5GANe

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 8
structure length 75
sequence length 83
chains with identical sequence p
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gane00
5LJ5f 4XU0A 3JCMb 4M7AB 3V8LA 2YLCA 4M7AA 3JCMe 3QSUA 3VU3C 4PJOA 4PJOB 4M78B 4HT9A 2RA2A 2YLBA 3JCMV 4XU2A 1U1TA 4EMKA 3M4GA 4C92F 4XTYA 4EMKB 5GANf 4XTXA 3SB2A 4M77C 5I21A 5LJ5g 4M7AF 1LOJA 2E1HA 2DXUA 4XU3A 3EFRA 4C8QD 4M7DC 5GMKm 1U1SA 2DTHA 4PJOF 3JCMg 3RKXA 5LJ5h 4NOYA 5LJ3f 3HSBA 2VXEA 2ZGWA 2FB7A 4XU1A 2I2LA 1Y96A 4XTUA 1Y96B 5GANh 4M77A 4M75F 4C92A 1YCYA 4M78E 4C92B 4EMGA 5GANj 3RIRA 4HT8A 3JCMX 3JB9H 4M7DA 5GMKi 5GAN5 5GAMd 4J6YA 4M75C 3BW1A 3JB9I 4XQ3A 1N9RA 1X01A 5GAMj 4NL2A 4C8QC 5GAMh 2YHTA 2EAYA 5LJ3h 3JCMf 1LNXA 4QVDA 4JUVA 1I8FA 5GMKl 2DJZA 1KQ1A 2QTXA 4J6WA 4M77F 3JB9G 4PJOG 4M78G 3V7RA 3HFNA 2EJ9A 4QVCA 1WQWA 4M7DF 3L2ZA 4JRIA 2VC8A 5DY9A 1H641 4M75A 5LJ3j 5LJ5d 4M75B 3BDUA 2VXFA 4C8QA 3RUXA 4C92E 3GIBA 5LJ5j 1HXDA 1M8VA 2Y90A 3JCMh 4F7UA 4RCBA 4F7UB 1TH7A 3JCMQ 5GANd 4HA8A 1HK9A 2E65A 1I81A 1WNLA 4M7AE 4XTZA 5GAOn 4M78D 2RM4A 4M77B 4PJOE 3RKYA 3RKWA 3JCMJ 1KQ2A 1M5Q1 3JB9J 2CGHA 4C8QF 1JRIA 4M7DB 3PGGA 4C92G 2DZCA 5LJ3d 4M7AG 4V2SA 4X9CA 4F7UF 3FIFA 5GANe 4RCCA 4EMHA 1JBMA 4M75E 3SWNC 3AHUA 2DTIA 5GAN6 3V8KA 1I5LA 1N9SA 5GMKh 5GMKj 5GAMe 4PNOA 5LJ3e 3FB9A 1B34A 1LJOA 4J6XA 1B34B 2DVEA 2DTOA 5GAN2 3RESA 4DQ2A 2HNIA 4M78C 3V8JA 4C92D 4M77E 3V7CA 3JCMd 4M75G 4C8QB 4EMKC 4JRKA 2DKGA 2EJFA 3SWNA 1MGQA 1BIAA 4M7DE 2JN0A 5GAOm 5GAOp 4M7AD 2RB6A 4XTWA 4A53A 2E41A 4NL3A 2RD1A 3JB9D 4F7UG 5LJ5e 4PJOD 2E64A 2E10A 1I4K1 3V7SA 1WQ7A 4M78A 3EFSA 3QO3A 4M77G 3FJPA 2FYKA 3QUIA 4MMKA 4M7DG 4A54A 5GAN3 5GAN4 4XTVA 4M75D 3JCMP 4N0AC 3BY7A 4C92C 4C8QE 3JB9F 4M78F 5GAOl 1D3BA 2EJGA 1D3BB 5GAMf 3HFOA 4OP0A 4F7UE 1WPYA 1BIBA 2DZ9A 4MMLA 3JCMc 4JLIA 4M7AC 5GANg 3JCMW 5CAIA 4PJOC 4X9DA 4M77D 4Y91A 2DXTA 2K57A 5GMKe 3L1AA 4N0AA 5GAOr 3RERA 2EWNA 4M7DD 5GAN8 4WF2A 3INZA 3QHSA 3SWNB 4C8QG 4J5YA 5GAN7 5GAMg 5GAOq 3BFMA 5LJ3g 2DEQA
chains in the Genus database with same CATH superfamily
2RJEA 3GPLA 1YN8A 1Q7YU 1VQPQ 2YLBA 4FYXB 1Z9ZA 3X24B 1R0BG 3CMET 5D6WA 2PTKA 4C0FA 2EQUA 2JM8A 2MF2A 4MDWA 1UUEA 3KFVA 3F70A 4C92B 3E19A 1UE9A 4M75C 3OYLA 2JNGA 4FYYB 4CC2A 2QTXA 5EC7A 2LNHB 2RJDA 2DD4A 2EJ9A 4J9IA 2M0OA 4A4EA 5LJ5d 2CP2A 2IVWA 3VYHB 4IUTA 3QYGB 2LZ6B 2AZSA 1QVFP 1PSEA 3C12A 3OYFA 3PVLA 1M5Q1 1UGVA 1PWTA 3NTHA 3EG9A 1IREB 3RBBB 5J26A 1OPKA 4RTVA 1AVZC 4Z8AA 1KSWA 3CPWA 2EKHA 3CPWS 2O88A 2HMAA 1B34A 1KD1C 1GXIE 2P4TA 2K3YA 3QDRB 3OS0A 4XTWA 1BYMA 1P92A 1WZOA 3NMZC 2KRNA 3OYBA 2RPNA 2NUZA 4E2FB 2LX9A 2JOYA 4N0AC 4RTZA 4D6WA 2F2WA 2WACA 3I55T 4LD9K 5LL6S 4M78F 3CCJT 3JRZA 1VQ4T 4Y91A 1OQKA 4Z02A 2L3SA 2DIQA 5GAMg 2YDLA 3BFMA 2XDBA 5CR2A 1JXOA 4JLGA 3TSZA 2XIDA 4E47A 1U06A 1RACB 1SPKA 1DJ7B 1X6GA 3H6ZA 1D1CA 4XTXA 1VQPT 2QGFB 4HVUA 3I55A 3SB2A 4QQGA 1B07A 1EFNA 4C8QD 2M16A 3CCJA 3HP9A 1PG5B 1VQ4A 2AKKA 1PSFA 2EBPA 1Q82R 1YCSB 2YXYA 1M1FA 2K4YA 2ZGWA 1AWWA 2DL5A 5ECAA 3X20B 3ER0A 2HSEB 4C92A 3ZBDA 3ME9A 1T0JA 3M5AA 3JB9I 4FYWB 1VYVA 1X01A 3L42A 1VQ7Q 4M7AG 4JUVA 2NWMA 4CRIA 1VQPA 2PUKB 4JJNK 4IIOA 4FT2A 1SG5A 3OS2A 4DOWA 1H641 4Y92A 3VS0A 2X51A 2VXFA 3WVDB 1XJWB 3AT1B 8AT1B 4RCBA 4F7UB 4HA8A 1IRXA 1Q7YR 4LUDA 1UHCA 2RM4A 4M77B 5CKHA 2BKDN 2W0ZA 3MKDA 2LMJA 3GBQA 2COWA 2OJ2A 4OMNA 3SEMA 1Y71A 2O2OA 2DO3A 3LGLA 2CDTA 4ANJA 1ZSZC 3OS1A 1TXQA 4B9WA 2ABLA 1WHGA 2DXBA 4J8OA 1LJOA 3RESA 1VQNA 2RJFA 4M78C 1WFWA 4EMKC 3LH5A 2CT3A 1GCQC 5CKEA 4BE1A 4OB3B 4L6V5 3X28B 1WQ7A 4CC7A 4BDZA 3I9QA 2KMTA 3LGFA 4CC4B 2QA4Q 4KRTA 1LVKA 3LH0A 5GAN4 1BI2A 2VVKA 3EG2A 1Y07A 3J81E 5GAMf 3QIIA 1I1JA 2PVOB 4F7UE 4OB2B 2DZ9A 1M90R 1BB9A 2QEXQ 1B7TA 4C5GA 5GAOr 3EHQA 3O8VA 1Q81U 2O4XB 1Y7XA 5IAYA 3O5ZA 2D8JA 9ATCB 1MHNA 2XMFA 2FZKB 3EHRA 4PFPA 3M55A 5LJ5g 3CC7Q 2DTHA 4QQDA 3OW2P 4IUQA 3EFOB 1RAFB 1ARKA 3M59A 1PD1A 2E5QA 2X9HA 3M54A 2ESWA 4R56A 1NE8A 4J6WA 1CKBA 5CQXA 2ZPIB 4FCYA 2VWFA 1S1NA 1VQ7T 4ZNXA 4M75B 2ZPHB 3MEVA 3LX7A 2HQEA 1KQSP 2CP5A 4F7UA 2HSPA 5GANd 2E65A 1I81A 5AYFA 5GJWB 3M4YA 4KGZB 4DBFA 2CYZB 5FLXE 3PT9A 2DZCA 4V2SA 2QQAA 2D0NA 2P4RA 4E7HA 1ZA2B 2LP5A 2YUNA 1VQ7A 2M9UA 3LWIA 4OMFB 2Y4XA 1UB4A 1IGQA 2JMAA 3MHXA 1PRLC 1X43A 3NPFA 3SWNA 5A0DA 2BUDA 5GAOm 4FL6A 2XDPA 4A53A 2V1RA 4MZPA 2K5FA 3CEYA 1H8KA 3LYIA 1RL2A 1W2BP 5KE2A 2PQWA 3A8LB 3S3NA 5FU7C 4KT0E 4Y28E 1BIBA 4JLIA 4QVZA 3FC3A 1WXUA 4ME7A 3CBMA 2LJ0A 4J7IA 1K76A 3ULRB 5KYYB 1X69A 3NFCA 3V8KA 5LJ5f 5J39A 4OB1B 3VU3C 4LDYA 2R5AA 3JAME 2KXDA 1UG1A 1VIFA 2QA4A 2RH2A 1PD0A 2IG0A 1ZUYA 2K5LA 4GBQA 4M7AF 2E1HA 1MNDA 4HVWA 5GMKm 3JCMg 4GLMA 2OX7A 3VS7A 1M1KU 2ATCB 2VXEA 4BE0A 2QEXA 3EFOA 3REAB 1K8AC 3BW1A 2RN8A 3VS2A 1X27A 3VS1A 2E3HA 2F5KA 1KC8C 2JTEA 3FLGA 1K0SA 1YBYA 4M75A 1UEBA 2V8JA 1Q81R 1M3BA 3CC7A 2RNAA 1NJIU 2L89A 3CXCA 4D8KA 2EYYA 3CXCS 1N8RU 3HKSA 2RJCA 3M0TA 4J9EA 2DNUA 3CCUT 4M7DB 5FW9A 5GANe 1S72A 3TVTA 2F2VA 3CC4T 2XDDA 3H0IA 4PFOA 2DXCA 1YNZA 1IZ6A 1H92A 1FXXA 2DVEA 2DTOA 3OYMA 2DL7A 3CCRQ 4HCKA 3DB4A 2CP7A 1ZSZB 3QKJA 3I56T 2JN0A 2KR3A 2QXFA 2EYZA 4IUPA 1TOVA 3J7AF 3KXTA 3QWYA 1BCOA 1ZQ1A 2K5IA 2HAXA 3SHWA 2J6KA 2EQIA 1NYFA 1VQ9Q 1GL5A 2WSCE 2EJGA 1UGRB 3U23A 4M7AC 3JCMc 5C0MA 1SSFA 4JDSA 4X9DA 1N27A 5GMKe 1TSFA 4N0AA 3GNGA 4FM4B 3INZA 4J5YA 5KYYA 2KYBA 2X4WA 1ZLMA 1Q86U 2DL4A 1K73C 2M51A 2RHIA 4YTLA 4RTUA 5L23A 1HD3A 2B86A 2CP0A 2KRSA 2RQWA 1UGPB 1PC0A 1MMAA 1RI9A 3OSVA 2OTJQ 5LJ5h 2WSEE 1FYNA 1BCMA 2PU9B 1Y96B 2COYA 1OZ3A 4M78E 4KGVB 2YUPA 5FWBA 4F17A 2YSQA 1V76A 4B6MA 3EAEA 2EAYA 1KQ1A 1QVGP 4M78G 4ZN3A 4EIKA 3CMEQ 1O9SA 4N4HA 4DEYA 3UT1A 1UDLA 1I0CA 1QVFA 1VQ8Q 1ZBXA 3PVQA 1V1CA 2KBTA 4RG8A 2DBKA 2ED0A 1WXBA 2DFUA 4C8QF 5GJVB 2O9VA 2E70A 4J83A 3OQ5A 1AEYA 2MYSA 1OZ2A 1M1KR 3VKIA 5HKCA 3TSWA 3RR6A 1MMNA 2HNIA 1EX4A 4C92D 5CVIA 3V7CA 1ZSZA 4KBMB 1MGQA 1QCNA 1JEGA 2E12A 1RAEB 5CO7A 2RQUA 3CCRT 2P0QA 3OB9A 3GOXA 2CT4A 4M78A 3QYHB 1BKBA 4RTXA 4AG1C 2JT4A 1NEGA 1GCQA 3JB9F 1N5ZA 3UA6A 3A8MB 2O01E 2J6OA 3EGDA 4E6RA 3EG1A 2XI9A 1N8RR 2V8KA 1VQ9T 2K9GA 1U5SA 1PM3A 2JTFA 3I5RA 3QHSA 2J6FA 1OYXA 3CCRA 1D0ZA 1TUGB 5FU7B 4KULA 1BBZA 2GQVA 1U1TA 3L2UA 1VQMT 5D7UA 4X34A 3MEWA 5GANf 1YHQT 1C1AA 1FMKA 3OYHA 1VQ6Q 2ZPBB 1RLPC 2PUOB 4DBHA 1OX9A 1VQKA 2OTJT 1W4SA 1Y96A 5GANj 3LW5E 3G1JA 2M0YA 2R58A 1N9RA 1UHFA 4C8QC 2DERA 2SEMA 2EPDA 2F1LA 1BI1A 2VKNA 4X1VA 1IHWA 1WHKA 4LDVA 5FU6C 2NUTB 1QVPA 1M8VA 2RI5A 1VQ8T 2OTJA 1Q86R 2KXCA 2R57A 4JJBA 1FWZA 1W1FA 1UJYA 4X9CA 2D0QB 5KYUB 4L5GA 4UC4A 4AFQC 1KHCA 5GMKj 5GAMe 2J05A 4P5NA 3FB9A 3CMEA 1RAIB 2FZGB 5HK0A 1VQ8A 2LCCA 1UFFA 1M90U 4PJOD 1J3TA 2MI6A 2PZ1A 