5CVIA

Structure of the manganese regulator slor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
PNKEDYLKIIYELSERDEKISNKQIAEKMSVSAPAVSEMVKKLLLEDLVLKDKQAGYLLTKKGQILASSLYRKHRLIEVFLMNHLNYTADEIHEEAEVLEHTVSDVFVERLDKFLNYPKVCPHGGTIPQHGQPLVERYRTTLKGVTEMGVYLLKRVQDNFQLLKYMEQHHLKIGDELRLLEYDAFAGAYTIEKDGEQLQVTSAVASQIYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords SloR
publication title SloR structure and DNA binding studies inform the SloR-SRE interaction in Streptococcus mutans
rcsb
source organism Streptococcus mutans
total genus 60
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cviA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cviA02
5LHIA 2Y48A 1ZLKA 1B4AA 3U1DA 3DXJF 4BYYA 2A69F 1K6OA 2H6BA 4L9VA 3W6KB 3J81K 4MQVA 4EJVA 3CO7C 1YLFA 3TO7A 2PMUA 3BZ6A 4EJOA 2QM3A 2LF8A 3WU0A 3BP8A 3B02A 1EH7A 3HRSA 1XGSA 4UVBA 3IRRA 3WGHA 5E17F 1ZH5A 2ETHA 2IA0A 3WTSC 4AIKA 1XD7A 4QWQA 4I0AA 1G6NA 1J2XA 5ICFA 3E6DA 3MAJA 4HDVA 4I02A 2EFWA 4AD9A 3RIRA 1WRJA 3DQVC 4HX8A 1LDDA 2G9WA 3GZ6A 2YPRA 2VOOA 3SHFA 1W5TA 5FB2A 5E1WA 2FMYA 1FT9A 3CJNA 4ENNA 2FE3A 3J7AO 2K7LA 3WTUC 3SZPA 1BI3A 2B0LA 2A6EF 1U3EM 4GCVA 3WGIA 4KMUX 1S3JA 2OQGA 5CVVA 3CUOA 2DAOA 4N9HA 1DDNA 3BPVA 2F5EA 4KT5C 5FLXZ 1HKTA 1ZYRF 2M5WA 2LX9A 5D8KB 4CGZA 4RGXA 2UZKA 4DQ2A 4ESBA 4OINF 4RGUA 1I1GA 3RKYA 3H3ZA 5KVRA 3KZYA 1TQPA 2IA1A 1F9NA 1STZA 3L2CA 3WTTC 2UXXA 1U2WA 2ELHA 3E6CC 1IW7F 2MLKA 4OMYA 4NB5A 1UCRA 4KIBA 5DUKA 2PG4A 4HF0A 2HDCA 3Q5FA 3WODF 4P5OA 2D2WA 4AIJA 2VOPA 4MEYF 1OKRA 2F2EA 5ICGA 1MJ9A 2XAHA 2GXGA 1PP8F 1FYMA 2M87A 1J9IA 2HKXA 2IJLA 1LDKB 1ONVA 4CYDA 1HKSA 1SD7A 1YW7A 3CDHA 4KN7X 3EYIA 1IN5A 4XSXF 3QPTA 3DF8A 4E70A 4BQAA 4Y13A 1JHHA 3HTSB 2Q8KA 5LEJA 2FMLA 2XGXA 3ABUA 2FNAA 2F5FA 4O5VA 3M1EA 4A5NA 3LSTA 2GXBA 2RQPA 3BPXA 2D1VA 5LEKA 1QZYA 2QWWA 3V8JA 4RGSA 4OOIA 1S29A 2GWRA 2ISYA 2V9VA 1I6XA 5IT9K 3P7NA 3ULQB 1YYVA 4L18B 2AXLA 1O3TA 1P4AA 4RB3C 4AWXB 5DCMB 4HA8A 4QLCU 2XVCA 3RPQA 3P9IA 5HLGA 4UXNA 2QBYB 3I5UA 2QQAA 1R22A 3FXQA 3L09A 3M7GA 1V3FA 2ZCWA 2X4HA 2H94A 4ESJA 5JFRA 4WCGA 1R5GA 2W57A 1SD4A 1R5HA 5D8LB 2XAFA 5JHUA 5ERIA 3BJ6A 2Z99A 2H09A 4H0EA 3KFWX 4Y15A 4Z2YA 4F7ZA 2XRNA 1IF1A 1E2XA 3FXUA 2FQ3A 1BYMA 2A3SA 4WWCA 1L3LA 2HFHA 1F1ZA 4I98B 2J5OA 2HQNA 3SXYA 1YFHA 3KCCA 3TDZC 2P7VB 2PFBA 1YO5C 3ML6A 5TJJA 2BE5F 1TW3A 4HZFA 2VE8A 1KQ0A 4L5IA 4M6XA 5KK1A 1WSUA 1P2FA 4OIQF 4EVIA 2GCXA 4R8HA 2EFNA 1J7KA 1GHCA 4WXDA 1O7LA 4BH9A 3VFZA 2DTRA 2JPCA 3TOAA 3DP7A 3GXOA 1FWZA 2BGCA 4EGZA 1IN4A 3PQJA 5HS8A 3ZMUA 4HF2A 4Q5SF 1TNSA 2ZNZA 1ON2A 1G3TA 2Y75A 2A68F 1KU9A 2ACJA 4AIHA 4M72A 2RNJA 4OIRF 4M71A 4G7ZF 3MZHA 3R4KA 2P5VA 4U0YA 4ASNA 2YSRA 1KQ9A 4KMFA 3MQ0A 1ZRFA 1IRFA 4JK1X 1MDMA 1XSDA 3NEUA 4A5MA 1TW2A 5D6FA 4FX4A 2H27A 5H6RA 1K79A 3JAMZ 5LGUA 2K5IA 3V7CA 1FBSA 3I0TA 1DPRA 2STTA 4RAZA 1KU2A 5DD4A 4S05A 2M1BA 3F8MA 2Z9OA 1SFUA 4N0BA 5CJ9A 4ZYDA 1R1VA 5E8IA 5LLQA 1YW9A 4I09A 2WTEA 5CVRA 4G6QA 5F6FA 4IVNA 4HV6A 4Q4ZF 3RJPA 1YIOA 1RZ4A 4M9XA 2F5DA 3GUDA 2QENA 3GW2A 2HYGD 3GO5A 4HQEA 2QQ9A 3DPLC 2JSCA 5HLHA 3NRVA 3SZTA 1MZBA 2XKPA 1H9TA 1I5ZA 4LB6B 3GYHX 4OMZA 5E8GA 1BC8C 1R1TA 2KRFA 3G73A 4KA4A 2YX4A 2NRAC 4PCQA 2P4WA 1T38A 1QVPA 2EFOA 5K5OA 1X3UA 1G3SA 5E18F 3KP5A 2YU3A 3HHHA 3F8BA 1V4RA 2Y0MA 3ROUA 3QOPA 1R1UA 2XHKA 4RB1A 4BNCA 3CUQA 3COAC 3WTWC 4BHPA 2HS5A 4ZYEA 4KNYA 3BY6A 2CSOA 4LLLA 2CQKA 1C0WA 1FSEA 3QP5A 5CVUA 4P96A 1OYIA 1H9GA 4EGYA 1E17A 2OAZA 2VODA 3L00A 1IXRC 3H3UA 3GFJA 1G3WA 3RTRA 1O57A 1U78A 2LSOA 3IRQA 5D4RA 3D5LA 2CG4A 2HYFA 3VEPA 3DEUA 4LD5A 1FY7A 5H6QA 3T8TA 3T8RA 3TDUC 1B6AA 5CVIA 1W7PB 2PJPA 1ULYA 1ZRDA 1BI2A 3T0YA 3AAFA 4UV9A 2OQRA 2RKHA 3ZMZA 1BN5A 3JTHA 1HW5A 3TOBA 4IF4A 3FWEA 2NAZA 4ZH4F 3B73A 1OYYA 3BJAA 2R7DA 4EQQA 1RNLA 2PMHA 4WF2A 3WTVC 5TRDA 3LWFA 4M73A 3HTUA 4NHJA 1O3RA 4PZJA 1RI7A 4BXUA 3RKXA 2ZXJA 2ADUA 5K1YA 3JSOA 3I64A 2XASA 3P9CA 4I01A 2HKOA 2O03A 3KP2A 5DD8A 3E5XA 1O3SA 4LG0B 1BJAA 1LVAA 4HX4A 2HOEA 4LB5A 3KLNA 4I2OA 2DU9A 2MH9A 1MKMA 2IRFG 4UVAA 2RC4A 3CLOA 2FXAA 1IXCA 1QZZA 2XAQA 4L9TA 3E19A 2VE9A 3CTAA 4MGRA 1SD6A 4IRGA 4EJWA 2QZ8A 1YW8A 1SFXA 3ZP5A 5DCMA 1ZGAA 2HZTA 1FYLA 2W24A 3G3ZA 1FLIA 5DCFA 2QBYA 4EJTA 4IRHA 3GLXA 1BM9A 2ZKZA 1SAXA 4P55A 3F23A 4MHGA 4YFXF 1XMKA 2E1NA 5LHHA 5LRRA 3R61A 1TQMA 2Q2EA 2BEOA 3EETA 5ILUA 1W4MA 5E1XA 4A0ZA 1K7AA 1KQ8A 2LKPA 1TTYA 1BIBA 2ZJ2A 1KGSA 2V1XA 1SMTA 4B09A 4EM2A 4YFKF 3HRTA 3FMSA 3MZYA 1KYZA 2ZMEA 2OZ6A 5BPIA 1CF7B 4MTDA 2EB7A 1Z6RA 3T5XA 1J59A 1REPC 5L3EA 4ZZDA 1CGPA 1QQIA 3WGGA 2JRTA 5HLIA 4IHSA 4L5JA 3HUGA 3FMQA 4O3MA 2FU4A 3Q9VA 2P7CB 3BWGA 4Y17A 3M8EA 5FD5A 1D8KA 4OIOF 1LB2A 4U88A 3IWFA 4U7BA 2Z3YA 5D5XB 3KZZA 4G8XA 2RVCA 5ICEA 5FLXK 1G4DA 1BIAA 1MGTA 3ECOA 5D5UB 2V1DA 1WKMA 3GEZA 5ILSA 3F22A 2XKOA 2GA1A 2BV6A 4R1HA 1TQIA 4LJZF 2K4BA 4KDPA 2FEZA 5K5RA 3MWMA 5HOOA 3R6SA 5F1RA 2ZFWA 4HX7A 3HOTA 3BOQA 1FPQA 3U9GA 4OIPF 3EYYA 4U0VA 3RYRA 1KU7A 2F5CA 1LEBA 2DO7A 3H92A 2HGCA 3KLOA 3HRMA 4YFNF 5JI6A 2K86A 1KU3A 2UWMA 5FD6A 3RKWA 1QW1A 2EFQA 3KP3A 4CXFA 3KETA 1O7FA 2NS0A 1EV7A 5A2QZ 1T98A 2CO5A 