5CVIA

Structure of the manganese regulator slor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
PNKEDYLKIIYELSERDEKISNKQIAEKMSVSAPAVSEMVKKLLLEDLVLKDKQAGYLLTKKGQILASSLYRKHRLIEVFLMNHLNYTADEIHEEAEVLEHTVSDVFVERLDKFLNYPKVCPHGGTIPQHGQPLVERYRTTLKGVTEMGVYLLKRVQDNFQLLKYMEQHHLKIGDELRLLEYDAFAGAYTIEKDGEQLQVTSAVASQIYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SloR structure and DNA binding studies inform the SloR-SRE interaction in Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
molecule keywords SloR
total genus 60
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cviA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cviA02
4OIQF 4GXOA 4LG0A 2F5FA 2RN7A 5ILUA 3P9CA 1KGSA 3P7NA 3WTXC 2ZO4A 3BZ6A 4I7HA 3K9TA 4Z2YA 2HQNA 1FBUA 2DQRA 2Z99A 3CUQC 1IN6A 4EJUA 2CWEA 4OIOF 4ESFA 2QYOA 1SD6A 3GZ5A 4A5NA 5HS7A 2QENA 2P5VA 4GO1A 4FX0A 5IT9K 1T0FA 1FBSA 1R1VA 1MJ9A 5TJJA 5BS6A 3W6JB 1XSVA 3QU6A 2GWRA 5HLGA 1XDSA 4CXFA 5ICFA 2Q0OA 3ZPLA 3SZTA 1SFUA 3R6SA 2EV0A 4AIKA 2NS0A 2OQGA 4KT5C 1BI0A 4M9ZA 4G8XA 1HQCA 1FX7A 3ECHA 2PMUA 1LNWA 4Y15A 3J81K 3E6DA 2KRFA 3GFMA 1KA8A 1FWZA 3RI4A 4IF4A 1YS7A 3KEQA 4EJTA 2XKPA 1YYVA 1CF7B 4CHUA 2DTRA 2WWYA 4ASNA 1W5SA 3TQNA 3J7AO 2IJLA 3KLOA 4XBFA 3GXOA 1KQ0A 3J80K 1UCRA 3FX3A 4MTDA 3WE3A 3V7CA 4BHPA 1SFXA 2ISZA 3ELKA 2VONA 2P8TA 3NRVA 1YTYA 3ML6A 3FF5A 3I59A 5D5VB 4GYGA 5TRDA 1H9GA 2XKOA 4A6DA 3GVAA 5DCMB 1WSUA 5L3BA 1KYZA 5CVRA 5E8GA 2K7LA 3CUQA 3L7WA 4IHSA 2D2WA 1P2FA 1WKMA 3KP6A 4BHCA 2STWA 2XAFA 3WTUC 4ENNA 1R7JA 4XLNF 5HDNA 3RYPA 3WTSC 1R23A 2F5EA 1R1TA 3BWGA 4YFKF 5F64A 5LGNA 4EJWA 3HTUA 4NHJA 3FMRA 4MNUA 4G7HF 3EYIA 2LX9A 2CSOA 1NHAA 3LFKA 5BPIA 2LKPA 2D1HA 1XD7A 4U7BA 5DUKA 3BJ6A 4O3MA 2Q2EA 2CQKA 2Y48A 3TGNA 2K02A 2IW5A 2IA0A 2O3FA 4CICA 2FF4A 5BOXA 3L09A 3PQJA 5FFXA 5KK1A 4LLLA 5D5XB 3RYRA 1J2XA 2OD5A 4KMFA 2BEOA 1XDUA 1LDDA 4KDPA 4OMYA 3LAPA 1REPC 2CYYA 2ADUA 2H27A 1ULYA 3U9GA 2GCXA 1WRJA 4ESBA 1ZRDA 4P9UA 2R7FA 4A6EA 1BIAA 2IP2A 1MD0A 2HTSA 3JSOA 2GAUA 1BC7C 1R5HA 3G3ZA 2RVCA 5DCFA 1Z6TA 3K1PA 2A69F 1MKMA 4M74A 2DFIA 2CGPA 1QVPA 2L3DA 2Z9OA 2XHKA 4L9VA 1IAWA 2PLYA 1U5TC 5HLIA 2DK8A 4F7ZA 4KIFA 4WXHA 5IT9Z 3MWMA 4U7DA 1G3TA 1YFHA 5HS8A 3I5UA 3M9AA 5LEJA 2L4AA 4HLXA 4L0YB 2M30A 1P92A 2IA1A 1XCBA 3FZVA 3IL2A 2DPUA 4N9HA 4IXAA 4BYYA 3H3ZA 2WTEA 2OBPA 2XUBA 2FQ3A 3EQLF 5BPDA 1D8KA 3HSEA 2RC4A 5LHHA 3EYYA 2C6YA 2O8XA 2G7HA 4ENJA 3LQQA 1HSJA 5K5RA 3LA7A 4L0ZB 2HTJA 3QP5A 3FMQA 1BN5A 3R0JA 4LGWA 1ZYRF 4BXUA 1BOAA 1IN8A 4IHTA 2IPQX 1FSHA 4I01A 1RNLA 1MDMB 3E6CC 2H6CA 4N9IA 1B9NA 1U6GA 1FZPB 1PUEE 3ROUA 5D8KB 4EM0B 3IRRA 1UB9A 2K5LA 2QM3A 2DLLA 3E97A 4R1HA 1W7PA 2DO7A 3IWFA 4IRGA 2JSCA 2BE5F 3TKYA 2VE9A 2ZXJA 4WF2A 3SFZA 5DDGA 3T8RA 2P5KA 4LG0B 1A04A 5J8CA 3MEXA 2GA1A 1JXSA 2H3JA 1USTA 4M72A 1TBXA 1O3TA 3FHZA 1XCVA 1OPCA 2BYVE 5KVRA 2W85A 5HDGA 3AAFA 3KLNA 4I98B 3GFLA 5HLHA 1J0RA 2E7XA 3O2PE 2M45A 1WWXA 1H0MA 2VODA 1EH6A 2EFQA 2P6TA 1T38A 4WWCA 2HYGD 4Y13A 5L3CA 5FD6A 5FGMA 2MH2A 5ILVA 1USSA 1F5TA 1XB4A 1O7LA 2RQPA 4KMUX 3CLOA 4RS8A 1P4AA 3CTAA 1U5TA 3GWZA 1LEBA 1SMYF 2MA3A 4G6DA 1I1GA 2FU4A 1F4KA 2CG4A 4XSZF 5E1ZB 2ZJ2A 1Z6RA 5HVQC 4A0YA 2FXAA 1YO5C 2M87A 4UXNA 3FWEA 1RZ4A 5DD8A 4U0YA 4Q4ZF 5ERIA 2M1BA 4XLPF 2FA5A 2ESNA 3QPHA 1SD5A 3DV8A 1QPMA 2VC0A 2QBYA 1CF7A 1DP7P 1YS6A 4P5OA 2GZWA 3W6KB 4P9FA 2DBBA 5LGUA 1X3UA 3GFIA 5D4SA 3HHHA 4HLYA 4BH9A 3F8NA 1HKSA 2J5OA 3OV8A 4KICA 1KU2A 1OYYA 3ZN1A 4PGHA 2VT3A 1MJBA 2P5LC 4L5IA 4HOBA 2NNNA 4B8XA 1FSEA 3QPTA 2FNAA 5E8IA 3BROA 1SMTA 2UZKA 3ZQ7A 4I2OA 4MHGA 1L3LA 1Y0UA 2A5YB 1C0WA 4KN4X 3ZMTA 3M1EA 4UVCA 5BQTA 2O61A 1ZGJA 5L3DA 3DP7A 3K69A 1SD7A 1ZG1A 1Z05A 3E5XA 5L3EA 5LHGA 3F6VA 2Y0MA 5E1XA 3V8JA 1XGOA 2EWNA 1RIOH 2XRNA 4U88A 2XIGA 1CGPA 2HZTA 3HHGA 2RNJA 3BOQA 4RB2C 4HQMA 3K1MA 2FEZA 2PQ8A 3C3WA 4M9XA 4EQQA 1KQ8A 2OA4A 4EVIA 1K7AA 3EDPA 5AONA 2KIUA 5CVVA 5DYMA 1QW1A 1GXQA 1UHMA 4E70A 2DT5A 3QRFF 2XAHA 2KJCA 3M8EA 5AIQA 4RGRA 2EFWA 1XSDA 4A5MA 3O6BB 2PMHA 4OINF 2YX4A 4HZFA 3C18A 3H3UA 4U0VA 3WU1B 1P4WA 1HKQA 5ICEA 3TOBA 2X4HA 3WTYC 2ZBKA 1TW2A 2B0LA 2EFPA 3OOPA 3GEZA 3GX4X 2W25A 5ED4A 1HBXG 1VTNC 4UNOA 3QOPA 3R0AA 3ISPA 1Z91A 3KCCA 1QO0D 1S29A 4WXCA 4HF0A 2PEXA 4AIJA 3IC7A 2G7UA 3F21A 3HUGA 4BNCA 4LK0F 1SFEA 4HX7A 4JBAA 2ZNZA 4CYDA 3FXRA 3F3XA 4RB3C 3D5LA 3JW4A 3SHFA 1U3EM 2AS5F 2K86A 3DQVC 4A2UA 2ZKZA 5JFRA 2BV6A 1XMKA 3E3VA 3HOSA 4RAYA 5J6XA 1ZARA 2M5WA 5H6RA 1EH8A 2EFNA 2NYXA 3WGGA 1BBYA 1B4AA 2IA2A 2QLZA 1ZGAA 4M71A 1WI9A 3F8CA 3HRUA 5LEKA 3WTVC 1DPUA 1S8NA 2ACJA 1J5YA 3GF2A 2PBIA 3V7RA 2ETHA 1DDNA 2LF7A 2P7CB 1W5TA 4OMZA 4AIHA 3RPUA 3SQNA 3K0LA 1IN5A 4UUVA 3F8BA 3BPVA 4XRFA 1HKTA 4EM2A 2LSOA 4CZZA 3DEUA 3MZYA 2G9WA 3IRQA 4RAZA 5JR3A 3ZMDA 5HOOA 3C7JA 1LDJA 1O7FA 4RGXA 4G7ZF 4HDVA 5D6EA 4M6XA 3I64A 1ZRFA 1IUYA 3V8LA 3F6OA 1GHCA 4G9YA 5CLSA 2A3SA 3LQRA 2O6GE 5JI6A 1HXDA 3WTWC 1BI1A 2KIFA 5E1WA 1IRFA 4Y17A 4WXDA 3IKVA 3REOA 1EV7A 2CW0F 1I1SA 3I58A 3ZMZA 1IXSB 4FX4A 4LLGF 2R3SA 4P96A 4EJVA 4GYIA 2V1UA 3F72A 2VXZA 3MHXA 2WC2A 2PJPA 2X0LA 3F22A 4EGZA 5ICGA 1V3FA 4YIIA 