4M7DA

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
ATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 65
sequence length 65
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dA00
1LNXA 5GAN6 1WQWA 5LJ5h 1I8FA 3BDUA 3VU3C 4A54A 5CAIA 5I21A 4Y91A 4EMKC 5LJ5d 2DZ9A 4C8QB 4M77B 2EAYA 3EFRA 3JCMh 5GAMh 3JB9G 5GMKm 5LJ5g 4XTZA 4M78G 3V8JA 5GAMf 3JCMd 3HFOA 5LJ3h 4M75F 4C8QA 4C8QE 4M77A 4M77E 3SWNC 4HA8A 4M75C 3JCMV 4DQ2A 5GAN5 5GAOl 3AHUA 1BIBA 4OP0A 5GAMg 4PJOB 5LJ3d 5LJ5e 3QUIA 4M7AG 3V7SA 1U1SA 4A53A 1HXDA 4JRIA 2EJGA 2EJ9A 2QTXA 4M75D 4C92C 4PJOD 1D3BB 3QSUA 2DTIA 1M8VA 3FB9A 1B34B 5GAMe 3JCMQ 2JN0A 5GMKl 1M5Q1 3BW1A 3RKXA 1I81A 5GAN7 5GMKh 2EJFA 2YHTA 4M78B 4XU3A 4HT9A 2E64A 2DXTA 3QHSA 1B34A 4M7DB 4HT8A 3JB9J 4M77F 3FIFA 4WF2A 2DVEA 4M7AB 4XU1A 4M78E 4M78A 3JB9H 2VXEA 4M7DA 1BIAA 4M7DE 4RCBA 4JLIA 1U1TA 4C8QD 4M77D 4M7AA 4M7AE 2HNIA 4MMKA 5GAMd 4XTXA 4PJOF 3RUXA 5GMKe 5GANj 4PJOC 4NOYA 5DY9A 1N9RA 3HSBA 1LJOA 3FJPA 4EMHA 2E41A 5GAOr 4XQ3A 2FB7A 2VXFA 4M75G 1HK9A 3JB9F 4X9DA 1WPYA 4XU0A 3RIRA 4F7UG 5GAOp 3V7RA 4M78F 1LOJA 4C92G 5LJ5j 4M7DF 4N0AA 4QVDA 2DKGA 4EMKB 3JB9D 2RD1A 4M7AF 5GAOq 4C8QF 4M78D 4C8QC 5GAMj 4M77C 4RCCA 1TH7A 4XTUA 4NL3A 3RESA 4JUVA 4EMKA 1I5LA 4M7DD 1JBMA 4EMGA 3SWNB 5GAOn 4M7AD 2EWNA 4JRKA 5LJ3j 3L2ZA 4J6WA 4J6YA 2CGHA 3INZA 4F7UB 3JB9I 3V8KA 1KQ2A 4MMLA 3JCMX 2ZGWA 5GANf 2FYKA 3SB2A 4C92B 4J5YA 3SWNA 3EFSA 1X01A 2E10A 2E65A 2DTOA 4M75E 4M75A 1WQ7A 1Y96A 4F7UA 4F7UE 3BY7A 3M4GA 5GANg 4J6XA 5GAOm 2E1HA 2RB6A 4N0AC 4X9CA 3JCMW 4C92E 4PJOG 4C92A 2DZCA 4XTVA 3JCMP 3BFMA 4V2SA 3JCMc 1WNLA 3RKWA 5GMKj 4M7DG 2YLCA 4NL2A 4XTYA 5GANe 4M78C 1JRIA 4QVCA 5LJ5f 1KQ1A 3RERA 3HFNA 4M7DC 1N9SA 2DEQA 4PNOA 5GAN2 3V7CA 1I4K1 2I2LA 3L1AA 2DJZA 2DTHA 3JCMf 4M7AC 3GIBA 2Y90A 4XTWA 5GAN3 4F7UF 4XU2A 3JCMg 2K57A 4M75B 5LJ3f 5GANh 1Y96B 4C8QG 2RA2A 4C92F 5GAN4 4M77G 5GMKi 3JCMb 1YCYA 2YLBA 5LJ3g 3PGGA 5GANd 1MGQA 2DXUA 3RKYA 3JCMe 4PJOA 4PJOE 2VC8A 4C92D 3V8LA 3JCMJ 5GAN8 1H641 1D3BA 3QO3A 5LJ3e 2RM4A
chains in the Genus database with same CATH superfamily
5DLQE 1M2VA 2WSCE 3EGXA 1VQ8T 2ZAEA 3VS4A 5LL6S 1M4ZA 3JB9G 1JU5C 2P4TA 1VQLA 4BDZA 4M78G 2L5QA 2EKOA 5GAN5 2HZYA 1N27A 2JT4A 1Q82U 2DIGA 3R6NA 1IO6A 1HJDA 2FPFA 4GBQA 1QCNA 4P5NA 3CCMA 3LGLA 1C6VX 2ZPFB 1C1AA 1A0NB 2E64A 2HAXA 3QHSA 4BDYA 3OYMA 1SHGA 3MEVA 5L23A 4M78E 4LDWA 2RQWA 1AWXA 1PHTA 2RMOA 1GCQC 1ZX6A 4PJOC 2HL5C 4F17A 1D1BA 1LJOA 3PE0A 4EMHA 4FW1A 1VQ8A 5CKHA 4OB1B 1B7TA 3CCMQ 2D0NA 1YJNQ 2AT1B 4QVDA 2C0IA 3MEWA 3OB9A 2YSQA 1RLQC 3TEEA 1HD3A 4PJMA 2LJ1A 5CVIA 5L8RE 1PD0A 2GFAA 5EG2A 5KYUA 2LQ8A 4KBMB 3G4SQ 2K3XA 1VQ4T 2E1HA 2CH4W 1WJQA 1WHGA 2LP5A 2P84A 2CP3A 3ZBDA 5HY6A 1K0SA 2MI6A 3EGDA 1KD1U 3QYHB 2EQJA 3VUZA 1MUZA 2FEIA 2DL5A 2O4XB 1G3SA 2XG8D 2CSIA 3RNJA 2SRCA 1ABQA 3KBGA 4HCKA 2VC8A 1WDXA 3SD4A 3OYCA 1AWJA 4MDWA 4A54A 3WVEB 4BI3A 2OJ2A 4Y91A 3LYIA 1IXDA 2EAYA 1VQ4A 3A5ZB 2I0NA 1KQ2A 2Z0WA 1N6AA 1TTHB 3ASKA 1WJSA 3JAME 2QTXA 2V1RA 5FU6B 2C0TA 1NPPA 5KYYB 5GAN7 3UA7A 3J7AF 3M0PA 4FYXB 4JRPA 4M7AB 5J3BA 3OS0A 4Y92A 3A8HB 4N4GA 2F5KA 4XTXA 4KH1B 2OAWA 4EDUA 3THKA 5FWBA 1GRIA 4OMPA 4E47A 4PK4A 2RQTA 1Y07A 1H3ZA 2K6DA 2OTJT 3SFMA 2DNUA 2EGAA 1FYNA 4A4HA 3CCUT 2EKHA 2QGGA 2FVUA 1NYFA 5GANf 2GTOA 4HKEA 3SB2A 3CPWA 1Q81C 3G6ET 5GANg 2K79A 4JJNK 4X9CA 1KC8C 2DBMA 4F14A 1ZBXA 3ZFJA 3OMGA 4LDUA 2X51A 4M78C 5LJ5f 3HFNA 4OMQA 2BIVA 4CC2A 1U8RA 1OEBA 2V26A 2EBPA 1RABB 1OULA 3MHXA 2GNCA 4PFPA 1UGSB 1X2QA 1MMDA 2CUDA 2E12A 2OTJA 4E7JA 1TS9A 1YN8A 1R0CB 2J7IA 3CCUA 1G3WA 2VGNA 1OI1A 1OPKA 3O5ZA 1YI2Q 4EMKC 3EG9A 5DM7R 2KXCA 4M77B 2ATCB 3G6EA 2C0OA 3J80E 1WXUA 2QQRA 2HKNA 1OU9A 2CKKA 4L6V5 5FU7B 1MNDA 2JZ2A 4M7AG 1T3SA 1TSFA 5FRMA 4RTTA 2QK0A 1PRLC 2QTVA 2O2OA 4PLIA 3JCMQ 2JN0A 1KIKA 2EJFA 1X2KA 1YWPA 2DX1A 1M90C 3JB9H 3EGUA 1W2BP 2E3HA 2E6NA 2ROLA 4A4FA 4C0DB 3OYAA 4M7AE 1GXIE 1TU0B 5GMKe 3CCJT 2JM9A 2QA4Q 4XQ3A 1VQPT 4OMOA 1FMVA 2LQNA 2PVDB 2VWFA 5GJWB 4JPBW 1W2BS 4C8QF 1RAIB 2PVGB 3LX7A 3M57A 2KXDA 2D1XA 1Q7YR 3SWNB 2A28A 3QPHA 1WA7A 1VUBA 4J8OA 4C92B 1YITT 5KYWB 3BE3A 3ER0A 3BY7A 3GPLA 5KCHA 2DEUA 1QKWA 4N0AC 2KRMA 2O9VA 4J9IA 2E5KA 3CCST 4QVCA 2BTTA 3CCJA 3H41A 2DMOA 1ZSZA 1EZZB 1GFDA 3OYEA 4PFZA 2JTFA 4KT0E 1VQPA 2HL3A 4DBFA 3GOXA 4M77G 3L42A 1S72Q 2RHIA 4ZTFA 4OMFB 1YWOA 5D6WA 2O01E 5KYXA 1H641 2HQXA 1GCPA 3NMZC 1VQKQ 3A8MB 3TSWA 2EYZA 2X35A 5GAMh 3VKIA 1RI0A 1VQ9T 1Q7YU 4M77E 1VQ7A 2VGMA 3CCSA 2RQUA 4PJOB 1WHJA 5FWCA 2CP2A 1B3QA 2RJFA 2A7YA 2R58A 4J7FA 3CC7T 4B9WA 4LUDA 1ZBJA 1UJ0A 4JJBA 2NYSA 3LLRA 2EQMA 2DXTA 2A0FB 3FJ5A 4FIBA 3TSZA 4AMCA 3CMEQ 4WF2A 4XU1A 2A08A 2LNHB 2X4WA 3OYIA 2EYQA 1VQ7Q 1X6OA 1M1KC 2YDLA 2LJ0A 1I1JA 4Q5WA 1VQ9A 5GAOp 3VRYA 3X24B 1OX8A 1LOJA 4C92G 4OMNA 2XU8A 3HP9A 4ZGEB 3L2QA 2QYZA 3VJPA 2P0KA 1OZ2A 2LRQA 3EG2A 5J26A 5GAMj 4RCCA 2DETA 4CI0C 2EQIA 1I5LA 3TCJA 2F5TX 3OBYA 2CT3A 1GBQA 4J9DA 1D09B 2E65A 2DTOA 4F7UA 3M4GA 1QCFA 3JCMW 4C92E 1JJ2A 1NJIR 4XTVA 4IUTA 3EAEA 3I55T 1KD1C 2RHUA 2V8KA 3NTKA 1M1FA 1PRMC 1S1NA 4LDYA 2I2LA 3UWNA 4M7AC 3GIBA 1SEMA 2DRMA 2DPPB 2K2MA 5GAN3 2JXBA 1QCOA 1D0ZA 5GANh 5CKEA 2XIDA 5GANd 1XNIA 3CD6T 5GAN8 4RG2A 5LJ5h 3G71T 2M02A 1I8FA 1X69A 4C0FA 5LJ5d 2RI5A 4C8QB 2XDDA 3MPUB 2ECZA 1EFNA 3OYGA 2K5LA 4IKFA 1G83A 3JCMV 4BY6B 4DQ2A 1QVGA 3QDFA 1MMGA 1K4US 1ABOA 3I55A 4IUQA 1QKXA 1IGUA 3BDLA 1SRLA 3FB9A 4R0KA 1QVFA 2RI3A 1VYUA 1NJIU 4WTOB 3H0FA 3MP8A 1B34A 3CXCA 4M7DB 1PCXA 1PNJA 3FIFA 2EIFA 4II1A 4DBRA 3OYJA 3VS5A 5CQXA 3CD6A 3TVTA 1G2BA 2L2PA 2XD0A 5GANj 1Z9ZA 3G71A 3I55Q 3CPWP 4OGEA 4FT2A 3VS3A 2LCLA 1BK2A 3QWYA 1HK9A 4C0GA 1AWWA 3V7RA 4LD9K 2J6KA 1GL5A 5LJ5j 4JLGA 2DKGA 4VUBA 1QP3A 5GAOq 2OTLT 4DEXA 1M2OA 4M77C 2RPNA 3I9QA 1LPLA 2CGHA 5FU7C 3G71Q 2ED1A 4CC3A 2L89A 3JCMP 1T0JA 1IZ6A 3REAB 2A36A 2DAQA 5GANe 2J05A 2OI3A 4XK8E 3VS1A 1RUWA 2Y90A 4MDXA 3VUBA 2CT4A 1XQHA 1Y96B 2L8DA 4C8QG 2LT1A 1GCQA 2YLBA 1YNZA 4QQ6A 3CQTA 1ZHIA 4PJOA 2OTLA 2QEXQ 5IXBA 1K9MR 2PUKB 2MMPA 1NM7A 3ZL7C 2FZKB 2RNAA 3BDUA 9ATCB 2VVKA 1UB4A 1WJRA 1RADB 4HCZA 5FW9A 4FYVB 3OW2A 1O75A 2GTJA 2HSEB 4C8QE 4M75F 4M7DG 3I56T 5GAOl 3SWNC 2PU9B 2VV5A 1SRMA 3V7SA 2J6FA 1UGRB 4D8DA 4AG1C 4C92C 1WFWA 1U3OA 3QSUA 1IB8A 2CDTA 3OYBA 1LVKA 1PSEA 2BE7D 2VASA 4FCYA 4M7DE 5CKDA 4RTYA 4MZMA 1MV0B 2NUPB 2EGCA 3QKJA 5DY9A 3H8ZA 3HSBA 3X28B 2QGFB 3EH1A 1K9MU 3RIRA 2OAUA 4E7KA 2F2VA 2F1LA 1KHIA 2K7AA 3I56A 2K9GA 4QQDA 1ZUYA 1D0XA 3FRNA 1Y71A 3RESA 1M30A 3CCVA 1VQLQ 4FSSA 2COZA 1WHLA 1X6BA 2CZ7B 5D6XA 2XKOC 1BU1A 1G5VA 1AZEA 3QZ5B 2NUTA 3C12A 1MNEA 2D9TA 1D1CA 1VQ5T 4CC7A 3OS1A 3EFOB 2ZPEB 3REBB 2ROTA 2QG9B 1HYOA 1NLPC 2IVWA 3CCVQ 4F7UF 2Y4YA 2JOYA 