3MO8A 1FMVA 3JCMP 3MEAA 1I5OB 3OYAA 3BY7A 2B8AA 3EG3A 2EFIA 2MAMA 1RAGB 4C5EA 1RI0A 3M57A 4J9BA 2K2VA 4M77D 2DXTA 4ZGJB 2DD5A 1JXMA 3CCQQ 2X35A 1GCPA 2GBQA 4M7AB 2K3BA 2YLCA 3QWXX 4E7JA 2LQKA 2HKQB 4XU2A 1JO8A 2OTLQ 1IO6A 2DEUA 1U3OA 3D7SB 3OW2A 1VQ5T 1QP2A 3GLXA 3OW2S 5I22A 4HCCA 3RKXA 3CBPA 2HD0A 1E6HA 1VQ6T 1VA7A 2AT1B 5GANh 4J9GA 1YCYA 3CCLT 2DK3A 3FEOA 1AWOA 1QWFA 5GMKi 2QQRA 4J6YA 4DBQA 1NPRA 1I8FA 1IB8A 1TUDA 1YITQ 2JTMA 4II1A 1KQSA 1OOTA 3JSCA 2NUTA 2CZ0B 1GBQA 2X4XA 1VQ6A 3CCVQ 3MP8A 3RNJA 4M7AE 1XOVA 4PK4A 4OMQA 3JB9J 2CGHA 3PGGA 1K1ZA 2EYWA 1AOJA 5KYUA 1KD1U 1OPLA 2E3IA 4EMHA 3M0SA 4QQ6A 2MOXA 3AHUA 5GMKh 4OMOA 4KH1B 3CC2T 3JCMd 5CKDA 2A0FB 4JRKA 2QI2A 1WLPB 1K9MU 3C94A 3TCJA 2E6NA 3JB9D 2RD1A 4RG2A 5LJ5e 2DE0X 3PMTA 1W2BA 1BU1A 1W2BS 5FRNA 3EFSA 1ZA1B 4LD6A 2COZA 1X6BA 1YI2Q 2GCXA 4M75D 3E2UA 5I2MA 2DA9A 3VUBA 3HFOA 4OP0A 4GY5A 4KUDK 2K57A 2OAUA 2XK0A 1T3LA 3SWNB 2K3XA 4R0KA 5LJ3g 2CP6A 1YJNQ 2XICA 3HRTA 4M7AA 3V8LA 3CCQT 1IXDA 4PFZA 1PKSA 3M4GA 3EH1A 2LDMA 2P0KA 1UJ0A 3VJPA 2OTLT 4E7ZA 3WVEB 2EGEA 1RADB 3CCET 1AD5A 2RF0A 4EMGA 5HCKA 3QBYA 5IHNA 3X25B 3CCQA 1CKAA 5GAMj 1M8MA 2AIRB 2QG9B 4KH0B 3OY9A 4DEXA 2DJZA 4PJOG 1WQWA 2OTLA 4JJCA 1YITT 3E9FA 3RUXA 3TU4K 3VS4A 4ELZC 3CPWP 4BE2A 1TH7A 1YFNA 3OSSC 3JCMJ 5IT9E 4OVAA 3CCVT 1H3HA 3Q1JA 1V29B 5FU6B 1K0XA 5M9OA 1E6GA 3OBYA 5HY6A 1WHHA 2FZCB 3QZ9B 8ATCB 1I5LA 5D6XA 2FPFA 4Z89A 1MV3A 1YITA 5GAN2 1PNJA 1WJSA 2EYQA 1O75A 3CCUQ 3MCAB 2E41A 1B3QA 3CCVA 3META 2IPOB 1A0NB 3QO3A 3CC4Q 3E1SA 2FYKA 4A54A 2RO0A 3OYNA 2JXBA 1SRMA 4WCIA 2IIMA 4C8QE 1YI2T 2JJ9A 1M27C 4BI4A 4LDXA 4MMLA 1NPPA 2JW4A 3I56Q 1VOMA 2HL3A 2PVDB 4RKUE 1XTDA 4M7DD 3H41A 4WF2A 4C8QG 1M1KC 3MP1A 1G83A 1KD1R 4M4ZA 1UTIA 3L2RA 2JS0A 1QCFA 4J9DA 2FEIA 1MNEA 4C92F 2KYMA 4C0DC 3LWHA 1YJNT 3PTAA 1GRIA 3VUZA 2M1HA 3MJXA 2DJQA 2GF7A 1N6AA 1JU5C 1K9MR 4IUUA 1EZZB 4RTYA 3TREA 2I2LA 3H9NA 3BE3A 1QVGA 4FU6A 1QVGS 5GAN5 1NJIC 4PJLA 1YIJQ 2KK4A 1ACMB 4BY6C 5GAMh 1QKWA 1YJNA 3JB9G 2MPXC 3RMQA 3HFNA 4XK8E 4JZ4A 3A8GB 4QW2A 3VYGA 3BDLA 1D1BA 4C8QA 2KNBB 5LJ5j 3A5ZB 1D09B 2DL3A 4PKCC 2LJ3A 3JCMQ 4JRPA 5DLQE 1VQLT 3RKYA 1KQ2A 1JRIA 4BD3A 1R8OB 2KQWA 2H3JA 3P8BB 1OULA 1SSHA 2DYBA 2ZPFB 3CCSQ 1OI1A 2LCLA 1N9SA 2KI7A 2DL8A 4PNOA 2KT8A 5HK3A 1ZSGA 4DA4A 2RI2A 1QW1A 5CKBA 4D8DA 2LQNA 3OMGA 1YJ9T 4IURA 2VYTA 4QKUA 4E7SA 1AZGB 4IKFA 3VS3A 3T9NA 1WYXA 1FX7A 1Q86C 2BZXA 4C92C 1XQHA 4DBRA 2ZZDA 1D3BB 4N4GA 2A3LA 1XNIA 1LCKA 3EH2A 3HL8A 3ZEHA 2EQKA 2VASA 4AFUC 3CCUA 4NS5A 1SEMA 1OV3A 1WHMA 4M78B 2RHUA 3R6NA 4EMKB 1WA7A 2CREA 1UECA 3KUFA 3CC4A 1WIEA 2LTOA 4F14A 4PJOF 4O5VA 4OMMA 3EGDB 1K8AU 2GFAA 2QDYB 4EDUA 3P8DA 2V26A 3I56A 4XTUA 1U8RA 1KFZA 2EKOA 1ABOA 3M53A 1VQMQ 1KC8U 7AT1B 2HKNA 4NL3A 2DIGA 3JCMf 4ZGEB 1YHQQ 4M77F 3C95A 1YIJT 5DLOA 2VGNA 4QVCA 2AKLA 4B9XA 4RMOA 1F1BB 5IXFA 1M4ZA 3GIBA 3NHNA 4AG2C 2EIFA 2Y90A 3UWNA 1JJ2P 1WNLA 4XTZA 4LDUA 5GAOn 2OAWA 3CPFA 3G4SQ 3MEUA 2V8IA 5KYXA 2KROA 1QLYA 1YIJA 1GFCA 2EW3A 4OMLA 2FO0A 2D8HA 2K79A 3S3MA 3EGXB 3E9GA 2RHYA 3OYIA 3IQLA 3CCST 1QVFS 2VB6A 5KCOA 5IH2A 2QDLA 3PIOA 1NG2A 3UA7A 2RB6A 2E64A 1I4K1 3QXEB 2L5QA 4HXJA 1YWOA 1Q82C 1NZ9A 3OYCA 3C0CA 5KYNA 1EIFA 1D3BA 2RMOA 3CCSA 1BK2A 1WPYA 1VQOQ 4PJOC 3G71T 2HBWA 1K73U 2L0AA 1OEBA 5GAN7 3QZ5B 4JS5A 4JZ3A 2KVQG 4BDYA 3M0UA 3R6OA 4EMKA 2CKKA 4M77C 4FT4A 5I21A 1Q7YC 1LOJA 3QJYA 4XU3A 1NEBA 1U1SA 1X6OA 2FPEA 2DETA 4C0DB 3OYJA 4M75F 3VRYA 3JCMX 4BI8B 1X75C 3CXCP 5KYWB 1VQ5Q 2YRDA 3A8OB 2LC4A 4OGCA 1ZHIA 2VC8A 1NYGA 4FYVB 4CI0C 3BDUA 2HBPA 4J9FA 1VQ9A 4HVVA 3CCLQ 3JCMh 2GFUA 2HQXA 5CKFA 1WJRA 2YUOA 2YT6A 5LJ3d 1M90C 3G4ST 4BACA 1WI7A 3NTIA 1VQMA 1UGSB 4O6JA 3QDFA 1K8AR 3EGXA 1YHQA 2CUDA 3RMSA 1X2QA 3A8HB 3V8JA 3TQ7P 1HSQA 2DYIA 3DLMA 1KC8R 4RUGA 1M2OA 1D0YA 2VV5A 2L3QA 2M02A 2AZVA 1ZUUA 1YJWQ 3G4SA 2RQVA 3QPHA 5GAN3 1AZEA 4C5HA 3WXMB 2BE7D 2CH4A 2XG8D 1NM7A 3CC2Q 5GAOl 2LRQA 2KDSA 2KAFA 2KEAA 2YWWA 4F16A 3JCMW 1G3WA 1PRMC 2DM1A 2EWNA 1VQOT 1AT1B 2C0OA 2BIVA 4A4HA 2DEQA 2MMPA 2FRYA 2KE9A 3GP8A 1GFDA 1OX8A 1Q95G 2OI3A 1VQNQ 2FPDA 4PJJA 6AT1B 2JVVA 2DRKA 2GTJA 2LJ1A 4FW1A 4IIMA 3OA6A 4PJNA 5FRMA 4OF1A 1VQOA 1RAHB 4F04B 1MV0B 4KUIA 5IHKA 1KG1A 1AWJA 1C0MA 4K11A 5KYWA 5GMKl 2HL5C 4OB0B 2MIOA 2E6ZA 4M7DF 4BI3A 1ABQA 2XU8A 1K73R 3HRUA 3CCEQ 4A4GA 4QT7A 4C92E 2Z0WA 1HXDA 2BZ8A 1SRLA 4XAXB 3X26B 2GGRA 3GNFB 1KIKA 2D6FA 3EGUA 4C92G 1K9MC 4ZTFA 4C0GA 2RHXA 3LLRA 2LT4A 3C4SA 2FL7A 3OYGA 2DPPB 2CSQA 2CSIA 5L8RE 1G3YA 1VQ5A 4ZTJA 3PIPA 1KQSS 2O9SA 5LJ3e 5FWCA 2GQIA 3S6WA 1IGUA 2RQTA 4Z88A 4CC3A 3CCLA 1M3AA 2DVJA 4J7FA 2DLPA 5FROA 3FJPA 2G6FX 1ZUKA 1KK7A 2MCNA 3VRZA 5CQYA 2HCKA 4ORZA 1YJWT 1ZBJA 5IXBA 1G5VA 5D6YA 2LNVA 2JMCA 4FSSA 3UF4A 3L1AA 5GAN8 1YWPA 1K4US 3M56A 1KJWA 4TVRA 4MZTA 1SHGA 4XU0A 3JCMb 3QSUA 2CH4W 1Q81C 4PJOB 2RA2A 3JCMV 1FMWA 1WHLA 1G3SA 2C06A 3PFSA 1AHJB 3J80E 5KCHA 1YJWA 2ZPGB 4M7DC 1VQNT 2QYZA 1MUZA 2K2MA 3CC2A 2ECZA 4AFSC 3G6EQ 2BZYA 3HSBA 1QMCA 1Y0MA 5KE3A 4MZMA 1CSKA 1SF9A 1ZX6A 4XU1A 1M2VB 3H0FA 2DAQA 2NUPB 2XD0A 3JB9H 1QQJA 2ZAEA 1NBEB 1WJQA 4JS4A 3OYEA 4XQ3A 4QVDA 1TTHB 3DKMA 4HCZA 1W70A 2QAZA 1WDXA 5I2SA 4A63B 2I0NA 3MP6A 4PJOE 3I35A 1R0CB 2F5TX 2EQMA 2LVMA 2GNCA 2PVGB 2BE9B 1OU9A 1JBMA 2K7AA 4LDWA 1D0XA 1VYUA 3RDVA 1C6VX 2A37A 4J6XA 1BI0A 1VIEA 1VQLQ 1GBRA 1TWBA 3CCMQ 4M77E 4C8QB 3OBWA 2DKGA 3CCEA 4LE9A 4ZN1A 1M3CA 5GAOp 4WTOB 4F7UG 5A0GA 3M0RA 4M77G 3QUIA 2HEQA 2XKOC 5A0LA 1H3ZA 4FW2A 3A1PA 1JB0E 2JUFA 3OMCA 1R77A 5KH6A 2HZYA 1YJ9Q 4ZGDB 3OYDA 1S72Q 3HRSA 3ZL7C 3JCMe 4E7IA 4PJOA 3CD6Q 3CMAQ 1MMDA 3DLLA 3OYYA 2P0PA 3EFRA 3M0QA 4ESRA 5AT1B 4NOYA 3NGPA 5LJ3f 4BB7A 2LX7A 4L59A 2FHDA 4J9HA 2K6DA 4KGXB 2ENMA 5J3BA 1M2VA 4M77A 2NUPA 3G6ET 4C0ZA 3HPWA 4HCBA 4N4IA 4E7LA 1HJDA 2ROTA 5LJ3j 1LNXA 2LQWA 5I11A 4FIBA 2CZ6B 2H8HA 2PNIA 3MPUB 3L2ZA 1QKXA 1JJ2A 1JJ2S 1K9AA 4FSXA 5DY9A 1YI2A 3VS5A 1VYTA 5CIUA 2AK5A 2ZPEB 3I5SA 2KT1A 2W10A 1HK9A 2L2PA 2DBMA 3G6EA 2CS7A 4M78D 3KBGA 4VUBA 5CCAA 2CZ7B 2EVRA 2DF6A 1N8RC 4RCCA 3SD4A 4M75E 2QA4T 2DTIA 3DB3A 1TS9A 1G2BA 4PL6A 4AT1B 2MWPA 1PKTA 4M75G 1G3TA 2EJFA 4BUGA 1BIAA 2QEXT 2EQJA 3CCMT 2O4XA 1AWXA 4AFZC 2E10A 2CZ1B 1I07A 5IN1A 3QG1A 2DRMA 2EGCA 4MMKA 5KYXB 3OYKA 1LPLA 4GLKA 3ZFJA 1OU8A 3TEEA 4AMCA 3H0HA 2ED1A 3CC7T 2O31A 2H3EB 3URGA 3L2QA 2RK1A 4PLIA 1TU0B 1VQLA 2V1QA 3CCMA 2QK0A 5GAOq 2A7YA 1KHIA 1RABB 3HHTB 2QGGA 3VS6A 4HT9A 1S72T 2F2XA 4XTYA 1VUBA 2FG0A 3CD6T 2MK5A 3CMAT 4MDXA 2XHCA 2DILA 3G71Q 2X3XD 1SKUB 1YP5A 4A4FA 2QQBA 1SHFA 2DMOA 2YUQA 3L2WA 3PNWC 1QP3A 1QWEA 1WHJA 2FB7A 2RK2A 1TUCA 3VV0A 2RHZA 4HT8A 3UDCA 1YJ9A 3PE0A 2E5KA 3M58A 2VGMA 2YHTA 5LJ3h 3RERA 1NLOC 1Y57A 3PMIA 3CMAA 3CD6A 4LXCA 