound cd2+
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
212
Chain Sequence
b'PNKEDYLKCLYELGTHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
molecule tags Transcription
source organism Streptococcus gordonii
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
total genus 52
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrtA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrtA02
2A07F 3WGHA 1S6LA 1TNTA 3HRMA 2CQKA 5LGTA 1RNLA 1T98A 1G3TA 2XKPA 1T38A 1HW1A 3FWEA 4K2EA 4KIGA 2HYGD 3REOA 4YIFA 1QNTA 2YU3A 4G7HF 1XGNA 5HDKA 1TBXA 2MC3A 2VONA 1XCVA 3GVAA 1SD4A 2CO5A 4N0BA 2Y0MA 1Z91A 1MZBA 1CF7A 4XLPF 2ACJA 1BI0A 5DUIA 3CTAA 3MWMA 4I0AA 4RAZA 5DCMA 3KFWX 1FSEA 1KQ0A 2LF8A 1IF1A 4BNCA 3TDUC 2HDCA 4XBFA 4I98B 4F7ZA 1XD7A 4P96A 4HDUA 2VBZA 2W25A 4IF4A 2EFQA 3CUOA 1QZZA 2LF7A 3N4MA 2QBYB 3ZPLA 1T0FA 1HSJA 1G4DA 3V8KA 4LG0A 5CVRA 1XDUA 2EA2A 1SFEA 4Q47A 4L9VA 4N9IA 4IRGA 1YLFA 1S7OA 5L3EA 2HKXA 1KA8A 3I58A 3K69A 3KZYA 3PQKA 3RYPA 3ELKA 2FBHA 3VB2A 1XSXA 3CJNA 2R3SA 3V7SA 2IA1A 3KLOA 4RB3C 3BZ6A 4WX9A 4RGRA 1K79A 3FF5A 1CF7B 2X4HA 2HTJA 3IHUA 3O3KA 4RGSA 3ZN1A 1P6RA 4M73A 1B6AA 4BH9A 5HS8A 4A0ZA 1LDJA 5FD5A 3SFZA 2GQQA 4EJUA 2QQAA 2EFNA 3F8BA 4Y17A 3EDPA 3ZQ7A 3C7JA 4FHTA 4AIJA 3KZZA 1W7PA 2CFXA 4Z2YA 1NHAA 3E5QA 1MKMA 2AS5F 1YO5C 1GXPA 2A3SA 3J80Z 2DQLA 4ESJA 5DCFA 3J7AO 2XAGA 4G94A 2HFHA 3Q5FA 3BWGA 1FBUA 3KETA 4IJAA 1ODDA 1YW7A 2AXLA 3V8LA 3M9AA 4CHUA 4NB5A 2JSCA 3L09A 1HKQA 3LSTA 2EB7A 2O3FA 4IVNA 2EFOA 1USSA 2A69F 4QWQA 2C6YA 3I5UA 3HTUA 3HHGA 3ECHA 3HYIA 4KIFA 4ZZLA 2UXXA 3FXUA 3TO6A 1HXDA 1BM9A 3FHZA 2QBYA 1Q1HA 5JHUA 2H09A 2MA3A 5DDGA 3ZMUA 4WK8F 2IW5A 5CJ9A 4HF0A 4ENNA 1LDDA 3P9CA 3B02A 3KEQA 3S2WA 1WRJA 2D1HA 1BIAA 1BC7C 5LBQA 2FBIA 2PFBA 5H20A 5BPIA 2WV0A 3RYRA 1K78A 5ILUA 1KQ9A 3RPUA 1ZRCA 4CZZA 1OPCA 5D5XB 1OR7A 4ON0A 3GXOA 2ZFWA 2IA0A 3GX4X 2EJRA 4XLNF 1BOAA 3E3VA 4CO8A 1L0OC 5DD8A 5CVJA 2E7XA 2IRFG 4EJTA 4Q4ZF 4G7OF 3JSOA 4O5VA 3U1DA 1X3UA 4EM0B 5ILVA 1QGPA 3E6CC 4HDVA 2W57A 3R4KA 5J8CA 4YIIA 2MLKA 4EM2A 4Y13A 2OU2A 1ULYA 2LKPA 5L3GA 3KE2A 1W7PB 1MGTA 1BN5A 1BBYA 4P5OA 3BY6A 2E1NA 4HBLA 5L3BA 4UHTA 2V1UA 2MD5A 2FMYA 4UVCA 5ICGA 4M9XA 6PAXA 3KEOA 3E97A 5BS6A 1EH6A 4OIRF 2FQ3A 4KN7X 2V1XA 1O57A 4A0YA 3KLNA 3H3UA 2EWNA 5HS7A 4HF1A 2VBWA 4U0YA 1U8RA 2GIVA 5L3FA 2K4YA 2RKHA 2ZJ2A 3RKYA 4U7DA 2NS0A 3WTZA 3H3ZA 3TOBA 2PN6A 5E1XA 3J81Z 5DUKA 4WF2A 3T8RA 4LB6B 4ENMA 1D8JA 1G3SA 4LGWA 4A5NA 3CO7C 1JHHA 4A0XA 3LA2A 1J0RA 1FWZA 1U2WA 2V1DA 2YX4A 1IXCA 1OYYA 4RGUA 4HOBA 2IT0A 2DLLA 1J9IA 4AWXB 3P9KA 2RN7A 2P7VB 4L18B 2ZNZA 2FU4A 4NQWA 2NRAC 1YQAA 1WWXA 1HQCA 4MEYF 1FY7A 1QQIA 5FFZA 4LMYA 1O7LA 4CYDA 1FOKA 1A04A 5E1WA 4FX4A 4GXOA 2DBBA 1UCRA 1EH8A 2XUBA 4ZYHA 1ZRFA 5DYMA 3IWZA 2D45A 2Z9OA 3MZYA 5K1YA 5AIPA 4Q5SF 2FMLA 1R1TA 1IAWA 3WTWC 5ICEA 1R5GA 2OAZA 1R1UA 1QVPA 2O6GE 2HOEA 3G73A 4ETSA 5IT9Z 1D8KA 2Z5UA 1JGSA 4YFXF 2YPRA 3IRRA 2FNAA 4AVPA 2WC2A 1LJ9A 2DT5A 2L3DA 1I5ZA 4G6DA 4L9JA 1DDNA 2A61A 2VOOA 3HTSB 1P2FA 2RQPA 2VC0A 3I0TA 4WXDA 4KIBA 3F8FA 2FRHA 2ZMEB 4G8XA 1YTYA 1ZGJA 1BI2A 1Z6TA 3IKTA 1WSUA 4OOIA 3L9FA 5HLGA 5AIQA 4UUVA 1UB9A 1AWCA 1KYWA 1R22A 4A2UA 5JR3A 3N97A 3QU3A 4ZYGA 3WTSC 4BYYA 2K27A 5HLHA 2Q8KA 2Z33A 2KJCA 4RB0A 3K1NA 1I1SA 2ESHA 1DPRA 5FLXZ 3D0SA 1GVJA 2A5YB 3TDZC 4M9ZA 2CSOA 1FNNA 2KRFA 2IJLA 1HW5A 3GFMA 3CUQA 2L01A 4G6QA 3MEXA 3SZPA 1TW3A 1KYZA 5LRSA 2XIGA 4LLGF 3NEUA 2K4JA 1HSTA 2OQRA 2RGVA 2A68F 2E1CA 3IL2A 1R23A 3KP2A 2FOKA 2P5VA 1XCBA 4L0ZB 2STTA 3WTXC 2H94A 3R0AA 3I53A 4WXCA 2EFPA 4CXFA 3ZP5A 2BYVE 4LG0B 1SD7A 2F5FA 5LHIA 1K7AA 4LLNA 2W85A 4KN4X 2V6CA 4EGZA 4WCGA 2HKOA 2J5OA 1PP7U 3COAC 2JT1A 2ZNYA 1ON2A 1U5TC 1SD6A 3RI4A 1ZG3A 4M6XA 2LX9A 3OOPA 4AIKA 5E1ZB 5EEHA 2KKOA 4OU0A 3M7GA 3GO5A 4PZJA 1I27A 4BAYA 2OZ6A 3ZMTA 3O2PE 2QYOA 2GA1A 4R79A 2H6CA 4PGGA 1XSDA 3C18A 2BEOA 4PCQA 1KGSA 3IC7A 1EH7A 1LVAA 2MLGA 1YYVA 1LDKB 3JAMK 1ZREA 3R60A 3M8EA 4BQAA 1Y0UA 2ZCWA 1ONVA 3ZMDA 2HZTA 3KP6A 3HRUA 3ML6A 4G7ZF 2W24A 3BROA 4IRHA 4S05A 3ZN0A 5TJJA 3F6OA 3L2CA 1QO0D 4CICA 2VE9A 3LQRA 4FX0A 5JI6A 5FO5A 3JW4A 3DV8A 2PMUA 1LQ1A 4KYWA 1SMYF 2M1BA 3K2ZA 2IVMA 3FMSA 4A5MA 2XAFA 5ERIA 1TQPA 4HYEA 1ZLJA 4E70A 1W7PD 2OQGA 4ZH4F 3WE2A 3T8TA 3FX3A 1ZARA 1BJAA 3FM3A 5F64A 4MQ9F 1FT9A 1XB4A 5ILSA 2O61A 2RV8A 4XSZF 2KIMA 4R8HA 4MQVA 2LDUA 2F5DA 1MJ9A 1G6NA 2XGXA 3F72A 5F6FA 3LQQA 2VBXA 3C3WA 1J5YA 3W6JB 2FE3A 1S3JA 2XRNA 1IXRC 2FF4A 2JZYA 2OD5A 3C1DA 4EJVA 2PI0A 3WGGA 5LHHA 1SMTA 4BHPA 2QENA 4H0EA 4HA8A 3GF2A 4RS8A 1QZYA 1FLIA 4HX7A 5HDGA 4P55A 2VT2A 5BPDA 3WTUC 5HOOA 1GXQA 4U0VA 4EV0A 4KFCA 1OKRA 5DD4A 3JAMZ 3E6BA 2M8EA 2Y48A 3ERED 1FYKA 4S04A 3FMQA 2XAHA 1Z9CA 2XROA 1XGMA 3B73A 3QP6A 5LLQA 5KVRA 1T2KA 2PMHA 5DV5A 4WXHA 2G7HA 4A6EA 5FGMA 4MHGA 4YFKF 3DPLC 2GA2A 3I54A 3K1PA 2J5PA 2NNYA 3BOQA 2VXZA 4HV6A 2P4WA 5CLSA 3F21A 4RAYA 3BPVA 4M72A 3EQLF 3MZHA 1W5TA 1MJBA 3Q9SA 4U7BA 1LEBA 5D5UB 2L4MA 3HOTA 1HKSA 5HLIA 1YS7A 3P7NA 4UNOA 3WTVC 1KU9A 5LRRA 4ZYEA 3GYHX 1RI7A 3HRTA 5DCMB 1U5TA 2MH2A 1XSVA 2JRTA 1IUYA 