3HRTA

Crystal structure of scar with bound cd2+
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
212
Chain Sequence
PNKEDYLKCLYELGTHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
molecule keywords Metalloregulator ScaR
total genus 52
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrtA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrtA02
5CVRA 3E6BA 1OYWA 2Y48A 5FD5A 3WG9A 1IN7A 1T39A 1QO0D 1R58A 2HEOA 1OPCA 2OZ6A 5L3EA 2EFQA 4G7ZF 3V7RA 3REOA 1Z7UA 3LWFA 3GEZA 2AS5F 3LFKA 2J5PA 2ZXJA 4YFKF 2GA2A 2X4HA 5IT3A 1KA8A 3U2RA 5E1XA 3DPLC 4I0BA 4KIFA 5J8FA 5CVVA 1V4RA 1J5YA 5ERIA 4OOIA 4RGSA 2QM3A 3WTTC 2HYGD 3HRMA 2RKHA 1HSTA 1WI9A 1PDNC 2UXNA 2A61A 4HQEA 1XGOA 2XV4S 1SD4A 4GCVA 3R6SA 4CZZA 4HF1A 4BHCA 1RUNA 1KU9A 4OU0A 1O3QA 2RQPA 2FXAA 2CG4A 5K5RA 4Q47A 5BPIA 3BROA 1SMTA 4WXCA 2JTVA 5D5XB 2QQ9A 3ROUA 1QZYA 4A2UA 1D5VA 3R0AA 2DW4A 4HDVA 2DPUA 4KMUX 3LAJA 2IW5A 3F8FA 2VONA 3TQNA 3KZZA 4ENKA 2W84A 5CVJA 4ASNA 4A0YA 1K79A 1P92A 4LD5A 1R22A 3TO6A 1SAXA 2VC0A 4LLLA 2D45A 5J6XA 3KFWX 4YFNF 3CO6C 1ON1A 2V1XA 4RB2C 2ISZA 4OIOF 2EV6A 2L4AA 1YIOA 2RVCA 3O6BB 1XMAA 2CQKA 5DCFA 3I54A 1U3EM 4A6EA 4L5IA 5LHGA 3PQKA 4LK0F 4ZH4F 3ML6A 3WGIA 2CFXA 2JPBA 1BYMA 1Z6RA 1MD0A 4IPAA 2GIVA 4XLNF 2O6GE 5DD8A 1I1SA 4D0PA 2RC4A 3F23A 2P5KA 1IXCA 3K1MA 3KP3A 1FSEA 3DV8A 2FE3A 2FNPA 4Q4ZF 1OYYA 4EJWA 2EWNA 5FFZA 1G3SA 5LBQA 3V7CA 4OMZA 4BAYA 2Z5UA 1Z6TA 5ILUA 1T2KA 4KIGA 1YQAA 1IRGA 3KEOA 1UFMA 2JZYA 1NHAA 1FBQA 3J81K 4L0ZB 4P55A 1FSHA 3CUQC 4I98B 1RNLA 3HOSA 1J75A 2ZMEB 3WTUC 5FLXK 2HQNA 1FY7A 4Z2YA 1WSUA 3J80K 2IA1A 3GVAA 4RAYA 4BHBA 5E20A 5HLIA 3F8MA 1MDMB 3RJPA 4AWXB 4RGUA 3BPVA 3E3VA 2DBBA 3K9TA 1OMIA 2VT2A 1HW1A 3H3UA 2PBIA 3FZVA 3CTAA 4M9ZA 5BS6A 3LQQA 2IT0A 1IUYA 1YS6A 1HQCA 1KQ0A 2XVCA 3ABTA 3QP6A 3RKWA 5D8KB 1FWZA 1SD7A 3M1EA 5J8CA 4S05A 3OOPA 5BMZA 2EV5A 1G3YA 2QBYB 1G4DA 2VBYA 4WXDA 2WV0A 3CUOA 3F22A 4A6DA 1XDUA 2UZKA 1BI1A 3E6DA 3DPTA 2O03A 2FQ3A 1KU3A 4Y15A 4LLNA 4L9VA 1YYVA 3G3ZA 4A12A 4XSZF 1FC3A 1YG2A 2MBFA 2ZKZA 1O3TA 3T8TA 2Z9OA 4L18B 2H6BA 3U1DA 1IXSB 1X3UA 2LSOA 3PFIA 1UCRA 1B9MA 1J2XA 3FX3A 5EEHA 2D2WA 3QAHA 2FA5A 1H9TA 1QNTA 5CYVA 4U0WA 2O0YA 5A2QK 4R1HA 2OQGA 5TRDA 1RI7A 1J0RA 3MAJA 1L3LA 3BJAA 4GGGA 1KQ9A 4LB5A 4HA8A 4HLXA 1OYIA 2FSWA 5ICGA 1T98A 4RB0A 1YW7A 2V1DA 3JAMK 2VC1A 1U8RA 5F64A 4WWCA 1Q1HA 1ZG1A 5FGMA 4O3MA 1TNTA 5AIQA 3BP8A 3F8NA 1XSVA 3RIRA 4RS8A 4A0XA 2XAGA 3BJOA 1XDSA 3T8RA 4CDGA 2F5EA 1HKQA 2H09A 4I01A 5HS7A 2FOKA 2G7HA 3ZP5A 1DUXC 1J59A 1ZREA 3ABUA 4Q48A 1YW9A 1FP1D 1U5TC 3FXRA 4HF0A 4IRIA 1LDDA 4HV6A 2F5CA 1PP8F 3MEXA 1W5TA 2EJRA 3ZMSA 4IHSA 3ERED 3GXOA 4WX9A 2EFNA 2HKOA 3F8BA 1BBYA 2LF7A 5F6FA 5TJJA 4RB1A 3TOBA 2HQRA 1LB2A 1CGPA 3I64A 2H94A 2Z3YA 1BI0A 3L2CA 3RI4A 2L54A 1ZYRF 3TO9A 3DP7A 4MNUA 4IF4A 2RGVA 3G73A 4UV9A 1O7LA 1B1BA 4KUMA 3BOQA 1E17A 1T38A 1IN4A 5H20A 5LGUA 3GLXA 3EDPA 1ZGAA 3DEUA 4HX7A 2V79A 3E6CC 2DO7A 3HSEA 4RGXA 5DYMA 4KFCA 3R0JA 3HIFA 1ZH5A 5HDKA 1QW1A 4DQ2A 3SZTA 4G8XA 4BH9A 2WC2A 2FEZA 2OZUA 1WQ2A 3HUGA 2MC3A 5HLGA 2LDUA 3MHXA 2YU3A 1LNWA 1Z05A 2IA2A 3TO7A 2GZWA 1P2FA 4MQVA 4LG0A 3ZMVA 3PQJA 2QUFA 3OV8A 1S6LA 1D8KA 5K5QA 4IRHA 2M30A 3EYIA 3R61A 1F9NA 2R3SA 2YX4A 1ZLKA 4ZZLA 3VEPA 5DUKA 4PCQA 2O61A 2ISYA 5ILSA 2KJCA 2L01A 2VN2A 4HYEA 4MGRA 2NYXA 3KE2A 3LAPA 3E5UA 5LRSA 5BPDA 4LJZF 5HVQC 2QLZA 2WWYA 3EETA 1HSJA 5FB2A 4KN7X 3K69A 4LLGF 3J80Z 1FBUA 4M72A 1KU2A 1EH6A 4P9FA 2QZ8A 5AIPA 3P9IA 3ZN1A 5E8IA 5D8LB 2OU2A 1KGSA 5L3GA 4LMYA 1ZN2A 3L09A 4ZYEA 2LNBA 4DNCA 1IAWA 1RZ4A 4JBAA 1IN8A 1LDKB 2E7WA 5LRRA 4GYGA 3WTVC 2BBYA 3I5UA 3KP5A 4NB5A 4O5VA 3GFJA 3VODA 4Y13A 3CJNA 1YFHA 4FHTA 2VODA 3ZPLA 4MTEA 3BJ6A 5DCMB 2Q0OA 3RKYA 4S04A 4EGZA 4QWQA 2HWVA 2JRTA 1DPUA 2XKOA 1AOYA 2MD5A 2PI0A 4M74A 3BY6A 2W24A 2ZO4A 4U0VA 2HZTA 2KJBA 2MA3A 3FM5A 2IJLA 4TV7A 3FWEA 2QQBA 1BI2A 4LB6B 2EFOA 2VOOA 2QYOA 3GO5A 5JR3A 4ENJA 2C6YA 2P5LC 3F6OA 1LEBA 2ZMEA 2STWA 5HDNA 2P4WA 1B4AA 1EH8A 4H0EA 2KIUA 3QPTA 2DLLA 2W85A 1R23A 3I0TA 1IN6A 5AONA 2E1NA 4LFUA 3BDDA 1ZLJA 1ON2A 3HRUA 3E5XA 3GFIA 2QQAA 4MEYF 2ZJ2A 3QU6A 3ZN0A 5JI6A 5ILVA 3U9GA 3IRQA 3DF8A 4L9NA 2R7DA 1JE8A 4HOBA 4BXUA 1CF7B 5K5OA 3F72A 3CUQB 2PLYA 3HTUA 4KT5C 1ZRFA 2XGXA 1H9GA 4IRGA 1SD5A 3I59A 2D1VA 2XAFA 4LG0B 4ZYHA 2PG4A 1XGNA 2VOPA 3B02A 3M8EA 4U0YA 1IW7F 4MHGA 2O8XA 3KLNA 2ESNA 1SD6A 4NHJA 1QGPA 2VE9A 5H6QA 2PFBA 4ESFA 5L3DA 4KYWA 4UVAA 2HOEA 2M1BA 5LEJA 2B0LA 1PP7U 1JXSA 4AIKA 2O3FA 5L3BA 4Q5SF 2A6EF 2CYYA 2JT1A 3DKWA 4FX0A 3GW2A 4B09A 3IRRA 1BOAA 3I59B 4L9JA 1ODDA 5HLHA 4BNCA 2Q8KA 3COAC 2XRNA 4B8XA 2CSOA 4A5MA 5JVTA 1FPQA 1P4WA 1W4MA 2LF8A 2W57A 3FMSA 2YX7A 3ECHA 2VBZA 5LEKA 3ULQB 3IC7A 2VT3A 3V8LA 5F1RA 4M6YA 3J81Z 1YTYA 2P7VB 4RAZA 2MH9A 3CUQA 4GXOA 3DXJF 5CLSA 2QWWA 1IRFA 1MKMA 4YFXF 2A69F 2K5LA 2JSCA 2Y0MA 5FD6A 1V3FA 2BYVE 5DUIA 1U78A 2Z99A 1J9IA 1R00A 1HW2A 4M73A 3TOAA 5E8GA 4HQMA 1SFXA 4BQAA 3P7NA 5E1ZB 5FFXA 3MFKA 3GFLA 2HR3A 3I53A 1QVPA 4M6XA 4WK8F 4OIRF 2GAUA 2V1UA 3V8KA 1AWCA 2FRHA 3WE2A 3GX4X 2EA2A 4FT8A 1OR7A 