3CC4Q

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc4Q00
3I56Q 2QEXQ 1Q82R 3CCQQ 1VQ8Q 1K73R 1KC8R 3CCJQ 2QA4Q 3CXCP 1VQMQ 1QVFP 2OTJQ 3CMEQ 3CC4Q 3CPWP 1YITQ 1W2BP 3CCUQ 1Q81R 1VQ9Q 1VQNQ 1YIJQ 1VQLQ 1YJ9Q 1QVGP 1NJIR 1N8RR 1KQSP 2OTLQ 1K8AR 3OW2P 1VQ4Q 1Q7YR 1YJNQ 1VQOQ 3G71Q 1S72Q 1Q86R 1JJ2P 3CD6Q 1VQKQ 3CCVQ 3CC7Q 1VQ7Q 3CCMQ 1YJWQ 1YI2Q 3I55Q 1VQ6Q 1K9MR 3CMAQ 3CC2Q 3G4SQ 3CCSQ 1VQPQ 1M1KR 1YHQQ 3G6EQ 3CCRQ 1M90R 1VQ5Q 1KD1R 3CCEQ 3CCLQ
chains in the Genus database with same CATH superfamily
4QT7A 5FROA 2ESWA 3OB9A 1AZGB 3OYBA 1YFNA 4VUBA 2EYYA 2Z0WA 4C8QB 2FZCB 3MP6A 3OYIA 2FYKA 4AMCA 1TU0B 3VJPA 2DYBA 5LJ3g 3M4YA 2YUQA 1T0HA 4NL3A 2RPNA 2QA4T 3OYAA 1VQLQ 2YDLA 2XU8A 2YHTA 4J9CA 4KUIA 4ELZC 5I2SA 2ATCB 2L3PA 2RHYA 4AT1B 1KSWA 1OQKA 5D6WA 2AK5A 2XICA 1C1AA 4QVCA 1BK2A 4PKCC 2EPDA 1GRIA 2L3SA 3VU3C 4PFOA 4JUVA 1M3AA 1QP2A 2ED0A 1B7TA 2JNGA 1B07A 2CZ6B 2DE0X 4DA4A 3OYMA 2DK3A 2LQKA 4J9FA 3VS7A 1KQ2A 1WJSA 2RHXA 2DVJA 2LTOA 1N9SA 4XQ3A 2DETA 3DB4A 2GQVA 3CBMA 2IVWA 3MEAA 1VQPQ 3ME9A 3MP8A 4KH1B 3V7CA 3HL8A 2A7YA 2LJ3A 5FWCA 1G3SA 3JCMb 2R57A 5CO7A 3V7RA 2K9GA 4CC2A 4EDUA 2KMTA 3TREA 1KD1U 1VQNT 4Z89A 3V8LA 1IHVA 3EHQA 3QIIA 4C8QD 4XAXB 2DPPB 4C0GA 1H3HA 1MMNA 2EQMA 1YBYA 4CC4B 2LCCA 3JB9J 1T3LA 1BU1A 1UJYA 3PTAA 3QWYA 2RJEA 2EBPA 2RK1A 4ATOA 1X69A 2QDYB 3M54A 1KC8U 2BTTA 4ZN3A 2KRSA 3M56A 1WA7A 2M0YA 3ZFJA 2HBPA 2CUDA 3CCMT 1R8OB 2GFAA 1PNJA 1AWJA 2K4YA 1SRLA 5GAMe 3G1JA 4X1VA 4ESRA 3MP1A 1VQ9T 2J05A 1IRXA 4J83A 1W4SA 1FWZA 2L2PA 2CP7A 4PL6A 1XQHA 1B34B 2EYQA 1BI0A 4M75E 2D8HA 2EAYA 2EKOA 1NJIC 2QA4Q 1Y0MA 3TU4K 4HVUA 1PKSA 1ZHIA 5GANf 2E3HA 5FLXE 5I2MA 2DL5A 3L2VA 4O5VA 2DTOA 1LJOA 3VS6A 1JXOA 2KDSA 1FMWA 2QXFA 3TVTA 3JCMe 2RJDA 1WHKA 2IIMA 4RUGA 3CCET 1IGQA 3EAEA 3HKSA 3UA7A 3META 2ED1A 3RERA 2DNUA 1R0CB 1I8FA 5M9OA 3EFOB 2E6ZA 4J9BA 1U5SA 3GBQA 1GCQA 1GCQC 1GBQA 2K2VA 5HY6A 2CUBA 2XHCA 4FYXB 2F69A 3MEVA 2ZPIB 2KI7A 1QKXA 1IO6A 3S3NA 5GAMh 5I21A 4OMNA 2WSCE 4LDWA 4A4FA 2E1HA 5C6SA 1VA7A 3M59A 4BE0A 3CCQA 2DILA 4QQ6A 3QZ5B 3CCUT 1OPLA 1KQSP 3JB9D 3ZBDA 2JTMA 3EG9B 4M75A 4M75C 2HNIA 4PJLA 4DBFA 4QKUA 3CCVA 4NS5A 4HT8A 5DLOA 4AG1C 2KT1A 2V1RA 2DXBA 4ZGJB 4EMGA 1WLPB 5KYYA 4XTUA 2QTVA 2X4WA 3V8KA 3OYNA 4B6MA 5CIUA 3O5ZA 2OX7A 2ZAEA 5DY9A 3JCMh 4XU0A 3IQLA 1TUDA 1U3OA 4Q5WA 4ZTJA 5KCOA 2MIOA 1BB9A 2F2XA 3L42A 2JUFA 3DLLA 4HVVA 4M77E 4HCBA 2QI2A 2MOXA 3VV0A 3E9FA 3QYGB 3CCQQ 3CCRT 3CCEA 2KQWA 4ZTFA 1I1JA 2BIVA 4C0DC 1JBMA 1XOVA 5D6XA 2JN0A 5HKCA 2WACA 1QWFA 1HSQA 2QASA 3C12A 3O8VA 1JJ2P 3CCVQ 4LDXA 1C6VX 4E7JA 4OB0B 4BY6C 5IHNA 1X43A 2QQSA 1QVPA 3CC2A 1K73R 4OMMA 5FWBA 5FRNA 2ENMA 3RNJA 4JJCA 2OAWA 4M78E 4JZ4A 1SHFA 3CMEA 2P4TA 2K3YA 2IG0A 2V8JA 3CCUA 1K8AR 2VYTA 8ATCB 1PG5B 5GAN4 5DM7R 4A4EA 5KYYB 2G3RA 1O75A 2YRVA 3CC7T 3CCEQ 1O9SA 2ABLA 3QZ9B 1H8KA 2F1LA 5CK9A 3TQ7P 2NUPB 3WVEB 4C0FA 5IHKA 1SRMA 2DJQA 3NTIA 4QVZA 2O4XB 4RCCA 4DQ2A 4BDZA 3OYEA 3HPWA 1VQOA 4M77A 4JRKA 2EQUA 3CC2Q 2HSEB 2ZPGB 2GTOA 3QDFA 4OMLA 1VQ6T 4RKUE 3LYIA 3CCST 1R0BG 2E5QA 6AT1B 1H641 3TSWA 1ZBXA 3CCUQ 4EMKB 2X9HA 3CC4T 4M75F 4MZTA 3OY9A 4RTVA 2KK4A 2DXTA 1D0XA 2K6DA 4XU3A 4KULA 1FX7A 1OULA 2K79A 1NG2A 3E9GA 2QGGA 2MAMA 3CMAT 1G83A 3I35A 3ULRB 4BE1A 4M78A 4X9DA 2YRDA 3E19A 4OVAA 3WXMB 2CSQA 3H0HA 2ZPFB 3E1SA 3F70A 5KE2A 3JCMW 4MDWA 2AZSA 2F5KA 4V2SA 2RF0A 3NTHA 1QCOA 3JB9H 2FB7A 1N8RC 3R6OA 2D0QB 2HCKA 2RD1A 2FO0A 2O31A 4OMOA 5CKEA 4M7AC 3OW2S 2Y4XA 1RAFB 2HMAA 1RI9A 2A3LA 2KRNA 4AFQC 2DLPA 2EIFA 4WF2A 2C06A 4HCCA 5LJ3f 3HRSA 4JPBW 1NLPC 4QQGA 3MPUB 5LJ5f 2GF7A 1VQ6A 5GAOp 3CCSA 3X25B 2AZVA 2HSPA 2ZGWA 3CC4A 2XIDA 1UGPB 1WHHA 3GNGA 5GAOm 2A08A 1Q86R 5FU7B 2NUTB 2OTLA 5IHIA 1WHMA 1WXBA 2E70A 1YWOA 1WZOA 4NL2A 4HCKA 3CXCP 1QVFP 4E7IA 2ZPHB 2EYZA 2FG0A 4IUVA 4LD6A 4R56A 1ZSZA 1PWTA 4M77F 1ZUUA 4F04B 1WHJA 2QQBA 3PE0A 4DOWA 1YJ9A 4XU1A 2HKQB 2L0AA 1VQ6Q 3CCSQ 2D8JA 1YI2T 2NWMA 2CZ0B 2JMCA 2V26A 4BI4A 4RTWA 3CC4Q 5GAOn 2LZ6B 2BE7D 1EX4A 5IAYA 2OTLQ 5GAOl 2RM4A 4PFPA 3BE3A 1ZUYA 5CAIA 2QQRA 2P0PA 2HAXA 4HA8A 2RQVA 4M78F 1RLQC 1VIEA 2KE9A 2DZCA 3X28B 3A98A 4F17A 3CMAQ 1TXQA 3G7ZA 3V7SA 2RI2A 2H8HA 2P0KA 