3HRTA

Crystal structure of scar with bound cd2+
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
212
Chain Sequence
PNKEDYLKCLYELGTHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
total genus 52
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrtA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrtA02
3WG9A 1RZ4A 3DKWA 3F8NA 3P7NA 5F64A 3H92A 4HYEA 1R36A 2IPQX 3BY6A 3TDZC 1MGTA 5IT9Z 2M5WA 5DCMA 1Z6RA 4I01A 3DF8A 1H9GA 2O03A 2ZMEA 3HRMA 1IXCA 1IXRC 2CG4A 4WXCA 2H6BA 1SFUA 4A6DA 4KIBA 2BYVE 1HKQA 3K1PA 3ML6A 3PQKA 4ENNA 2KJBA 4PGHA 1C0WA 5KVRA 2QQBA 5CVRA 3J7AO 4CXFA 1IN5A 4G9YA 3RJPA 2VN2A 2PMUA 3CUQC 2DQRA 3SHFA 2GWRA 3JAMZ 3FXUA 2FBIA 3HRUA 1Z1DA 5E8IA 5JFRA 1DUXC 2JTVA 3GFIA 4FX4A 3G73A 4HX4A 2P7VB 2QWWA 1XCBA 5HLHA 1U2WA 3GO5A 3ZP5A 1GHCA 4KICA 4WX9A 3P9KA 3BOQA 1U3EM 2D1HA 4M9SA 1H0MA 3QU6A 1NHAA 2Q8KA 4HQEA 3E3VA 4HV5A 1G4DA 4KYWA 4L5IA 4WXHA 3SZPA 5E18F 2FMLA 2DK8A 4OU0A 1EH7A 3R61A 4F7ZA 3LSTA 1B59A 2L54A 1F5TA 2HWVA 1R7JA 1V3FA 2EFPA 2H3JA 4IRIA 1BOAA 2L3DA 5BQTA 3HRSA 1LEAA 3R6SA 1S7OA 3W6JB 1UHMA 4OIPF 1SD4A 5DV5A 5HS7A 3S2WA 3MHXA 2K4JA 1IRFA 5FO5A 1D8KA 4IHTA 2F5EA 3LQRA 4WCGA 2Y0MA 4I7HA 1AOYA 3L9FA 2VBYA 4PDKA 3EETA 3GZ5A 3RYRA 1WSUA 4AWXB 3ELKA 4BH9A 1XGSA 2F5DA 1D3YA 3QPTA 4YFNF 2P6SA 2XGXA 1I1GA 1E2XA 2HDCA 3W6KB 3F8MA 4FX0A 3WTVC 3M8FA 4MQ9F 1SD7A 3DQVC 1S6LA 5DCMB 1ON2A 4HOBA 5L3EA 1UCRA 3T0YA 3DPLC 1K6OA 1HKTA 2L02A 3E6BA 1O3SA 3EYYA 2UXXA 5E1WA 2GIVA 4LGWA 1HW5A 1U5TA 2Q2EA 5E1XA 5H20A 2MC3A 3RYPA 2VC0A 1PDNC 4G6QA 5HDGA 5A2QK 4BQAA 4L9JA 4ESJA 3T1BA 4UHTA 5A2QZ 5E20A 2DO7A 2EFNA 2K27A 4HLXA 1R1UA 4ZZLA 5BMZA 3RIRA 1KYZA 3NQOA 4M6YA 2CYYA 2DLLA 3E5UA 2XAQA 3O6BB 4LFUA 3L2CA 2Z99A 2V6CA 5ICCA 1YW9A 3TO7A 5ICEA 2D1VA 1HQCA 1QPMA 1U78A 3TGNA 2RVCA 2Q0OA 5LHIA 1REPC 1J7KA 4YFKF 3BPXA 2FEZA 3T8RA 3KE2A 2DK5A 1STZA 2IA2A 4YIIA 4U0WA 5D5WB 2STTA 5DD4A 3BJOA 2ACJA 3HTSB 4BHBA 5H6RA 2EB7A 1YTYA 1LQ1A 3GW2A 2O6GE 2MD5A 4A0YA 5CVIA 4OMZA 2P7CB 2LF7A 3F72A 3JTHA 5ILUA 4KN4X 3IRRA 4LD5A 3U9GA 1OMIA 4MHGA 4G7HF 3BZ6A 4HF0A 4ENJA 2K5LA 1Q1HA 2F5FA 2LDUA 4JBAA 1GVJA 2OD5A 2H27A 1USTA 3REOA 1T39A 1S7AA 1GXPA 3ZMSA 5DUIA 5HDKA 1LDKB 3NRVA 2M87A 5J8FA 4G7ZF 1FP2A 1BI3A 1JGSA 4WF2A 4S05A 1R00A 1O7FA 3E6CC 3R0JA 4MTDA 3DPTA 1FSEA 1T0FA 3HSRA 2XAGA 5LHGA 2EA4A 2V1UA 2P6TA 1PP7U 1ZGAA 4U7DA 2FBHA 4XLNF 4E70A 1ZLKA 3P9IA 3QP5A 4UUVA 4BHCA 1IRGA 3KEQA 1ZG1A 4ASNA 2KIFA 4UVAA 2BEOA 3CUQA 5ERIA 2X0LA 4XSXF 1U5TB 3GX4X 5AONA 2UXNA 2LF8A 4KT5C 4XBFA 4LG0B 1IN6A 4B8XA 4UVCA 1ZRFA 1I5ZA 3M1EA 1FSHA 4JK1X 4S04A 4EM1A 1ZREA 4M6XA 2PJPA 3FXRA 4HBLA 2Z9OA 1TTYA 3TKYA 2W25A 3LA3A 5CJ9A 1QBJA 2CGPA 2FMYA 4EMSA 5FFXA 2JZYA 4LLLA 1OYYA 1MDMA 3KZYA 3BP8A 1S29A 1ODDA 3TO6A 3D5LA 5HLIA 2ZCWA 2ESHA 4B09A 3LQQA 2YPRA 1QW1A 1FT9A 1QZZA 5E8GA 5LRSA 1XSVA 1TW2A 3I0TA 1Z9CA 2QBYA 3Q5FA 3WTSC 3T5XA 2HGCA 4A6EA 2YSRA 3DXJF 3OOPA 2DBBA 3GLXA 1SFXA 2OZUA 4RAYA 3FMSA 4ON0A 1R1VA 1ZYRF 3F8CA 4GGGA 1OKRA 2HYFA 1J59A 2K7LA 3KP6A 1S8NA 2VODA 1SD6A 4P5OA 3B02A 2WTEA 1R22A 2HFHA 2V1XA 2PQ8A 4EM2A 3NEUA 2IP2A 1FC3A 3K0LA 3CLOA 2DPDA 1KU3A 1TLHB 1K7AA 2XUBA 4AIHA 4O5VA 2HTJA 1JHFA 1EV7A 3IKVA 1OR7A 4IVNA 2P5KA 3MQ0A 4N9HA 2O61A 1JE8A 3QU3A 2CFXA 2A5YB 5CYVA 1G3WA 3O3KA 2IJLA 2YU3A 5IT9K 2E7XA 4G8XA 1FP1D 3K9TA 2VE8A 4A0ZA 3RTRA 3D0SA 1QQIA 1IXSB 2ISZA 3CUQB 3ROUA 4KA4A 4RB2C 2YX4A 3WGGA 2HTSA 1SMTA 2HOEA 4QLCU 3MCZA 2HZTA 5FFZA 4I09A 3QPHA 4RGXA 3WE2A 4ENMA 3FXQA 4ZYDA 3DP7A 3BROA 2MA3A 3JAMK 3ZPLA 1TW3A 3I54A 3FZVA 1RUNA 4UV8A 4I0AA 1FBUA 4RS8A 4U7BA 4P9UA 4XRFA 3MEXA 4UXNA 3JW4A 3V7SA 3MZYA 2PLYA 1MDMB 4ZH4F 3MAJA 1WKMA 1O3TA 4RGSA 1JXSA 3FMQA 1XCVA 4AVPA 3MWMA 2XKOA 2GXBA 2NYXA 1I1SA 3BPVA 4L18B 1ZG5A 1WQ2A 2O0YA 1K79A 2QBYB 3ZMTA 3FF5A 3EUHA 2NNNA 4IF4A 5L3BA 1TBXA 1QVPA 3COAC 5D5XB 1KU9A 2Z33A 1XGNA 1ZGJA 2VT2A 3R0AA 4P9FA 4KNYA 3CDHA 1YS6A 4ESFA 4MNUA 2KRFA 5D5UB 3RPQA 3FX3A 3M7GA 5LBQA 3F6VA 2E1NA 4IRHA 2RDPA 1B9MA 1R23A 2KKOA 1QGPA 3V4GA 1B9NA 2KIUA 2STWA 4NB5A 2XROA 1IN4A 3KETA 4M9XA 3IWZA 4OMYA 3BWGA 3I58A 1G3TA 3RI4A 4L9TA 2BGCA 3HOTA 1L3LA 3J81Z 2EJRA 2DQLA 4EJTA 3C3WA 4HQMA 3M8EA 1F1ZA 1TNTA 4L5JA 3GYHX 3CO7C 5LLQA 1T38A 1QO0D 2E1CA 2PMHA 5AIQA 2VXZA 3WE3A 4OINF 1KQ8A 3R60A 2O3FA 2CSOA 2XRNA 1T2KA 1FZPB 1J9IA 1KGSA 2JRTA 2GCXA 3LFKA 4UV9A 3J80Z 3ULQB 2RNJA 2EV6A 1FY7A 3ERED 1HSTA 2X4HA 4KIGA 3MFKA 3JSOA 2QENA 2A3SA 2L4MA 1WI9A 1R5GA 1FYMA 2H94A 2E7WA 5HVQC 5F1RA 2FOKA 4LG0A 4Q5SF 4UNOA 1ZRDA 3I53A 2QQ9A 2LX9A 4PCQA 3KCCA 3EYIA 4FT8A 3V8LA 4M73A 1SAXA 4ZYEA 5CVJA 2AXLA 1Z6TA 1J0RA 3L09A 1SFEA 1Z91A 4O6JA 4YIFA 3KLOA 3RKWA 5K5OA 1UHWA 4M74A 4NQWA 3R4KA 3LAJA 2WWYA 4RAZA 1FX7A 3SZTA 2EA2A 2W57A 4RGUA 3FM3A 2FE3A 4K2EA 1W5TA 4BHPA 1KU7A 2PBIA 4DQ2A 3VOEA 4I98B 4U88A 2EFWA 3KP4A 4BYYA 2Y48A 1FYLA 3BDDA 2H6CA 5H6QA 1IN7A 4HA8A 3IL2A 1ZHFA 5L3GA 4I0BA 1W7PB 3GFMA 3VODA 4Y15A 4EJOA 2HKXA 3GFLA 2RC4A 1L0OC 4RB3C 4HLYA 4AIJA 2ADUA 2GQQA 5LGNA 1G6NA 2DI3A 2LSOA 3HHHA 3KP3A 1F4KA 1Z7UA 4L0YB 2WV0A 4KMUX 2FXAA 1B1BA 3V8JA 