3HRTA

Crystal structure of scar with bound cd2+
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
212
Chain Sequence
b'PNKEDYLKCLYELGTHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
total genus 52
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrtA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrtA02
4CGZA 5BMZA 2ZCWA 3V8LA 1LB2A 2ZJ2A 4IF4A 3E5XA 2OAZA 3HYIA 4OIPF 2AS5F 1OKRA 2W24A 3GWZA 2DQRA 2EFWA 3BY6A 1SFEA 1WKMA 2MA3A 3TOBA 4IPAA 1Z7UA 4BAYA 1BI2A 2ZNZA 4WF2A 4ENNA 4WXCA 2XAHA 4RGUA 5CJ9A 2XAQA 2EA2A 3L2CA 3SXYA 4FX4A 3KP6A 3P9CA 1IF1A 4L18B 2K4YA 1EH8A 1J5YA 2A07F 1BIBA 2H27A 4MNUA 2RNJA 4ZYDA 3IKVA 4LD5A 3WTYC 1XB4A 3QU6A 3W6JB 4L0YB 3G73A 3V7RA 3LSTA 3CUQA 2MH9A 4KICA 3GX4X 1XSVA 1MKMA 1RNLA 1FSHA 3C18A 3ZN0A 4A12A 3JSPA 3DEUA 1FPQA 4Y13A 4RAYA 3HHGA 2JPBA 1F5TA 2L02A 1Y0UA 3HOTA 2K5FA 1SFXA 4A0YA 4L9VA 2OD5A 2FRHA 3O3KA 1O7LA 2XAFA 5DYMA 4KFCA 4O5VA 4L9NA 5H6RA 3MCZA 3EDPA 2VT2A 3K9TA 2VC1A 5ILSA 1JXSA 3NQOA 1QQIA 2DI3A 2GWRA 3MZYA 5ICFA 4EMSA 1ZLJA 4UXNA 4EVIA 3TOAA 2M5WA 1SAXA 2FF4A 3GFIA 2GZWA 5LGTA 3HRUA 2VBXA 1KA8A 2STTA 3LQRA 1O3SA 4FHTA 1IXSB 4G8XA 5F64A 1FP2A 2A3SA 4HOBA 4U0WA 5FFZA 3QRFF 2GA2A 2D2WA 1U5TB 1STZA 2UXXA 4GCVA 5CVUA 1W5TA 2JT1A 4RGSA 1KQ8A 4N9HA 3TDUC 3QAHA 4EJTA 2VN2A 1FSEA 1FOKA 2C6YA 1LEBA 4UVAA 2V9VA 3RYPA 5AIPA 2P6TA 2CYYA 2P5VA 4CO8A 4HQEA 3F8NA 3B73A 3TGNA 1IN4A 4M9XA 4PCQA 1IRGA 2PQ8A 2Z33A 3F6VA 3E5QA 1RIOH 1HBXG 4MTEA 2RDPA 3GYHX 2GCXA 2QQBA 1BI3A 1V4RA 2K02A 1KU3A 2ELHA 2HGCA 4AVPA 2BV6A 3CO7C 3ZMDA 4HLXA 1LEAA 1MJBA 4A0ZA 1H0MA 5H6QA 1KGSA 5E20A 1FWZA 1FBQA 4PDKA 4F7ZA 1IN7A 3FMSA 3E6CC 3RI4A 1FX7A 3J7AO 3RIRA 3HSFA 2NRAC 1L0OC 3DFGA 3BZ6A 5DV5A 4M6XA 4YG2F 4EQQA 3IHUA 2HEOA 2F2EA 1ZG1A 1BC7C 4ENJA 1R7JA 3E6BA 4WX9A 3I5UA 3I71A 5HS9A 1S29A 4EJOA 3VFZA 5JR3A 2EWNA 3IL2A 3GLXA 2PLYA 3HOSA 1WI9A 3FM5A 3RDIA 2KJCA 1IUYA 2EB7A 2QQAA 4UNOA 2FNAA 4KUMA 4M9SA 3KP7A 1HW1A 4CZZA 5LHGA 1H9GA 2EK5A 1IZ1A 1TQIA 4MEXF 3RPUA 3Q5FA 1HKQA 1HW2A 3FZVA 1LDDA 4A5NA 2PG4A 4I0BA 2ZMEA 2ZXJA 1TLHB 2XKPA 5AONA 1I6XA 1ON1A 3RPQA 4EM1A 3WU1B 1ZGAA 1ZREA 2PFBA 1K78B 2AXLA 2K5LA 4NHJA 4RB2C 2E1CA 3OOPA 2B0LA 4JK1X 3CUQC 1YW9A 2K4JA 1J9IA 3CUOA 4L5JA 2HOEA 3V7CA 5CVJA 3FM3A 3FWEA 2F5CA 1JE8A 2XV4S 4MTDA 4P5OA 5BPIA 1YO5C 3HRSA 4OIQF 1PP8F 2VOPA 4KN7X 2ESHA 1PP7U 2D1HA 3L09A 5LGNA 1P4AA 4S05A 2P5LC 1XGMA 5FD6A 1YW7A 2V1XA 2Z9OA 1ZH5A 3ZQ7A 3L7WA 1Z1DA 4XLNF 2GXGA 5F6FA 1IRFA 2PBIA 3BP8A 2X4HA 1BIAA 4UVCA 2RC4A 3M1EA 1YLFA 1FYKA 1ZAOA 1FYLA 4G6QA 2ZNYA 5DCMB 2M8EA 4G7HF 4K2EA 1YFHA 4EGZA 4LG0A 3J80K 2VONA 2NNYA 3HHHA 2DU9A 3B02A 3WTSC 3ECOA 2GIVA 3P9KA 1O3RA 2F5FA 1FY7A 3KP4A 2CO5A 4Y15A 3IRRA 3U1DA 3ZP5A 3SZTA 2FE3A 2MLGA 2DFIA 2BYVE 1DDNA 2OA4A 4FT8A 2QM3A 4U7BA 3PFIA 4EM2A 3FHZA 3JSOA 3ZN1A 1ONVA 2A69F 4H0EA 4P9FA 1G3SA 2LDUA 1R58A 5FB2A 2ADUA 4HDVA 1FLIA 3U2RA 1O57A 4GXOA 3F3XA 3LFKA 5AIQA 3J80Z 2ACJA 1QNTA 1EH6A 3M9AA 4Z2YA 4R79A 3I59B 1MJAA 4HYEA 5ICCA 2QZ8A 4B8XA 1KQ0A 3CO6C 2E1NA 5LEKA 3ML6A 1FZPB 3BDDA 3E6DA 2M87A 1HQCA 3EYIA 1K79A 4M6YA 3FXRA 3I54A 1D8JA 4N0BA 4M9ZA 1IAWA 2JTVA 1WSUA 1KU7A 4OMYA 4EJUA 2HKXA 5CVVA 2QBYB 3ZMUA 4BHPA 3HSEA 3PQJA 4MQVA 1BBYA 3OV8A 4YFXF 4Y17A 1ULYA 1B9NA 1BI1A 2OBPA 2LSOA 6PAXA 2CWEA 4ZYGA 4NB5A 4TV7A 5IT3A 1R23A 3FMQA 4I7HA 1FYMA 1LDKB 4BNCA 1DPUA 1B4AA 4WWCA 1OYIA 1TBXA 3SHFA 5FLXK 2DTRA 3F6OA 3PQKA 4ESBA 3F22A 5CVIA 4XSZF 1TW2A 1XMKA 2RVCA 3BPVA 3R0AA 1Z6RA 2Y75A 1MDMA 5LHIA 1XDSA 1O3TA 3MFKA 1R5GA 1QBJA 5E8GA 4WXHA 3W6KB 1LJ9A 2O6GE 4YFNF 1W5SA 5D5VB 1BOAA 1AWCA 2H6BA 5LBQA 1QZYA 3GZ6A 3DXJF 3LAPA 3H92A 5L3CA 3Q9SA 5EEHA 5ICEA 4ZZLA 2V1UA 2ZO4A 2M1BA 3CLOA 5FLXZ 1RUOA 2G7HA 3DKWA 1MD0A 2XVCA 3GFJA 2P7CB 2MH2A 3WGGA 2DPUA 2VOOA 4IVNA 1ZARA 4N9IA 2W84A 5TRDA 4I09A 3BJAA 4KIGA 4A0XA 3KCCA 3JTGA 3R61A 2IW5A 4LK0F 1W4MA 2CQKA 3FXQA 1T2KA 4U88A 1U8RA 3V4GA 2YX4A 3HIFA 2QVOA 4KMUX 3CUQB 4HF2A 5D5UB 3NEUA 2KRFA 4LLGF 1IN6A 1YW8A 3BROA 5K5OA 3J81K 2Z5UA 2O3FA 5LRSA 5K5RA 2D1VA 3L9FA 3TO6A 2BEOA 3WG9A 5E8IA 2QQ9A 4DNCA 2IVMA 4CYDA 4IRGA 1P6RA 2BGCA 4KMFA 2Y0MA 1OYYA 2CSOA 2EA4A 4ON0A 2Y48A 3ULQB 2EFOA 3EYYA 2KJBA 5D4RA 1QGPA 3FX3A 4ZH4F 1A04A 2R7DA 4WCGA 2PMUA 3REOA 4G7ZF 1YIOA 2GXBA 3KEOA 5JI6A 4RB3C 2XAGA 2RKHA 1KU9A 1HXDA 2VXZA 2ZKZA 3T1BA 3P7NA 1ZRDA 1OR7A 1ZN2A 2IT0A 2M30A 1T0FA 3KEQA 1DUXC 2K4BA 3KFWX 4PGGA 2UWMA 3DV8A 1XMAA 5HDNA 3MQ0A 5F1RA 1ZRFA 1P2FA 5E1XA 3Q9VA 3WE2A 1ON2A 3IC7A 4E70A 3D5LA 1B9MA 2CG4A 5L3GA 4IJAA 3R6SA 2QENA 1DP7P 2LX9A 1HSTA 3T5XA 5KVRA 2BE5F 3K1NA 4B09A 4HX8A 3HUGA 3LA7A 2VBYA 4ENMA 4HW0A 5FD5A 3RYRA 2YU3A 2HWVA 5D5WB 1IXRC 3C1DA 1O7FA 2H09A 2K5IA 2HYGD 2VT3A 3IKTA 4ENKA 3BWGA 1XCVA 5TJJA 3HRTA 2F5EA 4XSXF 5D4SA 2WV0A 2PJPA 2HTSA 3KZYA 1KYWA 5LHHA 5DD8A 4FX0A 3S2WA 1PUEE 3ROUA 2RV8A 4A6DA 2VE8A 3D0SA 3WODF 3TKYA 2NAZA 1FP1D 1TTYA 1T39A 2EFNA 4RS8A 2RGVA 1RUNA 4O3MA 4Q5SF 1W7PD 3RKYA 2H3JA 4ZYHA 3G3ZA 1UFMA 2KIMA 5BPDA 2K86A 1E2XA 1TW3A 2O61A 2VC0A 1I1GA 3ZMVA 1GXPA 2J5OA 2HZTA 2EJRA 4QLCU 2FSWA 4GYGA 5DUIA 