3HRTA

Crystal structure of scar with bound cd2+
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
212
Chain Sequence
PNKEDYLKCLYELGTHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
total genus 52
structure length 212
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrtA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrtA02
5FLXZ 2J5OA 2P6SA 1FOKA 2KRFA 1R00A 2VN2A 5CVRA 3F8NA 1H9TA 1EH8A 3REOA 4U0WA 2ISZA 4EJWA 4WK8F 4P9UA 3HOTA 1CGPA 3J81Z 1SMTA 3LA2A 4LK0F 1U5TC 3F21A 1YG2A 2EA4A 2JSCA 4UVBA 2ADUA 2ESNA 1U5TB 1TW3A 2F5FA 2DU9A 3DEUA 2XIGA 1PDNC 2VE9A 1QZYA 2V6CA 1MDMA 1TNTA 1LDKB 4Q47A 3HTUA 1LDDA 2L3DA 1T98A 3DV8A 2IA2A 3E6CC 4IRGA 2DK8A 5KK1A 4MHGA 3WTVC 3ZN1A 1SAXA 2W24A 2D1HA 5TJJA 4ENKA 2K4BA 1KYZA 3U9GA 3DP7A 1RZ4A 1U6GA 1IZ1A 5IT9K 2CO5A 1U3EM 1W5TA 4G94A 2ZNYA 5K5OA 3VOEA 1ZYRF 3MHXA 4KMUX 2FBIA 1YIOA 1TTYA 3LQRA 5ILUA 2L02A 4LB6B 2Z3YA 2M30A 2GQQA 2QQAA 2QM3A 3B02A 3N97A 2IA0A 2CYYA 4A5NA 2ZNZA 1W7PA 3RJPA 1I27A 2V1UA 2K4JA 1BOAA 1ZREA 1Y0UA 1GHCA 3ERED 1FT9A 1HSJA 1OPCA 4CICA 5IT3A 3TKYA 2QUFA 3F22A 2VXZA 4M74A 2NNYA 1I6XA 1ONVA 1YTYA 4UV8A 4BAYA 5E20A 4LMYA 2O0YA 3CDHA 4GGGA 1IN5A 1MDMB 3DXJF 3V8JA 3ULQB 4N9IA 3F8CA 5D4SA 1B1BA 2O6GE 3JAMK 1J2XA 1R5HA 4P96A 4D0PA 2BGCA 2VBXA 3GZ6A 4WXCA 2NNNA 1USTA 2XROA 2IVMA 4AIHA 1RIOH 1J9IA 3V8LA 4L18B 4GXOA 5ICCA 2W84A 2ZFWA 1TNSA 1PP8F 1UCRA 3IWZA 4O5VA 4KDPA 1LEAA 2KJCA 4HV5A 1J59A 3LSTA 3H92A 3WTYC 2RC4A 4CZZA 2CGPA 3P9IA 2FXAA 2VBYA 4UUVA 2VE8A 3D0SA 1AOYA 4G7HF 1YW7A 4NHJA 3I64A 3K0LA 1W7PB 2E1CA 2WWYA 2P5LC 1XD7A 1ZN2A 3WU1B 2Y0MA 5DUKA 4CGZA 1B9MA 3V7CA 1KU3A 1E2XA 4NQWA 2FEZA 1SD5A 2EK5A 4OOIA 2HQNA 4Q4ZF 2V1DA 1ZGAA 2OD5A 3W6KB 5HOOA 2Y48A 2KIUA 3R6SA 3GFIA 3IC7A 1HW2A 1KU2A 1QPMA 4HQMA 4EJVA 4EM1A 1O3RA 3MAJA 1FYLA 4I02A 5D5VB 1ODDA 3DKWA 3E6BA 3VFZA 4ZYGA 2HQRA 1RNLA 1YS7A 4RGRA 3IRRA 2G7UA 4HF0A 4L0ZB 1BBYA 1D8JA 4OMZA 3Q5FA 2K86A 2M45A 1IF1A 2DT5A 1F4KA 4G7OF 1GXPA 3SHFA 3LA3A 1Z7UA 4IVNA 1B9NA 4YIIA 2YPRA 1U78A 4S05A 4Q48A 1NHAA 5F1RA 1R1TA 2ZO4A 3DPTA 3GYHX 3RPUA 1IW7F 2IPQX 4MTDA 1TQPA 2VC0A 2VT3A 2A61A 2XKPA 2E1NA 2VOOA 4L9JA 3L7WA 1HKQA 4UNOA 1XB4A 3GZ5A 1SD4A 3W6JB 3HIFA 4KNYA 1IXCA 3WTZA 2ESHA 3E5XA 5HS7A 3BY6A 4BH9A 4DNCA 1JE8A 3QAHA 2LF7A 4UVAA 2XVCA 5E1WA 3PQKA 3M1EA 4KUMA 1Z05A 2OQGA 4I7HA 1JHHA 4OIRF 2LSOA 3F3XA 2K02A 2GXBA 5E18F 4OINF 3MWMA 3F23A 4HX4A 1MD0A 3TQNA 4IF4A 4RGUA 5FB2A 2EFPA 3QOPA 3CUQA 4TV7A 2NYXA 2FF4A 3BJAA 1G4DA 1YLFA 1PP7U 3IL2A 3E97A 1LDJA 2PBIA 3WGIA 4K2EA 2PI0A 3RYRA 1LB2A 2Y75A 4RB1A 3T0YA 3QU6A 4KA4A 4G6DA 3KP2A 4HDUA 3FZVA 2DW4A 4AWXB 3V4GA 3K69A 4ETSA 1XDSA 4CDGA 3GFLA 1MJAA 2FU4A 4LG0A 4XBFA 2OZ6A 4KN7X 3RI4A 4HV6A 1J0RA 4XSXF 1IRFA 4B09A 3CO6C 4MNUA 4ON0A 3KEOA 4A2UA 4A6DA 1X3UA 2K4YA 4QWQA 3NQOA 1PUEE 3WTTC 2H6BA 5L3GA 1KQ0A 2Q2EA 4KYWA 1R5GA 2L01A 3VODA 1O7FA 2IRFG 1ZAOA 3WGGA 2HDCA 3CUQC 2R7DA 3JTGA 5LGUA 1S3JA 3CUQB 4LLLA 3N4MA 3TGNA 3WU0A 1O7LA 3CUOA 3F8MA 1LEBA 1DPRA 4S04A 5A2QK 1R1VA 4LGWA 3S2WA 2L4AA 2RGVA 5DEQA 1MJBA 2RNJA 2W57A 1ON1A 2A69F 2XRNA 1R36A 4IPAA 1W4MA 3E5UA 1DUXC 5L3BA 4IRIA 2EV5A 2XKOA 4MEXF 3O6BB 2HR3A 3M8EA 2KJBA 1C0WA 1XGNA 1U2WA 1T2KA 4LG0B 2P5VA 5ILSA 2EB7A 5D5UB 1OYWA 5HLIA 1FP2A 2CW0F 4H0EA 1KU7A 4G9YA 4A0XA 1WRJA 4RAYA 1HW1A 2Q0OA 3TOBA 3LWFA 5ICEA 2IT0A 4RS8A 5DV5A 3ZMSA 1HBXG 1KU9A 4RAZA 1FBQA 4CYDA 5BOXA 2YR2A 3E5QA 2ZKZA 3I53A 3U1DA 3LAPA 4FX0A 4HYEA 1YS6A 1SD6A 2GA1A 1V3FA 3QP6A 2Z33A 4RGXA 4PGHA 2GCXA 5DYMA 3I71A 2CSOA 3IKTA 2MA3A 2MC3A 2ZCWA 1FYKA 3GEZA 2VBWA 2IA1A 3I0TA 5H6QA 1WQ2A 4G8XA 2ACJA 4Y17A 2PFBA 1S7AA 4HF1A 4UV9A 3K1NA 1D3YA 1FC3A 5ICFA 5LEKA 1BI1A 3CLOA 3BPVA 5CVIA 2QVOA 1XGMA 3WODF 3RPQA 1R58A 3NEUA 5J6XA 5BMZA 2PMHA 3K9TA 3KZZA 2K7LA 2F5CA 4MQ9F 2JT1A 1G3TA 3ECOA 5E8IA 2QQ9A 1KGSA 1RUOA 2DBBA 1O3QA 4GYIA 1ZGJA 2BE5F 3SZPA 3WTWC 4ZZLA 4KN4X 1KA8A 1DDNA 5FGMA 1P4AA 3FM5A 4ZYEA 4A6EA 2BEOA 1STZA 4M6YA 5K5RA 4I0AA 2O8XA 4M9ZA 3HRTA 2IP2A 2ZBKA 3CJNA 2JRTA 1KQ9A 1FY7A 3KEQA 1I1GA 2P6TA 3ZMZA 2F5EA 1L0OC 5HS9A 5CLSA 1DPUA 4AVPA 3I4PA 1GXQA 3QRFF 3BJOA 3K1MA 4EQQA 2O3FA 3QPHA 3NRVA 3R60A 3GWZA 5DCFA 2D1VA 4XSZF 2FBKA 2ZJ2A 1TLHB 2P7VB 3LA7A 3P7NA 3GVAA 3WG9A 2OAZA 1ZH5A 2YX7A 3F6OA 2W85A 3GUDA 5ILVA 4ESFA 2MBFA 1ZG3A 5AIQA 1BC7C 2ZMEA 2QYOA 3M7GA 2VC1A 2QWWA 3SXYA 2H09A 2QBYA 3JSPA 1R23A 4IHTA 3ISPA 4U7DA 5K1YA 4FX4A 3LQQA 3BROA 4OIOF 2NAZA 2HYGD 4HX7A 3HTSB 2EWNA 2HOEA 4MEYF 2HTJA 5HVQC 2K27A 2PQ8A 4LJZF 4ASNA 2HEOA 1S7OA 2G9WA 4G6QA 2NRAC 2V9VA 2FNAA 1SFUA 1JHFA 4HF2A 1B59A 4FT8A 4YFKF 4HLYA 3WE2A 4OU0A 3L9FA 1JGSA 3O3KA 2GWRA 4A0YA 4YIFA 3KP4A 4ESJA 3BDDA 2EV0A 3L2CA 3KP6A 3CO7C 2CG4A 3EUHA 3E3VA 5FLXK 4B8XA 3F8FA 5JR3A 4QLCU 3ELKA 3V8KA 2M87A 1I5ZA 3B73A 1F1ZA 5HS8A 1G3WA 3FX3A 2JZYA 3FMSA 1J5YA 4IRHA 4L9NA 2OU2A 3JW4A 4I09A 1WSUA 1HQCA 2Z5UA 5J8CA 3Q9VA 3J7AO 2DFIA 3J81K 1W5SA 2VODA 4U88A 3OV8A 1FBUA 2YX4A 1P4XA 2XV4S 1S29A 2EFNA 2ZMEB 2XAQA 2G7HA 2QBYB 3WE3A 4WX9A 1Q1HA 4HZFA 2JPBA 2A07F 1O57A 5IT9Z 3ABUA 3WTXC 4GCVA 1V4RA 4ZYHA 3R0JA 