1NJIU 3I55A 3INZA 5GAMd 3OS1A 1HK9A 2RI5A 1YJ9Q 3EG0A 4Y28E 4LDUA 1UB4A 4C8QC 3CBPA 4DOVA 4M7AF 3RDVA 1Q81C 3REAB 3NFCA 4N4IA 2WSFE 2JS2A 1YHQA 3ZL7C 2A36A 1AHJB 4OB1B 2RJCA 3MJXA 3PNWC 4M75G 4F7UE 4C5HA 3RBBB 1YIJT 3HP9A 4LDYA 4C5IA 3I55Q 1ABOA 1W6XA 4XTWA 2PUKB 1YI2A 3UDCA 2X51A 4D6WA 5LL6S 3OYCA 1OU9A 1E6GA 2GFUA 4ME7A 1VQMT 3OSSC 2H3EB 3CCJA 1LNXA 4JZ3A 5GAOq 1M5Q1 2E5KA 3OW2A 2YXYA 2Y90A 3OS5A 3SDZA 3CEYA 2CYZB 4FIBA 5KE3A 4UC4A 4O6JA 5GANd 3RKWA 1YHQQ 4M7DE 2E4HA 2CS7A 1JQQA 5KYWA 3AHUA 2MWPA 2JT4A 1PSEA 3TEEA 1RAIB 3VYHB 5LJ5g 4LN2A 4P5NA 2DO3A 1GCPA 7AT1B 3FJ5A 4IURA 3EGDB 4ORZA 2XI9A 1YI2Q 1PHTA 4OF1A 5GANj 1UTIA 2CSIA 3CCJQ 4F7UA 2XDDA 2EJFA 1QMCA 1YIJA 1Q7YR 3DLMA 3UA6A 1JRIA 1BCOA 1BYMA 1M9SA 1UFFA 2DL3A 4JRPA 2DVEA 2FL7A 1MUZA 2FHDA 4L6V5 4FU6A 4PJMA 2RO0A 2FZGB 3I56A 2LCSA 4M77G 1VQMA 2DERA 1UGRB 5KH6A 4M7DA 4L5GA 3MO8A 4M7DC 2E12A 4FW2A 4C5GA 1YWPA 2JM8A 4AG2C 3OYFA 1M90R 3OMCA 1GXIE 1U06A 2E3IA 2AIRB 3EH2A 1OV3A 1BKBA 1PRMC 4HVWA 2I0NA 2NLUA 1V1CA 3OYYA 3REBB 1YIJQ 1BIAA 2K7AA 5KYXA 1BI2A 1TS9A 3JB9I 2PVOB 4E6RA 2LQ8A 4LUDA 4J6YA 4M78G 3JV3A 4DEXA 1KJWA 3VS3A 1TWBA 4N0AC 1WX6A 3A8GB 4OP0A 3J81E 3I56Q 2EKHA 1VQMQ 3HRTA 3KFVA 3CCQT 3A8LB 1BCMA 1YITA 3ZEHA 1NZ9A 4FYVB 4IKFA 2J6KA 2RH2A 1IZ6A 1QCFA 4M7AG 1AT1B 2VWFA 1WIEA 3CCVT 1VOMA 1GFCA 1KFZA 2XDPA 5A2QE 1HJDA 1Y96A 1W2BS 4PJOE 3HRUA 3NTKA 2KROA 3SFMA 2W10A 3EGXA 3VS4A 1NBEB 1ABQA 2YUOA 3QXEB 1GFDA 1LOJA 2RQTA 4F7UF 2Y4YA 2JVVA 1M1KR 5KYXB 4A53A 2PU9B 2EVRA 1N8RU 4EPCA 1OYXA 3NGPA 3CCLA 2KBTA 2JZ2A 2O01E 1YITQ 5GAN8 1RABB 1T0JA 4OB2B 5CR2A 1Q95G 4CI0C 4JJNK 4FYYB 5GAN3 4DBRA 4C92E 2X4XA 2HQHA 2EQKA 5GANe 2F2WA 3H0IA 2LJ1A 3CC2T 3OS2A 4BI3A 4BE2A 2KNBB 1U1TA 3RKYA 3CMET 4M7DF 3S6WA 1ZBJA 3GLXA 1G3YA 1ZLMA 4E7KA 2XD0A 3GP8A 2SRCA 2K5IA 4PJOA 4PJOC 1B3QA 4L59A 1Q82R 1M2VA 4OMPA 2RB6A 8AT1B 2VKNA 3ER0A 4AFSC 2B8AA 1UHFA 2VB6A 5CQYA 4J8OA 3QSUA 2PTKA 1VQOT 3PT9A 1ZA1B 4XU2A 1N5ZA 1OX8A 4M4ZA 2OI3A 1WNLA 3CPWS 2JXBA 2E41A 4FW1A 3VS5A 1QVGS 4Z88A 3A1PA 2F5TX 3A8HB 5LJ3d 1OI1A 4C92A 4F16A 4C92C 3MEWA 3C0CA 1RI0A 4RG2A 4DBHA 4E7SA 4X9CA 5GANh 5GAMg 2DF6A 5IN1A 1K73C 2KEAA 2JM9A 3A5ZB 1ACMB 1WXTA 1Y57A 4FCYA 3JCMV 1K8AC 9ATCB 1VQ5A 3OYJA 2LCLA 1VIFA 3PFSA 1T3SA 4M75B 2X3WD 1K9MU 4KRTA 1PC0A 2BZ8A 5LJ3j 2PNIA 2XMFA 4IIMA 4EMKC 3VUBA 4LE9A 1AWWA 3X20B 1M3BA 2EYWA 2EGAA 4PJNA 1Q81U 2CKKA 2DMOA 1UEBA 3VYGA 4A54A 2GBQA 1VYUA 1M8VA 3TSZA 4RCBA 1S1NA 5GMKj 1D1BA 4HT9A 2BKDN 3JCMg 1W2BA 5KYUA 4M7AE 5CKFA 3SWNA 3KXTA 3SWNC 1WGSA 4KGZB 3BFMA 2FZKB 2DL4A 2ECZA 4E2FB 2NUZA 1YJNA 1A0NB 4C0DB 2LDMA 1VQ5Q 1KD1R 1WDXA 2L8DA 4JS5A 1PCXA 3DKMA 3G6EA 2L5QA 3CMEQ 3TCJA 2P0QA 2E6NA 2E65A 4BY6B 4PJOF 1I07A 2HL3A 2OTLT 1X27A 4F7UG 2FVUA 1UDLA 2GGRA 2GTJA 4F14A 1K76A 2BE9B 3NMZC 1KC8R 5CKBA 5KYNA 2HDAA 5GAN5 2KXCA 1WI7A 1YJ9T 1YJNQ 1VQOQ 1N6AA 4M75D 1JO8A 1OZ3A 1TUCA 4Z02A 2CZ1B 2DEUA 2LQNA 3CD6A 3OQ5A 1VQKA 1KK7A 3M4GA 3G6EQ 1WJRA 5FU7C 4RG8A 4HXJA 2X4JA 4C92F 4M7AA 3OS0A 4XTXA 4M7DG 3MEUA 1QQJA 3VS2A 3LX7A 4M77B 5D6YA 4LUEA 1TSFA 3OYLA 2MMPA 2GCXA 4C0ZA 4KUDK 1DJ7B 2H3JA 1YP5A 2C0IA 1E6HA 2QK0A 4RTYA 5HK3A 1FYNA 2DTHA 2FPEA 3I55T 2CP6A 2X35A 2CH4W 4A4GA 2M02A 4FSSA 2KYBA 3MCAB 1UGSB 2RHIA 4X34A 3RIRA 2M1HA 1RAHB 2HEQA 2K5LA 2KAFA 4J7FA 1Q86C 3CPWA 3BDUA 3LGLA 4LD9K 1UGVA 2DFUA 3A8OB 1K1ZA 1MMDA 3UT1A 1K0XA 1QVGA 1PKTA 1RL2A 4BI8B 5AYFA 3RKXA 3CD6Q 1MV0B 1ZQ1A 3URGA 1VQKQ 4M78B 1FMKA 2LVMA 1ZX6A 3FDRA 4LDVA 1YJWT 2VGMA 2PUOB 4C8QE 1YN8A 2K2MA 2YWWA 3QYHB 1YHQT 3EG1A 2B86A 1I0CA 4KH0B 3HTRA 1X01A 3SD4A 3RMSA 4R55A 5LJ3e 5LJ5e 2OJ2A 1WYXA 4RTXA 4KBMB 3M0UA 4M7AB 1XJWB 2EYXA 2I2LA 5GMKm 3THKA 4DEYA 4IUUA 1MMAA 1UECA 4QW2A 1D3BA 2DX1A 4GY5A 3FIFA 5GMKe 5L8RE 3CCJT 2A37A 5FW9A 3DB3A 2DTIA 1OU8A 3FB9A 4LNPA 2QYZA 4XTVA 4M77D 1NEGA 3H6ZA 3PIPA 4J9IA 4B9XA 3H9NA 5FU6C 3J80E 4FSXA 2PVGB 1BI1A 3QJ6A 2KY9A 1VQ8A 2DIQA 4PJJA 4PFZA 1YCYA 1IGUA 1X6GA 4XTYA 2PZ1A 5DLQE 2DIGA 4IUQA 4QQDA 4C8QA 5GMKl 4N4HA 1WQ7A 1ZSZB 1YJWA 4M78D 2AT1B 2JOYA 3VRYA 5LJ3h 5HCKA 2SEMA 1V29B 2RMOA 1CKBA 3M53A 4PK4A 4PJOG 3LW5E 3S3OA 3R6NA 2AHJB 2K57A 4GBQA 4II1A 4KT0E 4E7ZA 1QKWA 5GMKh 