5HOOA 2P4WA 1T38A 5E17F 4DQ2A 2EFQA 2FA5A 2W85A 2Q2EA 3ISPA 4RB1A 4OMZA 1U78A 2YSRA 4XBFA 1IN5A 1JGSA 1XSXA 2H6CA 3WTZA 3JW4A 2V1DA 3LQQA 1BC8C 5LRRA 2YR2A 2L01A 2PN6A 3HTUA 5D8KB 1TNTA 4G7OF 4A2UA 3KLOA 3I53A 4P55A 3WU0A 2ZMEB 3COAC 1KYZA 3KE2A 1FT9A 2CFXA 2L3DA 2ETHA 1T6SA 5ILVA 1W7PA 4BQAA 3V8KA 3QP6A 3ZMSA 5HLGA 1XGSA 2GA1A 5H20A 1OMIA 2L54A 1S7OA 2FBIA 3I4PA 2IA2A 3K1MA 1R22A 2OU2A 3N4MA 4R1HA 1GVJA 3DP7A 3C7JA 2ISYA 3R0JA 3BPXA 2OZ6A 4EM0B 1R00A 3VODA 1S8NA 3C3WA 1CF7A 2W25A 5D6FA 1WWXA 3RKWA 4OIRF 4L9JA 4ESJA 1MZBA 2V79A 4KT5C 4G94A 3VOEA 3WTXC 1J2XA 4ASNA 4M73A 1BI0A 1XD7A 3ZMZA 1HKTA 5E18F 5D5XB 2P8TA 1XDUA 1F1ZA 2J5PA 2XKOA 3N97A 2HQRA 1S6LA 3LA3A 4KNYA 4LG0B 1TNSA 1Z05A 4ZYEA 3FMRA 3DF8A 3WE3A 4AWXB 2DAOA 1MGTA 3GW2A 4GGGA 4UV9A 4OIOF 2O0YA 1R1TA 2A5YB 4EGYA 3LAJA 2O03A 4HLYA 4U0YA 5L3EA 1DPRA 1FBSA 4WXDA 2MLKA 4R8HA 2JSCA 3JAMK 4MHGA 5LGUA 2LKPA 2MD5A 3QPHA 2W57A 2EV6A 3RJPA 3V7SA 5DEQA 5HS7A 3E97A 3GEZA 3ZPLA 4G9YA 1R1UA 2L4MA 2FMLA 5ICGA 4QWQA 1E17A 4HZFA 1SFUA 5IT9K 4S04A 4CICA 1HW5A 1JHHA 2A68F 1LDJA 3QU3A 3F8FA 2HKOA 5EEGA 2RQPA 1XGOA 4M74A 1KU2A 1SMYF 1D5VA 2P7VB 4A6EA 2Z99A 2HR3A 4LFUA 2E7XA 3JAMZ 4LK1F 3GFLA 1J0RA 4CHUA 4ETSA 3GUDA 1T98A 1UCRA 2K7LA 4I01A 1UHMA 4UHTA 3K2ZA 1Z91A 3WTVC 3I0TA 4PGHA 4YIFA 2LF8A 4UV8A 1SD4A 1OPCA 5E1WA 3V8JA 4I98B 3TDZC 1XN7A 1V3FA 2ZFWA 3E19A 2PI0A 2DW4A 3ELKA 3LA2A 5IT9Z 3I64A 4JBAA 4M72A 3WTWC 1Q1HA 2QUFA 1U2WA 1QO0D 4YIIA 2NNNA 3NRVA 3R4KA 2XHKA 5JHUA 4IXAA 1GHCA 1ZG5A 1O3QA 2K27A 4AIHA 2XAJA 4MEYF 4LGWA 1MDMB 4U7DA 2HS5A 3T0YA 1BN5A 3K1PA 1F9NA 2GQQA 1KQ9A 5DUKA 1EV7A 2Q0OA 3M7GA 3QOPA 1QZZA 3BJ6A 1ZYRF 3I58A 2NYXA 3TO9A 2V6CA 4HF0A 2ESNA 1WQ2A 2VODA 4Q48A 3GF2A 2Z3YA 4HF1A 5FFXA 2LF7A 1D3YA 2FBHA 4MQ9F 3E3VA 3FF5A 3GFMA 1ODDA 2FMYA 4CDGA 2XROA 1IXCA 3AAFA 1GXQA 5L3DA 4LB6B 4IRHA 1F4KA 2F5DA 2OQGA 1YQAA 2LNBA 2TDXA 2DPDA 2VBZA 3WTUC 1RI7A 3WGHA 4NQWA 1Z9CA 2HYFA 4KDPA 1OYWA 3T8TA 2STWA 5CLSA 2IJLA 5LEJA 1I1SA 3DQVC 3KP3A 3CJNA 3BJOA 2NS0A 1U5TA 4LLLA 2VBWA 3F8BA 3GO5A 4RB0A 3F23A 4BH9A 2UZKA 4HX7A 3MHXA 1P92A 2FNPA 4CXFA 1I27A 1G6NA 3F8CA 4OU0A 3H3UA 5ERIA 5HLHA 3FXUA 2JRTA 3M8FA 4GYIA 3J81Z 2YX7A 3K0LA 2KIUA 4LMYA 1VTNC 2MBFA 3KP2A 4RGXA 4HX4A 1LNWA 5HDKA 1YS6A 3WTTC 3TQNA 4BYYA 1YTYA 4HBLA 3WGIA 4XLPF 4UVBA 4IHTA 2VE9A 3QP5A 2DLLA 4IHSA 1AOYA 4UUVA 5FGMA 4ZZDA 1USSA 1YS7A 2OQRA 4WK8F 5K5QA 1P4WA 5DCFA 1EH7A 2HFHA 3GXOA 4HAMA 3R60A 3CDHA 2A61A 2WTEA 4BHCA 1L3LA 2HTJA 4G6DA 2RN7A 4A5MA 4RAZA 1S7AA 3BOQA 1PDNC 4L9TA 5K1YA 1P4XA 3VEPA 5JFRA 5HS8A 4EV0A 4AIKA 4Q47A 5E1ZB 4I2OA 1CGPA 3MZHA 5J8CA 2DBBA 4OINF 3RTRA 1JHFA 2FEZA 2FU4A 3SFZA 5HVQC 5BQTA 3EQLF 4L0ZB 4D0PA 2ZBKA 2IPQX 2X0LA 5HDGA 5CYVA 4LJZF 2COMA 1U3EM 2IA1A 1HKSA 3KLNA 1U6GA 2JPCA 1K7AA 1K78A 2DT5A 5J8FA 2DO7A 3P9IA 1QW1A 3DPLC 2ISZA 3HRMA 3ABTA 2PEXA 4I0AA 5CVRA 4O6JA 2EV0A 3ZMTA 3JTHA 4EJVA 2IP2A 5KK1A 3O6BB 5L3FA 3MAJA 1TQMA 2DK5A 4HQMA 5HLIA 1IN8A 1YYVA 3QPTA 3T8RA 3U9GA 3KETA 3KZZA 1G3YA 1UHWA 1REPC 4P9UA 4I02A 2M45A 1QVPA 2O8XA 5D6EA 1USTA 3SZPA 1SD7A 2FOKA 1HSJA 3GZ5A 4KA4A 1G3WA 3RKXA 1FC3A 4P96A 2FXAA 5L3BA 3MWMA 3E6MA 2XGXA 2OZUA 5DCMA 4BHBA 2P5KA 2WWYA 1D8KA 1J75A 1NHAA 3KP5A 1XSDA 2IRFG 3F21A 1ZHFA 2XASA 3CTAA 1RZ4A 5BOXA 2EFPA 1FNNA 5LLQA 2R3SA 3ECHA 1B1BA 1J59A 3IWZA 4IRIA 4OOIA 4HDUA 1TQPA 4AIJA 2DK8A 2DQLA 1XGNA 3HTSB 3F72A 1W7PB 3K69A 2L4AA 4RGRA 4KIFA 1BJAA 1R1VA 2FBKA 2XUBA 3EUHA 3MEXA 1FBUA 4YFKF 1UB9A 4LLNA 2WC2A 1U5TC 3GVAA 2FQ3A 2MC3A 2PMHA 4HV6A 4L5IA 5D8LB 1R36A 3IWFA 4JQFA 5FO5A 4KYWA 1G3TA 2H94A 2E7WA 2XRNA 1R5HA 2R7FA 1IW7F 3TO7A 1H9TA 2G9WA 3HSRA 3O2PE 1ZG3A 1CF7B 2QLZA 2YPRA 1WRJA 1B6AA 4GO1A 3I59A 5JVTA 2P6SA 2HDCA 1G4DA 3DPTA 1LQ1A 1ZLKA 4MGRA 2D45A 2GAUA 1ZRCA 3LWFA 2BBYA 4EJWA 5A2QK 2IA0A 4LB5A 2CW0F 2UXNA 4U0VA 2QYOA 3ERED 3E5UA 4BXUA 4KIBA 5ED4A 1X3UA 2A6EF 1BYMA 3ABUA 2QBYA 4KN4X 5BS6A 1S3JA 4Q4ZF 3L00A 2KIFA 1Z6TA 2CGPA 1B59A 1SMTA 4AD9A 5ILUA 2KKOA 3IRQA 1LVAA 3SQNA 1K6OA 2A6HF 4ESFA 2HQNA 1YG2A 1SD6A 5DD4A 4M71A 2G7UA 3VB2A 1XCBA 4HA8A 3EETA 1J7KA 3F8MA 2QWWA 2EV5A 1ZGJA 3M8EA 4XRFA 2Q8KA 5A2QZ 1SD5A 2XIGA 4PZJA 4HV5A 3H3ZA 1C0WA 5DDGA 1BM9A 1QPMA 2JZYA 1I5ZA 5J6XA 1MJ9A
chains in the Genus database with same CATH superfamily
2X48A 2J6OA 1WLPB 5KNLA 2FB7A 1VQ9A 4CGZA 2M3AA 3M57A 2ZPHB 5BMZA 1OCCH 5TISC 2ELKA 3EGDA 3CPWA 4M7DC 3ER0A 1SRLA 4PFZA 2JK3A 3TQ7P 2ZCWA 4OMLA 3G4SI 5A0DA 4IHXA 4FT2A 2M0OA 4M77G 5M9OA 2P0QA 3JCMd 1PC0A 3V8LA 1HD3A 1OPKA 3LFUA 2Z1DA 2COYA 5KHDA 1LB2A 2ZJ2A 1WXBA 2KT8A 2DMUA 1IB8A 1XOVA 4IF4A 3OIOA 3A0HC 2AXTC 3E5XA 3KX2A 2OAZA 3HYIA 2BY0A 4OIPF 2HMAA 4XTWA 5KYYB 2DODA 2AS5F 2LMDA 4BD3A 1OKRA 2COBA 1OPLA 2W24A 1Q81U 1YWOA 3GWZA 2DQRA 3CCQI 2EFWA 2D5VA 3QWYA 4A54A 3O8VA 4BE0A 5GAOn 1QLYA 3BY6A 1SFEA 1WKMA 2MA3A 2A3LA 3TOBA 4BS9A 2DRKA 4IPAA 2LQ8A 3ULRB 1I3AA 1Z7UA 2BVLA 1BI2A 4BAYA 2ZNZA 1SRMA 4WF2A 4L5EA 4BQOA 1R0BG 3MKLA 4E7KA 4ENNA 1WHLA 4WXCA 3IAS2 3A4CA 1K4TA 3CCSI 2XAHA 1HDDC 2KL4A 1Y8RB 4RGUA 1Y57A 5CJ9A 3G1MA 1YJ9I 3QWLA 