3CC4Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc4Q00
3OW2P 3CMAQ 1KD1R 3CCJQ 1YJNQ 1YHQQ 3I55Q 3CMEQ 3CCEQ 1VQ9Q 1VQ5Q 3CXCP 3CPWP 1Q7YR 1K8AR 1VQKQ 1KC8R 2QA4Q 1N8RR 3CC2Q 1VQOQ 1JJ2P 1YIJQ 2OTLQ 3CCMQ 1W2BP 1VQ6Q 1VQ7Q 3CC4Q 1K73R 3CD6Q 2QEXQ 3CCRQ 1YI2Q 1YITQ 1M90R 3G4SQ 3CCVQ 1QVGP 3CCLQ 3CCSQ 1M1KR 1Q86R 1VQLQ 1VQPQ 3G71Q 1YJ9Q 1KQSP 1VQ4Q 1K9MR 1YJWQ 2OTJQ 3CCQQ 3I56Q 1VQ8Q 1NJIR 1Q81R 1S72Q 1VQMQ 1Q82R 3G6EQ 1VQNQ 3CC7Q 1QVFP 3CCUQ
chains in the Genus database with same CATH superfamily
1IGQA 4RTYA 1UJ0A 3MCAB 3FIFA 1CKBA 2KROA 5KYWA 2QXFA 2ZPGB 1K9AA 5LJ3f 3OA6A 5GAOl 1PKSA 2AKLA 2DILA 4JUVA 4M75D 2LP5A 1R0CB 1X75C 5CCAA 3PMIA 5KYWB 1KHIA 2YXYA 3BY7A 2P84A 2CP2A 1M27C 2QK0A 1QWFA 3FEOA 2F69A 1UGVA 4J9DA 2KQWA 5IHNA 2DIGA 1M4ZA 1ARKA 4KUDK 3MJXA 3M0QA 2VXEA 3CXCS 4M78E 1WDXA 2NUTA 4LDWA 2EJ9A 2M51A 2XHCA 4QQDA 2J6FA 2RHYA 3LLRA 2KYMA 3I55Q 2HAXA 1W2BA 3IQLA 1I5LA 3VS1A 3OYDA 5CKEA 4Z88A 3CCUA 2XDBA 2NUTB 2DYIA 2YWWA 1Q81U 1ZHIA 3RKWA 2YHTA 3HHTB 4M78G 1QCFA 4F7UF 2MCNA 4LD6A 1Y96A 2A7YA 3UA6A 2CS7A 1BCOA 3MHXA 1TH7A 2WSFE 1YJWA 2OAUA 3JCMh 3RNJA 1AD5A 5FU7B 4PJOD 1FMWA 1M90U 1NYFA 3UDCA 3M9QA 4C0DB 5KYYB 1X01A 3RBBB 1K9MR 2K5LA 1MHNA 5DY9A 4XTUA 3R6NA 3CPWA 2DJZA 5GAMj 2MOXA 4CC3A 5I11A 2FPDA 1VQKQ 1BU1A 2JW4A 3L2ZA 1YITT 2GNCA 2RQTA 2RNAA 3SWNA 5GAN3 3WVEB 4KULA 4KRTA 1PRMC 1BIAA 4BI3A 2ATCB 2K79A 5A0LA 2Y4YA 4ME7A 1MMNA 5D6XA 4C92G 1S72A 1PG5B 2ECZA 3REAB 2J6KA 3JCMc 3CMAA 2RF0A 4LN2A 4MDWA 4E6RA 4J7FA 2R58A 5LJ5j 1I4K1 2YSQA 1D0ZA 4Z8AA 1TS9A 5I2MA 4F17A 2BIVA 5CKBA 3RDVA 4C92C 4UC4A 3QZ5B 1MV3A 3LH5A 1N8RR 3L2VA 1Y7XA 4DEXA 1KQSS 2JS0A 4OF1A 1YHQA 4PFOA 1E6HA 1VQ5A 1Q81C 2G3RA 4E7HA 4C8QG 3EG9A 2JMAA 3DLMA 4JZ4A 2EGEA 3KUFA 4M75F 2K3BA 3GNFB 1G3WA 2IIMA 4J9IA 1RAFB 4JLIA 1VQ9Q 4BI4A 2HDAA 5CQYA 1I1JA 1MGQA 3EG9B 4F7UA 4E7IA 4OGCA 4RMOA 2VV5A 2HKQB 1YI2T 4M77A 3NTHA 1AWJA 2EQUA 5IN1A 3PTAA 2MMPA 2QQBA 5ECAA 1WHLA 1KJWA 1IGUA 1JU5C 4C8QC 4F7UB 4OB3B 2JTMA 4QVDA 1I5OB 4O5VA 3CCUQ 3EH1A 2PQWA 1NBEB 1BCMA 1K8AR 1OX9A 2XICA 2HQEA 2CYZB 4Y91A 3M58A 4DQ2A 2RD1A 8AT1B 2HQHA 1G83A 1YFNA 4AT1B 3I56T 3TQ7P 1X43A 3C4SA 2EQMA 4FYXB 3PMTA 2H3EB 4BDZA 3QSUA 1YCSB 2KRSA 3VRYA 1D1AA 4JS5A 2ZZDA 4HA8A 3OYMA 2EW3A 3RKYA 1VIFA 1X6OA 1VQ4T 2AZSA 4JJBA 4PJOF 2V8IA 3CC2A 2KK4A 5J39A 1QVFS 1A0NB 5GAMh 5GMKm 1KQ2A 2PTKA 2RJCA 1D1CA 4LUDA 1ZA2B 3M4GA 2HZYA 4LE9A 5GAOr 4ZN3A 2D8JA 2L8DA 2QA4Q 1K76A 1XTDA 3CC4T 4BDYA 1PSFA 3EFRA 2DXCA 2HKNA 1N6AA 3SFMA 2V1QA 5A0GA 2NLUA 3M57A 4LD9K 3QWYA 5LJ3e 2E1HA 3V8LA 2QEXA 2VWFA 5L23A 3DLLA 1BI3A 2SRCA 2LJ0A 2QDYB 1KK7A 3HTRA 1OEBA 1W1FA 4HVVA 3SDZA 5LJ5h 4XTYA 3GOXA 3EH2A 2KSSA 2AZVA 3M4YA 1KFZA 3EAEA 2BE9B 2DM1A 3UATA 1UG1A 2RO0A 3DB3A 4J7IA 3PT9A 4M75B 3OSSC 3TEEA 1YHQQ 2LRQA 2OX7A 1GFDA 1UDLA 1VQ5Q 2R5AA 2F2VA 3G6EA 5L8RE 2A28A 1VQNA 1RL2A 1OV3A 2KY9A 2CH4W 2HSPA 4R55A 3G71T 1VQLQ 2ZPFB 4JPBW 2I2LA 3CCQQ 1RAAB 2J05A 1GCQC 2JUFA 5GAN5 3PVQA 1N27A 1ZX6A 5KYUB 1M8MA 3RERA 1U5SA 1M9SA 3S6WA 5LJ3h 1I8FA 1F1BB 4OMMA 1M1KR 3A8HB 1CKAA 5GAN8 2E70A 2QQSA 3SEMA 3QHSA 1GRIA 2EQKA 3H9NA 4HCZA 3OBYA 4PL6A 1YJ9A 1YJNT 1SHFA 4PFZA 4E7SA 4OB0B 4A53A 2CSQA 3I56A 3JV3A 2OTJA 5GAOp 3VYGA 3GBQA 1V76A 1HYOA 1PM3A 3PE0A 3GP8A 4HCBA 2BZ8A 4FCYA 1OI1A 3G4SQ 3OS1A 4RTTA 2E64A 4PJOB 1H92A 1K0XA 1WPYA 3VU3C 5I22A 3E9FA 4M77E 2YLBA 1MMGA 1Q7YU 1ZQ1A 2E5KA 2GBQA 1RLPC 1RAHB 1GXIE 1QP2A 1BB9A 3C12A 5D6YA 1VA7A 3NMZC 1UB4A 1M3CA 3JB9G 2JOYA 1M30A 1FYNA 4CC4B 4F7UG 1NM7A 2GGRA 3P8BB 1VQ8Q 4M77G 3CC4A 3EFSA 3PIOA 1WHHA 3A8LB 4LXCA 2RPNA 3OS5A 3QUIA 1YBYA 1Y0MA 9ATCB 3DKMA 2RHZA 3M59A 1GBQA 1GCPA 3JCMQ 2K5IA 3JCMd 2COZA 4AFZC 2QEXQ 2LDMA 1JXOA 4XU3A 1OZ3A 2RK2A 1LNXA 5CAIA 2KXCA 2DL5A 3MEAA 5J26A 1ZSZA 4OMOA 3OYIA 4MDXA 1UHFA 2FO0A 4HVUA 1M3BA 3QYGB 3NPFA 2XG8D 5C6SA 5GJWB 1NEGA 2FZKB 1RACB 1ZSZB 1EX4A 3CCST 1HXDA 2X51A 4M7DC 3SD4A 2KRNA 2K3XA 1TUCA 2EQIA 1AWXA 2NUPA 3G6EQ 2NWMA 1VQNQ 5GMKi 3G71A 1VQ9T 5GANe 4J5YA 4Z89A 3LGLA 2L3SA 3MPUB 3REBB 1JO8A 1VIEA 2CP0A 1T3SA 2MF2A 5CK9A 5DLOA 4II1A 3V7RA 2X4WA 1VQ7T 2JTFA 3JCMg 2CZ7B 4OMPA 4ZGDB 1B34A 3VV0A 2HEQA 1VQOA 2E10A 2BTTA 5IAYA 