4M7DA

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
ATLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 14
structure length 65
sequence length 65
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dA00
4XTXA 2HNIA 2E10A 1BIBA 5LJ3f 4C92E 4EMGA 3JB9H 4M7DF 3V8LA 5GAN2 5GANf 5GAMh 4C8QC 5GMKh 2DTIA 4M7AG 4PJOC 4C8QG 3JB9D 4M7AB 5GAOp 1N9RA 3FJPA 2RM4A 2EJGA 4C8QB 4EMHA 5LJ3e 4PJOG 3HFNA 5GAN4 3AHUA 2E64A 1H641 4PJOB 4EMKC 2DXUA 3SWNC 2DZCA 2EWNA 4F7UF 1D3BB 4M75F 4A53A 4M7AA 1LJOA 1LOJA 4OP0A 2E65A 2EJFA 4RCBA 4RCCA 4X9CA 4C8QA 4X9DA 4EMKB 4XQ3A 3SWNB 5LJ3j 4M78G 4PJOA 4C92F 4M78B 5GAMd 1D3BA 5GMKm 4M7AE 1U1SA 1KQ1A 4J6XA 4C8QE 3V7CA 3JCMW 4EMKA 3SWNA 3FB9A 4PJOE 1I81A 5I21A 3JB9G 4M78A 1TH7A 4JUVA 5LJ5d 5GAN3 4N0AC 1Y96B 2VC8A 4JLIA 4WF2A 3PGGA 3JB9I 4M7AC 5GAN8 1N9SA 3RKWA 3JCMg 3QO3A 1X01A 2EAYA 2DEQA 3RKXA 5LJ5g 3BDUA 3GIBA 1JBMA 3QUIA 3VU3C 2VXEA 4MMKA 4XTUA 3QHSA 5GAOn 5GAN5 3JCMh 4N0AA 3V8JA 5GAOq 4M7AF 4C8QF 5LJ5h 5GANe 3JCMP 2Y90A 5GAN6 4PJOF 1JRIA 4M78C 5GAMf 5GAOm 4J6YA 3EFRA 1I8FA 5GAOr 4QVDA 4M77D 4XU3A 2E1HA 4XTYA 4NOYA 4XU1A 2E41A 5GANj 4XTVA 5GMKl 3QSUA 1I4K1 5LJ5f 2DTOA 5GAMe 4XU2A 5CAIA 3RIRA 5GMKe 4A54A 2DKGA 3JCMX 3JCMd 1I5LA 4JRKA 4HT9A 3JCMc 3EFSA 2EJ9A 4HA8A 2JN0A 3JB9F 3JCMb 3L2ZA 4M7DD 2DZ9A 4M77C 5LJ5e 3M4GA 4M78E 3V7SA 5GMKj 5GAMj 1M8VA 3RESA 4F7UB 1Y96A 2VXFA 5LJ3g 2DVEA 4M77G 4XU0A 2FB7A 4M77B 1KQ2A 1WQ7A 3BFMA 3JCMQ 4JRIA 3INZA 4MMLA 4XTZA 1YCYA 1WNLA 4QVCA 1LNXA 3RUXA 1BIAA 2YHTA 4M77A 5GAOl 3FIFA 4HT8A 4M75D 3SB2A 4NL3A 3L1AA 4NL2A 2I2LA 4PNOA 2YLCA 4M7DG 4M77E 4C92D 3JCMf 4M7DB 1WQWA 4M78F 3V8KA 4XTWA 4J5YA 3HSBA 2K57A 3V7RA 5GMKi 5LJ3d 1HK9A 4M7DA 3JB9J 2DTHA 4M75C 1U1TA 3JCMe 5GANd 4Y91A 3HFOA 4DQ2A 4F7UG 4M75G 2CGHA 1B34B 3RKYA 4M7DE 4M75B 4C92C 2DJZA 5GANg 2ZGWA 4C92G 4M77F 5LJ5j 2RA2A 4C92B 1B34A 4M7AD 4F7UA 4M75A 5LJ3h 4C8QD 2DXTA 1HXDA 1M5Q1 5DY9A 5GANh 2QTXA 4PJOD 3BW1A 4M7DC 2FYKA 4J6WA 1MGQA 4C92A 3JCMJ 4F7UE 4M75E 4V2SA 3BY7A 1WPYA 2RB6A 5GAMg 3RERA 2YLBA 2RD1A 3JCMV 5GAN7 4M78D
chains in the Genus database with same CATH superfamily
2QQSA 3EGDB 3V8LA 5GANf 1PG5B 1EZZB 2LNVA 4EMHA 1H641 2OTLA 2YDLA 3CCUA 2EWNA 4ATOA 2QQ9A 2SRCA 2FPDA 2DILA 1W2BA 4B9WA 4XQ3A 2B8AA 3G6EQ 1YIJA 4AT1B 4JJNK 1QP2A 2D9TA 4R0KA 4C0ZA 5LJ5d 3CCQA 2EW3A 1YI2Q 3JCMg 1V76A 1JBMA 1GFCA 3VV0A 3OYDA 2DD4A 4GBQA 4C8QF 3EGUA 5GANe 4DOVA 1CKAA 4FL6A 4L6V5 4NOYA 3CCVA 3GNGA 3LWIA 3QSUA 1SSHA 2E6ZA 2ZCFB 4XU2A 1ZSGA 2DKGA 2M0OA 4FSSA 1TU0B 2NWMA 2AHJB 3FDRA 3M4GA 3V7SA 1YJWQ 5GMKj 1M8VA 1UEBA 3O5ZA 1QWFA 2KRMA 1QLYA 2CP5A 1KJWA 1M4ZA 4WTOB 4RTXA 1XNIA 4ME7A 2XDBA 5EC7A 4M7DG 1CSKA 3JCMf 3MP6A 2QG9B 1WYXA 2XD0A 3OYAA 1RABB 2LQ8A 5A2QE 4OVAA 5HY6A 1BI3A 3V7RA 5GMKi 2CT4A 3JB9J 1OPKA 4DQ2A 2ZPHB 2ED0A 3RDVA 5EG2A 2DA9A 2HKQB 4C92B 2L5QA 1ZA2B 3CPWP 2NUTA 3A98A 2RH2A 3JCMJ 2E3IA 3BY7A 5GJWB 2FYKA 5GAN7 2YT6A 4M78D 3CCEQ 5IXFA 2BIVA 1SSFA 4C0FA 2JT4A 4C8QC 1YHQQ 1W2BP 4HCCA 3EGDA 2E5KA 3HP9A 2LQNA 4PJOB 2DXUA 2E3HA 4A53A 1QQJA 1Y57A 2QQAA 1VQ9T 1Q82C 3CC4A 2FRYA 2KQWA 4M7AE 1WLPB 3ULRB 4J6XA 4D8DA 1VQKQ 3OW2S 3X26B 3CCMA 1G3YA 1QP3A 2JZ2A 4N0AC 3A8HB 3OS0A 1UGPB 2MWOA 1TUDA 1NLPC 5KE3A 2A0FB 4MMKA 1FMKA 5GAN5 2CYZB 1HSQA 1TS9A 3JCMP 2KI7A 5GAOm 1NZ9A 4M77D 2QGGA 5J39A 1VQ5T 3UWNA 3EG3A 2AZVA 4KGXB 2X4XA 4E7IA 1W70A 2QTVA 3QKJA 1Q7YC 5IXBA 1NG2A 3E9GA 1R8OB 2KT8A 1UG1A 4E7JA 4PJNA 2PNIA 5IHIA 6AT1B 5KYXB 1BCMA 1YCYA 3M0TA 1IRXA 1ZLMA 3CCUT 1BB9A 2I2LA 9ATCB 3CXCA 3S6WA 1YIJT 1VA7A 1V29B 1K4US 1PCXA 3HSBA 3GLXA 3WXMB 3CCQT 1MV0B 3HRSA 1JJ2A 2RI2A 1BBZA 4AG2C 1G8XA 1IREB 1IHVA 4FW2A 4ANJA 2W10A 1M27C 4IUPA 2NUZA 1X6BA 3FRNA 4J9HA 4V2SA 4C92A 2P4RA 2DL7A 4OGEA 3JCMV 2HNIA 3G6ET 4K11A 4ORZA 1VQLA 2WACA 2QGFB 1ZBXA 4C8QG 3VS6A 5GAOp 3PFSA 4E47A 2RMOA 1KHCA 3TQ7P 2HEQA 4PFOA 1LOJA 4X9CA 2E5QA 2RQWA 4PJOA 1H3HA 3MKDA 1X27A 2V1RA 1M90R 4JS5A 2MWPA 2CH4W 1I5OB 1GRIA 1Y96B 3QXEB 4WF2A 4HVUA 2BUDA 3PE0A 4BB7A 1U3OA 2DEQA 1K8AC 2GBQA 2YSQA 7AT1B 1EIFA 2DBMA 5GAN6 2E4HA 3OS2A 4J6YA 2IG0A 5CVIA 2RHYA 2E41A 2G6FX 4FYYB 2FVUA 2OJ2A 4KULA 3NTIA 2X3WD 1GCQA 1PHTA 4A54A 1UFFA 4J9CA 1NJIC 2EPDA 4JS4A 2GQVA 2K79A 2MAMA 5FU6B 2YWWA 4X1VA 1VQ6A 2F5TX 3CXCP 1ABOA 2X9HA 5IHNA 1KG1A 2YHTA 2H3EB 1IO6A 2B86A 4IUTA 4HVVA 5KYXA 8ATCB 3CC4T 2QYZA 3G71A 2L89A 1JJ2P 1W4SA 1WJQA 2YRCA 1M3AA 3J7AF 1B3QA 3CCET 5D6YA 3TSZA 4BDYA 2MF2A 2FZGB 4F7UA 1M5Q1 3QZ9B 3GBQA 3EGXA 5FW9A 2GTOA 1O75A 2CP0A 2DL5A 4EMGA 3M0PA 3EG1A 5GAMh 2HZYA 2CZ6B 1VQMA 2EJGA 5J3BA 4KUDK 5FU7C 4LXCA 4OB2B 1M1KU 3SWNC 2HBPA 4L59A 1D3BB 4OP0A 2RJFA 1M90C 4HCKA 3L2RA 1BYMA 2BKDN 3EG9B 2EYYA 1YBYA 1GBQA 2DMOA 1OYXA 5I21A 3L2VA 1W2BS 1TH7A 4N4GA 3R6OA 3ASKA 5IT9E 1PNJA 2KEAA 1K9MC 1T3SA 4OGCA 2BZ8A 1RAGB 3OYMA 4ESRA 1AOJA 1H92A 2L3QA 3OYJA 2V8KA 4BI4A 2K5LA 4OF1A 2JS0A 4BE1A 4XTVA 1VQ4Q 1I5LA 3CPFA 2QEXA 3JSCA 1TOVA 3L2ZA 1VQLT 3RESA 2NUPB 1M9SA 5LJ3g 1GL5A 2DRKA 4QVCA 1PSEA 2RJDA 4IURA 1M2OA 3X25B 2F2WA 4II1A 4M77E 2LQKA 3G1JA 1Q81U 1Q86U 1VQOA 4A4HA 1S1NA 2ROTA 1M1KR 2D0QB 2LJ1A 4ZGJB 4M75B 1PRLC 2MK5A 4JZ3A 1S72Q 3QWYA 2PVGB 1GCPA 4C5GA 1JXOA 4BE0A 2CP2A 3MHXA 2VYTA 1MGQA 1MMNA 2EFIA 4FW1A 3CMEQ 5LJ3f 3I5RA 1WHGA 2E70A 4N4HA 5GMKh 3BE3A 3JB9D 2X4JA 3FJPA 2QI2A 2E64A 2DZCA 1VQ6T 2XKOC 3OYCA 3CD6A 5LJ3j 3M57A 1TUGB 1D3BA 2L3SA 3QBYA 4LDXA 1PC0A 4FT4A 3EG9A 4E7LA 2ESWA 3G71T 3OQ5A 5AYFA 1XTDA 1YN8A 1N8RU 1ZSZA 1QCOA 1C1AA 2KT1A 2VXEA 3JCMh 4M7AF 1D1CA 3KXTA 1VQ7A 3OSSC 1JXMA 1M3CA 3KFVA 4XTYA 1Q81R 1Q86R 3C0CA 4BUGA 1WXBA 1N5ZA 1ZA1B 1I4K1 2EBPA 4Z89A 5LJ5f 1K1ZA 2L3RA 5IHKA 3QYHB 3REBB 3A1PA 2LX9A 3MP1A 4C0DC 1SF9A 4YTLA 2O01E 3LGFA 2HKNA 1VQMT 5DLQE 1EFNA 2NUPA 4AG1C 2VUBA 1F1BB 2CDTA 4Z88A 4NL3A 2EYZA 5A0LA 1WZOA 3VRZA 3UF4A 4MDWA 5KYNA 4M7DB 1WFWA 2IPOB 1UUEA 3CXCS 1VQ8A 4KRTA 3LGLA 2LZ6B 1OZ3A 2F2VA 4FM4B 4MZPA 2R57A 2DJZA 2V26A 5GANg 2RA2A 4LUDA 1HJDA 4M75A 4LDUA 1ZUYA 1FX7A 1HXDA 4JJCA 4M7DC 2KK4A 3X28B 4OMMA 1N8RR 2CS7A 3I56Q 4BE2A 2QEXT 2PVOB 1JO8A 5CR2A 2EKOA 3MP8A 5KYUB 4PJLA 1VYTA 3L2QA 2K5IA 1Y7XA 2EJFA 2QASA 2BZXA 3ZEHA 4DBHA 2EIFA 1I81A 3J81E 1D0ZA 4OB0B 1VQOT 2JW4A 3M5AA 1WDXA 1YNZA 4RUGA 2RK1A 4F16A 2XIDA 2RHIA 3VS0A 1ZUKA 5GAOr 2LCCA 1MUZA 5GANj 1NYFA 2KRNA 2MCNA 4IIOA 5FLXE 2QQRA 4CC3A 2YUNA 1NPRA 2DTOA 2ABLA 3IQLA 2QAZA 3THKA 1M30A 3I55A 3NGPA 4EDUA 4QQDA 2CZ0B 2AK5A 4JRQA 1K76A 2LRQA 1RAAB 1OOTA 1SRMA 2I0NA 3JCMQ 1MV3A 2J05A 4DBFA 4XTZA 4DBQA 2PUKB 3CD6T 3FIFA 5A0DA 2FG0A 1U06A 1Y07A 1JEGA 1YJ9Q 4C92D 2DM1A 1IGQA 3E9FA 3G6EA 3PVLA 2K57A 3H0FA 1K73C 3OYHA 3G4SQ 4M7DA 2BTTA 1AT1B 3OSVA 5FWBA 3OYFA 3RR6A 2O9SA 4A4GA 2OTJQ 4QKUA 1QVGA 1YI2A 1NM7A 1SEMA 