1NLPC 2L8DA 4LN2A 4LUEA 3EG0A 4RTTA 2A28A 1WXTA 2A36A 2Y4YA 4JJDA 2ROLA 2FVUA 4F7UF 3FIFA 4R55A 1RUWA 3CQTA 2JM9A 3N5BB 1VQKQ 2NLUA 2AHJB 2CUBA 1T0HA 2X3WD 4M7DE 2G3RA 3SFMA 2HQHA 5C6SA 1HYOA 2GTOA 2MWOA 2RI3A 3FJ5A 2WSFE 3V7SA 3H8ZA 2RQRA 4OGEA 4PLLA 2YRVA 1PHTA 4M7DG 2P84A 2QTVA 3M0PA 5CK9A 1X2KA 3A98A 3JV3A 4A4KA 2D1XA 2X4JA 2EGAA 3FDRA 1RAAB 2E4HA 5GANg 3QJ6A 4DOVA 4ELYC 1E7OA 1WGSA 1TG0A 3CBOA 2D9TA 2JS2A 1QCOA 2LQ8A 2DX1A 2LCSA 2L3RA 1JQQA 4OMPA 2J7IA 2QQSA 2DXUA 3FRNA 4JRQA 2SRCA 2KY9A 1MMGA 3RIRA 2VUBA 4M7DA 5IHIA 3P8HA 5GAMd 5DM7R 1IHVA 4NL2A 3V7RA 1M9SA 3OS5A 3REBB 3THKA 2YRCA 3SDZA 4JRIA 4EPCA 4Q5WA 2J06A 3NTKA 3G71A 2CP3A 2BTTA 2A08A 1M30A 2ZCFB 1PCXA 2C0TA 3RKWA 2EYXA 4LNPA 1Z9QA 2C0IA 1BI3A 1UGQB 3HTRA 4C5IA 3EG9B 2KSSA 2JZ2A 2HDAA 3SWNC 1T3SA 5GAN6 4IUVA 1NJIR 1B34B 3UATA 4DQ2A 1D1AA 1G8XA 2NYSA 4BY6B 4RTWA 3L2VA 1VQKT 2X4YA 2FRWA 2F69A 1Q82U 4M7AD 3G7ZA 4HKEA 4PJMA 3I55Q 2LT1A 4XTVA 3CCJQ 3ASKA 1VQ4Q 3S3OA 1RLQC 1M1GA 4E7KA 3UPUA 2KRMA 3M9QA 2R5MA 1W6XA 5CAIA 4J9CA 2QQ9A 2QASA 3GF5A 1WX6A 2L3PA 2KGTA 4JPBW 5EG2A 5A2QE 4ATOA
chains in the Genus database with same CATH topology
2RJEA 4XU0A 3JCMb 3GPLA 1K73C 1Q7YU 3QSUA 2RHIA 1Q81C 3L2RA 4PJOB 2RA2A 2YLBA 4YTLA 3JCMV 1G3SA 2C06A 4C92F 3LWHA 1YJNT 4C0DC 3PFSA 1AHJB 3X24B 3J80E 5KCHA 3PTAA 1YJWA 3VUZA 2M1HA 2ZPGB 2GF7A 1Q86U 1N6AA 3CMET 1UGPB 5D6WA 4C0FA 4M7DC 3OSVA 2EQUA 5LJ5h 1VQNT 2WSEE 4IUUA 2MF2A 3CC2A 3HSBA 4MDWA 5KE3A 4MZMA 2PU9B 3TREA 4XU1A 2I2LA 3F70A 1Y96B 4M78E 1OZ3A 2DAQA 4C92B 2XD0A 4M7AA 1QVGA 3JB9H 4FU6A 1QVGS 3E19A 5GAN5 4M75C 1NJIC 1WJQA 4JS4A 3OYEA 4XQ3A 3EAEA 2KK4A 4BY6C 5GAMh 3OYLA 2EAYA 2JNGA 4QVDA 1YJNA 1KQ1A 2QTXA 3DKMA 4HCZA 3JB9G 3RMQA 4M78G 2RJDA 4ZN3A 3HFNA 1O9SA 2DD4A 2EJ9A 4N4HA 4XK8E 3UT1A 2M0OA 5I2SA 3A8GB 4QW2A 4A4EA 1QVFA 5LJ5d 3VYGA 3BDLA 1ZBXA 4C8QA 5LJ5j 3A5ZB 2IVWA 4PKCC 4IUTA 3VYHB 3QYGB 4RG8A 3JCMQ 4JRPA 5DLQE 1VQLT 3MP6A 1PSEA 3C12A 4PJOE 3RKYA 1KQ2A 3OYFA 2F5TX 1M5Q1 2EQMA 4C8QF 1JRIA 2LVMA 4BD3A 1R8OB 2PVGB 2E70A 3NTHA 4J83A 2KQWA 1IREB 2H3JA 3OQ5A 3P8BB 1JBMA 5J26A 4LDWA 2ZPFB 1OZ2A 1OI1A 2LCLA 1N9SA 3CPWA 3CPWS 3VKIA 4PNOA 5HKCA 5HK3A 1B34A 4J6XA 1KD1C 1BI0A 1VIEA 2P4TA 2HNIA 1GXIE 4C92D 5CVIA 4M77E 3V7CA 2K3YA 4C8QB 4DA4A 3OBWA 2DKGA 3CCEA 4KBMB 1MGQA 2RI2A 4ZN1A 2E12A 3QDRB 5CO7A 1QW1A 5CKBA 5GAOp 4XTWA 3OS0A 3CCRT 2P0QA 3OMGA 4F7UG 3OB9A 3GOXA 1YJ9T 4IURA 2VYTA 5A0GA 1BYMA 1P92A 4IKFA 4M78A 3QYHB 1BKBA 4M77G 3T9NA 3QUIA 3OYBA 2LX9A 1FX7A 2JOYA 2XKOC 4N0AC 4D6WA 5A0LA 1Q86C 4C92C 2WACA 1H3ZA 3I55T 4LD9K 1XQHA 5LL6S 3JB9F 3A8MB 4M78F 2ZZDA 1JB0E 2O01E 2JUFA 1D3BB 3CCJT 3OMCA 3JRZA 2XI9A 4N4GA 1VQ4T 5KH6A 2V8KA 1VQ9T 2A3LA 1XNIA 4Y91A 2JTFA 3HL8A 3QHSA 4Z02A 1OYXA 3ZEHA 4ZGDB 3OYDA 3CCRA 2EQKA 2DIQA 5GAMg 3BFMA 2XDBA 3HRSA 5CR2A 3CCUA 5FU7B 4JLGA 4NS5A 4KULA 3JCMe 4E7IA 4PJOA 2XIDA 4M78B 2RHUA 4E47A 2GQVA 1U1TA 3L2UA 4EMKB 1VQMT 4X34A 1DJ7B 3KUFA 3MEWA 3H6ZA 5GANf 3CC4A 4XTXA 1VQPT 2LTOA 3I55A 3DLLA 3SB2A 1YHQT 3OYYA 4QQGA 2P0PA 4C8QD 2M16A 3EFRA 3CCJA 4PJOF 3HP9A 4O5VA 3OYHA 1VQ4A 2ZPBB 1PSFA 4NOYA 5LJ3f 4BB7A 2GFAA 1K8AU 1M1FA 2QDYB 4L59A 2FHDA 4EDUA 2K4YA 2ZGWA 2PUOB 3P8DA 1VQKA 2OTJT 1W4SA 1Y96A 4XTUA 5J3BA 3X20B 4M77A 3ER0A 4C92A 3I56A 5GANj 3ZBDA 3G6ET 4C0ZA 3HPWA 3ME9A 3M5AA 4N4IA 4HCBA 2EKOA 3M53A 3LW5E 4E7LA 3JB9I 1KC8U 2R58A 1N9RA 1X01A 3L42A 4C8QC 4NL3A 2DIGA 3JCMf 4ZGEB 5LJ3j 1LNXA 4M7AG 4JUVA 4CRIA 4FIBA 4M77F 3C95A 2CZ6B 1VQPA 1BI1A 1YIJT 2PUKB 5DLOA 2VGNA 4QVCA 4JJNK 3L2ZA 1JJ2A 4FT2A 3OS2A 4B9XA 4FSXA 1H641 5DY9A 4DOWA 4RMOA 1YI2A 1JJ2S 1M4ZA 4LDVA 5FU6C 2VXFA 3GIBA 1QVPA 5CIUA 2ZPEB 2EIFA 3WVDB 1M8VA 2RI5A 2Y90A 3UWNA 1VQ8T 4RCBA 4F7UB 2OTJA 4HA8A 1HK9A 1WNLA 2R57A 3G6EA 4XTZA 2CS7A 4LDUA 4M78D 2RM4A 3CPFA 4M77B 5CKHA 2BKDN 5GAOn 3KBGA 5A2QE 1FWZA 3MEUA 2V8IA 4VUBA 5CCAA 2CZ7B 4X9CA 1Y71A 2D0QB 2DO3A 3LGLA 4L5GA 1N8RC 4RCCA 3SD4A 4M75E 4UC4A 3OS1A 1YIJA 2QA4T 2DTIA 3DB3A 4B9WA 1KHCA 3S3MA 5GMKj 3E9GA 5GAMe 2DXBA 2RHYA 3OYIA 4P5NA 3FB9A 4J8OA 3CMEA 1LJOA 3CCST 4PL6A 1QVFS 3RESA 5HK0A 2RJFA 4M78C 2MWPA 5KCOA 1VQNA 4M75G 4EMKC 1G3TA 3PIOA 2EJFA 1VQ8A 2LCCA 4BUGA 1BIAA 2QEXT 2EQJA 2RB6A 3CCMT 2O4XA 1M90U 4PJOD 2E10A 2E64A 2CZ1B 2MI6A 5CKEA 4OB3B 1I4K1 3QXEB 2L5QA 4L6V5 1WQ7A 5IN1A 3X28B 4BDZA 3QG1A 2KMTA 3LGFA 1Q82C 4MMKA 3LH0A 3MO8A 1U8RA 1NZ9A 5GAN4 3OYCA 1BI2A 3OYKA 3JCMP 3MEAA 3OYAA 3BY7A 4GLKA 2B8AA 1Y07A 2EFIA 3ZFJA 2MAMA 1EIFA 1D3BA 3TEEA 4C5EA 3J81E 5GAMf 3QIIA 3CCSA 2PVOB 1RI0A 3M57A 4F7UE 1WPYA 4OB2B 2DZ9A 3CC7T 4PJOC 3G71T 2K2VA 4M77D 3URGA 2DXTA 4C5GA 3L2QA 1K73U 5GAOr 2RK1A 3O8VA 4PLIA 4ZGJB 2DD5A 5GAN7 1Q81U 1VQLA 3CCMA 2X35A 5GAOq 3QZ5B 2O4XB 2A7YA 1Y7XA 1KHIA 5IAYA 4JS5A 3HHTB 2KVQG 4M7AB 4BDYA 2YLCA 4E7JA 3R6OA 2LQKA 4HT9A 1S72T 4XU2A 4EMKA 4XTYA 1MHNA 1VUBA 2CKKA 3CD6T 3OW2A 1VQ5T 3CMAT 4MDXA 1QP2A 3GLXA 4FT4A 2XHCA 3M55A 4M77C 5I21A 5LJ5g 1LOJA 3OW2S 3QJYA 4XU3A 1Q7YC 1U1SA 2DTHA 4A4FA 1X6OA 4QQDA 4HCCA 2QQBA 3RKXA 3CBPA 2HD0A 3L2WA 3PNWC 4C0DB 1QP3A 1VQ6T 3OYJA 2FB7A 2RK2A 3VV0A 5GANh 4M75F 4IUQA 1YCYA 2RHZA 3CCLT 4HT8A 2DK3A 3FEOA 3UDCA 3JCMX 4BI8B 5GMKi 1YJ9A 2QQRA 3M59A 1X75C 2E5QA 4J6YA 4BE1A 3M58A 3M54A 2VGMA 2YHTA 5LJ3h 4R56A 1NE8A 1NPRA 1I8FA 3A8OB 3RERA 4J6WA 2LC4A 5CQXA 2ZPIB 3PMIA 4OGCA 3CMAA 2JTMA 3CD6A 4II1A 1KQSA 1ZHIA 2L8DA 2VC8A 1VQ7T 3JSCA 4M75B 2ZPHB 4CI0C 3MEVA 3BDUA 2HBPA 2HQEA 3LX7A 2CZ0B 1VQ9A 2X4XA 1VQ6A 3JCMh 4F7UA 5GANd 2E65A 3MP8A 1I81A 5AYFA 4M7AE 3M4YA 2GFUA 2HQXA 1XOVA 2CYZB 2Y4YA 5CKFA 1WJRA 3JB9J 2CGHA 3PGGA 5FLXE 3PT9A 2DZCA 5LJ3d 4V2SA 2FVUA 4F7UF 3FIFA 2QQAA 4R55A 1M90C 3G4ST 4BACA 1KD1U 4EMHA 1VQMA 3NTIA 4QQ6A 1UGSB 4O6JA 3AHUA 4E7HA 1VQ7A 5GMKh 1YHQA 2M9UA 3RMSA 3VUBA 3LWIA 3N5BB 4OMFB 2Y4XA 1UB4A 2NLUA 2AHJB 3CC2T 3A8HB 3V8JA 3JCMd 5CKDA 3MHXA 4JRKA 2QI2A 3SWNA 5A0DA 3DLMA 1K9MU 4M7DE 2G3RA 3C94A 2BUDA 3TCJA 4FL6A 3SFMA 2XDPA 5GAOm 5C6SA 4A53A 2E6NA 3JB9D 2RD1A 2MWOA 2RI3A 2VV5A 4RG2A 5LJ5e 3PMTA 2WSFE 4MZPA 1W2BA 2K5FA 3V7SA 3CEYA 3H8ZA 4OGEA 1W2BS 3EFSA 4PLLA 5FRNA 2YRVA 3LYIA 4LD6A 3G4SA 3QPHA 4M7DG 5GAN3 2GCXA 5CK9A 4M75D 4A4KA 4C5HA 1RL2A 3WXMB 2XG8D 2X4JA 5I2MA 5KE2A 5GAOl 2PQWA 3A8LB 3S3NA 2LRQA 5FU7C 2KDSA 3FDRA 3HFOA 2KAFA 1BIBA 4KT0E 4OP0A 4GY5A 4JLIA 4Y28E 4QVZA 5GANg 3JCMW 4KUDK 1G3WA 3QJ6A 3FC3A 2K57A 4DOVA 2EWNA 2OAUA 4ME7A 4ELYC 3CBMA 1VQOT 2XK0A 3SWNB 1WGSA 2K3XA 4J7IA 2BIVA 4A4HA 3CBOA 3NFCA 5LJ3g 2DEQA 2D9TA 2XICA 2MMPA 3HRTA 3V8KA 3V8LA 5J39A 4OB1B 5LJ5f 3CCQT 3VU3C 4LDYA 3GP8A 2LQ8A 2R5AA 3M4GA 3JAME 2L3RA 1VIFA 2LDMA 2QA4A 2P0KA 2IG0A 2K5LA 2RH2A 3VJPA 2QQSA 2OTLT 4M7AF 2E1HA 2DXUA 2JVVA 5GMKm 3WVEB 3JCMg 3FRNA 4JRQA 