5EDNA 4FQGA 1RETA 2XAQA 2EA2A 3L2CA 2EH3A 3SXYA 4FX4A 1OX8A 2MPXC 1Y56A 5F0HA 1QKXA 3KP6A 3P9CA 1IF1A 4L18B 5FRMA 1EH8A 4XR6A 2EVRA 2HQHA 1J5YA 2A07F 2K4YA 5LJ3j 1BIBA 2H27A 1TUCA 1ZUYA 3PNTA 2HVSA 3VV0A 3C0CA 3P8DA 4MNUA 2LX7A 1GXIE 3JB9G 2RNJA 5GAMh 1N75A 5EYRA 3EG2A 4ZYDA 4E7ZA 2EJGA 2E41A 1KD1R 2X1CA 4AYBA 3EFSA 4JRKA 3PFSA 3K70D 1IGNA 2RM4A 3I9V2 5CAIA 5KYUA 3IKVA 4LD5A 3LWHA 3WTYC 1XB4A 1UTIA 4FYVB 1E6GA 1JXMA 3QU6A 1LVKA 3DU6A 1XQHA 3W6JB 1M90R 2QDYB 1MMSA 4L0YB 4CA0A 1WXUA 2CRGA 3G73A 3V7RA 3CF5F 3OYBA 3WVDB 4LIVA 3LSTA 3CUQA 1UJYA 4D8DA 1BBZA 2EYXA 2F5TX 2Y4XA 3W3CA 1OISA 2MH9A 3E0JB 2RA2A 1SFKA 1BU1A 1I3QJ 4KICA 3I4MJ 4OP0A 4JJDA 2JMWA 3GX4X 1YI2T 4X1EA 2A5WA 3BE3A 3LMMA 4M78F 3LH5A 4F7UB 1XSVA 1X1AA 2WA0A 1ZLMA 2X4XA 1QVGA 1MKMA 1KD1U 1RNLA 1FSHA 2PMZN 3C18A 3RKQA 3ZN0A 4A12A 3JSPA 1HDPA 3DEUA 3D7SB 5J4VA 1FPQA 4CCLA 4Y13A 1ZSZB 3H9GA 4RAYA 1GFCA 3H9QA 3HHGA 2DTIA 3CCVT 2JPBA 1M90U 3S2DJ 1XG1A 5EZGA 1F5TA 4FSXA 3HOWJ 2R7ZJ 3S6WA 1VQ5A 2G6FX 2L02A 3KZIC 4DYCA 1C6VX 2KQWA 4XTYA 3C12A 2J7IA 1Y0UA 2W48A 3HOTA 2ID6A 2K5FA 1SFXA 4A0YA 3CCMA 1ZQ3P 3PL8A 2EGAA 4L9VA 4IKFA 2HXOA 5C6SA 2OD5A 5K7HA 1NPPA 3Q1JA 4JLIA 4KISA 2VKHA 2FRHA 3O3KA 4F14A 1O7LA 2R4GA 2XAFA 3QWXX 4C92C 5DYMA 3GOXA 3JRHA 4KFCA 3S1QJ 3CBPA 4M7AD 2LQWA 1JJ2A 4XQFA 1M27C 2W10A 4RCCA 4O5VA 1FMVA 3S3NA 4OWRB 3X24B 4L9NA 2A36A 2CUDA 2W00A 3LL7A 3PSFA 5H6RA 2RJEA 3X2QH 1WPYA 4OB0B 2LYCA 1XJWB 1Z77A 3K4NA 1LE8B 1M1KR 2ZPIB 2L0KA 2C0TA 1BL0A 1B34B 4JDSA 4ELYC 3MCZA 2DFFA 3EDPA 1AHDP 1BR4A 2VT2A 2VQLA 3K9TA 1VQPT 3EUHC 2VC1A 2K7AA 1KFZA 5ILSA 2HXIA 4ZDOA 2CV2A 1QZEA 1JXSA 2KDOA 2FD5A 3NQOA 1QQIA 2K9LA 3RUXA 2DI3A 5GAEJ 2GWRA 5H2FC 3MZYA 3G1LA 5ICFA 5J6XA 1K61A 3KBGA 3M58A 4EMSA 4JS5A 1ZLJA 2BHYA 1VQ8A 1YJNA 1FEXA 5IYDJ 2EZIA 1ZK8A 4UXNA 1XS9A 2BKDN 2L3PA 4RMNA 1TWFJ 4II2A 4EVIA 1Q95G 2BZ8A 4VUBA 2COZA 4XU0A 3TOAA 2M5WA 1HC8A 1VQ6T 2R7RA 5GAMg 4HXJA 3CXCP 1SAXA 1QP2A 2FF4A 3GFIA 3A98A 1WDXA 2FEIA 1K0XA 2HSPA 3C2GA 2ME0A 1NEBA 1ZGWA 3F0CA 5CQEA 2GZWA 4BY7J 2CGHA 3CMAA 4DW6A 5LGTA 1R4MB 1SVOA 3CZ6A 2JMCA 3HRUA 2DFHA 1VF9A 1KA8A 2VBXA 3ZR8X 2O2OA 3QODA 3R6NA 2STTA 2LD5A 4C8QB 4NQWB 3JRZA 7AT1B 1M1KU 4D9JA 3LQRA 4RTTA 2NUTA 2LREA 2CU7A 1O3SA 4GBQA 4FHTA 1IXSB 3DBHB 4G8XA 2YXYA 2B8AA 5A0GA 1OU8A 5F64A 4BBRJ 1UJ0A 1FP2A 1WGXA 3ASNH 1YI2I 3I55T 1KHCA 2A3SA 4PJOC 2GGRA 4HOBA 2E1MB 3U23A 4U0WA 5FFZA 2IGKA 1E3PA 3QRFF 3A0BC 2OPTA 1TWHJ 2C0IA 2L5QA 4C92F 2GA2A 3CCRA 1IUFA 2D2WA 4E4HA 1U5TB 5GMKh 1STZA 2K85A 2UXXA 4GCVA 5CVUA 1W5TA 3QQAA 1H92A 1WNLA 1VQLA 2JT1A 4RGSA 4KRTA 1KQ8A 2Y90A 4N9HA 3TDUC 4UUSA 1VA7A 1KQ2A 1D1CA 3QAHA 2KE9A 1WFWA 3CCVI 2XB0X 4M78G 4HVUA 4EJTA 3RR6A 3JCMV 5HLTA 2VN2A 1FSEA 1UB4A 3VUZA 1N8RR 4XKBA 3SWNC 1ACMB 5IXBA 1WZOA 3OR2C 3CC7A 1FOKA 3BDUA 3CEYA 4RCBA 3WVEB 1T33A 2C6YA 3KXTA 3OYJA 2HKNA 2MD0A 3PFYA 1LEBA 1PD1A 3UKGA 2QEXQ 4ITVA 4UVAA 2DL8A 3M55A 2V9VA 4BJ6C 1MV3A 3RYPA 5AIPA 3TBIA 2DXUA 2P6TA 2CYYA 2P5VA 1X2MA 2M16A 4IUPA 4EMKA 2K9QA 4CO8A 4V2FA 1YHQA 5K7ZA 3EG9A 4HQEA 3F8NA 3FISA 3RESA 3SEZA 3REAB 3BLYA 2NYSA 2L2OA 4JOMA 4D7NA 3K6GA 1PRMC 3MKWB 3JRCA 3B73A 3TGNA 1PWTA 2EQMA 3I5RA 2MSYA 4BDZA 1IN4A 3FXLA 4M9XA 4NBQA 4F7UE 2OV7A 4PCQA 2PQ8A 1IRGA 1BK2A 5FLXE 2Z33A 3F6VA 1VQPI 3E5QA 1RIOH 4HCCA 4C9YA 4KT6A 1G5VA 4XLAA 5IOYA 3RZOJ 2MAMA 4XTXA 3ZQHA 2VKEA 1IHVA 2RK2A 1HBXG 3CD6A 4MTEA 3OYNA 1TL8A 2RDPA 3GYHX 2GCXA 2QQBA 4QQGA 1BI3A 1V4RA 2K02A 1VIFA 2PMZA 1KU3A 1MBKA 2ELHA 2HGCA 1R6RA 4AVPA 1I5OB 2BV6A 3CO7C 2XF6A 4C5IA 5C4JJ 3OA6A 3R6OA 4A3JJ 3ZMDA 4QQDA 1Y7XA 4HLXA 3FBIB 1LEAA 1MJBA 3NWSA 4A0ZA 2OJ2A 2PUKB 1UUEA 5IHNA 1H0MA 5H6QA 3GZNB 4BE1A 3QZ9B 5E20A 4KJZA 4A3BJ 3RQIA 4D8KA 4BY6C 2CV1A 2K5CA 3TMOA 4RA2A 3G4SQ 2V1NA 1SEUA 1RAIB 1FWZA 1FBQA 3QYBA 4PDKA 2K3XA 3SDZA 2CT3A 2PJRA 1NZ9A 3RPUD 2DZCA 2OCCH 4F7ZA 1IN7A 3FMSA 5HNFA 5GAOm 2PNIA 2DOEA 3E6CC 3RI4A 2CUFA 1NEGA 4DOWA 3HPHA 1FX7A 3J7AO 3RIRA 3FJ5A 4V19K 1QP3A 3FB9A 3I55I 4M7DD 4NS5A 2CS3A 3HSFA 2VASA 1L0OC 3DFGA 2NRAC 1VIEA 2BY1A 4IEJA 1SAUA 2EPDA 4LDVA 2CP7A 3BZ6A 3CCQQ 3C2BA 1BR1A 5DV5A 4M6XA 3FIFA 4YG2F 3IHUA 4EQQA 2HEOA 2F2EA 5EF6A 3G4ST 1ZG1A 2GM4A 3LSMA 4MZMA 2LBFB 4XKWA 2GIZA 3AG3H 3PO2J 1I81A 1BC7C 4ENJA 1R7JA 3CQTA 3E6BA 3OS5A 3L1AA 5FKMA 3I5UA 3I71A 3WHBA 4WX9A 4BACA 1YJ9Q 5HS9A 1S29A 4EJOA 4EMKB 3VFZA 4M4ZA 5HK0A 3FKIJ 3PNVA 4LN2A 4Z88A 1X2NA 5LJ5h 5JR3A 1ETVA 3TP3A 4DBRA 2HZYA 2BXYA 3JB9I 2EWNA 2DJQA 2XDVA 3IL2A 3GLXA 2PLYA 3HOSA 4Y91A 3PUBA 1WI9A 1WHKA 1FMWA 9ANTA 4PJNA 1WH7A 4JJCA 4RTXA 3FXOA 2EZLA 3KEYA 3FM5A 3RDIA 2EBIA 1K9AA 2KJCA 4E7JA 5M5XJ 1IUYA 1RAFB 2DVJA 2XG8D 2EB7A 1Q82C 1Q7YC 4J00A 2QQAA 4UNOA 4C8QE 5GAMj 5IN1A 2XDDA 2FNAA 4KUMA 4I76A 4M9SA 4N4GA 3KP7A 2M02A 1HW1A 2E6NA 4N4IA 4MMKA 4CZZA 1MMAA 3BR1A 2EQIA 1V1CA 4D1QA 4J19A 1RPWA 1ORKA 5LHGA 1QA6A 1H9GA 1XX5A 2EK5A 3CF2A 4HEA2 2HDWA 3ABMH 1IZ1A 1TQIA 5I22A 3E9GA 4MEXF 2DXCA 2ZSIB 3LSGA 3JB9H 3HM5A 3RPUA 3Q5FA 3P8HA 3PNYA 1HKQA 1U8BA 3M0PA 1HW2A 3FZVA 2QK0A 2CZ6B 2FL7A 3BR0A 1EX4A 3JCMf 3TW6A 1LDDA 4A5NA 