2EBPA

Solution structure of the sh3 domain from human sam and sh3 domain containing protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM and SH3 domain-containing protein 1
publication title Solution structure of the SH3 domain from human SAM and SH3 domain containing protein 1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ebpA00
2L3PA 2PTKA 2L3SA 1WYXA 1GCQA 5I22A 4HVUA 1SHFA 2HCKA 1YWPA 1QWEA 1X27A 1YWOA 2QDLA 2IIMA 1NEBA 1SRMA 4J9BA 1K0SA 2RQTA 2LMJA 2X3WD 1Y0MA 2LJ1A 2DVJA 1AWXA 2KBTA 3SHWA 2KXCA 1G83A 1W1FA 4IIOA 2RF0A 1E6HA 1NG2A 1RLQC 1E7OA 1QCFA 4M4ZA 1SHGA 3M0SA 4RTWA 4QT7A 2GGRA 3TSWA 1WXUA 2DL5A 1K4US 2O31A 2VVKA 1OEBA 3TSZA 2FPDA 2L0AA 4OMPA 1U5SA 5FWCA 1H92A 3REAB 2D0NA 1GCPA 2CUBA 2CDTA 2EPDA 2KRNA 1H3HA 4AFSC 1N5ZA 3NHNA 2DRKA 4RTYA 2FRWA 3O5ZA 1KJWA 3PVQA 1AVZC 1I1JA 3M0PA 3VS5A 2DF6A 3THKA 1JO8A 1RLPC 2MIOA 2CREA 1UUEA 2YUQA 1ZUKA 1AZGB 2K7AA 3ZL7C 4LN2A 3ULRB 4J9GA 2PNIA 4J9EA 5ECAA 4J9FA 4HVWA 1UJYA 4RTXA 1GFCA 4A63B 1SSHA 1VYTA 2DRMA 3H41A 2YDLA 1I0CA 1HJDA 2HSPA 4D8DA 1M27C 2DX1A 1I07A 2JW4A 2CH4W 1ZLMA 3NGPA 3VS6A 2KT1A 1MV3A 1AZEA 3H0FA 2YUNA 4OMMA 2JMCA 1B3QA 1M3CA 1YP5A 4GBQA 1M8MA 1GCQC 1KFZA 2KNBB 3CQTA 4JJDA 4EIKA 1VYVA 1T3SA 2CUDA 1J3TA 1MV0B 1X6GA 1UHFA 2DNUA 1AD5A 2OAWA 5IHIA 2BZXA 1XOVA 1NLPC 1YCSB 2F2XA 2DL3A 4LE9A 1AWWA 1JXMA 1CSKA 2G6FX 1UJ0A 2H8HA 4OMLA 1ABOA 1WXTA 2LX7A 2A37A 1X2KA 2MCNA 1Z9QA 2FRYA 2K79A 2KYBA 4CC4B 2W0ZA 3NPFA 2DJQA 4AG1C 2OJ2A 4HCKA 5HCKA 1QKXA 1WIEA 3REBB 1U06A 1UTIA 1MUZA 2KXDA 2K3BA 4DEXA 4GLMA 1EFNA 2ABLA 3M0RA 3C0CA 1GRIA 2HDAA 3VRYA 2GTOA 3QWYA 2JS2A 1X6BA 1NYGA 3M0UA 2AZVA 1JXOA 2DL8A 5IH2A 3M0TA 2DBMA 3EG1A 1CKBA 2KRSA 2ENMA 1WXBA 4K11A 1X69A 2O9VA 4IIMA 4OMNA 2ED1A 2EGCA 2J7IA 1NM7A 2RMOA 1NYFA 4J9CA 1ZUUA 1AWJA 2FG0A 1AWOA 4CC7A 1V1CA 1WLPB 2DL7A 4Z8AA 1T3LA 1KIKA 4Y92A 2YUPA 4Z89A 3VS2A 1UECA 3SEMA 2LJ3A 1OPKA 1OV3A 1HD3A 2L3QA 1Z9ZA 1PWTA 2KE9A 2D8HA 1T0HA 3I35A 3NMZC 4AFZC 2ED0A 2C0IA 2LCSA 2EYZA 2O2OA 3LH5A 2DYBA 2AK5A 2DMOA 2A36A 1PKSA 1QLYA 2NUZA 2C0OA 3EHRA 2PZ1A 1OPLA 2RN8A 2J6FA 3I5RA 1QWFA 4AFQC 2E5KA 3VRZA 4FSSA 2DA9A 1S1NA 2RPNA 3EGUA 4LNPA 2FEIA 1PHTA 3EG2A 3JV3A 4F14A 1WI7A 1YN8A 3FJ5A 2DL4A 3PVLA 3I9QA 2LQNA 2SRCA 1PRLC 2EGEA 2B86A 1SRLA 1WFWA 4DEYA 4JZ4A 2DLPA 4X1VA 2ROLA 1VA7A 2EYXA 2KR3A 1NLOC 3H0IA 2D8JA 2LQWA 4R0KA 1RUWA 4HXJA 1W6XA 1GL5A 2GBQA 2GQIA 2YSQA 1AOJA 4RTTA 4JJCA 4AFUC 2DILA 1QKWA 2K9GA 4JJBA 1JU5C 1LCKA 4RUGA 1H8KA 2ROTA 2CT3A 3VS3A 2BTTA 2P4RA 1BK2A 1WA7A 2AKLA 4J9DA 2GNCA 4RTZA 1GBRA 1ARKA 5IHNA 5IHKA 2DE0X 2YT6A 2KROA 1TUDA 2KT8A 2VWFA 5FW9A 1TUCA 3VS7A 2RQRA 2F2VA 2CSQA 2RQWA 2V1RA 2HBWA 1BB9A 4LUEA 1UHCA 2JM9A 2I0NA 1YNZA 2LP5A 5GJVB 2JS0A 4E6RA 2KRMA 2LZ6B 1UDLA 1UE9A 2SEMA 5IXFA 1SPKA 3R6NA 1IO6A 2XMFA 3PE0A 2JMAA 1NEGA 1WDXA 3VS0A 3M0QA 2BZ8A 2RQVA 1ZUYA 4F17A 2V1QA 2EYWA 1Y57A 1GBQA 1UG1A 2EYYA 3QWXX 2EBPA 2K6DA 4CC3A 3GBQA 3H0HA 1M3AA 3EHQA 1ZBJA 2LJ0A 2C0TA 2EVRA 2FO0A 2J05A 4RTUA 1WX6A 4J9HA 3EG3A 2EQIA 4Z88A 2RNAA 4CC2A 1BU1A 2EW3A 2JXBA 2JM8A 2A08A 1PRMC 1B07A 3UF4A 2CH4A 2AKKA 1RI9A 2KGTA 1ZX6A 4WCIA 1UGVA 2OI3A 2L2PA 3RNJA 2J6KA 2CT4A 1K9AA 2EGAA 1ABQA 2ECZA 2VKNA 3UATA 4AG2C 2KEAA 5L23A 1X43A 1VYUA 2A28A 4ESRA 2FPEA 1ZSGA 1E6GA 4OMQA 1AEYA 4ZNXA 2AZSA 2KYMA 1G2BA 2FPFA 2J6OA 4ORZA 1GFDA 2EKHA 1PNJA 3RBBB 2CSIA 2HEQA 2X3XD 1K1ZA 4HVVA 2ESWA 2GTJA 1JEGA 1W70A 3VS1A 3I5SA 4D8KA 4F16A 3A98A 2O9SA 3U23A 3IQLA 4J9IA 3TVTA 2LNHB 1M30A 5IXBA 2JT4A 3EG0A 2K2MA 1UFFA 2W10A 1CKAA 1KSWA 1OOTA 2BZYA 2M51A 3KFVA 1BBZA 2F2WA 2O88A 2YUOA 1FMKA 5EC7A 2DM1A 4JZ3A 2NWMA 1K76A 3UA7A 1SEMA 4RTVA 3VS4A 1FYNA 1PKTA 1U3OA 4JPBW 2J06A 1JQQA 2DBKA 4OMOA 1K0XA 5GJWB 2MOXA 2D1XA 5FWBA 3UA6A 1A0NB 2JTEA 2M0YA 1HSQA 1X2QA 5I11A 4LUDA 1T0JA 2RQUA 1TG0A 1M3BA 4KRTA
chains in the Genus database with same CATH superfamily
2PTKA 4F7UA 1M2OA 1WHKA 1YWPA 1QWEA 3OYFA 1K8AC 2DO3A 1NEBA 5FU6B 3FC3A 1OU8A 1K9MC 4J9BA 2KAFA 1K0SA 4Y28E 2IG0A 2RI5A 3JCMd 1WGSA 3L42A 3L2UA 2K2VA 3GIBA 2RJEA 4ELZC 2KXCA 1W1FA 1VQ9T 4ZTFA 1NG2A 2RK1A 5CKBA 1QCFA 1IREB 2DERA 2DL5A 5CQYA 4OMPA 3HSBA 5FWCA 2CUBA 4IUVA 3X26B 1N5ZA 1WHLA 4RTYA 2E5QA 3ER0A 4M7DF 3HRSA 2A7YA 4M78F 2RI2A 3PVQA 3M0PA 3VS5A 3THKA 1RLPC 3CMEQ 2MIOA 1UUEA 2CP0A 2YUQA 3UT1A 3V8KA 3EFSA 4A4KA 2K7AA 3ZL7C 4QVDA 2YHTA 2QQAA 4XTXA 1Q82C 2K3YA 4RTXA 4YTLA 3OW2P 1NJIR 1LPLA 2KY9A 4PJOB 2K5FA 3CCVT 3CCLQ 5GAOl 1YCYA 1JRIA 2CH4W 2CGHA 1ZLMA 5KCOA 1PM3A 2DIQA 3JCMX 2QTXA 1M8MA 1VQOT 1GCQC 2E3HA 2IVWA 2DETA 3CQTA 3E1SA 2RHYA 4KUIA 4BI4A 4QVCA 1YJNA 3CCUA 4C5EA 1MV0B 1VQ8Q 5LJ3g 1AD5A 2DNUA 5IHIA 2BZXA 1XOVA 4KGZB 2F2XA 2XICA 3CPWA 2LNVA 4BI8B 1WJQA 3JAME 3DLMA 3G6EA 1WNLA 5GAOp 3OYYA 2XKOC 3BFMA 1V76A 1Z9QA 2FRYA 2X4WA 2W0ZA 2LRQA 5HCKA 4KGXB 1M2VB 4QW2A 4DOWA 1U06A 1UTIA 1MUZA 2KXDA 2K3BA 2ABLA 3M0RA 3C0CA 3VRYA 2GTOA 2JTFA 3I56Q 4LDYA 1NYGA 5D6XA 3OYIA 2WACA 3HRUA 2B8AA 1DJ7B 3M0UA 2AZVA 4JLIA 3CMET 1YJWA 2JTMA 4M7AD 3EG1A 4CRIA 1Y71A 4N0AA 2ZPFB 5GAN4 3I55T 3CC2A 2X35A 5DY9A 4IIMA 3V7SA 3AHUA 5KYUA 1Q7YU 4PL6A 3PT9A 1K73R 3CCLT 4E7HA 2EGCA 2RMOA 3FDRA 3GP8A 1ZUUA 4PJOE 5GAN2 1ZSZB 4CC7A 1V1CA 2DL7A 5LJ3f 3C4SA 1G3SA 2AT1B 2X4YA 1VQ9A 1KIKA 4BB7A 1C1AA 4Y92A 1NZ9A 7AT1B 1QVFA 3A8LB 3VS2A 1VQ8T 5KYXA 3SEMA 4F7UB 1VQ6Q 3P8BB 1OV3A 1Q86C 4TVRA 1HXDA 3I35A 3OYBA 3VKIA 1W2BA 4OF1A 2EJ9A 1OQKA 3P8DA 2LCSA 2E64A 1QCOA 1PKSA 1VQLA 1OPLA 2RN8A 2J6FA 1FMVA 4EMKA 1YIJA 1SKUB 5LJ5e 2E5KA 2DFUA 1RL2A 1PHTA 3EG2A 1VQPA 5GAOr 1WI7A 2AHJB 4FM4B 4XK8E 4QQ6A 5GAMg 3FJ5A 2E10A 2R5AA 3I9QA 3I56T 2RB6A 2RH2A 1WFWA 1MNEA 4X9CA 4DEYA 3Q1JA 3A8GB 3CMAQ 1W6XA 4RKUE 2YSQA 3DLLA 1TG0A 4PJOD 3SDZA 3M4YA 2A0FB 1VQOA 2GQVA 4BACA 2AKLA 2Y4XA 3OBYA 3EAEA 3S3MA 2GNCA 4M75G 2MWOA 1JJ2P 5GAOm 4ATOA 2VWFA 5FW9A 5KYYB 4M77G 3CCEA 2F2VA 2CSQA 2CZ7B 2V1RA 3CCMQ 2HBWA 3BDLA 3CBOA 3OYMA 3CCRA 2BE9B 3NTKA 3KXTA 2MPXC 2LP5A 1MNDA 5GJVB 2JS0A 2KMTA 3MEUA 3QHSA 4V2SA 1M90C 2FYKA 1SPKA 4F7UE 4M7DA 3QJYA 3JSCA 4M78A 2VYTA 3CPFA 1WDXA 1YBYA 3CCQQ 2BZ8A 2E6NA 2RQVA 3OYJA 5AT1B 5C0MA 1UG1A 5J39A 1ZQ1A 1M9SA 2E6ZA 3DKMA 4OB2B 2FO0A 2J05A 2RD1A 4RTUA 3EG3A 2EQIA 4JS5A 4Z88A 5A0DA 2RNAA 2KI7A 3I55A 1BU1A 2M0OA 3EFRA 1B07A 4FSXA 4BY6B 1UGVA 2OI3A 4FW1A 3CCLA 2X9HA 1RAHB 3CMAT 2F5KA 2VKNA 4AG2C 1R77A 2KEAA 4ME7A 5LJ3e 4ESRA 3J80E 4OMQA 2MMPA 4A4FA 2FPFA 4ORZA 2LTOA 2CSIA 3L2VA 1ZA2B 2COYA 2X3XD 3A8MB 3QYHB 2EQJA 1WPYA 5CO7A 1Q7YR 1MMDA 4BUGA 2ATCB 4OB0B 5KYUB 3L1AA 2R58A 3I5SA 2QYZA 2O9SA 3CXCA 3IQLA 2JT4A 3JCMh 3BDUA 3CCMT 2K2MA 3CEYA 1Q81U 3OYKA 2YXYA 3ZEHA 1CKAA 2M51A 1YJNQ 2F2WA 5EC7A 5D6YA 2NWMA 2NUPA 1SEMA 1G5VA 4RTVA 4JPBW 5KYXB 2DBKA 3GLXA 2HL3A 4C92C 3G6EQ 2PUKB 3CCQT 3UA6A 5GAOn 3I56A 4C8QB 1OZ3A 2KK4A 2CP7A 4XTYA 2BKDN 4M77C 4R55A 5CKDA 1M3BA 4KRTA 2L3PA 1HYOA 2L3SA 1GCQA 5I22A 2LDMA 3OMGA 5GANf 3VJPA 4EMKB 1WHGA 4XTVA 2QA4A 2RQTA 2EQMA 2XD0A 2LMJA 2VXFA 3VU3C 2VV5A 1Y0MA 2X3WD 3MP6A 1VUBA 4EMHA 4M7AG 2QTVA 1G83A 4IIOA 2OTLQ 2DTOA 3VUBA 4RTWA 3M56A 2HQEA 1K4US 2KDSA 2VVKA 3TSZA 3EGDA 1VQ4Q 5FU7B 1KQSA 3CC7A 3CC2Q 2D0NA 3SWNC 1F1BB 1GCPA 2ZPHB 3L2ZA 5KYWA 4A4HA 2EPDA 1H3HA 2QQ9A 2FRWA 3EH1A 1IHWA 4PLLA 4KGVB 1KJWA 2JNGA 1N8RU 1VQ7T 2DF6A 3META 3OSVA 1RADB 2LC4A 1YJNT 3L2QA 1AZGB 2FB7A 1X6OA 4X34A 1UB4A 4M77F 3ULRB 2OTJQ 3GF5A 2EKOA 4J9FA 4GLKA 4O6JA 3GNFB 1SSHA 1VYTA 1I0CA 1HJDA 2HSPA 3HP9A 2DX1A 4JRQA 3G6ET 1X01A 3NGPA 3VS6A 3G71Q 4KT0E 5D6WA 5HKCA 4ZGEB 2D0QB 1MV3A 1AZEA 1ZA1B 1M1FA 4M78B 1M3CA 1YP5A 2O01E 5GMKe 1VQLQ 1YIJQ 4EMGA 1VYVA 4C8QE 5GMKl 3E2UA 1VQPQ 1NJIC 2DZCA 3JCMW 2JN0A 3QSUA 2RHUA 1UHFA 1TSFA 3CPWS 3JCMV 2RJFA 1YCSB 1UGSB 1RAGB 3EH2A 1Y7XA 4LE9A 1AWWA 1JXMA 1CSKA 1VQMA 5DLQE 1UJ0A 2H8HA 1O75A 1EIFA 1ABOA 2LX7A 2MCNA 3OQ5A 2OTLT 3A1PA 4DBHA 5CKHA 2KYBA 4NS5A 3NPFA 1VQ4T 2P0KA 5LJ5j 3CCMA 1WIEA 1KQ1A 2LQ8A 3QZ9B 1YFNA 2JS2A 2RI3A 1QMCA 4PJNA 4J7IA 1YITQ 3CCEQ 1IHVA 4M7AC 2HKQB 1OULA 3PGGA 3CCQA 2MYSA 2RA2A 1YHQT 2DBMA 4OB3B 1CKBA 1KC8U 4L59A 2XDDA 3CCRQ 2OTJT 1VQ5Q 1Q81R 3M54A 4E47A 4KH1B 1N9SA 2WSEE 1IB8A 5CVIA 4C8QD 5GANe 3T9NA 3F70A 2MK5A 2NUPB 3S6WA 3RMSA 3QXEB 3SB2A 3G71T 3A8OB 2LQKA 2FG0A 2EJFA 1B34A 5FU6C 1M1GA 1VQLT 1WLPB 2KQWA 1YIJT 1QVFS 3CCSA 3HHTB 5LJ5f 1VQPT 1Q95G 4LDWA 4M78E 1K73C 2PVGB 2HL5C 2LJ3A 3QUIA 2CP3A 1W2BS 1HD3A 1FMWA 3I55Q 3MJXA 2L3QA 2RHIA 2KE9A 3JB9J 1T0HA 4ZGDB 4AFZC 5GAN3 2CP2A 2Z0WA 3VYHB 3M58A 1P92A 3LH5A 2VGNA 2DMOA 1QLYA 1QCNA 3EHRA 4M7AF 4LD9K 3I5RA 4AFQC 1D3BA 3VRZA 1VQ7A 3JB9H 2V8JA 1S1NA 1I8FA 2RJDA 5L8RE 5CK9A 3MCAB 3TEEA 3J7AF 3MPUB 2BE7D 4BE2A 4NL2A 1VQKQ 1PRLC 2EGEA 4JUVA 2XI9A 1YITT 3CCET 1Y96A 4X1VA 2ROLA 3OS2A 1XTDA 1UEBA 3TREA 1NLOC 2D8JA 2LQWA 1G3WA 4C5GA 4A4GA 1I5LA 1AOJA 1N8RR 3CCRT 1VQ5T 2K9GA 3FJPA 4JJBA 1LVKA 3MEWA 4MMLA 4NOYA 5LJ3j 3X20B 2HQHA 4ELYC 3FRNA 1BK2A 1IGQA 1WA7A 1RAIB 4M78D 1SSFA 1WHHA 1GBRA 5IHKA 1XNIA 1TUDA 4C0FA 2RQRA 3OYCA 4PNOA 2KSSA 4OVAA 3ZBDA 2CZ1B 3NFCA 4C0DB 2OTLA 1BI2A 3RR6A 1UHCA 4PJLA 5GMKm 4LDVA 9ATCB 3FLGA 3RMQA 1VQ4A 5CKEA 2QA4Q 1RAAB 1UE9A 1D1CA 3KUFA 4KH0B 3EFOB 5IXFA 2XMFA 3JB9D 3ME9A 2ZZDA 4IKFA 2RO0A 3CC4Q 4M75A 3FEOA 1Y57A 4QQGA 1D0YA 1GBQA 2COWA 2V8IA 3QWXX 3JCMg 5GANd 2K6DA 1NBEB 4M77A 4CC3A 3GBQA 2ZPEB 3CC7Q 3EHQA 1YHQA 2EVRA 3RIRA 2OTJA 2HD0A 1Q82R 4J9HA 2OAUA 1X75C 4J83A 1VQKT 5GAN5 1PRMC 1M8VA 3UF4A 2CH4A 3OSSC 2CP5A 4FYWB 3G71A 2QK0A 3UATA 3PTAA 2DTHA 4JJNK 1VYUA 2A28A 1VIEA 1AEYA 1ZSZC 1KC8R 4PLIA 3CCJA 2EKHA 1IRXA 1PNJA 3KBGA 3RBBB 2JZ2A 3OYLA 4FYVB 2HEQA 5KE3A 4HVVA 1NPPA 3OB9A 3CXCS 1W70A 5IN1A 2DXUA 3U23A 3TVTA 2PQWA 2K4YA 1B34B 2L5QA 1AT1B 4PFOA 1KG1A 4F04B 1FMKA 2ZPGB 2QA4T 4JRIA 1Q7YC 1D0XA 1UGQB 4N4HA 3QKJA 3R6OA 2DPPB 2J06A 2P84A 4FYYB 2DZ9A 1VQMQ 3JCMf 2D1XA 1PD0A 5FWBA 1RAEB 4C92G 5HY6A 5FLXE 8ATCB 1A0NB 2JTEA 5KYNA 1MMNA 3CC4T 3CPWP 1HK9A 4LUDA 4A53A 1M1KU 1YITA 2JUFA 2RQUA 2QGGA 5GMKj 3CC7T 4E7LA 1N6AA 5CIUA 1YWOA 2IIMA 2XIDA 3VV0A 5KE2A 1VQ5A 1OU9A 1D3BB 3RUXA 1SRMA 3LGFA 2H3EB 4E7JA 2E3IA 2PVDB 3TQ7P 2FL7A 2LJ1A 4JRPA 4XTUA 4E7SA 2KBTA 3SHWA 3M59A 1TXQA 1WZOA 6AT1B 2RF0A 1E6HA 1RLQC 1KQSS 1Y96B 4IUUA 4QT7A 3TSWA 1WXUA 1OEBA 1XJWB 2L0AA 1QP3A 5GAMf 2CZ0B 2EQKA 3E9FA 2L89A 4BE1A 1I4K1 4GY5A 5A0LA 3OYEA 1PD1A 4AMCA 2O4XA 3MEVA 4XU2A 4AFSC 2DRKA 3OYAA 4UC4A 1Q86R 2HSEB 2G3RA 3N5BB 4XTWA 2ZAEA 1AVZC 3CCSQ 4LXCA 1JO8A 2BUDA 2CREA 4M7AA 1ZUKA 3M4GA 4DQ2A 5HK3A 2RHZA 1U1SA 4J9GA 3CBPA 4J9EA 5A0GA 4JRKA 5ECAA 4HVWA 3EG9A 1GFCA 3D7SB 4A63B 1QVFP 2DRMA 3H41A 4D8DA 1VQMT 1M27C 1TOVA 3TCJA 5GANj 4XU0A 2X51A 4HCBA 1VQNQ 1WJSA 2KT1A 2JVVA 1VQKA 1BKBA 4FYXB 5LJ5d 2K57A 2YUNA 3C12A 4DOVA 1W2BP 3WVEB 3CBMA 3JCMQ 2M02A 3LGLA 2KNBB 3V7CA 1VQ7Q 4JJDA 1YJ9Q 4EIKA 2CUDA 1T3SA 2NLUA 4M75B 1J3TA 4BY6C 4FU6A 3OYGA 1N27A 3CD6Q 4BDYA 4FCYA 1R0CB 1QVGA 2AIRB 2OAWA 4M77B 2QQRA 3A8HB 1NLPC 4XU1A 1R0BG 4BE0A 4PJMA 2DAQA 5D7UA 4OMLA 1WXTA 1Y07A 4OP0A 2FZKB 1X2KA 2K79A 2VASA 2DJQA 4OGCA 5FROA 4AG1C 2OJ2A 2K5IA 5CKFA 1QKXA 4HCCA 3REBB 5IAYA 1TUGB 4DEXA 1VOMA 1EFNA 3G1JA 3LH0A 1GRIA 2HDAA 1FWZA 1O9SA 1PC0A 3QWYA 2P0PA 2E70A 1KQ2A 1X6BA 1M90R 3CCST 3PIPA 3JCMe 5GAN8 1JXOA 2DL8A 4VUBA 5FRNA 1KD1U 5IH2A 3RERA 3M0TA 1QVPA 4E2FB 3CC4A 2KRSA 4O5VA 3LX7A 4K11A 1UGPB 5J26A 4C8QC 4P5NA 3C95A 4A54A 4B9WA 3JB9G 2ED1A 5I21A 2QEXA 4B6MA 3PNWC 1NYFA 3URGA 1VQNT 4C0GA 1BIBA 5CQXA 3OA6A 1Q81C 4C92F 4RG2A 5GMKh 1YJ9T 4Z8AA 1M1KR 1PSFA 3OW2A 2YUPA 1YHQQ 3CD6T 3E19A 1IXDA 1UECA 1BCOA 5GAMe 3X25B 1K8AU 4RMOA 1OPKA 4M75E 2XDPA 1K9MU 1Z9ZA 1N9RA 2D8HA 1KHIA 3MHXA 2WSFE 2YRDA 4M77E 1TTHB 5FU7C 4MZPA 4AT1B 1OYXA 2O2OA 1WQ7A 5LJ3d 2DYBA 2AK5A 2A36A 4M7DB 2QAZA 2C0OA 2PZ1A 4A4EA 2Y90A 2CS7A 4FSSA 4LNPA 2EJGA 1OZ2A 3CCJQ 3JV3A 4F14A 1YN8A 3GNGA 2GFUA 3GOXA 2HZYA 4C8QF 5I2MA 2DEUA 2LQNA 4DBRA 2HKNA 2B86A 2O4XB 1BI0A 2DLPA 1VA7A 3VUZA 4BI3A 2EYXA 2KR3A 1RACB 1PSEA 4R0KA 1PG5B 1RUWA 3V8JA 4PJOG 1VIFA 2K3XA 1GL5A 2GBQA 1AHJB 2EYQA 2GFAA 3RESA 3CXCP 4JJCA 1QKWA 5CR2A 1LCKA 3MO8A 1H8KA 2ROTA 3DB3A 3VS3A 2BTTA 1Q82U 2P4RA 1BI1A 4M78C 2DXCA 3HL8A 4ZGJB 5GANh 4J9DA 1QQJA 5GMKi 2VGMA 3DB4A 4IUQA 5C6SA 2D9TA 1C6VX 2DE0X 2DEQA 4M75D 2XK0A 1N8RC 3H8ZA 1TUCA 3LWIA 4M77D 2RQWA 5HK0A 5A2QE 3A5ZB 1XQHA 1YNZA 4J8OA 2DJZA 2E1HA 2LZ6B 3LWHA 