2AZVA

Solution structure of the t22g mutant of n-terminal sh3 domain of drk (calculated without noes)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
MEAIAKHDFSATADDELSFRKGQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Comparison of the Unstable drkN SH3 Domain and a Stable Mutant
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords SH2-SH3 adapter protein drk
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2azvA00
3VS6A 4DEYA 2RQWA 1K1ZA 2RQUA 1E6HA 2ECZA 2X3WD 1AZEA 2RQTA 4HCKA 2KXDA 3VS3A 2KRMA 1GL5A 1WXBA 2FRYA 3KFVA 2VWFA 4Z89A 2EGCA 2D0NA 1HJDA 4J9GA 1JXMA 1OV3A 1VYTA 1X43A 2AZVA 3UA7A 1ZUKA 1PKTA 2K3BA 2O2OA 1W1FA 4HXJA 2RQRA 2FPDA 1TUDA 1QCFA 3EG3A 1OEBA 1X69A 3REBB 5IH2A 2CSQA 2JT4A 1MV0B 2VKNA 1Z9QA 4Z88A 1U3OA 4LUDA 1UGVA 5IHNA 2KYBA 1GBRA 4KRTA 2LJ0A 4JZ3A 4J9HA 2KE9A 2PZ1A 3LH5A 5IHIA 2ESWA 4HVVA 2VVKA 2AKLA 2GBQA 3M0RA 5GJVB 2H8HA 2PTKA 2V1RA 2KRNA 3CQTA 2DLPA 4E6RA 3THKA 2KYMA 1VYVA 2LQNA 1JU5C 4J9BA 3EG0A 2I0NA 4D8KA 1ZUUA 1WX6A 2CH4W 1KSWA 4M4ZA 1AWXA 1FMKA 1GCPA 4RTXA 5FWBA 2L2PA 3ULRB 2A36A 2M51A 2EQIA 1ABQA 1QKXA 2DJQA 2KT1A 3NMZC 4WCIA 1CKAA 2KNBB 2LJ3A 1H3HA 2CT3A 3RNJA 4JJDA 2ROLA 2EYYA 3EG1A 1Y0MA 2DL5A 2BZ8A 4EIKA 1PKSA 2DMOA 2DL4A 1GFCA 2KROA 1E6GA 3H41A 2F2WA 2BZYA 1M3BA 1EFNA 2G6FX 1UHCA 2LNHB 1QKWA 3EG2A 1JXOA 1G83A 2RN8A 4F17A 1YN8A 1SRMA 1BBZA 1UTIA 2GTJA 2LCSA 3VRZA 1U06A 2QDLA 2RF0A 1GBQA 3UA6A 4ORZA 3U23A 1SPKA 2D8HA 2FG0A 1M27C 2B86A 2K7AA 3M0SA 2C0IA 1V1CA 1ZLMA 1WA7A 4RTTA 1ARKA 1Y57A 4LN2A 1K0SA 1ZSGA 1AWOA 1FYNA 3I35A 3R6NA 1UHFA 1E7OA 1RI9A 2DBKA 1T3SA 4AG2C 1JEGA 1ZUYA 1I07A 2CDTA 1PHTA 3VS7A 2JM9A 1NYFA 5I22A 1WLPB 1AEYA 4OMOA 2KR3A 1YNZA 4ESRA 3TVTA 2EGAA 2HDAA 1WFWA 1ZBJA 1NG2A 2K2MA 4A63B 2PNIA 4IIMA 1KIKA 1QLYA 3UF4A 1HD3A 1HSQA 1AVZC 1PWTA 1W70A 4OMQA 4ZNXA 3TSWA 1VYUA 5FW9A 2DVJA 2XMFA 1OPKA 3H0FA 3VS1A 1H8KA 1SRLA 2O9SA 2ED1A 1TUCA 4FSSA 2W0ZA 2AK5A 4OMLA 2KT8A 2OJ2A 2YUOA 2CREA 2J6FA 4JPBW 2OAWA 2JS2A 2DL7A 2GNCA 3M0UA 1T3LA 1SHGA 1YWOA 2DRKA 4LE9A 3SEMA 3I5RA 2K9GA 1PNJA 2EKHA 1G2BA 1AD5A 1WIEA 4QT7A 1LCKA 1UFFA 2GTOA 1S1NA 2DX1A 2L3PA 2DILA 3O5ZA 3M0PA 4CC2A 1AOJA 2MIOA 4J9DA 3IQLA 1YWPA 4RUGA 1VA7A 2EYZA 2D1XA 2J05A 2V1QA 2YSQA 1RUWA 1UG1A 3UATA 5EC7A 1UDLA 5ECAA 1MUZA 5L23A 1PRMC 1K4US 4J9FA 2CUDA 2HCKA 4JJCA 4RTZA 4LUEA 1A0NB 1J3TA 4X1VA 1JO8A 1NLPC 2JTEA 1RLPC 4AFZC 5IXFA 3JV3A 2KBTA 4K11A 1K9AA 5HCKA 2DRMA 2FEIA 2ABLA 2JMAA 2JW4A 1WI7A 2DYBA 2L3SA 2GQIA 2BTTA 2O31A 1ABOA 2EYWA 2MCNA 1QWEA 1NM7A 1Z9ZA 2FPFA 2A08A 4JZ4A 2SRCA 4J9EA 3I5SA 2CT4A 1GCQC 2K79A 4D8DA 1SEMA 1NLOC 2EPDA 2C0OA 4GBQA 4DEXA 1X6GA 2KEAA 2GGRA 1IO6A 3VS4A 4LNPA 1T0HA 2HSPA 2A28A 2O9VA 2JM8A 1KJWA 3PE0A 2EYXA 1WXUA 1UUEA 1U5SA 1M3CA 2JXBA 3H0HA 1K76A 3H0IA 3M0QA 1KFZA 1M8MA 1W6XA 4Y92A 2YUQA 1H92A 4Z8AA 1M3AA 4AFUC 2FO0A 3SHWA 2YUPA 1BU1A 1TG0A 4HVWA 1PRLC 2DBMA 2CH4A 2KXCA 3PVQA 2LQWA 3EGUA 5FWCA 4F16A 2KGTA 4RTWA 2LMJA 2L3QA 1X2KA 4CC7A 2NWMA 2EW3A 5IHKA 2AKKA 2YUNA 1WXTA 3REAB 4IIOA 1UJYA 2DL8A 1M30A 2C0TA 3PVLA 1BK2A 2F2VA 2EBPA 2NUZA 4CC4B 1SSHA 2DA9A 1UE9A 2ENMA 2K6DA 1XOVA 1NYGA 2DNUA 3NGPA 2X3XD 3M0TA 3I9QA 2LX7A 4J9IA 2RNAA 1X27A 2JMCA 2HBWA 1B3QA 1MV3A 2DM1A 1T0JA 4RTVA 1JQQA 1AWJA 2J06A 3EHQA 4F14A 1YCSB 2ED0A 2L0AA 4J9CA 2CUBA 2YT6A 3A98A 1AZGB 1NEGA 1GRIA 2DE0X 3C0CA 4OMNA 1K0XA 3TSZA 3EHRA 3QWYA 2DL3A 2CSIA 2D8JA 1CKBA 1RLQC 4RTYA 4AFSC 4CC3A 2A37A 2P4RA 2J6KA 1I0CA 1ZX6A 3FJ5A 5GJWB 2EGEA 5IXBA 5I11A 1OPLA 1B07A 2W10A 1NEBA 2SEMA 4JJBA 1CSKA 4OMMA 2HEQA 2O88A 1N5ZA 4AFQC 3NPFA 2ROTA 1GFDA 2IIMA 3ZL7C 1UJ0A 3NHNA 2F2XA 4RTUA 3QWXX 2BZXA 1BB9A 1YP5A 1X6BA 2RQVA 2RPNA 1X2QA 2LZ6B 2DF6A 1UECA 1WDXA 1QWFA 4R0KA 3VRYA 1OOTA 3RBBB 2MOXA 4HVUA 3VS2A 2E5KA 2JS0A 4OMPA 2AZSA 1SHFA 2M0YA 2J6OA 2LJ1A 2LP5A 3VS0A 3VS5A 2J7IA 2KRSA 1WYXA 2OI3A 2YDLA 1AWWA 4AG1C 4GLMA 2RMOA 1GCQA 2FPEA 3GBQA 1I1JA 2EVRA 2FRWA
chains in the Genus database with same CATH superfamily
1D0YA 3FIFA 1KC8C 4TVRA 4C92D 1K1ZA 5GAMd 4HCKA 3OMCA 1OZ3A 2KRMA 4UC4A 1IHWA 1TH7A 4LD9K 1N9SA 4M7DB 4C5GA 1HJDA 1X43A 3MEVA 3MJXA 4RMOA 4HXJA 2FPDA 4M75A 3JCMV 1IRXA 1TUDA 3G4SA 1QCFA 3LH0A 4RCCA 1Q82C 3L2QA 3G7ZA 4M78E 1VQKQ 1N9RA 1U3OA 1UGVA 5GAN6 3CCMT 2LJ0A 4JZ3A 4J9HA 2ATCB 3CCRQ 2YHTA 3V7RA 4BDZA 4JRQA 4C92A 2RJDA 1YITQ 3LH5A 2MWOA 4MZTA 3AT1B 1WHGA 1D1BA 3H8ZA 4M7AB 1V76A 3WVDB 3S3MA 3JCMh 2V1RA 3JCMg 1UGRB 2KRNA 2HQEA 5GAMe 5GAOl 3JCMX 4XTXA 3CC4A 3QJ6A 2KYMA 3JCMf 2AIRB 3MP6A 3GOXA 2LT1A 2EWNA 1WX6A 3S3NA 2CH4W 1R0BG 1RAIB 1GCPA 4O6JA 3GNGA 3ULRB 1LPLA 4OF1A 2M51A 3CC4Q 2EQIA 4J5YA 1ABQA 3VYGA 2DJQA 2KT1A 2NYSA 2QQAA 4IUTA 4JLGA 3URGA 2CYZB 4M77C 4WCIA 4PJMA 1Y0MA 2DL5A 4PJOD 1ZQ1A 2IVWA 5CAIA 3JCMb 4IUVA 3H41A 2BZYA 3JAME 2LNHB 2RK2A 4FYYB 4BB7A 1VQ4T 2AHJB 1W2BP 4M7DG 2HKQB 3OBWA 1PD1A 2CS7A 1BBZA 5M9OA 3S3OA 3E9GA 4JRKA 2LNVA 5GMKe 4R56A 1U06A 2DEUA 2PUOB 3U23A 2D8HA 2FG0A 2B86A 3AHUA 2K7AA 1RAEB 3H6ZA 2ZZDA 3CXCS 4A4EA 1JJ2A 4LN2A 1FYNA 2EQMA 4JDSA 1VQLT 1ZUYA 4E2FB 3RMQA 2OTLA 2KSSA 2EGAA 1WFWA 1OX9A 2XG8D 1NG2A 1YHQQ 1U1TA 4A63B 2VGNA 2OX7A 3CCEA 5J39A 3ER0A 1QLYA 1HD3A 1AVZC 1C1AA 1W70A 4OP0A 4KGZB 4JJNK 3NTHA 4ZNXA 1JRIA 2XMFA 4PL6A 1YHQA 2O9SA 4OMLA 2KT8A 2OJ2A 4DA4A 2YUOA 2QEXQ 1VQPA 2D6FA 3M0UA 1YWOA 2VC8A 3MKDA 2FYKA 2QASA 1V29B 3I5RA 4IUPA 2JJ9A 3CC7A 4PFPA 1VQ8Q 3GNFB 4ZN1A 1VQ8T 3TREA 2L3PA 3O5ZA 4CC2A 2EJ9A 5FU6C 2JNGA 4OGEA 3J7AF 3IQLA 4M7AD 3OYFA 1QW1A 4M77F 2E6ZA 5IN1A 2KMTA 2YSQA 1RUWA 2FL7A 5HKCA 1UG1A 5EC7A 5ECAA 1MUZA 5L23A 1NPPA 4ATOA 2RO0A 4JJCA 4RTZA 2Z0WA 4BACA 4C5HA 4OB1B 2RM4A 1FMWA 3VKIA 3EFSA 2LQ8A 4FM4B 2HBPA 4M75D 1RI0A 1LJOA 4F7UE 1N8RU 2DO3A 2F5TX 1IXDA 2DRMA 2JW4A 1PM3A 4ZTJA 2L3SA 2DYBA 2GQIA 2WSFE 2A0FB 2MCNA 3SDZA 1Q81C 2RJEA 3HPWA 4JZ4A 2DZ9A 1Y71A 3JB9H 3V8LA 1WPYA 4KT0E 3JB9F 4QW2A 4DBFA 2HQHA 2DYIA 2EPDA 1X01A 2DVEA 4C0FA 2GGRA 3LGFA 3A5ZB 2HSPA 2O9VA 1YBYA 4X34A 2BE7D 1YJ9A 2HSEB 3GIBA 1DJ7B 3PE0A 3L1AA 2CZ6B 3CCLA 1JB0E 2M1HA 1U5SA 2KQWA 2RK1A 4LXCA 2YUQA 4Z8AA 1BU1A 3NFCA 4DBQA 2E3IA 1TS9A 1R0CB 1YIJA 2DBMA 3EGUA 4F16A 2LTOA 1X2KA 