3FXQA 4G9YA 3WTSC 5E18F 2YR2A 1QPMA 4G94A 4BHPA 4AIHA 4XSXF 1UB9A 5HDGA 1O3RA 2W25A 2UXXA 3O3KA 1ZAOA 4CICA 2BE5F 2P5VA 4KMFA 1KYZA 3T0YA 5DCMA 3F3XA 2F2EA 1S7OA 2ELHA 4N9HA 1Z9CA 2A3SA 1GHCA 2AXLA 3HHHA 3SHFA 4UV8A 3NQOA 2EFPA 2BEOA 3MCZA 4QLCU 1Y0UA 2A07F 2DK5A 2ESHA 1RUOA 2H3JA 3N97A 1U5TB 1XB4A 2VXZA 4AD9A 4FX4A 1ZARA 2A6HF 2NAZA 3JTHA 3NEUA 3W6KB 5CVUA 3IKTA 2LKPA 3J7AO 2FNAA 5ICEA 2HKXA 3WGHA 3MZHA 1BC7C 2DK8A 3TDUC 1YO5C 4N0BA 1VTNC 1KYWA 3ELKA 3JTGA 1I27A 3M9AA 1PUEE 1XGSA 3VB2A 3W6JB 4CXFA 1R36A 2ZNZA 3GFMA 1R7JA 3GUDA 4I09A 2PJPA 3L00A 1QZZA 2K86A 1ZRDA 3HHGA 3K1NA 5CJ9A 2GXGA 2HGCA 1BI3A 1G6NA 2L4MA 5DD4A 1JHFA 2E7XA 4LK1F 4WXHA 4G7HF 4HBLA 4G6DA 1W5SA 3SXYA 4Y17A 4ETSA 4AIJA 1MDMA 4HF2A 3WTYC 3FM3A 4LGWA 2XASA 4IJAA 4EJTA 2YSRA 4NQWA 2GCXA 2K5IA 1MJBA 2XAHA 1HW5A 3JSPA 3Q9VA 1HBXG 1K78A 3I71A 3HYIA 5KVRA 1IN5A 4MQ9F 1S8NA 1XMKA 4IHTA 4OIQF 2K5FA 3NRVA 3TGNA 4HV5A 3QU3A 1FYMA 1K78B 2MH2A 4K2EA 1XN7A 2BV6A 3VOEA 1DP7P 5DDGA 4EM1A 1BN5A 1FYKA 3KCCA 3GYHX 3E97A 1F1ZA 2EV0A 5HOOA 2DU9A 3C1DA 1LQ1A 3TKYA 5BQTA 2V6CA 3WODF 2CW0F 4EM0B 4UXNA 4KN4X 4WCGA 3K2ZA 2DTRA 5DV5A 2K4JA 3B73A 2H6CA 1E2XA 1FX7A 4PZJA 1ONVA 3P9CA 1FLIA 3IKVA 2ZNYA 4ZYGA 6PAXA 3ZMUA 2K7LA 3VFZA 3L7WA 1XGMA 4YIIA 3EUHA 1ZHFA 5LHIA 5CVIA 5H6RA 1STZA 4EJUA 3ECOA 2HFHA 1T0FA 3EYYA 1R1TA 3QOPA 4EVIA 4AVPA 3BZ6A 1W7PA 5FO5A 1DDNA 1GXPA 3LA3A 4E70A 4HX8A 2IPQX 5JHUA 4I0AA 1O57A 1S7AA 5L3CA 2GWRA 5HS9A 3GZ6A 1SMYF 2OBPA 1BIBA 2F5FA 3ZMZA 3RPUA 4A5NA 4GO1A 4I7HA 1IZ1A 2XHKA 3HSRA 4I2OA 2PQ8A 3KZYA 1P4XA 2PN6A 5IT9K 4N9IA 2VE8A 4GYIA 4IXAA 2HTSA 2FU4A 2XAJA 1MJ9A 3WU0A 3E19A 3ZMTA 3LSTA 4YIFA 1FZPB 2XROA 1EV7A 2DQLA 1YW8A 1TBXA 4KNYA 1I6XA 2DT5A 2D1HA 3JAMZ 2QENA 1U2WA 4RB3C 2KKOA 2ZBKA 4M9XA 1FT9A 3TDZC 4EV0A 2DPDA 2RN7A 4U88A 2J5OA 5D5UB 3DQVC 2GQQA 3KETA 1BM9A 5JFRA 1ZGJA 1R5HA 2GXBA 1TQIA 1HXDA 3P9KA 5ICCA 2FBIA 1FOKA 2MLGA 1BIAA 1WWXA 3BPXA 2FBKA 1O7FA 5LLQA 1IF1A 3AAFA 1SFUA 2TDXA 3KLOA 4CHUA 4WF2A 1LDJA 5D5WB 3BWGA 2EFWA 5IT9Z 1J7KA 1ZG3A 3V7SA 2VBXA 2OAZA 2NNYA 4U7DA 4A0ZA 4XRFA 4UNOA 4PGHA 1XCVA 5ED4A 2M87A 1DPRA 4EQQA 3JSOA 4KIBA 1ZG5A 1HKTA 4P9UA 1B59A 5K1YA 4M9SA 2M8EA 1MZBA 4UHTA 2QBYA 1TLHB 1GXQA 4G7OF 3C3WA 3SQNA 2CWEA 4R79A 2XUBA 4HX4A 4L5JA 4ESBA 2HYFA 3WU1B 2FBHA 4RGRA 1MGTA 2PMHA 2FF4A 3QRFF 4ESJA 2KRFA 3ZMDA 1K6OA 2OQRA 2R7FA 4UVCA 1K7AA 1ULYA 2M5WA 2P6TA 2V9VA 3SZPA 1TW2A 4CYDA 1XSDA 2ZCWA 1L0OC 3KEQA 3CLOA 3QP5A 4ZZDA 2HDCA 4ON0A 3GF2A 2DAOA 1B9NA 2EA4A 1EH7A 5HS8A 1XD7A 3LA7A 3R60A 2NRAC 3T1BA 2G9WA 1LVAA 2FMYA 2EB7A 1TTYA 5L3FA 2STTA 1XCBA 2L02A 3I58A 3RKXA 4UVBA 2DI3A 5LGNA 4XBFA 3HTSB 4EGYA 5A2QZ 4BYYA 5E17F 1R1UA 3V4GA 1YS7A 3ISPA 2K4BA 5BOXA 3L9FA 3RDIA 1U6GA 2ZFWA 3I4PA 4EJOA 1G3WA 4KICA 4KA4A 2KIFA 4L9TA 4HW0A 1WRJA 4UUVA 2H27A 5KK1A 3RTRA 1USSA 4XLPF 1UHWA 2Q2EA 4OINF 5D6EA 1A04A 1C0WA 2UWMA 2X0LA 1IXRC 1W7PB 3MZYA 4MEXF 4G6QA 4MTDA 3S2WA 2A68F 1F4KA 1USTA 2HTJA 1LEAA 3T5XA 4EJVA 2RNJA 4HAMA 1KU7A 2K27A 2L3DA 3WGGA 1CF7A 2IA0A 4P96A 1BJAA 2OD5A 3F8CA 5ICFA 3RYRA 5DEQA 2XIGA 1D8JA 4JK1X 4O6JA 3Q9SA 4L0YB 2XKPA 2P7CB 4ZYDA 3FXUA 4EMSA 1W7PD 5D4SA 4U7BA 2DFIA 2KIMA 2K4YA 3IHUA 1OKRA 4OIPF 3FMQA 3EQLF 1RIOH 1HKSA 5LGTA 1MJAA 3D5LA 2BGCA 5D5VB 3E6MA 2YPRA 4IVNA 4KDPA 2IP2A 2F5DA 1D3YA 3FMRA 3K1PA 5LHHA 2A5YB 1QBJA 3IL2A 3O2PE 4HDUA 2LX9A 4F7ZA 2P6SA 3D0SA 1LJ9A 2HS5A 1F5TA 2CGPA 1TNSA 3H3ZA 3IWFA 3KP6A 4P5OA 3Q5FA 2JPCA 2OA4A 3SFZA 3HRTA 2DQRA 3WTXC 5FLXZ 3M7GA 1FNNA 1JHHA 3DFGA 4YG2F 3RYPA 1I1GA 1YLFA 4JQFA 3N4MA 1TW3A 2NS0A 3F6VA 3KP2A 4R8HA 3LQRA 3WTZA 1GVJA 4ENMA 4M71A 2IVMA 4HLYA 1H0MA 3MWMA 3R4KA 2PEXA 1G3TA 2PMUA 3CO7C 4PDKA 2RDPA 4CGZA 2Z33A 3K0LA 1S29A 2RV8A 3RPQA 2IRFG 1T6SA 3FF5A 1QQIA 5EEGA 2K02A 1BC8C 5D4RA 3C18A 1ZRCA 1P6RA 1Z91A 1FYLA 3WTWC 1KQ8A 2GA1A 1R5GA 1I5ZA 3V8JA 2ACJA 1FBSA 3KP4A 4OMYA 4HZFA 2ETHA 3GZ5A 2QVOA 2EK5A 3GWZA 2FMLA 2XAQA 3HSFA 1B6AA 3HOTA 3F21A 1Z1DA 1REPC 1TQPA 2CO5A 2E1CA 2G7UA 3KP7A 1WKMA 4EM2A 1SFEA 2Y75A 1S3JA 1U5TA 3ZQ7A 2NNNA 3M8FA 2MLKA 2M45A 1TQMA 1R1VA 4I02A 2ADUA 3E5QA 1O3SA 1JGSA 2VBWA 3LA2A 4CO8A 1FP2A 3WE3A 3IWZA 3H92A 2P8TA 1P4AA 3QPHA 3JW4A 4ENNA 5D6FA 3CDHA 2WTEA 3C7JA 4PGGA 5E1WA 3FHZA 1UHMA 3MQ0A 1XSXA 2COMA 3HRSA
chains in the Genus database with same CATH superfamily
