2AZVA

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (calculated without noes)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH2-SH3 adapter protein drk
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azvA00
1CKBA 4OMQA 1YCSB 1NM7A 2KXDA 1BK2A 3SHWA 1TUDA 1NLOC 2K79A 1T3LA 3REBB 1GFDA 1K0XA 2GQIA 1U06A 3NPFA 3PVLA 4RTZA 4CC4B 1OPLA 2RF0A 5IH2A 2IIMA 4RTWA 2JXBA 2FRYA 2DRKA 3EG2A 2GBQA 1YP5A 1J3TA 2CSIA 2ED1A 4DEYA 2ENMA 5FWCA 5IHNA 4F16A 4J9GA 5IXFA 3M0QA 2RMOA 4Z8AA 3I9QA 2FEIA 4Y92A 1JXOA 1IO6A 1TG0A 2HCKA 2JT4A 1ARKA 2CDTA 2DE0X 4JZ4A 1AVZC 1T0JA 1NLPC 2KRNA 1Y0MA 2LP5A 2NUZA 3GBQA 3U23A 1H92A 4OMLA 1A0NB 2J6FA 2J05A 4AFZC 2K6DA 2OAWA 1OEBA 2DL7A 2EBPA 1WA7A 1M3CA 2L0AA 3VS6A 2AKLA 2C0IA 2NWMA 2DL5A 2MIOA 1SEMA 3ULRB 1CKAA 2EPDA 1WYXA 3VRYA 4RTYA 2F2XA 2EGCA 1VYUA 2DL4A 2CSQA 4R0KA 2VVKA 2DVJA 2YUOA 4AG2C 1JEGA 1U5SA 2I0NA 3UA6A 2P4RA 1M3BA 4AFSC 2J7IA 1LCKA 1B3QA 1RLPC 4RTTA 1X69A 4A63B 1WDXA 2BTTA 2FPDA 2DILA 2RQVA 3QWXX 3JV3A 1X43A 4J9EA 4Z88A 1TUCA 2O9SA 4J9HA 2GTOA 4HVWA 2DBMA 1M27C 1AWWA 2MOXA 2LJ3A 4J9DA 2PNIA 2FPEA 1FYNA 4JPBW 1BU1A 2L3PA 3H41A 1U3OA 3M0SA 1UG1A 1UFFA 3TVTA 2YSQA 4IIMA 2JM9A 2CH4A 2J6OA 2LQNA 1GL5A 1BB9A 2RQTA 1ZSGA 1ZUKA 3VS2A 2JS0A 3M0UA 1SHFA 1AWOA 4D8DA 1KFZA 3M0RA 2D8HA 3VS3A 2KT8A 2C0TA 1GBQA 2H8HA 2KRSA 1WXUA 1X6GA 3I5RA 1GCQC 1PRMC 1K0SA 3FJ5A 2A28A 3VS0A 4GBQA 1NYFA 2DYBA 4KRTA 4HCKA 4E6RA 1GCQA 1YN8A 3EG3A 1NEGA 1RI9A 1WXTA 3IQLA 5ECAA 2LZ6B 3RNJA 1QWFA 1Y57A 4Z89A 4LUEA 3VS1A 2CUDA 4ESRA 2KRMA 3VRZA 2EW3A 2KBTA 2PTKA 1HSQA 1MV3A 1H3HA 4LNPA 1PNJA 1SSHA 2KGTA 3VS7A 1UHCA 3PVQA 5GJWB 1UE9A 4DEXA 1JO8A 3EG0A 1KJWA 1FMKA 4JJBA 1X6BA 2SEMA 2K7AA 1GRIA 4AFQC 1AZGB 2DRMA 2CREA 1UUEA 1SRLA 1W6XA 1Z9ZA 4HXJA 4RTXA 1QLYA 2BZ8A 3C0CA 1QWEA 1E7OA 3THKA 2L2PA 2OI3A 2KEAA 1SHGA 2EYWA 1T0HA 2G6FX 1ZUYA 2BZXA 2W0ZA 2FRWA 2RQUA 2J6KA 4M4ZA 4JJCA 1NEBA 1NG2A 1QCFA 3VS4A 5HCKA 3M0TA 2ABLA 2O88A 2GTJA 1K4US 1RLQC 1I0CA 2GGRA 4K11A 3EG1A 1WX6A 2DBKA 4JZ3A 2DM1A 2EKHA 2FO0A 2LQWA 2KYMA 2DNUA 2ECZA 2KT1A 4OMPA 1I07A 3TSWA 2D0NA 3UATA 2M51A 2AKKA 2AZSA 2CT4A 3NHNA 1G2BA 2LMJA 2RPNA 1N5ZA 1UTIA 4F14A 4LUDA 1PKSA 2AZVA 5IHKA 5IXBA 2KXCA 2ROLA 2KE9A 4AG1C 1VYTA 2LCSA 5I11A 1ZBJA 3ZL7C 1AD5A 3KFVA 1E6HA 2D8JA 1YWPA 1UGVA 2O9VA 3RBBB 1K9AA 2EYXA 2JW4A 1K76A 1JXMA 2DX1A 5L23A 1MV0B 1YNZA 1KSWA 4WCIA 1MUZA 1AZEA 2LX7A 3CQTA 5I22A 2FG0A 1WXBA 5EC7A 1ABOA 2D1XA 4RTUA 1EFNA 3NGPA 1ZUUA 2JTEA 2RQWA 1NYGA 2YT6A 1YWOA 2EYYA 1GFCA 1WIEA 1JQQA 4IIOA 2FPFA 2EGEA 1ABQA 2DJQA 5GJVB 2CT3A 1WI7A 3EHRA 2A37A 2X3XD 2OJ2A 2JM8A 2SRCA 3O5ZA 1PHTA 2KROA 2RN8A 5FW9A 3UA7A 1E6GA 4CC3A 2K2MA 4CC7A 1Z9QA 1PRLC 1BBZA 1RUWA 4J9BA 2A08A 1AEYA 2LJ1A 1W70A 1VA7A 1I1JA 3QWYA 3PE0A 1G83A 4RTVA 2V1QA 2E5KA 3R6NA 1SPKA 1OOTA 2DLPA 2QDLA 2F2WA 2PZ1A 2X3WD 1X2QA 1KIKA 3VS5A 2VKNA 2DL3A 1X27A 3H0FA 4GLMA 1PWTA 4D8KA 4OMNA 4OMMA 2JMCA 3A98A 1UHFA 2HSPA 4J9FA 4JJDA 1H8KA 2M0YA 4RUGA 2KYBA 5FWBA 2YUQA 2ED0A 4LN2A 2DMOA 2GNCA 1WFWA 4QT7A 3H0IA 1ZLMA 2YUNA 2A36A 1CSKA 2KNBB 2XMFA 2DF6A 1VYVA 2YDLA 4X1VA 1UJYA 1OPKA 3M0PA 2EYZA 2O31A 2L3QA 2O2OA 3NMZC 2LNHB 4J9IA 2ESWA 4HVUA 1T3SA 1AWJA 1ZX6A 1W1FA 4FSSA 2JMAA 2V1RA 3REAB 2LJ0A 2EQIA 1HD3A 2VWFA 4J9CA 3EGUA 1OV3A 1GBRA 2B86A 4F17A 3I35A 1GCPA 2RNAA 2F2VA 2K3BA 1UECA 4EIKA 1UDLA 1QKWA 4ZNXA 1AWXA 3EHQA 4LE9A 1S1NA 1HJDA 2L3SA 3UF4A 2CH4W 2AK5A 4ORZA 2C0OA 3I5SA 1WLPB 2W10A 2HEQA 3SEMA 1M3AA 1UJ0A 2MCNA 1V1CA 2EVRA 2HDAA 2BZYA 2CUBA 4CC2A 1PKTA 2EGAA 2K9GA 1AOJA 1X2KA 1JU5C 2ROTA 3LH5A 1M8MA 2KR3A 2J06A 1K1ZA 2DL8A 5IHIA 1XOVA 2JS2A 2HBWA 1M30A 2RQRA 2DA9A 3TSZA 1SRMA 1QKXA 4HVVA 1B07A 4OMOA 2YUPA 3H0HA 4AFUC
chains in the Genus database with same CATH superfamily
5KYYA 4A4GA 1YCSB 4JLGA 3HP9A 1BK2A 1VQ9T 3SHWA 3OS1A 1NLOC 1YJWA 1K9MC 2DEUA 4M7AF 5GANg 4CC4B 2VXFA 2D6FA 3LYIA 2IIMA 1YIJA 4JJNK 1M4ZA 1BI2A 4JDSA 1JJ2A 2QGFB 2DRKA 3MPUB 3CC7Q 1YJNA 2E1HA 5CK9A 3J7AF 3EG2A 2GBQA 1NZ9A 2K3XA 4CRIA 3CCET 1VQKQ 5LJ3h 1R0CB 1JRIA 4XTUA 2FEIA 4GLKA 3OYDA 2COWA 1JXOA 4OB3B 1WQ7A 2HSEB 4PJOE 2HCKA 2JT4A 2DE0X 4JZ4A 1T0JA 2VASA 4M7AB 2LP5A 3U23A 4M7DE 4DOWA 2QTXA 4KH1B 4FT2A 1M5Q1 4MZMA 3CPWS 2RH2A 2DL7A 3I56A 3VS6A 2AKLA 4OB0B 2MIOA 2RHXA 3ULRB 2Y4YA 2EPDA 1WYXA 3OMCA 1VYUA 5GAN7 3G6EQ 2DL4A 1WHKA 4F7UA 1VQPQ 2YUOA 3FJPA 3A8MB 3SD4A 5C6SA 2ZPEB 1M3BA 2GFAA 2VC8A 3M59A 4AFSC 3EGDB 4A63B 2RD1A 2CZ1B 3JCMg 5CIUA 3HFNA 1X43A 4J9HA 4RKUE 5LJ5h 3MCAB 1AWWA 2MOXA 4C92F 2LJ3A 2R58A 3G7ZA 1VQ7A 3GNFB 1EZZB 2RI5A 2YHTA 1X75C 1M1KU 1S72Q 2DTOA 2FYKA 2RJDA 4OGCA 1FYNA 5FU7B 2L3PA 2LCLA 3M0SA 4B6MA 4KGVB 1UFFA 2J6OA 2LQNA 1GL5A 1ZSGA 4PJLA 4FT4A 2JS0A 3OS5A 3Q1JA 4RCCA 1AWOA 2RI3A 1GXIE 3QSUA 4M78F 2KT8A 1GBQA 4XU2A 3CD6T 3QDRB 1WJRA 4LDUA 2EQUA 3VUBA 1TH7A 1K0SA 2E4HA 2KAFA 2E70A 3HRSA 2A28A 5GAN5 5CAIA 1RI9A 1U8RA 4R55A 2LZ6B 3RNJA 4J7FA 3CMAA 1WHHA 4LUEA 3QIIA 3CXCP 2VGMA 2X4YA 2HD0A 4M7AE 4ESRA 3EFOA 2KRMA 1YHQT 2X4WA 3LW5E 1LVKA 4M78B 1I5LA 1RAIB 1LOJA 1PD0A 2XD0A 1QW1A 5KYUB 2COYA 5GJWB 4DEXA 1RAGB 1JO8A 1WPYA 2GF7A 4AT1B 3C4SA 4JJBA 3E9FA 3CCMQ 4PFPA 1FMVA 2SEMA 1NPRA 1GRIA 3BE3A 2CREA 1UUEA 1W6XA 4C0ZA 4HXJA 2DXBA 2JNGA 3ZEHA 3X24B 3V7RA 4PJMA 4FYWB 4DOVA 2ATCB 2OI3A 2RK2A 2KEAA 5D7UA 2EYWA 1T0HA 5DM7R 4F7UG 2WSFE 2J6KA 4M4ZA 1X6OA 1WGSA 3HL8A 5C0MA 1QCFA 3SWNB 1TUGB 5HCKA 3M0TA 2DXUA 1D0XA 2GTJA 4M77C 2FB7A 2L8DA 3CCLA 4M7DD 5LL6S 4AMCA 2QEXT 2DBKA 2WSCE 3QDFA 4BI8B 2YLBA 2FL7A 2ECZA 3URGA 4QW2A 1VQ9Q 1TSFA 2XG8D 2AKKA 1IXDA 2DD4A 2LMJA 2RPNA 1N5ZA 3FEOA 2OX7A 4YTLA 4C92E 2DZCA 2KXCA 5IXBA 2ROLA 2KE9A 5GAMh 1VYTA 5I11A 1D3BA 2EJ9A 1AD5A 3CCEQ 2D8JA 2JOYA 1YWPA 2VYTA 4R56A 2O9VA 2KQWA 4JUVA 2NUTB 4GY5A 5I22A 2D1XA 3HPWA 1ZUUA 5HKCA 1NJIU 2E3IA 1KC8U 3M9QA 2YT6A 2EYYA 1GFCA 4M78E 2CYZB 4IIOA 5D6YA 4FM4B 2X3XD 4IUVA 2SRCA 3QO3A 4PFZA 1KD1U 4C8QC 3GIBA 4DA4A 2K2MA 4Y28E 3RESA 1VQ7T 1Z9QA 3RMSA 1X01A 1Y71A 2O01E 4OGEA 2JZ2A 1MGQA 5FROA 2FZCB 1BI3A 1SKUB 1K9MU 5GMKi 3RR6A 3OW2A 3MKDA 1VQ6A 1SPKA 3JRZA 2DLPA 1Q86C 2F2WA 3O8VA 3L2VA 1X2QA 2XDDA 2DL3A 2IPOB 