4RTUA

Crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t96g/q128r mutant
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding, signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Crystal structure of the intertwined form of the Src tyrosine kinase SH3 domain T96G/Q128R mutant
rcsb
source organism Gallus gallus
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4rtuA00
4WCIA 4D8KA 2PZ1A 1EFNA 2AZVA 4HVUA 3ULRB 1UHCA 3VS2A 4J9FA 2QDLA 1WIEA 2BZXA 2F2XA 2HSPA 4KRTA 2JXBA 1ZSGA 3M0PA 3NGPA 1KIKA 1BB9A 1OOTA 3NPFA 2K2MA 2O9SA 2EYZA 1YP5A 2KYBA 2DVJA 1SSHA 1E7OA 1W70A 2ESWA 2KT1A 2L3SA 3I9QA 1GBQA 1UDLA 5IHIA 1HD3A 2DLPA 3UATA 1Z9QA 4LUDA 1QCFA 3U23A 4OMMA 2PNIA 2AKLA 2DA9A 4X1VA 2HEQA 1GCQA 3UA6A 2LJ1A 1FMKA 3UF4A 4R0KA 3ZL7C 2J6FA 1H8KA 4M4ZA 5GJWB 1LCKA 3H0FA 2A36A 1S1NA 4A63B 2J05A 4EIKA 5HCKA 4RTUA 2LNHB 4AFQC 1E6GA 2C0IA 1YN8A 2YUNA 2EGAA 1J3TA 2EYXA 2CREA 3JV3A 1K9AA 1K1ZA 5IHNA 2FRYA 1AWXA 3PE0A 2K9GA 2M0YA 2DX1A 1WYXA 3M0TA 4ZNXA 2LCSA 2FPDA 5ECAA 4FSSA 2M51A 1GRIA 2AZSA 3PVLA 4J9IA 3REAB 4Z88A 4HCKA 4CC7A 2D8JA 1A0NB 2DL7A 4J9EA 1UJYA 2EGEA 1NYGA 1TUCA 1Y57A 2SRCA 2GNCA 1U5SA 2AK5A 2BTTA 1QKXA 3RBBB 1FYNA 3CQTA 1WX6A 1WLPB 1UE9A 1B3QA 4HXJA 1YNZA 2KRNA 1GCPA 2KBTA 2OAWA 2FEIA 1YCSB 2K7AA 5GJVB 1B07A 2EVRA 5IXFA 1I1JA 3NMZC 3M0SA 1M8MA 2CUDA 2K3BA 2DL5A 4DEXA 1X6BA 3FJ5A 1BBZA 1OPLA 3H41A 3PVQA 2KXDA 2ENMA 4E6RA 3H0IA 4LUEA 2DRKA 2KNBB 2D8HA 2KRMA 2MCNA 4CC3A 2KT8A 2G6FX 4CC2A 2DL3A 2L2PA 1AVZC 1NG2A 3VS5A 5I22A 2J06A 3EG2A 1PRMC 4OMNA 2CSIA 1YWOA 1KJWA 1U06A 2J7IA 5IH2A 2LJ3A 2F2WA 3VS1A 4JJCA 2LZ6B 2V1QA 4J9BA 1SEMA 2YUPA 2K79A 1X2KA 4JZ4A 4RTYA 4ESRA 2FPFA 1UTIA 1IO6A 1M27C 4AG1C 2JS0A 2LP5A 3I5RA 2A37A 1M30A 3R6NA 3VS3A 3VRZA 4LE9A 1NEGA 1UFFA 2CUBA 2MIOA 4JJDA 1K4US 4DEYA 3TVTA 2ROTA 4LN2A 2BZ8A 1SHGA 4RTVA 2KXCA 5EC7A 4LNPA 1PNJA 3A98A 1NYFA 3I5SA 2JM9A 1AZEA 2EGCA 2SEMA 4JPBW 1MUZA 1G83A 2RF0A 2DBMA 4Z8AA 2GQIA 1I0CA 2LJ0A 2K6DA 4F16A 1OV3A 1GCQC 1XOVA 3H0HA 1TUDA 2EBPA 2BZYA 1H3HA 1YWPA 4F14A 1AWWA 2EQIA 2L3PA 2W0ZA 2ROLA 1JU5C 3VS6A 2EW3A 2VWFA 1HJDA 2DL8A 2DM1A 3EG1A 2DL4A 2DMOA 1NM7A 2DNUA 2PTKA 4HVVA 1UECA 2OJ2A 2JMAA 1RUWA 2W10A 1X2QA 2L0AA 2P4RA 5IXBA 2CH4W 3VS4A 3VRYA 1Z9ZA 2ABLA 3IQLA 1GFCA 3NHNA 1W1FA 1OPKA 1WXTA 2RQWA 2RQUA 3REBB 1MV3A 2LX7A 1V1CA 1KSWA 2EKHA 2O9VA 2YT6A 2KE9A 1GL5A 1UHFA 2LQNA 2X3WD 1SRLA 2I0NA 1PWTA 2OI3A 1K0XA 2FRWA 2HBWA 3QWYA 1UG1A 1M3CA 5FWCA 1AWOA 1Y0MA 4CC4B 2DYBA 2D0NA 1ARKA 2RN8A 2DILA 1M3BA 1T3SA 2KGTA 3EGUA 3O5ZA 2YUQA 2DBKA 3I35A 3KFVA 2GBQA 2V1RA 3VS7A 1GFDA 3EG3A 2A28A 3TSWA 1WXBA 2FO0A 2CT3A 1UJ0A 1WDXA 1G2BA 1ZUUA 2CH4A 3RNJA 4F17A 2JS2A 1QLYA 2YSQA 4JZ3A 4IIOA 4IIMA 2JM8A 1SHFA 2B86A 2VKNA 2X3XD 1I07A 1AOJA 2KROA 3LH5A 1WA7A 3EHQA 3C0CA 1SRMA 3M0RA 3TSZA 2EYWA 2JTEA 2LMJA 4GLMA 1PKTA 2H8HA 4RTTA 1PRLC 2KYMA 2EPDA 2GGRA 1JXMA 2RPNA 2O31A 5FW9A 2GTJA 2J6KA 1RLQC 2FPEA 2VVKA 2D1XA 1TG0A 2DRMA 4J9CA 3VS0A 2RMOA 4OMQA 2XMFA 1AEYA 2AKKA 2L3QA 1WFWA 4OMLA 1VA7A 3EHRA 4JJBA 1ABQA 1X43A 3GBQA 1VYVA 2MOXA 2JT4A 1RLPC 1ZLMA 1T0JA 1ABOA 3M0QA 4RTZA 4J9HA 2RQVA 4Y92A 4GBQA 2CDTA 1W6XA 2JW4A 2ED0A 1RI9A 4RTWA 2RNAA 2LQWA 4ORZA 1WXUA 3THKA 1M3AA 4QT7A 1K76A 1CKBA 1OEBA 2DJQA 1NLPC 1X69A 1KFZA 2C0TA 1PHTA 1U3OA 1E6HA 2EYYA 2O88A 4D8DA 1BU1A 1K0SA 2IIMA 1ZX6A 4J9GA 3M0UA 1JO8A 4K11A 5IHKA 1QWEA 4RUGA 4AG2C 2C0OA 1UGVA 2YUOA 1JQQA 1QWFA 2ED1A 1AWJA 5I11A 2FG0A 2A08A 3SHWA 1ZBJA 4AFUC 1CKAA 1WI7A 1MV0B 1T0HA 1X27A 1VYUA 1N5ZA 1GBRA 2HCKA 1QKWA 4HVWA 2CT4A 2KR3A 2DE0X 4Z89A 1HSQA 2O2OA 1JEGA 4OMPA 1AZGB 1PKSA 2E5KA 2YDLA 5L23A 1T3LA 2HDAA 2NWMA 4AFSC 2GTOA 5FWBA 1NEBA 2CSQA 1AD5A 3UA7A 4AFZC 1CSKA 3EG0A 2F2VA 2J6OA 1ZUKA 1H92A 2ECZA 1BK2A 1JXOA 3SEMA 1UUEA 4OMOA 1SPKA 1VYTA 1NLOC 1ZUYA 3QWXX 4J9DA 2RQTA 1X6GA 2KEAA 2JMCA 2RQRA 2NUZA 2KRSA 2DF6A 4RTXA
chains in the Genus database with same CATH superfamily
1TUGB 4E7KA 3OYCA 5GAMf 4M7DF 4J7IA 1D1AA 3GNGA 5GANg 1C0MA 3VS2A 4XTXA 2FZGB 2VB6A 2F2XA 3RMSA 2JXBA 3P8BB 1D3BA 5C6SA 2IVWA 2JOYA 4YTLA 3JB9J 4LDVA 2EYZA 1YP5A 4A53A 4J5YA 3CCUT 2KYBA 2RA2A 4M7DB 1G3TA 3N5BB 5GAN3 4M78D 3BW1A 4M77D 1YJ9T 2DLPA 4LUDA 1QCFA 4OMMA 3HTRA 4M75F 4M78B 5GAMe 3CCVA 2HEQA 4M77B 3UA6A 2LJ1A 1VQ8Q 3ZL7C 3H0FA 3R6OA 4C5IA 2RK2A 1FWZA 2J05A 3QDFA 4BD3A 1E6GA 3L2RA 2C0IA 5CKHA 2EGAA 1J3TA 3PTAA 2X4XA 2QQAA 2QG9B 3CCUQ 1BI2A 1ZSZC 4BI8B 2HQHA 2FB7A 2FRYA 3PE0A 1LNXA 2LVMA 2LCSA 2NYSA 5ECAA 2LX9A 4JLGA 3PVLA 1JJ2A 3GPLA 1K9MU 2E41A 1D0YA 2A7YA 4Z02A 2DL7A 4CRIA 1Y57A 1QKXA 2HSEB 1WLPB 2V8JA 1B3QA 1M2OA 5D6YA 1BKBA 3HFNA 2FEIA 2K7AA 3JCMg 2CUDA 1X6BA 2E6ZA 2ENMA 2QYZA 3H0IA 1X6OA 2I2LA 3OS2A 3S6WA 2D8HA 2G6FX 1M1FA 2E5QA 3JCMe 3L2WA 1PM3A 3EG9A 3CCEA 3BE3A 1VQ5A 1QVGS 1RAEB 2YRDA 3OBWA 2DD5A 4C8QA 2ZGWA 2VASA 2DEQA 1TS9A 2V1QA 1SEMA 1NPPA 3QJYA 1ZA1B 3LH0A 4M75A 1PSFA 4C0FA 3CXCA 1XNIA 1BIBA 4RTYA 4E7ZA 1YIJT 1UTIA 2O4XA 1M27C 3O8VA 2DIQA 3LWHA 2LP5A 4BY6C 1KQSP 3I5RA 3VS3A 1OU9A 4LE9A 5LJ5f 2CUBA 2MIOA 1NJIR 4DEYA 2ROTA 3CCQQ 1TXQA 1IREB 4D6WA 2VUBA 6AT1B 2XDBA 4MZMA 2EJFA 2SEMA 3V8JA 4PJMA 2HMAA 1MNDA 3PMIA 1N6AA 4ZGDB 3UDCA 4OB1B 2RH2A 1V29B 5L8RE 3OYDA 2K6DA 1YIJQ 3X28B 2GFAA 4M7AC 1WHMA 1TUDA 1KD1U 1KQSS 2BZYA 4C8QE 3PNWC 4F14A 2EQIA 3CC7Q 1S72T 2VWFA 1HJDA 1MNEA 2DM1A 3EG1A 4QVCA 1VQMT 1HK9A 1WNLA 5GMKe 1NM7A 2DNUA 2PTKA 4OVAA 2G3RA 2EQMA 4MMKA 3I55A 4PJLA 2CH4W 4JJNK 1ZSZA 3VRYA 4PJNA 2MPXC 1Z9ZA 2QK0A 5LL6S 2FYKA 4BY6B 3CMET 2CS7A 3EGXB 1K73C 1I5LA 3REBB 1MV3A 4F7UB 4M7AF 3MPUB 1S72Q 4PJOD 2LX7A 1VQ8A 2L89A 3DLLA 1Q81U 2Y4YA 4RCBA 1YFNA 1VQMQ 1W2BA 1OX9A 2X3WD 1ACMB 3VYHB 1WJSA 2I0NA 1KD1R 4XTUA 4QVZA 1SG5A 2DXCA 2GFUA 3NFCA 2KQWA 5GANh 3KXTA 3CCUA 1AWOA 3AT1B 2JUFA 3TCJA 2JN0A 3QDRB 4CC4B 1EIFA 2D0NA 1IB8A 2L3RA 1T3SA 3OSSC 2MWOA 1Q82U 2HD0A 2YUQA 4KGZB 1JB0E 3GIBA 2GBQA 3CPWP 2ZPEB 3TSWA 2FO0A 2CT3A 1VQNQ 1UJ0A 2K5IA 3CPFA 2X9HA 3M53A 2Z0WA 1KHIA 4E7IA 5LJ3g 2DXBA 1VOMA 2P84A 5J3BA 1SHFA 2NUTA 1VQ7Q 1ZQ1A 2B86A 4XU3A 2X3XD 4WTOB 2Y4XA 2KROA 5KYXB 3A8LB 3I56T 5AYFA 4E7HA 3INZA 3DKMA 1Q81R 2V26A 4GLMA 1M1KU 