2GBQA 2PG4A 4I0BA 2ZMEA 1AVZC 3RNJA 2L9RA 2ZXJA 1Z0XA 2Y30A 5M5YJ 1TLHB 1ZR4A 1XMXA 1V5EA 2XKPA 1I6XA 5AONA 1XTDA 1ON1A 2RN8A 2VXFA 3RPQA 4AFQC 2VGMA 2X3XD 4FL6A 1LFPA 3PT9A 4EM1A 1HYOA 3WU1B 1ZGAA 3CQZJ 1ZREA 2KSSA 3NPFA 2PFBA 1MMDA 3BY7A 3CJTB 1K78B 2AXLA 1VQMA 3E1SA 5D6WA 3EH2A 5IP7J 2OCEA 2K5LA 4QPQA 4BEHA 2WAQA 2COWA 1VQOA 2E5ZA 3K10A 4P1WA 4NHJA 5EG0B 4RB2C 2E1CA 3LSKA 3OOPA 2MWOA 3QZ5B 1YX5A 2B0LA 4JK1X 4B6MA 3CUQC 1WQ7A 2TRTA 1NK2P 5LL6S 1WIEA 5HKCA 1YW9A 2PVDB 3NARA 2K4JA 2XPUA 3TEDA 4BI3A 1J9IA 3WG7H 3CUOA 2XGDA 2D8HA 4L5JA 2HOEA 3V7CA 5CVJA 2NVQJ 1FYNA 5LFAA 2FO0A 5GAN8 4QTRA 4AM3A 3THKA 1T0HA 5GAOq 2P4RA 3G71A 3FM3A 4JYKA 3FWEA 2F5CA 1JE8A 2XV4S 4MTDA 4P5OA 3PIOF 5BPIA 1F36A 1R5ID 5J4YA 5GMKi 1YO5C 2DJNA 1A31A 1K1ZA 1M2OA 3HGYA 2JOYA 8AT1B 2OC6A 2KRMA 2K9SA 3HRSA 4X0GA 4OIQF 2JUCA 1PP8F 2VOPA 4KN7X 2ESHA 1PP7U 3MKYB 2D1HA 1YIJI 4KGZB 2GLOA 3L09A 1P4AA 5LGNA 2DDBA 5GAN3 3M54A 4S05A 4F7UF 2P5LC 1XGMA 5GADJ 1ZBXA 5LJ5g 4B48A 1VQKT 1K8AC 4ZDPA 5FD6A 5C4XJ 1YW7A 1ERDA 1V5GA 2V1XA 2Z9OA 2AHJB 5HY6A 3W2AA 4AFUC 1JUMA 2LY1A 2QYZA 1ZH5A 5LJ3d 3ZQ7A 3L7WA 3OY9A 1Z1DA 2XRLA 4XLNF 1WHHA 2EYYA 2GXGA 4A4FA 3HB9A 5F6FA 1IRFA 3VYTB 2KT0A 5IHIA 3WHCA 2E6ZA 2PBIA 3BP8A 3CC4A 2X4HA 1BIAA 3BZCA 1U5SA 1ZA1B 4M7AA 1OLTA 4J6YA 1QPIA 4UVCA 2RC4A 2EYWA 5CKFA 2WAFA 3M1EA 1VYUA 2XGEA 1YLFA 4NC8A 3L2RA 1W0TA 1FYKA 1ZAOA 4G6TB 2XK0A 1FYLA 4YTLA 3S32A 3G1OA 4XICA 1UFFA 5IOZA 4J9GA 2AKKA 2P4TA 3INZA 4G6QA 4QPOA 2ZNYA 1F1BB 2EJFA 2VPRA 1X2KA 2GOXB 4C2TA 5DCMB 2J6FA 5DLOA 1GV2A 2M8EA 2VUMJ 2I2LA 3GIBA 3FKJA 4LOCA 4G7HF 4K2EA 1YFHA 3K4LA 2MIOA 5F27A 2KZGA 4EGZA 4LG0A 4E7IA 3J80K 3BDLA 3HZJA 2VONA 4N4HA 2NNYA 2QEXT 3HHHA 1Y8QB 5FLVA 2KRHA 3QSUA 1IHWA 1YI2Q 3H0IA 2E5QA 1ZR2A 2DU9A 4XLCA 4M3GA 1HCRA 3GTOJ 3FRNA 4RUGA 3B02A 3CCUT 2NVXJ 3QJ6A 4DBQA 3M8JA 5GMKj 3H36A 4JRQA 1OEBA 5CKEA 1GL5A 3WTSC 1YN8A 4MDWA 4ABZA 3F70A 1Z7LA 2R7QA 1ZUKA 1OULA 2F2WA 1ZTRA 4Y92A 3QXEB 1HF0A 3VU3C 3ECOA 4C92B 3NFCA 2GIVA 3MZ8A 3P9KA 1O3RA 3KYCB 1O75A 3CCVQ 2XAUA 4LE9A 2F5FA 4DZPA 2E5KA 1FY7A 3KP4A 4IHWA 2CO5A 4PJLA 3H0FA 1Z3YA 2YRDA 4Y15A 4TVRA 1QVFS 3JRFA 1G2HA 3IRRA 4MDXA 2W0ZA 3OW2S 3M9QA 5KYXB 5EEAA 1MMGA 3U1DA 3ZP5A 1C0MA 1NM7A 3H6ZA 1K83J 4RM2A 3SZTA 1A36A 2FE3A 5CQXA 1W1WE 1SPKA 2MLGA 2V9KA 2O9SA 3QYHB 4X1VA 2DFIA 3CMMA 5TGTA 1GCPA 2GQVA 2ZCFB 3LLRA 3G4SA 1KG1A 1PKTA 2BYVE 3ZRGA 4C8QF 1DDNA 2OA4A 4OMOA 5FKLA 4EDUA 5LJ3e 4FT8A 4R56A 1GT0C 3VPRA 1NJIC 1A5JA 2QM3A 4A63B 2OJED 4U7BA 3PFIA 3RBBB 1W1FA 4EM2A 2GNCA 2B9SA 2AQFA 3FHZA 3JSOA 1LKXA 3ZN1A 2KRCA 1RR8C 2DCEA 1AHJB 3MD2A 1ONVA 2A69F 3O8HA 1NK3P 4J9DA 2M9UA 4OVAA 4H0EA 3SEQA 4P9FA 1G3SA 2LDUA 1R58A 2LOOA 1X1BA 2ADUA 5FKNA 4B1RA 5FB2A 4HDVA 1FLIA 1U9NA 2Y2ZA 3U2RA 3AG4H 1VQKI 1O57A 4LD6A 2IBDA 1H8KA 3PM1A 2JS2A 2NOJB 2VYTA 4GXOA 3VDXA 1X1PA 3F3XA 1YRNB 3LFKA 5AIQA 1KSWA 2HCKA 2AO9A 3HSBA 2ZFUA 3W6VA 2X6OA 3J80Z 3CCSA 5E3NA 3DKXA 4F3QA 2ACJA 1YJ9A 1QNTA 2TCTA 1WI7A 1EH6A 3M9AA 1FOWA 5B1AH 2EQRA 4F7UG 4EMKC 4Z2YA 1U1TA 4R79A 3I59B 2LVSA 2EZHA 1MJAA 2Y69H 2DK3A 4HYEA 5ICCA 1PUFB 4PJOB 2QZ8A 4B8XA 1KQ0A 1X6GA 4M75D 3CPWS 2VB6A 4MIMA 3CO6C 3WU2C 2DE0X 2E1NA 2YRCA 5LEKA 2ECZA 3ML6A 1FZPB 1ZX6A 3BDDA 5J3BA 4CCOA 3E6DA 1VYTA 2M87A 2CP6A 1A6IA 1SG5A 1HQCA 3EYIA 1BB9A 2L3RA 1X19A 4JX6A 3K4MA 2DA7A 4JP0A 1NE8A 4C0ZA 1QVFA 3OW2A 2QEXI 1KC8C 1K79A 4Y3OA 2V8JA 4M6YA 3I55Q 3FXRA 2CJJA 3LYIA 3SWNB 3I54A 2KXDA 1D8JA 3GMEA 1IJWC 2OTJI 3CCUI 4BDYA 2CP0A 2KLOA 4N0BA 4M9ZA 1IAWA 2JTVA 2YUPA 1WSUA 1KU7A 2R5YB 1CQTA 4OMYA 4C5GA 2NXNB 2DJZA 4EJUA 2VJJA 1Z21A 2HKXA 2V6EA 4P5NA 5CVVA 2QBYB 2BZTA 4KH1B 1ZKGA 3ZMUA 5I21A 2MWPA 1AA7A 2EAYA 1S72T 5CPRB 3PUFA 2HDDA 2MF2A 4BHPA 4RTZA 3QOEA 3FK7A 2ZPBB 3HSEA 3M0RA 4XRSG 3PQJA 3LGLA 6AT1B 2P81A 3ASOH 4MQVA 3QPSA 1VQNQ 1LPLA 2YT6A 1BBYA 4EMHA 2BE7D 3OV8A 4YFXF 3JSCA 3J7AY 4Y17A 1ULYA 1WHJA 1SVMA 2DXBA 3ME9A 1I0CA 4ZGJB 1Q81C 1B9NA 3QBYA 5FU7C 3BCBA 4M3DA 3L42A 3MJXA 3OYEA 1BI1A 3HJEA 4KT0E 4OMNA 1K9MR 3JCMh 2OBPA 2BE9B 2LSOA 2F48A 1R49A 2DL5A 4XTUA 2DILA 6PAXA 2CWEA 3E9FA 4ZYGA 4NB5A 4TV7A 2YUNA 4FU6A 4M75A 4RLQA 2YHTA 5IT3A 1R23A 3FMQA 2EIMH 2AHQA 4I7HA 4QSHA 1FYMA 1LDKB 1PCXA 2I8DA 3MPUB 4BNCA 4RTYA 1I50J 2K2VA 2ZSHB 2JA5J 1DPUA 2JXBA 1M2VA 1IO2A 1YWPA 3CC2Q 3AKZA 2HDAA 1OCPA 2MGQA 2EIKH 2VVKA 1X3WB 1AWJA 2F2VA 2L3QA 2NUPB 4C8QG 1B4AA 4WWCA 4BY6B 2FRWA 1B72B 2HAXA 1OYIA 2EYZA 1E7OA 2QG9B 1XC5A 2H8RA 2KMUA 1TBXA 4C92E 3SHFA 5FLXK 2DTRA 3HTRA 2OTLA 3F6OA 2KGTA 1IDZA 3BCAA 1FTTA 4KBMB 3PQKA 3CDLA 4ESBA 3F22A 1YCSB 5CVIA 1SFOJ 4BUGA 3QYGB 2D9TA 4DOVA 4ELZC 4X6AJ 3ONQA 2F4OB 1TW2A 4XSZF 4UB6C 1QVGS 2QQ8A 2RVCA 1XMKA 2DMTA 3BPVA 3R0AA 1AKHA 3OMGA 1Z6RA 2Y75A 5CK9A 2K40A 1MDMA 4FT4A 4FW1A 5LHIA 4PJ0C 1XDSA 1GFDA 1P7IA 2QTXA 3ZL7C 4KGXB 2R7SA 1O3TA 1N9RA 1YX3A 3LSRA 3MFKA 4QVZA 1R5GA 3SB2A 4EATA 3EGDB 2E4HA 1D1BA 1QBJA 4L6V5 3QIIA 2J05A 2L3SA 5E8GA 1GVDA 2R0QC 2NLUA 3OS2A 3BTJA 4WXHA 3W6KB 4N0AA 2C06A 1YITQ 1W2BA 2ZMEC 2B63J 1LJ9A 2O6GE 2QDLA 4YFNF 3REBB 1TWBA 1NG2A 4BE2A 1W5SA 