5CVIA

Structure of the manganese regulator slor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
b'PNKEDYLKIIYELSERDEKISNKQIAEKMSVSAPAVSEMVKKLLLEDLVLKDKQAGYLLTKKGQILASSLYRKHRLIEVFLMNHLNYTADEIHEEAEVLEHTVSDVFVERLDKFLNYPKVCPHGGTIPQHGQPLVERYRTTLKGVTEMGVYLLKRVQDNFQLLKYMEQHHLKIGDELRLLEYDAFAGAYTIEKDGEQLQVTSAVASQIYIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SloR
molecule tags Transcription regulator
source organism Streptococcus mutans
publication title SloR structure and DNA binding studies inform the SloR-SRE interaction in Streptococcus mutans
rcsb
total genus 60
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cviA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cviA02
1DDNA 3L7WA 1J9IA 5CJ9A 2A5YB 1MKMA 2V9VA 5D5UB 3CLOA 1FP1D 3ECHA 3FHZA 3N97A 4XRFA 5HDNA 1IXSB 4L0YB 5D5WB 3V8LA 2HKOA 3FXUA 2GAUA 2BE5F 4MNUA 4HLYA 1GXPA 1Z6TA 5D4RA 1Z6RA 3E6CC 3JAMK 1R7JA 1MJBA 3KZZA 5EEHA 1FOKA 2M45A 2CW0F 1EH7A 2ESNA 4R8HA 3I5UA 5DEQA 3DP7A 1KU3A 3GFMA 1J75A 1J0RA 2V1DA 3U2RA 4LLNA 2RN7A 2IA1A 3E6MA 3HIFA 1FZPB 3E6BA 4HLXA 2XAFA 4M71A 3KEOA 2H27A 3Q9VA 1F5TA 3FX3A 4AWXB 2L02A 4K2EA 4KN7X 2Y0MA 2O6GE 2KIUA 3KETA 3V7SA 5BS6A 5E8IA 5CYVA 1YFHA 1RNLA 3OOPA 4ZYHA 4EGZA 1AWCA 3ABTA 4M9ZA 2RV8A 4HV6A 1YS7A 4HX4A 4OU0A 2VE9A 1VTNC 1I1SA 1SD7A 4IRGA 2K5IA 3DF8A 3V8JA 3E5UA 1R36A 3HSEA 3BOQA 5AIQA 3FZVA 3REOA 3LA3A 2DAOA 2O3FA 3TGNA 3ZMTA 2HQNA 2L4MA 5HS7A 4ASNA 2P5LC 2M8EA 1P4WA 2JSCA 4KMFA 4BNCA 1XMAA 5ED4A 1FBUA 2YPRA 2QENA 3GFLA 2B0LA 1WQ2A 2L01A 3V4GA 3H3ZA 3EETA 4G94A 4LG0B 5FLXZ 2WWYA 3HRMA 5DYMA 2P5VA 2BBYA 4M9SA 2ADUA 2EV6A 3RPQA 3K0LA 3QPHA 5E18F 1FBQA 1O3TA 5H20A 5AONA 4ENNA 3JSPA 3HUGA 2OZUA 2PMHA 1S29A 1KA8A 2M87A 3O6BB 3J7AO 3GZ6A 1FT9A 2LSOA 2ZKZA 3R4KA 2CSOA 2ZMEB 3KP3A 3FM3A 2C6YA 2Z33A 2JPCA 1Z7UA 5BOXA 1YO5C 1P2FA 1JGSA 2ZXJA 4MGRA 1BI2A 3COAC 4ENJA 3KP6A 1MDMB 4HBLA 4CZZA 3BJOA 4U0VA 5DDGA 2BGCA 2QLZA 3Q9SA 1HW5A 1U5TA 3T0YA 2IRFG 4U88A 3LAPA 2NRAC 4OIQF 1HKSA 3FF5A 5D8LB 4BHBA 3P9IA 1BBYA 1R22A 1R1TA 1FBSA 1QGPA 4WWCA 4A0YA 1CF7A 1ZRCA 5JR3A 4HF0A 2FE3A 1XCBA 2HWVA 4R79A 2HZTA 4WXHA 1HQCA 1LDJA 1FY7A 4ENKA 2PN6A 3H3UA 4WCGA 3ZQ7A 1TBXA 1R5HA 5BPIA 1OYWA 2LF7A 3GXOA 4I0BA 2FNAA 4OIOF 3WTTC 2L3DA 1KQ0A 1R1VA 1RUNA 3E5XA 3TO7A 1O57A 2FNPA 4HDUA 4I7HA 1ZN2A 4EM2A 2GXGA 1BI1A 3VOEA 1U78A 1QZYA 5A2QZ 2QBYB 5HS8A 1G3YA 2A6HF 5J8CA 2A68F 3WGIA 4KUMA 3P7NA 5DCMB 1HSTA 2EV0A 1G3SA 3CUQA 1J2XA 4JBAA 1XGOA 2FBHA 1BYMA 4YIFA 2DW4A 1OYIA 1SFUA 4XSXF 3TOAA 3QOPA 4Z2YA 3I59A 2ZNYA 2DO7A 3F72A 4AD9A 2STTA 4RAYA 3J81K 1QO0D 5FD6A 3LFKA 5CLSA 1K79A 3RKXA 4L9TA 1OPCA 2XVCA 1TTYA 3F8BA 5CVVA 4Q5SF 4ESFA 1MJ9A 4EJVA 2COMA 2W24A 4I2OA 3ZMVA 2PFBA 5ICFA 4HX7A 2BEOA 1T98A 5LHIA 1REPC 2R7FA 1XD7A 5JHUA 5LGNA 1S6LA 1P4XA 2F2EA 3JTGA 1DPRA 2KIFA 2J5PA 2VOPA 2DTRA 3TKYA 3BPVA 2EJRA 2HTSA 3QP5A 4A6DA 1IN6A 2XHKA 4LB6B 1ON1A 2CFXA 1U5TB 3MQ0A 1UB9A 4UXNA 2K02A 3WGGA 2OA4A 3TOBA 1OMIA 1CF7B 1TNTA 4CGZA 1BC8C 1RI7A 4HYEA 2EWNA 2H94A 3VB2A 4MEXF 1W7PB 5KK1A 4P55A 5D5VB 3PQKA 2IA2A 2GA1A 1T39A 3GLXA 2HS5A 4YG2F 1DP7P 1P92A 2YX4A 3LA7A 4LLGF 2EFQA 3CUOA 2MA3A 2XIGA 4UNOA 1S8NA 1SFXA 3BJAA 4BQAA 1TW3A 3OV8A 4B8XA 3IL2A 3DKWA 2VT2A 2A07F 5ERIA 3V7RA 3R6SA 3E5QA 1Z1DA 3DEUA 4YFKF 3M8EA 2CQKA 4I98B 5FB2A 3LQQA 4RB1A 2Y48A 4BAYA 1HXDA 4N0BA 2R3SA 2VC1A 4DNCA 1UFMA 1ZAOA 1IRGA 1O3SA 5ICEA 3I53A 4HF1A 5HLHA 3WTUC 2D1HA 4GYGA 2UWMA 1Y0UA 2X4HA 1CGPA 2OZ6A 1X3UA 5FO5A 1E2XA 2FEZA 1T2KA 1WWXA 5L3GA 4QWQA 5BMZA 1U8RA 4CHUA 4Q4ZF 1RIOH 4BYYA 3FXRA 1K78A 4RS8A 3FWEA 3SQNA 5L3FA 3I59B 5H6QA 4ESJA 2CGPA 2FU4A 1ZLJA 4IXAA 4MEYF 3B73A 5LGTA 2EFWA 3L9FA 4A6EA 1XCVA 1FPQA 4NQWA 1QQIA 3BWGA 3ZMUA 2CO5A 3FXQA 2PMUA 1SD4A 2UXXA 1J59A 3TQNA 5LLQA 3F6VA 1ZG5A 1K6OA 3GX4X 4EJUA 2PBIA 2XAGA 3Q5FA 1HSJA 1PP8F 1TNSA 1ZGJA 2OBPA 3KP2A 2F5EA 1OR7A 3SXYA 3GO5A 4ZYGA 1ZHFA 4CDGA 2UZKA 4KT5C 4LK1F 3CTAA 2CWEA 2G7UA 2EFPA 2AS5F 5E17F 2QQAA 1V4RA 1I27A 4Y17A 2CYYA 1OKRA 3HSRA 3LA2A 2HFHA 2VE8A 2GQQA 4NHJA 3EUHA 1TQIA 4ENMA 3WTYC 5DD8A 3J80Z 3ZMDA 2BV6A 4KN4X 4UHTA 3R60A 4HV5A 2EFNA 4IVNA 3WGHA 2DK8A 4AIKA 1XGMA 2A6EF 2IVMA 1LJ9A 3B02A 2H6CA 4LLLA 1SAXA 3HOSA 1L0OC 3R61A 3D5LA 3NRVA 3SZTA 1TLHB 4L0ZB 3M8FA 1QPMA 3KFWX 1UCRA 5KVRA 2R7DA 3ECOA 1H9TA 1DPUA 1U6GA 2XAJA 1TW2A 2Q2EA 4PCQA 4U0YA 4I09A 2QYOA 3ZN0A 4RB0A 2KKOA 1BIBA 4IHTA 1ZG3A 3SHFA 2RQPA 4XLPF 3QRFF 3KP4A 5ILVA 3HTUA 3BP8A 3QAHA 4N9HA 4A2UA 4IF4A 3IRQA 3ABUA 5LRSA 1XSVA 2KJBA 4S04A 1RZ4A 2ACJA 4RAZA 5L3BA 1K78B 3M7GA 3LQRA 3ZMSA 3T8RA 5D6FA 2WV0A 4QLCU 3TO6A 2W84A 1QNTA 1GXQA 3W6JB 1J5YA 2XAHA 2H3JA 3JTHA 1D3YA 3K2ZA 2VBXA 2P5KA 2E1NA 2HQRA 3WTXC 1STZA 2OD5A 2F5CA 2JTVA 4ETSA 2JZYA 3LWFA 2UXNA 2EA2A 2Z99A 1KYZA 3G3ZA 1I6XA 1L3LA 3S2WA 2GIVA 3BY6A 2Z5UA 3W6KB 4HX8A 1FWZA 3QP6A 2PLYA 4FT8A 4PZJA 3F3XA 4KDPA 2IW5A 1PDNC 1U3EM 4M6YA 2RGVA 5DUIA 4A5MA 1BIAA 2Z3YA 1G6NA 1S7OA 3I58A 3QPTA 2VBYA 1KQ9A 4B09A 3ISPA 1KU9A 4EMSA 1TQMA 4XBFA 2GZWA 2PQ8A 4ESBA 2GWRA 4CO8A 2KJCA 1XN7A 3N4MA 2X0LA 2FSWA 1T38A 5LBQA 1BOAA 3IHUA 1KU7A 1ULYA 3MZYA 1BI3A 5LHHA 