5CVIA

Structure of the manganese regulator slor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
b'PNKEDYLKIIYELSERDEKISNKQIAEKMSVSAPAVSEMVKKLLLEDLVLKDKQAGYLLTKKGQILASSLYRKHRLIEVFLMNHLNYTADEIHEEAEVLEHTVSDVFVERLDKFLNYPKVCPHGGTIPQHGQPLVERYRTTLKGVTEMGVYLLKRVQDNFQLLKYMEQHHLKIGDELRLLEYDAFAGAYTIEKDGEQLQVTSAVASQIYIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SloR
publication title SloR structure and DNA binding studies inform the SloR-SRE interaction in Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
total genus 60
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cviA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cviA02
1UFMA 3WG9A 2LF8A 5CVIA 3REOA 1B4AA 3G73A 4HBLA 4IPAA 1PUEE 1TW3A 1ZHFA 4YFXF 5D4RA 5F64A 2RKHA 4UNOA 1K79A 2K4JA 1BI2A 5L3EA 2F2EA 1IRGA 5IT9Z 3VFZA 2Z5UA 1FP2A 4U0VA 2QUFA 2IP2A 3KP3A 1O3QA 2FNAA 4HF0A 5D6EA 2HOEA 2IVMA 3P9KA 1F1ZA 5E1XA 3GXOA 3F8FA 2DO7A 1MDMB 5TRDA 4YFKF 4HF2A 2VC1A 5DUKA 3Q5FA 1QGPA 3LFKA 4HDVA 2W25A 4RAYA 2H6CA 5D8LB 1G3YA 5D5WB 3P9IA 1RZ4A 2CYYA 1FSEA 2HR3A 3O3KA 4LK1F 2DPUA 3ECHA 2ISZA 3JAMZ 2XIGA 3FF5A 4UV9A 1O57A 2EV5A 1IN4A 2RDPA 4RGSA 1G6NA 1BC8C 4PCQA 1K78A 1ZRCA 3E6MA 2K27A 2FEZA 2XROA 3BJ6A 1ZGAA 3HHHA 1BBYA 1OYYA 1J75A 1IN8A 1HSTA 1RIOH 2RV8A 1TQIA 5ED4A 1HQCA 2ESNA 1I27A 1XGNA 1G3TA 3VB2A 2ZMEA 3E97A 4FHTA 4A0ZA 2J5PA 3CTAA 4U0YA 1T39A 1YLFA 3BPVA 3ELKA 2FE3A 1BM9A 4I02A 1J7KA 1AOYA 3TO9A 3M8EA 1B9MA 4DQ2A 1LNWA 3IC7A 4HOBA 1KU7A 1IN6A 4KICA 3WTVC 4M73A 2OQRA 4A2UA 3RKYA 3EQLF 2GA1A 3HIFA 4Y15A 3ZN1A 4Q48A 2JRTA 4O5VA 3TOBA 4R1HA 1J5YA 3FWEA 3HOTA 4CGZA 1BIBA 2VBWA 2P5KA 3WGGA 1QZZA 3QU6A 1GXQA 3QU3A 4ZH4F 1W7PB 4WX9A 3WTWC 5LGNA 3T5XA 1XCVA 2HYFA 4CHUA 1JE8A 4MQ9F 5EEGA 3D5LA 1FZPB 3HOSA 4UVAA 1YS6A 1S7AA 1BIAA 2ZCWA 3MCZA 2CGPA 2VE8A 4CDGA 3IKTA 1HXDA 3CO7C 2YR2A 1XN7A 1U78A 5K1YA 2Q8KA 2MH9A 2RC4A 4NHJA 2GQQA 4KN4X 3RYRA 2A68F 2GAUA 3KE2A 3EDPA 3E5UA 2LNBA 2UZKA 2Y0MA 3CUQC 3WE3A 5H20A 1S3JA 3ZN0A 2DAOA 2WV0A 2CG4A 3KP4A 4L0ZB 3E19A 2W57A 3TDUC 4B8XA 1FP1D 4KIGA 1XB4A 3HSEA 1RNLA 5ERIA 1FT9A 1W7PD 3KEQA 2DFIA 1ON1A 4KIBA 5J6XA 1WSUA 3EUHA 2KJCA 1D5VA 4MNUA 2ZNYA 2EV6A 2O6GE 2EJRA 5DD4A 3P9CA 2RNJA 2HS5A 3TOAA 3I0TA 1L3LA 4PDKA 2XAFA 1XCBA 5DCMA 4ENJA 3AAFA 3OV8A 1IAWA 5HDGA 3MAJA 1Z9CA 3FHZA 1BN5A 4L18B 4A0XA 2FSWA 3GLXA 5D8KB 1KGSA 3H3UA 3ERED 1O7FA 1KQ9A 3WODF 2K5IA 2JT1A 2FXAA 1ZLJA 2EB7A 2X4HA 1I1GA 1KQ0A 5DDGA 3IWZA 4XLPF 3TKYA 3WTZA 3FX3A 4A5MA 4ZYEA 2FF4A 1E2XA 3LQRA 2BBYA 4OMZA 4XBFA 4PGHA 2RQPA 4UV8A 4OIPF 1O3RA 2QVOA 2ELHA 3J81Z 4G7OF 1W4MA 2DTRA 3KETA 2HTJA 4HW0A 3TO7A 2YX4A 2A61A 5D5VB 3F6OA 2AXLA 5F6FA 4RAZA 2IW5A 2VN2A 3R61A 2A69F 4EJTA 2VT2A 1YTYA 1SD5A 4LD5A 1SMTA 4MTEA 3F3XA 5ILSA 3JW4A 4KDPA 3ABTA 4RS8A 4HDUA 1DDNA 3SZTA 1YW7A 1TLHB 5HS8A 1XD7A 2ZNZA 2DQRA 4RGXA 2K4BA 4S04A 4CO8A 4FX4A 5HDKA 3MWMA 2PFBA 3KCCA 5L3FA 1JHHA 2K5FA 1QO0D 4ENMA 4G6QA 2QBYB 1XGOA 4CXFA 3RPUA 3FMQA 1P6RA 1FBSA 2K02A 4UVBA 5AONA 3ZMUA 1T2KA 2NYXA 5LRSA 3M1EA 3DFGA 5BOXA 3B73A 2E1NA 4RGRA 4LLLA 2HTSA 1MJ9A 1MJBA 2ESHA 2LDUA 1HKTA 2QBYA 2OZ6A 4R8HA 3KP6A 1EH8A 5E8GA 1OKRA 4MEYF 1P4AA 1RUOA 3DPTA 3KZYA 2P6TA 1KYWA 3KEOA 4ZZLA 5CJ9A 5K5OA 4NB5A 2D2WA 3HRSA 3CUOA 5JR3A 3BPXA 1R00A 3E3VA 1AWCA 4HV6A 1S7OA 3KP2A 4EVIA 2V9VA 3ML6A 2DK5A 5HOOA 3J81K 2DPDA 1LEBA 3R0AA 2L54A 1QPMA 3RIRA 2K4YA 1IXCA 2NNNA 5E1ZB 4Y13A 2OA4A 2M87A 1S8NA 3QPHA 1ZREA 1DUXC 3E6BA 2HFHA 4M6YA 1MGTA 2L4MA 4HLXA 4HYEA 1FLIA 5FB2A 4FX0A 4I0BA 3RPQA 3ZPLA 3K9TA 3VEPA 4AD9A 5E1WA 3C7JA 1U5TC 2MH2A 3KP7A 1R1TA 2IA1A 2GXGA 3K2ZA 2MD5A 1FBQA 3U1DA 1LEAA 2YPRA 3BJAA 1FNNA 2D1VA 1BC7C 1REPC 4IVNA 1P92A 3ROUA 2L02A 1OMIA 4JK1X 2O0YA 3ECOA 1PDNC 2PI0A 2OZUA 1LDDA 4WXCA 3ZMTA 2L3DA 2XV4S 1D3YA 2FBIA 3V7CA 4EMSA 3KLOA 2TDXA 5J8FA 1FY7A 5ILUA 1FOKA 3PFIA 4F7ZA 4HX8A 4BXUA 2RN7A 1IN7A 2EWNA 1R23A 1XDUA 3S2WA 2EFOA 4RB0A 3Q9SA 3WTTC 1USTA 1XDSA 4ENKA 2V6CA 4LB5A 4KA4A 4P5OA 3TQNA 2PBIA 2MC3A 1YO5C 3LSTA 1B1BA 2P5VA 1BI0A 2HKXA 1K6OA 1H9TA 1K78B 3FMSA 2BYVE 4P96A 2ZFWA 5HLGA 3I54A 3T8TA 3EYIA 1FWZA 5AIQA 4U88A 1FYMA 4QWQA 1LB2A 4RB2C 2ZMEB 4I0AA 3L09A 3V7SA 2GA2A 2HYGD 1R1UA 2EA4A 3GZ5A 4IRGA 1WQ2A 1O3SA 1ZRDA 4I98B 1HKQA 2R7FA 1UHMA 4MHGA 1BYMA 2O3FA 3IWFA 2L01A 3FXQA 5KVRA 3QAHA 1B9NA 1XMAA 3L7WA 2XAHA 1BJAA 2UWMA 2NNYA 1USSA 5HLIA 4N0BA 4QLCU 5D4SA 4S05A 2CSOA 1OPCA 2NS0A 3I71A 2KIUA 3JTHA 3HTUA 4P9UA 2GCXA 2LKPA 1MJAA 1SD6A 1QBJA 1F4KA 4KMUX 2CFXA 4EQQA 1LVAA 3K1MA 3GWZA 3PQKA 2PJPA 3PQJA 1D8JA 3I5UA 4WWCA 5JHUA 4EGZA 3DF8A 4M6XA 2OAZA 3FM5A 3I53A 2KIFA 3KLNA 1R5GA 2RGVA 2VBXA 1E17A 3HSFA 1JHFA 1R5HA 3F6VA 2VE9A 5K5RA 1CGPA 5E18F 2CQKA 4LK0F 3HRMA 3IRQA 1SFXA 1IZ1A 3WTSC 2VOPA 5LHIA 2P7CB 5E17F 3GUDA 3COAC 2K5LA 1ON2A 2ZKZA 4Z2YA 5LGUA 1G3SA 5A2QK 3SFZA 3F22A 3F21A 3L00A 1K7AA 5JFRA 4NQWA 5D5XB 2GIVA 2FQ3A 3GO5A 2O03A 3O2PE 1FSHA 3ZMSA 2WTEA 2COMA 2HGCA 1XSXA 3L2CA 1R22A 3R4KA 5DCMB 1R58A 3QRFF 3JTGA 4PGGA 1ZG5A 4AIHA 1X3UA 3L9FA 5TJJA 1ZLKA 1KYZA 1YIOA 2HZTA 3K1NA 1TBXA 4XSXF 2M5WA 2DT5A 4G8XA 2F5EA 5ICFA 2L4AA 5L3GA 3F23A 