2EBPA

Solution structure of the sh3 domain from human sam and sh3 domain containing protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords SAM and SH3 domain-containing protein 1
publication title Solution structure of the SH3 domain from human SAM and SH3 domain containing protein 1
rcsb
source organism Homo sapiens
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ebpA00
2LQNA 3A98A 4JZ4A 1GCPA 2IIMA 1UHFA 2HDAA 1TG0A 4RTYA 3VS5A 1AWOA 2DLPA 3VS2A 1ABOA 4J9IA 2A37A 3UF4A 4RTWA 3VS1A 2CSIA 3REBB 1U06A 1V1CA 1NM7A 1ZUUA 3NPFA 3PVQA 4CC4B 4J9DA 5IXFA 5IHNA 2L3QA 2LMJA 3TVTA 2D0NA 1PKTA 1T0HA 3JV3A 2GTOA 2FRWA 3I9QA 4IIOA 4J9HA 1K0XA 2EQIA 1B07A 4LE9A 1OPKA 3KFVA 4RTTA 3TSWA 2J06A 1KIKA 2CREA 4AFQC 2OAWA 1XOVA 2CH4A 2JM9A 3EGUA 3NMZC 2ROTA 4OMOA 4AG1C 3PVLA 2GNCA 1KJWA 2ROLA 1SRMA 2BZYA 1G83A 2EGAA 4RUGA 1M3BA 1SSHA 3M0UA 2ED1A 3M0TA 2LQWA 1GBQA 2RNAA 2KXCA 3VS3A 2KT1A 4F14A 1NEBA 2CH4W 1GL5A 1GBRA 1GFCA 2K2MA 2KRNA 2DBMA 2KT8A 1KSWA 2J05A 1BBZA 4Y92A 2YT6A 5ECAA 3PE0A 1K0SA 4Z88A 1SHFA 1M3CA 1WDXA 4KRTA 2L2PA 1WX6A 2EW3A 2W10A 1A0NB 2YUPA 2RF0A 4DEXA 2AKLA 2EGEA 3EHRA 2DX1A 4IIMA 3NHNA 1WXBA 1MUZA 3M0PA 1UECA 5FWCA 1WIEA 2DL8A 1OPLA 2YSQA 4AG2C 3M0QA 5GJWB 3EG3A 2J6KA 2EGCA 2SRCA 2F2XA 2MOXA 2O9SA 2D8JA 4LNPA 1ZX6A 2DL3A 1ZUKA 2V1RA 3VRYA 5GJVB 1SEMA 2DILA 2EVRA 2LCSA 4AFSC 2CSQA 4HVVA 1H3HA 2XMFA 5HCKA 2C0OA 5L23A 2DRMA 3R6NA 1UTIA 2RQWA 2KGTA 2LJ3A 1MV3A 2C0IA 4CC3A 1SHGA 3H0IA 1GFDA 2YDLA 2KXDA 2BZXA 5FW9A 3I35A 1RUWA 1UE9A 2RQRA 1X43A 2KEAA 1W70A 2DL7A 2F2VA 2B86A 1S1NA 1VYVA 1I1JA 2EYZA 1KFZA 4OMMA 1FMKA 1QWEA 2VVKA 3QWYA 3C0CA 1YN8A 2O88A 1JQQA 4GLMA 2JMCA 1X6BA 2L0AA 3O5ZA 4LN2A 2SEMA 2X3XD 1T0JA 2RQTA 5IHIA 1UFFA 2RQVA 2AKKA 1GRIA 1J3TA 2FRYA 1RLPC 1VYTA 3VRZA 2A36A 1PHTA 2O31A 2K6DA 1Y0MA 3H0HA 1M27C 2L3PA 2JMAA 5EC7A 1X27A 1PRMC 4WCIA 2GBQA 1YWOA 2KBTA 2DBKA 2DMOA 1ZBJA 2EBPA 5FWBA 1WA7A 2DL5A 4J9BA 1AOJA 2A08A 2D1XA 1H92A 1T3LA 1HD3A 3M0SA 1YCSB 2O2OA 1NYFA 2J7IA 1AWWA 4ZNXA 3VS0A 2O9VA 2RMOA 1I07A 3I5RA 3GBQA 2KRSA 1K9AA 2ESWA 2BTTA 2RQUA 2A28A 4ESRA 4M4ZA 4QT7A 4R0KA 1CKBA 2EYXA 3RNJA 4JJBA 4RTVA 2NUZA 3REAB 1AVZC 4D8KA 2E5KA 4CC2A 1ARKA 1JU5C 1ZUYA 2OJ2A 3CQTA 4HCKA 5I22A 2K3BA 1JEGA 2CDTA 2GGRA 3VS7A 1UUEA 3EG0A 1GCQC 1MV0B 1RI9A 2L3SA 2JM8A 1Z9QA 4K11A 3SEMA 4D8DA 4RTZA 4RTUA 1N5ZA 4Z89A 2K9GA 1AWXA 3QWXX 4HXJA 2W0ZA 4AFUC 4JJCA 2VWFA 2P4RA 2M51A 2GQIA 1JXMA 1VYUA 4J9CA 1CSKA 2GTJA 1BB9A 1JO8A 1OOTA 2CUBA 1QLYA 1WLPB 2I0NA 1GCQA 3VS6A 1E7OA 2JS2A 3UA7A 1QKWA 3UA6A 2NWMA 2J6FA 4A63B 1W1FA 2KYMA 4JPBW 2G6FX 2C0TA 1JXOA 2LJ1A 1BU1A 2DRKA 1PRLC 4OMLA 1IO6A 4HVWA 1X69A 1NEGA 1U5SA 4J9FA 1UGVA 2DF6A 3NGPA 1WXTA 2HBWA 4LUDA 1UJ0A 1PKSA 1M8MA 3UATA 2KR3A 2LP5A 2JXBA 2FPFA 1WXUA 2EYWA 1SRLA 2OI3A 1E6GA 2H8HA 2JTEA 2MIOA 1VA7A 2EYYA 3VS4A 2QDLA 2DM1A 2EKHA 3RBBB 2X3WD 3FJ5A 1K76A 1OEBA 4ORZA 1PNJA 1Z9ZA 1ABQA 4X1VA 2DVJA 2BZ8A 4F16A 2AK5A 1PWTA 1K4US 2DL4A 2CT4A 1QCFA 2ENMA 2PTKA 2V1QA 2VKNA 2ECZA 1UHCA 2AZSA 1AZGB 2HSPA 4OMQA 2KYBA 1H8KA 1UG1A 2FPEA 4J9EA 5IHKA 1RLQC 2LJ0A 1AZEA 1QKXA 1T3SA 1TUDA 1Y57A 2KE9A 2RN8A 4OMNA 2KRMA 2YUOA 1WFWA 1AD5A 2EPDA 1ZSGA 4CC7A 2DNUA 3IQLA 1W6XA 2MCNA 2JW4A 3LH5A 4J9GA 2LX7A 2K79A 2LNHB 2CUDA 2M0YA 4FSSA 2PZ1A 3EG2A 4LUEA 2RPNA 4JJDA 4Z8AA 2K7AA 3THKA 2DJQA 2F2WA 4RTXA 3ULRB 2DYBA 1TUCA 1YNZA 2JS0A 1NLOC 2LZ6B 2PNIA 1M3AA 5IXBA 1ZLMA 2CT3A 4EIKA 1NG2A 2HCKA 1AEYA 2ABLA 2JT4A 1X2KA 1M30A 1CKAA 3ZL7C 2HEQA 4DEYA 1WYXA 3TSZA 2FO0A 1SPKA 1AWJA 4JZ3A 1FYNA 1E6HA 3I5SA 1B3QA 1WI7A 2DA9A 4OMPA 1YP5A 1OV3A 4HVUA 1NYGA 1YWPA 1LCKA 2FG0A 2AZVA 5I11A 2FPDA 1QWFA 2D8HA 3U23A 2KROA 4GBQA 3H41A 3M0RA 3EHQA 1G2BA 1X2QA 1BK2A 4E6RA 4F17A 1U3OA 2KNBB 1EFNA 1UJYA 5IH2A 1I0CA 1UDLA 2YUNA 2DE0X 3SHWA 2FEIA 4AFZC 1K1ZA 2ED0A 2YUQA 3H0FA 3EG1A 1HSQA 1HJDA 1X6GA 2J6OA 1NLPC
chains in the Genus database with same CATH superfamily
2XDBA 1VQ9Q 3OYLA 1IREB 3EH1A 4M77B 3A98A 1M8VA 4JZ4A 4KBMB 2CP0A 1UHFA 1TG0A 5AYFA 4RTYA 3OYNA 3SFMA 2DLPA 4J9IA 3CCMA 2BKDN 3EFRA 2KSSA 2WSEE 2COWA 2CSIA 2X4XA 4PJOG 1U06A 1NM7A 4CC4B 5FLXE 3I56A 3TVTA 2ZGWA 5CVIA 4M78D 1RI0A 3UPUA 2MI6A 4Z02A 1B07A 2EFIA 4LE9A 3ASKA 4KH0B 2NYSA 2BE9B 4KUDK 2VC8A 2LQ8A 4RCBA 1WPYA 4OVAA 3I55T 5HK3A 4FSXA 2L8DA 4OMOA 2A7YA 2P4TA 3PVLA 1KJWA 5FROA 3OYFA 4FW2A 2DKGA 4RUGA 2PVOB 3M0UA 4M7AA 2C06A 3M0TA 2RNAA 2KMTA 1NEBA 2CH4W 2HD0A 2ZPIB 2K2MA 2RM4A 3OYKA 1RABB 2O4XA 4M78E 1KQSP 4PJNA 3S3MA 3NTKA 5ECAA 3PE0A 4Z88A 1N9RA 4A53A 5I2SA 4KULA 2DVEA 4BUGA 1BI1A 3I55Q 1A0NB 2YUPA 2F1LA 2XHCA 3LYIA 3OW2P 5GANg 1MUZA 3OYIA 3HRSA 5FWCA 1WIEA 4NS5A 3M0QA 4M7DG 2ZPBB 3CCUA 4JLGA 4BB7A 5LJ5g 4DQ2A 1TS9A 1YJWA 2FL7A 3TCJA 1I81A 4M75D 1YJNA 2PVDB 1VQKQ 3MPUB 4D6WA 1JJ2S 2XICA 1YFNA 3G1JA 4HVVA 3VYHB 2C0OA 4ZN1A 2DRMA 2NUTB 3EFOA 4M7AE 4M77G 2MYSA 3L2QA 2RQWA 3CMEA 1RAAB 2R5AA 2C0IA 2X4JA 5J26A 2YDLA 5A0GA 3PTAA 2KXDA 2YHTA 3TREA 1EZZB 3PMIA 4LDXA 2BE7D 2F2VA 3OB9A 2QEXA 5LL6S 2B86A 1K9MR 4OB3B 1IGUA 1I1JA 3BW1A 1NJIU 1ZSZC 1BCOA 3MEWA 2O88A 3HPWA 5LJ3j 5FU7C 2L0AA 1JRIA 4C8QF 2XDPA 1MGQA 3OYAA 4O5VA 1IGQA 3X25B 1YJ9Q 2IPOB 4ZTJA 3EG9B 3JCMe 2O31A 2K6DA 1KQSS 2RJDA 4TVRA 2KBTA 3AHUA 4C0FA 2DTOA 4HA8A 2DMOA 5CQYA 3NTIA 2DXCA 3CMAA 1MNDA 3OW2S 2YRVA 2RK1A 4CI0C 2HNIA 1BKBA 3VUBA 4PJOA 1SF9A 2P0QA 1YITA 4E7ZA 5FU6B 2RQUA 3S6WA 2JNGA 4M4ZA 1JBMA 3CCET 3RNJA 1PG5B 4C92D 1G3TA 3VU3C 3WXMB 4D8KA 1ARKA 4PFZA 3G4SA 4PJOD 2OJ2A 1JEGA 2DJZA 5DLQE 3RKXA 2E6NA 2BIVA 4MDXA 1MV0B 2L3SA 4QQDA 2JM8A 1Z9QA 2PU9B 3SEMA 5CR2A 3MEAA 1S72A 2RJFA 5GAMj 4JJCA 2VWFA 2P4RA 1QMCA 3DKMA 3GNFB 1VQOT 3UDCA 5GAMd 3A8LB 5KYNA 2FB7A 2DERA 1YBYA 1NJIC 2CUBA 3RERA 2QQSA 3QJYA 2HL5C 3EGXB 4E7HA 3V8LA 2JS2A 4AMCA 1QKWA 1YCYA 2HKNA 3UA6A 3CCRQ 1W1FA 5D6XA 4JPBW 3CXCA 2C0TA 1YI2T 1M4ZA 1O9SA 4PJOE 4PNOA 5CKBA 3MP1A 4LDUA 1QCNA 1M1GA 4EMKB 4HVWA 1NEGA 4BI4A 4J9FA 2HBWA 2RI5A 5GAN3 3PMTA 5GMKe 1VQKA 1VQOQ 1SG5A 2JXBA 4M7DA 5GAN8 1QVFP 2H8HA 4M77C 3VS4A 5GANf 1HK9A 4CRIA 4BD3A 3FJ5A 3QDRB 3OS5A 2X4YA 2M0OA 3URGA 1YI2Q 1PC0A 4M7DD 4XU3A 4FW1A 5LJ5f 3J7AF 2EQUA 1V76A 