2AZVA

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (calculated without noes)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH2-SH3 adapter protein drk
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azvA00
1QKWA 1PHTA 2YUQA 2DL4A 2O9VA 1MV3A 2LQNA 1ABQA 2GQIA 2F2VA 2C0IA 2KE9A 3O5ZA 2KXCA 4HCKA 3UA6A 3M0UA 2CUBA 4AFUC 2B86A 4DEXA 4F17A 2AKLA 4JJBA 2FPFA 2O9SA 4JJDA 3M0SA 3RBBB 2K3BA 1PNJA 1WDXA 2FEIA 2CDTA 2KNBB 1YCSB 3ZL7C 2DRKA 1CKAA 3UATA 1SRLA 4FSSA 3VS5A 1RI9A 3H0IA 3NMZC 3VS7A 1T0JA 1V1CA 3TSWA 1FMKA 4AFQC 2KRSA 1VYVA 1NYFA 2AZSA 2CUDA 1I0CA 1AOJA 2HBWA 1ZLMA 1X2QA 2DBKA 4J9IA 2L2PA 1BB9A 1AZGB 5IHIA 3REAB 2X3WD 4Y92A 2RF0A 1G2BA 1UE9A 3I5SA 2GTJA 2QDLA 1H3HA 2EQIA 1OPLA 1X27A 2YT6A 3VRZA 4GBQA 2YUOA 2FRWA 2ESWA 4CC2A 2MIOA 3VS3A 2JXBA 1K0SA 4ESRA 1H8KA 2KYMA 3UF4A 1NEBA 1VA7A 1UFFA 2FO0A 1X69A 1M3AA 3EHRA 1SSHA 3TVTA 1X6GA 2ABLA 3VS4A 2K79A 2K7AA 5I11A 3EG3A 4K11A 4Z8AA 1GL5A 4AG2C 1JU5C 3EG0A 2GNCA 1TUCA 2CSQA 2RN8A 5IXFA 1PRLC 1KJWA 2A28A 2BTTA 2RNAA 3PE0A 4RTWA 2DA9A 1J3TA 2EVRA 4J9GA 1U3OA 2RMOA 1SEMA 5ECAA 2RQUA 2JM9A 1E7OA 4JPBW 1H92A 1MUZA 5IHKA 2LX7A 4OMPA 1ARKA 1TG0A 1B3QA 2D1XA 4RTVA 1S1NA 2DVJA 1JQQA 3PVLA 4LE9A 3NPFA 1PRMC 1SHFA 1M30A 2SEMA 1UG1A 2YUPA 2CH4A 4OMNA 2CSIA 3THKA 1GCPA 4JJCA 4AG1C 1GRIA 1JEGA 2HDAA 2ECZA 3M0PA 2LZ6B 2XMFA 2DNUA 2VKNA 3JV3A 3H41A 4J9FA 3I5RA 2KBTA 2ED1A 2D0NA 1UECA 1KSWA 3EG2A 4HXJA 1AZEA 4HVVA 2BZYA 1X43A 3VRYA 2KT1A 1AWXA 4Z88A 2BZ8A 3FJ5A 1KIKA 4ORZA 2P4RA 1B07A 2DRMA 1UUEA 3I35A 4CC7A 3IQLA 5GJWB 2DX1A 4F14A 1UGVA 1NLPC 1BK2A 2ENMA 1LCKA 2O2OA 3C0CA 3VS2A 2ROTA 4E6RA 1GFDA 2A36A 2DILA 3QWXX 2J6FA 2D8JA 2LNHB 3I9QA 1GCQA 2DL7A 4GLMA 1NG2A 2LJ3A 1UDLA 2RQTA 4J9CA 2X3XD 2G6FX 1OEBA 3VS6A 2ROLA 2RQRA 4J9DA 2AKKA 1M3CA 1T3LA 5IH2A 2YUNA 2M0YA 4A63B 1K0XA 2LCSA 1PKSA 2D8HA 1M8MA 1WI7A 4X1VA 1K9AA 1ZSGA 1ABOA 1G83A 1GCQC 2YDLA 4AFSC 4JZ4A 1Y0MA 5HCKA 3TSZA 2DF6A 2JMAA 1UTIA 1NM7A 2C0TA 2HSPA 1JXOA 1BBZA 3UA7A 1PKTA 2CREA 1RLPC 2KEAA 1AWWA 4F16A 1FYNA 1W1FA 2W10A 2A37A 4RTYA 5FW9A 2JM8A 3QWYA 2BZXA 2EYYA 4RTUA 4RTXA 2ED0A 1VYTA 2L0AA 4J9BA 1CSKA 2CT4A 1AWOA 3M0RA 1WA7A 4QT7A 4RTTA 3PVQA 2EW3A 5L23A 2DM1A 2KT8A 3REBB 2RQWA 2AK5A 1T0HA 1K1ZA 2GGRA 1Y57A 2RPNA 2C0OA 1OV3A 1MV0B 1AD5A 1NEGA 3GBQA 4ZNXA 2FPDA 1QCFA 2HCKA 5GJVB 1A0NB 2L3SA 2J05A 5IXBA 3EGUA 2J7IA 4LUEA 1YP5A 1X2KA 4OMLA 2LMJA 2JS0A 2EPDA 4OMMA 4J9EA 2EYXA 1GBRA 2L3PA 3NGPA 4HVWA 1ZUUA 1Z9QA 4R0KA 1OPKA 2JS2A 2MOXA 3M0TA 4RUGA 2L3QA 3SEMA 2V1RA 1VYUA 2PTKA 1XOVA 1WYXA 4RTZA 2A08A 2LP5A 5EC7A 2EKHA 4HVUA 1EFNA 4LUDA 3ULRB 2DE0X 2K9GA 2W0ZA 1QWFA 2YSQA 1WXUA 4LN2A 3VS0A 1SRMA 2EYZA 1GBQA 2CH4W 2DL3A 2OAWA 1WFWA 1ZUKA 2J6OA 2JT4A 1W6XA 1M27C 1HD3A 4WCIA 1WXTA 2J06A 3RNJA 1Z9ZA 1RLQC 1UHFA 1QKXA 3LH5A 2FG0A 2NUZA 4OMQA 3R6NA 4IIOA 4JZ3A 2V1QA 2DYBA 3EHQA 1HJDA 1KFZA 1WXBA 1ZUYA 1OOTA 1N5ZA 1WX6A 2SRCA 1GFCA 3H0HA 2EGCA 1QLYA 2EYWA 1E6HA 2GBQA 1IO6A 1HSQA 2OJ2A 2HEQA 1BU1A 1K76A 2DLPA 2VWFA 2KGTA 2NWMA 4LNPA 1NYGA 2K6DA 2E5KA 4KRTA 2EBPA 5FWCA 2GTOA 2KYBA 1JO8A 2LJ1A 2F2XA 1UJ0A 4J9HA 3CQTA 2O88A 1JXMA 2DMOA 2F2WA 5I22A 5FWBA 4D8KA 3A98A 1SHGA 4Z89A 3M0QA 2RQVA 1RUWA 2KRNA 1AEYA 1SPKA 1W70A 4CC3A 2DJQA 2O31A 2J6KA 2JW4A 2DL5A 2LJ0A 2EGAA 1WLPB 1UJYA 2I0NA 1U06A 1ZX6A 2OI3A 1YWPA 4IIMA 1ZBJA 2K2MA 2AZVA 2EGEA 3SHWA 2LQWA 3U23A 1NLOC 3EG1A 1E6GA 2H8HA 1CKBA 3VS1A 2KROA 4OMOA 4CC4B 1YWOA 1AWJA 2FRYA 2M51A 4DEYA 1QWEA 1PWTA 1T3SA 3KFVA 2DL8A 1UHCA 2KR3A 2DBMA 1I07A 3H0FA 2JTEA 4M4ZA 2VVKA 2CT3A 2PZ1A 1U5SA 4EIKA 2PNIA 4AFZC 1K4US 4D8DA 2MCNA 1YNZA 1TUDA 2KRMA 1I1JA 3NHNA 1X6BA 1WIEA 2KXDA 1M3BA 5IHNA 1AVZC 2FPEA 2IIMA 1YN8A 2JMCA
chains in the Genus database with same CATH superfamily
1QKWA 4BACA 1PD0A 1VQNQ 3CXCP 3OYJA 1M1GA 2F2VA 4OGEA 3X25B 3OYFA 4ATOA 3PIPA 4FCYA 1YBYA 5KYXA 1K8AR 2KXCA 3UA6A 4J5YA 1N8RC 2B86A 4JJBA 2FPFA 1KHIA 2XD0A 5GANe 1ZA2B 1PNJA 2CDTA 2O01E 2RHZA 4L5GA 2DERA 4OGCA 2GFAA 2CYZB 3HP9A 3H0IA 5GAOr 1VQ5A 2MAMA 3VS7A 1WHHA 1V1CA 4M7AD 1OYXA 2Y4YA 1D3BA 1FX7A 3GF5A 5GAMd 2HBWA 4PJOA 4XU3A 2COYA 4J9IA 1BI3A 2HKQB 3CMEQ 3HSBA 4M7DC 1VQOA 2RH2A 3QHSA 2OTLT 1G2BA 4L6V5 2GTJA 1OPLA 1X27A 3V7SA 1WHMA 3JCMV 2YUOA 2ESWA 8ATCB 4EMKC 4ESRA 2KYMA 2QQRA 4A4HA 2FO0A 1X69A 1Q82C 3TVTA 4C8QC 3VS4A 1VQKQ 1M1KR 2AIRB 4Z8AA 3I55Q 5I21A 2VGNA 3OYGA 1TUCA 1YFNA 1YJNT 3A8MB 5GAMj 2H3JA 4RTWA 2XG8D 1U3OA 1C6VX 3CC7Q 2F69A 3SWNA 2RQUA 3CMAA 1BCOA 3KXTA 2ZPHB 2QA4T 3HRTA 1VQNT 5IHKA 2IG0A 3I56Q 3GNGA 3OS5A 1XNIA 4LDXA 2D1XA 2DVJA 3NPFA 1PRMC 4C0DB 2PVOB 5GANd 3LWIA 1UG1A 1ZQ1A 3CCEA 2RO0A 3EFSA 4OMNA 5CKEA 3THKA 4JJCA 1G3SA 1GRIA 2K5IA 3VU3C 3E9GA 1SG5A 1K9MC 3H9NA 2DNUA 4C92B 3H41A 5GAN6 2E4HA 4HXJA 1VQ8A 1TS9A 2QXFA 4FW1A 4HVVA 1PC0A 3VRYA 3MPUB 4M78D 3SD4A 4LDUA 2KT1A 3OSVA 1M4ZA 2RHUA 2WACA 5KCHA 2JJ9A 5HK0A 2XICA 3CCVA 4IUUA 3C12A 4CC7A 1S72A 3IQLA 1UGVA 1NLPC 3G7ZA 2VXFA 2ENMA 3VS2A 4M7AG 1AHJB 2A36A 2DILA 4X9DA 3QWXX 4GLMA 3QDRB 1WGSA 2ROLA 2RQRA 2AKKA 5A0DA 4M77C 2ZPFB 1UB4A 3FB9A 5D6YA 3CD6A 4PJJA 4PJOC 1WI7A 2FYKA 3G4SQ 1K9AA 1ABOA 2YHTA 2HKNA 2D9TA 3DLLA 3CC7T 2DTOA 2VB6A 4JZ4A 3M4YA 3TSZA 3P8BB 3HTRA 4DBFA 1UTIA 4NL3A 1BIBA 2HSPA 1LJOA 1BBZA 5GAOn 2RI2A 3G6EA 2ZCFB 3OB9A 1AWWA 5DM7R 4M75F 1DJ7B 1C0MA 1HXDA 2A37A 3CCRQ 2XKOC 3LLRA 2B8AA 2MMPA 2E6ZA 2NLUA 1VQ7Q 4AT1B 4ELYC 4M7DB 2CT4A 4ZN3A 1UGQB 1WA7A 4QT7A 3DLMA 1IHWA 2DM1A 2KT8A 4OMFB 3REBB 1VQMA 1QW1A 4PFZA 5CO7A 4BE1A 2RPNA 1MV0B 1AD5A 5C6SA 3GBQA 4M77E 3CCLQ 4EMKB 3HRUA 3R6OA 2HCKA 3LGFA 1M9SA 1RAAB 4C8QB 1N9SA 3QUIA 5GAOq 1WNLA 2EKOA 5IXBA 1KK7A 1Q82R 4XTVA 2XDPA 4LUEA 1YP5A 4OMLA 2LMJA 4OMMA 1HYOA 1GBRA 1JB0E 2L3PA 3NGPA 8AT1B 3HFNA 2MWOA 3URGA 4N0AA 2X51A 4R0KA 2JS2A 4RUGA 4NS5A 1MNDA 2DAQA 1U1TA 3MJXA 2PTKA 2DZ9A 1QCOA 3N5BB 1XOVA 4RTZA 3BFMA 3OW2S 3NTKA 4HVUA 5LJ5f 3CCJT 2QTVA 1EFNA 4XU2A 3QDFA 3MEUA 2DE0X 2RI5A 2YSQA 1WXUA 1VQ8T 3LWHA 2H3EB 1GBQA 2DL3A 1ZUKA 1MMAA 1M27C 1QQJA 1QKXA 1K8AU 4DBQA 3X24B 4PKCC 4ANJA 2G3RA 2L89A 4E7JA 1HJDA 1KFZA 1WHJA 1ZUYA 2QGGA 1N5ZA 2EGCA 2D6FA 2F1LA 1E6HA 