5CVIA

Structure of the manganese regulator slor
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
PNKEDYLKIIYELSERDEKISNKQIAEKMSVSAPAVSEMVKKLLLEDLVLKDKQAGYLLTKKGQILASSLYRKHRLIEVFLMNHLNYTADEIHEEAEVLEHTVSDVFVERLDKFLNYPKVCPHGGTIPQHGQPLVERYRTTLKGVTEMGVYLLKRVQDNFQLLKYMEQHHLKIGDELRLLEYDAFAGAYTIEKDGEQLQVTSAVASQIYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SloR structure and DNA binding studies inform the SloR-SRE interaction in Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
molecule keywords SloR
total genus 60
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cviA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cviA02
5DCFA 3QPHA 4IPAA 5JI6A 4WCGA 3F3XA 3F6OA 3HRMA 3MEXA 4B09A 4HW0A 4E70A 1O3RA 3MZHA 1O3SA 2OD5A 1R1UA 1HKQA 4YFXF 4HF2A 5D6EA 3JW4A 5K5RA 2DI3A 3ISPA 3GEZA 5LEJA 2L02A 2NAZA 3BPVA 3PQJA 3RYPA 1S3JA 1K7AA 3I59B 2ESNA 1TW3A 5JHUA 1IXSB 3V7CA 1KYZA 2PI0A 4I0BA 2W57A 4HX7A 1I5ZA 1TNTA 4MTEA 2FMLA 4ZZDA 1IN8A 1TTYA 2WTEA 3RYRA 1BC8C 1LVAA 2FE3A 2HWVA 4UNOA 1SD5A 2XVCA 5CLSA 2JTVA 2P6SA 4KNYA 4P55A 3I71A 2TDXA 1B9NA 4OIOF 4ENKA 4HX4A 3CO7C 1T0FA 3VODA 4MQVA 4YG2F 3GZ6A 3R6SA 3MHXA 5HS7A 1ZH5A 5HS8A 4H0EA 1IUYA 4TV7A 1XSDA 3E5XA 2IP2A 4L0YB 1SFEA 1YS6A 1ZGAA 4MTDA 5KVRA 1CF7B 2XHKA 2MH9A 1QBJA 3R60A 1S7AA 2GWRA 4HQEA 2BV6A 2IPQX 2XKOA 1LQ1A 2XV4S 3SZTA 1EH6A 3T5XA 3KP5A 4CO8A 1IN6A 4NB5A 3BROA 3EQLF 3HRTA 1J7KA 3KLOA 2ELHA 4RS8A 1DPRA 1Z9CA 4EM0B 3M9AA 4BHPA 3SXYA 3DXJF 5FD5A 4RB1A 1BI1A 5CVUA 3HHHA 3MZYA 2STTA 1DPUA 3I4PA 5ILVA 2PMUA 4A6DA 2ZKZA 3VEPA 5ED4A 1P92A 2COMA 2FXAA 1T98A 1R36A 5F64A 1IZ1A 4EM1A 1J2XA 3TO9A 2BE5F 2W85A 3WGGA 2P5LC 3RI4A 5D5VB 4Q48A 4PCQA 5L3CA 2CQKA 3I54A 4Z2YA 2DW4A 3F21A 4ON0A 5DDGA 3TO7A 2STWA 2G7UA 2QQAA 3CTAA 1T38A 3TOBA 3FWEA 3T8TA 2ZNYA 5ICFA 2VBZA 2EA2A 2V6CA 1O57A 2DK8A 2DO7A 3CUOA 3G73A 1E17A 2GCXA 3IKTA 4GXOA 4PGGA 2C6YA 3KCCA 5K5OA 2ZJ2A 3IWFA 3MQ0A 4M73A 4ESJA 2NNYA 4M9SA 3WU1B 1FP1D 4QWQA 3WGIA 3T0YA 4CGZA 3GFLA 1P4WA 1MJ9A 1S8NA 2LDUA 3QPTA 2HOEA 4G6QA 2BBYA 2PQ8A 4ENNA 3M8EA 3DKWA 4OIRF 2V1DA 3P9CA 2LKPA 1XD7A 2YSRA 2MA3A 4U0VA 3JSOA 1WQ2A 1B59A 1PP8F 1XCBA 3C1DA 3MAJA 2UZKA 1CGPA 2PBIA 2FNAA 1ZYRF 4KMFA 2Z3YA 3OOPA 2P6TA 2D2WA 2NNNA 1GVJA 2DAOA 3PQKA 2MC3A 3U9GA 2JPCA 2DPUA 4LD5A 5E1WA 1RZ4A 3JAMZ 2W84A 2XGXA 3ELKA 2HEOA 3BJ6A 5ILSA 2VE9A 1FZPB 3J7AO 2VT3A 1HW2A 1DDNA 4PZJA 1USTA 5BPDA 1UCRA 2EFPA 3IRQA 5TRDA 1DP7P 5E1ZB 3BOQA 3EUHA 4MEXF 2Q2EA 4OMZA 2XAFA 4WF2A 3DPTA 3LAPA 3RIRA 3BJAA 1SFUA 4HX8A 2E7XA 1W7PB 4M74A 3L09A 2FOKA 5BOXA 1IRFA 3GFIA 1FC3A 1I27A 1BI0A 1K79A 1Q1HA 2V79A 3KETA 2NS0A 2DPDA 3HOSA 5CVJA 3BP8A 2MBFA 5HLGA 3J80K 3FF5A 3KP6A 2CW0F 2O03A 3IHUA 1FT9A 2OQGA 1LDKB 2HKXA 1GHCA 3S2WA 4EMSA 1FWZA 4LB5A 4I2OA 2MLGA 1O3TA 2RKHA 1T39A 2QQ9A 1FSEA 2E1NA 4P9UA 3EETA 1C0WA 4O5VA 4OU0A 2YPRA 3RPUA 4A0XA 3ZMTA 4AWXB 1RIOH 4PDKA 1FYKA 2JZYA 1UHMA 3GUDA 1R1TA 2RN7A 3E97A 1STZA 3F8FA 2W25A 2QZ8A 4XLNF 5LGTA 1ZRCA 4HDVA 2XAGA 1IN5A 1AOYA 3E19A 2HKOA 4RAYA 3CO6C 4Q4ZF 1IW7F 3COAC 2VBXA 3KLNA 4YFNF 3CLOA 2RQPA 5E8IA 2WV0A 1KU3A 3CJNA 4KICA 3QRFF 3BDDA 1BOAA 3F8CA 1L0OC 2X4HA 3ABTA 3JAMK 1YLFA 1XMAA 3C7JA 3RJPA 4CXFA 1HXDA 3ZMDA 4HV6A 4OIQF 2F5FA 1XMKA 3GX4X 1J59A 3JSPA 1G6NA 3RKWA 4MNUA 2H09A 1ODDA 2GXBA 1BM9A 2FEZA 2FBHA 2OU2A 5ICGA 3R0JA 4QLCU 1G3WA 2EB7A 4UXNA 1QPMA 2E1CA 3HSEA 2EWNA 1R00A 4A2UA 3V7RA 2ZMEB 4RB2C 5CVRA 3LQQA 1FP2A 2G9WA 2G7HA 1HKSA 3E6MA 1SMTA 3K9TA 5LHIA 4ENMA 4KN4X 2L54A 5BQTA 5FLXK 2MH2A 4DQ2A 1L3LA 4MHGA 1ON2A 4GYIA 1I1SA 2PJPA 3OV8A 4M6XA 2O61A 4R8HA 3HHGA 4HLXA 5D8KB 1OYWA 2M45A 4AIHA 5H6QA 5BS6A 1RI7A 2GZWA 1W5SA 2QWWA 4ESBA 2QLZA 2B0LA 2K86A 3K0LA 4I98B 2DQRA 4CZZA 3QOPA 1JXSA 3GZ5A 4L18B 4FX0A 1QZZA 2V1UA 3V8KA 5H6RA 3M8FA 5ERIA 4HF0A 3T1BA 5DCMA 1FYMA 3IWZA 2CFXA 2FA5A 3CUQB 5D6FA 1TLHB 2BEOA 3FM3A 4ENJA 2PG4A 4Q47A 1LJ9A 3FZVA 2LX9A 4D0PA 5ICCA 1U2WA 1IF1A 4U0WA 1F1ZA 1Z91A 5AIQA 1J5YA 4G7HF 4IVNA 1U78A 5D4RA 3JTHA 3IKVA 3LQRA 2CGPA 1ZHFA 1ZG3A 1QZYA 4WXCA 3HTSB 2ISYA 3U1DA 1FPQA 1Z05A 1ZLJA 3HIFA 1ZN2A 4FHTA 4L5IA 1BBYA 4A5NA 4P5OA 4EVIA 1UB9A 3KFWX 3FXQA 3WGHA 3E5UA 1ULYA 3N97A 2RDPA 1ONVA 2HTJA 4GYGA 2EFWA 2A5YB 1FBQA 2H3JA 4IHTA 1HW5A 4HZFA 2J5PA 2VT2A 1XGMA 2F5EA 1FBUA 1IXRC 2VC1A 5E17F 1YYVA 1IN4A 4U7BA 1FLIA 5ILUA 5D8LB 2A07F 2Z9OA 3SFZA 3ZN0A 5J6XA 2L4AA 2XAHA 3V7SA 5J8FA 2MD5A 2ZMEA 4RGRA 3WTVC 4MGRA 4WWCA 2P4WA 2HQNA 4I02A 2K4YA 2VC0A 1MD0A 3MWMA 2GXGA 3T8RA 4ZYDA 4S04A 1ZG1A 1OMIA 1ZGJA 1OKRA 3E5QA 1OYYA 3M7GA 3WE2A 4EQQA 3FMQA 2ESHA 2DLLA 4RB0A 2LNBA 2ETHA 2PEXA 5IT9Z 4LJZF 3HOTA 3GVAA 2VONA 2XASA 4Y15A 4EJTA 3H92A 3E3VA 2GQQA 2A68F 3W6KB 2K5LA 1G3SA 1ZAOA 3DQVC 3KP2A 3ERED 1V3FA 4A12A 3VOEA 5HDNA 2P5KA 3Q9VA 2A69F 2DU9A 2IRFG 4BXUA 1QNTA 1SFXA 2KJCA 3GFJA 1KU7A 5HS9A 1YFHA 1R23A 4ASNA 3WG9A 3TOAA 4CDGA 2UWMA 2EV5A 1O7FA 2HTSA 1KQ9A 5KK1A 4OINF 3ZP5A 4YIIA 2HZTA 4LB6B 3O2PE 4UVBA 3O3KA 3VFZA 4CHUA 2PFBA 5DCMB 3FMRA 1R5HA 2Q8KA 2IA2A 4EGZA 3F72A 4EJVA 1MJAA 3W6JB 1UHWA 3FXRA 3KEOA 4KIGA 5FGMA 1XGSA 3WTZA 4L9JA 3HRUA 1B9MA 3DFGA 3NQOA 