3OA6A 1M1KU 5FRMA 3CCET 2VXEA 4BE0A 4OF1A 2KY9A 1VQOA 2QEXA 4EMGA 3QBYA 3RIRA 3X25B 2VUBA 4M7DA 1K8AC 4KUIA 3P8HA 5GAMd 1KG1A 3CCQA 5DM7R 3BW1A 5GAMj 4NL2A 5GMKl 3OY9A 4OB0B 2DJZA 4PJOG 3V7RA 1M9SA 3OS5A 2E6ZA 1WQWA 4M7DF 2OTLA 3SDZA 4JRIA 2F5KA 4BI3A 4EPCA 1KC8C 2XU8A 3FLGA 1YBYA 3HRUA 4M75A 1YITT 1UEBA 2V8JA 3E9FA 4A4GA 4Q5WA 3RUXA 4C92E 3TU4K 3CC7A 3NTKA 1HXDA 4ELZC 3G71A 4BE2A 1NJIU 1TH7A 2L89A 3CXCA 3OSSC 4XAXB 3CXCS 1N8RU 2ZCFB 3HKSA 2RJCA 3X26B 3GNFB 3RKWA 3CCUT 3JCMJ 2D6FA 5IT9E 4OVAA 1BI3A 3CCVT 3Q1JA 1V29B 4C92G 1K9MC 5FU6B 4ZTFA 4M7DB 4C0GA 1UGQB 5M9OA 2RHXA 3LLRA 4C5IA 3OBYA 5HY6A 2LT4A 5GANe 1S72A 2KSSA 2JZ2A 2FL7A 3C4SA 3OYGA 2DPPB 3CC4T 3SWNC 3QZ9B 2XDDA 5GAN6 5L8RE 1G3YA 1I5LA 1VQ5A 5D6XA 4ZTJA 4IUVA 3PIPA 1KQSS 1YITA 2DXCA 5LJ3e 5GAN2 1IZ6A 1B34B 1FXXA 2DTOA 2DVEA 3S6WA 3OYMA 4DQ2A 1WJSA 4BY6B 3DB4A 3L2VA 2EYQA 1VQKT 3QKJA 2X4YA 1O75A 2JN0A 3I56T 2F69A 1Q82U 2QXFA 3MCAB 4M7AD 2E41A 3CCLA 4IUPA 3G7ZA 4HKEA 4J7FA 3CCVA 3J7AF 3KXTA 3META 5FROA 1ZQ1A 2K5IA 3QO3A 3E1SA 2HAXA 3FJPA 2FYKA 2LT1A 4A54A 2RO0A 3OYNA 4XTVA 3ASKA 5CQYA 3S3OA 1YJWT 1M1GA 1G5VA 4C8QE 1YI2T 5D6YA 2WSCE 4E7KA 2EJGA 3UPUA 4BI4A 1UGRB 4M7AC 4LDXA 3JCMc 2LNVA 3M9QA 1NPPA 2R5MA 4MMLA 5C0MA 1SSFA 4JDSA 5CAIA 4X9DA 1N27A 5GMKe 2PVDB 2QQ9A 3L1AA 4N0AA 4RKUE 1XTDA 3GF5A 3GNGA 4FM4B 3INZA 4WF2A 5GAN8 4C8QG 4J5YA 4M7DD 1M1KC 5EG2A 3MP1A 3M56A 2X4WA 4TVRA 4MZTA 4ATOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 f;  4XU0 A;  3JCM b;  4M7A B;  3V8L A;  2YLC A;  4M7A A;  3JCM e;  3QSU A;  3VU3 C;  4PJO A;  4PJO B;  4M78 B;  4HT9 A;  2RA2 A;  2YLB A;  3JCM V;  4XU2 A;  1U1T A;  4EMK A;  3M4G A;  4C92 F;  4XTY A;  4EMK B;  5GAN f;  4XTX A;  3SB2 A;  4M77 C;  5I21 A;  5LJ5 g;  4M7A F;  1LOJ A;  2E1H A;  2DXU A;  4XU3 A;  3EFR A;  4C8Q D;  4M7D C;  5GMK m;  1U1S A;  2DTH A;  4PJO F;  3JCM g;  3RKX A;  5LJ5 h;  4NOY A;  5LJ3 f;  3HSB A;  2VXE A;  2ZGW A;  2FB7 A;  4XU1 A;  2I2L A;  1Y96 A;  4XTU A;  1Y96 B;  5GAN h;  4M77 A;  4M75 F;  4C92 A;  1YCY A;  4M78 E;  4C92 B;  4EMG A;  5GAN j;  3RIR A;  4HT8 A;  3JCM X;  3JB9 H;  4M7D A;  5GMK i;  5GAN 5;  5GAM d;  4J6Y A;  4M75 C;  3BW1 A;  3JB9 I;  4XQ3 A;  1N9R A;  1X01 A;  5GAM j;  4NL2 A;  4C8Q C;  5GAM h;  2YHT A;  2EAY A;  5LJ3 h;  3JCM f;  1LNX A;  4QVD A;  4JUV A;  1I8F A;  5GMK l;  2DJZ A;  1KQ1 A;  2QTX A;  4J6W A;  4M77 F;  3JB9 G;  4PJO G;  4M78 G;  3V7R A;  3HFN A;  2EJ9 A;  4QVC A;  1WQW A;  4M7D F;  3L2Z A;  4JRI A;  2VC8 A;  5DY9 A;  1H64 1;  4M75 A;  5LJ3 j;  5LJ5 d;  4M75 B;  3BDU A;  2VXF A;  4C8Q A;  3RUX A;  4C92 E;  3GIB A;  5LJ5 j;  1HXD A;  1M8V A;  2Y90 A;  3JCM h;  4F7U A;  4RCB A;  4F7U B;  1TH7 A;  3JCM Q;  5GAN d;  4HA8 A;  1HK9 A;  2E65 A;  1I81 A;  1WNL A;  4M7A E;  4XTZ A;  5GAO n;  4M78 D;  2RM4 A;  4M77 B;  4PJO E;  3RKY A;  3RKW A;  3JCM J;  1KQ2 A;  1M5Q 1;  3JB9 J;  2CGH A;  4C8Q F;  1JRI A;  4M7D B;  3PGG A;  4C92 G;  2DZC A;  5LJ3 d;  4M7A G;  4V2S A;  4X9C A;  4F7U F;  3FIF A;  5GAN e;  4RCC A;  4EMH A;  1JBM A;  4M75 E;  3SWN C;  3AHU A;  2DTI A;  5GAN 6;  3V8K A;  1I5L A;  1N9S A;  5GMK h;  5GMK j;  5GAM e;  4PNO A;  5LJ3 e;  3FB9 A;  1B34 A;  1LJO A;  4J6X A;  1B34 B;  2DVE A;  2DTO A;  5GAN 2;  3RES A;  4DQ2 A;  2HNI A;  4M78 C;  3V8J A;  4C92 D;  4M77 E;  3V7C A;  3JCM d;  4M75 G;  4C8Q B;  4EMK C;  4JRK A;  2DKG A;  2EJF A;  3SWN A;  1MGQ A;  1BIA A;  4M7D E;  2JN0 A;  5GAO m;  5GAO p;  4M7A D;  2RB6 A;  4XTW A;  4A53 A;  2E41 A;  4NL3 A;  2RD1 A;  3JB9 D;  4F7U G;  5LJ5 e;  4PJO D;  2E64 A;  2E10 A;  1I4K 1;  3V7S A;  1WQ7 A;  4M78 A;  3EFS A;  3QO3 A;  4M77 G;  3FJP A;  2FYK A;  3QUI A;  4MMK A;  4M7D G;  4A54 A;  5GAN 3;  5GAN 4;  4XTV A;  4M75 D;  3JCM P;  4N0A C;  3BY7 A;  4C92 C;  4C8Q E;  3JB9 F;  4M78 F;  5GAO l;  1D3B A;  2EJG A;  1D3B B;  5GAM f;  3HFO A;  4OP0 A;  4F7U E;  1WPY A;  1BIB A;  2DZ9 A;  4MML A;  3JCM c;  4JLI A;  4M7A C;  5GAN g;  3JCM W;  5CAI A;  4PJO C;  4X9D A;  4M77 D;  4Y91 A;  2DXT A;  2K57 A;  5GMK e;  3L1A A;  4N0A A;  5GAO r;  3RER A;  2EWN A;  4M7D D;  5GAN 8;  4WF2 A;  3INZ A;  3QHS A;  3SWN B;  4C8Q G;  4J5Y A;  5GAN 7;  5GAM g;  5GAO q;  3BFM A;  5LJ3 g;  2DEQ A; 
#chains in the Genus database with same CATH topology
 2RJE A;  3GPL A;  1YN8 A;  1Q7Y U;  1VQP Q;  2YLB A;  4FYX B;  1Z9Z A;  3X24 B;  1R0B G;  3CME T;  5D6W A;  2PTK A;  4C0F A;  2EQU A;  2JM8 A;  2MF2 A;  4MDW A;  1UUE A;  3KFV A;  3F70 A;  4C92 B;  3E19 A;  1UE9 A;  4M75 C;  3OYL A;  2JNG A;  4FYY B;  4CC2 A;  2QTX A;  5EC7 A;  2LNH B;  2RJD A;  2DD4 A;  2EJ9 A;  4J9I A;  2M0O A;  4A4E A;  5LJ5 d;  2CP2 A;  2IVW A;  3VYH B;  4IUT A;  3QYG B;  2LZ6 B;  2AZS A;  1QVF P;  1PSE A;  3C12 A;  3OYF A;  3PVL A;  1M5Q 1;  1UGV A;  1PWT A;  3NTH A;  3EG9 A;  1IRE B;  3RBB B;  5J26 A;  1OPK A;  4RTV A;  1AVZ C;  4Z8A A;  1KSW A;  3CPW A;  2EKH A;  3CPW S;  2O88 A;  2HMA A;  1B34 A;  1KD1 C;  1GXI E;  2P4T A;  2K3Y A;  3QDR B;  3OS0 A;  4XTW A;  1BYM A;  1P92 A;  1WZO A;  3NMZ C;  2KRN A;  3OYB A;  2RPN A;  2NUZ A;  4E2F B;  2LX9 A;  2JOY A;  4N0A C;  4RTZ A;  4D6W A;  2F2W A;  2WAC A;  3I55 T;  4LD9 K;  5LL6 S;  4M78 F;  3CCJ T;  3JRZ A;  1VQ4 T;  4Y91 A;  1OQK A;  4Z02 A;  2L3S A;  2DIQ A;  5GAM g;  2YDL A;  3BFM A;  2XDB A;  5CR2 A;  1JXO A;  4JLG A;  3TSZ A;  2XID A;  4E47 A;  1U06 A;  1RAC B;  1SPK A;  1DJ7 B;  1X6G A;  3H6Z A;  1D1C A;  4XTX A;  1VQP T;  2QGF B;  4HVU A;  3I55 A;  3SB2 A;  4QQG A;  1B07 A;  1EFN A;  4C8Q D;  2M16 A;  3CCJ A;  3HP9 A;  1PG5 B;  1VQ4 A;  2AKK A;  1PSF A;  2EBP A;  1Q82 R;  1YCS B;  2YXY A;  1M1F A;  2K4Y A;  2ZGW A;  1AWW A;  2DL5 A;  5ECA A;  3X20 B;  3ER0 A;  2HSE B;  4C92 A;  3ZBD A;  3ME9 A;  1T0J A;  3M5A A;  3JB9 I;  4FYW B;  1VYV A;  1X01 A;  3L42 A;  1VQ7 Q;  4M7A G;  4JUV A;  2NWM A;  4CRI A;  1VQP A;  2PUK B;  4JJN K;  4IIO A;  4FT2 A;  1SG5 A;  3OS2 A;  4DOW A;  1H64 1;  4Y92 A;  3VS0 A;  2X51 A;  2VXF A;  3WVD B;  1XJW B;  3AT1 B;  8AT1 B;  4RCB A;  4F7U B;  4HA8 A;  1IRX A;  1Q7Y R;  4LUD A;  1UHC A;  2RM4 A;  4M77 B;  5CKH A;  2BKD N;  2W0Z A;  3MKD A;  2LMJ A;  3GBQ A;  2COW A;  2OJ2 A;  4OMN A;  3SEM A;  1Y71 A;  2O2O A;  2DO3 A;  3LGL A;  2CDT A;  4ANJ A;  1ZSZ C;  3OS1 A;  1TXQ A;  4B9W A;  2ABL A;  1WHG A;  2DXB A;  4J8O A;  1LJO A;  3RES A;  1VQN A;  2RJF A;  4M78 C;  1WFW A;  4EMK C;  3LH5 A;  2CT3 A;  1GCQ C;  5CKE A;  4BE1 A;  4OB3 B;  4L6V 5;  3X28 B;  1WQ7 A;  4CC7 A;  4BDZ A;  3I9Q A;  2KMT A;  3LGF A;  4CC4 B;  2QA4 Q;  4KRT A;  1LVK A;  3LH0 A;  5GAN 4;  1BI2 A;  2VVK A;  3EG2 A;  1Y07 A;  