1OYWA 2CO5A 5F6FA 4GYGA 2OQRA 4EJWA 1BIBA 2ZO4A 4OIOF 1W7PD 2FU4A 1BJAA 4HF1A 1ONVA 4KUMA 1G3YA 4P55A 3E97A 1BI2A 2F5CA 3I71A 1RUOA 2A68F 1P4WA 2GZWA 3WGHA 5ICGA 2HKOA 2QQAA 2VONA 3IKTA 3ISPA 3F22A 2W85A 1D8JA 1EH8A 3F6OA 5HLGA 2BE5F 2HEOA 2G9WA 2EFQA 1BIAA 1TQMA 1MJ9A 4BAYA 3CUOA 5E1ZB 3BJ6A 4G7OF 2G7UA 4R79A 4L0ZB 1R58A 2MBFA 5D6FA 4KFCA 1B6AA 1MZBA 2XAHA 3U1DA 4CDGA 2BV6A 5K1YA 1O57A 4IPAA 2BBYA 3V8KA 1XN7A 1W4MA 2P4WA 3FWEA 3FMRA 2FSWA 2IRFG 4LB5A 2H09A 1BBYA 5BS6A 5JR3A 1UFMA 2NNYA 5AIPA 3Q9VA 4LJZF 4KN7X 2RV8A 2A61A 4ZYHA 2LKPA 2PEXA 3K2ZA 5BPDA 3MZHA 3N97A 3WGIA 1FYKA 1IW7F 4HW0A 3VB2A 3PFIA 1G3SA 4LLNA 5ICFA 5LHHA 3ZN1A 2ZFWA 2OZ6A 1RI7A 5LEJA 2YX7A 2FNAA 4PGGA 1J5YA 2VOPA 1R1TA 2LNBA 1QNTA 1RNLA 2ZNZA 1YS7A 4OIQF 2FQ3A 2EWNA 1P2FA 4N9IA 2PG4A 1ZRCA 3AAFA 4GCVA 5CVVA 3I4PA 5D6EA 4H0EA 1T6SA 5HOOA 1HXDA 6PAXA 3WU0A 1EH6A 3F8FA 3HSFA 1BM9A 3K1MA 3M9AA 3KFWX 2ZJ2A 2DPUA 2DT5A 2K4YA 3ABUA 4RB0A 4NHJA 3RKYA 3L00A 3G3ZA 3Q9SA 1S3JA 3L7WA 3ZN0A 3ZMZA 1J75A 2PI0A 3T8TA 1XSDA 3DFGA 1QZYA 3QRFF 3OV8A 4EJUA 2NRAC 4MEXF 2K5IA 2W84A 4BXUA 4GYIA 2W24A 5HS8A 1P6RA 1U6GA 1WWXA 1FNNA 3IWFA 2K4BA 1XMAA 1D5VA 4ESBA 2ZNYA 3H3ZA 3C7JA 1Z05A 5DDGA 2V9VA 1XDUA 1R5HA 2EV5A 1BN5A 2ZKZA 3QOPA 2QLZA 2IA1A 1BI0A 2QZ8A 2QYOA 3WTWC 3KP2A 5KK1A 4ETSA 3K69A 5FD5A 5ILVA 1ON1A 1XGOA 4HX8A 5D4SA 2FNPA 2FRHA 1OPCA 2XV4S 4ENKA 1SD5A 3RKXA 2GA1A 5TJJA 5FLXZ 3E5QA 1K78B 1VTNC 1KYWA 2IVMA 5FD6A 1WRJA 3ECOA 3HSEA 3E5XA 4EM0B 2GA2A 4MEYF 4IXAA 2OAZA 4U0YA 2EK5A 2JPBA 5K5RA 2K5FA 2IW5A 1LVAA 2MH9A 5ILSA 4XLPF 1HSJA 4M72A 3SFZA 5K5QA 4M71A 3LA7A 1LDDA 4A12A 3WTTC 2HR3A 4BNCA 2EFOA 2KIMA 4GXOA 5EEHA 1XGMA 1KQ0A 1YW8A 2YR2A 3HRTA 4G6DA 3HHGA 1B4AA 1LB2A 2RQPA 2A6EF 3C1DA 1CF7B 2R7DA 4Y13A 2O8XA 1USSA 3HUGA 4CHUA 2HQNA 2F2EA 4HV6A 5J8CA 2R7FA 3FM5A 1FBQA 4YFXF 2QUFA 2V79A 4U0VA 4MGRA 5HDNA 1O7LA 3WTXC 1W5SA 4WWCA 4P96A 4PZJA 5LGUA 2D45A 2L01A 5E17F 5L3FA 3C18A 5JI6A 2MLGA 1IUYA 1W7PA 2KJCA 1KA8A 1PP8F 2XIGA 2XAJA 3F8BA 1AWCA 3ECHA 5CVUA 3ABTA 2P5LC 1LEBA 2ZXJA 1TQPA 1FPQA 3K1NA 2WC2A 2R3SA 5D4RA 4HDUA 3I59A 2FA5A 2MLKA 2OQGA 2XVCA 1P92A 2XKPA 4IRGA 3ZMDA 1CGPA 5JHUA 1X3UA 4QWQA 3GEZA 3GZ6A 4JQFA 2M1BA 4I2OA 3J81K 2QVOA 3HIFA 3WU1B 4MQVA 1OYIA 1P4XA 1RIOH 4LK1F 4MTEA 3TDUC 2M8EA 1FOKA 3IRQA 3N4MA 1YYVA 4EQQA 3V7RA 2V1DA 4OIRF 4LB6B 2A69F 3U2RA 5FGMA 4CO8A 4WK8F 3F21A 3J80K 3CJNA 4DNCA 4HF2A 2FF4A 4HAMA 1O3RA 1TNSA 2OA4A 1Y0UA 4EJVA 4A5MA 4EGYA 4R1HA 5L3DA 2P5VA 3SQNA 2IA0A 2FBKA 2HYGD 2JT1A 3CTAA 5DEQA 2ESNA 4L9VA 1YO5C 2DU9A 4Q48A 3RDIA 2ZMEB 3SXYA 1KU2A 1A04A 3F3XA 4FHTA 3E6DA 5L3CA 3QP6A 5FB2A 1SMYF 3KLNA 2VT3A 2GXGA 2DTRA 2P8TA 1IZ1A 5TRDA 1FLIA 2RGVA 1IF1A 5DCFA 5LGTA 2C6YA 4KMFA 1ZAOA 2RN7A 2Z5UA 1F9NA 2A6HF 3JTGA 1ZH5A 2GAUA 4A5NA 4Q47A 3HOSA 1IN8A 2J5PA 4HZFA 1E17A 1DDNA 1MJBA 1ZARA 1KQ9A 3KP7A 2OBPA 3I64A 4EVIA 3BJAA 2JPCA 2VOOA 1ZG3A 2VE9A 4L9NA 2Z3YA 2NS0A 2UWMA 2Y75A 3KEOA 2QM3A 3KP5A 1BC7C 4O3MA 1PUEE 1XD7A 3I59B 5D5VB 1I27A 1FWZA 2EV0A 1YQAA 4D0PA 1XDSA 2CWEA 2XAFA 3V7CA 2CW0F 3IHUA 1ZN2A 3IC7A 1YLFA 5DUKA 2NAZA 4GO1A 3WODF 1LNWA 3CO6C 4IJAA 3GFJA 2K02A 1BI1A 5CLSA 1O3QA 1XSXA 4WXDA 3JSPA 2HS5A 2ISYA 1GXQA 3DV8A 3FHZA 2IT0A 3QAHA 4AD9A 1MJAA 2ELHA 3ZQ7A 1YFHA 2OU2A 4A0XA 3KZZA 1DP7P 4Q4ZF 2DW4A 4Y17A 5EEGA 1K78A 4RGRA 4Z2YA 1U8RA 4I02A 2DAOA 1IAWA 2AS5F 1T98A 4EV0A 3RPUA 1LDJA 1XB4A 3VEPA 2VBZA 1YG2A 1DPRA 3ZMVA 2B0LA 3LAPA 3TQNA 3EQLF 3GWZA 2ZBKA 3O2PE 4RB1A 4EGZA 3GF2A 3LA2A 4CZZA 2M45A 1FBSA 3H3UA 2DFIA 3WTYC 4XSZF 3TOBA 2XASA 4G94A 2VBXA 1CF7A 4CYDA 2M30A 2XHKA 2VC1A 1H9TA 3GUDA 5IT3A 1BC8C 3EDPA 3F23A 1U5TC 4UVBA 1DPUA 2HQRA 4LLGF 3GXOA 4R8HA 1MD0A 4M9ZA 2UZKA 2PN6A 2VBWA 4A2UA 4YG2F 1HW1A 4LK0F 2G7HA 5J6XA 1YIOA 1TQIA 4N0BA 4IHSA 5BOXA 5LRRA 2TDXA 2CQKA 1JHHA 2ETHA 3ZMUA 1BYMA 1YW7A 3P9CA 3TO9A 1MKMA 3PQJA 3LWFA 4CICA 1P4AA 4TV7A 1XMKA 4ZZDA 1HW2A 5JVTA 5LEKA 3WTZA 1UB9A 3TOAA 3VFZA 2MH2A 4KDPA 2D2WA 5D8LB 3WTUC 1ZLJA 2COMA 4HX7A 3HYIA 5ED4A 2K86A 1ULYA 4AIKA 2L4AA 4LMYA 2PFBA 5HS9A 4OOIA 5DYMA 4HDVA 2A07F 5DD8A 3B73A 3E19A 1LJ9A 4KIFA 1HBXG 4ZYGA 3I5UA 2RKHA 1HKSA 3DEUA 3E6MA 5BPIA 3HTUA 1V4RA 5FLXK 1I6XA 3GVAA 1J2XA 2JSCA 4CGZA 5D8KB 2J5OA
chains in the Genus database with same CATH superfamily
3WG9A 3RNJA 3SFIA 3HHTB 1RZ4A 2LY2A 2QEXQ 1IDYA 4RTUA 5EZGA 3DKWA 3CCQI 3F8NA 3P7NA 2CQXA 1B07A 5F64A 3I9QA 3H92A 3D1NI 2X4JA 3G6EI 5IAYA 2MFZA 4HYEA 3TP0A 1R36A 2L2OA 2IPQX 3CCLT 1JBMA 3BR3A 3BY6A 4C0FA 4GDFA 1VQ4A 3GOXA 2A5WA 3FIWA 2CRGA 2P0PA 1ZTRA 2EQRA 3HC7A 3TDZC 1S72A 4J9IA 1MGTA 5IT9Z 3NTKA 1ACMB 4KGXB 2M5WA 5DCMA 1Y1VJ 2XB5A 1M8MA 1Z6RA 4I01A 4OMPA 3BR1A 3DF8A 1H9GA 2O03A 1MUZA 4E7ZA 3QYFA 2ZMEA 4A4EA 2HQEA 3HRMA 1ABOA 1YJNT 2X48A 3A0HC 1IXCA 1IXRC 2CG4A 3GCMA 1RKWA 4WXCA 3K4BA 4BGDA 2H6BA 5I21A 1VQ6A 1SFUA 4C3HJ 1T0FC 2V8KA 3S2HJ 4A6DA 4KIBA 2BYVE 1LVKA 4M7AB 5GAMd 1Q81R 1VQLA 4AFZC 5FKNA 3GNFB 1HKQA 3K4JA 1BL0A 3F0CA 3C4SA 3K1PA 2K9LA 1I6HJ 2ATCB 2EGCA 3ML6A 1D09B 2RJCA 1MMGA 1Q81C 2ZSHB 5KAIC 4M75A 5LJ3f 3PQKA 4ENNA 