5GANe

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
83
structure length
75
Chain Sequence
b'MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 75
sequence length 83
chains with identical sequence p
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gane00
5GANf 5GAN7 4M78E 4X9CA 5GAN4 1I4K1 4OP0A 4XTUA 2E65A 4V2SA 2E1HA 4M7DB 4EMHA 5GANd 4X9DA 1LOJA 4F7UA 4PJOD 4M75A 5GAN3 5LJ3h 3JB9G 1X01A 4EMGA 4M75E 4F7UE 5GAN2 3GIBA 2FB7A 2VXFA 4J6YA 4M77C 4C92D 2DJZA 4M78B 3SB2A 4C8QF 3JCMJ 4M7DF 3HFNA 4HA8A 2EJGA 5GMKi 5GAOl 4HT9A 5LJ5g 2DXTA 2ZGWA 1TH7A 3RERA 3SWNB 1I8FA 4XTXA 5LJ3e 4M75B 1WNLA 2Y90A 4DQ2A 2RB6A 4M78F 5CAIA 4XTVA 2EJ9A 3PGGA 4M77G 1YCYA 2I2LA 4M77A 1MGQA 3SWNC 4XTYA 4Y91A 4A54A 4M77E 4C92G 1HXDA 4C92A 4M7AD 3JCMQ 4N0AA 2E64A 4F7UF 3JCMe 4M75F 1KQ2A 4JUVA 5I21A 2EJFA 1BIAA 5GMKh 5LJ3j 5GAMd 1BIBA 4M77B 5LJ3f 4XQ3A 3SWNA 4C92B 4JRKA 3V8KA 4RCBA 3JB9J 4M7AG 4WF2A 1B34B 1JBMA 5LJ5h 4XU3A 2RA2A 4NOYA 2DTOA 1LJOA 4C92C 3JCMb 5GAOp 2CGHA 2E41A 1WPYA 4JLIA 3INZA 4M77F 4N0AC 5GMKe 4NL3A 3JCMh 3L1AA 1I5LA 1HK9A 2DXUA 5GMKl 4PNOA 3V7RA 4PJOG 3JCMP 3HSBA 4PJOA 2DZCA 3L2ZA 4M7AB 2VXEA 5LJ5e 3JB9F 4PJOE 4HT8A 2K57A 2DTIA 2DTHA 3RIRA 2YLCA 4MMKA 3RKXA 4XU2A 4C92E 4QVDA 5GAOq 4M7AC 2QTXA 1B34A 2FYKA 3FJPA 3QO3A 1WQWA 5GMKj 1N9SA 3RESA 2YHTA 4J6WA 4PJOB 5GAMg 4C8QD 3V7CA 2JN0A 5GAOm 5GANg 4M7DD 3JCMV 4QVCA 5LJ5j 2RM4A 3V8JA 1LNXA 4PJOC 5GANe 4M7AA 4JRIA 3JB9H 2DVEA 5LJ3d 4M78D 4M7AE 3V8LA 3BY7A 1WQ7A 2EWNA 3JCMf 4EMKA 1D3BA 3RUXA 2DEQA 3JCMc 4A53A 4C8QA 1U1TA 3RKYA 4C92F 4C8QG 4J6XA 3QUIA 1JRIA 2DZ9A 4M75D 3EFRA 1N9RA 4C8QE 3JCMd 3EFSA 2HNIA 5GAN6 5GAOn 3V7SA 5GAN5 3JB9I 4M78G 4MMLA 3AHUA 3BFMA 4EMKB 5GAMh 1M8VA 1D3BB 3BDUA 4C8QB 5GANh 1Y96A 3FIFA 1H641 1M5Q1 4M7AF 4F7UG 4M75G 3QSUA 4NL2A 4EMKC 4RCCA 4C8QC 4M77D 3JCMW 3RKWA 4M7DC 3FB9A 5GAMe 1I81A 5LJ5f 5GMKm 4J5YA 5LJ3g 5GAN8 3BW1A 1Y96B 3HFOA 4PJOF 3JB9D 4M78C 5LJ5d 4XU0A 2RD1A 5DY9A 4F7UB 5GAOr 2VC8A 2DKGA 4XTWA 4XU1A 1U1SA 1KQ1A 3QHSA 3JCMg 4M7DA 2E10A 4M75C 4M7DE 4M7DG 4XTZA 3VU3C 2YLBA 3JCMX 5GAMj 3M4GA 2EAYA 5GAMf 5GANj 4M78A
chains in the Genus database with same CATH superfamily
3G7ZA 1I4K1 2EPDA 4FSXA 4Z89A 2FZCB 3P8BB 3I35A 2SRCA 4J6YA 2DNUA 4FCYA 1GXIE 1H3HA 2C0OA 1ABOA 3HFNA 4X34A 1X2KA 2K5IA 2JVVA 1IHWA 1Q82C 3OY9A 1IZ6A 1M90R 2Y90A 4QT7A 1BCOA 3S3OA 2LZ6B 4DEYA 1MGQA 4Y91A 4OB0B 4OB1B 1N5ZA 1PM3A 1RLQC 4K11A 3C4SA 3C12A 3OB9A 4VUBA 3VS6A 1IO6A 1VQLT 3C95A 4KH0B 2QQSA 5I22A 5CCAA 1Y57A 3JCMP 1KG1A 4PJOG 4EDUA 1IGQA 2EYWA 2KXCA 3FEOA 3QO3A 2H3EB 2BIVA 4J6WA 3TU4K 3OBWA 4C8QD 4E2FB 1IB8A 2CUDA 2RI3A 2QEXQ 4J8OA 4M78D 5KCOA 3G6EQ 3BY7A 1BCMA 2V8JA 2ENMA 1JRIA 5DM7R 3EFRA 4FYYB 1ZA2B 1H8KA 1YIJT 1NJIC 3M57A 3PT9A 3NTHA 2MI6A 1D1AA 2KSSA 4AFZC 1VQ6T 4BDYA 1QMCA 1PWTA 3HRUA 2CDTA 4ESRA 3CMET 3SEMA 1U1SA 2AK5A 5KE2A 3J80E 1M8MA 3MPUB 4OGCA 1D0YA 1IGUA 1I5OB 2YLBA 3ER0A 4J9DA 2BZYA 1OI1A 1NBEB 4ZTJA 5GAN7 1E6GA 4X9CA 3TSWA 2COZA 4D8DA 3GIBA 5I2SA 1S72Q 1Q82R 4JRQA 2CP3A 2X4WA 5CKFA 2QEXA 4IUQA 3S3NA 5LJ3e 3HPWA 3G6EA 2QDLA 4JJCA 4M77A 4HXJA 4C92A 2XKOC 3D7SB 1BBZA 1M90U 1KD1U 2NYSA 3NMZC 2JTEA 2EQIA 3H0HA 2HEQA 3CCUQ 3EG9A 3OYDA 4PJMA 4RCBA 1VQNQ 1B34B 1RACB 1K9MC 2E41A 2XG8D 1WLPB 5GJVB 2OJ2A 2GTOA 1KHCA 1OX9A 4TVRA 2EW3A 3L1AA 2G3RA 1HK9A 3MP8A 4AMCA 2VVKA 3BDLA 1ZSZA 4BD3A 2K3XA 1K9AA 3VYGA 4F04B 2X4XA 3G71Q 5GMKj 1KSWA 1UGSB 2NUPA 3KUFA 1OEBA 2QA4T 2PNIA 1GFDA 2KT1A 4IUVA 5IAYA 5GANg 3OYMA 1U3OA 4RTZA 1PRLC 4LDYA 1R0CB 3R6NA 3WVEB 2L2PA 1W2BP 3QYGB 1S72A 1YHQQ 1M2VB 2XMFA 2SEMA 2GFUA 3QUIA 2HAXA 2O4XA 1NJIR 4HCZA 2EQJA 4MMLA 1AHJB 1D3BB 4A4HA 2HCKA 1I0CA 3CBOA 5IT9E 4GLMA 2HQHA 4WTOB 2XU8A 3RBBB 2J6KA 1M3AA 2DBMA 4JPBW 1VQNA 4XU0A 5DY9A 1QVGP 4C0FA 3OS0A 2Y4YA 1MMAA 2FHDA 5HKCA 5A0GA 5C6SA 1T3SA 4IURA 2L8DA 2YUOA 3JCMX 3CEYA 2QAZA 4M78A 3I56Q 1K8AU 2NUTA 2A7YA 3J7AF 5D6WA 1GBQA 4XTUA 1D0XA 2E65A 3GNFB 3P8DA 2QGGA 3G71A 1ZUKA 1V1CA 2CP6A 1KK7A 2EKHA 2KDSA 3MKDA 2XICA 1KQSP 3VS2A 2RN8A 1G83A 2X3WD 2DIQA 2FPDA 4XTVA 1YHQA 1PRMC 4XTYA 1FXXA 3VUZA 4M7AD 4N0AA 2E64A 4Z8AA 4F7UF 2RQVA 2EVRA 4OMLA 2FPEA 4M4ZA 1X75C 2ZPGB 5D6YA 5FWBA 4JRKA 3CCRT 1ZSGA 2M51A 1K9MR 3A1PA 1MV0B 4AFSC 2MOXA 3JCMb 4FT2A 1ZUUA 2WSFE 3CD6Q 1I1JA 1T0HA 1KC8U 1PSEA 3LW5E 2GQVA 4CRIA 4RTTA 1BI3A 1SSFA 3OMCA 4GY5A 3CC4T 2XI9A 3I56A 4JRPA 2JN0A 1QW1A 2O9SA 2JW4A 1WJRA 1WXTA 2RM4A 3V8JA 1QP2A 2JS2A 1WHHA 5GANe 1O9SA 1QCFA 2DEUA 4C0ZA 4KGVB 3RUXA 4BB7A 3M0RA 2JJ9A 1Q7YC 2VUBA 5IXFA 4BUGA 5D7UA 1VQKT 5GANh 1WHGA 1NJIU 2J06A 1M30A 2K9GA 5CK9A 3EHRA 1YJNQ 4L5GA 4LDWA 2GF7A 5FU7C 4ME7A 4A63B 3CCJQ 5A2QE 2DLPA 1KIKA 2LT1A 5GAOr 3H0FA 1NE8A 1VYVA 2YRDA 4A4GA 3CD6A 4M7DE 2V8KA 3MJXA 3TQ7P 1N8RC 4OMMA 4L6V5 1SKUB 5FU7B 3SD4A 2D6FA 3UA6A 2EYXA 3HL8A 2FZGB 1VQPQ 3CCMT 4E7ZA 1NPPA 2CZ6B 2X3XD 3A8MB 1IRXA 2ZGWA 3UA7A 1WNLA 2A0FB 2ZCFB 1ACMB 4J9BA 1FYNA 2JTMA 1WYXA 2RHUA 1M3BA 3S6WA 2W10A 4MZMA 2Y4XA 1BKBA 2AZVA 5LJ3j 2DO3A 1BIBA 3JB9J 4WF2A 3VYHB 1YJNA 2DTOA 4QQGA 4AFUC 3P8HA 2P0PA 3LWIA 3CCJA 1RLPC 3BE3A 3VS5A 3CPFA 5GMKl 1K9MU 2P0KA 4KBMB 1BYMA 2YDLA 4KUDK 4ZGJB 5CR2A 4BI8B 5KYWB 1I07A 4PJOC 4M7AA 4JRIA 2KNBB 1Q7YR 3JCMf 5IH2A 1VQPA 4HVUA 3JCMc 1T3LA 4M7DG 1WZOA 2DZ9A 2FZKB 4M75D 1BU1A 2ED0A 2IIMA 3ZFJA 3NFCA 2LMJA 2K7AA 2JXBA 3R6OA 4F16A 4C8QB 2DYBA 5HCKA 3I55T 5CKHA 1NLOC 3FB9A 3ME9A 2ROLA 1MMDA 3PFSA 5LJ5f 2JMAA 4J5YA 1WIEA 2MWPA 4PJLA 1FWZA 1FMVA 2DL5A 2G6FX 2QEXT 3OMGA 1RUWA 2CREA 1IHVA 3G6ET 4XTZA 3JB9G 3DKMA 3TCJA 3L2RA 3QWXX 2HL3A 1K73C 1WHJA 1VUBA 5HY6A 3JAME 2D9TA 1RI0A 1AD5A 2D1XA 3REAB 5CQYA 3FC3A 4M77E 5HK3A 4LD6A 2EFIA 5I21A 5DLOA 4ZN1A 3RMSA 4Z88A 5LJ3f 2MIOA 5KYNA 3OYLA 4LDUA 4AG2C 3S3MA 2JTFA 1TXQA 1LJOA 1PKTA 3M0QA 2KXDA 2L3SA 3M54A 2MCNA 3VS3A 1S72T 4JZ3A 1NZ9A 2AIRB 1JJ2A 3GF5A 1QLYA 2LQ8A 2K57A 4IIOA 2P84A 4BDZA 3IQLA 1KD1C 4PFZA 3UT1A 1YWOA 1YFNA 3FLGA 4AFQC 2EGAA 3JB9H 2X4YA 4J9IA 3CCUT 1UTIA 4RG8A 1VQNT 1VQ7Q 1N9RA 3JCMd 3EFSA 2CP0A 1ABQA 1C1AA 1H3ZA 2D0NA 1RAIB 4HKEA 4EMKB 3X28B 4RTUA 4IUUA 2MF2A 5IHNA 4RCCA 5IHIA 4OMPA 2HSPA 4LD9K 2YUNA 4CC3A 5GMKm 4LDXA 2HKQB 2DF6A 4PJOF 2XD0A 5LJ5d 4XTWA 2X35A 5KYXA 4XU1A 2DK3A 4B9WA 4JLGA 3QHSA 3JCMg 1PC0A 1LNXA 1YHQT 1K73R 4M78E 2C06A 2DFUA 4M75A 2CYZB 4C92D 4R55A 2DJZA 3OYAA 1B3QA 4ORZA 2K6DA 3G4ST 1OPLA 1M2OA 3CCQQ 4IUTA 4EIKA 1RABB 5LJ5g 1MNDA 2DIGA 1QP3A 2K2VA 2LCLA 2MYSA 1UUEA 5FRNA 5I2MA 3PIPA 1K8AC 1AWOA 1VQ7A 1AWXA 1W2BA 1FMWA 4FYXB 1D0ZA 5GAMd 1VQ9Q 4LDVA 2OTJA 1TU0B 3OYFA 2LT4A 2DA9A 4ANJA 3CXCS 1PCXA 2I0NA 1KD1R 2DZCA 4M7AB 3MP6A 1SF9A 4HCCA 2F5TX 3H0IA 1VQ4T 4MMKA 2KBTA 1UEBA 3PVQA 1LCKA 2DBKA 3OYBA 3L2QA 1QVGA 1HSQA 3RESA 1M1KC 