5CVIA

Structure of the manganese regulator slor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
PNKEDYLKIIYELSERDEKISNKQIAEKMSVSAPAVSEMVKKLLLEDLVLKDKQAGYLLTKKGQILASSLYRKHRLIEVFLMNHLNYTADEIHEEAEVLEHTVSDVFVERLDKFLNYPKVCPHGGTIPQHGQPLVERYRTTLKGVTEMGVYLLKRVQDNFQLLKYMEQHHLKIGDELRLLEYDAFAGAYTIEKDGEQLQVTSAVASQIYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SloR
publication title SloR structure and DNA binding studies inform the SloR-SRE interaction in Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
total genus 60
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cviA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cviA02
4EM1A 5CVUA 1OMIA 3QP5A 4IPAA 1I5ZA 1XMKA 2IW5A 1MJAA 2LX9A 3ZMUA 2UWMA 4AD9A 4ZZDA 4LB5A 1EH8A 3SZTA 2PLYA 3E5QA 2ELHA 2GXBA 1H0MA 2A5YB 3V8LA 1TNSA 2NNNA 5DCFA 2V1UA 4L0ZB 1S3JA 4KDPA 1BI3A 3PQKA 3LQRA 4BHPA 3TO6A 3WTYC 5DCMA 3DXJF 3QU3A 2IA0A 4AIJA 1IZ1A 2MBFA 1KU9A 3ML6A 1J9IA 1YW7A 3IRRA 3V8KA 3J81Z 5A2QK 2ISZA 4KIBA 1V4RA 4A5MA 1IXSB 3Q9VA 2IA1A 4EJOA 3K0LA 1TW2A 1S8NA 1XD7A 1CGPA 4HLXA 1UFMA 2HQNA 5TJJA 1U5TA 5DDGA 1FY7A 3SFZA 4KYWA 1OYYA 1I27A 5DV5A 1XCVA 3F6VA 4JBAA 1SFXA 3CUOA 2A69F 3TOBA 2OBPA 2BEOA 1EV7A 4I02A 2NYXA 4G8XA 3I5UA 5K5RA 5FD6A 4RB2C 3W6JB 1FT9A 4G9YA 4FT8A 2M45A 1PP8F 2Y48A 5CVVA 5AONA 4ENMA 5L3GA 1YS7A 3GX4X 2EFWA 3RKYA 1BYMA 2VBYA 2YU3A 2XROA 4MEXF 4EJVA 1FNNA 1FZPB 4M6XA 1REPC 2FNAA 1ON2A 2QUFA 1ZG3A 5E1ZB 5HLGA 1FP2A 2A6EF 2PMHA 1P4WA 5D5VB 1IRFA 5CJ9A 4QWQA 4L0YB 3C3WA 3BWGA 1UHWA 2H3JA 1U5TB 5K5OA 2DO7A 1KQ8A 1ZRFA 1KYWA 2LSOA 3KP7A 1F9NA 1Q1HA 3NEUA 2P6SA 2NS0A 2YX4A 2P6TA 4MNUA 1YTYA 4CYDA 1OPCA 1OYWA 3RI4A 4O5VA 2L54A 1XGMA 4M6YA 2A6HF 2LDUA 4P55A 1IF1A 4HV5A 5J6XA 4K2EA 2XAFA 4GGGA 3ZN0A 1Z6TA 4RGXA 3HHHA 1B9NA 1WRJA 4YFKF 3F3XA 4KIFA 1RZ4A 2ISYA 3HOTA 3N4MA 2A61A 3BPVA 3RYPA 4CO8A 2VBWA 4F7ZA 1CF7A 3K1MA 3PFIA 4Q47A 1QO0D 4XSXF 4UUVA 3MAJA 1O57A 1NHAA 4WCGA 4CHUA 3I71A 2L3DA 5LHGA 3E3VA 4RAZA 3QRFF 4L5IA 2K86A 5HOOA 1HW2A 4HOBA 4HX4A 3DFGA 1A04A 1R5GA 2GQQA 3DV8A 1B9MA 3OV8A 3G73A 3GWZA 2GZWA 1J2XA 1SAXA 4HV6A 1T6SA 2HS5A 4EGYA 2P8TA 2PI0A 4G6DA 1LQ1A 4ZZLA 5K5QA 4S04A 2CSOA 2GWRA 1TQMA 4OIQF 1XDSA 4S05A 4ZYHA 2DK5A 2LKPA 1USTA 2OQGA 5BQTA 1SD5A 3GXOA 1SMYF 2K4YA 4TV7A 2Q0OA 4R79A 5JR3A 2VOPA 3BJ6A 2CQKA 5DD4A 5CVJA 1CF7B 4Q5SF 3GFJA 2H94A 1K6OA 3MFKA 1GHCA 1YIOA 3RKWA 2R7FA 3D0SA 4YFNF 5HVQC 2DQRA 1ZAOA 2FSWA 4ZH4F 2P7VB 1RIOH 4HF2A 3KLOA 1IAWA 1TTYA 1F1ZA 4GYGA 4ESFA 1KA8A 4G6QA 1K78A 5BS6A 4Z2YA 1U8RA 4OIOF 3GFLA 3KZZA 5DEQA 3Q5FA 2W24A 1W7PD 2Y0MA 2BV6A 4UVAA 5E8GA 1UHMA 5D6EA 2RDPA 3DP7A 3KP3A 2LF7A 5D8LB 2EFPA 3V4GA 4MHGA 3CUQC 1ONVA 5HS7A 1IUYA 4RAYA 4IHTA 3ABTA 3VB2A 4H0EA 2Z3YA 2VODA 4G7HF 2HEOA 1W5TA 3V7SA 1BOAA 1PP7U 1XSDA 3JW4A 1BBYA 1UB9A 2IJLA 2EJRA 2FRHA 1PDNC 1KQ9A 4MGRA 1IN5A 3FXRA 2O8XA 3HRSA 3SQNA 1XSVA 3TO7A 3J7AO 1G4DA 1R1VA 5E17F 4KNYA 4L9VA 2OQRA 3ZPLA 5ILSA 5FLXZ 2M87A 2JSCA 1K78B 1OKRA 2V6CA 3M9AA 3I59A 3R4KA 3DF8A 4P5OA 4I98B 5BMZA 2FQ3A 5FO5A 2KJCA 1H9TA 3JSPA 5FD5A 1LJ9A 2XKOA 2ADUA 3O2PE 2XASA 2V1DA 3WE3A 2XHKA 2IT0A 4YIFA 3EYYA 4WK8F 2ZCWA 5IT9K 5L3FA 2HKOA 3QPHA 1FC3A 5LBQA 3G3ZA 1F5TA 2JPCA 2K5LA 5BPIA 2D1HA 2L01A 2DQLA 5DUKA 1J7KA 5LGNA 1Z91A 2XUBA 3GUDA 1JE8A 2YPRA 5BPDA 2CG4A 1XGOA 1O7FA 1HBXG 3ECOA 2CWEA 1FBUA 1O3TA 4KA4A 4M9XA 2K4JA 3FXQA 4A6DA 1BM9A 5HLHA 1T98A 1B4AA 2HYFA 1FBQA 1MKMA 4P9UA 3NRVA 1T0FA 1K79A 2A3SA 4P96A 5E18F 4UNOA 1KU3A 4JQFA 2EV5A 4Y17A 3J81K 3I59B 1QZYA 3GF2A 3IRQA 3WTTC 4L9TA 3TOAA 4HX7A 1SFUA 2H6CA 3DEUA 2KIUA 4BXUA 3T0YA 5E8IA 4A12A 1ZG5A 4L18B 1S7AA 1FLIA 3LA7A 5FB2A 2X4HA 1JXSA 1KGSA 4OU0A 4Y13A 3LAJA 1DP7P 2LNBA 3EETA 4LB6B 3MQ0A 3DPTA 3FF5A 2NNYA 1Z9CA 1J75A 5ED4A 1HKSA 1IRGA 4GO1A 3FMQA 4UVCA 3E6BA 4CXFA 3H3UA 3FHZA 3R0JA 1QNTA 4O6JA 4EJUA 2A68F 2DW4A 3WTXC 3KE2A 3REOA 2IPQX 4HAMA 1C0WA 2AS5F 3KP6A 4B09A 2EB7A 2RN7A 4R8HA 4QLCU 4I0AA 1O3RA 2YX7A 5JI6A 1ZGJA 2FBIA 2EA2A 3JAMZ 1QZZA 1TW3A 2ESNA 3HRTA 2QM3A 4XLNF 5L3BA 1J59A 4LLNA 2H27A 3FZVA 4P9FA 1KU2A 5FFXA 1T38A 2F2EA 2HR3A 1USSA 3LSTA 2VE9A 3BZ6A 2G7HA 3TDUC 5LGUA 1R23A 3FX3A 4ESJA 3MZHA 3EUHA 3CDHA 3CUQB 3R61A 3LWFA 3IKTA 1FSHA 3OOPA 4ENKA 1LDKB 4LLGF 3IKVA 4RGRA 5IT3A 4EQQA 3CLOA 4GCVA 2M8EA 3L9FA 2KIFA 2XKPA 4Y15A 2P5KA 1AOYA 3W6KB 4LG0A 4R1HA 2MA3A 1D5VA 4UV9A 2QVOA 3I53A 4AIKA 2KIMA 3WODF 4YFXF 3SZPA 1B59A 1P4XA 2OU2A 4PDKA 1G3YA 5LEKA 3MEXA 2JZYA 2IA2A 3F72A 1XGSA 1ZRDA 3VEPA 4WF2A 3ABUA 4DQ2A 2EA4A 4U7DA 2PMUA 2FOKA 4LGWA 1ZARA 2OZ6A 3F6OA 4EM0B 1G3SA 3T8TA 2DPUA 2VT3A 4BHBA 3L7WA 4OIRF 1ULYA 1L0OC 3MWMA 2VONA 1ON1A 1Z7UA 5A2QZ 3E6DA 3WTWC 1UCRA 1BC8C 4M9SA 3K2ZA 3QOPA 2F5DA 3KCCA 3COAC 1FYKA 5DD8A 2LF8A 1X3UA 1S29A 2G9WA 2K7LA 4NHJA 4I0BA 3KEOA 3GW2A 4I09A 2JRTA 4KT5C 2QYOA 4ZYGA 4LG0B 1QPMA 3EYIA 3BPXA 4Q48A 2RGVA 2DPDA 3E5XA 1WI9A 2O0YA 1IXRC 1SD4A 1YO5C 3JTHA 1KU7A 1U6GA 4IHSA 4A0ZA 3F21A 1F4KA 1QVPA 2QWWA 2Z5UA 4KMFA 1S7OA 5KVRA 4BHCA 3WTUC 2VC0A 5D4SA 4XLPF 5E1WA 1SFEA 1RUOA 2QZ8A 3F23A 1I1GA 5BOXA 2M30A 2Z99A 2VN2A 5AIQA 4MTDA 1TLHB 3B73A 5JHUA 