4RTUA

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t96g/q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain T96G/Q128R mutant
rcsb
source organism Gallus gallus
molecule tags Protein binding, signaling protein
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtuA00
4RTWA 2M51A 1T0JA 2K7AA 1M3AA 1M8MA 2V1RA 4GBQA 2YUNA 3M0RA 3VS2A 2JM8A 3EG2A 3GBQA 4Z89A 2YDLA 2GTOA 4F16A 2CSQA 4X1VA 4CC7A 1HSQA 2FEIA 4ESRA 1QKXA 2L3QA 2K79A 2O9SA 1I1JA 2AKKA 1PHTA 1SRMA 1YWOA 1A0NB 4JJDA 3LH5A 3H41A 1E6HA 4JPBW 3UA7A 2W0ZA 2FPDA 2W10A 1WFWA 1BBZA 1YN8A 4DEXA 3U23A 2F2VA 1M3BA 2DNUA 2VWFA 1ZUUA 1K9AA 2GBQA 1SSHA 2J7IA 2RMOA 2KT1A 2D8JA 3EHRA 2HCKA 1IO6A 2O88A 2EKHA 2ROLA 2EW3A 1QLYA 1ZUKA 4KRTA 2LJ3A 2YUQA 2RQWA 2FRYA 3UA6A 1X2KA 1JXOA 5GJWB 3I5RA 1K0XA 2D0NA 1TG0A 1JU5C 2L3SA 1UTIA 1U06A 2KRNA 2KRMA 3KFVA 3VRZA 2J6FA 2KR3A 2P4RA 3IQLA 3TSZA 5IHNA 1AD5A 1E7OA 2EVRA 3I35A 4CC2A 3TVTA 2F2WA 1OOTA 4RUGA 4K11A 4JJBA 1CKBA 2LNHB 3A98A 3H0FA 2OAWA 1UFFA 4RTZA 2LJ0A 4ZNXA 3EHQA 2A28A 1VYVA 3REBB 3PVLA 4LNPA 3THKA 3PVQA 1GCQC 2DBMA 1HJDA 4RTTA 1PRLC 1YP5A 2DYBA 1GBRA 2ENMA 3M0PA 2LX7A 1X69A 2RPNA 2DF6A 2KNBB 4OMOA 4D8DA 1PKSA 3C0CA 4AFSC 2EGAA 3VS7A 2BZYA 2EYYA 4GLMA 2GNCA 1ABQA 2A36A 1GBQA 4J9GA 4J9FA 4EIKA 1ZLMA 2L2PA 1UHFA 2HSPA 4D8KA 2ROTA 1X27A 2YUPA 3EGUA 5GJVB 2KGTA 2DL4A 5L23A 2RF0A 1YNZA 1NEGA 2CT3A 5IXFA 2KE9A 1M3CA 2QDLA 1UJYA 2BZXA 3VS3A 4IIOA 3QWXX 3FJ5A 1NLPC 2AZSA 1TUDA 4E6RA 1H3HA 2DL5A 1AEYA 1K0SA 1FYNA 1W1FA 1FMKA 1QWEA 3VS1A 2EBPA 1RLQC 4J9CA 1EFNA 2O2OA 2VKNA 2JT4A 1BK2A 2I0NA 2KT8A 1GFCA 5IXBA 2D8HA 4HXJA 1NLOC 1NYFA 1NM7A 2O9VA 1BU1A 2PZ1A 1T3LA 2KROA 2DX1A 2DVJA 2PTKA 4Z8AA 1B07A 1OPKA 1VA7A 1NEBA 2DRKA 2DJQA 3VS6A 4AG2C 4FSSA 1PWTA 2CT4A 2RQRA 1T3SA 2O31A 2HBWA 1WA7A 2LQNA 2DM1A 2FG0A 1QCFA 4OMQA 1GCPA 2DE0X 2LMJA 5IH2A 1X43A 2A08A 4JJCA 2HDAA 2CDTA 1UJ0A 3RBBB 1TUCA 1S1NA 2JMCA 3UATA 1WXUA 2JW4A 1JXMA 2MOXA 2KRSA 1M27C 1WLPB 2D1XA 1U5SA 3SEMA 2NWMA 1UDLA 1WIEA 1YWPA 1JO8A 2EYZA 2X3WD 2DRMA 1QWFA 4A63B 4Y92A 1K76A 1RLPC 1BB9A 1ABOA 1PRMC 3M0UA 2G6FX 2OI3A 1HD3A 3M0TA 4AFQC 4F17A 1AWXA 4HCKA 1JEGA 1H8KA 4WCIA 3REAB 4CC4B 2JMAA 3H0IA 4J9IA 2ABLA 1WXTA 2KYMA 1B3QA 2VVKA 2FO0A 5ECAA 1X2QA 1WXBA 3H0HA 4OMNA 1AZEA 2CSIA 1WDXA 4JZ4A 1I07A 2L3PA 1GCQA 1KJWA 2LCSA 1OV3A 2K9GA 1I0CA 2C0TA 4ORZA 2GQIA 1KSWA 2ED0A 2KXCA 4AFZC 1AZGB 3RNJA 4RTUA 2J6KA 2CH4A 2KEAA 1NYGA 3ULRB 2RQTA 3ZL7C 2RQVA 1K4US 1ZX6A 2MCNA 2K3BA 2RNAA 2K6DA 1SEMA 1U3OA 1J3TA 1Y57A 2RN8A 5HCKA 4OMPA 3TSWA 1PNJA 1SPKA 2J05A 2DBKA 3R6NA 4J9HA 2FRWA 2E5KA 1JQQA 2GTJA 1ZSGA 4LUEA 4DEYA 1RI9A 5FWCA 1VYUA 4J9BA 2FPEA 1E6GA 2DA9A 4RTXA 1LCKA 2DILA 2LJ1A 5IHKA 2OJ2A 4F14A 4QT7A 2EYXA 1GFDA 4J9DA 1OEBA 1K1ZA 4JZ3A 2EQIA 2HEQA 1SRLA 3VS0A 3EG0A 1Y0MA 1RUWA 1UE9A 2M0YA 3I9QA 1MV0B 2XMFA 3VS4A 2GGRA 1XOVA 2ESWA 1UG1A 1T0HA 1UGVA 2JXBA 2LP5A 3NPFA 2YT6A 2LQWA 5I22A 4RTVA 3PE0A 4HVWA 2JTEA 2DMOA 4OMLA 1M30A 1VYTA 2J6OA 2A37A 4HVVA 1OPLA 2IIMA 2PNIA 2ECZA 5IHIA 1H92A 1N5ZA 3EG1A 2NUZA 4OMMA 2H8HA 4AG1C 3I5SA 3UF4A 3SHWA 1GRIA 2JM9A 1ARKA 2MIOA 3CQTA 1YCSB 3NHNA 1W6XA 2CUDA 2EGCA 1AVZC 1W70A 5I11A 1WYXA 1PKTA 2EGEA 2V1QA 1CKAA 2AK5A 1UECA 2CH4W 1AOJA 2BTTA 4M4ZA 1SHGA 2K2MA 3VRYA 3M0SA 3NGPA 5FW9A 5EC7A 4Z88A 1AWJA 4RTYA 2CREA 1AWWA 4AFUC 1MV3A 3O5ZA 1ZUYA 1UUEA 2EYWA 4IIMA 2LZ6B 4LN2A 5FWBA 1AWOA 2DL3A 2DL8A 1MUZA 2C0IA 2F2XA 1Z9ZA 2B86A 1QKWA 1SHFA 1Z9QA 2DL7A 1NG2A 2C0OA 2FPFA 1V1CA 1G83A 2BZ8A 2DLPA 3EG3A 2SRCA 2J06A 2EPDA 1GL5A 1ZBJA 4CC3A 3JV3A 2ED1A 1UHCA 2KBTA 3NMZC 1WI7A 3M0QA 2CUBA 4LUDA 1X6GA 2RQUA 3QWYA 2JS0A 2AZVA 2JS2A 4HVUA 2KYBA 2SEMA 3VS5A 4J9EA 1WX6A 1CSKA 1KFZA 2AKLA 2YSQA 2YUOA 2KXDA 4R0KA 2X3XD 4LE9A 1KIKA 1G2BA 1X6BA 2L0AA
chains in the Genus database with same CATH superfamily
3CBPA 4RTWA 5GMKj 4OMFB 2QI2A 2K7AA 2M02A 3G71A 2NUPA 4BI4A 3QDFA 1M8MA 5D6XA 4GBQA 2YUNA 4DBQA 2AT1B 4KUDK 4J7IA 4M75E 3GBQA 5KYYA 3HHTB 2RJEA 4F16A 1VQ6Q 2CSQA 1HSQA 4ESRA 1TTHB 3FLGA 2L3QA 4F7UB 2K79A 3MEVA 2FB7A 1OZ2A 1PHTA 1SRMA 1U1TA 1YWOA 1A0NB 3H41A 3UA7A 2FPDA 1WFWA 3RUXA 1YCYA 1XTDA 4DEXA 4FYVB 3UDCA 5GMKm 2MI6A 4PNOA 3M5AA 3GF5A 3V7SA 1SSHA 5HKCA 4ZN3A 5LJ5g 2DIQA 1ZUKA 5CR2A 3OSSC 1H641 5FU7C 1O75A 4JRKA 2XD0A 3OW2P 3JSCA 2DTOA 3OYMA 1UTIA 1U8RA 1C1AA 3JCMX 2YRDA 3NTKA 3QZ5B 3TSZA 4PJOC 1M4ZA 3PFSA 1VQPQ 3TVTA 1WPYA 3LLRA 4M7DA 3EGDB 2CP6A 1OOTA 2VASA 3EFOA 4K11A 2V8KA 4JJBA 2LNHB 1M90U 2QGGA 3RKYA 3RESA 5KCOA 3JCMf 4LNPA 1IGQA 4JRQA 2ENMA 1MHNA 3M0PA 5CKBA 3DLLA 4A4EA 3X20B 1ACMB 2RPNA 4FSXA 4M77C 4BACA 3EG9A 2KNBB 3G6EQ 4D8DA 4XAXB 2XDBA 3A8GB 2EGAA 1JBMA 2YLCA 1ABQA 4EIKA 2DXTA 1YFNA 2KSSA 2HSPA 3EGUA 2F69A 3META 1FMVA 4J6XA 2M16A 4IUUA 2RF0A 2QTVA 2DD5A 1NEGA 1VQKQ 1M3CA 2BZXA 4KGVB 2QEXQ 2RK1A 3WVEB 1MMNA 1JJ2A 4M7AG 1VQOQ 2P0KA 5FU6B 1TUDA 2DL5A 1K0SA 2XDDA 3VS1A 4PLIA 3M57A 2VUBA 4J9CA 1SG5A 1UGRB 1BIAA 4XTXA 1QCOA 4HCBA 2O2OA 2VKNA 5GAMh 2I0NA 2RJCA 2KT8A 3I56A 3FB9A 2CZ6B 1Y71A 2HL5C 1FWZA 1NLOC 2EAYA 2LQ8A 2PZ1A 3RKWA 4F7UA 2D6FA 2JVVA 4PJMA 4BI8B 1VA7A 1NEBA 2M0OA 2PVOB 1VQMT 2VV5A 3CPWS 3CD6T 3C95A 4PL6A 3VS6A 4M7AF 2MF2A 1QP2A 4A4FA 1T3SA 1EIFA 1Q86C 2CP5A 2DM1A 1QVFA 4IKFA 4QKUA 1QCFA 4E7HA 1IXDA 3MP6A 2LMJA 5IH2A 1S72T 2CDTA 3RBBB 4D6WA 1X01A 3M54A 2XDPA 2KRSA 4C92C 2L3RA 2NWMA 1KD1U 3CCMQ 1WIEA 1JO8A 3CCJT 2X3WD 2RI2A 1VQ4Q 3JCMh 1QVPA 4ZGJB 2DRMA 8AT1B 4Y92A 1K76A 4KH0B 4R55A 1ABOA 2YXYA 1D0YA 1PRMC 2CS7A 4JS4A 1VQMA 3M0UA 3CD6A 4C8QE 3FEOA 3V8JA 4AFQC 1N6AA 1AWXA 4HCKA 2MYSA 1H8KA 3M4GA 2DPPB 5GMKh 2JMAA 3EGDA 4J9IA 2DKGA 1S72A 4A53A 2KYMA 4PJOG 3JCMc 2OTJT 3QZ9B 4M77B 4M7AD 1X2QA 1K8AU 1WXBA 4OMNA 2CSIA 4HA8A 1G8XA 1WDXA 5HY6A 2JJ9A 2DYIA 1I0CA 3EFSA 3RNJA 2ATCB 3J81E 4RTUA 4RMOA 3JB9I 3J7AF 1XJWB 2HQEA 1QVGA 3ZL7C 1Q86U 3GIBA 2VB6A 4TVRA 1SEMA 2JNGA 5CQXA 4M77G 2CP3A 5GAOl 1QW1A 3CCLA 3OYJA 2OTJA 4PJOF 1Q86R 2E5KA 1SKUB 3V8KA 1ZSGA 4R56A 5GAN6 5FWCA 1NE8A 5CKFA 3M9QA 5FRNA 4M78C 3TREA 4RTXA 3QJYA 2RA2A 5IHKA 5GANd 2ZPHB 3GNFB 1X75C 4A4KA 3G7ZA 4Y28E 2MK5A 3CC2Q 1OQKA 4J9DA 2R57A 2EQIA 3VS0A 1KQSP 