2EBPA

Solution structure of the sh3 domain from human sam and sh3 domain containing protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
b'GSSGSSGFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM and SH3 domain-containing protein 1
molecule tags Cell adhesion
source organism Homo sapiens
publication title Solution structure of the SH3 domain from human SAM and SH3 domain containing protein 1
rcsb
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ebpA00
4J9DA 2CH4A 2YUOA 3UATA 2VWFA 1V1CA 4RUGA 5I11A 2HEQA 3I5SA 2JM9A 2X3WD 1HD3A 1UGVA 2LJ3A 2FO0A 1K0SA 1SRMA 1KSWA 2DILA 3VS2A 2DVJA 2X3XD 1AWOA 2LJ0A 1NG2A 1T3LA 2EKHA 4JZ4A 2H8HA 2L3SA 2O9VA 1N5ZA 4RTXA 1UJ0A 1K76A 2V1QA 4GLMA 2DMOA 4D8KA 2ABLA 1VA7A 2CH4W 1QKXA 2AZVA 5HCKA 2YSQA 5GJVB 1PHTA 2EPDA 2K79A 2DLPA 3LH5A 2EW3A 1UUEA 1PKSA 1ZLMA 1K9AA 4RTUA 1ZSGA 2KXCA 4J9HA 5I22A 4RTWA 3I35A 2DF6A 1HJDA 4A63B 5EC7A 2PNIA 1ABOA 1WFWA 1M27C 1X2QA 1YN8A 5ECAA 4AG1C 2M0YA 2KT8A 3THKA 2J05A 4D8DA 1QKWA 4R0KA 1OOTA 2EGEA 5FWBA 3IQLA 5FW9A 2A08A 2DJQA 2EYYA 2I0NA 2L3PA 4DEYA 1PKTA 1VYUA 4J9EA 2RN8A 2KGTA 2W0ZA 2J6FA 3ZL7C 1ZBJA 4RTYA 2K6DA 1YCSB 4OMPA 1UDLA 3NMZC 1NLOC 2EGAA 1H92A 2K9GA 5IHNA 3QWYA 3ULRB 2KXDA 1AEYA 3M0PA 4X1VA 4AFQC 1LCKA 1SPKA 3JV3A 2LMJA 1AWWA 3SEMA 2EYZA 3UA6A 4CC2A 2BZYA 4HVUA 2F2VA 2MCNA 1UJYA 2VVKA 2K3BA 4Z8AA 1S1NA 2IIMA 1BU1A 1KFZA 4J9BA 1BBZA 1X27A 2KR3A 2C0OA 2KYBA 1WX6A 1M3BA 2FEIA 1HSQA 1PNJA 3UA7A 1FMKA 1EFNA 2JMAA 4AG2C 2AK5A 2D0NA 1NYFA 1WYXA 4OMMA 1M8MA 1NYGA 1GRIA 2JXBA 1UE9A 4LUEA 4CC4B 1JXOA 2G6FX 3GBQA 2ECZA 2RNAA 4HVWA 2P4RA 2JTEA 4AFZC 1ZUYA 2MOXA 3TSWA 3NPFA 4QT7A 4RTZA 1RLPC 2DNUA 1OPLA 2EBPA 4Z89A 2A37A 1IO6A 1WXUA 4F17A 1UECA 2DM1A 2BZXA 1XOVA 1GFDA 1W70A 2DRKA 4HVVA 1YNZA 2EYXA 2DX1A 5IHKA 2YUPA 4GBQA 2SEMA 4LE9A 1TG0A 2F2XA 2KNBB 2A36A 1M3CA 2DL4A 2AKLA 1AZEA 2AZSA 2RQVA 1KIKA 2NUZA 1K4US 4ESRA 2KT1A 3REBB 1I0CA 2EQIA 1UHCA 1G2BA 1CKBA 2CT4A 2CREA 2JS0A 4DEXA 1X2KA 4J9IA 4OMNA 1TUCA 1Z9ZA 1E6HA 1FYNA 2RQRA 2O88A 1E6GA 2RQUA 2DBMA 4CC3A 3M0RA 1E7OA 1RUWA 2DA9A 2CSIA 2JW4A 3VS0A 2LQNA 2OAWA 1Z9QA 3H0HA 1JXMA 2LZ6B 3VS6A 4ORZA 2HBWA 4J9GA 4OMLA 3VS7A 3EG3A 5L23A 2YUQA 5IXBA 2JT4A 2DRMA 2GTOA 2FRWA 4K11A 2GBQA 1T0HA 1OEBA 1X69A 2CUBA 2BTTA 2O9SA 3NGPA 2F2WA 4HXJA 4ZNXA 1JU5C 1QWFA 1GCPA 2JS2A 4J9CA 2HDAA 1CSKA 3VS3A 3H0FA 2K2MA 1SRLA 1GCQA 1B07A 2ESWA 2CT3A 5IXFA 4J9FA 1UHFA 1QCFA 1WXBA 1PWTA 4Z88A 3U23A 2W10A 1WI7A 4LUDA 1AD5A 1CKAA 1GCQC 3EGUA 2SRCA 3I9QA 1YWPA 1I1JA 1BB9A 4JZ3A 2AKKA 3EHRA 2M51A 1B3QA 2D8HA 3M0SA 2L0AA 5IH2A 1GBQA 1YP5A 3CQTA 3EG0A 2DL8A 3SHWA 2GQIA 2C0TA 2DL5A 2LCSA 4F16A 1ZUKA 2CSQA 1Y0MA 1JEGA 4CC7A 2CDTA 1GFCA 3RBBB 3UF4A 1T0JA 1WA7A 1K1ZA 1RLQC 2L2PA 2KEAA 1TUDA 1ARKA 1J3TA 3I5RA 1SHGA 4Y92A 2ENMA 1VYTA 3TVTA 2LJ1A 2FPDA 3QWXX 2LQWA 2O31A 2PZ1A 3EG1A 4EIKA 2ROLA 1WIEA 2L3QA 3NHNA 1I07A 2OI3A 4M4ZA 1UTIA 2RMOA 4RTTA 2FG0A 3FJ5A 2DL7A 2MIOA 3O5ZA 2KRMA 1YWOA 1MUZA 2VKNA 1QLYA 1NEGA 4AFUC 4E6RA 2V1RA 2D8JA 2ED1A 1JO8A 3PVQA 3VRYA 2RF0A 1OPKA 1RI9A 2JM8A 1NLPC 3C0CA 4AFSC 2RPNA 2FPEA 4OMOA 1SHFA 1BK2A 3KFVA 1AWXA 1U3OA 1NEBA 2K7AA 3H41A 4OMQA 2LNHB 4LNPA 1K0XA 1A0NB 2OJ2A 4KRTA 4JPBW 2XMFA 2HCKA 2YT6A 1SEMA 1ABQA 2DYBA 2C0IA 2YDLA 2LP5A 1Y57A 2E5KA 1AOJA 2KYMA 3VRZA 1W1FA 1X6GA 3REAB 2YUNA 3TSZA 4HCKA 4IIMA 1MV0B 3H0IA 2J6OA 2GGRA 1WLPB 1M3AA 2EGCA 2KRSA 1ZX6A 4F14A 3R6NA 1AWJA 2J7IA 4JJCA 2A28A 4IIOA 2BZ8A 3PVLA 1ZUUA 2HSPA 2RQTA 1U06A 2J06A 3M0UA 1SSHA 2QDLA 1X6BA 2RQWA 2KE9A 2PTKA 4WCIA 1H8KA 2B86A 4FSSA 1KJWA 1QWEA 1T3SA 2KBTA 2DE0X 2J6KA 3EG2A 1U5SA 2O2OA 1JQQA 2DL3A 1VYVA 1MV3A 1AVZC 3PE0A 1NM7A 1W6XA 3RNJA 1OV3A 2FRYA 1GBRA 1UFFA 5FWCA 1WXTA 1X43A 3M0TA 1UG1A 3M0QA 2KRNA 2GNCA 2GTJA 4JJBA 1PRLC 1AZGB 2LX7A 4RTVA 2EYWA 2NWMA 3VS5A 1WDXA 2DBKA 2ED0A 2ROTA 2CUDA 3VS1A 1M30A 4JJDA 1H3HA 3A98A 2EVRA 2KROA 1PRMC 2FPFA 4LN2A 2D1XA 3EHQA 3VS4A 1G83A 5GJWB 5IHIA 1GL5A 2JMCA
chains in the Genus database with same CATH superfamily
2CH4A 2YUOA 4F7UF 1H3ZA 3UATA 3CMAT 2VWFA 1EX4A 1IHVA 4J7IA 4RUGA 5I11A 5GANg 2JM9A 1Q7YU 1HD3A 2VYTA 1K0SA 4M7DB 3VKIA 2DILA 1V29B 3LGLA 2QYZA 3OS2A 2LJ0A 3E1SA 1T3LA 3HKSA 1X75C 3CCUA 3WXMB 2HKNA 2O9VA 1N5ZA 1UJ0A 1K76A 2V1QA 4PFOA 2OTJT 5LJ5j 4D8KA 2X51A 4MDXA 1D3BB 2YSQA 2EPDA 2P0KA 2DLPA 1MNEA 5KYWA 5D6YA 2KXCA 4J9HA 3CMEA 5I22A 4RTWA 4BD3A 2V26A 5HK0A 4A63B 5EC7A 3QJYA 1ABOA 3CCJQ 3CMEQ 1M27C 2L5QA 5LJ3g 3JCMf 4C0FA 2J05A 3CCEQ 2BUDA 2RHZA 3CCST 2LVMA 2A08A 1X6OA 3L2RA 2ZCFB 2EYYA 4F7UE 3VYGA 4DEYA 1RABB 1VYUA 1QVPA 2DO3A 3OYHA 3PFSA 2M0OA 2DD5A 4PL6A 1TXQA 3QDRB 1M2VA 1JJ2A 1QW1A 4OP0A 1H92A 2M1HA 2K9GA 5IHNA 4HT8A 3S3NA 4HCCA 3CCJA 4X1VA 4PJMA 2A3LA 1RAFB 2QASA 1MMAA 2RA2A 1YITQ 2LMJA 1VQ6T 1AWWA 1D1CA 3M56A 1VQ5Q 3A8HB 2MCNA 1UJYA 2ZGWA 1O75A 3JCMg 5HK3A 4Z8AA 3BY7A 3L42A 3JCMP 2KK4A 1BU1A 3CBOA 1KFZA 1KG1A 4PFPA 5KE2A 1X27A 3OYJA 2C0OA 4KH1B 2KYBA 5CCAA 2QQSA 1FMWA 2XD0A 2FEIA 3UA7A 3G6EQ 1EFNA 4LDYA 4HCBA 4AG2C 2ZPIB 1ZQ1A 2EJ9A 4IUTA 1KQ2A 4BE1A 2VB6A 1WYXA 4OMMA 1GRIA 4M7AG 2EIFA 4CC4B 4IKFA 2QEXT 1VQMA 3CCUQ 2E70A 4FW2A 4HVWA 2P4RA 3M9QA 1N8RR 3TSWA 3NPFA 1K73U 4QT7A 4RTZA 2YRDA 1MHNA 2EBPA 4RKUE 1YJ9Q 2A37A 2F1LA 5GAMj 1WXUA 4FT2A 1XOVA 1W70A 2DRKA 1YNZA 2DX1A 3CCMA 4LE9A 4F7UB 2JVVA 2KNBB 3MEAA 3ASKA 3A1PA 2E3IA 1NPPA 1Q82C 3BE3A 2RQVA 4RCCA 5KYNA 1KIKA 2JTMA 2WSFE 3REBB 4ZN1A 3SDZA 1Q82U 2GQVA 2JS0A 1IZ6A 4J9IA 2JUFA 4OMNA 1K8AU 4JUVA 2LCLA 4J6WA 2O88A 3O8VA 1E6GA 2DBMA 5KH6A 1WPYA 4E7IA 1WJQA 2E5QA 4PFZA 2JW4A 1RAAB 4M7AC 2XDBA 3RERA 1G3SA 3VS6A 2AT1B 3VU3C 1W2BP 2GFAA 1B34B 3VS7A 1M90C 2YUQA 2GTOA 3OBYA 2L89A 2GBQA 2LC4A 1OEBA 3CD6T 4A4KA 4XQ3A 2O9SA 1PG5B 5FLXE 1M1KC 2F2WA 4ZNXA 1JB0E 1S72T 3WVDB 4M75G 1OZ2A 1SRLA 1GCQA 4XU0A 1BKBA 1KD1C 1OZ3A 1QVGS 3BDUA 4M77B 4RG2A 3V7CA 3TQ7P 2CT3A 5IXFA 1UHFA 4Z88A 3U23A 3CMAQ 3SWNC 1KQSA 2QA4Q 2W10A 1OQKA 1WI7A 3J81E 1AD5A 2SRCA 3I9QA 4EMHA 1BB9A 3JRZA 2M51A 2CS7A 3NTKA 1VQKQ 3R6OA 3M0SA 2CP3A 4QQ6A 2M02A 5IH2A 4A4HA 1YJWT 2DL8A 2DEQA 2K5FA 3SHWA 1N9RA 2LTOA 3E9GA 1QVGP 5FROA 3PNWC 1Q95G 4CC7A 1JRIA 1D0XA 