3HRTA

Crystal structure of scar with bound cd2+
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
212
Chain Sequence
PNKEDYLKCLYELGTHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
molecule keywords Metalloregulator ScaR
total genus 52
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrtA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrtA02
4O5VA 3ECHA 4RB2C 3JSPA 1SD6A 1DPRA 3ML6A 1J9IA 1FBQA 3I53A 1W4MA 4U7DA 5E20A 4P5OA 4Y15A 3HRUA 3BPXA 5HDKA 1IXRC 2QYOA 3RKXA 3WE2A 1I1GA 4BXUA 2XKOA 2FNAA 2HZTA 2J5OA 3FMRA 2MLGA 3QAHA 4XLNF 1R1UA 2OZUA 3QRFF 4CYDA 1LDDA 3T8RA 3CUOA 2HOEA 2XASA 3M9AA 2CGPA 1BJAA 3HOSA 5L3DA 2YU3A 5LHIA 1R1TA 4MTDA 1EH6A 1SMYF 4HF2A 2FQ3A 4EM1A 1YG2A 4ZYGA 1P4XA 1W5SA 4FT8A 2FMLA 1QO0D 1U78A 3L7WA 2QBYA 1S7AA 3GW2A 5J6XA 3M7GA 5FLXZ 4AWXB 2BBYA 3GX4X 3WTXC 5HLGA 2NYXA 2QQAA 1USSA 1XMKA 2HYGD 3FM3A 3TQNA 4MEYF 1KA8A 4A2UA 5E18F 2FRHA 4HDVA 5L3FA 2DTRA 1PP7U 1MD0A 3EYYA 2QWWA 2Y48A 5FGMA 1TQPA 1W7PA 4XBFA 5IT9K 3FXRA 4EJTA 2EFOA 1MJAA 2H3JA 1KYWA 3W6KB 1C0WA 1R22A 1UFMA 4OIQF 2AS5F 2P7CB 2UZKA 2DU9A 1X3UA 4YIIA 3K9TA 4I02A 2EFQA 3KP6A 2VONA 2GQQA 4MGRA 4PGHA 3QP6A 3GLXA 2E1CA 1S6LA 4LD5A 2JRTA 3BJ6A 1U5TC 4G8XA 3Q9SA 2W85A 1XCVA 2RC4A 2FNPA 5FO5A 1USTA 3QPHA 2O8XA 4XRFA 3DPLC 3QPTA 2YX7A 1T0FA 3RTRA 1GHCA 2KIFA 4EGYA 3E6MA 3GFIA 1MZBA 5BMZA 2M5WA 4DNCA 1XGSA 2IA1A 3MHXA 3J7AO 2P7VB 5EEHA 1Z9CA 5D5UB 3IHUA 1V3FA 1ZHFA 3BWGA 4MQVA 5FD6A 2FBKA 3WU1B 2PLYA 4EJOA 5E8IA 2BE5F 3E19A 2V79A 3TDUC 1QGPA 3BJOA 2QM3A 1ZRFA 4NQWA 4GXOA 4D0PA 1BN5A 1L0OC 3TO7A 1G6NA 2HKOA 1ZH5A 3V7SA 4DQ2A 1DP7P 1XB4A 1B4AA 3O3KA 2UXNA 4E70A 2VT3A 4LFUA 1BYMA 5J8FA 2ZBKA 2ZNYA 2X4HA 1DUXC 2XAQA 3E3VA 3R61A 2PFBA 3MQ0A 3TGNA 2HGCA 4UVCA 1EH8A 2H94A 1E17A 3V7CA 1OMIA 4L18B 3LQRA 3QOPA 2ZKZA 4EJUA 1EH7A 2JTVA 2W25A 2VC1A 1XCBA 2VE9A 2STWA 1B9NA 2HWVA 1OR7A 3F72A 4G6QA 5EEGA 3H3ZA 5HVQC 1TW2A 1FSHA 1BM9A 2P5LC 2WC2A 3KZZA 3J81K 4BH9A 2EV6A 3MEXA 1BOAA 4EVIA 1IXSB 1DDNA 4MHGA 1LDJA 5ICFA 4R79A 4EM2A 1ZRDA 2HEOA 3F8FA 4WXCA 4G7ZF 1U5TB 1T6SA 3FXQA 1QZZA 2K4BA 3E5XA 5LRSA 2F5DA 3EQLF 4M72A 1FNNA 5A2QK 2Z99A 4Q5SF 2O03A 3TOBA 5ILVA 2V6CA 1E2XA 3ISPA 4QWQA 2W57A 2LDUA 2IA0A 3EDPA 5HLIA 1XSVA 2TDXA 4UV9A 4BNCA 2IA2A 3E6DA 3I4PA 1JHHA 2XAHA 4B8XA 1YS6A 2DO7A 4HDUA 2JPBA 2DI3A 3TKYA 3KETA 2Q8KA 4A6EA 3DXJF 3GF2A 1G3YA 4KMFA 1TQIA 3WU0A 2XHKA 1CF7B 2VN2A 5ICEA 4WF2A 2IW5A 3IKVA 4WX9A 2A5YB 2KJBA 3E6CC 2EK5A 2JT1A 4CZZA 5D4SA 1R5HA 2RN7A 5LRRA 3BP8A 3GUDA 4QLCU 2VBWA 1FYLA 6PAXA 1BI2A 5F1RA 5CVVA 3F22A 2COMA 2JZYA 1XMAA 3K0LA 3M8FA 5ILUA 5LHHA 2GZWA 2KRFA 2ZCWA 2W24A 4KN7X 3COAC 1K6OA 4HZFA 4HQMA 1HBXG 4S05A 1D8JA 5BS6A 2BV6A 5BPDA 2Z9OA 5CVJA 3KP7A 5L3GA 3K1NA 1IUYA 1KQ8A 2GA2A 2GA1A 5H6QA 2STTA 3KP3A 1WQ2A 1BIAA 3SFZA 1QBJA 4ZYHA 1FP2A 2D1VA 1B6AA 3L09A 3DPTA 2PBIA 3GEZA 2VBYA 4PCQA 1SFEA 2XIGA 4GCVA 2IRFG 2O61A 3R60A 3IRRA 3WTTC 1OYIA 2HR3A 2C6YA 4G7OF 1K78B 2MBFA 2E7XA 2A69F 1LDKB 3CUQA 2BGCA 5D5WB 4HLYA 2DAOA 1K7AA 2RGVA 5AONA 4BQAA 3WGHA 1P92A 1Z6RA 3J80K 3HSEA 3IRQA 3B02A 3RI4A 2ZMEB 5FB2A 4ENJA 3LA2A 5H6RA 4XSXF 2EFPA 2FE3A 3K69A 2P4WA 1FX7A 3O6BB 3BJAA 2K86A 2X0LA 3CO6C 1KQ9A 2RQPA 1TLHB 2KIUA 1I27A 3QU6A 3HHGA 3IWFA 3G73A 2LKPA 5FFZA 1U2WA 4M6XA 1UB9A 4A12A 3H92A 3LAJA 4LLGF 4M9ZA 3ZN1A 4A6DA 2XV4S 4WXHA 1LEBA 1HSTA 3RPUA 4HBLA 5HS9A 1B9MA 1F4KA 1TW3A 5E1WA 4L0YB 1Z1DA 3DP7A 4Q4ZF 5KK1A 4G7HF 2VXZA 2EV5A 1ZLJA 1O3SA 1J59A 3C1DA 5JFRA 2Y0MA 3ERED 4AD9A 1U6GA 3FHZA 2PG4A 2FBHA 4CHUA 5HS7A 4OINF 1Z05A 1RZ4A 2LF7A 5ED4A 4AIKA 2PQ8A 2EWNA 4R8HA 4I01A 4HF0A 4CXFA 4L9TA 2OQRA 5DD4A 4AIHA 2JSCA 2HDCA 3V7RA 1S8NA 4YFXF 4RAZA 3GWZA 5E17F 4IVNA 3NQOA 2CQKA 4KICA 2EFNA 1IXCA 3S2WA 3F8NA 5D8LB 2P5KA 1KU3A 4HA8A 5LHGA 3QP5A 1RNLA 2EV0A 3HIFA 3OV8A 5ICGA 2M30A 1HKQA 2F5EA 1G3TA 1ON2A 4HX4A 1ON1A 4RS8A 1FBSA 4IRHA 1F9NA 1FBUA 5LLQA 4A0YA 2GXBA 3LA7A 2XUBA 4XLPF 4Q47A 1MJBA 1SAXA 2M1BA 2K5IA 3K2ZA 3TOAA 2F2EA 1SD7A 3H3UA 3JTGA 4LK0F 1YLFA 1XSDA 3WGIA 2QZ8A 4PZJA 3IL2A 4MTEA 1I1SA 1Q1HA 4LB5A 3KEQA 3DQVC 1MDMA 1GXQA 4WK8F 1PDNC 2K5LA 4A0ZA 3RYRA 2CFXA 3F6OA 1D3YA 1H9GA 1O7LA 1LEAA 3I59B 1LNWA 3I58A 1W7PD 2H09A 1BI0A 4UXNA 2GAUA 3PQKA 1T38A 2B0LA 2ESHA 3PFIA 1FLIA 4BHCA 1HKTA 1QPMA 4IJAA 4P55A 4A5MA 2K7LA 1ZAOA 2ZJ2A 3HYIA 1ZREA 4YIFA 3ZMSA 3ABTA 4I7HA 3O2PE 3E5QA 1ONVA 3EETA 4O6JA 3DV8A 3ZQ7A 2EFWA 3MCZA 3CTAA 2IT0A 3LQQA 5JI6A 1H0MA 4KFCA 3LSTA 3U2RA 1J0RA 1HQCA 4BAYA 1YO5C 1S29A 1REPC 1KQ0A 1TNTA 3JSOA 2VE8A 2OA4A 2Q2EA 1JE8A 5IT3A 2GIVA 4GYIA 1H9TA 2ADUA 2OD5A 4EGZA 5TRDA 3L2CA 2DQRA 1T39A 3NRVA 3KP5A 1MDMB 4L0ZB 3HTSB 3QU3A 2ETHA 2HTSA 2EA2A 1YIOA 3WTUC 4KNYA 4KIBA 1GVJA 3SXYA 4KMUX 2IPQX 4HV5A 2HKXA 1SFXA 2CO5A 1TQMA 4I2OA 2DBBA 4TV7A 3DEUA 4B09A 3KZYA 5DCFA 1STZA 2ZFWA 5FFXA 3ZMZA 1HW2A 2BYVE 1AOYA 3TO9A 5AIPA 1FYKA 2QBYB 4F7ZA 2L01A 3F23A 2G7HA 2QLZA 2ZMEA 2XAGA 1O3TA 4HX8A 4EJWA 2D2WA 3CUQB 2F5CA 4KYWA 2MD5A 1QQIA 3VODA 4CO8A 2MH9A 2UXXA 1HW1A 3E5UA 5ICCA 3DFGA 5L3BA 1IN5A 2Q0OA 1P4AA 3J81Z 2XAJA 1YFHA 4EMSA 3BOQA 