2EFPA 1T0FA 2DLLA 5L3CA 1UFMA 3WE3A 2EK5A 2PEXA 2EV6A 1JE8A 5HVQC 2CWEA 3IC7A 1T39A 1XDUA 2M30A 2K4YA 4TV7A 1PP7U 2IW5A 1OMIA 2W85A 3FHZA 4GGGA 3REOA 4Q48A 2H3JA 1L0OC 2L4MA 2VBWA 1Q1HA 2DQRA 3L7WA 4G94A 5FFZA 1R36A 1U8RA 4EV0A 3W6JB 1FBUA 1ZHFA 3IHUA 3C1DA 3MFKA 1IXSB 4A12A 1Z7UA 3TO9A 2PBIA 4D0PA 1LQ1A 2VT3A 2DPUA 4UHTA 3PFIA 2EWNA 2MBFA 4KUMA 2HR3A 3O2PE 2QYOA 2HTSA 2ESHA 4EJUA 3F72A 3RI4A 1HW1A 1P6RA 3I4PA 2O0YA 2O8XA 1Z91A 5EEGA 3I71A 4CZZA 5LBQA 4P9FA 3F8FA 3C3WA 4IJAA 5DEQA 2EA2A 3I53A 4MQ9F 1BI0A 3K0LA 1W7PA 2L02A 1B59A 1IN8A 1ZRCA 1ODDA 4A2UA 1MD0A 4RGRA 1FP2A 3ZMDA 4G7OF 4G6DA 2UXNA 1YTYA 2IPQX 1U5TB 3SFZA 3GZ5A 4LLGF 4L0ZB 1XMAA 3QAHA 3QPHA 1QNTA 2HTJA 4OU0A 3HOSA 1B9NA 2P6TA 3F8NA 2CYYA 1LEAA 3EDPA 3M9AA 4HDUA 1F4KA 3WTZA 3I54A 3JTGA 1OYWA 5CVJA 4HF1A 3J80Z 1KYWA 2PI0A 4LG0A 3FF5A 4WXCA 5HS7A 1FX7A 2L3DA 1R7JA 3ECHA 3TGNA 1HXDA 2K4JA 1FOKA 3F6VA 3J81Z 1PDNC 1U5TC 3BDDA 2ESNA 4M9SA 3VODA 5BPDA 5HDNA 1RUNA 1WWXA 3T1BA 3QU6A 1BBYA 2ISZA 2JT1A 1FBQA 4I7HA 5H20A 4MTEA 3JAMK 1QPMA 3HSRA 5JVTA 3F3XA 5K5QA 4CO8A 3V7RA 2MH2A 5AIPA 4YIIA 1Z1DA 5LGTA 4PGHA 2KIUA 2IT0A 1XDSA 1XSXA 5F64A 5DUIA 2D1HA 3SQNA 2ZNYA 2QVOA 5JR3A 3NQOA 1U6GA 2R7FA 5D6EA 4M6YA 1W5SA 1CF7A 3K9TA 3HRUA 2E7WA 4FHTA 1KA8A 1FZPB 1W7PD 4WXHA 5ILVA 1FC3A 3OOPA 3E97A 3MHXA 1UB9A 1RIOH 2JZYA 5AIQA 1QBJA 2FNPA 2HEOA 4YIFA 2MD5A 1O3QA 2EJRA 2RDPA 1XCVA 3ABTA 1MDMB 3LA7A 3LQQA 1YQAA 1P4WA 2XIGA 1Z05A 1J5YA 3RPUA 3LAJA 1ZREA 3ERED 1T2KA 3GFMA 2D45A 1IAWA 2GAUA 2O61A 3IKTA 1I1SA 1ZG1A 2OBPA 4IRIA 4AVPA 1GXQA 1OR7A 3GX4X 2YR2A 3KP6A 3K2ZA 4KIFA 1HSTA 2BBYA 1DP7P 1S8NA 1IUYA 4IHTA 1HKQA 3FXRA 4LLNA 1S7AA 3GWZA 5L3BA 4GYIA 1ZN2A 3F6OA 5D4SA 4RB0A 3WTYC 1ON1A 1H0MA 4CHUA 1K78B 1FSHA 4DNCA 2E1CA 3K69A 3Q9SA 2GIVA 1EH6A 4M74A 2EV0A 4HBLA 2V1UA 2STWA 3R0AA 1MJAA 5FGMA 3V7SA 1HW2A 1J0RA 5D5WB 5DV5A 1P92A 3LQRA 4GXOA 1DUXC 3FM3A 1TLHB 1GXPA 6PAXA 1UHWA 2RGVA 5BMZA 2K27A 4HLYA 2QLZA 1FP1D 2NYXA 4GO1A 2DPDA 4ZYGA 2GZWA 2LNBA 2VXZA 3CUQB 3V8LA 1QGPA 4IPAA 4A0XA 4XLPF 3K1NA 2W84A 1HBXG 4MNUA 3DPTA 1ZG5A 5J8CA 3PQKA 3CO6C 3V8KA 2DBBA 1YG2A 2MC3A 4LGWA 2O3FA 4Q47A 1AOYA 3GFLA 1XGOA 4EM0B 2CFXA 3I59B 5IT9Z 2VBYA 5LHGA 4B8XA 2QQBA 2RN7A 2LF7A 1I27A 5J6XA 3FZVA 1TNTA 3QU3A 2OZUA 2LDUA 5AONA 3CUQC 4UV8A 3EUHA 1BC7C 5ICCA 2WWYA 4WX9A 3KE2A 1IN6A 4WK8F 3LA3A 2P5LC 4G7HF 2FA5A 3U2RA 1ZARA 3KEQA 2CW0F 3P9KA 4R79A 2C6YA 3TO6A 2GA2A 2OU2A 1Y0UA 3V4GA 3KP7A 2XAJA 4RAYA 2G7UA 4G9YA 2X0LA 4FX0A 2JTVA 2VC1A 2WV0A 3F8CA 3ZQ7A 3F21A 4ETSA 2COMA 1R58A 5BS6A 3DFGA 3MEXA 4ZYHA 1P4XA 4YG2F 4HW0A 2HWVA 5BOXA 1LNWA 1DPUA 2J5PA 2V79A 4NQWA 2VC0A 2M8EA 2IVMA 3N4MA 4BHBA 4ESFA 2FBKA 1XGNA 5DYMA 3K1MA 2KIFA 3DV8A 4ENKA 4CDGA 3KEOA 1D8JA 2XUBA 4RS8A 2JPBA 2FRHA 1VTNC 1WQ2A 3R60A 2OA4A 1U5TA 1OPCA 1SD5A 3BROA 2FF4A 3ELKA 2W25A 4LMYA 4EM1A 5D5VB 1LJ9A 4BAYA 4MEXF 3ISPA 4JQFA 4KN4X 3MCZA 5IT3A 3ZN0A 4HQMA 3JSPA 2FSWA 2L4AA 3BJOA 3QRFF 5E1ZB 4HLXA 3IKVA 3VOEA 1AWCA 4KYWA 4P9UA 5L3DA 2P8TA 2XAGA 2YX7A 4LFUA 3E5QA 5HDKA 2VBZA 2HQRA 2DI3A 1G3YA 3LFKA 3HYIA 2DT5A 2PLYA 2WC2A 2KJBA 2Q0OA 1JHFA 5EEHA 5LGNA 3IL2A 3GF2A 2PQ8A 5HS9A 5HDGA 1S6LA 2ZMEB 3HSFA 4U0WA 3VB2A 3E6MA 2DK8A 2DK5A 3WE2A 4KICA 1SMYF 2IP2A 3WU1B 2Z33A 3M8FA 2TDXA 2VONA 2O6GE 2PN6A 3FM5A 1ZLJA 3D0SA 2FOKA 1IN7A 1JXSA 2VBXA 1BI1A 5L3FA 4M9ZA 3RDIA 2RV8A 4XBFA 4HYEA 1F5TA 5J8FA 1IRGA 4LK1F 2L54A 2V6CA 2IA2A 1IZ1A 3JW4A 4PGGA 1GVJA 2EA4A 2Z5UA 4N9IA 3RYPA 2G7HA 4KFCA 5FO5A 5A2QK 1S7OA 4ENMA 5L3GA 3DKWA 2P5KA 3LAPA 2A6HF 4ENJA 2A5YB 2KIMA 2P6SA 2R3SA 2XV4S 3K1PA 2VT2A 4ZZLA 4PDKA 4KIGA 4ON0A 2CGPA 4UUVA 1JGSA 3O6BB 4XRFA 3ZN1A 2FBIA 1XGMA 4L0YB 1USTA 1XN7A 3S2WA 4HOBA 4A6DA 2DQLA 4A0YA 3ZMSA 1Z6TA 2MLGA 4A6EA 4S04A 4HV5A 3L9FA 4BHCA 3N97A 1FNNA 1B9MA 1EH8A 1WI9A 2ZO4A 1R23A 3C18A 3ZPLA 1D5VA 3WTXC 3WG9A 3R0JA 4XLNF 2MA3A 3E3VA 2A61A 3TKYA 2QUFA 2K02A 1D3YA 1MJBA 1A04A 5CYVA 1YS6A 4UVCA 1ZG3A 2NNNA 3GFIA 1XB4A 3EQLF 1XSVA 1TBXA 4U7DA 1J75A 3FMRA 5ED4A 1K78A 3C7JA 3E6BA 4IXAA 1B1BA 1UHMA 2BYVE 1SFEA 2VN2A 4UNOA 3I58A 4RB2C 1ZGJA 4I0BA 1HSJA 1ZAOA 4HAMA 1LDJA 1PUEE 2K5LA 2XROA 3ZMTA 4LK0F 2GQQA 2E7XA 1RUOA 5BQTA 4L9NA 3LA2A 4GYGA 3TQNA 3ZMVA 4CICA 4XSZF 1Z9CA 2FBHA 2DFIA 2DW4A 2OD5A 3IWZA 3HHGA 2NNYA 3QP6A 5DDGA 2AS5F 4K2EA 4JBAA 4EMSA 1QO0D 1YS7A 1R00A 2KJCA 4FT8A 1XCBA 4O6JA 5FFXA 2H6CA 3GVAA 2K5FA 2EV5A 2KKOA 3KP4A 1NHAA 2M45A 3OV8A 2L01A 1USSA 3HIFA 3HSEA 3O3KA 5E20A 1T6SA 3FX3A 1FYKA 3E5UA 2A07F 1BOAA 1HQCA 5LRSA 3J80K 5CLSA 2ZBKA 4L9JA 3I59A
chains in the Genus database with same CATH superfamily
