2AZVA

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (calculated without noes)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SH2-SH3 adapter protein drk
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azvA00
1FYNA 1UJYA 2NWMA 4RTVA 3REAB 1GCQA 2YDLA 2YSQA 2OI3A 1QKXA 2QDLA 1W70A 1UG1A 1K9AA 1M3CA 1OV3A 3NPFA 3I35A 2DL7A 2JXBA 4LE9A 1U3OA 2J06A 1TUCA 1GCPA 2CT3A 2ROLA 2YUNA 4E6RA 1SRMA 2HEQA 2DF6A 5IHKA 2DJQA 5GJVB 2CUBA 3H41A 2C0TA 2O9SA 2CSQA 1WX6A 2GNCA 2L3PA 3JV3A 2CDTA 2CSIA 1OOTA 1GCQC 5FW9A 5IXBA 2J6KA 3M0QA 2BTTA 2DL3A 2DNUA 3FJ5A 5EC7A 2FPDA 2ESWA 2W10A 2JMCA 3CQTA 3EG2A 3EHQA 2ED1A 2L2PA 1QKWA 2JT4A 5I11A 1M3AA 2OJ2A 1NM7A 2BZYA 1SEMA 1UGVA 4OMPA 4LNPA 3VS3A 2FG0A 5IH2A 5FWBA 1T0JA 3ZL7C 3UATA 2PTKA 4OMNA 1MV0B 2K6DA 1JXOA 5HCKA 1SPKA 4OMMA 3PVQA 1Y0MA 4CC7A 1GFDA 4HCKA 2F2VA 2O31A 1ZUKA 1NYFA 1H3HA 4RTTA 1PKTA 1YP5A 1K0SA 3VRZA 1T0HA 1OPKA 2I0NA 1CKBA 1K76A 2RQTA 3GBQA 4K11A 3VS4A 2DL8A 1ZBJA 2J6OA 1YWPA 1UE9A 1NEGA 3C0CA 2IIMA 3UA6A 4ORZA 1IO6A 3I5SA 3A98A 1X27A 2RMOA 1KJWA 1V1CA 5L23A 1N5ZA 1ZUYA 1X6BA 1VYUA 2EVRA 2KT1A 2DBKA 2KGTA 1NYGA 2DMOA 2C0OA 3UA7A 2CH4W 1Z9ZA 1QCFA 3EHRA 2D0NA 2MOXA 2OAWA 2M51A 1M30A 3LH5A 1PHTA 4JZ4A 2EGEA 2HBWA 2NUZA 3M0TA 4A63B 2KXDA 2MIOA 5IXFA 2L3SA 1JQQA 1JO8A 1PKSA 1KFZA 4RTZA 1UDLA 1X69A 2DRKA 2JM9A 2EYWA 2FPFA 1ZSGA 2LJ3A 1OPLA 2X3WD 1E7OA 1MV3A 2K7AA 4GBQA 1H92A 2F2WA 2ROTA 2BZ8A 2KXCA 1E6GA 1WXTA 1WI7A 4X1VA 4AFSC 1SHFA 2AZSA 1I07A 2EYYA 2V1QA 1ARKA 2FRYA 2DL4A 2AZVA 1WDXA 2RF0A 3VS6A 4AFQC 1MUZA 4IIMA 1NG2A 1GL5A 1X43A 1AWOA 2RQUA 4JPBW 2EW3A 3SEMA 1J3TA 1AWXA 1FMKA 2HSPA 3NMZC 4EIKA 1PNJA 2XMFA 1RI9A 1XOVA 1YWOA 2FO0A 4AFUC 4LUDA 2D8HA 2RNAA 1UHFA 1VYVA 2LX7A 1Y57A 2CREA 2DX1A 1QLYA 1JEGA 4F14A 3TSZA 2D1XA 3VRYA 5IHNA 2DBMA 1NLOC 2KR3A 2LZ6B 5IHIA 2EYXA 3U23A 4J9HA 1A0NB 1WXUA 2J05A 1M3BA 4FSSA 2LJ1A 2CUDA 1UFFA 3R6NA 1KSWA 4RTXA 2KBTA 4LN2A 2CH4A 1Z9QA 3ULRB 2DVJA 1CSKA 2MCNA 2L0AA 2KNBB 1JXMA 4JJDA 1K0XA 1S1NA 2YUQA 1B3QA 2LQWA 1E6HA 3RBBB 4RTUA 2ECZA 1GBQA 1M8MA 1AWWA 2O88A 1U5SA 1I1JA 2SEMA 2W0ZA 1W1FA 3PVLA 4HVUA 4CC4B 3TVTA 1NLPC 2LP5A 1YN8A 2J6FA 3VS0A 1KIKA 1TUDA 2AK5A 3QWYA 4HVVA 1WXBA 2F2XA 4J9IA 2DRMA 3RNJA 1VYTA 2K3BA 2DYBA 1UHCA 1K1ZA 4IIOA 1JU5C 2KE9A 2B86A 2KT8A 1ZUUA 4DEYA 1SHGA 1PRMC 4OMQA 5FWCA 1X2KA 1BBZA 1AVZC 1UUEA 3SHWA 1NEBA 4HVWA 4CC2A 2LCSA 3I9QA 2JMAA 1TG0A 1CKAA 2J7IA 1ABOA 1U06A 1RLPC 2A28A 2D8JA 2LQNA 1GRIA 4JZ3A 4OMOA 2BZXA 2VVKA 1AZEA 4Z89A 4JJBA 3NHNA 2HCKA 1GFCA 4LUEA 3IQLA 3M0SA 2GTJA 2FPEA 4Z88A 4J9BA 3M0PA 1LCKA 2AKLA 2EKHA 2EBPA 1WFWA 4J9FA 1WYXA 3QWXX 1X6GA 2DLPA 2DL5A 2PNIA 2KEAA 4D8DA 3VS1A 2V1RA 4HXJA 3H0FA 2A36A 3O5ZA 2O9VA 2JS0A 2JS2A 1W6XA 4RTYA 4RUGA 4OMLA 1QWEA 2CT4A 3VS2A 1I0CA 4QT7A 3M0RA 1EFNA 1ABQA 1BK2A 1BB9A 2GBQA 1AZGB 1WA7A 2A37A 2KYBA 4F17A 2KROA 2GGRA 2GTOA 2GQIA 1B07A 3EGUA 2LMJA 2AKKA 2RQRA 4M4ZA 3I5RA 1K4US 4CC3A 4RTWA 2KYMA 4JJCA 2RQWA 2DA9A 2ED0A 2RPNA 4Y92A 1G2BA 1UECA 3VS7A 2LJ0A 4ZNXA 2H8HA 4ESRA 2EYZA 3EG1A 2JM8A 2K79A 2M0YA 4DEXA 1AOJA 1BU1A 4WCIA 4R0KA 3EG3A 1T3SA 2JW4A 4J9GA 2YUPA 2YT6A 1WLPB 2KRNA 3TSWA 2KRMA 2O2OA 5ECAA 2EQIA 1WIEA 2EGAA 1RLQC 2ENMA 2VKNA 1SRLA 3KFVA 2DM1A 2G6FX 4KRTA 2X3XD 2FEIA 2P4RA 3H0HA 2KRSA 1HD3A 1UTIA 4AG1C 1GBRA 1AD5A 2LNHB 1H8KA 4J9CA 1T3LA 4GLMA 2K2MA 1G83A 1VA7A 4AFZC 2E5KA 1ZX6A 2A08A 1M27C 3THKA 2DE0X 3VS5A 2YUOA 1AWJA 3M0UA 1QWFA 1SSHA 2VWFA 1HJDA 2RQVA 3PE0A 4Z8AA 3EG0A 1YCSB 2FRWA 1PWTA 1RUWA 3H0IA 1AEYA 2SRCA 5I22A 1YNZA 2DILA 3UF4A 2JTEA 1OEBA 2L3QA 3NGPA 1UJ0A 3REBB 2K9GA 4J9EA 4F16A 2ABLA 4J9DA 1HSQA 2RN8A 1PRLC 5GJWB 4D8KA 2EGCA 1ZLMA 2EPDA 2HDAA 2PZ1A 4AG2C 1X2QA 2C0IA
chains in the Genus database with same CATH superfamily
1N9SA 1WJQA 1EX4A 2WACA 5C6SA 1ZSZB 2OI3A 4C8QG 2QGFB 2QDLA 3TU4K 2JXBA 2PVOB 4LE9A 5LJ5d 3JB9F 1YIJT 3OQ5A 2CT3A 2HEQA 2XDPA 3SD4A 2DF6A 2QA4T 3I56Q 2CUBA 2RI5A 2M02A 3H41A 2L3PA 5CKEA 2BE9B 3JV3A 3PFSA 2X4YA 1YJNA 5CO7A 2RHIA 4DBHA 5FW9A 2XICA 2VXEA 3JB9H 4O6JA 2DNUA 1NJIR 1NBEB 1YI2A 2DIGA 4JUVA 2ZAEA 4UC4A 2ESWA 4PFZA 4QKUA 1VQKA 1Q86C 1YJWA 4OVAA 5DY9A 4C92C 1QKWA 2JT4A 2CP7A 5LJ3f 2BZYA 1UGVA 4LNPA 3VS3A 2FG0A 4IUTA 1WZOA 3OYFA 1KC8C 3VJPA 3JCMf 3DLLA 1YFNA 1MV0B 3CXCA 2X4WA 5AYFA 2JN0A 2LNVA 1C0MA 2CYZB 1Y0MA 2K5IA 1OQKA 2QQSA 4CC7A 5GANh 1QVFS 1ZUKA 3M5AA 1K8AU 1PKTA 3A8HB 2DETA 4L6V5 3CCVQ 1T0HA 1OPKA 3LX7A 3I56T 1CKBA 1K76A 2LT1A 3BY7A 5I21A 4K11A 1G3YA 5GANj 1Q82U 3CMEQ 1BI3A 2VGMA 1LJOA 1UE9A 3C0CA 3I5SA 4HT9A 3A98A 3OYNA 2E4HA 1IREB 5GAN2 1V1CA 3JCMQ 1N5ZA 5IAYA 5KYXB 1X6BA 2E1HA 1PSEA 1PC0A 1UB4A 2CH4W 1Z9ZA 3OS0A 3N5BB 3EHRA 2D0NA 2HL3A 2MOXA 2RHXA 3OB9A 2M51A 1QCNA 5FU6C 4JLIA 3WXMB 3ER0A 1MMAA 3OYDA 1Y7XA 3OS1A 2V8JA 3HRSA 3CCEA 1JQQA 4C0DC 4BD3A 5CCAA 4RTZA 1YITQ 2OTJA 1X69A 4XU1A 2JM9A 1Y96B 3CCVT 3VU3C 2ZPGB 1XNIA 1UEBA 5CQYA 2E41A 5I2MA 5KYNA 5FRMA 1E6GA 2DTIA 3CMET 3MJXA 1DJ7B 1G8XA 4JJNK 1HXDA 2EYYA 2V1QA 3GNFB 3V8KA 2WSCE 2AZVA 2OTLA 2RF0A 2YRVA 4XTWA 1WHJA 4M7DF 5GANf 1H3ZA 4AFQC 2X51A 3HL8A 1YJNQ 1QVGP 1NG2A 1GL5A 2RQUA 2EW3A 3SEMA 1J3TA 1TXQA 4FYXB 2HSPA 4EIKA 1YWOA 4AFUC 4LUDA 1VOMA 3A8GB 3P8HA 1VYVA 1VQKQ 3G6EA 1YJWQ 3EG9A 4F14A 3TSZA 3VRYA 5IHNA 1NLOC 2QGGA 4A54A 2XK0A 1M90R 4C92B 3U23A 1YITT 1A0NB 4OF1A 2CP0A 4FSSA 5LJ5j 3EFSA 2CUDA 1KSWA 4EPCA 1K9MU 1B34B 1KQ2A 4JJDA 4B9WA 1K0XA 4PLIA 4N4GA 4E7JA 2R57A 5CAIA 3C12A 1Q95G 5KYYB 2OAUA 2DD4A 1D1AA 3NTKA 2O88A 4M77F 4EMHA 2X9HA 3CCUA 3G4SA 4VUBA 5IN1A 4RKUE 1JB0E 1TOVA 3PVLA 4BUGA 1YJNT 1IZ6A 4Q5WA 1YN8A 2J6FA 3VS0A 3OW2P 1BIBA 3QWYA 3JCMc 2MWOA 4HVVA 2CZ0B 4M7AD 1VYTA 3SWNA 1BI0A 4M75A 4L5GA 1UHCA 1VQKT 1YJWT 2RHUA 5KE2A 3OBYA 2FB7A 2B86A 2QK0A 4PKCC 3RERA 1SHGA 1HYOA 4C92G 4RCBA 3JCMV 5FWCA 3HFNA 3C94A 4C5EA 2RHZA 3QHSA 4ELYC 4CC2A 3CCEQ 2HNIA 1I5LA 1U06A 2OTJQ 4C0DB 4LD9K 5CR2A 5GAMe 3VV0A 4JZ3A 4KGVB 4OMOA 3UT1A 5LJ5f 2E6ZA 4Z89A 4JJBA 1V76A 3NHNA 2NUPB 4A4KA 2GTJA 2O4XB 4PJOE 1PM3A 2E70A 2E64A 2MF2A 2LRQA 3E19A 2E6NA 3A8OB 1M4ZA 2EBPA 3LGLA 4O5VA 2BE7D 4OGEA 3L42A 3QWXX 3FLGA 5KE3A 2PNIA 3FDRA 