3JSCA 5GAN7 1EX4A 3CCRT 4C0GA 4HA8A 3V8KA 3OBWA 2K2VA 1TH7A 2XDDA 4KRTA 1RAFB 5FWCA 1JO8A 4C92A 2F2XA 4J9HA 3V8JA 1JXMA 5I22A 4B9XA 3RR6A 2RJEA 5CAIA 1AEYA 3CD6T 1SPKA 1YIJA 3TEEA 5CK9A 3CCLT 3JCMe 2O31A 3MHXA 2RB6A 2YWWA 1PSEA 2K2MA 2E64A 3G6ET 3U23A 1UEBA 2LVMA 3OYKA 3QXEB 1TU0B 4M77B 2CZ6B 4ZGJB 2MI6A 2KROA 3JCMJ 2CZ7B 1W2BA 4XTZA 1BIAA 4PJOB 4CC4B 2QK0A 4E7ZA 4M7DD 1AWJA 2FRYA 2M51A 4DEYA 5GAOp 1T3SA 2KQWA 2DBMA 2KR3A 3QYGB 3H0FA 1VQ4Q 2VVKA 2CT3A 1Q7YU 2LX9A 1KHCA 2AHJB 1KQSS 2PNIA 3FEOA 5J39A 3OW2A 4BI8B 3GIBA 2MCNA 1YNZA 1TUDA 1I1JA 3NHNA 2COZA 4J6XA 5J26A 3OYDA 3TQ7P 1V76A 1M3BA 2X4WA 4J83A 2FPEA 1ZSZA 4C8QD 3M55A 5GAN4 2YUQA 2DL4A 2O9VA 1MV3A 4XTUA 3MP6A 1ABQA 2GQIA 1VQLQ 2C0IA 1XTDA 1TWBA 4JLIA 3M0UA 4AFUC 3OY9A 2AKLA 2NUTB 3S3OA 2CP3A 2O9SA 3M5AA 2KY9A 3RBBB 4C92G 2CZ1B 1IREB 2WSFE 4M78E 2DKGA 1NPRA 3RDVA 1YCSB 1CKAA 2OTLA 1YITQ 2P0KA 4KGVB 3JB9G 4FT2A 5KYYB 3A8OB 4ELZC 3TSWA 2VGMA 1C1AA 2JOYA 2KRSA 2RHXA 1NYFA 2AZSA 2CUDA 1I0CA 5CVIA 5LJ5h 2IVWA 4EMKA 5D7UA 2DBKA 3JCMd 4IUVA 1K73C 3REAB 3JCMQ 4M75C 4X9CA 5GAN8 2QDLA 4KH1B 2QYZA 4LDWA 3EAEA 4NL2A 5GANg 1YJNA 3VYHB 4GBQA 2FRWA 4CC2A 1H8KA 5GAN2 3UF4A 4FL6A 1UFFA 3CC2A 3DB4A 2K79A 3MP1A 3J80E 2A7YA 2K7AA 2FB7A 2DXTA 2QA4A 1Q81U 2GCXA 4X34A 2C06A 2CSQA 2QI2A 2VC8A 1VQNA 5IXFA 1KJWA 3VV0A 2BTTA 1J3TA 2EVRA 4KULA 1N8RU 1GXIE 5J3BA 1XQHA 4GY5A 1SEMA 5ECAA 1KQSA 4E7LA 2JM9A 1E7OA 4JPBW 4BE2A 5I2MA 2XK0A 1YJWQ 2NUPB 1VQLT 1B3QA 5FRMA 3PVLA 4M7DG 3S6WA 2XHCA 1SHFA 1M30A 4PJNA 2JNGA 1QP2A 5EG2A 4PJOD 4J7IA 1FXXA 3CMEA 2CSIA 1GCPA 4FSXA 1Q86U 1YITT 1M1FA 2HDAA 5CKFA 3A8HB 1TOVA 4JRIA 3OW2P 3E2UA 2LZ6B 2PUOB 2BUDA 2EWNA 2VKNA 3JV3A 4FU6A 2HSEB 4C8QG 2ED1A 1UECA 1NPPA 3JCMX 1KSWA 1LPLA 2JVVA 3UT1A 3CCMT 3FRNA 3EG2A 4QQ6A 2BZYA 1X43A 4N4HA 5LJ5j 1Q95G 4Z88A 1VQKA 2BZ8A 3OSSC 1ZSZC 1R0BG 3FJ5A 4ORZA 2CP7A 4C5HA 3J81E 2EQMA 2MYSA 2QGFB 2DRMA 3CCQT 2M02A 4M77A 3ZBDA 5CKBA 3FJPA 4F14A 4AMCA 4DQ2A 2EQKA 3GOXA 1H641 3C0CA 1QVFS 4E6RA 2F5KA 3GP8A 2K5LA 4BD3A 4EMGA 3CC7A 1NG2A 1UDLA 2RQTA 2X3XD 3VJPA 1B7TA 4FYYB 2BIVA 5FROA 1T3LA 5IH2A 2YUNA 1OULA 1K0XA 1UGRB 2HL3A 2D8HA 1SSFA 2DXBA 2KK4A 1ZSGA 1YCYA 1M8VA 2V26A 3M4GA 1U1SA 1GCQC 2YDLA 3QJ6A 5HCKA 3GNFB 4EDUA 3G71T 1YJWT 2C0TA 3M54A 3UA7A 2NUTA 1K9MU 1I8FA 3QKJA 3A8GB 4N4IA 1OX8A 4RTYA 5FW9A 2JM8A 1X6OA 5AYFA 2BZXA 2EYYA 3CC2T 2YLBA 4RTXA 3L2VA 3FIFA 3M9QA 1VYTA 1VIEA 2OTJQ 5KYYA 1VUBA 4M75B 2JUFA 4XTWA 1K73R 2P84A 2EW3A 2AK5A 1KQSP 1T0HA 1K1ZA 3FDRA 3CEYA 2GFUA 2JTMA 2VUBA 4BDZA 2DXCA 4ZNXA 3EGDA 1LNXA 1AT1B 1G5VA 1VQ6Q 1Y96B 2M1HA 4M77G 3M58A 4C0ZA 3JB9H 1EZZB 4BI3A 3HKSA 4MZMA 4PJOG 4M78F 3MP8A 2RJFA 2Z0WA 4BY6C 2HMAA 3CCJA 4BI4A 3L1AA 2YRDA 3Q1JA 2MF2A 2LC4A 3CMET 4XTXA 3M0TA 4QQGA 3SEMA 1VQ9Q 6AT1B 1U8RA 2V1RA 4LDVA 3OBYA 1QVFA 5LJ3g 1VYUA 2LQKA 1WYXA 5GMKi 2ZPEB 2EKHA 1KD1C 3OMCA 3M56A 2MK5A 4C0FA 2F5TX 1Y7XA 2E1HA 3CCRA 2OAWA 1WFWA 2JT4A 1HD3A 1VQKT 1PSFA 2J06A 1VQ7A 3HFOA 2NUPA 3I55T 1UHFA 3LH5A 2FG0A 3R6NA 2QTXA 5HY6A 3L42A 3QIIA 1GFCA 4ZGEB 4HCBA 2EYWA 4ZTFA 4EPCA 4C5EA 1OZ3A 1K76A 3CCLA 2VWFA 3QO3A 1NYGA 2K6DA 5GAOm 2EBPA 3EG9A 1RAEB 2KYBA 1I4K1 1I81A 5IN1A 4IURA 3I56T 1ZSZB 2O88A 2HBPA 5FWBA 4BB7A 3M0QA 4QVZA 1MMNA 2LCCA 4HCCA 1W70A 2DD5A 3PFSA 4CC3A 2DJQA 2DFUA 2CGHA 2J6KA 4R55A 2DL5A 2LJ0A 3JB9I 1UJYA 3TREA 1VQ6T 2O4XB 2I0NA 1BI2A 3CCUQ 2DIQA 2OI3A 5CQYA 1ZBJA 5KYUB 1S72Q 3SHWA 2DVEA 4QW2A 4FYWB 4RG2A 5DLOA 3CPWS 2FHDA 2EYQA 1P92A 5KE3A 1QMCA 1R8OB 2ZPBB 4OMOA 1VQ9T 1G3WA 1KQ2A 4J6WA 1YWOA 4M75D 1RACB 2WSEE 3KFVA 1MNEA 2DL8A 3RMQA 3JCMg 2JTEA 3OS0A 2PZ1A 1U5SA 3OA6A 2R57A 4EIKA 3ER0A 1K4US 3MEVA 2YLCA 1X6BA 4DBRA 4OB3B 4IUQA 1M2VB 5A0GA 5KYWB 2K3XA 2FZCB 5IHNA 2IIMA 1NJIC 1TXQA 3E1SA 3HPWA 4FW2A 1PHTA 1KC8U 3PIOA 4C92D 5CIUA 2KE9A 3O5ZA 4HCKA 4RCBA 1ZBXA 4DEXA 1QVFP 3G4ST 3JB9D 2X4YA 4XU0A 2FEIA 5LJ3h 2KNBB 2ZPIB 4M75A 3ZL7C 1G8XA 3UATA 3OYIA 2EIFA 2VASA 3VS5A 3VKIA 9ATCB 2RJDA 1M90C 3ME9A 4HT9A 4M7AE 1VYVA 2LTOA 1AOJA 2RI3A 2XI9A 2VXEA 3L2QA 3BDUA 4BY6B 1ZLMA 3CBMA 1YI2Q 3RERA 1BB9A 1AZGB 5IHIA 2L3RA 3D7SB 1Y96A 4F7UE 4XQ3A 4Y92A 2RF0A 3SFMA 1VQ7T 1UE9A 1VIFA 3I5SA 4BDYA 2EQIA 3CCUT 4J7FA 2DEQA 3QSUA 1MMGA 1FWZA 1UGPB 1YHQQ 3VRZA 1VQ4A 3NTIA 4FT4A 4RMOA 1VA7A 1IGQA 3EHRA 1M3AA 1SSHA 1X6GA 3AT1B 3C4SA 1KD1R 3EG3A 4K11A 3CPWA 1GL5A 1FMWA 4AG2C 1JU5C 3EG0A 2GNCA 2DYIA 1OU9A 3CC4Q 4JS5A 1W4SA 4GLKA 1VQLA 3PE0A 2DA9A 4M78C 2LNVA 1M1KU 3OYBA 4J9GA 1RAGB 3L2WA 4B9WA 4FYVB 1LVKA 3OYAA 2PQWA 2RMOA 3OYLA 5KYNA 1PG5B 1YITA 1H92A 1F1BB 1MUZA 4II1A 4FIBA 1IRXA 2LX7A 3EGXB 5GAMg 3CCSQ 1TG0A 1WQWA 4RTVA 1S1NA 1JQQA 1UGSB 3X28B 4M75G 4OB0B 3E9FA 2EQUA 3JAME 1N27A 1BKBA 2YRVA 4B6MA 3CCMA 2CP0A 2YUPA 2CH4A 2CP2A 1K73U 5GMKh 4JJNK 1JEGA 2ECZA 2QEXQ 5LJ5e 1WJSA 3FC3A 3QG1A 2XMFA 4RG8A 3CCQA 3I5RA 2KBTA 1QVGS 2A3LA 2EJ9A 3BY7A 2RK1A 2CP5A 5D6XA 4Z02A 1AZEA 1MMDA 1YI2T 4V2SA 4WTOB 2O4XA 4DA4A 2HNIA 1OU8A 2HL5C 3QZ5B 4OB1B 5CQXA 2K3YA 2QA4Q 4LD9K 3A1PA 3QPHA 5KYUA 1KIKA 1JRIA 5FU6C 1B07A 3QZ9B 3MEAA 1VQPQ 3G1JA 3V8LA 3OS1A 4JDSA 3SB2A 1JJ2S 3PMTA 5GJWB 2DX1A 4J8OA 3GPLA 1BK2A 1WJQA 2O2OA 2ROTA 1GFDA 4P5NA 2D8JA 2LNHB 5GANf 1GCQA 2RK2A 2LJ3A 1IHVA 1D09B 2FZKB 3EGDB 2G6FX 4JRPA 3A8LB 3CC4T 1MHNA 3G71A 1YJWA 2X35A 2PU9B 2LCSA 1VOMA 1NJIR 5KE2A 3QYHB 4E7HA 1M8MA 2P4TA 2VYTA 3PT9A 1M2VA 2V8IA 5KYWA 5CKHA 1G3YA 5GMKm 3VUBA 2ZZDA 3F70A 1RADB 3PMIA 2JMAA 4MDWA 2K57A 1NM7A 3P8DA 1PM3A 2EFIA 1BI0A 2PVDB 3LYIA 3NTHA 4E47A 3CCST 1M5Q1 1D0ZA 5I2SA 1BI1A 1PKTA 5FLXE 2KEAA 1RLPC 2CS7A 1VQ4T 2NYSA 4F16A 4QKUA 1FYNA 3CPWP 2W10A 1WHKA 1M90R 2E5QA 2EJFA 1D1BA 2ZPGB 2L0AA 5LJ5d 2DD4A 2QEXT 2BE7D 1CSKA 2PVGB 3M0RA 3RKXA 1BYMA 4RTTA 3PVQA 3A5ZB 5L23A 2RQWA 3ASKA 4PFOA 2OAUA 4A54A 3X26B 4A53A 4UC4A 1Y57A 4M77D 4PNOA 1NEGA 3C94A 5GAN5 5D6WA 2FPDA 4PFPA 1QCFA 2X4JA 1A0NB 5GAMh 2L3SA 3J7AF 3KUFA 1TTHB 3V7RA 2BKDN 2J05A 3EG9B 5GMKl 1VQPT 3META 2J7IA 2EPDA 3JCMP 2VV5A 3H8ZA 2LDMA 1O75A 1Z9QA 1JJ2A 4M7AF 3BE3A 3LX7A 3SDZA 4M78B 2MOXA 3L2UA 1Q82U 2RM4A 3KBGA 3I55A 4HCZA 4F7UF 2A08A 1D0XA 3MCAB 2K5FA 4Q5WA 4C92E 2DK3A 