3JR9A 1WQWA 2EYQA 4FYWB 2HL5C 3FXLA 2QDLA 4MLOA 2KJBA 2MSYA 3WHCA 1WXUA 4C8QE 3PNYA 1BJZA 4G12A 4P1WA 4PGHA 1Z67A 5KVRA 4DZJA 1C0WA 3BW1A 2VJ4A 2QQBA 1IGUA 1K9AA 5CVRA 3J7AO 4CXFA 3S16J 2VIXA 3DLAA 3OIQA 1IN5A 4G9YA 1Z3YA 3RJPA 2VN2A 1VIFA 2KHMA 3JRDA 3M4YA 2PMUA 1NK2P 3CUQC 3C12A 2DQRA 1YITT 3AT1B 3PO2J 3SHFA 4A4FA 4M7AC 1JKOC 5DM7F 1ZBJA 2HAXA 2GWRA 3JAMZ 5LJ3g 5DM7R 3FXUA 2FBIA 3HRUA 4RLQA 1TUDA 3EG3A 3JCUC 2EW3A 1Z1DA 3I55A 1ETVA 3F9KA 4M7AD 2COYA 3EG9A 5GAOr 5E8IA 2H8HA 1TWAJ 2O5RA 3OYDA 5JFRA 1SC7A 1H88C 3E0JB 1E3HA 3A01B 1JKQC 3HFOA 2DMNA 1DUXC 2HL3A 1BU1A 2K6DA 2JTVA 2RNAA 4M75E 3GFIA 2CP5A 2Y4YA 4FX4A 3G73A 1MBFA 2ELKA 2K2VA 4HX4A 4C92A 2OUMA 2P7VB 2AHQA 4BY7J 3TU4K 1Q7YR 4X1EA 2QWWA 3ERMA 1XCBA 5HLHA 2YUNA 4JS4A 2E5ZA 1U2WA 3GO5A 3ZP5A 3EPZA 1PUFB 3CC4I 1OI1A 5GANj 1GHCA 4KICA 2M9HA 4WX9A 1Q7YC 2ME6A 1PRLC 3P9KA 1OZ3A 2D0QB 3BOQA 1MHNA 1U3EM 9ANTA 5D6YA 2DM1A 2D1HA 5HNHA 4CI0C 4FYVB 2LDMA 1V5GA 4M9SA 1H0MA 3QU6A 4OB1B 2MYSA 2K85A 3ZQIA 4DYRA 3OSFA 2NVXJ 1Z9ZA 3CC2Q 1JI8A 4GFBA 2JWTA 1G8XA 1NHAA 2Q8KA 1X6OA 1WZ2A 1MBKA 1RR7A 4HQEA 2BE9B 3CC7A 3E3VA 3H1CA 1U8BA 4ZYAA 4HV5A 2DOFA 5GAN2 4XLEA 1G4DA 3LSRA 4KYWA 2QA4Q 4L5IA 4WXHA 3SZPA 5E18F 4JUVA 4DBHA 2FMLA 1KG1A 1YWOA 4ANJA 2IGKA 2HQ5A 2DK8A 4OU0A 3M0PA 4ZDOA 3VYHB 1KQSP 1T0JA 1NBEB 1EH7A 3R61A 5J40A 4Y28E 4F7ZA 3QQAA 1SHFA 3LSTA 1RUWA 4XN3A 3CCEI 3K70D 2WSCE 1B59A 1DU6A 2L54A 4BY6B 4I76A 2PJRA 2CT3A 1F5TA 2HWVA 4RG2A 4D1QA 1IDZA 2SEMA 3M3YJ 2HDDA 1R7JA 1V3FA 2CP6A 2EPDA 2F69A 2EFPA 2H3JA 4IRIA 1BOAA 4AUXA 2L3DA 2Q1ZB 5BQTA 2EAYA 5FLXE 4MZPA 4JOMA 1ZSZA 3P8DA 1AWXA 3HZJA 3HRSA 4RDUA 1LEAA 2KR3A 2H8WA 3R6SA 4X0GA 1SFKA 4M7DF 4IURA 2RQWA 3RSNA 4XLCA 1S7OA 2F6CA 2LC2A 2DODA 1RETA 5L8RE 3UPUA 1JJ6C 3W6JB 3KBGA 2E3HA 5HK0A 2JT4A 1UHMA 3QYEA 1MNMC 3IAS2 4OIPF 1S1NA 1B72A 2L5QA 1TC3C 4IHWA 4XU0A 4BY6C 4M7DC 1SD4A 3K4LA 3EFSA 5DV5A 2DDBA 4DEXA 5LJ5e 1PD0A 5HS7A 4RTWA 4DBRA 3S2WA 1YFNA 3MHXA 3OSVA 2DTOA 3QWYA 2K4JA 2ZZDA 4M7DD 1JJ2P 5JLWA 2EQUA 2CFOA 3OIOA 1IV8A 1IRFA 5FO5A 1XPXA 2P0KA 4A3EJ 2KXDA 4VUBA 4Y7NJ 1D8KA 4IHTA 2LCCA 2OJ2A 4PFZA 3VS6A 1H89C 4TVRA 4N4IA 5FWBA 2WADA 1M3CA 1VF9A 4BD3A 1VQNI 2O9VA 4ZN1A 2F5EA 1XC5A 3NWTA 1HD3A 3LQRA 2DILA 4WCGA 3CMAQ 2Y0MA 1DGWY 3ONQA 4I7HA 3M58A 1AOYA 2E1OA 2M7BA 3L9FA 2VBYA 2NXNB 3PL8A 5DM6F 2CSQA 4FU6A 4B48A 4ORZA 3I3LA 4PDKA 1YI2A 1QHGA 4PJOG 3ASOH 3EETA 1WFWA 3GZ5A 3RYRA 3RBBB 1FJLA 1QZEA 2XHCA 4J9CA 3HKZN 1IRXA 1WSUA 4AWXB 3CPWP 4A3IJ 3ELKA 4BH9A 3LWHA 4M3FA 2X85A 4DOVA 4ZGJB 1XGSA 2F5DA 5FROA 1D3YA 4E6RA 3QPTA 4YFNF 2R7SA 2V7FA 2P6SA 2XGXA 3J7YJ 3EH1A 5EYRA 1I1GA 1E2XA 2CMPA 3W6KB 2HDCA 4E7SA 1QKXA 1X01A 3F8MA 2YHTA 4FX0A 1U1SA 3DCFA 2XPVA 3WTVC 3M8FA 3JCMf 3CLQA 1ZK8A 3DBLB 2DK3A 1NEGA 3FJPA 4MQ9F 1OISA 2HKQB 1SD7A 4FT4A 1APLC 3DQVC 3G71I 3MP6A 1S6LA 4C2TA 4LE9A 4C8QB 4HXJA 4OAZA 1V5EA 4OP0A 2B63J 2P4TA 3BC8A 5DCMB 3AG3H 4PLLA 1ON2A 1ORKA 3FRNA 2LY1A 4HOBA 3TL4X 3VYTB 2KFDA 5L3EA 5FLMJ 1UCRA 1VQ7I 2QASA 5GAN5 3T0YA 3DPLC 4F16A 1VQ5T 1K6OA 1HKTA 3ESWB 3CCVT 1JXOA 2K3YA 3VS1A 2L02A 3FXOA 2VPRA 3E6BA 1O3SA 2RQQA 3EYYA 2UXXA 5E1WA 2GIVA 2PVOB 2DYSH 4LGWA 5J3BA 1YHQT 1HW5A 2E60A 3JCMg 3VRYA 1NG2A 2M0MA 4C8QF 3A4CA 3IH3A 2RI3A 1U5TA 2Q2EA 5E1XA 5H20A 3OMCA 3MEAA 3JCMc 2MC3A 2HVSA 4LIUA 2VC0A 3RYPA 1VQ4I 3HDDA 3QYGB 1X69A 3CCJA 1BBZA 1PDNC 1S72I 3G4SQ 5CKHA 4C5GA 4G6QA 5HDGA 5A2QK 1LKXA 2IPOB 3AG4H 3BTLA 3M07A 4BQAA 4C8QC 3RERA 2DCEA 1SRLA 2W00A 1UGQB 4L9JA 1VQOA 4ESJA 3HL2A 1Y8RB 4UHTA 3T1BA 1RESA 3RZDJ 2JA7J 2M1HA 3CBOA 5A2QZ 3KFVA 4C8QD 3CC2A 4E7KA 4QW2A 5E20A 2DO7A 3DEWA 2CDTA 4N0AA 1FYNA 2JVHA 3KZIC 2EQKA 2GFAA 4KUIA 4C30A 1UAAA 3REBB 1W36C 1YJWA 1VQLI 3WXMB 2EFNA 2E70A 4M77G 5EGOA 1GFDA 2K27A 2L9VA 2F4MB 4YRVA 1W36D 2ED1A 4HLXA 2E65A 5CAIA 1EJ9A 1R1UA 3OWTA 4ZZLA 3IH2A 5BMZA 4Z88A 5J39A 2BTTA 5GJVB 1YIJA 3CJQB 3EG9B 3ZQQA 3RIRA 1KYZA 4PJJA 1W6XA 1X2KA 5LJ5f 2V6EA 1IGNA 3NQOA 1PCXA 1PWTA 3JCMW 5KAFC 2KISA 4M6YA 1VYUA 2HMAA 2CYYA 4ZDLA 2RMOA 3HKSA 2DLLA 4IIMA 3CCEQ 3E5UA 2X6WA 4BDZA 5I2SA 2XAQA 2ZXIA 2HZYA 3O6BB 4LFUA 3L2CA 2Z99A 2LZ6B 2NVYJ 2V6CA 3O8HA 1PKSA 2PTKA 5ICCA 1I3AA 1YW9A 3TO7A 5ICEA 2YU9J 5GAMh 2D1VA 2CGHA 1HQCA 1V5FA 4DW6A 3UA7A 1KC8U 1QPMA 2VXFA 4OB2B 2DERA 1VQPT 2XB0X 3WVDB 4OMOA 2NUPA 4XQFA 3T9NA 1U78A 2BZYA 3TGNA 5CCAA 2Z16A 4DJAA 2RVCA 3OYJA 2Q0OA 3I55I 5LHIA 1REPC 2RJFA 3M9QA 4J5YA 3JB9G 2D1XA 4FETA 4JLGA 1H3ZA 1J7KA 2RH2A 3CCUI 1CQTA 2DRKA 5HY6A 4YFKF 1Y6IA 1M2VA 3NGPA 1F36A 3BPXA 1GXIE 2EH3A 1WHMA 3GF5A 2FEZA 5I2MA 1QVFS 3T8RA 3KE2A 1O4XA 2DK5A 2ROLA 1STZA 4PK4A 2L0AA 2M0OA 3G1JA 2IA2A 1K4SA 2LMJA 2JM8A 4YIIA 5LJ3j 2DFHA 3CCRA 2JA2A 4U0WA 3IAM2 3TEDA 1PHTA 2JM9A 5D5WB 2STTA 2R4GA 1P9QC 4J7FA 4RAFA 5DD4A 1VOMA 2EGAA 5D6XA 3W2AA 4AFSC 5IYCJ 2Y9ZA 1WXTA 3BJOA 4XN0A 2ACJA 2LX7A 3HTSB 4DYCA 4BHBA 2VQHA 3HPWA 4ZN3A 4BI8B 2Y30A 5H6RA 2ID3A 3FBIB 1QP3A 4IHVA 4JYKA 3X24B 2COBA 2EB7A 1YTYA 5GANe 2LCLA 2E5KA 3CC7I 1U9NA 3L2VA 1LQ1A 3GW2A 2O6GE 2MD5A 3X28B 4C5HA 2UV1A 4A0YA 1YX5A 4OMZA 5CVIA 2P7CB 1ETWA 