2XHKA 3J80K 1FPQA 1W5SA 3J7AO 5BMZA 5JI6A 2VODA 2E7XA 5DUIA 4LG0A 3SXYA 4N9HA 2STWA 1TQPA 2XRNA 2PQ8A 4MQVA 4I2OA 2KKOA 2W85A 2P8TA 2VONA 4EJVA 1U8RA 4WXDA 1OYIA 4E70A 5CVVA 1IRFA 1T0FA 3GF2A 4R79A 2QM3A 4LLGF 2XGXA 5FGMA 1J59A 2ZO4A 2R7DA 4MTDA 3IKVA 2JTVA 4G7HF 3HRTA 2ADUA 1YG2A 5EEHA 3V4GA 3IRRA 4Q47A 1J0RA 2FBKA 3FM3A 2EFQA 4L0YB 2J5OA 4EJUA 1PP8F 1WI9A 2E1CA 1P4XA 1Z91A 4XSZF 2CW0F 3ZP5A 1HKSA 3I58A 4YFNF 1KA8A 2H6BA 1LDKB 1Z1DA 3FXUA 2PMUA 4GYGA 2V1UA 1Y0UA 2VOOA 1GXPA 2A5YB 4Q4ZF 2WWYA 2GZWA 1QNTA 4WF2A 4HAMA 4KN7X 3E6DA 1ZARA 2FU4A 4GO1A 4ON0A 4HF1A 1HBXG 2C6YA 5E20A 3CDHA 3N4MA 3LAPA 3DKWA 2G7UA 3OOPA 4M9SA 2W84A 4RGUA 3ULQB 5FLXK 4PZJA 3RKWA 5LEJA 4HV5A 2G7HA 3QOPA 1EH7A 1KU2A 3M9AA 3T1BA 1XSDA 4IRHA 2OU2A 4ZYGA 3K1PA 2QZ8A 5H6RA 1IN5A 4AWXB 1L0OC 5KK1A 3SZPA 4BAYA 3HTSB 2DLLA 2M45A 5LHGA 2VXZA 5FFZA 2P4WA 1LJ9A 3BP8A 2QQ9A 3LA7A 3SQNA 2QLZA 2B0LA 1EH6A 3C3WA 5JVTA 3R6SA 4EJOA 4ENNA 3P7NA 5H6QA 4JQFA 1I1SA 3ZQ7A 1HW1A 1IF1A 3WU0A 5ICGA 1Z05A 4A5NA 2CO5A 2Q0OA 2H94A 3NRVA 2K7LA 3DEUA 3WU1B 2BE5F 4YIFA 3WGHA 4HLYA 5D5UB 4OMYA 2RVCA 3NEUA 3WGIA 1CF7B 1FC3A 3FXRA 1BOAA 1FBUA 1ZGJA 4M9ZA 3H3ZA 4HZFA 4WXHA 4LJZF 4M71A 1XGSA 1QZYA 4YG2F 2M1BA 1SMYF 3ZMZA 2KIMA 2ZXJA 3GFMA 2KRFA 2XAQA 4LMYA 1CF7A 5ICCA 3GZ6A 1HSJA 2DI3A 5FFXA 1U3EM 3MEXA 1IXRC 5HS9A 3E5QA 4A6EA 2FOKA 4OU0A 2OQGA 2BEOA 2F5FA 4P9FA 1WRJA 1F9NA 2PEXA 2XVCA 2F5DA 4M72A 2GWRA 5IT3A 2O61A 3QP5A 6PAXA 5LLQA 5AIPA 2H27A 2IJLA 5CVUA 4WK8F 3W6JB 3NQOA 3ZMVA 2D45A 2EK5A 2HKOA 4HQEA 2JPBA 2YU3A 3CUQB 3TDZC 3RJPA 4JBAA 3BROA 3WTUC 3GX4X 4OIRF 1QW1A 3DQVC 5BS6A 3GVAA 5BPDA 3RYPA 1F5TA 3T8RA 2VT3A 2PMHA 2PN6A 5A2QZ 2V1XA 3U2RA 2ZJ2A 2KJBA 2A6HF 4UUVA 3CUQA 4CZZA 3QP6A 4LGWA 4ASNA 3RTRA 4G7ZF 3HHGA 3KP5A 1GHCA 2M8EA 2H09A 1I6XA 3MZYA 2D1HA 3E6CC 1XMKA 2IPQX 2QWWA 2BV6A 1KU9A 4RB1A 2HQRA 2EA2A 2MA3A 3LWFA 2X0LA 5FD5A 2H3JA 3HRUA 1YS7A 2FMLA 4LLNA 3SHFA 1VTNC 2A6EF 2P6SA 1MDMA 1BI1A 4MEXF 4A12A 2M30A 4L5JA 4EV0A 2YX7A 2NRAC 2STTA 3R0JA 4GGGA 3I64A 4IXAA 3IL2A 1LQ1A 1ZAOA 3GYHX 2AS5F 3F8CA 1B59A 4DNCA 2FMYA 3IHUA 5FD6A 2Z33A 3K69A 3FZVA 3J80Z 5F1RA 1RUNA 1MKMA 3ISPA 2R3SA 2O8XA 4I7HA 3MZHA 5CLSA 4ZZDA 1BI3A 2DBBA 4U7DA 2ACJA 3T0YA 1TNSA 2BGCA 3C18A 2LSOA 1U2WA 4EM2A 3HUGA 3RKXA 2JPCA 3G3ZA 3MHXA 2FA5A 2DQLA 5L3BA 5CVJA 3WTXC 1NHAA 1SD4A 2EFNA 2A07F 3ABUA 2Q2EA 1ZYRF 3F8MA 3F72A 1O3TA 4CYDA 1XGMA 4BHCA 4GYIA 4M74A 4EJWA 2XKPA 1ONVA 1HW5A 5LRRA 4I09A 4Q5SF 2WC2A 3V8LA 2ISYA 2FRHA 1IW7F 4ESFA 2CWEA 3GFIA 2Y75A 5LEKA 3F8BA 5IT9K 4L9NA 1G3WA 1DPRA 1DP7P 1D8KA 2P7VB 1SD7A 2IT0A 1YW9A 1GVJA 2LF7A 1FYLA 2VBYA 1FX7A 2UXNA 2FNPA 4L9VA 4HX7A 1H0MA 1W7PA 1ZH5A 3KZZA 4XLNF 1J9IA 2XASA 2MBFA 4U7BA 2NAZA 3C1DA 5LBQA 2K86A 4MGRA 1P4WA 3RI4A 1V3FA 1Z6RA 4Y17A 1TTYA 1UHWA 2EFPA 2DK8A 1OYWA 4KUMA 4ETSA 1JXSA 3HYIA 1P2FA 2P5LC 2XAJA 2HEOA 5DCFA 1ZG1A 4ESBA 3GW2A 4H0EA 1T6SA 4AIKA 3I4PA 4IF4A 5FO5A 4BYYA 3JAMK 3WTYC 1I5ZA 3KFWX 2DU9A 4BHPA 5FLXZ 1FYKA 2QQAA 2QQBA 4LG0B 4B09A 1QQIA 3RDIA 2LX9A 3EETA 5DYMA 1MD0A 5D6FA 4LB6B 1UCRA 5HS7A 4BQAA 1OR7A 2EV0A 1WKMA 1UB9A 3W6KB 2OBPA 4BHBA 3BJOA 1HW2A 1C0WA 4KYWA 3K0LA 3DP7A 4IHSA 2FBHA 5HDNA 2Z99A 2Z3YA 1SFUA 4KMFA 3JSPA 2V1DA 2F5CA 5LHHA 1YFHA 3ZMDA 3BZ6A 5LGTA 1LDJA 3R60A 4A0YA 4UVCA 4YIIA 3LA2A 1ZG3A 5L3CA 1U5TB 1YQAA 1STZA 3B02A 1Q1HA 2VBZA 3DXJF 1TW2A 3GFLA 1S29A 1V4RA 3BWGA 1WWXA 1MZBA 3I59B 1U5TA 3WE2A 2ETHA 3BY6A 3DPLC 5CYVA 4IHTA 1YYVA 3CO6C 1KU3A 3VODA 3M7GA 5HVQC 3LQQA 2QENA 4G94A 2G9WA 5BQTA 1SAXA 4L9JA 2E7WA 1TQMA 5DEQA 3CLOA 2Y48A 5BPIA 1ZN2A 3I59A 2A3SA 4TV7A 4OOIA 3BOQA 2IA0A 2QYOA 3V8JA 4ESJA 2JSCA 2XAGA 2DW4A 4P55A 4KIFA 4M9XA 1YW8A 3MFKA 3D0SA 4IRIA 1Z6TA 2Z9OA 3TO6A 2V79A 3GEZA 3LA3A 4GCVA 2PG4A 5ILVA 1B6AA 3E5XA 4A6DA 3HSRA 4BH9A 1G4DA 2VC0A 4CICA 4O3MA 2ZBKA 2MLKA 4KFCA 4AIJA 4G9YA 1O7LA 1ZRFA 1IXSB 3CJNA 1ODDA 5ICEA 3H92A 4HX4A 3FMRA 5E8IA 1R1VA 4XRFA 3TGNA 4O6JA 5CVRA 3N97A 3LAJA 4GXOA 2HDCA 2OD5A 1R7JA 1W5TA 2PLYA 5HLHA 4ZYHA 3Q9VA 2HWVA 4IJAA 4KT5C 4EM1A 3V8KA 4K2EA 4N9IA 4LFUA 4OIOF 3O6BB 1XSVA 1H9GA 2IA2A 4BNCA 4KNYA 1QVPA 1T98A 1A04A 2XKOA 2UXXA 4AVPA 3QPTA 1J2XA 5DV5A 4L9TA 4I01A 1T38A 3MQ0A 3DV8A 4EM0B 1SFEA 5L3DA 2XUBA 3M8FA 4HQMA 4OINF 1U6GA 3V7RA 4EGYA 3U9GA 1TNTA 4L5IA 1PP7U 2YSRA 2HQNA 4HA8A 1JGSA 1ULYA 2JZYA 1KQ8A 3EYYA 3F8NA 4U0WA 1Z7UA 1S6LA 4D0PA 4OIQF 2W24A 5K5QA 4FT8A 3JSOA 5DD8A 1EV7A 3GFJA 1R36A 1RI7A 2MLGA 2EFWA 1DPUA 4UHTA 3BDDA 5J8CA 4UXNA 4WCGA 4G6DA 4RB3C 1IUYA 3VOEA 2IRFG 4ZYDA 2GXBA
chains in the Genus database with same CATH superfamily