2CG4A 4LD5A 1LVAA 1SMTA 1B9NA 5L3EA 5TJJA 2HDCA 2MBFA 3TO9A 5F1RA 1Z05A 3F6OA 2OQRA 4U7BA 3WG9A 3MAJA 2JPBA 3ROUA 2TDXA 2Y75A 4ZH4F 1I1GA 3V7CA 3PQJA 5FGMA 1FYLA 1P4AA 2QQ9A 2IP2A 5IT3A 2DQRA 4KYWA 3VODA 3DPTA 3DV8A 1QZZA 3FM5A 2RKHA 5IT9K 1XGSA 2OU2A 1EH8A 2HOEA 1YS6A 2F5FA 1IAWA 3HTSB 4GCVA 4M9XA 4FX4A 4RGSA 2D1VA 2DLLA 4Y13A 4G6DA 3I71A 3KP7A 5K5RA 2P7VB 1IXCA 1IXRC 4S05A 1BM9A 3LSTA 4WK8F 2MH2A 2GA2A 2IA0A 2ISYA 3EYYA 1IUYA 3CUQC 2BYVE 4PGHA 1J7KA 4G7ZF 1ZYRF 2PI0A 4AIJA 2MLGA 3TDUC 1F9NA 1PUEE 3HYIA 3GFJA 2KRFA 4O3MA 4EV0A 3O3KA 1ZREA 2EA4A 5D8KB 4KFCA 2K5LA 2FBKA 1A04A 1YG2A 5HDKA 1ZRDA 3JAMZ 1GHCA 3ML6A 2FMYA 3KCCA 1G4DA 5LHGA 2K4JA 2DK5A 1MD0A 3K1PA 5FD5A 1WI9A 1R58A 4AIHA 2HKXA 2NYXA 1V3FA 4EJWA 3GWZA 3GUDA 4HW0A 2RC4A 4M74A 5JFRA 1JE8A 2ETHA 4M72A 1WSUA 1LEAA 3WTZA 3I0TA 4WXCA 1XB4A 3R0AA 4L5JA 5TRDA 4KICA 3GF2A 5E8GA 1Q1HA 3T5XA 1BJAA 4EVIA 1FLIA 3MFKA 1DUXC 2K4YA 1LEBA 1ZG1A 2HEOA 4MHGA 2DBBA 3F8CA 4MQVA 3C1DA 3FMRA 4BHCA 3KEQA 1IW7F 4FHTA 3P9CA 2P6SA 1SMYF 1YLFA 3GYHX 2Q8KA 4Y15A 4RGRA 4NB5A 2L54A 4G6QA 4OIPF 2K7LA 2FQ3A 2H09A 3WE2A 1HBXG 3M9AA 1HKTA 3GZ5A 4KIBA 3M1EA 2EK5A 1NHAA 2IPQX 3MCZA 3IKVA 2VODA 4BH9A 3VFZA 3L09A 4R1HA 5JVTA 1LDKB 2XAQA 3HOTA 4IRIA 2K4BA 1Z91A 3KLNA 3U1DA 5HOOA 1MJAA 3IC7A 4WF2A 2MC3A 5K5OA 2HTJA 1JHHA 2NNNA 2NNYA 4LGWA 3DFGA 5D5XB 5D6EA 1LDDA 1XMKA 5LGUA 4Q48A 4U0WA 1ZLKA 2PEXA 3KZYA 3ZMZA 2YU3A 3K69A 3HHGA 4RGUA 1PP7U 1UHWA 1O3QA 1XDSA 2FMLA 4P5OA 2QBYA 4FX0A 3DXJF 3D0SA 1QBJA 3MHXA 2IT0A 3WU1B 5DUKA 4GXOA 4UVBA 1USSA 4HDVA 3BDDA 5E20A 5DV5A 2Q0OA 4ON0A 3T1BA 3L00A 3VEPA 1EV7A 1EH6A 2RDPA 3K1NA 1QW1A 1WKMA 3IKTA 1SD5A 4OIRF 5HLGA 2P4WA 3ZN1A 2QZ8A 1U5TC 2DT5A 3U9GA 2NS0A 3CJNA 2A61A 4EJTA 3RIRA 3HSFA 3J80K 4EGYA 4HAMA 1O7LA 1B59A 1T0FA 3ZP5A 3WODF 4RB3C 1W7PD 4YFXF 4L9VA 5FFXA 2DPUA 3RDIA 1BN5A 3KE2A 1GVJA 4RGXA 2HYGD 2LX9A 2WC2A 2YR2A 3C18A 4I0AA 4AVPA 1LNWA 1JHFA 1FYMA 4LB5A 2ZMEA 3RYPA 1QVPA 4UVAA 2AXLA 4G7OF 3H92A 5HS9A 2XKPA 3QU3A 1LB2A 3ERED 4EJOA 4E70A 5F64A 3WE3A 2ZFWA 3SZPA 5J8FA 2J5OA 2Z9OA 1HW1A 2V1XA 4OMZA 3F8MA 4HQMA 4UV9A 2M1BA 5ILSA 3NQOA 1W5SA 5EEGA 5K1YA 1IN7A 2LF8A 3K9TA 5A2QK 1P6RA 4KA4A 4I02A 1R1UA 2MH9A 3FMQA 1FYKA 3CDHA 1TQPA 4OINF 3RKWA 4MTDA 4N9IA 3BROA 1G3TA 2D45A 2LNBA 4MTEA 1KU2A 2E7WA 1F1ZA 1JXSA 3GVAA 4LFUA 1YW8A 1ZRFA 2FBIA 1B4AA 5CVJA 1B1BA 4CXFA 1SD6A 4DQ2A 4G7HF 2XASA 4RB2C 1KGSA 2ZBKA 2ISZA 2OQGA 1OYYA 1B6AA 2VN2A 3I64A 4I01A 4JQFA 1E17A 4ZZDA 2HYFA 2STWA 5L3CA 4L9JA 2FF4A 4A0ZA 2W25A 3IWFA 1IF1A 4M6XA 4F7ZA 1FC3A 2O03A 4EM0B 2ZCWA 3MWMA 2IJLA 2PJPA 3F23A 2P7CB 3T8TA 2ZJ2A 4HOBA 5D4SA 3AAFA 3CUQB 3F8NA 2FOKA 1YIOA 4D0PA 4HA8A 2MD5A 2K27A 2XROA 1XDUA 2QWWA 4UUVA 4WXDA 4HQEA 2VOOA 2K86A 4IHSA 2A69F 1ONVA 3SFZA 3NEUA 4ZYDA 4HF2A 3F21A 5DCMA 2NAZA 3GW2A 1IN8A 3KP5A 4LG0A 4M73A 1H9GA 3J81Z 3RYRA 4MQ9F 2VC0A 2E7XA 1FP2A 4H0EA 1RUOA 1D8KA 5HDGA 2JRTA 3LAJA 2O8XA 5CVIA 1C0WA 2LDUA 4YFNF 5J6XA 2A3SA 4O5VA 1AOYA 2F5DA 1B9MA 3QU6A 1FSEA 4A12A 5HVQC 1S3JA 1BI0A 2W57A 1D8JA 4EQQA 3FMSA 1SFEA 3EQLF 2XGXA 3RJPA 4U7DA 3O2PE 2GCXA 2EV5A 1XSXA 4KMUX 2RNJA 1ZGAA 2VBWA 3BPXA 5BQTA 2YX7A 3K1MA 2P6TA 5DD4A 4OOIA 3GFIA 3GEZA 1U2WA 3E97A 4LK0F 1R00A 3RPUA 1K7AA 2DI3A 2QQBA 3IWZA 1MGTA 4UVCA 1ON2A 3I4PA 4P96A 1MZBA 3EDPA 4Q47A 4L5IA 3HRSA 3I54A 2DFIA 2V79A 1USTA 2MLKA 3RKYA 1IRFA 4PGGA 1S7AA 1R5GA 2M30A 2OAZA 2QUFA 1H0MA 1I5ZA 2FA5A 1YTYA 2FXAA 1O7FA 2M5WA 2V1UA 5CVRA 1R23A 1FX7A 1FSHA 4GYIA 2ESHA 4GGGA 4BXUA 3TDZC 2QM3A 1XSDA 1XGNA 5ILUA 4A5NA 3DQVC 2YSRA 4XSZF 3BJ6A 2G9WA 2DU9A 4ZYEA 2VBZA 2ZO4A 3P9KA 3WTSC 6PAXA 5LEKA 5IT9Z 3G73A 2WTEA 1HW2A 5LRRA 3EYIA 4A0XA 1F4KA 4UV8A 1HKQA 5DCFA 5H6RA 5L3DA 2DPDA 2EFOA 4JK1X 1YQAA 3E3VA 3E19A 1BC7C 3E6DA 3WTWC 3CO6C 5ICCA 3F8FA 3HRTA 5LEJA 5AIPA 4ZZLA 2O0YA 4EM1A 1D5VA 2D2WA 4XLNF 2V6CA 5ICGA 1WRJA 2KIMA 3MEXA 5HLIA 1UHMA 1YW7A 2FRHA 4CYDA 3C3WA 3ELKA 5E1XA 3KLOA 2W85A 2L4AA 1Z9CA 3PFIA 2HR3A 4IJAA 4KNYA 4KIFA 3F22A 3R0JA 2PG4A 2GXBA 4IPAA 3CO7C 4O6JA 4P9FA 3DPLC 1IN5A 1T6SA 3ULQB 2G7HA 2ELHA 4CICA 2VT3A 5E1ZB 2H6BA 2VXZA 1FNNA 4L18B 1LQ1A 1MDMA 1YYVA 1G3WA 4TV7A 1W7PA 2QVOA 4GO1A 2RVCA 2LKPA 4YIIA 3BZ6A 2JT1A 2E1CA 1YW9A 1ODDA 2VONA 4L9NA 4LMYA 3L2CA 4KIGA 3WTVC 5CVUA 3HHHA 4PDKA 5FFZA 2XRNA 4G8XA 3V8KA 3ZPLA 2EB7A 1W5TA 3JW4A 2XUBA 4LJZF 4HZFA 1ZH5A 2O61A 3HRUA 5BPDA 4OMYA 2ZNZA 5JI6A 2XV4S 2DQLA 4WX9A 1KYWA 1KQ8A 3WU0A 2K5FA 4IRHA 4BHPA 3RI4A 5F6FA 1W4MA 3JSOA 3C7JA 4G9YA 5FLXK 2XKOA 2P8TA 1IZ1A 1ZARA 3IRRA 2HGCA 4P9UA 1O3RA 5K5QA 1IN4A 5E1WA 3MZHA 3RTRA
chains in the Genus database with same CATH superfamily