3OYDA 1JJ2S 1S72I 3HDDA 2SRCA 5I2MA 5D5VB 4CCKA 5C0MA 4Z8AA 2O9VA 3DKMA 1BOAA 1AWCA 2Y0SA 2H6BA 4BU2A 3M4OJ 1UECA 2AZSA 3J80E 3UDCA 1FXXA 1UHCA 4M6VA 1YI2A 1M90C 5LBQA 5HNHA 1YIJQ 4PJOE 2MMPA 1QZYA 3OYKA 1RABB 3DTIA 3DXJF 3LAPA 3GZ6A 3H92A 5L3CA 3Q9SA 1ABQA 5EEHA 5ICEA 3EAEA 1C1AA 2MFZA 2ME6A 1UDLA 3CPFA 1Y96A 4M3FA 1RRJA 2FPDA 5GPAA 2EIFA 3CCJQ 4PJJA 4ZZLA 1YFNA 2CKKA 2RJDA 2V1UA 3RQ4A 2ZO4A 4LIUA 2AKLA 1R77A 2M1BA 3CLOA 3UA7A 1H3ZA 5FLXZ 1RUOA 2G7HA 3DKWA 2K3YA 1MD0A 1WXTA 2XVCA 3GFJA 1FJLA 3ZBDA 3CCVA 2P7CB 2MH2A 3WGGA 2DPUA 3JCUC 2VOOA 5GAMd 1RI9A 3JB9J 1D0XA 4IVNA 2ENMA 1ZARA 4Y4RA 1AD5A 2DPPB 1VNDA 2DETA 4N9IA 2W84A 5TRDA 3GTPJ 3DLMA 3JCMg 2LH9A 4I09A 5E3MA 3BJAA 1EIFA 2DJIA 4F52A 4KIGA 1VQ4Q 3MP8A 4A0XA 4B9XA 4LG3A 4ZJZA 3KCCA 3JTGA 3DLLF 1D3BA 5JVGF 2DD5A 2BZXA 4M77D 3OYFA 3R61A 3VYSB 2MW8A 2DF6A 4F17A 2DN0A 2IW5A 1W4MA 4LK0F 5J3LA 3L2VA 2CQKA 2R5AA 3EHRA 3FDRA 2BHZA 5KYUB 1QCOA 5GANj 3FXQA 1D0ZA 2Y9ZA 1T2KA 9ATCB 2E10A 4U88A 4J9IA 1BA5A 1U8RA 1B3QA 3S93A 4JRIA 3DPUA 3V4GA 2YX4A 3HIFA 2HL3A 2OF7A 5BNGA 2QVOA 2KY9A 2XPWA 4KMUX 1B8IA 3LSIA 2YWWA 1RKWA 3CUQB 4HF2A 1APLC 4N4OB 5D5UB 3JB9D 3NEUA 1JQQA 2KRFA 1WJRA 4M7AC 1VQPA 2L7MP 3H8ZA 4LLGF 1IN6A 1ZELA 1YW8A 3BROA 5K5OA 1U1SA 3J81K 1TZLA 3M3YJ 3PE0A 1ARKA 2L7ZA 2Z5UA 3HHTB 2K57A 3G6ET 2E70A 2VJIA 2JS0A 2O3FA 5LRSA 2P0KA 1BW5A 2P0PA 5K5RA 3CMET 3H5NA 1M1KC 2D1VA 1UJ8A 3L9FA 3TO6A 2DIQA 2BEOA 4M77A 3DCFA 3WG9A 4PSWA 3TP0A 5E8IA 1X01A 4J7IA 2QQ9A 4DNCA 3A8LB 1RESA 2IVMA 2JA7J 4CCMA 1VQ6A 3S15J 1VFCA 3GNGA 1LUJB 2EYQA 2JSPA 4IQ4A 2E2HJ 4LDWA 2YUSA 3VS4A 3NMZC 4CYDA 3H0HA 4IRGA 2BZYA 1EF4A 3NTHA 4D5CA 1P6RA 3PJRA 1W4SA 4RMOA 2BGCA 5LJ3f 3A01A 2Y0MA 4KMFA 4BB7A 2D0NA 4ATOA 3VS5A 3VRYA 1X4OA 3K4KA 2XF5A 1OYYA 2CSOA 2EA4A 4ON0A 2Y48A 1WJBA 4HT9A 1WJEA 2M0MA 2CZ7B 2Y4YA 3ULQB 2EFOA 3EYYA 1X6OA 2JA8J 3VS0A 2LC2A 3I55A 1MH3A 1N6AA 3SYTA 1G8XA 5GAMe 2KJBA 5D4RA 1QGPA 1Q82U 2K9MA 2E2JJ 3FX3A 5F0FA 4B43A 2CZ1B 4ZH4F 2E64A 3OIQA 1A04A 3ZQCA 2DMQA 1MV0B 2M9HA 3K4CA 2LNHB 2E12A 1WGSA 4OMPA 1VQKQ 2R7DA 4WCGA 2PMUA 4J9FA 3SEMA 3REOA 4G7ZF 3OYAA 1YIOA 4XL9A 2GXBA 4HT8A 1K6YA 3KEOA 5JI6A 5M5WJ 2ID3A 2DBKA 2E35A 4RB3C 2DOFA 1X6BA 2XAGA 3H5AA 3K2AA 3HFNA 3HPWA 3GP8A 1WJQA 2DYRH 1UMQA 2B7EA 2RKHA 1KU9A 1EFNA 5IH2A 3EFOA 2WADA 3M5AA 2DBMA 4RM3A 2QA4A 2ZJQF 3JV3A 2XSDC 2SEMA 3S3MA 1VYVA 1HXDA 2DRMA 2VXZA 3GTJJ 1TU0B 5IT9E 3ESWB 4CCJA 3LX7A 2ZKZA 3NWTA 2CP2A 3L2ZA 4YELA 2RQVA 2X4WA 2HNIA 4MMLA 2LQKA 3CMAT 3T1BA 3JB9F 2EKHA 3HXLA 3P7NA 2RI3A 3VS3A 1ZRDA 1OR7A 3SHWA 1ZN2A 3TW7A 1VQNT 2DVEA 2M51A 4IL6C 1NLOC 5F08A 3MCAB 2FZCB 4GY5A 2IT0A 3ERMA 2M30A 2JVVA 1T0FA 3KEQA 1DUXC 2LKXA 2K4BA 4NUBA 4RKUE 3KFWX 4BI4A 4CC3A 3CCUQ 2JWTA 1UHSA 2QKLB 3VYRB 3H0DA 2ZJRF 1UGQB 2DA9A 2NUTB 2WACA 2VJ4A 4PGGA 1A0NB 2RAEA 2UWMA 2PX9A 3DV8A 3H5RA 1JUSA 2NVTJ 1XMAA 1WPKA 5HDNA 1V29B 2HBPA 3MQ0A 5GAN6 4Y28E 2JM8A 5F1RA 1ZRFA 1P2FA 4DOZA 3BQYA 3CXCA 5E1XA 3G6EI 2K9NA 3RSNA 4C0DC 3J7AF 1LPQA 3CC2T 2Z16A 3Q9VA 1ON2A 2DA2A 5B1BH 3WE2A 3CMEI 1TTHB 1H8AC 3NHNA 3IC7A 4M3BA 4E70A 1N8RU 3D5LA 1B9MA 2CG4A 1K76A 4UUSB 5L3GA 4ZTJA 4IJAA 2A08A 3R6SA 5KE2A 3CCLT 2QENA 1DP7P 3PGGA 4JPBW 4AFZC 1VQ7Q 4PJOF 2D0QB 3HOZJ 3EFRA 2LX9A 1MSFC 1HSTA 3T5XA 1I4K1 3PIPF 3ABKH 2NWMA 2LRDA 5GAN4 2LKSA 2ZXIA 5KVRA 2YLBA 2KQRA 4F92B 1JKPC 2BE5F 3K1NA 2D1XA 2K6DA 2PU9B 3ZCOA 4B09A 1R9TJ 1YJWQ 2R5MA 3M0SA 2DD4A 3WXMB 2E1OA 1WHGA 4Z02A 4CC4B 2X9DA 2W1OA 2M8GX 4HX8A 3HUGA 3LA7A 2VBYA 2M7AA 5C3EJ 1GUUA 4ENMA 2DFEA 1W36D 3P5JA 2E71A 2M7BA 4C30A 4HW0A 4F93B 5FD5A 5IYCJ 1UAAA 1M3CA 1QCFA 1T95A 2YU3A 3AG1H 3RYRA 2HVRA 3DTEA 3Q0UA 2HWVA 1TS9A 3EG9B 5D5WB 1IXRC 5FROA 2RK1A 4I6ZA 3EH1A 3LH0A 4OB2B 3C1DA 1JKRC 4PUSA 4M78D 1O7FA 2Y9YA 2H09A 3H1CA 2DXIA 3U21A 1M1FA 2K5IA 3A2KA 2HYGD 2VT3A 4ZNXA 2RQQA 3IKTA 3I56T 1VZ0A 4ENKA 4J9BA 3BWGA 2DYBA 1XCVA 4WTOB 5EJCA 3DWLE 1YITT 1ETOA 4R55A 1S1NA 2X1DA 5TJJA 4RAGA 4ZTFA 1U9OA 2LCCA 3HRTA 2F5EA 4XSXF 5KAFC 5D4SA 1N78A 4BQNA 4QT7A 1AOJA 4J9EA 3HKSA 2WV0A 2PJPA 2HTSA 3KZYA 2RQWA 4M75C 3OYMA 1KYWA 1P9QC 5GAN5 5LHHA 2X6XA 5DD8A 3CMAI 4BXXJ 2GOMA 4C92G 4FX0A 2CSIA 3S2WA 1PUEE 2LMJA 2CQ7A 2VKNA 3QYFA 2DMNA 3CBOA 1VQNI 5GMKe 1YIJT 2HBWA 4J8OA 1Y0NA 2GFAA 4A3GJ 3S1NJ 4OAYA 3H35A 2VLAA 1JBMA 3ROUA 8ATCB 3CCJT 2EGEA 5FU6C 2O4XA 2RV8A 4XLEA 1LFUP 2PJRB 5HCKA 4DEYA 2JM9A 2O31A 3CCEQ 4A6DA 2VE8A 2R7WA 3D0SA 2W7NA 2A28A 3ZQIA 2ED1A 1UEBA 2ZPFB 3JCMc 3URGA 3DTKA 3WODF 5FU7B 1S72Q 3TKYA 2NAZA 1VI0A 3F9KA 1VQLI 2DIGA 1FP1D 1TTYA 3OSFA 1VUBA 2LTOA 1LOJA 1T39A 2V1RA 2ZAEA 2EFNA 2ZPEB 4RS8A 4WCIA 2RGVA 2L9SA 4HSRA 5B5EC 1RUNA 4O3MA 1T0JA 3IQLA 3CMEQ 3CC2I 4E7LA 4Q5SF 3HOXJ 4IZZA 2VWFA 3BR3A 1PM3A 4D6WA 1Q82R 1W7PD 1QVUA 1RKTA 2I10A 3RKYA 2H3JA 1DQUA 4ZYHA 2E1HA 2H8HA 2XHCA 4JRPA 3CCLI 3G3ZA 1UFMA 2Z0WA 4AFSC 2KIMA 5BPDA 2K86A 1I8FA 1E2XA 2A0FB 2ZPGB 4M78A 4F55A 1TW3A 2LLKA 5J40A 2O61A 3EHQA 2VC0A 5A0LA 1I1GA 3ZMVA 4M7DA 1GXPA 1HA8A 2J5OA 1SHGA 2HZTA 4QVCA 1B7TA 2YU9J 2YUQA 2EJRA 4B3XA 4QLCU 4N0AC 2R5ZA 2QGFB 2X4YA 4J9CA 3J81E 