4E47A 1Q95G 2CP3A 4RCCA 3CCRA 2IPOB 4RG2A 1UEBA 1TU0B 1Q7YC 1JJ2S 4DEYA 2D8HA 3FDRA 1B34B 4BD3A 2WACA 1M8VA 3L2WA 3OYFA 1WXUA 2DBKA 2FPEA 3FLGA 4BY6B 4R0KA 1OZ2A 4YTLA 4XTWA 1Q86R 2CH4A 2M0OA 4DBQA 4M7AC 2OTJQ 1QMCA 2X35A 1U1TA 4A4FA 6AT1B 3QWXX 3OW2P 4IUPA 1KD1R 2L2PA 1H8KA 2RA2A 2KDSA 2DF6A 3OYJA 1NPPA 2F2XA 2XU8A 2EBPA 4J9CA 3FC3A 3CBPA 3H8ZA 3EG3A 1VYUA 1RADB 2DBMA 1OYXA 2KNBB 1KQSP 3ZFJA 2DA9A 3NFCA 4X1VA 4HXJA 4IIOA 2AIRB 2QTXA 4M75C 1D0YA 4OB1B 4IUUA 2L5QA 5GMKl 2QA4T 4GLMA 1D3BB 2RMOA 4IUQA 3JCMX 4RTZA 1WXBA 2GFAA 4QW2A 2JVVA 4GY5A 2YRCA 4HCCA 1WFWA 5GMKe 2MAMA 4XTVA 2E6ZA 3VS2A 3RR6A 2XD0A 2J06A 3P8DA 2W10A 2O9SA 4KGZB 1J3TA 3CCJT 2LT1A 3T9NA 4Z02A 1C1AA 3HRTA 1WIEA 3LWIA 3H41A 2VXFA 2DZCA 2EYXA 2K7AA 1LPLA 1HSQA 3HL8A 3LWHA 3CD6T 5KE3A 3CCEA 1UTIA 2QGGA 3A5ZB 4WCIA 4J6YA 3CCMA 3KXTA 2OTLA 3E9GA 2QQRA 2AHJB 5FWBA 3CC7T 1QW1A 5GAMd 4FYWB 3CPFA 1WX6A 3L2UA 1YIJT 3M56A 3TSWA 4N4HA 2K6DA 5GJVB 3VS6A 3CCQT 4PJOC 1B7TA 4DBRA 4N0AC 3OMCA 4CC2A 2HL3A 2C06A 3UWNA 2CZ6B 2DL8A 4RG8A 2X4YA 1QVFP 3OSVA 3CMET 4B9XA 2K9GA 3A8GB 5KYYA 1AVZC 2QG9B 1KC8R 3EG2A 1VQOQ 5GMKh 2P0KA 1GCQA 5D7UA 2V8JA 4M7DF 2K57A 1BK2A 5LJ5d 2DXBA 4DBHA 2HNIA 4J6WA 1N5ZA 2D0QB 2LQ8A 5GAMg 1M3AA 4A63B 2RJEA 4ZTFA 3PIPA 4J83A 4J6XA 4C92E 5A0DA 2OI3A 1W4SA 1MNEA 3G4ST 1OU8A 3A1PA 1UGPB 1QVGP 1MMAA 1Y07A 1WJQA 2KR3A 3OYKA 1UECA 4ZGJB 2DLPA 2PU9B 4O6JA 5FU6B 1QKWA 1X6BA 4XTZA 5AYFA 2O01E 2DL3A 4PNOA 3P8HA 4M78D 2LQKA 2EKHA 1ZSZC 3UA7A 1NZ9A 1NJIU 3D7SB 4F16A 4M7AF 5LJ3d 2KVQG 5LJ5g 4ORZA 2LX7A 2B8AA 3M54A 2QYZA 2XMFA 1KHCA 4C8QE 3VS7A 2JJ9A 2CZ0B 1SEMA 3EG1A 4EDUA 2YUNA 3QJ6A 4E7KA 3E1SA 2CP6A 4RCBA 5FW9A 1AHJB 2E41A 1BBZA 1VQ6T 2K4YA 2JT4A 3CCJA 3VJPA 1EIFA 2XI9A 3QJYA 3CCVT 1XJWB 3CCLT 1Y71A 2LJ1A 2AK5A 2YDLA 1ZBJA 2Z0WA 2VKNA 1ZBXA 1YWOA 4PJNA 1XOVA 2LC4A 1WHGA 3NGPA 4JZ3A 4QQ6A 5HK3A 5KYNA 3OYLA 2LCLA 3CCEQ 2FZCB 2VYTA 5HK0A 3CC7A 4BY6C 3HFOA 2OTLQ 4MZMA 1NG2A 5FROA 1M90C 2MIOA 4ZTJA 3VS4A 3E2UA 1M1FA 4J9FA 2NYSA 5GANf 1YIJA 3HP9A 4C0GA 4LDUA 2D1XA 2DERA 5LJ3g 3BE3A 5LJ3j 1VQMT 4FYVB 2DIQA 1IRXA 3VRZA 2E5QA 4M7DA 3S3MA 3PGGA 1SSFA 4J9HA 2RJFA 3VKIA 2DXTA 2A3LA 3QDRB 3J81E 1AZEA 2GTJA 2CSIA 1FWZA 1VQPT 4L6V5 5GAOq 1ZUUA 1YJWQ 4M7DB 4KH1B 1AZGB 1WQWA 2DTOA 2ED0A 4BI8B 2DEUA 4QT7A 5LL6S 3I5SA 1I07A 2ZAEA 1WHMA 4OP0A 3GLXA 1NJIC 1M2OA 4DBFA 1O75A 1YITA 4QQGA 4BE1A 5M9OA 3BFMA 5FLXE 1TG0A 4J9BA 3M55A 1FMKA 2ZPHB 5EC7A 4M7AA 4C0ZA 2E3IA 1U1SA 1RAEB 4FW2A 1WA7A 4AG2C 4V2SA 4PLIA 8ATCB 3X20B 2PVDB 2FHDA 2XDDA 2HCKA 2EYWA 4M7AB 2EGCA 1ABQA 1S72Q 1Q81R 2EJGA 2KMTA 2DPPB 4C0FA 3C94A 2AT1B 4FU6A 3CMAQ 3V8KA 2QQAA 3H0HA 2W0ZA 2DJQA 3EHRA 5A2QE 4FSXA 3RESA 2DX1A 2E12A 1X2QA 2XDPA 1M90R 4JS4A 4M75A 4A4HA 2YLCA 1JB0E 1Q82U 2K5FA 2KGTA 4M78F 3OW2A 2CREA 2M02A 3CCVA 3JCMf 3CCLA 3X24B 2RM4A 3PFSA 3ULRB 1JJ2P 4JRPA 3QDFA 4XQ3A 1KQSA 2DNUA 2F5TX 5C0MA 2YUOA 3AHUA 2EWNA 1PWTA 3QBYA 2ZPEB 3M5AA 5KYUA 4MMKA 1YI2A 2GTOA 1QCOA 4E7JA 2C0IA 3L2RA 3I55T 3BDLA 3QZ9B 3OBWA 1KIKA 1K73U 1Z9ZA 2JS2A 1I81A 2L3PA 4XK8E 4IUVA 2DXUA 3M0UA 2CUDA 3HFNA 2DL7A 3QG1A 4XAXB 5FU6C 2DYBA 2VVKA 3TVTA 3MO8A 2DVJA 4PJOA 1QCNA 4N0AA 1OQKA 2MI6A 2X3XD 2RK1A 1OOTA 3F70A 1SRLA 1AWOA 3RMSA 3GF5A 1UE9A 4F7UE 2H8HA 3VYHB 4RTWA 2FL7A 3LW5E 5GANj 1VQ4A 1VQKT 2V1RA 1V1CA 1NEBA 4EIKA 2RQRA 3CC2Q 3EHQA 4D6WA 4XTXA 1YITQ 1D1BA 4LUEA 2Y90A 1Q82C 2DK3A 3AT1B 4FW1A 2DTHA 4DOVA 1XQHA 1ZUYA 1QVFA 2ROLA 2A37A 5AT1B 5IHKA 2HD0A 2ABLA 3CXCP 1BYMA 2C0TA 3EFOB 2COYA 1K4US 4NL2A 1SSHA 4J9EA 3CBMA 3O5ZA 2CP5A 2EGAA 1WZOA 3CBOA 2DZ9A 4ZNXA 4A4GA 4M7DG 3I9QA 2DMOA 1OPLA 2F2WA 4FL6A 4M78B 4PKCC 4AFUC 3NTKA 4BUGA 2JM8A 2BKDN 1GL5A 3A98A 2BZXA 2LVMA 2YUQA 3OB9A 4C5EA 2CZ1B 2R5MA 1K73C 4AFSC 4PJLA 2KEAA 2LNHB 1QVGA 2A0FB 1B3QA 3MP1A 2DE0X 1K9MU 1WHKA 3ER0A 4KGXB 2JXBA 3ASKA 2EJFA 2RQVA 3OYEA 4J9GA 3I5RA 5KE2A 1W2BS 1FXXA 4A4KA 1T0HA 3JB9D 1WLPB 2E3HA 1HK9A 4ZGEB 2EYQA 4M77D 3MP8A 3OYHA 3X28B 5GAMf 5CKDA 1X2KA 4C5HA 4M7AG 5GMKj 3PNWC 3VS5A 2X3WD 2GCXA 1IHVA 3LYIA 4MZTA 3ZBDA 1U8RA 4OMQA 2GQIA 3CCUT 3JSCA 5KCOA 1T0JA 4M75E 3NTIA 4A4EA 1BI0A 5KYXB 4MMLA 4ELZC 4QKUA 1X69A 2LQNA 4R56A 1YJNA 