4M7DA

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
ATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 14
structure length 65
sequence length 65
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dA00
1KQ1A 3INZA 4PJOF 4N0AC 4XTVA 1YCYA 4C92B 5LJ5d 3PGGA 4PJOE 3M4GA 4XTYA 3FJPA 4C92C 4M7AG 4J6YA 5GAN6 3JCMQ 3EFSA 3JCMd 4Y91A 5LJ3h 4PJOB 3SB2A 4M78E 4M75E 3JCMf 4C8QD 4C92E 5GAMj 4M75F 3BFMA 4M78F 4M77D 5GAN7 3JCMP 3JCMc 2DZCA 4RCCA 4M7AE 4M77B 1JRIA 5GMKl 5GAMg 1U1SA 3HFNA 4WF2A 4F7UF 3GIBA 4DQ2A 3RKXA 4F7UG 5LJ5f 3V7RA 4M7DA 4M75G 4M78G 5GAN2 2QTXA 3QO3A 2DXUA 1KQ2A 2DJZA 5GMKh 3FIFA 4PJOD 4MMKA 1JBMA 4M75A 4M78A 3RIRA 5GAMd 4NOYA 4M7DG 4M77A 2DZ9A 3JB9H 2RA2A 4XTZA 1Y96B 4C8QG 2RB6A 5LJ3e 4EMKB 4X9DA 4XTUA 5GMKj 1TH7A 3JCMX 3RERA 3QUIA 4QVCA 3EFRA 3V8LA 2YHTA 2DVEA 4XQ3A 5GANf 4XU3A 3RKWA 1N9RA 5GANd 4M75D 4M78D 4C92A 1B34B 1D3BB 4M77F 2FB7A 5I21A 3JCMb 2E10A 5GAOm 2K57A 1WPYA 2JN0A 4RCBA 4M7AB 3SWNA 3VU3C 4JUVA 4XU2A 4A53A 4MMLA 4NL2A 3JCMg 4C92D 5GMKe 5GAMh 2HNIA 4M7DD 2EWNA 4X9CA 4M7AC 4M7DE 2RM4A 4J5YA 4M7DF 4JRKA 3V8KA 5GMKm 5GAN8 3FB9A 1WNLA 4EMKA 5GANh 5GAN5 4M77C 1Y96A 2CGHA 5GANj 2ZGWA 2DKGA 3RUXA 4HA8A 5LJ3g 5GANg 3JB9I 5LJ5h 5GAOq 3JCMJ 3AHUA 5GAOl 2VC8A 4C8QF 3JB9F 3JCMW 4XTWA 3SWNC 3JB9J 3BW1A 5GMKi 4J6WA 4PJOC 4V2SA 5LJ5e 3SWNB 4OP0A 4C92G 2VXEA 5GAMe 2I2LA 5GAOr 2E65A 1D3BA 1I8FA 1B34A 4JLIA 2YLBA 2RD1A 4F7UA 4QVDA 1U1TA 4PJOA 3BY7A 5GANe 4C8QA 3JCMe 4XU0A 2DTIA 1BIBA 2EAYA 1HXDA 4N0AA 4C8QB 5GAOp 4EMGA 1I5LA 5LJ3d 1LOJA 4XTXA 2DEQA 3JCMh 2E64A 4C8QC 4M75B 4M78B 3V7CA 4M7AA 2FYKA 4PJOG 5GAMf 5GAOn 4M7DC 4M7DB 5GAN4 4M77G 4C8QE 3RESA 1HK9A 1I4K1 2EJFA 2E41A 3L1AA 1WQ7A 5CAIA 3HFOA 5GAN3 4HT9A 1X01A 4PNOA 1LNXA 4C92F 4JRIA 4A54A 3RKYA 5LJ5g 4M7AF 2DTOA 2Y90A 5LJ3j 3V8JA 4NL3A 2DXTA 4EMHA 4M77E 4J6XA 4M7AD 5LJ5j 1MGQA 1H641 1LJOA 2EJGA 1BIAA 3V7SA 4F7UE 1WQWA 4M78C 4M75C 1I81A 3JCMV 4HT8A 3JB9G 3QSUA 1M5Q1 1M8VA 4EMKC 5LJ3f 4XU1A 4F7UB 2E1HA 5DY9A 1N9SA 3JB9D 2VXFA 2DTHA 3HSBA 2YLCA 2EJ9A 3BDUA 3L2ZA 3QHSA
chains in the Genus database with same CATH superfamily
2A28A 5M9OA 1FMWA 2JW4A 1PD0A 3UA7A 2FG0A 1C1AA 2MAMA 4M7AE 2RQTA 4C0FA 3QO3A 1VQNQ 1IRXA 2EVRA 3M9QA 4C0ZA 4AFUC 4FW2A 1GBRA 1X69A 2FZGB 2RQWA 3CCVA 1G3WA 4F14A 1WHMA 2M02A 2XU8A 3ER0A 1JU5C 1BCOA 1WPYA 1YJWA 4R56A 4XU2A 4FSXA 5GMKe 4L5GA 1SRMA 1WFWA 4FYVB 1K8AR 3I5SA 5CKDA 1SEMA 2QAZA 2D8HA 5GAN5 1KFZA 4HKEA 4TVRA 2EQUA 4DA4A 3CCJA 1N8RC 4C8QF 3CXCS 3JCMW 1MMGA 1WYXA 1UGRB 1HYOA 4C92G 1W4SA 1PRMC 4BI3A 4J7FA 3H0IA 4F7UA 4QVDA 1WIEA 1T0HA 5C0MA 2GQVA 4LXCA 3QYHB 2RO0A 4EMGA 2DEQA 5HK0A 3D7SB 5FW9A 4ZTFA 2RN8A 1VQ4Q 3X26B 3EGXA 2BTTA 4J9BA 3BDLA 3QDFA 1UJ0A 1LCKA 2D9TA 1JB0E 2Y90A 2DXTA 3H8ZA 3JRZA 4M78C 1PKSA 4QVZA 3QJ6A 2CUBA 1NPRA 2RF0A 2E6ZA 2EPDA 4LE9A 3HSBA 2H8HA 2MOXA 1D0XA 2VKNA 3INZA 3EFOA 1QCNA 3A5ZB 2BIVA 4Q5WA 4M7AG 4J6YA 2FO0A 1BI2A 2KGTA 3U23A 3SB2A 4C8QD 1D1CA 4Y28E 2E5QA 3F70A 2E3HA 3HFNA 3L42A 4XK8E 3OBYA 1NJIU 2I0NA 3L2VA 2EYQA 2VUBA 3Q1JA 2V1RA 3H6ZA 1UGPB 2G6FX 2DD5A 4EMKB 4BE2A 5KYYB 3CMAA 1KQSA 4WCIA 1MMAA 3VRZA 2DD4A 2WSEE 3HP9A 3H9NA 2VGNA 4NL2A 4M7DD 4JS4A 3CCRT 1GRIA 1NLOC 4ZGDB 2HSPA 1WNLA 3MCAB 3OSVA 3ZFJA 2ZGWA 1T3SA 4MZPA 1NZ9A 5GAOq 2NUPA 3JB9F 1YFNA 3BW1A 1QVFA 5A0DA 5FWBA 1VYUA 4C5IA 1Y71A 5DLQE 1OZ2A 1W70A 2DRKA 2KVQG 3SEMA 4BE0A 1YN8A 5FRMA 2RI5A 2GFAA 1XQHA 1UECA 2EAYA 2HMAA 2CP2A 3VUBA 3I56Q 2FZKB 3VS2A 3CPWP 4RG2A 4BACA 4E2FB 3CCLQ 1AD5A 3VS5A 2YUNA 4IUUA 3PIOA 4ZTJA 1VQOA 2JXBA 2DTOA 1VQ6A 3ZBDA 3HL8A 2CKKA 3J7AF 1NYFA 2F2VA 4JRPA 2YUOA 4E7HA 1AWXA 3L2ZA 4J9IA 1WLPB 4PJOE 5KYXB 4DBQA 4A4EA 3I9QA 5FWCA 2QASA 2QGGA 1NM7A 4OF1A 2COWA 4C92E 2GNCA 2DZCA 7AT1B 4RTVA 4DQ2A 2KXCA 2P0PA 2QA4Q 3KXTA 3OYBA 4JS5A 2JT4A 3LWHA 2CZ7B 1UE9A 2VV5A 5A0GA 1PD1A 4ANJA 3FEOA 1N27A 1WA7A 3S6WA 3RERA 1UUEA 3A8MB 2EGCA 3P8HA 2ROLA 2DVEA 3OBWA 2XMFA 1WXBA 4M75D 2DAQA 2KI7A 4LDWA 3VU3C 5IXFA 3JCMg 1PRLC 1RACB 2ECZA 1YWPA 4DBHA 4R55A 3CCVT 1FMKA 2RHUA 4KUDK 2X4WA 4JZ3A 2O4XB 4LDUA 2HZYA 1NPPA 2JVVA 1Q81C 3RMSA 1UJYA 2DNUA 3T9NA 2PQWA 2K3XA 2V1QA 2QG9B 2RK1A 1YNZA 3CCRQ 2RD1A 3LGLA 3CCMT 3OYYA 1ZX6A 1NLPC 1NYGA 5KYYA 1UGSB 1QVPA 3OYMA 2GBQA 1SKUB 1RLPC 1WQ7A 2DJQA 1WXUA 4C92F 1O75A 3ZEHA 3VKIA 2LTOA 2EW3A 1TU0B 3M59A 3LX7A 2DYIA 2QEXA 2E1HA 3OYNA 3LYIA 2VB6A 1MMDA 3GPLA 1EFNA 3OB9A 3G7ZA 3CC2A 1Q86U 1BBZA 5GAN6 1BB9A 1AEYA 3LWIA 4KGVB 3TU4K 3JCMc 2DF6A 4J9DA 1U1SA 3QXEB 1R8OB 4GLKA 2LRQA 1D0ZA 3NPFA 4LDYA 1Q7YR 2QEXQ 2ZPEB 1WHGA 3EHRA 1WGSA 1RLQC 3EG9B 2YUQA 2X35A 1K9MC 1K9AA 5CQXA 4DEXA 4XTUA 2LP5A 5CKHA 3UDCA 4QQDA 1Y07A 3EG0A 2KYBA 2ZPBB 3A8HB 4M78D 3EG1A 1M3AA 3G4SA 3I35A 4D8DA 5GAOl 4A53A 3SDZA 4IKFA 4MMLA 4C92D 1JJ2P 2XHCA 2ZZDA 3PIPA 2ROTA 3V8KA 1UB4A 1YI2A 2V26A 1UTIA 3I55A 3FDRA 5LJ3g 1MV0B 2VGMA 5LJ5h 3G6ET 4KULA 1M1GA 4J83A 4J6WA 1GBQA 4MZTA 2NUZA 3R6OA 1LVKA 1QMCA 4CC4B 1A0NB 4JLIA 1U1TA 1ZUYA 1PHTA 4RTUA 2DTIA 1WHKA 1M1KU 5GJWB 3EG9A 1M4ZA 2P4RA 2QQAA 2DL8A 2GGRA 3MPUB 2CSQA 1BKBA 3CEYA 1KHCA 3QIIA 5CAIA 2LQNA 1K8AC 3VUZA 1KC8U 3RKYA 3MEAA 3M55A 2MMPA 1WJQA 4QQGA 1AOJA 1BI3A 4XU1A 3JB9D 2QA4A 4X34A 3PT9A 1JO8A 5CVIA 3WXMB 3FLGA 1HJDA 1MV3A 1AWOA 3HRSA 5GAN7 1YITQ 2XDPA 2CUDA 2KRMA 4KGZB 4AFSC 5GJVB 4AMCA 1KD1R 4PJJA 5LJ5f 2PVDB 2QDYB 1OPLA 2ESWA 2BE9B 3FIFA 1VQKQ 2GF7A 3MHXA 2YXYA 4M77A 2KY9A 2EGEA 1KG1A 2MWPA 2F69A 5GMKj 5D7UA 1I5OB 1OX9A 2VASA 2ZPHB 1R0CB 2DRMA 3EAEA 1BCMA 3CCUT 2DL7A 2E4HA 4M7AB 3CCLA 2RHYA 4BB7A 4RKUE 3N5BB 4CC7A 1PSEA 4M7DE 3CC2T 4M7DF 1R77A 2J6FA 3FB9A 4M77C 1OQKA 2E5KA 4HA8A 3OS2A 1PWTA 1PC0A 3TQ7P 4XTWA 4EIKA 2EKOA 2LJ0A 4B9XA 4BDZA 1N5ZA 1GCPA 1VUBA 4MDWA 5IN1A 3TREA 3J81E 1NEGA 3M0SA 2BZXA 2J7IA 2H3JA 2H3EB 4A4GA 4KRTA 3THKA 2KNBB 4C8QB 5HK3A 2IIMA 1M1FA 2CDTA 3EG3A 3JV3A 1KD1U 1N8RU 4M77G 1Y57A 1D09B 2XIDA 1LNXA 3CCMA 1E6GA 2C0OA 2COYA 1TG0A 2EYXA 1VQ8T 1BIAA 2YUPA 2L89A 1I81A 2HKQB 4E7LA 1NJIC 1XOVA 2K6DA 3QWXX 1P92A 1O9SA 3QHSA 1VYTA 2DLPA 4PJNA 2EQMA 5D6XA 1ZQ1A 4JPBW 3EHQA 4C0DC 4M75E 1VQ7T 1GCQA 1QWFA 2MCNA 4HCBA 4OMPA 1JRIA 2YRDA 4WF2A 3QBYA 2YT6A 5GAN2 1OEBA 2A7YA 3CCQA 2D1XA 5FU6C 3M58A 2X3XD 4OB3B 4J9FA 3LGFA 1B07A 3SFMA 4N4IA 2FHDA 3JAME 2MIOA 3QJYA 4XU3A 1ZBXA 2CZ6B 2A37A 1D3BB 3NFCA 2JN0A 3TSWA 3QWYA 1WI7A 1X2QA 1JXOA 3MP1A 1PM3A 1AWJA 5GANh 2CT4A 2NLUA 3CMEQ 2P84A 2XDDA 1VQ6T 2V8KA 1G8XA 2X4YA 1N8RR 3JCMJ 4KUIA 1XNIA 1V76A 1TS9A 1ZA1B 4OB1B 4OGEA 2FRYA 1I8FA 2J6OA 1YJNQ 1W6XA 4XU0A 4QQ6A 3I55Q 1BIBA 2LQWA 2L3PA 2HSEB 3E19A 2C06A 1M2OA 2A0FB 3HRTA 1AWWA 5LL6S 1KIKA 4LD6A 4C5EA 2DIQA 4A54A 5LJ5g 3UF4A 3CCET 4M4ZA 3CBMA 1M9SA 4E7SA 1YITT 3CMAT 1YJNT 1VQLA 1YJ9T 4FSSA 