5GAMg 1VQOQ 3GNGA 1QCNA 4FYWB 2DL4A 4RTYA 2J7IA 2LCSA 2DVEA 3CCET 1RL2A 3EGXB 2NUZA 2KMTA 1KC8C 1WXUA 4C8QG 5FU6C 3CCQA 5CO7A 1PG5B 5DLQE 2HSEB 1MV3A 3V7SA 4M78G 4LN2A 2JNGA 1TWBA 1KQSA 1VQMT 2VGMA 1HD3A 1QWFA 1YITQ 4Y28E 2RQUA 1GCQC 1VQ9A 4JZ4A 3CPWS 4BI3A 4PLLA 5FU6B 1M27C 2YUQA 1AT1B 1VQ8Q 3ZEHA 2K3BA 3NGPA 1K4US 2AT1B 4DA4A 2YXYA 4MZPA 5GAN4 1UDLA 4OP0A 2JT4A 4EMHA 3VJPA 4PJOD 3OYGA 2GTJA 1JJ2P 1K73U 1VQOA 2EYZA 4HT9A 4HA8A 1LVKA 1NYFA 1YJNT 3AT1B 2QASA 4FYVB 2PVGB 1K8AR 4J9GA 3CCJT 5ECAA 4A54A 1UHFA 2CP7A 4C0DC 1RAFB 2RQWA 2LJ0A 4JUVA 3EG2A 4E7JA 2KI7A 3MCAB 2LDMA 3NHNA 2MAMA 2RHZA 3VRZA 2HQXA 1UB4A 1EX4A 3SWNA 1WJSA 5LJ5h 2AHJB 2F2XA 1XQHA 3X24B 1YITA 2OTLQ 2CGHA 4NL3A 1WPYA 1WDXA 2PVDB 1UHCA 3EG3A 4RUGA 3QDRB 4L59A 4C0DB 2L89A 3ASKA 1VQ8A 1AWJA 3RKXA 4XU2A 1M1KR 5KYUB 1N9SA 1W70A 3PIOA 3OYCA 4KT0E 4JS4A 4QVCA 4OMOA 1KC8R 5M9OA 3LWHA 4M7AE 4LUEA 2DL3A 4D6WA 1YJWQ 3QJ6A 4A53A 2BUDA 3RR6A 3HRTA 5GAOn 1G3YA 4O6JA 3AHUA 2EGCA 4DEXA 5KYYB 5GAMh 1M1GA 1Y96A 1ZHIA 1QVFP 3QSUA 1XTDA 5J3BA 1QKWA 1M3CA 2WSCE 4M7DC 4ZGDB 1CKAA 2RNAA 3RNJA 4ATOA 3CCSQ 2QQ9A 3EGDA 1JEGA 1G3WA 2OTLA 3CCVT 3HP9A 1O75A 1RAHB 2EKOA 3RMQA 1D1BA 2ZPIB 2L3PA 2GCXA 4V2SA 3EGUA 1R0BG 4M7DB 4X1VA 2A36A 5GAN3 4NS5A 2FB7A 4BE2A 4J7FA 1G8XA 3JCMJ 3DLMA 5J26A 2QXFA 4DQ2A 2VB6A 2ED1A 1YJWA 3VV0A 1PD1A 2K3YA 4MDWA 2QG9B 2M0OA 4DBFA 3EFOA 3ULRB 3V8KA 4M7AG 2D0QB 2F2VA 1JBMA 2IPOB 2LC4A 2RA2A 2RHIA 4E7SA 3CCSA 2DXUA 4PJOA 2EQKA 3L2ZA 4C0GA 1Q86C 2X4JA 2RHXA 2L3RA 1S1NA 3VRYA 4ZTFA 4N4GA 5GAOq 1MUZA 4PL6A 2WSEE 1Y7XA 2FL7A 3QZ9B 2YHTA 1VYTA 1G3SA 4F14A 1TUDA 4C5GA 1QKXA 2FRWA 1MMNA 2LJ1A 4PKCC 1YCSB 1M1KU 1ZA1B 2DX1A 4RTXA 2EQMA 3JSCA 3LH5A 3V8LA 3FRNA 1Y71A 1OPKA 4J6XA 3DB3A 2KYBA 3JB9I 2RF0A 2VV5A 2V1RA 3A8GB 4Z02A 2GBQA 2E12A 3CMAQ 7AT1B 2O9VA 2RMOA 3L42A 2E5KA 3OYIA 3EAEA 1PKSA 4JJDA 2WACA 3ZBDA 4MDXA 2VC8A 2B8AA 3M9QA 4E7LA 4QVZA 2RH2A 1VQ7T 1BB9A 3LGLA 3DLLA 4M75E 3EHQA 2VXFA 2M1HA 4M77C 2XK0A 3MEUA 2NLUA 4M7DF 2DXTA 4C5IA 3SWNB 2GFAA 1W4SA 4KRTA 2OX7A 2LNVA 2K5LA 4PJNA 2CSIA 2EYQA 4BY6B 1WJQA 2ATCB 4GLKA 4WCIA 2LJ3A 2QQAA 4M77B 4C92B 1AZGB 3OW2S 4E7IA 1ZSZC 2LQWA 2AZSA 3CMAA 3NPFA 1Q86R 3EG9B 4PNOA 1B7TA 3JB9F 1TTHB 3CCQT 2FG0A 2DTIA 1G3TA 3QDFA 5L23A 1ZSZB 2EBPA 2M16A 2NUPB 4DBQA 3META 4DBRA 2MWOA 4J9CA 5CIUA 3OBYA 3L2UA 5GAN5 4E47A 3BFMA 1WI7A 4CC2A 2LVMA 3BDUA 4ZGEB 2OI3A 2V1QA 4BE1A 1YP5A 2HBWA 3M4YA 2O4XB 4M75G 1WGSA 2PUOB 4C8QC 3CC7Q 1RADB 2NWMA 4KGZB 4HCBA 1AWWA 3OSSC 3QYHB 3X20B 4FU6A 1OOTA 4M78C 2PZ1A 2RI2A 1QCOA 3ZL7C 1JQQA 4QQ6A 3GP8A 1X6GA 2LTOA 2RPNA 1PNJA 2GGRA 2KYMA 2RK1A 2E1HA 4OMNA 4GBQA 2VYTA 4IKFA 1WX6A 4BE0A 4IUPA 4M78B 2NUTB 6AT1B 3A8LB 4HCKA 1X2QA 3M53A 3JV3A 1XNIA 1YITT 1X43A 3LLRA 1OQKA 4ZN3A 1OX8A 2FPFA 4ZNXA 3H41A 2E3IA 1VQ8T 2H8HA 3QG1A 3MEWA 2CS7A 2HD0A 2YSQA 3UF4A 3QBYA 2R5AA 1VA7A 3E19A 4XU3A 1AVZC 2CSQA 1U06A 3CC7A 4M77F 5KCHA 2CZ0B 2VXEA 3UATA 1N6AA 2MK5A 3NTIA 2DTHA 4C92E 2YLCA 3OSVA 3O5ZA 1Q86U 1WQWA 1BI2A 3VS0A 2ZPHB 3GLXA 2R57A 4FW2A 3OS5A 2ZAEA 1FX7A 3FDRA 2A37A 2HL5C 2XIDA 1OV3A 2M0YA 2YT6A 1U1TA 2DRMA 9ATCB 3EG1A 1GCQA 3OA6A 2COYA 2OTLT 4B9XA 3CCRQ 4OGEA 2J6OA 5J39A 2A3LA 5FRMA 3E2UA 2V26A 4KGXB 4EMKC 1HYOA 5L8RE 2CH4W 2VWFA 2JMCA 3BW1A 2HMAA 3MHXA 5LL6S 2AKKA 2QGFB 2E4HA 3EH1A 1C0MA 1YJWT 5GANj 1UJ0A 2DD5A 2FO0A 2BTTA 5CKDA 1QWEA 2C0TA 4F7UA 2IVWA 1X01A 2OTJQ 2EIFA 2RJCA 4C8QF 8AT1B 3G71T 1TH7A 3SDZA 4OMQA 1KFZA 4M78F 4D8KA 1JO8A 4M77G 1UGQB 2I2LA 3OQ5A 4C92G 2QDYB 1JU5C 3CCST 3GBQA 3PE0A 1MMGA 1Q81C 2KAFA 2K2MA 4E6RA 2BE9B 3CCRA 5GMKh 2RHYA 2J6FA 2YRCA 4Y92A 1WHKA 4ELZC 5GAOp 1IXDA 1M9SA 1XJWB 1W2BS 1QVFA 2EQUA 3UWNA 4LNPA 3OS2A 3CBPA 3M0PA 4PJOE 3OYYA 3I5RA 2F69A 2QYZA 1VQ5Q 4M7AC 3CCMQ 1EFNA 1T0JA 2KRNA 3VS7A 3TVTA 5CVIA 4FSSA 1M2VA 3V7CA 2B86A 1Y0MA 2DMOA 2DVJA 3E1SA 3I56T 3NTKA 5LJ3d 1UG1A 1TUGB 1R8OB 1D3BA 3UPUA 1QVGS 4FL6A 1V76A 5GAN6 4HVWA 1UGPB 4OB2B 2DL8A 1W1FA 4QQDA 1ZUYA 1X69A 2O31A 4AG1C 1E6HA 1HJDA 3TEEA 1ARKA 2H3JA 1NLPC 3PTAA 1SG5A 3JCMW 3RKWA 1ZBJA 4LXCA 3M58A 2RJDA 2KEAA 5LJ3g 4II1A 3LGFA 1M1FA 3WVDB 2DKGA 1UJYA 1KQSS 4A4FA 1SHGA 1YJ9Q 2PUKB 3OYEA 2FVUA 2RJEA 3T9NA 3OYJA 5IXBA 3CCLQ 2VGNA 3CXCA 2DJQA 5GANf 3CD6T 5FWCA 4KH1B 2RK2A 1VQ5A 1YI2Q 3CCMA 1LOJA 2P0QA 3Q1JA 1ZQ1A 1Y07A 2FEIA 1K0XA 5GAOl 1U8RA 1SHFA 2ESWA 2HKNA 4FW1A 3CMAT 1W6XA 1Q81R 2V8IA 3PGGA 3I55Q 3QJYA 3JCMe 2C0IA 1BIAA 1WHLA 2KRSA 5KH6A 3CC2Q 3EG0A 4XQ3A 3GOXA 5D6XA 4JDSA 2RQTA 2P4RA 3VS4A 4PJJA 4JJBA 5C0MA 3JCMh 1I5LA 2BZXA 3M56A 3E9FA 3H6ZA 3CPWA 5LJ5e 3LH0A 4XK8E 1WXBA 2HQEA 4FM4B 1GRIA 3A8OB 1YJ9A 3FJPA 2R58A 2QI2A 4KUIA 1YBYA 3CCLA 4PK4A 1SRMA 3JCMV 1B07A 4BI4A 1Q95G 1YI2A 1R77A 1JB0E 1GCPA 1K1ZA 2CT4A 1VQPT 2YRVA 2HNIA 4BACA 1X6OA 1TG0A 2K5FA 4JJNK 2COWA 4LE9A 2L0AA 3I55A 1M8VA 3M0TA 4M7AF 1CKBA 1MHNA 4R0KA 3F70A 1QQJA 3CC2A 5CKBA 5GAMe 1BI0A 3HHTB 1YN8A 4F7UB 2CZ1B 3KBGA 3E9GA 2E6NA 3EH2A 2R5MA 1BK2A 4DOVA 4M75C 2DETA 2DM1A 1OULA 2XDPA 1H92A 3VU3C 3M4GA 2LNHB 5KYXB 1RI9A 2ZPBB 5GANd 1GBRA 1J3TA 5LJ3h 1VOMA 5GJWB 2DPPB 1EZZB 3LX7A 4DOWA 5GMKi 2EGEA 2DILA 3FJ5A 1U5SA 1SEMA 2A08A 5AT1B 4M75B 3CC7T 4A4EA 2RB6A 2XHCA 2DXBA 4QW2A 4CC7A 1YCYA 2OAUA 3H9NA 2GQIA 2ZPEB 2E6ZA 2YUPA 3WXMB 1Q81U 2DRKA 1NG2A 1E7OA 4J9EA 3N5BB 2XDDA 1RAGB 4PLIA 1XOVA 1GFCA 2M9UA 4E7KA 8ATCB 4JLIA 2BKDN 2PQWA 3TSZA 2AKLA 3SFMA 4RTVA 4OVAA 3TREA 3VUBA 1DJ7B 5KYWA 3MEVA 2JUFA 3G4SQ 2F1LA 2XDBA 5GAOm 3HRSA 3CCUA 1WQ7A 2RO0A 3CXCP 2MMPA 1PSFA 4C8QA 3RKYA 1TSFA 3QIIA 4A4KA 3QKJA 1X6BA 3I5SA 3C94A 3VS1A 3X25B 2RJFA 4P5NA 2D8HA 1I81A 2JM9A 5GAN8 3H8ZA 1VQ4Q 1OYXA 4E7HA 3PMIA 1QVPA 1KJWA 2DL7A 3JRZA 1Q82U 1TOVA 1P92A 2E10A 3C0CA 1VQLQ 1PHTA 5A0LA 3CCEQ 2J05A 1G5VA 2E3HA 3G4SA 4OB3B 2DE0X 4F7UE 3CPWP 3OYNA 3HKSA 2EJGA 1WFWA 3RERA 1BI1A 1I8FA 1NEBA 5CAIA 1TS9A 1VQMQ 1LPLA 3SWNC 4EPCA 1ZX6A 4M75F 1KQ2A 2LQNA 2E70A 4BY6C 3A5ZB 4J83A 3PVLA 1YWPA 2LCCA 4FIBA 4C92C 1PD0A 1YIJQ 3RDVA 1SRLA 2QK0A 2OTJT 1VQ4A 5FROA 3DB4A 4HT8A 2YWWA 1VQ6Q 2E5QA 2ZPFB 4FT4A 1N27A 5FW9A 3HTRA 2MPXC 4JS5A 3CMEQ 1VQLA 1CSKA 2QQBA 1RAAB 1ZBXA 4R56A 3CCEA 4RG2A 1Z9ZA 5LJ5j 1OU8A 1AEYA 1SSHA 2LX9A 3J81E 2VASA 2L3QA 1OZ2A 1VIEA 4EMKA 1F1BB 2QTVA 5IHKA 1IREB 4LUDA 1C6VX 1SPKA 4OMFB 4CI0C 4RMOA 2ABLA 1VQMA 1K76A 3QWYA 3FIFA 1JXMA 3M5AA 2O2OA 1M5Q1 4DBHA 4F7UG 2CH4A 4NL2A 2F5KA 1VQ5T 1AOJA 2JS0A 2M02A 1Y96B 1MNEA 3X26B 1WHMA 3OW2A 1VQ9T 1KQ1A 1V29B 1KHIA 2KRMA 1YIJA 3LYIA 2KY9A 5GAMj 3EGDB 5CQXA 5I11A 2DERA 1VQ6A 2CUBA 4J9HA 3CMEA 2D8JA 2GNCA 3SB2A 3L2WA 1VQOT 2PTKA 2HDAA 2K79A 4AT1B 2QA4Q 1UE9A 3THKA 3PNWC 3M0UA 2FRYA 1HXDA 2A28A 3JCMQ 1NYGA 1Z9QA 3A8HB 3KFVA 3REBB 3VKIA 1YJ9T 2LRQA 2ECZA 2OAWA 5CKEA 