5L3CA 2KIFA 4XSXF 2QZ8A 3F22A 5ICFA 2DK8A 2ETHA 2E7WA 3DXJF 1J75A 4MTEA 2K7LA 1B9NA 1FYLA 1IXSB 4ASNA 1FZPB 5AONA 3NRVA 3ZMSA 1MDMB 4JBAA 4A6DA 3F6VA 3LFKA 4ENJA 3EYIA 2PQ8A 2NYXA 5L3DA 2ZBKA 2X0LA 5LEKA 4M9SA 4L9NA 5H6QA 3V8JA 5CVUA 3VFZA 3QP5A 1XDSA 3P9IA 3MHXA 4OMYA 4MTDA 1H0MA 1F1ZA 1USTA 4AIHA 2VT3A 3TOAA 4ZZDA 4KNYA 2RC4A 4R1HA 1MD0A 5TRDA 2V9VA 4GYIA 3L7WA 3ECOA 4Q48A 2EFWA 4M71A 2O03A 1IN6A 5D8LB 2ESNA 2W84A 1S29A 4EM1A 2DTRA 3BPXA 1ZH5A 5E8GA 4HQMA 1UHWA 4LJZF 3RJPA 3WTTC 1RZ4A 5A2QK 5FD6A 1XMAA 5JVTA 3LAJA 3IKVA 3GLXA 1O3TA 1KU2A 4OMZA 1TW2A 3F8MA 2Z3YA 3E6MA 4M74A 3KP4A 5IT9K 3GWZA 3F8CA 2JPCA 2GZWA 2GXBA 5D6FA 3EUHA 3FM5A 4Y15A 2DK5A 3KCCA 1E17A 1QPMA 4L0YB 1YFHA 2DW4A 3EETA 5HVQC 2F5CA 4HW0A 3FXRA 4LLLA 4KICA 1TLHB 3V7RA 4BHBA 3RKWA 1XMKA 2EA4A 3SZTA 2M87A 1OYWA 2EV0A 1G3WA 3T5XA 2KIUA 4L9TA 3AAFA 4U88A 3K0LA 4DQ2A 3ISPA 2LSOA 4CGZA 2K02A 4MEXF 2UWMA 4N9HA 4M6YA 4D0PA 4LK1F 5JFRA 2DO7A 3BJ6A 1YS6A 1TQMA 1UFMA 1U78A 1XGOA 3DF8A 2ISYA 2CGPA 3KP7A 1P4WA 4LK0F 3DP7A 5BQTA 3GUDA 4YG2F 3WU1B 2XAJA 1F9NA 4OIOF 1D3YA 2XKOA 4UVAA 2P6TA 3LAPA 3SQNA 4JQFA 4P9FA 2QLZA 1SFXA 3R6SA 2STWA 4FT8A 3I4PA 3RKXA 1HW2A 3NQOA 3GZ6A 2HWVA 1B9MA 2OZUA 2BGCA 1GHCA 4ESFA 1YW8A 2Q2EA 5KK1A 1QBJA 5EEGA 4RB1A 3R0JA 3K1MA 2L02A 2CW0F 5FLXK 5D6EA 5K5QA 2L54A 3CUQC 1E2XA 5LGUA 1I6XA 1IN5A 3DEUA 4YFNF 5CVVA 3GW2A 5ED4A 3QPTA 2CG4A 3KP3A 1ZAOA 2FA5A 1IN7A 4O6JA 4EVIA 3E6DA 4L5JA 4EJOA 3DKWA 1O3QA 3LA7A 1U6GA 1REPC 1BI1A 3CO6C 2COMA 5D4SA 1LB2A 2VE8A 3WODF 2PLYA 3JTHA 2QQ9A 2DPUA 4P9UA 3V7CA 2HGCA 4U0WA 2QWWA 1HKTA 3VEPA 3WG9A 3GFLA 4HQEA 2BE5F 3T0YA 4ESBA 4UXNA 5E17F 2ZKZA 2VC1A 2B0LA 2XHKA 3HHHA 2DPDA 4I0BA 4HF2A 1FC3A 3M1EA 1R58A 2GXGA 2Q0OA 3DFGA 4RB2C 4GYGA 1S7AA 3K9TA 5J6XA 4IXAA 2HS5A 2MH9A 2P6SA 5D5VB 2R7FA 1F4KA 1D5VA 2G9WA 2VODA 1R36A 4IHTA 4L5IA 1OMIA 1UHMA 1SFUA 5E8IA 4HX8A 3VODA 3HOSA 1IRFA 1TNSA 2ISZA 2VBYA 3ABTA 1ZRDA 1KQ8A 5D4RA 1IN4A 5LEJA 2OBPA 4EJWA 3TKYA 1FP1D 3RDIA 1ZN2A 2CWEA 2IPQX 1RUOA 3V4GA 1XN7A 3G3ZA 2BBYA 3J81K 2PBIA 2H27A 3DPTA 3LWFA 2K5LA 3IWFA 5HDNA 3ABUA 1TQIA 3TGNA 4KMUX 4TV7A 2PG4A 5IT3A 2MBFA 2GCXA 5LHGA 2PEXA 3JSPA 3HIFA 1P4XA 4I7HA 2M5WA 3T1BA 4PDKA 2EV5A 3F23A 1SD5A 3I71A 2HR3A 4ENKA 3WU0A 3PQJA 1U3EM 3MAJA 1BC8C 2F5EA 2G7UA 4I2OA 2FSWA 2WTEA 4LB5A 2D1VA 3RPQA 1BIBA 4HLXA 1L3LA 2UXNA 2R7DA 2ZMEA 3ROUA 3U2RA 2F2EA 5CVIA 2JTVA 1JE8A 1B1BA 5K5OA 1J59A 1STZA 3R61A 4I02A 5BMZA 2K86A 1J7KA 3BJAA 1SAXA 1ZGAA 4WWCA 1YW9A 5D5WB 2P5KA 1WI9A 4HX4A 1Z7UA 4BHCA 3FMRA 3HSRA 2RNJA 4O3MA 5LGNA 3Q9VA 3OV8A 4IPAA 1V4RA 3RTRA 3HRSA 1DPUA 1FSHA 3MQ0A 3IRQA 1FBQA 3GZ5A 4XRFA 2ADUA 5E20A 2DQRA 2HQRA 2KJBA 2GWRA 2K5FA 1O7FA 3DQVC 1T6SA 1RUNA 3M8FA 2QVOA 3HSEA 2XVCA 1O3SA 4UVBA 3LA3A 3JTGA 3J80K 1O3RA 3ULQB 2RVCA 3HSFA 2PJPA 2ZO4A 1MJAA 3MCZA 2NNNA 2HEOA 3E5UA 3L00A 5A2QZ 5HS9A 1ZYRF 4BXUA 2TDXA 4A12A 3I64A 1Z1DA 3TO7A 5FB2A 4OIPF 3BJOA 1B4AA 1C0WA 2Z99A 1W5SA 5D8KB 3GEZA 4GO1A 4I09A 4IHSA 1PP8F 4EGYA 3QOPA 2VN2A 2HTSA 4OIQF 1CGPA 1AOYA 1FPQA 3GFIA 2DI3A 2P5LC 1I1GA 1WQ2A 3E5XA 3CUQB 4LFUA 3O6BB 2EV6A 3VOEA 2ELHA 2QQBA 3MFKA 2FNPA 4HLYA 2YSRA 5E18F 1Z6RA 5J8FA 3E19A 1LEAA 3SHFA 4KA4A 2BV6A 2A6EF 1JHFA 2M45A 2DFIA 1R7JA 4HV5A 1ON1A 4HZFA 3QPHA 4PGHA 4JK1X 1FBSA 2UZKA 4DNCA 2M30A 2IP2A 3GFJA 1ZG5A 1VTNC 2ZXJA 3F8NA 1KU7A 3CLOA 1H9GA 1B59A 3D5LA 2P8TA 2O0YA 4HAMA 2K5IA 1PDNC 1IN8A 3I59B 2HQNA 3QU6A 2FXAA 1TTYA 2QM3A 2K4BA 2IA2A 2YR2A 3HUGA 2D2WA 1P92A 3W6KB 1FP2A 1EV7A 2WWYA 1RIOH 3H92A 4B09A 1V3FA 1BYMA 1PUEE 1ZHFA 5ICCA 4EMSA 3PFIA 1MDMA 1IRGA 1R00A 4RGXA 4NHJA 1R5HA 3WE3A 4B8XA 4AD9A 5F1RA 4OINF 4UV9A 1YIOA 3BP8A 2DAOA 4G9YA 1QW1A 5CYVA 1J2XA 2XASA 4MGRA 1IW7F 2NAZA 1T39A 1LNWA 4KUMA 2XV4S 1FX7A 3U9GA 2DU9A 4GGGA 5K5RA 4IRIA 1G3YA 1Z05A 2L4AA 2LNBA 1P4AA 1HBXG 1IZ1A 4ZYDA 3ZMVA 3FXQA 1DUXC 2O8XA 5H6RA 3TQNA 3QRFF 4GCVA 3QAHA 1ZG1A 1XGSA 3WGIA 1FYMA 2A6HF 4I01A 4UV8A 2H3JA 3FZVA 4MNUA 3BDDA 2V79A 3EYYA 1KU3A 1W4MA 2EK5A 2RDPA 1S8NA 1WKMA 1JXSA 1ZLKA 2CYYA 1OYIA 2XAQA 2VOPA 3SXYA 5DEQA 3F3XA 1YG2A 3WTYC 3CDHA 3RIRA 4KT5C 4KMFA 3TO9A 2JPBA 1F5TA 1DP7P 2Y75A 4KDPA 1BI3A 4QLCU 2FEZA 2H6BA 4EQQA 2YX7A 2QUFA 4LD5A 2GAUA 1K78B 2HYFA 2OA4A 1R1VA 3KP5A 3I59A 1U5TB 4CDGA 1K6OA 2P7CB 5BOXA 3ZMZA 5FFXA 2FBKA 1H9TA
chains in the Genus database with same CATH superfamily