4N4IA 2XMFA 4JUVA 2RHXA 2M1HA 4M77F 4XTVA 1XOVA 1UG1A 2LNVA 1Q7YU 2CP0A 2NUTB 1RAGB 4HVWA 2JTEA 5LJ3j 1WZOA 1VYTA 5KE2A 1OPLA 2PNIA 3EG1A 4PJOD 2NUZA 3PMTA 2V26A 1YJ9T 4C92B 2R58A 3I5SA 3INZA 1YITT 2JM9A 4RG8A 1ARKA 2E6ZA 3NHNA 3M59A 3ASKA 5A2QE 2CUDA 4IUVA 2IVWA 1YI2Q 3MO8A 2P84A 4ZTFA 3G4SQ 1IRXA 1YIJT 1AOJA 2BTTA 1SHGA 4DQ2A 3I55T 1UGPB 3NGPA 4Z88A 2OTLQ 1QMCA 1R0CB 5CAIA 3QXEB 3URGA 4AFUC 2XICA 3UWNA 1ZUYA 1UUEA 3SFMA 3OS0A 4C92G 2X4JA 4ELZC 1W4SA 1AWOA 4ZTJA 2DL3A 2DL8A 2C0IA 2F2XA 2QYZA 1QKWA 4KULA 5FROA 5GAOq 4O5VA 2C0OA 3OYNA 2BZ8A 3E1SA 3EG3A 5HK0A 2EPDA 4E7JA 1UHCA 5FRMA 1PD1A 3OW2A 2X4WA 3M0QA 1YIJA 4M77A 2QTXA 4L59A 4LUDA 3JAME 2RQUA 3I55A 3GPLA 2AZVA 4PJLA 4PFPA 2KYBA 2PU9B 1WX6A 4QW2A 3RMQA 5L8RE 5CO7A 1V76A 4C92F 2AKLA 2YSQA 3JCMP 2KXDA 2VXEA 1N9SA 3EGXB 4R0KA 2HAXA 4WF2A 5J3BA 3QBYA 3VS7A 5LJ3g 4M78B 3CC4T 4OB2B 4BUGA 1D3BB 2LVMA 2V1RA 4OVAA 4MZMA 3BDUA 2JM8A 2P4TA 4Z89A 2RH2A 3DB4A 4X1VA 1NJIC 2BE9B 2WSEE 2LQKA 2O9SA 4RCBA 3A8MB 2AKKA 5GAN3 4JDSA 4LDYA 3CCVT 1BBZA 1YN8A 1VQ9T 4M78G 4FT2A 4NL2A 3CCRT 1Q82C 5GANj 5KE3A 3CCJQ 3CC4A 1ZUUA 2KVQG 2RJFA 3OMCA 4E47A 1VQ5T 2CGHA 2KT1A 3EHRA 1IO6A 1P92A 3ER0A 2EKHA 2HL3A 2ROLA 2ZZDA 2YUQA 2COWA 4LD9K 1K73U 2NUTA 2FRYA 3UA6A 1VQLQ 3SD4A 1PD0A 3BE3A 5GJWB 1I5OB 3PIOA 2GFAA 2QG9B 3EH1A 4ME7A 1YJWT 2LTOA 1U06A 1VQ9A 2KR3A 2YWWA 4M78F 4C92A 3JB9J 3TU4K 2K4YA 4C5HA 1AD5A 3CCRA 3OYGA 3VKIA 3BW1A 3I35A 1OI1A 4CC2A 3OYBA 4BDYA 4RUGA 1VQ5A 3PMIA 5CKEA 4MMKA 4Y91A 3CCST 4N0AA 1VQ8T 3R6OA 3CMEA 3EHQA 1RAIB 1NJIU 2A28A 3CXCP 2GFUA 1PC0A 2DXCA 3VUZA 2DBMA 4XTWA 2CP7A 1YBYA 1PRLC 3CCQT 4C0DB 2DYBA 4FYYB 3E9GA 4LDVA 4M75C 1YJWA 4C5IA 2LX7A 1NJIR 2MMPA 1RADB 2QA4Q 1AT1B 1OX9A 5GMKi 2DF6A 2DIGA 2E5QA 3FJPA 4NL3A 4OMOA 1Q82U 1OYXA 5IN1A 2BZYA 2X4XA 4C0GA 1GBQA 1M2VB 3A5ZB 4J9GA 3HFOA 2L2PA 1UHFA 1G3SA 2ROTA 1Q82R 2DL4A 5GAN7 2CYZB 1VQ8A 2DTIA 3HRTA 4KBMB 4C5GA 2EJGA 3JCMJ 5GAOm 5LJ3h 1UJYA 3VS3A 4IIOA 2FZCB 3CCQA 2E65A 3JB9G 1WHJA 2X4YA 1MMGA 1M90C 1W2BP 5A0LA 3FJ5A 1VIEA 4KH1B 3EGXA 4E6RA 1H3HA 5FU6C 1AEYA 3DKMA 1RLQC 3GNGA 4M78A 3QUIA 4RCCA 3OS1A 1D3BA 2JT4A 5GAMe 4QQ6A 1U1SA 1GFCA 3OYLA 1YJ9Q 2D8HA 1YITQ 1KHCA 1OU8A 2KROA 2DX1A 2DVJA 3OS5A 2PTKA 5GAMf 2E41A 1B07A 2DETA 3JB9F 2DRKA 2WSFE 3QG1A 4F7UG 4M7DD 4AG2C 2KI7A 1G3TA 1PWTA 3ZFJA 2O31A 3CMAQ 1WA7A 1Y07A 3RERA 3HTRA 2K5LA 3MCAB 1YJNQ 1Q81C 2DAQA 3QSUA 3PT9A 1X43A 3EAEA 2L8DA 2H3JA 1TUCA 3ME9A 1M8VA 2BE7D 3UATA 1WXUA 4N4HA 2YRVA 1VUBA 2C06A 3HPWA 3KBGA 2DFUA 4DBHA 3JCMe 1N9RA 2HQXA 1M9SA 3BFMA 4RKUE 3OA6A 4DA4A 1KQSA 1RLPC 1BB9A 2QAZA 3C94A 4F7UF 3LWHA 5KYNA 4F17A 2EQMA 3CC7A 5GMKe 4OB3B 3V7RA 1M90R 2LT1A 2EKOA 2RK2A 3H0IA 4M75B 4FCYA 1K9MU 3JB9D 2FO0A 5ECAA 2MPXC 4JZ4A 1I07A 4E7LA 4CI0C 1KJWA 3CC4Q 1OV3A 3CBMA 4B6MA 3JCMb 2F1LA 3HFNA 2C0TA 5D6YA 4ORZA 3VJPA 5A0GA 2ED0A 3QYGB 4C0FA 3FDRA 3I56T 2J6KA 4JLGA 3ULRB 4ZN1A 1M1KU 1M5Q1 1KD1C 4M75G 2K3YA 3F70A 2MCNA 4J6YA 3WVDB 4PJOE 2K6DA 1Q81U 1U3OA 1J3TA 1EX4A 1M2VA 2RN8A 5HCKA 4BB7A 1SPKA 3BY7A 3R6NA 3CCVQ 5LL6S 1Q81R 1OX8A 3PGGA 1VYUA 3MHXA 3LX7A 1RABB 4HCCA 3LWIA 4DBFA 2KDSA 3QIIA 2DZ9A 1K8AC 3L2QA 1GFDA 2A7YA 3M53A 2HEQA 3O8VA 3MKDA 4M75F 1I8FA 2M0YA 4HT9A 1UGSB 1MV0B 6AT1B 4BE1A 3OQ5A 2RB6A 5LJ5h 1T0HA 1UGVA 2LP5A 5I22A 4RTVA 1N27A 3A8OB 2DMOA 2O01E 4B9WA 2QK0A 1VQ7Q 3EFRA 4C5EA 4HVVA 4MDWA 1H92A 1Y96B 2PVGB 1PSFA 3CCSQ 1VQ8Q 5KYWB 3QDRB 1GRIA 3OYDA 2MIOA 1WHHA 1Y7XA 5AT1B 3G71Q 2EGCA 1AVZC 4BE2A 2HKNA 1PKTA 2RM4A 1KD1R 1UECA 4N0AC 1F1BB 2DXBA 2LRQA 2GF7A 3M0SA 3E19A 3MP1A 2CREA 2BIVA 1MV3A 4CRIA 4IUQA 2DD4A 3CCET 3CCLT 4JLIA 2EYWA 4IIMA 1RI0A 2LZ6B 4LN2A 5FWBA 4BY6B 1MUZA 1Q7YC 1KHIA 1Z9ZA 1B7TA 3VUBA 1NG2A 3BDLA 4FW2A 1WJQA 1VOMA 2ZPEB 2KK4A 2SRCA 1K8AR 1GL5A 2Y4XA 4M75A 1LPLA 4CC3A 3L2WA 4JJNK 3NMZC 2EJ9A 3SWNC 1I81A 1X6GA 3QWYA 1RAHB 2SEMA 3M56A 3VS5A 1YHQA 4RG2A 3CCEA 1JJ2S 3MJXA 5CKHA 4LD6A 3X25B 4LE9A 2L0AA 2A0FB 3JCMW 1T0JA 2RHZA 3CPWP 2EQKA 1M3AA 1WQ7A 4ANJA 3CXCA 3KXTA 4QVZA 1HYOA 1MGQA 5FLXE 3VS2A 5I21A 2HMAA 4EMKC 2GTOA 1H3ZA 2XI9A 2FEIA 1QKXA 1I1JA 4PJJA 2QQSA 4JJDA 3LH5A 4C8QB 2W0ZA 2W10A 4LXCA 2F2VA 3M55A 1M3BA 1BCOA 2DNUA 5HK3A 4BE0A 1IREB 1QVFS 2VWFA 1RAEB 4LDUA 2HNIA 4XTYA 1Q7YR 3JCMV 2HCKA 2O88A 2EW3A 3L2ZA 3OBYA 3J80E 3H9NA 2EIFA 1VQ6T 2DZCA 5GAMd 1W2BA 2PQWA 4L6V5 3CCUA 3I5RA 1K0XA 1O9SA 1Q95G 1ZA1B 2D0NA 4FM4B 1TG0A 2DJZA 2L3SA 3L1AA 3A8HB 1JRIA 4XQ3A 1Y96A 3KFVA 2P4RA 3IQLA 5CKDA 2E12A 3LGLA 4OF1A 5IHNA 5KYWA 3OSVA 3X26B 2EVRA 4KT0E 2F2WA 2MAMA 3RKXA 2ZAEA 4M77D 2JZ2A 3A98A 3H0FA 3VYGA 2OAWA 2K3XA 3I56Q 4RTZA 2LJ0A 2DVEA 5GAN5 1VQ6A 1MNEA 1UB4A 1OULA 3MPUB 3REBB 2QQAA 2OX7A 3THKA 3PVQA 2COYA 2L5QA 1XQHA 2CZ1B 3NTHA 1HJDA 1RL2A 1ZA2B 1YP5A 1TUGB 3SWNB 4C0DC 3GLXA 1X69A 3JCMd 5GAN2 1K73C 1QVGS 4AFSC 1OZ3A 4MDXA 2GNCA 3H8ZA 2A36A 1IB8A 4J9FA 4M7DE 3N5BB 2YUPA 1X27A 3FC3A 2KGTA 2AIRB 1YNZA 3M58A 4E7IA 3QJ6A 1UEBA 5LJ3e 5J39A 5IXFA 2HZYA 2KE9A 2JOYA 3S3OA 4EMKB 1VQMQ 3QWXX 5KYYB 3CD6Q 2AZSA 2JTFA 4FL6A 5LJ3f 1FYNA 1QWEA 1VQPA 4Q5WA 4ZGEB 1EFNA 1S72Q 5DLQE 1SF9A 4IUPA 3OYCA 5IXBA 2YHTA 4HXJA 3UT1A 1NYFA 3RMSA 3X24B 1BU1A 1T3LA 4DOWA 1AHJB 3EH2A 2HKQB 4Z8AA 4E7ZA 2QEXT 4C92D 1OPKA 1TSFA 4C8QA 3OMGA 4PJNA 2DJQA 4A4GA 3CMET 1R77A 1WNLA 2CT4A 3G6EA 2RQRA 2R5MA 2PVDB 5GAOn 2LQNA 2FG0A 4LDXA 4OMQA 2DE0X 2HQHA 2A08A 4JJCA 2HDAA 5KYXB 1UJ0A 1K73R 2DO3A 3CCLQ 1S1NA 2OTJQ 2JW4A 2P0PA 2VYTA 2MOXA 2NLUA 1M27C 2D1XA 1U5SA 3SEMA 3FRNA 1UDLA 4Z02A 1IHWA 3RR6A 1N8RU 1VQKA 4MZTA 2E70A 1LJOA 1QWFA 4F7UE 2QEXA 5GAMj 2X35A 1VQOA 3OBWA 1KC8U 1C0MA 1NZ9A 1PCXA 2G3RA 4OP0A 2IG0A 4OB0B 2EFIA 1R0BG 3OW2S 5GAN8 5CIUA 1M2OA 4FW1A 2D0QB 2P0QA 4QVCA 3H0HA 1AZEA 5CCAA 1C6VX 3CCMT 2L3PA 1GCQA 2LCSA 1VQ4T 3AHUA 2FZGB 4DOVA 3SWNA 1AZGB 3P8HA 1MMAA 1RAFB 4M78D 2M9UA 3TEEA 4KGZB 5GANg 3S3NA 2K2VA 1QP3A 2KQWA 5GAOr 4L5GA 2RNAA 5A0DA 3ZEHA 2J05A 2FL7A 4LUEA 3L2UA 3CCMA 2CZ0B 4J9BA 1VQ4A 7AT1B 3A1PA 2DA9A 3QKJA 1K9MC 1QCNA 2E64A 4A54A 4F14A 1BI0A 3MP8A 4JRIA 4QT7A 3P8BB 4EMKA 2F5KA 2EYXA 4JZ3A 2EQUA 5GAOp 2E3HA 1RUWA 4KGXB 4M7AE 1M1FA 3VS4A 5GAMg 2GGRA 