2RI5A 2CZ7B 3CCLT 3CCVQ 2IG0A 1NM7A 1OZ3A 2HZYA 1YI2T 4N0AC 1X27A 3EFOB 2JZ2A 1EIFA 2ROTA 3HSBA 4ELYC 3OYHA 2KK4A 3QPHA 2LP5A 2K4YA 2CP2A 3EGXA 4PJOB 4F17A 4M7DD 2F2WA 3CC2T 3U23A 3A98A 2EWNA 3UDCA 4C92F 2DEQA 1A0NB 1N8RR 5KE3A 4XAXB 2JM8A 1JXOA 3L2VA 2QA4A 2CP5A 3OYKA 3GPLA 4OF1A 2KGTA 1H641 2DAQA 2DXCA 3KXTA 1UGVA 3M0SA 3PMTA 5A0DA 1JJ2S 3MO8A 3URGA 3JB9D 3CCVA 2RD1A 4IIMA 4RKUE 3CQTA 2W0ZA 2EAYA 5GAMf 2L5QA 4C5EA 1NEGA 3G1JA 1VYUA 2P4TA 2EYYA 4N4HA 4X9DA 4EMGA 5GAN2 2Z0WA 5EC7A 1D1CA 2BZ8A 3CC4Q 4XTXA 3MP1A 3SHWA 2EJ9A 2X51A 1M90C 3CBMA 1FMKA 1RAEB 2KVQG 1AZEA 1OU9A 2LX7A 2EJFA 4QKUA 2X9HA 1GL5A 3MEAA 1M4ZA 4YTLA 5AYFA 3OS1A 2VKNA 4NOYA 2CT3A 5GMKe 3INZA 4O5VA 5KYUA 2ZZDA 1VQKQ 3V7RA 4MZTA 2LQKA 5EG2A 4B6MA 1Q7YU 3O8VA 5HK0A 3RIRA 4QVDA 2QTXA 1B34A 2FYKA 4KULA 4RTWA 3OW2P 1QVFS 3QXEB 1ZLMA 1YNZA 2KR3A 1D09B 5IN1A 5KYYA 2PVOB 1TUCA 4Q5WA 1NPRA 4HVVA 1WA7A 2HBPA 1K0SA 4PFOA 4C8QE 4C5HA 4CC4B 3CC4A 2DYIA 1G2BA 4UC4A 4PFPA 2CKKA 2RQRA 4J7IA 1N8RU 3M59A 3I9QA 1VIFA 4M77D 2QQRA 2KQWA 2KT8A 2O01E 2DD4A 2O88A 3HFOA 1UFFA 3M55A 2PU9B 1UECA 5FLXE 1UGRB 4J9FA 4M7DA 2BE7D 2JOYA 2KROA 2KE9A 4N4IA 1VQKA 3QZ5B
chains in the Genus database with same CATH topology
3G7ZA 3TCJA 2RH2A 2ZPBB 1I4K1 3L2RA 1VQ7T 4FSXA 3LGLA 5GANd 1K73C 3DLLA 1VUBA 5LJ3h 5HY6A 3P8BB 4M75E 3JAME 2VXFA 2M1HA 2DPPB 4J6YA 2XK0A 3MEUA 4M77C 2NLUA 1GXIE 3LX7A 4M7DF 3HFNA 4X34A 4DOWA 5GMKi 2K5IA 2DXTA 4C5IA 2JVVA 3SWNB 2D9TA 1Q82C 3OY9A 1IZ6A 2GFAA 4M75B 1RI0A 2Y90A 4QVZA 4A4EA 1W4SA 2RB6A 2XHCA 2DXBA 4QW2A 3S3OA 5CQYA 3FC3A 1YCYA 2LNVA 1MGQA 2OAUA 2K5LA 4Y91A 4M77E 2EYQA 5HK3A 4OB0B 4LD6A 4BY6B 4OB1B 1WJQA 2ZPEB 2EFIA 4GLKA 2E6ZA 5I21A 3WXMB 3C4SA 3C12A 3OB9A 4ZN1A 5DLOA 1Q81U 4VUBA 3RMSA 2XDDA 3N5BB 2QQAA 4M77B 4PLIA 5LJ3f 4C92B 1XOVA 1VQLT 3C95A 3OW2S 4E7IA 3OYLA 4LDUA 2M9UA 3S3MA 2JTFA 3CMAA 1LJOA 4E7KA 4JLIA 2BKDN 2QQSA 2PQWA 4PJOA 3M54A 3SFMA 5CCAA 3JCMP 4PNOA 1KG1A 4OVAA 4PJOG 4EDUA 1S72T 1NZ9A 3JB9F 3TREA 3VUBA 1JJ2A 3GF5A 2LQ8A 2K57A 1DJ7B 3CCQT 2DTIA 1G3TA 1KD1C 4BDZA 3UT1A 3MEVA 3FEOA 2JUFA 3QO3A 3FLGA 2BIVA 4J6WA 3TU4K 3OBWA 4C8QD 2XDBA 5GAOm 2RI3A 3HRSA 3CCUA 3JB9H 4J8OA 4M78D 5KCOA 2X4YA 2M16A 3BY7A 1WQ7A 3META 2RO0A 2MMPA 1PSFA 3CCUT 2V8JA 2MWOA 4C8QA 3RKYA 4RG8A 1JRIA 3QIIA 5DM7R 3EFRA 1N9RA 5CIUA 3JCMd 1VQNT 3EFSA 4A4KA 3OBYA 3L2UA 5GAN5 1YIJT 1H3ZA 1NJIC 3M57A 3PT9A 3QKJA 4E47A 3BFMA 4HKEA 4EMKB 3NTHA 3X28B 2LVMA 3BDUA 4ZGEB 2MI6A 4BE1A 2KSSA 2O4XB 3M4YA 1WGSA 2MF2A 4IUUA 4M75G 1VQ6T 4BDYA 3HRUA 2PUOB 3C94A 4RCCA 4C8QC 3X25B 2RJFA 4P5NA 4LD9K 1I81A 5GMKm 4LDXA 4HCBA 5GAN8 3H8ZA 3OSSC 3QYHB 3X20B 3CMET 4FU6A 4PJOF 1OYXA 4M78C 2XD0A 2RI2A 5LJ5d 4XTWA 2X35A 4E7HA 4XU1A 1U1SA 3PMIA 2DK3A 4B9WA 1QVPA 3JRZA 3QHSA 4JLGA 4OGCA 4QQ6A 3JCMg 5KE2A 3GP8A 1Q82U 1P92A 2E10A 2LTOA 2YLBA 3ER0A 1LNXA 1OI1A 1YHQT 5A0LA 4ZTJA 5GAN7 4M78E 4X9CA 2C06A 2RK1A 2E1HA 1G5VA 3G4SA 4M75A 2VYTA 2CYZB 4OB3B 1YHQA 4F7UE 4IKFA 3GIBA 4BE0A 5I2SA 4C92D 4IUPA 4R55A 2DJZA 4M78B 3OYNA 3OYAA 3G4ST 4JRQA 4IUTA 3HKSA 2EJGA 2X4WA 3A8LB 5CKFA 2QEXA 3M53A 5LJ5g 3RERA 4IUQA 1BI1A 1I8FA 2DIGA 1XNIA 1QP3A 2K2VA 3LLRA 5LJ3e 3S3NA 4ZN3A 3HPWA 1YITT 2LCLA 3G6EA 5CAIA 5FRNA 4M77A 3SWNC 5I2MA 4C92A 3PIPA 1K8AC 2XKOC 4EPCA 1VQ7A 4M75F 1KQ2A 1VQ8T 1M90U 1W2BA 2E70A 1KD1U 3QG1A 4BY6C 3MEWA 2CS7A 2HD0A 3A5ZB 5GAMd 4LDVA 4J83A 3OYDA 2LCCA 3QBYA 4RCBA 2R5AA 1B34B 3E19A 4FIBA 4XU3A 4C92C 2OTJA 3CC7A 3OYFA 2E41A 2XG8D 4M77F 1K9MC 2LT4A 5KCHA 1KHCA 4TVRA 3L1AA 2G3RA 2CZ0B 1HK9A 3MP8A 3CXCS 1VQ4A 2OTJT 3BDLA 2DZCA 4M7AB 2VXEA 3MP6A 5FROA 3DB4A 2F5TX 4HCCA 1N6AA 4HT8A 4BD3A 3NTIA 2E5QA 2K3XA 2ZPFB 2DTHA 1VQ4T 4FT4A 2YLCA 4MMKA 1N27A 1UEBA 3OSVA 4C92E 1Q86U 3VYGA 2X4XA 3OYBA 5GMKj 1WQWA 3L2QA 4JS5A 1QVGA 1UGSB 1VQLA 1BI2A 3KUFA 2QQBA 3RESA 2QA4T 1M1KC 2ZPHB 3GLXA 5GAMg 2R57A 3GNGA 1ZBXA 4IUVA 5IAYA 5GANg 4R56A 4RG2A 5LJ5j 3OYMA 3CCEA 3OS5A 1FX7A 2DVEA 3FDRA 4LDYA 3CCET 1RL2A 2LX9A 3J81E 3WVEB 2KMTA 2XIDA 3QYGB 1OZ2A 1VIEA 4EMKA 1S72A 1KC8C 4C8QG 1U1TA 2GFUA 5FU6C 3CCQA 3QUIA 2HAXA 2O4XA 5CO7A 1IREB 3OA6A 4HCZA 5DLQE 2OTLT 3V7SA 4B9XA 4M78G 2EQJA 4MMLA 2JNGA 1AHJB 4OMFB 4OGEA 4CI0C 4RMOA 1VQMA 1D3BB 1KQSA 5J39A 3FIFA 3M5AA 2A3LA 5FRMA 1M5Q1 4A4HA 4F7UG 1VQMT 2VGMA 3CBOA 2F5KA 4NL2A 4EMKC 5IT9E 5L8RE 4Y28E 1VQ5T 2XU8A 1VQ9A 3CPWS 4BI3A 3BW1A 1Y96B 4PLLA 3MHXA 5FU6B 1VQNA 3X26B 4XU0A 5DY9A 5LL6S 3OW2A 4C0FA 1VQ9T 3OS0A 1KQ1A 1V29B 2Y4YA 3ZEHA 1KHIA 2FHDA 5A0GA 5HKCA 1YIJA 5C6SA 3LYIA 2KY9A 4IURA 2L8DA 3JCMX 5GAMj 4DA4A 3CEYA 1YJWT 5GANj 4M78A 4MZPA 5CQXA 2DD5A 1K8AU 3J7AF 2A7YA 5D6WA 5GAN4 1VQ6A 4OP0A 5CKDA 4XTUA 2E65A 3GNFB 3P8DA 4EMHA 3VJPA 4F7UA 2IVWA 3G71A 4PJOD 3OYGA 1X01A 3CMEA 2EIFA 1K73U 1VQOA 3SB2A 2RJCA 4C8QF 3G71T 2KDSA 3L2WA 4HA8A 4HT9A 2XICA 1YJNT 1TH7A 3SDZA 1VQOT 2PVGB 4M78F 2DIQA 4XTVA 3CCJT 4M77G 4A54A 1UGQB 2I2LA 3OQ5A 4C92G 2QDYB 3PNWC 4XTYA 3CCST 1FXXA 3VUZA 1HXDA 1Q81C 4M7AD 3JCMQ 2KAFA 4N0AA 4C0DC 2E64A 4F7UF 3A8HB 4JUVA 4E7JA 3MCAB 2LDMA 3VKIA 3CCRA 1YJ9T 2MAMA 5GMKh 2RHZA 1X75C 2HQXA 2LRQA 2ZPGB 2RHYA 5CKEA 1UB4A 5D6YA 3SWNA 4JRKA 1WJSA 2RI5A 2CZ7B 3CCLT 3CCRT 5LJ5h 2IG0A 2AHJB 4ELZC 1XQHA 3X24B 5GAOp 3JCMb 1YITA 1OZ3A 2CGHA 1M9SA 1WPYA 4NL3A 1YI2T 4FT2A 4N0AC 2PVDB 2WSFE 1W2BS 1QVFA 2EQUA 3UWNA 1KC8U 2JZ2A 1EIFA 1PSEA 3CBPA 3LW5E 3QDRB 3OS2A 3HSBA 2GQVA 4L59A 4CRIA 4C0DB 2L89A 4ELYC 4PJOE 1BI3A 3ASKA 3OYYA 1VQ8A 1SSFA 2F69A 3OMCA 2KK4A 3QPHA 3OYHA 4GY5A 2K4YA 3CC4T 3RKXA 4XU2A 4M7AC 2XI9A 5CVIA 1N9SA 4PJOB 3I56A 3V7CA 2JN0A 4JRPA 1QW1A 4M7DD 3PIOA 3OYCA 4KT0E 4JS4A 4QVCA 1WJRA 2RM4A 3V8JA 1QP2A 5GANe 3E1SA 3I56T 1O9SA 3NTKA 5LJ3d 5M9OA 3LWHA 3CC2T 4M7AE 4C0ZA 4D6WA 3QJ6A 2EWNA 3UDCA 1R8OB 1D3BA 3RUXA 2DEQA 4A53A 4BB7A 4C92F 3UPUA 1QVGS 4FL6A 5KE3A 1Q7YC 2BUDA 4XAXB 3HRTA 5GAN6 2VUBA 5GAOn 1UGPB 4OB2B 1G3YA 4BUGA 4O6JA 3AHUA 4QQDA 3L2VA 2QA4A 3OYKA 5GAMh 1M1GA 1VQKT 3GPLA 4OF1A 5GANh 1Y96A 1NJIU 1H641 1ZHIA 2DAQA 3TEEA 2DXCA 2H3JA 5CK9A 3QSUA 1XTDA 4L5GA 3KXTA 3PTAA 5J3BA 4LDWA 2GF7A 2WSCE 3JCMW 3RKWA 5FU7C 4M7DC 4ZGDB 4ME7A 3PMTA 5A0DA 3M58A 2RJDA 5LJ3g 5A2QE 4ATOA 1JJ2S 4II1A 3MO8A 2LT1A 3URGA 2QQ9A 3JB9D 3CCVA 3LGFA 5GAOr 1M1FA 2RD1A 1NE8A 3WVDB 2DKGA 1KQSS 1G3WA 4A4FA 2OTLA 3CCVT 2PUKB 3HP9A 3OYEA 2FVUA 2RJEA 1O75A 4RKUE 3T9NA 4A4GA 3CD6A 4M7DE 2V8KA 1N8RC 2EKOA 3RMQA 3OYJA 2EAYA 5GAMf 2L5QA 4L6V5 2VGNA 2ZPIB 4C5EA 5GANf 3CXCA 3CD6T 2GCXA 2RK2A 4V2SA 2P4TA 1VQ5A 5FU7B 4M7DB 4N4HA 3CCMA 4X9DA 1LOJA 2P0QA 5GAN3 3SD4A 3Q1JA 2D6FA 1ZQ1A 4EMGA 3HL8A 5GAN2 1Y07A 4NS5A 2FB7A 4BE2A 4J7FA 3CCMT 1NPPA 3JCMJ 2CZ6B 3DLMA 5GAOl 3A8MB 5J26A 3J80E 2ZGWA 1U8RA 3CMAT 4XTXA 2QXFA 3MP1A 1WNLA 2ZCFB 4DQ2A 