5LHIA 2Y48A 4C5HA 3LL7A 2FJ1A 2V1NA 1ZLKA 2EYYA 1B4AA 5FJ8J 1M30A 1POGA 3U1DA 3HOWJ 2M0YA 3TQ7P 3DXJF 4BYYA 5C0MA 1LFBA 2A69F 1K6OA 3JRCA 1UHSA 4W1UA 3M4OJ 2H6BA 2RHXA 4L9VA 3A02A 3W6KB 3J81K 4MQVA 3GTMJ 2DIQA 3HFNA 4LUDA 4EJVA 2XGCA 3CO7C 1YLFA 3V42A 3G6EQ 3CJRB 1WHHA 5IH2A 2Z2SB 3TO7A 2PMUA 3BZ6A 4EJOA 2M4GA 1EFNA 1BA5A 2QM3A 2CRGA 1MMSA 1IGQA 3VYGA 2HBPA 2LF8A 3SDBA 4KITB 3WU0A 1K73U 1PRMC 3CCJI 1ZUUA 2P4TA 3EGDB 3BP8A 3B02A 3S1MJ 1YJNA 5KCMA 2AKLA 3CCSQ 1EH7A 4JX5A 3QZ5B 3OYCA 3HRSA 2ZPEB 4M77C 1XGSA 4UVBA 3IRRA 3VSKA 2VV5A 1S9HA 4RA2A 3WGHA 5E17F 1ZH5A 4MO7A 4AT1B 5KYYA 4ME7A 5E3LA 3VYRB 3B6AA 5I2MA 2ETHA 4ZNXA 4XRMA 2HXOA 2IA0A 4Y33A 1UE9A 5JHFA 4A4KA 3WTSC 4AIKA 2VPRA 4LIUA 1JT6A 2AKKA 1XD7A 1UMQA 1Q95G 3VPRA 1QVFP 4QWQA 1NG6A 2DJQA 3FBIB 3GMEA 4I0AA 4QPQA 2FYKA 5GAMd 2CT4A 3CCEQ 1G6NA 5M9OA 2LZ6B 4JRIA 5JLXA 1WGSA 2NWMA 3G6ET 1J2XA 1N9RA 2H3EB 5DM7R 3NGPA 5HK0A 2JTEA 5ICFA 3E6DA 2BHYA 2FZGB 1YJ9A 2P0WA 3BG7A 3M4YA 4IQJA 3TL4X 2ENMA 5I2SA 4DIQA 1R5ID 3MAJA 4ITVA 3S32A 1EJ9A 1GUUA 4HDVA 3CLQA 2JM8A 1BCMA 3DKXA 2CP2A 4I02A 3E2UA 3CCST 2EFWA 2GLOA 3PNWC 4J19A 3FRNA 4M75F 4AD9A 4J00A 3RIRA 1WRJA 2MOXA 3DQVC 1Q86C 2A28A 5I11A 1SHGA 1H8AC 3EH1A 2FUG2 4HX8A 4XICA 1LDDA 2G9WA 3H9JA 1P7IA 2YPRA 3H9QA 4IL6C 3GZ6A 2BW3B 2R7WA 2KYMA 4J7IA 4QVCA 5KE2A 3SHFA 1RPWA 1GXIE 1W5TA 5FB2A 2HKNA 3MO8A 3H3VK 2C0IA 2K3FA 3HM5A 4R0KA 4JZ4A 1MMAA 2ROTA 5E1WA 2FMYA 2C0TA 3LSRA 2A05A 1Z7LA 2F2XA 2LKXA 1HCRA 1VQ5Q 1FT9A 3CJNA 2EZLA 4XKWA 1VQPI 4J9HA 1IO6A 4ENNA 1K9AA 2FE3A 3J7AO 2K7LA 1VQ4T 1FOWA 4PSXA 3WTUC 2HPMA 3SZPA 1BI3A 2LTOA 1VQ8A 4A53A 3CC7A 1BCOA 2B0LA 1U3OA 2A6EF 5JLWA 1Q1VA 1Z3XA 1U3EM 3JV3A 2QSFX 3ZFJA 4C8QA 3HSBA 3JCMJ 2FEIA 2V9KA 3TEDA 4GCVA 3GTQJ 1WCMJ 2P84A 2EPFA 5IP9J 1C6VX 2M8GX 1OZ3A 2RHYA 4AU7A 1H3ZA 3HXLA 3WGIA 1TSFA 4KMUX 5LJ5h 1K73R 2DM1A 1S3JA 2OQGA 3A0BC 5CVVA 5EEAA 1JQQA 1LVKA 3CUOA 5CR2A 4C92C 1X69A 5LJ5e 2DAOA 2VKEA 1LPQA 1Y1VJ 4N9HA 1DDNA 3BPVA 1YHQI 2MPXC 4OB1B 4OMFB 1O9SA 2F5EA 3S93A 2EW3A 1W2BS 3G1MA 2L3RA 4KT5C 5FLXZ 1W36D 2YXYA 1HKTA 3INZA 4XTXA 1ZYRF 2M5WA 1AHJB 2GTJA 3I55T 1J09A 1KQ2A 2IEKA 2X6XA 2LX9A 3QG1A 5D8KB 4CGZA 5E79C 4AG1C 3ABKH 4RGXA 3SFMA 2DXIA 4J7FA 2UZKA 4YELA 1MH3A 2PVGB 3CCYA 2QG9B 1VQ5T 4DQ2A 4HPQA 4ESBA 1UGVA 2NLUA 3PM1A 2LVSA 1VQOI 3HOZJ 2DFFA 3PSIA 2JVVA 3HBLA 2JMAA 4L5GA 4LE9A 1T3SA 4P5NA 4OINF 1WJDA 3GTOJ 3HG9A 4XM3A 4RGUA 3OBYA 1Y0MA 1Q81U 1DP3A 2D6FA 3P5JA 1I1GA 4M78E 1NJIC 1WA7A 4M7AG 3GCMA 3RKYA 3H3ZA 5KVRA 2OTJA 3KZYA 4IUTA 2YS9A 1TQPA 5FU6B 2XDPA 2IA1A 4FT2A 2RQTA 1F9NA 4NC7A 2WB1N 4Z6YA 1STZA 1DGRM 3CPWP 3L2CA 3S6WA 2DLPA 3QWLA 4JYKA 3EUAA 4ZN1A 3WTTC 3OIOA 4FETA 2LQKA 2UXXA 2EGCA 2QQ8A 2Y69H 1U2WA 4BKXA 1FMWA 1TWBA 2F4IA 5B66C 1VQ9I 2ELHA 5M5YJ 1IREB 2J7IA 2VJ4A 2MWOA 2K2VA 3E6CC 1M1EB 3QBYA 2N8GA 1IW7F 2MLKA 4OMYA 2OTLA 4RTVA 1M1GA 5CCAA 1VQMI 3CCMA 3VSLA 1YITQ 3K70D 4NB5A 1M1KU 1UCRA 4F7UB 3O8VA 4KIBA 5DUKA 2JA8J 2E41A 1JKOC 2PG4A 2R5YA 4HF0A 4QIWN 3OYIA 2HDCA 3CP2A 3DBHB 1YX5A 3Q5FA 3GTPJ 3WODF 2UUZA 3MN2A 1JXOA 1KQSS 2DO3A 4P5OA 2D2WA 1IO2A 4AIJA 1HLVA 2VOPA 3W3CA 2DK3A 3VYHB 3MEUA 2DA7A 4MEYF 1OKRA 5DLQE 2F2EA 3FHNA 5ICGA 1MJ9A 4XLFA 1MBHA 2NUTA 1I07A 1I1JA 2XAHA 2GXGA 2NOJB 3OYGA 1PP8F 1FYMA 1KC8R 2WACA 2O2OA 4J9CA 1D1BA 2M87A 1X6GA 3SEMA 4J01A 3T9NA 1YJNI 1J9IA 1G2BA 1JO8A 1SAUA 4PKCC 2HKXA 4HSRA 2Y30A 4NNJA 5IHNA 5GANg 1H92A 2IJLA 1LDKB 2DPPB 1ONVA 4CYDA 2ZCFB 3G4ST 1PUFA 1HKSA 2Y31A 4RMNA 1SD7A 1YW7A 3SEQA 2DL7A 2DXUA 5FU6C 3URGA 2VKHA 2B86A 3I56T 3CDHA 3X2QH 4KN7X 1WJRA 2RMOA 2EYZA 3EYIA 2D5VA 3S16J 5CKFA 5KCHA 5GAOp 2WAQA 2IIMA 4D7NA 1AZEA 1IN5A 4XSXF 3QPTA 2DCEA 1JEGA 3UR3C 3A8OB 2V26A 1OQYA 1XMXA 3DF8A 4E70A 4BQAA 1YITT 3JREA 4U87A 2MIOA 2LY9A 5KCOA 1FYNA 3JR9A 1OCPA 3OL3A 5FROA 1JHHA 4Y13A 2IGOA 1WDXA 2PUOB 5CQGA 3HTSB 5IXBA 2Q8KA 3CJTB 1ZSZB 5LEJA 2FMLA 1SKUB 2DYIA 2L3SA 4MZPA 2IS6A 2RQRA 4MZMA 5C6SA 2KT0A 4BJTA 2QQRA 1GCQC 1Q81R 2XGXA 3C2HA 1YJ9I 1HDDC 2BE7D 1S7EA 2DFEA 1ENHA 3ABUA 2DXBA 2FNAA 1X4OA 2F5FA 5E3MA 4J9BA 1VQLI 4N4GA 3E9GA 3O5ZA 4QVZA 4O5VA 5F04A 2LY2A 2DN0A 1Y96A 2OJ2A 3CXCA 3M1EA 2P0QA 1VQKT 4A5NA 3QDRB 3LSTA 4IEJA 1QVGS 4KISA 3CC4Q 4M7AE 2GXBA 1F1BB 1MMNA 5GAMg 2RQPA 5GAN7 1RAHB 1WZ2A 3BPXA 4FSSA 4XKBA 2BTTA 5EG2A 2D1VA 3E7LA 1LJOA 4J6WA 2JVHA 3PE0A 1FMKA 1AWOA 5LEKA 1QZYA 4C8QD 1VQ7A 2IGNA 3JCUC 2R7TA 2QWWA 3PIOF 4I99C 3M59A 3V8JA 4J6XA 2H8WA 5FKNA 3G71A 4RGSA 1IB8A 1M1KR 4JDSA 2HPIA 3CJQB 4OOIA 2E70A 1S29A 3M0SA 2GWRA 3REBB 1YE9A 2ISYA 2V9VA 2JN0A 5KH6A 1I6XA 2FZCB 5IT9K 2XU8A 3ME9A 4C5IA 3P7NA 3ULQB 1YYVA 2GFAA 3KFVA 4L18B 4E7KA 1W6XA 2AXLA 1O3TA 1P4AA 3CC7I 1WI7A 4RB3C 2X6WA 2HNIA 4MMKA 1Z3YA 1UZCA 4PLIA 1YRNB 4AWXB 3BFMA 1UELB 5DCMB 4HA8A 3X24B 4QLCU 2XVCA 3RPQA 3U21A 1B72A 1ZSZC 3P9IA 5HLGA 4UXNA 3A0HC 1U1TA 3AG2H 1IHWA 4E4HA 2QBYB 2MF2A 3I5UA 1Y1WJ 4FT4A 3NWTA 3CC4T 3WHCA 1WX6A 2QQAA 1JU5C 3OS5A 3D7SB 1R22A 2PMZN 4ZTFA 1AKHB 1VQNI 3FXQA 2RQWA 3L09A 3M7GA 1V3FA 2HU9A 1A5JA 4JJDA 1NEBA 2DJZA 2VQLA 2X4YA 2Y4YA 3CBMA 3SWNB 2QEXA 2OCEA 2ZCWA 2X4HA 2H94A 3H6ZA 3H0FA 4ESJA 5JFRA 3KPHA 4KGXB 2BY3A 1BJZA 4F92B 5FLVA 4WCGA 2Q2EB 2LJ0A 1VQPQ 1R5GA 3M07A 2HQ5A 2W57A 3BR1A 3BTIA 2R7VA 1SD4A 1BU1A 2E1OA 2ME0A 2VPLA 3O8HA 4ABZA 1R5HA 5D8LB 4MMLA 3UF4A 2XAFA 4RAFA 5JHUA 5ERIA 3BJ6A 2Z99A 5LL6S 2H09A 4MZTA 4H0EA 3CCVQ 3KFWX 3QZ9B 2JA7J 1EA3A 2K9LA 5J4YA 4Y15A 4Z2YA 4F7ZA 2EYWA 4UUSB 1MMGA 3IUOA 3CCLI 2XRNA 2M0OA 3NARA 1YHQQ 1IF1A 2OTJI 1E2XA 3FXUA 1ZHIA 2FQ3A 1BYMA 1MW7A 2A3SA 2LVMA 4WWCA 1N8RC 1L3LA 2YUQA 2HFHA 1F1ZA 4I98B 2J5OA 1I5LA 1WJAA 4NC6A 5HLTA 