3ULRB 2K9GA 2W0ZA 2Y90A 1N6AA 4A4KA 1YJ9Q 1OQKA 3CBPA 2EYZA 2Y4XA 2J6OA 1WXTA 2QG9B 3RNJA 1Z9ZA 5IT9E 2HQHA 2OTJA 3EGXA 1RLQC 2LCLA 1EIFA 1ZHIA 2GF7A 2NUZA 4OMQA 5GAN3 4JZ3A 2V1QA 3EHQA 1WXBA 3I56A 1OOTA 2FVUA 1WX6A 2EQJA 2QQSA 1NBEB 3H0HA 2GBQA 1I5LA 1IO6A 4FM4B 2XIDA 1BU1A 1Q86C 1XJWB 1PCXA 3CBOA 2NWMA 2LT1A 1VQ6A 2GTOA 5GANh 3LH0A 3PTAA 2LJ1A 5CKDA 3CQTA 2DMOA 2F2WA 2DTIA 2E12A 3A98A 5IAYA 3OYNA 5FU6B 2RQVA 4HT8A 2KRNA 1B34B 3S3MA 1D0YA 4ME7A 2XDBA 3WXMB 1ZA1B 4PLIA 1WLPB 3WVDB 4E2FB 2OX7A 1VQ9A 2RA2A 3HRSA 4M7AA 1VQ5Q 2X9HA 2AZVA 2QAZA 2EGEA 2LQWA 1O9SA 3RESA 4F7UA 1KD1U 3TCJA 3VYGA 2BE9B 2DXUA 2MPXC 1TUGB 3VS1A 1VQOQ 1Q7YR 4KGXB 2MWPA 3L2RA 2E3HA 3JCMc 3RUXA 5FU7C 4M7DE 3T9NA 1QWEA 1PWTA 2E70A 1UHCA 4ZGDB 1I07A 1QVGP 3UWNA 1FMVA 1YJ9T 3E19A 4AFZC 1WZOA 5LJ3f 2KRMA 3G4SA 3P8HA 1AVZC 1YN8A 1UJ0A 2L5QA 4C8QE 4BUGA 2LQNA 2CP6A 1RABB 1QP3A 2R58A 4MMLA 1JJ2P 4XAXB 2FL7A 2M0OA 4N4GA 2CUBA 4F17A 1OZ2A 4JJDA 3M0SA 2K3BA 4E7SA 1WDXA 5LL6S 3CMAQ 2LQ8A 2DRKA 3INZA 2E6NA 1SRLA 4FSSA 3MO8A 3WVEB 1RI9A 3CCUA 3NMZC 2ZGWA 1R77A 1T0JA 1KQ1A 1FMKA 4AFQC 5GANj 4KUIA 5DY9A 1TSFA 1X2QA 3CCEQ 4PJLA 2L2PA 1WHGA 2X3WD 4C5GA 2OTJT 4MMKA 4WF2A 1H3HA 3LGLA 4KH0B 4XK8E 4F7UG 1VQ5T 1H3ZA 2WSCE 2YT6A 3CCJQ 5KCOA 3L2ZA 1Q81R 4A4FA 1JBMA 2MIOA 4VUBA 2JXBA 3VS3A 1VQ8Q 1K0SA 3MKDA 4M78A 4TVRA 1NEBA 2D0QB 1VQOT 3C95A 2ABLA 2QQBA 2FZGB 3AHUA 2DEUA 5I11A 1N8RR 1IXDA 4JUVA 1NJIU 3RMSA 1WHLA 3CCVQ 2RN8A 3UPUA 1PRLC 4EMHA 4JRQA 2A28A 1IGUA 2RNAA 5DLQE 4OP0A 4R56A 4Y91A 4XTYA 3GLXA 2P0QA 3BDLA 3JCMf 4LD6A 4M7AC 1OI1A 2E10A 2X4XA 1Q86R 4OMPA 5A0LA 1ARKA 2YXYA 2LT4A 1M90U 4LE9A 5LJ3e 5GAOl 5FRNA 3CPFA 1WJRA 3CD6Q 5L8RE 4LDYA 2IPOB 2SEMA 5M9OA 1X01A 4C92F 1YI2A 3CMAT 3SWNC 4PJOE 3VUZA 4ZN1A 3RKWA 4AG1C 3PNWC 3EFOB 3M0PA 3JB9F 4JRKA 2DIGA 1V29B 3OQ5A 1IB8A 1RAHB 1B34A 3X20B 3G6EQ 4DOVA 1YHQA 1W2BS 4J9FA 2M16A 3OYYA 5KH6A 2D0NA 2PUKB 4KT0E 2GQVA 4PJMA 3S3NA 3CCET 1HK9A 2ATCB 1AWXA 3EH2A 2HZYA 4A4EA 3O8VA 3OS2A 2P4RA 4M78G 2KMTA 4HKEA 3V7CA 3CXCS 1LOJA 4KBMB 1VQMQ 4KGZB 5FU7B 1UUEA 3CC4A 1QCNA 3I35A 1ACMB 1N9RA 4O5VA 1LCKA 4IUTA 2DO3A 2RHIA 4RKUE 3RIRA 3EH1A 5LJ5g 2J6FA 4C5IA 2DPPB 3I9QA 2DL7A 2XU8A 2DETA 3OMGA 4J9CA 3NFCA 4QQDA 4QVDA 1OEBA 2ZAEA 3M59A 3VS6A 3CCVT 4J9DA 4CI0C 1S72T 1M3CA 3JB9J 3CCSA 2M0YA 1SKUB 4A63B 2AT1B 2YRCA 1PD1A 3TU4K 4Y28E 1PKSA 2RHYA 2DJZA 1WQ7A 4X1VA 4MZPA 1K9MR 3H6ZA 2HQEA 3ZFJA 1G83A 4F04B 4AFSC 3PGGA 2R5AA 1Y0MA 1KC8C 1NE8A 2DF6A 2V8KA 1KG1A 2JZ2A 4PLLA 4RCCA 2QEXA 1JXOA 5LJ3d 1NZ9A 2CREA 4M7DF 2M9UA 2KDSA 5GMKe 1W1FA 5KYXB 3QWYA 4RTUA 4CRIA 4D6WA 2ED0A 5GAMf 1RI0A 4PK4A 1K8AC 2I2LA 2L8DA 4J9BA 1AWOA 1VQPA 1R0CB 3OYCA 2HQXA 4C8QF 2DZCA 2GGRA 1D3BB 4MDXA 2C0OA 4PL6A 1OV3A 2KI7A 4DBHA 3ZEHA 3OYEA 5GJVB 1Y07A 2A0FB 4BE0A 4XU1A 4A4GA 5LJ3j 2COWA 3JCMh 4IUPA 2RD1A 3EGUA 1VQMT 1X2KA 2QQ9A 2JS0A 5CCAA 4J9EA 5CR2A 2KVQG 1YIJQ 2EYXA 4HVWA 3CXCA 4YTLA 1ZUUA 4DOWA 1OPKA 4JS4A 2L3QA 2E41A 1D1CA 1X75C 3QBYA 1OX9A 3M57A 4JLGA 2P0PA 4E7IA 2LP5A 5EC7A 1YHQT 4M7AB 4LUDA 1M1KC 2R5MA 4OVAA 1QWFA 2KSSA 2E3IA 4LN2A 7AT1B 3JRZA 3HHTB 3VS0A 3QJYA 1SRMA 4N0AC 1QVPA 2CH4W 4F7UB 3DKMA 4M7DA 3BW1A 3JCMW 1W6XA 4WCIA 1I5OB 2HAXA 4QVCA 4O6JA 3SWNB 4IIOA 3LW5E 2DYBA 1Q7YC 3EFRA 2QASA 1M2OA 2SRCA 1QLYA 3RKYA 3CCMQ 2QQAA 1HSQA 2OJ2A 2JTFA 5C0MA 2HEQA 4C8QA 2DLPA 2KGTA 1G3TA 4LNPA 3EFOA 3OYMA 2E5KA 3CCQQ 1BCMA 5HKCA 4C0DC 1RAIB 4D8KA 1SHGA 4Z89A 1RUWA 3M53A 4L59A 2K4YA 5GAMe 2QDYB 4KUDK 1MGQA 2JW4A 2EGAA 2OTLQ 1U06A 2V8JA 2EAYA 1ZX6A 2EJGA 4E7KA 4M77F 5HK3A 1YWPA 4C92C 4IIMA 4OB2B 4PJOF 5GMKj 1RL2A 3JCMb 1SF9A 1NLOC 1YIJT 3EG1A 1E6GA 2H8HA 2CZ0B 1CKBA 1Y71A 1YJ9A 5AT1B 3DB3A 1QVGA 2RJCA 1WPYA 4J6YA 4IKFA 4OF1A 4FYXB 4M75E 3G71Q 4MZTA 2E65A 2DTHA 3MEWA 5A2QE 3FLGA 2CKKA 1YJNQ 1W2BP 1D1AA 4M4ZA 4LXCA 2HD0A 1KC8R 3OYHA 2LRQA 4D8DA 3CC2Q 2KAFA 1WIEA 2KXDA 4ZTJA 1IZ6A 4NOYA 2JN0A 1Q81C 3HL8A 2JMCA 3UDCA
chains in the Genus database with same CATH topology
1QKWA 1PHTA 2YUQA 2DL4A 2O9VA 1MV3A 2LQNA 1ABQA 2GQIA 2F2VA 2C0IA 2KE9A 3O5ZA 2KXCA 4HCKA 3UA6A 3M0UA 2CUBA 4AFUC 2B86A 4DEXA 4F17A 2AKLA 4JJBA 2FPFA 2O9SA 4JJDA 3M0SA 3RBBB 2K3BA 1PNJA 1WDXA 2FEIA 2CDTA 2KNBB 1YCSB 3ZL7C 2DRKA 1CKAA 3UATA 1SRLA 4FSSA 3VS5A 1RI9A 3H0IA 3NMZC 3VS7A 1T0JA 1V1CA 3TSWA 1FMKA 4AFQC 2KRSA 1VYVA 1NYFA 2AZSA 2CUDA 1I0CA 1AOJA 2HBWA 1ZLMA 1X2QA 2DBKA 4J9IA 2L2PA 1BB9A 1AZGB 5IHIA 3REAB 2X3WD 4Y92A 2RF0A 1G2BA 1UE9A 3I5SA 2GTJA 2QDLA 1H3HA 2EQIA 1OPLA 1X27A 2YT6A 3VRZA 4GBQA 2YUOA 2FRWA 2ESWA 4CC2A 2MIOA 3VS3A 2JXBA 1K0SA 4ESRA 1H8KA 2KYMA 3UF4A 1NEBA 1VA7A 1UFFA 2FO0A 1X69A 1M3AA 3EHRA 1SSHA 3TVTA 1X6GA 2ABLA 3VS4A 2K79A 2K7AA 5I11A 3EG3A 4K11A 4Z8AA 1GL5A 4AG2C 1JU5C 3EG0A 2GNCA 1TUCA 2CSQA 2RN8A 5IXFA 1PRLC 1KJWA 2A28A 2BTTA 2RNAA 3PE0A 4RTWA 2DA9A 1J3TA 2EVRA 4J9GA 1U3OA 2RMOA 1SEMA 5ECAA 2RQUA 2JM9A 1E7OA 4JPBW 1H92A 1MUZA 5IHKA 2LX7A 4OMPA 1ARKA 1TG0A 1B3QA 2D1XA 4RTVA 1S1NA 2DVJA 1JQQA 3PVLA 4LE9A 3NPFA 1PRMC 1SHFA 1M30A 2SEMA 1UG1A 2YUPA 2CH4A 4OMNA 2CSIA 3THKA 1GCPA 4JJCA 4AG1C 1GRIA 1JEGA 2HDAA 2ECZA 3M0PA 2LZ6B 2XMFA 2DNUA 2VKNA 3JV3A 3H41A 4J9FA 3I5RA 2KBTA 2ED1A 2D0NA 1UECA 1KSWA 3EG2A 4HXJA 1AZEA 4HVVA 2BZYA 1X43A 3VRYA 2KT1A 1AWXA 4Z88A 2BZ8A 3FJ5A 1KIKA 4ORZA 2P4RA 1B07A 2DRMA 1UUEA 3I35A 4CC7A 3IQLA 5GJWB 2DX1A 4F14A 1UGVA 1NLPC 1BK2A 2ENMA 1LCKA 2O2OA 3C0CA 3VS2A 2ROTA 4E6RA 1GFDA 2A36A 2DILA 3QWXX 2J6FA 2D8JA 2LNHB 3I9QA 1GCQA 2DL7A 4GLMA 1NG2A 2LJ3A 1UDLA 2RQTA 4J9CA 2X3XD 2G6FX 1OEBA 3VS6A 2ROLA 2RQRA 4J9DA 2AKKA 1M3CA 1T3LA 5IH2A 2YUNA 2M0YA 4A63B 1K0XA 2LCSA 1PKSA 2D8HA 1M8MA 1WI7A 4X1VA 1K9AA 1ZSGA 1ABOA 1G83A 1GCQC 2YDLA 4AFSC 4JZ4A 1Y0MA 5HCKA 3TSZA 2DF6A 2JMAA 1UTIA 1NM7A 2C0TA 2HSPA 1JXOA 1BBZA 3UA7A 1PKTA 2CREA 1RLPC 2KEAA 1AWWA 4F16A 1FYNA 1W1FA 2W10A 2A37A 4RTYA 5FW9A 2JM8A 3QWYA 2BZXA 2EYYA 4RTUA 4RTXA 2ED0A 1VYTA 2L0AA 4J9BA 1CSKA 2CT4A 1AWOA 3M0RA 1WA7A 4QT7A 4RTTA 3PVQA 2EW3A 5L23A 2DM1A 2KT8A 3REBB 2RQWA 2AK5A 1T0HA 1K1ZA 2GGRA 1Y57A 2RPNA 2C0OA 1OV3A 1MV0B 1AD5A 1NEGA 3GBQA 4ZNXA 2FPDA 1QCFA 2HCKA 5GJVB 1A0NB 2L3SA 