1TWBA 3RMQA 3I56A 1IRXA 1XTDA 2WACA 2OX7A 3A8OB 3LWIA 2ENMA 5GAMe 2LJ1A 3OSSC 1WHLA 1TU0B 1BI3A 2EWNA 2DIQA 5A0DA 3H9NA 1C1AA 1UTIA 3PT9A 3ZBDA 2E10A 1RADB 2DL7A 2JOYA 2MIOA 1YWOA 4JJNK 2EQMA 2XG8D 3OS1A 5CR2A 4JLIA 5CK9A 2CYZB 1X01A 2D8JA 2ED1A 3RKWA 3CC4Q 3OYEA 2K5LA 4C8QD 1OPKA 3DKMA 1RI9A 2JM8A 1NLPC 3JCMh 4ZN3A 2FPEA 3CC4A 3CCMQ 4QQGA 4ZGEB 3OYFA 2LNHB 4KRTA 1YHQA 2BE7D 3NTHA 2X4YA 4BB7A 3OBWA 1B7TA 3MEVA 1VQ6Q 1Y57A 2E5KA 1X6GA 3CXCA 3WVEB 4IIMA 2F5TX 3H0IA 1QMCA 2A0FB 5M9OA 1M3AA 2EGCA 1ZSZA 1ZX6A 1KC8U 1O9SA 1VIFA 1QVFS 2WSCE 4J83A 3R6NA 4OGCA 4JJCA 3C4SA 1ZUUA 2RQTA 2ZPFB 7AT1B 2OTJQ 2J06A 1SSHA 4DOVA 5GAN4 3G1JA 5IAYA 2B8AA 4KUIA 1H8KA 2OTJA 3CBMA 2XICA 3EG2A 1LJOA 2DAQA 1G5VA 3PE0A 4ELZC 3I55A 4NL3A 2Y90A 3RNJA 1OV3A 4P5NA 3CPWA 2RI5A 1YCYA 5FWCA 1WXTA 3CCUT 1BIAA 2QGGA 3OS0A 3M59A 1UG1A 3HTRA 3JCMe 5LJ5d 1PRLC 2RJEA 3DLLA 2MMPA 3QJ6A 3HFNA 2EYWA 4OB2B 2HQHA 4F04B 4JJDA 1H3HA 4MDWA 2FPFA 2D1XA 3LYIA 5GJWB 2CP7A 1GL5A 4EMKC 2DJZA 3UPUA 2PVDB 5FU6B 2PUKB 4BE2A 1ZSZB 3I5SA 3OB9A 3ER0A 4C92A 2LJ3A 3HRTA 1I8FA 1S72A 1KSWA 2HBPA 3VS2A 1AWOA 1UGRB 1OU8A 1NG2A 1D1BA 3LGFA 2EKHA 3H6ZA 5GAMh 3CMAA 4D6WA 3CC2Q 5LJ3h 5KE3A 1FX7A 3QG1A 2QI2A 1N8RU 4M75D 2EQKA 2DMOA 3MJXA 1VA7A 2AZVA 5HCKA 4C0DC 1M2OA 5KYXA 4KGXB 2FHDA 1UUEA 1Q81R 5GMKm 2DETA 3CCMT 2HL3A 3V7RA 3GNGA 3I56Q 3I35A 2DF6A 2HAXA 4M7AE 3QPHA 1KHIA 1X2QA 4JRIA 4DQ2A 2KT8A 1IHWA 4D8DA 4R0KA 3LX7A 1OOTA 4M78C 5FWBA 4C5IA 3PIPA 3VYHB 2K4YA 2DJQA 3QIIA 2W0ZA 1OYXA 1DJ7B 4RTYA 3CCSA 1G3WA 3EH2A 3C95A 2JJ9A 4OMPA 3URGA 2L3RA 5CO7A 3QWYA 2RHUA 4AFQC 3OYDA 4JRKA 2DVEA 2KSSA 2XIDA 3SEMA 4HVUA 2QTVA 5DLQE 4XU2A 1BCOA 4JDSA 2DYIA 5LJ3f 4LDWA 4C0GA 1BBZA 3CC7Q 1YI2Q 2LDMA 1NJIR 1WX6A 4PK4A 4B6MA 1AHJB 1HSQA 1PNJA 1VOMA 3MEWA 1BCMA 3JCMQ 2D0NA 3MP1A 2A7YA 1FXXA 3MEUA 1YIJQ 2CP0A 1UGSB 2HKQB 2RK2A 3DB3A 1UE9A 2RO0A 4PJOD 3CC2A 3GBQA 2ECZA 2V8IA 2MOXA 1M1KU 3DLMA 4Z02A 2DNUA 1OPLA 1NJIU 4M78B 5LJ3d 2QAZA 2CKKA 4F17A 3A8LB 2BZXA 2QQ9A 2G3RA 1GFDA 5GAOr 3INZA 5LL6S 2EYXA 2H3JA 1VQNA 2YUPA 2SEMA 3JCMc 4C0ZA 2KDSA 3JB9J 3SFMA 2AKLA 3S6WA 2E6ZA 2MWOA 1TTHB 1M5Q1 4JRQA 3RR6A 2CZ6B 1KQSS 3CCRT 3F70A 3JCMW 1K8AC 1YJWA 1VQ6A 4M7AD 1NPRA 1R0BG 4EDUA 1M8VA 1VQ4T 4E47A 5CQYA 3QZ5B 4CC3A 3M53A 2LT1A 2VC8A 3KBGA 2DA9A 1M90R 1NZ9A 3A5ZB 3X25B 1Z9QA 2ZPBB 3GIBA 1KK7A 5GMKi 4M7DG 2QGFB 4M7DC 1KC8C 2LZ6B 1JJ2P 3CC7T 1MMGA 4J9GA 3EG3A 4KH0B 1Q82R 2FRWA 1V76A 2CUBA 1I5LA 3L2UA 5GAMd 4M7DE 1JU5C 3E19A 2HDAA 4A53A 1K8AR 2QXFA 1CSKA 5CKBA 3VS3A 3H0FA 1ZBXA 1ZHIA 2K2MA 4X9CA 5GAOn 1B07A 1M2VB 2ESWA 4LDXA 1IGUA 3CCVT 2E1HA 2XK0A 2E65A 1PWTA 4M75E 1PC0A 5D6WA 3CCEA 4R55A 3EGUA 5GMKl 4KT0E 4M7DA 2Y4YA 3J80E 3RUXA 4JZ3A 5J26A 2X4WA 3EHRA 3P8DA 4M78D 4PJJA 1B3QA 3PIOA 2L0AA 1GBQA 4NS5A 4DA4A 1YP5A 2CZ1B 1LNXA 1JEGA 1Y07A 1GFCA 3CEYA 1WA7A 4QQDA 5KYUB 2KEAA 1J3TA 5DLOA 3SD4A 3I5RA 1SHGA 3MP8A 1M4ZA 1VYTA 4C5EA 3EAEA 5D6XA 4M7DF 4E7KA 3JCMd 2I2LA 3OYBA 4EIKA 3NHNA 2FYKA 4C8QE 3QXEB 1C6VX 3OW2P 1D0ZA 4KGZB 4X34A 4AMCA 3OYAA 2M9UA 3JB9G 1NEGA 2NLUA 4AFUC 2GFUA 1WNLA 1JO8A 1TUGB 1WJRA 2Y4XA 3G71A 5IN1A 3VRYA 5LJ3j 2QQBA 2FZGB 4AFSC 1SHFA 2E6NA 3KFVA 1NEBA 3QBYA 4OMQA 3KUFA 4LNPA 2LX9A 2OJ2A 1IB8A 1VQ9Q 4JPBW 3S3OA 3OMGA 4FL6A 2R5AA 3L1AA 3NFCA 1ACMB 2HCKA 3L2VA 4XTXA 1R77A 3OYMA 2DYBA 4Y28E 3G71T 3CXCS 2KVQG 3VRZA 4E7JA 1YJNT 1VQ4Q 2OTLQ 1W1FA 2EQJA 1EIFA 4PLIA 3REAB 2ZZDA 3TSZA 4HCKA 2MYSA 1KQ1A 3V8LA 3G4ST 3MO8A 4FYWB 2GGRA 3M4GA 1U1TA 5LJ5e 1QVFA 4J7FA 1Q86R 5LJ5h 2D9TA 5GAOl 2E41A 2J7IA 8AT1B 2COYA 4IIOA 2FZKB 2PUOB 2HSPA 2RHXA 4IUVA 5DM7R 5HKCA 1VQ9A 5A0LA 1C0MA 3RMSA 1VIEA 4WCIA 1QWEA 2YHTA 4BI3A 1U5SA 1JQQA 5CQXA 1PSFA 4FT4A 3V8JA 3G6ET 1MV3A 4BI4A 2YRVA 3EFOA 2QQAA 2DTOA 1QP3A 2QEXQ 3M0QA 8ATCB 3TREA 1AZGB 3SWNB 5GAMg 3J7AF 2NWMA 2K57A 3VS5A 4MZPA 2DEUA 3RESA 1WDXA 3QO3A 2K3XA 1BI1A 2ROTA 2CUDA 2EKOA 4FYYB 4RG8A 3VS1A 4XTVA 3A98A 3CCQA 3M54A 3OYKA 1G83A 1RAHB 2PQWA 3QZ9B 4VUBA 2HZYA 4DBRA 1LPLA 4N0AA 4E7ZA 4J9DA 4L6V5 3KXTA 4JRPA 5GMKj 2X3WD 2P0QA 1YJ9A 3CCQT 1YFNA 1TOVA 3JB9H 2DVJA 4KUDK 1VQKT 3EFRA 4A4FA 1QVGA 1VQOT 1H641 5GAOm 4JS4A 2F69A 4RTXA 3EG9B 5A2QE 3PTAA 2ABLA 1KD1U 2DTIA 5GJVB 1YHQQ 1SG5A 3JAME 4QW2A 3LH5A 2EW3A 2LT4A 3VUBA 1ZSGA 2ZPEB 2MK5A 4M7AF 5J3BA 2HQEA 1FMVA 1HJDA 1R0CB 1KQSP 2PNIA 1IXDA 1WFWA 4C92F 1AT1B 1RI0A 4UC4A 2NYSA 1I5OB 3QDFA 4E7SA 4KULA 1YN8A 2X4XA 5ECAA 5EG2A 1Q7YR 3G71Q 3EGXA 2IPOB 5AYFA 2L8DA 5CIUA 2EGEA 4ZGJB 3GF5A 3QKJA 4M78G 3G4SQ 2L3PA 1PKTA 3RKYA 1SSFA 2YLBA 4J9EA 3PMIA 2RN8A 3I55Q 1YJNQ 2OTLT 1M90U 2KGTA 3M57A 9ATCB 1YJNA 1Q81U 1Q86C 1ZBJA 4ZGDB 4FM4B 1K73C 3CCLT 2K6DA 5AT1B 4MMKA 1YCSB 1YJWQ 2EGAA 3OYGA 4E7HA 3ULRB 2KXDA 3HP9A 4RMOA 4PJOC 2DD4A 3CCQQ 3JV3A 2F5KA 4DBHA 3JCMb 3UA6A 4XAXB 2F2VA 4XK8E 3EG9A 4XU1A 5CKHA 1S1NA 2P4TA 2IIMA 4C92E 4OB1B 2MAMA 3HHTB 4PJOE 1RAIB 4M7DD 2AIRB 2KR3A 1D09B 1M3BA 1PSEA 5C0MA 3CD6Q 3P8HA 2O01E 2QEXA 1NYFA 1QVFP 1M8MA 2YRCA 1YIJA 1ZA2B 4QVZA 1JXOA 1N9SA 2YXYA 2JTEA 3EGXB 4EMGA 1VQOA 3OS5A 4V2SA 2FZCB 4Z89A 1WGSA 3A8MB 1TS9A 3CPFA 1UECA 5KCOA 3L2ZA 4L59A 5GAOp 2R5MA 5IT9E 1UGPB 2DERA 5IHKA 2DZ9A 1TG0A 1VQMT 4OGEA 4FIBA 1M3CA 2DL4A 1VQKA 6AT1B 3CCLQ 2ZPGB 3P8BB 4Q5WA 2NUZA 2KT1A 2VXEA 1I0CA 2EQIA 1G2BA 3FRNA 2CREA 4DEXA 2CZ7B 4DBFA 1OX9A 3FIFA 1E6HA 3C94A 2D0QB 2EJFA 2RQRA 3VUZA 4TVRA 3CCRA 2RB6A 2CZ0B 3X28B 1K9MR 2BIVA 2LQNA 2DXBA 3MP6A 2K2VA 3H0HA 1YHQT 3OMCA 3JCMX 2HBWA 1F1BB 5CVIA 3QHSA 1QQJA 4M77D 3UDCA 3LW5E 3DB4A 4C0DB 1T0HA 1X69A 3JB9F 1VQOQ 1VQPQ 4N4GA 1QWFA 3CCSQ 1GCPA 1B34A 4PJOB 3M5AA 1PD1A 4FYXB 1BI0A 1MMNA 5FU7B 2XDPA 5CKDA 1VQ7T 3UT1A 4J9FA 1QCFA 2LQKA 2XHCA 5GANj 1CKAA 4C92D 2LRQA 3QSUA 2AKKA 3EFSA 5I2SA 3MCAB 2D8HA 3G7ZA 4PKCC 5CKEA 5KYWB 3CQTA 3EG0A 2RI3A 4PJOF 2GQIA 1I81A 2LCSA 2C0TA 2DL5A 2EAYA 1RACB 1ZUKA 3QYHB 1G8XA 2CGHA 3UF4A 2QG9B 5GANh 2L2PA 4MZMA 1ARKA 4M78E 2HQXA 2QQRA 2O4XB 2FPDA 3HFOA 3FC3A 2E4HA 2QDYB 2LQWA 4A54A 2PZ1A 3OW2S 2FB7A 3EG1A 4GLKA 2YLCA 2ROLA 1WIEA 1YIJT 1W2BA 1YI2T 3LLRA 3NTIA 1QCOA 1SKUB 1RL2A 1VQ4A 4BY6C 4YTLA 3FJ5A 1D3BA 2RH2A 1MMDA 5KCHA 3TEEA 5GMKh 1MUZA 3QYGB 3LWHA 1ZSZC 