1YE9A 2FSWA 4GYGA 4BL0B 4OMMA 2E19A 2HD0A 4HNVA 1OV3A 5DUIA 5HOOA 1QWFA 2L2PA 1OOTA 4KUIA 4C0GA 4PJOG 3QHSA 2CUBA 3CLQA 2P4WA 1T38A 2DNUA 5E17F 2OI3A 1YCYA 3OSVA 1DU0A 2YSQA 4DQ2A 2LY9A 2EFQA 5I11A 4XN3A 4HCKA 1N9SA 5D6XA 4PFPA 2FA5A 1QVTA 1IV8A 2W85A 3H3VK 4HSTA 4ORZA 2Q2EA 3V42A 1IRZA 2H3EB 2QAZA 4C92D 3ISPA 4RB1A 2E2IJ 2O7OA 4OMZA 1Q86R 4LITA 3I56I 4L59A 1U78A 4B47A 2YSRA 4XBFA 2RQTA 1IN5A 3OSSC 2EIJH 2L89A 1JGSA 1XSXA 2H6CA 3WTZA 3JW4A 3HL2A 3PSIA 2NS8A 1D09B 2V1DA 1YITI 2FHDA 2PUOB 2NS7A 3LQQA 4UUTA 1D0YA 5J1YA 3AL0C 1BC8C 3FC3A 5LRRA 2YR2A 3G2BA 2ZC2A 2L01A 2PN6A 3CJRB 3HTUA 5D8KB 3OQ5A 1AZEA 1TNTA 4G7OF 4A2UA 4A3FJ 3KLOA 2X85A 3FK6A 3I53A 4P55A 1KONA 3WU0A 3BTCA 3PVQA 2ZMEB 4BXFA 4L5GA 1VQ9Q 5GAOr 1V5FA 3OIPA 1JO8A 2J06A 3COAC 1KYZA 4RG8A 1QHGA 3KE2A 4XAXB 2CT4A 2DOAA 5LJ3h 1WI3A 1FT9A 2CFXA 2C0OA 2L3DA 4A3KJ 2ETHA 2BTTA 5IAYA 1T6SA 5ILVA 4CSWA 1W7PA 4CYCA 4BQAA 1VQOT 2CV0A 2LY2A 3QP6A 3V8KA 3ZMSA 2VPLA 1MGQA 5EG2A 4A69C 4GLMA 3VSKA 1RI0A 1QQJA 2MCNA 3TVTA 5HLGA 3L2WA 2HL5C 5L23A 2OX7A 3EG3A 1Q86U 3CCJI 1XGSA 2GA1A 3LOCA 5H20A 1OMIA 4BEHB 4CUGA 2L54A 1ZQ1A 2MYSA 2O01E 5LJ5e 1S7EA 3G1JA 2ZXHA 2DYSH 1S7OA 4FM4B 1AU7A 2KK4A 2FBIA 3I4PA 3T9NA 3TEEA 1WQWA 5EGOA 2F4MB 3GLLA 2CSQA 2DL7A 3META 2IA2A 2EPFA 2DERA 3K1MA 1R22A 4AG1C 1UGSB 3EG0A 4IUTA 3K70C 1VQ4I 2OU2A 1V55H 4PK4A 2IAIA 3N4MA 1HOMA 1K8AR 3A5ZB 2QEXA 1P7JA 4LD9K 4R1HA 3BG7A 5GAMf 4PJOD 2PTKA 1GVJA 1WJAA 1POGA 2QSHX 2DL4A 4EMGA 2E5NA 3DP7A 3BTIA 3C7JA 2KDZA 2XIDA 2ISYA 4IURA 2D8JA 4BJTA 2DM1A 3CCUA 1WJDA 3R0JA 4XM3A 2RHZA 2CW8A 3BPXA 2OZ6A 4EM0B 2XU8A 3DBRB 1R00A 3MN2A 1N25A 1S8NA 3C3WA 3VODA 4M77C 1CF7A 2KVQG 2VQGA 2LZ6B 2DA6A 2E3HA 5KCHA 2W25A 4IIOA 3RZDJ 1IV6A 3VS1A 1K73R 5D6FA 4DYQA 3K4BA 2A37A 3MVPA 3QUIA 2OTJT 3IP4B 2MK5A 1WWXA 3CP8A 3HKZN 2CQQA 4FTHA 2G3RA 1IGQA 4CRIA 3RKWA 4ESRA 4FASD 4XMYA 1Y71A 4HKEA 4OIRF 4XKCA 4L9JA 1CKAA 4ESJA 1MZBA 2V79A 2WSFE 4KT5C 1K8AU 4G94A 1RLPC 2WBMA 1IZ6A 1IXDA 3VOEA 1RAAB 1RL2A 3QKJA 4M7AB 1GBRA 3WTXC 1J2XA 3S2HJ 4BBSJ 2GTOA 4ASNA 4M73A 2PZ1A 1BI0A 5J26A 1XD7A 1Z9ZA 3ZMZA 2P0WA 2OAUA 3C94A 5CR2A 3HGGA 1HKTA 5E18F 4PFOA 4MO7A 4B3AA 1QMCA 2DLPA 3FLGA 5D5XB 4IQJA 1VQ7T 1W5CC 3CCYA 2ZXWH 1Y1VJ 1WX6A 2DO3A 3HFOA 4XNFA 5GANd 2P8TA 1XDUA 3JCMX 2HQAA 1F1ZA 2J5PA 1XNIA 2KI7A 2A7YA 1MBFA 2XKOA 2RO0A 4RTWA 3N97A 3EGXA 3IAM2 2JW4A 2RI5A 2HQRA 1K73U 2W4SA 1XTAA 1S6LA 3AFHA 2HU9A 3LA3A 3SFIA 1ETXA 5B3SH 4KNYA 4LG0B 2VC8A 1TNSA 4UY8I 2KHMA 1Z05A 4ZYEA 4E2FB 3FMRA 3H9JA 3DF8A 3WE3A 3SFMA 4AWXB 2AIRB 2DAOA 2JUFA 4BGDA 1MGTA 3GW2A 3BT9A 4GGGA 3G6EQ 4MZPA 1HJDA 4UV9A 3UA6A 2X6YA 1VQOI 4OIOF 3CCQA 2O0YA 1R1TA 2YUOA 1Y07A 4HCBA 4DYRA 2V8KA 5LJ3g 1E6HA 1NG6A 2FUG2 2M0CA 1OR7C 3D5SC 1AT1B 1ZHIA 2MOXA 3M59A 2GQIA 4DBFA 2A5YB 2XSJC 2QTVA 3MEVA 4EGYA 3PMIA 4AT1B 3CCMQ 1M8MA 2H8WA 2M34A 2O03A 3LAJA 4U0YA 2QGUA 4HLYA 1OQKA 2RQRA 2WV1A 5L3EA 1DPRA 4FETA 1T0FC 3ZQFA 2KYBA 3IH4A 5KYWA 2WSEE 1FBSA 4WXDA 2HSEB 2CQXA 4AYBN 5FJ8J 1DP3A 2VUBA 2JMAA 3TU4K 1AWOA 3JRBA 2DAQA 2MLKA 2XC7A 1ACIA 4R8HA 2K79A 2VXEA 2KP6A 3DBLB 2JSCA 3EUAA 3JAMK 5DTDA 5FRNA 2R57A 3DB3A 2H1LA 2R93J 4MHGA 3H41A 3OS1A 1E0EA 5LGUA 4HNUA 1QCNA 4M7DE 2LKPA 4N4NB 1KQSP 2E34A 2CH4A 2ZB9A 1JB0E 2MD5A 2BW3A 3QPHA 3LW5E 2GFUA 2W57A 1S72A 3CPWP 2EV6A 3N05A 3M1CA 3RJPA 3V7SA 5DEQA 2V26A 5HS7A 3B6AA 3LSPA 3M0TA 4AUXA 1TWAJ 4DIQA 3HOYJ 3TSZA 2ICWG 1JT6A 3CCET 3E97A 3S1MJ 4HPQA 1JI8A 1Z9QA 2QXFA 3GEZA 3UR3C 3ZPLA 5GANe 3OBWA 3L2QA 1UG0A 1EZZB 1OX9A 4G9YA 5KCMA 5JLXA 2RB6A 3A1PA 2DEQA 1RUWA 4RG2A 5DLQE 1R1UA 2L4MA 3AT1B 5LJ5j 3BR2A 1Y1WJ 1T8IA 1MW7A 1T08B 3CMAQ 4OAZA 3VRZA 4XU2A 4GLKA 2FMLA 5ICGA 3FDYA 4QWQA 1E17A 4HZFA 1SFUA 5IT9K 1VQ7I 4C0DB 1U3OA 4S04A 4DEXA 4CICA 1HW5A 1JHHA 4RAFA 1G83A 4JLGA 2A68F 1R4NB 1LDJA 2DFUA 1W2BS 5CQGA 2NVUB 4K11A 3QU3A 3UT1A 3C4SA 4JX5A 3O8GA 3F8FA 1YJWI 4FYWB 2RD1A 2HKOA 2FPEA 5EEGA 2RQPA 5KYYA 3HPGA 1ZA2B 3CCRQ 1XGOA 3JCMP 4XORA 3C2HA 4M74A 1KU2A 1SMYF 2LR8A 1MMNA 2P7VB 5FKOA 1J09A 2CUZA 1D5VA 3QJYA 2X1EA 4QKUA 1VQLQ 3J7YJ 3UWNA 3JCMQ 4A6EA 3J7ZI 2CREA 3VYGA 2Z99A 3KYLA 5LD2C 2HR3A 4LFUA 4IO9F 1RAEB 1X2QA 2XGCA 3CMYA 2E7XA 1BR2A 5GAHJ 3JAMZ 4LK1F 3LGFA 2JTFA 4OF1A 3GFLA 3CCLQ 1J0RA 4CHUA 2L8DA 4XIDA 5F0CA 3GUDA 1T98A 1UCRA 2RREA 4ETSA 2K7LA 3H0GJ 3GTKJ 2K3FA 1TOVA 3OL3A 1WHMA 2FPFA 3KIOA 5GAN2 2IGMA 2EILH 4I01A 1MNMC 4HVWA 3S8PA 1UHMA 3OR1C 3BR6A 3K2ZA 4UHTA 3W2WA 4BUPA 4Y52J 1Z91A 2OUMA 5GTIC 3WTVC 1OQYA 1BCOA 1NLPC 4XTVA 2D6FA 4M7AE 4FW2A 3I0TA 4PGHA 4YIFA 1V76A 4II3A 1MSEC 2LF8A 5DS9A 1K9MU 3HBLA 4UV8A 3VKIA 4MFDA 3X25B 1ETKA 1SD4A 1LCKA 4XOTA 1OPCA 2IXSA 1VQ9T 5E1WA 3V8JA 4I98B 4CZCA 4PLIA 2DT7B 1PJRA 2DA5A 4FISA 1A6QA 3I9QA 3TDZC 2RHYA 1N27A 1W36C 3JRDA 1JJ8C 4QQ6A 1XN7A 3G7ZA 1M30A 2CP3A 4JX4A 1V3FA 2ZFWA 3E19A 2PI0A 2DW4A 2P84A 4HVVA 4M75B 5FLMJ 4RBOA 2JVHA 1HLVA 4JZ3A 1I5LA 3ELKA 1QVGP 1JEGA 3I56Q 2DDAA 4M78C 3LA2A 5IPAA 5IT9Z 3CD6Q 1M2VB 1YNZA 3S1RJ 2DZ9A 1DU6A 1QRYA 2I0NA 4NL2A 3I64A 4JBAA 2FX0A 2CP5A 3VYHB 3VS6A 4CCNA 4M72A 5J47A 1MUZA 