1UFMA 4F7UF 3AFHA 3JB9J 4BJ6C 2GOMA 2BIVA 1TXQA 2K79A 3C12A 3WG9A 2LF8A 5CVIA 3REOA 2I2LA 4ZTJA 1RAFB 2CH4A 5KYUA 1B4AA 3G73A 4HBLA 4IPAA 3HPWA 2BVLA 1PUEE 1TW3A 3BR5A 4Y33A 1ZHFA 4YFXF 5CQGA 5GTIC 5D4RA 1FEXA 5F64A 2RKHA 2QKLB 4UNOA 2R7SA 2CREA 2M7BA 3NMZC 1K79A 4HCZA 2VL8A 3BCAA 2K4JA 2EAYA 1BI2A 2XB5A 4FISA 5L3EA 4PJOE 1N77A 3A02A 2F2EA 4XKVA 2LDMA 1IRGA 5IT9Z 3ZQFA 2LY2A 2OJ2A 3Q0UA 2Z5UA 3VFZA 1NH3A 4J7IA 3VRZA 4I76A 2VUMJ 2CSQA 1FP2A 4U0VA 2ELJA 1X1BA 1KG1A 2QUFA 2NVXJ 2IP2A 3KP3A 3M8JA 2XMFA 1O3QA 1OOTA 1PM3A 2FNAA 4ABZA 2JS2A 2D0QB 1E6HA 3M0QA 2KE9A 1M3CA 3EHQA 4FYVB 5GANd 4HSRA 4HF0A 5D6EA 4CCOA 1OYXA 1WA7A 2HOEA 2IVMA 4D5FA 3HOUJ 2JTMA 2LVSA 1F1ZA 3P9KA 5E1XA 5J3LA 2ZJPF 2CP3A 2M02A 5KYWA 4XN0A 2QA4I 1TG0A 1VQPA 2GIZA 2EVRA 1R5ID 3GXOA 4BXXJ 1I81A 4BE1A 5C0MA 1M30A 2OCCH 3F8FA 2R5ZB 4HCKA 3AHUA 2YU9J 2DO7A 1MDMB 1RC9A 2E35A 3QWLA 1RAEB 1VOMA 4JJCA 5TRDA 1VQLT 3BG3A 2DJNA 4YFKF 3FIWA 4HF2A 2VC1A 4JYKA 1N6AA 2DAQA 2E12A 4RLQA 4HVVA 4N4HA 4ELZC 5DUKA 4AG2C 5CAIA 3Q5FA 2QG9B 1WQWA 1QGPA 2RI3A 3LFKA 3C95A 3SFIA 4HDVA 1MSFC 2LQWA 2W25A 4RAYA 4GLMA 2H6CA 1G2HA 5HY6A 5D8LB 1HDDC 1G3YA 1NG6A 3S1MJ 5D5WB 4BUPA 3P9IA 4C8QG 4M75A 1RZ4A 2DMQA 4FE7A 2CYYA 4E6KG 1FSEA 4XRSG 3OBYA 4FCYA 1ABQA 3CCMA 2CUJA 2EW3A 2HR3A 3LOCA 3O3KA 4N4OB 3LNQA 3EGDB 4LK1F 2DPUA 1BU1A 4X1EA 2EFIA 3BR0A 2VJ5A 1WI7A 4PFPA 5FLXE 3TEEA 1MNEA 2R5ZA 2JW4A 3ECHA 3MKYB 3JAMZ 2ISZA 2KZGA 2KSSA 3CDIA 2XIGA 4E4HA 1NK2P 1VQ4I 2LBFB 2EIKH 2R92J 3FF5A 4C0DB 3CCLA 3VYHB 2CQ7A 5GAGJ 2QSGX 3GF5A 4UV9A 3TMOA 1O57A 1HDPA 1OZ2A 2DBKA 2EV5A 1IN4A 3X28B 5GAMd 2L3SA 2YXYA 3TSWA 2RDPA 4CUGA 1ZA2B 4RGSA 1K1ZA 1G6NA 1BC8C 2VYTA 4GLKA 4PCQA 1K78A 1ZRCA 3GTLJ 4C0ZA 4JRPA 3E6MA 2K27A 4C3IJ 3W2WA 1NPRA 2PZ1A 2FEZA 2XROA 1SANA 2DDAA 2J05A 3BJ6A 1ZGAA 1XMXA 3HHHA 3QPLA 4ORZA 1BBYA 3UWNA 3J7AF 3HJEA 3K4LA 4PFZA 3OL4A 3NPFA 1OYYA 4M3GA 4IX7A 1VQ8T 4MLOA 1J75A 1UJ0A 1IN8A 1HSTA 2LLKA 2RV8A 1BR2A 4II2A 4B4CA 1RIOH 1AU7A 1TQIA 3FXLA 5ED4A 1QP2A 2ENMA 2KNBB 3RR6A 5M5YJ 1XQHA 1YI2A 2LBFA 1HQCA 3RMSA 3HFOA 4M7DG 2ESNA 1VUBA 5F04A 4OMFB 1I27A 1XGNA 1G3TA 4QPOA 3VB2A 5M5XJ 1R8OB 2DL5A 2ZMEA 3E97A 4FHTA 1VQPT 4A0ZA 2NLUA 2J5PA 3FEOA 3CTAA 1NBEB 2ME0A 4U0YA 1T39A 3GPLA 2BXZA 3H35A 1RETA 1YLFA 2ZJQF 4PJOB 2LQNA 2Q2EB 2JK3A 3BPVA 3ELKA 2FE3A 1JXOA 2NWMA 4B3XA 2IG0A 2PJRB 1X27A 5D7UA 1BM9A 4I02A 2KRHA 4XLFA 1LKXA 4F52A 1J7KA 2V9PA 4J9FA 4LDXA 1AOYA 3TO9A 1NYFA 2DL4A 1N78A 2HKQB 3M55A 2E10A 4JP0A 3PJRA 1YCSB 1Y07A 2NUTA 1QVFP 4BE2A 1VQLI 4D1QA 1VQOQ 2KPMA 1VQNA 3M8EA 1B9MA 3E7LA 3H9JA 4DQ2A 1LNWA 3IC7A 3PSIA 3CC4A 4HOBA 3AG1H 1KU7A 1PWTA 4N4GA 1IN6A 1PUFA 4RTUA 1PC0A 4DEYA 3EFSA 1AEYA 1NE8A 2E34A 3A8LB 4RCBA 2K2VA 5IOZA 2LKXA 4KICA 3CC7Q 2QTXA 3WTVC 1UEBA 3SFMA 4S0HB 4N4IA 1H3ZA 4M73A 2OQRA 2DM1A 3QBYA 3BG7A 4A2UA 3RKYA 3EQLF 1I1JA 1K9MU 2WA0A 3C2BA 3HOWJ 2GA1A 3HIFA 4Y15A 3ZN1A 2DO3A 2ELKA 3A8HB 4PJOA 2CP2A 4Q48A 2JRTA 1R9TJ 3CCEA 4M7AC 4O5VA 3TOBA 2FYKA 2PJRA 3ZQLA 1AZEA 4R1HA 1J5YA 1PVEA 2HZYA 3FWEA 4MDWA 3L2ZA 3HOTA 4PK4A 4CGZA 1BIBA 1X19A 2XDDA 2VBWA 2YHTA 2P5KA 1RLPC 2EJGA 3WGGA 1QZZA 3QU6A 3LSGA 1GXQA 5LJ3j 3QU3A 1JUSA 4E7IA 3KZIC 5GAN4 5FRMA 1RAAB 1Z9QA 4ZH4F 4OB3B 1W7PB 4XTVA 3G71Q 1HA8A 3C4SA 3G1MA 3RESA 2LJ1A 1ABOA 4WX9A 3WTWC 5LGNA 2KT0A 1VQ7Q 2HOSA 1PJRA 4ESRA 3KIOA 1QHHD 3T5XA 3OYGA 1XCVA 2HYFA 3H0DA 1JE8A 4CHUA 4MQ9F 2DX1A 3CCVQ 2BXYA 1LFBA 4EEFG 5EEGA 3D5LA 1R4MB 1X2MA 3VYSB 1QLYA 2KI7A 1FZPB 1Z3XA 3JRIA 3HOSA 2B8AA 4UVAA 3CCQA 1A0NB 2DYSH 2LP5A 1YS6A 1S7AA 2H1LA 1BIAA 2HBPA 2A36A 4XTXA 2XICA 1KHIA 1KQSS 4MDXA 2ZCWA 3MCZA 1M1EB 1UHFA 1MBKA 2CGPA 2J7IA 2VE8A 4CDGA 3IKTA 2EBPA 1HXDA 4CCNA 4RM2A 3CO7C 2MCNA 1VQ8I 3HOZJ 2YR2A 2DZCA 2K57A 2L2OA 1LJOA 1XN7A 1U78A 1XTDA 4OGEA 1G2BA 4XK4A 2JSPA 5K1YA 1ZTRA 2Q8KA 4BEHB 1WNLA 2MH9A 3M0TA 3JCMV 4PJOD 2RC4A 2RNAA 2X1EA 4A3GJ 1N27A 3M56A 3X24B 2E1MB 1QKXA 4KUIA 3JRHA 1DU0A 1KSWA 3SDGA 3I56A 3KBGA 3CC4T 2YSQA 4NHJA 2GQQA 4KN4X 2JUGA 1P7JA 2X6OA 2CS7A 2DL8A 3SZGA 3RYRA 3S3MA 5DS9A 2A68F 2GAUA 3KE2A 3CMEI 2DTHA 3ASNH 3VYUB 2LMDA 5F27A 1NTCA 3JCMb 1SRLA 1DP3A 2EYQA 1OJLA 3L2WA 2EQMA 2L9SA 3TU4K 1OPKA 2VPRA 1Z3YA 3PFSA 1ZUYA 3EDPA 4XR6A 2CFOA 2LG4A 2LNBA 3E5UA 2Y0MA 3CUQC 2UZKA 3UKGA 1DU6A 3OYCA 3WE3A 3EG2A 1KONA 4F7UE 4M7DB 5H20A 3I4MJ 4QQGA 1S3JA 2EH3A 2DAOA 3CDLA 3ZN0A 5KYYA 3CXCA 2CV1A 4FIBA 4AM3A 2WV0A 2CG4A 3VRYA 3BTIA 1YIJI 2JS0A 2QAZA 1J3TA 4BEHA 3KP4A 4L0ZB 1Y57A 2O4XB 3E19A 1A6QA 2W57A 3TDUC 4B8XA 1WFXA 3GZNB 3HZJA 4K11A 2RNGA 2BOLA 1FP1D 4KIGA 1WFWA 1Q95G 1XB4A 2VJ4A 3HSBA 3HSEA 4OAYA 1RNLA 2EBIA 2C0IA 2Z0WA 7AT1B 5GMKe 3PO3J 5ERIA 2F5KA 1FT9A 3DPUA 4A3JJ 2ZPFB 1W7PD 1GRIA 4HT9A 1A6IA 2HOAA 3KEQA 3FJPA 4C0FA 2IS1A 2DFIA 2LREA 1ON1A 4LD6A 3CC2T 4BS9A 4C5EA 4KIBA 4UUSB 1YJWA 2K85A 2R7TA 5J6XA 1VQ9I 1WSUA 1SF9A 3EUHA 2KJCA 1D5VA 1JQQA 4IUTA 4MNUA 3LWHA 2ZNYA 2EV6A 1AZGB 2HMAA 2O6GE 4M78A 4J9EA 2EJRA 5DD4A 3P9CA 2RNJA 3CCSQ 4A4GA 2KVQG 2HS5A 2PUKB 1ITYA 4Y7NJ 1H8KA 3CJTB 1I39A 2O4XA 1R77A 3HP9A 1SG5A 4M75F 2CU7A 2LP0A 3TOAA 1Y71A 3QIIA 3I0TA 5DM7R 2Z16A 1L3LA 1LFPA 1GBRA 4PDKA 4BJ5C 3QJ6A 3SEMA 1SVMA 4BD3A 1TP4A 2XAFA 1SHFA 1XCBA 3HL8A 5DCMA 2LRDA 6AT1B 1SFKA 4ENJA 3GMEA 3AAFA 3OV8A 1WJEA 3QODA 4HSTA 1X6GA 1IAWA 5HDGA 4E7HA 1I8FA 3MAJA 4GRIA 3BY7A 2SEMA 4E7ZA 5IY5H 1Z9CA 2GTOA 3FHZA 4AFSC 1BN5A 2RMOA 3CCUA 4JJBA 4DOWA 4L18B 4A0XA 2FSWA 3GLXA 3CBOA 5FU7B 5D8KB 1KGSA 4OMMA 2OV7A 1R0CB 4ELYC 5KYXB 3H3UA 3ERED 4ZGJB 1O7FA 4CZCA 2Y4YA 1KQ9A 3WODF 1AKHA 3OB9A 2HU9A 4J8OA 2K5IA 3I55Q 2L5QA 1YJ9Q 2JT1A 3BC8A 2W00A 4BKXA 1PKTA 3NWSA 3FIFA 2FXAA 3L1AA 4M7DD 