1Z7UA 1Y0UA 2O0YA 3C3WA 5CLSA 4AVPA 1LVAA 4M74A 1YW9A 2BEOA 1O57A 3LFKA 3U1DA 4CGZA 4Y17A 3KLOA 3NEUA 4M9SA 3N4MA 3BDDA 1U8RA 2EB7A 4N0BA 2FF4A 4IHTA 2CW0F 5A2QZ 2HFHA 2MLKA 4LG0A 3VOEA 4FX0A 1PUEE 4XSZF 2V9VA 3TDZC 4YFKF 2O3FA 4KN4X 3DF8A 3SZPA 2MH2A 2DQLA 4RB3C 2G9WA 3FZVA 3R0JA 1R7JA 1YYVA 1IN7A 3Q5FA 3E6BA 4WCGA 4CDGA 1R36A 1IN4A 4JBAA 3B73A 2AXLA 4I0BA 1R23A 4MNUA 1W7PB 2GXGA 2WTEA 4BHBA 1G3WA 2VOPA 4G6DA 5D5XB 2VBXA 5HDGA 3DKWA 2JPCA 1HSJA 3KCCA 2OAZA 4LLLA 4S04A 1VTNC 2H27A 4NHJA 3MZYA 3GVAA 3I71A 4WXDA 1JHFA 2NS0A 2EA4A 3HUGA 2UWMA 4KIGA 4K2EA 3I0TA 3L00A 4WWCA 2WV0A 4ESJA 4UNOA 3HSFA 3LA3A 2F5FA 3M8EA 2RKHA 3BY6A 5FLXK 4L5JA 2LSOA 5DUKA 2NAZA 4YG2F 3WTSC 3R0AA 2OZ6A 4ZYEA 3BZ6A 5LGUA 3F8CA 2LX9A 4LK1F 1IRFA 4ZZLA 1EV7A 3HOTA 1QNTA 1F1ZA 4ESBA 3F8BA 3HRMA 4I0AA 1FP1D 3HHHA 5JR3A 1YW7A 5ERIA 4BHPA 2K5FA 5AIQA 1G3SA 1FWZA 1I5ZA 3K1MA 4OIRF 5BQTA 2PI0A 4KDPA 1ZARA 4ENKA 3U9GA 3Q9VA 3V4GA 2M45A 5D6EA 2H6CA 1D8KA 1FY7A 2W84A 4A0XA 2K27A 3V8KA 3RDIA 3WODF 4M73A 4UVBA 5HDNA 1J2XA 5K5OA 5D5VB 1IW7F 5TJJA 1TTYA 1KU7A 2Z3YA 1JGSA 1FC3A 5F6FA 1S7OA 2VT2A 4LMYA 4PGGA 1BC8C 3RPQA 1QVPA 2KJCA 3GXOA 2CYYA 4EJVA 2P6TA 1BI3A 5D8KB 3TO6A 4RB1A 1L3LA 1IN8A 3HTUA 5HS8A 4Y13A 2FSWA 2FOKA 1IN6A 2DPUA 3J80Z 1CGPA 1J5YA 3BPVA 2NRAC 4G9YA 5CVIA 2LF8A 3AAFA 3EUHA 3V8JA 4IHSA 1S3JA 1W5TA 5BOXA 2HS5A 2QQ9A 2DW4A 4M9XA 4H0EA 1J7KA 1LJ9A 4U0WA 5L3EA 4OIOF 1NHAA 2A68F 1TBXA 3WG9A 3JAMK 4BYYA 1Z6TA 3GZ6A 4HLXA 1RUNA 4MEXF 1SMTA 3ZPLA 4HOBA 3ROUA 3WTVC 5CVRA 3ZMDA 1T2KA 3C18A 2RDPA 1OYYA 4L9NA 5CJ9A 1FZPB 1XD7A 3F3XA 5L3CA 2ZXJA 3REOA 5HOOA 3GO5A 3MWMA 2E1NA 1RUOA 1FT9A 1YTYA 2YX4A 4UUVA 3KP2A 4ON0A 3IKTA 1FPQA 1FOKA 1FYMA 2OU2A 1T98A 2HQRA 2A6HF 4JK1X 5KVRA 3SZTA 3OOPA 5J8CA 1IZ1A 1SD5A 1U3EM 2A6EF 2L4AA 3P7NA 4RGRA 4ETSA 5CVUA 3T1BA 4HX7A 3BROA 3R4KA 4RGUA 1WKMA 4N9IA 2A07F 3L9FA 4P9FA 3WTYC 1AWCA 4U7BA 2VOOA 3GFLA 3CO7C 1P4WA 4HAMA 2RNJA 2V1UA 4OMZA 5DEQA 2FXAA 2CG4A 2Z33A 3CUQC 4ASNA 3M1EA 1GXPA 1CF7A 5LGNA 1UHMA 2MA3A 4ZZDA 4UV8A 3P9CA 1XDUA 2ZNZA 1V4RA 4YFNF 1R1VA 5K1YA 2V1XA 2CWEA 4UHTA 5DUIA 3F6VA 3FMSA 1KYZA 3ZMUA 1XDSA 4RB0A 1QZYA 2ACJA 1KU2A 2EJRA 5DD8A 5LEJA 5DCMA 1O7FA 4PDKA 3KEOA 1IRGA 3JAMZ 1HW5A 3FXUA 1HXDA 1BC7C 4ESFA 2OQGA 4HV6A 1G4DA 4KT5C 4CICA 1WRJA 4Q48A 1LB2A 2QQBA 3JTHA 3FWEA 4LG0B 4P9UA 1YS7A 2PJPA 3MAJA 2J5PA 2XVCA 2YR2A 3I64A 3RKWA 1ZG1A 2YSRA 3ZMVA 1D5VA 3PQJA 5F64A 3SQNA 3RJPA 1RI7A 1R5GA 3E97A 3F8MA 4OIPF 1XGMA 2GCXA 1ULYA 2HYFA 4I98B 3CDHA 2RV8A 2QUFA 3WE3A 1BIBA 2L3DA 2KKOA 4OOIA 3P9KA 1XGNA 2KIMA 2XGXA 4ZYDA 3F21A 1K78A 2QVOA 3ZMTA 2YPRA 5K5RA 5LEKA 2PEXA 3CLOA 2K4JA 4L5IA 5D6FA 2XROA 2DPDA 3MFKA 3IC7A 2R7FA 4M6YA 4MQ9F 3FX3A 4AIJA 5LGTA 5E1ZB 2VODA 3I5UA 2OBPA 1Z91A 4HW0A 1I6XA 1XN7A 2ESNA 2IJLA 3G3ZA 2V1DA 4ENMA 2RVCA 2A61A 5HLHA 5DCMB 4EQQA 3FM5A 5DV5A 5H20A 4Z2YA 1ZG3A 1FSEA 5IT9Z 1OKRA 1JXSA 4LGWA 2L54A 1WWXA 3R6SA 3T8TA 1BI1A 1P6RA 4U88A 3ECOA 2M8EA 1ZG5A 1O3QA 1SD4A 2HQNA 2WWYA 5JHUA 1WSUA 2HTJA 2FU4A 1ODDA 1J75A 4IXAA 3T5XA 1SFUA 2DLLA 3CJNA 5DYMA 5FD5A 4L9JA 1PP8F 5E1XA 2XKPA 3JW4A 4P96A 2GWRA 4U0VA 4ENNA 3KE2A 3WTWC 5DDGA 3HSRA 4IRIA 3T0YA 3GYHX 1IF1A 4EV0A 2A3SA 1B1BA 3VFZA 3MZHA 1MJ9A 1YQAA 1TNSA 1ZYRF 5D4RA 2L4MA 2XAFA 3I54A 3VB2A 4O3MA 5ILSA 1MKMA 1MGTA 4OU0A 3D0SA 2FBIA 4IF4A 3V8LA 3HRTA 3I59A 3EYIA 3RYPA 5E8GA 2PMHA 1KU9A 2ZO4A 2FA5A 3ZN0A 3GFMA 4G94A 4FX4A 2NNYA 2O6GE 3ABUA 2DFIA 1O3RA 2IP2A 1UCRA 3KFWX 3RIRA 2FEZA 1ZLKA 4LLNA 1OYWA 3LWFA 2ELHA 4R1HA 2XRNA 1XSXA 1A04A 2PMUA 4FHTA 2LNBA 1ZRCA 4HF1A 1ZN2A 1R58A 1ZGAA 2P6SA 1XGOA 2IVMA 2K4YA 2QENA 5BPIA 4GGGA 4LJZF 4ZH4F 4HYEA 1K79A 3IWZA 4EM0B 4U0YA 1B59A 4A5NA 1BBYA 2Y75A 2PN6A 5CYVA 3ELKA 3K1PA 2P8TA 1OPCA 4JQFA 3WGGA 5JVTA 1HKSA 4N9HA 3RKYA 2G7UA 2VBZA 4L9VA 2L02A 1KGSA 3SHFA 2DK8A 3KLNA 4LB6B 2R3SA 1P2FA 3GFJA 3FF5A 1YW8A 1F5TA 3VEPA 4RGSA 1WI9A 2Z5UA 1U5TA 4OMYA 2NNNA 4GYGA 2M87A 1RIOH 3KP4A 3N97A 4IPAA 2D45A 3D5LA 2CSOA 3LAPA 4UVAA 2D1HA 2K02A 5LBQA 4KA4A 1QW1A 1IAWA 1DPUA 3FMQA 5K5QA 3ZP5A 2ISZA 4IRGA 4GO1A 2H6BA 2MC3A 3P9IA 4NB5A 4I09A 3WTZA 3C7JA 2ISYA 2P5VA 1UHWA 1ZGJA 3HRSA 2DK5A 1R00A 2R7DA 2FMYA 4KIFA 2E7WA 3W6JB 3ULQB 2VC0A 4KUMA 3GZ5A 4RGXA 2DT5A 4RAYA 4HQEA 4M71A 1LQ1A
chains in the Genus database with same CATH superfamily