2E4HA 3OS2A 5LJ5e 3S6WA 2K57A 1MMDA 4PK4A 3QYHB 2FZKB 1YIJQ 4HKEA 4GLKA 1M1KC 3PE0A 3I55Q 3CC7T 2JN0A 3TCJA 8ATCB 4OMLA 4PFZA 1M30A 5M9OA 3KUFA 5LJ5f 3L2RA 2ECZA 5IHIA 1N5ZA 2LCLA 3CPWA 1D0XA 3CC2T 1WQWA 2E6NA 3SHWA 2LX9A 3OYEA 1W6XA 2X51A 1NPPA 1W70A 3L42A 1WYXA 5EG2A 3OYKA 2R5AA 2V1QA 1CKAA 2AK5A 5KYXA 4M4ZA 4VUBA 3MEWA 4AMCA 2Y90A 3JCMg 1AWWA 3C12A 4ZGDB 4F04B 3VYHB 2QQ9A 1FX7A 4IUTA 3PNWC 4FYWB 4B9XA 4XU0A 4BY6C 4O6JA 3CC2A 4PKCC 3DB3A 2ZCFB 3TQ7P 1HK9A 1K9MR 2DL7A 2FPFA 2YRCA 2E3IA 4DBRA 1V1CA 2DLPA 2GCXA 4GY5A 1YI2T 2J06A 2ED1A 2KBTA 2EWNA 3G4ST 3V7CA 2JUFA 3D7SB 3CEYA 4EMHA 4X9CA 2HD0A 2JS0A 4M7AB 2VC8A 2JS2A 2XU8A 3X28B 4JS5A 2OTLT 4HVUA 5GANh 2MWOA 3LYIA 2I2LA 4WTOB 2RJDA 4FT4A 1FMWA 1BCMA 1M1KR 5KYUB 2E10A 1VQ9Q 1PG5B 2MWPA 2X3XD 1WJSA 1G2BA 1VQNT 3FIFA 3CCRQ 1ZQ1A 5I2SA 2M51A 2GQVA 1XNIA 4MZPA 3RDVA 1VQ5Q 2AHJB 3SDZA 1YI2A 3RIRA 3M0RA 4EPCA 1TH7A 3EG2A 3QPHA 4E7SA 3G4SA 3H6ZA 3CMEQ 2YDLA 4IURA 5CVIA 4CC7A 4C0ZA 4M77E 2NYSA 4FU6A 2OTLA 1HXDA 3GOXA 2RO0A 1JB0E 3QO3A 1E6HA 4JPBW 4C8QC 1YJWQ 4YTLA 5LJ3d 4HCZA 2B8AA 2FVUA 3U23A 3Q1JA 2XKOC 2X9HA 3QHSA 1VQNA 2H3EB 4II1A 3MEAA 2A3LA 1K9AA 2GBQA 2J7IA 4X9DA 2RMOA 2D8JA 3HRUA 1ZHIA 3DLMA 4NOYA 5DM7R 2WACA 1QLYA 4KRTA 2LJ3A 2RQWA 5FU7B 2COZA 1X2KA 1JXOA 2EJFA 3E2UA 4UC4A 3GP8A 4HT8A 3HSBA 5J26A 1JU5C 3CCQQ 2FHDA 1KQSS 2KRNA 2KRMA 3VRZA 2J6FA 2XHCA 4PJOB 5CK9A 1E7OA 4M75D 3T9NA 3HP9A 1YHQT 5C6SA 4OGCA 1KK7A 1CKBA 2XIDA 1D1BA 3CPFA 1UFFA 3LH0A 4ZNXA 2K5IA 1VYVA 1VQLT 3PVLA 4ATOA 1GCQC 2ZPBB 4RTTA 4XTZA 1D0ZA 2VGMA 1GBRA 1WHMA 4J8OA 1WJRA 3PIPA 1BI1A 1TU0B 3SB2A 3VU3C 2EQJA 1PKSA 1B34B 3C0CA 4C92E 2DEUA 2EYYA 3CCJA 4GLMA 4QQGA 1ZLMA 2Z0WA 4D8KA 5GJVB 2HBPA 1ZSZC 5D6WA 5DY9A 5L23A 2FYKA 3S3MA 5KCHA 1VQLA 4JRPA 4BI3A 2V8JA 4M7AA 2CT3A 2O4XB 2QDLA 1G5VA 2LDMA 3OB9A 2QXFA 1I4K1 1WHGA 1X6OA 5KYUA 2QA4T 1OU9A 1NLPC 2LT4A 2KY9A 2L89A 3CC7Q 1W1FA 1FMKA 3CCUT 3OY9A 1KQ2A 2EBPA 2VGNA 3A8LB 1BI2A 1BK2A 5IAYA 2EYQA 2RHUA 1G3YA 5I2MA 3C4SA 4E2FB 2ZPIB 1NM7A 2V8IA 2O9VA 5GMKl 1LVKA 3P8DA 2XG8D 3OYFA 1NBEB 1BYMA 1V29B 2QA4A 4A4HA 2DK3A 4FSSA 3E9FA 1KG1A 4XU2A 1MNDA 1PM3A 4C8QG 2LC4A 2HBWA 4QQDA 1WHKA 2JTMA 1BKBA 2DXUA 1GCPA 4M78E 1BIBA 4EDUA 2JMCA 2ZPGB 1KQ1A 1BI3A 1JXMA 3V8LA 1WLPB 2K5FA 5LJ5d 2KAFA 1YWPA 2EYZA 1SSFA 1TWBA 4M7DC 5D7UA 4BDZA 2WSCE 4A63B 1ZBXA 2CP2A 4P5NA 2G6FX 2RD1A 2OI3A 1HD3A 3M0TA 4J6WA 2IPOB 2OAUA 3HRSA 3CMAT 4PJOA 1JEGA 2KMTA 1JJ2P 4C8QF 2XK0A 2LCCA 4WCIA 3REAB 1YJNT 4CC4B 3OYHA 2D9TA 2ABLA 2QQRA 1GXIE 9ATCB 1WXTA 1B3QA 2VVKA 3VV0A 3M4YA 4ELYC 1YJ9A 4E7KA 2RHYA 1YITA 1VQNQ 1VQPT 3JCMQ 1M1GA 5DLOA 2K9GA 4XU3A 2QGFB 1ZSZB 1KSWA 2GQIA 2KXCA 4EMGA 4PFOA 4AFZC 2CH4A 2KEAA 1NYGA 2VXFA 2RQTA 2ZPFB 3NTIA 4FYXB 2HSEB 3CMAA 1K4US 1D09B 2RQVA 4FIBA 1B34A 1ZX6A 2NUPB 1N8RC 2K3BA 1YJNA 1Y57A 3CXCS 4OGEA 4OMPA 3TSWA 1PNJA 2DBKA 3AT1B 4J9HA 2FRWA 1QVFP 3CBOA 1JQQA 3G6ET 2GTJA 2RI5A 4DEYA 4QVDA 1RI9A 2QDYB 1KC8C 5C0MA 2BKDN 4AT1B 4C8QD 2FPEA 1E6GA 2O4XA 2DTHA 2Y4YA 1LCKA 1LNXA 2QASA 2DILA 3OYIA 2LJ1A 2OJ2A 5AYFA 2BUDA 1OEBA 1K1ZA 4BD3A 1SRLA 4XU1A 3L2VA 3EG0A 1Y0MA 1VQKT 1UE9A 3I9QA 2ZGWA 4J83A 2ESWA 1I5LA 2JXBA 3NPFA 2YT6A 1VQOT 2LQWA 4V2SA 3LGFA 1DJ7B 1W2BS 1EZZB 2DERA 2J6OA 2A37A 4N4GA 3ZBDA 2IIMA 1YHQQ 1VIFA 3UPUA 1IGUA 1NPRA 3CCEQ 3MEUA 1FXXA 2CKKA 3HKSA 4OMMA 2H8HA 2RI3A 4AG1C 1RACB 3UF4A 2PUOB 3CQTA 1YCSB 1R8OB 4M7DB 1UGQB 3NFCA 2PUKB 3JB9H 3EFOB 5I11A 2F5TX 2EGEA 3HL8A 1QVGP 4X34A 1TOVA 3CCVA 2CH4W 1N8RR 2QQBA 4LDWA 2K2MA 3VRYA 4XTUA 5FW9A 5EC7A 4OB1B 4PLLA 1AWJA 4RTYA 1VQ7T 1G3WA 3O5ZA 3WXMB 3LW5E 4J5YA 1TXQA 2E1HA 5LJ5j 1KC8R 3OYAA 2RHIA 3EG9B 4M7DG 2CZ7B 2B86A 1SHFA 1TS9A 1Z9QA 1PSEA 3OYYA 3G71T 1G83A 5GAN4 1LOJA 1ZBJA 4MMLA 3JV3A 5KH6A 1RAAB 3PTAA 1WI7A 1IZ6A 2DEQA 2CUBA 4J7FA 1QQJA 1WHLA 5GANe 3CCUQ 5CQYA 4M7AC 1VQ7A 4XK8E 5IT9E 3G1JA 4J9EA 4KUIA 1CSKA 1KFZA 1ZSZA 2YUOA 1D1CA 3JRZA 4NS5A 3CCSA 1D1AA 1KIKA 5GANf 4M7DF 2YLBA 1WGSA 1X6BA 1IHVA
chains in the Genus database with same CATH topology
4RTWA 2M51A 1T0JA 2K7AA 1M3AA 1M8MA 2V1RA 4GBQA 2YUNA 3M0RA 3VS2A 2JM8A 3EG2A 3GBQA 4Z89A 2YDLA 2GTOA 4F16A 2CSQA 4X1VA 4CC7A 1HSQA 2FEIA 4ESRA 1QKXA 2L3QA 2K79A 2O9SA 1I1JA 2AKKA 1PHTA 1SRMA 1YWOA 1A0NB 4JJDA 3LH5A 3H41A 1E6HA 4JPBW 3UA7A 2W0ZA 2FPDA 2W10A 1WFWA 1BBZA 1YN8A 4DEXA 3U23A 2F2VA 1M3BA 2DNUA 2VWFA 1ZUUA 1K9AA 2GBQA 1SSHA 2J7IA 2RMOA 2KT1A 2D8JA 3EHRA 2HCKA 1IO6A 2O88A 2EKHA 2ROLA 2EW3A 1QLYA 1ZUKA 4KRTA 2LJ3A 2YUQA 2RQWA 2FRYA 3UA6A 1X2KA 1JXOA 5GJWB 3I5RA 1K0XA 2D0NA 1TG0A 1JU5C 2L3SA 1UTIA 1U06A 2KRNA 2KRMA 3KFVA 3VRZA 2J6FA 2KR3A 2P4RA 3IQLA 3TSZA 5IHNA 1AD5A 1E7OA 2EVRA 3I35A 4CC2A 3TVTA 2F2WA 1OOTA 4RUGA 4K11A 4JJBA 1CKBA 2LNHB 3A98A 3H0FA 2OAWA 1UFFA 4RTZA 2LJ0A 4ZNXA 3EHQA 2A28A 1VYVA 3REBB 3PVLA 4LNPA 3THKA 3PVQA 1GCQC 2DBMA 1HJDA 4RTTA 1PRLC 1YP5A 2DYBA 1GBRA 2ENMA 3M0PA 2LX7A 1X69A 2RPNA 2DF6A 2KNBB 4OMOA 4D8DA 1PKSA 3C0CA 4AFSC 2EGAA 3VS7A 2BZYA 2EYYA 4GLMA 2GNCA 1ABQA 2A36A 1GBQA 4J9GA 4J9FA 4EIKA 1ZLMA 2L2PA 1UHFA 2HSPA 4D8KA 2ROTA 1X27A 2YUPA 3EGUA 5GJVB 2KGTA 2DL4A 5L23A 2RF0A 1YNZA 1NEGA 2CT3A 5IXFA 2KE9A 1M3CA 2QDLA 1UJYA 2BZXA 3VS3A 4IIOA 3QWXX 3FJ5A 1NLPC 2AZSA 1TUDA 4E6RA 1H3HA 2DL5A 1AEYA 1K0SA 1FYNA 1W1FA 1FMKA 1QWEA 3VS1A 2EBPA 1RLQC 4J9CA 1EFNA 2O2OA 2VKNA 2JT4A 1BK2A 2I0NA 2KT8A 1GFCA 5IXBA 2D8HA 4HXJA 1NLOC 1NYFA 1NM7A 2O9VA 1BU1A 2PZ1A 1T3LA 2KROA 2DX1A 2DVJA 2PTKA 4Z8AA 1B07A 1OPKA 1VA7A 1NEBA 2DRKA 2DJQA 3VS6A 4AG2C 4FSSA 1PWTA 2CT4A 2RQRA 1T3SA 2O31A 2HBWA 1WA7A 2LQNA 2DM1A 2FG0A 1QCFA 4OMQA 1GCPA 2DE0X 2LMJA 5IH2A 1X43A 2A08A 4JJCA 2HDAA 2CDTA 1UJ0A 3RBBB 1TUCA 1S1NA 2JMCA 3UATA 1WXUA 2JW4A 1JXMA 2MOXA 2KRSA 1M27C 1WLPB 2D1XA 1U5SA 3SEMA 2NWMA 1UDLA 1WIEA 1YWPA 1JO8A 2EYZA 2X3WD 2DRMA 1QWFA 4A63B 4Y92A 1K76A 1RLPC 1BB9A 1ABOA 1PRMC 3M0UA 2G6FX 2OI3A 1HD3A 3M0TA 4AFQC 4F17A 1AWXA 4HCKA 1JEGA 1H8KA 4WCIA 3REAB 4CC4B 2JMAA 3H0IA 4J9IA 2ABLA 1WXTA 2KYMA 1B3QA 2VVKA 2FO0A 5ECAA 1X2QA 1WXBA 3H0HA 4OMNA 1AZEA 2CSIA 1WDXA 4JZ4A 1I07A 2L3PA 1GCQA 1KJWA 2LCSA 1OV3A 2K9GA 1I0CA 2C0TA 4ORZA 2GQIA 1KSWA 2ED0A 