1PKTA 5GMKl 1Y71A 3TQ7P 1UGQB 2H8HA 2LC4A 4RTTA 4RG8A 2GGRA 4EPCA 1QVFP 2KVQG 4BI3A 3ZFJA 4XQ3A 1TG0A 1K9MC 3DLMA 2MK5A 1M2VA 1YCYA 2DFUA 1AEYA 2A3LA 1M1GA 1O75A 4ELYC 5DY9A 1WPYA 1MGQA 3GBQA 3I56Q 2MOXA 4LXCA 4ATOA 4M7AA 1WHHA 3QZ9B 3P8HA 3M55A 5DM7R 1ABOA 4J6YA 2HQEA 2DK3A 3HSBA 3RKXA 1RAFB 1W6XA 2RD1A 4ORZA 2LQWA 1D09B 2EWNA 3THKA 3CCQA 2CP6A 1FMVA 5IT9E 1NLPC 1W4SA 1U3OA 3V7SA 2O88A 5GANj 3A8OB 2IIMA 4XTWA 1ZX6A 5FRNA 3M0UA 1JO8A 5IHKA 4JRQA 3PT9A 1YIJA 2JZ2A 2YUOA 2HL3A 3OYKA 1QCOA 3JB9D 4C8QG 1AWJA 2LT1A 3SHWA 4AFUC 3CC7A 1KHCA 3EFRA 1CKAA 1WI7A 4BI4A 1VYUA 4C92C 1RAHB 1GBRA 4GY5A 1UGSB 2KAFA 1QKWA 5KYYB 2E4HA 4HVWA 4MMLA 1Q95G 4QQGA 2DE0X 3OW2P 1HSQA 3M58A 2DZCA 4MDXA 1AZGB 1PKSA 2E5KA 4ME7A 3KUFA 4FM4B 4R56A 2CSQA 1AD5A 1CSKA 3EG0A 2F2VA 1ZUKA 1BK2A 2M0OA 1NPRA 4OMOA 1ZUYA 2KEAA 2YXYA 2KRSA 1KD1C 3UPUA 1S72A 5CKFA 2K2VA 1VQMA 2AZVA 4HVUA 1M90R 2X4WA 4PFOA 3ULRB 4O6JA 4C92F 2VV5A 2ZPIB 3OYEA 2GCXA 1ZSGA 3M0PA 4JS4A 2KSSA 3CCJA 3VJPA 1BB9A 4P5NA 1AHJB 2O9SA 3LLRA 4J6WA 5DLQE 1VQ5T 2CP5A 2CZ7B 2HZYA 3UATA 3OS1A 1Z9QA 4B9XA 2AKLA 1Q7YR 1VQNA 1VQ6T 3NTKA 1GCQA 1B34B 2K3XA 5FU6C 4R55A 1FMKA 3UF4A 1Q81C 1QCNA 1TTHB 4A4KA 1NE8A 2VC8A 1UB4A 4M4ZA 5GJWB 1VQ7A 4XAXB 2A36A 4EIKA 1Y96A 3AHUA 3CC4T 2V8KA 1R0CB 5KYWA 2EKOA 2EYXA 2F5TX 2E70A 3C94A 1K1ZA 4IUQA 1XQHA 5I21A 2QQ9A 2K9GA 2M0YA 1VQLT 1PC0A 1WYXA 2QQRA 2FPDA 3S3OA 4PJJA 4FSSA 1Q82C 2M51A 1N9RA 1MMAA 3MKDA 1VQ6Q 3M59A 2ZAEA 4CC7A 3HKSA 2LRQA 2C06A 1UJYA 2EGEA 1NYGA 1TUCA 2SRCA 2V8IA 4N0AA 2BTTA 2GNCA 1AT1B 1SKUB 4HKEA 3I56A 3CC4Q 2QI2A 3JCMP 3HFOA 2HBPA 2K57A 1G3SA 4M78C 5LJ3h 1BI0A 2EVRA 4M77C 1M1KC 4CI0C 4DEXA 3H41A 1OPLA 2VXFA 2DRKA 1VQLQ 2RJFA 1C1AA 4CC3A 3ZBDA 2KT8A 2DL3A 4PJOG 3I55T 2DYIA 5CKBA 5FU7C 2J06A 1Q86U 3OYNA 1YWOA 1KJWA 2R57A 1JJ2S 5CKEA 2LZ6B 2ZPFB 1K8AU 1X2KA 2RM4A 1VQ8T 5LJ5d 1I8FA 2FPFA 1FXXA 4RG2A 4AG1C 4M78F 4NOYA 3OYJA 4M77F 2A37A 1B7TA 3R6NA 4IUTA 2JVVA 4L6V5 2VGMA 3OSVA 3I55Q 3HHTB 2AIRB 2LNVA 2LQKA 5GAMg 1K4US 3EFOA 3FRNA 5GAOp 4PFPA 2KXCA 3QO3A 3A98A 2JM9A 2EGCA 4JPBW 1U1TA 2H3JA 2P0QA 2VXEA 1SF9A 2XKOC 1Q86R 3SWNA 4C0DC 3L2VA 4PL6A 2HQXA 3J80E 3CXCS 1AWWA 4O5VA 3RIRA 5FU7B 2KK4A 1K8AR 1JU5C 4A4FA 3RKWA 1ZA2B 2DL8A 1GXIE 2A0FB 1HYOA 5CCAA 1WJRA 4C8QD 2DL4A 2DMOA 1UECA 2OJ2A 2JMAA 1RUWA 2RHIA 1VQ4T 2CKKA 4GLKA 3M4GA 1N8RR 3MHXA 2L0AA 5LJ3j 4FT4A 4C8QB 2P4RA 4M75D 1LOJA 4PLIA 1RAGB 2PQWA 4F04B 3L2QA 4FYWB 3ZEHA 2ABLA 1QVGP 1W1FA 3C4SA 2COWA 5DLOA 2BE9B 2QA4Q 1WXTA 2RQWA 2RQUA 5GAN4 3A1PA 1BIAA 7AT1B 1NJIU 2EKHA 4E7LA 1GL5A 4M7DA 1D1BA 4DBRA 5GAOq 5CAIA 4C0GA 3JAME 1VQ4Q 1PWTA 3LGFA 1FMWA 1K0XA 4EMKC 2HBWA 4FYXB 4M78A 1R77A 4C0DB 3RKYA 3CC2T 3CCQT 3BDUA 3QG1A 3JB9G 1ARKA 2RN8A 2KGTA 5GAN8 5IN1A 2PU9B 2OTJQ 3E19A 1VQ6A 3EGUA 4BACA 4HT8A 1GFDA 1IHVA 2A28A 2WSFE 1OX8A 1TU0B 3J81E 1WDXA 2CH4A 1WHKA 3UT1A 4IIOA 2JM8A 1OZ3A 3CC4A 3QJ6A 1C6VX 2L5QA 2MMPA 2CZ0B 1WJQA 1W2BS 3CC7T 3C0CA 3M0RA 2LMJA 3CC2Q 3G71T 3HRTA 1H3ZA 3LYIA 1G8XA 2KYMA 1VQLA 4BE0A 1MMGA 4PJOC 2EPDA 3M5AA 5FW9A 2J6KA 1G3WA 3FEOA 2VVKA 1EZZB 1G5VA 4X34A 3JCMW 2QEXT 5GMKi 4ANJA 4DOWA 3WVEB 4EMKB 1WFWA 4OMLA 4JJBA 4LDXA 1MMDA 5LJ5e 2MI6A 2JT4A 3JB9I 2DO3A 4JRIA 3RMQA 1RLPC 3G71Q 4M75E 4QW2A 2XG8D 2DTHA 2XK0A 3M0QA 4F7UF 3OYBA 4NL3A 4J9HA 2RQVA 1ZBXA 2ED0A 1RI9A 2RNAA 5GAN5 1V76A 3M57A 3GNFB 4PJOF 3TEEA 3CCJT 4QT7A 5D6XA 2QEXQ 1Q86C 4LDUA 2PVGB 1X69A 1KFZA 2P0KA 3MEAA 2DD4A 3CCMA 4OP0A 4D8DA 3GP8A 3EH2A 1BU1A 2JNGA 4Q5WA 4BUGA 2EYQA 1K8AC 1KC8R 3WXMB 1VQNT 4RMOA 4BE2A 5KCOA 2QGFB 1QWFA 3M4YA 5CQXA 4PJOB 4KUIA 2ED1A 2FG0A 1VQ7T 3BFMA 2A08A 4L59A 3CD6A 2HKQB 1T0HA 2DZ9A 3JSCA 1IZ6A 2IG0A 3CCJQ 2RB6A 1KG1A 2HAXA 3E1SA 1RI0A 2O2OA 4BB7A 4OMPA 5L23A 3FJPA 1TSFA 2GTOA 5GAMh 3Q1JA 2RHYA 2YRCA 4RKUE 3DB3A 2ECZA 4OB0B 1BI3A 1VYTA 5D7UA 3VU3C 2QA4A 1O9SA 4QQ6A 2DF6A 4RTXA 3SDZA 3MP8A 1QP3A 1PSEA 5D6WA 2E10A 4KUDK 2XD0A 1EFNA 4NL2A 1KQSA 2KY9A 3RESA 1VQ4A 2AHJB 2QDLA 1WIEA 3EGXA 3FIFA 2QDYB 2BZXA 3LX7A 3QBYA 2ZPBB 3QYGB 4F7UA 3NGPA 4DBQA 1UGPB 2DXTA 4C5EA 1KIKA 4EMGA 3NPFA 2K2MA 1H641 1X01A 4XTZA 4IUPA 2ESWA 2KT1A 2L3SA 3MP6A 3GLXA 2OTJA 3A8GB 1GBQA 5IHIA 1HD3A 3D7SB 3EGDB 3OA6A 4X9CA 4KULA 3T9NA 3VUBA 3U23A 3EFSA 2PNIA 2DA9A 1PG5B 4X1VA 1ZHIA 1NJIC 2LQ8A 4QVDA 3VYGA 4R0KA 2AT1B 4A54A 1LCKA 3CCRT 1S1NA 3L2ZA 4A63B 3PIPA 4RTUA 3CEYA 4AFQC 3JCMh 1YN8A 1VQOA 3CC2A 2EQUA 3OYIA 2CREA 1F1BB 3JV3A 3PMTA 5GAOl 5A0GA 1X75C 2ATCB 3JB9F 3OYAA 4IUVA 1FX7A 2DX1A 5CQYA 4ZNXA 3VV0A 1IGUA 2KI7A 1YJNT 4N4GA 1P92A 2AZSA 1M90U 3LW5E 2D8JA 3E2UA 3M54A 4ZTFA 4J9EA 5GAMj 1PD0A 2CP7A 3CCRQ 1U5SA 3PGGA 2AK5A 4VUBA 1FYNA 1WX6A 3OS0A 2E1HA 2BKDN 4M75G 1YNZA 2KRNA 1GCPA 2KBTA 2H3EB 3G71A 4HCBA 4M7AE 5M9OA 5GJVB 1B07A 5IXFA 1I1JA 1M8MA 5AT1B 3FJ5A 4Y28E 1R8OB 4RCCA 4LD6A 5KH6A 3OYHA 2KNBB 2NUPA 1YJNQ 1Q7YU 3C95A 5KYNA 3VS5A 4LDWA 2QEXA 2M16A 2DIGA 3EG2A 4KGVB 4OMFB 4OMNA 2CSIA 3FC3A 2XU8A 1U06A 5HKCA 3P8DA 5GANd 3CPWA 2LJ3A 3CBMA 2F2WA 3NTHA 1WQWA 5HY6A 4J9BA 5HK3A 4PLLA 2K79A 4ZTJA 4UC4A 5KYWB 3LWIA 5GMKh 4JZ4A 4ESRA 2RHZA 2KMTA 1IO6A 5KE2A 4EDUA 3M56A 2CYZB 2FZKB 2QGGA 4AMCA 1WHGA 2PUOB 4X9DA 2R5MA 5KE3A 1M30A 3VRZA 4II1A 1UFFA 1PD1A 2FZCB 3TVTA 2BZ8A 1SHGA 1KQ1A 1QP2A 1QVFA 4JDSA 4RTVA 4LNPA 4MZTA 1PNJA 1NYFA 1AZEA 2CP2A 1RAIB 1MUZA 3MEUA 5KYYA 1G83A 1OU8A 2RF0A 4Z8AA 5CO7A 4IURA 2WSEE 2CP3A 2MWPA 3H0HA 3FLGA 1YITQ 3JCMQ 1YJWT 2EBPA 3A8MB 4ZN3A 1H3HA 1YWPA 2L3PA 2W0ZA 3QKJA 2EW3A 4FIBA 2RJDA 3ASKA 4HT9A 3C12A 2OTLT 3MP1A 1YBYA 2D6FA 1LVKA 1DJ7B 5FLXE 5KYUB 4JLIA 1G3YA 2W10A 1X2QA 3ER0A 4V2SA 2YLBA 5J39A 2RO0A 5IXBA 3CBPA 3VS4A 2X51A 1GFCA 3NHNA 3QZ5B 1YHQQ 2YRVA 1JJ2P 1VQ9T 1YJWQ 4FSXA 4PFZA 2BUDA 3PFSA 1OPKA 3QYHB 3FB9A 2D9TA 1D3BB 3CCSQ 4E7JA 1KSWA 2YT6A 2KE9A 1QQJA 2OTLQ 4DA4A 1RABB 2LQNA 4B6MA 3QHSA 1QW1A 2HL5C 4C92A 2OI3A 2HNIA 2B8AA 2FRWA 3NTIA 5GMKj 3OW2A 1UG1A 2KDSA 1B34A 4OB2B 1M3CA 4KBMB 3V7CA 4XTVA 3QSUA 3MEVA 2DJZA 1VQ9Q 1YI2Q 1Y07A 2DILA 1M3BA 1TOVA 3BY7A 4L5GA 3FDRA 3TREA 3JRZA 3RDVA 3CCMT 3O5ZA 3META 2E12A 3I35A 1JBMA 4C8QC 2R5AA 5GAN2 5GANf 1ZUUA 4J8OA 4F17A 3ME9A 1QLYA 2IPOB 2YSQA 