1W70A 4ZN3A 3HHTB 1M8MA 2KR3A 2GFUA 4RTXA 2LX7A 4ELZC 4E7ZA 1VQ6T 3FEOA 2E70A 1VQ8Q 4RTZA 3QO3A 4AFZC 2JJ9A 1VQMT 1FXXA 4GY5A 2AKLA 2LJ3A 1AWOA 2BZXA 2D8JA 1Q7YC 1BCOA 1WZOA 4QT7A 3OYHA 4XTZA 3HL8A 5GAMf 2DXCA 8ATCB 2XK0A 4E7HA 3MEUA 5CKBA 3CCRT 1BIBA 5GAMg 1NBEB 1VQ5A 1X75C 1H92A 2JVVA 2DF6A 1G3TA 4M75D 2FG0A 2E6ZA 1QP2A 4J9EA 3NFCA 2XICA 1YHQT 4JS4A 2DD5A 2X4JA 4M78A 1VQ6A 1AEYA 4BI4A 2QI2A 2RN8A 1UEBA 1PSFA 3M9QA 2DM1A 1VQMA 1RAFB 4YTLA 2WACA 5CO7A 2JS2A 2R5MA 2MAMA 4BB7A 3I35A 1WPYA 1JJ2P 2O31A 2YRDA 3E9GA 3OSSC 5DLOA 3EG1A 5CCAA 3A8OB 4C8QC 1VQ6Q 2B8AA 4EMKA 5IXFA 4BD3A 1VQ4Q 1ZUUA 2DFUA 5IN1A 4BY6C 2XHCA 1MMNA 2FL7A 1YHQA 2X9HA 4QQGA 3PIOA 1Y96A 5FLXE 3MCAB 1JJ2S 4J83A 1E6HA 4ME7A 2K4YA 2L3RA 2RJDA 3CBMA 2L0AA 1VIEA 2BKDN 3ME9A 4AFQC 1RAGB 3S3MA 2YLCA 2D8HA 1OQKA 4M7DC 2EQKA 3VYHB 2M9UA 2ENMA 5GAN2 2DTHA 1SPKA 1QQJA 4XU2A 3J81E 5LJ3f 1QVGP 2DJQA 5LJ3g 2DA9A 3JCMJ 1QVFP 2RHYA 1UTIA 3CXCP 2HEQA 3QXEB 2KRSA 2AIRB 5I22A 4CC4B 1OPLA 5LJ5g 3OYFA 1QVGS 2MWOA 3PNWC 3CCQT 1TXQA 1VOMA 2MYSA 1IHWA 2EJ9A 2MPXC 1D3BB 1QVFS 5A0GA 5J39A 4RMOA 1K73C 2KI7A 3CXCS 1QMCA 4FW2A 3EHRA 3GNFB 1R8OB 1N8RC 2R57A 2FRYA 2O9SA 2ZPGB 1U1TA 1BCMA 1F1BB 3RR6A 2CP7A 2ED0A 3LW5E 2OTJQ 4M75G 4KUDK 2DD4A 2KMTA 4ATOA 4KULA 2M0OA 1BBZA 3CCUQ 3CCQA 1K76A 2D0QB 2DLPA 1AVZC 2AK5A 4RG8A 4XTUA 5CIUA 1RACB 3G6EQ 4EMGA 4IUVA 3MKDA 3JB9I 3OYKA 4KH0B 4J5YA 3EFSA 4M75E 3GBQA 1YJ9T 3HRTA 4J6XA 1HSQA 2M16A 3BFMA 4XTYA 1K8AR 3UA6A 1X6GA 3CCQQ 2QQAA 1YFNA 2RK1A 1VYTA 1RAHB 4B6MA 4A4GA 1V1CA 3OW2P 1N5ZA 4ZN1A 1SSFA 2BZYA 2IIMA 4L5GA 2FPDA 2Y4XA 2O4XA 3CBOA 5AYFA 2A3LA 3C4SA 2KDSA 4LD6A 2K5IA 1NYGA 2LCSA 1T3LA 3VU3C 1BI0A 3EG0A 3C0CA 1UDLA 3HKSA 2AZSA 3OW2S 1YJ9A 1JEGA 1WHHA 2H3JA 1GFCA 4NS5A 4OP0A 1K0XA 4A4KA 1OV3A 1HXDA 2ZCFB 2EJGA 4PJOD 1P92A 3OYDA 2KGTA 4J9HA 4XU3A 1K8AU 2LCCA 4KUIA 2EYXA 1MV3A 4ZGJB 5KYYA 4BE0A 1JXOA 3CCJQ 1YITA 1KK7A 2PVOB 5A0LA 1YJ9Q 4GLKA 1JO8A 3X25B 1VQNT 3WVDB 5GAMd 4M7AA 4C0ZA 1M9SA 2GGRA 1Q82C 1VQPQ 4R56A 1N9RA 3RMSA 3CC4T 2KROA 4QW2A 3VV0A 3JB9F 4X9DA 1Y7XA 4M78F 1H3HA 2COYA 4PKCC 4HCCA 1C0MA 2HD0A 1KSWA 2F2XA 1PG5B 4AFUC 4JUVA 1YITQ 3GNGA 2GBQA 5M9OA 1TUCA 3NPFA 2EW3A 3JCMX 4X34A 3CCSQ 1ZUKA 2FPEA 2KY9A 2CP6A 1RAAB 2H3EB 2ESWA 3OY9A 3VRZA 1RI9A 3I5SA 1I4K1 5A0DA 3LH0A 3CC7A 1NPRA 2EYWA 3OSVA 5GMKi 1KQSA 1X43A 2ZZDA 1AHJB 2P4RA 2XDPA 3P8BB 1M2VB 2COWA 3EGXB 1D3BA 2P0PA 2V8IA 1KC8R 1VQ9Q 2CZ0B 2PTKA 3HRUA 3UT1A 2CYZB 3M58A 5C6SA 4EIKA 4KGVB 4C5HA 5GMKm 3CC2T 3LH5A 3CC7Q 5LJ3h 4M77A 4RUGA 4M75C 1T0HA 5LJ3d 4X1VA 2R5AA 1QWFA 1KHCA 3JV3A 5GAMe 3VS2A 2LT4A 3X26B 4JS5A 4UC4A 3EHQA 1CSKA 2BE9B 1R77A 5IAYA 2MIOA 2DRKA 5AT1B 3ULRB 4D6WA 4RCBA 3QYGB 2HNIA 3L2VA 3G7ZA 1XTDA 5HK3A 5GJVB 3UPUA 3RDVA 3FJPA 1AOJA 2FB7A 1ZQ1A 2W0ZA 3CC2A 1KC8U 4C5IA 1FX7A 4J9BA 3JB9D 1D0YA 3T9NA 3UDCA 4M78D 2V8JA 4NL3A 4IIMA 3CEYA 2A37A 4DBQA 5KYUB 2KT1A 1M90R 5GAOn 5LJ3j 4LN2A 4LDVA 3V8KA 1I07A 4PJJA 4QVZA 3PVLA 3A1PA 3SWNA 3LWIA 3E19A 4C92A 3EGDB 3M5AA 5KYWA 2DXBA 4O6JA 3G1JA 2XI9A 1BKBA 2G6FX 5FROA 1M27C 2DEQA 3V7CA 2AKKA 3JCMf 6AT1B 1QWEA 3JCMg 2C06A 3CD6Q 2EYYA 4IUPA 1RAEB 1I0CA 3CPWS 4N4HA 3CCLT 3PGGA 1KG1A 3P8DA 2CP5A 4HVWA 5IHIA 5LJ3e 2K5FA 1UECA 2RM4A 1D1AA 2RQVA 4WCIA 3DB4A 1NLOC 8AT1B 3LGFA 2FZCB 2DE0X 3V8JA 4Z8AA 4FM4B 1W6XA 1YJWT 4EPCA 5LJ5e 5HCKA 1XOVA 4FT4A 2L3PA 5A2QE 2X4YA 4R55A 2GQIA 2SEMA 3E1SA 3R6OA 4HT8A 3L2RA 3EH2A 5IHNA 3UATA 3CCLA 1G8XA 2KQWA 5D6YA 1PD1A 2XMFA 2VXEA 1BIAA 4JLIA 3PMTA 2YT6A 3RUXA 2X3WD 3O8VA 3DLLA 1DJ7B 1PM3A 3DKMA 2CZ6B 4XU0A 2OTLQ 2YUQA 1U06A 2RHZA 2DYBA 1VQOT 1GBRA 3OA6A 1YJWA 1OX9A 4M7AF 3QDRB 3HTRA 3NTHA 3CCMT 1TH7A 1YJNT 1AT1B 4AFSC 3FC3A 4OB2B 1FMKA 1M1KR 4OMLA 4MZTA 4DOVA 2HBPA 3M59A 3PIPA 1BB9A 2HBWA 2QAZA 1KJWA 3G4ST 3RERA 3RBBB 1YJWQ 2EVRA 3L1AA 4E7SA 1H8KA 3C94A 1VQOA 5GAN4 2RA2A 4BE1A 4HVVA 5D7UA 2KRNA 4E2FB 3Q1JA 2QQBA 2MWPA 1YJNA 1WXBA 2HCKA 3VYGA 2LX9A 3EG9B 1LNXA 5GAN6 5IT9E 1MMAA 4Z88A 3I56Q 2QXFA 5I21A 2X3XD 1QW1A 2DZ9A 2PUOB 3GF5A 1KD1R 4ZTJA 2JTEA 2DK3A 3HFOA 4C8QA 2YUNA 4L59A 2O88A 4J9FA 2MF2A 3H6ZA 4JJDA 1VQOQ 3G4SA 1M3AA 1Q86R 4Z02A 1M1KU 3CMAT 4KGZB 1K8AC 3CPFA 3M0TA 4C5EA 4HT9A 2LC4A 3NTIA 4XAXB 3RMQA 4RKUE 3OS5A 2DILA 3JB9J 4M77F 1NG2A 2L3QA 4M7DA 4OB0B 3H9NA 2L3SA 2H8HA 2JUFA 1VA7A 1WI7A 3JRZA 4PFOA 4BE2A 3CCET 3META 3A98A 4GLMA 2VXFA 1NEBA 2DIQA 4OGCA 3H0HA 2RD1A 2EPDA 5I11A 2AZVA 2CP0A 3OMCA 3CMAA 2CSQA 4E7IA 1BYMA 2LMJA 2E5QA 2DERA 1ZA2B 4M7AD 2EWNA 2JTMA 4J6YA 3A8GB 2JMAA 3HPWA 1U5SA 1VYVA 1KQSP 2DBKA 2FRWA 1Q86U 1VQ5Q 1PC0A 1QVPA 1UGQB 2RB6A 2DZCA 2QDLA 2F2WA 1ZSZB 2KE9A 4PJLA 4ESRA 3CCRA 3CCEA 1N9SA 1YCSB 2J06A 4PNOA 3PVQA 3E2UA 3JSCA 3CMAQ 4JRQA 1OU8A 4M75B 1KQSS 5ECAA 4C92F 2LNVA 5KYXB 1VQMQ 2YWWA 3RKYA 4DA4A 1E6GA 3OYYA 3V8LA 3M54A 1CKBA 2G3RA 2KBTA 4LUEA 4N4IA 4A4EA 4HCBA 5CQYA 3M0QA 2QDYB 3CCRQ 3CCEQ 3JCMh 2FZGB 3EFRA 4BACA 1LCKA 3JCMd 2HKQB 1SHFA 4E7LA 1YI2T 1RLPC 4A53A 2RI2A 1Z9QA 4J9CA 1YHQQ 2M0YA 3OYLA 4F16A 5GMKl 4LNPA 3RKXA 5GMKh 2E3IA 1WHMA 4IUUA 1TG0A 2YXYA 2YUOA 4M77D 3S3NA 4PJOF 2WSFE 2V1QA 5KCOA 3U23A 2NUPA 2RF0A 1NJIC 1M3CA 1UGPB 1W1FA 2J6OA 4C5GA 4JDSA 4QKUA 1I5OB 3EG3A 1YI2A 4N0AA 2QA4T 1IREB 4BI8B 1WGSA 2RH2A 2M1HA 2ZPIB 4Y28E 2JM8A 2K3BA 4JRKA 3MO8A 4J6WA 4F7UB 2DL4A 3INZA 4ANJA 2ZGWA 4B9XA 3DLMA 7AT1B 1TOVA 4Z89A 2E10A 1WQ7A 5CR2A 1V29B 1SF9A 5GAOm 4FU6A 4V2SA 5GMKj 2NWMA 3VS0A 4AT1B 1JRIA 2HMAA 2YRCA 5I2MA 2K2VA 1EIFA 5IHKA 3ZEHA 2KYMA 4IURA 4LXCA 2K57A 1WYXA 4JZ3A 2HDAA 3EFOA 2QA4A 3JCMb 3MEAA 3S6WA 3JCMe 1ACMB 1JXMA 4C92D 4RTWA 2KNBB 1J3TA 3L2UA 1QLYA 1S72T 2GF7A 2M51A 4LE9A 4CRIA 4K11A 2P0QA 2YUPA 1VQKT 1BI2A 1PWTA 2IPOB 2DO3A 2CS7A 4FYWB 2NLUA 4O5VA 1YIJT 2PQWA 5HKCA 2JMCA 3QBYA 1OYXA 2EGEA 2QQ9A 1YBYA 2DTIA 1B34B 2BZ8A 2RHXA 4J9GA 1M5Q1 3BW1A 1I81A 2ZPHB 5C0MA 4JJCA 2LQWA 1BI3A 4MZPA 3QZ9B 1AD5A 3L2WA 2IG0A 1E7OA 2NUZA 1VIFA 3CMET 1S72A 2F69A 3PT9A 3URGA 2E41A 5GAOr 2RJEA 2PNIA 4BUGA 1VQKA 4F7UG 1VQ7T 1YIJA 4M7DF 1WIEA 1IGQA 3MJXA 4PL6A 1Y57A 2GQVA 2KAFA 3GP8A 1JBMA 1NZ9A 2HQEA 4RTVA 1ZLMA 2EQUA 4MMLA 2KEAA 1X27A 2FYKA 4M75A 2LVMA 1K9MC 4F7UE 2DL3A 1FMWA 3QJ6A 1JQQA 1UUEA 1YIJQ 3CMEA 1K1ZA 1UE9A 1TUDA 3I5RA 2DJZA 3TREA 3KUFA 1ZSGA 2RJCA 3IQLA 3VS7A 1NE8A 3S3OA 1K9AA 2W10A 3F70A 1YCYA 3OQ5A 1MGQA 2B86A 3M0SA 1MHNA 1UFFA 1WQWA 1VQNA 1EX4A 5CAIA 4DBHA 3X20B 3VS6A 1UG1A 3CC4A 3C95A 1UHFA 5KH6A 3NHNA 4HA8A 3UF4A 3AHUA 4OB3B 1M1GA 3M4YA 1U1SA 4JRIA 2X4XA 2GCXA 1Q81R 3H0IA 4E6RA 1FWZA 1OZ3A 1G3YA 1ZSZC 2CUBA 1VQNQ 3SHWA 4HXJA 2EFIA 2AHJB 2BUDA 3CC4Q 4C8QD 4FL6A 1W4SA 2PZ1A 4AG2C 4MMKA 3P8HA 4RTUA 1SG5A 1V76A 4NOYA 3FDRA 2KYBA 5FU6C 3AT1B 4A63B 3SDZA 2JW4A 3PTAA 