4E2FB 2HQNA 3SXYA 1YFHA 3LH0A 3KCCA 3GF5A 3OSVA 3WXMB 1LOJA 2KL4A 3FISA 4Y7NJ 3RESA 5FRMA 3GTGJ 3SFIA 3TDZC 3HFOA 2P7VB 3J7ZI 2PFBA 3H0GJ 2L8DA 3EHQA 1VQOQ 1YO5C 3JRHA 3ML6A 1MBEA 3FKIJ 4GBQA 1H641 5TJJA 2RF0A 2OJED 2OTLI 2W0ZA 4FYYB 3SWNC 2BE5F 2CSQA 1TW3A 4HZFA 3HUGB 2VE8A 3HKSA 3CCMI 1KQ0A 4L5IA 4II3A 4M6XA 5KK1A 3A8MB 1WH7A 1P2FA 1WSUA 4Y52J 1OLTA 5GAN3 5CAIA 4OIQF 3JCMW 3C0CA 4EVIA 3S2DJ 3CCVT 3JB9G 2GCXA 4R8HA 2L3QA 3GTLJ 3ASKA 2DJNA 1J7KA 2EFNA 3JRDA 4XTYA 3VS4A 2E65A 4CCNA 1GHCA 1YHQT 4XLAA 1WQ7A 3WU2C 4WXDA 1AA7A 5KYWB 2PJRA 3ABLH 3SYTA 4CCMA 1O7LA 2HOTA 1ABOA 4BH9A 3VFZA 2GIZA 2DL5A 4CYCA 3PL8A 2DTRA 2JPCA 3TOAA 3L1PA 2DBKA 3EH2A 3DP7A 3GXOA 2FRWA 1FWZA 3NHNA 3QXEB 2BGCA 3DPUA 2ZJRF 1KD1U 4EGZA 4BBRJ 4PJNA 1IN4A 2M34A 3PQJA 1TT5B 5HS8A 2EAYA 3ZMUA 3EG9A 4HF2A 1VQ9Q 4Q5SF 1OEBA 2G6FX 3I9V2 1QU3A 1TNSA 1I8FA 2ZNZA 5GTHC 1ON2A 3EHRA 1G3TA 2Y75A 2A68F 1PNJA 1PKSA 4M77A 1KU9A 2ACJA 4AIHA 1VQOT 3ESWB 4M72A 2MGQA 5A0GA 1UG1A 4PJOB 2RNJA 4OIRF 4M71A 5GAGJ 2LP5A 4AIDA 2OI3A 5GAOm 4IUVA 3PTAA 4HRIA 4G7ZF 4DOZA 3JCMf 1Y8RB 5GMKi 3MZHA 3R4KA 3RKQA 2P5VA 5GPAA 2R5ZA 5TGTA 1LE8B 1MBGA 4U0YA 2XK0A 2KSSA 4HNUA 4XU1A 3M9QA 3OSFA 1K61A 1QLYA 3HL8A 2Y2ZA 2K9MA 5IN1A 3I3LA 2L3PA 2LCLA 4WTOB 5C4JJ 1ACIA 4ASNA 1U1SA 2J6KA 1WPYA 3OQ5A 1TL8A 2QGFB 1YJNQ 4G12A 2YSRA 1KQ9A 4KMFA 5GPCA 2Y9YA 3MQ0A 1IGUA 2Z1DA 2DEQA 5C3EJ 1G5VA 1ZRFA 3H9GA 1X6BA 4R55A 1FJLA 3OB9A 1IRFA 2DZCA 2HDAA 2CYZB 1B8IB 4C0DB 2K9QA 1LFUP 2BY1A 2DX1A 5J47A 2XDBA 2FOWA 4JK1X 5KNLA 3JCMb 1MDMA 1XSDA 3NEUA 3JRIA 5B1AH 4A5MA 4NQWB 1A31A 3Q1JA 1TW2A 1M2VB 3EUHC 3R6OA 4EMKA 2O8KA 3CCJA 5D6FA 4FX4A 2H27A 3GBQA 5H6RA 1K79A 3OR2C 4F16A 3JAMZ 5LGUA 3L2ZA 2PZ1A 3MCAB 1WH5A 4IHXA 2K5IA 3V7CA 2OPTA 1FBSA 3UWNA 3EGDA 1D0ZA 3LWIA 3I0TA 1KIKA 1DPRA 3CDIA 2XF5A 4RAZA 3G71I 2STTA 4B43A 1KU2A 2K40A 2RQVA 4M7DA 5DD4A 4S05A 3VDXA 2EJGA 2F1LA 4GY5A 1MNEA 4EEFG 2E19A 2DTOA 2M1BA 2QKMB 1WJ5A 3F8MA 2D8JA 2Z9OA 4PJOC 1YJ9Q 1SFUA 4XU2A 2LT1A 2XICA 2VLAA 4N0BA 2P0PA 2K79A 2NVUB 5CJ9A 4B1RA 3KYLA 2LCCA 1YJNT 4A3MJ 3BG9A 2CS3A 4ZYDA 2XKOC 1R1VA 5E8IA 1JJ2S 5LLQA 1YW9A 1JI8A 1X6OA 1OYXA 4I09A 2WTEA 2VJJA 2JA2A 4PFPA 3L2RA 4OMOA 5I22A 5LJ5g 5KAFC 5CVRA 4G6QA 4C3JJ 5GAOr 3QUIA 1KD1R 3FC3A 2EKOA 3LGFA 5F6FA 3R6NA 4IVNA 3A8LB 4HV6A 4QW2A 5FW9A 4M78B 4Q4ZF 2VUMJ 1UJ0A 3UPUA 2JVGA 2KP6A 3RJPA 4BI3A 1YIOA 4C92A 1RZ4A 1MMDA 4M9XA 2RM4A 2XB0X 5FLXE 2QEXI 2F5DA 3GUDA 2ZPHB 2QENA 4B3XA 2BZYA 4KGZB 4C0DC 2HKQB 2E71A 2XGEA 3GW2A 1E3HA 2HYGD 2K9GA 4Y92A 4ZGEB 2O4XA 4FSXA 4C8QF 3JB9J 4HVVA 2EFIA 2F5KA 4EMHA 3CCRA 3CMEA 3GO5A 4HQEA 4E6RA 1NE8A 2QQ9A 3DPLC 3HP9A 2JSCA 5HLHA 2ZJPF 3NRVA 2RNAA 3SZTA 1VQ8Q 3CC7Q 2K9NA 4HKEA 1MZBA 2XKPA 5CKHA 2QF7A 1H9TA 2AIRB 2X3WD 3W2VA 2X9HA 3CP8A 1I5ZA 2IS1A 2BW3A 2LG4A 1Y71A 4C5GA 4LB6B 2V1RA 4PL6A 3GYHX 4OMZA 5E8GA 2ICWG 3ASOH 2BZXA 1A0NB 1BC8C 4E7ZA 1BBZA 1R1TA 5F0HA 2KRFA 3FXLA 4RTTA 1VZ0A 3G73A 5H2FC 2XSDC 5GP9A 3OA6A 2QGUA 1NH3A 3HHTB 2QDYB 4KA4A 2YX4A 3BQZA 2FQ4A 2NRAC 1W2BP 1GFDA 1QHGA 4PCQA 2P4WA 1T38A 1SG5A 1QVPA 2EFOA 5K5OA 1X3UA 1G3SA 1MBJA 3ZQLA 2JM9A 5E18F 2WSCE 4LUEA 2A36A 3KP5A 1TWGJ 1MNDA 2YU3A 5GADJ 2COWA 2RB6A 1D5YA 3JRFA 2GTOA 3HHHA 4M78C 1RRJA 3QSUA 3F8BA 2BY0A 1V4RA 2SEMA 4KJZA 2LJ1A 5ECAA 4HT9A 4FE4A 2Y0MA 4RTWA 1VQ8T 3CC7T 3KYCB 4E7HA 2QDLA 1WI3A 2EJFA 5CIUA 2QA4A 3ROUA 3QOPA 1R1UA 2CU7A 2XHKA 2M0MA 4FE7A 4E7IA 1FIPA 4RB1A 2XF6A 4BNCA 1H8KA 1IV8A 2AZVA 2O31A 3H1CA 2OTJQ 4PJMA 1ETYA 3CUQA 1NK2P 1RR8C 2XDDA 1OCZH 3COAC 3WTWC 5JVGF 4B4CA 2EQJA 4EDUA 4LOCA 1HF0A 3LSHA 2HS5A 4BHPA 1T0FC 4ZYEA 4BE0A 3BY6A 1GDTA 1MSEC 4KNYA 2QGGA 4M77D 1D0XA 1UHFA 2LYCA 3FIFA 3PT9A 1SRLA 3P8BB 2CSOA 4LLLA 4DYQA 4F3QA 2BZ8A 5KHDA 2CQKA 4ZYAA 1FSEA 1C0WA 3QP5A 3UT1A 1P7JA 2V8JA 4J9FA 5CVUA 1T95A 4P96A 1OYIA 5K7HA 3VRZA 4BI4A 2LCSA 5E3OA 1H9GA 2YDLA 4KUDK 4EGYA 1E17A 3BDLA 2DA4A 3JRAA 1ZR2A 4GFBA 2OTLQ 2DL8A 3OYYA 1K0XA 5E3NA 4GLMA 1ZBJA 2OAZA 2VODA 3L00A 3CCMQ 1VQ6A 3E9FA 3LLRA 2KZGA 1IXRC 3DEWA 4FTHA 3H3UA 2X4WA 4D8KA 4XTWA 4AC0A 3GFJA 3KZIC 2ZSIB 4M7AB 1KC8U 1G3WA 2JUGA 1TZLA 2KE9A 3VS0A 5BNGA 1Q7YU 1K4SA 4IURA 4C0GA 3RTRA 3LYIA 3PNVA 2EQKA 1O57A 1U78A 1Z0XA 2CH4W 3M0RA 1KQSP 1UHCA 3DB4A 2RN8A 3HPGA 1R49A 1V5EA 4IIMA 2QXFA 2LSOA 4PLLA 2KDZA 3HZJA 3A03A 1TS9A 1WHUA 5FLMJ 2ESWA 3IRQA 5D4RA 3OYNA 1E6GA 3D5LA 2CG4A 1W4SA 2HYFA 5GANd 5CQEA 5C44J 3VEPA 2B8AA 3DEUA 4LD5A 1AWWA 2DMUA 1GCQA 4MDWA 4FL6A 2M0CA 1FY7A 2D1XA 2DL4A 4RTXA 4F7UA 1VYUA 5H6QA 2DXTA 2ED1A 4L5EA 3LNQA 2BVLA 2LKSA 5LFAA 3T8TA 1LCKA 3T8RA 4M7DD 3TDUC 1B6AA 5CVIA 4JX6A 4BY1J 4L59A 1W7PB 2WAEA 3META 2IBDA 1GT0C 2PJPA 1ULYA 3VUZA 2E4HA 1ZRDA 1CSKA 4KH1B 1BI2A 2NS7A 3T0YA 3AAFA 2CP0A 2EIJH 2LH9A 4UV9A 4E7SA 3M0PA 3MP8A 2OQRA 2XC7A 1NG2A 1E7OA 2I5UA 2RKHA 3LSKA 2R92J 1VUBA 2V9PA 4DYCA 3ZMZA 2MCNA 1BN5A 3JTHA 1HW5A 1DJ7B 3TOBA 2RI2A 4IF4A 4JS4A 3FWEA 2NAZA 4ZH4F 3B73A 1IRZA 1OYYA 5GAHJ 2J6OA 1U8BA 3BJAA 4GLKA 2R7DA 4EQQA 1RNLA 2PMHA 1GCPA 4M7AC 4WF2A 2VQCA 2GOXB 4D8DA 1ETWA 2KHMA 3DU6A 5GAOn 5GANj 4C92D 4E7JA 3WTVC 5TRDA 3LWFA 4M73A 1C0MA 3A2KA 2DA9A 