4E7LA 2RHXA 4AMCA 3V8JA 3QYGB 4PJOA 3RIRA 5IHKA 2JTMA 1G3YA 1RADB 3A1PA 3M9QA 3M56A 2OTLQ 1HK9A 3TCJA 3VV0A 5GAN7 2O01E 3BFMA 3MP8A 3QZ5B 2DXTA 1QQJA 2CP5A 2LX7A 4J9IA 1D3BB 2RNAA 3CCJA 5FROA 1X27A 3EGDA 5GMKj 5KYYA 1O9SA 3P8HA 4RTVA 4KH0B 3L2VA 2MK5A 5GAMh 3EHQA 3GLXA 4QVCA 1YCSB 2L0AA 5GAOq 3A98A 4LDXA 1N8RR 3C0CA 2WSEE 4E7ZA 4IUUA 1K0XA 3TSZA 1K9MU 3RR6A 4C0DC 4DQ2A 2DETA 2EYQA 3LWIA 2J6KA 2JVVA 2X4WA 4PNOA 5GJWB 5I11A 2X51A 3JCMJ 4JJBA 2CKKA 3Q1JA 2NLUA 4DBRA 1ZSZC 2ROTA 1GFDA 4B6MA 1BCMA 1M2VA 3VU3C 3ZL7C 1UJ0A 3NHNA 4VUBA 5LJ3h 1MHNA 4B9WA 2BZXA 1BB9A 3EG9B 1X6BA 2RQVA 1X2QA 2LZ6B 1KG1A 3OW2S 1W2BA 5CQXA 3E2UA 4LDUA 4M7AE 2E5KA 4OMPA 1WHMA 1SHFA 4KGXB 2XU8A 3ME9A 2J6OA 3VYHB 1XTDA 5CKDA 1WYXA 5CKFA 1Q86C 1RAFB 4NS5A 2RMOA 1GCQA 2E12A 2LVMA 2QQRA 3VS6A 2K5LA 4FYXB 4DEYA 2RQUA 4RG8A 1VQ9A 4F7UG 1E6HA 2ECZA 1BYMA 2V8JA 2RQTA 2KXDA 1NBEB 2D9TA 4XTZA 5GAN2 1WXBA 2FRYA 4FW1A 2DTOA 3M5AA 4Z89A 2F69A 3EFOB 1VQ4A 2DTHA 1ZUKA 2CZ7B 1KQSS 2K3BA 1W1FA 2GCXA 4J6WA 3SFMA 3EG3A 3REBB 3CCLQ 3HRSA 3CCUA 3PMTA 2VKNA 3S6WA 2LC4A 3F70A 3FRNA 5IHNA 2KYBA 2M9UA 2BKDN 1K73C 1RABB 2L8DA 1BKBA 2KE9A 3QDFA 1VQLA 1NJIR 1TXQA 2ESWA 1D0XA 2QG9B 3BW1A 3E9FA 4HVVA 5LJ3j 2VVKA 1KQSP 3OYYA 1BI3A 2GBQA 4C8QC 4MDXA 3JB9I 1Y96A 1TOVA 1KD1R 3OSVA 3LLRA 1SF9A 3RKXA 3THKA 4D8KA 1JBMA 1ZUUA 1VQ5Q 1M1GA 2COWA 2MYSA 1KC8R 1AWXA 1VQ5T 3M59A 2ZPHB 1YJNA 3CCMA 3OY9A 2YLCA 1QVGP 2D0QB 2E6NA 2HQXA 1QKXA 1D09B 1Q82R 2JN0A 4M7DE 4KH1B 3CCET 2YRDA 4PJOC 4PJOG 3M58A 2OTJQ 3V7SA 2LJ3A 2CT3A 1K73R 1VQPQ 4JJDA 1MMGA 2E3HA 2DERA 5KYWA 1IHVA 3EG1A 1U8RA 2DD4A 1RAAB 2MAMA 3RMSA 2X4XA 2CGHA 4L5GA 4EPCA 2DJZA 2DMOA 5GMKm 2DL4A 2RI3A 2KROA 3OYMA 4C0DB 2HZYA 1UGQB 4M78B 1QP3A 2CP7A 2GF7A 4J7FA 2KY9A 4F17A 4C92E 1UTIA 2GTJA 1KQ2A 9ATCB 2DKGA 3VRZA 3RESA 3N5BB 5CKEA 3LYIA 3WVEB 1GBQA 3UA6A 4OB0B 1KQSA 3CMEA 1NJIU 2YRCA 4L59A 4M7DC 5GANg 3M0SA 2C0IA 1ZLMA 1ZSGA 1WQWA 4HT9A 3I35A 2QQBA 2PVGB 4AG2C 1EIFA 3HRUA 4A53A 3CMEQ 3VS7A 3KXTA 4E7HA 3P8DA 1AEYA 2KR3A 1YNZA 3PIPA 3O8VA 1OX8A 2NUPB 3CD6A 1NZ9A 3CCRT 4C0ZA 1VQMA 3CC2A 1HXDA 2PNIA 1OULA 4IIMA 1VQ6A 1HSQA 3OS5A 4OMQA 3TSWA 1VYUA 2P4TA 3H0FA 1OPKA 3VS1A 2E1HA 1ZSZB 2ZPIB 2JZ2A 2AK5A 2XK0A 3QYHB 4XTWA 5D6XA 4JPBW 2JS2A 1P92A 2GNCA 1RAGB 1UGSB 4EMKA 1Y96B 1VQ7A 3GPLA 3SEMA 2YRVA 3G71Q 3HP9A 2EKHA 3G6EA 2Y4YA 4QT7A 1LCKA 2GTOA 1S1NA 1UGPB 2DX1A 4XAXB 1OYXA 4IUQA 4MZMA 4C92C 5LJ3f 2DILA 2MIOA 3HL8A 1YWPA 4RUGA 1G8XA 4XU2A 1Q86U 3ZBDA 1K8AU 1I5OB 2V1QA 3OQ5A 2IPOB 1BIAA 4M77D 4N4GA 2DEQA 3UATA 2FZCB 4E7KA 4HCCA 3T9NA 1K4US 5DY9A 2I2LA 4J9FA 3SWNA 4PJJA 2BE9B 1A0NB 4X1VA 2JTEA 4LDWA 4E7JA 5C0MA 2CP3A 3C95A 2X9HA 1K9AA 2L89A 1QCOA 2HKNA 1WI7A 2DPPB 1YJNT 2BTTA 4E47A 1ABOA 2EYWA 4C8QA 3OYHA 1QWEA 1VQKT 4HCBA 5FLXE 3PT9A 2A08A 2KDSA 3X24B 2CT4A 2K79A 4D8DA 1NLOC 4GBQA 5GAOm 2EQKA 4DEXA 1X6GA 3VS4A 4LNPA 2LQKA 1T0HA 2VB6A 2QA4Q 3R6OA 1G3SA 3M55A 1KJWA 4M7AA 3A8GB 5LJ3g 3FJPA 3H0IA 1KFZA 1WJRA 1KC8U 4Y92A 2QEXT 2FO0A 2YUPA 3DLLA 1W4SA 4HVWA 5A2QE 1UB4A 5IAYA 2KXCA 3C4SA 2NUTB 1PD0A 1QVFP 2KGTA 2FZGB 1OU9A 1VQ6Q 2LMJA 2L3QA 2CP2A 2FHDA 3OB9A 3UT1A 3EGXB 2YUNA 1WXTA 3MEUA 4IIOA 1MGQA 4XTUA 2XHCA 2C0TA 3CCRA 3PVLA 1BK2A 2VV5A 4PK4A 2DIGA 2XIDA 4C0GA 2ZPBB 2DA9A 1UE9A 2ENMA 2K6DA 1VQMQ 3CC2Q 3LW5E 2LCLA 5HK0A 4M7DF 4Z02A 3NGPA 2X3XD 3I9QA 4M75E 1HYOA 4C8QD 2EKOA 3OYLA 1RACB 3HHTB 1AWJA 4ELYC 1KK7A 1ZHIA 4ANJA 5FU6B 5CKBA 3CPWA 1M1KR 1VQ7T 1ZBXA 5GAOn 4OMNA 4J8OA 4N0AA 3CXCP 3QWYA 2DL3A 2CSIA 3G6ET 2XDPA 3G6EQ 3SWNB 2VASA 2EGEA 2W10A 3A8OB 3I56A 3SD4A 4M77B 2GQVA 4OMMA 2MWPA 4HA8A 1MMNA 3NPFA 4EMKC 1Y07A 2R57A 5KYNA 3TEEA 4C8QF 5GANj 1ZA2B 4RTUA 2DK3A 1N27A 1MNDA 1YP5A 2RPNA 2DF6A 2CP0A 3QO3A 1QWFA 3FC3A 1VOMA 4GLKA 1VQOQ 2MOXA 2A7YA 4WTOB 2JS0A 1X75C 2AZSA 4N4HA 2CP6A 2LP5A 3QKJA 4PJOB 4KGVB 3BE3A 2RHUA 3VS0A 3VS5A 3HFNA 2JUFA 4ZGJB 4XQ3A 2E70A 4QQ6A 4GLMA 1OQKA 2FRWA 4OB2B 1WJSA 1BIBA 2QQ9A 1BI2A 2VXFA 6AT1B 5LJ5h 2X4JA 2X3WD 3PFSA 1AZEA 1TWBA 4KBMB 3VS3A 4ZTFA 5GAOp 1GL5A 1PSEA 3DB4A 1UEBA 5LJ5f 1RAHB 3CCSQ 5AYFA 1KHIA 3UA7A 1OV3A 1VYTA 2AZVA 1VQKA 1G3WA 1PKTA 3X25B 2O2OA 1WJQA 4HCZA 3J81E 2KK4A 2NUTA 1X69A 4Y28E 1GXIE 2V8KA 1I4K1 3GP8A 2CSQA 2JT4A 5FU7B 1VIEA 2PVOB 3DLMA 4Z88A 4LUDA 2QEXA 4FCYA 3QSUA 5KYUA 1YITT 1YI2Q 3G4SQ 1M2VB 1VQ9T 3DB3A 1B7TA 3MEWA 1I5LA 1IZ6A 3OYDA 3M0RA 5GJVB 4Q5WA 2QA4T 3V7CA 5FRMA 1PSFA 1M90C 2Y90A 1WZOA 3RKYA 4FIBA 2DLPA 1LVKA 5GAOr 1JU5C 3EG0A 2I0NA 3MEAA 3RUXA 3BY7A 3JCMd 3QIIA 1KSWA 1B34A 2LCCA 1WQ7A 5I21A 2DZCA 2QGFB 3CCVA 2A36A 3M4YA 3G71T 3NMZC 3NTKA 1ZA1B 2ZAEA 3M57A 4XU0A 1VQ6T 4NOYA 4M77G 2E41A 1CKAA 1LNXA 3OYEA 1VIFA 4O5VA 4CI0C 1H3HA 5GAN3 4FL6A 1VQNT 3BDLA 2JTFA 2M0OA 2A3LA 1YJ9Q 4EIKA 1PKSA 3OW2P 1Q82U 2RHIA 4J7IA 2QTVA 1GFCA 1E6GA 1M3BA 1VQ4Q 1EFNA 1UHCA 4FT4A 4KUIA 5LJ5g 3PIOA 1G83A 1YN8A 1SRMA 4BI4A 3ASKA 3OS1A 3OYAA 2O4XB 3EFRA 2YLBA 3GF5A 2LCSA 1M8VA 3UWNA 5GANf 1S72T 1VQOA 2QDLA 1YIJQ 2HL5C 1SPKA 5CK9A 1M27C 3JB9G 1Y7XA 3META 1V1CA 1WA7A 2L5QA 4RTTA 1KD1C 1ARKA 1Y57A 4OVAA 1K0SA 4JS4A 2ZPEB 3JSCA 4II1A 1UHFA 1E7OA 3OYGA 2DBKA 1T3SA 3CCLT 1JEGA 2CZ1B 4ME7A 4NL2A 4A4KA 5J26A 1NYFA 2XKOC 5LJ3d 3CCQQ 5I22A 5LJ3e 3TQ7P 3WXMB 3TVTA 4ESRA 1RL2A 3OBYA 1YHQT 2MMPA 1QVGS 2AT1B 3VUBA 3L42A 3P8BB 4M75F 1YCYA 3EH1A 2C06A 3X20B 1PWTA 1KQ1A 5LJ5j 5FW9A 4BY6C 2DVJA 1H8KA 1SRLA 4PJOF 5CQYA 1TUCA 4EMKB 3V8KA 5A0DA 3OYNA 2K57A 4V2SA 2OTJA 3EH2A 5GANd 2CREA 2J6FA 1FX7A 2OAWA 4A4GA 1Q7YU 1EZZB 1SHGA 4M78D 5D6YA 2X35A 5IT9E 2E4HA 1PNJA 1QVFS 1AD5A 3CCJQ 1UFFA 2VXEA 3CCJT 3M0PA 2LRQA 3JB9J 1AOJA 4J9DA 2DXUA 4DBHA 1R8OB 2LX9A 2D1XA 2EQUA 2J05A 3CPFA 1YI2A 1WNLA 4KUDK 3OYIA 3D7SB 3C12A 2PQWA 1UDLA 1K8AC 2DXBA 1PRMC 5KCOA 2HNIA 1X6OA 4PFOA 2CUDA 1J3TA 2K5FA 1JO8A 2KAFA 4MMLA 1RLPC 4XU3A 5CO7A 5HCKA 5GMKl 2FEIA 1K73U 2ABLA 2JMAA 3MPUB 4BE1A 2MI6A 2O31A 2NUPA 1PCXA 1VQ9Q 1NM7A 3CCVQ 4PKCC 2FPFA 4J9EA 2H3EB 1TUGB 1MMAA 4BI3A 3LGLA 1GCQC 2RI2A 4EMGA 3DKMA 3PGGA 4BY6B 2YWWA 2A28A 2R58A 2JM8A 4QQDA 1WXUA 2EQJA 4M7AG 3H0HA 1VQNA 3M0QA 1AHJB 1BI1A 3PMIA 1M3AA 1VQOT 7AT1B 3UPUA 4MMKA 1TG0A 2HMAA 1PRLC 1VQNQ 