1GVJA 4RB2C 4HLXA 2X0LA 1WWXA 2OQRA 1ON2A 4I98B 2H94A 1K79A 5LHIA 1ZG1A 3E19A 4BHCA 4WCGA 3DQVC 3SQNA 1QVPA 2DO7A 5DCMA 1YW9A 1BM9A 3U2RA 1ZRCA 2GXGA 3V7SA 1HKSA 1B4AA 2AS5F 1WKMA 3RDIA 3MQ0A 2DI3A 2HFHA 2DLLA 1TQIA 1K78A 2A6EF 3KZYA 3HRSA 5J8FA 4XRFA 3TO6A 4AD9A 3PQJA 4U0YA 3FXUA 2O03A 2PN6A 3H3UA 2MLKA 3HSRA 3MZHA 1J7KA 5L3FA 2PEXA 3JAMZ 2FBHA 2Z99A 3ROUA 4PZJA 3VB2A 3CTAA 5H20A 3TO9A 4BNCA 2CWEA 3I54A 5DUIA 3GX4X 1IUYA 1ZHFA 3BZ6A 2VBZA 4LLNA 4ENJA 1ULYA 4MGRA 2IJLA 1P92A 2KIFA 1UFMA 5D8LB 3RIRA 1SFXA 2XGXA 3Q9SA 3DF8A 4O3MA 2FRHA 1SMYF 2GZWA 3SZTA 4F7ZA 3ZP5A 3T5XA 5E17F 2WTEA 1REPC 3HRUA 4BYYA 2O61A 2EV6A 3MEXA 4M6XA 4P9FA 4RGSA 1RUNA 1XGSA 3ZMVA 5JVTA 4EGYA 1BI0A 2RV8A 2C6YA 1S6LA 2DK5A 2HYFA 3BP8A 2EFOA 3GXOA 2K5LA 1T39A 1YQAA 2XUBA 1ZLJA 1VTNC 2OZUA 5FO5A 5BQTA 3G3ZA 5D8KB 4ENMA 1ZG5A 5DCMB 4L5IA 4AIJA 1FP1D 2DTRA 2P5KA 3G73A 1SFEA 1LJ9A 2BYVE 3IHUA 4P55A 3RKYA 2WC2A 5H6RA 1UHWA 1K78B 4KIBA 5FD5A 5D6FA 5ERIA 3KP7A 4KIFA 2MD5A 4ESBA 2UXNA 2LKPA 1IN8A 4JK1X 2P8TA 3BOQA 3FXQA 3HHGA 5LLQA 4E70A 3ABTA 4N9HA 5D5WB 3C3WA 2ELHA 1BC8C 4M9SA 2UXXA 3BWGA 1EV7A 4HX8A 4LK1F 1MKMA 1BN5A 3V7RA 5TRDA 3RTRA 2STWA 4HOBA 3LFKA 1OKRA 3KLNA 1FLIA 1E17A 2KKOA 2JPCA 4KICA 4KMFA 2CFXA 1H0MA 1OR7A 5F64A 3WTSC 3AAFA 1BI2A 2QENA 3FHZA 2MLGA 3L09A 5KVRA 1IN4A 5LRRA 4HBLA 2H6CA 4EMSA 2QZ8A 2JTVA 1CF7A 2HKOA 1H9GA 1G3SA 3HYIA 2RQPA 3EETA 4A0ZA 1XMKA 5L3CA 1MGTA 4JQFA 4EGZA 1LQ1A 5D4RA 4EVIA 3RYPA 4UVCA 2VONA 1FBSA 2HZTA 1QO0D 5K5QA 3WTUC 2PJPA 5E1ZB 4LFUA 4KFCA 1FX7A 3O2PE 2LF8A 4U0VA 1F5TA 2HKXA 2RKHA 3P9CA 3IRQA 2J5PA 4M72A 2A5YB 5HDKA 1K7AA 2H27A 3TDUC 3ZQ7A 1K6OA 2OA4A 1P6RA 1XCBA 3I58A 4OMYA 3MCZA 1YFHA 2EA2A 2MH2A 3EYYA 1G6NA 3RKWA 3KETA 1R22A 2UWMA 4A12A 3GW2A 5L3EA 2K5IA 3T8RA 3D5LA 3P9KA 4RB0A 4AIKA 4KT5C 4BHPA 1FSHA 4NB5A 4EJUA 1I1SA 1Z6TA 1HSTA 4O6JA 5EEHA 3R4KA 1P2FA 3GO5A 1FNNA 3ZMDA 2GIVA 3I59A 3R0AA 5AONA 2STTA 1XSXA 3FXRA 4R8HA 1EH6A 2HTSA 3GLXA 4P5OA 4CHUA 4L5JA 2LDUA 2X4HA 1IAWA 1CF7B 3TOAA 4R79A 2DQLA 5HLHA 4FHTA 5LHHA 1JXSA 4OIPF 3I5UA 1FSEA 2Z9OA 4Z2YA 3ZPLA 4WXHA 2RN7A 2XAFA 1LVAA 3EYIA 3ZN0A 3F72A 2A6HF 4L9TA 2BV6A 4GYGA 2DQRA 4UHTA 2F2EA 1O3SA 4BQAA 4HA8A 5CJ9A 4ENNA 5LRSA 4LB5A 1XGOA 3IKVA 4U7BA 2R3SA 5JHUA 3COAC 3DFGA 2RVCA 1QZZA 5EEGA 4ZYDA 1IXRC 4R1HA 4YFXF 1YW8A 4L0YB 2FNPA 2A3SA 3K1PA 4Y13A 2H3JA 3HSEA 1QQIA 3WGHA 5BPDA 2UZKA 1R7JA 1HW5A 2NS0A 5CVVA 1IN6A 1U8RA 5E1XA 3M8FA 4LD5A 5BPIA 2A68F 4EJTA 1BYMA 1QNTA 5CVJA 5ICGA 3KFWX 4PGGA 4M9XA 4I2OA 3I59B 1HXDA 4OIQF 2LX9A 3T8TA 1D5VA 5A2QZ 1BIAA 2W25A 1ZLKA 3J80Z 1T38A 1RI7A 2YSRA 5LEJA 1MZBA 3JSOA 2XAJA 1O3TA 5HLGA 1BIBA 1OYYA 2PLYA 4WWCA 4MTEA 2L54A 3QP5A 4M73A 3GFJA 2EFWA 3ML6A 4BHBA 5ED4A 1KYWA 2XHKA 2XAHA 3KLOA 1B6AA 4I01A 2FMLA 1A04A 5FFZA 4UXNA 4LLGF 1G3YA 1UB9A 4EJOA 1TW2A 1EH7A 4L9VA 2DPDA 2P7CB 3C18A 1USSA 2F5DA 5AIPA 3EDPA 2FSWA 1IRGA 2YU3A 5DDGA 3FF5A 1XCVA 2FOKA 4CO8A 1OYIA 2LNBA 1MJ9A 1LNWA 2M8EA 4DQ2A 1S8NA 1QBJA 1HKTA 1L3LA 2HWVA 2ZXJA 2PG4A 3PFIA 5D5XB 2KIMA 2CQKA 5FFXA 2QLZA 3R61A 3HHHA 3HSFA 2TDXA 2M1BA 1AWCA 3BPXA 3DPLC 2QQBA 1P4WA 3E6DA 1R1UA 2XASA 1YO5C 4XLNF 5E8GA 2ETHA 1QW1A 3EQLF 4YG2F 5CVUA 1T6SA 5L3DA 2VT2A 2EFQA 3M9AA 4HAMA 4M71A 1F9NA 2R7FA 4EV0A 3KP3A 4WXDA 4G7ZF 5BS6A 2COMA 1ZRDA 3OOPA 1WI9A 1XSDA 3QU3A 3H3ZA 2E7WA 3TDZC 3KCCA 3FMQA 3ZMTA 4EM2A 4IJAA 2PMUA 3KP5A 1ZRFA 3HOSA 2AXLA 3L00A 2V79A 5LHGA 2DPUA 4JBAA 5DD8A 4MQVA 3RKXA 4ZH4F 4IXAA 2IW5A 4CXFA 1Z9CA 3C1DA 2FMYA 3KE2A 4KIGA 4HW0A 1W7PD 3SFZA 5F6FA 1TQMA 1XSVA 4Y15A 5HDNA 2WV0A 2B0LA 5CYVA 4I0BA 3BJ6A 4PDKA 5JI6A 3HRMA 3E6MA 5D6EA 2MH9A 1YYVA 1TBXA 4Q5SF 6PAXA 2BBYA 4HDVA 5HDGA 1OMIA 3ZMUA 2P4WA 3F8BA 3IWFA 2D2WA 1Z91A 2HGCA 2EJRA 3T1BA 4BXUA 3FMRA 2GAUA 2FE3A 4ZZDA 1KQ8A 3GF2A 2VOPA 2ISYA 3MZYA 4N0BA 3LAJA 2OBPA 1FZPB 4GO1A 4EM0B 3HUGA 1ZARA 2Q8KA 4RB3C 1FPQA 4IHSA 2HS5A 1BJAA 3QPTA 1J75A 1FYMA 1IN7A 1XN7A 1FWZA 5JFRA 2FQ3A 1XDUA 4PCQA 1U5TA 3C7JA 4YFNF 2FA5A 2V1XA 4A5MA 4XLPF 1BI3A 1XMAA 3FM3A 2E7XA 5LGNA 1D8KA 3VEPA 2M5WA 2K5FA 2RDPA 3MFKA 1Z1DA 4WF2A 1UHMA 1T0FA 3TO7A 3F6VA 5LGTA 2D45A 2XAGA 2L4MA 1Z6RA 3GFMA 4HQEA 1DP7P 1SD7A 1QGPA 5LBQA 3JTHA 2DAOA 1IXSB 5DD4A 3J80K 3ECHA 3K2ZA 2GA2A 5FD6A 3FWEA
chains in the Genus database with same CATH superfamily
1F1BB 5FLXZ 1WGSA 2J5OA 1K9MR 1FIAA 4V19K 1ACMB 2E60A 3FXOA 1XS9A 1QVFP 3SB2A 5GANe 3TP0A 2P6SA 3GMEA 4OMPA 4LUDA 1VQ9A 1H88C 2XAUA 1ZHIA 2YRCA 1FOKA 2KRFA 5LJ3e 1R00A 1YCYA 2OCCH 2VN2A 1A35A 5CVRA 4XRMA 3F8NA 1M3CA 3X26B 1IG7A 2K6DA 1H9TA 2EZKA 3CCMT 1EH8A 3REOA 2BY3A 3Q0VA 1M1KR 2KNBB 2B86A 4U0WA 2BY1A 4F7UF 2ISZA 4L5GA 1F36A 3HUGB 4EJWA 2EIMH 4N4GA 2E4HA 3L1AA 2XHCA 1K4US 2JSPA 2I8DA 4WK8F 1YWPA 4ZC3A 2BY0A 4P9UA 4IQJA 1CSKA 4C8QC 3I56T 1R0BG 3E1SA 2M16A 5EF6A 5M3FJ 1ENHA 1VQ8I 2L3RA 1HJDA 3HOTA 1CGPA 3BCBA 3J81Z 1SMTA 3LA2A 2O4XB 3OR1C 1TUGB 1VQOA 4LK0F 1U5TC 5FROA 1W0UA 1QVUA 3F21A 1YG2A 2EA4A 2JSCA 3DKXA 5EDNA 3HB9A 4C8QB 4UVBA 3H1CA 3O8HA 2ADUA 1MBGA 5JVGF 3JCMW 2ESNA 3DU6A 1S72I 2BVMA 2JWTA 3S3OA 3GF5A 3TU4K 