4HVWA 1ACMB 2KSSA 2AKLA 2L3RA 3JCMf 1RADB 4M75F 4E7JA 2EQIA 4LUDA 3OS1A 4F7UF 5A2QE 1QCOA 4JJCA 2DBMA 3CCUQ 3CD6Q 2YRCA 2F1LA 1OPKA 1KJWA 4MMKA 4NOYA 3JB9H 1Y96B 3GNFB 3O8VA 3VS6A 2RQRA 1AT1B 2YHTA 3G1JA 1IB8A 2XD0A 4M77F 4F7UG 2EKHA 2AT1B 2EWNA 5AT1B 3PNWC 4FYYB 3CXCP 4J5YA 3QG1A 4JRKA 5IT9E 1VQPT 3EH1A 1WHJA 3BE3A 2E70A 5GANg 4FL6A 2K7AA 2QYZA 5CCAA 2QEXT 1ZUKA 3JB9J 3WVDB 3X24B 3CCRA 1Q7YC 1QVFS 2RI3A 4PJOC 4O5VA 1YJWT 1K1ZA 2CP3A 3MP6A 1U3OA 4PJOA 3G71T 4LDVA 1K9MR 2DL3A 2KE9A 5FU7B 1VQ7Q 3CMEA 3NMZC 3G6EQ 1HXDA 4OMOA 5HCKA 4FT4A 2O9VA 2RJDA 4M78B 2K4YA 5GAMf 3HRUA 2MPXC 1HK9A 1Q7YU 2R58A 4JRIA 1M3BA 3OYFA 5EG2A 4CC2A 1LJOA 2CYZB 2Z0WA 4F7UB 2EFIA 3CCQQ 3UWNA 2XG8D 3G4ST 2XK0A 4N0AC 4XTVA 4C92B 5FU7C 4B6MA 2JOYA 1IHWA 2HQXA 3PE0A 5GAMj 4PJOB 2LNVA 4M78F 2PTKA 1SRLA 2J05A 4HCCA 2OX7A 4J9EA 1VIEA 2DJZA 4L59A 2DL4A 1H3HA 2KXDA 1VQ6Q 1S72Q 2ZAEA 1BK2A 1M90U 4QT7A 2JZ2A 4XAXB 1VQOQ 3CC7T 4Z88A 2PUOB 3VS4A 4C92A 5KCHA 4DEYA 3SWNA 5GAMh 1WHLA 2DM1A 1Q86R 2HNIA 5KYWA 1JJ2A 2JUFA 3I56A 1Y96A 2CGHA 4Z8AA 1SPKA 1QKWA 1Q81R 3WVEB 3NGPA 1YHQT 2CP5A 2VC8A 3CC4A 1PNJA 4Z89A 1K8AU 4OMMA 1YCSB 5KYNA 5GAMe 1WHHA 4ZGJB 5I22A 2LDMA 1M30A 3DB3A 3HHTB 1X6BA 3CPWS 3CC4Q 2M51A 2CT3A 2F5KA 3OQ5A 2JTMA 2OAWA 1FMVA 4ZN3A 1IO6A 1EIFA 1AHJB 2L5QA 4N0AA 4D6WA 4PFZA 4IUQA 2KT1A 3V7CA 1SHFA 2SRCA 3M0PA 1NG2A 3QDRB 2BE7D 5GAN4 1I4K1 4M7DB 2M16A 2KAFA 2PU9B 1W2BP 2K2MA 5DM7R 5LJ3j 1UGQB 1S72A 3R6NA 2JTEA 4HT8A 1SSFA 1V1CA 2O88A 5CK9A 4KGXB 1VQKA 3VRYA 4MDXA 2YLCA 2EJ9A 3CCEA 5LJ5d 3OW2S 3KUFA 3EGUA 1M90R 1X43A 4VUBA 2KQWA 2LT4A 1RAGB 1SG5A 2X51A 3OYAA 3LH0A 1QLYA 2EQJA 2JMAA 2L3SA 2KROA 3GF5A 3RKXA 3REBB 3V7RA 3QZ9B 2M9UA 8ATCB 1VQ5Q 5DLOA 4M75A 5GAMd 3M53A 2FVUA 4CRIA 2RB6A 1Q81U 4JJBA 3OYKA 1TH7A 2FL7A 2X3WD 4GBQA 2EGAA 1KQSS 1K0SA 2MI6A 4PKCC 1NJIR 3EH2A 1D0YA 2LX7A 3S3OA 1PKTA 2EQKA 1G83A 1RABB 1ZA2B 1VQMQ 3OYCA 1UG1A 2B86A 1FWZA 3OS0A 4BUGA 1UGVA 5GANj 2HAXA 3DKMA 3I56T 1KD1C 4E47A 3OYEA 2OTJQ 3CMET 1J3TA 5GMKi 2RK2A 3OA6A 4V2SA 4N4GA 4OGCA 2I2LA 2E65A 2HEQA 3VV0A 1B34A 3A98A 2QA4T 3AT1B 3TVTA 2CSIA 1BI1A 1TOVA 5I11A 2OJ2A 2YLBA 3CCJQ 8AT1B 5GANe 1G3TA 2Y4XA 3CCSQ 4E7IA 1YI2Q 4OB2B 4YTLA 1SSHA 1WX6A 1WZOA 5GAOn 1IZ6A 4M7DC 4R0KA 1ZSZB 3LLRA 3ME9A 5GAN3 3L1AA 1NBEB 4PNOA 1G5VA 4EDUA 1W2BA 2DETA 4M7AF 3CCVQ 2E6NA 3GNGA 4M77E 1QW1A 5HKCA 2L3QA 3JCMV 2RQUA 2X4XA 3C0CA 1EX4A 3CCJT 1UHCA 3X25B 3HKSA 3EGDA 2DTHA 1K73C 2QGFB 1KQ1A 4PJOF 3CD6A 3CCUA 1K9MU 1ARKA 4AT1B 2QK0A 2RJCA 1Q82U 2NUPB 3JCMQ 4Y91A 1ZSGA 3PVLA 4DBRA 2LC4A 2LQKA 3M57A 2VVKA 2RNAA 4E6RA 3CC2Q 3L2UA 3RBBB 4A4FA 4M75G 3ZL7C 1VQLQ 3E9GA 4X1VA 2NWMA 1JBMA 2DL5A 4PL6A 5LJ3e 2ED1A 2KRSA 3TEEA 2SEMA 3QUIA 3OYHA 2WACA 3P8DA 4RTTA 2R57A 5GANf 4A4KA 2QQRA 5FU6B 3X20B 5FLXE 4JUVA 1BU1A 2HD0A 4M7AC 2ZPGB 3H41A 5GMKm 4EMKA 3QKJA 2V8IA 4FU6A 1OI1A 1VIFA 2KYMA 3GBQA 3REAB 4RG8A 1BI0A 1YJNA 5IAYA 2P4TA 3CD6T 1KC8C 2ENMA 5KE2A 2HDAA 2AHJB 1RAAB 3SHWA 2ATCB 5CR2A 4C8QA 5KCOA 4E7ZA 3FC3A 1OX8A 1UHFA 4ZGEB 5L8RE 4IUPA 2RHZA 4XTXA 4C8QC 4Y92A 2DA9A 1M2VB 2VWFA 1E6HA 1GCQC 3EGXB 1YWOA 2E41A 1QVGP 2CP0A 1C0MA 1IGQA 1Z9QA 1YBYA 4NS5A 3CCST 2CH4W 4F7UE 4KBMB 1HD3A 4RMOA 4EMKC 2LJ3A 1ZSZC 3BDUA 1QKXA 4M7AA 1YP5A 3CCLT 2C0IA 4PLIA 2LX9A 4HCKA 3VYHB 3L2QA 4M78E 2O01E 2K9GA 1QQJA 4PJMA 4J7IA 4C0DB 2RMOA 4M77B 2YDLA 5GAMg 1QCFA 1KQ2A 3OYDA 1Y7XA 5GMKh 1JEGA 1M2VA 3MP8A 2LQ8A 4KH0B 3JCMX 2E12A 3UA6A 1OOTA 1V29B 4BY6C 3EFRA 5KE3A 2QQ9A 2DXCA 5A0LA 3CCMQ 1UEBA 1N9RA 2FB7A 3VS3A 2DO3A 4JDSA 3OYLA 2MWOA 2DX1A 2KRNA 1YIJA 1MHNA 5I2MA 2A08A 3KFVA 2HCKA 2K79A 1S72T 1VQ8A 1K0XA 1VQPA 2OTLA 4DOVA 2JTFA 3AHUA 3SWNC 1TUGB 2K3BA 1GL5A 1QP3A 3GOXA 1U06A 3X28B 2EYYA 1XTDA 1RAHB 2HL3A 2YSQA 1KK7A 3O5ZA 2J6KA 2L8DA 3HTRA 1I5LA 1IHVA 4ORZA 2X9HA 1MNEA 5EC7A 2C0TA 1Q86C 2NUTA 3HFOA 4IURA 1X01A 2CH4A 4FYXB 3ULRB 2IG0A 2XICA 3QPHA 3CMAQ 4EMHA 1MGQA 2EJGA 2MK5A 3V7SA 1WQWA 3A8LB 2ZPIB 2XI9A 2MYSA 3G71Q 1C6VX 3M0QA 3QZ5B 9ATCB 3OYIA 2DIGA 3FJPA 2DBKA 3OMGA 2RJEA 3OS5A 4ZN1A 2P0QA 1YITA 2WSFE 1M1KR 2ED0A 2YRVA 4C0GA 4JLGA 2QQSA 1N6AA 4FIBA 5GMKl 2RI2A 1AZEA 3A1PA 2RHXA 3C95A 3VS1A 3UT1A 2DXUA 2LMJA 2DZ9A 2O4XA 5IXBA 3LW5E 2HBPA 2LZ6B 1RI9A 4RTZA 3S3NA 3VS7A 4FM4B 4QVCA 5J3BA 5KH6A 1B3QA 1UDLA 1NE8A 2JS0A 2KDSA 5HY6A 5CQYA 1B34B 2BZYA 3M5AA 3NTIA 2GQIA 2LCCA 3PVQA 1LPLA 2K57A 3M0TA 1VQ4A 2K3YA 4X9CA 1H3ZA 4CI0C 1M1KC 3RDVA 4AFQC 2QDLA 2OTLT 5L23A 3J80E 1WDXA 2J06A 3GP8A 1I0CA 5CIUA 5ECAA 2GTJA 1VYVA 1WJRA 4HCZA 4LUEA 4ATOA 3E9FA 4JJNK 2LJ1A 4HXJA 4J9CA 1MMNA 1I07A 2HKNA 3LH5A 2DFUA 2QXFA 2XKOC 5GAOp 5KYXA 1LOJA 2E64A 4M75B 1YIJQ 2FPDA 4AG2C 2V8JA 1YJWQ 2HBWA 2LCSA 3G4SQ 2OI3A 4AFZC 1X6GA 4HT9A 2E3IA 2QQBA 2D8JA 2IVWA 3V8JA 4BI8B 4M7AD 4J6XA 4GLMA 3I55T 1AZGB 2F2WA 1M8VA 1X6OA 2R5AA 4RTWA 3OW2P 3E1SA 1FXXA 5DY9A 2XDBA 4D8KA 1K76A 1HSQA 1VQNA 2QTVA 2FRWA 4HVVA 4IIOA 4FCYA 3NTKA 2ZCFB 4AG1C 1RAEB 4C92C 3EFSA 5CKBA 4A4HA 1ZBJA 2LNHB 1NEBA 3P8BB 3JCMP 2CZ1B 1VQKT 2RPNA 2K2VA 3M0RA 4KH1B 1BYMA 2EIFA 5AYFA 1VOMA 1T0JA 1YHQQ 2IPOB 4M7DG 4LDXA 2HL5C 4BDYA 2PVOB 4JZ4A 4XTZA 1OU8A 1OULA 2CZ0B 3V8LA 3M0UA 2KK4A 1OZ3A 4LNPA 3C4SA 3H0FA 5I21A 2AK5A 4JJDA 2BUDA 3VJPA 5GAN8 1QWEA 3NTHA 4DOWA 3CC7A 3MEUA 2VYTA 1WXTA 2W10A 1JQQA 3VS0A 5FROA 1U5SA 2GCXA 2D6FA 3HPWA 4FT2A 1VQMT 3DLMA 1CKBA 1QVGS 2RHIA 3CBPA 3CXCA 3M56A 5CKEA 5LJ3d 2FPEA 2F5TX 2FYKA 4PJOG 1R0BG 3TCJA 1VQNT 1Y0MA 2A36A 2NUTB 4FYWB 4OB0B 1RI0A 1M8MA 2DYBA 3CPWA 4F16A 3KBGA 4OVAA 5LJ5j 2ABLA 1FYNA 1U8RA 3OYGA 1RUWA 2DK3A 4A63B 1QVFP 1QVGA 3SD4A 2M0YA 1N9SA 4BD3A 1FX7A 1TUCA 3OYJA 4IUVA 4C5HA 2LVMA 4N4HA 2KMTA 4XTYA 1JJ2S 4PJLA 2GFUA 3RMQA 1ABQA 5LJ3h 4O6JA 1X75C 4BE1A 2WSCE 4J9HA 4OMFB 4M77D 1GXIE 3A8GB 1W2BS 5IH2A 2EYWA 2PVGB 1Z9ZA 1H8KA 1SHGA 2JNGA 4M78A 2PZ1A 4RTXA 5D6YA 3RR6A 4PFPA 3MEVA 3DLLA 1JXMA 4WTOB 4JRQA 5GANd 2RJFA 1D1AA 3EFOB 4Z02A 2E10A 3CCQT 5GAOm 3C12A 3DB4A 3M54A 2F2XA 3OSSC 2RM4A 4PK4A 3CCSA 1K4US 3TSZA 1RAFB 3FRNA 2L0AA 3JSCA 2D0NA 2BKDN 1VQ9T 3MJXA 2OTJA 1PSFA 2FZCB 1GFCA 1MUZA 5J26A 4PFOA 1OV3A 3ASKA 3JCMh 2FEIA 2X4JA 2DXBA 2O2OA 1YJ9Q 1G3YA 2COZA 1IXDA 2PNIA 3CBOA 1VQMA 5C6SA 1VA7A 5KYUB 4PLLA 1VQLT 3QSUA 2O31A 2MF2A 5LJ3f 4FW1A 1EZZB 1VQ9Q 3OW2A 1ABOA 1I1JA 1KC8R 2A3LA 1K73R 1VQ5A 1TTHB 3IQLA 1YCYA 3M4GA 1TWBA 1T3LA 1ZHIA 1E7OA 2D0QB 3BFMA 2FPFA 4RCCA 2ZPFB 2EYZA 4GY5A 2OAUA 1ZLMA 1WJSA 4M78G 1ZSZA 3CCEQ 2QTXA 1VQ9A 2P0KA 3G71A 2RA2A 1G2BA 4EPCA 5IHIA 2RQVA 4C8QG 4X9DA 2B8AA 1PCXA 4XQ3A 4L6V5 2DERA 3RKWA 2K5IA 2EBPA 4RCBA 2JJ9A 1YJ9A 2W0ZA 3UATA 4ME7A 2AIRB 1Q95G 4BY6B 1X2KA 3I5RA 4OMQA 5IHKA 2NYSA 4LN2A 2DE0X 3JB9I 2KT8A 3CPFA 2L2PA 4CC3A 1ZUUA 1IGUA 5LJ5e 4IUTA 