2DIQA 5CKHA 5FWCA 2EIFA 1M90R 3I56T 4PLLA 4CC7A 2EW3A 4J6XA 1S72A 3JCMQ 2AKKA 3E19A 4BE2A 4A4FA 2ZGWA 1UJYA 2DL8A 2P0QA 3CCQA 5FRNA 4A54A 4M7DA 4BE0A 1SSHA 4BDYA 3JCMP 1S72Q 4CRIA 1XOVA 2DAQA 5DM7R 2PU9B 1NYGA 2FB7A 3M54A 3M0TA 1VQ8A 4M78G 2JMCA 2HBWA 1B3QA 2L3RA 2P0KA 1PC0A 2J06A 3LX7A 1QVPA 3CCSA 4M7AF 4M77A 2ED0A 2CUBA 1AZGB 1NPRA 2QA4A 2EJGA 2V26A 4OB3B 4OGCA 3EHRA 5KYXB 1Q81R 2QTXA 1U1SA 1RLQC 4RTYA 1VUBA 2A37A 2P4RA 3HRTA 1I0CA 1ZX6A 2KI7A 3FJ5A 5IXBA 1N6AA 1G3TA 2VGMA 4D6WA 2QAZA 1NEBA 1CSKA 1M90U 2O88A 4MZPA 1N5ZA 5CIUA 4AFQC 1M9SA 3OYKA 2E10A 2IIMA 3CMAA 1WHHA 1YJWA 3QWXX 4F7UA 1N8RC 5CR2A 3VJPA 4J6YA 1UECA 1WDXA 3JB9D 2COZA 4Y91A 2P0PA 4R0KA 5GAN5 4R55A 5L8RE 3JCMW 1QVGA 1OOTA 4XTVA 3RBBB 4HVUA 3VS2A 3FB9A 4FT2A 2M0YA 3KUFA 4F04B 1YJ9T 4RG2A 3EGDB 4IKFA 1H641 4M75G 1M2OA 4FW2A 2J7IA 2KRSA 2GFAA 5GMKh 5AT1B 4AT1B 4NL3A 4QVDA 5DLOA 3L2WA 3A8LB 1I1JA 4HT8A 2EVRA 2LT4A 2XI9A 2RQWA 2KVQG 4RCBA 2E65A 5DLQE 2K2VA 4HKEA 4PJNA 3CBOA 4XTYA 1YIJT 3OS2A 1M5Q1 3KFVA 2VWFA 4C5IA 2EGCA 2D0NA 4J9GA 1JXMA 2QGGA 1VQMT 3CC2T 5LJ5d 2RHYA 2E5QA 3QZ9B 3FLGA 2QQSA 3M4GA 2F5KA 2RQRA 1VQLQ 2K3XA 4P5NA 5CCAA 1OEBA 1TU0B 3H9NA 3X28B 5IH2A 3JCMc 1MV0B 4LDVA 1Z9QA 1GBRA 1AT1B 4KRTA 2R5AA 1SG5A 1B34B 3MO8A 2K5IA 4BUGA 2PZ1A 4FU6A 5IHIA 1G5VA 2ZCFB 1FMVA 5KE2A 3OMGA 3MHXA 4M78F 5A0LA 4M7AC 3CCUT 2AKLA 3I55T 5GAMj 4KULA 2H8HA 2PTKA 4M78A 5D7UA 1PG5B 3CQTA 3L2ZA 3CBMA 1M4ZA 4E6RA 1VYVA 2LQNA 4J9BA 5I2MA 2WACA 3HSBA 3G1JA 4A4HA 2VYTA 2QYZA 4M4ZA 1WHKA 1FMKA 4RTXA 5FWBA 2L2PA 4FYWB 3QHSA 2QDYB 2CZ0B 5FU7C 2VUBA 2XD0A 2OTJT 1QCNA 4FSXA 8ATCB 2O4XA 1IB8A 3BDUA 2R5MA 3VUZA 3FDRA 2KNBB 4ZGDB 3RNJA 1WHJA 2ROLA 2EYYA 4LDYA 2M02A 3QBYA 2BZ8A 4QVZA 3NTIA 4EDUA 4E7IA 4LD6A 3QUIA 1K8AR 2F2WA 4E7SA 5J3BA 4PFZA 2G6FX 4QQGA 4EMHA 1QKWA 1YJWQ 3EG2A 1JXOA 2ZPGB 2RN8A 1BI0A 5C6SA 1ZSZA 2RF0A 4ORZA 2XICA 2QI2A 1C6VX 3MCAB 5HY6A 4C92G 1IREB 1AWOA 2QXFA 3R6NA 1I8FA 3UDCA 1RI9A 2DTIA 5KYUB 3HKSA 1I07A 2CDTA 1PHTA 2BIVA 3RERA 3HTRA 1OZ2A 1QP2A 2JM9A 3CMET 3QG1A 1WLPB 5GAN4 4OMOA 3TU4K 3RDVA 3JRZA 1EX4A 2HDAA 3PNWC 1D1CA 3OA6A 2MF2A 1ZBJA 3ZEHA 2K2MA 4PJOE 4PJLA 1NJIC 4DOWA 5GAMf 1OU8A 1Q7YR 1KIKA 3UF4A 3ZFJA 4X9CA 1QVFA 1BCOA 4WF2A 3EG9A 1WGSA 2WSCE 2QK0A 4QKUA 3LWHA 4N4IA 2ED1A 4FSSA 2W0ZA 5GMKi 4C8QB 1TTHB 2IG0A 3CC4T 2DL7A 4M75B 1T3LA 2DRKA 4C8QG 2H3JA 4LE9A 3JCMe 1K9MC 3M53A 5GAMg 2K9GA 3HFOA 3QJYA 4MDWA 1G2BA 1WIEA 4XK8E 4ZGEB 1SKUB 4M7DD 3OS0A 4N0AC 3I56Q 4RKUE 2RJFA 3QPHA 1VQ5A 1VA7A 2EYZA 3EFOA 2PUKB 1IGQA 1Q95G 3FEOA 3E1SA 2LDMA 2XDDA 2OTLT 1O75A 2F1LA 1D3BA 2RD1A 5LL6S 3SB2A 2HCKA 3CCST 4JLIA 4LUEA 3QDRB 4F7UB 2HD0A 2RJCA 1NLPC 4J83A 1IGUA 3OW2A 4AFZC 4ZN3A 5IXFA 3JV3A 2HL3A 5LJ5e 2KBTA 4K11A 1M1KU 1LOJA 2M16A 3OYCA 2K4YA 4M75C 2FZKB 1YFNA 1YJNQ 2X4YA 1Z9ZA 3CCMQ 4F7UF 2SRCA 2DFUA 4M78C 1YI2T 3I5SA 3G4ST 3I55Q 1SEMA 3J80E 4BI8B 2C0OA 3QXEB 5I2SA 2EAYA 2KEAA 1IO6A 3RKWA 2COYA 1QMCA 2RH2A 2EYXA 1UUEA 1M3CA 2JXBA 3CC7Q 1K76A 3INZA 2B8AA 8AT1B 1M8MA 3CC7T 4B9XA 1W6XA 1H92A 3CD6T 2FVUA 1XJWB 4AFUC 2Y4XA 3SHWA 2RA2A 2MPXC 3CD6Q 3CMAT 3X26B 5HK3A 2DXCA 2CH4A 3PVQA 2LQWA 3CMAQ 3PTAA 4RTWA 4BD3A 2E64A 2ZPFB 2NWMA 2GFUA 4GY5A 1D1AA 1KD1U 5CVIA 3A8MB 2G3RA 3REAB 2YXYA 4C92B 1YJWT 2P84A 4JUVA 1FXXA 1M30A 1KHCA 5KE3A 2EJFA 2F2VA 2EBPA 1I81A 2NUZA 2RB6A 3KBGA 4PLIA 4C5EA 4CC4B 1YITA 3EAEA 5GANh 2PVDB 4C92F 5KYXA 4YTLA 4C8QE 3MP1A 2DNUA 4L6V5 1C0MA 1Q7YC 1F1BB 5GAN8 1XQHA 3CXCA 1JJ2S 1MV3A 1OI1A 2DM1A 1ACMB 1T0JA 4JRIA 1MMDA 1JQQA 3CPWP 1K9MR 4OMFB 2RHZA 4F14A 4J9CA 2RI5A 2YT6A 5KYYB 2V8IA 1NEGA 1GRIA 2DE0X 3CCQT 3OYJA 1VQ7Q 3CCVT 3CCUQ 5D6WA 2D8JA 1CKBA 3G71A 2OAUA 3A8HB 4AFSC 4CC3A 1WHLA 3OYBA 2XDBA 4DOVA 4XU1A 2DD5A 1OPLA 1B07A 1M1FA 5KH6A 2SEMA 1Q81U 2BUDA 1W2BS 2HEQA 1SSFA 1TSFA 4ELZC 3EGXA 5KCHA 2JOYA 2EFIA 3OSSC 5A0GA 4IURA 4FYVB 4M77E 1FWZA 1M1KC 3SWNC 2F2XA 3L2UA 3CBPA 3C94A 3I55A 3VRYA 4X9DA 1MNEA 5KYWB 3CCEQ 4JRPA 2LJ1A 2K3YA 3CPWS 1NE8A 2OI3A 1D0ZA 1XNIA 1VQPT 5EG2A 2YDLA 1R77A 3L2RA 3CEYA 1AWWA 4AG1C 1JJ2P 4JS5A 5GANe 1H3ZA 2FPEA 3GBQA 2HAXA 1Q86R
chains in the Genus database with same CATH topology
3VS6A 4DEYA 2RQWA 1K1ZA 2RQUA 1E6HA 2ECZA 2X3WD 1AZEA 2RQTA 4HCKA 2KXDA 3VS3A 2KRMA 1GL5A 1WXBA 2FRYA 3KFVA 2VWFA 4Z89A 2EGCA 2D0NA 1HJDA 4J9GA 1JXMA 1OV3A 1VYTA 1X43A 2AZVA 3UA7A 1ZUKA 1PKTA 2K3BA 2O2OA 1W1FA 4HXJA 2RQRA 2FPDA 1TUDA 1QCFA 3EG3A 1OEBA 1X69A 3REBB 5IH2A 2CSQA 2JT4A 1MV0B 2VKNA 1Z9QA 4Z88A 1U3OA 4LUDA 1UGVA 5IHNA 2KYBA 1GBRA 4KRTA 2LJ0A 4JZ3A 4J9HA 2KE9A 2PZ1A 3LH5A 5IHIA 2ESWA 4HVVA 2VVKA 2AKLA 2GBQA 3M0RA 5GJVB 2H8HA 2PTKA 2V1RA 2KRNA 3CQTA 2DLPA 4E6RA 3THKA 2KYMA 1VYVA 2LQNA 1JU5C 4J9BA 3EG0A 2I0NA 4D8KA 1ZUUA 1WX6A 2CH4W 1KSWA 4M4ZA 1AWXA 1FMKA 1GCPA 4RTXA 5FWBA 2L2PA 3ULRB 2A36A 2M51A 2EQIA 1ABQA 1QKXA 2DJQA 2KT1A 3NMZC 4WCIA 1CKAA 2KNBB 2LJ3A 1H3HA 2CT3A 3RNJA 4JJDA 2ROLA 2EYYA 3EG1A 1Y0MA 2DL5A 2BZ8A 4EIKA 1PKSA 2DMOA 2DL4A 1GFCA 2KROA 1E6GA 3H41A 2F2WA 2BZYA 1M3BA 1EFNA 2G6FX 1UHCA 2LNHB 1QKWA 3EG2A 1JXOA 1G83A 2RN8A 4F17A 1YN8A 1SRMA 1BBZA 1UTIA 2GTJA 2LCSA 3VRZA 1U06A 2QDLA 2RF0A 1GBQA 3UA6A 4ORZA 3U23A 1SPKA 2D8HA 2FG0A 1M27C 2B86A 2K7AA 3M0SA 2C0IA 1V1CA 1ZLMA 1WA7A 4RTTA 1ARKA 1Y57A 4LN2A 1K0SA 1ZSGA 1AWOA 1FYNA 3I35A 3R6NA 1UHFA 1E7OA 1RI9A 2DBKA 1T3SA 4AG2C 1JEGA 1ZUYA 1I07A 2CDTA 1PHTA 3VS7A 2JM9A 1NYFA 5I22A 1WLPB 1AEYA 4OMOA 2KR3A 1YNZA 4ESRA 3TVTA 2EGAA 2HDAA 1WFWA 1ZBJA 1NG2A 2K2MA 4A63B 2PNIA 4IIMA 1KIKA 1QLYA 3UF4A 1HD3A 1HSQA 1AVZC 1PWTA 1W70A 4OMQA 4ZNXA 3TSWA 1VYUA 5FW9A 2DVJA 2XMFA 1OPKA 3H0FA 3VS1A 1H8KA 1SRLA 2O9SA 2ED1A 1TUCA 4FSSA 2W0ZA 2AK5A 4OMLA 2KT8A 2OJ2A 2YUOA 2CREA 2J6FA 4JPBW 2OAWA 2JS2A 2DL7A 2GNCA 3M0UA 1T3LA 1SHGA 1YWOA 2DRKA 4LE9A 3SEMA 3I5RA 2K9GA 1PNJA 2EKHA 1G2BA 1AD5A 1WIEA 4QT7A 1LCKA 1UFFA 2GTOA 1S1NA 2DX1A 2L3PA 2DILA 3O5ZA 3M0PA 4CC2A 1AOJA 2MIOA 4J9DA 3IQLA 1YWPA 4RUGA 1VA7A 2EYZA 2D1XA 2J05A 2V1QA 2YSQA 1RUWA 1UG1A 3UATA 5EC7A 1UDLA 5ECAA 1MUZA 5L23A 1PRMC 1K4US 4J9FA 2CUDA 2HCKA 4JJCA 4RTZA 4LUEA 1A0NB 1J3TA 4X1VA 1JO8A 1NLPC 2JTEA 1RLPC 4AFZC 5IXFA 3JV3A 2KBTA 4K11A 