2PQWA 4OMMA 5AYFA 4M7AD 2XDPA 2EQJA 2O4XA 2FZKB 4C5GA 4KUDK 1U1TA 4RUGA 4XTWA 1KD1R 4IUTA 1M1FA 2YRVA 4MDXA 2OTJT 1OQKA 3NFCA 4LN2A 4E7LA 1PSFA 2YUNA 3CMAT 2KNBB 4BE0A 2DVEA 5HK3A 1XNIA 2LDMA 1QQJA 1K9MR 1OPKA 3M0PA 3CCSQ 4HT8A 2O31A 4M77A 2OTLA 1V76A 3JCMd 2HQHA 5KYNA 3OS2A 1AWJA 2JMAA 2V1RA 2D0QB 1K8AC 1F1BB 2K5FA 1ACMB 3EFRA 3REAB 4C5HA 4OMFB 1OX8A 2QA4A 3E9GA 5A0LA 1B34B 1RI0A 4J9CA 2DERA 1IZ6A 1Y7XA 2E12A 3I35A 2DFUA 1YCYA 1YHQQ 3HSBA 2K3BA 1UECA 4WF2A 4EIKA 1XJWB 1AWXA 3EHQA 4PJOC 3AHUA 4M75F 2R57A 2P84A 3CCEA 1V1CA 1XTDA 2HDAA 4LXCA 5GMKh 4BDZA 2LRQA 3M54A 1AOJA 2BKDN 4N4HA 3M58A 2KI7A 3PTAA 3MHXA 4C92D 2F5KA 1BIBA 1M8MA 2DL8A 3CCUT 4E7IA 1XQHA 1B34A 4C0FA 3J81E 4ZTJA 2HBWA 5CO7A 3H8ZA 1C1AA 1YJWQ 1SRMA 1RAAB 1B07A 2DETA 4EMHA 4OMQA 1NM7A 3GOXA 3L2RA 3EGXA 4C8QA 1YIJQ 1K0XA 2GQIA 4BACA 1U06A 4PNOA 2QEXQ 1UEBA 2F1LA 3NPFA 4M78D 5GAN6 3F70A 4JRKA 2F69A 2CP3A 4QQGA 3PT9A 4BI3A 5FRNA 1J3TA 2CSIA 2ED1A 4DEYA 4F16A 3M0QA 2RMOA 2E64A 1QVGS 3QXEB 2EQKA 2A0FB 1IO6A 3JCMb 1TG0A 1ARKA 2DIGA 3CBOA 3I56Q 2DK3A 1BYMA 4IUUA 2E10A 2J6FA 4AFZC 1IGUA 2RHIA 1RABB 1WA7A 2DXTA 4M77G 5GMKl 2P0KA 1D0YA 1CKAA 1N8RC 1MNDA 3EFSA 1G5VA 3CD6A 4ME7A 2VVKA 7AT1B 5LJ5f 2DVJA 1U5SA 1VQ6T 3KXTA 2J7IA 1LCKA 3EAEA 4KH0B 4NS5A 2VB6A 1RLPC 2BTTA 2FPDA 5CQYA 1VQ7Q 5J39A 3CXCA 4Z88A 5J3BA 3V7CA 5LJ3e 5LJ3d 2GTOA 3CBPA 2LTOA 2XK0A 1MNEA 3LWIA 1YHQA 3OBWA 2FPEA 2ZPHB 4JPBW 2XIDA 4ZGJB 1UG1A 4PJOA 3G1JA 4E7KA 3TVTA 2YSQA 4M75E 3JCMQ 4NL3A 4M7DA 2M9UA 1PSEA 1BB9A 5FU6B 4C0DB 1OX9A 1Y07A 1ZUKA 3M0UA 1KHIA 2MMPA 4C5EA 4HT9A 2H8HA 2KRSA 1WXUA 3RDVA 2WSEE 4C8QG 1OULA 2QA4T 1VIEA 3ZFJA 4A4KA 2V8JA 3FJ5A 2D9TA 3CBMA 3ER0A 5GAN4 5FU7C 2K5LA 3CMAQ 2AT1B 1VQMT 3L2UA 1KQSP 2EQMA 1QWFA 2PVGB 2LNVA 5KYWB 3M57A 2RJFA 2QEXA 3QBYA 1IHWA 4LDWA 3M4YA 3VRZA 2EW3A 2L3RA 1Q82R 1HYOA 1H3HA 3CCRT 1VOMA 1N6AA 2KGTA 3OYLA 1UHCA 3PVQA 3L2WA 2EFIA 4XU1A 2X4JA 3QYGB 3LWHA 1Q86U 2NUPB 1Q7YR 2RI2A 4RTXA 2YWWA 3UWNA 1QLYA 1WHJA 4RG2A 1QWEA 3FIFA 5GAOn 3QJYA 2NYSA 4M78C 1AT1B 2H3EB 5CKEA 4V2SA 3CCLQ 4MZPA 1NG2A 1OI1A 2JVVA 2ABLA 3TQ7P 3EH1A 1P92A 3OYFA 3E2UA 4K11A 3EG1A 2R5AA 1WX6A 4PJNA 1WHGA 4JZ3A 2KSSA 2EKHA 2RHZA 3TU4K 2BE9B 2LQWA 5GAMf 4ZN3A 2DNUA 2KT1A 4XTYA 4M7AA 3UATA 2COZA 1Q86R 2E6NA 1M90R 2M16A 4PJOG 1UTIA 1H641 3OYEA 4N4IA 2GQVA 1IB8A 1MMNA 1W4SA 2ZCFB 3SWNC 1VQOA 1LJOA 4QQ6A 4M7DG 2LCSA 3MEUA 1G3SA 3ZL7C 4JS4A 3V8JA 2DJZA 3KFVA 2RB6A 1UGVA 5KE2A 3RBBB 2EYXA 4L6V5 2DX1A 3PMIA 4FYXB 4F04B 5M9OA 1AZEA 1KQSS 2EWNA 4KBMB 2LQ8A 3A8OB 1ABOA 4Y91A 3EGDA 4MDWA 4C92B 2JTEA 2RQWA 9ATCB 1K73C 4XU3A 1WHMA 2DZ9A 3OYJA 1ABQA 4N0AC 2OTJA 2CT3A 3EHRA 4M75D 3S3MA 1BI1A 3OSSC 2OJ2A 1K8AR 1YI2T 4JRIA 1BKBA 4II1A 4X9DA 1SG5A 4RCBA 2MPXC 4E47A 4CC7A 5CKBA 5DLQE 1PRLC 3FB9A 2A08A 4J6XA 4NOYA 1VQ6Q 4FL6A 3CCVT 3QYHB 2QG9B 1KHCA 1W70A 1VA7A 1I1JA 5KCHA 3QWYA 1G83A 3R6NA 1YFNA 4BD3A 1KIKA 2VKNA 1C6VX 3H0FA 1UGRB 2JMCA 3EH2A 5CVIA 1OZ3A 2M0YA 1G8XA 5FWBA 2DMOA 3X28B 1FMWA 4QT7A 1VQNA 3JAME 1LNXA 4M78A 4BY6B 3E19A 3PIOA 1WJSA 2OTLQ 5KYUA 3V7SA 1QVFP 3H9NA 4X1VA 3G71T 1DJ7B 1W2BP 2K4YA 1Q81C 2GCXA 4M7AG 3CCUA 2O2OA 2QA4Q 4J9IA 5GANf 3S6WA 2ESWA 1N8RU 1ZX6A 4XQ3A 4UC4A 4E7ZA 5CKDA 5KE3A 2LJ0A 2EQIA 2JTFA 2LVMA 1LPLA 1B7TA 1D1AA 3MEAA 1OV3A 1D1CA 2BUDA 4F17A 4E2FB 3M53A 3LGFA 2KDSA 3L2QA 5LJ3g 1Q82C 5KCOA 1PCXA 2F2VA 1UDLA 5GAOm 2HKNA 4ZNXA 3SWNA 3A1PA 3UF4A 2AK5A 2ZGWA 2C0OA 3I5SA 2Y90A 1WLPB 2CP0A 2W10A 5CQXA 3QKJA 2PUOB 1UJ0A 2MCNA 3NTKA 1RACB 2CUBA 2L89A 4DQ2A 2K9GA 1Q7YC 1G3YA 2QI2A 3G4ST 2ROTA 1N8RR 3J80E 1BIAA 1QP2A 3DB3A 2E3HA 3JCMJ 2KR3A 3UDCA 2RK1A 2CP7A 1M30A 2MK5A 2RQRA 4N0AA 4IKFA 2DA9A 3QPHA 2OAUA 2K2VA 1QKXA 3P8BB 4JLIA 1QCOA 2LCCA 1UB4A 3N5BB 3JCMf 1QMCA 2P0QA 1EIFA 1TUDA 1T3LA 3X26B 4WTOB 4MZTA 3WXMB 2NUTA 2DKGA 4RTZA 3PVLA 1VQOT 2QK0A 2RF0A 3QUIA 5IH2A 4C92G 2E6ZA 3CPWA 4RTWA 4Q5WA 1M90C 4DBHA 2ZPGB 2DO3A 5FWCA 5IHNA 4J9GA 1I8FA 2KY9A 1QVFS 3I9QA 3MP1A 2YRCA 5GMKe 1MMDA 1W2BS 3VV0A 2HBPA 4X34A 2PVOB 3C95A 3UPUA 5A0DA 1NLPC 2KRNA 3MP8A 5I2MA 1V29B 4MMLA 4QVDA 3GBQA 4M78G 1MMGA 5KYXB 4BUGA 4OMLA 1M2OA 1A0NB 1D0ZA 4HCBA 2G3RA 2EBPA 2M1HA 1JJ2S 1QVGP 1M3CA 4PK4A 3CD6Q 4A4EA 4A4FA 2DL5A 3VU3C 3S3OA 5J26A 1YJ9T 4R0KA 2AIRB 1VQ4A 1YITA 2EAYA 3UA6A 5LJ3j 2P4RA 5GAN2 3OA6A 3JB9G 1X69A 2QAZA 1WDXA 3QWXX 2DILA 3INZA 5GANh 1VQMA 2KK4A 1AHJB 3BDLA 5KYXA 4HVWA 4PLLA 1M27C 2VUBA 5CKFA 4KULA 1PC0A 2V8IA 3OQ5A 2DEQA 4LD6A 4J9DA 4NL2A 4M7DC 2PU9B 1U3OA 3CCRA 1VQNT 3BFMA 4IIMA 4ZN1A 4FU6A 1VUBA 2RQTA 3MP6A 5D6WA 1EX4A 3VS2A 1ZA1B 5HY6A 1SHFA 4B9WA 2PUKB 4D8DA 1R77A 5A0GA 2C0TA 1D1BA 1PG5B 4P5NA 3OYNA 4ATOA 1X6GA 4M75B 4FW2A 4ZTFA 2DTIA 2ZPBB 1K73U 3VYGA 5LJ5j 3DLLA 2DYBA 4KRTA 4HCKA 1VQPT 3ASKA 4LDYA 3CMEA 1GCQA 1YN8A 2HQEA 1WXTA 1OYXA 3QG1A 3G71Q 3JCMV 3RKYA 2M0OA 4Z89A 5FU6C 2CUDA 4C0DC 1I5OB 1VQ5A 3PMTA 4OB1B 3JCMh 4PKCC 2PTKA 1HSQA 2A7YA 2XHCA 1MV3A 2RHYA 1PNJA 4XU0A 3VS7A 2Z0WA 1U1SA 1S72T 1UE9A 3EG0A 1IHVA 1KJWA 1FMKA 1Y96B 3EG9B 4PJJA 1UGQB 1N27A 4J8OA 5GAOr 4HCCA 1SRLA 1K73R 3LGLA 4E7HA 3X20B 3CCQA 5GAOq 3C0CA 2Y4XA 1VQ8A 2L2PA 3V8KA 3FLGA 4E7JA 1SHGA 5GAN3 3RUXA 3OYGA 1ZUYA 2W0ZA 3OY9A 2FRWA 2XICA 2C06A 5L8RE 1NEBA 1FXXA 4ZGEB 2O88A 2DTHA 1RAHB 1K4US 2GGRA 1M9SA 4A54A 4M7AC 4Z02A 4EMKB 2EKOA 4PLIA 3A8LB 3H6ZA 1YI2A 5IN1A 2D0NA 4KGXB 4KT0E 5IAYA 2AZSA 2CT4A 3JB9I 1VQOQ 1G2BA 3VKIA 1UGPB 4ANJA 3CCVA 3OMGA 5FLXE 1VIFA 5IHKA 2MAMA 2QASA 3DB4A 3GNGA 1ZSZB 5KYYB 3ME9A 1Q82U 3A8HB 1SSFA 3CC4T 1K9AA 1JXMA 2EIFA 5DLOA 5L23A 1TOVA 5GMKm 1KSWA 4WCIA 1MUZA 2LX7A 1KQ1A 2FG0A 1WXBA 5EC7A 3HFOA 4QVCA 4RTUA 1EFNA 3TCJA 1VQ4T 1YITT 2OTJQ 4FYYB 2DYIA 3C94A 1Q81R 1WIEA 2KMTA 1Q7YU 4HKEA 2EGEA 3T9NA 5GJVB 1TWBA 2F5TX 4F7UF 2JM8A 2LX9A 4PL6A 2KROA 2RN8A 1VQLA 3RKWA 1YJ9Q 3UA7A 5GAMj 2V26A 4CC3A 5LJ5e 5LJ5d 3G71A 3OSVA 2EJGA 2RJEA 1BBZA 4J9BA 1JBMA 4BB7A 2JTMA 2CZ7B 1AEYA 4C92C 2QYZA 3PE0A 4DBQA 1WNLA 2E5KA 8ATCB 2RJCA 5KH6A 3S3NA 4M75G 2CZ0B 2QDLA 2X3WD 4F7UB 1TTHB 1M90U 4M77D 4D8KA 1PWTA 1QP3A 3META 3JB9H 1ZQ1A 4JS5A 1UHFA 1O75A 2QXFA 4J9FA 4JJDA 3OYYA 1VQNQ 3A8GB 4CI0C 