3CCRA 4M75C 1N8RU 4WF2A 3CXCP 3CD6T 1I07A 4KH0B 4M7AG 1AOJA 1WA7A 3EHQA 4JRKA 2XDDA 2EYWA 1MHNA 2JTEA 3CCLQ 4ELZC 2D0QB 5IAYA 4BDZA 1PRLC 1YJNA 3CCMQ 1JXMA 1OI1A 4C92E 1EX4A 2RPNA 1RLQC 4M7DD 3CMAQ 1M90C 5GANe 2P0PA 2K3YA 2RMOA 4TVRA 4C8QF 3OYFA 2RJEA 2XMFA 2AKKA 2L3QA 1TWBA 3L42A 3H6ZA 2QA4T 3CD6Q 1WHLA 1X43A 2BE7D 2GQVA 5GAN6 3WVDB 1RAAB 3EG9B 4OB3B 5I2SA 1XTDA 2XDPA 3HRSA 2QXFA 3RUXA 1NZ9A 2M9UA 4RTZA 2EQKA 1K73R 4HCZA 2K5LA 4GBQA 2DVEA 2JW4A 2LTOA 4RTWA 3G6ET 1Q7YC 1WXUA 3S3MA 1M3AA 5GAN7 2CZ6B 4Y91A 1BYMA 2OAUA 2MF2A 4DBFA 1SSFA 4OGCA 3SFMA 4ZN1A 4M75B 2F5KA 4FT2A 2O4XB 1YJ9Q 2OTJT 2E65A 4OGEA 4K11A 4A4HA 4AG2C 3JCMf 1UGVA 1KQ2A 1YITA 5I11A 2FVUA 3EH1A 1ZBJA 4ZGEB 1UGRB 1W2BP 1BI1A 3M9QA 3MO8A 4M77A 3G6EQ 1N5ZA 2QQSA 2HCKA 2HKNA 1VQOT 2QTVA 2CT4A 2KR3A 5CKDA 4Z89A 3OY9A 3E9GA 1I81A 2YDLA 1T3LA 5LJ3d 2HDAA 4KT0E 3HL8A 4AFSC 5FWBA 3GOXA 1NEBA 3RERA 2MYSA 3UA7A 3G4ST 3L1AA 2J6OA 1VQPT 2R58A 1YHQA 3JB9H 1H92A 4J7FA 1JXOA 1YJWA 1UUEA 2QQBA 1SPKA 1NLOC 4FYVB 1X6GA 1TH7A 3URGA 1KK7A 1D0XA 3CCSA 1M8VA 4WCIA 4D8KA 4KH1B 3X25B 8ATCB 2OTLA 1VQOQ 2PZ1A 3A8HB 1K9MR 1ZSZB 3BDLA 4M7DE 1UHCA 3F70A 5FROA 2M1HA 4J9FA 2F69A 1IHWA 3OQ5A 1WHJA 3SD4A 2HSPA 4KRTA 2OX7A 1LJOA 3OMGA 4XU2A 1KC8U 4M78E 3JCMc 4M77E 1R0BG 5LJ5g 3G4SQ 1OOTA 1VQPQ 1VIEA 1VQ9A 2DVJA 1SSHA 3OYGA 1YI2A 4OF1A 1E7OA 1W70A 3E9FA 1VUBA 2RI2A 3I9QA 1UDLA 4HCCA 3OYYA 1HXDA 3QUIA 3V8KA 2J6FA 1H8KA 4JS5A 4MZPA 2F1LA 4C5HA 3TU4K 5HCKA 2VGNA 2LNHB 5A2QE 4FW2A 4FW1A 3HPWA 5C0MA 3CCLA 2YUNA 2ZPGB 2VYTA 1IRXA 1I4K1 4EMHA 5CK9A 4FCYA 1K9AA 1OQKA 4C92G 2COYA 2COZA 5IHNA 4MDWA 1AWXA 4BDYA 2EJ9A 2L8DA 2NUTB 1RL2A 4PKCC 3M0TA 4B9WA 4IUUA 3SB2A 5A0DA 1QVGA 1GRIA 4FYYB 3CMAA 4J9IA 3REAB 4Z88A 4HCKA 1A0NB 2RHUA 4C0ZA 1WZOA 1JRIA 2PUKB 2ZPHB 3OYMA 3RBBB 3CQTA 1N8RC 3JCMJ 1UE9A 4HXJA 3LGLA 3HP9A 4E7SA 2DKGA 2OAWA 1YCSB 4XU0A 5A0LA 4JRPA 3NMZC 5GAOr 1M5Q1 3M0SA 5GMKm 3UWNA 4QKUA 2K3BA 2DL5A 1M2VB 3PVQA 1BBZA 4EMKA 2PVDB 2KXDA 2MAMA 4E6RA 4LUEA 1IGQA 4N4IA 2MCNA 2KRMA 4M7AD 2EAYA 4CC2A 2L2PA 1AVZC 1VQKT 1NG2A 4A4GA 5I22A 5CIUA 2QAZA 1PRMC 4M7AB 5LJ3f 9ATCB 2CZ1B 2J7IA 3MEWA 5IH2A 1YJ9A 3CMEQ 3VUZA 2LCLA 2XICA 4BE1A 3VS1A 2K5FA 4JJCA 2YUPA 2NLUA 2Y90A 1QMCA 2K4YA 4ZGJB 3JCMX 1Y7XA 1U8RA 2JS0A 3OS5A 3G6EA 1RADB 2DERA 1NEGA 1VQKQ 4JJDA 1I5OB 4DOVA 1OYXA 4LN2A 4XK8E 4PJOA 5LJ3e 5GAOm 1OULA 5EC7A 2P4TA 3I5SA 3GF5A 2DTIA 3HRUA 1PCXA 2XHCA 3KBGA 2LDMA 3CPWS 2DBMA 5FRMA 2GQIA 1RACB 5EG2A 2X4JA 1I0CA 2LJ0A 4F16A 1GCQC 1N9SA 1OV3A 3MJXA 1XOVA 5HK0A 2E6NA 2XIDA 4LD9K 3OYLA 1Q82R 3V7RA 2ROLA 4M7DG 2YHTA 2NUPB 3VS6A 2ZZDA 5CVIA 4HVVA 3G7ZA 2CGHA 4M78G 2RI5A 2X4YA 5J26A 4M77G 5I2MA 4F7UE 5KYXA 2RI3A 1QVFS 3G4SA 2JJ9A 4N4HA 1VQPA 1BCMA 3IQLA 4PNOA 4DBHA 2JTFA 1M1KR 4PJOE 1IXDA 3RR6A 2M02A 1OZ2A 1UEBA 4N0AC 1V1CA 2O9VA 3H9NA 5GAOn 3CCVT 2CP0A 1UHFA 2EJGA 2WACA 4J83A 4PK4A 3X26B 1SRLA 2O01E 3EGDA 3QWYA 1KC8C 5FWCA 4A4EA 3JCMV 2RK1A 2DEUA 4XTYA 1Y0MA 3CBOA 2DYBA 2WSCE 4HA8A 2DAQA 3V8LA 2E64A 4DQ2A 5LJ5h 2DBKA 4E47A 1Y96B 3KFVA 2V1RA 3VS7A 3EG3A 1WXBA 2QASA 3CCVQ 1G2BA 3RNJA 8AT1B 5GAMd 2JS2A 3QIIA 2YLCA 4JZ3A 4IIMA 1YITT 3VKIA 2XI9A 2YWWA 2VKNA 2RHXA 3LH5A 4AT1B 1SRMA 1D0ZA 2FL7A 4JUVA 3TSZA 2X35A 3PIOA 2DTOA 3OW2S 2FHDA 3J7AF 3S3NA 3QXEB 2O31A 2GTJA 2E3IA 2FPEA 1U1SA 1WQ7A 2D1XA 4FU6A 2DRMA 4J9CA 3VS0A 2LCCA 2EQJA 4OMQA 4C92D 4C5GA 1YHQT 3CCET 3CMEA 2DETA 2BIVA 3SWNC 1VA7A 3EHRA 1VIFA 4C92B 1N27A 1ABQA 3MCAB 1VYVA 3CCST 1ZLMA 3QPHA 4NS5A 1T0JA 2DXUA 3X24B 2LT4A 4Y92A 2QTXA 1VQKA 2CDTA 2DPPB 1K76A 1CKBA 1OEBA 2DJQA 3H8ZA 3JCMd 4IKFA 3CCEQ 3A5ZB 1YI2T 2C0TA 1PHTA 1VQ5Q 2PVOB 1E6HA 2EYYA 1QVPA 3OMCA 3JCMb 2EIFA 3OBYA 1K0SA 1M4ZA 4J9GA 1QWEA 4RUGA 2GF7A 1BCOA 2C0OA 1JQQA 2E3HA 3EFOB 3X20B 5LJ5j 2RJCA 1LPLA 4M7DC 1D1CA 1MV0B 4LDYA 1M9SA 1X27A 2ZCFB 5CR2A 3DB4A 3CCLT 4J6XA 3OB9A 3G1JA 1JEGA 4F7UG 3SWNB 1WGSA 2NWMA 3L2UA 4FL6A 4QQDA 3EAEA 4XU1A 4AFZC 1MMNA 5FU6B 3CMAT 5KCHA 1NBEB 4KGXB 1XJWB 3SEMA 5KYUA 2JTMA 4E2FB 3QWXX 4J9DA 2RQTA 1K73U 2JMCA 2RQRA 2NUZA 2EFIA
chains in the Genus database with same CATH topology
4WCIA 4D8KA 2PZ1A 1EFNA 2AZVA 4HVUA 3ULRB 1UHCA 3VS2A 4J9FA 2QDLA 1WIEA 2BZXA 2F2XA 2HSPA 4KRTA 2JXBA 1ZSGA 3M0PA 3NGPA 1KIKA 1BB9A 1OOTA 3NPFA 2K2MA 2O9SA 2EYZA 1YP5A 2KYBA 2DVJA 1SSHA 1E7OA 1W70A 2ESWA 2KT1A 2L3SA 3I9QA 1GBQA 1UDLA 5IHIA 1HD3A 2DLPA 3UATA 1Z9QA 4LUDA 1QCFA 3U23A 4OMMA 2PNIA 2AKLA 2DA9A 4X1VA 2HEQA 1GCQA 3UA6A 2LJ1A 1FMKA 3UF4A 4R0KA 3ZL7C 2J6FA 1H8KA 4M4ZA 5GJWB 1LCKA 3H0FA 2A36A 1S1NA 4A63B 2J05A 4EIKA 5HCKA 4RTUA 2LNHB 4AFQC 1E6GA 2C0IA 1YN8A 2YUNA 2EGAA 1J3TA 2EYXA 2CREA 3JV3A 1K9AA 1K1ZA 5IHNA 2FRYA 1AWXA 3PE0A 2K9GA 2M0YA 2DX1A 1WYXA 3M0TA 4ZNXA 2LCSA 2FPDA 5ECAA 4FSSA 2M51A 1GRIA 2AZSA 3PVLA 4J9IA 3REAB 4Z88A 4HCKA 4CC7A 2D8JA 1A0NB 2DL7A 4J9EA 1UJYA 2EGEA 1NYGA 1TUCA 1Y57A 2SRCA 2GNCA 1U5SA 2AK5A 2BTTA 1QKXA 3RBBB 1FYNA 3CQTA 1WX6A 1WLPB 1UE9A 1B3QA 4HXJA 1YNZA 2KRNA 1GCPA 2KBTA 2OAWA 2FEIA 1YCSB 2K7AA 5GJVB 1B07A 2EVRA 5IXFA 1I1JA 3NMZC 3M0SA 1M8MA 2CUDA 2K3BA 2DL5A 4DEXA 1X6BA 3FJ5A 1BBZA 1OPLA 3H41A 3PVQA 2KXDA 2ENMA 4E6RA 3H0IA 4LUEA 2DRKA 2KNBB 2D8HA 2KRMA 2MCNA 4CC3A 2KT8A 2G6FX 4CC2A 2DL3A 2L2PA 1AVZC 1NG2A 3VS5A 5I22A 2J06A 3EG2A 1PRMC 4OMNA 2CSIA 1YWOA 1KJWA 1U06A 2J7IA 5IH2A 2LJ3A 2F2WA 3VS1A 4JJCA 2LZ6B 2V1QA 4J9BA 1SEMA 2YUPA 2K79A 1X2KA 4JZ4A 4RTYA 4ESRA 2FPFA 1UTIA 1IO6A 1M27C 4AG1C 2JS0A 2LP5A 3I5RA 2A37A 1M30A 3R6NA 3VS3A 3VRZA 4LE9A 1NEGA 1UFFA 2CUBA 2MIOA 4JJDA 1K4US 4DEYA 3TVTA 2ROTA 4LN2A 2BZ8A 1SHGA 4RTVA 2KXCA 5EC7A 4LNPA 1PNJA 3A98A 1NYFA 3I5SA 2JM9A 1AZEA 2EGCA 2SEMA 4JPBW 1MUZA 1G83A 2RF0A 2DBMA 4Z8AA 2GQIA 1I0CA 2LJ0A 2K6DA 4F16A 1OV3A 1GCQC 1XOVA 3H0HA 1TUDA 2EBPA 2BZYA 1H3HA 1YWPA 4F14A 1AWWA 2EQIA 2L3PA 2W0ZA 2ROLA 1JU5C 3VS6A 2EW3A 2VWFA 1HJDA 2DL8A 2DM1A 3EG1A 2DL4A 2DMOA 1NM7A 2DNUA 2PTKA 4HVVA 1UECA 2OJ2A 2JMAA 1RUWA 2W10A 1X2QA 2L0AA 2P4RA 5IXBA 2CH4W 3VS4A 3VRYA 1Z9ZA 2ABLA 3IQLA 1GFCA 3NHNA 1W1FA 1OPKA 1WXTA 2RQWA 2RQUA 3REBB 1MV3A 2LX7A 1V1CA 1KSWA 2EKHA 2O9VA 2YT6A 2KE9A 1GL5A 1UHFA 2LQNA 2X3WD 1SRLA 2I0NA 1PWTA 