2EBPA

Solution structure of the sh3 domain from human sam and sh3 domain containing protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM and SH3 domain-containing protein 1
publication title Solution structure of the SH3 domain from human SAM and SH3 domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ebpA00
2KROA 4J9IA 4E6RA 2EW3A 2K2MA 1ZSGA 2OI3A 2DRMA 1T3LA 2O9SA 1T0HA 2DJQA 1GCQC 1K76A 1AZGB 1RUWA 2YDLA 4RTXA 2K7AA 3M0SA 4OMMA 3GBQA 2PNIA 4ESRA 2C0OA 3UA6A 4D8DA 1X2KA 2B86A 2FPDA 1YNZA 1GBQA 3EGUA 3SHWA 1NEBA 4OMPA 4HVVA 1MV3A 2KRSA 2KEAA 3NGPA 2O88A 1WDXA 1YN8A 1UHFA 1FYNA 1ZUYA 1Z9QA 4ORZA 1ZUKA 4AG1C 1WXUA 1WLPB 1UTIA 1GRIA 4M4ZA 2K3BA 2YT6A 4J9EA 2O2OA 1QKWA 2CT3A 2X3XD 1YWOA 2CDTA 1UG1A 3H0FA 4AFSC 2KR3A 1PNJA 1WI7A 2DYBA 3EG3A 4AG2C 2P4RA 1NLOC 1WXBA 2AKLA 4RTWA 1SRLA 2W10A 1MV0B 1B3QA 2BTTA 1VYVA 1UGVA 5IH2A 1QLYA 3VS3A 1W1FA 2EGCA 1BBZA 1UHCA 1CKAA 2RQWA 1Y0MA 2ABLA 3VS0A 2LCSA 2OJ2A 2EPDA 1V1CA 1Y57A 4J9FA 3M0TA 5EC7A 3THKA 4EIKA 2VVKA 2F2VA 1RLQC 1ABOA 2EVRA 2PTKA 1Z9ZA 2DL4A 1GFCA 3EG0A 2D1XA 3U23A 2DL5A 1QCFA 5ECAA 1JO8A 1UE9A 2EKHA 1CSKA 1G83A 1OPLA 3RBBB 2LJ1A 2LP5A 4R0KA 2DNUA 2AKKA 3PVQA 2ED1A 2L0AA 2KT8A 1LCKA 3UA7A 2CSIA 1OV3A 2DBKA 4X1VA 1AOJA 3I9QA 3SEMA 1HJDA 2GGRA 2BZ8A 1I1JA 4CC4B 3RNJA 3UATA 2NWMA 1QWFA 2VWFA 1WIEA 1IO6A 1AWJA 2L3PA 3M0UA 2GNCA 3QWYA 1K0XA 3EHQA 2KGTA 4DEXA 3H0IA 1JXMA 1ARKA 2GTJA 2V1QA 4FSSA 4OMLA 2IIMA 1H8KA 2KYBA 1PKTA 3PE0A 1YP5A 4A63B 2JM8A 4OMQA 4AFZC 1ZBJA 2CUDA 4JPBW 2K79A 2RQTA 1TG0A 2ESWA 1K0SA 1M3CA 2RQVA 2JT4A 1HSQA 1AD5A 2RQUA 2KE9A 3VS5A 1SHGA 1NLPC 4RTYA 2DE0X 2F2XA 2YUPA 1N5ZA 3VS7A 2YSQA 2LQWA 1QKXA 4HXJA 2C0TA 2CH4A 1SHFA 3EG2A 2DX1A 1KFZA 1OEBA 4JZ3A 1OPKA 4OMNA 2LMJA 4J9HA 4JZ4A 1EFNA 5FWBA 2YUQA 3CQTA 3VRYA 2LNHB 2HDAA 1M27C 2GQIA 1NG2A 1X27A 2DVJA 2KRMA 4QT7A 1J3TA 1PKSA 3VS2A 1B07A 2D8HA 1S1NA 3VS4A 4GLMA 2AZVA 4GBQA 2AK5A 1X2QA 2KXCA 3LH5A 3ZL7C 1K1ZA 1AEYA 2O31A 2EQIA 2OAWA 4JJDA 2RF0A 1X6GA 2J6FA 2FO0A 1W6XA 2D8JA 5FWCA 2DF6A 2LX7A 5IHNA 1U3OA 1W70A 1SRMA 3NPFA 4Z8AA 2RPNA 2H8HA 3I5SA 1H92A 2KNBB 2LQNA 2M51A 1VYUA 1JEGA 1I07A 2HCKA 2J05A 5FW9A 1X6BA 4J9DA 1GFDA 4RTZA 1MUZA 3UF4A 3QWXX 2JMCA 4K11A 2XMFA 5I11A 1U06A 2DILA 2SRCA 1GCPA 4HVUA 2EGEA 1UUEA 1E7OA 2K9GA 2L3QA 5IHKA 2CH4W 2X3WD 2A37A 1BU1A 1AWWA 2ECZA 4LE9A 2KT1A 4ZNXA 4D8KA 1ABQA 2DL7A 3IQLA 2FRWA 1KJWA 4IIOA 4AFUC 1ZX6A 3VRZA 2FG0A 3I35A 4WCIA 1NEGA 2KRNA 3TSZA 2CT4A 1PRMC 3VS6A 4CC3A 4RTTA 2M0YA 4Z89A 2JTEA 1SSHA 4LNPA 1ZUUA 1SEMA 1CKBA 5HCKA 1PHTA 1RLPC 2LJ0A 2EYZA 2KBTA 2MIOA 1BB9A 1PWTA 3C0CA 3R6NA 2HEQA 1NYFA 2HBWA 1T3SA 1UDLA 2L3SA 1ZLMA 4JJCA 1UECA 1E6GA 2AZSA 2FEIA 3I5RA 2RQRA 4F17A 3M0PA 2RNAA 2YUOA 5GJVB 1XOVA 2DBMA 1YCSB 2D0NA 1KIKA 1M30A 2I0NA 2MOXA 2J06A 3H0HA 3JV3A 1VA7A 2A08A 2JXBA 2V1RA 4J9CA 4RTVA 2PZ1A 3REBB 2DA9A 2JM9A 2NUZA 2O9VA 2RMOA 2BZXA 5IHIA 1K4US 1M8MA 1WX6A 1GCQA 4F16A 2F2WA 3KFVA 1SPKA 3TVTA 4LN2A 3NHNA 2FPEA 2DRKA 1GL5A 1JXOA 1AVZC 3REAB 3M0QA 2ROLA 4F14A 1JQQA 2CSQA 2ROTA 2EBPA 1RI9A 2DL3A 2JS0A 2EGAA 1FMKA 1UJ0A 1PRLC 2FPFA 1WXTA 3VS1A 2SEMA 2LZ6B 2J6OA 4CC7A 2EYWA 2ENMA 2EYYA 5I22A 2DLPA 4IIMA 2K6DA 2E5KA 4LUDA 2CREA 1UJYA 1HD3A 1NYGA 1AWXA 2JMAA 5L23A 2EYXA 3M0RA 2RN8A 1VYTA 3A98A 4Z88A 1UFFA 4Y92A 4LUEA 1JU5C 1X69A 2A28A 1YWPA 2W0ZA 4CC2A 1U5SA 3H41A 2BZYA 2DM1A 1T0JA 2J6KA 4AFQC 4RUGA 1M3AA 2DL8A 1M3BA 2JW4A 2QDLA 2GTOA 3NMZC 3O5ZA 1WYXA 1I0CA 4J9BA 1WFWA 3FJ5A 1E6HA 4KRTA 2A36A 2G6FX 1TUCA 2ED0A 1AWOA 1H3HA 2KXDA 3TSWA 2FRYA 1A0NB 1K9AA 2MCNA 3PVLA 4RTUA 1WA7A 2L2PA 4J9GA 1X43A 4HCKA 4JJBA 1AZEA 4DEYA 5IXBA 2VKNA 1GBRA 3ULRB 2LJ3A 1G2BA 2DMOA 3EHRA 2CUBA 5IXFA 5GJWB 2J7IA 2YUNA 2JS2A 1OOTA 1NM7A 1BK2A 2C0IA 3EG1A 1KSWA 2GBQA 4OMOA 2HSPA 1QWEA 1TUDA 2KYMA 4HVWA
chains in the Genus database with same CATH superfamily
2KROA 2YWWA 1YITA 4E6RA 4C8QA 5HKCA 1KQSA 2DEQA 5KYXB 1T3LA 3JB9I 5CKEA 5DM7R 4ZGEB 1AZGB 2K7AA 1OX9A 3GBQA 2KVQG 3CCQA 3RMQA 4QKUA 3G7ZA 2KK4A 4D8DA 5M9OA 1G3SA 4FW2A 2FPDA 1IGQA 1YNZA 5GAN8 1N8RC 4GY5A 3RESA 1NEBA 4C5EA 2QEXA 1RL2A 2O88A 3JSCA 1N8RR 3CMET 1HK9A 1RAIB 4L5GA 4NL2A 1WXUA 5FRMA 1WLPB 4B9WA 1OULA 2YT6A 4OF1A 1YWOA 2H3EB 5KYYB 5KYNA 1VQKT 4X9CA 4OB0B 3J81E 2DYBA 1WXBA 3WXMB 4DBRA 4DQ2A 1X6OA 3CXCP 2GF7A 2V8IA 2DXBA 3JCMc 1VYVA 1I4K1 5LJ3d 3PMTA 1PSEA 1JBMA 3JCMW 3BFMA 1CKAA 2FVUA 3G71Q 3DLMA 4M75E 2ABLA 3LWIA 3OYMA 2QA4A 2RM4A 3LGLA 3G6EA 2EPDA 1Y57A 3CCRQ 3THKA 1NPRA 2VVKA 1Z9ZA 3EG0A 1EX4A 2D1XA 4EMKB 2BIVA 4OVAA 3EGXA 4HCBA 2Y4XA 3CBPA 1OPLA 2HL3A 2LP5A 4R0KA 3PVQA 2L0AA 4NOYA 3EGDA 1Q7YC 3PNWC 1ZHIA 4F7UE 3TEEA 1Q7YR 5GANd 1QVGA 2CYZB 1YI2A 1Q82C 1AOJA 2PUKB 4PK4A 3EAEA 3CCVQ 2X4YA 1Q82R 4M7DF 2RHUA 4J6WA 4CC4B 3A1PA 4M7DC 3SWNB 2OTJT 2NWMA 1AWJA 1VQ6T 3EHQA 2KGTA 1VQ4Q 3L2QA 1W2BA 3A8GB 4XAXB 1N27A 4JRIA 3QUIA 2JM8A 2NUTB 3TU4K 1D09B 1W4SA 2QQBA 2R5MA 4XU3A 1FXXA 2ESWA 1OZ2A 2L3RA 4X9DA 2FYKA 4E7HA 1S72A 2RQUA 3CEYA 2VYTA 1P92A 2RHYA 4C5IA 2DE0X 3G4SA 2EIFA 3JB9G 1VQ5T 2IVWA 3A8HB 1I5OB 4MMLA 2C0TA 1SHFA 2E5QA 2EQUA 3EG2A 2M16A 2DX1A 4MZMA 1OEBA 2QYZA 3MP8A 3CXCS 4DA4A 2O4XB 5FWBA 2RI3A 3VRYA 2P4TA 1M2OA 2DK3A 2VGNA 3VJPA 3G1JA 4Q5WA 3OS5A 1RADB 2RJEA 2XDBA 4KGZB 1B07A 3VS4A 2QTVA 3RKWA 1Q81U 1X2QA 1LOJA 2K3XA 5KYXA 4ELYC 3CCLT 1K1ZA 2DXTA 2EQIA 1MNEA 2CP0A 3NTHA 4B9XA 2LQ8A 4JJDA 2HZYA 2EQJA 1KC8C 1QCNA 4R55A 1W6XA 2NLUA 4PJOF 4FYXB 1QCOA 5KH6A 3FIFA 1KC8R 1SRMA 2E3IA 3I5SA 4M7DB 4PJOC 2M51A 1K73U 5GAOr 2J05A 1X6BA 4J9DA 1GFDA 3G71A 3CD6Q 3VV0A 4PLIA 3CMAQ 1U06A 5I2MA 1GCPA 2YLBA 4KH1B 4QQ6A 3JCMQ 3X25B 3CCRA 1E7OA 2ATCB 2YRDA 8ATCB 3DKMA 3A8OB 3I55T 5A0GA 4F7UB 1Y96B 5LJ3j 3CC7T 3UWNA 2FRWA 4IIOA 2MK5A 3I35A 3V7CA 2KRNA 3JCMb 5C6SA 5A0DA 1QP3A 3VS6A 4CC3A 2EFIA 1LNXA 2M0YA 1ZSZC 1SSHA 1H641 4LNPA 2CP6A 5CIUA 5HCKA 1PHTA 1C6VX 2OTLT 3PIPA 1RLPC 2LJ0A 1QVGP 3OYCA 2MIOA 3CCVA 3OB9A 3OYLA 3C0CA 2DXUA 1NYFA 1ZLMA 3MCAB 1V76A 3E1SA 2FL7A 4F17A 3M0PA 4Z02A 2RO0A 5GJVB 1XOVA 2DBMA 4EMKA 2D0NA 4AMCA 5FLXE 1KIKA 1M30A 1G3WA 2GFUA 4PJOG 2J06A 3CCET 2XI9A 2JXBA 4A4KA 4RTVA 1QMCA 5GANj 