2SEMA 3MP1A 2FZCB 1RABB 1G3TA 3UPUA 2A3LA 3X24B 2JMAA 1NEGA 5M9OA 4KUDK 4XTZA 2EYWA 2PU9B 2XDBA 4R56A 1LJOA 2QQBA 4FIBA 3CCJT 3H0HA 4LD6A 4M7DE 1ZHIA 5KCHA 2LJ0A 2C0TA 1ACMB 1WX6A 3M57A 4J5YA 1KQSP 4CC2A 3RKYA 2JM8A 2A08A 2NYSA 2WSCE 4MZMA 2KGTA 4QVZA 4WCIA 2L2PA 2P4TA 4L5GA 2J6KA 2EGAA 1ABQA 5GAN7 1VQNA 4NL3A 1RAFB 3PMTA 5GAMd 5L23A 1X43A 1KD1R 4C0ZA 2MAMA 4ZNXA 3QPHA 2AZSA 1YJ9A 2KYMA 4N4IA 2IPOB 3CD6A 1K1ZA 3EGDB 5KYYA 3QDFA 4M7AE 4MDWA 3TU4K 8AT1B 5KYWB 3JB9F 4D8KA 3A98A 1YI2Q 4J9IA 2MWPA 4F7UG 1H3ZA 3EG0A 4L6V5 1KC8C 4HT9A 2KVQG 2COZA 3OS0A 4PJOC 1OOTA 3MP8A 1BBZA 2O88A 2YUOA 3PIOA 1JBMA 2DM1A 1M5Q1 1K76A 3UA7A 1I81A 1JJ2A 1PKTA 4IUPA 1JQQA 2E41A 3WVDB 4ZN1A 1Q86U 1K8AR 1U1TA 4M7DD 2XU8A 2MOXA 1K9MR 2M0YA 5I11A 4XAXB 5CAIA 1UGRB 3E9GA 1WYXA 4HVUA 1SHFA 1NE8A 2HCKA 1X27A 3INZA 3GPLA 2QDLA 2DK3A 4MZTA 2LT4A 3QYGB 1SG5A 2EIFA 2EAYA 4JS4A 4FT2A 2DVJA 1AWXA 2E12A 3JCMb 2GCXA 2H3JA 1W4SA 1KK7A 1E7OA 4OB1B 4M4ZA 1SHGA 3M0SA 4C92A 2GGRA 3M5AA 2O31A 2FPDA 2EWNA 3PFSA 5LJ5h 1U5SA 4PJOF 3ASKA 1H92A 3REAB 4EPCA 3BW1A 1S72Q 1EX4A 3RKXA 2CDTA 5EG2A 2KRNA 3NHNA 2QEXQ 3O5ZA 5CCAA 4C0DC 3OYHA 4OGEA 1YI2T 2OX7A 2QQSA 3JCMc 2HBPA 3MKDA 2YLCA 1EZZB 1I1JA 2YLBA 2Y4YA 3LYIA 2FZGB 4PJJA 3QBYA 2DXTA 4LN2A 2PNIA 4HT8A 2M16A 1UJYA 2LCLA 5I2SA 3X28B 4DA4A 2YDLA 4C8QA 4XQ3A 1I07A 2EFIA 2VXEA 2NUTA 2JW4A 4ZN3A 4J6YA 3SWNA 1M90U 4EDUA 3RDVA 5KH6A 2F1LA 1MHNA 4ZTJA 3LW5E 2BIVA 3H0FA 4OMMA 2JJ9A 2JMCA 2F69A 3UWNA 1B3QA 1IZ6A 4GBQA 2GF7A 3HFOA 2CP6A 1KFZA 3J81E 1QVGS 1NPRA 3G4SQ 2V8KA 3EGXA 1X6GA 1U8RA 1WHMA 3JCMP 2X4XA 5DM7R 4J6WA 2DD5A 3NTHA 2XHCA 5GAMj 4HCZA 2MI6A 2DL3A 3MEAA 3PMIA 2G6FX 3CCVA 4E7IA 1FXXA 2A37A 4B9XA 4CC4B 3H6ZA 2JOYA 4HCKA 1R8OB 4CI0C 1S72T 2QASA 4GLMA 4Q5WA 4FW2A 2QEXT 2HQXA 4J7FA 4HKEA 4WTOB 3P8HA 2RM4A 3AT1B 3QG1A 3FB9A 4D6WA 2DKGA 4MMKA 4F7UF 3BE3A 2ENMA 2F5TX 1VQ6T 1WHJA 1WXBA 3HTRA 3M9QA 4PFPA 5LJ3h 2QGFB 2HNIA 4C8QG 4II1A 1X69A 1WQWA 2O9VA 1LOJA 3M55A 4OMNA 2J7IA 1NM7A 3QO3A 4J9CA 1AWJA 1AWOA 1LNXA 1TH7A 3FIFA 1V29B 3OW2S 1MMGA 3HPWA 3QIIA 3CMEA 2DVEA 4E7KA 1T3LA 5LL6S 3G4ST 4BD3A 1D09B 4Z89A 5AYFA 3M53A 1OX8A 2MF2A 4JDSA 4QKUA 4X9DA 5GAOq 4BDZA 1MMAA 1PWTA 1BCMA 5GANg 5GAN6 3HFNA 3NMZC 1G8XA 4PFZA 4LDUA 2ED0A 3WXMB 2C0IA 1M1KC 2EYZA 3JCMJ 2CYZB 2V26A 2NUZA 1YI2A 2QI2A 3JRZA 3SD4A 1OI1A 1OX9A 1QWFA 2R5MA 2LCCA 3HRTA 3V7RA 3EGUA 3O8VA 1BI3A 2DA9A 2L8DA 2FEIA 2RPNA 4FL6A 4C92B 2RJCA 2ZGWA 3OYDA 2XG8D 1VQ8A 2DL4A 1B7TA 5FRMA 3PVLA 3QJ6A 2YRCA 1WJRA 2SRCA 3OY9A 4C5IA 1SRLA 2FVUA 4JZ4A 4WF2A 1BIAA 3H0IA 1KHCA 4HXJA 2HAXA 4N0AC 2GQIA 3CCUQ 4RTTA 3H9NA 4AFUC 3LLRA 2DILA 1H641 1JU5C 4RUGA 5J3BA 2CT3A 2LVMA 4M7DG 4M78G 2DD4A 2L3RA 4RCCA 4Y91A 4Z02A 4RCBA 4RTZA 2ZPIB 4M75C 2LX9A 1ARKA 4LDXA 5IHNA 2EQUA 2YT6A 2KROA 4JLGA 2CKKA 3S3NA 2KT8A 2NUTB 3VS7A 3SWNB 1RI0A 1SF9A 2C06A 3VYGA 2X4JA 2P0QA 1BB9A 2DYIA 4LUEA 2ZPBB 4PK4A 2DTIA 2E65A 4PJOA 2JM9A 1QW1A 2I0NA 1NJIU 1BYMA 3RKWA 2I2LA 4DBFA 4E6RA 2KRMA 5GAMh 1UDLA 1PCXA 3EGXB 1S72A 2M9UA 1D1AA 3JB9I 3NTIA 3R6NA 1IO6A 4DBQA 3PE0A 1YJWQ 3VS0A 3M0QA 4FT4A 2RK2A 4J6XA 1ZUYA 4EMKC 4F17A 2K5LA 2V1QA 3HKSA 1D1BA 4KULA 1G3YA 4N4GA 4HA8A 2EYYA 3OS1A 2LT1A 2CZ6B 2EBPA 2M1HA 1M3AA 1ZBJA 1TS9A 5IT9E 5DLOA 3V8LA 1VQ6A 4ANJA 4C92E 3OYNA 2PUOB 2EW3A 2JXBA 4QQDA 1TU0B 2AKKA 1RI9A 2YRVA 1ZX6A 2R57A 3L2RA 3QDRB 3RNJA 4M75F 1JB0E 1K9AA 2CT4A 1VQ9Q 2ECZA 2ZCFB 1IGUA 1M2VA 3CCUT 4KBMB 3OS5A 1GXIE 1TWBA 2FPEA 1ZSGA 1E6GA 1G2BA 3UDCA 3ZFJA 2J6OA 1GFDA 3G4SA 4PKCC 2DIGA 1D0ZA 1ZBXA 2QXFA 4OMFB 2VUBA 3OMCA 4E7ZA 1QP2A 2ESWA 2GTJA 1JEGA 2VB6A 2PVOB 3VS1A 3L2WA 4F16A 3BY7A 1I5OB 2D6FA 2LNHB 1KD1C 1M30A 5IXBA 3CMAA 1UFFA 2W10A 1MGQA 1KSWA 2BZYA 2QDYB 2HMAA 3KFVA 1JJ2S 2QG9B 3SFMA 3S3OA 3EFOA 5LJ5g 2DXBA 4JZ3A 1K73U 2VC8A 4RG8A 4M7AB 1C0MA 3VS4A 1FYNA 3QZ5B 1U3OA 4C5HA 4XU3A 4M7DC 1ZSZA 2RHXA 3C94A 2E4HA 4OMOA 1K0XA 3OBWA 1QVGP 1FX7A 2FHDA 5GJWB 3CCVQ 1YJWT 3EG9B 1M4ZA 1HSQA 1X2QA 4C92D 2YWWA 4IURA 3G7ZA 1T0JA 1VQOQ 4MDXA 4IUTA 3CC2T
chains in the Genus database with same CATH topology
2L3PA 2PTKA 2L3SA 1WYXA 1GCQA 5I22A 4HVUA 1SHFA 2HCKA 1YWPA 1QWEA 1X27A 1YWOA 2QDLA 2IIMA 1NEBA 1SRMA 4J9BA 1K0SA 2RQTA 2LMJA 2X3WD 1Y0MA 2LJ1A 2DVJA 1AWXA 2KBTA 3SHWA 2KXCA 1G83A 1W1FA 4IIOA 2RF0A 1E6HA 1NG2A 1RLQC 1E7OA 1QCFA 4M4ZA 1SHGA 3M0SA 4RTWA 4QT7A 2GGRA 3TSWA 1WXUA 2DL5A 1K4US 2O31A 2VVKA 1OEBA 3TSZA 2FPDA 2L0AA 4OMPA 1U5SA 5FWCA 1H92A 3REAB 2D0NA 1GCPA 2CUBA 2CDTA 2EPDA 2KRNA 1H3HA 4AFSC 1N5ZA 3NHNA 2DRKA 4RTYA 2FRWA 3O5ZA 1KJWA 3PVQA 1AVZC 1I1JA 3M0PA 3VS5A 2DF6A 3THKA 1JO8A 1RLPC 2MIOA 2CREA 1UUEA 2YUQA 1ZUKA 1AZGB 2K7AA 3ZL7C 4LN2A 3ULRB 4J9GA 2PNIA 4J9EA 5ECAA 4J9FA 4HVWA 1UJYA 4RTXA 1GFCA 4A63B 1SSHA 1VYTA 2DRMA 3H41A 2YDLA 1I0CA 1HJDA 2HSPA 4D8DA 1M27C 2DX1A 1I07A 2JW4A 2CH4W 1ZLMA 3NGPA 3VS6A 2KT1A 1MV3A 1AZEA 3H0FA 2YUNA 4OMMA 2JMCA 1B3QA 1M3CA 1YP5A 4GBQA 1M8MA 1GCQC 1KFZA 2KNBB 3CQTA 4JJDA 4EIKA 1VYVA 1T3SA 2CUDA 1J3TA 1MV0B 1X6GA 1UHFA 2DNUA 1AD5A 2OAWA 5IHIA 2BZXA 1XOVA 1NLPC 1YCSB 2F2XA 2DL3A 4LE9A 1AWWA 1JXMA 1CSKA 2G6FX 1UJ0A 2H8HA 4OMLA 1ABOA 1WXTA 2LX7A 2A37A 1X2KA 2MCNA 1Z9QA 2FRYA 2K79A 2KYBA 4CC4B 2W0ZA 3NPFA 2DJQA 4AG1C 2OJ2A 4HCKA 5HCKA 1QKXA 1WIEA 3REBB 1U06A 1UTIA 1MUZA 2KXDA 2K3BA 4DEXA 4GLMA 1EFNA 2ABLA 3M0RA 3C0CA 1GRIA 2HDAA 3VRYA 2GTOA 3QWYA 2JS2A 1X6BA 1NYGA 3M0UA 2AZVA 1JXOA 2DL8A 5IH2A 3M0TA 2DBMA 3EG1A 1CKBA 2KRSA 2ENMA 1WXBA 4K11A 1X69A 2O9VA 4IIMA 4OMNA 2ED1A 2EGCA 2J7IA 1NM7A 2RMOA 1NYFA 4J9CA 1ZUUA 1AWJA 2FG0A 1AWOA 4CC7A 1V1CA 1WLPB 2DL7A 4Z8AA 1T3LA 1KIKA 4Y92A 2YUPA 4Z89A 3VS2A 1UECA 3SEMA 2LJ3A 1OPKA 1OV3A 1HD3A 2L3QA 1Z9ZA 1PWTA 2KE9A 2D8HA 1T0HA 3I35A 3NMZC 4AFZC 2ED0A 2C0IA 2LCSA 2EYZA 2O2OA 3LH5A 2DYBA 2AK5A 2DMOA 2A36A 1PKSA 1QLYA 2NUZA 2C0OA 3EHRA 2PZ1A 1OPLA 2RN8A 2J6FA 3I5RA 1QWFA 4AFQC 2E5KA 3VRZA 4FSSA 2DA9A 1S1NA 2RPNA 3EGUA 4LNPA 2FEIA 1PHTA 3EG2A 3JV3A 4F14A 1WI7A 1YN8A 3FJ5A 2DL4A 3PVLA 3I9QA 2LQNA 2SRCA 1PRLC 2EGEA 2B86A 1SRLA 1WFWA 4DEYA 4JZ4A 2DLPA 4X1VA 2ROLA 1VA7A 2EYXA 2KR3A 1NLOC 3H0IA 2D8JA 2LQWA 4R0KA 1RUWA 4HXJA 1W6XA 1GL5A 