3RDIA 3P9KA 3TDZC 1EH7A 2FEZA 2FMLA 2FE3A 4OMYA 4U7BA 2X0LA 3M8EA 1BN5A 4HF0A 4IF4A 2FF4A 3E19A 3U2RA 3WTVC 5L3CA 1PUEE 1WSUA 2KRFA 2MLKA 1E2XA 2OZUA 4HA8A 2ZMEB 5LRSA 1D3YA 4HYEA 1QW1A 1GXPA 3LA3A 2OAZA 4IRGA 3BJOA 3QPTA 2VT2A 2ZO4A 5LEJA 1O3QA 3ZMVA 4ESBA 2HTSA 3Q9SA 3ROUA 3C7JA 2XVCA 1XDUA 1XSXA 5FGMA 4HX8A 2RVCA 2CYYA 2WC2A 2VOOA 4UVBA 5CVRA 1D8KA 1XMAA 4I7HA 5LHIA 3GYHX 4B8XA 2PG4A 3ZMSA 2ZBKA 4L5JA 4PGHA 4BYYA 2DI3A 3E97A 1JGSA 1O3SA 1T2KA 3U1DA 1LDJA 4ZYDA 2RNJA 1U78A 1HKQA 3ZMDA 3F22A 2WV0A 4HQEA 1ZREA 4L9NA 3SXYA 5L3DA 4A2UA 4HW0A 3HSFA 3QP6A 2DU9A 1Z1DA 5DUIA 1WKMA 3RKXA 2JT1A 5LHHA 5TRDA 2HTJA 5HS9A 1FOKA 3RTRA 3QAHA 5FFZA 3IWFA 4RB3C 3CTAA 2FA5A 1IW7F 4MTEA 2E7WA 3S2WA 3JSOA 3WTSC 2IRFG 3BJAA 2K4BA 2COMA 1G3TA 1BIBA 2ZNYA 1TQPA 4E70A 2H09A 2QENA 1W4MA 2EFNA 2K27A 4PZJA 4G7OF 2EK5A 1HKTA 3M8FA 1ZN2A 5CYVA 2D45A 4HBLA 1P6RA 3HTUA 2HQRA 4LMYA 2XAQA 2C6YA 2K5FA 3HOSA 1HSTA 1MDMA 1ZLKA 3DKWA 3K9TA 1YG2A 4ETSA 1HQCA 2QLZA 3T5XA 1HXDA 1B6AA 3ZMZA 3IC7A 1DPRA 3KFWX 4LD5A 2V79A 2F5FA 3MZYA 4KFCA 2E1NA 2PJPA 1DPUA 2DTRA 5E20A 4FHTA 2O3FA 4YIIA 1LDDA 5HS8A 4EJWA 1XGNA 1XB4A 3GO5A 2GAUA 1ZLJA 3DQVC 1BI2A 2Q2EA 1E17A 3GLXA 1B1BA 2W85A 1KQ0A 4RGUA 1STZA 4EM2A 4Q4ZF 2M5WA 5D5WB 2UZKA 1YFHA 2PFBA 2K02A 4CGZA 3TQNA 3D5LA 3TO9A 2QBYA 2P5VA 3B02A 2P5LC 4BAYA 3J80Z 4GXOA 2MD5A 2ETHA 2P4WA 4NB5A 4U0WA 3JAMK 3L09A 1MDMB 2DAOA 4CICA 2PQ8A 5CVIA 4HZFA 2RV8A 3QU6A 2XIGA 3N97A 3HRUA 4CZZA 1D8JA 1JHFA 3PQJA 2EV0A 2W84A 2NAZA 3SHFA 5HLIA 2YR2A 2FBKA 3CUQA 1FYMA 1Z05A 4U88A 4CDGA 1MZBA 3KP4A 2DK8A 3GZ6A 2BBYA 1TBXA 4WWCA 4EGZA 1HW1A 1IN6A 5L3EA 4MEYF 3L00A 3BDDA 3HIFA 2Z9OA 3K1PA 2RKHA 3HYIA 3I4PA 5IT9Z 5AIPA 1KYZA 5D6FA 1HSJA 2DBBA 3EQLF 2V9VA 3KP5A 4ZYEA 3IWZA 4OINF 2F5CA 4FX4A 2ACJA 1HW5A 3ELKA 5JFRA 1WQ2A 4HDUA 2QBYB 2KJBA 3GFIA 1K7AA 4U0VA 2E1CA 3ZN1A 4RGSA 3HSRA 1YS6A 2CO5A 1ZYRF 3GVAA 1TQIA 1ZHFA 2QQAA 2BGCA 4MQVA 2PBIA 4IVNA 4MQ9F 1J5YA 3DPLC 1O7LA 1R7JA 5D8KB 1R58A 2GXGA 4KN4X 4YG2F 2UXXA 3RIRA 4M9ZA 5H6QA 3I54A 4G7ZF 4DNCA 3ZQ7A 2A07F 2DLLA 1FX7A 2Q8KA 4ON0A 1ZH5A 4O3MA 1IXCA 4BNCA 2IVMA 3HRMA 5D4RA 1IN4A 2VBZA 3HTSB 1XCBA 5ICEA 3F8CA 2QQBA 1L3LA 6PAXA 3VODA 3P7NA 3FM3A 4NQWA 2XGXA 3F8MA 3BP8A 2FXAA 1AWCA 5ICGA 3ISPA 5DCMB 4LK1F 4L9JA 3C18A 4AVPA 4I01A 1FPQA 3CO6C 2ZNZA 1WWXA 3O6BB 1W5SA 2V1XA 2FMYA 1R5HA 2WTEA 2OD5A 3L2CA 4OMZA 3V7RA 1DUXC 3GZ5A 5HDNA 2DFIA 2MH2A 1QGPA 1R1UA 4PCQA 4UXNA 3WGIA 4WXDA 4KN7X 2L4MA 4N0BA 2EWNA 2HGCA 3I58A 3TGNA 3HHGA 1GVJA 4LLLA 1U3EM 1R22A 3LA2A 2HKXA 3RPUA 4KICA 1BI0A 4KUMA 3WG9A 4EVIA 5CLSA 4BQAA 3T1BA 5F1RA 5ICCA 1BJAA 2O6GE 2ZMEA 2STTA 2PN6A 3LQQA 3F8FA 2O61A 5J8CA 3NQOA 4U0YA 3I0TA 2EFQA 3VOEA 1U2WA 1SD6A 3K69A 1MJ9A 4WX9A 3ZMTA 5J8FA 4XSZF 1BC7C 2HWVA 1I1SA 2G7UA 4HDVA 1T39A 4A0XA 1RNLA 1YQAA 4EMSA 2CW0F 4XRFA 2K5IA 2EFOA 2QQ9A 2B0LA 2OA4A 1OR7A 4N9IA 4BH9A 4M72A 2AXLA 2TDXA 5DYMA 3FXUA 3FWEA 1FBSA 1LB2A 1RUNA 1ODDA 5LLQA 1Y0UA 3RPQA 4A6EA 2VC1A 5HDKA 1R00A 3RJPA 4IRHA 4GYIA 1I6XA 4A5NA 3BROA 3WGGA 2J5OA 1R1TA 5EEGA 3WE2A 4ENJA 1FYLA 3WU1B 4EV0A 2IP2A 1IN8A 2ZJ2A 3FMRA 2GCXA 5E1XA 2XAHA 2F5EA 3P9IA 4N9HA 5LGTA 1XN7A 2HFHA 3V8JA 2HDCA 1ZGAA 2R3SA 4UV8A 2KKOA 2FNPA 4WXCA 3WU0A 3BY6A 3GEZA 1QBJA 4WXHA 1MJBA 3O3KA 2ESHA 4RB0A 2GIVA 3ERED 1FSEA 1G3WA 3M1EA 1MGTA 4LK0F 2D1VA 2R7DA 2GA1A 2E7XA 3ULQB 5FLXK 4RS8A 5ILUA 2PEXA 2EV6A 2Z33A 4HQMA 3ECHA 3EDPA 3MCZA 3LFKA 1H9GA 4ASNA 4LJZF 1BI1A 1R36A 2MH9A 4G94A 4KMUX 1S6LA 5HDGA 5ICFA 2W57A 4LFUA 1VTNC 4A0YA 3KP2A 1W7PA 2W25A 2HOEA 2XV4S 5D5UB 3HUGA 3R6SA 4AIHA 3KLNA 2CGPA 3T8RA 1V3FA 3JTGA 2L02A 1DDNA 1YW9A 2MLGA 1P4AA 2ZKZA 2YSRA 1SD7A 4M73A 3E6CC 3TKYA 2CFXA 4UHTA 2XRNA 3CJNA 2XAJA 3J80K 5LRRA 4RB1A 2RQPA 2UXNA 5ILVA 1OYIA 2JPBA 3E5UA 1YYVA 4M74A 1LEAA 2FBHA 3P9CA 3R0AA 1ZG1A 3CO7C 2VBXA 4ENNA 2XAGA 3FMSA 1LNWA 3HSEA 1EH6A 2BE5F 3VFZA 3M7GA 3U9GA 4IRIA 1SMTA 2STWA 5F64A 1MD0A 2D2WA 4HF1A 4PGGA 4JK1X 3ZP5A 3K1NA 2HZTA 2BYVE 4M71A 3C1DA 4OOIA 4IJAA 3H92A 4XBFA 4HLYA 4KIGA 2WWYA 1U5TC 2J5PA 1W7PB 2NRAC 1P2FA 3F8NA 1Z6RA 5JVTA 3AAFA 2ZXJA 2FU4A 2HYGD 5K1YA 3KETA 5H20A 4OIPF 1TNTA 4AWXB 2O03A 3BOQA 4I2OA 4FX0A 2MC3A 3KEQA 2Y75A 1YW8A 4IXAA 3H3ZA 2ZFWA 2DT5A 3LAPA 3V7CA 2RC4A 2VE8A 1RI7A 2GA2A 5H6RA 5ERIA 2VXZA 2P7CB 1P92A 1GXQA 2M1BA 3IL2A 3R60A 1IN7A 1FP1D 1LVAA 1BIAA 3RYRA 5F6FA 3WGHA 3WTZA 3MHXA 1YLFA 3KZYA 3F8BA 1JHHA 2L4AA 1J0RA 3GFMA 3IHUA 5KK1A 1ZRCA 3I64A 5EEHA 4EJTA 1G6NA 4D0PA 1QQIA 3E6MA 5D5XB 2H6BA 1FWZA 1LEBA 2JTVA 3FM5A
chains in the Genus database with same CATH superfamily