1K9AA 5HCKA 2DRMA 2FEIA 2ABLA 2JMAA 2JW4A 1WI7A 2DYBA 2L3SA 2GQIA 2BTTA 2O31A 1ABOA 2EYWA 2MCNA 1QWEA 1NM7A 1Z9ZA 2FPFA 2A08A 4JZ4A 2SRCA 4J9EA 3I5SA 2CT4A 1GCQC 2K79A 4D8DA 1SEMA 1NLOC 2EPDA 2C0OA 4GBQA 4DEXA 1X6GA 2KEAA 2GGRA 1IO6A 3VS4A 4LNPA 1T0HA 2HSPA 2A28A 2O9VA 2JM8A 1KJWA 3PE0A 2EYXA 1WXUA 1UUEA 1U5SA 1M3CA 2JXBA 3H0HA 1K76A 3H0IA 3M0QA 1KFZA 1M8MA 1W6XA 4Y92A 2YUQA 1H92A 4Z8AA 1M3AA 4AFUC 2FO0A 3SHWA 2YUPA 1BU1A 1TG0A 4HVWA 1PRLC 2DBMA 2CH4A 2KXCA 3PVQA 2LQWA 3EGUA 5FWCA 4F16A 2KGTA 4RTWA 2LMJA 2L3QA 1X2KA 4CC7A 2NWMA 2EW3A 5IHKA 2AKKA 2YUNA 1WXTA 3REAB 4IIOA 1UJYA 2DL8A 1M30A 2C0TA 3PVLA 1BK2A 2F2VA 2EBPA 2NUZA 4CC4B 1SSHA 2DA9A 1UE9A 2ENMA 2K6DA 1XOVA 1NYGA 2DNUA 3NGPA 2X3XD 3M0TA 3I9QA 2LX7A 4J9IA 2RNAA 1X27A 2JMCA 2HBWA 1B3QA 1MV3A 2DM1A 1T0JA 4RTVA 1JQQA 1AWJA 2J06A 3EHQA 4F14A 1YCSB 2ED0A 2L0AA 4J9CA 2CUBA 2YT6A 3A98A 1AZGB 1NEGA 1GRIA 2DE0X 3C0CA 4OMNA 1K0XA 3TSZA 3EHRA 3QWYA 2DL3A 2CSIA 2D8JA 1CKBA 1RLQC 4RTYA 4AFSC 4CC3A 2A37A 2P4RA 2J6KA 1I0CA 1ZX6A 3FJ5A 5GJWB 2EGEA 5IXBA 5I11A 1OPLA 1B07A 2W10A 1NEBA 2SEMA 4JJBA 1CSKA 4OMMA 2HEQA 2O88A 1N5ZA 4AFQC 3NPFA 2ROTA 1GFDA 2IIMA 3ZL7C 1UJ0A 3NHNA 2F2XA 4RTUA 3QWXX 2BZXA 1BB9A 1YP5A 1X6BA 2RQVA 2RPNA 1X2QA 2LZ6B 2DF6A 1UECA 1WDXA 1QWFA 4R0KA 3VRYA 1OOTA 3RBBB 2MOXA 4HVUA 3VS2A 2E5KA 2JS0A 4OMPA 2AZSA 1SHFA 2M0YA 2J6OA 2LJ1A 2LP5A 3VS0A 3VS5A 2J7IA 2KRSA 1WYXA 2OI3A 2YDLA 1AWWA 4AG1C 4GLMA 2RMOA 1GCQA 2FPEA 3GBQA 1I1JA 2EVRA 2FRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS6 A;  4DEY A;  2RQW A;  1K1Z A;  2RQU A;  1E6H A;  2ECZ A;  2X3W D;  1AZE A;  2RQT A;  4HCK A;  2KXD A;  3VS3 A;  2KRM A;  1GL5 A;  1WXB A;  2FRY A;  3KFV A;  2VWF A;  4Z89 A;  2EGC A;  2D0N A;  1HJD A;  4J9G A;  1JXM A;  1OV3 A;  1VYT A;  1X43 A;  2AZV A;  3UA7 A;  1ZUK A;  1PKT A;  2K3B A;  2O2O A;  1W1F A;  4HXJ A;  2RQR A;  2FPD A;  1TUD A;  1QCF A;  3EG3 A;  1OEB A;  1X69 A;  3REB B;  5IH2 A;  2CSQ A;  2JT4 A;  1MV0 B;  2VKN A;  1Z9Q A;  4Z88 A;  1U3O A;  4LUD A;  1UGV A;  5IHN A;  2KYB A;  1GBR A;  4KRT A;  2LJ0 A;  4JZ3 A;  4J9H A;  2KE9 A;  2PZ1 A;  3LH5 A;  5IHI A;  2ESW A;  4HVV A;  2VVK A;  2AKL A;  2GBQ A;  3M0R A;  5GJV B;  2H8H A;  2PTK A;  2V1R A;  2KRN A;  3CQT A;  2DLP A;  4E6R A;  3THK A;  2KYM A;  1VYV A;  2LQN A;  1JU5 C;  4J9B A;  3EG0 A;  2I0N A;  4D8K A;  1ZUU A;  1WX6 A;  2CH4 W;  1KSW A;  4M4Z A;  1AWX A;  1FMK A;  1GCP A;  4RTX A;  5FWB A;  2L2P A;  3ULR B;  2A36 A;  2M51 A;  2EQI A;  1ABQ A;  1QKX A;  2DJQ A;  2KT1 A;  3NMZ C;  4WCI A;  1CKA A;  2KNB B;  2LJ3 A;  1H3H A;  2CT3 A;  3RNJ A;  4JJD A;  2ROL A;  2EYY A;  3EG1 A;  1Y0M A;  2DL5 A;  2BZ8 A;  4EIK A;  1PKS A;  2DMO A;  2DL4 A;  1GFC A;  2KRO A;  1E6G A;  3H41 A;  2F2W A;  2BZY A;  1M3B A;  1EFN A;  2G6F X;  1UHC A;  2LNH B;  1QKW A;  3EG2 A;  1JXO A;  1G83 A;  2RN8 A;  4F17 A;  1YN8 A;  1SRM A;  1BBZ A;  1UTI A;  2GTJ A;  2LCS A;  3VRZ A;  1U06 A;  2QDL A;  2RF0 A;  1GBQ A;  3UA6 A;  4ORZ A;  3U23 A;  1SPK A;  2D8H A;  2FG0 A;  1M27 C;  2B86 A;  2K7A A;  3M0S A;  2C0I A;  1V1C A;  1ZLM A;  1WA7 A;  4RTT A;  1ARK A;  1Y57 A;  4LN2 A;  1K0S A;  1ZSG A;  1AWO A;  1FYN A;  3I35 A;  3R6N A;  1UHF A;  1E7O A;  1RI9 A;  2DBK A;  1T3S A;  4AG2 C;  1JEG A;  1ZUY A;  1I07 A;  2CDT A;  1PHT A;  3VS7 A;  2JM9 A;  1NYF A;  5I22 A;  1WLP B;  1AEY A;  4OMO A;  2KR3 A;  1YNZ A;  4ESR A;  3TVT A;  2EGA A;  2HDA A;  1WFW A;  1ZBJ A;  1NG2 A;  2K2M A;  4A63 B;  2PNI A;  4IIM A;  1KIK A;  1QLY A;  3UF4 A;  1HD3 A;  1HSQ A;  1AVZ C;  1PWT A;  1W70 A;  4OMQ A;  4ZNX A;  3TSW A;  1VYU A;  5FW9 A;  2DVJ A;  2XMF A;  1OPK A;  3H0F A;  3VS1 A;  1H8K A;  1SRL A;  2O9S A;  2ED1 A;  1TUC A;  4FSS A;  2W0Z A;  2AK5 A;  4OML A;  2KT8 A;  2OJ2 A;  2YUO A;  2CRE A;  2J6F A;  4JPB W;  2OAW A;  2JS2 A;  2DL7 A;  2GNC A;  3M0U A;  1T3L A;  1SHG A;  1YWO A;  2DRK A;  4LE9 A;  3SEM A;  3I5R A;  2K9G A;  1PNJ A;  2EKH A;  1G2B A;  1AD5 A;  1WIE A;  4QT7 A;  1LCK A;  1UFF A;  2GTO A;  1S1N A;  2DX1 A;  2L3P A;  2DIL A;  3O5Z A;  3M0P A;  4CC2 A;  1AOJ A;  2MIO A;  4J9D A;  3IQL A;  1YWP A;  4RUG A;  1VA7 A;  2EYZ A;  2D1X A;  2J05 A;  2V1Q A;  2YSQ A;  1RUW A;  1UG1 A;  3UAT A;  5EC7 A;  1UDL A;  5ECA A;  1MUZ A;  5L23 A;  1PRM C;  1K4U S;  4J9F A;  2CUD A;  2HCK A;  4JJC A;  4RTZ A;  4LUE A;  1A0N B;  1J3T A;  4X1V A;  1JO8 A;  1NLP C;  2JTE A;  1RLP C;  4AFZ C;  5IXF A;  3JV3 A;  2KBT A;  4K11 A;  1K9A A;  5HCK A;  2DRM A;  2FEI A;  2ABL A;  2JMA A;  2JW4 A;  1WI7 A;  2DYB A;  2L3S A;  2GQI A;  2BTT A;  2O31 A;  1ABO A;  2EYW A;  2MCN A;  1QWE A;  1NM7 A;  1Z9Z A;  2FPF A;  2A08 A;  4JZ4 A;  2SRC A;  4J9E A;  3I5S A;  2CT4 A;  1GCQ C;  2K79 A;  4D8D A;  1SEM A;  1NLO C;  2EPD A;  2C0O A;  4GBQ A;  4DEX A;  1X6G A;  2KEA A;  2GGR A;  1IO6 A;  3VS4 A;  4LNP A;  1T0H A;  2HSP A;  2A28 A;  2O9V A;  2JM8 A;  1KJW A;  3PE0 A;  2EYX A;  1WXU A;  1UUE A;  1U5S A;  1M3C A;  2JXB A;  3H0H A;  1K76 A;  3H0I A;  3M0Q A;  1KFZ A;  1M8M A;  1W6X A;  4Y92 A;  2YUQ A;  1H92 A;  4Z8A A;  1M3A A;  4AFU C;  2FO0 A;  3SHW A;  2YUP A;  1BU1 A;  1TG0 A;  4HVW A;  1PRL C;  2DBM A;  2CH4 A;  2KXC A;  3PVQ A;  2LQW A;  3EGU A;  5FWC A;  4F16 A;  2KGT A;  4RTW A;  2LMJ A;  2L3Q A;  1X2K A;  4CC7 A;  2NWM A;  2EW3 A;  5IHK A;  2AKK A;  2YUN A;  1WXT A;  3REA B;  4IIO A;  1UJY A;  2DL8 A;  1M30 A;  2C0T A;  3PVL A;  1BK2 A;  2F2V A;  2EBP A;  2NUZ A;  4CC4 B;  1SSH A;  2DA9 A;  1UE9 A;  2ENM A;  2K6D A;  1XOV A;  1NYG A;  2DNU A;  3NGP A;  2X3X D;  3M0T A;  3I9Q A;  2LX7 A;  4J9I A;  2RNA A;  1X27 A;  2JMC A;  2HBW A;  1B3Q A;  1MV3 A;  2DM1 A;  1T0J A;  4RTV A;  1JQQ A;  1AWJ A;  2J06 A;  3EHQ A;  4F14 A;  1YCS B;  2ED0 A;  2L0A A;  4J9C A;  2CUB A;  2YT6 A;  3A98 A;  1AZG B;  1NEG A;  1GRI A;  2DE0 X;  3C0C A;  4OMN A;  1K0X A;  3TSZ A;  3EHR A;  3QWY A;  2DL3 A;  2CSI A;  2D8J A;  1CKB A;  1RLQ C;  4RTY A;  4AFS C;  4CC3 A;  2A37 A;  2P4R A;  2J6K A;  1I0C A;  1ZX6 A;  3FJ5 A;  5GJW B;  2EGE A;  5IXB A;  5I11 A;  1OPL A;  1B07 A;  2W10 