2CP5A 5KYWA 2FVUA 3CCJT 3HKSA 2YUQA 2ED0A 3CMET 3FDRA 2GNCA 4C5IA 3H0IA 1ZLMA 3OW2S 2A36A 2YRDA 1MHNA 3CCUQ 3G4SA 4X9CA 3JSCA 5D6XA 2I2LA 2E5QA 1PM3A 1VQ5T 1UJYA 2EYZA 1R0BG 3NMZC 2LNHB 3CC2T 1QCNA 8AT1B 1RADB 1W1FA 4FSSA 2NUPA 4QQDA 2X51A 2NLUA 2X35A 1K8AU 3I55T 3EGUA 2FHDA 3NTHA 4LDXA 1WZOA 2LT4A 3V8LA 1FWZA 5FRMA 2ZPFB 2K57A 1GCPA 2RNAA 2DD5A 1ZBXA 4BY6C 3LLRA 3CCQT 5GAOp 3BW1A 3JCMc 1QKWA 4LE9A 4OB2B 2YLCA 4XK8E 1VQ8T 1HJDA 2L3SA 2CH4W 1N9SA 1M3AA 6AT1B 1UGSB 3PIPA 4C8QD 2EVRA 2BZYA 2MWOA 4C0GA 3ZBDA 1PKTA 3EFOB 2E41A 2EGAA 4ZGDB 4FW1A 1X2KA 5HK0A 4B9XA 3L1AA 1JU5C 3LH5A 4N4GA 4BDYA 1H3ZA 5GAN8 3QZ5B 4XTVA 5CR2A 3MJXA 1M2VB 3KBGA 5IHIA 2JS2A 2CP6A 1QVGA 1TS9A 3CCST 2CZ6B 3E1SA 3TSZA 5GANj 2DXCA 4HVVA 2YUPA 3H0HA 4AFUC 4F7UE 1KQ2A 1CKBA 4LDVA 2KXDA 2KVQG 1OZ2A 1YJ9A 2K79A 3REBB 1GFDA 2ZZDA 1OPLA 4IUQA 3PFSA 2HAXA 1M1KR 4O6JA 1IGQA 2IVWA 5GAMe 5GAMd 3GP8A 5GMKj 3RKXA 2JXBA 2FRYA 3HTRA 4C92A 4BE2A 1YP5A 3JB9F 2ENMA 2B8AA 3D7SB 5IXFA 2QTVA 3DLMA 3CC7A 4Z8AA 1I81A 1G3TA 4J6YA 1M2VA 3MEVA 4Y92A 2A3LA 2RA2A 2CDTA 1VQKA 1AVZC 4XTZA 1NPPA 1Y0MA 3WVDB 2NUZA 3RMQA 1H92A 2P0PA 3CC4Q 1KK7A 2BE7D 5GAOl 2J05A 1FX7A 2QQRA 2K6DA 2OAWA 4OF1A 4QKUA 1OEBA 1VQLT 2CP2A 2L0AA 2C0IA 2NWMA 1SEMA 1YITQ 1VQ4Q 4E7SA 1D3BB 3QJ6A 3VRYA 4RTYA 2F2XA 1YJWT 2EGCA 2FZGB 4HCZA 2CSQA 4J83A 2HZYA 2H3JA 4PJOD 4ELZC 1JEGA 4AG2C 2I0NA 1YIJT 1VQMQ 4RG8A 3G6EA 1B3QA 1JJ2P 2LC4A 1YJNT 4RTTA 3GF5A 1VQPA 3FRNA 2XU8A 2RQVA 2XDBA 3JV3A 4A4HA 1M1GA 2EJFA 4J9EA 1RAEB 1TUCA 2O9SA 3MO8A 2PVDB 2DBMA 2MI6A 1D09B 4FCYA 3FC3A 2LQKA 2XI9A 2RM4A 3CCRQ 2PNIA 2QQ9A 1BU1A 2EYQA 3H41A 2P4TA 3OB9A 1BI0A 1OU8A 3TEEA 3P8DA 2E65A 1S72A 4OP0A 2HQXA 2JM9A 2MF2A 2L5QA 2CH4A 3I56T 3M55A 1WQWA 1KFZA 3M0RA 2D8HA 3VS3A 3CXCS 3CCJQ 2CKKA 3I5RA 1GCQC 2K3YA 3SDZA 1PRMC 3CMEQ 2DPPB 4KGZB 4M77F 4D6WA 3VS0A 4GBQA 1NYFA 4E6RA 3EG3A 3PGGA 1NEGA 2O4XB 1VQ5Q 3IQLA 5ECAA 1Q95G 5GANe 1Y57A 5LJ5g 5GANd 3OYMA 3VS1A 3CC2Q 3UT1A 4IURA 3VJPA 2RO0A 4A53A 2KBTA 4LNPA 3I55Q 1SSHA 3L2ZA 2DIQA 4M75C 1ZA2B 2RHUA 4M77B 3C12A 3AT1B 3OS0A 2QDYB 4MMKA 3CCQQ 1X6BA 1NJIR 2X4XA 1KC8R 3GPLA 3VUZA 2K7AA 4AFQC 1AZGB 2DRMA 3KUFA 1VQ8Q 3JCMP 2VXEA 3PNWC 3RERA 1Z9ZA 2GFUA 3CCMA 3CC4A 2BZ8A 2HL5C 4EDUA 1E7OA 3THKA 1OU9A 4EPCA 3TREA 2R5MA 2G6FX 2JJ9A 4BE1A 2BZXA 2RQUA 2JUFA 4JJCA 3OYKA 4J7IA 1MMAA 3VS4A 3HRUA 4TVRA 1WHLA 1RLQC 1I0CA 3OYCA 1YI2Q 3OYHA 4C8QF 2ZPIB 2DM1A 2FO0A 1M8VA 1R8OB 1KQSA 2KYMA 1BCMA 3JCMe 1NE8A 3CC7T 4OMPA 1I07A 3SB2A 3TSWA 2M51A 3CCVQ 4VUBA 1M1KC 5I21A 2VV5A 5EG2A 4J5YA 3NHNA 1VQKT 1ZHIA 1C0MA 1VQ9A 2QQSA 4F14A 4LUDA 1PKSA 2JN0A 3JB9J 2AZVA 4AG1C 2QGGA 1ZBJA 2LT1A 1E6HA 2X9HA 3LX7A 2DAQA 3EGXB 4C8QB 4EMKC 2JW4A 4BI4A 1K76A 5DY9A 3OBYA 1MV0B 1YNZA 3CPFA 2HMAA 3CQTA 3HRTA 4HA8A 1QVPA 3NGPA 4FYVB 2BIVA 3A5ZB 2CGHA 1NYGA 2QQAA 1YWOA 1HK9A 3CCLT 1JQQA 3G6ET 4L59A 2FPFA 3HHTB 3CCJA 2DJQA 4EMGA 1VQLQ 4QVZA 1WI7A 2M02A 2A37A 3OYBA 1ZSZC 3O5ZA 1PHTA 4M77E 1N9RA 5I2SA 5FW9A 2MWPA 1E6GA 4IUPA 1RUWA 4OVAA 2CS7A 1TXQA 2YXYA 3CC2A 5LJ3f 2LJ1A 1IRXA 4L5GA 5GAMg 1KG1A 4RTVA 1YJNQ 2V1QA 2ZAEA 1G3WA 1OOTA 3I55A 4KUIA 2PZ1A 4JRPA 3RIRA 4M75A 3BDUA 3VS5A 4PJOF 1X27A 1I4K1 4GLMA 2HNIA 4OMNA 4FIBA 3OYIA 3A98A 2V8KA 4M7DF 4LD9K 1RAFB 2WACA 1BCOA 2HSPA 1H8KA 3DKMA 2KYBA 1SF9A 2VGNA 3G4SQ 2HL3A 3VYHB 3WVEB 1WFWA 1WJQA 4DBRA 5CKHA 3JB9D 3BY7A 1CSKA 4DBFA 2XMFA 2DF6A 3MEWA 1VYVA 2YDLA 3R6OA 4PJOB 1HXDA 3P8HA 2QQBA 2L3QA 3OYAA 3GLXA 1Q81U 1Y96A 3EG9A 4J6WA 4M7DB 4HVUA 1T3SA 2XKOC 3CCSA 4C8QE 3LH0A 1HD3A 3CEYA 3OW2P 2VWFA 3CPWP 5IT9E 1YBYA 1GBRA 2B86A 4XAXB 3QHSA 3QZ9B 4O5VA 3L42A 4XTXA 3CCMT 3M5AA 4RMOA 5CCAA 1S1NA 4PFOA 5A2QE 2HKQB 2MYSA 3NTIA 3SFMA 4ORZA 2HEQA 3SEMA 1TU0B 2AHJB 1NJIC 1PD1A 1KC8C 5AT1B 3JCMX 4EMKA 3JCMW 4CC2A 3M56A 2K5IA 1JB0E 4FSXA 4ELYC 1O9SA 2J06A 1K1ZA 1NBEB 1XOVA 3M4GA 1KD1C 2OTLT 1RL2A 2IG0A 1QVFA 3X25B 1W2BA 1IREB 4OMOA 4JRQA 1ZSZA
chains in the Genus database with same CATH topology
1CKBA 4OMQA 1YCSB 1NM7A 2KXDA 1BK2A 3SHWA 1TUDA 1NLOC 2K79A 1T3LA 3REBB 1GFDA 1K0XA 2GQIA 1U06A 3NPFA 3PVLA 4RTZA 4CC4B 1OPLA 2RF0A 5IH2A 2IIMA 4RTWA 2JXBA 2FRYA 2DRKA 3EG2A 2GBQA 1YP5A 1J3TA 2CSIA 2ED1A 4DEYA 2ENMA 5FWCA 5IHNA 4F16A 4J9GA 5IXFA 3M0QA 2RMOA 4Z8AA 3I9QA 2FEIA 4Y92A 1JXOA 1IO6A 1TG0A 2HCKA 2JT4A 1ARKA 2CDTA 2DE0X 4JZ4A 1AVZC 1T0JA 1NLPC 2KRNA 1Y0MA 2LP5A 2NUZA 3GBQA 3U23A 1H92A 4OMLA 1A0NB 2J6FA 2J05A 4AFZC 2K6DA 2OAWA 1OEBA 2DL7A 2EBPA 1WA7A 1M3CA 2L0AA 3VS6A 2AKLA 2C0IA 2NWMA 2DL5A 2MIOA 1SEMA 3ULRB 1CKAA 2EPDA 1WYXA 3VRYA 4RTYA 2F2XA 2EGCA 1VYUA 2DL4A 2CSQA 4R0KA 2VVKA 2DVJA 2YUOA 4AG2C 1JEGA 1U5SA 2I0NA 3UA6A 2P4RA 1M3BA 4AFSC 2J7IA 1LCKA 1B3QA 1RLPC 4RTTA 1X69A 4A63B 1WDXA 2BTTA 2FPDA 2DILA 2RQVA 3QWXX 3JV3A 1X43A 4J9EA 4Z88A 1TUCA 2O9SA 4J9HA 2GTOA 4HVWA 2DBMA 1M27C 1AWWA 2MOXA 2LJ3A 4J9DA 2PNIA 2FPEA 1FYNA 4JPBW 1BU1A 2L3PA 3H41A 1U3OA 3M0SA 1UG1A 1UFFA 3TVTA 2YSQA 4IIMA 2JM9A 2CH4A 2J6OA 2LQNA 1GL5A 1BB9A 2RQTA 1ZSGA 1ZUKA 3VS2A 2JS0A 3M0UA 1SHFA 1AWOA 4D8DA 1KFZA 3M0RA 2D8HA 3VS3A 2KT8A 2C0TA 1GBQA 2H8HA 2KRSA 1WXUA 1X6GA 3I5RA 1GCQC 1PRMC 1K0SA 3FJ5A 2A28A 3VS0A 4GBQA 1NYFA 2DYBA 4KRTA 4HCKA 4E6RA 1GCQA 1YN8A 3EG3A 1NEGA 1RI9A 1WXTA 3IQLA 5ECAA 2LZ6B 3RNJA 1QWFA 1Y57A 4Z89A 4LUEA 3VS1A 2CUDA 4ESRA 2KRMA 3VRZA 2EW3A 2KBTA 2PTKA 1HSQA 1MV3A 1H3HA 4LNPA 1PNJA 1SSHA 2KGTA 3VS7A 1UHCA 3PVQA 5GJWB 1UE9A 4DEXA 1JO8A 3EG0A 1KJWA 1FMKA 4JJBA 1X6BA 2SEMA 2K7AA 1GRIA 4AFQC 1AZGB 2DRMA 2CREA 1UUEA 1SRLA 1W6XA 1Z9ZA 4HXJA 4RTXA 1QLYA 2BZ8A 3C0CA 1QWEA 1E7OA 3THKA 2L2PA 2OI3A 2KEAA 1SHGA 2EYWA 1T0HA 2G6FX 1ZUYA 2BZXA 2W0ZA 2FRWA 2RQUA 2J6KA 4M4ZA 4JJCA 1NEBA 1NG2A 1QCFA 3VS4A 5HCKA 3M0TA 2ABLA 2O88A 2GTJA 1K4US 1RLQC 1I0CA 2GGRA 4K11A 3EG1A 1WX6A 2DBKA 4JZ3A 2DM1A 2EKHA 2FO0A 2LQWA 2KYMA 2DNUA 2ECZA 2KT1A 4OMPA 1I07A 3TSWA 2D0NA 3UATA 2M51A 2AKKA 2AZSA 2CT4A 3NHNA 1G2BA 2LMJA 2RPNA 1N5ZA 1UTIA 4F14A 4LUDA 1PKSA 2AZVA 5IHKA 5IXBA 2KXCA 2ROLA 2KE9A 4AG1C 1VYTA 2LCSA 5I11A 1ZBJA 3ZL7C 1AD5A 3KFVA 1E6HA 2D8JA 1YWPA 1UGVA 2O9VA 3RBBB 1K9AA 2EYXA 2JW4A 1K76A 1JXMA 2DX1A 