1YJWA 2V8IA 2EJ9A 3CC7T 3PGGA 3VV0A 1M90C 3CBMA 2JTMA 3QJYA 2RHUA 2K3YA 2KVQG 3JCMe 4MDWA 3S6WA 2EJFA 4MZMA 2Y4XA 1BIAA 1BKBA 5KH6A 2M0OA 5LJ3j 2DO3A 1BIBA 3MEAA 1M4ZA 4XQ3A 4YTLA 5AYFA 3V8KA 3OS1A 3GOXA 3JB9J 5D6XA 2D0QB 4M7AG 4WF2A 1JBMA 4JDSA 3VYHB 1YJNA 2LC4A 2RA2A 2RHIA 2DTOA 4NOYA 4QQGA 5GMKe 3INZA 3P8HA 4O5VA 2P0PA 5C0MA 3LWIA 3CCJA 3JCMh 2ZZDA 1I5LA 3M56A 3CCSA 2DXUA 3CPFA 3E9FA 3V7RA 5GMKl 1K9MU 2P0KA 2EQKA 3H6ZA 3L2ZA 4KBMB 5LJ5e 3CPWA 3LH0A 4MZTA 4XK8E 4C0GA 2LQKA 5EG2A 1Q86C 1BYMA 2X4JA 2RHXA 1Q7YU 2HQEA 4FM4B 2L3RA 3O8VA 3A8OB 3RIRA 5HK0A 4ZTFA 1YJ9A 4N4GA 4QVDA 5GAOq 2QTXA 1B34A 2FYKA 3FJPA 4KULA 4PL6A 2WSEE 1Y7XA 2R58A 2FL7A 3QZ9B 2QI2A 2YHTA 4KUIA 1YBYA 4ZGJB 3CCLA 4KUDK 1G3SA 3JCMV 4C5GA 4BI8B 5CR2A 1QVFS 3QXEB 4PKCC 1M1KU 4BI4A 4PJOC 1YI2A 4M7AA 4JRIA 2EQMA 3JSCA 5IN1A 3V8LA 1JB0E 3FRNA 3JCMf 1VQPA 1Y71A 2PVOB 3JCMc 1NPRA 4Q5WA 2HBPA 4M7DG 4J6XA 2DZ9A 4C8QE 4M75D 4C5HA 3CC4A 1VQPT 2YRVA 2HNIA 3DB3A 1X6OA 4BACA 2K5FA 4JJNK 3JB9I 3ZFJA 3NFCA 2VV5A 4UC4A 2CKKA 3I55A 1M8VA 3A8GB 3R6OA 4J7IA 4Z02A 1N8RU 3M59A 4C8QB 4M7AF 2E12A 3I55T 1MHNA 1VIFA 3F70A 2QQRA 2KQWA 4M77D 5CKHA 3CC2A 3FB9A 3ME9A 5CKBA 3L42A 3PFSA 5GAMe 2O01E 3EAEA 1BI0A 5LJ5f 3OYIA 4J5YA 3HHTB 2DD4A 2MWPA 3HFOA 1FWZA 2WACA 3ZBDA 4MDXA 4F7UB 2CZ1B 3KBGA 2VC8A 3M55A 2PU9B 2B8AA 5FLXE 3M9QA 3E9GA 1UGRB 2E6NA 3OMGA 2QEXT 2R5MA 4M7DA 4DOVA 2JOYA 4M75C 2XDPA 4N4IA 4XTZA 3VU3C 3G6ET 4E7LA 1VQKA 3M4GA 3QZ5B 3JB9G 3DKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN f;  5GAN 7;  4M78 E;  4X9C A;  5GAN 4;  1I4K 1;  4OP0 A;  4XTU A;  2E65 A;  4V2S A;  2E1H A;  4M7D B;  4EMH A;  5GAN d;  4X9D A;  1LOJ A;  4F7U A;  4PJO D;  4M75 A;  5GAN 3;  5LJ3 h;  3JB9 G;  1X01 A;  4EMG A;  4M75 E;  4F7U E;  5GAN 2;  3GIB A;  2FB7 A;  2VXF A;  4J6Y A;  4M77 C;  4C92 D;  2DJZ A;  4M78 B;  3SB2 A;  4C8Q F;  3JCM J;  4M7D F;  3HFN A;  4HA8 A;  2EJG A;  5GMK i;  5GAO l;  4HT9 A;  5LJ5 g;  2DXT A;  2ZGW A;  1TH7 A;  3RER A;  3SWN B;  1I8F A;  4XTX A;  5LJ3 e;  4M75 B;  1WNL A;  2Y90 A;  4DQ2 A;  2RB6 A;  4M78 F;  5CAI A;  4XTV A;  2EJ9 A;  3PGG A;  4M77 G;  1YCY A;  2I2L A;  4M77 A;  1MGQ A;  3SWN C;  4XTY A;  4Y91 A;  4A54 A;  4M77 E;  4C92 G;  1HXD A;  4C92 A;  4M7A D;  3JCM Q;  4N0A A;  2E64 A;  4F7U F;  3JCM e;  4M75 F;  1KQ2 A;  4JUV A;  5I21 A;  2EJF A;  1BIA A;  5GMK h;  5LJ3 j;  5GAM d;  1BIB A;  4M77 B;  5LJ3 f;  4XQ3 A;  3SWN A;  4C92 B;  4JRK A;  3V8K A;  4RCB A;  3JB9 J;  4M7A G;  4WF2 A;  1B34 B;  1JBM A;  5LJ5 h;  4XU3 A;  2RA2 A;  4NOY A;  2DTO A;  1LJO A;  4C92 C;  3JCM b;  5GAO p;  2CGH A;  2E41 A;  1WPY A;  4JLI A;  3INZ A;  4M77 F;  4N0A C;  5GMK e;  4NL3 A;  3JCM h;  3L1A A;  1I5L A;  1HK9 A;  2DXU A;  5GMK l;  4PNO A;  3V7R A;  4PJO G;  3JCM P;  3HSB A;  4PJO A;  2DZC A;  3L2Z A;  4M7A B;  2VXE A;  5LJ5 e;  3JB9 F;  4PJO E;  4HT8 A;  2K57 A;  2DTI A;  2DTH A;  3RIR A;  2YLC A;  4MMK A;  3RKX A;  4XU2 A;  4C92 E;  4QVD A;  5GAO q;  4M7A C;  2QTX A;  1B34 A;  2FYK A;  3FJP A;  3QO3 A;  1WQW A;  5GMK j;  1N9S A;  3RES A;  2YHT A;  4J6W A;  4PJO B;  5GAM g;  4C8Q D;  3V7C A;  2JN0 A;  5GAO m;  5GAN g;  4M7D D;  3JCM V;  4QVC A;  5LJ5 j;  2RM4 A;  3V8J A;  1LNX A;  4PJO C;  5GAN e;  4M7A A;  4JRI A;  3JB9 H;  2DVE A;  5LJ3 d;  4M78 D;  4M7A E;  3V8L A;  3BY7 A;  1WQ7 A;  2EWN A;  3JCM f;  4EMK A;  1D3B A;  3RUX A;  2DEQ A;  3JCM c;  4A53 A;  4C8Q A;  1U1T A;  3RKY A;  4C92 F;  4C8Q G;  4J6X A;  3QUI A;  1JRI A;  2DZ9 A;  4M75 D;  3EFR A;  1N9R A;  4C8Q E;  3JCM d;  3EFS A;  2HNI A;  5GAN 6;  5GAO n;  3V7S A;  5GAN 5;  3JB9 I;  4M78 G;  4MML A;  3AHU A;  3BFM A;  4EMK B;  5GAM h;  1M8V A;  1D3B B;  3BDU A;  4C8Q B;  5GAN h;  1Y96 A;  3FIF A;  1H64 1;  1M5Q 1;  4M7A F;  4F7U G;  4M75 G;  3QSU A;  4NL2 A;  4EMK C;  4RCC A;  4C8Q C;  4M77 D;  3JCM W;  3RKW A;  4M7D C;  3FB9 A;  5GAM e;  1I81 A;  5LJ5 f;  5GMK m;  4J5Y A;  5LJ3 g;  5GAN 8;  3BW1 A;  1Y96 B;  3HFO A;  4PJO F;  3JB9 D;  4M78 C;  5LJ5 d;  4XU0 A;  2RD1 A;  5DY9 A;  4F7U B;  5GAO r;  2VC8 A;  2DKG A;  4XTW A;  4XU1 A;  1U1S A;  1KQ1 A;  3QHS A;  3JCM g;  4M7D A;  2E10 A;  4M75 C;  4M7D E;  4M7D G;  4XTZ A;  3VU3 C;  2YLB A;  3JCM X;  5GAM j;  3M4G A;  2EAY A;  5GAM f;  5GAN j;  4M78 A; 
#chains in the Genus database with same CATH topology
 3G7Z A;  1I4K 1;  2EPD A;  4FSX A;  4Z89 A;  2FZC B;  3P8B B;  3I35 A;  2SRC A;  4J6Y A;  2DNU A;  4FCY A;  1GXI E;  1H3H A;  2C0O A;  1ABO A;  3HFN A;  4X34 A;  1X2K A;  2K5I A;  2JVV A;  1IHW A;  1Q82 C;  3OY9 A;  1IZ6 A;  1M90 R;  2Y90 A;  4QT7 A;  1BCO A;  3S3O A;  2LZ6 B;  4DEY A;  1MGQ A;  4Y91 A;  4OB0 B;  4OB1 B;  1N5Z A;  1PM3 A;  1RLQ C;  4K11 A;  3C4S A;  3C12 A;  3OB9 A;  4VUB A;  3VS6 A;  1IO6 A;  1VQL T;  3C95 A;  4KH0 B;  2QQS A;  5I22 A;  5CCA A;  1Y57 A;  3JCM P;  1KG1 A;  4PJO G;  4EDU A;  1IGQ A;  2EYW A;  2KXC A;  3FEO A;  3QO3 A;  2H3E B;  2BIV A;  4J6W A;  3TU4 K;  3OBW A;  4C8Q D;  4E2F B;  1IB8 A;  2CUD A;  2RI3 A;  2QEX Q;  4J8O A;  4M78 D;  5KCO A;  3G6E Q;  3BY7 A;  1BCM A;  2V8J A;  2ENM A;  1JRI A;  5DM7 R;  3EFR A;  4FYY B;  1ZA2 B;  1H8K A;  1YIJ T;  1NJI C;  3M57 A;  3PT9 A;  3NTH A;  2MI6 A;  1D1A A;  2KSS A;  4AFZ C;  1VQ6 T;  4BDY A;  1QMC A;  1PWT A;  3HRU A;  2CDT A;  4ESR A;  3CME T;  3SEM A;  1U1S A;  2AK5 A;  5KE2 A;  3J80 E;  1M8M A;  3MPU B;  4OGC A;  1D0Y A;  1IGU A;  1I5O B;  2YLB A;  3ER0 A;  4J9D A;  2BZY A;  1OI1 A;  1NBE B;  4ZTJ A;  5GAN 7;  1E6G A;  4X9C A;  3TSW A;  2COZ A;  4D8D A;  3GIB A;  5I2S A;  1S72 Q;  1Q82 R;  4JRQ A;  2CP3 A;  2X4W A;  5CKF A;  2QEX A;  4IUQ A;  3S3N A;  5LJ3 e;  3HPW A;  3G6E A;  2QDL A;  4JJC A;  4M77 A;  4HXJ A;  4C92 A;  2XKO C;  3D7S B;  1BBZ A;  1M90 U;  1KD1 U;  2NYS A;  3NMZ C;  2JTE A;  2EQI A;  3H0H A;  2HEQ A;  3CCU Q;  3EG9 A;  3OYD A;  4PJM A;  4RCB A;  1VQN Q;  1B34 B;  1RAC B;  1K9M C;  2E41 A;  2XG8 D;  1WLP B;  5GJV B;  2OJ2 A;  2GTO A;  1KHC A;  1OX9 A;  4TVR A;  2EW3 A;  3L1A A;  2G3R A;  1HK9 A;  3MP8 A;  4AMC A;  2VVK A;  3BDL A;  1ZSZ A;  4BD3 A;  2K3X A;  1K9A A;  3VYG A;  4F04 B;  2X4X A;  3G71 Q;  5GMK j;  1KSW A;  1UGS B;  2NUP A;  3KUF A;  1OEB A;  2QA4 T;  2PNI A;  1GFD A;  2KT1 A;  4IUV A;  5IAY A;  5GAN g;  3OYM A;  1U3O A;  4RTZ A;  1PRL C;  4LDY A;  1R0C B;  3R6N A;  3WVE B;  2L2P A;  1W2B P;  3QYG B;  1S72 A;  1YHQ Q;  1M2V B;  2XMF A;  2SEM A;  2GFU A;  3QUI A;  2HAX A;  2O4X A;  1NJI R;  4HCZ A;  2EQJ A;  4MML A;  1AHJ B;  1D3B B;  4A4H A;  2HCK A;  1I0C A;  3CBO A;  5IT9 E;  4GLM A;  2HQH A;  4WTO B;  2XU8 A;  3RBB B;  2J6K A;  1M3A A;  2DBM A;  