1U5TB 1R1VA 1QW1A 3RDIA 3I53A 4L0ZB 4S05A 3F8MA 5IT3A 4KYWA 2K4JA 4IRIA 2JRTA 5HLHA 4HA8A 3DEUA 3EYIA 4G6DA 4EJWA 3TDUC 4HF1A 3LAJA 2R7DA 1P2FA 3SQNA 1T6SA 2QENA 3B02A 1SAXA 2K27A 2A6HF 1K78B 4M9ZA 5E1XA 3ZMSA 2ZBKA 3GO5A 3FHZA 4U0YA 3V4GA 2K5FA 2ZFWA 2UXNA 2LF7A 3D0SA 2Q0OA 4KIBA 2M8EA 1R5GA 1F5TA 2OZUA 4PGHA 4GCVA 4M9XA 5JFRA 3KP3A 2GA2A 3WE3A 2VBYA 1KQ0A 5D5XB 2LF8A 5L3BA 2KRFA 3R0AA 4ZZLA 1BC7C 1FNNA 5E8GA 4NQWA 5LGNA 2JSCA 2H6BA 2D1VA 3KP7A 3WTTC 2R3SA 3P9KA 1QGPA 3H3UA 2D1HA 2KKOA 3L7WA 3CUQA 5D5WB 4HLYA 3K1NA 4G9YA 3V8LA 2JPBA 2HS5A 1X3UA 3N4MA 1B1BA 4JQFA 3WODF 3ECHA 3R4KA 3GYHX 1HKTA 1BI3A 1SD7A 1I1GA 1HSTA 1T2KA 3GXOA 4LK1F 2VBWA 1KQ8A 1LEBA 3QAHA 2H27A 5DUKA 3P9IA 3WTYC 3DF8A 2ZXJA 1B4AA 3B73A 1GXPA 2L3DA 4L9NA 4ZYGA 3WTUC 2O8XA 1E2XA 3GLXA 1JHHA 3M1EA 2K7LA 4Q5SF 1FOKA 3LSTA 1G3YA 2K5IA 3KP4A 2H6CA 2JT1A 2Z33A 5LBQA 2CSOA 4GO1A 4CICA 3R61A 3QP5A 1SD6A 3GFMA 1LNWA 1XSVA 3D5LA 2DK5A 1QVPA 4KA4A 2UXXA 1FSHA 4EGYA 1RUOA 3SHFA 2IW5A 3BWGA 1IRGA 3L9FA 2M87A 5EEHA 2FMYA 2GIVA 1MDMB 2EFNA 1IXCA 4KDPA 4ETSA 1OYIA 4Y17A 1BN5A 1MZBA 4YFKF 4L9VA 4UV9A 3HYIA 2Z5UA 4XSXF 3NEUA 3JTGA 1B6AA 1EH8A 1AWCA 3GF2A 3FM5A 4I09A 2GAUA 1GXQA 4RB3C 2BYVE 1QO0D 3BPXA 2O6GE 4KFCA 2P5VA 4G7ZF 1PP7U 2CYYA 3KZYA 4A6EA 1BIAA 1WWXA 2QBYB 1JE8A 3HSFA 1A04A 5BPIA 1D3YA 1D5VA 2FBIA 4LG0A 1YW7A 1LDDA 5K5QA 2PLYA 1WRJA 4ZYHA 3KEQA 3RKYA 3ULQB 3GW2A 4RAZA 1G4DA 3QP6A 3WTXC 2OAZA 1U6GA 3TQNA 3ML6A 3H3ZA 1RUNA 2P7CB 3K1MA 5DV5A 3PFIA 2P7VB 2IVMA 2YU3A 3E6DA 3KZZA 4LFUA 4CYDA 4HYEA 2OA4A 4ZH4F 2FQ3A 4OMYA 1YS7A 5ICEA 1LDJA 1D8JA 2NRAC 3E6BA 5LHHA 2OQRA 1EV7A 2XIGA 2LSOA 1OPCA 1TW2A 1ZRFA 4KT5C 2CO5A 3EDPA 2QQBA 4I0AA 1O3QA 4N9HA 1CF7A 4A0YA 1FX7A 1U5TA 4M72A 2IA1A 4RGXA 4AD9A 2HYFA 1YW8A 1LEAA 5FB2A 2NYXA 3IRRA 4DNCA 1P4AA 2RC4A 3C18A 2IJLA 4EV0A 1H0MA 4UHTA 1TBXA 2YX4A 4I01A 4OOIA 4NHJA 1S7OA 2L4MA 4HDUA 2XUBA 3WTSC 2X0LA 2XAQA 2DBBA 2W24A 1HW1A 5HLIA 2O0YA 5D4SA 3HUGA 2V1XA 4BQAA 3Q9SA 2ISZA 1KU9A 1O7LA 5A2QK 4GGGA 2QM3A 4N0BA 2YX7A 5A2QZ 4WXDA 3LA7A 4A5MA 1U5TC 1FBSA 2Y75A 2WC2A 4IXAA 4R1HA 1WKMA 3REOA 4BYYA 2RV8A 2EFQA 1J9IA 2QBYA 1VTNC 5DUIA 3CDHA 1F4KA 4MEYF 2VODA 1KA8A 3CUQC 1PDNC 2KIFA 5DYMA 2J5OA 4Y13A 2AS5F 2ZCWA 3SZPA 5L3DA 3G3ZA 1MKMA 1Z6TA 2DT5A 2EFOA 4UUVA 3ZN1A 1PUEE 2DQLA 1S29A 2IA0A 2FBKA 1WI9A 2M1BA 2Y0MA 4ESFA 3BJOA 5L3GA 5TJJA 4XSZF 3I5UA 4UVCA 3C3WA 3HSRA 4AVPA 5JR3A 1F9NA 1TQPA 4U88A 1Y0UA 3K1PA 3IL2A 1XN7A 4EM2A 4L5JA 5CYVA 3MCZA 1ZARA 5F1RA 2ZO4A 2A6EF 5F6FA 4BHBA 1TNSA 1XB4A 4LK0F 3Q5FA 2QUFA 5LEKA 1ON1A 4EJOA 1REPC 3J80Z 1LB2A 3FX3A 5DD4A 1D8KA 3O6BB 5HOOA 4XBFA 4WXHA 4FT8A 4HOBA 2EV0A 2PN6A 2HDCA 4M71A 3ROUA 4KUMA 3L2CA 5LHGA 1MJBA 1H9GA 5FO5A 3RKXA 1U8RA 2EA4A 4LLLA 4RGUA 1K6OA 1S6LA 2KJBA 4AIJA 2FRHA 4KIFA 1YG2A 2ZNZA 3J81K 4G8XA 3WTWC 5BMZA 1YTYA 1R7JA 2ADUA 3EYYA 4L9TA 4AIKA 5L3FA 3GWZA 1ZRDA 4JBAA 2ACJA 1W4MA 1H9TA 2VOOA 4HQMA 2DTRA 3FXUA 4IJAA 2HGCA 1W7PD 3DP7A 5AONA 2FSWA 4OIPF 3LA3A 3LA2A 1W5TA 2L01A 4O3MA 4UV8A 2R7FA 1JHFA 1FY7A 1DUXC 1SD4A 5LLQA 5K1YA 3TO6A 4YIFA 4P9FA 3F8BA 3NRVA 1IAWA 4G7OF 2V9VA 3ZQ7A 1BI2A 2QVOA 4RGSA 3IC7A 3K2ZA 3TKYA 4O6JA 5L3EA 1TQIA 3J81Z 5HDGA 2O3FA 3F6VA 2F5CA 3I58A 4LMYA 4HAMA 1ZREA 3F22A 2KIUA 4KN7X 4JK1X 3I59A 3FMSA 5CVVA 3BZ6A 1J0RA 3AAFA 1U3EM 1XDSA 2K4BA 2HYGD 1I6XA 1G3TA 3VB2A 5IT9K 1XGOA 3F23A 4BH9A 1SMYF 1YIOA 2EK5A 2FF4A 2RNJA 2XKPA 3QU6A 4IHSA 3ZMUA 2PMHA 4FX4A 1R22A 5DD8A 3MFKA 2FNPA 2WWYA 1EH7A 2M30A 5E18F 3ZMVA 2HFHA 2IT0A 2QYOA 5AIPA 5LRRA 1R58A 1BJAA 2VE8A 3ABUA 4LGWA 3P7NA 1QQIA 2FU4A 3ZPLA 3RTRA 2GA1A 2VXZA 4KMUX 5FFXA 2VOPA 1Z6RA 3KE2A 3LWFA 5HVQC 2XROA 3L00A 2HR3A 5CVIA 4R79A 2Z99A 5JVTA 4IRHA 2OZ6A 4WK8F 1JGSA 2KIMA 1KGSA 3U2RA 1RNLA 2EV6A 4XRFA 4MQ9F 3I64A 3BY6A 3ZMZA 1WSUA 4WX9A 3K69A 2F2EA 5LGUA 2YR2A 1YQAA 4EJUA 2D45A 2MLKA 2CG4A 2A3SA 4M6YA 6PAXA 1XCVA 1J75A 2RVCA 4LLNA 2K02A 1P6RA 1Z1DA 3HRSA 4B8XA 3F8NA 4U7DA 4K2EA 1KYWA 4IF4A 1P4XA 4G94A 1HBXG 2VN2A 4BHCA 5FD6A 2P8TA 2XRNA 4LLGF 4I7HA 1XSXA 2E7WA 1XDUA 2H94A 3TDZC 5HDKA 5D5UB 1FYLA 1IN7A 2EJRA 5CJ9A 2HQRA 1OR7A 1KU2A 1UFMA 4P96A 1MDMA 4ZYEA 3I0TA 3ECOA 4F7ZA 3WU0A 2XAJA 1ZLKA 4XLPF 1YO5C 2OBPA 4N9IA 5J8CA 4HV5A 5LRSA 4BAYA 1YW9A 2Y48A 2AXLA 1HSJA 4UVAA 5EEGA 1NHAA 3HTUA 5E20A 3DPLC 5FLXZ 2M5WA 1XGNA 1Z7UA 5DEQA 1BIBA 2BGCA 5H20A 1TQMA 4HBLA 4BNCA 2RGVA 1K78A 2DFIA 2F5DA 1HQCA 4A0ZA 3V8JA 1MGTA 1V4RA 1W7PA 3LFKA 2A61A 1BYMA 4IRGA 4LG0B 3DV8A 5FFZA 1ZG5A 3QU3A 3TGNA 3RPQA 3E6CC 1USSA 2CWEA
chains in the Genus database with same CATH superfamily