2VXEA 1D3BA 1TUDA 3PTAA 1KHIA 1SF9A 3EGDB 4OMLA 1OU9A 2HQHA 4QW2A 1CKAA 2OTLQ 1VQPQ 4RUGA 1KQSP 1VQ8Q 3RNJA 3FJ5A 4ELZC 2M0OA 2YWWA 4B9WA 4F17A 2AZSA 3RESA 2EJFA 2DVJA 2QI2A 1B7TA 1RAIB 4II1A 4NL3A 4UC4A 1H641 1YI2T 1IREB 2KBTA 2CREA 1Q82R 4QKUA 4ESRA 2JS2A 2VXFA 3M4YA 5J39A 1XJWB 4HVUA 5D6WA 4P5NA 3META 3PGGA 4ZNXA 2Y4YA 2CP7A 3CQTA 4J8OA 1M90C 3A8OB 1YIJT 3URGA 2LCLA 3JCMd 4C5GA 3EG2A 1RL2A 1W1FA 2PUKB 2LT1A 2AKKA 3GIBA 4LD9K 5FRNA 6AT1B 4M7DA 1D1BA 3MEWA 1QP2A 2KR3A 1S1NA 2K5LA 4PJOD 1DJ7B 3RIRA 3H0HA 1PG5B 1K73U 1UFFA 2OTJT 1G3SA 3E2UA 3PFSA 4E7KA 3C94A 2HQEA 1MNDA 4KT0E 1Q82C 2JMCA 2KEAA 3NHNA 3JCMb 3S3MA 2DEUA 1GFDA 2CP6A 3PMIA 1TSFA 1X27A 4RTYA 3G6EA 1VQ4T 4F04B 1VQ7A 2DKGA 3RUXA 2RH2A 2G3RA 2AZVA 3L2RA 1M3CA 2DPPB 4OMNA 1TXQA 5KYWB 3OMCA 3SWNB 4OP0A 1CSKA 5GAOr 5CKFA 4K11A 4DBFA 5IHNA 3L2WA 3BY7A 1VQOT 3OY9A 3UPUA 3CC7Q 3JCMe 2CS7A 1H92A 1M27C 2R5MA 2JM9A 4IIMA 3MKDA 4BI4A 4C8QE 3GLXA 1F1BB 2M1HA 2DILA 3PMTA 1AVZC 2JM8A 3VYGA 1VQ5T 5KYUA 1OYXA 1KSWA 3MO8A 2O9SA 4J9GA 4M75C 5CO7A 2DMOA 5I2SA 3JB9G 4ELYC 1M5Q1 2GTOA 2BZ8A 1YHQA 2K5FA 4MZMA 3CC4T 3QYGB
chains in the Genus database with same CATH topology
5CVIA 5LJ5d 3NTKA 2ZCFB 3OW2S 3KUFA 3WXMB 5M9OA 4C92C 3FLGA 4VUBA 2KQWA 3EFSA 2LT4A 5CKBA 3OYAA 3HRSA 4A4HA 3LH0A 5GAN7 2EQJA 3P8BB 2MAMA 2XDPA 3JCMP 2CZ1B 4M7AE 1VQKT 3GF5A 2K2VA 3RKXA 5LJ5f 3V7RA 3QZ9B 4C0FA 2M9UA 2PVDB 2QDYB 1BYMA 5DLOA 2EIFA 3QO3A 3FIFA 5AYFA 2GF7A 4M75A 5GAMd 3M9QA 3MHXA 3M53A 4M77A 4C0ZA 2KY9A 4LDXA 4M7DG 4BDYA 2PVOB 1KG1A 2FVUA 4XTZA 2MWPA 2RB6A 4CRIA 1Q81U 2F69A 5GMKj 3OYKA 1TH7A 2FL7A 1KQSS 2MI6A 2CZ0B 2ZPHB 4PKCC 3V8LA 3CCVA 1G3WA 3S3OA 2EQKA 3EAEA 2KK4A 1OZ3A 3C4SA 5I21A 2XU8A 3OYCA 3CCUT 3ER0A 1FWZA 1WPYA 4M7AB 4R56A 3OS0A 1YJWA 4BUGA 4XU2A 2RHYA 4FSXA 4RKUE 4BB7A 4L5GA 5GMKe 3N5BB 1PSEA 4M7DE 3CC2T 4M7DF 5CKDA 2BUDA 3VJPA 5GAN8 3FB9A 5GAN5 4M77C 5GANj 4HKEA 2HAXA 4TVRA 4HA8A 3DKMA 3OS2A 3NTHA 4DOWA 3CC7A 3I56T 2EQUA 3MEUA 1KD1C 2VYTA 4E47A 3CCJA 4C8QF 3OYEA 3CXCS 4DA4A 3JCMW 1N8RC 4XTWA 1UGRB 2EKOA 4B9XA 3CMET 5GMKi 2RK2A 3OA6A 4BDZA 4V2SA 4N4GA 4OGCA 4C92G 1W4SA 2I2LA 5FROA 2E65A 3VV0A 2GCXA 4BI3A 1B34A 2QA4T 1VUBA 2D6FA 1BI1A 3HPWA 4FT2A 4J7FA 2YLBA 4MDWA 5IN1A 3TREA 4F7UA 4QVDA 1VQMT 5GANe 3J81E 3DLMA 1G3TA 5C0MA 2Y4XA 2RHIA 1QVGS 2H3JA 2GQVA 3CBPA 4A4GA 3CXCA 3M56A 3QYHB 5CKEA 4C8QB 4E7IA 5HK3A 2RO0A 4OB2B 4YTLA 4EMGA 5LJ3d 2F5TX 2DEQA 1M1FA 5HK0A 2FYKA 4PJOG 5GAOn 4ZTFA 1IZ6A 1KD1U 4M7DC 1N8RU 3TCJA 3X26B 1VQNT 4M77G 3LLRA 3ME9A 4OB0B 2XIDA 3L1AA 5GAN3 3BDLA 1RI0A 4PNOA 1LNXA 3CCMA 1G5VA 4EDUA 2D9TA 3CPWA 1JB0E 1W2BA 2Y90A 4M7AF 2E6NA 2DXTA 3GNGA 4M77E 3KBGA 3H8ZA 1QW1A 3JRZA 4OVAA 5HKCA 1BIAA 5LJ5j 1VQ8T 2L89A 4M78C 1I81A 4QVZA 3JCMV 2X4XA 3QJ6A 1U8RA 3OYGA 2DK3A 4E7LA 1NPRA 1NJIC 1QVGA 1XOVA 3SD4A 3CCJT 2E6ZA 3X25B 1N9SA 3HKSA 2DTHA 3HSBA 1P92A 1O9SA 3QHSA 1FX7A 4BD3A 1K73C 1KQ1A 3INZA 4PJOF 3CCUA 3CD6A 2EQMA 3OYJA 4IUVA 4C5HA 2LVMA 3A5ZB 4N4HA 1K9MU 2KMTA 4XTYA 2BIVA 2RJCA 5D6XA 4Q5WA 1JJ2S 1ZQ1A 4M7AG 4J6YA 2GFUA 3RMQA 1Q82U 1BI2A 3JCMQ 4Y91A 5LJ3h 4O6JA 1X75C 3SB2A 4C0DC 2WSCE 4M75E 4OMFB 4C8QD 4BE1A 1VQ7T 2LC4A 2LQKA 4M77D 4Y28E 3M57A 4HCBA 2E5QA 1GXIE 3A8GB 1JRIA 3F70A 1W2BS 3L2UA 3HFNA 4WF2A 3L42A 3QBYA 4A4FA 4XK8E 3OBYA 4M75G 2PVGB 5GAN2 1NJIU 2A7YA 3L2VA 2EYQA 2VUBA 3E9GA 3Q1JA 3CCQA 2JNGA 3H6ZA 1JBMA 3M58A 4M78A 5FU6C 4OB3B 5D6YA 3LGFA 1UGPB 4PL6A 3MEVA 3SFMA 5LJ3e 2DD5A 4EMKB 4BE2A 4N4IA 3TEEA 3DLLA 2FHDA 3QUIA 3OYHA 2WACA 3JAME 3CMAA 3P8DA 1KQSA 2R57A 5GANf 3QJYA 4XU3A 1ZBXA 4JRQA 2CZ6B 2DD4A 2RJFA 2WSEE 5GANd 3HP9A 4A4KA 1D3BB 3NFCA 4Z02A 2QQRA 2VGNA 2E10A 5FU6B 5GAOm 3CCQT 2JN0A 3X20B 5FLXE 4JUVA 4NL2A 3C12A 2HD0A 3DB4A 4JS4A 3M54A 4M7DD 2ZPGB 3CCRT 3OSSC 2RM4A 4M7AC 5GMKm 3MP1A 4ZGDB 1WNLA 3MCAB 3OSVA 2NLUA 3ZFJA 4EMKA 5GANh 2ZGWA 3QKJA 2V8IA 2XDDA 4FU6A 3CCSA 1OI1A 1VIFA 2V8KA 1VQ6T 4MZPA 1NZ9A 2X4YA 5GAOq 3JCMJ 4RG8A 1BI0A 3JB9F 1YJNA 3FRNA 3BW1A 1XNIA 4KUIA 5IAYA 1QVFA 3JSCA 5A0DA 4OB1B 2P4TA 2BKDN 3CD6T 4C5IA 1Y71A 1KC8C 4OGEA 5DLQE 1OZ2A 1I8FA 2KVQG 5KE2A 4BE0A 1VQ9T 5FRMA 2OTJA 2AHJB 1PSFA 5CR2A 4C8QA 2RI5A 5J26A 2GFAA 4XU0A 5KCOA 4QQ6A 1XQHA 1BIBA 2EAYA 3FC3A 3VUBA 3E19A 4ZGEB 5L8RE 4IUPA 2RHZA 3ASKA 3JCMh 4XTXA 2C06A 4C8QC 2X4JA 4RG2A 4BACA 3S3MA 2DXBA 3HRTA 1G3YA 5LL6S 4LD6A 2E41A 3CBOA 4IUUA 3PIOA 1VQMA 4ZTJA 4C5EA 2DIQA 5C6SA 4A54A 1YBYA 5LJ5g 1VQOA 2DTOA 3CCET 4NS5A 3CCST 3ZBDA 1VQ6A 4PLLA 4F7UE 3HL8A 2CKKA 3CBMA 3J7AF 1VQLT 1M9SA 3QSUA 4KBMB 4JRPA 4RMOA 1YITT 4EMKC 2MF2A 5LJ3f 3CMAT 1YJNT 3OW2A 1VQLA 4E7HA 3BDUA 1YJ9T 4M7AA 2A3LA 3L2ZA 3CCLT 1VQ5A 1YCYA 4PJOE 3M4GA 4PLIA 4A4EA 1ZHIA 2LX9A 3VYHB 2KSSA 3L2QA 2L3RA 4OF1A 4M78E 3JCMf 2O01E 4C92E 4M75F 3BFMA 2D0QB 4E7JA 2DZCA 4J7IA 4RCCA 2ZPFB 4M77B 4C0DB 5GAMg 3OS1A 4GY5A 4F7UF 5A2QE 2OAUA 4DQ2A 1WJSA 2P0PA 4M78G 2QTXA 1KQ2A 3OYDA 1Y7XA 5GMKh 3KXTA 1VQ9A 2P0KA 3OYBA 4JS5A 4MMKA 3LWHA 3MP8A 2CZ7B 3G71A 4NOYA 3JB9H 2RA2A 2VV5A 4EPCA 5A0GA 2LQ8A 1Y96B 4C8QG 3GNFB 3O8VA 3FEOA 2B8AA 1N27A 2E12A 4X9DA 3S6WA 3JCMX 1V29B 3RERA 4BY6C 3A8MB 3EFRA 5KE3A 2QQ9A 3P8HA 2YHTA 2DVEA 4XQ3A 2DXCA 5A0LA 3OBWA 4L6V5 2XD0A 1UEBA 3RKWA 1N9RA 4M75D 4M77F 2FB7A 2DAQA 2K5IA 4LDWA 4RCBA 3VU3C 4F7UG 2DO3A 4JDSA 3OYLA 1YJ9A 3JCMg 2MWOA 2EWNA 3PNWC 1YIJA 1MHNA 4J5YA 4ME7A 5I2MA 3QG1A 3CCVT 4JRKA 4R55A 5IT9E 1VQPT 4BY6B 2RHUA 4KUDK 1S72T 2E70A 2X4WA 1VQ8A 2O4XB 4LDUA 5GANg 3JB9I 2JVVA 1NPPA 3CPFA 4FL6A 1VQPA 1Q81C 4DOVA 2JTFA 2OTLA 5CCAA 3RMSA 2QEXT 3AHUA 3SWNC 3WVDB 3X24B 3CCRA 3JB9J 1Q7YC 1QVFS 3T9NA 2RI3A 4PJOC 2PQWA 4O5VA 5LJ5e 1YJWT 4IUTA 2VXEA 1QP3A 3GOXA 2K3XA 1D3BA 2RK1A 3PTAA 1KHIA 3MP6A 4QW2A 3X28B 1XTDA 2RD1A 3LGLA 3CCMT 4PJOA 3G71T 4LDVA 3OYYA 5FU7B 2L8DA 3CMEA 1HXDA 1I5LA 4FT4A 4ELZC 1YHQA 1UGSB 2RJDA 4M78B 2M0OA 1QVPA 4B9WA 2K4YA 3OYMA 5GAMf 3HRUA 1Q86C 3RESA 1HK9A 2EJFA 1Q7YU 1WQ7A 2R58A 2QI2A 3HFOA 1X01A 4IURA 2IG0A 4C92F 2XICA 4JRIA 1O75A 3ZEHA 3QPHA 4II1A 4NL3A 3OYFA 4EMHA 5EG2A 4UC4A 3VKIA 1MGQA 1H641 1LJOA 2EJGA 3V7SA 1YI2T 1WQWA 3A8LB 2LTOA 2ZPIB 1IREB 2CYZB 2XI9A 3M59A 3LX7A 4F7UB 2E1HA 2EFIA 3OYNA 3LYIA 2QEXA 2VXFA 3M4YA 5J39A 3UWNA 2XG8D 3G4ST 3GPLA 3QZ5B 2XK0A 5D6WA 4P5NA 4N0AC 3META 3OB9A 4XTVA 4C92B 3PGGA 5FU7C 2JOYA 3G7ZA 3OYIA 3CC2A 2DIGA 2Y4YA 3FJPA 1Q86U 4J8OA 3OMGA 4ZN1A 2RJEA 3A8OB 3OS5A 2P0QA 2HQXA 2WSFE 1YIJT 3URGA 5GAN6 2LCLA 3JCMd 3CCLA 4C5GA 2YRVA 3LWIA 5GAMj 4PJOB 2LNVA 1RL2A 4C0GA 4M78F 4JLGA 3TU4K 2QQSA 3JCMc 1N6AA 4FIBA 2PUKB 5GMKl 2LT1A 2RI2A 1U1SA 3GIBA 3QXEB 1R8OB 4HCCA 4GLKA 2LRQA 1YITA 4LD9K 4LDYA 5FRNA 4M7DA 2RHXA 3C95A 3MEWA 1QP2A 1VIEA 3UT1A 2DXUA 2K5LA 2DJZA 4PJOD 1DJ7B 2ZPEB 