2CSQA 3OYGA 3EFOB 2J6FA 3FLGA 1VQ7T 4PJOD 2DFUA 3MPUB 2EQKA 1YJNQ 2K6DA 4M7AG 2PUOB 4C8QB 3M0QA 2NLUA 4EMKC 1QVFA 3EHRA 2JVVA 5KYUA 4BY6B 2F2XA 4JLGA 4RCCA 1YJWA 3CC2Q 2M51A 2RPNA 4TVRA 4LD6A 5IN1A 2O4XB 1WXUA 1RADB 5HK0A 1VQ8T 5GAN8 4J7IA 4M4ZA 2QK0A 4LDVA 3U23A 1KQSA 4BY6C 1I0CA 2QXFA 3CCMQ 3S3NA 2G3RA 1YITQ 2KVQG 3LH5A 4XU1A 3I9QA 4BI3A 1M1FA 1WHJA 2E6NA 1UJYA 1QMCA 3TREA 2GFAA 4ZNXA 3KUFA 3CCEA 4IUVA 2DERA 5CKHA 1FXXA 3M4YA 5L23A 3E2UA 3M0SA 4PLIA 1PD1A 2YLCA 1VQPQ 1M1GA 2KROA 2FRWA 4J5YA 3CQTA 1VQKA 1QVGP 2DTHA 2GTJA 4J9DA 3H41A 2COYA 2R5AA 3OBYA 2VV5A 1VQNT 1AWXA 1H8KA 2HCKA 4OMOA 2A3LA 2Y4XA 4M77F 2MPXC 4ZTJA 3LW5E 2M1HA 2HL3A 4XK8E 2DLPA 2A08A 1QW1A 2D8HA 4PJMA 3OA6A 2CSIA 3DLLA 3I55T 1QVFP 2LQWA 2K3XA 2ECZA 2YUOA 4O6JA 1NE8A 1VUBA 2X3XD 1RI9A 3VYHB 2QDYB 2RK2A 4C8QA 3VJPA 1PWTA 2HBWA 5GMKm 5KH6A 1G83A 2RQVA 2H3JA 4HVWA 4KT0E 3META 1CKBA 1KQSP 3JB9I 2L2PA 5FRMA 3QO3A 1R77A 3BDUA 1OEBA 4PL6A 2M02A 4N0AA 3ZBDA 1YFNA 3M0UA 3I5SA 1JRIA 1YI2T 3CCSQ 2XK0A 3M56A 2EQJA 2IVWA 1BCOA 2O31A 2Y4YA 4HT9A 2RHZA 2A36A 1VYUA 1HD3A 4HA8A 1RAHB 2VKNA 1WXTA 1LCKA 2P0PA 4M77C 4ZGEB 4CC7A 3M53A 4EPCA 2FO0A 1EX4A 2NYSA 3SEMA 1M2VB 2EQIA 2OTJT 4HT8A 1YJWT 3QDRB 4A4FA 5L8RE 2D1XA 2L0AA 2QQBA 3CCRQ 1U5SA 2D6FA 4QT7A 2ZAEA 1K9AA 1U1TA 4RTVA 2DJQA 1N6AA 2CP3A 4IKFA 1J3TA 1SKUB 5CKDA 1AEYA 1LPLA 4LDWA 4J7FA 3HTRA 2DXTA 1WHHA 5KCHA 2PVDB 4ZGDB 3BW1A 4J6WA 2DK3A 2GGRA 3CCLQ 2F5KA 2RB6A 3CC2T 1KD1U 3UA7A 3WVDB 3CMAQ 4C92E 4PFPA 3MEUA 1AZGB 2A7YA 4A4EA 2HAXA 1N9RA 2K7AA 5GAN4 2QA4Q 3P8DA 3QPHA 3MEWA 2DL3A 3OYEA 2BE7D 5I2MA 5FU7B 2DVJA 3SWNB 2RHUA 4M78G 3FJ5A 1YHQT 4MDXA 2RN8A 3L2WA 2ED1A 4F14A 4PJOE 2KE9A 5IAYA 4PFZA 5GAN3 4J9FA 4D8KA 4CC4B 3VS4A 1VQKT 4R56A 3A5ZB 1PSFA 4BI8B 2HQEA 3JRZA 3C12A 3X24B 4LUEA 4B6MA 3OYLA 1XJWB 4J9IA 1MMAA 5CAIA 1SHFA 3RIRA 3CCJQ 3VS5A 2GFUA 2C06A 2EJ9A 3EHQA 1X2QA 1VQPT 4M78E 1WA7A 4FYXB 1Y96A 1MMGA 1V1CA 4M77G 3P8BB 4RKUE 3RUXA 4JJBA 4M75D 2CP7A 1KD1R 2WSCE 1M2VA 4XTWA 4AFQC 3ZL7C 3A8MB 5KYWB 4KGVB 2DRMA 2JOYA 3F70A 2FHDA 2PTKA 4KGZB 4DBRA 1PKTA 1UGQB 2MI6A 2KMTA 2KYMA 4KBMB 3CBOA 5DY9A 3HRUA 5GANh 2QTXA 1YWPA 1N27A 3NTHA 4F7UE 1QVGS 5I22A 2FL7A 3QG1A 5GAN2 3M54A 1IZ6A 1VQ4A 4BACA 1I1JA 2RM4A 2CT3A 3AHUA 3L42A 1RL2A 1T3LA 3OYIA 5I11A 1Q95G 5CCAA 2LJ3A 2L3PA 5CIUA 1FMVA 1QVFS 1UTIA 3JCMW 1BKBA 1WHKA 3HRTA 3SWNA 2X51A 3PIPA 2X4WA 4JZ4A 1VOMA 2JNGA 3RKWA 1HYOA 1X01A 2RI3A 5LJ5g 1QCNA 3MO8A 3VU3C 3V8JA 1TSFA 5C6SA 1AVZC 2M0YA 3H8ZA 4JDSA 4C5EA 1TXQA 3D7SB 1KQSS 3CPWA 4E7KA 1S72A 4PJJA 2CH4A 3NPFA 1M8MA 3VRYA 2X35A 3VUBA 3JB9F 3JCMb 3DLMA 3FC3A 4M7DD 1YP5A 1WIEA 2HD0A 2D0NA 4GLMA 3CMEA 3NFCA 3BFMA 4C0DB 4AMCA 1WNLA 3M58A 1KD1C 3SDZA 3UATA 5GAOl 1AWJA 3SB2A 4NL2A 2GNCA 3M9QA 2MYSA 2OI3A 1TUCA 1C0MA 4LNPA 1NEBA 2PZ1A 3N5BB 1BI0A 4UC4A 4JPBW 1SG5A 1PD0A 1PRMC 2CGHA 3EH1A 3EAEA 2KXDA 2GF7A 2DX1A 5FWCA 5LJ5j 4X34A 2ZZDA 4OMPA 3SD4A 4MZTA 1WPYA 2BE9B 1ZQ1A 1AZEA 1P92A 1M1KC 1D0XA 3NTKA 1VQ9Q 4M7AB 1Y0MA 2RQRA 1G5VA 1TG0A 3CEYA 2FPFA 1LJOA 1X75C 4AFZC 3OYBA 4R55A 3CC7Q 3R6NA 2DPPB 3FB9A 1IB8A 4QVZA 2Z0WA 1Q82U 1BU1A 4M7AC 2V1QA 3LYIA 3E1SA 3VUZA 1BI1A 2LC4A 1VQ5Q 2CP6A 2RNAA 3OYNA 1WJRA 3PMTA 3EFRA 1QVPA 3P8HA 5CQYA 2O88A 4CI0C 3OS5A 1SHGA 5GAMe 3GF5A 2ROLA 5J26A 1UGSB 3TSWA 2CUBA 5CK9A 3EFSA 5FRNA 4FIBA 2OTLQ 3HPWA 4ZN3A 3CCUQ 4Q5WA 2ZPEB 2HQHA 2DYIA 2JUFA 5LL6S 1VQ4T 2O9VA 1VQNA 2DETA 2NUTB 1WQ7A 2JTFA 5CO7A 3I56A 1YIJQ 1SPKA 2A37A 3INZA 1Q7YU 2AIRB 3DB4A 1YWOA 1Q81C 1Q86C 4ELZC 3CCQQ 4Y92A 3RNJA 4AFUC 1FYNA 1UECA 4PNOA 4CC2A 1NPPA 4QQGA 1RAEB 2DBKA 2C0IA 2J06A 3OYKA 4FYVB 3UPUA 2DYBA 4RTWA 3CCVQ 3RMQA 3C94A 1WX6A 3L2UA 4OMFB 1QWEA 5CQXA 5FROA 4C8QD 3TCJA 1UHCA 5IH2A 4WCIA 1Q82R 4M75E 1S72T 2RHXA 4DA4A 2LCLA 4XTXA 1QCFA 2E10A 1WJSA 2DTIA 4FU6A 1GXIE 4E7SA 1T0JA 3CMET 3HFNA 1D1AA 2BZYA 2CKKA 4LD9K 4M7AA 2P4TA 2RI5A 4QQ6A 1YCSB 4EMKB 3WVEB 2VVKA 2LMJA 4RG8A 4ELYC 2LNHB 4C92F 5GAMd 2MIOA 2K2MA 2V8IA 1N8RC 2JM8A 5KYYB 1AWWA 3JB9G 3H6ZA 1OX9A 1NBEB 1Q7YR 3OB9A 1N9SA 4LDYA 1YJ9A 2AT1B 1D0YA 4PLLA 5GAOn 1ZBJA 5AT1B 1KHIA 3G4SA 3NMZC 4RTUA 2XDDA 4PJOF 2OTJA 1K8AU 2OAWA 4XU3A 2AZSA 2FEIA 3TVTA 2O2OA 4FT2A 5GMKe 3LX7A 5A0GA 2DZ9A 1PKSA 2VXFA 2CZ1B 3CC4Q 1UB4A 1NJIU 1B07A 1LNXA 2KDSA 1YJNA 2JTMA 3QJYA 1D1BA 4B9XA 3PTAA 3ZFJA 3CBPA 4RMOA 1KSWA 1NLOC 1E6GA 3H9NA 3A8LB 4M78F 3CC2A 1BI2A 2GQIA 3VKIA 2DL4A 1K0XA 3JCMe 2FZCB 5GANd 3GOXA 5M9OA 4M7DE 4C92C 4RTYA 2V8JA 2JMCA 2M9UA 2RJEA 4DEYA 1YHQA 2XHCA 5GJVB 1NYGA 4FYWB 1VYVA 3FEOA 1YITA 2OAUA 4ZN1A 1ABQA 3HL8A 2YRVA 2K3YA 3CC7T 2DO3A 2ZPGB 3EG2A 1WI7A 4PJOC 1OV3A 2LDMA 1K8AR 2ZPIB 2DAQA 2ZPBB 1K0SA 3I56T 4F7UF 2EGAA 2X4YA 1OX8A 2D8JA 2OX7A 3QWXX 4HXJA 2COWA 4M78B 3OMGA 1RLPC 1KQ1A 2MOXA 4EMKA 3EFOA 2LTOA 3H0IA 2KXCA 1IXDA 4JUVA 1M90U 3VS3A 2VC8A 5KYYA 4HKEA 3HHTB 3MEVA 1VQPA 4N4IA 1ZUUA 2EAYA 1NJIR 4QW2A 2KGTA 1RACB 1K9MU 2EYXA 2OTLT 3ER0A 1TTHB 3MCAB 1GCQC 4M78C 4DEXA 4F17A 4QVDA 3GPLA 1ZHIA 2XG8D 2K5FA 2XDPA 5KCOA 4OB3B 3J80E 1VQLQ 1BK2A 4F04B 3JCMd 2K9GA 4A4KA 3JCMc 1AHJB 2O4XA 1I07A 3A8OB 4F7UB 4M77B 4JRIA 4MMLA 1H3ZA 3EGXB 2R58A 2KNBB 1AD5A 2LVMA 2RO0A 1ZX6A 1MNDA 3L1AA 3CCVT 3OYYA 4PKCC 1G3WA 3A8GB 2J6KA 3MEAA 1X69A 1YJ9T 2XI9A 1B34B 3RKYA 2DXCA 2EKHA 1WGSA 1W6XA 4E6RA 4C92G 1WHLA 2CZ7B 3G4ST 2KYBA 1OU8A 5LJ3h 4BDZA 1PM3A 4EIKA 1ACMB 3Q1JA 2YLBA 2RD1A 3CCSA 5HKCA 1BIBA 1VQ6Q 1K9MR 1OZ2A 3E19A 1M3BA 1UHFA 3LH0A 4O5VA 1NEGA 2JJ9A 4PJOG 2COZA 1OI1A 4E7ZA 1KIKA 4RTTA 1LVKA 2DE0X 4RCBA 3TEEA 3G71Q 3DB3A 1YJNT 4FCYA 2HMAA 3PT9A 4C8QE 4D6WA 2L8DA 3NHNA 3M59A 4M78A 3REAB 5D6XA 2LT4A 2HSEB 2EYWA 2VWFA 1X6OA 2YXYA 2F69A 1UE9A 3PGGA 4HCZA 1Z9QA 2EVRA 3RKXA 3S3OA 5DM7R 3CCRA 1SRLA 1UDLA 4ZTFA 2FZKB 2YRDA 4J9BA 5LJ5h 1DJ7B 2P0KA 4LE9A 3VS2A 4PK4A 4P5NA 1G3TA 3LLRA 2VGNA 2HQXA 2ATCB 1XOVA 3CCMT 1VQMQ 1YITT 3CBMA 1GFDA 5FU6C 1JB0E 2A28A 4KH1B 2XU8A 4JJDA 3RBBB 1D09B 2DXBA 5D6WA 3QIIA 3CCLA 4DOWA 4CRIA 1OPLA 4XU0A 3CMAA 1KQ2A 3C95A 2JM9A 1Y71A 3UA6A 3GP8A 1O9SA 4M77A 3GNFB 1RUWA 2QA4A 3G7ZA 3QDFA 1Z9ZA 2DEUA 2R5MA 2WSEE 2DL8A 2XMFA 3QYGB 4OMQA 1X6GA 2ZPFB 4Y28E 1E7OA 1OU9A 2HL5C 3CPWS 1A0NB 5DLOA 2SEMA 4F7UG 1G3SA 1XQHA 2KY9A 4KH0B 1R0CB 2ZGWA 1ARKA 1QKXA 1B34A 2VGMA 2K2VA 3OS1A 2QEXQ 2JTEA 2K4YA 2LT1A 5I2SA 1ZSZB 2WSFE 3JB9H 2DF6A 1T0HA 1W1FA 2RQTA 2LX7A 2RQUA 4C5HA 2DNUA 1QKWA 2F1LA 3CCJA 3PIOA 2PU9B 2P84A 4RG2A 3OW2A 4M75F 1MMDA 1JU5C 1R0BG 3I35A 1VQOQ 2EQMA 2VB6A 1ZSZC 3UDCA 2IIMA 3OY9A 2QDLA 2DD5A 3GIBA 4XTUA 1KC8U 5GAOq 2AKLA 4RTZA 2RJCA 3KBGA 3M0RA 4E7HA 1I8FA 3JAME 1RAIB 3MJXA 1IHWA 4NS5A 3BDLA 4J8OA 4BD3A 3PVQA 4OMLA 3S3MA 3TU4K 4A63B 5ECAA 4IIMA 3URGA 2EYQA 3JCMX 4JRKA 3CCST 2P0QA 