2L7KA 4EM1A 2KE9A 2KRMA 5CVUA 2YLCA 2BXYA 2L7ZA 4DEYA 1OMIA 3QP5A 2EZHA 4IPAA 4M6VA 4A3CJ 1TWFJ 3C0CA 4IIMA 4L5EA 3HFNA 1WH5A 1I5ZA 1XMKA 2FL7A 3E1SA 4OMNA 4RAFA 2IW5A 1MJAA 2LX9A 5EG0B 4JZ4A 3ZMUA 2XPVA 5F04A 1T56A 2QA4I 2UWMA 4AD9A 3HPGA 1QKWA 1LE8B 4ZZDA 2GTOA 1FIAA 4LB5A 5CKEA 1EH8A 3GLLA 3SZTA 2PLYA 2HSEB 3E5QA 4FL6A 2ELHA 2QTVA 2GXBA 5FKMA 1H0MA 1SHGA 1P7IA 5FKNA 2A5YB 3H1CA 3V8LA 1H8AC 1TNSA 2NNNA 5DCFA 3LSHA 3M0RA 3K10A 4D5FA 4ANJA 3HZJA 4C3JJ 2K6DA 3HBLA 2M51A 1OV3A 2CSQA 1K6YA 4B43A 2IBDA 2DOAA 2V1UA 4L0ZB 1VYUA 3OMGA 4OB2B 3PMTA 1S3JA 4KDPA 1YBYA 1BI3A 2IS1A 2R7QA 1LVKA 2K3PA 2R4GA 3PNTA 3PQKA 5KYYA 3LQRA 4S0HB 4BHPA 3IAM2 2DXCA 2IVWA 1MBFA 3HPHA 3CCQQ 4RMNA 1AZGB 2XPUA 3O5ZA 3TO6A 3WTYC 3H9GA 1TT5B 5DCMA 3JCMb 2EYQA 3DXJF 1RI9A 4MIMA 3QU3A 1EA3A 2IA0A 4AIJA 2KRNA 3CCQT 1IZ1A 4RCBA 2MBFA 2DXUA 3LWIA 5KYUB 4ABZA 1KU9A 3ML6A 2SRCA 4KULA 2X48A 4J6XA 4N0AA 2VKVA 3HKZA 1J9IA 5M3FJ 3JRHA 5K7HA 1VQ6A 3MKDA 2Y69H 1ETKA 5GTHC 1UG2A 2JN6A 2VB6A 1FMKA 2YUPA 3R6NA 1XQHA 1AHJB 3HP9A 3MP8A 1UHFA 4OB1B 1YW7A 2RNGA 3IRRA 3W2AA 1PJRA 3V8KA 3EG1A 4F7UE 2VJJA 2I8DA 4KH0B 3QYGB 1YJNA 1ETYA 3J81Z 2OUMA 5LJ3f 1I3QJ 5A2QK 2ISZA 4KIBA 3K70D 5C4XJ 1V4RA 3RKQA 1M2VA 2V9KA 1M1KR 1IO6A 3CD6A 3A98A 4A5MA 1QKXA 1IXSB 1UTIA 4EMHA 3HL2A 3AG4H 5GANf 3Q9VA 2IA1A 4EJOA 3K0LA 1R6RA 2X4XA 1TW2A 1S8NA 1XD7A 4CCJA 3CCJA 4BY6B 2BKDN 1CGPA 2E36A 2HKNA 4AYBA 1Q86U 2JTEA 2F4IA 4BD3A 2LZ6B 2R7VA 3H5RA 2OJED 4HLXA 1UFMA 4BI4A 2HQNA 5FW9A 3D5RC 3ZEHA 1PC0A 2F5VA 1YE9A 3X28B 1D09B 2CS3A 1ZA2B 2DD5A 5CO7A 4NOYA 2K85A 5J4VA 4ZN1A 5TJJA 5K7FA 1U5TA 3K6GA 1AOJA 2G3RA 1WPKA 3FK6A 2GBYA 1WHUA 3EGUA 3JCMf 5DDGA 2NUPA 3RDVA 2LQNA 4AFSC 1FY7A 4DYRA 4A3JJ 3SFZA 4M75D 5J47A 4KYWA 1OYYA 3Q0UA 1YI2A 2QASA 2RD1A 1OCCH 4FM4B 4IUUA 1W1WE 4LXCA 3G6EQ 3X20B 1DU6A 1I27A 3FKJA 2LJ1A 2JJ9A 5DV5A 3QOEA 1XCVA 5CQEA 4B44A 1FTTA 4FYYB 2VJ5A 1SVLA 3F6VA 5FKOA 3U1KA 4JBAA 1SFXA 3CPFA 1APLC 4M77D 4M78F 3SWNC 4C5IA 4AM3A 2IAIA 5GAN5 1MGQA 1YJ9Q 1ITYA 3OW2P 2DEQA 3G6ET 3CUOA 2A69F 2V1QA 3META 3SB2A 3TEDA 3TOBA 2XGDA 1Y7XA 2X1EA 2OBPA 2BEOA 2AZVA 1EV7A 3NAUA 4CA0A 2KI7A 3CBMA 4I02A 3UPUA 2NYXA 4G8XA 1YJ9T 1K1ZA 3I5UA 2M7AA 5K5RA 4CCMA 5FD6A 3CJQB 3FRNA 4RB2C 3W6JB 1FT9A 5FU7B 1U1TA 1W2BA 4KT6A 4ZTJA 2KXCA 2LT1A 4G9YA 2KZVA 5KYYB 3VS0A 2JVHA 4FT8A 1ZK8A 2M45A 4H4KC 4RKUE 1PP8F 3OYIA 4L6V5 5A0DA 2Y48A 5CVVA 5AONA 4ENMA 5F0FA 1W1FA 2AKLA 4M7DC 1RL2A 5L3GA 1BW5A 1JU5C 1WZOA 2ENMA 1YS7A 3CC7A 3GX4X 1KQSS 4N4IA 3UNGC 4C2MJ 3RKYA 2EFWA 3FBIB 1Y0MA 1VQ5Q 1BYMA 2WSFE 2HZDA 1YIJI 1GRIA 2E5NA 2M9HA 4NNJA 3UA7A 2VBYA 2R7TA 3JB9I 2YU3A 1VQ5T 2XROA 1QVTA 2QI2A 4A3FJ 3VWBA 1IHVA 4MEXF 2X9DA 1OCOH 4EJVA 1FNNA 1FZPB 2RHZA 3I5RA 4M6XA 5EC7A 5GAN6 3S16J 3DTIA 4C0DC 1REPC 2VPLA 2BZTA 1ON2A 2FNAA 3OIPA 1T95A 3Q0VA 1GFCA 2QUFA 2WY8Q 1ZG3A 3IUOA 2DILA 1M2VB 3M59A 3M54A 4J9FA 1RAAB 4DOVA 3FC3A 2DOEA 2JA2A 5E1ZB 4IQJA 5HLGA 2K3FA 1FP2A 2OTJT 3EAEA 2A6EF 3CMYA 3D7SB 3RPUD 4QVCA 4JJCA 4A69C 1V5EA 1P4WA 2PMHA 5D5VB 1R5ID 4PJNA 1IRFA 5CJ9A 2LK2A 4C3HJ 1A36A 2CZ0B 4C9YA 4QWQA 4L0YB 3C3WA 3BWGA 1H8KA 3DWLE 1SSHA 1WDXA 2JOYA 1H3HA 3EHRA 1WJEA 1NH3A 3H5NA 5FROA 1K9MC 5EF6A 1UHWA 2H3JA 3HGGA 1U5TB 4E2FB 1RPWA 3BG6A 4BJTA 1VQ9Q 5K5OA 1AKHA 2NUPB 2DO7A 1KQ8A 1ZRFA 1KYWA 1IJWC 3P8BB 3OR2C 2LSOA 3QO3A 4QVZA 2KDOA 4OAZA 3C95A 1VQKQ 3KP7A 1F9NA 3BR1A 1Q1HA 3NEUA 1YJWI 2P6SA 1GL5A 5IYDJ 1PM3A 2NS0A 3IH2A 3S17J 4ZDOA 1QCNA 1VQ9T 2YX4A 4JX6A 2CQQA 2P6TA 3UKGA 5FLVA 4MNUA 1YTYA 3QYBA 2W7NA 3PT9A 4JJDA 1KFZA 2XI9A 4QTRA 2LREA 3EGDB 3K4MA 4G12A 3CC4Q 1QCFA 4CYDA 3CCQA 3J7ZI 1OPCA 3L2WA 1KQ2A 3CJRB 3QJYA 1OYWA 3RI4A 4X34A 3VS5A 4AUXA 1WFXA 4O5VA 3A8OB 1BK2A 2L54A 1M4ZA 1TWHJ 3VV0A 3SEMA 3CC4T 4J6YA 2L3SA 4IHWA 1M1GA 1XGMA 4M6YA 2A6HF 2LDUA 5GPAA 1WJQA 4P55A 1IF1A 4HV5A 2LFBA 5J6XA 1OX8A 4K2EA 3CCSI 3BCBA 2XAFA 4GGGA 2Z2SB 2F48A 2DTOA 2DAQA 3JCMP 4XKCA 3ZN0A 4IUPA 1Z6TA 2DJIA 2CZ7B 4RGXA 3PFSA 3HHHA 1B9NA 1WRJA 2P0PA 4YFKF 4KUDK 3F3XA 4KIFA 1MIJA 1RZ4A 2ISYA 3HOTA 3N4MA 1QPIA 3QBYA 1NPPA 4FW2A 2A61A 3QPLA 5B66C 4IX7A 2FPFA 3BPVA 4HCZA 1C6VX 3MCAB 4IURA 5I11A 1PNJA 3QZ9B 2LRQA 2E5ZA 3RYPA 3UT1A 1H89C 2HL5C 3M0QA 4CO8A 4V2FA 4FYVB 4OGCA 2RI2A 1AEYA 2VBWA 4F7ZA 4YELA 3K1MA 3PFIA 4Q47A 1QO0D 4XSXF 1CF7A 4UUVA 3NTHA 2RQQA 3MAJA 3SYTA 1KC8C 1I81A 1O57A 2LQWA 4J7IA 4OAYA 1D1CA 4AVZA 3ONQA 2R5AA 1NHAA 2MCNA 4WCGA 4CHUA 4DOZA 3I71A 5GAOm 3G4SQ 2L3DA 5LHGA 1UHCA 4XTWA 3E3VA 1IV6A 1N5ZA 4XLAA 4RAZA 4E7SA 3QRFF 4CC2A 1PYVA 2R7UA 4MZPA 4L5IA 3OYKA 5CK9A 2K86A 2ZGWA 2R7XA 3K2AA 4BB7A 4R0KA 4M3FA 3G4ST 2FPDA 1YITI 3OS1A 2DL7A 5HOOA 1HW2A 4HOBA 4A3BJ 1EX4A 4J5YA 2CUDA 1H92A 5CAIA 4JRQA 4HX4A 4NC6A 2GLOA 3DFGA 4F3QA 2YU9J 1A04A 1R5GA 2GQQA 2MD0A 3C2BA 3DV8A 3L2UA 1O75A 2IPOB 1B9MA 1AKHB 3PL8A 2OI3A 3OV8A 5J40A 3PIPF 3G73A 2PUKB 1QMCA 4C0FA 1YJ9A 2FZGB 2RNAA 5GAGJ 2JM8A 2WB1A 3H9QA 4DBQA 4JS4A 3DKYA 1M5Q1 3GWZA 2X6OA 2GZWA 1J2XA 1SAXA 2E65A 2XKOC 5IYBJ 4HV6A 1T6SA 4XORA 1MMGA 1WXUA 1BU1A 2HS5A 4EGYA 2B9SA 2P8TA 2PI0A 3BG5A 4G6DA 5F27A 1LQ1A 3DTKA 1U9OA 1P9QC 5TISC 1BKBA 2K2VA 2P0KA 4ZZLA 3TVTA 5K5QA 2A7YA 2KLOA 4MDWA 3SWNA 4A4FA 1VIEA 1VQLT 4J01A 3LSJA 2DJZA 2PQWA 2OJ2A 3R6OA 4S04A 2CSOA 2GWRA 2R0QC 1TQMA 1LJOA 1Y8RB 1AVZC 2DYBA 1FOYA 4XIDA 5E3MA 4E7JA 1GCQA 3OOUA 2CS7A 1TWAJ 4OIQF 1C1AA 2L89A 1XDSA 4S05A 4ZYHA 1LPQA 1B34A 2MOXA 3G71Q 2BUDA 2I2LA 2Z0WA 2L2PA 2DK5A 3U23A 2CH0A 3K7AJ 4OWRB 2LKPA 3HOXJ 1ZUKA 1USTA 2OQGA 5BQTA 3SEZA 1SD5A 3GXOA 2JA7J 4A93J 1R77A 2XIDA 2FRYA 3OSSC 1SMYF 2K4YA 3DLMA 1JJ2S 3G71T 1POGA 2ZB9A 3P8HA 4FASD 4HNUA 2GM4A 4M7DA 4MLOA 1GBRA 