3FMSA 3ABUA 2XV4S 3TO9A 1B6AA 3BP8A 3J81Z 3NEUA 1E17A 1ON1A 2PG4A 2FBKA 4YFNF 1K6OA 4KYWA 2MC3A 3ZMVA 3KP7A 1S7OA 2FMYA 1G6NA 2QVOA 3JTHA 4BAYA 1XMAA 2H94A 1FY7A 4KA4A 2W84A 1YW9A 1ZAOA 2CFXA 1R58A 2PFBA 1ZLKA 1YW8A 1P4XA 1ON2A 5D5WB 4KN7X 2EV6A 2EA4A 2A07F 4O5VA 1S7AA 3I71A 4L9JA 4Q48A 1IW7F 4ZYHA 2J5PA 2QQ9A 1QQIA 1XGNA 3N97A 1HW5A 4HX4A 1FP1D 1STZA 2K4JA 1BC8C 1IZ1A 2GIVA 3J80Z 2F5DA 3B02A 2NNYA 2QQBA 3ERED 1BM9A 1U5TB 5FO5A 1D5VA 1FLIA 2QUFA 3EUHA 3D0SA 5ILSA 3KP4A 1LJ9A 5FD5A 1I6XA 3HYIA 1RUOA 1I27A 4A12A 1R00A 1JHFA 3B73A 3E5QA 1FOKA 3K1NA 1G3SA 2L01A 1ZG5A 2XAGA 3T0YA 2BBYA 1I5ZA 2QBYB 1T39A 1FYMA 2H09A 2D1VA 3H92A 1H9TA 1QGPA 1R36A 5BMZA 3MCZA 2QQAA 4ENKA 1W7PD 2NAZA 3ABTA 2STTA 1ZREA 2HQRA 2JPBA 1IXRC 5HDKA 1F9NA 2E1NA 2IT0A 4HBLA 3CO6C 1KU3A 3WODF 5CVJA 1D8JA 4XSXF 2ELHA 5A2QK 5H20A 3ULQB 4EV0A 4ZYDA 3VFZA 2XASA 3JSPA 3R60A 5JHUA 3CUOA 4KNYA 4MGRA 1FPQA 4MQVA 3IKTA 5F1RA 1XGSA 3U1DA 4Q5SF 3MZHA 2UXNA 3CDHA 1WQ2A 2LF8A 4HQEA 3DFGA 3DPLC 4RB1A 1J59A 3M8FA 3VB2A 4FT8A 1YLFA 2V1DA 3I0TA 4UVAA 5D4RA 3HTSB 1TW3A 2HOEA 2HYFA 2XVCA 4K2EA 3GLXA 2WV0A 2H6BA 1O3RA 1W4MA 4BHBA 1U8RA 1AOYA 1K78B 2GXGA 2K5IA 3DPTA 1E2XA 4HF1A 4YG2F 1HW2A 2Z3YA 2OQRA 2UWMA 2GXBA 2VOOA 3V7SA 1O57A 2EV5A 4EM1A 3ECOA 1LDKB 4D0PA 4ZYGA 2HFHA 2JPCA 1ZHFA 2OZUA 3I54A 1XN7A 5D8LB 3E6BA 4ON0A 4HX8A 1R22A 5LHIA 4ZYEA 1TLHB 5FLXK 3VODA 3KFWX 2KJBA 4AWXB 1FYKA 2JRTA 2V9VA 3G73A 4AD9A 3I4PA 5K1YA 4HYEA 1T2KA 4L18B 3MQ0A 1FYLA 2HWVA 3Q9VA 5IT3A 1TQIA 1JHHA 3KP2A 2FMLA 4L5JA 4O6JA 1L0OC 1IF1A 2D45A 2E7WA 5A2QZ 2ZMEB 4A0XA 2FRHA 2OAZA 3HRMA 2DPDA 5FB2A 2Q8KA 1RI7A 1KYWA 1OKRA 2A61A 1OYIA 2VC1A 4S04A 2R7DA 4KIGA 4JQFA 4UHTA 2ESHA 2HR3A 3CJNA 1LEAA 3KE2A 3R61A 2XAJA 3WE2A 3F23A 4RGUA 3F8FA 3RKWA 4YIFA 4CGZA 3T1BA 4OIPF 1Z7UA 1U78A 4MEXF 1UHWA 1QBJA 3FXUA 4YFXF 3S2WA 4M9SA 5JVTA 1HSTA 2TDXA 5L3GA 4UVBA 2HKXA 3GFJA 1K79A 3CO7C 3LSTA 4ZH4F 1QZYA 2L54A 5F6FA 5FFZA 2HEOA 3KZYA 1FNNA 5DEQA 3WG9A 1YW7A 1BYMA 1XSXA 1J7KA 2ISYA 3QU3A 2W57A 1TNSA 2XGXA 5DUIA 1OR7A 3L2CA 1AWCA 1YIOA 3E5UA 4N0BA 1FC3A 3T5XA 1PP7U 1F1ZA 2YX7A 3GW2A 3WU0A 1LVAA 3DXJF 4IPAA 2AXLA 3LAJA 3E19A 1JGSA 5CYVA 4H0EA 1YG2A 2MD5A 3MFKA 1ZRCA 2XROA 2FNPA 4R8HA 4U0WA 1BIBA 5FLXZ 4G7OF 1D3YA 3VEPA 2HDCA 4QLCU 4I09A 5LLQA 4IJAA 2RKHA 4IVNA 5D6FA 1PP8F 1BI3A 1PDNC 1TQMA 2EK5A 2OU2A 5LRSA 2RV8A 4S05A 4LJZF 3IHUA 1MJAA 4CO8A 5E17F 2DK5A 4I0AA 3ZMSA 3BJAA 3RKYA 1FP2A 1KU7A 3EETA 2QWWA 4NQWA 3TOAA 2YSRA 3V8KA 1R5GA 2V79A 3ZP5A 4HW0A 2YPRA 4NB5A 4OOIA 4PGGA 4LD5A 2MLKA 5ICCA 4UV8A 2P4WA 2FBIA 3LA2A 2DI3A 3FXQA 4Q47A 2VBWA 4EGYA 3GUDA 2DAOA 3SZPA 4R79A 2ZNYA 3WTTC 1OYWA 3RPQA 2Y75A 3DF8A 1O3QA 5L3FA 2E1CA 2VT2A 3WGHA 4KIBA 2P6SA 3NQOA 4CDGA 1R1UA 1EH7A 2K5FA 3RTRA 5AIPA 3JTGA 3E6MA 2GQQA 1RUNA 4IRHA 3RKXA 2HS5A 1ZH5A 2W24A 4LK1F 1QNTA 4AVPA 5H6QA 3PQKA 1Z9CA 5EEGA 3K2ZA 6PAXA 3I53A 4GGGA 2FBHA 2ZCWA 2A68F 4HF2A 2EB7A 5LBQA 4LMYA 2EJRA 2O03A 1O3SA 3I59B 4PDKA 2K27A 3RIRA 2KKOA 2F5CA 1Z1DA 1J75A 4MTEA 3HSFA 1B9MA 5DCMA 3HRSA 4HV5A 3RJPA 3CUQB 4HAMA 2HGCA 4LLNA 4BQAA 1LB2A 2PN6A 3QP6A 4MEYF 3R4KA 1ZN2A 3COAC 1U2WA 4UV9A 2DU9A 2L4MA 4EJOA 3SXYA 2A6EF 4DNCA 1B1BA 3C1DA 1ZLJA 2VBYA 3JAMK 4A0ZA 2M8EA 3BDDA 4I0BA 2K4YA 3HOTA 3GZ6A 1TQPA 2JZYA 5K5QA 2FOKA 3HSRA 4P55A 5DD4A 1IN4A 2F2EA 2KIMA 3QAHA 3BY6A 3JAMZ 3BJOA 1K78A 4B09A 3WTZA 1QZZA 1BI2A 2NRAC 1T6SA 1SD4A 2CO5A 2EFOA 3WGIA 1TNTA 1YQAA 1OMIA 3LA3A 2PI0A 2VBXA 5D5UB 2O0YA 3T8TA 4L9NA 3Q9SA 2VOPA 2OZ6A 4GCVA 1HW1A 3DKWA 1G4DA 3KEOA 4KFCA 1S3JA 1JE8A 2P7VB 4KUMA 3KETA 4QWQA 4FHTA 3LWFA 2VN2A 3N4MA 3ZN0A 3TO7A 4ESJA 2DW4A 3RDIA 5LRRA 2COMA 3PFIA 4I02A 3P9IA 3F8MA 2IRFG 1IXCA 1MZBA 1ONVA 3M7GA 3TDZC 3TDUC 4M6YA 3FM3A 5CVUA 2BGCA 2JT1A 3O3KA 2K4BA 1IN7A 5EEHA 2MBFA 4HV6A 2ZMEA 3HIFA 5K5OA 1P6RA 4WCGA 2RGVA 2GA2A 2MLGA 2LNBA 1KU9A 2DQLA 2Z5UA 4LFUA 2ZFWA 3KP5A 4JK1X 1BJAA 1MGTA 4M73A 1B59A 1GXPA 3KP3A 1FBQA 1IRGA 3VOEA 4RGSA 3GO5A 3TO6A 1ODDA 1SAXA 1FT9A 3U2RA 3L9FA 2L02A 2JTVA 4RB0A 5CVIA 3L00A 3IWZA 5HS9A 4MQ9F 2MH9A 2XAQA 3HRTA 3V4GA 4LB6B 4LB5A 2UXXA 4G94A 1T98A 1G3WA 1ZG3A 2A6HF 3BPXA 3KZZA 4IRIA 4ZZLA 2LDUA 4WX9A 2V1XA 4L9TA 1GVJA 4TV7A 2FE3A 3ZMUA 4EMSA 5E18F 1TTYA 1UFMA 3MAJA 2V6CA 4OIRF 1XGMA 2RDPA 4WK8F 3GYHX 4HDUA 4ENMA 2FSWA 4OU0A 2Z33A 2YR2A 3FM5A 1LQ1A 2VBZA 5DV5A 4ETSA 4DQ2A 1MDMA 2EA2A 1V4RA 2VE8A 5LGTA 1KQ9A 4G6QA 1G3YA 1S6LA 3P9KA 4PZJA 1DUXC 1DPRA 1J9IA 4ZZDA 2IVMA 2YU3A 1Q1HA 5J8FA 1W7PB 5E20A 4HA8A 5CJ9A 2HKOA 2QZ8A 3Q5FA 4PCQA
chains in the Genus database with same CATH superfamily