A;  1NEB A;  2SEM A;  4JJB A;  1CSK A;  4OMM A;  2HEQ A;  2O88 A;  1N5Z A;  4AFQ C;  3NPF A;  2ROT A;  1GFD A;  2IIM A;  3ZL7 C;  1UJ0 A;  3NHN A;  2F2X A;  4RTU A;  3QWX X;  2BZX A;  1BB9 A;  1YP5 A;  1X6B A;  2RQV A;  2RPN A;  1X2Q A;  2LZ6 B;  2DF6 A;  1UEC A;  1WDX A;  1QWF A;  4R0K A;  3VRY A;  1OOT A;  3RBB B;  2MOX A;  4HVU A;  3VS2 A;  2E5K A;  2JS0 A;  4OMP A;  2AZS A;  1SHF A;  2M0Y A;  2J6O A;  2LJ1 A;  2LP5 A;  3VS0 A;  3VS5 A;  2J7I A;  2KRS A;  1WYX A;  2OI3 A;  2YDL A;  1AWW A;  4AG1 C;  4GLM A;  2RMO A;  1GCQ A;  2FPE A;  3GBQ A;  1I1J A;  2EVR A;  2FRW A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  3FIF A;  1KC8 C;  4TVR A;  4C92 D;  1K1Z A;  5GAM d;  4HCK A;  3OMC A;  1OZ3 A;  2KRM A;  4UC4 A;  1IHW A;  1TH7 A;  4LD9 K;  1N9S A;  4M7D B;  4C5G A;  1HJD A;  1X43 A;  3MEV A;  3MJX A;  4RMO A;  4HXJ A;  2FPD A;  4M75 A;  3JCM V;  1IRX A;  1TUD A;  3G4S A;  1QCF A;  3LH0 A;  4RCC A;  1Q82 C;  3L2Q A;  3G7Z A;  4M78 E;  1VQK Q;  1N9R A;  1U3O A;  1UGV A;  5GAN 6;  3CCM T;  2LJ0 A;  4JZ3 A;  4J9H A;  2ATC B;  3CCR Q;  2YHT A;  3V7R A;  4BDZ A;  4JRQ A;  4C92 A;  2RJD A;  1YIT Q;  3LH5 A;  2MWO A;  4MZT A;  3AT1 B;  1WHG A;  1D1B A;  3H8Z A;  4M7A B;  1V76 A;  3WVD B;  3S3M A;  3JCM h;  2V1R A;  3JCM g;  1UGR B;  2KRN A;  2HQE A;  5GAM e;  5GAO l;  3JCM X;  4XTX A;  3CC4 A;  3QJ6 A;  2KYM A;  3JCM f;  2AIR B;  3MP6 A;  3GOX A;  2LT1 A;  2EWN A;  1WX6 A;  3S3N A;  2CH4 W;  1R0B G;  1RAI B;  1GCP A;  4O6J A;  3GNG A;  3ULR B;  1LPL A;  4OF1 A;  2M51 A;  3CC4 Q;  2EQI A;  4J5Y A;  1ABQ A;  3VYG A;  2DJQ A;  2KT1 A;  2NYS A;  2QQA A;  4IUT A;  4JLG A;  3URG A;  2CYZ B;  4M77 C;  4WCI A;  4PJM A;  1Y0M A;  2DL5 A;  4PJO D;  1ZQ1 A;  2IVW A;  5CAI A;  3JCM b;  4IUV A;  3H41 A;  2BZY A;  3JAM E;  2LNH B;  2RK2 A;  4FYY B;  4BB7 A;  1VQ4 T;  2AHJ B;  1W2B P;  4M7D G;  2HKQ B;  3OBW A;  1PD1 A;  2CS7 A;  1BBZ A;  5M9O A;  3S3O A;  3E9G A;  4JRK A;  2LNV A;  5GMK e;  4R56 A;  1U06 A;  2DEU A;  2PUO B;  3U23 A;  2D8H A;  2FG0 A;  2B86 A;  3AHU A;  2K7A A;  1RAE B;  3H6Z A;  2ZZD A;  3CXC S;  4A4E A;  1JJ2 A;  4LN2 A;  1FYN A;  2EQM A;  4JDS A;  1VQL T;  1ZUY A;  4E2F B;  3RMQ A;  2OTL A;  2KSS A;  2EGA A;  1WFW A;  1OX9 A;  2XG8 D;  1NG2 A;  1YHQ Q;  1U1T A;  4A63 B;  2VGN A;  2OX7 A;  3CCE A;  5J39 A;  3ER0 A;  1QLY A;  1HD3 A;  1AVZ C;  1C1A A;  1W70 A;  4OP0 A;  4KGZ B;  4JJN K;  3NTH A;  4ZNX A;  1JRI A;  2XMF A;  4PL6 A;  1YHQ A;  2O9S A;  4OML A;  2KT8 A;  2OJ2 A;  4DA4 A;  2YUO A;  2QEX Q;  1VQP A;  2D6F A;  3M0U A;  1YWO A;  2VC8 A;  3MKD A;  2FYK A;  2QAS A;  1V29 B;  3I5R A;  4IUP A;  2JJ9 A;  3CC7 A;  4PFP A;  1VQ8 Q;  3GNF B;  4ZN1 A;  1VQ8 T;  3TRE A;  2L3P A;  3O5Z A;  4CC2 A;  2EJ9 A;  5FU6 C;  2JNG A;  4OGE A;  3J7A F;  3IQL A;  4M7A D;  3OYF A;  1QW1 A;  4M77 F;  2E6Z A;  5IN1 A;  2KMT A;  2YSQ A;  1RUW A;  2FL7 A;  5HKC A;  1UG1 A;  5EC7 A;  5ECA A;  1MUZ A;  5L23 A;  1NPP A;  4ATO A;  2RO0 A;  4JJC A;  4RTZ A;  2Z0W A;  4BAC A;  4C5H A;  4OB1 B;  2RM4 A;  1FMW A;  3VKI A;  3EFS A;  2LQ8 A;  4FM4 B;  2HBP A;  4M75 D;  1RI0 A;  1LJO A;  4F7U E;  1N8R U;  2DO3 A;  2F5T X;  1IXD A;  2DRM A;  2JW4 A;  1PM3 A;  4ZTJ A;  2L3S A;  2DYB A;  2GQI A;  2WSF E;  2A0F B;  2MCN A;  3SDZ A;  1Q81 C;  2RJE A;  3HPW A;  4JZ4 A;  2DZ9 A;  1Y71 A;  3JB9 H;  3V8L A;  1WPY A;  4KT0 E;  3JB9 F;  4QW2 A;  4DBF A;  2HQH A;  2DYI A;  2EPD A;  1X01 A;  2DVE A;  4C0F A;  2GGR A;  3LGF A;  3A5Z B;  2HSP A;  2O9V A;  1YBY A;  4X34 A;  2BE7 D;  1YJ9 A;  2HSE B;  3GIB A;  1DJ7 B;  3PE0 A;  3L1A A;  2CZ6 B;  3CCL A;  1JB0 E;  2M1H A;  1U5S A;  2KQW A;  2RK1 A;  4LXC A;  2YUQ A;  4Z8A A;  1BU1 A;  3NFC A;  4DBQ A;  2E3I A;  1TS9 A;  1R0C B;  1YIJ A;  2DBM A;  3EGU A;  4F16 A;  2LTO A;  1X2K A;  4E7L A;  2RHX A;  4AMC A;  3V8J A;  3QYG B;  4PJO A;  3RIR A;  5IHK A;  2JTM A;  1G3Y A;  1RAD B;  3A1P A;  3M9Q A;  3M56 A;  2OTL Q;  1HK9 A;  3TCJ A;  3VV0 A;  5GAN 7;  2O01 E;  3BFM A;  3MP8 A;  3QZ5 B;  2DXT A;  1QQJ A;  2CP5 A;  2LX7 A;  4J9I A;  1D3B B;  2RNA A;  3CCJ A;  5FRO A;  1X27 A;  3EGD A;  5GMK j;  5KYY A;  1O9S A;  3P8H A;  4RTV A;  4KH0 B;  3L2V A;  2MK5 A;  5GAM h;  3EHQ A;  3GLX A;  4QVC A;  1YCS B;  2L0A A;  5GAO q;  3A98 A;  4LDX A;  1N8R R;  3C0C A;  2WSE E;  4E7Z A;  4IUU A;  1K0X A;  3TSZ A;  1K9M U;  3RR6 A;  4C0D C;  4DQ2 A;  2DET A;  2EYQ A;  3LWI A;  2J6K A;  2JVV A;  2X4W A;  4PNO A;  5GJW B;  5I11 A;  2X51 A;  3JCM J;  4JJB A;  2CKK A;  3Q1J A;  2NLU A;  4DBR A;  1ZSZ C;  2ROT A;  1GFD A;  4B6M A;  1BCM A;  1M2V A;  3VU3 C;  3ZL7 C;  1UJ0 A;  3NHN A;  4VUB A;  5LJ3 h;  1MHN A;  4B9W A;  2BZX A;  1BB9 A;  3EG9 B;  1X6B A;  2RQV A;  1X2Q A;  2LZ6 B;  1KG1 A;  3OW2 S;  1W2B A;  5CQX A;  3E2U A;  4LDU A;  4M7A E;  2E5K A;  4OMP A;  1WHM A;  1SHF A;  4KGX B;  2XU8 A;  3ME9 A;  2J6O A;  3VYH B;  1XTD A;  5CKD A;  1WYX A;  5CKF A;  1Q86 C;  1RAF B;  4NS5 A;  2RMO A;  1GCQ A;  2E12 A;  2LVM A;  2QQR A;  3VS6 A;  2K5L A;  4FYX B;  4DEY A;  2RQU A;  4RG8 A;  1VQ9 A;  4F7U G;  1E6H A;  2ECZ A;  1BYM A;  2V8J A;  2RQT A;  2KXD A;  1NBE B;  2D9T A;  4XTZ A;  5GAN 2;  1WXB A;  2FRY A;  4FW1 A;  2DTO A;  3M5A A;  4Z89 A;  2F69 A;  3EFO B;  1VQ4 A;  2DTH A;  1ZUK A;  2CZ7 B;  1KQS S;  2K3B A;  1W1F A;  2GCX A;  4J6W A;  3SFM A;  3EG3 A;  3REB B;  3CCL Q;  3HRS A;  3CCU A;  3PMT A;  2VKN A;  3S6W A;  2LC4 A;  3F70 A;  3FRN A;  5IHN A;  2KYB A;  2M9U A;  2BKD N;  1K73 C;  1RAB B;  2L8D A;  1BKB A;  2KE9 A;  3QDF A;  1VQL A;  1NJI R;  1TXQ A;  2ESW A;  1D0X A;  2QG9 B;  3BW1 A;  3E9F A;  4HVV A;  5LJ3 j;  2VVK A;  1KQS P;  3OYY A;  1BI3 A;  2GBQ A;  4C8Q C;  4MDX A;  3JB9 I;  1Y96 A;  1TOV A;  1KD1 R;  3OSV A;  3LLR A;  1SF9 A;  3RKX A;  3THK A;  4D8K A;  1JBM A;  1ZUU A;  1VQ5 Q;  1M1G A;  2COW A;  2MYS A;  1KC8 R;  1AWX A;  1VQ5 T;  3M59 A;  2ZPH B;  1YJN A;  3CCM A;  3OY9 A;  2YLC A;  1QVG P;  2D0Q B;  2E6N A;  2HQX A;  1QKX A;  1D09 B;  1Q82 R;  2JN0 A;  4M7D E;  4KH1 B;  3CCE T;  2YRD A;  4PJO C;  