2KT8A 3JCMV 2ED1A 2YUPA 4AG1C 2PNIA 1YJWT 1YJ9Q 4QVZA 4JLGA 4D8DA 3I56Q 3WXMB 3CPWS 2LMJA 4JJNK 4QVCA 4M75G 1VYVA 4E2FB 1N8RU 1ACMB 1R0BG 4OMLA 1WJSA 1DJ7B 2EFIA 1OULA 5LJ5f 2FRWA 1EZZB 2QI2A 3URGA 4RTXA 2MYSA 1VQKA 1JBMA 2ZCFB 2COWA 1D3BA 2VB6A 1VQ4Q 1UJYA 3A8MB 5GANh 4E7LA 2D9TA 5IT9E 2P0PA 2R57A 4CRIA 5HKCA 2HBWA 3SB2A 1PKTA 5IXBA 3INZA 4OGEA 3WVDB 4EMKC 2AKKA 3UT1A 2MPXC 3CC4Q 1K9MC 1G3SA 2LX9A 3FB9A 1V29B 4PJOE 5DLQE 5HCKA 2LTOA 1OX8A 2CT3A 3GIBA 2EYYA 1KG1A 3CMAT 1K8AU 1U06A 2HMAA 3X25B 1FMVA 1JEGA 4RTVA 4RKUE 1H641 3JCMe 3M0TA 4PJOG 1D0XA 2H3JA 1LJOA 1H3HA 1NLOC 1UUEA 2RJDA 3CCSA 1YHQT 1VQ5T 2O2OA 1Q7YR 4HKEA 2EQJA 3TREA 4OVAA 1JRIA 3ME9A 1VQ9A 2M0YA 2E6NA 1VQLT 3VUZA 2JNGA 2O9VA 3G71Q 5D6WA 3LH0A 2BUDA 3OS2A 1VQ7A 3PVLA 3SHWA 4F04B 4LNPA 1QVPA 1IZ6A 1N8RC 3HRSA 1IO6A 1FX7A 4PFPA 2M16A 3JCMJ 4ATOA 2FEIA 3VS0A 3JB9F 3CCRQ 3JB9I 2DD4A 3M0SA 4LDXA 3A8OB 5IHIA 4M77F 2KE9A 3JB9H 3L1AA 4GLKA 2J7IA 2A08A 3UF4A 2HSEB 1RI0A 2DVEA 1YJNQ 1JJ2A 1RLQC 3HKSA 2K2MA 5CQXA 1EFNA 5J3BA 2K2VA 2L3QA 1B07A 2X4JA 4M4ZA 1Y96B 5CIUA 4JRQA 1BIBA 3JCMW 2DD5A 1ZA1B 2V26A 3BW1A 3QIIA 1M2VA 4M78C 1ZSGA 4N4IA 3VS3A 1VUBA 1K8AC 4PJMA 4C5IA 3TCJA 1RAGB 2ZPIB 1PNJA 3RMQA 3CC2T 1NPRA 2FG0A 1M2VB 1N9RA 1ABOA 1NYGA 5KCHA 5GAN2 1MNDA 3THKA 5CKHA 1BI1A 4Y92A 4X9DA 2QA4A 4J8OA 3N5BB 4RTUA 1O9SA 5IH2A 1VQ8T 1LOJA 4DA4A 2RI5A 2QQ9A 3SWNB 5GAN4 1BI2A 2DO3A 1U3OA 2GQVA 2ZPBB 1BKBA 2M1HA 2OAWA 2QEXT 1M1KU 2DRKA 3Q1JA 1Z9QA 3OW2S 1MV0B 3C0CA 1RI9A 1WJRA 4JJDA 3KFVA 1TUGB 3CD6A 2IG0A 1C6VX 1TTHB 5FRNA 1S1NA 5FWCA 2MWPA 1ZLMA 3CCMQ 4HT9A 3J80E 4NL3A 2KRMA 4B9WA 3CCSQ 4JRIA 1E7OA 4C92D 2BE7D 3OY9A 3HRUA 1E6GA 3O8VA 3G6ET 1VQNT 3ZEHA 3GPLA 4VUBA 3CXCA 1VQLA 1PSEA 5GAMe 4PK4A 4OMNA 1SRMA 2LT4A 4MZPA 3CCQA 3MP6A 4Y28E 2RI2A 1YWPA 2VASA 1LVKA 2MK5A 4PJJA 1VQ7Q 3CMEA 3QYHB 4LDVA 1RUWA 4GBQA 2LZ6B 2RH2A 2HBPA 1M1GA 4M77B 1NE8A 2RQWA 2DL4A 2CP7A 4KH0B 2A36A 4FIBA 2RQUA 2EKOA 2P0QA 1JQQA 4OMFB 4RUGA 3BDUA 3EG0A 2JM9A 3RUXA 4C8QD 1M5Q1 1YJ9T 1WQ7A 4JRKA 2B86A 2OTJT 5LJ5e 2X9HA 4XU0A 3G4SA 2RHUA 1MMDA 1OU9A 1PD0A 4IIMA 3TU4K 1IHWA 3LX7A 2WSEE 1M1KC 3JCMb 1IXDA 3DB4A 1R8OB 3G7ZA 4F14A 2D0NA 1GBRA 1H3ZA 2JZ2A 1I0CA 2DTIA 5GAOn 2FRYA 3JRZA 4TVRA 3OS0A 1XNIA 1TOVA 5GAOm 2D6FA 2IVWA 1VQ8A 4JDSA 2PVOB 5FRMA 1R77A 2PUOB 4ANJA 5DM7R 1W2BP 3I35A 4XU2A 2CUBA 3HPWA 2RHIA 1LCKA 3OYGA 3M0RA 4AMCA 5GAN7 4N4GA 3VUBA 2G6FX 1W6XA 2VC8A 1VQ6A 1TUDA 3OYYA 4EMKA 5I2SA 5HY6A 3EGXA 2OJ2A 3CCJQ 2XKOC 1YNZA 3FRNA 1RABB 1QVGS 1PD1A 2L0AA 4FYYB 4D8KA 1AT1B 4EMKB 1Q86U 3CD6Q 2E65A 2MWOA 2KT1A 3EGXB 2V8KA 4K11A 3J7AF 3MKDA 4FT2A 2M9UA 4HVWA 1KD1U 5CKFA 4FM4B 3CC7Q 3QPHA 3OYAA 1X6GA 2ZGWA 5GANd 2WSCE 5FU7C 1TSFA 3CPWP 1G8XA 3H6ZA 3V7CA 5KH6A 1VQMA 4ELYC 1YIJQ 4NS5A 2P4TA 1G2BA 4WF2A 4C0DC 4ZN1A 1G3YA 4HT8A 2RHXA 1NJIR 2Y4XA 4KUIA 4L5GA 2JN0A 1UFFA 2DKGA 1K0SA 2L89A 2O4XA 1VQPA 3V7SA 1UGSB 3QKJA 3V8JA 4C92F 2J6OA 4CI0C 3CMEQ 3OYBA 2LNVA 1VQOT 3GNGA 3CCRT 2LCSA 2NUZA 2CGHA 2DETA 2P4RA 2JMCA 1WXTA 3QO3A 2YRVA 4BE0A 1NLPC 2O4XB 1G5VA 2YT6A 2E4HA 2QDLA 3QXEB 5CO7A 1WYXA 2F1LA 2QAZA 4LDYA 4Q5WA 3H0FA 3SWNC 3UPUA 3G1JA 5GANg 1C0MA 2DRMA 1UHCA 2F5KA 1KSWA 3OYNA 1HJDA 2RI3A 4KT0E 3META 4BACA 3ZL7C 1W70A 1QKXA 1WNLA 3U23A 2HQXA 1IREB 2VUBA 2VGMA 2ENMA 4M7DE 3EFOA 4C8QF 2JTEA 2FZGB 3E19A 1N9SA 2CT4A 2YRDA 3L2QA 2RB6A 2QTVA 3RKXA 3NHNA 1D09B 2O88A 1TWBA 4XU1A 1SPKA 2PZ1A 4M78A 4KGVB 3EGDA 3OMGA 1Q86C 2LCCA 2X4XA 1WHJA 2EPDA 4B6MA 3L42A 1P92A 1UGRB 1WI7A 2EYZA 3R6OA 2VGNA 1IB8A 1KD1C 4IKFA 1TXQA 4EPCA 3EGDB 3OQ5A 1RAIB 1CSKA 4E7ZA 5GAN6 1KC8U 2GFUA 2KYBA 1QP3A 1KQ1A 4A54A 1VQ6Q 2DFUA 3TSZA 2C0OA 2KI7A 3CCVQ 3CCLQ 2CDTA 1T3LA 2O31A 4ESRA 3CEYA 4M7AE 3M53A 4M77C 1ZUKA 4HCKA 2FPFA 1WGSA 3CCET 4X34A 3HSBA 3CCMT 2OTLT 2PUKB 5CVIA 3RIRA 4L59A 2DEQA 1AOJA 3FJPA 1YI2Q 3I55A 1GFCA 1OPKA 5EG2A 4C92A 4FSSA 1PRLC 1UGQB 4OB2B 5KYXA 1AWWA 1YN8A 1VQMQ 4NOYA 4JJCA 3M0PA 3X26B 2L3RA 2HL5C 1K1ZA 2ESWA 2QGFB 2XIDA 2SEMA 3EGUA 3FJ5A 3JAME 4IURA 2BZYA 4C92B 4M7DD 2EVRA 7AT1B 4KBMB 1JXMA 1HD3A 1VYTA 2NUPB 2LJ3A 2FB7A 1AEYA 2EIFA 2FVUA 1YCYA 3MEUA 3OYCA 5I21A 5CR2A 3S3NA 1SKUB 1VQPQ 2LQWA 1Q82R 1SHGA 4EMGA 2DAQA 3JCMP 1PHTA 4BB7A 4FT4A 1SG5A 1Y57A 3H0IA 2XK0A 1QWEA 4C8QA 1SF9A 4BE2A 2RN8A 3CQTA 2GF7A 4X9CA 4DOWA 1PC0A 2EAYA 3MEWA 3JB9J 2FYKA 1PCXA 4C8QB 1X27A 4C5GA 2I0NA 2QASA 1KC8C 1YP5A 3MEVA 1VOMA 1MUZA 4IUTA 4PLLA 4EMHA 4M7AD 2KXDA 2K3YA 2KBTA 4WTOB 1QQJA 4CC7A 3S3OA 1G3TA 1K73R 4P5NA 3KBGA 3LGFA 2KAFA 3C95A 2PVGB 2ROTA 1S72T 5IXFA 4AFQC 1QLYA 2CKKA