4ZDLA 1Q7YU 2H1KA 1WH7A 2QEXI 4OGCA 5DCFA 4PNOA 2HYJA 4F7UF 3DKMA 3QPHA 4IPAA 4RM2A 4B3AA 5JI6A 1LCKA 3PNVA 4M6VA 4WCGA 1UJ0A 2A28A 2EKOA 4PJOE 3F3XA 2KDZA 1RLQC 3F6OA 3HRMA 2LCSA 3MEXA 5HK0A 1UGRB 4B09A 1ZBJA 1Z0XA 4HW0A 1I5LA 5GAOq 2DJZA 3OWTA 4E70A 2CUFA 1O3RA 4YIRX 2H8HA 2RJFA 1EKEA 4PJMA 3MZHA 2F5KA 2RHUA 2JN6A 1O3SA 2OD5A 5CKTA 2VGNA 4XTXA 2R5ZA 1R1UA 1HKQA 3CCVA 4YFXF 4HF2A 3TQ7P 3JRGA 3FKIJ 5D6EA 1PUFA 2JNGA 2ZSIB 4BY6C 1VQKA 3ONQA 4HNVA 3JW4A 1CKAA 2HAXA 5K5RA 2K2VA 3CMEI 2DI3A 1Y56A 2CV1A 3TMOA 2F2WA 1SEMA 3SDGA 5IHKA 1OPLA 3JRBA 3ISPA 3GEZA 4E2FB 5LEJA 5EG2A 2L02A 2NAZA 3BPVA 4A3CJ 4A3KJ 3LWIA 2X6WA 3PQJA 3RYPA 4ZJZA 5KH6A 2IS4A 3M0RA 1S3JA 1K7AA 1BKBA 3I59B 2FB7A 1POGA 2ESNA 1TW3A 3CC2A 1M4ZA 3HXLA 5JHUA 2EZHA 1IXSB 3V7CA 1KYZA 1B07A 4DZJA 2PI0A 4I0BA 2W57A 4HX7A 2BVLA 1I5ZA 2DMPA 3MEVA 4PFZA 3SHWA 4M78B 4C2TA 1TNTA 1W2BS 4MTEA 2FMLA 4U87A 5JLXA 4ZZDA 5KHDA 3VJPA 2OTJT 1N75A 4F52A 1IN8A 1HF0A 1TTYA 5LJ3h 3J80E 2BXZA 3UATA 2WTEA 2Y9ZA 2DYIA 2E5KA 3RYRA 1RKTA 5EGOB 2JMCA 4XU1A 1BC8C 1AA7A 1LVAA 4C0ZA 2V9PA 1UMQA 1GFCA 5E79C 2FE3A 2HWVA 2PJRA 4UNOA 1SD5A 2XVCA 5CLSA 1ITYA 2J05A 2K9NA 2EILH 2V6EA 2JTVA 3VUBA 1TL8A 2P6SA 2E6NA 4KNYA 2MW8A 2VKNA 1VQ7I 3A8OB 5B1BH 3CF5F 4XTVA 1TWBA 4P55A 2L3SA 2R7QA 2DDAA 1H641 1UHFA 3I71A 2IG0A 2TDXA 1B9NA 2K9MA 3M9QA 5CQXA 3X26B 1HJDA 4OIOF 2DETA 4ENKA 4X1VA 4HX4A 1IDZA 1VQPA 3CO7C 3I5SA 1X2MA 1N8RR 2Z0WA 5GAN6 1T0FA 1QVGA 3Q1JA 4XTWA 1LFBA 3VODA 3CCEI 2A3LA 4MQVA 2DA6A 4YG2F 3OB9A 3GZ6A 4XICA 1SC7A 3R6SA 2LQNA 3OL3A 2Y31A 1WHKA 2P4RA 4HPQA 4CI0C 2YRCA 1VQLQ 3MHXA 5C44J 5HS7A 4BBRJ 3G6EQ 3AL0B 2DTOA 4PLLA 1ZH5A 5KYXA 4XK4A 4Y52J 5HS8A 1SRLA 2W4SA 1LUJB 4H0EA 1KQ1A 4XOTA 4D5CA 4TV7A 1IUYA 2XIDA 4JDSA 1XSDA 2F6CA 3E5XA 2IP2A 4L0YB 3W6VA 1SFEA 3ZOBA 1YS6A 1ZGAA 2R4GA 1JU5C 1ETKA 3Q0UA 4MTDA 1R0BG 4E6KG 2V4JC 4UUTA 5KVRA 4LDXA 4IZZA 2V1RA 3JCMQ 1CF7B 3MP8A 2K57A 1K4TA 1W0TA 2XHKA 2MH9A 4Q5WA 4ELYC 1QBJA 4C5EA 3GTGJ 3R60A 3LLRA 5D7UA 1GV5A 2MG4A 1W70A 1S7AA 2CW8A 2GWRA 2QKMB 2IS2A 1D09B 3S2DJ 1M8MA 1QLYA 3PE0A 3SJMA 1WVRA 2O4XB 4HQEA 3OBYA 2BV6A 4QVCA 1VZ0A 1VQKT 2IPQX 1B7TA 1RETA 3QO3A 2XKOA 2R7VA 1LQ1A 4PSWA 2XV4S 3SZTA 2DZ9A 5EC7A 3WVEB 1EH6A 3T5XA 3KP5A 2O7OA 4E7KA 1VQ6T 4CO8A 2VASA 1IN6A 2L7FP 4NB5A 3BROA 3H41A 3PFYA 4Y91A 3EQLF 1NG2A 3HRTA 3AG2H 1H8AC 5LD2C 2PU9B 3X25B 1I1JA 1LE8B 2E34A 1J7KA 3KLOA 2NVXJ 2KSSA 2QASA 2ELHA 5KYUB 2A0FB 3CC4A 2AZVA 4M75F 5GAEJ 2DVJA 1IJWC 1Y39A 4HCZA 4RS8A 1DPRA 4MIMA 3HL2A 1Z9CA 2H3EB 3NTIA 4B9WA 4EM0B 1Q95G 3M9AA 1UHCA 3CPWA 3WHCA 4IUUA 2BHYA 3RMSA 1ARKA 2EGEA 2P4TA 1WPYA 2CYZB 3S8PA 3CC7I 1X2QA 4BHPA 2CSIA 2IS1A 3SXYA 4CRIA 3DXJF 4A93J 2DEUA 2XG8D 2LQ8A 2CDTA 3RDVA 1DU0A 5FD5A 4RB1A 3LNQA 4EMKC 3UF4A 2G0EA 1BI1A 2BZTA 5CVUA 2F69A 1M1GA 5GJWB 3HHHA 2VJIA 3MZYA 2STTA 3H35A 1DPUA 3I4PA 4OMQA 5ILVA 4FM4B 2PMUA 2JA8J 3QYEA 4A6DA 2OAUA 2ZXWH 2ZKZA 5J3LA 3VEPA 3DLMA 3I9QA 3PVLA 3VPRA 4C8QE 4N4NB 2LRQA 5ED4A 1P92A 2COMA 4V2GA 2QGGA 3SEQA 5KYXB 3QOEA 2FXAA 2JSPA 2EPDA 1R4MB 1BR2A 1R36A 1T98A 2ZJPF 3N05A 2I5UA 5F64A 4LD9K 4QIWN 3A1PA 1IZ1A 1EZZB 2JT4A 1OPKA 4EM1A 4V2SA 2L0AA 1J2XA 2FX0A 2W0ZA 4XR6A 3TO9A 4EMKA 1JB0E 2BE5F 3BQZA 2W85A 2KFDA 3WGGA 5JHFA 2P5LC 2DRMA 3RI4A 1KHIA 5D5VB 2VJ4A 4FASD 3QIIA 2DRKA 1KQSS 4Q48A 3OSGA 5GANd 4PCQA 1DQUA 5L3CA 2YUNA 2DJQA 3TEDA 1SG5A 3G4SI 4PFOA 1NEBA 2CQKA 2HU9A 3DWLE 3I54A 4Z2YA 1TUDA 2DW4A 3S16J 1X58A 4ON0A 3F21A 2CT4A 2QDYB 5HK3A 5DDGA 3TO7A 2STWA 2G7UA 2NS7A 2QQAA 1VQ8Q 3CTAA 1YHQI 1T38A 1H3ZA 3CZ6A 4N4GA 1OU9A 1B8IB 3HZJA 4MZMA 3TOBA 1N9RA 1WX6A 3FWEA 2JUFA 3T8TA 1AHJB 2ZNYA 5ICFA 2X6OA 1RI9A 2E41A 2DMUA 2VBZA 4NQWB 2CZ7B 1WPKA 2O4XA 3I56T 3BR0A 2KP6A 2EA2A 2V6CA 3SWNA 1O57A 2CUJA 2DK8A 2DO7A 1AWXA 5GMKh 3CUOA 3SZGA 3G73A 1E17A 2LX7A 5HY6A 2CP3A 2GCXA 2JTFA 1X4PA 3C2HA 4HT8A 2HQ5A 4F7UA 3IKTA 2COWA 4GXOA 4PGGA 3C2BA 3OIQA 2C6YA 3I4MJ 2BTTA 3KCCA 5K5OA 2XDPA 3OYYA 3W2WA 4M7AA 2ZJ2A 5H2FC 2PQWA 1QQJA 3IWFA 3MQ0A 4M73A 4ESJA 4A3LJ 4HVUA 2NNYA 4M9SA 1FTZA 3LH5A 4M75D 2MGQA 1RKWA 3WU1B 4KBMB 2HVQA 4PJ0C 1FP1D 5GAN3 2BHZA 1EF4A 2VGMA 4QWQA 3WGIA 3VS0A 3T0YA 2FD5A 4CGZA 1VQMA 3GFLA 2JUCA 1X19A 2WAQA 4M7AB 2WAQN 5GTHC 1P4WA 1MJ9A 3CMAQ 1S8NA 2LDUA 4BU2A 3RBBB 4M7DD 1ABOA 3QPTA 4D6WA 2HOEA 4G6QA 4RTYA 2L2PA 3GBGA 3FJPA 1TWFJ 2BBYA 2ATCB 5F0HA 2MPXC 3F9KA 2XICA 2EIJH 2PQ8A 4ENNA 2EQJA 3A5ZB 4CSWA 4FT4A 3CCUQ 2WA0A 1U9OA 3M8EA 3DKWA 4OIRF 2V1DA 1P9QC 5DM6F 2R7TA 1ETXA 4X34A 2AIRB 1B8IA 3P9CA 3ABMH 2LKPA 5GPAA 1XD7A 2YSRA 1OQKA 4IOAF 2KYMA 4XLHA 3K6GA 2MA3A 1R0CB 1T08B 2WV1A 4U0VA 3S3NA 1YJ9I 4CCLA 3S14J 2D8HA 3JSOA 1WQ2A 2LJ1A 4WTOB 3JCMP 4IOCF 1KD1C 5IN1A 1B59A 3EFOB 4OF1A 2RD1A 2NUTA 1MV0B 2JM8A 3A8LB 1PNJA 2HOAA 3META 1WCMJ 1PP8F 1XCBA 3C1DA 1Q7YR 3MAJA 1MIJA 2QAZA 2UZKA 1CGPA 1FMKA 2PBIA 2FNAA 1W5CC 2VQLA 4C9YA 1SVLA 3BTCA 1WFXA 1APLC 2MWPA 4HCBA 2M4GA 1ZYRF 5FKNA 1JGGA 1Z9QA 3CD6T 2CUZA 4OMNA 4KMFA 3NGPA 2Z3YA 1UJYA 3OOPA 2XC7A 2D0NA 3HBLA 2P6TA 2HPIA 1UUEA 4J8OA 2D2WA 3DLLF 2NNNA 1GVJA 2K7AA 2DAOA 3M0TA 3FXJA 3PQKA 1PYVA 4C3HJ 2MC3A 1X69A 2Y4XA 1PVEA 3U9GA 2JPCA 1E3PA 4EATA 2DPUA 3FIFA 3HJEA 4LD5A 4E7HA 4G6TB 4FIBA 2X1DA 4M7AD 1TWHJ 5LJ5d 5E1WA 2YLCA 1RZ4A 4CCOA 3CD6I 1JO8A 2OAWA 4AYBA 2G6FX 4BDZA 3JAMZ 4C8QB 2GQIA 2W84A 3QYBA 4D5FA 3Q0WA 2RI5A 2XGXA 4XN3A 2RQVA 3ELKA 2Y90A 2HEOA 5F0FA 3GNFB 2V8IA 4MZPA 3EUKL 3BJ6A 1VQ9Q 2X4WA 5ILSA 5E3LA 3GPLA 2VE9A 1FZPB 3J7AO 2H8RA 4Y3OA 1RAIB 3M53A 3H9QA 3DBLB 1WGXA 2PMZN 2VT3A 4DOWA 1HW2A 2DA5A 1DDNA 3VS2A 3MP6A 4PZJA 1K4SA 3C94A 1ZTRA 4CZCA 1USTA 1ETWA 5BPDA 1UCRA 2EFPA 3IRQA 2FOWA 5TRDA 