4DBFA 4M77G 1BJZA 1SSHA 4OIQF 2K3YA 5IAYA 5BNGA 3GP8A 1VQ8Q 4QQ6A 1N25A 2VKHA 4GXOA 4LG0A 1M1KR 5F0CA 2F5FA 2RN7A 2WA0A 1VQKT 5ILUA 3P9CA 1B8IA 1PSEA 2JA2A 4FYXB 2CP3A 4OVAA 1KGSA 1SVLA 1ZUKA 5KE2A 2RI5A 4F55A 2XDBA 1H3HA 3LW5E 4DGWB 3P7NA 5IOYA 1UG2A 4J9IA 2XK0A 3WTXC 3HXLA 2P0PA 2LH9A 2ZO4A 5TISC 1A36A 3META 3BZ6A 4I7HA 3A2KA 4AMCA 2MF2A 2LYCA 4PJLA 1IRXA 2LP5A 3K9TA 2BHZA 2HQNA 1FBUA 4Z2YA 3VUZA 4KGZB 2DQRA 4X9DA 1Z3YA 2Z99A 4PKCC 4DEXA 2HEQA 1WI3A 4ZGJB 3QYEA 2CP2A 2XF5A 3CUQC 1IN6A 4EJUA 3S16J 4J9CA 2V1QA 4LDUA 2CWEA 1YHQQ 4HT8A 3H41A 3M1CA 4II3A 1IB8A 2F69A 4OIOF 4ESFA 4ABZA 2QYOA 1SD6A 1Z21A 3INZA 2XAUA 3GZ5A 1VA7A 4A5NA 3CMET 4IL6C 5HS7A 2V8JA 2QENA 2P5VA 2EIKH 1K76A 4GO1A 2D8JA 4NQWB 3REAB 4FX0A 3G6ET 1W2BS 3LMMA 4CYCA 2BVMA 5IT9K 1T0FA 2L3PA 2DTIA 3CMAQ 1MMDA 3GIBA 2B7EA 1FBSA 3BR5A 1VQOQ 1R1VA 1JQQA 3BZCA 4J19A 3E7LA 3QYBA 2DFHA 3CDLA 1WQWA 1MJ9A 4DIQA 4CCKA 4F04B 5TJJA 2CQQA 2VPRA 1PG5B 2HXIA 3I56A 1UMQA 1YI2A 3DTEA 1GUUA 3W6JB 1FIAA 5BS6A 1XSVA 2CV2A 3QU6A 3CCVQ 3VV0A 1GL5A 2GWRA 3EG2A 1E6GA 4F3QA 1PRMC 4H4KC 2YRCA 1RPWA 2L5QA 5HLGA 2MAMA 1Y56A 2PU9B 2JA7J 1XDSA 4CXFA 1FJLA 2E6NA 5GANg 4QVZA 4M7DD 5ICFA 3HOXJ 1S9HA 2Q0OA 3RUXA 3ZPLA 3M53A 3FDRA 3CCMQ 1V54H 2HYJA 1K83J 3ZQQA 1YRNA 3SZTA 2QGUA 4KT0E 4EMHA 1SFUA 1V76A 1WJFA 3I3LA 2P84A 3R6SA 2EV0A 5M5WJ 4EEFG 4AIKA 2XD0A 2L2PA 2NOJB 2NS0A 5GMKi 2COYA 3HP9A 1NEBA 4C92G 2OQGA 4KT5C 1WHJA 3H5NA 4EMKA 1BI0A 2FQ4A 4M9ZA 1BL0A 1M3BA 1VQNA 4FT2A 1UAAA 5IY5H 1I5OB 4G8XA 4MFEA 1HQCA 1FX7A 1GCQC 1W6XA 4CH7A 1X01A 3ECHA 2VKDA 2BZYA 2HNHA 3MKZA 2VXDA 3S93A 3H1CA 4XKWA 2PMUA 3MEWA 1LNWA 4JP0A 4NUBA 4Y15A 1BW5A 2DJQA 2RNGA 1YIJI 4JUVA 1VIFA 2OTLA 2DD5A 3QKJA 2HD0A 3JV3A 2VYTA 3J81K 1VQMQ 3E6DA 3H9NA 2KRFA 1YJWT 5B3SH 1MIJA 3GFMA 1YITI 2MFZA 1KA8A 3PIPA 1OQYA 4J7FA 3M9QA 4RTYA 5CKDA 1FWZA 1AT1B 1Y0MA 2LREA 3KZIC 3RI4A 3RDVA 2RN8A 2D1XA 1B72A 1QP2A 1AZGB 5GTIC 4IHVA 2ECZA 4IF4A 5C3EJ 1YS7A 1OISA 3KEQA 4XQ3A 4NC6A 4XN3A 5FROA 1OU9A 5CR2A 2AXTC 5GAOn 1VZ0A 2EIFA 2KK4A 4EJTA 5E3OA 3S15J 2QKLB 3Q1JA 2XKPA 1YYVA 1CF7B 4CHUA 4TVRA 5DS9A 4IOCF 2DTRA 3CMYA 3MP6A 2WWYA 4ASNA 4J9GA 1W5SA 3TQNA 3J7AO 2A08A 5FU7B 3LNQA 1CKAA 2JZ2A 2O8KA 3J7AY 2QSFX 5LJ5h 4N4IA 1QVGA 4KISA 1JEGA 1WHGA 2IJLA 3KLOA 4XBFA 3GXOA 1KQ0A 1BKBA 4XR6A 2KYBA 7AT1B 3J80K 1UCRA 5LJ3j 3MZ8A 4M3EA 3FX3A 4X1EA 1YN8A 2COBA 4D7NA 1WZOA 3UATA 1CQTA 4MTDA 3AG3H 1VQ6Q 1TZLA 3OMYA 2M51A 3WE3A 3ASKA 1WZ2A 1W2BP 2ECCA 3DEEA 3RBBB 1PRLC 1X1PA 3V7CA 5C0MA 3A1YA 4BHPA 2EYXA 3ZOBA 1SFXA 2ISZA 3KXTA 3ELKA 4FIBA 4KGXB 1QVUA 3KUFA 1WA7A 3AFHA 2VONA 1NG6A 1XTDA 2P8TA 4FYVB 2CV0A 1IHVA 3NRVA 1A6IA 1XC5A 1YTYA 2FB7A 3CCUI 3HOYJ 2CH4W 2K40A 1AHDP 3ML6A 5GAMh 3FF5A 4BJ6C 3I59A 2JRMA 1NJIU 2UUZA 2EW3A 5D5VB 4GYGA 5TRDA 3S6WA 1H9GA 2XKOA 1N8RU 1JT6A 2FHDA 1QU3A 1D1CA 2XGDA 4A6DA 2FG0A 4OAYA 2OF7A 3QWLA 3ULRB 3GVAA 1F36A 5A0GA 5FKNA 3H9QA 2YT6A 1NPPA 2MMPA 4HVUA 4LE9A 2HQ5A 5DCMB 1X1AA 2RQQA 3S8PA 1WSUA 2EZKA 2IIMA 4LNPA 5L3BA 4M4ZA 3RR6A 3QOEA 1T0JA 3SDZA 1KYZA 5CVRA 5E8GA 2K7LA 4IURA 5EZHA 3CQZJ 1B34B 3CUQA 4C30A 4D7MA 4JZ3A 3L7WA 1ZK8A 2O01E 5FKKA 5I21A 4IHSA 5L8RE 1K0XA 3H36A 2D2WA 1GBQA 5HLTA 1SF9A 2DMOA 3QYGB 3KEYA 2ID6A 4Z8AA 1P2FA 1WKMA 4C92F 3KP6A 4BHCA 2HL5C 2STWA 2GQVA 5GMKl 2XAFA 2J06A 4RTUA 3OS1A 5HNHA 1Q7YU 2TCTA 2EBIA 3WTUC 4ENNA 2E5KA 4B48A 1T0FC 3G4SQ 1R7JA 1Q86C 4XLNF 5HDNA 3RYPA 1SFKA 2H8WA 2V9KA 2Z16A 2EQJA 3M8JA 3WTSC 3W3CA 2V8KA 3E2UA 1R23A 2F5EA 3RMQA 5GPCA 2OUMA 1R1TA 1VQLA 3AL0B 1VQ7T 1OPLA 5GAOl 3M4YA 3BWGA 4MO7A 3M0PA 2LRDA 4BGDA 4YFKF 3ABLH 4A53A 1YJ9Q 5F64A 4HCKA 5GAEJ 2BTTA 1K4SA 4OMQA 3OS2A 5LGNA 2QA4I 1LFBA 4YEJA 5HK0A 4EJWA 1OX8A 3HTUA 4NHJA 2IGNA 2L9RA 2ESWA 4J9HA 4KULA 5FW9A 4ZN1A 1VQKQ 3FMRA 3HOWJ 4MNUA 3EGXB 1KSWA 2WSCE 2EINH 3BR6A 2WSFE 4C92B 3OYAA 3PNTA 2Y31A 4G7HF 3EYIA 2LX9A 3CMEA 2CSOA 3BTCA 3JRHA 1YIJA 1NHAA 2HCKA 3M59A 2JK3A 3LFKA 2OTLI 2E6ZA 1NG7A 2OI3A 1S5LC 5BPIA 1JI8A 2DK3A 5F0HA 2A36A 1KZHA 3C4SA 2HAXA 2LKPA 4XKBA 2D1HA 3VSKA 4BUGA 1XD7A 4HKEA 4U7BA 2QA4T 5DUKA 5CKFA 3BJ6A 4W1UA 4O3MA 2AKKA 3NTHA 3X28B 5DLOA 2D6FA 2Q2EA 3QJYA 4R55A 1E3HA 2CQKA 4E7HA 1QVGS 2Y48A 3QXEB 3TGNA 3BG7A 2DNUA 3AHUA 3TSWA 1ZLMA 3LSPA 2K02A 2IW5A 2IA0A 2O3FA 3LH0A 5FKOA 4CICA 2HBPA 2OX7A 2FF4A 9ATCB 5BOXA 1D0ZA 3G1JA 2JJ7A 3L09A 1QZEA 2RHUA 1AKHB 2M4GA 3X24B 3X26B 3PQJA 3FXLA 5FFXA 5KK1A 2O9LA 4LLLA 4F52A 5D5XB 2V8IA 2R7SA 5A2QE 4A3FJ 3HOUJ 1JGGA 3I4NJ 3CCSQ 1VQ5A 5EC7A 4BY6B 4DOVA 2R92J 1BCOA 5GJVB 5GAN6 3TP3A 3S1NJ 5J26A 3JCMQ 3OSSC 2KMUA 2HPMA 4F14A 3RYRA 2E1HA 1PUFA 5GAMe 3CCQT 1J2XA 2OD5A 4KMFA 2R7OA 2BEOA 3A01A 1AU7A 1ZKGA 3NHNA 1WFXA 3LFUA 1XDUA 1LDDA 3ZQGA 3GTJJ 5EDNA 5IYCJ 4RLFA 4KDPA 4OMYA 1W70A 1M3CA 4E2FB 3EH2A 3LAPA 1REPC 1NBEB 2CYYA 5CQGA 2CS7A 3CCMT 2ADUA 1KC8U 5B5EC 2H27A 1SANA 4XLCA 2ZXWH 3LWHA 1X2MA 1ULYA 2CFOA 3U9GA 2RO0A 2GCXA 1G5VA 1WRJA 4ESBA 4LDXA 1ZRDA 4E4HA 4HEA2 4ZTFA 2RREA 1GT0C 4P9UA 5EF6A 2HQAA 1VQ9Q 5LJ3d 1BB9A 1NEGA 2R7FA 4A6EA 4M78G 4D6WA 3H9GA 1BIAA 2ZCFB 1LCKA 4RKUE 2IP2A 1MD0A 2FL7A 2LBFB 2X4XA 1SAUA 2HTSA 3OYLA 3MKLA 2LOOA 3JSOA 1GVDA 2GAUA 4AIDA 1BC7C 4IOAF 1R5HA 4PSWA 2FRWA 2F5KA 3G3ZA 2GFAA 2RVCA 1BBZA 4DYRA 5DCFA 1MMNA 3OYMA 1JB0E 1SRLA 3T9NA 1Z6TA 3K1PA 1YJNA 2A69F 3NMZC 2GOMA 1MKMA 1E3OC 2CQNA 4M74A 1I6HJ 4XK8E 2DFIA 2CGPA 1QVPA 1Y96B 4LDWA 2L3DA 2Z9OA 3KX2A 2NUPA 2XHKA 5KE3A 1ZSZB 3C0CA 4LOCA 4ZNXA 4A4KA 3BTJA 4PUSA 3OW2P 5F1JA 2PVOB 1M90U 2L8DA 4L9VA 4ZN3A 1KQSP 1LFPA 1IAWA 4GDFA 1PNJA 2PLYA 1VYTA 5GAMd 4X34A 1U5TC 1HYOA 1N9RA 4CC2A 4PFOA 3L1AA 4C2MJ 4BDZA 5ECAA 5LJ3f 2D8HA 3K2AA 3CC2A 