2OI3A 1K0XA 2FRWA 2HBWA 3QWYA 1UG1A 1M3CA 5FWCA 1AWOA 1Y0MA 4CC4B 2DYBA 2D0NA 1ARKA 2RN8A 2DILA 1M3BA 1T3SA 2KGTA 3EGUA 3O5ZA 2YUQA 2DBKA 3I35A 3KFVA 2GBQA 2V1RA 3VS7A 1GFDA 3EG3A 2A28A 3TSWA 1WXBA 2FO0A 2CT3A 1UJ0A 1WDXA 1G2BA 1ZUUA 2CH4A 3RNJA 4F17A 2JS2A 1QLYA 2YSQA 4JZ3A 4IIOA 4IIMA 2JM8A 1SHFA 2B86A 2VKNA 2X3XD 1I07A 1AOJA 2KROA 3LH5A 1WA7A 3EHQA 3C0CA 1SRMA 3M0RA 3TSZA 2EYWA 2JTEA 2LMJA 4GLMA 1PKTA 2H8HA 4RTTA 1PRLC 2KYMA 2EPDA 2GGRA 1JXMA 2RPNA 2O31A 5FW9A 2GTJA 2J6KA 1RLQC 2FPEA 2VVKA 2D1XA 1TG0A 2DRMA 4J9CA 3VS0A 2RMOA 4OMQA 2XMFA 1AEYA 2AKKA 2L3QA 1WFWA 4OMLA 1VA7A 3EHRA 4JJBA 1ABQA 1X43A 3GBQA 1VYVA 2MOXA 2JT4A 1RLPC 1ZLMA 1T0JA 1ABOA 3M0QA 4RTZA 4J9HA 2RQVA 4Y92A 4GBQA 2CDTA 1W6XA 2JW4A 2ED0A 1RI9A 4RTWA 2RNAA 2LQWA 4ORZA 1WXUA 3THKA 1M3AA 4QT7A 1K76A 1CKBA 1OEBA 2DJQA 1NLPC 1X69A 1KFZA 2C0TA 1PHTA 1U3OA 1E6HA 2EYYA 2O88A 4D8DA 1BU1A 1K0SA 2IIMA 1ZX6A 4J9GA 3M0UA 1JO8A 4K11A 5IHKA 1QWEA 4RUGA 4AG2C 2C0OA 1UGVA 2YUOA 1JQQA 1QWFA 2ED1A 1AWJA 5I11A 2FG0A 2A08A 3SHWA 1ZBJA 4AFUC 1CKAA 1WI7A 1MV0B 1T0HA 1X27A 1VYUA 1N5ZA 1GBRA 2HCKA 1QKWA 4HVWA 2CT4A 2KR3A 2DE0X 4Z89A 1HSQA 2O2OA 1JEGA 4OMPA 1AZGB 1PKSA 2E5KA 2YDLA 5L23A 1T3LA 2HDAA 2NWMA 4AFSC 2GTOA 5FWBA 1NEBA 2CSQA 1AD5A 3UA7A 4AFZC 1CSKA 3EG0A 2F2VA 2J6OA 1ZUKA 1H92A 2ECZA 1BK2A 1JXOA 3SEMA 1UUEA 4OMOA 1SPKA 1VYTA 1NLOC 1ZUYA 3QWXX 4J9DA 2RQTA 1X6GA 2KEAA 2JMCA 2RQRA 2NUZA 2KRSA 2DF6A 4RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCI A;  4D8K A;  2PZ1 A;  1EFN A;  2AZV A;  4HVU A;  3ULR B;  1UHC A;  3VS2 A;  4J9F A;  2QDL A;  1WIE A;  2BZX A;  2F2X A;  2HSP A;  4KRT A;  2JXB A;  1ZSG A;  3M0P A;  3NGP A;  1KIK A;  1BB9 A;  1OOT A;  3NPF A;  2K2M A;  2O9S A;  2EYZ A;  1YP5 A;  2KYB A;  2DVJ A;  1SSH A;  1E7O A;  1W70 A;  2ESW A;  2KT1 A;  2L3S A;  3I9Q A;  1GBQ A;  1UDL A;  5IHI A;  1HD3 A;  2DLP A;  3UAT A;  1Z9Q A;  4LUD A;  1QCF A;  3U23 A;  4OMM A;  2PNI A;  2AKL A;  2DA9 A;  4X1V A;  2HEQ A;  1GCQ A;  3UA6 A;  2LJ1 A;  1FMK A;  3UF4 A;  4R0K A;  3ZL7 C;  2J6F A;  1H8K A;  4M4Z A;  5GJW B;  1LCK A;  3H0F A;  2A36 A;  1S1N A;  4A63 B;  2J05 A;  4EIK A;  5HCK A;  4RTU A;  2LNH B;  4AFQ C;  1E6G A;  2C0I A;  1YN8 A;  2YUN A;  2EGA A;  1J3T A;  2EYX A;  2CRE A;  3JV3 A;  1K9A A;  1K1Z A;  5IHN A;  2FRY A;  1AWX A;  3PE0 A;  2K9G A;  2M0Y A;  2DX1 A;  1WYX A;  3M0T A;  4ZNX A;  2LCS A;  2FPD A;  5ECA A;  4FSS A;  2M51 A;  1GRI A;  2AZS A;  3PVL A;  4J9I A;  3REA B;  4Z88 A;  4HCK A;  4CC7 A;  2D8J A;  1A0N B;  2DL7 A;  4J9E A;  1UJY A;  2EGE A;  1NYG A;  1TUC A;  1Y57 A;  2SRC A;  2GNC A;  1U5S A;  2AK5 A;  2BTT A;  1QKX A;  3RBB B;  1FYN A;  3CQT A;  1WX6 A;  1WLP B;  1UE9 A;  1B3Q A;  4HXJ A;  1YNZ A;  2KRN A;  1GCP A;  2KBT A;  2OAW A;  2FEI A;  1YCS B;  2K7A A;  5GJV B;  1B07 A;  2EVR A;  5IXF A;  1I1J A;  3NMZ C;  3M0S A;  1M8M A;  2CUD A;  2K3B A;  2DL5 A;  4DEX A;  1X6B A;  3FJ5 A;  1BBZ A;  1OPL A;  3H41 A;  3PVQ A;  2KXD A;  2ENM A;  4E6R A;  3H0I A;  4LUE A;  2DRK A;  2KNB B;  2D8H A;  2KRM A;  2MCN A;  4CC3 A;  2KT8 A;  2G6F X;  4CC2 A;  2DL3 A;  2L2P A;  1AVZ C;  1NG2 A;  3VS5 A;  5I22 A;  2J06 A;  3EG2 A;  1PRM C;  4OMN A;  2CSI A;  1YWO A;  1KJW A;  1U06 A;  2J7I A;  5IH2 A;  2LJ3 A;  2F2W A;  3VS1 A;  4JJC A;  2LZ6 B;  2V1Q A;  4J9B A;  1SEM A;  2YUP A;  2K79 A;  1X2K A;  4JZ4 A;  4RTY A;  4ESR A;  2FPF A;  1UTI A;  1IO6 A;  1M27 C;  4AG1 C;  2JS0 A;  2LP5 A;  3I5R A;  2A37 A;  1M30 A;  3R6N A;  3VS3 A;  3VRZ A;  4LE9 A;  1NEG A;  1UFF A;  2CUB A;  2MIO A;  4JJD A;  1K4U S;  4DEY A;  3TVT A;  2ROT A;  4LN2 A;  2BZ8 A;  1SHG A;  4RTV A;  2KXC A;  5EC7 A;  4LNP A;  1PNJ A;  3A98 A;  1NYF A;  3I5S A;  2JM9 A;  1AZE A;  2EGC A;  2SEM A;  4JPB W;  1MUZ A;  1G83 A;  2RF0 A;  2DBM A;  4Z8A A;  2GQI A;  1I0C A;  2LJ0 A;  2K6D A;  4F16 A;  1OV3 A;  1GCQ C;  1XOV A;  3H0H A;  1TUD A;  2EBP A;  2BZY A;  1H3H A;  1YWP A;  4F14 A;  1AWW A;  2EQI A;  2L3P A;  2W0Z A;  2ROL A;  1JU5 C;  3VS6 A;  2EW3 A;  2VWF A;  1HJD A;  2DL8 A;  2DM1 A;  3EG1 A;  2DL4 A;  2DMO A;  1NM7 A;  2DNU A;  2PTK A;  4HVV A;  1UEC A;  2OJ2 A;  2JMA A;  1RUW A;  2W10 A;  1X2Q A;  2L0A A;  2P4R A;  5IXB A;  2CH4 W;  3VS4 A;  3VRY A;  1Z9Z A;  2ABL A;  3IQL A;  1GFC A;  3NHN A;  1W1F A;  1OPK A;  1WXT A;  2RQW A;  2RQU A;  3REB B;  1MV3 A;  2LX7 A;  1V1C A;  1KSW A;  2EKH A;  2O9V A;  2YT6 A;  2KE9 A;  1GL5 A;  1UHF A;  2LQN A;  2X3W D;  1SRL A;  2I0N A;  1PWT A;  2OI3 A;  1K0X A;  2FRW A;  2HBW A;  3QWY A;  1UG1 A;  1M3C A;  5FWC A;  1AWO A;  1Y0M A;  4CC4 B;  2DYB A;  2D0N A;  1ARK A;  2RN8 A;  2DIL A;  1M3B A;  1T3S A;  2KGT A;  3EGU A;  3O5Z A;  2YUQ A;  2DBK A;  3I35 A;  3KFV A;  2GBQ A;  2V1R A;  3VS7 A;  1GFD A;  3EG3 A;  2A28 A;  3TSW A;  1WXB A;  2FO0 A;  2CT3 A;  1UJ0 A;  1WDX A;  1G2B A;  1ZUU A;  2CH4 A;  3RNJ A;  4F17 A;  2JS2 A;  1QLY A;  2YSQ A;  4JZ3 A;  4IIO A;  4IIM A;  2JM8 A;  1SHF A;  2B86 A;  2VKN A;  2X3X D;  1I07 A;  1AOJ A;  2KRO A;  3LH5 A;  1WA7 A;  3EHQ A;  3C0C A;  1SRM A;  3M0R A;  3TSZ A;  2EYW A;  2JTE A;  2LMJ A;  4GLM A;  1PKT A;  2H8H A;  4RTT A;  1PRL C;  2KYM A;  2EPD A;  2GGR A;  1JXM A;  2RPN A;  2O31 A;  5FW9 A;  2GTJ A;  2J6K A;  1RLQ C;  2FPE A;  2VVK A;  2D1X A;  1TG0 A;  2DRM A;  4J9C A;  3VS0 A;  2RMO A;  4OMQ A;  2XMF A;  1AEY A;  2AKK A;  2L3Q A;  1WFW A;  4OML A;  1VA7 A;  3EHR A;  4JJB A;  1ABQ A;  1X43 A;  3GBQ A;  1VYV A;  2MOX A;  2JT4 A;  1RLP C;  1ZLM A;  1T0J A;  1ABO A;  3M0Q A;  4RTZ A;  4J9H A;  2RQV A;  4Y92 A;  4GBQ A;  2CDT A;  1W6X A;  2JW4 A;  2ED0 A;  1RI9 A;  4RTW A;  2RNA A;  2LQW A;  4ORZ A;  1WXU A;  3THK A;  1M3A A;  4QT7 A;  1K76 A;  1CKB A;  1OEB A;  2DJQ A;  1NLP C;  1X69 A;  1KFZ A;  2C0T A;  1PHT A;  1U3O A;  1E6H A;  2EYY A;  2O88 A;  4D8D A;  1BU1 A;  1K0S A;  2IIM A;  1ZX6 A;  4J9G A;  3M0U A;  1JO8 A;  4K11 A;  5IHK A;  1QWE A;  4RUG A;  4AG2 C;  2C0O A;  1UGV A;  2YUO A;  1JQQ A;  1QWF A;  2ED1 A;  1AWJ A;  5I11 A;  2FG0 A;  2A08 A;  3SHW A;  1ZBJ A;  4AFU C;  1CKA A;  1WI7 A;  1MV0 B;  1T0H A;  1X27 A;  1VYU A;  1N5Z A;  1GBR A;  2HCK A;  1QKW A;  4HVW A;  2CT4 A;  2KR3 A;  2DE0 X;  4Z89 A;  1HSQ A;  2O2O A;  1JEG A;  4OMP A;  1AZG B;  1PKS A;  2E5K A;  2YDL A;  5L23 A;  1T3L A;  2HDA A;  2NWM A;  4AFS C;  2GTO A;  5FWB A;  1NEB A;  2CSQ A;  1AD5 A;  3UA7 A;  4AFZ C;  1CSK A;  3EG0 A;  2F2V A;  2J6O A;  1ZUK A;  1H92 A;  2ECZ A;  1BK2 A;  1JXO A;  3SEM A;  1UUE A;  4OMO A;  1SPK A;  1VYT A;  1NLO C;  1ZUY A;  3QWX X;  4J9D A;  2RQT A;  1X6G A;  2KEA A;  2JMC A;  2RQR A;  2NUZ A;  2KRS A;  2DF6 A;  4RTX A; 