4M75G 3HL2A 2JJ9A 3OMYA 4P1WA 3HTUA 4M78G 4BQNA 1K4US 1N9SA 1YN8A 1OX8A 1YJWA 4NHJA 1RL2A 3M5AA 1O3RA 4PZJA 3LSMA 1RI7A 2HDDA 4BXUA 3RKXA 2ZXJA 4D1QA 1G8XA 1WFXA 4C2UA 2ADUA 3H9NA 3QODA 3ZRGA 4NOYA 5LJ3f 5K1YA 1K0SA 1E6HA 2RJEA 3CZ6A 3JSOA 1Q82U 1QVGP 4J9DA 1ZSZA 1OI1A 2KI7A 2XD0A 5J26A 3MP1A 3I64A 1VQ7Q 2XASA 1PD1A 2ED0A 2MK5A 1D1AA 4OB2B 1VQLA 4XQ3A 2CW8A 3THKA 3PMTA 3G71Q 3P9CA 4I01A 1UTIA 3CF5F 2HKOA 2O03A 3KP2A 5DD8A 4E47A 1Q86U 2JRMA 2NS8A 3E5XA 4JJNK 1YI2A 3TU4K 1O3SA 2BOLA 3CCRI 1RLQC 3CMEI 2K2MA 1GV5A 2CMPA 4X0GA 3ZQIA 4LG0B 3M56A 1BJAA 5CKTA 1LVAA 4HX4A 2HOEA 4LB5A 4A3DJ 3KLNA 4I2OA 5GAN2 3FJPA 2E1HA 5EG0B 1FIAA 1X1DA 2DU9A 2MH9A 4DBHA 1M1FA 1MKMA 1JUPA 2WSEE 2IRFG 1ZUYA 1F43A 4Z88A 5L8RE 2DVJA 4UVAA 3CCET 2RC4A 3CLOA 5GAMj 3MEWA 2FXAA 1WJEA 3DWLE 2LR8A 5IPAA 1YFNA 1BL0A 3SJMA 1R77A 2X48A 3L2QA 4B47A 4RCBA 5KYUA 4DOWA 4ESRA 1IXCA 1QZZA 2XAQA 2CUDA 4L9TA 3E19A 2R7OA 4DJAA 2A6TA 2VE9A 3CTAA 3H0DA 2QEXQ 3C2BA 4MGRA 3W2WA 1VQ7T 1SD6A 4HNTA 4IRGA 1D3BB 1FOYA 4EJWA 2QZ8A 2KVQG 5J3BA 2BXYA 1YW8A 1SFXA 3ZP5A 2VQGA 3HOUJ 4ZTJA 5DCMA 4LDWA 1ZGAA 4Z02A 4PK4A 4NDLA 1UJ8A 4B48A 2I10A 2A37A 5AYFA 2HZTA 1HD3A 1FYLA 3TBIA 2HNHA 2W24A 3G3ZA 2X51A 1ERDA 1FLIA 1RC9A 5DCFA 2QBYA 1T0HA 3QYFA 2V7FA 4EJTA 4IRHA 3GLXA 2E5QA 1SEUA 3BZCA 1VNDA 4A3IJ 4DYRA 2QA4I 1BM9A 1AKHA 2ZKZA 1SAXA 1TP4A 1IHVA 3SWNA 1I81A 4P55A 3F23A 1YCSB 3CXCS 1T0JA 2XIDA 4C0FA 5GAN6 3CCQA 4MHGA 4YFXF 2LQWA 2DA5A 2Y90A 1SHFA 3WVEB 1XMKA 2E1NA 2DYSH 1KHIA 2RQUA 5LHHA 3PVLA 1KC8C 1RI0A 5J1RA 1ETKA 3R61A 5LRRA 1TQMA 2Q2EA 2BEOA 1PSEA 3PFSA 5F08A 2IPOB 4EMGA 3EETA 1A6IA 4LDXA 1LPLA 3OL4A 5CKBA 5ILUA 3RCOA 1QRYA 1MH4A 1W4MA 5E1XA 2JJ7A 4A0ZA 3QPSA 1K7AA 2A5WA 1OCTC 4IUQA 4M75E 1Q82R 1KQ8A 1NJIU 4C0ZA 2YHTA 2LKPA 3AFHA 1TTYA 1BIBA 4MFEA 3CCLA 2ZJ2A 2KDOA 2E12A 3M4GA 3EGXB 1KGSA 3PUFA 2V1XA 1SMTA 3OYDA 2E6NA 4B09A 3QPLA 1M4ZA 3ABMH 1M9SA 5IOZA 4EM2A 4YFKF 3FEOA 4OB3B 2IXSA 1MBKA 2TRTA 2VB6A 1VQ6I 2VKNA 5IAYA 1Q86R 1M90U 4JZ3A 3HRTA 3FMSA 3MZYA 3MZ8A 1ZLMA 2KMUA 1K9MU 1KYZA 2ZMEA 3J7AF 2OZ6A 5BPIA 1CF7B 4N4NB 4MTDA 2EB7A 1Z6RA 4UUTA 3T5XA 5J4VA 1R4NB 2DNUA 2PTKA 2QQSA 1SVMA 1NYGA 1Q81C 1J59A 1REPC 3OOUA 2CUBA 5L3EA 3RUXA 4ZZDA 5GAN5 1IC8A 1CGPA 1QQIA 3WGGA 3JAME 2JRTA 2FPFA 1MHNA 1VA7A 2G0EA 3EFSA 3DEEA 5HLIA 2KQWA 3H0IA 4A3FJ 5DTDA 4IHSA 4FU6A 2E2JJ 2CP7A 1H89C 3LX7A 3GLLA 3Q0UA 4L5JA 1ETVA 3HUGA 3DKYA 1QMCA 4M77F 3ZL7C 3FMQA 4O3MA 2O88A 4HVUA 1YWPA 3QHSA 2FU4A 4N4OB 3Q9VA 5GTIC 2P7CB 4FW1A 1BR2A 3BWGA 2JWTA 1OFCX 2VL8A 3RZDJ 1SVOA 4Y17A 1G59A 2D9TA 1K8AU 1YWOA 1YIJA 1H3HA 3M8EA 1WGXA 3HOVJ 4Y4RA 2KR3A 5FD5A 4QKUA 4V2FA 3HC7A 1M1KC 5HODA 3K4LA 3A8HB 5KYWA 6AT1B 3FK6A 1D8KA 2DBMA 5CPRB 5EJCA 4OIOF 1K1ZA 1JJ6C 5FKMA 1HK9A 2V6EA 1M2OA 2AZSA 4OMNA 2R4GA 2OAUA 4LN2A 3JB9I 2O9SA 1GBRA 1W36C 2RI5A 1LB2A 4D9JA 4U88A 3IWFA 1UGQB 1VIEA 1P9QC 1Y7XA 2K3PA 2RREA 4U7BA 2Z3YA 2F69A 1TC3C 5D5XB 3KZZA 4G6TB 3MKDA 4DEYA 4X34A 1Q7YC 4DZPA 4XN0A 1B34A 4XK8E 2R57A 4G8XA 2RVCA 3JB9H 2MWPA 5ICEA 5FLXK 1G4DA 5KYXB 4HXJA 4PJOA 1BIAA 1MGTA 3OYKA 2O01E 1WJBA 3ECOA 2A08A 3JSCA 3QOEA 1OV3A 3EG2A 1YJWI 4V2GA 5D5UB 2V1DA 1WKMA 2WBMA 3GEZA 3KIOA 5ILSA 3F22A 2DZ9A 1WYXA 4RUGA 2XKOA 1KZHA 2GA1A 1LE8A 2HZYA 5GMKh 1I6HJ 1NJIR 2BV6A 2EPDA 3J80E 3CCJQ 2NXNB 2KAFA 4R1HA 1TQIA 4LJZF 3BCAA 5GMKe 2M4KA 4M7DF 2K4BA 4C2MJ 4KDPA 4BEHB 1NPRA 2Z0WA 2FEZA 1PRLC 2H8RA 5K5RA 3MWMA 2DFHA 4HCKA 5HOOA 2DA3A 1M90R 1SSFA 3R6SA 2DFUA 1K9MR 5F1RA 2ZFWA 3CBOA 4HX7A 3HOTA 1YI2I 1WHLA 4PFZA 3J81E 2R5MA 2L9SA 2DMTA 1B8IA 2XG8D 4FYWB 4A4FA 1YIJQ 4ZDPA 3BOQA 3ERMA 1FPQA 2ZPIB 2VKVA 3FB9A 1N77A 5CQYA 3GTJJ 3M8JA 3U9GA 1U06A 2XI9A 4OIPF 2H1LA 3EYYA 4U0VA 4M77E 3HPWA 1Y6IA 2YLBA 2YLCA 1M2VA 2EYQA 2L89A 4JPBW 4RKUE 5LJ5d 3RYRA 1KU7A 4C5EA 5LJ3h 2F5CA 3MJXA 4FYXB 2L0AA 3S3OA 1LEBA 3DTEA 3NWSA 4RBOA 3CPFA 5LJ3e 4C92F 2DO7A 2J06A 3K70C 1JJ2P 3H92A 1VQMA 2HGCA 4BY7J 1QKXA 1RESA 2KY9A 4A3CJ 2K6DA 1VQ4A 3KLOA 1NEGA 2YRCA 3HRMA 4YFNF 5JI6A 3TSZA 3H35A 3H36A 2DT6A 4CZCA 3CCJT 3FXMA 2TCTA 4BXXJ 3H0HA 2K86A 1K8AR 1KU3A 3FK7A 4VUBA 3PFYA 3IAM2 4IZZA 2HSEB 2UWMA 1N5ZA 4MLOA 5FD6A 1GFCA 2HXIA 1OULA 3N5BB 5GMKl 3RKWA 1QCNA 1QW1A 2ZXWH 4JRPA 3D5SC 3CCRQ 3CMEQ 4XRSG 2EFQA 3KP3A 1OR7C 2ZXIA 3FDRA 2YUNA 1I0CA 2HVSA 2K3BA 5EZGA 4CXFA 4Z89A 3KETA 1NK3P 2LX7A 2RNGA 3I55A 1O7FA 2NS0A 4BBSJ 2A3LA 2QK0A 4LDUA 3G1LA 4MIMA 2RK1A 2DYRH 2ZC2A 1EV7A 5CKDA 4M78A 3VS2A 4MDXA 2BHZA 3F9KA 2OAWA 1NTCA 3RMSA 3QYGB 2VGMA 3BTLA 3H5NA 1KK7A 5A2QZ 3EUKL 4D5CA 3CCQI 2L7FP 2DAQA 2VVKA 2KLOA 1KONA 4QVDA 2UV1A 4M3FA 1X2KA 5IHKA 4F91B 4BB7A 3CCUA 4M7DE 1T98A 3VUBA 3K4MA 5CO7A 2LMDA 3MPUB 2CO5A 3ZQHA 4ZGDB 2EFPA 2KNBB 5FKLA 1T0FA 2DLLA 2EZKA 3LFUA 5L3CA 3TMOA 1HA8A 4FYVB 3CC2A 3CMYA 1S72A 1UFMA 2YRDA 2NVQJ 3WE3A 2EVRA 4C30A 2LDMA 2C0OA 1AT1B 1M3AA 2EK5A 2JN6A 1PSFA 2PEXA 2DD5A 1N8RU 2EV6A 2CKKA 1JE8A 3CMET 5HVQC 1PG5B 2NUPB 2FZKB 2CWEA 2LQNA 2HVRA 2F4OB 2ZAEA 2M7AA 2DMOA 2QA4Q 3IC7A 2KIQA 5HNFA 2M51A 4CA0A 1GV2A 2ZB9A 1JGGA 4II1A 1T39A 1PHTA 1XDUA 5C4XJ 4RDUA 3UDCA 4C92E 2EKHA 2X1DA 2EGEA 2M30A 1RADB 3M53A 