1ETQA 5HLIA 2LKSA 2DK8A 3HDDA 4F7ZA 2O9VA 4ZTJA 2A5WA 1ETYA 3M58A 4KIFA 3ERMA 5DTDA 4WXHA 5DM6F 5EGOB 2IBDA 5IT9Z 3HZJA 1VOMA 1Y8QB 1WX6A 1YWOA 3MWMA 2DXTA 4U7DA 4NOYA 2M02A 3FB9A 1G3TA 3CDIA 4JYKA 4MLOA 5HS8A 1YFHA 3I5UA 3S17J 3M9AA 4CZCA 2L4AA 2DN0A 2LMDA 3OL4A 5LEJA 3SWNC 4HLXA 4D1QA 2L3RA 1LKXA 1JO8A 3CZ6A 2JTMA 1AHJB 1WI7A 2ZPBB 4EMKC 4L0YB 1YJWI 2J6KA 3HFOA 2M30A 1K73C 2P0KA 1HDPA 3FXJA 1SVOA 1P92A 4OMOA 5B1BH 3JB9G 1RR8C 2OC6A 2ED0A 3DLMA 2ZSHB 4OP0A 3KYCB 1NJIC 3M4OJ 4BY7J 3WG7H 3F9KA 1VQ6T 5B66C 5I2SA 3IP4B 1VQ5Q 2IA1A 2DL5A 1KJWA 1XCBA 3FZVA 1ENHA 3SWNB 3JRAA 1QKWA 1OPKA 5M9OA 3HGGA 3EG0A 1X2KA 3IL2A 1A31A 2DPUA 1N9SA 4YELA 2ICWG 3ZEHA 4N9HA 4A3JJ 2WADA 1VQKI 4IXAA 4BYYA 3RKQA 3H3ZA 3R6OA 1WJSA 3P8DA 2WBMA 2HXOA 2WTEA 4AFQC 4NL3A 1FYNA 4OWRB 2C0IA 2CZ7B 2OBPA 2XUBA 4AYBN 2J7IA 1QVTA 4Z6YA 4BQOA 1ZTRA 2FQ3A 3EQLF 3SD4A 4CUGA 3CBPA 1SEUA 5BPDA 3RSNA 1D8KA 3HSEA 2NS8A 1VQLT 2DKGA 1JJ2A 4PFPA 2EYWA 2HVSA 2RC4A 5LHHA 3EYYA 1ITYA 4B9WA 1VQ9A 2HVRA 1ZA2B 1P7JA 2C6YA 4YRVA 4CCJA 2CMPA 2G7HA 2O8XA 4ENJA 2DTZA 1WHMA 4C8QB 5IP7J 1I0CA 1YITQ 2AIRB 3Q0UA 2DF6A 4PJOG 3C12A 2PMZN 1S72T 1WPKA 3DKXA 3LQQA 1UGQB 1HSJA 5GAOm 1X19A 4C0GA 3CMAA 5K5RA 5FLVA 3LA7A 4L0ZB 2HTJA 3QP5A 2DILA 2HQEA 2Y90A 3W2AA 4J01A 1WGSA 4HNTA 3FMQA 4BEHB 3JB9F 1NZ9A 1BN5A 1D0YA 3QUIA 3R0JA 2OTJQ 4LGWA 2ENMA 4RAGA 1ZYRF 3DWLE 2P81A 4BXUA 1BOAA 1B7TA 3GTMJ 2EILH 3MKDA 2DM1A 1IN8A 2HOSA 2DE0X 2EBPA 1EIFA 4IHTA 3CC4A 2IPQX 1FSHA 4HG2A 4I01A 1VQKA 1RNLA 2NUTA 1ETXA 3E6CC 2H6CA 1MDMB 3CCJA 1H3ZA 2DJIA 3DTKA 4N9IA 3JRIA 1BR2A 3H35A 3CF5F 1B9NA 1U6GA 1K8AC 1FZPB 4EIKA 1K4TA 2FRYA 1PUEE 3EGUA 3QZ9B 3ROUA 3CCEQ 5E79C 1ZQ3P 5D8KB 2LY9A 1N6AA 2JN6A 4EM0B 3IRRA 1UGPB 2EYYA 2NUZA 4BD3A 1YJ9T 1UB9A 1UHSA 3HPWA 1JJ8C 3ZGKA 2BZXA 4XONA 4FISA 2K5LA 3QBYA 3L2RA 5B1AH 2QM3A 2DLLA 2JOYA 4M7DA 2DT6A 3K4BA 5KAFC 1SEMA 1QHHD 3WVEB 3E97A 3FBNB 4NC7A 4R1HA 1W7PA 3M55A 2Y0SA 2DO7A 3IWFA 3DLLA 4IRGA 2JSCA 4M77F 2BE5F 1JUMA 3TKYA 3G71T 3A0HC 2VE9A 2R5YB 1E7OA 4C5IA 2ZXJA 4FW2A 2WAEA 1VQ8A 1NYGA 4WF2A 3SFZA 4OB3B 5DDGA 3T8RA 1GLNA 1FOXA 2P5KA 4LG0B 4RCCA 3ZQIA 1JRIA 4RMOA 3V42A 4A63B 1A04A 3VSLA 5J8CA 1FMVA 2GA1A 2MG4A 3MEXA 1JXSA 2E65A 1B8IB 2YDLA 3VU3C 4OMMA 2H3JA 1USTA 3VS5A 2PJRB 3IH3A 4DOWA 3D1NI 1I50J 2FJ1A 2HMAA 4IUVA 4KGVB 5IT9E 5C44J 4M72A 1TSFA 4M78F 1TBXA 1YHQI 2CZ1B 1UECA 4XKVA 3KPHA 3G71I 4E7IA 1O3TA 2ZC2A 2RNAA 2VL8A 3FHZA 3MPUB 4Z89A 2DPPB 4EATA 1BK2A 1Y57A 1XCVA 2KR3A 4PJJA 2JSPA 2DL3A 5CKBA 1OPCA 1MNDA 3HC7A 2RAEA 5D7UA 5IN1A 4C5HA 2D0NA 4JLIA 2CSIA 1M90C 2BYVE 5KVRA 1VQ8I 4RA2A 2W85A 2R7TA 2DDBA 5HDGA 3AAFA 2KEAA 1YHQT 4XTXA 3VDXA 3L2ZA 1UJYA 3KLNA 4I98B 1TG0A 4RTXA 3GFLA 4AFUC 5HLHA 2E60A 2W48A 4CYCB 1WJAA 3GTKJ 1J0RA 3HEFA 1OULA 2IPOB 4BS9A 4LXCA 4OF1A 5FWBA 2E7XA 3O2PE 3OW2S 1IV8A 2WV1A 5FKMA 2M45A 3CP2A 3RQIA 1IREB 4QTRA 4FL6A 1WWXA 1H0MA 4MDWA 2UV1A 3L2QA 2FVUA 2VODA 3SFMA 3LSJA 1RACB 1EH6A 2EFQA 4JX5A 1JKOC 3TMOA 2P6TA 3JCMb 5FU7C 1Q82R 1T38A 1VQOT 1D09B 4WWCA 1OCRH 4UUSA 2HYGD 2E2HJ 2KBTA 4Y13A 1VQ7Q 4B9XA 4PK4A 2PTKA 3WVDB 5L3CA 5FD6A 5FGMA 5GAN8 2MH2A 3JCMe 5ILVA 1USSA 2QDLA 2C0TA 2X1DA 3K7AJ 1XB4A 1F5TA 1O7LA 1MBEA 1YRNB 2RQPA 1Q81U 2CRGA 4KMUX 1X1CA 1VQMI 3CLOA 2EQUA 3JCMg 4RS8A 4IEJA 4AVZA 2LY1A 2FO0A 2LTOA 2E36A 2NWMA 5K7FA 1P4AA 1KD1U 3CTAA 2HOTA 1U5TA 3GWZA 2JMAA 3SEMA 3OYFA 1PM3A 1RAEB 1LEBA 1Y1VJ 1SMYF 1C0MA 1OCZH 2L7FP 2FPFA 1SG5A 2HKNA 2MA3A 4G6DA 1I1GA 5HNFA 1YWPA 2FZGB 2FU4A 2DOAA 1V1CA 2PUOB 2G3RA 1IHWA 2F4IA 3C2BA 1I1JA 1JU5C 1VYUA 2F4MB 2LY2A 1XS9A 1F4KA 3A8LB 2CG4A 4XSZF 3QSUA 5E1ZB 2ZJ2A 3JRCA 1Z6RA 2QAZA 2EQKA 3CC2I 3LGLA 3OYJA 2BY1A 2KIQA 2M4KA 5HVQC 2V4JC 2AZVA 4A0YA 3S14J 4B44A 2FXAA 1YO5C 1VQ4I 3PJRA 2M87A 1N78A 4UXNA 3FWEA 1RZ4A 4LN2A 1VQOI 3G1MA 2JTFA 5EZGA 2HKQB 5DD8A 4U0YA 3KBGA 4Q4ZF 1B72B 1VQMT 5ERIA 2OPTA 2M1BA 5JVGF 1MNMC 2EJFA 2BKDN 5TGTA 3BE3A 4J9FA 1AEYA 4XLPF 4E7ZA 1ZA1B 3AT1B 4QQDA 3EAEA 2FA5A 3G1LA 2AQEA 4B6MA 3OMGA 2ESNA 3QPHA 2RQUA 2YXYA 4BY6C 1N8RR 3PUBA 1SD5A 2DA5A 1BA5A 3DV8A 2DYRH 3VYRB 1G59A 1C6VX 2XDPA 3W2VA 3TSZA 1QPMA 2VC0A 2KZVA 2QBYA 3CCUA 3G6EI 4RDUA 4N4NB 1CF7A 1DP7P 1I4K1 1YS6A 1KQ1A 1UGSB 3B6CA 4P5OA 1RESA 2GZWA 3W6KB 5GAGJ 2HDDA 2QSHX 4P9FA 3CCQI 2DBBA 2RH2A 3VRZA 2L9SA 3PNWC 1P9QC 5LGUA 1X3UA 3UKGA 4XU1A 3GTQJ 3GFIA 2LX7A 5D4SA 3MO8A 3HHHA 3NARA 4NNJA 1ZR2A 2ZXHA 4XU2A 4HLYA 3MP1A 1ZUUA 3JCUC 2LG4A 3F8NA 4BH9A 1HKSA 2J5OA 3OV8A 1MUZA 3OBWA 4XU0A 1YITA 1KFZA 2X6OA 3FKIJ 4OGEA 5LJ5d 1QKXA 1UUEA 4C0ZA 4KICA 2HI3A 3VS2A 1KU2A 2LVSA 2QASA 4XL9A 2X4WA 1OYYA 1XG1A 2FX0A 4OB1B 3ZN1A 4IHYA 4PGHA 2VT3A 2L9VA 1MJBA 2LR8A 2P5LC 4L6V5 4L5IA 2I8DA 3BC8A 4HOBA 2NNNA 5C4JJ 4B8XA 1FSEA 4BDYA 3QPTA 1PD1A 4Y92A 2FNAA 2EPDA 3SHWA 1I07A 2KRNA 3FIFA 1WFWA 4QT7A 1M8VA 2JA6J 3TQ7P 4XTVA 5E8IA 5J1YA 3BROA 3VS3A 1SMTA 2UZKA 3I9QA 1W0UA 1UDLA 1I3AA 4KH0B 1KC8R 3AG2H 3ZQ7A 3K4CA 4XK4A 3TBIA 4I2OA 4MHGA 1L3LA 1Y0UA 1NLPC 3U23A 2A5YB 1C0WA 3OR1C 4JRIA 4AT1B 4KN4X 3ZMTA 1V29B 2A7YA 1U9NA 1AWXA 3M1EA 1XNIA 2G6FX 2GQIA 2RHZA 4UVCA 4PJOE 5FKLA 4CCMA 3PGGA 