4ZN3A 4RCBA 3A5ZB 2BZXA 5LJ5f 1K4US 2ZAEA 2PUOB 1KQ1A 3CCMQ 1TSFA 4C8QG 2V8KA 4BY6B 4C92D 3M0QA 1VQLQ 1EZZB 4F14A 4J83A 1JQQA 1QQJA 1D3BB 5D6YA 2MI6A 2DL3A 5HK0A 1OZ3A 3HP9A 1VQ8Q 1FMKA 3CCSQ 2CP2A 2E70A 2RHXA 2FPFA 3VS1A 2J6OA 3M58A 2HQEA 4PFZA 2DJZA 4PNOA 3FC3A 4DBHA 1BYMA 2K6DA 3SDZA 3GOXA 1UJYA 1NYGA 1AWXA 2QK0A 2NUTA 1SKUB 3S3OA 3A98A 4Y92A 5HY6A 1X69A 1M5Q1 2W0ZA 1KHCA 1UGQB 2DKGA 4CC2A 2AT1B 1U5SA 3H41A 1ZSZB 3M5AA 4RUGA 3OYIA 1M3BA 2JN0A 2JW4A 2QDLA 4J9BA 5HK3A 2RI2A 1WFWA 1R0CB 3CMEQ 2ZPEB 3S3MA 2P0KA 1O75A 2FRYA 1A0NB 1I8FA 2O4XA 2ZZDA 1SG5A 1YJNT 2L2PA 1X43A 5DY9A 1PM3A 4JJBA 1JRIA 3CD6A 2VKNA 2EQKA 1VQKQ 2DMOA 3CMAA 2J7IA 3HHTB 3H8ZA 5LJ3e 1QVGS 2HSPA 1WGSA 4BD3A 2PVGB 1TUDA 2JTEA 5KYWB 4J9IA 1D1AA 4RMOA 1Q95G 2K2MA 3OYGA 2RK2A 1SF9A 2DEUA 1WNLA 4RTXA 3ER0A 4OMMA 4M78F 3CPWA 4PJJA 2E4HA 1BIAA 4M7DA 4M78C 2DPPB 2X4WA 1NJIC 1GBQA 3SHWA 4OMPA 1MV3A 2E41A 2H3JA 3OBWA 1NJIR 1TUGB 1WDXA 1YN8A 2HKNA 3QPHA 1FYNA 4ORZA 1M8VA 3OYNA 1YJWA 1XJWB 4QQGA 1QKWA 3S6WA 2CT3A 4KGXB 2X3XD 3H0FA 1UG1A 5GANe 3VYHB 4ME7A 2KR3A 4C5HA 3L1AA 3OYHA 2D0QB 3QO3A 4PL6A 3EG3A 4LDWA 3JB9D 3NTKA 2AKLA 4RTWA 1SRLA 2XIDA 3EH1A 3EFSA 3OW2P 2W10A 1I5LA 3E9GA 4C92E 2RI5A 1UGVA 4V2SA 3CCMA 2YHTA 5CAIA 1QLYA 3VS3A 2OTJQ 3E9FA 1Y7XA 3MP6A 1VQ6Q 4VUBA 5D7UA 2VXEA 2LCSA 1VQLA 1VQMQ 2IPOB 4OP0A 3RMSA 3M0TA 4MDWA 5GANh 2QG9B 5EC7A 1VQ8A 2E6NA 4EIKA 1RLQC 4OB3B 2EVRA 4Y91A 2A7YA 1AT1B 5LJ5g 4M78G 5KCOA 2DL5A 1TOVA 5ECAA 2RHIA 2FZKB 1M2VA 3HL8A 1DJ7B 2DNUA 2AKKA 3BDUA 2KT8A 3OYDA 1HXDA 2CSIA 1OV3A 2E64A 4BB7A 1VQ5Q 3TREA 1KK7A 4C0ZA 1WQWA 2VV5A 2NYSA 4M78B 1D3BA 2DZCA 4PJOA 1JJ2A 3OYEA 2CKKA 3RNJA 3PMIA 2VWFA 1WIEA 4UC4A 1IO6A 2DIGA 1K0XA 3LWHA 5LJ3g 3CMEA 1VQOT 1JXMA 4JLIA 1ARKA 3A8LB 4FSSA 3RKYA 4OMLA 4L59A 3QIIA 1B7TA 2IIMA 1H8KA 3X26B 1NZ9A 1VOMA 5IAYA 1KD1U 1YP5A 4OMQA 5EG2A 4AFZC 3HFOA 1ZBJA 1PSFA 4ZTJA 4JPBW 3CCLQ 3LGFA 1VQKA 2K79A 4HT9A 4FYYB 2VUBA 4PFPA 3CCJT 3X28B 1FMVA 1BI2A 3SWNC 2RQVA 2JT4A 2EJGA 1M9SA 4XTUA 1ZSZA 5KYUB 2KE9A 2HAXA 1WHMA 3VS5A 1NLPC 3JCMV 1YHQT 4KUIA 2YUPA 4E2FB 1N5ZA 4RG8A 1XQHA 4ANJA 4F04B 3FEOA 4M77E 1OQKA 5FROA 4OMNA 4PJOD 2NUPB 2DTHA 4JZ4A 4N4GA 1EFNA 1G8XA 3OW2S 1K8AU 2K57A 4A53A 2D9TA 1OU8A 3QXEB 4M7AD 2HNIA 4KGVB 3E19A 3CCQT 7AT1B 2B8AA 3H9NA 3FJPA 4C8QD 1M90C 5GAN7 3L42A 3QYGB 2O01E 1M1FA 3QHSA 3VS2A 2HKQB 2D8HA 1M90R 4ZTFA 1D1CA 1BI3A 5KYWA 5CKFA 1WJSA 2QGFB 3P8HA 3PGGA 3ZL7C 2K5IA 1YJ9Q 2R57A 1PCXA 1MMDA 2YXYA 2J6FA 3JCMh 1VQ7T 1U3OA 1W70A 5GAN6 3PIOA 4PJMA 2HQHA 2OTJA 2GFAA 4RTZA 1MUZA 3FLGA 4JJNK 4M75F 3CCUA 2XMFA 5I11A 4E47A 2V26A 1VQMA 4KULA 8AT1B 2SRCA 3CCEQ 4M75C 3MEVA 3ZEHA 2K9GA 2L3QA 3OYBA 3A8MB 3L2RA 5IHKA 2CH4W 2A37A 1AWWA 2ECZA 1D0XA 2QA4T 4ZNXA 3G6ET 2DL7A 3IQLA 1KJWA 4AFUC 3VRZA 2FG0A 3LYIA 4WCIA 1VQNT 3TSZA 2CT4A 4E7KA 1H3ZA 1N8RU 4EPCA 4OGEA 4EMGA 1G5VA 1VQ5A 1IREB 5IN1A 4F7UF 2BE7D 5GAMd 2EYZA 2KBTA 1TH7A 3CBOA 4JRPA 1PWTA 3RERA 4FT4A 3QBYA 1UECA 1YI2T 2FEIA 2YUOA 2COZA 4JRQA 1YCSB 2I0NA 2KAFA 3JB9J 4J6YA 1KQSP 2E6ZA 3ASKA 1MMAA 2P84A 2V1RA 2PZ1A 4BDZA 2DA9A 3M53A 1WX6A 1ZA2B 4BDYA 3QJ6A 3TVTA 4LN2A 2LTOA 3CCLA 4KH0B 2KY9A 2RJDA 1M90U 2DRKA 2V8JA 4IUTA 1AHJB 3M9QA 1JXOA 3REAB 4C5GA 1IHWA 2JTFA 2X4JA 3GNGA 1KQ2A 4M78A 4M77B 1C0MA 2CSQA 2K2VA 2EBPA 1RI9A 2QASA 2LDMA 3I56T 4MDXA 1QVFA 4M7DG 1YJNQ 1UJ0A 2BKDN 2C06A 2SEMA 2LZ6B 4CC7A 2YRVA 4C0GA 1S72T 2JNGA 1RAHB 4M75B 2AHJB 3HRTA 4J7IA 3SB2A 5GAOn 2ENMA 4M7AE 5I22A 1YFNA 2DLPA 1I81A 2Y4YA 4A4GA 4BY6C 4OGCA 1HD3A 4C8QE 5L23A 4FYWB 3M0RA 3MO8A 1Q7YU 4F7UG 3OSVA 3L2ZA 3RR6A 4LUEA 1JU5C 5AT1B 3RUXA 1Q82U 1NPPA 4O6JA 4QVZA 1Q86C 2BZYA 2DM1A 4IURA 2J6KA 1PG5B 4XQ3A 2GTOA 4DOWA 1Q86R 3NMZC 1WYXA 1YJ9A 4MMKA 3OYKA 5GAOq 2P0PA 5KYYA 4KRTA 1UB4A 2G6FX 2XICA 3JCMd 1ZA1B 1H3HA 2KXDA 1LJOA 2K4YA 1D1BA 1K9AA 1IRXA 2NUPA 3VUBA 1WA7A 4C0FA 4HCKA 3TCJA 4DEYA 2MAMA 5GAN4 3WVEB 2LJ3A 3EHRA 1G3YA 4J8OA 2CUBA 2JJ9A 2JS2A 1OOTA 5GMKm 1R77A 4PLLA 3OS0A 1BK2A 4JS5A 3EG1A 1KSWA 2A0FB 4OMOA 3OBYA 1QWEA 1RAEB 2DTIA 2MMPA 3META 3PFSA 3BY7A 3LW5E 2DRMA 2O9SA 3AHUA 4LDUA 3M0SA 2DD5A 3ZFJA 2PNIA 4AT1B 1VQ4A 2C0OA 3HPWA 1KQSS 3OA6A 3JRZA 1W2BP 3EGUA 4HVVA 1BCMA 2XKOC 1M1KC 2KEAA 3HRUA 3NGPA 3WVDB 1UHFA 1ZUYA 1ZUKA 3CBMA 1M1KR 2M02A 3L2WA 3RKXA 4DBFA 2K3BA 4JS4A 4J9EA 2GQVA 2O2OA 4FIBA 2CDTA 3PTAA 3CCVT 3SWNA 1KC8U 4PKCC 1IHVA 2RK1A 1VIFA 2M1HA 5GAMj 2EGCA 1IXDA 1UHCA 5LJ3f 1R8OB 2RQWA 1Y0MA 1YBYA 1PC0A 1VQOQ 2OJ2A 2XHCA 1M4ZA 2L8DA 2M0OA 4J9FA 5CK9A 5KE2A 3P8BB 4ZN1A 5CR2A 2WSCE 2FZCB 2FZGB 1ABOA 1MMGA 5GAN2 2DL4A 3LLRA 1GFCA 1IGUA 4RCCA 3U23A 4NS5A 4FCYA 1WQ7A 1BKBA 1UE9A 2EKHA 3M55A 1ACMB 1G83A 3RBBB 2LJ1A 1RAGB 1O9SA 1NE8A 4ELZC 2ED1A 5DLQE 1YIJT 2ZCFB 3GF5A 3L2UA 1LCKA 2CZ1B 5LL6S 2E1HA 4X1VA 3OYJA 3T9NA 4M77A 3I9QA 3SEMA 5GANf 1N9RA 2VXFA 1U1TA 5GMKj 3HSBA 3P8DA 3UATA 2DZ9A 1WJQA 1QWFA 3M0UA 2GNCA 3QWYA 1SSFA 4DEXA 3CCQQ 1OX8A 4EDUA 2ZPHB 4M75A 2GTJA 2V1QA 2MF2A 2HD0A 3JB9H 2XDPA 3FB9A 3PE0A 4XTVA 1M1KU 3S3NA 2CUDA 1W2BS 1WHLA 1MHNA 2RQTA 6AT1B 2D6FA 4E7IA 2DETA 1K0SA 1M3CA 3MHXA 3OY9A 4FSXA 1K9MC 1VQ7Q 1AD5A 2CP5A 1SHGA 3MEAA 5A0LA 1K9MR 3CMAT 5CKHA 3MEUA 3MP1A 3FDRA 3CXCA 2YSQA 2QQ9A 3KXTA 1QKXA 5FU6C 5D6WA 4F7UA 1OYXA 2CH4A 1WJRA 1Y96A 4HCCA 1KFZA 2DD4A 2LMJA 4J9HA 2YUQA 3CC4T 2E12A 3CQTA 2LNHB 3OSSC 1FWZA 3HRSA 2QA4Q 2GQIA 2KSSA 1NG2A 2DVJA 1VQPT 4EMHA 4BE2A 2MYSA 4QT7A 1VQ9T 2X4XA 1VQNQ 1J3TA 4GLMA 3F70A 2AZVA 2AK5A 2KXCA 1Y07A 3SD4A 5IT9E 3J7AF 2LX9A 5GAMe 3DB3A 4M7DD 2YLCA 3CCSA 4KUDK 2OAWA 1TTHB 4FM4B 1YJWT 1Y71A 5FWCA 2ZPBB 2DF6A 5IHNA 2X35A 2XK0A 4Z8AA 3NPFA 3KBGA 2RPNA 1H92A 2KNBB 2LQKA 1VYUA 4N0AC 4C92F 1JEGA 5FW9A 3OMGA 1YI2Q 4C92C 4A4EA 3UF4A 1B34B 2M9UA 1VQOA 2JMCA 4K11A 4II1A 1OU9A 4HVUA 1UUEA 1VIEA 4ZGDB 5GAMh 5GAN3 4IUVA 1OI1A 3URGA 2X3WD 1BU1A 1BIBA 4R56A 2XD0A 2KT1A 4DOVA 4PJLA 3QSUA 2QAZA 4TVRA 2DTOA 3VUZA 3QYHB 2DYIA 1NEGA 4LDVA 1WHKA 1PRMC 4ZGJB 2ZPGB 4RTTA 4Z89A 3I56Q 1ZUUA 1NJIU 5FU6B 4PFOA 3TQ7P 1X01A 2XDDA 1RABB 2KI7A 2F5KA 3PT9A 2RD1A 5L8RE 2VC8A 3GP8A 2HEQA 1T3SA 1UDLA 3HTRA 2JOYA 4JJCA 1WHJA 2HSEB 3JCMP 1RACB 