3RIRA 2DZ9A 1K73U 2OTJT 2O4XA 1WGSA 3LW5E 1G3SA 3PFSA 4L59A 2HBPA 4E7KA 2X35A 3C94A 3S3NA 2HQEA 5CQXA 1M90C 4XTUA 1K9MC 5CKHA 4FM4B 4QVCA 5J3BA 4KT0E 3UDCA 1M90U 1Q82C 5KH6A 4QQDA 2JZ2A 4XAXB 1Y07A 3CC7T 2PUOB 2ZPBB 3A8HB 1NE8A 4M78D 2KDSA 5CQYA 1B34B 5HY6A 4C92A 3M5AA 3NTIA 3JCMb 2LCCA 3G4SA 5KCHA 2K57A 5GAOl 4A53A 3SWNA 5GAMh 3SDZA 4IKFA 4MMLA 4C92D 1VQ4A 2HNIA 3PMIA 2K3YA 4X9CA 1H3ZA 2XHCA 2ZZDA 3PIPA 1JJ2A 4CI0C 3V8KA 1M1KC 2JUFA 3I56A 1UB4A 3G6EA 1VQ4T 1YI2A 1Y96A 2CGHA 3I55A 1VQ7A 2DKGA 3RUXA 3FDRA 5LJ3g 2RH2A 2G3RA 2VGMA 5LJ5h 3WVEB 3L2RA 2DPPB 3G6ET 1YHQT 4KULA 2VC8A 1M1GA 3CC4A 4J83A 3OMCA 1K8AU 4J6WA 2OTLT 4MZTA 3SWNB 4OP0A 3R6OA 5GAMe 3J80E 3GP8A 5GAOr 4ZGJB 5CIUA 5CKFA 2LDMA 4JLIA 3DB3A 1WJRA 3HHTB 3L2WA 4HCZA 3CPWS 4ATOA 3E9FA 1U1TA 3BY7A 2F5KA 4JJNK 1VQOT 3OY9A 3UPUA 3OQ5A 3JCMe 2CS7A 2JTMA 2DTIA 2QXFA 4ZN3A 2XKOC 1M1KU 1EIFA 1AHJB 2L5QA 4N0AA 1M4ZA 5GAOp 4D6WA 2R5MA 2QQAA 4IUQA 1LOJA 2E64A 4M75B 3V7CA 1BKBA 3CEYA 3QDRB 5GAN4 2V8JA 4BI4A 1KHCA 4C8QE 1I4K1 3GLXA 3QIIA 5CAIA 2M16A 4M7DB 2M1HA 1K8AC 4HT9A 2KAFA 2PU9B 3VUZA 1KC8U 3PMTA 3RKYA 5DM7R 3VYGA 2QQBA 2IVWA 3V8JA 4BI8B 3MEAA 5LJ3j 1UGQB 3M55A 4J6XA 1S72A 1OYXA 1VQ5T 2MMPA 4M7AD 1WJQA 3I55T 3MO8A 4M75C 4HT8A 5CO7A 5I2SA 3JB9G 4ELYC 1M5Q1 1SSFA 1M8VA 1X6OA 2R5AA 5CK9A 4QQGA 2K5FA 1BI3A 3E1SA 4MZMA 1FXXA 4XU1A 5DY9A 3CC4T 3JB9D 1VQKA 2XDBA 2QA4A 1VQNA 4X34A 4MDXA 2YLCA 2EJ9A 3QYGB 3PT9A 3CCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ1 A;  3INZ A;  4PJO F;  4N0A C;  4XTV A;  1YCY A;  4C92 B;  5LJ5 d;  3PGG A;  4PJO E;  3M4G A;  4XTY A;  3FJP A;  4C92 C;  4M7A G;  4J6Y A;  5GAN 6;  3JCM Q;  3EFS A;  3JCM d;  4Y91 A;  5LJ3 h;  4PJO B;  3SB2 A;  4M78 E;  4M75 E;  3JCM f;  4C8Q D;  4C92 E;  5GAM j;  4M75 F;  3BFM A;  4M78 F;  4M77 D;  5GAN 7;  3JCM P;  3JCM c;  2DZC A;  4RCC A;  4M7A E;  4M77 B;  1JRI A;  5GMK l;  5GAM g;  1U1S A;  3HFN A;  4WF2 A;  4F7U F;  3GIB A;  4DQ2 A;  3RKX A;  4F7U G;  5LJ5 f;  3V7R A;  4M7D A;  4M75 G;  4M78 G;  5GAN 2;  2QTX A;  3QO3 A;  2DXU A;  1KQ2 A;  2DJZ A;  5GMK h;  3FIF A;  4PJO D;  4MMK A;  1JBM A;  4M75 A;  4M78 A;  3RIR A;  5GAM d;  4NOY A;  4M7D G;  4M77 A;  2DZ9 A;  3JB9 H;  2RA2 A;  4XTZ A;  1Y96 B;  4C8Q G;  2RB6 A;  5LJ3 e;  4EMK B;  4X9D A;  4XTU A;  5GMK j;  1TH7 A;  3JCM X;  3RER A;  3QUI A;  4QVC A;  3EFR A;  3V8L A;  2YHT A;  2DVE A;  4XQ3 A;  5GAN f;  4XU3 A;  3RKW A;  1N9R A;  5GAN d;  4M75 D;  4M78 D;  4C92 A;  1B34 B;  1D3B B;  4M77 F;  2FB7 A;  5I21 A;  3JCM b;  2E10 A;  5GAO m;  2K57 A;  1WPY A;  2JN0 A;  4RCB A;  4M7A B;  3SWN A;  3VU3 C;  4JUV A;  4XU2 A;  4A53 A;  4MML A;  4NL2 A;  3JCM g;  4C92 D;  5GMK e;  5GAM h;  2HNI A;  4M7D D;  2EWN A;  4X9C A;  4M7A C;  4M7D E;  2RM4 A;  4J5Y A;  4M7D F;  4JRK A;  3V8K A;  5GMK m;  5GAN 8;  3FB9 A;  1WNL A;  4EMK A;  5GAN h;  5GAN 5;  4M77 C;  1Y96 A;  2CGH A;  5GAN j;  2ZGW A;  2DKG A;  3RUX A;  4HA8 A;  5LJ3 g;  5GAN g;  3JB9 I;  5LJ5 h;  5GAO q;  3JCM J;  3AHU A;  5GAO l;  2VC8 A;  4C8Q F;  3JB9 F;  3JCM W;  4XTW A;  3SWN C;  3JB9 J;  3BW1 A;  5GMK i;  4J6W A;  4PJO C;  4V2S A;  5LJ5 e;  3SWN B;  4OP0 A;  4C92 G;  2VXE A;  5GAM e;  2I2L A;  5GAO r;  2E65 A;  1D3B A;  1I8F A;  1B34 A;  4JLI A;  2YLB A;  2RD1 A;  4F7U A;  4QVD A;  1U1T A;  4PJO A;  3BY7 A;  5GAN e;  4C8Q A;  3JCM e;  4XU0 A;  2DTI A;  1BIB A;  2EAY A;  1HXD A;  4N0A A;  4C8Q B;  5GAO p;  4EMG A;  1I5L A;  5LJ3 d;  1LOJ A;  4XTX A;  2DEQ A;  3JCM h;  2E64 A;  4C8Q C;  4M75 B;  4M78 B;  3V7C A;  4M7A A;  2FYK A;  4PJO G;  5GAM f;  5GAO n;  4M7D C;  4M7D B;  5GAN 4;  4M77 G;  4C8Q E;  3RES A;  1HK9 A;  1I4K 1;  2EJF A;  2E41 A;  3L1A A;  1WQ7 A;  5CAI A;  3HFO A;  5GAN 3;  4HT9 A;  1X01 A;  4PNO A;  1LNX A;  4C92 F;  4JRI A;  4A54 A;  3RKY A;  5LJ5 g;  4M7A F;  2DTO A;  2Y90 A;  5LJ3 j;  3V8J A;  4NL3 A;  2DXT A;  4EMH A;  4M77 E;  4J6X A;  4M7A D;  5LJ5 j;  1MGQ A;  1H64 1;  1LJO A;  2EJG A;  1BIA A;  3V7S A;  4F7U E;  1WQW A;  4M78 C;  4M75 C;  1I81 A;  3JCM V;  4HT8 A;  3JB9 G;  3QSU A;  1M5Q 1;  1M8V A;  4EMK C;  5LJ3 f;  4XU1 A;  4F7U B;  2E1H A;  5DY9 A;  1N9S A;  3JB9 D;  2VXF A;  2DTH A;  3HSB A;  2YLC A;  2EJ9 A;  3BDU A;  3L2Z A;  3QHS A; 
#chains in the Genus database with same CATH topology
 2A28 A;  5M9O A;  1FMW A;  2JW4 A;  1PD0 A;  3UA7 A;  2FG0 A;  1C1A A;  2MAM A;  4M7A E;  2RQT A;  4C0F A;  3QO3 A;  1VQN Q;  1IRX A;  2EVR A;  3M9Q A;  4C0Z A;  4AFU C;  4FW2 A;  1GBR A;  1X69 A;  2FZG B;  2RQW A;  3CCV A;  1G3W A;  4F14 A;  1WHM A;  2M02 A;  2XU8 A;  3ER0 A;  1JU5 C;  1BCO A;  1WPY A;  1YJW A;  4R56 A;  4XU2 A;  4FSX A;  5GMK e;  4L5G A;  1SRM A;  1WFW A;  4FYV B;  1K8A R;  3I5S A;  5CKD A;  1SEM A;  2QAZ A;  2D8H A;  5GAN 5;  1KFZ A;  4HKE A;  4TVR A;  2EQU A;  4DA4 A;  3CCJ A;  1N8R C;  4C8Q F;  3CXC S;  3JCM W;  1MMG A;  1WYX A;  1UGR B;  1HYO A;  4C92 G;  1W4S A;  1PRM C;  4BI3 A;  4J7F A;  3H0I A;  4F7U A;  4QVD A;  1WIE A;  1T0H A;  5C0M A;  2GQV A;  4LXC A;  3QYH B;  2RO0 A;  4EMG A;  2DEQ A;  5HK0 A;  3D7S B;  5FW9 A;  4ZTF A;  2RN8 A;  1VQ4 Q;  3X26 B;  3EGX A;  2BTT A;  4J9B A;  3BDL A;  3QDF A;  1UJ0 A;  1LCK A;  2D9T A;  1JB0 E;  2Y90 A;  2DXT A;  3H8Z A;  3JRZ A;  4M78 C;  1PKS A;  4QVZ A;  3QJ6 A;  2CUB A;  1NPR A;  2RF0 A;  2E6Z A;  2EPD A;  4LE9 A;  3HSB A;  2H8H A;  2MOX A;  1D0X A;  2VKN A;  3INZ A;  3EFO A;  1QCN A;  3A5Z B;  2BIV A;  4Q5W A;  4M7A G;  4J6Y A;  2FO0 A;  1BI2 A;  2KGT A;  3U23 A;  3SB2 A;  4C8Q D;  1D1C A;  4Y28 E;  2E5Q A;  3F70 A;  2E3H A;  3HFN A;  3L42 A;  4XK8 E;  3OBY A;  1NJI U;  2I0N A;  3L2V A;  2EYQ A;  2VUB A;  3Q1J A;  2V1R A;  3H6Z A;  1UGP B;  2G6F X;  2DD5 A;  4EMK B;  4BE2 A;  5KYY B;  3CMA A;  1KQS A;  4WCI A;  1MMA A;  3VRZ A;  2DD4 A;  2WSE E;  3HP9 A;  3H9N A;  2VGN A;  4NL2 A;  4M7D D;  4JS4 A;  3CCR T;  1GRI A;  1NLO C;  4ZGD B;  2HSP A;  1WNL A;  3MCA B;  3OSV A;  3ZFJ A;  2ZGW A;  1T3S A;  4MZP A;  1NZ9 A;  5GAO q;  2NUP A;  3JB9 F;  1YFN A;  3BW1 A;  1QVF A;  5A0D A;  5FWB A;  1VYU A;  4C5I A;  1Y71 A;  5DLQ E;  1OZ2 A;  1W70 A;  2DRK A;  2KVQ G;  3SEM A;  4BE0 A;  1YN8 A;  5FRM A;  2RI5 A;  2GFA A;  1XQH A;  1UEC A;  2EAY A;  2HMA A;  2CP2 A;  3VUB A;  3I56 Q;  2FZK B;  3VS2 A;  3CPW P;  4RG2 A;  4BAC A;  4E2F B;  3CCL Q;  1AD5 A;  3VS5 A;  2YUN A;  4IUU A;  3PIO A;  4ZTJ A;  1VQO A;  2JXB A;  2DTO A;  1VQ6 A;  3ZBD A;  3HL8 A;  2CKK A;  3J7A F;  1NYF A;  2F2V A;  4JRP A;  2YUO A;  4E7H A;  1AWX A;  3L2Z A;  4J9I A;  1WLP B;  4PJO E;  5KYX B;  4DBQ A;  4A4E A;  3I9Q A;  5FWC A;  2QAS A;  2QGG A;  1NM7 A;  