4PLLA 3OSVA 2V1QA 2VKNA 2ECZA 2AZSA 4X9CA 2KYBA 1H8KA 1NJIR 1UG1A 4QW2A 2VV5A 4M77A 2DK3A 2ZPHB 5I2MA 2K3YA 2RN8A 2CZ7B 1AD5A 2LTOA 5I21A 1I4K1 1W6XA 3ER0A 3LH5A 2AIRB 4MZTA 4KGXB 3A8GB 2LX7A 4L59A 3M53A 1KD1U 2MMPA 3P8DA 4M78F 4DOVA 3EG2A 1YJ9A 2HL3A 1P92A 1VQ8A 4XTVA 2AHJB 1VQ6Q 1WQWA 1YNZA 3G71T 1NLOC 4M7DE 1R77A 2JTFA 3RKYA 2K5FA 1OX8A 1TSFA 4QQ6A 4EDUA 4XTYA 2FO0A 1SPKA 2CZ6B 1WI7A 2DA9A 1PSFA 1OV3A 4PFOA 4HVUA 3CCMT 3M56A 4M77E 3CCLA 1LCKA 2FG0A 3BY7A 2GF7A 1NBEB 3M0RA 3X24B 1G2BA 4E6RA 1BK2A 3FLGA 1U3OA 3RMSA 2LRQA 3OY9A 1QVFS 1EFNA 1UJYA 1I0CA 2DE0X 2CZ1B 2JN0A 3V7CA 3CD6T 3H0FA 1ZSZB 7AT1B 3CCJA 8AT1B 2G6FX 4BDZA 2RHIA 4UC4A 1D0YA 2E65A 4B9WA 3QZ9B 5FU7B 4M75F 2IVWA 4B9XA 1FMVA 2A37A 1VQ4A 3A8MB 1VQLT 3G7ZA 2YWWA 4IUTA 2RA2A 1UGSB 1V1CA 8ATCB 1ZUUA 1KD1C 2E70A 3S3OA 2DTHA 5IHNA 2LMJA 1PKTA 3LX7A 1NZ9A 4PK4A 3JV3A 2NUTA 5GAMh 3MP6A 3TU4K 2CGHA 1W4SA 1M90C 4IIOA 3JCMQ 3JCMg 4C5IA 2XDDA 1OPKA 2VGMA 3NTHA 2Y90A 2PQWA 3GOXA 3OMCA 3CC2T 3ZFJA 3V8JA 3P8BB 4EMGA 2EWNA 2ROTA 3F70A 3G6EA 1WHMA 2P84A 4NL2A 1YJWT 1QVGP 1QP3A 2BZYA 4C0ZA 1OU9A 1SKUB 2X9HA 4NOYA 1M2VB 3CCST 3PT9A 2LQWA 3PGGA 2KXCA 2KI7A 2R5MA 3JB9D 1MMAA 5GANj 4E47A 2M1HA 1TWBA 3HRUA 2KRNA 4JUVA 4C5EA 1NPRA 2KT8A 4OMFB 3CMET 4Y92A 3EG9A 1SHFA 5LJ5j 3CXCP 3LW5E 2RF0A 5LJ5d 1XTDA 3E9GA 5HY6A 3EHRA 2DX1A 4BY6C 3NHNA 1VQ6A 1C0MA 2ZPEB 4E7LA 2FYKA 4N0AA 4DA4A 4J7IA 1WGSA 2KDSA 2EGCA 1VQNQ 4C92F 1Q81R 1PD1A 2MOXA 4LNPA 3BE3A 1SEMA 1HYOA 2EVRA 4OGEA 3M58A 1YIJA 4J6YA 1I5OB 1YHQA 2XKOC 1WJQA 3VJPA 5HCKA 1BIBA 3LLRA 3QSUA 3OYHA 1N8RR 3OYDA 1Q82R 3CC4Q 3JB9H 2DPPB 4IKFA 4CC3A 3H0IA 4PJMA 2RJCA 2LNVA 1BIAA 3I35A 4BACA 2DL7A 5CIUA 3KXTA 1S1NA 1VYVA 3META 2DZ9A 1KFZA 3A8OB 4EMKC 2E4HA 1FMKA 2DEQA 4XU0A 3C0CA 2V8IA 2OTLA 3CCQA 3EGXA 1ZQ1A 1QVGS 5CCAA 1Q95G 2VUBA 4OB2B 5GMKh 5IHIA 2YXYA 2FHDA 1C6VX 3G4ST 2CP3A 1G3WA 2EQKA 2AKKA 4J7FA 2FRYA 1RLPC 3QDFA 1VYTA 3FJPA 4EMKA 3V8KA 1VQ7A 4N4IA 4J6WA 1Y0MA 3OYCA 1M27C 4DBRA 2L3PA 2JMAA 1S72T 4BE2A 4WCIA 2GBQA 1VQ5T 2OTJA 4J6XA 3EFSA 3MJXA 5FWBA 1WA7A 4FYWB 4XTXA 4J9BA 2A08A 2D1XA 4M7DF 1I8FA 2V26A 2DIQA 1T3LA 4F7UF 3JSCA 2RHYA 1BI3A 3QYHB 2J7IA 4C0DC 2H3JA 1LOJA 4ZNXA 2RMOA 1I07A 3GF5A 1OX9A 2KRSA 1Q7YU 4QVDA 1Y7XA 3OYBA 4M7AD 1LVKA 1KQ2A 3QKJA 1R8OB 4JJBA 4RTVA 2RI2A 1M1KU 2V8KA 4LDVA 2DXBA 5I22A 2KQWA 4FU6A 2K3BA 1VQ5Q 1IRXA 3FRNA 4M75C 4C8QB 1R0BG 1D0ZA 1RAGB 3EG0A 3OYGA 1RI9A 5D7UA 2EIFA 2HAXA 3SWNC 3JCMf 2D9TA 2K9GA 4HXJA 4N4GA 4AFUC 3CPWA 1KC8U 1WHGA 2GQIA 3GP8A 2CZ0B 2LC4A 1Y96B 2GTJA 1BB9A 1JO8A 1OOTA 2RH2A 1QLYA 1WLPB 1RAFB 2I0NA 3BDLA 1E7OA 2K5LA 3UA7A 1PM3A 4X9DA 3CCVA 2J6FA 4O6JA 2KYMA 5CKEA 3KUFA 4FYYB 2LJ1A 1BU1A 3L2VA 4ZGJB 1IO6A 4ZTFA 4E7KA 5GAMe 1U5SA 3OA6A 5J3BA 1UGVA 4ELZC 2LDMA 1PKSA 3UATA 4OP0A 1W2BA 2KR3A 1G3YA 2LQKA 3LGLA 2FPFA 1VQ8T 1SRLA 1N27A 2A3LA 4PL6A 2RHXA 3JCMX 1VQ9A 1K8AU 2QA4T 3H8ZA 3QPHA 5LJ3d 3CC4A 1K76A 1OEBA 4WF2A 2DFUA 4X1VA 1PWTA 1K4US 1ZSZA 2CT4A 5CK9A 2ENMA 1Q7YC 1AZGB 3V7SA 4DBHA 4J9EA 1O75A 2X51A 3VV0A 1AZEA 1T3SA 4A4KA 1GXIE 1Y57A 2KE9A 1M1KC 3QJ6A 1WFWA 3MEUA 2JVVA 3MHXA 3HFNA 3IQLA 3CCLT 2MAMA 4C92C 4JRPA 2QA4Q 2YLCA 2CUDA 1ZA1B 5KYUB 3LH0A 4ME7A 4Y91A 1OQKA 2RPNA 4Z8AA 3C4SA 5KYWB 1D1CA 1KC8C 4BY6B 1RL2A 5KCHA 1TUCA 2LZ6B 5IXBA 3DB3A 4OGCA 2CT3A 1NG2A 1IXDA 1AEYA 4C8QG 1X2KA 2HBPA 3QYGB 4FCYA 2VASA 1CKAA 2ZAEA 2HEQA 5GAN4 5FRNA 1OULA 4ZN3A 1AWJA 1RAIB 1E6HA 3I5SA 2LVMA 5M9OA 2QASA 4OMPA 3JB9I 3JB9F 1VQ4T 3M57A 2IG0A 1YWPA 1ZBXA 1TH7A 2Y4XA 3CCEQ 1RAHB 1M1KR 2XI9A 4OB1B 5I11A 1KQ1A 1M2VA 4HCCA 1X6OA 3I55A 3QUIA 3JCMV 4ANJA 3WVDB 3H41A 2WSCE 1K8AC 2K2VA 3GIBA 1OZ3A 2ED0A 4C5GA 2CS7A 3EG1A 1H3HA 4PLIA 4DBFA 5GAOn 3CEYA 3R6OA 1GCPA 4BI3A 5GMKl 2IIMA 3G6ET 2KK4A 2JTMA 3PIPA 1AWOA 3WVEB 5CQXA 4PJLA 1ABOA 3CC7T 1OYXA 3UF4A 3VS1A 3X28B 3REBB 2GQVA 3PVQA 2VB6A 2NLUA 2L3QA 4OB0B 1D1AA 4II1A 1T0HA 4GLKA 2GTOA 3PFSA 5GAN7 2FRWA 3I9QA 1VQMT 1H3ZA 4QVZA 1K0XA 2EQIA 1VQPT 4C0DB 4EMHA 3QHSA 4RTTA 4E7IA 3L2WA 2J06A 4M77D 3AT1B 3CC7Q 4LDWA 3MO8A 2XU8A 1XOVA 2CH4A 3NMZC 4XTWA 3MP8A 4AG1C 4JLIA 1WNLA 2ROLA 1SRMA 3NFCA 2E3IA 1G83A 2E64A 5C6SA 2EGAA 1JJ2A 1M90U 1SSHA 4M75B 4BE1A 3DLMA 1YIJT 2ED1A 2DD5A 1GBQA 3VS3A 3GLXA 4MZPA 4F14A 3SWNB 2DBMA 5LJ3h 1KSWA 3CPFA 5C0MA 3N5BB 1IHVA 2FVUA 1WDXA 2L2PA 1WX6A 1Q86U 4HKEA 1TTHB 2EW3A 2W10A 3TEEA 1M2OA 4DEXA 2AKLA 5A2QE 3VKIA 2ZCFB 1UECA 1OPLA 2YSQA 1DJ7B 3PNWC 5GJWB 4M7AF 3EG3A 4NL3A 3G71Q 3I56T 2RI3A 2J6KA 3MKDA 4C8QC 1D0XA 2SRCA 3SB2A 2OTLT 1B34B 2F2XA 1W2BP 2D8JA 3RR6A 1ZX6A 2DL3A 1ZUKA 3GNGA 2JOYA 1WQ7A 3FEOA 3VRYA 3DB4A 5GJVB 2QTXA 5CKHA 1AHJB 1UGPB 4N4HA 5LJ5e 4AFSC 4FM4B 2X4WA 5GAN6 4XU1A 2OX7A 4JRIA 2QQAA 1KQSA 1XJWB 1EIFA 1K73U 3OBWA 1UTIA 2MK5A 4C8QA 3CCMQ 3CCEA 5GAMg 2KGTA 2LJ3A 4FL6A 1SHGA 2EJFA 1GFDA 3OW2A 5FW9A 3HKSA 3L1AA 1LJOA 3I56Q 1X43A 5A0DA 2KEAA 4E2FB 3M9QA 3CCRA 2JJ9A 1KHCA 1QP2A 2QAZA 2CYZB 2YLBA 2EYZA 2DO3A 1Y96A 2DYIA 4WTOB 1YN8A 3CD6Q 4XTZA 4GLMA 2JMCA 1XNIA 1VQOA 1T0JA 4C92B 2RQTA 9ATCB 1UFFA 2RQVA 1J3TA 2FZCB 3QG1A 3D7SB 4BI8B 2WACA 4XQ3A 2BUDA 1TXQA 3H0HA 1VQLQ 2X35A 3CCUT 1X27A 1YI2A 1PRMC 3QO3A 1Q86C 1U1SA 2EBPA 2QK0A 2V8JA 1WZOA 5CO7A 3OYJA 4C8QE 1WHKA 3HL8A 4M75G 1YJNT 1H92A 1HD3A 4EPCA 3M0SA 5KYXB 1AWWA 2O9VA 3I5RA 3GBQA 1UGRB 3HRTA 5GANd 1K9AA 4MZMA 2ESWA 2BTTA 2GCXA 2A28A 4ESRA 4QT7A 4R0KA 4XAXB 1KD1R 1CKBA 1H641 4PKCC 3CC2Q 2NUZA 3REAB 5A0LA 1JU5C 3CCUQ 4DOWA 2GFAA 1N6AA 2QEXT 1M9SA 1M90R 1F1BB 3BDUA 1YJWQ 3VS7A 1K73C 2DETA 2ZZDA 4VUBA 1KK7A 3OS0A 1UUEA 2PUKB 1YJNQ 5CAIA 2YRDA 4D8DA 1MNEA 3UWNA 2WSFE 3CCSQ 3UT1A 1N5ZA 3LGFA 5KYUA 2B8AA 1VQ9T 2QTVA 4PJOF 5KYWA 1WHLA 1OI1A 3CMEQ 4KGVB 4HT8A 2DIGA 3VS6A 3O8VA 2M02A 4F7UB 2RK2A 3VUZA 3C95A 4DBQA 1G5VA 4B6MA 2QEXQ 3OS1A 1K9MU 1JXOA 3G71A 2DRKA 4MMLA 1PRLC 3CMAT 3ZEHA 1X69A 1QQJA 4M78C 3NGPA 3A1PA 1WXTA 3M4GA 2EJGA 4LUDA 4FT4A 1M8MA 2CP5A 6AT1B 5KE3A 2LP5A 1D3BB 1YITT 4E7JA 2YRCA 2EYWA 2OI3A 3S3NA 1K73R 1E6GA 4MDWA 2K4YA 1PD0A 1VA7A 2MIOA 4RCCA 2DM1A 2EKHA 4C92G 2X3WD 3QBYA 1FWZA 2M9UA 4ORZA 4M78A 1JJ2P 1VOMA 4FYXB 4KGZB 2QI2A 1Z9ZA 3T9NA 3RDVA 3JCMJ 