4LNPA 3PIOA 4R0KA 2OTLT 1FOXA 3CCEI 3L2UA 4XTZA 1Z67A 3WTWC 2ELJA 4E7HA 1Q1HA 1GBQA 3BW1A 3NGPA 2QUFA 1FTZA 1U2WA 1UZCA 2EFIA 4JJBA 5FU6B 1KD1C 1QO0D 1TP4A 2WAEA 4A93J 2ROTA 5GAOp 1X58A 1S5LC 1FIPA 2NNNA 4YIIA 3NRVA 4F7UA 3M0QA 3R4KA 2XHKA 5JHUA 4IXAA 1MBEA 3FBNB 1GHCA 1O9SA 1ZG5A 1O3QA 1EKEA 2K27A 4AIHA 5IP6A 2CYZB 2YLCA 2XAJA 1AKHB 4MEYF 2M4KA 2F69A 5CO7A 4LGWA 3MEWA 1MDMB 2CZ0B 1DGRM 3N5BB 3P8BB 2BY3A 1ZSZA 2PQWA 2LCSA 4U7DA 3AHUA 4RTUA 2LRQA 2HS5A 3T0YA 1JJ2P 4C8QD 1BN5A 5M3MJ 1M1EB 2XF7A 2JTMA 1Z3XA 3DEEA 3K1PA 3ZQQA 4OB3B 5LJ5f 1EA3A 4A4HA 1F9NA 2VQCA 3K7AJ 4B4CA 3TREA 4ZGEB 2L9VA 2GQQA 1KQ9A 5DUKA 2KDSA 1EV7A 3SZGA 3GCMA 2Q0OA 3A1YA 4BJ5C 3M7GA 2XI9A 4B9WA 2DKGA 2LG4A 2YDLA 2K3PA 1WJCA 1PVEA 3GPLA 2CW7A 1K0SA 3QOPA 4FE4A 2R7XA 1E3HA 2EBPA 3G71Q 4XU1A 1QZZA 3BJ6A 3QPLA 1ZYRF 5EZHA 2X3WD 3I58A 4EEFG 2NYXA 3TO9A 3M4YA 4XK4A 3JCMe 2V6CA 2X6WA 4HF0A 4M3EA 3GTLJ 2ESNA 4ZDLA 1WQ2A 3BG6A 2VODA 2LJ1A 4XRSA 1M1GA 3M53A 2LC4A 4Q48A 3GF2A 1LE8A 3KYDB 4OMQA 4GRIA 5F04A 4M7DF 1GLNA 4BI8B 5E3LA 1PHTA 5KYNA 4A3IJ 1B34A 2Z3YA 4HF1A 5FFXA 1RAHB 4KGVB 2LF7A 2GXAA 4X9CA 1D3YA 2FBHA 4MQ9F 2LT1A 3JCMJ 2UV1A 1H89C 1BOBA 3JRGA 2KR3A 3E3VA 2RNAA 3G6EA 1KZHA 1Q1VA 2JN6A 3FF5A 2LNVA 3GF5A 3GFMA 1VQ4T 1Y96B 1JXOA 1VQ9I 1RR7A 1F43A 1UGPB 3AL0B 3CMEA 4AVZA 1ODDA 2FMYA 4AIDA 4GDFA 3DU5A 1R71A 4AC0A 4CDGA 2XROA 1IXCA 2RHXA 1GXQA 3AAFA 3KUFA 3BR5A 5L3DA 2F4IA 2QCOA 4LB6B 1OJLA 1PSEA 4IRHA 1F4KA 3OSGA 1OU9A 2F5DA 2OQGA 2WSCE 1YQAA 3A8GB 1HSQA 5A2QE 1M3AA 2L7FP 4CH7A 3MP6A 2JJ7A 2LNBA 2TDXA 3DEWA 2DPDA 1JU5C 2VBZA 5IY5H 4GFBA 1OZ3A 5E3OA 1SEMA 1VOMA 2DXTA 2XDBA 2JTEA 2ZJPF 1VQ5T 2HQXA 3WTUC 2CMPA 1RI7A 3KPHA 5IYBJ 4C8QA 3WGHA 2OTLI 1D3BB 4NQWA 2G0EA 1Z9CA 1RAGB 4XLHA 1W70A 1WJSA 5KAIC 1PD0A 3OYIA 2HYFA 2MI6A 2VXDA 4KDPA 1X3ZB 1OYWA 1NYGA 3JAME 3T8TA 2STWA 5CLSA 2VV5A 5GJVB 2IJLA 5LEJA 2EQJA 3W2VA 1I1SA 3DQVC 3KP3A 1W6XA 2LFBA 3X28B 3CJNA 4YIRX 3OYGA 3CXCS 3BJOA 2NS0A 1D1AA 4ZGDB 1U5TA 1B8IB 1YJWT 1VQMQ 3TCJA 5FWCA 2KZVA 3LSHA 2M4GA 2HZDA 2VBWA 4LLLA 2HNHA 1VQOQ 2LP0A 3GBQA 3CESA 3F8BA 1ETQA 3GO5A 3DKYA 4RB0A 2FJ1A 3F23A 4IOCF 2E3IA 3GNFB 2L9NA 4BH9A 2ATCB 2UZKA 2PVGB 2E65A 5FW9A 3RDVA 2KXCA 2VKDA 2DEUA 4HX7A 2ROLA 5GMKl 5DM7R 3A03A 1WJ5A 3I5SA 5HODA 3D5RC 1QWEA 2HQEA 3MHXA 5AYFA 4QVDA 1P92A 2Q1ZB 2FNPA 1A35A 4M77B 2RJFA 2XKOC 1SHFA 4J7FA 2CQNA 4M75E 1VQ8T 1YJNT 4M7AF 3QG1A 4CXFA 1GDTA 3CDIA 1U0JA 3NTIA 1I27A 4ZN3A 1G6NA 3F8CA 4DA4A 4A4GA 1VQNA 4X9DA 4W97A 4OU0A 1ZUUA 3H3UA 3K4JA 5ERIA 5HLHA 3FXUA 4XONA 1KK7A 4OMFB 1LJOA 5CQYA 2JRTA 4NC6A 3M8FA 4GYIA 3J81Z 2YX7A 3A01B 2GF7A 1BW6A 3ZQLA 1BCMA 1N8RC 3K0LA 2KIUA 4LUEA 3GTMJ 4QW2A 4LMYA 4Q5WA 4JS4A 3OYHA 2HYJA 4FE7A 5E79C 4ME7A 2JT4A 1IDYA 2LK2A 4YRVA 4OGCA 1VTNC 1WFXA 4OGEA 1SSHA 4CC7A 2DA1A 4V2GA 2MBFA 1MNEA 3EUKL 1GCQA 4XRMA 3A02A 2RF0A 2WY8Q 2RMOA 3OB9A 4FSSA 3KP2A 4RGXA 4D5FA 5FKKA 4UC4A 3CC2A 5DM7F 2GTJA 3CCRT 2DTZA 2JUGA 4HX4A 3CC4Q 5GANf 3PNWC 2DMOA 1LNWA 4RTVA 3PMTA 3CCLA 5HDKA 4EPCA 4M7DG 3SD4A 3TSWA 1VQLT 1YS6A 3WTTC 2QA4T 5D7UA 4E47A 4F04B 3BC8A 3TQNA 3AG2H 4BYYA 2DL3A 2IGNA 2O5RA 2WAQN 1YTYA 2LQNA 2N8GA 4HBLA 3EFOB 1JJ6C 3WGIA 4XLPF 1NH3A 2CH4W 1JKOC 4A4EA 1X4PA 4UVBA 4IHTA 1MBGA 2FVUA 2V4JC 2IGOA 1VQ5I 2VE9A 4A3CJ 3HEFA 3QP5A 4HG2A 2R7VA 5HK3A 4KITB 1JRIA 2FRYA 1S9HA 3CC7T 3CCMI 2DLLA 4ZYAA 4IHSA 1AOYA 2EJ9A 4C3IJ 3IV5A 4UUVA 1I07A 3VWBA 4NDLA 1K4US 3GTGJ 5FGMA 4ZZDA 3CCMT 1USSA 2EZKA 1YS7A 3FXMA 5KH6A 4IUUA 2AK5A 1HK9A 2IVWA 4HRIA 2OQRA 4WK8F 5K5QA 1P4WA 1YHQQ 5I2SA 5DCFA 1M9SA 2HOSA 1EH7A 2HFHA 2MABA 3OOUA 1WHUA 2MG4A 4F91B 2O9LA 4IUQA 3GXOA 5AT1B 4HAMA 1UELB 1NTCA 3R60A 2HOAA 2HI3A 3CDHA 1WCMJ 1MBJA 2A61A 4ZC3A 3OS0A 2WTEA 3FHNA 1XPXA 3I56A 4BHCA 3O5ZA 2LBFA 1L3LA 2HTJA 2KBTA 3ASKA 4XK8E 4B44A 1ENHA 2QQRA 1UG2A 1I1JA 1YITA 3A8MB 4G6DA 2RN7A 2FZKB 4ZN1A 2X35A 3OL4A 4A5MA 4RAZA 1S7AA 2NOGA 3BOQA 1PDNC 4L9TA 5K1YA 1P4XA 3S16J 1NBEB 4J9HA 2KFDA 3VEPA 5JFRA 3CD6T 3SDGA 1VQ6I 5HS8A 1ETWA 1JKQC 2WB1N 1UE9A 2Z2SB 1YBYA 2KMTA 3M4GA 3L1PA 3VS2A 5CIUA 2O88A 1H3HA 3TL4X 4EV0A 2IG0A 1VQ8I 1YJNI 5L8RE 2LVMA 2BY2A 2IS6A 4AIKA 4Q47A 4J6WA 1TT0A 3M07A 5E1ZB 1YIJA 4I2OA 1CGPA 4ANJA 3MZHA 2RNGA 3U1KA 1AWWA 2BVMA 1AWXA 5J8CA 2DBBA 4NNJA 3MKZA 2YS9A 4OINF 3OYYA 2ECCA 3CCJA 1T3SA 3RTRA 1JHFA 3FXJA 3SJMA 4C5HA 2FEZA 4IX7A 1TH7A 3OBYA 4MZTA 4M7AG 4AMCA 2BUDA 1BJZA 4KULA 3HUGB 1U06A 2QF7A 3KFVA 4XN0A 2W82A 2FU4A 3SFZA 5DM6F 5HVQC 5BQTA 1WZ2A 1NPRA 1LNXA 1SANA 2V7FA 3CP2A 1RACB 1IRXA 3EQLF 4L0ZB 2V8IA 3MP1A 4I99C 3HL8A 2JZ2A 1OFCX 2RQUA 4D0PA 1PKSA 2ZBKA 2IPQX 4AU7A 3BG9A 3CCSQ 1VQ4A 3SDBA 4NC7A 1KHIA 2X0LA 2QQSA 3CCRI 2FOWA 5HDGA 1QHHD 3BZKA 4LJZF 5CYVA 2B86A 2COMA 2VKVA 2O8KA 1U3EM 1MNDA 2IA1A 1SSFA 2QA4I 2LCLA 4JUVA 2EQUA 4G12A 1O4XA 2F1LA 3IUOA 4FCYA 1B07A 1HKSA 3KLNA 3JRIA 2IS1A 2KISA 4XLFA 4M77E 2R7OA 4XU3A 3MO8A 1Q7YR 1U6GA 2JPCA 5LJ5d 4BKXA 1SKUB 1K7AA 1K78A 2DT5A 2DA4A 5J8FA 2DO7A 3CC7I 3P9IA 2JA6J 1AZGB 4FYXB 2OTJQ 1QW1A 3DPLC 2ISZA 1PRLC 3NAUA 3HRMA 4D7MA 3ABTA 3VYUB 1CSKA 5EG0A 1X75C 