1Q1VA 3EUHC 5B3SH 1S5LC 5JVGF 2KP6A 2LF7A 3F72A 1WXBA 2DBMA 3I5SA 1WYXA 5D7UA 3JTHA 2KYBA 5ILUA 3RESA 2XSDC 2MF2A 4KN4X 3IRRA 3QWXX 2ZPGB 2I2LA 4F7UA 3M1CA 2VGNA 3TVTA 4LD5A 3U9GA 1OMIA 4MHGA 4G7HF 1YJ9T 2DL5A 2IS2A 2J06A 5D6WA 3BZ6A 1Z21A 3OYNA 4HF0A 4ENJA 5GMKj 2K5LA 1MBGA 4J9HA 1Q1HA 2F5FA 4DBQA 2LQKA 2LDUA 4JLIA 4BS9A 1VQ9T 2D6FA 3G71Q 4JBAA 4CSWA 1GVJA 2YUSA 2OD5A 3JRFA 1Y57A 1WQ7A 2H27A 3EHQA 2EGEA 3OIPA 1PKTA 1USTA 4CCOA 1QLYA 3CCMA 3REOA 2L3SA 1T39A 3FIFA 1YNZA 1S7AA 4JX5A 2HD0A 3JRHA 2XF5A 3QYBA 1POGA 1GXPA 3IP4B 3I4NJ 3E1SA 2CP7A 2L7KA 3ZMSA 4HNTA 4F7UE 2VXEA 2KYMA 5DUIA 2R5ZA 5HDKA 4BI4A 3EGDB 1LDKB 3NRVA 2M87A 3KYDB 1YRNB 1DGRM 5J8FA 2M0CA 2EBPA 3M8JA 1FP2A 4G7ZF 2DL3A 3MP8A 1BI3A 1WHKA 1S72Q 3H0GJ 1M30A 5A2QE 4P5NA 4L6V5 3HOVJ 1SEUA 1JGSA 2DMUA 4WF2A 1I3QJ 1UG2A 4S05A 1R00A 1O7FA 1X1BA 5IP9J 3J7ZI 3E6CC 2DXUA 4OWRB 2FZKB 4MFDA 4C3JJ 4UUTA 2A37A 2O01E 2XI9A 5GAOl 5GAN7 3R0JA 2Z0WA 4MTDA 3DPTA 1FSEA 2XF6A 3R6OA 4FT2A 1T0FA 3HSRA 4BQOA 1LNXA 1VQ6Q 2XAGA 3QYHB 3MEWA 4XONA 1QKWA 5LHGA 4IUVA 2EA4A 4OVAA 1T08B 1Z0XA 2LREA 3ME9A 1D3BB 3H3VK 1HSQA 2QK0A 3ZL7C 3I56Q 2V1UA 2P6TA 1PP7U 2OTJT 2E2IJ 1OOTA 2XAUA 1A31A 1RLQC 1ZGAA 2GQIA 2MG4A 3EUKL 1YI2I 2L8DA 2LTOA 2V8IA 2YT6A 1CKBA 4U7DA 1QVTA 2FBHA 2JA8J 4XLNF 5A0GA 3SDGA 3N05A 1E3OC 2CU7A 4E70A 2X1DA 3P9IA 3QP5A 1ZLKA 4BHCA 1LFPA 4M3GA 4UUVA 3DBHB 1IRGA 2GTOA 4MZMA 2CUBA 3KEQA 1ZG1A 4ASNA 1H641 1UJYA 4EATA 2KIFA 2VQGA 4UVAA 1JO8A 2BEOA 3CUQA 5ERIA 2IBDA 4KISA 3M0UA 4X1VA 1C1AA 3H36A 2X0LA 4MIMA 5BNGA 1UDLA 3QG1A 1KQ1A 4XSXF 4M7AA 1JU5C 1U5TB 3GX4X 4XTVA 2DF6A 2XC7A 3RZOJ 2LFBA 3CCLA 4J9FA 1GUUA 1K9MR 5AONA 2FX0A 2UXNA 2DXCA 3EGXB 1W0TA 3UF4A 2LF8A 1IRZA 5GMKi 5GAMe 3SWNC 4KT5C 3C95A 3M0SA 4XBFA 1DU0A 4LG0B 1IN6A 1UELB 2Y9YA 4UVCA 4B8XA 1NYGA 3G1LA 2VUBA 4PKCC 2WAQA 1NTCA 2B9SA 4D5FA 2EILH 4NUBA 4C3IJ 2CS3A 1ZRFA 3RMSA 1I5ZA 3HGGA 1EX4A 1KQSA 4UB6C 5CO7A 2BOLA 3M1EA 1FSHA 4JK1X 4S0HB 3GMEA 4S04A 2XIDA 4EM1A 1ZREA 4M6XA 2PJPA 4LUEA 4F14A 3FXRA 4HBLA 1WI7A 3CMEA 4X9DA 2Z9OA 2F5KA 1R6RA 3G1OA 5IYDJ 3CC4A 1TTYA 2V9PA 5FRNA 3JREA 4M7AE 4XTXA 3M57A 4RG8A 3M56A 3BG3A 3TKYA 2DA3A 2W25A 2ABLA 2XK0A 3LA3A 5CJ9A 2MI6A 2DN0A 3A01A 1QBJA 2FZCB 2CGPA 4XMYA 3HXLA 2FMYA 4L59A 4EMSA 1E6GA 5FFXA 1QCFA 3VV0A 4ELYC 2JZYA 4LLLA 3CC7Q 1M1GA 1ZR4A 3A8OB 2CZ7B 3OYYA 1T95A 1YJWI 1OJLA 4XRMA 1OYYA 1ZBXA 2OAWA 5IN1A 4D8KA 3TW6A 1MDMA 3IV5A 1WDXA 2KXCA 3KZYA 3BP8A 1S29A 1ODDA 3CMMA 4NQWB 3D5LA 3TO6A 5HLIA 4BE0A 2ZCWA 1IG7A 2BZ8A 2ESHA 3JCMV 3HB9A 4B09A 3S3OA 1VQKI 1FMKA 3LQQA 2ME0A 2YPRA 3SEMA 3BQYA 1M8VA 3VKIA 3H0DA 4OAYA 2QSGX 3FISA 1QW1A 1TS9A 3QZ5B 3G7ZA 1FT9A 1QZZA 5E8GA 5DY9A 5LRSA 4PJOB 1XSVA 1TW2A 3I0TA 1Z9CA 3VS7A 4XR6A 4F55A 2QBYA 3Q5FA 3VRZA 3WTSC 1HLVA 3T5XA 3M54A 2VJIA 2HGCA 2ID6A 2HPIA 4HCBA 3UATA 4A6EA 3CQTA 2W10A 5B66C 1B7TA 3FXMA 3ZXSA 4BL0B 2RQTA 2RREA 1IJWC 2E12A 3OBYA 2YSRA 1WZOA 4GLMA 3RMQA 4E47A 3DXJF 3OOPA 3TREA 2E2HJ 5JLXA 3TP3A 2DBBA 3BY7A 5GAHJ 3QDRB 4PJOF 2LT4A 3ZGKA 3GLXA 1SFXA 1IV6A 1OX9A 3ASNH 4HVWA 2OZUA 3AFHA 4RAYA 5KYYB 3CPWA 2PZ1A 3LW5E 4M78G 4QQDA 3FMSA 1D1AA 2VKVA 4ON0A 1VYTA 2M16A 3REAB 3JCMJ 3A8MB 3FC3A 3CC2T 1R1VA 4M7DA 3JCMX 4PJOC 1ZYRF 1RL2A 3F8CA 2ZB9A 3G1MA 4GGGA 4D5CA 1NK3P 1FTTA 1N9SA 1OCPA 1WPYA 4NL3A 4PJOD 1OKRA 5IHKA 2HYFA 2KRNA 1HC8A 3BCAA 3CCRI 1J59A 1KK7A 2IIMA 2K7LA 1X3ZB 3KP6A 1S8NA 1X19A 2VODA 4C0GA 1OQYA 2BVLA 4EEFG 4IOCF 1SD6A 3OMYA 4P5OA 4XNFA 4II1A 3B02A 2WTEA 2ZFUA 1Y0MA 4A54A 1YIJI 4IIOA 2PQWA 3UNGC 3R6NA 1R22A 2E3IA 1E0EA 3H9NA 4A4GA 1IZ6A 2ICWG 4UC4A 4CCNA 1FIPA 2X3XD 2HFHA 5GAMf 2V1XA 3QDFA 4LDXA 2VLAA 2PQ8A 2EIJH 2IAIA 2CW8A 3EFRA 4XKCA 2FPEA 4EM2A 3NEUA 2IP2A 2JZ2A 4M7DE 3VYGA 5KE2A 1FC3A 5CQGA 1M27C 1YI2Q 2BHZA 3K0LA 1QU3A 3CLOA 2DPDA 1KU3A 2P84A 1TLHB 3Q1JA 1YCSB 4MDWA 1WHUA 1K7AA 3Q0UA 2O2OA 2R58A 2X1EA 2XUBA 2V9KA 1SANA 4O5VA 4AIHA 1I81A 3PMIA 2HTJA 2L0KA 3B6CA 1X4OA 1JHFA 2LYCA 3BG5A 1FEXA 1EV7A 1NH3A 5GAMg 1TWFJ 3IKVA 4D6WA 2C0TA 4EDUA 4DBFA 3PIOF 3IUOA 2DPPB 2R5ZB 3LGFA 2CS7A 1U5SA 3MKZA 1PM3A 4JX4A 4RM3A 1VUBA 2KY9A 1OR7A 4IVNA 1M1EB 4R56A 2P5KA 5F1JA 1RAEB 2DA1A 3L2UA 3W2VA 1IC8A 4C2UA 3MQ0A 2M9UA 5IOYA 2R7TA 4N9HA 4M77F 2O61A 2GXAA 3O5ZA 4YTLA 2H3EB 3HPHA 2AIRB 3SDZA 2GFUA 5KYUB 3P5JA 4PJNA 1JE8A 3QU3A 4IO9F 2CFXA 1ZQ1A 2ZJPF 4DOWA 4BQNA 2FPFA 2A5YB 3D5RC 1NEBA 2RA2A 1QVFP 5LJ5h 4M77C 2VPLA 6AT1B 4B47A 3CD6T 2XPUA 5CYVA 4Z6YA 2K57A 3CMAT 3DU6A 3HGYA 3VS3A 4OGCA 1G3WA 1GL5A 3O3KA 2IJLA 4M77D 2YU3A 3GTJJ 5IT9K 2E7XA 5I22A 1K4US 4G8XA 1Z9QA 1FP1D 3K9TA 1MMDA 4ZGEB 3CCJQ 3OBWA 5F27A 2VGMA 3PJRA 4C8QA 1E6HA 2X4XA 2VE8A 1NG6A 4A0ZA 4KRTA 4OGEA 5K7ZA 3DTKA 2Y31A 3KIOA 3RTRA 1VQOQ 3X26B 2QSHX 3D0SA 3DKYA 2CV0A 3JRCA 2A08A 4HCKA 1CKAA 2DYBA 3L2ZA 4ABZA 2HQHA 3FLGA 3JB9F 1M3BA 1QQIA 4QVDA 5J3LA 1IXSB 1PSFA 4FSSA 2ISZA 3CUQB 3QSUA 3BTCA 3ROUA 2D8HA 4KA4A 3ZQLA 3S1RJ 4MMKA 9ATCB 2E34A 4RB2C 2YX4A 3WGGA 4IUPA 2HTSA 3OS1A 2DO3A 1SMTA 4HEA2 2QDYB 3M0QA 1M90U 2HOEA 1WCMJ 4J6XA 1K8AU 2JMAA 2IEKA 2LR8A 3A03A 4QLCU 3MCZA 