2BZ8A 2QQRA 1M5Q1 1QCFA 2QGFB 3CMAQ 2HSPA 4OMQA 1D1BA 4MMKA 5J39A 1QKXA 3HP9A 3CXCS 3FC3A 4OMNA 3CD6A 2KRMA 2EPDA 1MHNA 5LJ3e 1YITQ 2QDYB 1ZSGA 4M7AC 4JS4A 4CC7A 2DNUA 2MCNA 4J9GA 2K79A 5GAMf 3EGDB 4KH1B 1QVFA 4FSSA 2PZ1A 4LUEA 4LXCA 2KVQG 4JRKA 4JJDA 3G4SQ 2K7AA 2A0FB 1BYMA 2DXTA 1C1AA 2E6ZA 4IUVA 2F2WA 4RTXA 3ULRB 2KY9A 1X75C 1VQLA 2XK0A 2CP7A 1M3AA 1ZLMA 4IUUA 4M77F 4EIKA 1S72Q 2HCKA 2ZPGB 2F69A 2ABLA 2JT4A 2O01E 3HTRA 3C94A 4BE0A 1VQKT 3L42A 1WYXA 5GAN2 2RHZA 1K9MC 4IURA 1LNXA 1FYNA 1B3QA 4FYVB 1JB0E 3KBGA 3JAME 1YP5A 4V2SA 1NYGA 1R0CB 2ZPFB 3CC2A 2FZGB 2AZVA 4M75A 4LD9K 1EX4A 4A4GA 1QWFA 4ELYC 2D8HA 2RJEA 1XQHA 4F7UG 2KROA 2JUFA 2QYZA 4GBQA 4C0GA 3SWNA 3EHQA 2YUNA 3SHWA 2DZCA 2NUPB 2FEIA 1K1ZA 2RB6A 4GY5A 2YUQA 1VQNA 3CCSA 5GANh 2E10A 1PSEA 1HJDA 1X6GA 2LQNA 3RIRA 1X01A 2EKOA 2CKKA 5AT1B 1QVPA 2EJ9A 5LJ5h 1YJ9T 2HDAA 3LWIA 5IT9E 3VS5A 3VS2A 5DLOA 3LWHA 2P0KA 1B34A 3MCAB 4RG8A 1U1TA 4RTWA 3J80E 4QKUA 2E12A 2F5TX 3OMGA 2K5IA 2MF2A 2Y4YA 3NPFA 4J9DA 3HFOA 5IXFA 1N9SA 2D0NA 2E1HA 2L5QA 4J5YA 1LPLA 4M75E 4QQGA 3SDZA 4J9HA 1U8RA 3A8HB 3OSSC 4HT9A 4ZGDB 1TOVA 1FMWA 2L89A 3KFVA 1VQ8Q 1Y07A 3TSWA 2P0PA 1KIKA 2CREA 4AFQC 2OAWA 3CBMA 3L2ZA 4PJOC 2JM9A 3EGUA 1NPPA 1RADB 1ZHIA 2GNCA 3RMQA 2E3HA 2L3RA 1M3BA 2LCCA 3OS2A 1FX7A 2DD4A 5IAYA 2LT4A 4J8OA 4C92A 1NE8A 2KT1A 1G8XA 5KYYB 3CCJT 1GL5A 1GBRA 1GFCA 1IHWA 4J83A 1MMGA 2J05A 1IB8A 1BBZA 2YT6A 1K0SA 3CCLQ 1M3CA 1QCOA 1VIEA 4KRTA 5KE2A 1Q7YR 1IZ6A 2D0QB 2EGEA 3CCRT 4IIMA 1WXBA 3OYEA 3M0PA 4KUIA 2DL8A 4AG2C 3J81E 2K3XA 3H9NA 4IUQA 2QXFA 2E41A 5KYXA 1QVGA 2DTIA 2I2LA 3P8HA 1VQ5A 2DXUA 5GAOp 2O9SA 2V1RA 3CCJQ 2R57A 4E7SA 1UGQB 3V7RA 4M78B 2DILA 5HKCA 2VYTA 2LT1A 1BCMA 2LCSA 4XK8E 1KC8R 2CSQA 2XMFA 1M1FA 1WHJA 5L23A 3EH2A 4RKUE 3R6NA 5GAN5 1VQ4Q 4C92E 4M7DC 1MV3A 5CKDA 2BZXA 1RUWA 1UE9A 2RQRA 1W70A 3JCMc 2RHUA 3DLLA 3M54A 3JB9G 1MMNA 3JCMd 4OMMA 1MMDA 3EAEA 3OYYA 1QWEA 2VVKA 3JCMP 3QWYA 4JRQA 2MWPA 4A54A 1JQQA 2HQHA 2HZYA 3RESA 4F7UA 4M7AB 1X6BA 3O5ZA 4LN2A 2XG8D 4HCZA 3JCMb 2SEMA 2X3XD 2QQBA 3HHTB 1GRIA 2EYQA 1K8AR 1VQ6T 3G6EQ 2O4XB 4FIBA 1D09B 4PFPA 4X34A 3VRZA 2D6FA 2A36A 4JS5A 1PHTA 3H6ZA 5LJ3g 5EC7A 3QXEB 4A4HA 5DM7R 1YWOA 2DBKA 2DAQA 2VGNA 1ZBJA 1D3BA 3CBPA 2VXFA 2HQEA 2PVGB 3Q1JA 1QW1A 2MWOA 2DL5A 1AOJA 4BDYA 2JZ2A 2EAYA 3CPWP 2M16A 1YHQT 1YCSB 2O2OA 1NYFA 1VQMQ 2COYA 3VS0A 1UEBA 3RKWA 2DEUA 3VYGA 2QQ9A 1VQPQ 2R58A 3OBYA 5DY9A 3E19A 4C5HA 2EYXA 2QA4A 3E2UA 5GMKm 3E9FA 5GAOl 1AVZC 2E5KA 2QG9B 4CC2A 3JCMW 1ZUYA 4F7UE 3CQTA 3EFOB 3QIIA 1B7TA 4HCKA 1PCXA 3L2RA 5GAOr 2XD0A 1BI0A 1RAEB 2CDTA 2GGRA 2HSEB 1Q81U 1GCQC 1FXXA 4K11A 2COZA 1YIJQ 4P5NA 4RTZA 5GANe 3EGDA 1YHQQ 5FRMA 4RTUA 3CBOA 3CCQT 1ACMB 3SD4A 4Z89A 4RMOA 3X20B 1AWXA 3QWXX 2W0ZA 4L5GA 4M78G 2M51A 1JXMA 2K57A 1VYUA 4J9CA 4A4FA 5GMKj 1CSKA 1N8RU 5D6YA 1Q82U 1OZ2A 3FB9A 4RG2A 1VIFA 1GCQA 1VQ7T 5GAOq 4JJNK 2NWMA 4KT0E 1V29B 1VUBA 4A63B 1HXDA 3L2UA 4QVCA 2OTJT 5CKFA 4Q5WA 3ZBDA 4LDYA 4OMLA 4Y28E 3E1SA 5GMKi 2OTLQ 2KAFA 3CCQQ 4C8QD 2DF6A 2AT1B 2HMAA 1UJ0A 1Y71A 1TU0B 2CP2A 3GPLA 2OAUA 3M55A 1WXUA 4A4EA 4M7AG 2JTEA 2EYYA 2ATCB 1KG1A 2QDLA 1AT1B 2E5QA 1VQ7Q 3RBBB 2H3EB 3CPWS 2CP6A 2G3RA 2NUPA 5KH6A 2VXEA 4PJOB 2EQJA 1PNJA 1ABQA 5GAOm 2OTJQ 2F5KA 2DVJA 4F16A 3M4YA 2AK5A 4ZGEB 2DL4A 3HSBA 4ATOA 3TQ7P 2PTKA 3C12A 1RACB 3JB9J 1UHCA 2QGGA 4HCBA 2FPEA 5IHKA 1RLQC 2LJ0A 3M59A 3A5ZB 4R56A 1TUDA 4AT1B 4JDSA 2YUOA 3JRZA 4F04B 1WHHA 1Q81C 1OU8A 2JW4A 2HKQB 1ZA2B 3M5AA 1BI2A 3PIOA 5L8RE 2LNHB 2M0YA 2MPXC 1KHIA 1UB4A 3FIFA 1G3SA 1TUGB 5D6WA 3CCVT 3THKA 2DJQA 1W2BS 3BFMA 2HQXA 1WJSA 2EQMA 3CC7A 2DYBA 3JCMh 2JS0A 2PNIA 1N8RC 3RUXA 1Q82C 1VQNT 4IUPA 4L6V5 2RD1A 4LD6A 3FDRA 5KCOA 1M30A 3QZ5B 3ZL7C 2LX9A 4N0AC 4DEYA 3TSZA 1VQMA 4JZ3A 5HK0A 2XIDA 5FU6C 4FT2A 1WJRA 2FZKB 3CC4T 3INZA 1VQPA 4PJJA 4XTUA 3CCVQ 4OF1A 5LJ3f 1Q86R 1SSFA 4YTLA 2FPDA 2PUOB 5IN1A 4M7DB 3MEVA 3U23A 1I5LA 2LCLA 5KYYA 3OQ5A 1X2QA 4F17A 2KNBB 5IH2A 2RO0A 2Z0WA 1UDLA 3OYMA 3X26B 4AFZC 4R55A 3ME9A 4XU2A 5EG2A 2GFUA 1HSQA 2J6OA 1NLPC
chains in the Genus database with same CATH topology
2LQNA 3A98A 4JZ4A 1GCPA 2IIMA 1UHFA 2HDAA 1TG0A 4RTYA 3VS5A 1AWOA 2DLPA 3VS2A 1ABOA 4J9IA 2A37A 3UF4A 4RTWA 3VS1A 2CSIA 3REBB 1U06A 1V1CA 1NM7A 1ZUUA 3NPFA 3PVQA 4CC4B 4J9DA 5IXFA 5IHNA 2L3QA 2LMJA 3TVTA 2D0NA 1PKTA 1T0HA 3JV3A 2GTOA 2FRWA 3I9QA 4IIOA 4J9HA 1K0XA 2EQIA 1B07A 4LE9A 1OPKA 3KFVA 4RTTA 3TSWA 2J06A 1KIKA 2CREA 4AFQC 2OAWA 1XOVA 2CH4A 2JM9A 3EGUA 3NMZC 2ROTA 4OMOA 4AG1C 3PVLA 2GNCA 1KJWA 2ROLA 1SRMA 2BZYA 1G83A 2EGAA 4RUGA 1M3BA 1SSHA 3M0UA 2ED1A 3M0TA 2LQWA 1GBQA 2RNAA 2KXCA 3VS3A 2KT1A 4F14A 1NEBA 2CH4W 1GL5A 1GBRA 1GFCA 2K2MA 2KRNA 2DBMA 2KT8A 1KSWA 2J05A 1BBZA 4Y92A 2YT6A 5ECAA 3PE0A 1K0SA 4Z88A 1SHFA 1M3CA 1WDXA 4KRTA 2L2PA 1WX6A 2EW3A 2W10A 1A0NB 2YUPA 2RF0A 4DEXA 2AKLA 2EGEA 3EHRA 2DX1A 4IIMA 3NHNA 1WXBA 1MUZA 3M0PA 1UECA 5FWCA 1WIEA 2DL8A 1OPLA 2YSQA 4AG2C 3M0QA 5GJWB 3EG3A 2J6KA 2EGCA 2SRCA 2F2XA 2MOXA 2O9SA 2D8JA 4LNPA 1ZX6A 2DL3A 1ZUKA 2V1RA 3VRYA 5GJVB 1SEMA 2DILA 2EVRA 2LCSA 4AFSC 2CSQA 4HVVA 1H3HA 2XMFA 5HCKA 2C0OA 5L23A 2DRMA 3R6NA 1UTIA 2RQWA 2KGTA 2LJ3A 1MV3A 2C0IA 4CC3A 1SHGA 3H0IA 1GFDA 2YDLA 2KXDA 2BZXA 5FW9A 3I35A 1RUWA 1UE9A 2RQRA 1X43A 2KEAA 1W70A 2DL7A 2F2VA 2B86A 1S1NA 1VYVA 1I1JA 2EYZA 1KFZA 4OMMA 1FMKA 1QWEA 2VVKA 3QWYA 3C0CA 1YN8A 2O88A 1JQQA 4GLMA 2JMCA 1X6BA 2L0AA 3O5ZA 4LN2A 2SEMA 2X3XD 1T0JA 2RQTA 5IHIA 1UFFA 2RQVA 2AKKA 1GRIA 1J3TA 2FRYA 1RLPC 1VYTA 3VRZA 2A36A 1PHTA 2O31A 2K6DA 1Y0MA 3H0HA 1M27C 2L3PA 2JMAA 5EC7A 1X27A 1PRMC 4WCIA 2GBQA 1YWOA 2KBTA 2DBKA 2DMOA 1ZBJA 2EBPA 5FWBA 1WA7A 2DL5A 4J9BA 1AOJA 2A08A 2D1XA 1H92A 1T3LA 1HD3A 3M0SA 1YCSB 2O2OA 1NYFA 2J7IA 1AWWA 4ZNXA 3VS0A 2O9VA 2RMOA 1I07A 3I5RA 3GBQA 2KRSA 1K9AA 2ESWA 2BTTA 2RQUA 2A28A 4ESRA 4M4ZA 4QT7A 4R0KA 1CKBA 2EYXA 3RNJA 4JJBA 4RTVA 2NUZA 3REAB 1AVZC 4D8KA 2E5KA 4CC2A 1ARKA 1JU5C 1ZUYA 2OJ2A 3CQTA 4HCKA 5I22A 2K3BA 1JEGA 2CDTA 2GGRA 3VS7A 1UUEA 3EG0A 1GCQC 1MV0B 1RI9A 2L3SA 2JM8A 1Z9QA 4K11A 3SEMA 4D8DA 4RTZA 4RTUA 1N5ZA 4Z89A 2K9GA 1AWXA 3QWXX 4HXJA 2W0ZA 4AFUC 4JJCA 