5L23A 1MV0B 1YNZA 1KSWA 4WCIA 1MUZA 1AZEA 2LX7A 3CQTA 5I22A 2FG0A 1WXBA 5EC7A 1ABOA 2D1XA 4RTUA 1EFNA 3NGPA 1ZUUA 2JTEA 2RQWA 1NYGA 2YT6A 1YWOA 2EYYA 1GFCA 1WIEA 1JQQA 4IIOA 2FPFA 2EGEA 1ABQA 2DJQA 5GJVB 2CT3A 1WI7A 3EHRA 2A37A 2X3XD 2OJ2A 2JM8A 2SRCA 3O5ZA 1PHTA 2KROA 2RN8A 5FW9A 3UA7A 1E6GA 4CC3A 2K2MA 4CC7A 1Z9QA 1PRLC 1BBZA 1RUWA 4J9BA 2A08A 1AEYA 2LJ1A 1W70A 1VA7A 1I1JA 3QWYA 3PE0A 1G83A 4RTVA 2V1QA 2E5KA 3R6NA 1SPKA 1OOTA 2DLPA 2QDLA 2F2WA 2PZ1A 2X3WD 1X2QA 1KIKA 3VS5A 2VKNA 2DL3A 1X27A 3H0FA 4GLMA 1PWTA 4D8KA 4OMNA 4OMMA 2JMCA 3A98A 1UHFA 2HSPA 4J9FA 4JJDA 1H8KA 2M0YA 4RUGA 2KYBA 5FWBA 2YUQA 2ED0A 4LN2A 2DMOA 2GNCA 1WFWA 4QT7A 3H0IA 1ZLMA 2YUNA 2A36A 1CSKA 2KNBB 2XMFA 2DF6A 1VYVA 2YDLA 4X1VA 1UJYA 1OPKA 3M0PA 2EYZA 2O31A 2L3QA 2O2OA 3NMZC 2LNHB 4J9IA 2ESWA 4HVUA 1T3SA 1AWJA 1ZX6A 1W1FA 4FSSA 2JMAA 2V1RA 3REAB 2LJ0A 2EQIA 1HD3A 2VWFA 4J9CA 3EGUA 1OV3A 1GBRA 2B86A 4F17A 3I35A 1GCPA 2RNAA 2F2VA 2K3BA 1UECA 4EIKA 1UDLA 1QKWA 4ZNXA 1AWXA 3EHQA 4LE9A 1S1NA 1HJDA 2L3SA 3UF4A 2CH4W 2AK5A 4ORZA 2C0OA 3I5SA 1WLPB 2W10A 2HEQA 3SEMA 1M3AA 1UJ0A 2MCNA 1V1CA 2EVRA 2HDAA 2BZYA 2CUBA 4CC2A 1PKTA 2EGAA 2K9GA 1AOJA 1X2KA 1JU5C 2ROTA 3LH5A 1M8MA 2KR3A 2J06A 1K1ZA 2DL8A 5IHIA 1XOVA 2JS2A 2HBWA 1M30A 2RQRA 2DA9A 3TSZA 1SRMA 1QKXA 4HVVA 1B07A 4OMOA 2YUPA 3H0HA 4AFUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKB A;  4OMQ A;  1YCS B;  1NM7 A;  2KXD A;  1BK2 A;  3SHW A;  1TUD A;  1NLO C;  2K79 A;  1T3L A;  3REB B;  1GFD A;  1K0X A;  2GQI A;  1U06 A;  3NPF A;  3PVL A;  4RTZ A;  4CC4 B;  1OPL A;  2RF0 A;  5IH2 A;  2IIM A;  4RTW A;  2JXB A;  2FRY A;  2DRK A;  3EG2 A;  2GBQ A;  1YP5 A;  1J3T A;  2CSI A;  2ED1 A;  4DEY A;  2ENM A;  5FWC A;  5IHN A;  4F16 A;  4J9G A;  5IXF A;  3M0Q A;  2RMO A;  4Z8A A;  3I9Q A;  2FEI A;  4Y92 A;  1JXO A;  1IO6 A;  1TG0 A;  2HCK A;  2JT4 A;  1ARK A;  2CDT A;  2DE0 X;  4JZ4 A;  1AVZ C;  1T0J A;  1NLP C;  2KRN A;  1Y0M A;  2LP5 A;  2NUZ A;  3GBQ A;  3U23 A;  1H92 A;  4OML A;  1A0N B;  2J6F A;  2J05 A;  4AFZ C;  2K6D A;  2OAW A;  1OEB A;  2DL7 A;  2EBP A;  1WA7 A;  1M3C A;  2L0A A;  3VS6 A;  2AKL A;  2C0I A;  2NWM A;  2DL5 A;  2MIO A;  1SEM A;  3ULR B;  1CKA A;  2EPD A;  1WYX A;  3VRY A;  4RTY A;  2F2X A;  2EGC A;  1VYU A;  2DL4 A;  2CSQ A;  4R0K A;  2VVK A;  2DVJ A;  2YUO A;  4AG2 C;  1JEG A;  1U5S A;  2I0N A;  3UA6 A;  2P4R A;  1M3B A;  4AFS C;  2J7I A;  1LCK A;  1B3Q A;  1RLP C;  4RTT A;  1X69 A;  4A63 B;  1WDX A;  2BTT A;  2FPD A;  2DIL A;  2RQV A;  3QWX X;  3JV3 A;  1X43 A;  4J9E A;  4Z88 A;  1TUC A;  2O9S A;  4J9H A;  2GTO A;  4HVW A;  2DBM A;  1M27 C;  1AWW A;  2MOX A;  2LJ3 A;  4J9D A;  2PNI A;  2FPE A;  1FYN A;  4JPB W;  1BU1 A;  2L3P A;  3H41 A;  1U3O A;  3M0S A;  1UG1 A;  1UFF A;  3TVT A;  2YSQ A;  4IIM A;  2JM9 A;  2CH4 A;  2J6O A;  2LQN A;  1GL5 A;  1BB9 A;  2RQT A;  1ZSG A;  1ZUK A;  3VS2 A;  2JS0 A;  3M0U A;  1SHF A;  1AWO A;  4D8D A;  1KFZ A;  3M0R A;  2D8H A;  3VS3 A;  2KT8 A;  2C0T A;  1GBQ A;  2H8H A;  2KRS A;  1WXU A;  1X6G A;  3I5R A;  1GCQ C;  1PRM C;  1K0S A;  3FJ5 A;  2A28 A;  3VS0 A;  4GBQ A;  1NYF A;  2DYB A;  4KRT A;  4HCK A;  4E6R A;  1GCQ A;  1YN8 A;  3EG3 A;  1NEG A;  1RI9 A;  1WXT A;  3IQL A;  5ECA A;  2LZ6 B;  3RNJ A;  1QWF A;  1Y57 A;  4Z89 A;  4LUE A;  3VS1 A;  2CUD A;  4ESR A;  2KRM A;  3VRZ A;  2EW3 A;  2KBT A;  2PTK A;  1HSQ A;  1MV3 A;  1H3H A;  4LNP A;  1PNJ A;  1SSH A;  2KGT A;  3VS7 A;  1UHC A;  3PVQ A;  5GJW B;  1UE9 A;  4DEX A;  1JO8 A;  3EG0 A;  1KJW A;  1FMK A;  4JJB A;  1X6B A;  2SEM A;  2K7A A;  1GRI A;  4AFQ C;  1AZG B;  2DRM A;  2CRE A;  1UUE A;  1SRL A;  1W6X A;  1Z9Z A;  4HXJ A;  4RTX A;  1QLY A;  2BZ8 A;  3C0C A;  1QWE A;  1E7O A;  3THK A;  2L2P A;  2OI3 A;  2KEA A;  1SHG A;  2EYW A;  1T0H A;  2G6F X;  1ZUY A;  2BZX A;  2W0Z A;  2FRW A;  2RQU A;  2J6K A;  4M4Z A;  4JJC A;  1NEB A;  1NG2 A;  1QCF A;  3VS4 A;  5HCK A;  3M0T A;  2ABL A;  2O88 A;  2GTJ A;  1K4U S;  1RLQ C;  1I0C A;  2GGR A;  4K11 A;  3EG1 A;  1WX6 A;  2DBK A;  4JZ3 A;  2DM1 A;  2EKH A;  2FO0 A;  2LQW A;  2KYM A;  2DNU A;  2ECZ A;  2KT1 A;  4OMP A;  1I07 A;  3TSW A;  2D0N A;  3UAT A;  2M51 A;  2AKK A;  2AZS A;  2CT4 A;  3NHN A;  1G2B A;  2LMJ A;  2RPN A;  1N5Z A;  1UTI A;  4F14 A;  4LUD A;  1PKS A;  2AZV A;  5IHK A;  5IXB A;  2KXC A;  2ROL A;  2KE9 A;  4AG1 C;  1VYT A;  2LCS A;  5I11 A;  1ZBJ A;  3ZL7 C;  1AD5 A;  3KFV A;  1E6H A;  2D8J A;  1YWP A;  1UGV A;  2O9V A;  3RBB B;  1K9A A;  2EYX A;  2JW4 A;  1K76 A;  1JXM A;  2DX1 A;  5L23 A;  1MV0 B;  1YNZ A;  1KSW A;  4WCI A;  1MUZ A;  1AZE A;  2LX7 A;  3CQT A;  5I22 A;  2FG0 A;  1WXB A;  5EC7 A;  1ABO A;  2D1X A;  4RTU A;  1EFN A;  3NGP A;  1ZUU A;  2JTE A;  2RQW A;  1NYG A;  2YT6 A;  1YWO A;  2EYY A;  1GFC A;  1WIE A;  1JQQ A;  4IIO A;  2FPF A;  2EGE A;  1ABQ A;  2DJQ A;  5GJV B;  2CT3 A;  1WI7 A;  3EHR A;  2A37 A;  2X3X D;  2OJ2 A;  2JM8 A;  2SRC A;  3O5Z A;  1PHT A;  2KRO A;  2RN8 A;  5FW9 A;  3UA7 A;  1E6G A;  4CC3 A;  2K2M A;  4CC7 A;  1Z9Q A;  1PRL C;  1BBZ A;  1RUW A;  4J9B A;  2A08 A;  1AEY A;  2LJ1 A;  1W70 A;  1VA7 A;  1I1J A;  3QWY A;  3PE0 A;  1G83 A;  4RTV A;  2V1Q A;  2E5K A;  3R6N A;  1SPK A;  1OOT A;  2DLP A;  2QDL A;  2F2W A;  2PZ1 A;  2X3W D;  1X2Q A;  1KIK A;  3VS5 A;  2VKN A;  2DL3 A;  1X27 A;  3H0F A;  4GLM A;  1PWT A;  4D8K A;  4OMN A;  4OMM A;  2JMC A;  3A98 A;  1UHF A;  2HSP A;  4J9F A;  4JJD A;  1H8K A;  2M0Y A;  4RUG A;  2KYB A;  5FWB A;  2YUQ A;  2ED0 A;  4LN2 A;  2DMO A;  2GNC A;  1WFW A;  4QT7 A;  3H0I A;  1ZLM A;  2YUN A;  2A36 A;  1CSK A;  2KNB B;  2XMF A;  2DF6 A;  1VYV A;  2YDL A;  4X1V A;  1UJY A;  1OPK A;  3M0P A;  2EYZ A;  2O31 A;  2L3Q A;  2O2O A;  3NMZ C;  2LNH B;  4J9I A;  2ESW A;  4HVU A;  1T3S A;  1AWJ A;  1ZX6 A;  1W1F A;  4FSS A;  2JMA A;  2V1R A;  3REA B;  2LJ0 A;  2EQI A;  1HD3 A;  2VWF A;  4J9C A;  3EGU A;  1OV3 A;  1GBR A;  2B86 A;  4F17 A;  3I35 A;  1GCP A;  2RNA A;  2F2V A;  2K3B A;  1UEC A;  4EIK A;  1UDL A;  1QKW A;  4ZNX A;  1AWX A;  3EHQ A;  4LE9 A;  1S1N A;  1HJD A;  2L3S A;  3UF4 A;  2CH4 W;  2AK5 A;  4ORZ A;  2C0O A;  3I5S A;  1WLP B;  2W10 A;  2HEQ A;  3SEM A;  1M3A A;  1UJ0 A;  2MCN A;  1V1C A;  2EVR A;  2HDA A;  2BZY A;  2CUB A;  4CC2 A;  1PKT A;  2EGA A;  2K9G A;  1AOJ A;  1X2K A;  1JU5 C;  2ROT A;  3LH5 A;  1M8M A;  2KR3 A;  2J06 A;  1K1Z A;  2DL8 A;  5IHI A;  1XOV A;  2JS2 A;  2HBW A;  1M30 A;  2RQR A;  2DA9 A;  3TSZ A;  1SRM A;  1QKX A;  4HVV A;  1B07 A;  4OMO A;  2YUP A;  3H0H A;  4AFU C; 