3UR3C 1DDNA 3QJ6A 2TRTA 3UA6A 4CI0C 3L7WA 4CC4B 1GL5A 5KH6A 1WDXA 3RQ4A 4N0AA 5GAOp 1J9IA 5CJ9A 1WNLA 3H3VK 2B7EA 5B1BH 5KAFC 5CKEA 2F2XA 1ETQA 2A5YB 1MKMA 2DJNA 3QPSA 2V9VA 1ETOA 3HPHA 2COBA 3BW1A 1MNDA 2Y31A 4NC7A 5LJ5h 3TP3A 4DW6A 3KPHA 2X4JA 5D5UB 3CLOA 4NNJA 5GMKi 2E6NA 4M75D 2KRNA 1FP1D 3ECHA 1PCXA 5I2SA 5LJ3g 1YJ9T 3FHZA 5FLVA 1KSWA 3OYYA 2OJ2A 2R7SA 5DM7F 1TWFJ 3IH3A 3A0HC 3ZQFA 3N97A 2EIKH 5CAIA 4XRFA 5HDNA 1IXSB 4M7AB 3W2WA 4L0YB 5IHNA 5D5WB 3V8LA 2HKOA 3NWSA 5J3BA 3FXUA 4RG2A 2GAUA 5KYWA 1NPRA 3IAS2 3G4SQ 2BE5F 2DCEA 4MNUA 4HLYA 1GXPA 3K4MA 2EGAA 3S1RJ 4A4KA 4NQWB 1Z6TA 4B4CA 2JUGA 3HL2A 1JUSA 3CPWP 2GQVA 4F14A 3CCLA 5D4RA 3DU5A 1M1KR 1Z6RA 3E6CC 3JAMK 3JR9A 4EEFG 2DT7B 1R7JA 1M30A 5L23A 4KGZB 1MJBA 3D5RC 1WZ2A 3KZZA 3CCQI 1BB9A 1ZA2B 3GP8A 5EEHA 1Q81C 4BEHA 1FOKA 3EHRA 4A63B 1SAUA 2M45A 2E6ZA 2CW0F 5J4VA 1EH7A 3M1CA 4U87A 3HL8A 2ESNA 4R8HA 3M0SA 1SHGA 3JB9I 3AL0C 2I5UA 3I5UA 5DEQA 1WHMA 2YUSA 3DP7A 1KHCA 1KU3A 3GFMA 1J75A 2CH4A 1J0RA 2V1DA 3JRBA 3SJMA 1AWJA 2P0WA 4M78F 3BTLA 1RKTA 3U2RA 2RN7A 2IA1A 3HIFA 3E6MA 5HNFA 1QRYA 1FZPB 4LLNA 3J7AY 2MF2A 2F2VA 5EC7A 3E6BA 2NWMA 3ASNH 2EW3A 1JT0A 1C1AA 4HLXA 1T0FC 2XAFA 3OL4A 4M71A 4QQ6A 4XRMA 1GRIA 4J9CA 3KEOA 2H27A 4F17A 3O8HA 4XU2A 2ZXIA 3Q9VA 3FX3A 1F5TA 2COWA 4AWXB 3HOVJ 3BG9A 3LSJA 4PJOE 2PX9A 2L02A 1JUMA 3IAM2 4K2EA 4OAYA 2R5YB 2EQRA 4KN7X 2Y0MA 2AIRB 2BZYA 1QVGA 2O6GE 2KIUA 2HQXA 2QG9B 1S72I 4X6AJ 2CT4A 3NGPA 3RZDJ 3KETA 2DFUA 3V7SA 3IQLA 5BS6A 3OYNA 1LFPA 3DCFA 3DEEA 5E8IA 5CYVA 1YFHA 2KE9A 4M77B 3OIOA 1RNLA 3OOPA 4ZYHA 4RMNA 5EG0B 4EGZA 1AWCA 1HA8A 3ABTA 2LNVA 1VOMA 4FW1A 4M9ZA 2L8DA 3L2QA 3EG2A 2RV8A 2X35A 4HVVA 3CC7T 2QKLB 4FISA 4HV6A 1UFFA 1YS7A 2IVWA 4NS5A 1T56A 4HX4A 2XSDC 2K5CA 4OU0A 4MMLA 1P9QC 2WY8Q 2L7MP 2E65A 4OGCA 2QAZA 3I55T 1DQUA 2VE9A 2E1HA 5CIUA 2CUFA 1VTNC 2JUCA 1I1SA 1RAEB 3SDZA 3QUIA 1SD7A 2XSJC 4PSWA 3EG9B 4F16A 1GUUA 1K9MU 4IRGA 2K5IA 3S14J 3HHTB 3DF8A 1O4XA 3V8JA 3E5UA 2VKHA 2VQLA 1VQ5T 1R36A 3HSEA 1ZTRA 3BOQA 3ME9A 3VJPA 1JKQC 2QKMB 1X2MA 5AIQA 2LTPA 3FZVA 3REOA 2F4MB 1TWHJ 3LA3A 3O8GA 3C4SA 1Q86R 4GRIA 1ACIA 2DAOA 2O3FA 3TGNA 4ITVA 2KLOA 1XS9A 4IKFA 3BY7A 3ZMTA 3E9FA 8ATCB 4X1VA 2HVQA 2HQNA 2VKNA 1LVKA 3LL7A 1KONA 5CCAA 2JTMA 2L4MA 5HS7A 3BG6A 4ASNA 4DOZA 2M8EA 2P5LC 2CUZA 3H9QA 2LOOA 3OYMA 1RR8C 5A2QE 1P4WA 2E4HA 3JRDA 2GXAA 3KUFA 2JSCA 3OS0A 4KMFA 2QGFB 4BNCA 3REAB 5GAMj 1XMAA 5ED4A 1D0ZA 3QYHB 3CF2A 3LSRA 1SFKA 3GF5A 1R9TJ 1FBUA 3CBPA 1C6VX 1IC8A 2YPRA 1V29B 3VYHB 1TWGJ 2DMQA 2HDWA 2QENA 3GFLA 2B0LA 2D8JA 2ZPGB 1WQ2A 2L01A 1Q7YR 2WY7Q 4IQ4A 1OZ3A 3V4GA 3H3ZA 1B34B 2QDYB 3E2UA 4M78E 3LLRA 3RUXA 4ZYAA 5GMKh 1GLNA 4CYCB 1HCRA 2QA4I 2FD5A 2RB6A 3EETA 4G94A 4LG0B 5FLXZ 2WWYA 5J4YA 3HRMA 5DYMA 3DKYA 5B1AH 2P5VA 2BBYA 1E0EA 1IHWA 4M9SA 4C0ZA 2ADUA 2EV6A 1VQ4I 2MGQA 2VVKA 1OCZH 3RPQA 3M54A 3BTCA 3K0LA 3QPHA 3IV5A 2FX0A 1T8IA 1ABQA 5GAMg 3CC2A 5E18F 1H3ZA 1FBQA 2GBYA 3FXJA 1O3TA 3INZA 4B6MA 1XQHA 5FKOA 5H20A 3CCJI 3NWTA 3Q0UA 3ZXSA 3A1PA 5AONA 4ENNA 3BE3A 4HPQA 3JSPA 2CV2A 1WX6A 2X6OA 5IP9J 1E7OA 1SKUB 3HUGA 2F5TX 4HSTA 2OZUA 2PMHA 1IHVA 1S29A 1KA8A 2M87A 2HDAA 1RPWA 4XQFA 1PNJA 3HPWA 1XMXA 3O6BB 2MOXA 3ZL7C 1B07A 3J7AO 2ROTA 4XKCA 3GZ6A 1FT9A 2LSOA 2ZKZA 2WAQA 3R4KA 3CF5F 3LX7A 1FIAA 4A4EA 1C0MA 3A1YA 2CSOA 1JTYA 2W82A 2ZMEB 3KP3A 5FKNA 3FM3A 5C44J 3A4CA 2Z33A 2Y2ZA 4XK4A 2C6YA 1NLOC 2JPCA 1Z7UA 5BOXA 2DRMA 4RM2A 3RQIA 1YO5C 1P2FA 3TEDA 4YRVA 4N4HA 1JGSA 5IYCJ 2ZXJA 4MGRA 3CJQB 2DMNA 4KUIA 1BI2A 3S15J 3COAC 3FK7A 3CCSI 4K11A 4ENJA 3KP6A 2XF6A 3AKZA 1MDMB 1R5ID 2M8GX 4OMPA 4HBLA 4KT6A 2PUOB 3JSCA 4CZZA 2BY0A 3BJOA 2COYA 4R55A 2RQQA 4XNFA 4U0VA 3H0IA 5I21A 5DDGA 2BGCA 4IUVA 3JCMJ 1WHJA 4KT0E 1OQYA 2QLZA 3Q9SA 1HW5A 1WJQA 3LWIA 2KNBB 2EKOA 3RMSA 3CCMT 1VQ8Q 4QIWN 1U5TA 3T0YA 3MKYB 2ZMEC 2OCEA 1WJ5A 3C2HA 3GNGA 4M7AC 2LTOA 1VQOA 4PL6A 4L6V5 1M2VB 4ZDLA 2IRFG 1VFCA 4U88A 3LAPA 2NRAC 4OIQF 3OW2A 1XNIA 1JJ2P 2L9SA 1HKSA 4MIMA 4OB0B 3FF5A 1B3QA 1FOWA 2YT6A 3MPUB 5D8LB 4BHBA 4QTRA 3P9IA 3OYGA 1BBYA 1R22A 2BKDN 3SD4A 4AFQC 4CH7A 4A3EJ 5LFAA 3QYFA 2QXFA 1R1TA 1FBSA 2H1LA 3TVTA 4C92E 3JV3A 2VJ5A 3HG9A 1QWEA 1QGPA 2FOWA 4WWCA 5DTDA 3PUBA 4A0YA 2K79A 1CF7A 2IS6A 1ZA1B 1ZRCA 2M4KA 4B3XA 3OB9A 1QQJA 4A4FA 4M75F 5IYDJ 1M90U 3CMEI 5JR3A 4XN0A 1UGQB 2F5KA 4HF0A 2DODA 3PO2J 1UG0A 2FE3A 3OYJA 4R0KA 1RAHB 1X4PA 1XCBA 4FCYA 3ZGKA 4BU2A 1IO6A 3QDRB 4PJOC 5GAN3 3HDDA 2C0IA 2HWVA 4R79A 1MH3A 2E2JJ 2H1KA 2HZTA 2VYTA 4WXHA 1HQCA 1LDJA 3M0TA 2MI6A 1FY7A 3NTIA 3P8DA 4YELA 2D0NA 2HKNA 4V2GA 3HFNA 4ENKA 1TL8A 2PN6A 3QYGB 2ZCFB 3H3UA 4F7UB 4WCGA 1NTCA 2EBIA 3ZQ7A 3H0HA 3L1AA 1GV5A 3F0CA 1TBXA 4J6XA 3T9NA 1R5HA 3JRZA 5BPIA 1OYWA 3RERA 4ZDOA 1Z67A 3DKXA 3PSIA 5GADJ 2R7UA 3UF4A 2LF7A 1VQ4A 1K9AA 2RHXA 3GXOA 1ERDA 3EAEA 3H8ZA 3EG9A 4IX7A 4I0BA 2FNAA 3PL8A 4OIOF 2HZYA 4II1A 3WTTC 2ZPIB 2A08A 4Z88A 2L3DA 4C8QF 1Q86U 3FKJA 1KQ0A 1KQSA 1O9SA 1X1DA 1R1VA 2DA7A 4M7AG 4JPBW 2WAEA 4DA4A 1ENHA 1Q86C 1K0XA 2Y30A 3WVEB 3MKLA 1RUNA 1DP3A 3E5XA 3RCOA 3TO7A 1PKTA 3M56A 5GAN8 4ZN3A 1O57A 2FNPA 1HF0A 2DXUA 5HCKA 2VGMA 4HDUA 3D5SC 2NUZA 2RHZA 4PJLA 5L8RE 5HK3A 3VYRB 3M3YJ 4I7HA 1ZN2A 2NVUB 1IDZA 4EM2A 4OMQA 2GXGA 3VYGA 1X2KA 2YU9J 1ZSZB 2HAXA 3G7ZA 1BI1A 4PJ0C 5FKMA 1WJSA 1KC8R 1V5FA 2LRDA 3VOEA 4DYRA 3B6CA 3CCSQ 5KAIC 3G4ST 3HOYJ 1U78A 4XIDA 2R4GA 4E2FB 4MDWA 1QZYA 1HYOA 1OOTA 5A2QZ 4BDYA 2QBYB 4BACA 3EFOB 2DA2A 1E3HA 2HEQA 3H9JA 4J19A 5GPAA 5FJ8J 5TGTA 5HS8A 4C92A 1QA6A 1AT1B 2KVQG 3GIBA 2DE0X 2ESWA 3QQAA 5CQEA 1G3YA 3CCQT 2A6HF 3PFYA 1UE9A 4RTYA 2A37A 4M75E 1QZEA 5J8CA 