1NK3P 3BLYA 1RKWA 2DL7A 5BQTA 2O61A 2YU9J 1ZGJA 4PLLA 2YRDA 5L3DA 3DP7A 3K69A 4GRIA 4JZ4A 1SD7A 2HNIA 2R7XA 2VV5A 2FD5A 1PJRA 1ZG1A 2JVHA 4DW6A 3LSGA 2X6YA 2LDMA 1EA3A 2LNHB 3I55T 4MFDA 2M16A 3CEYA 1Z05A 3E5XA 5L3EA 1G8XA 2Y2ZA 4BQQA 5LHGA 2PVGB 3F6VA 1TWBA 1ABOA 2DMUA 3A0BC 4N4HA 2Y0MA 5E1XA 5K7HA 2EGEA 1WNLA 2LCSA 3V8JA 1XGOA 2EWNA 1BOBA 3L2UA 3TEEA 1U0JA 1RIOH 2BW3A 3CQTA 5DM7R 2XRNA 4L5GA 1BCMA 4U88A 4X9CA 2XIGA 4E47A 4BBRJ 4M77D 1CGPA 2HZTA 3HHGA 3HBLA 2JA8J 2RNJA 3BOQA 3URGA 5J39A 4RB2C 2B86A 1CKBA 3GF5A 1TC3C 4HQMA 3K1MA 2FEZA 2PQ8A 2VQHA 3C3WA 4QQGA 5KYYB 1VQ5T 3VYGA 4M9XA 4EQQA 1KQ8A 3BTIA 4ZDPA 5KH6A 4BJTA 4Q5WA 4J00A 2OA4A 4EVIA 1K7AA 2A05A 2A6TA 1OI1A 4C2TA 1WXUA 2HZYA 2PVDB 3EDPA 1UFFA 4AU7A 3FXMA 5AONA 2KIUA 5CVVA 1ZLKA 1B07A 3VKIA 5DYMA 2YUPA 2PZ1A 1QW1A 3H0IA 1GXQA 1UHMA 4JJCA 1FOYA 3CJRB 2DT5A 3OIQA 4CSWA 4E70A 2XAHA 3QRFF 4A3DJ 1XQHA 2XU8A 3M0UA 1XTAA 2KJCA 4XLEA 4KH1B 3PIOF 2VUBA 2QEXQ 3M8EA 5AIQA 2DODA 4RGRA 1T33A 3CJTB 3KIOA 3AKZA 1U9OA 4W97A 1IGUA 4EPCA 3A8OB 2SRCA 2EFWA 1M4ZA 1XSDA 3FKJA 3O6BB 2PMHA 4OINF 4A5MA 4C0DC 2R7QA 2ZB9A 3VWBA 5GANj 2K9MA 2YX4A 4HZFA 3DTIA 4M75F 3M57A 1MH4A 3C18A 4BUPA 3H3UA 1HK9A 1QVFS 3CXCP 4U0VA 2KROA 2QEXA 1RAFB 3HTRA 1X58A 1R5ID 3WU1B 1P4WA 1HKQA 3OYBA 5JLXA 4QPQA 1X6GA 1KONA 5ICEA 4PJOF 3TOBA 3CPWA 4P5NA 2DRMA 2X4HA 3QODA 1NTCA 3SZGA 1AKHA 3WTYC 3JRFA 5KAIC 2ZBKA 3DU6A 1DGRM 1TW2A 1VUBA 5FRMA 4CRIA 1YJNI 2QQ8A 3CCYA 4PJOC 2B0LA 2QK0A 2X4JA 2YRVA 3CCMA 2EFPA 3IH2A 3ZQFA 2FYKA 3QO3A 5D6WA 3OOPA 3GEZA 3GX4X 2DMTA 2W25A 1OYXA 3PTAA 4XKCA 3EHRA 5ED4A 3QDFA 4MZPA 3GBQA 2XF6A 3W2WA 1VTNC 1HBXG 3LGFA 1NG2A 3CCST 4UNOA 1NPRA 3QOPA 3R0AA 1WPYA 2IVWA 2X6XA 3ISPA 1Z91A 1TS9A 1FTZA 3KCCA 1QO0D 3JR9A 1S29A 4WXCA 4HF0A 2CUBA 2PEXA 4AIJA 2X3WD 4M77A 2DCEA 3S32A 3I56I 1RKTA 3OYDA 3IC7A 1NLOC 2W4SA 4RMNA 1RAAB 3CCMI 2G7UA 3F21A 2DT7B 2DXIA 2DL8A 2ZPHB 3HUGA 4BNCA 4LK0F 3ABMH 2E2JJ 1SFEA 4HX7A 4JBAA 1J9IA 2YLBA 5CQXA 2ZNZA 4D5CA 2EZIA 5E3MA 1VQ7I 4CYDA 1R49A 3VS4A 4IO9F 3JAME 4DEYA 3PFYA 2E3HA 3FXRA 2JVGA 3BTLA 1UZCA 3F3XA 3X2QH 4RB3C 2LBFA 4BI8B 3VYSB 2XPUA 3D5LA 2ME6A 4BACA 4BBSJ 1M9SA 2KDOA 1WXTA 1FIPA 2O4XB 3JW4A 2EQMA 1F43A 2NVQJ 1O9SA 4E7JA 3HKSA 2EH3A 3SHFA 3CCSI 5LJ5e 2AO9A 3HSBA 1U3EM 1KHCA 2ZJRF 2DA6A 3HHTB 1ZELA 3QQAA 3BG3A 2AS5F 2K86A 3DQVC 3W6VA 1ZSZA 2J6OA 2M7AA 4A2UA 2ZKZA 5JFRA 1R0CB 1X69A 5GAOq 2BV6A 5IPAA 3CC4Q 1GV5A 1XMKA 2QGGA 2BY0A 3E3VA 1Q82U 3IUOA 1W1WE 2X9DA 1KHIA 3HOSA 3PM1A 4RAYA 4M75E 3EG1A 3S3NA 4ANJA 1ZUYA 4M78C 3CCLQ 5J6XA 1ZARA 2M5WA 2BVLA 1B3QA 5H6RA 2RPNA 1EH8A 2VQCA 2EFNA 2NYXA 3WGGA 5EGOA 4A3EJ 2ROLA 3G1OA 1BBYA 1B4AA 3S3MA 4V2FA 5F0FA 2IA2A 4XTUA 2FPEA 1D1AA 2EIJH 2QLZA 3L2WA 1AOJA 4F91B 1LFUP 2A0FB 2MPXC 2LFBA 1ZGAA 4M71A 2MWOA 1WI9A 1WH5A 3F8CA 3HRUA 3I35A 4KITB 5LEKA 5GMKh 3WTVC 2EGCA 3OA6A 1DPUA 5IXFA 1S8NA 3OSVA 5CCAA 4FASD 4M78B 1WHUA 2ACJA 1J5YA 1OEBA 3GF2A 2HZDA 3OSGA 2A28A 2K6DA 2O2OA 2PBIA 1Y71A 5K7ZA 3V7RA 2DAQA 2I10A 4XTWA 2ETHA 2E19A 1Z0XA 2LF7A 2K9QA 1DDNA 1ACIA 2RI2A 1SHGA 3BDLA 4ME7A 5GAN5 2P7CB 2JM8A 2RJDA 3GNGA 2W1OA 3CBOA 1W5TA 1G83A 5J1UA 3SWNA 2LCLA 2RA2A 4OMZA 2AT1B 2P4RA 4ESRA 1VQPT 2JWTA 2J6FA 2EFIA 4AIHA 3RPUA 1QQJA 3QYHB 3SQNA 2A37A 2DEQA 1YIJT 1U8BA 4UB8C 2RQWA 2ME0A 3JB9D 5KYXB 4RBOA 2QDYB 1F1BB 4YIRX 3K0LA 1IN5A 3O8VA 4F7UB 4UUVA 4HT9A 1WVRA 3F8BA 2ZJPF 3BPVA 4M7AB 1MMSA 4XRFA 2CYZB 1HKTA 4RTWA 4EM2A 2LSOA 4CZZA 1YP5A 3M54A 3DEUA 2Y69H 1HOMA 3MZYA 4AM3A 2G9WA 1H8KA 2F6CA 1KK7A 1U1SA 1OCTC 3B6AA 3IRQA 3FLGA 4RAZA 5JR3A 3ZMDA 3CLQA 3N5BB 5HOOA 3H9JA 3C7JA 1LDJA 2CSQA 5GANh 2IXSA 5F27A 1O7FA 4RGXA 1K9MC 4G7ZF 2JMCA 2KGTA 2EYQA 5LJ3h 4HDVA 2HVQA 2EQIA 3IQLA 2XI9A 5D6EA 4M6XA 2F2XA 3H3VK 3QWXX 4MZTA 4VUBA 2RB6A 3I64A 3H8ZA 2EVRA 4GLKA 3HM5A 2GFUA 2L0AA 1ZRFA 3LX7A 2L2OA 2R0QC 2X6WA 1IUYA 1ZBJA 3BFMA 4J9BA 5GPAA 3V8LA 1VQ7A 3C95A 2DA4A 1X1BA 3F6OA 1GHCA 4G9YA 1UE9A 3JCMW 2M9HA 4A4HA 1AA7A 5CLSA 3DBRB 1IRZA 5I22A 2A3SA 4BEHA 4XICA 1ZQ1A 3MEUA 3EFOA 3OWTA 3LQRA 2O6GE 5JI6A 4C5GA 2YUSA 2CQ7A 4J5YA 3FK6A 1HXDA 2HSEB 4ORZA 3LSKA 2LP0A 3FIWA 3U21A 3WTWC 5LD2C 4JRPA 3G6EQ 1O4XA 2GGRA 1QWFA 1BI1A 2KIFA 3NPFA 2QF7A 2RF0A 2OTJT 2L3QA 3U1KA 1UTIA 5E1WA 1IRFA 1OLTA 4C9YA 3MCAB 4Y17A 3PMIA 3QHSA 4WXDA 1Q7YR 3IKVA 3REOA 4RLQA 1VQNI 2IGKA 1I3QJ 3BR3A 1TWHJ 4BXFA 1VQ8T 3K70C 4N4GA 1EV7A 2K5CA 2WY8Q 2CW0F 1I1SA 2K2MA 3I58A 2DMNA 1IXSB 3ZMZA 4FX4A 4LLGF 1WIEA 3NWTA 1M90R 4XN0A 2R3SA 4P96A 4EJVA 1KC8C 1V5FA 3CCET 4M7DB 5E3LA 1EFNA 1Z7LA 4GYIA 2B9SA 2V1UA 3F72A 2VXZA 3O8GA 1RADB 2D9TA 3MHXA 2WC2A 2X35A 3DPUA 4BY1J 2R58A 2MOXA 2PJPA 2X0LA 3F22A 1LOJA 4EGZA 1PC0A 2COWA 5ICGA 2V26A 1V3FA 4YIIA 2R5YA 2GF7A 2LJ3A 4ELZC 5A0DA 1W0TA 3FMSA 3ABUA 2AHJB 2XV4S 3TO9A 2GLOA 1B6AA 4GLMA 3CP8A 2E3IA 3BP8A 4RTTA 3IAM2 2JA5J 2NOGA 3PL8A 2EZLA 3J81Z 2CH4A 1NYFA 1XMXA 5GAN2 4KUIA 3NEUA 1E17A 3VS0A 1PVEA 2PJRA 6AT1B 1K73U 1ON1A 2PG4A 4DZPA 2GBQA 1P7IA 2FBKA 3ZQLA 1JXMA 3PIOA 2CUFA 4YFNF 1AWJA 1K6OA 3M0QA 2XDVA 4D9JA 2RJEA 2Z0WA 2CT3A 5KYNA 5GAOr 1M1FA 4KYWA 2MC3A 1X6BA 4PJOD 1UHFA 3P8HA 3EGDA 