2WV1A 2KK4A 1ZLJA 2EB7A 2CUBA 5GANg 1YHQT 1TTHB 2X4HA 1I1GA 1OCOH 2IGOA 3HGGA 3OS1A 4RG2A 1KQ0A 5DDGA 2GTJA 3IWZA 4XLPF 2ECCA 3TKYA 3S1RJ 1QA6A 4RTXA 5J3BA 2DDBA 1D1BA 3WTZA 1X1CA 1KFZA 3OA6A 3FX3A 4A5MA 1TWAJ 4ZYEA 2FF4A 2GXAA 1E2XA 2CP5A 4M77A 3LQRA 2JUCA 2BBYA 1YWPA 2RQWA 2YRVA 4OMZA 4XBFA 4OB1B 1QVGA 2K3XA 3TP0A 5DM6F 1WJ5A 4JX5A 1OCTC 4PGHA 1M3AA 1WJSA 4M3FA 5EGOB 2CH4W 3H8ZA 2EJFA 2RQPA 1FMWA 4D7MA 1HF0A 3WVDB 3A98A 5I21A 1NJIU 2IIMA 4UV8A 4OIPF 2M8GX 4XQFA 1O3RA 2QVOA 2ELHA 3J81Z 2R7WA 2R7XA 3OYYA 4F17A 3SWNC 2CUZA 3CD6I 4G7OF 1PNJA 5CQYA 2DKGA 2FJ1A 2QI2A 2ZXHA 1W4MA 2DTRA 4P1WA 3QJYA 4F7UB 4XICA 3KETA 5KE2A 2HTJA 5C6SA 5KYYB 1Y1WJ 4HW0A 2BW3B 2QSHX 3CC2I 3TO7A 3O8HA 4DW6A 1W0TA 3OQ5A 1AWOA 2YX4A 1Y6IA 2A61A 4Y92A 1Y0MA 5D5VB 4MZMA 9ATCB 3CCMQ 1VQKQ 5LJ5g 3GCMA 3WHBA 2XF7A 1B72B 3MEVA 4IZZA 2L7KA 3F6OA 1RLQC 2AXLA 4LXCA 1IGNA 5K7ZA 5F6FA 1I0CA 1M27C 1M3BA 5JLXA 4RAZA 1SKUB 5EGOA 2BUDA 2IW5A 2M0CA 2VN2A 3R61A 1EX4A 2A69F 3DLMA 4EJTA 5GMKi 5GAMg 3FB9A 3CCLQ 3KPHA 1C0MA 2XU8A 2VT2A 2NOGA 1VQ5Q 1YTYA 1SD5A 4LD5A 1SMTA 1S7EA 2GNCA 1YJNT 2DFFA 4F7UA 2V8IA 2CUFA 1T08B 1IJWC 3ZQHA 4MTEA 3PSFA 4CCKA 2IGMA 1TWCJ 3F3XA 2BW3A 1G83A 2QDYB 4RTZA 3JCMc 5ILSA 3JW4A 4KDPA 5CKHA 4AFUC 3IV5A 3ABTA 4RS8A 2G3RA 2KYMA 2NVUB 1WJAA 1Y8RB 4HDUA 1DDNA 1GCQC 2ZSIB 2KDZA 2AO9A 5EG0B 4A3IJ 4ZN3A 1NPPA 3SZTA 1YW7A 4CCJA 3M0PA 3UNGC 2E5ZA 3OS2A 2L0KA 1NM7A 1RADB 1TLHB 5HS8A 3QO3A 5GMKh 3CPWS 4C8QC 1XD7A 2ZNZA 1B34A 2P84A 2DQRA 2ATCB 5TISC 4RGXA 1BL0A 1ZSGA 2L3QA 2PQWA 2K4BA 4S04A 2AHQA 2QQ8A 1SEMA 1TWFJ 2A5WA 2K3PA 4CO8A 4FX4A 5HDKA 3UDCA 2O01E 2M4KA 3MWMA 3CBPA 3NHNA 2SRCA 3A8MB 3PMTA 1VQMI 1JRIA 2WAQA 2ABLA 2L7FP 3EHRA 2PFBA 1Y1VJ 3KCCA 4F3QA 2V8KA 4TVRA 5L3FA 3IP4B 1H92A 4RTVA 2Y0SN 4D8KA 1VQLA 4BBRJ 1JHHA 3QSUA 3GIBA 2K5FA 2DFHA 2CV2A 1K4TA 1QO0D 3FDYA 4ENMA 3G6EA 1N8RR 2OTJA 2BZTA 4G6QA 1MBGA 5IT9E 2IEKA 1K9MC 2QBYB 1WLPB 1UG1A 4XQ3A 1XGOA 1JT0A 1WIEA 3ZBDA 4DYCA 2EQIA 1IREB 4CXFA 1K8AU 3RPUA 2O2OA 3UA6A 3FMQA 4ZGDB 1P6RA 4QT7A 1FBSA 2K02A 2VJIA 1ENHA 4UVBA 5AONA 5DTDA 3ZMUA 1T2KA 4QQDA 1AWJA 3H0HA 1ZA1B 1M2OA 5GMKj 2DA7A 4ZNXA 2NYXA 3MPUB 3OW2S 1VF9A 4IHWA 1BCMA 3M1EA 5LRSA 3DFGA 4Y52J 3ZQIA 2ICWG 5BOXA 1VFCA 3META 3B73A 2XK0A 2EINH 3CCEQ 2OTLA 3MD2A 2E1NA 3N05A 4LIUA 4ZYAA 4RGRA 4LLLA 1FOXA 2PNIA 1B3QA 2XDBA 2HTSA 4EMKB 4PNOA 1MJ9A 1QRYA 3A4CA 1KQ2A 2EIMH 1MJBA 2ESHA 1GV5A 2LDUA 3JCMW 3JCMQ 3A8OB 1HKTA 2RHXA 3RQIA 2ECZA 1JJ2S 2QBYA 3NFCA 2OZ6A 4R8HA 2R7OA 1M90U 4N0AA 4Z89A 3JV3A 1M1GA 3DB3A 3KP6A 1EH8A 2R7VA 4BJTA 5E8GA 1OKRA 5CQEA 3JCMe 2LVMA 4MEYF 3MCAB 3CCQQ 1P4AA 1RUOA 2K3YA 3DPTA 2RH2A 2RHYA 1OR7C 5JVGF 2HXIA 1JGGA 3LYIA 2QGUA 5IXFA 2DA2A 3KZYA 1XJWB 2FHDA 2P6TA 4LIVA 3ABLH 1QCOA 2HCKA 4M78F 2JJ9A 3REAB 3VJPA 3CXCS 3DB4A 3PIPA 1X1DA 4CYCA 2QEXI 2CQNA 3G71A 1W1FA 2QA4A 1V5FA 1HCRA 1KYWA 4UY8I 3KEOA 3QYFA 1WH7A 4ZZLA 1VQ6A 5CJ9A 5K5OA 3JAME 3CCRA 4NB5A 3CCVA 1R4NB 2D2WA 3HRSA 3CUOA 1ZLMA 4Y91A 5JR3A 3BPXA 2LCLA 1UHSA 5FWCA 3CCYA 3PMIA 1YHQA 3GTKJ 1R00A 3E3VA 3U21A 4HV6A 1AWCA 3M5AA 1S7OA 1U9OA 3I56Q 1X2KA 3KP2A 3CMYA 2E2HJ 4EVIA 2DD4A 2V9VA 3FBIB 2EGCA 3ML6A 1MH3A 2VQHA 1OEBA 2DK5A 1WI3A 5HOOA 3J81K 2DPDA 1ACIA 4LD9K 1LEBA 1E3HA 2YRDA 2M1HA 5IAYA 4M75E 1RI9A 4F92B 2DA4A 3R0AA 1Q82U 3QYGB 2L54A 2ED1A 4XLEA 1QPMA 3RIRA 2E3IA 1WJFA 1G8XA 1T0FC 2V1NA 1OI1A 1MV0B 4MZTA 2K4YA 1IXCA 1ZBXA 2NNNA 4CC3A 2HSEB 5E1ZB 1Y56A 4BI3A 2E36A 4Y13A 5B1AH 5HLTA 3HXLA 3EG9B 2OA4A 2M87A 1UG0A 2ECBA 4UUTA 1S8NA 4C2TA 1H641 4BL0B 3ULRB 2LD5A 2DOEA 2CUEA 3UPUA 3QPHA 4ZDLA 2E41A 1ZREA 3S1QJ 4RTTA 4AT1B 2DFUA 1DUXC 3E6BA 3RCOA 2AK5A 1XG1A 5IOYA 1VQOT 4EMHA 1XC5A 5GMKl 2M9UA 2HFHA 4M77F 4M6YA 1MGTA 2LTPA 2R4GA 2L4MA 1P7IA 5M3MJ 2LYCA 4B9XA 1KQSA 2L8DA 4HLXA 4HYEA 1YITT 1Q1VA 3ZGKA 1MMNA 2F4MB 4UB8C 1EF4A 1FLIA 3CC7T 2JA5J 1EKEA 1UMQA 2FOWA 2GOXB 2M0MA 4FX0A 5FB2A 4I0BA 1QHGA 5C44J 1O75A 4A4EA 3RPQA 3ZPLA 3BTLA 3X25B 3OR2C 4BY6C 3K9TA 2GFAA 3INZA 2K3FA 2VQCA 3NTIA 1K61A 1M1KU 3VEPA 4AD9A 2DLPA 2LRQA 4I99C 5E1WA 4RTWA 3EG9A 2VV5A 2OCEA 3C7JA 1U5TC 2MH2A 3KP7A 4M3EA 1R1TA 4M3BA 5GP9A 5KCMA 3MKWB 2IA1A 2YLBA 2YUNA 1BR1A 2GXGA 4OF1A 3K2ZA 1AWXA 5FU6C 2MD5A 4RA2A 5KYUB 4A4HA 1FTZA 1FBQA 3U1DA 1LEAA 2YPRA 2VXFA 4BUGA 4BU2A 3BJAA 5I11A 1FNNA 2XB0X 2D1VA 3WG7H 1I6HJ 1BC7C 1REPC 5ECAA 4A4KA 1VQ7T 4IVNA 4ITVA 2L7ZA 3OL3A 3CMAA 4BI8B 1QVGS 1IG7A 1P92A 3OYHA 2ZPEB 3ROUA 3O5ZA 4PSXA 2L02A 1FMKA 3BG9A 2JVVA 1OMIA 4JK1X 2F1LA 3H9NA 2RQVA 3BG5A 5LJ3e 3FJ5A 2X1CA 2MF2A 4KITB 2CDTA 1Q7YU 4AYBA 3CCSA 2RJDA 2O0YA 2I0NA 3ECOA 2W1OA 4E47A 1PDNC 4XU1A 2COZA 2K9GA 2CW7A 2PI0A 4V2SA 3NTHA 3HFNA 1GUUA 4RM3A 3K70C 3QZ5B 2OZUA 4M7AA 2FQ4A 1LDDA 4WXCA 3ZMTA 3GTGJ 3QDRB 2OC6A 5CKTA 2L3DA 4FETA 4RUGA 4A4FA 2X6XA 2DL3A 2XV4S 1D3YA 4HVUA 1DJ7B 1WJQA 4JUVA 5KH6A 3OYBA 4QPQA 4PLLA 4X34A 3JCMf 3FHNA 5KYWB 1R49A 2GM4A 1LNXA 5HK0A 2FBIA 5GAOn 3V7CA 4EMSA 4LN2A 3MEAA 3KLOA 2TDXA 5J8FA 3NWTA 1NLOC 1FY7A 2DD5A 2WACA 3MMYB 5ILUA 2A6TA 1FOKA 1TSFA 4PJOG 2OPTA 1UZCA 3OS0A 1MBFA 3PFIA 1PRLC 3HTRA 3I55A 1FMVA 4F7ZA 1WHGA 4HX8A 