3TU4K 4LDXA 1JB0E 1K73R 2RK2A 4KGXB 2XDBA 1N8RR 4M7DD 3N5BB 2D6FA 2KVQG 1Q86C 1SKUB 1IRXA 3M0UA 2NUTB 1ZA1B 2HQHA 1WXTA 1X01A 2K3YA 1B07A 3CBPA 1KFZA 1TWBA 1WLPB 2HSPA 1YP5A 1Q81U 4PJOG 3OYNA 1NEGA 1WNLA 1UHCA 4NL2A 2RO0A 2FHDA 3QIIA 1KQ1A 2LQKA 2VYTA 3KFVA 2QQSA 3M56A 3MP6A 1IHVA 2MCNA 3KXTA 1AZGB 2DL8A 2KSSA 2LTOA 2FO0A 4HVUA 3SEMA 4PJOE 3A8LB 4DOWA 3OS2A 4DEYA 2CH4A 1SSHA 3LWHA 5EC7A 5KE2A 2MOXA 2CREA 2KT8A 4PLLA 3CC2Q 3PFSA 1K73U 4FSXA 2QEXT 3MP1A 3HRSA 2RQRA 3DB3A 5CK9A 1N8RU 1PKTA 2YRVA 4M4ZA 5KE3A 3QWXX 5I2SA 1OOTA 2DYIA 2MK5A 3QUIA 4PJNA 4OF1A 2JNGA 1M8VA 2VUBA 3M53A 2YHTA 4J7IA 4M78B 4JZ4A 3OBWA 2ABLA 4ORZA 2DVEA 2WSEE 1ARKA 1RL2A 1Y0MA 4ZGDB 3NGPA 1WHKA 2LZ6B 2VB6A 2DVJA 1M90U 2JS0A 3D7SB 2E4HA 3GLXA 2QEXA 3WXMB 5CKFA 1CKAA 3QG1A 1XJWB 5IH2A 3QJYA 4TVRA 4OVAA 4EMKB 5FRNA 1UGVA 3TQ7P 4ZNXA 4D8KA 1W2BA 2QASA 4FYYB 4C0DC 3L2ZA 4IIOA 4F04B 3PMIA 1BI1A 1Q82R 1PKSA 1VQLT 1TUGB 5HK0A 5KYNA 3JCMc 3RKWA 1WX6A 2CZ1B 1Q95G 1O9SA 4ELYC 3CCLQ 4XTWA 1M3BA 1UJYA 3E9FA 3M55A 2LDMA 2VKNA 2KK4A 1R0BG 3M0RA 2DL7A 4OMMA 2DXUA 3FLGA 2OX7A 3CCVT 4KRTA 2ZPBB
chains in the Genus database with same CATH topology
5DLQE 2K5IA 5LJ5h 4A4EA 2WSCE 3G71T 4HCBA 5CQYA 1I8FA 3VU3C 1BI0A 4C0FA 1VQ8T 5LJ5d 2QDYB 2RI5A 4C8QB 3HKSA 2XDDA 3JCMh 3EFRA 5LL6S 1M4ZA 4BACA 3OW2S 3JB9G 3OYGA 2P4TA 1YJ9A 1VQLA 4BDZA 2K5LA 4M78G 2L5QA 2EKOA 2H3JA 4NS5A 3JCMd 4IKFA 3JCMV 4BY6B 4DQ2A 4E7LA 5GAN5 1YI2T 1QVGA 1N27A 4OP0A 3I55A 4IUQA 4A4KA 4A53A 1Q82U 1HXDA 2RI2A 2DIGA 2ZCFB 2EJGA 3BDLA 4PJOD 1P92A 3OYDA 3OYLA 3FB9A 1QVFA 2RI3A 4P5NA 3CCMA 1NJIU 5GMKl 3LGLA 3RKXA 2ZPFB 5GMKh 4XU3A 1K8AU 2LCCA 2E64A 2HAXA 3QHSA 4KUIA 3MP8A 1B34A 3CXCA 4BDYA 4M7DB 4ZGJB 4IUUA 3OYMA 3MEVA 3FIFA 4BE0A 2EIFA 4II1A 4M78E 3OYJA 5CQXA 1YITA 2PVOB 4LDWA 5A0LA 4GLKA 3CD6A 3X25B 4M77D 1VQNT 3WVDB 5GAMd 3S3NA 4M7AA 4C0ZA 1M9SA 4PJOF 1Q82C 2XD0A 2WSFE 5GANj 4PJOC 4R56A 3G71A 1N9RA 5KCOA 1LJOA 4OGEA 3RMSA 4EMHA 3CC4T 4FT2A 1VQ8A 1NJIC 2LCLA 4QW2A 1UGPB 5CKHA 3VV0A 1HK9A 4OB1B 4X9DA 3JB9F 4C5GA 4JDSA 1Y7XA 4C0GA 3V7RA 4LD9K 4M78F 5LJ5j 4JLGA 4PKCC 1YI2A 4HCCA 4N0AA 2QA4T 1IREB 2DKGA 4BI8B 4QVDA 2HD0A 4VUBA 1QP3A 1WGSA 2RH2A 3MEWA 3OB9A 5GAOq 2OTLT 2M1HA 3TEEA 4M77C 4JUVA 2ZPIB 3GNGA 4Y28E 5CVIA 5M9OA 5L8RE 4JRKA 3MO8A 4J6WA 4F7UB 2CGHA 3INZA 2GFAA 1KQ2A 5EG2A 3JCMX 2ZGWA 5FU7C 4X34A 2LQ8A 3DLMA 4B9XA 2E10A 4KBMB 1WQ7A 5CR2A 2K3XA 1VQ4T 1V29B 2KY9A 2L89A 5GAOm 2E1HA 4FU6A 3JCMP 1WJQA 1IZ6A 4V2SA 3OY9A 2DAQA 3ZBDA 5GMKj 4M7DG 5HY6A 5GANe 1JRIA 2MI6A 4XK8E 5I2MA 2K2VA 1EIFA 1I4K1 1KD1U 3QYHB 2EQJA 3LH0A 3VUZA 3ZEHA 5A0DA 2Y90A 3CC7A 4MDXA 2O4XB 1NPRA 4IURA 4N4IA 3VUBA 2K57A 3OSVA 1G3SA 1XQHA 1Y96B 2L8DA 2XG8D 2LT1A 4C8QG 5GMKi 2QA4A 1KQSA 3JCMb 2ZZDA 2YLBA 3MEAA 4QQ6A 1AHJB 3KBGA 3S6WA 1KG1A 1ZHIA 2XDPA 3JCMe 4PJOA 2VC8A 2OTLA 3P8BB 4C92D 3SD4A 3OYCA 2PUKB 1D3BA 3L2UA 2P0PA 2V8IA 2MMPA 1S72T 2CZ0B 2GF7A 3HRUA 4MDWA 3UT1A 3BDUA 4A54A 3WVEB 2CYZB 3M58A 4BI3A 4Y91A 4CRIA 3LYIA 5C6SA 2EAYA 4C5HA 1UB4A 1WJRA 2P0QA 4HCZA 5GMKm 1VQ4A 1VQKT 3A5ZB 1BI2A 1O75A 3OW2A 3CC2T 2DO3A 2CS7A 5LJ3h 4M75F 2NLUA 4O5VA 4M77A 3SWNC 4C8QE 5GAOl 4M75C 2PU9B 2PQWA 3I56T 1YIJT 2VV5A 5HKCA 5LJ3d 1N6AA 2R5AA 3V7SA 3ASKA 3QBYA 1UGRB 1WJSA 4C92C 3JAME 2QTXA 1OYXA 2QQ9A 1JJ2S 1YBYA 5FU6B 2DTIA 3QSUA 1KHCA 1NPPA 1B34B 5GAMe 2RHXA 1M5Q1 3BW1A 2LT4A 1I81A 2ZPHB 3X26B 5C0MA 5GAN7 4JS5A 3OYBA 4UC4A 3J7AF 1BI3A 4MZPA 3QZ9B 5IAYA 4JRPA 1PSEA 4M7AB 5J3BA 3OS0A 3L2WA 2IG0A 4D6WA 4M7DE 4RCBA 5CKDA 3QYGB 3A8HB 4MZMA 4N4GA 2F5KA 2HNIA 4XTXA 3L2VA 3G7ZA 1XTDA 1VIFA 5HK3A 3CMET 1S72A 3UPUA 2F69A 3PT9A 5DY9A 3QKJA 3URGA 4EDUA 3H8ZA 3HSBA 3FJPA 2E41A 3X28B 5GAOr 2FB7A 4E47A 2RJEA 1ZQ1A 4BUGA 1K9MU 1VQKA 3RIRA 1Y07A 4F7UG 2OAUA 1VQ7T 4E7KA 3CC2A 1KC8U 1KHIA 4C5IA 1H3ZA 3I56A 1YIJA 4M7DF 4QQDA 1FX7A 3JB9D 4PL6A 3T9NA 2OTJT 3SFMA 3UDCA 4M78D 3FRNA 2V8JA 1Y71A 4NL3A 2GQVA 3CEYA 3RESA 3GPLA 2KAFA 4A4HA 3CCUT 3GP8A 1JBMA 3CCVA 5GAOn 1NZ9A 2HQEA 5LJ3j 2FVUA 4LDVA 2EQUA 3V8KA 4MMLA 2CZ7B 5D6XA 5GANf 2FYKA 4HKEA 4QVZA 3SB2A 3CPWA 3SWNA 2XKOC 4M75A 3LWIA 2LVMA 1Q81C 3G6ET 1K9MC 4F7UE 5GANg 3QJ6A 3E19A 4JJNK 1G5VA 4X9CA 1KC8C 3QZ5B 4C92A 3M5AA 1ZBXA 3C12A 2D9TA 2DXBA 4O6JA 3ZFJA 3OMGA 1VQ5T 2XI9A 4LDUA 4M78C 1BKBA 5LJ5f 3CMEA 3HFNA 5FROA 2BIVA 2DEQA 1U8RA 3V7CA 2DJZA 3JCMf 3OS1A 2ZPEB 3TREA 3KUFA 2IVWA 3MHXA 4F7UF 3JCMg 2RJCA 2Y4YA 2C06A 2JOYA 4ZN3A 1UGSB 1NE8A 4IUPA 3S3OA 3HHTB 3F70A 3CPWS 4N4HA 1YCYA 3CCLT 3PGGA 2E12A 2GFUA 3OQ5A 3P8DA 1MGQA 4ELZC 1VQ6T 3FEOA 2OTJA 2E70A 4E7JA 3CCUA 2VGNA 1G3WA 1OI1A 2RM4A 2K5FA 1MHNA 3QO3A 5LJ3e 1WQWA 1VQMT 1VQNA 1FXXA 4GY5A 3DB4A 5CAIA 4EMKC 5DM7R 1Q7YC 3X20B 4M77B 3LGFA 3G6EA 3CC4A 3J80E 3C95A 3OYHA 2QQRA 4XTZA 3HL8A 3V8JA 2DXCA 5GAMf 5KH6A 2CKKA 4L6V5 2XK0A 4FM4B 4E7HA 4HA8A 3MEUA 5CKBA 3AHUA 5FU7B 1BIBA 4OB3B 5GAMg 2JZ2A 4EPCA 5LJ5e 1X75C 1M1GA 3CCRT 2JVVA 3M4YA 1XOVA 1U1SA 4FT4A 1VQ5A 4M7AG 5A2QE 4JRIA 1G3TA 4M75D 5FRMA 2X4YA 4R55A 2X4XA 2GCXA 2E6ZA 4PLIA 3JCMQ 2JN0A 3E1SA 1QP2A 1FWZA 2EJFA 1OZ3A 1G3YA 3NFCA 2XICA 3R6OA 1YHQT 4JS4A 4HT8A 2DD5A 3L2RA 2X4JA 3CCLA 2EFIA 2KQWA 5D6YA 2AHJB 2BUDA 4M78A 1M90C 1VQ6A 4BI4A 3JB9H 2QI2A 2E6NA 2VXEA 1BIAA 4JLIA 4A4FA 4C8QD 4FL6A 3PMTA 1UEBA 1W4SA 4C0DB 3OYAA 4M7AE 4MMKA 1PSFA 3P8HA 3M9QA 3RUXA 1GXIE 5GMKe 4NOYA 1VQMA 3FDRA 4YTLA 3CCJT 3O8VA 2WACA 5CO7A 2R5MA 2MAMA 4XQ3A 3DLLA 5FU6C 1DJ7B 4BB7A 3PTAA 3DKMA 1WPYA 2CZ6B 4XU0A 3SDZA 1VQPT 3TU4K 2RHZA 3E9GA 3OSSC 5DLOA 1VQOT 4LDXA 1JB0E 3OA6A 1YJWA 2PVDB 5CCAA 1YJWT 2RK2A 1W2BS 4M7AF 4C8QF 2PVGB 3A8OB 3LX7A 3M57A 3QDRB 3NTHA 4C8QC 2XDBA 3CCMT 3N5BB 1TH7A 4M7DD 2B8AA 1YJNT 4EMKA 4BD3A 3SWNB 2D6FA 3QPHA 2KVQG 1Q86C 5IN1A 4BY6C 2XHCA 1VUBA 2FL7A 4J8OA 4C92B 3FC3A 1YHQA 4OB2B 4QQGA 3PIOA 1X01A 2K3YA 1YITT 1Y96A 3CBPA 5FLXE 3ER0A 3BY7A 3MCAB 4J83A 4ME7A 2HBPA 2K4YA 2L3RA 3M59A 2RJDA 4MZTA 4N0AC 4DOVA 5KCHA 3CBMA 4PJOG 3OYNA 1Q81U 1VIEA 2BKDN 3ME9A 1WNLA 3CCST 3PIPA 3S3MA 2YLCA 4NL2A 2RO0A 3G4ST 2FHDA 3QIIA 4QVCA 1KQ1A 3RERA 4M7DC 2EQKA 2LQKA 2M9UA 2VYTA 3VYHB 3CCJA 5GAN2 3L1AA 2DTHA 3OYEA 2QQSA 3M56A 3MP6A 3KXTA 2JTFA 4KT0E 1VQPA 4XU2A 3C94A 3J81E 5LJ3f 1VQOA 5GAN4 2KSSA 2RA2A 3GOXA 2LTOA 4M77G 4BE1A 3L42A 5LJ3g 2RHIA 4ZTFA 4PJOE 3A8LB 4OMFB 4DOWA 3Q1JA 2QQBA 3OS2A 2MWPA 5D6WA 3LWHA 2O01E 3JCMJ 3VYGA 1YJNA 2LX9A 1H641 2HQXA 2RHYA 5KE2A 3A8MB 1LNXA 5GAN6 4PLLA 5IT9E 3PFSA 1K73U 2QXFA 3QXEB 5I21A 2X35A 4FSXA 1QW1A 2QEXT 2DZ9A 2PUOB 3MP1A 3GF5A 3HRSA 4ZTJA 5GAMh 3DB3A 3VKIA 5CK9A 5LJ5g 3OYFA 1RI0A 1N8RU 1VQ9T 2DK3A 2YRVA 1Q7YU 1QVGS 5KE3A 2MWOA 3HFOA 4C8QA 3PNWC 4M77E 4L59A 5I2SA 3CCQT 1VQ7A 2VGMA 3CCSA 4PJOB 2MF2A 3H6ZA 3QUIA 