3FK7A 4O5VA 2R7OA 3ECHA 3Q1JA 2N8GA 4RB2C 2OTLT 2EFIA 4CA0A 3JSPA 1WJSA 1SD6A 1DPRA 1JGGA 3G7ZA 4J7IA 3WHCA 1FJLA 1XTDA 3ML6A 1J9IA 5FU7B 1FBQA 1ZUYA 2CGHA 4MFDA 3I53A 1W4MA 2CQXA 1VQ9A 3H36A 1E3HA 4U7DA 3C0CA 4MLOA 2DT7B 5E20A 4P5OA 4Y15A 4Y4RA 2X9HA 2CV0A 4FETA 3HRUA 3BPXA 1YIJQ 1YJWQ 5HDKA 1IXRC 2QYOA 3RKXA 1T56A 3WE2A 1I1GA 4BXUA 1TWCJ 1WJ5A 1ZTRA 3KYLA 3WG7H 2XKOA 2FNAA 2LY1A 2DA3A 4C2UA 3CCUQ 2HZTA 2J5OA 1RRJA 1ABOA 2NUTB 2IS2A 1M1FA 4CI0C 1VQOT 3FMRA 3OSGA 2KR3A 2MLGA 3QAHA 2OTLQ 4XLNF 1TH7A 1R1UA 2OZUA 4RTWA 1LKXA 1UHSA 3MKZA 3QRFF 4CYDA 3W6VA 2QGGA 2WSEE 3LSJA 3L2UA 3SYTA 1LDDA 3OOUA 1ETWA 3T8RA 3CUOA 2HOEA 2XASA 4PLIA 3M9AA 2CGPA 4N0AA 4C0ZA 5HLTA 5LJ5e 4MDWA 1BJAA 3HOSA 1MV3A 1JUMA 1WJBA 5L3DA 2CW8A 2F6CA 2IS1A 3BDUA 4HVVA 2YU3A 1XS9A 4M78G 1XC5A 5GAOm 1HK9A 1X6BA 4PJOF 2D9TA 3SWNA 5LHIA 1R1TA 3I55T 1UJYA 2LC2A 4ZGDB 3H5RA 4FCYA 2VXFA 2VQGA 2ZB9A 2NVTJ 2VGNA 4CRIA 2QA4I 4M7AA 3RKQA 3H35A 1VQPT 3DKYA 4MTDA 1EH6A 3H3VK 1SMYF 3CC7Q 2VUMJ 1YCYA 4HF2A 5GANj 1ETKA 2FQ3A 4EM1A 1KK7A 4C0DC 1YG2A 4M3FA 4ZYGA 1B72A 4LD6A 1P4XA 4KULA 3CD6Q 2ELJA 3HM5A 3G71I 4BEHA 2YRCA 4OB3B 1W5SA 4FT8A 2VKVA 2FMLA 4J6WA 3CMEQ 1K9MR 1Z67A 2QG9B 2QQSA 1QO0D 2CUZA 5IP7J 3QODA 4IHVA 4ZN3A 1U78A 3LNQA 4XLCA 2FX0A 3GIBA 4F14A 2R7UA 2CZ7B 3CC2T 2HQ5A 3L7WA 1S7AA 2QBYA 2NUPB 3OQ5A 4FT2A 3GW2A 1Y1VJ 2E34A 3M7GA 5J6XA 5FLXZ 4QPQA 2SRCA 4AWXB 2FB7A 2BBYA 3GX4X 5KE2A 3WTXC 4RTZA 4D9JA 5HLGA 2DK3A 1QKXA 2EZLA 2RHIA 2NYXA 2QQAA 2XIDA 4WCIA 1SEUA 2WSCE 3QYEA 2R5ZB 1WLPB 1USSA 1XMKA 1ZA1B 3M53A 2HYGD 2GGRA 3FM3A 4HG2A 3TQNA 2DTHA 1OULA 3I3LA 4MEYF 1KA8A 3W2AA 5GANh 3FXMA 4A2UA 2FRHA 5J1UA 5K7FA 5E18F 1UEBA 2JS2A 2LRQA 2X4YA 4HDVA 4XU2A 4J6YA 2VJJA 4DBQA 1W4SA 2E1HA 5FWBA 3OSVA 5GPAA 3CC4Q 5L3FA 3CCLT 2YUSA 3G1LA 1T08B 4OWRB 1OQKA 3AL0C 2LTOA 2X9DA 5D7UA 1AA7A 5TISC 2DTRA 3L2ZA 1PP7U 1MD0A 4KUIA 3G71T 3JRCA 3EYYA 3BCAA 2QWWA 4UUSB 2Y48A 4F7UB 1KC8C 2EIJH 3TW6A 4XQFA 3AL0B 5FGMA 4BXFA 4A3KJ 1O4XA 1B07A 2JJ7A 1TQPA 1W7PA 4XBFA 5IT9K 2OCEA 3FXRA 3PO2J 2X3WD 4B9WA 5E79C 4EJTA 3JCMW 5IAYA 2J6FA 4C92F 1XTAA 2CH0A 2EFOA 1MJAA 2HOAA 1KQSP 3DCFA 3BQYA 2F5TX 2NVYJ 4PUSA 2IS6A 2M4KA 2H3JA 1KYWA 4XK4A 1VQ4I 1VQKI 4X0GA 1I1JA 2MD0A 1TWHJ 3RCOA 1YHQT 1YI2A 4J7FA 4JZ3A 1IGNA 2E1MB 3BZCA 3PNTA 3W6KB 3PIOF 3S16J 1C0WA 4NNJA 5HY6A 5KYXB 1R22A 4AM3A 5B3SH 2FYKA 1AZGB 2RD1A 1UG1A 3BE3A 3OYDA 1K73U 1UFMA 2VB6A 1NG6A 2BZYA 3MPUB 4OIQF 2AS5F 2O9VA 2DJZA 3KEYA 4Y91A 2M0CA 1NJIC 3OYLA 2CSIA 3CCYA 2P7CB 1WPKA 2UZKA 3K6GA 1N25A 3PL8A 2DJQA 2BVLA 2KDSA 4I6ZA 1AEYA 2DU9A 1X3UA 3ZQGA 4PKCC 1EFNA 4UUTA 4YIIA 3FDRA 4A53A 3K9TA 4I02A 2FRYA 2GTJA 2KYBA 2R7VA 4JPBW 2EFQA 5GAOl 3FKIJ 3KP6A 2HSEB 1UG2A 4II2A 4NOYA 2LD5A 1WQ7A 2E5KA 1M27C 2VONA 2GQQA 3FXLA 4MGRA 1Z3XA 4PGHA 1YJNA 3BT9A 3CEYA 1OCTC 1FMKA 3S93A 3QP6A 3I55A 1RAEB 3GLXA 4UB6C 3CCJI 1S6LA 2E1CA 1GRIA 4LD5A 1YX3A 5IP6A 1C6VX 3RR6A 3Q3SA 1HC8A 4RAFA 2JRTA 4M75D 3M3YJ 3EFRA 3OW2A 2DEQA 2DPPB 2LCCA 4FE4A 5GAOn 3BJ6A 3DWLE 2AT1B 4LE9A 1U5TC 4G8XA 1AHJB 1ACMB 1M2VA 4M77F 4JYKA 3Q9SA 3G1JA 3OL3A 2QSGX 5IHNA 2W85A 1XCVA 1TP4A 2IGOA 3M55A 4X34A 9ATCB 2RC4A 2QEXT 2LJ0A 3FXKA 1N8RU 2FNPA 5FO5A 1USTA 3QPHA 2O8XA 1U06A 5FU7C 4XLEA 2XF5A 4XRFA 1B72B 1ZELA 2QCOA 3MD2A 3CCLI 2LP5A 1JB0E 3DPLC 4XONA 4F92B 5GAMj 1H88C 1IJWC 2Z16A 3QPTA 1AWJA 2CZ0B 2O4XB 2PMZA 5GP9A 2RHXA 2YX7A 1T0FA 3TSZA 3IUOA 1TWGJ 2RNAA 1VQ4T 5GAN5 4ATOA 2YUQA 4M77G 3RTRA 1GHCA 3U23A 2KIFA 1D09B 4EGYA 5EG0A 2LDMA 1IDYA 3E6MA 3GFIA 1MZBA 1OFCX 5BMZA 2M5WA 2M51A 3KBGA 1RADB 3O5ZA 3CCVI 2W00A 4DNCA 1XGSA 2IA1A 4RLFA 2YDLA 3AG1H 2X48A 3H9GA 3Q0WA 2P7VB 1JJ8C 3J7AO 5J47A 1DJ7B 3BG7A 5EEHA 2E5QA 4A63B 1Z9CA 5A0LA 5D5UB 3IHUA 1V3FA 4IUQA 1ZHFA 3BWGA 4MQVA 5FD6A 2EGEA 4CUGA 2FBKA 3WU1B 2PLYA 3BLYA 4EJOA 3MO8A 4Z8AA 5E8IA 3OB9A 2LY9A 1YJ9A 1YJNQ 2BE5F 2VKEA 3E19A 2V79A 3TDUC 1IV8A 4W1UA 4IQ4A 1QGPA 4N4HA 2JN0A 1R0BG 3BJOA 2JQ7A 1SRMA 1VQLI 2E12A 2QM3A 1ZRFA 1B3QA 4NQWA 4GXOA 2PUKB 2NLUA 1FOYA 1BN5A 4D0PA 2H1KA 3P8HA 1L0OC 1OCZH 3TO7A 3K4LA 4UUSA 2E60A 5IYCJ 1G6NA 4PFZA 4Y33A 3MEAA 1O75A 4CCNA 5IPAA 1DU6A 2HKOA 1I07A 1ZH5A 4RLQA 3V7SA 4JLIA 2HI3A 4M75E 4DQ2A 1Y71A 5LJ5f 3CMMA 1XB4A 1DP7P 3JB9I 1B4AA 4KJZA 3CCLA 4J9FA 2W4SA 1I8FA 2OV7A 3O3KA 3FJ5A 4A3JJ 3MP6A 1YI2I 1PVEA 2QGUA 1MNEA 2WY7Q 2DA9A 2ELKA 3I4MJ 1POGA 1JXMA 2UXNA 2EQIA 4E70A 3JB9J 1UHCA 2VT3A 2M1HA 1JJ2P 3CP8A 5GAN3 3LWHA 3EG0A 4LFUA 1BYMA 1MBJA 1NBEB 3TP3A 5J8FA 2ZBKA 3JRDA 1Y39A 1EX4A 3JCMJ 2IEKA 1OCOH 3CCEQ 1PJRA 2ZNYA 4B1RA 5KYXA 2X4HA 1DUXC 2FHDA 4C92G 2XAQA 3E3VA 3R61A 3SEZA 2PFBA 4BE2A 4OMQA 3MQ0A 3TGNA 2M7AA 2QAZA 3QDFA 2HGCA 1A5JA 4UVCA 5DTDA 2COZA 2QEXQ 2M9HA 1VQNQ 3A1YA 3GNFB 2BHZA 1EH8A 3QJ6A 4II1A 2H94A 2F5VA 3VKIA 2JRMA 1E17A 2VL8A 3MN2A 2DBMA 1YITQ 3OA6A 3PMIA 4DYCA 4AFUC 1WXTA 4J9BA 2JM9A 3V7CA 2CDTA 4J9HA 2DJIA 1OZ3A 2K9GA 1HCRA 4A54A 1K4US 1WHMA 1Y0MA 3QG1A 1MV0B 2R7RA 1OMIA 4LIUA 4L18B 3EFSA 5FU6C 1LE8B 2MGQA 3P8DA 5JLXA 4GFBA 2Y90A 5GMKj 3EHRA 3LQRA 3QOPA 4FSSA 2K85A 3ZL7C 4XKVA 3A0BC 2ZKZA 4OF1A 8ATCB 4AIDA 1QVFA 4EJUA 1EH7A 5LD2C 1WXBA 3FEOA 2JTVA 2W25A 1HF0A 1YITT 1KC8U 3SDBA 1T0FC 3CMYA 1IHWA 2LQWA 3CXCP 2VC1A 2KRCA 2LP0A 1VI0A 2RAEA 1XCBA 3HB9A 4RDUA 1VA7A 2DFHA 1W1FA 4Z89A 1X43A 2VE9A 3BDLA 4PJMA 2STWA 1B9NA 1TTHB 4QVDA 2HWVA 2W7NA 3VS4A 4MDXA 1OR7A 3F72A 3CCUT 3F0CA 1UG0A 4G6QA 2RQRA 1M90C 5GAMd 2YS9A 3CMAT 4PJJA 4XTWA 5EEGA 3H3ZA 2F4MB 5HVQC 2E70A 1TW2A 1FSHA 3HKSA 1AOJA 2LKXA 1BM9A 4DBRA 2P5LC 3AG4H 2G3RA 1BB9A 4HVWA 1TSFA 1VQ7I 3OMGA 1VQ8T 2V7FA 2AXTC 2WC2A 3C2GA 5CQGA 2Y4XA 3JV3A 2L2OA 2DODA 2Z1DA 3KZZA 3BG6A 3LSHA 4XTYA 3J81K 5FKMA 4BH9A 2CV1A 2OTJA 2HNIA 5GAMe 3JRAA 2EV6A 2DA6A 1BOAA 2IGMA 3MEXA 3W2VA 3F9KA 1IXSB 4EVIA 2RPNA 1YITA 2HOSA 4PSWA 2DMOA 5GANd 2HMAA 1VQ6A 3VS2A 4CCOA 