1LVKA 2ZPBB 3M57A 5CVIA 1VQ8Q 4M7AD 1HYOA 2FPFA 4Y92A 4JLGA 1RLPC 5CKDA 3EG2A 1SG5A 3I56T 3EGUA 2VV5A 4OMFB 1G2BA 4BUGA 4IUTA 3GF5A 3OYKA 3J7AF 1VQLA 2CGHA 2ROTA 1CSKA 5GJVB 1YJWQ 5A0LA 3OA6A 1IB8A 3H0FA 1SSFA 4C92G 2K5FA 4BDYA 3LH0A 1X6BA 2FRWA 5J3BA 2XDBA 2D6FA 5IXFA 1RADB 4B9WA 4J5YA 1AD5A 1FXXA 3QUIA 1VUBA 2PQWA 2VXFA 2P84A 3L1AA 3M0SA 3JSCA 4MMKA 3RMQA 2V8KA 1M1FA 2KT8A 3LLRA 1VQPA 3G4SA 1KHIA 3Q1JA 1Q7YC 1RACB 2LMJA 2FEIA 3PGGA 4OMQA 4FT2A 2DYIA 1QP3A 2KXDA 1P92A 1YITT 4D8KA 3H8ZA 3HSBA 2MYSA 1UUEA 2COWA 2L89A 4HCZA 1K73U 2HQEA 2M0OA 2EQIA 2KGTA 2QQAA 3VS0A 2O2OA 4XK8E 1VYVA 1I4K1 1K8AU 2LT4A 1ARKA 1TTHB 4JS4A 1MNDA 1TH7A 3HFOA 3OYGA 1D0YA 1MMGA 4MZPA 2LRQA 1KQSS 2CP3A 1OEBA 2MWOA 4C8QF 1G3TA 1M90C 2LC4A 3KUFA 5KYWB 4TVRA 4GLMA 2L3QA 1S72A 3G4SQ 2KSSA 4J9EA 5IH2A 1SEMA 2V8IA 2E10A 2HZYA 2FPDA 3CCLT 1F1BB 1X2KA 1D09B 2M16A 1B34A 1YNZA 3M0PA 1MGQA 2RN8A 2HBWA 2HL5C 5GAMf 4MDXA 1K4US 2C0OA 2VC8A 2VUBA 4FL6A 4F7UB 1PSFA 1OPKA 4N0AA 1Y7XA 1EFNA 4Y91A 2GQIA 3C95A 4DBQA 1FMVA 1LPLA 3PMIA 2QA4A 1EZZB 1JJ2S 3MKDA 1D1AA 2YUPA 4N4GA 3M55A 4JJBA 1TUGB 1S72Q 4BACA 3CPFA 1AWOA 2J6FA 4K11A 1VQ4T 4A4HA 3EFOA 3L2ZA 1VQ7T 2BZYA 1I81A 5J39A 4AFUC 3GIBA 1NYFA 1K0SA 3OBYA 1N27A 1K9AA 5A0GA 2YLCA 3JCMf 5CKHA 4ZN1A 1AEYA 1IREB 2VVKA 3I5SA 4JRIA 4M7DB 3QWXX 1IHWA 3FC3A 2AKKA 1ZA2B 2COYA 2QTXA 1M1KC 2K3BA 2DD5A 2QDLA 1RAEB 1G8XA 3VUZA 3QDRB 4KGVB 3QKJA 1XTDA 1C0MA 2L3RA 1TG0A 1SSHA 2A0FB 1BI3A 5GAN2 3EG9A 1Y71A 1AWXA 1M2OA 1EIFA 3FRNA 2J06A 3KBGA 1QLYA 1SPKA 3JAME 2W0ZA 1NJIR 2RK2A 3L2UA 5CCAA 1JXMA 1VQNA 2EWNA 1MHNA 1HD3A 3I9QA 2ROLA 2DAQA 2VGNA 4C5EA 3LWIA 1OX9A 1M1GA 2EGCA 3M58A 1VQ5T 1Q86U 1MV3A 1Z9ZA 2KR3A 4PLLA 3JB9F 1AVZC 3OBWA 3M9QA 1X75C 1MNEA 2M9UA 4Z8AA 1AOJA 1D0ZA 2CP5A 2P4RA 1Y96B 1Q82C 2MI6A 1XNIA 4WTOB 4LXCA 1IXDA 3A8MB 3G71T 1VQ4A 4OGEA 3MHXA 1I5LA 4ZGDB 3CCLQ 1VQ7A 4R0KA 3P8DA 3EGXB 3CCMA 2DM1A 3BY7A 1JEGA 2LNHB 4XTZA 1RAGB 2CP0A 3P8HA 2COZA 1VQNQ 5IT9E 4IIOA 2JTFA 1KQSA 2CREA 2KRMA 1VQ9A 4M7DD 4A4KA 3L2QA 1WFWA 4J7IA 1RAAB 2K3XA 1VYTA 1M8MA 1NYGA 1YJNT 5L23A 4J6WA 1V76A 1WQWA 2JJ9A 3T9NA 4JRQA 1W1FA 2R5MA 1GBRA 1OZ2A 4NOYA 2LQWA 5I22A 2AKLA 3G6ET 2DRMA 3EFSA 2RQWA 4FM4B 3JCMc 3LH5A 5GAOr 3UPUA 2OTJT 2MPXC 3GPLA 4C8QG 4J9GA 2BZXA 1N9RA 1VQ4Q 2NUPA 5LJ5d 2A28A 1M27C 1SKUB 2EJGA 1VQ7Q 5HK0A 3CCMQ 5GMKi 3X24B 4BB7A 2LX7A 4ZNXA 2O4XA 1CKAA 2X4YA 3LWHA 5FRMA 5EC7A 4ZGEB 1QCNA 2HKNA 2OAUA 3RUXA 1QWEA 1VQ9Q 5IXBA 2DXCA 1GL5A 2DBKA 2J6OA 4PJOB 3E2UA 5CQXA 1JJ2A 4EMKA 1M2VB 5LJ5j 3WVDB 3G71A 2DJZA 3CD6T 1VQKT 2R5AA 3QJYA 1PD0A 3CXCS 1QVFS 2NYSA 1M30A 3X26B 2XG8D 4JJDA 1RUWA 3SHWA 2RA2A 1W2BP 1PM3A 1AZEA 2QAZA 2YSQA 5D7UA 2HD0A 2DBMA 3QG1A 1KD1C 2LJ0A 3HHTB 3EFRA 3FLGA 3H41A 1NLOC 1KQ1A 4ANJA 3PIOA 4C92B 2DKGA 4A63B 2V1QA 4RTUA 1UE9A 5GANg 2OTJA 3I5RA 1I5OB 1UJ0A 1U1SA 5GJWB 3G71Q 2R58A 3EH1A 2O9SA 1KC8C 3EHRA 4M77C 2XK0A 3GOXA 2JS0A 4E7HA 3M5AA 3CCRA 3FEOA 2O9VA 4JDSA 3M0TA 3NPFA 1SF9A 2GNCA 3PVLA 1H92A 2KVQG 2ZCFB 4YTLA 2MK5A 1D1CA 2YT6A 1WHGA 4PJOD 1WHLA 1ZUKA 1SHGA 5KYUB 1U8RA 2RHUA 4E7LA 3S3MA 3AT1B 4J6XA 3PMTA 3EG3A 2DXUA 2NUTA 1OOTA 1KHCA 4E47A 4M78C 3JCMP 3VS1A 1Q7YU 3QPHA 3SWNB 2OTJQ 3JB9G 2QEXT 1X6OA 1JU5C 2DL8A 1E7OA 3UATA 5KCHA 5J26A 4J9HA 3OMGA 2KYMA 1NE8A 4OGCA 1G5VA 5I11A 2BUDA 2LT1A 4EIKA 1QW1A 2RQRA 3CCRQ 3CC7A 2DL7A 2MCNA 2DRKA 2QG9B 3CPWP 1VQ8T 4MZMA 4C92D 1YCSB 1QVGP 3PVQA 1M90U 1N8RR 2CH4A 1BBZA 3U23A 2J7IA 3SB2A 4EMHA 3JCMJ 2ZPEB 3QBYA 3QHSA 2YRCA 1UGQB 4KGXB 3FJPA 3JCMQ 1PRLC 4FYWB 2WSEE 5C0MA 3CBOA 3GNFB 1JB0E 2YLBA 2RNAA 2DEQA 1X2QA 3CC7Q 2YUNA 2QQ9A 4CRIA 3RR6A 1KIKA 4CC3A 3LGFA 3UWNA 1TOVA 4IUPA 3M0RA 3CMAA 2JMAA 1LCKA 1G3WA 2LP5A 3SEMA 1UHCA 2HQXA 3CXCA 1QVFA 2ZZDA 2RQUA 2QEXA 1WJQA 2LX9A 2CP2A 1ZSZC 2EJ9A 4RMOA 3L2RA 2G6FX 3ASKA 2D9TA 1VQLT 5ECAA 4OB3B 1WXUA 2VASA 2DZ9A 3NHNA 2QGFB 1Y07A 2RJFA 3V8JA 2PVDB 1NM7A 4J9DA 3L2WA 2DD4A 2CDTA 2VXEA 1WPYA 3CQTA 3D7SB 3UF4A 4BD3A 1KG1A 3N5BB 3C94A 2MF2A 4MMLA 5EG2A 1J3TA 1W70A 1M1KU 2JTEA 3M0QA 2O88A 2E64A 3OYHA 4PNOA 1UG1A 3OYDA 2RI3A 4FT4A 4WCIA 5A0DA 1NPPA 1M3CA 2X3XD 1HXDA 1PD1A 4CC7A 2D0NA 1VQPT 3RESA 2QEXQ 3G4ST 3QO3A 4JLIA 1BIBA 2IPOB 4RTZA 2CZ7B 3C4SA 4PLIA 2CT4A 4QVDA 1K9MC 2D1XA 5LJ5h 3VRZA 1NEBA 2EQJA 1H3ZA 1NPRA 4HKEA 5GAN6 4ELYC 1D3BB 2DA9A 5GAN7 1Z9QA 2EFIA 2RHZA 1R77A 2F2VA 1K9MR 3BW1A 3P8BB 3JRZA 1M4ZA 2XKOC 3OSVA 3EGDA 3VKIA 4D8DA 3BDLA 1ZSGA 4RTTA 4AFZC 5GAMj 1Q81R 2FRYA 2JW4A 3JCMX 2LNVA 2M51A 3OW2P 5FU6B 1Q82U 4GLKA 2EW3A 5AT1B 3JCMd 1S72T 2CT3A 3HFNA 2C0TA 2EGEA