1G2BA 3CD6Q 4JRPA 1UGVA 1U8RA 5KE2A 2KBTA 2KR3A 2LCSA 2LP5A 1AWOA 2FPEA 1BIAA 1MNEA 1X2KA 1TWBA 5HCKA 4LN2A 3H0HA 3PMIA 1WQWA 3X20B 3V8KA 3HKSA 3T9NA 1OQKA 2ENMA 4M75C 1VQ7Q 4AFSC 3HFOA 3VS7A 4Z8AA 3CCRT 1VIFA 1K73U 1OULA 4M7AD 1VIEA 2DIGA 3UT1A 3VYGA 2MMPA 2CUDA 1RLQC 4J9EA 2KRSA 3LWHA 5GAMg 2Y90A 4FSXA 4M7DF 1FMWA 3QZ5B 4E2FB 1KC8R 3OBWA 2YUPA 3OW2P 4XAXB 1WHMA 4GLKA 3CCLT 1FWZA 2HSPA 3M55A 5LJ3e 2J6OA 2AKKA 4OMNA 3CMAT 1UGRB 2LJ0A 4IUQA 2PQWA 5KYWA 2W0ZA 2E65A 2DIQA 4HCBA 4X9DA 1RAFB 1VQ8Q 2C0OA 1U1SA 2JXBA 4C5IA 2QA4T 3V7CA 2J7IA 5CKBA 4VUBA 3OMCA 2K3BA 3SHWA 3ME9A 4C0GA 4KUIA 1JQQA 4JLIA 3VS1A 4J83A 3QUIA 2EQUA 1C6VX 8AT1B 2JS2A 2E12A 3QHSA 5CKFA 4OB1B 3PNWC 3EH2A 3DKMA 5GAMf 2KSSA 2E1HA 1UJ0A 5GMKl 1RI0A 2EGEA 5D7UA 1GBRA 1KFZA 2JN0A 2XICA 4L5GA 5LJ5e 5GAMj 1K73R 2DVEA 1KK7A 2FB7A 3C4SA 3CCJT 4IUUA 4Z02A 1VQ9A 1JJ2S 3EG0A 3QJ6A 3AT1B 2YUQA 2RF0A 1IGUA 3JV3A 1VQNQ 3RMSA 3CC7A 5LJ3d 1HK9A 2CREA 3SFMA 5CKEA 4GY5A 4Y91A 2GCXA 4M75G 4J9GA 2HDAA 2H8HA 5HK3A 2KAFA 4MZMA 2M16A 3I55Q 5C0MA 2C0TA 1B7TA 1VQ5A 2EGCA 1E6HA 3RERA 1MHNA 2JMAA 1X43A 1KC8C 3O8VA 2VASA
chains in the Genus database with same CATH topology
5LJ3f 3WVDB 2YRVA 2K3YA 2QQSA 4C92E 2E70A 3V8LA 3MEUA 2DO3A 4N4HA 5GANf 3CC7T 2A7YA 2ZPGB 4A4EA 5GMKh 2HAXA 4PJOC 3JB9D 2LNVA 2X4JA 1N9RA 3FJPA 2LDMA 4EMHA 5GAN4 2QI2A 3P8DA 2E64A 1H641 2ZPIB 3MEWA 2DAQA 2ZPBB 3QPHA 2OTLA 2DZCA 3I56T 2EWNA 4F7UF 3CCUA 2QQ9A 2XKOC 5I2MA 3OYCA 3OYEA 1VQ6T 3CD6A 5FU7B 1W2BA 2X4YA 4B9WA 4XQ3A 3SWNB 5LJ3j 2RHUA 2B8AA 3M57A 4M78G 1YHQT 4M78B 3OMGA 1D3BA 3QBYA 4MDXA 3L2WA 1KQ1A 1YIJA 4LDXA 4JJNK 4FT4A 4EMKA 1QP2A 2D9TA 4PJOE 2LTOA 4JUVA 4C0ZA 5LJ5d 5IAYA 5GAN3 4E7LA 1M90U 2VC8A 3G71T 3CCQA 3OQ5A 4HKEA 5AYFA 3HHTB 1XTDA 1N8RU 3MEVA 3JCMg 4N4IA 1VQPA 2EAYA 1VQKT 1JBMA 4QW2A 4R56A 3A5ZB 1PSFA 2VXEA 3VV0A 3OYDA 3JCMh 4M7AF 2DD4A 4C8QF 1K9MU 2OTLT 5GANe 3ER0A 3KXTA 4BI8B 4DOVA 3MCAB 4M78C 1VQ7A 3OSSC 2HQEA 4FL6A 4L6V5 3JRZA 4QVDA 3GPLA 1ZHIA 3C12A 2XG8D 2K5FA 4XTYA 4NOYA 3X24B 4BUGA 3CCVA 3GNGA 2XDPA 3LWIA 3QSUA 5KCOA 4OB3B 3J80E 1I4K1 3OYLA 5LJ5f 2E6ZA 2ZCFB 4XU2A 5CAIA 2L3RA 3RIRA 3JCMd 2DKGA 3QYHB 2GFUA 4A4KA 2C06A 3JCMc 2EJ9A 2M0OA 2LX9A 2AHJB 3MP1A 1AHJB 3FDRA 2O4XA 1VQPT 3M4GA 4M78E 3V7SA 4C0DC 3A8OB 4YTLA 5GMKj 1UEBA 1M8VA 2O01E 4F7UB 1Y96A 4M77G 3LGFA 1VQMT 4M77B 4ATOA 5DLQE 4JRIA 4MMLA 1M4ZA 3P8BB 1H3ZA 4RKUE 1XNIA 3RUXA 2R58A 2VUBA 4M75D 2LVMA 4ME7A 4NL3A 2RO0A 3L1AA 2XDBA 3CCVT 5A0LA 2WSCE 3OYYA 4M7DG 4MDWA 3MP6A 3JCMf 4PKCC 4M7DB 1G3WA 2XD0A 4XTWA 3OYAA 2LQ8A 5A2QE 3A8GB 4OVAA 5HY6A 3CXCS 1BI3A 3V7RA 5GMKi 3MEAA 3LGLA 1VQ8A 3A8MB 3JB9J 1OZ3A 2JOYA 1YJ9T 2XI9A 2ZPHB 3F70A 4DQ2A 1B34B 3RKYA 4FM4B 4MZPA 2FHDA 2DXCA 2R57A 2DJZA 5EG2A 1WGSA 1UGQB 5GANg 2MI6A 4C92G 2CZ7B 2RA2A 4C92B 2L5QA 3G4ST 2KMTA 4M75A 5LJ3h 4LDUA 1FX7A 4KBMB 1HXDA 3CBOA 5DY9A 3HRUA 5GANh 2QTXA 1N27A 2RH2A 3NTHA 4BDZA 3JCMJ 4M7DC 4F7UE 2KK4A 3X28B 3BY7A 1QVGS 2FL7A 3Q1JA 2YLBA 2RD1A 2FYKA 2CS7A 5GAN7 3CCSA 3QG1A 4M78D 5HKCA 1BIBA 2BIVA 1SSFA 4C0FA 5GAN2 2QEXT 4BE2A 3M54A 1IZ6A 4C8QC 2PVOB 1OZ2A 3E19A 5CR2A 4HCCA 1VQ4A 4BACA 2EKOA 3LH0A 3MP8A 4O5VA 2RM4A 3HP9A 3L2QA 4PJOG 3AHUA 1OI1A 4PJOB 3L42A 2DXUA 2K5IA 1RL2A 1Y7XA 4A53A 3OYIA 2QQAA 2EJFA 4RCBA 3TEEA 3ZEHA 3DB3A 1VQ9T 1Q82C 1YJNT 5CCAA 3CC4A 2KQWA 4M7AE 3PT9A 4J6XA 5CIUA 4C8QE 1QVFS 4D6WA 2L8DA 3OW2S 3JCMW 1BKBA 3HRTA 3X26B 3SWNA 3M59A 2EIFA 1I81A 3CCMA 1G3YA 4M78A 5D6XA 1QP3A 3J81E 2X4WA 3PIPA 2JZ2A 2LT4A 4N0AC 4OB0B 3A8HB 3PGGA 1X6OA 1VQOT 2F69A 4HCZA 2JNGA 3M5AA 3OS0A 1UGPB 2MWOA 3RKWA 1X01A 2RI3A 3RKXA 5LJ5g 5DM7R 3S3OA 3MO8A 3CCRA 5KE3A 3VU3C 4ZTFA 2RK1A 4MMKA 5GAN5 2CYZB 3V8JA 2XIDA 5LJ5h 2RHIA 3JCMP 5C6SA 1DJ7B 5GAOm 2P0KA 3H8ZA 4JDSA 5GAOr 2LCCA 4P5NA 1NZ9A 1G3TA 4M77D 3LLRA 2VGNA 2HQXA 4C5EA 1KQSS 3CPWA 5GANj 5FLXE 4E7KA 2QQRA 5J39A 1S72A 1VQ5T 3UWNA 1XOVA 1NPRA 3CCMT 2DTOA 1YITT 3CBMA 2X4XA 4E7IA 3QKJA 1Q7YC 5FU6C 1JB0E 2X35A 3I55A 2XU8A 3E9GA 3VUBA 3JCMb 4EDUA 3JB9F 2DXBA 3DLMA 4QQDA 5D6WA 3FC3A 4M7DD 3QIIA 3CCLA 1R8OB 2CZ0B 2HD0A 3CMEA 4DOWA 4CRIA 4JRQA 4E7JA 3NFCA 2LRQA 4XU0A 3CMAA 1KQ2A 3BFMA 4C0DB 3JCMQ 3C95A 4XTZA 1YCYA 1WNLA 3M58A 1KD1C 3CCUT 3SDZA 1Y71A 3GP8A 1O9SA 2PUKB 4M77A 5GAOl 3FIFA 3GNFB 3CD6T 5A0DA 3SB2A 4NL2A 3G7ZA 3M9QA 2I2LA 3CXCA 2QA4A 3S6WA 1Y07A 4C92D 1YIJT 2R5MA 2WSEE 3QYGB 1V29B 2ZPFB 3E9FA 3G6EA 3HSBA 2K57A 3N5BB 4Y28E 3GLXA 3WXMB 1K73C 3OYHA 1BI0A 3CCQT 4M7DA 4UC4A 3OSVA 3OYFA 4A4GA 3CPWS 5DLOA 3HRSA 4F7UG 1G3SA 2CGHA 1JJ2A 1XQHA 2KY9A 2RI2A 3EAEA 1QVGA 1YI2A 2ZGWA 1IREB 2GF7A 5LJ5j 1B34A 2VGMA 3OYGA 2K2VA 3OS1A 1VQ7T 3FLGA 2K4YA 4IUPA 4PJOD 2LT1A 4X34A 3FRNA 2ZZDA 3SD4A 4C92A 4V2SA 4MZTA 1WPYA 5I2SA 1ZQ1A 4OGEA 3JCMV 2WSFE 2HNIA 3JB9H 3G6ET 1P92A 1M1KC 3NTKA 1VQLA 2EQKA 2WACA 4M7AG 4C5HA 1ZBXA 2PUOB 4C8QG 4M7AB 5GAOp 3PFSA 4C8QB 4E47A 3CCJA 1G5VA 1KHCA 3PIOA 2PU9B 2NLUA 4EMKC 1QVFA 4RG2A 3CEYA 2JVVA 4M75F 3OW2A 1LJOA 1LOJA 1X75C 4X9CA 4BY6B 4JLGA 4RCCA 2E5QA 1YJWA 3OYBA 4PJOA 4R55A 2EQMA 4TVRA 4LD6A 5IN1A 4JS5A 2DPPB 2MWPA 3FB9A 2O4XB 4QVZA 3UDCA 3OY9A 1Y96B 1Q82U 3QXEB 4WF2A 2BUDA 2DD5A 4BB7A 5HK0A 1VQ8T 4M7AC 5GAN8 4J7IA 3GIBA 2DEQA 3LYIA 3E1SA 3VUZA 1BI1A 1K8AC 4LDVA 2LC4A 4XTUA 1KC8U 1KQSA 5GAOq 4BY6C 2QXFA 3OYNA 3S3NA 1EIFA 2G3RA 1WJRA 2RJCA 3PMTA 5GAN6 3KBGA 4E7HA 2KVQG 3OS2A 4J6YA 2IG0A 1I8FA 1QVPA 2RHYA 3EFRA 3P8HA 5CQYA 5CVIA 3JAME 4XU1A 4NS5A 3BDLA 2E41A 4J8OA 4BD3A 4CI0C 3S3MA 3OS5A 4BI3A 2FVUA 3TU4K 4KULA 1M1FA 3NTIA 3GF5A 3URGA 5J26A 5GAMe 2EYQA 4A54A 1UGSB 3JCMX 4JRKA 5CK9A 3EFSA 3CCST 4FIBA 5FRNA 1NJIC 3HPWA 2P0QA 4ZN3A 4JS4A 2E6NA 2GQVA 4Q5WA 2ZPEB 2MAMA 5FU6B 2JUFA 3TREA 2GFAA 5LL6S 4JRPA 3KUFA 3CCEA 1VQ4T 1VQNA 1U8RA 5KE2A 3I56A 1WQ7A 2JTFA 4IUVA 2F5TX 5CO7A 1Q7YU 3INZA 1VQ6A 3DB4A 1Q81C 1BIAA 5CKHA 1Q86C 2YHTA 1KG1A 1FXXA 3M4YA 4ELZC 4IUTA 3CC4T 3CC2T 4PLIA 4PNOA 2YLCA 1NPPA 4QQGA 1M1GA 3PMIA 1WQWA 3X20B 3V8KA 3G71A 2L89A 4J5YA 3HKSA 1W4SA 3T9NA 1WJQA 3OYKA 1VQKA 2DTHA 4M75C 3J7AF 3UPUA 3HFOA 2R5AA 3OBYA 2VV5A 3CCRT 3CCET 1VQNT 5D6YA 3RMQA 1VIFA 3C94A 4BDYA 1K73U 2MF2A 3L2UA 2A3LA 2Y4XA 4M77F 4OMFB 4M7AD 5CQXA 4F7UA 4C8QA 5FROA 4C8QD 1VIEA 4ZTJA 3TCJA 1M5Q1 2DIGA 2M1HA 3LW5E 3UT1A 3VYGA 3QZ9B 2MMPA 4M75E 4XK8E 3LWHA 1QW1A 1S72T 2RHXA 5GAMg 3OA6A 2Y90A 4DA4A 4LD9K 1O75A 4FSXA 2LCLA 4XTXA 4EMGA 2E10A 4M7DF 3QZ5B 3DLLA 5GAMh 3I55T 3OBWA 1WJSA 2K3XA 2DTIA 4XAXB 4FU6A 4GLKA 4O6JA 2CZ6B 3CCLT 1FWZA 1VQMA 1GXIE 2EJGA 3M55A 5J3BA 5LJ3e 3CMET 4KUDK 3HFNA 5FU7C 1NE8A 1VUBA 4OB2B 1M1KU 2CKKA 2HBPA 1UGRB 4IUQA 4L59A 3SWNC 1D3BB 2PQWA 3CMAT 2P4TA 4OP0A 2RI5A 2QDYB 2E65A 2DIQA 2RK2A 4QQ6A 2RJFA 3VYHB 3VJPA 4X9DA 