5DTDA 3HTRA 1Y1WJ 1U5TB 1TW3A 1LFBA 3AG4H 2E1OA 3S1QJ 1M2VB 2P4TA 3CBOA 2F5FA 4A4GA 2DU9A 3DEUA 2EZIA 5DM6F 2OTLI 1S72Q 3E7LA 2L3PA 2XIGA 4PJOG 5GJVB 1PDNC 5F0CA 1PCXA 1MV3A 4DEYA 4UC4A 5GAOq 3CC2A 2L7FP 5CQGA 2FD5A 2VE9A 1JQQA 1QZYA 1AWXA 2XK0A 2V6CA 2AQEA 1MDMA 2CZ1B 2OTLQ 4LDUA 5EGOA 1TNTA 1SSHA 4XTZA 3VS6A 4BJ5C 5M9OA 2CKKA 3ME9A 2DJQA 1T0FC 1LDKB 4JX6A 1VQ7A 4KJZA 4Q47A 4CYCA 2P0PA 2FOWA 2W0ZA 4ORZA 1PRLC 3HTUA 3FKJA 3GOXA 3FJ5A 5F1JA 4P5NA 3CCJQ 5F04A 1LDDA 1YJNT 3CDLA 3S2DJ 2L3DA 2WSCE 4JLGA 1ZSZC 2DKGA 3BLYA 1T98A 3VV0A 2KMUA 3DV8A 2IA2A 3E6CC 1GV5A 1OISA 2DK8A 4IRGA 3K2AA 4MHGA 5KK1A 3WTVC 3KYLA 3ZN1A 2GLOA 4RTVA 3SEZA 1SAXA 2DL5A 2W24A 2M3AA 3EG0A 2YUQA 1BL0A 1WHUA 2D1HA 5IN1A 3JRIA 5TJJA 2MI6A 3BR1A 3GP8A 4XONA 2FRYA 4E7ZA 3KYCB 4ENKA 3ULRB 3OYKA 2DZ9A 2F4IA 2YUPA 4JDSA 2K4BA 3CLQA 1KYZA 1C0MA 2DILA 3U9GA 1K9MU 3DP7A 2MK5A 1YJ9Q 3C2GA 4MFDA 2DTOA 1RZ4A 2O2OA 1U6GA 1IZ1A 2IG0A 1WGXA 5GANd 2Y0SN 4FE4A 1VYVA 2XG8D 5IT9K 4J9BA 2LLKA 4MMLA 1AT1B 3UT1A 1EA3A 4C92E 1KG1A 4PK4A 1LKXA 1S9HA 1X58A 1W5TA 2CO5A 2XB0X 2ZNYA 3FBIB 3MVPA 4G94A 5K5OA 1U3EM 2HL5C 1VQKA 3VOEA 1ZYRF 3MHXA 4OP0A 1OU8A 3M0SA 2DYIA 5KYUA 2J05A 4KMUX 4CSWA 3S15J 2FBIA 1Z0XA 1Y71A 4J9HA 4E6KG 2BIVA 1M1KU 3MKYB 2A3LA 4XRSG 1M30A 1YIOA 2KT8A 1T33A 1MGQA 1K73C 1TTYA 3QO3A 3SFMA 3VKIA 2LYCA 3LQRA 4IHYA 2JUCA 5ILUA 1M1FA 4V2FA 3DPUA 1VZ0A 2L02A 2GOXB 4LB6B 4BEHA 3G6ET 3OYNA 1JT0A 3JB9H 4PJMA 3GTKJ 1Q86U 1KHCA 1VQLT 2CW7A 1WJ5A 2Z3YA 4JX5A 2EQKA 2M30A 2GQQA 4XLAA 2QQAA 5B1BH 1WLPB 4LIUA 4B3XA 1LNXA 2QM3A 2KT0A 2XPUA 1X6OA 2O88A 2VIXA 3B02A 2CREA 3N97A 3L2ZA 4FW2A 4LDXA 2IA0A 1OPKA 2CYYA 1IDZA 4A5NA 1MBHA 1BU1A 1YHQQ 2RA2A 1X1CA 3G1OA 1PSFA 1CQTA 2EQIA 2ZNZA 5FWCA 2IVWA 1W7PA 3RCOA 2BUDA 1PNJA 3UR3C 3RJPA 3BG6A 2CZ7B 3X28B 1R77A 1V5EA 2K3FA 4C0DB 1I27A 2V1UA 4E6RA 1VQPQ 2K4JA 2VWFA 1N8RR 2L9RA 1Y8QB 1AD5A 1BOAA 2BXZA 4M3FA 1ZREA 1Y0UA 3S6WA 4DGWB 1X6BA 4CC2A 1V29B 4RCCA 2NVTJ 2MC4A 1VIFA 1WJEA 5A0DA 1GHCA 1VQOT 5AYFA 3CCQA 5EZGA 3TP3A 1FT9A 3ERED 3A2KA 2CS7A 4MZTA 1HSJA 1QRYA 2L7ZA 1JGGA 3DLLA 1OPCA 2ZPFB 2D9TA 4CICA 5IT3A 3HFOA 3IUOA 3TKYA 4ZDOA 2QUFA 3F22A 2VXZA 4X9DA 4M74A 2NNYA 2R92J 1ETOA 1I6XA 3CCLT 2QCOA 1GFDA 2KEAA 4DOVA 1R5ID 3A01A 1ONVA 1YTYA 3FISA 3DLMA 4UV8A 3J81E 2EINH 4BAYA 5E20A 2DA7A 1TL8A 1NPPA 4LMYA 3LSRA 2KK4A 4IURA 4BI4A 2EYYA 2O0YA 2XSJC 3CDHA 4GGGA 4ZN1A 5IP6A 1OI1A 4JS4A 1IN5A 4DJAA 3CCUQ 1TT0A 1MDMB 3DXJF 2YUOA 4Z8AA 3GTOJ 3V8JA 3ULQB 2L3QA 5EGOB 4L59A 4AMCA 1BA5A 2EVRA 4N9IA 4NDLA 2WY7Q 3F8CA 5D4SA 4NL2A 1B1BA 4FM4B 4CYCB 1GRIA 2O6GE 3CC7I 3JAMK 1J2XA 1R5HA 4P96A 5EC7A 5LJ5d 1MH4A 3RESA 4RTYA 1Y0MA 1U9OA 4D0PA 1HK9A 4PUSA 2BGCA 2DA4A 2VBXA 2NVUB 3GZ6A 4WXCA 4B4CA 1IJWC 2PNIA 3CC7Q 4F52A 2NNNA 4AIDA 1USTA 1W70A 4D8KA 5E3MA 1UELB 2KE9A 3PFSA 1R4MB 4CUGA 2NXNB 2IVMA 4AIHA 2XROA 1RIOH 3LSIA 4QQDA 4EMHA 4UB6C 4RCBA 5GAEJ 1MMNA 4LUEA 5FKMA 1J9IA 4UUTA 2KZGA 2G6FX 2LC2A 1VQ4T 3V8LA 4PJOD 1BKBA 1VYTA 4L18B 3ZQHA 2R5ZA 1QZEA 2VJ4A 1TUCA 4GXOA 3LSJA 3NFCA 3QDFA 5LL6S 1KQSA 3QBYA 4RAGA 4IIOA 5ICCA 2W84A 2ZFWA 3HSBA 2R0QC 4BDYA 1R49A 2DA9A 1TNSA 5GMKj 1PP8F 3BFMA 1UCRA 3PUBA 3IWZA 4O5VA 2LDMA 4KDPA 3CCVQ 5KYUB 1LEAA 1X01A 2KDSA 3M0UA 3JCMQ 1Q82R 4QW2A 1EKEA 3Q1JA 5DM7R 1DU6A 4CC3A 1I6HJ 2PMZA 2KJCA 2F6CA 4HV5A 3RQ4A 1J59A 3LSTA 3S2HJ 2DF6A 3H92A 3WTYC 3JV3A 4BEHB 2RC4A 4BXFA 4CZZA 1OV3A 2CGPA 4DW6A 2F1LA 2LFBA 5CKFA 3KXTA 3MKLA 1N8RU 1Z3XA 3P9IA 1P7JA 4X6AJ 2FXAA 2VBYA 3FRNA 2HVRA 1T0JA 1QWFA 5GAMh 4I76A 2DFHA 4UUVA 1Z7LA 2DYBA 3X25B 5EEAA 2V7FA 4KH1B 3JCMb 1RAEB 1AEYA 3U1KA 2VE8A 3D0SA 3HPGA 4QPQA 2ZPEB 1AOYA 3NMZC 4KUDK 5LJ3f 1K0SA 4G7HF 2DBKA 4E4HA 5K7FA 1OULA 3NARA 1WQ7A 1YW7A 4NHJA 3I64A 3W2WA 2HPMA 3K0LA 1W7PB 2E1CA 1WHGA 2FZCB 2XMFA 3CBMA 4PNOA 4PJNA 2WWYA 1IC8A 1YJ9A 1SANA 1VI0A 4HPQA 2P5LC 3AL0C 5FWBA 3K4KA 3BR5A 3THKA 2QSHX 1M90C 5KCHA 1XD7A 1ZN2A 3WU1B 2RN8A 2Y0MA 1M27C 1SHGA 1K9AA 4JYKA 2QTVA 3META 5HCKA 5DUKA 4CGZA 3AFHA 3SJMA 2XIDA 1IZ6A 1B9MA 1Y8RB 2X6OA 2BZ8A 3V7CA 4G12A 1D1BA 1KU3A 2P0WA 5EZHA 4HNTA 3AL0B 1CKAA 1OEBA 1E2XA 2M9UA 4XMYA 4NQWA 3QKJA 4QVDA 3CCST 2X85A 2FEZA 1SD5A 2EK5A 1ZKGA 1I50J 2FVUA 4IOAF 3A01B 1SVMA 5DLOA 2JM8A 3MP6A 4OOIA 5GMKe 1PUFA 2HQNA 4FQGA 4Q4ZF 2V1DA 4ABZA 1ZGAA 4GY5A 4C5GA 2QA4A 2OD5A 3TW6A 3MN2A 3W6KB 5FLMJ 5HOOA 2Y48A 2F4MB 2KIUA 2Z16A 3R6SA 4CC7A 1BJZA 2BW3B 4QSHA 3IC7A 4LITA 3GFIA 1HW2A 2FHDA 4AFUC 1KU2A 1QPMA 4HQMA 4EJVA 3CMAI 1UB4A 3VS0A 3FBNB 3VSKA 4EM1A 1O3RA 2MABA 2CH0A 1YHQA 3MAJA 4CA0A 1FYLA 1EF4A 4A54A 4I02A 5D5VB 2OI3A 1KC8C 3CMAQ 2FPEA 5GANj 4OMNA 2AXTC 1ODDA 1E7OA 2DXCA 2MIOA 2Y90A 3VS4A 1MMAA 2EKOA 2YRDA 1JTXA 4HXJA 3TBIA 2O7OA 1UGSB 1WHJA 3DKWA 3E6BA 3VFZA 1PD1A 4ZYGA 3A1YA 1VQPA 1GCQA 2R7UA 2NUTA 5KCOA 2HQRA 1RAIB 4B9XA 1RNLA 1YS7A 4RGRA 2VUMJ 3VS7A 3VYHB 4PFOA 1K9MC 3HL2A 3CCMQ 3QYBA 3IRRA 2JZ2A 2G7UA 1S7EA 2V6EA 2NUPA 4HF0A 1D0ZA 2L89A 4A4KA 4L0ZB 4JPBW 1BBYA 1D8JA 2R5YA 1B34A 3I5RA 4FT2A 4C92F 4OMZA 3CD6I 1OCTC 3Q5FA 2R5ZB 2K86A 4JZ4A 2M45A 4IO9F 1IF1A 4ZTJA 2DT5A 