4JPB W;  1VQN A;  4XU0 A;  5DY9 A;  1QVG P;  4C0F A;  3OS0 A;  2Y4Y A;  1MMA A;  2FHD A;  5HKC A;  5A0G A;  5C6S A;  1T3S A;  4IUR A;  2L8D A;  2YUO A;  3JCM X;  3CEY A;  2QAZ A;  4M78 A;  3I56 Q;  1K8A U;  2NUT A;  2A7Y A;  3J7A F;  5D6W A;  1GBQ A;  4XTU A;  1D0X A;  2E65 A;  3GNF B;  3P8D A;  2QGG A;  3G71 A;  1ZUK A;  1V1C A;  2CP6 A;  1KK7 A;  2EKH A;  2KDS A;  3MKD A;  2XIC A;  1KQS P;  3VS2 A;  2RN8 A;  1G83 A;  2X3W D;  2DIQ A;  2FPD A;  4XTV A;  1YHQ A;  1PRM C;  4XTY A;  1FXX A;  3VUZ A;  4M7A D;  4N0A A;  2E64 A;  4Z8A A;  4F7U F;  2RQV A;  2EVR A;  4OML A;  2FPE A;  4M4Z A;  1X75 C;  2ZPG B;  5D6Y A;  5FWB A;  4JRK A;  3CCR T;  1ZSG A;  2M51 A;  1K9M R;  3A1P A;  1MV0 B;  4AFS C;  2MOX A;  3JCM b;  4FT2 A;  1ZUU A;  2WSF E;  3CD6 Q;  1I1J A;  1T0H A;  1KC8 U;  1PSE A;  3LW5 E;  2GQV A;  4CRI A;  4RTT A;  1BI3 A;  1SSF A;  3OMC A;  4GY5 A;  3CC4 T;  2XI9 A;  3I56 A;  4JRP A;  2JN0 A;  1QW1 A;  2O9S A;  2JW4 A;  1WJR A;  1WXT A;  2RM4 A;  3V8J A;  1QP2 A;  2JS2 A;  1WHH A;  5GAN e;  1O9S A;  1QCF A;  2DEU A;  4C0Z A;  4KGV B;  3RUX A;  4BB7 A;  3M0R A;  2JJ9 A;  1Q7Y C;  2VUB A;  5IXF A;  4BUG A;  5D7U A;  1VQK T;  5GAN h;  1WHG A;  1NJI U;  2J06 A;  1M30 A;  2K9G A;  5CK9 A;  3EHR A;  1YJN Q;  4L5G A;  4LDW A;  2GF7 A;  5FU7 C;  4ME7 A;  4A63 B;  3CCJ Q;  5A2Q E;  2DLP A;  1KIK A;  2LT1 A;  5GAO r;  3H0F A;  1NE8 A;  1VYV A;  2YRD A;  4A4G A;  3CD6 A;  4M7D E;  2V8K A;  3MJX A;  3TQ7 P;  1N8R C;  4OMM A;  4L6V 5;  1SKU B;  5FU7 B;  3SD4 A;  2D6F A;  3UA6 A;  2EYX A;  3HL8 A;  2FZG B;  1VQP Q;  3CCM T;  4E7Z A;  1NPP A;  2CZ6 B;  2X3X D;  3A8M B;  1IRX A;  2ZGW A;  3UA7 A;  1WNL A;  2A0F B;  2ZCF B;  1ACM B;  4J9B A;  1FYN A;  2JTM A;  1WYX A;  2RHU A;  1M3B A;  3S6W A;  2W10 A;  4MZM A;  2Y4X A;  1BKB A;  2AZV A;  5LJ3 j;  2DO3 A;  1BIB A;  3JB9 J;  4WF2 A;  3VYH B;  1YJN A;  2DTO A;  4QQG A;  4AFU C;  3P8H A;  2P0P A;  3LWI A;  3CCJ A;  1RLP C;  3BE3 A;  3VS5 A;  3CPF A;  5GMK l;  1K9M U;  2P0K A;  4KBM B;  1BYM A;  2YDL A;  4KUD K;  4ZGJ B;  5CR2 A;  4BI8 B;  5KYW B;  1I07 A;  4PJO C;  4M7A A;  4JRI A;  2KNB B;  1Q7Y R;  3JCM f;  5IH2 A;  1VQP A;  4HVU A;  3JCM c;  1T3L A;  4M7D G;  1WZO A;  2DZ9 A;  2FZK B;  4M75 D;  1BU1 A;  2ED0 A;  2IIM A;  3ZFJ A;  3NFC A;  2LMJ A;  2K7A A;  2JXB A;  3R6O A;  4F16 A;  4C8Q B;  2DYB A;  5HCK A;  3I55 T;  5CKH A;  1NLO C;  3FB9 A;  3ME9 A;  2ROL A;  1MMD A;  3PFS A;  5LJ5 f;  2JMA A;  4J5Y A;  1WIE A;  2MWP A;  4PJL A;  1FWZ A;  1FMV A;  2DL5 A;  2G6F X;  2QEX T;  3OMG A;  1RUW A;  2CRE A;  1IHV A;  3G6E T;  4XTZ A;  3JB9 G;  3DKM A;  3TCJ A;  3L2R A;  3QWX X;  2HL3 A;  1K73 C;  1WHJ A;  1VUB A;  5HY6 A;  3JAM E;  2D9T A;  1RI0 A;  1AD5 A;  2D1X A;  3REA B;  5CQY A;  3FC3 A;  4M77 E;  5HK3 A;  4LD6 A;  2EFI A;  5I21 A;  5DLO A;  4ZN1 A;  3RMS A;  4Z88 A;  5LJ3 f;  2MIO A;  5KYN A;  3OYL A;  4LDU A;  4AG2 C;  3S3M A;  2JTF A;  1TXQ A;  1LJO A;  1PKT A;  3M0Q A;  2KXD A;  2L3S A;  3M54 A;  2MCN A;  3VS3 A;  1S72 T;  4JZ3 A;  1NZ9 A;  2AIR B;  1JJ2 A;  3GF5 A;  1QLY A;  2LQ8 A;  2K57 A;  4IIO A;  2P84 A;  4BDZ A;  3IQL A;  1KD1 C;  4PFZ A;  3UT1 A;  1YWO A;  1YFN A;  3FLG A;  4AFQ C;  2EGA A;  3JB9 H;  2X4Y A;  4J9I A;  3CCU T;  1UTI A;  4RG8 A;  1VQN T;  1VQ7 Q;  1N9R A;  3JCM d;  3EFS A;  2CP0 A;  1ABQ A;  1C1A A;  1H3Z A;  2D0N A;  1RAI B;  4HKE A;  4EMK B;  3X28 B;  4RTU A;  4IUU A;  2MF2 A;  5IHN A;  4RCC A;  5IHI A;  4OMP A;  2HSP A;  4LD9 K;  2YUN A;  4CC3 A;  5GMK m;  4LDX A;  2HKQ B;  2DF6 A;  4PJO F;  2XD0 A;  5LJ5 d;  4XTW A;  2X35 A;  5KYX A;  4XU1 A;  2DK3 A;  4B9W A;  4JLG A;  3QHS A;  3JCM g;  1PC0 A;  1LNX A;  1YHQ T;  1K73 R;  4M78 E;  2C06 A;  2DFU A;  4M75 A;  2CYZ B;  4C92 D;  4R55 A;  2DJZ A;  3OYA A;  1B3Q A;  4ORZ A;  2K6D A;  3G4S T;  1OPL A;  1M2O A;  3CCQ Q;  4IUT A;  4EIK A;  1RAB B;  5LJ5 g;  1MND A;  2DIG A;  1QP3 A;  2K2V A;  2LCL A;  2MYS A;  1UUE A;  5FRN A;  5I2M A;  3PIP A;  1K8A C;  1AWO A;  1VQ7 A;  1AWX A;  1W2B A;  1FMW A;  4FYX B;  1D0Z A;  5GAM d;  1VQ9 Q;  4LDV A;  2OTJ A;  1TU0 B;  3OYF A;  2LT4 A;  2DA9 A;  4ANJ A;  3CXC S;  1PCX A;  2I0N A;  1KD1 R;  2DZC A;  4M7A B;  3MP6 A;  1SF9 A;  4HCC A;  2F5T X;  3H0I A;  1VQ4 T;  4MMK A;  2KBT A;  1UEB A;  3PVQ A;  1LCK A;  2DBK A;  3OYB A;  3L2Q A;  1QVG A;  1HSQ A;  3RES A;  1M1K C;  5GAM g;  1VQO Q;  3GNG A;  1QCN A;  4FYW B;  2DL4 A;  4RTY A;  2J7I A;  2LCS A;  2DVE A;  3CCE T;  1RL2 A;  3EGX B;  2NUZ A;  2KMT A;  1KC8 C;  1WXU A;  4C8Q G;  5FU6 C;  3CCQ A;  5CO7 A;  1PG5 B;  5DLQ E;  2HSE B;  1MV3 A;  3V7S A;  4M78 G;  4LN2 A;  2JNG A;  1TWB A;  1KQS A;  1VQM T;  2VGM A;  1HD3 A;  1QWF A;  1YIT Q;  4Y28 E;  2RQU A;  1GCQ C;  1VQ9 A;  4JZ4 A;  3CPW S;  4BI3 A;  4PLL A;  5FU6 B;  1M27 C;  2YUQ A;  1AT1 B;  1VQ8 Q;  3ZEH A;  2K3B A;  3NGP A;  1K4U S;  2AT1 B;  4DA4 A;  2YXY A;  4MZP A;  5GAN 4;  1UDL A;  4OP0 A;  2JT4 A;  4EMH A;  3VJP A;  4PJO D;  3OYG A;  2GTJ A;  1JJ2 P;  1K73 U;  1VQO A;  2EYZ A;  4HT9 A;  4HA8 A;  1LVK A;  1NYF A;  1YJN T;  3AT1 B;  2QAS A;  4FYV B;  2PVG B;  1K8A R;  4J9G A;  3CCJ T;  5ECA A;  4A54 A;  1UHF A;  2CP7 A;  4C0D C;  1RAF B;  2RQW A;  2LJ0 A;  4JUV A;  3EG2 A;  4E7J A;  2KI7 A;  3MCA B;  2LDM A;  3NHN A;  2MAM A;  2RHZ A;  3VRZ A;  2HQX A;  1UB4 A;  1EX4 A;  3SWN A;  1WJS A;  5LJ5 h;  2AHJ B;  2F2X A;  1XQH A;  3X24 B;  1YIT A;  2OTL Q;  2CGH A;  4NL3 A;  1WPY A;  1WDX A;  2PVD B;  1UHC A;  3EG3 A;  4RUG A;  3QDR B;  4L59 A;  4C0D B;  2L89 A;  3ASK A;  1VQ8 A;  1AWJ A;  3RKX A;  4XU2 A;  1M1K R;  5KYU B;  1N9S A;  1W70 A;  3PIO A;  3OYC A;  4KT0 E;  4JS4 A;  4QVC A;  4OMO A;  1KC8 R;  5M9O A;  3LWH A;  4M7A E;  4LUE A;  2DL3 A;  4D6W A;  1YJW Q;  3QJ6 A;  4A53 A;  2BUD A;  3RR6 A;  3HRT A;  5GAO n;  1G3Y A;  4O6J A;  3AHU A;  2EGC A;  4DEX A;  5KYY B;  5GAM h;  1M1G A;  1Y96 A;  1ZHI A;  1QVF P;  3QSU A;  1XTD A;  5J3B A;  1QKW A;  1M3C A;  2WSC E;  4M7D C;  4ZGD B;  1CKA A;  2RNA A;  3RNJ A;  4ATO A;  3CCS Q;  2QQ9 A;  3EGD A;  1JEG A;  1G3W A;  2OTL A;  3CCV T;  3HP9 A;  1O75 A;  1RAH B;  2EKO A;  3RMQ A;  1D1B A;  2ZPI B;  2L3P A;  2GCX A;  4V2S A;  3EGU A;  1R0B G;  4M7D B;  4X1V A;  2A36 A;  5GAN 3;  4NS5 A;  2FB7 A;  4BE2 A;  4J7F A;  1G8X A;  3JCM J;  3DLM A;  5J26 A;  2QXF A;  4DQ2 A;  2VB6 A;  2ED1 A;  1YJW A;  3VV0 A;  1PD1 A;  2K3Y A;  4MDW A;  2QG9 B;  2M0O A;  4DBF A;  3EFO A;  3ULR B;  3V8K A;  4M7A G;  2D0Q B;  2F2V A;  1JBM A;  2IPO B;  2LC4 A;  2RA2 A;  2RHI A;  4E7S A;  3CCS A;  2DXU A;  4PJO A;  2EQK A;  3L2Z A;  4C0G A;  1Q86 C;  