5CVIA

Structure of the manganese regulator slor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
PNKEDYLKIIYELSERDEKISNKQIAEKMSVSAPAVSEMVKKLLLEDLVLKDKQAGYLLTKKGQILASSLYRKHRLIEVFLMNHLNYTADEIHEEAEVLEHTVSDVFVERLDKFLNYPKVCPHGGTIPQHGQPLVERYRTTLKGVTEMGVYLLKRVQDNFQLLKYMEQHHLKIGDELRLLEYDAFAGAYTIEKDGEQLQVTSAVASQIYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SloR structure and DNA binding studies inform the SloR-SRE interaction in Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
molecule keywords SloR
total genus 60
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cviA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cviA02
2GQQA 2R3SA 5LEJA 3QRFF 1IN8A 2VODA 2MA3A 2ETHA 3KETA 3FMQA 5JFRA 1R22A 1ON1A 2K27A 3MZHA 3ECHA 5FFXA 5F6FA 3K1NA 4M9XA 4LG0A 3WU0A 1ZLJA 3E6MA 1XGNA 2XVCA 5CYVA 4EQQA 2E7WA 2FE3A 1UCRA 2H6BA 4XLPF 2GAUA 2Q0OA 2UXXA 1SMTA 4MTDA 3T0YA 1YFHA 3CO7C 1QBJA 2A3SA 2Q2EA 1OYWA 4KA4A 1SD7A 5L3EA 2PG4A 5D8LB 3GFJA 3ULQB 2QWWA 2ZMEA 5K5RA 4KT5C 4YIIA 4M74A 3CUOA 4BH9A 3E6BA 3L00A 3FMRA 4U7DA 2DK8A 1IRGA 3O3KA 1FBSA 3KP2A 4GXOA 1T0FA 1WRJA 4BHBA 2L01A 3IWFA 4WXHA 3KCCA 3ZMDA 1MKMA 2K02A 4ASNA 3IL2A 1R00A 5CJ9A 1IXRC 2XIGA 4FX4A 2PEXA 3F23A 1WQ2A 2LNBA 4GYIA 1XGSA 2GXBA 3V7RA 3T8RA 1IXSB 3R61A 2VBZA 2DW4A 2R7FA 3HRMA 1HQCA 2YPRA 1ODDA 1RUNA 4WK8F 3JTGA 1Z9CA 3L7WA 3JSOA 2JT1A 5TRDA 3U9GA 4BNCA 3NQOA 2FSWA 1QGPA 3QOPA 3ECOA 3IRRA 3CO6C 1OPCA 3Q9VA 4CGZA 4ESBA 5LGNA 2A61A 4K2EA 3VEPA 5E17F 3LFKA 4HYEA 4KIGA 4M9ZA 1LEAA 2F2EA 3WTSC 1BIAA 3GWZA 4ZYDA 1P4AA 3RKXA 1IN5A 1AOYA 1BIBA 2FRHA 3BJ6A 2K5FA 1TLHB 3P9KA 1MDMA 5DCMA 1FYKA 4UVCA 2ESHA 4NQWA 3TO6A 4PZJA 5E1ZB 5FD6A 4HF1A 4A6DA 5ICFA 2QVOA 4RB0A 1FWZA 3ZMVA 2JRTA 1PUEE 3ZPLA 4EV0A 3WGGA 4HW0A 3QPTA 1SD4A 1S3JA 2FMYA 3FF5A 2XGXA 1J9IA 3FM5A 2PBIA 3NRVA 4IRGA 3TO7A 4AIHA 2XHKA 2D1VA 4M9SA 4DQ2A 4UV8A 2HS5A 1BC7C 2W24A 1L3LA 1ZAOA 1EH6A 1FSEA 1O57A 4PDKA 3PFIA 1IRFA 1RIOH 1O3SA 2OAZA 3F8BA 4G6DA 3RPQA 1Z6TA 2VBWA 2PN6A 3KP3A 3M7GA 1Z1DA 4HV6A 5E18F 2F5DA 5ICEA 4N9IA 1FSHA 3O6BB 3HHHA 1A04A 2J5PA 2V1XA 1B9NA 3FWEA 1U78A 2QZ8A 1FBUA 4EJOA 4L0ZB 3HRUA 5FB2A 3CJNA 2STTA 1IN4A 3WTVC 1L0OC 4U0VA 4IHTA 2AXLA 2ACJA 2HTSA 1WI9A 1B9MA 3ABUA 1BJAA 5J8FA 3I59A 2NNYA 2RN7A 2HGCA 5CVJA 3IRQA 4KDPA 5LBQA 4ENMA 3BY6A 1R5GA 4G7ZF 3I53A 3KEQA 3TKYA 3WTYC 1FOKA 4LLLA 4EM2A 2CQKA 3DKWA 3PQKA 5D6FA 3R0JA 3E19A 1XDUA 5LHIA 5E1WA 3F8MA 4MHGA 1J59A 3KZZA 1R58A 1XB4A 2Z9OA 2V6CA 5EEGA 5ED4A 1FY7A 4L5IA 3IKTA 3ABTA 2FXAA 2OZUA 3DPLC 4RGUA 2MLKA 4CO8A 4KN4X 4CYDA 3I71A 1R1VA 2FA5A 1TQIA 3F21A 3MHXA 2EWNA 2L3DA 6PAXA 4ENNA 2XUBA 2MH9A 3MEXA 3GW2A 4ESJA 3RTRA 3Q5FA 1K78B 4LLGF 3N97A 3BZ6A 4EJVA 1LVAA 1BI3A 2LX9A 3C3WA 5HLGA 1FYMA 4GCVA 3DEUA 4R1HA 2HTJA 2A6HF 1FBQA 2CFXA 3H3ZA 2ISZA 2QYOA 4N9HA 5JVTA 2HR3A 5LGUA 4UUVA 4TV7A 4P9UA 1O3TA 1XSVA 3F8NA 1KQ8A 1TNTA 4L9NA 5JHUA 1KQ0A 5L3FA 4MQVA 3I59B 2M1BA 3DQVC 2Y75A 4LB5A 1XSDA 3BDDA 2PJPA 5E8IA 3VODA 3JSPA 1G4DA 4RAYA 2VN2A 2HQRA 3ZMTA 5KVRA 2DQRA 4A5NA 1WKMA 1KU2A 2H3JA 1S29A 2H09A 2CG4A 3F6VA 3HOSA 3WTTC 2IRFG 1USSA 5CVRA 4KFCA 1IZ1A 4UVAA 3DV8A 3KZYA 1VTNC 2EA4A 4PCQA 1P4WA 1J0RA 2KIFA 1BBYA 3W6KB 2L02A 1S8NA 3M9AA 3GZ5A 2OQGA 4A2UA 3EYIA 1KU9A 2ZCWA 1BOAA 4L9JA 5ILVA 2V79A 1HKSA 3D5LA 3B73A 4HA8A 3R0AA 1G3SA 3QU3A 2DPDA 1OYYA 2EK5A 2IW5A 3G73A 3D0SA 2Z5UA 1XMKA 3GFIA 4FHTA 3T8TA 5CVUA 3LQRA 3RKWA 2UZKA 2IA0A 2QQBA 4CHUA 1YG2A 1EH8A 5DCMB 1FLIA 5DYMA 2P5VA 3BOQA 1RI7A 3FX3A 2X0LA 3ISPA 4I98B 1LB2A 4MTEA 2CSOA 2ZNZA 2CGPA 3QPHA 4O3MA 3V7SA 1STZA 4A6EA 2WC2A 2LKPA 2VONA 3KP7A 1SFEA 1R1TA 5ICCA 4ZYEA 1Y0UA 4Q47A 4Q48A 3TQNA 3U1DA 2ELHA 2ZMEB 3E6DA 1U3EM 5LLQA 2OU2A 2F5FA 1ULYA 4ZYGA 4G7HF 5J6XA 5BOXA 4EJUA 3JTHA 4OINF 2Y48A 1XGMA 2ESNA 5FD5A 3B02A 3RDIA 2K4YA 4RAZA 2KJBA 5HS8A 3I4PA 3WGIA 3REOA 1R36A 2ADUA 1SFXA 3OV8A 4LLNA 3VFZA 3ZP5A 3C18A 3FXQA 1FYLA 2EV6A 1E17A 4Y17A 3F72A 4PGGA 4R8HA 3WTWC 5FO5A 4CDGA 4R79A 2RQPA 2M5WA 2P5KA 4FT8A 4EM0B 4AIKA 4JK1X 3I54A 1IXCA 4MEYF 1ZG5A 2D45A 5FGMA 4MGRA 1XDSA 1W5SA 3KP6A 5H6RA 4IRIA 2OQRA 3G3ZA 3EQLF 2VOPA 3ZN0A 2RC4A 2UWMA 2XROA 4LB6B 2ZO4A 2GWRA 5D5XB 3PQJA 3LSTA 2XAGA 2CYYA 3N4MA 3FXRA 3RKYA 2R7DA 4UXNA 5LGTA 5HVQC 1ON2A 3JAMZ 4KIBA 1R7JA 1WWXA 4HZFA 3JAMK 2CWEA 3RIRA 4QWQA 2NAZA 3MQ0A 1QVPA 2WWYA 2PMHA 5D5UB 4A0XA 2VT3A 4A0ZA 2ZBKA 5IT9K 2JPBA 1LJ9A 2YX7A 2XKOA 2IA1A 1YIOA 1XCBA 4XSZF 1GVJA 4Y15A 1MJAA 5CLSA 4U7BA 2OD5A 3J80Z 3J80K 4WF2A 1R5HA 3KFWX 1PDNC 4L18B 4MEXF 4N0BA 4LD5A 2JSCA 4Z2YA 1ZRFA 1MJBA 3V7CA 1D8JA 1HKTA 2GIVA 3MWMA 4XSXF 2MD5A 1F4KA 3J7AO 1QZYA 5IT3A 3LAJA 4LGWA 5HLHA 1ONVA 5F1RA 1KYZA 1G3WA 3CDHA 5LHGA 2W57A 2H27A 1ZH5A 1REPC 4MQ9F 1S7AA 5DDGA 1S6LA 2K86A 1Q1HA 1BN5A 2WTEA 1RZ4A 2Z33A 3WE2A 2A69F 2DBBA 3I64A 1U5TC 1UHWA 2K4JA 3GYHX 2VOOA 2EA2A 3IC7A 1W4MA 4HF0A 2XAJA 3EDPA 4L9TA 1XD7A 4U0WA 3WTUC 3QAHA 2M8EA 4IRHA 2ZNYA 3NEUA 4EJTA 1P92A 2QLZA 1QQIA 2OA4A 2QENA 2DK5A 4WXCA 5AIPA 1QPMA 2DO7A 4Y13A 2RKHA 2EFWA 5DD8A 3KEOA 2GZWA 2WV0A 4AWXB 1EV7A 1XGOA 3I0TA 3E6CC 4WX9A 3GZ6A 1K7AA 3RI4A 2VE9A 1O7FA 