3G4SA 4OF1A 2RJFA 2EJ9A 4Z02A 1M1KU 2A7YA 3CMAT 1D3BB 2R58A 1QVFS 4J7FA 3CC7T 2JNGA 5A0GA 1M8VA 1K8AC 4B9WA 2VUBA 3M53A 5J39A 4RMOA 1K73C 3CPFA 3LLRA 2EQMA 4C5EA 2YHTA 4J7IA 4M78B 3CXCS 2LC4A 4HT9A 2DXTA 3NTIA 4XAXB 3RMQA 4FIBA 4RKUE 3GNFB 1R8OB 3OBWA 3OS5A 1N8RC 3JB9J 2R57A 4M77F 4WF2A 2DVEA 2WSEE 4XU1A 1RL2A 4ZGDB 4M7DA 2ZPGB 4OB0B 1U1TA 2X4WA 1M90U 3OYIA 2EYQA 2JUFA 3JRZA 1X6OA 1M1KC 4BE2A 3CCET 3GLXA 3META 2QEXA 3LW5E 2VXFA 4Q5WA 4M75G 3WXMB 5CKFA 4KUDK 2DD4A 2DIQA 2KMTA 1VQ9A 4KULA 4ATOA 5GAOp 2M0OA 3X24B 3QG1A 1LOJA 4OGCA 4C92G 2XU8A 3CCQA 3QJYA 3HP9A 4TVRA 4OVAA 2D0QB 4ZGEB 3L2QA 4EMKB 2RD1A 3VJPA 5FRNA 2P0KA 1OZ2A 2LRQA 4RG8A 1W2BA 3OMCA 5J26A 4RCCA 5GAMj 4XTUA 5CIUA 4CI0C 3CMAA 4E7IA 1I5LA 1BYMA 2E5QA 4EMGA 3TCJA 4IUVA 2F5TX 2EWNA 3OBYA 4M7AD 2JTMA 4C0DC 3L2ZA 4J6YA 3JB9I 3A8GB 3PMIA 3OYKA 3HPWA 1BI1A 4J5YA 3EFSA 4M75E 2E65A 2DTOA 1Q86U 1YJ9T 4F7UA 3HRTA 1QVPA 1UGQB 3M4GA 1VQLT 4J6XA 2RB6A 5HK0A 3JCMW 4C92E 2M16A 1JJ2A 2DZCA 4XTVA 3BFMA 4IUTA 3JCMc 3EAEA 3RKWA 4XTYA 3I55T 1KD1C 2QQAA 2CZ1B 2RHUA 2V8KA 3CCRA 3NTKA 2RK1A 1M1FA 1N9SA 4LDYA 3CCEA 1O9SA 4PNOA 2I2LA 4ELYC 3UWNA 4M7AC 4A4GA 3JSCA 3GIBA 4XTWA 4JRQA 2DPPB 3E9FA 3M55A 4ZN1A 5GAN3 1SSFA 2LDMA 4M75B 4L5GA 1KQSS 2KK4A 5GANh 5CKEA 4C92F 2XIDA 2LNVA 2Y4XA 2O4XA 3CBOA 5AYFA 5GANd 2DXUA 3FLGA 1XNIA 3RKYA 4DA4A 3CCVT 2A3LA 3OYYA 3CD6T 3C4SA 3V8LA 2KDSA 3M54A 2G3RA 5GAN8 4RG2A 2ZPBB 4LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNX A;  5GAN 6;  1WQW A;  5LJ5 h;  1I8F A;  3BDU A;  3VU3 C;  4A54 A;  5CAI A;  5I21 A;  4Y91 A;  4EMK C;  5LJ5 d;  2DZ9 A;  4C8Q B;  4M77 B;  2EAY A;  3EFR A;  3JCM h;  5GAM h;  3JB9 G;  5GMK m;  5LJ5 g;  4XTZ A;  4M78 G;  3V8J A;  5GAM f;  3JCM d;  3HFO A;  5LJ3 h;  4M75 F;  4C8Q A;  4C8Q E;  4M77 A;  4M77 E;  3SWN C;  4HA8 A;  4M75 C;  3JCM V;  4DQ2 A;  5GAN 5;  5GAO l;  3AHU A;  1BIB A;  4OP0 A;  5GAM g;  4PJO B;  5LJ3 d;  5LJ5 e;  3QUI A;  4M7A G;  3V7S A;  1U1S A;  4A53 A;  1HXD A;  4JRI A;  2EJG A;  2EJ9 A;  2QTX A;  4M75 D;  4C92 C;  4PJO D;  1D3B B;  3QSU A;  2DTI A;  1M8V A;  3FB9 A;  1B34 B;  5GAM e;  3JCM Q;  2JN0 A;  5GMK l;  1M5Q 1;  3BW1 A;  3RKX A;  1I81 A;  5GAN 7;  5GMK h;  2EJF A;  2YHT A;  4M78 B;  4XU3 A;  4HT9 A;  2E64 A;  2DXT A;  3QHS A;  1B34 A;  4M7D B;  4HT8 A;  3JB9 J;  4M77 F;  3FIF A;  4WF2 A;  2DVE A;  4M7A B;  4XU1 A;  4M78 E;  4M78 A;  3JB9 H;  2VXE A;  4M7D A;  1BIA A;  4M7D E;  4RCB A;  4JLI A;  1U1T A;  4C8Q D;  4M77 D;  4M7A A;  4M7A E;  2HNI A;  4MMK A;  5GAM d;  4XTX A;  4PJO F;  3RUX A;  5GMK e;  5GAN j;  4PJO C;  4NOY A;  5DY9 A;  1N9R A;  3HSB A;  1LJO A;  3FJP A;  4EMH A;  2E41 A;  5GAO r;  4XQ3 A;  2FB7 A;  2VXF A;  4M75 G;  1HK9 A;  3JB9 F;  4X9D A;  1WPY A;  4XU0 A;  3RIR A;  4F7U G;  5GAO p;  3V7R A;  4M78 F;  1LOJ A;  4C92 G;  5LJ5 j;  4M7D F;  4N0A A;  4QVD A;  2DKG A;  4EMK B;  3JB9 D;  2RD1 A;  4M7A F;  5GAO q;  4C8Q F;  4M78 D;  4C8Q C;  5GAM j;  4M77 C;  4RCC A;  1TH7 A;  4XTU A;  4NL3 A;  3RES A;  4JUV A;  4EMK A;  1I5L A;  4M7D D;  1JBM A;  4EMG A;  3SWN B;  5GAO n;  4M7A D;  2EWN A;  4JRK A;  5LJ3 j;  3L2Z A;  4J6W A;  4J6Y A;  2CGH A;  3INZ A;  4F7U B;  3JB9 I;  3V8K A;  1KQ2 A;  4MML A;  3JCM X;  2ZGW A;  5GAN f;  2FYK A;  3SB2 A;  4C92 B;  4J5Y A;  3SWN A;  3EFS A;  1X01 A;  2E10 A;  2E65 A;  2DTO A;  4M75 E;  4M75 A;  1WQ7 A;  1Y96 A;  4F7U A;  4F7U E;  3BY7 A;  3M4G A;  5GAN g;  4J6X A;  5GAO m;  2E1H A;  2RB6 A;  4N0A C;  4X9C A;  3JCM W;  4C92 E;  4PJO G;  4C92 A;  2DZC A;  4XTV A;  3JCM P;  3BFM A;  4V2S A;  3JCM c;  1WNL A;  3RKW A;  5GMK j;  4M7D G;  2YLC A;  4NL2 A;  4XTY A;  5GAN e;  4M78 C;  1JRI A;  4QVC A;  5LJ5 f;  1KQ1 A;  3RER A;  3HFN A;  4M7D C;  1N9S A;  2DEQ A;  4PNO A;  5GAN 2;  3V7C A;  1I4K 1;  2I2L A;  3L1A A;  2DJZ A;  2DTH A;  3JCM f;  4M7A C;  3GIB A;  2Y90 A;  4XTW A;  5GAN 3;  4F7U F;  4XU2 A;  3JCM g;  2K57 A;  4M75 B;  5LJ3 f;  5GAN h;  1Y96 B;  4C8Q G;  2RA2 A;  4C92 F;  5GAN 4;  4M77 G;  5GMK i;  3JCM b;  1YCY A;  2YLB A;  5LJ3 g;  3PGG A;  5GAN d;  1MGQ A;  2DXU A;  3RKY A;  3JCM e;  4PJO A;  4PJO E;  2VC8 A;  4C92 D;  3V8L A;  3JCM J;  5GAN 8;  1H64 1;  1D3B A;  3QO3 A;  5LJ3 e;  2RM4 A; 
#chains in the Genus database with same CATH topology
 5DLQ E;  1M2V A;  2WSC E;  3EGX A;  1VQ8 T;  2ZAE A;  3VS4 A;  5LL6 S;  1M4Z A;  3JB9 G;  1JU5 C;  2P4T A;  1VQL A;  4BDZ A;  4M78 G;  2L5Q A;  2EKO A;  5GAN 5;  2HZY A;  1N27 A;  2JT4 A;  1Q82 U;  2DIG A;  3R6N A;  1IO6 A;  1HJD A;  2FPF A;  4GBQ A;  1QCN A;  4P5N A;  3CCM A;  3LGL A;  1C6V X;  2ZPF B;  1C1A A;  1A0N B;  2E64 A;  2HAX A;  3QHS A;  4BDY A;  3OYM A;  1SHG A;  3MEV A;  5L23 A;  4M78 E;  4LDW A;  2RQW A;  1AWX A;  1PHT A;  2RMO A;  1GCQ C;  1ZX6 A;  4PJO C;  2HL5 C;  4F17 A;  1D1B A;  1LJO A;  3PE0 A;  4EMH A;  4FW1 A;  1VQ8 A;  5CKH A;  4OB1 B;  1B7T A;  3CCM Q;  2D0N A;  1YJN Q;  2AT1 B;  4QVD A;  2C0I A;  3MEW A;  3OB9 A;  2YSQ A;  1RLQ C;  3TEE A;  1HD3 A;  4PJM A;  2LJ1 A;  5CVI A;  5L8R E;  1PD0 A;  2GFA A;  5EG2 A;  5KYU A;  2LQ8 A;  4KBM B;  3G4S Q;  2K3X A;  1VQ4 T;  2E1H A;  2CH4 W;  1WJQ A;  1WHG A;  2LP5 A;  2P84 A;  2CP3 A;  3ZBD A;  5HY6 A;  1K0S A;  2MI6 A;  3EGD A;  1KD1 U;  3QYH B;  2EQJ A;  3VUZ A;  1MUZ A;  2FEI A;  2DL5 A;  2O4X B;  1G3S A;  2XG8 D;  2CSI A;  3RNJ A;  2SRC A;  1ABQ A;  3KBG A;  4HCK A;  2VC8 A;  1WDX A;  3SD4 A;  3OYC A;  1AWJ A;  4MDW A;  4A54 A;  3WVE B;  4BI3 A;  2OJ2 A;  4Y91 A;  3LYI A;  1IXD A;  2EAY A;  1VQ4 A;  3A5Z B;  2I0N A;  1KQ2 A;  2Z0W A;  1N6A A;  1TTH B;  3ASK A;  1WJS A;  3JAM E;  2QTX A;  2V1R A;  5FU6 B;  2C0T A;  1NPP A;  5KYY B;  5GAN 7;  3UA7 A;  3J7A F;  3M0P A;  4FYX B;  4JRP A;  4M7A B;  5J3B A;  3OS0 A;  4Y92 A;  3A8H B;  4N4G A;  2F5K A;  4XTX A;  4KH1 B;  2OAW A;  4EDU A;  3THK A;  5FWB A;  1GRI A;  4OMP A;  4E47 A;  4PK4 A;  2RQT A;  1Y07 A;  1H3Z A;  2K6D A;  2OTJ T;  3SFM A;  2DNU A;  2EGA A;  1FYN A;  4A4H A;  3CCU T;  2EKH A;  2QGG A;  2FVU A;  1NYF A;  5GAN f;  2GTO A;  4HKE A;  3SB2 A;  3CPW A;  1Q81 C;  3G6E T;  5GAN g;  2K79 A;  4JJN K;  4X9C A;  1KC8 C;  2DBM A;  4F14 A;  1ZBX A;  3ZFJ A;  3OMG A;  4LDU A;  2X51 A;  4M78 C;  5LJ5 f;  3HFN A;  4OMQ A;  2BIV A;  4CC2 A;  1U8R A;  1OEB A;  2V26 A;  2EBP A;  1RAB B;  1OUL A;  3MHX A;  2GNC A;  4PFP A;  1UGS B;  1X2Q A;  1MMD A;  2CUD A;  2E12 A;  2OTJ A;  4E7J A;  1TS9 A;  1YN8 A;  1R0C B;  2J7I A;  3CCU A;  1G3W A;  2VGN A;  1OI1 A;  1OPK A;  3O5Z A;  1YI2 Q;  4EMK C;  3EG9 A;  5DM7 R;  2KXC A;  4M77 B;  2ATC B;  3G6E A;  2C0O A;  3J80 E;  1WXU A;  2QQR A;  