2X4J A;  2RHX A;  2L3R A;  1S1N A;  3VRY A;  4ZTF A;  4N4G A;  5GAO q;  1MUZ A;  4PL6 A;  2WSE E;  1Y7X A;  2FL7 A;  3QZ9 B;  2YHT A;  1VYT A;  1G3S A;  4F14 A;  1TUD A;  4C5G A;  1QKX A;  2FRW A;  1MMN A;  2LJ1 A;  4PKC C;  1YCS B;  1M1K U;  1ZA1 B;  2DX1 A;  4RTX A;  2EQM A;  3JSC A;  3LH5 A;  3V8L A;  3FRN A;  1Y71 A;  1OPK A;  4J6X A;  3DB3 A;  2KYB A;  3JB9 I;  2RF0 A;  2VV5 A;  2V1R A;  3A8G B;  4Z02 A;  2GBQ A;  2E12 A;  3CMA Q;  7AT1 B;  2O9V A;  2RMO A;  3L42 A;  2E5K A;  3OYI A;  3EAE A;  1PKS A;  4JJD A;  2WAC A;  3ZBD A;  4MDX A;  2VC8 A;  2B8A A;  3M9Q A;  4E7L A;  4QVZ A;  2RH2 A;  1VQ7 T;  1BB9 A;  3LGL A;  3DLL A;  4M75 E;  3EHQ A;  2VXF A;  2M1H A;  4M77 C;  2XK0 A;  3MEU A;  2NLU A;  4M7D F;  2DXT A;  4C5I A;  3SWN B;  2GFA A;  1W4S A;  4KRT A;  2OX7 A;  2LNV A;  2K5L A;  4PJN A;  2CSI A;  2EYQ A;  4BY6 B;  1WJQ A;  2ATC B;  4GLK A;  4WCI A;  2LJ3 A;  2QQA A;  4M77 B;  4C92 B;  1AZG B;  3OW2 S;  4E7I A;  1ZSZ C;  2LQW A;  2AZS A;  3CMA A;  3NPF A;  1Q86 R;  3EG9 B;  4PNO A;  1B7T A;  3JB9 F;  1TTH B;  3CCQ T;  2FG0 A;  2DTI A;  1G3T A;  3QDF A;  5L23 A;  1ZSZ B;  2EBP A;  2M16 A;  2NUP B;  4DBQ A;  3MET A;  4DBR A;  2MWO A;  4J9C A;  5CIU A;  3OBY A;  3L2U A;  5GAN 5;  4E47 A;  3BFM A;  1WI7 A;  4CC2 A;  2LVM A;  3BDU A;  4ZGE B;  2OI3 A;  2V1Q A;  4BE1 A;  1YP5 A;  2HBW A;  3M4Y A;  2O4X B;  4M75 G;  1WGS A;  2PUO B;  4C8Q C;  3CC7 Q;  1RAD B;  2NWM A;  4KGZ B;  4HCB A;  1AWW A;  3OSS C;  3QYH B;  3X20 B;  4FU6 A;  1OOT A;  4M78 C;  2PZ1 A;  2RI2 A;  1QCO A;  3ZL7 C;  1JQQ A;  4QQ6 A;  3GP8 A;  1X6G A;  2LTO A;  2RPN A;  1PNJ A;  2GGR A;  2KYM A;  2RK1 A;  2E1H A;  4OMN A;  4GBQ A;  2VYT A;  4IKF A;  1WX6 A;  4BE0 A;  4IUP A;  4M78 B;  2NUT B;  6AT1 B;  3A8L B;  4HCK A;  1X2Q A;  3M53 A;  3JV3 A;  1XNI A;  1YIT T;  1X43 A;  3LLR A;  1OQK A;  4ZN3 A;  1OX8 A;  2FPF A;  4ZNX A;  3H41 A;  2E3I A;  1VQ8 T;  2H8H A;  3QG1 A;  3MEW A;  2CS7 A;  2HD0 A;  2YSQ A;  3UF4 A;  3QBY A;  2R5A A;  1VA7 A;  3E19 A;  4XU3 A;  1AVZ C;  2CSQ A;  1U06 A;  3CC7 A;  4M77 F;  5KCH A;  2CZ0 B;  2VXE A;  3UAT A;  1N6A A;  2MK5 A;  3NTI A;  2DTH A;  4C92 E;  2YLC A;  3OSV A;  3O5Z A;  1Q86 U;  1WQW A;  1BI2 A;  3VS0 A;  2ZPH B;  3GLX A;  2R57 A;  4FW2 A;  3OS5 A;  2ZAE A;  1FX7 A;  3FDR A;  2A37 A;  2HL5 C;  2XID A;  1OV3 A;  2M0Y A;  2YT6 A;  1U1T A;  2DRM A;  9ATC B;  3EG1 A;  1GCQ A;  3OA6 A;  2COY A;  2OTL T;  4B9X A;  3CCR Q;  4OGE A;  2J6O A;  5J39 A;  2A3L A;  5FRM A;  3E2U A;  2V26 A;  4KGX B;  4EMK C;  1HYO A;  5L8R E;  2CH4 W;  2VWF A;  2JMC A;  3BW1 A;  2HMA A;  3MHX A;  5LL6 S;  2AKK A;  2QGF B;  2E4H A;  3EH1 A;  1C0M A;  1YJW T;  5GAN j;  1UJ0 A;  2DD5 A;  2FO0 A;  2BTT A;  5CKD A;  1QWE A;  2C0T A;  4F7U A;  2IVW A;  1X01 A;  2OTJ Q;  2EIF A;  2RJC A;  4C8Q F;  8AT1 B;  3G71 T;  1TH7 A;  3SDZ A;  4OMQ A;  1KFZ A;  4M78 F;  4D8K A;  1JO8 A;  4M77 G;  1UGQ B;  2I2L A;  3OQ5 A;  4C92 G;  2QDY B;  1JU5 C;  3CCS T;  3GBQ A;  3PE0 A;  1MMG A;  1Q81 C;  2KAF A;  2K2M A;  4E6R A;  2BE9 B;  3CCR A;  5GMK h;  2RHY A;  2J6F A;  2YRC A;  4Y92 A;  1WHK A;  4ELZ C;  5GAO p;  1IXD A;  1M9S A;  1XJW B;  1W2B S;  1QVF A;  2EQU A;  3UWN A;  4LNP A;  3OS2 A;  3CBP A;  3M0P A;  4PJO E;  3OYY A;  3I5R A;  2F69 A;  2QYZ A;  1VQ5 Q;  4M7A C;  3CCM Q;  1EFN A;  1T0J A;  2KRN A;  3VS7 A;  3TVT A;  5CVI A;  4FSS A;  1M2V A;  3V7C A;  2B86 A;  1Y0M A;  2DMO A;  2DVJ A;  3E1S A;  3I56 T;  3NTK A;  5LJ3 d;  1UG1 A;  1TUG B;  1R8O B;  1D3B A;  3UPU A;  1QVG S;  4FL6 A;  1V76 A;  5GAN 6;  4HVW A;  1UGP B;  4OB2 B;  2DL8 A;  1W1F A;  4QQD A;  1ZUY A;  1X69 A;  2O31 A;  4AG1 C;  1E6H A;  1HJD A;  3TEE A;  1ARK A;  2H3J A;  1NLP C;  3PTA A;  1SG5 A;  3JCM W;  3RKW A;  1ZBJ A;  4LXC A;  3M58 A;  2RJD A;  2KEA A;  5LJ3 g;  4II1 A;  3LGF A;  1M1F A;  3WVD B;  2DKG A;  1UJY A;  1KQS S;  4A4F A;  1SHG A;  1YJ9 Q;  2PUK B;  3OYE A;  2FVU A;  2RJE A;  3T9N A;  3OYJ A;  5IXB A;  3CCL Q;  2VGN A;  3CXC A;  2DJQ A;  5GAN f;  3CD6 T;  5FWC A;  4KH1 B;  2RK2 A;  1VQ5 A;  1YI2 Q;  3CCM A;  1LOJ A;  2P0Q A;  3Q1J A;  1ZQ1 A;  1Y07 A;  2FEI A;  1K0X A;  5GAO l;  1U8R A;  1SHF A;  2ESW A;  2HKN A;  4FW1 A;  3CMA T;  1W6X A;  1Q81 R;  2V8I A;  3PGG A;  3I55 Q;  3QJY A;  3JCM e;  2C0I A;  1BIA A;  1WHL A;  2KRS A;  5KH6 A;  3CC2 Q;  3EG0 A;  4XQ3 A;  3GOX A;  5D6X A;  4JDS A;  2RQT A;  2P4R A;  3VS4 A;  4PJJ A;  4JJB A;  5C0M A;  3JCM h;  1I5L A;  2BZX A;  3M56 A;  3E9F A;  3H6Z A;  3CPW A;  5LJ5 e;  3LH0 A;  4XK8 E;  1WXB A;  2HQE A;  4FM4 B;  1GRI A;  3A8O B;  1YJ9 A;  3FJP A;  2R58 A;  2QI2 A;  4KUI A;  1YBY A;  3CCL A;  4PK4 A;  1SRM A;  3JCM V;  1B07 A;  4BI4 A;  1Q95 G;  1YI2 A;  1R77 A;  1JB0 E;  1GCP A;  1K1Z A;  2CT4 A;  1VQP T;  2YRV A;  2HNI A;  4BAC A;  1X6O A;  1TG0 A;  2K5F A;  4JJN K;  2COW A;  4LE9 A;  2L0A A;  3I55 A;  1M8V A;  3M0T A;  4M7A F;  1CKB A;  1MHN A;  4R0K A;  3F70 A;  1QQJ A;  3CC2 A;  5CKB A;  5GAM e;  1BI0 A;  3HHT B;  1YN8 A;  4F7U B;  2CZ1 B;  3KBG A;  3E9G A;  2E6N A;  3EH2 A;  2R5M A;  1BK2 A;  4DOV A;  4M75 C;  2DET A;  2DM1 A;  1OUL A;  2XDP A;  1H92 A;  3VU3 C;  3M4G A;  2LNH B;  5KYX B;  1RI9 A;  2ZPB B;  5GAN d;  1GBR A;  1J3T A;  5LJ3 h;  1VOM A;  5GJW B;  2DPP B;  1EZZ B;  3LX7 A;  4DOW A;  5GMK i;  2EGE A;  2DIL A;  3FJ5 A;  1U5S A;  1SEM A;  2A08 A;  5AT1 B;  4M75 B;  3CC7 T;  4A4E A;  2RB6 A;  2XHC A;  2DXB A;  4QW2 A;  4CC7 A;  1YCY A;  2OAU A;  3H9N A;  2GQI A;  2ZPE B;  2E6Z A;  2YUP A;  3WXM B;  1Q81 U;  2DRK A;  1NG2 A;  1E7O A;  4J9E A;  3N5B B;  2XDD A;  1RAG B;  4PLI A;  1XOV A;  1GFC A;  2M9U A;  4E7K A;  8ATC B;  4JLI A;  2BKD N;  2PQW A;  3TSZ A;  2AKL A;  3SFM A;  4RTV A;  4OVA A;  3TRE A;  3VUB A;  1DJ7 B;  5KYW A;  3MEV A;  2JUF A;  3G4S Q;  2F1L A;  2XDB A;  5GAO m;  3HRS A;  3CCU A;  1WQ7 A;  2RO0 A;  3CXC P;  2MMP A;  1PSF A;  4C8Q A;  3RKY A;  1TSF A;  3QII A;  4A4K A;  3QKJ A;  1X6B A;  3I5S A;  3C94 A;  3VS1 A;  3X25 B;  2RJF A;  4P5N A;  2D8H A;  1I81 A;  2JM9 A;  5GAN 8;  3H8Z A;  1VQ4 Q;  1OYX A;  4E7H A;  3PMI A;  1QVP A;  1KJW A;  2DL7 A;  3JRZ A;  1Q82 U;  1TOV A;  1P92 A;  2E10 A;  3C0C A;  1VQL Q;  1PHT A;  5A0L A;  3CCE Q;  2J05 A;  1G5V A;  2E3H A;  3G4S A;  4OB3 B;  2DE0 X;  4F7U E;  3CPW P;  3OYN A;  3HKS A;  2EJG A;  1WFW A;  3RER A;  1BI1 A;  1I8F A;  1NEB A;  5CAI A;  1TS9 A;  1VQM Q;  1LPL A;  3SWN C;  4EPC A;  1ZX6 A;  4M75 F;  1KQ2 A;  2LQN A;  2E70 A;  4BY6 C;  3A5Z B;  4J83 A;  3PVL A;  1YWP A;  2LCC A;  4FIB A;  4C92 C;  1PD0 A;  1YIJ Q;  3RDV A;  1SRL A;  2QK0 A;  2OTJ T;  