2EQIA 1C1AA 5CVRA 4J19A 3O8VA 4D7NA 2I10A 1OYWA 2XGDA 2Y48A 3E6BA 5FD5A 3WG9A 3F0CA 3HOWJ 3G4ST 2W82A 2OJ2A 2JVHA 2D9TA 5GAN5 1IN7A 1T39A 1M2VB 4OB0B 3CCYA 1WPKA 1QO0D 2YLCA 1R58A 3HOYJ 1Y57A 1A5JA 2HEOA 2QAZA 1OPCA 3N5BB 5KYWB 5GAN8 3H3VK 2KFDA 2OZ6A 2BUDA 3S93A 2GF7A 4IHYA 2YRDA 3X24B 1YX3A 2K9SA 2XPUA 2Y9YA 3MZ8A 4M7AD 2NUZA 4KGZB 2PQWA 3A0HC 3ZR8X 5L3EA 3A0BC 4XR6A 3PNVA 1GCPA 1ZUKA 2EFQA 4OMQA 4G7ZF 5GAN6 3META 3HPHA 3JAME 2BVMA 4QIWN 3H8ZA 2R7QA 5IY5H 3V7RA 3I56I 2GNCA 3REOA 2EKOA 3C0CA 3IH3A 1Z7UA 3C2GA 3LWFA 4DZJA 2JN0A 3GEZA 4EEFG 2AS5F 1TS9A 1WXBA 3VYGA 4BY7J 1R9TJ 4A3LJ 3LFKA 3S1RJ 5LJ5h 2J5PA 3RDVA 1YJWT 2ZXJA 4YFKF 2GA2A 2Q2EB 2X4HA 5GAMe 2V1QA 4J9DA 5IT3A 4XLAA 2ICWG 3K4BA 2ZXHA 1YCSB 2KHMA 5GAOp 1KA8A 2FEIA 2RF0A 2CFOA 1I3AA 1IDZA 4P5NA 3U2RA 2Y90A 4PSXA 1R4MB 5E1XA 2XHCA 4EDUA 3TP0A 3DPLC 2ZCFB 4EMHA 1ZR2A 3CBPA 4I0BA 2KSSA 1NJIC 3CMMA 4KIFA 5J8FA 1PVEA 2XIDA 1MMDA 5CVVA 2R5ZB 1YJNT 1NE8A 4CCLA 1V4RA 1J5YA 4XU2A 2IGNA 4OOIA 5ERIA 4RGSA 3MKZA 2QM3A 2HQXA 2RI5A 3HKSA 2BHZA 2HYGD 3WTTC 3HRMA 3OW2P 4EMGA 3VSLA 1YITI 3DTEA 2RKHA 5GANe 4H4KC 1HSTA 3FB9A 1WI9A 1PDNC 3FHNA 2UXNA 2E1MB 2A61A 3E7LA 2HXOA 3DWLE 4LIUA 4HQEA 3EGXB 1XGOA 2V9KA 2XV4S 4FYXB 3FK6A 2DA2A 1SD4A 3LSRA 4GCVA 3CMEI 1TSFA 2C0TA 3WVDB 1HOMA 3R6SA 1XQHA 4CZZA 5HY6A 5B66C 2DEQA 2YDLA 3BR6A 4HF1A 2ZJPF 2COZA 3I55I 4BHCA 4ZGEB 4HKEA 3DEEA 2JA6J 1RUNA 1KU9A 4N4NB 3ZQQA 1GXIE 4OU0A 1WJSA 3UKGA 2CMPA 1JRIA 1O3QA 4NL3A 3QSUA 3W3CA 2BKDN 2RQPA 2BOLA 2A7YA 1ZKGA 3CESA 2X6OA 4Z6YA 2FXAA 2CG4A 1UGQB 4M78A 5K5RA 4YELA 2PMZA 5DM6F 3HBLA 4D6WA 1ZBXA 5F0FA 4Q47A 4L59A 1M90U 4KUDK 1X3WB 2VC8A 4C92D 5BPIA 2HKQB 1WLPB 2KI7A 2CQQA 2Q1ZB 2KT0A 3BROA 4F91B 1EIFA 1SMTA 4WXCA 4BL0B 2RN8A 4QQ6A 2JTVA 5D5XB 4C8QE 1OCPA 2QQ9A 1VNDA 4JJCA 3ROUA 1A35A 4B4CA 1KC8C 1QZYA 4A2UA 5FU6B 2KRMA 1W1WE 4IHVA 1D5VA 3R0AA 2DW4A 2GBYA 4HDVA 1VQOI 5FU7C 2DPUA 4KMUX 4ANJA 2CS3A 3LAJA 4CC4B 2IW5A 2WB1A 4HVUA 3F8FA 3K70D 2VONA 3TQNA 2H3EB 3KZZA 5F27A 4ENKA 2W84A 2F2WA 5CVJA 2R7WA 1APLC 2NVXJ 4ASNA 4A0YA 4P1WA 4DYCA 1VQ9I 2DL3A 3MKLA 4LOCA 1K79A 1P92A 4LD5A 1WDXA 3RZOJ 2CT4A 1B72B 1R22A 1H3ZA 3TO6A 2E1OA 1YI2T 1VQPI 1SAXA 2G6FX 1IO2A 2VC0A 1A0NB 1NG7A 1VQ4I 4LLLA 4Y52J 1JUPA 2VQHA 2F5TX 2FRWA 1UG2A 2D45A 5J6XA 2F4IA 3BZCA 3K4JA 3KFWX 4A3CJ 4YFNF 1OOTA 4M77C 3CO6C 3C95A 4HT9A 3CCJQ 2JRMA 2OI3A 1ON1A 3JCMW 1UFFA 2CUEA 2MG4A 2V1XA 4CH7A 4RB2C 2M02A 4XTXA 1VQPT 3CP8A 3GMEA 2ISZA 4OIOF 3CCMQ 2EV6A 2L4AA 1YIOA 5F1JA 2RVCA 3O6BB 1XMAA 2AQFA 2CQKA 5DCFA 2VGNA 3KYCB 1VQ9T 3I54A 1U3EM 2HOSA 4A6EA 2R58A 2LYCA 2M7BA 4L5IA 5LHGA 3PQKA 4LK0F 2PZ1A 1S7EA 2MFZA 5GTIC 4ZH4F 2E36A 2ED0A 5CKDA 1LOJA 4RTWA 3ML6A 3WGIA 3LX7A 2CFXA 2JPBA 4OB3B 2YUQA 1BYMA 1Z6RA 1MD0A 3LFUA 1Y56A 2Y4XA 2QKMB 4C0DB 4IPAA 2XDDA 1SHGA 5F0HA 2GIVA 5J1UA 1X2NA 2P0WA 1TUGB 3CCLA 2WAQA 3OYKA 4XLNF 5B1AH 2O6GE 4XU0A 3HZJA 5DD8A 2QEXA 1KQ2A 1I1SA 3FDRA 4D0PA 2RC4A 5CQEA 4BE0A 5FWBA 3F23A 5E3OA 1Y96B 2P5KA 1IXCA 1VQKT 1RAAB 1QCFA 4M77B 3K1MA 3KP3A 1FSEA 3DV8A 3M07A 4R55A 2FE3A 2FNPA 4Q4ZF 2ELJA 1OYYA 3RPUD 3CPFA 3FRNA 3ZQCA 1YE9A 4EJWA 2EWNA 5FFZA 1G3SA 3G4SQ 1UHCA 1RAFB 1VQNT 3SZGA 4Y7NJ 2V26A 3ABLH 5LBQA 3V7CA 4OMZA 4BAYA 2QSGX 1AHJB 1NYGA 3QKJA 5CK9A 2ZPHB 5IP6A 2DTOA 3JB9H 2Z5UA 4RG8A 3RSNA 2LRDA 2KDZA 2Y69H 1R4NB 1Z6TA 1WIEA 5IH2A 3SWNA 2R57A 4LDWA 5ILUA 1VQ4T 2ATCB 2OV7A 4NNJA 3VRYA 4HSTA 1IUFA 4E4HA 3RQ4A 4ZDPA 1T2KA 1MHNA 4KIGA 1YQAA 2HQHA 2XU8A 3OMCA 3D1NI 1IRGA 1TWFJ 3ZQFA 3KEOA 1UFMA 4XOTA 2DYRH 2JZYA 5C3EJ 2NUTA 1NHAA 4QSHA 3QZ9B 3EG3A 4KISA 4W1UA 3SFMA 3OMGA 1FBQA 1VZ0A 3A01B 3L1AA 3MPUB 4OF1A 4LUEA 3UR3C 3J81K 1M8VA 4IUUA 1TUDA 4L0ZB 1TWGJ 3KYDB 2X6XA 4P55A 3DB4A 1QVUA 4BY1J 1FSHA 4DOZA 3AG2H 3CDLA 1G8XA 1QLYA 3OBWA 5C6SA 2LY9A 5CKHA 3CUQC 5EYRA 3I56Q 1K0XA 2PJRB 1J3TA 2L7KA 4ZC3A 4I98B 2KMTA 3LYIA 1RNLA 1E6HA 3HOSA 3SEQA 1J75A 2V1RA 2ZMEB 2R93J 3WTUC 3JCMX 1UUEA 5FLXK 2MWOA 1QPIA 2HQNA 3SEMA 1FY7A 3G7ZA 1YIJA 2EIJH 4IUVA 4F52A 1YRNA 1AVZC 2Z16A 1FTTA 4Z2YA 1WSUA 4A53A 1ZTRA 4N0AC 3FXOA 3K10A 3J80K 1YHQI 3FK7A 5FU7B 1LUJB 1OQYA 2XF5A 1XOVA 2IA1A 3GVAA 4RAYA 4BHBA 2VPRA 4MZTA 4HVVA 4MZMA 1ZSZB 2W4SA 4UC4A 5E20A 5HLIA 2DXBA 3F8MA 2ZFUA 4A3KJ 1MDMB 1V29B 1M1KU 5M3MJ 4JX6A 3RJPA 1MUZA 4OGCA 4J9EA 1JJ2P 2O01E 4AWXB 4RGUA 2VASA 3BPVA 3PNTA 3TL4X 1RABB 1VUBA 3E3VA 2BVLA 2DBBA 5FKMA 1ETXA 3K9TA 2LZ6B 4OGEA 5DLOA 5CR2A 1YITT 1OMIA 1TT5B 1WH7A 2VT2A 1HW1A 3H3UA 4CA0A 2PBIA 3GTLJ 1MGQA 2DK3A 2LJ3A 4J9IA 3S2HJ 3QG1A 3VS6A 4A63B 3NHNA 4C8QF 3RCOA 5CKTA 2QI2A 2BIVA 2DRKA 3FZVA 3CTAA 4M9ZA 2V8IA 5BS6A 3LQQA 2IT0A 3CMEQ 4M7AF 3M4OJ 1IUYA 4L6V5 4XQ3A 3E9FA 2L9VA 2ZZDA 4J6YA 1YS6A 2H1KA 1HQCA 1KQ0A 2M4KA 2XVCA 3ABTA 3U21A 4DGWB 1WA7A 3EGDB 1TC3C 3QP6A 4RLFA 3OYFA 2IS6A 3DTIA 3RKWA 5D8KB 1X6BA 4ZN1A 1YHQA 4V2SA 5BNGA 1FWZA 1SD7A 3M1EA 4M3BA 2KPMA 5J8CA 2A3LA 4XU1A 4S05A 5EG0B 3PFSA 1VIEA 1X69A 1VQ8Q 3QDRB 3OOPA 4MFEA 5BMZA 1T95A 2K3BA 3RUXA 2EV5A 3QOEA 1G3YA 1YNZA 2OAUA 3E2UA 1WGSA 3FJPA 1HK9A 3H6ZA 2QBYB 1D1BA 1G4DA 2DMNA 2QEXI 3PO3J 1WXTA 2OTJT 2VBYA 3BR3A 4WXDA 4M78F 4OWRB 2WV0A 4B47A 3CUOA 4HXJA 3F22A 2OCCH 4A6DA 5DM7R 2JTMA 1WCMJ 4KT0E 1XDUA 2UZKA 1BI1A 3TP3A 3GPLA 1ZX6A 5GJWB 3MKYB 1KD1R 3Q0VA 3E6DA 3DPTA 1K8AU 4C5EA 2O03A 2KISA 1YHQQ 4PJOC 2X51A 1Y1VJ 4ITVA 4JJBA 2FQ3A 2I8DA 4BE2A 1KU3A 5M5YJ 2EFIA 3QPLA 4FU6A 2Y9ZA 4C2MJ 2COWA 4Y15A 1U9OA 4AFUC 4JP0A 2WB1N 3H5NA 3MN2A 3CCQI 4L9VA 4NC6A 1YYVA 3AG3H 4LLNA 1QU3A 2FZCB 3VS2A 9ATCB 4M7DE 4M7DA 3CCVI 4I99C 3G3ZA 2VL8A 4A12A 4XSZF 1VQOQ 4S0HB 4XKBA 3DU6A 3H9QA 1FC3A 1YG2A 2DVEA 2KL4A 3BFMA 2ELKA 2BY3A 2Y0SN 3DB3A 3CCVT 3REBB 2MBFA 2ZKZA 2FB7A 3PNWC 5KNLA 1O3TA 4RG2A 1M9SA 1RAGB 2M0OA 3T8TA 2Z9OA 4L18B 2H6BA 3U1DA 1IZ6A 1YWPA 1IXSB 1X3UA 1VF9A 2FQ4A 2LSOA 2O7OA 3E1SA 3PFIA 2E2IJ 