1F4KA 3I56Q 4G7OF 4OGCA 3H8ZA 1M1KC 3LLRA 1R0CB 2HZDA 4IEJA 2X6WA 5KAFC 1GXPA 3SHFA 3OW2P 4ESRA 3LA3A 1Z7UA 4DBQA 1ZA2B 3ZEHA 4IVNA 4J19A 3H41A 3ZQGA 1WX6A 1B9NA 2DA2A 4BE0A 4PJLA 4YIIA 4C92G 1MNDA 2YPRA 1U78A 3CCUA 4S05A 3JRAA 3G1LA 2HVSA 3EH1A 3BQZA 5FRNA 2DOAA 4XKWA 2CDTA 4Q48A 4J6WA 2BHZA 3K4LA 3HOZJ 4HVVA 1WH5A 4ME7A 3RUXA 5FLXE 1NHAA 5F1RA 1TWAJ 1NE8A 2ZPIB 3RDVA 4XLHA 4BKXA 1R1TA 2K2VA 2E35A 2ZO4A 1WPKA 3FHNA 3DPTA 1IGNA 3GYHX 5J1UA 2LT4A 2RQRA 4LXCA 4X34A 3CCJT 2E5ZA 2DERA 1N9SA 3GIBA 1FOYA 1GXIE 1WJAA 3RPUA 5AT1B 1FJLA 1IW7F 2OV7A 3VYRB 2IPQX 4MTDA 1TQPA 3X20B 3EG3A 2EQMA 2LVSA 4M77E 2VC0A 4RBOA 2JN0A 4ZN3A 2VT3A 2A61A 4A3JJ 1AU7A 4IHWA 3M4OJ 2HDWA 2J7IA 2K2MA 5B5EC 2XKPA 2E1NA 1NYFA 3HKZN 4L5EA 4L9JA 2VOOA 2OAUA 3FLGA 3L7WA 4EMKA 4M78E 1QVGP 1RLQC 1HKQA 4UNOA 5B66C 1XB4A 2RQWA 3J7AY 4XL9A 1Q7YR 1KD1R 3M07A 2VXDA 3OY9A 1YJNQ 3EGXA 2NVYJ 3GZ5A 3VUZA 1SD4A 3W6JB 3HIFA 1Y39A 1A36A 4KNYA 1HD3A 1IXCA 1QCFA 4II2A 3WTZA 1HYOA 2ESHA 3E5XA 1SSFA 4BY7J 3S16J 3EG2A 3NPFA 2LBFA 3WHCA 3H9GA 5HS7A 2CUJA 3EHQA 3M0PA 3G2BA 2ME0A 2X3WD 3BY6A 7AT1B 2MOXA 5KCMA 4BH9A 3ZRGA 1SRLA 3H0DA 3CCVA 4DNCA 2CQ7A 3NTKA 1JE8A 1KC8U 5LJ5j 4NQWB 3QAHA 2LF7A 4UVAA 4JJCA 2GGRA 1NJIR 2LY9A 2XVCA 1SF9A 1WJRA 2KQWA 5E1WA 2LCCA 3PQKA 1RI0A 2RMOA 1G8XA 2OTJQ 1I1JA 3M1EA 4XK4A 1W1FA 3K10A 1PUFB 2DEQA 2QA4T 4KUMA 2ZZDA 1Z05A 3CCJA 4M7AG 3LWHA 1ORKA 1AZGB 1VOMA 2OQGA 4I7HA 5CR2A 1K4SA 1JHHA 2YUSA 3DEEA 2K7AA 4JJDA 4OIRF 2DO3A 3S8PA 3G6EI 2LSOA 4JP0A 1NK3P 3S1MJ 5FU7C 1CKBA 3HM5A 3PMTA 1DGWY 4F91B 3F3XA 1JKOC 1RAAB 2R5MA 3HGYA 4BY6C 3GTGJ 2K02A 1GCQC 2D0QB 2GXBA 2XGEA 5E18F 5F0FA 5LD2C 3GPLA 3TEEA 2LTPA 4OINF 3H5RA 1VQ9I 1ZLMA 2KRSA 3MWMA 3F23A 1Y1VJ 4MO7A 2VXEA 1JBMA 4HX4A 2XDPA 4E7LA 1VQLQ 2K9LA 5B1AH 1MD0A 2GBQA 3CQTA 4ZGDB 4HNVA 4BY6B 4B44A 3VWBA 3A98A 3CQZJ 5FKLA 4F04B 2NUTB 1PHTA 3TQNA 3SDGA 4IF4A 4RGUA 3R6OA 1I5LA 2P0QA 5FB2A 1DQUA 2JJ9A 4CRIA 3H9QA 2M7BA 1QCOA 2EFPA 2IGNA 2WAQA 2NUPB 1LUJB 4DZPA 3H0HA 3QOPA 3CUQA 2X4WA 1B34B 4TV7A 3DBLB 2NYXA 3ZCOA 2R5YB 2V1QA 2BOLA 2FF4A 3BJAA 4B47A 5HNFA 4A3EJ 1G4DA 2CJJA 1UG1A 1YLFA 2GFAA 4Y92A 3MZ8A 2R7XA 1UJYA 2HEQA 1KQ1A 3VS5A 3JCMe 3OB9A 1VQOI 4PSXA 1OJLA 1PP7U 1FMVA 4KISA 2FZKB 2CSQA 5HK0A 3IL2A 2KMTA 3E97A 1LDJA 2PBIA 3WGIA 4F14A 4DOWA 5GP9A 1YE9A 4K2EA 4RA2A 2PI0A 3RYRA 3S3NA 1LB2A 1A5JA 1XJWB 2KRMA 2D6FA 2W10A 2Y75A 4ZDPA 3LSMA 1VQOQ 1U3OA 3C2BA 5LJ5e 2CV0A 3DKYA 4RB1A 2E34A 2J6OA 1NBEB 2KSSA 3JCMd 1XTDA 1N8RC 4FIBA 3T0YA 2P81A 3QU6A 4GLKA 1OFCX 4KA4A 1Q7YU 1Y57A 3CCLQ 3X2QH 3CC2I 1RAHB 2F4OB 2CS3A 1UGRB 4G6DA 1QCNA 2M0CA 1HLVA 4JUVA 4JLIA 3CCET 4M75G 2KROA 3D7SB 4D8DA 3KP2A 1JO8A 1DU0A 4HDUA 4FYVB 1U8BA 4EMKC 4RG2A 3FZVA 2DW4A 2OC6A 3V4GA 4AWXB 5HLTA 1R6RA 1VQ7I 3K69A 2BZXA 1W2BS 4ETSA 1XDSA 4CDGA 4GFBA 3I35A 3MJXA 3M55A 2Q1ZB 3GFLA 3JRCA 3CCMA 4AYBA 2W82A 3MMYB 1MJAA 3DLAA 3PIPA 2FU4A 4FETA 4EMKB 1TH7A 1V5GA 3M9QA 4LG0A 5GAN6 5M3MJ 3IQLA 4XBFA 4PJOA 3NWSA 2PUKB 4D7MA 3LW5E 2OZ6A 3TL4X 4C92D 2GOMA 4QVCA 4KN7X 3RI4A 2JQ7A 4AFZC 5GAOl 3I56A 3CMAT 2EQRA 1UJ8A 4HV6A 1J0RA 2LBFB 4XSXF 1IRFA 2MGQA 4B09A 3CO6C 1JXMA 4RTTA 4MNUA 1PD0A 1UG2A 4BUPA 3PO2J 3GCMA 4XM3A 2PU9B 1S1NA 4ON0A 3KEOA 1VQ4Q 4A2UA 1D5YA 4A6DA 1X3UA 2W4SA 2K4YA 4XQFA 3W6VA 2BZTA 2KRNA 1VQKI 4QWQA 2FUG2 1QU3A 2DT7B 3NQOA 1RACB 3HP9A 1PUEE 3ZXSA 4NBQA 3WTTC 2LNHB 2COBA 4X1VA 5KYYA 2H6BA 2K9GA 1BW6A 3K4MA 4LIVA 5L3GA 2ZAEA 1KFZA 3EFSA 1KQ0A 2Q2EA 1LPLA 1GT0C 3P5JA 4NC6A 4KYWA 3HOWJ 3O5ZA 4HVUA 4R55A 1R5GA 2ID3A 1UG0A 2E71A 1FMWA 2L01A 3VODA 1O7FA 2IRFG 1WFWA 4F93B 2RF0A 3OYJA 4F55A 4BB7A 1W1WE 3M4GA 2EPDA 1ZAOA 1YJNA 3WGGA 4V2SA 2X9DA 2HDCA 4XTYA 3BG9A 1ZGWA 3CUQC 1UTIA 3UPUA 2R7DA 2CP6A 3BY7A 1W5CC 2EYXA 2RHXA 3VS1A 1Q81R 3KIOA 3QUIA 3JTGA 4XRSA 1IREB 1NYGA 5LGUA 3PNTA 2W7NA 2K9MA 1S3JA 3OL4A 3URGA 1RKTA 2BE7D 5LJ5g 4KGXB 5FW9A 3CUQB 2A7YA 3SYTA 3TEDA 2PVOB 2R58A 1JRIA 3CESA 4LLLA 1J09A 5E3NA 3N4MA 3TGNA 3WU0A 2FEIA 2K57A 3M54A 4HSRA 2YUNA 4GBQA 3GLLA 4JRIA 1O7LA 4A53A 2DFFA 1IV6A 2M0MA 3CUOA 3BR6A 3F8MA 1LEBA 3OYFA 2K3BA 3BE3A 1DPRA 1RUWA 3CCQI 4S04A 5A2QK 4M3DA 3CCRQ 2DMUA 3G71A 1R1VA 4PFZA 1GLNA 4LGWA 3S2WA 3JRZA 1XPXA 2DDBA 1XOVA 2L4AA 2GBYA 3IV5A 3WG7H 3EG9A 1GBRA 3JRFA 2EQUA 2RGVA 1H3HA 5DEQA 1OX8A 2AHJB 1MJBA 3CCSQ 1OCZH 2RNJA 2W57A 2X4XA 1ON1A 2A69F 2LREA 2DEUA 2XRNA 1D0XA 5GAN7 1XQHA 1R36A 2IGOA 4IPAA 2PVGB 3A1PA 3WHBA 2VB6A 2JW4A 4M77F 1W4MA 3PL8A 3E5UA 1ZR4A 4RMNA 3KEYA 1DUXC 1VQLA 1JUPA 2X6YA 5L3BA 2VQHA 4IRIA 2EV5A 1KJWA 2XKOA 3LYIA 4CC4B 2EJFA 3DTIA 3O6BB 4MEXF 2DNUA 2HR3A 1GCPA 2YDLA 1VF9A 4D1QA 4M78F 3M8EA 2R7ZJ 4PJOC 4IX7A 1R9TJ 1ETQA 3ZQLA 2LG4A 2KGTA 3FXLA 4OMFB 1ABQA 2KJBA 2CT4A 1C0WA 3J7AF 4M77G 1Y96A 1XGNA 1U2WA 1T2KA 4LG0B 2KLOA 3SWNA 1IGUA 4B9WA 4PJOB 3SEQA 4A3CJ 1YFNA 2MPXC 2P5VA 3BG7A 1UMQA 5ILSA 5IP9J 2QSGX 4I6ZA 3DBHB 2EB7A 5D5UB 4DIQA 3MKZA 1OYWA 4II1A 5HLIA 1FP2A 2QSFX 3MKDA 1T95A 4RKUE 2CW0F 3RQIA 2H1KA 2CUFA 3CJTB 5GPCA 3AKZA 4H0EA 1KU7A 1BK2A 4XK8E 3PTAA 1QP2A 4DBRA 4F7UG 2FPFA 3ABKH 3OMYA 2E2HJ 