2KEAA 1OULA 1I81A 4HXJA 1I5OB 3QDRB 3EFRA 4QVCA 4RUGA 1QWEA 2NUTA 2ZCFB 1EFNA 4C5IA 2A37A 2P0PA 2M16A 4F7UF 2FZKB 3CCET 3X26B 2GGRA 2GTOA 2QEXA 2GQIA 5HKCA 2OTJT 3I5RA 1K4US 1Q81C 2JJ9A 5IT9E 4JJCA 3HRUA 2QXFA 3OYHA 2RPNA 1B7TA 4M78D 2VC8A 5M9OA 3UWNA 1NPPA 2FVUA 2EYZA 3TCJA 3EG1A 2M0OA 4DEXA 5GAMg 4WCIA 3A8LB 3JCMJ 3CCUQ 3G4SQ 2YUPA 2YRCA 2YT6A 4OB2B 5HY6A 5GMKl 5KYUB 3HRTA 2EKOA 4QQ6A 3OW2A 4E7HA 1RLQC 2VKNA 4FSXA 1W2BS 3EFOA 3KFVA 2G6FX 4OB0B 4XAXB 2P0KA 4KBMB 3M4YA 1VQ8A 2DERA 1H8KA 1VQ7A 2FHDA 5CKFA 4AFZC 4JS4A 2E5KA 1XQHA 4E7KA 2YUOA 1SSHA 3M59A 4NS5A 1MHNA 2FRWA 1PWTA 1SKUB 2DFUA 3URGA 1AEYA 4OB3B 5I22A 2DILA 3UF4A 5A2QE 2K9GA 3V7RA 2ABLA 4KUDK 2QASA 2EQUA 2CP3A 3FEOA 1D0ZA 2EPDA 4FW1A 3CCUT 3G4ST 3JB9D 4AG2C 2FZCB 4XU2A 3OYMA 4C8QE 1M1KC 1WHHA 2NWMA 5GAOr 4HCCA 5L8RE 2EQMA 4AMCA 4LXCA 1K9AA 1ZQ1A 1U3OA 2J06A 1TUCA 1SRMA 2QQBA 3JAME 5IHKA 1WHMA 1RADB 1TWBA 2K57A 2X4JA 4E7LA 1QP3A 4EMGA 2C0TA 1WX6A 2GNCA 2XG8D 2QEXQ 1GCQC 1D0XA 2J6KA 3M0QA 4A53A 2DL3A 4C0GA 4FT4A 3OMGA 3FJ5A 2XDBA 4QW2A 2YWWA 1S72A 1OZ2A 3AHUA 1Q86U 2K4YA 3KBGA 4C0FA 4F04B 2MK5A 1N27A 4M75F 3RDVA 2ED1A 4XTZA 1JJ2S 5KH6A 2L2PA 2QI2A 4M7AC 3S3MA 1OYXA 4LDWA 1SEMA 2QAZA 4OMPA 1PCXA 3INZA 5FWBA 4L59A 1KC8U 1Q7YU 4PJOA 3UATA 2K6DA 1JXOA 1VQ4A 2L3RA 2R5MA 2HKQB 5GAN8 4OMMA 1VQ6A 5D7UA 4IUQA 1WQWA 3OYBA 4HCKA 2O31A 1BI1A 1NYFA 1ZHIA 2K5LA 4JRQA 1H3HA 1YP5A 4YTLA 1VQNA 1K0SA 3GF5A 1VQ8Q 3J80E 1W4SA 1VQ7Q 1K73R 2DL8A 2LVMA 2J6OA 1NEGA 2IIMA 4BE2A 2QEXT 4ORZA 1IO6A 3VYGA 2RMOA 2RHYA 1KJWA 1TSFA 3VUZA 1YJ9A 5GAN4 2C0OA 2KI7A 3UA7A 4LDYA 2ZPBB 3QDFA 1QCFA 4IKFA 1HK9A 2Y4YA 3QZ5B 3CCRA 2ATCB 3G71A 3LH5A 2D6FA 2JTFA 5A0LA 2NUZA 1BKBA 3FIFA 1WGSA 4A63B 4FM4B 4PK4A 3A5ZB 2MIOA 3CC4A 2JUFA 2HAXA 1KFZA 1X6OA 4PL6A 1MMNA 4FIBA 3DB4A 4M7DD 1ZSGA 4EMKC 3V7CA 2M1HA 2K7AA 1YHQA 1D3BA 1VQ8T 1VQ7T 1WI7A 1SHFA 1WHGA 1I07A 1LOJA 1WQ7A 4A4GA 3PT9A 4M78C 2XD0A 7AT1B 2EQJA 2HQHA 1VIEA 1WPYA 3EGXB 5FLXE 4IIMA 4X9DA 1K8AR 3CPWS 1QVFP 2RH2A 4C5HA 1AWXA 3ZFJA 1FMKA 1I4K1 3CPFA 3NMZC 3OYKA 1PNJA 2XMFA 1RI9A 1Q82R 3MP1A 2FO0A 1WHKA 2WSEE 2D8HA 1S72Q 1UHFA 2LX7A 1Y57A 4XTVA 1JEGA 1SSFA 3EGDB 1G3TA 4ZN1A 1R77A 2D1XA 1U1SA 3TEEA 4MZMA 2F1LA 2LCCA 3LLRA 4M7AB 3TREA 3KXTA 2R5AA 3S3OA 4C8QA 3L2ZA 1MGQA 4XU0A 2EJ9A 2LX9A 4M77D 2LJ1A 4N0AC 3R6NA 5GAN3 3GIBA 3ULRB 1YCYA 2MCNA 2L0AA 3FJPA 5LJ3e 1KQ1A 2QQRA 3WVEB 4CI0C 3RBBB 4RTUA 3JCMe 1AWWA 2WSFE 4F7UA 5GAOm 2SEMA 1IGQA 2OX7A 3CD6Q 2LP5A 1KIKA 4ZGDB 3BDLA 1TUDA 4XQ3A 1WXBA 1IHWA 4JRIA 2DRMA 3RNJA 2XU8A 2LC4A 1D1BA 1S72T 3SB2A 2X35A 2K3BA 2EIFA 4C92E 1Y07A 1K1ZA 4IIOA 4BY6C 3CCRQ 3GNGA 2EAYA 2KT8A 1M9SA 3JCMb 3QXEB 1PRMC 4OMQA 2E3IA 1X2KA 4M7AG 1ZSZA 1AVZC 3SHWA 1NEBA 1IHVA 3CCJA 4MMLA 4ATOA 3CCQA 3FB9A 2LCSA 3PGGA 2JMAA 3CC4Q 3OSSC 2PVDB 2F5KA 4DA4A 3L2WA 3JCMX 4X9CA 2CZ6B 2BZXA 2KVQG 1YHQQ 4EMKB 3UPUA 3X25B 1I8FA 4NL3A 2FPEA 5AT1B 4J9BA 4LDUA 2AKLA 4DBRA 3CD6T 2EKHA 1WFWA 5LJ3g 5KCOA 1WYXA 3L2QA 4PJOF 1QW1A 4M78B 3H9NA 2DLPA 2DL5A 3JCMg 2CS7A 2DD5A 1K9MR 2V1RA 3H0FA 4J83A 1QVFA 3JB9J 2O9VA 1N8RC 2JS0A 2DAQA 1UGQB 3EH2A 3CCRT 2MYSA 1W6XA 1YI2Q 8AT1B 1D0YA 3QJ6A 3P8BB 3M4GA 3VS2A 3QKJA 3GP8A 1I0CA 4QT7A 5GANe 2JZ2A 1ABQA 5CKBA 4QVZA 1WA7A 5GAMh 1PG5B 2KYBA 2KROA 3CC4T 2RB6A 2VXFA 3CBOA 1QMCA 4N4HA 4PNOA 2VASA 4RTWA 2ED0A 4N4IA 4JRPA 1FX7A 4ZGJB 4Y92A 1YHQT 2DEQA 2YLBA 3PMTA 2LJ0A 4ZNXA 2H8HA 1YBYA 4ESRA 1RAAB 2COYA 1UGRB 4XK8E 2C06A 2JM8A 2IVWA 3G1JA 2ZGWA 2FZGB 2DPPB 1BU1A 4DBFA 5KYXA 1M2VB 5C0MA 4J9GA 4M78G 1ZA2B 4LDXA 2KRNA 2KRMA 3DKMA 2NLUA 4ZGEB 1VQ5A 2EQIA 1QVGS 4JLGA 4R56A 2DM1A 4XTUA 1YI2T 1VQPA 1NZ9A 3H0HA 2KY9A 2KRSA 4AG1C 1EIFA 1NJIC 4PJJA 1T3LA 2K2MA 1Q82C 4XTYA 3M58A 1QVPA 1ZX6A 1M27C 4BY6B 3M0UA 1OX8A 1KQSS 3PE0A 1OU8A 4V2SA 4Z8AA 2A3LA 3CCJQ 1Y96A 3EG0A 4ANJA 4FT2A 3CCQQ 1KD1U 2L8DA 2SRCA 5GANg 4ZTFA 3NGPA 1UJ0A 1WNLA 1HSQA 2HDAA 2PZ1A 1M1KU 2O01E 4FCYA 3OYIA 1UJYA 4OGCA 3OS2A 3REAB 2HSEB 2OTLQ 4JRKA 2YSQA 5LJ5e 2Y4XA 4MZTA 1W70A 1UG1A 3MKDA 4C8QF 4WF2A 4HCZA 3NPFA 3JB9G 3I35A 3OA6A 5D6WA 5A0DA 2YUNA 1GCPA 2ROLA 4E6RA 4E2FB 2GQVA 2YHTA 1VQOA 4M77C 4C92A 4RMOA 3G6EQ 3CCJT 1C1AA 3I55A 4M75D 3CCQT 2CDTA 2BTTA 1B34A 2DXCA 2JTMA 3QYHB 3CC7A 4HA8A 1UGPB 5KYYA 2FPDA 2VV5A 1U1TA 3CQTA 2IG0A 3EG2A 5GMKh 4PJMA 3QSUA 3R6OA 4FYWB 3JRZA 2OJ2A 1TH7A 2GF7A 3VKIA 2OTLT 3ZL7C 5GMKj 5GAOq 3E1SA 2PTKA 5HCKA 3OSVA 3EAEA 1VQ5Q 1VQMA 1RACB 2QDYB 2KK4A 2ZPIB 2YLCA 4RTTA 3VRZA 3NTHA 4EDUA 1RL2A 4J7FA 1R0CB 2E12A 3GBQA 2P84A 1PSFA 2EJFA 3VS4A 5LJ5g 3G6ET 1R8OB 2V8IA 1M2OA 1R0BG 1EZZB 4J7IA 1X27A 4M7DB 2E10A 2QTVA 3HFOA 5L23A 1ZUYA 4DBQA 3A1PA 2EVRA 1M90C 2H3EB 4E7IA 1NYGA 2DMOA 4Z02A 3F70A 2O4XA 5CQXA 1G3SA 2OAWA 1M30A 1PHTA 5EG2A 2K2VA 1MMGA 1KHIA 4II1A 4BACA 3JCMP 2XHCA 2XDDA 2Z0WA 4FYYB 2L3SA 1BI2A 5KYWB 1JO8A 1VQ5T 2X4XA 2MMPA 3GLXA 3MP8A 1UDLA 3X24B 2QG9B 4BI3A 3EH1A 1D09B 2DKGA 4E7SA 1Q86R 1QQJA 3LW5E 2FPFA 2DYIA 1SG5A 2F5TX 2X3WD 5DLQE 1E7OA 3BE3A 2F2WA 2ROTA 2BZ8A 1JJ2P 1WXTA 3VYHB 4QQGA 4AFSC 2K3XA 1KC8R 1Q7YR 2GFAA 6AT1B 1ARKA 2FRYA 1WDXA 4M7DG 1OI1A 4M77B 3DLMA 1BYMA 3I55Q 1TS9A 1PD1A 1ACMB 1X43A 3MCAB 3CCSA 1AWOA 4JPBW 3CC2A 4X34A 3CC7Q 3I56A 4DOWA 5LL6S 1OX9A 2RNAA 2DX1A 2CREA 3M9QA 1QLYA 2HD0A 1RAGB 2DBMA 5KYUA 2KR3A 2LZ6B 2EYXA 3MPUB 3WVDB 1WXUA 1M3BA 4IUUA 4XTXA 4RTXA 2HL5C 5HK0A 2RI3A 1VQMQ 1CSKA 2KNBB 2A0FB 1S1NA 2DTHA 2YUQA 4J5YA 4OB1B 4ELZC 2ECZA 2CP6A 3UDCA 2RJFA 1M8MA 4M77G 3M53A 1RAHB 1U5SA 3I55T 1O9SA 4B9XA 1FMWA 1TU0B 3DB3A 8ATCB 4D6WA 4PFOA 4HVUA 3TVTA 2BIVA 1BCOA 3E2UA 2AK5A 4J9IA 2RJEA 3CC7T 2H3JA 4C5GA 3SFMA 2DYBA 4MDWA 3C4SA 3OY9A 4M7AE 3CMEA 2FL7A 2RI2A 3CBPA 5J26A 3SDZA 4GLKA 1QCOA 2LDMA 3QJYA 4J6XA 1BBZA 4OMFB 4C92F 2Y90A 2BKDN 2CZ1B 3LWHA 4F7UB 1WJSA 5LJ3h 2EQKA 3FRNA 3I9QA 1TG0A 3CXCS 2J7IA 4QQDA 1VQMT 3CPWP 1RLPC 2A28A 1LNXA 3JCMh 2D8JA 3SWNC 5LJ3j 4M75C 2VVKA 3QBYA 2PQWA 4PJOD 1JJ2A 5GAMd 3G7ZA 1P92A 4LD6A 1GFCA 3IQLA 5HK3A 3M0SA 1IRXA 2AT1B 1RABB 3M0PA 2XKOC 3ME9A 2FYKA 2EYQA 3CEYA 1YITA 3QIIA 2BUDA 1MNEA 4J9FA 1XJWB 3X28B 1NPRA 3VS1A 2A36A 1N8RU 1OZ3A 3V8JA 2LT4A 