chains in the Genus database with same CATH topology
3I56Q 2QEXQ 1Q82R 3CCQQ 1VQ8Q 1K73R 1KC8R 3CCJQ 2QA4Q 3CXCP 1VQMQ 1QVFP 2OTJQ 3CMEQ 3CC4Q 3CPWP 1YITQ 1W2BP 3CCUQ 1Q81R 1VQ9Q 1VQNQ 1YIJQ 1VQLQ 1YJ9Q 1QVGP 1NJIR 1N8RR 1KQSP 2OTLQ 1K8AR 3OW2P 1VQ4Q 1Q7YR 1YJNQ 1VQOQ 3G71Q 1S72Q 1Q86R 1JJ2P 3CD6Q 1VQKQ 3CCVQ 3CC7Q 1VQ7Q 3CCMQ 1YJWQ 1YI2Q 3I55Q 1VQ6Q 1K9MR 3CMAQ 3CC2Q 3G4SQ 3CCSQ 1VQPQ 1M1KR 1YHQQ 3G6EQ 3CCRQ 1M90R 1VQ5Q 1KD1R 3CCEQ 3CCLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Q;  2QEX Q;  1Q82 R;  3CCQ Q;  1VQ8 Q;  1K73 R;  1KC8 R;  3CCJ Q;  2QA4 Q;  3CXC P;  1VQM Q;  1QVF P;  2OTJ Q;  3CME Q;  3CC4 Q;  3CPW P;  1YIT Q;  1W2B P;  3CCU Q;  1Q81 R;  1VQ9 Q;  1VQN Q;  1YIJ Q;  1VQL Q;  1YJ9 Q;  1QVG P;  1NJI R;  1N8R R;  1KQS P;  2OTL Q;  1K8A R;  3OW2 P;  1VQ4 Q;  1Q7Y R;  1YJN Q;  1VQO Q;  3G71 Q;  1S72 Q;  1Q86 R;  1JJ2 P;  3CD6 Q;  1VQK Q;  3CCV Q;  3CC7 Q;  1VQ7 Q;  3CCM Q;  1YJW Q;  1YI2 Q;  3I55 Q;  1VQ6 Q;  1K9M R;  3CMA Q;  3CC2 Q;  3G4S Q;  3CCS Q;  1VQP Q;  1M1K R;  1YHQ Q;  3G6E Q;  3CCR Q;  1M90 R;  1VQ5 Q;  1KD1 R;  3CCE Q;  3CCL Q; 
#chains in the Genus database with same CATH topology
 4QT7 A;  5FRO A;  2ESW A;  3OB9 A;  1AZG B;  3OYB A;  1YFN A;  4VUB A;  2EYY A;  2Z0W A;  4C8Q B;  2FZC B;  3MP6 A;  3OYI A;  2FYK A;  4AMC A;  1TU0 B;  3VJP A;  2DYB A;  5LJ3 g;  3M4Y A;  2YUQ A;  1T0H A;  4NL3 A;  2RPN A;  2QA4 T;  3OYA A;  1VQL Q;  2YDL A;  2XU8 A;  2YHT A;  4J9C A;  4KUI A;  4ELZ C;  5I2S A;  2ATC B;  2L3P A;  2RHY A;  4AT1 B;  1KSW A;  1OQK A;  5D6W A;  2AK5 A;  2XIC A;  1C1A A;  4QVC A;  1BK2 A;  4PKC C;  2EPD A;  1GRI A;  2L3S A;  3VU3 C;  4PFO A;  4JUV A;  1M3A A;  1QP2 A;  2ED0 A;  1B7T A;  2JNG A;  1B07 A;  2CZ6 B;  2DE0 X;  4DA4 A;  3OYM A;  2DK3 A;  2LQK A;  4J9F A;  3VS7 A;  1KQ2 A;  1WJS A;  2RHX A;  2DVJ A;  2LTO A;  1N9S A;  4XQ3 A;  2DET A;  3DB4 A;  2GQV A;  3CBM A;  2IVW A;  3MEA A;  1VQP Q;  3ME9 A;  3MP8 A;  4KH1 B;  3V7C A;  3HL8 A;  2A7Y A;  2LJ3 A;  5FWC A;  1G3S A;  3JCM b;  2R57 A;  5CO7 A;  3V7R A;  2K9G A;  4CC2 A;  4EDU A;  2KMT A;  3TRE A;  1KD1 U;  1VQN T;  4Z89 A;  3V8L A;  1IHV A;  3EHQ A;  3QII A;  4C8Q D;  4XAX B;  2DPP B;  4C0G A;  1H3H A;  1MMN A;  2EQM A;  1YBY A;  4CC4 B;  2LCC A;  3JB9 J;  1T3L A;  1BU1 A;  1UJY A;  3PTA A;  3QWY A;  2RJE A;  2EBP A;  2RK1 A;  4ATO A;  1X69 A;  2QDY B;  3M54 A;  1KC8 U;  2BTT A;  4ZN3 A;  2KRS A;  3M56 A;  1WA7 A;  2M0Y A;  3ZFJ A;  2HBP A;  2CUD A;  3CCM T;  1R8O B;  2GFA A;  1PNJ A;  1AWJ A;  2K4Y A;  1SRL A;  5GAM e;  3G1J A;  4X1V A;  4ESR A;  3MP1 A;  1VQ9 T;  2J05 A;  1IRX A;  4J83 A;  1W4S A;  1FWZ A;  2L2P A;  2CP7 A;  4PL6 A;  1XQH A;  1B34 B;  2EYQ A;  1BI0 A;  4M75 E;  2D8H A;  2EAY A;  2EKO A;  1NJI C;  2QA4 Q;  1Y0M A;  3TU4 K;  4HVU A;  1PKS A;  1ZHI A;  5GAN f;  2E3H A;  5FLX E;  5I2M A;  2DL5 A;  3L2V A;  4O5V A;  2DTO A;  1LJO A;  3VS6 A;  1JXO A;  2KDS A;  1FMW A;  2QXF A;  3TVT A;  3JCM e;  2RJD A;  1WHK A;  2IIM A;  4RUG A;  3CCE T;  1IGQ A;  3EAE A;  3HKS A;  3UA7 A;  3MET A;  2ED1 A;  3RER A;  2DNU A;  1R0C B;  1I8F A;  5M9O A;  3EFO B;  2E6Z A;  4J9B A;  1U5S A;  3GBQ A;  1GCQ A;  1GCQ C;  1GBQ A;  2K2V A;  5HY6 A;  2CUB A;  2XHC A;  4FYX B;  2F69 A;  3MEV A;  2ZPI B;  2KI7 A;  1QKX A;  1IO6 A;  3S3N A;  5GAM h;  5I21 A;  4OMN A;  2WSC E;  4LDW A;  4A4F A;  2E1H A;  5C6S A;  1VA7 A;  3M59 A;  4BE0 A;  3CCQ A;  2DIL A;  4QQ6 A;  3QZ5 B;  3CCU T;  1OPL A;  1KQS P;  3JB9 D;  3ZBD A;  2JTM A;  3EG9 B;  4M75 A;  4M75 C;  2HNI A;  4PJL A;  4DBF A;  4QKU A;  3CCV A;  4NS5 A;  4HT8 A;  5DLO A;  4AG1 C;  2KT1 A;  2V1R A;  2DXB A;  4ZGJ B;  4EMG A;  1WLP B;  5KYY A;  4XTU A;  2QTV A;  2X4W A;  3V8K A;  3OYN