1U1SA 2EJ9A 2AZSA 3CC2T 3MKDA 2RNAA 5CKBA 2XG8D 2MOXA 4XTXA 5KCHA 3H0HA 2CGHA 3H6ZA 2K5FA 1RAFB 3ZBDA 2JUFA 5LJ5d 3REBB 5GMKh 4C92G 2NUZA 2JM9A 2RMOA 5IHIA 1M8MA 4C0DC 3OS1A 5CCAA 1YITT 5CO7A 2COWA 4F16A 4A54A 5GANg 3CPWP 1WPYA 3NHNA 3JCMe 2VB6A 5J3BA 1AVZC 3I55Q 4D6WA 1VQ7A 2ROTA 9ATCB 3CC7Q 4NL3A 2FB7A 3SFMA 2QI2A 2JS0A 2EGAA 1PRLC 4C92B 1WXTA 4CRIA 2QEXT 4BE1A 4BI8B 2EYWA 1FX7A 2OTLQ 2E5KA 2L5QA 5GAMg 4M77F 2HL5C 2CREA 5CQYA 2JMAA 2LNVA 4M77C 1FMWA 2CP7A 2RN8A 1KG1A 1UFFA 2A28A 4HA8A 1YWPA 1VQ6A 1VQNA 2EKOA 1IB8A 4WTOB 4M7DE 1KHIA 1Q81C 2DAQA 1T0JA 4AFQC 3GPLA 1M3AA 1RI0A 2DL8A 2DIQA 3JB9F 1XNIA 1BI0A 1Q81R 3OYAA 1M1GA 1TWBA 3FJ5A 4BUGA 2A36A 2HQXA 3TSWA 1N9SA 2MCNA 3PVLA 3HKSA 4RTUA 1K73C 3QZ5B 1MGQA 3JCMX 2DVEA 2CZ7B 2FHDA 5IXBA 2LT1A 4LD6A 3ULRB 1K73R 3V8KA 5IXFA 5GJWB 4L6V5 2CZ6B 1LPLA 4C0DB 3EFRA 4MZPA 4BACA 1WZOA 3C4SA 2KYMA 5GAOp 2AIRB 3CCUT 4Y28E 2EW3A 3QG1A 1ZSGA 2OI3A 3BW1A 1VQMT 1QVPA 1T0HA 2DJQA 1GCQC 2QQRA 1K76A 1JJ2P 1RUWA 2YRCA 2RB6A 2YDLA 3RDVA 5C0MA 3V8LA 2OX7A 2WSFE 4ESRA 4M77G 3UA6A 3VYGA 1X2KA 3I56A 2B86A 4OB1B 2I2LA 3JCMJ 3D7SB 3M57A 4N4HA 5GMKl 2KRSA 2ZGWA 3CPWS 1B34A 2X9HA 2L89A 1Z9QA 4YTLA 3C12A 3DLLA 4AG1C 3EFOB 4M75G 3V7RA 2F69A 2QGGA 1UTIA 1QW1A 4E7ZA 5A2QE 1GRIA 2VASA 4M4ZA 4JDSA 3JCMg 2E65A 2PVOB 3KUFA 1D0ZA 3HFNA 1QP2A 1YIJQ 4AFSC 1PNJA 1WI7A 3M56A 1NBEB 2Z0WA 4JUVA 4MZTA 4AG2C 2P4RA 1NLOC 4PJOE 1LVKA 4FW1A 4CI0C 4IUUA 1MV0B 4BE0A 1B3QA 3OMCA 2BTTA 1XTDA 1X75C 2X51A 3G4ST 1PD1A 5IH2A 3GIBA 1W1FA 1BBZA 3OS2A 2F1LA 3I55A 3VS0A 2MWPA 3CC7A 1V1CA 2EJFA 4JLGA 4X34A 3ME9A 4FL6A 1U8RA 5KYUA 5LJ5j 3LH0A 2F2VA 2PTKA 3X20B 1UGPB 1QCFA 1JO8A 4PJNA 1D0YA 2OTLA 1CSKA 4M7AF 2RJFA 2EAYA 4FYVB 4M78D 4M7AC 2RJCA 4C8QF 4WF2A 2KMTA 3UA7A 3QDRB 3C94A 3L2VA 4C8QC 4A4FA 2DBKA 3J80E 1HJDA 3UDCA 2GGRA 2BZ8A 4N0AA 1N6AA 3CCEA 1I1JA 3CC4Q 4C92A 3G71T 2L3PA 5GAOl 1IZ6A 3H0IA 4FU6A 1VQPQ 2LC4A 1BI1A 1JJ2S 1VQ9Q 5I21A 3V7SA 2KYBA 3CCRT 1YJ9T 3AT1B 3CPFA 4LD9K 1PKTA 3X24B 2MPXC 3NTIA 3RIRA 4A63B 2CS7A 5FU7C 5KE3A 1TG0A 4XU1A 1MNDA 3EG9B 2R5AA 4JRKA 1YJWQ 1HSQA 2EYQA 5J39A 4RTYA 2F2XA 3C95A 3VS7A 2LQWA 2PQWA 4DBQA 3OW2A 1YCYA 4HT8A 2LCCA 4HXJA 1M2VB 3Q1JA 4M7AG 4RG2A 3V8JA 4JZ3A 1OPKA 1TXQA 5CVIA 2HDAA 1M27C 2RA2A 1X27A 1VQ4T 4PJOB 2KRMA 4N4IA 1PKSA 2PVDB 1S1NA 4M7AB 1Q86U 5AYFA 2HMAA 3QJYA 4GBQA 2ZPIB 3LH5A 3QDFA 5CQXA 1YIJA 4C8QB 1VUBA 4LXCA 3VU3C 2O31A 1AEYA 3OYYA 1YJNA 4OMFB 2R58A 1QVFP 3QZ9B 1F1BB 2P0QA 2RF0A 5FRNA 1X6GA 4QVDA 2FO0A 4XTWA 2D8JA 3O8VA 2LX7A 3FRNA 2QQAA 3CCJQ 2QXFA 2E10A 2H8HA 3VKIA 5GMKi 5GAOm 2G3RA 2LQNA 2VGMA 1I07A 2HCKA 2LCLA 4HCZA 3CC2Q 2QTXA 4P5NA 3QWXX 1YHQQ 4OB2B 1WHHA 5LJ5e 3EFOA 2DILA 2QQSA 4IKFA 2JTMA 2EGEA 3BDLA 3NFCA 5FU7B 5J26A 4LE9A 3M4YA 1YITQ 2WACA 4D8KA 1R0BG 4E7LA 1ABQA 4KBMB 4J6XA 1UEBA 1ZX6A 4M78E 3GNFB 2KDSA 2IG0A 5DLOA 2E3HA 1V29B 4QQDA 4XU0A 5LJ5h 1HYOA 1SEMA 4KT0E 2OAUA 3LX7A 2A3LA 1CKBA 2QEXQ 4XTZA 4B6MA 4GLKA 3DB4A 4FT2A 5GAN5 1C1AA 1BB9A 5GAMf 2DXCA 1MMNA 2KQWA 3R6NA 2HBWA 2L3SA 3CC4A 3GLXA 1E6GA 3MPUB 3CD6T 3I5RA 2RQRA 5D6XA 1UGSB 5I2SA 2EWNA 4HKEA 4IUPA 1VQPA 2Y90A 3UT1A 1TS9A 2ZPFB 3JV3A 1EIFA 1VA7A 2A08A 2GCXA 1VQ9A 4J7FA 3EGXB 4J9CA 3M4GA 2RHZA 2O9VA 1KD1C 2JVVA 4M77D 2BE9B 5LJ3h 1GCQA 2F2WA 3EGDB 3KFVA 1SPKA 1KD1R 4QW2A 2FPEA 3E2UA 1GL5A 2F5TX 1JB0E 4ATOA 1WHGA 2ROLA 2LT4A 3G6EQ 3INZA 2K5LA 2WSEE 2EQMA 2CZ0B 4A4HA 4M75D 2LRQA 4O5VA 2LVMA 1RAAB 3R6OA 1G3TA 2XU8A 2PU9B 4IUQA 1TU0B 3BE3A 1QVFS 1ZQ1A 2EYYA 4IIMA 3MEWA 3M59A 3N5BB 4LUDA 1K8AC 2EYXA 3MJXA 3CCUQ 1K8AR 1VYTA 4Z88A 1GXIE 3EH2A 4XU2A 4XK8E 3EG9A 4J5YA 2DO3A 3JAME 4RKUE 4BI3A 2RH2A 1BCOA 2DERA 3CCMT 3O5ZA 1I0CA 2HBPA 4LDYA 4E7JA 1E6HA 1TUCA 2ED0A 1VQLT 1AWOA 3OYFA 4QVCA 4LDXA 3CCJA 3JCMf 2COYA 1VQ8T 2K3YA 1PD0A 2CP3A 4J9GA 3CCST 4BI4A 3UPUA 1AZEA 3CC2A 3QKJA 1GBRA 3M54A 4E7SA 1YHQA 1G2BA 4XTYA 2QDYB 2YUNA 5GMKe 3OQ5A 1UGRB 2BUDA 4EMKC 5CKDA 1NM7A 1K9MU 1S72Q 2C0IA 2MWOA 4M7AA 2GBQA 2JZ2A 1ZBXA 2DFUA 3G4SQ 4HVWA
chains in the Genus database with same CATH topology
2KROA 4J9IA 4E6RA 2EW3A 2K2MA 1ZSGA 2OI3A 2DRMA 1T3LA 2O9SA 1T0HA 2DJQA 1GCQC 1K76A 1AZGB 1RUWA 2YDLA 4RTXA 2K7AA 3M0SA 4OMMA 3GBQA 2PNIA 4ESRA 2C0OA 3UA6A 4D8DA 1X2KA 2B86A 2FPDA 1YNZA 1GBQA 3EGUA 3SHWA 1NEBA 4OMPA 4HVVA 1MV3A 2KRSA 2KEAA 3NGPA 2O88A 1WDXA 1YN8A 1UHFA 1FYNA 1ZUYA 1Z9QA 4ORZA 1ZUKA 4AG1C 1WXUA 1WLPB 1UTIA 1GRIA 4M4ZA 2K3BA 2YT6A 4J9EA 2O2OA 1QKWA 2CT3A 2X3XD 1YWOA 2CDTA 1UG1A 3H0FA 4AFSC 2KR3A 1PNJA 1WI7A 2DYBA 3EG3A 4AG2C 2P4RA 1NLOC 1WXBA 2AKLA 4RTWA 1SRLA 2W10A 1MV0B 1B3QA 2BTTA 1VYVA 1UGVA 5IH2A 1QLYA 3VS3A 1W1FA 2EGCA 1BBZA 1UHCA 1CKAA 2RQWA 1Y0MA 2ABLA 3VS0A 2LCSA 2OJ2A 2EPDA 1V1CA 1Y57A 4J9FA 3M0TA 5EC7A 3THKA 4EIKA 2VVKA 2F2VA 1RLQC 1ABOA 2EVRA 2PTKA 1Z9ZA 2DL4A 1GFCA 3EG0A 2D1XA 3U23A 2DL5A 1QCFA 5ECAA 1JO8A 1UE9A 2EKHA 1CSKA 1G83A 1OPLA 3RBBB 2LJ1A 2LP5A 4R0KA 2DNUA 2AKKA 3PVQA 2ED1A 2L0AA 2KT8A 1LCKA 3UA7A 2CSIA 1OV3A 2DBKA 4X1VA 1AOJA 3I9QA 3SEMA 1HJDA 2GGRA 2BZ8A 1I1JA 4CC4B 3RNJA 3UATA 2NWMA 1QWFA 2VWFA 1WIEA 1IO6A 1AWJA 2L3PA 3M0UA 2GNCA 3QWYA 1K0XA 3EHQA 2KGTA 4DEXA 3H0IA 1JXMA 1ARKA 2GTJA 2V1QA 4FSSA 4OMLA 2IIMA 1H8KA 2KYBA 1PKTA 3PE0A 1YP5A 4A63B 2JM8A 4OMQA 4AFZC 1ZBJA 2CUDA 4JPBW 2K79A 2RQTA 1TG0A 2ESWA 1K0SA 1M3CA 2RQVA 2JT4A 1HSQA 1AD5A 2RQUA 2KE9A 3VS5A 1SHGA 1NLPC 4RTYA 2DE0X 2F2XA 2YUPA 1N5ZA 3VS7A 2YSQA 2LQWA 1QKXA 4HXJA 2C0TA 2CH4A 1SHFA 3EG2A 2DX1A 1KFZA 1OEBA 4JZ3A 1OPKA 4OMNA 2LMJA 4J9HA 4JZ4A 1EFNA 5FWBA 2YUQA 3CQTA 3VRYA 2LNHB 2HDAA 1M27C 2GQIA 1NG2A 1X27A 2DVJA 2KRMA 4QT7A 1J3TA 1PKSA 3VS2A 1B07A 2D8HA 1S1NA 3VS4A 4GLMA 2AZVA 4GBQA 2AK5A 1X2QA 2KXCA 3LH5A 3ZL7C 1K1ZA 1AEYA 2O31A 2EQIA 2OAWA 4JJDA 2RF0A 1X6GA 2J6FA 2FO0A 1W6XA 2D8JA 5FWCA 2DF6A 2LX7A 5IHNA 1U3OA 1W70A 1SRMA 3NPFA 4Z8AA 2RPNA 2H8HA 3I5SA 1H92A 2KNBB 2LQNA 2M51A 1VYUA 1JEGA 1I07A 2HCKA 2J05A 5FW9A 1X6BA 4J9DA 1GFDA 4RTZA 1MUZA 3UF4A 3QWXX 2JMCA 4K11A 2XMFA 5I11A 1U06A 2DILA 2SRCA 1GCPA 4HVUA 2EGEA 1UUEA 1E7OA 2K9GA 2L3QA 5IHKA 2CH4W 2X3WD 2A37A 1BU1A 1AWWA 2ECZA 4LE9A 2KT1A 4ZNXA 4D8KA 1ABQA 2DL7A 3IQLA 