4OF1 A;  2COW A;  4C92 E;  2GNC A;  2DZC A;  7AT1 B;  4RTV A;  4DQ2 A;  2KXC A;  2P0P A;  2QA4 Q;  3KXT A;  3OYB A;  4JS5 A;  2JT4 A;  3LWH A;  2CZ7 B;  1UE9 A;  2VV5 A;  5A0G A;  1PD1 A;  4ANJ A;  3FEO A;  1N27 A;  1WA7 A;  3S6W A;  3RER A;  1UUE A;  3A8M B;  2EGC A;  3P8H A;  2ROL A;  2DVE A;  3OBW A;  2XMF A;  1WXB A;  4M75 D;  2DAQ A;  2KI7 A;  4LDW A;  3VU3 C;  5IXF A;  3JCM g;  1PRL C;  1RAC B;  2ECZ A;  1YWP A;  4DBH A;  4R55 A;  3CCV T;  1FMK A;  2RHU A;  4KUD K;  2X4W A;  4JZ3 A;  2O4X B;  4LDU A;  2HZY A;  1NPP A;  2JVV A;  1Q81 C;  3RMS A;  1UJY A;  2DNU A;  3T9N A;  2PQW A;  2K3X A;  2V1Q A;  2QG9 B;  2RK1 A;  1YNZ A;  3CCR Q;  2RD1 A;  3LGL A;  3CCM T;  3OYY A;  1ZX6 A;  1NLP C;  1NYG A;  5KYY A;  1UGS B;  1QVP A;  3OYM A;  2GBQ A;  1SKU B;  1RLP C;  1WQ7 A;  2DJQ A;  1WXU A;  4C92 F;  1O75 A;  3ZEH A;  3VKI A;  2LTO A;  2EW3 A;  1TU0 B;  3M59 A;  3LX7 A;  2DYI A;  2QEX A;  2E1H A;  3OYN A;  3LYI A;  2VB6 A;  1MMD A;  3GPL A;  1EFN A;  3OB9 A;  3G7Z A;  3CC2 A;  1Q86 U;  1BBZ A;  5GAN 6;  1BB9 A;  1AEY A;  3LWI A;  4KGV B;  3TU4 K;  3JCM c;  2DF6 A;  4J9D A;  1U1S A;  3QXE B;  1R8O B;  4GLK A;  2LRQ A;  1D0Z A;  3NPF A;  4LDY A;  1Q7Y R;  2QEX Q;  2ZPE B;  1WHG A;  3EHR A;  1WGS A;  1RLQ C;  3EG9 B;  2YUQ A;  2X35 A;  1K9M C;  1K9A A;  5CQX A;  4DEX A;  4XTU A;  2LP5 A;  5CKH A;  3UDC A;  4QQD A;  1Y07 A;  3EG0 A;  2KYB A;  2ZPB B;  3A8H B;  4M78 D;  3EG1 A;  1M3A A;  3G4S A;  3I35 A;  4D8D A;  5GAO l;  4A53 A;  3SDZ A;  4IKF A;  4MML A;  4C92 D;  1JJ2 P;  2XHC A;  2ZZD A;  3PIP A;  2ROT A;  3V8K A;  1UB4 A;  1YI2 A;  2V26 A;  1UTI A;  3I55 A;  3FDR A;  5LJ3 g;  1MV0 B;  2VGM A;  5LJ5 h;  3G6E T;  4KUL A;  1M1G A;  4J83 A;  4J6W A;  1GBQ A;  4MZT A;  2NUZ A;  3R6O A;  1LVK A;  1QMC A;  4CC4 B;  1A0N B;  4JLI A;  1U1T A;  1ZUY A;  1PHT A;  4RTU A;  2DTI A;  1WHK A;  1M1K U;  5GJW B;  3EG9 A;  1M4Z A;  2P4R A;  2QQA A;  2DL8 A;  2GGR A;  3MPU B;  2CSQ A;  1BKB A;  3CEY A;  1KHC A;  3QII A;  5CAI A;  2LQN A;  1K8A C;  3VUZ A;  1KC8 U;  3RKY A;  3MEA A;  3M55 A;  2MMP A;  1WJQ A;  4QQG A;  1AOJ A;  1BI3 A;  4XU1 A;  3JB9 D;  2QA4 A;  4X34 A;  3PT9 A;  1JO8 A;  5CVI A;  3WXM B;  3FLG A;  1HJD A;  1MV3 A;  1AWO A;  3HRS A;  5GAN 7;  1YIT Q;  2XDP A;  2CUD A;  2KRM A;  4KGZ B;  4AFS C;  5GJV B;  4AMC A;  1KD1 R;  4PJJ A;  5LJ5 f;  2PVD B;  2QDY B;  1OPL A;  2ESW A;  2BE9 B;  3FIF A;  1VQK Q;  2GF7 A;  3MHX A;  2YXY A;  4M77 A;  2KY9 A;  2EGE A;  1KG1 A;  2MWP A;  2F69 A;  5GMK j;  5D7U A;  1I5O B;  1OX9 A;  2VAS A;  2ZPH B;  1R0C B;  2DRM A;  3EAE A;  1BCM A;  3CCU T;  2DL7 A;  2E4H A;  4M7A B;  3CCL A;  2RHY A;  4BB7 A;  4RKU E;  3N5B B;  4CC7 A;  1PSE A;  4M7D E;  3CC2 T;  4M7D F;  1R77 A;  2J6F A;  3FB9 A;  4M77 C;  1OQK A;  2E5K A;  4HA8 A;  3OS2 A;  1PWT A;  1PC0 A;  3TQ7 P;  4XTW A;  4EIK A;  2EKO A;  2LJ0 A;  4B9X A;  4BDZ A;  1N5Z A;  1GCP A;  1VUB A;  4MDW A;  5IN1 A;  3TRE A;  3J81 E;  1NEG A;  3M0S A;  2BZX A;  2J7I A;  2H3J A;  2H3E B;  4A4G A;  4KRT A;  3THK A;  2KNB B;  4C8Q B;  5HK3 A;  2IIM A;  1M1F A;  2CDT A;  3EG3 A;  3JV3 A;  1KD1 U;  1N8R U;  4M77 G;  1Y57 A;  1D09 B;  2XID A;  1LNX A;  3CCM A;  1E6G A;  2C0O A;  2COY A;  1TG0 A;  2EYX A;  1VQ8 T;  1BIA A;  2YUP A;  2L89 A;  1I81 A;  2HKQ B;  4E7L A;  1NJI C;  1XOV A;  2K6D A;  3QWX X;  1P92 A;  1O9S A;  3QHS A;  1VYT A;  2DLP A;  4PJN A;  2EQM A;  5D6X A;  1ZQ1 A;  4JPB W;  3EHQ A;  4C0D C;  4M75 E;  1VQ7 T;  1GCQ A;  1QWF A;  2MCN A;  4HCB A;  4OMP A;  1JRI A;  2YRD A;  4WF2 A;  3QBY A;  2YT6 A;  5GAN 2;  1OEB A;  2A7Y A;  3CCQ A;  2D1X A;  5FU6 C;  3M58 A;  2X3X D;  4OB3 B;  4J9F A;  3LGF A;  1B07 A;  3SFM A;  4N4I A;  2FHD A;  3JAM E;  2MIO A;  3QJY A;  4XU3 A;  1ZBX A;  2CZ6 B;  2A37 A;  1D3B B;  3NFC A;  2JN0 A;  3TSW A;  3QWY A;  1WI7 A;  1X2Q A;  1JXO A;  3MP1 A;  1PM3 A;  1AWJ A;  5GAN h;  2CT4 A;  2NLU A;  3CME Q;  2P84 A;  2XDD A;  1VQ6 T;  2V8K A;  1G8X A;  2X4Y A;  1N8R R;  3JCM J;  4KUI A;  1XNI A;  1V76 A;  1TS9 A;  1ZA1 B;  4OB1 B;  4OGE A;  2FRY A;  1I8F A;  2J6O A;  1YJN Q;  1W6X A;  4XU0 A;  4QQ6 A;  3I55 Q;  1BIB A;  2LQW A;  2L3P A;  2HSE B;  3E19 A;  2C06 A;  1M2O A;  2A0F B;  3HRT A;  1AWW A;  5LL6 S;  1KIK A;  4LD6 A;  4C5E A;  2DIQ A;  4A54 A;  5LJ5 g;  3UF4 A;  3CCE T;  4M4Z A;  3CBM A;  1M9S A;  4E7S A;  1YIT T;  3CMA T;  1YJN T;  1VQL A;  1YJ9 T;  4FSS A;  4HVW A;  1ACM B;  2KSS A;  2AKL A;  2L3R A;  3JCM f;  1RAD B;  4M75 F;  4E7J A;  2EQI A;  4LUD A;  3OS1 A;  4F7U F;  5A2Q E;  1QCO A;  4JJC A;  2DBM A;  3CCU Q;  3CD6 Q;  2YRC A;  2F1L A;  1OPK A;  1KJW A;  4MMK A;  4NOY A;  3JB9 H;  1Y96 B;  3GNF B;  3O8V A;  3VS6 A;  2RQR A;  1AT1 B;  2YHT A;  3G1J A;  1IB8 A;  2XD0 A;  4M77 F;  4F7U G;  2EKH A;  2AT1 B;  2EWN A;  5AT1 B;  3PNW C;  4FYY B;  3CXC P;  4J5Y A;  3QG1 A;  4JRK A;  5IT9 E;  1VQP T;  3EH1 A;  1WHJ A;  3BE3 A;  2E70 A;  5GAN g;  4FL6 A;  2K7A A;  2QYZ A;  5CCA A;  2QEX T;  1ZUK A;  3JB9 J;  3WVD B;  3X24 B;  3CCR A;  1Q7Y C;  1QVF S;  2RI3 A;  4PJO C;  4O5V A;  1YJW T;  1K1Z A;  2CP3 A;  3MP6 A;  1U3O A;  4PJO A;  3G71 T;  4LDV A;  1K9M R;  2DL3 A;  2KE9 A;  5FU7 B;  1VQ7 Q;  3CME A;  3NMZ C;  3G6E Q;  1HXD A;  4OMO A;  5HCK A;  4FT4 A;  2O9V A;  2RJD A;  4M78 B;  2K4Y A;  5GAM f;  3HRU A;  2MPX C;  1HK9 A;  1Q7Y U;  2R58 A;  4JRI A;  1M3B A;  3OYF A;  5EG2 A;  4CC2 A;  1LJO A;  2CYZ B;  2Z0W A;  4F7U B;  2EFI A;  3CCQ Q;  3UWN A;  2XG8 D;  3G4S T;  2XK0 A;  4N0A C;  4XTV A;  4C92 B;  5FU7 C;  4B6M A;  2JOY A;  1IHW A;  2HQX A;  3PE0 A;  5GAM j;  4PJO B;  2LNV A;  4M78 F;  2PTK A;  1SRL A;  2J05 A;  4HCC A;  2OX7 A;  4J9E A;  1VIE A;  2DJZ A;  4L59 A;  2DL4 A;  1H3H A;  2KXD A;  1VQ6 Q;  1S72 Q;  2ZAE A;  1BK2 A;  1M90 U;  4QT7 A;  2JZ2 A;  4XAX B;  1VQO Q;  3CC7 T;  4Z88 A;  2PUO B;  3VS4 A;  4C92 A;  5KCH A;  4DEY A;  3SWN A;  5GAM h;  1WHL A;  2DM1 A;  1Q86 R;  2HNI A;  5KYW A;  1JJ2 A;  2JUF A;  3I56 A;  1Y96 A;  2CGH A;  4Z8A A;  1SPK A;  1QKW A;  1Q81 R;  3WVE B;  3NGP A;  1YHQ T;  2CP5 A;  2VC8 A;  3CC4 A;  1PNJ A;  4Z89 A;  1K8A U;  4OMM A;  1YCS B;  5KYN A;  5GAM e;  1WHH A;  4ZGJ B;  5I22 A;  2LDM A;  1M30 A;  3DB3 A;  3HHT B;  1X6B A;  3CPW S;  3CC4 Q;  2M51 A;  2CT3 A;  2F5K A;  3OQ5 A;  2JTM A;  2OAW A;  1FMV A;  4ZN3 A;  1IO6 A;  1EIF A;  1AHJ B;  2L5Q A;  4N0A A;  4D6W A;  4PFZ A;  4IUQ A;  2KT1 A;  3V7C A;  1SHF A;  2SRC A;  3M0P A;  1NG2 A;  3QDR B;  2BE7 D;  5GAN 4;  1I4K 1;  4M7D B;  2M16 A;  2KAF A;  2PU9 B;  1W2B P;  2K2M A;  5DM7 R;  5LJ3 j;  1UGQ B;  1S72 A;  3R6N A;  2JTE