2IGNA 4YRVA 1YITI 2RF0A 4C30A 4XR6A 3IV5A 3CC7A 4C8QD 3OYMA 4RTTA 2YUOA 3M9QA 3S2DJ 1DDNA 5KAFC 1UGRB 4XTUA 4MHGA 1MMAA 1WCMJ 1N5ZA 1LDJA 5ICFA 4R79A 3EHQA 4EM2A 5GAEJ 5KCMA 3F8FA 1ZRDA 3L2WA 2HEOA 4WXCA 4G7ZF 2HXOA 2K57A 1U5TB 1IZ6A 2L0AA 3M57A 1Q7YU 1T6SA 3QZ5B 2G6FX 3FXQA 3GOXA 1QZZA 2K4BA 3E5XA 5LRSA 3O8GA 2F5DA 3DKMA 2LKSA 1WYXA 2VXEA 2DTIA 4L5EA 4BXXJ 2IIMA 2HQEA 1IDZA 3NTKA 1K9MC 2PTKA 3EQLF 2DDAA 3PVQA 3TBIA 3WVEB 4M72A 3K4BA 2K3BA 2KRNA 4C92E 3J7ZI 1FNNA 2R7XA 3CPWP 2OTJT 5A2QK 1VF9A 2Z99A 3W3CA 2O03A 1KONA 3TOBA 3CQZJ 1S72I 1TL8A 4Q5SF 3C4SA 5ILVA 1MMNA 5FKKA 4N4IA 4BUGA 4M7AD 1AWWA 5F1JA 1DGRM 1WZOA 2M3AA 2V6CA 1E2XA 3NAUA 1QVFS 3ISPA 4QWQA 3CC7T 2JA6J 2W57A 1NG2A 4EMGA 2R7ZJ 3I5SA 2K3YA 2AIRB 2LDUA 1VQMT 2IA0A 1MMSA 3EDPA 4XNFA 1XSVA 5HLIA 1QWFA 3FLGA 2L89A 3ABLH 5KYUA 3CCQA 3CJTB 2TDXA 1X1AA 2DXCA 3JCUC 1Y0NA 2IGKA 3ZOBA 1T8IA 2E2HJ 1YJ9I 1BKBA 1WH7A 1ENHA 2BZTA 4EMHA 4JS5A 4RG2A 4J83A 4UV9A 4C8QG 1QQJA 1K83J 4XN0A 2B9SA 4BNCA 5FLVA 2ROLA 3A98A 4CC2A 4IX7A 1I5LA 2LH9A 2IA2A 1XOVA 2FPEA 5KYYB 2MWOA 3E6DA 4ZDPA 4C5EA 3I4PA 1JHHA 2XB0X 2XAHA 2NUZA 1K8AC 1RUWA 2LX7A 4B8XA 1XQHA 1YS6A 3M58A 4C8QE 4HT9A 2DO7A 2QTVA 2JPBA 2DI3A 3TKYA 4HDUA 3KETA 2Q8KA 4A6EA 3DXJF 1PSEA 3K4KA 3GF2A 1G3YA 4KMFA 1ZSZB 3PFSA 2ZC2A 2B8AA 1Y96B 1YI2T 3M0PA 1TQIA 3WU0A 2XHKA 3NGPA 1CF7B 1UTIA 3OYYA 3G6ET 4FM4B 3ZQCA 2VN2A 5GTHC 3CC4A 5ICEA 4M3DA 2AKLA 5I11A 1NG7A 4WF2A 3OIOA 3G1OA 4QQ6A 2IW5A 1R0CB 4XLAA 3IKVA 4WX9A 1X2KA 2A5YB 2KJBA 3DEEA 4LITA 3E6CC 2EK5A 2JT1A 4CZZA 5D4SA 1R5HA 1DU0A 4IHWA 1PKTA 2RN7A 5LRRA 1YP5A 3NARA 2EQUA 2WV1A 5FKOA 3RERA 3BP8A 3GUDA 4QLCU 2HOTA 1YHQA 5EG2A 2VBWA 1FYLA 3M07A 2ZXIA 1BI2A 5F1RA 5J4YA 6PAXA 1RLQC 5CVVA 2C0TA 3VS1A 3OW2S 3F22A 2Y2ZA 2COMA 5LJ5h 3BTCA 2R4GA 2A28A 4LDVA 2E6ZA 2JZYA 2XKOC 1XMAA 2L9VA 3K0LA 3M8FA 4AYBN 5ILUA 5LHHA 3HXLA 2HSPA 2DXIA 2GZWA 4NDLA 4RM2A 2XC7A 2NOGA 2KRFA 3E9FA 2ZCWA 4HKEA 2K9MA 2W24A 4M7AC 2DTOA 4KN7X 3COAC 2MI6A 2L3QA 2EYQA 4S0HB 1JU5C 1SHFA 1K76A 3O8HA 3CCRT 1Y8RB 1K6OA 4HZFA 3X24B 2HEQA 1QP3A 4HQMA 2A3LA 4AFZC 1U9OA 2FZCB 1HBXG 2E1OA 4ZN1A 1KHCA 4S05A 2R5YB 3VWBA 1D8JA 2HQAA 2JTEA 1G5VA 4DYRA 5BS6A 2BV6A 1M9SA 3MKDA 4BY6C 4IOCF 2DOFA 3GTGJ 4F04B 1QVGS 2QKLB 1VYUA 2NWMA 5BPDA 4U87A 2Z9OA 5E3LA 5CVJA 3LMMA 1ZKGA 3KP7A 1X6GA 3L1AA 5L3GA 4KT0E 2NS7A 4CC4B 3K1NA 1IUYA 2BHYA 1J3TA 1KQ8A 2GA2A 2ZXHA 5GAOp 2GA1A 3URGA 4JLGA 4DBHA 1E3PA 2MABA 5H6QA 2EYWA 2R57A 4M75B 5HNHA 2STTA 3KP3A 1KHIA 3ME9A 5GANg 1WQ2A 1VQ4Q 3EPZA 2E36A 3H0GJ 1PUFA 1PCXA 3FC3A 1BIAA 2HNHA 4KITB 1YJNI 4N0AC 3FIWA 4JX4A 3SFZA 3C2BA 1X3ZB 1QBJA 4OB0B 4ZYHA 2OTJI 1EZZB 3RNJA 1PM3A 4E47A 1FP2A 2HKNA 2D1VA 1B6AA 3L09A 1BR4A 3CC2Q 2X85A 2K9SA 2PBIA 3DPTA 3GEZA 2J6KA 4A4GA 2VBYA 1SFKA 1U9NA 4PCQA 1SFEA 2XIGA 1KQ1A 2LY2A 3G71Q 4GCVA 4RTXA 2AZVA 1JUPA 2IRFG 2O61A 1MMDA 2VJIA 1UJ0A 4D7MA 2R5ZA 3H41A 3BR1A 2DTZA 3CCQI 3QIIA 3R60A 3H5NA 2LQ8A 3H6ZA 4FSXA 1MIJA 2GQVA 2DFUA 5CPRB 1TUCA 3IRRA 2BOLA 4E7JA 1ZR2A 3WTTC 2DL4A 4RMOA 3I55Q 1OYIA 1WHLA 1OX8A 2EBPA 4M3EA 2H8HA 2HR3A 3R6NA 2C6YA 4OB2B 5J26A 3ER0A 4G7OF 1K78B 2MBFA 2G0EA 2E7XA 2A69F 5CAIA 1LDKB 4XMYA 2LCLA 3DLLA 1ABQA 2Y0SN 2D8JA 3CUQA 2CUFA 1JJ6C 1NK3P 1CSKA 3HKZN 3M56A 1HJDA 2BGCA 1YWPA 3OS1A 1YX5A 1JT0A 1MSEC 1VQ4A 2E1MC 5D5WB 4HLYA 2HXIA 2DAOA 3DBRB 1K7AA 2O01E 3UWNA 1K9MU 5CKBA 4J19A 1G2BA 3LH5A 5DS9A 1M1EB 2D5VA 1OLTA 1V1CA 2RGVA 1Y96A 1FOWA 1UMQA 4LDXA 4M77D 3G6EA 5AONA 2HAXA 2VLAA 2JUCA 2MW8A 4BQAA 2E5ZA 2O9SA 2YSQA 2RNGA 3WGHA 1P92A 5LJ3j 2IXSA 1NEGA 1Z6RA 2X6XA 3HSEA 3J80K 3IRQA 2CSQA 3G4ST 3BTLA 4DJAA 3GTQJ 3B02A 2PZ1A 3RI4A 1IRZA 2R5AA 2VVKA 2ZMEB 2DZCA 3EG9A 5FB2A 5M5YJ 2HCKA 4ENJA 3LA2A 5H6RA 2V4JC 1Q7YR 4XSXF 1PKSA 1D1AA 2EFPA 4XICA 2FE3A 2BXYA 3K69A 2LFBA 4E7KA 4A3MJ 3QPLA 5GJWB 4C0GA 4C9YA 2M34A 2P4WA 1BJZA 1ETVA 2X1CA 1FX7A 1T3SA 2WB1N 3O6BB 3BJAA 1VUBA 2K86A 2X0LA 3CO6C 2A7YA 2XU8A 2RQPA 1KQ9A 2IS4A 1TLHB 2KIUA 1UECA 4LDWA 1HDDC 1I27A 2V9KA 1R5ID 2ID6A 3QU6A 5LJ3f 1LFUP 1RAIB 3HHGA 1FIAA 3IWFA 1SEMA 1WFXA 4YIRX 1WJEA 3S3MA 3G73A 2LKPA 1ZR4A 5FFZA 1U2WA 4A3CJ 2XI9A 5CCAA 5J39A 1X1DA 2X1DA 3SFMA 2X6OA 2K3XA 2WAQN 4M6XA 2PU9B 4P5NA 4PJOD 5F27A 3QYHB 1UB9A 2ZPHB 5E3MA 4BD3A 2VXDA 3PO3J 4A12A 1WH5A 5CKDA 4RTUA 4MFEA 2UUZA 4C3HJ 1LOJA 1W2BA 3K7AJ 4C3JJ 3H92A 4J6XA 3LAJA 1HOMA 2FPDA 3QWXX 1I3QJ 2D1XA 4LDYA 4LLGF 1QVGP 2H8RA 1Q86U 2BE9B 4QQGA 2LT1A 1RETA 4FQGA 4M9ZA 3ZN1A 4IUVA 2GXAA 4A6DA 3EUHC 2XV4S 1YOVB 1EF4A 1M5Q1 4WXHA 1LEBA 1HSTA 3RPUA 4HBLA 5HS9A 5KNLA 1B9MA 2L5QA 1LFBA 1TW3A 5E1WA 3PIPF 1F4KA 4L0YB 3HOVJ 2L9SA 1CKBA 1WJQA 1X75C 1JKQC 2EJFA 1Z1DA 2JMCA 3GBGA 4IKFA 3GNGA 3CZ6A 3DP7A 3PMTA 4Q4ZF 1NJIU 1QVFP 5KK1A 4G7HF 1IV6A 1K73C 4PJOG 4M78F 1JJ2S 2VXZA 4XRSA 5CQEA 3G71A 3PT9A 2X3XD 4F16A 1SVMA 3PE0A 2GLOA 2EV5A 2F1LA 2JVGA 4XKWA 1LPQA 2VKDA 1JKPC 3DLAA 2Y4YA 3HFOA 5GAOq 1ZLJA 1O3SA 1J59A 1A35A 3PNWC 3WVDB 3X26B 4QSHA 1HA8A 1WQWA 1JUSA 3C1DA 1NLOC 5JFRA 2E3IA 4YELA 2Y0MA 3ERED 3RSNA 4AC0A 4F7UG 1XX5A 2DOEA 3DEWA 3FISA 1S5LC 4AD9A 1U6GA 