1UDLA 1DP7P 3G1LA 1TOVA 3FJ5A 5E1ZB 4XQFA 3ZQGA 3BOQA 3PTAA 1M90C 1YITI 3EUHA 2ZMEC 4MEXF 2KNBB 2KBTA 1RUWA 2ME0A 4A69C 2YUOA 3CCJQ 4AFZC 5IXBA 2Q2EA 1KZHA 2FJ1A 1FOYA 1JUMA 2OCEA 2XAFA 4OMZA 1QHHD 3A01B 3I55A 4WF2A 3DPTA 3LAPA 2O2OA 3K4CA 3RIRA 2XI9A 3PGGA 5GMKl 3CMAT 4F04B 2M7BA 2E35A 3BJAA 5F0CA 3RPUD 1DGWY 2DA7A 4Y33A 4HX8A 2E7XA 1W7PB 2QSFX 1AZGB 2QA4A 2Z16A 4M74A 3MEUA 3OYGA 5J1UA 3CPWS 2KXDA 1WI3A 2ZXIA 3ULRB 4II1A 1ETVA 3L09A 4DGWB 4FYXB 1SVOA 2FOKA 5BOXA 1IRFA 3GFIA 3JB9D 3A01A 1QCOA 2K9SA 3M55A 3EH2A 2QEXQ 2IGKA 2KIQA 2DL8A 1FC3A 1I27A 4A3MJ 1MGQA 2HL3A 3EHRA 1BI0A 2YWWA 2QEXA 3EGXA 1K79A 1Q1HA 3H9GA 2E5QA 2KL4A 3BDLA 2V79A 2ZZDA 3KETA 3G6ET 3DTKA 2NS0A 2X85A 2P0PA 5D6WA 2KPMA 2F4MB 2VXFA 1SRMA 4W97A 1OCPA 4F17A 2MABA 2NXNB 2DPDA 3HOSA 3OYAA 2PZ1A 5CVJA 2WY8Q 1H3HA 2PVOB 3BP8A 3JSCA 3NMZC 3JCMb 2E12A 1UG2A 2MBFA 3HOWJ 1VQNA 5HLGA 1JJ2P 2XD0A 4M7AG 1W36C 3J80K 3FF5A 2M16A 3KP6A 2AQEA 4A3DJ 2HZYA 2CW0F 2O03A 2K6DA 3SFMA 4C0GA 4XKCA 2LY9A 3IHUA 2CP5A 4PSXA 2KY9A 5L8RE 1VYVA 1FT9A 2E3IA 2OQGA 2I10A 5GAMe 1LDKB 2HKXA 1EX4A 1GHCA 2ELKA 4AM3A 1XOVA 1WNLA 3JCMh 1AU7A 4HSTA 3S2WA 3JRIA 2CP0A 3BR2A 4EMSA 4XTUA 3CCLA 4AFQC 1J09A 1WJEA 3QHSA 1FWZA 4IHXA 3ZGKA 4M75E 4LB5A 1T0HA 4I2OA 2H8WA 4QQDA 2MLGA 1O3TA 3CC2I 2RKHA 1UTIA 3I56A 1RC9A 1T39A 4HVVA 3IUOA 2AZSA 2QQ9A 3R6NA 2BY1A 1FSEA 3C95A 5DM7R 5J26A 1XX5A 2E1NA 3WG7H 4P9UA 1D1BA 3CCRI 3BDUA 5B66C 3EETA 1VQ4I 5KAFC 3GZNB 1C0WA 2JA5J 3HOYJ 3PM1A 3N5BB 4O5VA 1Q81C 4OU0A 4FYYB 2YPRA 3JRDA 2PTKA 3J81E 3JCMW 2EQRA 3LSMA 5IOZA 3RPUA 1Z21A 2HEQA 4A0XA 2PJRB 2LP5A 3ZMTA 5FKMA 4AWXB 1F36A 2LZ6B 1RIOH 2IS6A 2K79A 1YJWT 5I2MA 2P81A 5FKOA 4DA4A 4XLAA 4PFPA 4BQQA 1QCNA 5B5EC 4RAGA 4OMMA 4PDKA 1S7EA 1EIFA 2R5YA 1WJQA 4J9EA 1PJRA 1WJBA 2JZYA 2IGOA 2X6YA 1UHMA 3TW6A 4ANJA 3GUDA 3OYCA 1Y0NA 1FEXA 1YNZA 3DB3A 4FE4A 1R1TA 1NK2P 4ZGDB 3RMQA 2RN7A 3E97A 4YELA 2EAYA 2BOLA 1STZA 2R0QC 1UJ8A 3F8FA 3TCJA 2P84A 1RESA 3THKA 1A35A 2W25A 4XLFA 1OISA 2QZ8A 2LNVA 3HKSA 2XK0A 4JJDA 4M78F 4XLNF 1YI2A 3CC7Q 3PIPF 5LGTA 1ZRCA 3MVPA 1S72I 3AG3H 2YT6A 2XDVA 5D6YA 1W2BA 3HOXJ 4HDVA 1K9AA 2NVTJ 2XAGA 3GTKJ 2LT1A 2YHTA 1IN5A 4I76A 4NBQA 2BW3B 1MV3A 1KQSA 2KMTA 2KI7A 5A0GA 5GANg 2EBPA 1AOYA 5LJ3f 3FRNA 1PUFB 2QEXT 1YN8A 4A4HA 1SAUA 1OCTC 3E19A 2HKOA 4BY1J 1LJOA 4OB3B 4RAYA 2O9LA 3CO6C 3EGXB 4Q4ZF 2VV5A 1IW7F 3COAC 4GY5A 2DX1A 2VBXA 1CSKA 3P8BB 1S72T 3KBGA 3KLNA 1JXOA 3OOUA 3HOUJ 2FO0A 1H92A 4FW1A 3S17J 4C0FA 4YFNF 1P7JA 3CLOA 1OCCH 2LYCA 1VUBA 2DILA 2JOYA 2KGTA 2QQRA 2LT4A 4FYWB 1XG1A 3UNGC 3LW5E 3PNTA 4IHVA 2LQKA 3T9NA 2RQPA 3A03A 4F91B 2XGCA 2EQUA 5E8IA 2RH2A 3EG9A 1PWTA 3CCSI 2WV0A 3ZQLA 1ETYA 3E9GA 1KU3A 3CJNA 2COZA 3F70A 4KICA 2QDLA 3P5JA 3QRFF 5LJ5f 1XTDA 2NLUA 3EAEA 4AMCA 2UV1A 2J7IA 3JCMV 3BDDA 1BOAA 2M3AA 5E3MA 1T3SA 3F8CA 4A4KA 2KDOA 4IQ4A 3P8HA 1L0OC 2X4HA 3W3CA 1Q86R 3K4NA 2OUMA 5C4JJ 3ABTA 4HXJA 3JAMK 2RM4A 1YLFA 1XMAA 1OEBA 1Y57A 3C7JA 4IEJA 3RJPA 4CXFA 3LMMA 2SRCA 1HXDA 3RESA 3CCST 3BQYA 5IP6A 3ZMDA 1GLNA 2NOJB 4NDLA 3CC4I 5FRNA 1SHGA 4HV6A 1VYUA 4OIQF 2Z1DA 1SVMA 1XJWB 1VF9A 1YRNB 2F5FA 2WADA 2E5NA 1XMKA 1YIJT 3I35A 4MMKA 2EZLA 3GX4X 1J59A 5F27A 1G6NA 3JSPA 3RKWA 4MNUA 2LJ3A 1OFCX 2H09A 1ODDA 3CC7A 2GXBA 1BM9A 2FEZA 3VS1A 2FBHA 2NUPA 1WYXA 3CCMQ 2OU2A 2JJ7A 5KE3A 5ICGA 2FPEA 2UUZA 3DBHB 3LSGA 2R93J 2NS8A 2JM9A 5FKLA 3JRZA 3KX2A 3S2HJ 2EGAA 1M2OA 3QYGB 4C0DB 2VQCA 1X6GA 1VQOQ 3D5RC 3R0JA 4BUPA 4QLCU 1G3WA 3ME9A 1VQOA 4JS4A 2A5WA 3J7AF 1TSFA 2GTOA 2DAQA 3PT9A 5K7FA 2D5VA 2NUPB 1PRMC 4HCKA 2EB7A 4UXNA 1QPMA 2E65A 2KE9A 3HFOA 3NHNA 4RMOA 3CF2A 2QA4T 2E1CA 2Y69H 3HSEA 1Q86U 2NYSA 3EUAA 2EWNA 4C92D 1NYFA 1RLPC 3CC2T 1IO2A 1R00A 3M3YJ 4A2UA 1GVDA 1VQLA 4G12A 3V7RA 2ZMEB 3G1JA 2ZPHB 2EYYA 4RB2C 5CVRA 3LQQA 2FPDA 1FP2A 5J4YA 1HCRA 2JTEA 2G9WA 1E6GA 2G7HA 4C3IJ 2KZVA 1HKSA 3E6MA 3G6EA 1E3HA 2CREA 1SMTA 1M1FA 2DMOA 3G4SA 5IYBJ 3SEZA 2LMJA 2MWOA 3VYTB 3K9TA 5LHIA 1JBMA 4ENMA 2DDBA 2VKDA 2GOMA 2BKDN 4KN4X 2L54A 4II2A 1S72Q 1WI7A 2HVSA 1TTHB 4EMGA 5BQTA 1VQ5A 3BTJA 2C0OA 4LD6A 5FLXK 3QUIA 2OI3A 1M3CA 3URGA 2MH2A 4DQ2A 3BE3A 1L3LA 3I4NJ 1OV3A 3AKZA 4MHGA 1W36D 1ON2A 2IAIA 3IAM2 4GYIA 5IY5H 1QP3A 1RRJA 3K4BA 5C4XJ 1I1SA 2JMAA 2WSCE 3JB9I 2HCKA 2PJPA 3MKYB 2XHCA 2BY0A 3OV8A 4M6XA 3BTIA 4A54A 2CGHA 4B1RA 4OWRB 2O61A 2E1HA 4X9DA 1ZA1B 4R8HA 3HHGA 3GTOJ 4HLXA 3GLLA 1VQ9T 1M1KC 1HLVA 4LUEA 2XSJC 4LDWA 5D8KB 1OYWA 2L2OA 2M45A 3HB9A 3MMYB 2CRGA 5H6QA 4AIHA 5FJ8J 1LFPA 2HOTA 5BS6A 1RI7A 3Q0VA 2ECCA 2GZWA 1W5SA 2QWWA 2HSEB 3CXCS 2X9DA 3HGYA 3ZCOA 4PJOF 4HG2A 2RAEA 4ESBA 5EG0B 2QLZA 2B0LA 2JS0A 3SDBA 2EW3A 2JUGA 4M7DG 4I99C 2JTMA 4OMFB 3RUXA 2K86A 3K0LA 3M4GA 4I98B 3B6AA 2YUQA 3M8JA 3OYHA 2HDWA 1EJ9A 5J39A 2DQRA 3CCJT 3BR1A 1YI2Q 4CZZA 3CCMT 1OCZH 1TT5B 3QOPA 3OYNA 4J19A 3GZ5A 4L18B 2EIMH 1QZZA 2K9LA 2L9SA 3DEWA 4FX0A 2V1UA 2DKGA 4FYVB 4N0AC 4YRVA 2DJIA 3H36A 4LITA 1QHGA 1K9MC 1ETOA 3V8KA 1QU3A 1MNEA 5J47A 3EG1A 1VQ8I 1OQYA 4FETA 5H6RA 1IGQA 4B9XA 3JCMJ 5FRMA 1KSWA 1U1SA 1V5FA 3GIBA 3M8FA 4PJJA 2VC8A 5ERIA 4HF0A 1VQKQ 3T1BA 5DCMA 5E3OA 2GQVA 