2VWFA 2P4RA 2M51A 2GQIA 1JXMA 1VYUA 4J9CA 1CSKA 2GTJA 1BB9A 1JO8A 1OOTA 2CUBA 1QLYA 1WLPB 2I0NA 1GCQA 3VS6A 1E7OA 2JS2A 3UA7A 1QKWA 3UA6A 2NWMA 2J6FA 4A63B 1W1FA 2KYMA 4JPBW 2G6FX 2C0TA 1JXOA 2LJ1A 1BU1A 2DRKA 1PRLC 4OMLA 1IO6A 4HVWA 1X69A 1NEGA 1U5SA 4J9FA 1UGVA 2DF6A 3NGPA 1WXTA 2HBWA 4LUDA 1UJ0A 1PKSA 1M8MA 3UATA 2KR3A 2LP5A 2JXBA 2FPFA 1WXUA 2EYWA 1SRLA 2OI3A 1E6GA 2H8HA 2JTEA 2MIOA 1VA7A 2EYYA 3VS4A 2QDLA 2DM1A 2EKHA 3RBBB 2X3WD 3FJ5A 1K76A 1OEBA 4ORZA 1PNJA 1Z9ZA 1ABQA 4X1VA 2DVJA 2BZ8A 4F16A 2AK5A 1PWTA 1K4US 2DL4A 2CT4A 1QCFA 2ENMA 2PTKA 2V1QA 2VKNA 2ECZA 1UHCA 2AZSA 1AZGB 2HSPA 4OMQA 2KYBA 1H8KA 1UG1A 2FPEA 4J9EA 5IHKA 1RLQC 2LJ0A 1AZEA 1QKXA 1T3SA 1TUDA 1Y57A 2KE9A 2RN8A 4OMNA 2KRMA 2YUOA 1WFWA 1AD5A 2EPDA 1ZSGA 4CC7A 2DNUA 3IQLA 1W6XA 2MCNA 2JW4A 3LH5A 4J9GA 2LX7A 2K79A 2LNHB 2CUDA 2M0YA 4FSSA 2PZ1A 3EG2A 4LUEA 2RPNA 4JJDA 4Z8AA 2K7AA 3THKA 2DJQA 2F2WA 4RTXA 3ULRB 2DYBA 1TUCA 1YNZA 2JS0A 1NLOC 2LZ6B 2PNIA 1M3AA 5IXBA 1ZLMA 2CT3A 4EIKA 1NG2A 2HCKA 1AEYA 2ABLA 2JT4A 1X2KA 1M30A 1CKAA 3ZL7C 2HEQA 4DEYA 1WYXA 3TSZA 2FO0A 1SPKA 1AWJA 4JZ3A 1FYNA 1E6HA 3I5SA 1B3QA 1WI7A 2DA9A 4OMPA 1YP5A 1OV3A 4HVUA 1NYGA 1YWPA 1LCKA 2FG0A 2AZVA 5I11A 2FPDA 1QWFA 2D8HA 3U23A 2KROA 4GBQA 3H41A 3M0RA 3EHQA 1G2BA 1X2QA 1BK2A 4E6RA 4F17A 1U3OA 2KNBB 1EFNA 1UJYA 5IH2A 1I0CA 1UDLA 2YUNA 2DE0X 3SHWA 2FEIA 4AFZC 1K1ZA 2ED0A 2YUQA 3H0FA 3EG1A 1HSQA 1HJDA 1X6GA 2J6OA 1NLPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQN A;  3A98 A;  4JZ4 A;  1GCP A;  2IIM A;  1UHF A;  2HDA A;  1TG0 A;  4RTY A;  3VS5 A;  1AWO A;  2DLP A;  3VS2 A;  1ABO A;  4J9I A;  2A37 A;  3UF4 A;  4RTW A;  3VS1 A;  2CSI A;  3REB B;  1U06 A;  1V1C A;  1NM7 A;  1ZUU A;  3NPF A;  3PVQ A;  4CC4 B;  4J9D A;  5IXF A;  5IHN A;  2L3Q A;  2LMJ A;  3TVT A;  2D0N A;  1PKT A;  1T0H A;  3JV3 A;  2GTO A;  2FRW A;  3I9Q A;  4IIO A;  4J9H A;  1K0X A;  2EQI A;  1B07 A;  4LE9 A;  1OPK A;  3KFV A;  4RTT A;  3TSW A;  2J06 A;  1KIK A;  2CRE A;  4AFQ C;  2OAW A;  1XOV A;  2CH4 A;  2JM9 A;  3EGU A;  3NMZ C;  2ROT A;  4OMO A;  4AG1 C;  3PVL A;  2GNC A;  1KJW A;  2ROL A;  1SRM A;  2BZY A;  1G83 A;  2EGA A;  4RUG A;  1M3B A;  1SSH A;  3M0U A;  2ED1 A;  3M0T A;  2LQW A;  1GBQ A;  2RNA A;  2KXC A;  3VS3 A;  2KT1 A;  4F14 A;  1NEB A;  2CH4 W;  1GL5 A;  1GBR A;  1GFC A;  2K2M A;  2KRN A;  2DBM A;  2KT8 A;  1KSW A;  2J05 A;  1BBZ A;  4Y92 A;  2YT6 A;  5ECA A;  3PE0 A;  1K0S A;  4Z88 A;  1SHF A;  1M3C A;  1WDX A;  4KRT A;  2L2P A;  1WX6 A;  2EW3 A;  2W10 A;  1A0N B;  2YUP A;  2RF0 A;  4DEX A;  2AKL A;  2EGE A;  3EHR A;  2DX1 A;  4IIM A;  3NHN A;  1WXB A;  1MUZ A;  3M0P A;  1UEC A;  5FWC A;  1WIE A;  2DL8 A;  1OPL A;  2YSQ A;  4AG2 C;  3M0Q A;  5GJW B;  3EG3 A;  2J6K A;  2EGC A;  2SRC A;  2F2X A;  2MOX A;  2O9S A;  2D8J A;  4LNP A;  1ZX6 A;  2DL3 A;  1ZUK A;  2V1R A;  3VRY A;  5GJV B;  1SEM A;  2DIL A;  2EVR A;  2LCS A;  4AFS C;  2CSQ A;  4HVV A;  1H3H A;  2XMF A;  5HCK A;  2C0O A;  5L23 A;  2DRM A;  3R6N A;  1UTI A;  2RQW A;  2KGT A;  2LJ3 A;  1MV3 A;  2C0I A;  4CC3 A;  1SHG A;  3H0I A;  1GFD A;  2YDL A;  2KXD A;  2BZX A;  5FW9 A;  3I35 A;  1RUW A;  1UE9 A;  2RQR A;  1X43 A;  2KEA A;  1W70 A;  2DL7 A;  2F2V A;  2B86 A;  1S1N A;  1VYV A;  1I1J A;  2EYZ A;  1KFZ A;  4OMM A;  1FMK A;  1QWE A;  2VVK A;  3QWY A;  3C0C A;  1YN8 A;  2O88 A;  1JQQ A;  4GLM A;  2JMC A;  1X6B A;  2L0A A;  3O5Z A;  4LN2 A;  2SEM A;  2X3X D;  1T0J A;  2RQT A;  5IHI A;  1UFF A;  2RQV A;  2AKK A;  1GRI A;  1J3T A;  2FRY A;  1RLP C;  1VYT A;  3VRZ A;  2A36 A;  1PHT A;  2O31 A;  2K6D A;  1Y0M A;  3H0H A;  1M27 C;  2L3P A;  2JMA A;  5EC7 A;  1X27 A;  1PRM C;  4WCI A;  2GBQ A;  1YWO A;  2KBT A;  2DBK A;  2DMO A;  1ZBJ A;  2EBP A;  5FWB A;  1WA7 A;  2DL5 A;  4J9B A;  1AOJ A;  2A08 A;  2D1X A;  1H92 A;  1T3L A;  1HD3 A;  3M0S A;  1YCS B;  2O2O A;  1NYF A;  2J7I A;  1AWW A;  4ZNX A;  3VS0 A;  2O9V A;  2RMO A;  1I07 A;  3I5R A;  3GBQ A;  2KRS A;  1K9A A;  2ESW A;  2BTT A;  2RQU A;  2A28 A;  4ESR A;  4M4Z A;  4QT7 A;  4R0K A;  1CKB A;  2EYX A;  3RNJ A;  4JJB A;  4RTV A;  2NUZ A;  3REA B;  1AVZ C;  4D8K A;  2E5K A;  4CC2 A;  1ARK A;  1JU5 C;  1ZUY A;  2OJ2 A;  3CQT A;  4HCK A;  5I22 A;  2K3B A;  1JEG A;  2CDT A;  2GGR A;  3VS7 A;  1UUE A;  3EG0 A;  1GCQ C;  1MV0 B;  1RI9 A;  2L3S A;  2JM8 A;  1Z9Q A;  4K11 A;  3SEM A;  4D8D A;  4RTZ A;  4RTU A;  1N5Z A;  4Z89 A;  2K9G A;  1AWX A;  3QWX X;  4HXJ A;  2W0Z A;  4AFU C;  4JJC A;  2VWF A;  2P4R A;  2M51 A;  2GQI A;  1JXM A;  1VYU A;  4J9C A;  1CSK A;  2GTJ A;  1BB9 A;  1JO8 A;  1OOT A;  2CUB A;  1QLY A;  1WLP B;  2I0N A;  1GCQ A;  3VS6 A;  1E7O A;  2JS2 A;  3UA7 A;  1QKW A;  3UA6 A;  2NWM A;  2J6F A;  4A63 B;  1W1F A;  2KYM A;  4JPB W;  2G6F X;  2C0T A;  1JXO A;  2LJ1 A;  1BU1 A;  2DRK A;  1PRL C;  4OML A;  1IO6 A;  4HVW A;  1X69 A;  1NEG A;  1U5S A;  4J9F A;  1UGV A;  2DF6 A;  3NGP A;  1WXT A;  2HBW A;  4LUD A;  1UJ0 A;  1PKS A;  1M8M A;  3UAT A;  2KR3 A;  2LP5 A;  2JXB A;  2FPF A;  1WXU A;  2EYW A;  1SRL A;  2OI3 A;  1E6G A;  2H8H A;  2JTE A;  2MIO A;  1VA7 A;  2EYY A;  3VS4 A;  2QDL A;  2DM1 A;  2EKH A;  3RBB B;  2X3W D;  3FJ5 A;  1K76 A;  1OEB A;  4ORZ A;  1PNJ A;  1Z9Z A;  1ABQ A;  4X1V A;  2DVJ A;  2BZ8 A;  4F16 A;  2AK5 A;  1PWT A;  1K4U S;  2DL4 A;  2CT4 A;  1QCF A;  2ENM A;  2PTK A;  2V1Q A;  2VKN A;  2ECZ A;  1UHC A;  2AZS A;  1AZG B;  2HSP A;  4OMQ A;  2KYB A;  1H8K A;  1UG1 A;  2FPE A;  4J9E A;  5IHK A;  1RLQ C;  2LJ0 A;  1AZE A;  1QKX A;  1T3S A;  1TUD A;  1Y57 A;  2KE9 A;  2RN8 A;  4OMN A;  2KRM A;  2YUO A;  1WFW A;  1AD5 A;  2EPD A;  1ZSG A;  4CC7 A;  2DNU A;  3IQL A;  1W6X A;  2MCN A;  2JW4 A;  3LH5 A;  4J9G A;  2LX7 A;  2K79 A;  2LNH B;  2CUD A;  2M0Y A;  4FSS A;  2PZ1 A;  3EG2 A;  4LUE A;  2RPN A;  4JJD A;  4Z8A A;  2K7A A;  3THK A;  2DJQ A;  2F2W A;  4RTX A;  3ULR B;  2DYB A;  1TUC A;  1YNZ A;  2JS0 A;  1NLO C;  2LZ6 B;  2PNI A;  1M3A A;  5IXB A;  1ZLM A;  2CT3 A;  4EIK A;  1NG2 A;  2HCK A;  1AEY A;  2ABL A;  2JT4 A;  1X2K A;  1M30 A;  1CKA A;  3ZL7 C;  2HEQ A;  4DEY A;  1WYX A;  3TSZ A;  2FO0 A;  1SPK A;  1AWJ A;  4JZ3 A;  1FYN A;  1E6H A;  3I5S A;  1B3Q A;  1WI7 A;  2DA9 A;  4OMP A;  1YP5 A;  1OV3 A;  4HVU A;  1NYG A;  1YWP A;  1LCK A;  2FG0 A;  2AZV A;  5I11 A;  2FPD A;  1QWF A;  2D8H A;  3U23 A;  2KRO A;  4GBQ A;  3H41 A;  3M0R A;  3EHQ A;  1G2B A;  1X2Q A;  1BK2 A;  4E6R A;  4F17 A;  1U3O A;  2KNB B;  1EFN A;  1UJY A;  5IH2 A;  1I0C A;  1UDL A;  2YUN A;  2DE0 X;  3SHW A;  2FEI A;  4AFZ C;  1K1Z A;  2ED0 A;  2YUQ A;  3H0F A;  3EG1 A;  1HSQ A;  1HJD A;  1X6G A;  2J6O A;  1NLP C; 