1VQ4 A;  5FRO A;  3DB4 A;  4HT8 A;  2YWW A;  1VQ6 Q;  2E5Q A;  2ZPF B;  4FT4 A;  1N27 A;  5FW9 A;  3HTR A;  2MPX C;  4JS5 A;  3CME Q;  1VQL A;  1CSK A;  2QQB A;  1RAA B;  1ZBX A;  4R56 A;  3CCE A;  4RG2 A;  1Z9Z A;  5LJ5 j;  1OU8 A;  1AEY A;  1SSH A;  2LX9 A;  3J81 E;  2VAS A;  2L3Q A;  1OZ2 A;  1VIE A;  4EMK A;  1F1B B;  2QTV A;  5IHK A;  1IRE B;  4LUD A;  1C6V X;  1SPK A;  4OMF B;  4CI0 C;  4RMO A;  2ABL A;  1VQM A;  1K76 A;  3QWY A;  3FIF A;  1JXM A;  3M5A A;  2O2O A;  1M5Q 1;  4DBH A;  4F7U G;  2CH4 A;  4NL2 A;  2F5K A;  1VQ5 T;  1AOJ A;  2JS0 A;  2M02 A;  1Y96 B;  1MNE A;  3X26 B;  1WHM A;  3OW2 A;  1VQ9 T;  1KQ1 A;  1V29 B;  1KHI A;  2KRM A;  1YIJ A;  3LYI A;  2KY9 A;  5GAM j;  3EGD B;  5CQX A;  5I11 A;  2DER A;  1VQ6 A;  2CUB A;  4J9H A;  3CME A;  2D8J A;  2GNC A;  3SB2 A;  3L2W A;  1VQO T;  2PTK A;  2HDA A;  2K79 A;  4AT1 B;  2QA4 Q;  1UE9 A;  3THK A;  3PNW C;  3M0U A;  2FRY A;  1HXD A;  2A28 A;  3JCM Q;  1NYG A;  1Z9Q A;  3A8H B;  3KFV A;  3REB B;  3VKI A;  1YJ9 T;  2LRQ A;  2ECZ A;  2OAW A;  5CKE A;  2RI5 A;  2CZ7 B;  3CCL T;  3CCV Q;  2IG0 A;  1NM7 A;  1OZ3 A;  2HZY A;  1YI2 T;  4N0A C;  1X27 A;  3EFO B;  2JZ2 A;  1EIF A;  2ROT A;  3HSB A;  4ELY C;  3OYH A;  2KK4 A;  3QPH A;  2LP5 A;  2K4Y A;  2CP2 A;  3EGX A;  4PJO B;  4F17 A;  4M7D D;  2F2W A;  3CC2 T;  3U23 A;  3A98 A;  2EWN A;  3UDC A;  4C92 F;  2DEQ A;  1A0N B;  1N8R R;  5KE3 A;  4XAX B;  2JM8 A;  1JXO A;  3L2V A;  2QA4 A;  2CP5 A;  3OYK A;  3GPL A;  4OF1 A;  2KGT A;  1H64 1;  2DAQ A;  2DXC A;  3KXT A;  1UGV A;  3M0S A;  3PMT A;  5A0D A;  1JJ2 S;  3MO8 A;  3URG A;  3JB9 D;  3CCV A;  2RD1 A;  4IIM A;  4RKU E;  3CQT A;  2W0Z A;  2EAY A;  5GAM f;  2L5Q A;  4C5E A;  1NEG A;  3G1J A;  1VYU A;  2P4T A;  2EYY A;  4N4H A;  4X9D A;  4EMG A;  5GAN 2;  2Z0W A;  5EC7 A;  1D1C A;  2BZ8 A;  3CC4 Q;  4XTX A;  3MP1 A;  3SHW A;  2EJ9 A;  2X51 A;  1M90 C;  3CBM A;  1FMK A;  1RAE B;  2KVQ G;  1AZE A;  1OU9 A;  2LX7 A;  2EJF A;  4QKU A;  2X9H A;  1GL5 A;  3MEA A;  1M4Z A;  4YTL A;  5AYF A;  3OS1 A;  2VKN A;  4NOY A;  2CT3 A;  5GMK e;  3INZ A;  4O5V A;  5KYU A;  2ZZD A;  1VQK Q;  3V7R A;  4MZT A;  2LQK A;  5EG2 A;  4B6M A;  1Q7Y U;  3O8V A;  5HK0 A;  3RIR A;  4QVD A;  2QTX A;  1B34 A;  2FYK A;  4KUL A;  4RTW A;  3OW2 P;  1QVF S;  3QXE B;  1ZLM A;  1YNZ A;  2KR3 A;  1D09 B;  5IN1 A;  5KYY A;  2PVO B;  1TUC A;  4Q5W A;  1NPR A;  4HVV A;  1WA7 A;  2HBP A;  1K0S A;  4PFO A;  4C8Q E;  4C5H A;  4CC4 B;  3CC4 A;  2DYI A;  1G2B A;  4UC4 A;  4PFP A;  2CKK A;  2RQR A;  4J7I A;  1N8R U;  3M59 A;  3I9Q A;  1VIF A;  4M77 D;  2QQR A;  2KQW A;  2KT8 A;  2O01 E;  2DD4 A;  2O88 A;  3HFO A;  1UFF A;  3M55 A;  2PU9 B;  1UEC A;  5FLX E;  1UGR B;  4J9F A;  4M7D A;  2BE7 D;  2JOY A;  2KRO A;  2KE9 A;  4N4I A;  1VQK A;  3QZ5 B; 
#chains in the Genus database with same CATH homology
 3G7Z A;  3TCJ A;  2RH2 A;  2ZPB B;  1I4K 1;  3L2R A;  1VQ7 T;  4FSX A;  3LGL A;  5GAN d;  1K73 C;  3DLL A;  1VUB A;  5LJ3 h;  5HY6 A;  3P8B B;  4M75 E;  3JAM E;  2VXF A;  2M1H A;  2DPP B;  4J6Y A;  2XK0 A;  3MEU A;  4M77 C;  2NLU A;  1GXI E;  3LX7 A;  4M7D F;  3HFN A;  4X34 A;  4DOW A;  5GMK i;  2K5I A;  2DXT A;  4C5I A;  2JVV A;  3SWN B;  2D9T A;  1Q82 C;  3OY9 A;  1IZ6 A;  2GFA A;  4M75 B;  1RI0 A;  2Y90 A;  4QVZ A;  4A4E A;  1W4S A;  2RB6 A;  2XHC A;  2DXB A;  4QW2 A;  3S3O A;  5CQY A;  3FC3 A;  1YCY A;  2LNV A;  1MGQ A;  2OAU A;  2K5L A;  4Y91 A;  4M77 E;  2EYQ A;  5HK3 A;  4OB0 B;  4LD6 A;  4BY6 B;  4OB1 B;  1WJQ A;  2ZPE B;  2EFI A;  4GLK A;  2E6Z A;  5I21 A;  3WXM B;  3C4S A;  3C12 A;  3OB9 A;  4ZN1 A;  5DLO A;  1Q81 U;  4VUB A;  3RMS A;  2XDD A;  3N5B B;  2QQA A;  4M77 B;  4PLI A;  5LJ3 f;  4C92 B;  1XOV A;  1VQL T;  3C95 A;  3OW2 S;  4E7I A;  3OYL A;  4LDU A;  2M9U A;  3S3M A;  2JTF A;  3CMA A;  1LJO A;  4E7K A;  4JLI A;  2BKD N;  2QQS A;  2PQW A;  4PJO A;  3M54 A;  3SFM A;  5CCA A;  3JCM P;  4PNO A;  1KG1 A;  4OVA A;  4PJO G;  4EDU A;  1S72 T;  1NZ9 A;  3JB9 F;  3TRE A;  3VUB A;  1JJ2 A;  3GF5 A;  2LQ8 A;  2K57 A;  1DJ7 B;  3CCQ T;  2DTI A;  1G3T A;  1KD1 C;  4BDZ A;  3UT1 A;  3MEV A;  3FEO A;  2JUF A;  3QO3 A;  3FLG A;  2BIV A;  4J6W A;  3TU4 K;  3OBW A;  4C8Q D;  2XDB A;  5GAO m;  2RI3 A;  3HRS A;  3CCU A;  3JB9 H;  4J8O A;  4M78 D;  5KCO A;  2X4Y A;  2M16 A;  3BY7 A;  1WQ7 A;  3MET A;  2RO0 A;  2MMP A;  1PSF A;  3CCU T;  2V8J A;  2MWO A;  4C8Q A;  3RKY A;  4RG8 A;  1JRI A;  3QII A;  5DM7 R;  3EFR A;  1N9R A;  5CIU A;  3JCM d;  1VQN T;  3EFS A;  4A4K A;  3OBY A;  3L2U A;  5GAN 5;  1YIJ T;  1H3Z A;  1NJI C;  3M57 A;  3PT9 A;  3QKJ A;  4E47 A;  3BFM A;  4HKE A;  4EMK B;  3NTH A;  3X28 B;  2LVM A;  3BDU A;  4ZGE B;  2MI6 A;  4BE1 A;  2KSS A;  2O4X B;  3M4Y A;  1WGS A;  2MF2 A;  4IUU A;  4M75 G;  1VQ6 T;  4BDY A;  3HRU A;  2PUO B;  3C94 A;  4RCC A;  4C8Q C;  3X25 B;  2RJF A;  4P5N A;  4LD9 K;  1I81 A;  5GMK m;  4LDX A;  4HCB A;  5GAN 8;  3H8Z A;  3OSS C;  3QYH B;  3X20 B;  3CME T;  4FU6 A;  4PJO F;  1OYX A;  4M78 C;  2XD0 A;  2RI2 A;  5LJ5 d;  4XTW A;  2X35 A;  4E7H A;  4XU1 A;  1U1S A;  3PMI A;  2DK3 A;  4B9W A;  1QVP A;  3JRZ A;  3QHS A;  4JLG A;  4OGC A;  4QQ6 A;  3JCM g;  5KE2 A;  3GP8 A;  1Q82 U;  1P92 A;  2E10 A;  2LTO A;  2YLB A;  3ER0 A;  1LNX A;  1OI1 A;  1YHQ T;  5A0L A;  4ZTJ A;  5GAN 7;  4M78 E;  4X9C A;  2C06 A;  2RK1 A;  2E1H A;  1G5V A;  3G4S A;  4M75 A;  2VYT A;  2CYZ B;  4OB3 B;  1YHQ A;  4F7U E;  4IKF A;  3GIB A;  4BE0 A;  5I2S A;  4C92 D;  4IUP A;  4R55 A;  2DJZ A;  4M78 B;  3OYN A;  3OYA A;  3G4S T;  4JRQ A;  4IUT A;  3HKS A;  2EJG A;  2X4W A;  3A8L B;  5CKF A;  2QEX A;  3M53 A;  5LJ5 g;  3RER A;  4IUQ A;  1BI1 A;  1I8F A;  2DIG A;  1XNI A;  1QP3 A;  2K2V A;  3LLR A;  5LJ3 e;  3S3N A;  4ZN3 A;  3HPW A;  1YIT T;  2LCL A;  3G6E A;  5CAI A;  5FRN A;  4M77 A;  3SWN C;  5I2M A;  4C92 A;  3PIP A;  1K8A C;  2XKO C;  4EPC A;  1VQ7 A;  4M75 F;  1KQ2 A;  1VQ8 T;  1M90 U;  1W2B A;  2E70 A;  1KD1 U;  3QG1 A;  4BY6 C;  3MEW A;  2CS7 A;  2HD0 A;  3A5Z B;  5GAM d;  4LDV A;  4J83 A;  3OYD A;  2LCC A;  3QBY A;  4RCB A;  2R5A A;  1B34 B;  3E19 A;  4FIB A;  4XU3 A;  4C92 C;  2OTJ A;  3CC7 A;  3OYF A;  2E41 A;  2XG8 D;  4M77 F;  1K9M C;  2LT4 A;  5KCH A;  1KHC A;  4TVR A;  3L1A A;  2G3R A;  2CZ0 B;  1HK9 A;  3MP8 A;  3CXC S;  1VQ4 A;  2OTJ T;  3BDL A;  2DZC A;  4M7A B;  2VXE A;  3MP6 A;  5FRO A;  3DB4 A;  2F5T X;  4HCC A;  1N6A A;  4HT8 A;  4BD3 A;  3NTI A;  2E5Q A;  2K3X A;  2ZPF B;  2DTH A;  1VQ4 T;  4FT4 A;  2YLC A;  4MMK A;  1N27 A;  1UEB A;  3OSV A;  4C92 E;  1Q86 U;  3VYG A;  2X4X A;  3OYB A;  5GMK j;  1WQW