2HKN A;  1OU9 A;  2CKK A;  4L6V 5;  5FU7 B;  1MND A;  2JZ2 A;  4M7A G;  1T3S A;  1TSF A;  5FRM A;  4RTT A;  2QK0 A;  1PRL C;  2QTV A;  2O2O A;  4PLI A;  3JCM Q;  2JN0 A;  1KIK A;  2EJF A;  1X2K A;  1YWP A;  2DX1 A;  1M90 C;  3JB9 H;  3EGU A;  1W2B P;  2E3H A;  2E6N A;  2ROL A;  4A4F A;  4C0D B;  3OYA A;  4M7A E;  1GXI E;  1TU0 B;  5GMK e;  3CCJ T;  2JM9 A;  2QA4 Q;  4XQ3 A;  1VQP T;  4OMO A;  1FMV A;  2LQN A;  2PVD B;  2VWF A;  5GJW B;  4JPB W;  1W2B S;  4C8Q F;  1RAI B;  2PVG B;  3LX7 A;  3M57 A;  2KXD A;  2D1X A;  1Q7Y R;  3SWN B;  2A28 A;  3QPH A;  1WA7 A;  1VUB A;  4J8O A;  4C92 B;  1YIT T;  5KYW B;  3BE3 A;  3ER0 A;  3BY7 A;  3GPL A;  5KCH A;  2DEU A;  1QKW A;  4N0A C;  2KRM A;  2O9V A;  4J9I A;  2E5K A;  3CCS T;  4QVC A;  2BTT A;  3CCJ A;  3H41 A;  2DMO A;  1ZSZ A;  1EZZ B;  1GFD A;  3OYE A;  4PFZ A;  2JTF A;  4KT0 E;  1VQP A;  2HL3 A;  4DBF A;  3GOX A;  4M77 G;  3L42 A;  1S72 Q;  2RHI A;  4ZTF A;  4OMF B;  1YWO A;  5D6W A;  2O01 E;  5KYX A;  1H64 1;  2HQX A;  1GCP A;  3NMZ C;  1VQK Q;  3A8M B;  3TSW A;  2EYZ A;  2X35 A;  5GAM h;  3VKI A;  1RI0 A;  1VQ9 T;  1Q7Y U;  4M77 E;  1VQ7 A;  2VGM A;  3CCS A;  2RQU A;  4PJO B;  1WHJ A;  5FWC A;  2CP2 A;  1B3Q A;  2RJF A;  2A7Y A;  2R58 A;  4J7F A;  3CC7 T;  4B9W A;  4LUD A;  1ZBJ A;  1UJ0 A;  4JJB A;  2NYS A;  3LLR A;  2EQM A;  2DXT A;  2A0F B;  3FJ5 A;  4FIB A;  3TSZ A;  4AMC A;  3CME Q;  4WF2 A;  4XU1 A;  2A08 A;  2LNH B;  2X4W A;  3OYI A;  2EYQ A;  1VQ7 Q;  1X6O A;  1M1K C;  2YDL A;  2LJ0 A;  1I1J A;  4Q5W A;  1VQ9 A;  5GAO p;  3VRY A;  3X24 B;  1OX8 A;  1LOJ A;  4C92 G;  4OMN A;  2XU8 A;  3HP9 A;  4ZGE B;  3L2Q A;  2QYZ A;  3VJP A;  2P0K A;  1OZ2 A;  2LRQ A;  3EG2 A;  5J26 A;  5GAM j;  4RCC A;  2DET A;  4CI0 C;  2EQI A;  1I5L A;  3TCJ A;  2F5T X;  3OBY A;  2CT3 A;  1GBQ A;  4J9D A;  1D09 B;  2E65 A;  2DTO A;  4F7U A;  3M4G A;  1QCF A;  3JCM W;  4C92 E;  1JJ2 A;  1NJI R;  4XTV A;  4IUT A;  3EAE A;  3I55 T;  1KD1 C;  2RHU A;  2V8K A;  3NTK A;  1M1F A;  1PRM C;  1S1N A;  4LDY A;  2I2L A;  3UWN A;  4M7A C;  3GIB A;  1SEM A;  2DRM A;  2DPP B;  2K2M A;  5GAN 3;  2JXB A;  1QCO A;  1D0Z A;  5GAN h;  5CKE A;  2XID A;  5GAN d;  1XNI A;  3CD6 T;  5GAN 8;  4RG2 A;  5LJ5 h;  3G71 T;  2M02 A;  1I8F A;  1X69 A;  4C0F A;  5LJ5 d;  2RI5 A;  4C8Q B;  2XDD A;  3MPU B;  2ECZ A;  1EFN A;  3OYG A;  2K5L A;  4IKF A;  1G83 A;  3JCM V;  4BY6 B;  4DQ2 A;  1QVG A;  3QDF A;  1MMG A;  1K4U S;  1ABO A;  3I55 A;  4IUQ A;  1QKX A;  1IGU A;  3BDL A;  1SRL A;  3FB9 A;  4R0K A;  1QVF A;  2RI3 A;  1VYU A;  1NJI U;  4WTO B;  3H0F A;  3MP8 A;  1B34 A;  3CXC A;  4M7D B;  1PCX A;  1PNJ A;  3FIF A;  2EIF A;  4II1 A;  4DBR A;  3OYJ A;  3VS5 A;  5CQX A;  3CD6 A;  3TVT A;  1G2B A;  2L2P A;  2XD0 A;  5GAN j;  1Z9Z A;  3G71 A;  3I55 Q;  3CPW P;  4OGE A;  4FT2 A;  3VS3 A;  2LCL A;  1BK2 A;  3QWY A;  1HK9 A;  4C0G A;  1AWW A;  3V7R A;  4LD9 K;  2J6K A;  1GL5 A;  5LJ5 j;  4JLG A;  2DKG A;  4VUB A;  1QP3 A;  5GAO q;  2OTL T;  4DEX A;  1M2O A;  4M77 C;  2RPN A;  3I9Q A;  1LPL A;  2CGH A;  5FU7 C;  3G71 Q;  2ED1 A;  4CC3 A;  2L89 A;  3JCM P;  1T0J A;  1IZ6 A;  3REA B;  2A36 A;  2DAQ A;  5GAN e;  2J05 A;  2OI3 A;  4XK8 E;  3VS1 A;  1RUW A;  2Y90 A;  4MDX A;  3VUB A;  2CT4 A;  1XQH A;  1Y96 B;  2L8D A;  4C8Q G;  2LT1 A;  1GCQ A;  2YLB A;  1YNZ A;  4QQ6 A;  3CQT A;  1ZHI A;  4PJO A;  2OTL A;  2QEX Q;  5IXB A;  1K9M R;  2PUK B;  2MMP A;  1NM7 A;  3ZL7 C;  2FZK B;  2RNA A;  3BDU A;  9ATC B;  2VVK A;  1UB4 A;  1WJR A;  1RAD B;  4HCZ A;  5FW9 A;  4FYV B;  3OW2 A;  1O75 A;  2GTJ A;  2HSE B;  4C8Q E;  4M75 F;  4M7D G;  3I56 T;  5GAO l;  3SWN C;  2PU9 B;  2VV5 A;  1SRM A;  3V7S A;  2J6F A;  1UGR B;  4D8D A;  4AG1 C;  4C92 C;  1WFW A;  1U3O A;  3QSU A;  1IB8 A;  2CDT A;  3OYB A;  1LVK A;  1PSE A;  2BE7 D;  2VAS A;  4FCY A;  4M7D E;  5CKD A;  4RTY A;  4MZM A;  1MV0 B;  2NUP B;  2EGC A;  3QKJ A;  5DY9 A;  3H8Z A;  3HSB A;  3X28 B;  2QGF B;  3EH1 A;  1K9M U;  3RIR A;  2OAU A;  4E7K A;  2F2V A;  2F1L A;  1KHI A;  2K7A A;  3I56 A;  2K9G A;  4QQD A;  1ZUY A;  1D0X A;  3FRN A;  1Y71 A;  3RES A;  1M30 A;  3CCV A;  1VQL Q;  4FSS A;  2COZ A;  1WHL A;  1X6B A;  2CZ7 B;  5D6X A;  2XKO C;  1BU1 A;  1G5V A;  1AZE A;  3QZ5 B;  2NUT A;  3C12 A;  1MNE A;  2D9T A;  1D1C A;  1VQ5 T;  4CC7 A;  3OS1 A;  3EFO B;  2ZPE B;  3REB B;  2ROT A;  2QG9 B;  1HYO A;  1NLP C;  2IVW A;  3CCV Q;  4F7U F;  2Y4Y A;  2JOY A;  1W70 A;  4ZN3 A;  3HHT B;  1M8M A;  2KR3 A;  2GFU A;  4RTX A;  2LX7 A;  4ELZ C;  4E7Z A;  1VQ6 T;  3FEO A;  2E70 A;  1VQ8 Q;  4RTZ A;  3QO3 A;  4AFZ C;  2JJ9 A;  1VQM T;  1FXX A;  4GY5 A;  2AKL A;  2LJ3 A;  1AWO A;  2BZX A;  2D8J A;  1Q7Y C;  1BCO A;  1WZO A;  4QT7 A;  3OYH A;  4XTZ A;  3HL8 A;  5GAM f;  2DXC A;  8ATC B;  2XK0 A;  4E7H A;  3MEU A;  5CKB A;  3CCR T;  1BIB A;  5GAM g;  1NBE B;  1VQ5 A;  1X75 C;  1H92 A;  2JVV A;  2DF6 A;  1G3T A;  4M75 D;  2FG0 A;  2E6Z A;  1QP2 A;  4J9E A;  3NFC A;  2XIC A;  1YHQ T;  4JS4 A;  2DD5 A;  2X4J A;  4M78 A;  1VQ6 A;  1AEY A;  4BI4 A;  2QI2 A;  2RN8 A;  1UEB A;  1PSF A;  3M9Q A;  2DM1 A;  1VQM A;  1RAF B;  4YTL A;  2WAC A;  5CO7 A;  2JS2 A;  2R5M A;  2MAM A;  4BB7 A;  3I35 A;  1WPY A;  1JJ2 P;  2O31 A;  2YRD A;  3E9G A;  3OSS C;  5DLO A;  3EG1 A;  5CCA A;  3A8O B;  4C8Q C;  1VQ6 Q;  2B8A A;  4EMK A;  5IXF A;  4BD3 A;  1VQ4 Q;  1ZUU A;  2DFU A;  5IN1 A;  4BY6 C;  2XHC A;  1MMN A;  2FL7 A;  1YHQ A;  2X9H A;  4QQG A;  3PIO A;  1Y96 A;  5FLX E;  3MCA B;  1JJ2 S;  4J83 A;  1E6H A;  4ME7 A;  2K4Y A;  2L3R A;  2RJD A;  3CBM A;  2L0A A;  1VIE A;  2BKD N;  3ME9 A;  4AFQ C;  1RAG B;  3S3M A;  2YLC A;  2D8H A;  1OQK A;  4M7D C;  2EQK A;  3VYH B;  2M9U A;  2ENM A;  5GAN 2;  2DTH A;  1SPK A;  1QQJ A;  4XU2 A;  3J81 E;  5LJ3 f;  1QVG P;  2DJQ A;  5LJ3 g;  2DA9 A;  3JCM J;  1QVF P;  2RHY A;  1UTI A;  3CXC P;  2HEQ A;  3QXE B;  2KRS A;  2AIR B;  5I22 A;  4CC4 B;  1OPL A;  5LJ5 g;  3OYF A;  1QVG S;  2MWO A;  3PNW C;  3CCQ T;  1TXQ A;  1VOM A;  2MYS A;  1IHW A;  2EJ9 A;  2MPX C;  1D3B B;  1QVF S;  5A0G A;  5J39 A;  4RMO A;  1K73 C;  2KI7 A;  3CXC S;  1QMC A;  4FW2 A;  3EHR A;  3GNF B;  1R8O B;  1N8R C;  2R57 A;  2FRY A;  2O9S A;  2ZPG B;  1U1T A;  1BCM A;  1F1B B;  3RR6 A;  2CP7 A;  2ED0 A;  3LW5 E;  2OTJ Q;  4M75 G;  4KUD K;  2DD4 A;  2KMT A;  4ATO A;  4KUL A;  2M0O A;  1BBZ A;  3CCU Q;  3CCQ A;  1K76 A;  2D0Q B;  2DLP A;  1AVZ C;  2AK5 A;  4RG8 A;  4XTU A;  5CIU A;  1RAC B;  3G6E Q;  4EMG A;  4IUV A;  3MKD A;  3JB9 I;  3OYK A;  4KH0 B;  4J5Y A;  3EFS A;  4M75 E;  3GBQ A;  1YJ9 T;  3HRT A;  4J6X A;  1HSQ A;  