3CCSQ 2JS2A 4BDYA 3HHTB 3CC2Q 4RTYA 3QPHA 4HT8A 1M1FA 4OMLA 5D6XA 3A8MB 3X20B 2E5QA 3M0RA 2KAFA 1BK2A 1QP2A 1IGUA 2GBQA 4F7UG 2K5FA 4F17A 5GAN6 1B07A 2DK3A 3EGUA 3BW1A 1BIAA 2AKKA 4M75E 1LVKA 3PNWC 3PIOA 2RQRA 3MEVA 4BE1A 4CC3A 2KYMA 2D0QB 2DA9A 1VQ4Q 1G2BA 3E9GA 1UECA 3VS7A 1VQ6Q 1LPLA 1VQ9A 3L1AA 1VUBA 3BFMA 2RO0A 4M78E 1VQNQ 4J6YA 1SF9A 3T9NA 2M0YA 3QO3A 1TTHB 4Y28E 1Q7YC 2AHJB 4R0KA 2PUKB 1T3SA 2JW4A 3EG9B 1ZA1B 3RESA 3O8VA 1WLPB 2DZCA 3RKYA 3OYYA 5ECAA 4P5NA 1WIEA 2EGAA 2ENMA 3CCST 1YJ9Q 4KRTA 2X3XD 3CC2T 1NJIU 1UTIA 2KDSA 2JOYA 1AD5A 2LNHB 4PJNA 4E7ZA 4GLMA 1GXIE 1G83A 1VA7A 4FYVB 2KSSA 4FL6A 5GAOl 3G71Q 2A08A 3AT1B 3THKA 3QG1A 2QTXA 2RQVA 4TVRA 4Y91A 4C0ZA 4MMKA 1YCSB 2P0QA 1RUWA 1VQ4T 3H0IA 4WTOB 3HKSA 3GPLA 3CPWA 3BDUA 5A0GA 1VQ6T 2RD1A 3JSCA 4LDVA 2JTEA 3H6ZA 2HZYA 2RA2A 3REBB 4J9EA 4F16A 1VQNT 1RAEB 3MO8A 3SWNB 4M75B 4C8QD 2RN8A 1PRLC 5GJWB 3S3NA 4D8KA 2EGCA 3C95A 2DTOA 4A4HA 2O9SA 1X2QA 1Q81R 3EGXA 1K73C 1FYNA 2LQKA 4RTVA 2K3YA 1GCQA 4PFPA 3J7AF 4DOVA 2YDLA 1YJ9T 2DXBA 1QKXA 3ASKA 1M3CA 1OV3A 2DL7A 2MPXC 2EFIA 3HSBA 3EGDA 3OBWA 3G71T 2CKKA 2DJQA 5GJVB 4M7AA 9ATCB 2RK1A 1X01A 2CSQA 3MP6A 3NFCA 2CSIA 5J3BA 2RJCA 1OOTA 3V8LA 5IXBA 1M5Q1 1Q81U 5CIUA 3QYGB 3MEWA 5GAMj 3CMAA 2QQAA 5EC7A 2MWPA 3OYAA 4IUVA 2W10A 4HCBA 2JMCA 4M75G 4CRIA 3EHQA 2COWA 1VQ9Q 3CCLA 5I11A 5LJ5h 1H641 1M3AA 2HQXA 1NM7A 3LWIA 1KQSP 4KH1B 5IH2A 1MMDA 1T0JA 4A4FA 3V7SA 1KD1R 2NUTB 4OMNA 4KGZB 2MI6A 1SPKA 3KUFA 2P4TA 3D7SB 1Y71A 3PVQA 4IUPA 5GAOp 1GFDA 2F2VA 3LYIA 3NTIA 2QYZA 4KULA 3M57A 3HPWA 1K8AC 2I0NA 5GAN7 2RQTA 4MZPA 4RG8A 2ZPEB 1M1KR 1JBMA 1ZBJA 1YWPA 4M7DC 3UA6A 4PJOC 1KG1A 2HKNA 5DLOA 2CP5A 1M90U 3LGFA 1N6AA 1VYUA 2KT1A 2DBKA 1AT1B 4JDSA 2KGTA 4PLLA 4EMKA 5CKHA 2LCLA 1VQ9T 1XTDA 2M9UA 3OYLA 2RJDA 2VYTA 4FW2A 5GAMf 3EFOB 4JZ4A 2EGEA 2E3HA 2PU9B 2HBWA 4PJLA 1X75C 4M78A 3M0TA 2LTOA 2L89A 5FU6B 2RM4A 2KXDA 2DVEA 2DJZA 5IXFA 3RKXA 3OYEA 3L2VA 1O75A 1PKSA 2JNGA 1FXXA 2DRKA 4NL2A 4BE0A 3OW2S 4DQ2A 2COZA 2JVVA 1M1GA 2EYWA 2LJ3A 5I2SA 1OPLA 3L2RA 1MV3A 4GBQA 1H92A 3J81E 2KXCA 4M7DE 5FU7C 3Q1JA 4X1VA 4KH0B 2A7YA 2AZSA 2DL4A 3MEAA 3P8DA 2E65A 3JCMW 2VUBA 3CCMA 3VS6A 4BB7A 1MUZA 1ZBXA 1QVGA 4GY5A 4N0AA 3S6WA 4IURA 1N9RA 4KGXB 1RI0A 1W2BP 3E9FA 4NOYA 2LQ8A 3CMAQ 3H8ZA 1XOVA 1TUGB 3RR6A 1AHJB 1M2VA 2PUOB 3CCLQ 2HBPA 3PMIA 1KQSA 4J6WA 5IHIA 4BI8B 2QQ9A 4J9HA 1F1BB 1VQLA 5D6YA 2J05A 1RAFB 5GMKm 1UFFA 2KBTA 4LN2A 2CH4A 1Z9QA 2DVJA 2ZZDA 5DM7R 1JXMA 4M77E 1WHLA 3OYGA 4AT1B 1K9MC 2D9TA 3OMCA 1B3QA 2LQWA 1IB8A 3QZ9B 1VQPQ 1E6HA 2EJGA 1GBQA 1UGSB 5LJ3d 2KMTA 1KK7A 1I1JA 2PVGB 2G3RA 5GAN5 3M56A 2W0ZA 3JCMd 1W1FA 4CC4B 2VB6A 1NLPC 3RMQA 4B6MA 4C8QC 2R58A 1WJRA 4PJOB 4C92D 3CMAT 4RCCA 2V26A 2F2XA 4E47A 5KCHA 3TQ7P 3RIRA 2MAMA 2DXUA 2HQEA 2NUPA 1YIJA 4KUIA 3CCLT 5J39A 1JU5C 2KE9A 2F69A 1ZUUA 2AIRB 2QA4A 4DEYA 3GOXA 3M54A 2NYSA 1FMVA 4JS5A 1VIFA 1UUEA 4M7AF 4HVWA 1KHCA 1KD1C 1MNDA 1CKAA 1ABOA 5FRNA 2LQNA 2DO3A 1GRIA 3META 1VQPT 1AZEA 2XIDA 2GFUA 2HCKA 4LUEA 5CVIA 3LH0A 4Z88A 3RMSA 1VQOQ 2ZPHB 5FU7B 5CKDA 1LCKA 1ZSZC 1D1CA 5GMKe 3CBMA 3CCMQ 4PJOG 4BDZA 4QVDA 2DEUA 2DIQA 1X6GA 3L2UA 3OYJA 4D8DA 1C6VX 1JRIA 1NE8A 1W2BA 3O5ZA 3FC3A 2XI9A 1M8VA 4F7UE 2CT4A 2B8AA 1PD0A 1D3BB 4A4EA 1G3WA 2IPOB 2KQWA 1BB9A 1AZGB 4BI4A 5GANd 3PTAA 2LMJA 1IXDA 2ZPFB 3PIPA 4M4ZA 1VQLQ 4XU3A 2RQWA 2YXYA 3ZEHA 2I2LA 2YRDA 2GCXA 3VUBA 1VQOT 2CP2A 2K79A 4M7DA 4OP0A 1AOJA 3CCMT 4R55A 2VGNA 5GMKi 3EG3A 1RAIB 5GAOn 4M78F 3CXCP 3TSWA 2O2OA 1FWZA 2L5QA 1SRLA 2CGHA 4C8QB 3CCVA 3MHXA 2FEIA 2P4RA 2CZ7B 2EWNA 1HD3A 1GBRA 4J8OA 3HP9A 4J9CA 1YIJQ 3JB9I 3RUXA 5KYWA 4HKEA 3QUIA 1V29B 3MEUA 2QA4Q 3VS5A 2DE0X 3OS5A 3CD6A 1AWJA 1QWFA 2VWFA 1HJDA 1G5VA 4FU6A 1VQLT 3RKWA 5FROA 1U8RA 3ZBDA 1N8RR 5CK9A 4MDXA 1YNZA 2HMAA 4KT0E 1OEBA 2L3QA 4ZN3A 2V8KA 3M55A 2RK2A 4J9DA 2DXTA 2DZ9A 4M77A 3HTRA 1OU9A 1ZLMA 1BCMA 4ZTJA 4RG2A 2C0IA 4ME7A 1K73U 3OYCA
chains in the Genus database with same CATH topology
1FYNA 1UJYA 2NWMA 4RTVA 3REAB 1GCQA 2YDLA 2YSQA 2OI3A 1QKXA 2QDLA 1W70A 1UG1A 1K9AA 1M3CA 1OV3A 3NPFA 3I35A 2DL7A 2JXBA 4LE9A 1U3OA 2J06A 1TUCA 1GCPA 2CT3A 2ROLA 2YUNA 4E6RA 1SRMA 2HEQA 2DF6A 5IHKA 2DJQA 5GJVB 2CUBA 3H41A 2C0TA 2O9SA 2CSQA 1WX6A 2GNCA 2L3PA 3JV3A 2CDTA 2CSIA 1OOTA 1GCQC 5FW9A 5IXBA 2J6KA 3M0QA 2BTTA 2DL3A 2DNUA 3FJ5A 5EC7A 2FPDA 2ESWA 2W10A 2JMCA 3CQTA 3EG2A 3EHQA 2ED1A 2L2PA 1QKWA 2JT4A 5I11A 1M3AA 2OJ2A 1NM7A 2BZYA 1SEMA 1UGVA 4OMPA 4LNPA 3VS3A 2FG0A 5IH2A 5FWBA 1T0JA 3ZL7C 3UATA 2PTKA 4OMNA 1MV0B 2K6DA 1JXOA 5HCKA 1SPKA 4OMMA 3PVQA 1Y0MA 4CC7A 1GFDA 4HCKA 2F2VA 2O31A 1ZUKA 1NYFA 1H3HA 4RTTA 1PKTA 1YP5A 1K0SA 3VRZA 1T0HA 1OPKA 2I0NA 1CKBA 1K76A 2RQTA 3GBQA 4K11A 3VS4A 2DL8A 1ZBJA 2J6OA 1YWPA 1UE9A 1NEGA 3C0CA 2IIMA 3UA6A 4ORZA 1IO6A 3I5SA 3A98A 1X27A 2RMOA 1KJWA 1V1CA 5L23A 1N5ZA 1ZUYA 1X6BA 1VYUA 2EVRA 2KT1A 2DBKA 2KGTA 1NYGA 2DMOA 2C0OA 3UA7A 2CH4W 1Z9ZA 1QCFA 3EHRA 2D0NA 2MOXA 2OAWA 2M51A 1M30A 3LH5A 1PHTA 4JZ4A 2EGEA 2HBWA 2NUZA 3M0TA 4A63B 2KXDA 2MIOA 5IXFA 2L3SA 1JQQA 1JO8A 1PKSA 1KFZA 4RTZA 1UDLA 1X69A 2DRKA 2JM9A 2EYWA 2FPFA 1ZSGA 2LJ3A 1OPLA 2X3WD 1E7OA 1MV3A 2K7AA 4GBQA 1H92A 2F2WA 2ROTA 2BZ8A 2KXCA 1E6GA 1WXTA 1WI7A 4X1VA 4AFSC 1SHFA 2AZSA 1I07A 2EYYA 2V1QA 1ARKA 2FRYA 2DL4A 2AZVA 1WDXA 2RF0A 3VS6A 4AFQC 1MUZA 4IIMA 1NG2A 1GL5A 1X43A 1AWOA 2RQUA 4JPBW 2EW3A 3SEMA 1J3TA 1AWXA 1FMKA 2HSPA 3NMZC 4EIKA 1PNJA 2XMFA 1RI9A 1XOVA 1YWOA 2FO0A 4AFUC 4LUDA 2D8HA 2RNAA 1UHFA 1VYVA 2LX7A 1Y57A 2CREA 2DX1A 1QLYA 1JEGA 4F14A 3TSZA 2D1XA 3VRYA 5IHNA 2DBMA 1NLOC 2KR3A 2LZ6B 5IHIA 2EYXA 3U23A 4J9HA 1A0NB 1WXUA 2J05A 1M3BA 4FSSA 2LJ1A 2CUDA 1UFFA 3R6NA 1KSWA 4RTXA 2KBTA 4LN2A 2CH4A 1Z9QA 3ULRB 2DVJA 1CSKA 2MCNA 2L0AA 2KNBB 1JXMA 4JJDA 1K0XA 1S1NA 2YUQA 1B3QA 2LQWA 1E6HA 3RBBB 4RTUA 2ECZA 1GBQA 1M8MA 1AWWA 2O88A 1U5SA 1I1JA 2SEMA 2W0ZA 1W1FA 3PVLA 4HVUA 4CC4B 3TVTA 1NLPC 2LP5A 1YN8A 2J6FA 3VS0A 1KIKA 1TUDA 2AK5A 3QWYA 4HVVA 1WXBA 2F2XA 4J9IA 2DRMA 3RNJA 1VYTA 2K3BA 2DYBA 1UHCA 1K1ZA 4IIOA 1JU5C 2KE9A 2B86A 2KT8A 1ZUUA 4DEYA 1SHGA 1PRMC 4OMQA 5FWCA 1X2KA 1BBZA 1AVZC 