1FYMA 2DEQA 2DXUA 3KXTA 3TU4K 2LY1A 1KK7A 5M5YJ 1NLPC 3IWZA 1IC8A 4J6XA 5DY9A 2CFXA 3WXMB 2FA5A 1Y8QB 3FXLA 2VI6A 1YBYA 3CUQB 3RKQA 2LP0A 4D7NA 3OYFA 4OMOA 5D6FA 1TLHB 5J1YA 5KAIC 3EG2A 2BEOA 2CQ7A 3FM3A 4P1WA 4MFDA 3KEYA 4ENJA 2GFUA 2PG4A 4Q47A 1TWGJ 3SDZA 4E4HA 2QSGX 3QG1A 1OI1A 5KCMA 1LJ9A 4LG3A 4KUIA 3REBB 3FZVA 2TRTA 5HNHA 2LX9A 2L8DA 4IIOA 3CCVT 4D0PA 2QKLB 2AHQA 3CJRB 1JJ8C 4AYBN 5ICCA 1TUCA 2G3RA 1ACIA 1U2WA 3NFCA 4EEFG 4PUSA 1IF1A 5IPAA 1MNMC 2DA1A 4U0WA 2LTPA 2RI3A 3QDRB 1F1ZA 2W00A 2CSQA 4M78A 1Z91A 5AIQA 2EGCA 3MKZA 3LSRA 2XPUA 3CLQA 1WFWA 2KROA 3GP8A 3D1NI 3CP8A 1F43A 1OLTA 1J5YA 1Y7XA 1GV2A 4G7HF 3PNWC 4RTTA 4Z8AA 5GAOm 4IVNA 1U78A 5D4RA 1BR1A 1UECA 3VRZA 3JTHA 1KC8U 3IKVA 4XAXB 3LQRA 2CGPA 3GTPJ 1ZHFA 1ZG3A 4ABZA 1QZYA 3OIOA 2ICWG 2ISYA 4WXCA 2R5ZB 2B9SA 1T8IA 1VQKI 3HTSB 4JUVA 3H0GJ 3U1DA 4A63B 4DJAA 2DA4A 1FPQA 1Z05A 1ZLJA 3HIFA 1AVZC 1ZN2A 4FHTA 4M3EA 1WXUA 2VQGA 4L5IA 1YITQ 3VV0A 1BBYA 4MO7A 4A5NA 2GFAA 1M1KR 2CS3A 4P5OA 4EVIA 4R56A 3HKZA 4KGXB 4C92A 3VYGA 1UB9A 2D9TA 2O01E 2KR3A 3KFWX 3A4CA 3FXQA 2L7ZA 3WGHA 3E5UA 1ULYA 3N97A 2DFUA 2RDPA 4NL3A 4D8KA 1K8AU 1EA3A 1ONVA 2HTJA 4GYGA 3OSVA 2EFWA 1AOJA 2GTJA 2A5YB 1RAFB 3TEEA 4F7UE 3WVDB 1FBQA 2QXFA 2H3JA 3KYCB 4NC6A 4JX4A 4IHTA 4OB1B 3CDLA 3L2WA 1BCMA 3CMET 1HW5A 4IHWA 3K10A 2X48A 5TISC 4XLCA 4HZFA 3JCMg 2FRYA 4Y7NJ 2OV7A 3OYMA 2J5PA 3U23A 4C0DC 5GAN5 2VT2A 4JOMA 4RLFA 1XGMA 2F5EA 1PCXA 3JB9G 1FBUA 2L5QA 1IXRC 1B34A 2K3XA 1KJWA 2VC1A 1R77A 3H5NA 4AU7A 5E17F 3RZDJ 2IGNA 3GTLJ 4DBFA 2E6ZA 2DXTA 2VUBA 4IUTA 4C8QF 1YYVA 2ZFUA 1IN4A 4U7BA 2LNHB 1FLIA 5ILUA 5D8LB 2ROTA 2ZJRF 2A07F 3KIOA 3SFZA 2Z9OA 1FOWA 3ZN0A 5J6XA 2VLAA 2L4AA 1VQPI 2XAHA 1AKHB 2K9QA 2VL8A 1X1BA 1G59A 3ERMA 1WJRA 3DTEA 1X4OA 3V7SA 5J8FA 2M0OA 2RI2A 3QYHB 2MD5A 5JVGF 1HA8A 2ZMEA 2DE0X 1UGQB 3GNGA 3G71Q 5IHIA 3VYHB 4RGRA 5GANf 1TWCJ 4KISA 4C5IA 5KCHA 4R0KA 3WTVC 2LLKA 1K0SA 5EJCA 1MBKA 2QGFB 3CDIA 5EYRA 1D1CA 3ZL7C 4FE7A 1VQNI 4E6RA 4MGRA 1D0XA 1VQ7T 2DODA 4WWCA 3CCUI 2P4WA 4B6MA 2HQNA 1XS9A 4LE9A 4I02A 2HNIA 2K4YA 2ID6A 2VC0A 2L3PA 5HCKA 1IZ6A 2JN0A 1NM7A 1A6QA 1RAHB 1MD0A 3MWMA 3OQ5A 1WXTA 2GXGA 2R7ZJ 2DN0A 3T8RA 4A3JJ 4ZYDA 4S04A 1ZG1A 1OMIA 4M77A 4EMHA 1BW5A 3CCUT 1ZGJA 2P0KA 1OCOH 1OKRA 3E5QA 1NK3P 1OYYA 1PC0A 3M7GA 5J1RA 2NUZA 3OSSC 1YJWA 5J40A 4LN2A 3WE2A 3I56I 4EQQA 2B8AA 2DIGA 2L3RA 5K7HA 1CKBA 3KYDB 4NNJA 2CZ6B 3OS1A 4PLIA 3CCRA 3CCRQ 3GOXA 1A6IA 1XPXA 2R7XA 4QKUA 3MCAB 1X3WB 3FMQA 2MSYA 4ZDPA 2ESHA 1QVUA 2DLLA 2F5VA 2ZJQF 2GOXB 2VPRA 4RB0A 2ECBA 2LNBA 2ETHA 2RQQA 3S32A 1JUPA 4IO9F 3A2KA 1Y96A 3BZCA 2BE9B 1ZBXA 4K11A 5GMKe 3JCMe 1BL0A 3MEWA 4N0AA 2PEXA 1LE8A 5IT9Z 4LJZF 3HOTA 4BACA 3EFOA 1YJNQ 5FW9A 3GVAA 2VONA 2E10A 3SYTA 5HKCA 3GTMJ 4DZPA 5LJ5j 1C0MA 5IXFA 4CA0A 2XASA 4F14A 1JKQC 1VQPQ 4Y15A 1MH4A 4EJTA 2LKXA 1HDDC 3OSFA 3H92A 4BL0B 3QQAA 3E3VA 3BTLA 2GQQA 2F2XA 3CMEQ 2A68F 5M3MJ 2JW4A 3L2ZA 3W6KB 2K5LA 3PO3J 1G3SA 3M4OJ 1YHQQ 2EIKH 3L2UA 4J00A 1UE9A 4J9IA 1ZAOA 1Q81R 3DQVC 2X1EA 1NBEB 3KP2A 1NLOC 4JPBW 3ERED 3RZOJ 4RTUA 2DMNA 2ZPIB 1GBQA 4YTLA 1V3FA 2YU9J 4DBRA 4LUDA 2DBMA 5CIUA 4PJOG 4A12A 4IQJA 3VOEA 5HDNA 2P5KA 4HRIA 3Q9VA 2A69F 1UAAA 3ZXSA 1VQ5Q 1YJ9T 2D1XA 2X51A 3FC3A 2L9NA 2DU9A 1QP2A 2IRFG 1QNTA 1SFXA 2KJCA 3H5RA 4BXUA 3NTHA 3LSKA 3L42A 3GFJA 1KU7A 2EJGA 1HC8A 5HS9A 4CCJA 4QSHA 1R23A 1YFHA 5GMKi 4ASNA 5DM7F 5E3NA 2DCEA 3WG9A 3TOAA 1Y96B 5FKKA 2EINH 3DU5A 1TUGB 4CDGA 3CQZJ 2UWMA 2FZCB 2O31A 2EV5A 2KHMA 1O7FA 5FU7C 4KH0B 4J83A 2M0MA 4L59A 2HTSA 1KQ9A 5KK1A 1AEYA 2OCCH 2BZXA 3CCSA 2FZKB 1UHSA 4OINF 2FRWA 3ZP5A 4YIIA 2HZTA 4LB6B 2RJCA 2J6FA 3O2PE 4UVBA 2X3WD 2LBFB 1OYXA 1SSHA 3A02A 1ZSGA 3VS4A 2F4IA 4MDXA 3GF5A 2XGEA 3CCEQ 4D1QA 2VB6A 2WB1A 3O3KA 2P0QA 3VFZA 4CHUA 3MP1A 3QWYA 1DGRM 2PFBA 5DCMB 3FMRA 1WJ5A 1R5HA 4NC7A 2IA2A 2Q8KA 3F72A 4EGZA 1QKXA 2FPFA 1NYGA 1YE9A 3K7AJ 3H6ZA 4EJVA 2VJJA 4XL9A 1KQSP 3ESWB 2LH9A 4IKFA 3BG7A 3BLYA 1MSEC 1MJAA 1KIKA 2FEIA 1K6YA 2EQKA 3W6JB 1WJFA 4ZTFA 1UHWA 3HKZN 4X9CA 3FXRA 2JJ9A 4XU3A 4KJZA 3M07A 3I55Q 2IIMA 3VRYA 2MYSA 2MI6A 2J6OA 2X35A 3KEOA 4KIGA 2YSQA 5FGMA 1WHMA 1V54H 5M5WJ 5IOYA 1K9MU 3TBIA 1XGSA 3HFNA 3WTZA 5KYYA 4L9JA 3HRUA 4BY6B 1B9MA 1UGSB 1X75C 3SFIA 1U1TA 4RLQA 2M1HA 3DFGA 4RAFA 2LOOA 4M7DA 1P7IA 2FG0A 3FXMA 3NQOA 4BE0A 1U5TB 3BG5A 1VQPT 3HHTB 2NVYJ 2I8DA 1R1VA 1QW1A 1Z7LA 2ID3A 3FXKA 2A6TA 3OR1C 3RDIA 1KD1R 2AT1B 4PJOD 4ZNXA 2CW7A 2I0NA 3I53A 2BVMA 4A3EJ 4L0ZB 4MLOA 5GAN2 4B44A 2ZPFB 1I8FA 4DYCA 4S05A 4UUSA 1A31A 3F8MA 1LPLA 2HSPA 4QT7A 5KYUA 5IT3A 1ENHA 4KYWA 4M7DB 1BJZA 3CQTA 2K4JA 2OTJI 2LCCA 2RK1A 2NOGA 1XTAA 1FYKA 2JRTA 4IRIA 3CCQQ 2DA3A 3OS0A 3BCAA 5HLHA 2DL4A 4HA8A 4LIUA 4X6AJ 5M3FJ 4ESRA 3DEUA 1TXQA 1YJ9A 2CFOA 5CPRB 2JVVA 1YJ9Q 1AD5A 3EYIA 4G6DA 4EJWA 4ATOA 3CPFA 2HD0A 4QQGA 3TDUC 4F7UG 2ME6A 4HF1A 3EG0A 2ELJA 3LAJA 1VA7A 2M34A 2R7DA 3BCBA 5GANe 1ZKGA 1P2FA 3SQNA 2HBPA 4XM3A 1AT1B 1T6SA 2QENA 3B02A 3LSPA 3H5AA 3TSWA 5GAGJ 3MKDA 3FDYA 2K85A 3BR3A 1X43A 4BB7A 5IP7J 1SAXA 1VQ5I 4ORZA 2K27A 5B1AH 2A6HF 2R7UA 3M54A 4H4KC 1K78B 3S6WA 3X2QH 2CP6A 4M9ZA 1TWAJ 