2M16 A;  3BFM A;  4XTY A;  1K8A R;  3UA6 A;  1X6G A;  3CCQ Q;  2QQA A;  1YFN A;  2RK1 A;  1VYT A;  1RAH B;  4B6M A;  4A4G A;  1V1C A;  3OW2 P;  1N5Z A;  4ZN1 A;  1SSF A;  2BZY A;  2IIM A;  4L5G A;  2FPD A;  2Y4X A;  2O4X A;  3CBO A;  5AYF A;  2A3L A;  3C4S A;  2KDS A;  4LD6 A;  2K5I A;  1NYG A;  2LCS A;  1T3L A;  3VU3 C;  1BI0 A;  3EG0 A;  3C0C A;  1UDL A;  3HKS A;  2AZS A;  3OW2 S;  1YJ9 A;  1JEG A;  1WHH A;  2H3J A;  1GFC A;  4NS5 A;  4OP0 A;  1K0X A;  4A4K A;  1OV3 A;  1HXD A;  2ZCF B;  2EJG A;  4PJO D;  1P92 A;  3OYD A;  2KGT A;  4J9H A;  4XU3 A;  1K8A U;  2LCC A;  4KUI A;  2EYX A;  1MV3 A;  4ZGJ B;  5KYY A;  4BE0 A;  1JXO A;  3CCJ Q;  1YIT A;  1KK7 A;  2PVO B;  5A0L A;  1YJ9 Q;  4GLK A;  1JO8 A;  3X25 B;  1VQN T;  3WVD B;  5GAM d;  4M7A A;  4C0Z A;  1M9S A;  2GGR A;  1Q82 C;  1VQP Q;  4R56 A;  1N9R A;  3RMS A;  3CC4 T;  2KRO A;  4QW2 A;  3VV0 A;  3JB9 F;  4X9D A;  1Y7X A;  4M78 F;  1H3H A;  2COY A;  4PKC C;  4HCC A;  1C0M A;  2HD0 A;  1KSW A;  2F2X A;  1PG5 B;  4AFU C;  4JUV A;  1YIT Q;  3GNG A;  2GBQ A;  5M9O A;  1TUC A;  3NPF A;  2EW3 A;  3JCM X;  4X34 A;  3CCS Q;  1ZUK A;  2FPE A;  2KY9 A;  2CP6 A;  1RAA B;  2H3E B;  2ESW A;  3OY9 A;  3VRZ A;  1RI9 A;  3I5S A;  1I4K 1;  5A0D A;  3LH0 A;  3CC7 A;  1NPR A;  2EYW A;  3OSV A;  5GMK i;  1KQS A;  1X43 A;  2ZZD A;  1AHJ B;  2P4R A;  2XDP A;  3P8B B;  1M2V B;  2COW A;  3EGX B;  1D3B A;  2P0P A;  2V8I A;  1KC8 R;  1VQ9 Q;  2CZ0 B;  2PTK A;  3HRU A;  3UT1 A;  2CYZ B;  3M58 A;  5C6S A;  4EIK A;  4KGV B;  4C5H A;  5GMK m;  3CC2 T;  3LH5 A;  3CC7 Q;  5LJ3 h;  4M77 A;  4RUG A;  4M75 C;  1T0H A;  5LJ3 d;  4X1V A;  2R5A A;  1QWF A;  1KHC A;  3JV3 A;  5GAM e;  3VS2 A;  2LT4 A;  3X26 B;  4JS5 A;  4UC4 A;  3EHQ A;  1CSK A;  2BE9 B;  1R77 A;  5IAY A;  2MIO A;  2DRK A;  5AT1 B;  3ULR B;  4D6W A;  4RCB A;  3QYG B;  2HNI A;  3L2V A;  3G7Z A;  1XTD A;  5HK3 A;  5GJV B;  3UPU A;  3RDV A;  3FJP A;  1AOJ A;  2FB7 A;  1ZQ1 A;  2W0Z A;  3CC2 A;  1KC8 U;  4C5I A;  1FX7 A;  4J9B A;  3JB9 D;  1D0Y A;  3T9N A;  3UDC A;  4M78 D;  2V8J A;  4NL3 A;  4IIM A;  3CEY A;  2A37 A;  4DBQ A;  5KYU B;  2KT1 A;  1M90 R;  5GAO n;  5LJ3 j;  4LN2 A;  4LDV A;  3V8K A;  1I07 A;  4PJJ A;  4QVZ A;  3PVL A;  3A1P A;  3SWN A;  3LWI A;  3E19 A;  4C92 A;  3EGD B;  3M5A A;  5KYW A;  2DXB A;  4O6J A;  3G1J A;  2XI9 A;  1BKB A;  2G6F X;  5FRO A;  1M27 C;  2DEQ A;  3V7C A;  2AKK A;  3JCM f;  6AT1 B;  1QWE A;  3JCM g;  2C06 A;  3CD6 Q;  2EYY A;  4IUP A;  1RAE B;  1I0C A;  3CPW S;  4N4H A;  3CCL T;  3PGG A;  1KG1 A;  3P8D A;  2CP5 A;  4HVW A;  5IHI A;  5LJ3 e;  2K5F A;  1UEC A;  2RM4 A;  1D1A A;  2RQV A;  4WCI A;  3DB4 A;  1NLO C;  8AT1 B;  3LGF A;  2FZC B;  2DE0 X;  3V8J A;  4Z8A A;  4FM4 B;  1W6X A;  1YJW T;  4EPC A;  5LJ5 e;  5HCK A;  1XOV A;  4FT4 A;  2L3P A;  5A2Q E;  2X4Y A;  4R55 A;  2GQI A;  2SEM A;  3E1S A;  3R6O A;  4HT8 A;  3L2R A;  3EH2 A;  5IHN A;  3UAT A;  3CCL A;  1G8X A;  2KQW A;  5D6Y A;  1PD1 A;  2XMF A;  2VXE A;  1BIA A;  4JLI A;  3PMT A;  2YT6 A;  3RUX A;  2X3W D;  3O8V A;  3DLL A;  1DJ7 B;  1PM3 A;  3DKM A;  2CZ6 B;  4XU0 A;  2OTL Q;  2YUQ A;  1U06 A;  2RHZ A;  2DYB A;  1VQO T;  1GBR A;  3OA6 A;  1YJW A;  1OX9 A;  4M7A F;  3QDR B;  3HTR A;  3NTH A;  3CCM T;  1TH7 A;  1YJN T;  1AT1 B;  4AFS C;  3FC3 A;  4OB2 B;  1FMK A;  1M1K R;  4OML A;  4MZT A;  4DOV A;  2HBP A;  3M59 A;  3PIP A;  1BB9 A;  2HBW A;  2QAZ A;  1KJW A;  3G4S T;  3RER A;  3RBB B;  1YJW Q;  2EVR A;  3L1A A;  4E7S A;  1H8K A;  3C94 A;  1VQO A;  5GAN 4;  2RA2 A;  4BE1 A;  4HVV A;  5D7U A;  2KRN A;  4E2F B;  3Q1J A;  2QQB A;  2MWP A;  1YJN A;  1WXB A;  2HCK A;  3VYG A;  2LX9 A;  3EG9 B;  1LNX A;  5GAN 6;  5IT9 E;  1MMA A;  4Z88 A;  3I56 Q;  2QXF A;  5I21 A;  2X3X D;  1QW1 A;  2DZ9 A;  2PUO B;  3GF5 A;  1KD1 R;  4ZTJ A;  2JTE A;  2DK3 A;  3HFO A;  4C8Q A;  2YUN A;  4L59 A;  2O88 A;  4J9F A;  2MF2 A;  3H6Z A;  4JJD A;  1VQO Q;  3G4S A;  1M3A A;  1Q86 R;  4Z02 A;  1M1K U;  3CMA T;  4KGZ B;  1K8A C;  3CPF A;  3M0T A;  4C5E A;  4HT9 A;  2LC4 A;  3NTI A;  4XAX B;  3RMQ A;  4RKU E;  3OS5 A;  2DIL A;  3JB9 J;  4M77 F;  1NG2 A;  2L3Q A;  4M7D A;  4OB0 B;  3H9N A;  2L3S A;  2H8H A;  2JUF A;  1VA7 A;  1WI7 A;  3JRZ A;  4PFO A;  4BE2 A;  3CCE T;  3MET A;  3A98 A;  4GLM A;  2VXF A;  1NEB A;  2DIQ A;  4OGC A;  3H0H A;  2RD1 A;  2EPD A;  5I11 A;  2AZV A;  2CP0 A;  3OMC A;  3CMA A;  2CSQ A;  4E7I A;  1BYM A;  2LMJ A;  2E5Q A;  2DER A;  1ZA2 B;  4M7A D;  2EWN A;  2JTM A;  4J6Y A;  3A8G B;  2JMA A;  3HPW A;  1U5S A;  1VYV A;  1KQS P;  2DBK A;  2FRW A;  1Q86 U;  1VQ5 Q;  1PC0 A;  1QVP A;  1UGQ B;  2RB6 A;  2DZC A;  2QDL A;  2F2W A;  1ZSZ B;  2KE9 A;  4PJL A;  4ESR A;  3CCR A;  3CCE A;  1N9S A;  1YCS B;  2J06 A;  4PNO A;  3PVQ A;  3E2U A;  3JSC A;  3CMA Q;  4JRQ A;  1OU8 A;  4M75 B;  1KQS S;  5ECA A;  4C92 F;  2LNV A;  5KYX B;  1VQM Q;  2YWW A;  3RKY A;  4DA4 A;  1E6G A;  3OYY A;  3V8L A;  3M54 A;  1CKB A;  2G3R A;  2KBT A;  4LUE A;  4N4I A;  4A4E A;  4HCB A;  5CQY A;  3M0Q A;  2QDY B;  3CCR Q;  3CCE Q;  3JCM h;  2FZG B;  3EFR A;  4BAC A;  1LCK A;  3JCM d;  2HKQ B;  1SHF A;  4E7L A;  1YI2 T;  1RLP C;  4A53 A;  2RI2 A;  1Z9Q A;  4J9C A;  1YHQ Q;  2M0Y A;  3OYL A;  4F16 A;  5GMK l;  4LNP A;  3RKX A;  5GMK h;  2E3I A;  1WHM A;  4IUU A;  1TG0 A;  2YXY A;  2YUO A;  4M77 D;  3S3N A;  4PJO F;  2WSF E;  2V1Q A;  5KCO A;  3U23 A;  2NUP A;  2RF0 A;  1NJI C;  1M3C A;  1UGP B;  1W1F A;  2J6O A;  4C5G A;  4JDS A;  4QKU A;  1I5O B;  3EG3 A;  1YI2 A;  4N0A A;  2QA4 T;  1IRE B;  4BI8 B;  1WGS A;  2RH2 A;  2M1H A;  2ZPI B;  4Y28 E;  2JM8 A;  2K3B A;  4JRK A;  3MO8 A;  4J6W A;  4F7U B;  2DL4 A;  3INZ A;  4ANJ A;  2ZGW A;  4B9X A;  3DLM A;  7AT1 B;  1TOV A;  4Z89 A;  2E10 A;  1WQ7 A;  5CR2 A;  1V29 B;  1SF9 A;  5GAO m;  4FU6 A;  4V2S A;  5GMK j;  2NWM A;  3VS0 A;  4AT1 B;  1JRI A;  2HMA A;  2YRC A;  5I2M A;  2K2V A;  1EIF A;  5IHK A;  3ZEH A;  2KYM A;  4IUR A;  4LXC A;  2K57 A;  1WYX A;  4JZ3 A;  2HDA A;  3EFO A;  2QA4 A;  3JCM b;  3MEA A;  3S6W A;  3JCM e;  1ACM B;  1JXM A;  4C92 D;  4RTW A;  2KNB B;  1J3T A;  3L2U A;  1QLY A;  1S72 T;  2GF7 A;  2M51 A;  4LE9 A;  4CRI A;  4K11 A;  2P0Q A;  2YUP A;  1VQK T;  1BI2 A;  1PWT A;  2IPO B;  2DO3 A;  2CS7 A;  4FYW B;  2NLU A;  4O5V A;  1YIJ T;  2PQW A;  5HKC A;  2JMC A;  3QBY A;  1OYX A;  2EGE A;  2QQ9 A;  1YBY A;  2DTI A;  1B34 B;  2BZ8 A;  2RHX A;  4J9G A;  1M5Q 1;  3BW1 A;  1I81 A;  2ZPH B;  5C0M A;  4JJC A;  2LQW A;  1BI3 A;  4MZP A;  3QZ9 B;  1AD5 A;  3L2W A;  2IG0 A;  1E7O A;  2NUZ A;  1VIF A;  3CME T;  1S72 A;  2F69 A;  