3J81 E;  5GAM f;  3QII A;  1I1J A;  2PVO B;  4F7U E;  4OB2 B;  2DZ9 A;  1M90 R;  1BB9 A;  2QEX Q;  1B7T A;  4C5G A;  5GAO r;  3EHQ A;  3O8V A;  1Q81 U;  2O4X B;  1Y7X A;  5IAY A;  3O5Z A;  2D8J A;  9ATC B;  1MHN A;  2XMF A;  2FZK B;  3EHR A;  4PFP A;  3M55 A;  5LJ5 g;  3CC7 Q;  2DTH A;  4QQD A;  3OW2 P;  4IUQ A;  3EFO B;  1RAF B;  1ARK A;  3M59 A;  1PD1 A;  2E5Q A;  2X9H A;  3M54 A;  2ESW A;  4R56 A;  1NE8 A;  4J6W A;  1CKB A;  5CQX A;  2ZPI B;  4FCY A;  2VWF A;  1S1N A;  1VQ7 T;  4ZNX A;  4M75 B;  2ZPH B;  3MEV A;  3LX7 A;  2HQE A;  1KQS P;  2CP5 A;  4F7U A;  2HSP A;  5GAN d;  2E65 A;  1I81 A;  5AYF A;  5GJW B;  3M4Y A;  4KGZ B;  4DBF A;  2CYZ B;  5FLX E;  3PT9 A;  2DZC A;  4V2S A;  2QQA A;  2D0N A;  2P4R A;  4E7H A;  1ZA2 B;  2LP5 A;  2YUN A;  1VQ7 A;  2M9U A;  3LWI A;  4OMF B;  2Y4X A;  1UB4 A;  1IGQ A;  2JMA A;  3MHX A;  1PRL C;  1X43 A;  3NPF A;  3SWN A;  5A0D A;  2BUD A;  5GAO m;  4FL6 A;  2XDP A;  4A53 A;  2V1R A;  4MZP A;  2K5F A;  3CEY A;  1H8K A;  3LYI A;  1RL2 A;  1W2B P;  5KE2 A;  2PQW A;  3A8L B;  3S3N A;  5FU7 C;  4KT0 E;  4Y28 E;  1BIB A;  4JLI A;  4QVZ A;  3FC3 A;  1WXU A;  4ME7 A;  3CBM A;  2LJ0 A;  4J7I A;  1K76 A;  3ULR B;  5KYY B;  1X69 A;  3NFC A;  3V8K A;  5LJ5 f;  5J39 A;  4OB1 B;  3VU3 C;  4LDY A;  2R5A A;  3JAM E;  2KXD A;  1UG1 A;  1VIF A;  2QA4 A;  2RH2 A;  1PD0 A;  2IG0 A;  1ZUY A;  2K5L A;  4GBQ A;  4M7A F;  2E1H A;  1MND A;  4HVW A;  5GMK m;  3JCM g;  4GLM A;  2OX7 A;  3VS7 A;  1M1K U;  2ATC B;  2VXE A;  4BE0 A;  2QEX A;  3EFO A;  3REA B;  1K8A C;  3BW1 A;  2RN8 A;  3VS2 A;  1X27 A;  3VS1 A;  2E3H A;  2F5K A;  1KC8 C;  2JTE A;  3FLG A;  1K0S A;  1YBY A;  4M75 A;  1UEB A;  2V8J A;  1Q81 R;  1M3B A;  3CC7 A;  2RNA A;  1NJI U;  2L89 A;  3CXC A;  4D8K A;  2EYY A;  3CXC S;  1N8R U;  3HKS A;  2RJC A;  3M0T A;  4J9E A;  2DNU A;  3CCU T;  4M7D B;  5FW9 A;  5GAN e;  1S72 A;  3TVT A;  2F2V A;  3CC4 T;  2XDD A;  3H0I A;  4PFO A;  2DXC A;  1YNZ A;  1IZ6 A;  1H92 A;  1FXX A;  2DVE A;  2DTO A;  3OYM A;  2DL7 A;  3CCR Q;  4HCK A;  3DB4 A;  2CP7 A;  1ZSZ B;  3QKJ A;  3I56 T;  2JN0 A;  2KR3 A;  2QXF A;  2EYZ A;  4IUP A;  1TOV A;  3J7A F;  3KXT A;  3QWY A;  1BCO A;  1ZQ1 A;  2K5I A;  2HAX A;  3SHW A;  2J6K A;  2EQI A;  1NYF A;  1VQ9 Q;  1GL5 A;  2WSC E;  2EJG A;  1UGR B;  3U23 A;  4M7A C;  3JCM c;  5C0M A;  1SSF A;  4JDS A;  4X9D A;  1N27 A;  5GMK e;  1TSF A;  4N0A A;  3GNG A;  4FM4 B;  3INZ A;  4J5Y A;  5KYY A;  2KYB A;  2X4W A;  1ZLM A;  1Q86 U;  2DL4 A;  1K73 C;  2M51 A;  2RHI A;  4YTL A;  4RTU A;  5L23 A;  1HD3 A;  2B86 A;  2CP0 A;  2KRS A;  2RQW A;  1UGP B;  1PC0 A;  1MMA A;  1RI9 A;  3OSV A;  2OTJ Q;  5LJ5 h;  2WSE E;  1FYN A;  1BCM A;  2PU9 B;  1Y96 B;  2COY A;  1OZ3 A;  4M78 E;  4KGV B;  2YUP A;  5FWB A;  4F17 A;  2YSQ A;  1V76 A;  4B6M A;  3EAE A;  2EAY A;  1KQ1 A;  1QVG P;  4M78 G;  4ZN3 A;  4EIK A;  3CME Q;  1O9S A;  4N4H A;  4DEY A;  3UT1 A;  1UDL A;  1I0C A;  1QVF A;  1VQ8 Q;  1ZBX A;  3PVQ A;  1V1C A;  2KBT A;  4RG8 A;  2DBK A;  2ED0 A;  1WXB A;  2DFU A;  4C8Q F;  5GJV B;  2O9V A;  2E70 A;  4J83 A;  3OQ5 A;  1AEY A;  2MYS A;  1OZ2 A;  1M1K R;  3VKI A;  5HKC A;  3TSW A;  3RR6 A;  1MMN A;  2HNI A;  1EX4 A;  4C92 D;  5CVI A;  3V7C A;  1ZSZ A;  4KBM B;  1MGQ A;  1QCN A;  1JEG A;  2E12 A;  1RAE B;  5CO7 A;  2RQU A;  3CCR T;  2P0Q A;  3OB9 A;  3GOX A;  2CT4 A;  4M78 A;  3QYH B;  1BKB A;  4RTX A;  4AG1 C;  2JT4 A;  1NEG A;  1GCQ A;  3JB9 F;  1N5Z A;  3UA6 A;  3A8M B;  2O01 E;  2J6O A;  3EGD A;  4E6R A;  3EG1 A;  2XI9 A;  1N8R R;  2V8K A;  1VQ9 T;  2K9G A;  1U5S A;  1PM3 A;  2JTF A;  3I5R A;  3QHS A;  2J6F A;  1OYX A;  3CCR A;  1D0Z A;  1TUG B;  5FU7 B;  4KUL A;  1BBZ A;  2GQV A;  1U1T A;  3L2U A;  1VQM T;  5D7U A;  4X34 A;  3MEW A;  5GAN f;  1YHQ T;  1C1A A;  1FMK A;  3OYH A;  1VQ6 Q;  2ZPB B;  1RLP C;  2PUO B;  4DBH A;  1OX9 A;  1VQK A;  2OTJ T;  1W4S A;  1Y96 A;  5GAN j;  3LW5 E;  3G1J A;  2M0Y A;  2R58 A;  1N9R A;  1UHF A;  4C8Q C;  2DER A;  2SEM A;  2EPD A;  2F1L A;  1BI1 A;  2VKN A;  4X1V A;  1IHW A;  1WHK A;  4LDV A;  5FU6 C;  2NUT B;  1QVP A;  1M8V A;  2RI5 A;  1VQ8 T;  2OTJ A;  1Q86 R;  2KXC A;  2R57 A;  4JJB A;  1FWZ A;  1W1F A;  1UJY A;  4X9C A;  2D0Q B;  5KYU B;  4L5G A;  4UC4 A;  4AFQ C;  1KHC A;  5GMK j;  5GAM e;  2J05 A;  4P5N A;  3FB9 A;  3CME A;  1RAI B;  2FZG B;  5HK0 A;  1VQ8 A;  2LCC A;  1UFF A;  1M90 U;  4PJO D;  1J3T A;  2MI6 A;  2PZ1 A;  3MO8 A;  1FMV A;  3JCM P;  3MEA A;  1I5O B;  3OYA A;  3BY7 A;  2B8A A;  3EG3 A;  2EFI A;  2MAM A;  1RAG B;  4C5E A;  1RI0 A;  3M57 A;  4J9B A;  2K2V A;  4M77 D;  2DXT A;  4ZGJ B;  2DD5 A;  1JXM A;  3CCQ Q;  2X35 A;  1GCP A;  2GBQ A;  4M7A B;  2K3B A;  2YLC A;  3QWX X;  4E7J A;  2LQK A;  2HKQ B;  4XU2 A;  1JO8 A;  2OTL Q;  1IO6 A;  2DEU A;  1U3O A;  3D7S B;  3OW2 A;  1VQ5 T;  1QP2 A;  3GLX A;  3OW2 S;  5I22 A;  4HCC A;  3RKX A;  3CBP A;  2HD0 A;  1E6H A;  1VQ6 T;  1VA7 A;  2AT1 B;  5GAN h;  4J9G A;  1YCY A;  3CCL T;  2DK3 A;  3FEO A;  1AWO A;  1QWF A;  5GMK i;  2QQR A;  4J6Y A;  4DBQ A;  1NPR A;  1I8F A;  1IB8 A;  1TUD A;  1YIT Q;  2JTM A;  4II1 A;  1KQS A;  1OOT A;  3JSC A;  2NUT A;  2CZ0 B;  1GBQ A;  2X4X A;  1VQ6 A;  3CCV Q;  3MP8 A;  3RNJ A;  4M7A E;  1XOV A;  4PK4 A;  4OMQ A;  3JB9 J;  2CGH A;  3PGG A;  1K1Z A;  2EYW A;  1AOJ A;  5KYU A;  1KD1 U;  1OPL A;  2E3I A;  4EMH A;  3M0S A;  4QQ6 A;  2MOX A;  3AHU A;  5GMK h;  4OMO A;  4KH1 B;  3CC2 T;  3JCM d;  5CKD A;  2A0F B;  4JRK A;  2QI2 A;  1WLP B;  1K9M U;  3C94 A;  3TCJ A;  2E6N A;  3JB9 D;  2RD1 A;  4RG2 A;  5LJ5 e;  2DE0 X;  3PMT A;  1W2B A;  1BU1 A;  1W2B S;  5FRN A;  3EFS A;  1ZA1 B;  4LD6 A;  2COZ A;  1X6B A;  1YI2 Q;  2GCX A;  4M75 D;  3E2U A;  5I2M A;  2DA9 A;  3VUB A;  3HFO A;  4OP0 A;  4GY5 A;  4KUD K;  2K57 A;  2OAU A;  2XK0 A;  1T3L A;  3SWN B;  2K3X A;  4R0K A;  5LJ3 g;  2CP6 A;  1YJN Q;  2XIC A;  3HRT A;  4M7A A;  3V8L A;  3CCQ T;  1IXD A;  4PFZ A;  1PKS A;  3M4G A;  3EH1 A;  2LDM A;  2P0K A;  1UJ0 A;  3VJP A;  2OTL T;  4E7Z A;  3WVE B;  2EGE A;  1RAD B;  3CCE T;  1AD5 A;  2RF0 A;  4EMG A;  5HCK A;  3QBY A;  5IHN A;  3X25 B;  3CCQ A;  1CKA A;  5GAM j;  1M8M A;  2AIR B;  2QG9 B;  4KH0 B;  3OY9 A;  4DEX A;  2DJZ A;  4PJO G;  1WQW A;  2OTL A;  4JJC A;  1YIT T;  3E9F A;  3RUX A;  3TU4 K;  3VS4 A;  4ELZ C;  3CPW P;  4BE2 A;  1TH7 A;  1YFN A;  3OSS C;  3JCM J;  5IT9 E;  4OVA A;  3CCV T;  1H3H A;  3Q1J A;  1V29 B;  5FU6 B;  1K0X A;  5M9O A;  1E6G A;  3OBY A;  5HY6 A;  1WHH A;  2FZC B;  3QZ9 B;  8ATC B;  1I5L A;  5D6X A;  2FPF A;  4Z89 A;  1MV3 A;  1YIT A;  5GAN 2;  1PNJ A;  1WJS