4TV7A 2HOAA 1DJ7B 2OTJA 2F6CA 2Q0OA 4R79A 2MABA 2KZGA 5JR3A 2OV7A 3OS2A 1BCMA 1OCZH 2VOPA 3BJ6A 2LCSA 4E6RA 1PVEA 2BY0A 2CQKA 4A3KJ 2X1DA 3A1YA 5DD4A 2A08A 5CVJA 2KYMA 3H8ZA 1CF7B 1WXTA 4Q5SF 3GFJA 2H94A 2XF5A 4XLFA 5CQGA 1K6OA 1ABOA 1ZUYA 2CP6A 1K9MU 3MFKA 3GTJJ 4J9BA 4JX5A 2LCCA 1GHCA 1YIOA 2Y0SA 3RKWA 1W70A 2CH4W 4A3IJ 2R7FA 5ECAA 3D0SA 3K4JA 4YFNF 3KYDB 5HVQC 2DQRA 4WTOB 1ZAOA 3WG7H 3PNVA 2FSWA 1VOMA 5GAMh 4ZH4F 3MO8A 1RAHB 2HQAA 2P7VB 1NK3P 2EQKA 3H6ZA 1RIOH 2OPTA 2VXEA 3NTIA 4HF2A 2CRGA 2LQKA 1IGNA 4XQ3A 3SHWA 1K9MR 3KLOA 1IAWA 1T0FC 1VQ9A 1TTYA 2E1HA 4F92B 1F1ZA 4GYGA 1M3CA 4XTVA 3ER0A 4ESFA 3M9QA 1KA8A 1RLPC 2DMPA 4G6QA 4RTZA 1GVDA 1K78A 3GTPJ 1PSEA 3NGPA 1KHIA 4HSTA 5HNHA 5BS6A 3DTEA 4Z2YA 1K8AC 4LN2A 1YJNI 2FQ4A 1U8RA 2L9RA 2WAQA 3TSWA 3HG9A 1Z9ZA 1S72I 3M5AA 4OIOF 3CD6I 3GFLA 3KZZA 5DEQA 1Y8QB 3BCAA 5KE3A 2QQRA 1QA6A 3Q5FA 1WI7A 2W24A 4AMCA 4J9DA 1VQ4Q 2DETA 1IHWA 2VKEA 4M7DG 1W7PD 1B07A 2Y0MA 3KIOA 2BV6A 1X58A 4UVAA 3L2ZA 3CCUQ 4ATOA 2FG0A 3PVLA 2LVSA 1ZQ1A 1UEBA 3CMAQ 1VI0A 5E8GA 4ZTFA 3CPWA 1UHMA 1VQ4T 1X3WB 5D6EA 2EQRA 3M56A 2O88A 2RDPA 3DP7A 3KP3A 2LF7A 5D8LB 3RQ4A 2EFPA 3CCUT 2L7MP 3V4GA 3SWNB 3CMAT 2ZJRF 4MHGA 3CUQC 2BIVA 1ONVA 3ZOBA 5HS7A 2NVXJ 2HZYA 3ERMA 2J6FA 4EMGA 2EILH 3S14J 1IUYA 2CP0A 4RAYA 2P4TA 4IHTA 3OYCA 5GANj 3ABTA 3VB2A 4H0EA 2M0CA 4F14A 2Z3YA 2VODA 1FMWA 4IQ4A 3I9QA 4G7HF 2HEOA 1W5TA 1T3LA 1QVGS 2WADA 2QKMB 2EAYA 2EQJA 3V7SA 2K9NA 1ETWA 3Q3SA 2HBPA 3H41A 1BOAA 2QEXI 3JB9D 1PP7U 1RETA 2DMTA 2F4MB 4M7DB 1XSDA 3PSIA 4KITB 5C44J 3JW4A 1E3OC 3EG2A 1BBYA 4UC4A 5KYXB 3TU4K 1KC8R 1UB9A 2IJLA 3EGXA 2XDVA 4Y52J 3GPLA 4XL9A 2EJRA 4B1RA 2LMDA 2XGCA 3TEEA 3G4SA 2OX7A 2FRHA 3T9NA 3AG2H 3K4CA 2YLBA 3DCFA 1PDNC 5D7UA 2BHYA 4RMOA 3TREA 1RAEB 3BQZA 1KQ9A 4MGRA 1IN5A 5KAFC 2A3LA 3FXRA 3PMIA 3BR6A 2AHQA 3S1QJ 2O8XA 3HRSA 2HPIA 3CC7I 1MHNA 3EG9A 3G1MA 1XSVA 3SQNA 3TO7A 3TW7A 2Z1DA 3A02A 3KPHA 4CYCB 3J7AO 2J06A 2DRKA 1G4DA 3G7ZA 5CIUA 1YCSB 5HY6A 3UF4A 1R1VA 5KYWB 4AU7A 1AWOA 3VYUB 2KGTA 5E17F 2DJNA 1WH7A 2LNHB 4KNYA 3HTRA 4L9VA 2OQRA 3ZPLA 5EZHA 1ACMB 1Y1VJ 2EZIA 4QPQA 2Y4YA 2RJCA 1NG6A 4EEFG 2DD4A 5ILSA 5FLXZ 2D0NA 2M87A 3QDRB 3JB9G 2JSCA 1K78B 3S3MA 2DF6A 4XTXA 1WJAA 2KSSA 2VWFA 1OKRA 2V6CA 2F5TX 5KYWA 2LC2A 4JLIA 1VQLA 3M9AA 3QYEA 3I59A 3H3VK 3R4KA 1XC5A 2DDBA 3DF8A 4B4CA 3MEWA 4P5OA 2I0NA 5L8RE 4I98B 4C0ZA 1O4XA 1VQ6Q 5BMZA 2FQ3A 1QCOA 3EFSA 3I56T 5FO5A 2KJCA 3BR5A 1H9TA 4XR6A 1A5JA 1B8IA 2IGNA 2MW8A 3JSPA 5FD5A 1NPRA 2JVVA 1WXBA 1VQ6T 1IREB 1LJ9A 2XKOA 2ADUA 5I2MA 3O2PE 2ZJQF 4GDFA 4B6MA 2XASA 5FWCA 3TMOA 2V1DA 2ZXWH 3WE3A 4J6WA 3G71A 1V55H 2XHKA 2G6FX 1IDZA 5C6SA 3CEYA 4M7DE 3EUHC 4Z6YA 5B5EC 4YIFA 1FIPA 3EYYA 3I3LA 4WK8F 2IT0A 4E7KA 2ZCWA 3CCJQ 5IT9K 5L3FA 3SZGA 2HKOA 2E3IA 3QPHA 3QQAA 1FC3A 1LFUP 3FEOA 3DB3A 5GMKh 5LBQA 3CF5F 4HCCA 3RNJA 1WLPB 2B8AA 2ED0A 3G3ZA 2RQWA 4PL6A 1F5TA 1KQSP 1D0XA 2OTLT 3Q1JA 3CCJT 2JPCA 1Z67A 4BDYA 1WJDA 1M90U 2NVUB 3CZ6A 2LDMA 2K5LA 2LKXA 2ZPGB 5BPIA 3X24B 2D1HA 3H0IA 1Q86C 3CCQI 3M4YA 2L01A 3VS1A 2CUFA 1UGSB 2DQLA 3C2HA 3BTCA 5DUKA 2KQRA 4HKEA 1ZKGA 3JB9H 2DTZA 1YI2Q 1J7KA 2ID3A 4ZDLA 5LGNA 4M7AF 4Z02A 3EGXB 1Z91A 1ZLMA 1IUFA 2DM1A 5GAN7 2IG0A 3LLRA 4OVAA 2XUBA 3A03A 1I0CA 1WX6A 5KCOA 3CC2Q 1PD1A 3GUDA 3F9KA 1JE8A 2YPRA 3RCOA 5BPDA 1XTDA 1YI2T 3QXEB 2CG4A 1K8AU 1XGOA 2E35A 3O8HA 2M8GX 1M8MA 4LD6A 2M2EA 2V4JC 4BQNA 1O7FA 1ZSZC 2M3AA 1DP3A 4M75C 2VJ4A 4M78A 3CC2T 1X3ZB 1G8XA 1HBXG 2K9GA 3ECOA 2CWEA 3EG9B 1HSQA 1FBUA 4LUDA 1AU7A 3CCMT 1O3TA 4HCKA 5EG2A 4KRTA 4KA4A 2MGQA 4M9XA 2K4JA 1K8AR 3FXQA 1MH4A 4A6DA 2XSDC 1BM9A 5HLHA 1T98A 2EYWA 1TWCJ 1T8IA 1B4AA 2HYFA 1FBQA 1MKMA 3M58A 4P9UA 3NRVA 1T0FA 3REAB 1VQ4A 3JRGA 3ESWB 1K79A 2A3SA 3OYHA 4P96A 4A3GJ 3CCUA 2CP7A 5E18F 3PVQA 4UNOA 1KU3A 4JQFA 4QQGA 2EV5A 4Y17A 1J09A 3J81K 3JRBA 3I59B 4AFZC 3CMAA 1QZYA 3GF2A 5CKTA 5CR2A 5GAEJ 3IRQA 5HCKA 3WTTC 2O7OA 4L9TA 3TOAA 5GAMf 3JB9J 2R5ZA 4F16A 4HX7A 3TP3A 1SFUA 2H6CA 3DEUA 5E3LA 2DL3A 1B8IB 4FE4A 2KIUA 4BXUA 4FE7A 5LJ5g 3T0YA 5E8IA 1WJRA 4JOMA 4A12A 4LD9K 4UUTA 1ZG5A 5LFAA 1VQPQ 2MG4A 4L18B 1S7AA 1X6BA 2FZKB 3S8PA 1FLIA 2B63J 3LA7A 4GRIA 4FSXA 5JHFA 3G6EI 1TUCA 1VZ0A 3CESA 5FB2A 4F55A 5KAIC 1VQPT 2X4HA 3H0DA 1JXSA 5B1AH 1CKAA 2EGAA 2EKOA 2NYSA 1KGSA 3FISA 4M78G 1NTCA 3M1CA 1YJ9I 1IB8A 3DU6A 4OU0A 4Y13A 3LAJA 1DP7P 1TUGB 1UGRB 2LNBA 3EETA 2A0FB 4L5GA 3CBPA 4LB6B 4IHVA 4D7NA 1TP4A 3MQ0A 3A1PA 2CSIA 5JLWA 1UAAA 1BR2A 2W48A 3DPTA 3H0GJ 4OP0A 3VYHB 3LL7A 4C5EA 3FF5A 2NNYA 1Z9CA 3DKXA 1J75A 1V29B 1KSWA 2COZA 3VS7A 1AWWA 5J1YA 4FTHA 1PWTA 2EPDA 3RR6A 2GTJA 2X4WA 5ED4A 1HKSA 1RR7A 4F7UB 1IRGA 2V8IA 3I9V2 2RHYA 4GO1A 2DPPB 2DA7A 1SKUB 1FMVA 2Q2EB 3FMQA 4UVCA 1ZR2A 2KR3A 3E6BA 3BW1A 3HFOA 5LL6S 2HU9A 3S1RJ 4CXFA 2RH2A 3VUBA 2EYZA 3TW6A 1WHKA 2CZ6B 2IS4A 3H3UA 3FHZA 3R0JA 3MP1A 2DCEA 2DE0X 1QNTA 1VQ5I 3JAME 1OX9A 1KQ1A 1OZ3A 4O6JA 4EJUA 2ZMEC 4PJ0C 3J81E 4I99C 2A68F 1Z9QA 2RQTA 3ZGKA 2DW4A 4B47A 3WTXC 4M78B 3AG1H 3KE2A 4ZC3A 3REOA 3LSGA 4GLMA 2IPQX 2KBTA 3NMZC 5FRMA 2XG8D 1VUBA 2ZZDA 1VQNA 3BR2A 4HAMA 3PSFA 1C0WA 2AS5F 