2VXEA 4J6WA 2EYXA 3CC2Q 2A68F 3FXOA 3WGIA 1S7EA 4B44A 4A4HA 1BW6A 3TCJA 1F36A 4RAGA 4M7AA 1ETXA 4CRIA 4QVZA 4KUMA 1FYNA 1ZSZA 2MAMA 4EMHA 3P7NA 4WTOB 1W2BA 2XF7A 5DCMB 1HSTA 2EV0A 1TC3C 3ULRB 1G3SA 5GAOq 1ETYA 3BTIA 2M7AA 3QZ9B 3N05A 3G4SI 1NJIU 4NBQA 3CUQA 5HK0A 1IO2A 1RL2A 3HKSA 3HP9A 4M78C 3CJTB 1J2XA 2EIMH 4JBAA 3HOWJ 1XGOA 2DKGA 2RI2A 5GAN4 1K73U 1ZSGA 2FBHA 1E3OC 1FTZA 1BYMA 2JVGA 3LSHA 2V8IA 4YIFA 1WJEA 2DW4A 1OYIA 1LPQA 2HOSA 3OSGA 1XX5A 1XOVA 1UG2A 1SFUA 3HBLA 3EFOA 2QYZA 2V1NA 3VV0A 4E4HA 4XSXF 2CP5A 2EQKA 2M02A 1PYVA 3TOAA 4UUSA 1YWOA 2AHJB 1IGUA 1MBFA 1B34A 2DBMA 2E3HA 4MZTA 3QOPA 4IOCF 4ZGJB 4RMOA 2I10A 2FJ1A 4Z2YA 3I59A 4Q5WA 2QQ8A 3CD6A 2ZNYA 3O5ZA 2DO7A 2JWTA 3F72A 4AD9A 1VQ6A 2O4XB 4Y91A 2STTA 2WAQN 1ZK8A 1MMDA 4PJJA 4RAYA 3J81K 3EGDB 2LVSA 3OMGA 4M7DB 1QO0D 2X6XA 5FD6A 1VA7A 1G2BA 1SVOA 3LFKA 1TP4A 5CLSA 3I55I 4OP0A 1YI2A 2DL4A 1K79A 3RKXA 4L9TA 1OPCA 1EKEA 2XVCA 1G2HA 2JJ9A 2V8JA 1TTYA 2HNHA 3F8BA 1YIJA 5CVVA 3C94A 1BR2A 4M7DG 4DJAA 2WSFE 4RUGA 4Q5SF 4ESFA 1MJ9A 1ZSZC 1RACB 5LJ3d 4HNUA 4EJVA 2COMA 2W24A 4I2OA 4C0GA 3KYDB 3ZMVA 2PFBA 4JX6A 5ICFA 4HX7A 5J47A 5KYYA 5F1JA 2Y4YA 2L9VA 2BEOA 3S2HJ 1D09B 1YJNA 3CC4I 3A8GB 1T98A 4JRIA 5LHIA 4FE7A 2MIOA 1X3WB 3ABLH 4OVAA 3PNYA 5GAGJ 1REPC 3I55Q 1RLQC 2R7FA 1XD7A 2ATCB 5JHUA 1SRMA 5LGNA 1S6LA 1P4XA 2V9KA 4A93J 1QVGS 2F2EA 1EFNA 1K8AU 3JTGA 1I50J 1SSFA 1DPRA 1V76A 2KIFA 2NS8A 4M7DA 2J5PA 2VOPA 3M0PA 2DTRA 4PLLA 4C9YA 2DA5A 3CCYA 3TKYA 2VV5A 2KZVA 4OB1B 4LNPA 4C8QB 3BPVA 2EH3A 4ME7A 3J7ZI 5LJ3h 2AXTC 1IZ6A 2EJRA 2HTSA 4X34A 3QP5A 4A6DA 1APLC 2GGRA 1IN6A 2Y90A 3MEVA 2DIGA 3ZR8X 2XHKA 4LB6B 2CUBA 1AVZC 1ON1A 2CFXA 2LD5A 2EQMA 1U5TB 3CCLT 3MQ0A 3LNQA 1YI2T 1MBHA 4X9DA 3OIQA 1UB9A 1LE8B 4PJOD 4UXNA 2K02A 3WGGA 2OA4A 2XK0A 3TOBA 1VQOT 2ZAEA 1OMIA 3JCMW 2GFUA 1HD3A 1CF7B 1TNTA 2ZJRF 1O75A 1R0BG 4V2SA 2ICWG 2RREA 1U06A 4F55A 1B8IA 1OV3A 3DBHB 4CCJA 3CMEQ 2VASA 2XKOC 4M78G 1VQPT 1KQ2A 4CGZA 2L89A 4LD9K 1BC8C 2D5VA 3C12A 2ECZA 1RI7A 4HYEA 3JRIA 2EWNA 2IAIA 1YHQA 4XKVA 5KHDA 2H94A 3VB2A 1D1CA 3OYAA 2FL7A 4MEXF 4J01A 1W7PB 2ZZDA 5KK1A 4CYCA 1YJ9I 2VJ4A 2J6OA 3I56I 4P55A 5HNHA 5D5VB 1MSFC 3VS5A 1XJWB 3GOXA 2BHYA 1VQLT 3PQKA 1POGA 2IA2A 2J7IA 2GLOA 2GA1A 3VSKA 2OTLT 4FW2A 3FXKA 1T39A 1OCOH 3GLXA 2JA5J 3L1PA 1UECA 3U21A 2HS5A 4YG2F 5FKLA 1DP7P 4ORZA 5KYNA 5GMKl 2BZXA 1P92A 4ZNXA 2YX4A 3LA7A 2BOLA 3HEFA 4LLGF 2EFQA 3CUOA 2NVXJ 3CC7I 1JXMA 1TTHB 2PUKB 2X1DA 3K70C 1NYGA 2MA3A 2IS2A 3S3OA 4OMNA 2XDBA 3JCMh 1H8KA 3NPFA 2M9HA 2XIGA 1S1NA 4UNOA 1WI7A 3FRNA 2I2LA 2FZGB 2KDZA 1S8NA 2E5ZA 1SFXA 3BJAA 2DX1A 1OCTC 3FC3A 1BR1A 2CP7A 4M7DE 3NHNA 2HBWA 2QDLA 4XU0A 2DDBA 1ZUYA 2V26A 1TW3A 3IUOA 3OV8A 3B6AA 4BQAA 3QHSA 2BY2A 4C92C 4B8XA 2RK1A 1N8RC 3TW6A 3IL2A 3DKWA 2FRWA 2GFAA 2VT2A 2A07F 3MP1A 1N6AA 3C2GA 2FYKA 2JVHA 2X4WA 1BOBA 5ERIA 3V7RA 3QZ5B 5FW9A 3R6SA 3E5QA 1Z1DA 2R7XA 1A0NB 1YN8A 5LJ3f 2CJJA 2WBMA 1K4TA 5K7FA 2X4XA 3JCMd 3DEUA 2PVGB 4JP0A 1X1AA 3I9QA 3FIWA 2JMWA 4YFKF 4BY1J 3EH1A 3WHCA 2M2EA 3M8EA 5IPAA 1VQ6T 4C2UA 1Y1WJ 4OB2B 3AG3H 2CQKA 4I98B 5KCMA 5FB2A 2G6FX 1K83J 2ABLA 2LCSA 3THKA 1UGPB 3OYHA 1AZGB 1S5LC 2E12A 2J6FA 2JM9A 1GT0C 4RTXA 2L7KA 4HCBA 2RHIA 2OTJA 1BA5A 3LQQA 4RB1A 2HI3A 2LK2A 2DYRH 2Y48A 3LFUA 4BAYA 1RUWA 4XICA 2G3RA 2N8GA 3BFMA 4LUEA 4PJOG 1YIJT 1VQLQ 1HXDA 2OTLA 1WHLA 2A3LA 2EPDA 4N0BA 1KD1R 1NE8A 5J1UA 1VQ5Q 2VJIA 1NEBA 2R3SA 2VC1A 4BQOA 4DNCA 1UFMA 1LJOA 1UB4A 3PM1A 1ZAOA 3LSIA 3LOCA 1IRGA 4RCBA 1O3SA 3G71A 4OMLA 5ICEA 3I53A 5HLHA 4HF1A 2DA3A 5B66C 3LH5A 2HKQB 1SVLA 3EGDA 4II2A 3WTUC 2D1HA 1UJ8A 2IXSA 2K3FA 4GYGA 2UWMA 1BW5A 3F9KA 2PTKA 2YSQA 5EJCA 1Y0UA 2BTTA 2X4HA 1CGPA 4P5NA 3VS1A 2OZ6A 5GAMe 1B72A 3AG2H 2QTVA 4A54A 2OC6A 3CCST 1X3UA 5FO5A 4M75G 2P84A 4IHXA 3A01A 3AFHA 2TCTA 1D5YA 1E2XA 1Z7LA 2FEZA 4C2MJ 2HBPA 2R93J 4XLCA 2EJ9A 1T2KA 3I5SA 2EIJH 1WWXA 5L3GA 1DU0A 1M2VA 2QEXA 4QWQA 5BMZA 3G2BA 3K4BA 4XM3A 4E7SA 1RI9A 4NOYA 1A6IA 1U8RA 4CHUA 4Q4ZF 1RIOH 4BYYA 3FXRA 4BXXJ 2HNIA 2Y69H 3CMET 2SEMA 3A8HB 3CP8A 1K78A 1S72Q 4DZJA 2BVMA 1SVMA 5E3OA 4YTLA 3S3MA 1KHIA 2VQCA 4RS8A 3EG1A 1W2BP 3FWEA 3SQNA 4BS9A 2F5VA 4GDFA 5L3FA 2JRMA 3I59B 5H6QA 4ESJA 1VQ7I 2UUZA 1TT0A 2LP5A 2R5MA 2M0MA 2PJRA 3H5NA 5F27A 2CGPA 3GTKJ 3HTRA 3QIIA 2FU4A 5KYWB 1ZLJA 4IXAA 4MEYF 2R7WA 3B73A 3BG3A 4IL6C 5LGTA 5C6SA 1VQ4T 2ZXWH 2EFWA 3DWLE 3L9FA 4A6EA 1XCVA 5M5WJ 1WFXA 2DTHA 1FPQA 1OCRH 1HK9A 3K4KA 1QQIA 3HB9A 4NQWA 1E6HA 4EMGA 4KH1B 1YI2I 1SG5A 3BWGA 3ZMUA 3PGGA 2CO5A 1J09A 3FXQA 4NC8A 2VL8A 1EIFA 2PMUA 1HJDA 1SD4A 2UXXA 3BC8A 1A35A 1J59A 4LDYA 3P5JA 3MVPA 3TQNA 1PM3A 1X4OA 5CKDA 1WZOA 3ZQQA 5GAOm 2JMCA 3FBNB 4F3QA 1CSKA 1W6XA 4M3BA 3ZEHA 4DYQA 5LLQA 3JRFA 1IREB 4AMCA 2XGEA 3KEYA 2QSFX 3F6VA 1Y6IA 4PJNA 2DBKA 5GAEJ 3ER0A 5F0HA 3G71I 1ZG5A 1K6OA 4XTYA 3GX4X 4EJUA 2PBIA 1I5OB 2XAGA 1U9NA 2DD5A 2LP0A 3Q5FA 1WXUA 1HSJA 3OS2A 2R7ZJ 2BE7D 4J9EA 2CU7A 1ETVA 1N9SA 1QVFA 1PP8F 1TXQA 1PSFA 3JB9D 3KIOA 5DM6F 1K6YA 1TNSA 1VQ9T 5LJ3j 4HXJA 4Z8AA 3I56A 1W5CC 2B8AA 1WIEA 1ZGJA 2K9SA 5FU6C 1PVEA 2OBPA 1R6RA 3KP2A 4BQQA 1G83A 3SEMA 2F5EA 