A;  2EYQ A;  1O75 A;  3CCU Q;  3MCA B;  2E41 A;  1B3Q A;  3CCV A;  3MET A;  2IPO B;  1A0N B;  3QO3 A;  3CC4 Q;  3E1S A;  2FYK A;  4A54 A;  2RO0 A;  3OYN A;  2JXB A;  1SRM A;  4WCI A;  2IIM A;  4C8Q E;  1YI2 T;  2JJ9 A;  1M27 C;  4BI4 A;  4LDX A;  4MML A;  1NPP A;  2JW4 A;  3I56 Q;  1VOM A;  2HL3 A;  2PVD B;  4RKU E;  1XTD A;  4M7D D;  3H41 A;  4WF2 A;  4C8Q G;  1M1K C;  3MP1 A;  1G83 A;  1KD1 R;  4M4Z A;  1UTI A;  3L2R A;  2JS0 A;  1QCF A;  4J9D A;  2FEI A;  1MNE A;  4C92 F;  2KYM A;  4C0D C;  3LWH A;  1YJN T;  3PTA A;  1GRI A;  3VUZ A;  2M1H A;  3MJX A;  2DJQ A;  2GF7 A;  1N6A A;  1JU5 C;  1K9M R;  4IUU A;  1EZZ B;  4RTY A;  3TRE A;  2I2L A;  3H9N A;  3BE3 A;  1QVG A;  4FU6 A;  1QVG S;  5GAN 5;  1NJI C;  4PJL A;  1YIJ Q;  2KK4 A;  1ACM B;  4BY6 C;  5GAM h;  1QKW A;  1YJN A;  3JB9 G;  2MPX C;  3RMQ A;  3HFN A;  4XK8 E;  4JZ4 A;  3A8G B;  4QW2 A;  3VYG A;  3BDL A;  1D1B A;  4C8Q A;  2KNB B;  5LJ5 j;  3A5Z B;  1D09 B;  2DL3 A;  4PKC C;  2LJ3 A;  3JCM Q;  4JRP A;  5DLQ E;  1VQL T;  3RKY A;  1KQ2 A;  1JRI A;  4BD3 A;  1R8O B;  2KQW A;  2H3J A;  3P8B B;  1OUL A;  1SSH A;  2DYB A;  2ZPF B;  3CCS Q;  1OI1 A;  2LCL A;  1N9S A;  2KI7 A;  2DL8 A;  4PNO A;  2KT8 A;  5HK3 A;  1ZSG A;  4DA4 A;  2RI2 A;  1QW1 A;  5CKB A;  4D8D A;  2LQN A;  3OMG A;  1YJ9 T;  4IUR A;  2VYT A;  4QKU A;  4E7S A;  1AZG B;  4IKF A;  3VS3 A;  3T9N A;  1WYX A;  1FX7 A;  1Q86 C;  2BZX A;  4C92 C;  1XQH A;  4DBR A;  2ZZD A;  1D3B B;  4N4G A;  2A3L A;  1XNI A;  1LCK A;  3EH2 A;  3HL8 A;  3ZEH A;  2EQK A;  2VAS A;  4AFU C;  3CCU A;  4NS5 A;  1SEM A;  1OV3 A;  1WHM A;  4M78 B;  2RHU A;  3R6N A;  4EMK B;  1WA7 A;  2CRE A;  1UEC A;  3KUF A;  3CC4 A;  1WIE A;  2LTO A;  4F14 A;  4PJO F;  4O5V A;  4OMM A;  3EGD B;  1K8A U;  2GFA A;  2QDY B;  4EDU A;  3P8D A;  2V26 A;  3I56 A;  4XTU A;  1U8R A;  1KFZ A;  2EKO A;  1ABO A;  3M53 A;  1VQM Q;  1KC8 U;  7AT1 B;  2HKN A;  4NL3 A;  2DIG A;  3JCM f;  4ZGE B;  1YHQ Q;  4M77 F;  3C95 A;  1YIJ T;  5DLO A;  2VGN A;  4QVC A;  2AKL A;  4B9X A;  4RMO A;  1F1B B;  5IXF A;  1M4Z A;  3GIB A;  3NHN A;  4AG2 C;  2EIF A;  2Y90 A;  3UWN A;  1JJ2 P;  1WNL A;  4XTZ A;  4LDU A;  5GAO n;  2OAW A;  3CPF A;  3G4S Q;  3MEU A;  2V8I A;  5KYX A;  2KRO A;  1QLY A;  1YIJ A;  1GFC A;  2EW3 A;  4OML A;  2FO0 A;  2D8H A;  2K79 A;  3S3M A;  3EGX B;  3E9G A;  2RHY A;  3OYI A;  3IQL A;  3CCS T;  1QVF S;  2VB6 A;  5KCO A;  5IH2 A;  2QDL A;  3PIO A;  1NG2 A;  3UA7 A;  2RB6 A;  2E64 A;  1I4K 1;  3QXE B;  2L5Q A;  4HXJ A;  1YWO A;  1Q82 C;  1NZ9 A;  3OYC A;  3C0C A;  5KYN A;  1EIF A;  1D3B A;  2RMO A;  3CCS A;  1BK2 A;  1WPY A;  1VQO Q;  4PJO C;  3G71 T;  2HBW A;  1K73 U;  2L0A A;  1OEB A;  5GAN 7;  3QZ5 B;  4JS5 A;  4JZ3 A;  2KVQ G;  4BDY A;  3M0U A;  3R6O A;  4EMK A;  2CKK A;  4M77 C;  4FT4 A;  5I21 A;  1Q7Y C;  1LOJ A;  3QJY A;  4XU3 A;  1NEB A;  1U1S A;  1X6O A;  2FPE A;  2DET A;  4C0D B;  3OYJ A;  4M75 F;  3VRY A;  3JCM X;  4BI8 B;  1X75 C;  3CXC P;  5KYW B;  1VQ5 Q;  2YRD A;  3A8O B;  2LC4 A;  4OGC A;  1ZHI A;  2VC8 A;  1NYG A;  4FYV B;  4CI0 C;  3BDU A;  2HBP A;  4J9F A;  1VQ9 A;  4HVV A;  3CCL Q;  3JCM h;  2GFU A;  2HQX A;  5CKF A;  1WJR A;  2YUO A;  2YT6 A;  5LJ3 d;  1M90 C;  3G4S T;  4BAC A;  1WI7 A;  3NTI A;  1VQM A;  1UGS B;  4O6J A;  3QDF A;  1K8A R;  3EGX A;  1YHQ A;  2CUD A;  3RMS A;  1X2Q A;  3A8H B;  3V8J A;  3TQ7 P;  1HSQ A;  2DYI A;  3DLM A;  1KC8 R;  4RUG A;  1M2O A;  1D0Y A;  2VV5 A;  2L3Q A;  2M02 A;  2AZV A;  1ZUU A;  1YJW Q;  3G4S A;  2RQV A;  3QPH A;  5GAN 3;  1AZE A;  4C5H A;  3WXM B;  2BE7 D;  2CH4 A;  2XG8 D;  1NM7 A;  3CC2 Q;  5GAO l;  2LRQ A;  2KDS A;  2KAF A;  2KEA A;  2YWW A;  4F16 A;  3JCM W;  1G3W A;  1PRM C;  2DM1 A;  2EWN A;  1VQO T;  1AT1 B;  2C0O A;  2BIV A;  4A4H A;  2DEQ A;  2MMP A;  2FRY A;  2KE9 A;  3GP8 A;  1GFD A;  1OX8 A;  1Q95 G;  2OI3 A;  1VQN Q;  2FPD A;  4PJJ A;  6AT1 B;  2JVV A;  2DRK A;  2GTJ A;  2LJ1 A;  4FW1 A;  4IIM A;  3OA6 A;  4PJN A;  5FRM A;  4OF1 A;  1VQO A;  1RAH B;  4F04 B;  1MV0 B;  4KUI A;  5IHK A;  1KG1 A;  1AWJ A;  1C0M A;  4K11 A;  5KYW A;  5GMK l;  2HL5 C;  4OB0 B;  2MIO A;  2E6Z A;  4M7D F;  4BI3 A;  1ABQ A;  2XU8 A;  1K73 R;  3HRU A;  3CCE Q;  4A4G A;  4QT7 A;  4C92 E;  2Z0W A;  1HXD A;  2BZ8 A;  1SRL A;  4XAX B;  3X26 B;  2GGR A;  3GNF B;  1KIK A;  2D6F A;  3EGU A;  4C92 G;  1K9M C;  4ZTF A;  4C0G A;  2RHX A;  3LLR A;  2LT4 A;  3C4S A;  2FL7 A;  3OYG A;  2DPP B;  2CSQ A;  2CSI A;  5L8R E;  1G3Y A;  1VQ5 A;  4ZTJ A;  3PIP A;  1KQS S;  2O9S A;  5LJ3 e;  5FWC A;  2GQI A;  3S6W A;  1IGU A;  2RQT A;  4Z88 A;  4CC3 A;  3CCL A;  1M3A A;  2DVJ A;  4J7F A;  2DLP A;  5FRO A;  3FJP A;  2G6F X;  1ZUK A;  1KK7 A;  2MCN A;  3VRZ A;  5CQY A;  2HCK A;  4ORZ A;  1YJW T;  1ZBJ A;  5IXB A;  1G5V A;  5D6Y A;  2LNV A;  2JMC A;  4FSS A;  3UF4 A;  3L1A A;  5GAN 8;  1YWP A;  1K4U S;  3M56 A;  1KJW A;  4TVR A;  4MZT A;  1SHG A;  4XU0 A;  3JCM b;  3QSU A;  2CH4 W;  1Q81 C;  4PJO B;  2RA2 A;  3JCM V;  1FMW A;  1WHL A;  1G3S A;  2C06 A;  3PFS A;  1AHJ B;  3J80 E;  5KCH A;  1YJW A;  2ZPG B;  4M7D C;  1VQN T;  2QYZ A;  1MUZ A;  2K2M A;  3CC2 A;  2ECZ A;  4AFS C;  3G6E Q;  2BZY A;  3HSB A;  1QMC A;  1Y0M A;  5KE3 A;  4MZM A;  1CSK A;  1SF9 A;  1ZX6 A;  4XU1 A;  1M2V B;  3H0F A;  2DAQ A;  2NUP B;  2XD0 A;  3JB9 H;  1QQJ A;  2ZAE A;  1NBE B;  1WJQ A;  4JS4 A;  3OYE A;  4XQ3 A;  4QVD A;  1TTH B;  3DKM A;  4HCZ A;  1W70 A;  2QAZ A;  1WDX A;  5I2S A;  4A63 B;  2I0N A;  3MP6 A;  4PJO E;  3I35 A;  1R0C B;  2F5T X;  2EQM A;  2LVM A;  2GNC A;  2PVG B;  2BE9 B;  1OU9 A;  1JBM A;  2K7A A;  4LDW A;  1D0X A;  1VYU A;  3RDV A;  1C6V X;  2A37 A;  4J6X A;  1BI0 A;  1VIE A;  1VQL Q;  1GBR A;  1TWB A;  3CCM Q;  4M77 E;  4C8Q B;  3OBW A;  2DKG A;  3CCE A;  4LE9 A;  4ZN1 A;  1M3C A;  5GAO p;  4WTO B;  4F7U G;  5A0G A;  3M0R A;  4M77 G;  3QUI A;  2HEQ A;  2XKO C;  5A0L A;  1H3Z A;  4FW2 A;  3A1P A;  1JB0 E;  2JUF A;  3OMC A;  1R77 A;  5KH6 A;  2HZY A;  1YJ9 Q;  4ZGD B;  3OYD A;  1S72 Q;  3HRS A;  3ZL7 C;  3JCM e;  4E7I A;  4PJO A;  3CD6 Q;  3CMA Q;  1MMD A;  3DLL A;  3OYY A;  2P0P A;  3EFR A;  3M0Q A;  4ESR A;  5AT1 B;  4NOY A;  3NGP A;  5LJ3 f;  4BB7 A;  2LX7 A;  4L59 A;  2FHD A;  4J9H A;  2K6D A;  4KGX B;  2ENM A;  5J3B A;  1M2V A;  4M77 A;  2NUP A;  3G6E T;  4C0Z A;  3HPW A;  4HCB A;  4N4I A;  4E7L A;  1HJD A;  2ROT A;  5LJ3 j;  1LNX A;  2LQW A;  5I11 A;  4FIB A;  2CZ6 B;  2H8H A;  2PNI A;  3MPU B;  3L2Z A;  1QKX A;  1JJ2 A;  1JJ2 S;  1K9A A;  4FSX A;  5DY9 A;  1YI2 A;  3VS5 A;  1VYT A;  5CIU A;  2AK5 A;  2ZPE B;  3I5S A;  2KT1 