2HZTA 2VJJA 2XGEA 2JNGA 2E35A 1BB9A 5E3OA 3SB2A 5FFZA 1IO6A 3JB9D 5EG2A 3SEQA 2CV2A 1VQ8T 4MDXA 1K0SA 4AU7A 3BCBA 1JT6A 4I09A 4RBOA 4B3AA 1U0JA 3QPHA 4RGXA 3WE2A 4ENMA 3QBYA 1VQ5A 3FXQA 4ZYDA 5K7HA 2X6XA 2K9SA 2EBIA 5GADJ 3DP7A 2KVQG 3A8LB 2VV5A 4J19A 3BROA 2DIGA 5FU6B 2MA3A 3JAMK 3ZPLA 2KEAA 3DB3A 3CCYA 1AA7A 1TW3A 3GPLA 3I54A 1WJRA 3LLRA 3FZVA 1RUNA 3CCLI 2JJ7A 4B44A 4A3LJ 1KD1U 2L9RA 3C2GA 3G4ST 4LIVA 1IHVA 3WHBA 4UV8A 3BFMA 3C2BA 4QKUA 4I0AA 4BXFA 4DZPA 5KCMA 1FBUA 2CUZA 3RPUD 4IQJA 4RS8A 3CCUA 2DA6A 4DGWB 4U7BA 1BR2A 2F4OB 4ZTFA 2KRMA 4Z89A 4P9UA 4XRFA 3MEXA 4UXNA 2YRVA 3EGUA 3CCSA 3JW4A 2F48A 3V7SA 1YJNI 1WLPB 2DDAA 4A4HA 2DJZA 1A0NB 1OULA 3CMEI 3MZYA 2PLYA 1R77A 4C0DB 5IXFA 2VKHA 4ZH4F 1MDMB 5FU6C 1WI3A 2G6FX 3CCRQ 3MAJA 1WKMA 1RAFB 3MO8A 1O3TA 2GIZA 2X6OA 4RGSA 3S1NJ 4Z8AA 4ZGDB 3SDBA 1JXSA 3FMQA 1R9TJ 1NPRA 1XCVA 3OL3A 4XLFA 4AVPA 3MWMA 2AHJB 3VPRA 2XKOA 2JOYA 2DZ9A 2GXBA 2F4IA 1N6AA 5JHFA 2NYXA 1V55H 1I1SA 2QKLB 3CCET 3QZ9B 3BPVA 4HCZA 3ZCOA 2VI6A 3AKZA 4BUPA 4L18B 1ZG5A 3A0BC 1WQ2A 2O0YA 3DTEA 4UB8C 1UZCA 3ZOBA 1K79A 2QBYB 3B6AA 2DXBA 4GLKA 2M02A 1B3QA 3ZMTA 3FF5A 3EUHA 3KPHA 2EYWA 2F5TX 2NVTJ 2DL4A 1LE8A 4FSXA 2NNNA 4IF4A 5L3BA 1TBXA 1QVPA 3COAC 5D5XB 2DD4A 4C0DC 2CREA 1KU9A 2Z33A 2D5VA 3PT9A 1XGNA 4Y91A 1MMSA 1ZGJA 3Q3SA 1VQPA 3K70C 2QKMB 2VT2A 4X9CA 3R0AA 4P9FA 1I50J 4KNYA 2DYIA 1YCYA 5C4XJ 2JUCA 3J7AY 4M7DB 5GPCA 3CDHA 1SSFA 1YS6A 2LKSA 4ESFA 4MNUA 2KGTA 2M7AA 1X3WB 2KRFA 3PUBA 5D5UB 3EG1A 3RPQA 2KROA 4F92B 2HBPA 5C6SA 1DJ7B 3OY9A 1A6QA 1GCPA 3FX3A 3M7GA 5LBQA 3PNVA 3F6VA 3MN2A 4EMKB 1G83A 3BDLA 3A98A 2LY9A 2E1NA 4IRHA 5DS9A 2RDPA 3CCMQ 3L42A 1B9MA 1R23A 3Q0VA 5J1RA 2ZCFB 2KKOA 1QGPA 5KE3A 3V4GA 3KX2A 2HSEB 5C3EJ 3BT9A 5LJ3d 5KYXB 3S1QJ 1I5LA 2ZJQF 3DEEA 4IKFA 4LUDA 4C5IA 2CZ6B 1B9NA 1OPLA 1TOVA 5HCKA 3CCQQ 2KIUA 4JZ3A 1X2NA 3G6EQ 2STWA 1Z77A 4NB5A 2XROA 2BE7D 2YUPA 4E7IA 1IN4A 3BTIA 5IT9E 3OSGA 2RM4A 3KETA 1P7IA 3LSJA 3H5RA 3CQZJ 4QQ6A 4M9XA 3IWZA 1UHFA 4WTOB 1BA5A 4OMYA 4B43A 3OYEA 2RQVA 2WB1N 2EKOA 3BWGA 3ASKA 3H9GA 3I58A 4CZCA 4K11A 1G3TA 2ZXHA 3RI4A 2F2WA 4LD6A 4EMKC 2J7IA 2VJ5A 4L9TA 5GANh 2BGCA 3HOTA 1L3LA 1M1KR 2F5VA 2PMZA 3J81Z 2C0OA 2KNBB 2JJ9A 3THKA 2EJRA 2WY7Q 2DQLA 1TWCJ 4EJTA 3C3WA 1GRIA 1VA7A 1X43A 4HQMA 1YJ9A 2PX9A 1D1CA 3M8EA 3GNGA 1F1ZA 1TNTA 1WJAA 4L5JA 2Y0SA 5GTIC 5LLQA 3BG6A 3GYHX 3CO7C 1QO0D 4IX7A 1ZGWA 1T38A 2K5CA 1YRNA 1LOJA 3I35A 4J9GA 3G71T 1SEMA 1M1KC 4HT9A 2LVMA 1VQ9A 1TTHB 2E1CA 2PMHA 3CJRB 5AIQA 2JUGA 2VXZA 1AHDP 2R5MA 1IO2A 3WE3A 4IHYA 3BR0A 4JX6A 4OINF 2VB6A 2F2XA 2KQWA 3GIBA 3GBQA 2F2VA 2W7NA 2QF7A 1KQ8A 3R60A 2CKKA 1RACB 3I5RA 4XRSG 4QTRA 1TWHJ 2O3FA 2M51A 2CSOA 3JRIA 3QWLA 2XRNA 3M0TA 1T2KA 1FZPB 3JAME 1J9IA 1Y39A 2LRQA 2MIOA 1KGSA 3PO3J 3A8HB 1F1BB 2JRTA 5CPRB 1D3BA 1HCRA 2GCXA 3U21A 1X1AA 3LFKA 4UV9A 2RQRA 4QVCA 3EH2A 1S72T 3PUFA 2WSEE 4XTYA 3SWNA 1RAAB 3J80Z 1X75C 5GMKl 3ULQB 1WJBA 2RNJA 1QPIA 3HFNA 1FMWA 1NJIU 2CP0A 4A3FJ 1MNEA 2EV6A 1FY7A 3ERED 2DBKA 1GBRA 1HSTA 3NARA 1ZA1B 3OB9A 1VQMT 1VQ6T 2X4HA 2DTIA 4KIGA 3MFKA 1HA8A 2FB7A 3LGLA 3JSOA 4LN2A 2DFEA 1X58A 4FTHA 2YRCA 4HVUA 1VQLT 1JEGA 2QENA 3CMEQ 3I56T 2R7XA 1UJ0A 5FWCA 2A3SA 3CC4Q 2L4MA 2QQ8A 4AFQC 1WI9A 1R5GA 3VYRB 3OYHA 1FYMA 2H94A 2KDOA 1GFCA 1UE9A 1X27A 2E7WA 4XKBA 3S93A 5EEAA 2A7YA 2LT1A 3EGXA 4OB3B 2ED0A 2QYZA 4PL6A 2K9QA 5HVQC 3BE3A 5F1RA 2FOKA 4LG0A 2K40A 2KI7A 2FL7A 4Q5SF 2OCEA 4UNOA 4XTWA 1ZRDA 3I53A 2DXTA 1IHWA 1SAUA 2QQ9A 2GNCA 2LX9A 2QCOA 4MMLA 4PCQA 3KCCA 3EYIA 4M78F 4FT8A 3RR6A 1M90R 3V8LA 4ZTJA 4J8OA 5IHNA 2VXDA 4M73A 3JB9J 1SAXA 2QI2A 2HVQA 4CYCB 4ZYEA 5CVJA 1WGXA 2AXLA 2EYXA 1W2BS 1WHGA 1M90C 4M78C 2LLKA 3BZCA 1VQKA 2XGCA 2L7ZA 1Z6TA 3EGDA 2WA0A 4M78D 1J0RA 3L09A 4HKEA 5ECAA 1SFEA 1VQ5I 4A69C 3MP1A 3CCVI 3LSKA 1Z91A 3KYCB 4A63B 4O6JA 1HK9A 3MJXA 3PSFA 2ZPIB 4YIFA 2LKXA 4BI3A 2LD5A 5E17F 2DZCA 3I4MJ 3KLOA 3RKWA 3HJEA 2JTEA 2O4XB 4AYBN 8ATCB 2PVDB 3HUGB 2LJ1A 1BK2A 1SVMA 1KD1R 3S14J 5K5OA 4KULA 2MD0A 3EUAA 4XORA 2KSSA 2Y69H 2KZVA 4EMGA 1UHWA 4M74A 4NQWA 3R4KA 4IUQA 3LAJA 4XAXB 1W2BA 3WG7H 4NNJA 4LDYA 2X6YA 2WWYA 4RAZA 2FVUA 1FX7A 1R4MB 5LJ5g 4BKXA 5CK9A 2KRCA 3UKGA 1KD1C 3SZTA 2EA2A 1D0ZA 2LK2A 2W57A 3BLYA 3HBLA 2JMCA 4RGUA 3FM3A 2LJ0A 3HOUJ 2FE3A 2I8DA 3OYMA 4K2EA 4PJOA 4J6WA 2EINH 3HOWJ 3WVEB 2KDSA 1W5TA 4BHPA 1KU7A 2PBIA 3CCSI 3F70A 4JDSA 4DQ2A 2AK5A 3VOEA 2DJQA 4RTVA 2OX7A 4I98B 4U88A 4E6KG 1MW7A 1UEBA 2EFWA 3JCMd 3KP4A 4BYYA 1LE8B 2Y48A 2LNHB 1FYLA 1JQQA 3BDDA 2K9GA 2DE0X 1SRMA 2R7VA 2MGQA 2COZA 1AKHB 3LWIA 3UDCA 2HZDA 2WACA 4NBQA 2PVGB 1AEYA 1ENHA 2DMTA 2H6CA 2DXIA 5H6QA 3URGA 1IN7A 2O9LA 4HA8A 3IL2A 1ZHFA 5L3GA 4RKUE 5KYYA 4I0BA 1HF0A 1W7PB 4V2FA 2KE9A 3CJTB 2RHIA 1R0BG 1VQNQ 4RA2A 1AD5A 3C2HA 3GFMA 3S3NA 1U06A 3FHNA 3S8PA 3VODA 2KT8A 3EAEA 4Y15A 3GZNB 4Y33A 1TWBA 1N8RU 2DETA 1ARKA 1QVFA 1LPQA 1K6YA 5B1BH 4EJOA 2EZKA 1E3PA 2MC4A 4PJOE 1O9SA 2HKXA 3GFLA 3PFSA 3W6VA 1RAHB 3CBPA 2RC4A 1K73U 5AT1B 4HSRA 3LMMA 3OYAA 5J4VA 3JCMP 1WHLA 1L0OC 3CBMA 1XX5A 4RB3C 4C9YA 2DA2A 1AWWA 4HLYA 