4EMKB 1M90C 3WVEB 4ELYC 4RG8A 3L2RA 4HCBA 2BKDN 1BYMA 4C92F 5GAMd 5GMKm 1U1SA 2V8IA 4C5IA 5KH6A 1N8RC 2QA4T 3V7CA 5CKBA 1YBYA 4VUBA 3OMCA 2H3JA 1W2BS 1OYXA 5I21A 3L2VA 3ME9A 3JB9G 1TH7A 4KT0E 4C0GA 4N4GA 3META 3H6ZA 3R6OA 4KUIA 3ASKA 4JLIA 5IT9E 4M7AA 1K9MC 3JB9I 4OGCA 3OB9A 1N9SA 4LDYA 1YJ9A 3QO3A 4J83A 5FRMA 3BDUA 3OYMA 3QUIA 4PL6A 2EQUA 3OYJA 4PLLA 2E12A 3QHSA 5GAOn 4N0AA 2V8KA 1KHIA 5CKFA 4OB1B 4BI4A 3G4SA 3PNWC 2K5LA 3ZBDA 2XDDA 3DKMA 4PJOF 1JRIA 1YI2T 5GAMf 2OTJA 2KSSA 4OF1A 1K8AU 2XK0A 3M56A 2E1HA 4XU3A 2EQJA 4BE1A 2IVWA 4XTVA 5GMKl 1RI0A 2Y4YA 4FT2A 5GMKe 3CPFA 1I5LA 4HT9A 2RHZA 2QEXA 3JSCA 3LX7A 4HA8A 2JN0A 2XICA 5A0GA 3L2ZA 4L5GA 2DZ9A 2P0PA 4M77C 4ZGEB 5LJ5e 5GAMj 1VQLT 3M53A 3RESA 1M9SA 2VXFA 2CZ1B 5LJ3g 1UB4A 2DVEA 2FB7A 3C4SA 3CCJT 1NJIU 4IUUA 4EPCA 4QVCA 1PSEA 4Z02A 1LNXA 2RJDA 2KDSA 1VQ9A 1YJNA 2JTMA 3QJYA 4IURA 1JJ2S 2OTJT 4HT8A 4B9XA 3PTAA 1YJWT 3ZFJA 3QDRB 4A4FA 3QJ6A 3X25B 3CBPA 5L8RE 4RMOA 4II1A 4M77E 2LQKA 2QQBA 3A8LB 4M78F 2D6FA 3CC2A 1Q81U 1BI2A 3RMSA 1Q86U 1VQOA 3CC7A 3VKIA 5LJ3d 1HK9A 4A4HA 1U1TA 3SFMA 3JCMe 5GANd 5CKEA 3GOXA 4GY5A 4Y91A 2D0QB 2GCXA 4M75G 5M9OA 4ZGJB 4M7DE 4M75B 4C92C 1N6AA 2V8JA 4IKFA 2PVGB 4C5GA 5CKDA 5HK3A 2M9UA 4LDWA 4J7FA 2KAFA 2DXTA 2RJEA 2M16A 4MZMA 4BE0A 1YHQA 2XHCA 5C0MA 5KCHA 3MHXA 2PVDB 4ZGDB 3BW1A 2VYTA 1VQ5A 4J6WA 1MGQA 2DK3A 3FEOA 2EFIA 1YITA 2OAUA 2F5KA 2RB6A 1MHNA 4ZN1A 1KC8C 3RERA 3O8VA 3HL8A 1KD1U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTX A;  2HNI A;  2E10 A;  1BIB A;  5LJ3 f;  4C92 E;  4EMG A;  3JB9 H;  4M7D F;  3V8L A;  5GAN 2;  5GAN f;  5GAM h;  4C8Q C;  5GMK h;  2DTI A;  4M7A G;  4PJO C;  4C8Q G;  3JB9 D;  4M7A B;  5GAO p;  1N9R A;  3FJP A;  2RM4 A;  2EJG A;  4C8Q B;  4EMH A;  5LJ3 e;  4PJO G;  3HFN A;  5GAN 4;  3AHU A;  2E64 A;  1H64 1;  4PJO B;  4EMK C;  2DXU A;  3SWN C;  2DZC A;  2EWN A;  4F7U F;  1D3B B;  4M75 F;  4A53 A;  4M7A A;  1LJO A;  1LOJ A;  4OP0 A;  2E65 A;  2EJF A;  4RCB A;  4RCC A;  4X9C A;  4C8Q A;  4X9D A;  4EMK B;  4XQ3 A;  3SWN B;  5LJ3 j;  4M78 G;  4PJO A;  4C92 F;  4M78 B;  5GAM d;  1D3B A;  5GMK m;  4M7A E;  1U1S A;  1KQ1 A;  4J6X A;  4C8Q E;  3V7C A;  3JCM W;  4EMK A;  3SWN A;  3FB9 A;  4PJO E;  1I81 A;  5I21 A;  3JB9 G;  4M78 A;  1TH7 A;  4JUV A;  5LJ5 d;  5GAN 3;  4N0A C;  1Y96 B;  2VC8 A;  4JLI A;  4WF2 A;  3PGG A;  3JB9 I;  4M7A C;  5GAN 8;  1N9S A;  3RKW A;  3JCM g;  3QO3 A;  1X01 A;  2EAY A;  2DEQ A;  3RKX A;  5LJ5 g;  3BDU A;  3GIB A;  1JBM A;  3QUI A;  3VU3 C;  2VXE A;  4MMK A;  4XTU A;  3QHS A;  5GAO n;  5GAN 5;  3JCM h;  4N0A A;  3V8J A;  5GAO q;  4M7A F;  4C8Q F;  5LJ5 h;  5GAN e;  3JCM P;  2Y90 A;  5GAN 6;  4PJO F;  1JRI A;  4M78 C;  5GAM f;  5GAO m;  4J6Y A;  3EFR A;  1I8F A;  5GAO r;  4QVD A;  4M77 D;  4XU3 A;  2E1H A;  4XTY A;  4NOY A;  4XU1 A;  2E41 A;  5GAN j;  4XTV A;  5GMK l;  3QSU A;  1I4K 1;  5LJ5 f;  2DTO A;  5GAM e;  4XU2 A;  5CAI A;  3RIR A;  5GMK e;  4A54 A;  2DKG A;  3JCM X;  3JCM d;  1I5L A;  4JRK A;  4HT9 A;  3JCM c;  3EFS A;  2EJ9 A;  4HA8 A;  2JN0 A;  3JB9 F;  3JCM b;  3L2Z A;  4M7D D;  2DZ9 A;  4M77 C;  5LJ5 e;  3M4G A;  4M78 E;  3V7S A;  5GMK j;  5GAM j;  1M8V A;  3RES A;  4F7U B;  1Y96 A;  2VXF A;  5LJ3 g;  2DVE A;  4M77 G;  4XU0 A;  2FB7 A;  4M77 B;  1KQ2 A;  1WQ7 A;  3BFM A;  3JCM Q;  4JRI A;  3INZ A;  4MML A;  4XTZ A;  1YCY A;  1WNL A;  4QVC A;  1LNX A;  3RUX A;  1BIA A;  2YHT A;  4M77 A;  5GAO l;  3FIF A;  4HT8 A;  4M75 D;  3SB2 A;  4NL3 A;  3L1A A;  4NL2 A;  2I2L A;  4PNO A;  2YLC A;  4M7D G;  4M77 E;  4C92 D;  3JCM f;  4M7D B;  1WQW A;  4M78 F;  3V8K A;  4XTW A;  4J5Y A;  3HSB A;  2K57 A;  3V7R A;  5GMK i;  5LJ3 d;  1HK9 A;  4M7D A;  3JB9 J;  2DTH A;  4M75 C;  1U1T A;  3JCM e;  5GAN d;  4Y91 A;  3HFO A;  4DQ2 A;  4F7U G;  4M75 G;  2CGH A;  1B34 B;  3RKY A;  4M7D E;  4M75 B;  4C92 C;  2DJZ A;  5GAN g;  2ZGW A;  4C92 G;  4M77 F;  5LJ5 j;  2RA2 A;  4C92 B;  1B34 A;  4M7A D;  4F7U A;  4M75 A;  5LJ3 h;  4C8Q D;  2DXT A;  1HXD A;  1M5Q 1;  5DY9 A;  5GAN h;  2QTX A;  4PJO D;  3BW1 A;  4M7D C;  2FYK A;  4J6W A;  1MGQ A;  4C92 A;  3JCM J;  4F7U E;  4M75 E;  4V2S A;  3BY7 A;  1WPY A;  2RB6 A;  5GAM g;  3RER A;  2YLB A;  2RD1 A;  3JCM V;  5GAN 7;  4M78 D; 
#chains in the Genus database with same CATH topology
 2QQS A;  3EGD B;  3V8L A;  5GAN f;  1PG5 B;  1EZZ B;  2LNV A;  4EMH A;  1H64 1;  2OTL A;  2YDL A;  3CCU A;  2EWN A;  4ATO A;  2QQ9 A;  2SRC A;  2FPD A;  2DIL A;  1W2B A;  4B9W A;  4XQ3 A;  2B8A A;  3G6E Q;  1YIJ A;  4AT1 B;  4JJN K;  1QP2 A;  2D9T A;  4R0K A;  4C0Z A;  5LJ5 d;  3CCQ A;  2EW3 A;  1YI2 Q;  3JCM g;  1V76 A;  1JBM A;  1GFC A;  3VV0 A;  3OYD A;  2DD4 A;  4GBQ A;  4C8Q F;  3EGU A;  5GAN e;  4DOV A;  1CKA A;  4FL6 A;  4L6V 5;  4NOY A;  3CCV A;  3GNG A;  3LWI A;  3QSU A;  1SSH A;  2E6Z A;  2ZCF B;  4XU2 A;  1ZSG A;  2DKG A;  2M0O A;  4FSS A;  1TU0 B;  2NWM A;  2AHJ B;  3FDR A;  3M4G A;  3V7S A;  1YJW Q;  5GMK j;  1M8V A;  1UEB A;  3O5Z A;  1QWF A;  2KRM A;  1QLY A;  2CP5 A;  1KJW A;  1M4Z A;  4WTO B;  4RTX A;  1XNI A;  4ME7 A;  2XDB A;  5EC7 A;  4M7D G;  1CSK A;  3JCM f;  3MP6 A;  2QG9 B;  1WYX A;  2XD0 A;  3OYA A;  1RAB B;  2LQ8 A;  5A2Q E;  4OVA A;  5HY6 A;  1BI3 A;  3V7R A;  5GMK i;  2CT4 A;  3JB9 J;  1OPK A;  4DQ2 A;  2ZPH B;  2ED0 A;  3RDV A;  5EG2 A;  2DA9 A;  2HKQ B;  4C92 B;  2L5Q A;  1ZA2 B;  3CPW P;  2NUT A;  3A98 A;  2RH2 A;  3JCM J;  2E3I A;  3BY7 A;  5GJW B;  2FYK A;  5GAN 7;  2YT6 A;  4M78 D;  3CCE Q;  5IXF A;  2BIV A;  1SSF A;  4C0F A;  2JT4 A;  4C8Q C;  1YHQ Q;  1W2B P;  4HCC A;  3EGD A;  2E5K A;  3HP9 A;  2LQN A;  4PJO B;  2DXU A;  2E3H A;  4A53 A;  1QQJ A;  1Y57 A;  2QQA A;  1VQ9 T;  1Q82 C;  3CC4 A;  2FRY A;  2KQW A;  4M7A E;  1WLP B;  3ULR B;  4J6X A;  4D8D A;  1VQK Q;  3OW2 S;  3X26 B;  3CCM A;  1G3Y A;  1QP3 A;  2JZ2 A;  4N0A C;  3A8H B;  3OS0 A;  1UGP B;  2MWO A;  1TUD A;  1NLP C;  5KE3 A;  2A0F B;  4MMK A;  1FMK A;  5GAN 5;  2CYZ B;  1HSQ A;  1TS9 A;  3JCM P;  2KI7 A;  5GAO m;  1NZ9 A;  4M77 D;  2QGG A;  5J39 A;  1VQ5 T;  3UWN A;  3EG3 A;  2AZV A;  4KGX B;  2X4X A;  4E7I A;  1W70 A;  2QTV A;  3QKJ A;  1Q7Y C;  5IXB A;  1NG2 A;  3E9G A;  1R8O B;  2KT8 A;  1UG1 A;  4E7J A;  4PJN A;  2PNI A;  5IHI A;  6AT1 B;  5KYX B;  1BCM A;  1YCY A;  3M0T A;  1IRX A;  1ZLM A;  3CCU T;  1BB9 A;  2I2L A;  9ATC B;  3CXC A;  3S6W A;  1YIJ T;  1VA7 A;  1V29 B;  1K4U S;  1PCX A;  3HSB A;  3GLX A;  3WXM B;  3CCQ T;  1MV0 B;  3HRS A;  1JJ2 A;  2RI2 A;  1BBZ A;  4AG2 C;  1G8X A;  1IRE B;  1IHV A;  4FW2 A;  4ANJ A;  2W10 A;  1M27 C;  4IUP A;  2NUZ A;  1X6B A;  3FRN A;  4J9H