4XU2A 3SDZA 2P0QA 1GXIE 4BXUA 2RN7A 2P4RA 4IHVA 2C0TA 1IN7A 3WXMB 4II1A 3FLGA 4BQOA 1VQ8Q 3JCMh 2EWNA 2F5VA 3OMGA 1CSKA 3PNWC 1R23A 4D9JA 1XDUA 3S2WA 3QPSA 2K7AA 5JLWA 4M75B 1B07A 2EFOA 4RB0A 2LJ0A 3JB9F 3K4MA 1YITI 3CC7I 1QZEA 3Q9SA 3WTTC 1USTA 2HQAA 3ASKA 1AHDP 2MWPA 4Z02A 1XDSA 4ENKA 1KJWA 4FYYB 5KCOA 2V6CA 1X1AA 1I4K1 4KH1B 3GP8A 5DLOA 1IUFA 4LB5A 5EZGA 4KA4A 2KYBA 4P5OA 2KRNA 2CZ7B 3M07A 3TQNA 2LNHB 2PBIA 1CKBA 2MC3A 4BBSJ 1YN8A 1YO5C 3LSTA 4E7LA 1YJ9I 1B1BA 4MIMA 4JZ4A 2P5VA 3ZQGA 4A3FJ 1BI0A 2HKXA 2F4OB 1K6OA 1H9TA 1K78B 4WCIA 3FMSA 2BYVE 2JXBA 2W0ZA 3HG9A 4E6RA 1S9HA 1HJDA 4NNJA 4P96A 1OU9A 4L5EA 1V1CA 2LJ3A 4FW1A 5HNFA 1VQ7I 2DTIA 2KDSA 4JZ3A 2Y0SA 2DXUA 2R7QA 1PHTA 2ZFWA 5HLGA 1W1WE 2N8GA 1BA5A 3CMEA 3JRFA 1S5LC 3CCST 1VQKA 1R71A 3I54A 3KX2A 4V19K 1M2VA 1X3WB 4Q5WA 1ARKA 4J6XA 3T8TA 3EYIA 2LOOA 3HOYJ 5LJ5d 2RO0A 1FWZA 5AIQA 4U88A 1WXTA 1WZOA 1K73U 1FYMA 4QWQA 2DTZA 1LB2A 1UGRB 2W10A 1POGA 4RB2C 3PT9A 4A3LJ 1VQ5A 2ZMEB 4I0AA 1YIJA 3L09A 5EYRA 3V7SA 3AG2H 5E3NA 3GNGA 2GA2A 2HYGD 2RHZA 2K9NA 1R1UA 2EA4A 3GZ5A 4IRGA 2R7UA 2KQWA 4L6V5 1WQ2A 1RPWA 2HL5C 2XKOC 3PL8A 3MKLA 1O3SA 1BJZA 2VKDA 4V2FA 1ZRDA 4I98B 5CKBA 1HKQA 3PIPF 4HRIA 4R55A 2R7FA 5J40A 1IRZA 3TP3A 3OR1C 1Q86U 1UHMA 2RHIA 4MHGA 1ETYA 2COWA 1BYMA 2XPWA 2K40A 2NUTB 2O3FA 3IWFA 2VJJA 2DA6A 2L01A 5LJ3f 4J9GA 2ZPBB 1UGPB 5EDNA 2B9SA 3DLLA 3FXQA 5KVRA 4JS4A 1K8AC 1B9NA 3QAHA 4DYRA 1XMAA 4M75D 1VQ9A 3L7WA 3HOXJ 2D6FA 2XAHA 1BJAA 3GLLA 1PUFB 2M0OA 2UWMA 3OSSC 2NNYA 1USSA 3LSIA 5HLIA 1EZZB 2RD1A 4QW2A 5J39A 3G6EQ 2OTJQ 2DETA 1S72Q 1W36D 4N0BA 4XNFA 1BBZA 3PVQA 4OMOA 3J7AY 4Z8AA 2MOXA 4A63B 4C92C 3JCMP 4M78E 1YJNA 5FKOA 3EFRA 2JN6A 1Q81U 2DA1A 2GGRA 1Y39A 3HEFA 1HSQA 2CRGA 2OJED 4QLCU 4XAXB 4KISA 2E2IJ 3KYDB 5D4SA 2BE7D 5LJ3h 4B44A 2VASA 4S05A 2CSOA 1OPCA 2NS0A 4BE0A 2EILH 2F4IA 2X4JA 3I71A 2LT4A 3A1PA 3VS4A 5KCHA 3GOXA 3ONQA 2KIUA 3JTHA 5B5EC 3HTUA 3AKZA 1KQ1A 2OX7A 3C94A 2E5KA 1ETKA 4P9UA 1TL8A 2OTLQ 3OYIA 1Y7XA 2GCXA 1F36A 2LKPA 3MEUA 1MJAA 1SD6A 3QQAA 1QBJA 2F5TX 1F4KA 3BR2A 3LSRA 1UAAA 1ETQA 4CRIA 1OFCX 4KMUX 1X1PA 1Z67A 2LTOA 2CFXA 4EQQA 1LVAA 3K1MA 3GWZA 1MMAA 2PUOB 3H9GA 3CPWA 3CCMT 4PJ0C 1JO8A 3PNTA 1XNIA 2D8JA 4EATA 2XD0A 4QTRA 2BE9B 3VS3A 2DERA 3DKMA 1E0EA 1ZSZC 1I07A 3PQKA 2R57A 5GJVB 1WH5A 5GAEJ 2PJPA 3ZOBA 1W6XA 3PQJA 4IUUA 5CPRB 1D8JA 3CCLT 3I5UA 3EGUA 4WWCA 2KDOA 5JHUA 3H0IA 4EGZA 4RMNA 3EH1A 3MO8A 3QYEA 1RKTA 4NL2A 1B8IB 1VQ5T 4J9HA 3DF8A 4EPCA 4M6XA 3J7ZI 4FTHA 2QA4Q 1WQ7A 2WAQN 2K9QA 1T3LA 1V29B 2OAZA 1PYVA 3FM5A 3I53A 3MVPA 2PTKA 4M77E 4M6VA 2KIFA 3IH2A 3KLNA 4DBHA 1R5GA 2RGVA 2O9LA 1XOVA 3VS0A 2VBXA 3W2AA 1VIFA 1E17A 2KT8A 1VQ6Q 5LFAA 2WSEE 3CXCP 2DMTA 2V4JC 3CCRQ 1HYOA 3X26B 2K9SA 1ZGWA 1ORKA 3R6NA 3K10A 2DT6A 2DYIA 2HZDA 1MIJA 3HSFA 4AUXA 2CZ1B 3JRZA 1JHFA 1OCRH 2WY8Q 1R5HA 3DBHB 3SEZA 3F6VA 3DTEA 1Q82C 2VE9A 3FDRA 1NLPC 5K5RA 2O31A 1CGPA 1BCOA 5GTHC 5E18F 1AWWA 2CQKA 4N4NB 2CZ6B 1YI2T 3L2VA 4E7KA 2EKOA 1RABB 3OW2A 4LK0F 3HRMA 4LITA 3L2QA 3IRQA 1SFXA 2V26A 1IZ1A 3WTSC 1B8IA 2WSFE 3LX7A 3K6GA 2XDVA 2VOPA 3RZOJ 3VSLA 5LHIA 1PG5B 5IP7J 1LVKA 4YRVA 4M7AF 1E6GA 2P7CB 5E17F 4PJJA 5F0HA 3GUDA 4J7FA 1VQPI 3COAC 1UB4A 1MW7A 4OP0A 4DZPA 3S3OA 1X58A 2FVUA 2DYRH 2K5LA 4AC0A 2VGMA 4JPBW 1JJ2A 1VQ4Q 4HNVA 1QVFA 4KGXB 4XKWA 1OX9A 1Z9ZA 4BB7A 1K0SA 1WGSA 4LUDA 3M0SA 4XOTA 1JKPC 5J4VA 4LDYA 1ON2A 2CGHA 1GL5A 3UR3C 1VQNT 4AIDA 2ZKZA 4Z2YA 5LGUA 3CESA 2DN0A 1G3SA 3DEEA 5A2QK 2KFDA 2IS2A 3BZCA 2IGNA 1WPKA 8ATCB 3SFZA 1M1KC 1IB8A 1K76A 2PU9B 1JXMA 3F22A 3F21A 2JMWA 3LFUA 3L00A 3A03A 4YEJA 3RKQA 5JFRA 1K7AA 3S2DJ 4NQWA 2F2XA 3PVLA 5D5XB 4M78B 2O88A 1RUWA 2HQ5A 3CP8A 2GIVA 2FQ3A 2FD5A 2DJIA 3GO5A 2O03A 3PFYA 3O2PE 4XONA 4XRSA 2MIOA 2XHCA 1FSHA 2AQFA 2Y30A 1G59A 5FLVA 2NVTJ 2DVJA 3RNJA 1N75A 1J09A 2WTEA 3ZMSA 2CQXA 2Y69H 2AQEA 3CCMI 1LPLA 2COMA 2FRYA 2HGCA 1OPLA 3CCET 5KYNA 2XGCA 1XSXA 5FKNA 4KJZA 1WJCA 3L2CA 4J00A 1R22A 5J47A 2AHJB 3JCMd 3R4KA 5DCMB 1R58A 3PUFA 2CT3A 3QRFF 3GTJJ 5EG2A 2HAXA 1I5LA 3JTGA 2YWWA 3JCMX 2V9KA 1VA7A 1Q7YC 3CCLI 2XGEA 4B43A 2FPEA 3QZ9B 3REBB 3TSZA 2W48A 4GBQA 4R56A 4HNTA 3K4KA 3OYEA 4PGGA 1ZG5A 2VPLA 1DQUA 2EZKA 3LSHA 4AIHA 2W7NA 2CZ0B 3CMAQ 1X3UA 1W2BS 2W4SA 1JJ6C 1NZ9A 2WY7Q 1VQMA 3L9FA 2R5AA 2CP0A 5TJJA 1RR8C 1ZLKA 5IN1A 1KYZA 1JKQC 1AKHB 3OYAA 2YS9A 1YIOA 2HZTA 1CQTA 3R6OA 3CCQT 1W5CC 1XPXA 3K1NA 3MP8A 1D09B 1X01A 2BTTA 5KAFC 5L23A 2RI5A 1YX5A 5GANe 5CQXA 4PUSA 1UFFA 4P5NA 4EMGA 3CJRB 1RI0A 4DBRA 2MYSA 3VUBA 1TBXA 4XSXF 2M5WA 1T8IA 1UJYA 2L3PA 2DT5A 2HNHA 4G8XA 2RI2A 3BQZA 3VS2A 1YI2I 1WVRA 5TGTA 4M77B 2AZVA 5FRNA 1QQJA 4XORA 1FYNA 2RK1A 2F5EA 5GAOr 2LNVA 4CC7A 3I56T 3NTKA 1H3HA 5I2SA 5GAHJ 5ICFA 3SHWA 1D1AA 2L4AA 3ZCOA 2KAFA 1P9QC 2M0YA 4MMKA 3H0FA 5L3GA 5E3MA 3F23A 2AKKA 3T9NA 2XHKA 4C0DC 3J80K 4B1RA 1FPQA 1W5SA 3AL0B 3DKYA 4PSWA 3J7AO 1QCNA 3GBQA 1KD1U 2X51A 1U8BA 3ME9A 1VQNI 3JSCA 4M78D 5DM7F 5BMZA 5JI6A 2CP7A 2VODA 2E7XA 3CC4I 5DUIA 3DLLF 2QXFA 4RBOA 3CJQB 2DRMA 2COBA 4LG0A 4X9CA 1MMGA 2ZFUA 3ABMH 2JOYA 3SXYA 4N9HA 3PM1A 2FO0A 1T56A 3G4SA 2STWA 1I3AA 