#chains in the Genus database with same CATH topology
 1TUG B;  4E7K A;  3OYC A;  5GAM f;  4M7D F;  4J7I A;  1D1A A;  3GNG A;  5GAN g;  1C0M A;  3VS2 A;  4XTX A;  2FZG B;  2VB6 A;  2F2X A;  3RMS A;  2JXB A;  3P8B B;  1D3B A;  5C6S A;  2IVW A;  2JOY A;  4YTL A;  3JB9 J;  4LDV A;  2EYZ A;  1YP5 A;  4A53 A;  4J5Y A;  3CCU T;  2KYB A;  2RA2 A;  4M7D B;  1G3T A;  3N5B B;  5GAN 3;  4M78 D;  3BW1 A;  4M77 D;  1YJ9 T;  2DLP A;  4LUD A;  1QCF A;  4OMM A;  3HTR A;  4M75 F;  4M78 B;  5GAM e;  3CCV A;  2HEQ A;  4M77 B;  3UA6 A;  2LJ1 A;  1VQ8 Q;  3ZL7 C;  3H0F A;  3R6O A;  4C5I A;  2RK2 A;  1FWZ A;  2J05 A;  3QDF A;  4BD3 A;  1E6G A;  3L2R A;  2C0I A;  5CKH A;  2EGA A;  1J3T A;  3PTA A;  2X4X A;  2QQA A;  2QG9 B;  3CCU Q;  1BI2 A;  1ZSZ C;  4BI8 B;  2HQH A;  2FB7 A;  2FRY A;  3PE0 A;  1LNX A;  2LVM A;  2LCS A;  2NYS A;  5ECA A;  2LX9 A;  4JLG A;  3PVL A;  1JJ2 A;  3GPL A;  1K9M U;  2E41 A;  1D0Y A;  2A7Y A;  4Z02 A;  2DL7 A;  4CRI A;  1Y57 A;  1QKX A;  2HSE B;  1WLP B;  2V8J A;  1B3Q A;  1M2O A;  5D6Y A;  1BKB A;  3HFN A;  2FEI A;  2K7A A;  3JCM g;  2CUD A;  1X6B A;  2E6Z A;  2ENM A;  2QYZ A;  3H0I A;  1X6O A;  2I2L A;  3OS2 A;  3S6W A;  2D8H A;  2G6F X;  1M1F A;  2E5Q A;  3JCM e;  3L2W A;  1PM3 A;  3EG9 A;  3CCE A;  3BE3 A;  1VQ5 A;  1QVG S;  1RAE B;  2YRD A;  3OBW A;  2DD5 A;  4C8Q A;  2ZGW A;  2VAS A;  2DEQ A;  1TS9 A;  2V1Q A;  1SEM A;  1NPP A;  3QJY A;  1ZA1 B;  3LH0 A;  4M75 A;  1PSF A;  4C0F A;  3CXC A;  1XNI A;  1BIB A;  4RTY A;  4E7Z A;  1YIJ T;  1UTI A;  2O4X A;  1M27 C;  3O8V A;  2DIQ A;  3LWH A;  2LP5 A;  4BY6 C;  1KQS P;  3I5R A;  3VS3 A;  1OU9 A;  4LE9 A;  5LJ5 f;  2CUB A;  2MIO A;  1NJI R;  4DEY A;  2ROT A;  3CCQ Q;  1TXQ A;  1IRE B;  4D6W A;  2VUB A;  6AT1 B;  2XDB A;  4MZM A;  2EJF A;  2SEM A;  3V8J A;  4PJM A;  2HMA A;  1MND A;  3PMI A;  1N6A A;  4ZGD B;  3UDC A;  4OB1 B;  2RH2 A;  1V29 B;  5L8R E;  3OYD A;  2K6D A;  1YIJ Q;  3X28 B;  2GFA A;  4M7A C;  1WHM A;  1TUD A;  1KD1 U;  1KQS S;  2BZY A;  4C8Q E;  3PNW C;  4F14 A;  2EQI A;  3CC7 Q;  1S72 T;  2VWF A;  1HJD A;  1MNE A;  2DM1 A;  3EG1 A;  4QVC A;  1VQM T;  1HK9 A;  1WNL A;  5GMK e;  1NM7 A;  2DNU A;  2PTK A;  4OVA A;  2G3R A;  2EQM A;  4MMK A;  3I55 A;  4PJL A;  2CH4 W;  4JJN K;  1ZSZ A;  3VRY A;  4PJN A;  2MPX C;  1Z9Z A;  2QK0 A;  5LL6 S;  2FYK A;  4BY6 B;  3CME T;  2CS7 A;  3EGX B;  1K73 C;  1I5L A;  3REB B;  1MV3 A;  4F7U B;  4M7A F;  3MPU B;  1S72 Q;  4PJO D;  2LX7 A;  1VQ8 A;  2L89 A;  3DLL A;  1Q81 U;  2Y4Y A;  4RCB A;  1YFN A;  1VQM Q;  1W2B A;  1OX9 A;  2X3W D;  1ACM B;  3VYH B;  1WJS A;  2I0N A;  1KD1 R;  4XTU A;  4QVZ A;  1SG5 A;  2DXC A;  2GFU A;  3NFC A;  2KQW A;  5GAN h;  3KXT A;  3CCU A;  1AWO A;  3AT1 B;  2JUF A;  3TCJ A;  2JN0 A;  3QDR B;  4CC4 B;  1EIF A;  2D0N A;  1IB8 A;  2L3R A;  1T3S A;  3OSS C;  2MWO A;  1Q82 U;  2HD0 A;  2YUQ A;  4KGZ B;  1JB0 E;  3GIB A;  2GBQ A;  3CPW P;  2ZPE B;  3TSW A;  2FO0 A;  2CT3 A;  1VQN Q;  1UJ0 A;  2K5I A;  3CPF A;  2X9H A;  3M53 A;  2Z0W A;  1KHI A;  4E7I A;  5LJ3 g;  2DXB A;  1VOM A;  2P84 A;  5J3B A;  1SHF A;  2NUT A;  1VQ7 Q;  1ZQ1 A;  2B86 A;  4XU3 A;  2X3X D;  4WTO B;  2Y4X A;  2KRO A;  5KYX B;  3A8L B;  3I56 T;  5AYF A;  4E7H A;  3INZ A;  3DKM A;  1Q81 R;  2V26 A;  4GLM A;  1M1K U;  1PKT A;  5GMK l;  1Y71 A;  3TQ7 P;  1UGQ B;  2H8H A;  2LC4 A;  4RTT A;  4RG8 A;  2GGR A;  4EPC A;  1QVF P;  2KVQ G;  4BI3 A;  3ZFJ A;  4XQ3 A;  1TG0 A;  1K9M C;  3DLM A;  2MK5 A;  1M2V A;  1YCY A;  2DFU A;  1AEY A;  2A3L A;  1M1G A;  1O75 A;  4ELY C;  5DY9 A;  1WPY A;  1MGQ A;  3GBQ A;  3I56 Q;  2MOX A;  4LXC A;  4ATO A;  4M7A A;  1WHH A;  3QZ9 B;  3P8H A;  3M55 A;  5DM7 R;  1ABO A;  4J6Y A;  2HQE A;  2DK3 A;  3HSB A;  3RKX A;  1RAF B;  1W6X A;  2RD1 A;  4ORZ A;  2LQW A;  1D09 B;  2EWN A;  3THK A;  3CCQ A;  2CP6 A;  1FMV A;  5IT9 E;  1NLP C;  1W4S A;  1U3O A;  3V7S A;  2O88 A;  5GAN j;  3A8O B;  2IIM A;  4XTW A;  1ZX6 A;  5FRN A;  3M0U A;  1JO8 A;  5IHK A;  4JRQ A;  3PT9 A;  1YIJ A;  2JZ2 A;  2YUO A;  2HL3 A;  3OYK A;  1QCO A;  3JB9 D;  4C8Q G;  1AWJ A;  2LT1 A;  3SHW A;  4AFU C;  3CC7 A;  1KHC A;  3EFR A;  1CKA A;  1WI7 A;  4BI4 A;  1VYU A;  4C92 C;  1RAH B;  1GBR A;  4GY5 A;  1UGS B;  2KAF A;  1QKW A;  5KYY B;  2E4H A;  4HVW A;  4MML A;  1Q95 G;  4QQG A;  2DE0 X;  3OW2 P;  1HSQ A;  3M58 A;  2DZC A;  4MDX A;  1AZG B;  1PKS A;  2E5K A;  4ME7 A;  3KUF A;  4FM4 B;  4R56 A;  2CSQ A;  1AD5 A;  1CSK A;  3EG0 A;  2F2V A;  1ZUK A;  1BK2 A;  2M0O A;  1NPR A;  4OMO A;  1ZUY A;  2KEA A;  2YXY A;  2KRS A;  1KD1 C;  3UPU A;  1S72 A;  5CKF A;  2K2V A;  1VQM A;  2AZV A;  4HVU A;  1M90 R;  2X4W A;  4PFO A;  3ULR B;  4O6J A;  4C92 F;  2VV5 A;  2ZPI B;  3OYE A;  2GCX A;  1ZSG A;  3M0P A;  4JS4 A;  2KSS A;  3CCJ A;  3VJP A;  1BB9 A;  4P5N A;  1AHJ B;  2O9S A;  3LLR A;  4J6W A;  5DLQ E;  1VQ5 T;  2CP5 A;  2CZ7 B;  2HZY A;  3UAT A;  3OS1 A;  1Z9Q A;  4B9X A;  2AKL A;  1Q7Y R;  1VQN A;  1VQ6 T;  3NTK A;  1GCQ A;  1B34 B;  2K3X A;  5FU6 C;  4R55 A;  1FMK A;  3UF4 A;  1Q81 C;  1QCN A;  1TTH B;  4A4K A;  1NE8 A;  2VC8 A;  1UB4 A;  4M4Z A;  5GJW B;  1VQ7 A;  4XAX B;  2A36 A;  4EIK A;  1Y96 A;  3AHU A;  3CC4 T;  2V8K A;  1R0C B;  5KYW A;  2EKO A;  2EYX A;  2F5T X;  2E70 A;  3C94 A;  1K1Z A;  4IUQ A;  1XQH A;  5I21 A;  2QQ9 A;  2K9G A;  2M0Y A;  1VQL T;  1PC0 A;  1WYX A;  2QQR A;  2FPD A;  3S3O A;  4PJJ A;  4FSS A;  1Q82 C;  2M51 A;  1N9R A;  1MMA A;  3MKD A;  1VQ6 Q;  3M59 A;  2ZAE