1B59A 1HBXG 4UHTA 3M8FA 1H9GA 2FF4A 2KIUA 1KU3A 1H9TA 3KLNA 1I27A 2KJCA 2P5LC 5A2QZ 3WGHA 1B4AA 5FFZA 3IWZA 1MZBA 4YFXF 4YIFA 4E70A 1FNNA 4KICA 3MCZA 2GA1A 2IPQX 4KMFA 5CVIA 4EM1A 4RGSA 1S7OA 2G9WA 5F64A 1GHCA 4IXAA 2K5LA 4JBAA 3L09A 3ROUA 1R23A 4Q4ZF 2P7CB 2P4WA 4WXDA 4S04A 2FNPA 3QP5A 5L3DA 2EFPA 1TW2A 1DUXC 1U8RA 3SQNA 5BMZA 2XAQA 4B09A 2G7UA 4I01A 1DPUA 5D5WB 2RVCA 2PMUA 3LWFA 1C0WA 1PP8F 3BPXA 2VC1A 5ILUA 3V8LA 2YR2A 1J7KA 3KLOA 1D5VA 2MC3A 2XASA 4UV9A 4QLCU 4XRFA 5LHHA 4ETSA 1FX7A 5BS6A 3H3UA 2HWVA 4HDVA 1I1SA 1U5TA 2CO5A 1X3UA 4RB1A 1DP7P 2HKOA 4M72A 3MFKA 3HRSA 4HX4A 1Z7UA 4CZZA 2L4MA 2DQLA 2DLLA 2COMA 1UHMA 1T98A 4JQFA 1BYMA 4P5OA 4HDUA 1CGPA 2FNAA 2MH2A 4LFUA 2XKPA 1UFMA 2E7XA 3E5QA 4AIJA 1NHAA 1YO5C 4ZZLA 2F5CA 4HQEA 1HW1A 1YLFA 1KU7A 2YX4A 3LAPA 4IVNA 4H0EA 4M71A 3GO5A 2M45A 4P96A 1G3YA 4M6YA 4Q5SF 1LEBA 2DTRA 1GXQA 2Q8KA 3Q9SA 3M8EA 1I1GA 3MAJA 4HX8A 1ZYRF 3F3XA 1ZRDA 2DI3A 4RS8A 1ZARA 5K1YA 4OOIA 3V4GA 3TO9A 2KKOA 4G7OF 4LG0B 3WODF 1YW9A 3HSEA 5HS7A 4BYYA 2XAHA 3R4KA 4BQAA 5LRSA 1BI2A 2EFQA 4A12A 1AWCA 4A0YA 2V1UA 3WU1B 1K78A 1T2KA 4AD9A 1YS7A 2P6TA 3BWGA 1I6XA 1KGSA 1MDMB 2L54A 1FT9A 1B1BA 1ZG1A 4KYWA 4I09A 4UVBA 3T1BA 1FC3A 5EEHA 3FHZA 4IPAA 4ENJA 3ZMZA 2MBFA 1F1ZA 4YFKF 2RNJA 3V8JA 5E20A 3WTXC 1BI1A 1TBXA 2XAFA 4O6JA 2RV8A 2DT5A 3W6JB 4OMZA 2XRNA 1D3YA 3E3VA 3RYPA 3MZYA 1QNTA 5ICGA 1YS6A 1IN6A 2K4BA 1O3QA 1JXSA 2TDXA 1MGTA 3FM3A 2IVMA 4KNYA 4IHSA 2LDUA 5DV5A 4ZZDA 2PFBA 3C1DA 1ZN2A 3LQQA 2K5IA 3DPTA 2NNNA 2QUFA 4S05A 2LSOA 5HLIA 2FBHA 1XSXA 4EGYA 1O3RA 3VB2A 1T6SA 5JR3A 3HOTA 3SZPA 1SD5A 4M6XA 4HAMA 3CUQC 3QU6A 2E1CA 2EFNA 1W5TA 2HQNA 3K1MA 4OIOF 1JGSA 4EJWA 1YYVA 2IT0A 1ZRCA 1V3FA 3K1PA 5DEQA 3HSFA 1JE8A 4ZYHA 1TNSA 1DDNA 2VXZA 2D2WA 1SD6A 3FXUA 3FMSA 4BHPA 4P9FA 4GO1A 1XMAA 2VT2A 4PGHA 1RUOA 4L5JA 2DU9A 5E1XA 3GFMA 1DPRA 2A6EF 3COAC 2GA2A 4OIPF 2EV5A 3BROA 4EMSA 4L9VA 4F7ZA 4ZH4F 3F8FA 3GXOA 4ENKA 2PLYA 4U0YA 4WWCA 2LF7A 2GCXA 2HDCA 4OIQF 2H94A 3FZVA 2BE5F 1ZG3A 3P9CA 3DP7A 1OR7A 4HV5A 1SAXA 4ESFA 1F9NA 2OBPA 2JTVA 1OMIA 4U88A 1LDDA 4G9YA 4ON0A 4GGGA 4XBFA 4D0PA 3TGNA 1HSTA 4CXFA 1F5TA 1G6NA 2RDPA 3BJOA 2PI0A 4I2OA 5BPIA 1O7LA 2C6YA 1HW5A 1ZGJA 1U5TB 4DNCA 2G7HA 4BHCA 2A5YB 4I02A 4OIRF 1T38A 2V1DA 1U6GA 1HW2A 1IN7A 5K5QA 5L3GA 2W84A 5FLXZ 2FEZA 4KIFA 1LDJA 2BGCA 5D6EA 2CW0F 3EYYA 1P2FA 4HF2A 2L4AA 3DXJF 1YTYA 4NHJA 3BP8A 1FPQA 2QM3A 5J8CA 1TTYA 2KRFA 4M73A 1P6RA 1XCVA 3TDUC 5HDKA 3R6SA 2F5EA 5ILSA 5D4RA 3V8KA 5L3CA 2A68F 2QBYA 4HQMA 3WTZA 4KN7X 4EVIA 2HOEA 2BEOA 5H6QA 1IAWA 1QO0D 3EUHA 4LJZF 1SMYF 3IHUA 1FZPB 2JZYA 1J5YA 2XV4S 2GXGA 3HHGA 2STWA 3ZN1A 2EV0A 5HDNA 2KIMA 4RB3C 1U2WA 1YW8A 3F6OA 4GYGA 2QBYB 4AVPA 4HOBA 1P4XA 2FMLA 4EGZA 2HZTA 4LMYA 3ERED 4YFNF 3KP4A 3DF8A 5LEKA 2H6CA 2IJLA 2W85A 1LDKB 2FBKA 1TW3A 5AONA 3TOBA 3GUDA 5DD4A 1T39A 1KA8A 2HKXA 3RJPA 3ELKA 4HLXA 3K69A 4IJAA 2FQ3A 2NYXA 1QZZA 2EFOA 4HBLA 5L3BA 2HYGD 3GEZA 2K7LA 3T5XA 4RGRA 3TOAA 5HOOA 3QP6A 1E2XA 3KE2A 3R60A 3ML6A 2J5OA 4I0AA 5K5OA 2E1NA 5BQTA 1RNLA 2HYFA 3HIFA 1EH7A 2VBYA 2UXNA 2VBXA 1JHFA 2W25A 2YU3A 5BPDA 5FLXK 2VE8A 1J75A 2B0LA 3K2ZA 2ZJ2A 2IP2A 2DFIA 1SFUA 3I58A 3WE3A 1W7PB 2BV6A 4KMUX 3JW4A 4CICA 4NB5A 1TQMA 1YQAA 2BBYA 1G3TA 1LNWA 3RPUA 3LA2A 5JI6A 3DFGA 2OZ6A 5H20A 2Z99A 1K6OA 3CUQB 3LA7A 1CF7B 2EB7A 2AS5F 1H0MA 1W7PA 3CTAA 3HSRA 2DPUA 2PQ8A 1OKRA 3K9TA 3E97A 2V9VA 3F8CA 3J81K 4RB2C 3S2WA 2MLGA 2Z3YA 5DUKA 3O2PE 4IF4A 2A07F 1LQ1A 1XN7A 3ZMUA 1FP1D 1HSJA 2IA2A 3CUQA 1CF7A 4UNOA 1IF1A 3EETA 3L9FA 4O5VA 3K0LA 3BPVA 5CVVA 3SHFA 5ERIA 3GFLA 1Z05A 2JPCA 2NS0A 2LF8A 2M87A 4L0YB 2O8XA 2D1HA 1BM9A 2HFHA 1GXPA 3ZQ7A 3HRTA 4KUMA 1MJ9A 4BAYA 4LK1F 3GX4X 4B8XA 3E5UA 1R1UA 2HEOA 2P7VB 1UB9A 2ZXJA 4HLYA 2QQAA 2Y0MA 1ZLKA 2O6GE 1IUYA 3P9IA 3TDZC 1KYWA 1W7PD 3H92A 4WCGA 4BXUA 2EJRA 2RGVA 1JHHA 4I7HA 5AIQA 1HKQA 2BYVE 4FX0A 1PP7U 3SXYA 1OYIA 1Z6RA 5D8KB 3HTUA 3M1EA 1FP2A 3SFZA 1ZREA 3RYRA 4XLNF 4P55A 5DUIA 1IW7F 2O3FA 4OMYA 4A5MA 3C7JA 3GLXA 2FU4A 4G8XA 3CLOA 4G6QA 3GF2A 3VOEA 2O0YA 5E8GA 4MNUA 1MD0A 2YSRA 1B6AA 3GVAA 5LRRA 4RGXA 1I5ZA 3LA3A 4HX7A 5HDGA 3IKVA 2FOKA 1J2XA 2QQ9A 3J81Z 5HS9A 2P8TA 3F22A 5TJJA 3OOPA 2P6SA 1KQ9A 2X4HA 3U2RA 2ZFWA 2VC0A 2DAOA 5D5VB 2ZKZA 5A2QK 2O61A 4I0BA 2M30A 3HTSB 3I5UA 3L2CA 3WG9A 3BJAA 1Z91A 3ZMSA 1BI0A 5D4SA 1QW1A 2ISYA 5DCFA 4G94A 4OU0A 1YW7A 3P7NA 1WSUA 4YG2F 1V4RA 2FBIA 1USTA 3HYIA 4LK0F 3KP5A 1ZHFA 1BC8C 1HXDA 1K79A 3SZTA 3HUGA 1D8KA 2O03A 3AAFA 5IT9Z 5KK1A 2NRAC 3E5XA 1ZGAA 1TQPA
chains in the Genus database with same CATH superfamily