1EZZB 2I0NA 3J80E 1W2BP 1Q7YU 1SRLA 3FXLA 5I21A 3DLMA 1UCRA 1B9MA 1J2XA 3GTGJ 4JX4A 5LJ3e 3FX3A 2EINH 4M7DB 1BJZA 5GANg 2ED1A 2B9SA 5GAOn 5M9OA 2AXTC 5EEHA 3LH0A 4D5CA 1ZUYA 3JB9D 5EF6A 2O4XB 2D2WA 3QAHA 4AVZA 1Q81R 2F2VA 3BG3A 4XK8E 3A8LB 2FA5A 3MKWB 5GAEJ 3OBYA 1H9TA 1QNTA 3MMYB 5CYVA 4U0WA 3S32A 1K73R 2O0YA 3TVTA 5A2QK 1W2BS 1H92A 4R1HA 4BU2A 2CZ7B 3M56A 2OQGA 5TRDA 1ZGWA 1RI7A 2O4XA 2FUG2 1J0RA 5EEAA 1TL8A 3FC3A 2JS2A 2YUPA 1LVKA 2VI6A 3MAJA 1EX4A 2JUFA 3NWTA 2DRMA 4CI0C 2W7NA 5GANh 4ESRA 3LWIA 2K5CA 3PO2J 1L3LA 2DVJA 3CBOA 3QO3A 5F0CA 1BW6A 3BJAA 2DMOA 1BA5A 4GGGA 1VQ4Q 1KQ9A 2I5UA 4LB5A 2CGHA 4QQGA 4HA8A 4B3XA 5GAMd 3CF2A 4KUIA 3J7ZI 3EFRA 4HLXA 2XD0A 3ASKA 3JRDA 5E3LA 4E7ZA 1OYIA 2FSWA 4ZDOA 8ATCB 1I81A 2JWTA 4I6ZA 2E3HA 2PTKA 2DDAA 5ICGA 3CD6T 4JRQA 1T98A 4RB0A 3IH4A 4M75C 1YW7A 2V1DA 3JAMK 5GAMf 3L2VA 2E5QA 3MP1A 1OCZH 2VC1A 1ZQ1A 5KYYA 2F2XA 4HCBA 2EJGA 4PFOA 3CCSQ 1U8RA 2CS7A 5F64A 1XTDA 4BB7A 3OYIA 2IG0A 2ID6A 4WWCA 1Q1HA 3O8HA 2V1NA 4XLEA 2LG4A 5C4JJ 2OCEA 1ZG1A 2M9HA 1RKWA 2VQGA 1HD3A 3HUGB 2HKNA 1UB4A 5CQYA 5FGMA 4XM3A 1TNTA 3G1MA 4O3MA 5AIQA 3U23A 3BP8A 3F8NA 1XTAA 4C8QC 3E9GA 1EF4A 1XSVA 3DPUA 3RIRA 4CCKA 2DA1A 4RS8A 4A0XA 2KYMA 3KX2A 2R7OA 2XAGA 3BJOA 2QYZA 2CSIA 3A03A 2DLPA 5F08A 3ZCOA 3CCJI 1XDSA 3T8RA 4QW2A 4A4GA 4ELZC 4XONA 4CDGA 2F5EA 1BCMA 1HKQA 3JRIA 3VU3C 4B1RA 1JT0A 2YU9J 5IOYA 2H09A 1VFCA 2MF2A 1BBZA 4I01A 5HS7A 1LFBA 2FOKA 2G7HA 2KR3A 1W36D 3MJXA 1OV3A 2D6FA 2RAEA 2W1OA 2Z2SB 2HDWA 3ZP5A 1J59A 2F4MB 2MGQA 3FISA 1DUXC 3ABUA 1ZREA 1YI2Q 3EFOA 3CC4Q 4Q48A 1Z7LA 3JB9G 1YW9A 1FP1D 1U5TC 3GTOJ 1PYVA 3FXRA 3CCSI 4HF0A 2EYQA 4PL6A 1N8RU 2CREA 4PJOB 4C5IA 1OZ3A 2G3RA 2DE0X 4IRIA 1U8BA 1SVOA 1X2KA 1LDDA 4HV6A 1KQSP 2O2OA 2F5CA 3JRZA 1PP8F 3JCMh 4E6RA 3JCMe 1UELB 1W5TA 3MEXA 5K7ZA 5HK0A 2EJRA 3ZMSA 3GF5A 1C0MA 2M9UA 5IHKA 1FMVA 2XGCA 4IHSA 1DP3A 3ERED 1AOJA 3T9NA 1NJIU 2LY1A 2JTEA 3GXOA 1Z9ZA 4WX9A 2EFNA 1UGSB 1B7TA 2HKOA 3F8BA 3TSWA 3ZEHA 4BEHB 2KAFA 3HHTB 1VQLT 3OL3A 2DJNA 4NS5A 1BBYA 2XF7A 2M7AA 3S3OA 3CC2Q 4C30A 2LF7A 1W2BA 5F6FA 2CV1A 5TJJA 4RB1A 3TOBA 4BGDA 4QVDA 4M78E 3JCMd 2LCCA 2HQRA 3VJPA 1GL5A 1U1SA 1K9MC 3OWTA 3CCUT 1LB2A 1CGPA 3I64A 2MYSA 1Y7XA 3EUHC 5FROA 3BTJA 2D5VA 2K9QA 4BUPA 1MBEA 1X6GA 3UNGC 1GBQA 2H94A 3EGUA 2Z3YA 2FHDA 3M3YJ 1BI0A 4DIQA 3L2CA 3RI4A 2L54A 1ZYRF 5LJ3g 3TO9A 4B44A 3DP7A 2ABLA 4R0KA 4MNUA 2DXUA 3NFCA 4IF4A 1Q86R 2RGVA 1MSFC 3G73A 2BY2A 1O7LA 4UV9A 1BKBA 1B1BA 4KUMA 3BOQA 1E17A 3HFNA 4A93J 1T38A 1IN4A 1N75A 2DPPB 3P8DA 5FU6C 3BZKA 2K3YA 3VS7A 5A0GA 3CC7Q 4CYCB 5H20A 2WSFE 1YIJI 3ASNH 3QYBA 3S3NA 2W48A 5LGUA 2GBQA 3LGLA 3CJRB 3ERMA 2KDOA 3GLXA 2OX7A 2V8KA 2DO3A 2ZB9A 1OZ2A 1Y96A 3EDPA 2E70A 2HXIA 3VS3A 1VI0A 2VIXA 1G59A 1U1TA 2XKOC 1ZGAA 2MCNA 2COYA 2M4GA 3DEUA 1WVRA 1ZELA 3A02A 3HGYA 3SDZA 1UJYA 1YJWA 1GCQC 4HX7A 2V79A 2PMZN 4X1EA 2HBWA 3E6CC 4J7IA 3TEDA 3GBGA 2DO7A 3HSEA 1VYVA 3EG9B 3Q1JA 4RGXA 5DYMA 4KFCA 2CP0A 3VYUB 4BDYA 1BU1A 3R0JA 3HIFA 1H8KA 1LNXA 2CUDA 1RL2A 1ZH5A 3ZBDA 3PSFA 5HDKA 3M0RA 1M3CA 5GAMj 5D6XA 2EZIA 2E12A 1V5FA 1IJWC 4M77E 1RKTA 1QW1A 3HB9A 4L5GA 2E2JJ 2WA0A 5FKOA 2XB0X 4DQ2A 3JCUC 3DLLF 3BCAA 3SZTA 3HL2A 4G8XA 4BH9A 1TOVA 1W70A 4LD9K 3RERA 3BR2A 2CU7A 2WC2A 3QQAA 1BL0A 2OTLA 5K7HA 2J6FA 2FEZA 2OZUA 2O31A 3ULRB 1WQ2A 3HUGA 2MC3A 2JA5J 2M0MA 5HLGA 2LDUA 4AC0A 2KVQG 2ZAEA 1VQ7T 3BG5A 4JZ3A 1OCRH 3HDDA 3MHXA 2YU3A 1R71A 2RJEA 3FEOA 4GLKA 1LNWA 2JSPA 4ZNXA 3PVLA 1Z05A 2IA2A 4NC7A 1B07A 1I5OB 1RAHB 2DILA 2HEQA 2HL3A 5IHNA 3TO7A 1B72A 1GV5A 2XG8D 2GZWA 2X4WA 1P2FA 4MQVA 2EQMA 4X9DA 4M78C 1WZOA 4LG0A 4GBQA 1WHUA 5IAYA 1KC8R 2X1CA 3ZMVA 3VWBA 4E7KA 2JA7J 1NLPC 2E5KA 2RMOA 3C4SA 1CKBA 3CCEQ 4FCYA 4F14A 1K73C 1IO6A 2RA2A 4PKCC 3PQJA 1WJQA 2QUFA 1V55H 3OV8A 1JKQC 1S6LA 2CV0A 5B1BH 4RMOA 1D8KA 1SAUA 2YRCA 2L3PA 2JN6A 5IP9J 4IRHA 5K5QA 1BCOA 2K7AA 3QPSA 2HVSA 1T08B 2W10A 4PJOF 5LJ5g 5EG2A 2NVQJ 2ZPIB 1Y8RB 2M30A 5CAIA 3EYIA 3R61A 1F9NA 5AYFA 2R3SA 4EIKA 2ZSHB 2YX4A 4AG1C 3SYTA 1H8AC 2X4XA 3VYHB 2Y2ZA 2O88A 2VLAA 3M0QA 1ZLKA 4ZZLA 2XK0A 1GUUA 1DQUA 4FYYB 5EZGA 2JJ9A 3VEPA 2E64A 5CIUA 5DUKA 4PCQA 4IQJA 3FIFA 4LXCA 3BDUA 1I0CA 2O61A 2R5YA 3QUIA 4F93B 2EZLA 4C8QA 5LJ5f 2WSEE 3K4KA 2ISYA 3BY7A 3B6CA 5ILSA 1JGGA 2KJCA 1PWTA 2DT7B 3SDBA 3GTKJ 3DLLA 2L01A 4OMLA 1KZHA 3HKZA 4PNOA 2VN2A 4HYEA 4MGRA 1A36A 1NEGA 2RHXA 2DMTA 3M8JA 3FBNB 2NYXA 2CP2A 3KE2A 5AT1B 4C8QG 2DERA 3LAPA 1F1BB 4DBHA 3E5UA 2NWMA 2FD5A 5LRSA 1MMGA 2E60A 2ZGWA 2K57A 4C92B 1KQ1A 3CCUQ 5BPDA 4LJZF 5HVQC 1K0SA 5ECAA 1T0FC 4OVAA 2DYBA 3UDCA 1VQ6T 2QLZA 3CMAQ 2V7FA 3CCQT 2WWYA 1U0JA 3EETA 3VYSB 1HSJA 5FB2A 3CBMA 4A3FJ 4KN7X 3OYCA 1OJLA 2HPIA 3K69A 4IQ4A 4LLGF 3LNQA 2E2HJ 1ZSGA 1KK7A 3EHRA 1QVGA 2IAIA 3J80Z 3CC2A 2GOMA 2LBFA 2XC7A 3DTKA 1FBUA 2BE9B 2DBMA 2P4RA 4M78G 3G71T 3CCMA 4M72A 4LDVA 1UGRB 3S1NJ 2M51A 5L8RE 1AT1B 2DJIA 3M5AA 1KU2A 3TW6A 5J3LA 1EH6A 2QTVA 1VQPQ 1T56A 4P9FA 4CUGA 2QZ8A 4GLMA 1IDYA 5AIPA 1ZR4A 2SEMA 3QBYA 1QRYA 3P9IA 4LUDA 3TCJA 4II2A 3ZN1A 1F43A 5E8IA 5IYBJ 2KEAA 1M1KR 5D8LB 