2LOOA 1ZUUA 4LG3A 3WGHA 1S6LA 2A07F 2DDBA 3A2KA 2A08A 1VQ4T 1TNTA 4F52A 3HRMA 2CQKA 5LGTA 4IHVA 1RNLA 4LDVA 4EMHA 3LGLA 1T98A 2BHYA 3G6EA 3PVLA 1G3TA 2QCOA 2XKPA 4ZDLA 4F3QA 5IPAA 1T38A 3M3YJ 2ZCFB 1IB8A 3CD6Q 3SFMA 3FIFA 5LJ3j 2D0NA 1HW1A 3OBYA 1MV0B 5FU6C 2JZ2A 3FWEA 3H0FA 1S7EA 3OWTA 3A0HC 1DQUA 4M7DC 2DXCA 2QQRA 2XDPA 4K2EA 4KIGA 2HYGD 3A4CA 3REOA 2DXIA 2CSQA 4GLMA 4OMOA 3CCQQ 1LKXA 4YIFA 4CUGA 4DEXA 3ZL7C 4AT1B 1QNTA 2DXUA 3FEOA 3IH3A 3META 1Z21A 2YU3A 2OJ2A 3JB9G 4QIWN 4IURA 2DA1A 1PNJA 3WXMB 3BZCA 4G7HF 1KC8C 1XGNA 2PNIA 1KG1A 2CT4A 2H8RA 1FMWA 5E3OA 2EIFA 2VKHA 4XKVA 4GY5A 5GAOq 3GNFB 5HDKA 5EDNA 2CRGA 1TBXA 2MC3A 2VONA 3A1PA 1Q7YU 1XCVA 5DS9A 2EIMH 5LL6S 3NWSA 1Q7YR 1X19A 1KD1R 3GVAA 1IG7A 1NLPC 2X9HA 1SD4A 5EYRA 4HNTA 2GLOA 3RDVA 3CCUA 3ZQIA 1VQ8I 1OR7C 5GAN6 2CO5A 1YNZA 3CCLQ 4N0BA 2Y0MA 5HY6A 2V8JA 2E65A 3TU4K 1QCNA 3QSUA 1Z91A 5B5EC 1I81A 4B48A 1MZBA 1CF7A 3TP0A 2X1DA 2LCLA 4XLPF 2ACJA 2KT8A 1D09B 1W2BS 1HYOA 3SDGA 1BI0A 2NOJB 2HQXA 1KQ1A 5DUIA 3EGDA 4MMKA 4R0KA 1V1CA 3CTAA 2Y4YA 3IP4B 1M2VA 1Z3YA 3JCMV 3A8MB 2NVXJ 2AKLA 2COYA 4FW2A 3MWMA 2QEXT 1BK2A 4I0AA 3BR6A 4RAZA 1Q95G 5DCMA 4FW1A 3KFWX 1FSEA 1KQ0A 2LF8A 1IF1A 5DTDA 4F14A 2WY8Q 3G6EI 4BNCA 3QYEA 1X1DA 3TDUC 1IREB 2D8HA 3H35A 2HDCA 1LNXA 4XBFA 4PJOC 3W2VA 1NJIU 5J39A 2XPUA 5LFAA 4N4HA 4I98B 3CP8A 4F7ZA 1XD7A 5KYUA 4P96A 4BY7J 4HDUA 1Q81C 1VZ0A 2VBZA 2W25A 3KIOA 3LYIA 3VRYA 2OTLA 4M3EA 4J9BA 4JX6A 2IGKA 4IF4A 2CZ1B 3DPUA 2EFQA 2KIQA 1QZZA 2BY2A 2LF7A 3CUOA 3N4MA 1FMKA 4KGXB 1MMAA 4KGVB 3ULRB 2E60A 2DFUA 4F55A 2QBYB 3K10A 3ZPLA 1ZA1B 1YIJQ 3CC4T 1T0FA 3EH1A 1HSJA 1G4DA 1X27A 1YITA 3V8KA 5KAIC 4LG0A 4GLKA 5IN1A 1KC8R 2W82A 1JTXA 3VWBA 1WLPB 1R4NB 5CVRA 1VQKA 5A0LA 4M75E 1XDUA 1U1TA 2EA2A 4XMYA 2E3HA 1SFEA 2OJED 2LBFB 2K85A 5KYYB 2CZ0B 4G6TB 1M90U 4Q47A 4L9VA 2MAMA 2O88A 5FROA 4A93J 2RI2A 4LDWA 4N9IA 4RCBA 3OS2A 5I2MA 3JCMJ 5FU6B 4CYCB 1RACB 1UFFA 1WPYA 4FSXA 1PG5B 1VI0A 2P81A 4IRGA 3LSJA 4XU1A 3CCJI 1YLFA 1S7OA 1X1CA 5L3EA 2HKXA 1GT0C 1M27C 1TS9A 3JCMW 1K9MR 1KA8A 4J7IA 4RTYA 2M16A 2X35A 3I58A 3K69A 2K3YA 2X4XA 1ETYA 3KZYA 2JS0A 3PQKA 1PD1A 1VQPQ 3RYPA 3GIBA 2GGRA 4CCNA 3ELKA 3OYHA 2WY7Q 2FBHA 2YUNA 4M7AB 4QVDA 2F6CA 1OCCH 1MMSA 2VV5A 1BR2A 2YRDA 1MH4A 3VB2A 1XSXA 2JA5J 4DOWA 1OV3A 3CJNA 2R3SA 2NS8A 2HXOA 3V7SA 4HCZA 2K9SA 4Q5WA 1U0JA 2FQ4A 2IA1A 1D0XA 3KLOA 3NMZC 4RB3C 2KRCA 3BZ6A 2R7TA 4WX9A 3C95A 3JRAA 4RGRA 3BTLA 3BDUA 1ETVA 1UG0A 1O75A 2F5TX 5EGOA 4XK8E 3URGA 1Q86R 1K79A 2HKNA 3VS5A 3FF5A 4RAGA 3QO3A 4DA4A 3MD2A 3CCVI 1CSKA 1CF7B 3DLAA 2CYZB 2X4HA 4X1EA 3AHUA 4XTUA 1LE8B 4ATOA 1JB0E 2HTJA 3IHUA 1QVFA 3O3KA 4RGSA 5EZGA 3GCMA 3ZN1A 3DKMA 1P6RA 2EH3A 4M73A 5IH2A 4XQFA 1GCPA 3JCMf 1B6AA 2LQ8A 4BH9A 2EYYA 5HS8A 3QWYA 4A0ZA 4C0DC 2IS6A 1UGSB 1LDJA 1ZELA 5FD5A 2MK5A 2WSCE 4AFSC 3CCLT 3I4NJ 2M0OA 3SFZA 4M75C 5J26A 2VB6A 4PJOB 2GQQA 4DYQA 1GV5A 3M0TA 3RCOA 2MWPA 3CCUQ 1JEGA 2NVUB 3RSNA 4EJUA 1RAHB 2K3BA 2QQAA 2JMCA 2EFNA 3F8BA 3PO3J 4Y17A 2K9LA 1CKAA 3K7AJ 5IHIA 3EDPA 3ZQ7A 3C7JA 1QMCA 1R77A 1W2BP 1TG0A 1YJNI 1UAAA 2OTJQ 2ENMA 1AHJB 3DTIA 4FHTA 3M1CA 4AIJA 3KZZA 3FDYA 2H3EB 3HKSA 1W7PA 2CFXA 5F0FA 4Z2YA 1K76A 1NHAA 3E5QA 4BXXJ 2DMQA 1MKMA 4IO9F 2AS5F 4JZ4A 5CQGA 1YO5C 3FXMA 2EBIA 2PTKA 1GXPA 2A3SA 3J80Z 2DQLA 4ESJA 5DCFA 3J7AO 2DEQA 2W4SA 3F9KA 2XAGA 2TCTA 4G94A 3OIPA 4AYBN 2C0OA 2ZMEC 2DL7A 1YOVB 3OYIA 3E2UA 4E4HA 3OMGA 4XU2A 4E7JA 2HFHA 3HG9A 3BWGA 3Q5FA 2L7FP 4BY6C 1JUMA 1QVGS 2YSQA 3U1KA 4JUVA 2ME6A 2DD5A 3BQZA 1FBUA 3ONQA 2DTIA 4R55A 4BQNA 1YCSB 3CCRT 1SANA 2DEUA 3KETA 4C92C 3PJRA 2K9NA 4IJAA 4XR6A 1QRYA 1Y07A 3QOEA 5GJWB 1ODDA 4CCLA 1S72Q 1Q81R 4FISA 1YW7A 5IYBJ 1ZBXA 2AXLA 2D0QB 3V8LA 5LJ5g 1S72A 3M9AA 1YFNA 2LYCA 2JUFA 2EYXA 4M7AC 2V1RA 4V2FA 1SF9A 1SRMA 4B47A 4XTZA 2HNIA 4M3FA 4C8QB 3TW7A 2K2VA 4CZCA 5J4YA 4CHUA 2L9VA 5KH6A 1E6GA 1Z77A 2RNGA 4NB5A 5BNGA 4IOCF 2J6OA 4IQ4A 4BB7A 2HCKA 2JSCA 1Q81U 2CZ7B 3L09A 1HKQA 2X85A 1BOBA 3LSTA 4YELA 2FYKA 2RJDA 3O8VA 3C2GA 4M4ZA 3ASNH 3AKZA 3OYYA 2ME0A 2EB7A 2O3FA 4IVNA 2EFOA 5M5WJ 2Y90A 1USSA 2A69F 4QWQA 2C6YA 4C5HA 3I5UA 2DMOA 3HTUA 3LH0A 3ZR8X 2ZPHB 2QTXA 4M78D 2M8GX 2FG0A 3PUBA 4AM3A 5HNFA 3HHGA 3FB9A 3ECHA 3CCMQ 1Q82R 2VKVA 3HYIA 2QGGA 4KIFA 5HK0A 3E7LA 1ZKGA 2WA0A 2ELJA 1WJRA 2YS9A 4ZZLA 1TOVA 1H8KA 1X01A 2UXXA 3DCFA 3FXUA 4RLQA 3I56I 3TO6A 2E2HJ 3S2DJ 1HXDA 5D6WA 4BI4A 2GFUA 2MGQA 4C3JJ 1BM9A 3EG2A 2O4XA 3M53A 3ESWB 3SWNC 4F7UE 4UC4A 4HRIA 2BW3B 1E3HA 2VQGA 3FHZA 3OA6A 5B3SH 3JREA 2X51A 2IS1A 3MN2A 2QBYA 2GM4A 3MKZA 2JRMA 1Z0XA 4CCKA 3BC8A 1Q1HA 1KFZA 2K9MA 2XU8A 2CUDA 5JHUA 3G1LA 2H09A 2MA3A 2DTOA 5DDGA 2OTLQ 3KFVA 1LFBA 2DT6A 5EJCA 3ZMUA 4WK8F 1K9AA 4M7DF 3BR0A 3VPRA 4NS5A 1QHHD 2IW5A 1M90C 1UDLA 5CJ9A 4HF0A 3G1JA 3UATA 1RABB 2F2XA 1U9OA 4ENNA 1LDDA 2DBKA 1WXBA 3P9CA 2XAUA 1SSFA 4QW2A 5CPRB 3B02A 2F2WA 5CKDA 2EYQA 3KEQA 3CMEA 3S2WA 3H8ZA 3A8OB 1WRJA 2D1HA 2DLPA 1BIAA 1JJ8C 2OAUA 3RPUD 2HMAA 1BC7C 5LBQA 2VLAA 2FBIA 2PFBA 3EFRA 3M4YA 1RKWA 4QQGA 1Q82U 5H20A 5BPIA 2WV0A 3RYRA 1VQ5T 1K78A 4QQ6A 5ILUA 1FTZA 1Y1VJ 1M1FA 2OV7A 1KQ9A 3RPUA 2X1CA 5DM7F 1ZRCA 3EPZA 2B63J 2L3PA 4CCJA 4CZZA 1ZLMA 3H9GA 4F16A 1OPCA 1YWPA 5D5XB 2E3IA 1LVKA 3CC7T 5F0CA 2KRSA 2VKEA 2E71A 4J9EA 3GNGA 1OR7A 2KRHA 4XTYA 4ON0A 3GXOA 1XG1A 1JJ6C 2ZFWA 4XTWA 3H9JA 1ZUYA 2IA0A 3A01B 3CD6A 3GX4X 2QA4A 2JXBA 2EJRA 1R4MB 3QYBA 2E64A 4XLNF 5GAOr 1BOAA 1VQKI 3E3VA 3LLRA 4CO8A 1L0OC 2HPMA 1ZHIA 5A0DA 1VQ7T 2OPTA 5DD8A 2JSPA 3E1SA 5CVJA 2E70A 2E7XA 2IRFG 2IPOB 4EJTA 4Q4ZF 2NUTA 4G7OF 1OISA 3JRGA 2KYMA 5CQYA 1QVGP 4HEA2 4BBRJ 1GBQA 1TTHB 3JSOA 4M7AD 4O5VA 1K4TA 1I07A 4XM3A 4LD6A 5FLXE 3U1DA 3UA7A 1W4SA 2LFBA 4A54A 1X3UA 2WB1N 4EM0B 5ILVA 3W2WA 4HVWA 1QGPA 4LUEA 1PC0A 1WNLA 3M55A 4NNJA 4PSXA 3E6CC 1XQHA 1WI7A 