3H0HA 4FYYB 1A0NB 3ZMVA 2CUEA 3KP7A 2IS1A 2MC4A 1S7OA 2FMYA 1D3BA 2D0QB 1JTXA 1G6NA 3M56A 4QW2A 1H92A 1Q86R 3M0SA 3O5ZA 1T56A 2QVOA 3JTHA 4BAYA 1XMAA 2H8HA 2KT1A 5FWCA 3EG3A 4WCIA 2ZGWA 1RETA 2FEIA 2H94A 2DRKA 3ASOH 3ZXSA 2KRMA 4J9DA 1FY7A 4KA4A 1DU0A 2W84A 1YW9A 1DP3A 1ZAOA 4PLIA 4XM3A 2CFXA 1R58A 2F4OB 2KL4A 1YW8A 2PFBA 3DBHB 5DM7F 2CS3A 2V7FA 3BDUA 1P4XA 2DERA 1VYVA 1ON2A 2DTHA 5D5WB 2H3EB 4C5EA 4KN7X 5LFAA 1VQMA 2EV6A 5CQEA 1WJEA 2KRHA 1TXQA 5CKHA 5IYDJ 2RI3A 2EA4A 1R71A 1IDYA 3PUFA 2R93J 5KYUB 2A07F 4XNFA 5EYRA 4O5VA 3VYTB 3GLLA 1S7AA 2AZSA 4BI4A 3I71A 4G6TB 4L9JA 2EAYA 4F17A 2FOWA 4Q48A 2Y30A 1IW7F 3GTOJ 1N5ZA 2DO3A 2EYZA 1JXOA 1QWEA 4ZYHA 2MI6A 2BXZA 2J5PA 2BY3A 2QQ9A 1QQIA 1XGNA 2XGCA 4HVVA 4UUSB 3N97A 2DIQA 3JB9J 1HW5A 2QQSA 3J81E 2LLKA 4PFZA 1YI2Q 2K79A 2RJCA 3H6ZA 4HX4A 1FP1D 1STZA 2ROTA 2K4JA 2OCCH 4BQNA 3IV5A 4NBQA 1BC8C 1MSFC 1IZ1A 4OGCA 4M7DE 5CO7A 3H5AA 2GIVA 2ZPIB 3J80Z 2F5DA 1VQ9I 4PL6A 4AYBA 5FU6C 2VJIA 3B02A 2LNVA 2KDZA 2NNYA 3EPZA 3LYIA 4NL2A 1GCPA 3CD6Q 4PJOA 1X4PA 2QQBA 2BUDA 3ERED 1U5TB 1BM9A 2RD1A 3C2HA 2V9PA 3ZQHA 4A93J 4C8QD 4DOZA 4LD9K 5FO5A 1TU0B 1D5VA 1FLIA 3OY9A 2ZXIA 2DXBA 5HKCA 2QUFA 2Z1DA 1I81A 2C0OA 3EUHA 3BY7A 3I56T 3NAUA 3D0SA 3GBGA 3G7ZA 2M7BA 4C8QC 5ILSA 2F5VA 3KP4A 1I8FA 1LJ9A 1FOWA 2CUZA 5FD5A 1I6XA 2DVJA 2HQHA 4KRTA 4R0KA 4M75G 3HYIA 3OYKA 1RUOA 1I27A 2R7UA 1UELB 1M27C 3D7SB 2PUKB 1MBJA 4YTLA 1SKUB 4A69C 2MD0A 1IC8A 4A12A 3TW6A 1R00A 1JHFA 3B73A 3E5QA 3FDYA 1FOKA 2ELJA 2W00A 4NC8A 2JQ7A 1R0BG 2KP6A 3K1NA 2HDAA 1G3SA 3DEWA 1POGA 2L01A 2YS9A 1M5Q1 2DFFA 1ZG5A 1Q95G 1YJNT 4N0AC 1M1KU 2XAGA 1BU1A 2L9NA 3T0YA 2E4HA 2W0ZA 3OSFA 4D8DA 3CMEQ 2BBYA 3JRBA 3ESWB 1I5ZA 2QBYB 3VYHB 1T39A 3TCJA 1N77A 3CPWP 1K9MR 4CC4B 1FYMA 1OJLA 3QWYA 2H09A 2CP7A 4DYQA 2F2WA 3A8MB 2D1VA 3H92A 1H9TA 1QGPA 4FQGA 5EG2A 1R36A 5BMZA 1LVKA 2JVVA 3MCZA 3S1QJ 3CXCA 2VGMA 2QEXT 1GFDA 1JKRC 1J3TA 2QQAA 4ENKA 2FZKB 2RK1A 4JX6A 1W7PD 2NAZA 3ABTA 2STTA 3CCVT 3E9GA 2KPMA 3GZNB 1ZREA 1E3PA 4XOTA 2HQRA 2WSEE 2JPBA 1IXRC 5HDKA 2XB0X 1F9NA 5LJ5g 2E1NA 3ABKH 1V55H 3UA6A 2IT0A 4HBLA 3CO6C 2EKHA 1MBKA 1KU3A 5KYWB 3HL8A 3FBIB 3K4MA 4CA0A 2XHCA 5GAMf 3WODF 5GTHC 5CVJA 1WYXA 4M3DA 4A54A 2XG8D 1D8JA 2KVQG 3R6NA 4XSXF 4LG3A 3S1RJ 1GCQA 2GTOA 3M0TA 2K3PA 4K11A 2ELHA 4QPOA 5A2QK 4ELYC 4A3BJ 5H20A 3ULQB 1X6OA 4EV0A 2VVKA 4R56A 4ZYDA 3RESA 4LIVA 3PSFA 3VFZA 3JRDA 2XASA 3MMYB 4E7LA 1S72I 1RR7A 3CCEA 3JSPA 4X0GA 3R60A 3LSRA 3CC4T 4PSXA 1DGWY 3SJMA 5JHUA 4V19K 4OMPA 1YE9A 3CUOA 4KNYA 1Q86U 1ETWA 3JB9H 4BI3A 1HJDA 2KMTA 1Y0NA 1OCCH 4MGRA 3UPUA 1T08B 2R57A 1FPQA 2QGFB 2ZPGB 3CPFA 3OB9A 3HGYA 4MQVA 4N0AA 3TU4K 1AZEA 3IKTA 3PO2J 2DOEA 1IGNA 5F1RA 1XGSA 1X27A 4JLGA 3U1DA 4Q5SF 4RUGA 4B1RA 2FPDA 4NDLA 3MZHA 3CD6I 5IOZA 1WGXA 1SPKA 4LUEA 2UXNA 1AWOA 2CH0A 3EFSA 1K6YA 3CDHA 3FC3A 1WQ2A 2R7ZJ 2DL4A 2DA3A 3A02A 2LF8A 1U5SA 5EEAA 1WXBA 3X20B 3TEDA 2BW3B 5J4YA 4HQEA 4QVDA 4JJDA 4ZJZA 1ETVA 3DFGA 3DPLC 4RB1A 1HDDC 2VKNA 1J59A 4A4FA 5AYFA 3I9V2 3M8FA 3VB2A 5LJ3e 4FT8A 1K4US 1YLFA 2OJED 2WB1A 2M0OA 1PD0A 4M7DG 2BY2A 2V1DA 1WHHA 3I0TA 5JLWA 4V2GA 4JOMA 4UVAA 2CP6A 5KYYA 5D4RA 3HTSB 2ZZDA 3MJXA 2ATCB 3JREA 1RL2A 1TW3A 1V5GA 2HOEA 2HYFA 1RABB 5C4XJ 1ABQA 2XVCA 4K2EA 3MEAA 3GLXA 3CC2Q 4C8QF 3CCLA 3H5RA 4Y91A 4HRIA 3DBLB 2WV0A 5M5XJ 4G12A 3Q0VA 2H6BA 1M2VA 3THKA 3UDCA 3MVPA 4Y3OA 1YIJQ 2LVMA 1IDZA 4L59A 1YJ9A 4CC3A 1SHFA 3VYUB 1ZSZC 2Y0SN 3D5SC 3BZKA 4J9EA 2M2EA 4XRSA 2DLPA 5DY9A 3FRNA 2XPWA 1O3RA 4C8QA 1KD1C 1W4MA 3TVTA 3ZFJA 2OV7A 5CPRB 2CKKA 3JCMf 5GMKm 4BHBA 1R4NB 1U8RA 3S2DJ 2M3AA 1TOVA 1ZHIA 1AOYA 1K78B 3PE0A 1OX9A 2GXGA 1APLC 1VIEA 2K5IA 5FLXE 1T3LA 3DPTA 1E2XA 4HF1A 2DVEA 4YG2F 1HW2A 3PFSA 2Z3YA 3GTPJ 4M77C 1K61A 1DQUA 2OQRA 1UJ8A 3CXCS 3OS0A 2H8RA 1PCXA 1MNEA 3HL2A 2UWMA 3CCRQ 5J47A 1PKTA 2GXBA 2VOOA 3V7SA 1O57A 4HSRA 1WJ5A 2EV5A 2CDTA 4RTZA 4EM1A 3J7ZI 1YBYA 1E0EA 4LUDA 2LC4A 3G4SI 2QYZA 3ECOA 3I55A 1LDKB 4D0PA 4ZYGA 2HFHA 1T8IA 2JPCA 1ZHFA 2GOXB 2OZUA 4JX4A 3DLLF 3CCUT 2GNCA 3I54A 1XN7A 2VJJA 3K70D 1QCFA 3F70A 3GPLA 3UNGC 3A4CA 1RI0A 5D8LB 3E6BA 3L1PA 4M7DF 1UG0A 4ON0A 4OAZA 2HL3A 4HX8A 1CSKA 2KSSA 1R22A 3CMAI 4GY5A 3CC7I 2NYSA 1YJ9I 5IYBJ 1OZ2A 5LHIA 2BE7D 2ZPEB 2JUCA 3J7YJ 2KYMA 4ZYEA 2RHYA 2K9NA 3GOXA 1TLHB 1TWAJ 5FLXK 1DU6A 3REBB 4IX7A 3LSMA 1PHTA 3CCSA 4PJ0C 3VODA 1N8RC 2C06A 1BW6A 1K73R 2QI2A 3BR0A 2QCOA 2LCCA 1OZ3A 1G2BA 2JM9A 4M75D 2H1KA 2O88A 5J40A 1IZ6A 3KFWX 3FISA 1WJQA 5M3FJ 2KJBA 4M7DC 4M77B 4AWXB 1FYKA 2TRTA 2JRTA 1U1TA 2V9VA 3G73A 2VXEA 1JUPA 3I4PA 4AD9A 5K1YA 3ZRGA 4M75B 3J80E 4HYEA 1T2KA 4U87A 3HUGB 4L18B 5FRNA 5GANd 3SEQA 5KCHA 3FHNA 3CD6T 2LT1A 3MQ0A 2RMOA 1Q81R 1XJWB 3M4GA 1FYLA 2OTJA 4F93B 2CW7A 2HWVA 4D5FA 2CV1A 3AL0C 2O31A 5IHNA 5GMKe 3CCRI 2B63J 4M7AC 2LJ1A 3Q9VA 5IT3A 2E1OA 4M75C 3LL7A 1TQIA 1R4MB 2E5NA 2DIGA 1JHHA 3OYCA 2MK5A 2O4XA 4DJAA 4A3IJ 4E7SA 1GV2A 3I56Q 3KP2A 4Y52J 2CZ0B 3G71Q 1OCOH 2FMLA 4JJNK 2AQFA 4B3XA 4IQJA 4HVWA 4L5JA 1FEXA 2NXNB 4Y7NJ 3QPLA 1K8AU 3M5AA 4O6JA 4Z02A 1L0OC 1IF1A 1OOTA 3K6GA 5J3BA 2D45A 1ERDA 2E7WA 1Z9QA 2ID3A 5A2QZ 