2V1RA 1BIBA 4KBMB 5I2MA 3PVQA 2RJCA 1WHMA 3FEOA 2RF0A 4OMOA 1RAGB 2MWPA 1BK2A 2HL5C 1AWXA 5C6SA 1G3YA 1OU9A 2K7AA 3CCET 1K0XA 1A0NB 4M75A 1Y7XA 4LD9K 4E2FB 2EFIA 1QCNA 2MF2A 4WF2A 1VQMQ 1U1SA 2Z0WA 1ABQA 1Q7YC 4X9DA 2YDLA 4RCBA 5L8RE 1VQ5T 4C5HA 2YUNA 4EMKA 4IUQA 1OX8A 5FRMA 2V8JA 3T9NA 3OYCA 3CCVA 2J6OA 4R56A 4F7UG 5GAN3 2KRSA 3I55T 4F14A 3PGGA 3GPLA 2VV5A 3RDVA 3META 1AWJA 2EQUA 3HRSA 2DFUA 2GF7A 2BZ8A 3PVLA 5KYUA 3Q1JA 3V8KA 4A4EA 4C8QC 5LJ5f 2RK1A 2RQWA 2IG0A 1VQPT 2OAUA 2MI6A 1KJWA 2KY9A 4M7AA 4M7AB 1Y71A 4BY6B 1T3SA 3FB9A 2O2OA 2H3EB 1D1AA 3CCVQ 4MMLA 1NM7A 2KQWA 1W6XA 3GNFB 4M77F 3MHXA 2NUTA 2NUTB 1Q86U 3OY9A 4O6JA 4N4HA 2FRYA 5CAIA 3G4SA 1UFFA 1TH7A 2D6FA 2KRNA 2GNCA 1FWZA 1VQNT 4FU6A 4PNOA 2DXCA 2DIGA 1YI2A 2FL7A 1U8RA 4J5YA 2DBKA 2RI2A 4C8QB 1UB4A 4C8QF 1WHKA 2KROA 2VASA 3EHQA 5GMKe 3SWNA 1VQLA 2ATCB 1YJ9T 1EZZB 1HXDA 5IHIA 2JMCA 2JNGA 3ME9A 1V1CA 1R8OB 4FYVB 2VXFA 2HEQA 4HKEA 1UGVA 2RHYA 4OF1A 2FO0A 1SRMA 4M75C 4PJNA 2X3XD 1RAEB 4IURA 4FSXA 4JZ4A 3FDRA 2H8HA 4NL2A 5A0GA 4WTOB 2L3SA 1BYMA 4GLMA 3OSVA 2CH4W 1QKXA 4PJLA 1PHTA 1VUBA 2K79A 2RM4A 3A8GB 1VQ8A 4M77G 1PKSA 1ZLMA 4LDVA 1K9AA 1IGQA 4RTUA 1JBMA 2M16A 3MKDA 1VQ8T 3UWNA 1WHHA 4N4IA 2LCCA 1VQ9T 3JB9D 2ZAEA 4BI8B 2BKDN 3AHUA 4AG1C 2M0YA 4XTZA 3THKA 2JN0A 3MPUB 4MZTA 1QKWA 5I21A 1WJSA 3IQLA 1UEBA 1M1FA 2KAFA 5FW9A 3PMTA 2NUPB 4PJOG 2I0NA 1WHGA 4C92G 4ZTJA 4DBQA 3OA6A 3LH0A 2J6FA 3ZL7C 2RJDA 4M77A 1NBEB 1KC8R 2QA4T 2X35A 5GAMf 1UDLA 4L5GA 3NMZC 1NLOC 1GXIE 2BE9B 5GAN8 3GP8A 5GANf 1AEYA 3FJPA 3M0PA 4F7UA 1VQLQ 1PM3A 1LCKA 3X24B 1SPKA 5CKFA 5GAN6 4ZTFA 2EYZA 4HCZA 4CC2A 2BZYA 3H8ZA 1K73R 4M77E 4J6XA 4BE0A 3BDLA 2VVKA 4O5VA 2K3BA 4FCYA 3RIRA 1Y96B 4BACA 4J9BA 1UGQB 3OYIA 4BDZA 2X4JA 4M77C 3JB9I 4EPCA 1FMKA 2JMAA 1Q81C 2CP2A 2AK5A 3E9FA 2VGNA 2DXTA 1QP2A 3CCLA 1NYGA 1S72Q 2JXBA 4LUEA 2LNVA 3CD6A 2G6FX 2RNAA 5GANe 4AFZC 1ZUYA 1NJIC 4B9WA 1RLPC 3HSBA 4M78F 4XU3A 4M75F 4ME7A 1IO6A 4OMFB 2DM1A 4CI0C 4XTUA 4HVVA 3L2WA 4GBQA 1TSFA 2F2XA 2A36A 4CRIA 1AZEA 2XDDA 2AZSA 4AT1B 2NUPA 4BDYA 5KYXB 5FRNA 5GANd 2HMAA 4KGVB 3CXCP 1M9SA 1P92A 1K4US 4ESRA 2CP6A 2XU8A 1UHCA 1CKBA 2CT4A 1X2KA 1XQHA 4C5GA 1IREB 1PCXA 1MNDA 1Y96A 1TUCA 1Z9ZA 1K9MC 3HL8A 5HY6A 4C8QA 1FYNA 2VUBA 4A4GA 5FU7C 3QUIA 2DPPB 4XTWA 2MPXC 2RQUA 4JLGA 2K3YA 3M0RA 1E7OA 1RUWA 2DZCA 2R57A 2PVOB 3OYYA 3M55A 2CSIA 1M1KR 3VS0A 2OAWA 1YBYA 3X20B 2X9HA 1JXMA 3JCMV 1JJ2S 4ORZA 3CCJT 3AT1B 4OMLA 5L23A 5IXBA 4QVCA 1HK9A 2JT4A 4QKUA 2DRMA 4K11A 5LJ5g 2BTTA 3NGPA 4HXJA 4LDUA 2RD1A 3EGDA 2JS2A 4J9CA 4ELYC 3RKXA 3OYLA 3CPWP 2COWA 3GOXA 2LQ8A 5GAN2 2HD0A 3HPWA 1W4SA 1WXBA 3OYNA 1WQ7A 4LUDA 2AHJB 3M58A 3GLXA 5FU6C 1GCQC 4BUGA 2XI9A 1YWPA 1I1JA 4PLLA 3X26B 4II1A 1VQNQ 1G3TA 2ZPHB 4GY5A 3V7SA 4DOWA 5DY9A 3N5BB 2RHIA 3CBPA 4F16A 4IUUA 2CSQA 1Y0MA 2CDTA 4E7LA 4OB3B 1NE8A 3RBBB 1LVKA 3SB2A 1T0JA 2KI7A 1K1ZA 1RLQC 1TUDA 4Y92A 3TVTA 3QWXX 1BI2A 1OULA 2O31A 3I56T 4J6YA 1VQ7A 1KHCA 3HRUA 3CPWS 3OQ5A 4FW1A 2L3QA 3CMET 2KMTA 1I07A 1WHJA 2O4XA 1K9MU 4ATOA 2OI3A 4M4ZA 1WZOA 2E64A 1M1GA 2RMOA 3CC2T 2HSEB 4RTTA 2FG0A 3O5ZA 1N6AA 2KRMA 2VKNA 1W2BS 3JCMJ 2EYQA 1QLYA 2HNIA 3EGDB 2YWWA 2VGMA 4E6RA 3FLGA 1HYOA 4J8OA 3BW1A 2QK0A 3E2UA 3C0CA 2RPNA 1N8RC 4JS5A 1U3OA 2EJGA 4C92B 1OI1A 1VQ8Q 3H41A 2E3HA 4C8QG 2GCXA 3CCRQ 2QTXA 2XMFA 4QVDA 3TCJA 2JZ2A 2YT6A 1D0YA 2E12A 2K5IA 1SEMA 3M4YA 2C0IA 2LP5A 1AOJA 2KYMA 4N0AC 4M75B 1MGQA 2WSEE 1MV0B 1LOJA 1SF9A 3ZEHA 4LD6A 4HA8A 1WLPB 4LXCA 2RJFA 4C92C 2PVGB 5LJ3e 2OTLA 2PU9B 1VQPA 4EMKB 1PD0A 2COZA 2P84A 3CC7A 2A28A 2P0PA 2C06A 1U06A 4NOYA 2DKGA 3M0UA 2QDLA 1WQWA 1XJWB 1X6BA 1VQLT 2R58A 3ZFJA 4PJOA 2KE9A 1ZA1B 2PTKA 4OVAA 5KYYB 5J39A 2B86A 4FSSA 4M78A 1YITT 2KBTA 5D7UA 3TU4K 2DE0X 2V8KA 2J6KA 2DL3A 1VYVA 4OB0B 4XTYA 1AVZC 5GAN7 4IUPA 3C12A 3G6EA 2CP5A 3CC4T 1GBRA 2QA4A 3VV0A 3L2QA 3S3MA 1I4K1 1X43A 3M0TA 1VQ7Q 2DXUA 2GTJA 4JJBA 2LX7A 1KD1R 4Y91A 4RTVA 3EFOB 2DTHA 4HT9A 2JTFA 2DK3A 2ED0A 2XKOC 1M30A 2FVUA 3D7SB 3EH1A 4B9XA 1YITA 2EVRA 1PRMC 4LN2A 3BFMA 3VS4A 3VJPA 3JSCA 1VQ5A 1XNIA 5GAOq 5GAN5 2IVWA 5KYYA 3OW2A 1N27A 4ANJA
chains in the Genus database with same CATH topology
4J9DA 2CH4A 2YUOA 3UATA 2VWFA 1V1CA 4RUGA 5I11A 2HEQA 3I5SA 2JM9A 2X3WD 1HD3A 1UGVA 2LJ3A 2FO0A 1K0SA 1SRMA 1KSWA 2DILA 3VS2A 2DVJA 2X3XD 1AWOA 2LJ0A 1NG2A 1T3LA 2EKHA 4JZ4A 2H8HA 2L3SA 2O9VA 1N5ZA 4RTXA 1UJ0A 1K76A 2V1QA 4GLMA 2DMOA 4D8KA 2ABLA 1VA7A 2CH4W 1QKXA 2AZVA 5HCKA 2YSQA 5GJVB 1PHTA 2EPDA 2K79A 2DLPA 3LH5A 2EW3A 1UUEA 1PKSA 1ZLMA 1K9AA 4RTUA 1ZSGA 2KXCA 4J9HA 5I22A 4RTWA 3I35A 2DF6A 1HJDA 4A63B 5EC7A 2PNIA 1ABOA 1WFWA 1M27C 1X2QA 1YN8A 5ECAA 4AG1C 2M0YA 2KT8A 3THKA 2J05A 4D8DA 1QKWA 4R0KA 1OOTA 2EGEA 5FWBA 3IQLA 5FW9A 2A08A 2DJQA 2EYYA 2I0NA 2L3PA 4DEYA 1PKTA 1VYUA 4J9EA 2RN8A 2KGTA 2W0ZA 2J6FA 3ZL7C 1ZBJA 4RTYA 2K6DA 1YCSB 4OMPA 1UDLA 3NMZC 1NLOC 2EGAA 1H92A 2K9GA 5IHNA 3QWYA 3ULRB 2KXDA 1AEYA 3M0PA 4X1VA 4AFQC 1LCKA 1SPKA 3JV3A 2LMJA 1AWWA 3SEMA 2EYZA 3UA6A 4CC2A 2BZYA 4HVUA 2F2VA 2MCNA 1UJYA 2VVKA 2K3BA 4Z8AA 1S1NA 2IIMA 1BU1A 1KFZA 4J9BA 1BBZA 1X27A 2KR3A 2C0OA 2KYBA 1WX6A 1M3BA 2FEIA 1HSQA 1PNJA 3UA7A 1FMKA 1EFNA 2JMAA 4AG2C 2AK5A 2D0NA 1NYFA 1WYXA 4OMMA 1M8MA 1NYGA 1GRIA 2JXBA 1UE9A 4LUEA 4CC4B 1JXOA 2G6FX 3GBQA 2ECZA 2RNAA 4HVWA 2P4RA 2JTEA 4AFZC 1ZUYA 2MOXA 3TSWA 3NPFA 4QT7A 4RTZA 1RLPC 2DNUA 1OPLA 2EBPA 4Z89A 2A37A 1IO6A 1WXUA 4F17A 1UECA 2DM1A 2BZXA 1XOVA 1GFDA 1W70A 2DRKA 4HVVA 1YNZA 2EYXA 2DX1A 5IHKA 2YUPA 4GBQA 2SEMA 4LE9A 1TG0A 2F2XA 2KNBB 2A36A 1M3CA 2DL4A 2AKLA 1AZEA 2AZSA 2RQVA 1KIKA 2NUZA 1K4US 4ESRA 2KT1A 3REBB 1I0CA 2EQIA 1UHCA 1G2BA 1CKBA 2CT4A 2CREA 2JS0A 4DEXA 1X2KA 4J9IA 4OMNA 1TUCA 1Z9ZA 1E6HA 1FYNA 2RQRA 2O88A 1E6GA 2RQUA 2DBMA 4CC3A 3M0RA 1E7OA 1RUWA 2DA9A 2CSIA 2JW4A 3VS0A 2LQNA 2OAWA 1Z9QA 3H0HA 1JXMA 2LZ6B 3VS6A 4ORZA 2HBWA 4J9GA 4OMLA 3VS7A 3EG3A 5L23A 2YUQA 5IXBA 2JT4A 2DRMA 2GTOA 2FRWA 4K11A 2GBQA 1T0HA 1OEBA 1X69A 2CUBA 2BTTA 2O9SA 3NGPA 2F2WA 4HXJA 4ZNXA 1JU5C 1QWFA 1GCPA 2JS2A 4J9CA 2HDAA 1CSKA 3VS3A 3H0FA 2K2MA 1SRLA 1GCQA 1B07A 2ESWA 2CT3A 5IXFA 4J9FA 1UHFA 1QCFA 1WXBA 1PWTA 