2J05A 5IXBA 3EGUA 2J7IA 4LUEA 1YP5A 1X2KA 4OMLA 2LMJA 2JS0A 2EPDA 4OMMA 4J9EA 2EYXA 1GBRA 2L3PA 3NGPA 4HVWA 1ZUUA 1Z9QA 4R0KA 1OPKA 2JS2A 2MOXA 3M0TA 4RUGA 2L3QA 3SEMA 2V1RA 1VYUA 2PTKA 1XOVA 1WYXA 4RTZA 2A08A 2LP5A 5EC7A 2EKHA 4HVUA 1EFNA 4LUDA 3ULRB 2DE0X 2K9GA 2W0ZA 1QWFA 2YSQA 1WXUA 4LN2A 3VS0A 1SRMA 2EYZA 1GBQA 2CH4W 2DL3A 2OAWA 1WFWA 1ZUKA 2J6OA 2JT4A 1W6XA 1M27C 1HD3A 4WCIA 1WXTA 2J06A 3RNJA 1Z9ZA 1RLQC 1UHFA 1QKXA 3LH5A 2FG0A 2NUZA 4OMQA 3R6NA 4IIOA 4JZ3A 2V1QA 2DYBA 3EHQA 1HJDA 1KFZA 1WXBA 1ZUYA 1OOTA 1N5ZA 1WX6A 2SRCA 1GFCA 3H0HA 2EGCA 1QLYA 2EYWA 1E6HA 2GBQA 1IO6A 1HSQA 2OJ2A 2HEQA 1BU1A 1K76A 2DLPA 2VWFA 2KGTA 2NWMA 4LNPA 1NYGA 2K6DA 2E5KA 4KRTA 2EBPA 5FWCA 2GTOA 2KYBA 1JO8A 2LJ1A 2F2XA 1UJ0A 4J9HA 3CQTA 2O88A 1JXMA 2DMOA 2F2WA 5I22A 5FWBA 4D8KA 3A98A 1SHGA 4Z89A 3M0QA 2RQVA 1RUWA 2KRNA 1AEYA 1SPKA 1W70A 4CC3A 2DJQA 2O31A 2J6KA 2JW4A 2DL5A 2LJ0A 2EGAA 1WLPB 1UJYA 2I0NA 1U06A 1ZX6A 2OI3A 1YWPA 4IIMA 1ZBJA 2K2MA 2AZVA 2EGEA 3SHWA 2LQWA 3U23A 1NLOC 3EG1A 1E6GA 2H8HA 1CKBA 3VS1A 2KROA 4OMOA 4CC4B 1YWOA 1AWJA 2FRYA 2M51A 4DEYA 1QWEA 1PWTA 1T3SA 3KFVA 2DL8A 1UHCA 2KR3A 2DBMA 1I07A 3H0FA 2JTEA 4M4ZA 2VVKA 2CT3A 2PZ1A 1U5SA 4EIKA 2PNIA 4AFZC 1K4US 4D8DA 2MCNA 1YNZA 1TUDA 2KRMA 1I1JA 3NHNA 1X6BA 1WIEA 2KXDA 1M3BA 5IHNA 1AVZC 2FPEA 2IIMA 1YN8A 2JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKW A;  1PHT A;  2YUQ A;  2DL4 A;  2O9V A;  1MV3 A;  2LQN A;  1ABQ A;  2GQI A;  2F2V A;  2C0I A;  2KE9 A;  3O5Z A;  2KXC A;  4HCK A;  3UA6 A;  3M0U A;  2CUB A;  4AFU C;  2B86 A;  4DEX A;  4F17 A;  2AKL A;  4JJB A;  2FPF A;  2O9S A;  4JJD A;  3M0S A;  3RBB B;  2K3B A;  1PNJ A;  1WDX A;  2FEI A;  2CDT A;  2KNB B;  1YCS B;  3ZL7 C;  2DRK A;  1CKA A;  3UAT A;  1SRL A;  4FSS A;  3VS5 A;  1RI9 A;  3H0I A;  3NMZ C;  3VS7 A;  1T0J A;  1V1C A;  3TSW A;  1FMK A;  4AFQ C;  2KRS A;  1VYV A;  1NYF A;  2AZS A;  2CUD A;  1I0C A;  1AOJ A;  2HBW A;  1ZLM A;  1X2Q A;  2DBK A;  4J9I A;  2L2P A;  1BB9 A;  1AZG B;  5IHI A;  3REA B;  2X3W D;  4Y92 A;  2RF0 A;  1G2B A;  1UE9 A;  3I5S A;  2GTJ A;  2QDL A;  1H3H A;  2EQI A;  1OPL A;  1X27 A;  2YT6 A;  3VRZ A;  4GBQ A;  2YUO A;  2FRW A;  2ESW A;  4CC2 A;  2MIO A;  3VS3 A;  2JXB A;  1K0S A;  4ESR A;  1H8K A;  2KYM A;  3UF4 A;  1NEB A;  1VA7 A;  1UFF A;  2FO0 A;  1X69 A;  1M3A A;  3EHR A;  1SSH A;  3TVT A;  1X6G A;  2ABL A;  3VS4 A;  2K79 A;  2K7A A;  5I11 A;  3EG3 A;  4K11 A;  4Z8A A;  1GL5 A;  4AG2 C;  1JU5 C;  3EG0 A;  2GNC A;  1TUC A;  2CSQ A;  2RN8 A;  5IXF A;  1PRL C;  1KJW A;  2A28 A;  2BTT A;  2RNA A;  3PE0 A;  4RTW A;  2DA9 A;  1J3T A;  2EVR A;  4J9G A;  1U3O A;  2RMO A;  1SEM A;  5ECA A;  2RQU A;  2JM9 A;  1E7O A;  4JPB W;  1H92 A;  1MUZ A;  5IHK A;  2LX7 A;  4OMP A;  1ARK A;  1TG0 A;  1B3Q A;  2D1X A;  4RTV A;  1S1N A;  2DVJ A;  1JQQ A;  3PVL A;  4LE9 A;  3NPF A;  1PRM C;  1SHF A;  1M30 A;  2SEM A;  1UG1 A;  2YUP A;  2CH4 A;  4OMN A;  2CSI A;  3THK A;  1GCP A;  4JJC A;  4AG1 C;  1GRI A;  1JEG A;  2HDA A;  2ECZ A;  3M0P A;  2LZ6 B;  2XMF A;  2DNU A;  2VKN A;  3JV3 A;  3H41 A;  4J9F A;  3I5R A;  2KBT A;  2ED1 A;  2D0N A;  1UEC A;  1KSW A;  3EG2 A;  4HXJ A;  1AZE A;  4HVV A;  2BZY A;  1X43 A;  3VRY A;  2KT1 A;  1AWX A;  4Z88 A;  2BZ8 A;  3FJ5 A;  1KIK A;  4ORZ A;  2P4R A;  1B07 A;  2DRM A;  1UUE A;  3I35 A;  4CC7 A;  3IQL A;  5GJW B;  2DX1 A;  4F14 A;  1UGV A;  1NLP C;  1BK2 A;  2ENM A;  1LCK A;  2O2O A;  3C0C A;  3VS2 A;  2ROT A;  4E6R A;  1GFD A;  2A36 A;  2DIL A;  3QWX X;  2J6F A;  2D8J A;  2LNH B;  3I9Q A;  1GCQ A;  2DL7 A;  4GLM A;  1NG2 A;  2LJ3 A;  1UDL A;  2RQT A;  4J9C A;  2X3X D;  2G6F X;  1OEB A;  3VS6 A;  2ROL A;  2RQR A;  4J9D A;  2AKK A;  1M3C A;  1T3L A;  5IH2 A;  2YUN A;  2M0Y A;  4A63 B;  1K0X A;  2LCS A;  1PKS A;  2D8H A;  1M8M A;  1WI7 A;  4X1V A;  1K9A A;  1ZSG A;  1ABO A;  1G83 A;  1GCQ C;  2YDL A;  4AFS C;  4JZ4 A;  1Y0M A;  5HCK A;  3TSZ A;  2DF6 A;  2JMA A;  1UTI A;  1NM7 A;  2C0T A;  2HSP A;  1JXO A;  1BBZ A;  3UA7 A;  1PKT A;  2CRE A;  1RLP C;  2KEA A;  1AWW A;  4F16 A;  1FYN A;  1W1F A;  2W10 A;  2A37 A;  4RTY A;  5FW9 A;  2JM8 A;  3QWY A;  2BZX A;  2EYY A;  4RTU A;  4RTX A;  2ED0 A;  1VYT A;  2L0A A;  4J9B A;  1CSK A;  2CT4 A;  1AWO A;  3M0R A;  1WA7 A;  4QT7 A;  4RTT A;  3PVQ A;  2EW3 A;  5L23 A;  2DM1 A;  2KT8 A;  3REB B;  2RQW A;  2AK5 A;  1T0H A;  1K1Z A;  2GGR A;  1Y57 A;  2RPN A;  2C0O A;  1OV3 A;  1MV0 B;  1AD5 A;  1NEG A;  3GBQ A;  4ZNX A;  2FPD A;  1QCF A;  2HCK A;  5GJV B;  1A0N B;  2L3S A;  2J05 A;  5IXB A;  3EGU A;  2J7I A;  4LUE A;  1YP5 A;  1X2K A;  4OML A;  2LMJ A;  2JS0 A;  2EPD A;  4OMM A;  4J9E A;  2EYX A;  1GBR A;  2L3P A;  3NGP A;  4HVW A;  1ZUU A;  1Z9Q A;  4R0K A;  1OPK A;  2JS2 A;  2MOX A;  3M0T A;  4RUG A;  2L3Q A;  3SEM A;  2V1R A;  1VYU A;  2PTK A;  1XOV A;  1WYX A;  4RTZ A;  2A08 A;  2LP5 A;  5EC7 A;  2EKH A;  4HVU A;  1EFN A;  4LUD A;  3ULR B;  2DE0 X;  2K9G A;  2W0Z A;  1QWF A;  2YSQ A;  1WXU A;  4LN2 A;  3VS0 A;  1SRM A;  2EYZ A;  1GBQ A;  2CH4 W;  2DL3 A;  2OAW A;  1WFW A;  1ZUK A;  2J6O A;  2JT4 A;  1W6X A;  1M27 C;  1HD3 A;  4WCI A;  1WXT A;  2J06 A;  3RNJ A;  1Z9Z A;  1RLQ C;  1UHF A;  1QKX A;  3LH5 A;  2FG0 A;  2NUZ A;  4OMQ A;  3R6N A;  4IIO A;  4JZ3 A;  2V1Q A;  2DYB A;  3EHQ A;  1HJD A;  1KFZ A;  1WXB A;  1ZUY A;  1OOT A;  1N5Z A;  1WX6 A;  2SRC A;  1GFC A;  3H0H A;  2EGC A;  1QLY A;  2EYW A;  1E6H A;  2GBQ A;  1IO6 A;  1HSQ A;  2OJ2 A;  2HEQ A;  1BU1 A;  1K76 A;  2DLP A;  2VWF A;  2KGT A;  2NWM A;  4LNP A;  1NYG A;  2K6D A;  2E5K A;  4KRT A;  2EBP A;  5FWC A;  2GTO A;  2KYB A;  1JO8 A;  2LJ1 A;  2F2X A;  1UJ0 A;  4J9H A;  3CQT A;  2O88 A;  1JXM A;  2DMO A;  2F2W A;  5I22 A;  5FWB A;  4D8K A;  3A98 A;  1SHG A;  4Z89 A;  3M0Q A;  2RQV A;  1RUW A;  2KRN A;  1AEY A;  1SPK A;  1W70 A;  4CC3 A;  2DJQ A;  2O31 A;  2J6K A;  2JW4 A;  2DL5 A;  2LJ0 A;  2EGA A;  1WLP B;  1UJY A;  2I0N A;  1U06 A;  1ZX6 A;  2OI3 A;  1YWP A;  4IIM A;  1ZBJ A;  2K2M A;  2AZV A;  2EGE A;  3SHW A;  2LQW A;  3U23 A;  1NLO C;  3EG1 A;  1E6G A;  2H8H A;  1CKB A;  3VS1 A;  2KRO A;  4OMO A;  4CC4 B;  1YWO A;  1AWJ A;  2FRY A;  2M51 A;  4DEY A;  1QWE A;  1PWT A;  1T3S A;  3KFV A;  2DL8 A;  1UHC A;  2KR3 A;  2DBM A;  1I07 A;  3H0F A;  2JTE A;  4M4Z A;  2VVK A;  2CT3 A;  2PZ1 A;  1U5S A;  4EIK A;  2PNI A;  4AFZ C;  1K4U S;  4D8D A;  2MCN A;  1YNZ A;  1TUD A;  2KRM A;  1I1J A;  3NHN A;  1X6B A;  1WIE A;  2KXD A;  1M3B A;  5IHN A;  1AVZ C;  2FPE A;  2IIM A;  1YN8 A;  2JMC A; 