#chains in the Genus database with same CATH topology
 2XDB A;  1VQ9 Q;  3OYL A;  1IRE B;  3EH1 A;  4M77 B;  3A98 A;  1M8V A;  4JZ4 A;  4KBM B;  2CP0 A;  1UHF A;  1TG0 A;  5AYF A;  4RTY A;  3OYN A;  3SFM A;  2DLP A;  4J9I A;  3CCM A;  2BKD N;  3EFR A;  2KSS A;  2WSE E;  2COW A;  2CSI A;  2X4X A;  4PJO G;  1U06 A;  1NM7 A;  4CC4 B;  5FLX E;  3I56 A;  3TVT A;  2ZGW A;  5CVI A;  4M78 D;  1RI0 A;  3UPU A;  2MI6 A;  4Z02 A;  1B07 A;  2EFI A;  4LE9 A;  3ASK A;  4KH0 B;  2NYS A;  2BE9 B;  4KUD K;  2VC8 A;  2LQ8 A;  4RCB A;  1WPY A;  4OVA A;  3I55 T;  5HK3 A;  4FSX A;  2L8D A;  4OMO A;  2A7Y A;  2P4T A;  3PVL A;  1KJW A;  5FRO A;  3OYF A;  4FW2 A;  2DKG A;  4RUG A;  2PVO B;  3M0U A;  4M7A A;  2C06 A;  3M0T A;  2RNA A;  2KMT A;  1NEB A;  2CH4 W;  2HD0 A;  2ZPI B;  2K2M A;  2RM4 A;  3OYK A;  1RAB B;  2O4X A;  4M78 E;  1KQS P;  4PJN A;  3S3M A;  3NTK A;  5ECA A;  3PE0 A;  4Z88 A;  1N9R A;  4A53 A;  5I2S A;  4KUL A;  2DVE A;  4BUG A;  1BI1 A;  3I55 Q;  1A0N B;  2YUP A;  2F1L A;  2XHC A;  3LYI A;  3OW2 P;  5GAN g;  1MUZ A;  3OYI A;  3HRS A;  5FWC A;  1WIE A;  4NS5 A;  3M0Q A;  4M7D G;  2ZPB B;  3CCU A;  4JLG A;  4BB7 A;  5LJ5 g;  4DQ2 A;  1TS9 A;  1YJW A;  2FL7 A;  3TCJ A;  1I81 A;  4M75 D;  1YJN A;  2PVD B;  1VQK Q;  3MPU B;  4D6W A;  1JJ2 S;  2XIC A;  1YFN A;  3G1J A;  4HVV A;  3VYH B;  2C0O A;  4ZN1 A;  2DRM A;  2NUT B;  3EFO A;  4M7A E;  4M77 G;  2MYS A;  3L2Q A;  2RQW A;  3CME A;  1RAA B;  2R5A A;  2C0I A;  2X4J A;  5J26 A;  2YDL A;  5A0G A;  3PTA A;  2KXD A;  2YHT A;  3TRE A;  1EZZ B;  3PMI A;  4LDX A;  2BE7 D;  2F2V A;  3OB9 A;  2QEX A;  5LL6 S;  2B86 A;  1K9M R;  4OB3 B;  1IGU A;  1I1J A;  3BW1 A;  1NJI U;  1ZSZ C;  1BCO A;  3MEW A;  2O88 A;  3HPW A;  5LJ3 j;  5FU7 C;  2L0A A;  1JRI A;  4C8Q F;  2XDP A;  1MGQ A;  3OYA A;  4O5V A;  1IGQ A;  3X25 B;  1YJ9 Q;  2IPO B;  4ZTJ A;  3EG9 B;  3JCM e;  2O31 A;  2K6D A;  1KQS S;  2RJD A;  4TVR A;  2KBT A;  3AHU A;  4C0F A;  2DTO A;  4HA8 A;  2DMO A;  5CQY A;  3NTI A;  2DXC A;  3CMA A;  1MND A;  3OW2 S;  2YRV A;  2RK1 A;  4CI0 C;  2HNI A;  1BKB A;  3VUB A;  4PJO A;  1SF9 A;  2P0Q A;  1YIT A;  4E7Z A;  5FU6 B;  2RQU A;  3S6W A;  2JNG A;  4M4Z A;  1JBM A;  3CCE T;  3RNJ A;  1PG5 B;  4C92 D;  1G3T A;  3VU3 C;  3WXM B;  4D8K A;  1ARK A;  4PFZ A;  3G4S A;  4PJO D;  2OJ2 A;  1JEG A;  2DJZ A;  5DLQ E;  3RKX A;  2E6N A;  2BIV A;  4MDX A;  1MV0 B;  2L3S A;  4QQD A;  2JM8 A;  1Z9Q A;  2PU9 B;  3SEM A;  5CR2 A;  3MEA A;  1S72 A;  2RJF A;  5GAM j;  4JJC A;  2VWF A;  2P4R A;  1QMC A;  3DKM A;  3GNF B;  1VQO T;  3UDC A;  5GAM d;  3A8L B;  5KYN A;  2FB7 A;  2DER A;  1YBY A;  1NJI C;  2CUB A;  3RER A;  2QQS A;  3QJY A;  2HL5 C;  3EGX B;  4E7H A;  3V8L A;  2JS2 A;  4AMC A;  1QKW A;  1YCY A;  2HKN A;  3UA6 A;  3CCR Q;  1W1F A;  5D6X A;  4JPB W;  3CXC A;  2C0T A;  1YI2 T;  1M4Z A;  1O9S A;  4PJO E;  4PNO A;  5CKB A;  3MP1 A;  4LDU A;  1QCN A;  1M1G A;  4EMK B;  4HVW A;  1NEG A;  4BI4 A;  4J9F A;  2HBW A;  2RI5 A;  5GAN 3;  3PMT A;  5GMK e;  1VQK A;  1VQO Q;  1SG5 A;  2JXB A;  4M7D A;  5GAN 8;  1QVF P;  2H8H A;  4M77 C;  3VS4 A;  5GAN f;  1HK9 A;  4CRI A;  4BD3 A;  3FJ5 A;  3QDR B;  3OS5 A;  2X4Y A;  2M0O A;  3URG A;  1YI2 Q;  1PC0 A;  4M7D D;  4XU3 A;  4FW1 A;  5LJ5 f;  3J7A F;  2EQU A;  1V76 A;  4PLL A;  3OSV A;  2V1Q A;  2VKN A;  2ECZ A;  2AZS A;  4X9C A;  2KYB A;  1H8K A;  1NJI R;  1UG1 A;  4QW2 A;  2VV5 A;  4M77 A;  2DK3 A;  2ZPH B;  5I2M A;  2K3Y A;  2RN8 A;  2CZ7 B;  1AD5 A;  2LTO A;  5I21 A;  1I4K 1;  1W6X A;  3ER0 A;  3LH5 A;  2AIR B;  4MZT A;  4KGX B;  3A8G B;  2LX7 A;  4L59 A;  3M53 A;  1KD1 U;  2MMP A;  3P8D A;  4M78 F;  4DOV A;  3EG2 A;  1YJ9 A;  2HL3 A;  1P92 A;  1VQ8 A;  4XTV A;  2AHJ B;  1VQ6 Q;  1WQW A;  1YNZ A;  3G71 T;  1NLO C;  4M7D E;  1R77 A;  2JTF A;  3RKY A;  2K5F A;  1OX8 A;  1TSF A;  4QQ6 A;  4EDU A;  4XTY A;  2FO0 A;  1SPK A;  2CZ6 B;  1WI7 A;  2DA9 A;  1PSF A;  1OV3 A;  4PFO A;  4HVU A;  3CCM T;  3M56 A;  4M77 E;  3CCL A;  1LCK A;  2FG0 A;  3BY7 A;  2GF7 A;  1NBE B;  3M0R A;  3X24 B;  1G2B A;  4E6R A;  1BK2 A;  3FLG A;  1U3O A;  3RMS A;  2LRQ A;  3OY9 A;  1QVF S;  1EFN A;  1UJY A;  1I0C A;  2DE0 X;  2CZ1 B;  2JN0 A;  3V7C A;  3CD6 T;  3H0F A;  1ZSZ B;  7AT1 B;  3CCJ A;  8AT1 B;  2G6F X;  4BDZ A;  2RHI A;  4UC4 A;  1D0Y A;  2E65 A;  4B9W A;  3QZ9 B;  5FU7 B;  4M75 F;  2IVW A;  4B9X A;  1FMV A;  2A37 A;  1VQ4 A;  3A8M B;  1VQL T;  3G7Z A;  2YWW A;  4IUT A;  2RA2 A;  1UGS B;  1V1C A;  8ATC B;  1ZUU A;  1KD1 C;  2E70 A;  3S3O A;  2DTH A;  5IHN A;  2LMJ A;  1PKT A;  3LX7 A;  1NZ9 A;  4PK4 A;  3JV3 A;  2NUT A;  5GAM h;  3MP6 A;  3TU4 K;  2CGH A;  1W4S A;  1M90 C;  4IIO A;  3JCM Q;  3JCM g;  4C5I A;  2XDD A;  1OPK A;  2VGM A;  3NTH A;  2Y90 A;  2PQW A;  3GOX A;  3OMC A;  3CC2 T;  3ZFJ A;  3V8J A;  3P8B B;  4EMG A;  2EWN A;  2ROT A;  3F70 A;  3G6E A;  1WHM A;  2P84 A;  4NL2 A;  1YJW T;  1QVG P;  1QP3 A;  2BZY A;  4C0Z A;  1OU9 A;  1SKU B;  2X9H A;  4NOY A;  1M2V B;  3CCS T;  3PT9 A;  2LQW A;  3PGG A;  2KXC A;  2KI7 A;  2R5M A;  3JB9 D;  1MMA A;  5GAN j;  4E47 A;  2M1H A;  1TWB A;  3HRU A;  2KRN A;  4JUV A;  4C5E A;  1NPR A;  2KT8 A;  4OMF B;  3CME T;  4Y92 A;  3EG9 A;  1SHF A;  5LJ5 j;  3CXC P;  3LW5 E;  2RF0 A;  5LJ5 d;  1XTD A;  3E9G A;  5HY6 A;  3EHR A;  2DX1 A;  4BY6 C;  3NHN A;  1VQ6 A;  1C0M A;  2ZPE B;  4E7L A;  2FYK A;  4N0A A;  4DA4 A;  4J7I A;  1WGS A;  2KDS A;  2EGC A;  1VQN Q;  4C92 F;  1Q81 R;  1PD1 A;  2MOX