2FRWA 1KJWA 4IIOA 4AFUC 1ZX6A 3VRZA 2FG0A 3I35A 4WCIA 1NEGA 2KRNA 3TSZA 2CT4A 1PRMC 3VS6A 4CC3A 4RTTA 2M0YA 4Z89A 2JTEA 1SSHA 4LNPA 1ZUUA 1SEMA 1CKBA 5HCKA 1PHTA 1RLPC 2LJ0A 2EYZA 2KBTA 2MIOA 1BB9A 1PWTA 3C0CA 3R6NA 2HEQA 1NYFA 2HBWA 1T3SA 1UDLA 2L3SA 1ZLMA 4JJCA 1UECA 1E6GA 2AZSA 2FEIA 3I5RA 2RQRA 4F17A 3M0PA 2RNAA 2YUOA 5GJVB 1XOVA 2DBMA 1YCSB 2D0NA 1KIKA 1M30A 2I0NA 2MOXA 2J06A 3H0HA 3JV3A 1VA7A 2A08A 2JXBA 2V1RA 4J9CA 4RTVA 2PZ1A 3REBB 2DA9A 2JM9A 2NUZA 2O9VA 2RMOA 2BZXA 5IHIA 1K4US 1M8MA 1WX6A 1GCQA 4F16A 2F2WA 3KFVA 1SPKA 3TVTA 4LN2A 3NHNA 2FPEA 2DRKA 1GL5A 1JXOA 1AVZC 3REAB 3M0QA 2ROLA 4F14A 1JQQA 2CSQA 2ROTA 2EBPA 1RI9A 2DL3A 2JS0A 2EGAA 1FMKA 1UJ0A 1PRLC 2FPFA 1WXTA 3VS1A 2SEMA 2LZ6B 2J6OA 4CC7A 2EYWA 2ENMA 2EYYA 5I22A 2DLPA 4IIMA 2K6DA 2E5KA 4LUDA 2CREA 1UJYA 1HD3A 1NYGA 1AWXA 2JMAA 5L23A 2EYXA 3M0RA 2RN8A 1VYTA 3A98A 4Z88A 1UFFA 4Y92A 4LUEA 1JU5C 1X69A 2A28A 1YWPA 2W0ZA 4CC2A 1U5SA 3H41A 2BZYA 2DM1A 1T0JA 2J6KA 4AFQC 4RUGA 1M3AA 2DL8A 1M3BA 2JW4A 2QDLA 2GTOA 3NMZC 3O5ZA 1WYXA 1I0CA 4J9BA 1WFWA 3FJ5A 1E6HA 4KRTA 2A36A 2G6FX 1TUCA 2ED0A 1AWOA 1H3HA 2KXDA 3TSWA 2FRYA 1A0NB 1K9AA 2MCNA 3PVLA 4RTUA 1WA7A 2L2PA 4J9GA 1X43A 4HCKA 4JJBA 1AZEA 4DEYA 5IXBA 2VKNA 1GBRA 3ULRB 2LJ3A 1G2BA 2DMOA 3EHRA 2CUBA 5IXFA 5GJWB 2J7IA 2YUNA 2JS2A 1OOTA 1NM7A 1BK2A 2C0IA 3EG1A 1KSWA 2GBQA 4OMOA 2HSPA 1QWEA 1TUDA 2KYMA 4HVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRO A;  4J9I A;  4E6R A;  2EW3 A;  2K2M A;  1ZSG A;  2OI3 A;  2DRM A;  1T3L A;  2O9S A;  1T0H A;  2DJQ A;  1GCQ C;  1K76 A;  1AZG B;  1RUW A;  2YDL A;  4RTX A;  2K7A A;  3M0S A;  4OMM A;  3GBQ A;  2PNI A;  4ESR A;  2C0O A;  3UA6 A;  4D8D A;  1X2K A;  2B86 A;  2FPD A;  1YNZ A;  1GBQ A;  3EGU A;  3SHW A;  1NEB A;  4OMP A;  4HVV A;  1MV3 A;  2KRS A;  2KEA A;  3NGP A;  2O88 A;  1WDX A;  1YN8 A;  1UHF A;  1FYN A;  1ZUY A;  1Z9Q A;  4ORZ A;  1ZUK A;  4AG1 C;  1WXU A;  1WLP B;  1UTI A;  1GRI A;  4M4Z A;  2K3B A;  2YT6 A;  4J9E A;  2O2O A;  1QKW A;  2CT3 A;  2X3X D;  1YWO A;  2CDT A;  1UG1 A;  3H0F A;  4AFS C;  2KR3 A;  1PNJ A;  1WI7 A;  2DYB A;  3EG3 A;  4AG2 C;  2P4R A;  1NLO C;  1WXB A;  2AKL A;  4RTW A;  1SRL A;  2W10 A;  1MV0 B;  1B3Q A;  2BTT A;  1VYV A;  1UGV A;  5IH2 A;  1QLY A;  3VS3 A;  1W1F A;  2EGC A;  1BBZ A;  1UHC A;  1CKA A;  2RQW A;  1Y0M A;  2ABL A;  3VS0 A;  2LCS A;  2OJ2 A;  2EPD A;  1V1C A;  1Y57 A;  4J9F A;  3M0T A;  5EC7 A;  3THK A;  4EIK A;  2VVK A;  2F2V A;  1RLQ C;  1ABO A;  2EVR A;  2PTK A;  1Z9Z A;  2DL4 A;  1GFC A;  3EG0 A;  2D1X A;  3U23 A;  2DL5 A;  1QCF A;  5ECA A;  1JO8 A;  1UE9 A;  2EKH A;  1CSK A;  1G83 A;  1OPL A;  3RBB B;  2LJ1 A;  2LP5 A;  4R0K A;  2DNU A;  2AKK A;  3PVQ A;  2ED1 A;  2L0A A;  2KT8 A;  1LCK A;  3UA7 A;  2CSI A;  1OV3 A;  2DBK A;  4X1V A;  1AOJ A;  3I9Q A;  3SEM A;  1HJD A;  2GGR A;  2BZ8 A;  1I1J A;  4CC4 B;  3RNJ A;  3UAT A;  2NWM A;  1QWF A;  2VWF A;  1WIE A;  1IO6 A;  1AWJ A;  2L3P A;  3M0U A;  2GNC A;  3QWY A;  1K0X A;  3EHQ A;  2KGT A;  4DEX A;  3H0I A;  1JXM A;  1ARK A;  2GTJ A;  2V1Q A;  4FSS A;  4OML A;  2IIM A;  1H8K A;  2KYB A;  1PKT A;  3PE0 A;  1YP5 A;  4A63 B;  2JM8 A;  4OMQ A;  4AFZ C;  1ZBJ A;  2CUD A;  4JPB W;  2K79 A;  2RQT A;  1TG0 A;  2ESW A;  1K0S A;  1M3C A;  2RQV A;  2JT4 A;  1HSQ A;  1AD5 A;  2RQU A;  2KE9 A;  3VS5 A;  1SHG A;  1NLP C;  4RTY A;  2DE0 X;  2F2X A;  2YUP A;  1N5Z A;  3VS7 A;  2YSQ A;  2LQW A;  1QKX A;  4HXJ A;  2C0T A;  2CH4 A;  1SHF A;  3EG2 A;  2DX1 A;  1KFZ A;  1OEB A;  4JZ3 A;  1OPK A;  4OMN A;  2LMJ A;  4J9H A;  4JZ4 A;  1EFN A;  5FWB A;  2YUQ A;  3CQT A;  3VRY A;  2LNH B;  2HDA A;  1M27 C;  2GQI A;  1NG2 A;  1X27 A;  2DVJ A;  2KRM A;  4QT7 A;  1J3T A;  1PKS A;  3VS2 A;  1B07 A;  2D8H A;  1S1N A;  3VS4 A;  4GLM A;  2AZV A;  4GBQ A;  2AK5 A;  1X2Q A;  2KXC A;  3LH5 A;  3ZL7 C;  1K1Z A;  1AEY A;  2O31 A;  2EQI A;  2OAW A;  4JJD A;  2RF0 A;  1X6G A;  2J6F A;  2FO0 A;  1W6X A;  2D8J A;  5FWC A;  2DF6 A;  2LX7 A;  5IHN A;  1U3O A;  1W70 A;  1SRM A;  3NPF A;  4Z8A A;  2RPN A;  2H8H A;  3I5S A;  1H92 A;  2KNB B;  2LQN A;  2M51 A;  1VYU A;  1JEG A;  1I07 A;  2HCK A;  2J05 A;  5FW9 A;  1X6B A;  4J9D A;  1GFD A;  4RTZ A;  1MUZ A;  3UF4 A;  3QWX X;  2JMC A;  4K11 A;  2XMF A;  5I11 A;  1U06 A;  2DIL A;  2SRC A;  1GCP A;  4HVU A;  2EGE A;  1UUE A;  1E7O A;  2K9G A;  2L3Q A;  5IHK A;  2CH4 W;  2X3W D;  2A37 A;  1BU1 A;  1AWW A;  2ECZ A;  4LE9 A;  2KT1 A;  4ZNX A;  4D8K A;  1ABQ A;  2DL7 A;  3IQL A;  2FRW A;  1KJW A;  4IIO A;  4AFU C;  1ZX6 A;  3VRZ A;  2FG0 A;  3I35 A;  4WCI A;  1NEG A;  2KRN A;  3TSZ A;  2CT4 A;  1PRM C;  3VS6 A;  4CC3 A;  4RTT A;  2M0Y A;  4Z89 A;  2JTE A;  1SSH A;  4LNP A;  1ZUU A;  1SEM A;  1CKB A;  5HCK A;  1PHT A;  1RLP C;  2LJ0 A;  2EYZ A;  2KBT A;  2MIO A;  1BB9 A;  1PWT A;  3C0C A;  3R6N A;  2HEQ A;  1NYF A;  2HBW A;  1T3S A;  1UDL A;  2L3S A;  1ZLM A;  4JJC A;  1UEC A;  1E6G A;  2AZS A;  2FEI A;  3I5R A;  2RQR A;  4F17 A;  3M0P A;  2RNA A;  2YUO A;  5GJV B;  1XOV A;  2DBM A;  1YCS B;  2D0N A;  1KIK A;  1M30 A;  2I0N A;  2MOX A;  2J06 A;  3H0H A;  3JV3 A;  1VA7 A;  2A08 A;  2JXB A;  2V1R A;  4J9C A;  4RTV A;  2PZ1 A;  3REB B;  2DA9 A;  2JM9 A;  2NUZ A;  2O9V A;  2RMO A;  2BZX A;  5IHI A;  1K4U S;  1M8M A;  1WX6 A;  1GCQ A;  4F16 A;  2F2W A;  3KFV A;  1SPK A;  3TVT A;  4LN2 A;  3NHN A;  2FPE A;  2DRK A;  1GL5 A;  1JXO A;  1AVZ C;  3REA B;  3M0Q A;  2ROL A;  4F14 A;  1JQQ A;  2CSQ A;  2ROT A;  2EBP A;  1RI9 A;  2DL3 A;  2JS0 A;  2EGA A;  1FMK A;  1UJ0 A;  1PRL C;  2FPF A;  1WXT A;  3VS1 A;  2SEM A;  2LZ6 B;  2J6O A;  4CC7 A;  2EYW A;  2ENM A;  2EYY A;  5I22 A;  2DLP A;  4IIM A;  2K6D A;  2E5K A;  4LUD A;  2CRE A;  1UJY A;  1HD3 A;  1NYG A;  1AWX A;  2JMA A;  5L23 A;  2EYX A;  3M0R A;  2RN8 A;  1VYT A;  3A98 A;  4Z88 A;  1UFF A;  4Y92 A;  4LUE A;  1JU5 C;  1X69 A;  2A28 A;  1YWP A;  2W0Z A;  4CC2 A;  1U5S A;  3H41 A;  2BZY A;  2DM1 A;  1T0J A;  2J6K A;  4AFQ C;  4RUG A;  1M3A A;  2DL8 A;  1M3B A;  2JW4 A;  2QDL A;  2GTO A;  3NMZ C;  3O5Z A;  1WYX A;  1I0C A;  4J9B A;  1WFW A;  3FJ5 A;  1E6H A;  4KRT A;  2A36 A;  2G6F X;  1TUC A;  2ED0 A;  1AWO A;  1H3H A;  2KXD A;  3TSW A;  2FRY A;  1A0N B;  1K9A A;  2MCN A;  3PVL A;  4RTU A;  1WA7 A;  2L2P A;  4J9G A;  1X43 A;  4HCK A;  4JJB A;  1AZE A;  4DEY A;  5IXB A;  2VKN A;  1GBR A;  3ULR B;  2LJ3 A;  1G2B A;  2DMO A;  3EHR A;  2CUB A;  5IXF A;  5GJW B;  2J7I A;  2YUN A;  2JS2 A;  1OOT A;  1NM7 A;  1BK2 A;  2C0I A;  3EG1 A;  1KSW A;  2GBQ A;  4OMO A;  2HSP A;  1QWE A;  1TUD A;  2KYM A;  4HVW A; 