2PEXA 2VI6A 3Q3SA 2R7TA 5GTHC 5M3FJ 2M1HA 4I0AA 5CVRA 4O6JA 1IG7A 3LWIA 2HVQA 3PO3J 3GTQJ 1JTXA 2EV0A 4YEJA 2ED0A 3JRAA 3ZMTA 2IIMA 3NTKA 2V9PA 1TUGB 3JTHA 3DLLA 4M75F 4EJVA 4PKCC 1X27A 2JQ7A 2O4XB 2IP2A 2IPOB 1TUDA 4H4KC 5KK1A 2NUZA 2OAWA 5IXFA 2L0AA 3JREA 1ABOA 2LDMA 4A3MJ 2RHUA 1JUPA 1NG7A 1OCRH 3BTLA 1X1DA 3O6BB 3MAJA 4DJAA 1DGWY 5L3FA 1WYXA 1TQMA 4NL3A 2DK5A 4BQQA 4HQMA 2DMPA 5GP9A 5HLIA 1UGVA 5CKBA 1IN8A 1Q7YU 2DT6A 1YYVA 3QPTA 4IHVA 4A4KA 1RC9A 1QU3A 3T8RA 3ZQGA 3U9GA 3KETA 3KZZA 1G3YA 2IS4A 2QASA 4OB1B 3CD6I 4A3EJ 4Z6YA 1ZSZC 1Q86C 2F6CA 1UHWA 5GAGJ 1REPC 4X34A 4P9UA 1YP5A 1ZBJA 1OI1A 2CS7A 2KAFA 1JGGA 2HPMA 4I02A 3IH2A 2M45A 2HKQB 3OWTA 2IS2A 4M78B 1MHNA 1H88C 1YOVB 2O8XA 3BG3A 1QVPA 2F5VA 5IP9J 5D6EA 1USTA 3FIWA 4QIWN 2H1KA 2FZGB 4Z89A 4M7DB 2EKOA 1QKWA 3SZPA 1X69A 1SD7A 5GAN7 2FOKA 1HSJA 1OCOH 3GZ5A 4KA4A 2HQ5A 1VQKA 2R5ZB 1PG5B 1G3WA 3ABLH 1VQMT 4C3HJ 5CKHA 3RKXA 1FC3A 3EPZA 3C95A 1LFBA 2FXAA 2X51A 4P96A 5L3BA 2ESWA 2XDPA 4IHYA 2HPIA 1IC8A 3MWMA 4S0HB 3E6MA 5DY9A 1UG1A 1PYVA 4LDYA 2XGXA 2X9HA 2OZUA 2XB5A 1ZSGA 4PSXA 3VJPA 2M0YA 1TWCJ 1OCTC 5DCMA 4BHBA 1M3BA 2P5KA 3BFMA 1FMKA 2WWYA 5CCAA 1D8KA 1J75A 3IH3A 1NHAA 3KP5A 2OTLQ 4V2SA 1Y0MA 4C0FA 4CC2A 1XSDA 2YRVA 2Q2EB 4PNOA 3VUBA 2QKMB 2PVOB 2DTHA 3I35A 2IRFG 3B6CA 3F21A 1PSFA 1ZHFA 2JRMA 4FYYB 4F16A 4XOPA 2XASA 3CTAA 3FEOA 1RZ4A 2BXZA 5BOXA 4XQ3A 2JJ9A 3G71T 2CUJA 2EFPA 3RCOA 4C2UA 1FNNA 5LLQA 4J01A 3MEAA 2R3SA 4DZJA 3ECHA 2JN0A 4A53A 4IIMA 2Y31A 1SF9A 3HG9A 3VS7A 2OTJA 2WB1A 1B1BA 2V1QA 1OYXA 3JCMb 1J59A 1TXQA 1Y6IA 3IWZA 4IRIA 4A3DJ 2XMFA 2VGNA 2LJ0A 4C92A 2AQEA 4OOIA 2ECBA 4HDUA 2CDTA 1TQPA 5JHFA 4AIJA 2DK8A 4Y33A 2DQLA 2VL8A 4JZ4A 1TSFA 4MLOA 2A6TA 1XGNA 3HTSB 3F72A 5K7FA 4CYCB 1W7PB 1GRIA 3K69A 4J83A 5KE3A 4C8QC 1K4SA 2L4AA 2F2XA 4RGRA 5KYXA 1K73C 4KIFA 2DTOA 1BJAA 1R1VA 2FBKA 1X1CA 2KRNA 1M8VA 1JT0A 2XUBA 3CC4T 3QO3A 1MH4A 3EUHA 3MEXA 5C44J 1FBUA 3E2UA 2IEKA 4YFKF 1VQ7A 2QI2A 1UB9A 2E1MC 3HOVJ 3I3LA 3X20B 3ZXSA 4LXCA 4E6RA 1MBHA 4LLNA 2WC2A 2RPNA 5GANh 1U5TC 2MC4A 3GVAA 3ZEHA 2JA2A 5EGOB 3MEUA 3DB4A 2FQ3A 2MC3A 2PMHA 4HV6A 2JVGA 4L5IA 5D8LB 1UHFA 1YJWA 2RHIA 1T3LA 4M75G 1R36A 3IWFA 4JQFA 5FO5A 1R8OB 2DX1A 4KUDK 1MIJA 4E6KG 4KYWA 1KQ1A 1RADB 1G3TA 2J6KA 2I5UA 5CKTA 2H94A 2E7WA 2LTPA 2XRNA 2XICA 2VIXA 1R5HA 3DLAA 4Y7NJ 4E7SA 4C5EA 4JJNK 2R7FA 1IW7F 3OMCA 3JR9A 3TO7A 1H9TA 2G9WA 2E36A 3HSRA 4AG2C 5CKDA 3O2PE 1YRNA 2HOTA 2CUEA 2ZZDA 1YHQT 1ZG3A 1CF7B 3OYLA 1TG0A 4A3LJ 2QLZA 2YPRA 1QVFP 4NOYA 1WRJA 1FOYA 1TWGJ 3OW2P 1B6AA 3S3OA 3CJQB 5J1UA 1VQMI 1N5ZA 2K3BA 2DA3A 4GO1A 2K9GA 4EIKA 1ETYA 3I59A 5JVTA 1M4ZA 5GAOl 4PJOA 1PUFA 4DBHA 2P6SA 2JNGA 2HDCA 3ZGKA 3DPTA 1G4DA 1LQ1A 1ZLKA 2KT1A 3PIPA 1KJWA 4M77F 4XKVA 3M56A 4MGRA 3Q0VA 4W1UA 2QSFX 5B66C 2D45A 1SC7A 2QSGX 1VQ5Q 1KIKA 4LDUA 2GAUA 1ZRCA 2FG0A 2NVYJ 1NJIR 3LWFA 1FIAA 2BBYA 2BOLA 3JCMW 2L7KA 4EJWA 2IA0A 5A2QK 2RJCA 4J6XA 4LB5A 2CW0F 3EGUA 3I4NJ 5EC7A 2UXNA 3A8HB 4U0VA 2QYOA 2F5KA 1OZ2A 5GPCA 3M0UA 2ABLA 4FIBA 4RDUA 3OYCA 1GCQC 2AT1B 3ERED 4PL6A 3E5UA 2KROA 1GV5A 4BXUA 3G71I 2CFOA 1ITYA 3SWNA 4KIBA 2AZVA 1I6HJ 4C3JJ 1X3UA 5ED4A 2RH2A 1VQPQ 2A6EF 3BQZA 3UPUA 3MKDA 3S14J 2R5YA 2WY7Q 3ABUA 4HNTA 2Y0SN 5JLWA 1PNJA 3EGXB 1BYMA 2RI2A 1AEYA 2XD0A 4M78E 5F1JA 2QBYA 3EG1A 2ZGWA 5J39A 1EJ9A 2KEAA 4KN4X 2FQ4A 1UGRB 3CBMA 1Y39A 4UB8C 2R7UA 3CCQT 5BS6A 1S3JA 1D5YA 3CCEA 2UUZA 4Q4ZF 3X26B 3L00A 2KIFA 2EQKA 1KQSS 1Z6TA 2CGPA 1I39A 1CKBA 1X43A 5FWBA 1TT5B 2EW3A 5KCOA 3GBGA 1B59A 1SMTA 4AD9A 1G2BA 1R0CB 1NJIU 1IO6A 1VQ6Q 1NYFA 5ILUA 4PLLA 3FXKA 3LNQA 3CCST 3OMYA 3HC7A 1TC3C 1SVLA 2EINH 5GJWB 1YJ9T 1VQ8Q 1YJNQ 3HP9A 3CC4I 4HCZA 2VJ5A 3RERA 2KKOA 2R92J 2KRSA 3FJPA 4IOAF 3H9NA 3IRQA 2VQHA 3Q0WA 4II1A 5IHKA 1LVAA 1WVRA 3SQNA 1K6OA 2A6HF 4PJMA 4ESFA 2X4JA 2CH0A 5D6YA 1KC8R 2FYKA 1JTYA 2HQNA 5J1RA 5KYWB 1YG2A 1BKBA 1SD6A 3ZOBA 1N77A 3UF4A 1WJFA 2KIQA 3UATA 1OCZH 3MMYB 3BG5A 5DD4A 4M71A 2QGGA 2G7UA 4BY1J 3VB2A 1W0UA 2DYIA 2K2MA 1XCBA 4HA8A 3EETA 5GMKm 1J7KA 4IUVA 3F8MA 4RLFA 3VSLA 1M5Q1 4C2MJ 4CI0C 5GANg 1DJ7B 2BIVA 3A8OB 3LSJA 2KYMA 2QWWA 2R58A 3RMQA 2EV5A 1E3OC 3HOUJ 2E60A 3D1NI 1ZGJA 2A05A 2KPMA 3M8EA 4MFEA 4XRFA 2Q8KA 3S17J 1B72A 2LT4A 2NUPA 1G59A 3QDRB 5A2QZ 1J3TA 1YHQI 3ZFJA 1K9MC 1SD5A 1IREB 2XIGA 2BW3B 1WA7A 1WH5A 2EGCA 3PTAA 3QDFA 2QA4Q 4PZJA 2LJ3A 1H641 3PVLA 4LDXA 1V54H 4HV5A 4DGWB 3RMSA 1KC8U 3H3ZA 4U87A 1Q81R 3QYEA 1IGUA 5ECAA 1C0WA 5DDGA 1W2BP 1T56A 1RLQC 1BM9A 2M2EA 1QPMA 2GBYA 4LUDA 2HEQA 2JZYA 2KNBB 1I5ZA 4J5YA 3E7LA 2LP5A 1KGSA 4KH0B 3HKZA 3CC7Q 3UNGC 1MJ9A 2XPVA 1KQSA
chains in the Genus database with same CATH topology
2FB7A 1VQ9A 4CGZA 3M57A 2ZPHB 5BMZA 3CPWA 3ER0A 2ZCWA 5A0DA 4FT2A 2M0OA 4M77G 5M9OA 2P0QA 3JCMd 3V8LA 1LB2A 2ZJ2A 1XOVA 4IF4A 3E5XA 4XTWA 2OAZA 3HYIA 4OIPF 2AS5F 4BD3A 1OKRA 2W24A 1Q81U 4A54A 3GWZA 2DQRA 2EFWA 5GAOn 3O8VA 4BE0A 3BY6A 1SFEA 1WKMA 2MA3A 2A3LA 3TOBA 2LQ8A 4IPAA 1Z7UA 4BAYA 1BI2A 2ZNZA 4WF2A 4E7KA 4ENNA 4WXCA 2XAHA 4RGUA 5CJ9A 2XAQA 2EA2A 3L2CA 3SXYA 4FX4A 3KP6A 3P9CA 1IF1A