4HDVA 5I21A 2W10A 3C2HA 2W57A 1W0TA 3R4KA 1ERDA 5KYUB 2O31A 4YRVA 3LSGA 3QBYA 4YIIA 4M75A 2MLKA 4EM2A 4Y13A 3PTAA 4D8DA 2V6EA 2RPNA 2OU2A 1ULYA 3C4SA 3NHNA 1EA3A 3VS4A 5GAN2 5JLXA 5GAHJ 1M4ZA 2LKPA 5L3GA 4BQQA 3HOYJ 2CQXA 2L5QA 3KE2A 2BZYA 1W7PB 1MGTA 2CUEA 3PO2J 1PYVA 1UHCA 4JZ3A 1BN5A 2XSDC 4OAYA 2XMFA 4DJAA 1BBYA 3DU5A 2ZFUA 4JJBA 4CRIA 3CCJA 4P5NA 4P5OA 3H0IA 3BY6A 3MJXA 3NAUA 3ABKH 2E1NA 4RA2A 2E5ZA 3PNTA 4HBLA 5L3BA 2FVUA 3KUFA 1H92A 2CZ6B 3EFOA 3VYUB 2AT1B 3CMAQ 3GZNB 4UHTA 2V1UA 1E3OC 3CD6I 1VQMA 2X6WA 3OR1C 2A6TA 2MD5A 1N8RC 2HKQB 1GXIE 2FMYA 2V8IA 4JOMA 4UVCA 3HL8A 5FKOA 5ICGA 1B07A 4M9XA 3OYNA 1YE9A 6PAXA 2KDOA 2H1LA 3BG7A 3KEOA 2R7ZJ 4B9WA 1LCKA 4FE4A 2E4HA 4PJOA 3E97A 4NC6A 2DJIA 4IEJA 4MLOA 2JTFA 5BS6A 1EH6A 2CH4W 3A0BC 2FQ3A 3FKIJ 4OIRF 3RZOJ 4KN7X 2V1XA 1O57A 2COZA 3CCQT 2GF7A 3Q1JA 2O2OA 4A0YA 3KLNA 4QPQA 3JRIA 4JLIA 1KHIA 2MMPA 3CPFA 4JRKA 3P8DA 1FIAA 1AZEA 3H3UA 2EWNA 5HS7A 2HQEA 2KQWA 3VU3C 4F92B 4HF1A 2E41A 2VBWA 5E3LA 4U0YA 2RA2A 1M30A 3I5RA 2DFFA 2GIVA 4I6ZA 5L3FA 1U8RA 1N6AA 2RKHA 2K4YA 2PVDB 2ZJ2A 1IGUA 2YRVA 3JRZA 4N0AA 4QVCA 2BE7D 2B9SA 3HJEA 3PE0A 1I5LA 1ETQA 3RKYA 2NS0A 5K7HA 4U7DA 3WTZA 1JU5C 2KYBA 3GMEA 5LJ3h 2R7XA 1QQJA 2J7IA 2F69A 1RLPC 2MPXC 2DERA 1AWOA 4F7UG 3ZFJA 3H3ZA 2MD0A 3HGYA 3TOBA 2PN6A 3W2AA 3C0CA 3UPUA 1VQPA 5GAOn 1UJYA 5GANe 3MCAB 2PUKB 1ZSGA 1OJLA 1IGQA 1OLTA 5E1XA 5CCAA 4C5EA 5HKCA 4M77F 3J81Z 3PT9A 4LNPA 2RN8A 1UB4A 5DUKA 3NTKA 4WF2A 3T8RA 4LB6B 2KZGA 3CP2A 3L2VA 3CBMA 4ENMA 3X24B 3IV5A 3CJRB 1ITYA 5A0GA 1D8JA 2L9RA 3K4MA 1D5YA 1G3SA 4LGWA 3H5AA 1DP3A 4A5NA 3CO7C 5GAGJ 4Z02A 5AT1B 1JHHA 3REAB 2KL4A 4OMNA 4AG2C 4A0XA 3LA2A 1YIJI 1TWFJ 2PVGB 1J0RA 1FWZA 3SFIA 1U2WA 1X4PA 2V1DA 2A5WA 1N27A 2YX4A 4CCMA 2B8AA 1IXCA 1OYYA 1MBGA 3AG2H 3S3OA 4RGUA 3I55T 1JJ2A 1TWCJ 4HOBA 3D7SB 1JUPA 4L5GA 5GAOp 2IT0A 1AHDP 5C4JJ 4OGCA 4CH7A 2DLLA 1J9IA 4LXCA 1Y39A 4AWXB 3P9KA 3S1MJ 4DGWB 2RN7A 2X6YA 4M6VA 2I2LA 5LJ5e 4CC4B 4B6MA 3FHNA 1OQKA 2KISA 1N8RU 2P7VB 4RDUA 4L18B 3HOUJ 5GPAA 2ZNZA 2FU4A 2DKGA 4NQWA 2NRAC 2G6FX 3VS1A 4KRTA 1M8VA 1YQAA 4QT7A 2P0PA 3MP1A 2ZGWA 1WWXA 2EFIA 2KR3A 1DGRM 2LJ3A 3OB9A 4EMKB 2XB0X 1I0CA 5IY5H 4A63B 1QVFS 4J9FA 4VUBA 3CC2Q 1HQCA 4MEYF 4J8OA 1RLQC 2DFEA 2NUTB 1FY7A 3LSPA 4MFDA 3GTLJ 1QQIA 2JWTA 3BG9A 2XICA 4J6WA 1UMQA 4LMYA 5FFZA 3NFCA 1O7LA 4CYDA 4HT8A 1VQPI 1FOKA 1UE9A 1A04A 3PMTA 5CKFA 2C06A 5E1WA 1VA7A 4FX4A 1ZR4A 5C0MA 3INZA 1VQLT 2V1NA 3REBB 4GXOA 4PKCC 2DBBA 1VQ4A 1SFKA 1QVFP 2ECBA 1UCRA 1EZZB 1QA6A 3UR3C 3S1QJ 1OPLA 1EH8A 1RAIB 2XUBA 2EYWA 3KBGA 4ZYHA 1ZRFA 2FRYA 3OW2P 1S72I 5DYMA 1WA7A 4BD3A 3IWZA 5GANg 2D45A 2Z9OA 3PUFA 1TC3C 2W7NA 1RAEB 3MZYA 5K1YA 1BU1A 5AIPA 4Q5SF 2FMLA 1R1TA 2VPRA 1IAWA 1YX3A 3WTWC 3SEQA 5J3LA 5ICEA 1R5GA 2OAZA 1R1UA 1EF4A 4M7DG 3FKJA 4XAXB 1QVPA 3FLGA 1NLOC 3BLYA 3A01A 2VASA 2O6GE 3TEEA 1WYXA 2LLKA 4A3EJ 3BR1A 3T9NA 2HOEA 4M3DA 2XF6A 3G73A 3WU2C 3O5ZA 1YJWQ 3CEYA 4M78C 1XJWB 4B9XA 1J3TA 4ETSA 5IT9Z 2EQJA 1D8KA 2RK2A 1MBFA 2Z5UA 4RAFA 2EQKA 4EDUA 2JA6J 3CCVT 4M7DE 1JGSA 4YFXF 2AQFA 4YTLA 2YPRA 5IXFA 2CUBA 3GTMJ 3IRRA 2FNAA 3BTJA 4AVPA 2WC2A 4XKWA 4A3IJ 3CCUT 1LJ9A 3O8HA 5FWBA 2DT5A 5FKKA 4N4IA 3X20B 1YI2T 1YBYA 1YHQA 2L3DA 1ACIA 4WCIA 1QWFA 1I5ZA 4J6XA 5GAN3 3G71I 1FOXA 4G6DA 3HBLA 4L9JA 4UUSB 4IUVA 1DDNA 3QYGB 1V55H 3LWHA 1OU9A 2A61A 2BY0A 3S1NJ 3G6EQ 2LDMA 3VS3A 2XF5A 4BUGA 3PIPF 2VOOA 3OMCA 3HTSB 1W36C 2XKOC 1LPLA 5J3BA 3UDCA 2EZHA 1P2FA 1JKOC 2RQPA 1VQ4I 2VC0A 5HK3A 3GPLA 2XGEA 3S32A 3I0TA 4PJ0C 4WXDA 5DY9A 4KIBA 1QKWA 3F8FA 3VS7A 1WIEA 4B1RA 1PD0A 2FRHA 2ZMEB 4RTVA 4G8XA 1OCOH 2ROLA 1YTYA 1ZGJA 4B43A 2L3QA 5B66C 1BI2A 3M0PA 1Z6TA 3IKTA 4X9CA 1WSUA 2XRLA 2W00A 1WHKA 4OOIA 3LMMA 4L6V5 3L9FA 5M5YJ 5M3MJ 3OW2A 3JAME 5HLGA 1VQLI 4C92B 1QHGA 1NEBA 5AIQA 4UUVA 3I5SA 1UB9A 1AWCA 2KMTA 3IUOA 3QWLA 4NUBA 3KPHA 4PFOA 3CC4A 3EGDB 1KYWA 1R22A 1F43A 2XPVA 4PK4A 3C2BA 4A2UA 2OUMA 5JR3A 3JRBA 3N97A 2M0YA 4FYYB 2KPMA 2B7EA 3QU3A 4V2GA 2K27A 4BYYA 4ZYGA 3WTSC 1R49A 1VQKT 5HLHA 2Q8KA 2HYJA 4A3JJ 1OOTA 2XGDA 3G1OA 2Z33A 3CC2T 2L9SA 1VIFA 2M0MA 1H3ZA 2KJCA 4RB0A 4FM4B 3K1NA 1UGVA 3LL7A 2AHQA 3SDBA 2MG4A 1P7IA 1I1SA 1B72B 2G3RA 2ESHA 2O9SA 1DPRA 4XLCA 5FLXZ 1GL5A 1YIJA 1VQLQ 1HJDA 5KYNA 2JA2A 3UNGC 3RESA 1UG2A 4ELZC 3D0SA 4M78B 3VUZA 4A3LJ 4Y33A 4DIQA 2P0QA 1R8OB 1GVJA 1V5EA 3M59A 5IP6A 1H3HA 4II1A 2A5YB 3TDZC 1UELB 4M9ZA 5CKTA 5FRMA 2CSOA 3FIWA 4Y52J 3PFSA 4QQDA 4C8QA 1FNNA 4B3AA 1K8AC 1QWEA 2CT3A 1HC8A 2KRFA 2YUSA 3KX2A 2L3RA 2LX7A 2IJLA 1HW5A 4QKUA 1VQ8Q 3GFMA 3EG0A 3CUQA 4OMPA 2L01A 3EG3A 1I39A 4G6QA 1V76A 5GAN5 4OB0B 2F5VA 3OIOA 4NQWB 3UT1A 1M8MA 3A8LB 4D5CA 3MEXA 1A36A 3PFYA 3SZPA 1TW3A 2OAWA 3NTHA 1KYZA 5LRSA 2XIGA 3CF5F 4C3HJ 4LLGF 4HKEA 2RHXA 1WJCA 1Z3XA 2KLOA 1GFCA 3NEUA 2KE9A 2YUPA 1YJWT 2AXTC 4C0ZA 2K4JA 3CMMA 4C8QC 1HSTA 4C0FA 3EH2A 2OQRA 1AD5A 4FQGA 2E1MC 2RGVA 1RAAB 2A68F 1JI8A 2E1CA 2WACA 3CC4I 3IL2A 2VKDA 2ZZDA 4F7UA 1WHHA 1R23A 3KP2A 2BIVA 1OCTC 4BE1A 4JJDA 2FOKA 2P5VA 2QDYB 1XCBA 4L0ZB 4PLLA 2STTA 3WTXC 2LQKA 2H94A 3CCLA 3PL8A 