A;  4LNP A;  3BE3 A;  1SEM A;  1HYO A;  2EVR A;  4OGE A;  3M58 A;  1YIJ A;  4J6Y A;  1I5O B;  1YHQ A;  2XKO C;  1WJQ A;  3VJP A;  5HCK A;  1BIB A;  3LLR A;  3QSU A;  3OYH A;  1N8R R;  3OYD A;  1Q82 R;  3CC4 Q;  3JB9 H;  2DPP B;  4IKF A;  4CC3 A;  3H0I A;  4PJM A;  2RJC A;  2LNV A;  1BIA A;  3I35 A;  4BAC A;  2DL7 A;  5CIU A;  3KXT A;  1S1N A;  1VYV A;  3MET A;  2DZ9 A;  1KFZ A;  3A8O B;  4EMK C;  2E4H A;  1FMK A;  2DEQ A;  4XU0 A;  3C0C A;  2V8I A;  2OTL A;  3CCQ A;  3EGX A;  1ZQ1 A;  1QVG S;  5CCA A;  1Q95 G;  2VUB A;  4OB2 B;  5GMK h;  5IHI A;  2YXY A;  2FHD A;  1C6V X;  3G4S T;  2CP3 A;  1G3W A;  2EQK A;  2AKK A;  4J7F A;  2FRY A;  1RLP C;  3QDF A;  1VYT A;  3FJP A;  4EMK A;  3V8K A;  1VQ7 A;  4N4I A;  4J6W A;  1Y0M A;  3OYC A;  1M27 C;  4DBR A;  2L3P A;  2JMA A;  1S72 T;  4BE2 A;  4WCI A;  2GBQ A;  1VQ5 T;  2OTJ A;  4J6X A;  3EFS A;  3MJX A;  5FWB A;  1WA7 A;  4FYW B;  4XTX A;  4J9B A;  2A08 A;  2D1X A;  4M7D F;  1I8F A;  2V26 A;  2DIQ A;  1T3L A;  4F7U F;  3JSC A;  2RHY A;  1BI3 A;  3QYH B;  2J7I A;  4C0D C;  2H3J A;  1LOJ A;  4ZNX A;  2RMO A;  1I07 A;  3GF5 A;  1OX9 A;  2KRS A;  1Q7Y U;  4QVD A;  1Y7X A;  3OYB A;  4M7A D;  1LVK A;  1KQ2 A;  3QKJ A;  1R8O B;  4JJB A;  4RTV A;  2RI2 A;  1M1K U;  2V8K A;  4LDV A;  2DXB A;  5I22 A;  2KQW A;  4FU6 A;  2K3B A;  1VQ5 Q;  1IRX A;  3FRN A;  4M75 C;  4C8Q B;  1R0B G;  1D0Z A;  1RAG B;  3EG0 A;  3OYG A;  1RI9 A;  5D7U A;  2EIF A;  2HAX A;  3SWN C;  3JCM f;  2D9T A;  2K9G A;  4HXJ A;  4N4G A;  4AFU C;  3CPW A;  1KC8 U;  1WHG A;  2GQI A;  3GP8 A;  2CZ0 B;  2LC4 A;  1Y96 B;  2GTJ A;  1BB9 A;  1JO8 A;  1OOT A;  2RH2 A;  1QLY A;  1WLP B;  1RAF B;  2I0N A;  3BDL A;  1E7O A;  2K5L A;  3UA7 A;  1PM3 A;  4X9D A;  3CCV A;  2J6F A;  4O6J A;  2KYM A;  5CKE A;  3KUF A;  4FYY B;  2LJ1 A;  1BU1 A;  3L2V A;  4ZGJ B;  1IO6 A;  4ZTF A;  4E7K A;  5GAM e;  1U5S A;  3OA6 A;  5J3B A;  1UGV A;  4ELZ C;  2LDM A;  1PKS A;  3UAT A;  4OP0 A;  1W2B A;  2KR3 A;  1G3Y A;  2LQK A;  3LGL A;  2FPF A;  1VQ8 T;  1SRL A;  1N27 A;  2A3L A;  4PL6 A;  2RHX A;  3JCM X;  1VQ9 A;  1K8A U;  2QA4 T;  3H8Z A;  3QPH A;  5LJ3 d;  3CC4 A;  1K76 A;  1OEB A;  4WF2 A;  2DFU A;  4X1V A;  1PWT A;  1K4U S;  1ZSZ A;  2CT4 A;  5CK9 A;  2ENM A;  1Q7Y C;  1AZG B;  3V7S A;  4DBH A;  4J9E A;  1O75 A;  2X51 A;  3VV0 A;  1AZE A;  1T3S A;  4A4K A;  1GXI E;  1Y57 A;  2KE9 A;  1M1K C;  3QJ6 A;  1WFW A;  3MEU A;  2JVV A;  3MHX A;  3HFN A;  3IQL A;  3CCL T;  2MAM A;  4C92 C;  4JRP A;  2QA4 Q;  2YLC A;  2CUD A;  1ZA1 B;  5KYU B;  3LH0 A;  4ME7 A;  4Y91 A;  1OQK A;  2RPN A;  4Z8A A;  3C4S A;  5KYW B;  1D1C A;  1KC8 C;  4BY6 B;  1RL2 A;  5KCH A;  1TUC A;  2LZ6 B;  5IXB A;  3DB3 A;  4OGC A;  2CT3 A;  1NG2 A;  1IXD A;  1AEY A;  4C8Q G;  1X2K A;  2HBP A;  3QYG B;  4FCY A;  2VAS A;  1CKA A;  2ZAE A;  2HEQ A;  5GAN 4;  5FRN A;  1OUL A;  4ZN3 A;  1AWJ A;  1RAI B;  1E6H A;  3I5S A;  2LVM A;  5M9O A;  2QAS A;  4OMP A;  3JB9 I;  3JB9 F;  1VQ4 T;  3M57 A;  2IG0 A;  1YWP A;  1ZBX A;  1TH7 A;  2Y4X A;  3CCE Q;  1RAH B;  1M1K R;  2XI9 A;  4OB1 B;  5I11 A;  1KQ1 A;  1M2V A;  4HCC A;  1X6O A;  3I55 A;  3QUI A;  3JCM V;  4ANJ A;  3WVD B;  3H41 A;  2WSC E;  1K8A C;  2K2V A;  3GIB A;  1OZ3 A;  2ED0 A;  4C5G A;  2CS7 A;  3EG1 A;  1H3H A;  4PLI A;  4DBF A;  5GAO n;  3CEY A;  3R6O A;  1GCP A;  4BI3 A;  5GMK l;  2IIM A;  3G6E T;  2KK4 A;  2JTM A;  3PIP A;  1AWO A;  3WVE B;  5CQX A;  4PJL A;  1ABO A;  3CC7 T;  1OYX A;  3UF4 A;  3VS1 A;  3X28 B;  3REB B;  2GQV A;  3PVQ A;  2VB6 A;  2NLU A;  2L3Q A;  4OB0 B;  1D1A A;  4II1 A;  1T0H A;  4GLK A;  2GTO A;  3PFS A;  5GAN 7;  2FRW A;  3I9Q A;  1VQM T;  1H3Z A;  4QVZ A;  1K0X A;  2EQI A;  1VQP T;  4C0D B;  4EMH A;  3QHS A;  4RTT A;  4E7I A;  3L2W A;  2J06 A;  4M77 D;  3AT1 B;  3CC7 Q;  4LDW A;  3MO8 A;  2XU8 A;  1XOV A;  2CH4 A;  3NMZ C;  4XTW A;  3MP8 A;  4AG1 C;  4JLI A;  1WNL A;  2ROL A;  1SRM A;  3NFC A;  2E3I A;  1G83 A;  2E64 A;  5C6S A;  2EGA A;  1JJ2 A;  1M90 U;  1SSH A;  4M75 B;  4BE1 A;  3DLM A;  1YIJ T;  2ED1 A;  2DD5 A;  1GBQ A;  3VS3 A;  3GLX A;  4MZP A;  4F14 A;  3SWN B;  2DBM A;  5LJ3 h;  1KSW A;  3CPF A;  5C0M A;  3N5B B;  1IHV A;  2FVU A;  1WDX A;  2L2P A;  1WX6 A;  1Q86 U;  4HKE A;  1TTH B;  2EW3 A;  2W10 A;  3TEE A;  1M2O A;  4DEX A;  2AKL A;  5A2Q E;  3VKI A;  2ZCF B;  1UEC A;  1OPL A;  2YSQ A;  1DJ7 B;  3PNW C;  5GJW B;  4M7A F;  3EG3 A;  4NL3 A;  3G71 Q;  3I56 T;  2RI3 A;  2J6K A;  3MKD A;  4C8Q C;  1D0X A;  2SRC A;  3SB2 A;  2OTL T;  1B34 B;  2F2X A;  1W2B P;  2D8J A;  3RR6 A;  1ZX6 A;  2DL3 A;  1ZUK A;  3GNG A;  2JOY A;  1WQ7 A;  3FEO A;  3VRY A;  3DB4 A;  5GJV B;  2QTX A;  5CKH A;  1AHJ B;  1UGP B;  4N4H A;  5LJ5 e;  4AFS C;  4FM4 B;  2X4W A;  5GAN 6;  4XU1 A;  2OX7 A;  4JRI A;  2QQA A;  1KQS A;  1XJW B;  1EIF A;  1K73 U;  3OBW A;  1UTI A;  2MK5 A;  4C8Q A;  3CCM Q;  3CCE A;  5GAM g;  2KGT A;  2LJ3 A;  4FL6 A;  1SHG A;  2EJF A;  1GFD A;  3OW2 A;  5FW9 A;  3HKS A;  3L1A A;  1LJO A;  3I56 Q;  1X43 A;  5A0D A;  2KEA A;  4E2F B;  3M9Q A;  3CCR A;  2JJ9 A;  1KHC A;  1QP2 A;  2QAZ A;  2CYZ B;  2YLB A;  2EYZ A;  2DO3 A;  1Y96 A;  2DYI A;  4WTO B;  1YN8 A;  3CD6 Q;  4XTZ A;  4GLM A;  2JMC A;  1XNI A;  1VQO A;  1T0J A;  4C92 B;  2RQT A;  9ATC B;  1UFF A;  2RQV A;  1J3T A;  2FZC B;  3QG1 A;  3D7S B;  4BI8 B;  2WAC A;  4XQ3 A;  2BUD A;  1TXQ A;  3H0H A;  1VQL Q;  2X35 A;  3CCU T;  1X27 A;  1YI2 A;  1PRM C;  3QO3 A;  1Q86 C;  1U1S A;  2EBP A;  2QK0 A;  2V8J A;  1WZO A;  5CO7 A;  3OYJ A;  4C8Q E;  1WHK A;  3HL8 A;  4M75 G;  1YJN T;  1H92 A;  1HD3 A;  4EPC A;  3M0S A;  5KYX B;  1AWW A;  2O9V A;  3I5R A;  3GBQ A;  1UGR B;  3HRT A;  5GAN d;  1K9A A;  4MZM A;  2ESW A;  2BTT A;  2GCX A;  2A28 A;  4ESR A;  4QT7 A;  4R0K A;  4XAX B;  1KD1 R;  1CKB A;  1H64 1;  4PKC C;  3CC2 Q;  2NUZ A;  3REA B;  5A0L A;  1JU5 C;  3CCU Q;  4DOW A;  2GFA A;  1N6A A;  2QEX T;  1M9S A;  1M90 R;  1F1B B;  3BDU A;  1YJW Q;  3VS7 A;  1K73 C;  2DET A;  2ZZD A;  4VUB A;  1KK7 A;  3OS0 A;  1UUE A;  2PUK B;  1YJN Q;  