3PO3J 2LJ0A 4IUVA 4M75D 4RG8A 5D6XA 4ZGJB 1M90U 2LP0A 2VJ5A 4G9YA 4PJ0C 4A0XA 1X3ZB 1WRJA 4RAYA 1HW1A 3CCLA 2F5KA 3VPRA 2Q0OA 1WJCA 2VQLA 1YIJT 3TOBA 1OOTA 2DETA 3LWFA 1I4K1 3AG3H 5ICEA 1BW5A 5KYYB 1SAUA 1UGQB 1XX5A 2VI6A 5GAN4 2RI5A 2IT0A 2DXUA 1T8IA 3DB4A 2Q2EB 3UWNA 2JVHA 1LFUP 3ZQFA 2HCKA 3QDRB 1VFCA 5FKOA 4J9GA 3JCMV 5GAOr 4LE9A 2RQTA 3CPWA 3CCJI 4RS8A 5BNGA 4ZTFA 3IP4B 5IP7J 1AHDP 2Y4XA 3CPWS 1UGVA 5DV5A 2LJ1A 2I5UA 3HHTB 3ZMSA 1HBXG 4XORA 1BR2A 4JJNK 4XOTA 1WH7A 1KU9A 5IXBA 4RAZA 3OYEA 1FBQA 4CYDA 5BOXA 4OB1B 3MEAA 2ROLA 2E2JJ 2AO9A 2YR2A 3E5QA 5CKTA 2HU9A 2ZKZA 3SDBA 2CGHA 4OB2B 2IS1A 3I53A 4C8QF 2IAIA 2FJ1A 4CZCA 1EZZB 5CKEA 3U1DA 5JLXA 3LAPA 2BVLA 4FX0A 4M7DC 2FO0A 4XIDA 3A8OB 4HYEA 2ZB9A 1YS6A 1SD6A 2NS8A 2GA1A 1YJ9I 1T0HA 1V3FA 3QP6A 2F2XA 1VQ4A 3OMGA 2Z33A 1ZUYA 2Z2SB 4PGHA 4RGXA 3G4SA 2GCXA 5DYMA 4XU0A 2A0FB 3I71A 2ZCFB 4Y7NJ 4HKEA 2CSOA 3QHSA 1W36D 3IKTA 2MA3A 3PJRA 4XR6A 1C6VX 3PGGA 2MC3A 4M7DB 3OOUA 2ZCWA 1FYKA 1E3PA 5K7HA 3GEZA 2VBWA 4J6YA 2IA1A 3BCAA 1PM3A 3I0TA 3BC8A 3M5AA 3G71T 1M4ZA 2OJ2A 5H6QA 4HCKA 1WQ2A 2IGKA 4G8XA 1Q7YC 2ACJA 3DTEA 4Y17A 1IHVA 3CC4T 3EG9B 2JMAA 2PFBA 4KT0E 1S7AA 4HF1A 1QKXA 4IL6C 2EJ9A 5KYWA 4UV9A 2CT3A 2FL7A 3FXMA 5LJ3g 3OA6A 3K1NA 4ZJZA 5I22A 2NVXJ 2QA4I 5LJ5f 3OW2S 2DL4A 1D3YA 4C0FA 2FYKA 2CV2A 1FC3A 4A3FJ 2LVMA 5ICFA 5LEKA 2QXFA 2XD0A 3GTMJ 3EAEA 2QGUA 1BI1A 1XC5A 2JT4A 1WHKA 1RKWA 4HVWA 3CLOA 3BPVA 4A3IJ 2QA4Q 2C0IA 1OX9A 3ZOBA 5FU6C 3ZBDA 5CVIA 1KQSP 1YHQI 2ENMA 2QVOA 1XGMA 3SWNC 2CQQA 5KH6A 3WODF 3RPQA 4M3GA 2L8DA 2K9QA 2L0AA 2LY1A 4C0DC 4JRKA 1R58A 3NEUA 5J6XA 2LZ6B 2RPNA 5BMZA 2LQKA 2LRDA 2KXDA 1X3WB 1D09B 2KRCA 1Y96B 2PMHA 1VQPI 3K4BA 2A28A 1FTZA 5FU6B 1RAGB 3SWNB 3BQYA 3K9TA 3KZZA 4UY8I 1PC0A 2FRWA 3HG9A 2WV1A 2K7LA 3FEOA 2LMDA 2OCEA 1M5Q1 3QWXX 4XTWA 2F5CA 5IT9E 4MQ9F 5M5YJ 2JT1A 1T3SA 1G3TA 2HPIA 3ECOA 5E8IA 2ABLA 2QQ9A 2P0KA 1KGSA 1RUOA 2CP3A 3PMIA 2DBBA 2VLAA 3CCRA 1O3QA 5GMKl 3RNJA 4GYIA 1OZ2A 2QQSA 5GAGJ 3LL7A 2XU8A 1ZGJA 5FKKA 1TOVA 3MPUB 1UE9A 2BE5F 3SZPA 3WTWC 4ZZLA 2QG9B 3PE0A 3FC3A 3M0TA 3CCSA 4KN4X 1JJ6C 1OLTA 4UB8C 3JREA 1M2OA 1KA8A 1DDNA 2X1DA 3E9FA 3INZA 5FGMA 1P4AA 3FM5A 3M58A 2AHQA 4ZYEA 2F5TX 1JKQC 4A6EA 2KDOA 3OS2A 3CCUI 2BEOA 1STZA 4NS5A 1TZLA 2KPMA 4M77D 1IRXA 4M6YA 5GTIC 3H0GJ 5K5RA 1N5ZA 3M56A 4BY1J 3MP8A 4I0AA 1BCOA 2F5VA 4OAZA 2O8XA 4M9ZA 3HRTA 2IP2A 4M78D 2Y9YA 2JA2A 3CCEI 2ZBKA 4XU2A 4A4EA 3CJNA 2EGCA 4CCNA 3G1MA 5F0HA 3UF4A 2JRTA 2RB6A 2IGMA 3E0JB 4JJBA 1WJBA 3CXCA 1KQ9A 1FY7A 3KEQA 4C8QE 3ER0A 3CXCS 1I1GA 2P6TA 3CCEQ 2BE9B 4C92A 1VNDA 2HBWA 3ZMZA 2F5EA 1I07A 2HL3A 1L0OC 1MBFA 2Z1DA 5HS9A 2L0KA 5CLSA 5FRMA 3PVQA 2DODA 3H5AA 3DB3A 5IHKA 4A4HA 3BTLA 1OQYA 1X2MA 1DPUA 4LNPA 2NOGA 2RJCA 2QGFB 1SEUA 3SHWA 1N6AA 2CRGA 4AVPA 3I4PA 3REBB 2MAMA 4KGVB 4A69C 1GXQA 3OYMA 1MMDA 3QRFF 2CSIA 2EBIA 3CMYA 2E12A 2RHYA 4KUIA 3G4ST 1YI2T 3BJOA 5CIUA 2C06A 4HT9A 3K1MA 2VQGA 3CCVI 4Y33A 4LDVA 3J7YJ 1ETKA 4EQQA 4ZGEB 4NOYA 2VKVA 2PQWA 3UA6A 3BR3A 2JTMA 2H8WA 2M4KA 2O3FA 3QPHA 2MW8A 2RJDA 1MW7A 3MEUA 3NRVA 3R60A 2HOTA 2HXOA 1IRZA 1APLC 1W6XA 3GWZA 2YXYA 5KYWB 5DCFA 2CU7A 2D1VA 1HCRA 1T3LA 2QTXA 4XSZF 2FBKA 4Y91A 1LE8A 3PIOA 3QZ5B 2ZJ2A 4LN2A 3K4CA 3LFUA 1TLHB 2P7VB 3LA7A 1MMSA 2X4YA 3P7NA 3GVAA 4YRVA 2JOYA 1QVTA 2V26A 1HDPA 1IDYA 3WG9A 2OAZA 1ZH5A 2YRVA 2YX7A 4KBMB 3JCMg 2QDLA 5GAMd 3F6OA 2W85A 3GUDA 2DOEA 4DYQA 4ESFA 2MBFA 5ILVA 2KXCA 2HQEA 1ZG3A 3QOEA 1IB8A 2M1HA 4C8QD 3PNYA 5AIQA 5DS9A 1BC7C 2ELJA 2COWA 2QGGA 3UATA 1VA7A 4FT4A 2ZMEA 3OIPA 1M1GA 1MSEC 2QYOA 3IH2A 4XKBA 2DL8A 3M7GA 2VC1A 5DY9A 3A8MB 5EJCA 1X2QA 5KYXA 1E6HA 4M7AA 5HNHA 2QWWA 3SXYA 2H09A 1WVRA 2QBYA 4XKVA 1JUSA 1VQ5T 1PYVA 3JSPA 5GPAA 3K7AJ 1I81A 1K6YA 1ZTRA 2XDDA 2HNIA 1R23A 4IHTA 2D8JA 3FXKA 4N4NB 1ZR2A 4A3BJ 2CV1A 2O9SA 4L6V5 3WVEB 3ISPA 4U7DA 3CCRT 1JJ2S 1LFPA 3C94A 3FB9A 5GAN3 2DFEA 5K1YA 1DGRM 1G83A 2KQRA 3LQQA 4FX4A 2Y9ZA 2E6NA 2J06A 3UDCA 4RTWA 3GZNB 3BROA 3ZQQA 4OIOF 1LJOA 3H9JA 4IZZA 2NAZA 2L9NA 3DTKA 3L2RA 1Q81C 5IPAA 2SRCA 2HYGD 3A8GB 1VQNQ 3AG2H 4N4IA 4HX7A 3FK6A 3HTSB 2EWNA 2JRMA 1FYNA 1I3AA 2HOEA 3QPSA 1UEBA 3CP8A 4MEYF 2HTJA 4HSTA 5HVQC 3A8HB 4A4FA 4HCCA 1H3ZA 3CMET 2K27A 2EILH 2YWWA 2PQ8A 4LJZF 1PKSA 3RSNA 3KZIC 2ZFUA 3EGUA 4ASNA 2HEOA 4TVRA 4WCIA 3OYAA 1S7OA 4LD9K 2G9WA 4G6QA 1ACIA 1U0JA 2NRAC 2V9VA 2EAYA 1X43A 3QIIA 3QXEB 1YITA 3CMMA 2FNAA 1SFUA 3LGLA 1JHFA 2KHMA 4HF2A 1WXUA 2X1CA 1B59A 4FT8A 3W3CA 4YFKF 4HLYA 3UA7A 1PJRA 3WE2A 2K3PA 3CF2A 4FCYA 2XGCA 1U06A 2GTOA 4BQQA 4AVZA 4OU0A 3OS0A 4E7KA 3L9FA 4ZDLA 4A3GJ 1YCSB 1JGSA 4YTLA 3JCMP 4OGEA 3O3KA 4C92B 4IKFA 2HXIA 2ICWG 3AG1H 3CCMI 1QQJA 2GWRA 2QKMB 3K4NA 4ITVA 5FLVA 4A0YA 2DRMA 2XDBA 2XF7A 2HD0A 5A0LA 2JM9A 4YIFA 1LVKA 1ETWA 3KP4A 4XLFA 2JUFA 4ESJA 1FOXA 3BDDA 2BKDN 3P8DA 2FPDA 2MG4A 2EV0A 3L2CA 3KP6A 3CO7C 1OCCH 1Q82U 2CG4A 1RETA 2NS7A 2L9VA 3I56I 2KDZA 3BDLA 4M75A 5GMKi 1K61A 4XTVA 2VPRA 1ETYA 2DMPA 3EUHA 1AHJB 1OPLA 3E3VA 5H2FC 3QYFA 3HBLA 3QYEA 5FLXK 1O75A 2H3EB 4J9CA 2JJ7A 1PSEA 2OX7A 4B8XA 2KR3A 3F8FA 5JR3A 