4D9JA 2ADUA 4AIJA 1RC9A 2GQQA 1VQPI 4CC4B 3KXTA 1I39A 2EZLA 5LGNA 1UHCA 1G6NA 2DI3A 2LSOA 2DTHA 1Q82U 4BDYA 3M0RA 2P4RA 3HHHA 3KP3A 2ZPFB 1F4KA 4A4KA 2KLOA 4ITVA 1Z7UA 1XG1A 2VVKA 1ZUKA 4L0YB 5A0DA 2WV0A 2W82A 2FXAA 1B1BA 4KMUX 1OYWA 3V8JA 4F17A 2CO5A 5F6FA 1Y71A 2BW3B 4GYGA 3PIOA 2OQRA 3MEUA 3VS0A 1X2MA 4EJWA 1BIBA 2ZO4A 4OIOF 1W7PD 2R7UA 4NOYA 1WFXA 3OS0A 3DBRB 2JXBA 4A53A 1QMCA 2FU4A 5CKEA 3MVPA 1BJAA 3H35A 4MFEA 2DL8A 1W70A 4HF1A 3P8BB 1ONVA 1VQ7Q 1J3TA 4KUMA 3OYCA 1G3YA 1K76A 2B86A 2J05A 3M53A 3HL8A 4M77A 4BUGA 2KAFA 4P55A 2I10A 1ZUYA 3E97A 1VZ0A 1X1CA 1BI2A 2F5CA 4OF1A 3I71A 2LH9A 1RPWA 1RUOA 2EYYA 2OAUA 3ZRGA 2E5NA 3MPUB 1VQLQ 2EZIA 2A68F 2XF7A 4UY8I 1WJQA 1P4WA 5DLQE 2GZWA 3HKZA 3WGHA 3VU3C 1VQ4Q 4R0KA 1JUPA 2A05A 2WBMA 5ICGA 5GAN8 1N77A 1ETOA 1K4TA 3CMYA 2A0FB 3AL0B 2BZXA 2HKOA 1JRIA 2NYSA 1O75A 5KYUA 2QQAA 4BJ5C 3EG0A 3DPUA 2OTLA 2VONA 3IKTA 3KUFA 3LH5A 3ISPA 4XKVA 3F22A 2W85A 4JRPA 1D8JA 1RRJA 1EH8A 3F6OA 5HLGA 3V42A 2BE5F 2HEOA 2AT1B 1YJ9I 2LBFB 2G9WA 4M77E 4LG3A 2EFQA 1XNIA 4JPBW 2MW8A 2RF0A 1OCRH 2F1LA 1BIAA 1TQMA 1MJ9A 3CP2A 1VQ9I 2KIQA 4BAYA 3CUOA 5E1ZB 3BJ6A 1MBJA 2DYRH 5GAEJ 2EQJA 4E7HA 4BJTA 2GTJA 2XMFA 3BR2A 4G7OF 5CQXA 2PNIA 4XK8E 2DOAA 2G7UA 4R79A 4L0ZB 4E2FB 1PD1A 1PSEA 2HXIA 2YDLA 1FOYA 2QEXT 1JTXA 2RO0A 1R58A 1C6VX 3AL0C 1VQ5Q 2MBFA 5D6FA 4KFCA 1B6AA 1A36A 1MZBA 4M3DA 2XAHA 2Z1DA 3U1DA 2CUDA 4CDGA 1D1BA 5FKKA 2BV6A 5IY5H 5IH2A 1K9MU 3VUBA 3CD6A 2COWA 3CMAA 1A35A 5K1YA 1O57A 2LC4A 4IPAA 1BOBA 2O7OA 2BBYA 2E36A 3V8KA 1XN7A 1W4MA 2P4WA 2DVJA 3CCJT 2CH4W 2L7MP 3FMRA 3FWEA 2CUEA 1NJIR 4LDUA 2FSWA 3I55Q 2IRFG 1OCOH 4ZJZA 4LB5A 2JVVA 2H09A 2L9SA 3S2DJ 5GANf 1VQOT 3JRGA 1BBYA 2Y90A 5BS6A 2HCKA 2KT1A 3CCUQ 5JR3A 1UFMA 2NNYA 5AIPA 3Q9VA 5GPAA 4F52A 1UB4A 3LSHA 4LJZF 3LFUA 4KN7X 1AWJA 1ZSGA 2VYTA 2HOAA 2RV8A 3MKDA 1NJIC 3CCSQ 1H3HA 3OL4A 2A61A 4ZYHA 4M6VA 1YJNA 4KJZA 2LKPA 2PEXA 4IQ4A 1MMNA 2DIQA 4GBQA 3K2ZA 2FEIA 1W1WE 5BPDA 1UG1A 1HDPA 3MZHA 5CIUA 1GBQA 3N97A 2RAEA 2QTVA 3WGIA 1FYKA 5GANg 1MH4A 2XDBA 2R7QA 1VQ8A 1UUEA 1IW7F 4HW0A 3LYIA 1N27A 4XLAA 1F43A 1N9RA 3VB2A 2JTFA 4J00A 5HNFA 3ZEHA 1EKEA 3PFIA 1G3SA 4ATOA 4LLNA 1WJDA 2WY8Q 5ICFA 2RHXA 2ZXWH 3ZN1A 2ZFWA 5LHHA 2OZ6A 4B4CA 1RI7A 5A0LA 3K4NA 2KPMA 4MZTA 5LEJA 2YX7A 1M3AA 2RB6A 4DOZA 2CV1A 4IL6C 2FNAA 1Z7LA 3SJMA 4PGGA 4X34A 1SPKA 1J5YA 1YITA 3QO3A 5FKOA 2VOPA 2R7WA 2QGGA 2EYZA 1ITYA 1R1TA 2LNBA 3BZKA 2K3FA 4ZNXA 1QNTA 5C0MA 3LSIA 2JMWA 2ZNZA 1RNLA 1YS7A 2DFUA 4OIQF 1J09A 2OC6A 2IG0A 2FQ3A 5M3MJ 2HEQA 5F0FA 2KMTA 2EWNA 1RABB 2R57A 4FW1A 1P2FA 1D0YA 1X4PA 4N9IA 5B5EC 4A3GJ 2PG4A 4XOTA 1ZRCA 2R0QC 1TUCA 5GAOq 3AAFA 1ETKA 4GCVA 2K79A 1SG5A 3EFOB 3E7LA 1T33A 1KC8R 4XL9A 1JXMA 1ZR2A 2RI2A 1OFCX 5F04A 3AG2H 5E3LA 1W1FA 3CCRT 1WIEA 2FOWA 4A3BJ 1VI0A 5J47A 5CVVA 3CZ6A 3TMOA 3I4PA 3M5AA 5D6EA 3EG2A 5IPAA 4H0EA 3ZQHA 1KC8C 1T6SA 2TCTA 4BU2A 2LQ8A 5HOOA 1HXDA 3LX7A 2BZTA 6PAXA 2E1MB 5FJ8J 3WU0A 1EH6A 3F8FA 3HSFA 1BM9A 3CDLA 3K1MA 3M9AA 1NPPA 2E6NA 2K9NA 3O8VA 3K4MA 1B8IB 3DLLF 2NLUA 3KFWX 1TG0A 1QP2A 2BY1A 1FOWA 2HNHA 1FMVA 2DRMA 1C0MA 2AXTC 1OCZH 2QQRA 4N4GA 2QA4T 3PM1A 5GAN3 2ZJ2A 3J7AF 3X2QH 5HLTA 1YOVB 1JJ8C 3L2RA 4JRKA 3N5BB 2DPUA 4EMKA 4KH0B 5LJ5j 1UFFA 3S3MA 4Y52J 2DT5A 2K4YA 3ABUA 4RB0A 3LSPA 3RKYA 4NHJA 1FTZA 2QTXA 5FW9A 3QPSA 3L00A 3K6GA 3G3ZA 2KMUA 3BTJA 3Q9SA 2LMDA 5KYXA 1S3JA 3L7WA 3ZN0A 3ZMZA 2IS4A 5GP9A 2BY2A 2LG4A 1J75A 1MNDA 2PI0A 3VSLA 3JSCA 2AQEA 1YJ9Q 2GQVA 2LP5A 3T8TA 2E1MC 4NS5A 5LJ3e 2DT6A 3A02A 1XSDA 1Z3XA 1PUFA 3DFGA 1EIFA 4M75G 5J1YA 1QZYA 3QRFF 3OV8A 4EJUA 3FBNB 2NRAC 3CF5F 4MEXF 2K5IA 1JGGA 1W2BP 1K73R 1VQ9Q 1G2HA 5E3MA 3OQ5A 2V1QA 1N8RC 2W84A 2EQIA 3OR1C 4BXUA 4B1RA 2BIVA 2KRSA 5J4YA 4GYIA 3CCMT 2W0ZA 4HCCA 2W24A 5HS8A 1P6RA 1U6GA 2BXZA 1K73C 1Q82R 4FE7A 1WWXA 1FNNA 3FK7A 3BQZA 2EIFA 4M77B 3IWFA 4AM3A 1PC0A 2K4BA 3MKYB 4LDWA 3CCQT 3DTIA 1XMAA 3C94A 4J9EA 2CP2A 2CH0A 1D5VA 1ZLMA 3G6ET 5C44J 2E1HA 4ESBA 5IHIA 3FXKA 3CC2I 2LRDA 2ZNYA 3H3ZA 4I6ZA 3C7JA 1Q82C 4M3BA 3K2AA 2FRYA 2L7FP 1Z05A 5F0HA 3HOZJ 4N4HA 2DA7A 5DDGA 2V8JA 4N4NB 4XKWA 2AQFA 2V9VA 2BY0A 1M5Q1 2L2PA 2FG0A 1XDUA 1ZHIA 1R5HA 1UHSA 2EV5A 1BN5A 2ZKZA 1WJCA 3QOPA 4PSXA 2JS2A 2QLZA 2IA1A 4J7IA 3C0CA 1BI0A 4C92G 1BR1A 1Y7XA 2DJIA 3D5SC 2EFIA 1ZKGA 2QZ8A 2QYOA 1N78A 3WTWC 3KYLA 4D7MA 5GMKe 2OCCH 3KP2A 5KK1A 4ETSA 2FO0A 3K69A 1A6IA 2BY3A 1QWEA 5FD5A 5ILVA 1AZGB 1ON1A 1XGOA 2O9SA 1OCTC 1WNLA 2RJEA 1GCQC 2WSFE 4HX8A 3QUIA 1RADB 3TEEA 4LDVA 5D4SA 4PUSA 2FNPA 2FRHA 1OPCA 2XV4S 4XK4A 3GTMJ 2CZ0B 3H5AA 1SD5A 2Y0SN 3BR5A 4ENKA 4FYYB 3INZA 4F93B 4BJ6C 2E4HA 3FJ5A 2CSIA 2J6OA 5GAOm 3RKXA 2GA1A 5TJJA 1V1CA 3X25B 2XRLA 1GLNA 2GOMA 2R7OA 2X51A 1R49A 2CT4A 2HDWA 3NHNA 5FLXZ 3TQ7P 3E5QA 1K78B 1ACIA 2OTLI 2R5YB 2X35A 3UA6A 3S6WA 1VTNC 1G2BA 1KYWA 1G59A 2IVMA 2JS0A 3HPGA 3IH4A 5FD6A 1WRJA 2KZGA 1WA7A 3ECOA 1SHGA 3HSEA 3JB9I 2YLCA 3K4CA 3E5XA 4BE1A 4EM0B 5M3FJ 2GA2A 4MEYF 1YJWQ 1WH7A 4IXAA 4FM4B 2OAZA 2MPXC 1I8FA 2ESWA 4M78A 3OS2A 2X9DA 2MWOA 3NTIA 4U0YA 2EK5A 5KHDA 2JPBA 4QQGA 