3QWYA 4X34A 2OU2A 5GPAA 1KGSA 5L3GA 3F70A 7AT1B 3ZFJA 4Q5WA 2E3IA 4LMYA 4M77A 1ZN2A 4NBQA 1QVTA 3G71I 1OX9A 1QP2A 3L09A 2M34A 2ZXIA 1FYNA 3JCMP 1KIKA 2QDYB 3L2RA 2ZJRF 1TWHJ 1Z3YA 4ZYEA 3ZL7C 3JB9J 2LNBA 2LTPA 5KAIC 4DNCA 1IAWA 1RZ4A 2NS8A 5EJCA 1W1FA 2DOFA 3BG7A 2ZJQF 4Z88A 3HOUJ 4JBAA 1IN8A 1LDKB 1WX6A 2NVTJ 2E7WA 5LRRA 4GYGA 1I39A 4IIMA 2OTLI 2EIFA 3VDXA 4FSXA 3WTVC 2BBYA 3I5UA 4M7DF 2DD4A 4QQDA 2ZPBB 3KP5A 5HNHA 4KGVB 4NB5A 2V8JA 4XTYA 1AZGB 2R5ZA 2IEKA 5CQGA 4O5VA 2D0QB 3GFJA 3VODA 1T8IA 1UHFA 5FLXE 1QHHD 2LH9A 2R92J 4DA4A 1X4PA 1KFZA 2EGCA 2O5RA 1MV3A 4Y13A 1NPRA 1W5CC 2EH3A 4RTZA 1JTXA 2E1HA 3CJNA 1YFHA 4FHTA 2Y30A 2VODA 3K2AA 3ZPLA 4MTEA 4J9FA 5CPRB 4C5HA 1JB0E 3BJ6A 5DCMB 2Q0OA 4ZTFA 1D3BA 4FW2A 4QKUA 3RKYA 4S04A 4EGZA 4QWQA 2R7SA 1KSWA 1NTCA 2HWVA 2JRTA 5KCMA 1DPUA 1WJBA 1OEBA 2MD0A 1VQMA 2X48A 3J7YJ 3JRHA 2XKOA 1AOYA 2HU9A 2MD5A 2PI0A 4M74A 4BDZA 1CQTA 3ZGKA 2DA6A 2W24A 3BY6A 3X2QH 4F7UG 2ZO4A 3OW2A 2RHZA 2DA7A 2HZTA 4U0VA 5KCHA 2KJBA 3FXJA 3RQIA 4RTYA 5GAN2 1IRZA 2MA3A 3FM5A 4C0FA 2EJFA 3DBLB 1SEMA 2EZHA 4M3FA 5I2MA 2IJLA 1VQ5A 2E35A 3OSFA 3S17J 1WJ5A 1W36C 4TV7A 3FWEA 2QQBA 1BI2A 4LB6B 3HL8A 2VV5A 3I56A 3J7AY 2KYBA 2EGEA 2EFOA 4BS9A 1PHTA 1RAIB 3JCMQ 2DMUA 1FXXA 4M3EA 1Q7YR 3PIPA 3NTHA 1AWJA 2VOOA 2EBIA 2QYOA 3CC7I 1GFDA 3GO5A 2I2LA 3J81E 3GIBA 2L5QA 5CQXA 3CMAA 1V5EA 5JR3A 4ENJA 2C6YA 3UA7A 3VUBA 4XKWA 3W2WA 2P5LC 3F6OA 1LEBA 2ZMEA 2STWA 1K9MR 1G2BA 5HDNA 2QA4T 2UUZA 1GBRA 3CC4I 2PJRA 3I4NJ 1N77A 2DOAA 2P4WA 1B4AA 2XSDC 2X85A 5JLXA 1HC8A 1EH8A 2RJFA 1X1DA 4JRIA 4H0EA 2KIUA 2ROTA 1LE8A 4FASD 4XAXB 3QPTA 5IOZA 1KQSS 4M3DA 2DLLA 3OOUA 2OTLQ 2DZCA 2W85A 1R23A 2HSEB 1WHLA 5CKBA 2GIZA 3I0TA 1HF0A 1IN6A 2MSYA 3C2BA 4DYQA 1KHIA 2CUZA 4M6VA 5AONA 4XTWA 1AZEA 5EGOB 2E1NA 4LFUA 3BDDA 4M75D 2A6TA 3PNYA 1WJFA 1ZLJA 1K61A 2BXYA 1I3QJ 1ON2A 3M0UA 3HRUA 3E5XA 4A3GJ 3G4SA 4AYBN 4AFZC 1VQOT 3GFIA 2QQAA 5DM7F 4MEYF 4YTLA 2ZJ2A 3QU6A 3ZN0A 5JHFA 5JI6A 1UE9A 1JXMA 5GTHC 1WHHA 3NTKA 5J4VA 4BKXA 5GMKl 4VUBA 2ZSIB 4XKCA 5ILVA 2E65A 1TWCJ 4GRIA 1OCTC 5J1RA 2NLUA 2LP0A 4LITA 3U9GA 3IRQA 2AKKA 2X6WA 1MBKA 3DF8A 4L9NA 2QTXA 2GTOA 4QPQA 2A0FB 3UWNA 4DOVA 1YI2A 2OUMA 2BE7D 2R7DA 1JE8A 1D1AA 3CCLQ 1M1EB 2IBDA 1BB9A 4HOBA 1S9HA 2LJ0A 2AQEA 4BXUA 2EAYA 1CF7B 2KRHA 4Z89A 5K5OA 5KYUB 2HDAA 2Z1DA 4XICA 2RQTA 4JOMA 2HAXA 1ETKA 2GOXB 2E1MC 3F72A 3CUQB 2XDPA 3NMZC 2PLYA 3HTUA 4KT5C 3S2DJ 3BCBA 2M0CA 1ZRFA 3VS0A 3H0DA 3OYNA 2XGXA 3H0HA 1H9GA 5GMKi 4IRGA 1SD5A 3I59A 2NUPB 5CKFA 2XAUA 1AA7A 2D1VA 1QP3A 3OMYA 4QT7A 5H2FC 1UEBA 3LSHA 2XAFA 3G2BA 5HODA 4LG0B 3S16J 3TQ7P 3IP4B 1OI1A 4ZYHA 2RJDA 2PG4A 4AU7A 1MMNA 4JLGA 2K3XA 1XGNA 2VOPA 3B02A 3M8EA 4U0YA 2DZ9A 3V42A 2A37A 1I4K1 2COBA 5LL6S 3H5AA 3AHUA 2XPWA 1IW7F 4MHGA 3RNJA 3GLLA 2O8XA 1POGA 3KLNA 3CCVA 3NWSA 4XOPA 1VQNQ 4FIBA 3DEWA 4N4GA 1TXQA 1MNEA 1W0UA 4EMKA 1W0TA 4OMOA 2ESNA 2N8GA 2VJ4A 1SD6A 1YI2I 4NHJA 1AKHA 1QGPA 2V4JC 2VE9A 5H6QA 4IOCF 2R0QC 2VKVA 2PFBA 5GMKe 4ESFA 4KBMB 5L3DA 4FT2A 4KYWA 4UVAA 2EW3A 2HOEA 4DEYA 3DKXA 3WHCA 2M1BA 2C0OA 5LEJA 1IHWA 4NQWB 1MBJA 3QYHB 2B0LA 4PJOD 2KP6A 1PP7U 5GAOr 1JXSA 2EIMH 3W2AA 2GQIA 4AIKA 2M3AA 2O3FA 1JBMA 2LT4A 5L3BA 3DCFA 4Q5SF 4KH1B 2A6EF 2CYYA 3EG2A 5GAOm 2JT1A 3CCET 3KZIC 4YEJA 3DKWA 4FX0A 3GW2A 4B09A 1VQ5I 3H0IA 3IRRA 1Q82U 1BOAA 3OYBA 1V54H 3I59B 4UB8C 1D5YA 1CKAA 2MW8A 4L9JA 2LX7A 2PNIA 1ODDA 5IN1A 5HLHA 3OYMA 1WJEA 4Y33A 2Q8KA 3COAC 4BNCA 4JJDA 3DKMA 4BI4A 2LVSA 2XRNA 4B8XA 2LCLA 4EPCA 2CSOA 4A5MA 2OF7A 2JMCA 5J4YA 1WYXA 4IO9F 4RCCA 4HCCA 5JVTA 1FPQA 1WI7A 3CPWP 3AL0B 3CCJT 1SKUB 1P4WA 1NK3P 1SPKA 3IAM2 4OMMA 2V6EA 2L3QA 1NG6A 1W4MA 2L7FP 2XMFA 2M16A 3I55T 1TU0B 2LF8A 2W57A 1I6HJ 3CJQB 1V1CA 2PUOB 3HC7A 3OIPA 4HCZA 4Y91A 3FMSA 2YX7A 3ECHA 3O8GA 3A5ZB 2VBZA 4M7AG 5LEKA 4HRIA 4XTUA 2BXZA 3CCSA 3K6GA 3HOXJ 3ULQB 1HA8A 2KXCA 3IC7A 2VT3A 3A98A 3V8LA 5F1RA 3THKA 1ABOA 4M6YA 3J81Z 2GXAA 2B63J 3H5RA 1GCQA 1YTYA 2P7VB 2ME0A 2KQRA 4RAZA 2MH9A 3CUQA 2RM4A 4Y92A 3FLGA 1Z21A 2JK3A 3VSKA 1VYTA 3LSPA 3K70C 3MP8A 5A0DA 3G1JA 2AZVA 4C0GA 3VS5A 5J39A 3IAS2 4GXOA 3DXJF 3EGXA 2ECBA 3CC4T 1G5VA 5CLSA 2QWWA 1WZ2A 3S6WA 2CH4W 1IRFA 5GAOq 2DMQA 3Q0WA 1K6YA 1MKMA 4BJTA 4UUSB 4YFXF 2VXEA 2A69F 2K5LA 5D7UA 1M2OA 5GP9A 2OAWA 2JSCA 2Y0MA 1QVFP 2Y31A 5KE3A 2K9GA 1WFWA 4J6XA 5FD6A 3W2VA 4XTZA 4OAZA 4RKUE 3EUAA 2W00A 2EKHA 5JVGF 1V3FA 2BYVE 3M4GA 3NGPA 2CQXA 5DUIA 4PJOA 2F48A 2Z99A 1U78A 1J9IA 1R00A 1ZK8A 1HW2A 4M73A 3R6NA 4D8KA 1OPKA 4JDSA 3EFOB 1VQ5Q 3TOAA 1MMAA 5E8GA 4HQMA 1SFXA 1K4TA 1VQNA 1GV2A 4BQAA 4HNUA 1X75C 3LL7A 5FW9A 1R0CB 1HDDC 1WHMA 1TWAJ 3L1PA 2X9DA 2CZ1B 4II3A 4A54A 3X26B 1VQ9A 3P7NA 5E1ZB 4K11A 1YWOA 3URGA 1K9AA 5FFXA 3AT1B 4Y28E 3MFKA 3GFLA 2KRSA 3L42A 2HR3A 1LFPA 3HG9A 3I53A 3OR1C 4XLCA 1I07A 2EQUA 1W6XA 1QVPA 3M58A 4M6XA 4BY6C 4WK8F 4OIRF 4E7LA 1QZEA 2GAUA 1T3SA 1M5Q1 2AK5A 3MVPA 3S1MJ 1EA3A 3H9JA 4CYCA 2V1UA 3V8KA 2OTJA 2IGMA 4PLIA 1AWCA 1YP5A 1S72T 1VQLA 1PUFA 3CF5F 1JQQA 2LRQA 2LKSA 2FRHA 4PJJA 3R6OA 3TSZA 2F6CA 3EG0A 3WE2A 3JCMb 3G1OA 3BTLA 