3J80E 3TU4K 4B48A 1OR7A 3SXYA 3GO5A 3CC2I 1M5Q1 3QSUA 3EUAA 4ZYGA 2EVRA 1K0SA 1ZHFA 2YXYA 4DBQA 4Y28E 2FZKB 2DMUA 4XOPA 4CDGA 4JLIA 5ECAA 1KQ1A 2UZKA 4KT5C 2XPVA 2KT8A 3PIOA 4LK1F 3CTAA 2RJDA 2CWEA 4JJDA 2G7UA 3FEOA 2EFPA 2WSCE 4RTTA 2AS5F 2MK5A 1T33A 1I07A 3L42A 5LL6S 5E17F 2QQAA 2LKXA 1UEBA 1V4RA 1KG1A 2QQRA 1M1EB 2FG0A 4C3HJ 1Y96A 2KMTA 1I27A 1VF9A 4FM4B 2XC7A 3HSRA 2CYYA 1OKRA 3LA2A 4Y17A 2HFHA 4XR6A 2LCLA 8AT1B 2XDDA 3QWXX 1J3TA 2VE8A 2EZKA 3OYCA 3C95A 2GQQA 4J7IA 3BR2A 4NHJA 3CCMQ 1VQ8T 3G1JA 1JXOA 2YUNA 2NVTJ 2AKKA 1V5GA 3EUHA 1IB8A 1TQIA 4A3JJ 3UPUA 2VUMJ 3NFCA 4ENMA 2DK3A 3WTYC 2F4OB 5DD8A 1WHHA 3CCUT 2HZDA 3J80Z 3ZMDA 2BV6A 5GAOn 3ERMA 4KN4X 3PIPF 3GTMJ 1CKAA 4M77G 4D9JA 4J83A 2DL8A 2NYSA 3I56Q 3CCVA 4E7ZA 2VUBA 1MMNA 3X24B 4UHTA 1SPKA 4ANJA 2LREA 3NAUA 3R60A 4HV5A 4BJ6C 1VQ7A 2EFNA 4C8QD 4IVNA 1GCQC 3WGHA 1ZQ1A 2COZA 1JTXA 2IGKA 1JBMA 2ELKA 4CCKA 2DK8A 4DYCA 1KK7A 3FLGA 5IH2A 4AIKA 1TWAJ 4ABZA 2W10A 3EH2A 1XGMA 4QSHA 2A6EF 3R6NA 1UMQA 1WA7A 2ZB9A 5IHKA 2IVMA 1LJ9A 2E71A 3B02A 2H6CA 1I81A 4LLLA 1VQOI 1U8BA 2H3EB 5LJ5j 1SAXA 3GTQJ 5GAMh 3H9NA 3PVQA 3HOSA 4PUSA 2K9NA 1L0OC 2VQGA 3R61A 4A3IJ 2A36A 2V9PA 1WFWA 3RDVA 3SB2A 4BXFA 3D5LA 3LMMA 3NRVA 3SZTA 2EQIA 3UATA 1D0XA 1TLHB 4C0DB 3OL3A 3Q3SA 2DTIA 3M8FA 4L0ZB 3OS5A 1QPMA 3KFWX 3LSGA 1UCRA 4B43A 5KVRA 2R7DA 2AKLA 1WH7A 3ZCOA 3ECOA 1H9TA 5CPRB 1DPUA 2J6KA 2BVLA 4ELZC 2CQQA 1Y7XA 2DETA 2O7OA 2KDOA 1U6GA 1I6HJ 4ESRA 2A28A 2KPMA 2GBQA 2XAJA 5H2FC 2V8KA 1MUZA 1MNEA 1TW2A 1TZLA 3LSPA 2B9SA 4XL9A 1RRJA 2Q2EA 4JS5A 1Q82C 3HSBA 1QHHD 4PCQA 2WSEE 2YRDA 2Z0WA 3VRYA 4U0YA 4I09A 2QYOA 3GCMA 3HXLA 3OSVA 2KT1A 1ZX6A 2IIMA 4ELYC 2R92J 3HOUJ 3ZN0A 2ZJQF 4RB0A 2JTEA 2LC4A 3A5ZB 4FU6A 2KKOA 3SFIA 2WAFA 1BIBA 4IHTA 4FETA 2D9TA 3SFMA 1ZG3A 2EZLA 2RQPA 3SHFA 4XLPF 2A0FB 3I56T 3QRFF 2KFDA 3KP4A 2OTLI 3BLYA 2X9DA 3ZOBA 3HOXJ 2E60A 5ILVA 1LNXA 4J7FA 4OF1A 2XB0X 5DY9A 2C0TA 2E2HJ 3HTUA 4AYBA 1T0JA 1OEBA 1M1KU 3BP8A 2NUTA 3KXTA 2IGMA 2LZ6B 2RK2A 3QAHA 1MMGA 4N9HA 4A2UA 1VYVA 4N4GA 2CQ7A 4IF4A 3IRQA 3ABUA 4XKWA 3CC7Q 5LRSA 5EDNA 3A01B 2RD1A 2YWWA 1MNMC 3VS4A 1IXDA 3VS7A 3VSLA 4OMOA 1XSVA 2BZTA 3A98A 2ZGWA 4RA2A 1FTTA 1QVFS 2KJBA 4FYWB 3JB9G 5EYRA 1OCCH 1RLPC 2CZ0B 3LYIA 4N4OB 2B86A 2FHDA 4VUBA 3ASOH 4S04A 2Z2SB 1RZ4A 2ACJA 4RAZA 4C8QA 5L3BA 3O8VA 2OTLQ 1K78B 2CREA 3M7GA 1FMWA 3BZKA 3LQRA 5EG2A 2HD0A 1RAGB 1AKHB 3ZMSA 2DA6A 1WQ7A 2QI2A 2OTJQ 3T8RA 5D6FA 5FRMA 2L3PA 2WV0A 3HGGA 4M7DF 4QLCU 3TO6A 4PFZA 4BUGA 2W84A 1QNTA 4MMKA 2ZFUA 1WGSA 2E5KA 1GXQA 4KH0B 2Z16A 2LDMA 4HVWA 3W6JB 1J5YA 1KD1C 2K9LA 4CCNA 3QBYA 2XAHA 1VQPA 2EPFA 5E3LA 4Y7NJ 2M34A 1X01A 1U1SA 2H3JA 3NMZC 3JTHA 3DEWA 2GNCA 3WXMB 4LE9A 2WB1N 3A8LB 2D6FA 1D3YA 1MMAA 3OW2S 1M8VA 1RC9A 2KSSA 4MZMA 1UHSA 4F92B 2W0ZA 2X6YA 3K2ZA 2VBXA 2P5KA 1XPXA 2E1NA 2HQRA 3UNGC 3WTXC 1CQTA 1MHNA 3VU3C 4ATOA 4A3DJ 1PRMC 3RESA 1STZA 2OD5A 4M7AD 1YITT 4Z02A 1M3AA 2F5CA 2YRCA 2JTVA 4ETSA 2JZYA 4N0AC 1Z9QA 2CFOA 2XGCA 2QSGX 2E70A 5EG0A 3CCMA 1YJ9A 3LWFA 1M4ZA 2UXNA 2ZPHB 2EA2A 3I35A 2Z99A 1KYZA 3G3ZA 2AQFA 3MEUA 3CCVT 5FWCA 1OULA 2CW7A 3TBIA 3K7AJ 4XRSA 1I6XA 1SC7A 3S2WA 1L3LA 2GIVA 3BY6A 2GQIA 2P4TA 3GBGA 4QPOA 1ZBJA 3CCRA 3MZ8A 2YLCA 2Z5UA 3CBMA 2M16A 3I4NJ 3W6KB 4HX8A 1FWZA 3QP6A 1X3ZB 2JN0A 2E5QA 2PLYA 4M75C 4BY6B 4JS4A 4FT8A 4EPCA 1VQ4Q 3JAME 4QQDA 3ZQGA 4RBOA 4LIVA 4PZJA 2Y4XA 4FT2A 3S2DJ 3SEZA 3F3XA 5FROA 2XGDA 4KDPA 1AU7A 1VQNA 1WH5A 2L7ZA 4AFZC 2IW5A 3FBIB 4XU3A 3EUHC 4BY7J 5BNGA 1PDNC 2FUG2 2CP0A 5C4JJ 1U3EM 1TG0A 1TWCJ 1UHFA 5GANj 3DTIA 2LQKA 4AG2C 1KIKA 1I39A 3MEWA 3WVDB 3K4CA 3EFSA 4HT9A 5LJ5g 4M6YA 3DLLF 3FDRA 2RGVA 4DIQA 1OU8A 1ZGWA 4D7NA 4Y92A 5DUIA 4A3LJ 1BL0A 4FTHA 4LOCA 3H1CA 4A5MA 6AT1B 3D1NI 1BIAA 4M77E 2DYBA 2Z3YA 5GP9A 1G6NA 1S7OA 1LCKA 2HOAA 5A0DA 1QVFP 5CKTA 3SWNB 3I58A 5JHFA 1BKBA 1OX8A 4JYKA 4PFPA 2XB5A 3QPTA 1QCNA 2VBYA 3AT1B 1KQ9A 3BG5A 1QPIA 4D7MA 4M78D 3CMAI 5GAN6 5J39A 4B09A 3ISPA 1KU9A 4M77D 3OYLA 4M3DA 3S1QJ 2EGEA 4A3CJ 4EMSA 1ZUKA 5CK9A 2VI6A 3MO8A 1GFDA 4RG8A 1TQMA 4XBFA 2GZWA 3CCLI 5CR2A 2PQ8A 4ESBA 2GWRA 2K9QA 4C3JJ 3HGYA 3W3CA 2X48A 4CO8A 4HNTA 3LGLA 1K9MR 2KJCA 4ZJZA 4IUPA 1XN7A 3CCRT 5IT9E 4B47A 1VQOQ 1AWXA 5GANe 3CDLA 4M4ZA 1SF9A 4L5EA 5CKFA 3N4MA 2X0LA 2MC4A 3M8JA 2FSWA 1OPKA 4PK4A 4LG3A 1T38A 4J9IA 5LBQA 1BOAA 5M9OA 1UZCA 3IHUA 3JCMX 3I55A 4BB7A 2RQVA 3RPUD 1VUBA 1QKWA 1KU7A 5F0FA 1AWWA 2LJ0A 1ULYA 3MZYA 1BI3A 5LHHA 2CG4A 1JKRC 1VQ7T 4LD5A 1LVAA 1SMTA 4A3MJ 2JQ7A 1B9NA 1Y07A 1Q1VA 1W2BS 5L3EA 5TJJA 2HDCA 2RQWA 4FT4A 2V6EA 1X1BA 2R7QA 2JA2A 3PUFA 3ZQLA 4QPQA 2MBFA 1Q81R 2QEXQ 2DFEA 2VB6A 3TO9A 2DOEA 1FMKA 5F1RA 1Z05A 3F6OA 2FEIA 2O2OA 4D8KA 5EZHA 1M1FA 2YDLA 3CC2T 2OQRA 1NZ9A 2KYBA 1IJWC 3CCUQ 4U7BA 3U1KA 3WG9A 3MAJA 2LJ3A 1Y56A 2JPBA 4ZN1A 4C2TA 4LDVA 4DGWB 2O31A 2RF0A 3ROUA 5J26A 5KYYB 2TDXA 4XU1A 3OW2P 1DGRM 1YI2Q 2Y75A 4ZH4F 1I1GA 2R5ZA 1PUFA 3V7CA 3OR2C 3PQJA 1OZ2A 3ZBDA 3VKIA 5FGMA 1FYLA 1P4AA 2OAWA 2QQ9A 1QU3A 2IP2A 2QK0A 1NJIR 1TOVA 4MZPA 5IT3A 3D7SB 4BQNA 2O9LA 3GLLA 1VQKA 3RNJA 1KQSS 3BDLA 4OMFB 4PJMA 2DQRA 2XMFA 1Y1VJ 2M4GA 4KYWA 