A;  4HT8 A;  1SSF A;  1V1C A;  2O88 A;  5CK9 A;  4KGX B;  1VQK A;  3VRY A;  4MDX A;  2YLC A;  2EJ9 A;  3CCE A;  5LJ5 d;  3OW2 S;  3KUF A;  3EGU A;  1M90 R;  1X43 A;  4VUB A;  2KQW A;  2LT4 A;  1RAG B;  1SG5 A;  2X51 A;  3OYA A;  3LH0 A;  1QLY A;  2EQJ A;  2JMA A;  2L3S A;  2KRO A;  3GF5 A;  3RKX A;  3REB B;  3V7R A;  3QZ9 B;  2M9U A;  8ATC B;  1VQ5 Q;  5DLO A;  4M75 A;  5GAM d;  3M53 A;  2FVU A;  4CRI A;  2RB6 A;  1Q81 U;  4JJB A;  3OYK A;  1TH7 A;  2FL7 A;  2X3W D;  4GBQ A;  2EGA A;  1KQS S;  1K0S A;  2MI6 A;  4PKC C;  1NJI R;  3EH2 A;  1D0Y A;  2LX7 A;  3S3O A;  1PKT A;  2EQK A;  1G83 A;  1RAB B;  1ZA2 B;  1VQM Q;  3OYC A;  1UG1 A;  2B86 A;  1FWZ A;  3OS0 A;  4BUG A;  1UGV A;  5GAN j;  2HAX A;  3DKM A;  3I56 T;  1KD1 C;  4E47 A;  3OYE A;  2OTJ Q;  3CME T;  1J3T A;  5GMK i;  2RK2 A;  3OA6 A;  4V2S A;  4N4G A;  4OGC A;  2I2L A;  2E65 A;  2HEQ A;  3VV0 A;  1B34 A;  3A98 A;  2QA4 T;  3AT1 B;  3TVT A;  2CSI A;  1BI1 A;  1TOV A;  5I11 A;  2OJ2 A;  2YLB A;  3CCJ Q;  8AT1 B;  5GAN e;  1G3T A;  2Y4X A;  3CCS Q;  4E7I A;  1YI2 Q;  4OB2 B;  4YTL A;  1SSH A;  1WX6 A;  1WZO A;  5GAO n;  1IZ6 A;  4M7D C;  4R0K A;  1ZSZ B;  3LLR A;  3ME9 A;  5GAN 3;  3L1A A;  1NBE B;  4PNO A;  1G5V A;  4EDU A;  1W2B A;  2DET A;  4M7A F;  3CCV Q;  2E6N A;  3GNG A;  4M77 E;  1QW1 A;  5HKC A;  2L3Q A;  3JCM V;  2RQU A;  2X4X A;  3C0C A;  1EX4 A;  3CCJ T;  1UHC A;  3X25 B;  3HKS A;  3EGD A;  2DTH A;  1K73 C;  2QGF B;  1KQ1 A;  4PJO F;  3CD6 A;  3CCU A;  1K9M U;  1ARK A;  4AT1 B;  2QK0 A;  2RJC A;  1Q82 U;  2NUP B;  3JCM Q;  4Y91 A;  1ZSG A;  3PVL A;  4DBR A;  2LC4 A;  2LQK A;  3M57 A;  2VVK A;  2RNA A;  4E6R A;  3CC2 Q;  3L2U A;  3RBB B;  4A4F A;  4M75 G;  3ZL7 C;  1VQL Q;  3E9G A;  4X1V A;  2NWM A;  1JBM A;  2DL5 A;  4PL6 A;  5LJ3 e;  2ED1 A;  2KRS A;  3TEE A;  2SEM A;  3QUI A;  3OYH A;  2WAC A;  3P8D A;  4RTT A;  2R57 A;  5GAN f;  4A4K A;  2QQR A;  5FU6 B;  3X20 B;  5FLX E;  4JUV A;  1BU1 A;  2HD0 A;  4M7A C;  2ZPG B;  3H41 A;  5GMK m;  4EMK A;  3QKJ A;  2V8I A;  4FU6 A;  1OI1 A;  1VIF A;  2KYM A;  3GBQ A;  3REA B;  4RG8 A;  1BI0 A;  1YJN A;  5IAY A;  2P4T A;  3CD6 T;  1KC8 C;  2ENM A;  5KE2 A;  2HDA A;  2AHJ B;  1RAA B;  3SHW A;  2ATC B;  5CR2 A;  4C8Q A;  5KCO A;  4E7Z A;  3FC3 A;  1OX8 A;  1UHF A;  4ZGE B;  5L8R E;  4IUP A;  2RHZ A;  4XTX A;  4C8Q C;  4Y92 A;  2DA9 A;  1M2V B;  2VWF A;  1E6H A;  1GCQ C;  3EGX B;  1YWO A;  2E41 A;  1QVG P;  2CP0 A;  1C0M A;  1IGQ A;  1Z9Q A;  1YBY A;  4NS5 A;  3CCS T;  2CH4 W;  4F7U E;  4KBM B;  1HD3 A;  4RMO A;  4EMK C;  2LJ3 A;  1ZSZ C;  3BDU A;  1QKX A;  4M7A A;  1YP5 A;  3CCL T;  2C0I A;  4PLI A;  2LX9 A;  4HCK A;  3VYH B;  3L2Q A;  4M78 E;  2O01 E;  2K9G A;  1QQJ A;  4PJM A;  4J7I A;  4C0D B;  2RMO A;  4M77 B;  2YDL A;  5GAM g;  1QCF A;  1KQ2 A;  3OYD A;  1Y7X A;  5GMK h;  1JEG A;  1M2V A;  3MP8 A;  2LQ8 A;  4KH0 B;  3JCM X;  2E12 A;  3UA6 A;  1OOT A;  1V29 B;  4BY6 C;  3EFR A;  5KE3 A;  2QQ9 A;  2DXC A;  5A0L A;  3CCM Q;  1UEB A;  1N9R A;  2FB7 A;  3VS3 A;  2DO3 A;  4JDS A;  3OYL A;  2MWO A;  2DX1 A;  2KRN A;  1YIJ A;  1MHN A;  5I2M A;  2A08 A;  3KFV A;  2HCK A;  2K79 A;  1S72 T;  1VQ8 A;  1K0X A;  1VQP A;  2OTL A;  4DOV A;  2JTF A;  3AHU A;  3SWN C;  1TUG B;  2K3B A;  1GL5 A;  1QP3 A;  3GOX A;  1U06 A;  3X28 B;  2EYY A;  1XTD A;  1RAH B;  2HL3 A;  2YSQ A;  1KK7 A;  3O5Z A;  2J6K A;  2L8D A;  3HTR A;  1I5L A;  1IHV A;  4ORZ A;  2X9H A;  1MNE A;  5EC7 A;  2C0T A;  1Q86 C;  2NUT A;  3HFO A;  4IUR A;  1X01 A;  2CH4 A;  4FYX B;  3ULR B;  2IG0 A;  2XIC A;  3QPH A;  3CMA Q;  4EMH A;  1MGQ A;  2EJG A;  2MK5 A;  3V7S A;  1WQW A;  3A8L B;  2ZPI B;  2XI9 A;  2MYS A;  3G71 Q;  1C6V X;  3M0Q A;  3QZ5 B;  9ATC B;  3OYI A;  2DIG A;  3FJP A;  2DBK A;  3OMG A;  2RJE A;  3OS5 A;  4ZN1 A;  2P0Q A;  1YIT A;  2WSF E;  1M1K R;  2ED0 A;  2YRV A;  4C0G A;  4JLG A;  2QQS A;  1N6A A;  4FIB A;  5GMK l;  2RI2 A;  1AZE A;  3A1P A;  2RHX A;  3C95 A;  3VS1 A;  3UT1 A;  2DXU A;  2LMJ A;  2DZ9 A;  2O4X A;  5IXB A;  3LW5 E;  2HBP A;  2LZ6 B;  1RI9 A;  4RTZ A;  3S3N A;  3VS7 A;  4FM4 B;  4QVC A;  5J3B A;  5KH6 A;  1B3Q A;  1UDL A;  1NE8 A;  2JS0 A;  2KDS A;  5HY6 A;  5CQY A;  1B34 B;  2BZY A;  3M5A A;  3NTI A;  2GQI A;  2LCC A;  3PVQ A;  1LPL A;  2K57 A;  3M0T A;  1VQ4 A;  2K3Y A;  4X9C A;  1H3Z A;  4CI0 C;  1M1K C;  3RDV A;  4AFQ C;  2QDL A;  2OTL T;  5L23 A;  3J80 E;  1WDX A;  2J06 A;  3GP8 A;  1I0C A;  5CIU A;  5ECA A;  2GTJ A;  1VYV A;  1WJR A;  4HCZ A;  4LUE A;  4ATO A;  3E9F A;  4JJN K;  2LJ1 A;  4HXJ A;  4J9C A;  1MMN A;  1I07 A;  2HKN A;  3LH5 A;  2DFU A;  2QXF A;  2XKO C;  5GAO p;  5KYX A;  1LOJ A;  2E64 A;  4M75 B;  1YIJ Q;  2FPD A;  4AG2 C;  2V8J A;  1YJW Q;  2HBW A;  2LCS A;  3G4S Q;  2OI3 A;  4AFZ C;  1X6G A;  4HT9 A;  2E3I A;  2QQB A;  2D8J A;  2IVW A;  3V8J A;  4BI8 B;  4M7A D;  4J6X A;  4GLM A;  3I55 T;  1AZG B;  2F2W A;  1M8V A;  1X6O A;  2R5A A;  4RTW A;  3OW2 P;  3E1S A;  1FXX A;  5DY9 A;  2XDB A;  4D8K A;  1K76 A;  1HSQ A;  1VQN A;  2QTV A;  2FRW A;  4HVV A;  4IIO A;  4FCY A;  3NTK A;  2ZCF B;  4AG1 C;  1RAE B;  4C92 C;  3EFS A;  5CKB A;  4A4H A;  1ZBJ A;  2LNH B;  1NEB A;  3P8B B;  3JCM P;  2CZ1 B;  1VQK T;  2RPN A;  2K2V A;  3M0R A;  4KH1 B;  1BYM A;  2EIF A;  5AYF A;  1VOM A;  1T0J A;  1YHQ Q;  2IPO B;  4M7D G;  4LDX A;  2HL5 C;  4BDY A;  2PVO B;  4JZ4 A;  4XTZ A;  1OU8 A;  1OUL A;  2CZ0 B;  3V8L A;  3M0U A;  2KK4 A;  1OZ3 A;  4LNP A;  3C4S A;  3H0F A;  5I21 A;  2AK5 A;  4JJD A;  2BUD A;  3VJP A;  5GAN 8;  1QWE A;  3NTH A;  4DOW A;  3CC7 A;  3MEU A;  2VYT A;  1WXT A;  2W10 A;  1JQQ A;  3VS0 A;  5FRO A;  1U5S A;  2GCX A;  2D6F A;  3HPW A;  4FT2 A;  1VQM T;  3DLM A;  1CKB A;  1QVG S;  2RHI A;  3CBP A;  3CXC A;  3M56 A;  5CKE A;  5LJ3 d;  2FPE A;  2F5T X;  2FYK A;  4PJO G;  1R0B G;  3TCJ A;  1VQN T;  1Y0M A;  2A36 A;  2NUT B;  4FYW B;  4OB0 B;  1RI0 A;  1M8M A;  2DYB A;  3CPW A;  4F16 A;  3KBG A;  4OVA A;  5LJ5 j;  2ABL A;  1FYN A;  1U8R A;  3OYG A;  1RUW A;  2DK3 A;  4A63 B;  1QVF P;  1QVG A;  3SD4 A;  2M0Y A;  1N9S A;  4BD3 A;  1FX7 A;  1TUC A;  3OYJ A;  4IUV A;  4C5H A;  2LVM A;  4N4H A;  2KMT A;  4XTY A;  1JJ2 S;  4PJL A;  2GFU A;  3RMQ A;  1ABQ A;  5LJ3 h;  4O6J A;  1X75 C;  4BE1 A;  2WSC E;  4J9H A;  4OMF B;  4M77 D;  1GXI E;  3A8G B;  1W2B S;  5IH2 A;  2EYW A;  2PVG B;  1Z9Z A;  1H8K A;  1SHG A;  2JNG A;  4M78 A;  2PZ1 A;  4RTX A;  5D6Y A;  3RR6 A;  4PFP A;  3MEV A;  3DLL A;  1JXM A;  4WTO B;  4JRQ A;  5GAN d;  2RJF A;  1D1A A;  3EFO B;  4Z02 A;  2E10 A;  3CCQ T;  5GAO m;  3C12 A;  3DB4 A;  3M54 A;  2F2X