1UUEA 3SHWA 1NEBA 4HVWA 4CC2A 2LCSA 3I9QA 2JMAA 1TG0A 1CKAA 2J7IA 1ABOA 1U06A 1RLPC 2A28A 2D8JA 2LQNA 1GRIA 4JZ3A 4OMOA 2BZXA 2VVKA 1AZEA 4Z89A 4JJBA 3NHNA 2HCKA 1GFCA 4LUEA 3IQLA 3M0SA 2GTJA 2FPEA 4Z88A 4J9BA 3M0PA 1LCKA 2AKLA 2EKHA 2EBPA 1WFWA 4J9FA 1WYXA 3QWXX 1X6GA 2DLPA 2DL5A 2PNIA 2KEAA 4D8DA 3VS1A 2V1RA 4HXJA 3H0FA 2A36A 3O5ZA 2O9VA 2JS0A 2JS2A 1W6XA 4RTYA 4RUGA 4OMLA 1QWEA 2CT4A 3VS2A 1I0CA 4QT7A 3M0RA 1EFNA 1ABQA 1BK2A 1BB9A 2GBQA 1AZGB 1WA7A 2A37A 2KYBA 4F17A 2KROA 2GGRA 2GTOA 2GQIA 1B07A 3EGUA 2LMJA 2AKKA 2RQRA 4M4ZA 3I5RA 1K4US 4CC3A 4RTWA 2KYMA 4JJCA 2RQWA 2DA9A 2ED0A 2RPNA 4Y92A 1G2BA 1UECA 3VS7A 2LJ0A 4ZNXA 2H8HA 4ESRA 2EYZA 3EG1A 2JM8A 2K79A 2M0YA 4DEXA 1AOJA 1BU1A 4WCIA 4R0KA 3EG3A 1T3SA 2JW4A 4J9GA 2YUPA 2YT6A 1WLPB 2KRNA 3TSWA 2KRMA 2O2OA 5ECAA 2EQIA 1WIEA 2EGAA 1RLQC 2ENMA 2VKNA 1SRLA 3KFVA 2DM1A 2G6FX 4KRTA 2X3XD 2FEIA 2P4RA 3H0HA 2KRSA 1HD3A 1UTIA 4AG1C 1GBRA 1AD5A 2LNHB 1H8KA 4J9CA 1T3LA 4GLMA 2K2MA 1G83A 1VA7A 4AFZC 2E5KA 1ZX6A 2A08A 1M27C 3THKA 2DE0X 3VS5A 2YUOA 1AWJA 3M0UA 1QWFA 1SSHA 2VWFA 1HJDA 2RQVA 3PE0A 4Z8AA 3EG0A 1YCSB 2FRWA 1PWTA 1RUWA 3H0IA 1AEYA 2SRCA 5I22A 1YNZA 2DILA 3UF4A 2JTEA 1OEBA 2L3QA 3NGPA 1UJ0A 3REBB 2K9GA 4J9EA 4F16A 2ABLA 4J9DA 1HSQA 2RN8A 1PRLC 5GJWB 4D8KA 2EGCA 1ZLMA 2EPDA 2HDAA 2PZ1A 4AG2C 1X2QA 2C0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYN A;  1UJY A;  2NWM A;  4RTV A;  3REA B;  1GCQ A;  2YDL A;  2YSQ A;  2OI3 A;  1QKX A;  2QDL A;  1W70 A;  1UG1 A;  1K9A A;  1M3C A;  1OV3 A;  3NPF A;  3I35 A;  2DL7 A;  2JXB A;  4LE9 A;  1U3O A;  2J06 A;  1TUC A;  1GCP A;  2CT3 A;  2ROL A;  2YUN A;  4E6R A;  1SRM A;  2HEQ A;  2DF6 A;  5IHK A;  2DJQ A;  5GJV B;  2CUB A;  3H41 A;  2C0T A;  2O9S A;  2CSQ A;  1WX6 A;  2GNC A;  2L3P A;  3JV3 A;  2CDT A;  2CSI A;  1OOT A;  1GCQ C;  5FW9 A;  5IXB A;  2J6K A;  3M0Q A;  2BTT A;  2DL3 A;  2DNU A;  3FJ5 A;  5EC7 A;  2FPD A;  2ESW A;  2W10 A;  2JMC A;  3CQT A;  3EG2 A;  3EHQ A;  2ED1 A;  2L2P A;  1QKW A;  2JT4 A;  5I11 A;  1M3A A;  2OJ2 A;  1NM7 A;  2BZY A;  1SEM A;  1UGV A;  4OMP A;  4LNP A;  3VS3 A;  2FG0 A;  5IH2 A;  5FWB A;  1T0J A;  3ZL7 C;  3UAT A;  2PTK A;  4OMN A;  1MV0 B;  2K6D A;  1JXO A;  5HCK A;  1SPK A;  4OMM A;  3PVQ A;  1Y0M A;  4CC7 A;  1GFD A;  4HCK A;  2F2V A;  2O31 A;  1ZUK A;  1NYF A;  1H3H A;  4RTT A;  1PKT A;  1YP5 A;  1K0S A;  3VRZ A;  1T0H A;  1OPK A;  2I0N A;  1CKB A;  1K76 A;  2RQT A;  3GBQ A;  4K11 A;  3VS4 A;  2DL8 A;  1ZBJ A;  2J6O A;  1YWP A;  1UE9 A;  1NEG A;  3C0C A;  2IIM A;  3UA6 A;  4ORZ A;  1IO6 A;  3I5S A;  3A98 A;  1X27 A;  2RMO A;  1KJW A;  1V1C A;  5L23 A;  1N5Z A;  1ZUY A;  1X6B A;  1VYU A;  2EVR A;  2KT1 A;  2DBK A;  2KGT A;  1NYG A;  2DMO A;  2C0O A;  3UA7 A;  2CH4 W;  1Z9Z A;  1QCF A;  3EHR A;  2D0N A;  2MOX A;  2OAW A;  2M51 A;  1M30 A;  3LH5 A;  1PHT A;  4JZ4 A;  2EGE A;  2HBW A;  2NUZ A;  3M0T A;  4A63 B;  2KXD A;  2MIO A;  5IXF A;  2L3S A;  1JQQ A;  1JO8 A;  1PKS A;  1KFZ A;  4RTZ A;  1UDL A;  1X69 A;  2DRK A;  2JM9 A;  2EYW A;  2FPF A;  1ZSG A;  2LJ3 A;  1OPL A;  2X3W D;  1E7O A;  1MV3 A;  2K7A A;  4GBQ A;  1H92 A;  2F2W A;  2ROT A;  2BZ8 A;  2KXC A;  1E6G A;  1WXT A;  1WI7 A;  4X1V A;  4AFS C;  1SHF A;  2AZS A;  1I07 A;  2EYY A;  2V1Q A;  1ARK A;  2FRY A;  2DL4 A;  2AZV A;  1WDX A;  2RF0 A;  3VS6 A;  4AFQ C;  1MUZ A;  4IIM A;  1NG2 A;  1GL5 A;  1X43 A;  1AWO A;  2RQU A;  4JPB W;  2EW3 A;  3SEM A;  1J3T A;  1AWX A;  1FMK A;  2HSP A;  3NMZ C;  4EIK A;  1PNJ A;  2XMF A;  1RI9 A;  1XOV A;  1YWO A;  2FO0 A;  4AFU C;  4LUD A;  2D8H A;  2RNA A;  1UHF A;  1VYV A;  2LX7 A;  1Y57 A;  2CRE A;  2DX1 A;  1QLY A;  1JEG A;  4F14 A;  3TSZ A;  2D1X A;  3VRY A;  5IHN A;  2DBM A;  1NLO C;  2KR3 A;  2LZ6 B;  5IHI A;  2EYX A;  3U23 A;  4J9H A;  1A0N B;  1WXU A;  2J05 A;  1M3B A;  4FSS A;  2LJ1 A;  2CUD A;  1UFF A;  3R6N A;  1KSW A;  4RTX A;  2KBT A;  4LN2 A;  2CH4 A;  1Z9Q A;  3ULR B;  2DVJ A;  1CSK A;  2MCN A;  2L0A A;  2KNB B;  1JXM A;  4JJD A;  1K0X A;  1S1N A;  2YUQ A;  1B3Q A;  2LQW A;  1E6H A;  3RBB B;  4RTU A;  2ECZ A;  1GBQ A;  1M8M A;  1AWW A;  2O88 A;  1U5S A;  1I1J A;  2SEM A;  2W0Z A;  1W1F A;  3PVL A;  4HVU A;  4CC4 B;  3TVT A;  1NLP C;  2LP5 A;  1YN8 A;  2J6F A;  3VS0 A;  1KIK A;  1TUD A;  2AK5 A;  3QWY A;  4HVV A;  1WXB A;  2F2X A;  4J9I A;  2DRM A;  3RNJ A;  1VYT A;  2K3B A;  2DYB A;  1UHC A;  1K1Z A;  4IIO A;  1JU5 C;  2KE9 A;  2B86 A;  2KT8 A;  1ZUU A;  4DEY A;  1SHG A;  1PRM C;  4OMQ A;  5FWC A;  1X2K A;  1BBZ A;  1AVZ C;  1UUE A;  3SHW A;  1NEB A;  4HVW A;  4CC2 A;  2LCS A;  3I9Q A;  2JMA A;  1TG0 A;  1CKA A;  2J7I A;  1ABO A;  1U06 A;  1RLP C;  2A28 A;  2D8J A;  2LQN A;  1GRI A;  4JZ3 A;  4OMO A;  2BZX A;  2VVK A;  1AZE A;  4Z89 A;  4JJB A;  3NHN A;  2HCK A;  1GFC A;  4LUE A;  3IQL A;  3M0S A;  2GTJ A;  2FPE A;  4Z88 A;  4J9B A;  3M0P A;  1LCK A;  2AKL A;  2EKH A;  2EBP A;  1WFW A;  4J9F A;  1WYX A;  3QWX X;  1X6G A;  2DLP A;  2DL5 A;  2PNI A;  2KEA A;  4D8D A;  3VS1 A;  2V1R A;  4HXJ A;  3H0F A;  2A36 A;  3O5Z A;  2O9V A;  2JS0 A;  2JS2 A;  1W6X A;  4RTY A;  4RUG A;  4OML A;  1QWE A;  2CT4 A;  3VS2 A;  1I0C A;  4QT7 A;  3M0R A;  1EFN A;  1ABQ A;  1BK2 A;  1BB9 A;  2GBQ A;  1AZG B;  1WA7 A;  2A37 A;  2KYB A;  4F17 A;  2KRO A;  2GGR A;  2GTO A;  2GQI A;  1B07 A;  3EGU A;  2LMJ A;  2AKK A;  2RQR A;  4M4Z A;  3I5R A;  1K4U S;  4CC3 A;  4RTW A;  2KYM A;  4JJC A;  2RQW A;  2DA9 A;  2ED0 A;  2RPN A;  4Y92 A;  1G2B A;  1UEC A;  3VS7 A;  2LJ0 A;  4ZNX A;  2H8H A;  4ESR A;  2EYZ A;  3EG1 A;  2JM8 A;  2K79 A;  2M0Y A;  4DEX A;  1AOJ A;  1BU1 A;  4WCI A;  4R0K A;  3EG3 A;  1T3S A;  2JW4 A;  4J9G A;  2YUP A;  2YT6 A;  1WLP B;  2KRN A;  3TSW A;  2KRM A;  2O2O A;  5ECA A;  2EQI A;  1WIE A;  2EGA A;  1RLQ C;  2ENM A;  2VKN A;  1SRL A;  3KFV A;  2DM1 A;  2G6F X;  4KRT A;  2X3X D;  2FEI A;  2P4R A;  3H0H A;  2KRS A;  1HD3 A;  1UTI A;  4AG1 C;  1GBR A;  1AD5 A;  2LNH B;  1H8K A;  4J9C A;  1T3L A;  4GLM A;  2K2M A;  1G83 A;  1VA7 A;  4AFZ C;  2E5K A;  1ZX6 A;  2A08 A;  1M27 C;  3THK A;  2DE0 X;  3VS5 A;  2YUO A;  1AWJ A;  3M0U A;  1QWF A;  1SSH A;  2VWF A;  1HJD A;  2RQV A;  3PE0 A;  4Z8A A;  3EG0 A;  1YCS B;  2FRW A;  1PWT A;  1RUW A;  3H0I A;  1AEY A;  2SRC A;  5I22 A;  1YNZ A;  2DIL A;  3UF4 A;  2JTE A;  1OEB A;  2L3Q A;  3NGP A;  1UJ0 A;  3REB B;  2K9G A;  4J9E A;  4F16 A;  2ABL A;  4J9D A;  1HSQ A;  2RN8 A;  1PRL C;  5GJW B;  4D8K A;  2EGC A;  1ZLM A;  2EPD A;  2HDA A;  2PZ1 A;  4AG2 C;  1X2Q A;  2C0I A; 