#chains in the Genus database with same CATH topology
 1QKW A;  4BAC A;  1PD0 A;  1VQN Q;  3CXC P;  3OYJ A;  1M1G A;  2F2V A;  4OGE A;  3X25 B;  3OYF A;  4ATO A;  3PIP A;  4FCY A;  1YBY A;  5KYX A;  1K8A R;  2KXC A;  3UA6 A;  4J5Y A;  1N8R C;  2B86 A;  4JJB A;  2FPF A;  1KHI A;  2XD0 A;  5GAN e;  1ZA2 B;  1PNJ A;  2CDT A;  2O01 E;  2RHZ A;  4L5G A;  2DER A;  4OGC A;  2GFA A;  2CYZ B;  3HP9 A;  3H0I A;  5GAO r;  1VQ5 A;  2MAM A;  3VS7 A;  1WHH A;  1V1C A;  4M7A D;  1OYX A;  2Y4Y A;  1D3B A;  1FX7 A;  3GF5 A;  5GAM d;  2HBW A;  4PJO A;  4XU3 A;  2COY A;  4J9I A;  1BI3 A;  2HKQ B;  3CME Q;  3HSB A;  4M7D C;  1VQO A;  2RH2 A;  3QHS A;  2OTL T;  1G2B A;  4L6V 5;  2GTJ A;  1OPL A;  1X27 A;  3V7S A;  1WHM A;  3JCM V;  2YUO A;  2ESW A;  8ATC B;  4EMK C;  4ESR A;  2KYM A;  2QQR A;  4A4H A;  2FO0 A;  1X69 A;  1Q82 C;  3TVT A;  4C8Q C;  3VS4 A;  1VQK Q;  1M1K R;  2AIR B;  4Z8A A;  3I55 Q;  5I21 A;  2VGN A;  3OYG A;  1TUC A;  1YFN A;  1YJN T;  3A8M B;  5GAM j;  2H3J A;  4RTW A;  2XG8 D;  1U3O A;  1C6V X;  3CC7 Q;  2F69 A;  3SWN A;  2RQU A;  3CMA A;  1BCO A;  3KXT A;  2ZPH B;  2QA4 T;  3HRT A;  1VQN T;  5IHK A;  2IG0 A;  3I56 Q;  3GNG A;  3OS5 A;  1XNI A;  4LDX A;  2D1X A;  2DVJ A;  3NPF A;  1PRM C;  4C0D B;  2PVO B;  5GAN d;  3LWI A;  1UG1 A;  1ZQ1 A;  3CCE A;  2RO0 A;  3EFS A;  4OMN A;  5CKE A;  3THK A;  4JJC A;  1G3S A;  1GRI A;  2K5I A;  3VU3 C;  3E9G A;  1SG5 A;  1K9M C;  3H9N A;  2DNU A;  4C92 B;  3H41 A;  5GAN 6;  2E4H A;  4HXJ A;  1VQ8 A;  1TS9 A;  2QXF A;  4FW1 A;  4HVV A;  1PC0 A;  3VRY A;  3MPU B;  4M78 D;  3SD4 A;  4LDU A;  2KT1 A;  3OSV A;  1M4Z A;  2RHU A;  2WAC A;  5KCH A;  2JJ9 A;  5HK0 A;  2XIC A;  3CCV A;  4IUU A;  3C12 A;  4CC7 A;  1S72 A;  3IQL A;  1UGV A;  1NLP C;  3G7Z A;  2VXF A;  2ENM A;  3VS2 A;  4M7A G;  1AHJ B;  2A36 A;  2DIL A;  4X9D A;  3QWX X;  4GLM A;  3QDR B;  1WGS A;  2ROL A;  2RQR A;  2AKK A;  5A0D A;  4M77 C;  2ZPF B;  1UB4 A;  3FB9 A;  5D6Y A;  3CD6 A;  4PJJ A;  4PJO C;  1WI7 A;  2FYK A;  3G4S Q;  1K9A A;  1ABO A;  2YHT A;  2HKN A;  2D9T A;  3DLL A;  3CC7 T;  2DTO A;  2VB6 A;  4JZ4 A;  3M4Y A;  3TSZ A;  3P8B B;  3HTR A;  4DBF A;  1UTI A;  4NL3 A;  1BIB A;  2HSP A;  1LJO A;  1BBZ A;  5GAO n;  2RI2 A;  3G6E A;  2ZCF B;  3OB9 A;  1AWW A;  5DM7 R;  4M75 F;  1DJ7 B;  1C0M A;  1HXD A;  2A37 A;  3CCR Q;  2XKO C;  3LLR A;  2B8A A;  2MMP A;  2E6Z A;  2NLU A;  1VQ7 Q;  4AT1 B;  4ELY C;  4M7D B;  2CT4 A;  4ZN3 A;  1UGQ B;  1WA7 A;  4QT7 A;  3DLM A;  1IHW A;  2DM1 A;  2KT8 A;  4OMF B;  3REB B;  1VQM A;  1QW1 A;  4PFZ A;  5CO7 A;  4BE1 A;  2RPN A;  1MV0 B;  1AD5 A;  5C6S A;  3GBQ A;  4M77 E;  3CCL Q;  4EMK B;  3HRU A;  3R6O A;  2HCK A;  3LGF A;  1M9S A;  1RAA B;  4C8Q B;  1N9S A;  3QUI A;  5GAO q;  1WNL A;  2EKO A;  5IXB A;  1KK7 A;  1Q82 R;  4XTV A;  2XDP A;  4LUE A;  1YP5 A;  4OML A;  2LMJ A;  4OMM A;  1HYO A;  1GBR A;  1JB0 E;  2L3P A;  3NGP A;  8AT1 B;  3HFN A;  2MWO A;  3URG A;  4N0A A;  2X51 A;  4R0K A;  2JS2 A;  4RUG A;  4NS5 A;  1MND A;  2DAQ A;  1U1T A;  3MJX A;  2PTK A;  2DZ9 A;  1QCO A;  3N5B B;  1XOV A;  4RTZ A;  3BFM A;  3OW2 S;  3NTK A;  4HVU A;  5LJ5 f;  3CCJ T;  2QTV A;  1EFN A;  4XU2 A;  3QDF A;  3MEU A;  2DE0 X;  2RI5 A;  2YSQ A;  1WXU A;  1VQ8 T;  3LWH A;  2H3E B;  1GBQ A;  2DL3 A;  1ZUK A;  1MMA A;  1M27 C;  1QQJ A;  1QKX A;  1K8A U;  4DBQ A;  3X24 B;  4PKC C;  4ANJ A;  2G3R A;  2L89 A;  4E7J A;  1HJD A;  1KFZ A;  1WHJ A;  1ZUY A;  2QGG A;  1N5Z A;  2EGC A;  2D6F A;  2F1L A;  1E6H A;  3JSC A;  5GAN 7;  1EX4 A;  3CCR T;  4C0G A;  4HA8 A;  3V8K A;  3OBW A;  2K2V A;  1TH7 A;  2XDD A;  4KRT A;  1RAF B;  5FWC A;  1JO8 A;  4C92 A;  2F2X A;  4J9H A;  3V8J A;  1JXM A;  5I22 A;  4B9X A;  3RR6 A;  2RJE A;  5CAI A;  1AEY A;  3CD6 T;  1SPK A;  1YIJ A;  3TEE A;  5CK9 A;  3CCL T;  3JCM e;  2O31 A;  3MHX A;  2RB6 A;  2YWW A;  1PSE A;  2K2M A;  2E64 A;  3G6E T;  3U23 A;  1UEB A;  2LVM A;  3OYK A;  3QXE B;  1TU0 B;  4M77 B;  2CZ6 B;  4ZGJ B;  2MI6 A;  2KRO A;  3JCM J;  2CZ7 B;  1W2B A;  4XTZ A;  1BIA A;  4PJO B;  4CC4 B;  2QK0 A;  4E7Z A;  4M7D D;  1AWJ A;  2FRY A;  2M51 A;  4DEY A;  5GAO p;  1T3S A;  2KQW A;  2DBM A;  2KR3 A;  3QYG B;  3H0F A;  1VQ4 Q;  2VVK A;  2CT3 A;  1Q7Y U;  2LX9 A;  1KHC A;  2AHJ B;  1KQS S;  2PNI A;  3FEO A;  5J39 A;  3OW2 A;  4BI8 B;  3GIB A;  2MCN A;  1YNZ A;  1TUD A;  1I1J A;  3NHN A;  2COZ A;  4J6X A;  5J26 A;  3OYD A;  3TQ7 P;  1V76 A;  1M3B A;  2X4W A;  4J83 A;  2FPE A;  1ZSZ A;  4C8Q D;  3M55 A;  5GAN 4;  2YUQ A;  2DL4 A;  2O9V A;  1MV3 A;  4XTU A;  3MP6 A;  1ABQ A;  2GQI A;  1VQL Q;  2C0I A;  1XTD A;  1TWB A;  4JLI A;  3M0U A;  4AFU C;  3OY9 A;  2AKL A;  2NUT B;  3S3O A;  2CP3 A;  2O9S A;  3M5A A;  2KY9 A;  3RBB B;  4C92 G;  2CZ1 B;  1IRE B;  2WSF E;  4M78 E;  2DKG A;  1NPR A;  3RDV A;  1YCS B;  1CKA A;  2OTL A;  1YIT Q;  2P0K A;  4KGV B;  3JB9 G;  4FT2 A;  5KYY B;  3A8O B;  4ELZ C;  3TSW A;  2VGM A;  1C1A A;  2JOY A;  2KRS A;  2RHX A;  1NYF A;  2AZS A;  2CUD A;  1I0C A;  5CVI A;  5LJ5 h;  2IVW A;  4EMK A;  5D7U A;  2DBK A;  3JCM d;  4IUV A;  1K73 C;  3REA B;  3JCM Q;  4M75 C;  4X9C A;  5GAN 8;  2QDL A;  4KH1 B;  2QYZ A;  4LDW A;  3EAE A;  4NL2 A;  5GAN g;  1YJN A;  3VYH B;  4GBQ A;  2FRW A;  4CC2 A;  1H8K A;  5GAN 2;  3UF4 A;  4FL6 A;  1UFF A;  3CC2 A;  3DB4 A;  2K79 A;  3MP1 A;  3J80 E;  2A7Y A;  2K7A A;  2FB7 A;  2DXT A;  2QA4 A;  1Q81 U;  2GCX A;  4X34 A;  2C06 A;  2CSQ A;  2QI2 A;  2VC8 A;  1VQN A;  5IXF A;  1KJW A;  3VV0 A;  2BTT A;  1J3T A;  2EVR A;  4KUL A;  1N8R