2K3BA 2FYKA 5E1XA 4C5GA 1MBFA 3ZMSA 2RB6A 2NWMA 2ZBKA 3GO5A 3VWBA 1W4SA 3FHZA 4U0YA 5LJ3j 1LFUP 3V4GA 4J01A 2K5FA 1D1AA 2E4HA 4CUGA 4OMLA 2WSFE 1V1CA 4XTZA 2ZFWA 2BY3A 2E19A 2UXNA 3EFSA 3X24B 2LF7A 2EQMA 3D0SA 1PM3A 3C12A 2Q0OA 3O8HA 1Y71A 4CC7A 3RQ4A 4KIBA 2M8EA 1R5GA 3CCQI 1F5TA 5AT1B 2OZUA 4PGHA 4XKWA 4ELZC 3EGDB 1FOXA 2LR8A 4GCVA 1ZSZA 1WHHA 4M9XA 5JFRA 2O88A 3KP3A 1IUFA 1N78A 2EIFA 3CCRT 2GA2A 3SB2A 3WE3A 2JK3A 2VBYA 1ZK8A 3QBYA 2LKSA 2OF7A 4PJOA 1KQ0A 5HODA 5D5XB 1PG5B 2K40A 2LF8A 1N27A 4OGEA 1GUUA 2BW3A 5L3BA 4BEHB 4JRKA 2KRFA 2GLOA 2YLBA 3R0AA 3MJXA 1JXMA 4ZZLA 1M2VA 1BC7C 4M77F 3LL7A 1FNNA 4JRIA 3LWHA 5E8GA 1YJNT 2JVGA 2R57A 4NQWA 1O75A 3G2BA 5LGNA 2QYZA 3VYUB 1WJCA 2JSCA 2AKLA 3L1AA 1T0FC 4BS9A 5GJVB 1X6OA 1XQHA 2KVQG 2H6BA 1C1AA 2DFHA 5IYDJ 2D1VA 3KP7A 1E0EA 3WTTC 1OZ2A 2R3SA 2DVEA 2VVKA 3P9KA 4M7AC 1VFCA 3I55I 1QGPA 3LOCA 1M2VB 1VQMQ 3C0CA 1G8XA 4I6ZA 4UC4A 3H3UA 4ME7A 2D1HA 4RMNA 3EH1A 2KKOA 2LY2A 5GAMh 3L7WA 3CUQA 4M3DA 5D5WB 4HLYA 1V29B 4M77B 3K1NA 4QVZA 3OYDA 1HD3A 4GRIA 4XKBA 4G9YA 2CJJA 1T3LA 1KD1U 3V8LA 3H9JA 1RI0A 4JJBA 2JPBA 2HS5A 5LJ3d 1X3UA 3PUFA 3N4MA 2LK2A 1B1BA 3OMYA 3PIPA 1D3BB 4JQFA 4RG8A 3S1MJ 3WODF 3ZQQA 4X1EA 4BDYA 3ECHA 4PK4A 3R4KA 2HVRA 1VQ6Q 4DIQA 3GYHX 1ZUKA 1HKTA 1BI3A 1SD7A 1GFDA 2K5CA 1YIJQ 1I1GA 3JRCA 4FSXA 1HSTA 1X3ZB 5CQEA 4CYCA 1T2KA 4Z88A 1YJWQ 2OTJQ 3GXOA 4XMYA 2AQFA 4LOCA 4PJOB 4FISA 1A5JA 2LVSA 2Y2ZA 1YX5A 2CQNA 3JREA 4LK1F 2DL5A 3UDCA 1ERDA 3WU2C 1F1BB 2VBWA 2HQEA 1KQ8A 4HCCA 3HPHA 4J5YA 5CCAA 3VYSB 3CESA 1WHGA 3M0UA 1ZUUA 1K73C 1N8RC 1LEBA 1NJIC 3QAHA 2DO3A 3EGDA 1SFKA 1VQOT 2BY2A 5IYCJ 3ZQCA 1R6RA 2CP7A 5LJ3e 1UELB 2H27A 2DIQA 1ZSZC 5M9OA 5DUKA 1HDPA 1MBEA 3P9IA 4DEXA 3K70D 2DTIA 5A0DA 4HSRA 4BXFA 3WTYC 3CCLI 3DF8A 4V19K 4KH1B 2ZXJA 3TW7A 1B4AA 3HTRA 3B73A 5GADJ 4F55A 3PUBA 1GXPA 2L3DA 4JJCA 4L9NA 5CAIA 1SFOJ 4XRMA 4ZTJA 4ZYGA 3WTUC 2O8XA 1E2XA 4BGDA 3GLXA 1V5EA 1FTTA 1JHHA 1PSFA 1PHTA 3H9NA 4M75C 5CKEA 3M1EA 2K7LA 2KQRA 2VXDA 4F92B 4Q5SF 1MH3A 4IUQA 4AIDA 4L6V5 4KULA 2CV2A 3UKGA 1FOKA 3LSTA 3J7YJ 1PD1A 4LNPA 1G3YA 2K5IA 3PO2J 1V76A 2OC6A 3KP4A 1UGPB 2H6CA 3HEFA 1BB9A 2YRVA 2JQ7A 3Q3SA 1RAGB 1MNDA 4BI8B 5CKHA 2JT1A 5CQYA 3KFVA 2Z33A 2ZB9A 2LD5A 3K4KA 2KRSA 5LBQA 4EMKB 1GDTA 2CSOA 4FSSA 1H88C 9ATCB 4A3BJ 2KXCA 1GBRA 2DA9A 4BXXJ 2M2EA 4GO1A 2BZYA 5FU7B 3UT1A 4FT2A 3FLGA 4CICA 5DLOA 1NJIU 3ZR8X 2DMQA 4MZTA 4RCBA 2L89A 2PX9A 3QP5A 1Q1VA 3R61A 1Z77A 3QDFA 1SD6A 2FL7A 2LRDA 3GFMA 4XTYA 1LNWA 2E2IJ 3M5AA 1K83J 4BI3A 1WQ7A 1XSVA 3D5LA 2RHXA 1R4NB 1FIAA 1NTCA 1G2BA 1S72A 2DK5A 3CCQT 2CH4W 3CCSQ 1QVPA 2DYBA 2MF2A 4KA4A 3AFHA 2UXXA 4BD3A 5LJ5g 1BW6A 4PJLA 1FSHA 2GF7A 4EGYA 5GPCA 2PVGB 3J7ZI 4L5EA 3SHFA 4DW6A 1RUOA 1I39A 5GAMj 3CC2Q 2IW5A 3BWGA 2K3YA 2HOSA 1IRGA 2QSHX 4J7IA 3L9FA 3TREA 4M7DE 1VQ4T 1LVKA 3JR9A 3VS6A 2M87A 5EEHA 4X0GA 2JRMA 1JT0A 3MEAA 2FMYA 2R5MA 2D0QB 1W2BP 1Z3XA 4A4GA 1FJLA 1Q82R 2KRCA 2GIVA 1X2NA 2QQ8A 3FB9A 5GAOn 2KYBA 1MDMB 1MBJA 2OJ2A 2COYA 2EFNA 1IXCA 4KDPA 5GAN8 2KT1A 1IB8A 1LPQA 3UA6A 1YI2T 4XONA 4ETSA 3CEYA 1OYIA 1WQWA 2M9UA 4Y17A 4CC4B 1BN5A 1QRYA 4E47A 3O8GA 2B7EA 1TC3C 1MMGA 4F16A 1MZBA 4YFKF 2CU7A 3DKXA 4L9VA 3OYLA 2DLPA 3M0PA 4UV9A 1ZQ3P 4M7AF 1IO6A 3HYIA 2Z5UA 4RKUE 3E2UA 5GAN4 3PIOA 3PFSA 4XSXF 1QWEA 2YUSA 2RQUA 3NEUA 4NC8A 4J9FA 2GIZA 1YJNI 4RTXA 1OR7C 3JTGA 1B6AA 2X1CA 1EH8A 4BJ5C 1AWCA 4AFUC 3HOVJ 2ZSHB 3GF2A 2CZ1B 1KHCA 5EGOA 3AG1H 5ECAA 4ZGEB 3FM5A 2RHYA 3O8VA 1BR4A 4AC0A 4I09A 2R58A 3M58A 2ECZA 2GAUA 3F0CA 4IHYA 3S1NJ 5I2SA 1YCSB 1GXQA 4QPOA 1E7OA 2FQ4A 4HEA2 4E7SA 5J4VA 3OYBA 4RB3C 2BYVE 2E36A 2KISA 2XMFA 4CC3A 4EIKA 2LTOA 5B3SH 1QO0D 4C92B 1BK2A 4GLMA 3VDXA 2QI2A 3JB9J 3BPXA 1JKPC 3G4SQ 2RHIA 1X1CA 2O6GE 1O9SA 5CQGA 3IP4B 4KFCA 2P5VA 3DB4A 5GAOr 2Z2SB 4G7ZF 4D8DA 4OMPA 1PP7U 4C92F 2CYYA 3KZYA 2R5AA 1VQLT 1M1EB 3OW2P 1VQ8T 4A6EA 1I5OB 4Y28E 2Y30A 1BIAA 3FXOA 1WLPB 1YP5A 1WWXA 1QKWA 4M78C 4OP0A 3JAME 1W1FA 2QBYB 4RCCA 1JE8A 3HSFA 5AYFA 1A04A 3IH3A 5BPIA 1YIJI 1D3YA 2X4YA 3P8DA 4HVWA 4QW2A 5IH2A 3CCLT 1D0ZA 4KUDK 1D5VA 1MW7A 2FBIA 4C8QD 3CBMA 2RNGA 2X4JA 3G1MA 3FBNB 4LG0A 1YITT 1MMSA 1M1KU 2HDAA 1YW7A 1LDDA 4RTWA 5C0MA 1TZLA 5K5QA 1VQLI 5A2QE 1HOMA 1JTYA 2PLYA 2MC4A 3A8GB 1WRJA 2ESWA 3ASKA 1AZEA 2DTZA 1OU8A 1M90U 5CO7A 4ZYHA 4F93B 5C3EJ 4IUVA 3KEQA 3RKYA 3ULQB 2ED0A 2X4XA 3GW2A 3CMAI 3ABLH 3ASOH 3PSFA 2EVRA 4RAZA 3SD4A 1G4DA 5LJ5h 5I22A 3VSKA 2DXIA 1ZX6A 4JYKA 5CKDA 2KMUA 1IHWA 3CCYA 3HSBA 3FK6A 3QP6A 3WTXC 2OAZA 3G1OA 2KEAA 3ZBDA 1I50J 3MKLA 3OL4A 1U6GA 3TQNA 1OOTA 4MFEA 4Y4RA 2A05A 4ZDOA 3FIWA 1I6HJ 3ML6A 4BE1A 2XAUA 2DF6A 3H3ZA 1RUNA 4XK8E 4JP0A 5FLMJ 1MHNA 2P7CB 2RMOA 2VKEA 3K1MA 5DV5A 4RTZA 1OULA 3PFIA 3MKWB 1C6VX 1LNXA 2XDDA 4JRPA 2P7VB 2IVMA 2YU3A 3E6DA 3KZZA 4LFUA 4CYDA 4BE2A 4C92C 2HL5C 2EJFA 2KQWA 2QQSA 4MMLA 3REAB 1PRLC 4HYEA 3EUHC 2OA4A 1I0CA 4ZH4F 2EJ9A 2FQ3A 3DU6A 1Q86C 3VS3A 4DYRA 3RR6A 2XU8A 3DEEA 3IH2A 1ZA2B 2O5RA 2VKVA 2GXAA 3G71T 1T95A 2XF7A 4C30A 3J7AY 2E70A 2LQWA 4OMYA 3MN2A 2O9VA 4II3A 2WAFA 1I07A 4IX7A 4HKEA 4C8QG 1YS7A 3TP0A 1K9MR 3EPZA 5ICEA 