A;  4B6M A;  5CIU A;  3O5Z A;  2OX7 A;  2ZAE A;  5DY9 A;  3JCM h;  4XU0 A;  3IQL A;  1TUD A;  1U3O A;  4Q5W A;  4ZTJ A;  5KCO A;  2MIO A;  1BB9 A;  2F2X A;  3L42 A;  2JUF A;  3DLL A;  4HVV A;  4M77 E;  4HCB A;  2QI2 A;  2MOX A;  3VV0 A;  3E9F A;  3QYG B;  3CCQ Q;  3CCR T;  3CCE A;  2KQW A;  4ZTF A;  1I1J A;  2BIV A;  4C0D C;  1JBM A;  1XOV A;  5D6X A;  2JN0 A;  5HKC A;  2WAC A;  1QWF A;  1HSQ A;  2QAS A;  3C12 A;  3O8V A;  1JJ2 P;  3CCV Q;  4LDX A;  1C6V X;  4E7J A;  4OB0 B;  4BY6 C;  5IHN A;  1X43 A;  2QQS A;  1QVP A;  3CC2 A;  1K73 R;  4OMM A;  5FWB A;  5FRN A;  2ENM A;  3RNJ A;  4JJC A;  2OAW A;  4M78 E;  4JZ4 A;  1SHF A;  3CME A;  2P4T A;  2K3Y A;  2IG0 A;  2V8J A;  3CCU A;  1K8A R;  2VYT A;  8ATC B;  1PG5 B;  5GAN 4;  5DM7 R;  4A4E A;  5KYY B;  2G3R A;  1O75 A;  2YRV A;  3CC7 T;  3CCE Q;  1O9S A;  2ABL A;  3QZ9 B;  1H8K A;  2F1L A;  5CK9 A;  3TQ7 P;  2NUP B;  3WVE B;  4C0F A;  5IHK A;  1SRM A;  2DJQ A;  3NTI A;  4QVZ A;  2O4X B;  4RCC A;  4DQ2 A;  4BDZ A;  3OYE A;  3HPW A;  1VQO A;  4M77 A;  4JRK A;  2EQU A;  3CC2 Q;  2HSE B;  2ZPG B;  2GTO A;  3QDF A;  4OML A;  1VQ6 T;  4RKU E;  3LYI A;  3CCS T;  1R0B G;  2E5Q A;  6AT1 B;  1H64 1;  3TSW A;  1ZBX A;  3CCU Q;  4EMK B;  2X9H A;  3CC4 T;  4M75 F;  4MZT A;  3OY9 A;  4RTV A;  2KK4 A;  2DXT A;  1D0X A;  2K6D A;  4XU3 A;  4KUL A;  1FX7 A;  1OUL A;  2K79 A;  1NG2 A;  3E9G A;  2QGG A;  2MAM A;  3CMA T;  1G83 A;  3I35 A;  3ULR B;  4BE1 A;  4M78 A;  4X9D A;  2YRD A;  3E19 A;  4OVA A;  3WXM B;  2CSQ A;  3H0H A;  2ZPF B;  3E1S A;  3F70 A;  5KE2 A;  3JCM W;  4MDW A;  2AZS A;  2F5K A;  4V2S A;  2RF0 A;  3NTH A;  1QCO A;  3JB9 H;  2FB7 A;  1N8R C;  3R6O A;  2D0Q B;  2HCK A;  2RD1 A;  2FO0 A;  2O31 A;  4OMO A;  5CKE A;  4M7A C;  3OW2 S;  2Y4X A;  1RAF B;  2HMA A;  1RI9 A;  2A3L A;  2KRN A;  4AFQ C;  2DLP A;  2EIF A;  4WF2 A;  2C06 A;  4HCC A;  5LJ3 f;  3HRS A;  4JPB W;  1NLP C;  4QQG A;  3MPU B;  5LJ5 f;  2GF7 A;  1VQ6 A;  5GAO p;  3CCS A;  3X25 B;  2AZV A;  2HSP A;  2ZGW A;  3CC4 A;  2XID A;  1UGP B;  1WHH A;  3GNG A;  5GAO m;  2A08 A;  1Q86 R;  5FU7 B;  2NUT B;  2OTL A;  5IHI A;  1WHM A;  1WXB A;  2E70 A;  1YWO A;  1WZO A;  4NL2 A;  4HCK A;  3CXC P;  1QVF P;  4E7I A;  2ZPH B;  2EYZ A;  2FG0 A;  4IUV A;  4LD6 A;  4R56 A;  1ZSZ A;  1PWT A;  4M77 F;  1ZUU A;  4F04 B;  1WHJ A;  2QQB A;  3PE0 A;  4DOW A;  1YJ9 A;  4XU1 A;  2HKQ B;  2L0A A;  1VQ6 Q;  3CCS Q;  2D8J A;  1YI2 T;  2NWM A;  2CZ0 B;  2JMC A;  2V26 A;  4BI4 A;  4RTW A;  3CC4 Q;  5GAO n;  2LZ6 B;  2BE7 D;  1EX4 A;  5IAY A;  2OTL Q;  5GAO l;  2RM4 A;  4PFP A;  3BE3 A;  1ZUY A;  5CAI A;  2QQR A;  2P0P A;  2HAX A;  4HA8 A;  2RQV A;  4M78 F;  1RLQ C;  1VIE A;  2KE9 A;  2DZC A;  3X28 B;  3A98 A;  4F17 A;  3CMA Q;  1TXQ A;  3G7Z A;  3V7S A;  2RI2 A;  2H8H A;  2P0K A;  1NJI U;  3I55 A;  3INZ A;  5GAM d;  3OS1 A;  1HK9 A;  2RI5 A;  1YJ9 Q;  3EG0 A;  4Y28 E;  4LDU A;  1UB4 A;  4C8Q C;  3CBP A;  4DOV A;  4M7A F;  3RDV A;  1Q81 C;  3REA B;  3NFC A;  4N4I A;  2WSF E;  2JS2 A;  1YHQ A;  3ZL7 C;  2A36 A;  1AHJ B;  4OB1 B;  2RJC A;  3MJX A;  3PNW C;  4M75 G;  4F7U E;  4C5H A;  3RBB B;  1YIJ T;  3HP9 A;  4LDY A;  4C5I A;  3I55 Q;  1ABO A;  1W6X A;  4XTW A;  2PUK B;  1YI2 A;  3UDC A;  2X51 A;  4D6W A;  5LL6 S;  3OYC A;  1OU9 A;  1E6G A;  2GFU A;  4ME7 A;  1VQM T;  3OSS C;  2H3E B;  3CCJ A;  1LNX A;  4JZ3 A;  5GAO q;  1M5Q 1;  2E5K A;  3OW2 A;  2YXY A;  2Y90 A;  3OS5 A;  3SDZ A;  3CEY A;  2CYZ B;  4FIB A;  5KE3 A;  4UC4 A;  4O6J A;  5GAN d;  3RKW A;  1YHQ Q;  4M7D E;  2E4H A;  2CS7 A;  1JQQ A;  5KYW A;  3AHU A;  2MWP A;  2JT4 A;  1PSE A;  3TEE A;  1RAI B;  3VYH B;  5LJ5 g;  4LN2 A;  4P5N A;  2DO3 A;  1GCP A;  7AT1 B;  3FJ5 A;  4IUR A;  3EGD B;  4ORZ A;  2XI9 A;  1YI2 Q;  1PHT A;  4OF1 A;  5GAN j;  1UTI A;  2CSI A;  3CCJ Q;  4F7U A;  2XDD A;  2EJF A;  1QMC A;  1YIJ A;  1Q7Y R;  3DLM A;  3UA6 A;  1JRI A;  1BCO A;  1BYM A;  1M9S A;  1UFF A;  2DL3 A;  4JRP A;  2DVE A;  2FL7 A;  1MUZ A;  2FHD A;  4L6V 5;  4FU6 A;  4PJM A;  2RO0 A;  2FZG B;  3I56 A;  2LCS A;  4M77 G;  1VQM A;  2DER A;  1UGR B;  5KH6 A;  4M7D