2HVRA 4IOAF 2L5QA 1SANA 3VODA 4F91B 3DPTA 3A8MB 3DV8A 2CZ6B 2E41A 2IS1A 2KK4A 2EFIA 1VQLA 4M6VA 1QZZA 1MV0B 3FM5A 2RKHA 5IT9K 2DDAA 2AT1B 2RMOA 3PNWC 1XGSA 1Q95G 2CSQA 3FDYA 2E36A 2OU2A 3GZNB 2JM8A 3ASKA 2QA4Q 1EH8A 1A31A 4LD6A 2HOEA 5C3EJ 2EYYA 1VQNT 1YS6A 3E1SA 1SSHA 2F5FA 1IAWA 2VXFA 1YITA 2DMOA 3HTSB 4GCVA 5JVGF 1Y39A 2L2OA 3KYCB 4M9XA 2BUDA 2R57A 2C06A 3DPUA 4FX4A 4RGSA 3JCMP 2D1VA 2DLLA 2BE9B 2CH4W 1WPKA 4Y13A 2XI9A 4G6DA 4EMKA 4D8DA 2Y9YA 1X19A 2MSYA 3I71A 3KP7A 5K5RA 2RNGA 5KE3A 2CP6A 3JCUC 2JSPA 1DJ7B 3AG1H 2ENMA 2P7VB 1IRZA 1H641 3VUBA 5E3MA 1IXCA 1F43A 1IXRC 3G6EI 2BW3A 3J7AF 3QPLA 4S05A 1BM9A 3LSTA 4RM3A 4WK8F 4LDXA 2MH2A 4UY8I 1YBYA 3M5AA 3VS3A 2GA2A 2LC2A 1PC0A 5A0GA 2IA0A 2XU8A 3QJYA 5DM7R 3CCJA 3WU2C 2ISYA 4E7LA 3EYYA 1AKHA 3CUQC 2BYVE 3A2KA 1IUYA 3TW7A 4F93B 4PGHA 5CQGA 1GBRA 1J7KA 4G7ZF 2JT4A 2H8WA 2X4YA 1ZYRF 3REBB 3S6WA 4UB8C 1GDTA 2DEUA 3S93A 2PI0A 2QEXT 4AIJA 3PVLA 2MLGA 2XRLA 1JKPC 1R4MB 1MGQA 4F7UF 1VNDA 3TDUC 1F9NA 1PUEE 3CP2A 3HYIA 3R6OA 1W1WE 3GFJA 4BEHB 1K8AC 2KRFA 1XC5A 4O3MA 2VKEA 4JJCA 4MFDA 4R56A 4EV0A 2L9RA 3O3KA 2DNUA 2LMJA 1ZREA 1Y71A 2CP2A 2CT3A 4C0DC 3MN2A 2EA4A 3OS1A 2M9UA 5D8KB 2ID3A 3LSMA 2KROA 4JX5A 4KGVB 3CCJQ 2FPFA 1K8AR 4E7KA 4KFCA 2D1XA 2K5LA 4JJNK 1VQMQ 2FBKA 1A04A 2JS0A 9ATCB 4Y3OA 1YG2A 5HDKA 4PSXA 1ZRDA 3K4LA 3E9GA 3JAMZ 3H6ZA 1GHCA 4M75A 5IHIA 1ZBXA 1YJWA 4H4KC 5IOYA 3ML6A 2FMYA 3KCCA 1G4DA 4J9HA 4ZGDB 1S72T 2LQNA 2KRCA 5LHGA 4I6ZA 3GTJJ 1X1PA 2K4JA 1FEXA 1X6GA 2LQWA 2DK5A 4IUUA 4RTUA 1YHQQ 2Z1DA 1MD0A 1GCPA 3FIFA 3K1PA 5FD5A 2L2PA 1WI9A 2LQ8A 4IUTA 1R58A 1VQ5I 2VQHA 3CXCA 5FWBA 2OX7A 4AIHA 3META 3PMIA 4F7UE 1RKWA 5CKHA 3DB4A 1R8OB 1YWPA 2KI7A 2HKXA 2DTZA 4TVRA 4NDLA 3TREA 2KZGA 2DEQA 1OR7C 2NYXA 1V3FA 4EJWA 1OX9A 3JCMe 1BJZA 3GWZA 3QOEA 1E6GA 1QP2A 5IXFA 3GUDA 3MMYB 4HW0A 4C8QE 2RC4A 2KGTA 3BQZA 5A0LA 3CD6T 4M74A 5JFRA 1JE8A 4PJOF 1R0CB 2ETHA 5F08A 4M72A 2HPMA 3MKWB 3URGA 4X0GA 4IIOA 1LFUP 1NBEB 2BXZA 1WSUA 1SEMA 2PQWA 3KFVA 1LEAA 3WTZA 2FZCB 2RHYA 4C92B 2X1EA 4C92G 3I0TA 4C30A 2YUQA 3DBRB 2YHTA 4WXCA 5KE2A 2DL7A 1XB4A 2X3WD 4QQGA 2QA4T 4YIRX 3SZGA 3M57A 5GPCA 1BK2A 3R0AA 1YRNB 1A5JA 1VI0A 4L5JA 3FJPA 2DXBA 5TRDA 4KICA 4D1QA 3RKQA 1X2NA 3K10A 3GF2A 5E8GA 2EYWA 4RTVA 1Q1HA 5CQYA 4EIKA 5HKCA 1K73C 3T5XA 5FU7C 1BJAA 2LJ1A 4M77F 3CEYA 4EVIA 1FLIA 3MFKA 1DUXC 2K4YA 5DLOA 1LEBA 1H3HA 1ZG1A 4J9BA 2HEOA 4MHGA 2DBBA 2HOTA 3F8CA 4XRSG 4AC0A 4MQVA 1MBJA 4IEJA 4KITB 3JB9F 2O01E 3C1DA 3MP6A 3FMRA 3M9QA 3CD6I 2CGHA 4BHCA 1BCOA 2OF7A 3KEQA 5FLMJ 1WPYA 4FE4A 4FSXA 4PKCC 3LWHA 3UWNA 1IW7F 4FHTA 3P9CA 2P6SA 1SMYF 1YLFA 4RAFA 3GYHX 4CC2A 1JJ2S 2Q8KA 5GAMd 3AHUA 3MD2A 4Y15A 1WJCA 1NM7A 4RGRA 4NB5A 1D1AA 1HDPA 2L7FP 5GAN2 2L54A 1QCOA 1VQ8A 2LT1A 5HY6A 2DT6A 2OTJI 4G6QA 2FRYA 2LT4A 1IV6A 4GBQA 2GOMA 4BI8B 2EQJA 4J00A 4CCOA 2DMPA 2JW4A 4XORA 3BDUA 2O88A 4CA0A 4OIPF 1PRLC 3M0UA 4S0HB 2A05A 1VQ9I 3CCMI 4ZTJA 1PUFB 2K7LA 3SDBA 2EBPA 2WV1A 2FQ3A 2H09A 3WE2A 4HCKA 2HDDA 3W2AA 4LXCA 2CW8A 5K7HA 1VQ6Q 1HBXG 3CD6Q 2HMAA 3FKIJ 3M9AA 1HKTA 3S8PA 3GZ5A 1K9MC 1ZUUA 4C5EA 1I1JA 4ZDPA 1N77A 3H9GA 3M1EA 4KIBA 3W6VA 3GTLJ 2VC8A 2P81A 1WVRA 3CCVI 1YITQ 2EK5A 1NHAA 2IPQX 3FXMA 2LY9A 2Y0SA 3FHNA 3MCZA 2M0CA 1RAIB 2DTOA 2K3BA 2KAFA 1MBGA 2P0QA 2WACA 3IKVA 2CQXA 2QA4A 2MMPA 2EAYA 2VODA 1ITYA 2O9VA 4C8QC 5LD2C 1NG7A 4BH9A 1R49A 2R7VA 1Q7YU 5GTHC 2LNHB 2E1OA 2CMPA 2O9SA 1T0HA 4KJZA 3BR0A 3VFZA 2R5ZB 2JA7J 3L09A 4R1HA 5JVTA 2XPUA 3BCBA 1YJWI 2DD4A 3Q1JA 2VLAA 4IUQA 1LDKB 1OPLA 3FB9A 2XAQA 4J5YA 1G5VA 1XTDA 2AQEA 2LYCA 5GMKj 1JRIA 2DXCA 5I22A 2X51A 3CPWS 2FPDA 2YLBA 3HOTA 3NTHA 1HOMA 1WHUA 1Z21A 2DL3A 4IRIA 2K3XA 1NH3A 2K4BA 3TSWA 4BI4A 1Z91A 3C2BA 3KLNA 4F52A 1JKOC 2K2VA 3U1DA 1WJFA 4JOMA 5HOOA 1MJAA 3IC7A 1F1BB 4WF2A 4J9FA 2RJFA 1X2QA 2MC3A 5K5OA 4G12A 2UV1A 4HG2A 2E64A 3MP8A 2HTJA 1JHHA 2NNNA 1M2OA 1LKXA 3OYFA 2NNYA 2JXBA 2KQWA 3H35A 1ORKA 4LGWA 5B3SH 1NJIC 3DFGA 4XOTA 3PJRA 5D5XB 5D6EA 1LDDA 2K57A 1XMKA 4M3GA 1HDDC 1Z3XA 1YJNT 4CSWA 3JB9J 4AG1C 1YJWT 1U5SA 1EZZB 1G59A 4LITA 5IXBA 5LGUA 4Q48A 2NUPB 1NG6A 4U0WA 1ZLKA 2BXYA 2PEXA 3BR3A 3KZYA 3ZMZA 2L9NA 1W36C 2YU3A 3HJEA 1WHKA 3VS0A 3K69A 2KRHA 4PLIA 1M90R 1YJ9Q 5FRNA 1UJ0A 3SWNA 1OISA 1AEYA 3HHGA 3KZIC 4RGUA 3RR6A 5K7ZA 1PP7U 5F04A 2DOFA 1UHWA 1O3QA 1NEGA 2JA6J 3GTGJ 5GMKe 4LIUA 1XDSA 2CUEA 4XLFA 5M5XJ 3CC4Q 2BY1A 3EGXB 2FMLA 2GTJA 4P5OA 2GTOA 2RI5A 2DFHA 2LY1A 2QBYA 1CKBA 1UGSB 2EYQA 4FX0A 3WG7H 3M58A 3DXJF 1OQKA 1VYTA 2F4IA 3D0SA 2W7NA 1QBJA 3MHXA 2KP6A 2IT0A 4EMKC 5C0MA 3WU1B 1EF4A 4QKUA 5DUKA 4GXOA 2F48A 4CC3A 4UVBA 3I9V2 1SEUA 1USSA 1VQLI 4HDVA 3HFOA 3EGUA 2XIDA 2F69A 3BDDA 2OPTA 5E20A 3VYTB 1AHDP 5DV5A 4XLEA 2JA8J 2Q0OA 4DBHA 3PSFA 2RI3A 4ON0A 3T1BA 1K61A 3L00A 1LUJB 3EUKL 1HLVA 1UJYA 3M0QA 3VEPA 1EV7A 1RESA 2OV7A 2QSHX 4XK8E 5GMKm 1X1CA 3CZ6A 1AWOA 2GF7A 2JNGA 1RADB 1EH6A 2RDPA 3DTKA 2W00A 1UTIA 3I5RA 3K1NA 1QW1A 1WXBA 3OQ5A 4OB3B 4V2FA 1WKMA 4AT1B 2CKKA 3L2UA 3KX2A 3IKTA 1SD5A 1X69A 4JJBA 4E7HA 4A4GA 1VQKQ 4OIRF 5HLGA 2P4WA 3ZN1A 2QZ8A 4GLMA 1U5TC 2X1CA 5GAOr 4PJOB 2RQTA 4E6KG 2XPWA 2DT5A 