2KXCA 4AFZC 1AZGB 3RNJA 4RTUA 2J6KA 2CH4A 2KEAA 1NYGA 3ULRB 2RQTA 3ZL7C 2RQVA 1K4US 1ZX6A 2MCNA 2K3BA 2RNAA 2K6DA 1SEMA 1U3OA 1J3TA 1Y57A 2RN8A 5HCKA 4OMPA 3TSWA 1PNJA 1SPKA 2J05A 2DBKA 3R6NA 4J9HA 2FRWA 2E5KA 1JQQA 2GTJA 1ZSGA 4LUEA 4DEYA 1RI9A 5FWCA 1VYUA 4J9BA 2FPEA 1E6GA 2DA9A 4RTXA 1LCKA 2DILA 2LJ1A 5IHKA 2OJ2A 4F14A 4QT7A 2EYXA 1GFDA 4J9DA 1OEBA 1K1ZA 4JZ3A 2EQIA 2HEQA 1SRLA 3VS0A 3EG0A 1Y0MA 1RUWA 1UE9A 2M0YA 3I9QA 1MV0B 2XMFA 3VS4A 2GGRA 1XOVA 2ESWA 1UG1A 1T0HA 1UGVA 2JXBA 2LP5A 3NPFA 2YT6A 2LQWA 5I22A 4RTVA 3PE0A 4HVWA 2JTEA 2DMOA 4OMLA 1M30A 1VYTA 2J6OA 2A37A 4HVVA 1OPLA 2IIMA 2PNIA 2ECZA 5IHIA 1H92A 1N5ZA 3EG1A 2NUZA 4OMMA 2H8HA 4AG1C 3I5SA 3UF4A 3SHWA 1GRIA 2JM9A 1ARKA 2MIOA 3CQTA 1YCSB 3NHNA 1W6XA 2CUDA 2EGCA 1AVZC 1W70A 5I11A 1WYXA 1PKTA 2EGEA 2V1QA 1CKAA 2AK5A 1UECA 2CH4W 1AOJA 2BTTA 4M4ZA 1SHGA 2K2MA 3VRYA 3M0SA 3NGPA 5FW9A 5EC7A 4Z88A 1AWJA 4RTYA 2CREA 1AWWA 4AFUC 1MV3A 3O5ZA 1ZUYA 1UUEA 2EYWA 4IIMA 2LZ6B 4LN2A 5FWBA 1AWOA 2DL3A 2DL8A 1MUZA 2C0IA 2F2XA 1Z9ZA 2B86A 1QKWA 1SHFA 1Z9QA 2DL7A 1NG2A 2C0OA 2FPFA 1V1CA 1G83A 2BZ8A 2DLPA 3EG3A 2SRCA 2J06A 2EPDA 1GL5A 1ZBJA 4CC3A 3JV3A 2ED1A 1UHCA 2KBTA 3NMZC 1WI7A 3M0QA 2CUBA 4LUDA 1X6GA 2RQUA 3QWYA 2JS0A 2AZVA 2JS2A 4HVUA 2KYBA 2SEMA 3VS5A 4J9EA 1WX6A 1CSKA 1KFZA 2AKLA 2YSQA 2YUOA 2KXDA 4R0KA 2X3XD 4LE9A 1KIKA 1G2BA 1X6BA 2L0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTW A;  2M51 A;  1T0J A;  2K7A A;  1M3A A;  1M8M A;  2V1R A;  4GBQ A;  2YUN A;  3M0R A;  3VS2 A;  2JM8 A;  3EG2 A;  3GBQ A;  4Z89 A;  2YDL A;  2GTO A;  4F16 A;  2CSQ A;  4X1V A;  4CC7 A;  1HSQ A;  2FEI A;  4ESR A;  1QKX A;  2L3Q A;  2K79 A;  2O9S A;  1I1J A;  2AKK A;  1PHT A;  1SRM A;  1YWO A;  1A0N B;  4JJD A;  3LH5 A;  3H41 A;  1E6H A;  4JPB W;  3UA7 A;  2W0Z A;  2FPD A;  2W10 A;  1WFW A;  1BBZ A;  1YN8 A;  4DEX A;  3U23 A;  2F2V A;  1M3B A;  2DNU A;  2VWF A;  1ZUU A;  1K9A A;  2GBQ A;  1SSH A;  2J7I A;  2RMO A;  2KT1 A;  2D8J A;  3EHR A;  2HCK A;  1IO6 A;  2O88 A;  2EKH A;  2ROL A;  2EW3 A;  1QLY A;  1ZUK A;  4KRT A;  2LJ3 A;  2YUQ A;  2RQW A;  2FRY A;  3UA6 A;  1X2K A;  1JXO A;  5GJW B;  3I5R A;  1K0X A;  2D0N A;  1TG0 A;  1JU5 C;  2L3S A;  1UTI A;  1U06 A;  2KRN A;  2KRM A;  3KFV A;  3VRZ A;  2J6F A;  2KR3 A;  2P4R A;  3IQL A;  3TSZ A;  5IHN A;  1AD5 A;  1E7O A;  2EVR A;  3I35 A;  4CC2 A;  3TVT A;  2F2W A;  1OOT A;  4RUG A;  4K11 A;  4JJB A;  1CKB A;  2LNH B;  3A98 A;  3H0F A;  2OAW A;  1UFF A;  4RTZ A;  2LJ0 A;  4ZNX A;  3EHQ A;  2A28 A;  1VYV A;  3REB B;  3PVL A;  4LNP A;  3THK A;  3PVQ A;  1GCQ C;  2DBM A;  1HJD A;  4RTT A;  1PRL C;  1YP5 A;  2DYB A;  1GBR A;  2ENM A;  3M0P A;  2LX7 A;  1X69 A;  2RPN A;  2DF6 A;  2KNB B;  4OMO A;  4D8D A;  1PKS A;  3C0C A;  4AFS C;  2EGA A;  3VS7 A;  2BZY A;  2EYY A;  4GLM A;  2GNC A;  1ABQ A;  2A36 A;  1GBQ A;  4J9G A;  4J9F A;  4EIK A;  1ZLM A;  2L2P A;  1UHF A;  2HSP A;  4D8K A;  2ROT A;  1X27 A;  2YUP A;  3EGU A;  5GJV B;  2KGT A;  2DL4 A;  5L23 A;  2RF0 A;  1YNZ A;  1NEG A;  2CT3 A;  5IXF A;  2KE9 A;  1M3C A;  2QDL A;  1UJY A;  2BZX A;  3VS3 A;  4IIO A;  3QWX X;  3FJ5 A;  1NLP C;  2AZS A;  1TUD A;  4E6R A;  1H3H A;  2DL5 A;  1AEY A;  1K0S A;  1FYN A;  1W1F A;  1FMK A;  1QWE A;  3VS1 A;  2EBP A;  1RLQ C;  4J9C A;  1EFN A;  2O2O A;  2VKN A;  2JT4 A;  1BK2 A;  2I0N A;  2KT8 A;  1GFC A;  5IXB A;  2D8H A;  4HXJ A;  1NLO C;  1NYF A;  1NM7 A;  2O9V A;  1BU1 A;  2PZ1 A;  1T3L A;  2KRO A;  2DX1 A;  2DVJ A;  2PTK A;  4Z8A A;  1B07 A;  1OPK A;  1VA7 A;  1NEB A;  2DRK A;  2DJQ A;  3VS6 A;  4AG2 C;  4FSS A;  1PWT A;  2CT4 A;  2RQR A;  1T3S A;  2O31 A;  2HBW A;  1WA7 A;  2LQN A;  2DM1 A;  2FG0 A;  1QCF A;  4OMQ A;  1GCP A;  2DE0 X;  2LMJ A;  5IH2 A;  1X43 A;  2A08 A;  4JJC A;  2HDA A;  2CDT A;  1UJ0 A;  3RBB B;  1TUC A;  1S1N A;  2JMC A;  3UAT A;  1WXU A;  2JW4 A;  1JXM A;  2MOX A;  2KRS A;  1M27 C;  1WLP B;  2D1X A;  1U5S A;  3SEM A;  2NWM A;  1UDL A;  1WIE A;  1YWP A;  1JO8 A;  2EYZ A;  2X3W D;  2DRM A;  1QWF A;  4A63 B;  4Y92 A;  1K76 A;  1RLP C;  1BB9 A;  1ABO A;  1PRM C;  3M0U A;  2G6F X;  2OI3 A;  1HD3 A;  3M0T A;  4AFQ C;  4F17 A;  1AWX A;  4HCK A;  1JEG A;  1H8K A;  4WCI A;  3REA B;  4CC4 B;  2JMA A;  3H0I A;  4J9I A;  2ABL A;  1WXT A;  2KYM A;  1B3Q A;  2VVK A;  2FO0 A;  5ECA A;  1X2Q A;  1WXB A;  3H0H A;  4OMN A;  1AZE A;  2CSI A;  1WDX A;  4JZ4 A;  1I07 A;  2L3P A;  1GCQ A;  1KJW A;  2LCS A;  1OV3 A;  2K9G A;  1I0C A;  2C0T A;  4ORZ A;  2GQI A;  1KSW A;  2ED0 A;  2KXC A;  4AFZ C;  1AZG B;  3RNJ A;  4RTU A;  2J6K A;  2CH4 A;  2KEA A;  1NYG A;  3ULR B;  2RQT A;  3ZL7 C;  2RQV A;  1K4U S;  1ZX6 A;  2MCN A;  2K3B A;  2RNA A;  2K6D A;  1SEM A;  1U3O A;  1J3T A;  1Y57 A;  2RN8 A;  5HCK A;  4OMP A;  3TSW A;  1PNJ A;  1SPK A;  2J05 A;  2DBK A;  3R6N A;  4J9H A;  2FRW A;  2E5K A;  1JQQ A;  2GTJ A;  1ZSG A;  4LUE A;  4DEY A;  1RI9 A;  5FWC A;  1VYU A;  4J9B A;  2FPE A;  1E6G A;  2DA9 A;  4RTX A;  1LCK A;  2DIL A;  2LJ1 A;  5IHK A;  2OJ2 A;  4F14 A;  4QT7 A;  2EYX A;  1GFD A;  4J9D A;  1OEB A;  1K1Z A;  4JZ3 A;  2EQI A;  2HEQ A;  1SRL A;  3VS0 A;  3EG0 A;  1Y0M A;  1RUW A;  1UE9 A;  2M0Y A;  3I9Q A;  1MV0 B;  2XMF A;  3VS4 A;  2GGR A;  1XOV A;  2ESW A;  1UG1 A;  1T0H A;  1UGV A;  2JXB A;  2LP5 A;  3NPF A;  2YT6 A;  2LQW A;  5I22 A;  4RTV A;  3PE0 A;  4HVW A;  2JTE A;  2DMO A;  4OML A;  1M30 A;  1VYT A;  2J6O A;  2A37 A;  4HVV A;  1OPL A;  2IIM A;  2PNI A;  2ECZ A;  5IHI A;  1H92 A;  1N5Z A;  3EG1 A;  2NUZ A;  4OMM A;  2H8H A;  4AG1 C;  3I5S A;  3UF4 A;  3SHW A;  1GRI A;  2JM9 A;  1ARK A;  2MIO A;  3CQT A;  1YCS B;  3NHN A;  1W6X A;  2CUD A;  2EGC A;  1AVZ C;  1W70 A;  5I11 A;  1WYX A;  1PKT A;  2EGE A;  2V1Q A;  1CKA A;  2AK5 A;  1UEC A;  2CH4 W;  1AOJ A;  2BTT A;  4M4Z A;  1SHG A;  2K2M A;  3VRY A;  3M0S A;  3NGP A;  5FW9 A;  5EC7 A;  4Z88 A;  1AWJ A;  4RTY A;  2CRE A;  1AWW A;  4AFU C;  1MV3 A;  3O5Z A;  1ZUY A;  1UUE A;  2EYW A;  4IIM A;  2LZ6 B;  4LN2 A;  5FWB A;  1AWO A;  2DL3 A;  2DL8 A;  1MUZ A;  2C0I A;  2F2X A;  1Z9Z A;  2B86 A;  1QKW A;  1SHF A;  1Z9Q A;  2DL7 A;  1NG2 A;  2C0O A;  2FPF A;  1V1C A;  1G83 A;  2BZ8 A;  2DLP A;  3EG3 A;  2SRC A;  2J06 A;  2EPD A;  1GL5 A;  1ZBJ A;  4CC3 A;  3JV3 A;  2ED1 A;  1UHC A;  2KBT A;  3NMZ C;  1WI7 A;  3M0Q A;  2CUB A;  4LUD A;  1X6G A;  2RQU A;  3QWY A;  2JS0 A;  2AZV A;  2JS2 A;  4HVU A;  2KYB A;  2SEM A;  3VS5 A;  4J9E A;  1WX6 A;  1CSK A;  1KFZ A;  2AKL A;  2YSQ A;  2YUO A;  2KXD A;  4R0K A;  2X3X D;  4LE9 A;  1KIK A;  1G2B A;  1X6B A;  2L0A A; 