4M4ZA 2K4YA 1IUFA 1JXMA 4TV7A 1VQPT 3W6VA 3CF2A 1PP7U 2K9SA 2IW5A 1OMIA 2W85A 3FHZA 3ER0A 2WA0A 3QKJA 4RG2A 3RMQA 4B9WA 4GGGA 3REOA 3FLGA 3S1NJ 2R0QC 2DERA 3JRZA 2CV0A 4Q48A 2H3JA 2HQHA 1TWCJ 1L0OC 2L4MA 1SPKA 2NYSA 2VBWA 3I4MJ 3NPFA 3SD4A 2EQRA 1IXDA 4N4HA 3LSJA 2JSPA 1Q1HA 2DQRA 4YEJA 3L7WA 1WHGA 4LD9K 2K7AA 4G94A 5FFZA 2VQHA 1QVUA 1R36A 4UB8C 1JB0E 1QVFA 1VQ6Q 1YIJI 1U8RA 2QSHX 1ZELA 4EV0A 3EGUA 4HCZA 3W6JB 4BACA 3S8PA 4XTZA 2AT1B 4NC8A 1FBUA 4MFDA 4PJOD 1YX3A 2FPDA 1Y57A 3MEAA 3G4SA 1ZHFA 2ZFUA 3BG5A 3IHUA 4BDZA 2F2VA 3C1DA 3OR1C 3MFKA 5KAIC 1IXSB 4E7LA 4ZGJB 1LUJB 3HOXJ 3I56A 4BD3A 4LITA 2L0KA 4A12A 1Z7UA 3TO9A 1GL5A 1VQMQ 2PBIA 4D0PA 3A01B 4F7UF 2YUSA 2VT3A 1LQ1A 2DPUA 4RLQA 3IQLA 2CP5A 3FXKA 2MG4A 2E3IA 2DRKA 3JCMV 4UHTA 1ARKA 2RJFA 1JRIA 4WCIA 4BXFA 2EH3A 2EWNA 2MBFA 3PFIA 3LGLA 2WB1A 2PNIA 4KUMA 2HR3A 1PUFB 3O2PE 2QYOA 2WADA 4XORA 1KD1C 2HTSA 2ESHA 3K6GA 4M7AA 4EJUA 1X4PA 3OYLA 2Y0SN 3F72A 3RI4A 4DBFA 1HW1A 3OYAA 2M9UA 1P6RA 3I4PA 2O0YA 4M7AD 2MFZA 2DMPA 2O8XA 1Z91A 1N25A 3BR0A 1FMVA 3FBNB 5EEGA 5LD2C 1VQ6T 2E10A 1AZGB 3I71A 5GAN4 3UA7A 4CZZA 2EGAA 2XF7A 1U9NA 1QP2A 1UB4A 2KMTA 3KX2A 3VYUB 1ZA1B 5LJ3d 4II2A 1GLNA 5LBQA 4P9FA 3F8FA 2PVDB 4BY6B 2KPMA 1FOXA 3C3WA 1EKEA 2XHCA 3PMIA 4Y28E 1VQKA 4IJAA 3HTRA 3H5RA 1VQ9T 2NVXJ 1YNZA 3EFOB 3PIPA 2KGTA 5DEQA 2DIGA 3C94A 2GNCA 2CP3A 2EA2A 3I53A 2FRYA 4B6MA 4MQ9F 4RLFA 1VQMT 3K2AA 4ZC3A 3SHWA 1BI0A 1OCOH 3K0LA 1W7PA 2L02A 2HEQA 4AMCA 1B59A 4BU2A 1X27A 2ECZA 1IN8A 4A3GJ 4FM4B 1YJWQ 1ZRCA 1ODDA 1QKWA 1R4MB 2DXCA 3C4SA 4A2UA 1MD0A 2RH2A 3TSWA 4RGRA 5EDNA 1FP2A 1MNMC 4NL3A 3ZMDA 3VWBA 2XPUA 4G7OF 2P0KA 1W0UA 1N78A 2AQFA 4G6DA 1VQ4I 1RAEB 2UXNA 5J40A 1VQLQ 4F04B 1YTYA 2X35A 3DLLA 1D0YA 5L23A 4ATOA 1PKTA 4C8QG 3F70A 2IPQX 2CQ7A 1U5TB 2CJJA 3NTIA 4FW2A 4AFZC 3K7AJ 2K57A 5EYRA 3SFZA 3GZ5A 4LLGF 3LSPA 1TOVA 2EJ9A 4L0ZB 2MMPA 2JTMA 1XMAA 2VC8A 4OVAA 1CKBA 1YI2Q 2CZ0B 3QAHA 1MV0B 2E1MB 2XPVA 2VWFA 3NAUA 3ZR8X 1VYVA 2K3YA 3KUFA 3QPHA 4M75B 3ZQQA 4BUGA 3CD6A 1NG7A 1WXTA 3SB2A 2ZGWA 4J9EA 4A4GA 4RTUA 4NS5A 4OP0A 2MSYA 3Q3SA 2HQAA 2QCOA 4A3KJ 2IS4A 4XOTA 1QNTA 1QCOA 2QI2A 3I55I 2FB7A 1RAAB 4BY6C 2EIFA 2HTJA 4OU0A 3HOSA 5HKCA 4XL9A 1B9NA 5M3FJ 4RM3A 2P6TA 1O75A 4AYBN 3EG3A 1V54H 3F8NA 2CYYA 5GJWB 1LEAA 3EDPA 5IY5H 3IAS2 5CQXA 2OUMA 3M9AA 2RHIA 2XPWA 1YJWT 4OGCA 4BS9A 3UNGC 1ORKA 3RBBB 3CPWA 2CV2A 2HYJA 4HDUA 2VUBA 1F4KA 4A69C 5F0FA 1VQ5I 5IHIA 3WTZA 3VS3A 3I54A 4PJ0C 3JTGA 3CCUI 4DBRA 1YJ9T 1OYWA 1WFWA 5CVJA 2E36A 4HF1A 3Q0VA 2X4XA 2RJDA 1SSHA 3J80Z 1KYWA 3KBGA 2PI0A 5GAOq 2E5NA 4LG0A 4BJ5C 3AKZA 1VQLT 1Z77A 1XPXA 2MI6A 2CUFA 5FU7B 1OU9A 1AU7A 1WPKA 2FG0A 4BJ6C 3FF5A 4WXCA 1SVLA 5HS7A 5EG0A 3CC2I 5HY6A 1FX7A 2KFDA 2L3DA 4KT6A 1R7JA 1S72I 1T3LA 3ECHA 3IH3A 1UJYA 3TGNA 1HXDA 4NUBA 2K4JA 1YI2T 1A6QA 4Y91A 5EGOB 1FOKA 4TVRA 2WY7Q 3F6VA 3ULRB 1VQNQ 4V2SA 2LP0A 3J81Z 1PDNC 1K76A 2M2EA 4F52A 1U5TC 1SANA 3BDDA 3HDDA 1M3BA 3WVDB 5IT9E 2ESNA 2JMWA 2M3AA 3BTCA 1XOVA 4M9SA 3VODA 5BPDA 2DL3A 5CK9A 1UG0A 5HDNA 3CCQQ 1RUNA 3OYBA 2ATCB 1WWXA 2F2WA 3DLMA 4IHVA 3T1BA 1SRMA 3TP0A 3QU6A 1D3BA 4M75C 1T56A 2LC2A 1VOMA 4B3AA 2O9LA 3CXCP 3G1OA 1EX4A 1IG7A 1RLPC 1BBYA 2ISZA 2J05A 1VI0A 2JT1A 3EFRA 2PMZA 3SDGA 1FBQA 5B5EC 4I7HA 1KQ1A 2JK3A 3I9QA 2X85A 3CCLQ 1Z21A 5H20A 4MTEA 4CCOA 3JAMK 1QPMA 3QJYA 1T33A 4YTLA 4EATA 3HSRA 3IH2A 5JVTA 1PJRA 3F3XA 3OMCA 5K5QA 4ELZC 4CO8A 2KK4A 3V7RA 2MH2A 5AIPA 4YIIA 1VQNT 1Z1DA 4LG3A 5LGTA 1JKRC 3VYTB 2W00A 2Y9ZA 1PYVA 2JTFA 1UGRB 2KBTA 5FU7C 2JUFA 4GRIA 3X20B 3GOXA 3A4CA 4PGHA 2RJCA 4C8QE 2KIUA 2IT0A 2YSQA 2HVQA 1XDSA 1XSXA 2L2OA 3G4SI 3QWXX 3CCQT 2E60A 2E35A 2HBWA 5F64A 3I56I 1WVRA 2KT8A 5DY9A 4CYCB 2B63J 5DUIA 2A7YA 3EGXA 3KXTA 3VU3C 2CUEA 4UB6C 1FXXA 2D1HA 4AG2C 2X1CA 1JTXA 2KXCA 3SQNA 2ZNYA 2R7XA 1NBEB 1NPPA 4LDYA 4NL2A 2RAEA 4Q5WA 4ELYC 3QYHB 2QVOA 4CSWA 5JR3A 3NQOA 1U6GA 2R7FA 2L7KA 5D6EA 2KZVA 3CCLT 3H41A 5HK3A 1WJFA 4M6YA 4R56A 1W5SA 2OTJT 1N75A 4DW6A 3K9TA 1CF7A 2BE9B 3HRUA 2E7WA 3FXOA 4FHTA 1KA8A 2KT1A 1DU6A 2BKDN 2JW4A 3CQTA 2WAQN 3OSGA 1FZPB 1JUMA 1CKAA 3H8ZA 1X2NA 4BE2A 3FDYA 4A3JJ 2CV1A 2COYA 3GBGA 4I6ZA 3RERA 4XU0A 2E64A 1W7PD 4WXHA 3PSFA 3G2BA 2VXFA 4KULA 4CCLA 4A3BJ 2LK2A 2W1OA 2LNVA 5ILVA 1HSQA 3DBLB 3RSNA 1EZZB 4QTRA 1FC3A 2CQXA 1QWFA 1OCRH 3BR2A 1E3PA 1VQKI 1S5LC 3OOPA 3FJ5A 1I39A 3C2GA 5FWCA 4KH0B 4PJOF 3E97A 1HC8A 4JRKA 3MHXA 2EZHA 2OTLT 4F7UE 4CC3A 1UB9A 1RIOH 8AT1B 5IP6A 2JZYA 5GAN8 2OCCH 2QYZA 3JCMh 1ETXA 4HCCA 5CKEA 3CCMT 1G83A 4XQFA 3JCMc 5AIQA 2W82A 1QBJA 2LT4A 2KRHA 3JCMe 2FNPA 4J5YA 2HEOA 4YIFA 1EF4A 2MD5A 1O3QA 2EJRA 4XR6A 2RD1A 2RDPA 4C9YA 1E3OC 2JA5J 1XCVA 2DT7B 1X2QA 2RO0A 4IUUA 3ABTA 5LJ3g 1MDMB 4XAXB 4DEXA 2LBFB 2DJIA 2KXDA 2LQ8A 1KSWA 3LA7A 2CSIA 3LQQA 2RPNA 1YQAA 2HL3A 4A63B 4A3LJ 1UUEA 4EMKB 4CI0C 3JCMQ 3CMAA 1P4WA 2QSGX 1YIJT 3GNGA 2XIGA 1Z05A 1J5YA 4DBQA 1OU8A 2E5KA 2R93J 3K4CA 4ZDLA 3RPUA 3LAJA 1ZREA 2NOGA 1X1AA 3ERED 2KRNA 5D6YA 1K73C 3I4NJ 2CS7A 3FXJA 2YU9J 4EPCA 5A2QE 2MD0A 3AG4H 3OS0A 1T2KA 3SZGA 2GQVA 4M7DB 1X43A 1WHKA 1R71A 5KYXA 4RMOA 3GFMA 2NUZA 4D6WA 