3PIPF 2CQ7A 1VQPQ 2WAEA 2GQQA 5GAMh 2R3SA 3ONQA 5LEJA 1LPLA 2XB0X 2Y4YA 4L6V5 3QRFF 1IN8A 2DA7A 4XL9A 3PFSA 2K9MA 1PUFB 3TREA 4JUVA 2BY3A 1WYXA 2WAQA 2KDZA 3OYYA 4OMQA 2VODA 2KT0A 2MA3A 2PU9B 2R0QC 2M9UA 2K3FA 2ETHA 2CGHA 2L0KA 2LVSA 3FKIJ 5K7ZA 4JJDA 4CZCA 5J3BA 3KETA 3QJ6A 3FMQA 5JFRA 2X4XA 1S72I 3ZBDA 5GAN2 5KCOA 1R22A 2L2OA 1ON1A 9ANTA 2DJQA 2PZ1A 2K27A 2NOJB 2VL8A 4JX5A 3JRIA 3MZHA 1TWFJ 1MMDA 3ECHA 4W97A 1BA5A 4AFSC 2EPDA 5FFXA 4BI3A 4J9EA 2EYQA 3W2VA 3G4SA 2OJ2A 5F6FA 4PJ0C 3H0DA 3TSWA 4ZYAA 1OCPA 1OX8A 4XTVA 5DS9A 3M1CA 4M7AE 5KYWA 3K1NA 2P0KA 4M9XA 4LG0A 3PNWC 3H9JA 4RTZA 3WU0A 2CYZB 3WVDB 1T3SA 1ZLJA 3P8HA 2YLCA 4ZJZA 3BW1A 5FROA 4QTRA 4ESRA 3E6MA 1XGNA 4FT4A 3PNYA 2XVCA 5CYVA 5BNGA 4HVWA 2CUDA 4EQQA 1VI0A 1B3QA 2E7WA 2J06A 4I6ZA 2FE3A 1UCRA 2H6BA 2R7VA 3K2AA 3TMOA 4XLPF 3S3OA 5GANj 2M7BA 2DYRH 2GAUA 2Q0OA 2UXXA 1SMTA 2VJIA 3T0YA 5EG0A 2W48A 3BG6A 4MTDA 3CO7C 2A3SA 4HSRA 3S1RJ 1APLC 4IIOA 4CI0C 2Q2EA 4XTWA 1OYWA 3K4CA 1KQ2A 4KA4A 2QA4Q 1SD7A 2R5YB 3VYUB 3CC2I 2FHDA 3ME9A 5L3EA 1BCMA 2QI2A 4RM3A 1FTZA 2F2XA 1VQOI 2PG4A 5D8LB 3LFUA 5F1JA 2FVUA 1YIJT 2LT1A 1MHNA 3GFJA 3ULQB 1Z67A 4PFPA 2QWWA 1EX4A 3OW2P 2ZMEA 4PJOG 5GAOp 1YJ9Q 2DEUA 4RLFA 5K5RA 5J47A 1NJIR 4KT5C 1G2HA 4YIIA 1UHSA 1NH3A 2H1KA 4M74A 2QTXA 2DMQA 3CUOA 3PFYA 1T56A 3ASOH 2PVGB 1FMVA 4BH9A 1YHQA 2Z2SB 4HRIA 3E6BA 3M58A 3L00A 4FW1A 4QW2A 1UECA 1D1BA 3FMRA 4U7DA 1EA3A 2DK8A 4IHVA 1IRGA 1X6GA 2YHTA 3O3KA 3G71I 1FBSA 3KP2A 1Q81C 4A93J 4GXOA 4M7AC 4F04B 5F08A 2DA9A 1T0FA 4ZTFA 2PNIA 1NK2P 1GV2A 1YIJA 4RG2A 1YFNA 1WRJA 4BHBA 2L01A 2ZXIA 3IWFA 2LP5A 4WXHA 3M0RA 3KCCA 3ZMDA 4J9HA 4AC0A 2L3PA 4X0GA 4YIRX 1MKMA 5GAEJ 2K02A 4ASNA 3IL2A 3M54A 1VQLA 1R00A 2HL5C 5J4YA 2QCOA 1IXRC 2A05A 2IGNA 2DA1A 2W1OA 2XIGA 2OJED 4RAFA 5CJ9A 2H8RA 3H9QA 5IT9E 1Q86R 2EQIA 2JA8J 4C2MJ 5GAN5 5KYXA 3KUFA 4GY5A 1PKSA 4FX4A 2CSQA 5EG2A 2CSIA 1YFHA 2VJJA 2PEXA 3L1PA 3F23A 1N25A 1WQ2A 2LNBA 1LCKA 1RKWA 2LMDA 3PUBA 2LKXA 2QDLA 1Z9ZA 1IDYA 4M7AA 2HDWA 1F36A 1XGSA 4GYIA 3V7RA 2GXBA 3T8RA 3KX2A 4YEJA 1IXSB 3R61A 1SFKA 1K4TA 4B1RA 2VBZA 3GTPJ 4AIDA 2R7WA 3HL8A 2AQFA 2DW4A 2M8GX 4D5CA 2YUOA 2R7FA 5LJ3f 3JRFA 1VQ7I 4C8QA 2DEQA 2MG4A 2O5RA 2VWFA 2XG8D 3I55A 2RQWA 2ZSHB 4CYCB 4C0FA 2NXNB 1OCTC 4NC7A 1TT5B 3PSIA 3HRMA 1A31A 2VQHA 4NC6A 2AZVA 1V5GA 1BR4A 1HQCA 1ZTRA 2XGDA 2YPRA 1R4MB 3HHTB 3QWXX 1HDPA 1ODDA 5EZHA 3Q0VA 1RUNA 4WK8F 2K79A 1MNDA 3CC4I 2E34A 3JTGA 4AM3A 2M7AA 3SFMA 1Z9CA 1RAIB 3L7WA 4RTXA 3JSOA 2XD0A 4FETA 5FRNA 4FSXA 2VKNA 3PJRA 2JT1A 5TRDA 4E7ZA 3N05A 3RZOJ 1LJOA 1UJYA 1M1KR 3U9GA 1AA7A 4BNCA 1IDZA 2R4GA 3NQOA 2RJCA 2FSWA 1QGPA 2V8IA 3GBQA 3QOPA 4L59A 3ECOA 2QAZA 1XG1A 3X20B 3L2VA 3IRRA 3CO6C 3CCQT 1S7EA 4E7JA 1OPCA 1NEBA 2IGMA 3Q0UA 2OC6A 3Q9VA 2M0OA 3QYBA 2WBMA 2LG4A 1W0TA 4JJBA 2DERA 2F48A 5LJ5g 4CGZA 2E3HA 4ESBA 5LGNA 5HNHA 3X2QH 5LJ5f 3JB9J 5CPRB 2RO0A 4J9GA 2A61A 1WCMJ 4K2EA 3VEPA 4FCYA 1VQNT 3QQAA 4X9DA 5E17F 3LFKA 4OMNA 3B6CA 4HYEA 4I76A 5FKLA 2OTJQ 5C6SA 3CQZJ 1Y96B 1VQ6A 4KIGA 2YRDA 1YJNI 4M9ZA 1LEAA 1VOMA 2F2EA 3WTSC 2HEQA 1FXXA 1BIAA 1RACB 1EIFA 4LG3A 3OYKA 3GWZA 3BFMA 4ZYDA 1P4AA 3RKXA 2NVQJ 2ZAEA 1IN5A 2O01E 3JV3A 2R5AA 1W0UA 1AOYA 1BIBA 5A0DA 2CQNA 3CDLA 2FRHA 3OL3A 3RPUD 1YITT 4M3BA 3BJ6A 1VQ4I 2K5FA 1TLHB 3P9KA 3A8LB 3FXOA 1MDMA 5DCMA 1ZSGA 1FYKA 4UVCA 2DL4A 2ESHA 2F6CA 3CP8A 4NQWA 2G6FX 5LJ3d 4DEXA 3PIPA 3TO6A 4PZJA 5E1ZB 5FD6A 2K2VA 3OBWA 2HZDA 4CC2A 4JRIA 4AMCA 4XU0A 1VQMT 3VS5A 5CCAA 4X6AJ 3CXCA 4HF1A 3GF5A 4A6DA 2BKDN 5DM6F 3CXCP 1IG7A 4M75B 2LP0A 4NC8A 2QVOA 5ICFA 1Y96A 2P4TA 2WSFE 2ZCFB 4VUBA 2DFFA 3LGFA 3OBYA 2E35A 4RB0A 3KZIC 4IQJA 1FWZA 3ZMVA 2JRTA 1PUEE 3ZPLA 1E3HA 1RESA 2E1OA 4EV0A 3WGGA 4HW0A 3SWNB 5IP7J 3QPTA 2XI9A 2EJFA 1SD4A 1S3JA 2J05A 2FMYA 2XKOC 3FF5A 1WHLA 4KRTA 1M2VA 1U0JA 2XGXA 2FB7A 2CUEA 3GPLA 2HQ5A 5A2QE 3CCEA 1J9IA 3CCSA 3FM5A 4PJOF 1KC8U 1B34A 1T08B 3EUAA 2PBIA 2VGNA 2LBFB 2MPXC 3NRVA 4IRGA 3TO7A 4AIHA 2XHKA 5LD2C 2D1VA 4LOCA 4M9SA 1RRJA 2VUBA 3J81E 1M8VA 4UB6C 4J19A 1KD1U 4J5YA 1AD5A 2V1RA 3M56A 5CKDA 1TWCJ 4HXJA 4DQ2A 1QZEA 4ZDPA 4UV8A 2WB1A 4A3DJ 4HSTA 2X4YA 2HS5A 2KZGA 4PSXA 1BC7C 2W24A 3INZA 1ZAOA 2M4GA 1EH6A 1L3LA 4LXCA 5GANd 3C12A 1FSEA 4M7DE 1O57A 4PDKA 2OUMA 3PFIA 1IRFA 2ECZA 2XGCA 3MEAA 2NVYJ 1RIOH 1O3SA 2DMNA 5K7FA 3OW2A 2OAZA 3F8BA 4G6DA 3RPQA 3PIOF 5L23A 3BG5A 1Z6TA 2VBWA 2PN6A 3KP3A 3M7GA 2D9TA 4M78E 3CZ6A 2LRQA 3H0FA 1IRXA 1W2BS 1VQ6T 1E3PA 3R6NA 1GUUA 3NTHA 1KQSA 1M3BA 1UJ0A 4C92B 4C8QC 1Z1DA 2R5YA 1ACMB 2DZ9A 5GANf 4BI8B 3OYLA 3A8GB 4II1A 4HV6A 5E18F 3LSMA 3OYIA 3BR6A 4BDYA 5L8RE 1WJRA 2JSPA 2F5DA 5ICEA 1VUBA 3GMEA 4DBFA 3CF5F 2LR8A 3M3YJ 3JCMh 2QGUA 2M3AA 4N9IA 1FSHA 3O6BB 4IL6C 1NBEB 1HSQA 2CP0A 3MCAB 3OSVA 4XTUA 3RBBB 1BR1A 2X1CA 2HPMA 2KXDA 4JLGA 3CC4T 2QEXI 2P0PA 1V54H 1WJCA 5CKBA 3HHHA 2DL3A 2EIFA 2CUBA 4M78F 4HNTA 3ZCOA 1A04A 2J5PA 2V1XA 4BXFA 1B9NA 2DYIA 2LMJA 1B72B 3FWEA 4N4HA 3IH3A 5GAMf 2KYBA 2DDBA 1N75A 4KT6A 1U78A 1OEBA 2QZ8A 1FBUA 4EJOA 2TCTA 1JT0A 4L0ZB 4HCZA 3EG2A 3HRUA 1Y1VJ 5FB2A 2YWWA 3CJNA 2STTA 1IN4A 3WTVC 1L0OC 4U0VA 4IHTA 1TT0A 1JB0E 2CJJA 2AXLA 2X9DA 1R8OB 2AO9A 4AFZC 4ZGJB 1H8KA 3G4SQ 2HL3A 1WJAA 1ITYA 2ACJA 1PSFA 2RQTA 1TC3C 2DVEA 2HTSA 1K73U 1WI9A 4A4EA 4CH7A 2CV1A 5DLQE 3NFCA 4KULA 1B9MA 1RR7A 3CMMA 3OIOA 3PUFA 2R93J 2DVJA 2OTJA 4RTWA 2O4XA 2LDMA 1WPKA 3PVQA 3ABUA 2V6EA 4M77C 1WFXA 1BJAA 2V4JC 5J8FA 1BK2A 5FKNA 4FU6A 1AOJA 3FXLA 3I59A 2NNYA 2I2LA 2K2MA 2RN7A 2KVQG 2LY1A 2HGCA 1SHFA 3S2DJ 3GBGA 1WQ7A 1MW7A 2ICWG 2XB5A 4RDUA 3JCMQ 5CVJA 3IRQA 4KDPA 5LBQA 1X75C 4BGDA 2VXEA 2KI7A 3H41A 3JRZA 3NPFA 4ENMA 1VQ5Q 