5EEAA 4B44A 2R7WA 3R0AA 1GCQA 3I53A 4WXCA 4NL3A 5DLQE 2HAXA 2EFPA 3CCET 4CXFA 5GAN8 4BBSJ 1E7OA 5GAOl 2DRKA 3ZP5A 1XS9A 2BYVE 4W97A 2DIQA 4LG0B 1SD7A 3VS2A 2F5FA 1TZLA 3ZQLA 3HPGA 5LHIA 3ZXSA 2W85A 1K7AA 4KN4X 2V6CA 2LR8A 2M7AA 4LLNA 2LKSA 4EGZA 2PUOB 3EG9B 4Y92A 4XL9A 1OYXA 1RAGB 2EGAA 4E7KA 2MYSA 2HVRA 1XTDA 1MV3A 4F93B 1I3QJ 2IGOA 2CQNA 4WCGA 2LT4A 2QA4I 2HKOA 2E35A 2J5OA 1OU8A 3HP9A 1YX5A 2CH0A 1PP7U 1UGPB 2HNHA 3COAC 2O4XB 4CI0C 2MI6A 3EG9A 2JT1A 2DTZA 2LC2A 3JCMP 2ZNYA 1ON2A 1U5TC 3QWXX 1SD6A 3RI4A 4LIUA 4JPBW 2JS2A 2EIKH 2JM8A 4ZTFA 3D1NI 2ZJQF 3VV0A 2FUG2 1ZG3A 2O5RA 2Z2SB 3KZIC 4M6XA 3OOPA 3UKGA 4AIKA 2LX9A 3LH5A 4C92G 5E1ZB 5EEHA 4II2A 3TVTA 3N05A 2KKOA 3H1CA 2R7RA 2FX0A 4OU0A 1UJ0A 4DOVA 2JJ7A 1BR4A 3M7GA 1IC8A 4HXJA 3GO5A 2DILA 4BI3A 4ZN1A 1X3ZB 3FJ5A 3I3LA 3L1AA 2QI2A 2ECCA 4PZJA 2RAEA 2MFZA 1S72T 3EGUA 1WHJA 2K6DA 4J83A 4JX5A 4DBFA 1I27A 3X28B 4BAYA 2VJIA 5FWCA 3PIOF 4RTUA 4BY6B 2OZ6A 2A37A 3EGXB 3CDLA 3ZMTA 3O2PE 1HOMA 2QAZA 2ROTA 4NOYA 2D9TA 2QYOA 2DA5A 2GA1A 4BS9A 4S0HB 1Z9QA 3OL4A 4OP0A 2QEXQ 4R79A 1Y57A 1TL8A 5IOYA 2H6CA 4PGGA 1XSDA 1MNDA 2KHMA 3C18A 3OMYA 2ABLA 2LY2A 1M9SA 5JHFA 2BEOA 2DF6A 4M7DD 4PCQA 1KGSA 1D0YA 4XN0A 2IGNA 1T95A 3IC7A 1BR1A 1VYUA 2VI6A 1EH7A 1LVAA 2MLGA 2Y69H 3TSWA 2K5CA 1YYVA 1LDKB 3F0CA 2JJ9A 3RQ4A 3KEYA 3JAMK 3C12A 4A4EA 1ZREA 3R60A 1DJ7B 1KSWA 2LT1A 3M8EA 2SEMA 3S3MA 4BQAA 1ETWA 1W5CC 2VQLA 1Y0UA 1ZSZA 3WVDB 1I8FA 2F4IA 3QQAA 3L2ZA 2Y0SN 2ZCWA 1ONVA 2WAEA 4A3CJ 5I11A 5KYWA 3VRZA 5LJ5d 3ZMDA 4UUTA 2RHZA 2PQWA 2HZTA 3KP6A 1M3CA 4FTHA 4M77B 3HRUA 1SC7A 1T0JA 2Z0WA 2I5UA 2DA3A 3JCMQ 1KONA 4NC7A 2RMOA 3ML6A 4C30A 4G7ZF 3MEUA 2COWA 2W24A 3BROA 4IRHA 2HU9A 4S05A 1RL2A 3AL0C 2DK3A 3OSSC 3P8BB 4PSWA 3ZN0A 4CA0A 1YWOA 3EHQA 4XTVA 1WPKA 2QTVA 1OX8A 5TJJA 3F6OA 1QCOA 2LJ1A 3L2CA 1QO0D 1LPQA 4NDLA 4CICA 1N25A 2VE9A 2FRWA 5GAMe 4GFBA 3J81E 3LQRA 2BOLA 4FX0A 5JI6A 4DEYA 5FO5A 2Z16A 3JRCA 1V54H 5GAEJ 2BY1A 2DDAA 1JT6A 1W6XA 3JW4A 2AO9A 1PVEA 2DO3A 4LDYA 1JUSA 2RQTA 3DV8A 2PMUA 1O4XA 1TP4A 1LQ1A 4KYWA 1FEXA 2R7SA 1K9MC 1HDDC 1K8AR 1MBKA 1SMYF 5LJ3e 2M1BA 3K2ZA 2IVMA 1NPRA 3FMSA 2E2JJ 3RZDJ 1WJQA 2EZKA 3B6CA 4M78A 1PM3A 1SSHA 2IGMA 1BW6A 1E6HA 3HHTB 3OYMA 4A5MA 2ED0A 1F36A 2XAFA 5ERIA 2EZIA 1TQPA 4HYEA 1ZLJA 1RR7A 5FKMA 1W7PD 2OQGA 4E70A 4ZH4F 1Z7LA 1OCRH 1VNDA 2LY1A 2OC6A 2ZXHA 1AWXA 3CCMA 1NE8A 4IUUA 5IXBA 5GMKj 3FC3A 1OULA 4EATA 3WE2A 3CMAA 3T8TA 3FX3A 1ZARA 1BJAA 1WJFA 4ZC3A 5D6XA 3FM3A 5F64A 1ZGWA 4MQ9F 1FT9A 3TEDA 4JJNK 1XB4A 4D1QA 2X3WD 4LIVA 3NARA 1W2BA 2ZC2A 5ILSA 2K3PA 3NTIA 1ZUKA 2O61A 4QTRA 3QUIA 2RV8A 1X1AA 4XSZF 2KIMA 2M7BA 3QPSA 2YUOA 3G71T 2MC4A 3OS0A 3GTGJ 2DL4A 4PUSA 4R8HA 4MQVA 4BJTA 1B34A 2LDUA 4FYWB 4IIMA 3VS0A 2YRCA 3QYFA 4UUSA 3FRNA 2RNAA 2F5DA 4C5IA 1MJ9A 1G6NA 1TWHJ 2XGXA 3F72A 5F6FA 4M77G 3LQQA 1C1AA 2VBXA 3C3WA 1YITQ 1CQTA 1J5YA 3W6JB 1JKRC 4V2SA 1IV6A 1W0UA 4EMKA 1UGQB 2FE3A 3QDFA 1WJAA 1S3JA 2XRNA 3MKLA 1Y1WJ 3GTPJ 4DZPA 3JB9D 3OYGA 1IXRC 4IHYA 2DVJA 3VKIA 2FF4A 3HOXJ 2O7OA 3CMEQ 2JZYA 2OD5A 1QP2A 2HVSA 1IDZA 1SHFA 2M9HA 3C1DA 1SG5A 4EJVA 2HL3A 3IAS2 2EGCA 2PI0A 2VWFA 2E1MB 2CS3A 3WGGA 5LHHA 4OMMA 2KDSA 2FD5A 2D8JA 1SMTA 3QDRB 2FHDA 1R6RA 4BHPA 1QU3A 4F04B 2QENA 4F7UB 4H0EA 2HVQA 5TGTA 4HA8A 1VQ6A 3GF2A 2WV1A 2PJRA 2C0TA 3MEWA 1IUFA 2VJJA 1VQ5I 3OYJA 1D3BA 1X43A 4RS8A 4M75F 2KMUA 1QZYA 4BKXA 1FLIA 5LJ3d 4C8QE 2QQSA 1OPKA 2MIOA 4HX7A 2DBMA 2K9GA 1A31A 5HDGA 4P55A 2VT2A 5BPDA 3WTUC 4OMFB 2W1OA 4XLFA 3HL2A 5F27A 4XRSA 4LD9K 1MW7A 4HCKA 4ZGDB 1K73R 5HOOA 1GXQA 1BW5A 3OR2C 4M7DB 4U0VA 4EV0A 4KFCA 1OKRA 5DD4A 5EGOB 3JAMZ 4M75D 3G4SI 4ELYC 3HFOA 5FU7B 5GAMj 2BZTA 2M8EA 3E6BA 2RHUA 2QKLB 2Y48A 1S1NA 3ERED 2QSHX 4BDYA 1X2KA 2KNBB 2RB6A 1FYKA 2EQIA 3PIOA 4S04A 3CJTB 1AEYA 3FMQA 2VL8A 2XAHA 1Z9CA 2OF7A 1U3OA 4A4HA 3CCJQ 1WJEA 1JKQC 2XROA 3GTJJ 4FCYA 1MHNA 3M0RA 1XGMA 4GDFA 2FPDA 4PJNA 2OCCH 1VQOA 3B73A 3LOCA 1MBJA 3QP6A 5LLQA 1RI9A 2KBTA 3J7YJ 1YJNA 3TCJA 5KVRA 4BI8B 1GLNA 2X48A 1T2KA 2PMHA 1M1KR 2NUZA 5DV5A 2DL8A 4DBHA 4WXHA 5EF6A 3CPWA 2G7HA 4XLAA 4A6EA 2BZXA 1Y96A 5FGMA 1TWGJ 4MHGA 4YFKF 1KJWA 4XK4A 3DPLC 2GA2A 5J4VA 3FDRA 2VGMA 4M77A 2NUPB 3EUAA 4KITB 3I54A 4CYCA 3K1PA 5CAIA 2J5PA 2NNYA 4XTXA 5KHDA 3L1PA 2BUDA 3BOQA 4IHXA 1U5SA 5GMKh 2VXZA 4HV6A 2P4WA 5CLSA 2JT4A 4QVZA 2K3XA 3F21A 4LN2A 1ETOA 1QZEA 4RAYA 5C3EJ 3OYCA 2NWMA 3BPVA 3BTCA 4M72A 3ME9A 3EQLF 1WHMA 3X25B 5M9OA 3MZHA 1W5TA 3CCUI 1MJBA 2LBFA 3K70C 3Q9SA 1Y0MA 1Z9ZA 4C5GA 5KYYA 4J7FA 2F1LA 3FXOA 5GANf 4U7BA 1LEBA 5D5UB 1K4SA 2VXFA 2L4MA 1T0FC 3HOTA 2FO0A 1HKSA 4CSWA 3TREA 5HLIA 4OB2B 1VIEA 2E5QA 3OBWA 1YS7A 2L2PA 1POGA 3Q0UA 4C8QD 3M0UA 2RQVA 3SWNA 5B1AH 1MSEC 3P7NA 1VQNQ 2WB1A 4JP0A 3BT9A 4UNOA 3CCYA 4BGDA 3WTVC 1KHCA 1KU9A 5LRRA 4ZYEA 3GYHX 2CP7A 2PMZA 3IQLA 1RI7A 4J00A 1RPWA 2CH4A 3ABMH 3DEWA 3HRTA 2HDDA 2YLBA 3M57A 1NG6A 2L0AA 2PZ1A 4JLGA 5DCMB 1U5TA 4YIRX 2MH2A 4J9IA 4M75G 1XSVA 2JRTA 4I76A 3JRFA 1IUYA 1OZ2A 5L3CA 2KIFA 3M56A 4XSXF 2ZJPF 2AKKA 1ZBJA 3S2HJ 2QZ8A 3F22A 5ICFA 5GP9A 5F08A 1BA5A 1NEGA 1WXTA 3M4OJ 