3L2UA 2HQ5A 3GX4X 4MFDA 3MP6A 2Y0SA 3I4MJ 4HG2A 1UECA 2EA2A 3BDLA 3OR2C 1K76A 4WCIA 1FTZA 4FT8A 3PUFA 1OR7A 3P8HA 3JRBA 2L3SA 2RD1A 1YJ9A 3FXQA 1N8RR 2CDTA 4G9YA 3WG7H 3P8BB 3WTSC 1K83J 4J00A 2QA4Q 4KULA 2LCSA 5E18F 2LC4A 3JV3A 2YR2A 1KG1A 4JS4A 1QPMA 4G94A 4E7SA 3D5SC 4AIHA 4BHPA 4XSXF 1RI0A 2HSPA 2EYYA 1UB9A 5HDGA 1O3RA 4IEJA 2W25A 2CUBA 2UXXA 5IXBA 2NOJB 3H41A 3O3KA 1ZAOA 3OYLA 2FJ1A 2KK4A 4CICA 2QG9B 4BEHA 2X3XD 5DLQE 4BY6B 5KH6A 5I2SA 2BE5F 2P5VA 4KMFA 4F7UA 1KYZA 4DBRA 3T0YA 2A36A 1QWFA 1FIAA 5DCMA 3RBBB 3F3XA 2FG0A 2F2EA 4MLOA 3MCAB 1S7OA 2ELHA 4N9HA 4E7HA 2KDSA 1JT6A 1UZCA 1Z9CA 2OTJI 3CJTB 2A3SA 2JT4A 3OIOA 2AXLA 2EPFA 3HHHA 1GHCA 2RI3A 2VJ5A 4UV8A 3SHFA 3I5RA 2PX9A 1N9SA 3MEAA 3SB2A 3NQOA 2RQWA 4JRPA 2EFPA 2YUSA 2BEOA 4HT8A 3MCZA 1LKXA 4QLCU 1UG1A 4XLHA 1I50J 2M8GX 1Y0UA 2A07F 1VA7A 3RMQA 3JCMg 1B3QA 2CQ7A 3ZXSA 2QGGA 2DK5A 1GDTA 4LN2A 3SWNC 3CD6A 1LJOA 5DS9A 2ESHA 4CCJA 1RUOA 1AWXA 1X01A 2H3JA 3N97A 2DJZA 1Q86U 1WQ7A 1U5TB 3QJ6A 1ACIA 1XB4A 4RUGA 4C92C 4OMNA 2VXZA 5KCOA 1QVGS 3ZQGA 4AD9A 4FX4A 1YITA 3CMEA 2DFEA 1ZARA 2A6HF 1NZ9A 3SD4A 2DFUA 4EATA 1Q81C 2NAZA 3JTHA 5K7FA 1JEGA 2LQNA 2JVVA 3NEUA 4AIDA 3W6KB 3EAEA 2PVDB 3ZQIA 2QCOA 2CP6A 4IZZA 3IQLA 1PNJA 1XC5A 3CCLI 3PTAA 2RQRA 5CVUA 4AMCA 5LJ3h 4NDLA 3IKTA 2DA9A 2LKPA 3J7AO 3I35A 2R5YB 2LBFB 1UDLA 2A28A 2EYXA 2FNAA 2EBPA 3VYTB 3GP8A 5ICEA 5KE2A 2HKXA 3BW1A 3WGHA 3JR9A 1AKHB 1VQ8I 3MZHA 3HOVJ 3EFSA 1NEBA 2R7TA 2FOWA 3TU4K 3MEWA 2W0ZA 2IS4A 1H641 1BC7C 2J6KA 5GAOl 1I5LA 3CCLT 4F3QA 2DK8A 3TDUC 2QEXQ 4JYKA 3UF4A 3ZQHA 1VTNC 4N0BA 1YO5C 1KYWA 3ELKA 3JTGA 1WJDA 3H36A 2TCTA 3EG1A 2J7IA 1I27A 1X19A 4B9XA 1UHSA 3M9AA 2R7XA 1PUEE 3HTRA 3ZRGA 2NVUB 1MMSA 3JCMJ 1ERDA 4M3GA 1U5SA 1AEYA 2DX1A 1XGSA 2K40A 3VB2A 3W6JB 4CXFA 2DFFA 2RHYA 3ME9A 4BUGA 1H88C 4JLIA 4XTVA 4AFQC 3IUOA 4AFSC 5EG0A 1N8RC 1R36A 4C3IJ 4MDWA 2ZNZA 1JJ6C 1IB8A 3GFMA 1MIJA 3LSMA 1E0EA 2E19A 2NVYJ 2YS9A 3PSIA 2QF7A 3G6EI 1IXDA 4CCMA 1ETYA 2JOYA 4LE9A 1R7JA 3GUDA 5GAMg 4I09A 1R77A 2RK1A 2BY1A 4PJOE 2BW3A 1VQ4A 1QCNA 1S72Q 4A3IJ 2PJPA 3L00A 1QZZA 2BHYA 2K86A 3EHQA 4D1QA 1ZRDA 3KPHA 3HHGA 3K7AJ 2KQWA 3K1NA 1YJNA 5CJ9A 2YT6A 2GXGA 3MEUA 2EGAA 2HGCA 2EPDA 3CCUA 3ZQLA 1N6AA 5FLVA 3GBQA 1BI3A 3AG4H 1G6NA 2HVRA 2L4MA 5DD4A 2M0YA 2RJCA 3BG9A 1KJWA 1JHFA 1M3BA 1N27A 1WJRA 5A2QE 2E7XA 4LK1F 4WXHA 2HOTA 2X6YA 4G7HF 1KC8U 4HBLA 2HL5C 2RHIA 2ZPFB 3U1KA 2JJ7A 2KZGA 3HPGA 3EPZA 4G6DA 1W5SA 3SXYA 4BACA 4Y17A 4BBRJ 1A31A 3CCVQ 4ETSA 4AIJA 1MDMA 2HVQA 1SEUA 1EKEA 3L2WA 1Y07A 3M54A 4Z02A 4M7AB 3PJRA 2F5KA 4HF2A 1JU5C 1R5ID 2LKXA 3WTYC 1PKSA 3SDGA 3FM3A 4LGWA 3ZOBA 2XASA 2A5WA 4LIVA 3SJMA 1ZA1B 1ZUUA 3OYDA 3QWXX 4IJAA 4EMKC 4EJTA 3JREA 4FL6A 1WHKA 2YSRA 2RB6A 4NQWA 4JRKA 1ETVA 2VKHA 2GCXA 1OU8A 2JZ2A 4M77D 4CCNA 5A0LA 2MWPA 4AT1B 2K5IA 3LSIA 2KGTA 4HNVA 1MJBA 5IP7J 3UT1A 2LOOA 2XAHA 4RAFA 1ZHIA 1HW5A 3K4NA 3JSPA 1Z9QA 3Q9VA 1HBXG 1K78A 3I71A 1PJRA 1PKTA 2A08A 3HYIA 4XNFA 5KVRA 2MOXA 1IN5A 4MQ9F 4J8OA 5J1YA 1S8NA 1XMKA 3CZ6A 4IHTA 3FIWA 4OIQF 4A4HA 4BQQA 3X28B 2K5FA 2QQ8A 3NRVA 1MNMC 3TGNA 2IS1A 3MEVA 2P81A 2FZKB 4HV5A 3QU3A 1H3HA 4M75B 1IC8A 1FYMA 2GLOA 1X27A 1K78B 2MH2A 2RNGA 4K2EA 2GFAA 1XN7A 2BV6A 1AD5A 4MIMA 2QXFA 1P9QC 1UGPB 2FPDA 3H0FA 4ME7A 4RM2A 3QYEA 3VOEA 2K9LA 4PJNA 4C8QD 3DBHB 1DP7P 5DDGA 2AKLA 2RK2A 2TRTA 1YJ9I 4JJNK 3D5RC 1SC7A 1NK2P 3VRZA 3A1YA 2LFBA 3I3LA 4EM1A 4HVWA 3AFHA 3LMMA 1Y0NA 1O4XA 1BN5A 1FYKA 5GANf 3HJEA 1VQLQ 5FKKA 3KCCA 3SEZA 1NBEB 1S5LC 3GYHX 5M5WJ 2NUPA 3E97A 3JCMc 2DFHA 5KYNA 2P0PA 3OA6A 1F1ZA 1YJ9T 2EV0A 2PVOB 3OYYA 5HOOA 2QSHX 2DU9A 2DKGA 3CXCP 3C1DA 4NUBA 5EZHA 2P4TA 1LQ1A 1M8MA 5IHIA 3TKYA 1Z3XA 3A2KA 5LJ5e 5BQTA 1T0HA 2V6CA 3WODF 1HCRA 2CW0F 4Y4RA 2H8WA 2D8JA 2LVMA 2AHQA 1K4SA 4EM0B 2AZSA 2RH2A 1Y6IA 4FTHA 1D1CA 4NL2A 4RTVA 1UJ8A 4UXNA 4KN4X 2PVGB 2XI9A 1VQ8A 4A3BJ 1WJAA 4WCGA 1IG7A 3K2ZA 2DTRA 5DV5A 2K4JA 2L0KA 3B73A 3OSGA 1VQMI 1N5ZA 1RAEB 2J05A 2H6CA 2L89A 3KBGA 1E2XA 1FX7A 2HYJA 3RESA 4PZJA 2H1LA 4ATOA 1T33A 3B6AA 4D7MA 3QHSA 3EH2A 2E71A 1ONVA 3KIOA 3P9CA 1FLIA 1U06A 2WACA 3IKVA 2ZNYA 4ZYGA 2R7UA 3TEEA 3CC7T 5HNFA 6PAXA 3ZMUA 2CQNA 2K7LA 3VFZA 4BE1A 2VUBA 3L7WA 3C12A 5LD2C 1XGMA 2F5VA 1VQ7I 4YIIA 1FOWA 1X1CA 1VQ9Q 3EUHA 3CEYA 1ZHFA 5LHIA 5CVIA 3A1PA 5H6RA 4E6KG 4FE4A 2YRVA 1STZA 4EJUA 3KXTA 2EJ9A 2X1DA 1SFKA 1X2MA 1UAAA 3GNGA 3EG9A 3CQZJ 2AT1B 3GTQJ 1TUCA 2JXBA 3ECOA 4IUPA 2HFHA 1T0FA 4M77F 3EYYA 1R1TA 4Y3OA 3VS1A 3QOPA 3CPWS 2B7EA 4C92G 4EVIA 3GNFB 4OB2B 1JKOC 4F55A 4RA2A 2YWWA 4AVPA 3Q0UA 2CH0A 4IL6C 2G0EA 1Z0XA 3GTJJ 3CMET 4IHXA 3BZ6A 2K2MA 2DTHA 3A8GB 1W7PA 5FO5A 1DDNA 1GXPA 3RKQA 1IGUA 3LA3A 2HI3A 2FPEA 2KROA 1Q7YC 4E70A 4GFBA 1T0JA 4FT4A 4HX8A 5DY9A 1HLVA 4XKVA 2IPQX 2AHJB 3M9QA 3OSSC 5JHUA 4I0AA 1O57A 2DCEA 3ESWB 3LOCA 2DM1A 2X1EA 4C0DC 3CCJA 5GANj 1S7AA 1D0YA 5L3CA 2GWRA 4V2FA 4A3MJ 1D0XA 2DOEA 1N9RA 2AIRB 2BZ8A 2E6ZA 2O9SA 3SFIA 3BG6A 1JUMA 1X1BA 5HS9A 3M4YA 3GZ6A 1GFCA 1ZQ3P 4M7AC 2EQRA 2DF6A 1SMYF 2L9RA 2OBPA 2OC6A 1Y0MA 2CJJA 4M7AE 2DA5A 2FYKA 1BIBA 1TZLA 4QVCA 2UV1A 