A;  4V2S A;  4C92 A;  2P4R A;  2DL7 A;  4OGE A;  3JCM V;  2HNI A;  3G6E T;  4K11 A;  4ORZ A;  1VQL A;  2WAC A;  2QGF B;  1ZBX A;  4C8Q G;  3VS6 A;  5GAO p;  3PFS A;  4E47 A;  2RMO A;  1KHC A;  3TQ7 P;  2HEQ A;  4PFO A;  1LOJ A;  4X9C A;  2E5Q A;  2RQW A;  4PJO A;  1H3H A;  3MKD A;  1X27 A;  2V1R A;  1M90 R;  4JS5 A;  2MWP A;  2CH4 W;  1I5O B;  1GRI A;  1Y96 B;  3QXE B;  4WF2 A;  4HVU A;  2BUD A;  3PE0 A;  4BB7 A;  1U3O A;  2DEQ A;  1K8A C;  2GBQ A;  2YSQ A;  7AT1 B;  1EIF A;  2DBM A;  5GAN 6;  2E4H A;  3OS2 A;  4J6Y A;  2IG0 A;  5CVI A;  2RHY A;  2E41 A;  2G6F X;  4FYY B;  2FVU A;  2OJ2 A;  4KUL A;  3NTI A;  2X3W D;  1GCQ A;  1PHT A;  4A54 A;  1UFF A;  4J9C A;  1NJI C;  2EPD A;  4JS4 A;  2GQV A;  2K79 A;  2MAM A;  5FU6 B;  2YWW A;  4X1V A;  1VQ6 A;  2F5T X;  3CXC P;  1ABO A;  2X9H A;  5IHN A;  1KG1 A;  2YHT A;  2H3E B;  1IO6 A;  2B86 A;  4IUT A;  4HVV A;  5KYX A;  8ATC B;  3CC4 T;  2QYZ A;  3G71 A;  2L89 A;  1JJ2 P;  1W4S A;  1WJQ A;  2YRC A;  1M3A A;  3J7A F;  1B3Q A;  3CCE T;  5D6Y A;  3TSZ A;  4BDY A;  2MF2 A;  2FZG B;  4F7U A;  1M5Q 1;  3QZ9 B;  3GBQ A;  3EGX A;  5FW9 A;  2GTO A;  1O75 A;  2CP0 A;  2DL5 A;  4EMG A;  3M0P A;  3EG1 A;  5GAM h;  2HZY A;  2CZ6 B;  1VQM A;  2EJG A;  5J3B A;  4KUD K;  5FU7 C;  4LXC A;  4OB2 B;  1M1K U;  3SWN C;  2HBP A;  4L59 A;  1D3B B;  4OP0 A;  2RJF A;  1M90 C;  4HCK A;  3L2R A;  1BYM A;  2BKD N;  3EG9 B;  2EYY A;  1YBY A;  1GBQ A;  2DMO A;  1OYX A;  5I21 A;  3L2V A;  1W2B S;  1TH7 A;  4N4G A;  3R6O A;  3ASK A;  5IT9 E;  1PNJ A;  2KEA A;  1K9M C;  1T3S A;  4OGC A;  2BZ8 A;  1RAG B;  3OYM A;  4ESR A;  1AOJ A;  1H92 A;  2L3Q A;  3OYJ A;  2V8K A;  4BI4 A;  2K5L A;  4OF1 A;  2JS0 A;  4BE1 A;  4XTV A;  1VQ4 Q;  1I5L A;  3CPF A;  2QEX A;  3JSC A;  1TOV A;  3L2Z A;  1VQL T;  3RES A;  2NUP B;  1M9S A;  5LJ3 g;  1GL5 A;  2DRK A;  4QVC A;  1PSE A;  2RJD A;  4IUR A;  1M2O A;  3X25 B;  2F2W A;  4II1 A;  4M77 E;  2LQK A;  3G1J A;  1Q81 U;  1Q86 U;  1VQO A;  4A4H A;  1S1N A;  2ROT A;  1M1K R;  2D0Q B;  2LJ1 A;  4ZGJ B;  4M75 B;  1PRL C;  2MK5 A;  4JZ3 A;  1S72 Q;  3QWY A;  2PVG B;  1GCP A;  4C5G A;  1JXO A;  4BE0 A;  2CP2 A;  3MHX A;  2VYT A;  1MGQ A;  1MMN A;  2EFI A;  4FW1 A;  3CME Q;  5LJ3 f;  3I5R A;  1WHG A;  2E70 A;  4N4H A;  5GMK h;  3BE3 A;  3JB9 D;  2X4J A;  3FJP A;  2QI2 A;  2E64 A;  2DZC A;  1VQ6 T;  2XKO C;  3OYC A;  3CD6 A;  5LJ3 j;  3M57 A;  1TUG B;  1D3B A;  2L3S A;  3QBY A;  4LDX A;  1PC0 A;  4FT4 A;  3EG9 A;  4E7L A;  2ESW A;  3G71 T;  3OQ5 A;  5AYF A;  1XTD A;  1YN8 A;  1N8R U;  1ZSZ A;  1QCO A;  1C1A A;  2KT1 A;  2VXE A;  3JCM h;  4M7A F;  1D1C A;  3KXT A;  1VQ7 A;  3OSS C;  1JXM A;  1M3C A;  3KFV A;  4XTY A;  1Q81 R;  1Q86 R;  3C0C A;  4BUG A;  1WXB A;  1N5Z A;  1ZA1 B;  1I4K 1;  2EBP A;  4Z89 A;  5LJ5 f;  1K1Z A;  2L3R A;  5IHK A;  3QYH B;  3REB B;  3A1P A;  2LX9 A;  3MP1 A;  4C0D C;  1SF9 A;  4YTL A;  2O01 E;  3LGF A;  2HKN A;  1VQM T;  5DLQ E;  1EFN A;  2NUP A;  4AG1 C;  2VUB A;  1F1B B;  2CDT A;  4Z88 A;  4NL3 A;  2EYZ A;  5A0L A;  1WZO A;  3VRZ A;  3UF4 A;  4MDW A;  5KYN A;  4M7D B;  1WFW A;  2IPO B;  1UUE A;  3CXC S;  1VQ8 A;  4KRT A;  3LGL A;  2LZ6 B;  1OZ3 A;  2F2V A;  4FM4 B;  4MZP A;  2R57 A;  2DJZ A;  2V26 A;  5GAN g;  2RA2 A;  4LUD A;  1HJD A;  4M75 A;  4LDU A;  1ZUY A;  1FX7 A;  1HXD A;  4JJC A;  4M7D C;  2KK4 A;  3X28 B;  4OMM A;  1N8R R;  2CS7 A;  3I56 Q;  4BE2 A;  2QEX T;  2PVO B;  1JO8 A;  5CR2 A;  2EKO A;  3MP8 A;  5KYU B;  4PJL A;  1VYT A;  3L2Q A;  2K5I A;  1Y7X A;  2EJF A;  2QAS A;  2BZX A;  3ZEH A;  4DBH A;  2EIF A;  1I81 A;  3J81 E;  1D0Z A;  4OB0 B;  1VQO T;  2JW4 A;  3M5A A;  1WDX A;  1YNZ A;  4RUG A;  2RK1 A;  4F16 A;  2XID A;  2RHI A;  3VS0 A;  1ZUK A;  5GAO r;  2LCC A;  1MUZ A;  5GAN j;  1NYF A;  2KRN A;  2MCN A;  4IIO A;  5FLX E;  2QQR A;  4CC3 A;  2YUN A;  1NPR A;  2DTO A;  2ABL A;  3IQL A;  2QAZ A;  3THK A;  1M30 A;  3I55 A;  3NGP A;  4EDU A;  4QQD A;  2CZ0 B;  2AK5 A;  4JRQ A;  1K76 A;  2LRQ A;  1RAA B;  1OOT A;  1SRM A;  2I0N A;  3JCM Q;  1MV3 A;  2J05 A;  4DBF A;  4XTZ A;  4DBQ A;  2PUK B;  3CD6 T;  3FIF A;  5A0D A;  2FG0 A;  1U06 A;  1Y07 A;  1JEG A;  1YJ9 Q;  4C92 D;  2DM1 A;  1IGQ A;  3E9F A;  3G6E A;  3PVL A;  2K57 A;  3H0F A;  1K73 C;  3OYH A;  3G4S Q;  4M7D A;  2BTT A;  1AT1 B;  3OSV A;  5FWB A;  3OYF A;  3RR6 A;  2O9S A;  4A4G A;  2OTJ Q;  4QKU A;  1QVG A;  1YI2 A;  1NM7 A;  1SEM A;  2CSQ A;  3OYG A;  3EFO B;  2J6F A;  3FLG A;  1VQ7 T;  4PJO D;  2DFU A;  3MPU B;  2EQK A;  1YJN Q;  2K6D A;  4M7A G;  2PUO B;  4C8Q B;  3M0Q A;  2NLU A;  4EMK C;  1QVF A;  3EHR A;  2JVV A;  5KYU A;  4BY6 B;  2F2X A;  4JLG A;  4RCC A;  1YJW A;  3CC2 Q;  2M51 A;  2RPN A;  4TVR A;  4LD6 A;  5IN1 A;  2O4X B;  1WXU A;  1RAD B;  5HK0 A;  1VQ8 T;  5GAN 8;  4J7I A;  4M4Z A;  2QK0 A;  4LDV A;  3U23 A;  1KQS A;  4BY6 C;  1I0C A;  2QXF A;  3CCM Q;  3S3N A;  2G3R A;  1YIT Q;  2KVQ G;  3LH5 A;  4XU1 A;  3I9Q A;  4BI3 A;  1M1F A;  1WHJ A;  2E6N A;  1UJY A;  1QMC A;  3TRE A;  2GFA A;  4ZNX A;  3KUF A;  3CCE A;  4IUV A;  2DER A;  5CKH A;  1FXX A;  3M4Y A;  5L23 A;  3E2U A;  3M0S A;  4PLI A;  1PD1 A;  2YLC A;  1VQP Q;  1M1G A;  2KRO A;  2FRW A;  4J5Y A;  3CQT A;  1VQK A;  1QVG P;  2DTH A;  2GTJ A;  4J9D A;  3H41 A;  2COY A;  2R5A A;  3OBY A;  2VV5 A;  1VQN T;  1AWX A;  1H8K A;  2HCK A;  4OMO A;  2A3L A;  2Y4X A;  4M77 F;  2MPX C;  4ZTJ A;  3LW5 E;  2M1H A;  2HL3 A;  4XK8 E;  2DLP A;  2A08 A;  1QW1 A;  2D8H A;  4PJM A;  3OA6 A;  2CSI A;  3DLL A;  3I55 T;  1QVF P;  2LQW A;  2K3X A;  2ECZ A;  2YUO A;  4O6J A;  1NE8 A;  1VUB A;  2X3X D;  1RI9 A;  3VYH B;  2QDY B;  2RK2 A;  4C8Q A;  3VJP A;  1PWT A;  2HBW A;  5GMK m;  5KH6 A;  1G83 A;  2RQV A;  2H3J A;  4HVW A;  4KT0 E;  3MET A;  1CKB A;  1KQS P;  3JB9 I;  2L2P A;  5FRM A;  3QO3 A;  1R77 A;  3BDU A;  1OEB A;  4PL6 A;  2M02 A;  4N0A A;  3ZBD A;  1YFN A;  3M0U A;  3I5S A;  1JRI A;  1YI2 T;  3CCS Q;  2XK0 A;  3M56 A;  2EQJ A;  2IVW A;  1BCO A;  2O31 A;  2Y4Y A;  4HT9 A;  2RHZ A;  2A36 A;  1VYU A;  1HD3 A;  4HA8 A;  1RAH B;  2VKN A;  1WXT A;  1LCK A;  2P0P A;  4M77 C;  4ZGE B;  4CC7 A;  3M53 A;  4EPC A;  2FO0 A;  1EX4 A;  2NYS A;  3SEM A;  1M2V B;  2EQI A;  2OTJ T;  4HT8 A;  1YJW T;  3QDR B;  4A4F A;  5L8R E;  2D1X A;  2L0A A;  2QQB A;  3CCR Q;  1U5S A;  2D6F A;  4QT7 A;  2ZAE A;  1K9A A;  1U1T A;  4RTV A;  2DJQ A;  1N6A A;  2CP3 A;  4IKF A;  1J3T A;  1SKU B;  5CKD A;  1AEY A;  1LPL A;  4LDW A;  4J7F A;  3HTR A;  2DXT A;  1WHH A;  5KCH A;  2PVD B;  4ZGD B;  3BW1 A;  4J6W A;  2DK3 A;  2GGR A;  3CCL Q;  2F5K A;  2RB6 A;  3CC2 T;  1KD1 