A;  4L5G A;  3MO8 A;  4M7D C;  2E12 A;  4FW2 A;  4C5G A;  1YWP A;  2JM8 A;  4AG2 C;  3OYF A;  1M90 R;  3OMC A;  1GXI E;  1U06 A;  2E3I A;  2AIR B;  3EH2 A;  1OV3 A;  1BKB A;  1PRM C;  4HVW A;  2I0N A;  2NLU A;  1V1C A;  3OYY A;  3REB B;  1YIJ Q;  1BIA A;  2K7A A;  5KYX A;  1BI2 A;  1TS9 A;  3JB9 I;  2PVO B;  4E6R A;  2LQ8 A;  4LUD A;  4J6Y A;  4M78 G;  3JV3 A;  4DEX A;  1KJW A;  3VS3 A;  1TWB A;  4N0A C;  1WX6 A;  3A8G B;  4OP0 A;  3J81 E;  3I56 Q;  2EKH A;  1VQM Q;  3HRT A;  3KFV A;  3CCQ T;  3A8L B;  1BCM A;  1YIT A;  3ZEH A;  1NZ9 A;  4FYV B;  4IKF A;  2J6K A;  2RH2 A;  1IZ6 A;  1QCF A;  4M7A G;  1AT1 B;  2VWF A;  1WIE A;  3CCV T;  1VOM A;  1GFC A;  1KFZ A;  2XDP A;  5A2Q E;  1HJD A;  1Y96 A;  1W2B S;  4PJO E;  3HRU A;  3NTK A;  2KRO A;  3SFM A;  2W10 A;  3EGX A;  3VS4 A;  1NBE B;  1ABQ A;  2YUO A;  3QXE B;  1GFD A;  1LOJ A;  2RQT A;  4F7U F;  2Y4Y A;  2JVV A;  1M1K R;  5KYX B;  4A53 A;  2PU9 B;  2EVR A;  1N8R U;  4EPC A;  1OYX A;  3NGP A;  3CCL A;  2KBT A;  2JZ2 A;  2O01 E;  1YIT Q;  5GAN 8;  1RAB B;  1T0J A;  4OB2 B;  5CR2 A;  1Q95 G;  4CI0 C;  4JJN K;  4FYY B;  5GAN 3;  4DBR A;  4C92 E;  2X4X A;  2HQH A;  2EQK A;  5GAN e;  2F2W A;  3H0I A;  2LJ1 A;  3CC2 T;  3OS2 A;  4BI3 A;  4BE2 A;  2KNB B;  1U1T A;  3RKY A;  3CME T;  4M7D F;  3S6W A;  1ZBJ A;  3GLX A;  1G3Y A;  1ZLM A;  4E7K A;  2XD0 A;  3GP8 A;  2SRC A;  2K5I A;  4PJO A;  4PJO C;  1B3Q A;  4L59 A;  1Q82 R;  1M2V A;  4OMP A;  2RB6 A;  8AT1 B;  2VKN A;  3ER0 A;  4AFS C;  2B8A A;  1UHF A;  2VB6 A;  5CQY A;  4J8O A;  3QSU A;  2PTK A;  1VQO T;  3PT9 A;  1ZA1 B;  4XU2 A;  1N5Z A;  1OX8 A;  4M4Z A;  2OI3 A;  1WNL A;  3CPW S;  2JXB A;  2E41 A;  4FW1 A;  3VS5 A;  1QVG S;  4Z88 A;  3A1P A;  2F5T X;  3A8H B;  5LJ3 d;  1OI1 A;  4C92 A;  4F16 A;  4C92 C;  3MEW A;  3C0C A;  1RI0 A;  4RG2 A;  4DBH A;  4E7S A;  4X9C A;  5GAN h;  5GAM g;  2DF6 A;  5IN1 A;  1K73 C;  2KEA A;  2JM9 A;  3A5Z B;  1ACM B;  1WXT A;  1Y57 A;  4FCY A;  3JCM V;  1K8A C;  9ATC B;  1VQ5 A;  3OYJ A;  2LCL A;  1VIF A;  3PFS A;  1T3S A;  4M75 B;  2X3W D;  1K9M U;  4KRT A;  1PC0 A;  2BZ8 A;  5LJ3 j;  2PNI A;  2XMF A;  4IIM A;  4EMK C;  3VUB A;  4LE9 A;  1AWW A;  3X20 B;  1M3B A;  2EYW A;  2EGA A;  4PJN A;  1Q81 U;  2CKK A;  2DMO A;  1UEB A;  3VYG A;  4A54 A;  2GBQ A;  1VYU A;  1M8V A;  3TSZ A;  4RCB A;  1S1N A;  5GMK j;  1D1B A;  4HT9 A;  2BKD N;  3JCM g;  1W2B A;  5KYU A;  4M7A E;  5CKF A;  3SWN A;  3KXT A;  3SWN C;  1WGS A;  4KGZ B;  3BFM A;  2FZK B;  2DL4 A;  2ECZ A;  4E2F B;  2NUZ A;  1YJN A;  1A0N B;  4C0D B;  2LDM A;  1VQ5 Q;  1KD1 R;  1WDX A;  2L8D A;  4JS5 A;  1PCX A;  3DKM A;  3G6E A;  2L5Q A;  3CME Q;  3TCJ A;  2P0Q A;  2E6N A;  2E65 A;  4BY6 B;  4PJO F;  1I07 A;  2HL3 A;  2OTL T;  1X27 A;  4F7U G;  2FVU A;  1UDL A;  2GGR A;  2GTJ A;  4F14 A;  1K76 A;  2BE9 B;  3NMZ C;  1KC8 R;  5CKB A;  5KYN A;  2HDA A;  5GAN 5;  2KXC A;  1WI7 A;  1YJ9 T;  1YJN Q;  1VQO Q;  1N6A A;  4M75 D;  1JO8 A;  1OZ3 A;  1TUC A;  4Z02 A;  2CZ1 B;  2DEU A;  2LQN A;  3CD6 A;  3OQ5 A;  1VQK A;  1KK7 A;  3M4G A;  3G6E Q;  1WJR A;  5FU7 C;  4RG8 A;  4HXJ A;  2X4J A;  4C92 F;  4M7A A;  3OS0 A;  4XTX A;  4M7D G;  3MEU A;  1QQJ A;  3VS2 A;  3LX7 A;  4M77 B;  5D6Y A;  4LUE A;  1TSF A;  3OYL A;  2MMP A;  2GCX A;  4C0Z A;  4KUD K;  1DJ7 B;  2H3J A;  1YP5 A;  2C0I A;  1E6H A;  2QK0 A;  4RTY A;  5HK3 A;  1FYN A;  2DTH A;  2FPE A;  3I55 T;  2CP6 A;  2X35 A;  2CH4 W;  4A4G A;  2M02 A;  4FSS A;  2KYB A;  3MCA B;  1UGS B;  2RHI A;  4X34 A;  3RIR A;  2M1H A;  1RAH B;  2HEQ A;  2K5L A;  2KAF A;  4J7F A;  1Q86 C;  3CPW A;  3BDU A;  3LGL A;  4LD9 K;  1UGV A;  2DFU A;  3A8O B;  1K1Z A;  1MMD A;  3UT1 A;  1K0X A;  1QVG A;  1PKT A;  1RL2 A;  4BI8 B;  5AYF A;  3RKX A;  3CD6 Q;  1MV0 B;  1ZQ1 A;  3URG A;  1VQK Q;  4M78 B;  1FMK A;  2LVM A;  1ZX6 A;  3FDR A;  4LDV A;  1YJW T;  2VGM A;  2PUO B;  4C8Q E;  1YN8 A;  2K2M A;  2YWW A;  3QYH B;  1YHQ T;  3EG1 A;  2B86 A;  1I0C A;  4KH0 B;  3HTR A;  1X01 A;  3SD4 A;  3RMS A;  4R55 A;  5LJ3 e;  5LJ5 e;  2OJ2 A;  1WYX A;  4RTX A;  4KBM B;  3M0U A;  4M7A B;  1XJW B;  2EYX