A;  3OSS C;  2RM4 A;  4PK4 A;  3CCS A;  1K4U S;  3TSZ A;  1RAF B;  3FRN A;  2L0A A;  3JSC A;  2D0N A;  2BKD N;  1VQ9 T;  3MJX A;  2OTJ A;  1PSF A;  2FZC B;  1GFC A;  1MUZ A;  5J26 A;  4PFO A;  1OV3 A;  3ASK A;  3JCM h;  2FEI A;  2X4J A;  2DXB A;  2O2O A;  1YJ9 Q;  1G3Y A;  2COZ A;  1IXD A;  2PNI A;  3CBO A;  1VQM A;  5C6S A;  1VA7 A;  5KYU B;  4PLL A;  1VQL T;  3QSU A;  2O31 A;  2MF2 A;  5LJ3 f;  4FW1 A;  1EZZ B;  1VQ9 Q;  3OW2 A;  1ABO A;  1I1J A;  1KC8 R;  2A3L A;  1K73 R;  1VQ5 A;  1TTH B;  3IQL A;  1YCY A;  3M4G A;  1TWB A;  1T3L A;  1ZHI A;  1E7O A;  2D0Q B;  3BFM A;  2FPF A;  4RCC A;  2ZPF B;  2EYZ A;  4GY5 A;  2OAU A;  1ZLM A;  1WJS A;  4M78 G;  1ZSZ A;  3CCE Q;  2QTX A;  1VQ9 A;  2P0K A;  3G71 A;  2RA2 A;  1G2B A;  4EPC A;  5IHI A;  2RQV A;  4C8Q G;  4X9D A;  2B8A A;  1PCX A;  4XQ3 A;  4L6V 5;  2DER A;  3RKW A;  2K5I A;  2EBP A;  4RCB A;  2JJ9 A;  1YJ9 A;  2W0Z A;  3UAT A;  4ME7 A;  2AIR B;  1Q95 G;  4BY6 B;  1X2K A;  3I5R A;  4OMQ A;  5IHK A;  2NYS A;  4LN2 A;  2DE0 X;  3JB9 I;  2KT8 A;  3CPF A;  2L2P A;  4CC3 A;  1ZUU A;  1IGU A;  5LJ5 e;  4IUT A;  2VXE A;  1D3B A;  1TUD A;  3PTA A;  1KHI A;  1SF9 A;  3EGD B;  4OML A;  1OU9 A;  2HQH A;  4QW2 A;  1CKA A;  2OTL Q;  1VQP Q;  4RUG A;  1KQS P;  1VQ8 Q;  3RNJ A;  3FJ5 A;  4ELZ C;  2M0O A;  2YWW A;  4B9W A;  4F17 A;  2AZS A;  3RES A;  2EJF A;  2DVJ A;  2QI2 A;  1B7T A;  1RAI B;  4II1 A;  4NL3 A;  4UC4 A;  1H64 1;  1YI2 T;  1IRE B;  2KBT A;  2CRE A;  1Q82 R;  4QKU A;  4ESR A;  2JS2 A;  2VXF A;  3M4Y A;  5J39 A;  1XJW B;  4HVU A;  5D6W A;  4P5N A;  3MET A;  3PGG A;  4ZNX A;  2Y4Y A;  2CP7 A;  3CQT A;  4J8O A;  1M90 C;  3A8O B;  1YIJ T;  3URG A;  2LCL A;  3JCM d;  4C5G A;  3EG2 A;  1RL2 A;  1W1F A;  2PUK B;  2LT1 A;  2AKK A;  3GIB A;  4LD9 K;  5FRN A;  6AT1 B;  4M7D A;  1D1B A;  3MEW A;  1QP2 A;  2KR3 A;  1S1N A;  2K5L A;  4PJO D;  1DJ7 B;  3RIR A;  3H0H A;  1PG5 B;  1K73 U;  1UFF A;  2OTJ T;  1G3S A;  3E2U A;  3PFS A;  4E7K A;  3C94 A;  2HQE A;  1MND A;  4KT0 E;  1Q82 C;  2JMC A;  2KEA A;  3NHN A;  3JCM b;  3S3M A;  2DEU A;  1GFD A;  2CP6 A;  3PMI A;  1TSF A;  1X27 A;  4RTY A;  3G6E A;  1VQ4 T;  4F04 B;  1VQ7 A;  2DKG A;  3RUX A;  2RH2 A;  2G3R A;  2AZV A;  3L2R A;  1M3C A;  2DPP B;  4OMN A;  1TXQ A;  5KYW B;  3OMC A;  3SWN B;  4OP0 A;  1CSK A;  5GAO r;  5CKF A;  4K11 A;  4DBF A;  5IHN A;  3L2W A;  3BY7 A;  1VQO T;  3OY9 A;  3UPU A;  3CC7 Q;  3JCM e;  2CS7 A;  1H92 A;  1M27 C;  2R5M A;  2JM9 A;  4IIM A;  3MKD A;  4BI4 A;  4C8Q E;  3GLX A;  1F1B B;  2M1H A;  2DIL A;  3PMT A;  1AVZ C;  2JM8 A;  3VYG A;  1VQ5 T;  5KYU A;  1OYX A;  1KSW A;  3MO8 A;  2O9S A;  4J9G A;  4M75 C;  5CO7 A;  2DMO A;  5I2S A;  3JB9 G;  4ELY C;  1M5Q 1;  2GTO A;  2BZ8 A;  1YHQ A;  2K5F A;  4MZM A;  3CC4 T;  3QYG B; 
#chains in the Genus database with same CATH homology
 5CVI A;  5LJ5 d;  3NTK A;  2ZCF B;  3OW2 S;  3KUF A;  3WXM B;  5M9O A;  4C92 C;  3FLG A;  4VUB A;  2KQW A;  3EFS A;  2LT4 A;  5CKB A;  3OYA A;  3HRS A;  4A4H A;  3LH0 A;  5GAN 7;  2EQJ A;  3P8B B;  2MAM A;  2XDP A;  3JCM P;  2CZ1 B;  4M7A E;  1VQK T;  3GF5 A;  2K2V A;  3RKX A;  5LJ5 f;  3V7R A;  3QZ9 B;  4C0F A;  2M9U A;  2PVD B;  2QDY B;  1BYM A;  5DLO A;  2EIF A;  3QO3 A;  3FIF A;  5AYF A;  2GF7 A;  4M75 A;  5GAM d;  3M9Q A;  3MHX A;  3M53 A;  4M77 A;  4C0Z A;  2KY9 A;  4LDX A;  4M7D G;  4BDY A;  2PVO B;  1KG1 A;  2FVU A;  4XTZ A;  2MWP A;  2RB6 A;  4CRI A;  1Q81 U;  2F69 A;  5GMK j;  3OYK A;  1TH7 A;  2FL7 A;  1KQS S;  2MI6 A;  2CZ0 B;  2ZPH B;  4PKC C;  3V8L A;  3CCV A;  1G3W A;  3S3O A;  2EQK A;  3EAE A;  2KK4 A;  1OZ3 A;  3C4S A;  5I21 A;  2XU8 A;  3OYC A;  3CCU T;  3ER0 A;  1FWZ A;  1WPY A;  4M7A B;  4R56 A;  3OS0 A;  1YJW A;  4BUG A;  4XU2 A;  2RHY A;  4FSX A;  4RKU E;  4BB7 A;  4L5G A;  5GMK e;  3N5B B;  1PSE A;  4M7D E;  3CC2 T;  4M7D F;  5CKD A;  2BUD A;  3VJP A;  5GAN 8;  3FB9 A;  5GAN 5;  4M77 C;  5GAN j;  4HKE A;  2HAX A;  4TVR A;  4HA8 A;  3DKM A;  3OS2 A;  3NTH A;  4DOW A;  3CC7 A;  3I56 T;  2EQU A;  3MEU A;  1KD1 C;  2VYT A;  4E47 A;  3CCJ A;  4C8Q F;  3OYE A;  3CXC S;  4DA4 A;  3JCM W;  1N8R C;  4XTW A;  1UGR B;  2EKO A;  4B9X A;  3CME T;  5GMK i;  2RK2 A;  3OA6 A;  4BDZ A;  4V2S A;  4N4G A;  4OGC A;  4C92 G;  1W4S A;  2I2L A;  5FRO A;  2E65 A;  3VV0 A;  2GCX A;  4BI3 A;  1B34 A;  2QA4 T;  1VUB A;  2D6F A;  1BI1 A;  3HPW A;  4FT2 A;  4J7F A;  2YLB A;  4MDW A;  5IN1 A;  3TRE A;  4F7U A;  4QVD A;  1VQM T;  5GAN e;  3J81 E;  3DLM A;  1G3T A;  5C0M A;  2Y4X A;  2RHI A;  1QVG S;  2H3J A;  2GQV A;  3CBP A;  4A4G A;  3CXC A;  3M56 A;  3QYH B;  5CKE A;  4C8Q B;  4E7I A;  5HK3 A;  2RO0 A;  4OB2 B;  4YTL A;  4EMG A;  5LJ3 d;  2F5T X;  2DEQ A;  1M1F A;  5HK0 A;  2FYK A;  4PJO G;  5GAO n;  4ZTF A;  1IZ6 A;  1KD1 U;  4M7D C;  1N8R U;  3TCJ A;  3X26 B;  1VQN T;  4M77 G;  3LLR A;  3ME9 A;  4OB0 B;  2XID A;  3L1A A;  5GAN 3;  3BDL A;  1RI0 A;  4PNO A;  1LNX A;  3CCM A;  1G5V A;  4EDU A;  2D9T A;  3CPW A;  1JB0 E;  1W2B A;  2Y90 A;  4M7A F;  2E6N A;  2DXT A;  3GNG A;  4M77 E;  3KBG A;  3H8Z A;  1QW1 A;  3JRZ A;  4OVA A;  5HKC A;  1BIA A;  5LJ5 j;  1VQ8 T;  2L89 A;  4M78 C;  1I81 A;  4QVZ A;  3JCM V;  2X4X A;  3QJ6 A;  1U8R A;  3OYG A;  2DK3 A;  4E7L A;  1NPR A;  1NJI C;  1QVG A;  1XOV A;  3SD4 A;  3CCJ T;  2E6Z A;  3X25 B;  1N9S A;  3HKS A;  2DTH A;  3HSB A;  1P92 A;  1O9S A;  3QHS A;  1FX7 A;  4BD3 A;  1K73 C;  1KQ1 A;  3INZ A;  4PJO F;  3CCU A;  3CD6 A;  2EQM A;  3OYJ A;  4IUV A;  4C5H A;  2LVM A;  3A5Z B;  4N4H A;  1K9M U;  2KMT A;  4XTY A;  2BIV A;  2RJC A;  5D6X A;  4Q5W A;  1JJ2 S;  1ZQ1 A;  4M7A G;  4J6Y A;  2GFU A;  3RMQ A;  1Q82 U;  1BI2 A;  3JCM Q;  4Y91 A;  5LJ3 h;  4O6J A;  1X75 C;  3SB2 A;  4C0D C;  2WSC E;  4M75 E;  4OMF B;  4C8Q D;  4BE1 A;  1VQ7 T;  2LC4 A;  2LQK A;  4M77 D;  4Y28 E;  3M57 A;  4HCB A;  2E5Q A;  1GXI E;  3A8G B;  1JRI A;  3F70 A;  1W2B S;  3L2U A;  3HFN A;  4WF2 A;  3L42 A;  3QBY A;  4A4F A;  4XK8 E;  3OBY A;  4M75 G;  2PVG B;  5GAN 2;  1NJI U;  2A7Y A;  3L2V A;  2EYQ A;  2VUB A;  3E9G A;  3Q1J A;  3CCQ A;  2JNG A;  3H6Z A;  1JBM A;  3M58 A;  4M78 A;  5FU6 C;  4OB3 B;  5D6Y A;  3LGF A;  1UGP B;  4PL6 A;  3MEV A;  3SFM A;  5LJ3 e;  2DD5 A;  4EMK B;  4BE2 A;  4N4I A;  3TEE A;  3DLL A;  2FHD A;  3QUI A;  3OYH A;  2WAC A;  3JAM E;  3CMA A;  3P8D A;  1KQS A;  2R57 A;  5GAN f;  3QJY A;  4XU3 A;  1ZBX A;  4JRQ A;  2CZ6 B;  2DD4 A;  2RJF A;  2WSE E;  5GAN d;  3HP9 A;  4A4K A;  1D3B B;  3NFC A;  4Z02 A;  2QQR A;  2VGN A;  2E10 A;  5FU6 B;  5GAO m;  3CCQ T;  2JN0 A;  3X20 B;  5FLX E;  4JUV A;  4NL2 A;  