5CAI A;  2YRD A;  4D8D A;  1MNE A;  3UWN A;  2WSF E;  3CCS Q;  3UT1 A;  1N5Z A;  3LGF A;  5KYU A;  2B8A A;  1VQ9 T;  2QTV A;  4PJO F;  5KYW A;  1WHL A;  1OI1 A;  3CME Q;  4KGV B;  4HT8 A;  2DIG A;  3VS6 A;  3O8V A;  2M02 A;  4F7U B;  2RK2 A;  3VUZ A;  3C95 A;  4DBQ A;  1G5V A;  4B6M A;  2QEX Q;  3OS1 A;  1K9M U;  1JXO A;  3G71 A;  2DRK A;  4MML A;  1PRL C;  3CMA T;  3ZEH A;  1X69 A;  1QQJ A;  4M78 C;  3NGP A;  3A1P A;  1WXT A;  3M4G A;  2EJG A;  4LUD A;  4FT4 A;  1M8M A;  2CP5 A;  6AT1 B;  5KE3 A;  2LP5 A;  1D3B B;  1YIT T;  4E7J A;  2YRC A;  2EYW A;  2OI3 A;  3S3N A;  1K73 R;  1E6G A;  4MDW A;  2K4Y A;  1PD0 A;  1VA7 A;  2MIO A;  4RCC A;  2DM1 A;  2EKH A;  4C92 G;  2X3W D;  3QBY A;  1FWZ A;  2M9U A;  4ORZ A;  4M78 A;  1JJ2 P;  1VOM A;  4FYX B;  4KGZ B;  2QI2 A;  1Z9Z A;  3T9N A;  3RDV A;  3JCM J;  2BZ8 A;  2QQR A;  1M5Q 1;  1QCF A;  2QGF B;  3CMA Q;  2HSP A;  4OMQ A;  1D1B A;  4MMK A;  5J39 A;  1QKX A;  3HP9 A;  3CXC S;  3FC3 A;  4OMN A;  3CD6 A;  2KRM A;  2EPD A;  1MHN A;  5LJ3 e;  1YIT Q;  2QDY B;  1ZSG A;  4M7A C;  4JS4 A;  4CC7 A;  2DNU A;  2MCN A;  4J9G A;  2K79 A;  5GAM f;  3EGD B;  4KH1 B;  1QVF A;  4FSS A;  2PZ1 A;  4LUE A;  4LXC A;  2KVQ G;  4JRK A;  4JJD A;  3G4S Q;  2K7A A;  2A0F B;  1BYM A;  2DXT A;  1C1A A;  2E6Z A;  4IUV A;  2F2W A;  4RTX A;  3ULR B;  2KY9 A;  1X75 C;  1VQL A;  2XK0 A;  2CP7 A;  1M3A A;  1ZLM A;  4IUU A;  4M77 F;  4EIK A;  1S72 Q;  2HCK A;  2ZPG B;  2F69 A;  2ABL A;  2JT4 A;  2O01 E;  3HTR A;  3C94 A;  4BE0 A;  1VQK T;  3L42 A;  1WYX A;  5GAN 2;  2RHZ A;  1K9M C;  4IUR A;  1LNX A;  1FYN A;  1B3Q A;  4FYV B;  1JB0 E;  3KBG A;  3JAM E;  1YP5 A;  4V2S A;  1NYG A;  1R0C B;  2ZPF B;  3CC2 A;  2FZG B;  2AZV A;  4M75 A;  4LD9 K;  1EX4 A;  4A4G A;  1QWF A;  4ELY C;  2D8H A;  2RJE A;  1XQH A;  4F7U G;  2KRO A;  2JUF A;  2QYZ A;  4GBQ A;  4C0G A;  3SWN A;  3EHQ A;  2YUN A;  3SHW A;  2DZC A;  2NUP B;  2FEI A;  1K1Z A;  2RB6 A;  4GY5 A;  2YUQ A;  1VQN A;  3CCS A;  5GAN h;  2E10 A;  1PSE A;  1HJD A;  1X6G A;  2LQN A;  3RIR A;  1X01 A;  2EKO A;  2CKK A;  5AT1 B;  1QVP A;  2EJ9 A;  5LJ5 h;  1YJ9 T;  2HDA A;  3LWI A;  5IT9 E;  3VS5 A;  3VS2 A;  5DLO A;  3LWH A;  2P0K A;  1B34 A;  3MCA B;  4RG8 A;  1U1T A;  4RTW A;  3J80 E;  4QKU A;  2E12 A;  2F5T X;  3OMG A;  2K5I A;  2MF2 A;  2Y4Y A;  3NPF A;  4J9D A;  3HFO A;  5IXF A;  1N9S A;  2D0N A;  2E1H A;  2L5Q A;  4J5Y A;  1LPL A;  4M75 E;  4QQG A;  3SDZ A;  4J9H A;  1U8R A;  3A8H B;  3OSS C;  4HT9 A;  4ZGD B;  1TOV A;  1FMW A;  2L89 A;  3KFV A;  1VQ8 Q;  1Y07 A;  3TSW A;  2P0P A;  1KIK A;  2CRE A;  4AFQ C;  2OAW A;  3CBM A;  3L2Z A;  4PJO C;  2JM9 A;  3EGU A;  1NPP A;  1RAD B;  1ZHI A;  2GNC A;  3RMQ A;  2E3H A;  2L3R A;  1M3B A;  2LCC A;  3OS2 A;  1FX7 A;  2DD4 A;  5IAY A;  2LT4 A;  4J8O A;  4C92 A;  1NE8 A;  2KT1 A;  1G8X A;  5KYY B;  3CCJ T;  1GL5 A;  1GBR A;  1GFC A;  1IHW A;  4J83 A;  1MMG A;  2J05 A;  1IB8 A;  1BBZ A;  2YT6 A;  1K0S A;  3CCL Q;  1M3C A;  1QCO A;  1VIE A;  4KRT A;  5KE2 A;  1Q7Y R;  1IZ6 A;  2D0Q B;  2EGE A;  3CCR T;  4IIM A;  1WXB A;  3OYE A;  3M0P A;  4KUI A;  2DL8 A;  4AG2 C;  3J81 E;  2K3X A;  3H9N A;  4IUQ A;  2QXF A;  2E41 A;  5KYX A;  1QVG A;  2DTI A;  2I2L A;  3P8H A;  1VQ5 A;  2DXU A;  5GAO p;  2O9S A;  2V1R A;  3CCJ Q;  2R57 A;  4E7S A;  1UGQ B;  3V7R A;  4M78 B;  2DIL A;  5HKC A;  2VYT A;  2LT1 A;  1BCM A;  2LCS A;  4XK8 E;  1KC8 R;  2CSQ A;  2XMF A;  1M1F A;  1WHJ A;  5L23 A;  3EH2 A;  4RKU E;  3R6N A;  5GAN 5;  1VQ4 Q;  4C92 E;  4M7D C;  1MV3 A;  5CKD A;  2BZX A;  1RUW A;  1UE9 A;  2RQR A;  1W70 A;  3JCM c;  2RHU A;  3DLL A;  3M54 A;  3JB9 G;  1MMN A;  3JCM d;  4OMM A;  1MMD A;  3EAE A;  3OYY A;  1QWE A;  2VVK A;  3JCM P;  3QWY A;  4JRQ A;  2MWP A;  4A54 A;  1JQQ A;  2HQH A;  2HZY A;  3RES A;  4F7U A;  4M7A B;  1X6B A;  3O5Z A;  4LN2 A;  2XG8 D;  4HCZ A;  3JCM b;  2SEM A;  2X3X D;  2QQB A;  3HHT B;  1GRI A;  2EYQ A;  1K8A R;  1VQ6 T;  3G6E Q;  2O4X B;  4FIB A;  1D09 B;  4PFP A;  4X34 A;  3VRZ A;  2D6F A;  2A36 A;  4JS5 A;  1PHT A;  3H6Z A;  5LJ3 g;  5EC7 A;  3QXE B;  4A4H A;  5DM7 R;  1YWO A;  2DBK A;  2DAQ A;  2VGN A;  1ZBJ A;  1D3B A;  3CBP A;  2VXF A;  2HQE A;  2PVG B;  3Q1J A;  1QW1 A;  2MWO A;  2DL5 A;  1AOJ A;  4BDY A;  2JZ2 A;  2EAY A;  3CPW P;  2M16 A;  1YHQ T;  1YCS B;  2O2O A;  1NYF A;  1VQM Q;  2COY A;  3VS0 A;  1UEB A;  3RKW A;  2DEU A;  3VYG A;  2QQ9 A;  1VQP Q;  2R58 A;  3OBY A;  5DY9 A;  3E19 A;  4C5H A;  2EYX A;  2QA4 A;  3E2U A;  5GMK m;  3E9F A;  5GAO l;  1AVZ C;  2E5K A;  2QG9 B;  4CC2 A;  3JCM W;  1ZUY A;  4F7U E;  3CQT A;  3EFO B;  3QII A;  1B7T A;  4HCK A;  1PCX A;  3L2R A;  5GAO r;  2XD0 A;  1BI0 A;  1RAE B;  2CDT A;  2GGR A;  2HSE B;  1Q81 U;  1GCQ C;  1FXX A;  4K11 A;  2COZ A;  1YIJ Q;  4P5N A;  4RTZ A;  5GAN e;  3EGD A;  1YHQ Q;  5FRM A;  4RTU A;  3CBO A;  3CCQ T;  1ACM B;  3SD4 A;  4Z89 A;  4RMO A;  3X20 B;  1AWX A;  3QWX X;  2W0Z A;  4L5G A;  4M78 G;  2M51 A;  1JXM A;  2K57 A;  1VYU A;  4J9C A;  4A4F A;  5GMK j;  1CSK A;  1N8R U;  5D6Y A;  1Q82 U;  1OZ2 A;  3FB9 A;  4RG2 A;  1VIF A;  1GCQ A;  1VQ7 T;  5GAO q;  4JJN K;  2NWM A;  4KT0 E;  1V29 B;  1VUB A;  4A63 B;  1HXD A;  3L2U A;  4QVC A;  2OTJ T;  5CKF A;  4Q5W A;  3ZBD A;  4LDY A;  4OML A;  4Y28 E;  3E1S A;  5GMK i;  2OTL Q;  2KAF A;  3CCQ Q;  4C8Q D;  2DF6 A;  2AT1 B;  2HMA A;  1UJ0 A;  1Y71 A;  1TU0 B;  2CP2 A;  3GPL A;  2OAU A;  3M55 A;  1WXU A;  4A4E A;  4M7A G;  2JTE A;  2EYY A;  2ATC B;  1KG1 A;  2QDL A;  1AT1 B;  2E5Q A;  1VQ7 Q;  3RBB B;  2H3E B;  3CPW S;  2CP6 A;  2G3R A;  2NUP A;  5KH6 A;  2VXE A;  4PJO B;  2EQJ A;  1PNJ A;  1ABQ A;  5GAO m;  2OTJ Q;  2F5K A;  2DVJ A;  4F16 A;  3M4Y A;  2AK5 A;  4ZGE B;  2DL4 A;  3HSB A;  4ATO A;  3TQ7 P;  2PTK A;  3C12 A;  1RAC B;  3JB9 J;  1UHC A;  2QGG A;  4HCB A;  2FPE A;  5IHK A;  1RLQ C;  2LJ0 A;  3M59 A;  3A5Z B;  4R56 A;  1TUD A;  4AT1 B;  4JDS A;  2YUO A;  3JRZ A;  4F04 B;  1WHH A;  1Q81 C;  1OU8 A;  2JW4 A;  2HKQ B;  1ZA2 B;  3M5A A;  1BI2 A;  3PIO A;  5L8R E;  2LNH B;  2M0Y A;  2MPX C;  1KHI A;  1UB4 A;  3FIF A;  1G3S A;  1TUG B;  5D6W A;  3CCV T;  3THK A;  2DJQ A;  1W2B S;  3BFM A;  2HQX A;  1WJS A;  2EQM A;  3CC7 A;  2DYB A;  3JCM h;  2JS0 A;  2PNI A;  1N8R C;  3RUX A;  1Q82 C;  1VQN T;  4IUP A;  4L6V 5;  2RD1 A;  4LD6 A;  3FDR A;  5KCO A;  1M30 A;  3QZ5 B;  3ZL7 C;  2LX9 A;  4N0A C;  4DEY A;  3TSZ A;  1VQM A;  4JZ3 A;  5HK0 A;  2XID A;  5FU6 C;  4FT2 A;  1WJR A;  2FZK B;  3CC4 T;  3INZ A;  1VQP A;  4PJJ A;  4XTU A;  3CCV Q;  4OF1 A;  5LJ3 f;  1Q86 R;  1SSF A;  4YTL A;  2FPD A;  2PUO B;  5IN1 A;  4M7D B;  3MEV A;  3U23 A;  1I5L A;  2LCL A;  5KYY A;  3OQ5 A;  1X2Q A;  4F17 A;  2KNB B;  5IH2 A;  2RO0 A;  2Z0W A;  1UDL A;  3OYM A;  3X26 B;  4AFZ C;  4R55 A;  3ME9 A;  4XU2 A;  5EG2 A;  2GFU A;  1HSQ A;  2J6O A;  1NLP C; 