U;  3UA7 A;  3WVD B;  3CMA Q;  4C92 E;  4PFP A;  3MEU A;  1AZG B;  2A7Y A;  4A4E A;  2HAX A;  1N9R A;  2K7A A;  5GAN 4;  2QA4 Q;  3P8D A;  3QPH A;  3MEW A;  2DL3 A;  3OYE A;  2BE7 D;  5I2M A;  5FU7 B;  2DVJ A;  3SWN B;  2RHU A;  4M78 G;  3FJ5 A;  1YHQ T;  4MDX A;  2RN8 A;  3L2W A;  2ED1 A;  4F14 A;  4PJO E;  2KE9 A;  5IAY A;  4PFZ A;  5GAN 3;  4J9F A;  4D8K A;  4CC4 B;  3VS4 A;  1VQK T;  4R56 A;  3A5Z B;  1PSF A;  4BI8 B;  2HQE A;  3JRZ A;  3C12 A;  3X24 B;  4LUE A;  4B6M A;  3OYL A;  1XJW B;  4J9I A;  1MMA A;  5CAI A;  1SHF A;  3RIR A;  3CCJ Q;  3VS5 A;  2GFU A;  2C06 A;  2EJ9 A;  3EHQ A;  1X2Q A;  1VQP T;  4M78 E;  1WA7 A;  4FYX B;  1Y96 A;  1MMG A;  1V1C A;  4M77 G;  3P8B B;  4RKU E;  3RUX A;  4JJB A;  4M75 D;  2CP7 A;  1KD1 R;  2WSC E;  1M2V A;  4XTW A;  4AFQ C;  3ZL7 C;  3A8M B;  5KYW B;  4KGV B;  2DRM A;  2JOY A;  3F70 A;  2FHD A;  2PTK A;  4KGZ B;  4DBR A;  1PKT A;  1UGQ B;  2MI6 A;  2KMT A;  2KYM A;  4KBM B;  3CBO A;  5DY9 A;  3HRU A;  5GAN h;  2QTX A;  1YWP A;  1N27 A;  3NTH A;  4F7U E;  1QVG S;  5I22 A;  2FL7 A;  3QG1 A;  5GAN 2;  3M54 A;  1IZ6 A;  1VQ4 A;  4BAC A;  1I1J A;  2RM4 A;  2CT3 A;  3AHU A;  3L42 A;  1RL2 A;  1T3L A;  3OYI A;  5I11 A;  1Q95 G;  5CCA A;  2LJ3 A;  2L3P A;  5CIU A;  1FMV A;  1QVF S;  1UTI A;  3JCM W;  1BKB A;  1WHK A;  3HRT A;  3SWN A;  2X51 A;  3PIP A;  2X4W A;  4JZ4 A;  1VOM A;  2JNG A;  3RKW A;  1HYO A;  1X01 A;  2RI3 A;  5LJ5 g;  1QCN A;  3MO8 A;  3VU3 C;  3V8J A;  1TSF A;  5C6S A;  1AVZ C;  2M0Y A;  3H8Z A;  4JDS A;  4C5E A;  1TXQ A;  3D7S B;  1KQS S;  3CPW A;  4E7K A;  1S72 A;  4PJJ A;  2CH4 A;  3NPF A;  1M8M A;  3VRY A;  2X35 A;  3VUB A;  3JB9 F;  3JCM b;  3DLM A;  3FC3 A;  4M7D D;  1YP5 A;  1WIE A;  2HD0 A;  2D0N A;  4GLM A;  3CME A;  3NFC A;  3BFM A;  4C0D B;  4AMC A;  1WNL A;  3M58 A;  1KD1 C;  3SDZ A;  3UAT A;  5GAO l;  1AWJ A;  3SB2 A;  4NL2 A;  2GNC A;  3M9Q A;  2MYS A;  2OI3 A;  1TUC A;  1C0M A;  4LNP A;  1NEB A;  2PZ1 A;  3N5B B;  1BI0 A;  4UC4 A;  4JPB W;  1SG5 A;  1PD0 A;  1PRM C;  2CGH A;  3EH1 A;  3EAE A;  2KXD A;  2GF7 A;  2DX1 A;  5FWC A;  5LJ5 j;  4X34 A;  2ZZD A;  4OMP A;  3SD4 A;  4MZT A;  1WPY A;  2BE9 B;  1ZQ1 A;  1AZE A;  1P92 A;  1M1K C;  1D0X A;  3NTK A;  1VQ9 Q;  4M7A B;  1Y0M A;  2RQR A;  1G5V A;  1TG0 A;  3CEY A;  2FPF A;  1LJO A;  1X75 C;  4AFZ C;  3OYB A;  4R55 A;  3CC7 Q;  3R6N A;  2DPP B;  3FB9 A;  1IB8 A;  4QVZ A;  2Z0W A;  1Q82 U;  1BU1 A;  4M7A C;  2V1Q A;  3LYI A;  3E1S A;  3VUZ A;  1BI1 A;  2LC4 A;  1VQ5 Q;  2CP6 A;  2RNA A;  3OYN A;  1WJR A;  3PMT A;  3EFR A;  1QVP A;  3P8H A;  5CQY A;  2O88 A;  4CI0 C;  3OS5 A;  1SHG A;  5GAM e;  3GF5 A;  2ROL A;  5J26 A;  1UGS B;  3TSW A;  2CUB A;  5CK9 A;  3EFS A;  5FRN A;  4FIB A;  2OTL Q;  3HPW A;  4ZN3 A;  3CCU Q;  4Q5W A;  2ZPE B;  2HQH A;  2DYI A;  2JUF A;  5LL6 S;  1VQ4 T;  2O9V A;  1VQN A;  2DET A;  2NUT B;  1WQ7 A;  2JTF A;  5CO7 A;  3I56 A;  1YIJ Q;  1SPK A;  2A37 A;  3INZ A;  1Q7Y U;  2AIR B;  3DB4 A;  1YWO A;  1Q81 C;  1Q86 C;  4ELZ C;  3CCQ Q;  4Y92 A;  3RNJ A;  4AFU C;  1FYN A;  1UEC A;  4PNO A;  4CC2 A;  1NPP A;  4QQG A;  1RAE B;  2DBK A;  2C0I A;  2J06 A;  3OYK A;  4FYV B;  3UPU A;  2DYB A;  4RTW A;  3CCV Q;  3RMQ A;  3C94 A;  1WX6 A;  3L2U A;  4OMF B;  1QWE A;  5CQX A;  5FRO A;  4C8Q D;  3TCJ A;  1UHC A;  5IH2 A;  4WCI A;  1Q82 R;  4M75 E;  1S72 T;  2RHX A;  4DA4 A;  2LCL A;  4XTX A;  1QCF A;  2E10 A;  1WJS A;  2DTI A;  4FU6 A;  1GXI E;  4E7S A;  1T0J A;  3CME T;  3HFN A;  1D1A A;  2BZY A;  2CKK A;  4LD9 K;  4M7A A;  2P4T A;  2RI5 A;  4QQ6 A;  1YCS B;  4EMK B;  3WVE B;  2VVK A;  2LMJ A;  4RG8 A;  4ELY C;  2LNH B;  4C92 F;  5GAM d;  2MIO A;  2K2M A;  2V8I A;  1N8R C;  2JM8 A;  5KYY B;  1AWW A;  3JB9 G;  3H6Z A;  1OX9 A;  1NBE B;  1Q7Y R;  3OB9 A;  1N9S A;  4LDY A;  1YJ9 A;  2AT1 B;  1D0Y A;  4PLL A;  5GAO n;  1ZBJ A;  5AT1 B;  1KHI A;  3G4S A;  3NMZ C;  4RTU A;  2XDD A;  4PJO F;  2OTJ A;  1K8A U;  2OAW A;  4XU3 A;  2AZS A;  2FEI A;  3TVT A;  2O2O A;  4FT2 A;  5GMK e;  3LX7 A;  5A0G A;  2DZ9 A;  1PKS A;  2VXF A;  2CZ1 B;  3CC4 Q;  1UB4 A;  1NJI U;  1B07 A;  1LNX A;  2KDS A;  1YJN A;  2JTM A;  3QJY A;  1D1B A;  4B9X A;  3PTA A;  3ZFJ A;  3CBP A;  4RMO A;  1KSW A;  1NLO C;  1E6G A;  3H9N A;  3A8L B;  4M78 F;  3CC2 A;  1BI2 A;  2GQI A;  3VKI A;  2DL4 A;  1K0X A;  3JCM e;  2FZC B;  5GAN d;  3GOX A;  5M9O A;  4M7D E;  4C92 C;  4RTY A;  2V8J A;  2JMC A;  2M9U A;  2RJE A;  4DEY A;  1YHQ A;  2XHC A;  5GJV B;  1NYG A;  4FYW B;  1VYV A;  3FEO A;  1YIT A;  2OAU A;  4ZN1 A;  1ABQ A;  3HL8 A;  2YRV A;  2K3Y A;  3CC7 T;  2DO3 A;  2ZPG B;  3EG2 A;  1WI7 A;  4PJO C;  1OV3 A;  2LDM A;  1K8A R;  2ZPI B;  2DAQ A;  2ZPB B;  1K0S A;  3I56 T;  4F7U F;  2EGA A;  2X4Y A;  1OX8 A;  2D8J A;  2OX7 A;  3QWX X;  4HXJ A;  2COW A;  4M78 B;  3OMG A;  1RLP C;  1KQ1 A;  2MOX A;  4EMK A;  3EFO A;  2LTO A;  3H0I A;  2KXC A;  1IXD A;  4JUV A;  1M90 U;  3VS3 A;  2VC8 A;  5KYY A;  4HKE A;  3HHT B;  3MEV A;  1VQP A;  4N4I A;  1ZUU A;  2EAY A;  1NJI R;  4QW2 A;  2KGT A;  1RAC B;  1K9M U;  2EYX A;  2OTL T;  3ER0 A;  1TTH B;  3MCA B;  1GCQ C;  4M78 C;  4DEX A;  4F17 A;  4QVD A;  3GPL A;  1ZHI A;  2XG8 D;  2K5F A;  2XDP A;  5KCO A;  4OB3 B;  3J80 E;  1VQL Q;  1BK2 A;  4F04 B;  3JCM d;  2K9G A;  4A4K A;  3JCM c;  1AHJ B;  2O4X A;  1I07 A;  3A8O B;  4F7U B;  4M77 B;  4JRI A;  4MML A;  1H3Z A;  3EGX B;  2R58 A;  2KNB B;  1AD5 A;  2LVM A;  2RO0 A;  1ZX6 A;  1MND A;  3L1A A;  3CCV T;  3OYY A;  4PKC C;  1G3W A;  3A8G B;  2J6K A;  3MEA A;  1X69 A;  1YJ9 T;  2XI9 A;  1B34 B;  3RKY A;  2DXC A;  2EKH A;  1WGS A;  1W6X A;  4E6R A;  4C92 G;  1WHL A;  2CZ7 B;  3G4S T;  2KYB A;  1OU8 A;  5LJ3 h;  4BDZ A;  1PM3 A;  4EIK A;  1ACM B;  3Q1J A;  2YLB A;  2RD1 A;  3CCS A;  5HKC A;  1BIB A;  1VQ6 Q;  1K9M R;  1OZ2 A;  3E19 A;  1M3B A;  1UHF A;  3LH0 A;  4O5V A;  1NEG A;  2JJ9 A;  4PJO G;  2COZ A;  1OI1 A;  4E7Z A;  1KIK A;  4RTT A;  1LVK A;  2DE0 X;  4RCB A;  3TEE A;  3G71 Q;  3DB3 A;  1YJN T;  4FCY A;  2HMA A;  3PT9 A;  4C8Q E;  4D6W A;  2L8D A;  3NHN A;  3M59 A;  4M78 A;  3REA B;  5D6X A;  2LT4 A;  2HSE B;  2EYW A;  2VWF A;  1X6O A;  2YXY A;  2F69 A;  1UE9 A;  3PGG A;  4HCZ A;  1Z9Q A;  2EVR A;  3RKX A;  3S3O A;  5DM7 R;  3CCR A;  1SRL A;  1UDL A;  4ZTF A;  2FZK B;  2YRD A;  4J9B A;  5LJ5 h;  1DJ7 B;  2P0K A;  4LE9 A;  3VS2 A;  4PK4 A;  4P5N A;  1G3T A;  3LLR A;  2VGN A;  2HQX A;  2ATC B;  1XOV A;  3CCM T;  1VQM Q;  1YIT T;  3CBM A;  1GFD A;  5FU6 C;  1JB0 E;  2A28 A;  4KH1 B;  2XU8 A;  4JJD A;  3RBB B;  1D09 B;  2DXB A;  5D6W A;  3QII A;  3CCL A;  