U;  1GXI E;  5J3B A;  1XQH A;  4GY5 A;  1SEM A;  5ECA A;  1KQS A;  4E7L A;  2JM9 A;  1E7O A;  4JPB W;  4BE2 A;  5I2M A;  2XK0 A;  1YJW Q;  2NUP B;  1VQL T;  1B3Q A;  5FRM A;  3PVL A;  4M7D G;  3S6W A;  2XHC A;  1SHF A;  1M30 A;  4PJN A;  2JNG A;  1QP2 A;  5EG2 A;  4PJO D;  4J7I A;  1FXX A;  3CME A;  2CSI A;  1GCP A;  4FSX A;  1Q86 U;  1YIT T;  1M1F A;  2HDA A;  5CKF A;  3A8H B;  1TOV A;  4JRI A;  3OW2 P;  3E2U A;  2LZ6 B;  2PUO B;  2BUD A;  2EWN A;  2VKN A;  3JV3 A;  4FU6 A;  2HSE B;  4C8Q G;  2ED1 A;  1UEC A;  1NPP A;  3JCM X;  1KSW A;  1LPL A;  2JVV A;  3UT1 A;  3CCM T;  3FRN A;  3EG2 A;  4QQ6 A;  2BZY A;  1X43 A;  4N4H A;  5LJ5 j;  1Q95 G;  4Z88 A;  1VQK A;  2BZ8 A;  3OSS C;  1ZSZ C;  1R0B G;  3FJ5 A;  4ORZ A;  2CP7 A;  4C5H A;  3J81 E;  2EQM A;  2MYS A;  2QGF B;  2DRM A;  3CCQ T;  2M02 A;  4M77 A;  3ZBD A;  5CKB A;  3FJP A;  4F14 A;  4AMC A;  4DQ2 A;  2EQK A;  3GOX A;  1H64 1;  3C0C A;  1QVF S;  4E6R A;  2F5K A;  3GP8 A;  2K5L A;  4BD3 A;  4EMG A;  3CC7 A;  1NG2 A;  1UDL A;  2RQT A;  2X3X D;  3VJP A;  1B7T A;  4FYY B;  2BIV A;  5FRO A;  1T3L A;  5IH2 A;  2YUN A;  1OUL A;  1K0X A;  1UGR B;  2HL3 A;  2D8H A;  1SSF A;  2DXB A;  2KK4 A;  1ZSG A;  1YCY A;  1M8V A;  2V26 A;  3M4G A;  1U1S A;  1GCQ C;  2YDL A;  3QJ6 A;  5HCK A;  3GNF B;  4EDU A;  3G71 T;  1YJW T;  2C0T A;  3M54 A;  3UA7 A;  2NUT A;  1K9M U;  1I8F A;  3QKJ A;  3A8G B;  4N4I A;  1OX8 A;  4RTY A;  5FW9 A;  2JM8 A;  1X6O A;  5AYF A;  2BZX A;  2EYY A;  3CC2 T;  2YLB A;  4RTX A;  3L2V A;  3FIF A;  3M9Q A;  1VYT A;  1VIE A;  2OTJ Q;  5KYY A;  1VUB A;  4M75 B;  2JUF A;  4XTW A;  1K73 R;  2P84 A;  2EW3 A;  2AK5 A;  1KQS P;  1T0H A;  1K1Z A;  3FDR A;  3CEY A;  2GFU A;  2JTM A;  2VUB A;  4BDZ A;  2DXC A;  4ZNX A;  3EGD A;  1LNX A;  1AT1 B;  1G5V A;  1VQ6 Q;  1Y96 B;  2M1H A;  4M77 G;  3M58 A;  4C0Z A;  3JB9 H;  1EZZ B;  4BI3 A;  3HKS A;  4MZM A;  4PJO G;  4M78 F;  3MP8 A;  2RJF A;  2Z0W A;  4BY6 C;  2HMA A;  3CCJ A;  4BI4 A;  3L1A A;  2YRD A;  3Q1J A;  2MF2 A;  2LC4 A;  3CME T;  4XTX A;  3M0T A;  4QQG A;  3SEM A;  1VQ9 Q;  6AT1 B;  1U8R A;  2V1R A;  4LDV A;  3OBY A;  1QVF A;  5LJ3 g;  1VYU A;  2LQK A;  1WYX A;  5GMK i;  2ZPE B;  2EKH A;  1KD1 C;  3OMC A;  3M56 A;  2MK5 A;  4C0F A;  2F5T X;  1Y7X A;  2E1H A;  3CCR A;  2OAW A;  1WFW A;  2JT4 A;  1HD3 A;  1VQK T;  1PSF A;  2J06 A;  1VQ7 A;  3HFO A;  2NUP A;  3I55 T;  1UHF A;  3LH5 A;  2FG0 A;  3R6N A;  2QTX A;  5HY6 A;  3L42 A;  3QII A;  1GFC A;  4ZGE B;  4HCB A;  2EYW A;  4ZTF A;  4EPC A;  4C5E A;  1OZ3 A;  1K76 A;  3CCL A;  2VWF A;  3QO3 A;  1NYG A;  2K6D A;  5GAO m;  2EBP A;  3EG9 A;  1RAE B;  2KYB A;  1I4K 1;  1I81 A;  5IN1 A;  4IUR A;  3I56 T;  1ZSZ B;  2O88 A;  2HBP A;  5FWB A;  4BB7 A;  3M0Q A;  4QVZ A;  1MMN A;  2LCC A;  4HCC A;  1W70 A;  2DD5 A;  3PFS A;  4CC3 A;  2DJQ A;  2DFU A;  2CGH A;  2J6K A;  4R55 A;  2DL5 A;  2LJ0 A;  3JB9 I;  1UJY A;  3TRE A;  1VQ6 T;  2O4X B;  2I0N A;  1BI2 A;  3CCU Q;  2DIQ A;  2OI3 A;  5CQY A;  1ZBJ A;  5KYU B;  1S72 Q;  3SHW A;  2DVE A;  4QW2 A;  4FYW B;  4RG2 A;  5DLO A;  3CPW S;  2FHD A;  2EYQ A;  1P92 A;  5KE3 A;  1QMC A;  1R8O B;  2ZPB B;  4OMO A;  1VQ9 T;  1G3W A;  1KQ2 A;  4J6W A;  1YWO A;  4M75 D;  1RAC B;  2WSE E;  3KFV A;  1MNE A;  2DL8 A;  3RMQ A;  3JCM g;  2JTE A;  3OS0 A;  2PZ1 A;  1U5S A;  3OA6 A;  2R57 A;  4EIK A;  3ER0 A;  1K4U S;  3MEV A;  2YLC A;  1X6B A;  4DBR A;  4OB3 B;  4IUQ A;  1M2V B;  5A0G A;  5KYW B;  2K3X A;  2FZC B;  5IHN A;  2IIM A;  1NJI C;  1TXQ A;  3E1S A;  3HPW A;  4FW2 A;  1PHT A;  1KC8 U;  3PIO A;  4C92 D;  5CIU A;  2KE9 A;  3O5Z A;  4HCK A;  4RCB A;  1ZBX A;  4DEX A;  1QVF P;  3G4S T;  3JB9 D;  2X4Y A;  4XU0 A;  2FEI A;  5LJ3 h;  2KNB B;  2ZPI B;  4M75 A;  3ZL7 C;  1G8X A;  3UAT A;  3OYI A;  2EIF A;  2VAS A;  3VS5 A;  3VKI A;  9ATC B;  2RJD A;  1M90 C;  3ME9 A;  4HT9 A;  4M7A E;  1VYV A;  2LTO A;  1AOJ A;  2RI3 A;  2XI9 A;  2VXE A;  3L2Q A;  3BDU A;  4BY6 B;  1ZLM A;  3CBM A;  1YI2 Q;  3RER A;  1BB9 A;  1AZG B;  5IHI A;  2L3R A;  3D7S B;  1Y96 A;  4F7U E;  4XQ3 A;  4Y92 A;  2RF0 A;  3SFM A;  1VQ7 T;  1UE9 A;  1VIF A;  3I5S A;  4BDY A;  2EQI A;  3CCU T;  4J7F A;  2DEQ A;  3QSU A;  1MMG A;  1FWZ A;  1UGP B;  1YHQ Q;  3VRZ A;  1VQ4 A;  3NTI A;  4FT4 A;  4RMO A;  1VA7 A;  1IGQ A;  3EHR A;  1M3A A;  1SSH A;  1X6G A;  3AT1 B;  3C4S A;  1KD1 R;  3EG3 A;  4K11 A;  3CPW A;  1GL5 A;  1FMW A;  4AG2 C;  1JU5 C;  3EG0 A;  2GNC A;  2DYI A;  1OU9 A;  3CC4 Q;  4JS5 A;  1W4S A;  4GLK A;  1VQL A;  3PE0 A;  2DA9 A;  4M78 C;  2LNV A;  1M1K U;  3OYB A;  4J9G A;  1RAG B;  3L2W A;  4B9W A;  4FYV B;  1LVK A;  3OYA A;  2PQW A;  2RMO A;  3OYL A;  5KYN A;  1PG5 B;  1YIT A;  1H92 A;  1F1B B;  1MUZ A;  4II1 A;  4FIB A;  1IRX A;  2LX7 A;  3EGX B;  5GAM g;  3CCS Q;  1TG0 A;  1WQW A;  4RTV A;  1S1N A;  1JQQ A;  1UGS B;  3X28 B;  4M75 G;  4OB0 B;  3E9F A;  2EQU A;  3JAM E;  1N27 A;  1BKB A;  2YRV A;  4B6M A;  3CCM A;  2CP0 A;  2YUP A;  2CH4 A;  2CP2 A;  1K73 U;  5GMK h;  4JJN K;  1JEG A;  2ECZ A;  2QEX Q;  5LJ5 e;  1WJS A;  3FC3 A;  3QG1 A;  2XMF A;  4RG8 A;  3CCQ A;  3I5R A;  2KBT A;  1QVG S;  2A3L A;  2EJ9 A;  3BY7 A;  2RK1 A;  2CP5 A;  5D6X A;  4Z02 A;  1AZE A;  1MMD A;  1YI2 T;  4V2S A;  4WTO B;  2O4X A;  4DA4 A;  2HNI A;  1OU8 A;  2HL5 C;  3QZ5 B;  4OB1 B;  5CQX A;  2K3Y A;  2QA4 Q;  4LD9 K;  3A1P A;  3QPH A;  5KYU A;  1KIK A;  1JRI A;  5FU6 C;  1B07 A;  3QZ9 B;  3MEA A;  1VQP Q;  3G1J A;  3V8L A;  3OS1 A;  4JDS A;  3SB2 A;  1JJ2 S;  3PMT A;  5GJW B;  2DX1 A;  4J8O A;  3GPL A;  1BK2 A;  1WJQ A;  2O2O A;  2ROT A;  1GFD A;  4P5N A;  2D8J A;  2LNH B;  5GAN f;  1GCQ A;  2RK2 A;  2LJ3 A;  1IHV A;  1D09 B;  2FZK B;  3EGD B;  2G6F X;  4JRP A;  3A8L B;  3CC4 T;  1MHN A;  3G71 A;  1YJW A;  2X35 A;  2PU9 B;  2LCS A;  1VOM A;  1NJI R;  5KE2 A;  3QYH B;  4E7H A;  1M8M A;  2P4T A;  2VYT A;  3PT9 A;  1M2V A;  2V8I A;  5KYW A;  5CKH A;  1G3Y A;  5GMK m;  3VUB A;  2ZZD A;  3F70 A;  1RAD B;  3PMI A;  2JMA A;  4MDW A;  2K57 A;  1NM7 A;  3P8D