#chains in the Genus database with same CATH homology
 2LQN A;  3A98 A;  4JZ4 A;  1GCP A;  2IIM A;  1UHF A;  2HDA A;  1TG0 A;  4RTY A;  3VS5 A;  1AWO A;  2DLP A;  3VS2 A;  1ABO A;  4J9I A;  2A37 A;  3UF4 A;  4RTW A;  3VS1 A;  2CSI A;  3REB B;  1U06 A;  1V1C A;  1NM7 A;  1ZUU A;  3NPF A;  3PVQ A;  4CC4 B;  4J9D A;  5IXF A;  5IHN A;  2L3Q A;  2LMJ A;  3TVT A;  2D0N A;  1PKT A;  1T0H A;  3JV3 A;  2GTO A;  2FRW A;  3I9Q A;  4IIO A;  4J9H A;  1K0X A;  2EQI A;  1B07 A;  4LE9 A;  1OPK A;  3KFV A;  4RTT A;  3TSW A;  2J06 A;  1KIK A;  2CRE A;  4AFQ C;  2OAW A;  1XOV A;  2CH4 A;  2JM9 A;  3EGU A;  3NMZ C;  2ROT A;  4OMO A;  4AG1 C;  3PVL A;  2GNC A;  1KJW A;  2ROL A;  1SRM A;  2BZY A;  1G83 A;  2EGA A;  4RUG A;  1M3B A;  1SSH A;  3M0U A;  2ED1 A;  3M0T A;  2LQW A;  1GBQ A;  2RNA A;  2KXC A;  3VS3 A;  2KT1 A;  4F14 A;  1NEB A;  2CH4 W;  1GL5 A;  1GBR A;  1GFC A;  2K2M A;  2KRN A;  2DBM A;  2KT8 A;  1KSW A;  2J05 A;  1BBZ A;  4Y92 A;  2YT6 A;  5ECA A;  3PE0 A;  1K0S A;  4Z88 A;  1SHF A;  1M3C A;  1WDX A;  4KRT A;  2L2P A;  1WX6 A;  2EW3 A;  2W10 A;  1A0N B;  2YUP A;  2RF0 A;  4DEX A;  2AKL A;  2EGE A;  3EHR A;  2DX1 A;  4IIM A;  3NHN A;  1WXB A;  1MUZ A;  3M0P A;  1UEC A;  5FWC A;  1WIE A;  2DL8 A;  1OPL A;  2YSQ A;  4AG2 C;  3M0Q A;  5GJW B;  3EG3 A;  2J6K A;  2EGC A;  2SRC A;  2F2X A;  2MOX A;  2O9S A;  2D8J A;  4LNP A;  1ZX6 A;  2DL3 A;  1ZUK A;  2V1R A;  3VRY A;  5GJV B;  1SEM A;  2DIL A;  2EVR A;  2LCS A;  4AFS C;  2CSQ A;  4HVV A;  1H3H A;  2XMF A;  5HCK A;  2C0O A;  5L23 A;  2DRM A;  3R6N A;  1UTI A;  2RQW A;  2KGT A;  2LJ3 A;  1MV3 A;  2C0I A;  4CC3 A;  1SHG A;  3H0I A;  1GFD A;  2YDL A;  2KXD A;  2BZX A;  5FW9 A;  3I35 A;  1RUW A;  1UE9 A;  2RQR A;  1X43 A;  2KEA A;  1W70 A;  2DL7 A;  2F2V A;  2B86 A;  1S1N A;  1VYV A;  1I1J A;  2EYZ A;  1KFZ A;  4OMM A;  1FMK A;  1QWE A;  2VVK A;  3QWY A;  3C0C A;  1YN8 A;  2O88 A;  1JQQ A;  4GLM A;  2JMC A;  1X6B A;  2L0A A;  3O5Z A;  4LN2 A;  2SEM A;  2X3X D;  1T0J A;  2RQT A;  5IHI A;  1UFF A;  2RQV A;  2AKK A;  1GRI A;  1J3T A;  2FRY A;  1RLP C;  1VYT A;  3VRZ A;  2A36 A;  1PHT A;  2O31 A;  2K6D A;  1Y0M A;  3H0H A;  1M27 C;  2L3P A;  2JMA A;  5EC7 A;  1X27 A;  1PRM C;  4WCI A;  2GBQ A;  1YWO A;  2KBT A;  2DBK A;  2DMO A;  1ZBJ A;  2EBP A;  5FWB A;  1WA7 A;  2DL5 A;  4J9B A;  1AOJ A;  2A08 A;  2D1X A;  1H92 A;  1T3L A;  1HD3 A;  3M0S A;  1YCS B;  2O2O A;  1NYF A;  2J7I A;  1AWW A;  4ZNX A;  3VS0 A;  2O9V A;  2RMO A;  1I07 A;  3I5R A;  3GBQ A;  2KRS A;  1K9A A;  2ESW A;  2BTT A;  2RQU A;  2A28 A;  4ESR A;  4M4Z A;  4QT7 A;  4R0K A;  1CKB A;  2EYX A;  3RNJ A;  4JJB A;  4RTV A;  2NUZ A;  3REA B;  1AVZ C;  4D8K A;  2E5K A;  4CC2 A;  1ARK A;  1JU5 C;  1ZUY A;  2OJ2 A;  3CQT A;  4HCK A;  5I22 A;  2K3B A;  1JEG A;  2CDT A;  2GGR A;  3VS7 A;  1UUE A;  3EG0 A;  1GCQ C;  1MV0 B;  1RI9 A;  2L3S A;  2JM8 A;  1Z9Q A;  4K11 A;  3SEM A;  4D8D A;  4RTZ A;  4RTU A;  1N5Z A;  4Z89 A;  2K9G A;  1AWX A;  3QWX X;  4HXJ A;  2W0Z A;  4AFU C;  4JJC A;  2VWF A;  2P4R A;  2M51 A;  2GQI A;  1JXM A;  1VYU A;  4J9C A;  1CSK A;  2GTJ A;  1BB9 A;  1JO8 A;  1OOT A;  2CUB A;  1QLY A;  1WLP B;  2I0N A;  1GCQ A;  3VS6 A;  1E7O A;  2JS2 A;  3UA7 A;  1QKW A;  3UA6 A;  2NWM A;  2J6F A;  4A63 B;  1W1F A;  2KYM A;  4JPB W;  2G6F X;  2C0T A;  1JXO A;  2LJ1 A;  1BU1 A;  2DRK A;  1PRL C;  4OML A;  1IO6 A;  4HVW A;  1X69 A;  1NEG A;  1U5S A;  4J9F A;  1UGV A;  2DF6 A;  3NGP A;  1WXT A;  2HBW A;  4LUD A;  1UJ0 A;  1PKS A;  1M8M A;  3UAT A;  2KR3 A;  2LP5 A;  2JXB A;  2FPF A;  1WXU A;  2EYW A;  1SRL A;  2OI3 A;  1E6G A;  2H8H A;  2JTE A;  2MIO A;  1VA7 A;  2EYY A;  3VS4 A;  2QDL A;  2DM1 A;  2EKH A;  3RBB B;  2X3W D;  3FJ5 A;  1K76 A;  1OEB A;  4ORZ A;  1PNJ A;  1Z9Z A;  1ABQ A;  4X1V A;  2DVJ A;  2BZ8 A;  4F16 A;  2AK5 A;  1PWT A;  1K4U S;  2DL4 A;  2CT4 A;  1QCF A;  2ENM A;  2PTK A;  2V1Q A;  2VKN A;  2ECZ A;  1UHC A;  2AZS A;  1AZG B;  2HSP A;  4OMQ A;  2KYB A;  1H8K A;  1UG1 A;  2FPE A;  4J9E A;  5IHK A;  1RLQ C;  2LJ0 A;  1AZE A;  1QKX A;  1T3S A;  1TUD A;  1Y57 A;  2KE9 A;  2RN8 A;  4OMN A;  2KRM A;  2YUO A;  1WFW A;  1AD5 A;  2EPD A;  1ZSG A;  4CC7 A;  2DNU A;  3IQL A;  1W6X A;  2MCN A;  2JW4 A;  3LH5 A;  4J9G A;  2LX7 A;  2K79 A;  2LNH B;  2CUD A;  2M0Y A;  4FSS A;  2PZ1 A;  3EG2 A;  4LUE A;  2RPN A;  4JJD A;  4Z8A A;  2K7A A;  3THK A;  2DJQ A;  2F2W A;  4RTX A;  3ULR B;  2DYB A;  1TUC A;  1YNZ A;  2JS0 A;  1NLO C;  2LZ6 B;  2PNI A;  1M3A A;  5IXB A;  1ZLM A;  2CT3 A;  4EIK A;  1NG2 A;  2HCK A;  1AEY A;  2ABL A;  2JT4 A;  1X2K A;  1M30 A;  1CKA A;  3ZL7 C;  2HEQ A;  4DEY A;  1WYX A;  3TSZ A;  2FO0 A;  1SPK A;  1AWJ A;  4JZ3 A;  1FYN A;  1E6H A;  3I5S A;  1B3Q A;  1WI7 A;  2DA9 A;  4OMP A;  1YP5 A;  1OV3 A;  4HVU A;  1NYG A;  1YWP A;  1LCK A;  2FG0 A;  2AZV A;  5I11 A;  2FPD A;  1QWF A;  2D8H A;  3U23 A;  2KRO A;  4GBQ A;  3H41 A;  3M0R A;  3EHQ A;  1G2B A;  1X2Q A;  1BK2 A;  4E6R A;  4F17 A;  1U3O A;  2KNB B;  1EFN A;  1UJY A;  5IH2 A;  1I0C A;  1UDL A;  2YUN A;  2DE0 X;  3SHW A;  2FEI A;  4AFZ C;  1K1Z A;  2ED0 A;  2YUQ A;  3H0F A;  3EG1 A;  1HSQ A;  1HJD A;  1X6G A;  2J6O A;  1NLP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...