1LDJA 4OB2B 1T33A 3E9FA 1D8JA 3LGFA 4LDUA 2C0IA 1S5LC 2FHDA 2LG4A 5EZGA 3JCMf 1MBHA 2NRAC 1ZUYA 4HT9A 5F1JA 3E6BA 5LHHA 1K8AR 2HKQB 1ORKA 4C3JJ 4Z6YA 4LDYA 2R92J 3QZ5B 3LH0A 2ABLA 4TVRA 4M7AE 4KT6A 2GBQA 2OQRA 2HKNA 2RF0A 2KZGA 3HDDA 2LFBA 3H8ZA 3DLAA 1EV7A 3BW1A 3JRHA 4N4HA 2XIGA 2LSOA 5TGTA 2LCLA 2E71A 1VQ8A 1ZQ1A 1ETQA 3K4LA 2OTLA 3EG3A 3BFMA 2DZCA 1OPCA 4XIDA 1TW2A 3E7LA 1X01A 1I3AA 1ZRFA 1B72A 2W48A 3INZA 3DTIA 1SEUA 5KCOA 3IAS2 2LREA 2L7KA 2M51A 4KT5C 4JZ3A 4J9DA 3JV3A 1IREB 2P0WA 2VUMJ 1JTXA 5FU6B 2CO5A 3EDPA 2RREA 2R7RA 2JMWA 2QQBA 2K3FA 4I0AA 1RR8C 1O3QA 1UGVA 1ZELA 3TP3A 4N9HA 1CF7A 1XNIA 3CCMI 1K1ZA 4A0YA 4NS5A 1RADB 1DJ7B 1FX7A 1U5TA 3C2GA 4M72A 2KRMA 3L1PA 1NZ9A 1RABB 4R55A 2IA1A 1MUZA 4AG2C 1D0YA 4PKCC 4DBHA 4RGXA 4AD9A 2HYFA 1SKUB 1U8BA 3RNJA 1YW8A 1IV8A 1YOVB 1LEAA 2ZCFB 1NJIR 1MMNA 2CQQA 5FB2A 1R71A 1M3BA 1VIEA 2NYXA 5GP9A 3IRRA 1SSFA 2ZC2A 3SWNC 1H89C 4CCMA 3A0HC 3NWSA 3PNYA 1R49A 3VSLA 1GT0C 1I4K1 4DNCA 1P4AA 3IH4A 5EDNA 2LMDA 2RC4A 3C18A 2IJLA 2MFZA 2M0YA 4EV0A 3EGUA 2CZ0B 1H0MA 4CYCB 3M4YA 2CT3A 2EZIA 1RPWA 4UHTA 1NG7A 1TBXA 2YX4A 5KNLA 3M1CA 2WACA 2CKKA 4B4CA 4I01A 1V55H 4OAZA 5DS9A 1Y8RB 2JA6J 4OOIA 4NHJA 1S1NA 2DTHA 1S7OA 2E60A 3QJYA 3CC7T 1WJDA 2QK0A 2L4MA 1JJ2A 4HDUA 3VS5A 1U5SA 2XUBA 3WTSC 1YRNA 2V1NA 2X0LA 2XAQA 3QPLA 2DBBA 4Z89A 2PUKB 3IQLA 1X2KA 1QVFS 1Y6IA 1XMXA 3G71A 4DYQA 4QPQA 2PNIA 2DYRH 2LVMA 2W24A 1N8RU 1U06A 2W1OA 3QKJA 1TH7A 3A0BC 1HW1A 3HM5A 5HLIA 2OTLQ 2O0YA 3W2VA 3HUGA 5D4SA 2DOFA 2V1XA 4BQAA 3Q9SA 2NUTB 2H1LA 2ISZA 1KU9A 1O7LA 5F04A 3S1QJ 5A2QK 3OMCA 4GGGA 2QM3A 2YS9A 4M3BA 5LJ5e 2RK2A 3G4ST 2XPVA 4N0BA 1M9SA 1KFZA 2ENMA 2YX7A 1QVFP 5A2QZ 4WXDA 2DFFA 3ZFJA 3LA7A 4A5MA 1U5TC 3VS7A 2R7OA 2CS7A 3NPFA 1R5ID 3FISA 1FBSA 3S15J 2Y75A 2WC2A 4UB8C 2K3PA 4IXAA 2DM1A 4R1HA 1WKMA 3REOA 5GAHJ 3CBOA 4BYYA 4BBSJ 4IUPA 4BUGA 3CXCA 2RV8A 1JXSA 2E1OA 1RR7A 2DT7B 2ZXHA 2HQXA 4LDVA 2EFQA 3AG4H 1IG7A 4JX5A 2C06A 5BNGA 1J9IA 2RA2A 2X6XA 1VTNC 2QBYA 3OBWA 3OW2S 4M3GA 5DUIA 1KC8R 3CDHA 1F4KA 3FK7A 3JRFA 2AXTC 3GTQJ 2CP2A 3OYEA 2RNAA 4MEYF 3D7SB 2VODA 1VQ9A 1KA8A 4J6YA 3CUQC 5EG0A 1PDNC 1MBGA 2KIFA 5DYMA 4RM3A 1JKOC 2J5OA 3PJRA 2DK3A 1WJSA 4Y13A 2AS5F 3PL8A 3KUFA 2ZCWA 3SZPA 2VQHA 3GMEA 5L3DA 2A36A 3G3ZA 1QWFA 3M0QA 3AHUA 1MKMA 3E1SA 2EYXA 2CUBA 1V5GA 2O9SA 2EYWA 2QCOA 1Z6TA 1WZ2A 2B86A 4CH7A 3H0DA 2L9VA 2E3HA 3CCUA 2DT5A 2EFOA 5M5XJ 2VJ5A 4XU0A 4UUVA 3ZN1A 4QTRA 1PUEE 2DQLA 4L5GA 4N4IA 2MAMA 2VPLA 1TU0B 3HP9A 1S29A 2IA0A 3ABKH 3VYRB 2JVHA 2FBKA 4OAYA 2RQRA 1WI9A 2K2MA 3JCUC 3QSUA 2M1BA 2Y0MA 4E7JA 4ESFA 3BJOA 5L3GA 4A3IJ 5TJJA 4RUGA 4XSZF 1JUSA 3I5UA 3C3WA 4UVCA 3GBQA 3HSRA 4J9HA 3JCMX 4OVAA 1TG0A 4AVPA 2EYQA 3K4JA 5I11A 1YHQA 5GAMd 1SFUA 1AWOA 5JR3A 2Y4YA 2LJ0A 1IRXA 1F9NA 4M7DC 1Q7YC 1YJWI 1TQPA 4U88A 1QA6A 1JRIA 4ITVA 1Y0UA 2KK4A 3K1PA 3IL2A 3AT1B 4J9CA 4M77E 2DXBA 1VQNT 1QVTA 2HDDA 1XN7A 2AKKA 1NG6A 1VYTA 4PL6A 4EM2A 3UWNA 2DYSH 4L5JA 5CYVA 3MCZA 4RG2A 2XRLA 3OS5A 3ZRGA 3I5RA 4M4ZA 1ZARA 5F1RA 2ZO4A 1EFNA 3MD2A 2W10A 3H0FA 3UA7A 2A6EF 5F6FA 4BHBA 1TNSA 3D5SC 4KRTA 2VWFA 3L2VA 4DOVA 1XB4A 4LK0F 4C2MJ 2MIOA 2EZKA 3Q5FA 1X1DA 3C4SA 4XNFA 4DOZA 2YXYA 2QUFA 3S3OA 3NAUA 4BEHA 5LEKA 3QPSA 5KYWA 1VQMI 2DD5A 4M78D 4AG1C 1KQ2A 2JS2A 4LXCA 1ON1A 3QJ6A 3TVTA 4IURA 1K4US 1MMDA 1N6AA 2F48A 1FMWA 5A0LA 4EJOA 3ZEHA 1NPPA 2MMPA 3RSNA 1VI0A 3BG6A 3RERA 1REPC 3GCMA 1WJAA 2EH3A 3CCLQ 3J80Z 1LB2A 2PVDB 1IRZA 3FX3A 5DD4A 2D8JA 2FZGB 1AHDP 2WSEE 5IHNA 5KYWB 4JLGA 1VQMT 1D8KA 4Y92A 1FMVA 2BXYA 3O6BB 5HOOA 2XB0X 4B43A 2XF5A 4XBFA 3CCJI 2KDSA 2DXCA 4BY7J 4J9BA 4WXHA 2PMZA 4FT8A 4MDWA 3H1CA 4HOBA 5GAOl 1BA5A 3MZ8A 2EV0A 3LX7A 5J3BA 2CV0A 3VKIA 1VIFA 3S3MA 4M78E 1VQ6A 2RHZA 1WHJA 1WIEA 2PN6A 3R6OA 4E7LA 2L0KA 2HDCA 1NH3A 3AL0C 3HGGA 4M71A 3ROUA 1RAEB 4M77G 1IGNA 4KUMA 2F1LA 3L2CA 5LHGA 3QWXX 1MJBA 2MD0A 1YWOA 1H9GA 5FO5A 3RKXA 1U8RA 5K7ZA 5GAOp 5GANh 2RJDA 2EA4A 3OMGA 4FCYA 3V42A 4LLLA 3M59A 4RGUA 1K6OA 1MSFC 1S6LA 2GM4A 4UY8I 1JI8A 1UEBA 3X20B 2A7YA 2KJBA 4AIJA 2FRHA 4KIFA 2QTXA 1YG2A 2ZNZA 3DPUA 4G8XA 3J81K 3FEOA 4CC2A 3CP2A 4FQGA 2AK5A 2V8JA 1GCPA 3WTWC 5BMZA 2RQTA 3H3VK 1Z9ZA 5EEAA 1YJNA 5LJ3g 5LL6S 2CH4A 5C6SA 3CD6A 3BR6A 3CCVI 1YTYA 1R7JA 1SHFA 2E1MB 2MK5A 2ADUA 1GRIA 3EYYA 3PMIA 4DEYA 4L9TA 4JJNK 1IHVA 4BJTA 5L23A 3CMEA 3QXEB 3ZQIA 4AIKA 1VQNQ 1W6XA 1S9HA 2C0TA 2DFEA 2HXOA 2RJEA 1QVGP 5L3FA 2M4KA 2VIXA 3KPHA 2ZAEA 3GWZA 3JB9F 2YUPA 4KGVB 1ZRDA 1PSEA 4XLEA 3NWTA 1ZHIA 4JBAA 4BJ6C 2HQAA 3CC4Q 1T56A 2E5ZA 3CMYA 3DCFA 2WAEA 1UB4A 2ROLA 2DD4A 2ACJA 1W4MA 2IXSA 1H9TA 2ZGWA 3HL8A 2VOOA 4HQMA 2DTRA 1CQTA 4KITB 2XSDC 2JA7J 1HK9A 3A8MB 3FXUA 4IJAA 2NVUB 2DMTA 4AUXA 2PUOB 2E2HJ 2HGCA 7AT1B 5LFAA 1W7PD 3DP7A 1M3AA 3CMMA 2FSWA 5AONA 4OIPF 9ANTA 1BBZA 3LFUA 3LA3A 1NE8A 2X3XD 3OW2A 1TT0A 3LA2A 1W5TA 2L01A 1JT6A 2E1MC 2L3QA 4WCIA 4XU2A 3OA6A 1YIJA 4O3MA 5IP9J 1X1AA 2L7MP 1J3TA 2XDBA 3HPGA 2CH0A 2V7FA 2R7FA 4JX6A 4UV8A 1JHFA 1FY7A 3U1KA 1DUXC 2Q1ZB 1VQ7A 1SD4A 2FUG2 2OTJA 3QODA 4A3GJ 5LLQA 2IVWA 5FWBA 2GGRA 4F7UB 5K1YA 2CUDA 3TO6A 4YIFA 3EG9B 4AVZA 2QTVA 