4PJO G;  3M58 A;  2OTJ Q;  3V7S A;  2LJ3 A;  2CT3 A;  1K73 R;  1VQP Q;  4JJD A;  1MMG A;  2E3H A;  2DER A;  5KYW A;  1IHV A;  3EG1 A;  1U8R A;  2DD4 A;  1RAA B;  2MAM A;  3RMS A;  2X4X A;  2CGH A;  4L5G A;  4EPC A;  2DJZ A;  2DMO A;  5GMK m;  2DL4 A;  2RI3 A;  2KRO A;  3OYM A;  4C0D B;  2HZY A;  1UGQ B;  4M78 B;  1QP3 A;  2CP7 A;  2GF7 A;  4J7F A;  2KY9 A;  4F17 A;  4C92 E;  1UTI A;  2GTJ A;  1KQ2 A;  9ATC B;  2DKG A;  3VRZ A;  3RES A;  3N5B B;  5CKE A;  3LYI A;  3WVE B;  1GBQ A;  3UA6 A;  4OB0 B;  1KQS A;  3CME A;  1NJI U;  2YRC A;  4L59 A;  4M7D C;  5GAN g;  3M0S A;  2C0I A;  1ZLM A;  1ZSG A;  1WQW A;  4HT9 A;  3I35 A;  2QQB A;  2PVG B;  4AG2 C;  1EIF A;  3HRU A;  4A53 A;  3CME Q;  3VS7 A;  3KXT A;  4E7H A;  3P8D A;  1AEY A;  2KR3 A;  1YNZ A;  3PIP A;  3O8V A;  1OX8 A;  2NUP B;  3CD6 A;  1NZ9 A;  3CCR T;  4C0Z A;  1VQM A;  3CC2 A;  1HXD A;  2PNI A;  1OUL A;  4IIM A;  1VQ6 A;  1HSQ A;  3OS5 A;  4OMQ A;  3TSW A;  1VYU A;  2P4T A;  3H0F A;  1OPK A;  3VS1 A;  2E1H A;  1ZSZ B;  2ZPI B;  2JZ2 A;  2AK5 A;  2XK0 A;  3QYH B;  4XTW A;  5D6X A;  4JPB W;  2JS2 A;  1P92 A;  2GNC A;  1RAG B;  1UGS B;  4EMK A;  1Y96 B;  1VQ7 A;  3GPL A;  3SEM A;  2YRV A;  3G71 Q;  3HP9 A;  2EKH A;  3G6E A;  2Y4Y A;  4QT7 A;  1LCK A;  2GTO A;  1S1N A;  1UGP B;  2DX1 A;  4XAX B;  1OYX A;  4IUQ A;  4MZM A;  4C92 C;  5LJ3 f;  2DIL A;  2MIO A;  3HL8 A;  1YWP A;  4RUG A;  1G8X A;  4XU2 A;  1Q86 U;  3ZBD A;  1K8A U;  1I5O B;  2V1Q A;  3OQ5 A;  2IPO B;  1BIA A;  4M77 D;  4N4G A;  2DEQ A;  3UAT A;  2FZC B;  4E7K A;  4HCC A;  3T9N A;  1K4U S;  5DY9 A;  2I2L A;  4J9F A;  3SWN A;  4PJJ A;  2BE9 B;  1A0N B;  4X1V A;  2JTE A;  4LDW A;  4E7J A;  5C0M A;  2CP3 A;  3C95 A;  2X9H A;  1K9A A;  2L89 A;  1QCO A;  2HKN A;  1WI7 A;  2DPP B;  1YJN T;  2BTT A;  4E47 A;  1ABO A;  2EYW A;  4C8Q A;  3OYH A;  1QWE A;  1VQK T;  4HCB A;  5FLX E;  3PT9 A;  2A08 A;  2KDS A;  3X24 B;  2CT4 A;  2K79 A;  4D8D A;  1NLO C;  4GBQ A;  5GAO m;  2EQK A;  4DEX A;  1X6G A;  3VS4 A;  4LNP A;  2LQK A;  1T0H A;  2VB6 A;  2QA4 Q;  3R6O A;  1G3S A;  3M55 A;  1KJW A;  4M7A A;  3A8G B;  5LJ3 g;  3FJP A;  3H0I A;  1KFZ A;  1WJR A;  1KC8 U;  4Y92 A;  2QEX T;  2FO0 A;  2YUP A;  3DLL A;  1W4S A;  4HVW A;  5A2Q E;  1UB4 A;  5IAY A;  2KXC A;  3C4S A;  2NUT B;  1PD0 A;  1QVF P;  2KGT A;  2FZG B;  1OU9 A;  1VQ6 Q;  2LMJ A;  2L3Q A;  2CP2 A;  2FHD A;  3OB9 A;  3UT1 A;  3EGX B;  2YUN A;  1WXT A;  3MEU A;  4IIO A;  1MGQ A;  4XTU A;  2XHC A;  2C0T A;  3CCR A;  3PVL A;  1BK2 A;  2VV5 A;  4PK4 A;  2DIG A;  2XID A;  4C0G A;  2ZPB B;  2DA9 A;  1UE9 A;  2ENM A;  2K6D A;  1VQM Q;  3CC2 Q;  3LW5 E;  2LCL A;  5HK0 A;  4M7D F;  4Z02 A;  3NGP A;  2X3X D;  3I9Q A;  4M75 E;  1HYO A;  4C8Q D;  2EKO A;  3OYL A;  1RAC B;  3HHT B;  1AWJ A;  4ELY C;  1KK7 A;  1ZHI A;  4ANJ A;  5FU6 B;  5CKB A;  3CPW A;  1M1K R;  1VQ7 T;  1ZBX A;  5GAO n;  4OMN A;  4J8O A;  4N0A A;  3CXC P;  3QWY A;  2DL3 A;  2CSI A;  3G6E T;  2XDP A;  3G6E Q;  3SWN B;  2VAS A;  2EGE A;  2W10 A;  3A8O B;  3I56 A;  3SD4 A;  4M77 B;  2GQV A;  4OMM A;  2MWP A;  4HA8 A;  1MMN A;  3NPF A;  4EMK C;  1Y07 A;  2R57 A;  5KYN A;  3TEE A;  4C8Q F;  5GAN j;  1ZA2 B;  4RTU A;  2DK3 A;  1N27 A;  1MND A;  1YP5 A;  2RPN A;  2DF6 A;  2CP0 A;  3QO3 A;  1QWF A;  3FC3 A;  1VOM A;  4GLK A;  1VQO Q;  2MOX A;  2A7Y A;  4WTO B;  2JS0 A;  1X75 C;  2AZS A;  4N4H A;  2CP6 A;  2LP5 A;  3QKJ A;  4PJO B;  4KGV B;  3BE3 A;  2RHU A;  3VS0 A;  3VS5 A;  3HFN A;  2JUF A;  4ZGJ B;  4XQ3 A;  2E70 A;  4QQ6 A;  4GLM A;  1OQK A;  2FRW A;  4OB2 B;  1WJS A;  1BIB A;  2QQ9 A;  1BI2 A;  2VXF A;  6AT1 B;  5LJ5 h;  2X4J A;  2X3W D;  3PFS A;  1AZE A;  1TWB A;  4KBM B;  3VS3 A;  4ZTF A;  5GAO p;  1GL5 A;  1PSE A;  3DB4 A;  1UEB A;  5LJ5 f;  1RAH B;  3CCS Q;  5AYF A;  1KHI A;  3UA7 A;  1OV3 A;  1VYT A;  2AZV A;  1VQK A;  1G3W A;  1PKT A;  3X25 B;  2O2O A;  1WJQ A;  4HCZ A;  3J81 E;  2KK4 A;  2NUT A;  1X69 A;  4Y28 E;  1GXI E;  2V8K A;  1I4K 1;  3GP8 A;  2CSQ A;  2JT4 A;  5FU7 B;  1VIE A;  2PVO B;  3DLM A;  4Z88 A;  4LUD A;  2QEX A;  4FCY A;  3QSU A;  5KYU A;  1YIT T;  1YI2 Q;  3G4S Q;  1M2V B;  1VQ9 T;  3DB3 A;  1B7T A;  3MEW A;  1I5L A;  1IZ6 A;  3OYD A;  3M0R A;  5GJV B;  4Q5W A;  2QA4 T;  3V7C A;  5FRM A;  1PSF A;  1M90 C;  2Y90 A;  1WZO A;  3RKY A;  4FIB A;  2DLP A;  1LVK A;  5GAO r;  1JU5 C;  3EG0 A;  2I0N A;  3MEA A;  3RUX A;  3BY7 A;  3JCM d;  3QII A;  1KSW A;  1B34 A;  2LCC A;  1WQ7 A;  5I21 A;  2DZC A;  2QGF B;  3CCV A;  2A36 A;  3M4Y A;  3G71 T;  3NMZ C;  3NTK A;  1ZA1 B;  2ZAE A;  3M57 A;  4XU0 A;  1VQ6 T;  4NOY A;  4M77 G;  2E41 A;  1CKA A;  1LNX A;  3OYE A;  1VIF A;  4O5V A;  4CI0 C;  1H3H A;  5GAN 3;  4FL6 A;  1VQN T;  3BDL A;  2JTF A;  2M0O A;  2A3L A;  1YJ9 Q;  4EIK A;  1PKS A;  3OW2 P;  1Q82 U;  2RHI A;  4J7I A;  2QTV A;  1GFC A;  1E6G A;  1M3B A;  1VQ4 Q;  1EFN A;  1UHC A;  4FT4 A;  4KUI A;  5LJ5 g;  3PIO A;  1G83 A;  1YN8 A;  1SRM A;  4BI4 A;  3ASK A;  3OS1 A;  3OYA A;  2O4X B;  3EFR A;  2YLB A;  3GF5 A;  2LCS A;  1M8V A;  3UWN A;  5GAN f;  1S72 T;  1VQO A;  2QDL A;  1YIJ Q;  2HL5 C;  1SPK A;  5CK9 A;  1M27 C;  3JB9 G;  1Y7X A;  3MET A;  1V1C A;  1WA7 A;  2L5Q A;  4RTT A;  1KD1 C;  1ARK A;  1Y57 A;  4OVA A;  1K0S A;  4JS4 A;  2ZPE B;  3JSC A;  4II1 A;  1UHF A;  1E7O A;  3OYG A;  2DBK A;  1T3S A;  3CCL T;  1JEG A;  2CZ1 B;  4ME7 A;  4NL2 A;  4A4K A;  5J26 A;  1NYF A;  2XKO C;  5LJ3 d;  3CCQ Q;  5I22 A;  5LJ3 e;  3TQ7 P;  3WXM B;  3TVT A;  4ESR A;  1RL2 A;  3OBY A;  1YHQ T;  2MMP A;  1QVG S;  2AT1 B;  3VUB A;  3L42 A;  3P8B B;  4M75 F;  1YCY A;  3EH1 A;  2C06 A;  3X20 B;  1PWT A;  1KQ1 A;  5LJ5 j;  5FW9 A;  4BY6 C;  2DVJ A;  1H8K A;  1SRL A;  4PJO F;  5CQY A;  1TUC A;  4EMK B;  3V8K A;  5A0D A;  3OYN A;  2K57 A;  4V2S A;  2OTJ A;  3EH2 A;  5GAN d;  2CRE A;  2J6F A;  1FX7 A;  2OAW A;  4A4G A;  1Q7Y U;  1EZZ B;  1SHG A;  4M78 D;  5D6Y A;  2X35 A;  5IT9 E;  2E4H A;  1PNJ A;  1QVF S;  1AD5 A;  3CCJ Q;  1UFF A;  2VXE A;  3CCJ T;  3M0P A;  2LRQ A;  3JB9 J;  1AOJ A;  4J9D