chains in the Genus database with same CATH topology
3OW2P 3CMAQ 1KD1R 3CCJQ 1YJNQ 1YHQQ 3I55Q 3CMEQ 3CCEQ 1VQ9Q 1VQ5Q 3CXCP 3CPWP 1Q7YR 1K8AR 1VQKQ 1KC8R 2QA4Q 1N8RR 3CC2Q 1VQOQ 1JJ2P 1YIJQ 2OTLQ 3CCMQ 1W2BP 1VQ6Q 1VQ7Q 3CC4Q 1K73R 3CD6Q 2QEXQ 3CCRQ 1YI2Q 1YITQ 1M90R 3G4SQ 3CCVQ 1QVGP 3CCLQ 3CCSQ 1M1KR 1Q86R 1VQLQ 1VQPQ 3G71Q 1YJ9Q 1KQSP 1VQ4Q 1K9MR 1YJWQ 2OTJQ 3CCQQ 3I56Q 1VQ8Q 1NJIR 1Q81R 1S72Q 1VQMQ 1Q82R 3G6EQ 1VQNQ 3CC7Q 1QVFP 3CCUQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 P;  3CMA Q;  1KD1 R;  3CCJ Q;  1YJN Q;  1YHQ Q;  3I55 Q;  3CME Q;  3CCE Q;  1VQ9 Q;  1VQ5 Q;  3CXC P;  3CPW P;  1Q7Y R;  1K8A R;  1VQK Q;  1KC8 R;  2QA4 Q;  1N8R R;  3CC2 Q;  1VQO Q;  1JJ2 P;  1YIJ Q;  2OTL Q;  3CCM Q;  1W2B P;  1VQ6 Q;  1VQ7 Q;  3CC4 Q;  1K73 R;  3CD6 Q;  2QEX Q;  3CCR Q;  1YI2 Q;  1YIT Q;  1M90 R;  3G4S Q;  3CCV Q;  1QVG P;  3CCL Q;  3CCS Q;  1M1K R;  1Q86 R;  1VQL Q;  1VQP Q;  3G71 Q;  1YJ9 Q;  1KQS P;  1VQ4 Q;  1K9M R;  1YJW Q;  2OTJ Q;  3CCQ Q;  3I56 Q;  1VQ8 Q;  1NJI R;  1Q81 R;  1S72 Q;  1VQM Q;  1Q82 R;  3G6E Q;  1VQN Q;  3CC7 Q;  1QVF P;  3CCU Q; 
#chains in the Genus database with same CATH topology
 1IGQ A;  4RTY A;  1UJ0 A;  3MCA B;  3FIF A;  1CKB A;  2KRO A;  5KYW A;  2QXF A;  2ZPG B;  1K9A A;  5LJ3 f;  3OA6 A;  5GAO l;  1PKS A;  2AKL A;  2DIL A;  4JUV A;  4M75 D;  2LP5 A;  1R0C B;  1X75 C;  5CCA A;  3PMI A;  5KYW B;  1KHI A;  2YXY A;  3BY7 A;  2P84 A;  2CP2 A;  1M27 C;  2QK0 A;  1QWF A;  3FEO A;  2F69 A;  1UGV A;  4J9D A;  2KQW A;  5IHN A;  2DIG A;  1M4Z A;  1ARK A;  4KUD K;  3MJX A;  3M0Q A;  2VXE A;  3CXC S;  4M78 E;  1WDX A;  2NUT A;  4LDW A;  2EJ9 A;  2M51 A;  2XHC A;  4QQD A;  2J6F A;  2RHY A;  3LLR A;  2KYM A;  3I55 Q;  2HAX A;  1W2B A;  3IQL A;  1I5L A;  3VS1 A;  3OYD A;  5CKE A;  4Z88 A;  3CCU A;  2XDB A;  2NUT B;  2DYI A;  2YWW A;  1Q81 U;  1ZHI A;  3RKW A;  2YHT A;  3HHT B;  4M78 G;  1QCF A;  4F7U F;  2MCN A;  4LD6 A;  1Y96 A;  2A7Y A;  3UA6 A;  2CS7 A;  1BCO A;  3MHX A;  1TH7 A;  2WSF E;  1YJW A;  2OAU A;  3JCM h;  3RNJ A;  1AD5 A;  5FU7 B;  4PJO D;  1FMW A;  1M90 U;  1NYF A;  3UDC A;  3M9Q A;  4C0D B;  5KYY B;  1X01 A;  3RBB B;  1K9M R;  2K5L A;  1MHN A;  5DY9 A;  4XTU A;  3R6N A;  3CPW A;  2DJZ A;  5GAM j;  2MOX A;  4CC3 A;  5I11 A;  2FPD A;  1VQK Q;  1BU1 A;  2JW4 A;  3L2Z A;  1YIT T;  2GNC A;  2RQT A;  2RNA A;  3SWN A;  5GAN 3;  3WVE B;  4KUL A;  4KRT A;  1PRM C;  1BIA A;  4BI3 A;  2ATC B;  2K79 A;  5A0L A;  2Y4Y A;  4ME7 A;  1MMN A;  5D6X A;  4C92 G;  1S72 A;  1PG5 B;  2ECZ A;  3REA B;  2J6K A;  3JCM c;  3CMA A;  2RF0 A;  4LN2 A;  4MDW A;  4E6R A;  4J7F A;  2R58 A;  5LJ5 j;  1I4K 1;  2YSQ A;  1D0Z A;  4Z8A A;  1TS9 A;  5I2M A;  4F17 A;  2BIV A;  5CKB A;  3RDV A;  4C92 C;  4UC4 A;  3QZ5 B;  1MV3 A;  3LH5 A;  1N8R R;  3L2V A;  1Y7X A;  4DEX A;  1KQS S;  2JS0 A;  4OF1 A;  1YHQ A;  4PFO A;  1E6H A;  1VQ5 A;  1Q81 C;  2G3R A;  4E7H A;  4C8Q G;  3EG9 A;  2JMA A;  3DLM A;  4JZ4 A;  2EGE A;  3KUF A;  4M75 F;  2K3B A;  3GNF B;  1G3W A;  2IIM A;  4J9I A;  1RAF B;  4JLI A;  1VQ9 Q;  4BI4 A;  2HDA A;  5CQY A;  1I1J A;  1MGQ A;  3EG9 B;  4F7U A;  4E7I A;  4OGC A;  4RMO A;  2VV5 A;  2HKQ B;  1YI2 T;  4M77 A;  3NTH A;  1AWJ A;  2EQU A;  5IN1 A;  3PTA A;  2MMP A;  2QQB A;  5ECA A;  1WHL A;  1KJW A;  1IGU A;  1JU5 C;  4C8Q C;  4F7U B;  4OB3 B;  2JTM A;  4QVD A;  1I5O B;  4O5V A;  3CCU Q;  3EH1 A;  2PQW A;  1NBE B;  1BCM A;  1K8A R;  1OX9 A;  2XIC A;  2HQE A;  2CYZ B;  4Y91 A;  3M58 A;  4DQ2 A;  2RD1 A;  8AT1 B;  2HQH A;  1G83 A;  1YFN A;  4AT1 B;  3I56 T;  3TQ7 P;  1X43 A;  3C4S A;  2EQM A;  4FYX B;  3PMT A;  2H3E B;  4BDZ A;  3QSU A;  1YCS B;  2KRS A;  3VRY A;  1D1A A;  4JS5 A;  2ZZD A;  4HA8 A;  3OYM