2ZSIB 3CLQA 3DTEA 1G83A 3PSFA 3TP3A 1UEBA 1AWWA 4IUQA 2DTHA 2ZXIA 3QZ9B 2COBA 2V4JC 2EQMA 1HD3A 1VQ6Q 4NL2A 2DK8A 4RUGA 2ETHA 2E7WA 3DXJF 1D0ZA 2YU9J 2CUJA 1J75A 1FMVA 1B8IA 4MTEA 2R5YB 2K7LA 5GTHC 2GBYA 1IRXA 1B9NA 1DGWY 4XOTA 1FYLA 1IXSB 4ASNA 4E7IA 2VUMJ 2VQHA 1FZPB 2LRQA 2RJFA 5AONA 3NRVA 1JJ2S 1T33A 1YJ9Q 4IOAF 3ZMSA 4FYXB 1MDMB 2QDLA 4GRIA 2KXDA 1MMGA 5GMKm 4JBAA 4C2UA 2MSYA 1RR8C 2GTOA 2J05A 2UV1A 1TUDA 4OB1B 5CKEA 3HUGB 3I56T 3CCSI 1G2BA 5CR2A 4A6DA 3F6VA 3LFKA 1N9RA 2JNGA 1QVUA 4ENJA 2XGCA 2PQ8A 2NYXA 5L3DA 3EYIA 1DU6A 2JVVA 3BZKA 3TQ7P 2WSFE 2RI3A 2D5VA 2ZBKA 1ZSZC 2X3XD 1AWJA 4LOCA 2X0LA 1PWTA 2DM1A 1H89C 5LEKA 3CMEI 4M9SA 2F2VA 1KC8U 4JYKA 4FU6A 4D9JA 1WH5A 4L9NA 3OYLA 1SEMA 1X2NA 3BE3A 2R92J 3QG1A 2R7OA 4Z8AA 2LNHB 1GVDA 5H6QA 3J80E 3V8JA 1YITT 4A3BJ 1WGSA 4E7LA 5IHNA 5CVUA 4GBQA 3JB9H 4OAZA 3VFZA 2LMDA 3QP5A 3HPWA 2JUGA 2Q2EB 4A3KJ 1XDSA 3FBIB 3P9IA 3ASOH 2CMPA 2LVSA 3CCMI 1X1BA 3B6AA 4OMYA 1B34B 2KVQG 9ANTA 1P7JA 4JRIA 5CIUA 4MTDA 2WADA 4E6KG 1H0MA 2NS7A 1PKSA 1F1ZA 3CCSQ 1USTA 4AIHA 3AT1B 4UY8I 2VT3A 2PVOB 1SEUA 5EZHA 4AIDA 3TOAA 1KQSA 5JVGF 2F4OB 4ZZDA 4DYRA 2HPIA 4KNYA 3A8HB 2RC4A 3EUKL 1TU0B 4R1HA 1MD0A 2EKHA 3CXCS 5TRDA 3A98A 2V9VA 3EUHC 4GYIA 4AUXA 2LCCA 3L7WA 3ECOA 4Q48A 2EFWA 4ZDPA 1Q86C 2I0NA 2WSEE 3DLLA 5CKBA 2HZDA 4LUDA 4JJCA 2JMWA 4M71A 2O03A 1IN6A 4I99C 5D8LB 3LSKA 2DD4A 2ESNA 3GP8A 2W84A 3BR5A 4XORA 1ZR2A 2CV2A 4C0DB 1S29A 2YT6A 4EM1A 2DTRA 4BQOA 4J9HA 2Y31A 3BPXA 1ZH5A 2QGFB 1H9TA 4ZN3A 3VDXA 1S5LC 5E8GA 2B86A 3HKZA 4C9YA 4HQMA 3CCRI 5GANj 1UHWA 4LJZF 3RJPA 3WTTC 2NVTJ 4MZMA 4IX7A 1RZ4A 5A2QK 5FD6A 1XMAA 5JVTA 1M5Q1 2ZB9A 2GOMA 2FZKB 3MZ8A 3LAJA 3H36A 4MO7A 2HQAA 4DYCA 2HD0A 3IKVA 3GLXA 1VFCA 3CCQI 2ZJRF 4AMCA 1UZCA 1O3TA 1KU2A 3OYKA 2HBWA 4OMZA 5GAOm 1TW2A 3F8MA 2VGNA 1FOWA 5HCKA 5IAYA 5I22A 1UTIA 2GIZA 2Z3YA 1ZTRA 2KXCA 2M0CA 2Q1ZB 1M3BA 3E6MA 2FZGB 1VF9A 4E6RA 4M74A 4M78G 1FIPA 2XI9A 2CU7A 3KP4A 4KT6A 5IT9K 4XONA 4OWRB 3GWZA 3F8CA 2JPCA 2GZWA 1GFDA 3CC7I 2OTLI 2GXBA 2M3AA 2RQRA 5D6FA 3EUHA 1RADB 3CC2A 3FM5A 1RRJA 3CMAI 1RETA 2V7FA 2PX9A 1TWAJ 2DMUA 4QPOA 1OFCX 4Y15A 2EQUA 1K83J 4AYBA 3WHCA 1C0MA 4X9DA 4Y91A 1ZQ1A 2V9KA 2DRMA 1K0XA 2DK5A 1JGGA 3JCMg 3KCCA 3SB2A 1WHUA 1EX4A 2OI3A 1E17A 1SHGA 1N75A 1QPMA 3HZJA 4L0YB 3BCBA 4FASD 2BKDN 4AFZC 1YFHA 2H8HA 2DW4A 3EETA 1PRLC 1ZK8A 3BQYA 3BG3A 3UF4A 4F7UF 1V29B 5HVQC 4C2MJ 2DN0A 3QXEB 4PJOG 2R58A 1G2HA 2F5CA 4HW0A 3OIQA 3FXRA 4LLLA 4KICA 3I55Q 1Q82C 1WJSA 1TLHB 3V7RA 4BHBA 4IQJA 3A5ZB 4J9GA 2DE0X 4MDWA 3RKWA 3SWNB 1XMKA 2EA4A 2RM4A 5GMKi 4BEHB 2HDAA 3SZTA 5C44J 2R4GA 3V42A 3CCRA 5DM7R 1JTYA 2M87A 1OYWA 2EV0A 2WAFA 3RNJA 1G3WA 3T5XA 2M02A 2V9PA 1WZOA 2JN0A 2FJ1A 2X4WA 4FYVB 2KIUA 3OQ5A 4L9TA 2HSEB 3OSFA 1YJWA 1KQSS 3AAFA 4AVZA 4C2TA 3H9NA 3FISA 2Y9YA 1A6IA 4U88A 5J1YA 3K0LA 4DQ2A 1MMDA 3ISPA 2LSOA 1VQ9I 2KT1A 2KY9A 4CGZA 4V19K 2K02A 4KUDK 4M7AG 4MEXF 1NYGA 2UWMA 2A3LA 2KDZA 2MABA 3K4CA 1OX9A 1T56A 2BXYA 2E1OA 2FPEA 2UUZA 4N9HA 2IVWA 2CUZA 4M6YA 3OSVA 4D0PA 4LK1F 4J01A 2EJFA 5GANd 1WCMJ 8ATCB 3W3CA 5JFRA 3MVPA 2DO7A 1B8IB 2XG8D 3CCEA 4ORZA 3DBHB 4XU3A 2HI3A 1NZ9A 3I9QA 3U21A 1JXOA 3BJ6A 3EAEA 4KISA 1YS6A 1TQMA 1UFMA 1U78A 2CS7A 1WQWA 2XC7A 2LREA 2DIGA 1XGOA 3DF8A 2JOYA 1AKHB 2ISYA 2CGPA 2QXFA 1IV8A 1QVGA 1SAUA 3KP7A 1P4WA 4LK0F 4RBOA 3DP7A 3M0SA 1IHVA 1WI3A 5BQTA 3G71Q 3GUDA 4YG2F 2CV1A 2YLCA 3WU1B 4D7MA 1X2QA 1T08B 2XAJA 3VYSB 2BY3A 2X9DA 2EAYA 2LTPA 1F9NA 4G12A 2NUPA 3L42A 3JCMd 4IKFA 4OIOF 1X58A 2WBMA 3AL0B 1D3YA 4BXFA 4IZZA 3JSCA 3MPUB 1OQYA 2XKOA 4UVAA 5FJ8J 2P6TA 1Y0NA 3LAPA 4MDXA 2E5NA 3TW6A 4JX4A 3SQNA 4JQFA 4P9FA 2ATCB 1S9HA 2DPPB 2QLZA 1SFXA 1P9QC 2IG0A 3R6SA 2STWA 2M51A 2ELKA 3OYAA 3BR2A 3MKWB 4B3XA 4FT8A 3M07A 1KQSP 2CP2A 1PCXA 4WTOB 1HDPA 1YJNQ 5KYXA 4HSTA 1YI2Q 1VQ9A 2E12A 3I4PA 2K2MA 2DJZA 4PJOF 5KCMA 3IAM2 3RKXA 4X6AJ 1PHTA 2KZVA 4M7AF 4M7AE 1MBEA 2JW4A 1HW2A 3NQOA 2KGTA 3H41A 3H3VK 1GUUA 3GZ6A 2HWVA 2PMZN 1B9MA 3HOVJ 3OY9A 2OZUA 2BGCA 1GHCA 4ESFA 1M3AA 2BTTA 3P8HA 5GAN7 1YW8A 1VQ5A 4EMKC 1F1BB 2Q2EA 2A05A 3KYCB 2ESWA 2VC8A 3G4ST 2AIRB 1X3WB 4KT0E 3Q3SA 4E7HA 2HQ5A 2K40A 2R7VA 1K73C 5KK1A 1QBJA 4KGZB 3H0GJ 1H8AC 5EEGA 1APLC 5CKHA 2DT7B 4M77E 4KULA 5FKLA 4RB1A 2QSFX 3R0JA 5EC7A 1MNEA 3K1MA 4BE0A 5K7ZA 1NM7A 5E3MA 2OX7A 3CD6T 2QA4T 2L02A 2CKKA 2CW0F 5FLXK 4LDXA 5DM6F 5GANh 3EGXA 3CCRQ 5D6EA 1VQ7A 2L9NA 3H5RA 5K5QA 4EPCA 4Z88A 1C6VX 2L54A 1R71A 4AC0A 3CUQC 2KEAA 1E2XA 4N4NB 2VJ5A 1J09A 5B1BH 4N0AC 5LGUA 1I6XA 2DZ9A 1IN5A 1X2MA 5KE3A 1RESA 1AA7A 2R5AA 3DB3A 3DEUA 2ID3A 4YFNF 1NPPA 2K79A 1PUFB 2L89A 4M3BA 5CVVA 3SYTA 2KI7A 2KK4A 2RK1A 3A8GB 3UWNA 3GW2A 2ZPBB 1M2OA 5ED4A 2EJ9A 3J7AF 4XKCA 3GTQJ 3KXTA 3QPTA 2CG4A 2NVYJ 3KP3A 1B3QA 1ZAOA 1TXQA 3SEZA 2FA5A 1XNIA 5FLMJ 1IN7A 3H5NA 4O6JA 2A0FB 4EVIA 2DNUA 3BG6A 3M58A 3E6DA 4L5JA 3S93A 2EPFA 5E3NA 2CQQA 4EJOA 3H0DA 3M0QA 4AFQC 3DKWA 1O3QA 1MIJA 2DMTA 3LA7A 1U6GA 1PKTA 1REPC 1V5GA 2R57A 3EFOB 3H6ZA 1X6OA 1BI1A 3CO6C 2L7ZA 4LE9A 2BXZA 2COMA 1R5ID 5D4SA 1LB2A 3KYLA 2VE8A 2O9VA 3HOZJ 3WODF 