2NUZA 4K11A 3BY6A 1R5GA 3TU4K 3P5JA 3VRYA 2ZSIB 2R7RA 1PCXA 2HZYA 2MOXA 4JX4A 4G7ZF 2HKNA 1TQPA 3I53A 2ZPHB 2RQVA 2RJEA 1D09B 2PVDB 3G71T 1YIJI 3ESWB 3KEQA 3TKYA 4A3KJ 3WTYC 2DRKA 4OMPA 3CCMQ 1FOKA 4LLLA 4EM2A 4XKVA 2CQKA 2ID3A 4II2A 2M1HA 1OCOH 3DKWA 3PQKA 4KJZA 2BHYA 5D6FA 2O9SA 2BY0A 3R0JA 4BBRJ 1MV0B 1XDUA 5LHIA 2FEIA 3E19A 3JB9G 5E1WA 3F8MA 4MHGA 3SWNA 1HOMA 1FYNA 1J59A 3U21A 3KZZA 1R58A 1XB4A 2Z9OA 3CCJQ 3HSBA 4BI4A 4IKFA 3O8GA 2YUSA 2V6CA 5EEGA 5ED4A 2FZKB 1FY7A 4L5IA 2RJFA 3IKTA 3ABTA 2FXAA 2K9NA 1TL8A 3D7SB 3CC2A 2OZUA 3F9KA 3DPLC 4RGUA 2YRCA 4A4FA 2MLKA 4NL3A 5FKOA 4CO8A 5KAIC 1ETWA 1JTXA 4KN4X 3I4MJ 2HKQB 4C5EA 1MNMC 4Y52J 4CYDA 3H5RA 2EIJH 2FO0A 3FXMA 4M6VA 4CCJA 1XX5A 2JUFA 1VQ9A 5FKMA 3I71A 3SYTA 1UE9A 2E19A 1R1VA 2CH0A 3UWNA 2FA5A 1TQIA 1YJ9I 1UZCA 3F21A 5TGTA 1E3OC 1R71A 1SRLA 3MHXA 2EWNA 2K6DA 1GLNA 1CSKA 2L3DA 3KYCB 6PAXA 4ENNA 5JLXA 2XUBA 1N27A 2CREA 5A0LA 1U9NA 2EIMH 1M1KU 4B47A 2MH9A 4D5FA 3W3CA 2DFHA 2D0NA 3D1NI 1WHJA 2IVWA 1QVGA 3M0QA 2MSYA 4JYKA 1O75A 3KBGA 1T0FC 4BQNA 3VPRA 3H0GJ 1UGQB 2VKEA 2R5ZB 1GCQA 3LSGA 1QLYA 3ASKA 3MEXA 2RH2A 1S72T 2LH9A 3GW2A 3K4KA 3ZQFA 4ZC3A 1V29B 2OAUA 4A63B 4BBSJ 2A37A 5GAMe 4ESJA 3RTRA 3Q5FA 4GBQA 3AL0C 3UPUA 4M75D 4IOCF 3UKGA 5CO7A 3GNFB 2FJ1A 1WI3A 3F0CA 4LLGF 2DJNA 2HPIA 4C3IJ 1K78B 2BE7D 3TW7A 3N97A 1VQMA 1UTIA 9ATCB 2EZKA 1DJ7B 4LDVA 2ZB9A 3BZ6A 2EQUA 4EJVA 4C5IA 4BY7J 2ROTA 5GTIC 1JT6A 1LVAA 2COYA 2Y9ZA 2R7XA 1KK7A 2DLPA 4BUGA 1BI3A 1UG2A 1MBEA 2LX9A 3PTAA 3C3WA 5HLGA 4B3XA 1FYMA 2LFBA 4GCVA 4CC7A 3CC2Q 1ZX6A 4EMGA 3PMTA 3DEUA 2DN0A 1VQMQ 4XTZA 4BE1A 3CDIA 1W6XA 3FXJA 4R1HA 3H36A 2KQRA 1RAHB 5GMKm 1VQ8A 2RI3A 2XIDA 2HTJA 3H5NA 5GAMj 2A6HF 1FBQA 2CFXA 3H3ZA 2KRCA 2ISZA 3S2HJ 1I8FA 2QYOA 2VI6A 1M3AA 2GF7A 4M3EA 4N9HA 5JVTA 1NYGA 2SEMA 1GBRA 1AKHB 2HR3A 2P81A 2W7NA 2E12A 5LGUA 4UUVA 4TV7A 4P9UA 1O3TA 1XSVA 3CCQA 3F8NA 4FISA 2QG9B 5J39A 1U1TA 3KYLA 3I5SA 2M51A 1KQ8A 1TNTA 1RC9A 1YBYA 2R5MA 4XQFA 1U5SA 4L9NA 1SFOJ 2LRDA 5JHUA 1R49A 1IGNA 3A1PA 4E6KG 1QCFA 1I4K1 4OAZA 1KQ0A 5L3FA 1Z3YA 3MKWB 1Q95G 4MQVA 3I59B 2K3XA 4HCBA 3EFSA 1JUMA 2M1BA 4M77B 3DQVC 2L9NA 1OFCX 5J3LA 1Q7YR 2DTOA 1K9MU 2ESWA 1DGRM 2Y75A 4LB5A 4C92D 1TOVA 1XSDA 1D3BA 4XLEA 2LT4A 3BDDA 4A3JJ 2PJPA 2V1NA 1KSWA 4KISA 3S16J 5E8IA 1KJWA 3C94A 3VODA 3JSPA 1R6RA 4RAYA 1G4DA 2VN2A 3DBLB 4BS9A 1BW5A 3DTKA 3CJQB 5KYXB 4KGXB 2HQRA 3ZMTA 1SVLA 1Y71A 5KVRA 1V76A 2WB1N 1QP3A 3TP0A 2F1LA 2DQRA 4QT7A 5HODA 2CP7A 3JCMg 4A5NA 1NLOC 1WKMA 1KU2A 2H3JA 3ULRB 1S29A 1HK9A 3J80E 2H09A 2CG4A 4RCCA 3F6VA 3HOSA 3WTTC 5ECAA 1YJNQ 3CCJA 2IRFG 4IUTA 4PJMA 1USSA 1ZSZC 2FPEA 2C06A 5CVRA 4CCKA 2KE9A 4KFCA 3MVPA 4HEA2 4C8QG 4RTYA 3ZOBA 3CMEI 1YWOA 4OMFB 4UC4A 1VQ7Q 1IZ1A 4UVAA 3EH2A 4QQGA 3DV8A 3KZYA 1VTNC 2EA4A 2WAQN 2X85A 4PJJA 3HKZA 2HBWA 3QPLA 4PCQA 1P4WA 4XK4A 1Y8RB 2E5ZA 2Y31A 1J0RA 3I4NJ 4BXXJ 1QKXA 2KIFA 2VKDA 2FX0A 1UAAA 1BBYA 1EKEA 1TWBA 2F4MB 2XPVA 3W6KB 2L02A 4IHXA 2LZ6B 3REBB 4A54A 2HXIA 4EIKA 2DO3A 2O4XB 1S8NA 3M9AA 3GZ5A 3K4MA 2OQGA 1K8AR 1GBQA 2DM1A 3EH1A 3BT9A 4DIQA 1JUPA 4MFDA 2X51A 4XKBA 3C2BA 4A2UA 3OSGA 1KU9A 3EYIA 1VQOQ 2CUFA 3TVTA 1VQNI 2ZCWA 5DLOA 1OCZH 1BOAA 2F5VA 2JWTA 4L9JA 5ILVA 3LSPA 1UHCA 2VQLA 2V79A 3MKDA 1HKSA 1IRZA 3L2QA 4MFEA 1RAAB 2E65A 2KK4A 3JCMW 4KBMB 2ME6A 2L7KA 2I8DA 2MAMA 3I9V2 3GP8A 2Z1DA 4XTXA 4C8QF 3HOYJ 3CJRB 4JZ3A 3D5LA 2DCEA 3B73A 1RKTA 1WDXA 4HA8A 3R0AA 2AT1B 4MZMA 4PJOE 4XIDA 1G3SA 2DD4A 5GANg 3QU3A 1KG1A 2DPDA 4Z89A 1OYYA 3HL2A 2MMPA 2EK5A 2IW5A 3FRNA 2MW8A 2LNVA 4C0ZA 2R92J 1WXUA 2EQMA 3RERA 4ATOA 4IUUA 3G73A 3CCUA 3D0SA 2CKKA 2Z5UA 2V9KA 3AFHA 4HG2A 1YJNA 1XMKA 4JP0A 1I1JA 3GFIA 4FHTA 3T8TA 5LJ3j 3BDLA 1POGA 1I81A 4J9BA 3FLGA 1MNEA 4LE9A 5CVUA 2CS7A 3Q1JA 2JTFA 1NG2A 1NK3P 1AWXA 3CCST 3CP2A 3LQRA 3RKWA 2UZKA 4N0AA 3OYBA 2IA0A 2QQBA 4CCOA 2OAWA 3RMSA 2RJDA 2E2JJ 4CHUA 1YG2A 3MKLA 2JA7J 2NLUA 1EH8A 4C9YA 5DCMB 3VUZA 2DFUA 1FLIA 3ZXSA 5DYMA 1Y57A 2P5VA 3BOQA 2C0IA 3A8OB 1RI7A 4M77D 3FX3A 2EQKA 4AYBN 2X0LA 4QQDA 3ISPA 2CP2A 1QCNA 2PUKB 4I98B 3IQLA 3UA7A 5GAN7 2CUZA 4M75A 4B9WA 1LB2A 2HU9A 4MTEA 3TSZA 1SEUA 2CSOA 2O9LA 4M77E 5KYWB 2ZNZA 4C30A 4C0DB 2CGPA 3M0UA 2R7OA 2QEXA 4FYXB 3QPHA 3JRHA 3QYGB 5EDNA 4E7KA 5E79C 3V7SA 4O3MA 2KBTA 1Z21A 2VKHA 1ETQA 1STZA 2NUTB 3GNGA 4S0HB 5LJ3g 4A6EA 5GAHJ 3CC4A 2WC2A 5FU7B 2KAFA 2LKPA 4XICA 3K4LA 2LX7A 1X2KA 3HGYA 2VONA 1VQKI 1OZ3A 1WHGA 3KP7A 1N8RC 2M9HA 4DZPA 2PJRB 1YP5A 3K4JA 1K9MR 4M7DG 2ME0A 3FJPA 1PSEA 3CLQA 3MN2A 1UHFA 2HOTA 3EHRA 2HI3A 1D1CA 1MSFC 2JS2A 1SFEA 1R1TA 5ICCA 3G1JA 1TH7A 2WACA 3DTIA 4ZYEA 1Y0UA 2CRGA 1RADB 4RG8A 4Q47A 3JRCA 2FL7A 4Q48A 3TQNA 1JO8A 3U1DA 2DYSH 2ELHA 2ZMEB 5J1UA 5FLXE 3E6DA 1J3TA 1U3EM 5LLQA 2OU2A 2F5FA 1ULYA 2I5UA 2YU9J 5GPAA 3A0HC 3HKSA 4BE2A 1DU0A 2E60A 4ZYGA 2LCSA 3REAB 4YTLA 1K8AC 1MMNA 3QODA 3CCRT 3GOXA 4G7HF 5IPAA 5J6XA 2E2HJ 1WFWA 1K0XA 3AG2H 4D7MA 2JA5J 4XKCA 5BOXA 1VIEA 5GAN3 2QGFB 4PJOA 1EFNA 3BR0A 4EJUA 1HF0A 3JTHA 5H2FC 3I35A 4BUPA 4C92A 4OINF 2Y48A 2CP3A 2XPWA 4FSSA 2EQRA 1J09A 1XGMA 2DYBA 5KHDA 1VQPT 2ESNA 2HVRA 2DDAA 3HOZJ 