3VWBA 2JS2A 2PZ1A 3CCEI 2GM4A 1TH7A 3RBBB 5FKKA 2DL5A 3G71T 4D5CA 1YJWQ 3SDGA 4XTUA 3F70A 1VQNQ 3U9GA 2NS0A 3CJNA 3ZQHA 3GMEA 3M59A 3QYBA 1VYUA 2DIQA 2A61A 1M8MA 4HEA2 4EJTA 2H8HA 3RIRA 2O4XA 3HSFA 3J80K 2EGCA 1IDYA 3OYKA 3CCUA 3H5RA 4EGYA 4HAMA 1O7LA 3L2ZA 1T0FA 1B59A 4XQ3A 3ZP5A 3CLQA 2ZSHB 3WODF 2VPRA 4RB3C 1YCYA 2HL3A 5GAMf 1W7PD 2O5RA 4YFXF 4L9VA 5FFXA 4LDUA 2QQSA 1RETA 2DPUA 2ZXHA 1S9HA 4JRPA 3A0BC 1ZKGA 3RDIA 3QXEB 3MKZA 4FYXB 3X20B 3G6ET 1TWBA 4UC4A 2KL4A 2RAEA 4Y33A 1N8RU 1VQ6I 1BN5A 2J05A 3ABKH 3KE2A 1GVJA 4RGXA 2QF7A 1ZR4A 4JRQA 5HODA 2OAUA 2HYGD 2LX9A 2WC2A 3TEEA 5GANg 4XTVA 1OJLA 3CC4T 2QTXA 2JOYA 1I3AA 2VXDA 2LKSA 2YR2A 3LH0A 2R7RA 3C18A 3A03A 1QHGA 4I0AA 2F1LA 4PJOA 1X43A 3VS2A 4AVPA 1LNWA 1M1GA 1V54H 1JHFA 1FYMA 1KZHA 4LB5A 4HRIA 3CPWA 1W0TA 2ZMEA 3L2RA 1NK2P 5KCOA 2HSEB 3RYPA 1QVPA 4DBFA 3H0FA 3DTEA 4UVAA 2AXLA 4A53A 4G7OF 2EINH 3H92A 5HS9A 3OYDA 1VQPQ 2LBFA 3GTOJ 2XICA 9ANTA 1KFZA 2EKHA 3G6EQ 4HSRA 2XKPA 1T95A 3QU3A 3M07A 1VQMT 3G1OA 2DOAA 3GNFB 4PNOA 3RMQA 2ECCA 4XKBA 1VIEA 1WHGA 4B1RA 4HT8A 3Q0VA 1LB2A 2FO0A 2MCNA 2JJ7A 2MD0A 3ERED 4DOWA 1ABOA 2DO3A 2DERA 3E7LA 2ECBA 5LJ3e 4BI3A 4EJOA 5LJ5e 4E70A 2KDSA 4DOVA 1TUGB 3M53A 1Z0XA 3LSKA 5F64A 4V19K 2DYSH 3WE3A 5J1RA 5LJ5d 1V1CA 4WCIA 2ZFWA 3SZPA 1LFBA 5J8FA 1Y0NA 1G8XA 3H0GJ 2DXIA 4HKEA 2J5OA 2Z9OA 2DAQA 4C5GA 3CCQQ 1N27A 3N5BB 1HW1A 2HQAA 2LMDA 2V1XA 2M51A 4OMZA 1I0CA 4J9GA 1YITI 3CCVQ 1ARKA 3F8MA 5GANf 4HQMA 3EPZA 4UV9A 4CCMA 2K7AA 1Q82U 2AK5A 3BZCA 1BBZA 4DBRA 2M1BA 2KY9A 2EZHA 5ILSA 3UKGA 4C92D 3HM5A 1VQKI 3NQOA 1V55H 2RJEA 1W5SA 1GBQA 2X85A 1PD0A 2DVJA 1H8AC 1P7JA 1UDLA 5EEGA 5K1YA 3HKZA 1IN7A 2KRMA 2LF8A 1KC8U 3K9TA 5A2QK 4RTZA 3PTAA 1P6RA 3PNTA 3K6GA 4UB6C 1M3BA 2R7TA 4AUXA 4KA4A 2NS7A 1YX5A 3AG4H 2VPLA 2LX7A 4I02A 1R1UA 1FIPA 2IPOB 1N25A 3CCRQ 4HCCA 5HLTA 2E35A 4G6TB 1SRLA 2MH9A 3M55A 2R0QC 2EQUA 3FMQA 4BY6C 1JU5C 4HCZA 1OU9A 2NUPA 1U3OA 1FYKA 3CDHA 5KYUA 1YJNI 1OLTA 1UGRB 1TQPA 3HC7A 4N4NB 2RJCA 1EA3A 1IV8A 5GAOl 1KJWA 1RABB 1WJRA 1M27C 4II3A 2ME6A 2ZJPF 4OINF 1WGXA 2ME0A 1TT5B 4P1WA 5M3MJ 2QGUA 2KT0A 3RKWA 1K4SA 4MTDA 4N9IA 1RAAB 3K4JA 3BROA 3FXLA 1G3TA 2LNBA 2D45A 1NYFA 1TU0B 4MTEA 2DJZA 1KU2A 2E7WA 1W0UA 4OMMA 1F1ZA 2ZC2A 3A8OB 1D3BB 5J3LA 1QMCA 3PE0A 1P7IA 3TL4X 4IO9F 1JXSA 4J6YA 3GVAA 4C92F 3JRCA 1X6BA 4LFUA 1YW8A 2IGNA 4MFEA 2P0KA 4FYVB 2V7FA 1ZRFA 2CUDA 2FBIA 1B4AA 2HXOA 3LGFA 3CQZJ 1U0JA 5CVJA 2OTJT 2KYMA 1B1BA 2HQEA 4CXFA 1TS9A 2X6WA 2F6CA 3OWTA 3S1NJ 2EIFA 2QASA 3CCEQ 2HYJA 2CUJA 2E2IJ 2HQ5A 2MABA 3E0JB 2EILH 1H88C 3EFRA 2E1MC 2LRQA 4QT7A 2DA1A 4FL6A 5KYXB 1SD6A 3CCEA 1X27A 5KYXA 2R7OA 2K85A 4DQ2A 4G7HF 2L3QA 2XASA 4JZ4A 4RB2C 1KGSA 5GTIC 2ZBKA 2ISZA 4LDWA 4F7UG 5EZGA 2I8DA 5IOZA 2OQGA 1OYYA 1B6AA 4BE2A 1ZHIA 2VN2A 3I64A 4BKXA 4IQJA 2NVQJ 4I01A 4JQFA 1E17A 4ZZDA 1W1FA 2VWFA 2HYFA 2STWA 4DZPA 2HXIA 5L3CA 1HC8A 1RI0A 3FISA 4JDSA 1I3QJ 4L9JA 4I99C 1K76A 1WJDA 2KXCA 3EGXA 2V4JC 2FF4A 3FJ5A 4A0ZA 4M77C 1SHFA 4ZGEB 2W25A 3IWFA 1IF1A 1YRNA 3DB3A 4M6XA 4M7DD 1NPPA 4F7ZA 2CYZB 2RQUA 2G0EA 1LPLA 2RHUA 3CMAT 1FC3A 1XG1A 2O03A 4EM0B 2ZCWA 3EHQA 3MWMA 4J8OA 3CCET 2IJLA 3CMYA 2PJPA 5J40A 1A36A 3CQTA 5EEAA 3GBQA 3F23A 1ZQ3P 2P7CB 3EG3A 1S72A 4ZTFA 3T8TA 2ZJ2A 4HOBA 3K70D 3S32A 2K9GA 5D4SA 3CXCS 1GVDA 3AAFA 2QGGA 2E10A 3CUQB 1Y8RB 2MWPA 3F8NA 2FOKA 3BT9A 2Q2EB 2LCCA 3BG7A 1IRXA 1YIOA 4D0PA 4HA8A 2MD5A 3VDXA 3UT1A 1QVGP 2K27A 2XROA 1XDUA 1PG5B 2QWWA 3JCMg 2DILA 2WB1A 3SYTA 2P4RA 2HPIA 4IZZA 1AZEA 4C3IJ 4WXDA 4UUVA 4HQEA 1KC8C 1W4SA 2VOOA 1I5LA 4B9XA 2MWOA 3CCLQ 2A5WA 2K86A 3QWLA 4IHSA 4A3BJ 2A69F 1VIFA 4XONA 2PNIA 1ONVA 1YX3A 3SFZA 4UUSB 4Y52J 3NEUA 4A3KJ 3OYEA 1U9OA 1AA7A 4ZYDA 4HF2A 3KYLA 2ID6A 2DXTA 2FPEA 4FYYB 5GJWB 3F21A 5DCMA 1HSQA 1N9RA 2PVOB 1DU6A 2NAZA 1TSFA 3G4SA 3GW2A 1IN8A 3KP5A 2CS3A 4LG0A 4CUGA 3OSFA 5D6YA 4M73A 3TSZA 1H9GA 2OCCH 2NLUA 3J81Z 5E3NA 4NC6A 4A69C 3RYRA 3K4NA 5F0CA 1H89C 2PJRB 2JUFA 4MQ9F 2XDPA 5D7UA 5IAYA 2PMZN 2VC0A 2E7XA 4HNVA 1FMVA 2DMTA 1N8RR 2ED0A 2ELJA 2K40A 5JLXA 4IIMA 3QKJA 3NTKA 1FP2A 4H0EA 3ZQIA 1RUOA 4KULA 4XTXA 1D8KA 5HDGA 2JRTA 3HUGB 3LAJA 2O8XA 2DZCA 4MO7A 4PFOA 5CVIA 1NG2A 2RO0A 3M0RA 3CMMA 5AYFA 1YFNA 5M3FJ 3SWNC 4BE1A 1YP5A 2IEKA 1C0WA 2LDUA 1MV3A 1ZLMA 3OBWA 3QYEA 5IY5H 2A6TA 2DJIA 2M0OA 3JCMf 2FQ4A 4DEYA 4YFNF 1JI8A 3J81E 5J6XA 4B3AA 1FXXA 1GXIE 1LE8A 1WYXA 4CZCA 3HOZJ 2A3SA 3CC7A 3JRAA 3OA6A 1PSEA 2BZ8A 4O5VA 3PT9A 4A3FJ 1AOYA 1JT6A 2CSIA 1IGNA 3VYUB 2F5DA 2IS4A 1B9MA 2IGOA 3OIPA 5IYBJ 3QU6A 1FSEA 2KQRA 3IP4B 1D1BA 5HVQC 1S3JA 4A12A 1I4K1 4N4IA 1BI0A 1Q82R 5IP7J 1RR7A 2L3SA 2LY2A 2W57A 2CDTA 3M4YA 3QODA 1XTAA 2WADA 1D8JA 3CPFA 1KD1U 4EQQA 4KRTA 4W97A 3H0DA 3JRGA 4KBMB 3FMSA 3S16J 1SFEA 5B5EC 5FU7B 3EQLF 3S3NA 2X3XD 2PMZA 2XGXA 4YEJA 3JREA 4RTWA 3RJPA 1YHQT 2W4SA 4U7DA 3O2PE 2GCXA 3L2WA 4RLFA 2EV5A 2LVMA 4X9CA 4BJ5C 5KNLA 1XSXA 1M9SA 4KMUX 2I0NA 2LH9A 5J1YA 4M78A 4M7DC 2RNJA 1VQ8I 4C0FA 1ZGAA 5DS9A 3OYBA 2VBWA 2DA4A 4XTZA 2NOJB 3BPXA 2DLPA 2KRSA 2RH2A 4RCCA 2J06A 1VQKT 2EYZA 5BQTA 2YX7A 3U23A 2DPPB 4M7AE 3S17J 3K1MA 2P6TA 5DD4A 2GOXB 