#chains in the Genus database with same CATH topology
 3CBP A;  4RTW A;  5GMK j;  4OMF B;  2QI2 A;  2K7A A;  2M02 A;  3G71 A;  2NUP A;  4BI4 A;  3QDF A;  1M8M A;  5D6X A;  4GBQ A;  2YUN A;  4DBQ A;  2AT1 B;  4KUD K;  4J7I A;  4M75 E;  3GBQ A;  5KYY A;  3HHT B;  2RJE A;  4F16 A;  1VQ6 Q;  2CSQ A;  1HSQ A;  4ESR A;  1TTH B;  3FLG A;  2L3Q A;  4F7U B;  2K79 A;  3MEV A;  2FB7 A;  1OZ2 A;  1PHT A;  1SRM A;  1U1T A;  1YWO A;  1A0N B;  3H41 A;  3UA7 A;  2FPD A;  1WFW A;  3RUX A;  1YCY A;  1XTD A;  4DEX A;  4FYV B;  3UDC A;  5GMK m;  2MI6 A;  4PNO A;  3M5A A;  3GF5 A;  3V7S A;  1SSH A;  5HKC A;  4ZN3 A;  5LJ5 g;  2DIQ A;  1ZUK A;  5CR2 A;  3OSS C;  1H64 1;  5FU7 C;  1O75 A;  4JRK A;  2XD0 A;  3OW2 P;  3JSC A;  2DTO A;  3OYM A;  1UTI A;  1U8R A;  1C1A A;  3JCM X;  2YRD A;  3NTK A;  3QZ5 B;  3TSZ A;  4PJO C;  1M4Z A;  3PFS A;  1VQP Q;  3TVT A;  1WPY A;  3LLR A;  4M7D A;  3EGD B;  2CP6 A;  1OOT A;  2VAS A;  3EFO A;  4K11 A;  2V8K A;  4JJB A;  2LNH B;  1M90 U;  2QGG A;  3RKY A;  3RES A;  5KCO A;  3JCM f;  4LNP A;  1IGQ A;  4JRQ A;  2ENM A;  1MHN A;  3M0P A;  5CKB A;  3DLL A;  4A4E A;  3X20 B;  1ACM B;  2RPN A;  4FSX A;  4M77 C;  4BAC A;  3EG9 A;  2KNB B;  3G6E Q;  4D8D A;  4XAX B;  2XDB A;  3A8G B;  2EGA A;  1JBM A;  2YLC A;  1ABQ A;  4EIK A;  2DXT A;  1YFN A;  2KSS A;  2HSP A;  3EGU A;  2F69 A;  3MET A;  1FMV A;  4J6X A;  2M16 A;  4IUU A;  2RF0 A;  2QTV A;  2DD5 A;  1NEG A;  1VQK Q;  1M3C A;  2BZX A;  4KGV B;  2QEX Q;  2RK1 A;  3WVE B;  1MMN A;  1JJ2 A;  4M7A G;  1VQO Q;  2P0K A;  5FU6 B;  1TUD A;  2DL5 A;  1K0S A;  2XDD A;  3VS1 A;  4PLI A;  3M57 A;  2VUB A;  4J9C A;  1SG5 A;  1UGR B;  1BIA A;  4XTX A;  1QCO A;  4HCB A;  2O2O A;  2VKN A;  5GAM h;  2I0N A;  2RJC A;  2KT8 A;  3I56 A;  3FB9 A;  2CZ6 B;  1Y71 A;  2HL5 C;  1FWZ A;  1NLO C;  2EAY A;  2LQ8 A;  2PZ1 A;  3RKW A;  4F7U A;  2D6F A;  2JVV A;  4PJM A;  4BI8 B;  1VA7 A;  1NEB A;  2M0O A;  2PVO B;  1VQM T;  2VV5 A;  3CPW S;  3CD6 T;  3C95 A;  4PL6 A;  3VS6 A;  4M7A F;  2MF2 A;  1QP2 A;  4A4F A;  1T3S A;  1EIF A;  1Q86 C;  2CP5 A;  2DM1 A;  1QVF A;  4IKF A;  4QKU A;  1QCF A;  4E7H A;  1IXD A;  3MP6 A;  2LMJ A;  5IH2 A;  1S72 T;  2CDT A;  3RBB B;  4D6W A;  1X01 A;  3M54 A;  2XDP A;  2KRS A;  4C92 C;  2L3R A;  2NWM A;  1KD1 U;  3CCM Q;  1WIE A;  1JO8 A;  3CCJ T;  2X3W D;  2RI2 A;  1VQ4 Q;  3JCM h;  1QVP A;  4ZGJ B;  2DRM A;  8AT1 B;  4Y92 A;  1K76 A;  4KH0 B;  4R55 A;  1ABO A;  2YXY A;  1D0Y A;  1PRM C;  2CS7 A;  4JS4 A;  1VQM A;  3M0U A;  3CD6 A;  4C8Q E;  3FEO A;  3V8J A;  4AFQ C;  1N6A A;  1AWX A;  4HCK A;  2MYS A;  1H8K A;  3M4G A;  2DPP B;  5GMK h;  2JMA A;  3EGD A;  4J9I A;  2DKG A;  1S72 A;  4A53 A;  2KYM A;  4PJO G;  3JCM c;  2OTJ T;  3QZ9 B;  4M77 B;  4M7A D;  1X2Q A;  1K8A U;  1WXB A;  4OMN A;  2CSI A;  4HA8 A;  1G8X A;  1WDX A;  5HY6 A;  2JJ9 A;  2DYI A;  1I0C A;  3EFS A;  3RNJ A;  2ATC B;  3J81 E;  4RTU A;  4RMO A;  3JB9 I;  3J7A F;  1XJW B;  2HQE A;  1QVG A;  3ZL7 C;  1Q86 U;  3GIB A;  2VB6 A;  4TVR A;  1SEM A;  2JNG A;  5CQX A;  4M77 G;  2CP3 A;  5GAO l;  1QW1 A;  3CCL A;  3OYJ A;  2OTJ A;  4PJO F;  1Q86 R;  2E5K A;  1SKU B;  3V8K A;  1ZSG A;  4R56 A;  5GAN 6;  5FWC A;  1NE8 A;  5CKF A;  3M9Q A;  5FRN A;  4M78 C;  3TRE A;  4RTX A;  3QJY A;  2RA2 A;  5IHK A;  5GAN d;  2ZPH B;  3GNF B;  1X75 C;  4A4K A;  3G7Z A;  4Y28 E;  2MK5 A;  3CC2 Q;  1OQK A;  4J9D A;  2R57 A;  2EQI A;  3VS0 A;  1KQS P;  4N4I A;  2XMF A;  4JUV A;  2RHX A;  2M1H A;  4M77 F;  4XTV A;  1XOV A;  1UG1 A;  2LNV A;  1Q7Y U;  2CP0 A;  2NUT B;  1RAG B;  4HVW A;  2JTE A;  5LJ3 j;  1WZO A;  1VYT A;  5KE2 A;  1OPL A;  2PNI A;  3EG1 A;  4PJO D;  2NUZ A;  3PMT A;  2V26 A;  1YJ9 T;  4C92 B;  2R58 A;  3I5S A;  3INZ A;  1YIT T;  2JM9 A;  4RG8 A;  1ARK A;  2E6Z A;  3NHN A;  3M59 A;  3ASK A;  5A2Q E;  2CUD A;  4IUV A;  2IVW A;  1YI2 Q;  3MO8 A;  2P84 A;  4ZTF A;  3G4S Q;  1IRX A;  1YIJ T;  1AOJ A;  2BTT A;  1SHG A;  4DQ2 A;  3I55 T;  1UGP B;  3NGP A;  4Z88 A;  2OTL Q;  1QMC A;  1R0C B;  5CAI A;  3QXE B;  3URG A;  4AFU C;  2XIC A;  3UWN A;  1ZUY A;  1UUE A;  3SFM A;  3OS0 A;  4C92 G;  2X4J A;  4ELZ C;  1W4S A;  1AWO A;  4ZTJ A;  2DL3 A;  2DL8 A;  2C0I A;  2F2X A;  2QYZ A;  1QKW A;  4KUL A;  5FRO A;  5GAO q;  4O5V A;  2C0O A;  3OYN A;  2BZ8 A;  3E1S A;  3EG3 A;  5HK0 A;  2EPD A;  4E7J A;  1UHC A;  5FRM A;  1PD1 A;  3OW2 A;  2X4W A;  3M0Q A;  1YIJ A;  4M77 A;  2QTX A;  4L59 A;  4LUD A;  3JAM E;  2RQU A;  3I55 A;  3GPL A;  2AZV A;  4PJL A;  4PFP A;  2KYB A;  2PU9 B;  1WX6 A;  4QW2 A;  3RMQ A;  5L8R E;  5CO7 A;  1V76 A;  4C92 F;  2AKL A;  2YSQ A;  3JCM P;  2KXD A;  2VXE A;  1N9S A;  3EGX B;  4R0K A;  2HAX A;  4WF2 A;  5J3B A;  3QBY A;  3VS7 A;  5LJ3 g;  4M78 B;  3CC4 T;  4OB2 B;  4BUG A;  1D3B B;  2LVM A;  2V1R A;  4OVA A;  4MZM A;  3BDU A;  2JM8 A;  2P4T A;  4Z89 A;  2RH2 A;  3DB4 A;  4X1V A;  1NJI C;  2BE9 B;  2WSE E;  2LQK A;  2O9S A;  4RCB A;  3A8M B;  2AKK A;  5GAN 3;  4JDS A;  4LDY A;  3CCV T;  1BBZ A;  1YN8 A;  1VQ9 T;  4M78 G;  4FT2 A;  4NL2 A;  3CCR T;  1Q82 C;  5GAN j;  5KE3 A;  3CCJ Q;  3CC4 A;  1ZUU A;  2KVQ G;  2RJF A;  3OMC A;  4E47 A;  1VQ5 T;  2CGH A;  2KT1 A;  3EHR A;  1IO6 A;  1P92 A;  3ER0 A;  2EKH A;  2HL3 A;  2ROL A;  2ZZD A;  2YUQ A;  2COW A;  4LD9 K;  1K73 U;  2NUT A;  2FRY A;  3UA6 A;  1VQL Q;  3SD4 A;  1PD0 A;  3BE3 A;  5GJW B;  1I5O B;  3PIO A;  2GFA A;  2QG9 B;  3EH1 A;  4ME7 A;  1YJW T;  2LTO A;  1U06 A;  1VQ9 A;  2KR3 A;  2YWW A;  4M78 F;  4C92 A;  3JB9 J;  3TU4 K;  