3A8MB 1UGPB 2JMCA 3VRZA 3KP6A 1QVFP 2XC7A 2CW7A 2M4KA 2NOJB 3OY9A 4LDWA 3I56A 4B09A 5I2SA 3OYAA 2C0OA 1NJIC 4XK8E 2EB7A 2RN7A 4R8HA 4Z89A 4QLCU 4I0AA 1O3RA 1G2HA 1X4OA 4J9CA 2YX7A 4QKUA 5JI6A 4BKXA 4J7FA 3PIOF 3L1PA 4IIOA 1W6XA 3BR0A 2PVOB 3DPUA 2F5KA 1ZGJA 3B6AA 1FOWA 4J9EA 2YRDA 2FBIA 2EA2A 1QP2A 3JAMZ 1QZZA 1TW3A 2ESNA 3HRTA 2QM3A 3NFCA 3JRDA 4KGVB 4Y3OA 4XLNF 1WPYA 2X4JA 5GMKm 1W2BS 5L3BA 4LUEA 2AIRB 1N27A 1J59A 1MMAA 3SD4A 2R5ZB 4LLNA 3EH2A 2H27A 4N4HA 4XQFA 1A35A 1MNDA 3FZVA 4P9FA 3GNGA 1KU2A 4PJOF 3CMEQ 2OTLA 1VQ9I 5GMKl 1WQWA 2P0WA 3EGDA 1I1JA 3A01B 5FFXA 2M0YA 1TG0A 1VQKI 4OMPA 1Z3XA 1T38A 2XGEA 2EZLA 2X6YA 2F2EA 1JKOC 2KY9A 4II1A 2HR3A 2RO0A 1USSA 1ERDA 2LMJA 3LSTA 1YHQQ 2ZJPF 1M2OA 3CMET 1HLVA 2VE9A 3BZ6A 1QRYA 2D8JA 1OU9A 2G7HA 1IXDA 3TDUC 4C92F 5LGUA 1R23A 3FX3A 2DMQA 4ESJA 2CYZB 2LLKA 3UA6A 3MZHA 2VQCA 3EUHA 4A3MJ 4HXJA 3CC4I 1YHQT 3CDHA 4ESRA 2R7ZJ 3CUQB 3QHSA 3R61A 2XK0A 1UGQB 4KUIA 1Q86R 3LWFA 3IKTA 1JJ2P 1FSHA 3OOPA 1LFBA 2M1HA 3CCRQ 2VUMJ 4XN3A 3BDLA 4XAXB 3W2WA 1E7OA 3HKSA 1JT6A 3C94A 3E7LA 4BL0B 4ENKA 1OQYA 1LDKB 1WYXA 1X2KA 2AKKA 2RPNA 4M78E 4IUTA 3SFMA 4LLGF 1HCRA 1I4K1 3CC2A 1NLOC 3H0FA 3IKVA 4RGRA 2KHMA 2ZPBB 5IT3A 4XKWA 1K4US 5CKHA 2HQEA 1HOMA 1JBMA 4C2UA 4EQQA 3CLOA 4GCVA 4M4ZA 3I55Q 3ASNH 3CCMA 3CCVQ 2M8EA 3PIPA 2E2HJ 3L9FA 2RJEA 2YUSA 2KIFA 2XKPA 2E12A 4Y15A 1MMNA 3IH4A 2RF0A 1LFPA 4L59A 1E3HA 2P5KA 3I55T 3L42A 2FOWA 3M57A 2Y9ZA 1UG1A 4JRPA 5DM6F 3OIQA 3CCVT 1AOYA 2QQSA 1R0BG 2FO0A 3W6KB 2KDSA 3QSUA 4LG0A 2LP5A 8ATCB 4R1HA 2DA9A 2RREA 2FB7A 2MA3A 1D5VA 4UV9A 1DQUA 2CFOA 4LIUA 2M0OA 3RBBB 2CMPA 3NPFA 4C8QF 2QVOA 5IHKA 1OFCX 1ZSZA 2LNVA 3I53A 4AIKA 3BY7A 5HLTA 2KIMA 2DBKA 1GT0C 3FJPA 1K61A 3WODF 1N78A 3OYJA 2AHJB 4YFXF 4ELZC 3SZPA 1B59A 1P4XA 4PJJA 2OU2A 4PDKA 1G3YA 5LEKA 3G4SI 1FYNA 2LTOA 3MEXA 4MDXA 2E41A 1YRNA 2JZYA 3HOYJ 4ME7A 2IA2A 2JW4A 3F72A 4C0DB 2E1MC 4LITA 1XGSA 4RLQA 5I22A 1V5GA 2KFDA 1ZRDA 3VEPA 4AFUC 2DVJA 4WF2A 3M0SA 1VQPA 3BT9A 2OTJQ 4M7AC 3ABUA 4DQ2A 3MKZA 2R92J 2EA4A 4F93B 1UJYA 5B1BH 4U7DA 3GP8A 4JS5A 2JA6J 1X43A 2M16A 3F70A 3KFVA 2ELKA 1WJBA 2PMUA 2BHZA 2BY2A 2FOKA 1Z7LA 5F08A 1B3QA 4LGWA 1ZARA 2OZ6A 3F6OA 3A4CA 4CCNA 1X27A 4EM0B 1G3SA 3JRCA 2CH4A 2LD5A 3N5BB 3T8TA 2K3BA 2R7WA 3BG9A 2DPUA 2VI6A 3MVPA 2KT0A 3LSIA 2VT3A 4BHBA 3L7WA 2DA4A 4OIRF 1ULYA 2ELJA 4PUSA 4M3EA 2GQVA 1L0OC 3MWMA 5A0LA 2YS9A 2VONA 1ON1A 1JTXA 3CP8A 3CCLQ 3M0UA 4KJZA 3AL0C 1VQ7A 1Z7UA 2YRCA 4D8DA 2JA8J 5A2QZ 1M30A 2HDAA 2LVMA 4N4OB 2OAUA 3E6DA 3F0CA 3WTWC 1KJWA 1UCRA 1NG7A 4MZTA 2X3XD 1BC8C 4JYKA 3JCUC 3K2ZA 4M9SA 2COWA 3CCLT 4JPBW 3QOPA 2CU7A 3KX2A 1GLNA 4XKBA 2O8KA 1OZ2A 2P4RA 3CXCP 4PK4A 2F5DA 2MI6A 4BJ6C 2JXBA 4E47A 2DZCA 1OJLA 3G71I 4MMKA 4TVRA 2DA3A 3KCCA 2CV2A 2HYJA 2X35A 3COAC 1FYKA 5DD8A 3JCMc 1IG7A 5A0GA 2O2OA 1SRMA 1NJIU 2LF8A 1X3UA 2DMNA 1S29A 2QF7A 4DZJA 2V9PA 2G9WA 1W36C 2DIGA 1Y6IA 2K7LA 4NHJA 4I0BA 3KEOA 2LG4A 4UB8C 1SANA 3MKLA 3OS0A 4HNVA 2QXFA 3GW2A 1JUMA 1KZHA 1DU0A 4I09A 4C5HA 2JRTA 2QGFB 4XK4A 1HDDC 3JSCA 4KT5C 5IPAA 2QYOA 4ZYGA 1SC7A 3WU2C 4LG0B 2RHUA 4RTYA 3UDCA 1NJIR 4YEJA 1QPMA 4B48A 3EYIA 4CRIA 2ZXHA 4DBHA 3FJ5A 3A0BC 3AT1B 3BPXA 3GOXA 4RM2A 2ZPIB 4Q48A 1LUJB 1ZSZB 2WA0A 5GAOp 2RGVA 2KP6A 2DPDA 3AHUA 3E5XA 4QT7A 4XRMA 3MN2A 2DXIA 2E5QA 2HKQB 2E2JJ 4W1UA 2D6FA 4M3DA 1OI1A 5DM7F 1WI9A 4D1QA 1WIEA 2DX1A 3GBGA 3OIOA 3VS2A 2O0YA 2XAUA 1JTYA 1IXRC 5IOYA 3M4GA 2D1XA 3VYTB 1OOTA 1WGSA 1NYGA 1SD4A 1YO5C 3JTHA 1MBHA 3ZQLA 1KU7A 1YRNB 1U6GA 1XOVA 2DBMA 4IHSA 4A0ZA 3CMEA 3BZCA 2HCKA 4IEJA 3F21A 1F4KA 1QVPA 2QWWA 2Z5UA 3PJRA 4KMFA 4PNOA 1S7OA 5FU6B 3OBYA 2CT3A 2CQNA 3M8JA 4C92C 5KVRA 4BHCA 1TZLA 3LNQA 3WTUC 1YHQA 2VC0A 5D4SA 5J4YA 5E1WA 4XLPF 1SFEA 2H1KA 2KQWA 2LJ0A 3OQ5A 2YSQA 4AG2C 3A5ZB 5IXBA 2FUG2 2JJ7A 1XG1A 2QZ8A 1RUOA 3ZQIA 4C0GA 1TTHB 4YRVA 3F23A 3K4NA 3D1NI 1I1GA 4Z88A 5BOXA 2M30A 4IHYA 1JEGA 2XSJC 4PJMA 4OMOA 2Z99A 1VQ4I 2D9TA 4F17A 2V6EA 1Y07A 2VN2A 5AIQA 5IN1A 1QHHD 4MTDA 2VL8A 1ETXA 1QVFS 3FDYA 2JK3A 3CCUI 1TLHB 2NVQJ 3M0TA 3B73A 3C12A 1MSEC 2LY2A 3CMAI 5JHUA 2PVDB 2EBIA 1E6GA 4KGXB 3RDIA 3PUBA 5FRNA 3P9KA 2NXNB 3TDZC 3OYFA 2MWOA 3VS3A 1EH7A 4CC7A 2FEZA 2FMLA 2X6WA 2AO9A 2EVRA 1ZHIA 2FE3A 2Q1ZB 4CCKA 4OMYA 4U7BA 1VIFA 2E5KA 3I55A 2EJFA 2X0LA 1JJ6C 2ABLA 3M8EA 2V8KA 2YT6A 3CCVA 3KYCB 1BN5A 1TL8A 2DTHA 2A6TA 4HF0A 1VQLQ 4IF4A 1ZBXA 2R58A 4JZ3A 4R56A 2B7EA 2FF4A 4WCIA 3E19A 1I8FA 5L23A 3U2RA 1UMQA 3J7YJ 1M1FA 4M75F 4ZNXA 1X19A 2GF7A 3WTVC 1HF0A 4OMLA 2ME0A 3QUIA 3UATA 2FJ1A 4LE9A 2CUJA 3QZ5B 2LY1A 5L3CA 1TH7A 1PUEE 1WSUA 2KRFA 2H8HA 4A4EA 4PJOC 2V26A 2MLKA 4OMMA 1E2XA 5GAMj 2ROTA 3KXTA 1Y96A 2OZUA 2EPFA 2MSYA 1S5LC 5GTIC 2W10A 2E70A 3PE0A 4M7DD 5BNGA 1PUFA 4HA8A 2YUOA 2EH3A 2ZMEB 5LRSA 3H9NA 1IV8A 1D3YA 1GDTA 3KZIC 4HYEA 1QW1A 1WHHA 2C06A 2E3HA 4V2SA 2WBMA 1GXPA 3LA3A 1S9HA 4OGEA 1Z0XA 1RAGB 2OAZA 4IRGA 1I6HJ 3BJOA 5LJ5e 1KG1A 3S1MJ 3QPTA 2VT2A 2ZO4A 3CPWS 5LEJA 5KYXA 2DEUA 1O3QA 3M4OJ 3ZMVA 2DMOA 2RM4A 4ESBA 4BI8B 1K73C 2NS7A 2HTSA 3Q9SA 3ROUA 2DFEA 1U8BA 3C7JA 3NWSA 4HT8A 1U5SA 1OLTA 2XVCA 1XDUA 5KE2A 5JVGF 