#chains in the Genus database with same CATH topology
 5KYY A;  4A4G A;  1YCS B;  4JLG A;  3HP9 A;  1BK2 A;  1VQ9 T;  3SHW A;  3OS1 A;  1NLO C;  1YJW A;  1K9M C;  2DEU A;  4M7A F;  5GAN g;  4CC4 B;  2VXF A;  2D6F A;  3LYI A;  2IIM A;  1YIJ A;  4JJN K;  1M4Z A;  1BI2 A;  4JDS A;  1JJ2 A;  2QGF B;  2DRK A;  3MPU B;  3CC7 Q;  1YJN A;  2E1H A;  5CK9 A;  3J7A F;  3EG2 A;  2GBQ A;  1NZ9 A;  2K3X A;  4CRI A;  3CCE T;  1VQK Q;  5LJ3 h;  1R0C B;  1JRI A;  4XTU A;  2FEI A;  4GLK A;  3OYD A;  2COW A;  1JXO A;  4OB3 B;  1WQ7 A;  2HSE B;  4PJO E;  2HCK A;  2JT4 A;  2DE0 X;  4JZ4 A;  1T0J A;  2VAS A;  4M7A B;  2LP5 A;  3U23 A;  4M7D E;  4DOW A;  2QTX A;  4KH1 B;  4FT2 A;  1M5Q 1;  4MZM A;  3CPW S;  2RH2 A;  2DL7 A;  3I56 A;  3VS6 A;  2AKL A;  4OB0 B;  2MIO A;  2RHX A;  3ULR B;  2Y4Y A;  2EPD A;  1WYX A;  3OMC A;  1VYU A;  5GAN 7;  3G6E Q;  2DL4 A;  1WHK A;  4F7U A;  1VQP Q;  2YUO A;  3FJP A;  3A8M B;  3SD4 A;  5C6S A;  2ZPE B;  1M3B A;  2GFA A;  2VC8 A;  3M59 A;  4AFS C;  3EGD B;  4A63 B;  2RD1 A;  2CZ1 B;  3JCM g;  5CIU A;  3HFN A;  1X43 A;  4J9H A;  4RKU E;  5LJ5 h;  3MCA B;  1AWW A;  2MOX A;  4C92 F;  2LJ3 A;  2R58 A;  3G7Z A;  1VQ7 A;  3GNF B;  1EZZ B;  2RI5 A;  2YHT A;  1X75 C;  1M1K U;  1S72 Q;  2DTO A;  2FYK A;  2RJD A;  4OGC A;  1FYN A;  5FU7 B;  2L3P A;  2LCL A;  3M0S A;  4B6M A;  4KGV B;  1UFF A;  2J6O A;  2LQN A;  1GL5 A;  1ZSG A;  4PJL A;  4FT4 A;  2JS0 A;  3OS5 A;  3Q1J A;  4RCC A;  1AWO A;  2RI3 A;  1GXI E;  3QSU A;  4M78 F;  2KT8 A;  1GBQ A;  4XU2 A;  3CD6 T;  3QDR B;  1WJR A;  4LDU A;  2EQU A;  3VUB A;  1TH7 A;  1K0S A;  2E4H A;  2KAF A;  2E70 A;  3HRS A;  2A28 A;  5GAN 5;  5CAI A;  1RI9 A;  1U8R A;  4R55 A;  2LZ6 B;  3RNJ A;  4J7F A;  3CMA A;  1WHH A;  4LUE A;  3QII A;  3CXC P;  2VGM A;  2X4Y A;  2HD0 A;  4M7A E;  4ESR A;  3EFO A;  2KRM A;  1YHQ T;  2X4W A;  3LW5 E;  1LVK A;  4M78 B;  1I5L A;  1RAI B;  1LOJ A;  1PD0 A;  2XD0 A;  1QW1 A;  5KYU B;  2COY A;  5GJW B;  4DEX A;  1RAG B;  1JO8 A;  1WPY A;  2GF7 A;  4AT1 B;  3C4S A;  4JJB A;  3E9F A;  3CCM Q;  4PFP A;  1FMV A;  2SEM A;  1NPR A;  1GRI A;  3BE3 A;  2CRE A;  1UUE A;  1W6X A;  4C0Z A;  4HXJ A;  2DXB A;  2JNG A;  3ZEH A;  3X24 B;  3V7R A;  4PJM A;  4FYW B;  4DOV A;  2ATC B;  2OI3 A;  2RK2 A;  2KEA A;  5D7U A;  2EYW A;  1T0H A;  5DM7 R;  4F7U G;  2WSF E;  2J6K A;  4M4Z A;  1X6O A;  1WGS A;  3HL8 A;  5C0M A;  1QCF A;  3SWN B;  1TUG B;  5HCK A;  3M0T A;  2DXU A;  1D0X A;  2GTJ A;  4M77 C;  2FB7 A;  2L8D A;  3CCL A;  4M7D D;  5LL6 S;  4AMC A;  2QEX T;  2DBK A;  2WSC E;  3QDF A;  4BI8 B;  2YLB A;  2FL7 A;  2ECZ A;  3URG A;  4QW2 A;  1VQ9 Q;  1TSF A;  2XG8 D;  2AKK A;  1IXD A;  2DD4 A;  2LMJ A;  2RPN A;  1N5Z A;  3FEO A;  2OX7 A;  4YTL A;  4C92 E;  2DZC A;  2KXC A;  5IXB A;  2ROL A;  2KE9 A;  5GAM h;  1VYT A;  5I11 A;  1D3B A;  2EJ9 A;  1AD5 A;  3CCE Q;  2D8J A;  2JOY A;  1YWP A;  2VYT A;  4R56 A;  2O9V A;  2KQW A;  4JUV A;  2NUT B;  4GY5 A;  5I22 A;  2D1X A;  3HPW A;  1ZUU A;  5HKC A;  1NJI U;  2E3I A;  1KC8 U;  3M9Q A;  2YT6 A;  2EYY A;  1GFC A;  4M78 E;  2CYZ B;  4IIO A;  5D6Y A;  4FM4 B;  2X3X D;  4IUV A;  2SRC A;  3QO3 A;  4PFZ A;  1KD1 U;  4C8Q C;  3GIB A;  4DA4 A;  2K2M A;  4Y28 E;  3RES A;  1VQ7 T;  1Z9Q A;  3RMS A;  1X01 A;  1Y71 A;  2O01 E;  4OGE A;  2JZ2 A;  1MGQ A;  5FRO A;  2FZC B;  1BI3 A;  1SKU B;  1K9M U;  5GMK i;  3RR6 A;  3OW2 A;  3MKD A;  1VQ6 A;  1SPK A;  3JRZ A;  2DLP A;  1Q86 C;  2F2W A;  3O8V A;  3L2V A;  1X2Q A;  2XDD A;  2DL3 A;  2IPO B;  2PQW A;  4OMM A;  5AYF A;  4M7A D;  2XDP A;  2EQJ A;  2O4X A;  2FZK B;  4C5G A;  4KUD K;  1U1T A;  4RUG A;  4XTW A;  1KD1 R;  4IUT A;  1M1F A;  2YRV A;  4MDX A;  2OTJ T;  1OQK A;  3NFC A;  4LN2 A;  4E7L A;  1PSF A;  2YUN A;  3CMA T;  2KNB B;  4BE0 A;  2DVE A;  5HK3 A;  1XNI A;  2LDM A;  1QQJ A;  1K9M R;  1OPK A;  3M0P A;  3CCS Q;  4HT8 A;  2O31 A;  4M77 A;  2OTL A;  1V76 A;  3JCM d;  2HQH A;  5KYN A;  3OS2 A;  1AWJ A;  2JMA A;  2V1R A;  2D0Q B;  1K8A C;  1F1B B;  2K5F A;  1ACM B;  3EFR A;  3REA B;  4C5H A;  4OMF B;  1OX8 A;  2QA4 A;  3E9G A;  5A0L A;  1B34 B;  1RI0 A;  4J9C A;  2DER A;  1IZ6 A;  1Y7X A;  2E12 A;  3I35 A;  2DFU A;  1YCY A;  1YHQ Q;  3HSB A;  2K3B A;  1UEC A;  4WF2 A;  4EIK A;  1XJW B;  1AWX A;  3EHQ A;  4PJO C;  3AHU A;  4M75 F;  2R57 A;  2P84 A;  3CCE A;  1V1C A;  1XTD A;  2HDA A;  4LXC A;  5GMK h;  4BDZ A;  2LRQ A;  3M54 A;  1AOJ A;  2BKD N;  4N4H A;  3M58 A;  2KI7 A;  3PTA A;  3MHX A;  4C92 D;  2F5K A;  1BIB A;  1M8M A;  2DL8 A;  3CCU T;  4E7I A;  1XQH A;  1B34 A;  4C0F A;  3J81 E;  4ZTJ A;  2HBW A;  5CO7 A;  3H8Z A;  1C1A A;  1YJW Q;  1SRM A;  1RAA B;  1B07 A;  2DET A;  4EMH A;  4OMQ A;  1NM7 A;  3GOX A;  3L2R A;  3EGX A;  4C8Q A;  1YIJ Q;  1K0X A;  2GQI A;  4BAC A;  1U06 A;  4PNO A;  2QEX Q;  1UEB A;  2F1L A;  3NPF A;  4M78 D;  5GAN 6;  3F70 A;  4JRK A;  2F69 A;  2CP3 A;  4QQG A;  3PT9 A;  4BI3 A;  5FRN A;  1J3T A;  2CSI A;  2ED1 A;  4DEY A;  4F16 A;  3M0Q A;  2RMO A;  2E64 A;  1QVG S;  3QXE B;  2EQK A;  2A0F B;  1IO6 A;  3JCM b;  1TG0 A;  1ARK A;  2DIG A;  3CBO A;  3I56 Q;  2DK3 A;  1BYM A;  4IUU A;  2E10 A;  2J6F A;  4AFZ C;  1IGU A;  2RHI A;  1RAB B;  1WA7 A;  2DXT A;  4M77 G;  5GMK l;  2P0K A;  1D0Y A;  1CKA A;  1N8R C;  1MND A;  3EFS A;  1G5V A;  3CD6 A;  4ME7 A;  2VVK A;  7AT1 B;  5LJ5 f;  2DVJ A;  1U5S A;  1VQ6 T;  3KXT A;  2J7I A;  1LCK A;  3EAE A;  4KH0 B;  4NS5 A;  2VB6 A;  1RLP C;  2BTT A;  2FPD A;  5CQY A;  1VQ7 Q;  5J39 A;  3CXC A;  4Z88 A;  5J3B A;  3V7C A;  5LJ3 e;  5LJ3 