A;  1PM3 A;  2EFI A;  1BI0 A;  2PVD B;  3LYI A;  3NTH A;  4E47 A;  3CCS T;  1M5Q 1;  1D0Z A;  5I2S A;  1BI1 A;  1PKT A;  5FLX E;  2KEA A;  1RLP C;  2CS7 A;  1VQ4 T;  2NYS A;  4F16 A;  4QKU A;  1FYN A;  3CPW P;  2W10 A;  1WHK A;  1M90 R;  2E5Q A;  2EJF A;  1D1B A;  2ZPG B;  2L0A A;  5LJ5 d;  2DD4 A;  2QEX T;  2BE7 D;  1CSK A;  2PVG B;  3M0R A;  3RKX A;  1BYM A;  4RTT A;  3PVQ A;  3A5Z B;  5L23 A;  2RQW A;  3ASK A;  4PFO A;  2OAU A;  4A54 A;  3X26 B;  4A53 A;  4UC4 A;  1Y57 A;  4M77 D;  4PNO A;  1NEG A;  3C94 A;  5GAN 5;  5D6W A;  2FPD A;  4PFP A;  1QCF A;  2X4J A;  1A0N B;  5GAM h;  2L3S A;  3J7A F;  3KUF A;  1TTH B;  3V7R A;  2BKD N;  2J05 A;  3EG9 B;  5GMK l;  1VQP T;  3MET A;  2J7I A;  2EPD A;  3JCM P;  2VV5 A;  3H8Z A;  2LDM A;  1O75 A;  1Z9Q A;  1JJ2 A;  4M7A F;  3BE3 A;  3LX7 A;  3SDZ A;  4M78 B;  2MOX A;  3L2U A;  1Q82 U;  2RM4 A;  3KBG A;  3I55 A;  4HCZ A;  4F7U F;  2A08 A;  1D0X A;  3MCA B;  2K5F A;  4Q5W A;  4C92 E;  2DK3 A;  3ULR B;  2K9G A;  2W0Z A;  2Y90 A;  1N6A A;  4A4K A;  1YJ9 Q;  1OQK A;  3CBP A;  2EYZ A;  2Y4X A;  2J6O A;  1WXT A;  2QG9 B;  3RNJ A;  1Z9Z A;  5IT9 E;  2HQH A;  2OTJ A;  3EGX A;  1RLQ C;  2LCL A;  1EIF A;  1ZHI A;  2GF7 A;  2NUZ A;  4OMQ A;  5GAN 3;  4JZ3 A;  2V1Q A;  3EHQ A;  1WXB A;  3I56 A;  1OOT A;  2FVU A;  1WX6 A;  2EQJ A;  2QQS A;  1NBE B;  3H0H A;  2GBQ A;  1I5L A;  1IO6 A;  4FM4 B;  2XID A;  1BU1 A;  1Q86 C;  1XJW B;  1PCX A;  3CBO A;  2NWM A;  2LT1 A;  1VQ6 A;  2GTO A;  5GAN h;  3LH0 A;  3PTA A;  2LJ1 A;  5CKD A;  3CQT A;  2DMO A;  2F2W A;  2DTI A;  2E12 A;  3A98 A;  5IAY A;  3OYN A;  5FU6 B;  2RQV A;  4HT8 A;  2KRN A;  1B34 B;  3S3M A;  1D0Y A;  4ME7 A;  2XDB A;  3WXM B;  1ZA1 B;  4PLI A;  1WLP B;  3WVD B;  4E2F B;  2OX7 A;  1VQ9 A;  2RA2 A;  3HRS A;  4M7A A;  1VQ5 Q;  2X9H A;  2AZV A;  2QAZ A;  2EGE A;  2LQW A;  1O9S A;  3RES A;  4F7U A;  1KD1 U;  3TCJ A;  3VYG A;  2BE9 B;  2DXU A;  2MPX C;  1TUG B;  3VS1 A;  1VQO Q;  1Q7Y R;  4KGX B;  2MWP A;  3L2R A;  2E3H A;  3JCM c;  3RUX A;  5FU7 C;  4M7D E;  3T9N A;  1QWE A;  1PWT A;  2E70 A;  1UHC A;  4ZGD B;  1I07 A;  1QVG P;  3UWN A;  1FMV A;  1YJ9 T;  3E19 A;  4AFZ C;  1WZO A;  5LJ3 f;  2KRM A;  3G4S A;  3P8H A;  1AVZ C;  1YN8 A;  1UJ0 A;  2L5Q A;  4C8Q E;  4BUG A;  2LQN A;  2CP6 A;  1RAB B;  1QP3 A;  2R58 A;  4MML A;  1JJ2 P;  4XAX B;  2FL7 A;  2M0O A;  4N4G A;  2CUB A;  4F17 A;  1OZ2 A;  4JJD A;  3M0S A;  2K3B A;  4E7S A;  1WDX A;  5LL6 S;  3CMA Q;  2LQ8 A;  2DRK A;  3INZ A;  2E6N A;  1SRL A;  4FSS A;  3MO8 A;  3WVE B;  1RI9 A;  3CCU A;  3NMZ C;  2ZGW A;  1R77 A;  1T0J A;  1KQ1 A;  1FMK A;  4AFQ C;  5GAN j;  4KUI A;  5DY9 A;  1TSF A;  1X2Q A;  3CCE Q;  4PJL A;  2L2P A;  1WHG A;  2X3W D;  4C5G A;  2OTJ T;  4MMK A;  4WF2 A;  1H3H A;  3LGL A;  4KH0 B;  4XK8 E;  4F7U G;  1VQ5 T;  1H3Z A;  2WSC E;  2YT6 A;  3CCJ Q;  5KCO A;  3L2Z A;  1Q81 R;  4A4F A;  1JBM A;  2MIO A;  4VUB A;  2JXB A;  3VS3 A;  1VQ8 Q;  1K0S A;  3MKD A;  4M78 A;  4TVR A;  1NEB A;  2D0Q B;  1VQO T;  3C95 A;  2ABL A;  2QQB A;  2FZG B;  3AHU A;  2DEU A;  5I11 A;  1N8R R;  1IXD A;  4JUV A;  1NJI U;  3RMS A;  1WHL A;  3CCV Q;  2RN8 A;  3UPU A;  1PRL C;  4EMH A;  4JRQ A;  2A28 A;  1IGU A;  2RNA A;  5DLQ E;  4OP0 A;  4R56 A;  4Y91 A;  4XTY A;  3GLX A;  2P0Q A;  3BDL A;  3JCM f;  4LD6 A;  4M7A C;  1OI1 A;  2E10 A;  2X4X A;  1Q86 R;  4OMP A;  5A0L A;  1ARK A;  2YXY A;  2LT4 A;  1M90 U;  4LE9 A;  5LJ3 e;  5GAO l;  5FRN A;  3CPF A;  1WJR A;  3CD6 Q;  5L8R E;  4LDY A;  2IPO B;  2SEM A;  5M9O A;  1X01 A;  4C92 F;  1YI2 A;  3CMA T;  3SWN C;  4PJO E;  3VUZ A;  4ZN1 A;  3RKW A;  4AG1 C;  3PNW C;  3EFO B;  3M0P A;  3JB9 F;  4JRK A;  2DIG A;  1V29 B;  3OQ5 A;  1IB8 A;  1RAH B;  1B34 A;  3X20 B;  3G6E Q;  4DOV A;  1YHQ A;  1W2B S;  4J9F A;  2M16 A;  3OYY A;  5KH6 A;  2D0N A;  2PUK B;  4KT0 E;  2GQV A;  4PJM A;  3S3N A;  3CCE T;  1HK9 A;  2ATC B;  1AWX A;  3EH2 A;  2HZY A;  4A4E A;  3O8V A;  3OS2 A;  2P4R A;  4M78 G;  2KMT A;  4HKE A;  3V7C A;  3CXC S;  1LOJ A;  4KBM B;  1VQM Q;  4KGZ B;  5FU7 B;  1UUE A;  3CC4 A;  1QCN A;  3I35 A;  1ACM B;  1N9R A;  4O5V A;  1LCK A;  4IUT A;  2DO3 A;  2RHI A;  4RKU E;  3RIR A;  3EH1 A;  5LJ5 g;  2J6F A;  4C5I A;  2DPP B;  3I9Q A;  2DL7 A;  2XU8 A;  2DET A;  3OMG A;  4J9C A;  3NFC A;  4QQD A;  4QVD A;  1OEB A;  2ZAE A;  3M59 A;  3VS6 A;  3CCV T;  4J9D A;  4CI0 C;  1S72 T;  1M3C A;  3JB9 J;  3CCS A;  2M0Y A;  1SKU B;  4A63 B;  2AT1 B;  2YRC A;  1PD1 A;  3TU4 K;  4Y28 E;  1PKS A;  2RHY A;  2DJZ A;  1WQ7 A;  4X1V A;  4MZP A;  1K9M R;  3H6Z A;  2HQE A;  3ZFJ A;  1G83 A;  4F04 B;  4AFS C;  3PGG A;  2R5A A;  1Y0M A;  1KC8 C;  1NE8 A;  2DF6 A;  2V8K A;  1KG1 A;  2JZ2 A;  4PLL A;  4RCC A;  2QEX A;  1JXO A;  5LJ3 d;  1NZ9 A;  2CRE A;  4M7D F;  2M9U A;  2KDS A;  5GMK e;  1W1F A;  5KYX B;  3QWY A;  4RTU A;  4CRI A;  4D6W A;  2ED0 A;  5GAM f;  1RI0 A;  4PK4 A;  1K8A C;  2I2L A;  2L8D A;  4J9B A;  1AWO A;  1VQP A;  1R0C B;  3OYC A;  2HQX A;  4C8Q F;  2DZC A;  2GGR A;  1D3B B;  4MDX A;  2C0O A;  4PL6 A;  1OV3 A;  2KI7 A;  4DBH A;  3ZEH A;  3OYE A;  5GJV B;  1Y07 A;  2A0F B;  4BE0 A;  4XU1 A;  4A4G A;  5LJ3 j;  2COW A;  3JCM h;  4IUP A;  2RD1 A;  3EGU A;  1VQM T;  1X2K A;  2QQ9 A;  2JS0 A;  5CCA A;  4J9E A;  5CR2 A;  2KVQ G;  1YIJ Q;  2EYX A;  4HVW A;  3CXC A;  4YTL A;  1ZUU A;  4DOW A;  1OPK A;  4JS4 A;  2L3Q A;  2E41 A;  1D1C A;  1X75 C;  3QBY A;  1OX9 A;  3M57 A;  4JLG A;  2P0P A;  4E7I A;  2LP5 A;  5EC7 A;  1YHQ T;  4M7A B;  4LUD A;  1M1K C;  2R5M A;  4OVA A;  1QWF A;  2KSS A;  2E3I A;  4LN2 A;  7AT1 B;  3JRZ A;  3HHT B;  3VS0 A;  3QJY A;  1SRM A;  4N0A C;  1QVP A;  2CH4 W;  4F7U B;  3DKM A;  4M7D A;  3BW1 A;  3JCM W;  1W6X A;  4WCI A;  1I5O B;  2HAX A;  4QVC A;  4O6J A;  3SWN B;  4IIO A;  3LW5 E;  2DYB A;  1Q7Y C;  3EFR A;  2QAS A;  1M2O A;  2SRC A;  1QLY A;  3RKY A;  3CCM Q;  2QQA A;  1HSQ A;  2OJ2 A;  2JTF A;  5C0M A;  2HEQ A;  4C8Q A;  2DLP A;  2KGT A;  1G3T A;  4LNP A;  3EFO A;  3OYM A;  2E5K A;  3CCQ Q;  1BCM A;  5HKC A;  4C0D C;  1RAI B;  4D8K A;  1SHG A;  4Z89 A;  1RUW A;  3M53 A;  4L59 A;  2K4Y A;  5GAM e;  2QDY B;  4KUD K;  1MGQ A;  2JW4 A;  2EGA A;  2OTL Q;  1U06 A;  2V8J A;  2EAY A;  1ZX6 A;  2EJG A;  4E7K A;  4M77 F;  5HK3 A;  1YWP A;  4C92 C;  4IIM A;  4OB2 B;  4PJO F;  5GMK j;  1RL2 A;  3JCM b;  1SF9 A;  1NLO C;  1YIJ T;  3EG1 A;  1E6G A;  2H8H A;  2CZ0 B;  1CKB A;  1Y71 A;  1YJ9 A;  5AT1 B;  3DB3 A;  1QVG A;  2RJC A;  1WPY A;  4J6Y A;  4IKF A;  4OF1 A;  4FYX B;  4M75 E;  3G71 Q;  4MZT A;  2E65 A;  2DTH A;  3MEW A;  5A2Q E;  3FLG A;  2CKK A;  1YJN Q;  1W2B P;  1D1A A;  4M4Z A;  4LXC A;  2HD0 A;  1KC8 R;  3OYH A;  2LRQ A;  4D8D A;  3CC2 Q;  2KAF A;  1WIE A;  2KXD A;  4ZTJ A;  1IZ6 A;  4NOY A;  2JN0 A;  1Q81 C;  3HL8 A;  2JMC A;  3UDC A; 