A;  2EW3 A;  3RKY A;  1VIF A;  1X6O A;  1VQ4 T;  2AZS A;  4JJB A;  4PJO F;  2V8I A;  3CC2 A;  2KK4 A;  5J39 A;  1QVF S;  1A0N B;  5GAM h;  5GMK m;  1KQ2 A;  2PTK A;  2RJC A;  1D1C A;  4LUD A;  1ZA2 B;  3M4G A;  2HZY A;  4LE9 A;  5GAO r;  4ZN3 A;  2D8J A;  2L8D A;  2QA4 Q;  1K76 A;  1XTD A;  3CC4 T;  4BDY A;  1PSF A;  3EFR A;  2DXC A;  2HKN A;  1N6A A;  3SFM A;  2V1Q A;  5A0G A;  2NLU A;  3M57 A;  4LD9 K;  3QWY A;  5LJ3 e;  2E1H A;  3V8L A;  2QEX A;  2VWF A;  5L23 A;  3DLL A;  1BI3 A;  2SRC A;  2LJ0 A;  2QDY B;  1KK7 A;  3HTR A;  1OEB A;  1W1F A;  4HVV A;  3SDZ A;  5LJ5 h;  4XTY A;  3GOX A;  3EH2 A;  2KSS A;  2AZV A;  3M4Y A;  1KFZ A;  3EAE A;  2BE9 B;  2DM1 A;  3UAT A;  1UG1 A;  2RO0 A;  3DB3 A;  4J7I A;  3PT9 A;  4M75 B;  3OSS C;  3TEE A;  1YHQ Q;  2LRQ A;  2OX7 A;  1GFD A;  1UDL A;  1VQ5 Q;  2R5A A;  2F2V A;  3G6E A;  5L8R E;  2A28 A;  1VQN A;  1RL2 A;  1OV3 A;  2KY9 A;  2CH4 W;  2HSP A;  4R55 A;  3G71 T;  1VQL Q;  2ZPF B;  4JPB W;  2I2L A;  3CCQ Q;  1RAA B;  2J05 A;  1GCQ C;  2JUF A;  5GAN 5;  3PVQ A;  1N27 A;  1ZX6 A;  5KYU B;  1M8M A;  3RER A;  1U5S A;  1M9S A;  3S6W A;  5LJ3 h;  1I8F A;  1F1B B;  4OMM A;  1M1K R;  3A8H B;  1CKA A;  5GAN 8;  2E70 A;  2QQS A;  3SEM A;  3QHS A;  1GRI A;  2EQK A;  3H9N A;  4HCZ A;  3OBY A;  4PL6 A;  1YJ9 A;  1YJN T;  1SHF A;  4PFZ A;  4E7S A;  4OB0 B;  4A53 A;  2CSQ A;  3I56 A;  3JV3 A;  2OTJ A;  5GAO p;  3VYG A;  3GBQ A;  1V76 A;  1HYO A;  1PM3 A;  3PE0 A;  3GP8 A;  4HCB A;  2BZ8 A;  4FCY A;  1OI1 A;  3G4S Q;  3OS1 A;  4RTT A;  2E64 A;  4PJO B;  1H92 A;  1K0X A;  1WPY A;  3VU3 C;  5I22 A;  3E9F A;  4M77 E;  2YLB A;  1MMG A;  1Q7Y U;  1ZQ1 A;  2E5K A;  2GBQ A;  1RLP C;  1RAH B;  1GXI E;  1QP2 A;  1BB9 A;  3C12 A;  5D6Y A;  1VA7 A;  3NMZ C;  1UB4 A;  1M3C A;  3JB9 G;  2JOY A;  1M30 A;  1FYN A;  4CC4 B;  4F7U G;  1NM7 A;  2GGR A;  3P8B B;  1VQ8 Q;  4M77 G;  3CC4 A;  3EFS A;  3PIO A;  1WHH A;  3A8L B;  4LXC A;  2RPN A;  3OS5 A;  3QUI A;  1YBY A;  1Y0M A;  9ATC B;  3DKM A;  2RHZ A;  3M59 A;  1GBQ A;  1GCP A;  3JCM Q;  2K5I A;  3JCM d;  2COZ A;  4AFZ C;  2QEX Q;  2LDM A;  1JXO A;  4XU3 A;  1OZ3 A;  2RK2 A;  1LNX A;  5CAI A;  2KXC A;  2DL5 A;  3MEA A;  5J26 A;  1ZSZ A;  4OMO A;  3OYI A;  4MDX A;  1UHF A;  2FO0 A;  4HVU A;  1M3B A;  3QYG B;  3NPF A;  2XG8 D;  5C6S A;  5GJW B;  1NEG A;  2FZK B;  1RAC B;  1ZSZ B;  1EX4 A;  3CCS T;  1HXD A;  2X51 A;  4M7D C;  3SD4 A;  2KRN A;  2K3X A;  1TUC A;  2EQI A;  1AWX A;  2NUP A;  3G6E Q;  2NWM A;  1VQN Q;  5GMK i;  3G71 A;  1VQ9 T;  5GAN e;  4J5Y A;  4Z89 A;  3LGL A;  2L3S A;  3MPU B;  3REB B;  1JO8 A;  1VIE A;  2CP0 A;  1T3S A;  2MF2 A;  5CK9 A;  5DLO A;  4II1 A;  3V7R A;  2X4W A;  1VQ7 T;  2JTF A;  3JCM g;  2CZ7 B;  4OMP A;  4ZGD B;  1B34 A;  3VV0 A;  2HEQ A;  1VQO A;  2E10 A;  2BTT A;  5IAY A;  4E47 A;  1Q95 G;  2CP3 A;  4RCC A;  3CCR A;  2IPO B;  4RG2 A;  1UEB A;  1TU0 B;  1Q7Y C;  1JJ2 S;  4DEY A;  2D8H A;  3FDR A;  1B34 B;  4BD3 A;  2WAC A;  1M8V A;  3L2W A;  3OYF A;  1WXU A;  2DBK A;  2FPE A;  3FLG A;  4BY6 B;  4R0K A;  1OZ2 A;  4YTL A;  4XTW A;  1Q86 R;  2CH4 A;  2M0O A;  4DBQ A;  4M7A C;  2OTJ Q;  1QMC A;  2X35 A;  1U1T A;  4A4F A;  6AT1 B;  3QWX X;  3OW2 P;  4IUP A;  1KD1 R;  2L2P A;  1H8K A;  2RA2 A;  2KDS A;  2DF6 A;  3OYJ A;  1NPP A;  2F2X A;  2XU8 A;  2EBP A;  4J9C A;  3FC3 A;  3CBP A;  3H8Z A;  3EG3 A;  1VYU A;  1RAD B;  2DBM A;  1OYX A;  2KNB B;  1KQS P;  3ZFJ A;  2DA9 A;  3NFC A;  4X1V A;  4HXJ A;  4IIO A;  2AIR B;  2QTX A;  4M75 C;  1D0Y A;  4OB1 B;  4IUU A;  2L5Q A;  5GMK l;  2QA4 T;  4GLM A;  1D3B B;  2RMO A;  4IUQ A;  3JCM X;  4RTZ A;  1WXB A;  2GFA A;  4QW2 A;  2JVV A;  4GY5 A;  2YRC A;  4HCC A;  1WFW A;  5GMK e;  2MAM A;  4XTV A;  2E6Z A;  3VS2 A;  3RR6 A;  2XD0 A;  2J06 A;  3P8D A;  2W10 A;  2O9S A;  4KGZ B;  1J3T A;  3CCJ T;  2LT1 A;  3T9N A;  4Z02 A;  1C1A A;  3HRT A;  1WIE A;  3LWI A;  3H41 A;  2VXF A;  2DZC A;  2EYX A;  2K7A A;  1LPL A;  1HSQ A;  3HL8 A;  3LWH A;  3CD6 T;  5KE3 A;  3CCE A;  1UTI A;  2QGG A;  3A5Z B;  4WCI A;  4J6Y A;  3CCM A;  3KXT A;  2OTL A;  3E9G A;  2QQR A;  2AHJ B;  5FWB A;  3CC7 T;  1QW1 A;  5GAM d;  4FYW B;  3CPF A;  1WX6 A;  3L2U A;  1YIJ T;  3M56 A;  3TSW A;  4N4H A;  2K6D A;  5GJV B;  3VS6 A;  3CCQ T;  4PJO C;  1B7T A;  4DBR A;  4N0A C;  3OMC A;  4CC2 A;  2HL3 A;  2C06 A;  3UWN A;  2CZ6 B;  2DL8 A;  4RG8 A;  2X4Y A;  1QVF P;  3OSV A;  3CME T;  4B9X A;  2K9G A;  3A8G B;  5KYY A;  1AVZ C;  2QG9 B;  1KC8 R;  3EG2 A;  1VQO Q;  5GMK h;  2P0K A;  1GCQ A;  5D7U A;  2V8J A;  4M7D F;  2K57 A;  1BK2 A;  5LJ5 d;  2DXB A;  4DBH A;  2HNI A;  4J6W A;  1N5Z A;  2D0Q B;  2LQ8 A;  5GAM g;  1M3A A;  4A63 B;  2RJE A;  4ZTF A;  3PIP A;  4J83 A;  4J6X A;  4C92 E;  5A0D A;  2OI3 A;  1W4S A;  1MNE A;  3G4S T;  1OU8 A;  3A1P A;  1UGP B;  1QVG P;  1MMA A;  1Y07 A;  1WJQ A;  2KR3 A;  3OYK A;  1UEC A;  4ZGJ B;  2DLP A;  2PU9 B;  4O6J A;  5FU6 B;  1QKW A;  1X6B A;  4XTZ A;  5AYF A;  2O01 E;  2DL3 A;  4PNO A;  3P8H A;  4M78 D;  2LQK A;  2EKH A;  1ZSZ C;  3UA7 A;  1NZ9 A;  1NJI U;  3D7S B;  4F16 A;  4M7A F;  5LJ3 d;  2KVQ G;  5LJ5 g;  4ORZ A;  2LX7 A;  2B8A A;  3M54 A;  2QYZ A;  2XMF A;  1KHC A;  4C8Q E;  3VS7 A;  2JJ9 A;  2CZ0 B;  1SEM A;  3EG1 A;  4EDU A;  2YUN A;  3QJ6 A;  4E7K A;  3E1S A;  2CP6 A;  4RCB A;  5FW9 A;  1AHJ B;  2E41 A;  1BBZ A;  1VQ6 T;  2K4Y A;  2JT4 A;  3CCJ A;  3VJP A;  1EIF A;  2XI9 A;  3QJY A;  3CCV T;  1XJW B;  3CCL T;  1Y71 A;  2LJ1 A;  2AK5 A;  2YDL A;  1ZBJ A;  2Z0W A;  2VKN A;  1ZBX A;  1YWO A;  4PJN A;  1XOV A;  2LC4 A;  1WHG A;  3NGP A;  4JZ3 A;  4QQ6 A;  5HK3 A;  5KYN A;  3OYL A;  2LCL A;  3CCE Q;  2FZC B;  2VYT A;  5HK0 A;  3CC7 A;  4BY6 C;  3HFO A;  2OTL Q;  4MZM A;  1NG2 A;  5FRO A;  1M90 C;  2MIO A;  4ZTJ A;  3VS4 A;  3E2U A;  1M1F A;  4J9F A;  2NYS A;  5GAN f;  1YIJ A;  3HP9 A;  4C0G A;  4LDU A;  2D1X A;  2DER A;  5LJ3 g;  3BE3 A;  5LJ3 j;  1VQM T;  4FYV B;  2DIQ A;  1IRX A;  3VRZ A;  2E5Q A;  4M7D A;  3S3M A;  3PGG A;  1SSF A;  4J9H A;  2RJF A;  3VKI A;  2DXT A;  2A3L A;  3QDR B;  3J81 E;  1AZE A;  2GTJ A;  2CSI A;  1FWZ A;  1VQP T;  4L6V 5;  5GAO q;  1ZUU A;  1YJW Q;  4M7D B;  4KH1 B;  1AZG B;  1WQW A;  2DTO A;  2ED0 A;  4BI8 B;  2DEU A;  4QT7 A;  5LL6 S;  3I5S A;  1I07 A;  2ZAE A;  1WHM A;  4OP0 A;  3GLX A;  1NJI C;  1M2O A;  4DBF A;  1O75 A;  1YIT A;  4QQG A;  4BE1 A;  5M9O A;  3BFM A;  5FLX E;  1TG0 A;  4J9B A;  3M55 A;  1FMK A;  2ZPH B;  5EC7 A;  4M7A A;  4C0Z A;  2E3I A;  1U1S A;  1RAE B;  4FW2 A;  1WA7 A;  4AG2 C;  4V2S A;  4PLI A;  8ATC B;  3X20 B;  2PVD B;  2FHD A;  2XDD A;  2HCK A;  2EYW A;  4M7A B;  2EGC A;  1ABQ A;  1S72 Q;  1Q81 R;  2EJG A;  2KMT A;  2DPP B;  4C0F A;  3C94 A;  2AT1 B;  4FU6 A;  3CMA Q;  3V8K A;  2QQA A;  3H0H A;  2W0Z A;  2DJQ A;  3EHR A;  5A2Q E;  4FSX A;  3RES A;  2DX1 A;  2E12 A;  1X2Q A;  2XDP A;  1M90 R;  4JS4 A;  4M75 A;  4A4H A;  2YLC A;  1JB0 E;  1Q82 U;  2K5F A;  2KGT A;  4M78 F;  3OW2 A;  2CRE A;  2M02 A;  3CCV A;  3JCM f;  3CCL A;  3X24 B;  2RM4 A;  3PFS A;  3ULR B;  1JJ2 P;  4JRP A;  3QDF A;  4XQ3 A;  1KQS A;  2DNU A;  2F5T X;  5C0M A;  2YUO A;  3AHU A;  2EWN A;  1PWT A;  3QBY A;  2ZPE B;  3M5A A;  5KYU A;  4MMK A;  1YI2 A;  2GTO A;  1QCO A;  4E7J A;  2C0I A;  3L2R A;  3I55 T;  3BDL A;  3QZ9 B;  3OBW A;  1KIK A;  1K73 U;  1Z9Z A;  2JS2 A;  1I81 A;  2L3P A;  4XK8 E;  4IUV A;  2DXU A;  3M0U A;  2CUD A;  3HFN A;  2DL7 A;  3QG1 A;  4XAX B;  5FU6 C;  2DYB A;  2VVK A;  3TVT A;  3MO8 A;  2DVJ A;  4PJO A;  1QCN A;  4N0A A;  1OQK A;  2MI6 A;  2X3X D;  2RK1 A;  1OOT A;  3F70 A;  1SRL A;  1AWO A;  3RMS A;  3GF5 A;  1UE9 A;  4F7U E;  2H8H A;  3VYH B;  4RTW A;  2FL7 A;  3LW5 E;  5GAN j;  1VQ4 A;  1VQK T;  2V1R A;  1V1C A;  1NEB A;  4EIK A;  2RQR A;  3CC2 Q;  3EHQ A;  4D6W A;  4XTX A;  1YIT Q;  1D1B A;  4LUE A;  2Y90 A;  1Q82 C;  2DK3 A;  3AT1 B;  4FW1 A;  2DTH A;  4DOV A;  1XQH A;  1ZUY A;  1QVF A;  2ROL A;  2A37 A;  5AT1 B;  5IHK A;  2HD0 A;  2ABL A;  3CXC P;  1BYM A;  2C0T A;  3EFO B;  2COY A;  1K4U S;  4NL2 A;  1SSH A;  4J9E A;  3CBM A;  3O5Z A;  2CP5 A;  2EGA A;  1WZO A;  3CBO A;  2DZ9 A;  4ZNX A;  4A4G A;  4M7D G;  3I9Q A;  2DMO A;  1OPL A;  2F2W A;  4FL6 A;  4M78 B;  4PKC C;  4AFU C;  3NTK