4DOW A;  4CRI A;  1OPL A;  4XU0 A;  3CMA A;  1KQ2 A;  3C95 A;  2JM9 A;  1Y71 A;  3UA6 A;  3GP8 A;  1O9S A;  4M77 A;  3GNF B;  1RUW A;  2QA4 A;  3G7Z A;  3QDF A;  1Z9Z A;  2DEU A;  2R5M A;  2WSE E;  2DL8 A;  2XMF A;  3QYG B;  4OMQ A;  1X6G A;  2ZPF B;  4Y28 E;  1E7O A;  1OU9 A;  2HL5 C;  3CPW S;  1A0N B;  5DLO A;  2SEM A;  4F7U G;  1G3S A;  1XQH A;  2KY9 A;  4KH0 B;  1R0C B;  2ZGW A;  1ARK A;  1QKX A;  1B34 A;  2VGM A;  2K2V A;  3OS1 A;  2QEX Q;  2JTE A;  2K4Y A;  2LT1 A;  5I2S A;  1ZSZ B;  2WSF E;  3JB9 H;  2DF6 A;  1T0H A;  1W1F A;  2RQT A;  2LX7 A;  2RQU A;  4C5H A;  2DNU A;  1QKW A;  2F1L A;  3CCJ A;  3PIO A;  2PU9 B;  2P84 A;  4RG2 A;  3OW2 A;  4M75 F;  1MMD A;  1JU5 C;  1R0B G;  3I35 A;  1VQO Q;  2EQM A;  2VB6 A;  1ZSZ C;  3UDC A;  2IIM A;  3OY9 A;  2QDL A;  2DD5 A;  3GIB A;  4XTU A;  1KC8 U;  5GAO q;  2AKL A;  4RTZ A;  2RJC A;  3KBG A;  3M0R A;  4E7H A;  1I8F A;  3JAM E;  1RAI B;  3MJX A;  1IHW A;  4NS5 A;  3BDL A;  4J8O A;  4BD3 A;  3PVQ A;  4OML A;  3S3M A;  3TU4 K;  4A63 B;  5ECA A;  4IIM A;  3URG A;  2EYQ A;  3JCM X;  4JRK A;  3CCS T;  2P0Q A;  1G2B A;  3CD6 Q;  4JRP A;  1UGV A;  1U8R A;  5KE2 A;  2KBT A;  2KR3 A;  2LCS A;  2LP5 A;  1AWO A;  2FPE A;  1BIA A;  1MNE A;  1X2K A;  1TWB A;  5HCK A;  4LN2 A;  3H0H A;  3PMI A;  1WQW A;  3X20 B;  3V8K A;  3HKS A;  3T9N A;  1OQK A;  2ENM A;  4M75 C;  1VQ7 Q;  4AFS C;  3HFO A;  3VS7 A;  4Z8A A;  3CCR T;  1VIF A;  1K73 U;  1OUL A;  4M7A D;  1VIE A;  2DIG A;  3UT1 A;  3VYG A;  2MMP A;  2CUD A;  1RLQ C;  4J9E A;  2KRS A;  3LWH A;  5GAM g;  2Y90 A;  4FSX A;  4M7D F;  1FMW A;  3QZ5 B;  4E2F B;  1KC8 R;  3OBW A;  2YUP A;  3OW2 P;  4XAX B;  1WHM A;  4GLK A;  3CCL T;  1FWZ A;  2HSP A;  3M55 A;  5LJ3 e;  2J6O A;  2AKK A;  4OMN A;  3CMA T;  1UGR B;  2LJ0 A;  4IUQ A;  2PQW A;  5KYW A;  2W0Z A;  2E65 A;  2DIQ A;  4HCB A;  4X9D A;  1RAF B;  1VQ8 Q;  2C0O A;  1U1S A;  2JXB A;  4C5I A;  2QA4 T;  3V7C A;  2J7I A;  5CKB A;  4VUB A;  3OMC A;  2K3B A;  3SHW A;  3ME9 A;  4C0G A;  4KUI A;  1JQQ A;  4JLI A;  3VS1 A;  4J83 A;  3QUI A;  2EQU A;  1C6V X;  8AT1 B;  2JS2 A;  2E12 A;  3QHS A;  5CKF A;  4OB1 B;  3PNW C;  3EH2 A;  3DKM A;  5GAM f;  2KSS A;  2E1H A;  1UJ0 A;  5GMK l;  1RI0 A;  2EGE A;  5D7U A;  1GBR A;  1KFZ A;  2JN0 A;  2XIC A;  4L5G A;  5LJ5 e;  5GAM j;  1K73 R;  2DVE A;  1KK7 A;  2FB7 A;  3C4S A;  3CCJ T;  4IUU A;  4Z02 A;  1VQ9 A;  1JJ2 S;  3EG0 A;  3QJ6 A;  3AT1 B;  2YUQ A;  2RF0 A;  1IGU A;  3JV3 A;  1VQN Q;  3RMS A;  3CC7 A;  5LJ3 d;  1HK9 A;  2CRE A;  3SFM A;  5CKE A;  4GY5 A;  4Y91 A;  2GCX A;  4M75 G;  4J9G A;  2HDA A;  2H8H A;  5HK3 A;  2KAF A;  4MZM A;  2M16 A;  3I55 Q;  5C0M A;  2C0T A;  1B7T A;  1VQ5 A;  2EGC A;  1E6H A;  3RER A;  1MHN A;  2JMA A;  1X43 A;  1KC8 C;  3O8V A;  2VAS A; 
#chains in the Genus database with same CATH homology
 5LJ3 f;  3WVD B;  2YRV A;  2K3Y A;  2QQS A;  4C92 E;  2E70 A;  3V8L A;  3MEU A;  2DO3 A;  4N4H A;  5GAN f;  3CC7 T;  2A7Y A;  2ZPG B;  4A4E A;  5GMK h;  2HAX A;  4PJO C;  3JB9 D;  2LNV A;  2X4J A;  1N9R A;  3FJP A;  2LDM A;  4EMH A;  5GAN 4;  2QI2 A;  3P8D A;  2E64 A;  1H64 1;  2ZPI B;  3MEW A;  2DAQ A;  2ZPB B;  3QPH A;  2OTL A;  2DZC A;  3I56 T;  2EWN A;  4F7U F;  3CCU A;  2QQ9 A;  2XKO C;  5I2M A;  3OYC A;  3OYE A;  1VQ6 T;  3CD6 A;  5FU7 B;  1W2B A;  2X4Y A;  4B9W A;  4XQ3 A;  3SWN B;  5LJ3 j;  2RHU A;  2B8A A;  3M57 A;  4M78 G;  1YHQ T;  4M78 B;  3OMG A;  1D3B A;  3QBY A;  4MDX A;  3L2W A;  1KQ1 A;  1YIJ A;  4LDX A;  4JJN K;  4FT4 A;  4EMK A;  1QP2 A;  2D9T A;  4PJO E;  2LTO A;  4JUV A;  4C0Z A;  5LJ5 d;  5IAY A;  5GAN 3;  4E7L A;  1M90 U;  2VC8 A;  3G71 T;  3CCQ A;  3OQ5 A;  4HKE A;  5AYF A;  3HHT B;  1XTD A;  1N8R U;  3MEV A;  3JCM g;  4N4I A;  1VQP A;  2EAY A;  1VQK T;  1JBM A;  4QW2 A;  4R56 A;  3A5Z B;  1PSF A;  2VXE A;  3VV0 A;  3OYD A;  3JCM h;  4M7A F;  2DD4 A;  4C8Q F;  1K9M U;  2OTL T;  5GAN e;  3ER0 A;  3KXT A;  4BI8 B;  4DOV A;  3MCA B;  4M78 C;  1VQ7 A;  3OSS C;  2HQE A;  4FL6 A;  4L6V 5;  3JRZ A;  4QVD A;  3GPL A;  1ZHI A;  3C12 A;  2XG8 D;  2K5F A;  4XTY A;  4NOY A;  3X24 B;  4BUG A;  3CCV A;  3GNG A;  2XDP A;  3LWI A;  3QSU A;  5KCO A;  4OB3 B;  3J80 E;  1I4K 1;  3OYL A;  5LJ5 f;  2E6Z A;  2ZCF B;  4XU2 A;  5CAI A;  2L3R A;  3RIR A;  3JCM d;  2DKG A;  3QYH B;  2GFU A;  4A4K A;  2C06 A;  3JCM c;  2EJ9 A;  2M0O A;  2LX9 A;  2AHJ B;  3MP1 A;  1AHJ B;  3FDR A;  2O4X A;  1VQP T;  3M4G A;  4M78 E;  3V7S A;  4C0D C;  3A8O B;  4YTL A;  5GMK j;  1UEB A;  1M8V A;  2O01 E;  4F7U B;  1Y96 A;  4M77 G;  3LGF A;  1VQM T;  4M77 B;  4ATO A;  5DLQ E;  4JRI A;  4MML A;  1M4Z A;  3P8B B;  1H3Z A;  4RKU E;  1XNI A;  3RUX A;  2R58 A;  2VUB A;  4M75 D;  2LVM A;  4ME7 A;  4NL3 A;  2RO0 A;  3L1A A;  2XDB A;  3CCV T;  5A0L A;  2WSC E;  3OYY A;  4M7D G;  4MDW A;  3MP6 A;  3JCM f;  4PKC C;  4M7D B;  1G3W A;  2XD0 A;  4XTW A;  3OYA A;  2LQ8 A;  5A2Q E;  3A8G B;  4OVA A;  5HY6 A;  3CXC S;  1BI3 A;  3V7R A;  5GMK i;  3MEA A;  3LGL A;  1VQ8 A;  3A8M B;  3JB9 J;  1OZ3 A;  2JOY A;  1YJ9 T;  2XI9 A;  2ZPH B;  3F70 A;  4DQ2 A;  1B34 B;  3RKY A;  4FM4 B;  4MZP A;  2FHD A;  2DXC A;  2R57 A;  2DJZ A;  5EG2 A;  1WGS A;  1UGQ B;  5GAN g;  2MI6 A;  4C92 G;  2CZ7 B;  2RA2 A;  4C92 B;  2L5Q A;  3G4S T;  2KMT A;  4M75 A;  5LJ3 h;  4LDU A;  1FX7 A;  4KBM B;  1HXD A;  3CBO A;  5DY9 A;  3HRU A;  5GAN h;  2QTX A;  1N27 A;  2RH2 A;  3NTH A;  4BDZ A;  3JCM J;  4M7D C;  4F7U E;  2KK4 A;  3X28 B;  3BY7 A;  1QVG S;  2FL7 A;  3Q1J A;  2YLB A;  2RD1 A;  2FYK A;  2CS7 A;  5GAN 7;  3CCS A;  3QG1 A;  4M78 D;  5HKC A;  1BIB A;  2BIV A;  1SSF A;  4C0F A;  5GAN 2;  2QEX T;  4BE2 A;  3M54 A;  1IZ6 A;  4C8Q C;  2PVO B;  1OZ2 A;  3E19 A;  5CR2 A;  4HCC A;  1VQ4 A;  4BAC A;  2EKO A;  3LH0 A;  3MP8 A;  4O5V A;  2RM4 A;  3HP9 A;  3L2Q A;  4PJO G;  3AHU A;  1OI1 A;  4PJO B;  3L42 A;  2DXU A;  2K5I A;  1RL2 A;  1Y7X A;  4A53 A;  3OYI A;  2QQA A;  2EJF A;  4RCB A;  3TEE A;  3ZEH A;  3DB3 A;  1VQ9 T;  1Q82 C;  1YJN T;  5CCA A;  3CC4 A;  2KQW A;  4M7A E;  3PT9 A;  4J6X A;  5CIU A;  4C8Q E;  1QVF S;  4D6W A;  2L8D A;  3OW2 S;  3JCM W;  1BKB A;  3HRT A;  3X26 B;  3SWN A;  3M59 A;  2EIF A;  1I81 A;  3CCM A;  1G3Y A;  4M78 A;  5D6X A;  1QP3 A;  3J81 E;  2X4W A;  3PIP A;  2JZ2 A;  2LT4 A;  4N0A C;  4OB0 B;  3A8H B;  3PGG A;  1X6O A;  1VQO T;  2F69 A;  4HCZ A;  2JNG A;  3M5A A;  3OS0 A;  1UGP B;  2MWO A;  3RKW A;  1X01 A;  2RI3 A;  3RKX A;  5LJ5 g;  5DM7 R;  3S3O A;  3MO8 A;  3CCR A;  5KE3 A;  3VU3 C;  4ZTF A;  2RK1 A;  4MMK A;  5GAN 5;  2CYZ B;  3V8J A;  2XID A;  5LJ5 h;  2RHI A;  