2GBQA 2GQIA 2YSQA 1AOJA 4RTTA 4JJCA 4AFUC 2DILA 1QKWA 2K9GA 4JJBA 1JU5C 1LCKA 4RUGA 1H8KA 2ROTA 2CT3A 3VS3A 2BTTA 2P4RA 1BK2A 1WA7A 2AKLA 4J9DA 2GNCA 4RTZA 1GBRA 1ARKA 5IHNA 5IHKA 2DE0X 2YT6A 2KROA 1TUDA 2KT8A 2VWFA 5FW9A 1TUCA 3VS7A 2RQRA 2F2VA 2CSQA 2RQWA 2V1RA 2HBWA 1BB9A 4LUEA 1UHCA 2JM9A 2I0NA 1YNZA 2LP5A 5GJVB 2JS0A 4E6RA 2KRMA 2LZ6B 1UDLA 1UE9A 2SEMA 5IXFA 1SPKA 3R6NA 1IO6A 2XMFA 3PE0A 2JMAA 1NEGA 1WDXA 3VS0A 3M0QA 2BZ8A 2RQVA 1ZUYA 4F17A 2V1QA 2EYWA 1Y57A 1GBQA 1UG1A 2EYYA 3QWXX 2EBPA 2K6DA 4CC3A 3GBQA 3H0HA 1M3AA 3EHQA 1ZBJA 2LJ0A 2C0TA 2EVRA 2FO0A 2J05A 4RTUA 1WX6A 4J9HA 3EG3A 2EQIA 4Z88A 2RNAA 4CC2A 1BU1A 2EW3A 2JXBA 2JM8A 2A08A 1PRMC 1B07A 3UF4A 2CH4A 2AKKA 1RI9A 2KGTA 1ZX6A 4WCIA 1UGVA 2OI3A 2L2PA 3RNJA 2J6KA 2CT4A 1K9AA 2EGAA 1ABQA 2ECZA 2VKNA 3UATA 4AG2C 2KEAA 5L23A 1X43A 1VYUA 2A28A 4ESRA 2FPEA 1ZSGA 1E6GA 4OMQA 1AEYA 4ZNXA 2AZSA 2KYMA 1G2BA 2FPFA 2J6OA 4ORZA 1GFDA 2EKHA 1PNJA 3RBBB 2CSIA 2HEQA 2X3XD 1K1ZA 4HVVA 2ESWA 2GTJA 1JEGA 1W70A 3VS1A 3I5SA 4D8KA 4F16A 3A98A 2O9SA 3U23A 3IQLA 4J9IA 3TVTA 2LNHB 1M30A 5IXBA 2JT4A 3EG0A 2K2MA 1UFFA 2W10A 1CKAA 1KSWA 1OOTA 2BZYA 2M51A 3KFVA 1BBZA 2F2WA 2O88A 2YUOA 1FMKA 5EC7A 2DM1A 4JZ3A 2NWMA 1K76A 3UA7A 1SEMA 4RTVA 3VS4A 1FYNA 1PKTA 1U3OA 4JPBW 2J06A 1JQQA 2DBKA 4OMOA 1K0XA 5GJWB 2MOXA 2D1XA 5FWBA 3UA6A 1A0NB 2JTEA 2M0YA 1HSQA 1X2QA 5I11A 4LUDA 1T0JA 2RQUA 1TG0A 1M3BA 4KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3P A;  2PTK A;  2L3S A;  1WYX A;  1GCQ A;  5I22 A;  4HVU A;  1SHF A;  2HCK A;  1YWP A;  1QWE A;  1X27 A;  1YWO A;  2QDL A;  2IIM A;  1NEB A;  1SRM A;  4J9B A;  1K0S A;  2RQT A;  2LMJ A;  2X3W D;  1Y0M A;  2LJ1 A;  2DVJ A;  1AWX A;  2KBT A;  3SHW A;  2KXC A;  1G83 A;  1W1F A;  4IIO A;  2RF0 A;  1E6H A;  1NG2 A;  1RLQ C;  1E7O A;  1QCF A;  4M4Z A;  1SHG A;  3M0S A;  4RTW A;  4QT7 A;  2GGR A;  3TSW A;  1WXU A;  2DL5 A;  1K4U S;  2O31 A;  2VVK A;  1OEB A;  3TSZ A;  2FPD A;  2L0A A;  4OMP A;  1U5S A;  5FWC A;  1H92 A;  3REA B;  2D0N A;  1GCP A;  2CUB A;  2CDT A;  2EPD A;  2KRN A;  1H3H A;  4AFS C;  1N5Z A;  3NHN A;  2DRK A;  4RTY A;  2FRW A;  3O5Z A;  1KJW A;  3PVQ A;  1AVZ C;  1I1J A;  3M0P A;  3VS5 A;  2DF6 A;  3THK A;  1JO8 A;  1RLP C;  2MIO A;  2CRE A;  1UUE A;  2YUQ A;  1ZUK A;  1AZG B;  2K7A A;  3ZL7 C;  4LN2 A;  3ULR B;  4J9G A;  2PNI A;  4J9E A;  5ECA A;  4J9F A;  4HVW A;  1UJY A;  4RTX A;  1GFC A;  4A63 B;  1SSH A;  1VYT A;  2DRM A;  3H41 A;  2YDL A;  1I0C A;  1HJD A;  2HSP A;  4D8D A;  1M27 C;  2DX1 A;  1I07 A;  2JW4 A;  2CH4 W;  1ZLM A;  3NGP A;  3VS6 A;  2KT1 A;  1MV3 A;  1AZE A;  3H0F A;  2YUN A;  4OMM A;  2JMC A;  1B3Q A;  1M3C A;  1YP5 A;  4GBQ A;  1M8M A;  1GCQ C;  1KFZ A;  2KNB B;  3CQT A;  4JJD A;  4EIK A;  1VYV A;  1T3S A;  2CUD A;  1J3T A;  1MV0 B;  1X6G A;  1UHF A;  2DNU A;  1AD5 A;  2OAW A;  5IHI A;  2BZX A;  1XOV A;  1NLP C;  1YCS B;  2F2X A;  2DL3 A;  4LE9 A;  1AWW A;  1JXM A;  1CSK A;  2G6F X;  1UJ0 A;  2H8H A;  4OML A;  1ABO A;  1WXT A;  2LX7 A;  2A37 A;  1X2K A;  2MCN A;  1Z9Q A;  2FRY A;  2K79 A;  2KYB A;  4CC4 B;  2W0Z A;  3NPF A;  2DJQ A;  4AG1 C;  2OJ2 A;  4HCK A;  5HCK A;  1QKX A;  1WIE A;  3REB B;  1U06 A;  1UTI A;  1MUZ A;  2KXD A;  2K3B A;  4DEX A;  4GLM A;  1EFN A;  2ABL A;  3M0R A;  3C0C A;  1GRI A;  2HDA A;  3VRY A;  2GTO A;  3QWY A;  2JS2 A;  1X6B A;  1NYG A;  3M0U A;  2AZV A;  1JXO A;  2DL8 A;  5IH2 A;  3M0T A;  2DBM A;  3EG1 A;  1CKB A;  2KRS A;  2ENM A;  1WXB A;  4K11 A;  1X69 A;  2O9V A;  4IIM A;  4OMN A;  2ED1 A;  2EGC A;  2J7I A;  1NM7 A;  2RMO A;  1NYF A;  4J9C A;  1ZUU A;  1AWJ A;  2FG0 A;  1AWO A;  4CC7 A;  1V1C A;  1WLP B;  2DL7 A;  4Z8A A;  1T3L A;  1KIK A;  4Y92 A;  2YUP A;  4Z89 A;  3VS2 A;  1UEC A;  3SEM A;  2LJ3 A;  1OPK A;  1OV3 A;  1HD3 A;  2L3Q A;  1Z9Z A;  1PWT A;  2KE9 A;  2D8H A;  1T0H A;  3I35 A;  3NMZ C;  4AFZ C;  2ED0 A;  2C0I A;  2LCS A;  2EYZ A;  2O2O A;  3LH5 A;  2DYB A;  2AK5 A;  2DMO A;  2A36 A;  1PKS A;  1QLY A;  2NUZ A;  2C0O A;  3EHR A;  2PZ1 A;  1OPL A;  2RN8 A;  2J6F A;  3I5R A;  1QWF A;  4AFQ C;  2E5K A;  3VRZ A;  4FSS A;  2DA9 A;  1S1N A;  2RPN A;  3EGU A;  4LNP A;  2FEI A;  1PHT A;  3EG2 A;  3JV3 A;  4F14 A;  1WI7 A;  1YN8 A;  3FJ5 A;  2DL4 A;  3PVL A;  3I9Q A;  2LQN A;  2SRC A;  1PRL C;  2EGE A;  2B86 A;  1SRL A;  1WFW A;  4DEY A;  4JZ4 A;  2DLP A;  4X1V A;  2ROL A;  1VA7 A;  2EYX A;  2KR3 A;  1NLO C;  3H0I A;  2D8J A;  2LQW A;  4R0K A;  1RUW A;  4HXJ A;  1W6X A;  1GL5 A;  2GBQ A;  2GQI A;  2YSQ A;  1AOJ A;  4RTT A;  4JJC A;  4AFU C;  2DIL A;  1QKW A;  2K9G A;  4JJB A;  1JU5 C;  1LCK A;  4RUG A;  1H8K A;  2ROT A;  2CT3 A;  3VS3 A;  2BTT A;  2P4R A;  1BK2 A;  1WA7 A;  2AKL A;  4J9D A;  2GNC A;  4RTZ A;  1GBR A;  1ARK A;  5IHN A;  5IHK A;  2DE0 X;  2YT6 A;  2KRO A;  1TUD A;  2KT8 A;  2VWF A;  5FW9 A;  1TUC A;  3VS7 A;  2RQR A;  2F2V A;  2CSQ A;  2RQW A;  2V1R A;  2HBW A;  1BB9 A;  4LUE A;  1UHC A;  2JM9 A;  2I0N A;  1YNZ A;  2LP5 A;  5GJV B;  2JS0 A;  4E6R A;  2KRM A;  2LZ6 B;  1UDL A;  1UE9 A;  2SEM A;  5IXF A;  1SPK A;  3R6N A;  1IO6 A;  2XMF A;  3PE0 A;  2JMA A;  1NEG A;  1WDX A;  3VS0 A;  3M0Q A;  2BZ8 A;  2RQV A;  1ZUY A;  4F17 A;  2V1Q A;  2EYW A;  1Y57 A;  1GBQ A;  1UG1 A;  2EYY A;  3QWX X;  2EBP A;  2K6D A;  4CC3 A;  3GBQ A;  3H0H A;  1M3A A;  3EHQ A;  1ZBJ A;  2LJ0 A;  2C0T A;  2EVR A;  2FO0 A;  2J05 A;  4RTU A;  1WX6 A;  4J9H A;  3EG3 A;  2EQI A;  4Z88 A;  2RNA A;  4CC2 A;  1BU1 A;  2EW3 A;  2JXB A;  2JM8 A;  2A08 A;  1PRM C;  1B07 A;  3UF4 A;  2CH4 A;  2AKK A;  1RI9 A;  2KGT A;  1ZX6 A;  4WCI A;  1UGV A;  2OI3 A;  2L2P A;  3RNJ A;  2J6K A;  2CT4 A;  1K9A A;  2EGA A;  1ABQ A;  2ECZ A;  2VKN A;  3UAT A;  4AG2 C;  2KEA A;  5L23 A;  1X43 A;  1VYU A;  2A28 A;  4ESR A;  2FPE A;  1ZSG A;  1E6G A;  4OMQ A;  1AEY A;  4ZNX A;  2AZS A;  2KYM A;  1G2B A;  2FPF A;  2J6O A;  4ORZ A;  1GFD A;  2EKH A;  1PNJ A;  3RBB B;  2CSI A;  2HEQ A;  2X3X D;  1K1Z A;  4HVV A;  2ESW A;  2GTJ A;  1JEG A;  1W70 A;  3VS1 A;  3I5S A;  4D8K A;  4F16 A;  3A98 A;  2O9S A;  3U23 A;  3IQL A;  4J9I A;  3TVT A;  2LNH B;  1M30 A;  5IXB A;  2JT4 A;  3EG0 A;  2K2M A;  1UFF A;  2W10 A;  1CKA A;  1KSW A;  1OOT A;  2BZY A;  2M51 A;  3KFV A;  1BBZ A;  2F2W A;  2O88 A;  2YUO A;  1FMK A;  5EC7 A;  2DM1 A;  4JZ3 A;  2NWM A;  1K76 A;  3UA7 A;  1SEM A;  4RTV A;  3VS4 A;  1FYN A;  1PKT A;  1U3O A;  4JPB W;  2J06 A;  1JQQ A;  2DBK A;  4OMO A;  1K0X A;  5GJW B;  2MOX A;  2D1X A;  5FWB A;  3UA6 A;  1A0N B;  2JTE A;  2M0Y A;  1HSQ A;  1X2Q A;  5I11 A;  4LUD A;  1T0J A;  2RQU A;  1TG0 A;  1M3B A;  4KRT A; 