4Z88A 3U23A 2W10A 1WI7A 4LUDA 1AD5A 1CKAA 1GCQC 3EGUA 2SRCA 3I9QA 1YWPA 1I1JA 1BB9A 4JZ3A 2AKKA 3EHRA 2M51A 1B3QA 2D8HA 3M0SA 2L0AA 5IH2A 1GBQA 1YP5A 3CQTA 3EG0A 2DL8A 3SHWA 2GQIA 2C0TA 2DL5A 2LCSA 4F16A 1ZUKA 2CSQA 1Y0MA 1JEGA 4CC7A 2CDTA 1GFCA 3RBBB 3UF4A 1T0JA 1WA7A 1K1ZA 1RLQC 2L2PA 2KEAA 1TUDA 1ARKA 1J3TA 3I5RA 1SHGA 4Y92A 2ENMA 1VYTA 3TVTA 2LJ1A 2FPDA 3QWXX 2LQWA 2O31A 2PZ1A 3EG1A 4EIKA 2ROLA 1WIEA 2L3QA 3NHNA 1I07A 2OI3A 4M4ZA 1UTIA 2RMOA 4RTTA 2FG0A 3FJ5A 2DL7A 2MIOA 3O5ZA 2KRMA 1YWOA 1MUZA 2VKNA 1QLYA 1NEGA 4AFUC 4E6RA 2V1RA 2D8JA 2ED1A 1JO8A 3PVQA 3VRYA 2RF0A 1OPKA 1RI9A 2JM8A 1NLPC 3C0CA 4AFSC 2RPNA 2FPEA 4OMOA 1SHFA 1BK2A 3KFVA 1AWXA 1U3OA 1NEBA 2K7AA 3H41A 4OMQA 2LNHB 4LNPA 1K0XA 1A0NB 2OJ2A 4KRTA 4JPBW 2XMFA 2HCKA 2YT6A 1SEMA 1ABQA 2DYBA 2C0IA 2YDLA 2LP5A 1Y57A 2E5KA 1AOJA 2KYMA 3VRZA 1W1FA 1X6GA 3REAB 2YUNA 3TSZA 4HCKA 4IIMA 1MV0B 3H0IA 2J6OA 2GGRA 1WLPB 1M3AA 2EGCA 2KRSA 1ZX6A 4F14A 3R6NA 1AWJA 2J7IA 4JJCA 2A28A 4IIOA 2BZ8A 3PVLA 1ZUUA 2HSPA 2RQTA 1U06A 2J06A 3M0UA 1SSHA 2QDLA 1X6BA 2RQWA 2KE9A 2PTKA 4WCIA 1H8KA 2B86A 4FSSA 1KJWA 1QWEA 1T3SA 2KBTA 2DE0X 2J6KA 3EG2A 1U5SA 2O2OA 1JQQA 2DL3A 1VYVA 1MV3A 1AVZC 3PE0A 1NM7A 1W6XA 3RNJA 1OV3A 2FRYA 1GBRA 1UFFA 5FWCA 1WXTA 1X43A 3M0TA 1UG1A 3M0QA 2KRNA 2GNCA 2GTJA 4JJBA 1PRLC 1AZGB 2LX7A 4RTVA 2EYWA 2NWMA 3VS5A 1WDXA 2DBKA 2ED0A 2ROTA 2CUDA 3VS1A 1M30A 4JJDA 1H3HA 3A98A 2EVRA 2KROA 1PRMC 2FPFA 4LN2A 2D1XA 3EHQA 3VS4A 1G83A 5GJWB 5IHIA 1GL5A 2JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9D A;  2CH4 A;  2YUO A;  3UAT A;  2VWF A;  1V1C A;  4RUG A;  5I11 A;  2HEQ A;  3I5S A;  2JM9 A;  2X3W D;  1HD3 A;  1UGV A;  2LJ3 A;  2FO0 A;  1K0S A;  1SRM A;  1KSW A;  2DIL A;  3VS2 A;  2DVJ A;  2X3X D;  1AWO A;  2LJ0 A;  1NG2 A;  1T3L A;  2EKH A;  4JZ4 A;  2H8H A;  2L3S A;  2O9V A;  1N5Z A;  4RTX A;  1UJ0 A;  1K76 A;  2V1Q A;  4GLM A;  2DMO A;  4D8K A;  2ABL A;  1VA7 A;  2CH4 W;  1QKX A;  2AZV A;  5HCK A;  2YSQ A;  5GJV B;  1PHT A;  2EPD A;  2K79 A;  2DLP A;  3LH5 A;  2EW3 A;  1UUE A;  1PKS A;  1ZLM A;  1K9A A;  4RTU A;  1ZSG A;  2KXC A;  4J9H A;  5I22 A;  4RTW A;  3I35 A;  2DF6 A;  1HJD A;  4A63 B;  5EC7 A;  2PNI A;  1ABO A;  1WFW A;  1M27 C;  1X2Q A;  1YN8 A;  5ECA A;  4AG1 C;  2M0Y A;  2KT8 A;  3THK A;  2J05 A;  4D8D A;  1QKW A;  4R0K A;  1OOT A;  2EGE A;  5FWB A;  3IQL A;  5FW9 A;  2A08 A;  2DJQ A;  2EYY A;  2I0N A;  2L3P A;  4DEY A;  1PKT A;  1VYU A;  4J9E A;  2RN8 A;  2KGT A;  2W0Z A;  2J6F A;  3ZL7 C;  1ZBJ A;  4RTY A;  2K6D A;  1YCS B;  4OMP A;  1UDL A;  3NMZ C;  1NLO C;  2EGA A;  1H92 A;  2K9G A;  5IHN A;  3QWY A;  3ULR B;  2KXD A;  1AEY A;  3M0P A;  4X1V A;  4AFQ C;  1LCK A;  1SPK A;  3JV3 A;  2LMJ A;  1AWW A;  3SEM A;  2EYZ A;  3UA6 A;  4CC2 A;  2BZY A;  4HVU A;  2F2V A;  2MCN A;  1UJY A;  2VVK A;  2K3B A;  4Z8A A;  1S1N A;  2IIM A;  1BU1 A;  1KFZ A;  4J9B A;  1BBZ A;  1X27 A;  2KR3 A;  2C0O A;  2KYB A;  1WX6 A;  1M3B A;  2FEI A;  1HSQ A;  1PNJ A;  3UA7 A;  1FMK A;  1EFN A;  2JMA A;  4AG2 C;  2AK5 A;  2D0N A;  1NYF A;  1WYX A;  4OMM A;  1M8M A;  1NYG A;  1GRI A;  2JXB A;  1UE9 A;  4LUE A;  4CC4 B;  1JXO A;  2G6F X;  3GBQ A;  2ECZ A;  2RNA A;  4HVW A;  2P4R A;  2JTE A;  4AFZ C;  1ZUY A;  2MOX A;  3TSW A;  3NPF A;  4QT7 A;  4RTZ A;  1RLP C;  2DNU A;  1OPL A;  2EBP A;  4Z89 A;  2A37 A;  1IO6 A;  1WXU A;  4F17 A;  1UEC A;  2DM1 A;  2BZX A;  1XOV A;  1GFD A;  1W70 A;  2DRK A;  4HVV A;  1YNZ A;  2EYX A;  2DX1 A;  5IHK A;  2YUP A;  4GBQ A;  2SEM A;  4LE9 A;  1TG0 A;  2F2X A;  2KNB B;  2A36 A;  1M3C A;  2DL4 A;  2AKL A;  1AZE A;  2AZS A;  2RQV A;  1KIK A;  2NUZ A;  1K4U S;  4ESR A;  2KT1 A;  3REB B;  1I0C A;  2EQI A;  1UHC A;  1G2B A;  1CKB A;  2CT4 A;  2CRE A;  2JS0 A;  4DEX A;  1X2K A;  4J9I A;  4OMN A;  1TUC A;  1Z9Z A;  1E6H A;  1FYN A;  2RQR A;  2O88 A;  1E6G A;  2RQU A;  2DBM A;  4CC3 A;  3M0R A;  1E7O A;  1RUW A;  2DA9 A;  2CSI A;  2JW4 A;  3VS0 A;  2LQN A;  2OAW A;  1Z9Q A;  3H0H A;  1JXM A;  2LZ6 B;  3VS6 A;  4ORZ A;  2HBW A;  4J9G A;  4OML A;  3VS7 A;  3EG3 A;  5L23 A;  2YUQ A;  5IXB A;  2JT4 A;  2DRM A;  2GTO A;  2FRW A;  4K11 A;  2GBQ A;  1T0H A;  1OEB A;  1X69 A;  2CUB A;  2BTT A;  2O9S A;  3NGP A;  2F2W A;  4HXJ A;  4ZNX A;  1JU5 C;  1QWF A;  1GCP A;  2JS2 A;  4J9C A;  2HDA A;  1CSK A;  3VS3 A;  3H0F A;  2K2M A;  1SRL A;  1GCQ A;  1B07 A;  2ESW A;  2CT3 A;  5IXF A;  4J9F A;  1UHF A;  1QCF A;  1WXB A;  1PWT A;  4Z88 A;  3U23 A;  2W10 A;  1WI7 A;  4LUD A;  1AD5 A;  1CKA A;  1GCQ C;  3EGU A;  2SRC A;  3I9Q A;  1YWP A;  1I1J A;  1BB9 A;  4JZ3 A;  2AKK A;  3EHR A;  2M51 A;  1B3Q A;  2D8H A;  3M0S A;  2L0A A;  5IH2 A;  1GBQ A;  1YP5 A;  3CQT A;  3EG0 A;  2DL8 A;  3SHW A;  2GQI A;  2C0T A;  2DL5 A;  2LCS A;  4F16 A;  1ZUK A;  2CSQ A;  1Y0M A;  1JEG A;  4CC7 A;  2CDT A;  1GFC A;  3RBB B;  3UF4 A;  1T0J A;  1WA7 A;  1K1Z A;  1RLQ C;  2L2P A;  2KEA A;  1TUD A;  1ARK A;  1J3T A;  3I5R A;  1SHG A;  4Y92 A;  2ENM A;  1VYT A;  3TVT A;  2LJ1 A;  2FPD A;  3QWX X;  2LQW A;  2O31 A;  2PZ1 A;  3EG1 A;  4EIK A;  2ROL A;  1WIE A;  2L3Q A;  3NHN A;  1I07 A;  2OI3 A;  4M4Z A;  1UTI A;  2RMO A;  4RTT A;  2FG0 A;  3FJ5 A;  2DL7 A;  2MIO A;  3O5Z A;  2KRM A;  1YWO A;  1MUZ A;  2VKN A;  1QLY A;  1NEG A;  4AFU C;  4E6R A;  2V1R A;  2D8J A;  2ED1 A;  1JO8 A;  3PVQ A;  3VRY A;  2RF0 A;  1OPK A;  1RI9 A;  2JM8 A;  1NLP C;  3C0C A;  4AFS C;  2RPN A;  2FPE A;  4OMO A;  1SHF A;  1BK2 A;  3KFV A;  1AWX A;  1U3O A;  1NEB A;  2K7A A;  3H41 A;  4OMQ A;  2LNH B;  4LNP A;  1K0X A;  1A0N B;  2OJ2 A;  4KRT A;  4JPB W;  2XMF A;  2HCK A;  2YT6 A;  1SEM A;  1ABQ A;  2DYB A;  2C0I A;  2YDL A;  2LP5 A;  1Y57 A;  2E5K A;  1AOJ A;  2KYM A;  3VRZ A;  1W1F A;  1X6G A;  3REA B;  2YUN A;  3TSZ A;  4HCK A;  4IIM A;  1MV0 B;  3H0I A;  2J6O A;  2GGR A;  1WLP B;  1M3A A;  2EGC A;  2KRS A;  1ZX6 A;  4F14 A;  3R6N A;  1AWJ A;  2J7I A;  4JJC A;  2A28 A;  4IIO A;  2BZ8 A;  3PVL A;  1ZUU A;  2HSP A;  2RQT A;  1U06 A;  2J06 A;  3M0U A;  1SSH A;  2QDL A;  1X6B A;  2RQW A;  2KE9 A;  2PTK A;  4WCI A;  1H8K A;  2B86 A;  4FSS A;  1KJW A;  1QWE A;  1T3S A;  2KBT A;  2DE0 X;  2J6K A;  3EG2 A;  1U5S A;  2O2O A;  1JQQ A;  2DL3 A;  1VYV A;  1MV3 A;  1AVZ C;  3PE0 A;  1NM7 A;  1W6X A;  3RNJ A;  1OV3 A;  2FRY A;  1GBR A;  1UFF A;  5FWC A;  1WXT A;  1X43 A;  3M0T A;  1UG1 A;  3M0Q A;  2KRN A;  2GNC A;  2GTJ A;  4JJB A;  1PRL C;  1AZG B;  2LX7 A;  4RTV A;  2EYW A;  2NWM A;  3VS5 A;  1WDX A;  2DBK A;  2ED0 A;  2ROT A;  2CUD A;  3VS1 A;  1M30 A;  4JJD A;  1H3H A;  3A98 A;  2EVR A;  2KRO A;  1PRM C;  2FPF A;  4LN2 A;  2D1X A;  3EHQ A;  3VS4 A;  1G83 A;  5GJW B;  5IHI A;  1GL5 A;  2JMC A; 