A;  2I2L A;  5GMK m;  3THK A;  4DEY A;  4IUU A;  1MMA A;  1UEC A;  4QW2 A;  1D3B A;  2DX1 A;  4GY5 A;  3FIF A;  5GMK e;  5L8R E;  3CCJ T;  2A37 A;  5FW9 A;  3DB3 A;  2DTI A;  1OU8 A;  3FB9 A;  4LNP A;  2QYZ A;  4XTV A;  4M77 D;  1NEG A;  3H6Z A;  3PIP A;  4J9I A;  4B9X A;  3H9N A;  5FU6 C;  3J80 E;  4FSX A;  2PVG B;  1BI1 A;  3QJ6 A;  2KY9 A;  1VQ8 A;  2DIQ A;  4PJJ A;  4PFZ A;  1YCY A;  1IGU A;  1X6G A;  4XTY A;  2PZ1 A;  5DLQ E;  2DIG A;  4IUQ A;  4QQD A;  4C8Q A;  5GMK l;  4N4H A;  1WQ7 A;  1ZSZ B;  1YJW A;  4M78 D;  2AT1 B;  2JOY A;  3VRY A;  5LJ3 h;  5HCK A;  2SEM A;  1V29 B;  2RMO A;  1CKB A;  3M53 A;  4PK4 A;  4PJO G;  3LW5 E;  3S3O A;  3R6N A;  2AHJ B;  2K57 A;  4GBQ A;  4II1 A;  4KT0 E;  4E7Z A;  1QKW A;  5GMK h;  1LVK A;  2ZPB B;  3M57 A;  5CVI A;  1VQ8 Q;  4M7A D;  1HYO A;  2FPF A;  4Y92 A;  4JLG A;  1RLP C;  5CKD A;  3EG2 A;  1SG5 A;  3I56 T;  3EGU A;  2VV5 A;  4OMF B;  1G2B A;  4BUG A;  4IUT A;  3GF5 A;  3OYK A;  3J7A F;  1VQL A;  2CGH A;  2ROT A;  1CSK A;  5GJV B;  1YJW Q;  5A0L A;  3OA6 A;  1IB8 A;  3H0F A;  1SSF A;  4C92 G;  2K5F A;  4BDY A;  3LH0 A;  1X6B A;  2FRW A;  5J3B A;  2XDB A;  2D6F A;  5IXF A;  1RAD B;  4B9W A;  4J5Y A;  1AD5 A;  1FXX A;  3QUI A;  1VUB A;  2PQW A;  2VXF A;  2P84 A;  3L1A A;  3M0S A;  3JSC A;  4MMK A;  3RMQ A;  2V8K A;  1M1F A;  2KT8 A;  3LLR A;  1VQP A;  3G4S A;  1KHI A;  3Q1J A;  1Q7Y C;  1RAC B;  2LMJ A;  2FEI A;  3PGG A;  4OMQ A;  4FT2 A;  2DYI A;  1QP3 A;  2KXD A;  1P92 A;  1YIT T;  4D8K A;  3H8Z A;  3HSB A;  2MYS A;  1UUE A;  2COW A;  2L89 A;  4HCZ A;  1K73 U;  2HQE A;  2M0O A;  2EQI A;  2KGT A;  2QQA A;  3VS0 A;  2O2O A;  4XK8 E;  1VYV A;  1I4K 1;  1K8A U;  2LT4 A;  1ARK A;  1TTH B;  4JS4 A;  1MND A;  1TH7 A;  3HFO A;  3OYG A;  1D0Y A;  1MMG A;  4MZP A;  2LRQ A;  1KQS S;  2CP3 A;  1OEB A;  2MWO A;  4C8Q F;  1G3T A;  1M90 C;  2LC4 A;  3KUF A;  5KYW B;  4TVR A;  4GLM A;  2L3Q A;  1S72 A;  3G4S Q;  2KSS A;  4J9E A;  5IH2 A;  1SEM A;  2V8I A;  2E10 A;  2HZY A;  2FPD A;  3CCL T;  1F1B B;  1X2K A;  1D09 B;  2M16 A;  1B34 A;  1YNZ A;  3M0P A;  1MGQ A;  2RN8 A;  2HBW A;  2HL5 C;  5GAM f;  4MDX A;  1K4U S;  2C0O A;  2VC8 A;  2VUB A;  4FL6 A;  4F7U B;  1PSF A;  1OPK A;  4N0A A;  1Y7X A;  1EFN A;  4Y91 A;  2GQI A;  3C95 A;  4DBQ A;  1FMV A;  1LPL A;  3PMI A;  2QA4 A;  1EZZ B;  1JJ2 S;  3MKD A;  1D1A A;  2YUP A;  4N4G A;  3M55 A;  4JJB A;  1TUG B;  1S72 Q;  4BAC A;  3CPF A;  1AWO A;  2J6F A;  4K11 A;  1VQ4 T;  4A4H A;  3EFO A;  3L2Z A;  1VQ7 T;  2BZY A;  1I81 A;  5J39 A;  4AFU C;  3GIB A;  1NYF A;  1K0S A;  3OBY A;  1N27 A;  1K9A A;  5A0G A;  2YLC A;  3JCM f;  5CKH A;  4ZN1 A;  1AEY A;  1IRE B;  2VVK A;  3I5S A;  4JRI A;  4M7D B;  3QWX X;  1IHW A;  3FC3 A;  2AKK A;  1ZA2 B;  2COY A;  2QTX A;  1M1K C;  2K3B A;  2DD5 A;  2QDL A;  1RAE B;  1G8X A;  3VUZ A;  3QDR B;  4KGV B;  3QKJ A;  1XTD A;  1C0M A;  2L3R A;  1TG0 A;  1SSH A;  2A0F B;  1BI3 A;  5GAN 2;  3EG9 A;  1Y71 A;  1AWX A;  1M2O A;  1EIF A;  3FRN A;  2J06 A;  3KBG A;  1QLY A;  1SPK A;  3JAM E;  2W0Z A;  1NJI R;  2RK2 A;  3L2U A;  5CCA A;  1JXM A;  1VQN A;  2EWN A;  1MHN A;  1HD3 A;  3I9Q A;  2ROL A;  2DAQ A;  2VGN A;  4C5E A;  3LWI A;  1OX9 A;  1M1G A;  2EGC A;  3M58 A;  1VQ5 T;  1Q86 U;  1MV3 A;  1Z9Z A;  2KR3 A;  4PLL A;  3JB9 F;  1AVZ C;  3OBW A;  3M9Q A;  1X75 C;  1MNE A;  2M9U A;  4Z8A A;  1AOJ A;  1D0Z A;  2CP5 A;  2P4R A;  1Y96 B;  1Q82 C;  2MI6 A;  1XNI A;  4WTO B;  4LXC A;  1IXD A;  3A8M B;  3G71 T;  1VQ4 A;  4OGE A;  3MHX A;  1I5L A;  4ZGD B;  3CCL Q;  1VQ7 A;  4R0K A;  3P8D A;  3EGX B;  3CCM A;  2DM1 A;  3BY7 A;  1JEG A;  2LNH B;  4XTZ A;  1RAG B;  2CP0 A;  3P8H A;  2COZ A;  1VQN Q;  5IT9 E;  4IIO A;  2JTF A;  1KQS A;  2CRE A;  2KRM A;  1VQ9 A;  4M7D D;  4A4K A;  3L2Q A;  1WFW A;  4J7I A;  1RAA B;  2K3X A;  1VYT A;  1M8M A;  1NYG A;  1YJN T;  5L23 A;  4J6W A;  1V76 A;  1WQW A;  2JJ9 A;  3T9N A;  4JRQ A;  1W1F A;  2R5M A;  1GBR A;  1OZ2 A;  4NOY A;  2LQW A;  5I22 A;  2AKL A;  3G6E T;  2DRM A;  3EFS A;  2RQW A;  4FM4 B;  3JCM c;  3LH5 A;  5GAO r;  3UPU A;  2OTJ T;  2MPX C;  3GPL