1WH7A 2ZMEB 3HB9A 4A0XA 2PQWA 2FRHA 4F16A 1S72Q 4XLAA 5GANf 2JTEA 2B8AA 2YUOA 1Y39A 1YJWA 1OFCX 2KLOA 2OAZA 3HRMA 5EG0B 2DPDA 1UGRB 2GTJA 5FB2A 2ZPFB 2E34A 4C3JJ 4F7UF 2Q8KA 2LQNA 2GM4A 1RI7A 1KYWA 1YX3A 2QXFA 4J83A 4LDYA 1OKRA 4L5EA 1X43A 4C8QG 2A61A 1XX5A 1TH7A 1OYIA 2FUG2 4XRSG 1LE8A 2VC1A 3OYYA 3GCMA 2VPLA 3CCLT 4S04A 4UUTA 2R7DA 3OBYA 4KIGA 4JQFA 2VGNA 4UHTA 2VI6A 4A4GA 1ACMB 3CCRA 1HSQA 1W2BA 2OTLT 4ATOA 2ESHA 2R5ZB 2RQTA 2E35A 3OYNA 1YCYA 2HR3A 2ED1A 4XU3A 2EZHA 3CJNA 2QSGX 2PX9A 1LEAA 2P0QA 4M78A 3KE2A 3R61A 2XAJA 3WE2A 3QG1A 2CW8A 3F23A 1QA6A 1ZSGA 5LJ5f 3SB2A 4RGUA 5L23A 2XRLA 3F8FA 1QRYA 1SVMA 2KT0A 4QSHA 3RKWA 4YIFA 2Z2SB 2XF7A 3HJEA 3T1BA 4CGZA 4LDVA 5CQYA 4F7UG 4OIPF 2DZ9A 5GP9A 1Z7UA 1U78A 2DJNA 2DMQA 4MEXF 2XIDA 1UHWA 4XMYA 2XSDC 4GFBA 1QBJA 2DJZA 5CIUA 5I2MA 2OTJI 2O5RA 3LH5A 2XPVA 3MKWB 1OU8A 1YI2T 1NH3A 1VNDA 2R7WA 1WHKA 3FXUA 5GMKj 5KYXA 2E70A 2YHTA 4OMLA 2Y4XA 4F7UA 1VQ9T 3E1SA 2DMPA 4YFXF 1HF0A 1YNZA 4M7AA 3CC7A 1IGQA 2R4GA 3TREA 3S2WA 1JT0A 2JMWA 2X4YA 4M9SA 3UF4A 4N4OB 2AHQA 3OYHA 1W36D 5JVTA 4FSXA 4ZGDB 4M6VA 1HSTA 3LOCA 4XRMA 2TDXA 5L3GA 2DFUA 3A8GB 1AD5A 4UVBA 3HKZA 1VQ4T 2HKXA 3GFJA 4I6ZA 1S7EA 4QIWN 1MHNA 3VS1A 2D5VA 4AG2C 3FXKA 1GDTA 1A5JA 3PT9A 5JHFA 1K79A 2V1RA 5FU6B 1WJDA 3CO7C 3SEZA 3LSTA 4ZH4F 1QZYA 2L54A 5F6FA 1H641 1N75A 1IXDA 1EZZB 5FFZA 2HEOA 1TWGJ 3KZYA 1FNNA 2KXCA 2GXAA 5DEQA 3WG9A 1YW7A 1BYMA 2BZTA 4RM2A 1WQ7A 1XSXA 1J7KA 2ISYA 3K4LA 4CCOA 3EG9B 4AFZC 4E7KA 3EFOB 1TP4A 4XTYA 2K85A 3QU3A 3FJPA 3CCJQ 1QCOA 2W57A 3NGPA 4II1A 4IIMA 1TNSA 2XB5A 1QVFA 2XGXA 5DUIA 2JS0A 2XDDA 1OR7A 3L2CA 1RRJA 1AWCA 1D1BA 1YIOA 2KHMA 3E5UA 4N0BA 1QP3A 2FZCB 1FC3A 3T5XA 4C2UA 2K57A 4QKUA 1YJNQ 1PP7U 1F1ZA 2VASA 2YX7A 3GW2A 4X6AJ 2WAFA 1LVAA 1PYVA 3WU0A 2LC2A 3TW7A 1LJOA 2MGQA 3DXJF 3ZR8X 2X1CA 2LQ8A 3A98A 2DTOA 3P8BB 2A3LA 4MZMA 5J4VA 1RI9A 3ASNH 2MABA 5CAIA 3CC2T 2CQXA 3CJQB 1QPIA 4IPAA 2YSQA 2AXLA 2LTPA 3LAJA 5M3MJ 2EJ9A 2HBWA 3E19A 2DOFA 2L3SA 2LJ0A 1LNXA 3OW2A 2CZ6B 1JGSA 2KQWA 5CYVA 3F0CA 4DBRA 4H0EA 4IHWA 1YG2A 2ECBA 2KRCA 2MD5A 8ATCB 3MFKA 1ZRCA 3X25B 3FK7A 3D5RC 2HU9A 1YFNA 4DA4A 2XROA 2LQKA 2FNPA 3CCLI 1MV3A 4XTZA 4R8HA 4U0WA 1BIBA 5FLXZ 1MGQA 2E64A 3E9FA 2M9UA 1NK2P 2I0NA 4C3HJ 4G7OF 1D3YA 3VEPA 1IV6A 4M7AD 2HDCA 1TTHB 1W1FA 4QLCU 4I09A 3GTGJ 1QVFP 5LLQA 4IJAA 1WJBA 2RKHA 2RHXA 4IVNA 5D6FA 2PMZA 3BR1A 1PP8F 5KCOA 1BI3A 1VQLQ 1NM7A 2KRSA 2KY9A 4UC4A 3RZDJ 1PDNC 5D6XA 1TQMA 2EK5A 2O7OA 4J6YA 1GFCA 4HCCA 2F48A 1R6RA 5KHDA 4M7AG 2OU2A 3RQ4A 5LRSA 3EGDB 2JXBA 2RV8A 1YITT 4C8QE 1D3BB 1TWCJ 3CMMA 4X1VA 4M3BA 4LJZF 4S05A 1N27A 1YX5A 2OCEA 3IHUA 3PMTA 1KIKA 1TT0A 4Y33A 1MJAA 2LT4A 4Y4RA 4CO8A 2GBYA 5E17F 2HOAA 4V2SA 2DK5A 5HK3A 4I0AA 2M0MA 1E6HA 2W7NA 4LD6A 1Z67A 3ZMSA 1VQ5I 3BJAA 2IS4A 2P4TA 3RKYA 5EJCA 2KZGA 1C1AA 1FP2A 2DYBA 3S3OA 3EETA 1KU7A 3HOZJ 2QWWA 2VJ5A 1VQOA 2V6EA 2E10A 4NQWA 3L2VA 2K9LA 2DXUA 3ZBDA 3QIIA 1UGVA 1Q7YC 2VKVA 3EUAA 1JKPC 4DBHA 3TOAA 2YSRA 3N05A 3V8KA 5KYUA 1R5GA 1K8AR 1BR1A 1ZR4A 1QHGA 1T95A 2IGMA 2V79A 3OIPA 3ZP5A 1PKSA 2YUQA 5GAOp 3Q3SA 1Q1VA 4HW0A 2AKLA 1IO2A 2WAQA 4HNVA 4OMFB 1VQ4A 2YPRA 4NB5A 3K4NA 4OOIA 4PGGA 4LD5A 1LPQA 4IHXA 1T3SA 3NWSA 1U3OA 4RTVA 4FE4A 2JN0A 1Z77A 1SC7A 1TUDA 3LSIA 1FMKA 4J6XA 2VWFA 4OB2B 2M0YA 2V1NA 1IUFA 2CP5A 4IUTA 4M3FA 2MLKA 5ICCA 3CCEI 3JSCA 4UV8A 1HLVA 3CC7T 1K0SA 1RLPC 1ZX6A 4FSSA 2ABLA 4XLHA 2P4WA 3CCVI 2NVTJ 4B4CA 2ZAEA 3DB4A 2BZ8A 3IAS2 3BG6A 4I76A 3DKYA 2R5AA 2FBIA 2VUMJ 3LA2A 3WHCA 5LL6S 2DETA 2DI3A 1LPLA 3JCMJ 3FXQA 4PNOA 4KJZA 2LMJA 3DKMA 1YI2I 3OIOA 4PJOB 4Q47A 4EMKB 4JRKA 1AVZC 1PWTA 1FMWA 3S1MJ 3DLAA 2HQXA 2HSPA 2VBWA 2JW4A 5GAHJ 3CCQA 3H0DA 4EGYA 3GUDA 2DA9A 4IIOA 3CD6A 2DAOA 2SEMA 4A4EA 2EKOA 2OJ2A 3SZPA 5CKEA 3KYDB 4R79A 2ZNYA 4RAFA 2L7KA 3WTTC 4IUUA 4FCYA 1OYWA 2L7ZA 3RPQA 4IZZA 2N8GA 3SDBA 4HXJA 2Y75A 3BCAA 3DF8A 5GAN4 4KUDK 5GANe 1G2HA 2MWPA 1O3QA 3HKZN 1OQKA 2VXFA 2K3XA 3CCRT 4PJMA 3SFIA 3BQZA 5FLMJ 1FTTA 2DZCA 5L3FA 3BQYA 1HCRA 2E1CA 4HCZA 1YOVB 2VT2A 4KIBA 3WGHA 2P6SA 3NQOA 5DLQE 4FETA 4CDGA 3MKYB 1FXXA 2QG9B 3JRZA 1R1UA 1EH7A 2K5FA 5CK9A 1TUCA 2EIMH 4XORA 3CCUQ 1XPXA 3IH4A 3K4JA 3MN2A 3RTRA 4OB0B 2JS2A 1MH3A 5AIPA 3JTGA 3E6MA 2GQQA 1RUNA 1IO6A 3HOVJ 5HY6A 1VQNT 2DA1A 2VJ4A 1YHQA 4XAXB 4IRHA 3RKXA 2HS5A 1VQPI 1ZH5A 4A3CJ 2X9HA 2W24A 1NE8A 2E12A 2RJFA 4LK1F 1QNTA 3GMEA 4AVPA 9ANTA 5H6QA 3I4MJ 3PQKA 1Z9CA 2Q1ZB 2XMFA 3OYIA 2KNBB 2HPIA 2IS2A 3JCMc 4F7UE 5D6YA 5EEGA 3K2ZA 6PAXA 3TL4X 3I53A 4A3LJ 2VC8A 1GRIA 4AFSC 1RC9A 3PO3J 4GGGA 5AT1B 2FBHA 4UB6C 2ZCWA 2A68F 3VS7A 1ARKA 4HF2A 3I55I 2J05A 4EMGA 3TP0A 3A8HB 4BE0A 5KYWA 3AG1H 1Y8RB 1IJWC 2EB7A 3M0RA 5LBQA 1ORKA 2XSJC 2OAWA 4LMYA 3JCMd 3JB9I 2EJRA 2O03A 4BB7A 1GBRA 1QCNA 3M07A 2O9SA 3G6EA 1O3SA 1VQLI 5GAN3 3I59B 2E1MC 4WTOB 4PDKA 2K27A 3RIRA 3ME9A 3GTLJ 2F1LA 2KKOA 1X2NA 2F5CA 1Z1DA 2XGEA 2ZJQF 1J75A 1X75C 2KAFA 4FYWB 4KBMB 2LKXA 5LJ3g 4MTEA 3PSIA 3HSFA 3A5ZB 5HODA 1B9MA 2DBMA 2KE9A 3HG9A 1WLPB 3CESA 5DCMA 1DJ7B 2M8GX 1WJRA 3HRSA 4HV5A 4QVCA 3QYFA 3PNYA 2QKMB 3RJPA 3CCJT 3HPGA 3O8HA 3BG5A 1BR4A 3NTIA 