5KCOA 3E2UA 3RCOA 1VQKQ 4V2SA 2RD1A 4FE4A 3L2QA 5K5RA 2K5FA 2IW5A 1LVAA 2D8JA 2MH9A 2IXSA 5ILSA 3PVLA 5TGTA 1HSJA 4XLPF 2QGUA 4M72A 1KQ2A 3DWLE 3HSBA 3SFZA 5K5QA 3CCVA 4M71A 4DYQA 3FKIJ 1LDDA 3H9QA 3LA7A 4I99C 4IOAF 1MV3A 2DMOA 1VQMA 4A12A 1TH7A 3WTTC 3NTHA 1YHQA 2HR3A 3CD6I 5HKCA 3CMET 3CMAI 1SKUB 5M5XJ 4HG2A 2EFOA 2KIMA 2VASA 4GXOA 4CUGA 4BNCA 2DKGA 3CC4T 5EEHA 4J9BA 1XGMA 3I56A 1KQ0A 1JUSA 4CYCA 1K9MC 5FKLA 1YW8A 2YR2A 1UGVA 2XDPA 3HRTA 4G6DA 3OMGA 3HHGA 4KT0E 2AZSA 3O8GA 2Y4XA 3UWNA 1Y1WJ 2EJFA 3PMTA 2DA9A 4IHXA 4M78E 3K10A 5J26A 1I0CA 2CJJA 1B4AA 1OZ2A 1WHHA 4RMOA 2ROTA 3OW2S 2A6TA 3CESA 1LB2A 3NMZC 2RQPA 1R0CB 2A6EF 4RTTA 2NUTB 3C1DA 1S9HA 3OA6A 3GLLA 1CF7B 2RHZA 1SFOJ 2R7DA 4Y13A 2KBTA 2O8XA 2O4XA 4LITA 5EG0A 3HG9A 1USSA 1V76A 3HUGA 4CHUA 1A5JA 1H8KA 2DVEA 4XU1A 1FIAA 2HQNA 3JCMb 2F2EA 5F0CA 2ECCA 4RTZA 4HV6A 5J8CA 2WAEA 1NE8A 2W1OA 4AIDA 4ME7A 3ABMH 3LSGA 1VQ8I 2X4WA 2ZPEB 2IS6A 2R7FA 1E7OA 3FM5A 5F08A 5KNLA 3NPFA 1FBQA 1YIJQ 4YFXF 1Y07A 3OW2A 1ZX6A 2QUFA 3OOUA 2V79A 4U0VA 2JUFA 1TT5B 3GP8A 1M1FA 1VYVA 3CXCP 4QSHA 4DIQA 5IYBJ 4MGRA 2A3LA 2AZVA 4JJBA 4AG2C 5HDNA 1O7LA 3TW7A 4CC2A 2LTPA 1EFNA 2A36A 3H5NA 4PJMA 2JA5J 1PVEA 4XIDA 3WTXC 5KYWB 2HVRA 1YITI 4C0ZA 1W5SA 2XDDA 2GM4A 4WWCA 2RPNA 3HOYJ 3G4SI 3CP8A 4P96A 4PZJA 2H1LA 5LGUA 2L01A 4UUSB 2D45A 1AKHA 5H2FC 3GTPJ 1OX8A 5L3FA 4RTYA 3JCMe 3C18A 1BCMA 2DOEA 5JI6A 4HPQA 2I5UA 2GBYA 5CQYA 2EIMH 2MLGA 1IUYA 1LCKA 4OMFB 2JN0A 1W7PA 3L2WA 2KJCA 1MIJA 1KA8A 1PP8F 2XIGA 3VUZA 2XAJA 1MBEA 3F8BA 5K7FA 1AWCA 1RAIB 1XOVA 2E71A 1YN8A 2D0NA 4RAGA 2EQMA 2QG9B 5EJCA 3OYFA 3ECHA 2V1RA 2YRDA 3DKMA 5CVUA 3ABTA 2C06A 4C92E 2DA5A 2RHYA 2P5LC 2PU9B 3QKJA 1LEBA 1XQHA 2ZXJA 1UG0A 2D9TA 2LVSA 1TQPA 4X6AJ 2PUOB 1FPQA 1LPLA 1RAGB 3QPLA 3OYIA 2NS8A 1BR4A 3K1NA 2WC2A 2E64A 3FK6A 2R3SA 4RLFA 2VL8A 5D4RA 1UGSB 1VQNT 2BHYA 3JRAA 4HDUA 1OYXA 1ZUUA 3I59A 1R5ID 2DAQA 2DX1A 2FA5A 2MLKA 3VYSB 1NM7A 3TSZA 2OQGA 2XVCA 2JTMA 1P92A 1BW5A 2XKPA 3Q0WA 4PJ0C 3MKWB 4IRGA 2JW4A 3ZMDA 2CQNA 1CGPA 2BW3A 5JHUA 4W97A 3VS2A 1X3UA 4QWQA 3GEZA 3GZ6A 2M1BA 4JQFA 3NFCA 3PNWC 4I2OA 2XD0A 1QA6A 3J81K 1W5CC 2NVQJ 2E10A 2LCSA 2QVOA 3HIFA 3WU1B 2OTLQ 3ZQCA 4IEJA 4A3CJ 3VJPA 1XTAA 2DTZA 3RQ4A 4MQVA 1OYIA 2H1KA 1EF4A 2E19A 4BBSJ 1LFUP 2CP3A 1P4XA 3S32A 1RIOH 2FHDA 4LK1F 1I5OB 2YSQA 4LNPA 4QVZA 4H4KC 4ELZC 2K3PA 4KUDK 1OU8A 4MTEA 2HBWA 3TDUC 3TCJA 2IVWA 4CCKA 1M2OA 5EC7A 1X6BA 2M8EA 2YUQA 3NAUA 3L1PA 1S7EA 3IRQA 3N4MA 1FOKA 1YYVA 4EQQA 3W2WA 4A3KJ 3V7RA 1WH5A 1X6GA 3OS5A 1VQ7T 2V1DA 2LOOA 3DKXA 2OPTA 4OIRF 1R71A 3UT1A 1BKBA 2HNIA 4LB6B 5DLOA 2A69F 3U2RA 4QT7A 2HYJA 3OYKA 3SWNB 2YWWA 5FGMA 3FEOA 1PYVA 5M5YJ 3HTRA 4WCIA 3AHUA 3CD6Q 5CQEA 2CUFA 4BEHB 4CO8A 4WK8F 3F21A 2HXOA 2NUZA 2GLOA 3U23A 2LBFA 3J80K 1JKPC 5CKFA 1V54H 4Z02A 3CJNA 4DNCA 4HF2A 2DD5A 3CCLQ 1VQ4T 4A3JJ 2OF7A 3VYUB 2EKHA 2FF4A 2V26A 4HAMA 1PNJA 3E9GA 4RCBA 1O3RA 1TNSA 2HU9A 4KGVB 2L3RA 2O31A 4KH1B 2OA4A 3KEYA 1PJRA 1XMXA 1Y0UA 2DJNA 2M2EA 4A5MA 4EJVA 4EGYA 4R1HA 3VWBA 1HOMA 2L3QA 5GJWB 2HSPA 3HEFA 3GTLJ 3ER0A 4MO7A 3OYLA 4RM2A 5L3DA 2KL4A 3CPFA 5GAMj 2P5VA 1T0HA 1I4K1 2K3BA 3SQNA 1JUMA 4BE2A 2DNUA 1YJNQ 2IA0A 2M0YA 2FBKA 4CH7A 2E6ZA 2XICA 1OCCH 1QHHD 2I0NA 2BVMA 3LL7A 5TISC 2HYGD 3QXEB 2JT1A 3CTAA 4EPCA 2OJED 5CKDA 2LP0A 3MZ8A 4M78B 2CH4A 1X2QA 4LXCA 5DEQA 5HK3A 2OTJA 2ESNA 4L9VA 1YO5C 1X1PA 3PIPF 1OR7C 3LOCA 1SF9A 1U9OA 2NOJB 1HDDC 4B3XA 1VQ8Q 2DU9A 4Q48A 2Z2SB 2X3WD 4W1UA 3RDIA 1K61A 2ZMEB 1OU9A 4II3A 5GAN4 5IOZA 2QEXA 2DL7A 4XQ3A 4PLIA 3SXYA 1QVGS 2YLBA 1KU2A 5C4JJ 1MGQA 2AKLA 7AT1B 1U3OA 1A04A 1UJ8A 2DFFA 2R7ZJ 1M9SA 4F7UG 4PNOA 1K8AR 2KQRA 2MAMA 3F3XA 3QJYA 4FHTA 2HOTA 3E6DA 4BY1J 5E79C 3QP6A 1JTYA 5L3CA 1TL8A 1OV3A 1YITQ 5FB2A 1SMYF 3I55T 2QQSA 3KLNA 2RN8A 5EDNA 4M75B 2JA6J 2VT3A 1K8AC 1QQJA 2GGRA 2DMQA 2GXGA 3TBIA 2DTRA 1VNDA 1I1JA 3PTAA 4AC0A 3CCUT 3A8GB 2P8TA 3G2BA 3W3CA 5GAGJ 3SHWA 3CCST 1IZ1A 1I07A 5TRDA 4NDLA 2WAQN 1VQMI 1VQ6I 2ZMEC 4II2A 3VDXA 1YHQI 1FLIA 2FYKA 3A1YA 2WAFA 1QVGA 5EG0B 2RGVA 2XSJC 2MK5A 1LJOA 3K4KA 5M5WJ 4M75F 3I56I 1ETYA 1IF1A 4A3MJ 1ABQA 2K3XA 3GTKJ 1QCNA 5DCFA 2NS7A 5LGTA 3VSKA 2C6YA 3LH0A 4YEJA 3JV3A 1TSFA 3HOXJ 2W48A 1PRMC 4Y92A 2SRCA 3FDRA 4KMFA 4JJDA 1AT1B 1TUGB 4XICA 2E5QA 4M75C 4QIWN 1ZAOA 3CEYA 3H41A 1XS9A 2EPFA 2RN7A 4JS5A 4CCJA 2J6KA 2FPDA 4M75D 1Y56A 2Z5UA 3S17J 1F9NA 2A6HF 3JTGA 1ZH5A 4C92B 3CC7T 1HYOA 3H8ZA 4F91B 2PUKB 5HODA 4QPQA 1ETQA 2GAUA 4A5NA 5FRMA 2R93J 4Q47A 3HOSA 2R5AA 5CR2A 4XRSA 1YE9A 1ZELA 2G0EA 4Y3OA 2GF7A 1IN8A 3DLLA 2J5PA 4YIRX 4HZFA 5KCHA 2XGDA 1E17A 4ZC3A 2MMPA 5FKMA 2V4JC 1DDNA 1MJBA 3J81E 2JK3A 1MH3A 1ZARA 1B34A 2GOXB 1UECA 2FUG2 4E7LA 3BG9A 4KT6A 2HPMA 4AMCA 4C92F 2VKEA 4PFPA 4CC3A 1UMQA 1KQ9A 3KP7A 1TP4A 5KYNA 2YUOA 3QJ6A 3M55A 4XTZA 2OBPA 3I64A 4M4ZA 5CKBA 4EVIA 2ZC2A 3BJAA 5GTHC 1B8IA 1TT0A 1K83J 2JPCA 3UR3C 4HNVA 4U87A 1D0XA 2VOOA 1N5ZA 1KHCA 4C92C 1Y0NA 1YP5A 2O8KA 1ZG3A 1WVRA 2E41A 2VE9A 3IQLA 4L9NA 2Z3YA 3H0IA 2NS0A 4J9DA 4C92D 2CW7A 5LFAA 2UWMA 2VC8A 2XG8D 2Y75A 1OLTA 1SVOA 3KEOA 