3C12 A;  2HD0 A;  3DB4 A;  4JS4 A;  3M54 A;  4M7D D;  2ZPG B;  3CCR T;  3OSS C;  2RM4 A;  4M7A C;  5GMK m;  3MP1 A;  4ZGD B;  1WNL A;  3MCA B;  3OSV A;  2NLU A;  3ZFJ A;  4EMK A;  5GAN h;  2ZGW A;  3QKJ A;  2V8I A;  2XDD A;  4FU6 A;  3CCS A;  1OI1 A;  1VIF A;  2V8K A;  1VQ6 T;  4MZP A;  1NZ9 A;  2X4Y A;  5GAO q;  3JCM J;  4RG8 A;  1BI0 A;  3JB9 F;  1YJN A;  3FRN A;  3BW1 A;  1XNI A;  4KUI A;  5IAY A;  1QVF A;  3JSC A;  5A0D A;  4OB1 B;  2P4T A;  2BKD N;  3CD6 T;  4C5I A;  1Y71 A;  1KC8 C;  4OGE A;  5DLQ E;  1OZ2 A;  1I8F A;  2KVQ G;  5KE2 A;  4BE0 A;  1VQ9 T;  5FRM A;  2OTJ A;  2AHJ B;  1PSF A;  5CR2 A;  4C8Q A;  2RI5 A;  5J26 A;  2GFA A;  4XU0 A;  5KCO A;  4QQ6 A;  1XQH A;  1BIB A;  2EAY A;  3FC3 A;  3VUB A;  3E19 A;  4ZGE B;  5L8R E;  4IUP A;  2RHZ A;  3ASK A;  3JCM h;  4XTX A;  2C06 A;  4C8Q C;  2X4J A;  4RG2 A;  4BAC A;  3S3M A;  2DXB A;  3HRT A;  1G3Y A;  5LL6 S;  4LD6 A;  2E41 A;  3CBO A;  4IUU A;  3PIO A;  1VQM A;  4ZTJ A;  4C5E A;  2DIQ A;  5C6S A;  4A54 A;  1YBY A;  5LJ5 g;  1VQO A;  2DTO A;  3CCE T;  4NS5 A;  3CCS T;  3ZBD A;  1VQ6 A;  4PLL A;  4F7U E;  3HL8 A;  2CKK A;  3CBM A;  3J7A F;  1VQL T;  1M9S A;  3QSU A;  4KBM B;  4JRP A;  4RMO A;  1YIT T;  4EMK C;  2MF2 A;  5LJ3 f;  3CMA T;  1YJN T;  3OW2 A;  1VQL A;  4E7H A;  3BDU A;  1YJ9 T;  4M7A A;  2A3L A;  3L2Z A;  3CCL T;  1VQ5 A;  1YCY A;  4PJO E;  3M4G A;  4PLI A;  4A4E A;  1ZHI A;  2LX9 A;  3VYH B;  2KSS A;  3L2Q A;  2L3R A;  4OF1 A;  4M78 E;  3JCM f;  2O01 E;  4C92 E;  4M75 F;  3BFM A;  2D0Q B;  4E7J A;  2DZC A;  4J7I A;  4RCC A;  2ZPF B;  4M77 B;  4C0D B;  5GAM g;  3OS1 A;  4GY5 A;  4F7U F;  5A2Q E;  2OAU A;  4DQ2 A;  1WJS A;  2P0P A;  4M78 G;  2QTX A;  1KQ2 A;  3OYD A;  1Y7X A;  5GMK h;  3KXT A;  1VQ9 A;  2P0K A;  3OYB A;  4JS5 A;  4MMK A;  3LWH A;  3MP8 A;  2CZ7 B;  3G71 A;  4NOY A;  3JB9 H;  2RA2 A;  2VV5 A;  4EPC A;  5A0G A;  2LQ8 A;  1Y96 B;  4C8Q G;  3GNF B;  3O8V A;  3FEO A;  2B8A A;  1N27 A;  2E12 A;  4X9D A;  3S6W A;  3JCM X;  1V29 B;  3RER A;  4BY6 C;  3A8M B;  3EFR A;  5KE3 A;  2QQ9 A;  3P8H A;  2YHT A;  2DVE A;  4XQ3 A;  2DXC A;  5A0L A;  3OBW A;  4L6V 5;  2XD0 A;  1UEB A;  3RKW A;  1N9R A;  4M75 D;  4M77 F;  2FB7 A;  2DAQ A;  2K5I A;  4LDW A;  4RCB A;  3VU3 C;  4F7U G;  2DO3 A;  4JDS A;  3OYL A;  1YJ9 A;  3JCM g;  2MWO A;  2EWN A;  3PNW C;  1YIJ A;  1MHN A;  4J5Y A;  4ME7 A;  5I2M A;  3QG1 A;  3CCV T;  4JRK A;  4R55 A;  5IT9 E;  1VQP T;  4BY6 B;  2RHU A;  4KUD K;  1S72 T;  2E70 A;  2X4W A;  1VQ8 A;  2O4X B;  4LDU A;  5GAN g;  3JB9 I;  2JVV A;  1NPP A;  3CPF A;  4FL6 A;  1VQP A;  1Q81 C;  4DOV A;  2JTF A;  2OTL A;  5CCA A;  3RMS A;  2QEX T;  3AHU A;  3SWN C;  3WVD B;  3X24 B;  3CCR A;  3JB9 J;  1Q7Y C;  1QVF S;  3T9N A;  2RI3 A;  4PJO C;  2PQW A;  4O5V A;  5LJ5 e;  1YJW T;  4IUT A;  2VXE A;  1QP3 A;  3GOX A;  2K3X A;  1D3B A;  2RK1 A;  3PTA A;  1KHI A;  3MP6 A;  4QW2 A;  3X28 B;  1XTD A;  2RD1 A;  3LGL A;  3CCM T;  4PJO A;  3G71 T;  4LDV A;  3OYY A;  5FU7 B;  2L8D A;  3CME A;  1HXD A;  1I5L A;  4FT4 A;  4ELZ C;  1YHQ A;  1UGS B;  2RJD A;  4M78 B;  2M0O A;  1QVP A;  4B9W A;  2K4Y A;  3OYM A;  5GAM f;  3HRU A;  1Q86 C;  3RES A;  1HK9 A;  2EJF A;  1Q7Y U;  1WQ7 A;  2R58 A;  2QI2 A;  3HFO A;  1X01 A;  4IUR A;  2IG0 A;  4C92 F;  2XIC A;  4JRI A;  1O75 A;  3ZEH A;  3QPH A;  4II1 A;  4NL3 A;  3OYF A;  4EMH A;  5EG2 A;  4UC4 A;  3VKI A;  1MGQ A;  1H64 1;  1LJO A;  2EJG A;  3V7S A;  1YI2 T;  1WQW A;  3A8L B;  2LTO A;  2ZPI B;  1IRE B;  2CYZ B;  2XI9 A;  3M59 A;  3LX7 A;  4F7U B;  2E1H A;  2EFI A;  3OYN A;  3LYI A;  2QEX A;  2VXF A;  3M4Y A;  5J39 A;  3UWN A;  2XG8 D;  3G4S T;  3GPL A;  3QZ5 B;  2XK0 A;  5D6W A;  4P5N A;  4N0A C;  3MET A;  3OB9 A;  4XTV A;  4C92 B;  3PGG A;  5FU7 C;  2JOY A;  3G7Z A;  3OYI A;  3CC2 A;  2DIG A;  2Y4Y A;  3FJP A;  1Q86 U;  4J8O A;  3OMG A;  4ZN1 A;  2RJE A;  3A8O B;  3OS5 A;  2P0Q A;  2HQX A;  2WSF E;  1YIJ T;  3URG A;  5GAN 6;  2LCL A;  3JCM d;  3CCL A;  4C5G A;  2YRV A;  3LWI A;  5GAM j;  4PJO B;  2LNV A;  1RL2 A;  4C0G A;  4M78 F;  4JLG A;  3TU4 K;  2QQS A;  3JCM c;  1N6A A;  4FIB A;  2PUK B;  5GMK l;  2LT1 A;  2RI2 A;  1U1S A;  3GIB A;  3QXE B;  1R8O B;  4HCC A;  4GLK A;  2LRQ A;  1YIT A;  4LD9 K;  4LDY A;  5FRN A;  4M7D A;  2RHX A;  3C95 A;  3MEW A;  1QP2 A;  1VIE A;  3UT1 A;  2DXU A;  2K5L A;  2DJZ A;  4PJO D;  1DJ7 B;  2ZPE B;  3RIR A;  2DZ9 A;  1K73 U;  2OTJ T;  2O4X A;  1WGS A;  3LW5 E;  1G3S A;  3PFS A;  4L59 A;  2HBP A;  4E7K A;  2X35 A;  3C94 A;  3S3N A;  2HQE A;  5CQX A;  1M90 C;  4XTU A;  1K9M C;  5CKH A;  4FM4 B;  4QVC A;  5J3B A;  4KT0 E;  3UDC A;  1M90 U;  1Q82 C;  5KH6 A;  4QQD A;  2JZ2 A;  4XAX B;  1Y07 A;  3CC7 T;  2PUO B;  2ZPB B;  3A8H B;  1NE8 A;  4M78 D;  2KDS A;  5CQY A;  1B34 B;  5HY6 A;  4C92 A;  3M5A A;  3NTI A;  3JCM b;  2LCC A;  3G4S A;  5KCH A;  2K57 A;  5GAO l;  4A53 A;  3SWN A;  5GAM h;  3SDZ A;  4IKF A;  4MML A;  4C92 D;  1VQ4 A;  2HNI A;  3PMI A;  2K3Y A;  4X9C A;  1H3Z A;  2XHC A;  2ZZD A;  3PIP A;  1JJ2 A;  4CI0 C;  3V8K A;  1M1K C;  2JUF A;  3I56 A;  1UB4 A;  3G6E A;  1VQ4 T;  1YI2 A;  1Y96 A;  2CGH A;  3I55 A;  1VQ7 A;  2DKG A;  3RUX A;  3FDR A;  5LJ3 g;  2RH2 A;  2G3R A;  2VGM A;  5LJ5 h;  3WVE B;  3L2R A;  2DPP B;  3G6E T;  1YHQ T;  4KUL A;  2VC8 A;  1M1G A;  3CC4 A;  4J83 A;  3OMC A;  1K8A U;  4J6W A;  2OTL T;  4MZT A;  3SWN B;  4OP0 A;  3R6O A;  5GAM e;  3J80 E;  3GP8 A;  5GAO r;  4ZGJ B;  5CIU A;  5CKF A;  2LDM A;  4JLI A;  3DB3 A;  1WJR A;  3HHT B;  3L2W A;  4HCZ A;  3CPW S;  4ATO A;  3E9F A;  1U1T A;  3BY7 A;  2F5K A;  4JJN K;  1VQO T;  3OY9 A;  3UPU A;  3OQ5 A;  3JCM e;  2CS7 A;  2JTM A;  2DTI A;  2QXF A;  4ZN3 A;  2XKO C;  1M1K U;  1EIF A;  1AHJ B;  2L5Q A;  4N0A A;  1M4Z A;  5GAO p;  4D6W A;  2R5M A;  2QQA A;  4IUQ A;  1LOJ A;  2E64 A;  4M75 B;  3V7C A;  1BKB A;  3CEY A;  3QDR B;  5GAN 4;  2V8J A;  4BI4 A;  1KHC A;  4C8Q E;  1I4K 1;  3GLX A;  3QII A;  5CAI A;  2M16 A;  4M7D B;  2M1H A;  1K8A C;  4HT9 A;  2KAF A;  2PU9 B;  3VUZ A;  1KC8 U;  3PMT A;  3RKY A;  5DM7 R;  3VYG A;  2QQB A;  2IVW A;  3V8J A;  4BI8 B;  3MEA A;  5LJ3 j;  1UGQ B;  3M55 A;  4J6X A;  1S72 A;  1OYX A;  1VQ5 T;  2MMP A;  4M7A D;  1WJQ A;  3I55 T;  3MO8 A;  4M75 C;  4HT8 A;  5CO7 A;  5I2S A;  3JB9 G;  4ELY C;  1M5Q 1;  1SSF A;  1M8V A;  1X6O A;  2R5A A;  5CK9 A;  4QQG A;  2K5F A;  1BI3 A;  3E1S A;  4MZM A;  1FXX A;  4XU1 A;  5DY9 A;  3CC4 T;  3JB9 D;  1VQK A;  2XDB A;  2QA4 A;  1VQN A;  4X34 A;  4MDX A;  2YLC A;  2EJ9 A;  3QYG B;  3PT9 A;  3CCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...