#chains in the Genus database with same CATH topology
 1N9S A;  1WJQ A;  1EX4 A;  2WAC A;  5C6S A;  1ZSZ B;  2OI3 A;  4C8Q G;  2QGF B;  2QDL A;  3TU4 K;  2JXB A;  2PVO B;  4LE9 A;  5LJ5 d;  3JB9 F;  1YIJ T;  3OQ5 A;  2CT3 A;  2HEQ A;  2XDP A;  3SD4 A;  2DF6 A;  2QA4 T;  3I56 Q;  2CUB A;  2RI5 A;  2M02 A;  3H41 A;  2L3P A;  5CKE A;  2BE9 B;  3JV3 A;  3PFS A;  2X4Y A;  1YJN A;  5CO7 A;  2RHI A;  4DBH A;  5FW9 A;  2XIC A;  2VXE A;  3JB9 H;  4O6J A;  2DNU A;  1NJI R;  1NBE B;  1YI2 A;  2DIG A;  4JUV A;  2ZAE A;  4UC4 A;  2ESW A;  4PFZ A;  4QKU A;  1VQK A;  1Q86 C;  1YJW A;  4OVA A;  5DY9 A;  4C92 C;  1QKW A;  2JT4 A;  2CP7 A;  5LJ3 f;  2BZY A;  1UGV A;  4LNP A;  3VS3 A;  2FG0 A;  4IUT A;  1WZO A;  3OYF A;  1KC8 C;  3VJP A;  3JCM f;  3DLL A;  1YFN A;  1MV0 B;  3CXC A;  2X4W A;  5AYF A;  2JN0 A;  2LNV A;  1C0M A;  2CYZ B;  1Y0M A;  2K5I A;  1OQK A;  2QQS A;  4CC7 A;  5GAN h;  1QVF S;  1ZUK A;  3M5A A;  1K8A U;  1PKT A;  3A8H B;  2DET A;  4L6V 5;  3CCV Q;  1T0H A;  1OPK A;  3LX7 A;  3I56 T;  1CKB A;  1K76 A;  2LT1 A;  3BY7 A;  5I21 A;  4K11 A;  1G3Y A;  5GAN j;  1Q82 U;  3CME Q;  1BI3 A;  2VGM A;  1LJO A;  1UE9 A;  3C0C A;  3I5S A;  4HT9 A;  3A98 A;  3OYN A;  2E4H A;  1IRE B;  5GAN 2;  1V1C A;  3JCM Q;  1N5Z A;  5IAY A;  5KYX B;  1X6B A;  2E1H A;  1PSE A;  1PC0 A;  1UB4 A;  2CH4 W;  1Z9Z A;  3OS0 A;  3N5B B;  3EHR A;  2D0N A;  2HL3 A;  2MOX A;  2RHX A;  3OB9 A;  2M51 A;  1QCN A;  5FU6 C;  4JLI A;  3WXM B;  3ER0 A;  1MMA A;  3OYD A;  1Y7X A;  3OS1 A;  2V8J A;  3HRS A;  3CCE A;  1JQQ A;  4C0D C;  4BD3 A;  5CCA A;  4RTZ A;  1YIT Q;  2OTJ A;  1X69 A;  4XU1 A;  2JM9 A;  1Y96 B;  3CCV T;  3VU3 C;  2ZPG B;  1XNI A;  1UEB A;  5CQY A;  2E41 A;  5I2M A;  5KYN A;  5FRM A;  1E6G A;  2DTI A;  3CME T;  3MJX A;  1DJ7 B;  1G8X A;  4JJN K;  1HXD A;  2EYY A;  2V1Q A;  3GNF B;  3V8K A;  2WSC E;  2AZV A;  2OTL A;  2RF0 A;  2YRV A;  4XTW A;  1WHJ A;  4M7D F;  5GAN f;  1H3Z A;  4AFQ C;  2X51 A;  3HL8 A;  1YJN Q;  1QVG P;  1NG2 A;  1GL5 A;  2RQU A;  2EW3 A;  3SEM A;  1J3T A;  1TXQ A;  4FYX B;  2HSP A;  4EIK A;  1YWO A;  4AFU C;  4LUD A;  1VOM A;  3A8G B;  3P8H A;  1VYV A;  1VQK Q;  3G6E A;  1YJW Q;  3EG9 A;  4F14 A;  3TSZ A;  3VRY A;  5IHN A;  1NLO C;  2QGG A;  4A54 A;  2XK0 A;  1M90 R;  4C92 B;  3U23 A;  1YIT T;  1A0N B;  4OF1 A;  2CP0 A;  4FSS A;  5LJ5 j;  3EFS A;  2CUD A;  1KSW A;  4EPC A;  1K9M U;  1B34 B;  1KQ2 A;  4JJD A;  4B9W A;  1K0X A;  4PLI A;  4N4G A;  4E7J A;  2R57 A;  5CAI A;  3C12 A;  1Q95 G;  5KYY B;  2OAU A;  2DD4 A;  1D1A A;  3NTK A;  2O88 A;  4M77 F;  4EMH A;  2X9H A;  3CCU A;  3G4S A;  4VUB A;  5IN1 A;  4RKU E;  1JB0 E;  1TOV A;  3PVL A;  4BUG A;  1YJN T;  1IZ6 A;  4Q5W A;  1YN8 A;  2J6F A;  3VS0 A;  3OW2 P;  1BIB A;  3QWY A;  3JCM c;  2MWO A;  4HVV A;  2CZ0 B;  4M7A D;  1VYT A;  3SWN A;  1BI0 A;  4M75 A;  4L5G A;  1UHC A;  1VQK T;  1YJW T;  2RHU A;  5KE2 A;  3OBY A;  2FB7 A;  2B86 A;  2QK0 A;  4PKC C;  3RER A;  1SHG A;  1HYO A;  4C92 G;  4RCB A;  3JCM V;  5FWC A;  3HFN A;  3C94 A;  4C5E A;  2RHZ A;  3QHS A;  4ELY C;  4CC2 A;  3CCE Q;  2HNI A;  1I5L A;  1U06 A;  2OTJ Q;  4C0D B;  4LD9 K;  5CR2 A;  5GAM e;  3VV0 A;  4JZ3 A;  4KGV B;  4OMO A;  3UT1 A;  5LJ5 f;  2E6Z A;  4Z89 A;  4JJB A;  1V76 A;  3NHN A;  2NUP B;  4A4K A;  2GTJ A;  2O4X B;  4PJO E;  1PM3 A;  2E70 A;  2E64 A;  2MF2 A;  2LRQ A;  3E19 A;  2E6N A;  3A8O B;  1M4Z A;  2EBP A;  3LGL A;  4O5V A;  2BE7 D;  4OGE A;  3L42 A;  3QWX X;  3FLG A;  5KE3 A;  2PNI A;  3FDR A;  2KEA A;  1OUL A;  1I81 A;  4HXJ A;  1I5O B;  3QDR B;  3EFR A;  4QVC A;  4RUG A;  1QWE A;  2NUT A;  2ZCF B;  1EFN A;  4C5I A;  2A37 A;  2P0P A;  2M16 A;  4F7U F;  2FZK B;  3CCE T;  3X26 B;  2GGR A;  2GTO A;  2QEX A;  2GQI A;  5HKC A;  2OTJ T;  3I5R A;  1K4U S;  1Q81 C;  2JJ9 A;  5IT9 E;  4JJC A;  3HRU A;  2QXF A;  3OYH A;  2RPN A;  1B7T A;  4M78 D;  2VC8 A;  5M9O A;  3UWN A;  1NPP A;  2FVU A;  2EYZ A;  3TCJ A;  3EG1 A;  2M0O A;  4DEX A;  5GAM g;  4WCI A;  3A8L B;  3JCM J;  3CCU Q;  3G4S Q;  2YUP A;  2YRC A;  2YT6 A;  4OB2 B;  5HY6 A;  5GMK l;  5KYU B;  3HRT A;  2EKO A;  4QQ6 A;  3OW2 A;  4E7H A;  1RLQ C;  2VKN A;  4FSX A;  1W2B S;  3EFO A;  3KFV A;  2G6F X;  4OB0 B;  4XAX B;  2P0K A;  4KBM B;  3M4Y A;  1VQ8 A;  2DER A;  1H8K A;  1VQ7 A;  2FHD A;  5CKF A;  4AFZ C;  4JS4 A;  2E5K A;  1XQH A;  4E7K A;  2YUO A;  1SSH A;  3M59 A;  4NS5 A;  1MHN A;  2FRW A;  1PWT A;  1SKU B;  2DFU A;  3URG A;  1AEY A;  4OB3 B;  5I22 A;  2DIL A;  3UF4 A;  5A2Q E;  2K9G A;  3V7R A;  2ABL A;  4KUD K;  2QAS A;  2EQU A;  2CP3 A;  3FEO A;  1D0Z A;  2EPD A;  4FW1 A;  3CCU T;  3G4S T;  3JB9 D;  4AG2 C;  2FZC B;  4XU2 A;  3OYM A;  4C8Q E;  1M1K C;  1WHH A;  2NWM A;  5GAO r;  4HCC A;  5L8R E;  2EQM A;  4AMC A;  4LXC A;  1K9A A;  1ZQ1 A;  1U3O A;  2J06 A;  1TUC A;  1SRM A;  2QQB A;  3JAM E;  5IHK A;  1WHM A;  1RAD B;  1TWB A;  2K57 A;  2X4J A;  4E7L A;  1QP3 A;  4EMG A;  2C0T A;  1WX6 A;  2GNC A;  2XG8 D;  2QEX Q;  1GCQ C;  1D0X A;  2J6K A;  3M0Q A;  4A53 A;  2DL3 A;  4C0G A;  4FT4 A;  3OMG A;  3FJ5 A;  2XDB A;  4QW2 A;  2YWW A;  1S72 A;  1OZ2 A;  3AHU A;  1Q86 U;  2K4Y A;  3KBG A;  4C0F A;  4F04 B;  2MK5 A;  1N27 A;  4M75 F;  3RDV A;  2ED1 A;  4XTZ A;  1JJ2 S;  5KH6 A;  2L2P A;  2QI2 A;  4M7A C;  3S3M A;  1OYX A;  4LDW A;  1SEM A;  2QAZ A;  4OMP A;  1PCX A;  3INZ A;  5FWB A;  4L59 A;  1KC8 U;  1Q7Y U;  4PJO A;  3UAT A;  2K6D A;  1JXO A;  1VQ4 A;  2L3R A;  2R5M A;  2HKQ B;  5GAN 8;  4OMM A;  1VQ6 A;  5D7U A;  4IUQ A;  1WQW A;  3OYB A;  4HCK