3I56A 2ZMEC 2QEXT 2BXZA 3A4CA 1Z7LA 5FD5A 2EZLA 1PNJA 2DIGA 1FTTA 3PNTA 1GDTA 2VUMJ 2LCLA 5EGOA 4XLFA 3TCJA 3B02A 3I5RA 1KFZA 2CZ6B 1ENHA 2KP6A 3RDIA 1PG5B 1X6BA 4DGWB 3G71A 2K4YA 2X4JA 4RAZA 1WHHA 4IX7A 2KJBA 1XPXA 3MEUA 5HCKA 7AT1B 3DB4A 5HS8A 1MBFA 3I4PA 2BUDA 1Q81U 3OYHA 1K83J 2QQ8A 3AG3H 2X6XA 3PE0A 3ABKH 4FYYB 3EFOA 1LPQA 3WGIA 3REOA 4XR6A 3OMCA 1R36A 2ADUA 3PT9A 1N5ZA 1SFXA 3OV8A 2A28A 4M77A 2DKGA 2VXFA 3BCBA 4LLNA 3HPHA 3VFZA 5GANh 2DT7B 4QVZA 2D6FA 1WIEA 3HTRA 3ZP5A 3C18A 4A3LJ 3FXQA 1FYLA 2EV6A 1E17A 4Y17A 3F72A 3QDFA 1UFFA 4PGGA 4C8QB 4R8HA 4C92C 4CCMA 2Y90A 3WTWC 3ZR8X 3JRDA 5FO5A 4IQ4A 1IV8A 4CDGA 3G7ZA 4R79A 4PNOA 2RQPA 2M5WA 1ETVA 2E1MB 2P5KA 2B9SA 1M8MA 1XJWB 3CPFA 4LD6A 4M78C 1MMAA 1VQ5A 3X26B 4FT8A 3MZ8A 5K7HA 1UGRB 1JJ2S 4EM0B 2XF7A 2QSHX 3CBMA 1KZHA 3DTEA 4AIKA 4JK1X 2BXYA 2COWA 2X35A 3I54A 1IXCA 3DCFA 4MEYF 3HEFA 4A3IJ 1ZG5A 5CKEA 1G5VA 3LOCA 3EAEA 2CP5A 3AKZA 2EH3A 3HB9A 5FGMA 2D45A 2J6FA 2DMPA 5EYRA 4MGRA 1XDSA 1W5SA 3JCMV 3KP6A 4H4KC 5H6RA 5M5WJ 4UY8I 3BC8A 4IRIA 4WCIA 3CCMT 1JJ2P 2OQRA 2OCCH 3GTMJ 1NZ9A 4MIMA 4B3AA 5IHIA 2A08A 1TXQA 4OB0B 5HKCA 3UNGC 2LNHB 4F14A 3BTCA 1K73C 2LY9A 3G3ZA 4E7HA 3EQLF 2NS7A 1AWJA 4M7DA 5EF6A 3M0SA 5GAN6 1W36D 2VOPA 3S17J 3ZN0A 4J01A 4OAYA 2RC4A 3A1YA 2UWMA 2MF2A 3EGUA 2XROA 4M78A 4LB6B 1M1FA 2ZO4A 2CUJA 1R5ID 1ORKA 3FISA 1ZKGA 5A0GA 2GWRA 2VQCA 2A36A 1GL5A 1X6OA 1GVDA 1OJLA 3QPSA 3K7AJ 5D5XB 3OYJA 3PQJA 4X1EA 3LSTA 2X1DA 2XAGA 1JKPC 3G6EI 4NNJA 4PLLA 2CYYA 2DOEA 1OCRH 4NUBA 3N4MA 5FRMA 2KSSA 2DFEA 3FXRA 3RKYA 1M1GA 3A8HB 2R7DA 4UXNA 3SHWA 4GFBA 5LGTA 1M90U 5HVQC 1ON2A 5CKFA 3HXLA 3JAMZ 2QEXQ 4KIBA 2R7ZJ 1R7JA 1WWXA 4HZFA 3JAMK 2CWEA 1YHQT 2GLOA 3RIRA 1ZR4A 1M27C 4QWQA 1WGSA 3CBOA 3OWTA 4J7FA 2NAZA 3MQ0A 1FOYA 3A2KA 2L3QA 1M5Q1 4QPOA 5CQEA 2DXUA 1QVPA 2WWYA 2KLOA 2KMUA 1WJFA 2PMHA 1OOTA 1W4SA 2DX1A 3G4ST 4J9IA 1TP4A 1M3CA 1SSHA 2EVRA 4TVRA 1RUWA 2X6WA 5D5UB 3BR2A 3LH0A 2EW3A 1FJLA 4IO9F 5C4XJ 4A0XA 1X1AA 2VT3A 3DKMA 2RMOA 1R4NB 1GCQC 4A0ZA 2ZBKA 3ZFJA 4KGVB 1TUDA 3CC7T 5IT9K 2JPBA 4BD3A 2CU7A 2OV7A 2L89A 2JVGA 4J8OA 5GAN8 1JUSA 1LJ9A 1ZELA 2VGMA 4JRPA 2HAXA 5JVGF 3SEQA 2LBFA 1ZUUA 2KL4A 4J83A 2CV0A 2KPMA 5FWBA 4PJOB 2YX7A 2QYZA 3EG0A 2XKOA 1AEYA 4M75F 1QVTA 2L7MP 2IA1A 1YIOA 1XCBA 4XSZF 1GVJA 2EGAA 2RI5A 4Y15A 1ABQA 1MJAA 5CLSA 4U7BA 2OD5A 2K3YA 3MEWA 4OB2B 1AZEA 1AWWA 3J80Z 3CPWP 1IO2A 3J80K 4WF2A 4J9CA 1R5HA 5KCMA 1YJ9A 3KFWX 1ZBJA 4FE7A 4EDUA 1PDNC 4L18B 3A98A 4MEXF 4N0BA 2YRVA 2M0MA 2LJ3A 4A53A 4UUTA 4LD5A 2JSCA 4Z2YA 1ZRFA 5HK0A 1MJBA 1HYOA 3IP4B 1Q82C 1W70A 5M9OA 2DMUA 3OIPA 2JW4A 2E41A 3LW5E 4M3DA 4F7UG 2EINH 3V7CA 3TEDA 1D8JA 2DZCA 1K4SA 1WJ5A 1HKTA 2GIVA 2KRMA 3CBPA 2J7IA 3MWMA 2XDVA 1ZA1B 1ETOA 4XSXF 2MD5A 1YI2A 1RABB 1VYVA 4GRIA 5CIUA 5DM7F 1ETXA 5IXBA 1U06A 2BOLA 2MWOA 2F69A 4Y33A 5AT1B 3VS7A 1M2OA 3JAME 1F4KA 3G1OA 4XN3A 2DA2A 3PSFA 3J7AO 2XGEA 1QZYA 2PMZN 1RLQC 1VQ8I 1MIJA 2ZJPF 2CW8A 3H1CA 3C2GA 4I99C 5IT3A 3LAJA 2JTEA 4LGWA 5HLHA 3A01B 1ONVA 4J6WA 5IH2A 2BIVA 3LWHA 5F1RA 3QSUA 1KYZA 5LJ5j 1T3LA 3PIOA 1VQ8T 5E3MA 1G3WA 3CDHA 5LHGA 2JVVA 3L1AA 4C92F 1SEMA 4A3FJ 2W57A 2H1LA 2ZJQF 2H27A 1ZH5A 3QYHB 4ZN3A 1REPC 2XDDA 2N8GA 4MQ9F 2Z0WA 1S7AA 5DDGA 1S6LA 2K86A 1Q1HA 2AXTC 2EBIA 1BN5A 2JJ7A 2W82A 3S6WA 2WTEA 2IG0A 1RZ4A 4BY1J 1TWAJ 1YCSB 2Z33A 2L2PA 5HLTA 3RMQA 1V5FA 1RETA 3WE2A 2XDBA 3BZCA 2DXTA 1UG0A 2A69F 5IOYA 2VVKA 3OYMA 3B6AA 2DBBA 3I64A 1AHDP 3GTOJ 2E6NA 5GMKj 1U5TC 1UHWA 3M59A 2JMWA 4B9XA 2RHIA 2K4JA 3JRGA 3A02A 3GYHX 2VOOA 2JTMA 1U1SA 5TISC 3I55T 4F52A 4XORA 2EA2A 5E3NA 4EMKC 4J00A 3EHQA 3S1MJ 2AKKA 1ETYA 3IC7A 4XRSG 1W4MA 2IIMA 1WJBA 4HF0A 2KMTA 1MBKA 2XAJA 3EDPA 5M3FJ 2KT8A 4LUEA 1CQTA 4L9TA 2MGQA 1XD7A 1KC8R 2EIKH 2EAYA 1OLTA 4U0WA 4HKEA 1VQ6Q 4ZGEB 3CMEQ 2RHUA 3GTGJ 4P5NA 3WTUC 2DTZA 3FIWA 3QAHA 3X28B 2M8EA 4J7IA 4IRHA 2ZNYA 3NEUA 4JOMA 2KFDA 2RHYA 3AT1B 4EJTA 3HFOA 3VS0A 1P92A 2QLZA 1JTYA 3HOUJ 4BQOA 2KQWA 1QQIA 4MDWA 1VQ4Q 3ZQLA 2ZFUA 4BKXA 2WY7Q 1XS9A 5GAOr 2RQRA 4RMNA 1WGXA 4DYRA 2OA4A 2QENA 2WY8Q 3HZJA 4DW6A 2DK5A 3SZGA 5B66C 2FG0A 2ZXWH 5IYCJ 2LQNA 2DODA 1PD1A 4WXCA 5AIPA 1QPMA 4BL0B 4ZNXA 3ZQHA 4JJNK 1UMQA 1Q7YU 4MMKA 2ATCB 2DO7A 2EILH 2K3PA 4Y13A 1PRLC 2RKHA 2EFWA 5DD8A 2GM4A 2RN8A 3KEOA 4CC3A 2KRHA 1FOXA 2JM8A 1P7JA 4A4GA 3LGLA 2GZWA 2WV0A 3KEYA 5KYUB 2XRLA 4N4IA 4XN0A 3CCLI 4IHWA 4AWXB 2RQQA 1TWGJ 4J9DA 3OOUA 3G1MA 1EV7A 4PK4A 1TU0B 2HD0A 3VU3C 4Q5WA 1XGOA 3I0TA 3T9NA 5GMKe 2WADA 4WX9A 3E6CC 5KE3A 4M7DB 3GZ6A 2F5KA 3BQYA 2Y69H 1K7AA 3OS0A 3RI4A 2ENMA 2GQVA 2CQXA 2VE9A 3MO8A 1O7FA 3LSIA 3QYEA 3CMET 1B59A 1YI2I 1HBXG 2EYYA 4E7IA 4UHTA 3M8FA 1VIFA 5CKHA 1H9GA 2FF4A 3OIQA 4FL6A 1LFBA 2K5CA 1KU3A 2KIUA 1H9TA 3S15J 1QQJA 4GLKA 3KLNA 4C5HA 4NS5A 1I27A 2KJCA 5EEAA 3GTKJ 2EBPA 2P5LC 5J1YA 1C0MA 3FK7A 3LSJA 3EG9A 3G2BA 5A2QZ 1G8XA 3HG9A 1A6IA 3WGHA 1B4AA 1IB8A 1JXMA 2HOAA 2D0QB 5FFZA 1TUCA 2PQWA 3UDCA 3ZQGA 3IWZA 2QKLB 1MZBA 4YFXF 5GAGJ 2RK2A 5D6WA 4YIFA 3J7YJ 4E70A 4M3FA 5EG0B 4DOVA 1ZSZA 5I11A 1FNNA 4KICA 3MCZA 5KYYB 2RF0A 4LDXA 5C3EJ 3OYAA 2K9QA 1BCOA 1VQLQ 2MCNA 1NE8A 