A;  4BUG A;  2JM8 A;  2BKD N;  1GL5 A;  3A98 A;  2BZX A;  2LVM A;  2YUQ A;  3OB9 A;  4C5E A;  2CZ1 B;  2R5M A;  1K73 C;  4AFS C;  4PJL A;  2KEA A;  2LNH B;  1QVG A;  2A0F B;  1B3Q A;  3MP1 A;  2DE0 X;  1K9M U;  1WHK A;  3ER0 A;  4KGX B;  2JXB A;  3ASK A;  2EJF A;  2RQV A;  3OYE A;  4J9G A;  3I5R A;  5KE2 A;  1W2B S;  1FXX A;  4A4K A;  1T0H A;  3JB9 D;  1WLP B;  2E3H A;  1HK9 A;  4ZGE B;  2EYQ A;  4M77 D;  3MP8 A;  3OYH A;  3X28 B;  5GAM f;  5CKD A;  1X2K A;  4C5H A;  4M7A G;  5GMK j;  3PNW C;  3VS5 A;  2X3W D;  2GCX A;  1IHV A;  3LYI A;  4MZT A;  3ZBD A;  1U8R A;  4OMQ A;  2GQI A;  3CCU T;  3JSC A;  5KCO A;  1T0J A;  4M75 E;  3NTI A;  4A4E A;  1BI0 A;  5KYX B;  4MML A;  4ELZ C;  4QKU A;  1X69 A;  2LQN A;  4R56 A;  1YJN A;  2KT8 A;  3JCM V;  2ED1 A;  2YUP A;  4AG1 C;  2PNI A;  1YJW T;  1YJ9 Q;  4QVZ A;  4JLG A;  4D8D A;  3I56 Q;  3WXM B;  3CPW S;  2LMJ A;  4JJN K;  4QVC A;  4M75 G;  1VYV A;  4E2F B;  1N8R U;  1ACM B;  1R0B G;  4OML A;  1WJS A;  1DJ7 B;  2EFI A;  1OUL A;  5LJ5 f;  2FRW A;  1EZZ B;  2QI2 A;  3URG A;  4RTX A;  2MYS A;  1VQK A;  1JBM A;  2ZCF B;  2COW A;  1D3B A;  2VB6 A;  1VQ4 Q;  1UJY A;  3A8M B;  5GAN h;  4E7L A;  2D9T A;  5IT9 E;  2P0P A;  2R57 A;  4CRI A;  5HKC A;  2HBW A;  3SB2 A;  1PKT A;  5IXB A;  3INZ A;  4OGE A;  3WVD B;  4EMK C;  2AKK A;  3UT1 A;  2MPX C;  3CC4 Q;  1K9M C;  1G3S A;  2LX9 A;  3FB9 A;  1V29 B;  4PJO E;  5DLQ E;  5HCK A;  2LTO A;  1OX8 A;  2CT3 A;  3GIB A;  2EYY A;  1KG1 A;  3CMA T;  1K8A U;  1U06 A;  2HMA A;  3X25 B;  1FMV A;  1JEG A;  4RTV A;  4RKU E;  1H64 1;  3JCM e;  3M0T A;  4PJO G;  1D0X A;  2H3J A;  1LJO A;  1H3H A;  1NLO C;  1UUE A;  2RJD A;  3CCS A;  1YHQ T;  1VQ5 T;  2O2O A;  1Q7Y R;  4HKE A;  2EQJ A;  3TRE A;  4OVA A;  1JRI A;  3ME9 A;  1VQ9 A;  2M0Y A;  2E6N A;  1VQL T;  3VUZ A;  2JNG A;  2O9V A;  3G71 Q;  5D6W A;  3LH0 A;  2BUD A;  3OS2 A;  1VQ7 A;  3PVL A;  3SHW A;  4F04 B;  4LNP A;  1QVP A;  1IZ6 A;  1N8R C;  3HRS A;  1IO6 A;  1FX7 A;  4PFP A;  2M16 A;  3JCM J;  4ATO A;  2FEI A;  3VS0 A;  3JB9 F;  3CCR Q;  3JB9 I;  2DD4 A;  3M0S A;  4LDX A;  3A8O B;  5IHI A;  4M77 F;  2KE9 A;  3JB9 H;  3L1A A;  4GLK A;  2J7I A;  2A08 A;  3UF4 A;  2HSE B;  1RI0 A;  2DVE A;  1YJN Q;  1JJ2 A;  1RLQ C;  3HKS A;  2K2M A;  5CQX A;  1EFN A;  5J3B A;  2K2V A;  2L3Q A;  1B07 A;  2X4J A;  4M4Z A;  1Y96 B;  5CIU A;  4JRQ A;  1BIB A;  3JCM W;  2DD5 A;  1ZA1 B;  2V26 A;  3BW1 A;  3QII A;  1M2V A;  4M78 C;  1ZSG A;  4N4I A;  3VS3 A;  1VUB A;  1K8A C;  4PJM A;  4C5I A;  3TCJ A;  1RAG B;  2ZPI B;  1PNJ A;  3RMQ A;  3CC2 T;  1NPR A;  2FG0 A;  1M2V B;  1N9R A;  1ABO A;  1NYG A;  5KCH A;  5GAN 2;  1MND A;  3THK A;  5CKH A;  1BI1 A;  4Y92 A;  4X9D A;  2QA4 A;  4J8O A;  3N5B B;  4RTU A;  1O9S A;  5IH2 A;  1VQ8 T;  1LOJ A;  4DA4 A;  2RI5 A;  2QQ9 A;  3SWN B;  5GAN 4;  1BI2 A;  2DO3 A;  1U3O A;  2GQV A;  2ZPB B;  1BKB A;  2M1H A;  2OAW A;  2QEX T;  1M1K U;  2DRK A;  3Q1J A;  1Z9Q A;  3OW2 S;  1MV0 B;  3C0C A;  1RI9 A;  1WJR A;  4JJD A;  3KFV A;  1TUG B;  3CD6 A;  2IG0 A;  1C6V X;  1TTH B;  5FRN A;  1S1N A;  5FWC A;  2MWP A;  1ZLM A;  3CCM Q;  4HT9 A;  3J80 E;  4NL3 A;  2KRM A;  4B9W A;  3CCS Q;  4JRI A;  1E7O A;  4C92 D;  2BE7 D;  3OY9 A;  3HRU A;  1E6G A;  3O8V A;  3G6E T;  1VQN T;  3ZEH A;  3GPL A;  4VUB A;  3CXC A;  1VQL A;  1PSE A;  5GAM e;  4PK4 A;  4OMN A;  1SRM A;  2LT4 A;  4MZP A;  3CCQ A;  3MP6 A;  4Y28 E;  2RI2 A;  1YWP A;  2VAS A;  1LVK A;  2MK5 A;  4PJJ A;  1VQ7 Q;  3CME A;  3QYH B;  4LDV A;  1RUW A;  4GBQ A;  2LZ6 B;  2RH2 A;  2HBP A;  1M1G A;  4M77 B;  1NE8 A;  2RQW A;  2DL4 A;  2CP7 A;  4KH0 B;  2A36 A;  4FIB A;  2RQU A;  2EKO A;  2P0Q A;  1JQQ A;  4OMF B;  4RUG A;  3BDU A;  3EG0 A;  2JM9 A;  3RUX A;  4C8Q D;  1M5Q 1;  1YJ9 T;  1WQ7 A;  4JRK A;  2B86 A;  2OTJ T;  5LJ5 e;  2X9H A;  4XU0 A;  3G4S A;  2RHU A;  1MMD A;  1OU9 A;  1PD0 A;  4IIM A;  3TU4 K;  1IHW A;  3LX7 A;  2WSE E;  1M1K C;  3JCM b;  1IXD A;  3DB4 A;  1R8O B;  3G7Z A;  4F14 A;  2D0N A;  1GBR A;  1H3Z A;  2JZ2 A;  1I0C A;  2DTI A;  5GAO n;  2FRY A;  3JRZ A;  4TVR A;  3OS0 A;  1XNI A;  1TOV