A;  2DXU A;  4DBH A;  1R8O B;  2LX9 A;  2D1X A;  2EQU A;  2J05 A;  3CPF A;  1YI2 A;  1WNL A;  4KUD K;  3OYI A;  3D7S B;  3C12 A;  2PQW A;  1UDL A;  1K8A C;  2DXB A;  1PRM C;  5KCO A;  2HNI A;  1X6O A;  4PFO A;  2CUD A;  1J3T A;  2K5F A;  1JO8 A;  2KAF A;  4MML A;  1RLP C;  4XU3 A;  5CO7 A;  5HCK A;  5GMK l;  2FEI A;  1K73 U;  2ABL A;  2JMA A;  3MPU B;  4BE1 A;  2MI6 A;  2O31 A;  2NUP A;  1PCX A;  1VQ9 Q;  1NM7 A;  3CCV Q;  4PKC C;  2FPF A;  4J9E A;  2H3E B;  1TUG B;  1MMA A;  4BI3 A;  3LGL A;  1GCQ C;  2RI2 A;  4EMG A;  3DKM A;  3PGG A;  4BY6 B;  2YWW A;  2A28 A;  2R58 A;  2JM8 A;  4QQD A;  1WXU A;  2EQJ A;  4M7A G;  3H0H A;  1VQN A;  3M0Q A;  1AHJ B;  1BI1 A;  3PMI A;  1M3A A;  1VQO T;  7AT1 B;  3UPU A;  4MMK A;  1TG0 A;  2HMA A;  1PRL C;  1VQN Q;  2DIQ A;  5CKH A;  5FWC A;  2EIF A;  1M90 R;  3I56 T;  4PLL A;  4CC7 A;  2EW3 A;  4J6X A;  1S72 A;  3JCM Q;  2AKK A;  3E19 A;  4BE2 A;  4A4F A;  2ZGW A;  1UJY A;  2DL8 A;  2P0Q A;  3CCQ A;  5FRN A;  4A54 A;  4M7D A;  4BE0 A;  1SSH A;  4BDY A;  3JCM P;  1S72 Q;  4CRI A;  1XOV A;  2DAQ A;  5DM7 R;  2PU9 B;  1NYG A;  2FB7 A;  3M54 A;  3M0T A;  1VQ8 A;  4M78 G;  2JMC A;  2HBW A;  1B3Q A;  2L3R A;  2P0K A;  1PC0 A;  2J06 A;  3LX7 A;  1QVP A;  3CCS A;  4M7A F;  4M77 A;  2ED0 A;  2CUB A;  1AZG B;  1NPR A;  2QA4 A;  2EJG A;  2V26 A;  4OB3 B;  4OGC A;  3EHR A;  5KYX B;  1Q81 R;  2QTX A;  1U1S A;  1RLQ C;  4RTY A;  1VUB A;  2A37 A;  2P4R A;  3HRT A;  1I0C A;  1ZX6 A;  2KI7 A;  3FJ5 A;  5IXB A;  1N6A A;  1G3T A;  2VGM A;  4D6W A;  2QAZ A;  1NEB A;  1CSK A;  1M90 U;  2O88 A;  4MZP A;  1N5Z A;  5CIU A;  4AFQ C;  1M9S A;  3OYK A;  2E10 A;  2IIM A;  3CMA A;  1WHH A;  1YJW A;  3QWX X;  4F7U A;  1N8R C;  5CR2 A;  3VJP A;  4J6Y A;  1UEC A;  1WDX A;  3JB9 D;  2COZ A;  4Y91 A;  2P0P A;  4R0K A;  5GAN 5;  4R55 A;  5L8R E;  3JCM W;  1QVG A;  1OOT A;  4XTV A;  3RBB B;  4HVU A;  3VS2 A;  3FB9 A;  4FT2 A;  2M0Y A;  3KUF A;  4F04 B;  1YJ9 T;  4RG2 A;  3EGD B;  4IKF A;  1H64 1;  4M75 G;  1M2O A;  4FW2 A;  2J7I A;  2KRS A;  2GFA A;  5GMK h;  5AT1 B;  4AT1 B;  4NL3 A;  4QVD A;  5DLO A;  3L2W A;  3A8L B;  1I1J A;  4HT8 A;  2EVR A;  2LT4 A;  2XI9 A;  2RQW A;  2KVQ G;  4RCB A;  2E65 A;  5DLQ E;  2K2V A;  4HKE A;  4PJN A;  3CBO A;  4XTY A;  1YIJ T;  3OS2 A;  1M5Q 1;  3KFV A;  2VWF A;  4C5I A;  2EGC A;  2D0N A;  4J9G A;  1JXM A;  2QGG A;  1VQM T;  3CC2 T;  5LJ5 d;  2RHY A;  2E5Q A;  3QZ9 B;  3FLG A;  2QQS A;  3M4G A;  2F5K A;  2RQR A;  1VQL Q;  2K3X A;  4P5N A;  5CCA A;  1OEB A;  1TU0 B;  3H9N A;  3X28 B;  5IH2 A;  3JCM c;  1MV0 B;  4LDV A;  1Z9Q A;  1GBR A;  1AT1 B;  4KRT A;  2R5A A;  1SG5 A;  1B34 B;  3MO8 A;  2K5I A;  4BUG A;  2PZ1 A;  4FU6 A;  5IHI A;  1G5V A;  2ZCF B;  1FMV A;  5KE2 A;  3OMG A;  3MHX A;  4M78 F;  5A0L A;  4M7A C;  3CCU T;  2AKL A;  3I55 T;  5GAM j;  4KUL A;  2H8H A;  2PTK A;  4M78 A;  5D7U A;  1PG5 B;  3CQT A;  3L2Z A;  3CBM A;  1M4Z A;  4E6R A;  1VYV A;  2LQN A;  4J9B A;  5I2M A;  2WAC A;  3HSB A;  3G1J A;  4A4H A;  2VYT A;  2QYZ A;  4M4Z A;  1WHK A;  1FMK A;  4RTX A;  5FWB A;  2L2P A;  4FYW B;  3QHS A;  2QDY B;  2CZ0 B;  5FU7 C;  2VUB A;  2XD0 A;  2OTJ T;  1QCN A;  4FSX A;  8ATC B;  2O4X A;  1IB8 A;  3BDU A;  2R5M A;  3VUZ A;  3FDR A;  2KNB B;  4ZGD B;  3RNJ A;  1WHJ A;  2ROL A;  2EYY A;  4LDY A;  2M02 A;  3QBY A;  2BZ8 A;  4QVZ A;  3NTI A;  4EDU A;  4E7I A;  4LD6 A;  3QUI A;  1K8A R;  2F2W A;  4E7S A;  5J3B A;  4PFZ A;  2G6F X;  4QQG A;  4EMH A;  1QKW A;  1YJW Q;  3EG2 A;  1JXO A;  2ZPG B;  2RN8 A;  1BI0 A;  5C6S A;  1ZSZ A;  2RF0 A;  4ORZ A;  2XIC A;  2QI2 A;  1C6V X;  3MCA B;  5HY6 A;  4C92 G;  1IRE B;  1AWO A;  2QXF A;  3R6N A;  1I8F A;  3UDC A;  1RI9 A;  2DTI A;  5KYU B;  3HKS A;  1I07 A;  2CDT A;  1PHT A;  2BIV A;  3RER A;  3HTR A;  1OZ2 A;  1QP2 A;  2JM9 A;  3CME T;  3QG1 A;  1WLP B;  5GAN 4;  4OMO A;  3TU4 K;  3RDV A;  3JRZ A;  1EX4 A;  2HDA A;  3PNW C;  1D1C A;  3OA6 A;  2MF2 A;  1ZBJ A;  3ZEH A;  2K2M A;  4PJO E;  4PJL A;  1NJI C;  4DOW A;  5GAM f;  1OU8 A;  1Q7Y R;  1KIK A;  3UF4 A;  3ZFJ A;  4X9C A;  1QVF A;  1BCO A;  4WF2 A;  3EG9 A;  1WGS A;  2WSC E;  2QK0 A;  4QKU A;  3LWH A;  4N4I A;  2ED1 A;  4FSS A;  2W0Z A;  5GMK i;  4C8Q B;  1TTH B;  2IG0 A;  3CC4 T;  2DL7 A;  4M75 B;  1T3L A;  2DRK A;  4C8Q G;  2H3J A;  4LE9 A;  3JCM e;  1K9M C;  3M53 A;  5GAM g;  2K9G A;  3HFO A;  3QJY A;  4MDW A;  1G2B A;  1WIE A;  4XK8 E;  4ZGE B;  1SKU B;  4M7D D;  3OS0 A;  4N0A C;  3I56 Q;  4RKU E;  2RJF A;  3QPH A;  1VQ5 A;  1VA7 A;  2EYZ A;  3EFO A;  2PUK B;  1IGQ A;  1Q95 G;  3FEO A;  3E1S A;  2LDM A;  2XDD A;  2OTL T;  1O75 A;  2F1L A;  1D3B A;  2RD1 A;  5LL6 S;  3SB2 A;  2HCK A;  3CCS T;  4JLI A;  4LUE A;  3QDR B;  4F7U B;  2HD0 A;  2RJC A;  1NLP C;  4J83 A;  1IGU A;  3OW2 A;  4AFZ C;  4ZN3 A;  5IXF A;  3JV3 A;  2HL3 A;  5LJ5 e;  2KBT A;  4K11 A;  1M1K U;  1LOJ A;  2M16 A;  3OYC A;  2K4Y A;  4M75 C;  2FZK B;  1YFN A;  1YJN Q;  2X4Y A;  1Z9Z A;  3CCM Q;  4F7U F;  2SRC A;  2DFU A;  4M78 C;  1YI2 T;  3I5S A;  3G4S T;  3I55 Q;  1SEM A;  3J80 E;  4BI8 B;  2C0O A;  3QXE B;  5I2S A;  2EAY A;  2KEA A;  1IO6 A;  3RKW A;  2COY A;  1QMC A;  2RH2 A;  2EYX A;  1UUE A;  1M3C A;  2JXB A;  3CC7 Q;  1K76 A;  3INZ A;  2B8A A;  8AT1 B;  1M8M A;  3CC7 T;  4B9X A;  1W6X A;  1H92 A;  3CD6 T;  2FVU A;  1XJW B;  4AFU C;  2Y4X A;  3SHW A;  2RA2 A;  2MPX C;  3CD6 Q;  3CMA T;  3X26 B;  5HK3 A;  2DXC A;  2CH4 A;  3PVQ A;  2LQW A;  3CMA Q;  3PTA A;  4RTW A;  4BD3 A;  2E64 A;  2ZPF B;  2NWM A;  2GFU A;  4GY5 A;  1D1A A;  1KD1 U;  5CVI A;  3A8M B;  2G3R A;  3REA B;  2YXY A;  4C92 B;  1YJW T;  2P84 A;  4JUV A;  1FXX A;  1M30 A;  1KHC A;  5KE3 A;  2EJF A;  2F2V A;  2EBP A;  1I81 A;  2NUZ A;  2RB6 A;  3KBG A;  4PLI A;  4C5E A;  4CC4 B;  1YIT A;  3EAE A;  5GAN h;  2PVD B;  4C92 F;  5KYX A;  4YTL A;  4C8Q E;  3MP1 A;  2DNU A;  4L6V 5;  1C0M A;  1Q7Y C;  1F1B B;  5GAN 8;  1XQH A;  3CXC A;  1JJ2 S;  1MV3 A;  1OI1 A;  2DM1 A;  1ACM B;  1T0J A;  4JRI A;  1MMD A;  1JQQ A;  3CPW P;  1K9M R;  4OMF B;  2RHZ A;  4F14 A;  4J9C A;  2RI5 A;  2YT6 A;  5KYY B;  2V8I A;  1NEG A;  1GRI A;  2DE0 X;  3CCQ T;  3OYJ A;  1VQ7 Q;  3CCV T;  3CCU Q;  5D6W A;  2D8J A;  1CKB A;  3G71 A;  2OAU A;  3A8H B;  4AFS C;  4CC3 A;  1WHL A;  3OYB A;  2XDB A;  4DOV A;  4XU1 A;  2DD5 A;  1OPL A;  1B07 A;  1M1F A;  5KH6 A;  2SEM A;  1Q81 U;  2BUD A;  1W2B S;  2HEQ A;  1SSF A;  1TSF A;  4ELZ C;  3EGX A;  5KCH A;  2JOY A;  2EFI A;  3OSS C;  5A0G A;  4IUR A;  4FYV B;  4M77 E;  1FWZ A;  1M1K C;  3SWN C;  2F2X A;  3L2U A;  3CBP A;  3C94 A;  3I55 A;  3VRY A;  4X9D A;  1MNE A;  5KYW B;  3CCE Q;  4JRP A;  2LJ1 A;  2K3Y A;  3CPW S;  1NE8 A;  2OI3 A;  1D0Z A;  1XNI A;  1VQP T;  5EG2 A;  2YDL A;  1R77 A;  3L2R A;  3CEY A;  1AWW A;  4AG1 C;  1JJ2 P;  4JS5 A;  5GAN e;  1H3Z A;  2FPE A;  3GBQ A;  2HAX A;  1Q86 R; 