2GA1A 3NMZC 5GAOn 2IPQX 4KMFA 3CCSI 5CVIA 1NPRA 3CCEI 3AG1H 4EM1A 4RGSA 4FTHA 1WXTA 1S7OA 2G9WA 2X9HA 3OYNA 2E2IJ 1IGUA 4MMLA 5F64A 3BG9A 1GHCA 2HSPA 2YS9A 1GV5A 4IXAA 1VQ9I 2K5LA 2QA4A 2ZPFB 3OMGA 5M5YJ 4MZTA 1LNXA 2CMPA 1X58A 4JBAA 4X1VA 4C0DC 2RNAA 2DMOA 3L09A 4M78D 3ROUA 1R23A 3EG1A 4HCKA 4HPQA 4Q4ZF 2P4WA 2P7CB 2JJ9A 4WXDA 4ORZA 1MBJA 4S04A 3C0CA 1VQKQ 2FNPA 3G6EA 3E9GA 2Y0SN 3QP5A 4RBOA 3Q0WA 2KR3A 5L3DA 2Y0SA 2EFPA 5C0MA 1W36C 2HNIA 1TW2A 2FPFA 4LNPA 1H3ZA 2MK5A 5KAFC 1DUXC 1VQ4A 1U8RA 2RQUA 2V9PA 2HMAA 5D6YA 1TZLA 2L0AA 3SQNA 2IS1A 5BMZA 2AIRB 2XAQA 3DBRB 4B09A 3FB9A 1CKAA 4ELZC 2EQJA 2L5QA 2ZPGB 4UUSB 2G7UA 4I01A 1DPUA 5D5WB 1M90C 4C2UA 2BZTA 4L5EA 2RVCA 4PJNA 2PMUA 3QOEA 2KT1A 3LWFA 4G12A 1I50J 1C0WA 1NM7A 1PP8F 3BPXA 2L3RA 2ROLA 2VC1A 2LVMA 5ILUA 1B34B 2WV1A 1ZUYA 1NJIU 3V8LA 1T8IA 3M55A 2GOXB 4V2FA 3AL0B 2YR2A 2DETA 1YI2T 1BW6A 2P0WA 1J7KA 2Q2EB 3ASNH 3KLOA 1D5VA 1K9AA 1WJEA 2L8DA 1YE9A 2VB6A 3SJMA 2MC3A 2K3BA 2XASA 4UV9A 2HQXA 3DLMA 2DD5A 3JB9D 1M1KC 4QLCU 4XRFA 5LHHA 5D7UA 4ETSA 2OPTA 1FX7A 2DOAA 3VDXA 5BS6A 3H3UA 2HWVA 4HDVA 1I1SA 1CKBA 4E2FB 1U5TA 2CO5A 1X3UA 4RB1A 2L9VA 1VQ5I 4KUIA 1VQPA 1KQSS 1DP7P 3JCMf 2HKOA 4M72A 3C4SA 4X34A 3MFKA 1XMXA 3CC7I 3HRSA 4HX4A 1Z7UA 2SRCA 2V8JA 4CZZA 3EFRA 5D6XA 3PVLA 1NPPA 2M02A 3PMIA 1YX3A 2L4MA 1O9SA 2DQLA 3KXTA 2DLLA 4XOTA 4M7AD 1I6HJ 2COMA 3OL4A 1UHMA 1P9QC 3META 2LREA 2JQ7A 4GLMA 5IHKA 1Q86C 2D1XA 1T98A 4JQFA 4ZN1A 5B1AH 4AFQC 3H8ZA 3IAM2 5IYDJ 1Y39A 1MGQA 3UATA 4P5OA 2FZCB 1BYMA 1GT0C 4AT1B 4JPBW 3OSFA 1TG0A 3PNVA 1LFUP 4EEFG 4HDUA 1CGPA 4JS4A 2FNAA 1X1DA 2MH2A 4A69C 1X01A 3M9QA 5GJVB 4LFUA 3TEEA 3HGGA 1IHWA 2XKPA 1UFMA 1QVFP 2E7XA 2IS2A 5IYBJ 2E4HA 1OR7C 2Z16A 3AG4H 1IJWC 1VQ7T 3E5QA 4E6RA 2X3WD 1IC8A 4AIJA 4Y28E 1Q81R 1NHAA 1YO5C 4ZZLA 2F5CA 3FXKA 1HW1A 1OISA 1YLFA 3SDBA 4HQEA 1KU7A 2YX4A 3U1KA 2L7FP 5LL6S 3LAPA 3CCET 5EZGA 4IVNA 3I56I 4H0EA 2A5WA 3H3VK 4PLIA 2ELKA 2X3XD 4M71A 1C6VX 3GO5A 2JUGA 2M45A 3J7ZI 3QZ5B 2I0NA 4P96A 1G3YA 4M6YA 3LSKA 4Q5SF 1LEBA 3MEVA 2DTRA 1SVMA 1GXQA 2Q8KA 3NTKA 3Q9SA 3M8EA 1UB4A 3OS5A 2BZXA 1I1GA 4F55A 4HCCA 3UR3C 1R9TJ 3MAJA 3S1NJ 4HX8A 2Y2ZA 3E1SA 1WA7A 3QDRB 3OS2A 2G3RA 1ZYRF 1OQYA 3CF2A 3F3XA 2EGCA 2RHXA 3TP3A 1O4XA 1P7IA 2UUZA 3LSRA 1H89C 1ZRDA 3S14J 2DI3A 4RS8A 3O8VA 4RTUA 1ZARA 3BG7A 4BB7A 4KT0E 2IAIA 5K1YA 4OOIA 1ZSZB 4XMYA 2H8WA 3V4GA 2E71A 3TO9A 2KKOA 3IAS2 2L9RA 4DBQA 4G7OF 1LFPA 4B4CA 4ZDLA 1ERDA 4OB1B 2IPOB 1A6QA 1YHQI 1JJ6C 1UEBA 4LG0B 2NOGA 2LTPA 5M5XJ 3WODF 4BJ5C 1SSFA 1YW9A 3LNQA 2PMZA 2WSCE 3M5AA 4JX6A 3HSEA 4N4OB 5HS7A 4BYYA 2XAHA 5FKKA 3MD2A 2A0FB 3R4KA 3CXCS 1RAFB 2KGTA 4N4NB 1VA7A 1A5JA 3GZNB 4AYBA 4BQAA 5IXFA 3FKJA 5LRSA 3G6EQ 4XONA 1M2VB 2J6KA 4AU7A 4C92E 1OYXA 4M4ZA 5KYUA 3FIFA 4R55A 3JCUC 3S93A 1GFCA 1U3OA 1HD3A 4Y7NJ 2DL7A 2GGRA 1BI2A 3FBIB 1QCOA 3P8BB 1X2QA 2QSGX 1X19A 1OQKA 1RLPC 2EFQA 2COZA 4BDZA 1MBGA 2R5ZA 3SFIA 4C92G 1B07A 3OYDA 4A12A 4M7DF 1GFDA 1EF4A 1AWCA 2A3LA 1SF9A 2DL8A 4OMOA 2V8KA 3I55I 2Y9YA 4A0YA 4C2TA 2LQKA 2ZJRF 3SEMA 1X3ZB 1QHHD 2V1UA 3WU1B 2YSQA 4DEYA 4JS5A 2FUG2 1T2KA 2ID6A 3EUKL 1K78A 1E6GA 1YS7A 2P6TA 4AD9A 2E5QA 4V2SA 1A0NB 2DA3A 3BWGA 1I6XA 4PKCC 1VQ8Q 1KGSA 4II3A 1MDMB 1X2MA 2L54A 1XOVA 1FT9A 2MABA 1B1BA 5KYYA 1ZG1A 4KYWA 2BZYA 2BW3B 2B7EA 2JS0A 4I09A 4M75C 3DLAA 2R57A 4UVBA 3T1BA 4C3JJ 1FC3A 3BG3A 3CCUI 5EEHA 2B86A 3FHZA 5IN1A 1SPKA 2CH4W 1PJRA 1M90R 4IPAA 4C8QD 2O2OA 4ENJA 3OYEA 1XTDA 2F5TX 3JCMd 3QIIA 3ZMZA 1R77A 1IXDA 4QSHA 2MBFA 2GTJA 1F1ZA 4YFKF 1YJWI 2RNJA 4J9FA 4FQGA 2O7OA 3V8JA 1AKHA 4RLQA 1RAEB 4OGEA 5E20A 3WTXC 4CCNA 5LJ5h 1BI1A 1JI8A 1FMKA 1TBXA 2K7AA 3BTIA 2XAFA 4O6JA 2RV8A 1AZGB 1MBHA 2DT5A 3W6JB 8AT1B 1R0BG 3BLYA 2XRNA 4OMZA 2IEKA 1BB9A 4LITA 5CQYA 1OV3A 3DLLF 1D3YA 3E3VA 3RYPA 3CCQI 3JB9I 4A3CJ 3MZYA 2QXFA 5IHNA 1QNTA 1D0ZA 4EMKB 5ICGA 2FQ4A 2DE0X 2QSFX 2GTOA 1YS6A 1LE8A 2EYWA 1IN6A 4F92B 1JKQC 2K4BA 4C3HJ 2E1MC 1O3QA 2CZ7B 2YUPA 1JXSA 2A6TA 3S32A 2JM9A 5E3LA 4UUSA 3L42A 2TDXA 1MGTA 1Z77A 3FM3A 2IVMA 2VPRA 3LSHA 4BJTA 5C44J 2LY2A 3S3NA 1X1PA 1YN8A 3EGXB 4KNYA 2DOFA 1BL0A 1YJWQ 4FM4B 4IHSA 4MDXA 4BACA 2HDAA 2LDUA 4OWRB 2F2WA 3CCMA 3K6GA 2R7UA 1RPWA 1B8IA 3OS1A 5DV5A 3VYHB 1IZ6A 3CD6A 4ZZDA 2VLAA 4XU2A 4F7UE 3QXEB 2PFBA 3C1DA 4FW2A 3DKYA 1ZN2A 3LQQA 3ER0A 1KQSP 2LC2A 5E3OA 2JMCA 3IUOA 1Q82R 1WPYA 3H35A 3R6OA 3WXMB 3CCVA 2KIQA 1PHTA 2E70A 2BVMA 4PJLA 4CSWA 2EKHA 2RNGA 4HVVA 3ZQQA 1I3QJ 3ZQIA 3DPTA 1OU8A 2K5IA 3UF4A 1AHJB 1DGWY 1VQNQ 1XC5A 2LQWA 2NNNA 2QUFA 1V55H 1UGPB 3A5ZB 4S05A 1MH3A 2E3IA 2GNCA 3QUIA 5LJ5e 2LSOA 2HSEB 1NJIC 2E5KA 3CMAI 5HLIA 3J7AF 3VS2A 3JRAA 2FBHA 5IP6A 3W2AA 4M77G 1XSXA 3FHNA 4W1UA 1H3HA 4EGYA 1ZK8A 2KRSA 1O3RA 3C95A 1W1WE 5FU6C 2RI2A 4OB3B 3A8MB 2EFIA 2NUPB 3CMEA 3VB2A 2IXSA 1T6SA 3VJPA 4XRSA 2DILA 1XNIA 3JRBA 5JR3A 2B63J 3HOTA 1KHCA 4NL2A 4M7AB 2M4KA 1TWHJ 4FYVB 3VS3A 1YJWT 5HY6A 5GAOm 2EZHA 3KIOA 4IZZA 3SZPA 1RAGB 1SD5A 2VPLA 2GFUA 2M0CA 1LOJA 1VQNA 1VQ9T 3CPWA 1D3BB 1S72A 3CCVT 4A3GJ 3VYGA 1OPKA 3JCMX 1D1AA 1F1BB 3RKQA 1NEGA 4M6XA 4HAMA 4PJOD 3CUQC 3QU6A 4XU3A 1FIAA 