2K4Y A;  4C5H A;  1AD5 A;  3CCR A;  3OYG A;  3VKI A;  3BW1 A;  3I35 A;  1OI1 A;  4CC2 A;  3OYB A;  4BDY A;  4RUG A;  1VQ5 A;  3PMI A;  5CKE A;  4MMK A;  4Y91 A;  3CCS T;  4N0A A;  1VQ8 T;  3R6O A;  3CME A;  3EHQ A;  1RAI B;  1NJI U;  2A28 A;  3CXC P;  2GFU A;  1PC0 A;  2DXC A;  3VUZ A;  2DBM A;  4XTW A;  2CP7 A;  1YBY A;  1PRL C;  3CCQ T;  4C0D B;  2DYB A;  4FYY B;  3E9G A;  4LDV A;  4M75 C;  1YJW A;  4C5I A;  2LX7 A;  1NJI R;  2MMP A;  1RAD B;  2QA4 Q;  1AT1 B;  1OX9 A;  5GMK i;  2DF6 A;  2DIG A;  2E5Q A;  3FJP A;  4NL3 A;  4OMO A;  1Q82 U;  1OYX A;  5IN1 A;  2BZY A;  2X4X A;  4C0G A;  1GBQ A;  1M2V B;  3A5Z B;  4J9G A;  3HFO A;  2L2P A;  1UHF A;  1G3S A;  2ROT A;  1Q82 R;  2DL4 A;  5GAN 7;  2CYZ B;  1VQ8 A;  2DTI A;  3HRT A;  4KBM B;  4C5G A;  2EJG A;  3JCM J;  5GAO m;  5LJ3 h;  1UJY A;  3VS3 A;  4IIO A;  2FZC B;  3CCQ A;  2E65 A;  3JB9 G;  1WHJ A;  2X4Y A;  1MMG A;  1M90 C;  1W2B P;  5A0L A;  3FJ5 A;  1VIE A;  4KH1 B;  3EGX A;  4E6R A;  1H3H A;  5FU6 C;  1AEY A;  3DKM A;  1RLQ C;  3GNG A;  4M78 A;  3QUI A;  4RCC A;  3OS1 A;  1D3B A;  2JT4 A;  5GAM e;  4QQ6 A;  1U1S A;  1GFC A;  3OYL A;  1YJ9 Q;  2D8H A;  1YIT Q;  1KHC A;  1OU8 A;  2KRO A;  2DX1 A;  2DVJ A;  3OS5 A;  2PTK A;  5GAM f;  2E41 A;  1B07 A;  2DET A;  3JB9 F;  2DRK A;  2WSF E;  3QG1 A;  4F7U G;  4M7D D;  4AG2 C;  2KI7 A;  1G3T A;  1PWT A;  3ZFJ A;  2O31 A;  3CMA Q;  1WA7 A;  1Y07 A;  3RER A;  3HTR A;  2K5L A;  3MCA B;  1YJN Q;  1Q81 C;  2DAQ A;  3QSU A;  3PT9 A;  1X43 A;  3EAE A;  2L8D A;  2H3J A;  1TUC A;  3ME9 A;  1M8V A;  2BE7 D;  3UAT A;  1WXU A;  4N4H A;  2YRV A;  1VUB A;  2C06 A;  3HPW A;  3KBG A;  2DFU A;  4DBH A;  3JCM e;  1N9R A;  2HQX A;  1M9S A;  3BFM A;  4RKU E;  3OA6 A;  4DA4 A;  1KQS A;  1RLP C;  1BB9 A;  2QAZ A;  3C94 A;  4F7U F;  3LWH A;  5KYN A;  4F17 A;  2EQM A;  3CC7 A;  5GMK e;  4OB3 B;  3V7R A;  1M90 R;  2LT1 A;  2EKO A;  2RK2 A;  3H0I A;  4M75 B;  4FCY A;  1K9M U;  3JB9 D;  2FO0 A;  5ECA A;  2MPX C;  4JZ4 A;  1I07 A;  4E7L A;  4CI0 C;  1KJW A;  3CC4 Q;  1OV3 A;  3CBM A;  4B6M A;  3JCM b;  2F1L A;  3HFN A;  2C0T A;  5D6Y A;  4ORZ A;  3VJP A;  5A0G A;  2ED0 A;  3QYG B;  4C0F A;  3FDR A;  3I56 T;  2J6K A;  4JLG A;  3ULR B;  4ZN1 A;  1M1K U;  1M5Q 1;  1KD1 C;  4M75 G;  2K3Y A;  3F70 A;  2MCN A;  4J6Y A;  3WVD B;  4PJO E;  2K6D A;  1Q81 U;  1U3O A;  1J3T A;  1EX4 A;  1M2V A;  2RN8 A;  5HCK A;  4BB7 A;  1SPK A;  3BY7 A;  3R6N A;  3CCV Q;  5LL6 S;  1Q81 R;  1OX8 A;  3PGG A;  1VYU A;  3MHX A;  3LX7 A;  1RAB B;  4HCC A;  3LWI A;  4DBF A;  2KDS A;  3QII A;  2DZ9 A;  1K8A C;  3L2Q A;  1GFD A;  2A7Y A;  3M53 A;  2HEQ A;  3O8V A;  3MKD A;  4M75 F;  1I8F A;  2M0Y A;  4HT9 A;  1UGS B;  1MV0 B;  6AT1 B;  4BE1 A;  3OQ5 A;  2RB6 A;  5LJ5 h;  1T0H A;  1UGV A;  2LP5 A;  5I22 A;  4RTV A;  1N27 A;  3A8O B;  2DMO A;  2O01 E;  4B9W A;  2QK0 A;  1VQ7 Q;  3EFR A;  4C5E A;  4HVV A;  4MDW A;  1H92 A;  1Y96 B;  2PVG B;  1PSF A;  3CCS Q;  1VQ8 Q;  5KYW B;  3QDR B;  1GRI A;  3OYD A;  2MIO A;  1WHH A;  1Y7X A;  5AT1 B;  3G71 Q;  2EGC A;  1AVZ C;  4BE2 A;  2HKN A;  1PKT A;  2RM4 A;  1KD1 R;  1UEC A;  4N0A C;  1F1B B;  2DXB A;  2LRQ A;  2GF7 A;  3M0S A;  3E19 A;  3MP1 A;  2CRE A;  2BIV A;  1MV3 A;  4CRI A;  4IUQ A;  2DD4 A;  3CCE T;  3CCL T;  4JLI A;  2EYW A;  4IIM A;  1RI0 A;  2LZ6 B;  4LN2 A;  5FWB A;  4BY6 B;  1MUZ A;  1Q7Y C;  1KHI A;  1Z9Z A;  1B7T A;  3VUB A;  1NG2 A;  3BDL A;  4FW2 A;  1WJQ A;  1VOM A;  2ZPE B;  2KK4 A;  2SRC A;  1K8A R;  1GL5 A;  2Y4X A;  4M75 A;  1LPL A;  4CC3 A;  3L2W A;  4JJN K;  3NMZ C;  2EJ9 A;  3SWN C;  1I81 A;  1X6G A;  3QWY A;  1RAH B;  2SEM A;  3M56 A;  3VS5 A;  1YHQ A;  4RG2 A;  3CCE A;  1JJ2 S;  3MJX A;  5CKH A;  4LD6 A;  3X25 B;  4LE9 A;  2L0A A;  2A0F B;  3JCM W;  1T0J A;  2RHZ A;  3CPW P;  2EQK A;  1M3A A;  1WQ7 A;  4ANJ A;  3CXC A;  3KXT A;  4QVZ A;  1HYO A;  1MGQ A;  5FLX E;  3VS2 A;  5I21 A;  2HMA A;  4EMK C;  2GTO A;  1H3Z A;  2XI9 A;  2FEI A;  1QKX A;  1I1J A;  4PJJ A;  2QQS A;  4JJD A;  3LH5 A;  4C8Q B;  2W0Z A;  2W10 A;  4LXC A;  2F2V A;  3M55 A;  1M3B A;  1BCO A;  2DNU A;  5HK3 A;  4BE0 A;  1IRE B;  1QVF S;  2VWF A;  1RAE B;  4LDU A;  2HNI A;  4XTY A;  1Q7Y R;  3JCM V;  2HCK A;  2O88 A;  2EW3 A;  3L2Z A;  3OBY A;  3J80 E;  3H9N A;  2EIF A;  1VQ6 T;  2DZC A;  5GAM d;  1W2B A;  2PQW A;  4L6V 5;  3CCU A;  3I5R A;  1K0X A;  1O9S A;  1Q95 G;  1ZA1 B;  2D0N A;  4FM4 B;  1TG0 A;  2DJZ A;  2L3S A;  3L1A A;  3A8H B;  1JRI A;  4XQ3 A;  1Y96 A;  3KFV A;  2P4R A;  3IQL A;  5CKD A;  2E12 A;  3LGL A;  4OF1 A;  5IHN A;  5KYW A;  3OSV A;  3X26 B;  2EVR A;  4KT0 E;  2F2W A;  2MAM A;  3RKX A;  2ZAE A;  4M77 D;  2JZ2 A;  3A98 A;  3H0F A;  3VYG A;  2OAW A;  2K3X A;  3I56 Q;  4RTZ A;  2LJ0 A;  2DVE A;  5GAN 5;  1VQ6 A;  1MNE A;  1UB4 A;  1OUL A;  3MPU B;  3REB B;  2QQA A;  2OX7 A;  3THK A;  3PVQ A;  2COY A;  2L5Q A;  1XQH A;  2CZ1 B;  3NTH A;  1HJD A;  1RL2 A;  1ZA2 B;  1YP5 A;  1TUG B;  3SWN B;  4C0D C;  3GLX A;  1X69 A;  3JCM d;  5GAN 2;  1K73 C;  1QVG S;  4AFS C;  1OZ3 A;  4MDX A;  2GNC A;  3H8Z A;  2A36 A;  1IB8 A;  4J9F A;  4M7D E;  3N5B B;  2YUP A;  1X27 A;  3FC3 A;  2KGT A;  2AIR B;  1YNZ A;  3M58 A;  4E7I A;  3QJ6 A;  1UEB A;  5LJ3 e;  5J39 A;  5IXF A;  2HZY A;  2KE9 A;  2JOY A;  3S3O A;  4EMK B;  1VQM Q;  3QWX X;  5KYY B;  3CD6 Q;  2AZS A;  2JTF A;  4FL6 A;  5LJ3 f;  1FYN A;  1QWE A;  1VQP A;  4Q5W A;  4ZGE B;  1EFN A;  1S72 Q;  5DLQ E;  1SF9 A;  4IUP A;  3OYC A;  5IXB A;  2YHT A;  4HXJ A;  3UT1 A;  1NYF A;  3RMS A;  3X24 B;  1BU1 A;  1T3L A;  4DOW A;  1AHJ B;  3EH2 A;  2HKQ B;  4Z8A A;  4E7Z A;  2QEX T;  4C92 D;  1OPK A;  1TSF A;  4C8Q A;  3OMG A;  4PJN A;  2DJQ A;  4A4G A;  3CME T;  1R77 A;  1WNL A;  2CT4 A;  3G6E A;  2RQR A;  2R5M A;  2PVD B;  5GAO n;  2LQN A;  2FG0 A;  4LDX A;  4OMQ A;  2DE0 X;  2HQH A;  2A08 A;  4JJC A;  2HDA A;  5KYX B;  1UJ0 A;  1K73 R;  2DO3 A;  3CCL Q;  1S1N A;  2OTJ Q;  2JW4 A;  2P0P A;  2VYT A;  2MOX A;  2NLU A;  1M27 C;  2D1X A;  1U5S A;  3SEM A;  3FRN A;  1UDL A;  