A;  4CC7 A;  3HKS A;  2LRQ A;  2C06 A;  1UJY A;  2EGE A;  1NYG A;  1TUC A;  2SRC A;  2V8I A;  4N0A A;  2BTT A;  2GNC A;  1AT1 B;  1SKU B;  4HKE A;  3I56 A;  3CC4 Q;  2QI2 A;  3JCM P;  3HFO A;  2HBP A;  2K57 A;  1G3S A;  4M78 C;  5LJ3 h;  1BI0 A;  2EVR A;  4M77 C;  1M1K C;  4CI0 C;  4DEX A;  3H41 A;  1OPL A;  2VXF A;  2DRK A;  1VQL Q;  2RJF A;  1C1A A;  4CC3 A;  3ZBD A;  2KT8 A;  2DL3 A;  4PJO G;  3I55 T;  2DYI A;  5CKB A;  5FU7 C;  2J06 A;  1Q86 U;  3OYN A;  1YWO A;  1KJW A;  2R57 A;  1JJ2 S;  5CKE A;  2LZ6 B;  2ZPF B;  1K8A U;  1X2K A;  2RM4 A;  1VQ8 T;  5LJ5 d;  1I8F A;  2FPF A;  1FXX A;  4RG2 A;  4AG1 C;  4M78 F;  4NOY A;  3OYJ A;  4M77 F;  2A37 A;  1B7T A;  3R6N A;  4IUT A;  2JVV A;  4L6V 5;  2VGM A;  3OSV A;  3I55 Q;  3HHT B;  2AIR B;  2LNV A;  2LQK A;  5GAM g;  1K4U S;  3EFO A;  3FRN A;  5GAO p;  4PFP A;  2KXC A;  3QO3 A;  3A98 A;  2JM9 A;  2EGC A;  4JPB W;  1U1T A;  2H3J A;  2P0Q A;  2VXE A;  1SF9 A;  2XKO C;  1Q86 R;  3SWN A;  4C0D C;  3L2V A;  4PL6 A;  2HQX A;  3J80 E;  3CXC S;  1AWW A;  4O5V A;  3RIR A;  5FU7 B;  2KK4 A;  1K8A R;  1JU5 C;  4A4F A;  3RKW A;  1ZA2 B;  2DL8 A;  1GXI E;  2A0F B;  1HYO A;  5CCA A;  1WJR A;  4C8Q D;  2DL4 A;  2DMO A;  1UEC A;  2OJ2 A;  2JMA A;  1RUW A;  2RHI A;  1VQ4 T;  2CKK A;  4GLK A;  3M4G A;  1N8R R;  3MHX A;  2L0A A;  5LJ3 j;  4FT4 A;  4C8Q B;  2P4R A;  4M75 D;  1LOJ A;  4PLI A;  1RAG B;  2PQW A;  4F04 B;  3L2Q A;  4FYW B;  3ZEH A;  2ABL A;  1QVG P;  1W1F A;  3C4S A;  2COW A;  5DLO A;  2BE9 B;  2QA4 Q;  1WXT A;  2RQW A;  2RQU A;  5GAN 4;  3A1P A;  1BIA A;  7AT1 B;  1NJI U;  2EKH A;  4E7L A;  1GL5 A;  4M7D A;  1D1B A;  4DBR A;  5GAO q;  5CAI A;  4C0G A;  3JAM E;  1VQ4 Q;  1PWT A;  3LGF A;  1FMW A;  1K0X A;  4EMK C;  2HBW A;  4FYX B;  4M78 A;  1R77 A;  4C0D B;  3RKY A;  3CC2 T;  3CCQ T;  3BDU A;  3QG1 A;  3JB9 G;  1ARK A;  2RN8 A;  2KGT A;  5GAN 8;  5IN1 A;  2PU9 B;  2OTJ Q;  3E19 A;  1VQ6 A;  3EGU A;  4BAC A;  4HT8 A;  1GFD A;  1IHV A;  2A28 A;  2WSF E;  1OX8 A;  1TU0 B;  3J81 E;  1WDX A;  2CH4 A;  1WHK A;  3UT1 A;  4IIO A;  2JM8 A;  1OZ3 A;  3CC4 A;  3QJ6 A;  1C6V X;  2L5Q A;  2MMP A;  2CZ0 B;  1WJQ A;  1W2B S;  3CC7 T;  3C0C A;  3M0R A;  2LMJ A;  3CC2 Q;  3G71 T;  3HRT A;  1H3Z A;  3LYI A;  1G8X A;  2KYM A;  1VQL A;  4BE0 A;  1MMG A;  4PJO C;  2EPD A;  3M5A A;  5FW9 A;  2J6K A;  1G3W A;  3FEO A;  2VVK A;  1EZZ B;  1G5V A;  4X34 A;  3JCM W;  2QEX T;  5GMK i;  4ANJ A;  4DOW A;  3WVE B;  4EMK B;  1WFW A;  4OML A;  4JJB A;  4LDX A;  1MMD A;  5LJ5 e;  2MI6 A;  2JT4 A;  3JB9 I;  2DO3 A;  4JRI A;  3RMQ A;  1RLP C;  3G71 Q;  4M75 E;  4QW2 A;  2XG8 D;  2DTH A;  2XK0 A;  3M0Q A;  4F7U F;  3OYB A;  4NL3 A;  4J9H A;  2RQV A;  1ZBX A;  2ED0 A;  1RI9 A;  2RNA A;  5GAN 5;  1V76 A;  3M57 A;  3GNF B;  4PJO F;  3TEE A;  3CCJ T;  4QT7 A;  5D6X A;  2QEX Q;  1Q86 C;  4LDU A;  2PVG B;  1X69 A;  1KFZ A;  2P0K A;  3MEA A;  2DD4 A;  3CCM A;  4OP0 A;  4D8D A;  3GP8 A;  3EH2 A;  1BU1 A;  2JNG A;  4Q5W A;  4BUG A;  2EYQ A;  1K8A C;  1KC8 R;  3WXM B;  1VQN T;  4RMO A;  4BE2 A;  5KCO A;  2QGF B;  1QWF A;  3M4Y A;  5CQX A;  4PJO B;  4KUI A;  2ED1 A;  2FG0 A;  1VQ7 T;  3BFM A;  2A08 A;  4L59 A;  3CD6 A;  2HKQ B;  1T0H A;  2DZ9 A;  3JSC A;  1IZ6 A;  2IG0 A;  3CCJ Q;  2RB6 A;  1KG1 A;  2HAX A;  3E1S A;  1RI0 A;  2O2O A;  4BB7 A;  4OMP A;  5L23 A;  3FJP A;  1TSF A;  2GTO A;  5GAM h;  3Q1J A;  2RHY A;  2YRC A;  4RKU E;  3DB3 A;  2ECZ A;  4OB0 B;  1BI3 A;  1VYT A;  5D7U A;  3VU3 C;  2QA4 A;  1O9S A;  4QQ6 A;  2DF6 A;  4RTX A;  3SDZ A;  3MP8 A;  1QP3 A;  1PSE A;  5D6W A;  2E10 A;  4KUD K;  2XD0 A;  1EFN A;  4NL2 A;  1KQS A;  2KY9 A;  3RES A;  1VQ4 A;  2AHJ B;  2QDL A;  1WIE A;  3EGX A;  3FIF A;  2QDY B;  2BZX A;  3LX7 A;  3QBY A;  2ZPB B;  3QYG B;  4F7U A;  3NGP A;  4DBQ A;  1UGP B;  2DXT A;  4C5E A;  1KIK A;  4EMG A;  3NPF A;  2K2M A;  1H64 1;  1X01 A;  4XTZ A;  4IUP A;  2ESW A;  2KT1 A;  2L3S A;  3MP6 A;  3GLX A;  2OTJ A;  3A8G B;  1GBQ A;  5IHI A;  1HD3 A;  3D7S B;  3EGD B;  3OA6 A;  4X9C A;  4KUL A;  3T9N A;  3VUB A;  3U23 A;  3EFS A;  2PNI A;  2DA9 A;  1PG5 B;  4X1V A;  1ZHI A;  1NJI C;  2LQ8 A;  4QVD A;  3VYG A;  4R0K A;  2AT1 B;  4A54 A;  1LCK A;  3CCR T;  1S1N A;  3L2Z A;  4A63 B;  3PIP A;  4RTU A;  3CEY A;  4AFQ C;  3JCM h;  1YN8 A;  1VQO A;  3CC2 A;  2EQU A;  3OYI A;  2CRE A;  1F1B B;  3JV3 A;  3PMT A;  5GAO l;  5A0G A;  1X75 C;  2ATC B;  3JB9 F;  3OYA A;  4IUV A;  1FX7 A;  2DX1 A;  5CQY A;  4ZNX A;  3VV0 A;  1IGU A;  2KI7 A;  1YJN T;  4N4G A;  1P92 A;  2AZS A;  1M90 U;  3LW5 E;  2D8J A;  3E2U A;  3M54 A;  4ZTF A;  4J9E A;  5GAM j;  1PD0 A;  2CP7 A;  3CCR Q;  1U5S A;  3PGG A;  2AK5 A;  4VUB A;  1FYN A;  1WX6 A;  3OS0 A;  2E1H A;  2BKD N;  4M75 G;  1YNZ A;  2KRN A;  1GCP A;  2KBT A;  2H3E B;  3G71 A;  4HCB A;  4M7A E;  5M9O A;  5GJV B;  1B07 A;  5IXF A;  1I1J A;  1M8M A;  5AT1 B;  3FJ5 A;  4Y28 E;  1R8O B;  4RCC A;  4LD6 A;  5KH6 A;  3OYH A;  2KNB B;  2NUP A;  1YJN Q;  1Q7Y U;  3C95 A;  5KYN A;  3VS5 A;  4LDW A;  2QEX A;  2M16 A;  2DIG A;  3EG2 A;  4KGV B;  4OMF B;  4OMN A;  2CSI A;  3FC3 A;  2XU8 A;  1U06 A;  5HKC A;  3P8D A;  5GAN d;  3CPW A;  2LJ3 A;  3CBM A;  2F2W A;  3NTH A;  1WQW A;  5HY6 A;  4J9B A;  5HK3 A;  4PLL A;  2K79 A;  4ZTJ A;  4UC4 A;  5KYW B;  3LWI A;  5GMK h;  4JZ4 A;  4ESR A;  2RHZ A;  2KMT A;  1IO6 A;  5KE2 A;  4EDU A;  3M56 A;  2CYZ B;  2FZK B;  2QGG A;  4AMC A;  1WHG A;  2PUO B;  4X9D A;  2R5M A;  5KE3 A;  1M30 A;  3VRZ A;  4II1 A;  1UFF A;  1PD1 A;  2FZC B;  3TVT A;  2BZ8 A;  1SHG A;  1KQ1 A;  1QP2 A;  1QVF A;  4JDS A;  4RTV A;  4LNP A;  4MZT A;  1PNJ A;  1NYF A;  1AZE A;  2CP2 A;  1RAI B;  1MUZ A;  3MEU A;  5KYY A;  1G83 A;  1OU8 A;  2RF0 A;  4Z8A A;  5CO7 A;  4IUR A;  2WSE E;  2CP3 A;  2MWP A;  3H0H A;  3FLG A;  1YIT Q;  3JCM Q;  1YJW T;  2EBP A;  3A8M B;  4ZN3 A;  1H3H A;  1YWP A;  2L3P A;  2W0Z A;  3QKJ A;  2EW3 A;  4FIB A;  2RJD A;  3ASK A;  4HT9 A;  3C12 A;  2OTL T;  3MP1 A;  1YBY A;  2D6F A;  1LVK A;  1DJ7 B;  5FLX E;  5KYU B;  4JLI A;  1G3Y A;  