A;  5GAO m;  2D6F A;  2IVW A;  1VQ8 A;  4JDS A;  2PVO B;  5FRM A;  1R77 A;  2PUO B;  4ANJ A;  5DM7 R;  1W2B P;  3I35 A;  4XU2 A;  2CUB A;  3HPW A;  2RHI A;  1LCK A;  3OYG A;  3M0R A;  4AMC A;  5GAN 7;  4N4G A;  3VUB A;  2G6F X;  1W6X A;  2VC8 A;  1VQ6 A;  1TUD A;  3OYY A;  4EMK A;  5I2S A;  5HY6 A;  3EGX A;  2OJ2 A;  3CCJ Q;  2XKO C;  1YNZ A;  3FRN A;  1RAB B;  1QVG S;  1PD1 A;  2L0A A;  4FYY B;  4D8K A;  1AT1 B;  4EMK B;  1Q86 U;  3CD6 Q;  2E65 A;  2MWO A;  2KT1 A;  3EGX B;  2V8K A;  4K11 A;  3J7A F;  3MKD A;  4FT2 A;  2M9U A;  4HVW A;  1KD1 U;  5CKF A;  4FM4 B;  3CC7 Q;  3QPH A;  3OYA A;  1X6G A;  2ZGW A;  5GAN d;  2WSC E;  5FU7 C;  1TSF A;  3CPW P;  1G8X A;  3H6Z A;  3V7C A;  5KH6 A;  1VQM A;  4ELY C;  1YIJ Q;  4NS5 A;  2P4T A;  1G2B A;  4WF2 A;  4C0D C;  4ZN1 A;  1G3Y A;  4HT8 A;  2RHX A;  1NJI R;  2Y4X A;  4KUI A;  4L5G A;  2JN0 A;  1UFF A;  2DKG A;  1K0S A;  2L89 A;  2O4X A;  1VQP A;  3V7S A;  1UGS B;  3QKJ A;  3V8J A;  4C92 F;  2J6O A;  4CI0 C;  3CME Q;  3OYB A;  2LNV A;  1VQO T;  3GNG A;  3CCR T;  2LCS A;  2NUZ A;  2CGH A;  2DET A;  2P4R A;  2JMC A;  1WXT A;  3QO3 A;  2YRV A;  4BE0 A;  1NLP C;  2O4X B;  1G5V A;  2YT6 A;  2E4H A;  2QDL A;  3QXE B;  5CO7 A;  1WYX A;  2F1L A;  2QAZ A;  4LDY A;  4Q5W A;  3H0F A;  3SWN C;  3UPU A;  3G1J A;  5GAN g;  1C0M A;  2DRM A;  1UHC A;  2F5K A;  1KSW A;  3OYN A;  1HJD A;  2RI3 A;  4KT0 E;  3MET A;  4BAC A;  3ZL7 C;  1W70 A;  1QKX A;  1WNL A;  3U23 A;  2HQX A;  1IRE B;  2VUB A;  2VGM A;  2ENM A;  4M7D E;  3EFO A;  4C8Q F;  2JTE A;  2FZG B;  3E19 A;  1N9S A;  2CT4 A;  2YRD A;  3L2Q A;  2RB6 A;  2QTV A;  3RKX A;  3NHN A;  1D09 B;  2O88 A;  1TWB A;  4XU1 A;  1SPK A;  2PZ1 A;  4M78 A;  4KGV B;  3EGD A;  3OMG A;  1Q86 C;  2LCC A;  2X4X A;  1WHJ A;  2EPD A;  4B6M A;  3L42 A;  1P92 A;  1UGR B;  1WI7 A;  2EYZ A;  3R6O A;  2VGN A;  1IB8 A;  1KD1 C;  4IKF A;  1TXQ A;  4EPC A;  3EGD B;  3OQ5 A;  1RAI B;  1CSK A;  4E7Z A;  5GAN 6;  1KC8 U;  2GFU A;  2KYB A;  1QP3 A;  1KQ1 A;  4A54 A;  1VQ6 Q;  2DFU A;  3TSZ A;  2C0O A;  2KI7 A;  3CCV Q;  3CCL Q;  2CDT A;  1T3L A;  2O31 A;  4ESR A;  3CEY A;  4M7A E;  3M53 A;  4M77 C;  1ZUK A;  4HCK A;  2FPF A;  1WGS A;  3CCE T;  4X34 A;  3HSB A;  3CCM T;  2OTL T;  2PUK B;  5CVI A;  3RIR A;  4L59 A;  2DEQ A;  1AOJ A;  3FJP A;  1YI2 Q;  3I55 A;  1GFC A;  1OPK A;  5EG2 A;  4C92 A;  4FSS A;  1PRL C;  1UGQ B;  4OB2 B;  5KYX A;  1AWW A;  1YN8 A;  1VQM Q;  4NOY A;  4JJC A;  3M0P A;  3X26 B;  2L3R A;  2HL5 C;  1K1Z A;  2ESW A;  2QGF B;  2XID A;  2SEM A;  3EGU A;  3FJ5 A;  3JAM E;  4IUR A;  2BZY A;  4C92 B;  4M7D D;  2EVR A;  7AT1 B;  4KBM B;  1JXM A;  1HD3 A;  1VYT A;  2NUP B;  2LJ3 A;  2FB7 A;  1AEY A;  2EIF A;  2FVU A;  1YCY A;  3MEU A;  3OYC A;  5I21 A;  5CR2 A;  3S3N A;  1SKU B;  1VQP Q;  2LQW A;  1Q82 R;  1SHG A;  4EMG A;  2DAQ A;  3JCM P;  1PHT A;  4BB7 A;  4FT4 A;  1SG5 A;  1Y57 A;  3H0I A;  2XK0 A;  1QWE A;  4C8Q A;  1SF9 A;  4BE2 A;  2RN8 A;  3CQT A;  2GF7 A;  4X9C A;  4DOW A;  1PC0 A;  2EAY A;  3MEW A;  3JB9 J;  2FYK A;  1PCX A;  4C8Q B;  1X27 A;  4C5G A;  2I0N A;  2QAS A;  1KC8 C;  1YP5 A;  3MEV A;  1VOM A;  1MUZ A;  4IUT A;  4PLL A;  4EMH A;  4M7A D;  2KXD A;  2K3Y A;  2KBT A;  4WTO B;  1QQJ A;  4CC7 A;  3S3O A;  1G3T A;  1K73 R;  4P5N A;  3KBG A;  3LGF A;  2KAF A;  3C95 A;  2PVG B;  2ROT A;  1S72 T;  5IXF A;  4AFQ C;  1QLY A;  2CKK A; 
#chains in the Genus database with same CATH homology
 3OW2 P;  3CMA Q;  1KD1 R;  3CCJ Q;  1YJN Q;  1YHQ Q;  3I55 Q;  3CME Q;  3CCE Q;  1VQ9 Q;  1VQ5 Q;  3CXC P;  3CPW P;  1Q7Y R;  1K8A R;  1VQK Q;  1KC8 R;  2QA4 Q;  1N8R R;  3CC2 Q;  1VQO Q;  1JJ2 P;  1YIJ Q;  2OTL Q;  3CCM Q;  1W2B P;  1VQ6 Q;  1VQ7 Q;  3CC4 Q;  1K73 R;  3CD6 Q;  2QEX Q;  3CCR Q;  1YI2 Q;  1YIT Q;  1M90 R;  3G4S Q;  3CCV Q;  1QVG P;  3CCL Q;  3CCS Q;  1M1K R;  1Q86 R;  1VQL Q;  1VQP Q;  3G71 Q;  1YJ9 Q;  1KQS P;  1VQ4 Q;  1K9M R;  1YJW Q;  2OTJ Q;  3CCQ Q;  3I56 Q;  1VQ8 Q;  1NJI R;  1Q81 R;  1S72 Q;  1VQM Q;  1Q82 R;  3G6E Q;  1VQN Q;  3CC7 Q;  1QVF P;  3CCU Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...