A;  2O31 A;  1BI1 A;  1NYF A;  1ZHI A;  2K5L A;  4JRQ A;  1H3H A;  1YP5 A;  4YTL A;  1VQN A;  1K0S A;  3GF5 A;  1VQ8 Q;  3J80 E;  1W4S A;  1VQ7 Q;  1K73 R;  2DL8 A;  2LVM A;  2J6O A;  1NEG A;  2IIM A;  4BE2 A;  2QEX T;  4ORZ A;  1IO6 A;  3VYG A;  2RMO A;  2RHY A;  1KJW A;  1TSF A;  3VUZ A;  1YJ9 A;  5GAN 4;  2C0O A;  2KI7 A;  3UA7 A;  4LDY A;  2ZPB B;  3QDF A;  1QCF A;  4IKF A;  1HK9 A;  2Y4Y A;  3QZ5 B;  3CCR A;  2ATC B;  3G71 A;  3LH5 A;  2D6F A;  2JTF A;  5A0L A;  2NUZ A;  1BKB A;  3FIF A;  1WGS A;  4A63 B;  4FM4 B;  4PK4 A;  3A5Z B;  2MIO A;  3CC4 A;  2JUF A;  2HAX A;  1KFZ A;  1X6O A;  4PL6 A;  1MMN A;  4FIB A;  3DB4 A;  4M7D D;  1ZSG A;  4EMK C;  3V7C A;  2M1H A;  2K7A A;  1YHQ A;  1D3B A;  1VQ8 T;  1VQ7 T;  1WI7 A;  1SHF A;  1WHG A;  1I07 A;  1LOJ A;  1WQ7 A;  4A4G A;  3PT9 A;  4M78 C;  2XD0 A;  7AT1 B;  2EQJ A;  2HQH A;  1VIE A;  1WPY A;  3EGX B;  5FLX E;  4IIM A;  4X9D A;  1K8A R;  3CPW S;  1QVF P;  2RH2 A;  4C5H A;  1AWX A;  3ZFJ A;  1FMK A;  1I4K 1;  3CPF A;  3NMZ C;  3OYK A;  1PNJ A;  2XMF A;  1RI9 A;  1Q82 R;  3MP1 A;  2FO0 A;  1WHK A;  2WSE E;  2D8H A;  1S72 Q;  1UHF A;  2LX7 A;  1Y57 A;  4XTV A;  1JEG A;  1SSF A;  3EGD B;  1G3T A;  4ZN1 A;  1R77 A;  2D1X A;  1U1S A;  3TEE A;  4MZM A;  2F1L A;  2LCC A;  3LLR A;  4M7A B;  3TRE A;  3KXT A;  2R5A A;  3S3O A;  4C8Q A;  3L2Z A;  1MGQ A;  4XU0 A;  2EJ9 A;  2LX9 A;  4M77 D;  2LJ1 A;  4N0A C;  3R6N A;  5GAN 3;  3GIB A;  3ULR B;  1YCY A;  2MCN A;  2L0A A;  3FJP A;  5LJ3 e;  1KQ1 A;  2QQR A;  3WVE B;  4CI0 C;  3RBB B;  4RTU A;  3JCM e;  1AWW A;  2WSF E;  4F7U A;  5GAO m;  2SEM A;  1IGQ A;  2OX7 A;  3CD6 Q;  2LP5 A;  1KIK A;  4ZGD B;  3BDL A;  1TUD A;  4XQ3 A;  1WXB A;  1IHW A;  4JRI A;  2DRM A;  3RNJ A;  2XU8 A;  2LC4 A;  1D1B A;  1S72 T;  3SB2 A;  2X35 A;  2K3B A;  2EIF A;  4C92 E;  1Y07 A;  1K1Z A;  4IIO A;  4BY6 C;  3CCR Q;  3GNG A;  2EAY A;  2KT8 A;  1M9S A;  3JCM b;  3QXE B;  1PRM C;  4OMQ A;  2E3I A;  1X2K A;  4M7A G;  1ZSZ A;  1AVZ C;  3SHW A;  1NEB A;  1IHV A;  3CCJ A;  4MML A;  4ATO A;  3CCQ A;  3FB9 A;  2LCS A;  3PGG A;  2JMA A;  3CC4 Q;  3OSS C;  2PVD B;  2F5K A;  4DA4 A;  3L2W A;  3JCM X;  4X9C A;  2CZ6 B;  2BZX A;  2KVQ G;  1YHQ Q;  4EMK B;  3UPU A;  3X25 B;  1I8F A;  4NL3 A;  2FPE A;  5AT1 B;  4J9B A;  4LDU A;  2AKL A;  4DBR A;  3CD6 T;  2EKH A;  1WFW A;  5LJ3 g;  5KCO A;  1WYX A;  3L2Q A;  4PJO F;  1QW1 A;  4M78 B;  3H9N A;  2DLP A;  2DL5 A;  3JCM g;  2CS7 A;  2DD5 A;  1K9M R;  2V1R A;  3H0F A;  4J83 A;  1QVF A;  3JB9 J;  2O9V A;  1N8R C;  2JS0 A;  2DAQ A;  1UGQ B;  3EH2 A;  3CCR T;  2MYS A;  1W6X A;  1YI2 Q;  8AT1 B;  1D0Y A;  3QJ6 A;  3P8B B;  3M4G A;  3VS2 A;  3QKJ A;  3GP8 A;  1I0C A;  4QT7 A;  5GAN e;  2JZ2 A;  1ABQ A;  5CKB A;  4QVZ A;  1WA7 A;  5GAM h;  1PG5 B;  2KYB A;  2KRO A;  3CC4 T;  2RB6 A;  2VXF A;  3CBO A;  1QMC A;  4N4H A;  4PNO A;  2VAS A;  4RTW A;  2ED0 A;  4N4I A;  4JRP A;  1FX7 A;  4ZGJ B;  4Y92 A;  1YHQ T;  2DEQ A;  2YLB A;  3PMT A;  2LJ0 A;  4ZNX A;  2H8H A;  1YBY A;  4ESR A;  1RAA B;  2COY A;  1UGR B;  4XK8 E;  2C06 A;  2JM8 A;  2IVW A;  3G1J A;  2ZGW A;  2FZG B;  2DPP B;  1BU1 A;  4DBF A;  5KYX A;  1M2V B;  5C0M A;  4J9G A;  4M78 G;  1ZA2 B;  4LDX A;  2KRN A;  2KRM A;  3DKM A;  2NLU A;  4ZGE B;  1VQ5 A;  2EQI A;  1QVG S;  4JLG A;  4R56 A;  2DM1 A;  4XTU A;  1YI2 T;  1VQP A;  1NZ9 A;  3H0H A;  2KY9 A;  2KRS A;  4AG1 C;  1EIF A;  1NJI C;  4PJJ A;  1T3L A;  2K2M A;  1Q82 C;  4XTY A;  3M58 A;  1QVP A;  1ZX6 A;  1M27 C;  4BY6 B;  3M0U A;  1OX8 A;  1KQS S;  3PE0 A;  1OU8 A;  4V2S A;  4Z8A A;  2A3L A;  3CCJ Q;  1Y96 A;  3EG0 A;  4ANJ A;  4FT2 A;  3CCQ Q;  1KD1 U;  2L8D A;  2SRC A;  5GAN g;  4ZTF A;  3NGP A;  1UJ0 A;  1WNL A;  1HSQ A;  2HDA A;  2PZ1 A;  1M1K U;  2O01 E;  4FCY A;  3OYI A;  1UJY A;  4OGC A;  3OS2 A;  3REA B;  2HSE B;  2OTL Q;  4JRK A;  2YSQ A;  5LJ5 e;  2Y4X A;  4MZT A;  1W70 A;  1UG1 A;  3MKD A;  4C8Q F;  4WF2 A;  4HCZ A;  3NPF A;  3JB9 G;  3I35 A;  3OA6 A;  5D6W A;  5A0D A;  2YUN A;  1GCP A;  2ROL A;  4E6R A;  4E2F B;  2GQV A;  2YHT A;  1VQO A;  4M77 C;  4C92 A;  4RMO A;  3G6E Q;  3CCJ T;  1C1A A;  3I55 A;  4M75 D;  3CCQ T;  2CDT A;  2BTT A;  1B34 A;  2DXC A;  2JTM A;  3QYH B;  3CC7 A;  4HA8 A;  1UGP B;  5KYY A;  2FPD A;  2VV5 A;  1U1T A;  3CQT A;  2IG0 A;  3EG2 A;  5GMK h;  4PJM A;  3QSU A;  3R6O A;  4FYW B;  3JRZ A;  2OJ2 A;  1TH7 A;  2GF7 A;  3VKI A;  2OTL T;  3ZL7 C;  5GMK j;  5GAO q;  3E1S A;  2PTK A;  5HCK A;  3OSV A;  3EAE A;  1VQ5 Q;  1VQM A;  1RAC B;  2QDY B;  2KK4 A;  2ZPI B;  2YLC A;  4RTT A;  3VRZ A;  3NTH A;  4EDU A;  1RL2 A;  4J7F A;  1R0C B;  2E12 A;  3GBQ A;  2P84 A;  1PSF A;  2EJF A;  3VS4 A;  5LJ5 g;  3G6E T;  1R8O B;  2V8I A;  1M2O A;  1R0B G;  1EZZ B;  4J7I A;  1X27 A;  4M7D B;  2E10 A;  2QTV A;  3HFO A;  5L23 A;  1ZUY A;  4DBQ A;  3A1P A;  2EVR A;  1M90 C;  2H3E B;  4E7I A;  1NYG A;  2DMO A;  4Z02 A;  3F70 A;  2O4X A;  5CQX A;  1G3S A;  2OAW A;  1M30 A;  1PHT A;  5EG2 A;  2K2V A;  1MMG A;  1KHI A;  4II1 A;  4BAC A;  3JCM P;  2XHC A;  2XDD A;  2Z0W A;  4FYY B;  2L3S A;  1BI2 A;  5KYW B;  1JO8 A;  1VQ5 T;  2X4X A;  2MMP A;  3GLX A;  3MP8 A;  1UDL A;  3X24 B;  2QG9 B;  4BI3 A;  3EH1 A;  1D09 B;  2DKG A;  4E7S A;  1Q86 R;  1QQJ A;  3LW5 E;  2FPF A;  2DYI A;  1SG5 A;  2F5T X;  2X3W D;  5DLQ E;  1E7O A;  3BE3 A;  2F2W A;  2ROT A;  2BZ8 A;  1JJ2 P;  1WXT A;  3VYH B;  4QQG A;  4AFS C;  2K3X A;  1KC8 R;  1Q7Y R;  2GFA A;  6AT1 B;  1ARK A;  2FRY A;  1WDX A;  4M7D G;  1OI1 A;  4M77 B;  3DLM A;  1BYM A;  3I55 Q;  1TS9 A;  1PD1 A;  1ACM B;  1X43 A;  3MCA B;  3CCS A;  1AWO A;  4JPB W;  3CC2 A;  4X34 A;  3CC7 Q;  3I56 A;  4DOW A;  5LL6 S;  1OX9 A;  2RNA A;  2DX1 A;  2CRE A;  3M9Q A;  1QLY A;  2HD0 A;  1RAG B;  2DBM A;  5KYU A;  2KR3 A;  2LZ6 B;  2EYX A;  3MPU B;  3WVD B;  1WXU A;  1M3B A;  4IUU A;  4XTX A;  4RTX A;  2HL5 C;  5HK0 A;  2RI3 A;  1VQM Q;  1CSK A;  2KNB B;  2A0F B;  1S1N A;  2DTH A;  2YUQ A;  4J5Y A;  4OB1 B;  4ELZ C;  2ECZ A;  2CP6 A;  3UDC A;  2RJF