A;  2W10 A;  1HK9 A;  2L2P A;  2DBM A;  3G6E A;  2CS7 A;  4M78 D;  3KBG A;  4VUB A;  5CCA A;  2CZ7 B;  2EVR A;  2DF6 A;  1N8R C;  4RCC A;  3SD4 A;  4M75 E;  2QA4 T;  2DTI A;  3DB3 A;  1TS9 A;  1G2B A;  4PL6 A;  4AT1 B;  2MWP A;  1PKT A;  4M75 G;  1G3T A;  2EJF A;  4BUG A;  1BIA A;  2QEX T;  2EQJ A;  3CCM T;  2O4X A;  1AWX A;  4AFZ C;  2E10 A;  2CZ1 B;  1I07 A;  5IN1 A;  3QG1 A;  2DRM A;  2EGC A;  4MMK A;  5KYX B;  3OYK A;  1LPL A;  4GLK A;  3ZFJ A;  1OU8 A;  3TEE A;  4AMC A;  3H0H A;  2ED1 A;  3CC7 T;  2O31 A;  2H3E B;  3URG A;  3L2Q A;  2RK1 A;  4PLI A;  1TU0 B;  1VQL A;  2V1Q A;  3CCM A;  2QK0 A;  5GAO q;  2A7Y A;  1KHI A;  1RAB B;  3HHT B;  2QGG A;  3VS6 A;  4HT9 A;  1S72 T;  2F2X A;  4XTY A;  1VUB A;  2FG0 A;  3CD6 T;  2MK5 A;  3CMA T;  4MDX A;  2XHC A;  2DIL A;  3G71 Q;  2X3X D;  1SKU B;  1YP5 A;  4A4F A;  2QQB A;  1SHF A;  2DMO A;  2YUQ A;  3L2W A;  3PNW C;  1QP3 A;  1QWE A;  1WHJ A;  2FB7 A;  2RK2 A;  1TUC A;  3VV0 A;  2RHZ A;  4HT8 A;  3UDC A;  1YJ9 A;  3PE0 A;  2E5K A;  3M58 A;  2VGM A;  2YHT A;  5LJ3 h;  3RER A;  1NLO C;  1Y57 A;  3PMI A;  3CMA A;  3CD6 A;  4LXC A;  1NLP C;  2L8D A;  4LN2 A;  4LUE A;  3EG0 A;  4RTT A;  2A28 A;  1WXT A;  2A36 A;  2Y4Y A;  4JJD A;  2ROL A;  2FVU A;  4F7U F;  3FIF A;  4R55 A;  1RUW A;  3CQT A;  2JM9 A;  3N5B B;  1VQK Q;  2NLU A;  2AHJ B;  2CUB A;  1T0H A;  2X3W D;  4M7D E;  2G3R A;  3SFM A;  2HQH A;  5C6S A;  1HYO A;  2GTO A;  2MWO A;  2RI3 A;  3FJ5 A;  2WSF E;  3V7S A;  3H8Z A;  2RQR A;  4OGE A;  4PLL A;  2YRV A;  1PHT A;  4M7D G;  2P84 A;  2QTV A;  3M0P A;  5CK9 A;  1X2K A;  3A98 A;  3JV3 A;  4A4K A;  2D1X A;  2X4J A;  2EGA A;  3FDR A;  1RAA B;  2E4H A;  5GAN g;  3QJ6 A;  4DOV A;  4ELY C;  1E7O A;  1WGS A;  1TG0 A;  3CBO A;  2D9T A;  2JS2 A;  1QCO A;  2LQ8 A;  2DX1 A;  2LCS A;  2L3R A;  1JQQ A;  4OMP A;  2J7I A;  2QQS A;  2DXU A;  3FRN A;  4JRQ A;  2SRC A;  2KY9 A;  1MMG A;  3RIR A;  2VUB A;  4M7D A;  5IHI A;  3P8H A;  5GAM d;  5DM7 R;  1IHV A;  4NL2 A;  3V7R A;  1M9S A;  3OS5 A;  3REB B;  3THK A;  2YRC A;  3SDZ A;  4JRI A;  4EPC A;  4Q5W A;  2J06 A;  3NTK A;  3G71 A;  2CP3 A;  2BTT A;  2A08 A;  1M30 A;  2ZCF B;  1PCX A;  2C0T A;  3RKW A;  2EYX A;  4LNP A;  1Z9Q A;  2C0I A;  1BI3 A;  1UGQ B;  3HTR A;  4C5I A;  3EG9 B;  2KSS A;  2JZ2 A;  2HDA A;  3SWN C;  1T3S A;  5GAN 6;  4IUV A;  1NJI R;  1B34 B;  3UAT A;  4DQ2 A;  1D1A A;  1G8X A;  2NYS A;  4BY6 B;  4RTW A;  3L2V A;  1VQK T;  2X4Y A;  2FRW A;  2F69 A;  1Q82 U;  4M7A D;  3G7Z A;  4HKE A;  4PJM A;  3I55 Q;  2LT1 A;  4XTV A;  3CCJ Q;  3ASK A;  1VQ4 Q;  3S3O A;  1RLQ C;  1M1G A;  4E7K A;  3UPU A;  2KRM A;  3M9Q A;  2R5M A;  1W6X A;  5CAI A;  4J9C A;  2QQ9 A;  2QAS A;  3GF5 A;  1WX6 A;  2L3P A;  2KGT A;  4JPB W;  5EG2 A;  5A2Q E;  4ATO A; 
#chains in the Genus database with same CATH homology
 2RJE A;  4XU0 A;  3JCM b;  3GPL A;  1K73 C;  1Q7Y U;  3QSU A;  2RHI A;  1Q81 C;  3L2R A;  4PJO B;  2RA2 A;  2YLB A;  4YTL A;  3JCM V;  1G3S A;  2C06 A;  4C92 F;  3LWH A;  1YJN T;  4C0D C;  3PFS A;  1AHJ B;  3X24 B;  3J80 E;  5KCH A;  3PTA A;  1YJW A;  3VUZ A;  2M1H A;  2ZPG B;  2GF7 A;  1Q86 U;  1N6A A;  3CME T;  1UGP B;  5D6W A;  4C0F A;  4M7D C;  3OSV A;  2EQU A;  5LJ5 h;  1VQN T;  2WSE E;  4IUU A;  2MF2 A;  3CC2 A;  3HSB A;  4MDW A;  5KE3 A;  4MZM A;  2PU9 B;  3TRE A;  4XU1 A;  2I2L A;  3F70 A;  1Y96 B;  4M78 E;  1OZ3 A;  2DAQ A;  4C92 B;  2XD0 A;  4M7A A;  1QVG A;  3JB9 H;  4FU6 A;  1QVG S;  3E19 A;  5GAN 5;  4M75 C;  1NJI C;  1WJQ A;  4JS4 A;  3OYE A;  4XQ3 A;  3EAE A;  2KK4 A;  4BY6 C;  5GAM h;  3OYL A;  2EAY A;  2JNG A;  4QVD A;  1YJN A;  1KQ1 A;  2QTX A;  3DKM A;  4HCZ A;  3JB9 G;  3RMQ A;  4M78 G;  2RJD A;  4ZN3 A;  3HFN A;  1O9S A;  2DD4 A;  2EJ9 A;  4N4H A;  4XK8 E;  3UT1 A;  2M0O A;  5I2S A;  3A8G B;  4QW2 A;  4A4E A;  1QVF A;  5LJ5 d;  3VYG A;  3BDL A;  1ZBX A;  4C8Q A;  5LJ5 j;  3A5Z B;  2IVW A;  4PKC C;  4IUT A;  3VYH B;  3QYG B;  4RG8 A;  3JCM Q;  4JRP A;  5DLQ E;  1VQL T;  3MP6 A;  1PSE A;  3C12 A;  4PJO E;  3RKY A;  1KQ2 A;  3OYF A;  2F5T X;  1M5Q 1;  2EQM A;  4C8Q F;  1JRI A;  2LVM A;  4BD3 A;  1R8O B;  2PVG B;  2E70 A;  3NTH A;  4J83 A;  2KQW A;  1IRE B;  2H3J A;  3OQ5 A;  3P8B B;  1JBM A;  5J26 A;  4LDW A;  2ZPF B;  1OZ2 A;  1OI1 A;  2LCL A;  1N9S A;  3CPW A;  3CPW S;  3VKI A;  4PNO A;  5HKC A;  5HK3 A;  1B34 A;  4J6X A;  1KD1 C;  1BI0 A;  1VIE A;  2P4T A;  2HNI A;  1GXI E;  4C92 D;  5CVI A;  4M77 E;  3V7C A;  2K3Y A;  4C8Q B;  4DA4 A;  3OBW A;  2DKG A;  3CCE A;  4KBM B;  1MGQ A;  2RI2 A;  4ZN1 A;  2E12 A;  3QDR B;  5CO7 A;  1QW1 A;  5CKB A;  5GAO p;  4XTW A;  3OS0 A;  3CCR T;  2P0Q A;  3OMG A;  4F7U G;  3OB9 A;  3GOX A;  1YJ9 T;  4IUR A;  2VYT A;  5A0G A;  1BYM A;  1P92 A;  4IKF A;  4M78 A;  3QYH B;  1BKB A;  4M77 G;  3T9N A;  3QUI A;  3OYB A;  2LX9 A;  1FX7 A;  2JOY A;  2XKO C;  4N0A C;  4D6W A;  5A0L A;  1Q86 C;  4C92 C;  2WAC A;  1H3Z A;  3I55 T;  4LD9 K;  1XQH A;  5LL6 S;  3JB9 F;  3A8M B;  4M78 F;  2ZZD A;  1JB0 E;  2O01 E;  2JUF A;  1D3B B;  3CCJ T;  3OMC A;  3JRZ A;  2XI9 A;  4N4G A;  1VQ4 T;  5KH6 A;  2V8K A;  1VQ9 T;  2A3L A;  1XNI A;  4Y91 A;  2JTF A;  3HL8 A;  3QHS A;  4Z02 A;  1OYX A;  3ZEH A;  4ZGD B;  3OYD A;  3CCR A;  2EQK A;  2DIQ A;  5GAM g;  3BFM A;  2XDB A;  3HRS A;  5CR2 A;  3CCU A;  5FU7 B;  4JLG A;  4NS5 A;  4KUL A;  3JCM e;  4E7I A;  4PJO A;  2XID A;  4M78 B;  2RHU A;  4E47 A;  2GQV A;  1U1T A;  3L2U A;  4EMK B;  1VQM T;  4X34 A;  1DJ7 B;  3KUF A;  3MEW A;  3H6Z A;  5GAN f;  3CC4 A;  4XTX A;  1VQP T;  2LTO A;  3I55 A;  3DLL A;  3SB2 A;  1YHQ T;  3OYY A;  4QQG A;  2P0P A;  4C8Q D;  2M16 A;  3EFR A;  3CCJ A;  4PJO F;  3HP9 A;  4O5V A;  3OYH A;  1VQ4 A;  2ZPB B;  1PSF A;  4NOY A;  5LJ3 f;  4BB7 A;  2GFA A;  1K8A U;  1M1F A;  2QDY B;  4L59 A;  2FHD A;  4EDU A;  2K4Y A;  2ZGW A;  2PUO B;  3P8D A;  1VQK A;  2OTJ T;  1W4S A;  1Y96 A;  4XTU A;  5J3B A;  3X20 B;  4M77 A;  3ER0 A;  4C92 A;  3I56 A;  5GAN j;  3ZBD A;  3G6E T;  4C0Z A;  3HPW A;  3ME9 A;  3M5A A;  4N4I A;  4HCB A;  2EKO A;  3M53 A;  3LW5 E;  4E7L A;  3JB9 I;  1KC8 U;  2R58 A;  1N9R A;  1X01 A;  3L42 A;  4C8Q C;  4NL3 A;  2DIG A;  3JCM f;  4ZGE B;  5LJ3 j;  1LNX A;  4M7A G;  4JUV A;  4CRI A;  4FIB A;  4M77 F;  3C95 A;  2CZ6 B;  1VQP A;  1BI1 A;  1YIJ T;  2PUK B;  5DLO A;  2VGN A;  4QVC A;  4JJN K;  3L2Z A;  1JJ2 A;  4FT2 A;  3OS2 A;  4B9X A;  4FSX A;  1H64 1;  5DY9 A;  4DOW A;  4RMO A;  1YI2 A;  1JJ2 S;  1M4Z A;  4LDV A;  5FU6 C;  2VXF A;  3GIB A;  1QVP A;  5CIU A;  2ZPE B;  2EIF A;  3WVD B;  1M8V A;  2RI5 A;  2Y90 A;  3UWN A;  1VQ8 