A;  4C8Q G;  4J9G A;  2BZX A;  1N9R A;  1VQ4 Q;  2NUP A;  5LJ5 d;  2A28 A;  1M27 C;  1SKU B;  2EJG A;  1VQ7 Q;  5HK0 A;  3CCM Q;  5GMK i;  3X24 B;  4BB7 A;  2LX7 A;  4ZNX A;  2O4X A;  1CKA A;  2X4Y A;  3LWH A;  5FRM A;  5EC7 A;  4ZGE B;  1QCN A;  2HKN A;  2OAU A;  3RUX A;  1QWE A;  1VQ9 Q;  5IXB A;  2DXC A;  1GL5 A;  2DBK A;  2J6O A;  4PJO B;  3E2U A;  5CQX A;  1JJ2 A;  4EMK A;  1M2V B;  5LJ5 j;  3WVD B;  3G71 A;  2DJZ A;  3CD6 T;  1VQK T;  2R5A A;  3QJY A;  1PD0 A;  3CXC S;  1QVF S;  2NYS A;  1M30 A;  3X26 B;  2XG8 D;  4JJD A;  1RUW A;  3SHW A;  2RA2 A;  1W2B P;  1PM3 A;  1AZE A;  2QAZ A;  2YSQ A;  5D7U A;  2HD0 A;  2DBM A;  3QG1 A;  1KD1 C;  2LJ0 A;  3HHT B;  3EFR A;  3FLG A;  3H41 A;  1NLO C;  1KQ1 A;  4ANJ A;  3PIO A;  4C92 B;  2DKG A;  4A63 B;  2V1Q A;  4RTU A;  1UE9 A;  5GAN g;  2OTJ A;  3I5R A;  1I5O B;  1UJ0 A;  1U1S A;  5GJW B;  3G71 Q;  2R58 A;  3EH1 A;  2O9S A;  1KC8 C;  3EHR A;  4M77 C;  2XK0 A;  3GOX A;  2JS0 A;  4E7H A;  3M5A A;  3CCR A;  3FEO A;  2O9V A;  4JDS A;  3M0T A;  3NPF A;  1SF9 A;  2GNC A;  3PVL A;  1H92 A;  2KVQ G;  2ZCF B;  4YTL A;  2MK5 A;  1D1C A;  2YT6 A;  1WHG A;  4PJO D;  1WHL A;  1ZUK A;  1SHG A;  5KYU B;  1U8R A;  2RHU A;  4E7L A;  3S3M A;  3AT1 B;  4J6X A;  3PMT A;  3EG3 A;  2DXU A;  2NUT A;  1OOT A;  1KHC A;  4E47 A;  4M78 C;  3JCM P;  3VS1 A;  1Q7Y U;  3QPH A;  3SWN B;  2OTJ Q;  3JB9 G;  2QEX T;  1X6O A;  1JU5 C;  2DL8 A;  1E7O A;  3UAT A;  5KCH A;  5J26 A;  4J9H A;  3OMG A;  2KYM A;  1NE8 A;  4OGC A;  1G5V A;  5I11 A;  2BUD A;  2LT1 A;  4EIK A;  1QW1 A;  2RQR A;  3CCR Q;  3CC7 A;  2DL7 A;  2MCN A;  2DRK A;  2QG9 B;  3CPW P;  1VQ8 T;  4MZM A;  4C92 D;  1YCS B;  1QVG P;  3PVQ A;  1M90 U;  1N8R R;  2CH4 A;  1BBZ A;  3U23 A;  2J7I A;  3SB2 A;  4EMH A;  3JCM J;  2ZPE B;  3QBY A;  3QHS A;  2YRC A;  1UGQ B;  4KGX B;  3FJP A;  3JCM Q;  1PRL C;  4FYW B;  2WSE E;  5C0M A;  3CBO A;  3GNF B;  1JB0 E;  2YLB A;  2RNA A;  2DEQ A;  1X2Q A;  3CC7 Q;  2YUN A;  2QQ9 A;  4CRI A;  3RR6 A;  1KIK A;  4CC3 A;  3LGF A;  3UWN A;  1TOV A;  4IUP A;  3M0R A;  3CMA A;  2JMA A;  1LCK A;  1G3W A;  2LP5 A;  3SEM A;  1UHC A;  2HQX A;  3CXC A;  1QVF A;  2ZZD A;  2RQU A;  2QEX A;  1WJQ A;  2LX9 A;  2CP2 A;  1ZSZ C;  2EJ9 A;  4RMO A;  3L2R A;  2G6F X;  3ASK A;  2D9T A;  1VQL T;  5ECA A;  4OB3 B;  1WXU A;  2VAS A;  2DZ9 A;  3NHN A;  2QGF B;  1Y07 A;  2RJF A;  3V8J A;  2PVD B;  1NM7 A;  4J9D A;  3L2W A;  2DD4 A;  2CDT A;  2VXE A;  1WPY A;  3CQT A;  3D7S B;  3UF4 A;  4BD3 A;  1KG1 A;  3N5B B;  3C94 A;  2MF2 A;  4MML A;  5EG2 A;  1J3T A;  1W70 A;  1M1K U;  2JTE A;  3M0Q A;  2O88 A;  2E64 A;  3OYH A;  4PNO A;  1UG1 A;  3OYD A;  2RI3 A;  4FT4 A;  4WCI A;  5A0D A;  1NPP A;  1M3C A;  2X3X D;  1HXD A;  1PD1 A;  4CC7 A;  2D0N A;  1VQP T;  3RES A;  2QEX Q;  3G4S T;  3QO3 A;  4JLI A;  1BIB A;  2IPO B;  4RTZ A;  2CZ7 B;  3C4S A;  4PLI A;  2CT4 A;  4QVD A;  1K9M C;  2D1X A;  5LJ5 h;  3VRZ A;  1NEB A;  2EQJ A;  1H3Z A;  1NPR A;  4HKE A;  5GAN 6;  4ELY C;  1D3B B;  2DA9 A;  5GAN 7;  1Z9Q A;  2EFI A;  2RHZ A;  1R77 A;  2F2V A;  1K9M R;  3BW1 A;  3P8B B;  3JRZ A;  1M4Z A;  2XKO C;  3OSV A;  3EGD A;  3VKI A;  4D8D A;  3BDL A;  1ZSG A;  4RTT A;  4AFZ C;  5GAM j;  1Q81 R;  2FRY A;  2JW4 A;  3JCM X;  2LNV A;  2M51 A;  3OW2 P;  5FU6 B;  1Q82 U;  4GLK A;  2EW3 A;  5AT1 B;  3JCM d;  1S72 T;  2CT3 A;  3HFN A;  2C0T A;  2EGE A; 
#chains in the Genus database with same CATH homology
 3I56 Q;  2QEX Q;  1Q82 R;  3CCQ Q;  1VQ8 Q;  1K73 R;  1KC8 R;  3CCJ Q;  2QA4 Q;  3CXC P;  1VQM Q;  1QVF P;  2OTJ Q;  3CME Q;  3CC4 Q;  3CPW P;  1YIT Q;  1W2B P;  3CCU Q;  1Q81 R;  1VQ9 Q;  1VQN Q;  1YIJ Q;  1VQL Q;  1YJ9 Q;  1QVG P;  1NJI R;  1N8R R;  1KQS P;  2OTL Q;  1K8A R;  3OW2 P;  1VQ4 Q;  1Q7Y R;  1YJN Q;  1VQO Q;  3G71 Q;  1S72 Q;  1Q86 R;  1JJ2 P;  3CD6 Q;  1VQK Q;  3CCV Q;  3CC7 Q;  1VQ7 Q;  3CCM Q;  1YJW Q;  1YI2 Q;  3I55 Q;  1VQ6 Q;  1K9M R;  3CMA Q;  3CC2 Q;  3G4S Q;  3CCS Q;  1VQP Q;  1M1K R;  1YHQ Q;  3G6E Q;  3CCR Q;  1M90 R;  1VQ5 Q;  1KD1 R;  3CCE Q;  3CCL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...