1XJWB 3RDVA 5IYCJ 1GRIA 5HNHA 1QHHD 3CC4I 2Y0SA 3S15J 2JS0A 2D45A 2F6CA 3CD6I 4ZDOA 2LJ3A 3ZEHA 1IAWA 2GAUA 5J3LA 2O61A 2O7OA 1KFZA 3BCBA 3IKTA 1I1SA 2JS2A 1ZTRA 2AQEA 2CH0A 2OBPA 4CH7A 3BG6A 1ZG1A 2BY2A 4IRIA 1XQHA 5I21A 4AVPA 1GXQA 1OR7A 3BG3A 3GX4X 1DQUA 1PCXA 1VIFA 1W1FA 4KT0E 2E6ZA 2W4SA 2YR2A 4BEHA 4XKVA 1V1CA 3CEYA 2ID6A 3KP6A 3K2ZA 4KIFA 5M3MJ 4DOVA 3BZKA 3VJPA 4I76A 4V19K 2LLKA 1Q7YR 1VQ4Q 1HSTA 3OS2A 3VS6A 2BBYA 1DP7P 3HPHA 2W7NA 2ZJQF 4C92B 1S8NA 2L9VA 3W2AA 1HKQA 3FXRA 4IHTA 1IUYA 3EG1A 1Q82C 1NLPC 3GNFB 4XTUA 5KE3A 4B44A 4IOAF 1QQJA 4XNFA 3M54A 2RA2A 4LLNA 1XTDA 3CESA 1FTTA 1V29B 1ZKGA 2O4XB 1S7AA 3GWZA 5L3BA 1I3QJ 5IYDJ 1T08B 2PVOB 3A8GB 4UC4A 2ZPBB 4PJOE 2NVTJ 2COBA 1T8IA 2RQQA 4GYIA 3DB3A 4EMKC 1ZN2A 3ZXSA 3HGGA 5FRNA 4BI8B 2I2LA 9ATCB 4AFSC 4OGEA 4X6AJ 4LNPA 4M78F 3F6OA 4CCKA 5D4SA 4RB0A 3NTHA 3I55Q 5K7FA 1ON1A 3WTYC 1H0MA 4CHUA 1K78B 2FL7A 2YWWA 1FSHA 4DNCA 3CQZJ 3U1KA 3VYSB 2E1CA 2IVWA 2OX7A 4M7DC 3K69A 3Q9SA 4BDYA 1I5OB 2GQIA 3G71T 2GIVA 1YRNA 1EH6A 2XSJC 1APLC 2M1HA 2WSFE 4M74A 2EV0A 4HBLA 3IH4A 4XKCA 2V1UA 4GDFA 2HSPA 2E2HJ 3CCUQ 1RETA 2STWA 3R0AA 2ZXHA 1MJAA 5FGMA 3V7SA 2GXAA 1HW2A 5D7UA 5D6WA 1J0RA 5IXFA 2ABLA 2DE0X 3MVPA 1YOVB 1OQKA 1K83J 2FPEA 5D5WB 4Y3OA 5DV5A 2EQIA 3ZQGA 1TG0A 3CC2Q 1P92A 2CQNA 3LQRA 1S72Q 4GXOA 5F27A 1R8OB 1DUXC 3FM3A 3CCVI 2J6FA 2SRCA 4J83A 1HJDA 4AYBA 1WIEA 1TLHB 4N4IA 3JB9F 1TXQA 1X1CA 2B7EA 1WXBA 1GXPA 4QT7A 3GIBA 4IQ4A 3HEFA 1UHWA 4AVZA 3J7YJ 6PAXA 2RGVA 3E0JB 3K4KA 5BMZA 5DS9A 2COZA 4AFQC 3MKLA 5FKOA 4OF1A 2K27A 4HLYA 2DF6A 2CFOA 2GBQA 4HT8A 2LRQA 2QLZA 1FP1D 2NYXA 1BB9A 4GO1A 1QA6A 2K3XA 5GJVB 2QEXT 1KG1A 4KUIA 2DPDA 1QWEA 1EIFA 4N0AC 4XU3A 1GVDA 2GZWA 2LNBA 3CUQB 2VXZA 3DTIA 4ZYGA 3V8LA 5DM7F 3GTKJ 1TUCA 2CZ1B 2DD4A 2KROA 1QGPA 3DU5A 3QDFA 1WNLA 3REAB 4IPAA 3LSGA 4A0XA 1U9OA 4DGWB 1QZEA 5HCKA 4XLPF 3K1NA 2W84A 4UUSA 3EG0A 2LTPA 1WXUA 2DOFA 1MBFA 4HEA2 3HKZN 1AHDP 2HQEA 3CCUT 1HBXG 1XTAA 4MNUA 4M77G 4JJCA 5EF6A 2CGHA 1FEXA 3DPTA 2GBYA 4M6VA 1ZG5A 1PC0A 1NZ9A 1BKBA 2KRMA 2NUPA 2JXBA 1NYFA 1PVEA 1XX5A 5J8CA 1GBQA 3PQKA 3TVTA 3OW2S 3CO6C 3CC2T 3V8KA 2G3RA 1S72T 2XDVA 3JRGA 1JT0A 3DKMA 4CC4B 2DBBA 1WZOA 8ATCB 3DLAA 1YG2A 3S14J 2DDBA 2CZ6B 3PJRA 3H5AA 3LW5E 3JCMd 2MC3A 3VV0A 4LGWA 2O3FA 5M5WJ 4Z8AA 1BR4A 4Q47A 4C2TA 4BQOA 2D0QB 1AOYA 4OMQA 2VOOA 3GFLA 3OY9A 2L2PA 3CMMA 1XGOA 4EM0B 1M90C 2CFXA 3QYEA 1IZ6A 1K9MC 1Y07A 3G4SQ 3I59B 3JB9D 5GAEJ 1V5FA 1I50J 5IT9Z 1QVFS 2VBYA 1AVZC 2HD0A 5LHGA 3OIPA 3D1NI 3QQAA 4B8XA 2QQBA 4ZJZA 4L6V5 3I56Q 2RN7A 2LF7A 3AT1B 1QVTA 1I27A 5J6XA 2IAIA 5M5XJ 3VRYA 1TU0B 2L9RA 4BQQA 1YP5A 2X3XD 4M7AF 3FZVA 1TNTA 3QU3A 2OZUA 1BOBA 1QPIA 5K7ZA 3RPUD 2X4JA 4A3EJ 4CC2A 2LDUA 3PNYA 3CUQC 5AONA 3ZOBA 4OAZA 4JRQA 4UV8A 1UGPB 3EUHA 1BC7C 5ICCA 2WWYA 2PX9A 4WX9A 2R7RA 3KE2A 1IN6A 3B6CA 2ID3A 3LA3A 4WK8F 2P5LC 4G7HF 4A93J 1UDLA 4M7DG 2DTZA 1X01A 2FA5A 1TUGB 3OBWA 3IP4B 3U2RA 3CMAI 2LMJA 2Y4XA 1K8AC 4RTYA 4XIDA 2BIVA 1PWTA 1ZARA 1R9TJ 3KEQA 1ACMB 2CW0F 1KHCA 5DLOA 3P9KA 4R79A 2C6YA 3TO6A 3A01A 2GA2A 2OU2A 2MYSA 2FD5A 3PIPF 1XNIA 4FIBA 1Y0UA 3V4GA 4RCCA 4X9DA 2DDAA 1ZBXA 2WAFA 2LFBA 5KYYB 3MMYB 1VQKQ 3KP7A 2XAJA 4DA4A 1XG1A 4RAYA 2G7UA 1FTZA 3G6EA 3NFCA 3SDZA 4G9YA 3S1RJ 3S3MA 2X0LA 4FX0A 2KRCA 1ZX6A 1Y39A 1M5Q1 2LRDA 2ZZDA 2JTVA 2V8IA 2GOMA 3HGYA 2DOEA 2VC1A 3ONQA 2K85A 4PJJA 2WV0A 1YCYA 4BGDA 3F8CA 1V76A 3VS7A 4C92G 3ZQ7A 3F21A 4ETSA 2COMA 1R58A 2VIXA 4C3HJ 5BS6A 5J1YA 4M3GA 5GANf 3CCSA 3DFGA 3MEXA 4ZYHA 1MSFC 3RQ4A 5A0DA 1P4XA 4YG2F 3ZQCA 2VYTA 4HW0A 4PFOA 3DLLF 3I5SA 4J6YA 2R58A 4XK4A 4OMPA 3F0CA 1W2BA 2HWVA 1E0EA 1DGWY 3EFOA 5BOXA 1LNWA 2V4JC 1X1PA 1DPUA 2J5PA 2V79A 3BR3A 4FQGA 2VC0A 4NQWA 1Z9QA 2M8EA 2DILA 3UATA 1DU0A 2IVMA 2EZIA 3N4MA 4BHBA 4ESFA 2FBKA 1XGNA 5DYMA 2R5AA 2E5ZA 3CCEA 2R7QA 3A1PA 3K1MA 2KIFA 1RAGB 2DRMA 2HOAA 3DV8A 4ENKA 2BUDA 3CD6Q 2VJIA 2VASA 4CDGA 3CDLA 1HOMA 2QTVA 3KEOA 1D8JA 4ORZA 2XUBA 4RS8A 2JPBA 2FRHA 3WG7H 4IHWA 2DA2A 2HZDA 1VTNC 1SEMA 2ELKA 3EAEA 4PJLA 3P8DA 1W5CC 3OW2A 1WQ2A 3X26B 1X3ZB 1X2MA 1G2HA 2GFUA 2JUCA 5KYUB 4JLGA 4KBMB 3R60A 3A1YA 2BZTA 3AG3H 1LFPA 1YBYA 5IP7J 2OA4A 2QAZA 1U5TA 4RG8A 1OPCA 1SD5A 3LWHA 2F48A 2B9SA 3BROA 2FF4A 3ELKA 2W25A 3LSIA 4LMYA 4XN3A 4EM1A 5D5VB 4C8QB 4XONA 5GAMf 1LJ9A 2O9VA 4D7MA 2HCKA 4QQDA 4J9GA 1D1CA 1R6RA 1SC7A 4BAYA 2NVYJ 3OS1A 2ME6A 3M1CA 1VQ8I 4BUPA 4MEXF 4M75A 2QKLB 3AHUA 3ISPA 4JQFA 4KN4X 4S0HB 3BTJA 3MCZA 5IT3A 1D09B 2DTIA 2F4MB 2FHDA 3LH5A 1M3CA 1WJSA 3ZN0A 2IG0A 1O4XA 5LJ5j 5GAOl 4HQMA 3VS1A 2EINH 3JSPA 2FSWA 2L4AA 3BJOA 3OMGA 1VQ5A 2M9HA 4HG2A 1IJWC 3BDUA 1JKPC 3QRFF 5E1ZB 4HLXA 3CD6T 3IKVA 1V55H 2V1QA 1TWAJ 3I35A 2W48A 1NLOC 3VOEA 5J1UA 1MGQA 1AWCA 4HVWA 1X3WB 4AFUC 2MABA 1KQSA 3BQYA 4KYWA 4P9UA 5DM6F 4XMYA 2DA1A 5L3DA 2P8TA 3M3YJ 4JUVA 3VS5A 2RHZA 3MKWB 3PGGA 2XAGA 2KYBA 1S1NA 2YX7A 1TWFJ 4LFUA 1OOTA 3E5QA 2EQMA 3QIIA 2WY8Q 2VKDA 5HDKA 3PVQA 1VFCA 2EIKH 2VBZA 4FISA 3CCRT 2HQRA 1CQTA 2DODA 2DI3A 2EYXA 1ABQA 4UY8I 2L7ZA 3L2VA 1G3YA 2HOSA 1LKXA 2R7SA 5D6XA 4RTZA 3OYJA 5EGOA 2PQWA 2IGMA 3LFKA 3HYIA 1TWHJ 2DT5A 2PLYA 