A;  3L2Q A;  4JS5 A;  1QVG A;  1UGS B;  1VQL A;  1BI2 A;  3KUF A;  2QQB A;  3RES A;  2QA4 T;  1M1K C;  2ZPH B;  3GLX A;  5GAM g;  2R57 A;  3GNG A;  1ZBX A;  4IUV A;  5IAY A;  5GAN g;  4R56 A;  4RG2 A;  5LJ5 j;  3OYM A;  3CCE A;  3OS5 A;  1FX7 A;  2DVE A;  3FDR A;  4LDY A;  3CCE T;  1RL2 A;  2LX9 A;  3J81 E;  3WVE B;  2KMT A;  2XID A;  3QYG B;  1OZ2 A;  1VIE A;  4EMK A;  1S72 A;  1KC8 C;  4C8Q G;  1U1T A;  2GFU A;  5FU6 C;  3CCQ A;  3QUI A;  2HAX A;  2O4X A;  5CO7 A;  1IRE B;  3OA6 A;  4HCZ A;  5DLQ E;  2OTL T;  3V7S A;  4B9X A;  4M78 G;  2EQJ A;  4MML A;  2JNG A;  1AHJ B;  4OMF B;  4OGE A;  4CI0 C;  4RMO A;  1VQM A;  1D3B B;  1KQS A;  5J39 A;  3FIF A;  3M5A A;  2A3L A;  5FRM A;  1M5Q 1;  4A4H A;  4F7U G;  1VQM T;  2VGM A;  3CBO A;  2F5K A;  4NL2 A;  4EMK C;  5IT9 E;  5L8R E;  4Y28 E;  1VQ5 T;  2XU8 A;  1VQ9 A;  3CPW S;  4BI3 A;  3BW1 A;  1Y96 B;  4PLL A;  3MHX A;  5FU6 B;  1VQN A;  3X26 B;  4XU0 A;  5DY9 A;  5LL6 S;  3OW2 A;  4C0F A;  1VQ9 T;  3OS0 A;  1KQ1 A;  1V29 B;  2Y4Y A;  3ZEH A;  1KHI A;  2FHD A;  5A0G A;  5HKC A;  1YIJ A;  5C6S A;  3LYI A;  2KY9 A;  4IUR A;  2L8D A;  3JCM X;  5GAM j;  4DA4 A;  3CEY A;  1YJW T;  5GAN j;  4M78 A;  4MZP A;  5CQX A;  2DD5 A;  1K8A U;  3J7A F;  2A7Y A;  5D6W A;  5GAN 4;  1VQ6 A;  4OP0 A;  5CKD A;  4XTU A;  2E65 A;  3GNF B;  3P8D A;  4EMH A;  3VJP A;  4F7U A;  2IVW A;  3G71 A;  4PJO D;  3OYG A;  1X01 A;  3CME A;  2EIF A;  1K73 U;  1VQO A;  3SB2 A;  2RJC A;  4C8Q F;  3G71 T;  2KDS A;  3L2W A;  4HA8 A;  4HT9 A;  2XIC A;  1YJN T;  1TH7 A;  3SDZ A;  1VQO T;  2PVG B;  4M78 F;  2DIQ A;  4XTV A;  3CCJ T;  4M77 G;  4A54 A;  1UGQ B;  2I2L A;  3OQ5 A;  4C92 G;  2QDY B;  3PNW C;  4XTY A;  3CCS T;  1FXX A;  3VUZ A;  1HXD A;  1Q81 C;  4M7A D;  3JCM Q;  2KAF A;  4N0A A;  4C0D C;  2E64 A;  4F7U F;  3A8H B;  4JUV A;  4E7J A;  3MCA B;  2LDM A;  3VKI A;  3CCR A;  1YJ9 T;  2MAM A;  5GMK h;  2RHZ A;  1X75 C;  2HQX A;  2LRQ A;  2ZPG B;  2RHY A;  5CKE A;  1UB4 A;  5D6Y A;  3SWN A;  4JRK A;  1WJS A;  2RI5 A;  2CZ7 B;  3CCL T;  3CCR T;  5LJ5 h;  2IG0 A;  2AHJ B;  4ELZ C;  1XQH A;  3X24 B;  5GAO p;  3JCM b;  1YIT A;  1OZ3 A;  2CGH A;  1M9S A;  1WPY A;  4NL3 A;  1YI2 T;  4FT2 A;  4N0A C;  2PVD B;  2WSF E;  1W2B S;  1QVF A;  2EQU A;  3UWN A;  1KC8 U;  2JZ2 A;  1EIF A;  1PSE A;  3CBP A;  3LW5 E;  3QDR B;  3OS2 A;  3HSB A;  2GQV A;  4L59 A;  4CRI A;  4C0D B;  2L89 A;  4ELY C;  4PJO E;  1BI3 A;  3ASK A;  3OYY A;  1VQ8 A;  1SSF A;  2F69 A;  3OMC A;  2KK4 A;  3QPH A;  3OYH A;  4GY5 A;  2K4Y A;  3CC4 T;  3RKX A;  4XU2 A;  4M7A C;  2XI9 A;  5CVI A;  1N9S A;  4PJO B;  3I56 A;  3V7C A;  2JN0 A;  4JRP A;  1QW1 A;  4M7D D;  3PIO A;  3OYC A;  4KT0 E;  4JS4 A;  4QVC A;  1WJR A;  2RM4 A;  3V8J A;  1QP2 A;  5GAN e;  3E1S A;  3I56 T;  1O9S A;  3NTK A;  5LJ3 d;  5M9O A;  3LWH A;  3CC2 T;  4M7A E;  4C0Z A;  4D6W A;  3QJ6 A;  2EWN A;  3UDC A;  1R8O B;  1D3B A;  3RUX A;  2DEQ A;  4A53 A;  4BB7 A;  4C92 F;  3UPU A;  1QVG S;  4FL6 A;  5KE3 A;  1Q7Y C;  2BUD A;  4XAX B;  3HRT A;  5GAN 6;  2VUB A;  5GAO n;  1UGP B;  4OB2 B;  1G3Y A;  4BUG A;  4O6J A;  3AHU A;  4QQD A;  3L2V A;  2QA4 A;  3OYK A;  5GAM h;  1M1G A;  1VQK T;  3GPL A;  4OF1 A;  5GAN h;  1Y96 A;  1NJI U;  1H64 1;  1ZHI A;  2DAQ A;  3TEE A;  2DXC A;  2H3J A;  5CK9 A;  3QSU A;  1XTD A;  4L5G A;  3KXT A;  3PTA A;  5J3B A;  4LDW A;  2GF7 A;  2WSC E;  3JCM W;  3RKW A;  5FU7 C;  4M7D C;  4ZGD B;  4ME7 A;  3PMT A;  5A0D A;  3M58 A;  2RJD A;  5LJ3 g;  5A2Q E;  4ATO A;  1JJ2 S;  4II1 A;  3MO8 A;  2LT1 A;  3URG A;  2QQ9 A;  3JB9 D;  3CCV A;  3LGF A;  5GAO r;  1M1F A;  2RD1 A;  1NE8 A;  3WVD B;  2DKG A;  1KQS S;  1G3W A;  4A4F A;  2OTL A;  3CCV T;  2PUK B;  3HP9 A;  3OYE A;  2FVU A;  2RJE A;  1O75 A;  4RKU E;  3T9N A;  4A4G A;  3CD6 A;  4M7D E;  2V8K A;  1N8R C;  2EKO A;  3RMQ A;  3OYJ A;  2EAY A;  5GAM f;  2L5Q A;  4L6V 5;  2VGN A;  2ZPI B;  4C5E A;  5GAN f;  3CXC A;  3CD6 T;  2GCX A;  2RK2 A;  4V2S A;  2P4T A;  1VQ5 A;  5FU7 B;  4M7D B;  4N4H A;  3CCM A;  4X9D A;  1LOJ A;  2P0Q A;  5GAN 3;  3SD4 A;  3Q1J A;  2D6F A;  1ZQ1 A;  4EMG A;  3HL8 A;  5GAN 2;  1Y07 A;  4NS5 A;  2FB7 A;  4BE2 A;  4J7F A;  3CCM T;  1NPP A;  3JCM J;  2CZ6 B;  3DLM A;  5GAO l;  3A8M B;  5J26 A;  3J80 E;  2ZGW A;  1U8R A;  3CMA T;  4XTX A;  2QXF A;  3MP1 A;  1WNL A;  2ZCF B;  4DQ2 A;  1YJW A;  2V8I A;  2EJ9 A;  3CC7 T;  3PGG A;  3VV0 A;  1M90 C;  3CBM A;  2JTM A;  3QJY A;  2RHU A;  2K3Y A;  2KVQ G;  3JCM e;  4MDW A;  3S6W A;  2EJF A;  4MZM A;  2Y4X A;  1BIA A;  1BKB A;  5KH6 A;  2M0O A;  5LJ3 j;  2DO3 A;  1BIB A;  3MEA A;  1M4Z A;  4XQ3 A;  4YTL A;  5AYF A;  3V8K A;  3OS1 A;  3GOX A;  3JB9 J;  5D6X A;  2D0Q B;  4M7A G;  4WF2 A;  1JBM A;  4JDS A;  3VYH B;  1YJN A;  2LC4 A;  2RA2 A;  2RHI A;  2DTO A;  4NOY A;  4QQG A;  5GMK e;  3INZ A;  3P8H A;  4O5V A;  2P0P A;  5C0M A;  3LWI A;  3CCJ A;  3JCM h;  2ZZD A;  1I5L A;  3M56 A;  3CCS A;  2DXU A;  3CPF A;  3E9F A;  3V7R A;  5GMK l;  1K9M U;  2P0K A;  2EQK A;  3H6Z A;  3L2Z A;  4KBM B;  5LJ5 e;  3CPW A;  3LH0 A;  4MZT A;  4XK8 E;  4C0G A;  2LQK A;  5EG2 A;  1Q86 C;  1BYM A;  2X4J A;  2RHX A;  1Q7Y U;  2HQE A;  4FM4 B;  2L3R A;  3O8V A;  3A8O B;  3RIR A;  5HK0 A;  4ZTF A;  1YJ9 A;  4N4G A;  4QVD A;  5GAO q;  2QTX A;  1B34 A;  2FYK A;  3FJP A;  4KUL A;  4PL6 A;  2WSE E;  1Y7X A;  2R58 A;  2FL7 A;  3QZ9 B;  2QI2 A;  2YHT A;  4KUI A;  1YBY A;  4ZGJ B;  3CCL A;  4KUD K;  1G3S A;  3JCM V;  4C5G A;  4BI8 B;  5CR2 A;  1QVF S;  3QXE B;  4PKC C;  1M1K U;  4BI4 A;  4PJO C;  1YI2 A;  4M7A A;  4JRI A;  2EQM A;  3JSC A;  5IN1 A;  3V8L A;  1JB0 E;  3FRN A;  3JCM f;  1VQP A;  1Y71 A;  2PVO B;  3JCM c;  1NPR A;  4Q5W A;  2HBP A;  4M7D G;  4J6X A;  2DZ9 A;  4C8Q E;  4M75 D;  4C5H A;  3CC4 A;  1VQP T;  2YRV A;  2HNI A;  3DB3 A;  1X6O A;  4BAC A;  2K5F A;  4JJN K;  3JB9 I;  3ZFJ A;  3NFC A;  2VV5 A;  4UC4 A;  2CKK A;  3I55 A;  1M8V A;  3A8G B;  3R6O A;  4J7I A;  4Z02 A;  1N8R U;  3M59 A;  4C8Q B;  4M7A F;  2E12 A;  3I55 T;  1MHN A;  1VIF A;  3F70 A;  2QQR A;  2KQW A;  4M77 D;  5CKH A;  3CC2 A;  3FB9 A;  3ME9 A;  5CKB A;  3L42 A;  3PFS A;  5GAM e;  2O01 E;  3EAE A;  1BI0 A;  5LJ5 f;  3OYI A;  4J5Y A;  3HHT B;  2DD4 A;  2MWP A;  3HFO A;  1FWZ A;  2WAC A;  3ZBD A;  4MDX A;  4F7U B;  2CZ1 B;  3KBG A;  2VC8 A;  3M55 A;  2PU9 B;  2B8A A;  5FLX E;  3M9Q A;  3E9G A;  1UGR B;  2E6N A;  3OMG A;  2QEX T;  2R5M A;  4M7D A;  4DOV A;  2JOY A;  4M75 C;  2XDP A;  4N4I A;  4XTZ A;  3VU3 C;  3G6E T;  4E7L A;  1VQK A;  3M4G A;  3QZ5 B;  3JB9 G;  3DKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...