4B48A 1EIFA 1TQPA 2XRNA 2MWOA 2DTOA 3CPFA 2DXBA 2PQ8A 1OLTA 4IIMA 2QEXA 1QVTA 4MQVA 2LY1A 1EJ9A 3GTPJ 2HVQA 3CCEI 1KK7A 2E6ZA 2Y4XA 1MMSA 4AYBN 1LUJB 4I2OA 2KKOA 2W85A 2NXNB 1VYTA 1MBHA 3E9FA 4OWRB 3PTAA 2BY3A 2EIJH 3A5ZB 2P8TA 2DJZA 3UT1A 3BTJA 2VONA 4EJVA 4DEXA 2GQVA 1YJWT 5J1YA 1U8RA 5GAOl 4LG3A 1TT5B 4WXDA 3ZQCA 3JRAA 3MP1A 1OYIA 4F04B 4YTLA 2OAWA 4E70A 5CVVA 5FKMA 1OQKA 2KISA 5AYFA 4CC2A 3U23A 1NG2A 1IRFA 2DNUA 1K73C 4PJOC 1NK3P 1WHKA 1T0FA 2F69A 2K3BA 3GF2A 5LJ3d 3KUFA 3RDVA 4R79A 3JCUC 2QM3A 4LLGF 2Y2ZA 2XGXA 2DBMA 3VS5A 5FGMA 3DU6A 3CMEQ 2OUMA 1J59A 2ZO4A 2M16A 3FISA 2R7DA 4MTDA 3IKVA 2JTVA 3CCQI 4IO9F 4G7HF 3BLYA 4F91B 1MGQA 1D1CA 1A31A 3U1KA 1JU5C 1VYUA 2ROLA 3HRTA 3QKJA 3HBLA 2ADUA 1YG2A 5EEHA 3V4GA 1B34B 2HNIA 3TREA 3JCMJ 3RMQA 5I22A 3IRRA 8AT1B 4M77D 4Q47A 1J0RA 2M3AA 2F48A 2J6OA 2DMOA 3M9QA 1YIJQ 2FBKA 3E9GA 4LOCA 4C5HA 1K6YA 2X4WA 3FM3A 5J1RA 2KRMA 2R93J 3FK6A 3CCUT 2EFQA 4LNPA 1H8AC 3M59A 3M1CA 1XS9A 5I2MA 1UE9A 4L0YB 4QSHA 3RUXA 2J5OA 4EJUA 1PP8F 1WI9A 2VQLA 3OYKA 3I56I 1P4XA 1E3OC 2E1CA 2HL3A 1Z91A 3H0GJ 2MG4A 1JTYA 1TUCA 4XSZF 3BDUA 2CYZB 2BY0A 2CW0F 2YUSA 3ZP5A 2DA3A 1Q81C 2CV0A 1QWFA 4A3MJ 1HKSA 5GAN6 3I58A 4GY5A 1VQ9Q 4B47A 2OI3A 4YFNF 1KA8A 2H6BA 1YHQI 5LL6S 3HL2A 1LDKB 4XLAA 3VYRB 2EIFA 1Z1DA 2RQTA 2ZB9A 1UJ8A 1M8MA 3G1OA 4QVDA 1YJNQ 3VYTB 4C3HJ 4DJAA 4RAGA 3FXUA 1D5YA 3DBLB 1K0XA 2KROA 2PMUA 2G6FX 4GYGA 1DGWY 2V1UA 2IS6A 4C3JJ 1N9RA 1WDXA 2TCTA 1WHHA 1Y0UA 2IGKA 2VOOA 1GXPA 3DU5A 5J26A 1NEBA 2KGTA 1AA7A 2A5YB 2JVHA 4Q4ZF 1DGRM 3MEWA 2WWYA 4QVCA 1RR7A 1QNTA 2GZWA 4WF2A 2HYJA 4HAMA 1T95A 1JI8A 3QUIA 1S72A 4KN7X 4R0KA 3E6DA 1BB9A 1T33A 1ZARA 4QVZA 2FU4A 4GO1A 4DZJA 3OY9A 3EAEA 2J6FA 4HCBA 3CCJA 4BY7J 2E1MC 2XF6A 3MN2A 4ON0A 4CCMA 4ZJZA 4YIRX 1YJWI 1HBXG 1QVUA 2PMZA 5E20A 2C6YA 2DK3A 1K9MR 4A3KJ 3OS5A 2B63J 3CDHA 5CKFA 2EZLA 3N4MA 2MABA 4F16A 3LAPA 2AT1B 4M7AE 2LY9A 3RQ4A 4M7AG 3CLQA 3DKWA 2X48A 4C8QF 1TZLA 3QWXX 2G7UA 1T0JA 3OOPA 4M9SA 4CYCB 2NS8A 2H8RA 2HOTA 2L3RA 3OIPA 2HEQA 2MFZA 1IGUA 2W84A 4FT4A 5GPAA 4RGUA 4CI0C 3EUHC 2DL7A 4M7DC 3ULQB 1ZK8A 2E60A 5FLXK 2EYXA 1M4ZA 4C2UA 4IQ4A 4PZJA 3RKWA 5LEJA 4HV5A 3OYJA 3TCJA 2G7HA 3K4NA 3QOPA 5B3SH 1EH7A 1KU2A 4MO7A 3HGYA 4KUDK 1QVFS 2BHYA 5GANj 2NYSA 3M9AA 1OV3A 1YFNA 3JB9D 5HODA 3T1BA 2DRKA 4FYWB 4OMQA 1XSDA 2B86A 4IRHA 4WTOB 5GAN5 3CCUI 4FYXB 4IUPA 5IPAA 2OU2A 1B7TA 4KBMB 5BNGA 1HLVA 1N25A 4ZYGA 3W2VA 3K1PA 1YNZA 1U1TA 2JJ7A 5M3FJ 2QZ8A 2E6NA 3I5RA 3SD4A 3CD6Q 5H6RA 5JHFA 4L5GA 3H5RA 2OAUA 1IN5A 4AWXB 1L0OC 3W3CA 3H3VK 3J7YJ 5KK1A 2LH9A 3SZPA 4BAYA 3HTSB 3RPUD 2DLLA 2M45A 3AG4H 3GTOJ 2X3XD 4W97A 3VS7A 1GCPA 5LHGA 2ZC2A 2VXZA 1RAGB 1KQSP 5A0GA 3CC2Q 4BI4A 2D9TA 1PKSA 5FFZA 3JREA 2E70A 2P4WA 1H88C 4FW2A 2RPNA 1LJ9A 5IYDJ 2R5MA 3JRCA 1O4XA 3ABKH 2HVSA 3BP8A 2QQ9A 3BFMA 3LA7A 1D0YA 3OW2P 1WZ2A 2DXCA 3BW1A 3SQNA 4IUVA 1YP5A 2QLZA 3B6AA 2B0LA 1EH6A 3HPGA 3HKZA 4KT6A 2L89A 3HHTB 4OAZA 2R7RA 4J19A 3C3WA 2YUPA 4CH7A 3M3YJ 2A7YA 3OBWA 5JVTA 5E3OA 2XAUA 3R6SA 3L2RA 1CKAA 3RBBB 5K7FA 1MNDA 2XSJC 1X6OA 2DMUA 4EJOA 2A28A 1I50J 2RHUA 3BR6A 4BQNA 3GTMJ 3G6ET 2OTJT 1S72T 4ENNA 4XLCA 2W82A 5LJ5j 2L2PA 3PE0A 3VDXA 3P7NA 4J6YA 3S6WA 5H6QA 4M75G 4JQFA 3ERMA 4MFDA 3DKXA 1M90R 5B66C 3D1NI 2ED0A 1I1SA 1Q7YR 3ZQ7A 2DILA 1HW1A 3A8GB 5DY9A 5IHKA 2FZCB 5GAMj 2AZSA 2QF7A 5FU7C 1VQ4A 1IF1A 4HPQA 1OU8A 3WU0A 5ICGA 1UTIA 4NS5A 3VS1A 1Z05A 4A5NA 2CO5A 2FZGB 2Q0OA 3JCMg 4UC4A 2OTLT 5HNHA 2H94A 3UF4A 3NRVA 2K7LA 2GF7A 4RKUE 3NGPA 3DEUA 3WU1B 2BE5F 1JB0E 4YIFA 3A2KA 4JS5A 4PFOA 3WGHA 4HLYA 5D5UB 4OMYA 4X1VA 5KHDA 4ANJA 2RVCA 2DMNA 3NEUA 3WGIA 2M51A 1CF7B 2MI6A 1JUPA 3QDFA 1FC3A 3CQZJ 1MBJA 3BQYA 3M4GA 4MMLA 3TVTA 4C92A 1EA3A 1I3QJ 1VQMQ 3W6VA 3FXRA 2RN8A 1BOAA 1FBUA 1ZGJA 4M9ZA 1JKRC 3H3ZA 2X4YA 4IHYA 5FROA 4M7AB 4HZFA 4WXHA 4LJZF 4M71A 1MMDA 1JKOC 2LKSA 2DA5A 4XL9A 3M0RA 3DWLE 1XGSA 5IHNA 3C0CA 1QZYA 4YG2F 2M1BA 1SMYF 3ZMZA 1QKWA 2QA4T 3G71T 1TC3C 1Y96B 4HKEA 2KIMA 2ZXJA 3GFMA 2KRFA 4XM3A 1ERDA 2IPOB 3RZDJ 4XTUA 1VQ6T 2JM9A 3CCRT 3CCVT 5IYBJ 2QQSA 4FT2A 2XAQA 4LMYA 1CF7A 1MHNA 2IXSA 4DOZA 3NAUA 3UA7A 1IGQA 5ICCA 3GZ6A 2RM4A 3DEWA 2QQRA 1APLC 3I9QA 1KD1C 3QYBA 3S1NJ 1HSJA 2HI3A 2DI3A 5C4JJ 5FFXA 1U3EM 4PLIA 3MEXA 4HEA2 1IXRC 3HC7A 4CCLA 1XX5A 3V42A 4M4ZA 5HS9A 3E5QA 4A6EA 2FOKA 4OU0A 2X85A 2OQGA 1WYXA 2BEOA 3HM5A 2LZ6B 2X9HA 4PKCC 3AG3H 3S8PA 2E1HA 5CIUA 2QTVA 2F5FA 4P9FA 3G6EI 2D1XA 4LDVA 1WRJA 1ETWA 1F9NA 2PEXA 2JMCA 2XVCA 1NJIC 1Y96A 3LH5A 1Z0XA 2F5DA 2VKEA 2RAEA 4M72A 2GWRA 1WJBA 1LFUP 2E64A 5IT3A 2O61A 1IXDA 3QP5A 6PAXA 1C6VX 1YJ9T 1NJIR 2EYYA 1JUMA 5AIPA 5LLQA 5KNLA 3K4CA 4XTZA 5GMKm 3G4SQ 4HT8A 3TL4X 2H27A 2V8JA 2O5RA 2IJLA 3MZ8A 4EIKA 5CVUA 4WK8F 3W6JB 2VGNA 3EGXA 3NQOA 1W2BA 3ZMVA 2D45A 2EK5A 3C2GA 2HKOA 1HC8A 3IH4A 2JQ7A 2QEXQ 2K2MA 4HQEA 4IHXA 3A0BC 2JPBA 2UUZA 1VQOI 4AMCA 2YU3A 3EUAA 3CUQB 3TDZC 2OTLI 3RJPA 1LE8B 4JBAA 5HK3A 3IAS2 3BROA 1TH7A 2NOJB 3K7AJ 3VPRA 2CJJA 2VVKA 3FC3A 3WTUC 2QGFB 4OIRF 3FKJA 3GX4X 2EYZA 1QW1A 4IKFA 3DQVC 1TU0B 1BW5A 2XRLA 1M2VB 2BZXA 3QWYA 1BKBA 3Q0WA 3GVAA 4PJMA 5BS6A 2NUZA 