2KRHA 3FHZA 2PG4A 2FBHA 4CHUA 5HS7A 2DMTA 4OINF 1M8MA 1Z05A 2OI3A 4D8DA 1ZSZC 5LJ3e 3I56T 1RZ4A 1ZSGA 2KLOA 4F3QA 2LF7A 5ED4A 4AIKA 2PQ8A 1W5CC 3UA7A 3MEVA 2EWNA 4R8HA 4I01A 4HF0A 1QHGA 4CXFA 3QWLA 2VWFA 3C95A 4L9TA 1MBGA 4FU6A 2J06A 2OQRA 5DD4A 4AIHA 2JWTA 3JCMP 3JB9H 2X6YA 3K4MA 2ZZDA 2JSCA 2HDCA 1E6HA 3V7RA 2CJJA 3A1PA 3M0QA 4DZJA 1S8NA 2RI5A 2X4JA 3ABKH 4BQNA 4RAZA 4YFXF 3GWZA 2OTLI 2JS0A 1VQ8Q 1UHFA 5E17F 2DL3A 2IPOB 3FB9A 4RUGA 5LJ3d 3HUGB 3A02A 4C92A 4IVNA 1V29B 1YFNA 2BZ8A 2EIKH 2CQKA 3NQOA 2CQ7A 5J3LA 1X69A 4OVAA 4KICA 2EFNA 1IXCA 3REBB 1VQOQ 2CU7A 2EQKA 3S2WA 1UGSB 2DYBA 1QZEA 3F8NA 3HOUJ 2QDYB 4J9EA 2DRMA 3G4SA 1Q82R 1IXDA 2P5KA 1KU3A 3C2HA 4HA8A 5D8LB 2NYSA 5LHGA 3QP5A 1BR1A 2CP7A 3CCSQ 2M8GX 4ANJA 1RACB 2CKKA 3RBBB 4FASD 4FT4A 3ZBDA 1RNLA 2EV0A 4ZDLA 2DDBA 1ZK8A 3HIFA 3OV8A 1VFCA 2DA1A 4C8QF 5ICGA 1D0YA 2EGCA 3HFNA 2M30A 4M75G 1HKQA 2F5EA 3EGDA 1G3TA 4E7SA 2RHZA 1ON2A 3CD6I 4KGZB 3VYHB 1YRNB 3B6CA 2C0OA 2QTXA 3GLLA 4FL6A 4HX4A 1ZGWA 2P4RA 4JJDA 1ON1A 4XU0A 4RS8A 5GAMf 3X20B 1K0XA 3HPHA 1H3ZA 1K9AA 1Y7XA 1FBSA 2BW3A 4F7UF 4ZGJB 4IRHA 4BY6B 4V2SA 1Q86R 2VKHA 1VQ5T 4CZCA 1F9NA 1B8IB 1W1WE 1FBUA 3ZRGA 5LLQA 3SB2A 4HCCA 4FE7A 4HSRA 1SC7A 2JUFA 2JTFA 2OAWA 4A0YA 4L59A 1BCOA 1A6QA 2KMTA 5IT9E 2C06A 2A0FB 4B47A 1F1BB 3BCBA 2GXBA 1WJCA 2M0OA 6AT1B 3LA7A 3LSPA 2XUBA 1FMWA 4HNVA 3KZIC 1V55H 4XLPF 4Q47A 2JA8J 1MJBA 2LQKA 2O31A 1SRLA 1SAXA 2E35A 2M1BA 2KDOA 2K5IA 1FXXA 4X9CA 4B3AA 4PL6A 3JRIA 2XDBA 1FTTA 3K2ZA 3TOAA 2E64A 2F2EA 1NH3A 3CMAQ 2YRVA 4M75C 1SD7A 4XK8E 3CCET 3J81E 3H3UA 3EFOB 3SEMA 2WAFA 3MJXA 1OU9A 4ZYAA 1VQ5I 1TWFJ 1Q81U 3JTGA 1NLPC 2DKGA 1MBKA 4LK0F 1YLFA 3PVLA 3CQTA 1XSDA 3H9QA 3WGIA 2QZ8A 2JM8A 2ZGWA 4E2FB 1YJWT 4I99C 2QQRA 1ERDA 1TXQA 4PZJA 2ZXWH 3DTIA 4FYXB 4F7UE 1BR2A 3G1MA 3IL2A 1IUFA 1VQ7T 4MTEA 1A31A 1ZX6A 2P0WA 1I1SA 3HL8A 3VS6A 1Q1HA 3JCMg 4LB5A 4BI3A 3KEQA 3DQVC 5GAMg 1VQ8A 5IYDJ 4D5FA 1MDMA 5M3MJ 1H89C 5GADJ 2KVQG 3A8LB 2BY3A 5CO7A 1GXQA 4KGVB 1LFPA 5EGOA 4WK8F 4RM3A 2DE0X 5IOZA 2A6TA 4J8OA 2EZHA 4M7DD 3Q0UA 1PDNC 1X01A 5DLQE 3RDVA 2E65A 2K5LA 4A0ZA 3RYRA 4NL3A 1H8AC 4D5CA 2CFXA 3F6OA 1D3YA 2DMNA 1H9GA 2EBIA 1O7LA 2MOXA 3TCJA 1LEAA 1BU1A 2BY1A 3ERMA 3I59B 4ME7A 1LNWA 1YJWA 1M90U 3I58A 4HSTA 4AFQC 1W7PD 2H09A 5FRMA 3A2KA 2FJ1A 1IC8A 5IHKA 1MW7A 2M2EA 1D3BB 1VQ9T 1BI0A 4UXNA 2GAUA 3PQKA 1T38A 2B0LA 1TS9A 1V54H 2ESHA 2VC8A 3PFIA 1FLIA 3CC2I 4BHCA 1AZEA 2VIXA 2KP6A 1HKTA 4ZC3A 1YWOA 2OJ2A 3MZ8A 5FRNA 3S6WA 4CC3A 1QPMA 4IJAA 4P55A 4RCBA 1NK2P 1S1NA 4A5MA 2HZDA 2K7LA 2W82A 1EKEA 2LNVA 1KD1C 4RKUE 4BE1A 4OMLA 1LJOA 1ZAOA 3OL4A 2ZJ2A 5DY9A 3HYIA 1BOBA 1ETQA 3HGYA 4YIFA 1ZREA 3ZMSA 3INZA 3ABTA 1TZLA 3QBYA 4R56A 3OW2P 2O88A 4I7HA 3O2PE 3A01A 2R93J 2KEAA 3E5QA 1VQ7A 3BR2A 2GQIA 1ONVA 1DQUA 3EETA 1RL2A 1GT0C 4Q5WA 3CMET 4O6JA 2XGEA 2X35A 3G6EI 3S1MJ 3QO3A 5KYUB 1MH3A 2M7BA 3UA6A 2YRDA 3HGGA 1TG0A 1N9RA 3DV8A 3D7SB 3RESA 5KYNA 1QVGA 1YJWI 2AZSA 3ZQ7A 3OY9A 3CXCS 4D1QA 4N4OB 2YU9J 2BUDA 2EFWA 2GNCA 2ZPEB 1GL5A 4ZDOA 3EG2A 3MCZA 1QVTA 3CTAA 3TEDA 3LQQA 2IT0A 2XGCA 2FG0A 5GMKm 4PJOC 2AO9A 3S8PA 4M7AF 5JI6A 4NL2A 2H3EB 2RK1A 2R0QC 1JBMA 3PJRA 1H0MA 3OSSC 2W48A 4EIKA 1S72Q 4J01A 1WIEA 1VQ7Q 5F04A 3OS0A 2OAUA 4CCKA 5FWCA 1VZ0A 4C2MJ 4KFCA 3LW5E 3LSIA 3LSTA 1FIPA 3U2RA 3JRGA 3ZR8X 1J0RA 4DZPA 2V9PA 1PG5B 1HQCA 4BAYA 1YO5C 3TREA 1UDLA 3NPFA 5GANe 1ZUKA 1S29A 3FJPA 2LCSA 1REPC 1RC9A 3VPRA 3M0TA 2DO3A 2KXCA 1KQ0A 1TNTA 1BA5A 1LCKA 4J5YA 3JSOA 3D5RC 1N9SA 4KH0B 2VE8A 2D0QB 4M77B 2KE9A 1S72T 1VQNA 1WJRA 3HSBA 2OA4A 3NHNA 1VQ6T 4OB1B 2KK4A 1N77A 3M0UA 2Q2EA 4FISA 4HEA2 2H8WA 1JE8A 5IT3A 2GIVA 3UNGC 4GYIA 3B6AA 1B34B 4GY5A 3E1SA 1YBYA 1KFZA 2V1QA 5L8RE 2L7KA 1UZCA 1H9TA 2ADUA 2OD5A 2MMPA 4ELZC 4EGZA 1BW6A 3OYHA 5TRDA 2RK2A 4C8QB 3L2CA 2X1EA 2DVEA 2DQRA 4MZMA 1FMVA 1T39A 3CXCA 3GTPJ 2YHTA 3JCMc 4PJOE 3NRVA 1MGQA 3KP5A 2KY9A 2ZPBB 1MDMB 5LJ3h 4L0ZB 2LR8A 1Z9ZA 4KH1B 3ZQLA 3HTSB 3QU3A 2ETHA 5IN1A 2JA2A 4DYQA 1QCFA 1QMCA 3JCMX 4M78A 4NC6A 1WPYA 1X2NA 2HTSA 4M3BA 1PUFB 2E2IJ 2MF2A 2RQVA 3LSMA 2QEXI 1QA6A 1WX6A 3IQLA 2EA2A 1JKRC 1AD5A 2COYA 2PMZN 4LIVA 2HZYA 4MZTA 1YIOA 3A03A 5DLOA 2WAQA 3WTUC 2R5YA 4KNYA 4KIBA 2MIOA 1P7IA 3VSKA 2YXYA 1GVJA 1Y6IA 3K4CA 3CC7I 3AT1B 3ZQQA 2DD5A 2EIMH 1PWTA 3SXYA 2EILH 4KMUX 2DD4A 2EQJA 3OYJA 2IPQX 4HV5A 1VQOA 1K4TA 1VQ6I 3JREA 2HKXA 1W36C 1SFXA 2CO5A 3D5SC 2ZSHB 4LDUA 5M5XJ 3SWNB 4FTHA 1Y57A 3TL4X 2FEIA 1TQMA 1Y56A 3FBIB 1ORKA 2DBBA 5B1AH 5HNFA 4I2OA 2BIVA 5F0CA 1R49A 2CFOA 4A3EJ 4IOAF 4L5GA 3I56Q 1R77A 4TV7A 2LZ6B 3DEUA 2OX7A 2RJEA 2CH4W 3VRYA 5F08A 3CESA 2JSPA 2VKNA 1DP3A 2JTMA 5IOYA 4B09A 2ZPFB 1OR7C 4XOTA 3G6EQ 3EUKL 3DLMA 3MP8A 3E7LA 3KZYA 3CCQT 5DCFA 1UFFA 2R5MA 2PJRB 1OPLA 1VQKQ 1STZA 1VYVA 2ZFWA 3MCAB 5FFXA 3OYBA 2DETA 2GOXB 1WHUA 1JJ2A 3ZMZA 3M8JA 1HW2A 2BYVE 2DA2A 1JXOA 3WXMB 2FRWA 2GFUA 3LH0A 1WGXA 1AOYA 2DYSH 3TO9A 5AIPA 4DGWB 2ESWA 3CBPA 1FYKA 2QBYB 2NVUB 2GOMA 1YJNT 2VJ4A 2DMQA 4F7ZA 2L01A 3KYCB 2WB1A 3JSCA 2CMPA 3AG3H 3N05A 2EYXA 3VUZA 5I21A 2RJFA 1MBEA 3F23A 2G7HA 