#chains in the Genus database with same CATH topology
 2PTK A;  4F7U A;  1M2O A;  1WHK A;  1YWP A;  1QWE A;  3OYF A;  1K8A C;  2DO3 A;  1NEB A;  5FU6 B;  3FC3 A;  1OU8 A;  1K9M C;  4J9B A;  2KAF A;  1K0S A;  4Y28 E;  2IG0 A;  2RI5 A;  3JCM d;  1WGS A;  3L42 A;  3L2U A;  2K2V A;  3GIB A;  2RJE A;  4ELZ C;  2KXC A;  1W1F A;  1VQ9 T;  4ZTF A;  1NG2 A;  2RK1 A;  5CKB A;  1QCF A;  1IRE B;  2DER A;  2DL5 A;  5CQY A;  4OMP A;  3HSB A;  5FWC A;  2CUB A;  4IUV A;  3X26 B;  1N5Z A;  1WHL A;  4RTY A;  2E5Q A;  3ER0 A;  4M7D F;  3HRS A;  2A7Y A;  4M78 F;  2RI2 A;  3PVQ A;  3M0P A;  3VS5 A;  3THK A;  1RLP C;  3CME Q;  2MIO A;  1UUE A;  2CP0 A;  2YUQ A;  3UT1 A;  3V8K A;  3EFS A;  4A4K A;  2K7A A;  3ZL7 C;  4QVD A;  2YHT A;  2QQA A;  4XTX A;  1Q82 C;  2K3Y A;  4RTX A;  4YTL A;  3OW2 P;  1NJI R;  1LPL A;  2KY9 A;  4PJO B;  2K5F A;  3CCV T;  3CCL Q;  5GAO l;  1YCY A;  1JRI A;  2CH4 W;  2CGH A;  1ZLM A;  5KCO A;  1PM3 A;  2DIQ A;  3JCM X;  2QTX A;  1M8M A;  1VQO T;  1GCQ C;  2E3H A;  2IVW A;  2DET A;  3CQT A;  3E1S A;  2RHY A;  4KUI A;  4BI4 A;  4QVC A;  1YJN A;  3CCU A;  4C5E A;  1MV0 B;  1VQ8 Q;  5LJ3 g;  1AD5 A;  2DNU A;  5IHI A;  2BZX A;  1XOV A;  4KGZ B;  2F2X A;  2XIC A;  3CPW A;  2LNV A;  4BI8 B;  1WJQ A;  3JAM E;  3DLM A;  3G6E A;  1WNL A;  5GAO p;  3OYY A;  2XKO C;  3BFM A;  1V76 A;  1Z9Q A;  2FRY A;  2X4W A;  2W0Z A;  2LRQ A;  5HCK A;  4KGX B;  1M2V B;  4QW2 A;  4DOW A;  1U06 A;  1UTI A;  1MUZ A;  2KXD A;  2K3B A;  2ABL A;  3M0R A;  3C0C A;  3VRY A;  2GTO A;  2JTF A;  3I56 Q;  4LDY A;  1NYG A;  5D6X A;  3OYI A;  2WAC A;  3HRU A;  2B8A A;  1DJ7 B;  3M0U A;  2AZV A;  4JLI A;  3CME T;  1YJW A;  2JTM A;  4M7A D;  3EG1 A;  4CRI A;  1Y71 A;  4N0A A;  2ZPF B;  5GAN 4;  3I55 T;  3CC2 A;  2X35 A;  5DY9 A;  4IIM A;  3V7S A;  3AHU A;  5KYU A;  1Q7Y U;  4PL6 A;  3PT9 A;  1K73 R;  3CCL T;  4E7H A;  2EGC A;  2RMO A;  3FDR A;  3GP8 A;  1ZUU A;  4PJO E;  5GAN 2;  1ZSZ B;  4CC7 A;  1V1C A;  2DL7 A;  5LJ3 f;  3C4S A;  1G3S A;  2AT1 B;  2X4Y A;  1VQ9 A;  1KIK A;  4BB7 A;  1C1A A;  4Y92 A;  1NZ9 A;  7AT1 B;  1QVF A;  3A8L B;  3VS2 A;  1VQ8 T;  5KYX A;  3SEM A;  4F7U B;  1VQ6 Q;  3P8B B;  1OV3 A;  1Q86 C;  4TVR A;  1HXD A;  3I35 A;  3OYB A;  3VKI A;  1W2B A;  4OF1 A;  2EJ9 A;  1OQK A;  3P8D A;  2LCS A;  2E64 A;  1QCO A;  1PKS A;  1VQL A;  1OPL A;  2RN8 A;  2J6F A;  1FMV A;  4EMK A;  1YIJ A;  1SKU B;  5LJ5 e;  2E5K A;  2DFU A;  1RL2 A;  1PHT A;  3EG2 A;  1VQP A;  5GAO r;  1WI7 A;  2AHJ B;  4FM4 B;  4XK8 E;  4QQ6 A;  5GAM g;  3FJ5 A;  2E10 A;  2R5A A;  3I9Q A;  3I56 T;  2RB6 A;  2RH2 A;  1WFW A;  1MNE A;  4X9C A;  4DEY A;  3Q1J A;  3A8G B;  3CMA Q;  1W6X A;  4RKU E;  2YSQ A;  3DLL A;  1TG0 A;  4PJO D;  3SDZ A;  3M4Y A;  2A0F B;  1VQO A;  2GQV A;  4BAC A;  2AKL A;  2Y4X A;  3OBY A;  3EAE A;  3S3M A;  2GNC A;  4M75 G;  2MWO A;  1JJ2 P;  5GAO m;  4ATO A;  2VWF A;  5FW9 A;  5KYY B;  4M77 G;  3CCE A;  2F2V A;  2CSQ A;  2CZ7 B;  2V1R A;  3CCM Q;  2HBW A;  3BDL A;  3CBO A;  3OYM A;  3CCR A;  2BE9 B;  3NTK A;  3KXT A;  2MPX C;  2LP5 A;  1MND A;  5GJV B;  2JS0 A;  2KMT A;  3MEU A;  3QHS A;  4V2S A;  1M90 C;  2FYK A;  1SPK A;  4F7U E;  4M7D A;  3QJY A;  3JSC A;  4M78 A;  2VYT A;  3CPF A;  1WDX A;  1YBY A;  3CCQ Q;  2BZ8 A;  2E6N A;  2RQV A;  3OYJ A;  5AT1 B;  5C0M A;  1UG1 A;  5J39 A;  1ZQ1 A;  1M9S A;  2E6Z A;  3DKM A;  4OB2 B;  2FO0 A;  2J05 A;  2RD1 A;  4RTU A;  3EG3 A;  2EQI A;  4JS5 A;  4Z88 A;  5A0D A;  2RNA A;  2KI7 A;  3I55 A;  1BU1 A;  2M0O A;  3EFR A;  1B07 A;  4FSX A;  4BY6 B;  1UGV A;  2OI3 A;  4FW1 A;  3CCL A;  2X9H A;  1RAH B;  3CMA T;  2F5K A;  2VKN A;  4AG2 C;  1R77 A;  2KEA A;  4ME7 A;  5LJ3 e;  4ESR A;  3J80 E;  4OMQ A;  2MMP A;  4A4F A;  2FPF A;  4ORZ A;  2LTO A;  2CSI A;  3L2V A;  1ZA2 B;  2COY A;  2X3X D;  3A8M B;  3QYH B;  2EQJ A;  1WPY A;  5CO7 A;  1Q7Y R;  1MMD A;  4BUG A;  2ATC B;  4OB0 B;  5KYU B;  3L1A A;  2R58 A;  3I5S A;  2QYZ A;  2O9S A;  3CXC A;  3IQL A;  2JT4 A;  3JCM h;  3BDU A;  3CCM T;  2K2M A;  3CEY A;  1Q81 U;  3OYK A;  2YXY A;  3ZEH A;  1CKA A;  2M51 A;  1YJN Q;  2F2W A;  5EC7 A;  5D6Y A;  2NWM A;  2NUP A;  1SEM A;  1G5V A;  4RTV A;  4JPB W;  5KYX B;  2DBK A;  3GLX A;  2HL3 A;  4C92 C;  3G6E Q;  2PUK B;  3CCQ T;  3UA6 A;  5GAO n;  3I56 A;  4C8Q B;  1OZ3 A;  2KK4 A;  2CP7 A;  4XTY A;  2BKD N;  4M77 C;  4R55 A;  5CKD A;  1M3B A;  4KRT A;  2L3P A;  1HYO A;  2L3S A;  1GCQ A;  5I22 A;  2LDM A;  3OMG A;  5GAN f;  3VJP A;  4EMK B;  1WHG A;  4XTV A;  2QA4 A;  2RQT A;  2EQM A;  2XD0 A;  2LMJ A;  2VXF A;  3VU3 C;  2VV5 A;  1Y0M A;  2X3W D;  3MP6 A;  1VUB A;  4EMH A;  4M7A G;  2QTV A;  1G83 A;  4IIO A;  2OTL Q;  2DTO A;  3VUB A;  4RTW A;  3M56 A;  2HQE A;  1K4U S;  2KDS A;  2VVK A;  3TSZ A;  3EGD A;  1VQ4 Q;  5FU7 B;  1KQS A;  3CC7 A;  3CC2 Q;  2D0N A;  3SWN C;  1F1B B;  1GCP A;  2ZPH B;  3L2Z A;  5KYW A;  4A4H A;  2EPD A;  1H3H A;  2QQ9 A;  2FRW A;  3EH1 A;  1IHW A;  4PLL A;  4KGV B;  1KJW A;  2JNG A;  1N8R U;  1VQ7 T;  2DF6 A;  3MET A;  3OSV A;  1RAD B;  2LC4 A;  1YJN T;  3L2Q A;  1AZG B;  2FB7 A;  1X6O A;  4X34 A;  1UB4 A;  4M77 F;  3ULR B;  2OTJ Q;  3GF5 A;  2EKO A;  4J9F A;  4GLK A;  4O6J A;  3GNF B;  1SSH A;  1VYT A;  1I0C A;  1HJD A;  2HSP A;  3HP9 A;  2DX1 A;  4JRQ A;  3G6E T;  1X01 A;  3NGP A;  3VS6 A;  3G71 Q;  4KT0 E;  5D6W A;  5HKC A;  4ZGE B;  2D0Q B;  1MV3 A;  1AZE A;  1ZA1 B;  1M1F A;  4M78 B;  1M3C A;  1YP5 A;  2O01 E;  5GMK e;  1VQL Q;  1YIJ Q;  4EMG A;  1VYV A;  4C8Q