T;  4RCB A;  4F7U B;  2OTJ A;  4HA8 A;  1HK9 A;  1WNL A;  2R57 A;  3G6E A;  4XTZ A;  2CS7 A;  4LDU A;  4M78 D;  2RM4 A;  3CPF A;  4M77 B;  5CKH A;  2BKD N;  5GAO n;  3KBG A;  5A2Q E;  1FWZ A;  3MEU A;  2V8I A;  4VUB A;  5CCA A;  2CZ7 B;  4X9C A;  1Y71 A;  2D0Q B;  2DO3 A;  3LGL A;  4L5G A;  1N8R C;  4RCC A;  3SD4 A;  4M75 E;  4UC4 A;  3OS1 A;  1YIJ A;  2QA4 T;  2DTI A;  3DB3 A;  4B9W A;  1KHC A;  3S3M A;  5GMK j;  3E9G A;  5GAM e;  2DXB A;  2RHY A;  3OYI A;  4P5N A;  3FB9 A;  4J8O A;  3CME A;  1LJO A;  3CCS T;  4PL6 A;  1QVF S;  3RES A;  5HK0 A;  2RJF A;  4M78 C;  2MWP A;  5KCO A;  1VQN A;  4M75 G;  4EMK C;  1G3T A;  3PIO A;  2EJF A;  1VQ8 A;  2LCC A;  4BUG A;  1BIA A;  2QEX T;  2EQJ A;  2RB6 A;  3CCM T;  2O4X A;  1M90 U;  4PJO D;  2E10 A;  2E64 A;  2CZ1 B;  2MI6 A;  5CKE A;  4OB3 B;  1I4K 1;  3QXE B;  2L5Q A;  4L6V 5;  1WQ7 A;  5IN1 A;  3X28 B;  4BDZ A;  3QG1 A;  2KMT A;  3LGF A;  1Q82 C;  4MMK A;  3LH0 A;  3MO8 A;  1U8R A;  1NZ9 A;  5GAN 4;  3OYC A;  1BI2 A;  3OYK A;  3JCM P;  3MEA A;  3OYA A;  3BY7 A;  4GLK A;  2B8A A;  1Y07 A;  2EFI A;  3ZFJ A;  2MAM A;  1EIF A;  1D3B A;  3TEE A;  4C5E A;  3J81 E;  5GAM f;  3QII A;  3CCS A;  2PVO B;  1RI0 A;  3M57 A;  4F7U E;  1WPY A;  4OB2 B;  2DZ9 A;  3CC7 T;  4PJO C;  3G71 T;  2K2V A;  4M77 D;  3URG A;  2DXT A;  4C5G A;  3L2Q A;  1K73 U;  5GAO r;  2RK1 A;  3O8V A;  4PLI A;  4ZGJ B;  2DD5 A;  5GAN 7;  1Q81 U;  1VQL A;  3CCM A;  2X35 A;  5GAO q;  3QZ5 B;  2O4X B;  2A7Y A;  1Y7X A;  1KHI A;  5IAY A;  4JS5 A;  3HHT B;  2KVQ G;  4M7A B;  4BDY A;  2YLC A;  4E7J A;  3R6O A;  2LQK A;  4HT9 A;  1S72 T;  4XU2 A;  4EMK A;  4XTY A;  1MHN A;  1VUB A;  2CKK A;  3CD6 T;  3OW2 A;  1VQ5 T;  3CMA T;  4MDX A;  1QP2 A;  3GLX A;  4FT4 A;  2XHC A;  3M55 A;  4M77 C;  5I21 A;  5LJ5 g;  1LOJ A;  3OW2 S;  3QJY A;  4XU3 A;  1Q7Y C;  1U1S A;  2DTH A;  4A4F A;  1X6O A;  4QQD A;  4HCC A;  2QQB A;  3RKX A;  3CBP A;  2HD0 A;  3L2W A;  3PNW C;  4C0D B;  1QP3 A;  1VQ6 T;  3OYJ A;  2FB7 A;  2RK2 A;  3VV0 A;  5GAN h;  4M75 F;  4IUQ A;  1YCY A;  2RHZ A;  3CCL T;  4HT8 A;  2DK3 A;  3FEO A;  3UDC A;  3JCM X;  4BI8 B;  5GMK i;  1YJ9 A;  2QQR A;  3M59 A;  1X75 C;  2E5Q A;  4J6Y A;  4BE1 A;  3M58 A;  3M54 A;  2VGM A;  2YHT A;  5LJ3 h;  4R56 A;  1NE8 A;  1NPR A;  1I8F A;  3A8O B;  3RER A;  4J6W A;  2LC4 A;  5CQX A;  2ZPI B;  3PMI A;  4OGC A;  3CMA A;  2JTM A;  3CD6 A;  4II1 A;  1KQS A;  1ZHI A;  2L8D A;  2VC8 A;  1VQ7 T;  3JSC A;  4M75 B;  2ZPH B;  4CI0 C;  3MEV A;  3BDU A;  2HBP A;  2HQE A;  3LX7 A;  2CZ0 B;  1VQ9 A;  2X4X A;  1VQ6 A;  3JCM h;  4F7U A;  5GAN d;  2E65 A;  3MP8 A;  1I81 A;  5AYF A;  4M7A E;  3M4Y A;  2GFU A;  2HQX A;  1XOV A;  2CYZ B;  2Y4Y A;  5CKF A;  1WJR A;  3JB9 J;  2CGH A;  3PGG A;  5FLX E;  3PT9 A;  2DZC A;  5LJ3 d;  4V2S A;  2FVU A;  4F7U F;  3FIF A;  2QQA A;  4R55 A;  1M90 C;  3G4S T;  4BAC A;  1KD1 U;  4EMH A;  1VQM A;  3NTI A;  4QQ6 A;  1UGS B;  4O6J A;  3AHU A;  4E7H A;  1VQ7 A;  5GMK h;  1YHQ A;  2M9U A;  3RMS A;  3VUB A;  3LWI A;  3N5B B;  4OMF B;  2Y4X A;  1UB4 A;  2NLU A;  2AHJ B;  3CC2 T;  3A8H B;  3V8J A;  3JCM d;  5CKD A;  3MHX A;  4JRK A;  2QI2 A;  3SWN A;  5A0D A;  3DLM A;  1K9M U;  4M7D E;  2G3R A;  3C94 A;  2BUD A;  3TCJ A;  4FL6 A;  3SFM A;  2XDP A;  5GAO m;  5C6S A;  4A53 A;  2E6N A;  3JB9 D;  2RD1 A;  2MWO A;  2RI3 A;  2VV5 A;  4RG2 A;  5LJ5 e;  3PMT A;  2WSF E;  4MZP A;  1W2B A;  2K5F A;  3V7S A;  3CEY A;  3H8Z A;  4OGE A;  1W2B S;  3EFS A;  4PLL A;  5FRN A;  2YRV A;  3LYI A;  4LD6 A;  3G4S A;  3QPH A;  4M7D G;  5GAN 3;  2GCX A;  5CK9 A;  4M75 D;  4A4K A;  4C5H A;  1RL2 A;  3WXM B;  2XG8 D;  2X4J A;  5I2M A;  5KE2 A;  5GAO l;  2PQW A;  3A8L B;  3S3N A;  2LRQ A;  5FU7 C;  2KDS A;  3FDR A;  3HFO A;  2KAF A;  1BIB A;  4KT0 E;  4OP0 A;  4GY5 A;  4JLI A;  4Y28 E;  4QVZ A;  5GAN g;  3JCM W;  4KUD K;  1G3W A;  3QJ6 A;  3FC3 A;  2K57 A;  4DOV A;  2EWN A;  2OAU A;  4ME7 A;  4ELY C;  3CBM A;  1VQO T;  2XK0 A;  3SWN B;  1WGS A;  2K3X A;  4J7I A;  2BIV A;  4A4H A;  3CBO A;  3NFC A;  5LJ3 g;  2DEQ A;  2D9T A;  2XIC A;  2MMP A;  3HRT A;  3V8K A;  3V8L A;  5J39 A;  4OB1 B;  5LJ5 f;  3CCQ T;  3VU3 C;  4LDY A;  3GP8 A;  2LQ8 A;  2R5A A;  3M4G A;  3JAM E;  2L3R A;  1VIF A;  2LDM A;  2QA4 A;  2P0K A;  2IG0 A;  2K5L A;  2RH2 A;  3VJP A;  2QQS A;  2OTL T;  4M7A F;  2E1H A;  2DXU A;  2JVV A;  5GMK m;  3WVE B;  3JCM g;  3FRN A;  4JRQ A;  3OA6 A;  1M1K U;  5FRM A;  3CCE T;  2VXE A;  4BE0 A;  4OF1 A;  2KY9 A;  1VQO A;  2QEX A;  4EMG A;  3QBY A;  3RIR A;  3X25 B;  2VUB A;  4M7D A;  1K8A C;  4KUI A;  3P8H A;  5GAM d;  1KG1 A;  3CCQ A;  5DM7 R;  3BW1 A;  5GAM j;  4NL2 A;  5GMK l;  3OY9 A;  4OB0 B;  2DJZ A;  4PJO G;  3V7R A;  1M9S A;  3OS5 A;  2E6Z A;  1WQW A;  4M7D F;  2OTL A;  3SDZ A;  4JRI A;  2F5K A;  4BI3 A;  4EPC A;  1KC8 C;  2XU8 A;  3FLG A;  1YBY A;  3HRU A;  4M75 A;  1YIT T;  1UEB A;  2V8J A;  3E9F A;  4A4G A;  4Q5W A;  3RUX A;  4C92 E;  3TU4 K;  3CC7 A;  3NTK A;  1HXD A;  4ELZ C;  3G71 A;  4BE2 A;  1NJI U;  1TH7 A;  2L89 A;  3CXC A;  3OSS C;  4XAX B;  3CXC S;  1N8R U;  2ZCF B;  3HKS A;  2RJC A;  3X26 B;  3GNF B;  3RKW A;  3CCU T;  3JCM J;  2D6F A;  5IT9 E;  4OVA A;  1BI3 A;  3CCV T;  3Q1J A;  1V29 B;  4C92 G;  1K9M C;  5FU6 B;  4ZTF A;  4M7D B;  4C0G A;  1UGQ B;  5M9O A;  2RHX A;  3LLR A;  4C5I A;  3OBY A;  5HY6 A;  2LT4 A;  5GAN e;  1S72 A;  2KSS A;  2JZ2 A;  2FL7 A;  3C4S A;  3OYG A;  2DPP B;  3CC4 T;  3SWN C;  3QZ9 B;  2XDD A;  5GAN 6;  5L8R E;  1G3Y A;  1I5L A;  1VQ5 A;  5D6X A;  4ZTJ A;  4IUV A;  3PIP A;  1KQS S;  1YIT A;  2DXC A;  5LJ3 e;  5GAN 2;  1IZ6 A;  1B34 B;  1FXX A;  2DTO A;  2DVE A;  3S6W A;  3OYM A;  4DQ2 A;  1WJS A;  4BY6 B;  3DB4 A;  3L2V A;  2EYQ A;  1VQK T;  3QKJ A;  2X4Y A;  1O75 A;  2JN0 A;  3I56 T;  2F69 A;  1Q82 U;  2QXF A;  3MCA B;  4M7A D;  2E41 A;  3CCL A;  4IUP A;  3G7Z A;  4HKE A;  4J7F A;  3CCV A;  3J7A F;  3KXT A;  3MET A;  5FRO A;  1ZQ1 A;  2K5I A;  3QO3 A;  3E1S A;  2HAX A;  3FJP A;  2FYK A;  2LT1 A;  4A54 A;  2RO0 A;  3OYN A;  4XTV A;  3ASK A;  5CQY A;  3S3O A;  1YJW T;  1M1G A;  1G5V A;  4C8Q E;  1YI2 T;  5D6Y A;  2WSC E;  4E7K A;  2EJG A;  3UPU A;  4BI4 A;  1UGR B;  4M7A C;  4LDX A;  3JCM c;  2LNV A;  3M9Q A;  1NPP A;  2R5M A;  4MML A;  5C0M A;  1SSF A;  4JDS A;  5CAI A;  4X9D A;  1N27 A;  5GMK e;  2PVD B;  2QQ9 A;  3L1A A;  4N0A A;  4RKU E;  1XTD A;  3GF5 A;  3GNG A;  4FM4 B;  3INZ A;  4WF2 A;  5GAN 8;  4C8Q G;  4J5Y A;  4M7D D;  1M1K C;  5EG2 A;  3MP1 A;  3M56 A;  2X4W A;  4TVR A;  4MZT A;  4ATO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...