4ZTJA 2QLZA 5J40A 1ZUUA 2KT8A 3H0IA 3JAME 4A3LJ 4RBOA 2ZMEA 2P81A 4ELYC 2XAGA 1YIJT 1O3TA 2YUNA 4HX8A 1P9QC 4EJWA 3VYTB 3CC4T 2PX9A 3U1KA 3KUFA 4ZNXA 3K70C 2D2WA 2XF7A 4E7IA 1XPXA 3CUQB 3UPUA 4JJBA 2GTOA 3CMAI 1K0SA 4QT7A 2L9NA 2DZ9A 1G2HA 2DL7A 2F5CA 4KYWA 2MD5A 3PSFA 1QQIA 1RESA 1GBRA 3J7AF 3VODA 4CO8A 2V8KA 3CCEA 2MH9A 2UXXA 3JCMf 1HW1A 3FXOA 3CLQA 3E5UA 3QYGB 1LPLA 4XU3A 2XSJC 3DFGA 3OR1C 5ICCA 5L3BA 2COBA 1OISA 1IN5A 2Q0OA 3TP0A 2VGMA 2NUTA 2HVSA 3HG9A 2QF7A 2ZPIB 4X1EA 1J09A 2KQRA 1I81A 2XB5A 1P4AA 1GVDA 3HBLA 3J81Z 3JCMV 4QVCA 4JRPA 2XAJA 1XG1A 1QKWA 1YFHA 3LSRA 2GBQA 2XHCA 4EMSA 2K2MA 2Q2EB 3BOQA 3WU2C 3CCLQ 4QQDA 5C6SA 2F48A 3LLRA 3AHUA 3LOCA 1B34A 3K10A 2M4GA 3BR0A 2X4XA 1OYXA 3SDGA 1M1KC 1Z7UA 5FW9A 5BNGA 1SPKA 3HL2A 1Y0UA 2KL4A 4D6WA 3I9V2 1VQLT 2O0YA 3C3WA 4D7NA 5CLSA 2RHYA 1X27A 4AVPA 1LVAA 2QDLA 1OPKA 3UATA 1GFDA 4M74A 4A3IJ 1RAAB 1YW9A 4HVUA 2BEOA 5FROA 4FYVB 4BDZA 3OYGA 3GTMJ 1O57A 4BQQA 3S1RJ 3ABMH 3LFKA 5F0FA 1M3BA 3U1DA 2DCEA 1QWEA 4CGZA 1VQLQ 4Y17A 3RQIA 4C5GA 3HOWJ 1RAFB 3KLOA 1M8VA 2E19A 3LSKA 3P8BB 1Y07A 3NEUA 1GFCA 2QXFA 1K73R 4M9SA 3N4MA 1VYTA 3M4GA 3BDDA 1VQPI 1U8RA 2DXUA 2EB7A 3OBYA 4N0BA 1RKWA 4RG8A 3HPGA 2JA5J 2FF4A 2K3PA 3AKZA 4Y3OA 4IHTA 3X25B 2CW0F 5A2QZ 2HFHA 2MLKA 3G2BA 2DMPA 4AU7A 4LG0A 2GF7A 3M59A 3VOEA 3GTJJ 3OBWA 4FX0A 2EYYA 1PUEE 2ZJPF 4XSZF 2V9VA 3TDZC 3FBNB 2YT6A 4M77C 2ZFUA 3CCMT 1OCPA 4YFKF 2M0MA 2O3FA 4KN4X 1NYGA 2X51A 1WI7A 3OS5A 4J9CA 3DF8A 2L0KA 3SZPA 2MH2A 1W36D 3SJMA 4BUPA 2DQLA 2I5UA 2DT6A 4RB3C 1M3CA 1NEBA 3QHSA 2G9WA 3FZVA 4CCMA 2L3SA 4GRIA 4M78E 3R0JA 2NXNB 2HL5C 1R7JA 1YYVA 3I5RA 2AK5A 1IN7A 3GCMA 3Q5FA 3JCMQ 2BY2A 2R7QA 1D5YA 2DN0A 3E6BA 2KROA 4WCGA 4CDGA 3CCEI 4C8QC 2Y9ZA 4I76A 2EAYA 3OSFA 2CUBA 1R36A 1IN4A 4PJLA 3H9NA 4JBAA 3B73A 2XMFA 2BTTA 4XORA 4XQ3A 2AXLA 2ZPGB 4I0BA 4NBQA 2ZMEC 1I5OB 3JCMe 2Y9YA 3ZQIA 1PRMC 3NTHA 3VYGA 1R23A 1X2QA 2MWPA 3PNYA 3BC8A 4MNUA 1W7PB 4BL0B 4V19K 4FIBA 4PJOB 1KG1A 2GXGA 4E7LA 1ZLMA 5GMKh 2X6WA 2WTEA 4BHBA 3OR2C 1G3WA 4JDSA 1X3WB 4BU2A 1E0EA 2VOPA 4G6DA 2K6DA 3E9GA 3GF5A 3CCVT 1KZHA 2ICWG 1SAUA 1MNMC 2PVGB 5FKLA 5D5XB 2VBXA 5HDGA 3RMSA 3DKWA 3H0DA 2PNIA 1SSFA 2JPCA 1HSJA 3BG5A 2LBFA 3KCCA 4BQOA 3R6OA 2OAZA 4M3GA 4LLLA 2CREA 4M75F 4M7AE 4S04A 3SWNC 2ME6A 2EZIA 1VTNC 3MZYA 2H27A 4NHJA 3EGDB 1VQPQ 3GVAA 4A4KA 3I71A 4WXDA 2E10A 1K8AR 1IREB 1IHVA 5TGTA 2RQUA 1JHFA 2NS0A 2EA4A 2B7EA 2NS8A 3HUGA 1E3OC 2UWMA 2P0QA 4KIGA 5C4JJ 1R8OB 2DOAA 4K2EA 1U0JA 1A0NB 3I0TA 3L00A 4WWCA 4AMCA 2WV0A 2MAMA 4UY8I 3SZGA 4B3XA 4ESJA 2JXBA 4UNOA 5LJ5d 3HSFA 3LA3A 2F5FA 2JNGA 4LXCA 2RA2A 5A0DA 3M8EA 2RKHA 4A4EA 3BY6A 3NWTA 5FLXK 2K79A 1VQ8I 4L5JA 2QSHX 4FW2A 2OJED 2ED1A 2LSOA 2ZJRF 5DUKA 1H92A 2NAZA 4YG2F 3WTSC 3R0AA 2OZ6A 4ZYEA 3JRHA 2R7SA 3BZ6A 1PD0A 2J05A 4RCCA 5LGUA 2LMDA 4EMKA 2TRTA 3F8CA 2JVHA 4AG1C 4QW2A 2LX9A 1Z0XA 3HKZA 2M0YA 4LK1F 1IRFA 3QOEA 1VQOI 4ZZLA 2V1NA 1UAAA 1VQNI 2IBDA 4R0KA 1EV7A 3HOTA 1QNTA 1F1ZA 4ESBA 1R71A 4LD9K 1M3AA 1KQSA 2V6EA 4M77E 2DILA 3GTKJ 2M02A 3VYUB 3F8BA 1VQLA 3HRMA 5J3BA 2LQNA 4I0AA 1FP1D 3HHHA 5JR3A 1M2VB 1WFWA 2L3PA 3REAB 3H0HA 3DU6A 4PJ0C 1YW7A 5ERIA 3UKGA 5GJVB 3JCMh 1VQ5Q 1RPWA 1SHGA 4W97A 3E2UA 4KRTA 2ZSIB 4J9IA 3BG3A 4BHPA 2K5FA 1U3OA 2QK0A 2KRMA 4KBMB 5AIQA 1H3HA 3H1CA 1G3SA 1FWZA 1I5ZA 3K1MA 3OYEA 3S1NJ 4B44A 1WXUA 2BZXA 3S1QJ 3UR3C 3VS5A 4OIRF 5BQTA 2PI0A 1X1BA 1ZARA 4KDPA 2CZ6B 2O4XA 4IUUA 4OMPA 4C5IA 5KYWB 3IAS2 3S2HJ 1OV3A 2XPWA 2HVRA 2A37A 2KIQA 1OCCH 2QQ8A 3U9GA 3I55I 4ENKA 4ZTFA 2IVWA 4JZ4A 4XTVA 2FO0A 3Q9VA 4BE0A 3V4GA 2RO0A 4BJTA 5LJ5j 1FOXA 4EEFG 5GAGJ 2M45A 4NUBA 4Y52J 5D6EA 4BACA 1VQKA 5CKFA 3CDLA 4ZGEB 1D8KA 1FY7A 2H6CA 2DAQA 2P0KA 2W84A 2O5RA 2KHMA 4YEJA 3CCUI 4OGCA 2KZGA 1Q7YC 4A93J 2HD0A 4A0XA 3A8HB 4IURA 5J1YA 3E0JB 1D3BA 4GBQA 1WGSA 2K27A 1V5GA 1TUDA 3V8KA 3HTRA 3RDIA 3QXEB 3CCSA 1OI1A 2L7FP 2D8HA 4BJ5C 1X4PA 3WODF 2Z0WA 1EIFA 3EG3A 3K4NA 1OCRH 5EF6A 2K9LA 2XSDC 1CQTA 3CCST 2XGDA 4M73A 1WA7A 2DL8A 2HPIA 1RR7A 3CJQB 4M78D 4UVBA 5HDNA 1J2XA 1N8RR 5K5OA 5D5VB 3X28B 2DLPA 5CQXA 5GAN8 5TJJA 2XDDA 2QYZA 1RABB 5GAN2 3GP8A 1TTYA 1S72A 1KU7A 2Z3YA 4M7DA 1X58A 4OMFB 1JGSA 1FC3A 2ZJQF 1BL0A 2F2WA 5F6FA 2KDZA 5HK0A 1S7OA 4F17A 2UV1A 2VT2A 4LMYA 4PGGA 2EJGA 3A01B 1BC8C 2ATCB 2CT3A 3BG9A 2GIZA 5J4VA 2AKKA 3RPQA 1QVPA 5KCHA 2KJCA 3GXOA 4N4NB 5AT1B 1U1TA 5K7HA 2CYYA 5FU6B 4EJVA 4A4FA 2P6TA 1S9HA 1BI3A 3EH1A 2CP5A 4EMKC 2EQRA 3TO6A 5D8KB 4RB1A 4BBRJ 1L3LA 2F2XA 1IN8A 3HTUA 5HS8A 4CCJA 4Y13A 2FSWA 1TT0A 2FOKA 1V5FA 1IN6A 4F55A 2Y69H 1WJDA 2DPUA 2DM1A 1MNDA 4HCKA 4OMMA 5CKEA 4DW6A 2IAIA 3J80Z 4IHYA 1TWAJ 5M3FJ 1CGPA 1E7OA 2DBKA 2MK5A 3EG1A 4X1VA 1KD1U 2VV5A 1J5YA 1A36A 5KCOA 3BPVA 3OYIA 1UGQB 2NRAC 1MBFA 3H9JA 4G9YA 4PJNA 5CVIA 1TOVA 4R55A 5GMKe 2LF8A 3AAFA 2NVXJ 5DM7F 2HL3A 1OQYA 3EUHA 1Y8QB 2YLCA 3V8JA 1OOTA 3M1CA 4IHSA 3QYBA 1M30A 1S3JA 1W5TA 3CCRI 5BOXA 3J7AY 1KJWA 2HS5A 2DRKA 3M0RA 4GLKA 4OMOA 4QKUA 3AFHA 4OP0A 1Q1VA 3DB3A 2QQ9A 5B66C 4D8KA 2CP6A 2EIFA 1G59A 1KC8R 1T33A 2DW4A 4FW1A 4EMKB 1A6IA 4M9XA 1J7KA 