4QLCU 2Y30A 3ELKA 3V8KA 2YU9J 2M87A 3LX7A 1I5ZA 4JOMA 1WFXA 3OYYA 3B73A 5CQXA 1F1ZA 2XPWA 5HS8A 1KQ2A 1G3WA 2L2PA 3FX3A 4NC8A 4D5FA 4Z6YA 3P8HA 2JZYA 3FMSA 1HDDC 2G3RA 2VXFA 1J5YA 3C95A 2CZ0B 1D0YA 1X19A 5IH2A 1K83J 4MZPA 4BI8B 4IRHA 1X6GA 1YP5A 1VQ8T 1FIPA 4L9NA 2OU2A 2ZJPF 1LE8B 3JW4A 4I09A 4XLCA 1KHIA 4IIMA 2RQVA 4RTXA 2BTTA 1WSUA 1HQCA 2Z5UA 1YIJQ 5J8CA 1FOWA 1X4PA 3Q9VA 3J7AO 2RNAA 3CCEA 2DFIA 3O8GA 2LX7A 2V4JC 1OCPA 2DTIA 2JMCA 2ZMEC 1BCMA 2PTKA 3J81K 1W5SA 3PT9A 3TQ7P 3M59A 5C4JJ 2VODA 2L5QA 2ATCB 4U88A 3HPWA 4M7AC 2O9VA 3OV8A 5JLWA 5I21A 1FBUA 1YJNI 1TP4A 2YX4A 1P4XA 2XV4S 1S29A 2EFNA 2ZMEB 4M3EA 3QZ9B 2XAQA 5KYXB 4M7AB 2DVJA 4OF1A 2G7HA 2LQ8A 1I5OB 2QBYB 3N05A 4D5CA 1HSQA 3LSKA 5IAYA 3WE3A 3VU3C 4WX9A 1Q1HA 3IAS2 4HZFA 2RQQA 3ZGKA 5CQYA 2JPBA 2A07F 1O57A 4FYYB 1UZCA 3S3MA 1I39A 1SPKA 2O9LA 3M57A 3BZCA 5IT9Z 3ABUA 3WTXC 4GCVA 1MBKA 1UGPB 4I99C 5EG2A 1V4RA 4ZYHA 3JCMf 3R0JA 2E65A 1GVJA 4RB2C 3LGFA 4HLXA 2L7MP 4B43A 5CCAA 2X0LA 1WWXA 5J40A 1OQKA 4VUBA 2NOJB 2XPVA 2OQRA 3RMQA 1ON2A 3G71I 1X69A 4I98B 2H94A 1WXBA 3JCMX 4P1WA 1K79A 4CCMA 3CC4I 3EH2A 2R5AA 5LHIA 3ABLH 1ZG1A 1SFOJ 4KULA 2HAXA 1A0NB 3E19A 1H8KA 4ANJA 2AZSA 1WJQA 3KYDB 2GF7A 4BE2A 4OMOA 2GXAA 4RTUA 1I8FA 3G71Q 3HJEA 3FDYA 3HPHA 4BHCA 3OW2A 4MDXA 1WJFA 3CC4Q 3EFRA 3GBGA 1YITT 2I2LA 4WCGA 4M6VA 1WDXA 2RK1A 2RD1A 3TREA 3DQVC 3SQNA 3H3VK 3GTQJ 2JNGA 3SEMA 1T08B 1H8AC 1VQLI 2DO7A 3CF5F 1QVPA 4PL6A 5DCMA 1YW9A 1ARKA 1BM9A 3U2RA 1ZRCA 2JA8J 3HOVJ 2HYJA 3LSHA 3K70D 4J00A 4AG1C 2LCLA 2GXGA 4PJOE 3SZGA 1W0TA 4GRIA 4QKUA 2K3YA 3V7SA 1HKSA 1B4AA 2ZC2A 2AS5F 2RI2A 2HBPA 2LD5A 4M75C 6AT1B 4A3KJ 3RZDJ 1WKMA 3RDIA 1VQ6Q 3MQ0A 3HOYJ 2DI3A 2HFHA 3D1NI 1TSFA 3I5SA 5KE2A 1EFNA 2DLLA 2DA6A 2EIJH 1HA8A 1I3QJ 4IQ4A 2D1XA 1TQIA 1K78A 3CCYA 1POGA 2ZXHA 2RI3A 2RH2A 2A6EF 4M75B 3KZYA 1EJ9A 1VQNA 3HRSA 1ETVA 3HXLA 5J8FA 2F2VA 2ZGWA 3C2HA 4XRFA 3TO6A 3VYSB 4JRQA 4AD9A 2K9NA 4OMQA 1FMKA 2COZA 1EX4A 4CI0C 3PQJA 4U0YA 1KZHA 5GAMj 3FXUA 2O03A 2COYA 2EYZA 2BZYA 2PUOB 2GFUA 3U23A 2C0TA 1IO6A 2PN6A 2EIKH 5J47A 2E41A 2JTFA 3CCLI 2RHZA 2RNGA 2DA1A 5J4YA 1ABOA 1M9SA 2DK3A 3H3UA 2MLKA 3WU2C 4K11A 2CUZA 3HSRA 1S5LC 2R7TA 2J6FA 3MZHA 1WJSA 3UNGC 4N4OB 2DIQA 1VQMA 3HGGA 1J7KA 4BBRJ 5GANg 3OS1A 1UDLA 5L3FA 4PFPA 1JJ8C 2PEXA 2MD0A 4RM3A 2ECBA 2FBHA 4MFEA 2Z99A 3ROUA 3JAMZ 4PZJA 4YIRX 2DL7A 3VB2A 4J6XA 3CTAA 3OYCA 1WHHA 4F7UA 5H20A 3TO9A 4BNCA 1YJWT 2CWEA 1W2BA 3JSCA 3LH5A 3I54A 1YWOA 4C3IJ 3HFNA 3VRZA 5DUIA 1ZA1B 3GX4X 1IUYA 2WAQN 3A8LB 1ZHFA 4LDYA 4HRIA 2V8JA 3BZ6A 2VBZA 4LLNA 4BJTA 1QVGS 4ENJA 1SG5A 1W36C 1ULYA 4MGRA 2IJLA 2HOAA 1P92A 5IOZA 1DP3A 4PLLA 3OSFA 3B6CA 4BQOA 1Y07A 4A63B 4EPCA 1NJIU 2F2WA 2KIFA 3BDUA 2JXBA 3OYLA 1UFMA 2IBDA 5D8LB 3RIRA 1JXOA 1SFXA 2XGXA 3Q9SA 1RL2A 3DF8A 2LRQA 3EG1A 4O3MA 3EGXB 2FRHA 1SMYF 3KBGA 2GZWA 3DU5A 2R93J 2B7EA 3O8VA 5IY5H 2DOFA 1WYXA 1NLPC 4ZNXA 3SZTA 4RMOA 4F7ZA 3ESWB 3ZP5A 3H0IA 4QVZA 3T5XA 5E17F 2WTEA 1REPC 4M7DE 1MNEA 3HRUA 4NC7A 4BYYA 1VQ4I 2O61A 1E3HA 2EV6A 1R4NB 3MEXA 4M6XA 4P9FA 4RGSA 3A02A 3G4SI 1RUNA 1XGSA 3ZMVA 5JVTA 4EGYA 3S1RJ 4AUXA 1P7IA 5C6SA 1BI0A 3VYUB 2RV8A 2CFOA 2CZ6B 2C6YA 1S6LA 1X1PA 4J01A 2DK5A 4Y4RA 4OVAA 3G4SQ 2E6ZA 5KE3A 1YI2Q 2HYFA 5GAMe 3BP8A 1YIJA 2EFOA 2EZLA 3GXOA 2CUDA 2K5LA 3RZOJ 2DMQA 2ECCA 1T39A 2VJJA 3S14J 1YNZA 3QG1A 1YQAA 2XUBA 4KITB 4Y52J 4F92B 3L2UA 1M8MA 3X24B 2WB1N 1ZLJA 2DRKA 3OYBA 1VTNC 4N4HA 2A6TA 2OZUA 4XNFA 5FO5A 2L9SA 4AYBN 3ASNH 1TG0A 5BQTA 3FXJA 3G3ZA 4XLEA 1E0EA 5D8KB 1V55H 3GTJJ 2QQRA 1YBYA 2BHYA 3A03A 2QEXA 3BG5A 1T56A 4ENMA 1ZG5A 5DCMB 3TSWA 4L5IA 2H1LA 4AIJA 3BW1A 3F0CA 3QYHB 4BD3A 4ATOA 5KAIC 4IHVA 1FP1D 3BTIA 2DTRA 2P5KA 2IS6A 3MO8A 2DYRH 1Q82C 2KRHA 3VS3A 1RABB 3G73A 1RR8C 2GIZA 1TWGJ 3QWLA 3MKWB 3F9KA 1SFEA 1LJ9A 2WY8Q 1IXDA 2BYVE 1B8IA 2DTZA 3IHUA 2CW8A 4P55A 3RKYA 5C44J 4E7HA 1G59A 2WC2A 2QYZA 5H6RA 1UHWA 2LKXA 1K78B 1VQ5I 4KIBA 1SVLA 1RLPC 5FD5A 5D6FA 3CZ6A 5ERIA 2VVKA 3KP7A 4J9EA 2JA6J 2OUMA 4KIFA 2MD5A 4FW1A 4ESBA 5ECAA 3CCRI 2UXNA 2LKPA 1IN8A 3QPLA 2LK2A 4JK1X 3CPWP 2H8RA 2D8HA 1VQ5Q 1KONA 2AQFA 2P8TA 3BOQA 3FXQA 3C0CA 3H35A 3HHGA 2VKNA 2AZVA 5LLQA 2IS4A 1C1AA 4IUTA 3HOUJ 2DFUA 4PLIA 1JJ2A 2PZ1A 3CCSI 1N25A 3OBWA 4E70A 2L2OA 4QQ6A 2N8GA 2MCNA 2AT1B 4J9FA 3CC4A 3M3YJ 3ABTA 4N9HA 3HC7A 2QDYB 3DWLE 4DYCA 5D5WB 3C3WA 3LSPA 3CMEI 4D7NA 1Q95G 2JS2A 2OTJA 2NVQJ 2ELHA 2ME6A 1BC8C 4E2FB 1ZSZA 2E5KA 4M9SA 2UXXA 3BWGA 1EV7A 5B3SH 1AOJA 1UUEA 4HX8A 2KYMA 4LK1F 1VQMT 2I0NA 1G2HA 3W2VA 1VUBA 4DYRA 1MKMA 1WXTA 1BN5A 3V7RA 3ZR8X 1NG2A 3CMEQ 5TRDA 3RTRA 2STWA 4F7UB 3OMCA 3TCJA 1OU9A 4J7FA 1VQ6A 1NLOC 4HOBA 4XTUA 3NWTA 5DM7F 3LFKA 4EEFG 1K4TA 3ASKA 4OB0B 1OKRA 1KC8R 5CAIA 3KLNA 3QQAA 5GAN8 2HQHA 2DDAA 1FTTA 5J1RA 5D7UA 3LWIA 1FLIA 5J1YA 3DCFA 1E17A 2CUEA 5J4VA 1PRMC 2P4RA 4FYXB 3VUBA 4DBHA 2KKOA 2TCTA 4IUPA 2DXBA 2HQXA 5GANf 2JPCA 4KICA 4KMFA 5A2QE 4M78G 1FEXA 2NLUA 2WAEA 5GAMg 2CFXA 1H0MA 2GQVA 1OR7A 5F64A 1BOBA 3WTSC 3AAFA 3OS5A 3FDRA 4R56A 2HDDA 2ID6A 3J80E 3MEVA 1BI2A 2QENA 1W4SA 3MD2A 2ZJRF 3FHZA 