2DL5A 3S15J 1XSXA 5HKCA 5FGMA 3AFHA 2ZPHB 4HX8A 2R7OA 7AT1B 1M90C 3AKZA 2RVCA 2CYYA 2WC2A 2Y4XA 3GZNB 4E7LA 2VOOA 3X26B 1Y56A 2X6XA 3I56I 4CYCA 4M7AA 2HQ5A 1N6AA 4UVBA 1F1BB 4PLLA 5CVRA 1IGUA 1D8KA 3CCLA 3GNFB 1WJ5A 1BJZA 3GCMA 2WB1N 3NWTA 3ZQHA 1G59A 4X1EA 1F36A 1VQ6I 3CLQA 1N9SA 1S1NA 2V8JA 1RABB 1XMAA 4I7HA 5LHIA 3GYHX 3GTGJ 1KIKA 1ARKA 3TBIA 4B8XA 1T08B 2PG4A 3CP2A 3ZMSA 4HNTA 2ZBKA 2L3QA 4L5JA 4PGHA 4BYYA 3UWNA 3LOCA 4C8QC 3DB4A 3JCMQ 2DI3A 3E97A 3FBNB 2WAEA 1PKSA 2R93J 1IZ6A 1JGSA 1O3SA 3WHBA 1T2KA 2E2IJ 3U1DA 3X2QH 1JGGA 2QSGX 1LDJA 1FOXA 4ZYDA 1AD5A 1MUZA 1YNZA 4ZGJB 2RNJA 4JLGA 3HDDA 3CDLA 3HOUJ 2KEAA 1A0NB 1X4PA 1U78A 3H35A 2RJFA 2QKLB 4A53A 2DLPA 1HKQA 5GAN4 3QIIA 3ZMDA 5KNLA 5GAN3 1UUEA 3F22A 1D0ZA 1I50J 2WV0A 3CCJI 4HQEA 3GTLJ 3BDUA 5TGTA 1D3BA 4BJ5C 3HOZJ 4FYXB 2F2WA 2X3WD 1I07A 2LOOA 4LDXA 1ZREA 2GBQA 3OYDA 1VA7A 2I5UA 3GF5A 4L9NA 1GBQA 1PRMC 3SXYA 3HGYA 5L3DA 4BQQA 4A2UA 5E3OA 1EFNA 2PU9B 2RK2A 4RTWA 1SF9A 3FXLA 4HW0A 2E10A 3HSFA 3RMSA 1S7EA 3JREA 2I10A 3QP6A 5LJ3j 1AA7A 4HVVA 1I3AA 1LNXA 2DU9A 2F69A 2FVUA 1Y96B 5GP9A 1YI2I 4IHXA 1CKBA 4FYWB 4M7AG 1Z1DA 5GANg 5DUIA 1PUFB 3JCMd 2E1OA 2X9HA 1WKMA 3PUFA 3RKXA 4XNFA 2V1NA 3CC2I 1VFCA 2YWWA 2JT1A 5LHHA 3BQYA 5TRDA 1SFKA 2QSHX 2H3EB 2M02A 4P5NA 2HTJA 5GAN2 2PX9A 2HOSA 3KYLA 5HS9A 2DA1A 1FOKA 3RTRA 3QAHA 3OW2A 5FFZA 3IWFA 4RB3C 2JWTA 2BZYA 3N05A 3CTAA 2JM9A 2FA5A 4XTUA 3CXCS 4RAGA 1IW7F 4MZMA 2L7FP 4HRIA 3RERA 3M53A 4MTEA 5FLXE 1BL0A 2E7WA 1RAIB 3JCMg 2DYIA 2C0TA 1W2BP 1Q95G 2D8HA 3S2WA 2EJ9A 3JSOA 3WTSC 3EFOB 3OWTA 4HPQA 4FU6A 2IRFG 3BJAA 2K4BA 1MBJA 4BEHB 2QG9B 4E4HA 2PMZN 2JUGA 4FQGA 1U9NA 2E1MB 1YP5A 2COMA 3LGLA 1T3SA 5D6WA 1Q82C 4DOWA 1G3TA 2GFAA 4EMKC 1E3PA 4F52A 1G5VA 2DYSH 2WAQN 5EYRA 2RA2A 1BIBA 1MW7A 2VV5A 2ZNYA 3EUAA 4BE1A 4M7AB 2BY3A 1TQPA 4E70A 3S2HJ 3ABKH 2H09A 2QENA 1ETVA 2DOFA 2NUTA 3LX7A 2XDDA 3GTKJ 1W4MA 1K9AA 2MAMA 1NZ9A 2EFNA 2K27A 4PZJA 4G7OF 1BB9A 2EK5A 3OBWA 5GMKj 4C30A 2EGEA 5FKLA 4F04B 1HKTA 3M8FA 1VQNQ 1B72A 1ZN2A 2EIMH 5CYVA 2KISA 1A31A 4Y7NJ 2D45A 1OQKA 1UB4A 4HBLA 3D5SC 3HOVJ 1BCOA 4LIVA 4LOCA 1VQPI 5KH6A 1JXMA 1P6RA 3HTUA 2HQRA 4LMYA 2XAQA 5EDNA 2C6YA 2GNCA 2K5FA 3HOSA 1HSTA 3VDXA 2LCLA 2RHXA 3CDIA 2L3RA 3AL0B 1MDMA 2KROA 4CI0C 2E34A 1OULA 4DBRA 1K4TA 2NVTJ 1UE9A 2KT1A 4V2GA 1AWXA 1ZLKA 3DKWA 3K4KA 2AQEA 3K9TA 1YG2A 2TRTA 2XMFA 4FT2A 4ETSA 2LT4A 1HQCA 3VU3C 3ZL7C 3CCRT 1W5CC 1MBKA 1D3BB 2DL4A 2QLZA 4GFBA 2IS6A 1XMXA 3T5XA 1HXDA 3OSFA 3BTJA 3NHNA 3PIOA 1B6AA 1HJDA 3ZMZA 3S32A 2FD5A 2MWPA 2EYYA 4RBOA 2F2VA 4U87A 3IC7A 1H88C 1DPRA 3KFWX 2K9MA 4LD5A 4D6WA 2V79A 1ZQ3P 1X1PA 2F5FA 5C4JJ 1K73U 3MZYA 3SEQA 4BS9A 5IP9J 4KFCA 3PTAA 2E1NA 2OTLQ 2PJPA 1DPUA 3BTLA 2JQ7A 5AT1B 4ZGDB 2DTRA 1Z21A 5E20A 4FHTA 1RR8C 2DL8A 1ZTRA 1YX5A 2O3FA 2VKHA 1WFWA 2NUZA 4PJOA 2HOTA 2RI3A 4YIIA 1LDDA 1K76A 3K70C 5HS8A 4EJWA 1X01A 4CC3A 2J05A 4EDUA 2ID6A 1XGNA 1K73R 3RQIA 1XB4A 4PKCC 3GO5A 2GAUA 1S72Q 1ZLJA 3DQVC 1JI8A 1YN8A 5J1UA 2XF7A 4C92A 3EHQA 1BI2A 2Q2EA 1E17A 5GAOr 4M7AE 1RRJA 1I39A 3BC8A 3EFRA 3GLXA 1S72T 4BBRJ 1B1BA 5K7ZA 2W85A 1KQ0A 2YHTA 2DK3A 4M78D 1M90R 3HL8A 3HUGB 3J80E 4RGUA 3FK7A 2DXBA 1STZA 5LD2C 2DTIA 3JR9A 4XU2A 1VQ8Q 3CCEQ 5M5YJ 2EYXA 4EM2A 4Q4ZF 2OF7A 3C4SA 2M5WA 3MJXA 3S93A 2MPXC 1JXOA 1OPLA 2PZ1A 2CP2A 3CCMQ 1UGVA 2A28A 5D5WB 1X2MA 1TSFA 2UZKA 1YFHA 3QWYA 1MSFC 4Z8AA 1VQ8T 2PFBA 3CCET 2K02A 2A37A 4FCYA 4CGZA 3TQNA 2LJ3A 2DERA 1Z77A 4ITVA 1ORKA 4NC8A 2NUTB 4M77C 2O9VA 3D5LA 1PHTA 4XLCA 4GBQA 3TO9A 2NLUA 3G1LA 3NARA 5DS9A 4B9XA 2QBYA 2F2XA 2P5VA 1R49A 3B02A 4B3AA 4BAYA 2XF6A 3CMEI 2P5LC 1B72B 2JUFA 1D1BA 3J80Z 2EQMA 4PJOG 4GXOA 5LJ5d 2MD5A 1N8RC 1RKTA 2VKDA 4DEXA 2ETHA 2P4WA 4NB5A 4U0WA 3JAMK 4UUSA 2CP5A 2EIFA 2O9SA 4JRIA 2DXTA 3MMYB 1G83A 4C8QA 3L09A 1O9SA 4E7HA 1XTAA 1YHQI 4QPOA 3FXOA 4HSRA 1MDMB 1X2NA 1WI3A 1G2BA 1ZSGA 3QKJA 4R55A 2TCTA 3QYHB 1WA7A 3J7AY 2DAOA 5CQYA 4C92G 3VRYA 5KCHA 1KD1U 1YCYA 4AG1C 4CH7A 4PSWA 2KL4A 4JJBA 4CICA 2PQ8A 4JRKA 5CVIA 1YX3A 4HZFA 3A01A 3S3NA 4QW2A 2RV8A 3QU6A 2XIGA 2QSFX 3N97A 1YITA 1EJ9A 1JUSA 2GFUA 3HRUA 3PFYA 4HG2A 4CZZA 2VUBA 1D8JA 3BG3A 4CUGA 4CSWA 5GADJ 1X1BA 3ZQGA 1JHFA 2DYRH 3HJEA 3PQJA 2EV0A 3HOWJ 2W84A 1AT1B 2NAZA 4DW6A 3SHFA 4FW1A 3WHCA 5HLIA 2F4OB 2YR2A 1RC9A 2ZFUA 3G1OA 2EGCA 2FBKA 2BOLA 3CUQA 1NYFA 3I55I 1R9TJ 1FYMA 1Z05A 4U88A 5I21A 4PJOB 4CDGA 1MZBA 3CCVI 3TL4X 5CQXA 5CCAA 5IH2A 5FLMJ 1VQMQ 1Q82U 1RESA 3KP4A 2DK8A 2XHCA 3DKMA 3RUXA 3GZ6A 2BBYA 1VQ7Q 1TBXA 4WWCA 4EGZA 4CC4B 1HW1A 1RI0A 3FLGA 3JV3A 4KISA 1IN6A 5L3EA 1VQMT 4MEYF 2VXDA 5J1RA 4GLKA 4C92B 3L00A 1DGRM 4X9DA 3OMCA 1VQ7T 3BDDA 5M5XJ 2DODA 3HIFA 2Z9OA 3K1PA 1SFOJ 2HVSA 4BI3A 2RKHA 3HYIA 3I4PA 1JB0E 5IT9Z 4C8QG 1HDPA 1Q82R 3PGGA 4A3LJ 3GMEA 4Y33A 2V7FA 5AIPA 1LPLA 2X1CA 1E0EA 1KYZA 1MH3A 1NBEB 3LSRA 2CZ1B 5D6FA 1ACIA 1HSJA 2DBBA 1Y71A 2WSEE 3JB9F 2EQUA 3K4LA 3EQLF 3TP0A 2V9VA 1U0JA 4IO9F 3E9GA 4K11A 3QDFA 4LG3A 4W97A 3KP5A 2P0QA 4ZYEA 3CQTA 2JSPA 1T33A 2XD0A 4XOTA 2QK0A 3FXJA 2RHIA 2XDBA 1QWFA 3CCYA 2JVGA 2W00A 3IWZA 2HMAA 2A5WA 3FKIJ 2ZSIB 4OINF 4ZJZA 3HHTB 