#chains in the Genus database with same CATH topology
 2KRO A;  2YWW A;  1YIT A;  4E6R A;  4C8Q A;  5HKC A;  1KQS A;  2DEQ A;  5KYX B;  1T3L A;  3JB9 I;  5CKE A;  5DM7 R;  4ZGE B;  1AZG B;  2K7A A;  1OX9 A;  3GBQ A;  2KVQ G;  3CCQ A;  3RMQ A;  4QKU A;  3G7Z A;  2KK4 A;  4D8D A;  5M9O A;  1G3S A;  4FW2 A;  2FPD A;  1IGQ A;  1YNZ A;  5GAN 8;  1N8R C;  4GY5 A;  3RES A;  1NEB A;  4C5E A;  2QEX A;  1RL2 A;  2O88 A;  3JSC A;  1N8R R;  3CME T;  1HK9 A;  1RAI B;  4L5G A;  4NL2 A;  1WXU A;  5FRM A;  1WLP B;  4B9W A;  1OUL A;  2YT6 A;  4OF1 A;  1YWO A;  2H3E B;  5KYY B;  5KYN A;  1VQK T;  4X9C A;  4OB0 B;  3J81 E;  2DYB A;  1WXB A;  3WXM B;  4DBR A;  4DQ2 A;  1X6O A;  3CXC P;  2GF7 A;  2V8I A;  2DXB A;  3JCM c;  1VYV A;  1I4K 1;  5LJ3 d;  3PMT A;  1PSE A;  1JBM A;  3JCM W;  3BFM A;  1CKA A;  2FVU A;  3G71 Q;  3DLM A;  4M75 E;  2ABL A;  3LWI A;  3OYM A;  2QA4 A;  2RM4 A;  3LGL A;  3G6E A;  2EPD A;  1Y57 A;  3CCR Q;  3THK A;  1NPR A;  2VVK A;  1Z9Z A;  3EG0 A;  1EX4 A;  2D1X A;  4EMK B;  2BIV A;  4OVA A;  3EGX A;  4HCB A;  2Y4X A;  3CBP A;  1OPL A;  2HL3 A;  2LP5 A;  4R0K A;  3PVQ A;  2L0A A;  4NOY A;  3EGD A;  1Q7Y C;  3PNW C;  1ZHI A;  4F7U E;  3TEE A;  1Q7Y R;  5GAN d;  1QVG A;  2CYZ B;  1YI2 A;  1Q82 C;  1AOJ A;  2PUK B;  4PK4 A;  3EAE A;  3CCV Q;  2X4Y A;  1Q82 R;  4M7D F;  2RHU A;  4J6W A;  4CC4 B;  3A1P A;  4M7D C;  3SWN B;  2OTJ T;  2NWM A;  1AWJ A;  1VQ6 T;  3EHQ A;  2KGT A;  1VQ4 Q;  3L2Q A;  1W2B A;  3A8G B;  4XAX B;  1N27 A;  4JRI A;  3QUI A;  2JM8 A;  2NUT B;  3TU4 K;  1D09 B;  1W4S A;  2QQB A;  2R5M A;  4XU3 A;  1FXX A;  2ESW A;  1OZ2 A;  2L3R A;  4X9D A;  2FYK A;  4E7H A;  1S72 A;  2RQU A;  3CEY A;  2VYT A;  1P92 A;  2RHY A;  4C5I A;  2DE0 X;  3G4S A;  2EIF A;  3JB9 G;  1VQ5 T;  2IVW A;  3A8H B;  1I5O B;  4MML A;  2C0T A;  1SHF A;  2E5Q A;  2EQU A;  3EG2 A;  2M16 A;  2DX1 A;  4MZM A;  1OEB A;  2QYZ A;  3MP8 A;  3CXC S;  4DA4 A;  2O4X B;  5FWB A;  2RI3 A;  3VRY A;  2P4T A;  1M2O A;  2DK3 A;  2VGN A;  3VJP A;  3G1J A;  4Q5W A;  3OS5 A;  1RAD B;  2RJE A;  2XDB A;  4KGZ B;  1B07 A;  3VS4 A;  2QTV A;  3RKW A;  1Q81 U;  1X2Q A;  1LOJ A;  2K3X A;  5KYX A;  4ELY C;  3CCL T;  1K1Z A;  2DXT A;  2EQI A;  1MNE A;  2CP0 A;  3NTH A;  4B9X A;  2LQ8 A;  4JJD A;  2HZY A;  2EQJ A;  1KC8 C;  1QCN A;  4R55 A;  1W6X A;  2NLU A;  4PJO F;  4FYX B;  1QCO A;  5KH6 A;  3FIF A;  1KC8 R;  1SRM A;  2E3I A;  3I5S A;  4M7D B;  4PJO C;  2M51 A;  1K73 U;  5GAO r;  2J05 A;  1X6B A;  4J9D A;  1GFD A;  3G71 A;  3CD6 Q;  3VV0 A;  4PLI A;  3CMA Q;  1U06 A;  5I2M A;  1GCP A;  2YLB A;  4KH1 B;  4QQ6 A;  3JCM Q;  3X25 B;  3CCR A;  1E7O A;  2ATC B;  2YRD A;  8ATC B;  3DKM A;  3A8O B;  3I55 T;  5A0G A;  4F7U B;  1Y96 B;  5LJ3 j;  3CC7 T;  3UWN A;  2FRW A;  4IIO A;  2MK5 A;  3I35 A;  3V7C A;  2KRN A;  3JCM b;  5C6S A;  5A0D A;  1QP3 A;  3VS6 A;  4CC3 A;  2EFI A;  1LNX A;  2M0Y A;  1ZSZ C;  1SSH A;  1H64 1;  4LNP A;  2CP6 A;  5CIU A;  5HCK A;  1PHT A;  1C6V X;  2OTL T;  3PIP A;  1RLP C;  2LJ0 A;  1QVG P;  3OYC A;  2MIO A;  3CCV A;  3OB9 A;  3OYL A;  3C0C A;  2DXU A;  1NYF A;  1ZLM A;  3MCA B;  1V76 A;  3E1S A;  2FL7 A;  4F17 A;  3M0P A;  4Z02 A;  2RO0 A;  5GJV B;  1XOV A;  2DBM A;  4EMK A;  2D0N A;  4AMC A;  5FLX E;  1KIK A;  1M30 A;  1G3W A;  2GFU A;  4PJO G;  2J06 A;  3CCE T;  2XI9 A;  2JXB A;  4A4K A;  4RTV A;  1QMC A;  5GAN j;  4ZN3 A;  4RCB A;  3A5Z B;  2BZX A;  5LJ5 f;  1K4U S;  2ZAE A;  2PUO B;  1KQ1 A;  3CCM Q;  1TSF A;  4C8Q G;  2V8K A;  4BY6 B;  4C92 D;  3M0Q A;  1VQL Q;  1EZZ B;  4F14 A;  4J83 A;  1JQQ A;  1QQJ A;  1D3B B;  5D6Y A;  2MI6 A;  2DL3 A;  5HK0 A;  1OZ3 A;  3HP9 A;  1VQ8 Q;  1FMK A;  3CCS Q;  2CP2 A;  2E70 A;  2RHX A;  2FPF A;  3VS1 A;  2J6O A;  3M58 A;  2HQE A;  4PFZ A;  2DJZ A;  4PNO A;  3FC3 A;  4DBH A;  1BYM A;  2K6D A;  3SDZ A;  3GOX A;  1UJY A;  1NYG A;  1AWX A;  2QK0 A;  2NUT A;  1SKU B;  3S3O A;  3A98 A;  4Y92 A;  5HY6 A;  1X69 A;  1M5Q 1;  2W0Z A;  1KHC A;  1UGQ B;  2DKG A;  4CC2 A;  2AT1 B;  1U5S A;  3H41 A;  1ZSZ B;  3M5A A;  4RUG A;  3OYI A;  1M3B A;  2JN0 A;  2JW4 A;  2QDL A;  4J9B A;  5HK3 A;  2RI2 A;  1WFW A;  1R0C B;  3CME Q;  2ZPE B;  3S3M A;  2P0K A;  1O75 A;  2FRY A;  1A0N B;  1I8F A;  2O4X A;  2ZZD A;  1SG5 A;  1YJN T;  2L2P A;  1X43 A;  5DY9 A;  1PM3 A;  4JJB A;  1JRI A;  3CD6 A;  2VKN A;  2EQK A;  1VQK Q;  2DMO A;  3CMA A;  2J7I A;  3HHT B;  3H8Z A;  5LJ3 e;  1QVG S;  2HSP A;  1WGS A;  4BD3 A;  2PVG B;  1TUD A;  2JTE A;  5KYW B;  4J9I A;  1D1A A;  4RMO A;  1Q95 G;  2K2M A;  3OYG A;  2RK2 A;  1SF9 A;  2DEU A;  1WNL A;  4RTX A;  3ER0 A;  4OMM A;  4M78 F;  3CPW A;  4PJJ A;  2E4H A;  1BIA A;  4M7D A;  4M78 C;  2DPP B;  2X4W A;  1NJI C;  1GBQ A;  3SHW A;  4OMP A;  1MV3 A;  2E41 A;  2H3J A;  3OBW A;  1NJI R;  1TUG B;  1WDX A;  1YN8 A;  2HKN A;  3QPH A;  1FYN A;  4ORZ A;  1M8V A;  3OYN A;  1YJW A;  1XJW B;  4QQG A;  1QKW A;  3S6W A;  2CT3 A;  4KGX B;  2X3X D;  3H0F A;  1UG1 A;  5GAN e;  3VYH B;  4ME7 A;  2KR3 A;  4C5H A;  3L1A A;  3OYH A;  2D0Q B;  3QO3 A;  4PL6 A;  3EG3 A;  4LDW A;  3JB9 D;  3NTK A;  2AKL A;  4RTW A;  1SRL A;  2XID A;  3EH1 A;  3EFS A;  3OW2 P;  2W10 A;  1I5L A;  3E9G A;  4C92 E;  2RI5 A;  1UGV A;  4V2S A;  3CCM A;  2YHT A;  5CAI A;  1QLY A;  3VS3 A;  2OTJ Q;  3E9F A;  1Y7X A;  3MP6 A;  1VQ6 Q;  4VUB A;  5D7U A;  2VXE A;  2LCS A;  1VQL A;  1VQM Q;  2IPO B;  4OP0 A;  3RMS A;  3M0T A;  4MDW A;  5GAN h;  2QG9 B;  5EC7 A;  1VQ8 A;  2E6N A;  4EIK A;  1RLQ C;  4OB3 B;  2EVR