2MLGA 2M2EA 5KYNA 3L09A 5KVRA 1IN4A 1YOVB 4RLFA 5LRRA 1JKRC 5GMKh 2LH9A 4HBLA 1PWTA 2H6CA 4BI3A 3JB9I 4EMSA 1WZ2A 2QZ8A 2A36A 2JTVA 4A3MJ 1QWEA 2YLBA 1CF7A 1B7TA 3F70A 4FL6A 2HKOA 1RRJA 5GJWB 2UUZA 3CJQB 1H9GA 1G3SA 2VL8A 3HYIA 2RQPA 3EETA 4A0ZA 3LNQA 1XMKA 1Q81U 3E2UA 1TT5B 4E7JA 1AWJA 5L3CA 4M3BA 1QMCA 2B9SA 1Q86R 2HI3A 2K79A 1BR1A 1MGTA 3DKMA 3CD6T 3AHUA 2RAEA 4RDUA 4JQFA 3PIPF 4EGZA 3H9NA 1LQ1A 5D4RA 4EVIA 2OAWA 3OIQA 3ZQCA 4Y28E 3RYPA 2ROTA 4DZJA 4HEA2 4RTZA 4PJOF 1TWHJ 3VS2A 2KIQA 5GAOn 3J7ZI 4B6MA 1VQ8Q 4UVCA 5GAN2 2VONA 1FBSA 9ANTA 2QEXT 2HZTA 5IYCJ 3NGPA 2XF5A 1QO0D 5K5QA 1GL5A 3QJYA 3WTUC 2KI7A 2CQXA 1KIKA 4AT1B 4FSSA 2PJPA 5E1ZB 4LFUA 2JUGA 2XSDC 4KFCA 2E36A 3Q3SA 4LD6A 1FX7A 1SVOA 3O2PE 2LF8A 1K8AR 4Y3OA 3A0BC 1B8IB 2Y0SA 4U0VA 2HKXA 1F5TA 4MDWA 2RKHA 3BTCA 3CEYA 1IGQA 4QQGA 2Z0WA 1H89C 8AT1B 2M7AA 5J3BA 3TVTA 2XF6A 3P9CA 1M8VA 3TSZA 3IRQA 2J5PA 2FZGB 4QIWN 4M72A 2A5YB 1TC3C 1YI2A 4F17A 1Y56A 3JRHA 5HDKA 5J3LA 5D6WA 3FKIJ 1YN8A 5IYBJ 1K7AA 2VPLA 2H27A 2MF2A 4FYWB 4C8QG 3TDUC 3RPUD 2KT1A 2R7QA 1LPQA 2M0OA 3ZQ7A 3CXCP 2ECZA 2VKDA 4H4KC 2OA4A 1K6OA 2DYSH 2WSFE 4F3QA 2CUBA 1P6RA 1XCBA 2VKHA 3I58A 3OSGA 4OMYA 4WTOB 2R7VA 2DJZA 3MCZA 1YFHA 1QA6A 4BJ6C 1JUMA 2EA2A 2MH2A 1G6NA 3EYYA 1XG1A 3RKWA 3ONQA 1U1SA 5GAHJ 3KETA 1ZSZB 2XKOC 1R22A 4C3HJ 2UWMA 1QVFA 2KFDA 4A12A 3I55A 1QVFS 3GW2A 5L3EA 2DE0X 2DXTA 2K3XA 2K5IA 5GANh 3T8RA 1YITI 5GAN5 9ATCB 3SFIA 3D5LA 2XB5A 3P9KA 3OQ5A 2I10A 2OF7A 4RB0A 4AIKA 1NJIC 2DA5A 4B1RA 4C5IA 1VQ6T 2PX9A 4KT5C 3U21A 1WPYA 4BHPA 1FSHA 2ZPGB 1YITQ 3RR6A 1ZBXA 1SC7A 4NB5A 4EJUA 2CP5A 2A08A 1N27A 1Z21A 1QPIA 1I1SA 1OR7C 1Z6TA 1YRNA 4MMKA 1HSTA 3DEWA 1WHLA 2P84A 4R0KA 3KX2A 4O6JA 4M7DF 5EEHA 3R4KA 2XDVA 1P2FA 4CCJA 3BTJA 2VASA 3GO5A 1MV0B 3BZKA 1FNNA 1ZBJA 1VQ5A 3ZMDA 4HT8A 2V9PA 2GIVA 3I59A 3R0AA 5AONA 2STTA 2CP7A 1E6GA 1BB9A 5LFAA 4EMGA 1AVZC 4FE7A 2QKLB 1R8OB 1XSXA 1FXXA 3FXRA 1VQ9T 4R8HA 4GDFA 2D5VA 1EH6A 4M7DG 1K1ZA 5HK3A 2HTSA 3GLXA 2E2IJ 4P5OA 1JB0E 1WA7A 4EDUA 3D5RC 4CHUA 3OWTA 4L5JA 2W1OA 2LDUA 2M9HA 1N75A 2X4HA 4AC0A 1SEMA 2GTJA 1IAWA 1AA7A 2V1RA 4Z02A 3RBBB 2NYSA 4JZ3A 1CF7B 3TOAA 3HZJA 2JVVA 2RJEA 4R79A 3VYGA 3FIWA 2DQLA 3L42A 1MNMC 3QWYA 3CMEA 5HLHA 4JRPA 5IHNA 4FHTA 2ED1A 1G5VA 3QYGB 3OIOA 4XKCA 5LHHA 1GBQA 2RO0A 3C12A 3UKGA 2WAFA 1JXSA 5GAMf 1K8AU 2WBMA 4B48A 3OYDA 3I5UA 1FSEA 4OIPF 2HMAA 2NUZA 2X3XD 3CDIA 1V54H 2BY2A 2DTHA 2Z9OA 4Z2YA 1HC8A 1RAFB 1JJ2P 3ZPLA 1BR4A 2DCEA 3FK7A 4WXHA 4C2TA 3CPFA 2VQCA 2ZSHB 5A0GA 3W2AA 2CP2A 2HVQA 3EUKL 2RN7A 1YJWI 2V1NA 2XAFA 1IHWA 1LVAA 4AM3A 3EYIA 4EATA 3RMSA 3ZN0A 3F72A 2HDAA 3S1NJ 2A6HF 4AU7A 2GM4A 2AKLA 3H5NA 4L9TA 2BV6A 1X1DA 1V1CA 1V76A 4J8OA 4M7AE 4GYGA 2KZVA 2XC7A 1YJWQ 1UHFA 4XQ3A 3PUFA 2DQRA 1MH3A 4UHTA 1GUUA 3JCMJ 2F2EA 3CC2T 1O3SA 2BW3A 1Z77A 1X1BA 1AKHA 3HDDA 2CP0A 4BQAA 4HA8A 5CJ9A 1UJ0A 5K7ZA 5EG0A 4ENNA 2E64A 2KAFA 1VQ7T 2GNCA 3JR9A 1QHHD 5LJ5h 5LRSA 4LB5A 1XGOA 3IKVA 3BT9A 4U7BA 2DX1A 4IUQA 2R3SA 4ZYAA 3M1CA 4XICA 1MSFC 3KPHA 5JHUA 3COAC 2LCSA 3DFGA 3PFYA 1TUDA 2RVCA 1U5SA 1QZZA 4MZMA 5EEGA 4Z89A 3G6EA 4ZYDA 2EFIA 2LMJA 4S0HB 3PSFA 1IXRC 2QF7A 4BU2A 4CH7A 4R1HA 4YFXF 2J6KA 1Z67A 3K70C 2E3HA 4XTXA 2R7OA 2EBPA 2MFZA 1YW8A 2JN6A 3CP2A 2FNPA 1UHSA 2A3SA 4D9JA 4L0YB 3JAME 1VQ8A 2KBTA 1NTCA 2CMPA 3I3LA 4MIMA 4E7IA 1PG5B 2LT1A 1PVEA 2LJ3A 3IH4A 2ELKA 2PJRA 3ZL7C 3M0QA 4QT7A 4X1EA 3I55T 3K1PA 4Y13A 2H3JA 4KRTA 3HSEA 1X4OA 2IEKA 1EIFA 1ZK8A 2DAQA 2DBMA 1QQIA 4KH0B 2LC4A 1KQSS 3WGHA 2EW3A 2ZJQF 5BPDA 1AZEA 2Y31A 1QKWA 5LJ3h 4U87A 2UZKA 1R7JA 1S72A 4BE1A 1HW5A 2NS0A 4J7IA 5CVVA 3HOXJ 3VJPA 1IN6A 3OBYA 1VQKT 4CCKA 3FJPA 1U8RA 2W00A 3SDZA 1VQNT 3L2VA 2EKHA 1LOJA 5J26A 8ATCB 2OTLA 5IYDJ 5E1XA 1A31A 2RREA 2X51A 2HQ5A 3M8FA 3BR0A 5F27A 1YRNB 4LD5A 4XN3A 5BPIA 2X4JA 2NWMA 1Z3YA 2A68F 1YX3A 4EJTA 1BYMA 1QNTA 4M75E 1ZUUA 5CVJA 4LOCA 2VC8A 5ICGA 3KFWX 4PGGA 4M9XA 5CQEA 2E3IA 2CH4W 1N78A 2FX0A 2W48A 4I2OA 3I59B 1UHCA 4HNUA 2M8GX 1HXDA 4OIQF 1XTAA 2LX9A 2X35A 1GFCA 3AT1B 3T8TA 1MMGA 1ZX6A 1J3TA 2JA7J 1D5VA 2RHIA 5KNLA 2FQ4A 5A2QZ 2ZPHB 4V2GA 1BIAA 2W25A 4FISA 4QPOA 3S32A 1VQNI 3N5BB 2ZSIB 5D6YA 4IOCF 4XU1A 1WCMJ 1O9SA 2XRLA 1ZLKA 2PMZN 1K0XA 3J80Z 4Z88A 3OSSC 3VDXA 1HOMA 1T38A 4A93J 1RI7A 4XU3A 2YSRA 5EYRA 5LEJA 1MZBA 3JSOA 2XAJA 1O3TA 3M4YA 5HLGA 2E1HA 4J9DA 4PKCC 1BIBA 1OYYA 1V5FA 2PLYA 4WWCA 4MTEA 2L54A 3QP5A 4M73A 3GFJA 2EFWA 2DL3A 2HSEB 3ML6A 4BHBA 2ZXIA 1TWCJ 5ED4A 1KYWA 2XHKA 2Y69H 1VQMI 1XNIA 2XAHA 1NEGA 3TW7A 3C4SA 4E47A 3KLOA 1B6AA 1D3BA 4IUUA 4C92C 3CCQT 2OPTA 1UFFA 2LOOA 4AFSC 4I01A 3OYHA 3ZQIA 1GV2A 2FMLA 1A04A 2IIMA 4RAFA 5FFZA 4UXNA 1VQMQ 3GTPJ 1A6QA 4LLGF 1G3YA 1UB9A 1O4XA 1NM7A 4BGDA 4EJOA 1WJDA 2D0NA 2GQIA 2KY9A 4M7DD 3I9V2 2H8HA 5GAOm 1U1TA 1TW2A 2EQJA 3H36A 3T9NA 4EIKA 4BQNA 1EH7A 4L9VA 2DPDA 2HOSA 2P7CB 2F69A 2HKQB 4C0GA 3DLLF 3C18A 4BACA 1USSA 2F5DA 2E5NA 5AIPA 3I9QA 2RHUA 1AKHB 5GADJ 1ZQ1A 3PM1A 3EDPA 5TISC 2AKKA 2FSWA 4Q5WA 2OTJT 3H6ZA 5EG0B 1IRGA 2C0OA 5C4XJ 4CCLA 4KGZB 2YU3A 5J39A 1X27A 5DDGA 3ERMA 3OYIA 4ELYC 