A;  1M8M A;  4M77 G;  3M53 A;  1RAH B;  1U5S A;  3I55 T;  1O9S A;  4B9X A;  1FMW A;  1TU0 B;  3DB3 A;  8ATC B;  4D6W A;  4PFO A;  4HVU A;  3TVT A;  2BIV A;  1BCO A;  3E2U A;  2AK5 A;  4J9I A;  2RJE A;  3CC7 T;  2H3J A;  4C5G A;  3SFM A;  2DYB A;  4MDW A;  3C4S A;  3OY9 A;  4M7A E;  3CME A;  2FL7 A;  2RI2 A;  3CBP A;  5J26 A;  3SDZ A;  4GLK A;  1QCO A;  2LDM A;  3QJY A;  4J6X A;  1BBZ A;  4OMF B;  4C92 F;  2Y90 A;  2BKD N;  2CZ1 B;  3LWH A;  4F7U B;  1WJS A;  5LJ3 h;  2EQK A;  3FRN A;  3I9Q A;  1TG0 A;  3CXC S;  2J7I A;  4QQD A;  1VQM T;  3CPW P;  1RLP C;  2A28 A;  1LNX A;  3JCM h;  2D8J A;  3SWN C;  5LJ3 j;  4M75 C;  2VVK A;  3QBY A;  2PQW A;  4PJO D;  1JJ2 A;  5GAM d;  3G7Z A;  1P92 A;  4LD6 A;  1GFC A;  3IQL A;  5HK3 A;  3M0S A;  1IRX A;  2AT1 B;  1RAB B;  3M0P A;  2XKO C;  3ME9 A;  2FYK A;  2EYQ A;  3CEY A;  1YIT A;  3QII A;  2BUD A;  1MNE A;  4J9F A;  1XJW B;  3X28 B;  1NPR A;  3VS1 A;  2A36 A;  1N8R U;  1OZ3 A;  3V8J A;  2LT4 A;  3CCS Q;  2JS2 A;  4BDY A;  3HHT B;  3CC2 Q;  4RTY A;  3QPH A;  4HT8 A;  1M1F A;  4OML A;  5D6X A;  3A8M B;  3X20 B;  2E5Q A;  3M0R A;  2KAF A;  1BK2 A;  1QP2 A;  1IGU A;  2GBQ A;  4F7U G;  2K5F A;  4F17 A;  5GAN 6;  1B07 A;  2DK3 A;  3EGU A;  3BW1 A;  1BIA A;  2AKK A;  4M75 E;  1LVK A;  3PNW C;  3PIO A;  2RQR A;  3MEV A;  4BE1 A;  4CC3 A;  2KYM A;  2D0Q B;  2DA9 A;  1VQ4 Q;  1G2B A;  3E9G A;  1UEC A;  3VS7 A;  1VQ6 Q;  1LPL A;  1VQ9 A;  3L1A A;  1VUB A;  3BFM A;  2RO0 A;  4M78 E;  1VQN Q;  4J6Y A;  1SF9 A;  3T9N A;  2M0Y A;  3QO3 A;  1TTH B;  4Y28 E;  1Q7Y C;  2AHJ B;  4R0K A;  2PUK B;  1T3S A;  2JW4 A;  3EG9 B;  1ZA1 B;  3RES A;  3O8V A;  1WLP B;  2DZC A;  3RKY A;  3OYY A;  5ECA A;  4P5N A;  1WIE A;  2EGA A;  2ENM A;  3CCS T;  1YJ9 Q;  4KRT A;  2X3X D;  3CC2 T;  1NJI U;  1UTI A;  2KDS A;  2JOY A;  1AD5 A;  2LNH B;  4PJN A;  4E7Z A;  4GLM A;  1GXI E;  1G83 A;  1VA7 A;  4FYV B;  2KSS A;  4FL6 A;  5GAO l;  3G71 Q;  2A08 A;  3AT1 B;  3THK A;  3QG1 A;  2QTX A;  2RQV A;  4TVR A;  4Y91 A;  4C0Z A;  4MMK A;  1YCS B;  2P0Q A;  1RUW A;  1VQ4 T;  3H0I A;  4WTO B;  3HKS A;  3GPL A;  3CPW A;  3BDU A;  5A0G A;  1VQ6 T;  2RD1 A;  3JSC A;  4LDV A;  2JTE A;  3H6Z A;  2HZY A;  2RA2 A;  3REB B;  4J9E A;  4F16 A;  1VQN T;  1RAE B;  3MO8 A;  3SWN B;  4M75 B;  4C8Q D;  2RN8 A;  1PRL C;  5GJW B;  3S3N A;  4D8K A;  2EGC A;  3C95 A;  2DTO A;  4A4H A;  2O9S A;  1X2Q A;  1Q81 R;  3EGX A;  1K73 C;  1FYN A;  2LQK A;  4RTV A;  2K3Y A;  1GCQ A;  4PFP A;  3J7A F;  4DOV A;  2YDL A;  1YJ9 T;  2DXB A;  1QKX A;  3ASK A;  1M3C A;  1OV3 A;  2DL7 A;  2MPX C;  2EFI A;  3HSB A;  3EGD A;  3OBW A;  3G71 T;  2CKK A;  2DJQ A;  5GJV B;  4M7A A;  9ATC B;  2RK1 A;  1X01 A;  2CSQ A;  3MP6 A;  3NFC A;  2CSI A;  5J3B A;  2RJC A;  1OOT A;  3V8L A;  5IXB A;  1M5Q 1;  1Q81 U;  5CIU A;  3QYG B;  3MEW A;  5GAM j;  3CMA A;  2QQA A;  5EC7 A;  2MWP A;  3OYA A;  4IUV A;  2W10 A;  4HCB A;  2JMC A;  4M75 G;  4CRI A;  3EHQ A;  2COW A;  1VQ9 Q;  3CCL A;  5I11 A;  5LJ5 h;  1H64 1;  1M3A A;  2HQX A;  1NM7 A;  3LWI A;  1KQS P;  4KH1 B;  5IH2 A;  1MMD A;  1T0J A;  4A4F A;  3V7S A;  1KD1 R;  2NUT B;  4OMN A;  4KGZ B;  2MI6 A;  1SPK A;  3KUF A;  2P4T A;  3D7S B;  1Y71 A;  3PVQ A;  4IUP A;  5GAO p;  1GFD A;  2F2V A;  3LYI A;  3NTI A;  2QYZ A;  4KUL A;  3M57 A;  3HPW A;  1K8A C;  2I0N A;  5GAN 7;  2RQT A;  4MZP A;  4RG8 A;  2ZPE B;  1M1K R;  1JBM A;  1ZBJ A;  1YWP A;  4M7D C;  3UA6 A;  4PJO C;  1KG1 A;  2HKN A;  5DLO A;  2CP5 A;  1M90 U;  3LGF A;  1N6A A;  1VYU A;  2KT1 A;  2DBK A;  1AT1 B;  4JDS A;  2KGT A;  4PLL A;  4EMK A;  5CKH A;  2LCL A;  1VQ9 T;  1XTD A;  2M9U A;  3OYL A;  2RJD A;  2VYT A;  4FW2 A;  5GAM f;  3EFO B;  4JZ4 A;  2EGE A;  2E3H A;  2PU9 B;  2HBW A;  4PJL A;  1X75 C;  4M78 A;  3M0T A;  2LTO A;  2L89 A;  5FU6 B;  2RM4 A;  2KXD A;  2DVE A;  2DJZ A;  5IXF A;  3RKX A;  3OYE A;  3L2V A;  1O75 A;  1PKS A;  2JNG A;  1FXX A;  2DRK A;  4NL2 A;  4BE0 A;  3OW2 S;  4DQ2 A;  2COZ A;  2JVV A;  1M1G A;  2EYW A;  2LJ3 A;  5I2S A;  1OPL A;  3L2R A;  1MV3 A;  4GBQ A;  1H92 A;  3J81 E;  2KXC A;  4M7D E;  5FU7 C;  3Q1J A;  4X1V A;  4KH0 B;  2A7Y A;  2AZS A;  2DL4 A;  3MEA A;  3P8D A;  2E65 A;  3JCM W;  2VUB A;  3CCM A;  3VS6 A;  4BB7 A;  1MUZ A;  1ZBX A;  1QVG A;  4GY5 A;  4N0A A;  3S6W A;  4IUR A;  1N9R A;  4KGX B;  1RI0 A;  1W2B P;  3E9F A;  4NOY A;  2LQ8 A;  3CMA Q;  3H8Z A;  1XOV A;  1TUG B;  3RR6 A;  1AHJ B;  1M2V A;  2PUO B;  3CCL Q;  2HBP A;  3PMI A;  1KQS A;  4J6W A;  5IHI A;  4BI8 B;  2QQ9 A;  4J9H A;  1F1B B;  1VQL A;  5D6Y A;  2J05 A;  1RAF B;  5GMK m;  1UFF A;  2KBT A;  4LN2 A;  2CH4 A;  1Z9Q A;  2DVJ A;  2ZZD A;  5DM7 R;  1JXM A;  4M77 E;  1WHL A;  3OYG A;  4AT1 B;  1K9M C;  2D9T A;  3OMC A;  1B3Q A;  2LQW A;  1IB8 A;  3QZ9 B;  1VQP Q;  1E6H A;  2EJG A;  1GBQ A;  1UGS B;  5LJ3 d;  2KMT A;  1KK7 A;  1I1J A;  2PVG B;  2G3R A;  5GAN 5;  3M56 A;  2W0Z A;  3JCM d;  1W1F A;  4CC4 B;  2VB6 A;  1NLP C;  3RMQ A;  4B6M A;  4C8Q C;  2R58 A;  1WJR A;  4PJO B;  4C92 D;  3CMA T;  4RCC A;  2V26 A;  2F2X A;  4E47 A;  5KCH A;  3TQ7 P;  3RIR A;  2MAM A;  2DXU A;  2HQE A;  2NUP A;  1YIJ A;  4KUI A;  3CCL T;  5J39 A;  1JU5 C;  2KE9 A;  2F69 A;  1ZUU A;  2AIR B;  2QA4 A;  4DEY A;  3GOX A;  3M54 A;  2NYS A;  1FMV A;  4JS5 A;  1VIF A;  1UUE A;  4M7A F;  4HVW A;  1KHC A;  1KD1 C;  1MND A;  1CKA A;  1ABO A;  5FRN A;  2LQN A;  2DO3 A;  1GRI A;  3MET A;  1VQP T;  1AZE A;  2XID A;  2GFU A;  2HCK A;  4LUE A;  5CVI A;  3LH0 A;  4Z88 A;  3RMS A;  1VQO Q;  2ZPH B;  5FU7 B;  5CKD A;  1LCK A;  1ZSZ C;  1D1C A;  5GMK e;  3CBM A;  3CCM Q;  4PJO G;  4BDZ A;  4QVD A;  2DEU A;  2DIQ A;  1X6G A;  3L2U A;  3OYJ A;  4D8D A;  1C6V X;  1JRI A;  1NE8 A;  1W2B A;  3O5Z A;  3FC3 A;  2XI9 A;  1M8V A;  4F7U E;  2CT4 A;  2B8A A;  1PD0 A;  1D3B B;  4A4E A;  1G3W A;  2IPO B;  2KQW A;  1BB9 A;  1AZG B;  4BI4 A;  5GAN d;  3PTA A;  2LMJ A;  1IXD A;  2ZPF B;  3PIP A;  4M4Z A;  1VQL Q;  4XU3 A;  2RQW A;  2YXY A;  3ZEH A;  2I2L A;  2YRD A;  2GCX A;  3VUB A;  1VQO T;  2CP2 A;  2K79 A;  4M7D A;  4OP0 A;  1AOJ A;  3CCM T;  4R55 A;  2VGN A;  5GMK i;  3EG3 A;  1RAI B;  5GAO n;  4M78 F;  3CXC P;  3TSW A;  2O2O A;  1FWZ A;  2L5Q A;  1SRL A;  2CGH A;  4C8Q B;  3CCV A;  3MHX A;  2FEI A;  2P4R A;  2CZ7 B;  2EWN A;  1HD3 A;  1GBR A;  4J8O A;  3HP9 A;  4J9C A;  1YIJ Q;  3JB9 I;  3RUX A;  5KYW A;  4HKE A;  3QUI A;  1V29 B;  3MEU A;  2QA4 Q;  3VS5 A;  2DE0 X;  3OS5 A;  3CD6 A;  1AWJ A;  1QWF A;  2VWF A;  1HJD A;  1G5V A;  4FU6 A;  1VQL T;  3RKW A;  5FRO A;  1U8R A;  3ZBD A;  1N8R R;  5CK9 A;  4MDX A;  1YNZ A;  2HMA A;  4KT0 E;  1OEB A;  2L3Q A;  4ZN3 A;  2V8K A;  3M55 A;  2RK2 A;  4J9D A;  2DXT A;  2DZ9 A;  4M77 A;  3HTR A;  1OU9 A;  1ZLM A;  1BCM A;  4ZTJ A;  4RG2 A;  2C0I A;  4ME7 A;  1K73 U;  3OYC A; 