3E0JB 3S3MA 1OQKA 2F5FA 3QYGB 3VPRA 2HMAA 4OMFB 3ZMZA 4M78D 1ENHA 3RPUA 4A5NA 2VGMA 1B34A 4GO1A 4LNPA 4I7HA 1IZ1A 2DL5A 1Y39A 4HNTA 4MDXA 2XHKA 3HSRA 2DYSH 5M3FJ 1TP4A 4I2OA 4A4FA 4G6TB 2V9PA 1DGRM 2RPNA 2CW7A 1QKXA 2PQ8A 1RC9A 2VKNA 5D6WA 3LH5A 2CP5A 3KZYA 1VYUA 2GFUA 1K73U 1OYXA 1JJ2A 1P4XA 4F04B 2PN6A 4CC2A 5IT9K 4N9IA 2VE8A 1TG0A 1FMWA 4GYIA 2P84A 4IXAA 2MI6A 2VB6A 2ESWA 1O75A 2ZPEB 4N4IA 3CCQA 2HTSA 2E41A 2FU4A 4X9CA 1MBHA 1ZA2B 2XAJA 1MJ9A 1RRJA 3BT9A 3BQZA 3PIOF 1XMXA 3WU0A 2L0AA 3E19A 3ZMTA 2Y4YA 4QVZA 3LSTA 4C2UA 2HNHA 2FX0A 5E79C 1YCYA 4YIFA 2HPMA 2MAMA 5GMKh 1ORKA 4XRSA 3AG1H 1FZPB 4WTOB 5CCAA 2XROA 1EV7A 3S8PA 2LK2A 1XPXA 1HSQA 2DQLA 5LJ3d 2O8KA 1YW8A 3D7SB 3OQ5A 2KT8A 3GOXA 1E3OC 1YIJT 1TBXA 1OULA 4KNYA 4E7JA 1X43A 1I6XA 1R6RA 2D1HA 2DT5A 3P5JA 1B34B 1JO8A 3CD6Q 3OIQA 2FPFA 3JAMZ 4J6WA 2QENA 1GRIA 4C0ZA 1U2WA 4RB3C 2DL4A 2RNAA 2WY8Q 5LJ3f 2KKOA 2ZBKA 1LFUP 4M9XA 1FT9A 4UUTA 3TDZC 5FKNA 4XRSG 4I76A 1HDPA 1S72I 4IUTA 4XMYA 2JW4A 3CD6I 4EV0A 3KYLA 2DPDA 1EJ9A 1PCXA 2DTIA 1NH3A 1H89C 3JRCA 1R49A 2RN7A 1DU0A 2IGKA 4U88A 3JRAA 1WJCA 2WADA 4OMPA 2CRGA 4M4ZA 4C92F 2J5OA 4IOAF 1XNIA 3M55A 1KD1U 5D5UB 3DQVC 2B8AA 1RLPC 2GQQA 3OYHA 1PUFB 5KYYB 3KETA 1OPLA 4C92E 1ITYA 1RR8C 4MZPA 3QWLA 2BZTA 1BM9A 3OL4A 2QQRA 4A4KA 1JJ2S 9ANTA 4F7UF 4RTUA 5KYXA 2RO0A 3CCRA 1K1ZA 5JFRA 1SFOJ 2EQJA 1SF9A 2DDBA 4PJMA 5TISC 4D9JA 1M3AA 2DT6A 2ME6A 1ZGJA 1IGQA 1MV0B 1R5HA 2GXBA 1QVFS 1TQIA 1UTIA 4XN3A 2IIMA 1OFCX 2EYWA 4J5YA 3FBIB 1BR2A 3BLYA 1HXDA 3VKIA 2F69A 2XDBA 2QDLA 1PM3A 2WBMA 5LFAA 3P9KA 4FETA 1ZSZC 1Y1WJ 3HSBA 2GGRA 5ICCA 3JRGA 3LLRA 1K9MU 1NYFA 4X6AJ 3GCMA 1MBFA 3K4LA 2L8DA 4JUVA 3HGGA 5GAGJ 1U9NA 2LD5A 3S14J 2FBIA 4KJZA 1TH7A 4BI8B 4M75A 4LDXA 1PRMC 2BTTA 1G83A 3OS0A 3QIIA 3TW7A 1FOKA 4BXXJ 3HXLA 1PD1A 2DD5A 2HBPA 2LQKA 4FE7A 1MH4A 2MLGA 2L2OA 1BK2A 1V76A 2MPXC 1BIAA 3OY9A 1RETA 4M75G 1WWXA 4XQFA 3BPXA 4LDUA 3UPUA 2FBKA 3CC2I 2FZGB 1Q82C 2RREA 1O7FA 5LLQA 2E4HA 2WAFA 1IF1A 1VQ8T 3AAFA 4A3DJ 4TVRA 2J6OA 2VKEA 2CKKA 2YUNA 2VPLA 2JNGA 2DODA 2RI2A 2QA4A 1G2HA 4NC8A 1SFUA 4PJLA 2JQ7A 1N78A 1FEXA 4PJ0C 3QYFA 1LCKA 2J06A 2K6DA 2L3RA 2MIOA 4J01A 4ZGDB 5I11A 1WI3A 2TDXA 1S72A 2HDDA 3KLOA 1C6VX 1ZSZA 1RPWA 4CHUA 2HQEA 4X0GA 4WF2A 4IHWA 5EC7A 1LDJA 3DBRB 3SWNB 2YHTA 2P0QA 2DA4A 5D5WB 1Z67A 4MO7A 3BWGA 2EFWA 5IT9Z 4QPOA 3M0PA 4HSRA 3M0TA 1J7KA 1ZG3A 2XSJC 3V7SA 4FISA 2VBXA 2NS7A 2QSFX 1YJWQ 5LJ5j 1ETQA 3ASOH 2OAZA 1WXUA 2NNYA 2R7ZJ 3DKYA 4U7DA 4Z8AA 4A0ZA 4XRFA 2KBTA 3CCEI 1XG1A 2VJJA 4UNOA 3OSVA 1FOYA 3AL0C 4PGHA 1XCVA 3BTIA 5ED4A 4IX7A 4FW1A 1RR7A 2M87A 2JM8A 2F4OB 1DPRA 4EQQA 3JSOA 3WHBA 2EILH 5GMKj 4KIBA 4U87A 2MK5A 1ZG5A 3OYAA 1HKTA 1BR4A 1YJNQ 3BTCA 4P9UA 3H9GA 1PG5B 1B59A 5K1YA 1Y71A 1KD1C 4M9SA 1VOMA 2CH4A 4DBFA 4ZJZA 2YLBA 5CO7A 5GMKm 5J47A 5JLWA 2M8EA 3A01A 1GVDA 1MZBA 2KT1A 2ECZA 5J26A 3DU5A 4UHTA 2E34A 3CCUI 2XB5A 3BR0A 3H1CA 3TMOA 5E3NA 2QBYA 1TLHB 1E6GA 2HZDA 4C3HJ 4A3JJ 1GXQA 4G7OF 4XIDA 2ENMA 2KNBB 1YJ9Q 3QZ5B 3INZA 2A05A 3C3WA 2VVKA 4AG2C 1YRNB 3SQNA 2CWEA 4R79A 3MD2A 3OB9A 5FRMA 4M7DD 2JVGA 2XUBA 4HX4A 3HOZJ 3HFOA 4L5JA 2FVUA 1GT0C 4N4HA 4ESBA 4ZDLA 4PFPA 3HEFA 1NG2A 5IYDJ 2HYFA 3C2HA 3EGDA 2KMUA 3WU1B 2FBHA 4OB1B 4PJOG 4RGRA 1SVMA 4RMNA 1MGTA 2PMHA 4C3JJ 2E6NA 2FF4A 3QRFF 1YOVB 4BQNA 4ESJA 5C44J 1ZLMA 2KRFA 2DXTA 3ZMDA 3PM1A 1K6OA 4LD6A 1ABQA 4LG3A 2F1LA 1OR7C 5IT9E 2OQRA 2LLKA 2R7FA 2QGFB 3K4CA 3GTMJ 2DJQA 1VQ7Q 2R7VA 2VXFA 2R7RA 1XJWB 1AU7A 4UVCA 1Q82R 1K7AA 1OU9A 2LREA 4KGXB 1GLNA 1SG5A 2OTLT 2X4YA 4RTXA 3G6EQ 2H8HA 1ULYA 3FDYA 5GADJ 1E7OA 3CPWA 2C06A 2M5WA 4RM3A 2ZMEC 4CZCA 1PC0A 1R0BG 4CC3A 1YIJQ 1I1JA 4L5EA 4N4OB 3REAB 2P6TA 2XRLA 3PMIA 4FSSA 2PU9B 2PUKB 1X2QA 2DMPA 1KQSA 3GTPJ 2V9VA 2JS0A 3SZPA 1MBGA 1NM7A 1TW2A 2MABA 2RQQA 2XDVA 3PL8A 4CYDA 4LDYA 1JI8A 2K9NA 1XSDA 2LQ8A 2ZCWA 1MNDA 1L0OC 1IREB 2WV1A 3KEQA 3M0SA 1XX5A 3CLOA 3QP5A 4ZZDA 2HDCA 1ZBJA 3NPFA 3X20B 4ON0A 3M53A 3GF2A 1F36A 1LPQA 2DAOA 2C0IA 4F7UE 3CCRQ 1D0ZA 2SRCA 1B9NA 3FKJA 3H0GJ 4BJ6C 2CV2A 2EA4A 1YFNA 1VQKQ 1EH7A 4YIRX 5HS8A 1XD7A 5DTDA 3JRFA 3LA7A 2R5AA 3R60A 5E3MA 2NRAC 1M27C 2CW8A 3T1BA 2QEXT 2G9WA 2VQCA 1PSFA 4FM4B 1LVAA 2FMYA 2DIGA 2K9MA 2EB7A 2IXSA 1TTYA 1FJLA 2X3WD 5L3FA 2STTA 2WY7Q 5KYUA 2VJIA 1XCBA 3FXKA 2GM4A 1ETWA 2L02A 3I58A 1AHDP 2ZC2A 3RKXA 4UVBA 1LPLA 3GZNB 3CXCS 2DI3A 5LGNA 4IURA 2JUGA 1SANA 4XBFA 1BOBA 3HTSB 2HNIA 1U3OA 4EGYA 1FIPA 5A2QZ 3QDFA 4ZN3A 4BYYA 3G6ET 1DU6A 4F7UB 2LQWA 2X35A 4D5FA 5GAN3 2VUMJ 5E17F 2GTJA 2NUTB 1R1UA 3V4GA 4OP0A 1UJ0A 1YS7A 5IXFA 3ISPA 4GY5A 2CZ6B 3VYRB 1K4US 2K4BA 1WHJA 1UG0A 2BY0A 3CLQA 5J40A 4ELYC 4M7DG 5BOXA 3KUFA 2RHUA 3L9FA 4M75E 5KHDA 3VS4A 5HLTA 3RDIA 1U6GA 5KYXB 3OYGA 2ZFWA 3BR5A 4XK4A 5J3BA 3JB9I 3I4PA 4EJOA 3NARA 2VYTA 1M90R 1G3WA 4KICA 4DW6A 4KA4A 1JKPC 3WU2C 3PT9A 1VQMQ 4DBQA 1M1KC 3A8OB 4PFZA 4KT6A 2O9LA 2DAQA 4RTTA 2KIFA 3TREA 2M2EA 4C5GA 3CC4A 2ID3A 4L9TA 2CZ0B 3VV0A 4J9CA 4HW0A 1WRJA 4UUVA 2H27A 5KK1A 1QKWA 3RTRA 5C4XJ 1RLQC 1USSA 2B86A 1UMQA 3FXMA 4XLPF 2X4JA 3KEYA 3LW5E 5FWCA 