2Y2ZA 4RM2A 3FF5A 4OWRB 2EIFA 3Q0WA 1XCVA 2FOKA 4CO8A 1MUZA 2A05A 1OYIA 1TU0B 2LNBA 4MLOA 2WACA 2QK0A 5L8RE 1Y0NA 2DMTA 1MJ9A 1WQWA 2DZCA 4NUBA 2VGMA 1IO2A 3OR2C 3E9GA 1TTHB 1LNWA 2M8EA 5F08A 4DQ2A 1WI7A 3PVLA 4LG3A 1YIJI 4HG2A 1S8NA 2PVDB 1ZELA 1QBJA 1RESA 5FJ8J 1HKTA 1L3LA 1SHFA 2HWVA 3BR2A 1M3AA 2PJRB 3HKZA 5LJ3d 1OCRH 2ZXJA 2PG4A 3EGDA 4C2UA 3PFIA 5D5XB 2K85A 2KVQG 5CKBA 3GBQA 4BL0B 2KIMA 5IOYA 4C5HA 2A37A 1KD1U 2CQKA 2X6XA 1NPRA 4M4ZA 1YJWA 2LQNA 4C0ZA 5FFXA 2JMWA 3CD6Q 2DN0A 2QEXI 1TS9A 3TMOA 1S72T 2QLZA 3R61A 1MBEA 3HHHA 3HSFA 2MYSA 2M0YA 4C5EA 2MSYA 2TDXA 1QHGA 1SFKA 2M1BA 1AWCA 3EPZA 1JEGA 3BPXA 3DPLC 3EFOA 2QQBA 2QEXQ 2OTLT 3ZFJA 2VYTA 3D5SC 1SRMA 1P4WA 1JU5C 1Q86C 4C30A 4OMLA 1X75C 3E6DA 4DBFA 3JB9F 1WIEA 4IHXA 1R1UA 5GAOp 3HEFA 2XASA 2LR8A 4J83A 1YO5C 4XLNF 5E8GA 2ETHA 3R6NA 3CC7A 3RERA 2B8AA 2QASA 1QW1A 3EQLF 2LTOA 4YG2F 2YLCA 2K9SA 1SKUB 5CVUA 4RUGA 2DJIA 1XMXA 1T6SA 3PIOF 3JB9G 2VKEA 5L3DA 2VT2A 2Y4YA 1W2BP 5L23A 2EFQA 1NZ9A 3M9AA 1ZQ3P 4HAMA 1PKTA 4M71A 1K8AC 2IPOB 2L3SA 3EHRA 2CQNA 2VGNA 4F16A 3OYGA 3LOCA 1DJ7B 1F9NA 2R7FA 3OSVA 1Q1VA 2ZXWH 4C3JJ 4EV0A 5JHFA 2JTEA 2K5CA 1WI3A 2QQ8A 5HKCA 2DD4A 2E19A 1OYXA 1Y6IA 2A5WA 1WZOA 1YJ9T 5KHDA 2TRTA 3H0FA 3KP3A 3GNGA 2KP6A 2OTJI 1BBZA 4WXDA 5DLQE 3REAB 4F7UE 4G7ZF 2LNVA 2EPFA 2K40A 3S17J 2EYQA 4X9CA 4W97A 1YX5A 3L2QA 2O31A 1D3BB 1K73R 3M8JA 4BXXJ 2E10A 2HQAA 5BS6A 2M34A 2M4GA 4M7AF 2COMA 2OJED 3OOPA 1ZRDA 1WI9A 1B3QA 3L1PA 2MWPA 1XSDA 3QU3A 3NAUA 4UUSA 3SD4A 2WSEE 3H3ZA 2E7WA 3TDZC 2KYBA 3KCCA 4JS5A 1VQ6I 4NNJA 2R7WA 2LP5A 1H641 1HF0A 3FIFA 1K76A 2ESWA 2EZHA 3KFVA 2E70A 1VYUA 4W1UA 4HCZA 3FMQA 2JA5J 2YS9A 2HZYA 3ZMTA 3VRYA 3EUHC 3ASOH 1ZUKA 4EM2A 4FU6A 1I0CA 2AIRB 4X0GA 4IJAA 3K6GA 2PMUA 3KP5A 2M02A 2XI9A 1M1EB 1ZRFA 3HOSA 4PSWA 2AXLA 1ETXA 2HNHA 3L00A 1YHQT 2CYZB 3P8BB 4GLMA 3G6EQ 1RR7A 2V79A 5LHGA 2RK2A 2DD5A 4N0AA 2O5RA 2DPUA 3MEWA 1NK2P 1B72A 3QSUA 5FU7B 1F43A 2WADA 1N77A 4JBAA 1B07A 3QODA 1VQPT 2LKSA 2V8IA 1VQ9Q 4M77A 4HCBA 5DD8A 4MQVA 3RKXA 4ZH4F 2HKNA 3L2WA 2V9KA 4IXAA 3MP1A 2AK5A 1D1AA 5IXFA 1IUFA 3A4CA 2IW5A 3ABMH 3K4JA 3Q0UA 4CXFA 2IS2A 1Z9CA 4XN0A 1M3BA 2X9HA 4M78A 1LCKA 2E1MC 4CCOA 3A5ZB 1P9QC 3C1DA 2FMYA 3KE2A 3M53A 4KIGA 4HW0A 1W7PD 3SFZA 5F6FA 1RADB 2DVEA 4DEXA 1TQMA 1MIJA 3EGDB 3JRDA 1E3OC 1XSVA 4YELA 2UV1A 4Y15A 5HDNA 4A3LJ 2JS0A 2RQUA 2WV0A 2B0LA 1NG6A 1OCOH 2E1MB 5CYVA 2O01E 4I0BA 2O8KA 2M51A 5E3LA 2KL4A 2G0EA 3DBRB 3BJ6A 4M75F 4PDKA 5JI6A 4KT6A 3HRMA 4LDWA 1ITYA 5I2SA 1QVGA 1D1CA 3E6MA 1KSWA 5D6EA 3CCUT 2MH9A 3JCMh 1YYVA 1ERDA 3EFOB 1OZ3A 1TBXA 2EJGA 3IH3A 4Q5SF 1JI8A 2YSQA 1NG7A 5CKHA 6PAXA 2R7RA 2BBYA 5HODA 3PNWC 4HDVA 1H92A 4BS9A 2DLPA 1RI9A 3CMAA 1OMIA 4G6TB 5HDGA 1R71A 2X1EA 4FTHA 1G2BA 3ZMUA 2P4WA 3F8BA 3IWFA 2D2WA 2RM4A 1MHNA 1Z91A 4BDZA 2HGCA 2EJRA 2VUBA 3T1BA 2VV5A 2V8KA 2EYWA 2R57A 4XAXB 3CC2Q 3CC7T 1A6IA 3G1JA 3JRGA 1K73U 4BXUA 4AFQC 2WB1A 3FMRA 2GAUA 2FE3A 4ZZDA 1YI2I 3A0HC 1KQ8A 1JT6A 3GF2A 2VOPA 2DIGA 2LQWA 2ISYA 2YHTA 2L7KA 1JKPC 2MWOA 1GVDA 1RPWA 3MZYA 2IXSA 4N0BA 4ELZC 5I2MA 3LAJA 4NL3A 1VQ7Q 2OBPA 1FZPB 2KISA 1KK7A 2RJFA 3KUFA 2F48A 4GO1A 1AWWA 4EM0B 3HUGA 2DA3A 5TGTA 1ZARA 3OL3A 5CPRB 2Q8KA 4RB3C 3I4NJ 1NEBA 4OB3B 1FPQA 5C3EJ 4IHSA 2EGAA 3G7ZA 2HSPA 2HS5A 3IAM2 5GTHC 3S93A 2ZPBB 3CD6A 3GTLJ 3PNVA 5M5WJ 2O4XA 2EGEA 2XGDA 3I55I 4RLQA 1BJAA 1Z9QA 3QPTA 3CCVT 1J75A 1X2NA 3I4MJ 1FYMA 4OMMA 1IN7A 1UECA 1XN7A 4XOPA 1GDTA 1X1AA 4C8QA 4UUSB 5HY6A 1FWZA 3EUAA 2EH3A 5JFRA 3I55Q 2FQ3A 1WHMA 1XDUA 4PCQA 2DPPB 3LMMA 1U5TA 1M2VA 4B3AA 1TWBA 3LH0A 4DA4A 3C7JA 1U9NA 3JB9D 1JTYA 4YFNF 3LSGA 2FA5A 2V1XA 1IV8A 2R4GA 4J5YA 4A5MA 1MBJA 4XLPF 5GMKm 1VQKQ 4BUGA 1BI3A 3NTHA 2LY2A 1XMAA 4DOZA 3WVDB 4AG2C 4N0AC 3FM3A 2DJNA 5IHIA 2E7XA 5LGNA 5M5XJ 3HKSA 1D8KA 3NHNA 5LJ3j 5CKDA 1ZSGA 1M90R 3VEPA 4M77C 5CO7A 5I11A 2M5WA 1KD1C 2K5FA 2MMPA 2JK3A 4YEJA 4BBSJ 2R7SA 4FSXA 2RDPA 1N9RA 2QI2A 3JCMc 3MFKA 1B72B 4M78C 1Z1DA 4WF2A 1UHMA 1T0FA 2DXIA 3TO7A 3JRBA 3F6VA 5E79C 2ED0A 2YT6A 2FG0A 5E3OA 4M77B 2JVGA 5LGTA 2D45A 1X2KA 1TWFJ 3JCUC 3CJRB 2XAGA 1Z9ZA 2L4MA 1VIEA 4C9YA 3NTIA 1Z6RA 3GFMA 2B63J 4HQEA 3PSIA 1DP7P 1RC9A 2X48A 3MCAB 3QJ6A 1SD7A 2QAZA 4M78B 1QGPA 2DMOA 5LBQA 5CK9A 2VJIA 2DAOA 3JTHA 5C0MA 1AWOA 2DMNA 4JX4A 4M7AD 2BXYA 1WNLA 4J9IA 3BG3A 5FKNA 2FB7A 1QLYA 3WXMB 4M7DA 3GNFB 1IXSB 5DD4A 3HL8A 4FASD 4QTRA 4E7SA 3V42A 3J80K 1QP3A 3CCQQ 3VSLA 2SEMA 3CBPA 3B6AA 4PJJA 2E5QA 1NH3A 3RKQA 4II3A 3ECHA 1TXQA 4OAYA 4A3DJ 2DM1A 2DT6A 4D6WA 3VYTB 3JB9J 3K2ZA 1UAAA 2WA0A 2CH4A 3M0RA 2GA2A 5FD6A 2XICA 3FWEA 1Y7XA 4C2MJ
chains in the Genus database with same CATH topology
5FLXZ 1WGSA 2J5OA 3SB2A 2P6SA 1VQ9A 1ZHIA 1FOKA 2KRFA 5LJ3e 1R00A 1YCYA 2VN2A 5CVRA 3F8NA 3X26B 1H9TA 3CCMT 1EH8A 3REOA 4U0WA 4F7UF 2ISZA 4L5GA 4EJWA 4N4GA 3L1AA 2XHCA 4WK8F 4P9UA 3I56T 4C8QC 3E1SA 2M16A 2L3RA 3HOTA 1CGPA 3J81Z 1SMTA 3LA2A 2O4XB 1VQOA 4LK0F 1U5TC 5FROA 3F21A 1YG2A 2EA4A 2JSCA 4C8QB 4UVBA 2ADUA 3JCMW 2ESNA 3S3OA 3GF5A 3TU4K 1U5TB 1TW3A 2P4TA 3CBOA 4A4GA 2F5FA 2DU9A 3DEUA