E;  5GMK l;  3E2U A;  1VQP Q;  1NJI C;  2DZC A;  3JCM W;  2JN0 A;  3QSU A;  2RHU A;  1UHF A;  1TSF A;  3CPW S;  3JCM V;  2RJF A;  1YCS B;  1UGS B;  1RAG B;  3EH2 A;  1Y7X A;  4LE9 A;  1AWW A;  1JXM A;  1CSK A;  1VQM A;  5DLQ E;  1UJ0 A;  2H8H A;  1O75 A;  1EIF A;  1ABO A;  2LX7 A;  2MCN A;  3OQ5 A;  2OTL T;  3A1P A;  4DBH A;  5CKH A;  2KYB A;  4NS5 A;  3NPF A;  1VQ4 T;  2P0K A;  5LJ5 j;  3CCM A;  1WIE A;  1KQ1 A;  2LQ8 A;  3QZ9 B;  1YFN A;  2JS2 A;  2RI3 A;  1QMC A;  4PJN A;  4J7I A;  1YIT Q;  3CCE Q;  1IHV A;  4M7A C;  2HKQ B;  1OUL A;  3PGG A;  3CCQ A;  2MYS A;  2RA2 A;  1YHQ T;  2DBM A;  4OB3 B;  1CKB A;  1KC8 U;  4L59 A;  2XDD A;  3CCR Q;  2OTJ T;  1VQ5 Q;  1Q81 R;  3M54 A;  4E47 A;  4KH1 B;  1N9S A;  2WSE E;  1IB8 A;  5CVI A;  4C8Q D;  5GAN e;  3T9N A;  3F70 A;  2MK5 A;  2NUP B;  3S6W A;  3RMS A;  3QXE B;  3SB2 A;  3G71 T;  3A8O B;  2LQK A;  2FG0 A;  2EJF A;  1B34 A;  5FU6 C;  1M1G A;  1VQL T;  1WLP B;  2KQW A;  1YIJ T;  1QVF S;  3CCS A;  3HHT B;  5LJ5 f;  1VQP T;  1Q95 G;  4LDW A;  4M78 E;  1K73 C;  2PVG B;  2HL5 C;  2LJ3 A;  3QUI A;  2CP3 A;  1W2B S;  1HD3 A;  1FMW A;  3I55 Q;  3MJX A;  2L3Q A;  2RHI A;  2KE9 A;  3JB9 J;  1T0H A;  4ZGD B;  4AFZ C;  5GAN 3;  2CP2 A;  2Z0W A;  3VYH B;  3M58 A;  1P92 A;  3LH5 A;  2VGN A;  2DMO A;  1QLY A;  1QCN A;  3EHR A;  4M7A F;  4LD9 K;  3I5R A;  4AFQ C;  1D3B A;  3VRZ A;  1VQ7 A;  3JB9 H;  2V8J A;  1S1N A;  1I8F A;  2RJD A;  5L8R E;  5CK9 A;  3MCA B;  3TEE A;  3J7A F;  3MPU B;  2BE7 D;  4BE2 A;  4NL2 A;  1VQK Q;  1PRL C;  2EGE A;  4JUV A;  2XI9 A;  1YIT T;  3CCE T;  1Y96 A;  4X1V A;  2ROL A;  3OS2 A;  1XTD A;  1UEB A;  3TRE A;  1NLO C;  2D8J A;  2LQW A;  1G3W A;  4C5G A;  4A4G A;  1I5L A;  1AOJ A;  1N8R R;  3CCR T;  1VQ5 T;  2K9G A;  3FJP A;  4JJB A;  1LVK A;  3MEW A;  4MML A;  4NOY A;  5LJ3 j;  3X20 B;  2HQH A;  4ELY C;  3FRN A;  1BK2 A;  1IGQ A;  1WA7 A;  1RAI B;  4M78 D;  1SSF A;  1WHH A;  1GBR A;  5IHK A;  1XNI A;  1TUD A;  4C0F A;  2RQR A;  3OYC A;  4PNO A;  2KSS A;  4OVA A;  3ZBD A;  2CZ1 B;  3NFC A;  4C0D B;  2OTL A;  1BI2 A;  3RR6 A;  1UHC A;  4PJL A;  5GMK m;  4LDV A;  9ATC B;  3FLG A;  3RMQ A;  1VQ4 A;  5CKE A;  2QA4 Q;  1RAA B;  1UE9 A;  1D1C A;  3KUF A;  4KH0 B;  3EFO B;  5IXF A;  2XMF A;  3JB9 D;  3ME9 A;  2ZZD A;  4IKF A;  2RO0 A;  3CC4 Q;  4M75 A;  3FEO A;  1Y57 A;  4QQG A;  1D0Y A;  1GBQ A;  2COW A;  2V8I A;  3QWX X;  3JCM g;  5GAN d;  2K6D A;  1NBE B;  4M77 A;  4CC3 A;  3GBQ A;  2ZPE B;  3CC7 Q;  3EHQ A;  1YHQ A;  2EVR A;  3RIR A;  2OTJ A;  2HD0 A;  1Q82 R;  4J9H A;  2OAU A;  1X75 C;  4J83 A;  1VQK T;  5GAN 5;  1PRM C;  1M8V A;  3UF4 A;  2CH4 A;  3OSS C;  2CP5 A;  4FYW B;  3G71 A;  2QK0 A;  3UAT A;  3PTA A;  2DTH A;  4JJN K;  1VYU A;  2A28 A;  1VIE A;  1AEY A;  1ZSZ C;  1KC8 R;  4PLI A;  3CCJ A;  2EKH A;  1IRX A;  1PNJ A;  3KBG A;  3RBB B;  2JZ2 A;  3OYL A;  4FYV B;  2HEQ A;  5KE3 A;  4HVV A;  1NPP A;  3OB9 A;  3CXC S;  1W70 A;  5IN1 A;  2DXU A;  3U23 A;  3TVT A;  2PQW A;  2K4Y A;  1B34 B;  2L5Q A;  1AT1 B;  4PFO A;  1KG1 A;  4F04 B;  1FMK A;  2ZPG B;  2QA4 T;  4JRI A;  1Q7Y C;  1D0X A;  1UGQ B;  4N4H A;  3QKJ A;  3R6O A;  2DPP B;  2J06 A;  2P84 A;  4FYY B;  2DZ9 A;  1VQM Q;  3JCM f;  2D1X A;  1PD0 A;  5FWB A;  1RAE B;  4C92 G;  5HY6 A;  5FLX E;  8ATC B;  1A0N B;  2JTE A;  5KYN A;  1MMN A;  3CC4 T;  3CPW P;  1HK9 A;  4LUD A;  4A53 A;  1M1K U;  1YIT A;  2JUF A;  2RQU A;  2QGG A;  5GMK j;  3CC7 T;  4E7L A;  1N6A A;  5CIU A;  1YWO A;  2IIM A;  2XID A;  3VV0 A;  5KE2 A;  1VQ5 A;  1OU9 A;  1D3B B;  3RUX A;  1SRM A;  3LGF A;  2H3E B;  4E7J A;  2E3I A;  2PVD B;  3TQ7 P;  2FL7 A;  2LJ1 A;  4JRP A;  4XTU A;  4E7S A;  2KBT A;  3SHW A;  3M59 A;  1TXQ A;  1WZO A;  6AT1 B;  2RF0 A;  1E6H A;  1RLQ C;  1KQS S;  1Y96 B;  4IUU A;  4QT7 A;  3TSW A;  1WXU A;  1OEB A;  1XJW B;  2L0A A;  1QP3 A;  5GAM f;  2CZ0 B;  2EQK A;  3E9F A;  2L89 A;  4BE1 A;  1I4K 1;  4GY5 A;  5A0L A;  3OYE A;  1PD1 A;  4AMC A;  2O4X A;  3MEV A;  4XU2 A;  4AFS C;  2DRK A;  3OYA A;  4UC4 A;  1Q86 R;  2HSE B;  2G3R A;  3N5B B;  4XTW A;  2ZAE A;  1AVZ C;  3CCS Q;  4LXC A;  1JO8 A;  2BUD A;  2CRE A;  4M7A A;  1ZUK A;  3M4G A;  4DQ2 A;  5HK3 A;  2RHZ A;  1U1S A;  4J9G A;  3CBP A;  4J9E A;  5A0G A;  4JRK A;  5ECA A;  4HVW A;  3EG9 A;  1GFC A;  3D7S B;  4A63 B;  1QVF P;  2DRM A;  3H41 A;  4D8D A;  1VQM T;  1M27 C;  1TOV A;  3TCJ A;  5GAN j;  4XU0 A;  2X51 A;  4HCB A;  1VQN Q;  1WJS A;  2KT1 A;  2JVV A;  1VQK A;  1BKB A;  4FYX B;  5LJ5 d;  2K57 A;  2YUN A;  3C12 A;  4DOV A;  1W2B P;  3WVE B;  3CBM A;  3JCM Q;  2M02 A;  3LGL A;  2KNB B;  3V7C A;  1VQ7 Q;  4JJD A;  1YJ9 Q;  4EIK A;  2CUD A;  1T3S A;  2NLU A;  4M75 B;  1J3T A;  4BY6 C;  4FU6 A;  3OYG A;  1N27 A;  3CD6 Q;  4BDY A;  4FCY A;  1R0C B;  1QVG A;  2AIR B;  2OAW A;  4M77 B;  2QQR A;  3A8H B;  1NLP C;  4XU1 A;  1R0B G;  4BE0 A;  4PJM A;  2DAQ A;  5D7U A;  4OML A;  1WXT A;  1Y07 A;  4OP0 A;  2FZK B;  1X2K A;  2K79 A;  2VAS A;  2DJQ A;  4OGC A;  5FRO A;  4AG1 C;  2OJ2 A;  2K5I A;  5CKF A;  1QKX A;  4HCC A;  3REB B;  5IAY A;  1TUG B;  4DEX A;  1VOM A;  1EFN A;  3G1J A;  3LH0 A;  1GRI A;  2HDA A;  1FWZ A;  1O9S A;  1PC0 A;  3QWY A;  2P0P A;  2E70 A;  1KQ2 A;  1X6B A;  1M90 R;  3CCS T;  3PIP A;  3JCM e;  5GAN 8;  1JXO A;  2DL8 A;  4VUB A;  5FRN A;  1KD1 U;  5IH2 A;  3RER A;  3M0T A;  1QVP A;  4E2F B;  3CC4 A;  2KRS A;  4O5V A;  3LX7 A;  4K11 A;  1UGP B;  5J26 A;  4C8Q C;  4P5N A;  3C95 A;  4A54 A;  4B9W A;  3JB9 G;  2ED1 A;  5I21 A;  2QEX A;  4B6M A;  3PNW C;  1NYF A;  3URG A;  1VQN T;  4C0G A;  1BIB A;  5CQX A;  3OA6 A;  1Q81 C;  4C92 F;  4RG2 A;  5GMK h;  1YJ9 T;  4Z8A A;  1M1K R;  1PSF A;  3OW2 A;  2YUP A;  1YHQ Q;  3CD6 T;  3E19 A;  1IXD A;  1UEC A;  1BCO A;  5GAM e;  3X25 B;  1K8A U;  4RMO A;  1OPK A;  4M75 E;  2XDP A;  1K9M U;  1Z9Z A;  1N9R A;  2D8H A;  1KHI A;  3MHX A;  2WSF E;  2YRD A;  4M77 E;  1TTH B;  5FU7 C;  4MZP A;  4AT1 B;  1OYX A;  2O2O A;  1WQ7 A;  5LJ3 d;  2DYB A;  2AK5 A;  2A36 A;  4M7D B;  2QAZ A;  2C0O A;  