A;  4Y91 A;  2A7Y A;  1AT1 B;  5LJ5 g;  4M78 G;  5KCO A;  2DL5 A;  1TOV A;  5ECA A;  2RHI A;  2FZK B;  1M2V A;  3HL8 A;  1DJ7 B;  2DNU A;  2AKK A;  3BDU A;  2KT8 A;  3OYD A;  1HXD A;  2CSI A;  1OV3 A;  2E64 A;  4BB7 A;  1VQ5 Q;  3TRE A;  1KK7 A;  4C0Z A;  1WQW A;  2VV5 A;  2NYS A;  4M78 B;  1D3B A;  2DZC A;  4PJO A;  1JJ2 A;  3OYE A;  2CKK A;  3RNJ A;  3PMI A;  2VWF A;  1WIE A;  4UC4 A;  1IO6 A;  2DIG A;  1K0X A;  3LWH A;  5LJ3 g;  3CME A;  1VQO T;  1JXM A;  4JLI A;  1ARK A;  3A8L B;  4FSS A;  3RKY A;  4OML A;  4L59 A;  3QII A;  1B7T A;  2IIM A;  1H8K A;  3X26 B;  1NZ9 A;  1VOM A;  5IAY A;  1KD1 U;  1YP5 A;  4OMQ A;  5EG2 A;  4AFZ C;  3HFO A;  1ZBJ A;  1PSF A;  4ZTJ A;  4JPB W;  3CCL Q;  3LGF A;  1VQK A;  2K79 A;  4HT9 A;  4FYY B;  2VUB A;  4PFP A;  3CCJ T;  3X28 B;  1FMV A;  1BI2 A;  3SWN C;  2RQV A;  2JT4 A;  2EJG A;  1M9S A;  4XTU A;  1ZSZ A;  5KYU B;  2KE9 A;  2HAX A;  1WHM A;  3VS5 A;  1NLP C;  3JCM V;  1YHQ T;  4KUI A;  2YUP A;  4E2F B;  1N5Z A;  4RG8 A;  1XQH A;  4ANJ A;  4F04 B;  3FEO A;  4M77 E;  1OQK A;  5FRO A;  4OMN A;  4PJO D;  2NUP B;  2DTH A;  4JZ4 A;  4N4G A;  1EFN A;  1G8X A;  3OW2 S;  1K8A U;  2K57 A;  4A53 A;  2D9T A;  1OU8 A;  3QXE B;  4M7A D;  2HNI A;  4KGV B;  3E19 A;  3CCQ T;  7AT1 B;  2B8A A;  3H9N A;  3FJP A;  4C8Q D;  1M90 C;  5GAN 7;  3L42 A;  3QYG B;  2O01 E;  1M1F A;  3QHS A;  3VS2 A;  2HKQ B;  2D8H A;  1M90 R;  4ZTF A;  1D1C A;  1BI3 A;  5KYW A;  5CKF A;  1WJS A;  2QGF B;  3P8H A;  3PGG A;  3ZL7 C;  2K5I A;  1YJ9 Q;  2R57 A;  1PCX A;  1MMD A;  2YXY A;  2J6F A;  3JCM h;  1VQ7 T;  1U3O A;  1W70 A;  5GAN 6;  3PIO A;  4PJM A;  2HQH A;  2OTJ A;  2GFA A;  4RTZ A;  1MUZ A;  3FLG A;  4JJN K;  4M75 F;  3CCU A;  2XMF A;  5I11 A;  4E47 A;  2V26 A;  1VQM A;  4KUL A;  8AT1 B;  2SRC A;  3CCE Q;  4M75 C;  3MEV A;  3ZEH A;  2K9G A;  2L3Q A;  3OYB A;  3A8M B;  3L2R A;  5IHK A;  2CH4 W;  2A37 A;  1AWW A;  2ECZ A;  1D0X A;  2QA4 T;  4ZNX A;  3G6E T;  2DL7 A;  3IQL A;  1KJW A;  4AFU C;  3VRZ A;  2FG0 A;  3LYI A;  4WCI A;  1VQN T;  3TSZ A;  2CT4 A;  4E7K A;  1H3Z A;  1N8R U;  4EPC A;  4OGE A;  4EMG A;  1G5V A;  1VQ5 A;  1IRE B;  5IN1 A;  4F7U F;  2BE7 D;  5GAM d;  2EYZ A;  2KBT A;  1TH7 A;  3CBO A;  4JRP A;  1PWT A;  3RER A;  4FT4 A;  3QBY A;  1UEC A;  1YI2 T;  2FEI A;  2YUO A;  2COZ A;  4JRQ A;  1YCS B;  2I0N A;  2KAF A;  3JB9 J;  4J6Y A;  1KQS P;  2E6Z A;  3ASK A;  1MMA A;  2P84 A;  2V1R A;  2PZ1 A;  4BDZ A;  2DA9 A;  3M53 A;  1WX6 A;  1ZA2 B;  4BDY A;  3QJ6 A;  3TVT A;  4LN2 A;  2LTO A;  3CCL A;  4KH0 B;  2KY9 A;  2RJD A;  1M90 U;  2DRK A;  2V8J A;  4IUT A;  1AHJ B;  3M9Q A;  1JXO A;  3REA B;  4C5G A;  1IHW A;  2JTF A;  2X4J A;  3GNG A;  1KQ2 A;  4M78 A;  4M77 B;  1C0M A;  2CSQ A;  2K2V A;  2EBP A;  1RI9 A;  2QAS A;  2LDM A;  3I56 T;  4MDX A;  1QVF A;  4M7D G;  1YJN Q;  1UJ0 A;  2BKD N;  2C06 A;  2SEM A;  2LZ6 B;  4CC7 A;  2YRV A;  4C0G A;  1S72 T;  2JNG A;  1RAH B;  4M75 B;  2AHJ B;  3HRT A;  4J7I A;  3SB2 A;  5GAO n;  2ENM A;  4M7A E;  5I22 A;  1YFN A;  2DLP A;  1I81 A;  2Y4Y A;  4A4G A;  4BY6 C;  4OGC A;  1HD3 A;  4C8Q E;  5L23 A;  4FYW B;  3M0R A;  3MO8 A;  1Q7Y U;  4F7U G;  3OSV A;  3L2Z A;  3RR6 A;  4LUE A;  1JU5 C;  5AT1 B;  3RUX A;  1Q82 U;  1NPP A;  4O6J A;  4QVZ A;  1Q86 C;  2BZY A;  2DM1 A;  4IUR A;  2J6K A;  1PG5 B;  4XQ3 A;  2GTO A;  4DOW A;  1Q86 R;  3NMZ C;  1WYX A;  1YJ9 A;  4MMK A;  3OYK A;  5GAO q;  2P0P A;  5KYY A;  4KRT A;  1UB4 A;  2G6F X;  2XIC A;  3JCM d;  1ZA1 B;  1H3H A;  2KXD A;  1LJO A;  2K4Y A;  1D1B A;  1K9A A;  1IRX A;  2NUP A;  3VUB A;  1WA7 A;  4C0F A;  4HCK A;  3TCJ A;  4DEY A;  2MAM A;  5GAN 4;  3WVE B;  2LJ3 A;  3EHR A;  1G3Y A;  4J8O A;  2CUB A;  2JJ9 A;  2JS2 A;  1OOT A;  5GMK m;  1R77 A;  4PLL A;  3OS0 A;  1BK2 A;  4JS5 A;  3EG1 A;  1KSW A;  2A0F B;  4OMO A;  3OBY A;  1QWE A;  1RAE B;  2DTI A;  2MMP A;  3MET A;  3PFS A;  3BY7 A;  3LW5 E;  2DRM A;  2O9S A;  3AHU A;  4LDU A;  3M0S A;  2DD5 A;  3ZFJ A;  2PNI A;  4AT1 B;  1VQ4 A;  2C0O A;  3HPW A;  1KQS S;  3OA6 A;  3JRZ A;  1W2B P;  3EGU A;  4HVV A;  1BCM A;  2XKO C;  1M1K C;  2KEA A;  3HRU A;  3NGP A;  3WVD B;  1UHF A;  1ZUY A;  1ZUK A;  3CBM A;  1M1K R;  2M02 A;  3L2W A;  3RKX A;  4DBF A;  2K3B A;  4JS4 A;  4J9E A;  2GQV A;  2O2O A;  4FIB A;  2CDT A;  3PTA A;  3CCV T;  3SWN A;  1KC8 U;  4PKC C;  1IHV A;  2RK1 A;  1VIF A;  2M1H A;  5GAM j;  2EGC A;  1IXD A;  1UHC A;  5LJ3 f;  1R8O B;  2RQW A;  1Y0M A;  1YBY A;  1PC0 A;  1VQO Q;  2OJ2 A;  2XHC A;  1M4Z A;  2L8D A;  2M0O A;  4J9F A;  5CK9 A;  5KE2 A;  3P8B B;  4ZN1 A;  5CR2 A;  2WSC E;  2FZC B;  2FZG B;  1ABO A;  1MMG A;  5GAN 2;  2DL4 A;  3LLR A;  1GFC A;  1IGU A;  4RCC A;  3U23 A;  4NS5 A;  4FCY A;  1WQ7 A;  1BKB A;  1UE9 A;  2EKH A;  3M55 A;  1ACM B;  1G83 A;  3RBB B;  2LJ1 A;  1RAG B;  1O9S A;  1NE8 A;  4ELZ C;  2ED1 A;  5DLQ E;  1YIJ T;  2ZCF B;  3GF5 A;  3L2U A;  1LCK A;  2CZ1 B;  5LL6 S;  2E1H A;  4X1V A;  3OYJ A;  3T9N A;  4M77 A;  3I9Q A;  3SEM A;  5GAN f;  1N9R A;  2VXF A;  1U1T A;  5GMK j;  3HSB A;  3P8D A;  3UAT A;  2DZ9 A;  1WJQ A;  1QWF A;  3M0U A;  2GNC A;  3QWY A;  1SSF A;  4DEX A;  3CCQ Q;  1OX8 A;  4EDU A;  2ZPH B;  4M75 A;  2GTJ A;  2V1Q A;  2MF2 A;  2HD0 A;  3JB9 H;  2XDP A;  3FB9 A;  3PE0 A;  4XTV A;  1M1K U;  3S3N A;  2CUD A;  1W2B S;  1WHL A;  1MHN A;  2RQT A;  6AT1 B;  2D6F A;  4E7I A;  2DET A;  1K0S A;  1M3C A;  3MHX A;  3OY9 A;  4FSX A;  1K9M C;  1VQ7 Q;  1AD5 A;  2CP5 A;  1SHG A;  3MEA A;  5A0L A;  1K9M R;  3CMA T;  5CKH A;  3MEU A;  3MP1 A;  3FDR A;  3CXC A;  2YSQ A;  2QQ9 A;  3KXT A;  1QKX A;  5FU6 C;  5D6W A;  4F7U A;  1OYX A;  2CH4 A;  1WJR A;  1Y96 A;  4HCC A;  1KFZ A;  2DD4 A;  2LMJ A;  4J9H A;  2YUQ A;  3CC4 T;  2E12 A;  3CQT A;  2LNH B;  3OSS C;  1FWZ A;  3HRS A;  2QA4 Q;  2GQI A;  2KSS A;  1NG2 A;  2DVJ A;  1VQP T;  4EMH A;  4BE2 A;  2MYS A;  4QT7 A;  1VQ9 T;  2X4X A;  1VQN Q;  1J3T A;  4GLM A;  3F70 A;  2AZV A;  2AK5 A;  2KXC A;  1Y07 A;  3SD4 A;  5IT9 E;  3J7A F;  2LX9 A;  5GAM e;  3DB3 A;  4M7D