1B34A 2E1MB 3CUQB 1EKEA 4HAMA 4FW1A 2CUDA 2F5TX 3PVLA 2HGCA 3RZOJ 4LLNA 4BQAA 2ZMEC 8AT1B 4ZGEB 1MMGA 4CCLA 1LB2A 1KQ2A 2OAUA 2PN6A 3G4ST 3QP6A 1VQPA 2EGAA 4MEYF 2K3FA 2DDAA 3CMAT 2HDWA 1V5EA 5F04A 4CCNA 3R4KA 2WY7Q 1TWFJ 3FXOA 2I2LA 1ZN2A 3COAC 2K9GA 2WB1N 5FJ8J 2BOLA 2MYSA 1U2WA 2QTXA 4Z88A 2E71A 4UV9A 3QJ6A 4DBQA 3VRYA 2DU9A 2KI7A 2L4MA 4EJOA 1JTYA 2A6EF 3SXYA 4DNCA 5F08A 1B1BA 2X51A 4S0HB 5IP6A 3C1DA 3E0JB 1MV0B 1W4SA 2CREA 1S72A 1ZLJA 2VBYA 4A0ZA 3JAMK 3I5SA 3EH1A 2AK5A 2M8EA 3BDDA 4I0BA 3VPRA 3DB3A 3H0FA 3SYTA 5LJ5j 4M7AF 5E3NA 1XOVA 2G0EA 2M0CA 1ZBXA 2K4YA 4GBQA 3OL3A 3HOTA 3GZ6A 4J8OA 2KQRA 1TQPA 4FE7A 3RPUD 1M2VB 2JZYA 5K5QA 1WJCA 4ZDOA 2FOKA 3HSRA 1MSEC 4BXXJ 2CP0A 2DX1A 2JNGA 3C94A 4P55A 5DD4A 3EGXA 3FEOA 4IUQA 1IN4A 2F2EA 4C92A 1JUSA 3DCFA 3RCOA 1X3WB 2ZFUA 1VI0A 2KIMA 3QAHA 2BXYA 3A03A 3CPWS 3BY6A 4KT6A 2M34A 3JAMZ 2P0WA 3BJOA 2NVUB 1K78A 1RAGB 3BR2A 3BW1A 1A35A 4B09A 3WTZA 1OV3A 4A3GJ 1ETOA 2CU7A 4FU6A 2H1LA 1QZZA 1BI2A 1UEBA 2NRAC 1PSFA 4RG2A 2Q2EB 3VS6A 1T6SA 1SSFA 1SD4A 2CO5A 2EFOA 4IQ4A 3KFVA 2KISA 3WGIA 3OR2C 5IXBA 4JRQA 3KYLA 1TNTA 1YQAA 2RHIA 1QVGP 1OMIA 1QLYA 3LA3A 4UY8I 1H8AC 2YLCA 1M30A 1M1GA 3J7AF 1MBGA 4XIDA 2PI0A 1VQ6A 2LK2A 3OOUA 2KXDA 2VBXA 2X48A 4XLFA 3I5RA 5D5UB 1U06A 2O0YA 2L0KA 3T8TA 2E41A 1MW7A 5HCKA 2XKOC 2NVXJ 3UT1A 5M5YJ 1RLQC 4L9NA 3Q9SA 1Y6IA 2VOPA 3I55Q 3HFNA 4J7IA 4JS5A 1M1KC 2IS6A 2DBKA 2OZ6A 2E2IJ 4GCVA 1VFCA 1HW1A 3QPSA 2DYSH 3DKWA 2JT4A 4J6WA 3EHQA 3LSHA 2LD5A 2QEXI 1EJ9A 1G4DA 2W82A 2BHYA 3KEOA 2LZ6B 2MCNA 2I5UA 1PUFB 4KFCA 1UHCA 2QA4Q 3A01B 1S3JA 3JCMV 2DA7A 5KNLA 1JE8A 2P7VB 2NVYJ 3EUKL 4KUMA 3ZCOA 3KETA 2NUTB 4QWQA 3SDGA 3AG4H 1M1EB 4FHTA 3OMCA 1YCSB 4E6RA 3CC7Q 3LWFA 4B43A 1VQPQ 2VN2A 3N4MA 3PVQA 3ZN0A 4M75A 5A0LA 3TO7A 3RERA 2EJGA 2NLUA 3PIPF 1K9AA 4C0FA 4PJNA 4ESJA 1JBMA 3G4SA 4EDUA 2NS7A 2DW4A 3RDIA 1RAHB 2LQWA 1TT5B 2DXCA 4ITVA 1GXIE 1QMCA 2IEKA 5LRRA 2COMA 3WU2C 1VQ6I 2ZSIB 3PFIA 1MBFA 4I02A 3K10A 4RM3A 1M3AA 2E5QA 3P9IA 4ZYAA 3F8MA 1D5YA 1W5CC 2X85A 4P1WA 2IRFG 1KD1R 1IXCA 2KFDA 1MZBA 4HNUA 1W36C 4IUPA 1ONVA 3M7GA 3TDZC 3TDUC 4M6YA 2W10A 1LUJB 2VLAA 4RCBA 5J1RA 3FM3A 5I11A 5GAMg 5CVUA 2BGCA 5C6SA 1HD3A 1KQSS 1M8MA 2VKEA 2K3BA 4NS5A 1Y96A 2JT1A 3O3KA 3VUBA 2K4BA 2NUPB 1TUGB 1IN7A 1VF9A 2MBFA 5EEHA 4FM4B 1J09A 1JJ6C 4MMKA 2K2VA 2E5ZA 4HV6A 3JCMh 2ZMEA 3HIFA 3CBMA 5K5OA 1P6RA 5GAN7 4I99C 4WCGA 2RGVA 3RNJA 2IGOA 2GA2A 4DYCA 2MLGA 5EG0A 2LNBA 1R77A 1EF4A 1KU9A 2F2VA 2CUJA 3ZL7C 1Z3XA 2DQLA 2Y9YA 2Z5UA 4A3MJ 4LFUA 3S2HJ 2ZFWA 1WDXA 1MBHA 2K9SA 3KP5A 4JK1X 3DU5A 2Y9ZA 2RK2A 3ZQCA 4XQFA 1ZGWA 1O75A 1YJWQ 1BJAA 3BG9A 1I39A 4CI0C 1X4OA 1LE8B 2X3XD 3MP8A 5KCMA 1JJ2S 1VQNQ 1MMAA 2EPFA 3M3YJ 1MGTA 3UWNA 3JCMX 4MMLA 1UJ0A 3VJPA 1I5LA 1R9TJ 4M73A 1X2QA 1B59A 2L7MP 1GXPA 1JJ2P 4C0DB 4XOPA 2VB6A 3KP3A 2R5ZA 2BIVA 4Y28E 3UA7A 1FBQA 1Y7XA 1IRGA 1Q82C 4HSTA 1S1NA 3VOEA 1KQSA 1KG1A 3ER0A 4BE1A 4LIUA 4RGSA 3GO5A 3TO6A 2OTLQ 1ODDA 2QQRA 1RAIB 2CJJA 4E6KG 3G2BA 1SAXA 2MW8A 3CCJI 1M2OA 1FT9A 2DYIA 4BJ5C 2IAIA 3U2RA 3OYGA 1X1DA 3CF2A 2DA2A 4JDSA 3GNFB 3L9FA 4FTHA 3A1PA 3WHBA 2L02A 1TL8A 4C92C 3P5JA 2JTVA 4RB0A 2EQRA 5CVIA 2RQRA 3L00A 3IWZA 2CGHA 3JRGA 1RUWA 4M77E 5HS9A 2X1EA 2ELKA 4MQ9F 2MH9A 3BCBA 3UR3C 5IHKA 2YUNA 2XAQA 3HRTA 3V4GA 4LB6B 4LB5A 3NTKA 2QA4A 5IH2A 1Q81C 2GIZA 2UXXA 2R5MA 4C92D 4G94A 1JKQC 4ZDLA 1ETKA 1T98A 1OR7C 4BU2A 1G3WA 1ZG3A 2A6HF 2CT4A 4B47A 3BPXA 1UG1A 3KZZA 4A3KJ 1AWWA 3CMEI 1HC8A 4AUXA 4IRIA 2WACA 4BKXA 4HCBA 4ZZLA 4M78E 4JPBW 3FJ5A 4BL0B 4RG8A 2LDUA 4WX9A 1D0XA 5GJWB 2V1XA 1Y1WJ 3LLRA 3K4KA 2R7VA 2R7RA 3C2GA 4L9TA 4C92E 3EUHC 1GVJA 1OCPA 4TV7A 2FE3A 4B3AA 3ZMUA 4EMSA 5E18F 1EX4A 2DD4A 3BT9A 3HPHA 5J3LA 2XICA 2YWWA 1VQ4Q 3MEVA 1TTYA 2BE9B 1UFMA 3MAJA 2V6CA 4OIRF 4JS4A 2RQVA 1XGMA 4ZC3A 2RDPA 4OMNA 3EFRA 4CC7A 2LRQA 4D8KA 5CKTA 4WK8F 3H0GJ 3QDRB 3GYHX 4HDUA 4ENMA 1NJIR 2FSWA 2IG0A 5IHIA 3ONQA 2MIOA 2WAQN 4OU0A 3EG9A 4M7AE 2Z33A 2KDSA 2K7AA 2JJ9A 1K9MU 1R8OB 3FM5A 2YR2A 2VQLA 1LQ1A 2VBZA 5DV5A 2KT8A 2JUGA 3WXMB 4BE2A 1SFOJ 5GAMj 3L42A 1H89C 3CCVA 1WHLA 4FT4A 4ETSA 4F92B 2JUFA 4M3GA 4DQ2A 2L89A 3RMSA 1MDMA 2EA2A 1V4RA 2VE8A 3MD2A 1T0HA 1Z9ZA 2QTVA 4JJBA 3CCQQ 3OQ5A 4AG1C 2RM4A 4MDXA 5LGTA 2PNIA 3OS5A 3OYEA 4IKFA 1SRMA 4M78D 1KQ9A 2VQGA 2VIXA 1H88C 4G6QA 3G71A 4AC0A 2DEUA 1G3YA 3PNVA 4DZJA 5IP9J 2M1HA 1HA8A 4MIMA 4LITA 1S6LA 2Y4YA 2MSYA 3P9KA 4PZJA 2DFEA 3NFCA 1DUXC 3LWIA 3JCMP 1DPRA 3QZ5B 4II2A 1X3ZB 1WCMJ 4HPQA 4ZZDA 2IVMA 1A6QA 2YU3A 5H2FC 1Q1HA 5J8FA 2XC7A 3CC4I 1UB4A 1W7PB 5E20A 4HA8A 5CJ9A 2HKOA 2QZ8A 3Q5FA 5GADJ 1K1ZA 2COZA 4C3IJ 1IG7A 3Q0WA 4PCQA 1Y07A
chains in the Genus database with same CATH topology
4M77G 4OIQF 2K3YA 5IAYA 3GP8A 4QQ6A 4GXOA 4LG0A 2F5FA 2RN7A 1VQKT 5ILUA 3P9CA 1PSEA 4OVAA 1KGSA 2XDBA 5KE2A 2RI5A 3LW5E 3P7NA 2XK0A 3WTXC 2P0PA 2ZO4A 3META 3BZ6A 4I7HA 2MF2A 3K9TA 4Z2YA 2HQNA 1FBUA 2DQRA 4X9DA 2Z99A 4PKCC 4ZGJB 3CUQC 1IN6A 4EJUA 4LDUA 4HT8A 2CWEA 2F69A 4OIOF 4ESFA 2QYOA 1SD6A 3INZA 3GZ5A 4A5NA 3CMET 5HS7A 2V8JA 2QENA 2P5VA 4GO1A 1W2BS 4FX0A 3G6ET 5IT9K 1T0FA 2DTIA 3GIBA