1VQ6A 2BW3B 2LJ1A 1UHWA 2Q2EA 4OINF 5D6EA 3S1QJ 3OS5A 1SVLA 2CUJA 1A04A 2LC2A 2XGEA 4W97A 1C0WA 2UWMA 3A8MB 2X0LA 1AWWA 2JTFA 3I9V2 4JPBW 1IXRC 4G12A 1JKRC 1W7PB 3W6VA 2DNUA 2BZXA 1MW7A 3MZYA 4G6QA 4MEXF 4MTDA 3C94A 2OPTA 4A69C 1WQWA 3FJ5A 3CCMT 1VQNI 3CC2T 3S2WA 3K4MA 2A68F 3LSGA 5CKEA 4GDFA 1F4KA 1PD0A 1USTA 2K79A 2HTJA 1LEAA 3T5XA 2JM9A 2YUOA 4EJVA 2RNJA 4HAMA 1KU7A 3BQYA 1TWBA 1CSKA 8AT1B 2WAQN 1VQ6Q 2K27A 2L3DA 1VQKI 1WHGA 3WGGA 1CF7A 4BI3A 2IA0A 4P96A 1BJAA 2DYIA 3DLAA 1YITQ 2HCKA 2OD5A 3LSKA 1Q1VA 4XLFA 4J7FA 4JS5A 1N25A 5GANd 1MSEC 1QVGP 3F8CA 5ICFA 1D3BB 3CCMI 2OJED 1O9SA 2KIQA 3RYRA 1WNLA 2CSQA 2KZVA 4JZ4A 5LJ5d 2NOGA 3UATA 5DEQA 2XIGA 1D8JA 1M2VA 4FYWB 4CC7A 1VQMT 1PRLC 4JK1X 2XF6A 4O6JA 1VQOA 3G71Q 3Q9SA 4L0YB 1BW5A 2XKPA 2LP5A 4B3AA 2P7CB 4ZYDA 3LWHA 3FXUA 1JUSA 3ABMH 4EMSA 4J9BA 1DGWY 4ZTJA 4BBSJ 2EZKA 2QGUA 2ROLA 1W7PD 3Q3SA 5D4SA 4AYBA 3CCEA 1AWOA 1DJ7B 1K8AR 4U7BA 1X4OA 1R8OB 1QVFA 1HJDA 2DFIA 2KIMA 2K4YA 2QASA 3IHUA 3M59A 1K8AC 3J7AF 1X1PA 3RR6A 2LTOA 2IGOA 1WPYA 3M57A 1OKRA 5FLMJ 4OIPF 3FMQA 2IVWA 4MMKA 3EQLF 2IPOB 2O9VA 2YXYA 1RIOH 1MH3A 3N05A 5LJ3j 1HKSA 4BJ5C 1SRMA 4R56A 3PIPF 1M1FA 5LGTA 2KY9A 1MJAA 3D5LA 1OLTA 2BGCA 1IV6A 5D5VB 3E6MA 1P7IA 3PMTA 4J9HA 2YPRA 4IVNA 4KDPA 4V19K 5F04A 1Z77A 3LGFA 3BE3A 2IP2A 2QQSA 2DTZA 4AM3A 3PIOA 2F5DA 2KLOA 1D3YA 3FMRA 3K1PA 5LHHA 3M1CA 2A5YB 3CP2A 1OX8A 1QBJA 1FOXA 1YBYA 3IL2A 3O2PE 2L9NA 4HDUA 1W4SA 2LX9A 2DETA 3OW2S 4F7ZA 1ACMB 2P6SA 3D0SA 1LJ9A 2HS5A 1F5TA 2H8RA 4M78B 3CCRI 2AO9A 3OS2A 1VQ5T 2ZXWH 4V2GA 5TGTA 2CGPA 3X25B 4DZPA 1TNSA 3H3ZA 3IWFA 3KP6A 4P5OA 2HZYA 3JSCA 4D8DA 2KXDA 1TT0A 3I5SA 3Q5FA 3MO8A 2JPCA 2OA4A 3SFZA 3HRTA 2DQRA 4BQOA 3RMSA 2K85A 1BR1A 4XORA 1E3PA 4UUSA 4PK4A 4RAGA 3WTXC 2D8HA 2R5MA 4C92A 3WXMB 6AT1B 2QK0A 1HYOA 4XRMA 2EQKA 4RLQA 4B43A 5FLXZ 3M7GA 3HKZN 2YSQA 2NXNB 2QKLB 4X1VA 2VWFA 4BXFA 1FNNA 4C2TA 1JHHA 1RACB 3DFGA 2CP7A 1ETOA 4YG2F 3RYPA 4B9WA 1SSHA 1I1GA 1M4ZA 2NYSA 2R4GA 2LMJA 4KRTA 1YLFA 4JQFA 4FQGA 1JXOA 3N4MA 1TW3A 4IIOA 4NOYA 2NS0A 2E5NA 1JTYA 1OISA 1Q95G 3F6VA 3KP2A 1VQLI 4C8QB 3BR1A 1YN8A 4R8HA 5FRNA 3LQRA 3WTZA 1GVJA 4ENMA 1I8FA 4E7IA 4M71A 2DIQA 4B6MA 2IVMA 2XPVA 5FJ8J 4HLYA 4ZGJB 2DXCA 3A4CA 1H0MA 2MMPA 4E2FB 3MWMA 1TTHB 4EMKB 3R4KA 1EFNA 3OS1A 1NLOC 1P7JA 2PEXA 1G3TA 4IKFA 3CMAI 1X58A 2PMUA 3CO7C 1M30A 2BZYA 2RQUA 2X9HA 3PGGA 4PDKA 2DXIA 2RDPA 4II1A 4DOWA 3O5ZA 2ECCA 2LMDA 1RI9A 4FYVB 4CGZA 1KHCA 2QA4I 2Z33A 3K0LA 5I22A 4C9YA 2D0NA 1KONA 1IHVA 1S29A 2RV8A 1IV8A 3PUBA 4JX5A 3RPQA 5EDNA 3G71A 5IPAA 5GPCA 2GQVA 1T6SA 3G1LA 3FF5A 1QQIA 5EEGA 2IRFG 1S1NA 2CP3A 3EH1A 2K02A 3QXEB 4RBOA 2D1XA 4HEA2 4AUXA 1BC8C 1B8IB 4ABZA 1QWEA 4KH0B 4HCKA 3OYJA 5D4RA 2LR8A 3S15J 3C18A 3CMYA 1ZRCA 1XS9A 1P6RA 1Z91A 4M75F 2DA3A 4RDUA 2L2PA 1FYLA 2L7ZA 1NJIR 2K3FA 3F9KA 3ER0A 3WVEB 2LNHB 1JJ8C 4UY8I 3WTWC 2JMAA 5HK3A 4CSWA 1ARKA 2CT3A 3G6EA 1UGVA 2JA8J 1KQ8A 1V5GA 2GA1A 3H35A 3HM5A 5KYWA 2EYZA 1R5GA 1I5ZA 4OAYA 2HOAA 5C0MA 3V8JA 2ACJA 2K2VA 3UA6A 1FBSA 3JCMf 5GAHJ 3PVQA 2KRNA 4UB6C 1D09B 2XICA 3IV5A 1YHQT 3KP4A 2DL8A 1QQJA 3I55Q 4OMYA 2LT1A 2M1HA 3LSJA 4HZFA 1A6QA 2ETHA 3GZ5A 3A8HB 2QVOA 3NTIA 4KITB 4HPQA 3CQTA 4F16A 1OCOH 4PLLA 5HCKA 2CYZB 1RADB 5GAN7 2EK5A 3GWZA 2FMLA 4PSWA 2FRYA 2XAQA 4CRIA 1PSEA 1M90C 3HSFA 3KFVA 2LDMA 3EUKL 1B6AA 3QODA 3HOTA 1QHGA 2VKDA 4XL9A 3F21A 1YJNI 5M5XJ 2KRCA 3L2QA 2L7MP 3NAUA 4CCOA 5B3SH 3BC8A 1Z1DA 4PUSA 3ONQA 2OTJQ 1REPC 3JB9F 2IS2A 1TQPA 2CO5A 2VQLA 2EIKH 5B5EC 1SHFA 2DL7A 3HPWA 4RCBA 2FL7A 2E1CA 4M7AA 4DJAA 2G7UA 5KAFC 4F92B 2HD0A 1VQ7A 2CUFA 1VQPA 1E3HA 2JA2A 5FKLA 1QA6A 3KP7A 1WKMA 4XN0A 4QTRA 1IGNA 2HQAA 4N0AA 1YX5A 1QCOA 1X6OA 4EM2A 1SFEA 1YJWI 2Y75A 2EVRA 3CXCA 3CCQQ 3CMAT 1S3JA 1X1AA 2VXDA 1WH5A 4BD3A 3RZDJ 1U5TA 4J83A 4E47A 1A6IA 3ZQ7A 2NNNA 3M8FA 5GAMh 4DEXA 4B48A 2FO0A 3PE0A 4ORZA 2MLKA 2M45A 1TQMA 1R1VA 2MC4A 4I02A 2L9SA 3IH2A 1VIFA 3HP9A 2ADUA 3ABKH 3OYEA 1RESA 3I56T 2WSCE 4M7DC 3E5QA 1O3SA 3I9QA 1JGSA 2RQVA 2JMWA 3TBIA 4IUQA 2VBWA 3LA2A 1T3LA 4ZYAA 4CO8A 1FP2A 3FKIJ 2DBKA 2ZPGB 3WE3A 3IWZA 3PFYA 1X3ZB 4A3EJ 5HKCA 3H9NA 2P0KA 3QJYA 1Y8QB 3H92A 2P8TA 3AKZA 1Q86C 1P4AA 1M1GA 1VQKA 2E5ZA 2LNVA 1IRXA 2LY2A 3QPHA 1B8IA 4YRVA 1RUWA 3JCMV 3VUZA 3SHWA 3L2ZA 3JW4A 5EGOA 2WAEA 3I55A 1WFXA 4ENNA 2DEUA 2K3PA 3G4SI 5D6FA 5D6YA 4XU3A 3CDHA 2DN0A 3CC7A 4F17A 4A4EA 2WTEA 1VQ6I 3C7JA 1Q81U 4PGGA 1SSFA 2KE9A 5L23A 4M77G 5E1WA 2E10A 2Z0WA 3FHZA 3CDIA 1LE8B 4J9GA 3CCST 3MKDA 1UHMA 1OCCH 3MQ0A 1XSXA 5GAN4 3CCRT 1WGXA 1QMCA 5GJVB 2COMA 2JUCA 3HRSA 5IYCJ 1FMKA 4MMLA 1J09A 1NPPA 4DYRA
chains in the Genus database with same CATH topology
5CVRA 3O8VA 3E6BA 1OYWA 2Y48A 5FD5A 3WG9A 3G4ST 2D9TA 5GAN5 1IN7A 1T39A 4OB0B 1QO0D 2YLCA 1R58A 2HEOA 1OPCA 3N5BB 5GAN8 2BUDA 2OZ6A 2GF7A 3X24B 4M7AD 2PQWA 5L3EA 5GAN6 2EFQA 4G7ZF 3JAME 3META 3H8ZA 3V7RA 3REOA 2EKOA 1Z7UA 2JN0A 3LWFA 3VYGA 3GEZA 2AS5F 3LFKA 5LJ5h 2J5PA 1YJWT 2ZXJA 4YFKF 2GA2A 5GAMe 2X4HA 5IT3A 5GAOp 1KA8A 4P5NA 3U2RA 2Y90A 5E1XA 2XHCA 2ZCFB 3DPLC 4EMHA 3CBPA 4I0BA 2KSSA