D;  2YLC A;  3CCS A;  4KUD K;  2OAW A;  1TTH B;  4FM4 B;  1YJW T;  1Y71 A;  5FWC A;  2ZPB B;  2DF6 A;  5IHN A;  2X35 A;  2XK0 A;  4Z8A A;  3NPF A;  3KBG A;  2RPN A;  1H92 A;  2KNB B;  2LQK A;  1VYU A;  4N0A C;  4C92 F;  1JEG A;  5FW9 A;  3OMG A;  1YI2 Q;  4C92 C;  4A4E A;  3UF4 A;  1B34 B;  2M9U A;  1VQO A;  2JMC A;  4K11 A;  4II1 A;  1OU9 A;  4HVU A;  1UUE A;  1VIE A;  4ZGD B;  5GAM h;  5GAN 3;  4IUV A;  1OI1 A;  3URG A;  2X3W D;  1BU1 A;  1BIB A;  4R56 A;  2XD0 A;  2KT1 A;  4DOV A;  4PJL A;  3QSU A;  2QAZ A;  4TVR A;  2DTO A;  3VUZ A;  3QYH B;  2DYI A;  1NEG A;  4LDV A;  1WHK A;  1PRM C;  4ZGJ B;  2ZPG B;  4RTT A;  4Z89 A;  3I56 Q;  1ZUU A;  1NJI U;  5FU6 B;  4PFO A;  3TQ7 P;  1X01 A;  2XDD A;  1RAB B;  2KI7 A;  2F5K A;  3PT9 A;  2RD1 A;  5L8R E;  2VC8 A;  3GP8 A;  2HEQ A;  1T3S A;  1UDL A;  3HTR A;  2JOY A;  4JJC A;  1WHJ A;  2HSE B;  3JCM P;  1RAC B;  1U1S A;  2EJ9 A;  2AZS A;  3CC2 T;  3MKD A;  2RNA A;  5CKB A;  2XG8 D;  2MOX A;  4XTX A;  5KCH A;  3H0H A;  2CGH A;  3H6Z A;  2K5F A;  1RAF B;  3ZBD A;  2JUF A;  5LJ5 d;  3REB B;  5GMK h;  4C92 G;  2NUZ A;  2JM9 A;  2RMO A;  5IHI A;  1M8M A;  4C0D C;  3OS1 A;  5CCA A;  1YIT T;  5CO7 A;  2COW A;  4F16 A;  4A54 A;  5GAN g;  3CPW P;  1WPY A;  3NHN A;  3JCM e;  2VB6 A;  5J3B A;  1AVZ C;  3I55 Q;  4D6W A;  1VQ7 A;  2ROT A;  9ATC B;  3CC7 Q;  4NL3 A;  2FB7 A;  3SFM A;  2QI2 A;  2JS0 A;  2EGA A;  1PRL C;  4C92 B;  1WXT A;  4CRI A;  2QEX T;  4BE1 A;  4BI8 B;  2EYW A;  1FX7 A;  2OTL Q;  2E5K A;  2L5Q A;  5GAM g;  4M77 F;  2HL5 C;  2CRE A;  5CQY A;  2JMA A;  2LNV A;  4M77 C;  1FMW A;  2CP7 A;  2RN8 A;  1KG1 A;  1UFF A;  2A28 A;  4HA8 A;  1YWP A;  1VQ6 A;  1VQN A;  2EKO A;  1IB8 A;  4WTO B;  4M7D E;  1KHI A;  1Q81 C;  2DAQ A;  1T0J A;  4AFQ C;  3GPL A;  1M3A A;  1RI0 A;  2DL8 A;  2DIQ A;  3JB9 F;  1XNI A;  1BI0 A;  1Q81 R;  3OYA A;  1M1G A;  1TWB A;  3FJ5 A;  4BUG A;  2A36 A;  2HQX A;  3TSW A;  1N9S A;  2MCN A;  3PVL A;  3HKS A;  4RTU A;  1K73 C;  3QZ5 B;  1MGQ A;  3JCM X;  2DVE A;  2CZ7 B;  2FHD A;  5IXB A;  2LT1 A;  4LD6 A;  3ULR B;  1K73 R;  3V8K A;  5IXF A;  5GJW B;  4L6V 5;  2CZ6 B;  1LPL A;  4C0D B;  3EFR A;  4MZP A;  4BAC A;  1WZO A;  3C4S A;  2KYM A;  5GAO p;  2AIR B;  3CCU T;  4Y28 E;  2EW3 A;  3QG1 A;  1ZSG A;  2OI3 A;  3BW1 A;  1VQM T;  1QVP A;  1T0H A;  2DJQ A;  1GCQ C;  2QQR A;  1K76 A;  1JJ2 P;  1RUW A;  2YRC A;  2RB6 A;  2YDL A;  3RDV A;  5C0M A;  3V8L A;  2OX7 A;  2WSF E;  4ESR A;  4M77 G;  3UA6 A;  3VYG A;  1X2K A;  3I56 A;  2B86 A;  4OB1 B;  2I2L A;  3JCM J;  3D7S B;  3M57 A;  4N4H A;  5GMK l;  2KRS A;  2ZGW A;  3CPW S;  1B34 A;  2X9H A;  2L89 A;  1Z9Q A;  4YTL A;  3C12 A;  3DLL A;  4AG1 C;  3EFO B;  4M75 G;  3V7R A;  2F69 A;  2QGG A;  1UTI A;  1QW1 A;  4E7Z A;  5A2Q E;  1GRI A;  2VAS A;  4M4Z A;  4JDS A;  3JCM g;  2E65 A;  2PVO B;  3KUF A;  1D0Z A;  3HFN A;  1QP2 A;  1YIJ Q;  4AFS C;  1PNJ A;  1WI7 A;  3M56 A;  1NBE B;  2Z0W A;  4JUV A;  4MZT A;  4AG2 C;  2P4R A;  1NLO C;  4PJO E;  1LVK A;  4FW1 A;  4CI0 C;  4IUU A;  1MV0 B;  4BE0 A;  1B3Q A;  3OMC A;  2BTT A;  1XTD A;  1X75 C;  2X51 A;  3G4S T;  1PD1 A;  5IH2 A;  3GIB A;  1W1F A;  1BBZ A;  3OS2 A;  2F1L A;  3I55 A;  3VS0 A;  2MWP A;  3CC7 A;  1V1C A;  2EJF A;  4JLG A;  4X34 A;  3ME9 A;  4FL6 A;  1U8R A;  5KYU A;  5LJ5 j;  3LH0 A;  2F2V A;  2PTK A;  3X20 B;  1UGP B;  1QCF A;  1JO8 A;  4PJN A;  1D0Y A;  2OTL A;  1CSK A;  4M7A F;  2RJF A;  2EAY A;  4FYV B;  4M78 D;  4M7A C;  2RJC A;  4C8Q F;  4WF2 A;  2KMT A;  3UA7 A;  3QDR B;  3C94 A;  3L2V A;  4C8Q C;  4A4F A;  2DBK A;  3J80 E;  1HJD A;  3UDC A;  2GGR A;  2BZ8 A;  4N0A A;  1N6A A;  3CCE A;  1I1J A;  3CC4 Q;  4C92 A;  3G71 T;  2L3P A;  5GAO l;  1IZ6 A;  3H0I A;  4FU6 A;  1VQP Q;  2LC4 A;  1BI1 A;  1JJ2 S;  1VQ9 Q;  5I21 A;  3V7S A;  2KYB A;  3CCR T;  1YJ9 T;  3AT1 B;  3CPF A;  4LD9 K;  1PKT A;  3X24 B;  2MPX C;  3NTI A;  3RIR A;  4A63 B;  2CS7 A;  5FU7 C;  5KE3 A;  1TG0 A;  4XU1 A;  1MND A;  3EG9 B;  2R5A A;  4JRK A;  1YJW Q;  1HSQ A;  2EYQ A;  5J39 A;  4RTY A;  2F2X A;  3C95 A;  3VS7 A;  2LQW A;  2PQW A;  4DBQ A;  3OW2 A;  1YCY A;  4HT8 A;  2LCC A;  4HXJ A;  1M2V B;  3Q1J A;  4M7A G;  4RG2 A;  3V8J A;  4JZ3 A;  1OPK A;  1TXQ A;  5CVI A;  2HDA A;  1M27 C;  2RA2 A;  1X27 A;  1VQ4 T;  4PJO B;  2KRM A;  4N4I A;  1PKS A;  2PVD B;  1S1N A;  4M7A B;  1Q86 U;  5AYF A;  2HMA A;  3QJY A;  4GBQ A;  2ZPI B;  3LH5 A;  3QDF A;  5CQX A;  1YIJ A;  4C8Q B;  1VUB A;  4LXC A;  3VU3 C;  2O31 A;  1AEY A;  3OYY A;  1YJN A;  4OMF B;  2R58 A;  1QVF P;  3QZ9 B;  1F1B B;  2P0Q A;  2RF0 A;  5FRN A;  1X6G A;  4QVD A;  2FO0 A;  4XTW A;  2D8J A;  3O8V A;  2LX7 A;  3FRN A;  2QQA A;  3CCJ Q;  2QXF A;  2E10 A;  2H8H A;  3VKI A;  5GMK i;  5GAO m;  2G3R A;  2LQN A;  2VGM A;  1I07 A;  2HCK A;  2LCL A;  4HCZ A;  3CC2 Q;  2QTX A;  4P5N A;  3QWX X;  1YHQ Q;  4OB2 B;  1WHH A;  5LJ5 e;  3EFO A;  2DIL A;  2QQS A;  4IKF A;  2JTM A;  2EGE A;  3BDL A;  3NFC A;  5FU7 B;  5J26 A;  4LE9 A;  3M4Y A;  1YIT Q;  2WAC A;  4D8K A;  1R0B G;  4E7L A;  1ABQ A;  4KBM B;  4J6X A;  1UEB A;  1ZX6 A;  4M78 E;  3GNF B;  2KDS A;  2IG0 A;  5DLO A;  2E3H A;  1V29 B;  4QQD A;  4XU0 A;  5LJ5 h;  1HYO A;  1SEM A;  4KT0 E;  2OAU A;  3LX7 A;  2A3L A;  1CKB A;  2QEX Q;  4XTZ A;  4B6M A;  4GLK A;  3DB4 A;  4FT2 A;  5GAN 5;  1C1A A;  1BB9 A;  5GAM f;  2DXC A;  1MMN A;  2KQW A;  3R6N A;  2HBW A;  2L3S A;  3CC4 A;  3GLX A;  1E6G A;  3MPU B;  3CD6 T;  3I5R A;  2RQR A;  5D6X A;  1UGS B;  5I2S A;  2EWN A;  4HKE A;  4IUP A;  1VQP A;  2Y90 A;  3UT1 A;  1TS9 A;  2ZPF B;  3JV3 A;  1EIF A;  1VA7 A;  2A08 A;  2GCX A;  1VQ9 A;  4J7F A;  3EGX B;  4J9C A;  3M4G A;  2RHZ A;  2O9V A;  1KD1 C;  2JVV A;  4M77 D;  2BE9 B;  5LJ3 h;  1GCQ A;  2F2W A;  3EGD B;  3KFV A;  1SPK A;  1KD1 R;  4QW2 A;  2FPE A;  3E2U A;  1GL5 A;  2F5T X;  1JB0 E;  4ATO A;  1WHG A;  2ROL A;  2LT4 A;  3G6E Q;  3INZ A;  2K5L A;  2WSE E;  2EQM A;  2CZ0 B;  4A4H A;  4M75 D;  2LRQ A;  4O5V A;  2LVM A;  1RAA B;  3R6O A;  1G3T A;  2XU8 A;  2PU9 B;  4IUQ A;  1TU0 B;  3BE3 A;  1QVF S;  1ZQ1 A;  2EYY A;  4IIM A;  3MEW A;  3M59 A;  3N5B B;  4LUD A;  1K8A C;  2EYX A;  3MJX A;  3CCU Q;  1K8A R;  1VYT A;  4Z88 A;  1GXI E;  3EH2 A;  4XU2 A;  4XK8 E;  3EG9 A;  4J5Y A;  2DO3 A;  3JAM E;  4RKU E;  4BI3 A;  2RH2 A;  1BCO A;  2DER A;  3CCM T;  3O5Z A;  1I0C A;  2HBP A;  4LDY A;  4E7J A;  1E6H A;  1TUC A;  2ED0 A;  1VQL T;  1AWO A;  3OYF A;  4QVC A;  4LDX A;  3CCJ A;  3JCM f;  2COY A;  1VQ8 T;  2K3Y A;  1PD0 A;  2CP3 A;  4J9G A;  3CCS T;  4BI4 A;  3UPU A;  1AZE A;  3CC2 A;  3QKJ A;  1GBR A;  3M54 A;  4E7S A;  1YHQ A;  1G2B A;  4XTY A;  2QDY B;  2YUN A;  5GMK e;  3OQ5 A;  1UGR B;  2BUD A;  4EMK C;  5CKD A;  1NM7 A;  1K9M U;  1S72 Q;  2C0I A;  2MWO A;  4M7A A;  2GBQ A;  2JZ2 A;  1ZBX A;  2DFU A;  3G4S Q;  4HVW A; 