#chains in the Genus database with same CATH topology
 2CH4 A;  2YUO A;  4F7U F;  1H3Z A;  3UAT A;  3CMA T;  2VWF A;  1EX4 A;  1IHV A;  4J7I A;  4RUG A;  5I11 A;  5GAN g;  2JM9 A;  1Q7Y U;  1HD3 A;  2VYT A;  1K0S A;  4M7D B;  3VKI A;  2DIL A;  1V29 B;  3LGL A;  2QYZ A;  3OS2 A;  2LJ0 A;  3E1S A;  1T3L A;  3HKS A;  1X75 C;  3CCU A;  3WXM B;  2HKN A;  2O9V A;  1N5Z A;  1UJ0 A;  1K76 A;  2V1Q A;  4PFO A;  2OTJ T;  5LJ5 j;  4D8K A;  2X51 A;  4MDX A;  1D3B B;  2YSQ A;  2EPD A;  2P0K A;  2DLP A;  1MNE A;  5KYW A;  5D6Y A;  2KXC A;  4J9H A;  3CME A;  5I22 A;  4RTW A;  4BD3 A;  2V26 A;  5HK0 A;  4A63 B;  5EC7 A;  3QJY A;  1ABO A;  3CCJ Q;  3CME Q;  1M27 C;  2L5Q A;  5LJ3 g;  3JCM f;  4C0F A;  2J05 A;  3CCE Q;  2BUD A;  2RHZ A;  3CCS T;  2LVM A;  2A08 A;  1X6O A;  3L2R A;  2ZCF B;  2EYY A;  4F7U E;  3VYG A;  4DEY A;  1RAB B;  1VYU A;  1QVP A;  2DO3 A;  3OYH A;  3PFS A;  2M0O A;  2DD5 A;  4PL6 A;  1TXQ A;  3QDR B;  1M2V A;  1JJ2 A;  1QW1 A;  4OP0 A;  1H92 A;  2M1H A;  2K9G A;  5IHN A;  4HT8 A;  3S3N A;  4HCC A;  3CCJ A;  4X1V A;  4PJM A;  2A3L A;  1RAF B;  2QAS A;  1MMA A;  2RA2 A;  1YIT Q;  2LMJ A;  1VQ6 T;  1AWW A;  1D1C A;  3M56 A;  1VQ5 Q;  3A8H B;  2MCN A;  1UJY A;  2ZGW A;  1O75 A;  3JCM g;  5HK3 A;  4Z8A A;  3BY7 A;  3L42 A;  3JCM P;  2KK4 A;  1BU1 A;  3CBO A;  1KFZ A;  1KG1 A;  4PFP A;  5KE2 A;  1X27 A;  3OYJ A;  2C0O A;  4KH1 B;  2KYB A;  5CCA A;  2QQS A;  1FMW A;  2XD0 A;  2FEI A;  3UA7 A;  3G6E Q;  1EFN A;  4LDY A;  4HCB A;  4AG2 C;  2ZPI B;  1ZQ1 A;  2EJ9 A;  4IUT A;  1KQ2 A;  4BE1 A;  2VB6 A;  1WYX A;  4OMM A;  1GRI A;  4M7A G;  2EIF A;  4CC4 B;  4IKF A;  2QEX T;  1VQM A;  3CCU Q;  2E70 A;  4FW2 A;  4HVW A;  2P4R A;  3M9Q A;  1N8R R;  3TSW A;  3NPF A;  1K73 U;  4QT7 A;  4RTZ A;  2YRD A;  1MHN A;  2EBP A;  4RKU E;  1YJ9 Q;  2A37 A;  2F1L A;  5GAM j;  1WXU A;  4FT2 A;  1XOV A;  1W70 A;  2DRK A;  1YNZ A;  2DX1 A;  3CCM A;  4LE9 A;  4F7U B;  2JVV A;  2KNB B;  3MEA A;  3ASK A;  3A1P A;  2E3I A;  1NPP A;  1Q82 C;  3BE3 A;  2RQV A;  4RCC A;  5KYN A;  1KIK A;  2JTM A;  2WSF E;  3REB B;  4ZN1 A;  3SDZ A;  1Q82 U;  2GQV A;  2JS0 A;  1IZ6 A;  4J9I A;  2JUF A;  4OMN A;  1K8A U;  4JUV A;  2LCL A;  4J6W A;  2O88 A;  3O8V A;  1E6G A;  2DBM A;  5KH6 A;  1WPY A;  4E7I A;  1WJQ A;  2E5Q A;  4PFZ A;  2JW4 A;  1RAA B;  4M7A C;  2XDB A;  3RER A;  1G3S A;  3VS6 A;  2AT1 B;  3VU3 C;  1W2B P;  2GFA A;  1B34 B;  3VS7 A;  1M90 C;  2YUQ A;  2GTO A;  3OBY A;  2L89 A;  2GBQ A;  2LC4 A;  1OEB A;  3CD6 T;  4A4K A;  4XQ3 A;  2O9S A;  1PG5 B;  5FLX E;  1M1K C;  2F2W A;  4ZNX A;  1JB0 E;  1S72 T;  3WVD B;  4M75 G;  1OZ2 A;  1SRL A;  1GCQ A;  4XU0 A;  1BKB A;  1KD1 C;  1OZ3 A;  1QVG S;  3BDU A;  4M77 B;  4RG2 A;  3V7C A;  3TQ7 P;  2CT3 A;  5IXF A;  1UHF A;  4Z88 A;  3U23 A;  3CMA Q;  3SWN C;  1KQS A;  2QA4 Q;  2W10 A;  1OQK A;  1WI7 A;  3J81 E;  1AD5 A;  2SRC A;  3I9Q A;  4EMH A;  1BB9 A;  3JRZ A;  2M51 A;  2CS7 A;  3NTK A;  1VQK Q;  3R6O A;  3M0S A;  2CP3 A;  4QQ6 A;  2M02 A;  5IH2 A;  4A4H A;  1YJW T;  2DL8 A;  2DEQ A;  2K5F A;  3SHW A;  1N9R A;  2LTO A;  3E9G A;  1QVG P;  5FRO A;  3PNW C;  1Q95 G;  4CC7 A;  1JRI A;  1D0X A;  1TWB A;  3RMQ A;  3I56 A;  1IRX A;  1XTD A;  2WAC A;  2OX7 A;  3A8O B;  3LWI A;  2ENM A;  5GAM e;  2LJ1 A;  3OSS C;  1WHL A;  1TU0 B;  1BI3 A;  2EWN A;  2DIQ A;  5A0D A;  3H9N A;  1C1A A;  1UTI A;  3PT9 A;  3ZBD A;  2E10 A;  1RAD B;  2DL7 A;  2JOY A;  2MIO A;  1YWO A;  4JJN K;  2EQM A;  2XG8 D;  3OS1 A;  5CR2 A;  4JLI A;  5CK9 A;  2CYZ B;  1X01 A;  2D8J A;  2ED1 A;  3RKW A;  3CC4 Q;  3OYE A;  2K5L A;  4C8Q D;  1OPK A;  3DKM A;  1RI9 A;  2JM8 A;  1NLP C;  3JCM h;  4ZN3 A;  2FPE A;  3CC4 A;  3CCM Q;  4QQG A;  4ZGE B;  3OYF A;  2LNH B;  4KRT A;  1YHQ A;  2BE7 D;  3NTH A;  2X4Y A;  4BB7 A;  3OBW A;  1B7T A;  3MEV A;  1VQ6 Q;  1Y57 A;  2E5K A;  1X6G A;  3CXC A;  3WVE B;  4IIM A;  2F5T X;  3H0I A;  1QMC A;  2A0F B;  5M9O A;  1M3A A;  2EGC A;  1ZSZ A;  1ZX6 A;  1KC8 U;  1O9S A;  1VIF A;  1QVF S;  2WSC E;  4J83 A;  3R6N A;  4OGC A;  4JJC A;  3C4S A;  1ZUU A;  2RQT A;  2ZPF B;  7AT1 B;  2OTJ Q;  2J06 A;  1SSH A;  4DOV A;  5GAN 4;  3G1J A;  5IAY A;  2B8A A;  4KUI A;  1H8K A;  2OTJ A;  3CBM A;  2XIC A;  3EG2 A;  1LJO A;  2DAQ A;  1G5V A;  3PE0 A;  4ELZ C;  3I55 A;  4NL3 A;  2Y90 A;  3RNJ A;  1OV3 A;  4P5N A;  3CPW A;  2RI5 A;  1YCY A;  5FWC A;  1WXT A;  3CCU T;  1BIA A;  2QGG A;  3OS0 A;  3M59 A;  1UG1 A;  3HTR A;  3JCM e;  5LJ5 d;  1PRL C;  2RJE A;  3DLL A;  2MMP A;  3QJ6 A;  3HFN A;  2EYW A;  4OB2 B;  2HQH A;  4F04 B;  4JJD A;  1H3H A;  4MDW A;  2FPF A;  2D1X A;  3LYI A;  5GJW B;  2CP7 A;  1GL5 A;  4EMK C;  2DJZ A;  3UPU A;  2PVD B;  5FU6 B;  2PUK B;  4BE2 A;  1ZSZ B;  3I5S A;  3OB9 A;  3ER0 A;  4C92 A;  2LJ3 A;  3HRT A;  1I8F A;  1S72 A;  1KSW A;  2HBP A;  3VS2 A;  1AWO A;  1UGR B;  1OU8 A;  1NG2 A;  1D1B A;  3LGF A;  2EKH A;  3H6Z A;  5GAM h;  3CMA A;  4D6W A;  3CC2 Q;  5LJ3 h;  5KE3 A;  1FX7 A;  3QG1 A;  2QI2 A;  1N8R U;  4M75 D;  2EQK A;  2DMO A;  3MJX A;  1VA7 A;  2AZV A;  5HCK A;  4C0D C;  1M2O A;  5KYX A;  4KGX B;  2FHD A;  1UUE A;  1Q81 R;  5GMK m;  2DET A;  3CCM T;  2HL3 A;  3V7R A;  3GNG A;  3I56 Q;  3I35 A;  2DF6 A;  2HAX A;  4M7A E;  3QPH A;  1KHI A;  1X2Q A;  4JRI A;  4DQ2 A;  2KT8 A;  1IHW A;  4D8D A;  4R0K A;  3LX7 A;  1OOT A;  4M78 C;  5FWB A;  4C5I A;  3PIP A;  3VYH B;  2K4Y A;  2DJQ A;  3QII A;  2W0Z A;  1OYX A;  1DJ7 B;  