#chains in the Genus database with same CATH homology
 1QKW A;  1PHT A;  2YUQ A;  2DL4 A;  2O9V A;  1MV3 A;  2LQN A;  1ABQ A;  2GQI A;  2F2V A;  2C0I A;  2KE9 A;  3O5Z A;  2KXC A;  4HCK A;  3UA6 A;  3M0U A;  2CUB A;  4AFU C;  2B86 A;  4DEX A;  4F17 A;  2AKL A;  4JJB A;  2FPF A;  2O9S A;  4JJD A;  3M0S A;  3RBB B;  2K3B A;  1PNJ A;  1WDX A;  2FEI A;  2CDT A;  2KNB B;  1YCS B;  3ZL7 C;  2DRK A;  1CKA A;  3UAT A;  1SRL A;  4FSS A;  3VS5 A;  1RI9 A;  3H0I A;  3NMZ C;  3VS7 A;  1T0J A;  1V1C A;  3TSW A;  1FMK A;  4AFQ C;  2KRS A;  1VYV A;  1NYF A;  2AZS A;  2CUD A;  1I0C A;  1AOJ A;  2HBW A;  1ZLM A;  1X2Q A;  2DBK A;  4J9I A;  2L2P A;  1BB9 A;  1AZG B;  5IHI A;  3REA B;  2X3W D;  4Y92 A;  2RF0 A;  1G2B A;  1UE9 A;  3I5S A;  2GTJ A;  2QDL A;  1H3H A;  2EQI A;  1OPL A;  1X27 A;  2YT6 A;  3VRZ A;  4GBQ A;  2YUO A;  2FRW A;  2ESW A;  4CC2 A;  2MIO A;  3VS3 A;  2JXB A;  1K0S A;  4ESR A;  1H8K A;  2KYM A;  3UF4 A;  1NEB A;  1VA7 A;  1UFF A;  2FO0 A;  1X69 A;  1M3A A;  3EHR A;  1SSH A;  3TVT A;  1X6G A;  2ABL A;  3VS4 A;  2K79 A;  2K7A A;  5I11 A;  3EG3 A;  4K11 A;  4Z8A A;  1GL5 A;  4AG2 C;  1JU5 C;  3EG0 A;  2GNC A;  1TUC A;  2CSQ A;  2RN8 A;  5IXF A;  1PRL C;  1KJW A;  2A28 A;  2BTT A;  2RNA A;  3PE0 A;  4RTW A;  2DA9 A;  1J3T A;  2EVR A;  4J9G A;  1U3O A;  2RMO A;  1SEM A;  5ECA A;  2RQU A;  2JM9 A;  1E7O A;  4JPB W;  1H92 A;  1MUZ A;  5IHK A;  2LX7 A;  4OMP A;  1ARK A;  1TG0 A;  1B3Q A;  2D1X A;  4RTV A;  1S1N A;  2DVJ A;  1JQQ A;  3PVL A;  4LE9 A;  3NPF A;  1PRM C;  1SHF A;  1M30 A;  2SEM A;  1UG1 A;  2YUP A;  2CH4 A;  4OMN A;  2CSI A;  3THK A;  1GCP A;  4JJC A;  4AG1 C;  1GRI A;  1JEG A;  2HDA A;  2ECZ A;  3M0P A;  2LZ6 B;  2XMF A;  2DNU A;  2VKN A;  3JV3 A;  3H41 A;  4J9F A;  3I5R A;  2KBT A;  2ED1 A;  2D0N A;  1UEC A;  1KSW A;  3EG2 A;  4HXJ A;  1AZE A;  4HVV A;  2BZY A;  1X43 A;  3VRY A;  2KT1 A;  1AWX A;  4Z88 A;  2BZ8 A;  3FJ5 A;  1KIK A;  4ORZ A;  2P4R A;  1B07 A;  2DRM A;  1UUE A;  3I35 A;  4CC7 A;  3IQL A;  5GJW B;  2DX1 A;  4F14 A;  1UGV A;  1NLP C;  1BK2 A;  2ENM A;  1LCK A;  2O2O A;  3C0C A;  3VS2 A;  2ROT A;  4E6R A;  1GFD A;  2A36 A;  2DIL A;  3QWX X;  2J6F A;  2D8J A;  2LNH B;  3I9Q A;  1GCQ A;  2DL7 A;  4GLM A;  1NG2 A;  2LJ3 A;  1UDL A;  2RQT A;  4J9C A;  2X3X D;  2G6F X;  1OEB A;  3VS6 A;  2ROL A;  2RQR A;  4J9D A;  2AKK A;  1M3C A;  1T3L A;  5IH2 A;  2YUN A;  2M0Y A;  4A63 B;  1K0X A;  2LCS A;  1PKS A;  2D8H A;  1M8M A;  1WI7 A;  4X1V A;  1K9A A;  1ZSG A;  1ABO A;  1G83 A;  1GCQ C;  2YDL A;  4AFS C;  4JZ4 A;  1Y0M A;  5HCK A;  3TSZ A;  2DF6 A;  2JMA A;  1UTI A;  1NM7 A;  2C0T A;  2HSP A;  1JXO A;  1BBZ A;  3UA7 A;  1PKT A;  2CRE A;  1RLP C;  2KEA A;  1AWW A;  4F16 A;  1FYN A;  1W1F A;  2W10 A;  2A37 A;  4RTY A;  5FW9 A;  2JM8 A;  3QWY A;  2BZX A;  2EYY A;  4RTU A;  4RTX A;  2ED0 A;  1VYT A;  2L0A A;  4J9B A;  1CSK A;  2CT4 A;  1AWO A;  3M0R A;  1WA7 A;  4QT7 A;  4RTT A;  3PVQ A;  2EW3 A;  5L23 A;  2DM1 A;  2KT8 A;  3REB B;  2RQW A;  2AK5 A;  1T0H A;  1K1Z A;  2GGR A;  1Y57 A;  2RPN A;  2C0O A;  1OV3 A;  1MV0 B;  1AD5 A;  1NEG A;  3GBQ A;  4ZNX A;  2FPD A;  1QCF A;  2HCK A;  5GJV B;  1A0N B;  2L3S A;  2J05 A;  5IXB A;  3EGU A;  2J7I A;  4LUE A;  1YP5 A;  1X2K A;  4OML A;  2LMJ A;  2JS0 A;  2EPD A;  4OMM A;  4J9E A;  2EYX A;  1GBR A;  2L3P A;  3NGP A;  4HVW A;  1ZUU A;  1Z9Q A;  4R0K A;  1OPK A;  2JS2 A;  2MOX A;  3M0T A;  4RUG A;  2L3Q A;  3SEM A;  2V1R A;  1VYU A;  2PTK A;  1XOV A;  1WYX A;  4RTZ A;  2A08 A;  2LP5 A;  5EC7 A;  2EKH A;  4HVU A;  1EFN A;  4LUD A;  3ULR B;  2DE0 X;  2K9G A;  2W0Z A;  1QWF A;  2YSQ A;  1WXU A;  4LN2 A;  3VS0 A;  1SRM A;  2EYZ A;  1GBQ A;  2CH4 W;  2DL3 A;  2OAW A;  1WFW A;  1ZUK A;  2J6O A;  2JT4 A;  1W6X A;  1M27 C;  1HD3 A;  4WCI A;  1WXT A;  2J06 A;  3RNJ A;  1Z9Z A;  1RLQ C;  1UHF A;  1QKX A;  3LH5 A;  2FG0 A;  2NUZ A;  4OMQ A;  3R6N A;  4IIO A;  4JZ3 A;  2V1Q A;  2DYB A;  3EHQ A;  1HJD A;  1KFZ A;  1WXB A;  1ZUY A;  1OOT A;  1N5Z A;  1WX6 A;  2SRC A;  1GFC A;  3H0H A;  2EGC A;  1QLY A;  2EYW A;  1E6H A;  2GBQ A;  1IO6 A;  1HSQ A;  2OJ2 A;  2HEQ A;  1BU1 A;  1K76 A;  2DLP A;  2VWF A;  2KGT A;  2NWM A;  4LNP A;  1NYG A;  2K6D A;  2E5K A;  4KRT A;  2EBP A;  5FWC A;  2GTO A;  2KYB A;  1JO8 A;  2LJ1 A;  2F2X A;  1UJ0 A;  4J9H A;  3CQT A;  2O88 A;  1JXM A;  2DMO A;  2F2W A;  5I22 A;  5FWB A;  4D8K A;  3A98 A;  1SHG A;  4Z89 A;  3M0Q A;  2RQV A;  1RUW A;  2KRN A;  1AEY A;  1SPK A;  1W70 A;  4CC3 A;  2DJQ A;  2O31 A;  2J6K A;  2JW4 A;  2DL5 A;  2LJ0 A;  2EGA A;  1WLP B;  1UJY A;  2I0N A;  1U06 A;  1ZX6 A;  2OI3 A;  1YWP A;  4IIM A;  1ZBJ A;  2K2M A;  2AZV A;  2EGE A;  3SHW A;  2LQW A;  3U23 A;  1NLO C;  3EG1 A;  1E6G A;  2H8H A;  1CKB A;  3VS1 A;  2KRO A;  4OMO A;  4CC4 B;  1YWO A;  1AWJ A;  2FRY A;  2M51 A;  4DEY A;  1QWE A;  1PWT A;  1T3S A;  3KFV A;  2DL8 A;  1UHC A;  2KR3 A;  2DBM A;  1I07 A;  3H0F A;  2JTE A;  4M4Z A;  2VVK A;  2CT3 A;  2PZ1 A;  1U5S A;  4EIK A;  2PNI A;  4AFZ C;  1K4U S;  4D8D A;  2MCN A;  1YNZ A;  1TUD A;  2KRM A;  1I1J A;  3NHN A;  1X6B A;  1WIE A;  2KXD A;  1M3B A;  5IHN A;  1AVZ C;  2FPE A;  2IIM A;  1YN8 A;  2JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...