3VU3C 4NL2A 4J9GA 2N8GA 2V8KA 4P9FA 3F8BA 3NRVA 3PIOF 1IAWA 2DA2A 1RAAB 1WGSA 1Y1VJ 3M0SA 1ZGWA 2V9VA 4G7OF 3ZQ7A 1BI2A 3CMAA 2QVOA 4RGSA 3MO8A 5FU6C 2M8GX 1Z67A 3OYIA 3H0IA 3IC7A 3K2ZA 3CCEA 4C5HA 3OYKA 1YWPA 3TKYA 1VNDA 2EPFA 3NARA 4O6JA 5FROA 5L3EA 2W7NA 1WA7A 2LC4A 1TQIA 3ZQFA 2EQIA 3J81Z 1M27C 2XKOC 3CD6Q 5HDGA 1AWJA 2J6KA 4ZYAA 4KGZB 1I81A 3M56A 4C2UA 2O3FA 3F6VA 2I2LA 2F5CA 3I58A 4BI4A 4LMYA 2J06A 4HAMA 2WY7Q 1ZREA 1PKTA 1K8AC 3F22A 2KIUA 2BUDA 2D6FA 4KN7X 1Q82U 4JK1X 4W1UA 1DP3A 3I59A 3FMSA 1ZR2A 2KLOA 1GCQA 2QGUA 1JJ2S 5CVVA 3BZ6A 4RA2A 1J0RA 3OS2A 5DLQE 3AAFA 1U3EM 4XOPA 1BCOA 2V9KA 2L9RA 4PJOC 2QA4Q 4M75A 3EFRA 1XDSA 5F08A 1YHQT 1Z3YA 2K4BA 3JRAA 4C92G 2HYGD 4RBOA 2EBIA 2XGDA 2IBDA 4V2FA 1I6XA 5GTIC 4EPCA 1AWWA 1WXBA 2AO9A 4BQNA 3IV5A 1G3TA 5GAMg 1OX9A 3QYFA 2Y9YA 1G83A 3VB2A 5IT9K 1M5Q1 3CJTB 1A36A 1DU6A 3BG9A 3G7ZA 3H0HA 4HNUA 1XGOA 3F23A 1FXXA 3OR2C 1VQ4A 1GCQC 4BH9A 2DNUA 2V1QA 1VQ4Q 1SMYF 3S1RJ 1IGUA 2ZPGB 1YIOA 2OTLT 2EK5A 2FF4A 2RNJA 1JKRC 4S0HB 3PVQA 4ZN3A 3CCVQ 2VYTA 3O5ZA 2JWTA 1B72B 2XKPA 3QU6A 3DBRB 2Y0SA 4IHSA 2XF6A 2HBWA 1NPRA 1VQ7Q 3LGLA 2WB1N 3L2QA 3ZMUA 2PMHA 2NVQJ 1JQQA 3JB9H 3CCET 4FX4A 1R22A 5I21A 3CPWP 5DD8A 3MFKA 4C92E 1K0XA 2IGMA 4M7DF 2FNPA 3A1YA 2WWYA 5IAYA 1EH7A 2M9HA 2M02A 2OTLI 2M30A 3PMTA 4ZGJB 3OIPA 2XB5A 1KONA 1X27A 5E18F 1K73R 2AHJB 4ZC3A 1N25A 4XRSG 1U0JA 2CUEA 3ZMVA 1KC8C 1GL5A 1W0UA 2HFHA 1GXIE 2IT0A 2CMPA 1OZ3A 2QYOA 5AIPA 4OB0B 5FLXE 1K76A 5LRRA 4D9JA 2Q2EB 3A98A 2OJED 2DPPB 1R58A 3CCMA 1BJAA 2HZDA 2VE8A 4M75B 3I3LA 3ABUA 4LGWA 3UR3C 4HNTA 3P7NA 1QQIA 2FU4A 5D6XA 3LSHA 3ZPLA 4E7IA 3RTRA 1QMCA 2A37A 2GA1A 3I55T 2DERA 4UB6C 4RTVA 1D5YA 3ER0A 2VXZA 4KMUX 1RACB 4NOYA 5FFXA 4RDUA 5GAMf 4LIVA 4GBQA 2VOPA 1HYOA 1Z6RA 3SEMA 4JRQA 1UG1A 3KE2A 3QZ9B 2HPMA 2B63J 3LWFA 2LBFA 3W2AA 3VUZA 5HVQC 4JS5A 4CCKA 2W82A 4B47A 4C8QA 2XROA 3L00A 1ZLMA 1YX3A 2HR3A 2GBYA 5CVIA 3RCOA 3M57A 4BKXA 1BOBA 2Z99A 4R79A 4IRHA 5JVTA 2V26A 4QVDA 1SANA 3KYLA 4XQ3A 1AKHA 2IPOB 3JCMd 5CK9A 2OZ6A 2HXIA 1M30A 1SPKA 4WK8F 4NUBA 2LDMA 5KYNA 1JGSA 4QQ6A 1OJLA 2KIMA 2YRDA 3K4MA 1KGSA 3U2RA 1RNLA 2Y0SN 3DKYA 2EV6A 3RQIA 4XRFA 1O4XA 5CKFA 2KRNA 5KYYB 4MQ9F 1R9TJ 3I64A 3BY6A 2JXBA 3PSIA 3ZMZA 3G71I 1WSUA 4WX9A 1E3OC 3LSIA 3GTJJ 3K69A 4VUBA 2EYZA 3BG3A 2F2EA 5LGUA 1RL2A 2JZ2A 2VXEA 2DOEA 1YQAA 2YR2A 1K61A 5FWCA 4EJUA 2D45A 1X1PA 2MLKA 4KT0E 2CG4A 1UFFA 2A3SA 3CJQB 4M77C 1Y1WJ 1YCYA 3TSZA 2BZ8A 3ASNH 1JEGA 4M6YA 2QG9B 2E2JJ 4GFBA 4B48A 3X28B 1I3QJ 3HOZJ 6PAXA 1XCVA 2HMAA 2F2VA 1ZSZB 4JZ4A 1J75A 1ACMB 3U21A 4A4EA 2RQWA 2BE7D 3EHQA 3FHNA 3S93A 2RVCA 2TCTA 2YDLA 4PJNA 3HPWA 4J7FA 5KE2A 4XN0A 1VQOI 1QVGS 4LLNA 2K02A 3HRSA 1P6RA 1Z1DA 2QF7A 4B8XA 3F8NA 2ZPEB 1IXDA 4U7DA 4DBQA 2F5TX 4Z02A 1A0NB 4K2EA 1B3QA 1VQ9I 2GNCA 3B6CA 2IEKA 4J6WA 1KYWA 4IF4A 2DOAA 1P4XA 2CQXA 4G94A 4M3FA 2X9HA 5GMKm 3HC7A 1HBXG 2VN2A 3L2RA 4F3QA 4M75G 4BHCA 5FD6A 2XRNA 2P8TA 4LLGF 2HI3A 1PD0A 2DJNA 4I7HA 1XSXA 2E7WA 1IV6A 1WDXA 2DBKA 2SEMA 1XDUA 1G5VA 1YFNA 1FYNA 2H94A 2E64A 1SF9A 2ZPBB 1K73U 2OPTA 3FKJA 1X6BA 2MCNA 3TDZC 1MMAA 2ED1A 5CKBA 4C8QC 4YEJA 5HDKA 5D5UB 3CCJA 3UPUA 1M90R 2M7AA 1UG0A 3G6EI 4IL6C 1FYLA 6AT1B 1WHUA 1PKSA 5IT9E 1IN7A 2EJRA 5CJ9A 2R5YB 1VOMA 2HQHA 5FLVA 2HQRA 1NEGA 2DL3A 1QVFA 3NTKA 4P5NA 2KT0A 3SWNB 1D3BA 1OR7A 5DTDA 1WZOA 3I9V2 1Y07A 3FBIB 1U9NA 1KU2A 2F4OB 3K2AA 1UFMA 3KZIC 4P96A 4XRSA 1MDMA 2M0CA 2VKHA 1WH5A 4ZYEA 3I0TA 3ECOA 4A3FJ 1H8KA 1WHLA 4F7ZA 1N9SA 3E0JB 3JCMc 1M8VA 1XC5A 1N5ZA 4GDFA 3BR5A 4FW2A 1BU1A 3A8HB 3HUGB 4B3XA 1R8OB 3FDRA 3OYJA 4EDUA 2EFIA 1UZCA 3OY9A 3WU0A 3CBPA 3CXCP 1Q81U 2XAJA 1ZLKA 2R7SA 4XLPF 5CR2A 4FU6A 1YO5C 3CCQA 3LYIA 2OBPA 2FVUA 4N9IA 5J8CA 1IDYA 2COBA 3ZQHA 4M78G 2DT6A 5HNFA 2K9GA 4GLKA 2DL7A 1Q82C 3BZKA 3I56Q 4JLIA 1LKXA 1VQ5T 4HV5A 4UUSB 5LRSA 1ZR4A 4BAYA 2KAFA 1YW9A 2MOXA 2Y48A 2AXLA 1HSJA 1G2HA 1T0JA 4UVAA 1Y0MA 5EEGA 1NHAA 4IIMA 3CC4T 3QWLA 1JJ6C 2RO0A 3HTUA 3MPUB 5E20A 5GAN7 1ABQA 3DPLC 2O8KA 5HLTA 2LC2A 3BC8A 3TL4X 5FLXZ 2EKHA 2M5WA 1QPIA 2A08A 8ATCB 4XKVA 1XGNA 1Z7UA 5DEQA 2HNHA 3K70C 1BIBA 1YITA 1LOJA 1YI2I 3LSJA 4BQOA 2OX7A 2BGCA 3DLLA 3WHBA 5H20A 4M77D 1TQMA 1QZEA 1OX8A 4ZN1A 4HBLA 4BNCA 1U3OA 5JLWA 1W1WE 4AFSC 2RGVA 5EF6A 4FTHA 4N4OB 5GANj 1K78A 4AT1B 2DFIA 2F5DA 2RPNA 1TP4A 1HQCA 4XORA 4A0ZA 1N77A 8AT1B 4D7MA 3HG9A 3V8JA 1FIPA 2QA4I 1MGTA 1V4RA 1W7PA 3LFKA 1HSQA 2A61A 2JA2A 4E7ZA 2KRHA 2KT8A 3BT9A 5EZHA 1TS9A 2R7WA 2XPWA 4CCNA 1BYMA 1VQ6I 4IRGA 2BIVA 4LG0B 3DV8A 5FFZA 1OCRH 3QU3A 1ZG5A 3TGNA 4FL6A 3RPQA 3E6CC 1B34B 1E6HA 2WBMA 3BY7A 4A4FA 1USSA 4A53A 1QCFA 5GMKj 1KG1A 2RN8A 2CWEA
chains in the Genus database with same CATH topology
1Q7YU 4OGCA 5DCFA 4PNOA 4F7UF 3DKMA 3QPHA 4IPAA 5JI6A 4WCGA 2EKOA 4PJOE 3F3XA 3F6OA 3HRMA 3MEXA 5HK0A 1UGRB 4B09A 1I5LA 4HW0A 5GAOq 2DJZA 4E70A 1O3RA 2RJFA 3MZHA 2F5KA 2RHUA 1O3SA 2OD5A 2VGNA 4XTXA 1R1UA 1HKQA 3CCVA 4YFXF 4HF2A 5D6EA 2JNGA 4BY6C 1VQKA 3JW4A 2HAXA 5K5RA 2K2VA 2DI3A 3ISPA 3GEZA 5LEJA 5EG2A 2L02A 2NAZA 3BPVA 3LWIA 3PQJA 3RYPA 5KH6A 1S3JA 1K7AA 1BKBA 3I59B 2FB7A 2ESNA 3CC2A