d;  2GTO A;  3CBP A;  2LTO A;  2XK0 A;  1MNE A;  3LWI A;  1YHQ A;  3OBW A;  2FPE A;  2ZPH B;  4JPB W;  2XID A;  4ZGJ B;  1UG1 A;  4PJO A;  3G1J A;  4E7K A;  3TVT A;  2YSQ A;  4M75 E;  3JCM Q;  4NL3 A;  4M7D A;  2M9U A;  1PSE A;  1BB9 A;  5FU6 B;  4C0D B;  1OX9 A;  1Y07 A;  1ZUK A;  3M0U A;  1KHI A;  2MMP A;  4C5E A;  4HT9 A;  2H8H A;  2KRS A;  1WXU A;  3RDV A;  2WSE E;  4C8Q G;  1OUL A;  2QA4 T;  1VIE A;  3ZFJ A;  4A4K A;  2V8J A;  3FJ5 A;  2D9T A;  3CBM A;  3ER0 A;  5GAN 4;  5FU7 C;  2K5L A;  3CMA Q;  2AT1 B;  1VQM T;  3L2U A;  1KQS P;  2EQM A;  1QWF A;  2PVG B;  2LNV A;  5KYW B;  3M57 A;  2RJF A;  2QEX A;  3QBY A;  1IHW A;  4LDW A;  3M4Y A;  3VRZ A;  2EW3 A;  2L3R A;  1Q82 R;  1HYO A;  1H3H A;  3CCR T;  1VOM A;  1N6A A;  2KGT A;  3OYL A;  1UHC A;  3PVQ A;  3L2W A;  2EFI A;  4XU1 A;  2X4J A;  3QYG B;  3LWH A;  1Q86 U;  2NUP B;  1Q7Y R;  2RI2 A;  4RTX A;  2YWW A;  3UWN A;  1QLY A;  1WHJ A;  4RG2 A;  1QWE A;  3FIF A;  5GAO n;  3QJY A;  2NYS A;  4M78 C;  1AT1 B;  2H3E B;  5CKE A;  4V2S A;  3CCL Q;  4MZP A;  1NG2 A;  1OI1 A;  2JVV A;  2ABL A;  3TQ7 P;  3EH1 A;  1P92 A;  3OYF A;  3E2U A;  4K11 A;  3EG1 A;  2R5A A;  1WX6 A;  4PJN A;  1WHG A;  4JZ3 A;  2KSS A;  2EKH A;  2RHZ A;  3TU4 K;  2BE9 B;  2LQW A;  5GAM f;  4ZN3 A;  2DNU A;  2KT1 A;  4XTY A;  4M7A A;  3UAT A;  2COZ A;  1Q86 R;  2E6N A;  1M90 R;  2M16 A;  4PJO G;  1UTI A;  1H64 1;  3OYE A;  4N4I A;  2GQV A;  1IB8 A;  1MMN A;  1W4S A;  2ZCF B;  3SWN C;  1VQO A;  1LJO A;  4QQ6 A;  4M7D G;  2LCS A;  3MEU A;  1G3S A;  3ZL7 C;  4JS4 A;  3V8J A;  2DJZ A;  3KFV A;  2RB6 A;  1UGV A;  5KE2 A;  3RBB B;  2EYX A;  4L6V 5;  2DX1 A;  3PMI A;  4FYX B;  4F04 B;  5M9O A;  1AZE A;  1KQS S;  2EWN A;  4KBM B;  2LQ8 A;  3A8O B;  1ABO A;  4Y91 A;  3EGD A;  4MDW A;  4C92 B;  2JTE A;  2RQW A;  9ATC B;  1K73 C;  4XU3 A;  1WHM A;  2DZ9 A;  3OYJ A;  1ABQ A;  4N0A C;  2OTJ A;  2CT3 A;  3EHR A;  4M75 D;  3S3M A;  1BI1 A;  3OSS C;  2OJ2 A;  1K8A R;  1YI2 T;  4JRI A;  1BKB A;  4II1 A;  4X9D A;  1SG5 A;  4RCB A;  2MPX C;  4E47 A;  4CC7 A;  5CKB A;  5DLQ E;  1PRL C;  3FB9 A;  2A08 A;  4J6X A;  4NOY A;  1VQ6 Q;  4FL6 A;  3CCV T;  3QYH B;  2QG9 B;  1KHC A;  1W70 A;  1VA7 A;  1I1J A;  5KCH A;  3QWY A;  1G83 A;  3R6N A;  1YFN A;  4BD3 A;  1KIK A;  2VKN A;  1C6V X;  3H0F A;  1UGR B;  2JMC A;  3EH2 A;  5CVI A;  1OZ3 A;  2M0Y A;  1G8X A;  5FWB A;  2DMO A;  3X28 B;  1FMW A;  4QT7 A;  1VQN A;  3JAM E;  1LNX A;  4M78 A;  4BY6 B;  3E19 A;  3PIO A;  1WJS A;  2OTL Q;  5KYU A;  3V7S A;  1QVF P;  3H9N A;  4X1V A;  3G71 T;  1DJ7 B;  1W2B P;  2K4Y A;  1Q81 C;  2GCX A;  4M7A G;  3CCU A;  2O2O A;  2QA4 Q;  4J9I A;  5GAN f;  3S6W A;  2ESW A;  1N8R U;  1ZX6 A;  4XQ3 A;  4UC4 A;  4E7Z A;  5CKD A;  5KE3 A;  2LJ0 A;  2EQI A;  2JTF A;  2LVM A;  1LPL A;  1B7T A;  1D1A A;  3MEA A;  1OV3 A;  1D1C A;  2BUD A;  4F17 A;  4E2F B;  3M53 A;  3LGF A;  2KDS A;  3L2Q A;  5LJ3 g;  1Q82 C;  5KCO A;  1PCX A;  2F2V A;  1UDL A;  5GAO m;  2HKN A;  4ZNX A;  3SWN A;  3A1P A;  3UF4 A;  2AK5 A;  2ZGW A;  2C0O A;  3I5S A;  2Y90 A;  1WLP B;  2CP0 A;  2W10 A;  5CQX A;  3QKJ A;  2PUO B;  1UJ0 A;  2MCN A;  3NTK A;  1RAC B;  2CUB A;  2L89 A;  4DQ2 A;  2K9G A;  1Q7Y C;  1G3Y A;  2QI2 A;  3G4S T;  2ROT A;  1N8R R;  3J80 E;  1BIA A;  1QP2 A;  3DB3 A;  2E3H A;  3JCM J;  2KR3 A;  3UDC A;  2RK1 A;  2CP7 A;  1M30 A;  2MK5 A;  2RQR A;  4N0A A;  4IKF A;  2DA9 A;  3QPH A;  2OAU A;  2K2V A;  1QKX A;  3P8B B;  4JLI A;  1QCO A;  2LCC A;  1UB4 A;  3N5B B;  3JCM f;  1QMC A;  2P0Q A;  1EIF A;  1TUD A;  1T3L A;  3X26 B;  4WTO B;  4MZT A;  3WXM B;  2NUT A;  2DKG A;  4RTZ A;  3PVL A;  1VQO T;  2QK0 A;  2RF0 A;  3QUI A;  5IH2 A;  4C92 G;  2E6Z A;  3CPW A;  4RTW A;  4Q5W A;  1M90 C;  4DBH A;  2ZPG B;  2DO3 A;  5FWC A;  5IHN A;  4J9G A;  1I8F A;  2KY9 A;  1QVF S;  3I9Q A;  3MP1 A;  2YRC A;  5GMK e;  1MMD A;  1W2B S;  3VV0 A;  2HBP A;  4X34 A;  2PVO B;  3C95 A;  3UPU A;  5A0D A;  1NLP C;  2KRN A;  3MP8 A;  5I2M A;  1V29 B;  4MML A;  4QVD A;  3GBQ A;  4M78 G;  1MMG A;  5KYX B;  4BUG A;  4OML A;  1M2O A;  1A0N B;  1D0Z A;  4HCB A;  2G3R A;  2EBP A;  2M1H A;  1JJ2 S;  1QVG P;  1M3C A;  4PK4 A;  3CD6 Q;  4A4E A;  4A4F A;  2DL5 A;  3VU3 C;  3S3O A;  5J26 A;  1YJ9 T;  4R0K A;  2AIR B;  1VQ4 A;  1YIT A;  2EAY A;  3UA6 A;  5LJ3 j;  2P4R A;  5GAN 2;  3OA6 A;  3JB9 G;  1X69 A;  2QAZ A;  1WDX A;  3QWX X;  2DIL A;  3INZ A;  5GAN h;  1VQM A;  2KK4 A;  1AHJ B;  3BDL A;  5KYX A;  4HVW A;  4PLL A;  1M27 C;  2VUB A;  5CKF A;  4KUL A;  1PC0 A;  2V8I A;  3OQ5 A;  2DEQ A;  4LD6 A;  4J9D A;  4NL2 A;  4M7D C;  2PU9 B;  1U3O A;  3CCR A;  1VQN T;  3BFM A;  4IIM A;  4ZN1 A;  4FU6 A;  1VUB A;  2RQT A;  3MP6 A;  5D6W A;  1EX4 A;  3VS2 A;  1ZA1 B;  5HY6 A;  1SHF A;  4B9W A;  2PUK B;  4D8D A;  1R77 A;  5A0G A;  2C0T A;  1D1B A;  1PG5 B;  4P5N A;  3OYN A;  4ATO A;  1X6G A;  4M75 B;  4FW2 A;  4ZTF A;  2DTI A;  2ZPB B;  1K73 U;  3VYG A;  5LJ5 j;  3DLL A;  2DYB A;  4KRT A;  4HCK A;  1VQP T;  3ASK A;  4LDY A;  3CME A;  1GCQ A;  1YN8 A;  2HQE A;  1WXT A;  1OYX A;  3QG1 A;  3G71 Q;  3JCM V;  3RKY A;  2M0O A;  4Z89 A;  5FU6 C;  2CUD A;  4C0D C;  1I5O B;  1VQ5 A;  3PMT A;  4OB1 B;  3JCM h;  4PKC C;  2PTK A;  1HSQ A;  2A7Y A;  2XHC A;  1MV3 A;  2RHY A;  1PNJ A;  4XU0 A;  3VS7 A;  2Z0W A;  1U1S A;  1S72 T;  1UE9 A;  3EG0 A;  1IHV A;  1KJW A;  1FMK A;  1Y96 B;  3EG9 B;  4PJJ A;  1UGQ B;  1N27 A;  4J8O A;  5GAO r;  4HCC A;  1SRL A;  1K73 R;  3LGL A;  4E7H A;  3X20 B;  3CCQ A;  5GAO q;  3C0C A;  2Y4X A;  1VQ8 A;  2L2P A;  3V8K A;  3FLG A;  4E7J A;  1SHG A;  5GAN 3;  3RUX A;  3OYG A;  1ZUY A;  2W0Z A;  3OY9 A;  2FRW A;  2XIC A;  2C06 A;  5L8R E;  1NEB A;  1FXX A;  4ZGE B;  2O88 A;  2DTH A;  1RAH B;  1K4U S;  2GGR A;  1M9S A;  4A54 A;  4M7A C;  4Z02 A;  4EMK B;  2EKO A;  4PLI A;  3A8L B;  3H6Z A;  1YI2 A;  5IN1 A;  2D0N A;  4KGX B;  4KT0 E;  5IAY A;  2AZS A;  2CT4 A;  3JB9 I;  1VQO Q;  1G2B A;  3VKI A;  1UGP B;  4ANJ A;  3CCV A;  3OMG A;  5FLX E;  1VIF A;  5IHK A;  2MAM