4Z02 A;  1IHW A;  3RR6 A;  1N8R U;  1VQK A;  4MZT A;  2E70 A;  1LJO A;  1QWF A;  4F7U E;  2QEX A;  5GAM j;  2X35 A;  1VQO A;  3OBW A;  1KC8 U;  1C0M A;  1NZ9 A;  1PCX A;  2G3R A;  4OP0 A;  2IG0 A;  4OB0 B;  2EFI A;  1R0B G;  3OW2 S;  5GAN 8;  5CIU A;  1M2O A;  4FW1 A;  2D0Q B;  2P0Q A;  4QVC A;  3H0H A;  1AZE A;  5CCA A;  1C6V X;  3CCM T;  2L3P A;  1GCQ A;  2LCS A;  1VQ4 T;  3AHU A;  2FZG B;  4DOV A;  3SWN A;  1AZG B;  3P8H A;  1MMA A;  1RAF B;  4M78 D;  2M9U A;  3TEE A;  4KGZ B;  5GAN g;  3S3N A;  2K2V A;  1QP3 A;  2KQW A;  5GAO r;  4L5G A;  2RNA A;  5A0D A;  3ZEH A;  2J05 A;  2FL7 A;  4LUE A;  3L2U A;  3CCM A;  2CZ0 B;  4J9B A;  1VQ4 A;  7AT1 B;  3A1P A;  2DA9 A;  3QKJ A;  1K9M C;  1QCN A;  2E64 A;  4A54 A;  4F14 A;  1BI0 A;  3MP8 A;  4JRI A;  4QT7 A;  3P8B B;  4EMK A;  2F5K A;  2EYX A;  4JZ3 A;  2EQU A;  5GAO p;  2E3H A;  1RUW A;  4KGX B;  4M7A E;  1M1F A;  3VS4 A;  5GAM g;  2GGR A;  2E4H A;  3OS2 A;  5LJ5 e;  3S6W A;  2K57 A;  1MMD A;  4PK4 A;  3QYH B;  2FZK B;  1YIJ Q;  4HKE A;  4GLK A;  1M1K C;  3PE0 A;  3I55 Q;  3CC7 T;  2JN0 A;  3TCJ A;  8ATC B;  4OML A;  4PFZ A;  1M30 A;  5M9O A;  3KUF A;  5LJ5 f;  3L2R A;  2ECZ A;  5IHI A;  1N5Z A;  2LCL A;  3CPW A;  1D0X A;  3CC2 T;  1WQW A;  2E6N A;  3SHW A;  2LX9 A;  3OYE A;  1W6X A;  2X51 A;  1NPP A;  1W70 A;  3L42 A;  1WYX A;  5EG2 A;  3OYK A;  2R5A A;  2V1Q A;  1CKA A;  2AK5 A;  5KYX A;  4M4Z A;  4VUB A;  3MEW A;  4AMC A;  2Y90 A;  3JCM g;  1AWW A;  3C12 A;  4ZGD B;  4F04 B;  3VYH B;  2QQ9 A;  1FX7 A;  4IUT A;  3PNW C;  4FYW B;  4B9X A;  4XU0 A;  4BY6 C;  4O6J A;  3CC2 A;  4PKC C;  3DB3 A;  2ZCF B;  3TQ7 P;  1HK9 A;  1K9M R;  2DL7 A;  2FPF A;  2YRC A;  2E3I A;  4DBR A;  1V1C A;  2DLP A;  2GCX A;  4GY5 A;  1YI2 T;  2J06 A;  2ED1 A;  2KBT A;  2EWN A;  3G4S T;  3V7C A;  2JUF A;  3D7S B;  3CEY A;  4EMH A;  4X9C A;  2HD0 A;  2JS0 A;  4M7A B;  2VC8 A;  2JS2 A;  2XU8 A;  3X28 B;  4JS5 A;  2OTL T;  4HVU A;  5GAN h;  2MWO A;  3LYI A;  2I2L A;  4WTO B;  2RJD A;  4FT4 A;  1FMW A;  1BCM A;  1M1K R;  5KYU B;  2E10 A;  1VQ9 Q;  1PG5 B;  2MWP A;  2X3X D;  1WJS A;  1G2B A;  1VQN T;  3FIF A;  3CCR Q;  1ZQ1 A;  5I2S A;  2M51 A;  2GQV A;  1XNI A;  4MZP A;  3RDV A;  1VQ5 Q;  2AHJ B;  3SDZ A;  1YI2 A;  3RIR A;  3M0R A;  4EPC A;  1TH7 A;  3EG2 A;  3QPH A;  4E7S A;  3G4S A;  3H6Z A;  3CME Q;  2YDL A;  4IUR A;  5CVI A;  4CC7 A;  4C0Z A;  4M77 E;  2NYS A;  4FU6 A;  2OTL A;  1HXD A;  3GOX A;  2RO0 A;  1JB0 E;  3QO3 A;  1E6H A;  4JPB W;  4C8Q C;  1YJW Q;  4YTL A;  5LJ3 d;  4HCZ A;  2B8A A;  2FVU A;  3U23 A;  3Q1J A;  2XKO C;  2X9H A;  3QHS A;  1VQN A;  2H3E B;  4II1 A;  3MEA A;  2A3L A;  1K9A A;  2GBQ A;  2J7I A;  4X9D A;  2RMO A;  2D8J A;  3HRU A;  1ZHI A;  3DLM A;  4NOY A;  5DM7 R;  2WAC A;  1QLY A;  4KRT A;  2LJ3 A;  2RQW A;  5FU7 B;  2COZ A;  1X2K A;  1JXO A;  2EJF A;  3E2U A;  4UC4 A;  3GP8 A;  4HT8 A;  3HSB A;  5J26 A;  1JU5 C;  3CCQ Q;  2FHD A;  1KQS S;  2KRN A;  2KRM A;  3VRZ A;  2J6F A;  2XHC A;  4PJO B;  5CK9 A;  1E7O A;  4M75 D;  3T9N A;  3HP9 A;  1YHQ T;  5C6S A;  4OGC A;  1KK7 A;  1CKB A;  2XID A;  1D1B A;  3CPF A;  1UFF A;  3LH0 A;  4ZNX A;  2K5I A;  1VYV A;  1VQL T;  3PVL A;  4ATO A;  1GCQ C;  2ZPB B;  4RTT A;  4XTZ A;  1D0Z A;  2VGM A;  1GBR A;  1WHM A;  4J8O A;  1WJR A;  3PIP A;  1BI1 A;  1TU0 B;  3SB2 A;  3VU3 C;  2EQJ A;  1PKS A;  1B34 B;  3C0C A;  4C92 E;  2DEU A;  2EYY A;  3CCJ A;  4GLM A;  4QQG A;  1ZLM A;  2Z0W A;  4D8K A;  5GJV B;  2HBP A;  1ZSZ C;  5D6W A;  5DY9 A;  5L23 A;  2FYK A;  3S3M A;  5KCH A;  1VQL A;  4JRP A;  4BI3 A;  2V8J A;  4M7A A;  2CT3 A;  2O4X B;  2QDL A;  1G5V A;  2LDM A;  3OB9 A;  2QXF A;  1I4K 1;  1WHG A;  1X6O A;  5KYU A;  2QA4 T;  1OU9 A;  1NLP C;  2LT4 A;  2KY9 A;  2L89 A;  3CC7 Q;  1W1F A;  1FMK A;  3CCU T;  3OY9 A;  1KQ2 A;  2EBP A;  2VGN A;  3A8L B;  1BI2 A;  1BK2 A;  5IAY A;  2EYQ A;  2RHU A;  1G3Y A;  5I2M A;  3C4S A;  4E2F B;  2ZPI B;  1NM7 A;  2V8I A;  2O9V A;  5GMK l;  1LVK A;  3P8D A;  2XG8 D;  3OYF A;  1NBE B;  1BYM A;  1V29 B;  2QA4 A;  4A4H A;  2DK3 A;  4FSS A;  3E9F A;  1KG1 A;  4XU2 A;  1MND A;  1PM3 A;  4C8Q G;  2LC4 A;  2HBW A;  4QQD A;  1WHK A;  2JTM A;  1BKB A;  2DXU A;  1GCP A;  4M78 E;  1BIB A;  4EDU A;  2JMC A;  2ZPG B;  1KQ1 A;  1BI3 A;  1JXM A;  3V8L A;  1WLP B;  2K5F A;  5LJ5 d;  2KAF A;  1YWP A;  2EYZ A;  1SSF A;  1TWB A;  4M7D C;  5D7U A;  4BDZ A;  2WSC E;  4A63 B;  1ZBX A;  2CP2 A;  4P5N A;  2G6F X;  2RD1 A;  2OI3 A;  1HD3 A;  3M0T A;  4J6W A;  2IPO B;  2OAU A;  3HRS A;  3CMA T;  4PJO A;  1JEG A;  2KMT A;  1JJ2 P;  4C8Q F;  2XK0 A;  2LCC A;  4WCI A;  3REA B;  1YJN T;  4CC4 B;  3OYH A;  2D9T A;  2ABL A;  2QQR A;  1GXI E;  9ATC B;  1WXT A;  1B3Q A;  2VVK A;  3VV0 A;  3M4Y A;  4ELY C;  1YJ9 A;  4E7K A;  2RHY A;  1YIT A;  1VQN Q;  1VQP T;  3JCM Q;  1M1G A;  5DLO A;  2K9G A;  4XU3 A;  2QGF B;  1ZSZ B;  1KSW A;  2GQI A;  2KXC A;  4EMG A;  4PFO A;  4AFZ C;  2CH4 A;  2KEA A;  1NYG A;  2VXF A;  2RQT A;  2ZPF B;  3NTI A;  4FYX B;  2HSE B;  3CMA A;  1K4U S;  1D09 B;  2RQV A;  4FIB A;  1B34 A;  1ZX6 A;  2NUP B;  1N8R C;  2K3B A;  1YJN A;  1Y57 A;  3CXC S;  4OGE A;  4OMP A;  3TSW A;  1PNJ A;  2DBK A;  3AT1 B;  4J9H A;  2FRW A;  1QVF P;  3CBO A;  1JQQ A;  3G6E T;  2GTJ A;  2RI5 A;  4DEY A;  4QVD A;  1RI9 A;  2QDY B;  1KC8 C;  5C0M A;  2BKD N;  4AT1 B;  4C8Q D;  2FPE A;  1E6G A;  2O4X A;  2DTH A;  2Y4Y A;  1LCK A;  1LNX A;  2QAS A;  2DIL A;  3OYI A;  2LJ1 A;  2OJ2 A;  5AYF A;  2BUD A;  1OEB A;  1K1Z A;  4BD3 A;  1SRL A;  4XU1 A;  3L2V A;  3EG0 A;  1Y0M A;  1VQK T;  1UE9 A;  3I9Q A;  2ZGW A;  4J83 A;  2ESW A;  1I5L A;  2JXB A;  3NPF A;  2YT6 A;  1VQO T;  2LQW A;  4V2S A;  3LGF A;  1DJ7 B;  1W2B S;  1EZZ B;  2DER A;  2J6O A;  2A37 A;  4N4G A;  3ZBD A;  2IIM A;  1YHQ Q;  1VIF A;  3UPU A;  1IGU A;  1NPR A;  3CCE Q;  3MEU A;  1FXX A;  2CKK A;  3HKS A;  4OMM A;  2H8H A;  2RI3 A;  4AG1 C;  1RAC B;  3UF4 A;  2PUO B;  3CQT A;  1YCS B;  1R8O B;  4M7D B;  1UGQ B;  3NFC A;  2PUK B;  3JB9 H;  3EFO B;  5I11 A;  2F5T X;  2EGE A;  3HL8 A;  1QVG P;  4X34 A;  1TOV A;  3CCV A;  2CH4 W;  1N8R R;  2QQB A;  4LDW A;  2K2M A;  3VRY A;  4XTU A;  5FW9 A;  5EC7 A;  4OB1 B;  4PLL A;  1AWJ A;  4RTY A;  1VQ7 T;  1G3W A;  3O5Z A;  3WXM B;  3LW5 E;  4J5Y A;  1TXQ A;  2E1H A;  5LJ5 j;  1KC8 R;  3OYA A;  2RHI A;  3EG9 B;  4M7D G;  2CZ7 B;  2B86 A;  1SHF A;  1TS9 A;  1Z9Q A;  1PSE A;  3OYY A;  3G71 T;  1G83 A;  5GAN 4;  1LOJ A;  1ZBJ A;  4MML A;  3JV3 A;  5KH6 A;  1RAA B;  3PTA A;  1WI7 A;  1IZ6 A;  2DEQ A;  2CUB A;  4J7F A;  1QQJ A;  1WHL A;  5GAN e;  3CCU Q;  5CQY A;  4M7A C;  1VQ7 A;  4XK8 E;  5IT9 E;  3G1J A;  4J9E A;  4KUI A;  1CSK A;  1KFZ A;  1ZSZ A;  2YUO A;  1D1C A;  3JRZ A;  4NS5 A;  3CCS A;  1D1A A;  1KIK A;  5GAN f;  4M7D F;  2YLB A;  1WGS A;  1X6B A;  1IHV A; 