4H0EA 2B63J 1T95A 3S15J 3QKJA 1AVZC 4EPCA 1LJ9A 3OIQA 1NPPA 2OF7A 1GCPA 2F4OB 5I22A 4U0WA 3CCMA 2QA4Q 5L3EA 4OIOF 3N5BB 1NHAA 1ETOA 2A68F 3W2WA 4M77A 1TBXA 3WG9A 2JUGA 1NYFA 5ECAA 3JAMK 4BYYA 1Z6TA 3OYAA 1Q95G 3IH3A 2DIGA 2DEUA 2RQWA 1HLVA 5C44J 2OPTA 3HEFA 2VPRA 2M16A 3GZ6A 4HLXA 2O8KA 1RUNA 2A36A 4MEXF 3S14J 2HU9A 1SMTA 2B86A 2MPXC 5KYYA 2L7MP 4BY1J 3ZPLA 4HOBA 3ROUA 3WTVC 1UGVA 4DOVA 5CVRA 2L9RA 1WVRA 3VV0A 3FHNA 3ZMDA 1T2KA 2JZ2A 4DBFA 3CCJT 3BTIA 3C18A 2RDPA 1OYYA 1VQ9I 4M7AB 1W2BS 1ZSZA 1FTZA 3TW7A 4A3FJ 4JX6A 4L9NA 1WNLA 3JCMb 5CJ9A 1ZHIA 1GCQA 2V26A 4AUXA 2COWA 4J9DA 4LUEA 4KISA 2HBPA 3VUBA 3IAM2 4M78B 1FZPB 2LRDA 1XD7A 1Q81C 1XMXA 3F3XA 5L3CA 2ZXJA 4V2GA 3DBHB 5KAIC 3REOA 5HOOA 2YUPA 4BB7A 3OMYA 1YIJA 3GO5A 3MWMA 2E1NA 1RUOA 3TEEA 1FT9A 1YTYA 2YX4A 4UUVA 1JO8A 1M4ZA 2JT4A 1VQ5A 4C5HA 2ZAEA 1WI3A 2I10A 3KP2A 5EZHA 1AU7A 3BQZA 1M1KR 4ON0A 2LJ3A 4HRIA 2AHJB 3IKTA 1FPQA 3CCSI 2K5CA 1ETXA 2OC6A 1FOKA 3CMEA 1Z7LA 3META 4C8QA 2OTJQ 4C92D 2SEMA 3ASNH 1MSFC 1WHGA 1Q81R 3OYFA 4AG2C 2O9LA 2NVQJ 1M2OA 1VQMQ 1YHQI 1Y1WJ 3VSLA 3CP2A 1FYMA 1W6XA 2OU2A 2QASA 5IXBA 3CD6A 1T98A 3VS7A 1IRXA 2HQRA 2A6HF 4JK1X 5KVRA 2CS7A 2KRSA 3KFVA 3SZTA 2RI2A 3OOPA 5J8CA 4J00A 5CR2A 3BW1A 1R4NB 2CUEA 1IZ1A 1SD5A 1D0ZA 3DLLF 2PJRA 1HSQA 4L6V5 2BKDN 5FKNA 5HKCA 3DBLB 1U3EM 3BR5A 1QPIA 2A6EF 2BXZA 2L4AA 3P7NA 2KI7A 5D6YA 4RGRA 4ETSA 5CVUA 3CPWA 3T1BA 4HX7A 2Y0SA 3BROA 3R4KA 4RGUA 2RM4A 2NOJB 3HDDA 5I2MA 3MEWA 1C1AA 1WKMA 4N9IA 1G83A 4A69C 2A07F 1T0JA 4GLMA 2LVMA 1H8KA 4GDFA 3L9FA 2CUDA 3A4CA 4P9FA 1GDTA 3WTYC 1AWCA 1D1BA 3IH2A 4BI8B 1KQ2A 4U7BA 2CW7A 2VOOA 3GFLA 2F69A 3CO7C 2ENMA 2WA0A 3QWYA 1P4WA 4HAMA 2EKHA 4LUDA 2RNJA 3LGFA 4XKCA 2V1UA 1I6HJ 1QLYA 3HJEA 4RAGA 3EUAA 4OMZA 3CCRQ 4F93B 2QKMB 3ONQA 5DEQA 3VU3C 2A5WA 5GTIC 1JRIA 3VRZA 4HNTA 1Q82C 1VNDA 3KX2A 1UGPB 2FXAA 1N6AA 3ZQFA 1Q82U 3H8ZA 5IHIA 3L2RA 3CCMQ 1GXIE 4A4HA 2CG4A 2Z33A 3CUQC 3SD4A 2JN6A 3LX7A 1VQ6Q 4ASNA 1GLNA 3M1EA 2K2VA 1GXPA 2LC4A 5GANf 5HK3A 3H5AA 4IIOA 2AQEA 4XTXA 2CUJA 5E3NA 5EDNA 2DFEA 5F0HA 3JRBA 1CF7A 5LGNA 1UHMA 2MA3A 4ZZDA 2JK3A 4UV8A 1LUJB 4Y28E 4HPQA 3P9CA 1XDUA 2ZNZA 1V4RA 4YFNF 1C0MA 3C12A 1X4OA 1Z3YA 1R1VA 4Z6YA 5K1YA 1EA3A 3ZFJA 4IIMA 4JOMA 2CH4A 2KYMA 2V1XA 1W70A 3CMEI 4RA2A 4XAXB 2CWEA 2LG4A 1X6OA 4UHTA 5DUIA 3F6VA 2EQMA 1YN8A 3FMSA 3F70A 3DPUA 5EEAA 1KYZA 2L3RA 1NZ9A 3CBMA 3ZMUA 3CCRA 4IL6C 1XDSA 4RB0A 3LL7A 2LK2A 4LG3A 3KXTA 4F91B 4Z02A 1QRYA 1QZYA 2ACJA 2WSFE 1KU2A 2A05A 2JW4A 3THKA 5CQYA 2ZCFB 3PTAA 2EJRA 2VQCA 3L1PA 1HYOA 2EYZA 5DD8A 3HOXJ 3JRFA 1NPRA 2RH2A 5LEJA 3IH4A 3HOYJ 1F36A 5DCMA 4AFSC 4ZJZA 1O7FA 4PDKA 1JEGA 5IY5H 1V5EA 3KEOA 3OYKA 2O2OA 3PIOA 1IRGA 3K2AA 3JAMZ 1HW5A 4ABZA 2E2JJ 3FXUA 3QJYA 3MMYB 2CQNA 1UJ8A 3VYRB 4P1WA 4E6KG 1AKHB 1RI9A 1U5SA 5LL6S 1HXDA 1SKUB 1X19A 1BC7C 5IH2A 1KIKA 4ESFA 1GCQC 1N27A 2OQGA 1IB8A 2DXTA 1SVLA 3PUFA 4HV6A 3LYIA 1G4DA 9ANTA 2ECZA 4A3DJ 4KT5C 2XPUA 3A5ZB 4CICA 3JRZA 4E7ZA 5M5WJ 1WRJA 4Q48A 1LB2A 3CDIA 2MYSA 2QQBA 3JTHA 3BFMA 3FWEA 2JJ9A 1PSFA 4LG0B 3JB9G 2KZVA 2K9QA 2E71A 1YS7A 4P9UA 2PJPA 3FKJA 1KSWA 5KH6A 4MIMA 2FQ4A 2ID3A 2J5PA 3MAJA 4CH7A 1SFOJ 3GPLA 2XVCA 3BR3A 3X2QH 5HODA 2GM4A 2YR2A 5J1RA 3I64A 1NM7A 2L2PA 3RKWA 1ZG1A 2YSRA 3ZMVA 1D5VA 3PQJA 5F64A 3SQNA 2X4WA 3PSIA 2XG8D 4LNPA 3TVTA 5GAN6 3RJPA 3UF4A 2KT0A 1U8BA 4G12A 4FYYB 2DA4A 4B48A 5I2SA 2QA4T 2MSYA 1Z21A 1OX9A 2KQWA 1RI7A 4BY7J 5C0MA 1R5GA 1T3LA 3D1NI 2DJNA 1RLPC 3E97A 2KSSA 5GPCA 1I50J 4M75A 3F8MA 3K70D 4OIPF 1XGMA 2GCXA 1I3AA 1ULYA 1YI2Q 4PSXA 1MUZA 3TU4K 2HQXA 4BEHB 2C0IA 2HYFA 4XKBA 1F43A 2MCNA 2DYIA 4LN2A 4OMNA 2P4TA 5LFAA 4I98B 2HVQA 1NJIR 3CDHA 5C3EJ 1T0HA 3OWTA 4JJNK 2RV8A 1Z9QA 3DU5A 1X2MA 2QUFA 4M78C 5K7ZA 3WE3A 4II3A 4M6VA 1R6RA 4AVZA 1BIBA 2L3DA 2MC4A 3J7YJ 2CV2A 3I9QA 2KKOA 1FEXA 2NUPA 2KISA 3KYDB 5GAHJ 2PUOB 4OOIA 1TUGB 3RPUD 3P9KA 1XGNA 2KIMA 1K4SA 2XGXA 4ZYDA 3VYSB 1N78A 3F21A 1RKTA 4RTVA 5CIUA 3G4SQ 4XLFA 2WADA 1CKAA 1APLC 3T9NA 3GTLJ 4QPOA 3PGGA 4IUTA 2D6FA 3ZEHA 1K78A 2QVOA 1WHJA 1PYVA 3QYFA 1KD1R 1GUUA 3BTJA 4B43A 4YTLA 3ZMTA 2YPRA 5K5RA 1JI8A 4XTZA 5LEKA 2PEXA 2DL5A 4IUPA 1AT1B 4DEYA 2DERA 2HQHA 1N8RC 3CLOA 4M7DE 3QQAA 3PNVA 3TSWA 2K4JA 4L5IA 3RQ4A 2R58A 2D0NA 5D6FA 2XROA 2DPDA 4BI4A 5GAOr 3MFKA 3NFCA 4PJOA 3IC7A 2R7FA 4M6YA 4MQ9F 4C0FA 4F7UA 3ZCOA 3FX3A 1N75A 1YE9A 4AIJA 2Y30A 2DMUA 5LGTA 3M4OJ 5E1ZB 2EVRA 2VODA 3AG2H 1OU8A 2EGAA 3CCJA 2BVMA 2AHQA 2PVOB 1YJ9T 3I5UA 3GBQA 4UB8C 3EG9B 2OBPA 1Z91A 4HW0A 4KT6A 4IZZA 1I6XA 1MBHA 1R9TJ 1SSHA 1XN7A 2ESNA 2LBFB 3ULRB 2IJLA 3M0SA 3ZGKA 3MVPA 4DEXA 2HKQB 3G3ZA 4MMLA 2PQWA 2V1DA 2EH3A 3DTEA 4BS9A 3TMOA 1DGWY 3RMQA 2VASA 4QVZA 2XPVA 5EYRA 3ZQHA 4ENMA 4BBSJ 5CKTA 1SANA 2RVCA 4HNUA 2A61A 1BK2A 1PNJA 5HLHA 2ME0A 3SDZA 4JRIA 2AQFA 3JB9F 2DIQA 2VQLA 5DCMB 2RHUA 5IYBJ 3CCQQ 1ARKA 1UUEA 2FD5A 4EQQA 2HDDA 1HDPA 1ZA2B 4CC7A 3FM5A 2RREA 5DV5A 2EPFA 5H20A 1O9SA 4Z2YA 1SG5A 2XF6A 1WDXA 1ZG3A 2KT1A 1AKHA 1IGQA 1FSEA 5IT9Z 2RMOA 1OKRA 2LNHB 2QEXA 2F5KA 1YHQQ 1WZ2A 2LYCA 4A3BJ 4LGWA 2L54A 3FK6A 1JXSA 