A;  2QAS A;  3DB4 A;  3GNG A;  1ZSZ B;  5KYY B;  3ME9 A;  1Q82 U;  3A8H B;  1SSF A;  3CC4 T;  1K9A A;  1JXM A;  2EIF A;  5DLO A;  5L23 A;  1TOV A;  5GMK m;  1KSW A;  4WCI A;  1MUZ A;  2LX7 A;  1KQ1 A;  2FG0 A;  1WXB A;  5EC7 A;  3HFO A;  4QVC A;  4RTU A;  1EFN A;  3TCJ A;  1VQ4 T;  1YIT T;  2OTJ Q;  4FYY B;  2DYI A;  3C94 A;  1Q81 R;  1WIE A;  2KMT A;  1Q7Y U;  4HKE A;  2EGE A;  3T9N A;  5GJV B;  1TWB A;  2F5T X;  4F7U F;  2JM8 A;  2LX9 A;  4PL6 A;  2KRO A;  2RN8 A;  1VQL A;  3RKW A;  1YJ9 Q;  3UA7 A;  5GAM j;  2V26 A;  4CC3 A;  5LJ5 e;  5LJ5 d;  3G71 A;  3OSV A;  2EJG A;  2RJE A;  1BBZ A;  4J9B A;  1JBM A;  4BB7 A;  2JTM A;  2CZ7 B;  1AEY A;  4C92 C;  2QYZ A;  3PE0 A;  4DBQ A;  1WNL A;  2E5K A;  8ATC B;  2RJC A;  5KH6 A;  3S3N A;  4M75 G;  2CZ0 B;  2QDL A;  2X3W D;  4F7U B;  1TTH B;  1M90 U;  4M77 D;  4D8K A;  1PWT A;  1QP3 A;  3MET A;  3JB9 H;  1ZQ1 A;  4JS5 A;  1UHF A;  1O75 A;  2QXF A;  4J9F A;  4JJD A;  3OYY A;  1VQN Q;  3A8G B;  4CI0 C;  2CP5 A;  5KYW A;  2FVU A;  3CCJ T;  3HKS A;  2YUQ A;  2ED0 A;  3CME T;  3FDR A;  2GNC A;  4C5I A;  3H0I A;  1ZLM A;  3OW2 S;  2A36 A;  2YRD A;  1MHN A;  3CCU Q;  3G4S A;  4X9C A;  3JSC A;  5D6X A;  2I2L A;  2E5Q A;  1PM3 A;  1VQ5 T;  1UJY A;  2EYZ A;  1R0B G;  3NMZ C;  2LNH B;  3CC2 T;  1QCN A;  8AT1 B;  1RAD B;  1W1F A;  4FSS A;  2NUP A;  4QQD A;  2X51 A;  2NLU A;  2X35 A;  1K8A U;  3I55 T;  3EGU A;  2FHD A;  3NTH A;  4LDX A;  1WZO A;  2LT4 A;  3V8L A;  1FWZ A;  5FRM A;  2ZPF B;  2K57 A;  1GCP A;  2RNA A;  2DD5 A;  1ZBX A;  4BY6 C;  3LLR A;  3CCQ T;  5GAO p;  3BW1 A;  3JCM c;  1QKW A;  4LE9 A;  4OB2 B;  2YLC A;  4XK8 E;  1VQ8 T;  1HJD A;  2L3S A;  2CH4 W;  1N9S A;  1M3A A;  6AT1 B;  1UGS B;  3PIP A;  4C8Q D;  2EVR A;  2BZY A;  2MWO A;  4C0G A;  3ZBD A;  1PKT A;  3EFO B;  2E41 A;  2EGA A;  4ZGD B;  4FW1 A;  1X2K A;  5HK0 A;  4B9X A;  3L1A A;  1JU5 C;  3LH5 A;  4N4G A;  4BDY A;  1H3Z A;  5GAN 8;  3QZ5 B;  4XTV A;  5CR2 A;  3MJX A;  1M2V B;  3KBG A;  5IHI A;  2JS2 A;  2CP6 A;  1QVG A;  1TS9 A;  3CCS T;  2CZ6 B;  3E1S A;  3TSZ A;  5GAN j;  2DXC A;  4HVV A;  2YUP A;  3H0H A;  4AFU C;  4F7U E;  1KQ2 A;  1CKB A;  4LDV A;  2KXD A;  2KVQ G;  1OZ2 A;  1YJ9 A;  2K79 A;  3REB B;  1GFD A;  2ZZD A;  1OPL A;  4IUQ A;  3PFS A;  2HAX A;  1M1K R;  4O6J A;  1IGQ A;  2IVW A;  5GAM e;  5GAM d;  3GP8 A;  5GMK j;  3RKX A;  2JXB A;  2FRY A;  3HTR A;  4C92 A;  4BE2 A;  1YP5 A;  3JB9 F;  2ENM A;  2B8A A;  3D7S B;  5IXF A;  2QTV A;  3DLM A;  3CC7 A;  4Z8A A;  1I81 A;  1G3T A;  4J6Y A;  1M2V A;  3MEV A;  4Y92 A;  2A3L A;  2RA2 A;  2CDT A;  1VQK A;  1AVZ C;  4XTZ A;  1NPP A;  1Y0M A;  3WVD B;  2NUZ A;  3RMQ A;  1H92 A;  2P0P A;  3CC4 Q;  1KK7 A;  2BE7 D;  5GAO l;  2J05 A;  1FX7 A;  2QQR A;  2K6D A;  2OAW A;  4OF1 A;  4QKU A;  1OEB A;  1VQL T;  2CP2 A;  2L0A A;  2C0I A;  2NWM A;  1SEM A;  1YIT Q;  1VQ4 Q;  4E7S A;  1D3B B;  3QJ6 A;  3VRY A;  4RTY A;  2F2X A;  1YJW T;  2EGC A;  2FZG B;  4HCZ A;  2CSQ A;  4J83 A;  2HZY A;  2H3J A;  4PJO D;  4ELZ C;  1JEG A;  4AG2 C;  2I0N A;  1YIJ T;  1VQM Q;  4RG8 A;  3G6E A;  1B3Q A;  1JJ2 P;  2LC4 A;  1YJN T;  4RTT A;  3GF5 A;  1VQP A;  3FRN A;  2XU8 A;  2RQV A;  2XDB A;  3JV3 A;  4A4H A;  1M1G A;  2EJF A;  4J9E A;  1RAE B;  1TUC A;  2O9S A;  3MO8 A;  2PVD B;  2DBM A;  2MI6 A;  1D09 B;  4FCY A;  3FC3 A;  2LQK A;  2XI9 A;  2RM4 A;  3CCR Q;  2PNI A;  2QQ9 A;  1BU1 A;  2EYQ A;  3H41 A;  2P4T A;  3OB9 A;  1BI0 A;  1OU8 A;  3TEE A;  3P8D A;  2E65 A;  1S72 A;  4OP0 A;  2HQX A;  2JM9 A;  2MF2 A;  2L5Q A;  2CH4 A;  3I56 T;  3M55 A;  1WQW A;  1KFZ A;  3M0R A;  2D8H A;  3VS3 A;  3CXC S;  3CCJ Q;  2CKK A;  3I5R A;  1GCQ C;  2K3Y A;  3SDZ A;  1PRM C;  3CME Q;  2DPP B;  4KGZ B;  4M77 F;  4D6W A;  3VS0 A;  4GBQ A;  1NYF A;  4E6R A;  3EG3 A;  3PGG A;  1NEG A;  2O4X B;  1VQ5 Q;  3IQL A;  5ECA A;  1Q95 G;  5GAN e;  1Y57 A;  5LJ5 g;  5GAN d;  3OYM A;  3VS1 A;  3CC2 Q;  3UT1 A;  4IUR A;  3VJP A;  2RO0 A;  4A53 A;  2KBT A;  4LNP A;  3I55 Q;  1SSH A;  3L2Z A;  2DIQ A;  4M75 C;  1ZA2 B;  2RHU A;  4M77 B;  3C12 A;  3AT1 B;  3OS0 A;  2QDY B;  4MMK A;  3CCQ Q;  1X6B A;  1NJI R;  2X4X A;  1KC8 R;  3GPL A;  3VUZ A;  2K7A A;  4AFQ C;  1AZG B;  2DRM A;  3KUF A;  1VQ8 Q;  3JCM P;  2VXE A;  3PNW C;  3RER A;  1Z9Z A;  2GFU A;  3CCM A;  3CC4 A;  2BZ8 A;  2HL5 C;  4EDU A;  1E7O A;  3THK A;  1OU9 A;  4EPC A;  3TRE A;  2R5M A;  2G6F X;  2JJ9 A;  4BE1 A;  2BZX A;  2RQU A;  2JUF A;  4JJC A;  3OYK A;  4J7I A;  1MMA A;  3VS4 A;  3HRU A;  4TVR A;  1WHL A;  1RLQ C;  1I0C A;  3OYC A;  1YI2 Q;  3OYH A;  4C8Q F;  2ZPI B;  2DM1 A;  2FO0 A;  1M8V A;  1R8O B;  1KQS A;  2KYM A;  1BCM A;  3JCM e;  1NE8 A;  3CC7 T;  4OMP A;  1I07 A;  3SB2 A;  3TSW A;  2M51 A;  3CCV Q;  4VUB A;  1M1K C;  5I21 A;  2VV5 A;  5EG2 A;  4J5Y A;  3NHN A;  1VQK T;  1ZHI A;  1C0M A;  1VQ9 A;  2QQS A;  4F14 A;  4LUD A;  1PKS A;  2JN0 A;  3JB9 J;  2AZV A;  4AG1 C;  2QGG A;  1ZBJ A;  2LT1 A;  1E6H A;  2X9H A;  3LX7 A;  2DAQ A;  3EGX B;  4C8Q B;  4EMK C;  2JW4 A;  4BI4 A;  1K76 A;  5DY9 A;  3OBY A;  1MV0 B;  1YNZ A;  3CPF A;  2HMA A;  3CQT A;  3HRT A;  4HA8 A;  1QVP A;  3NGP A;  4FYV B;  2BIV A;  3A5Z B;  2CGH A;  1NYG A;  2QQA A;  1YWO A;  1HK9 A;  3CCL T;  1JQQ A;  3G6E T;  4L59 A;  2FPF A;  3HHT B;  3CCJ A;  2DJQ A;  4EMG A;  1VQL Q;  4QVZ A;  1WI7 A;  2M02 A;  2A37 A;  3OYB A;  1ZSZ C;  3O5Z A;  1PHT A;  4M77 E;  1N9R A;  5I2S A;  5FW9 A;  2MWP A;  1E6G A;  4IUP A;  1RUW A;  4OVA A;  2CS7 A;  1TXQ A;  2YXY A;  3CC2 A;  5LJ3 f;  2LJ1 A;  1IRX A;  4L5G A;  5GAM g;  1KG1 A;  4RTV A;  1YJN Q;  2V1Q A;  2ZAE A;  1G3W A;  1OOT A;  3I55 A;  4KUI A;  2PZ1 A;  4JRP A;  3RIR A;  4M75 A;  3BDU A;  3VS5 A;  4PJO F;  1X27 A;  1I4K 1;  4GLM A;  2HNI A;  4OMN A;  4FIB A;  3OYI A;  3A98 A;  2V8K A;  4M7D F;  4LD9 K;  1RAF B;  2WAC A;  1BCO A;  2HSP A;  1H8K A;  3DKM A;  2KYB A;  1SF9 A;  2VGN A;  3G4S Q;  2HL3 A;  3VYH B;  3WVE B;  1WFW A;  1WJQ A;  4DBR A;  5CKH A;  3JB9 D;  3BY7 A;  1CSK A;  4DBF A;  2XMF A;  2DF6 A;  3MEW A;  1VYV A;  2YDL A;  3R6O A;  4PJO B;  1HXD A;  3P8H A;  2QQB A;  2L3Q A;  3OYA A;  3GLX A;  1Q81 U;  1Y96 A;  3EG9 A;  4J6W A;  4M7D B;  4HVU A;  1T3S A;  2XKO C;  3CCS A;  4C8Q E;  3LH0 A;  1HD3 A;  3CEY A;  3OW2 P;  2VWF A;  3CPW P;  5IT9 E;  1YBY A;  1GBR A;  2B86 A;  4XAX B;  3QHS A;  3QZ9 B;  4O5V A;  3L42 A;  4XTX A;  3CCM T;  3M5A A;  4RMO A;  5CCA A;  1S1N A;  4PFO A;  5A2Q E;  2HKQ B;  2MYS A;  3NTI A;  3SFM A;  4ORZ A;  2HEQ A;  3SEM A;  1TU0 B;  2AHJ B;  1NJI C;  1PD1 A;  1KC8 C;  5AT1 B;  3JCM X;  4EMK A;  3JCM W;  4CC2 A;  3M56 A;  2K5I A;  1JB0 E;  4FSX A;  4ELY C;  1O9S A;  2J06 A;  1K1Z A;  1NBE B;  1XOV A;  3M4G A;  1KD1 C;  2OTL T;  1RL2 A;  2IG0 A;  1QVF A;  3X25 B;  1W2B A;  1IRE B;  4OMO A;  4JRQ A;  1ZSZ A; 