#chains in the Genus database with same CATH homology
 4RTW A;  2M51 A;  1T0J A;  2K7A A;  1M3A A;  1M8M A;  2V1R A;  4GBQ A;  2YUN A;  3M0R A;  3VS2 A;  2JM8 A;  3EG2 A;  3GBQ A;  4Z89 A;  2YDL A;  2GTO A;  4F16 A;  2CSQ A;  4X1V A;  4CC7 A;  1HSQ A;  2FEI A;  4ESR A;  1QKX A;  2L3Q A;  2K79 A;  2O9S A;  1I1J A;  2AKK A;  1PHT A;  1SRM A;  1YWO A;  1A0N B;  4JJD A;  3LH5 A;  3H41 A;  1E6H A;  4JPB W;  3UA7 A;  2W0Z A;  2FPD A;  2W10 A;  1WFW A;  1BBZ A;  1YN8 A;  4DEX A;  3U23 A;  2F2V A;  1M3B A;  2DNU A;  2VWF A;  1ZUU A;  1K9A A;  2GBQ A;  1SSH A;  2J7I A;  2RMO A;  2KT1 A;  2D8J A;  3EHR A;  2HCK A;  1IO6 A;  2O88 A;  2EKH A;  2ROL A;  2EW3 A;  1QLY A;  1ZUK A;  4KRT A;  2LJ3 A;  2YUQ A;  2RQW A;  2FRY A;  3UA6 A;  1X2K A;  1JXO A;  5GJW B;  3I5R A;  1K0X A;  2D0N A;  1TG0 A;  1JU5 C;  2L3S A;  1UTI A;  1U06 A;  2KRN A;  2KRM A;  3KFV A;  3VRZ A;  2J6F A;  2KR3 A;  2P4R A;  3IQL A;  3TSZ A;  5IHN A;  1AD5 A;  1E7O A;  2EVR A;  3I35 A;  4CC2 A;  3TVT A;  2F2W A;  1OOT A;  4RUG A;  4K11 A;  4JJB A;  1CKB A;  2LNH B;  3A98 A;  3H0F A;  2OAW A;  1UFF A;  4RTZ A;  2LJ0 A;  4ZNX A;  3EHQ A;  2A28 A;  1VYV A;  3REB B;  3PVL A;  4LNP A;  3THK A;  3PVQ A;  1GCQ C;  2DBM A;  1HJD A;  4RTT A;  1PRL C;  1YP5 A;  2DYB A;  1GBR A;  2ENM A;  3M0P A;  2LX7 A;  1X69 A;  2RPN A;  2DF6 A;  2KNB B;  4OMO A;  4D8D A;  1PKS A;  3C0C A;  4AFS C;  2EGA A;  3VS7 A;  2BZY A;  2EYY A;  4GLM A;  2GNC A;  1ABQ A;  2A36 A;  1GBQ A;  4J9G A;  4J9F A;  4EIK A;  1ZLM A;  2L2P A;  1UHF A;  2HSP A;  4D8K A;  2ROT A;  1X27 A;  2YUP A;  3EGU A;  5GJV B;  2KGT A;  2DL4 A;  5L23 A;  2RF0 A;  1YNZ A;  1NEG A;  2CT3 A;  5IXF A;  2KE9 A;  1M3C A;  2QDL A;  1UJY A;  2BZX A;  3VS3 A;  4IIO A;  3QWX X;  3FJ5 A;  1NLP C;  2AZS A;  1TUD A;  4E6R A;  1H3H A;  2DL5 A;  1AEY A;  1K0S A;  1FYN A;  1W1F A;  1FMK A;  1QWE A;  3VS1 A;  2EBP A;  1RLQ C;  4J9C A;  1EFN A;  2O2O A;  2VKN A;  2JT4 A;  1BK2 A;  2I0N A;  2KT8 A;  1GFC A;  5IXB A;  2D8H A;  4HXJ A;  1NLO C;  1NYF A;  1NM7 A;  2O9V A;  1BU1 A;  2PZ1 A;  1T3L A;  2KRO A;  2DX1 A;  2DVJ A;  2PTK A;  4Z8A A;  1B07 A;  1OPK A;  1VA7 A;  1NEB A;  2DRK A;  2DJQ A;  3VS6 A;  4AG2 C;  4FSS A;  1PWT A;  2CT4 A;  2RQR A;  1T3S A;  2O31 A;  2HBW A;  1WA7 A;  2LQN A;  2DM1 A;  2FG0 A;  1QCF A;  4OMQ A;  1GCP A;  2DE0 X;  2LMJ A;  5IH2 A;  1X43 A;  2A08 A;  4JJC A;  2HDA A;  2CDT A;  1UJ0 A;  3RBB B;  1TUC A;  1S1N A;  2JMC A;  3UAT A;  1WXU A;  2JW4 A;  1JXM A;  2MOX A;  2KRS A;  1M27 C;  1WLP B;  2D1X A;  1U5S A;  3SEM A;  2NWM A;  1UDL A;  1WIE A;  1YWP A;  1JO8 A;  2EYZ A;  2X3W D;  2DRM A;  1QWF A;  4A63 B;  4Y92 A;  1K76 A;  1RLP C;  1BB9 A;  1ABO A;  1PRM C;  3M0U A;  2G6F X;  2OI3 A;  1HD3 A;  3M0T A;  4AFQ C;  4F17 A;  1AWX A;  4HCK A;  1JEG A;  1H8K A;  4WCI A;  3REA B;  4CC4 B;  2JMA A;  3H0I A;  4J9I A;  2ABL A;  1WXT A;  2KYM A;  1B3Q A;  2VVK A;  2FO0 A;  5ECA A;  1X2Q A;  1WXB A;  3H0H A;  4OMN A;  1AZE A;  2CSI A;  1WDX A;  4JZ4 A;  1I07 A;  2L3P A;  1GCQ A;  1KJW A;  2LCS A;  1OV3 A;  2K9G A;  1I0C A;  2C0T A;  4ORZ A;  2GQI A;  1KSW A;  2ED0 A;  2KXC A;  4AFZ C;  1AZG B;  3RNJ A;  4RTU A;  2J6K A;  2CH4 A;  2KEA A;  1NYG A;  3ULR B;  2RQT A;  3ZL7 C;  2RQV A;  1K4U S;  1ZX6 A;  2MCN A;  2K3B A;  2RNA A;  2K6D A;  1SEM A;  1U3O A;  1J3T A;  1Y57 A;  2RN8 A;  5HCK A;  4OMP A;  3TSW A;  1PNJ A;  1SPK A;  2J05 A;  2DBK A;  3R6N A;  4J9H A;  2FRW A;  2E5K A;  1JQQ A;  2GTJ A;  1ZSG A;  4LUE A;  4DEY A;  1RI9 A;  5FWC A;  1VYU A;  4J9B A;  2FPE A;  1E6G A;  2DA9 A;  4RTX A;  1LCK A;  2DIL A;  2LJ1 A;  5IHK A;  2OJ2 A;  4F14 A;  4QT7 A;  2EYX A;  1GFD A;  4J9D A;  1OEB A;  1K1Z A;  4JZ3 A;  2EQI A;  2HEQ A;  1SRL A;  3VS0 A;  3EG0 A;  1Y0M A;  1RUW A;  1UE9 A;  2M0Y A;  3I9Q A;  1MV0 B;  2XMF A;  3VS4 A;  2GGR A;  1XOV A;  2ESW A;  1UG1 A;  1T0H A;  1UGV A;  2JXB A;  2LP5 A;  3NPF A;  2YT6 A;  2LQW A;  5I22 A;  4RTV A;  3PE0 A;  4HVW A;  2JTE A;  2DMO A;  4OML A;  1M30 A;  1VYT A;  2J6O A;  2A37 A;  4HVV A;  1OPL A;  2IIM A;  2PNI A;  2ECZ A;  5IHI A;  1H92 A;  1N5Z A;  3EG1 A;  2NUZ A;  4OMM A;  2H8H A;  4AG1 C;  3I5S A;  3UF4 A;  3SHW A;  1GRI A;  2JM9 A;  1ARK A;  2MIO A;  3CQT A;  1YCS B;  3NHN A;  1W6X A;  2CUD A;  2EGC A;  1AVZ C;  1W70 A;  5I11 A;  1WYX A;  1PKT A;  2EGE A;  2V1Q A;  1CKA A;  2AK5 A;  1UEC A;  2CH4 W;  1AOJ A;  2BTT A;  4M4Z A;  1SHG A;  2K2M A;  3VRY A;  3M0S A;  3NGP A;  5FW9 A;  5EC7 A;  4Z88 A;  1AWJ A;  4RTY A;  2CRE A;  1AWW A;  4AFU C;  1MV3 A;  3O5Z A;  1ZUY A;  1UUE A;  2EYW A;  4IIM A;  2LZ6 B;  4LN2 A;  5FWB A;  1AWO A;  2DL3 A;  2DL8 A;  1MUZ A;  2C0I A;  2F2X A;  1Z9Z A;  2B86 A;  1QKW A;  1SHF A;  1Z9Q A;  2DL7 A;  1NG2 A;  2C0O A;  2FPF A;  1V1C A;  1G83 A;  2BZ8 A;  2DLP A;  3EG3 A;  2SRC A;  2J06 A;  2EPD A;  1GL5 A;  1ZBJ A;  4CC3 A;  3JV3 A;  2ED1 A;  1UHC A;  2KBT A;  3NMZ C;  1WI7 A;  3M0Q A;  2CUB A;  4LUD A;  1X6G A;  2RQU A;  3QWY A;  2JS0 A;  2AZV A;  2JS2 A;  4HVU A;  2KYB A;  2SEM A;  3VS5 A;  4J9E A;  1WX6 A;  1CSK A;  1KFZ A;  2AKL A;  2YSQ A;  2YUO A;  2KXD A;  4R0K A;  2X3X D;  4LE9 A;  1KIK A;  1G2B A;  1X6B A;  2L0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...