3G71Q 2VJJA 4E7IA 3X28B 3CMEA 4B9WA 4OOIA 4FSSA 1AHJB 2CS7A 5IN1A 2VKDA 3GFIA 3GEZA 2DVEA 1U2WA 1VQ5A 1FJLA 2JMAA 2VIXA 2VKVA 3QG1A 3E97A 2ZPEB 4LK0F 1D3BA 1R00A 3S1MJ 4C5HA 3RPUA 1BR4A 1K7AA 2DI3A 2QQBA 3HKZN 4JX4A 4E7JA 1JB0E 3IWZA 2C0OA 4JRKA 1FOXA 1MGTA 2DM1A 4UVCA 1ON2A 3I4PA 2K2MA 4P96A 4AM3A 3TQ7P 1MMSA 1PJRA 2HVSA 4MDXA 4BGDA 2JTFA 4OWRB 3VPRA 2AZVA 1B7TA 5KYUB 1Z9ZA 1I8FA 3WHBA 4Y4RA 3NARA 1YCSB 1M3CA 3DKMA 1MBKA 1R4NB 3BR5A 1MZBA 1NLPC 2VGNA 3OSSC 1QVUA 4M3EA 3EDPA 2XD0A 3VYSB 1VQ7Q 2CZ1B 1LOJA 1V5EA 2EJGA 2F2WA 4Q47A 3CMAA 1OI1A 2RM4A 1QLYA 2EZIA 4L5IA 1B8IB 1WJAA 4GY5A 3HRSA 4M75B 5D6WA 3I54A 2DFIA 2V79A 1USTA 1WLPB 2V1QA 1PD1A 2MLKA 3RKYA 1IRFA 4PGGA 2KEAA 2DN0A 1S7AA 2BHZA 2MW8A 4J9DA 1R5GA 2M30A 2Y0SN 2OAZA 2QUFA 4AU7A 1H0MA 4E47A 1JEGA 1I5ZA 5CQXA 2KIQA 1NK3P 1UGVA 4OAZA 1X75C 3HZJA 2QEXI 2YUPA 3OBYA 2FA5A 1YJNQ 2IBDA 1YTYA 2FXAA 3HPGA 4A3GJ 1O7FA 4GLKA 2MG4A 2M5WA 3JCMb 1YIJI 2M7BA 2V1UA 5CVRA 1R23A 2LBFB 1FX7A 1FSHA 2ZPFB 1WQWA 4GYIA 4QVDA 2ESHA 5FLXE 4GGGA 4BXUA 3TDZC 4D5FA 1TUDA 4AFUC 2QM3A 3CBOA 1XSDA 1E3PA 2NOGA 4KUDK 1XGNA 3BCAA 4X1EA 5ILUA 1PKSA 5GAHJ 3UDCA 4A5NA 1M90C 3DQVC 2YSRA 4XLAA 4XSZF 4L5GA 3BJ6A 2MPXC 3PMTA 4KISA 4UUTA 2G9WA 1MSEC 3JCMc 3CXCP 4FASD 2DU9A 4ZYEA 2VBZA 3ABMH 3ONQA 2ED1A 2OI3A 1PWTA 1DGWY 2KMUA 5JLWA 1VQ9Q 2X9HA 3JCMQ 5EF6A 2ZO4A 3SEQA 2Y9ZA 2BIVA 4M3FA 3P9KA 2D8HA 1GCQA 1AOJA 2LR8A 3OMYA 1ETKA 2EJFA 2XF5A 3X2QH 3WTSC 6PAXA 3PFSA 3CCQA 5LEKA 5IT9Z 3G73A 2WTEA 4IHYA 1HW2A 4OGEA 5GAN7 1Y0MA 2NVYJ 2ZSIB 3BR6A 5LRRA 3EYIA 4A0XA 1F4KA 3GTPJ 1N78A 2R5AA 1B72B 4QW2A 4BBSJ 4UV8A 1YE9A 1Q7YC 1HKQA 2V1RA 5DCFA 3SHWA 5H6RA 5L3DA 2DPDA 1JO8A 1QP3A 5DLQE 5EGOB 4BD3A 2LFBA 1WCMJ 2EFOA 4JK1X 1YQAA 2KR3A 4LUDA 3G6EA 1IGQA 3DLMA 1PHTA 1TUCA 1MBEA 1FOYA 3CJRB 3E3VA 3E19A 3VS6A 7AT1B 2DRKA 1M1KC 2LLKA 1UAAA 4D6WA 2JZ2A 3JCMV 1X58A 2YS9A 4RLQA 3OR1C 3I4MJ 1JJ6C 1BC7C 2HCKA 3E6DA 3WTWC 1BCMA 3X26B 5I11A 2AO9A 3CO6C 2RNAA 1QWFA 3V42A 5ICCA 1OYXA 3F8FA 3HRTA 2YUOA 5LEJA 1ACMB 4M78B 5AIPA 3RSNA 1K4US 1QVTA 5TISC 2DYIA 4ZZLA 2D0QB 3A02A 2RQRA 3LW5E 4AYBN 3PO3J 2E34A 4HVUA 4EMKB 3RZOJ 4FIBA 2O0YA 4EM1A 3AL0B 1D5VA 1X6OA 2AZSA 1OFCX 1K73R 1JGGA 4IURA 5D6XA 2D2WA 2L0KA 4XLNF 2V6CA 3CCJT 4RKUE 5AT1B 5ICGA 2KBTA 2M0YA 1WRJA 4NL2A 2KIMA 3MEXA 1N5ZA 2K3PA 5HLIA 1UHMA 1Y57A 4NUBA 3MJXA 1YW7A 1IG7A 3H5AA 2FRHA 4CYDA 3C3WA 1UUEA 3ELKA 2HU9A 2HQHA 2K6DA 5E1XA 5GANh 3IH4A 3OYIA 1UHCA 3KLOA 4RDUA 1VQ9A 2W85A 2FVUA 2L4AA 1Z9CA 1W70A 3PFIA 2HR3A 5E79C 2Q1ZB 3X25B 4KGXB 2H8RA 4IJAA 3W2VA 2P0PA 1YIJQ 2E3IA 3TMOA 2R5YA 4KNYA 4ZC3A 3M4OJ 3EG0A 2XG8D 3QWYA 4KIFA 3MKDA 3F22A 1YHQI 3R0JA 5I2MA 1ZELA 2KHMA 2PG4A 3PIOF 2IG0A 2GXBA 2CV1A 1D0YA 2RN8A 4JZ3A 2PU9B 4IPAA 3CO7C 4IHWA 2NUTB 3P8BB 4O6JA 4P9FA 2ZPBB 4M77A 3DPLC 3CDIA 4IHVA 1IN5A 1T6SA 2E1MB 3ULQB 3QDFA 2WA0A 1MW7A 3ZRGA 2G7HA 3BTJA 2ELHA 2LG4A 3K2AA 4CICA 2CZ7B 2RA2A 5KCHA 5GANd 2AHQA 2VT3A 1UG1A 1Y8QB 5E1ZB 4CCLA 3QO3A 2H6BA 2E5NA 3PIPA 1AD5A 3JB9H 2VXZA 1FNNA 1MH4A 4L18B 4W1UA 2W1OA 1LQ1A 3OY9A 1MDMA 3CESA 3KBGA 1Z77A 2E19A 3P8HA 2NXNB 1YYVA 1T3LA 3ZQCA 1G3WA 1JJ8C 4XTWA 3CCUI 2SRCA 4TV7A 3ZFJA 4I76A 1EX4A 1W7PA 2QVOA 4GO1A 1EJ9A 2RVCA 1VQNI 2LKPA 2XDVA 3BZ6A 4YIIA 1JQQA 4JUVA 2JT1A 5GAN5 1UELB 3CMAQ 4DEXA 2E1CA 2K3YA 1JUPA 2PVDB 4XLHA 4XN3A 1YW9A 2BY3A 1ODDA 2CH0A 2OJED 4L9NA 2VONA 2FB7A 4LMYA 4BJTA 3L2CA 4CC7A 2DJQA 4KIGA 2HL5C 3DBLB 5CKBA 1QKXA 3WTVC 5LJ5f 2DFFA 3MEAA 4L59A 1ETWA 3HHHA 5CVUA 3CC4A 2BW3B 2HSPA 2QCOA 1A6QA 4EDUA 1VQMA 4XMYA 4PDKA 5FFZA 3PNVA 2W48A 4LN2A 2XRNA 4G8XA 2JN6A 3ESWB 3V8KA 2M3AA 2EB7A 3TP0A 3ZPLA 2L0AA 2CV0A 3M4GA 4Z6YA 4EATA 2KISA 3VRZA 1W5TA 3OOUA 1ZR2A 3JW4A 4C5IA 1W36D 2XUBA 1RAFB 1WI3A 4LJZF 1VZ0A 2MFZA 3G1LA 3H41A 4HZFA 2GIZA 1SFOJ 3L2VA 2RPNA 2JVVA 1ZH5A 2O61A 2OUMA 3HRUA 3DLLA 5M5YJ 1T08B 3VUZA 5BPDA 4OMYA 5IP6A 2ZNZA 4BE0A 5FU6B 1KQSP 3CCSA 4BDZA 1YNZA 3G1MA 1N75A 2K9MA 4F7UA 1WXTA 3MCAB 1VQPI 4Z89A 5JI6A 5GJVB 4AVZA 1Y96B 3BR1A 2DA9A 2XV4S 2DQLA 4WX9A 1GFCA 3FK6A 1MIJA 1OCPA 1R71A 1KYWA 2CRGA 1KQ8A 3IH2A 1K1ZA 3I3LA 4E6RA 1GV2A 3WU0A 2JK3A 2K5FA 4IRHA 1IUFA 3JRHA 4NL3A 1WJBA 4GFBA 3OMCA 4C8QG 4BHPA 4AIDA 3RI4A 4JLGA 3DLAA 5F6FA 3UA7A 4F04B 1W4MA 3BQYA 3C7JA 3JSOA 3CCRI 4G9YA 1Z3YA 4XAXB 3GPLA 4M7AF 5FLXK 2XKOA 2YRVA 2A7YA 1QCFA 2CP3A 2CQNA 2P8TA 2MYSA 4BBRJ 4BL0B 4BUPA 4QVCA 2O8KA 2B63J 1IZ1A 1ZARA 3IRRA 1H92A 2KXDA 2HGCA 4P9UA 2ROLA 1Q81U 4MLOA 3DU6A 1O3RA 3C0CA 1JJ2A 5CO7A 3J7YJ 3H36A 4AFSC 5EGOA 5K5QA 1U1TA 1IN4A 5E1WA 1BU1A 1YOVB 2M1HA 2DZ9A 4FQGA 3MZHA 3Q0WA 2DF6A 2L3RA 2XHCA 1T3SA 2R58A 1VQMI 2XAUA 3RTRA 5C4XJ 1R77A
chains in the Genus database with same CATH topology
1DDNA 3QJ6A 4CI0C 3L7WA 5KH6A 4N0AA 5GAOp 1J9IA 5CJ9A 1WNLA 5CKEA 2A5YB 1MKMA 2V9VA 3BW1A 5LJ5h 2X4JA 5D5UB 3CLOA 5GMKi 2E6NA 4M75D 1FP1D 3ECHA 5I2SA 5LJ3g 1YJ9T 3FHZA 3OYYA 5CAIA 3N97A 4XRFA 5HDNA 1IXSB 4M7AB 4L0YB 5D5WB 3V8LA 2HKOA 5J3BA 3FXUA 4RG2A 2GAUA 1NPRA 2BE5F 4MNUA 4HLYA 1GXPA 4A4KA 1Z6TA 2GQVA 3CCLA 5D4RA 1Z6RA 3E6CC 3JAMK 1R7JA 1MJBA 3KZZA 3GP8A 5EEHA 1Q81C 1FOKA 2M45A 2E6ZA