3CCMT 2PLYA 2N8GA 3JTHA 4XRSG 2QQ9A 5CK9A 2DPUA 2CGHA 4TVRA 4P9UA 1BCOA 3CMAT 4CC7A 3HSBA 1I3AA 1WFXA 3V7CA 4M77D 2HGCA 4U0WA 2QWWA 1HKTA 3VEPA 1FOYA 1TH7A 2LH9A 1M1GA 3WG9A 2LD5A 2CREA 2LQWA 3GBGA 2FOWA 3GFLA 1T0HA 1WZ2A 3QYHB 3S1RJ 1UG1A 4HQEA 2RI5A 4M75B 3THKA 2BE5F 3K4BA 1EFNA 3T0YA 1T3LA 3TMOA 2CV0A 4ESBA 3QJ6A 4UXNA 1HLVA 1QCFA 1PSEA 1PSFA 2R5ZB 2XDDA 4D6WA 3IH4A 4ZDOA 2O9LA 2DFHA 2RH2A 4BEHA 1U8BA 2DXTA 5E17F 2ZKZA 2VC1A 2B0LA 3HKZN 5GADJ 1X6GA 3PNYA 5KE2A 2XHKA 1LFPA 2F4MB 5FKNA 4KBMB 2L7KA 3CJQB 3HHHA 2VUBA 2H1KA 1ORKA 1WX6A 3CQZJ 2RD1A 4W1UA 3S8PA 2E6NA 4KUIA 2C0IA 2HOTA 3S15J 2DPDA 3C94A 1WGXA 4I0BA 4HF2A 1JXMA 1FC3A 4F17A 3S14J 3M1EA 2M34A 2VIXA 1MSFC 1R58A 5FRNA 1OCZH 2GXGA 2HSPA 2WAQN 2LKXA 1VQMT 1EKEA 1AT1B 2I8DA 4JRQA 2RHYA 1YJ9T 1ZSZB 5IYCJ 1H641 2RQUA 1VQPT 2Q0OA 3JRHA 1AKHA 2DYIA 2JVHA 4IIOA 4A4KA 3DFGA 3DLLF 2L0KA 1M1KC 4RB2C 4GYGA 3QODA 1S7AA 1BBZA 2EGEA 2IBDA 1WH7A 3ZOBA 2M1HA 3K9TA 2V26A 3CZ6A 4M7DA 5J6XA 1VQ8A 3DEEA 3H9QA 2HEQA 3ZQCA 3ZEHA 3CBPA 4IXAA 1PRMC 5IHKA 2HS5A 2MH9A 2P6SA 3HM5A 1LJOA 1UHFA 5D5VB 2A7YA 2R7FA 3ZRGA 1F4KA 1D5VA 1YP5A 4PNOA 5C6SA 9ATCB 2G9WA 3HOWJ 1W70A 2JTMA 4OVAA 4HCBA 1BCMA 2VODA 4RTWA 1R36A 4IHTA 4EIKA 1RKTA 5GMKl 4A53A 1W1FA 3JCMb 3I56Q 1W36D 4L5IA 2FL7A 1OMIA 4E7SA 4XU0A 1UHMA 2DCEA 2JUCA 1FXXA 1SFUA 4A4FA 5E8IA 3CCLI 3DB4A 1XTAA 4ME7A 4HX8A 2LMJA 4Z89A 4IHWA 1Y71A 3VODA 4CCOA 5KAFC 4J19A 3HOSA 3RQIA 3CC7Q 1IRFA 3PSIA 3CCST 1TNSA 1D3BB 1TT5B 3RR6A 2ISZA 2ZPFB 2DL5A 2DOAA 4XLHA 4PJJA 4DOZA 1SKUB 2LJ0A 5GJVB 2TRTA 1O9SA 1JT0A 2GFAA 2VBYA 4NBQA 2VXEA 3LSRA 3ZQQA 2NYSA 3ABTA 1ZRDA 4C8QF 4BUPA 2X4YA 1KQ8A 5D4RA 4P1WA 3OYBA 1IN4A 5LEJA 2OBPA 1I6HJ 1TSFA 2KT0A 4EJWA 3U23A 4R56A 3G6ET 3TKYA 3K4NA 5M5XJ 1YITI 3I35A 4M3GA 1FP1D 3RDIA 1ZN2A 2VKNA 2CWEA 3JB9I 2IIMA 4ESRA 5GMKe 3VYHB 1M1KU 2IPQX 1RUOA 3V4GA 1XN7A 3G3ZA 2BBYA 1X4OA 5K7FA 3J81K 1M1EB 2LK2A 4PFPA 2PBIA 3EHRA 3FJPA 5FW9A 2CW8A 1GDTA 2H27A 2E36A 3BW1A 3I55A 3N5BB 2IXSA 3DPTA 3LWFA 2K5LA 3IWFA 1Y8RB 5HDNA 2QK0A 3ABUA 3UA6A 1TQIA 1YHQI 4ZGEB 3K4LA 3TGNA 1NJIR 4KMUX 4XOPA 1D1BA 4TV7A 1OI1A 4NC8A 1JKPC 1OZ3A 1WHGA 1TUCA 1XC5A 2PG4A 5IT3A 5AYFA 3LW5E 3QIIA 2MBFA 1MGQA 2BE9B 3ASKA 4RTTA 5IYDJ 5KCOA 1TWBA 5LHGA 2GCXA 3IH2A 1W1WE 2PEXA 2LNVA 2P0KA 3JSPA 2AK5A 3HIFA 2DODA 1P4XA 1WFWA 2EKOA 2G0EA 3DKYA 2EQRA 4I7HA 3CBOA 2M5WA 4IUTA 4KH1B 1PJRA 5F1JA 2JQ7A 4M78F 4E7ZA 1VQNT 3VYGA 3JRDA 4J5YA 3T1BA 4HNVA 2DA9A 4BACA 4PDKA 4ZJZA 1VUBA 2EV5A 3F23A 3QZ5B 1SD5A 5KYXB 2R7UA 4RMOA 2VXDA 4ZTJA 4OMLA 4DZJA 3E9FA 5H2FC 2ZPIB 3HEFA 3I71A 1NTCA 3LSMA 2HR3A 3CDIA 4ENKA 3CC2I 4FIBA 3CCVA 1IHWA 1K73U 3WU0A 3OL3A 2D6FA 3PQJA 4C92D 1ZX6A 2QEXA 1U3EM 3MAJA 1Y6IA 2HQHA 1BC8C 1U06A 4J6YA 2F5EA 4JRPA 1MNMC 2G7UA 2PJRB 1VQLA 4MFEA 3ERMA 4I2OA 2FSWA 2CP3A 2CQ7A 4C92A 3L2WA 1FTTA 2WTEA 4LB5A 2V1QA 1HK9A 2D1VA 3RPQA 2DMNA 1BIBA 4HLXA 1L3LA 1AOJA 2AQEA 4J9CA 3VS6A 5IT9E 2J6KA 3S3NA 3RKQA 1R0CB 5D7UA 1VQOI 5LJ5f 2UXNA 2R7DA 1ACMB 2OTLT 1MBHA 2ZMEA 3ROUA 5J1RA 3U2RA 2E2IJ 2L3SA 5DLOA 2MF2A 4YEJA 2F2EA 2XF7A 4Y28E 1YIJT 4MMLA 5CVIA 2RQQA 2MOXA 5KYWB 3LWIA 4JS4A 2L7MP 2JTVA 1R9TJ 1JE8A 2DYBA 5J40A 1CKBA 3MHXA 3VJPA 1B1BA 5JLWA 1LOJA 1T8IA 3M5AA 1VYTA 5K5OA 2KRNA 3DWLE 3DLMA 4C8QG 5GTIC 1J59A 2KRMA 3I9V2 5GAMg 3I56A 1K6YA 4PLIA 2DZCA 1WXUA 3AFHA 1NH3A 1STZA 2ID6A 3AG1H 3R61A 4I02A 3O8GA 5BMZA 1IRZA 3NPFA 3D5SC 1YJWI 3FXJA 2DX1A 2K86A 4HVUA 1BKBA 4X1VA 1N8RR 2DL3A 1J7KA 4A3GJ 2LQNA 2PU9B 3BJAA 2XB5A 2DMPA 4BJ5C 5CQEA 1SAXA 2HXIA 1ZGAA 1YI2A 1VQ9Q 4U87A 2EJGA 2ECZA 1YHQT 4WWCA 1JRIA 1YW9A 4XICA 3MP8A 3S6WA 3OYDA 5D5WB 1I5OB 5KCHA 2P5KA 3CPWS 1IO6A 1XMXA 3PM1A 1WI9A 5F0HA 2OTJA 1XX5A 4HX4A 1Z7UA 4BHCA 4LITA 3VSLA 2IS4A 3S16J 3FMRA 3HSRA 2YUQA 3M54A 2RNJA 2X6XA 4O3MA 1ENHA 1V5FA 1NK3P 1N9SA 2CP6A 5LJ3g 1LFUP 2M2EA 1NBEB 1SPKA 2XDVA 2LRDA 2D1XA 2ICWG 3OYFA 1VQNI 5LGNA 2R5MA 2XK0A 3MKDA 6AT1B 2I10A 3Q9VA 4BE2A 2BHZA 2M9UA 3SEMA 3M8JA 3A1YA 3OV8A 3QPLA 3M9QA 3JB9J 4RM2A 1JJ2P 1D1CA 1RUWA 4IPAA 5HLTA 1VQ7I 2R7QA 4Y7NJ 1V4RA 3BG5A 3HRSA 3RTRA 1NK2P 4QSHA 1DPUA 1HA8A 1FSHA 3MQ0A 3J7ZI 3IRQA 1FBQA 1D1AA 2EIJH 2CP5A 2F48A 3GZ5A 2YHTA 4C0GA 1MMNA 4BU2A 4HPQA 4XRFA 2ADUA 5E20A 3ZQGA 2JN6A 3ZGKA 1VQMI 3W6VA 2DXBA 2DQRA 2HQRA 4II3A 1YCYA 2P4TA 4ABZA 1IDYA 2KJBA 3ZQHA 2GWRA 4MIMA 2K5FA 1O7FA 4RTXA 1LE8A 1IO2A 2QSGX 4AU7A 5CQXA 3WVEB 4H4KC 3JCMh 3DQVC 1T6SA 4BDZA 1RUNA 2GQIA 3M8FA 2QVOA 3HSEA 2XVCA 1O3SA 3K70D 1JBMA 4UVBA 3LA3A 2FZCB 3VSKA 1Z67A 3JTGA 2XHCA 3PVQA 2KP6A 1PUFA 2W0ZA 3J80K 1O3RA 3ULQB 2ZSHB 1JQQA 1BL0A 3HXLA 2RVCA 3HSFA 1ETXA 5FLVA 2PJPA 2M4GA 2ZO4A 1MJAA 1GBRA 3MCZA 3JCMc 2YXYA 3PNVA 1U1SA 2QKMB 1SFOJ 2NNNA 2OTJI 2HEOA 2DVEA 1N77A 3E5UA 2X4JA 2LG4A 3L00A 7AT1B 5A2QZ 1X75C 2R5YA 1QKXA 3MMYB 4EMGA 1NYFA 5HS9A 3SDZA 1ZYRF 2QQ8A 4HG2A 4BXUA 2R5ZA 5TISC 4ZYAA 3GTKJ 2TDXA 4A12A 1Q1VA 3OYEA 3I64A 1Z1DA 3TO7A 5LJ3f 5FB2A 4OIPF 3BJOA 1K1ZA 5LJ5j 2ZPEB 2RF0A 4PJLA 1BB9A 1B4AA 2QA4Q 1C0WA 5EG0A 5C4XJ 2Z99A 3MEAA 1W5SA 5D8KB 2HZYA 3GEZA 4GO1A 4I09A 4RKUE 4FL6A 3SHWA 