#chains in the Genus database with same CATH homology
 3VS6 A;  4DEY A;  2RQW A;  1K1Z A;  2RQU A;  1E6H A;  2ECZ A;  2X3W D;  1AZE A;  2RQT A;  4HCK A;  2KXD A;  3VS3 A;  2KRM A;  1GL5 A;  1WXB A;  2FRY A;  3KFV A;  2VWF A;  4Z89 A;  2EGC A;  2D0N A;  1HJD A;  4J9G A;  1JXM A;  1OV3 A;  1VYT A;  1X43 A;  2AZV A;  3UA7 A;  1ZUK A;  1PKT A;  2K3B A;  2O2O A;  1W1F A;  4HXJ A;  2RQR A;  2FPD A;  1TUD A;  1QCF A;  3EG3 A;  1OEB A;  1X69 A;  3REB B;  5IH2 A;  2CSQ A;  2JT4 A;  1MV0 B;  2VKN A;  1Z9Q A;  4Z88 A;  1U3O A;  4LUD A;  1UGV A;  5IHN A;  2KYB A;  1GBR A;  4KRT A;  2LJ0 A;  4JZ3 A;  4J9H A;  2KE9 A;  2PZ1 A;  3LH5 A;  5IHI A;  2ESW A;  4HVV A;  2VVK A;  2AKL A;  2GBQ A;  3M0R A;  5GJV B;  2H8H A;  2PTK A;  2V1R A;  2KRN A;  3CQT A;  2DLP A;  4E6R A;  3THK A;  2KYM A;  1VYV A;  2LQN A;  1JU5 C;  4J9B A;  3EG0 A;  2I0N A;  4D8K A;  1ZUU A;  1WX6 A;  2CH4 W;  1KSW A;  4M4Z A;  1AWX A;  1FMK A;  1GCP A;  4RTX A;  5FWB A;  2L2P A;  3ULR B;  2A36 A;  2M51 A;  2EQI A;  1ABQ A;  1QKX A;  2DJQ A;  2KT1 A;  3NMZ C;  4WCI A;  1CKA A;  2KNB B;  2LJ3 A;  1H3H A;  2CT3 A;  3RNJ A;  4JJD A;  2ROL A;  2EYY A;  3EG1 A;  1Y0M A;  2DL5 A;  2BZ8 A;  4EIK A;  1PKS A;  2DMO A;  2DL4 A;  1GFC A;  2KRO A;  1E6G A;  3H41 A;  2F2W A;  2BZY A;  1M3B A;  1EFN A;  2G6F X;  1UHC A;  2LNH B;  1QKW A;  3EG2 A;  1JXO A;  1G83 A;  2RN8 A;  4F17 A;  1YN8 A;  1SRM A;  1BBZ A;  1UTI A;  2GTJ A;  2LCS A;  3VRZ A;  1U06 A;  2QDL A;  2RF0 A;  1GBQ A;  3UA6 A;  4ORZ A;  3U23 A;  1SPK A;  2D8H A;  2FG0 A;  1M27 C;  2B86 A;  2K7A A;  3M0S A;  2C0I A;  1V1C A;  1ZLM A;  1WA7 A;  4RTT A;  1ARK A;  1Y57 A;  4LN2 A;  1K0S A;  1ZSG A;  1AWO A;  1FYN A;  3I35 A;  3R6N A;  1UHF A;  1E7O A;  1RI9 A;  2DBK A;  1T3S A;  4AG2 C;  1JEG A;  1ZUY A;  1I07 A;  2CDT A;  1PHT A;  3VS7 A;  2JM9 A;  1NYF A;  5I22 A;  1WLP B;  1AEY A;  4OMO A;  2KR3 A;  1YNZ A;  4ESR A;  3TVT A;  2EGA A;  2HDA A;  1WFW A;  1ZBJ A;  1NG2 A;  2K2M A;  4A63 B;  2PNI A;  4IIM A;  1KIK A;  1QLY A;  3UF4 A;  1HD3 A;  1HSQ A;  1AVZ C;  1PWT A;  1W70 A;  4OMQ A;  4ZNX A;  3TSW A;  1VYU A;  5FW9 A;  2DVJ A;  2XMF A;  1OPK A;  3H0F A;  3VS1 A;  1H8K A;  1SRL A;  2O9S A;  2ED1 A;  1TUC A;  4FSS A;  2W0Z A;  2AK5 A;  4OML A;  2KT8 A;  2OJ2 A;  2YUO A;  2CRE A;  2J6F A;  4JPB W;  2OAW A;  2JS2 A;  2DL7 A;  2GNC A;  3M0U A;  1T3L A;  1SHG A;  1YWO A;  2DRK A;  4LE9 A;  3SEM A;  3I5R A;  2K9G A;  1PNJ A;  2EKH A;  1G2B A;  1AD5 A;  1WIE A;  4QT7 A;  1LCK A;  1UFF A;  2GTO A;  1S1N A;  2DX1 A;  2L3P A;  2DIL A;  3O5Z A;  3M0P A;  4CC2 A;  1AOJ A;  2MIO A;  4J9D A;  3IQL A;  1YWP A;  4RUG A;  1VA7 A;  2EYZ A;  2D1X A;  2J05 A;  2V1Q A;  2YSQ A;  1RUW A;  1UG1 A;  3UAT A;  5EC7 A;  1UDL A;  5ECA A;  1MUZ A;  5L23 A;  1PRM C;  1K4U S;  4J9F A;  2CUD A;  2HCK A;  4JJC A;  4RTZ A;  4LUE A;  1A0N B;  1J3T A;  4X1V A;  1JO8 A;  1NLP C;  2JTE A;  1RLP C;  4AFZ C;  5IXF A;  3JV3 A;  2KBT A;  4K11 A;  1K9A A;  5HCK A;  2DRM A;  2FEI A;  2ABL A;  2JMA A;  2JW4 A;  1WI7 A;  2DYB A;  2L3S A;  2GQI A;  2BTT A;  2O31 A;  1ABO A;  2EYW A;  2MCN A;  1QWE A;  1NM7 A;  1Z9Z A;  2FPF A;  2A08 A;  4JZ4 A;  2SRC A;  4J9E A;  3I5S A;  2CT4 A;  1GCQ C;  2K79 A;  4D8D A;  1SEM A;  1NLO C;  2EPD A;  2C0O A;  4GBQ A;  4DEX A;  1X6G A;  2KEA A;  2GGR A;  1IO6 A;  3VS4 A;  4LNP A;  1T0H A;  2HSP A;  2A28 A;  2O9V A;  2JM8 A;  1KJW A;  3PE0 A;  2EYX A;  1WXU A;  1UUE A;  1U5S A;  1M3C A;  2JXB A;  3H0H A;  1K76 A;  3H0I A;  3M0Q A;  1KFZ A;  1M8M A;  1W6X A;  4Y92 A;  2YUQ A;  1H92 A;  4Z8A A;  1M3A A;  4AFU C;  2FO0 A;  3SHW A;  2YUP A;  1BU1 A;  1TG0 A;  4HVW A;  1PRL C;  2DBM A;  2CH4 A;  2KXC A;  3PVQ A;  2LQW A;  3EGU A;  5FWC A;  4F16 A;  2KGT A;  4RTW A;  2LMJ A;  2L3Q A;  1X2K A;  4CC7 A;  2NWM A;  2EW3 A;  5IHK A;  2AKK A;  2YUN A;  1WXT A;  3REA B;  4IIO A;  1UJY A;  2DL8 A;  1M30 A;  2C0T A;  3PVL A;  1BK2 A;  2F2V A;  2EBP A;  2NUZ A;  4CC4 B;  1SSH A;  2DA9 A;  1UE9 A;  2ENM A;  2K6D A;  1XOV A;  1NYG A;  2DNU A;  3NGP A;  2X3X D;  3M0T A;  3I9Q A;  2LX7 A;  4J9I A;  2RNA A;  1X27 A;  2JMC A;  2HBW A;  1B3Q A;  1MV3 A;  2DM1 A;  1T0J A;  4RTV A;  1JQQ A;  1AWJ A;  2J06 A;  3EHQ A;  4F14 A;  1YCS B;  2ED0 A;  2L0A A;  4J9C A;  2CUB A;  2YT6 A;  3A98 A;  1AZG B;  1NEG A;  1GRI A;  2DE0 X;  3C0C A;  4OMN A;  1K0X A;  3TSZ A;  3EHR A;  3QWY A;  2DL3 A;  2CSI A;  2D8J A;  1CKB A;  1RLQ C;  4RTY A;  4AFS C;  4CC3 A;  2A37 A;  2P4R A;  2J6K A;  1I0C A;  1ZX6 A;  3FJ5 A;  5GJW B;  2EGE A;  5IXB A;  5I11 A;  1OPL A;  1B07 A;  2W10 A;  1NEB A;  2SEM A;  4JJB A;  1CSK A;  4OMM A;  2HEQ A;  2O88 A;  1N5Z A;  4AFQ C;  3NPF A;  2ROT A;  1GFD A;  2IIM A;  3ZL7 C;  1UJ0 A;  3NHN A;  2F2X A;  4RTU A;  3QWX X;  2BZX A;  1BB9 A;  1YP5 A;  1X6B A;  2RQV A;  2RPN A;  1X2Q A;  2LZ6 B;  2DF6 A;  1UEC A;  1WDX A;  1QWF A;  4R0K A;  3VRY A;  1OOT A;  3RBB B;  2MOX A;  4HVU A;  3VS2 A;  2E5K A;  2JS0 A;  4OMP A;  2AZS A;  1SHF A;  2M0Y A;  2J6O A;  2LJ1 A;  2LP5 A;  3VS0 A;  3VS5 A;  2J7I A;  2KRS A;  1WYX A;  2OI3 A;  2YDL A;  1AWW A;  4AG1 C;  4GLM A;  2RMO A;  1GCQ A;  2FPE A;  3GBQ A;  1I1J A;  2EVR A;  2FRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...