3JCM P;  5C6S A;  1DJ7 B;  5GAO m;  2P0K A;  3H8Z A;  4JDS A;  5GAO r;  2LCC A;  4P5N A;  1NZ9 A;  1G3T A;  4M77 D;  3LLR A;  2VGN A;  2HQX A;  4C5E A;  1KQS S;  3CPW A;  5GAN j;  5FLX E;  4E7K A;  2QQR A;  5J39 A;  1S72 A;  1VQ5 T;  3UWN A;  1XOV A;  1NPR A;  3CCM T;  2DTO A;  1YIT T;  3CBM A;  2X4X A;  4E7I A;  3QKJ A;  1Q7Y C;  5FU6 C;  1JB0 E;  2X35 A;  3I55 A;  2XU8 A;  3E9G A;  3VUB A;  3JCM b;  4EDU A;  3JB9 F;  2DXB A;  3DLM A;  4QQD A;  5D6W A;  3FC3 A;  4M7D D;  3QII A;  3CCL A;  1R8O B;  2CZ0 B;  2HD0 A;  3CME A;  4DOW A;  4CRI A;  4JRQ A;  4E7J A;  3NFC A;  2LRQ A;  4XU0 A;  3CMA A;  1KQ2 A;  3BFM A;  4C0D B;  3JCM Q;  3C95 A;  4XTZ A;  1YCY A;  1WNL A;  3M58 A;  1KD1 C;  3CCU T;  3SDZ A;  1Y71 A;  3GP8 A;  1O9S A;  2PUK B;  4M77 A;  5GAO l;  3FIF A;  3GNF B;  3CD6 T;  5A0D A;  3SB2 A;  4NL2 A;  3G7Z A;  3M9Q A;  2I2L A;  3CXC A;  2QA4 A;  3S6W A;  1Y07 A;  4C92 D;  1YIJ T;  2R5M A;  2WSE E;  3QYG B;  1V29 B;  2ZPF B;  3E9F A;  3G6E A;  3HSB A;  2K57 A;  3N5B B;  4Y28 E;  3GLX A;  3WXM B;  1K73 C;  3OYH A;  1BI0 A;  3CCQ T;  4M7D A;  4UC4 A;  3OSV A;  3OYF A;  4A4G A;  3CPW S;  5DLO A;  3HRS A;  4F7U G;  1G3S A;  2CGH A;  1JJ2 A;  1XQH A;  2KY9 A;  2RI2 A;  3EAE A;  1QVG A;  1YI2 A;  2ZGW A;  1IRE B;  2GF7 A;  5LJ5 j;  1B34 A;  2VGM A;  3OYG A;  2K2V A;  3OS1 A;  1VQ7 T;  3FLG A;  2K4Y A;  4IUP A;  4PJO D;  2LT1 A;  4X34 A;  3FRN A;  2ZZD A;  3SD4 A;  4C92 A;  4V2S A;  4MZT A;  1WPY A;  5I2S A;  1ZQ1 A;  4OGE A;  3JCM V;  2WSF E;  2HNI A;  3JB9 H;  3G6E T;  1P92 A;  1M1K C;  3NTK A;  1VQL A;  2EQK A;  2WAC A;  4M7A G;  4C5H A;  1ZBX A;  2PUO B;  4C8Q G;  4M7A B;  5GAO p;  3PFS A;  4C8Q B;  4E47 A;  3CCJ A;  1G5V A;  1KHC A;  3PIO A;  2PU9 B;  2NLU A;  4EMK C;  1QVF A;  4RG2 A;  3CEY A;  2JVV A;  4M75 F;  3OW2 A;  1LJO A;  1LOJ A;  1X75 C;  4X9C A;  4BY6 B;  4JLG A;  4RCC A;  2E5Q A;  1YJW A;  3OYB A;  4PJO A;  4R55 A;  2EQM A;  4TVR A;  4LD6 A;  5IN1 A;  4JS5 A;  2DPP B;  2MWP A;  3FB9 A;  2O4X B;  4QVZ A;  3UDC A;  3OY9 A;  1Y96 B;  1Q82 U;  3QXE B;  4WF2 A;  2BUD A;  2DD5 A;  4BB7 A;  5HK0 A;  1VQ8 T;  4M7A C;  5GAN 8;  4J7I A;  3GIB A;  2DEQ A;  3LYI A;  3E1S A;  3VUZ A;  1BI1 A;  1K8A C;  4LDV A;  2LC4 A;  4XTU A;  1KC8 U;  1KQS A;  5GAO q;  4BY6 C;  2QXF A;  3OYN A;  3S3N A;  1EIF A;  2G3R A;  1WJR A;  2RJC A;  3PMT A;  5GAN 6;  3KBG A;  4E7H A;  2KVQ G;  3OS2 A;  4J6Y A;  2IG0 A;  1I8F A;  1QVP A;  2RHY A;  3EFR A;  3P8H A;  5CQY A;  5CVI A;  3JAM E;  4XU1 A;  4NS5 A;  3BDL A;  2E41 A;  4J8O A;  4BD3 A;  4CI0 C;  3S3M A;  3OS5 A;  4BI3 A;  2FVU A;  3TU4 K;  4KUL A;  1M1F A;  3NTI A;  3GF5 A;  3URG A;  5J26 A;  5GAM e;  2EYQ A;  4A54 A;  1UGS B;  3JCM X;  4JRK A;  5CK9 A;  3EFS A;  3CCS T;  4FIB A;  5FRN A;  1NJI C;  3HPW A;  2P0Q A;  4ZN3 A;  4JS4 A;  2E6N A;  2GQV A;  4Q5W A;  2ZPE B;  2MAM A;  5FU6 B;  2JUF A;  3TRE A;  2GFA A;  5LL6 S;  4JRP A;  3KUF A;  3CCE A;  1VQ4 T;  1VQN A;  1U8R A;  5KE2 A;  3I56 A;  1WQ7 A;  2JTF A;  4IUV A;  2F5T X;  5CO7 A;  1Q7Y U;  3INZ A;  1VQ6 A;  3DB4 A;  1Q81 C;  1BIA A;  5CKH A;  1Q86 C;  2YHT A;  1KG1 A;  1FXX A;  3M4Y A;  4ELZ C;  4IUT A;  3CC4 T;  3CC2 T;  4PLI A;  4PNO A;  2YLC A;  1NPP A;  4QQG A;  1M1G A;  3PMI A;  1WQW A;  3X20 B;  3V8K A;  3G71 A;  2L89 A;  4J5Y A;  3HKS A;  1W4S A;  3T9N A;  1WJQ A;  3OYK A;  1VQK A;  2DTH A;  4M75 C;  3J7A F;  3UPU A;  3HFO A;  2R5A A;  3OBY A;  2VV5 A;  3CCR T;  3CCE T;  1VQN T;  5D6Y A;  3RMQ A;  1VIF A;  3C94 A;  4BDY A;  1K73 U;  2MF2 A;  3L2U A;  2A3L A;  2Y4X A;  4M77 F;  4OMF B;  4M7A D;  5CQX A;  4F7U A;  4C8Q A;  5FRO A;  4C8Q D;  1VIE A;  4ZTJ A;  3TCJ A;  1M5Q 1;  2DIG A;  2M1H A;  3LW5 E;  3UT1 A;  3VYG A;  3QZ9 B;  2MMP A;  4M75 E;  4XK8 E;  3LWH A;  1QW1 A;  1S72 T;  2RHX A;  5GAM g;  3OA6 A;  2Y90 A;  4DA4 A;  4LD9 K;  1O75 A;  4FSX A;  2LCL A;  4XTX A;  4EMG A;  2E10 A;  4M7D F;  3QZ5 B;  3DLL A;  5GAM h;  3I55 T;  3OBW A;  1WJS A;  2K3X A;  2DTI A;  4XAX B;  4FU6 A;  4GLK A;  4O6J A;  2CZ6 B;  3CCL T;  1FWZ A;  1VQM A;  1GXI E;  2EJG A;  3M55 A;  5J3B A;  5LJ3 e;  3CME T;  4KUD K;  3HFN A;  5FU7 C;  1NE8 A;  1VUB A;  4OB2 B;  1M1K U;  2CKK A;  2HBP A;  1UGR B;  4IUQ A;  4L59 A;  3SWN C;  1D3B B;  2PQW A;  3CMA T;  2P4T A;  4OP0 A;  2RI5 A;  2QDY B;  2E65 A;  2DIQ A;  2RK2 A;  4QQ6 A;  2RJF A;  3VYH B;  3VJP A;  4X9D A;  4EMK B;  1M90 C;  3WVE B;  4ELY C;  4RG8 A;  3L2R A;  4HCB A;  2BKD N;  1BYM A;  4C92 F;  5GAM d;  5GMK m;  1U1S A;  2V8I A;  4C5I A;  5KH6 A;  1N8R C;  2QA4 T;  3V7C A;  5CKB A;  1YBY A;  4VUB A;  3OMC A;  2H3J A;  1W2B S;  1OYX A;  5I21 A;  3L2V A;  3ME9 A;  3JB9 G;  1TH7 A;  4KT0 E;  4C0G A;  4N4G A;  3MET A;  3H6Z A;  3R6O A;  4KUI A;  3ASK A;  4JLI A;  5IT9 E;  4M7A A;  1K9M C;  3JB9 I;  4OGC A;  3OB9 A;  1N9S A;  4LDY A;  1YJ9 A;  3QO3 A;  4J83 A;  5FRM A;  3BDU A;  3OYM A;  3QUI A;  4PL6 A;  2EQU A;  3OYJ A;  4PLL A;  2E12 A;  3QHS A;  5GAO n;  4N0A A;  2V8K A;  1KHI A;  5CKF A;  4OB1 B;  4BI4 A;  3G4S A;  3PNW C;  2K5L A;  3ZBD A;  2XDD A;  3DKM A;  4PJO F;  1JRI A;  1YI2 T;  5GAM f;  2OTJ A;  2KSS A;  4OF1 A;  1K8A U;  2XK0 A;  3M56 A;  2E1H A;  4XU3 A;  2EQJ A;  4BE1 A;  2IVW A;  4XTV A;  5GMK l;  1RI0 A;  2Y4Y A;  4FT2 A;  5GMK e;  3CPF A;  1I5L A;  4HT9 A;  2RHZ A;  2QEX A;  3JSC A;  3LX7 A;  4HA8 A;  2JN0 A;  2XIC A;  5A0G A;  3L2Z A;  4L5G A;  2DZ9 A;  2P0P A;  4M77 C;  4ZGE B;  5LJ5 e;  5GAM j;  1VQL T;  3M53 A;  3RES A;  1M9S A;  2VXF A;  2CZ1 B;  5LJ3 g;  1UB4 A;  2DVE A;  2FB7 A;  3C4S A;  3CCJ T;  1NJI U;  4IUU A;  4EPC A;  4QVC A;  1PSE A;  4Z02 A;  1LNX A;  2RJD A;  2KDS A;  1VQ9 A;  1YJN A;  2JTM A;  3QJY A;  4IUR A;  1JJ2 S;  2OTJ T;  4HT8 A;  4B9X A;  3PTA A;  1YJW T;  3ZFJ A;  3QDR B;  4A4F A;  3QJ6 A;  3X25 B;  3CBP A;  5L8R E;  4RMO A;  4II1 A;  4M77 E;  2LQK A;  2QQB A;  3A8L B;  4M78 F;  2D6F A;  3CC2 A;  1Q81 U;  1BI2 A;  3RMS A;  1Q86 U;  1VQO A;  3CC7 A;  3VKI A;  5LJ3 d;  1HK9 A;  4A4H A;  1U1T A;  3SFM A;  3JCM e;  5GAN d;  5CKE A;  3GOX A;  4GY5 A;  4Y91 A;  2D0Q B;  2GCX A;  4M75 G;  5M9O A;  4ZGJ B;  4M7D E;  4M75 B;  4C92 C;  1N6A A;  2V8J A;  4IKF A;  2PVG B;  4C5G A;  5CKD A;  5HK3 A;  2M9U A;  4LDW A;  4J7F A;  2KAF A;  2DXT A;  2RJE A;  2M16 A;  4MZM A;  4BE0 A;  1YHQ A;  2XHC A;  5C0M A;  5KCH A;  3MHX A;  2PVD B;  4ZGD B;  3BW1 A;  2VYT A;  1VQ5 A;  4J6W A;  1MGQ A;  2DK3 A;  3FEO A;  2EFI A;  1YIT A;  2OAU A;  2F5K A;  2RB6 A;  1MHN A;  4ZN1 A;  1KC8 C;  3RER A;  3O8V A;  3HL8 A;  1KD1 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...