1PP8F 1QVTA 4EGYA 4IHSA 3QOPA 2VN2A 2DOFA 1AU7A 1ETKA 1RC9A 2HTSA 4OIQF 2HDWA 4RG8A 3DBRB 5IP9J 2P0WA 1RAFB 3JCMe 5L23A 2X6OA 2LZ6B 3KYDB 4UB6C 1CGPA 1AOYA 3PNWC 1YJ9I 4X0GA 3TL4X 1FPQA 3GFIA 1NG2A 2W48A 2J06A 1X6BA 5LD2C 2CJJA 1I50J 2GOXB 3FXLA 3OOUA 2DI3A 1VYVA 4LDUA 1NG7A 4KJZA 2RHIA 2P5LC 1I1GA 3FK6A 1WQ2A 3E5XA 3ABLH 1FYNA 2QG9B 1IZ6A 1MUZA 5FU7C 4BJ6C 3CUQB 4LFUA 2VYTA 1JO8A 3O6BB 3ZQFA 2M4KA 2EV6A 3J7AY 3VOEA 1GCQC 2ELHA 2L2OA 3G1MA 2QQBA 3Q0WA 4XRMA 2LVMA 3CF2A 4XIDA 2Y30A 3MFKA 2E1HA 1LUJB 2EPDA 2FNPA 4HLYA 1QLYA 3H0HA 2KFDA 3G4SQ 2YSRA 4XQ3A 5E18F 2E19A 1Z6RA 2P4RA 5J8FA 4XN3A 2J6FA 3MEVA 3E19A 1LEAA 2LC4A 3SHFA 4KA4A 2BV6A 3K4JA 2A6EF 1JHFA 1WVRA 2DFIA 2M45A 4Y3OA 5EG2A 1R7JA 2YWWA 4HV5A 4FT2A 4RG2A 1ON1A 2QGUA 4HZFA 3LX7A 1NJIC 3QPHA 2LTOA 4PGHA 4JK1X 1K8AU 1M90R 1FBSA 2VQCA 2UZKA 4Y4RA 4DNCA 3OW2S 2M30A 2IP2A 2RO0A 2DJNA 3GFJA 1ZG5A 3QJYA 1G5VA 4HVVA 3HFNA 1A5JA 2AZSA 1Y96B 1AVZC 3R6OA 3JCMX 3PMIA 2LCSA 3RUXA 2AHJB 1VTNC 4MZTA 2ZXJA 3SJMA 5GAMd 3PGGA 3F8NA 4EEFG 1B72A 5IP7J 1KU7A 3CLOA 1H9GA 2OCEA 3F70A 1B59A 2ZAEA 3D5LA 2KAFA 3RERA 2DYSH 2P8TA 1A0NB 2O0YA 4HAMA 1WDXA 1ABQA 2K5IA 4RCCA 5GAMh 4FT4A 3PIPA 1UECA 1Y8QB 3L2UA 1IGNA 2E10A 3DKXA 1PDNC 1WHLA 2NLUA 4AFUC 2CDTA 1IN8A 2DA6A 1KD1U 4K11A 2RJEA 2CUFA 2JMAA 4FE7A 3HB9A 3BFMA 3CMET 3I59B 2BVLA 1U9NA 1Y56A 2HQNA 3MO8A 2HBPA 3QU6A 2FXAA 1ZQ3P 2V8KA 3BTIA 1TTYA 1IXDA 2K3FA 2QM3A 2A36A 1UUEA 2K4BA 3K6GA 3LSHA 5E79C 1R0BG 1QP3A 4JS5A 2L8DA 3BDLA 3RMQA 2IA2A 1VQ9T 2XDBA 3RMSA 2JM9A 3JR9A 2YR2A 2JK3A 3HUGA 2D2WA 2E5KA 1P92A 2LP0A 1VQKQ 2CFOA 3W6KB 2GXAA 3CXCA 1QPIA 1AZGB 2HOAA 1FP2A 3SZGA 3LNQA 3CCEQ 2VJ4A 1EV7A 2CSIA 2WWYA 1RIOH 2SRCA 3LGFA 2HL5C 2CW7A 1Q86U 2GQVA 3R6NA 3H92A 4B09A 8AT1B 1V3FA 3MKYB 3P5JA 1BYMA 4XNFA 3JCUC 1PUEE 3CQTA 3S17J 1ZHFA 3QHSA 3DBLB 4AG1C 4FETA 5ICCA 4KH0B 3CXCP 4EMSA 4L5EA 2LP5A 2XIDA 3PFIA 2LY9A 5F04A 1MDMA 1HSQA 1IRGA 2EW3A 4OMQA 1R00A 1KK7A 3EFSA 4RGXA 3VYTB 2QASA 1IJWC 4NHJA 5L8RE 1EIFA 1X69A 2MW8A 3CCJT 1R5HA 3WE3A 4HT9A 2QF7A 1VQ6I 1ABOA 4B8XA 3OSGA 4AD9A 5F1RA 3CESA 4OINF 4HNUA 2EBPA 2O01E 2X1EA 2DAQA 2E6ZA 1EJ9A 4OGEA 4UV9A 2FPFA 3FXKA 4ZGJB 1K9MU 4A3DJ 1T3SA 1YIOA 3BP8A 2Z1DA 2ZPGB 2DAOA 1VQOQ 4G9YA 4D8KA 1QW1A 5CYVA 4PL6A 2DOEA 3L2RA 2QEXI 1J2XA 1RI0A 3BY7A 1K0SA 4M77C 3L2QA 2KQRA 4F91B 5GPCA 5HODA 1YRNB 4ZNXA 2XASA 4MGRA 1KIKA 3WHBA 1IW7F 3WG7H 3NGPA 5IOZA 1YRNA 4HCCA 4OF1A 2NAZA 3G4SA 2EILH 1T39A 4RTZA 2XD0A 2BVMA 1XPXA 2MCNA 1ARKA 1LNWA 2ZXWH 4KUMA 2XV4S 3NWTA 4A3FJ 5A2QE 3GOXA 3CCVQ 1FX7A 3U9GA 3ZCOA 4DBQA 2DU9A 4GGGA 1A35A 2KSSA 1I1JA 2QYZA 4C92F 4CC3A 1G59A 2FEIA 5K5RA 4M7AA 2DJQA 2EZLA 2CP0A 1YN8A 4L59A 4IRIA 2ED1A 3X2QH 4XLEA 5J1UA 1G3YA 1I4K1 3G7ZA 3CMYA 1FJLA 3RBBB 4Z6YA 2RJCA 1Z05A 2JA7J 3EG1A 2L4AA 4ANJA 3GF5A 4IUPA 1VQ4Q 2LNBA 1P4AA 1HBXG 1A6QA 2GTJA 2NOGA 5ECAA 1IZ1A 5EG0B 4ZYDA 3ZMVA 3FXQA 2K9QA 2GBQA 1DUXC 1WJDA 2O8XA 2Y0SA 2HOSA 2IAIA 4PJMA 5H6RA 3G71A 3K4KA 1SVOA 2DYRH 3TQNA 3I55I 2EINH 3QRFF 1WJ5A 4GCVA 3QAHA 3HDDA 1ZG1A 3CCQA 2O8KA 3VUBA 1XGSA 2H8WA 3WGIA 1FYMA 1B7TA 2A6HF 4UB8C 4I01A 4A4GA 3A02A 3HPHA 5D6YA 1K4US 2BW3A 4UV8A 1XOVA 5I2SA 2H3JA 3FZVA 2FB7A 2K7AA 2XPWA 1UHSA 2R0QC 3GTOJ 4HSRA 1HF0A 3FK7A 3CC7A 4D7NA 4MNUA 1MH3A 1Y7XA 2EYZA 3BDDA 5HNHA 1OCPA 1H88C 3CCEI 3ZBDA 2V79A 4BL0B 3EYYA 2P84A 4RMNA 1KU3A 1W4MA 2EK5A 3I4MJ 4RLFA 3AG4H 2NXNB 4CC2A 3MP6A 2RDPA 2DA7A 3DU6A 2Y4XA 3AG3H 1S8NA 1WKMA 3K2AA 1JXSA 1ZLKA 3M4GA 1VQ6T 4C3IJ 2IS2A 1ZA2B 3A03A 4JDSA 4N4GA 4PFZA 3CPWP 1VQNA 2K57A 1SVLA 2CYYA 3VYRB 1OYIA 2XAQA 4A69C 3BCAA 4B4CA 2VOPA 1WQ7A 2YDLA 2JTEA 3HGGA 3SXYA 2R93J 5DEQA 3SD4A 3BR3A 2WAQA 3F3XA 2A28A 4MZPA 4N4OB 1YG2A 1OEBA 1VQ5Q 1G8XA 3WTYC 3CDHA 3RIRA 4KT5C 4KMFA 2KROA 3TO9A 4OB3B 2JPBA 1F5TA 1TT0A 1N78A 5GAN4 3GBQA 3TBIA 4DBRA 3E9GA 1DP7P 1SRLA 2Y75A 1N5ZA 1YJ9A 2OTJT 1Q7YC 4PJOD 2DA4A 1BJZA 1WJBA 4D5FA 2E34A 4KDPA 2VPLA 2EVRA 1E3PA 1HCRA 4M78E 1BI3A 3E0JB 1VQMQ 1TUGB 4QLCU 2FEZA 2H6BA 4RM3A 1GRIA 3HTRA 4EQQA 4E47A 1KZHA 3HC7A 4FSSA 2JVGA 1VQ8T 3JB9F 4X34A 3X26B 2YX7A 2QUFA 3GLLA 4LD5A 2GAUA 4IL6C 1K61A 1K78B 2F5KA 2VVKA 1VQ7Q 3G2BA 5J47A 2HYFA 2OA4A 1R1VA 3FBNB 2XSJC 3OS1A 3ER0A 5GAMf 1VQOT 1YJNT 2AZVA 2Y9ZA 3KP5A 5CO7A 1GV2A 3I59A 1U5TB 4CDGA 2NVQJ 3LFUA 5LJ5h 2JA8J 3CC4Q 1UJ8A 1K6OA 3OS5A 2RREA 2DA2A 2P7CB 4ITVA 1E0EA 3JV3A 5BOXA 3ZMZA 2DETA 2Y2ZA 3TSZA 1DU0A 1KQ2A 1KD1C 4E2FB 2BZ8A 1YI2I 4PJOE 1SVMA 3LSIA 3DTKA 3Q0VA 4A3MJ 4C92E 4BY1J 4J9DA 1UGRB 3CCSA 4DW6A 2IEKA 1X1PA 3D5RC 5FFXA 1M2VB 1VOMA 2GNCA 3QKJA 5M3FJ 2RQWA 1YHQQ 5KNLA 2FBKA 2MWOA 5J8CA 4XKBA
chains in the Genus database with same CATH topology
2A07F 3WGHA 1S6LA 1VQ4T 1TNTA 3HRMA 2CQKA 5LGTA 4LDVA 1RNLA 4EMHA 3LGLA 1T98A 3G6EA 1G3TA 2XKPA 1T38A 2ZCFB 3FIFA 5LJ3j 1HW1A 3OBYA 5FU6C 2JZ2A 3FWEA 4M7DC 2DXCA 2QQRA 2XDPA 4K2EA 4KIGA 2HYGD 3REOA 5LJ3g 4YIFA 1QNTA 2DXUA 3FEOA 3META 2YU3A 3JB9G 4IURA 3WXMB 4G7HF 1KC8C 1XGNA 1KG1A 2EIFA 4GY5A 5GAOq 3GNFB 5HDKA 1TBXA 2MC3A 2VONA 1Q7YU 1XCVA 5LL6S 3GVAA 1SD4A 3CCUA 5GAN6 2CO5A 4N0BA 2Y0MA