2PZ1 A;  4A4E A;  2Y90 A;  2CS7 A;  4FSS A;  4LNP A;  2EJG A;  1OZ2 A;  3CCJ Q;  3JV3 A;  4F14 A;  1YN8 A;  3GNG A;  2GFU A;  3GOX A;  2HZY A;  4C8Q F;  5I2M A;  2DEU A;  2LQN A;  4DBR A;  2HKN A;  2B86 A;  2O4X B;  1BI0 A;  2DLP A;  1VA7 A;  3VUZ A;  4BI3 A;  2EYX A;  2KR3 A;  1RAC B;  1PSE A;  4R0K A;  1PG5 B;  1RUW A;  3V8J A;  4PJO G;  1VIF A;  2K3X A;  1GL5 A;  2GBQ A;  1AHJ B;  2EYQ A;  2GFA A;  3RES A;  3CXC P;  4JJC A;  1QKW A;  5CR2 A;  1LCK A;  3MO8 A;  1H8K A;  2ROT A;  3DB3 A;  3VS3 A;  2BTT A;  1Q82 U;  2P4R A;  1BI1 A;  4M78 C;  2DXC A;  3HL8 A;  4ZGJ B;  5GAN h;  4J9D A;  1QQJ A;  5GMK i;  2VGM A;  3DB4 A;  4IUQ A;  5C6S A;  2D9T A;  1C6V X;  2DE0 X;  2DEQ A;  4M75 D;  2XK0 A;  1N8R C;  3H8Z A;  1TUC A;  3LWI A;  4M77 D;  2RQW A;  5HK0 A;  5A2Q E;  3A5Z B;  1XQH A;  1YNZ A;  4J8O A;  2DJZ A;  2E1H A;  2LZ6 B;  3LWH A;  2SEM A;  3MP1 A;  2FZC B;  1RAB B;  1G3T A;  3UPU A;  2A3L A;  3X24 B;  2JMA A;  1NEG A;  5M9O A;  4KUD K;  4XTZ A;  2EYW A;  2PU9 B;  2XDB A;  4R56 A;  1LJO A;  2QQB A;  4FIB A;  3CCJ T;  3H0H A;  4LD6 A;  4M7D E;  1ZHI A;  5KCH A;  2LJ0 A;  2C0T A;  1ACM B;  1WX6 A;  3M57 A;  4J5Y A;  1KQS P;  4CC2 A;  3RKY A;  2JM8 A;  2A08 A;  2NYS A;  2WSC E;  4MZM A;  2KGT A;  4QVZ A;  4WCI A;  2L2P A;  2P4T A;  4L5G A;  2J6K A;  2EGA A;  1ABQ A;  5GAN 7;  1VQN A;  4NL3 A;  1RAF B;  3PMT A;  5GAM d;  5L23 A;  1X43 A;  1KD1 R;  4C0Z A;  2MAM A;  4ZNX A;  3QPH A;  2AZS A;  1YJ9 A;  2KYM A;  4N4I A;  2IPO B;  3CD6 A;  1K1Z A;  3EGD B;  5KYY A;  3QDF A;  4M7A E;  4MDW A;  3TU4 K;  8AT1 B;  5KYW B;  3JB9 F;  4D8K A;  3A98 A;  1YI2 Q;  4J9I A;  2MWP A;  4F7U G;  1H3Z A;  3EG0 A;  4L6V 5;  1KC8 C;  4HT9 A;  2KVQ G;  2COZ A;  3OS0 A;  4PJO C;  1OOT A;  3MP8 A;  1BBZ A;  2O88 A;  2YUO A;  3PIO A;  1JBM A;  2DM1 A;  1M5Q 1;  1K76 A;  3UA7 A;  1I81 A;  1JJ2 A;  1PKT A;  4IUP A;  1JQQ A;  2E41 A;  3WVD B;  4ZN1 A;  1Q86 U;  1K8A R;  1U1T A;  4M7D D;  2XU8 A;  2MOX A;  1K9M R;  2M0Y A;  5I11 A;  4XAX B;  5CAI A;  1UGR B;  3E9G A;  1WYX A;  4HVU A;  1SHF A;  1NE8 A;  2HCK A;  1X27 A;  3INZ A;  3GPL A;  2QDL A;  2DK3 A;  4MZT A;  2LT4 A;  3QYG B;  1SG5 A;  2EIF A;  2EAY A;  4JS4 A;  4FT2 A;  2DVJ A;  1AWX A;  2E12 A;  3JCM b;  2GCX A;  2H3J A;  1W4S A;  1KK7 A;  1E7O A;  4OB1 B;  4M4Z A;  1SHG A;  3M0S A;  4C92 A;  2GGR A;  3M5A A;  2O31 A;  2FPD A;  2EWN A;  3PFS A;  5LJ5 h;  1U5S A;  4PJO F;  3ASK A;  1H92 A;  3REA B;  4EPC A;  3BW1 A;  1S72 Q;  1EX4 A;  3RKX A;  2CDT A;  5EG2 A;  2KRN A;  3NHN A;  2QEX Q;  3O5Z A;  5CCA A;  4C0D C;  3OYH A;  4OGE A;  1YI2 T;  2OX7 A;  2QQS A;  3JCM c;  2HBP A;  3MKD A;  2YLC A;  1EZZ B;  1I1J A;  2YLB A;  2Y4Y A;  3LYI A;  2FZG B;  4PJJ A;  3QBY A;  2DXT A;  4LN2 A;  2PNI A;  4HT8 A;  2M16 A;  1UJY A;  2LCL A;  5I2S A;  3X28 B;  4DA4 A;  2YDL A;  4C8Q A;  4XQ3 A;  1I07 A;  2EFI A;  2VXE A;  2NUT A;  2JW4 A;  4ZN3 A;  4J6Y A;  3SWN A;  1M90 U;  4EDU A;  3RDV A;  5KH6 A;  2F1L A;  1MHN A;  4ZTJ A;  3LW5 E;  2BIV A;  3H0F A;  4OMM A;  2JJ9 A;  2JMC A;  2F69 A;  3UWN A;  1B3Q A;  1IZ6 A;  4GBQ A;  2GF7 A;  3HFO A;  2CP6 A;  1KFZ A;  3J81 E;  1QVG S;  1NPR A;  3G4S Q;  2V8K A;  3EGX A;  1X6G A;  1U8R A;  1WHM A;  3JCM P;  2X4X A;  5DM7 R;  4J6W A;  2DD5 A;  3NTH A;  2XHC A;  5GAM j;  4HCZ A;  2MI6 A;  2DL3 A;  3MEA A;  3PMI A;  2G6F X;  3CCV A;  4E7I A;  1FXX A;  2A37 A;  4B9X A;  4CC4 B;  3H6Z A;  2JOY A;  4HCK A;  1R8O B;  4CI0 C;  1S72 T;  2QAS A;  4GLM A;  4Q5W A;  4FW2 A;  2QEX T;  2HQX A;  4J7F A;  4HKE A;  4WTO B;  3P8H A;  2RM4 A;  3AT1 B;  3QG1 A;  3FB9 A;  4D6W A;  2DKG A;  4MMK A;  4F7U F;  3BE3 A;  2ENM A;  2F5T X;  1VQ6 T;  1WHJ A;  1WXB A;  3HTR A;  3M9Q A;  4PFP A;  5LJ3 h;  2QGF B;  2HNI A;  4C8Q G;  4II1 A;  1X69 A;  1WQW A;  2O9V A;  1LOJ A;  3M55 A;  4OMN A;  2J7I A;  1NM7 A;  3QO3 A;  4J9C A;  1AWJ A;  1AWO A;  1LNX A;  1TH7 A;  3FIF A;  1V29 B;  3OW2 S;  1MMG A;  3HPW A;  3QII A;  3CME A;  2DVE A;  4E7K A;  1T3L A;  5LL6 S;  3G4S T;  4BD3 A;  1D09 B;  4Z89 A;  5AYF A;  3M53 A;  1OX8 A;  2MF2 A;  4JDS A;  4QKU A;  4X9D A;  5GAO q;  4BDZ A;  1MMA A;  1PWT A;  1BCM A;  5GAN g;  5GAN 6;  3HFN A;  3NMZ C;  1G8X A;  4PFZ A;  4LDU A;  2ED0 A;  3WXM B;  2C0I A;  1M1K C;  2EYZ A;  3JCM J;  2CYZ B;  2V26 A;  2NUZ A;  1YI2 A;  2QI2 A;  3JRZ A;  3SD4 A;  1OI1 A;  1OX9 A;  1QWF A;  2R5M A;  2LCC A;  3HRT A;  3V7R A;  3EGU A;  3O8V A;  1BI3 A;  2DA9 A;  2L8D A;  2FEI A;  2RPN A;  4FL6 A;  4C92 B;  2RJC A;  2ZGW A;  3OYD A;  2XG8 D;  1VQ8 A;  2DL4 A;  1B7T A;  5FRM A;  3PVL A;  3QJ6 A;  2YRC A;  1WJR A;  2SRC A;  3OY9 A;  4C5I A;  1SRL A;  2FVU A;  4JZ4 A;  4WF2 A;  1BIA A;  3H0I A;  1KHC A;  4HXJ A;  2HAX A;  4N0A C;  2GQI A;  3CCU Q;  4RTT A;  3H9N A;  4AFU C;  3LLR A;  2DIL A;  1H64 1;  1JU5 C;  4RUG A;  5J3B A;  2CT3 A;  2LVM A;  4M7D G;  4M78 G;  2DD4 A;  2L3R A;  4RCC A;  4Y91 A;  4Z02 A;  4RCB A;  4RTZ A;  2ZPI B;  4M75 C;  2LX9 A;  1ARK A;  4LDX A;  5IHN A;  2EQU A;  2YT6 A;  2KRO A;  4JLG A;  2CKK A;  3S3N A;  2KT8 A;  2NUT B;  3VS7 A;  3SWN B;  1RI0 A;  1SF9 A;  2C06 A;  3VYG A;  2X4J A;  2P0Q A;  1BB9 A;  2DYI A;  4LUE A;  2ZPB B;  4PK4 A;  2DTI A;  2E65 A;  4PJO A;  2JM9 A;  1QW1 A;  2I0N A;  1NJI U;  1BYM A;  3RKW A;  2I2L A;  4DBF A;  4E6R A;  2KRM A;  5GAM h;  1UDL A;  1PCX A;  3EGX B;  1S72 A;  2M9U A;  1D1A A;  3JB9 I;  3NTI A;  3R6N A;  1IO6 A;  4DBQ A;  3PE0 A;  1YJW Q;  3VS0 A;  3M0Q A;  4FT4 A;  2RK2 A;  4J6X A;  1ZUY A;  4EMK C;  4F17 A;  2K5L A;  2V1Q A;  3HKS A;  1D1B A;  4KUL A;  1G3Y A;  4N4G A;  4HA8 A;  2EYY A;  3OS1 A;  2LT1 A;  2CZ6 B;  2EBP A;  2M1H A;  1M3A A;  1ZBJ A;  1TS9 A;  5IT9 E;  5DLO A;  3V8L A;  1VQ6 A;  4ANJ A;  4C92 E;  3OYN A;  2PUO B;  2EW3 A;  2JXB A;  4QQD A;  1TU0 B;  2AKK A;  1RI9 A;  2YRV A;  1ZX6 A;  2R57 A;  3L2R A;  3QDR B;  3RNJ A;  4M75 F;  1JB0 E;  1K9A A;  2CT4 A;  1VQ9 Q;  2ECZ A;  2ZCF B;  1IGU A;  1M2V A;  3CCU T;  4KBM B;  3OS5 A;  1GXI E;  1TWB A;  2FPE A;  1ZSG A;  1E6G A;  1G2B A;  3UDC A;  3ZFJ A;  2J6O A;  1GFD A;  3G4S A;  4PKC C;  2DIG A;  1D0Z A;  1ZBX A;  2QXF A;  4OMF B;  2VUB A;  3OMC A;  4E7Z A;  1QP2 A;  2ESW A;  2GTJ A;  1JEG A;  2VB6 A;  2PVO B;  3VS1 A;  3L2W A;  4F16 A;  3BY7 A;  1I5O B;  2D6F A;  2LNH B;  1KD1 C;  1M30 A;  5IXB A;  3CMA A;  1UFF A;  2W10 A;  1MGQ A;  1KSW A;  2BZY A;  2QDY B;  2HMA A;  3KFV A;  1JJ2 S;  2QG9 B;  3SFM A;  3S3O A;  3EFO A;  5LJ5 g;  2DXB A;  4JZ3 A;  1K73 U;  2VC8 A;  4RG8 A;  4M7A B;  1C0M A;  3VS4 A;  1FYN A;  3QZ5 B;  1U3O A;  4C5H A;  4XU3 A;  4M7D C;  1ZSZ A;  2RHX A;  3C94 A;  2E4H A;  4OMO A;  1K0X A;  3OBW A;  1QVG P;  1FX7 A;  2FHD A;  5GJW B;  3CCV Q;  1YJW T;  3EG9 B;  1M4Z A;  1HSQ A;  1X2Q A;  4C92 D;  2YWW A;  4IUR A;  3G7Z A;  1T0J A;  1VQO Q;  4MDX A;  4IUT A;  3CC2 T; 