4BL0B 5FWBA 2WC2A 1RI9A 5EC7A 2KJBA 2Q0OA 4BE1A 1JHFA 3FKJA 5EEHA 5LGNA 3IL2A 4E6KG 1IDYA 5F1JA 3GF2A 2KISA 1TH7A 3TP3A 1ZA2B 3BR6A 4C8QC 3ZCOA 5FKKA 2PQ8A 2WV1A 5B1BH 2DVEA 5HS9A 2ECCA 5HDGA 4IUPA 2FVUA 2HMAA 4CRIA 1AEYA 1BK2A 1S6LA 1R0BG 2E34A 2ZMEB 3BLYA 3HSFA 3S17J 4U0WA 4X1VA 2JOYA 3NMZC 3VB2A 1M8VA 1WJCA 2VXDA 1WLPB 4KRTA 3E6MA 2OV7A 1MUZA 1A36A 2P4RA 2PUKB 3CBPA 2DK8A 3FIWA 2VXEA 3M58A 4X9CA 1RABB 2DK5A 3WE2A 4KICA 1SMYF 2IP2A 2XB5A 3WU1B 1KJWA 1WHJA 2PU9B 4XLCA 4F93B 2JQ7A 2VI6A 2VGNA 4F7UG 2XAUA 2Z33A 2ECBA 1WJQA 3JRBA 4JX4A 2IS2A 1OPLA 3CPWS 3M8FA 2TDXA 1Z67A 4M3EA 3MEVA 2VONA 2O6GE 2R5YB 1R0CB 3LOCA 2GF7A 3MD2A 2PN6A 2YUPA 3JCMg 1AWXA 3FM5A 1C1AA 2QA4T 1ZLJA 2MW8A 1ZGWA 3D0SA 1M8MA 2E2IJ 3DBRB 1OX9A 3KYDB 2OF7A 2FOKA 3JCMX 1QVGA 3E1SA 1IN7A 2CP6A 3AG1H 2MC4A 2NUTB 1JXSA 3C95A 1AOJA 3PNTA 2ROLA 2F5TX 1BW6A 2VBXA 1ZQ3P 1BI1A 5L3FA 4M9ZA 3RDIA 1LNXA 2RV8A 1W1WE 1UAAA 2CW7A 1N6AA 2CDTA 2X6OA 4XTVA 1UG2A 4XBFA 4HYEA 2ZPGB 3I5RA 1F5TA 1XS9A 1X19A 5J8FA 2FO0A 3HKZA 3RR6A 2LY1A 1IRGA 1ZQ1A 1YITA 2L7MP 5GMKm 2OC6A 1AWJA 4LK1F 4B9XA 2L54A 2V6CA 1Z9ZA 3PO3J 1WQWA 1OZ2A 2IA2A 1IZ1A 2A0FB 1X58A 3JW4A 3WHBA 2CZ7B 4PGGA 1GVJA 2EA4A 2Z5UA 4N9IA 3G6EI 3RYPA 2G7HA 3AL0B 1QP3A 2ZMEC 1B34B 2O5RA 2L9NA 4KFCA 1I4K1 2E3HA 2M7BA 5FO5A 5A2QK 3IV5A 2M16A 1S7OA 3TREA 1ETQA 4K11A 4XLHA 4ENMA 3RQIA 1N8RR 5L3GA 4CCJA 9ANTA 1RUWA 4JJBA 3QYBA 1SF9A 4F14A 3DKWA 3CCSI 4XOPA 2I8DA 2P5KA 3LAPA 2A6HF 3SEZA 2ELJA 1SFKA 4ENJA 3UA6A 2ZSHB 2A5YB 4YIRX 2W10A 2DA6A 2KIMA 2P6SA 1UECA 3CMAQ 1RKTA 1N27A 2R3SA 5GMKj 4RAGA 2HAXA 2LREA 2XV4S 4PSWA 1Y56A 1OCCH 3K1PA 2VT2A 1PM3A 4ZZLA 4OMLA 4PDKA 1RAFB 1Y96B 1K4TA 1JJ8C 3G1JA 4KIGA 4ON0A 2CGPA 1U5SA 2EIMH 4UUVA 3L2WA 2RHUA 4M77B 3GPLA 1B3QA 2V8KA 1JGSA 4W97A 1SFOJ 3O6BB 4OB0B 3U23A 4XRFA 3BE3A 4OMMA 4XLEA 1RACB 3CCEI 2H8HA 3P8HA 3MKYB 2YT6A 1BR1A 3ZN1A 2FBIA 1F36A 1XGMA 3EPZA 4FASD 5KYNA 1BW5A 3GP8A 2LC4A 2DOAA 2LBFA 1MIJA 1IGNA 4L0YB 2XRLA 3QWYA 3OYHA 1USTA 2C06A 1XN7A 2HI3A 3OYMA 1UGSB 4M75D 4EIKA 5GANh 3S2WA 2CH4A 4HOBA 2GM4A 4HNVA 1HYOA 4M78D 4JP0A 4QQGA 1VQ7I 5LJ3j 5GANe 2P81A 4A6DA 3HB9A 3BY7A 2DQLA 4IKFA 3BC8A 5F0CA 4A0YA 3ZMSA 1IDZA 3K4NA 1Z6TA 3AL0C 4PNOA 2JT4A 2VJ5A 4ZN3A 4F17A 3CC4A 2YUOA 2MLGA 4A6EA 2JMCA 2AK5A 1QCFA 3CMAT 4S04A 1B07A 3PO2J 2GGRA 4HV5A 1B72B 2RI3A 3L9FA 4BHCA 2DEUA 3N97A 1FNNA 1B9MA 1EH8A 4KGVB 3QJ6A 1WI9A 2ZO4A 2Z16A 1R23A 4PUSA 3D5RC 2EQUA 3MP6A 3C18A 3ZPLA 3ZQFA 1JBMA 3O8GA 1D5VA 3WTXC 4H4KC 3WG9A 3R0JA 3TW6A 3M55A 3HOYJ 2R7ZJ 1TT0A 1JUSA 4RM2A 2ZPFB 1XC5A 3PIOA 2L5QA 2JA6J 3K10A 1WHMA 4XLNF 2MA3A 1ZUKA 1VQNA 3E3VA 4LDVA 1UEBA 2A61A 4AM3A 4F55A 2DYBA 1VF9A 2CUJA 2IGKA 4LD6A 2I0NA 5B3SH 2XGDA 3M0QA 3TKYA 2QUFA 2K02A 2X9DA 1D3YA 1MJBA 5GAMh 1A04A 5CYVA 1YS6A 1M27C 4JLIA 4UVCA 3VKIA 2X1EA 4AUXA 3RNJA 4N0AA 5GAMe 2M02A 2FX0A 2AO9A 5LJ5f 1ZG3A 1OJLA 4OAYA 1IV6A 5AT1B 2NNNA 3DTKA 3GFIA 2KEAA 1XB4A 3ASNH 5IYBJ 3L1AA 3LMMA 3EQLF 1XSVA 5EZHA 4M3DA 4IX7A 1TUDA 1TBXA 4U7DA 1J75A 2EILH 3L2UA 3FMRA 2RK2A 3M0UA 4X1EA 5J39A 3K4JA 3J7AY 5ED4A 2HDWA 4C3IJ 3JCMP 1IRXA 3C7JA 1K78A 2KQRA 3E6BA 4IXAA 3BW1A 3TEEA 2E1MC 1B1BA 1UHMA 2BYVE 1SFEA 2VN2A 2AHJB 4UNOA 3K4BA 3I58A 2DETA 3S1QJ 1VQPA 1PD0A 4FCYA 2CREA 4HCBA 4RB2C 3MKZA 1ZGJA 4I0BA 1JTYA 3OSSC 3OWTA 2XMFA 1HSJA 1K6YA 2R7UA 2LOOA 4ANJA 1ZAOA 4HAMA 3OYFA 2D8HA 5IOYA 1MV3A 1LDJA 1PUEE 1ZSGA 2K5LA 4CUGA 3S3NA 2XROA 3UKGA 2HQXA 2JZ2A 3CCVA 2CUZA 3ZMTA 4LK0F 1ZR4A 2GQQA 4J8OA 4LXCA 2E7XA 4XRSA 4QQ6A 1Y8QB 4OWRB 1RUOA 1U0JA 5BQTA 4L9NA 1OPKA 2DKGA 3C12A 3LA2A 1UFFA 1JKQC 4JS5A 4M3BA 4GYGA 3TQNA 3ZMVA 4CICA 1YHQA 4JOMA 2X6YA 1RKWA 2LNHB 4XSZF 3OYEA 4A4EA 2F5VA 1Z9CA 3RZOJ 2BVMA 2FBHA 1X1BA 1RAIB 3HJEA 2AHQA 4YRVA 4NBQA 3M0TA 2DFIA 2DW4A 2OD5A 2KDSA 3IWZA 2DMQA 4D5FA 3HHGA 2NNYA 3N05A 3QO3A 3QP6A 2K5CA 5DDGA 3OIQA 2AS5F 4K2EA 4JBAA 2PJRB 2QTXA 3OW2P 4EMSA 3X28B 1QO0D 2DTHA 2EBPA 1YS7A 2CT3A 2QASA 1VQOA 1R00A 2AXTC 2KJCA 2Q1ZB 3DCFA 4FT8A 1NM7A 1XCBA 5TISC 1I3AA 4A54A 4O6JA 5FFXA 2H6CA 3EG9B 3NTKA 3GVAA 1YITI 2EV5A 2K5FA 1TTHB 4IO9F 3X25B 3A5ZB 2D0NA 2KKOA 4J9IA 4PJOG 3KP4A 2DMNA 1NHAA 1X75C 2M45A 3OV8A 1J3TA 3ZBDA 1B7TA 3TCJA 2L01A 3KEYA 1USSA 1AD5A 3PUBA 3ZGKA 1RR7A 4QPOA 2LD5A 1OISA 2MAMA 3HIFA 2BXZA 3A98A 3HSEA 4A4HA 5A0LA 4CC7A 2YRVA 3O3KA 1ZK8A 1T6SA 3FX3A 5E20A 1FYKA 4IIOA 2JNGA 4IHYA 3E5UA 4HSTA 2A07F 2EBIA 3TW7A 1VYTA 3G7ZA 1ETOA 1W70A 2KRSA 1BOAA 2R5ZB 4DZJA 2H1KA 4LIVA 1W0TA 1ITYA 1V5GA 3M57A 1JJ2A 2CQQA 1HQCA 3Q0WA 3S2HJ 1Y0NA 5LRSA 1HDPA 3BR5A 3GZNB 4QSHA 5CLSA 3J80K 4IOCF 3BT9A 1A35A 2HL5C 2ZBKA 4L9JA 7AT1B 1VQ9A 1H88C 3I59A 3L42A
chains in the Genus database with same CATH topology
5LHIA 2Y48A 4C5HA 1ZLKA 1B4AA 3U1DA 3DXJF 4BYYA 5C0MA 2A69F 1K6OA 2H6BA 2RHXA 4L9VA 3HFNA 3W6KB 3J81K 4MQVA 2DIQA 4EJVA 3CO7C 1YLFA 3TO7A 2PMUA 3BZ6A 4EJOA 2QM3A 3VYGA 2HBPA 2LF8A 1K73U 3WU0A 1YJNA 2P4TA 3BP8A 3B02A 1EH7A 3QZ5B 3OYCA 3HRSA 2ZPEB 4M77C 1XGSA 4UVBA 3IRRA 2VV5A 3WGHA 5E17F 1ZH5A 4ME7A 5I2MA 2ETHA 2IA0A 4A4KA 3WTSC 4AIKA 1XD7A 4QWQA 4I0AA 2FYKA 5GAMd 1G6NA 5M9OA 4JRIA 1WGSA