3MEAA 4EMKA 1J3TA 2E19A 2F5CA 5LJ5h 4FX4A 2CQ7A 2JA5J 2ACJA 1X1CA 2OTJI 1HW5A 2JNGA 3ELKA 2LX7A 3L2RA 5CKDA 3CCRA 3A8LB 2FEIA 5JFRA 5DM7R 1WQ2A 2KIQA 4HDUA 5KHDA 1YWOA 2QBYB 4ORZA 3I56Q 2OC6A 4MFDA 3OL4A 2DT7B 2KJBA 5HNFA 2LR8A 3GFIA 4Y4RA 4U0VA 1K7AA 4IKFA 2E1CA 3ZCOA 2O4XA 3RMQA 4DBFA 4UUSB 3RSNA 3DLLF 1OCPA 4C8QB 2Y31A 3EPZA 1KHCA 3ZN1A 3QJ6A 1SRLA 2O5RA 2QGGA 1M3BA 4RGSA 5GAMe 3HSRA 1Q7YC 1YS6A 2FYKA 2FX0A 5EGOB 1PRLC 1MNEA 4FISA 2CO5A 1ZYRF 2NOGA 3CCLI 2D0QB 3GVAA 1FXXA 2ESWA 2R5MA 4PJOE 2GOMA 1ZBJA 1OR7C 5B3SH 1TUDA 2HL3A 2KDZA 1TQIA 1GUUA 3DEWA 1ZHFA 2RN8A 1M1KU 2QQAA 3I35A 2EZKA 1ABQA 1WHJA 2BGCA 4MQVA 3VSKA 2PBIA 4IVNA 4MQ9F 2VC8A 5IHNA 1J5YA 3DPLC 1O7LA 2IEKA 4BACA 5DY9A 3VS4A 1OCTC 5J3BA 4C92E 5GAOn 1R7JA 3JCMJ 5D8KB 1TXQA 1R58A 2GXGA 4RLFA 5KYNA 4KN4X 4YG2F 5EEAA 4F7UF 4G6TB 4XOPA 2UXXA 1SPKA 4RG8A 3I4MJ 1RKWA 2X4YA 3MPUB 2KXDA 1S72A 2UV1A 2R5YB 2IIMA 3RIRA 2QYZA 5IAYA 4M9ZA 1M1EB 5H6QA 4DYQA 4EATA 2ZPFB 3ASOH 1MMDA 5F1JA 2KT8A 5D6XA 5DLOA 1SAUA 3I54A 4G7ZF 2IGKA 3BG7A 3ZXSA 4DNCA 3HM5A 3ZQ7A 2PVGB 3CPWP 3DBLB 2HNHA 2A07F 2Y30A 1MMSA 3BFMA 1VQ8A 3CCEA 1W0UA 1PSFA 2DLLA 4KH1B 1FX7A 2V1RA 4HCBA 2Q8KA 3BR3A 4ON0A 5M5WJ 4NL2A 3DEEA 5DLQE 1ZH5A 1WVRA 3HSBA 1GFDA 3S1NJ 1CQTA 1R4MB 4O3MA 4GY5A 1IXCA 4BNCA 2R57A 2DDAA 2GIZA 2VXFA 3KBGA 3LGFA 1VQOQ 1A6IA 2BW3A 2IVMA 4RM3A 3PO2J 3HKZN 3HRMA 4RCCA 2BE7D 2XRLA 1IN4A 5D4RA 2VBZA 5GAHJ 1FTZA 4J9IA 1N8RU 3HTSB 2JTFA 4A54A 4PFOA 4D9JA 1EKEA 1XCBA 1EF4A 1M8VA 1VQOT 2WV1A 2X85A 5ICEA 3ABLH 1W4SA 3JRIA 2HQXA 4C8QE 3CMMA 3F8CA 1JKPC 2QQBA 1FEXA 3OSVA 3OMYA 1L3LA 4M75A 2ZSHB 1JRIA 2QEXA 3W6VA 4EMKB 2H8WA 2P84A 6PAXA 1N8RR 1PD0A 2AXTC 1GCQC 3VODA 3P7NA 1UJ8A 4JX4A 4XONA 3QWXX 2QA4Q 1BOBA 3FM3A 4NQWA 3VYSB 2BZXA 5F0HA 4M77A 4A4GA 3RESA 4C5GA 1VF9A 4BY1J 1N77A 5KCMA 2ECZA 2XGXA 3F8MA 4BBSJ 1XJWB 3BP8A 2B86A 4AYBN 3E2UA 2O4XB 2A05A 2FXAA 2QA4T 1AWCA 2XICA 5ICGA 3ISPA 3G2BA 5DCMB 2YDLA 2K79A 5A2QE 4LK1F 5LJ3e 2BTTA 4L9JA 3C18A 2IS2A 4AVPA 1FPQA 4I01A 3QG1A 3CO6C 1HD3A 2XB0X 4MO7A 2ZNZA 1I5OB 1WWXA 1Y1WJ 3ULRB 3O6BB 5GANe 1ZELA 2J7IA 4RTVA 4FETA 1W5SA 4I76A 1WJFA 2V1XA 4DJAA 2FMYA 3LYIA 1R5HA 2WTEA 4PLIA 4XU3A 5DTDA 5M3MJ 3PO3J 1X75C 2W0ZA 3P8DA 2OD5A 5GJWB 1Q1VA 2RK1A 3L2CA 4CCOA 2GGRA 1UECA 1VQMA 1PG5B 4OMZA 2BZ8A 4AC0A 2F1LA 3DBRB 4DZPA 2KPMA 1VQLI 3JCMe 4OB3B 2KMUA 1BR1A 3V7RA 2ECBA 3SDBA 3S2DJ 3BTIA 1DUXC 4BE2A 2FRWA 3EG3A 2GXAA 3GZ5A 5HDNA 2DFIA 4IOCF 3I4NJ 2CT4A 3IQLA 1PKTA 1R0CB 2JT4A 2MH2A 5IHIA 4NBQA 4M75G 4D8KA 1QU3A 1ETOA 1QGPA 1R1UA 4PCQA 4UXNA 3WGIA 4QQDA 4WXDA 1FJLA 4KN7X 2L4MA 3C2GA 4N0BA 2EWNA 2HGCA 3I58A 1IDYA 1IGQA 3JCMX 3TGNA 1HA8A 1HYOA 4M77G 2LKSA 4OF1A 3LWHA 2HXIA 1GVJA 3HHGA 2JS2A 4LLLA 3I5SA 2M0MA 2LBFA 2L0KA 2XB5A 1U3EM 1R22A 3LA2A 4MMLA 2HKXA 3RPUA 4KICA 5GMKe 2N8GA 1JKRC 1BI0A 4V19K 1UELB 2DA5A 4KUMA 4BXFA 3WG9A 4YIRX 2K57A 2BW3B 3HB9A 4EVIA 5CLSA 3MKWB 4LDVA 2DT6A 4BQAA 4OB0B 4J8OA 2VQHA 3T1BA 5F1RA 2JMWA 4RDUA 1KQSA 5ICCA 2K5CA 2CREA 4Y92A 3OYBA 1BJAA 2L9SA 1SHFA 4BQOA 2BVMA 1K4SA 1MBGA 3QWLA 2O6GE 2CP3A 1VQKT 2ZMEA 1Q7YU 1BA5A 2STTA 4JDSA 2D5VA 4LNPA 4XN0A 4A3EJ 2COBA 2PN6A 1X6GA 3LQQA 3F8FA 4M75B 4OMQA 2O61A 3THKA 5GMKi 3M3YJ 1NE8A 4A4HA 4XKVA 5J8CA 2DKGA 3NQOA 4UB6C 4U0YA 4KT0E 3I0TA 2VLAA 3NTKA 3A0HC 5JLXA 1SVOA 4E7IA 2EFQA 1UZCA 3VOEA 1U2WA 2VQGA 4NQWB 1WNLA 1SD6A 4M77B 3K69A 1MJ9A 3M0PA 3FDRA 4WX9A 1Q7YR 1YWPA 3ZMTA 5J8FA 4XSZF 1BC7C 3M07A 2UUZA 2AQFA 2W1OA 4QSHA 3OYEA 3RZDJ 2HWVA 1I1SA 2G7UA 2E6NA 2VASA 1RACB 3IP4B 1SVMA 4HDVA 2HBWA 1T39A 4A0XA 1RNLA 4XLEA 1YQAA 2X51A 2CW0F 4EMSA 4KBMB 4XRFA 1JUPA 3OL3A 2K5IA 3A8HB 5LJ5f 2EFOA 2QQ9A 2L0AA 4CCLA 4XLHA 1YOVB 1V1CA 2DO3A 3L2QA 1VNDA 2B0LA 2OA4A 3VKIA 1OR7A 1WHMA 1OISA 2HI3A 1JO8A 4X9CA 3OYMA 3BE3A 4N9IA 3W2VA 4BH9A 1R4NB 1M3AA 4M72A 2KAFA 4XTYA 2VYTA 5HK0A 2AXLA 2TDXA 5DYMA 4II3A 4N4GA 2LYCA 3FXUA 1ENHA 3FWEA 3GTOJ 3ZQFA 3IAS2 4LDUA 1YIJQ 1FBSA 3UR3C 3RZOJ 3GBQA 3LW5E 4BUGA 1GV2A 3VUZA 1LB2A 2HAXA 1I5LA 3JRFA 1RUNA 1BW6A 2E60A 1M9SA 2EJGA 4JJNK 1TC3C 1LCKA 1ODDA 5LLQA 2KRSA 1YIJT 1Y0UA 4XICA 3RPQA 4X6AJ 4I6ZA 3JCMW 4A6EA 1MBEA 2VC1A 5HDKA 1R00A 4X0GA 2ZCFB 3RJPA 2MMPA 1VQOA 1QVGP 3EG0A 5GAOl 1X1DA 1TOVA 1QWEA 4IRHA 4GYIA 5GAMd 2MF2A 1NLPC 1I6XA 3ZQQA 4A5NA 4J00A 1ZR4A 2EIKH 4DGWB 3BROA 3WGGA 2J5OA 4M75E 1N25A 1QVUA 1R1TA 2GQIA 4X1VA 3G6EA 5EEGA 3H36A 2LBFB 3WE2A 4ENJA 1FYLA 4JP0A 3MKYB 2QTXA 1SEUA 4FSSA 3WU1B 4QQ6A 1QZEA 2LTPA 2NVYJ 4A3DJ 2MC4A 4QIWN 1JKQC 4EV0A 4AIDA 1IO2A 2MK5A 2IP2A 2LQ8A 1IN8A 1QHGA 1JT0A 4M77E 2KRHA 3V42A 2HQHA 2K9SA 2ZJ2A 2QAZA 2ROLA 3FMRA 4HVUA 4ELYC 4M77F 1R8OB 2XU8A 2MYSA 4ZYAA 1Y57A 2K7AA 5GAMg 2DA2A 1XNIA 3CJTB 2AT1B 2GCXA 1GXIE 2QA4A 1Q81C 4II2A 5E1XA 4IOAF 3GIBA 3FHNA 2OCEA 4M3BA 1OU8A 2K40A 2XAHA 4BU2A 3LSPA 2F5EA 3P9IA 3U21A 3PNYA 4N9HA 4E6KG 5LGTA 3GTQJ 3TQ7P 1XN7A 2HFHA 3V8JA 3VJPA 4XU1A 5J26A 2HDCA 2EFIA 4DA4A 1ZGAA 1H641 3PNWC 3EUKL 4Q5WA 2R3SA 5IP7J 1YJWQ 1RLQC 3CBOA 5E79C 2DNUA 2IXSA 4UV8A 5GAOq 2KKOA 1F43A 3HXLA 1H3ZA 2CV0A 4XM3A 2L3PA 2FNPA 1OPKA 4WXCA 3WU0A 1WCMJ 3BY6A 3GEZA 1QBJA 