4M7DD 4LD9K 2E1CA 2EFNA 5FU6B 2EYZA 1KD1C 1W5TA 1WZ2A 4IIMA 2HQNA 2LYCA 3H5AA 3K1MA 4OIOF 1JGSA 1IUFA 2L3SA 4EJWA 2GIZA 5J1RA 1LKXA 5GAN4 5GMKl 1YYVA 2W4SA 2B8AA 1QHGA 1WX6A 3SDZA 4CUGA 2IT0A 1W2BA 2XU8A 5CK9A 1X1CA 2CH4A 3SD4A 1ZRCA 3E9FA 1V3FA 2FPDA 3K1PA 3FJ5A 3X25B 5DEQA 1N6AA 3I9QA 2V26A 3AHUA 1K6YA 1ZGWA 5GAMg 4HT9A 1KIKA 2PVOB 2ZPBB 1VF9A 4OMMA 3HSFA 1JE8A 4QIWN 1M1EB 2KHMA 2NS8A 3TL4X 4ZYHA 1VYTA 3NHNA 1TNSA 2LLKA 1DDNA 2VXZA 1YITI 2D2WA 1OULA 2D5VA 1QP2A 1SD6A 3FXUA 2MC4A 1NG6A 2DA4A 1I5OB 2OTLA 1PUFA 2GXAA 2DBMA 1YI2Q 3FMSA 2E6ZA 4BHPA 2JA2A 4P9FA 4GO1A 1XMAA 2RAEA 3MMYB 1HDDC 3BR1A 5F0HA 3SEZA 3Q3SA 2VT2A 1LE8B 4PGHA 2K9SA 3VS6A 5LJ5d 3JSCA 3UT1A 3GLLA 1RUOA 4KGZB 3CMAA 3DU5A 3VYRB 2X1EA 4L5JA 2ECCA 2DU9A 1OI1A 2PTKA 1DU6A 4XLHA 2LJ1A 6AT1B 4M77F 5E1XA 3GFMA 3QWYA 1EZZB 1DPRA 1Y0NA 2A6EF 1OPLA 1PRMC 1UGVA 1RR8C 2RB6A 2QA4T 5CAIA 1GRIA 3CCVI 3COAC 4Z88A 2XICA 1BR2A 2GA2A 3PL8A 5J4VA 1WJSA 1H88C 4IOAF 5JLWA 4OIPF 2IS4A 3A03A 3HDDA 1WHMA 2EV5A 4KH0B 3BROA 2K9LA 1VQKT 4EMSA 2CDTA 1FEXA 4L9VA 3WG7H 4F7ZA 3F8FA 3GXOA 4ZH4F 4ENKA 2PLYA 1SRMA 4U0YA 4WWCA 2E10A 1A36A 1SG5A 4IUQA 1V1CA 2JUCA 2LF7A 4HVUA 2KISA 1QRYA 2KRNA 1GCPA 2DTHA 2FZGB 4EPCA 4E7SA 3RQIA 2GCXA 3H6ZA 2HDCA 1OU9A 5GAMd 4OIQF 1BBZA 2H94A 3FZVA 2BE5F 2BW3A 1ZG3A 1I5LA 1PD0A 1TTHB 3P9CA 3RZDJ 2NWMA 3DP7A 1ARKA 2HQAA 3IH4A 1OR7A 4F3QA 3IV5A 4HV5A 1SAXA 1AT1B 4ESFA 1E7OA 5IP9J 1ZR2A 2QKMB 1F9NA 2YDLA 2LK2A 3CCRI 2OBPA 2JTVA 1OMIA 4ITVA 4U88A 1LDDA 4G9YA 1PM3A 5FU7C 4CRIA 4ON0A 3M4YA 4GGGA 4YRVA 3VV0A 3FC3A 2KYMA 1Y0MA 1QVFA 3CD6I 3K4NA 3M0TA 1W2BP 3HJEA 4XBFA 4NDLA 3TGNA 4D0PA 3DEEA 5GADJ 2VASA 1JKOC 1HSTA 2HOSA 3G6ET 2AQEA 3LH5A 1LVKA 4YELA 1IREB 4CXFA 2RDPA 1G6NA 1F5TA 4JZ4A 4WTOB 3BJOA 5HK3A 3CQTA 2PI0A 2FRYA 1G83A 2DAQA 4I2OA 1MV3A 2ZPIB 4M7AF 4MO7A 1N8RU 3QZ9B 2NVTJ 4RAGA 5CKTA 3OYCA 3VWBA 2VQGA 4PFZA 3ABLH 1LUJB 3ERMA 5BPIA 1QA6A 2NVXJ 1NLPC 1T0HA 2MYSA 1WLPB 1O7LA 2C6YA 1HW5A 4V2GA 3C2HA 2OCEA 1ZGJA 1PWTA 1U5TB 4DNCA 1I07A 2G7HA 1QPIA 4BHCA 1I3AA 2A5YB 4I02A 1DQUA 1WQWA 4JRKA 1S72Q 2I10A 3IH2A 1JU5C 2DTIA 4ANJA 2FRWA 4OIRF 4KH1B 3DPUA 2G0EA 2OTLQ 2VV5A 3H0IA 3M8JA 2RHZA 3QBYA 1T38A 1QU3A 4ABZA 4JRQA 2V1DA 1U6GA 2HXOA 4PSWA 1IN7A 1HW2A 3HOWJ 2L7ZA 2KY9A 4Y91A 4AG1C 5K5QA 1Y07A 3KPHA 5L3GA 2X6YA 3M0PA 1YJWA 2W84A 5FLXZ 2HCKA 4FT2A 2FEZA 4KIFA 5KNLA 1LDJA 2KXCA 2XK0A 3URGA 3CCSQ 3BTLA 3DU6A 2BGCA 3CCEQ 5D6EA 2AKLA 3BTJA 2HBPA 2CW0F 4LUDA 5F27A 3EYYA 3G1LA 1P2FA 4HF2A 5GPCA 2C0TA 3P8DA 1U9OA 1Z3XA 1JJ2A 3L2WA 4KITB 2IS6A 4XK8E 2FOWA 3QYFA 2EPFA 4BY6C 1AWOA 2L4AA 3DXJF 1YTYA 1N78A 2YT6A 3OB9A 4NHJA 1I0CA 1JRIA 1D0YA 1Q1VA 2X48A 3BP8A 2CZ1B 2JN0A 5GMKh 2LCCA 2XMFA 3L2UA 3JCMe 4B43A 1N9RA 4XM3A 2W10A 4RKUE 1FPQA 5EC7A 2QM3A 4D9JA 5J8CA 2W0ZA 3FDRA 1TTYA 2R7TA 2KRFA 4M73A 1P6RA 1XCVA 1H8AC 3M4OJ 3TDUC 5HDKA 2Y30A 3R6SA 3CCJT 3JCMb 2F5EA 5ILSA 5D4RA 2Y4XA 2ED0A 4ZTJA 3O5ZA 2ELJA 3RDVA 1QVGS 2YUNA 3V8KA 5L3CA 1VQOT 1N77A 3I55Q 3HPWA 3LL7A 2A68F 1AU7A 4ELYC 4XLCA 2QBYA 2DPPB 1JQQA 1UGSB 2CZ0B 5I2SA 4BU2A 1MMGA 2MD0A 1ETKA 4HQMA 3HBLA 1WJQA 3WTZA 2DBKA 4KN7X 4EVIA 1WXBA 2HOEA 2V7FA 4PJOC 4G6TB 1X2NA 2BEOA 5H6QA 4D7NA 2XSDC 1QO0D 3EUHA 4LJZF 1SMYF 3IHUA 1IAWA 1FZPB 3G71Q 2E5NA 2BHZA 2GBYA 2VKVA 3KYDB 2LQ8A 2JZYA 4V19K 1BU1A 1J5YA 2AHQA 1EJ9A 4CC4B 3JR9A 1UJ8A 2XV4S 3HKZN 2GXGA 2LOOA 3HHGA 1YJNT 2STWA 2PX9A 3ZN1A 2JT4A 2GBQA 3NWSA 2EV0A 5HDNA 4A3EJ 3BZKA 2DIQA 1VQ5T 4DOWA 3LLRA 2KIMA 4RB3C 1YNZA 2JOYA 5CR2A 2HNHA 1WNLA 2BZ8A 1U2WA 1YW8A 3F6OA 4GYGA 2QBYB 1YX5A 4HOBA 1KONA 4XNFA 4AVPA 2HQEA 3NGPA 4LDYA 3JCMJ 3NARA 3VYTB 1WH5A 3QO3A 1OCCH 1P4XA 1VZ0A 1Y8QB 2FMLA 2HVQA 4XKWA 4EGZA 4XQ3A 1MMSA 3O8HA 2JNGA 2HZTA 4LMYA 4PL6A 3ERED 5J26A 1YJ9T 4YFNF 4NQWB 1IHVA 2C0OA 3KP4A 1MSEC 2ZZDA 3PGGA 3DF8A 4JLIA 3S1QJ 4X9CA 1YIJQ 1K4US 4C8QE 1D0XA 2KNBB 1S1NA 4A4HA 3DEWA 3FK6A 4HNVA 1TSFA 3OR2C 5LEKA 2FYKA 5FJ8J 2H6CA 5GANe 3QHSA 3SDGA 1K73R 3FBNB 2IJLA 1SKUB 2W85A 1LDKB 2FBKA 3D5SC 1TW3A 3VYSB 1X69A 5AONA 1QWFA 2D8HA 2XPUA 3BDUA 3VKIA 3TOBA 3GUDA 5DD4A 4EMKA 1ACIA 5KH6A 3DB3A 2ZC2A 1T39A 3WU2C 1KA8A 2HKXA 3RJPA 3ELKA 2XC7A 4HLXA 5JHFA 3K69A 3CCJI 1X43A 4IJAA 4M7DC 2FQ3A 4F93B 5GJWB 2O9VA 2NYXA 2O31A 2P0QA 3DLLA 3CC7A 4J6YA 5IOZA 3CC4Q 1QZZA 3NAUA 1VQPI 2EFOA 3MJXA 1OX9A 4HBLA 5L3BA 3FDYA 1QMCA 2HYGD 5GP9A 3I56Q 3GEZA 2HYJA 3HOVJ 1VQLT 2DMTA 2K7LA 3CESA 4KUDK 1N8RR 1K76A 1QKWA 3T5XA 1K1ZA 4RGRA 3M53A 1OZ2A 3TOAA 5HOOA 3QP6A 4IUVA 3QWLA 2HVSA 5FW9A 1E2XA 3KE2A 3R60A 4E7LA 2OI3A 3U23A 1X4OA 2QF7A 1K8AU 3CD6T 3ML6A 2J5OA 4I0AA 5K5OA 2VC8A 5FLVA 3CC2T 2E1NA 2K40A 2DT6A 5BQTA 1RNLA 1X1BA 1KHIA 2HYFA 3HIFA 2KROA 3CMAQ 4DOZA 3A01A 2D8JA 3ABMH 3H9NA 1EH7A 2CV2A 2VBYA 2UXNA 3M57A 2VBXA 3SWNC 4FIBA 4RA2A 1JHFA 2W25A 2YU3A 5BPDA 4AG2C 5FLXK 2F4IA 2VE8A 3PO3J 1J75A 1JXOA 1SANA 4UB8C 2DF6A 2B0LA 3K2ZA 2ZJ2A 2IP2A 1VYUA 2HQHA 4OF1A 3PO2J 5CQGA 1YHQQ 3M4GA 2DFIA 5F0CA 1SFUA 1VQ6I 2VJ4A 3I58A 1GXIE 2WA0A 1W7PB 2BV6A 3WE3A 3GTJJ 3S3MA 3NTIA 4RTVA 3OQ5A 4JDSA 4KMUX 3JB9H 3JW4A 4CICA 1YWPA 1NG7A 5J40A 3CJTB 4XRMA 2YXYA 