2W10 A;  1X2Q A;  3ER0 A;  4V2S A;  2YLB A;  5J39 A;  2RO0 A;  5IXB A;  3CBP A;  3VS4 A;  2X51 A;  1GFC A;  3NHN A;  3QZ5 B;  1YHQ Q;  2YRV A;  1JJ2 P;  1VQ9 T;  1YJW Q;  4FSX A;  4PFZ A;  2BUD A;  3PFS A;  1OPK A;  3QYH B;  3FB9 A;  2D9T A;  1D3B B;  3CCS Q;  4E7J A;  1KSW A;  2YT6 A;  2KE9 A;  1QQJ A;  2OTL Q;  4DA4 A;  1RAB B;  2LQN A;  4B6M A;  3QHS A;  1QW1 A;  2HL5 C;  4C92 A;  2OI3 A;  2HNI A;  2B8A A;  2FRW A;  3NTI A;  5GMK j;  3OW2 A;  1UG1 A;  2KDS A;  1B34 A;  4OB2 B;  1M3C A;  4KBM B;  3V7C A;  4XTV A;  3QSU A;  3MEV A;  2DJZ A;  1VQ9 Q;  1YI2 Q;  1Y07 A;  2DIL A;  1M3B A;  1TOV A;  3BY7 A;  4L5G A;  3FDR A;  3TRE A;  3JRZ A;  3RDV A;  3CCM T;  3O5Z A;  3MET A;  2E12 A;  3I35 A;  1JBM A;  4C8Q C;  2R5A A;  5GAN 2;  5GAN f;  1ZUU A;  4J8O A;  4F17 A;  3ME9 A;  1QLY A;  2IPO B;  2YSQ A;  3CCR A;  4M75 C;  1N8R U;  4WF2 A;  3CXC P;  3CD6 T;  1I07 A;  4KH0 B;  4M7A G;  1AOJ A;  1WA7 A;  3EHQ A;  4JRK A;  2XDD A;  2EYW A;  1MHN A;  2JTE A;  3CCL Q;  4ELZ C;  2D0Q B;  5IAY A;  4BDZ A;  1PRL C;  1YJN A;  3CCM Q;  1JXM A;  1OI1 A;  4C92 E;  1EX4 A;  2RPN A;  1RLQ C;  4M7D D;  3CMA Q;  1M90 C;  5GAN e;  2P0P A;  2K3Y A;  2RMO A;  4TVR A;  4C8Q F;  3OYF A;  2RJE A;  2XMF A;  2AKK A;  2L3Q A;  1TWB A;  3L42 A;  3H6Z A;  2QA4 T;  3CD6 Q;  1WHL A;  1X43 A;  2BE7 D;  2GQV A;  5GAN 6;  3WVD B;  1RAA B;  3EG9 B;  4OB3 B;  5I2S A;  1XTD A;  2XDP A;  3HRS A;  2QXF A;  3RUX A;  1NZ9 A;  2M9U A;  4RTZ A;  2EQK A;  1K73 R;  4HCZ A;  2K5L A;  4GBQ A;  2DVE A;  2JW4 A;  2LTO A;  4RTW A;  3G6E T;  1Q7Y C;  1WXU A;  3S3M A;  1M3A A;  5GAN 7;  2CZ6 B;  4Y91 A;  1BYM A;  2OAU A;  2MF2 A;  4DBF A;  1SSF A;  4OGC A;  3SFM A;  4ZN1 A;  4M75 B;  2F5K A;  4FT2 A;  2O4X B;  1YJ9 Q;  2OTJ T;  2E65 A;  4OGE A;  4K11 A;  4A4H A;  4AG2 C;  3JCM f;  1UGV A;  1KQ2 A;  1YIT A;  5I11 A;  2FVU A;  3EH1 A;  1ZBJ A;  4ZGE B;  1UGR B;  1W2B P;  1BI1 A;  3M9Q A;  3MO8 A;  4M77 A;  3G6E Q;  1N5Z A;  2QQS A;  2HCK A;  2HKN A;  1VQO T;  2QTV A;  2CT4 A;  2KR3 A;  5CKD A;  4Z89 A;  3OY9 A;  3E9G A;  1I81 A;  2YDL A;  1T3L A;  5LJ3 d;  2HDA A;  4KT0 E;  3HL8 A;  4AFS C;  5FWB A;  3GOX A;  1NEB A;  3RER A;  2MYS A;  3UA7 A;  3G4S T;  3L1A A;  2J6O A;  1VQP T;  2R58 A;  1YHQ A;  3JB9 H;  1H92 A;  4J7F A;  1JXO A;  1YJW A;  1UUE A;  2QQB A;  1SPK A;  1NLO C;  4FYV B;  1X6G A;  1TH7 A;  3URG A;  1KK7 A;  1D0X A;  3CCS A;  1M8V A;  4WCI A;  4D8K A;  4KH1 B;  3X25 B;  8ATC B;  2OTL A;  1VQO Q;  2PZ1 A;  3A8H B;  1K9M R;  1ZSZ B;  3BDL A;  4M7D E;  1UHC A;  3F70 A;  5FRO A;  2M1H A;  4J9F A;  2F69 A;  1IHW A;  3OQ5 A;  1WHJ A;  3SD4 A;  2HSP A;  4KRT A;  2OX7 A;  1LJO A;  3OMG A;  4XU2 A;  1KC8 U;  4M78 E;  3JCM c;  4M77 E;  1R0B G;  5LJ5 g;  3G4S Q;  1OOT A;  1VQP Q;  1VIE A;  1VQ9 A;  2DVJ A;  1SSH A;  3OYG A;  1YI2 A;  4OF1 A;  1E7O A;  1W70 A;  3E9F A;  1VUB A;  2RI2 A;  3I9Q A;  1UDL A;  4HCC A;  3OYY A;  1HXD A;  3QUI A;  3V8K A;  2J6F A;  1H8K A;  4JS5 A;  4MZP A;  2F1L A;  4C5H A;  3TU4 K;  5HCK A;  2VGN A;  2LNH B;  5A2Q E;  4FW2 A;  4FW1 A;  3HPW A;  5C0M A;  3CCL A;  2YUN A;  2ZPG B;  2VYT A;  1IRX A;  1I4K 1;  4EMH A;  5CK9 A;  4FCY A;  1K9A A;  1OQK A;  4C92 G;  2COY A;  2COZ A;  5IHN A;  4MDW A;  1AWX A;  4BDY A;  2EJ9 A;  2L8D A;  2NUT B;  1RL2 A;  4PKC C;  3M0T A;  4B9W A;  4IUU A;  3SB2 A;  5A0D A;  1QVG A;  1GRI A;  4FYY B;  3CMA A;  4J9I A;  3REA B;  4Z88 A;  4HCK A;  1A0N B;  2RHU A;  4C0Z A;  1WZO A;  1JRI A;  2PUK B;  2ZPH B;  3OYM A;  3RBB B;  3CQT A;  1N8R C;  3JCM J;  1UE9 A;  4HXJ A;  3LGL A;  3HP9 A;  4E7S A;  2DKG A;  2OAW A;  1YCS B;  4XU0 A;  5A0L A;  4JRP A;  3NMZ C;  5GAO r;  1M5Q 1;  3M0S A;  5GMK m;  3UWN A;  4QKU A;  2K3B A;  2DL5 A;  1M2V B;  3PVQ A;  1BBZ A;  4EMK A;  2PVD B;  2KXD A;  2MAM A;  4E6R A;  4LUE A;  1IGQ A;  4N4I A;  2MCN A;  2KRM A;  4M7A D;  2EAY A;  4CC2 A;  2L2P A;  1AVZ C;  1VQK T;  1NG2 A;  4A4G A;  5I22 A;  5CIU A;  2QAZ A;  1PRM C;  4M7A B;  5LJ3 f;  9ATC B;  2CZ1 B;  2J7I A;  3MEW A;  5IH2 A;  1YJ9 A;  3CME Q;  3VUZ A;  2LCL A;  2XIC A;  4BE1 A;  3VS1 A;  2K5F A;  4JJC A;  2YUP A;  2NLU A;  2Y90 A;  1QMC A;  2K4Y A;  4ZGJ B;  3JCM X;  1Y7X A;  1U8R A;  2JS0 A;  3OS5 A;  3G6E A;  1RAD B;  2DER A;  1NEG A;  1VQK Q;  4JJD A;  1I5O B;  4DOV A;  1OYX A;  4LN2 A;  4XK8 E;  4PJO A;  5LJ3 e;  5GAO m;  1OUL A;  5EC7 A;  2P4T A;  3I5S A;  3GF5 A;  2DTI A;  3HRU A;  1PCX A;  2XHC A;  3KBG A;  2LDM A;  3CPW S;  2DBM A;  5FRM A;  2GQI A;  1RAC B;  5EG2 A;  2X4J A;  1I0C A;  2LJ0 A;  4F16 A;  1GCQ C;  1N9S A;  1OV3 A;  3MJX A;  1XOV A;  5HK0 A;  2E6N A;  2XID A;  4LD9 K;  3OYL A;  1Q82 R;  3V7R A;  2ROL A;  4M7D G;  2YHT A;  2NUP B;  3VS6 A;  2ZZD A;  5CVI A;  4HVV A;  3G7Z A;  2CGH A;  4M78 G;  2RI5 A;  2X4Y A;  5J26 A;  4M77 G;  5I2M A;  4F7U E;  5KYX A;  2RI3 A;  1QVF S;  3G4S A;  2JJ9 A;  4N4H A;  1VQP A;  1BCM A;  3IQL A;  4PNO A;  4DBH A;  2JTF A;  1M1K R;  4PJO E;  1IXD A;  3RR6 A;  2M02 A;  1OZ2 A;  1UEB A;  4N0A C;  1V1C A;  2O9V A;  3H9N A;  5GAO n;  3CCV T;  2CP0 A;  1UHF A;  2EJG A;  2WAC A;  4J83 A;  4PK4 A;  3X26 B;  1SRL A;  2O01 E;  3EGD A;  3QWY A;  1KC8 C;  5FWC A;  4A4E A;  3JCM V;  2RK1 A;  2DEU A;  4XTY A;  1Y0M A;  3CBO A;  2DYB A;  2WSC E;  4HA8 A;  2DAQ A;  3V8L A;  2E64 A;  4DQ2 A;  5LJ5 h;  2DBK A;  4E47 A;  1Y96 B;  3KFV A;  2V1R A;  3VS7 A;  3EG3 A;  1WXB A;  2QAS A;  3CCV Q;  1G2B A;  3RNJ A;  8AT1 B;  5GAM d;  2JS2 A;  3QII A;  2YLC A;  4JZ3 A;  4IIM A;  1YIT T;  3VKI A;  2XI9 A;  2YWW A;  2VKN A;  2RHX A;  3LH5 A;  4AT1 B;  1SRM A;  1D0Z A;  2FL7 A;  4JUV A;  3TSZ A;  2X35 A;  3PIO A;  2DTO A;  3OW2 S;  2FHD A;  3J7A F;  3S3N A;  3QXE B;  2O31 A;  2GTJ A;  2E3I A;  2FPE A;  1U1S A;  1WQ7 A;  2D1X A;  4FU6 A;  2DRM A;  4J9C A;  3VS0 A;  2LCC A;  2EQJ A;  4OMQ A;  4C92 D;  4C5G A;  1YHQ T;  3CCE T;  3CME A;  2DET A;  2BIV A;  3SWN C;  1VA7 A;  3EHR A;  1VIF A;  4C92 B;  1N27 A;  1ABQ A;  3MCA B;  1VYV A;  3CCS T;  1ZLM A;  3QPH A;  4NS5 A;  1T0J A;  2DXU A;  3X24 B;  2LT4 A;  4Y92 A;  2QTX A;  1VQK A;  2CDT A;  2DPP B;  1K76 A;  1CKB A;  1OEB A;  2DJQ A;  3H8Z A;  3JCM d;  4IKF A;  3CCE Q;  3A5Z B;  1YI2 T;  2C0T A;  1PHT A;  1VQ5 Q;  2PVO B;  1E6H A;  2EYY A;  1QVP A;  3OMC A;  3JCM b;  2EIF A;  3OBY A;  1K0S A;  1M4Z A;  4J9G A;  1QWE A;  4RUG A;  2GF7 A;  1BCO A;  2C0O A;  1JQQ A;  2E3H A;  3EFO B;  3X20 B;  5LJ5 j;  2RJC A;  1LPL A;  4M7D C;  1D1C A;  1MV0 B;  4LDY A;  1M9S A;  1X27 A;  2ZCF B;  5CR2 A;  3DB4 A;  3CCL T;  4J6X A;  3OB9 A;  3G1J A;  1JEG A;  4F7U G;  3SWN B;  1WGS A;  2NWM A;  3L2U A;  4FL6 A;  4QQD A;  3EAE A;  4XU1 A;  4AFZ C;  1MMN A;  5FU6 B;  3CMA T;  5KCH A;  1NBE B;  4KGX B;  1XJW B;  3SEM A;  5KYU A;  2JTM A;  4E2F B;  3QWX X;  4J9D A;  2RQT A;  1K73 U;  2JMC A;  2RQR A;  2NUZ A;  2EFI A; 