4JJDA 5F0CA 5BPDA 4D8DA 5LJ3g 4M7AD 3RYPA 1F5TA 2BKDN 3T8RA 1VQ8A 2VT3A 1IZ6A 1SVLA 2RREA 4V2GA 4JRKA 2PMHA 2L9RA 2VUBA 2H3EB 4X6AJ 2PN6A 3URGA 3EUKL 2V6EA 4QQ6A 4JDSA 5A2QZ 2A0FB 2FG0A 4JOMA 2L7MP 2ZXWH 2EGEA 2XPVA 1N9SA 2V1XA 3U2RA 3CMAT 2ZJ2A 2E19A 2KJBA 5EF6A 3G71I 2A6HF 3KFVA 4JLGA 4N0AC 4UUVA 2DEQA 3CUQA 4CZZA 3QP6A 4LGWA 1LE8A 4ASNA 1A5JA 2DIGA 3RTRA 4X9DA 1JT6A 2CQQA 3HOVJ 1SEUA 4G7ZF 3HHGA 4BY1J 3KP5A 1GHCA 1VQ6I 2M8EA 1SFOJ 3CCRI 2H09A 3CCVI 1SPKA 1I6XA 3M57A 3MZYA 2D1HA 1WCMJ 3E6CC 1XMKA 2IPQX 3TQ7P 2C0OA 3UATA 2MW8A 2QWWA 1X75C 2LT1A 2JA6J 1UG2A 2BV6A 3IH3A 1D3BB 4A53A 1ZBJA 5F1JA 4A54A 1KU9A 2DOFA 4CSWA 4EMKC 4RB1A 3LLRA 2E71A 2HQRA 5D6XA 4C8QE 2EA2A 1BW6A 2MA3A 3FK7A 3I9V2 2K9LA 2X0LA 3LWFA 5E3LA 4FU6A 3LSJA 5EC7A 2B7EA 3BZKA 1AT1B 5FD5A 2XSDC 2H3JA 1M1FA 2KZVA 2XIDA 2KY9A 1PRMC 3HRUA 2ZCFB 2CW8A 1YS7A 2FMLA 4LLNA 1GV2A 3SHFA 3CPWP 5C4XJ 1VTNC 2JTEA 2DA9A 3I55T 1I5OB 2A6EF 2P6SA 2Y9YA 1SHGA 2KR3A 1IDZA 4AFZC 4IEJA 1MDMA 1MSEC 1FTTA 1BI1A 3LGLA 3FXOA 3PNYA 4A12A 4MEXF 2M30A 3S15J 4L5JA 4LUEA 4IURA 4EV0A 2YX7A 4XLHA 4E7JA 2NRAC 2MSYA 2DVEA 5EEAA 1PD1A 2ZAEA 5HCKA 2FZKB 2KRSA 2STTA 1RACB 1D3BA 1SC7A 3R0JA 5CO7A 2EGAA 1OISA 1K8AR 2NVQJ 1D0XA 1SAUA 1Y0NA 3I64A 4GGGA 4HG2A 1X6BA 1V55H 4ME7A 3IUOA 2EYWA 3VSKA 1VNDA 4IXAA 1FXXA 5IXBA 3WHCA 4M78G 3IL2A 2JNGA 2HBWA 3PO2J 2MD0A 3CCJQ 1LQ1A 3HUGB 1ZAOA 1ZELA 1KHCA 3GYHX 1UGQB 2AS5F 2E3HA 3F8CA 1B59A 4DNCA 2H8HA 4JRQA 4XKCA 2FMYA 3GTQJ 2LQKA 3IHUA 3EGDA 3MKDA 3QG1A 5FD6A 2Z33A 3K69A 1QU3A 1X43A 3FZVA 2V7FA 3J80Z 1PD0A 5F1RA 3G1LA 1M9SA 3SWNB 1RUNA 1YX3A 4NOYA 2H8WA 1MKMA 1TWHJ 1HK9A 3ISPA 4M7DE 3OOUA 2XDPA 2F6CA 2M9HA 2R3SA 2J6KA 1M90C 2O8XA 2WB1A 4I7HA 2GBYA 3MZHA 3H1CA 5CLSA 2ME6A 4ZZDA 2VQGA 3S17J 3H6ZA 2BY1A 4FL6A 1BI3A 1X3ZB 2DBBA 4U7DA 3ZRGA 2ACJA 2RK2A 4YELA 3JR9A 2ZPGB 1HOMA 2CMPA 3CMAI 4J9CA 5J1UA 3EG1A 4LDWA 3J81E 3T0YA 1TNSA 5L8RE 2BGCA 1V54H 2FRWA 1WJRA 1TWGJ 3CMET 3C18A 1VQKT 1NEGA 2LSOA 4CA0A 1T3SA 1OCZH 2P0KA 4HVWA 5LD2C 1U2WA 3ZXSA 3CCSI 3HUGA 4EM2A 4E7SA 2DEUA 3DLAA 3C2HA 3RKXA 1JJ2P 3BCBA 2YRCA 2CSIA 2KQRA 1K9AA 2JPCA 1TT0A 4C92F 1TUDA 4NC8A 3S32A 3G3ZA 3VWBA 1N8RU 3SWNA 2LK2A 2YT6A 1YIJT 3MHXA 2FA5A 2VKVA 3ZEHA 1YITQ 2DQLA 2VI6A 5L3BA 1MNMC 1U0JA 3CF2A 5CVJA 4IOAF 2KT1A 3WTXC 2HPMA 3OYDA 4M77G 3LSKA 1NHAA 2JMAA 1SD4A 4C5IA 4DOVA 2EFNA 2A07F 2Y90A 3ABUA 2CH0A 2GQIA 4OMPA 1ETOA 1AOJA 2Q2EA 1ZYRF 2Z1DA 3D5SC 1QCFA 3F8MA 2I5UA 1D0ZA 2KP6A 1YWOA 3F72A 2FL7A 1IRXA 1VI0A 2OF7A 2FB7A 3CD6A 1O3TA 4CYDA 3I55I 4JX4A 1XGMA 1E3PA 4BHCA 1JEGA 4GYIA 4M74A 2NVYJ 2EKHA 2PMZN 1VQ9T 1OQYA 4EJWA 2XKPA 1ONVA 1HW5A 2J06A 1Q82R 4JX6A 2G0EA 1WHMA 4H4KC 5LRRA 4I09A 4Q5SF 3CC2A 2GBQA 1K83J 2WC2A 4NQWB 3V8LA 3PIOF 2YUOA 2ISYA 3L1PA 1WX6A 2FRHA 4C8QB 2PVGB 1JBMA 2BY2A 1ZR4A 1ZKGA 2JA2A 1IW7F 2E5NA 3WVEB 4ESFA 2CWEA 5GPCA 1PSEA 4J5YA 3GFIA 2AKLA 2A37A 5C3EJ 3VKIA 2Y75A 3DCFA 3I5SA 5LEKA 1RKWA 2VC8A 3I3LA 4AU7A 3F8BA 2KLOA 5IT9K 4L9NA 2DJQA 1G3WA 3S16J 1DPRA 1DP7P 3OWTA 1D8KA 2P7VB 1SD7A 2KBTA 2IT0A 1YW9A 1SRMA 1W4SA 3TW6A 1GFDA 1GVJA 2LF7A 1FYLA 2VBYA 1GCQA 1R0BG 1FX7A 1KC8U 2UXNA 4FE4A 2RQRA 2EQKA 4XKBA 2FNPA 2RQUA 4L9VA 4HX7A 1H0MA 3THKA 4A69C 2WAEA 2EJ9A 3M58A 3G2BA 1A36A 3F70A 2DMPA 3K4JA 1YCYA 1W7PA 2AXTC 4Y3OA 1LCKA 1ZH5A 1UGSB 4C8QA 4W1UA 3KZZA 4XLNF 1J9IA 4E2FB 2XASA 1M1KR 1UHCA 2MBFA 2KMTA 4U7BA 4C0GA 2ZXIA 3ESWB 2NAZA 3C1DA 5LBQA 3F0CA 1VQKI 2E1OA 2K86A 4NL3A 4J01A 4MGRA 1P4WA 2AIRB 1WXUA 4RG8A 5FKLA 3RI4A 1V3FA 1JTXA 2PX9A 1Z6RA 4NBQA 4Y17A 3GNFB 3M4YA 1TTYA 1UHWA 2EFPA 2A3LA 2DK8A 1OYWA 4KUMA 1W0UA 2RA2A 4ETSA 1MH4A 5CKEA 4D6WA 1JXSA 3JRBA 4M75C 1R6RA 2LCSA 3H9QA 4C5GA 2K9MA 1QPIA 1GBQA 3HKZN 3HYIA 1P2FA 3FRNA 1VQ5I 2RJFA 4LE9A 1W36C 3B6CA 2P5LC 2XAJA 5IP9J 2JVGA 1WHLA 4FM4B 5GAN7 3LWIA 4Y28E 2HEOA 5DCFA 1ZG1A 4XOPA 2R0QC 1U06A 3KEYA 4ESBA 3GW2A 4H0EA 4BDZA 1T6SA 2PVOB 4AIKA 3I4PA 3M4OJ 3LH0A 1SSFA 3CD6T 4IF4A 3JB9G 1QVGP 5D6YA 1Z77A 5FO5A 2IVWA 2LQ8A 4BYYA 3JAMK 4XU3A 2HDDA 2VWFA 1VQLQ 2HSPA 3WTYC 4U87A 4QIWN 1I5ZA 3KFWX 2DU9A 4F7UG 5FW9A 4C8QD 4XIDA 3I35A 3Q3SA 4BHPA 1IV6A 1M5Q1 5FLXZ 1OULA 1VIEA 1WXBA 1FYKA 2ESWA 2EQRA 2QQAA 2X6WA 2QQBA 5GJWB 2QDLA 4M7DA 4LG0B 3LL7A 3SDBA 2Z2SB 1U5SA 2KEAA 1AVZC 3BR1A 4B09A 5AT1B 5HKCA 2QKMB 1QQIA 3RDIA 2XGDA 2LX9A 1WJDA 4AVZA 1YJNI 3EETA 4J83A 5DYMA 2D5VA 2VLAA 5FLMJ 1E7OA 4KGVB 2MMPA 2FUG2 4J9DA 1MD0A 3M0UA 3X20B 4MZPA 3OYMA 1ZUKA 1IHWA 4XTWA 2VXEA 3MP6A 5J4YA 3D5RC 5DLQE 2VB6A 5D6FA 4LB6B 1UCRA 4UB6C 5HS7A 3JRGA 1X2NA 4BQAA 4KGZB 2E5QA 2XI9A 1A35A 3DTKA 1OR7A 3KYCB 3VYGA 2EV0A 2ZMEC 4C30A 3BTCA 3BG6A 2GFUA 4CC4B 3ZR8X 1WKMA 3TBIA 1OX8A 3O8VA 2HD0A 3H41A 2MAMA 1UB9A 1UUEA 4Z88A 3SEQA 3DBRB 3W6KB 4UUSA 2A08A 2NS7A 1TUGB 2OBPA 4BHBA 3TW7A 3VV0A 3BJOA 5LJ5e 1HW2A 4IQJA 4PJLA 5E79C 2LMJA 4RTYA 5K7HA 2IS4A 2DE0X 2HDAA 2KHMA 4D5CA 5GADJ 3OYFA 2HKNA 3OIQA 1FIPA 1C0WA 1VZ0A 5M9OA 2COYA 2ZSHB 1Z21A 4I6ZA 4BDYA 3K0LA 4KYWA 1GDTA 2I8DA 5GAMe 2MPXC 1ZQ3P 3DP7A 4IHSA 4KRTA 2FBHA 2M4GA 4HF1A 5HDNA 2YDLA 2Z99A 2Z3YA 1SFUA 4KMFA 1SVOA 1IC8A 2O7OA 4DBQA 2DZ9A 4OB2B 