2QM3A 4FW2A 1Q86U 4BXXJ 3KP5A 2O88A 1RI0A 4M7AG 2KT0A 4HSTA 2VQLA 4JRIA 1BC7C 2XKOC 4XU2A 4O3MA 4V2GA 1AZEA 3ZQFA 4F3QA 1PUEE 4G6TB 1XD7A 4FCYA 3I59B 5D5VB 1I27A 2PJRB 5E3NA 2ENMA 3ZFJA 2DA4A 1IREB 1FWZA 2J6FA 3J80E 5M9OA 3LSMA 2DT7B 2NVUB 2K2MA 4J6YA 4CC7A 1GVDA 2EV0A 2K7AA 2WB1A 3OR2C 4M3EA 3CDIA 2ZAEA 1YQAA 4D0PA 1UGPB 3QOEA 1ZSZB 2QA4A 1CSKA 4BB7A 1XDSA 1KHIA 8AT1B 2CWEA 2M34A 2XAFA 5DTDA 3V7CA 3EHRA 1FOXA 3OW2P 4XU3A 5IXBA 4PJLA 2CW0F 2DMPA 3IHUA 3VS5A 1K0XA 1ZN2A 1H8AC 3IC7A 3MCAB 1Q95G 1SSHA 2X9HA 5LJ5d 3I9V2 1YLFA 5DUKA 5FU7B 1GCQA 2NAZA 3RQIA 4GO1A 4L5EA 3WODF 1W0UA 1LNWA 4XLHA 1B72B 3CO6C 1XTDA 4IJAA 4F04B 3GFJA 1NYFA 2L3PA 2K02A 3L1AA 3MKLA 1YI2T 3ABLH 4FQGA 2GBQA 1UTIA 2RK1A 1BI1A 3PFYA 5CLSA 3CF2A 2FRWA 2MCNA 1T56A 1O3QA 2CYZB 2C0IA 1ZSZC 4R55A 1DQUA 1XSXA 3H9JA 4E4HA 2K9MA 3H6ZA 4WXDA 3JSPA 2HS5A 5LJ3h 2M4KA 1YWPA 4J83A 3FB9A 1JT0A 1MSEC 1AVZC 1GV2A 2ISYA 4HVVA 3CCQA 1GXQA 2IGOA 3DV8A 2HQAA 4B9WA 2RQUA 3FHZA 3G6EA 2A28A 3SFMA 2IT0A 3QAHA 1WGSA 1Y96A 2EIKH 4AD9A 4KGZB 1OEBA 1MJAA 2ELHA 3ZQ7A 1RI9A 5FU7C 3CXCS 3NWSA 1YFHA 5GAOn 3EFOA 3ZBDA 1YX3A 2OU2A 4XM3A 4ZDPA 4A0XA 2B7EA 4OMLA 3KZZA 1DP7P 2XDVA 2DW4A 4Q4ZF 2JQ7A 3M4GA 1AU7A 2XPWA 2HQXA 4Y17A 2OI3A 5B1AH 2JVGA 5EEGA 4HNUA 2YXYA 2KK4A 5L23A 5EF6A 1K78A 2ZPHB 4RGRA 2R5YA 3CCVQ 3FXJA 4Z2YA 1U8RA 4I02A 1NG7A 1EZZB 1WHJA 4NL2A 1VQMQ 3TSWA 1WJFA 2DAOA 2E2JJ 1M4ZA 3RUXA 1YHQQ 4JJCA 1IAWA 1V29B 3U1KA 4XOPA 4IZZA 2AS5F 4KITB 1UGRB 4NC7A 2FJ1A 1T98A 4FIBA 4FYXB 4EV0A 5GMKm 1Q81U 3RPUA 2ZSIB 1GV5A 1LDJA 1XB4A 5AYFA 3VEPA 3CXCA 1IUFA 5GAOp 2KDZA 2VBZA 3PNTA 3QODA 4M7DG 1XJWB 1YG2A 3A2KA 3AG1H 4J01A 1DPRA 4B6MA 4DA4A 2EJGA 5GMKh 3ZMVA 3GTQJ 2P0QA 2B0LA 2VKDA 3JCMQ 2N8GA 2V1NA 3TQNA 3LAPA 4CCLA 2HDAA 1MSFC 3MEVA 1KQSS 3EQLF 1KIKA 3GWZA 5EZHA 3DB4A 2M4GA 4CCMA 1OPKA 4BQQA 2ZBKA 3O2PE 4RB1A 4EGZA 3X20B 1IXDA 4A93J 4AFUC 1YJWT 1RR8C 4AT1B 2Q2EB 3GF2A 3LA2A 2MABA 2QSFX 3SEZA 2M45A 4CZZA 1P7JA 1ZA2B 2VWFA 1KFZA 1FBSA 4LOCA 3H3UA 2DFIA 2OTJI 3WTYC 1VQKT 4LD9K 2P81A 1QWFA 4XSZF 1DP3A 2ZJRF 1OQKA 3TOBA 4D7NA 3MD2A 2EVRA 2XASA 4PSWA 4XTUA 3FKJA 2DEUA 4G94A 1JKRC 2DLPA 1MMAA 1N75A 1RKTA 2VBXA 2WV1A 4AYBA 2QEXI 3H0FA 4L5GA 2NUTA 4JP0A 2KRHA 1CF7A 4C5EA 2QGFB 4CYDA 2M30A 2XHKA 3DU5A 2HKNA 2VC1A 1H9TA 4RMNA 1ETXA 3GUDA 5IT3A 5EGOB 1BC8C 3S15J 2CZ1B 2G3RA 1Q7YU 2Y2ZA 3EDPA 3F23A 2HI3A 3RDVA 2BUDA 2FQ4A 4E7JA 1U5TC 3CCJI 4UVBA 1DPUA 3G4SA 2HQRA 3GTOJ 4LLGF 5IP7J 4A3DJ 4CA0A 3GXOA 1JJ2S 4KBMB 4R8HA 2BXYA 1MD0A 3OYGA 1VQPQ 4M7AF 4M9ZA 1X1DA 2RNGA 1VQOI 1WJSA 1AWOA 1LUJB 1T8IA 1GDTA 4GY5A 4DEYA 2UZKA 2PN6A 2VBWA 4A2UA 3QIIA 1N25A 5FLVA 1FXXA 2CQQA 1W4SA 4YG2F 1H92A 1QRYA 2EZHA 4Q5WA 1HW1A 4LK0F 3PVQA 4N0AC 2IGNA 3M4OJ 5LL6S 2VUMJ 1ERDA 4BACA 2CQ7A 3BG7A 5J1UA 4FL6A 2G7HA 2NUPB 4ESRA 5KYWA 5J6XA 1KSWA 1YIOA 4RUGA 2R7RA 4OMMA 1NLPC 4NC6A 1VIEA 1TQIA 1WJ5A 4HT8A 4N0BA 4UUSA 3A1PA 4IHSA 2IGMA 1B34B 1KZHA 3OYBA 5BOXA 2JSPA 1NLOC 4RCCA 3CPWS 1BCOA 1YIJT 5LRRA 1JJ2A 2TDXA 2ECZA 3GTGJ 1ZQ3P 3DLMA 1M2VB 4GRIA 3CCEA 2VKNA 1TXQA 2VQCA 4OB0B 2CQKA 1WPKA 2M3AA 1JHHA 4C8QG 5IP6A 1MBHA 2ETHA 2AO9A 1NZ9A 2BKDN 3OSSC 1HJDA 3ZMUA 1VFCA 2RK2A 3ULRB 2JRMA 2IS1A 4EMHA 2LQNA 4AG1C 1YW7A 1BYMA 1WJEA 2TRTA 2FZGB 1T3LA 1AHJB 3P9CA 3TO9A 5LD2C 2LNVA 3QHSA 1MKMA 3PQJA 4N4OB 3GBGA 1QCOA 1EA3A 1KJWA 5GANd 3ZR8X 3LWFA 1K1ZA 1QVGP 4CICA 1RLPC 2W4SA 3META 1P4AA 1TZLA 1R4NB 4NC8A 4TV7A 3LNQA 3FDYA 1XMKA 3S1MJ 4ZZDA 5I11A 3ZQGA 1HW2A 1N8RR 5JVTA 2FD5A 5LEKA 2ECBA 3ABKH 3WTZA 2YS9A 2RHUA 1Y8QB 1UB9A 1KONA 3M59A 4EIKA 3TOAA 3D7SB 1IB8A 3SYTA 3HM5A 4FISA 3VFZA 2MH2A 5KH6A 4KDPA 3JCMh 4JZ4A 2D2WA 2MWPA 3SD4A 1AOJA 2L89A 4D8DA 3A5ZB 3P8HA 2RI5A 1Q86R 5D8LB 3WTUC 1ZLJA 2NWMA 4F7UB 4IUTA 2COMA 4HX7A 1T3SA 4JRQA 2ZGWA 2X1CA 2L9NA 4QPOA 4V19K 2OV7A 3HYIA 1IGQA 3PGGA 5ED4A 2P0WA 3BR6A 2ELJA 2K86A 1VQNA 1R8OB 3H0HA 1Q86C 1ULYA 2EJ9A 4AIKA 3HP9A 1M1KU 2AKKA 2QAZA 2L4AA 1MV0B 2H8RA 4LMYA 3K7AJ 2LJ3A 1GT0C 2MOXA 4B9XA 2PFBA 5HS9A 4OOIA 5DYMA 1BW6A 4AVZA 1YBYA 2QXFA 4HDVA 1TWGJ 3RKQA 2A07F 1WX6A 2NOGA 2M8GX 1JB0E 2LQWA 4F7UF 5DD8A 2QA4I 4HRIA 5GAN6 3E9FA 5CKTA 3B73A 3E19A 1PG5B 1LJ9A 2ZPBB 4KIFA 4OMQA 4RTXA 1U1TA 2RJDA 2OTLT 3BDUA 1LFBA 3PSIA 4CRIA 3WU2C 4Y4RA 1HBXG 3JRBA 3VS4A 4ZYGA 3I5UA 3SZGA 2RKHA 4PFOA 1Y96B 2R92J 2DEQA 4BEHA 4IUUA 3PE0A 4JJNK 1QVUA 2CUJA 2PMZN 1SVLA 2JN6A 4C2MJ 1D5YA 2B8AA 3JRZA 4OMNA 1HKSA 3DEUA 3E6MA 3G71A 4FASD 3JB9H 1TU0B 2X4YA 2OTJQ 5BPIA 1G5VA 3HTUA 4YELA 1V4RA 5FLXK 1I6XA 2UUZA 3GVAA 1J2XA 2HOSA 2XU8A 3CCMI 3MMYB 2JSCA 4CGZA 5D8KB 2J5OA 1VQ7A 4BBRJ 3PIPA
chains in the Genus database with same CATH topology
3WG9A 3HHTB 1RZ4A 3DKWA 3F8NA 3P7NA 5F64A 5IAYA 3H92A 2X4JA 4HYEA 1R36A 2IPQX 3CCLT 1JBMA 3BY6A 4C0FA 1VQ4A 3GOXA 2P0PA 1S72A 3TDZC 1MGTA 5IT9Z 3NTKA 2M5WA 5DCMA 1Z6RA 4I01A 3DF8A 1H9GA 2O03A 4A4EA 2ZMEA 2HQEA 3HRMA 1YJNT 1IXCA 1IXRC 2CG4A 4WXCA 1VQ6A 2H6BA 1SFUA 2V8KA 4M7AB 4A6DA 4KIBA 2BYVE 5GAMd 1VQLA 3GNFB 1HKQA 3C4SA 3K1PA 2RJCA 3ML6A 1Q81C 5LJ3f 4M75A 3PQKA 4ENNA 1WQWA 2EYQA 2KJBA