4RTY A;  3CCS A;  1G3W A;  3EH2 A;  3C95 A;  2JJ9 A;  4OMP A;  3URG A;  2L3R A;  5CO7 A;  3QWY A;  2RHU A;  4AFQ C;  3OYD A;  4JRK A;  2DVE A;  2KSS A;  2XID A;  3SEM A;  4HVU A;  2QTV A;  5DLQ E;  4XU2 A;  1BCO A;  4JDS A;  2DYI A;  5LJ3 f;  4LDW A;  4C0G A;  1BBZ A;  3CC7 Q;  1YI2 Q;  2LDM A;  1NJI R;  1WX6 A;  4PK4 A;  4B6M A;  1AHJ B;  1HSQ A;  1PNJ A;  1VOM A;  3MEW A;  1BCM A;  3JCM Q;  2D0N A;  3MP1 A;  2A7Y A;  1FXX A;  3MEU A;  1YIJ Q;  2CP0 A;  1UGS B;  2HKQ B;  2RK2 A;  3DB3 A;  1UE9 A;  2RO0 A;  4PJO D;  3CC2 A;  3GBQ A;  2ECZ A;  2V8I A;  2MOX A;  1M1K U;  3DLM A;  4Z02 A;  2DNU A;  1OPL A;  1NJI U;  4M78 B;  5LJ3 d;  2QAZ A;  2CKK A;  4F17 A;  3A8L B;  2BZX A;  2QQ9 A;  2G3R A;  1GFD A;  5GAO r;  3INZ A;  5LL6 S;  2EYX A;  2H3J A;  1VQN A;  2YUP A;  2SEM A;  3JCM c;  4C0Z A;  2KDS A;  3JB9 J;  3SFM A;  2AKL A;  3S6W A;  2E6Z A;  2MWO A;  1TTH B;  1M5Q 1;  4JRQ A;  3RR6 A;  2CZ6 B;  1KQS S;  3CCR T;  3F70 A;  3JCM W;  1K8A C;  1YJW A;  1VQ6 A;  4M7A D;  1NPR A;  1R0B G;  4EDU A;  1M8V A;  1VQ4 T;  4E47 A;  5CQY A;  3QZ5 B;  4CC3 A;  3M53 A;  2LT1 A;  2VC8 A;  3KBG A;  2DA9 A;  1M90 R;  1NZ9 A;  3A5Z B;  3X25 B;  1Z9Q A;  2ZPB B;  3GIB A;  1KK7 A;  5GMK i;  4M7D G;  2QGF B;  4M7D C;  1KC8 C;  2LZ6 B;  1JJ2 P;  3CC7 T;  1MMG A;  4J9G A;  3EG3 A;  4KH0 B;  1Q82 R;  2FRW A;  1V76 A;  2CUB A;  1I5L A;  3L2U A;  5GAM d;  4M7D E;  1JU5 C;  3E19 A;  2HDA A;  4A53 A;  1K8A R;  2QXF A;  1CSK A;  5CKB A;  3VS3 A;  3H0F A;  1ZBX A;  1ZHI A;  2K2M A;  4X9C A;  5GAO n;  1B07 A;  1M2V B;  2ESW A;  4LDX A;  1IGU A;  3CCV T;  2E1H A;  2XK0 A;  2E65 A;  1PWT A;  4M75 E;  1PC0 A;  5D6W A;  3CCE A;  4R55 A;  3EGU A;  5GMK l;  4KT0 E;  4M7D A;  2Y4Y A;  3J80 E;  3RUX A;  4JZ3 A;  5J26 A;  2X4W A;  3EHR A;  3P8D A;  4M78 D;  4PJJ A;  1B3Q A;  3PIO A;  2L0A A;  1GBQ A;  4NS5 A;  4DA4 A;  1YP5 A;  2CZ1 B;  1LNX A;  1JEG A;  1Y07 A;  1GFC A;  3CEY A;  1WA7 A;  4QQD A;  5KYU B;  2KEA A;  1J3T A;  5DLO A;  3SD4 A;  3I5R A;  1SHG A;  3MP8 A;  1M4Z A;  1VYT A;  4C5E A;  3EAE A;  5D6X A;  4M7D F;  4E7K A;  3JCM d;  2I2L A;  3OYB A;  4EIK A;  3NHN A;  2FYK A;  4C8Q E;  3QXE B;  1C6V X;  3OW2 P;  1D0Z A;  4KGZ B;  4X34 A;  4AMC A;  3OYA A;  2M9U A;  3JB9 G;  1NEG A;  2NLU A;  4AFU C;  2GFU A;  1WNL A;  1JO8 A;  1TUG B;  1WJR A;  2Y4X A;  3G71 A;  5IN1 A;  3VRY A;  5LJ3 j;  2QQB A;  2FZG B;  4AFS C;  1SHF A;  2E6N A;  3KFV A;  1NEB A;  3QBY A;  4OMQ A;  3KUF A;  4LNP A;  2LX9 A;  2OJ2 A;  1IB8 A;  1VQ9 Q;  4JPB W;  3S3O A;  3OMG A;  4FL6 A;  2R5A A;  3L1A A;  3NFC A;  1ACM B;  2HCK A;  3L2V A;  4XTX A;  1R77 A;  3OYM A;  2DYB A;  4Y28 E;  3G71 T;  3CXC S;  2KVQ G;  3VRZ A;  4E7J A;  1YJN T;  1VQ4 Q;  2OTL Q;  1W1F A;  2EQJ A;  1EIF A;  4PLI A;  3REA B;  2ZZD A;  3TSZ A;  4HCK A;  2MYS A;  1KQ1 A;  3V8L A;  3G4S T;  3MO8 A;  4FYW B;  2GGR A;  3M4G A;  1U1T A;  5LJ5 e;  1QVF A;  4J7F A;  1Q86 R;  5LJ5 h;  2D9T A;  5GAO l;  2E41 A;  2J7I A;  8AT1 B;  2COY A;  4IIO A;  2FZK B;  2PUO B;  2HSP A;  2RHX A;  4IUV A;  5DM7 R;  5HKC A;  1VQ9 A;  5A0L A;  1C0M A;  3RMS A;  1VIE A;  4WCI A;  1QWE A;  2YHT A;  4BI3 A;  1U5S A;  1JQQ A;  5CQX A;  1PSF A;  4FT4 A;  3V8J A;  3G6E T;  1MV3 A;  4BI4 A;  2YRV A;  3EFO A;  2QQA A;  2DTO A;  1QP3 A;  2QEX Q;  3M0Q A;  8ATC B;  3TRE A;  1AZG B;  3SWN B;  5GAM g;  3J7A F;  2NWM A;  2K57 A;  3VS5 A;  4MZP A;  2DEU A;  3RES A;  1WDX A;  3QO3 A;  2K3X A;  1BI1 A;  2ROT A;  2CUD A;  2EKO A;  4FYY B;  4RG8 A;  3VS1 A;  4XTV A;  3A98 A;  3CCQ A;  3M54 A;  3OYK A;  1G83 A;  1RAH B;  2PQW A;  3QZ9 B;  4VUB A;  2HZY A;  4DBR A;  1LPL A;  4N0A A;  4E7Z A;  4J9D A;  4L6V 5;  3KXT A;  4JRP A;  5GMK j;  2X3W D;  2P0Q A;  1YJ9 A;  3CCQ T;  1YFN A;  1TOV A;  3JB9 H;  2DVJ A;  4KUD K;  1VQK T;  3EFR A;  4A4F A;  1QVG A;  1VQO T;  1H64 1;  5GAO m;  4JS4 A;  2F69 A;  4RTX A;  3EG9 B;  5A2Q E;  3PTA A;  2ABL A;  1KD1 U;  2DTI A;  5GJV B;  1YHQ Q;  1SG5 A;  3JAM E;  4QW2 A;  3LH5 A;  2EW3 A;  2LT4 A;  3VUB A;  1ZSG A;  2ZPE B;  2MK5 A;  4M7A F;  5J3B A;  2HQE A;  1FMV A;  1HJD A;  1R0C B;  1KQS P;  2PNI A;  1IXD A;  1WFW A;  4C92 F;  1AT1 B;  1RI0 A;  4UC4 A;  2NYS A;  1I5O B;  3QDF A;  4E7S A;  4KUL A;  1YN8 A;  2X4X A;  5ECA A;  5EG2 A;  1Q7Y R;  3G71 Q;  3EGX A;  2IPO B;  5AYF A;  2L8D A;  5CIU A;  2EGE A;  4ZGJ B;  3GF5 A;  3QKJ A;  4M78 G;  3G4S Q;  2L3P A;  1PKT A;  3RKY A;  1SSF A;  2YLB A;  4J9E A;  3PMI A;  2RN8 A;  3I55 Q;  1YJN Q;  2OTL T;  1M90 U;  2KGT A;  3M57 A;  9ATC B;  1YJN A;  1Q81 U;  1Q86 C;  1ZBJ A;  4ZGD B;  4FM4 B;  1K73 C;  3CCL T;  2K6D A;  5AT1 B;  4MMK A;  1YCS B;  1YJW Q;  2EGA A;  3OYG A;  4E7H A;  3ULR B;  2KXD A;  3HP9 A;  4RMO A;  4PJO C;  2DD4 A;  3CCQ Q;  3JV3 A;  2F5K A;  4DBH A;  3JCM b;  3UA6 A;  4XAX B;  2F2V A;  4XK8 E;  3EG9 A;  4XU1 A;  5CKH A;  1S1N A;  2P4T A;  2IIM A;  4C92 E;  4OB1 B;  2MAM A;  3HHT B;  4PJO E;  1RAI B;  4M7D D;  2AIR B;  2KR3 A;  1D09 B;  1M3B A;  1PSE A;  5C0M A;  3CD6 Q;  3P8H A;  2O01 E;  2QEX A;  1NYF A;  1QVF P;  1M8M A;  2YRC A;  1YIJ A;  1ZA2 B;  4QVZ A;  1JXO A;  1N9S A;  2YXY A;  2JTE A;  3EGX B;  4EMG A;  1VQO A;  3OS5 A;  4V2S A;  2FZC B;  4Z89 A;  1WGS A;  3A8M B;  1TS9 A;  3CPF A;  1UEC A;  5KCO A;  3L2Z A;  4L59 A;  5GAO p;  2R5M A;  5IT9 E;  1UGP B;  2DER A;  5IHK A;  2DZ9 A;  1TG0 A;  1VQM T;  4OGE A;  4FIB A;  1M3C A;  2DL4 A;  1VQK A;  6AT1 B;  3CCL Q;  2ZPG B;  3P8B B;  4Q5W A;  2NUZ A;  2KT1 A;  2VXE A;  1I0C A;  2EQI A;  1G2B A;  3FRN A;  2CRE A;  4DEX A;  2CZ7 B;  4DBF A;  1OX9 A;  3FIF A;  1E6H A;  3C94 A;  2D0Q B;  2EJF A;  2RQR A;  3VUZ A;  4TVR A;  3CCR A;  2RB6 A;  2CZ0 B;  3X28 B;  1K9M R;  2BIV A;  2LQN A;  2DXB A;  3MP6 A;  2K2V A;  3H0H A;  1YHQ T;  3OMC A;  3JCM X;  2HBW A;  1F1B B;  5CVI A;  3QHS A;  1QQJ A;  4M77 D;  3UDC A;  3LW5 E;  3DB4 A;  4C0D B;  1T0H A;  1X69 A;  3JB9 F;  1VQO Q;  1VQP Q;  4N4G A;  1QWF A;  3CCS Q;  1GCP A;  1B34 A;  4PJO B;  3M5A A;  1PD1 A;  4FYX B;  1BI0 A;  1MMN A;  5FU7 B;  2XDP A;  5CKD