3PT9 A;  3URG A;  2E41 A;  5GAO r;  2RJE A;  2PNI A;  4BUG A;  1VQK A;  4F7U G;  1VQ7 T;  1YIJ A;  4M7D F;  1WIE A;  1IGQ A;  3MJX A;  4PL6 A;  1Y57 A;  2GQV A;  2KAF A;  3GP8 A;  1JBM A;  1NZ9 A;  2HQE A;  4RTV A;  1ZLM A;  2EQU A;  4MML A;  2KEA A;  1X27 A;  2FYK A;  4M75 A;  2LVM A;  1K9M C;  4F7U E;  2DL3 A;  1FMW A;  3QJ6 A;  1JQQ A;  1UUE A;  1YIJ Q;  3CME A;  1K1Z A;  1UE9 A;  1TUD A;  3I5R A;  2DJZ A;  3TRE A;  3KUF A;  1ZSG A;  2RJC A;  3IQL A;  3VS7 A;  1NE8 A;  3S3O A;  1K9A A;  2W10 A;  3F70 A;  1YCY A;  3OQ5 A;  1MGQ A;  2B86 A;  3M0S A;  1MHN A;  1UFF A;  1WQW A;  1VQN A;  1EX4 A;  5CAI A;  4DBH A;  3X20 B;  3VS6 A;  1UG1 A;  3CC4 A;  3C95 A;  1UHF A;  5KH6 A;  3NHN A;  4HA8 A;  3UF4 A;  3AHU A;  4OB3 B;  1M1G A;  3M4Y A;  1U1S A;  4JRI A;  2X4X A;  2GCX A;  1Q81 R;  3H0I A;  4E6R A;  1FWZ A;  1OZ3 A;  1G3Y A;  1ZSZ C;  2CUB A;  1VQN Q;  3SHW A;  4HXJ A;  2EFI A;  2AHJ B;  2BUD A;  3CC4 Q;  4C8Q D;  4FL6 A;  1W4S A;  2PZ1 A;  4AG2 C;  4MMK A;  3P8H A;  4RTU A;  1SG5 A;  1V76 A;  4NOY A;  3FDR A;  2KYB A;  5FU6 C;  3AT1 B;  4A63 B;  3SDZ A;  2JW4 A;  3PTA A;  3TU4 K;  4LDX A;  1JB0 E;  1K73 R;  2RK2 A;  4KGX B;  2XDB A;  1N8R R;  4M7D D;  3N5B B;  2D6F A;  2KVQ G;  1Q86 C;  1SKU B;  1IRX A;  3M0U A;  2NUT B;  1ZA1 B;  2HQH A;  1WXT A;  1X01 A;  2K3Y A;  1B07 A;  3CBP A;  1KFZ A;  1TWB A;  1WLP B;  2HSP A;  1YP5 A;  1Q81 U;  4PJO G;  3OYN A;  1NEG A;  1WNL A;  1UHC A;  4NL2 A;  2RO0 A;  2FHD A;  3QII A;  1KQ1 A;  2LQK A;  2VYT A;  3KFV A;  2QQS A;  3M56 A;  3MP6 A;  1IHV A;  2MCN A;  3KXT A;  1AZG B;  2DL8 A;  2KSS A;  2LTO A;  2FO0 A;  4HVU A;  3SEM A;  4PJO E;  3A8L B;  4DOW A;  3OS2 A;  4DEY A;  2CH4 A;  1SSH A;  3LWH A;  5EC7 A;  5KE2 A;  2MOX A;  2CRE A;  2KT8 A;  4PLL A;  3CC2 Q;  3PFS A;  1K73 U;  4FSX A;  2QEX T;  3MP1 A;  3HRS A;  2RQR A;  3DB3 A;  5CK9 A;  1N8R U;  1PKT A;  2YRV A;  4M4Z A;  5KE3 A;  3QWX X;  5I2S A;  1OOT A;  2DYI A;  2MK5 A;  3QUI A;  4PJN A;  4OF1 A;  2JNG A;  1M8V A;  2VUB A;  3M53 A;  2YHT A;  4J7I A;  4M78 B;  4JZ4 A;  3OBW A;  2ABL A;  4ORZ A;  2DVE A;  2WSE E;  1ARK A;  1RL2 A;  1Y0M A;  4ZGD B;  3NGP A;  1WHK A;  2LZ6 B;  2VB6 A;  2DVJ A;  1M90 U;  2JS0 A;  3D7S B;  2E4H A;  3GLX A;  2QEX A;  3WXM B;  5CKF A;  1CKA A;  3QG1 A;  1XJW B;  5IH2 A;  3QJY A;  4TVR A;  4OVA A;  4EMK B;  5FRN A;  1UGV A;  3TQ7 P;  4ZNX A;  4D8K A;  1W2B A;  2QAS A;  4FYY B;  4C0D C;  3L2Z A;  4IIO A;  4F04 B;  3PMI A;  1BI1 A;  1Q82 R;  1PKS A;  1VQL T;  1TUG B;  5HK0 A;  5KYN A;  3JCM c;  3RKW A;  1WX6 A;  2CZ1 B;  1Q95 G;  1O9S A;  4ELY C;  3CCL Q;  4XTW A;  1M3B A;  1UJY A;  3E9F A;  3M55 A;  2LDM A;  2VKN A;  2KK4 A;  1R0B G;  3M0R A;  2DL7 A;  4OMM A;  2DXU A;  3FLG A;  2OX7 A;  3CCV T;  4KRT A;  2ZPB B; 
#chains in the Genus database with same CATH homology
 5DLQ E;  2K5I A;  5LJ5 h;  4A4E A;  2WSC E;  3G71 T;  4HCB A;  5CQY A;  1I8F A;  3VU3 C;  1BI0 A;  4C0F A;  1VQ8 T;  5LJ5 d;  2QDY B;  2RI5 A;  4C8Q B;  3HKS A;  2XDD A;  3JCM h;  3EFR A;  5LL6 S;  1M4Z A;  4BAC A;  3OW2 S;  3JB9 G;  3OYG A;  2P4T A;  1YJ9 A;  1VQL A;  4BDZ A;  2K5L A;  4M78 G;  2L5Q A;  2EKO A;  2H3J A;  4NS5 A;  3JCM d;  4IKF A;  3JCM V;  4BY6 B;  4DQ2 A;  4E7L A;  5GAN 5;  1YI2 T;  1QVG A;  1N27 A;  4OP0 A;  3I55 A;  4IUQ A;  4A4K A;  4A53 A;  1Q82 U;  1HXD A;  2RI2 A;  2DIG A;  2ZCF B;  2EJG A;  3BDL A;  4PJO D;  1P92 A;  3OYD A;  3OYL A;  3FB9 A;  1QVF A;  2RI3 A;  4P5N A;  3CCM A;  1NJI U;  5GMK l;  3LGL A;  3RKX A;  2ZPF B;  5GMK h;  4XU3 A;  1K8A U;  2LCC A;  2E64 A;  2HAX A;  3QHS A;  4KUI A;  3MP8 A;  1B34 A;  3CXC A;  4BDY A;  4M7D B;  4ZGJ B;  4IUU A;  3OYM A;  3MEV A;  3FIF A;  4BE0 A;  2EIF A;  4II1 A;  4M78 E;  3OYJ A;  5CQX A;  1YIT A;  2PVO B;  4LDW A;  5A0L A;  4GLK A;  3CD6 A;  3X25 B;  4M77 D;  1VQN T;  3WVD B;  5GAM d;  3S3N A;  4M7A A;  4C0Z A;  1M9S A;  4PJO F;  1Q82 C;  2XD0 A;  2WSF E;  5GAN j;  4PJO C;  4R56 A;  3G71 A;  1N9R A;  5KCO A;  1LJO A;  4OGE A;  3RMS A;  4EMH A;  3CC4 T;  4FT2 A;  1VQ8 A;  1NJI C;  2LCL A;  4QW2 A;  1UGP B;  5CKH A;  3VV0 A;  1HK9 A;  4OB1 B;  4X9D A;  3JB9 F;  4C5G A;  4JDS A;  1Y7X A;  4C0G A;  3V7R A;  4LD9 K;  4M78 F;  5LJ5 j;  4JLG A;  4PKC C;  1YI2 A;  4HCC A;  4N0A A;  2QA4 T;  1IRE B;  2DKG A;  4BI8 B;  4QVD A;  2HD0 A;  4VUB A;  1QP3 A;  1WGS A;  2RH2 A;  3MEW A;  3OB9 A;  5GAO q;  2OTL T;  2M1H A;  3TEE A;  4M77 C;  4JUV A;  2ZPI B;  3GNG A;  4Y28 E;  5CVI A;  5M9O A;  5L8R E;  4JRK A;  3MO8 A;  4J6W A;  4F7U B;  2CGH A;  3INZ A;  2GFA A;  1KQ2 A;  5EG2 A;  3JCM X;  2ZGW A;  5FU7 C;  4X34 A;  2LQ8 A;  3DLM A;  4B9X A;  2E10 A;  4KBM B;  1WQ7 A;  5CR2 A;  2K3X A;  1VQ4 T;  1V29 B;  2KY9 A;  2L89 A;  5GAO m;  2E1H A;  4FU6 A;  3JCM P;  1WJQ A;  1IZ6 A;  4V2S A;  3OY9 A;  2DAQ A;  3ZBD A;  5GMK j;  4M7D G;  5HY6 A;  5GAN e;  1JRI A;  2MI6 A;  4XK8 E;  5I2M A;  2K2V A;  1EIF A;  1I4K 1;  1KD1 U;  3QYH B;  2EQJ A;  3LH0 A;  3VUZ A;  3ZEH A;  5A0D A;  2Y90 A;  3CC7 A;  4MDX A;  2O4X B;  1NPR A;  4IUR A;  4N4I A;  3VUB A;  2K57 A;  3OSV A;  1G3S A;  1XQH A;  1Y96 B;  2L8D A;  2XG8 D;  2LT1 A;  4C8Q G;  5GMK i;  2QA4 A;  1KQS A;  3JCM b;  2ZZD A;  2YLB A;  3MEA A;  4QQ6 A;  1AHJ B;  3KBG A;  3S6W A;  1KG1 A;  1ZHI A;  2XDP A;  3JCM e;  4PJO A;  2VC8 A;  2OTL A;  3P8B B;  4C92 D;  3SD4 A;  3OYC A;  2PUK B;  1D3B A;  3L2U A;  2P0P A;  2V8I A;  2MMP A;  1S72 T;  2CZ0 B;  2GF7 A;  3HRU A;  4MDW A;  3UT1 A;  3BDU A;  4A54 A;  3WVE B;  2CYZ B;  3M58 A;  4BI3 A;  4Y91 A;  4CRI A;  3LYI A;  5C6S A;  2EAY A;  4C5H A;  1UB4 A;  1WJR A;  2P0Q A;  4HCZ A;  5GMK m;  1VQ4 A;  1VQK T;  3A5Z B;  1BI2 A;  1O75 A;  3OW2 A;  3CC2 T;  2DO3 A;  2CS7 A;  5LJ3 h;  4M75 F;  2NLU A;  4O5V A;  4M77 A;  3SWN C;  4C8Q E;  5GAO l;  4M75 C;  2PU9 B;  2PQW A;  3I56 T;  1YIJ T;  2VV5 A;  5HKC A;  5LJ3 d;  1N6A A;  2R5A A;  3V7S A;  3ASK A;  3QBY A;  1UGR B;  1WJS A;  4C92 C;  3JAM E;  2QTX A;  1OYX A;  2QQ9 A;  1JJ2 S;  1YBY A;  5FU6 B;  2DTI A;  3QSU A;  1KHC A;  1NPP A;  1B34 B;  5GAM e;  2RHX A;  1M5Q 1;  3BW1 A;  2LT4 A;  1I81 A;  2ZPH B;  3X26 B;  5C0M A;  5GAN 7;  4JS5 A;  3OYB A;  4UC4 A;  3J7A F;  1BI3 A;  4MZP A;  3QZ9 B;  5IAY A;  4JRP A;  1PSE A;  4M7A B;  5J3B A;  3OS0 A;  3L2W A;  2IG0 A;  4D6W A;  4M7D E;  4RCB A;  5CKD A;  3QYG B;  3A8H B;  4MZM A;  4N4G A;  2F5K A;  2HNI A;  4XTX A;  3L2V A;  3G7Z A;  1XTD A;  1VIF A;  5HK3 A;  3CME T;  1S72 A;  3UPU A;  2F69 A;  3PT9 A;  5DY9 A;  3QKJ A;  3URG A;  4EDU A;  3H8Z A;  3HSB A;  3FJP A;  2E41 A;  3X28 B;  5GAO r;  2FB7 A;  4E47 