#chains in the Genus database with same CATH homology
 4WCI A;  4D8K A;  2PZ1 A;  1EFN A;  2AZV A;  4HVU A;  3ULR B;  1UHC A;  3VS2 A;  4J9F A;  2QDL A;  1WIE A;  2BZX A;  2F2X A;  2HSP A;  4KRT A;  2JXB A;  1ZSG A;  3M0P A;  3NGP A;  1KIK A;  1BB9 A;  1OOT A;  3NPF A;  2K2M A;  2O9S A;  2EYZ A;  1YP5 A;  2KYB A;  2DVJ A;  1SSH A;  1E7O A;  1W70 A;  2ESW A;  2KT1 A;  2L3S A;  3I9Q A;  1GBQ A;  1UDL A;  5IHI A;  1HD3 A;  2DLP A;  3UAT A;  1Z9Q A;  4LUD A;  1QCF A;  3U23 A;  4OMM A;  2PNI A;  2AKL A;  2DA9 A;  4X1V A;  2HEQ A;  1GCQ A;  3UA6 A;  2LJ1 A;  1FMK A;  3UF4 A;  4R0K A;  3ZL7 C;  2J6F A;  1H8K A;  4M4Z A;  5GJW B;  1LCK A;  3H0F A;  2A36 A;  1S1N A;  4A63 B;  2J05 A;  4EIK A;  5HCK A;  4RTU A;  2LNH B;  4AFQ C;  1E6G A;  2C0I A;  1YN8 A;  2YUN A;  2EGA A;  1J3T A;  2EYX A;  2CRE A;  3JV3 A;  1K9A A;  1K1Z A;  5IHN A;  2FRY A;  1AWX A;  3PE0 A;  2K9G A;  2M0Y A;  2DX1 A;  1WYX A;  3M0T A;  4ZNX A;  2LCS A;  2FPD A;  5ECA A;  4FSS A;  2M51 A;  1GRI A;  2AZS A;  3PVL A;  4J9I A;  3REA B;  4Z88 A;  4HCK A;  4CC7 A;  2D8J A;  1A0N B;  2DL7 A;  4J9E A;  1UJY A;  2EGE A;  1NYG A;  1TUC A;  1Y57 A;  2SRC A;  2GNC A;  1U5S A;  2AK5 A;  2BTT A;  1QKX A;  3RBB B;  1FYN A;  3CQT A;  1WX6 A;  1WLP B;  1UE9 A;  1B3Q A;  4HXJ A;  1YNZ A;  2KRN A;  1GCP A;  2KBT A;  2OAW A;  2FEI A;  1YCS B;  2K7A A;  5GJV B;  1B07 A;  2EVR A;  5IXF A;  1I1J A;  3NMZ C;  3M0S A;  1M8M A;  2CUD A;  2K3B A;  2DL5 A;  4DEX A;  1X6B A;  3FJ5 A;  1BBZ A;  1OPL A;  3H41 A;  3PVQ A;  2KXD A;  2ENM A;  4E6R A;  3H0I A;  4LUE A;  2DRK A;  2KNB B;  2D8H A;  2KRM A;  2MCN A;  4CC3 A;  2KT8 A;  2G6F X;  4CC2 A;  2DL3 A;  2L2P A;  1AVZ C;  1NG2 A;  3VS5 A;  5I22 A;  2J06 A;  3EG2 A;  1PRM C;  4OMN A;  2CSI A;  1YWO A;  1KJW A;  1U06 A;  2J7I A;  5IH2 A;  2LJ3 A;  2F2W A;  3VS1 A;  4JJC A;  2LZ6 B;  2V1Q A;  4J9B A;  1SEM A;  2YUP A;  2K79 A;  1X2K A;  4JZ4 A;  4RTY A;  4ESR A;  2FPF A;  1UTI A;  1IO6 A;  1M27 C;  4AG1 C;  2JS0 A;  2LP5 A;  3I5R A;  2A37 A;  1M30 A;  3R6N A;  3VS3 A;  3VRZ A;  4LE9 A;  1NEG A;  1UFF A;  2CUB A;  2MIO A;  4JJD A;  1K4U S;  4DEY A;  3TVT A;  2ROT A;  4LN2 A;  2BZ8 A;  1SHG A;  4RTV A;  2KXC A;  5EC7 A;  4LNP A;  1PNJ A;  3A98 A;  1NYF A;  3I5S A;  2JM9 A;  1AZE A;  2EGC A;  2SEM A;  4JPB W;  1MUZ A;  1G83 A;  2RF0 A;  2DBM A;  4Z8A A;  2GQI A;  1I0C A;  2LJ0 A;  2K6D A;  4F16 A;  1OV3 A;  1GCQ C;  1XOV A;  3H0H A;  1TUD A;  2EBP A;  2BZY A;  1H3H A;  1YWP A;  4F14 A;  1AWW A;  2EQI A;  2L3P A;  2W0Z A;  2ROL A;  1JU5 C;  3VS6 A;  2EW3 A;  2VWF A;  1HJD A;  2DL8 A;  2DM1 A;  3EG1 A;  2DL4 A;  2DMO A;  1NM7 A;  2DNU A;  2PTK A;  4HVV A;  1UEC A;  2OJ2 A;  2JMA A;  1RUW A;  2W10 A;  1X2Q A;  2L0A A;  2P4R A;  5IXB A;  2CH4 W;  3VS4 A;  3VRY A;  1Z9Z A;  2ABL A;  3IQL A;  1GFC A;  3NHN A;  1W1F A;  1OPK A;  1WXT A;  2RQW A;  2RQU A;  3REB B;  1MV3 A;  2LX7 A;  1V1C A;  1KSW A;  2EKH A;  2O9V A;  2YT6 A;  2KE9 A;  1GL5 A;  1UHF A;  2LQN A;  2X3W D;  1SRL A;  2I0N A;  1PWT A;  2OI3 A;  1K0X A;  2FRW A;  2HBW A;  3QWY A;  1UG1 A;  1M3C A;  5FWC A;  1AWO A;  1Y0M A;  4CC4 B;  2DYB A;  2D0N A;  1ARK A;  2RN8 A;  2DIL A;  1M3B A;  1T3S A;  2KGT A;  3EGU A;  3O5Z A;  2YUQ A;  2DBK A;  3I35 A;  3KFV A;  2GBQ A;  2V1R A;  3VS7 A;  1GFD A;  3EG3 A;  2A28 A;  3TSW A;  1WXB A;  2FO0 A;  2CT3 A;  1UJ0 A;  1WDX A;  1G2B A;  1ZUU A;  2CH4 A;  3RNJ A;  4F17 A;  2JS2 A;  1QLY A;  2YSQ A;  4JZ3 A;  4IIO A;  4IIM A;  2JM8 A;  1SHF A;  2B86 A;  2VKN A;  2X3X D;  1I07 A;  1AOJ A;  2KRO A;  3LH5 A;  1WA7 A;  3EHQ A;  3C0C A;  1SRM A;  3M0R A;  3TSZ A;  2EYW A;  2JTE A;  2LMJ A;  4GLM A;  1PKT A;  2H8H A;  4RTT A;  1PRL C;  2KYM A;  2EPD A;  2GGR A;  1JXM A;  2RPN A;  2O31 A;  5FW9 A;  2GTJ A;  2J6K A;  1RLQ C;  2FPE A;  2VVK A;  2D1X A;  1TG0 A;  2DRM A;  4J9C A;  3VS0 A;  2RMO A;  4OMQ A;  2XMF A;  1AEY A;  2AKK A;  2L3Q A;  1WFW A;  4OML A;  1VA7 A;  3EHR A;  4JJB A;  1ABQ A;  1X43 A;  3GBQ A;  1VYV A;  2MOX A;  2JT4 A;  1RLP C;  1ZLM A;  1T0J A;  1ABO A;  3M0Q A;  4RTZ A;  4J9H A;  2RQV A;  4Y92 A;  4GBQ A;  2CDT A;  1W6X A;  2JW4 A;  2ED0 A;  1RI9 A;  4RTW A;  2RNA A;  2LQW A;  4ORZ A;  1WXU A;  3THK A;  1M3A A;  4QT7 A;  1K76 A;  1CKB A;  1OEB A;  2DJQ A;  1NLP C;  1X69 A;  1KFZ A;  2C0T A;  1PHT A;  1U3O A;  1E6H A;  2EYY A;  2O88 A;  4D8D A;  1BU1 A;  1K0S A;  2IIM A;  1ZX6 A;  4J9G A;  3M0U A;  1JO8 A;  4K11 A;  5IHK A;  1QWE A;  4RUG A;  4AG2 C;  2C0O A;  1UGV A;  2YUO A;  1JQQ A;  1QWF A;  2ED1 A;  1AWJ A;  5I11 A;  2FG0 A;  2A08 A;  3SHW A;  1ZBJ A;  4AFU C;  1CKA A;  1WI7 A;  1MV0 B;  1T0H A;  1X27 A;  1VYU A;  1N5Z A;  1GBR A;  2HCK A;  1QKW A;  4HVW A;  2CT4 A;  2KR3 A;  2DE0 X;  4Z89 A;  1HSQ A;  2O2O A;  1JEG A;  4OMP A;  1AZG B;  1PKS A;  2E5K A;  2YDL A;  5L23 A;  1T3L A;  2HDA A;  2NWM A;  4AFS C;  2GTO A;  5FWB A;  1NEB A;  2CSQ A;  1AD5 A;  3UA7 A;  4AFZ C;  1CSK A;  3EG0 A;  2F2V A;  2J6O A;  1ZUK A;  1H92 A;  2ECZ A;  1BK2 A;  1JXO A;  3SEM A;  1UUE A;  4OMO A;  1SPK A;  1VYT A;  1NLO C;  1ZUY A;  3QWX X;  4J9D A;  2RQT A;  1X6G A;  2KEA A;  2JMC A;  2RQR A;  2NUZ A;  2KRS A;  2DF6 A;  4RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...