A;  1VQ7 T;  3UT1 A;  4J9F A;  1QCF A;  2LQK A;  2XHC A;  5GAN j;  1CKA A;  4C92 D;  2LRQ A;  3QSU A;  2AKK A;  3EFS A;  5I2S A;  3MCA B;  2D8H A;  3G7Z A;  4PKC C;  5CKE A;  5KYW B;  3CQT A;  3EG0 A;  2RI3 A;  4PJO F;  2GQI A;  1I81 A;  2LCS A;  2C0T A;  2DL5 A;  2EAY A;  1RAC B;  1ZUK A;  3QYH B;  1G8X A;  2CGH A;  3UF4 A;  2QG9 B;  5GAN h;  2L2P A;  4MZM A;  1ARK A;  4M78 E;  2HQX A;  2QQR A;  2O4X B;  2FPD A;  3HFO A;  3FC3 A;  2E4H A;  2QDY B;  2LQW A;  4A54 A;  2PZ1 A;  3OW2 S;  2FB7 A;  3EG1 A;  4GLK A;  2YLC A;  2ROL A;  1WIE A;  1YIJ T;  1W2B A;  1YI2 T;  3LLR A;  3NTI A;  1QCO A;  1SKU B;  1RL2 A;  1VQ4 A;  4BY6 C;  4YTL A;  3FJ5 A;  1D3B A;  2RH2 A;  1MMD A;  5KCH A;  3TEE A;  5GMK h;  1MUZ A;  3QYG B;  3LWH A;  1ZSZ C;  2V1R A;  1BIB A;  4KBM B;  5I2M A;  3PVQ A;  2RJC A;  1WHM A;  3FEO A;  2RF0 A;  4OMO A;  1RAG B;  2MWP A;  1BK2 A;  2HL5 C;  1AWX A;  5C6S A;  1G3Y A;  1OU9 A;  2K7A A;  3CCE T;  1K0X A;  1A0N B;  4M75 A;  1Y7X A;  4LD9 K;  4E2F B;  2EFI A;  1QCN A;  2MF2 A;  4WF2 A;  1VQM Q;  1U1S A;  2Z0W A;  1ABQ A;  1Q7Y C;  4X9D A;  2YDL A;  4RCB A;  5L8R E;  1VQ5 T;  4C5H A;  2YUN A;  4EMK A;  4IUQ A;  1OX8 A;  5FRM A;  2V8J A;  3T9N A;  3OYC A;  3CCV A;  2J6O A;  4R56 A;  4F7U G;  5GAN 3;  2KRS A;  3I55 T;  4F14 A;  3PGG A;  3GPL A;  2VV5 A;  3RDV A;  3MET A;  1AWJ A;  2EQU A;  3HRS A;  2DFU A;  2GF7 A;  2BZ8 A;  3PVL A;  5KYU A;  3Q1J A;  3V8K A;  4A4E A;  4C8Q C;  5LJ5 f;  2RK1 A;  2RQW A;  2IG0 A;  1VQP T;  2OAU A;  2MI6 A;  1KJW A;  2KY9 A;  4M7A A;  4M7A B;  1Y71 A;  4BY6 B;  1T3S A;  3FB9 A;  2O2O A;  2H3E B;  1D1A A;  3CCV Q;  4MML A;  1NM7 A;  2KQW A;  1W6X A;  3GNF B;  4M77 F;  3MHX A;  2NUT A;  2NUT B;  1Q86 U;  3OY9 A;  4O6J A;  4N4H A;  2FRY A;  5CAI A;  3G4S A;  1UFF A;  1TH7 A;  2D6F A;  2KRN A;  2GNC A;  1FWZ A;  1VQN T;  4FU6 A;  4PNO A;  2DXC A;  2DIG A;  1YI2 A;  2FL7 A;  1U8R A;  4J5Y A;  2DBK A;  2RI2 A;  4C8Q B;  1UB4 A;  4C8Q F;  1WHK A;  2KRO A;  2VAS A;  3EHQ A;  5GMK e;  3SWN A;  1VQL A;  2ATC B;  1YJ9 T;  1EZZ B;  1HXD A;  5IHI A;  2JMC A;  2JNG A;  3ME9 A;  1V1C A;  1R8O B;  4FYV B;  2VXF A;  2HEQ A;  4HKE A;  1UGV A;  2RHY A;  4OF1 A;  2FO0 A;  1SRM A;  4M75 C;  4PJN A;  2X3X D;  1RAE B;  4IUR A;  4FSX A;  4JZ4 A;  3FDR A;  2H8H A;  4NL2 A;  5A0G A;  4WTO B;  2L3S A;  1BYM A;  4GLM A;  3OSV A;  2CH4 W;  1QKX A;  4PJL A;  1PHT A;  1VUB A;  2K79 A;  2RM4 A;  3A8G B;  1VQ8 A;  4M77 G;  1PKS A;  1ZLM A;  4LDV A;  1K9A A;  1IGQ A;  4RTU A;  1JBM A;  2M16 A;  3MKD A;  1VQ8 T;  3UWN A;  1WHH A;  4N4I A;  2LCC A;  1VQ9 T;  3JB9 D;  2ZAE A;  4BI8 B;  2BKD N;  3AHU A;  4AG1 C;  2M0Y A;  4XTZ A;  3THK A;  2JN0 A;  3MPU B;  4MZT A;  1QKW A;  5I21 A;  1WJS A;  3IQL A;  1UEB A;  1M1F A;  2KAF A;  5FW9 A;  3PMT A;  2NUP B;  4PJO G;  2I0N A;  1WHG A;  4C92 G;  4ZTJ A;  4DBQ A;  3OA6 A;  3LH0 A;  2J6F A;  3ZL7 C;  2RJD A;  4M77 A;  1NBE B;  1KC8 R;  2QA4 T;  2X35 A;  5GAM f;  1UDL A;  4L5G A;  3NMZ C;  1NLO C;  1GXI E;  2BE9 B;  5GAN 8;  3GP8 A;  5GAN f;  1AEY A;  3FJP A;  3M0P A;  4F7U A;  1VQL Q;  1PM3 A;  1LCK A;  3X24 B;  1SPK A;  5CKF A;  5GAN 6;  4ZTF A;  2EYZ A;  4HCZ A;  4CC2 A;  2BZY A;  3H8Z A;  1K73 R;  4M77 E;  4J6X A;  4BE0 A;  3BDL A;  2VVK A;  4O5V A;  2K3B A;  4FCY A;  3RIR A;  1Y96 B;  4BAC A;  4J9B A;  1UGQ B;  3OYI A;  4BDZ A;  2X4J A;  4M77 C;  3JB9 I;  4EPC A;  1FMK A;  2JMA A;  1Q81 C;  2CP2 A;  2AK5 A;  3E9F A;  2VGN A;  2DXT A;  1QP2 A;  3CCL A;  1NYG A;  1S72 Q;  2JXB A;  4LUE A;  2LNV A;  3CD6 A;  2G6F X;  2RNA A;  5GAN e;  4AFZ C;  1ZUY A;  1NJI C;  4B9W A;  1RLP C;  3HSB A;  4M78 F;  4XU3 A;  4M75 F;  4ME7 A;  1IO6 A;  4OMF B;  2DM1 A;  4CI0 C;  4XTU A;  4HVV A;  3L2W A;  4GBQ A;  1TSF A;  2F2X A;  2A36 A;  4CRI A;  1AZE A;  2XDD A;  2AZS A;  4AT1 B;  2NUP A;  4BDY A;  5KYX B;  5FRN A;  5GAN d;  2HMA A;  4KGV B;  3CXC P;  1M9S A;  1P92 A;  1K4U S;  4ESR A;  2CP6 A;  2XU8 A;  1UHC A;  1CKB A;  2CT4 A;  1X2K A;  1XQH A;  4C5G A;  1IRE B;  1PCX A;  1MND A;  1Y96 A;  1TUC A;  1Z9Z A;  1K9M C;  3HL8 A;  5HY6 A;  4C8Q A;  1FYN A;  2VUB A;  4A4G A;  5FU7 C;  3QUI A;  2DPP B;  4XTW A;  2MPX C;  2RQU A;  4JLG A;  2K3Y A;  3M0R A;  1E7O A;  1RUW A;  2DZC A;  2R57 A;  2PVO B;  3OYY A;  3M55 A;  2CSI A;  1M1K R;  3VS0 A;  2OAW A;  1YBY A;  3X20 B;  2X9H A;  1JXM A;  3JCM V;  1JJ2 S;  4ORZ A;  3CCJ T;  3AT1 B;  4OML A;  5L23 A;  5IXB A;  4QVC A;  1HK9 A;  2JT4 A;  4QKU A;  2DRM A;  4K11 A;  5LJ5 g;  2BTT A;  3NGP A;  4HXJ A;  4LDU A;  2RD1 A;  3EGD A;  2JS2 A;  4J9C A;  4ELY C;  3RKX A;  3OYL A;  3CPW P;  2COW A;  3GOX A;  2LQ8 A;  5GAN 2;  2HD0 A;  3HPW A;  1W4S A;  1WXB A;  3OYN A;  1WQ7 A;  4LUD A;  2AHJ B;  3M58 A;  3GLX A;  5FU6 C;  1GCQ C;  4BUG A;  2XI9 A;  1YWP A;  1I1J A;  4PLL A;  3X26 B;  4II1 A;  1VQN Q;  1G3T A;  2ZPH B;  4GY5 A;  3V7S A;  4DOW A;  5DY9 A;  3N5B B;  2RHI A;  3CBP A;  4F16 A;  4IUU A;  2CSQ A;  1Y0M A;  2CDT A;  4E7L A;  4OB3 B;  1NE8 A;  3RBB B;  1LVK A;  3SB2 A;  1T0J A;  2KI7 A;  1K1Z A;  1RLQ C;  1TUD A;  4Y92 A;  3TVT A;  3QWX X;  1BI2 A;  1OUL A;  2O31 A;  3I56 T;  4J6Y A;  1VQ7 A;  1KHC A;  3HRU A;  3CPW S;  3OQ5 A;  4FW1 A;  2L3Q A;  3CME T;  2KMT A;  1I07 A;  1WHJ A;  2O4X A;  1K9M U;  4ATO A;  2OI3 A;  4M4Z A;  1WZO A;  2E64 A;  1M1G A;  2RMO A;  3CC2 T;  2HSE B;  4RTT A;  2FG0 A;  3O5Z A;  1N6A A;  2KRM A;  2VKN A;  1W2B S;  3JCM J;  2EYQ A;  1QLY A;  2HNI A;  3EGD B;  2YWW A;  2VGM A;  4E6R A;  3FLG A;  1HYO A;  4J8O A;  3BW1 A;  2QK0 A;  3E2U A;  3C0C A;  2RPN A;  1N8R C;  4JS5 A;  1U3O A;  2EJG A;  4C92 B;  1OI1 A;  1VQ8 Q;  3H41 A;  2E3H A;  4C8Q G;  2GCX A;  3CCR Q;  2QTX A;  2XMF A;  4QVD A;  3TCJ A;  2JZ2 A;  2YT6 A;  1D0Y A;  2E12 A;  2K5I A;  1SEM A;  3M4Y A;  2C0I A;  2LP5 A;  1AOJ A;  2KYM A;  4N0A C;  4M75 B;  1MGQ A;  2WSE E;  1MV0 B;  1LOJ A;  1SF9 A;  3ZEH A;  4LD6 A;  4HA8 A;  1WLP B;  4LXC A;  2RJF A;  4C92 C;  2PVG B;  5LJ3 e;  2OTL A;  2PU9 B;  1VQP A;  4EMK B;  1PD0 A;  2COZ A;  2P84 A;  3CC7 A;  2A28 A;  2P0P A;  2C06 A;  1U06 A;  4NOY A;  2DKG A;  3M0U A;  2QDL A;  1WQW A;  1XJW B;  1X6B A;  1VQL T;  2R58 A;  3ZFJ A;  4PJO A;  2KE9 A;  1ZA1 B;  2PTK A;  4OVA A;  5KYY B;  5J39 A;  2B86 A;  4FSS A;  4M78 A;  1YIT T;  2KBT A;  5D7U A;  3TU4 K;  2DE0 X;  2V8K A;  2J6K A;  2DL3 A;  1VYV A;  4OB0 B;  4XTY A;  1AVZ C;  5GAN 7;  4IUP A;  3C12 A;  3G6E A;  2CP5 A;  3CC4 T;  1GBR A;  2QA4 A;  3VV0 A;  3L2Q A;  3S3M A;  1I4K 1;  1X43 A;  3M0T A;  1VQ7 Q;  2DXU A;  2GTJ A;  4JJB A;  2LX7 A;  1KD1 R;  4Y91 A;  4RTV A;  3EFO B;  2DTH A;  4HT9 A;  2JTF A;  2DK3 A;  2ED0 A;  2XKO C;  1M30 A;  2FVU A;  3D7S B;  3EH1 A;  4B9X A;  1YIT A;  2EVR A;  1PRM C;  4LN2 A;  3BFM A;  3VS4 A;  3VJP A;  3JSC A;  1VQ5 A;  1XNI A;  5GAO q;  5GAN 5;  2IVW A;  5KYY A;  3OW2 A;  1N27 A;  4ANJ A; 