#chains in the Genus database with same CATH homology
 1FYN A;  1UJY A;  2NWM A;  4RTV A;  3REA B;  1GCQ A;  2YDL A;  2YSQ A;  2OI3 A;  1QKX A;  2QDL A;  1W70 A;  1UG1 A;  1K9A A;  1M3C A;  1OV3 A;  3NPF A;  3I35 A;  2DL7 A;  2JXB A;  4LE9 A;  1U3O A;  2J06 A;  1TUC A;  1GCP A;  2CT3 A;  2ROL A;  2YUN A;  4E6R A;  1SRM A;  2HEQ A;  2DF6 A;  5IHK A;  2DJQ A;  5GJV B;  2CUB A;  3H41 A;  2C0T A;  2O9S A;  2CSQ A;  1WX6 A;  2GNC A;  2L3P A;  3JV3 A;  2CDT A;  2CSI A;  1OOT A;  1GCQ C;  5FW9 A;  5IXB A;  2J6K A;  3M0Q A;  2BTT A;  2DL3 A;  2DNU A;  3FJ5 A;  5EC7 A;  2FPD A;  2ESW A;  2W10 A;  2JMC A;  3CQT A;  3EG2 A;  3EHQ A;  2ED1 A;  2L2P A;  1QKW A;  2JT4 A;  5I11 A;  1M3A A;  2OJ2 A;  1NM7 A;  2BZY A;  1SEM A;  1UGV A;  4OMP A;  4LNP A;  3VS3 A;  2FG0 A;  5IH2 A;  5FWB A;  1T0J A;  3ZL7 C;  3UAT A;  2PTK A;  4OMN A;  1MV0 B;  2K6D A;  1JXO A;  5HCK A;  1SPK A;  4OMM A;  3PVQ A;  1Y0M A;  4CC7 A;  1GFD A;  4HCK A;  2F2V A;  2O31 A;  1ZUK A;  1NYF A;  1H3H A;  4RTT A;  1PKT A;  1YP5 A;  1K0S A;  3VRZ A;  1T0H A;  1OPK A;  2I0N A;  1CKB A;  1K76 A;  2RQT A;  3GBQ A;  4K11 A;  3VS4 A;  2DL8 A;  1ZBJ A;  2J6O A;  1YWP A;  1UE9 A;  1NEG A;  3C0C A;  2IIM A;  3UA6 A;  4ORZ A;  1IO6 A;  3I5S A;  3A98 A;  1X27 A;  2RMO A;  1KJW A;  1V1C A;  5L23 A;  1N5Z A;  1ZUY A;  1X6B A;  1VYU A;  2EVR A;  2KT1 A;  2DBK A;  2KGT A;  1NYG A;  2DMO A;  2C0O A;  3UA7 A;  2CH4 W;  1Z9Z A;  1QCF A;  3EHR A;  2D0N A;  2MOX A;  2OAW A;  2M51 A;  1M30 A;  3LH5 A;  1PHT A;  4JZ4 A;  2EGE A;  2HBW A;  2NUZ A;  3M0T A;  4A63 B;  2KXD A;  2MIO A;  5IXF A;  2L3S A;  1JQQ A;  1JO8 A;  1PKS A;  1KFZ A;  4RTZ A;  1UDL A;  1X69 A;  2DRK A;  2JM9 A;  2EYW A;  2FPF A;  1ZSG A;  2LJ3 A;  1OPL A;  2X3W D;  1E7O A;  1MV3 A;  2K7A A;  4GBQ A;  1H92 A;  2F2W A;  2ROT A;  2BZ8 A;  2KXC A;  1E6G A;  1WXT A;  1WI7 A;  4X1V A;  4AFS C;  1SHF A;  2AZS A;  1I07 A;  2EYY A;  2V1Q A;  1ARK A;  2FRY A;  2DL4 A;  2AZV A;  1WDX A;  2RF0 A;  3VS6 A;  4AFQ C;  1MUZ A;  4IIM A;  1NG2 A;  1GL5 A;  1X43 A;  1AWO A;  2RQU A;  4JPB W;  2EW3 A;  3SEM A;  1J3T A;  1AWX A;  1FMK A;  2HSP A;  3NMZ C;  4EIK A;  1PNJ A;  2XMF A;  1RI9 A;  1XOV A;  1YWO A;  2FO0 A;  4AFU C;  4LUD A;  2D8H A;  2RNA A;  1UHF A;  1VYV A;  2LX7 A;  1Y57 A;  2CRE A;  2DX1 A;  1QLY A;  1JEG A;  4F14 A;  3TSZ A;  2D1X A;  3VRY A;  5IHN A;  2DBM A;  1NLO C;  2KR3 A;  2LZ6 B;  5IHI A;  2EYX A;  3U23 A;  4J9H A;  1A0N B;  1WXU A;  2J05 A;  1M3B A;  4FSS A;  2LJ1 A;  2CUD A;  1UFF A;  3R6N A;  1KSW A;  4RTX A;  2KBT A;  4LN2 A;  2CH4 A;  1Z9Q A;  3ULR B;  2DVJ A;  1CSK A;  2MCN A;  2L0A A;  2KNB B;  1JXM A;  4JJD A;  1K0X A;  1S1N A;  2YUQ A;  1B3Q A;  2LQW A;  1E6H A;  3RBB B;  4RTU A;  2ECZ A;  1GBQ A;  1M8M A;  1AWW A;  2O88 A;  1U5S A;  1I1J A;  2SEM A;  2W0Z A;  1W1F A;  3PVL A;  4HVU A;  4CC4 B;  3TVT A;  1NLP C;  2LP5 A;  1YN8 A;  2J6F A;  3VS0 A;  1KIK A;  1TUD A;  2AK5 A;  3QWY A;  4HVV A;  1WXB A;  2F2X A;  4J9I A;  2DRM A;  3RNJ A;  1VYT A;  2K3B A;  2DYB A;  1UHC A;  1K1Z A;  4IIO A;  1JU5 C;  2KE9 A;  2B86 A;  2KT8 A;  1ZUU A;  4DEY A;  1SHG A;  1PRM C;  4OMQ A;  5FWC A;  1X2K A;  1BBZ A;  1AVZ C;  1UUE A;  3SHW A;  1NEB A;  4HVW A;  4CC2 A;  2LCS A;  3I9Q A;  2JMA A;  1TG0 A;  1CKA A;  2J7I A;  1ABO A;  1U06 A;  1RLP C;  2A28 A;  2D8J A;  2LQN A;  1GRI A;  4JZ3 A;  4OMO A;  2BZX A;  2VVK A;  1AZE A;  4Z89 A;  4JJB A;  3NHN A;  2HCK A;  1GFC A;  4LUE A;  3IQL A;  3M0S A;  2GTJ A;  2FPE A;  4Z88 A;  4J9B A;  3M0P A;  1LCK A;  2AKL A;  2EKH A;  2EBP A;  1WFW A;  4J9F A;  1WYX A;  3QWX X;  1X6G A;  2DLP A;  2DL5 A;  2PNI A;  2KEA A;  4D8D A;  3VS1 A;  2V1R A;  4HXJ A;  3H0F A;  2A36 A;  3O5Z A;  2O9V A;  2JS0 A;  2JS2 A;  1W6X A;  4RTY A;  4RUG A;  4OML A;  1QWE A;  2CT4 A;  3VS2 A;  1I0C A;  4QT7 A;  3M0R A;  1EFN A;  1ABQ A;  1BK2 A;  1BB9 A;  2GBQ A;  1AZG B;  1WA7 A;  2A37 A;  2KYB A;  4F17 A;  2KRO A;  2GGR A;  2GTO A;  2GQI A;  1B07 A;  3EGU A;  2LMJ A;  2AKK A;  2RQR A;  4M4Z A;  3I5R A;  1K4U S;  4CC3 A;  4RTW A;  2KYM A;  4JJC A;  2RQW A;  2DA9 A;  2ED0 A;  2RPN A;  4Y92 A;  1G2B A;  1UEC A;  3VS7 A;  2LJ0 A;  4ZNX A;  2H8H A;  4ESR A;  2EYZ A;  3EG1 A;  2JM8 A;  2K79 A;  2M0Y A;  4DEX A;  1AOJ A;  1BU1 A;  4WCI A;  4R0K A;  3EG3 A;  1T3S A;  2JW4 A;  4J9G A;  2YUP A;  2YT6 A;  1WLP B;  2KRN A;  3TSW A;  2KRM A;  2O2O A;  5ECA A;  2EQI A;  1WIE A;  2EGA A;  1RLQ C;  2ENM A;  2VKN A;  1SRL A;  3KFV A;  2DM1 A;  2G6F X;  4KRT A;  2X3X D;  2FEI A;  2P4R A;  3H0H A;  2KRS A;  1HD3 A;  1UTI A;  4AG1 C;  1GBR A;  1AD5 A;  2LNH B;  1H8K A;  4J9C A;  1T3L A;  4GLM A;  2K2M A;  1G83 A;  1VA7 A;  4AFZ C;  2E5K A;  1ZX6 A;  2A08 A;  1M27 C;  3THK A;  2DE0 X;  3VS5 A;  2YUO A;  1AWJ A;  3M0U A;  1QWF A;  1SSH A;  2VWF A;  1HJD A;  2RQV A;  3PE0 A;  4Z8A A;  3EG0 A;  1YCS B;  2FRW A;  1PWT A;  1RUW A;  3H0I A;  1AEY A;  2SRC A;  5I22 A;  1YNZ A;  2DIL A;  3UF4 A;  2JTE A;  1OEB A;  2L3Q A;  3NGP A;  1UJ0 A;  3REB B;  2K9G A;  4J9E A;  4F16 A;  2ABL A;  4J9D A;  1HSQ A;  2RN8 A;  1PRL C;  5GJW B;  4D8K A;  2EGC A;  1ZLM A;  2EPD A;  2HDA A;  2PZ1 A;  4AG2 C;  1X2Q A;  2C0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...