#chains in the Genus database with same CATH homology
 1CKB A;  4OMQ A;  1YCS B;  1NM7 A;  2KXD A;  1BK2 A;  3SHW A;  1TUD A;  1NLO C;  2K79 A;  1T3L A;  3REB B;  1GFD A;  1K0X A;  2GQI A;  1U06 A;  3NPF A;  3PVL A;  4RTZ A;  4CC4 B;  1OPL A;  2RF0 A;  5IH2 A;  2IIM A;  4RTW A;  2JXB A;  2FRY A;  2DRK A;  3EG2 A;  2GBQ A;  1YP5 A;  1J3T A;  2CSI A;  2ED1 A;  4DEY A;  2ENM A;  5FWC A;  5IHN A;  4F16 A;  4J9G A;  5IXF A;  3M0Q A;  2RMO A;  4Z8A A;  3I9Q A;  2FEI A;  4Y92 A;  1JXO A;  1IO6 A;  1TG0 A;  2HCK A;  2JT4 A;  1ARK A;  2CDT A;  2DE0 X;  4JZ4 A;  1AVZ C;  1T0J A;  1NLP C;  2KRN A;  1Y0M A;  2LP5 A;  2NUZ A;  3GBQ A;  3U23 A;  1H92 A;  4OML A;  1A0N B;  2J6F A;  2J05 A;  4AFZ C;  2K6D A;  2OAW A;  1OEB A;  2DL7 A;  2EBP A;  1WA7 A;  1M3C A;  2L0A A;  3VS6 A;  2AKL A;  2C0I A;  2NWM A;  2DL5 A;  2MIO A;  1SEM A;  3ULR B;  1CKA A;  2EPD A;  1WYX A;  3VRY A;  4RTY A;  2F2X A;  2EGC A;  1VYU A;  2DL4 A;  2CSQ A;  4R0K A;  2VVK A;  2DVJ A;  2YUO A;  4AG2 C;  1JEG A;  1U5S A;  2I0N A;  3UA6 A;  2P4R A;  1M3B A;  4AFS C;  2J7I A;  1LCK A;  1B3Q A;  1RLP C;  4RTT A;  1X69 A;  4A63 B;  1WDX A;  2BTT A;  2FPD A;  2DIL A;  2RQV A;  3QWX X;  3JV3 A;  1X43 A;  4J9E A;  4Z88 A;  1TUC A;  2O9S A;  4J9H A;  2GTO A;  4HVW A;  2DBM A;  1M27 C;  1AWW A;  2MOX A;  2LJ3 A;  4J9D A;  2PNI A;  2FPE A;  1FYN A;  4JPB W;  1BU1 A;  2L3P A;  3H41 A;  1U3O A;  3M0S A;  1UG1 A;  1UFF A;  3TVT A;  2YSQ A;  4IIM A;  2JM9 A;  2CH4 A;  2J6O A;  2LQN A;  1GL5 A;  1BB9 A;  2RQT A;  1ZSG A;  1ZUK A;  3VS2 A;  2JS0 A;  3M0U A;  1SHF A;  1AWO A;  4D8D A;  1KFZ A;  3M0R A;  2D8H A;  3VS3 A;  2KT8 A;  2C0T A;  1GBQ A;  2H8H A;  2KRS A;  1WXU A;  1X6G A;  3I5R A;  1GCQ C;  1PRM C;  1K0S A;  3FJ5 A;  2A28 A;  3VS0 A;  4GBQ A;  1NYF A;  2DYB A;  4KRT A;  4HCK A;  4E6R A;  1GCQ A;  1YN8 A;  3EG3 A;  1NEG A;  1RI9 A;  1WXT A;  3IQL A;  5ECA A;  2LZ6 B;  3RNJ A;  1QWF A;  1Y57 A;  4Z89 A;  4LUE A;  3VS1 A;  2CUD A;  4ESR A;  2KRM A;  3VRZ A;  2EW3 A;  2KBT A;  2PTK A;  1HSQ A;  1MV3 A;  1H3H A;  4LNP A;  1PNJ A;  1SSH A;  2KGT A;  3VS7 A;  1UHC A;  3PVQ A;  5GJW B;  1UE9 A;  4DEX A;  1JO8 A;  3EG0 A;  1KJW A;  1FMK A;  4JJB A;  1X6B A;  2SEM A;  2K7A A;  1GRI A;  4AFQ C;  1AZG B;  2DRM A;  2CRE A;  1UUE A;  1SRL A;  1W6X A;  1Z9Z A;  4HXJ A;  4RTX A;  1QLY A;  2BZ8 A;  3C0C A;  1QWE A;  1E7O A;  3THK A;  2L2P A;  2OI3 A;  2KEA A;  1SHG A;  2EYW A;  1T0H A;  2G6F X;  1ZUY A;  2BZX A;  2W0Z A;  2FRW A;  2RQU A;  2J6K A;  4M4Z A;  4JJC A;  1NEB A;  1NG2 A;  1QCF A;  3VS4 A;  5HCK A;  3M0T A;  2ABL A;  2O88 A;  2GTJ A;  1K4U S;  1RLQ C;  1I0C A;  2GGR A;  4K11 A;  3EG1 A;  1WX6 A;  2DBK A;  4JZ3 A;  2DM1 A;  2EKH A;  2FO0 A;  2LQW A;  2KYM A;  2DNU A;  2ECZ A;  2KT1 A;  4OMP A;  1I07 A;  3TSW A;  2D0N A;  3UAT A;  2M51 A;  2AKK A;  2AZS A;  2CT4 A;  3NHN A;  1G2B A;  2LMJ A;  2RPN A;  1N5Z A;  1UTI A;  4F14 A;  4LUD A;  1PKS A;  2AZV A;  5IHK A;  5IXB A;  2KXC A;  2ROL A;  2KE9 A;  4AG1 C;  1VYT A;  2LCS A;  5I11 A;  1ZBJ A;  3ZL7 C;  1AD5 A;  3KFV A;  1E6H A;  2D8J A;  1YWP A;  1UGV A;  2O9V A;  3RBB B;  1K9A A;  2EYX A;  2JW4 A;  1K76 A;  1JXM A;  2DX1 A;  5L23 A;  1MV0 B;  1YNZ A;  1KSW A;  4WCI A;  1MUZ A;  1AZE A;  2LX7 A;  3CQT A;  5I22 A;  2FG0 A;  1WXB A;  5EC7 A;  1ABO A;  2D1X A;  4RTU A;  1EFN A;  3NGP A;  1ZUU A;  2JTE A;  2RQW A;  1NYG A;  2YT6 A;  1YWO A;  2EYY A;  1GFC A;  1WIE A;  1JQQ A;  4IIO A;  2FPF A;  2EGE A;  1ABQ A;  2DJQ A;  5GJV B;  2CT3 A;  1WI7 A;  3EHR A;  2A37 A;  2X3X D;  2OJ2 A;  2JM8 A;  2SRC A;  3O5Z A;  1PHT A;  2KRO A;  2RN8 A;  5FW9 A;  3UA7 A;  1E6G A;  4CC3 A;  2K2M A;  4CC7 A;  1Z9Q A;  1PRL C;  1BBZ A;  1RUW A;  4J9B A;  2A08 A;  1AEY A;  2LJ1 A;  1W70 A;  1VA7 A;  1I1J A;  3QWY A;  3PE0 A;  1G83 A;  4RTV A;  2V1Q A;  2E5K A;  3R6N A;  1SPK A;  1OOT A;  2DLP A;  2QDL A;  2F2W A;  2PZ1 A;  2X3W D;  1X2Q A;  1KIK A;  3VS5 A;  2VKN A;  2DL3 A;  1X27 A;  3H0F A;  4GLM A;  1PWT A;  4D8K A;  4OMN A;  4OMM A;  2JMC A;  3A98 A;  1UHF A;  2HSP A;  4J9F A;  4JJD A;  1H8K A;  2M0Y A;  4RUG A;  2KYB A;  5FWB A;  2YUQ A;  2ED0 A;  4LN2 A;  2DMO A;  2GNC A;  1WFW A;  4QT7 A;  3H0I A;  1ZLM A;  2YUN A;  2A36 A;  1CSK A;  2KNB B;  2XMF A;  2DF6 A;  1VYV A;  2YDL A;  4X1V A;  1UJY A;  1OPK A;  3M0P A;  2EYZ A;  2O31 A;  2L3Q A;  2O2O A;  3NMZ C;  2LNH B;  4J9I A;  2ESW A;  4HVU A;  1T3S A;  1AWJ A;  1ZX6 A;  1W1F A;  4FSS A;  2JMA A;  2V1R A;  3REA B;  2LJ0 A;  2EQI A;  1HD3 A;  2VWF A;  4J9C A;  3EGU A;  1OV3 A;  1GBR A;  2B86 A;  4F17 A;  3I35 A;  1GCP A;  2RNA A;  2F2V A;  2K3B A;  1UEC A;  4EIK A;  1UDL A;  1QKW A;  4ZNX A;  1AWX A;  3EHQ A;  4LE9 A;  1S1N A;  1HJD A;  2L3S A;  3UF4 A;  2CH4 W;  2AK5 A;  4ORZ A;  2C0O A;  3I5S A;  1WLP B;  2W10 A;  2HEQ A;  3SEM A;  1M3A A;  1UJ0 A;  2MCN A;  1V1C A;  2EVR A;  2HDA A;  2BZY A;  2CUB A;  4CC2 A;  1PKT A;  2EGA A;  2K9G A;  1AOJ A;  1X2K A;  1JU5 C;  2ROT A;  3LH5 A;  1M8M A;  2KR3 A;  2J06 A;  1K1Z A;  2DL8 A;  5IHI A;  1XOV A;  2JS2 A;  2HBW A;  1M30 A;  2RQR A;  2DA9 A;  3TSZ A;  1SRM A;  1QKX A;  4HVV A;  1B07 A;  4OMO A;  2YUP A;  3H0H A;  4AFU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...