#chains in the Genus database with same CATH homology
 2L3P A;  2PTK A;  2L3S A;  1WYX A;  1GCQ A;  5I22 A;  4HVU A;  1SHF A;  2HCK A;  1YWP A;  1QWE A;  1X27 A;  1YWO A;  2QDL A;  2IIM A;  1NEB A;  1SRM A;  4J9B A;  1K0S A;  2RQT A;  2LMJ A;  2X3W D;  1Y0M A;  2LJ1 A;  2DVJ A;  1AWX A;  2KBT A;  3SHW A;  2KXC A;  1G83 A;  1W1F A;  4IIO A;  2RF0 A;  1E6H A;  1NG2 A;  1RLQ C;  1E7O A;  1QCF A;  4M4Z A;  1SHG A;  3M0S A;  4RTW A;  4QT7 A;  2GGR A;  3TSW A;  1WXU A;  2DL5 A;  1K4U S;  2O31 A;  2VVK A;  1OEB A;  3TSZ A;  2FPD A;  2L0A A;  4OMP A;  1U5S A;  5FWC A;  1H92 A;  3REA B;  2D0N A;  1GCP A;  2CUB A;  2CDT A;  2EPD A;  2KRN A;  1H3H A;  4AFS C;  1N5Z A;  3NHN A;  2DRK A;  4RTY A;  2FRW A;  3O5Z A;  1KJW A;  3PVQ A;  1AVZ C;  1I1J A;  3M0P A;  3VS5 A;  2DF6 A;  3THK A;  1JO8 A;  1RLP C;  2MIO A;  2CRE A;  1UUE A;  2YUQ A;  1ZUK A;  1AZG B;  2K7A A;  3ZL7 C;  4LN2 A;  3ULR B;  4J9G A;  2PNI A;  4J9E A;  5ECA A;  4J9F A;  4HVW A;  1UJY A;  4RTX A;  1GFC A;  4A63 B;  1SSH A;  1VYT A;  2DRM A;  3H41 A;  2YDL A;  1I0C A;  1HJD A;  2HSP A;  4D8D A;  1M27 C;  2DX1 A;  1I07 A;  2JW4 A;  2CH4 W;  1ZLM A;  3NGP A;  3VS6 A;  2KT1 A;  1MV3 A;  1AZE A;  3H0F A;  2YUN A;  4OMM A;  2JMC A;  1B3Q A;  1M3C A;  1YP5 A;  4GBQ A;  1M8M A;  1GCQ C;  1KFZ A;  2KNB B;  3CQT A;  4JJD A;  4EIK A;  1VYV A;  1T3S A;  2CUD A;  1J3T A;  1MV0 B;  1X6G A;  1UHF A;  2DNU A;  1AD5 A;  2OAW A;  5IHI A;  2BZX A;  1XOV A;  1NLP C;  1YCS B;  2F2X A;  2DL3 A;  4LE9 A;  1AWW A;  1JXM A;  1CSK A;  2G6F X;  1UJ0 A;  2H8H A;  4OML A;  1ABO A;  1WXT A;  2LX7 A;  2A37 A;  1X2K A;  2MCN A;  1Z9Q A;  2FRY A;  2K79 A;  2KYB A;  4CC4 B;  2W0Z A;  3NPF A;  2DJQ A;  4AG1 C;  2OJ2 A;  4HCK A;  5HCK A;  1QKX A;  1WIE A;  3REB B;  1U06 A;  1UTI A;  1MUZ A;  2KXD A;  2K3B A;  4DEX A;  4GLM A;  1EFN A;  2ABL A;  3M0R A;  3C0C A;  1GRI A;  2HDA A;  3VRY A;  2GTO A;  3QWY A;  2JS2 A;  1X6B A;  1NYG A;  3M0U A;  2AZV A;  1JXO A;  2DL8 A;  5IH2 A;  3M0T A;  2DBM A;  3EG1 A;  1CKB A;  2KRS A;  2ENM A;  1WXB A;  4K11 A;  1X69 A;  2O9V A;  4IIM A;  4OMN A;  2ED1 A;  2EGC A;  2J7I A;  1NM7 A;  2RMO A;  1NYF A;  4J9C A;  1ZUU A;  1AWJ A;  2FG0 A;  1AWO A;  4CC7 A;  1V1C A;  1WLP B;  2DL7 A;  4Z8A A;  1T3L A;  1KIK A;  4Y92 A;  2YUP A;  4Z89 A;  3VS2 A;  1UEC A;  3SEM A;  2LJ3 A;  1OPK A;  1OV3 A;  1HD3 A;  2L3Q A;  1Z9Z A;  1PWT A;  2KE9 A;  2D8H A;  1T0H A;  3I35 A;  3NMZ C;  4AFZ C;  2ED0 A;  2C0I A;  2LCS A;  2EYZ A;  2O2O A;  3LH5 A;  2DYB A;  2AK5 A;  2DMO A;  2A36 A;  1PKS A;  1QLY A;  2NUZ A;  2C0O A;  3EHR A;  2PZ1 A;  1OPL A;  2RN8 A;  2J6F A;  3I5R A;  1QWF A;  4AFQ C;  2E5K A;  3VRZ A;  4FSS A;  2DA9 A;  1S1N A;  2RPN A;  3EGU A;  4LNP A;  2FEI A;  1PHT A;  3EG2 A;  3JV3 A;  4F14 A;  1WI7 A;  1YN8 A;  3FJ5 A;  2DL4 A;  3PVL A;  3I9Q A;  2LQN A;  2SRC A;  1PRL C;  2EGE A;  2B86 A;  1SRL A;  1WFW A;  4DEY A;  4JZ4 A;  2DLP A;  4X1V A;  2ROL A;  1VA7 A;  2EYX A;  2KR3 A;  1NLO C;  3H0I A;  2D8J A;  2LQW A;  4R0K A;  1RUW A;  4HXJ A;  1W6X A;  1GL5 A;  2GBQ A;  2GQI A;  2YSQ A;  1AOJ A;  4RTT A;  4JJC A;  4AFU C;  2DIL A;  1QKW A;  2K9G A;  4JJB A;  1JU5 C;  1LCK A;  4RUG A;  1H8K A;  2ROT A;  2CT3 A;  3VS3 A;  2BTT A;  2P4R A;  1BK2 A;  1WA7 A;  2AKL A;  4J9D A;  2GNC A;  4RTZ A;  1GBR A;  1ARK A;  5IHN A;  5IHK A;  2DE0 X;  2YT6 A;  2KRO A;  1TUD A;  2KT8 A;  2VWF A;  5FW9 A;  1TUC A;  3VS7 A;  2RQR A;  2F2V A;  2CSQ A;  2RQW A;  2V1R A;  2HBW A;  1BB9 A;  4LUE A;  1UHC A;  2JM9 A;  2I0N A;  1YNZ A;  2LP5 A;  5GJV B;  2JS0 A;  4E6R A;  2KRM A;  2LZ6 B;  1UDL A;  1UE9 A;  2SEM A;  5IXF A;  1SPK A;  3R6N A;  1IO6 A;  2XMF A;  3PE0 A;  2JMA A;  1NEG A;  1WDX A;  3VS0 A;  3M0Q A;  2BZ8 A;  2RQV A;  1ZUY A;  4F17 A;  2V1Q A;  2EYW A;  1Y57 A;  1GBQ A;  1UG1 A;  2EYY A;  3QWX X;  2EBP A;  2K6D A;  4CC3 A;  3GBQ A;  3H0H A;  1M3A A;  3EHQ A;  1ZBJ A;  2LJ0 A;  2C0T A;  2EVR A;  2FO0 A;  2J05 A;  4RTU A;  1WX6 A;  4J9H A;  3EG3 A;  2EQI A;  4Z88 A;  2RNA A;  4CC2 A;  1BU1 A;  2EW3 A;  2JXB A;  2JM8 A;  2A08 A;  1PRM C;  1B07 A;  3UF4 A;  2CH4 A;  2AKK A;  1RI9 A;  2KGT A;  1ZX6 A;  4WCI A;  1UGV A;  2OI3 A;  2L2P A;  3RNJ A;  2J6K A;  2CT4 A;  1K9A A;  2EGA A;  1ABQ A;  2ECZ A;  2VKN A;  3UAT A;  4AG2 C;  2KEA A;  5L23 A;  1X43 A;  1VYU A;  2A28 A;  4ESR A;  2FPE A;  1ZSG A;  1E6G A;  4OMQ A;  1AEY A;  4ZNX A;  2AZS A;  2KYM A;  1G2B A;  2FPF A;  2J6O A;  4ORZ A;  1GFD A;  2EKH A;  1PNJ A;  3RBB B;  2CSI A;  2HEQ A;  2X3X D;  1K1Z A;  4HVV A;  2ESW A;  2GTJ A;  1JEG A;  1W70 A;  3VS1 A;  3I5S A;  4D8K A;  4F16 A;  3A98 A;  2O9S A;  3U23 A;  3IQL A;  4J9I A;  3TVT A;  2LNH B;  1M30 A;  5IXB A;  2JT4 A;  3EG0 A;  2K2M A;  1UFF A;  2W10 A;  1CKA A;  1KSW A;  1OOT A;  2BZY A;  2M51 A;  3KFV A;  1BBZ A;  2F2W A;  2O88 A;  2YUO A;  1FMK A;  5EC7 A;  2DM1 A;  4JZ3 A;  2NWM A;  1K76 A;  3UA7 A;  1SEM A;  4RTV A;  3VS4 A;  1FYN A;  1PKT A;  1U3O A;  4JPB W;  2J06 A;  1JQQ A;  2DBK A;  4OMO A;  1K0X A;  5GJW B;  2MOX A;  2D1X A;  5FWB A;  3UA6 A;  1A0N B;  2JTE A;  2M0Y A;  1HSQ A;  1X2Q A;  5I11 A;  4LUD A;  1T0J A;  2RQU A;  1TG0 A;  1M3B A;  4KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...