#chains in the Genus database with same CATH homology
 4J9D A;  2CH4 A;  2YUO A;  3UAT A;  2VWF A;  1V1C A;  4RUG A;  5I11 A;  2HEQ A;  3I5S A;  2JM9 A;  2X3W D;  1HD3 A;  1UGV A;  2LJ3 A;  2FO0 A;  1K0S A;  1SRM A;  1KSW A;  2DIL A;  3VS2 A;  2DVJ A;  2X3X D;  1AWO A;  2LJ0 A;  1NG2 A;  1T3L A;  2EKH A;  4JZ4 A;  2H8H A;  2L3S A;  2O9V A;  1N5Z A;  4RTX A;  1UJ0 A;  1K76 A;  2V1Q A;  4GLM A;  2DMO A;  4D8K A;  2ABL A;  1VA7 A;  2CH4 W;  1QKX A;  2AZV A;  5HCK A;  2YSQ A;  5GJV B;  1PHT A;  2EPD A;  2K79 A;  2DLP A;  3LH5 A;  2EW3 A;  1UUE A;  1PKS A;  1ZLM A;  1K9A A;  4RTU A;  1ZSG A;  2KXC A;  4J9H A;  5I22 A;  4RTW A;  3I35 A;  2DF6 A;  1HJD A;  4A63 B;  5EC7 A;  2PNI A;  1ABO A;  1WFW A;  1M27 C;  1X2Q A;  1YN8 A;  5ECA A;  4AG1 C;  2M0Y A;  2KT8 A;  3THK A;  2J05 A;  4D8D A;  1QKW A;  4R0K A;  1OOT A;  2EGE A;  5FWB A;  3IQL A;  5FW9 A;  2A08 A;  2DJQ A;  2EYY A;  2I0N A;  2L3P A;  4DEY A;  1PKT A;  1VYU A;  4J9E A;  2RN8 A;  2KGT A;  2W0Z A;  2J6F A;  3ZL7 C;  1ZBJ A;  4RTY A;  2K6D A;  1YCS B;  4OMP A;  1UDL A;  3NMZ C;  1NLO C;  2EGA A;  1H92 A;  2K9G A;  5IHN A;  3QWY A;  3ULR B;  2KXD A;  1AEY A;  3M0P A;  4X1V A;  4AFQ C;  1LCK A;  1SPK A;  3JV3 A;  2LMJ A;  1AWW A;  3SEM A;  2EYZ A;  3UA6 A;  4CC2 A;  2BZY A;  4HVU A;  2F2V A;  2MCN A;  1UJY A;  2VVK A;  2K3B A;  4Z8A A;  1S1N A;  2IIM A;  1BU1 A;  1KFZ A;  4J9B A;  1BBZ A;  1X27 A;  2KR3 A;  2C0O A;  2KYB A;  1WX6 A;  1M3B A;  2FEI A;  1HSQ A;  1PNJ A;  3UA7 A;  1FMK A;  1EFN A;  2JMA A;  4AG2 C;  2AK5 A;  2D0N A;  1NYF A;  1WYX A;  4OMM A;  1M8M A;  1NYG A;  1GRI A;  2JXB A;  1UE9 A;  4LUE A;  4CC4 B;  1JXO A;  2G6F X;  3GBQ A;  2ECZ A;  2RNA A;  4HVW A;  2P4R A;  2JTE A;  4AFZ C;  1ZUY A;  2MOX A;  3TSW A;  3NPF A;  4QT7 A;  4RTZ A;  1RLP C;  2DNU A;  1OPL A;  2EBP A;  4Z89 A;  2A37 A;  1IO6 A;  1WXU A;  4F17 A;  1UEC A;  2DM1 A;  2BZX A;  1XOV A;  1GFD A;  1W70 A;  2DRK A;  4HVV A;  1YNZ A;  2EYX A;  2DX1 A;  5IHK A;  2YUP A;  4GBQ A;  2SEM A;  4LE9 A;  1TG0 A;  2F2X A;  2KNB B;  2A36 A;  1M3C A;  2DL4 A;  2AKL A;  1AZE A;  2AZS A;  2RQV A;  1KIK A;  2NUZ A;  1K4U S;  4ESR A;  2KT1 A;  3REB B;  1I0C A;  2EQI A;  1UHC A;  1G2B A;  1CKB A;  2CT4 A;  2CRE A;  2JS0 A;  4DEX A;  1X2K A;  4J9I A;  4OMN A;  1TUC A;  1Z9Z A;  1E6H A;  1FYN A;  2RQR A;  2O88 A;  1E6G A;  2RQU A;  2DBM A;  4CC3 A;  3M0R A;  1E7O A;  1RUW A;  2DA9 A;  2CSI A;  2JW4 A;  3VS0 A;  2LQN A;  2OAW A;  1Z9Q A;  3H0H A;  1JXM A;  2LZ6 B;  3VS6 A;  4ORZ A;  2HBW A;  4J9G A;  4OML A;  3VS7 A;  3EG3 A;  5L23 A;  2YUQ A;  5IXB A;  2JT4 A;  2DRM A;  2GTO A;  2FRW A;  4K11 A;  2GBQ A;  1T0H A;  1OEB A;  1X69 A;  2CUB A;  2BTT A;  2O9S A;  3NGP A;  2F2W A;  4HXJ A;  4ZNX A;  1JU5 C;  1QWF A;  1GCP A;  2JS2 A;  4J9C A;  2HDA A;  1CSK A;  3VS3 A;  3H0F A;  2K2M A;  1SRL A;  1GCQ A;  1B07 A;  2ESW A;  2CT3 A;  5IXF A;  4J9F A;  1UHF A;  1QCF A;  1WXB A;  1PWT A;  4Z88 A;  3U23 A;  2W10 A;  1WI7 A;  4LUD A;  1AD5 A;  1CKA A;  1GCQ C;  3EGU A;  2SRC A;  3I9Q A;  1YWP A;  1I1J A;  1BB9 A;  4JZ3 A;  2AKK A;  3EHR A;  2M51 A;  1B3Q A;  2D8H A;  3M0S A;  2L0A A;  5IH2 A;  1GBQ A;  1YP5 A;  3CQT A;  3EG0 A;  2DL8 A;  3SHW A;  2GQI A;  2C0T A;  2DL5 A;  2LCS A;  4F16 A;  1ZUK A;  2CSQ A;  1Y0M A;  1JEG A;  4CC7 A;  2CDT A;  1GFC A;  3RBB B;  3UF4 A;  1T0J A;  1WA7 A;  1K1Z A;  1RLQ C;  2L2P A;  2KEA A;  1TUD A;  1ARK A;  1J3T A;  3I5R A;  1SHG A;  4Y92 A;  2ENM A;  1VYT A;  3TVT A;  2LJ1 A;  2FPD A;  3QWX X;  2LQW A;  2O31 A;  2PZ1 A;  3EG1 A;  4EIK A;  2ROL A;  1WIE A;  2L3Q A;  3NHN A;  1I07 A;  2OI3 A;  4M4Z A;  1UTI A;  2RMO A;  4RTT A;  2FG0 A;  3FJ5 A;  2DL7 A;  2MIO A;  3O5Z A;  2KRM A;  1YWO A;  1MUZ A;  2VKN A;  1QLY A;  1NEG A;  4AFU C;  4E6R A;  2V1R A;  2D8J A;  2ED1 A;  1JO8 A;  3PVQ A;  3VRY A;  2RF0 A;  1OPK A;  1RI9 A;  2JM8 A;  1NLP C;  3C0C A;  4AFS C;  2RPN A;  2FPE A;  4OMO A;  1SHF A;  1BK2 A;  3KFV A;  1AWX A;  1U3O A;  1NEB A;  2K7A A;  3H41 A;  4OMQ A;  2LNH B;  4LNP A;  1K0X A;  1A0N B;  2OJ2 A;  4KRT A;  4JPB W;  2XMF A;  2HCK A;  2YT6 A;  1SEM A;  1ABQ A;  2DYB A;  2C0I A;  2YDL A;  2LP5 A;  1Y57 A;  2E5K A;  1AOJ A;  2KYM A;  3VRZ A;  1W1F A;  1X6G A;  3REA B;  2YUN A;  3TSZ A;  4HCK A;  4IIM A;  1MV0 B;  3H0I A;  2J6O A;  2GGR A;  1WLP B;  1M3A A;  2EGC A;  2KRS A;  1ZX6 A;  4F14 A;  3R6N A;  1AWJ A;  2J7I A;  4JJC A;  2A28 A;  4IIO A;  2BZ8 A;  3PVL A;  1ZUU A;  2HSP A;  2RQT A;  1U06 A;  2J06 A;  3M0U A;  1SSH A;  2QDL A;  1X6B A;  2RQW A;  2KE9 A;  2PTK A;  4WCI A;  1H8K A;  2B86 A;  4FSS A;  1KJW A;  1QWE A;  1T3S A;  2KBT A;  2DE0 X;  2J6K A;  3EG2 A;  1U5S A;  2O2O A;  1JQQ A;  2DL3 A;  1VYV A;  1MV3 A;  1AVZ C;  3PE0 A;  1NM7 A;  1W6X A;  3RNJ A;  1OV3 A;  2FRY A;  1GBR A;  1UFF A;  5FWC A;  1WXT A;  1X43 A;  3M0T A;  1UG1 A;  3M0Q A;  2KRN A;  2GNC A;  2GTJ A;  4JJB A;  1PRL C;  1AZG B;  2LX7 A;  4RTV A;  2EYW A;  2NWM A;  3VS5 A;  1WDX A;  2DBK A;  2ED0 A;  2ROT A;  2CUD A;  3VS1 A;  1M30 A;  4JJD A;  1H3H A;  3A98 A;  2EVR A;  2KRO A;  1PRM C;  2FPF A;  4LN2 A;  2D1X A;  3EHQ A;  3VS4 A;  1G83 A;  5GJW B;  5IHI A;  1GL5 A;  2JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...