3I56I 1WWXA 3R6SA 1E6GA 2YLBA 3T8TA 1BI1A 5KYWA 3ZXSA 1W0TA 2KFDA 3LGLA 2K9NA 1P6RA 4PK4A 4U88A 2EINH 2GFAA 3ECOA 2M8EA 1ZG5A 3MKYB 1O3QA 3HHTB 3K4JA 1SD4A 3EGXA 3CCUA 4JRKA 1QCNA 2HQNA 2E4HA 3QUIA 3PFYA 1X1PA 3RZOJ 2LT4A 2LMJA 2WWYA 5FLMJ 1ITYA 5JHUA 2F2VA 1WSUA 1IGUA 3A8MB 4JJCA 1AWXA 4PNOA 1S7EA 4XU1A 3BZKA 2W0ZA 3CCVA 1OZ2A 4MMKA 2HTJA 2FU4A 4M7DF 3FRNA 1LNXA 3JCMd 3MKWB 1K6YA 1VIFA 1ODDA 1J75A 1KQSS 3CMAA 2BW3B 1VQKT 5GAN7 4IXAA 3T5XA 4XRMA 1SFUA 2RJCA 2DLLA 4NC7A 2VQHA 3QDRB 3CJNA 1V76A 1PRLC 5D6WA 5DYMA 5FD5A 2KAFA 2RB6A 4L9JA 3LFUA 4BKXA 2HBWA 4KUDK 5DM6F 4M7DC 1PP8F 5B1BH 5E1XA 1QCOA 2CS3A 2XKPA 4V2FA 2V8JA 4C3IJ 3JW4A 4P96A 3JR9A 1H641 4JUVA 4KGXB 2GWRA 4U0VA 1VQPA 3PM1A 2RI3A 4ENNA 3I56A 4M7DB 3LSGA 3VDXA 3G4SI 3KE2A 3UDCA 4MO7A 3WTWC 3KIOA 5DDGA 1YNZA 1YJ9Q 3HSRA 4IRIA 3NWSA 3T0YA 1ZQ1A 2L8DA 3GYHX 2P84A 3OS2A 3IP4B 4M7DG 4H4KC 2F4IA 1TWBA 2ABLA 4XRSG 1X1CA 3WHBA 4Z88A 1YIJI 4BGDA 4J9GA 1IF1A 4EV0A 2K7AA 2DA5A 2YWWA 2A3SA 4CYCA 1Z77A 2Q1ZB 4EDUA 3CF2A 2OTLA 2FZKB 4QTRA 4DOWA 1B1BA 3ESWB 3VFZA 3MZHA 3BY7A 4HXJA 4E4HA 1MJ9A 1K8AU 3OYCA 4JRQA 1YQAA 1TNSA 1ZYRF 5D4RA 1YCSB 3M5AA 2JA7J 3M54A 4DOZA 2L7ZA 1GBQA 2EJ9A 4C92B 4ITVA 1PC0A 3DB4A 3MKLA 2E5NA 2L4MA 2XAFA 4NC8A 4NQWB 4JX5A 4OAZA 3I54A 2XRLA 3VB2A 3JB9D 4X6AJ 4IEJA 4C92C 3L42A 2K40A 5D6XA 1OJLA 2KNBB 2H1LA 2LVSA 4WTOB 4O3MA 5ILSA 3VJPA 5EG0B 3OYNA 2HDAA 3C94A 3FIFA 1MKMA 1MGTA 1PHTA 4OU0A 3D0SA 1PD1A 2FBIA 1TU0B 2CZ1B 4B4CA 3CBOA 5GMKl 4IF4A 2LOOA 3V8LA 1Q86C 4VUBA 3VS3A 3HRTA 3HC7A 1M90R 2HYJA 3RUXA 3I59A 5EJCA 3KPHA 4XM3A 3RYPA 3SFIA 3EYIA 3EAEA 5E8GA 1WHHA 1ZQ3P 3GZNB 5KE3A 4C0DB 3CCMI 1JTXA 5LJ3g 4JS4A 2LLKA 2PMHA 1KU9A 1JQQA 1FYNA 2DVJA 4JP0A 1I0CA 3EH2A 2ZO4A 4M71A 5GAN4 5EC7A 5JVGF 1U1SA 1YRNA 1D1CA 1UE9A 4M7AG 4LOCA 2FA5A 3ZN0A 3GFMA 2CP2A 2VUBA 3GTOJ 3CC2A 4G94A 4F52A 2ECCA 1SVOA 4FX4A 2XD0A 2NNYA 2ED0A 2O6GE 3HPWA 4HT8A 3ABUA 3CJRB 2DFIA 3LWIA 1O3RA 1B8IA 4EATA 1WJFA 2IP2A 1ZBXA 8AT1B 1UCRA 1ETYA 4C2TA 2QGFB 1JTYA 3KFWX 5EZGA 3RIRA 1JKOC 2JOYA 2XAUA 2FEZA 1ZLKA 2VYTA 3EGUA 2LREA 4LLNA 1OYWA 1IO2A 1WHKA 2CT4A 3MEUA 3LWFA 4NS5A 4RTYA 2ELHA 1VOMA 2V8IA 4R1HA 3UT1A 2XRNA 1NE8A 1XSXA 5A2QE 1TC3C 1AHDP 4CCLA 2BE7D 3CPWS 1HD3A 1A04A 2PMUA 4FHTA 1I4K1 1QU3A 2ROTA 2TCTA 2HDWA 3MHXA 5GAMh 2LNBA 4XN3A 1ZRCA 1B7TA 4HF1A 2DXBA 5C4XJ 1ZN2A 3EGXB 3NTIA 1R58A 2RQTA 3EFOA 4XL9A 3A8GB 3HZJA 1ZGAA 3A8OB 2P6SA 2XDVA 3L2QA 1XGOA 2IVMA 1VQNT 2K4YA 4XIDA 2QENA 1QVUA 5BPIA 2O7OA 2R7TA 2QA4A 3QPSA 4HCBA 4OGEA 4GGGA 3VS0A 1IG7A 2DFFA 4LJZF 2E41A 2J6OA 4ZH4F 4HYEA 1K79A 3HP9A 4BJ6C 3IWZA 3S32A 5KHDA 2DNUA 2PVDB 4PFPA 2E3HA 4M4ZA 3QZ9B 2DA7A 5IXFA 1JT6A 4EM0B 4U0YA 4PLLA 1B59A 3RZDJ 2RQQA 4A5NA 3CCJQ 1BBYA 3DKXA 2CYZB 2Y75A 5FLXE 2PN6A 5CYVA 5AYFA 4OAYA 3ELKA 3K1PA 5EGOB 2P8TA 1ZBJA 1P7JA 4ESRA 4BDYA 1OPCA 4JQFA 4HCZA 3WGGA 5JVTA 5L23A 4B9XA 1HKSA 2JMAA 5CKHA 4N9HA 2FZGB 2LJ1A 3RKYA 4CSWA 1K61A 2A08A 1LE8A 2G7UA 2LTPA 3S3OA 2EPDA 2WACA 3CPFA 2KBTA 4ORZA 4E6RA 2VBZA 2GBYA 4L9VA 3O8VA 2FUG2 2L02A 1KGSA 4Y7NJ 1ACIA 3SHFA 1D0XA 2WAEA 2DK8A 2FOWA 3KLNA 1VIEA 3SEQA 2WBMA 4LB6B 1G8XA 5H2FC 2ECBA 2OUMA 4CYCB 1NTCA 2MG4A 1OEBA 2V1RA 5IP9J 1I39A 2R3SA 4A3GJ 1P2FA 1BBZA 1VQ9Q 4RMNA 3GFJA 4XOPA 2DX1A 5M9OA 3FF5A 1YW8A 1UB4A 4XLHA 1F5TA 3OIPA 3VEPA 4RGSA 1W0UA 3S17J 1WI9A 2VPLA 3L2VA 2Z5UA 2XDPA 1GV5A 1U5TA 2DYRH 2OCCH 3I4NJ 2W10A 3DTKA 4OMYA 3HOZJ 4Y92A 4FYWB 2NNNA 1RAHB 5HCKA 5DM7R 4GYGA 1RAGB 1LVKA 2M87A 1VQMI 1RIOH 2EW3A 3FDYA 3V42A 3TQ7P 3KP4A 4IQJA 3Q0VA 2P0PA 2W1OA 3N97A 2MFZA 4IPAA 1K1ZA 2D45A 1IO6A 3D5LA 1RI0A 3I35A 3S3NA 1QHHD 2CSOA 4MZPA 2K3FA 2KPMA 3LAPA 1SF9A 4UVAA 3ASOH 5B5EC 2D1HA 1BW5A 1BCMA 4N4GA 4K11A 2K02A 5LBQA 4KA4A 2I2LA 2JVVA 3J80E 2EKOA 2FPFA 2FL7A 2Z2SB 1AWOA 1QW1A 2KGTA 3CF5F 1IAWA 2HPMA 3FMQA 5K5QA 1DPUA 3NMZC 3ZP5A 3ASKA 2EZKA 4AT1B 5JLWA 2ISZA 4X9DA 4IO9F 2XICA 4IRGA 1M1GA 2CP3A 1WJAA 1UELB 4QIWN 1QP2A 4GO1A 2I0NA 3OMCA 2H6BA 2CRGA 2MC3A 3P9IA 4NB5A 2M9UA 5FJ8J 4I09A 5CK9A 3WTZA 2QI2A 5GMKi 3C7JA 1XNIA 2ISYA 5JHFA 2RJDA 2P5VA 1XJWB 2CP0A 1W2BP 1UHWA 1ZGJA 3FXJA 2RN8A 1M1KU 3SHWA 3CD6T 1RR8C 3QSUA 3HRSA 2E6NA 1R4MB 3BR6A 2JMWA 2R92J 3CCVQ 2DK5A 3U21A 2QSFX 4TVRA 1R00A 2WY8Q 2R7DA 2FMYA 4KIFA 3P5JA 2E7WA 3W6JB 1GV2A 2CQQA 4B6MA 5LJ5g 4AYBA 4E7HA 2FVUA 2R7WA 2J7IA 3CC4I 1MHNA 1VQMA 4G6TB 4PFOA 5E3OA 3MP1A 4DIQA 1MMGA 2VJ5A 3ULQB 4UC4A 1MH4A 2VI6A 2VC0A 4KUMA 2I8DA 3GZ5A 2IG0A 3H0FA 2KMUA 4RGXA 2DF6A 2DT5A 2KXDA 2Y31A 1TT5B 3A0HC 4IHXA 3PUBA 4RAYA 3GMEA 5A0GA 7AT1B 3PIPA 4HQEA 1EJ9A 3M4YA 4DA4A 2BY0A 1IW7F 2XK0A 1LQ1A
chains in the Genus database with same CATH topology
4O5VA 3ECHA 3Q1JA 4RB2C 2OTLT 2EFIA 3JSPA 1WJSA 1SD6A 1DPRA 3G7ZA 4J7IA 1XTDA 3ML6A 1J9IA 5FU7B 1FBQA 2CGHA 3I53A 1W4MA 1VQ9A 4U7DA 5E20A 4P5OA 4Y15A 3HRUA 3BPXA 5HDKA 1IXRC 2QYOA 3RKXA 3WE2A 1I1GA 4BXUA 2XKOA 2FNAA 2HZTA 2J5OA 4CI0C 1VQOT 1M1FA 3FMRA 2MLGA 3QAHA 4XLNF 1TH7A 1R1UA 2OZUA 2WSEE 3QRFF 4CYDA 3L2UA 1LDDA 3T8RA 3CD6A 4PLIA 3CUOA 2HOEA 2XASA 3M9AA 2CGPA 4N0AA 4C0ZA 5LJ5e 4MDWA