1EIFA 5J3LA 1JQQA 2RQVA 4HVWA 1YJWT 1VQ5A 3DBHB 4WXHA 3EFOA 3DLAA 4M7AD 3SFIA 1IC8A 1C0MA 1MJBA 4BUPA 3O3KA 2ESHA 1CSKA 1X69A 4RB0A 2ED1A 3OR1C 2J6KA 4BEHA 2GIVA 3ERED 4HEA2 3VSLA 3SDZA 3WVDB 3MD2A 3QODA 1VQNI 2HPMA 1FSEA 1G3WA 2EQIA 2L9NA 1K83J 2RI5A 3M1EA 1TWBA 1MGTA 4LK0F 1QVFA 3LSKA 3CCRI 2D1VA 1KK7A 2E6ZA 2R7DA 3CQZJ 2WACA 1RAFB 3LMMA 5E3NA 4XTZA 2GA1A 3CCSQ 2E7XA 3AG3H 3BLYA 3OW2S 3DU5A 3ULQB 1SEMA 2KRCA 4NDLA 3A2KA 5FLXK 3ASKA 4M78C 4XU0A 4RS8A 1AHDP 3WXMB 3MZ8A 5ILUA 1RUWA 2VGNA 2ATCB 2FPEA 3E9FA 3OA6A 2QDYB 3OS5A 1N9RA 3CCST 4J83A 4Y91A 2PEXA 2XPWA 1BBZA 5D6YA 2M4GA 2EV6A 2Z33A 1V54H 2ZPEB 1OCRH 6AT1B 2YUNA 2HVRA 3A8GB 4PJLA 4HQMA 4BY7J 2O31A 1SG5A 2KVQG 3ECHA 3EDPA 3MCZA 2OTLI 3LFKA 4C2TA 1NEBA 3J7AF 4RA2A 5EZGA 1H9GA 5LJ3d 2JRMA 3SDGA 4ASNA 2JTMA 8AT1B 4ZN3A 1VQKA 2MIOA 2L8DA 4LJZF 1AWJA 1BI1A 2FZCB 4J9GA 4RUGA 2PMZA 1W36D 5GANd 3K4BA 3FIWA 3FXMA 2R7SA 2Z16A 3O8GA 1QQJA 3ABMH 2W82A 5IYCJ 3INZA 3VYGA 2EIJH 1R36A 2MH9A 4BXXJ 1WJSA 2PJRA 3EH1A 5HK3A 4G94A 1HC8A 2FHDA 2WY7Q 4KMUX 4XRSA 4JUVA 1S6LA 2AK5A 1WHLA 3CC4A 3OYYA 3M55A 5LJ3g 5IY5H 2VPRA 1JJ2A 4BY6C 9ATCB 1YITQ 2COYA 5GJVB 2E71A 3H9JA 1D0YA 2HXOA 1V5FA 1W0TA 2O9LA 2VKNA 4AT1B 2K9LA 4KGZB 5HDGA 1KD1C 3MEUA 5ICFA 2DFFA 2H1LA 3OYLA 2W57A 4LFUA 1V76A 1VTNC 2J6OA 1VQ8I 1Z3YA 3QPSA 4A0YA 3CCEI 2RB6A 3O8VA 2LH9A 1YITT 4NL3A 2Y0SN 4J9HA 3KP2A 1W7PA 3CCMI 1TU0B 1UFFA 2O01E 2W25A 1D1AA 1R71A 2AZSA 3H5AA 2PTKA 2HDDA 5FKKA 2HOEA 5AYFA 3CF2A 1JJ8C 3OB9A 4ZGEB 2XV4S 2WAFA 2ZC2A 3B6CA 3HUGA 3R6SA 3KLNA 4AIHA 5F0CA 5D5UB 2JN0A 2CGPA 1B34B 1ETQA 2EBPA 2BXZA 3T8RA 1KC8U 2RJDA 1GCPA 1VYVA 1KONA 1K0XA 1V3FA 3JTGA 4UY8I 2L02A 1YFNA 1XX5A 1DDNA 4BE0A 1YW9A 1LKXA 1P4AA 2MLGA 2ZKZA 2YSRA 2L9VA 4MFEA 4J19A 2OCCH 1D5YA 4D7MA 1U1SA 4IZZA 1SD7A 4M73A 3E6CC 5C0MA 3TKYA 3ZRGA 3IV5A 2DMUA 2H8RA 1M27C 3REBB 3FXKA 3X25B 2CFXA 1YIJA 4RTXA 1VYTA 5FU7C 2HEQA 4UHTA 1WQ7A 2XDPA 4A63B 4PSXA 4YTLA 4XRSG 2XRNA 3CJNA 2XAJA 1LOJA 4IUQA 3J80K 5LRRA 3KEYA 3E0JB 1X6OA 4EIKA 2VIXA 2BE9B 1T0JA 4VUBA 2NWMA 1ZX6A 4RB1A 1VQNT 2RQPA 2K9QA 2UXNA 1OYXA 4PFPA 2A36A 5ILVA 1OYIA 4DYCA 5IOZA 5CKBA 1WHGA 2RQUA 5LJ3h 2JPBA 2MFZA 1NEGA 2DRMA 4N0AC 2LP0A 3S3OA 3E5UA 1YYVA 5IP6A 4M74A 9ANTA 5GANh 2PUOB 5FJ8J 2WSCE 1Q81U 1LEAA 2FBHA 3P9CA 2JS0A 3R0AA 1Y39A 5CPRB 1ZG1A 2CDTA 3CO7C 2VBXA 3LSMA 4ENNA 1X2QA 2DIQA 2XAGA 4AFQC 1Y0NA 4C3IJ 1ZA1B 4N4NB 2ICWG 1VQMI 1K0SA 1UDLA 3FMSA 2C0IA 1LNWA 2DFHA 2M34A 3HSEA 3DLLA 4PJOD 1EH6A 4RTTA 2BE5F 1IRXA 2NS8A 3HC7A 3VFZA 1VQ7I 1U3OA 3H0HA 2W4SA 1Q81R 5GPCA 2E4HA 1TWGJ 3JCMh 3M7GA 3U9GA 1ZGWA 2PJRB 5J39A 4IUVA 2BY1A 2ME6A 4IRIA 1SMTA 2STWA 1MV3A 1QVGA 5F64A 1QP3A 3QYFA 1MD0A 2VJIA 2CW8A 4C92D 5GAN8 1DGWY 2CQXA 4M3GA 2DZ9A 2D2WA 2QCOA 4HF1A 2CUZA 4PGGA 2DVEA 1IRZA 2JMAA 1YJWA 4JK1X 4HT9A 3ZP5A 3K1NA 1GV5A 2HZTA 3CXCA 4BGDA 2BYVE 4M71A 4E7ZA 5H2FC 3JRAA 1YJNQ 2R7RA 3C1DA 4OOIA 3L2VA 4IJAA 1M1KC 3H92A 3CD6Q 2EKHA 4XBFA 2QQ8A 4KIGA 2WWYA 4HLYA 1SSFA 2P81A 1U5TC 2J5PA 1W7PB 1XS9A 4B3XA 2NRAC 1P2FA 3F8NA 2YUQA 4F7UA 4EPCA 3L1AA 4M7DF 2L5QA 1YJNT 4D5CA 1Z6RA 4DIQA 2CJJA 5JVTA 3BZKA 3AAFA 2ZXJA 3CD6T 2FU4A 2HYGD 3TCJA 3HEFA 2CUBA 4ZDPA 3G1JA 1WJCA 5K1YA 4B9WA 2RQRA 1UJ0A 2QGUA 5EG0A 2CKKA 1P7JA 1WGXA 5H20A 3KETA 1T0HA 3ZR8X 2EINH 4IL6C 4F91B 4OIPF 1LE8A 3GTMJ 1TNTA 1HK9A 3OSGA 1X1AA 4AWXB 4RTUA 2O03A 2KYBA 3CCSA 3BOQA 4I2OA 4FX0A 1RADB 2Y90A 1TS9A 4P1WA 2MC3A 2BVLA 4Y28E 3LH5A 3KEQA 2Y75A 1YW8A 5EJCA 2RAEA 4A4KA 4IXAA 3KUFA 3MEVA 3H3ZA 3SJMA 2ZFWA 2DT5A 3JRZA 3LAPA 4CZCA 4C8QD 2JUCA 4QVDA 2DN0A 1E6HA 2DJQA 3V7CA 2RC4A 1NK2P 2E64A 1BR4A 3VYRB 2QDLA 1UHSA 2VE8A 4RG2A 1RI7A 2GA2A 3OYNA 1PCXA 3ZFJA 1B7TA 1U06A 2HNIA 2QEXQ 4LDYA 5H6RA 1OEBA 4OMFB 2LC4A 5HODA 2VGMA 5ERIA 1MNMC 2CGHA 2HD0A 3LH0A 2ZAEA 5FWBA 2Y2ZA 2VXZA 3IH3A 4PFZA 2P7CB 2HSPA 1P92A 1ZUUA 1GXQA 2G0EA 2M1BA 2QEXT 2LRDA 3IL2A 3ME9A 2K2MA 3P5JA 3R60A 1IN7A 5EGOA 2IGMA 5CKFA 2CV1A 1FP1D 2SEMA 5KYUA 2DFUA 3TSZA 1LVAA 2JZ2A 4F7UG 3ZBDA 2HVQA 1BIAA 5C3EJ 2KNBB 2OAWA 3RYRA 2LY9A 1A6QA 1TT0A 5F6FA 2KMTA 3MP6A 1UG0A 3WGHA 3WTZA 2VVKA 3LFUA 4XMYA 4BDZA 2YRVA 3OYGA 3MHXA 2M7BA 1XPXA 3CC7Q 2ZXIA 1YLFA 3KZYA 5FU6C 3WVEB 5IT9E 3F8BA 2M9UA 2KK4A 2EW3A 2HDWA 3FB9A 4FIBA 1KD1R 3PM1A 1EZZB 1MV0B 3Q0WA 3VPRA 1JHHA 2K3YA 2L4AA 2RMOA 1WZ2A 2R5YA 1J0RA 2ECCA 3CC7T 3GFMA 3IHUA 5KK1A 1ZRCA 5IXFA 3I64A 2YXYA 4NS5A 5EEHA 2GOXB 2CUEA 2Y9YA 4EJTA 5LJ5j 3URGA 2VQLA 1G6NA 4D0PA 2IGOA 3S6WA 1VQOI 4NC7A 3HPWA 1QQIA 3E6MA 3FIFA 2DA6A 5D5XB 1QLYA 5M9OA 2PNIA 4NUBA 1AZEA 2H6BA 1FWZA 1N75A 1NM7A 1LEBA 4FT4A 3JCMV 2JTVA 3FM5A 1NG2A 3VS6A 3ZQCA 2K3XA 3W3CA 2L2OA
chains in the Genus database with same CATH topology
4EM1A 5CVUA 2YLCA 1OMIA 3QP5A 4IPAA 3HFNA 1I5ZA 1XMKA 2FL7A 3E1SA 2IW5A 1MJAA 2LX9A 3ZMUA 2UWMA 4AD9A 4ZZDA 4LB5A 5CKEA 1EH8A 3SZTA 2PLYA 4FL6A 3E5QA 2ELHA 2GXBA 1H0MA 2A5YB 3V8LA 1TNSA 2NNNA 5DCFA 2V1UA 3OMGA 4L0ZB 4OB2B 3PMTA 1S3JA 4KDPA 1YBYA 1BI3A 3PQKA 3LQRA 2DXCA 4BHPA 2IVWA 3TO6A 3WTYC 5DCMA 3JCMb 2EYQA 3DXJF 3QU3A 2IA0A 4AIJA 3CCQT 1IZ1A 4RCBA 2MBFA 2DXUA 1KU9A 3ML6A 4KULA 4J6XA