4ZN1A 3JSPA 2V1DA 4C9YA 2F5CA 2F2WA 3EG3A 3K4BA 5FKKA 5LHHA 1YFHA 1VYVA 2JZ2A 2QYZA 2L9NA 4JRIA 3ZMDA 3BZ6A 5LGTA 1ZUUA 2E4HA 2JN0A 2LC4A 4RMOA 1LDJA 3R60A 1IV8A 4A0YA 4UVCA 1VQMT 1VQPQ 4YIIA 1FJLA 4BY6B 2A05A 5CCAA 3CZ6A 4FASD 5IH2A 3LA2A 1PCXA 4AG1C 3ZL7C 1ZG3A 5L3CA 4D7NA 3OIOA 2X3WD 2KRCA 2X6YA 1EFNA 1U5TB 4II3A 2WADA 3BR3A 3HPHA 5KYXA 2Y9ZA 1K73R 1YQAA 2XF5A 2DYBA 2E65A 1STZA 5FU6B 1ZR2A 2E2JJ 5KAIC 4BACA 5GAOq 4HCCA 3B02A 2DF6A 4OB0B 1Q1HA 1W70A 1OCPA 2VBZA 3DXJF 4DYQA 4XMYA 2BZYA 2M2EA 1TW2A 1Q86C 3S93A 3TEDA 3GFLA 1S29A 5D6WA 3PUBA 2P4TA 2EZHA 4LDUA 1V4RA 3WU2C 2UV1A 1T0HA 1Q86R 1UGVA 3BWGA 3ER0A 4JLIA 4F55A 1LPQA 1NYGA 4IUQA 4EDUA 3QYHB 3QHSA 1WWXA 3FKIJ 3OSGA 3I4NJ 4A3DJ 3EG0A 3SB2A 4ZDPA 1MZBA 3L2UA 3I59B 2R7ZJ 1IDYA 3OYLA 3H36A 4VUBA 1U5TA 3IAM2 3WE2A 2ETHA 1GFCA 4PJOF 2VKHA 3BY6A 4BGDA 1U9NA 3DPLC 2CKKA 2QSFX 4IL6C 5CYVA 4IHTA 1G5VA 1YYVA 4C92E 5GANf 3E0JB 2JA7J 1X4PA 3VS6A 3CMMA 4C92G 3CO6C 1Q81R 1ZHIA 1KU3A 4GDFA 3VODA 3M7GA 5HVQC 3OSVA 3BT9A 2IAIA 1AHJB 5A0DA 1K4US 4XK8E 3LQQA 3G4ST 2EZIA 1C1AA 2QENA 4BQQA 4G94A 1YE9A 3M54A 3Q1JA 1M8VA 5H2FC 2G9WA 5BQTA 1O9SA 3QXEB 2DFEA 2FX0A 1SAXA 1RL2A 4L9JA 1KZHA 5IP6A 4OGCA 2E7WA 1TQMA 1B72A 5DEQA 2QEXT 2VXDA 3CLOA 4RCCA 3IQLA 1FOWA 2Y48A 5BPIA 2TRTA 5M5WJ 2K6DA 1ZN2A 3I59A 1YOVB 2A3SA 5GANh 5GAOm 3MKZA 1YI2Q 3VU3C 2DCEA 4TV7A 4NUBA 5CR2A 2LC2A 2X9DA 3P8DA 2BHZA 5CKDA 1V5GA 2X1DA 3QOEA 3O8GA 4OOIA 5EJCA 2HVRA 2DXTA 2WSCE 1WGXA 3BOQA 2IA0A 1QMCA 2QYOA 2ID3A 3V8JA 4ESJA 2JSCA 5IYCJ 2XAGA 2JWTA 2DW4A 2RQQA 3PGGA 4MFEA 4P55A 3S14J 2F2VA 2CUDA 1N8RC 4KIFA 4M9XA 1YW8A 3MFKA 3D0SA 3CP2A 1BR4A 3CF5F 5GAN3 3H5NA 4IRIA 1Z6TA 4FSSA 4DA4A 5LJ5f 2KXCA 1KIKA 5EG0A 2EQUA 5B1BH 3A01B 4NDLA 2Z9OA 1F43A 4A3BJ 3ZFJA 1VQNQ 3TO6A 1SSHA 3SYTA 2V79A 3KYLA 2XPUA 2DXIA 2MK5A 3AT1B 3P8BB 4AFQC 3CC4Q 1OCCH 3S3NA 5GAMf 4M78C 3GEZA 5KE3A 2P81A 5FJ8J 3LA3A 3LSMA 3JRDA 2FEIA 4JJNK 2L9VA 4ZGEB 2KMUA 2DOAA 1WHUA 2PG4A 4GCVA 4ZDOA 2P0WA 1ACMB 1UDLA 1GVDA 4KH0B 2DPPB 5A2QE 3FXMA 1UELB 1B6AA 3E5XA 4A6DA 2K5CA 3HSRA 4BH9A 2VC0A 4CICA 5ILVA 1G4DA 4O3MA 2ZBKA 2MLKA 5IHIA 5LJ5h 4KFCA 3K70D 1UECA 4B9WA 1XTAA 3ZQQA 4AIJA 3EPZA 4G9YA 1O7LA 1VQOA 2Q1ZB 3RERA 5GAN2 4XRMA 1NG7A 1TWBA 5FWBA 1K4SA 1Y8QB 3M53A 1FIAA 2JA8J 1N5ZA 3SJMA 1IO6A 1ZRFA 3FXKA 3H5AA 1ZQ1A 1IXSB 3CJNA 5GAMh 1JJ8C 2JTFA 2ZPIB 1YITA 1ODDA 4DGWB 3CC7A 5ICEA 3GBGA 3A01A 4PL6A 3H92A 4HX4A 3LW5E 3FMRA 3RSNA 5E8IA 3EFOB 1R1VA 3E1SA 4OVAA 4XRFA 3TGNA 4PJNA 1QWEA 4O6JA 2KL4A 5CVRA 4RDUA 2CP6A 3N97A 3D7SB 4M3DA 2P0PA 1MV3A 4J9BA 4KT0E 2C06A 3LAJA 4GXOA 3BDLA 1KC8C 4ATOA 2XG8D 2HDCA 3EH2A 1BOBA 2R5YB 2WB1N 2HPIA 1IO2A 1RESA 2OD5A 2BZ8A 2EQJA 1R7JA 1W5TA 2X35A 2QGGA 4M7DF 3G4SI 1PSFA 1YJ9A 2O9SA 2PVDB 1GT0C 2PLYA 5HLHA 4ZYHA 3Q9VA 2LR8A 4RAFA 2JUFA 2HWVA 4IJAA 2MGQA 4NC6A 4HXJA 3NARA 4KT5C 2RF0A 2HDWA 4EM1A 2O8KA 4B6MA 2RJEA 4ZC3A 2WAFA 3V8KA 1VQ7A 4A3CJ 4RLFA 4K2EA 4N9IA 4LFUA 5F08A 3HDDA 4OIOF 4M77C 4EMKA 3O6BB 1XSVA 1RRJA 4C92B 1H9GA 2IA2A 2WBMA 3VUZA 1ETXA 3CCJT 2HQEA 2I10A 4BNCA 4KNYA 2V1QA 3HKSA 1X2QA 1V5EA 3EFOA 1QVPA 1GLNA 1T98A 1U1SA 3CBMA 1WHJA 1A04A 2XKOA 5CK9A 1BK2A 2ZGWA 2UXXA 4AVPA 1U3OA 3QPTA 3E2UA 1J2XA 4L59A 4XTYA 3OYNA 4OMLA 5DV5A 1FOYA 4L9TA 4I01A 2DIQA 2R5YA 2NUPA 3PNVA 2X4XA 4OMNA 3MJXA 1T38A 3Q0VA 3AL0C 2M7AA 3A0HC 3MQ0A 3DV8A 4DBFA 2NUPB 2VKNA 3G1JA 2XC7A 2LX7A 5GAOp 2HXOA 2HQHA 3G7ZA 3LGFA 3F9KA 1QP3A 2R58A 9ANTA 4EM0B 1YHQQ 1SFEA 2IBDA 2M34A 4XN3A 5L3DA 2GLOA 2BVMA 2D8HA 2JT4A 3OSFA 2LCCA 3BE3A 2ROTA 2QCOA 1TS9A 2LFBA 2XUBA 2HQXA 3M8FA 3J80E 4BXFA 1LOJA 4FSXA 2O9VA 4KULA 4HQMA 1H89C 2JM8A 4OINF 1YBYA 1YRNB 4F93B 4Y4RA 2CS3A 1U6GA 2EPFA 3V7RA 3FXJA 4EGYA 1ZX6A 1ZSZB 2ZPHB 3U9GA 1TNTA 4L5IA 1PP7U 4A93J 1TOVA 2VIXA 2YSRA 5F0FA 2ID6A 5A0LA 3LMMA 2HQNA 2L0AA 3X2QH 1W2BP 4IOCF 1RAHB 1RAIB 2QASA 2YUQA 4HA8A 3N5BB 1JGSA 1KC8R 3A1YA 3OMYA 4G12A 5EZHA 4NC7A 4J9IA 2DODA 1OZ3A 1ULYA 2JZYA 2V1RA 3KXTA 4B3AA 4Z6YA 2D0NA 3DTIA 1YJWQ 1KQ8A 3EYYA 4XU0A 3F8NA 1V76A 2RJCA 4A3EJ 4U0WA 1F1BB 1Z7UA 3HB9A 1S6LA 4D0PA 4OIQF 3JB9H 3P5JA 1ETVA 2W24A 1X4OA 3OMCA 3FBNB 4FT8A 5K5QA 3JSOA 4FQGA 3EGXB 3L42A 5DD8A 4QKUA 3ASOH 2CT4A 1EV7A 1YRNA 3PIOA 3GFJA 1R36A 2H1KA 4F14A 1RI7A 4HNUA 1HD3A 2EPDA 1ZSZA 2KXDA 2MLGA 2EFWA 1S1NA 3P8HA 3CQTA 1DPUA 2ZZDA 4IIOA 2ZJRF 4UHTA 2MC4A 1X69A 1KD1R 3BDDA 5J8CA 3JB9I 3S2HJ 4ZTFA 4C92D 4X0GA 4G6TB 4DIQA 4GFBA 2QK0A 4J6WA 3LSPA 4UXNA 2OTJI 1S72I 4WCGA 2DT7B 1MBEA 4G6DA 2JRMA 2YLCA 3CEYA 3K2AA 4RB3C 2GXBA 1WPYA 5GAN8 3CCJI 1IUYA 3CCUQ 2RB6A 2FPDA 1Z7LA 1MUZA 3VOEA 2IRFG 1VQ4T 2Y31A 4ZYDA 4C2MJ 1IHVA 1AD5A 2FPFA 2KIQA
chains in the Genus database with same CATH topology
1UFMA 4F7UF 3JB9J 2BIVA 3C12A 3HL8A 3RMQA 3WG9A 2LF8A 5CVIA 3REOA 2I2LA 4ZTJA 1B4AA 3G73A 4HBLA 4IPAA 3HPWA 1PUEE 1TW3A 1ZHFA 4YFXF 5D4RA 5F64A 2RKHA 4UNOA 1K79A 4HCZA 2EAYA 4PJOE 2K4JA 1BI2A 5L3EA 2F2EA 2LDMA 1IRGA 5IT9Z 3VFZA 2Z5UA 4J7IA 1FP2A 4U0VA 1KG1A 2QUFA 2IP2A 3KP3A 1O3QA 2FNAA 2D0QB 5GANd 4HF0A 5D6EA 1OYXA 2HOEA 2IVMA 2JTMA 3P9KA 1F1ZA 5E1XA 1VQPA 3GXOA 1I81A 5C0MA 4BE1A 3F8FA