A;  2RJE A;  1ZQ1 A;  4BUG A;  1K9M U;  1VQK A;  3RIR A;  1Y07 A;  4F7U G;  2OAU A;  1VQ7 T;  4E7K A;  3CC2 A;  1KC8 U;  1KHI A;  4C5I A;  1H3Z A;  3I56 A;  1YIJ A;  4M7D F;  4QQD A;  1FX7 A;  3JB9 D;  4PL6 A;  3T9N A;  2OTJ T;  3SFM A;  3UDC A;  4M78 D;  3FRN A;  2V8J A;  1Y71 A;  4NL3 A;  2GQV A;  3CEY A;  3RES A;  3GPL A;  2KAF A;  4A4H A;  3CCU T;  3GP8 A;  1JBM A;  3CCV A;  5GAO n;  1NZ9 A;  2HQE A;  5LJ3 j;  2FVU A;  4LDV A;  2EQU A;  3V8K A;  4MML A;  2CZ7 B;  5D6X A;  5GAN f;  2FYK A;  4HKE A;  4QVZ A;  3SB2 A;  3CPW A;  3SWN A;  2XKO C;  4M75 A;  3LWI A;  2LVM A;  1Q81 C;  3G6E T;  1K9M C;  4F7U E;  5GAN g;  3QJ6 A;  3E19 A;  4JJN K;  1G5V A;  4X9C A;  1KC8 C;  3QZ5 B;  4C92 A;  3M5A A;  1ZBX A;  3C12 A;  2D9T A;  2DXB A;  4O6J A;  3ZFJ A;  3OMG A;  1VQ5 T;  2XI9 A;  4LDU A;  4M78 C;  1BKB A;  5LJ5 f;  3CME A;  3HFN A;  5FRO A;  2BIV A;  2DEQ A;  1U8R A;  3V7C A;  2DJZ A;  3JCM f;  3OS1 A;  2ZPE B;  3TRE A;  3KUF A;  2IVW A;  3MHX A;  4F7U F;  3JCM g;  2RJC A;  2Y4Y A;  2C06 A;  2JOY A;  4ZN3 A;  1UGS B;  1NE8 A;  4IUP A;  3S3O A;  3HHT B;  3F70 A;  3CPW S;  4N4H A;  1YCY A;  3CCL T;  3PGG A;  2E12 A;  2GFU A;  3OQ5 A;  3P8D A;  1MGQ A;  4ELZ C;  1VQ6 T;  3FEO A;  2OTJ A;  2E70 A;  4E7J A;  3CCU A;  2VGN A;  1G3W A;  1OI1 A;  2RM4 A;  2K5F A;  1MHN A;  3QO3 A;  5LJ3 e;  1WQW A;  1VQM T;  1VQN A;  1FXX A;  4GY5 A;  3DB4 A;  5CAI A;  4EMK C;  5DM7 R;  1Q7Y C;  3X20 B;  4M77 B;  3LGF A;  3G6E A;  3CC4 A;  3J80 E;  3C95 A;  3OYH A;  2QQR A;  4XTZ A;  3HL8 A;  3V8J A;  2DXC A;  5GAM f;  5KH6 A;  2CKK A;  4L6V 5;  2XK0 A;  4FM4 B;  4E7H A;  4HA8 A;  3MEU A;  5CKB A;  3AHU A;  5FU7 B;  1BIB A;  4OB3 B;  5GAM g;  2JZ2 A;  4EPC A;  5LJ5 e;  1X75 C;  1M1G A;  3CCR T;  2JVV A;  3M4Y A;  1XOV A;  1U1S A;  4FT4 A;  1VQ5 A;  4M7A G;  5A2Q E;  4JRI A;  1G3T A;  4M75 D;  5FRM A;  2X4Y A;  4R55 A;  2X4X A;  2GCX A;  2E6Z A;  4PLI A;  3JCM Q;  2JN0 A;  3E1S A;  1QP2 A;  1FWZ A;  2EJF A;  1OZ3 A;  1G3Y A;  3NFC A;  2XIC A;  3R6O A;  1YHQ T;  4JS4 A;  4HT8 A;  2DD5 A;  3L2R A;  2X4J A;  3CCL A;  2EFI A;  2KQW A;  5D6Y A;  2AHJ B;  2BUD A;  4M78 A;  1M90 C;  1VQ6 A;  4BI4 A;  3JB9 H;  2QI2 A;  2E6N A;  2VXE A;  1BIA A;  4JLI A;  4A4F A;  4C8Q D;  4FL6 A;  3PMT A;  1UEB A;  1W4S A;  4C0D B;  3OYA A;  4M7A E;  4MMK A;  1PSF A;  3P8H A;  3M9Q A;  3RUX A;  1GXI E;  5GMK e;  4NOY A;  1VQM A;  3FDR A;  4YTL A;  3CCJ T;  3O8V A;  2WAC A;  5CO7 A;  2R5M A;  2MAM A;  4XQ3 A;  3DLL A;  5FU6 C;  1DJ7 B;  4BB7 A;  3PTA A;  3DKM A;  1WPY A;  2CZ6 B;  4XU0 A;  3SDZ A;  1VQP T;  3TU4 K;  2RHZ A;  3E9G A;  3OSS C;  5DLO A;  1VQO T;  4LDX A;  1JB0 E;  3OA6 A;  1YJW A;  2PVD B;  5CCA A;  1YJW T;  2RK2 A;  1W2B S;  4M7A F;  4C8Q F;  2PVG B;  3A8O B;  3LX7 A;  3M57 A;  3QDR B;  3NTH A;  4C8Q C;  2XDB A;  3CCM T;  3N5B B;  1TH7 A;  4M7D D;  2B8A A;  1YJN T;  4EMK A;  4BD3 A;  3SWN B;  2D6F A;  3QPH A;  2KVQ G;  1Q86 C;  5IN1 A;  4BY6 C;  2XHC A;  1VUB A;  2FL7 A;  4J8O A;  4C92 B;  3FC3 A;  1YHQ A;  4OB2 B;  4QQG A;  3PIO A;  1X01 A;  2K3Y A;  1YIT T;  1Y96 A;  3CBP A;  5FLX E;  3ER0 A;  3BY7 A;  3MCA B;  4J83 A;  4ME7 A;  2HBP A;  2K4Y A;  2L3R A;  3M59 A;  2RJD A;  4MZT A;  4N0A C;  4DOV A;  5KCH A;  3CBM A;  4PJO G;  3OYN A;  1Q81 U;  1VIE A;  2BKD N;  3ME9 A;  1WNL A;  3CCS T;  3PIP A;  3S3M A;  2YLC A;  4NL2 A;  2RO0 A;  3G4S T;  2FHD A;  3QII A;  4QVC A;  1KQ1 A;  3RER A;  4M7D C;  2EQK A;  2LQK A;  2M9U A;  2VYT A;  3VYH B;  3CCJ A;  5GAN 2;  3L1A A;  2DTH A;  3OYE A;  2QQS A;  3M56 A;  3MP6 A;  3KXT A;  2JTF A;  4KT0 E;  1VQP A;  4XU2 A;  3C94 A;  3J81 E;  5LJ3 f;  1VQO A;  5GAN 4;  2KSS A;  2RA2 A;  3GOX A;  2LTO A;  4M77 G;  4BE1 A;  3L42 A;  5LJ3 g;  2RHI A;  4ZTF A;  4PJO E;  3A8L B;  4OMF B;  4DOW A;  3Q1J A;  2QQB A;  3OS2 A;  2MWP A;  5D6W A;  3LWH A;  2O01 E;  3JCM J;  3VYG A;  1YJN A;  2LX9 A;  1H64 1;  2HQX A;  2RHY A;  5KE2 A;  3A8M B;  1LNX A;  5GAN 6;  4PLL A;  5IT9 E;  3PFS A;  1K73 U;  2QXF A;  3QXE B;  5I21 A;  2X35 A;  4FSX A;  1QW1 A;  2QEX T;  2DZ9 A;  2PUO B;  3MP1 A;  3GF5 A;  3HRS A;  4ZTJ A;  5GAM h;  3DB3 A;  3VKI A;  5CK9 A;  5LJ5 g;  3OYF A;  1RI0 A;  1N8R U;  1VQ9 T;  2DK3 A;  2YRV A;  1Q7Y U;  1QVG S;  5KE3 A;  2MWO A;  3HFO A;  4C8Q A;  3PNW C;  4M77 E;  4L59 A;  5I2S A;  3CCQ T;  1VQ7 A;  2VGM A;  3CCS A;  4PJO B;  2MF2 A;  3H6Z A;  3QUI A;  3G4S A;  4OF1 A;  2RJF A;  2EJ9 A;  4Z02 A;  1M1K U;  2A7Y A;  3CMA T;  1D3B B;  2R58 A;  1QVF S;  4J7F A;  3CC7 T;  2JNG A;  5A0G A;  1M8V A;  1K8A C;  4B9W A;  2VUB A;  3M53 A;  5J39 A;  4RMO A;  1K73 C;  3CPF A;  3LLR A;  2EQM A;  4C5E A;  2YHT A;  4J7I A;  4M78 B;  3CXC S;  2LC4 A;  4HT9 A;  2DXT A;  3NTI A;  4XAX B;  3RMQ A;  4FIB A;  4RKU E;  3GNF B;  1R8O B;  3OBW A;  3OS5 A;  1N8R C;  3JB9 J;  2R57 A;  4M77 F;  4WF2 A;  2DVE A;  2WSE E;  4XU1 A;  1RL2 A;  4ZGD B;  4M7D A;  2ZPG B;  4OB0 B;  1U1T A;  2X4W A;  1M90 U;  3OYI A;  2EYQ A;  2JUF A;  3JRZ A;  1X6O A;  1M1K C;  4BE2 A;  3CCE T;  3GLX A;  3MET A;  2QEX A;  3LW5 E;  2VXF A;  4Q5W A;  4M75 G;  3WXM B;  5CKF A;  4KUD K;  2DD4 A;  2DIQ A;  2KMT A;  1VQ9 A;  4KUL A;  4ATO A;  5GAO p;  2M0O A;  3X24 B;  3QG1 A;  1LOJ A;  4OGC A;  4C92 G;  2XU8 A;  3CCQ A;  3QJY A;  3HP9 A;  4TVR A;  4OVA A;  2D0Q B;  4ZGE B;  3L2Q A;  4EMK B;  2RD1 A;  3VJP A;  5FRN A;  2P0K A;  1OZ2 A;  2LRQ A;  4RG8 A;  1W2B A;  3OMC A;  5J26 A;  4RCC A;  5GAM j;  4XTU A;  5CIU A;  4CI0 C;  3CMA A;  4E7I A;  1I5L A;  1BYM A;  2E5Q A;  4EMG A;  3TCJ A;  4IUV A;  2F5T X;  2EWN A;  3OBY A;  4M7A D;  2JTM A;  4C0D C;  3L2Z A;  4J6Y A;  3JB9 I;  3A8G B;  3PMI A;  3OYK A;  3HPW A;  1BI1 A;  4J5Y A;  3EFS A;  4M75 E;  2E65 A;  2DTO A;  1Q86 U;  1YJ9 T;  4F7U A;  3HRT A;  1QVP A;  1UGQ B;  3M4G A;  1VQL T;  4J6X A;  2RB6 A;  5HK0 A;  3JCM W;  4C92 E;  2M16 A;  1JJ2 A;  2DZC A;  4XTV A;  3BFM A;  4IUT A;  3JCM c;  3EAE A;  3RKW A;  4XTY A;  3I55 T;  1KD1 C;  2QQA A;  2CZ1 B;  2RHU A;  2V8K A;  3CCR A;  3NTK A;  2RK1 A;  1M1F A;  1N9S A;  4LDY A;  3CCE A;  1O9S A;  4PNO A;  2I2L A;  4ELY C;  3UWN A;  4M7A C;  4A4G A;  3JSC A;  3GIB A;  4XTW A;  4JRQ A;  2DPP B;  3E9F A;  3M55 A;  4ZN1 A;  5GAN 3;  1SSF A;  2LDM A;  4M75 B;  4L5G A;  1KQS S;  2KK4 A;  5GAN h;  5CKE A;  4C92 F;  2XID A;  2LNV A;  2Y4X A;  2O4X A;  3CBO A;  5AYF A;  5GAN d;  2DXU A;  3FLG A;  1XNI A;  3RKY A;  4DA4 A;  3CCV T;  2A3L A;  3OYY A;  3CD6 T;  3C4S A;  3V8L A;  2KDS A;  3M54 A;  2G3R A;  5GAN 8;  4RG2 A;  2ZPB B;  4LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...