#chains in the Genus database with same CATH homology
 2KRO A;  4J9I A;  4E6R A;  2EW3 A;  2K2M A;  1ZSG A;  2OI3 A;  2DRM A;  1T3L A;  2O9S A;  1T0H A;  2DJQ A;  1GCQ C;  1K76 A;  1AZG B;  1RUW A;  2YDL A;  4RTX A;  2K7A A;  3M0S A;  4OMM A;  3GBQ A;  2PNI A;  4ESR A;  2C0O A;  3UA6 A;  4D8D A;  1X2K A;  2B86 A;  2FPD A;  1YNZ A;  1GBQ A;  3EGU A;  3SHW A;  1NEB A;  4OMP A;  4HVV A;  1MV3 A;  2KRS A;  2KEA A;  3NGP A;  2O88 A;  1WDX A;  1YN8 A;  1UHF A;  1FYN A;  1ZUY A;  1Z9Q A;  4ORZ A;  1ZUK A;  4AG1 C;  1WXU A;  1WLP B;  1UTI A;  1GRI A;  4M4Z A;  2K3B A;  2YT6 A;  4J9E A;  2O2O A;  1QKW A;  2CT3 A;  2X3X D;  1YWO A;  2CDT A;  1UG1 A;  3H0F A;  4AFS C;  2KR3 A;  1PNJ A;  1WI7 A;  2DYB A;  3EG3 A;  4AG2 C;  2P4R A;  1NLO C;  1WXB A;  2AKL A;  4RTW A;  1SRL A;  2W10 A;  1MV0 B;  1B3Q A;  2BTT A;  1VYV A;  1UGV A;  5IH2 A;  1QLY A;  3VS3 A;  1W1F A;  2EGC A;  1BBZ A;  1UHC A;  1CKA A;  2RQW A;  1Y0M A;  2ABL A;  3VS0 A;  2LCS A;  2OJ2 A;  2EPD A;  1V1C A;  1Y57 A;  4J9F A;  3M0T A;  5EC7 A;  3THK A;  4EIK A;  2VVK A;  2F2V A;  1RLQ C;  1ABO A;  2EVR A;  2PTK A;  1Z9Z A;  2DL4 A;  1GFC A;  3EG0 A;  2D1X A;  3U23 A;  2DL5 A;  1QCF A;  5ECA A;  1JO8 A;  1UE9 A;  2EKH A;  1CSK A;  1G83 A;  1OPL A;  3RBB B;  2LJ1 A;  2LP5 A;  4R0K A;  2DNU A;  2AKK A;  3PVQ A;  2ED1 A;  2L0A A;  2KT8 A;  1LCK A;  3UA7 A;  2CSI A;  1OV3 A;  2DBK A;  4X1V A;  1AOJ A;  3I9Q A;  3SEM A;  1HJD A;  2GGR A;  2BZ8 A;  1I1J A;  4CC4 B;  3RNJ A;  3UAT A;  2NWM A;  1QWF A;  2VWF A;  1WIE A;  1IO6 A;  1AWJ A;  2L3P A;  3M0U A;  2GNC A;  3QWY A;  1K0X A;  3EHQ A;  2KGT A;  4DEX A;  3H0I A;  1JXM A;  1ARK A;  2GTJ A;  2V1Q A;  4FSS A;  4OML A;  2IIM A;  1H8K A;  2KYB A;  1PKT A;  3PE0 A;  1YP5 A;  4A63 B;  2JM8 A;  4OMQ A;  4AFZ C;  1ZBJ A;  2CUD A;  4JPB W;  2K79 A;  2RQT A;  1TG0 A;  2ESW A;  1K0S A;  1M3C A;  2RQV A;  2JT4 A;  1HSQ A;  1AD5 A;  2RQU A;  2KE9 A;  3VS5 A;  1SHG A;  1NLP C;  4RTY A;  2DE0 X;  2F2X A;  2YUP A;  1N5Z A;  3VS7 A;  2YSQ A;  2LQW A;  1QKX A;  4HXJ A;  2C0T A;  2CH4 A;  1SHF A;  3EG2 A;  2DX1 A;  1KFZ A;  1OEB A;  4JZ3 A;  1OPK A;  4OMN A;  2LMJ A;  4J9H A;  4JZ4 A;  1EFN A;  5FWB A;  2YUQ A;  3CQT A;  3VRY A;  2LNH B;  2HDA A;  1M27 C;  2GQI A;  1NG2 A;  1X27 A;  2DVJ A;  2KRM A;  4QT7 A;  1J3T A;  1PKS A;  3VS2 A;  1B07 A;  2D8H A;  1S1N A;  3VS4 A;  4GLM A;  2AZV A;  4GBQ A;  2AK5 A;  1X2Q A;  2KXC A;  3LH5 A;  3ZL7 C;  1K1Z A;  1AEY A;  2O31 A;  2EQI A;  2OAW A;  4JJD A;  2RF0 A;  1X6G A;  2J6F A;  2FO0 A;  1W6X A;  2D8J A;  5FWC A;  2DF6 A;  2LX7 A;  5IHN A;  1U3O A;  1W70 A;  1SRM A;  3NPF A;  4Z8A A;  2RPN A;  2H8H A;  3I5S A;  1H92 A;  2KNB B;  2LQN A;  2M51 A;  1VYU A;  1JEG A;  1I07 A;  2HCK A;  2J05 A;  5FW9 A;  1X6B A;  4J9D A;  1GFD A;  4RTZ A;  1MUZ A;  3UF4 A;  3QWX X;  2JMC A;  4K11 A;  2XMF A;  5I11 A;  1U06 A;  2DIL A;  2SRC A;  1GCP A;  4HVU A;  2EGE A;  1UUE A;  1E7O A;  2K9G A;  2L3Q A;  5IHK A;  2CH4 W;  2X3W D;  2A37 A;  1BU1 A;  1AWW A;  2ECZ A;  4LE9 A;  2KT1 A;  4ZNX A;  4D8K A;  1ABQ A;  2DL7 A;  3IQL A;  2FRW A;  1KJW A;  4IIO A;  4AFU C;  1ZX6 A;  3VRZ A;  2FG0 A;  3I35 A;  4WCI A;  1NEG A;  2KRN A;  3TSZ A;  2CT4 A;  1PRM C;  3VS6 A;  4CC3 A;  4RTT A;  2M0Y A;  4Z89 A;  2JTE A;  1SSH A;  4LNP A;  1ZUU A;  1SEM A;  1CKB A;  5HCK A;  1PHT A;  1RLP C;  2LJ0 A;  2EYZ A;  2KBT A;  2MIO A;  1BB9 A;  1PWT A;  3C0C A;  3R6N A;  2HEQ A;  1NYF A;  2HBW A;  1T3S A;  1UDL A;  2L3S A;  1ZLM A;  4JJC A;  1UEC A;  1E6G A;  2AZS A;  2FEI A;  3I5R A;  2RQR A;  4F17 A;  3M0P A;  2RNA A;  2YUO A;  5GJV B;  1XOV A;  2DBM A;  1YCS B;  2D0N A;  1KIK A;  1M30 A;  2I0N A;  2MOX A;  2J06 A;  3H0H A;  3JV3 A;  1VA7 A;  2A08 A;  2JXB A;  2V1R A;  4J9C A;  4RTV A;  2PZ1 A;  3REB B;  2DA9 A;  2JM9 A;  2NUZ A;  2O9V A;  2RMO A;  2BZX A;  5IHI A;  1K4U S;  1M8M A;  1WX6 A;  1GCQ A;  4F16 A;  2F2W A;  3KFV A;  1SPK A;  3TVT A;  4LN2 A;  3NHN A;  2FPE A;  2DRK A;  1GL5 A;  1JXO A;  1AVZ C;  3REA B;  3M0Q A;  2ROL A;  4F14 A;  1JQQ A;  2CSQ A;  2ROT A;  2EBP A;  1RI9 A;  2DL3 A;  2JS0 A;  2EGA A;  1FMK A;  1UJ0 A;  1PRL C;  2FPF A;  1WXT A;  3VS1 A;  2SEM A;  2LZ6 B;  2J6O A;  4CC7 A;  2EYW A;  2ENM A;  2EYY A;  5I22 A;  2DLP A;  4IIM A;  2K6D A;  2E5K A;  4LUD A;  2CRE A;  1UJY A;  1HD3 A;  1NYG A;  1AWX A;  2JMA A;  5L23 A;  2EYX A;  3M0R A;  2RN8 A;  1VYT A;  3A98 A;  4Z88 A;  1UFF A;  4Y92 A;  4LUE A;  1JU5 C;  1X69 A;  2A28 A;  1YWP A;  2W0Z A;  4CC2 A;  1U5S A;  3H41 A;  2BZY A;  2DM1 A;  1T0J A;  2J6K A;  4AFQ C;  4RUG A;  1M3A A;  2DL8 A;  1M3B A;  2JW4 A;  2QDL A;  2GTO A;  3NMZ C;  3O5Z A;  1WYX A;  1I0C A;  4J9B A;  1WFW A;  3FJ5 A;  1E6H A;  4KRT A;  2A36 A;  2G6F X;  1TUC A;  2ED0 A;  1AWO A;  1H3H A;  2KXD A;  3TSW A;  2FRY A;  1A0N B;  1K9A A;  2MCN A;  3PVL A;  4RTU A;  1WA7 A;  2L2P A;  4J9G A;  1X43 A;  4HCK A;  4JJB A;  1AZE A;  4DEY A;  5IXB A;  2VKN A;  1GBR A;  3ULR B;  2LJ3 A;  1G2B A;  2DMO A;  3EHR A;  2CUB A;  5IXF A;  5GJW B;  2J7I A;  2YUN A;  2JS2 A;  1OOT A;  1NM7 A;  1BK2 A;  2C0I A;  3EG1 A;  1KSW A;  2GBQ A;  4OMO A;  2HSP A;  1QWE A;  1TUD A;  2KYM A;  4HVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...