4NB5A 2V1QA 3RUXA 4IURA 1UELB 2XAUA 3K4BA 1ZQ3P 1TQMA 2ECBA 1YQAA 2BBYA 4F7UF 2JK3A 2QK0A 1Z9QA 2XSJC 4DYCA 1B8IB 1G3TA 3DBHB 1LNWA 3RPUA 2XHCA 3LA2A 1B72A 2VIXA 2DA5A 2QA4I 5JI6A 3DFGA 2CT4A 2OZ6A 5H20A 2Z99A 4ME7A 5CQXA 2JXBA 1K6OA 2DJZA 3CUQB 3LA7A 3BR3A 2EB7A 1CF7B 2AS5F 2O8KA 4BJ6C 1ABOA 1H0MA 4M75E 1VQMI 4OVAA 2EZIA 3OR1C 8ATCB 1S9HA 4OMLA 2ZPEB 4HNUA 2R58A 1ZBXA 1W7PA 3CTAA 3HSRA 2ED1A 2KEAA 2DPUA 2IGKA 5EGOB 2MWPA 5I22A 1K61A 2PQ8A 1OKRA 3K9TA 3E97A 2V9VA 3F8CA 3J81K 1QWEA 4RB2C 4M75G 3VS1A 2X4WA 1X4PA 3CCLQ 3S2WA 1ZHIA 2MLGA 2Z3YA 5DUKA 1V5EA 3JB9F 5F04A 3O2PE 4RM2A 3MP8A 2AZSA 3V42A 1YRNA 1DP3A 4MLOA 3OY9A 4IF4A 2IBDA 1XQHA 2A07F 1LQ1A 5GAOl 3CCUT 2JVHA 1VQ7A 1YITQ 1XN7A 4F16A 3ZMUA 1FP1D 1HSJA 4B6MA 1SC7A 2IA2A 3CUQA 1CF7A 4UNOA 3NWTA 3CCUQ 1MH4A 1IF1A 3EETA 1KQ1A 2F4OB 1AVZC 3L9FA 2DXCA 2ZGWA 3EG3A 5I2MA 4M78G 4O5VA 1MUZA 3TBIA 4D8KA 3K0LA 3BPVA 5CVVA 3QG1A 2M34A 3SHFA 1PVEA 5ERIA 3F70A 4N0AC 4PFOA 2CP6A 5C4JJ 2OTJT 3GFLA 1UDLA 5AYFA 3OYGA 3S8PA 1Z05A 2JPCA 2NS0A 3FEOA 5EJCA 5LJ3e 3L2ZA 2KZVA 4DA4A 3H9GA 5GAOq 1YOVB 2MIOA 1ZA2B 4M78B 2GOMA 2CQQA 2LF8A 4D1QA 1QVUA 1PKTA 2M87A 3VSLA 1QVGP 4DYQA 3HFNA 4L0YB 4Z6YA 1VQLI 2O8XA 3K10A 2D1HA 2E36A 1WHKA 3M07A 2M16A 4LDWA 3JCMP 3THKA 3CCQQ 1BM9A 2DNUA 2XDPA 4LDUA 2HFHA 3CCVQ 1GXPA 3ZQ7A 3E0JB 3HRTA 4KUMA 1MJ9A 3UA6A 4BAYA 4CA0A 3EUHC 4QVDA 4LK1F 2DXIA 3GX4X 2JZ2A 1B7TA 1YCYA 4RUGA 1KC8C 3SB2A 4B8XA 3E2UA 3E5UA 1R1UA 2HEOA 2NUTA 2P7VB 2BE9B 1FMWA 1RI0A 1UB9A 2ZXJA 4E4HA 2GQIA 2OF7A 5FWCA 4HLYA 2QQAA 4IUPA 3GCMA 3CCLA 2Y0MA 1FIPA 3PM1A 1ZLKA 3CCYA 4BQQA 2YLBA 5DTDA 2WAFA 3VSKA 2O6GE 1SHGA 2J6OA 1QBJA 4Y92A 2CS3A 1D5YA 1IUYA 2DXBA 3P9IA 3TDZC 3J7AY 1VNDA 2F2VA 4A4KA 1KYWA 1VFCA 1KD1R 2RK1A 1W7PD 1PC0A 4QVCA 2X6OA 3H92A 5KE2A 1SVOA 4GDFA 2E64A 4DZJA 4WCGA 4XLAA 1VQKA 4BXUA 2EJRA 3HP9A 3ZRGA 4F17A 2EKOA 2RGVA 1VQOA 2K9GA 2LJ0A 4BEHA 1ZLMA 3G4SI 4LIUA 3HC7A 3CCRQ 1Y56A 4DJAA 1JHHA 2VYTA 5KYNA 4R0KA 2JRMA 4I7HA 5AIQA 3JCMc 3X24B 1VQ4T 1Q7YC 4F91B 3CMAT 1HKQA 5GTHC 2BYVE 4RTTA 4FX0A 4ZGDB 5B5EC 4FYWB 3CD6Q 1TUGB 3N5BB 4M7AG 1PP7U 3EGDA 3SXYA 3MP6A 2P84A 4Z02A 1OYIA 1F43A 2O88A 1WHUA 1VQ9Q 4N4GA 2HDDA 3I3LA 2IGOA 2BVLA 1G59A 1Y6IA 4D6WA 1Z6RA 4EMHA 3HPGA 5D8KB 4B48A 1A35A 3HTUA 4M3GA 3W2WA 2OTJI 3M1EA 3I56T 2RPNA 1FP2A 3SFZA 1ZREA 2RM4A 4XU1A 3VUBA 1NYFA 2K85A 1JEGA 3RYRA 1WVRA 4XLNF 4NBQA 3MKZA 4P55A 5DUIA 2BTTA 2RD1A 1IW7F 2MI6A 3MP1A 4BEHB 2O3FA 4AFUC 1E6HA 4OMYA 4A5MA 3MPUB 4XTYA 2JMAA 2LKSA 3C7JA 3GLXA 5I21A 3CC7Q 3KFVA 3EG9B 2QQRA 1T95A 2VXDA 2FU4A 2R7QA 3A0BC 4G8XA 4A3MJ 3D5RC 3BE3A 3CLOA 2FD5A 2OTLI 1IO6A 3EGDB 4G6QA 2QASA 2EYXA 3OW2S 3GF2A 1Q86U 2VJ5A 2O0YA 5E8GA 3VOEA 4R56A 4PUSA 3RCOA 2PJRA 3GTQJ 3VS4A 4BY6B 1Q82U 5LJ3h 2EJGA 2Q1ZB 4MNUA 1MD0A 3RNJA 3CPWS 2YUQA 3EFOB 2YSRA 1PYVA 2CT3A 2EJ9A 3W6VA 1RI9A 2M0YA 3JREA 1B6AA 4QQ6A 1SAUA 3GVAA 1WH7A 4RGXA 4Y4RA 1I5ZA 3LA3A 4HX7A 5LRRA 5HDGA 5B3SH 3ZQCA 1HCRA 1M4ZA 2K57A 4AVZA 2P4RA 5B1BH 1WJDA 3QKJA 4QKUA 4J6XA 4OGCA 3IKVA 5M3MJ 3TQ7P 2FOKA 1J2XA 2OX7A 2QQ9A 5DM7R 1BKBA 1S5LC 2R7SA 1H92A 3J81Z 5HS9A 2KDSA 4FASD 4Z8AA 3CCRA 3CEYA 2P8TA 3EGXA 3BY7A 1TS9A 2QQSA 4LIVA 3F22A 3WHCA 5TJJA 4C5GA 2JN6A 1IGQA 4NOYA 3OOPA 2DA6A 2P6SA 3GIBA 1KQ9A 2MFZA 3HOXJ 4P1WA 2QGGA 2CFOA 1K0SA 1K9MC 3BR5A 3DKXA 3LMMA 2DK3A 4HT8A 1H641 2X4HA 5FLMJ 3U2RA 2ZFWA 1JGGA 2VC0A 2H3EB 1M9SA 1Z0XA 2DAOA 5D5VB 3RQ4A 4IHYA 1UUEA 4OP0A 2ZKZA 4Y3OA 3ZGKA 4RMOA 1Y1WJ 3RSNA 5A2QK 1X27A 4XOPA 3LYIA 2O61A 3BQZA 5DY9A 3ZL7C 3TW6A 4CYCA 1R0CB 2CW7A 1HJDA 4I0BA 5LFAA 1IV6A 1HA8A 4F7UB 2M30A 3WHBA 3HTSB 2KDOA 2TRTA 2A7YA 3I5UA 3L2CA 1QVFS 1T0JA 3WG9A 4AUXA 5IY5H 2NUPA 3BJAA 4U87A 1WZOA 1Z91A 1M30A 4ZDOA 3ZMSA 1BI0A 2PUOB 5D4SA 1NTCA 2EGEA 4DBHA 2DRMA 1W5CC 5KCHA 2DJIA 1QW1A 2M2EA 2ABLA 2AK5A 2L9SA 2QDYB 3CMYA 4MZPA 3WVEB 1X3WB 2W00A 1FOWA 4EATA 1RL2A 2XF6A 3HUGB 1BOBA 3OA6A 2ISYA 2RA2A 3H0HA 3CCLT 4RCBA 2NVUB 1JJ8C 4B44A 1JKRC 5DCFA 1XTAA 1HC8A 1N9SA 2COBA 2GFAA 4G94A 1W1FA 4E47A 2RREA 4XAXB 5GMKi 4QPQA 3DWLE 4OU0A 3MKYB 3EPZA 1YW7A 1ZQ1A 2DL5A 3QJYA 3P7NA 4LN2A 3ZEHA 3L2RA 4FE4A 1I39A 3OMYA 4BE0A 2AHJB 3VRZA 1WSUA 4F7UA 4YG2F 1V4RA 1YRNB 2FBIA 1USTA 3HYIA 4LK0F 3K70C 1UG1A 2BY1A 5HNFA 2ZXHA 3KP5A 1YITA 2H8HA 1ZHFA 1BC8C 3RR6A 1BJZA 3CCMI 5F0FA 2XF5A 1HLVA 1T33A 4CCLA 3OSSC 1HXDA 3GTLJ 2LTOA 3E7LA 1K79A 2WSEE 1WI7A 2NYSA 4D8DA 4IEJA 1C1AA 4L5GA 3SZTA 3HUGA 3RESA 5IAYA 1E0EA 2OTLT 2BY2A 1G2BA 1D8KA 3HM5A 2O03A 3BCAA 2LC4A 2E1HA 3AAFA 5IT9Z 1ZUKA 1JBMA 1Y7XA 5KK1A 4DBRA 2NRAC 1U8BA 4A3BJ 3K70D 2LD5A 3E5XA 3OYFA 1ZGAA 2QTVA 2JA6J 3LX7A 4JJCA 4C0GA 3LWIA 2UV1A
chains in the Genus database with same CATH topology
2GQQA 5GAMh 2R3SA 5LEJA 2Y4YA 4L6V5 3QRFF 1IN8A 3PFSA 3TREA 4JUVA 3OYYA 2VODA 2MA3A 2PU9B 2M9UA 2ETHA 2CGHA 5J3BA 3KETA 3QJ6A 3FMQA 5JFRA 2X4XA 3ZBDA 5GAN2 5KCOA 1R22A 1ON1A 2K27A 3MZHA 3ECHA 5FFXA 4BI3A 2EYQA 3G4SA 5F6FA 4XTVA 4M7AE 3K1NA 2P0KA 4M9XA 4LG0A 3PNWC 3WU0A 2CYZB 3WVDB 1ZLJA 3P8HA 2YLCA 3BW1A 5FROA 3E6MA 1XGNA 4FT4A 2XVCA 5CYVA 4EQQA 2E7WA 2FE3A 1UCRA 2H6BA 4XLPF 3S3OA 5GANj